3ZXFA

High resolution structure of human galectin-7
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
135
structure length
134
Chain Sequence
SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALECTIN-7
publication title Inhibition Mechanism of Human Galectin-7 by a Novel Galactose-Benzylphosphate Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 31
structure length 134
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zxfA00
2SLIA 2PHTA 1UAIA 1KJRA 2ZHKA 5HCBA 3N36A 1LU1A 4XJUA 5GZFA 4BLJA 4YZ5A 1S0FA 1GNHA 1WCSA 2A3XA 4YW3A 5CA6A 2R16A 3AP9A 2AR6A 2CWMA 2ZGKA 1Q8QA 2ZGSA 1DFQA 5CB7A 4FPJA 3M3CA 1BXHA 1LHOA 1MS9A 4FP3A 3RSJA 4KBBA 1N1YA 3ILNA 4LBOA 1BKZA 1AX2A 3N3HA 1LGNA 5JOXA 3ZXKA 4AWDA 4FVVA 1KQRA 4AVSA 4FPHA 4DRVA 5HCAA 4BMBA 2W39A 2ZGUA 1H30A 3O12A 5T55A 4WV8A 1SLBA 1AJOA 1LOCA 2AGSA 4PF5A 4XILA 3INAA 5HCFA 1ULDA 3OGGA 4Y1XA 4R9CA 1DIWA 4GWMA 4XXAA 1F9KA 1Q56A 4Y1YA 1IKQA 1WBLA 3AZXA 2TEPA 2D3SA 5DUWA 2VW2A 4GXLA 2YZ4A 5JOYA 1W6OB 4M3CB 3C2UA 5IK7A 1GSLA 3VKLA 1GZWA 1G7YA 1LGCA 2WT0A 1AXKA 4UW3A 1PZ7A 5GLUA 1APNA 3T1LA 5JOWA 4Q8LA 1RINA 2NYYA 3IM0A 1MR5A 2CY6A 3ZSKA 4I30A 3N35A 2WSUA 3U4XA 4NOTA 2GN7A 1DQ0A 3B69A 4ATEA 2B7YA 3ZXFA 4DFSA 4R9DA 3M1HA 5FREA 3B3QE 5DZEA 2UWCA 3AZWA 5EWSA 4HL0A 1DYKA 2D6MA 3NV1A 3TAYA 4AGRA 1N3OA 1O4YA 1XQNA 5DZGA 2ZHNA 1AVBA 2EALA 2EAKA 2ZABA 2ZGMA 1G8WA 2A6VA 4GA9A 1CVNA 1IS4A 1LESA 4YG3A 3UJQA 4FOQA 5H9RA 1V6OA 2ZMKA 1FNZA 3AP4A 2CL2A 5T52A 3AFKA 4XJZA 2AUYA 2WKKA 3IPVB 4XE9A 4Y20A 1D2SA 1W6QA 1Y7BA 5KXEA 1G9FA 2XG3A 3HMYA 5CAZA 1U0AA 2FHRA 4BLIA 2RHPA 2PHWA 1WW4A 4YGDA 1N3PA 1LOGA 3V0AA 1G86A 2R0FA 2C9AA 1W0OA 1MVEA 4XBLA 1SBEA 2YY1A 2ES3A 3BTAA 2D6OX 4LBJA 5CNAA 5EYYA 3WHUA 1DZQA 2GNMA 3SITA 4FPYA 1SLLA 2A5ZA 1VAMA 3FUOA 3V0BA 2DYCA 5E89A 3R4SA 2ZGPA 4XMIA 2YXSA 5IK4A 4XJ9A 2GNTA 1ONAA 3M3QA 2AREA 4K1ZA 5T5PA 3HR9A 2W68A 5F5QA 3RMYA 3UJOA 1GZWB 2A6YA 1MS5A 2ZHMA 2D6PA 1GKBA 1GICA 3T2TA 4DS0A 3MW4A 2VH9A 3PMEA 1W6PA 4ISQA 4LBQA 4M01A 3VUOA 4GKXA 4Y1VA 1QOTA 4RL7A 3Q9OA 2DUPA 1GV9A 1GLHA 1LOFA 1LULA 1AX1A 1Q8SA 4FPOB 4NO4A 2ENRA 1KRIA 3BODA 3PVOA 5T54A 4ITCA 3RMXA 2A7AA 3AZVA 2AH2A 5GLZA 1WD3A 1WW7A 4SLIA 4CRQA 1A78A 1DQ2A 1WW6A 3AYCA 1B09A 1SFYA 1DBNA 3KQRA 2H0BA 2P3KA 2E7QA 2NP0A 1BJQA 1A3KA 2CYFA 2WSVA 5JMCA 3ENRA 4R9AA 5DUUA 1UKGA 5E88A 3WLUA 3WNXA 4RA0A 4Y20B 4XJ8A 1W6QB 2A70A 3A0NA 2KM2A 3FLPA 3USUA 4BM8A 1S0DA 5DZFA 5T5JA 3AP5A 3V0AB 4XIKA 1S0JA 2ZZJA 1FYUA 2DVGA 2P2KA 4YZ4A 2GALA 2VUAA 1IS6A 1R1ZA 1JYIA 2OUHA 4UW4A 1CPMA 4P9YA 2P3JA 4M3CF 4XJWA 4XOGA 4YW1A 2W08A 2V5YA 3PVNA 4YW4A 1ENQA 4PQ9A 3AK0A 3AYEA 3W58A 1G9AA 3NV2A 3RQ0A 4R9BA 1LHUA 4XJAA 3ILFA 1MS3A 2UWBA 1JBCA 1YIFA 1WUVA 3H0OA 1I3HA 3O0VA 3UL2A 1PZ8A 5JOZA 3FUQA 4FQ4A 1W6PB 4LBQB 1W6NA 5GLTA 4YLZA 2GMPA 2E7TA 4Z8BA 1LOBA 1H9WA 1S0EA 2NMNA 1MACA 4FPCA 1HDKA 2JE9A 2PHFA 2ZGQA 3HN1A 3WDYA 5SV8A 2LALA 4LBQD 4OZXA 2GMEA 4FPGA 1S1AA 3VKOA 1A8DA 4XBQA 4XTMA 2DU0A 5IT6A 1N47A 2CTVA 2BQPA 3MW3A 1VALA 2D3PA 1JOJA 3WDXA 4XZPA 1S0GA 2DVAA 4BQ1A 1RIRA 2A6WA 3ZVXA 1H9PA 3RS6A 5H9SA 4MYEA 2R1BA 1IKPA 3TB0A 3N7KA 2DTWA 2ZGRA 1DQ1A 1SLCA 4DQAA 1W0PA 1FX5A 3IN9A 4YM0A 3ZPYA 1C1FA 2NM1A 3WG3A 1QOOA 1D0HA 1Q8PA 5LK5A 3OBRA 4DRRA 1UL9A 2DVFA 4XYXA 1UMZA 1UZYA 3D5OA 3VKNA 3AX4A 3WG1A 1LENA 2ZA9A 3AP7A 5T50A 2ERFA 3POYA 5DUXA 2YV8A 5GZEA 1JN2P 5KXBA 4YM3A 5GALA 4GALA 1LGBA 2GNBA 1LODA 1V6NA 1MVQA 3AJZA 4FPKA 4ATFA 1SACA 1GANA 2ZGLA 2VY0A 2WQZC 1FATA 3AZYA 3OJBA 1NLSA 3PJQA 1N3QA 4TYSA 4YM2A 1UPSA 1Q8OA 1Z0HA 2E53A 4FP2A 3WV6A 4ASMB 3CNAA 1W6NB 3AXEA 4FPFA 3MW2A 5GLWA 4JCKA 1MS0A 2EXIA 5H9PA 5T5LA 1JXNA 1ZA4A 1CN1A 5DXDA 5F9TA 1AX0A 1QNYA 2OUJA 3AXDA 3ZYPA 4AGGA 4K20A 1DYPA 2UU8A 2ZBJA 2DURA 3OYWA 2A75A 2DU1A 3B00A 2EXKA 3SLIA 2VW0A 4C1WA 2R49A 3I8TA 3WDWA 4AYUA 3PVEA 1S0BA 1SLTA 1YXWA 1G9CA 1KJLA 3KM5A 4W65A 5DG1A 1CESA 1GZCA 2D6NA 3SH4A 4UW6A 3QLQA 2AENA 3WG2A 1CR7A 2D3RA 5IK5A 3N7MA 5GLVA 1YI7A 5BYNA 3JU9A 1TEIA 4YG0A 3V65A 1X50A 2A3WA 4P14A 2G4IA 5EYXA 2ZGTA 5IK8A 1CJPA 1AF9A 1VIWB 1FAYA 1LOAA 2JKBA 1N1VA 4GKYA 4BMEA 2GDFA 1C4RA 5FRAA 1MS8A 1SLIA 1WD4A 3VV1A 1CQ9A 1YO8A 3ATGA 3A0KA 1DLLA 3ZSMA 4Y26A 1MS1A 1SBFA 1J1TA 2GN3A 2JD4A 4YW5A 3ZSLA 1JHNA 3ZXEA 3ZXLA 3FLTA 1LHNA 1AXZA 2DUOA 2AYHA 2WT2A 1UN1A 3L2YA 4Y24A 3DUIA 2I2SA 2WJSA 3B01A 3OY8A 2DWRA 4D69A 1HQWA 4XXPA 1Q8VA 2D6LX 1ZM1A 1HQLA 1V6MA 4C1XA 2PELA 1JW6A 2P37A 3ASIA 4DPNA 1LCLA 2UWAA 4PBOA 5DUVA 1SCSA 3M2MA 4XHBA 4XMAA 5JDBA 3LCPA 2HYKA 2NMOA 4P9XA 2OVUA 2JECA 3APBA 2Q5TA 2D7FA 2PHUA 2A71A 2EXJA 4Q1RA 3WDVA 3WZ1A 4TZDA 3RG0A 3V0BB 1QDCA 3DGTA 1V6LA 1QNWA 3OYWB 5L73A 3SH3A 4AVVA 4YGEA 1LOEA 1KITA 2YROA 4LBNA 4UW5A 1QU0A 1SLAA 2DVDA 3M3EA 2A6XA 4ZXKA 3WVJA 2VW1A 1WLWA 2D6KA 3SNMA 2PHXA 1C57A 4YW2A 2E6VA 3T1MA 3WUDA 1WLDA 1ENRA 3M3OA 3ZSJA 1WBFA 3O0XA 5GZCA 1LJ7A 2ZMNA 3WUCA 5GM0A 3FFZA 1DHKB 5IUQA 4GWNA 1Z78A 3BOPA 4FPEA 3UK9A 1DQ6A 2P3IA 4M00A 3GNEA 1LHWA 4P9WA 3WCSA 4XIOA 3FLRA 2W52A 3IPVA 1F5FA 1V6KA 4XDQA 4YFWA 4ZKTB 1YYNA 2YMZA 3WDUA 4WZFA 2C5DA 3I4IA 1KDKA 4L8QA 4BPZA 5H9QA 1ENSA 1WW5A 3OY8B 3D4KA 2SBAA 1IS3A 2ZAAA 3AP6A 3USUB 4Q27A 3JUUA 4LBLA 4BOWA 4JRAA 2ZHLA 5AVAA 2A6ZA 1PZ9A 1UZZA 1EPWA 3N7JA 1FV2A 1DGLA 2D44A 1C1LA 1AJKA 2VXRA 3FBYA 4JC1A 4XHXA 2EF6A 3A4UA 2DV9A 3ZYRA 1LECA 1NXD1 4Y22A 2ARBA 3R05A 2NN8A 3WCRA 1DQ5A 1MZ5A 4CTEA 1GYKA 1V6IA 3ILRA 1DQ4A 5T5OA 4K1YA 1LTEA 2JDZA 4YGCA 1KDMA 3WOGA 3R4UA 2PHRA 1G9BA 1YRZA 5CBLA 2JE7A 1OKQA 1ULGA 3GALA 1QOSA 3BIWE 5GZDA 1HKDA 1SCRA 2ARXA 2DUQA 4Q2FA 2ZGNA 1ULFA 1JYCA 4AGVA 4YM1A 3VKFC 1LOFC 3NV4A 4YZ2A 5DG2A 4FOVA 5GJ6A 2XB6C 3V64A 1FNYA 4CZSA 2ZKNA 4F83A 1W6MA 3OBTA 1G9DA 4H55A 3POWA 1AZDA 2FMDA 4AVTA 4Q8KA 1MS4A 2V73A 1RITA 3O5SA 5KXDA 2R0HA 1QKQA 2WLQA 4K21A 1IOAA 2Z42A 1QDOA 4YFZA 1S0IA 1SBDA 1WLCA 2CNAA 1OQ1A 4Q26A 3NWKA 2R1DA 3WG4A 2LTNA 3MEPA 1URXA 3AZZA 4WVWA 2A3YA 4Q1PA 2ZMLA 2DTYA 2GMMA 4YZ1A 1ULCA 4PBPA 1N1TA 1LU2A 2UURA 3QCWA 4YGBA 1V6JA 3VKMA 3D6EA 1GZ9A 2ZACA 3RRDA 1UX6A 3AYAA 3IMNA 3LSDA 1IS5A 4U36A 3W59A 3B9CA 1BQPA 5JLVA 1QGLA 1ULEA 2GNDA 1BYHA 4XTPA 4Y1UA 4XBNA 2E51A 2P34A 1O4ZA 2ZGOA 2D43A 5GZGA 4WVVA 3LSEA 3MPPG 5JVVA 4PCRA 4FQZA 2NZ9A 1JUIA 4YG6A 3POSA 4Y22B 2WNEA 1QMJA 3SH5A 3WHTA 1S0CA 4Y1ZA 3SISA 4U2AA 1CONA 1LEMA 4HANA 1FV3A 1LEDA 5EXOA 2EIGA 4M3CE 3N7LA 4FOWA 3NV3A 3AYDA 1N1SA 2DVBA 1I1EA 1LHVA 1F31A 4FPLA 1V00A 1CPNA 1QF3A 5E8AA 2VU9A 4LBMA 1W6OA 4FOYA 4YZ3A 1AXYA 1VAVA 1OFSA 1W6MB 2OW4A 2WT1A 3OPZA 4M3CA 3WDTA 3O0WA 4IQPA 3ZXJA 2JJ6A 2EXHA 4ISRA 1HLCA 1VLNA 4LBKA 1BZWA 1MZ6A 3AJYA 1CIWA 5KXCA 1GBGA 1GNZA 3IKWA 2CWSA
chains in the Genus database with same CATH superfamily
5FQ0B 2PHTA 5HCBA 2W95A 2VL4A 3N36A 4D7TA 1H8TB 3BCWA 4BLJA 4YARA 1C8M1 3IBMA 3POBA 5CA6A 3AP9A 2QQKA 2AR6A 3LPFA 1S2KA 2VCAA 4LPLA 1DFQA 2IXLA 2EVXA 4URTA 1QWRA 4L2NA 5C8CA 1F35A 3RZJA 1LHOA 1Y9GA 3GGLA 3ZOIA 3PU8A 3UETA 2B9VA 2P4EA 4LBOA 1PK6A 1HB4A 1LGNA 4AWDA 4BQ5A 1ZREA 4A6OA 4H14A 4AVSA 4L97A 5FR3A 1JS9A 2R071 3VD7A 1FPN2 4RN5A 1DDLA 4XFBA 4L11A 4LKEA 4NHXA 2OZ6A 1BBT1 1JH5A 1SLBA 5FYMA 4AI0A 4PF5A 2BWAA 1PX4A 4PT6A 4QQPA 4PHZA 1OD3A 1YFWA 4Y1XA 4R9CA 1LR5A 1DIWA 1UZWA 2Z69A 1GFF2 4GWIA 1IKQA 2I07B 1JZ4A 2JDPA 1IG0A 3AZXA 3SCGA 5DUWA 2A73B 2VW2A 4GB31 4J1WA 5JOYA 1K12A 1NT0A 2OT7A 4LLOA 3KT1A 1A6CA 4DNYA 2WT0A 5JOWA 4UW3A 1YQ2A 1WCKA 1JI6A 4W6YA 3IM0A 1VBE2 5C4WB 2VMGA 1UCXA 5C3OA 2WINB 4I30A 5JSOA 4B8EA 1H8TC 4MHUA 1BVVA 2Z5WA 2ZXQA 1JHJA 3U4XA 1W8FA 4AVCA 2P3YA 4ATEA 1VB2A 3OG2A 2B7YA 4DFSA 1VBD3 5BPXA 2GC0A 3B3QE 1JZ8A 1DYOA 5SV5A 5LZ6A 5LK7B 1TZOA 4L92A 3SEEA 1VMHA 4RQPA 1N3OA 1AR81 3K4DA 1UNBA 1QXRA 4AQ6A 2ZABA 3VGIA 2ZZQA 5F1RA 1G8WA 1TME2 1NZCA 4XETA 3O1SA 4G9SB 4LE4A 2FDGA 4FFFA 5H9RA 1FNZA 5I0SA 3AFKA 1QQP1 2VAUA 2WKKA 1YWKA 3IPVB 1YIPA 4Y20A 2YPDA 4LR4A 5IWFA 3HEIA 1RUG1 3HMYA 5CAZA 4UAPA 4BLIA 2FHRA 1WMDA 2RHPA 3DPRB 1HXS1 3K3NA 2R0FA 4A42A 4RD7A 2C9AA 2KD7A 4ZY9A 2VTXJ 4YWAA 4RR3A 2YY1A 5CNAA 5EYYA 4IGPA 4LBJA 3UGHA 3ZIWA 4V1PA 1NLRA 1DZQA 3W21A 2VM9A 2CAVA 1YLLA 3GM8A 2QQVA 4ZXEA 2GNTA 4LITA 1ONAA 4MADA 2BOJA 2AREA 1ZRRA 4K1ZA 4N53A 1OC1A 2W68A 5IW0A 3KQ4B 3AKQA 3NJXA 4CUBA 1EP0A 5C4WC 5C9AB 3ZYFA 2D6PA 1GKBA 1ZVFA 5ABJA 3T2TA 2VQAA 4DS0A 2XLGA 1IPSA 2XJSA 4C91A 4LBQA 4ISQA 5IJRA 3O1TA 4OCTA 2B39A 3Q9OA 2DUPA 1LULA 1Q8SA 1UZVA 4MGIE 4Q0VA 4UBHA 5IHRA 3SMHA 3RMXA 2ARAA 3AZVA 1NG0A 1O91A 2VULA 1NXMA 1J58A 2ORXA 3K48A 2PLV2 1B09A 1SFYA 1DBNA 3PURA 4DXZA 5J37A 4OUMA 1BJQA 1RMU3 4HN1A 5FO9B 2YFUA 3QACA 4BE3A 4CDWA 2WFF1 5DUUA 3LZZA 2XBO2 1ACCA 4BZ4A 2W2IA 2VNGA 3WNXA 3CEWA 2VR4A 3FLPA 1TMF2 2KM2A 2W46A 3USUA 2IZWA 4KWKA 2C9KA 2OPWA 2ZX4A 1W06A 1BMV1 5A3WA 3H3LA 5FYCA 2ZEWA 2QQWA 5BUVA 1VJ2A 2ZZJA 3GHNA 1GMMA 2DVGA 5FMCA 4EWEA 4S2DA 5D2AA 1Z7S2 2FBEA 4H3WA 3RWKX 1VBA1 4A7KA 1SHWB 2W5FA 2GALA 3TN91 4P02B 4XAAA 1R1ZA 3H8OA 4TWTA 1H4GA 1W05A 4UFIA 5FFOC 1CPMA 1AL23 4XJWA 4HVQA 2V5YA 2HJIA 3PIGA 4NE9A 4PQ9A 4XFAA 3AYEA 3CZJA 3I2KA 2RJLA 5IVYA 5F32A 4XJAA 1GOGA 1MS3A 2YBSA 5F5CA 1NAEA 2GP5A 1WUVA 1EAH2 3VBUA 3VBRB 2BERA 4W6WA 4FQ4A 1ZX5A 1UYZA 4DO0A 2E7TA 1S0EA 2NMNA 3R0RA 1HDKA 5HPOA 3WDYA 3HQUA 3ZXAC 2AEYA 4OZXA 2Y26A 3KCXA 4FPGA 4AXOA 3QH7A 1S1AA 4QU1A 4ONUA 4XBQA 3VKOA 3NNGA 2C4XA 1LNSA 4I3GA 2WS92 4CEWA 4CXYA 5KC5A 1XNTA 1N47A 2RDRA 2Y0IA 1V9U3 1UOJA 1VALA 2D3PA 3B02A 3KV5A 3BUCA 2MPFA 2VOXA 4BQ1A 5A7NA 3KB5A 2A6WA 3RWNA 3Q8AA 3O14A 2VBBA 5H9SA 1RVF2 4QB1A 1QJU3 2VZOA 2WWSA 3J7HA 4DQAA 3H1MA 4UFKA 4PIYA 4A2UA 3ON7A 5C3QA 4P5YA 3JB8A 4YM0A 5FUNA 3ZPYA 3OEBA 4WM7A 1QY4A 4WVMB 2CGOA 3LPGA 2ZKLA 2RDQA 2FDFA 2J1EA 1D0HA 1FMD1 1Q8PA 1UL9A 2XWJB 4XYXA 3VKNA 1UZYA 2E31A 4C0HA 1IQAA 2BGPA 3IDBB 4OZOA 5DUXA 3ZXDA 2GP3A 1EYBA 4F7ZA 5IVBA 5CG9A 5FYZA 3UV9A 1DG6A 5JSPA 1UY3A 3UKTA 2RR11 4LUKA 3S7IA 1LB2A 4P9GA 1MVQA 3AJZA 3AMPA 4QHZA 2V4VA 3DEMA 4UFMA 3VBRC 2WQZC 3MLJA 2JIGA 3UNPA 2YBPA 1R092 3ZN5A 1N3QA 2ZS6B 5F3IA 1UPSA 4KWUA 5FP8A 1O5UA 3CJIA 2CGNA 3I3EA 3CNAA 4K8RB 5FZOA 4FPFA 1AYM1 2Y6HA 3OSDA 4JCKA 1DF0A 1X36A 1RHI1 5B4XA 5T5LA 3WQ7A 1ZA4A 1JYVA 1BEV2 4RFT0 3T0DA 2HWF3 4W4ZA 4LK7A 3TWIA 3WINE 4BCUA 1DYPA 4A45A 2UU8A 3C7GA 3GXUA 1IZ3A 4OUSA 1OUSA 2DU1A 4E2GA 2RJ2A 2J1AA 1OSGA 4C1WA 3T4VA 3I8TA 5CKMA 1CAWA 1D0GA 4XUOA 2O8OA 4AYUA 1OH3A 1KJLA 4W65A 1XBFA 2D6NA 1G6NA 2AENA 2AZ5A 1CR7A 2BJSA 2HKXA 3N7MA 2XKOA 3U37A 1YI7A 3MZHA 2V5DA 5BYNA 1TEIA 1EPZA 1CAXB 1X50A 5EYXA 3OPTA 4GULA 5L9RA 2BPA2 1OLRA 1RUH3 5JZGC 1O3TA 2JKBA 1N1VA 5IVEA 4Y5SA 4QX1A 4O65A 5HV4A 4RSUA 2GDFA 4R8HA 4LA3A 1MS8A 1SLIA 4PF1A 2XJVA 4P9IA 1CQ9A 5J96B 4ZHNA 3F95A 1J1TA 2JD4A 3POFA 1VMFA 3RI9A 1YJKA 5ACA1 1LHNA 4BQ4A 2E63A 2ZJCA 5E6HA 2AYHA 1R1A3 2QNKA 1UN1A 1O4TA 1QJY3 2WA3A 1QIQA 3P3PA 4IV1B 5EFUA 4HK8A 4Q4W3 4AQTA 2WJSA 2GH2A 5T3NA 2HWB1 1TG7A 1UYYA 5FK7A 5JMOA 1YC61 1M06G 3ASIA 4DPNA 3GBGA 1H1MA 4IE6A 4PBOA 5DUVA 1SCSA 1W04A 2RMU3 3M2MA 4AFDA 1W2OA 4DB5A 2OVUA 2J1VA 2BEOA 2RS33 2D7FA 4H7LA 5E1RA 3WDVA 3H9AA 2QVSB 4NN0A 5EV7A 4OMCA 2RS52 2WFPA 1QNWA 1O8PA 2VCBA 5K7PA 2FQPA 3N9NA 5CISA 3EXUA 4UW5A 5FWJA 1QU0A 3ZDSA 1UY4A 1SQ4A 2DVDA 4LKDA 2A6XA 4Q4Y3 2VMIA 4EN6B 5K0UB 1WLWA 4MO3M 1REEA 3Q8EA 1OQDA 4PLOA 2EIEA 5FZIA 3SNMA 4OMDA 4K40A 3CO2A 4BXFA 4YW2A 3B7MA 3I2FA 3T0BA 4QX7A 1PO13 5GZCA 4JDOA 1ZBE3 3WF0A 2ZMNA 1J3QA 1YQCA 1LKNA 1ULOA 4GWNA 1WMXA 2B5HA 5FAXA 4NIDA 4Q0QA 1CGPA 1JZ7A 3UK9A 5FYVA 1DQ6A 4M00A 3OGJA 3TNQA 1LHWA 4QHOA 4MGZE 4ZU4A 4BQWA 4XIOA 3FLRA 1F5FA 4YFWA 4IV1C 4XPVA 2IVJA 4WZFA 3P1IA 3MPBA 3WQ0A 2JG9B 3TNPB 3UYJA 3CJXA 3OY8B 5DDJ3 5FZAA 3MFCA 5A3MA 3BYWA 2X8KA 3PLQA 2Q30A 4KWLA 2VUCA 2DCJA 1L3JA 1XB9A 3CIHA 4DIQA 4M4PA 1PGSA 1PZ9A 1UZZA 3K2OA 2VXRA 1U5XA 1MQTB 1PO22 4MOAA 4HONA 3AL5A 3KV4A 1LECA 3IT8A 5A7QA 3HT2A 5HV0A 5JAXA 3RJRA 1UYPA 2UYBA 2ARBA 3JB4C 4CDXB 1NCRB 5A32B 5F2SA 1UW8A 1JZ6A 1S55A 1VP6A 3U4SA 3HOBA 2VOKA 3ILRA 3ZYGA 2XXZA 1EV12 1LTEA 1UPIA 3POJA 1C8M3 3GJBA 5K4LA 1SPPA 5I0TA 1YRZA 2LW8A 3DV8A 5FXZA 1J83A 3ACHA 3OCPA 4JZRA 4LHSA 4AR2A 3G7DA 4KBZA 4UF0B 4MVTA 5GZDA 2G9FA 5C5UA 1SCRA 4FAGA 2MHFA 4YPJA 3AMQA 3ZPOA 4XF0A 4LT5A 4AGVA 3H1WA 2VOVA 4YM1A 1LOFC 2VVEA 5GJ6A 4TN7A 4DXRA 4CZSA 2ZKNA 4IGOA 4LHNA 3SEPA 1G9DA 2RDSA 4H55A 3POWA 2FMDA 4AK3A 3VBHA 1MS4A 2V73A 1SMVA 2R073 2OKXA 4QT6A 1ZNPA 2R0HA 3W20A 1IOAA 1CAVA 1BBT3 4WM8B 1S0IA 2CNAA 2RV9A 4AL9A 3NWKA 2X5IA 1ND3B 4JGYB 3MEPA 1URXA 4XW3A 1POV1 1OURA 1VR3A 2W1QA 1H2MA 4Q1PA 5J1XA 2ZMLA 2BZDA 5ISLA 1N1TA 4NPRA 3NNJA 1WLTA 4JKKA 1C5IA 3M8LA 1K45A 5D8AA 2Y8KA 1PHMA 3UGGA 1UX6A 3IMNA 1ASJ1 1WWYA 3KV9A 3W59A 2L9LA 4Q0PA 5JLVA 1E5RA 5FYBA 5G05L 1MQTC 2ORZA 3RYKA 2JKXA 1COV2 4XBNA 1AR72 3LSEA 3MPPG 4MZUA 5CFDA 1NCRC 3I59A 3LA7A 5TSWA 3FZ3A 3ZMOA 4GMP1 2YYOA 5FYIA 3WQ1A 3JZVA 2WNEA 1QMJA 2FDHA 4Q4V2 1OOPA 3ZMNA 5JXHA 3H8RA 1X7NA 3N9QA 1OT5A 4Y1ZA 4U2AA 2HEVF 1RUE1 3T08A 4OHYA 1Y9QA 4M3CE 3N7LA 4MHRA 1UD1A 3BPSA 3RFRA 2ZEYA 4XAEA 4NIHA 4INDA 1AR83 3TEZA 1LAJA 2I74A 2R062 5DAWA 4OHZA 4QGNA 5BNNB 5BY5A 2YC0A 5E8AA 1W6OA 1AXYA 4M3CA 3WDTA 2WT1A 1QQP3 3U78A 3MUY1 3I97A 4OFGA 4GQ7A 4YVSB 1SDWA 2JJ6A 2UY8A 4ISRA 2PLV1 3VBFC 2NQYA 2P1BA 2P6CA 4R4XA 4WM8C 1O5LA 1RUG3 2D40A 3K77A 4X8NA 2BDRA 1BZWA 2ZTNA 3NSTA 1ND3C 4GH4A 2XGXA 3E5QA 1CIWA 1XNDA 2BGOA 1XC6A 4JGYC 1HXS3 2WUHA 4Y3OA 2Q0AA 3IKWA 2CWSA 2XBO1 2SLIA 3J8F2 1UAIA 2F4LA 1W8TA 2WN2A 4DXTA 1LU1A 1AR92 4AF9A 3NJZA 1ZZ9A 1GNHA 1F4HA 4CDUB 5FZMA 4OHXA 3DL3A 1QJX2 3LEMA 4CEYA 5CB7A 5B2GB 4YVWA 1Z7S1 2XOMA 4N7IA 2JG8C 4Q29A 4D7YA 1MS9A 5FZCA 4BQ3A 4KBBA 5L7OB 1VAKA 1US2A 4CCNA 1H0BA 3PJYA 2QUOA 1BKZA 4UFHA 5JOXA 1W8UA 4XF1A 3ZXKA 4FVVA 4IEYA 4NR1A 1UU5A 3VDDA 1UOGA 1HJFA 2BW8A 5ANQA 4F8AA 4OQ8A 5FDBA 2RE9A 5A3OA 2E7AA 3KSCA 3WF3A 5T55A 2OX0A 1EAH1 3LF7A 2AGSA 3C3VA 3INAA 5BNOB 2O14A 4FO9A 1O6UA 2RM22 3ZFFA 4EZ4A 1GWKA 1Q56A 5LATA 3TRSB 3VBOB 5BNNC 1WBLA 2GU9A 4OYUA 4QKNA 2IXHA 4NHYA 1K5MA 2WFF3 2VD7A 3MV11 1CWPA 3SXWA 1UZ0A 1A8MA 4HPKA 3NKTA 3DECA 5F3CA 4LORA 1AXKA 5GLUA 1PZ7A 3T1LA 1D4M1 4MXWB 1AYN2 1W2AX 1YQ8A 2NYYA 4Q8LA 4ARXA 1KFUL 2IC1A 4EE2A 1ZRDA 2MNGA 2WWJA 2LM3A 2X29A 3N9MA 3ZSKA 2KXLA 1RVF1 1WA6X 1W8OA 2JD9A 3AVRA 1DQ0A 4FTSA 1VPHA 4JV4A 4CDUC 2E33A 1RUJ2 2DFBA 3TN93 5A3LA 4R9DA 3M1HA 5A7OA 3NNLA 1K3IA 5L9VA 1V70A 5DZEA 2UWCA 3ZKYA 4HL0A 3I3MA 2BNMA 2WNUA 2B42B 2IXJA 5HCHA 2Y6LA 4GWJA 2ZHNA 1Y43B 4ZU5A 5EP9A 2A6VA 1IS4A 2WO2A 2H6CA 5CIRA 2ZMKA 3AP4A 2R041 1PK6B 1OKOA 2VVFA 1UIKA 4YW7A 2AUYA 4E4HA 4XE9A 3OGVA 4MSVA 5FY0A 1W6QA 4FCAA 2XL7A 1G9FA 2XG3A 1HRV2 4YYOA 1IPJA 3ZR5A 5BNOC 5LA9A 1Y4WA 1R091 1S4CA 3LOBA 4DZGA 4MGSA 1DZTA 5FZKA 3VZJA 5LA0A 3VBOC 3BTAA 3KGZA 2ES3A 1NCQA 1W2TA 4XUPA 1OI6A 5F3GA 5F3EA 4NIAA 3WHUA 4BDVB 3DF0A 4CCMA 2GNMA 2XUEA 1S2BA 2A5ZA 3FC0A 5CG8A 3R4SA 3T2QA 4E4SA 5FWEA 3VBSA 2YC2A 4AEKA 2YXSA 4XZUG 3M3QA 1W99A 5F5QA 2Q4SA 4A6SA 4CU7A 1WA4A 3ZYBA 1VBC1 2R32A 5DMYA 1GICA 3MW4A 5FOJB 3PMEA 4CUCA 2KR2A 1W6PA 3BVCA 5FPLA 4GKXA 4Y1VA 1FMD3 1QOTA 1XE0A 4B1LA 4X6QB 1KRIA 1AX1A 1UOFA 4NO4A 4MGYE 4NWVA 4E9KA 2XHNA 1OA3A 4B29A 2AH2A 4CCLA 1ZZCA 1US3A 2IVIB 3C7FA 2J7MA 4X8PA 2FDIA 4RQPB 2RR13 4CRQA 4NPMA 5F5IA 1DQ2A 3VDCA 4CCCA 4DEVA 4GAZA 2BTVC 3KQRA 1RYYA 3I3QA 4JGZC 3I54A 4CCEA 5FXVA 4AI1A 3BTXA 1UU4A 3OPWA 4NUBA 5AVPA 4RHV2 4BQ2A 2WYFA 1AYM3 1Q43A 3J7LA 5E88A 1RHI3 4Y20B 4JKMA 1DU3D 1ND2B 3A0NA 3LB9A 5CFCC 4AQSA 4B4QA 2FD8A 5DZFA 3T09A 2VZVA 4QXCA 3VHRA 5JUVA 4XIKA 2BBAA 1FYUA 2W9XA 4FXGB 1VBD2 2W92A 4MX3A 4QGMA 4QX3A 5FXWA 3RZMA 5FLJA 2OA2A 5J7MA 2XLAA 1UXXX 1FXZA 2Y6KA 1IG3A 5EQUA 5FUIA 4UW4A 4TLFA 4C0BA 4M3CF 3HJRA 3QH6A 4N53B 3AK0A 1MZFA 4EWDA 2VECA 1X33A 1CZSA 4GD4A 3PUHA 4W50A 3O0VA 3UL2A 1NE4A 2B9UA 3O7OA 2XJPA 4LE3A 4PDWA 5CKQA 3LAGA 4FTEA 4LBQB 2VZPA 3ECQA 4Z8BA 1H8VA 1H9WA 4JQRA 3HIFA 4XABA 3ZFGA 4FPCA 2ZGQA 5KHHA 5SV8A 2LALA 3PU3A 4FI9A 4LBQD 2GMEA 5ACA3 4EWAA 5FV3A 1FOD1 1A8DA 5FY4A 1JYTA 4HKWA 4I0AA 3O1RA 5FZ0A 2CTVA 1OMIA 2BQPA 2D5FA 3A23A 4XZPA 1PVC2 4I01A 2DVAA 2FDJA 2HWB3 5DABA 1B35A 1O3SA 1KEXA 3IDCB 3ZVXA 3C8XA 2YB7A 1H9PA 5EPAA 3RS6A 1ND2C 1IKPA 4L0PA 3FJSA 2QZ2A 1PNFA 1RXGA 1RTVA 2OPKA 1KD7A 3I2HA 3IN9A 2K0GA 3PTRB 3VL9A 3WG3A 4BYYA 4IUGA 3OBRA 4DRRA 3RZHA 3ME2A 2YGLA 5AC92 4EROA 4K7JA 5FJKA 1UMZA 1ZRFA 5FY9A 4QPWA 1PO21 2YHJA 1W9TA 3G6JB 1XJAA 1JMUB 4ZS3A 2ERFA 3CZUA 4N53C 4ZZ8A 2QKDA 4MG2A 2VBDA 1LGBA 3ES4A 4A7YA 4EJRA 2DCZA 1LODA 1V6NA 2GNBA 3I7DA 1EV11 4FPKA 4QPGA 4IETA 1GANA 5FZ3A 4ATFA 1JYXA 3JXSA 3OJBA 3VBUB 1NLSA 1TNFA 5A1FA 4TYSA 4RFRB 2E53A 4JAAA 2W47A 2ETEA 4QX8A 3GCWA 5FMOS 2J1UA 3MW2A 1MS0A 4IV3A 2RVAA 2W87A 4QKBA 3HBZA 1JXNA 2BU9A 1BCXA 3X29B 2H0VA 1F15A 3ZYPA 3MGUA 3K4ZA 4OHVA 2CSGA 1RJ8A 2RJKA 1E57A 4B7EA 3I2GA 2FZ1A 2Y34A 3QD6A 5I8TA 3OYWA 2A75A 5CZKA 4S2GA 4LIUA 2MEV1 5BNPA 2VW0A 3M7AA 1AL22 3LDRA 4C90A 1S0BA 1YFYA 4I02A 3P5BA 1G9CA 1XOYA 1H8TA 1VRBA 4MH0E 1CESA 3RZZA 5JXIA 3EJKA 5FP9A 5D21A 1C3HA 4Z82A 5BNQA 4Q4X2 3RGBA 1RUI1 2A3WA 3HVDA 2GC1A 1WMEA 2ZGTA 1Y3TA 4XCAA 3ZDVA 1VIWB 1FAYA 1LOAA 3MIEA 4GKYA 5D1IA 5A3TA 4AHXA 1C4RA 2QBXA 2VUDA 2PAEA 1COV1 3VV1A 5I0DA 2R6QA 3A0KA 1XYPA 2V09A 1AR71 4QQ2A 1PGL2 5IVFA 1MS1A 3MDPA 5I8SA 1J84A 4LKFA 1JHNA 1UY1A 3LD8A 3I3DA 1GWMA 2DUOA 4Q4V1 3OF1A 5J09A 2VZTA 3B01A 3VBUC 1JYWA 4D69A 3RZKA 1GQPA 1Q8VA 3DPRC 1V6MA 3VDAA 5FZ4A 2E32A 4IXLA 3RYRA 5FZOB 2BWCA 2R061 3OUIA 2F4PA 3WNPA 2WWUA 4S2FA 4P9XA 4LHKA 2JECA 2Q5TA 5FPVA 3WW3A 5DAQA 2EXJA 5FP7A 3WZ1A 2BVBA 3E6CC 2VGDA 4E4ZA 5FJHA 3V0BB 1POV3 4AI9A 1V6LA 1CZVA 5C3PA 4LIVA 4X6RB 3HNMA 4BXSV 1ALYA 5C9AC 3KHCA 2CGPA 1SLAA 1U5ZA 1X8EA 1CAWB 4ZXKA 5FZ8A 3WVJA 1M4WA 1ASJ3 2HBUA 3J8F1 4XFHA 3LIHA 3DCQA 2D5HA 2D6KA 4O9EA 4AHZA 3CBNA 1UMHA 5FZ9A 5KR7A 1JZ3A 1AR91 4L9BA 4AQ2A 3E6DA 1R082 4LO8A 5IAVA 4QXBA 1HIXA 1SDDB 3KF5A 1WLDA 4AEDA 2NPIA 1TVGA 2QTWB 1L7RA 1W90A 3J26N 3M3OA 3ZSJA 4D0QA 1LJ7A 1QJX1 4GMP3 5GM0A 1J1LA 1NYWA 3E1F1 5IFPA 5M0TA 2VZ3A 3ROUA 2HWF2 3IAPA 3OD0A 4FPEA 4GJYA 4ASKA 1T6GC 2DBNA 2FDKA 1RUE3 3WNOA 3URFA 3C7OA 4IE7A 4DEQA 3GNEA 4HOOA 1DGWA 5F37A 3JBG2 1P8JA 3AVSA 2JDYA 3FWEA 3IPVA 4KQ7A 2QQNA 4UFJA 2H6BA 5FLHA 3NRUA 2QQOA 3QOPA 1HN0A 2YMZA 4YNIA 3WDUA 4ZKTB 4D6QA 2C5DA 1DP0A 3I4IA 5FMOL 4BPZA 3MIGA 1RUF2 2EAAA 5H9QA 5KC6A 4WZCA 3POIA 1IS3A 2AC1A 2WZR1 4CPBA 5FMDA 5FYHA 1KFXL 3AP6A 4GIQA 3HN3A 1WCDJ 1YHFA 2RM21 3IIIA 4YSFA 2HLEA 4XF4A 2ZHLA 2PLV3 4XQDA 2PXJA 2QQUA 4JC1A 5EHDA 2QQIA 1C1LA 2O8QA 3BI3A 1RUH2 4XVHA 3IMMA 4R4ZA 2DV9A 4FBFA 3H7YA 4LJHA 3HPNA 4HVRA 4I0WB 4Y22A 2XBO3 3R05A 1W9WA 1TE1B 1GP5A 1GOFA 3WCRA 4UYBA 2OQ6A 2C6SA 4CTEA 4XUNA 5FY5A 4D6SA 1AYN1 3LE0A 4JRLA 4K1YA 2JDZA 4YGCA 1KDMA 1RL3A 1XU1A 3RJ2X 1G9BA 1EUTA 1J3RA 4CP9A 1OKQA 2EIDA 1NZIA 5IVCA 2G1MA 1FT9A 1Z7S3 2DUQA 2ARXA 3OB8A 4XC9A 1UF2C 3HNYM 1RUJ1 3VKFC 1S2EA 3HQRA 3FBMA 3D0SA 1AZDA 3MIBA 3DN7A 3GCXA 5A7SA 4AVTA 3W5MA 3O5SA 3MF9A 4XEZA 1JTZX 5KXDA 1QKQA 1HB1A 2RS32 2WLQA 4HETA 1D7PM 2Z42A 1EAH3 1SBDA 2VOTA 3NMBA 1OQEA 4JDMA 1Q5OA 4Q26A 1W8ZA 3WX5A 4D8MA 3ETPA 3K51A 3OD4A 3E97A 3FFQA 2A3YA 1AHSA 4QX5A 3ZN6A 3N9OA 4YZ1A 4PBPA 1HRV1 4QDSA 4P9JA 1V6JA 2YC4A 4ASLA 2PQQA 4IE0A 4PIXA 4UT5A 3AYAA 3LSDA 4FSJA 1IS5A 1CAUB 4IEQA 1DCSA 1OVSA 1UU6A 2UYAA 4DINB 2WA4A 4ZZ5A 1D4M3 4NRQA 1QH7A 1PO12 2P34A 2ZGOA 3THTA 2VPVA 3T30A 4YG6A 1RVF3 2K2SA 4AVAA 4BK4A 2WBKA 3ITQA 5LY2A 5K8SA 1PMHX 2B46X 4W6XA 4K3UA 4QM8A 2Z79A 3KD4A 3TEYA 3S5QA 5F7UA 1O8SA 1LEDA 3DYMA 5L19A 3JQXA 1RUC2 1SPPB 2ZX1A 5FO7B 2XVLA 4EN8B 2Z4FA 4IEXA 3NV3A 4OI2A 4JKLA 2YDEA 3AYDA 1N1SA 1H1IA 1VE0A 4CCDA 1LHVA 3O1OA 1F31A 4FPLA 4TXWA 1QF3A 5J48A 5KHIA 5J3UA 1DLCA 4YZ3A 1VAVA 2R043 1OFSA 2OW4A 3ZIXA 5LEKA 3WF2A 4OI0A 2FZ2A 4V2VA 4IQPA 4XFFA 4LK6A 3B94A 1ZZ8A 4JHTA 2XJQA 1POQA 4AAXA 1XSRA 4XURA 1CAVB 4KU7A 4DUVA 1R093 3ZKUA 3B00A 1U5YA 1NA1A 2X5IB 3MLLA 4RHV1 3ZX7A 5HI0A 5FZ1A 3MO4A 1HRI2 4XJUA 1NLQA 5FBZA 1S0FA 4RGGA 1KS4A 2QQLA 1RUD2 1YNAA 3A7QA 2R16A 5JZGA 5D8AB 3ZFEB 2ZGSA 3E5XA 2B45X 1I5PA 4FPJA 3I3BA 1I5ZA 2IFRA 4IL7A 5IYYA 5LBBA 3ACGA 3WQBA 4HFSA 1VBC3 3VHOA 1U5IA 1WCQA 3LFMA 1F8VA 1AX2A 3VZKA 4KL1A 1PM4A 4FPHA 3KGLA 4BMBA 4FAHA 4Z1VA 2ZGUA 5CYYA 5JXGA 3O12A 1NQJA 2ZEXA 4WV8A 1FPN1 3H3UA 1C5HA 5DAXA 4LOTA 5HCFA 2XQRA 1ULDA 3N9LA 3OGGA 3WOGA 4GWMA 4LO5B 1F9KA 3MYXA 4LXLA 3LFIA 2TEPA 4Q0UA 3PNAA 3WXPA 1W6OB 4M3CB 3C2UA 1T6BX 5IK7A 1GSLA 1E5HA 3VD4A 4CXWA 1H6XA 3VKLA 1GZWA 1GOHA 3EYPA 5EJ1B 1APNA 4QXHA 1PVC1 4IE5A 2C0ZA 2GC2A 1DGRN 2X5IC 1H2LA 4GH4B 3ZYIB 2WZ8A 2CY6A 2IXKA 1VBE1 3S7EA 2WSUA 4AFBA 2KA3A 2CHHA 1JUHA 4KGQA 5K0UC 4Q0SA 4NOTA 1YEWA 3B69A 2FCTA 5JI7A 1YCIA 4WVZA 4XDPA 3H7JA 1STMA 5D8AC 5FREA 1CX1A 2HWD2 1DZRA 3ZFEC 1PGW2 3AZWA 5EWSA 1AR82 1DYKA 3NV1A 2HWE2 3IZOA 5HBAA 3AMMA 1XE8A 4YVWB 3U0ZA 5AC91 5DZGA 2BFUS 3AKPA 2EAKA 2ZGMA 3THPA 4H2AA 1JU4A 1QJZA 2UY9A 4LNVA 4FOQA 4YG3A 1TME1 1UO9A 3WNNA 2CL2A 3ACIA 3KS7A 3KF3A 4HZFA 4XJZA 4AEJA 3VDDB 3ZM8A 1NOVA 1RGSA 2HEWF 4MGKE 1OA2A 1SFNA 4K9SA 4DOUA 2QE3A 4ZONA 2JG9C 5FBJA 5A3UA 5I93A 1HXS2 2PHWA 3ZR6A 4CUGA 3UESA 4YGDA 1N3PA 4QPIB 3S30A 5C70A 2WLPA 1FOD3 1G86A 3V0AA 4CU8A 4GB33 2QQPA 5JR2A 1W3VA 1W0OA 1XXNA 3SH3A 4XBLA 3ZFFB 1RUOA 2JWPA 2D6OX 2WO7A 1X82A 4N43A 5FPXA 1SEFA 4JTNA 5A7WA 2OZJA 2PN5A 4FPYA 3GZAA 4MLOA 2DYCA 5E89A 3M70A 1ODMA 3JD72 1K5MB 2VO5A 4XJ9A 2VNRA 3LDKA 4AZZA 2DCKA 3RMYA 3BU7A 4CDXC 1ZBA2 3MFAA 1AR62 1PIV2 1MS5A 4GH4C 2ZHMA 2Y64A 4RS5B 4C8DA 5JIAA 4FTBA 1EUUA 1VBB2 2V72A 3FHAA 5LWBA 1ZYBA 2DCTA 3KT7A 4QB2A 3AMHA 2ID4A 4RL7A 2XPJA 3WP6A 5JWPA 2HBTA 1LOFA 1UYXA 3U10A 1YFXA 1KXGA 4Q4X1 2ENRA 1PO23 5T54A 1W8WA 4QXKA 2VZQA 3ACLA 1ODNA 1WW7A 4YVWC 2WNUB 4HSJA 4KG0A 4FFGA 4IEVA 4LO7A 3LKJA 3LQCA 3ZLIA 3T3YA 4FFIA 2JXAA 3ZSEA 1GZTA 3AYCA 2WZPP 3VDBA 3UKVA 4K6BA 2NP0A 3AKTA 5C6CA 3HWJA 3JQWA 3ENRA 4RGAA 1JOPA 3OOXA 1KGYA 3KCCA 2HEYF 3H50A 3NO8A 2F6BA 3WLUA 3S57A 3LEGA 2HWC2 1W6QB 2A70A 1MEC2 1VRH2 4QPIC 1X8MA 4CP1A 1TMF1 4CP0A 3KVBA 3D3AA 5FY7A 5A7PA 1S0JA 1XSQA 2ET7A 5FOBB 1MQTA 1NCQB 4HVOA 5DN2A 1QJEA 4BB3A 2MEV3 5LA1A 4YZ4A 1OF4A 4IEWA 2IXCA 3BB6A 1IS6A 2VTFA 1NCRA 4IEUA 3WR0A 2VQTA 2OUHA 1NKGA 2N7GA 2OS2A 1GP6A 3IB3A 4P9YA 3R4DB 4YW4A 2W08A 3PVNA 2WN3A 1ENQA 4NHKA 4RS5C 3W58A 1W8NA 3NV2A 3Q8FA 2G9GA 3K75B 4R9BA 3ILFA 1PNGA 3RQ0A 5F6LB 1YIFA 1RUI3 1PX3A 4G4FA 4AFAA 1PZ8A 3F2ZA 2J1TA 5JOZA 3ES1A 4IE4A 3WSOA 1UY0A 4Y4RA 1W6PB 1W6NA 3L2HA 4YLZA 1LOBA 1W2UA 3WEZA 2TBVA 3HN1A 1COV3 1R081 2PHFA 2WZEA 2ZEZA 1AR73 4NROA 2CU5A 5LBEA 2WNUC 1WCUA 3FMGA 4I09A 4XTMA 3RVHA 4CDQA 2DU0A 2VC9A 4H7MA 4CCOA 1A34A 4Q4V3 4YVSC 5GKAC 1UKRA 3VBFA 4JHZA 4WM8A 5IT6A 2GZWA 3MW3A 2WS91 1JOJA 5FZFA 1ND3A 1S0GA 3SHRA 5IFTA 5FZEA 2JIJA 2ATFA 3JBG1 1RIRA 2LRPA 3RI8A 3VZMA 2RS12 2W91A 1TQ5A 4OHWA 2R1BA 2R063 1PMJX 2DTWA 2ZGRA 1DQ1A 1RUF1 5FP3A 3BKZA 1F4AA 1VBA3 4E2QA 3WW4A 1FMD2 2NM1A 2C26A 1NCQC 2GAUA 3THDA 1BK1A 4AHWA 2JG8A 2Q1MA 2DVFA 1NE6A 2F17A 4HN0A 4AHYA 3AX4A 5L7OC 2ZA9A 3AP7A 5C8CB 5T50A 5I0RA 3H8XA 3POYA 3I2OA 1GP4A 1DGWX 2RR12 3J8F3 1JN2P 5GZEA 5KXBA 1REDA 4YM3A 2CDOA 1MPXA 4GALA 1AR93 3GJAA 1XRUA 1SACA 1XYOA 2WNOA 2ZGLA 1W9YA 2VY0A 3MLKA 4I3PA 1FATA 3AZYA 4SBVA 5BXXA 4CUAA 2WR9A 5J98B 2OIIA 5A33A 3KWVA 4PDWB 1QJX3 3WV6A 1RHI2 2XVKA 2ZAHA 2JB8A 4ASMB 1J59A 3AXEA 3ZXGA 5GLWA 2EXIA 5H9PA 1RXFA 3ZFGB 1CN1A 2WNVA 5DXDA 1AX0A 3W5NA 3MHZA 1BEV1 1UQXA 4K20A 2VOWA 3BIEA 2ZBJA 2DURA 3AFGA 5FMBA 4QX0A 1PMIA 1R64A 2BOIA 2EXKA 3SLIA 5LY1A 2R49A 2VUJA 2WZR3 3PVEA 1B35B 2Q8OA 2TUNA 3MV01 5DG1A 1GZCA 2RM23 4UW6A 3QLQA 2BNOA 2D3RA 4CDUA 5GLVA 4TTGA 4GJZA 2CAUA 3GBFA 3JU9A 2JENA 4P14A 2G4IA 3ACFA 3MICA 4NAOA 1CJPA 4QM9A 1OLME 3PHMA 3VLBB 3NAPA 2BUKA 2E26A 1FI2A 1E5IA 5FRAA 3SCFA 1K42A 5LBCA 5C8CC 1WD4A 1AYN3 1YO8A 2J1SA 4BU2A 2BP6A 1PO11 2GSYA 4XACA 4Y26A 3ABZA 1H6YA 3DKWA 3M4FA 4YW5A 3ZSLA 4NVPA 1PK6C 3FLTA 4BHPA 1QEXA 1WKYA 4IGQA 1OA4A 4O61A 4QAWA 3L2YA 4E8CA 3PUQA 1RUNA 1RUJ3 3O1UA 2FCUA 1QHDA 5BNOA 2DWRA 1HQWA 4QPGB 4XXPA 1RUC1 2D6LX 2VMEA 1HQLA 2ZOEB 4C1XA 2PELA 2WDBA 1JW6A 3ZFGC 3TEXA 4IV3B 4XHBA 4A44A 2R30A 4RR3B 2VQUA 2PHUA 3TEWA 2A71A 2JDMA 2VCMA 4Q1RA 4Z92B 4TZDA 1HN1A 2D97A 3CQOA 2DFCA 1QDCA 2Z2SB 4KI5M 5FZDA 3RG0A 4AE2A 5AFBA 4NHMA 5I8YA 3SCHA 2Y60A 1NQDA 3OYWB 1YFUA 2RS51 1I6XA 4YGEA 1HRV3 1LOEA 2QQJA 2YROA 4LBNA 4XDOA 3TYJA 3UT0A 1B35C 5BNPB 3CL1A 3CDZB 3M3EA 1XPWA 3FX3A 2VW1A 2Y6FA 5ABJB 3T2PA 4O7XA 1C57A 1HRI1 5A1AA 3DYPA 2OXBA 3OGSA 3J7MA 2CV6A 4XF9A 4NIGA 3LA3A 5F5AA 5KHKA 1RUD1 1VMJA 3J4UH 3T1MA 2W3JA 2YFZA 3KZ4C 4D6RA 2IXIA 3O1PA 3FFZA 4Z2WA 5C3RA 1DHKB 3WD5A 5FYUA 4CVUA 4RQPC 4WBBA 2OYZA 3R6SA 2P3IA 3OBAA 4JGZA 5FKBA 3S0MA 2GH8A 1JZ2A 1YYNA 1C28A 4CDWB 5CFCA 4QPGC 1ENSA 3CLPA 3VZLA 5JPMB 4LOSA 3D4KA 3FHIB 3LDBA 2NLRA 2ZAAA 1X9PA 1IPKA 1YQ5A 3USUB 1SFPA 2PHLA 3JUUA 4IV3C 4LBLA 2PQSA 4BOWA 4JRAA 4RR3C 2X10A 2A6ZA 3T0AA 1EPWA 1FV2A 3FBYA 3AB0A 1AJKA 2ADDA 2LS6A 2BYVE 2EF6A 3NVCA 3OUJA 4HSLA 2PYTA 3ZYRA 3PL0A 1O3QA 1NXD1 4META 4RHV3 1BK0A 3GYDA 2HYXA 2XH6A 3SC7X 2NN8A 2VVDA 5BNPC 5JPNB 1V6IA 2W1WA 1ENXA 1DQ4A 2ZPXA 4QWNA 1HW5A 3NJVA 2PHRA 5ABJC 1RMU2 4KU8A 2JE7A 1ULGA 3PUIA 4B3NA 2QZ3A 4A3ZA 5FCCA 3GALA 1QOSA 3ZYJB 4NPLA 1HKDA 4QB6A 4Q2FA 1U12A 4EYUA 1ULFA 2BNNA 1W03A 3VD3A 3MI8A 4FOVA 2HWD1 2XB6C 2DCYA 5ERLA 3FHQA 1PGW1 3C7HA 1W6MA 3OBTA 4PI2A 5HXVA 4AEDB 4N90A 5FPBA 4DMIA 2HWE1 2XDVA 4COWA 4PLMA 3IDEA 3SQOA 4BK5A 1XNAA 1RITA 1QJFA 1VB4A 5G04L 5DPNA 2WQ8A 3FN9A 1QDOA 2XJRA 2VMHA 4QDQA 4UXAA 1FPN3 2K9ZA 4CEWB 4YFZA 3Q8CA 2EIBA 5APAA 3O1MA 3D8CA 3EMRA 4BQYA 4CDWC 5FQ0A 5C7GA 1ND2A 3DYOA 1H1AA 4WVWA 3WT3A 2J22A 2DTYA 2GMMA 3LOIA 1ULCA 2IWGB 4PIZA 3QCWA 2UURA 1ZRCA 3VB9A 1H2NA 4YGBA 3VKMA 1ASJ2 3D6EA 3K3OA 1GZ9A 2JDUA 2ZACA 5FK8A 4OQ9A 1ZRIA 3HT1A 4U36A 5JXJA 3POEA 4PQQA 1BQPA 2JDKA 5FZLA 1QGLA 1JODA 1ZZ6A 4WM7B 1ULEA 2GNDA 4JX0A 5L9BA 1BYHA 4CPBD 5KHGA 4XTPA 1PVC3 3Q8BA 4Y1UA 3USSA 5L36A 3B9IA 1O4ZA 2D43A 4W8JA 5LRRA 4WVVA 5FYYA 5GZGA 3JD71 5CADA 4FQZA 3ALQA 1VBE3 4M0HA 4Y22B 4AFCA 5C3SA 2BBVA 1ZBA1 1RUE2 1AR61 1GQHA 3WHTA 2JDHA 1PIV1 2XVGA 1V9U2 3SISA 4CCJA 1Y9MA 5IATA 2CDPA 5EXOA 3U07A 3OTFA 2EIGA 1VBB1 4CP9B 4FOWA 3CMGA 1YQ6A 5AC93 1QJU2 2W1UA 3S6PA 1I1EA 4BH9A 3CJIB 1SZBA 3U1XA 2XWBB 4ORFA 5K9YA 1CPNA 4AEDC 4IEOA 2FMYA 2QFEA 1TME3 2VU9A 2Y6GA 4IDZA 5A6ZA 3OPZA 3ST7A 3BN6A 3TOJA 4EN9B 4LTAA 5DQ0A 2C1FA 2VZ1A 4YW6A 4CEWC 4QGLA 1VLNA 2JDAA 4JTOA 4LBKA 5C4WA 3AJYA 3DXUA 2GC3A 5FUPA 1GBGA 4YG0A 1GNZA 3LA2A 2ZHKA 1KJRA 4A4AA 3FL7A 4OLLA 1NY72 5GZFA 3ZN6B 2HWC1 5JI9A 3PMSA 1MEC1 4YZ5A 2P5BA 1VRH1 1WCSA 4I2OA 4HT1T 1HV0A 1AUYA 2A3XA 2YU1A 3KMHA 4OULA 4YW3A 3BTYA 2CWMA 2ZGKA 1Q8QA 3LWCA 1UIJA 4WM7C 3M3CA 4E27A 4EN0A 5FP4A 1BXHA 4E2SA 3NQHA 5LRSA 1O59A 4NJ4A 2HH9A 4FP3A 4Y33A 3RSJA 1N1YA 3EBRA 4COYA 3ILNA 5A3PA 1LRHA 3MIFA 2W0XA 4LHLA 3N3HA 4BWOA 4HKLA 2WAAA 4UOJA 4HG6B 3T4HB 1KQRA 5CEHA 2ARCA 4DRVA 2VZRA 3EB7A 3MIHA 2W39A 4MXVA 5HCAA 2JEMA 1H30A 5IVVA 4Q4X3 2ILMA 1D4VB 3I2JA 3LEIA 4LQRA 1AJOA 3DPRA 2P6HA 1LOCA 5F6KA 4XILA 4QDRA 5EIYB 3AMNA 4P08A 4Y5TA 2PHDA 4N8MA 5J36A 3CJIC 3BOWA 4XXAA 3IIAA 1F5JA 1BLZA 4Y1YA 3NL1A 2D3SA 3WNMA 4GXLA 1UWWA 1X9TA 2YZ4A 4XFGA 1QH6A 5FPUA 3PIJA 4LMFA 1D4M2 1PM7A 2YPJA 1AL0G 1G7YA 1LGCA 1L7QA 2VMCA 2XLFA 3ORJA 5FXXA 3K46A 5C9AA 4NIIA 1RINA 4FT8A 5B4NA 1TMF3 4KG8A 1MR5A 2O1QA 2RS11 4XFCA 5I0UA 1GNYA 2D93A 3N35A 1NA1B 2WO1A 3E6BA 1R1A2 2GN7A 1QJY2 2QDRA 4Q4W2 5DAVA 3ZXFA 2RG4A 3H3ZA 5JZGB 2D6MA 4KWJA 3TAYA 1GUIA 4Q5OA 1O4YA 1HB3A 1XQNA 3ELNA 4AGRA 3MF6A 1AVBA 2EALA 2VG9A 2RMU2 5LEJA 5FO8B 2R042 4GA9A 1CVNA 1LESA 2IUWA 3UJQA 3BU0A 1MZEA 1OLQA 1V6OA 2Q1FA 5T52A 2PA7A 4BIFA 2VE1A 1HX6A 4B7KA 2WABA 2DBIA 2PTMA 1D2SA 3LEKA 1R083 1Y7BA 5KXEA 3POGA 4XF3A 1ULPA 3C7EA 4RYDA 1RC6A 2Q8EA 5C71A 1U0AA 1WW4A 5FPZA 1ST8A 3PVBB 1LOGA 4Q4Y2 4BIOA 4NRPA 3VHNA 3B93A 3KHBA 2D98A 5FYSA 1MVEA 2J42A 1SBEA 2WL1A 2YUEA 3J9SA 4XFIA 4QKDA 2WS93 1XU2A 4ZU7A 3SITA 1SLLA 3V0BA 1T2XA 1VAMA 1XNCA 3A21A 3FUOA 3N9PA 1W2NA 3JBG3 4N9IA 3CF6E 2ZGPA 1C8NA 5JSRA 2I45A 2JICA 4XMIA 4JVAA 1HJGA 5IK4A 3KV6A 3OGRA 1ZBE2 1CIYA 5FZHA 2PMWB 5T5PA 4TLGA 3HR9A 1VBC2 1RUF3 1GZWB 2A6YA 2IFWA 3U11A 5FY8A 1QXPA 5FZ6A 3UJOA 3O1VA 4L99A 3VBRA 2WQ4A 2XUMA 2B4KA 1NA1C 2VH9A 4LLFA 3RYPA 4AI3A 1QXJA 4M01A 3VUOA 2V4AA 1XYNA 4P00B 4K8FA 3ETQA 2P17A 1GV9A 1GLHA 1UOBA 5A70A 4FPOB 4QPYA 3BODA 3PVOA 2QQMA 4UFLA 5FY1A 4ITCA 5DDJ2 3WP4A 4AOCA 5F8PA 2A7AA 5BV6A 5GLZA 4MGQA 1WD3A 4N9HA 1UXZA 2YG0A 4SLIA 2E9QA 4QD2A 4LUMA 4FXKB 4AG4A 4P9LA 1A78A 1WW6A 3BALA 3VBHB 5CKNA 4QQLA 2H0BA 1EY2A 2P3KA 2E7QA 5C8WA 2WSVA 1A3KA 2CYFA 3KT4A 4R52A 5JMCA 5LCWL 5DAPA 4EN7B 4R9AA 4ES8A 1UKGA 1JOBA 3KCYA 4LO6B 4A41A 1KS5A 4RA0A 3DXTA 4XJ8A 2XONA 4QQOA 4AI2A 2Q1ZB 4BM8A 4E8DA 2LROA 1S0DA 1BEV3 5HXMA 1C8M2 3NNMA 1YJLA 5T5JA 4WVMA 1OXCA 2TNFA 1J3PA 3AP5A 1K5JA 2Q8CA 3RDIA 2LUWA 3V0AB 1RB8G 1F2NA 4NWWA 2P2KA 1W3XA 3AM2A 4N43B 4A3XA 4B4RA 3DKQA 1VBD1 2VUAA 4G3YC 5A7WB 1W9SA 5CVRA 1JYIA 4Y4YA 2VMDA 1OFNA 2P3JA 4KGGA 2BV4A 4XOGA 1UMIA 2QCSB 2Y38A 4YW1A 3UKNA 3MIDA 5CFDB 3I59B 3VZNA 2R072 1G9AA 1W0NA 1LHUA 2DF7A 2UWBA 1JBCA 2JB4A 1OOPB 2WYSA 1BBT2 1I3HA 3E5UA 3H0OA 3ZN4A 5C5TA 4ARYA 3FUQA 2XKPA 2B8MA 5LB6A 5GLTA 3K4AA 2GMPA 4KNCA 5A6XA 1MACA 2JE9A 4F3JA 2YU2A 2XQXA 1FOD2 1GU3A 3HNBM 4GB32 4IEPA 3BTZA 5F2WA 3H8UA 5LA2A 4IERA 1DGRA 1OPMA 3VD9A 4PJYA 2A1XA 3CKHA 3VBHC 1OD5A 2QDNA 4NMIA 3WDXA 2J1RA 1RUC3 2EICA 3D0JA 3HBKA 1CZTA 3M3IA 4IEZA 4M4RA 4HLTA 4MYEA 4XQWA 4CCKA 4A7ZA 3TB0A 3N7KA 4UBGA 1OUXA 1SLCA 1W0PA 4IW3A 3VZOA 1CAXA 1OHFA 4CSWA 4DY5A 1CAUA 1FX5A 4CA9A 4M0NA 2JDNA 4TSVA 4CP2A 1W39A 5A1LA 1C1FA 2AACA 4AVVA 1QOOA 3GZEA 4I0BA 5LK5A 3V56A 4N43C 5KWRA 2WRAA 2RS53 5ANNA 2PAKA 1WGPA 3D5OA 4CEYB 3RZLA 4B1MA 3NJYA 3WG1A 1LENA 2VMFA 2FCVA 5EZWA 4E4DX 2XHKA 5AFEA 2YV8A 1IGOA 5CFDC 1QQP2 4CYDA 2QJVA 4IV1A 1HRI3 5GALA 1OOPC 2ZX0A 1RUG2 1RUD3 4QMAA 1IQDC 3IDAA 1RMU1 3JCIA 3ZYHA 3PJQA 4YM2A 1E5SA 4QX2A 1Q8OA 1Z0HA 4FP2A 1RJ7A 2YBKA 1W6NB 1CJDA 3GZTB 4ES9A 2G9ZA 5F9TA 5KBFA 1HB2A 1QNYA 2OUJA 3AXDA 4CU6A 2Q8DA 4AGGA 1GQGA 3WY6A 3VN4A 3TBDA 5FZ7A 4CDQB 4ZS2A 1PVXA 4YRDA 2MEV2 1HQNA 3THCA 3VBFB 3NKGA 3AL6A 3WP5A 4HPKB 3WDWA 1SLTA 1YXWA 2VQ0A 5K0UA 3KM5A 1AL21 1YUDA 4V2WA 3SH4A 4D3WA 3OUHA 3U75A 4OI4A 1POV0 3WG2A 2Y6JA 5IK5A 4LO4B 5EJ3A 1RUI2 2RDNA 3IWZA 3ZFEA 3V65A 4NAMA 1HV1A 1I9RA 1BHGA 3L9JT 4AVBA 5IK8A 3S5AA 1AF9A 4LA2A 4BMEA 3MBWA 4D94A 3OEAA 3VD5A 2VJXA 4CEYC 2JG8B 4BQXA 4EV0A 5A80A 4OUEA 1NX9A 2YGMA 3ATGA 2BRTA 3SKJE 4B4PA 1DLLA 2JX9A 3ZSMA 1SBFA 2VCCA 4MV2A 2GN3A 1EV13 5EJZB 3ZXEA 3ZXLA 2WFF2 3D82A 1XNBA 4HBNA 1PGL1 1AXZA 4QQHA 4GMP0 4XCBA 2WT2A 2XMLA 3VDDC 4BJ0A 5FIXA 2DDUA 2ZX3A 2JG9A 4PLNA 4Y24A 1W28A 1SG3A 1V9U1 3DUIA 2JE8A 2I2SA 3OY8A 4IESA 2PFWA 4LULA 2HWD3 4COUA 4COVA 2ET1A 2W1SA 1ZM1A 1BMV2 5A33B 2HWE3 4UI9L 2P37A 5C33A 1QJU1 1LCLA 2UWAA 3ZFFC 2X09A 4URAA 5JDBA 4XMAA 2BGCA 1VBA2 1YI9A 3LCPA 4OI1A 2HYKA 2NMOA 2WNVB 2WIIB 4UWDA 3APBA 3TN92 3VHPA 1V0AA 4CDQC 2XJUA 2ZCWA 1K5MC 4CDXA 2VNVA 3DGTA 3H1YA 4P5HA 5A32A 1ZZBA 3VBSB 4QKFA 4XQ4A 4D7SA 1KITA 3GBWA 3EQEA 5A6YA 3PTYA 3NNFA 3N4MA 1UY2A 1ZZ7A 1OH4A 4UF0A 5FTTC 3EO6A 4BA6A 2C24A 3P3NA 1O7FA 2PHXA 3PUAA 1NY71 3WW2A 3WNLA 4AAPA 4XUQA 4BISA 2E6VA 3WNKA 3I49A 3JD73 3WUDA 2BFUL 1ENRA 3HQXA 1WBFA 3O0XA 3WUCA 3CU7A 3NAPB 1ZBA3 5IUQA 5CU1A 4DUXA 1Z78A 1AR63 3BOPA 1PIV3 2XR4A 3I2DA 4EQVA 2HWF1 4P9WA 4MGTA 3W9AA 1VBB3 3WCSA 3ZO0B 2W52A 4JGYA 4AFMA 2R7EB 1V6KA 4XDQA 4EZHA 1KDKA 4L8QA 4COZA 2EA7A 2WZR2 4QPIA 1WW5A 5IAXA 1UX7A 1XNKA 2SBAA 3RPQA 5I91A 1Q3EA 4AI8A 3A22A 3WF4A 5A6QA 3FE5A 4O9GA 4Q27A 2AEZA 4Z07A 3LIGA 2WNVC 5AVAA 3VL8A 1IHMA 3N7JA 4QU2A 5FZBA 4CE8A 1DGLA 2D44A 1H2KA 1GWLA 1ZA7A 4GZ9A 2VXJA 4XHXA 5F39A 2XL9A 5JR7B 3MUZ1 4CXXA 3A4UA 2ADEA 1RUH1 2G19A 3VBSC 3QBQA 5IVJA 5LBFA 3AKRA 4DUWA 4RS5A 3U14A 1DQ5A 1MZ5A 4AEMA 2HWC3 1GYKA 1MEC3 1WZXA 1VRH3 4XUTA 5T5OA 4FFHA 4N7UA 3R4UA 3GF6A 3OBZA 5CBLA 4DXSA 1O3RA 4MUVA 4S2HA 3BIWE 1R1A1 1AYM2 1QJY1 2ZGNA 1JU3A 5L73A 1JYCA 4Q4W1 2K46A 4HKOA 4YZ2A 3NV4A 4LKSA 5BNNA 5DG2A 3V64A 3AKSA 4HXCA 1FNYA 4F83A 5KHJA 3NAPC 3P6BA 4YVSA 1CD3G 4Q8KA 1JYNA 3I2IA 1W8HA 4HK9A 2RMU1 4K21A 4JGZB 4OVEA 3EHKA 1TNRA 2RS31 1WLCA 2O0OA 4J1XA 1OQ1A 4QHBA 2VZUA 2R1DA 3HAGA 2LTNA 3KVAA 2Y0OA 3WG4A 3HD8B 5LASA 3WF1A 4JQTA 2ZX2A 3AZZA 3LGRA 4JDNA 4AW7A 5JCTA 3NW4A 5CFCB 2PAMA 1LU2A 2VZSA 1JZ5A 4DY3A 3CHXA 1H4HA 3H42B 4Q4Y1 3RRDA 3B9CA 5FPAA 1NUKA 5FLIA 1XE7A 2BVVA 3BPZA 5L7OA 2VTXA 5A3NA 2E51A 2WC2A 4ZPIA 4NRMA 5JVVA 2RS13 4PCRA 2OQ7A 2NZ9A 5FKCA 1JUIA 4PI0A 1BVP1 5FZGA 2X05A 5ACA2 1ZBE1 3J7NA 2WO3A 3GZUC 3POSA 5JIUA 1REFA 3SH5A 3SKVA 4ET7A 1OLMA 3T2OA 3PDQA 1S0CA 3KLSA 1CONA 1LEMA 4HANA 1FV3A 1D2QA 1OF3A 4KMQA 3WP3A 2HWB2 4KH9A 2Y33A 3PUSA 5FYTA 1L7LA 4PDWC 4J25A 5LW9A 3WW1A 3VBOA 1OPOA 2DVBA 5E16A 1V00A 2XJTA 1OVPA 2VNOA 3GDBA 2X53S 5DDJ1 4LBMA 4HMZA 4FOYA 4CU9A 4J6GA 1W6MB 3B5LB 3O0WA 3RNSA 3ZXJA 1WMFA 4RGKA 3AC0A 2EXHA 4LEJA 2VBPA 3RZGA 2WAOA 1GR3A 3BGAA 3IAQA 1HLCA 4MXWA 3UGFA 3GHMA 1MZ6A 4Y5Z0 4NHLA 1W9FA 5KXCA 2W94A 1CX4A 1OBNA 4Z2AA
chains in the Genus database with same CATH topology
5FQ0B 2PHTA 5HCBA 3N36A 4D7TA 1H8TB 3BCWA 4BLJA 4YARA 1C8M1 3IBMA 5CA6A 3AP9A 2AR6A 1S2KA 1DFQA 2IXLA 2EVXA 4URTA 1QWRA 4L2NA 5C8CA 1LHOA 4LBOA 1PK6A 1LGNA 4AWDA 1ZREA 4H14A 4AVSA 4L97A 2R071 1FPN2 1DDLA 4XFBA 4L11A 2OZ6A 1BBT1 1JH5A 1SLBA 4AI0A 4PF5A 2BWAA 4QQPA 1YFWA 4Y1XA 4R9CA 1LR5A 1DIWA 2Z69A 1GFF2 1IKQA 2I07B 3AZXA 3SCGA 5DUWA 2A73B 2VW2A 4GB31 4J1WA 5JOYA 4LLOA 3KT1A 1A6CA 4DNYA 2WT0A 5JOWA 4UW3A 1WCKA 4W6YA 3IM0A 1VBE2 5C4WB 2VMGA 1UCXA 2WINB 4I30A 5JSOA 4B8EA 1H8TC 1BVVA 2Z5WA 3U4XA 4AVCA 4ATEA 1VB2A 2B7YA 4DFSA 1VBD3 5BPXA 2GC0A 3B3QE 5SV5A 5LK7B 4L92A 4RQPA 1N3OA 1AR81 4AQ6A 1QXRA 5F1RA 2ZABA 3VGIA 2ZZQA 1G8WA 1TME2 1NZCA 4XETA 4G9SB 4LE4A 5H9RA 1FNZA 5I0SA 3AFKA 1QQP1 2WKKA 3IPVB 1YWKA 4Y20A 1YIPA 4LR4A 1RUG1 3HMYA 5CAZA 4BLIA 2FHRA 1WMDA 2RHPA 3DPRB 1HXS1 2R0FA 4RD7A 2C9AA 4RR3A 2YY1A 5CNAA 5EYYA 3ZIWA 4LBJA 4V1PA 1NLRA 1DZQA 2CAVA 1YLLA 2GNTA 1ONAA 4N53A 2AREA 1ZRRA 4K1ZA 2W68A 3AKQA 5C4WC 1EP0A 5C9AB 2D6PA 1GKBA 1ZVFA 5ABJA 3T2TA 2VQAA 4DS0A 2XLGA 2XJSA 4C91A 4LBQA 4ISQA 2B39A 3Q9OA 2DUPA 1LULA 1Q8SA 4MGIE 4Q0VA 4UBHA 3SMHA 3RMXA 3AZVA 1NG0A 1O91A 2VULA 1NXMA 1J58A 3K48A 2PLV2 1B09A 1SFYA 1DBNA 4DXZA 5J37A 4OUMA 1BJQA 1RMU3 4HN1A 5FO9B 3QACA 4CDWA 4BE3A 2WFF1 5DUUA 3LZZA 2XBO2 4BZ4A 2VNGA 3WNXA 3CEWA 3FLPA 1TMF2 2KM2A 3USUA 2IZWA 4KWKA 2ZX4A 1BMV1 5BUVA 1VJ2A 2ZZJA 3GHNA 4EWEA 2DVGA 4S2DA 1Z7S2 2FBEA 4H3WA 1VBA1 4A7KA 2GALA 3TN91 1R1ZA 4TWTA 1H4GA 5FFOC 1CPMA 1AL23 4XJWA 4HVQA 2V5YA 2HJIA 4PQ9A 4XFAA 3AYEA 2RJLA 4XJAA 1MS3A 1WUVA 1EAH2 3VBUA 3VBRB 4W6WA 4FQ4A 1ZX5A 2E7TA 1S0EA 2NMNA 3R0RA 1HDKA 3WDYA 3ZXAC 4OZXA 2Y26A 3KCXA 4FPGA 4AXOA 3QH7A 1S1AA 4ONUA 4XBQA 3VKOA 4I3GA 2WS92 4CEWA 5KC5A 1N47A 2Y0IA 1V9U3 1VALA 2D3PA 3B02A 2MPFA 2VOXA 4BQ1A 3KB5A 2A6WA 3RWNA 3O14A 5H9SA 1RVF2 1QJU3 2WWSA 4DQAA 3H1MA 4PIYA 4A2UA 3JB8A 4YM0A 3ZPYA 4WM7A 1QY4A 4WVMB 2CGOA 2ZKLA 1D0HA 1FMD1 1Q8PA 1UL9A 2XWJB 4XYXA 3VKNA 1UZYA 4C0HA 1IQAA 3IDBB 5DUXA 3ZXDA 1EYBA 4F7ZA 5CG9A 3UV9A 1DG6A 5JSPA 3UKTA 2RR11 4LUKA 3S7IA 1LB2A 4P9GA 1MVQA 3AJZA 3AMPA 3VBRC 2WQZC 3MLJA 1R092 3ZN5A 1N3QA 2ZS6B 1UPSA 1O5UA 3CJIA 2CGNA 3CNAA 4FPFA 1AYM1 4JCKA 1DF0A 1X36A 1RHI1 5T5LA 1ZA4A 1BEV2 4RFT0 2HWF3 3TWIA 3WINE 4BCUA 1DYPA 2UU8A 1IZ3A 4OUSA 2DU1A 4E2GA 1OSGA 4C1WA 3I8TA 1CAWA 1D0GA 4AYUA 2O8OA 1KJLA 4W65A 2D6NA 1G6NA 2AENA 2AZ5A 1CR7A 2HKXA 3N7MA 2XKOA 1YI7A 3MZHA 5BYNA 1TEIA 1EPZA 1CAXB 1X50A 5EYXA 4GULA 2BPA2 1OLRA 1RUH3 5JZGC 1O3TA 2JKBA 1N1VA 4RSUA 2GDFA 4R8HA 4LA3A 1MS8A 1SLIA 2XJVA 4P9IA 1CQ9A 5J96B 1J1TA 2JD4A 3RI9A 1YJKA 5ACA1 1LHNA 2E63A 2ZJCA 2AYHA 1R1A3 2QNKA 1UN1A 1O4TA 1QJY3 2WA3A 3P3PA 4IV1B 5EFUA 4AQTA 4HK8A 4Q4W3 2WJSA 2GH2A 5T3NA 2HWB1 1M06G 3ASIA 4DPNA 3GBGA 1H1MA 4PBOA 5DUVA 1SCSA 2RMU3 3M2MA 4AFDA 4DB5A 2OVUA 2BEOA 2RS33 2D7FA 4H7LA 5E1RA 3WDVA 3H9AA 2QVSB 4NN0A 5EV7A 2RS52 2WFPA 1QNWA 5K7PA 2FQPA 3EXUA 4UW5A 1QU0A 3ZDSA 1SQ4A 2DVDA 2A6XA 4Q4Y3 2VMIA 4EN6B 5K0UB 1WLWA 1REEA 4PLOA 1OQDA 3SNMA 4K40A 3CO2A 4YW2A 3B7MA 1PO13 5GZCA 4JDOA 1ZBE3 2ZMNA 1J3QA 1LKNA 4GWNA 5FAXA 2B5HA 4Q0QA 1CGPA 3UK9A 1DQ6A 4M00A 3OGJA 3TNQA 1LHWA 4MGZE 4ZU4A 4XIOA 3FLRA 1F5FA 4YFWA 4IV1C 4XPVA 4WZFA 3MPBA 3WQ0A 2JG9B 3TNPB 3CJXA 3OY8B 5DDJ3 3MFCA 5A3MA 2X8KA 3PLQA 2Q30A 4KWLA 2DCJA 1L3JA 1PGSA 1PZ9A 1UZZA 2VXRA 1U5XA 1MQTB 1PO22 1LECA 3IT8A 3HT2A 5JAXA 3RJRA 2UYBA 3JB4C 2ARBA 4CDXB 1NCRB 5A32B 1UW8A 1S55A 1VP6A 2VOKA 3ILRA 3ZYGA 1EV12 1LTEA 1UPIA 1C8M3 3WOGA 5I0TA 1YRZA 3DV8A 3OCPA 3G7DA 4MVTA 5GZDA 2G9FA 1SCRA 4FAGA 2MHFA 3AMQA 4XF0A 4LT5A 4AGVA 3H1WA 2VOVA 4YM1A 1LOFC 2VVEA 5GJ6A 4CZSA 2ZKNA 4LHNA 1G9DA 4H55A 3POWA 2FMDA 4AK3A 3VBHA 1MS4A 2V73A 1SMVA 2R073 4QT6A 1ZNPA 2R0HA 1IOAA 1CAVA 1BBT3 4WM8B 1S0IA 2CNAA 3NWKA 2X5IA 1ND3B 4JGYB 3MEPA 1URXA 4XW3A 1POV1 1VR3A 1H2MA 4Q1PA 2ZMLA 1N1TA 4NPRA 1WLTA 1C5IA 3M8LA 5D8AA 1PHMA 1UX6A 3IMNA 1ASJ1 3W59A 4Q0PA 5JLVA 1MQTC 3RYKA 1COV2 4XBNA 1AR72 3LSEA 3MPPG 4MZUA 5CFDA 1NCRC 3I59A 3LA7A 5TSWA 3FZ3A 3ZMOA 4GMP1 2YYOA 3WQ1A 3JZVA 2WNEA 1QMJA 4Q4V2 1OOPA 3ZMNA 1X7NA 4Y1ZA 4U2AA 2HEVF 1RUE1 4OHYA 1Y9QA 4M3CE 3N7LA 1UD1A 4INDA 1AR83 2I74A 2R062 4OHZA 4QGNA 5BNNB 5BY5A 2YC0A 5E8AA 1W6OA 1AXYA 4M3CA 3WDTA 2WT1A 1QQP3 4YVSB 4OFGA 4GQ7A 1SDWA 2JJ6A 2UY8A 4ISRA 2PLV1 3VBFC 2NQYA 4R4XA 4WM8C 4BIOA 1O5LA 1RUG3 2D40A 4X8NA 1BZWA 2ZTNA 3NSTA 1ND3C 4GH4A 2XGXA 3E5QA 1CIWA 1XNDA 4JGYC 1HXS3 2Q0AA 3IKWA 2CWSA 2XBO1 2SLIA 3J8F2 1UAIA 1LU1A 1AR92 4AF9A 3NJZA 1ZZ9A 1GNHA 4CDUB 4OHXA 3DL3A 1QJX2 4CEYA 5CB7A 5B2GB 4YVWA 1Z7S1 4N7IA 2JG8C 4Q29A 4D7YA 1MS9A 4KBBA 5L7OB 1VAKA 1H0BA 3PJYA 2QUOA 1BKZA 5JOXA 4XF1A 3ZXKA 4FVVA 4IEYA 4NR1A 1UU5A 3VDDA 2BW8A 4F8AA 5FDBA 2RE9A 2E7AA 3KSCA 5T55A 1EAH1 2AGSA 3C3VA 3INAA 5BNOB 4FO9A 2RM22 3ZFFA 1Q56A 3TRSB 3VBOB 5BNNC 1WBLA 2GU9A 2IXHA 1K5MA 2WFF3 3SXWA 1A8MA 4HPKA 3NKTA 1AXKA 5GLUA 1PZ7A 3T1LA 1D4M1 4MXWB 1AYN2 4Q8LA 2NYYA 1ZRDA 1KFUL 2IC1A 2MNGA 2LM3A 2X29A 3ZSKA 2KXLA 1RVF1 1DQ0A 4FTSA 4JV4A 4CDUC 1RUJ2 2DFBA 3TN93 5A3LA 4R9DA 3M1HA 1V70A 5DZEA 2UWCA 4HL0A 2BNMA 2WNUA 2B42B 2IXJA 2ZHNA 1Y43B 4ZU5A 2A6VA 1IS4A 2H6CA 5CIRA 2ZMKA 3AP4A 2R041 1PK6B 2VVFA 1UIKA 2AUYA 4XE9A 4MSVA 1W6QA 4FCAA 2XL7A 1G9FA 2XG3A 1HRV2 4YYOA 1IPJA 5BNOC 1R091 3LOBA 4DZGA 3VZJA 1DZTA 3VBOC 3BTAA 3KGZA 2ES3A 1NCQA 3WHUA 1OI6A 3DF0A 2GNMA 1S2BA 2A5ZA 3FC0A 5CG8A 3R4SA 4E4SA 3VBSA 4AEKA 2YXSA 3M3QA 5F5QA 2Q4SA 1WA4A 1VBC1 2R32A 1GICA 3MW4A 5FOJB 3PMEA 1W6PA 4GKXA 4Y1VA 1FMD3 1QOTA 4X6QB 1KRIA 1AX1A 4NO4A 4MGYE 4NWVA 4E9KA 1OA3A 4B29A 2AH2A 1ZZCA 4X8PA 4RQPB 2RR13 4CRQA 1DQ2A 2BTVC 3KQRA 4JGZC 3I54A 4AI1A 1UU4A 5AVPA 4RHV2 1AYM3 1Q43A 5E88A 1RHI3 4Y20B 1DU3D 1ND2B 3A0NA 3LB9A 5CFCC 4AQSA 5DZFA 3VHRA 4XIKA 1FYUA 4FXGB 1VBD2 4MX3A 4QGMA 5FLJA 2OA2A 5J7MA 2XLAA 1FXZA 4UW4A 4TLFA 4C0BA 4M3CF 3QH6A 4N53B 3AK0A 1MZFA 4EWDA 2VECA 1X33A 3O0VA 3UL2A 1NE4A 2B9UA 3O7OA 2XJPA 4LE3A 4PDWA 3LAGA 4FTEA 4LBQB 3ECQA 4Z8BA 1H8VA 1H9WA 4JQRA 3HIFA 3ZFGA 4FPCA 2ZGQA 5KHHA 5SV8A 2LALA 4LBQD 2GMEA 5ACA3 4EWAA 1FOD1 1A8DA 4HKWA 4I0AA 2CTVA 1OMIA 2BQPA 2D5FA 4XZPA 1PVC2 4I01A 2DVAA 2HWB3 1B35A 1O3SA 3IDCB 3ZVXA 1H9PA 3RS6A 1ND2C 1IKPA 3FJSA 2QZ2A 1PNFA 1RTVA 2OPKA 1KD7A 3IN9A 2K0GA 3VL9A 3WG3A 4BYYA 4DRRA 3OBRA 3ME2A 2YGLA 5AC92 4EROA 4K7JA 1UMZA 1ZRFA 1PO21 2YHJA 3G6JB 2ERFA 4N53C 2QKDA 1LGBA 3ES4A 4A7YA 4EJRA 2DCZA 1LODA 1V6NA 2GNBA 3I7DA 1EV11 4FPKA 4QPGA 4IETA 1GANA 4ATFA 3OJBA 3VBUB 1NLSA 1TNFA 4TYSA 2E53A 4JAAA 2ETEA 5FMOS 3MW2A 1MS0A 4IV3A 3HBZA 1JXNA 1BCXA 3X29B 2H0VA 3ZYPA 3MGUA 4OHVA 1RJ8A 2RJKA 1E57A 4B7EA 2FZ1A 3QD6A 5I8TA 3OYWA 2A75A 4S2GA 2MEV1 5BNPA 2VW0A 3M7AA 1AL22 4C90A 1S0BA 1YFYA 4I02A 1G9CA 1H8TA 3RZZA 4MH0E 1CESA 3EJKA 1C3HA 4Z82A 5BNQA 4Q4X2 1RUI1 2A3WA 2GC1A 1WMEA 2ZGTA 1Y3TA 1VIWB 1FAYA 1LOAA 3MIEA 4GKYA 5D1IA 4AHXA 1C4RA 2PAEA 1COV1 3VV1A 2R6QA 3A0KA 1XYPA 2V09A 1AR71 4QQ2A 1PGL2 1MS1A 3MDPA 5I8SA 1JHNA 2DUOA 4Q4V1 3OF1A 5J09A 3B01A 3VBUC 4D69A 1Q8VA 3DPRC 1V6MA 4IXLA 3RYRA 2BWCA 2R061 2F4PA 4S2FA 4P9XA 4LHKA 2JECA 2Q5TA 3WW3A 2EXJA 3WZ1A 2BVBA 3E6CC 2VGDA 4E4ZA 3V0BB 1POV3 1V6LA 4X6RB 1ALYA 5C9AC 2CGPA 1SLAA 1U5ZA 1X8EA 1CAWB 4ZXKA 3WVJA 1M4WA 1ASJ3 3J8F1 4XFHA 2D5HA 2D6KA 4O9EA 4AHZA 1AR91 4L9BA 4AQ2A 3E6DA 1R082 4LO8A 1HIXA 1WLDA 4AEDA 2NPIA 3J26N 3M3OA 3ZSJA 1LJ7A 1QJX1 4GMP3 5GM0A 1J1LA 1NYWA 3ROUA 2HWF2 3OD0A 4FPEA 1T6GC 1RUE3 3URFA 3GNEA 1DGWA 3JBG2 3IPVA 3FWEA 4KQ7A 2H6BA 5FLHA 3QOPA 4ZKTB 2YMZA 4YNIA 3WDUA 2C5DA 3I4IA 5FMOL 4BPZA 3MIGA 1RUF2 2EAAA 5H9QA 5KC6A 4WZCA 1IS3A 2WZR1 1KFXL 3AP6A 4GIQA 1WCDJ 1YHFA 2RM21 4YSFA 4XF4A 2ZHLA 2PLV3 4XQDA 4JC1A 1C1LA 2O8QA 1RUH2 4R4ZA 2DV9A 4FBFA 3H7YA 4HVRA 4I0WB 4Y22A 2XBO3 3R05A 1TE1B 3WCRA 4CTEA 1AYN1 4JRLA 4K1YA 2JDZA