3ZXFA

High resolution structure of human galectin-7
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
135
structure length
134
Chain Sequence
SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords GALECTIN-7
publication title Inhibition Mechanism of Human Galectin-7 by a Novel Galactose-Benzylphosphate Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 134
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3zxfA00
1S0EA 5JOWA 4YGDA 1VIWB 3IPVB 1LJ7A 4BOWA 3N7LA 3D4KA 5FRAA 1Q8OA 5E89A 1V6JA 2B7YA 3WHUA 1QNWA 3M3QA 2WSUA 4GA9A 5H9PA 4JCKA 5JDBA 3AZVA 5DUVA 4AVVA 2GMPA 4AYUA 5T5JA 5CAZA 2NMOA 4BMEA 5BYNA 4Q1PA 2VU9A 2JECA 3BTAA 3LSEA 3N35A 4Y1ZA 4AVTA 3ZSKA 5DZFA 1MACA 2D43A 1G8WA 4M01A 5DXDA 1JOJA 3N7JA 3ZSLA 4UW3A 1BQPA 4FOQA 4YZ5A 1SBEA 1WW5A 2JJ6A 5H9SA 4Y20B 1I1EA 1WW7A 2GN7A 2WJSA 2A5ZA 2P3KA 3UK9A 4GKYA 1GBGA 3WDYA 2ZBJA 2VW2A 3T2TA 1IS4A 1QOOA 2FHRA 2ZMKA 3ILNA 2PHTA 1DQ1A 1ENSA 2ZGMA 4K20A 1C1FA 2ZGLA 2DVAA 4GKXA 2ZGNA 1U0AA 1CESA 4Q8KA 1FV3A 2NYYA 1LGBA 2D6PA 4JRAA 2WT1A 4FVVA 2A6YA 1V00A 1UZZA 3AP4A 3RMYA 3USUA 4DQAA 1LU2A 1Q8PA 1X50A 2A6XA 1KDKA 3SH3A 5JMCA 2SBAA 4XJ8A 1JYIA 2E53A 3WCRA 1QOSA 2UWAA 4PBPA 4XIKA 3A0KA 2EXJA 4C1XA 5HCAA 4DS0A 3KQRA 4ITCA 1LOGA 4FPHA 3W59A 3ZSMA 1UL9A 3NV4A 3QLQA 1SACA 2A3WA 3I8TA 4HANA 4XTMA 1LECA 4ZXKA 3WOGA 2ZGOA 1S0FA 4F83A 1BZWA 3BIWE 3BODA 3IPVA 5IT6A 3ZXKA 3WG1A 1LCLA 4XIOA 1ZM1A 3VKLA 5F9TA 1TEIA 3MEPA 4XMIA 3M3OA 4XBQA 4YZ1A 1W6NB 2DTYA 2EF6A 1QOTA 1AZDA 3OBRA 2G4IA 5JVVA 4R9AA 1SLLA 1LU1A 1MS1A 1WBFA 5EWSA 1GSLA 4ASMB 1HLCA 5HCFA 5T50A 3AP6A 3MPPG 1JUIA 1A8DA 4YG3A 2EAKA 1GZWB 3RSJA 1DQ0A 1S0BA 3FUQA 1CJPA 1SLIA 4Q2FA 4Y20A 3AK0A 2VUAA 2JD4A 3ZSJA 4YFWA 3AJZA 2JDZA 4WVVA 4CRQA 2YZ4A 1LEDA 4IQPA 2UWCA 2WNEA 2ZGPA 1WW4A 1LOEA 3NV3A 3O12A 3PVNA 2ZABA 4Y1YA 3WUDA 1QDCA 2ZHMA 2Z42A 3HN1A 4YZ4A 1UPSA 3SITA 4YW1A 3LCPA 3O0WA 3OY8A 5L73A 2GMEA 3ZVXA 2DTWA 1KDMA 1LHWA 3ASIA 1LOFC 4YGBA 1SLAA 1I3HA 2W08A 2VW1A 1AXZA 1G7YA 4NOTA 5EYXA 2UU8A 2A71A 4D69A 1DQ2A 1W6OA 1JYCA 5GLTA 4NO4A 2AGSA 3POYA 2R16A 5H9QA 5DUXA 4XJAA 3N7KA 3SH5A 2ZAAA 2ZZJA 3USUB 1V6OA 3ZPYA 4YM2A 1ULGA 1YYNA 2D6KA 2PHFA 1GYKA 4LBLA 2DYCA 3VKNA 4CTEA 5GZDA 2DWRA 4DRRA 2ZGTA 3WG4A 2WLQA 1IKQA 2DU1A 3AZZA 4H55A 5HCBA 4M3CE 2DV9A 1HDKA 4XJZA 5IUQA 3AZXA 2D6MA 3RMXA 4GWNA 3NV2A 2A6WA 5GLVA 2DU0A 2GNDA 3GNEA 2H0BA 3IM0A 1H30A 1QNYA 3WDTA 1LGNA 4XOGA 1CVNA 3O0XA 3VUOA 1JW6A 2EXHA 1GZWA 2D3SA 1LEMA 1CPMA 2KM2A 4LBOA 1DQ5A 1G86A 4UW4A 4LBQB 5IK5A 1Q8QA 1F9KA 1ULCA 1UMZA 1LTEA 4YFZA 4FOWA 4YG0A 3CNAA 2A70A 1BJQA 1CIWA 4ISRA 2WQZC 2ZGUA 1G9DA 4PQ9A 2ZGKA 3AP7A 4BLIA 1FX5A 3INAA 2ES3A 1IOAA 2JE7A 4YGCA 1JN2P 2C9AA 4W65A 5IK7A 4FOYA 1MS9A 5CNAA 1RITA 1LOFA 1CPNA 1DYKA 1OKQA 1MZ5A 1AF9A 2CWMA 3O5SA 4UW5A 2R0HA 2R49A 5T5LA 4DPNA 5GM0A 3AFKA 3O0VA 1GZ9A 1J1TA 1YRZA 2DVFA 4U2AA 2AENA 3I4IA 5T52A 4AGRA 4I30A 3V65A 1BXHA 4XE9A 3WV6A 2GNBA 1F5FA 1QKQA 2W39A 3OBTA 3ILRA 4M3CA 2CNAA 5GLUA 3N7MA 2D3RA 1O4ZA 1VALA 4AWDA 1GLHA 2P34A 1EPWA 2YXSA 3KM5A 1D2SA 1AXKA 4GXLA 3OY8B 1V6KA 3FLTA 3IMNA 3V0AA 5AVAA 1Y7BA 1RIRA 2PELA 3ZYRA 3PVOA 1VAMA 3VKFC 5GZFA 1SCRA 1S0CA 1Q56A 1S0IA 2GNTA 1LGCA 1MVEA 1PZ7A 2CYFA 1N3QA 3NWKA 5LK5A 1A78A 1G9BA 1DBNA 1W6OB 3POSA 3PVEA 1R1ZA 2DURA 3W58A 3WDXA 3WVJA 2JE9A 4M3CF 2AH2A 3V64A 1SLTA 3RG0A 3RRDA 4FPJA 3WDWA 1IS6A 2YY1A 5EYYA 3DGTA 1H9PA 1GICA 1G9AA 4LBQA 2AREA 4LBMA 3A0NA 2ZHNA 4XHBA 3SISA 1WLCA 5DG2A 4P9WA 1DLLA 4YM0A 2ERFA 1LOBA 4Y1VA 4DRVA 4YZ2A 1S0DA 4YZ3A 4BLJA 5IK4A 3HR9A 1UKGA 1DQ4A 3WUCA 2ZMLA 2V5YA 2BQPA 5GZCA 3L2YA 1A3KA 5T55A 4WV8A 3U4XA 4YW4A 1JXNA 1FV2A 5GLZA 4ATEA 1MS4A 4P14A 4R9CA 1RINA 1JBCA 2EXIA 3D5OA 4P9YA 2P2KA 3MW2A 4PCRA 2R0FA 5KXDA 1BKZA 2OW4A 5JOYA 1UN1A 3M3EA 1V6MA 4Q27A 1GKBA 5KXEA 1LHNA 4R9DA 1WCSA 1UZYA 1N3OA 3FFZA 2HYKA 3TAYA 5IK8A 2P3IA 2ZHLA 4Y26A 1GV9A 1S0JA 3SNMA 1ONAA 2NZ9A 1YI7A 3UJQA 1MR5A 2NN8A 1DHKB 2DUOA 3ILFA 3OYWB 1CR7A 1SLBA 4M00A 2ZACA 2I2SA 4Q1RA 1B09A 1KJRA 4YW3A 2CTVA 2ARBA 3WG3A 2E7TA 3N3HA 3WLUA 5EXOA 2EIGA 2CL2A 4WZFA 2GDFA 4M3CB 4XTPA 1DIWA 3AYAA 3WDUA 1D0HA 1W0PA 5H9RA 3POWA 2DUPA 2A3XA 3ZXEA 4YM1A 3VKOA 4XBLA 2R1DA 2EALA 1ENRA 3V0AB 1HQLA 2P3JA 5DG1A 1ENQA 1DFQA 2YV8A 1OFSA 3ZXJA 4Y1XA 5CA6A 4HL0A 4FP2A 5FREA 1LODA 3AP9A 1AX1A 3SLIA 1AX2A 1KITA 1KRIA 1N1VA 3AZWA 1WLWA 3JU9A 4FP3A 1Q8VA 1FYUA 2XG3A 5JLVA 3T1LA 4P9XA 3H0OA 1FNZA 4ISQA 2ZGRA 1Q8SA 2VW0A 2WKKA 4GALA 2WT0A 3C2UA 4YW2A 1QF3A 1MVQA 1CN1A 5JOZA 3PJQA 5GJ6A 3B01A 1GZCA 4XZPA 4XHXA 2E7QA 2YMZA 1N1TA 2SLIA 1MS3A 3ZXLA 4Y1UA 3SH4A 2W52A 3ENRA 4FPCA 2GNMA 1ULFA 3AP5A 2FMDA 2ZGSA 5JOXA 1GANA 1LOAA 3OYWA 1V6LA 2DVBA 1CONA 1W6PB 2D6NA 1SFYA 2GALA 2NM1A 4XILA 3RQ0A 4Q8LA 1NXD1 2YROA 3AZYA 1MS0A 1IS5A 3Q9OA 1AJOA 2D7FA 1CQ9A 4UW6A 3OPZA 1V6NA 1QDOA 4FPYA 1DGLA 1LOCA 1HKDA 2WSVA 3AJYA 2PHXA 5GLWA 3RS6A 4XJUA 3FLRA 3WDVA 3HMYA 1LENA 4DFSA 5T5OA 3LSDA 1W6MB 2ARXA 4FQZA 4FPOB 3TB0A 3VV1A 3V0BB 1NLSA 2ZMNA 4YW5A 3A4UA 4K21A 2ZKNA 1DQ6A 2RHPA 1WW6A 1FATA 2CY6A 1YXWA 2ENRA 1O4YA 3B00A 4GWMA 1FNYA 2XB6C 4XDQA 3ATGA 4YM3A 3AYEA 1LESA 4FPGA 1DZQA 4ATFA 1WD4A 3APBA 2VXRA 4KBBA 1ULEA 1N3PA 2A3YA 3AXDA 2R1BA 5DZEA 2VH9A 1UAIA 5SV8A 3UL2A 1LHUA 2DVDA 4WVWA 1LULA 4AVSA 4MYEA 2A6VA 1MS5A 1SBDA 2AYHA 1LHOA 1OQ1A 1UX6A 3OJBA 1PZ9A 4FPEA 3T1MA 2LTNA 1G9CA 1YO8A 2DUQA 1W6QA 4LBNA 4Y22B 3FBYA 1N1YA 5CBLA 1H9WA 2AR6A 2D6LX 2ZHKA 3PMEA 2EXKA 3B3QE 1WUVA 1URXA 3DUIA 3WHTA 1AJKA 2Q5TA 2ZGQA 3GALA 4XBNA 3D6EA 3QCWA 4FOVA 1SLCA 3FLPA 4Q26A 4PF5A 1W0OA 3ZYPA 2E6VA 1W6PA 1GNZA 2A6ZA 1SBFA 4Y24A 5DUWA 5CB7A 1BYHA 3MW4A 5GALA 1G9FA 4LBQD 4LBKA 4BMBA 1YIFA 5KXBA 1Z78A 1HQWA 1KQRA 3B9CA 3NV1A 4SLIA 2W68A 4PBOA 4RA0A 2ZA9A 2D6OX 2PHWA 1N1SA 2AUYA 1IS3A 1W6MA 1WLDA 2PHUA 4YGEA 4JC1A 3V0BA 1QGLA 1Z0HA 1FAYA 4AGVA 4FPLA 4BM8A 3AYDA 5DZGA 1KJLA 1N47A 2DVGA 3R4SA 5DUUA 5E88A 4OZXA 1JHNA 1F31A 2PHRA 4TZDA 2A75A 2GN3A 2GMMA 4XXAA 5GZEA 2OUJA 3VKMA 5T5PA 1QMJA 2C5DA 3AYCA 3WZ1A 2JKBA 2D3PA 4YLZA 4AGGA 1C1LA 3ZXFA 3M1HA 2NP0A 1SCSA 1DYPA 3FUOA 2VY0A 3M2MA 3OGGA 1AXYA 4FQ4A 1S0GA 4U36A 2CWSA 4CZSA 4YG6A 4BPZA 2D44A 4FPKA 4Y22A 1PZ8A 1C4RA 4C1WA 4XJWA 3AXEA 1VLNA 4BQ1A 1AVBA 4LBJA 1LHVA 5GZGA 1QU0A 4Z8BA 3R05A 2TEPA 4XJ9A 3UJOA 4RL7A 4K1YA 3WNXA 1ULDA 3B69A 1ZA4A 2UWBA 3MW3A 4TYSA 3WG2A 1APNA 2P37A 1AX0A 2WT2A 2E51A 4ZKTB 1S1AA 4R9BA 1V6IA 4K1ZA 1W6QB 4XXPA 3JUUA 2OUHA 2V73A 4XYXA 4FPFA 3IKWA 3WCSA 4XMAA 5T54A 5F5QA 2NMNA 1IKPA 1VAVA 2OVUA 4L8QA 3M3CA 1MZ6A 1C57A 1W6NA 5KXCA 1MS8A 3IN9A 1WD3A 2A7AA 5E8AA 3N36A 3R4UA 1WBLA 1GNHA 2UURA 1XQNA 2LALA 3AX4A 3BOPA
chains in the Genus database with same CATH superfamily
2XJRA 5DPNA 5F6LB 5JOWA 1H2KA 5LY1A 4O9GA 3JCIA 4BOWA 4AI3A 2E26A 5FPLA 1V6JA 2B7YA 1QNWA 1TQ5A 4GA9A 1WMDA 3POBA 2TNFA 2GP3A 1FPN1 2ORXA 4AYUA 2BNNA 1QJY1 5BYNA 3BIEA 4LEJA 4QX1A 2VM9A 2JECA 2CHHA 4AVTA 3LSEA 1FOD1 5K8SA 5E16A 3ZSKA 1MACA 4M01A 4PF1A 5DXDA 5FAXA 5HXMA 2MHFA 5A7OA 4WBBA 5IAVA 1JUHA 3C3VA 1D2QA 2H0VA 4YZ5A 2JJ6A 2MEV1 3W9AA 1WW7A 3KF3A 4BIOA 2P3KA 3WINE 3B7MA 5C3SA 3PIGA 4GKYA 3AMNA 4GULA 1K45A 1TMF1 3WDYA 2K0GA 5FBZA 4C0HA 1YLLA 1OH4A 3FHIB 4LE3A 4JHTA 4DIQA 2WO2A 4K20A 4EZ4A 3K4AA 3I2HA 2DVAA 3VBFA 2PFWA 3FE5A 1PVC2 5KC6A 3LOBA 3R4DB 5AFEA 3S30A 5A7PA 4WM7B 5LK7B 2D6PA 1OQEA 2A6YA 1UZZA 3UGGA 2OX0A 1LU2A 1RJ8A 2PXJA 5L7OC 4OHWA 3WP3A 2SBAA 1OXCA 1JYIA 2E53A 3WCRA 4RN5A 2KD7A 3K4DA 2Q4SA 1J3PA 2RS12 5LA2A 4C1XA 1KS4A 4QWNA 4Z2AA 2DCZA 1YJLA 2HWE1 1ZZCA 4MOAA 4QXBA 3ZSMA 2HWC2 3GHMA 3I3QA 5ANQA 3I2GA 4NN0A 1SACA 2Y64A 1SPPA 1VBE2 3GF6A 3LGRA 4QKBA 4ZXKA 2WYSA 2ZGOA 2V72A 3WNOA 4GH4A 3U14A 2HBTA 3GBWA 3FMGA 3BI3A 2OPWA 5A7WA 4NR1A 1MZFA 4XIOA 3RJRA 3WG1A 2BU9A 5L9VA 3WW1A 2J1UA 4RSUA 1TEIA 1UZVA 2WFPA 3MEPA 4XBQA 5JSPA 2ZX3A 3SKVA 2RMU2 1RVF2 4BK4A 2G4IA 1MS1A 5AC91 3MPPG 1SDDB 2R7EB 2YBSA 2G19A 1MQTC 1O3RA 2Z2SB 1UY3A 1DQ0A 2HWF2 4RFRB 2O14A 1S0BA 2RS52 3VBRB 4Y20A 2BNMA 5EP9A 4EN9B 3AK0A 2VOWA 3T2PA 1QJZA 2QQLA 3PNAA 4NROA 2H6CA 5K7PA 1RXFA 5ACA2 2W95A 2JD4A 1GR3A 1JZ4A 3ZSJA 2K9ZA 4CRQA 1JH5A 3AFGA 2YZ4A 4QPGA 5FQ0B 3JD72 2WNEA 1REDA 5D8AC 1ND2A 1EV12 2Z42A 3HBKA 3HN1A 3NAPB 4UI9L 3SITA 1PO22 4CVUA 1HB3A 3O0WA 4KH9A 2GMEA 2VZ1A 3ZVXA 2DTWA 1KDMA 1UO9A 1JU4A 1PVC3 2ETEA 4V2VA 2G9FA 4YGBA 4UBHA 5A6XA 1I3HA 1MZEA 4RD7A 3VBHC 5BNNA 4QPIA 4D69A 1ACCA 3U07A 4G3YC 5FZ0A 2AGSA 3ZFFB 1F2NA 2RS13 3E5UA 3GZAA 1ZRDA 4XJAA 3N7KA 2XJQA 4XUNA 3LAGA 3ZPYA 4BWOA 1W8ZA 2HWC3 4HG6B 5D21A 4DRRA 5DQ0A 1AR72 3AZZA 4K8RB 3VD9A 1PGL1 1VBE3 3EXUA 2DV9A 1BK0A 1OMIA 3OGSA 4META 4CU6A 3AZXA 1QJFA 4OHVA 4CP1A 3RZMA 1QIQA 2BRTA 2P3YA 3LFMA 2QQJA 4Q4Y2 2QCSB 2VC9A 3IM0A 5C8CA 5C8WA 1QNYA 1ENXA 1D4VB 1QJX1 1J58A 4PIZA 1H6YA 2RE9A 1UQXA 1RVF3 1JW6A 3D3AA 4IV1B 4OI0A 3LEKA 2D3SA 4UFKA 3JZVA 4Q4X2 1UY0A 1W06A 4AI2A 3AMMA 5EV7A 4D8MA 1F9KA 1XNCA 1LTEA 4YFZA 2PHLA 5FUIA 3ECQA 4FOWA 4AHXA 4JGZA 2QKDA 3JQXA 2XDVA 3G7DA 4XCAA 2HWF3 2ZGUA 1O8PA 3Q8FA 1ZRRA 3AP7A 4FI9A 1FX5A 1HRV2 4BXFA 4ASKA 3PUSA 4URTA 4BYYA 2XJSA 5ACA3 1CD3G 1PGW2 1GOHA 3ZYIB 4QB6A 4W65A 4CDQC 4FOYA 4C8DA 3LEGA 1OC1A 4NHLA 2I07B 3I97A 3JD73 2YFZA 4AW7A 1OFNA 1DYKA 5FO7B 4Z1VA 1XNDA 5G05L 2JDNA 2R062 1EV13 1X8MA 5FP4A 3AFKA 3VBSB 1GZ9A 1J1TA 1PO23 4AI1A 4N43A 4I30A 1W9YA 4QT6A 5EJ3A 1OVSA 2GNBA 2VL4A 1QKQA 3ACFA 4QX2A 1BMV2 2IXKA 3N7MA 1O4ZA 4UT5A 4AWDA 3ACHA 1NAEA 2A1XA 1D2SA 5J1XA 1AXKA 4GXLA 3H7JA 2VAUA 4XUQA 1XOYA 1RMU2 5FPZA 4CCOA 4CU9A 1MEC2 5FR3A 3ITQA 2PELA 1NQDA 1ZBE1 1OLQA 1RUOA 4MXVA 1U5XA 3ON7A 4JDNA 1WCDJ 5GZFA 5K0UC 3MIEA 2H6BA 1S0CA 4XF1A 4YVSC 1PZ7A 1G9BA 2CYFA 4CXWA 4IEQA 4XFBA 4N7IA 5FPVA 4W6XA 3W58A 2BZDA 4M3CF 4M4RA 4DO0A 1OT5A 5CZKA 3PHMA 5EYYA 1C5IA 1H9PA 5KHHA 4Q4Y3 4LBQA 1D4M2 2AREA 3VL9A 1PIV3 2ZX0A 4ZXEA 5C71A 2R073 1GFF2 4AAPA 4E2QA 1REFA 4NHKA 4Q4X3 4XDOA 4Y1VA 4YZ2A 2N7GA 4XFGA 1O4TA 4EWDA 3WUCA 1VR3A 5A3MA 4CDUA 3QH6A 5FZ4A 4EZHA 3KGZA 2ORZA 3PJYA 4LE4A 1CGPA 4RS5A 4IEZA 3O1RA 2OIIA 3L2YA 4AEDA 4WV8A 5C4WB 5CADA 1JXNA 3OUJA 1HRV3 3ZFGC 4ATEA 4R9CA 4ZU7A 1JBCA 3D5OA 2P2KA 2WWSA 5FKBA 2D98A 3WF1A 4WVMA 1UOBA 2OW4A 5A1FA 4IV3C 1V6MA 4Q27A 5IVJA 4DOUA 4MX3A 4R9DA 5IK8A 1UZYA 4Q0VA 2ID4A 2JIGA 2P5BA 2ZHLA 3O1TA 1CAUA 4EWAA 3ZN5A 2R063 2VR4A 3NNFA 1MR5A 4I02A 1DHKB 2Z79A 4NAOA 2W9XA 2DUOA 3ROUA 3MZHA 3I54A 4KWJA 2ZACA 2VECA 4JV4A 4SBVA 5CFDB 5JZGC 3O7OA 2HKXA 1F4HA 4AQSA 1W8HA 4HLTA 1HIXA 5FZHA 4UFLA 2E7TA 1AR91 1F5JA 2E9QA 2VGDA 3MLKA 1RMU3 3OSDA 4IE6A 4W50A 1VBC2 1VMFA 1MEC3 3WQ0A 4NRMA 3P1IA 5A6ZA 3CEWA 5ISLA 3AYAA 1D0HA 1W0PA 5FY1A 3BTZA 3ZXEA 1VBA2 1O59A 4YM1A 3VZNA 2G1MA 4XBLA 2R1DA 3V0AB 3N9QA 2P3JA 5DG1A 1R1A1 3BTYA 1DFQA 2YV8A 1OSGA 5FYYA 5CA6A 1JZ7A 3WP6A 2C9KA 5J96B 2VO5A 3AP9A 4JHZA 2ZCWA 1JU3A 1AX2A 1T6BX 4FFHA 1NCQC 5FYUA 3BTXA 1JS9A 1FYUA 3H3UA 1D4M3 1L3JA 1VBB1 1FNZA 4B7EA 1IGOA 2ZGRA 3AMQA 5C70A 4CUGA 3T09A 4LO8A 1BBT1 2RG4A 4YW2A 2JG9A 4CP9B 4NWVA 5FZ9A 1MVQA 3K75B 4BDVB 3S5QA 5JUVA 3MPBA 1RUJ2 4XZPA 3KV9A 1C8NA 3OEBA 4FXKB 1L7RA 1UYXA 5LW9A 2YMZA 2XMLA 4V2WA 3HJRA 3ZXLA 1I5PA 4IE7A 4LNVA 2W52A 4BQ4A 1JYXA 2XVGA 2XR4A 4P9GA 5I91A 2ZGSA 1XSRA 3RZKA 2B46X 3LD8A 5GKAC 1HN0A 1JOBA 1NXD1 2GC2A 3N4MA 3AZYA 1IS5A 4A7KA 1IZ3A 4RYDA 1AJOA 2D7FA 1C3HA 1UXZA 2WBKA 4UW6A 2XWJB 1V6NA 1GQGA 2XQRA 1VMHA 3L2HA 4OI1A 1DGRA 4YW7A 5GLWA 4HK9A 1AL21 2YC2A 1H8TA 1BEV3 2W1UA 1LENA 5F2WA 3I59B 5CU1A 3RDIA 2VMIA 5T5OA 2ARXA 1VBC3 1SMVA 5BXXA 4I2OA 4XAAA 1PVXA 3HOBA 4H7MA 4IGOA 2XJPA 5IYYA 2BTVC 1OOPB 4MGQA 4UF0B 1VBA3 2WAOA 4ZS3A 3T4VA 1W8TA 2JDUA 4LO4B 1GU3A 2CDPA 3ATGA 4YM3A 2B39A 3T4HB 1W8UA 4MLOA 3BN6A 1OA2A 4LT5A 1DZQA 1X7NA 1NA1B 3VHPA 2GZWA 5E6HA 2IFWA 2R32A 3APBA 4IEOA 4KBBA 4E4DX 4LUMA 3AXDA 1PMIA 5ABJA 5SV8A 2RR13 2W3JA 5AFBA 2Q30A 4WVWA 1LULA 2BYVE 1U5ZA 1H4HA 1SBDA 3OJBA 1UX6A 1OQ1A 2VCAA 3HT2A 5FBJA 4BK5A 2LTNA 3CQOA 4IEUA 4FBFA 1G9CA 3OD4A 2YBPA 4FAHA 1H8VA 1VRBA 3FBYA 2BGOA 3NL1A 2AR6A 4DNYA 3A7QA 3PMEA 5IFTA 2BBAA 1WUVA 3IDCB 1URXA 2Q5TA 4KG8A 5J3UA 1WZXA 2BERA 4AHYA 4FOVA 3J7HA 4L2NA 4Q26A 3KCYA 5I0UA 2ARAA 1W0OA 3ZYPA 1YFWA 3SHRA 1W6PA 1SBFA 5LRRA 2R071 4A42A 1K5MC 4OULA 2DFBA 5I8SA 5FLHA 3MV01 3PURA 5GALA 1G9FA 5JXHA 3VHOA 3RGBA 4LBKA 1PNFA 1Z78A 1HQWA 4EN7B 3B9CA 1H1AA 2VTFA 4RA0A 2DCJA 4RGKA 4DUXA 3GZUC 2ZOEB 3ZN4A 3OF1A 2AUYA 1WLDA 3V0BA 1PO13 1Z0HA 1AR63 1S2EA 4AGVA 1FPN2 5FYVA 1QY4A 4B29A 2YUEA 1NZCA 2VZQA 1KJLA 1HRI1 2VBPA 5E88A 1FOD2 3AKTA 2OYZA 2PHRA 2RS31 1R64A 1XB9A 3TWIA 2VNOA 5GZEA 2OUJA 2XBO1 4YSFA 4OHXA 1QMJA 2C5DA 3AYCA 3WZ1A 2JKBA 3GM8A 5IVFA 4AF9A 4MGKE 3NNGA 4XETA 2WNVB 3OGGA 5A7QA 2VTXJ 1UD1A 2WAAA 1KXGA 4BPZA 4CCLA 1PZ8A 3LA3A 4A7YA 1ZRIA 3RZJA 2FDKA 1VLNA 3EB7A 1AVBA 2Q1FA 4I0BA 4UWDA 1LHVA 1QWRA 4A3ZA 5GZGA 5L36A 4LO5B 5D1IA 4ZS2A 4Q0PA 4JZRA 4Z8BA 4CXYA 4L97A 2XJVA 4M4PA 4RL7A 1CAXA 1SG3A 1ULDA 3P5BA 3VBFC 4P02B 3DPRA 2UWBA 3HNBM 4MGYE 2P37A 1W2OA 4PI2A 4Q4W1 5BNOB 1TZOA 4GB31 4XFFA 5I93A 1W6QB 2Y33A 2ZX4A 3ES4A 4XYXA 3ZXAC 2HWB2 2HWE2 4PI0A 4CU7A 2TUNA 4XMAA 3IWZA 3BUCA 5F5QA 4L8QA 2W1WA 1OH3A 2HJIA 1LKNA 2FCUA 1C57A 2P6CA 5A33A 3E5QA 3HIFA 1ZVFA 3VDCA 1JYTA 5FXZA 1H2MA 1R083 3M8LA 3GCXA 2PAEA 5DAPA 4JKMA 4XVHA 3WT3A 1VIWB 2XUMA 3IPVB 4B1LA 4BQ5A 3N7LA 1J59A 3D4KA 1DGWA 4GH4C 3VBRA 1BCXA 4NHYA 5E89A 4UBGA 3OB8A 3VHNA 2B4KA 4ES9A 3WHUA 3MBWA 4FTEA 2WSUA 4AQ2A 2R041 2GC1A 5DUVA 5FY0A 3U10A 5JSRA 5T5JA 3X29B 5CAZA 2NMOA 1LR5A 1OI6A 2I45A 3HNMA 3J7NA 4Q1PA 4BMEA 1CAWB 2JKXA 2VU9A 4LPLA 2WNOA 3BTAA 2V4AA 5TSWA 3D0SA 4WM8A 2D43A 1G8WA 1UOFA 3ZSLA 1JOJA 1K5JA 3N7JA 1OUXA 4IESA 4UW3A 4BIFA 2W94A 3JBG3 2NQYA 5J36A 4FOQA 3MF9A 3THCA 3HD8B 3GXUA 1VP6A 4TSVA 4DY5A 3K3NA 1HQNA 3UK9A 1ZZ8A 2BPA2 1YCIA 4JGYA 4LHNA 1AHSA 5DN2A 3LZZA 3T2TA 1IS4A 5FYSA 1QOOA 3DECA 2ZMKA 4RQPA 1QQP3 4E2SA 3VBOB 1ENSA 1RUC2 1C8M2 3KQ4B 1UX7A 4ARXA 2ZGNA 3ZYHA 1CESA 2VPVA 2IFRA 3MLJA 4QPGC 4DUVA 5KWRA 2NYYA 1LGBA 1REEA 3MLLA 1V00A 1ND2C 1WCKA 2XUEA 3AP4A 4JRLA 1X50A 3RMYA 3SH3A 5JMCA 3CBNA 3ALQA 4LA2A 5FPAA 3BGAA 4J6GA 4PDWA 1QOSA 2V4VA 5FZFA 4HT1T 3R6SA 5FO8B 3VDAA 3KB5A 2RM22 1HXS1 3TEWA 3QD6A 4ITCA 4AZZA 1AYN1 1QJU1 1UW8A 2VQTA 2X5IA 3C7FA 4N9HA 1OF4A 5FMDA 5BNNC 1YFXA 3VN4A 1O6UA 4QPIC 2HWB3 3QLQA 4FFIA 2A3WA 1W3XA 2D5HA 3I8TA 2Q0AA 3KT1A 4XTMA 3PU8A 3WD5A 2WS91 5FV3A 4QD2A 3I2KA 1RUD3 3ACIA 1PGL2 1BZWA 3BIWE 4MZUA 5IVCA 2ZEZA 5FP7A 3VKLA 3GJBA 1EUTA 1NX9A 1ZZ9A 3RI8A 4AFDA 5K4LA 2QQMA 4XUPA 3I3MA 1W6NB 4RGGA 2ZEXA 4NPLA 1QOTA 4FCAA 3JXSA 2WRAA 2OS2A 2VMCA 4QHOA 1WBFA 2YGLA 2VVDA 3IDBB 4ASMB 4GIQA 5T50A 2DDUA 1GQPA 1YQ8A 5C8CC 2EAKA 1GZWB 1UWWA 1JZ8A 3BPZA 3ST7A 5IVVA 4IXLA 3FUQA 4A4AA 2OQ7A 4MGSA 1W9SA 2IVIB 1PX3A 5FJHA 2PAKA 3J8F1 3K2OA 3QBQA 4X6RB 3LFIA 3NJYA 4D7TA 3ZYBA 4W4ZA 4IEWA 2DCKA 4JGZC 5FJKA 5J98B 3VBSA 3ZIWA 3UKVA 4QU2A 1SZBA 2YBKA 3VLBB 2Q1ZB 5FK8A 2ZGPA 1WW4A 3NV3A 5D8AB 5BV6A 4Y1YA 2ZEWA 1QDCA 1XE8A 4DB5A 1UPSA 1TME2 3FJSA 3LIGA 1RUC3 1C8M3 2WA4A 3UV9A 2Y26A 3ASIA 4JQRA 3C7HA 1OHFA 4D6SA 2B8MA 2OZJA 2W08A 4P5HA 4NOTA 5EYXA 2PN5A 4HSJA 1DQ2A 1H6XA 4N43C 4PJYA 5C9AB 4EWEA 1AR81 3POYA 2QJVA 2LRPA 5H9QA 2WFF1 5DUXA 3SH5A 3USUB 1GMMA 2RM23 2ZZJA 3DCQA 4PT6A 5I0DA 1YYNA 2PHFA 4LBLA 1GYKA 2XONA 3VKNA 3ZN6B 3NQHA 2DWRA 5F5CA 3N9OA 2ZGTA 4P00B 2VVFA 2Z69A 3WG4A 2DU1A 4HVRA 3WR0A 1F35A 5HCBA 4OQ9A 3AL5A 3E1F1 3U0ZA 2X8KA 3NO8A 4GWNA 5E1RA 3MHZA 1FMD1 1L7LA 2A6WA 1RUE1 5GLVA 5LBEA 3GNEA 2H0BA 1H30A 3AVRA 3UGFA 4CP0A 4XOGA 5FP8A 2PLV1 2ZKLA 3H8XA 1KS5A 1RHI1 1COV3 2JX9A 1ODNA 3SQOA 2AEZA 4UFMA 4FXGB 5FKCA 2VZVA 3MF6A 2KM2A 1GZTA 3GBGA 3DXUA 3NJVA 1Q8QA 1S2BA 4R8HA 5HBAA 4HPKB 3IIAA 1RUI3 4J1XA 4QQLA 5A3OA 5LBFA 1WMEA 2Q8CA 4PQ9A 2ZGKA 3TBDA 4BLIA 4COWA 5FZCA 2HYXA 2J7MA 5CFCB 1IOAA 2JE7A 1F15A 4CDQB 5C5TA 2BGCA 4BA6A 4Y3OA 4CDUC 2PTMA 2C9AA 2WZR1 3I2JA 1MS9A 1ODMA 1UY4A 4INDA 4RS5C 3MO4A 2GH2A 4AEDC 5CFDA 1RUH1 1RITA 1LOFA 1R091 2PHDA 4QB2A 1MZ5A 1AF9A 4UW5A 5F3GA 5A70A 5A6YA 5JIUA 1VRH2 5T5LA 3ZKYA 4W6YA 5EFUA 1TME3 2AENA 3I4IA 4AGRA 1BXHA 2PQSA 5FPXA 2YC4A 4RHV1 2C0ZA 2CNAA 4CUBA 1K3IA 3I49A 4AG4A 1OPMA 2P34A 4DXSA 1EPWA 1O7FA 1C28A 2VZ3A 3DYOA 1ZNPA 2GC3A 2W1SA 3K48A 3V0AA 1GNYA 1Y7BA 4COUA 1RIRA 1AR92 5K0UB 4HN1A 2OPKA 1NCRB 1VAMA 4IE5A 2CAVA 1PM4A 3PVBB 2GNTA 4OQ8A 1MVEA 5BNPB 5LK5A 3ZR6A 3DYPA 2JDHA 1DBNA 1W6OB 5L9RA 4CDWA 4NE9A 4DXRA 4N53B 4AEJA 2Y6KA 3WDXA 4MXWB 3K51A 3V64A 3RG0A 3RRDA 4J25A 2P6HA 4HVOA 2QQVA 4QQPA 4KU7A 5F39A 5IW0A 3DGTA 4XFCA 3B02A 1G9AA 1J84A 5FY7A 4N9IA 2E7AA 4ARYA 2WNUB 1O8SA 1Z7S1 2ZHNA 5ERLA 1WLCA 3IBMA 2EAAA 3KD4A 4YM0A 2ERFA 1VBB2 1LOBA 2IZWA 5EZWA 1W2UA 3RYPA 4YZ3A 1UIJA 3HR9A 1IPKA 1UKGA 3TNPB 1BBT2 5LB6A 4QKDA 3DKWA 5F8PA 1QJEA 3E6DA 3AC0A 3OUIA 1A6CA 3AKSA 3V56A 2BQPA 3ZFGB 5T55A 4DXTA 2YG0A 4YW4A 5GLZA 1FV2A 1MS4A 2JG9C 5IWFA 3PUAA 2HEWF 1UIKA 3DV8A 1JMUB 1BVP1 3MW2A 1NT0A 5D2AA 4IV3B 4CEYA 3ZOIA 2Y6LA 2CV6A 2R0FA 1CAVB 1BKZA 1HJGA 2K2SA 2YU1A 1UN1A 3VDBA 2QQIA 3CZJA 5JI7A 4WZCA 3WXPA 3VD7A 4QX8A 3BOWA 4HKWA 1WCSA 2HYKA 2W87A 1AYM1 2LW8A 3IAPA 3SNMA 2HWD1 1S0JA 3UJQA 1JZ5A 1H2LA 1VRH3 1V9U1 2NN8A 4AFBA 3ILFA 5JZGB 3I59A 1CR7A 2XPJA 1POV3 3WF4A 5A6QA 1RUNA 1BLZA 3ZM8A 3ELNA 4LORA 3WY6A 3IAQA 4AVBA 1IPSA 4DMIA 3BU7A 3CIHA 4UF0A 3I2OA 2ARBA 1ZREA 1IQDC 3TN92 3WLUA 2EIGA 3LKJA 2JE8A 3IDAA 4GMP1 4WZFA 1W8FA 3SMHA 3WNPA 4XPVA 2VCCA 1XJAA 3WDUA 2QDNA 3RYRA 4AFAA 1H8TC 1NA1A 3C8XA 3THPA 3POWA 2DUPA 3DEMA 3RPQA 2Y60A 3I2DA 5FZOA 1ENRA 4XF0A 2C24A 1HQLA 1KFXL 2X29A 3ZXJA 5A3UA 4XDPA 5FZ8A 4Y1XA 4XFAA 4FP2A 5FREA 5C3RA 2QQUA 3UESA 1E5SA 1WCUA 2WO1A 3DKQA 2OXBA 5F5AA 1N1VA 4P9JA 4NIAA 3U11A 2BP6A 4FP3A 3I3BA 3JU9A 4UOJA 3T1LA 4KGGA 1B35A 1EYBA 1ZBA2 5CG8A 4BHPA 1Q8SA 2VW0A 2WN3A 1YUDA 2RMU3 3A23A 3POGA 2ZXQA 1Y9MA 4GALA 4OYUA 5A32A 3CZUA 5ABJC 4XC9A 4JQTA 4Q4V1 3PJQA 1FT9A 3UGHA 3MYXA 3I2IA 4QQ2A 1VB4A 4XHXA 3H3LA 4J1WA 3C7OA 2RS53 3KCCA 1N1TA 2SLIA 3RFRA 1W9FA 3SKJE 2J1TA 2ZS6B 4XURA 5LEKA 3OYWA 2NM1A 2D6NA 1SFYA 3H50A 3MFCA 1TNRA 2BFUS 2FBEA 3H8UA 3WNKA 1MS0A 1OUSA 1UZ0A 2RDRA 3F2ZA 3Q9OA 4LHKA 1CQ9A 1YNAA 1PMHX 4FPYA 2QTWB 3VBSC 4BE3A 2WSVA 3OBZA 5F3IA 4URAA 3H1MA 5FMOS 3FLRA 3TYJA 3WDVA 3CDZB 3TNQA 5BY5A 4DFSA 3TN93 3GHNA 1RL3A 3VV1A 2ZAHA 5F3EA 2ZMNA 4BZ4A 4YW5A 3Q8BA 1Q3EA 4KWLA 1HRI2 2RHPA 1H4GA 1XNTA 3POFA 4E4HA 3ZFEA 1O5UA 2CY6A 4CDXA 2ZTNA 2BUKA 5I8TA 2OKXA 1O4YA 4GWMA 1HN1A 3QACA 5FUNA 5IATA 5JXIA 2OT7A 2XBO2 3ZO0B 1AR73 2QQKA 5FFOC 1POV0 3S5AA 4IERA 3JB4C 3MV11 1NXMA 1ULEA 3EMRA 2DVDA 3ZYFA 2FDGA 1UPIA 2JDKA 2A6VA 2AYHA 4MH0E 3T1MA 1ZBA3 3LPGA 5BNOA 3PL0A 1YO8A 4BQ2A 1W6QA 4OMDA 1YHFA 4Y22B 2XQXA 2OZ6A 3ACGA 3ZXDA 1W2NA 5F1RA 5FYCA 2D6LX 2ZHKA 3TOJA 4EYUA 1GP5A 3B3QE 4B4RA 1RXGA 4H7LA 3DUIA 4XBNA 1X9PA 1HJFA 4QHZA 4Q4W2 3VZKA 2GAUA 1OLRA 3FLPA 4GB32 4NRPA 4QX0A 2Y34A 2GU9A 1W28A 4K7JA 1GNZA 2RV9A 3DPRC 4Y24A 1ZX5A 2K46A 2ILMA 4HZFA 5IHRA 1YWKA 1J3RA 3CJIA 4OFGA 4OUEA 4PIXA 4CCDA 3RZHA 1JZ6A 3MW4A 3SCGA 5LEJA 2ZX2A 4AHWA 4QPWA 1CAWA 1KQRA 2BNOA 2VOTA 2XLAA 4BB3A 2W68A 1UXXX 3KLSA 2LROA 4PBOA 2G9ZA 2ZA9A 2D6OX 1IG3A 2PHWA 4F3JA 1N1SA 1W6MA 1JYNA 1ND3B 5FZ1A 2VNGA 3MIDA 1W2AX 3URFA 3VBRC 3MGUA 1N47A 1AUYA 2DVGA 3R4SA 5DUUA 2WYFA 5A3NA 4OZXA 2F6BA 1OF3A 4P9LA 1VMJA 4TZDA 2VMGA 3VBOA 1RUF2 2GMMA 3VKMA 4QB1A 4MVTA 5T5PA 3LOIA 3OBAA 2LM3A 1UNBA 4HN0A 1QH7A 4WM8C 5A3PA 2NP0A 4TLFA 1SCSA 1DYPA 2YFUA 1PVC1 4F7ZA 1POQA 5DDJ2 1MPXA 3PTYA 4A2UA 1S0GA 1DF0A 2OA2A 3UETA 2VCBA 4GJYA 3H3ZA 4FPKA 1BVVA 5FZAA 1C4RA 1RGSA 4JGYC 4XF4A 4QXHA 5BPXA 3EHKA 3VDDB 4BQ1A 4LBJA 3FHAA 3J4UH 1W90A 4RQPC 2RS11 4XJ9A 2TEPA 4QQOA 3UJOA 3VBFB 4BQWA 2VNVA 3WNXA 5FXXA 2HWC1 3MW3A 3WG2A 1APNA 4MV2A 1VBE1 1S1AA 4HXCA 1EY2A 4K1ZA 2QFEA 4XXPA 3JUUA 1FI2A 2HEVF 2V73A 1Y9GA 4CEWB 1AYN2 1QJU2 1RUG2 4C91A 3I3DA 1E5IA 4PDWC 1VAVA 5FY9A 2JXAA 4A44A 1EAH2 1W6NA 3GJAA 1ALYA 5KXCA 1EP0A 4CCNA 1VJ2A 5BNQA 4JAAA 4S2GA 3ZIXA 2X5IC 1RVF1 2LALA 1SPPB 3AP5A 1S0EA 4L92A 1WCQA 1UMHA 2RDNA 1YFYA 2IXLA 2QVSB 2VQUA 4YVWA 1W2TA 1LJ7A 2VUJA 2YPJA 3LWCA 5CISA 4BISA 1Q8OA 3FN9A 5FWEA 1WLTA 3M3QA 5H9PA 1ASJ2 2HWF1 5FWJA 4AVVA 2GMPA 3WX5A 3B5LB 5DAQA 4LITA 2XKPA 5ACA1 1T6GC 4RR3B 1K12A 4ZONA 3ORJA 1QH6A 4Y1ZA 1OA4A 5DZFA 4QGNA 5F6KA 5FYZA 4PLMA 1GWMA 2PYTA 3JD71 2R6QA 4TN7A 3ZMOA 5KC5A 1YQ2A 5LZ6A 1SBEA 4C90A 4LOTA 5H9SA 4Y20B 1NE4A 1RUF3 2A5ZA 2WJSA 4CCEA 1EV11 4LK6A 3SC7X 4EROA 4ET7A 1GBGA 1PO21 2JB4A 4HETA 4NPMA 3WQ1A 3E6CC 2ZBJA 2VW2A 4LXLA 2PHTA 2Y38A 1DQ1A 5I0TA 2ZGMA 4QPGB 5DDJ3 1C1FA 1Y4WA 3BYWA 3OUHA 1YQCA 3HBZA 3PUIA 5FLJA 3VD5A 4YPJA 5C9AA 4Y5TA 1FV3A 3LIHA 1ND2B 4LK7A 3WW3A 4Q5OA 3U4SA 4JRAA 4FVVA 3USUA 1ST8A 4A7ZA 4DQAA 4Y5Z0 2A6XA 2JDYA 4AQTA 4IEVA 2UWAA 2QQPA 4PHZA 2EXJA 4HBNA 1DZTA 2TBVA 4DS0A 3KQRA 1NY71 1U5IA 5BNNB 5HCAA 1LOGA 1RUJ3 4QKFA 4FPHA 4L9BA 3I7DA 4EN0A 1PK6A 1UF2C 2RDSA 3OEAA 1DCSA 1EAH3 1S0FA 4Q4Y1 2JG8B 2JIJA 4F83A 5LA9A 4IW3A 3MI8A 1PIV1 3BU0A 2P1BA 4IGQA 3N9NA 3UKTA 5B4XA 1ZM1A 3QH7A 3FL7A 5FY5A 1FMD2 4Q4X1 3BALA 1TNFA 3O14A 1SDWA 1YFUA 3M3OA 3KHCA 2DTYA 4JX0A 1OLME 1VBD2 2EF6A 1HV0A 2J22A 1SLLA 2PLV2 1RHI2 2VMHA 2VZOA 5FK7A 2WC2A 2BBVA 5CFCA 1ASJ3 4LKEA 3OD0A 1L7QA 5APAA 5HCFA 2EVXA 3WEZA 1O3SA 1JUIA 1CZTA 4HSLA 4YG3A 1HRV1 3RYKA 3RSJA 4AOCA 1PGW1 2Y6GA 3H9AA 4XUOA 4DUWA 2E33A 2J1RA 1QJY2 2ARCA 1CIYA 4JGZB 4KNCA 1DU3D 5FUPA 4AFMA 2VNRA 1OPOA 2IXHA 3T30A 4YFWA 1STMA 2JDZA 2R061 1LEDA 4LKDA 4C0BA 1IHMA 4E8CA 1V0AA 5IVEA 3O12A 1DGWX 1LOEA 4H14A 5A3TA 2MEV2 5FPUA 2ZABA 4XFIA 4QX5A 3VBUB 5FCCA 3WUDA 4AR2A 4GZ9A 2ZHMA 4WM7A 4YZ4A 5KBFA 4YW1A 1TMF2 3LCPA 5L73A 1W8NA 3FWEA 3NKGA 4XEZA 5CFDC 4G9SB 4A6OA 1LOFC 2HH9A 1RMU1 1NCRA 1JZ2A 4I01A 1MEC1 1SLAA 3I2FA 1G7YA 4N43B 4QX7A 4UFIA 5JIAA 5BNPA 3ZYGA 1W6OA 1JYCA 2VZPA 3KWVA 3LEMA 5K9YA 4W8JA 4N53A 2VTXA 3SCFA 2Y6FA 3CLPA 1OLMA 1NOVA 3NNLA 5KHJA 1ULGA 3N9LA 2D6KA 1M4WA 1FXZA 2WLQA 1BHGA 3UKNA 2GC0A 2WNUA 5IUQA 3RMXA 2D6MA 1D4M1 1J83A 5IAXA 4ZY9A 4BJ0A 3AMPA 4KI5M 2ADDA 4OCTA 2GNDA 1UCXA 4CDWC 3T0AA 4L0PA 2VZRA 4P5YA 3WDTA 4OUSA 1LGNA 1Q43A 3BKZA 3K3OA 1VBD3 1X8EA 2EXHA 4CCKA 1LEMA 3UYJA 2PAMA 1DQ5A 1G86A 1PHMA 1Z7S2 4UW4A 4LBQB 4ZU5A 3WP5A 5IK5A 1ZRFA 3D0JA 4YG0A 3CNAA 2QQWA 4LHLA 1BJQA 3H8OA 3K77A 3POIA 2FQPA 1CIWA 2C4XA 4UFJA 3MIFA 2WQZC 4BQXA 1G9DA 4P9IA 3SXWA 5AC92 1XSQA 1FPN3 1QJY3 5FQ0A 4YGCA 3ZMNA 1JN2P 5EHDA 2DCTA 4M0HA 1HB1A 1FOD3 4JKKA 1OVPA 4AEDB 4D6RA 3NAPA 4LQRA 3Q8AA 4RFT0 1X82A 5CNAA 5C5UA 4IL7A 2MEV3 3ME2A 3J7LA 2CWMA 1W8WA 2B45X 4WVMB 1UU5A 2R0HA 2R49A 4CEYC 4DPNA 5GM0A 4L11A 4S2DA 5T52A 1RYYA 2DVFA 1TMF3 2HWD2 4O9EA 1BEV1 3V65A 4GWJA 3VD3A 4XE9A 1XC6A 3ETPA 2W39A 5EPAA 1CAUB 1Q5OA 3ACLA 3ILRA 5FZ3A 4ASLA 4FTBA 4LIVA 1ULPA 1W8OA 2D3RA 1VALA 1VBC1 1GLHA 4MGZE 3ZFFA 3O1PA 2YXSA 3IT8A 2Q8EA 5FP9A 5L7OB 4PIYA 5C6CA 3OY8B 4XABA 2J1SA 4AI9A 2XVLA 3FLTA 3IMNA 4QPYA 3RWNA 1VBA1 4XACA 1EPZA 4ES8A 2PA7A 3VKFC 1SCRA 3S7IA 3P3PA 5HCHA 3HQXA 3HQUA 4CCMA 4XUTA 4AVCA 1N3QA 5DAXA 1KEXA 1A78A 5FY4A 1DZRA 3VZOA 3LQCA 5EQUA 3PVEA 1R1ZA 4AI8A 4BQYA 5L19A 2HWE3 5F7UA 2L9LA 3WVJA 2JE9A 2RR11 1O3QA 1TVGA 4A45A 4HFSA 1NA1C 4IV1A 3WDWA 4UYBA 1UMIA 4KQ7A 4NHXA 3VGIA 4XZUG 1RJ7A 5KHKA 1J3QA 2DFCA 4LBMA 1DLCA 3A0NA 2FZ2A 3CMGA 3E97A 5DG2A 4K3UA 1XYPA 2FZ1A 3JQWA 2J1EA 1QJX2 4BCUA 1YI9A 4BLJA 4D3WA 4OHYA 1DQ4A 2ZMLA 3A22A 2V5YA 1MQTB 1B35C 4MGTA 1W0NA 1SHWB 4Q4V2 5FPBA 2J42A 4I3GA 5AC93 2EIBA 3AKQA 2KXLA 3U4XA 2XWBB 4P9YA 5A3LA 4MHUA 4PCRA 2WIIB 1JTZX 5HV4A 3M3EA 1JYWA 4QHBA 3J9SA 1LHNA 3TAYA 3BCWA 2P3IA 2IXCA 1GV9A 3KCXA 2ET1A 2XLFA 2WA3A 3RZZA 2AACA 2HLEA 4FT8A 1JYVA 1PO11 2XJUA 3IZOA 4BH9A 2WZEA 3B94A 1AR61 1SLBA 4M00A 1A34A 2I2SA 4ZZ8A 3O1MA 1WKYA 2QE3A 4OUMA 1B09A 1KJRA 3VBHB 4CXXA 1K42A 4OZOA 3PTRB 3N3HA 5EXOA 2NLRA 1HB2A 3DF0A 2GDFA 1H8TB 2VMDA 4M3CB 1DIWA 1QEXA 4NIHA 4NIIA 5AVPA 1GP4A 3KVAA 4LO7A 5H9RA 2W47A 4JTNA 4KGQA 1X33A 2VBDA 3LPFA 3VKOA 1ZBE2 5FOBB 5IVBA 1HV1A 4DINB 2YDEA 2C26A 3HT1A 2RVAA 1PK6B 1OFSA 1UU4A 2IUWA 4WVZA 3KF5A 2B5HA 1LODA 4QGMA 4CCJA 2BFUL 1AX1A 5FYMA 2WR9A 3ZFEC 4CDXC 4KL1A 1KRIA 2QUOA 1Q8VA 2J1VA 3EQEA 4P9XA 2VXJA 4R4XA 5FMOL 4ISQA 3JB8A 4O61A 3MIBA 1QJX3 1QF3A 5A80A 2WN2A 4XCBA 5C4WA 3HQRA 1C5HA 2IXIA 4AVAA 1Y3TA 3MIHA 3G6JB 5FZ7A 1P8JA 2UYAA 5FZIA 5BNOC 3EJKA 1XU1A 2RJLA 4NAMA 1T2XA 3NRUA 3RWKX 3CKHA 1MS3A 3WQBA 3D82A 1O3TA 2BVBA 3FX3A 4LO6B 1R081 1YIPA 2GNMA 2FMDA 5JOXA 4IEPA 1LOAA 2HBUA 1UOGA 1V6LA 4QU1A 2Q8OA 3VHRA 3O1VA 1CONA 2BWAA 4HKOA 1W6PB 4XILA 3RQ0A 4D7YA 1UY1A 4JDMA 4Q8LA 3SEPA 5JCTA 2BVVA 2FCVA 1ND3A 2YROA 4FTSA 4OI4A 4A3XA 4JTOA 3OPZA 2C6SA 1UYZA 1DGLA 1LOCA 3PIJA 1HKDA 3CJIC 3OGVA 2PHXA 3KSCA 2HEYF 4OHZA 3EYPA 3RS6A 3CF6E 3MUY1 3PDQA 3AB0A 2XLGA 3HMYA 4MO3M 1VPHA 3JBG1 1I5ZA 4TXWA 1M06G 3TB0A 3LSDA 3TRSB 3HEIA 4YNIA 3V0BB 3H1YA 1NLSA 3GCWA 4OMCA 3CJXA 3DYMA 4TWTA 4IEYA 4Y33A 4B3NA 5FMBA 2VQAA 2ZKNA 1DQ6A 3M7AA 1V70A 3AX4A 3T2QA 4BXSV 4YVSB 3T08A 1FATA 2VZUA 3W20A 5B2GB 2V09A 2ENRA 5FZEA 3B00A 5LWBA 1QQP1 1ZBE3 2XB6C 4LTAA 4XDQA 3AYEA 2WQ4A 1LESA 1UKRA 3VDDA 1UY2A 3VUOA 2VOVA 1DDLA 3FBMA 2D40A 4I0WB 3VBOC 1XU2A 1R1A2 2A3YA 3RJ2X 2R1BA 2DF7A 3D8CA 1UAIA 2R30A 3UL2A 3NKTA 3KVBA 2JWPA 3CO2A 1XNBA 4KWKA 1ZZ6A 4MYEA 4FPEA 4CP9A 1LHOA 4LJHA 1PZ9A 5M0TA 3VB9A 5I0RA 3C7EA 2VD7A 4LBNA 4AAXA 3J26N 4Y4RA 4CEWA 4GMP0 1N1YA 1H9WA 1SFNA 2HWB1 4LIUA 5LATA 3U37A 1AJKA 2ZGQA 3GALA 2JICA 3GGLA 3WF2A 1CAXB 1D0GA 2GH8A 1OQDA 3QCWA 2F17A 1RUD1 1SLCA 1XXNA 2VG9A 4CPBA 3DPRB 1H2NA 1YQ6A 2E6VA 1UU6A 2CGPA 4QXKA 2A6ZA 4B4QA 5DUWA 1GOFA 4QDQA 1CX1A 5F37A 2GP5A 2Y0OA 5CB7A 4TTGA 2FMYA 4CYDA 1PMJX 1NG0A 1BYHA 5A33B 5JAXA 2AC1A 4BMBA 4EE2A 3MFAA 4RR3A 4SLIA 2E32A 4RGAA 1WMXA 3HNYM 4YGEA 1IS3A 1OA3A 2PHUA 4JC1A 2YYOA 1QGLA 1RTVA 4YVWC 1FAYA 1LAJA 3WW2A 2O1QA 4YW6A 4NVPA 3AYDA 4BM8A 1OOPA 1AL22 4QX3A 4AFCA 4NMIA 4AE2A 2QNKA 1JHNA 1AR93 3W21A 4ZPIA 2A75A 4CP2A 5G04L 2GN3A 3LDRA 2RDQA 4WM8B 2VVEA 1ZZ7A 2D3PA 1WGPA 2XXZA 1RUC1 4FO9A 4YLZA 1C8M1 4AGGA 3ZXGA 2XVKA 4KU8A 2KA3A 3FUOA 2VY0A 3M2MA 1H0BA 5FZMA 3U78A 1AXYA 2W2IA 1NCQB 1R1A3 2CWSA 4JGYB 4MHRA 2D44A 2Q1MA 4R4ZA 4C1WA 1UZWA 4RQPB 4XJWA 3AXEA 4XW3A 1CZVA 4Z82A 4DEQA 2FD8A 3PUHA 1QXPA 3R05A 2BOJA 2WO3A 3NJZA 2JDMA 2RM21 5HV0A 1VBB3 4IDZA 4COVA 3KS7A 5C9AC 4KWUA 4AL9A 3THDA 4TYSA 2ZPXA 1BBT3 2JG8A 2QDRA 5JPMB 2VCMA 4ZKTB 4R9BA 2VMEA 5DMYA 1X9TA 1NY72 4PDWB 3WCSA 2BDRA 1XBFA 2XH6A 3LA2A 2X05A 1DP0A 5T54A 3GBFA 2AEYA 1IKPA 1S55A 1ZZBA 3M3CA 4D6QA 2X5IB 1MS8A 5FMCA 3NJXA 5L9BA 2A7AA 3N36A 3R4UA 1COV1 1WBLA 1IG0A 2CL2A 2UURA 4HMZA 1LB2A 1ZRCA 1UYYA 1PIV2 1PK6C 2R072 2WDBA 3WP4A 4YGDA 1RUI1 4XF9A 5FRAA 4F8AA 4Y4YA 3AVSA 3LF7A 5JDBA 2UY9A 2IXJA 2X09A 3AZVA 4JCKA 5C3QA 3MDPA 3O1OA 2I74A 4EJRA 3TEYA 1E5HA 1VE0A 2CGNA 5CKNA 3N35A 1AL23 2Y0IA 5CIRA 2VUCA 1J1LA 5CFCC 4AQ6A 3VBUA 4X8NA 4K40A 2W1QA 1BQPA 1WW5A 4LOSA 3OPWA 3WF3A 5JPNB 2GN7A 1I1EA 3DXTA 2WNVA 1TME1 5C3PA 2RS32 1US3A 4AK3A 2WL1A 3MICA 2FHRA 3ILNA 3POEA 2ZGLA 4H3WA 4B7KA 5LRSA 4GKXA 5IVYA 1U0AA 4Q8KA 1XPWA 1I9RA 3VL8A 2ZEYA 2WT1A 1LNSA 1HX6A 4WM7C 1Q8PA 1KDKA 4QQHA 4XJ8A 2DBNA 2G9GA 1NQJA 3BB6A 3H7YA 4TLGA 2X10A 4PBPA 4XIKA 3A0KA 3OCPA 3CL1A 2E63A 2XJTA 1NCRC 2JENA 4R52A 3ZYJB 2YHJA 1XYNA 3HAGA 3W59A 1UL9A 5BNPC 3NV4A 4E4ZA 4EN6B 4D7SA 4BQ3A 4HANA 4N53C 1LECA 3WOGA 2YU2A 5FYTA 4ZZ5A 5IT6A 3BODA 4ONUA 1K5MB 3IPVA 3ZXKA 1LCLA 4NRQA 5F9TA 4XMIA 4NIGA 4YZ1A 4HONA 1PM7A 4A6SA 2WNUC 3BPSA 1AZDA 4P08A 3OBRA 3HN3A 4Y5SA 5JVVA 4R9AA 3OPTA 1LU1A 2QQOA 5EWSA 1GSLA 5FLIA 4IETA 1HLCA 1ULOA 4EV0A 5HI0A 4DXZA 3AP6A 5A1LA 5BUVA 4EN8B 1A8DA 5JR2A 4B1MA 1GWLA 2ZZQA 4LULA 5JI9A 2R042 4QMAA 4XQ4A 1W05A 1XNKA 1CJPA 1SLIA 4LLOA 4Q2FA 3FHQA 3BVCA 2VUAA 1XRUA 1TG7A 2Y8KA 3AJZA 4WVVA 1HRI3 2E31A 1VRH1 4IQPA 2UWCA 3E6BA 4LR4A 3ZR5A 2RS33 3PVNA 1POV1 2CDOA 2W92A 2LS6A 2XBO3 1YEWA 4N8MA 5L7OA 4N90A 2P17A 5DABA 5FZDA 3AL6A 3NAPC 3OY8A 1JODA 1W99A 5IFPA 1S4CA 4MADA 3P3NA 3KT4A 1LHWA 1YJKA 5FXVA 1BEV2 3WQ7A 3U75A 3HWJA 1X36A 2VW1A 2EA7A 1OD3A 2DBIA 1AXZA 1GUIA 2UU8A 1CZSA 2A71A 1NLQA 4K6BA 2O8OA 4O7XA 3N9MA 2KR2A 5GLTA 4NO4A 3LDBA 2R16A 3S7EA 2BW8A 2ZAAA 3ES1A 1V6OA 3LE0A 3ZFFC 4COYA 4YM2A 2W0XA 5FZLA 2DYCA 2IVJA 3KZ4C 1AL0G 1U5YA 5CKMA 5EJZB 4Q4W3 5GZDA 1IKQA 4H55A 1HXS2 1QXRA 2RJ2A 4GB33 3MUZ1 4XAEA 4M3CE 1HDKA 1OKOA 1CJDA 2FCTA 1WA6X 2W91A 4XJZA 3P6BA 3NV2A 1YC61 2RR12 4CDWB 2CSGA 4QM9A 2DU0A 3U1XA 4E9KA 2WS92 2RMU1 2XKOA 4Q0SA 4AXOA 5JMOA 3ZKUA 1MQTA 1XE0A 3NMBA 1CVNA 3O0XA 4GH4B 5F3CA 1GZWA 2BJSA 1CPMA 1E5RA 4LBOA 2V5DA 4E27A 5A7WB 4IV1C 4Z92B 1ULCA 1UMZA 1OBNA 1D7PM 3ZDSA 4FAGA 3LEIA 2RS51 1CWPA 2A70A 2C1FA 1BK1A 4ISRA 4OVEA 2R043 1NKGA 2JD9A 3AKRA 3H42B 5A7NA 3INAA 2ES3A 3OOXA 4QKNA 1EUUA 4V1PA 5D8AA 5ANNA 4ZU4A 2X53S 2XL9A 2BGPA 2IC1A 2GSYA 5EIYB 3S0MA 5IK7A 1I6XA 4UAPA 5FY8A 3J8F2 3TEXA 5LBBA 4CEYB 4PLNA 1CPNA 1OKQA 3FC0A 3O5SA 1H1MA 3VBHA 3O0VA 1YRZA 4U2AA 3OGRA 5FDBA 3ZX7A 3WV6A 1GP6A 3S57A 1F5FA 1JOPA 1PO12 3OBTA 4M3CA 3TN91 1AR62 5GLUA 2VQ0A 5KR7A 5C3OA 3KM5A 4AEKA 4CCCA 5HXVA 5FTTC 1V6KA 2IWGB 2PQQA 3K46A 4LKSA 3WNLA 3ZN6A 1OURA 1S2KA 2VBBA 3LB9A 5AVAA 5FZ6A 5DAVA 3ZDVA 4K8FA 3T3YA 1GWKA 3ZYRA 2AZ5A 3PVOA 4XQWA 1G6NA 2VZTA 1AR71 1Q56A 1S0IA 2RJKA 1LGCA 3M70A 3EO6A 4CTEA 1AR82 2CAUA 2D5FA 3KV5A 3NWKA 3POSA 4QPIB 5FYHA 2WFF2 2DURA 1HXS3 4AHZA 2QBXA 1AYN3 1QJU3 1RUG3 4KG0A 2AH2A 3Q8CA 1SLTA 4KMQA 4X8PA 1CX4A 4FPJA 5FZOB 4IE0A 1IS6A 2YY1A 1ZBA1 3USSA 2OQ6A 1GICA 2WS93 2Z5WA 2QZ2A 4AI0A 3HVDA 5J37A 5A7SA 2BOIA 2VE1A 4HPKA 1W04A 2O8QA 3RZLA 4XHBA 1RUE2 3SISA 2QZ3A 4P9WA 1DLLA 3IB3A 3R0RA 2EIEA 3KGLA 3HPNA 4DRVA 1TE1B 4NHMA 3UT0A 1S0DA 2WLPA 2VZSA 2JEMA 2QQNA 1B35B 2W46A 2VJXA 5F2SA 5IK4A 3I3EA 3LDKA 5C8CB 2F4LA 4CDQA 5FZBA 1QHDA 4LKFA 4Q29A 2XGXA 1PNGA 2MPFA 3PMSA 5A32B 5LBCA 5GZCA 3W5MA 1A3KA 4XFHA 2XHNA 3TEZA 4P14A 1RINA 5C4WC 2EXIA 4N7UA 1DYOA 4YRDA 4CPBD 5J48A 5A1AA 4Z07A 4GJZA 5KXDA 3W5NA 3M4FA 4O65A 5JOYA 3M3IA 2O0OA 3J8F3 4L99A 4MG2A 1PX4A 5KXEA 1GKBA 1R082 4NWWA 3CU7A 2WZR2 2YC0A 1N3OA 3FFZA 4FFGA 4Y26A 2CGOA 3AM2A 1ONAA 2NZ9A 1YI7A 5JWPA 1RUH2 2YPDA 3Q8EA 3OYWB 1R092 1WA4A 4YARA 2FDIA 1BMV1 1ZYBA 4Q0UA 5F5IA 4FSJA 3CHXA 4QDSA 4HVQA 1SFPA 4QM8A 1W9TA 3AMHA 4QAWA 4IE4A 4Q1RA 5FP3A 5K0UA 4XF3A 1ND3C 4YW3A 2CTVA 4YVSA 3OG2A 1QXJA 4RHV2 5CKQA 3WG3A 5LY2A 1GOGA 4NUBA 1XYOA 5I8YA 3JBG2 1O91A 4MUVA 5LA1A 1PGSA 4XTPA 5CG9A 3RZGA 1Y43B 3H1WA 4MXWA 4QDRA 2A3XA 1AR83 4I0AA 3VD4A 3NVCA 2EALA 2WFF3 4S2FA 1OD5A 1ENQA 1QQP2 4ORFA 2J1AA 5FIXA 2F4PA 4HL0A 3ZFEB 3VZLA 4CDXB 4GWIA 2PMWB 5FYBA 3RNSA 4CA9A 3SLIA 1RC6A 1KITA 3FZ3A 3AZWA 1WLWA 4BU2A 2XG3A 3PLQA 5JLVA 3S6PA 4HKLA 1JZ3A 2WUHA 1FMD3 3H0OA 5FYIA 3VDDC 4LHSA 1RUE3 1DG6A 5CYYA 4OLLA 3WW4A 3H8RA 2XOMA 2WKKA 3N9PA 4ZHNA 2WT0A 2WZ8A 3C2UA 3DL3A 3GDBA 3ZFGA 2PLV3 1RHI3 3IMMA 2P4EA 1CN1A 5JOZA 3NSTA 3SEEA 2FDJA 5GJ6A 4JKLA 3B01A 1GZCA 4IV3A 2VOKA 2WINB 4G4FA 4B4PA 1CAVA 1UYPA 2E7QA 5KHIA 2EIDA 2BEOA 2WWJA 5EJ1B 2ET7A 4GD4A 4CEWC 4HOOA 4Y1UA 4CDUB 1RUD2 3E5XA 5CVRA 3SH4A 4FPCA 3ENRA 1RB8G 1ULFA 4RS5B 1VAKA 1GANA 5JXJA 3IDEA 5JZGA 4NIDA 3VZMA 2DVBA 2NPIA 2WZR3 2GALA 3ZPOA 4Q0QA 2WZPP 3POJA 3B93A 4MSVA 4FFFA 4QXCA 4DY3A 1F4AA 2VULA 1RUH3 3GZEA 1R093 5HPOA 3CJIB 3DN7A 4LUKA 1AYM2 1QDOA 5LA0A 3AKPA 5IJRA 1V9U2 3AJYA 5KHGA 1XE7A 5I0SA 2Y6JA 4XJUA 3RI9A 5FO9B 5CEHA 1A8MA 1GQHA 2YGMA 4RHV3 4RR3C 2D93A 3QOPA 4GAZA 1W6MB 4FQZA 1GNHA 4FPOB 4NPRA 3EBRA 1RUF1 2YB7A 3PUQA 3WSOA 2MNGA 2LUWA 3A4UA 4K21A 3L9JT 4OI2A 5DAWA 5T3NA 1US2A 1KGYA 1WW6A 1YXWA 1NCQA 3ETQA 4KBZA 3THTA 5FOJB 1DGRN 4B8EA 1OOPC 1FNYA 5DDJ1 5LCWL 1U12A 2Y6HA 2B9UA 3OGJA 4XQDA 2Q8DA 1IPJA 4FPGA 3T0BA 4ATFA 1NYWA 1WD4A 3UNPA 5SV5A 2VXRA 4YYOA 1N3PA 2UYBA 2VH9A 5DZEA 3WF0A 1LHUA 4AEMA 5JSOA 4AVSA 5FXWA 3T0DA 1MS5A 3MIGA 4DEVA 4QGLA 3O1SA 2W5FA 2DUQA 1W39A 5JR7B 4CE8A 1HB4A 1RUJ1 1W9WA 1Z7S3 2ATFA 5CBLA 5JXGA 4CUAA 4X6QB 3O1UA 3K4ZA 2EXKA 1RUG1 1NZIA 2A73B 3WHTA 4I3PA 2JB8A 4PQQA 3J7MA 4E4SA 1EAH1 2DCYA 3D6EA 4D0QA 3NW4A 5C33A 2JG9B 3GZTB 3LA7A 4PF5A 5FZGA 2JDAA 1YQ5A 3NNJA 3B9IA 2JG8C 1JI6A 4MGIE 1WWYA 3FFQA 3KHBA 2WABA 5A3WA 1COV2 3NNMA 4LBQD 3KT7A 4CUCA 1ASJ1 1YIFA 2CU5A 5KXBA 3OTFA 3NV1A 4LMFA 1HW5A 1O5LA 1AYM3 1KFUL 1NE6A 2HWD3 4W6WA 4D94A 1RUI2 4A41A 1V9U3 4YVWB 4IUGA 2XL7A 2FDFA 4I09A 3T2OA 1SQ4A 4K9SA 4FPLA 4CU8A 5DZGA 2ZX1A 4DZGA 2JDPA 3IIIA 5F32A 2ADEA 4IGPA 4LLFA 1NLRA 3SCHA 4E2GA 4UFHA 1IQAA 1F31A 2BWCA 1WMFA 1SEFA 2VMFA 3RVHA 3KV4A 4GMP3 4XXAA 3KV6A 5J09A 4YWAA 1KD7A 3ZSEA 4M0NA 2B42B 4S2HA 1C1LA 1E57A 3M1HA 4IEXA 3ZXFA 1ZA7A 3VBUC 3F95A 4FQ4A 5J7MA 4U36A 3KMHA 4EQVA 4JVAA 3PU3A 4JDOA 4CZSA 4YG6A 2XHKA 2VUDA 2WNVC 2VOXA 4Y22A 1UOJA 4COZA 4CSWA 5B4NA 2ZJCA 1VB2A 2FDHA 3VZJA 2Z4FA 4LA3A 2WQ8A 3WNMA 2WO7A 1LRHA 1QU0A 1XNAA 5ABJB 4K1YA 1F8VA 3B69A 1ZA4A 4UXAA 1NUKA 2B9VA 2BV4A 1AX0A 2WT2A 2E51A 1H1IA 1K5MA 4E8DA 1V6IA 2WWUA 4Q4V3 4Z2WA 1JHJA 2OUHA 4FPFA 3IKWA 4NJ4A 3ABZA 5LASA 1Y9QA 3C7GA 5C7GA 2NMNA 4H2AA 4PLOA 2OVUA 1MZ6A 3WNNA 4HK8A 3ZLIA 3GYDA 3IN9A 1W3VA 1WD3A 2UY8A 5E8AA 4GQ7A 2D97A 1VBD1 2EICA 1XQNA 3A21A 1W03A 5FZKA 3BOPA
chains in the Genus database with same CATH topology
2XJRA 5JOWA 5F6LB 1H2KA 4O9GA 3JCIA 4BOWA 4AI3A 1V6JA 2B7YA 1QNWA 1TQ5A 4GA9A 1WMDA 2TNFA 1FPN1 4AYUA 2BNNA 1QJY1 5BYNA 4LEJA 2JECA 4AVTA 3LSEA 1FOD1 5K8SA 5E16A 3ZSKA 1MACA 4M01A 5DXDA 5FAXA 2MHFA 4WBBA 1JUHA 3C3VA 1D2QA 2H0VA 4YZ5A 2JJ6A 2MEV1 3W9AA 1WW7A 4BIOA 2P3KA 3WINE 3B7MA 4GKYA 3AMNA 4GULA 1TMF1 3WDYA 2K0GA 5FBZA 4C0HA 1YLLA 3FHIB 4LE3A 4K20A 2DVAA 3VBFA 2PFWA 3FE5A 1PVC2 5KC6A 3LOBA 3R4DB 5AFEA 3S30A 4WM7B 5LK7B 2D6PA 1OQEA 2A6YA 1UZZA 1LU2A 1RJ8A 5L7OC 4OHWA 3WP3A 2SBAA 1JYIA 2E53A 3WCRA 2Q4SA 1J3PA 2RS12 4C1XA 1KS4A 2DCZA 1YJLA 2HWE1 1ZZCA 3ZSMA 2HWC2 3GHMA 4NN0A 1SACA 1VBE2 3GF6A 3LGRA 4ZXKA 2ZGOA 4GH4A 3GBWA 3FMGA 4NR1A 1MZFA 4XIOA 3RJRA 3WG1A 3WW1A 4RSUA 1TEIA 2WFPA 3MEPA 4XBQA 5JSPA 2ZX3A 2RMU2 1RVF2 2G4IA 1MS1A 5AC91 3MPPG 1MQTC 1O3RA 2Z2SB 1DQ0A 2HWF2 3VBRB 1S0BA 2RS52 4Y20A 2BNMA 4EN9B 3AK0A 2VOWA 1QJZA 3PNAA 5K7PA 2H6CA 5ACA2 2JD4A 1GR3A 3ZSJA 2K9ZA 4CRQA 1JH5A 3AFGA 2YZ4A 4QPGA 5FQ0B 3JD72 2WNEA 1REDA 5D8AC 1ND2A 1EV12 2Z42A 3HN1A 3NAPB 3SITA 1PO22 3O0WA 4KH9A 2GMEA 3ZVXA 2DTWA 1KDMA 1PVC3 2ETEA 2G9FA 4YGBA 4UBHA 1I3HA 1MZEA 4RD7A 3VBHC 5BNNA 4QPIA 4D69A 3U07A 4G3YC 2AGSA 3ZFFB 1F2NA 2RS13 3E5UA 3GZAA 1ZRDA 4XJAA 3N7KA 2XJQA 3LAGA 3ZPYA 4BWOA 2HWC3 4DRRA 1AR72 3AZZA 1PGL1 1VBE3 3EXUA 2DV9A 4META 1OMIA 3AZXA 4OHVA 4CP1A 4Q4Y2 2QCSB 3IM0A 5C8CA 5C8WA 1QNYA 1ENXA 1D4VB 1QJX1 1J58A 4PIZA 2RE9A 1RVF3 1JW6A 4IV1B 4OI0A 2D3SA 3JZVA 4Q4X2 4AI2A 3AMMA 5EV7A 1F9KA 1XNCA 1LTEA 4YFZA 2PHLA 4AHXA 3ECQA 4FOWA 4JGZA 2QKDA 3JQXA 3G7DA 2HWF3 2ZGUA 1ZRRA 3AP7A 1FX5A 1HRV2 4URTA 4BYYA 2XJSA 5ACA3 1CD3G 1PGW2 3ZYIB 4W65A 4CDQC 4FOYA 4NHLA 2I07B 3JD73 4AW7A 1OFNA 1DYKA 5FO7B 4Z1VA 1XNDA 2R062 1EV13 1X8MA 3AFKA 3VBSB 1GZ9A 1J1TA 1PO23 4AI1A 4N43A 4I30A 4QT6A 5EJ3A 2GNBA 1QKQA 1BMV2 2IXKA 3N7MA 1O4ZA 4AWDA 1D2SA 1AXKA 4GXLA 3H7JA 1RMU2 5FPZA 1MEC2 2PELA 1NQDA 1ZBE1 1OLQA 1RUOA 4MXVA 1U5XA 5GZFA 4JDNA 1WCDJ 5K0UC 3MIEA 2H6BA 1S0CA 4XF1A 4YVSC 1PZ7A 1G9BA 2CYFA 4IEQA 4XFBA 4N7IA 4W6XA 3W58A 4M3CF 3PHMA 5EYYA 1C5IA 1H9PA 5KHHA 4Q4Y3 4LBQA 1D4M2 2AREA 3VL9A 1PIV3 2ZX0A 2R073 1GFF2 4E2QA 1REFA 4NHKA 4Q4X3 4Y1VA 4YZ2A 2N7GA 4XFGA 1O4TA 4EWDA 3WUCA 1VR3A 5A3MA 4CDUA 3QH6A 3KGZA 3PJYA 4LE4A 1CGPA 4RS5A 4IEZA 2OIIA 3L2YA 4AEDA 4WV8A 5C4WB 5CADA 1JXNA 4ATEA 1HRV3 3ZFGC 4ZU7A 4R9CA 1JBCA 3D5OA 2P2KA 2WWSA 2D98A 4WVMA 2OW4A 4IV3C 1V6MA 4Q27A 4DOUA 4MX3A 4R9DA 5IK8A 1UZYA 4Q0VA 2ZHLA 1CAUA 4EWAA 3ZN5A 2R063 1MR5A 4I02A 1DHKB 2Z79A 3ROUA 2DUOA 3MZHA 3I54A 4KWJA 2ZACA 2VECA 4JV4A 4SBVA 5CFDB 5JZGC 3O7OA 2HKXA 4AQSA 4HLTA 1HIXA 2E7TA 1AR91 1F5JA 2E9QA 2VGDA 3MLKA 1RMU3 1DDLA 1VBC2 3WQ0A 1MEC3 3CEWA 3AYAA 1D0HA 1W0PA 3ZXEA 1VBA2 4YM1A 3VZNA 4XBLA 2R1DA 3V0AB 2P3JA 5DG1A 1R1A1 1DFQA 2YV8A 1OSGA 5CA6A 3WP6A 5J96B 3AP9A 2ZCWA 1AX2A 1NCQC 1FYUA 3H3UA 1D4M3 1L3JA 1VBB1 1FNZA 4B7EA 1IGOA 2ZGRA 3AMQA 4LO8A 1BBT1 4YW2A 2JG9A 4NWVA 1MVQA 3MPBA 1RUJ2 4XZPA 4FXKB 1C8NA 2YMZA 3ZXLA 4LNVA 2W52A 2XVGA 4P9GA 5I91A 2ZGSA 2B46X 5GKAC 1NXD1 2GC2A 3N4MA 3AZYA 1IS5A 4A7KA 1IZ3A 1AJOA 2D7FA 1C3HA 4UW6A 2XWJB 1V6NA 1GQGA 3L2HA 4OI1A 1DGRA 5GLWA 4HK9A 1AL21 1H8TA 1BEV3 1LENA 3I59B 5CU1A 3RDIA 2VMIA 5T5OA 2ARXA 1VBC3 1SMVA 5BXXA 4I2OA 1PVXA 4H7MA 2XJPA 2BTVC 1OOPB 1VBA3 4LO4B 3ATGA 4YM3A 2B39A 4MLOA 4LT5A 1OA2A 1DZQA 1X7NA 1NA1B 3VHPA 2GZWA 2IFWA 2R32A 3APBA 4IEOA 4KBBA 4E4DX 4LUMA 3AXDA 1PMIA 5ABJA 5SV8A 2RR13 5AFBA 2Q30A 4WVWA 1LULA 2BYVE 1U5ZA 1H4HA 1SBDA 3OJBA 1UX6A 1OQ1A 3HT2A 2LTNA 4IEUA 4FBFA 1G9CA 3OD4A 4FAHA 1H8VA 3FBYA 3NL1A 2AR6A 4DNYA 3PMEA 1WUVA 3IDCB 1URXA 2Q5TA 4KG8A 5J3UA 4AHYA 4FOVA 4L2NA 4Q26A 3KCYA 5I0UA 1W0OA 3ZYPA 1YFWA 3SHRA 1W6PA 1SBFA 5LRRA 2R071 1K5MC 4OULA 2DFBA 5I8SA 5FLHA 5GALA 1G9FA 3VHOA 4LBKA 1PNFA 1Z78A 1HQWA 4EN7B 3B9CA 1H1AA 4RA0A 2DCJA 3GZUC 2ZOEB 3ZN4A 3OF1A 2AUYA 1WLDA 3V0BA 1PO13 1Z0HA 1AR63 4AGVA 1FPN2 1QY4A 4B29A 2YUEA 1NZCA 1KJLA 1HRI1 5E88A 1FOD2 3AKTA 2OYZA 2PHRA 2RS31 3TWIA 2VNOA 5GZEA 2OUJA 2XBO1 4YSFA 4OHXA 1QMJA 2C5DA 3AYCA 3WZ1A 2JKBA 4AF9A 4MGKE 4XETA 2WNVB 3OGGA 1UD1A 1KXGA 4BPZA 1PZ8A 3LA3A 4A7YA 1VLNA 1AVBA 4I0BA 1LHVA 1QWRA 5GZGA 5L36A 4LO5B 5D1IA 4Z8BA 4Q0PA 4L97A 2XJVA 4RL7A 1CAXA 1ULDA 3VBFC 3DPRA 2UWBA 4MGYE 2P37A 4Q4W1 5BNOB 4GB31 4XFFA 5I93A 1W6QB 2ZX4A 3ES4A 4XYXA 3ZXAC 2HWB2 2HWE2 2TUNA 4XMAA 3IWZA 5F5QA 4L8QA 1LKNA 2HJIA 1C57A 5A33A 3E5QA 3HIFA 1ZVFA 1H2MA 1R083 3M8LA 2PAEA 3WT3A 1VIWB 2XUMA 3IPVB 1J59A 3N7LA 3D4KA 1DGWA 4GH4C 3VBRA 1BCXA 5E89A 4UBGA 3VHNA 4ES9A 3WHUA 4FTEA 2WSUA 4AQ2A 2R041 2GC1A 5DUVA 5JSRA 3U10A 5T5JA 3X29B 5CAZA 2NMOA 1LR5A 1OI6A 2I45A 4BMEA 4Q1PA 1CAWB 2VU9A 3BTAA 5TSWA 3D0SA 4WM8A 2D43A 1G8WA 3ZSLA 1JOJA 3N7JA 4IESA 4UW3A 4BIFA 3JBG3 2NQYA 5J36A 4FOQA 3MF9A 3HD8B 4DY5A 1VP6A 4TSVA 1HQNA 3UK9A 1ZZ8A 2BPA2 1YCIA 4JGYA 4LHNA 1AHSA 3LZZA 3T2TA 1IS4A 1QOOA 4RQPA 2ZMKA 1QQP3 4E2SA 3VBOB 1ENSA 1RUC2 1C8M2 2ZGNA 1CESA 2VPVA 2IFRA 3MLJA 4QPGC 5KWRA 2NYYA 1LGBA 1REEA 3MLLA 1V00A 1ND2C 1WCKA 3AP4A 4JRLA 3RMYA 1X50A 3SH3A 5JMCA 3ALQA 4LA2A 4J6GA 4PDWA 1QOSA 4HT1T 3R6SA 5FO8B 3KB5A 2RM22 1HXS1 3QD6A 4ITCA 1AYN1 1QJU1 1UW8A 2X5IA 4N9HA 5BNNC 1YFXA 3VN4A 4QPIC 2HWB3 3QLQA 2A3WA 3KT1A 2D5HA 3I8TA 2Q0AA 4XTMA 3WD5A 2WS91 4QD2A 1RUD3 1PGL2 1BZWA 3BIWE 4MZUA 3VKLA 1ZZ9A 3RI8A 4AFDA 1W6NB 4RGGA 1QOTA 4FCAA 1WBFA 2YGLA 2VVDA 3IDBB 4ASMB 4GIQA 5T50A 5C8CC 2EAKA 1GZWB 3BPZA 3ST7A 4IXLA 3FUQA 2PAKA 3J8F1 3QBQA 4X6RB 4D7TA 4IEWA 2DCKA 4JGZC 5J98B 3VBSA 3UKVA 4QU2A 3VLBB 2Q1ZB 2ZGPA 1WW4A 3NV3A 5D8AB 5BV6A 4Y1YA 4DB5A 1QDCA 1XE8A 1UPSA 1TME2 3FJSA 1RUC3 1C8M3 2WA4A 3UV9A 2Y26A 3ASIA 4JQRA 1OHFA 2B8MA 2OZJA 2W08A 4P5HA 4NOTA 5EYXA 2PN5A 4HSJA 1DQ2A 4N43C 4PJYA 5C9AB 4EWEA 1AR81 3POYA 2QJVA 5H9QA 2WFF1 5DUXA 3SH5A 3USUB 2RM23 2ZZJA 1YYNA 2PHFA 4LBLA 1GYKA 3VKNA 3ZN6B 2DWRA 5I0SA 2ZGTA 3WG4A 2VVFA 2Z69A 2DU1A 4HVRA 3WR0A 5HCBA 3U0ZA 2X8KA 3NO8A 4GWNA 5E1RA 1FMD1 2A6WA 1RUE1 5GLVA 3GNEA 2H0BA 1H30A 4CP0A 4XOGA 2PLV1 2ZKLA 1KS5A 1RHI1 1COV3 2JX9A 3VUOA 4FXGB 3MF6A 2KM2A 3GBGA 1Q8QA 1S2BA 4R8HA 5HBAA 4HPKB 3IIAA 1RUI3 4J1XA 4QQLA 1WMEA 4PQ9A 2ZGKA 3TBDA 4BLIA 4COWA 5CFCB 1IOAA 2JE7A 4CDQB 2BGCA 4BA6A 4CDUC 2PTMA 2C9AA 2WZR1 1MS9A 4INDA 4RS5C 4AEDC 2GH2A 5CFDA 1RUH1 1RITA 1LOFA 1R091 2PHDA 1MZ5A 1AF9A 4UW5A 5JIUA 1VRH2 5T5LA 4W6YA 5EFUA 1TME3 2AENA 3I4IA 4AGRA 1BXHA 5FPXA 4RHV1 2C0ZA 2CNAA 4AG4A 1OPMA 2P34A 1EPWA 1O7FA 1C28A 1ZNPA 2GC3A 3K48A 3V0AA 1Y7BA 4COUA 1RIRA 1AR92 5K0UB 4HN1A 2OPKA 1NCRB 1VAMA 2CAVA 3PVBB 2GNTA 1MVEA 5BNPB 5LK5A 1DBNA 1W6OB 4CDWA 4N53B 4AEJA 3WDXA 4MXWB 3K51A 3V64A 3RG0A 3RRDA 4HVOA 4QQPA 4KU7A 3DGTA 4XFCA 3B02A 1G9AA 4N9IA 2E7AA 2WNUB 2ZHNA 1Z7S1 1WLCA 3IBMA 2EAAA 3KD4A 4YM0A 2ERFA 1VBB2 1LOBA 2IZWA 5EZWA 1W2UA 3RYPA 4YZ3A 1UIJA 3HR9A 1IPKA 1UKGA 3TNPB 1BBT2 3DKWA 3E6DA 1A6CA 3AKSA 3V56A 2BQPA 3ZFGB 5T55A 4YW4A 5GLZA 1FV2A 1MS4A 2JG9C 2HEWF 1UIKA 3DV8A 4CEYA 1BVP1 3MW2A 4IV3B 2CV6A 2R0FA 1CAVB 1BKZA 2K2SA 1UN1A 5JI7A 4WZCA 3WXPA 3BOWA 4HKWA 1WCSA 2HYKA 1AYM1 3SNMA 1S0JA 2HWD1 3UJQA 1H2LA 1VRH3 1V9U1 2NN8A 4AFBA 3ILFA 5JZGB 3I59A 1CR7A 2XPJA 1POV3 1RUNA 3ELNA 3WY6A 4AVBA 4DMIA 3BU7A 2ARBA 1ZREA 3TN92 3WLUA 2EIGA 3LKJA 3SMHA 4GMP1 4WZFA 4XPVA 3WDUA 2QDNA 3RYRA 4AFAA 1H8TC 1NA1A 3THPA 3POWA 2DUPA 3RPQA 3I2DA 1ENRA 4XF0A 1HQLA 2X29A 1KFXL 3ZXJA 4Y1XA 4XFAA 4FP2A 5FREA 1N1VA 4P9JA 3U11A 4FP3A 3JU9A 3T1LA 4KGGA 1B35A 1EYBA 1ZBA2 5CG8A 4BHPA 1Q8SA 2VW0A 1YUDA 2RMU3 4GALA 5A32A 5ABJC 4Q4V1 3PJQA 1FT9A 3MYXA 4QQ2A 1VB4A 4XHXA 4J1WA 2RS53 3KCCA 1N1TA 2SLIA 2ZS6B 5LEKA 3OYWA 2NM1A 2D6NA 1SFYA 3H50A 3MFCA 1TNRA 2BFUS 2FBEA 3H8UA 1MS0A 4LHKA 3Q9OA 1CQ9A 1YNAA 4FPYA 4BE3A 2WSVA 3H1MA 5FMOS 3FLRA 3TYJA 3WDVA 3TNQA 5BY5A 4DFSA 3TN93 3GHNA 1RL3A 3VV1