3E5UA

Ocpa complexed cprk (c200s)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
219
structure length
215
Chain Sequence
DFCGAIIPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGGNSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNTYNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKIIVYNLGELKHLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclic nucleotide-binding protein
publication title Molecular basis of halorespiration control by CprK, a CRP-FNR type transcriptional regulator
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Transcription regulation
total genus 68
structure length 215
sequence length 219
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e5uA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3e5uA01
2WWYA 4Q0VA 3ULQB 3FM3A 2XGXA 1Q3EA 2Q4SA 4JTOA 1Y9QA 1NE6A 4EJUA 4M71A 4ZZLA 4NQWA 3EDPA 4IEQA 3D0JA 4IETA 1MDMA 4U7DA 2Z69A 1QBJA 3HSRA 3KP5A 3K1NA 1GHCA 5CVVA 1WWXA 1FT9A 3TO9A 1YW8A 4EMSA 3RNSA 1Z6RA 3IC7A 4TV7A 1XGMA 5L3BA 3SZPA 3HTSB 1H1IA 2EB7A 1J2XA 3FHIB 3ZQ7A 2ZO4A 3IIAA 1GXQA 1EH7A 1BI0A 2DLLA 2W85A 5LEJA 2KIFA 3I59A 2GC1A 4JVAA 4Z82A 1YYVA 4HLXA 3BOQA 1RUNA 2A68F 3KP4A 3QU6A 4IEVA 1ZG3A 5DD4A 2PQQA 1ZZ7A 3R60A 2IJLA 5ICCA 4D0PA 1VTNC 1O3SA 3KZZA 4WXHA 4G8XA 2O03A 2VBXA 3WU0A 2FBHA 3OF1A 1E17A 2F2EA 1W7PB 3IRRA 5D5UB 4CICA 4M9ZA 2RNJA 4X6QB 2XAHA 3FX3A 1EP0A 4IHSA 2NS0A 5D5XB 4KN4X 3WW2A 1R5HA 3ECOA 1ZZ9A 4I2OA 4BQAA 1G4DA 3MAJA 4UBHA 3C7JA 5FQ0B 2H09A 4YNIA 1JE8A 2D1HA 3L9FA 2P4WA 4WXCA 3RI4A 3LSTA 2DU9A 1ZH5A 3IHUA 2XLGA 3ELKA 3I53A 4L2NA 1CAWA 3J81K 4IERA 3NKTA 4KDPA 2XIGA 5KK1A 1K7AA 3KMHA 2XAFA 2EA7A 4EM1A 2Q0OA 1DPRA 3LA3A 3GFLA 2M5WA 3LQRA 2FU4A 4FX4A 2HWVA 3DQVC 3CF6E 3KP2A 1P6RA 5DDGA 2EFWA 1U5TB 3E6BA 2YPRA 1L3LA 3IWZA 3JAMZ 5H6QA 2O61A 4MQVA 3DPLC 1IW7F 1LVAA 4TLFA 4BYYA 4EWDA 1KQ9A 4LTAA 4KIBA 3E6DA 3CL1A 2QDRA 3HRMA 5FFXA 3E5QA 3EJKA 1UIJA 3EHKA 4ESFA 4HX4A 1DZRA 4BIFA 3TO7A 1NXMA 2PAEA 2UYAA 4YFNF 4IJAA 2D5FA 3WTWC 5I0TA 3ABTA 5FLXZ 5E1WA 2CYYA 3HRTA 1YS6A 3QPTA 3ERED 4J1XA 2YX7A 4HDVA 3TOAA 4QM8A 4LMYA 2X0LA 4Q48A 1ULYA 2E1CA 1Q5OA 1T0FA 2HR3A 4AIKA 1SAXA 2M45A 2PMUA 2DBBA 4AD9A 2OPKA 4AQ6A 3BROA 3RJPA 4EV0A 4RGXA 1R7JA 4YFXF 1TW3A 2AXLA 2FNPA 4U0WA 4ENNA 4X6RB 1RL3A 1USTA 5HOOA 3N4MA 3WGIA 3U11A 4JBAA 4KUMA 4MGIE 2OQRA 2OZ6A 3OCPA 4O3MA 2COMA 4OLLA 4FBFA 1YO5C 3F6VA 3ACLA 3CJNA 1ZRCA 3GF2A 3DL3A 3R4KA 1HSTA 1QNTA 1WSUA 3V7CA 1FYKA 1R5GA 5JI6A 1XSDA 3EBRA 4M6XA 3BALA 4AIJA 1QPMA 3V7SA 3RIRA 3U0ZA 2DPDA 3VHRA 1EH6A 2CQKA 1S8NA 1FYLA 5HS9A 1D3YA 3H3ZA 3BJOA 4P5OA 3COAC 2Z33A 4OMZA 2G7UA 1ZRRA 1XDSA 1R58A 2N7GA 2YX4A 3FHZA 2STTA 3N97A 3GWZA 4ESBA 4I3PA 1YUDA 3BPXA 2D40A 1WI9A 1Z9CA 4ENKA 5LGTA 3I58A 2M8EA 2UZKA 1J75A 1WLTA 4A0ZA 2OZUA 4XFHA 4E2GA 1P4AA 2GH2A 1S7OA 3VFZA 2PFBA 4MV2A 1O4TA 5BV6A 1X8EA 4Q0SA 1TQIA 1VP6A 3WU1B 3HHGA 3SZTA 1SMYF 2AS5F 3BCWA 2DTRA 5BMZA 2EV0A 3SFZA 5CVUA 2QZ8A 3V8JA 2CAVA 3F3XA 2VOPA 2KIMA 3MEXA 2HKXA 1J3QA 3H7YA 4HQEA 2FRHA 4IEOA 3M8EA 1SFXA 4ZYEA 2PQ8A 2GXBA 2YR2A 1KU7A 2DFIA 2IA1A 4IRGA 1U8RA 1FSHA 3HIFA 4P9UA 2F5DA 3WODF 2XAQA 3BPVA 4CHUA 2E1NA 1PP7U 4UNOA 4HSLA 1SQ4A 3HHHA 5HDKA 3GFJA 5L3DA 4LUMA 1SMTA 3LA7A 4M9XA 1FP2A 5DEQA 1J3PA 4HAMA 4KMUX 2IXLA 4KIGA 1UIKA 2JTVA 5F1RA 3W6KB 3HYIA 2R3SA 4XFIA 1LEAA 3MZHA 2DAOA 4QGNA 4B29A 5D6EA 3FZ3A 3SCHA 1O3RA 2QVSB 3C1DA 1TNSA 2PLYA 3P7NA 1I1GA 4MTDA 1ZVFA 2XVCA 2GC3A 3V4GA 1F9NA 3E3VA 4A6DA 2FOKA 2A69F 1Q1HA 1FXZA 1KYWA 1RZ4A 1NYWA 2CO5A 5ERIA 2QYOA 1IRFA 3BPZA 1JXSA 3FM5A 1STZA 3T5XA 2GIVA 5I0SA 1FBUA 2IXJA 1RTVA 3WE3A 5IT9Z 1LEBA 1CAUB 1W4MA 2OAZA 2DT5A 3H1MA 3GLXA 4DNCA 3E6MA 3U10A 3P9CA 4L9VA 5LGUA 4UUVA 3ETQA 1H0MA 1I5ZA 4EM0B 1W7PA 3M1EA 2EK5A 4PCQA 4G6DA 4WF2A 1AOYA 3GUDA 2QVOA 3B02A 3GBFA 4Q4ZF 2BGCA 4WZCA 1HW1A 3SHFA 3WTYC 3I4PA 5K1YA 1ZLJA 4BNCA 3DF8A 4RB2C 5FQ0A 2Q30A 2V1DA 2OD5A 4UBGA 1IF1A 1HW5A 1R00A 4ASNA 3D5LA 3H1WA 2ZKZA 1EPZA 2GWRA 2HDCA 3I71A 1NHAA 5HS8A 3RYKA 4R8HA 4M73A 3HRSA 5EEHA 1J5YA 2L54A 2RV8A 1YHFA 1EH8A 4Y17A 2OYZA 1YW9A 4YFKF 1O5UA 2K86A 2V79A 3KEQA 3R0JA 2STWA 4E2QA 3G73A 1U5TA 4XF0A 2PN6A 1OYYA 4HZFA 4IF4A 4I09A 2MD5A 4R79A 2IT0A 3IKTA 5I91A 3J7AO 4HBNA 1YWKA 3K69A 1ZGAA 4RS8A 3O14A 4XRFA 5FB2A 3KP3A 3C3VA 3REOA 1UCXA 3OOPA 3LAJA 4ETSA 4CO8A 5JR3A 1CAXB 1ZZ6A 2Z2SB 2I45A 2A3SA 3O6BB 5A2QZ 1D8KA 1YFHA 3QOPA 1S29A 1LQ1A 2GC0A 4HW0A 1TBXA 5DCFA 4KL1A 3O2PE 2LNBA 3I54A 4LJZF 2HOEA 2IXCA 1B1BA 1S6LA 3ELNA 2XLAA 2RDPA 4L0ZB 4IESA 5DD8A 1SFEA 3O3KA 4QGMA 4L9TA 5D6FA 1UW8A 1RIOH 3JZVA 4WBBA 2PHDA 3LWFA 4QM9A 1YS7A 3DV8A 3TGNA 1KU3A 1YG2A 2FBIA 4IRHA 1G6NA 3SQNA 1F1ZA 3HT2A 2EFPA 5JR7B 2R7DA 1FBQA 3KEOA 4FX0A 1U12A 1KA8A 1QWRA 2VC0A 5C6CA 4RGSA 1X3UA 5FFZA 3J80K 4D7SA 1YQAA 1LNWA 2IXHA 4XF3A 4HMZA 4EWAA 3PQJA 2XASA 2PI0A 2KJBA 1R1TA 4WWCA 4KYWA 1IN6A 1IXSB 4DQ2A 3GVAA 1Z6TA 3IDCB 2P5VA 4JTNA 2P7CB 2IP2A 4EVIA 5FLIA 4PGGA 1I27A 5J48A 1TLHB 4PZJA 5KVRA 1EYBA 4L9NA 4HDUA 5K5RA 5I0RA 2JPCA 1FPQA 5DUKA 1KYZA 2Z9OA 2RKHA 3HRUA 6PAXA 1REPC 4HYEA 1T6SA 2ZNYA 1TNTA 2GU9A 3CO6C 4HX8A 4P96A 3F23A 4KWJA 1BIAA 2QQAA 2M1BA 4HV6A 5E8GA 1R1UA 3ROUA 2VT3A 1HKQA 4CXFA 4RD7A 1MD0A 2FF4A 3H92A 4EJTA 2Z5UA 3FJSA 2XL9A 3FXUA 1U5TC 3WTTC 3WGGA 3DXJF 2VN2A 3EETA 2J5PA 4B8XA 2F5CA 1K6OA 4HN1A 4M72A 3F6OA 1HKTA 2G7HA 2B5HA 3CUOA 2FA5A 1LR5A 4LEJA 2P8TA 2FQPA 1QGPA 2ZFWA 3K0LA 4CDGA 2ZJ2A 1LKNA 5ICGA 4LA3A 2VONA 1NE4A 2D2WA 4XF9A 4PJYA 2PA7A 4WXDA 1UHWA 3WTZA 2VBWA 3PVBB 1O3QA 4MZUA 1FWZA 3M3IA 3OTFA 2HYFA 5D5VB 3QP5A 3ES1A 1TW2A 3MPBA 4A0YA 2JZYA 4EJOA 2VT2A 4HSJA 4GULA 4CGZA 4MGKE 4MNUA 1XSVA 4LLGF 3CTAA 2VC1A 2DPUA 4UHTA 1QO0D 3H3UA 4AIHA 4HBLA 1ZAOA 3L2HA 2MLKA 3LAGA 1KGSA 1Z7UA 2VXZA 1LRHA 4HLTA 4OIOF 1J0RA 2W24A 2PYTA 4IXAA 2EAAA 4Y15A 4ESJA 4IVNA 2XUBA 3SXWA 3ZMSA 4A12A 2UY8A 4QLCU 1IPKA 4K8FA 3DP7A 3F8CA 4MGZE 1ON2A 2PFWA 4META 4YYOA 2V09A 2OQGA 2D1VA 2RC4A 1XGNA 3JAMK 4IEWA 4OIQF 4XEZA 1ZG1A 1V4RA 5JHUA 1CAUA 3OD0A 2CG4A 1J1LA 3NSTA 2J5OA 3VOEA 2RVCA 1BI2A 5ICFA 3DKWA 1JHHA 2EFQA 3BJAA 4ZU5A 4XBFA 3GZ6A 4G7HF 1YFXA 5FLXK 3R61A 3TOBA 2K0GA 3ABUA 1Y0UA 3F72A 3LWCA 4ZYGA 4QGLA 2IVMA 1PM7A 2MPFA 1FLIA 2NNYA 4XFFA 2MH2A 5E16A 3EQLF 3L2CA 2NYXA 2HZTA 4GYGA 2WFPA 3PFIA 3Q5FA 3T8TA 3H50A 4G6QA 3FMQA 2XLFA 4MH0E 4UVAA 2ZXJA 1G3YA 4I01A 1XRUA 4JV4A 2OZJA 3JTGA 3WTXC 2ATFA 3WW4A 2L4AA 3I0TA 3FFQA 5BUVA 1U3EM 1K78B 3H9AA 3KLOA 4IHTA 4U0VA 3SMHA 5KHGA 4ON0A 3MCZA 4MEXF 3LOIA 2V1XA 2RQPA 1GVJA 1FNNA 5E1XA 2EA4A 2EFNA 5TJJA 2GQQA 1FI2A 1ZRFA 4HN0A 1MJ9A 3R6SA 3ZMDA 3NQOA 1KQ8A 1W5SA 3MZYA 2HS5A 1IXRC 4L9JA 5CVRA 2MNGA 2OU2A 1KU2A 3VB2A 1FYMA 3C3WA 1ONVA 3ML6A 5FLHA 4LUKA 4KT5C 1CAXA 1QZYA 1PMIA 4ZYDA 1J3RA 3MFKA 1HBXG 4LLLA 4A5MA 4N9HA 1UB9A 4HVOA 3DEUA 1RI7A 5BOXA 1B9NA 4AVCA 5FD6A 2IXKA 3KETA 1U2WA 1WKMA 1S7AA 2GA1A 5J7MA 2H6BA 2HGCA 1BM9A 4HX7A 3F21A 3FXQA 2BBYA 2ETHA 4YG2F 3PNAA 5LRRA 2ETEA 2BE5F 2XKOA 1MJBA 2CSOA 4RGUA 4XFGA 2V1UA 3R0AA 4HA8A 2UXNA 4ZZDA 3KP6A 3MQ0A 4GYIA 2WC2A 4LB6B 2EV6A 2KIUA 3CUQB 4IEXA 3TO6A 2RGVA 1OMIA 4L18B 4K2EA 5JVTA 3V8KA 1TQMA 2BEOA 3MYXA 3F8FA 4ONUA 4I98B 2HYGD 1RC6A 2QQ9A 2FNAA 4P9GA 3SCFA 4BAYA 2PHLA 1J59A 5AVPA 3PLQA 1T98A 5AIQA 3ES4A 2RN7A 2HJIA 4L5IA 1MZBA 3FF5A 5E20A 2O3FA 1WA4A 2W84A 1MKMA 2HQRA 2XKPA 3DFGA 1B6AA 3ISPA 3E6CC 1FP1D 3FMRA 4HOBA 3NEUA 3ZDSA 3SCGA 4AVBA 1IRGA 3RPQA 2VBYA 2W25A 1P4WA 3RKXA 1MJAA 2EWNA 2CAUA 1XN7A 5LRSA 4CYDA 2Y48A 3KE2A 3GW2A 2FXAA 1YIOA 1XE7A 1UPIA 3BWGA 5FPZA 1H1MA 5F64A 3QRFF 5AIPA 1DZTA 3GFIA 1ZYRF 4RB0A 2VODA 1ZHFA 1SFUA 4KU8A 5BQTA 3QAHA 1NZCA 4Z2YA 3E5UA 2XRNA 3CEWA 1BOAA 1TQ5A 4EJVA 2ACJA 5JSPA 4XFCA 1FZPB 2NRAC 4B09A 3K9TA 1BC8C 2NAZA 1HKSA 2KKOA 1YLFA 3QU3A 3WTVC 2PAMA 2E7XA 1X7NA 4BH9A 2IA2A 1AWCA 1CGPA 4G7OF 4ENJA 2Z3YA 2ZMEB 4LFUA 4XFBA 5LBQA 3Q9SA 2ADUA 2DK5A 3IRQA 1FC3A 4N9IA 5IT9K 4J1WA 1BN5A 4E70A 5CLSA 5I8SA 3ZMTA 3ECHA 1RNLA 5L3GA 2Q0AA 5H20A 4KICA 1I6XA 2ISZA 4AVAA 2XHKA 3CO7C 2F5FA 3DPTA 4O9GA 4HVQA 3LFKA 5FD5A 2L4MA 3TNQA 3HOTA 4Q0UA 3F8MA 1T38A 1O3TA 1D5VA 2Y0OA 2PG4A 5K5QA 1OYIA 4WCGA 4JQFA 2L3DA 3GX4X 1XGSA 2HTJA 4RAYA 5D4RA 3F22A 1G3SA 4PIZA 1KQ0A 4BHCA 1OI6A 4NVPA 2O0YA 3BDDA 4Q0PA 1A04A 4L0YB 3HSEA 5E18F 2MBFA 2IRFG 3TKYA 3T8RA 4RAZA 2QBYB 1OYWA 4G94A 4ZU4A 2EVXA 3EYIA 2WTEA 4M74A 1HQCA 4UXNA 1R23A 3IDBB 4OINF 3RKWA 1IN4A 2XROA 4UVCA 4G9YA 5FGMA 3F8NA 3TNPB 4GO1A 2DW4A 5HI0A 2FSWA 4BXUA 4RB3C 5BPDA 2VPVA 1G3TA 3S0MA 1V70A 1CF7B 4KWLA 3ZP5A 2D45A 2VE8A 2PEXA 2A6HF 1S3JA 2MH9A 1IN7A 3TDUC 2YSRA 2ET7A 1SD4A 4GCVA 4PIXA 4XF4A 2LF7A 3K1PA 4ORFA 4KFCA 4KNYA 4KIFA 5L3FA 1V3FA 2DO7A 3GEZA 2E9QA 3WW3A 1LDDA 3E5XA 5A2QK 3I5UA 3S7EA 2VQAA 5BPXA 5H6RA 4IEZA 1KU9A 5T3NA 5KHHA 4MUVA 3UKNA 5LEKA 3IWFA 3IL2A 1LB2A 4IEYA 3JSPA 2CV6A 1PDNC 5JAXA 4LGWA 2A6EF 2UY9A 2O6GE 2X4HA 4XSXF 4WK8F 4M9SA 5F6FA 5BPIA 2DI3A 3KP7A 5JSRA 4LK1F 4EJWA 2PAKA 2ISYA 3L7WA 1K78A 2PTMA 2LKPA 3G3ZA 5EEGA 1U78A 2Y75A 2LDUA 2QUFA 2PBIA 2DQLA 3PQKA 1R1VA 4KN7X 2P17A 2XV4S 2IC1A 2FMLA 2QCSB 2FQ3A 3BP8A 4Q0QA 1B9MA 2B8MA 2JSCA 1DGRA 5E8IA 5I0UA 1FSEA 3FWEA 4OFGA 1DUXC 2ZKLA 3WW1A 2XAJA 1HW2A 1UHMA 2GXGA 1XD7A 1XSXA 5D8LB 2HEOA 3H1YA 1O7FA 1XCBA 2L02A 2EA2A 1XMKA 2K02A 1XB4A 2JPBA 1W7PD 5CU1A 1G3WA 2NNNA 1ZZCA 3V8LA 2ET1A 5AONA 1ZARA 2MC3A 5CADA 2QJVA 4IRIA 3ZN1A 4BHBA 3J81Z 2LSOA 5EFUA 4OIPF 1YLLA 4KU7A 1FBSA 4MEYF 4F7ZA 5L3EA 2PMHA 2YU3A 4OMYA 4LD5A 1T2KA 3CO2A 1IZ1A 2HQNA 3QACA 3L09A 3KSCA 2EFOA 2CW0F 5FLJA 3CUQA 2QWWA 3M8FA 2Z99A 3K1MA 4EWEA 2KXLA 1YTYA 4HV5A 3RKYA 1QY4A 3LQQA 3D0SA 1UD1A 4LG0B 3EYYA 5KBFA 3K2ZA 5DCMB 2CWEA 2EV5A 5LHHA 3B73A 4XLNF 4XF1A 3GYHX 1CAVB 1K79A 1GQHA 2VOOA 2GA2A 2C6YA 4U7BA 3NJZA 1R22A 1WRJA 1XGOA 3VODA 3USSA 3QP6A 5HDNA 2A07F 1P4XA 1O57A 2OA4A 1Y3TA 5J8FA 2BV6A 4H7LA 1WQ2A 2GAUA 3CLOA 1BJAA 4IEPA 1WGPA 3U9GA 2O8XA 4HF0A 3KZYA 5E1RA 4EQQA 3GYDA 4L11A 1ZREA 1XE8A 4Q29A 1H9TA 2P6TA 1X82A 1O7LA 5L3CA 1OD5A 3HOSA 4P9FA 1ZN2A 4OOIA 4DINB 1H9GA 4GXOA 2FE3A 4UVBA 1IAWA 2PJPA 1E2XA 4Y13A 4EROA 4LK0F 2WV0A 1OFNA 5FO5A 1IUYA 4LA2A 3LZZA 2P5KA 2H27A 4PDKA 2XAGA 3H7JA 1SEFA 4HF2A 1XMAA 4HF1A 1IPJA 3RDIA 4YARA 2QM3A 2ZNZA 1XCVA 1TQPA 4S04A 5CYVA 4G7ZF 2P7VB 5I8YA 3Q9VA 5JSOA 3E97A 4YSFA 5BS6A 2IW5A 2QENA 1EY2A 3BB6A 1FY7A 3M7GA 3VEPA 4AQ2A 4YIIA 3U2RA 5LGNA 2ZMEA 1JUHA 2IXIA 2HTSA 2FBKA 4AXOA 1B59A 1QXJA 1BBYA 2K27A 1ZRDA 1LJ9A 4XETA 5J6XA 4MTEA 2VBZA 4D7TA 1BC7C 2HFHA 3UKTA 1YFYA 1BIBA 1BI3A 5E1ZB 3FE5A 4FT8A 4A5NA 2BNMA 2DCTA 2OBPA 1HSJA 3HT1A 1YW7A 5HS7A 3NRVA 3KGZA 3T1BA 1ZG5A 5DV5A 4LB5A 5BY5A 2Y0MA 4PIYA 1DPUA 1XDUA 4U88A 4R52A 1IXCA 1MDMB 4OIRF 2DK8A 1YFWA 1JGSA 3IKVA 3I64A 2VECA 3P9IA 2OA2A 4UXAA 4O9EA 3GXOA 2P6SA 3HTUA 2GZWA 3WE2A 3CLPA 2UWMA 5FDBA 2BNNA 3CUQC 1GQGA 1L3JA 4QWQA 3JTHA 4ZYHA 5CJ9A 3ZMVA 1YFUA 2HKOA 3I59B 2XL7A 5BXXA 1ZGJA 5HVQC 3MWMA 1P92A 3TQNA 2QQBA 3S2WA 1Z1DA 2QBYA 3D82A 4M6YA 1ODDA 5D4SA 3AAFA 1SFNA 2VE9A 4CZZA 3OGJA 3EQEA 4ZH4F 3QPHA 3RZZA 1J58A 2MA3A 1MGTA 3ZMUA 2B0LA 2ELHA 1CF7A 4FAGA 3OV8A 4H0EA 5LLQA 1DP7P 3WTUC 3UKVA 3V7RA 2Q1ZB 5JFRA 1FOKA 5KHJA 4MQ9F 2UYBA 4QMAA 4R1HA 5TRDA 4S05A 1ZZBA 4HQMA 4A2UA 3S7IA 1VR3A 5I93A 1BI1A 1ZX5A 4EGYA 3IBMA 4Q47A 2KJCA 2UXXA 2BNOA 4BHPA 1P2FA 2FMYA 1CAWB 2V9VA 2G9WA 4ZU7A 4EM2A 4WVZA 2P5LC 2M87A 5D1IA 2K4BA 3KFWX 5IT3A 3RTRA 1SD5A 2O1QA 4KA4A 1U6GA 4RGRA 1Z05A 5HDGA 4I0AA 4KWKA 3HUGA 2JT1A 5K5OA 4NB5A 5FCCA 1RGSA 4MGYE 4UV8A 1O5LA 1ZNPA 3HQXA 3FZVA 4MHGA 3ST7A 2MLGA 4AVPA 4U0YA 5HLGA 1GXPA 4HLYA 1QZZA 4RB1A 3M70A 1Q43A 1SD6A 4LLNA 2ESNA 2W57A 2IPQX 2QNKA 3ZN0A 1TTYA 3C18A 3GFMA 4JK1X 2L01A 3CDHA 5J3UA 5LHIA 4UV9A 5D8KB 5ILVA 1F5TA 1LDJA 3L00A 1R36A 3BZ6A 5C8WA 1L0OC 3NW4A 1Z91A 1X8MA 2DQRA 2K7LA 3LAPA 4YRDA 2LF8A 4XLPF 1D8JA 2A5YB 2F5EA 2H6CA 3KLNA 4MX3A 3RYRA 5FPXA 4OU0A 1W5TA 4XSZF 1DDNA 3HSFA 3SHRA 2JRTA 2K4JA 2R7FA 1CX4A 2TDXA 4LULA 2C0ZA 2B9UA 4N0BA 4IEUA 4F8AA 3ZPLA 1UCRA 2EJRA 3WG9A 4WX9A 4AWXB 5ED4A 3FXRA 3NVCA 4HVRA 5D5WB 4MGRA 4Z07A 5K8SA 1RUOA 4Q5SF 4O6JA 1OPCA 4LG0A 2Q8KA 1HXDA 1I1SA 3G7DA 3EO6A 2V6CA 5DCMA 5J8CA 3SXYA 5HLIA 2H0VA 5E17F 5I8TA 2KRFA 2K9ZA 3MDPA 4I7HA 1F4KA 1J9IA 3GO5A 2FEZA 1CAVA 3BJ6A 3WTSC 2ZBKA 4NHJA 1DGWA 3P9KA 5JCTA 2F4PA 5LHGA 2BYVE 3DN7A 4ENMA 3RYPA 4PGHA 1QXRA 1QQIA 3TDZC 3ZMZA 2H94A 3I7DA 2CFXA 1LDKB 1OR7A 1ZLKA 5ICEA 5CVIA 3RPUA 3BY6A 2Q2EA 2QLZA 1C0WA 4E2SA 4XFAA 1FX7A 4IPAA 3FMSA 4FAHA 3U1DA 4FHTA 4O5VA 5KHIA 2ESHA 2M30A 1IN5A 4A6EA 4EGZA 3WGHA 2D5HA 4I02A 2A61A 1JHFA 1USSA 4I0BA 3KGLA 3W6JB 5ILUA 3EUHA 5HLHA 4KMFA 2O8QA 1ZZ8A 3M9AA 4P55A 3CJXA 5KHKA 2MHFA 2D93A 5ILSA 2E7WA 1J7KA 3GZ5A 1SD7A 5DUIA 1IN8A 1PUEE 4L5JA 3J80Z 2ZCWA 1OKRA 5CVJA 3NL1A 3JW4A 4QXKA 2GC2A 1B4AA 5DYMA 2IA0A 2CGPA 4GGGA 4YIFA 1UFMA 1T39A 1EV7A 4LLOA 3JSOA 1VJ2A 4QX5A 4A0XA 1PP8F 3F8BA 5EZWA 3H8UA 3LA2A 3KCCA 3BU7A 1ON1A 3T0YA
chains in the Genus database with same CATH superfamily
1Y1VJ 2WWYA 1SPPA 2JXAA 3FM3A 3AP7A 1R49A 4M71A 2YY1A 1VRH3 4NQWA 4M3BA 2V5YA 2EXJA 4UF0B 4IETA 4B3AA 3HSRA 2WBKA 1BL0A 2Y6HA 3ZXDA 1Z6RA 1BW6A 5L3BA 4BQWA 4IQ4A 4ES9A 4DYQA 2VOXA 4LORA 4ARYA 1QOTA 3T30A 3RKQA 1IRXA 3FBMA 2DLLA 5M5YJ 4QPGA 3I59A 3VD5A 4Z82A 1JZ2A 2AGSA 2K3PA 4XJ8A 5A6XA 3JRGA 1MS4A 5FRMA 4LKEA 2ECBA 3W2VA 5ICCA 4D0PA 1O3SA 2JDYA 2E71A 2O03A 2XGCA 2YGLA 3ZQLA 3WU0A 1OQYA 2WQZC 5JLWA 2FBHA 3OF1A 4N7UA 1E17A 2F2EA 1W7PB 3IRRA 1NCQA 4M9ZA 4X6QB 2XAHA 5KHDA 4E4DX 2NS0A 3RFRA 5JHFA 4IV1A 2JA5J 4KN4X 1HLCA 2EICA 1ZZ9A 3RGBA 1LGNA 2R072 1JE8A 1F2NA 2P4WA 4YPJA 4QTRA 4CRQA 5IT6A 3IHUA 3ELKA 4CCJA 1QKQA 3Q8FA 1RUD3 3V42A 1W36C 3I53A 3AYAA 5TISC 3WNNA 3J81K 1ST8A 3G6EI 2OX0A 1GZCA 5DAXA 4L9BA 1GLHA 3WF2A 5KK1A 3A0HC 1DU6A 1WLDA 5DDJ3 2EA7A 2LH9A 4EM1A 3LA3A 1DPRA 4ASLA 4BLIA 4KGGA 4C91A 2FU4A 5IVBA 2JVHA 2HWVA 3DQVC 4YELA 5IOZA 2R93J 3GZNB 5D8AA 2YPRA 3IWZA 1RVF1 1WBFA 3DPLC 3C8XA 3CL1A 4PLOA 4XHBA 4A3ZA 2CSGA 2X6WA 1A8MA 3O1RA 3NWSA 4HX4A 1DZRA 2FMDA 1W0UA 2D5FA 4A3KJ 4KT6A 3Q8BA 4B7KA 2E63A 1AYN1 3KV9A 4OAZA 5HCAA 5FLXZ 2CYYA 1POV1 4YW5A 1YS6A 4BEHA 4HDVA 1WW4A 2JDUA 2NOJB 3AG4H 2VNRA 4D5CA 2FCTA 3ZFEA 1T0FA 1SAXA 3ZFGB 3HOUJ 1XOYA 3RJPA 3WR0A 4M3FA 1ZR4A 2BY1A 1WJCA 1AKHB 1C28A 3WG3A 4C0HA 1GUIA 3LF7A 2BHZA 1RPWA 1USTA 2GMMA 4JBAA 1HRI3 1W06A 3CZUA 2OZ6A 2NS7A 4OLLA 3HNYM 3JRFA 3ACLA 3CJNA 1QQP2 4AI1A 3R4KA 2A6XA 1H8TB 4LXLA 3LSGA 3BOWA 5JI6A 2LY9A 1XSDA 3EBRA 1OCZH 2Z16A 4URTA 4AIJA 1QPMA 1MBGA 3RIRA 3AKRA 1SDDB 4IHVA 1SACA 5HS9A 1EV11 3DXTA 1W8UA 3WLUA 3COAC 2Z33A 3GTGJ 2G7UA 1ZRRA 2D7FA 2W94A 5DN2A 2A5WA 4MYEA 4B48A 4NBQA 1NY72 4V2WA 4N4OB 3LMMA 4ESBA 4LK7A 1HJFA 1YUDA 2DUPA 1Z9CA 4P14A 1R092 3LIGA 4XFHA 2VBBA 3VFZA 3ILFA 2WA0A 1Z0HA 4MV2A 3QYBA 3CCQI 1O4TA 5HV4A 4FPYA 5BV6A 1UN1A 2VQTA 5A7OA 4QX3A 2GNBA 3WU1B 3MIEA 3FMGA 4CDXB 3SZTA 1SMYF 2IGOA 5BMZA 1TEIA 3UYJA 5CVUA 2QZ8A 2JG9C 2CAVA 2HKXA 1J3QA 3IN9A 2YFZA 3H7YA 4ZS2A 1T6BX 4IEOA 4ZYEA 2GXBA 1KU7A 2M4KA 1U0JA 3HIFA 1COV1 1FPN3 3RS6A 2X5IC 4IGQA 3BPVA 2WY7Q 2E1NA 1VBA1 1KJLA 3GFJA 1DQ0A 3LA7A 4OUSA 3TEZA 3MN2A 2WLPA 1UIKA 3GNEA 1QNWA 3VZKA 5F1RA 3W6KB 4CCEA 5A6ZA 4W65A 1B35C 2DAOA 4PQ9A 5JOWA 4QGNA 4B29A 5C71A 4O7XA 5D6EA 1AR61 3CJIC 1O3RA 2P0WA 4PI2A 5C3OA 3C1DA 4CCMA 3SKVA 1QDCA 4RGKA 5JXIA 1ZVFA 2GC3A 4L97A 3V4GA 5C8CC 3E3VA 4A6DA 3L2RA 4IX7A 1WJDA 3O8HA 4QXBA 2CO5A 1YRNB 4PSWA 3VSLA 3BPZA 1STZA 3R4SA 3WEZA 1JT0A 2R041 1OLRA 4GWJA 2ZJPF 2SBAA 5IT9Z 2YHJA 2JA2A 4MXWA 2I2SA 3WSOA 1QHGA 1RUI2 1V9U1 4L9VA 3UJQA 2QQWA 3KHCA 1VBE1 3FFZA 4Y7NJ 3PM1A 4G6DA 4XLFA 1YNAA 2XG3A 3UGGA 3GUDA 2QVOA 2ZGMA 2FQ4A 3FL7A 3ZYHA 1HRV3 2HYKA 3B7MA 4Q4ZF 1BBT1 1ULOA 3PO2J 2VOTA 5K1YA 2VG9A 1ZLJA 2Z79A 2R49A 1OCCH 2ZX1A 2OD5A 3DBLB 1R00A 2K2SA 3D5LA 1HJGA 2GWRA 1RUJ3 2HDCA 2Z42A 4U2AA 1NHAA 3RYKA 2G9FA 1PVXA 4R8HA 1N1VA 4CUBA 3HRSA 1AA7A 1REEA 1YHFA 2RV8A 1SANA 1LOBA 4RFT0 1UYPA 3BZKA 2VZPA 1F4HA 4QX7A 3KEQA 3R0JA 2STWA 3VBHA 3G73A 1U5TA 3RSNA 4PUSA 2R0QC 2VVDA 3PUIA 2DA7A 2WADA 2ZGNA 2L9RA 4FISA 4Y4RA 3J7AO 1IUFA 5J1XA 1ZGAA 1JJ6C 1VB2A 4RS8A 3O14A 2DA6A 3BVCA 2ZA9A 4Z2AA 4CXXA 4CTEA 3LAJA 3THTA 1V6IA 3UNGC 1CAXB 2HWC1 5F2WA 1MS9A 2VPRA 1VQKI 5A2QZ 2NYYA 1LQ1A 4HW0A 1ZYBA 5DCFA 4KL1A 1QJU2 2A6TA 2RS53 3I54A 4LJZF 4AIDA 2WABA 3P3PA 5EJCA 2IXCA 5JOXA 5H2FC 2W47A 1IKQA 1ZR2A 2VULA 3AG3H 5EP9A 3I2IA 4Y24A 3O3KA 2JDNA 4L9TA 1N3PA 4AWDA 1DU3D 4LHNA 4NJ4A 5GPCA 3CD6I 4E7JA 4CE8A 2NZ9A 5FV3A 5K4LA 1Y8QB 4QM9A 1UOBA 3DV8A 4CEWB 1YG2A 3HT2A 2EFPA 1QJY1 3ZOIA 3N9OA 5CKMA 2HDWA 2R7DA 2VOKA 3Q0VA 2R4GA 2DBIA 1ETKA 2HEYF 5BNNB 4D7SA 1YEWA 4FXGB 3HG9A 5LW9A 4BQOA 1FATA 4LOTA 4NROA 2D6MA 5A7PA 4E7HA 3KT4A 1WCQA 1DGLA 4GMP0 1URXA 1YJKA 3H36A 3M07A 2ES3A 4JTNA 3C7FA 1I27A 1W9WA 1EYBA 4BWOA 2BZTA 4L9NA 5FPLA 3QD6A 4HDUA 1MBEA 1V55H 4K20A 4RA2A 5J98B 4J00A 4HYEA 2W00A 1TNTA 4RLQA 3F23A 2E5ZA 4HV6A 1JYTA 2EIMH 2VT3A 1YQ6A 5FJ8J 4HSTA 2YU1A 4C2TA 3VHPA 3MUZ1 3CCRI 4XUOA 3H92A 4X0GA 4EJTA 2XPJA 4J19A 2Z5UA 3R4UA 4E7SA 3OG2A 4RA0A 3ESWB 2XRLA 1NK3P 1WH5A 2EQRA 1GWMA 1R1ZA 2AQFA 1W8FA 2W95A 2F5CA 3F6OA 3GTLJ 1X1CA 1LKNA 3MO4A 2BZDA 3W2WA 5GAGJ 1CR7A 4C0BA 1KS4A 2FDFA 5C70A 1NE4A 2EAKA 1OVSA 2VBWA 1AVBA 2WWSA 1WJFA 1FWZA 2E34A 3CC4I 4CDWB 2HYFA 2IAIA 1CQTA 3K4LA 3QP5A 3ES1A 4XTPA 3G1LA 1G9BA 2JZYA 4EJOA 2PLV1 4WM8B 5GZCA 2XJRA 5IVJA 4CGZA 3ZQFA 1UMQA 2R7OA 3CTAA 2R5YA 2VC1A 3H3UA 2KFDA 4HBLA 1ZAOA 3L2HA 3HN3A 2MLKA 2NQYA 5F5QA 1LRHA 1PX4A 3TWIA 4OIOF 1W9FA 4BXSV 2EAAA 3IDEA 2FDHA 1WCSA 2ID6A 1N25A 4A12A 4OI4A 2C9AA 1S0CA 3F8CA 1BK1A 1ZBE2 2PFWA 4FFHA 1LOCA 3MW2A 2V09A 1XGNA 2W1SA 3UETA 4HXCA 4Q4V3 5JOYA 4XEZA 1PUFA 3C2BA 4LO7A 5EZGA 1WMDA 3OBTA 4IE6A 2VI6A 5FP4A 1CAUA 2ZGQA 3KWVA 4KNCA 2XB6C 2CDOA 3Q3SA 5JIAA 3DKWA 1HXS3 2UWCA 1C57A 4AHZA 2LLKA 1N1TA 4PT6A 4ZU5A 2PMZN 5CKNA 3GZ6A 3V0BA 5FLXK 2WT0A 1BW5A 4LE3A 4CP1A 1QNYA 1PM7A 1B09A 3ZN6B 1FLIA 4SBVA 3ZR6A 5FZOB 3SC7X 3EQLF 5EYRA 3L2CA 3J4UH 2G4IA 4DRVA 3SDBA 2WFPA 3J7NA 3H50A 2V26A 2XLFA 4UVAA 3PNYA 3MW4A 2GMPA 3JTGA 3WTXC 2ATFA 5LCWL 2L4AA 3FFQA 5BUVA 5DM6F 1K78B 1VQ4I 1S0DA 4IHTA 1ITYA 2RV9A 2TNFA 5KHGA 4RFRB 3A03A 4ON0A 1HQNA 4HEA2 4Q8LA 3LOIA 5M3FJ 2J1TA 1Y0NA 3S14J 3NKGA 1MR5A 3ZSEA 4NWVA 2ZXIA 3KLSA 2TUNA 2EA4A 1Z7S1 4RS5C 5FYZA 2QTWB 5TJJA 2WNVB 1MJ9A 1PGL2 3NQOA 3EYPA 2BBAA 4GB31 2VU9A 1TME3 3CZ6A 4G12A 1WCUA 3H1CA 2EXIA 2NM1A 3K46A 4WVVA 1HB4A 4DW6A 4LUKA 5E3OA 3BG7A 1K42A 1UB9A 4LK6A 3DEUA 1G9DA 4JC1A 3DLAA 1L7QA 4NHKA 1BA5A 2XHNA 1OA4A 4F83A 1U2WA 3B9CA 2PX9A 2IVJA 2XJVA 3RZDJ 3F21A 4YG2F 2ETEA 2LKSA 2XKOA 2P3IA 2CSOA 2E2IJ 3R0AA 2UXNA 4ZZDA 3KP6A 3MQ0A 4GYIA 2WC2A 2KIUA 4YFZA 1QMJA 1OMIA 4K2EA 3V8KA 4ZC3A 1OPMA 1OOPA 3ERMA 3WNPA 3K70D 2Y6LA 2HYGD 3OIPA 2FNAA 4ZONA 2WNUC 3PLQA 4CA0A 4AGRA 1GP5A 1K4SA 3ES4A 2RN7A 1RESA 4L5IA 3FXJA 4OZXA 2FZ2A 4BISA 1OA2A 1WA4A 1QH7A 3T3YA 4YFWA 2HQRA 3DFGA 5EPAA 4WZFA 3WQ0A 3FMRA 2VTFA 4FOWA 4AVBA 1BK0A 5C33A 4NPMA 3O1VA 1VPHA 2VBYA 3RKXA 3S2DJ 4NE9A 1UKRA 2CAUA 4YW1A 3LPGA 5LRSA 1GANA 2UU8A 3S16J 4RN5A 2X9DA 2FXAA 5FXXA 1UPIA 1H1MA 3HQUA 2ZJCA 5IP7J 1DZTA 5J09A 2H8WA 1D2SA 1JBCA 3NJYA 3ZQQA 5L9BA 1R71A 2B45X 2XGDA 4Z2YA 3IDAA 3BZCA 4ZDLA 1R1A1 4EATA 2ACJA 2QKLB 1FZPB 2RS12 3K9TA 2NAZA 2WZ8A 4D9JA 4RYDA 3QU3A 1R4MB 3SLIA 3C7GA 2IA2A 4JDOA 4G7OF 4BMEA 1V6KA 4BJTA 4LFUA 2A7AA 4XFBA 4P9LA 4RAFA 5LBQA 3CJIB 1QHHD 3K10A 4XE9A 2ADUA 3MW3A 2FX0A 5IY5H 1ETYA 5ERLA 3HAGA 4UW5A 5IT9K 4IOAF 1R083 1BN5A 3I3QA 5I8SA 4M3CB 1RNLA 4ANJA 4JZRA 4B47A 1I6XA 1Z21A 5JIUA 3MIHA 3BUCA 5IVEA 5FUNA 2VMIA 4HANA 1BMV1 2F5FA 4HVQA 3LFKA 3LDRA 2Q8EA 4RM3A 3UT0A 2WAAA 2KL4A 3ABLH 3HR9A 1D1AA 5J96B 1XGSA 1ETOA 2MW8A 2DODA 3JBG1 2JWTA 3F22A 1G3SA 2XB0X 5FP7A 4BHCA 1WW5A 1OI6A 3MV11 1MBJA 2CGNA 4N53A 2O0YA 3BDDA 2CY6A 2P34A 2WZPP 1Z78A 5FP9A 3T8RA 2QBYB 4ABZA 3VYRB 1J09A 5IYDJ 3J7LA 4OINF 1IN4A 2R7XA 5FPAA 4G9YA 5FGMA 4B4QA 4UYBA 3WCRA 2QQLA 4BXUA 4RB3C 3H3VK 1G3TA 2DDAA 2VJ4A 4DYRA 1V70A 1CF7B 3BPSA 4KWLA 2D45A 3IH2A 3TDUC 1HDDC 2YSRA 2ET7A 1SD4A 2KPMA 4GCVA 1MQTB 2LF7A 4ORFA 5KWRA 4GAZA 3GEZA 3WW3A 5IOYA 5A2QK 3VBUB 3DYOA 3O7OA 5CFDB 2MEV2 5LEKA 2XPUA 3IL2A 4IEYA 3JSPA 1MSEC 2O0OA 2CDPA 1FAYA 1M06G 3IMNA 1YC61 2UY9A 3HB9A 2X4HA 1DQ5A 2DVDA 4WK8F 3HUGB 4ZXKA 3K4DA 5JSRA 4LK1F 2ISYA 5A32A 5AFEA 1DGRM 4LBKA 5JPNB 5GZFA 1W0OA 1RUG2 2BOLA 2RDSA 2PBIA 2ZXHA 1ZM1A 1KXGA 2FMLA 4B44A 2B8MA 2JDKA 4P9YA 2JSCA 1FSEA 1ZA4A 1IG3A 2W39A 4A44A 4QU2A 3WW1A 5A6YA 1PMHX 2WNOA 2GXGA 1XD7A 1MS1A 5FRAA 1LECA 2DJNA 3KIOA 2L2OA 3GXUA 2EA2A 4A41A 4P5HA 4PDWB 2ZAAA 2QKMB 3D5SC 2RM23 3GBWA 3WZ1A 4M00A 4GXLA 5IP9J 3M3CA 1ZZCA 4P5YA 4YG3A 4OI0A 5AONA 1ZARA 3KD4A 1MBHA 4BHBA 4QSHA 1YLLA 1H9PA 3PUAA 4QPYA 3G2BA 1JS9A 3CO2A 3LEKA 4R9BA 3CC7I 2HQNA 1G86A 3L09A 5ACA3 2EFOA 5FZLA 3CUQA 3WDYA 1US2A 2QWWA 4EWEA 1OCOH 1YTYA 1JOPA 1U5XA 4BY1J 3FHQA 4LG0B 1RUH2 1W2UA 2E32A 1QRYA 1ENSA 2NP0A 2HWF3 1JZ7A 1D0ZA 2ZX0A 2CWEA 4ZYAA 3AZZA 1HIXA 2EZKA 5DAQA 2XVGA 2PJRA 4DEQA 4Y52J 4YVWC 1J1TA 4XLNF 3GYHX 1T6GC 5JVGF 2DU0A 2VOOA 1R22A 1XGOA 3VODA 2V4VA 4C9YA 3O1OA 2WS93 3S57A 2RE9A 5C4WA 3QP6A 4AHYA 1IGOA 4LOSA 1O57A 2OA4A 5DMYA 1KS5A 1SFOJ 1WQ2A 2GAUA 3IT8A 4AAXA 2ME0A 4IEPA 2O8XA 2DA2A 2RDNA 1W3VA 3NARA 3RWNA 5E1RA 2DCEA 1XPXA 5IHRA 2OT7A 4CSWA 4URAA 1JZ5A 1W8WA 4Q4Y3 4XXPA 3UJOA 4P9FA 3HPHA 3OYAA 4Y13A 3UK9A 5JPMB 4LK0F 1OFNA 3GM8A 3KV6A 2ZHLA 3ZO0B 2ICWG 3AL0C 2VXJA 1HOMA 1KITA 2P5BA 2P7VB 2MFZA 5JSOA 2G0EA 3E97A 4YSFA 2QQJA 2VZVA 5BS6A 3J7AY 1C8M2 3QWLA 4AEJA 1ZELA 1EY2A 4DY3A 1FY7A 1MS8A 1PIV2 4BDYA 3U2RA 2RR13 3OYWA 1IV6A 4XUNA 1BBYA 4IHYA 1H4HA 4MTEA 4A3LJ 3NAPC 3S5AA 3UKTA 3R4DB 3MHZA 1BIBA 1SPPB 4FT8A 3J7ZI 3WY6A 4A5NA 4JGZC 5T52A 3GTPJ 3T1BA 1S2EA 1ZG5A 1XNDA 4NQWB 4JRAA 5BY5A 4ZHNA 1XDUA 4U88A 4R52A 2M0CA 4A3MJ 5EF6A 5C3QA 2DK8A 1JGSA 3I64A 5B2GB 1IS4A 1CX1A 4OYUA 1PO11 2VMGA 3GXOA 2J1UA 1GQPA 3N9MA 2UWMA 4XIKA 2F5VA 3DWLE 4A3BJ 1LHVA 5A7WA 1MH3A 1FIPA 2RNGA 4ZYHA 5CJ9A 1YFUA 2HKOA 4QPGB 3I59B 3BT9A 1ZGJA 5HVQC 1P92A 2QQBA 1WCDJ 4MO3M 4GMP1 1Z1DA 1OH3A 2ARAA 1IS3A 3B9IA 4FO9A 5CG8A 4IV3A 4RQPA 4FXKB 2AACA 2QEXI 1RR7A 2XJSA 1PO21 2LUWA 4C90A 2WLQA 4NC6A 3OGJA 3HBZA 4YGCA 4D0QA 1QJU3 3QPHA 1NCQB 4MHRA 3TW7A 2MA3A 3ZMUA 2B0LA 2G9ZA 2ELHA 3OV8A 4H0EA 3A0NA 3AXEA 1DP7P 3UKVA 4IV1B 5KHJA 4MGSA 1LHUA 4S05A 4XACA 4YVSC 2RAEA 4BQYA 3H3LA 4M3EA 2I07B 3TYJA 3N35A 4AVVA 1ZX5A 3UGFA 4BMBA 1QJX1 1AR73 1XG1A 2XBO1 2BNOA 1W2AX 3CDIA 4D6QA 2Y6FA 2DJIA 2K46A 4WVZA 1OVPA 2M87A 4K40A 5E3LA 5C4XJ 1NLSA 1U6GA 2R0FA 2JVGA 4RGRA 5HDGA 3BG6A 5K5OA 5D8AB 1JKRC 1WI3A 2D5VA 3J8F2 5FCCA 3VYTB 1S55A 1VBB1 4UV8A 4JGYC 4ZY9A 1ZNPA 5HLGA 2Y31A 4W6WA 4HNTA 1QZZA 1H2LA 4AM3A 1UU5A 1FOD1 2WN3A 3VBRC 1SG3A 1TTYA 4XPVA 1T95A 4AHXA 2FOWA 5FLMJ 3FXKA 4EQVA 2E1MB 3BG5A 1GZTA 3IP4B 4AOCA 1F5TA 3E1SA 5C8WA 4BEHB 4MLOA 3NW4A 4PJMA 3WX5A 1BYHA 1CWPA 1S0JA 4AU7A 1OH4A 4LPLA 3POJA 3TW6A 4KI5M 3ZFEB 3G1OA 3VBFC 3QYFA 5DXDA 2F5EA 1TMF1 3TBDA 2OCCH 4CDQC 1HB1A 4XSZF 5APAA 4BOWA 3B94A 5FKLA 1U0AA 3HBKA 2R7FA 1CX4A 2O14A 1Y1WJ 2BOIA 1QF3A 1JUIA 3BR5A 2DTZA 4NRPA 3TMOA 4AW7A 4F8AA 1BR1A 3NO8A 1CVNA 3WG9A 3I49A 5ED4A 1VMHA 3NVCA 4Y5SA 1OKOA 2HYXA 5D5WB 2ZGPA 1K5JA 1RVF2 4FE7A 4BZ4A 3N7LA 3O5SA 5FYUA 3PTRB 1OPCA 3AB0A 1ETVA 1IDZA 2Q8KA 1MPXA 1SLLA 2GNTA 3G7DA 1G8WA 2V6CA 3MPPG 4XJ9A 5J8CA 2GALA 5A3TA 5HLIA 2H0VA 1V6NA 3JRIA 3BOPA 2DT7B 3FUQA 3GO5A 1AYN2 1K5MA 1TWAJ 3IH3A 3WTSC 2YU2A 2ZBKA 3ZQGA 5LWBA 2DT6A 4XM3A 1E57A 1YX3A 2CGOA 2E33A 3OPWA 1ZBA2 2B42B 1QXRA 2EIKH 3LB9A 2LALA 2H94A 4H2AA 1SLCA 2CFXA 5K7FA 1OR7A 3A0KA 4RM2A 3BY6A 2Q2EA 1QQP1 4QAWA 1T08B 2V6EA 4UUSA 4X8NA 4FAHA 4AEDA 5KHIA 2ESHA 2BJSA 5BNPA 1IN5A 1S7EA 4EGZA 4MHUA 3OY9A 3KGLA 1M4WA 1X1BA 1GUUA 1S2KA 3EUHA 4P9JA 5KHKA 4YM1A 3I97A 3BQZA 3POWA 5CFCA 3GZ5A 1SD7A 4KBBA 1OCRH 4PBOA 2W68A 3J80Z 5CVJA 4ZPIA 1UL9A 2X29A 4R4ZA 1NY71 3DCQA 5FKOA 3AX4A 3PNTA 1QXPA 4GGGA 1UFMA 1APNA 4QQ2A 1EV12 1M1EB 5C9AA 5FYMA 1TC3C 3H8UA 3K48A 3WF0A 4D8MA 1ON1A 3PJYA 4BE1A 4Q0VA 3GBGA 4ET7A 3LSEA 2XGXA 1Q3EA 3OSGA 1W8OA 4JTOA 3VWBA 1D0HA 1F8VA 4RGAA 3B00A 3FHAA 4N43C 5GALA 3S15J 1LE8B 2E60A 3EDPA 1EAH2 2RHPA 3W21A 5FMOS 1DF0A 5EQUA 4U7DA 2Z69A 1R5ID 2QSGX 3K1NA 1GHCA 3LFMA 3OYFA 1ND2A 4FVVA 4MO7A 2ZXWH 3SZPA 4OUMA 3F0CA 1H1IA 3H5RA 2EB7A 1SBEA 3R0RA 3KX2A 1OLME 1YITI 3IIAA 2JUCA 1SFKA 1EH7A 1VIWB 3ORJA 4OHWA 4QPIA 2GC1A 1PK6A 2MG4A 4HLXA 2JA6J 3BOQA 3BR0A 1RUNA 2OUHA 3M8JA 4LBNA 1ZG3A 5DD4A 2PQQA 2IJLA 4MXWB 2FHRA 4NHYA 1COV2 4BE3A 5BYNA 2VBXA 1Q56A 5E3MA 1S1AA 3P6BA 2J22A 4ITCA 1VBA2 2YV8A 3VBSA 3HJEA 3FX3A 3C7OA 4IHSA 5D5XB 5ABJC 4ZTJA 1OUXA 1R5HA 5CA6A 2OTLI 2RMU3 4PJNA 1G4DA 2H09A 4J25A 2D1HA 3JB4C 3L9FA 4WXCA 1RHI2 3RI4A 5FPVA 1K45A 3B3QE 4DFSA 1AR62 1G59A 2XLGA 2WAEA 1GOHA 3AG1H 3C2HA 3JRHA 4W97A 2WO7A 4LR4A 3WP3A 3KM5A 4IERA 3NKTA 4XUQA 5LY1A 1UG0A 2DUOA 2Q5TA 3GTKJ 4Q4W3 2XAFA 2L9VA 2M5WA 1E3HA 2WRAA 5FOBB 4LQRA 5FFOC 2JD9A 1CPMA 4EE2A 3CF6E 1RUC1 2R1DA 5E6HA 3E0JB 1U5TB 2EFWA 2R042 2RJKA 4CU8A 3JAMZ 4C1WA 3LD8A 4TLFA 4EWDA 5DUWA 1KQ9A 4KIBA 2CV0A 2AEYA 3HRMA 5K7HA 4E27A 1TWFJ 2IVIB 3VDDA 1V9U2 4ESFA 3AKTA 1UOFA 4C3HJ 1FTTA 1MVEA 1VBE2 2PAEA 4AGGA 1VFCA 1RMU2 3WTWC 5I0TA 1ASJ2 4B3NA 1SC7A 3ABTA 3SEEA 5E1WA 3HRTA 5LATA 3ERED 5FY9A 4J1XA 2YX7A 1DQ1A 3RVHA 1IKPA 3P5BA 4QM8A 4LMYA 1QOOA 2X0LA 3I2JA 2AQEA 1PGW1 3MKWB 1DYPA 4CEYA 4G6TB 1GSLA 2HR3A 3OS1A 4AIKA 1O4ZA 2M45A 4QDQA 4XQWA 2PMUA 2DBBA 4AD9A 2OPKA 4PF5A 5IYCJ 4EV0A 4RGXA 2EZLA 1NT0A 2HWE3 2AXLA 2SLIA 4NHXA 5F0HA 2K9QA 3MD2A 1MH4A 3N4MA 3WGIA 5DUUA 3U11A 3ZSJA 2QSHX 4KUMA 3OOUA 2VIXA 3OCPA 1I3QJ 1IOAA 4X6AJ 3F6VA 2A6ZA 4NR1A 2XDVA 2MC4A 5A3PA 2BVMA 3GF2A 3DL3A 3PIOF 1WSUA 1V6LA 3LIHA 4XTMA 2GOXB 3V7CA 1FYKA 3QH7A 2ZGTA 2LBFA 4M6XA 3BALA 3FK7A 1FPN1 2HWC2 3V7SA 2X1EA 3AL0B 4YM2A 3IM0A 3BR1A 1EH6A 4FPEA 1S8NA 4LBOA 1NCRC 4Q2FA 3AZWA 1D3YA 2B46X 5D21A 3HC7A 2FCVA 4P5OA 4OMZA 1H0BA 1NQJA 4A3CJ 3S2HJ 2H1KA 2YX4A 1RKTA 3O12A 3PO3J 3MICA 2DYRH 3KHBA 3OJBA 4I3PA 3BPXA 2D40A 4MADA 1WI9A 4EZHA 1JMUB 3NAPB 2M8EA 1J75A 1BEV3 4CXWA 2OZUA 4E2GA 1E5SA 1P4AA 1ND3A 1VBD3 3VBOA 4FPOB 2B7EA 1X8EA 1R4NB 1QJY2 1Z3XA 1VP6A 1FX5A 4J6GA 1RYYA 2RS32 3PMEA 1SCSA 2AS5F 2DTRA 3DBRB 2W0XA 2EV0A 2WZR3 3B6CA 3I2GA 1T33A 4PHZA 5EWSA 2VOPA 3MEXA 1FMD3 3M8EA 1YE9A 2PQ8A 3SDGA 2YR2A 2IA1A 1RIRA 1W9YA 2E26A 1RJ7A 2XAQA 3GALA 4FQGA 1HKDA 3T08A 2Y34A 1I3AA 1HRV1 1SQ4A 3OUHA 5H9RA 1YJWI 4CYCB 4M9XA 1WGXA 1V5GA 2IXLA 4KIGA 1LEDA 2VKEA 1ONAA 5FPUA 2AEZA 4CH7A 3POBA 4IHWA 4XOPA 1R9TJ 2R5YB 4UFMA 5J1YA 3BCBA 3FZ3A 3JRDA 1S72I 3AP6A 4A3FJ 2TBVA 2PLYA 2MYSA 3P7NA 4RBOA 2ZPXA 1KQRA 3VZNA 2BW8A 3L1PA 1F9NA 4COUA 4LIVA 1RZ4A 2QYOA 3HPNA 1IRFA 1JXSA 1E5IA 2KT0A 3MKYB 3WDWA 1NA1A 5F3IA 1XSQA 5LK7B 4UFLA 1LEBA 5LBFA 5JZGA 1CAUB 4Y1YA 4Q26A 1H2MA 1W4MA 5FUIA 3H1MA 3OGRA 4FFFA 1W6NA 5F2SA 1LOGA 4DNCA 2LRPA 3VN4A 2ERFA 4V2FA 1Y39A 3V0BB 2IBDA 1UO9A 3M1EA 2EK5A 4EN6B 4PCQA 4BIOA 4DNYA 1GDTA 5FZBA 2F4OB 4UOJA 2BGCA 2Y69H 1ULFA 3H42B 2PLV2 1JYXA 4LOCA 1XYOA 1Z0XA 4BNCA 3DF8A 4BJ0A 4CA9A 3S3OA 2ZFUA 2HNHA 4HPQA 1BXHA 2A3WA 3H1WA 2ZKZA 5FXWA 1EPZA 5JXJA 1T8IA 4Y33A 2FDIA 1AF9A 1WJAA 4Y17A 3USUB 4XDPA 2OYZA 3POSA 3AYCA 3TRSB 4WM7C 3DGTA 1HF0A 2O5RA 3H9GA 4XF0A 3NNJA 4AG4A 1JHNA 4HZFA 4TXWA 1SLAA 4I09A 4JKMA 2IT0A 3ZXGA 2P3KA 3NNMA 1WCKA 4HBNA 1YWKA 2BDRA 2HPIA 4U87A 1CD3G 3KP3A 2VL4A 5IFTA 4ETSA 1ACIA 1VAVA 2ZX4A 2QDNA 5JWPA 5JR3A 3KPHA 1J84A 1W6QA 2Z2SB 1KZHA 5C3EJ 3O6BB 1O59A 3WDUA 4U36A 1YFHA 3QOPA 1XJAA 4K21A 1RUE3 3O2PE 1RINA 4CDUA 2GNDA 2WWUA 5A80A 1X2MA 4LKDA 1JKOC 4KITB 3ELNA 1PGL1 2XLAA 3RCOA 2BY2A 5DS9A 2RDPA 4IESA 3HWJA 3ZSMA 3E1F1 2R063 1JYWA 3N05A 2DFCA 3K77A 2BTVC 1UW8A 2QZ2A 5FYVA 3SEZA 1OOPB 1RIOH 2H8RA 3LGRA 3TGNA 2ZEXA 1AJOA 2FBIA 1W2NA 4IRHA 3SQNA 2WB1N 4F3QA 5JR7B 1FYUA 5FP8A 1O91A 3KEOA 4FX0A 1XNTA 1KFXL 3GTMJ 2V9KA 1UY1A 2Y26A 1X3UA 3J80K 4BK4A 3PMSA 2VZRA 3KF5A 3Q8EA 3UGHA 3T0BA 1YQAA 5LBEA 1LNWA 2WJSA 4XF3A 4HMZA 2PI0A 2NVUB 2QCOA 5F5IA 4KYWA 4EYUA 3SQOA 1IN6A 2AH2A 2WFF3 4BDZA 4DQ2A 3AK0A 3MLKA 2DDUA 4ATFA 3MLJA 1GZWA 3IDCB 3WP6A 5IVVA 4II2A 4PGGA 2YROA 5J48A 1V5FA 3H5NA 4BB3A 4NIGA 2JPCA 4FPHA 1VE0A 3AVRA 1HLVA 2CH0A 1BVP1 2W92A 3ECQA 1T56A 2Z9OA 1UQXA 1REPC 4BQ5A 3CO6C 3ZR5A 1PVC3 3MI8A 4LBJA 2QQAA 2M1BA 1X58A 1JOJA 2DYSH 3ROUA 4FE4A 2G9GA 4CXFA 4RD7A 5A70A 2OKXA 2VC9A 5L7OA 2Y60A 2VH9A 3FXUA 4AI2A 3DLLF 1LCLA 3WTTC 2HQ5A 3DXJF 3PTYA 3FDYA 4R9AA 5AFBA 4Q4V1 2VN2A 1O6UA 3WHTA 3MMYB 4HN1A 4M72A 3WHBA 1HKTA 4K7JA 4XKVA 2B5HA 3CUOA 4FPJA 4LEJA 2OQ7A 2FQPA 2DMQA 3T2PA 4CDGA 3K0LA 5K7PA 2ZJ2A 4FPGA 5ICGA 4CP0A 4QDSA 1DZQA 2VPLA 4M3CF 2VONA 4DRRA 3U07A 4WXDA 1UHWA 2E7TA 3O1TA 2X6OA 3HXLA 3IZOA 5LY2A 2RS11 4MZUA 2F4MB 5LA1A 3VZMA 4HFSA 1AHDP 3VV1A 1YX5A 1PHMA 2EPFA 1TW2A 4XILA 3ABZA 3ZFGC 2BP6A 1NG7A 3MZ8A 2JN6A 4HSJA 4GULA 4MGKE 1YI7A 4MNUA 2OV7A 1R1A2 2DPUA 4N53B 3LAGA 1KGSA 3HKZN 3A2KA 2VXZA 2JB4A 2Y38A 4HLTA 3I3LA 2W24A 2PYTA 4Y15A 4RHV3 2XPVA 4IVNA 4S2HA 2B63J 3SXWA 2D6NA 1O8SA 3L2VA 3U75A 4QLCU 1ON2A 2TRTA 2XQXA 1W6OA 4DYCA 2BVVA 4MXVA 2RC4A 3GLLA 3JAMK 5FZ3A 1H8TC 1LPQA 3SEQA 1DQ4A 1TME1 3RSJA 1H8AC 5C7GA 5FJHA 1V4RA 2OC6A 1W0NA 5JHUA 3NV3A 1A6CA 3OD0A 2CG4A 1J1LA 1BI2A 3ASOH 3OGVA 4NIDA 2DYCA 1JHHA 2EFQA 3EXUA 2VKHA 4HKWA 2V72A 2VOVA 1YFXA 1AZDA 2Y2ZA 4EN7B 2VW0A 4YM3A 4JX5A 3ABUA 1WZXA 3F72A 3LWCA 4QGLA 2IVMA 1G9FA 5CEHA 2HU9A 2XJUA 4XFFA 5J1UA 4W6YA 4Q1RA 5E16A 3H0GJ 3PFIA 3T8TA 1QVUA 3FMQA 1K12A 4W50A 3BGAA 4M6VA 2YDEA 1IGNA 3WHCA 1LHOA 3O1PA 3I0TA 2ZACA 1U3EM 5A32B 2XONA 3OYMA 4DXTA 4E4HA 4U0VA 3WNOA 2RQPA 2Q8CA 2VJXA 3L9JT 5C5UA 1FNNA 4MFDA 5E1XA 1POV3 3K75B 1SFPA 2EFNA 1W05A 3AL5A 1JYNA 4CUCA 1UY0A 1AL0G 2LY2A 1EUUA 3Q0WA 3R6SA 3JCIA 1W5SA 2I5UA 3L2YA 1D2QA 1FNZA 4IHXA 1GNYA 2MNGA 1TZOA 1KU2A 1QJFA 1JZ6A 4RAGA 3K4NA 3BR6A 3ML6A 4DBQA 4AZZA 1QZYA 2UWBA 1HBXG 4UW4A 4HVOA 2IFRA 5FY7A 1RI7A 2R92J 1B9NA 3DF0A 3T0AA 5FD6A 3JRBA 4RSUA 3OR1C 2HGCA 1BM9A 3E7LA 4IE5A 1GNHA 3VHNA 2FDJA 1JU3A 4QQPA 3PNAA 3J7MA 2BE5F 1JKPC 1NCRB 2V1UA 3CUQB 1W28A 3ZSKA 3S8PA 3OUIA 2RGVA 4L18B 1WPKA 4Z2WA 2BEOA 5EHDA 4ONUA 4BBSJ 4I98B 3AJYA 1YOVB 1EF4A 4KG0A 2J1SA 4C1XA 2IXSA 2PJRB 2PHLA 1J59A 1SBFA 2C5DA 4TZDA 2HJIA 1MZBA 2AZ5A 2O3FA 4YW7A 2CUFA 1NLQA 1R081 3JU9A 5C4WB 2W84A 1GOGA 1MMNA 1LU1A 4YLZA 1Q1VA 3OEAA 3ISPA 4LHSA 1FP1D 2Y0SN 4P00B 4NRQA 3IPVA 1DIWA 3NEUA 4LT5A 3ON7A 5DZEA 3S5QA 1I5PA 3ZDSA 4Z6YA 3AKZA 2Y6JA 2L7KA 2QQKA 1MJAA 2EWNA 1RUH1 2W7NA 4DXSA 2OXBA 2Y48A 3CF5F 1GLNA 1YIOA 4KGQA 4BQNA 3H5AA 2PHRA 2X48A 1D4VB 3ZSLA 1ZYRF 4RB0A 2VODA 1AXYA 1FV3A 1SFUA 4XZUG 4BQ1A 1X3ZB 3E5UA 4JKLA 4WVWA 4LBLA 2XWJB 3VKMA 2PAMA 1LHNA 3ZYJB 4BH9A 3KV4A 2Q8OA 4GA9A 3F9KA 4ES8A 4HK8A 4A42A 4MVTA 3Q9SA 1W3XA 4AR2A 2IUWA 5CPRB 4XR6A 1KGYA 2W1OA 3VD3A 4N9IA 2ZAHA 4BQXA 1K6YA 2W48A 3HZJA 3ZMTA 1XSRA 4KJZA 2LKXA 4I30A 4AGVA 1UZZA 4W1UA 4QX2A 1NX9A 4KH9A 2GMEA 3PUSA 5FD5A 2L4MA 2EINH 2X1DA 3DPRA 1KEXA 4W6XA 2P3YA 2HXIA 1T38A 5FKMA 2Y0OA 4ZS3A 5K5QA 1OYIA 3WQ7A 3OOXA 4INDA 3TEYA 3A23A 4PIZA 5A7WB 3M2MA 3HBLA 4NVPA 4Q0PA 3HSEA 5E18F 3PU8A 2IRFG 1H9WA 1QIQA 1V9U3 4CEWC 2ZMKA 4TSVA 4ZU4A 3JRCA 4IV3B 4RQPB 4JKKA 4XKWA 5CQGA 4FETA 2M0MA 4CXYA 3WQ1A 3F8NA 3AMNA 3AMMA 2DV9A 1BBT3 5BNNC 1JKQC 5BNOA 5FY1A 3THCA 2A70A 5IK8A 5BPDA 3M7AA 1CIYA 2LMDA 2VE8A 2LYCA 1IN7A 4OHVA 1MNMC 4YW2A 1WUVA 1OHFA 4XF4A 2X6XA 4FCYA 3K1PA 4KFCA 5FY0A 1LDDA 4O65A 5FZ0A 3S7EA 1RUF2 2VQAA 1MEC3 3ILRA 4XDOA 1KU9A 2W08A 2QGUA 5KHHA 3U1XA 3J9SA 3IWFA 5M3MJ 2UURA 5F0FA 2VTXA 2VW2A 3O1MA 2V9PA 2WNEA 5JAXA 3DU5A 4LGWA 1ENQA 1ZA7A 5ACA1 2RJLA 3BR3A 1H4GA 2D44A 1AL22 3H35A 5F6FA 1S9HA 1F43A 5C44J 4EJWA 2PAKA 2J1RA 5K0UA 5C3PA 1Z7LA 2E7AA 5HNFA 3S3MA 4LJHA 2VCCA 5GLVA 5FKBA 4IOCF 4C30A 4V2GA 3QODA 1PO22 2XV4S 1N77A 2HBUA 2QCSB 2FQ3A 1B9MA 4DS0A 5DPNA 3FWEA 2XGEA 4YG0A 3FKJA 1DUXC 2K5CA 4S0HB 5JXGA 2XAJA 1HW2A 4GQ7A 3ME2A 1UHMA 2RVAA 4DUXA 4YRVA 4DB5A 2ZX3A 1O7FA 1XCBA 2L02A 2R5ZA 1YQCA 3J8F1 1QJX2 4CDWC 2NNNA 5FAXA 5LBBA 2XBO2 1NKGA 3W5MA 1BLZA 4CP9A 4UT5A 4P9XA 2QJVA 4XLEA 4GH4A 4WM8C 3WNLA 5EFUA 4OIPF 2EIEA 4KU7A 1PVEA 4MEYF 3OYHA 3FBYA 4OMYA 1Y9MA 2NLRA 3KSCA 1D4M3 3LEGA 1VBB2 2VW1A 1AR93 4N7IA 4MGQA 2JA7J 2KXLA 1JI6A 4E7IA 5FYCA 1QY4A 3I3BA 3LQQA 3D0SA 1BCXA 4D1QA 4P9IA 4DOUA 3M3OA 3K2ZA 1FOD2 3MLLA 1V6OA 2OTJI 3VLBB 2RR11 4XJZA 1GV5A 5FO7B 1XC5A 2KD7A 3I2DA 1K5MB 2GA2A 2ZHKA 3NJZA 1WRJA 5FZIA 3USSA 3ZFFA 1BQPA 1Y56A 3CLOA 2CYFA 4OUEA 3U9GA 4HF0A 1TMF2 4M3CE 3KZYA 3GYDA 2Q2EB 4YG6A 2J1VA 2RQQA 4XOTA 4UUSB 2P6TA 1X82A 4D3WA 2QQIA 2HOSA 3WUDA 5KNLA 5L19A 4AEDB 2DVBA 4DINB 5ANQA 5BNPB 3BTZA 2VZSA 3PU3A 5DG1A 2X09A 2WV0A 5FO5A 3LZZA 4RR3A 2JMWA 2X85A 1DP0A 2HDDA 4NHMA 3RDIA 1ZBA1 1TVGA 2GBYA 1JYIA 4IGPA 1D7PM 1U5IA 3ZYBA 3ZXSA 4JRLA 3BB6A 2WNVC 3DEMA 4GALA 4AQ2A 4YIIA 5M5XJ 1DCSA 2ZMEA 4LBQA 2V4AA 5GZDA 1VQMI 4AXOA 3CMGA 1B59A 1QXJA 2K27A 5C9AB 3FISA 4XETA 5FZHA 1DYOA 4FFGA 2VBZA 5GAEJ 1H30A 1BC7C 2HFHA 1YFYA 1Q8OA 1VRH2 2ZJRF 3AMQA 2DCTA 2GDFA 4V1PA 1YW7A 3NRVA 2ORZA 3TN93 1RRJA 1DQUA 3RJ2X 5HXVA 5A6QA 2ELKA 3DUIA 4Z92B 2WYFA 1LFPA 2Y0IA 4GDFA 2VECA 3ZN5A 2OA2A 5EJ3A 4CCNA 4O9EA 4A3DJ 2GZWA 3WE2A 5FDBA 2BNNA 4PK4A 2CUZA 5FWEA 3D3AA 3C7EA 1QU0A 4QWQA 3JTHA 3ZMVA 1R64A 4QPIB 1OF4A 4HG6B 1PK6B 2ZGSA 4CCKA 3D82A 3LL7A 4M6YA 3LEIA 3RQ4A 2KR2A 1E3OC 4JX6A 1EAH1 5D4SA 3M3YJ 2P6CA 5EJ1B 3ALQA 1SFNA 2DOFA 4L0PA 4B4PA 1N3OA 3EMRA 1SEUA 3RZZA 1J58A 3HOXJ 1MGTA 4AI0A 3C7HA 3VBSB 1B8IA 1VQ6I 4YZ2A 2JJ7A 2BUKA 2TCTA 2UYBA 1JOBA 1TZLA 3WNXA 5FIXA 4YZ1A 1ZZBA 1RUD2 4A2UA 5A7SA 5AC91 4TWTA 1F4AA 1MS5A 4XOGA 2B9VA 5I93A 3Q8CA 4UY8I 2JG8A 3IBMA 5FYBA 3AKQA 4LIUA 2UXXA 2VCBA 1Z7S3 1VQPI 5DDJ2 4BHPA 1P2FA 2FMYA 2P2KA 3O1UA 3DXUA 5F3EA 2M3AA 4EM2A 2CFOA 2P5LC 2F17A 2EIJH 1PGSA 5EG0A 3D4KA 2UWAA 5EJZB 4GB33 4WVMA 2D6KA 3RZGA 2LOOA 2EIDA 4H14A 3P1IA 5FO9B 4MGYE 3U4SA 1K61A 1BKZA 1EJ9A 1O5LA 5CAZA 3FZVA 2VR4A 1CZVA 3FXLA 1AR83 4DUVA 2MLGA 3IUOA 4AVPA 3VDBA 2QZ3A 1S0BA 1GXPA 2AC1A 1GKBA 4I3GA 4CP2A 1DGWY 2WKKA 3HEIA 3VDDB 4RB1A 1RHI1 1SD6A 2ESNA 2W57A 3KYDB 1YQ2A 2VO5A 3K4CA 4NIHA 3AYEA 3CDHA 2AR6A 1S2BA 4NUBA 3S3NA 3WINE 1R36A 3OY8A 4BACA 2VKDA 4CEYB 2BFUS 3LAPA 2CWMA 2VUDA 4YRDA 2LF8A 2A5YB 2HVQA 4MX3A 2JDMA 4ZDPA 4OU0A 1W5TA 1ZK8A 5E79C 1SLTA 1PZ9A 2ZGLA 2TDXA 3OSFA 1HRI2 2B9UA 3VDAA 4N0BA 2AYHA 4QHOA 4IEUA 1UCRA 5F27A 2JRMA 3QPLA 4JYKA 2E5NA 1RUC2 1RMU1 1JI8A 1ASJ1 1VB4A 2ZGRA 2FJ1A 2DUQA 4HVRA 4QKDA 4Q5SF 4O6JA 4QKBA 3ZRGA 2NMNA 3N36A 5CQEA 3I4NJ 1HXDA 4D7MA 1I1SA 3PVEA 5EXOA 3ABKH 3SXYA 2LBFB 3KVBA 3JXSA 1VAKA 1TT5B 5E17F 3WF1A 1APLC 3MDPA 1J9IA 3PJRA 2B39A 3CQOA 1CAVA 2X53S 1ULEA 5IVYA 5FYIA 4YZ5A 3AZXA 5JCTA 4ENMA 3RYPA 4PGHA 4I76A 1PGW2 1MQTC 2JB8A 3MF6A 1P7JA 3CJQB 3TDZC 3ZMZA 3JRAA 2ZKNA 3I7DA 1LDKB 2CMPA 1AYM3 1DFQA 3RPUA 1A8DA 3VBUC 3CNAA 4HG2A 1YQ5A 5CFDC 3X29B 1C5IA 4O5VA 1F31A 3K4ZA 3KYLA 3LFIA 1ND3B 3VBOB 3WGHA 1JGGA 2D5HA 3TEWA 1USSA 2ZC2A 4I0BA 1TWGJ 4XQDA 2PELA 5HLHA 4W4ZA 2FD5A 4EZ4A 1KONA 2MHFA 4HNVA 5ILSA 2E7WA 1J7KA 2WAQN 3FBIB 2JWPA 4FTHA 4NOTA 2C6SA 1PUEE 1W0TA 2VQLA 1FPN2 3PFYA 2GNMA 1B4AA 3GTQJ 3LPFA 4NO4A 1T39A 2OCEA 4LLOA 1ODMA 5FY8A 4NC8A 3F8BA 3BU7A 3EUKL 4Q4X3 5J47A 3RZJA 3JBG3 2CQQA 2Q4SA 2RMU1 2CS3A 3OEBA 2RS31 4PDWC 4EJUA 4ZZLA 1YXWA 3CESA 2VJ5A 3H0DA 3D0JA 2RDRA 2ZEZA 1OCPA 1NXD1 3LNQA 1QBJA 3KP5A 5CVVA 1WD4A 1N75A 4F52A 2VQUA 2QQPA 3RNSA 1QDOA 2YYOA 1D0YA 3JR9A 1VBC3 3IC7A 2DFFA 4Q4W1 2A75A 3THDA 1XGMA 4BQ2A 3P5JA 3HTSB 2CQ7A 3WU2C 3FHIB 2AREA 3ZQ7A 3OYEA 1GXQA 1TWCJ 4DPNA 3TEXA 1BI0A 2W85A 5LEJA 1UZ0A 2A6YA 2VTXJ 4GZ9A 1YYVA 3GTOJ 1OURA 1OJLA 2A68F 1NA1B 3KP4A 3QU6A 3AM2A 4IEVA 4D6RA 1HX6A 5JZGB 3PSFA 1VTNC 2ZJQF 3KZZA 4WXHA 4G8XA 1W6NB 3ZMNA 4UWDA 3VL9A 1LULA 1LFBA 2DDBA 1HRV2 2D97A 5D5UB 1XQNA 4CICA 3PIJA 2DA5A 2VBPA 1PZ7A 2DTYA 2P37A 4BQAA 5FXZA 3ZXEA 4YIRX 3MAJA 4UBHA 5GZGA 3C7JA 1LOFC 2E2HJ 3CLQA 1VZ0A 1RUJ2 1Y8RB 4Y1XA 2IS2A 1ZH5A 2HWE1 5FZKA 5GADJ 1BJZA 2A3XA 5IAXA 3GDBA 3QH6A 4XQ4A 2YU9J 4KDPA 3WG1A 1K7AA 5SV5A 2WSVA 3GFLA 1N47A 1LUJB 4FX4A 3KP2A 3E6BA 4PJJA 3RZKA 5H6QA 2JG9A 2O61A 3PUHA 1DQ6A 1BR4A 4BYYA 4LTAA 2BXYA 3E6DA 3AKSA 3FUOA 2WB1A 5FFXA 2VJIA 3AFHA 3EJKA 1UIJA 2NMOA 3AMPA 3Q9OA 4A3JJ 4ZTFA 4BIFA 2UYAA 1HDPA 3KYCB 1W6QB 2RS52 1XC6A 2NXNB 2X5IA 2CTVA 2ZS6B 2HWD3 4BKXA 2W1UA 3TOAA 4CDUB 2O8OA 1RXFA 4A7KA 4Q48A 1WBLA 3A22A 1Q5OA 1Z77A 4M3GA 1RKWA 4E8DA 4AQ6A 1WVRA 4LLFA 4BE2A 4QPWA 5BNQA 4XRMA 1FTZA 3S1QJ 4YFXF 1B35A 1VBD1 3VKLA 4U0WA 4P1WA 2Y64A 4ENNA 3CJIA 4L99A 4X6RB 3EPZA 4MGIE 2OQRA 2COMA 2WZR1 2HWB3 4QPGC 1ERDA 5C8CA 1ZGWA 1UMHA 2F6BA 2E53A 3S32A 1QPIA 1QNTA 2JDHA 4JDMA 1DLCA 2ECCA 5F37A 1SLIA 3ZM8A 4BA6A 3U0ZA 3S1RJ 1G8XA 1NCQC 3VHRA 2W82A 1GZWB 3H3ZA 3BJOA 4IV1C 1XDSA 2XSJC 4II3A 5LA2A 2STTA 2LK2A 3N97A 4BU2A 3G6JB 4HRIA 3GWZA 3M1CA 4ENKA 1NOVA 5LGTA 1GICA 1YJNI 1A3KA 4LITA 1WLTA 3O1SA 1S4CA 1PNFA 3INAA 2PHXA 2R32A 3SH3A 4XIOA 3K70C 2DOEA 4MGTA 1VRBA 4JQTA 4AYBN 1TQIA 1JH5A 5D8AC 3BCWA 1OLQA 2JIJA 1X3WB 3HKZA 2W1QA 3SFZA 2CW7A 3T4VA 3F3XA 2L0KA 3A0BC 3QBQA 2KIMA 4GFBA 3D5RC 4HQEA 2FRHA 3UV9A 2CNAA 5JI7A 2E35A 3U4XA 2W52A 1CZSA 4HONA 1FSHA 4LE4A 4XDQA 2VY0A 2F5DA 3WODF 2E1MC 5IFPA 2FZ1A 4H4KC 1PO13 4BCUA 2JUGA 1W8TA 4XICA 3PVNA 2R16A 4HSLA 4M0HA 2RG4A 3PUQA 1SMTA 5GM0A 3ZFEC 4AFMA 1T0FC 1FP2A 4HAMA 4KMUX 1NTCA 2WL1A 2JTVA 3ETPA 4GMP3 2X1CA 1XMXA 3HYIA 4OWRB 4XFIA 2ELJA 5KXDA 4IO9F 2BERA 3L2WA 3SCHA 2QVSB 3BKZA 2R0HA 3ENRA 5C5TA 1I1GA 2VGDA 5JR2A 2WY8Q 3I2FA 4DBRA 1UMIA 2FOKA 2HEVF 4Q4V2 5IVCA 1Q1HA 3BG9A 1W6OB 2ZBJA 5ERIA 3I2OA 4BK5A 4HL0A 2WAFA 1OBNA 3FM5A 3T5XA 2GIVA 5HCHA 1HXS2 2W46A 3IV5A 4FASD 2OAZA 1PYVA 3GLXA 4UB8C 4LBQD 3U10A 3P9CA 4UUVA 5T5OA 1H0MA 3I3EA 2LRDA 1I5ZA 2VMDA 3F95A 3W5NA 1RUE1 4WF2A 1AOYA 1Q8SA 4LBMA 4Z8BA 1UHSA 3GBFA 4WZCA 1MNDA 3CCSI 1HW1A 3U1KA 4JCKA 3SHFA 3ZPYA 1LOAA 4RB2C 5FQ0A 3ACFA 1UAAA 2Q30A 4QIWN 4XLCA 2V1DA 2YBSA 4UBGA 1NLRA 2ILMA 1FMVA 2QKDA 3SEPA 2HOTA 2R073 5IPAA 1J83A 3T1LA 3I71A 5HS8A 2XUEA 5KXBA 5F6KA 1XB9A 5EEHA 2L54A 1EH8A 3ZQHA 3TB0A 1O5UA 1W0PA 3G4SI 1K83J 4OQ9A 2V79A 4JX0A 3RQIA 4E2QA 3JD71 4XJAA 1TME2 2QQMA 2QQ8A 4H55A 4QKFA 5FBZA 4A6SA 1OYYA 4IF4A 4HOOA 2MD5A 4R79A 5DM7F 3IKTA 3K69A 4BXFA 2VZ3A 3ACHA 1VMJA 3N7KA 4XRFA 3OBAA 1A35A 5FPBA 1BR2A 3REOA 3OOPA 4CO8A 1Z67A 4NHLA 4YGEA 5GLUA 2R7ZJ 1ZZ6A 5DG2A 5D2AA 2A3SA 3VB9A 4CCLA 2WN2A 5EZHA 1S29A 2Y0SA 2LNBA 2ZX2A 4G4FA 1AX1A 2ADDA 2HZDA 1PVC1 1AHSA 4L0ZB 3TP3A 2DA3A 3N9QA 3BIEA 1ZTRA 3LSRA 3CCVI 3NNLA 5D6FA 4QGMA 4Y1VA 4AQSA 1AU7A 4P02B 4CU6A 1BZWA 4F92B 1HV0A 1AXZA 1JU4A 4BDVB 3OD4A 3JZVA 4WBBA 3VZLA 3LWFA 1YS7A 1KU3A 1PM4A 1G6NA 3LSDA 3FK6A 1FBQA 1U12A 1W6PA 1DBNA 3MIDA 4RGSA 3ZXLA 1SFYA 2BGOA 2VNVA 3HVDA 1QQP3 4EWAA 4R9DA 2MSYA 2KJBA 5FTTC 4WWCA 2Y33A 3VD7A 3MF9A 3IPVB 3WDTA 1IXSB 2VLAA 2LC2A 1YIJI 1Z6TA 5IK5A 4KBZA 1TT0A 2P7CB 2IP2A 1S0IA 3I3MA 4EVIA 1TLHB 3W20A 3BG3A 5K5RA 5I0RA 1A34A 3ZLIA 1FPQA 1KYZA 2B9SA 3A1YA 2RKHA 1T6SA 2ZNYA 2GU9A 4P96A 5GAHJ 2DMPA 1OFSA 4P9WA 1BIAA 3ITQA 4KQ7A 2VUAA 2D6OX 4M01A 1MS0A 1PZ8A 5E3NA 2H1LA 4RHV1 3DU6A 5FK8A 1HKQA 1R093 3UR3C 1MD0A 2FF4A 2YBKA 3FJSA 1POGA 3CCUI 2XL9A 4UI9L 3OYCA 5LK5A 1U5TC 3VBHC 4DO0A 2WSUA 4XMYA 3DKQA 3WGGA 4RS5A 1R082 3OPZA 3EETA 2P81A 1XU2A 4Q1PA 5CISA 1A36A 2G7HA 2ID3A 3N9LA 2FA5A 3H9QA 4F93B 3IKWA 1OKQA 2P8TA 1QGPA 3WDVA 1UELB 2ZFWA 1V5EA 1XS9A 5FZAA 4LA3A 2CQXA 3ATGA 2D2WA 4XF9A 4DXRA 1VQ8I 3WTZA 2ZSIB 1ACCA 1O3QA 2F4IA 3DPRB 1MZ5A 1C4RA 2D3SA 5D5VB 4BQ3A 2QQNA 3VDXA 1MNEA 1WKYA 3MPBA 3NMBA 3RPUD 2A1XA 1IG0A 1HA8A 4PBPA 1H6XA 1MACA 1XSVA 2IWGB 2LS6A 4UHTA 4XN3A 4BL0B 1MZ6A 1QO0D 1KJRA 4ZJZA 5FUPA 1W36D 1GWLA 4XURA 4FTEA 1UZCA 1J0RA 4IXAA 2YB7A 2XUBA 3ZMSA 3TL4X 2UY8A 1LU2A 4K8FA 3DP7A 3P3NA 1LOEA 4MGZE 2WNUA 4YYOA 2D1VA 3RZOJ 5BNOB 5FZFA 2VCMA 1UU6A 4IEWA 5TSWA 4BJ6C 3HPGA 1JHJA 4OIQF 4QKNA 1ZG1A 2OPTA 2JIGA 3NSTA 2J5OA 2VASA 3VOEA 4NAMA 2RVCA 5ICFA 1WJEA 4C2UA 1OT5A 2HVRA 3KT1A 3WG4A 4G7HF 5E88A 1IQAA 3R61A 3TOBA 1RUI3 1Y0UA 3LSIA 4ZYGA 3BLYA 2MPFA 3KB5A 4OHYA 1I39A 1RUC3 3BC8A 3ZOBA 4XVHA 4CCDA 3VYSB 2NYXA 2DMNA 2HZTA 3PL0A 3Q5FA 4A69C 2ZXJA 2LM3A 1G3YA 1XRUA 4QXCA 3WW4A 1MVQA 5K0UB 3KLOA 3SMHA 4OI2A 3MCZA 1H88C 4MEXF 4YEJA 4CU9A 5IK7A 3IMMA 5EEAA 1WMEA 1OPOA 3AXDA 1FEXA 3W3CA 2A6WA 4B1LA 1GT0C 2BWCA 4O61A 1WLCA 4ISRA 1RUF1 2RREA 5JI9A 4BLJA 1UZYA 1ZRFA 5TGTA 1GYKA 1R6RA 5F3GA 2BWAA 4LO4B 3QPSA 2HS5A 2ENRA 4L92A 3O0XA 2ADEA 4LKFA 3DYMA 2OU2A 4Q8KA 2DCKA 3MV01 3VB2A 1FYMA 2RM22 1B72A 4JOMA 1AL21 3ZDVA 2GH8A 2R5ZB 1OLTA 4Y1ZA 5FLHA 1UAIA 2K9NA 1VQ9I 1PMIA 3GHMA 2DCJA 2DWRA 5BOXA 3SJMA 4BXXJ 4CP9B 3C2UA 3CCEI 4AVCA 1LENA 2GA1A 1S7AA 2I74A 2XR4A 2L7FP 4GH4B 4A4AA 2DA4A 3BTJA 3OYKA 2MD0A 3FXQA 2BBYA 4XNFA 4P08A 5ACA2 4ZZ5A 3HNBM 3K3NA 2R1BA 5LRRA 2PHTA 1MBKA 4XFGA 2DURA 2L9NA 1OQDA 2EV6A 2HQAA 3TO6A 1GNZA 5IVFA 3UESA 2HWF2 2LREA 3MFAA 2DVAA 1LAJA 2J7MA 3PHMA 2EIGA 2QQ9A 4P9GA 4UFKA 2HXOA 3T09A 3HOYJ 4IEJA 1I1EA 2P1BA 2WS92 5AIQA 4XUTA 3CJRB 1JYVA 3FF5A 1LE8A 4FOVA 3DTKA 3CHXA 1SVMA 3U21A 3ZFFB 2N8GA 3KV5A 2DBNA 1DGWX 2NVXJ 3E6CC 1GOFA 1MZEA 1FOXA 1TWHJ