3E5UA

Ocpa complexed cprk (c200s)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
219
structure length
215
Chain Sequence
DFCGAIIPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGGNSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNTYNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKIIVYNLGELKHLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation
molecule keywords Cyclic nucleotide-binding protein
publication title Molecular basis of halorespiration control by CprK, a CRP-FNR type transcriptional regulator
pubmed doi rcsb
source organism Desulfitobacterium hafniense
total genus 68
structure length 215
sequence length 219
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e5uA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3e5uA01
4BYYA 2D5FA 3EBRA 3QPHA 3G3ZA 4HX8A 1BJAA 3IBMA 1YG2A 4BXUA 2DQRA 2PQ8A 4AQ6A 3HOTA 4MGZE 2V1DA 1R36A 1ZG1A 2V09A 5JFRA 2PAEA 2OQGA 1LDKB 2HKOA 2VBWA 4JTNA 4MH0E 2CV6A 2IJLA 4META 2H6BA 1H0MA 2Y0MA 4XBFA 1QWRA 2RQPA 3B02A 4LLOA 2L4MA 2N7GA 2VQAA 5JR7B 3MYXA 4KFCA 2M87A 1R5GA 2IVMA 1VR3A 1DZRA 3DF8A 1HKTA 5DEQA 5FB2A 1D5VA 4OU0A 2VODA 4LFUA 3CUQC 4EV0A 5LRRA 3HRTA 1CX4A 2Z33A 3TQNA 2F5EA 1ZHFA 5L3FA 3AAFA 1J7KA 4XFAA 3K1PA 4LK1F 4XFGA 4HF1A 3MQ0A 1Z7UA 4MEXF 3LZZA 5JHUA 4IVNA 3PNAA 3TOBA 2O03A 4A0YA 1OYIA 4QWQA 1DPRA 3FMSA 1CAVB 2MH2A 5FQ0A 4ESBA 1CAXA 1XMKA 3E6CC 1B9MA 1RNLA 5FFZA 1TW3A 3SZPA 2CFXA 3ZMUA 2ET1A 5CLSA 3LOIA 1F4KA 4KT5C 4EM2A 5FLIA 1FLIA 2YSRA 5D4SA 1KU9A 3H3UA 3CUOA 3GFJA 1EH8A 2JZYA 2HOEA 1FOKA 4IESA 4QLCU 3DFGA 4KWLA 1FSEA 3SCGA 2G7HA 3GYHX 4EROA 3UKVA 4A12A 2IT0A 2M1BA 2DFIA 3H1WA 1LDDA 1P4XA 3H8UA 1MDMB 5H20A 5AVPA 3GWZA 4ZYDA 2EV0A 2UYBA 1X82A 2ZFWA 4FAHA 2W25A 2MLGA 3V7CA 3GUDA 2FNAA 2IA0A 1HQCA 4L0YB 2QNKA 3BJOA 5HI0A 4YYOA 2QZ8A 2QCSB 3JW4A 4AXOA 1JE8A 1GQHA 5IT9Z 3T5XA 4KWKA 3U2RA 4Y13A 1BIBA 2MNGA 4AD9A 1S8NA 3E3VA 2MPFA 5TJJA 3H1YA 3V8KA 1IAWA 2EFPA 4YARA 2MBFA 1ZLKA 4Q0PA 3ULQB 2TDXA 4Q0VA 2K86A 5AIPA 1T6SA 3GFIA 1PUEE 2HYGD 1T38A 4RB1A 4CZZA 2A6HF 4O3MA 3G7DA 2O8QA 3ML6A 2ZKLA 3LA7A 4N0BA 3BZ6A 1IXRC 4AIKA 1LRHA 1TTYA 4WZCA 3V4GA 2OA2A 1YO5C 4XEZA 1CAVA 4AQ2A 2OZUA 2DU9A 1U8RA 3BB6A 1O7LA 1UFMA 3WU1B 1O4TA 1SAXA 3ES4A 2ETEA 4ZU4A 3P7NA 4BHPA 4RB2C 2W24A 4L9TA 4HDVA 2ADUA 3RKYA 2XAHA 4RS8A 2O8XA 2GA2A 3FMQA 3PQKA 1ZRCA 3FMRA 2K27A 1LR5A 2DK8A 3I5UA 3D0SA 3J80K 1ZZBA 2IP2A 3HRMA 4AVBA 4IEQA 3HOSA 3TGNA 2IXCA 1P4AA 2ZMEB 2ZNZA 2HTJA 1XSXA 3M3IA 2XL7A 4JK1X 1J0RA 3O2PE 2PJPA 3WW3A 2KKOA 1VTNC 2MHFA 4LLLA 1IPJA 3BDDA 5A2QK 2DLLA 1RI7A 3E5UA 1W4MA 3CF6E 1GQGA 4QGNA 4MGIE 1J75A 1LEAA 1NE4A 3ELKA 3WTTC 4HSJA 4X6QB 4LD5A 3I58A 2NNNA 1KQ0A 2HR3A 1U5TA 4EVIA 3J81Z 1FC3A 3FZ3A 2GC2A 1YFUA 3SCFA 3LAPA 4YFKF 3MCZA 2V9VA 3TO9A 2PMHA 1SD4A 2M8EA 3Q9SA 2CAUA 3CO2A 4G7ZF 2XKOA 2XUBA 4ASNA 2R7DA 1KQ8A 1MJBA 4GXOA 4HW0A 4P96A 5E8GA 1ZRDA 3EETA 2ZNYA 1Z1DA 4A6DA 6PAXA 3NJZA 3F3XA 2GWRA 3F8MA 3F23A 1WRJA 1HW1A 3H3ZA 4I0AA 4CHUA 4G7HF 3NRVA 1ONVA 2W85A 4M6YA 3W6JB 2OA4A 5ED4A 4OLLA 5JSPA 3WW1A 1W5SA 4Z82A 1WQ2A 3VOEA 3IC7A 2C6YA 2Q1ZB 5BS6A 5BMZA 5FLJA 3BP8A 3PQJA 5BPIA 5D6FA 4R52A 3WTZA 1EYBA 1XSVA 1X8EA 1YW9A 2FXAA 4AVCA 3GBFA 1XGOA 4CYDA 3HRUA 4UXNA 4XF9A 3C3VA 3BPVA 4P9UA 3ZMVA 4UV9A 4Q5SF 2A07F 5C6CA 3L2CA 2RVCA 3IL2A 2WC2A 1J3QA 3S7EA 3QRFF 4QM8A 2EA7A 2BEOA 1SMYF 5KHHA 2FMYA 2GH2A 2BYVE 3SCHA 4IEWA 5EFUA 2FMLA 1Z91A 5EZWA 3WTSC 1VP6A 3GFLA 5BPXA 3ZMSA 2H6CA 4RGRA 3ZMTA 1ON1A 2JTVA 3BJAA 2ZCWA 3GX4X 1XE8A 3HSEA 2L3DA 1ZGJA 2XGXA 2BNOA 4H7LA 2ZMEA 2MD5A 1XB4A 2E1NA 1YFXA 1F5TA 3KGZA 5LEKA 2LDUA 1SFNA 1CGPA 3DN7A 5K8SA 3LAGA 1LNWA 3DPTA 4ZU7A 4EJUA 4WWCA 2OU2A 4HQMA 2H27A 5HOOA 1ZLJA 1G3WA 4N9IA 2LSOA 4O9GA 3C3WA 1FWZA 3KFWX 4AIHA 3WTUC 4D7TA 3TKYA 3JZVA 1RTVA 4XF1A 1YW8A 4A2UA 4HF0A 1WSUA 2D45A 2XLGA 1UD1A 3GEZA 3NVCA 4CO8A 1T0FA 1RUNA 1XRUA 2QJVA 2ZO4A 4HN0A 4MZUA 3ABTA 2DI3A 2BV6A 1MKMA 2UXXA 1YFYA 4HDUA 2ELHA 4CDGA 4YG2F 1J9IA 4L5IA 2L54A 1FP1D 2GXGA 2XLAA 2QQBA 4FBFA 2CSOA 1CAWA 3V8JA 1L0OC 5JSOA 4EWDA 3K9TA 4NB5A 3GYDA 3GF2A 4IEVA 1R7JA 1JGSA 4QXKA 4Z2YA 1SD7A 4IHTA 1O7FA 2VOOA 2PHLA 2FRHA 1ODDA 1FBQA 5FLHA 4JQFA 3SMHA 1CF7B 1UIKA 2K4JA 4Q4ZF 3GXOA 4IEXA 2FQ3A 1Z05A 2EK5A 3L00A 2ESHA 3K1NA 4HVQA 2ZJ2A 4EGZA 2K4BA 3O6BB 4I09A 1HW5A 3HUGA 5J8CA 5DD4A 2GU9A 2GZWA 2PEXA 2F4PA 4BAYA 2QUFA 4F7ZA 4WX9A 4UNOA 3KMHA 4I98B 2PA7A 3H7YA 4QM9A 2GA1A 4XFBA 5C8WA 2HWVA 3H92A 3IHUA 1SFXA 4U0WA 4PZJA 3GZ5A 2CYYA 3LA2A 3H1MA 4P55A 3OOPA 4G9YA 2XHKA 1SMTA 4HZFA 4PIYA 1ZZCA 3H9AA 1G3SA 5FQ0B 3EDPA 1DUXC 4G7OF 4YIIA 3KE2A 1BBYA 1B6AA 3USSA 2XASA 1PM7A 4U7DA 3BOQA 1B4AA 1NYWA 4AWXB 1FBUA 1HSTA 4G6DA 3BALA 3U1DA 2Q8KA 1T98A 4EM1A 1DZTA 4HOBA 3HT2A 4ENMA 3U11A 4AIJA 3OTFA 3D5LA 4L2NA 1SD5A 1V70A 1TNTA 1KGSA 1K7AA 1XGMA 5I8YA 2H0VA 1XGNA 3BROA 4MGYE 4GO1A 1I27A 5CJ9A 3TOAA 5I8TA 3RYKA 2EA4A 4LUMA 3M1EA 3M70A 5HDKA 2M5WA 3HIFA 4RAYA 5KHGA 1IF1A 1DGRA 3RNSA 2F5DA 4H0EA 5ICCA 1B9NA 1V4RA 1BI0A 2XROA 4MV2A 1CF7A 4ENNA 3M8FA 1PDNC 2VE9A 4MGKE 1A04A 4HLTA 5D8KB 1EH6A 2QYOA 2P4WA 2DQLA 4N9HA 3H7JA 5H6RA 4O6JA 1GVJA 4OFGA 5DUIA 2VBZA 4BIFA 1MZBA 3HHHA 1UW8A 5BQTA 1NZCA 5F6FA 4A0ZA 1KQ9A 3KEOA 3I54A 3J7AO 1P2FA 4GYGA 3ABUA 2FBIA 2ZKZA 5D5WB 3S2WA 4G8XA 3BY6A 1S29A 2IXKA 2BGCA 4MHGA 5I0UA 5I0SA 3BJ6A 3WW2A 2EB7A 1RIOH 1G4DA 2YPRA 3KP2A 2EVXA 1O3SA 3OGJA 4Q0QA 3SHRA 3F8BA 4KA4A 4UHTA 4OIRF 3U0ZA 1O3TA 4HX4A 3IRQA 5EEHA 1FNNA 2VE8A 4XF0A 4LB6B 4HSLA 5K5QA 3EYYA 1WLTA 3NQOA 5KBFA 4ZZDA 3ZMZA 1YIOA 2W84A 4U0YA 5FLXZ 3ZMDA 3UKTA 2ATFA 5ICFA 1E2XA 5BXXA 1IPKA 2G9WA 5CADA 2C0ZA 1GXQA 5LRSA 2Q2EA 2E1CA 1H1IA 1F9NA 4RB0A 3VB2A 4S05A 2QBYB 2EV5A 4EMSA 5D5UB 4M9XA 3T8TA 4MTDA 3QP6A 3RTRA 2DK5A 5CYVA 1J2XA 1HKQA 3L2HA 4DINB 5J48A 5LHIA 1YFWA 1IN6A 3G73A 3WE2A 1DPUA 1ZZ6A 3HYIA 5I91A 2RDPA 1YFHA 1PP8F 4IJAA 3ZDSA 5JI6A 4U0VA 5J6XA 3LFKA 2EFWA 4XFIA 1JHHA 2CWEA 4KL1A 1ZARA 1I5ZA 3I0TA 4RGUA 1ZZ7A 3U10A 1LEBA 3F8FA 3LWCA 1U5TB 1STZA 4EWEA 4KNYA 2Q4SA 3CTAA 1YUDA 1B59A 5EEGA 2EFOA 4IXAA 3F6VA 1OYWA 4L9VA 1UIJA 2JSCA 3D0JA 3NL1A 1FP2A 1IXCA 3U9GA 1FI2A 1ZYRF 3H50A 2EJRA 1EP0A 5HS7A 1R22A 4IEYA 4RB3C 1O5UA 5HS9A 3T8RA 3J80Z 2E9QA 1UPIA 4GULA 3M8EA 5I8SA 4M6XA 3K0LA 2COMA 4RAZA 3I59B 1UCXA 3W6KB 4RD7A 5AIQA 2LF8A 1ZRFA 1HBXG 4OIOF 3ECHA 1YS7A 4HAMA 5I0TA 2PLYA 2HZTA 2KJBA 2XAQA 4M9SA 1NE6A 1QO0D 5A2QZ 4FX0A 2VPVA 5IT9K 1S7AA 4MUVA 2PG4A 5FD5A 4XFFA 5BOXA 4BNCA 3O14A 2Y48A 4FHTA 4Y17A 3PVBB 1TNSA 4ESJA 2QENA 5DV5A 1O3QA 1YQAA 5D5VB 3QOPA 2QBYA 1CAUB 1UHWA 1O3RA 3HT1A 4B8XA 2F5CA 1KYZA 4HQEA 1TQIA 3LQRA 2PAKA 4WVZA 3LA3A 2PAMA 3ZN0A 1FPQA 4WK8F 4UVCA 3JSOA 1FBSA 1VJ2A 1UCRA 5E18F 5LEJA 2PBIA 1OD5A 3KZZA 4M71A 3KSCA 3E97A 2OBPA 2Q0OA 2A61A 2D40A 2VT3A 3DL3A 1ZNPA 3DPLC 1PP7U 1SEFA 4R1HA 3QAHA 4EQQA 3SFZA 1BOAA 2GQQA 2STTA 4PCQA 2Z99A 4XSZF 5ICEA 5DCMA 1F1ZA 2IA2A 5HDNA 4EJOA 1R1VA 4ZYEA 1I1SA 3V8LA 2ZXJA 5LGTA 3RZZA 4A0XA 5HDGA 4EGYA 2XAGA 3ACLA 2QLZA 3M7GA 4KU8A 1HKSA 4IEUA 3HQXA 4PDKA 1W5TA 2EFNA 4KIGA 5BV6A 5FCCA 1XMAA 2O0YA 1WWXA 1ZRRA 5D6EA 4CXFA 4QGLA 1MGTA 4IETA 1H9TA 2WFPA 3IWZA 5KVRA 2GC0A 4IPAA 1RL3A 2HQRA 4CICA 1CAWB 3IDBB 4JVAA 3FHIB 2KRFA 4YSFA 1OKRA 3RYPA 3RIRA 3QP5A 2ISZA 3I59A 3VEPA 2XAJA 2VBXA 2JRTA 3CLOA 4I0BA 4MNUA 2H94A 1K6OA 3WTVC 3FFQA 1Q3EA 3K2ZA 3HTSB 1JXSA 5HLIA 4OIQF 2OZ6A 1AOYA 4PJYA 4E2QA 5ICGA 4G6QA 5FPZA 1Q43A 3WTYC 1Q5OA 3E6BA 4HF2A 2F5FA 2D5HA 5DD8A 1J59A 4LG0A 3Q9VA 3JTGA 2FSWA 1U6GA 5LGNA 1CAUA 1HSJA 4KUMA 1J5YA 4JBAA 2IXJA 1SFUA 1YW7A 1MJAA 3CDHA 4HA8A 1EY2A 3EJKA 4PIZA 3E6MA 2P8TA 4HVRA 1G3YA 2EV6A 3GZ6A 2P5KA 3JAMK 1QXRA 4LLNA 2FEZA 3LWFA 2UZKA 3F22A 5CU1A 1RZ4A 4KMUX 2IRFG 4S04A 1DGWA 1ZGAA 3QU3A 4Z07A 1BI1A 2YR2A 4YNIA 1RUOA 1H1MA 5J7MA 3R60A 5E1WA 3MDPA 2L02A 3MEXA 1LQ1A 1Z6RA 3FHZA 1U5TC 3RJPA 2PHDA 1OR7A 4UXAA 1W7PA 5KHKA 3WGGA 3KP3A 1P6RA 2VOPA 3LQQA 5J8FA 5HLHA 1D3YA 3FXUA 3CJNA 4IERA 4O9EA 5DCFA 3R4KA 2OPKA 2YU3A 2PTMA 3VFZA 2P5VA 1P92A 2J5OA 4D0PA 1XE7A 1IW7F 4O5VA 4L5JA 3IRRA 4LTAA 1T2KA 2DBBA 2OQRA 4OMZA 2GC1A 1USSA 4P9GA 2GAUA 5KHJA 3COAC 4NHJA 3B73A 2UXNA 2RN7A 2WWYA 1EH7A 2NRAC 3E5QA 4KIBA 2V1XA 4XLPF 3T0YA 5KK1A 3CO7C 4XF3A 3SXWA 1FYKA 3WG9A 3EQLF 1C0WA 4UV8A 3OV8A 2VN2A 3DKWA 1FYMA 2PMUA 1U3EM 3I64A 1LKNA 1MJ9A 4P9FA 2B9UA 3OF1A 1J1LA 4ZU5A 1BI3A 2M45A 3BWGA 2O3FA 1V3FA 1IRFA 4B09A 5D4RA 1Q1HA 4R79A 4IRIA 2VBYA 4KIFA 1OI6A 3P9CA 3ZP5A 5FPXA 2LKPA 2IXIA 4IEZA 4OOIA 1JUHA 1FY7A 3L09A 5L3DA 4KDPA 4WXDA 3KP7A 4KN4X 1ON2A 3N97A 2UY9A 1G3TA 1I1GA 3I4PA 2XV4S 4ZYGA 3CUQA 1Z9CA 2QVSB 4Y15A 1AWCA 2VC1A 3KLNA 3OCPA 1S6LA 4RGXA 2K02A 2YX7A 5CVVA 5D5XB 1LJ9A 5JCTA 1BC7C 1IN7A 3RPUA 4K2EA 4XF4A 2BNMA 2A68F 1FYLA 5E8IA 4LA3A 1TLHB 4KYWA 3I71A 5AONA 3WTWC 2UYAA 5E1RA 2DW4A 2V1UA 2HJIA 3MFKA 2IPQX 2OD5A 1Y9QA 3IWFA 4XFHA 4MTEA 1QBJA 3ES1A 2HFHA 2VC0A 4D7SA 2Z3YA 1OPCA 4LGWA 2OYZA 3CEWA 3BPZA 1GHCA 2FNPA 5HVQC 3S0MA 1RC6A 1ZAOA 3ETQA 1WKMA 3HSFA 2Q30A 3HHGA 1YLLA 1B1BA 2QDRA 4XLNF 2FA5A 1W7PD 5I93A 2QQ9A 1TQMA 3QU6A 1ZZ8A 2Z69A 3BPXA 3MAJA 1IRGA 3F8CA 1U12A 5L3GA 3IIAA 3F8NA 4IEOA 2OAZA 3RDIA 3DXJF 1IN4A 3ZN1A 1NXMA 5JAXA 2CGPA 3EO6A 4I01A 5HLGA 4XFCA 1P4WA 3HTUA 1TBXA 5JVTA 3TNQA 4LUKA 3NSTA 1HXDA 5CVUA 3JSPA 5LGUA 1L3JA 3FZVA 4E70A 4JTOA 3NEUA 4Q0SA 4GCVA 4BH9A 4Q48A 2JPCA 1QY4A 5FO5A 2AS5F 2EWNA 4J1XA 1UHMA 2KIUA 1TQPA 3V7RA 4HVOA 3EYIA 5JSRA 1O57A 3TO7A 2PI0A 4ONUA 4EJTA 4YFNF 1U2WA 4ON0A 2QVOA 2RKHA 4I2OA 1QZYA 1ZREA 1Z6TA 3FM3A 2B8MA 3VODA 4Q47A 1XN7A 1QZZA 1QNTA 4BHCA 2PN6A 2B5HA 3CO6C 1G6NA 4LK0F 4WXHA 2F2EA 2KIFA 1ZVFA 1XGSA 1YTYA 4DQ2A 2FQPA 4M9ZA 4A5NA 2MA3A 3P9IA 1KA8A 3ROUA 1PMIA 3TNPB 2D93A 4XSXF 2O61A 3ECOA 3GO5A 5FDBA 1MD0A 2IW5A 1BM9A 2PFWA 1ZX5A 4XRFA 3P9KA 4A5MA 2HS5A 4GGGA 2UY8A 3ISPA 2RV8A 3KP6A 3GLXA 1RGSA 2CAVA 4MEYF 2A6EF 1D8KA 4XETA 4MQVA 2FE3A 1LB2A 1FZPB 2QM3A 2IA1A 3ZPLA 2FOKA 4ORFA 4BHBA 4G94A 2EFQA 5HS8A 4AVAA 3TO6A 4K8FA 5CVJA 1OFNA 1J3RA 2FBHA 3JTHA 3I53A 2V79A 5K5RA 3IDCB 4ENJA 2XL9A 1IXSB 5CVIA 3KGLA 5K1YA 3RPQA 1X7NA 4JV4A 2QQAA 4L18B 2FBKA 2DPUA 1K79A 1WA4A 1FSHA 2XAFA 2P5LC 1H9GA 4MGRA 3KCCA 2Z2SB 2P6TA 3GFMA 1UB9A 1K78B 2Q0AA 1Y3TA 5DCMB 5ILVA 2DAOA 2XKPA 5FLXK 2Y0OA 3WE3A 2J5PA 5E1ZB 1ULYA 1KU3A 3R0AA 2PFBA 3E6DA 1DDNA 5ERIA 3BCWA 4NVPA 2XVCA 4HBNA 3FF5A 3FWEA 4Q0UA 2KXLA 1GXPA 2A5YB 3E5XA 5FGMA 4L11A 4HBLA 4I7HA 2CO5A 4NQWA 3F6OA 1YWKA 1R00A 4HX7A 4WF2A 5L3CA 3R6SA 4R8HA 2LNBA 1JHFA 4FT8A 5LLQA 5ILUA 4UBHA 3BU7A 2XIGA 1ZG5A 2YX4A 1XCBA 4FX4A 3WGHA 4KU7A 4LMYA 4CGZA 3NKTA 3NW4A 5I0RA 1D8JA 2O1QA 4KMFA 4HLXA 2BNNA 2D1VA 3KETA 1KU2A 3C18A 4M74A 2STWA 4PGGA 4QGMA 2VT2A 3N4MA 5IT3A 3KP5A 4LG0B 3CJXA 2G7UA 3KZYA 3HSRA 4X6RB 3KEQA 4HMZA 1ZG3A 4WCGA 5FFXA 4PGHA 1FXZA 1BIAA 4LULA 3RKXA 2CW0F 2HYFA 1YHFA 4KICA 1R23A 3I7DA 2I45A 2A3SA 4EM0B 3IKTA 3HRSA 4LA2A 5D1IA 2XRNA 3CL1A 4IEPA 2DPDA 1E17A 1MDMA 2P17A 3UKNA 2HKXA 3DQVC 4ZYHA 3ST7A 2RGVA 2BBYA 3FE5A 1OMIA 2HDCA 3M9AA 1K78A 1ZN2A 3DV8A 5L3EA 4UVAA 2Z5UA 1LDJA 2MC3A 1W7PB 3CLPA 1R1UA 2DTRA 4A6EA 2EA2A 4HV6A 2A69F 5LBQA 3WODF 4OMYA 4ETSA 1FX7A 1SFEA 2NS0A 3O3KA 3C1DA 4LJZF 3DEUA 1YLFA 2EAAA 1XDUA 4PIXA 4UUVA 1QGPA 2B0LA 4KN7X 2IC1A 1S7OA 3KLOA 5KHIA 3SHFA 3WTXC 4Q29A 2VXZA 3R61A 3F21A 3TDZC 3OD0A 5L3BA 1J3PA 1U78A 5BPDA 3PLQA 4EJWA 4HV5A 5DYMA 1BN5A 4U88A 3WW4A 4IRHA 4BQAA 2ETHA 3JAMZ 2DT5A 2UWMA 3PFIA 4YIFA 5T3NA 2ACJA 3FM5A 4I3PA 2DCTA 1Y0UA 5D8LB 4LEJA 2CG4A 3J81K 4P5OA 5DUKA 2GC3A 1KU7A 4KWJA 3RI4A 2R3SA 3QACA 2OZJA 2PYTA 3MZHA 2K0GA 2X0LA 1EPZA 2E7XA 4E2SA 2DO7A 2RNJA 3R0JA 2K9ZA 4IF4A 4QMAA 4F8AA 4FAGA 3REOA 3CUQB 1IN5A 2AXLA 4LB5A 3EHKA 5H6QA 4TLFA 1HW2A 4EJVA 4E2GA 2HQNA 2R7FA 4L9JA 1LVAA 4IHSA 4ZZLA 1IZ1A 1L3LA 1J58A 3FXRA 2NYXA 1R1TA 1TW2A 2ISYA 3QPTA 3D82A 2W57A 4GYIA 4TV7A 1O5LA 4YFXF 5FD6A 2PQQA 1YS6A 4OINF 3SQNA 2E7WA 1DP7P 3DP7A 1X8MA 3KP4A 3MWMA 1QXJA 1IUYA 1XD7A 3ERED 3FXQA 3T1BA 1FT9A 1I6XA 4DNCA 1WGPA 1YYVA 1TQ5A 4J1WA 2L4AA 2M30A 2WTEA 3VHRA 2FU4A 1IN8A 4EWAA 2CQKA 2H09A 4OIPF 4I02A 2O6GE 2MLKA 5ILSA 5BUVA 3MPBA 4QX5A 5BY5A 4MX3A 4RGSA 3EQEA 3C7JA 2JT1A 1XCVA 2IXLA 1REPC 1R58A 1ZZ9A 3Q5FA 5K5OA 2MH9A 3F72A 2FF4A 2Z9OA 3WGIA 3RYRA 3EUHA 3ELNA 5CVRA 2VECA 2ESNA 1BC8C 3FX3A 2ET7A 2D2WA 3LSTA 5J3UA 1OYYA 3FJSA 5F64A 4ZH4F 4ESFA 1ZH5A 2P6SA 5E16A 2X4HA 3V7SA 5LHGA 3S7IA 3WU0A 4L0ZB 2P7CB 2L01A 4M73A 2P7VB 2D1HA 2HGCA 2KIMA 1USTA 3K1MA 4ENKA 3RKWA 2NAZA 4B29A 2KJCA 4WBBA 4YRDA 3ZQ7A 4HN1A 1R5HA 2HTSA 2LF7A 2QWWA 1WI9A 1QQIA 4M72A 2XLFA 3SXYA 1XSDA 3SZTA 5E1XA 2RC4A 4AVPA 5JR3A 2ZBKA 5TRDA 2WV0A 1EV7A 3L7WA 2IXHA 1X3UA 1CAXB 3IKVA 1SD6A 4U7BA 3TDUC 2Y75A 3GW2A 4L9NA 2V6CA 3MZYA 4HYEA 5DDGA 4UBGA 2HEOA 5LHHA 5E17F 4IRGA 2VONA 3L9FA 3GVAA 1S3JA 2BE5F 5F1RA 2GIVA 2NNYA 4HLYA 2K7LA 1BI2A 4UVBA 5E20A 2JPBA 4WXCA 4MQ9F 4LLGF 1XDSA 1T39A 3LAJA 2GXBA 1SQ4A 3K69A 1NHAA 1QPMA 1KYWA
chains in the Genus database with same CATH superfamily
4BYYA 4ZONA 2DMQA 1GICA 3ZXGA 3OOXA 5LA0A 2IVIB 2J22A 2DQRA 1KXGA 3VBUB 2E2HJ 4AQ6A 3POYA 3O1TA 3HOTA 1GKBA 4MGZE 1W90A 1ZG1A 2V09A 2EILH 1YRNB 1LDKB 3JUUA 2NZ9A 2VBWA 4JTNA 2RR12 4RR3B 2CV6A 4YELA 2LUWA 3WDXA 3NJXA 3I4IA 1A34A 4UFIA 3WDTA 4BWOA 4XQWA 1FMVA 1Y8QB 5DAVA 5A7SA 3B02A 2RAEA 1NCQA 4LLOA 3JRIA 5ISLA 1BJZA 2PHTA 4NQWB 1PUFA 1VR3A 1RUI1 5IVFA 5DEQA 4OU0A 3ZQFA 3MW2A 4LFUA 3CUQC 2BHYA 5FY7A 5LRRA 2D5VA 3S32A 4Q4X2 4RQPB 5C33A 3CMYA 1QQP3 3TQNA 4IL6C 4CDWC 1VQ6I 2B7EA 2GP3A 3A0HC 3AAFA 4XFGA 1G9DA 3LSJA 3MQ0A 2AQFA 5JLXA 4MXWB 1Z7UA 3OYMA 3TOBA 4A0YA 1T08B 1OYIA 2CUZA 2BOLA 4HFSA 1UY1A 3ZR6A 2KD7A 3SLIA 5C3SA 1CAXA 1XMKA 1W1WE 1B9MA 2BY2A 2D98A 1RNLA 2ZMNA 1Z67A 2K5CA 2R5YA 3BR1A 5CLSA 3BOPA 2VNVA 5JI9A 2DTZA 4EM2A 1DQUA 2JN6A 1WCUA 1FLIA 2JEMA 5D4SA 5J40A 2JZYA 1TP4A 1FOKA 1OHFA 3SCGA 1G9CA 1GZWB 1HV0A 1RJ8A 2IXSA 2IT0A 4CEWA 5F6KA 1BKZA 3PL0A 4JKKA 4ZYDA 3OGGA 3GJBA 3LNQA 2EV0A 2R0HA 3C7GA 4NUBA 3GUDA 2WS93 1HQCA 3S1RJ 5HI0A 2EIKH 2BXYA 3FC0A 4Y5Z0 5IP6A 2WNUC 3JD73 1BIBA 1QJY1 4AD9A 2GNTA 3E3VA 2CH0A 3ZN5A 1FPN2 5APAA 2Q8DA 4URAA 1ZLKA 5AIPA 3JR9A 4XRSG 5CZKA 4QX1A 1ZA4A 3AG2H 3ZM8A 2HYGD 2LD5A 4ZXKA 1QOSA 1GOFA 5M5XJ 1SFPA 3ZN6B 3G7DA 2O8QA 2B9SA 2ZKLA 3G6EI 1F2NA 1LHNA 3TBIA 5FUNA 2W1OA 1VBA2 4MXWA 5LBEA 1IJWC 2BZDA 1HXS2 2B63J 3CLQA 3V4GA 2VZ1A 1YO5C 4ZDPA 4NPRA 5C4JJ 5F1JA 4XEZA 2WV1A 4AQ2A 1U8RA 1VQLI 3BB6A 4AHZA 5JLVA 3WU1B 3J8F2 3HBKA 2B4KA 3L9JT 1JYIA 2ETEA 5H9QA 4RB2C 4IHYA 2ADUA 3QPLA 3ZYPA 5B4NA 1ZRIA 2VNOA 3BZKA 3S3NA 1ZRCA 4Z2WA 3D4KA 2OKXA 2DK8A 3I5UA 2H8RA 1GZWA 1RHI1 1KEXA 2CUFA 4GWIA 3H9JA 2OTJI 1AR82 2H1KA 2F4OB 2AC1A 2IXCA 5J37A 3VYUB 1P4AA 4M3GA 3ZFFB 1VBD3 2XL7A 2RS52 2Y26A 4DY3A 3RZDJ 2QQNA 3O2PE 2PJPA 1QJEA 1IPJA 5A2QK 2XWBB 1CIWA 2W46A 3HOWJ 3IDAA 1LEAA 2W94A 4AQTA 5A6XA 4WM8A 4X6QB 4JCKA 3UGGA 2XSDC 5BNGA 2W0XA 1U5TA 4EVIA 3M3CA 1FC3A 5A7WB 2GC2A 2A7AA 5F39A 1A6IA 1RUD3 2M8EA 1D2SA 3CO2A 4G7ZF 3ZYFA 2XUBA 1GNYA 4XM3A 5BNOA 4K20A 4GXOA 5IATA 4RSUA 1ZRDA 3EETA 6PAXA 3NJZA 3AYEA 3F3XA 2GWRA 3ZN6A 1WRJA 3MIDA 4I0AA 3SFIA 4X8NA 4AVTA 4QQHA 2E7AA 2HWF1 3ZQIA 3U1KA 1LOCA 4M6YA 1PGSA 5ED4A 5JSPA 4P9XA 1U5IA 5A3MA 3VBSB 2BVLA 4COUA 1JI6A 2Q1ZB 3IC7A 3BP8A 5BPIA 1WBFA 2OQ7A 5KC6A 1EYBA 3AP5A 4DZJA 2CGOA 1KITA 2BXZA 2A1XA 1XGOA 1PK6B 5FYSA 4M3CE 4OZOA 1FNZA 3WNNA 3L2CA 4PQQA 1DYKA 3NMBA 5LA2A 2ELJA 2JG8B 4N43B 4LG3A 3PIJA 3KZIC 4QM8A 2FMYA 1ASJ3 3ZMOA 1CD3G 1MIJA 4C2MJ 4P08A 5E3LA 4QXBA 2H6CA 3MFCA 3CJRB 3ZR8X 1H6XA 4FPCA 4Z1VA 2JTVA 1QA6A 1ZGJA 2BNOA 1SHWB 3HEFA 3ZFFA 1GANA 4RA2A 1UN1A 1M06G 4XW3A 1ULCA 2LDUA 4KJZA 3NAUA 1SFNA 4CCEA 5CQEA 1VQPI 3DN7A 2Y0SN 2RDSA 3T2TA 2DYRH 3DYPA 4WWCA 2OU2A 1VZ0A 2HU9A 1G3WA 2A5WA 2HOSA 4O9GA 3WTUC 4D7TA 1VQMI 2AZ5A 4ZYAA 1I1EA 1UD1A 3TW6A 3PU3A 1OCPA 3POEA 3NNFA 1RUNA 3NWSA 2ZO4A 4HN0A 1AZDA 4YFZA 3LEMA 2EQRA 1DYOA 4LJHA 1RUE3 3T4VA 2DI3A 2GMEA 4HEA2 2ELHA 4HDUA 4QX8A 3PUIA 4YG2F 1FP1D 1RC9A 1VBC2 3AZVA 2VXDA 1COV2 5DAWA 2CSOA 2DT6A 3GTQJ 2ZSIB 1DLCA 1PX3A 1SCSA 5JSOA 4CUAA 4EWDA 1AUYA 2LY2A 2WYFA 3GF2A 3LOCA 5GPAA 2CGNA 1JYXA 1R7JA 1JGSA 5K7FA 2V9KA 2YC4A 1KZHA 1RMU1 4PDWC 1JOPA 2JX9A 4IHTA 3JRAA 2X1CA 1YIPA 2VOOA 3L2WA 1S2EA 3ILFA 2YHJA 1J84A 1CF7B 4N43A 1UIKA 1JZ3A 2EK5A 2WBMA 4DZPA 2ESHA 2CUEA 5J1RA 2ZX1A 2LMDA 3K1NA 2VMFA 3OPZA 3SKVA 4XBNA 4EGZA 3FMGA 4I09A 1HW5A 5J8CA 2BGPA 3V0BB 1ENSA 4AVSA 4BAYA 1M1EB 1CESA 1W8NA 2QUFA 1O6UA 3VBRB 1PGW1 3NWTA 4CP2A 3PNTA 4C1XA 2GA1A 4LBOA 4XFBA 2HWVA 3C7EA 1SFXA 2YUEA 2P6HA 3PVOA 1ULFA 1VLNA 4GJYA 2WB1N 3OOPA 2XHKA 2V5YA 5F32A 1WMXA 3K4ZA 3EDPA 2I8DA 1XNDA 5C70A 3DBRB 2WNOA 3V0AA 1PM7A 4UY8I 4U7DA 1V6IA 1B4AA 1NYWA 4AWXB 1NTCA 1HSTA 2VCMA 1DZTA 4ENMA 4PJJA 3PNYA 2ZGLA 2Q2EB 1XSRA 1SD5A 2R4GA 2B39A 5JZGC 5E3OA 4QPGB 2DVFA 2X85A 2Y38A 3VD3A 2BY3A 3IH4A 1YNAA 1I27A 5F0HA 1UU4A 3OYNA 3T4HB 1POV3 1DLLA 5GLZA 1JBCA 1H6YA 3WP5A 2BOJA 2X09A 3HIFA 2BBVA 3A23A 3RNSA 1V4RA 2NMNA 4XZPA 2CQ7A 3B00A 1ENQA 1IKQA 1CF7A 2I74A 4NIAA 4ENNA 3SYTA 1X50A 2V72A 3EUHC 5DUUA 1N1SA 1PDNC 1N1VA 2WNEA 4HKOA 2VE9A 1A04A 2W87A 4IEJA 3QPSA 5EV7A 1EH6A 3BTYA 4FTSA 4IV1C 3D1NI 1W39A 2HEYF 2DQLA 4D8MA 3DEEA 4M3DA 4O6JA 4M0HA 2FDGA 2VBZA 2JDNA 4LLFA 3T2QA 4BIFA 3K2AA 2A70A 4A0ZA 3I54A 1STMA 3ABUA 2X48A 3S2WA 1VAMA 1RUC3 2BBAA 5KXDA 1H8TC 4YFWA 3P6BA 1PVC2 2DXIA 2HEVF 5GLUA 2EVXA 3SHRA 4ZTJA 3OGJA 5FY1A 4F83A 1R081 4D0QA 4UHTA 4M6VA 1JKRC 4HX4A 1W04A 5HCBA 2OF7A 1CWPA 2WJSA 3K10A 1ULDA 5EEHA 2P37A 4CUCA 5KBFA 1MR5A 2G9ZA 3CJTB 3N3HA 4ES8A 2RHPA 1YQ8A 3WNKA 2VMIA 3MLJA 2ATFA 4A3EJ 2JG9A 3F2ZA 1EPWA 2RJKA 1IPKA 4FP2A 3PUSA 3I4NJ 2IEKA 3NO8A 3TEZA 5LRSA 2Q2EA 1H1IA 1F9NA 4RB0A 4XDOA 1UZYA 2QBYB 2UWBA 3WDYA 4QPGA 3ZXAC 2HXIA 2K9LA 4M9XA 4Y4RA 2DK5A 5CYVA 3IUOA 1G8XA 1OQYA 1YFWA 1IN6A 1A31A 5I91A 1EAH1 1S4CA 4FFHA 2JKXA 4IJAA 1PO12 4U0VA 1ZGWA 4RFT0 4NHXA 2M9HA 4W1UA 1JHHA 4KL1A 2V26A 1C28A 3I0TA 2ZGRA 3U10A 4K9SA 3WQ7A 1VF9A 3F8FA 4U2AA 3N7MA 4NN0A 1YI9A 2DCJA 1STZA 3BI3A 4PHZA 4YG0A 2JIGA 4QXHA 4CA0A 1X4PA 1TWAJ 4CE8A 3AC0A 3BTXA 2E26A 1FP2A 2AYHA 5FXXA 3GZEA 3GGLA 3A21A 3P3PA 3PMEA 2EJRA 2VW2A 4OI0A 3S2HJ 4FXGB 3M8EA 4PF1A 2MEV3 3K0LA 1AL22 3DTKA 1UCXA 4RBOA 1LGNA 2GNBA 5FZ0A 4FTBA 4CRQA 3S1MJ 5I0TA 2PLYA 2ZX2A 2XAQA 2XF7A 3JCIA 1FMD1 4PFPA 3ZQHA 2DCKA 5K0UB 1S7AA 5LBFA 1SDWA 1BEV2 3AYAA 3Q9OA 5LW9A 3NNGA 4XFFA 2BWCA 1BBT1 3GM8A 4A3KJ 2KPMA 1D4M1 2QBYA 1VB2A 3H36A 4ATEA 5JWPA 1UHWA 1O3RA 4LBQB 2QQJA 4B8XA 2F5CA 2DFBA 4LIUA 1KYZA 2PAKA 1R1A3 2PAMA 3ZN0A 5CPRB 1BR4A 4D9JA 3JSOA 3B93A 2VUCA 2HOAA 2PBIA 4JHZA 3M4OJ 1A6QA 2P6CA 4NPMA 2Q0OA 2EINH 5LASA 3VDDA 2M8GX 2ZS6B 4Y1ZA 2GDFA 3L2YA 4R1HA 3QAHA 1ETXA 5IYCJ 1SCRA 1N3QA 4MFEA 1XQNA 5ICEA 4Y3OA 3DKXA 5HDNA 2VQ0A 1X2NA 5HDGA 4DGWB 2QLZA 5BNNB 2DJNA 4IEUA 4C3JJ 5GTHC 2EFNA 4KIGA 2NM1A 4QD2A 1APNA 3BIWE 5F27A 4CXFA 1XG1A 1MGTA 4R4ZA 1H9TA 3IWZA 4QB2A 4G3YC 2I2SA 2WO3A 4S2HA 1RL3A 5IY5H 2VZPA 3IDBB 3KPHA 4XE9A 4N4NB 2KRFA 1IDYA 2DBIA 3DTEA 2ISZA 1AHDP 2XAJA 2VBXA 3CLOA 5FLMJ 2MGQA 3AZWA 1W9SA 4N4OB 3WTVC 3K2ZA 4BE3A 1BW6A 3POIA 5IP7J 5HLIA 2YBSA 2ERFA 4TZDA 4FI9A 1EV12 4BISA 5K0UA 4G6QA 3ABMH 3NAPC 5DD8A 2FSWA 1U6GA 2E1MB 2HBUA 4R9BA 3HUGB 4GB31 5LGNA 2R063 4KUMA 4JBAA 4LBQA 2J1EA 5A80A 1SFUA 4BU2A 1GV5A 3EJKA 1VBB3 2R073 4HVRA 5GLTA 1UYYA 4P9YA 2Z16A 3GZ6A 4J6GA 1MBEA 1NCRB 1W8TA 4QTRA 1ZGAA 3LSGA 1P7IA 4CDWB 2ZEYA 5T55A 5EP9A 3URFA 2ZEWA 3MEXA 5JIAA 3QCWA 2PHDA 4FPFA 1OR7A 2HXOA 1W7PA 3WGGA 2VD7A 5HLHA 2IGOA 5FZKA 1D3YA 3DEMA 4AEDC 3FXUA 4IERA 2EIEA 5F0FA 3R4KA 1IS5A 1OLMA 3PIGA 5IVVA 4D0PA 4LHNA 3IPVB 4MG2A 3ZYRA 2IS1A 1IW7F 5T54A 1T2KA 4JDNA 1MS4A 2GC1A 5FROA 1USSA 2DODA 2A75A 4XICA 1QQP2 3B73A 1BMV1 1NA1C 1RUG1 2WWYA 3T0YA 4Q4W3 5CKTA 1NUKA 4K6BA 3RGBA 3SXWA 1RB8G 2W3JA 2XSJC 2VN2A 3I64A 1LULA 2P1BA 3OIQA 1MJ9A 3VBHB 3OF1A 4ZU5A 1G59A 1OH4A 3VGIA 3BWGA 1IG7A 2GOXB 5D4RA 5FZ3A 4M4RA 2IS6A 4BKXA 2R7OA 3P9CA 2LKPA 2IWGB 4IEZA 1RUH1 4JOMA 4XTPA 4IE6A 1JUHA 1GSLA 4AGVA 1QF3A 3LIGA 4NHYA 4WXDA 1TL8A 4IE7A 2FHRA 2SBAA 2ZXIA 2DV9A 1S0BA 1NCRA 5KWRA 3CUQA 4DYQA 2QVSB 4Y15A 4Y26A 4ES9A 2DFHA 2M0MA 4MHUA 4CDWA 4XN0A 1FX5A 4RS5C 3SH5A 4XF4A 2AACA 4BE2A 4KYWA 3I71A 3GTOJ 3BTIA 3WTWC 2UYAA 5E1RA 2WS92 1D0HA 3MFKA 4I30A 2OD5A 2IS4A 1XB9A 4E4HA 4MTEA 1QBJA 1UKRA 4EYUA 1OPCA 1K3IA 4Y1UA 3JD72 2FNPA 3FHNA 3S0MA 1RC6A 3M1CA 3CCSI 2NVUB 1WKMA 1QHDA 2VXRA 2GXAA 1OURA 1YLLA 1B1BA 5I93A 4RLQA 4Z8BA 1WD3A 3BPXA 3MAJA 2YC2A 3HDDA 1WCMJ 4DZGA 5L3GA 4QKNA 3IIAA 2L0KA 1T33A 2EZKA 4MVTA 1SMVA 4YW1A 1X1BA 2E34A 2LW8A 1T8IA 1TZOA 3AVRA 2GMPA 3GBGA 4XHBA 1X19A 2CGPA 3EO6A 3MKYB 1E3HA 3VBHA 1AYN3 3KCYA 3RJ2X 2RJLA 5CNAA 2HYJA 1FOD3 4EN8B 1JOJA 4EN0A 4JTOA 2VNGA 3NEUA 3ETPA 4DW6A 4GCVA 1RJ7A 4EN6B 4Q48A 2HPMA 4LHKA 4V2GA 2AS5F 1GV9A 2WZR3 5JXIA 5IK8A 3DXTA 2XONA 3S8PA 3N9PA 1TQPA 3WP4A 2BY1A 1QPIA 2ID3A 3FISA 4LR4A 2PI0A 2WNUA 3Q8FA 1XC5A 3WVJA 4YFNF 1F9KA 3AJYA 3QBQA 4PLOA 1HB2A 2X10A 5C9AB 4MSVA 2RKHA 1Z6TA 5FREA 4XJZA 1W0TA 1VAKA 4C3IJ 3JCUC 2B5HA 4S2DA 2FCTA 5FP7A 1G6NA 4LK0F 1ETYA 2EXHA 2D7FA 2HNHA 5LB6A 2CTVA 2CWMA 1XGSA 4IE0A 4M9ZA 1TT0A 2MA3A 3P9IA 3ROUA 2DMPA 3ECOA 2HWC1 5KAFC 1JUPA 2IW5A 5G04L 4XRFA 4BCUA 1WH5A 5LK5A 2UY8A 2RV8A 2CAVA 4ATFA 2A6EF 2WY8Q 2JMWA 1QU0A 1RUD2 1C1LA 1DP0A 4XOGA 3ZOBA 1TME1 2QSGX 2BJSA 4XURA 3OR2C 2W2IA 4XK4A 1J3RA 2WZEA 5L19A 5F2SA 5L36A 2LC2A 4XAAA 5M0TA 3S30A 1REEA 1X7NA 2QQAA 4GJZA 1AYM3 4L18B 4MLOA 1V00A 3H5RA 4LORA 2Z2SB 4KGQA 3BTAA 1GNZA 2Q0AA 1HC8A 3ZYBA 1DF0A 2RQQA 2LFBA 3PTRB 3R0AA 2RS31 3WHTA 2NQYA 2XVCA 2DJIA 3GCMA 3B5LB 4QB6A 4Q0UA 2K9QA 1GXPA 5JPNB 3HEIA 1UZZA 4U36A 1Z3YA 3T1LA 2CO5A 1WH7A 1T56A 3J7AY 2W1UA 1YWKA 1HJGA 4KBZA 5L3CA 3R6SA 1K5MB 4W6YA 4FT8A 1QJFA 2A6YA 2YX4A 1GQPA 2JB8A 3WGHA 4LMYA 3K46A 4CGZA 2JD4A 1DZQA 5I0RA 5H9PA 4OHWA 4BY1J 1ND3C 4V19K 2BW8A 3NRUA 3T0AA 3KETA 1AF9A 1KU2A 2G9GA 3KV6A 4BB3A 2VT2A 3KP5A 2JECA 1LE8A 3GBWA 2VAUA 3JB8A 3HSRA 2B7YA 3QYBA 4DRRA 4CCKA 4X6AJ 1LHVA 3UYJA 5FFXA 1RUE2 4WVVA 4PGHA 1FAYA 3Q8AA 5A6ZA 1RXGA 1SFKA 4CXYA 2HYFA 1R23A 4AI0A 1OF4A 3T2OA 3HRSA 1BL0A 3BVCA 3KV9A 5D1IA 1B72B 4IEPA 2DPDA 2E60A 1MDMA 3AVSA 2R043 5IK7A 1UG0A 3FE5A 4HXCA 4RHV1 1OMIA 3M9AA 3DV8A 2W08A 3SZGA 4EATA 1QJU3 2MC3A 2WIIB 5LD2C 2A69F 5LBQA 3WODF 2ME0A 4OMYA 1SFEA 2EIJH 3C1DA 4OULA 1ST8A 3Q3SA 1PVEA 1XDUA 4UUVA 1DU6A 4PIXA 2D6MA 3ZIXA 5EPAA 1XMXA 3F0CA 4Q29A 2ZGOA 1F4HA 3OD0A 1MMGA 5L3BA 4Q4V1 5BPDA 3PLQA 3OIOA 1CIYA 1R6RA 1MEC3 4ANJA 2RREA 3RQ0A 5JZGB 1BN5A 3QOEA 1K42A 2ETHA 3JAMZ 4E7IA 3ZQGA 2F4IA 2UWMA 3AJZA 3PFIA 3UK9A 5T3NA 4A3ZA 3KB5A 1UY2A 3GALA 2ACJA 3FM5A 3POGA 2V4VA 4HPKB 4P5OA 3O12A 2KLOA 2FBEA 3L2RA 4PDWA 1TMF1 1SEUA 5KHDA 1UAAA 2ZB9A 4IE4A 2PYTA 3P5BA 2X0LA 5FK7A 1HQNA 3U78A 1EPZA 2A3WA 2E7XA 4Y5SA 1L7LA 5FZ6A 1DFQA 3W2WA 4C3HJ 4NRMA 3DWLE 1UO9A 2E2IJ 2AO9A 1RUF3 2DA6A 2RR11 5IW0A 3EHKA 5GZDA 4TLFA 3S5QA 1R71A 1UF2C 4ZZLA 4YVSC 4MO3M 2VUDA 3K4DA 1J58A 3HWJA 1QIQA 3IB3A 2YGLA 3FXRA 3VD4A 2NYXA 4GYIA 1KJLA 4TV7A 1NG7A 2NYYA 2DDAA 3SQNA 2K9SA 1WJAA 1PGL2 1RPWA 2HVRA 1TWCJ 3M3QA 1X8MA 1QXJA 1IUYA 2XJPA 2M34A 4QPWA 1IPSA 3ERED 4CH7A 5FMOL 2F17A 1RUC2 5JZGA 3ACHA 3NV4A 4M0NA 2FU4A 1JYTA 1IN8A 5KXBA 2H09A 4LKEA 3MF6A 5FBJA 2O6GE 4DXSA 3RCOA 1U8BA 5BUVA 4GZ9A 3V56A 4CU7A 2VMEA 3HN3A 3CZ6A 2VMHA 3EQEA 4L97A 1LOEA 2W91A 5IAXA 2QQVA 1REPC 1ZZ9A 3Q5FA 5K5OA 4CYCB 4XJUA 4PLMA 3ZKUA 2Z9OA 1WW6A 2DWRA 3EUHA 1HJFA 3J7ZI 4BM8A 4HONA 3AKZA 2R7VA 2ESNA 2W9XA 2ET7A 1OYYA 4IV1A 5F64A 4ESFA 4DXZA 2R7TA 1ZH5A 4XHXA 2X1EA 5AC91 2KL4A 1CVNA 3MUZ1 2WINB 2V4AA 2X53S 2JA7J 1USTA 3K1MA 5IYBJ 3AZYA 3V65A 2NAZA 2VZRA 4YG6A 2LBFB 1H8TA 1XYPA 2AQEA 1R5HA 2LF7A 3PDQA 1QQIA 1GWLA 5GAHJ 3SXYA 1ZR2A 2W1SA 3PHMA 2JJ6A 3U37A 2Y6LA 2WV0A 1EV7A 4F55A 4GD4A 1TNRA 3ZFEB 1V6OA 5C3OA 3IKVA 5GAEJ 3DXUA 1AX2A 3FXMA 4GAZA 1V6LA 3GW2A 3T0DA 1TWHJ 2VGDA 4MGSA 2JB4A 1VBA1 5DDGA 1UMZA 4UBGA 5LHHA 5E17F 1HXS1 2VONA 1H2NA 1S3JA 2JIJA 3GZUC 4RLFA 2K7LA 3H3LA 5E20A 4WXCA 3J8F1 4LLGF 1T39A 1UL9A 4XKVA 1DG6A 1SQ4A 2CU5A 1GOHA 3K69A 4DIQA 1KYWA 2PJRB 2MEV2 1WCQA 2D5FA 4GMP0 3FKJA 4DB5A 2GALA 4IX7A 4BL0B 4NHKA 4JP0A 4BXSV 5DMYA 1AR81 4GFBA 2NVQJ 2PAEA 2OQGA 5EQUA 5GALA 5A3OA 5FYCA 4W8JA 2H6BA 2GM4A 1B8IA 3MLKA 2RQPA 3ZSLA 2RS51 5FP9A 5JR7B 2BDRA 1YIJI 1Q8PA 4KFCA 4BXFA 2M87A 1FTZA 4A45A 5C4WC 1DZRA 1HKTA 3WDUA 4CUGA 2DA1A 1NAEA 1MH4A 3AFHA 1R4NB 3PJRA 1R1A2 3AKPA 2F5EA 3I8TA 2JVHA 2VL8A 1Z7S2 1ZHFA 2LBFA 4XFAA 4LK1F 1Y6IA 1LOAA 4BQXA 4HF1A 3POJA 4FXKB 4Y24A 5JHUA 4OQ9A 3MW3A 1V9U3 3FMSA 1CAVB 2MH2A 5FQ0A 2R7XA 1CQ9A 4M01A 3ZSKA 2ECCA 5FXVA 5IK5A 1UY3A 1GNHA 4XCBA 3NARA 3KF3A 2OX0A 3PURA 5J09A 1ZBE3 3NAPB 3CUOA 3GFJA 1EH8A 1B35C 4KQ7A 3GTJJ 4BMBA 4KWLA 2G7HA 3BQYA 4XQFA 4TXWA 1R49A 1SAUA 2ILMA 5E8AA 1J83A 2LY9A 3RZGA 4WM7B 2BVMA 4HG2A 4AHXA 4YZ3A 3OMYA 1LDDA 2VM9A 1P4XA 1Y8RB 1N75A 5H20A 3MD2A 3GWZA 3AMHA 3ZQQA 3ATGA 4BXXJ 3OL3A 2UYBA 3ABKH 2MLGA 3V7CA 5CISA 3NWKA 1RINA 3GNEA 4DYCA 1PGW2 2UU8A 2QCSB 3JW4A 1AR72 1U5ZA 2W7NA 1GQHA 5FR3A 4K1ZA 2MPFA 5TJJA 1P9QC 1IAWA 2OPTA 4YARA 2GOMA 3T3YA 1DU0A 4Q0PA 2R062 1H4GA 4B7EA 3AYDA 2VQTA 4JHTA 1PUEE 2K2SA 4AEDB 3W21A 3RG0A 1VBB2 2R072 1T38A 5J3LA 4RB1A 3RSNA 4O3MA 1U0JA 3O7OA 3WP3A 1PO23 2XXZA 3J7LA 3NV3A 1NZIA 3HOVJ 1JN2P 2XGDA 2Y30A 3BZ6A 1LRHA 4WZCA 3RWKX 4GWJA 5JOZA 4GQ7A 5FY0A 3VZLA 1CAVA 2VBPA 3ZFGB 2OZUA 3BR3A 1RVF3 3AG3H 1SAXA 2VZOA 2XMLA 3P7NA 4BHPA 2W24A 4L9TA 4HDVA 1OUXA 1VBC1 2X6YA 1COV1 3RKYA 1JW6A 3HD8B 4RS8A 1CZVA 1GP6A 2XDVA 2NXNB 3NAPA 1UAIA 3FMQA 4AF9A 3MGUA 1RKTA 3PQKA 4OMDA 1UMQA 5J96B 5D8AC 1AR61 2K27A 3DU6A 3G2BA 3LL7A 1JI8A 3J80K 1NOVA 2ZGKA 1ZZBA 2EIBA 3CDIA 3HRMA 3ZXFA 2E71A 2F6BA 3S3OA 3DUIA 4KT6A 5LA1A 2ZMEB 4ARYA 2HTJA 2JA5J 1OBNA 3M3IA 3H8OA 4PT6A 3CKHA 4JK1X 3K3OA 4Q4W2 1IS4A 3WW3A 5FPBA 1VTNC 5A3UA 3B69A 3VBUC 3BDDA 2ZXWH 1EJ9A 2C5DA 3CF6E 2D3RA 4A3JJ 4FISA 4I99C 4MGIE 4LKFA 4HNTA 4YM1A 1SANA 3WTTC 4RR3C 3CC7I 4QQ2A 4HSJA 3VZKA 2GBYA 2Y6JA 1KQ0A 3J81Z 2IFRA 4LK6A 5IYDJ 1YFUA 3B6CA 5HCHA 4YFKF 1D1AA 1Q1VA 2EF6A 2PMHA 1SD4A 3RMYA 4AFMA 3VSLA 4NMIA 1MJBA 4AEDA 1O91A 3MZ8A 4NC6A 2AR6A 4CDUC 5E8GA 1Z1DA 3JXSA 3IP4B 5T5LA 4RQPC 2PHRA 1KDMA 1FJLA 4BGDA 3BTZA 1GZCA 3BR0A 3BLYA 4CHUA 4E7ZA 1ONVA 2W85A 5F08A 3W6JB 2DFFA 1C57A 4OLLA 3A02A 5BS6A 5BMZA 1NA1A 1XSVA 3QWLA 5HNHA 1YW9A 4AVCA 1WW5A 2KZVA 4Q8LA 2HDDA 3HRUA 4UXNA 3UJQA 1OLTA 3C3VA 3ZMVA 3HB9A 3AK0A 3S7EA 1GWKA 5F7UA 1MS9A 1V5GA 2BEOA 2Y9ZA 4YZ2A 1PIV3 2ZX3A 4IEWA 1H2KA 3GFLA 1MPXA 4GDFA 3ZMSA 4KG0A 2ZCWA 2XGXA 4H7LA 1V6JA 2ZMEA 2MD5A 3PTYA 2E1NA 5D21A 3ZPYA 3CQOA 3KGZA 2YU9J 2WRAA 5LEKA 1CGPA 4KITB 5EJ3A 4LKSA 1RUJ3 4ZU7A 2W52A 1VNDA 4CZSA 4B4CA 4EJUA 2RDNA 2DMTA 2H27A 4FPOB 2BVVA 2XR4A 1ZLJA 2XQXA 4RS5A 1H89C 4F3JA 1FOD2 3HOYJ 1A6CA 1VE0A 4AIHA 3TKYA 1YW8A 1FOXA 4GIQA 4A2UA 3HL2A 2WZR2 1JMUB 4CO8A 2FUG2 1PVC1 3VDXA 2QJVA 3LSMA 3MHZA 3VDCA 2F4MB 2AENA 5FRMA 5FYHA 4JGYB 2JDUA 3H0OA 3VPRA 2GXGA 1FMD2 1CAWA 3BTJA 1Z0XA 1GLHA 4JYKA 5A32B 2LREA 3K9TA 3AG1H 2P34A 4QPIB 2VU9A 4D5CA 4Q27A 2G19A 3K48A 3IDEA 5F3IA 4A93J 2GIZA 3A0BC 3BG9A 1URXA 5K4LA 1BVVA 1XNCA 2PHLA 1ODDA 3H0GJ 4JQFA 3ZPOA 2CHHA 5IVBA 2P81A 2FQ3A 2V9PA 3L00A 4QAWA 4HVQA 2ZJ2A 3O6BB 4ZJZA 1JUSA 3OGVA 5DQ0A 2GZWA 4IL7A 2WABA 2F4PA 3RZMA 4D1QA 3KMHA 2LRDA 3ZYGA 3H7YA 1G8WA 3TRSB 1DQ5A 2KISA 2QQOA 3VYRB 4FPJA 1NLRA 4U0WA 2DFCA 3HBLA 2EZLA 4G9SB 3ITQA 3BT9A 2IGKA 4G9YA 2X9DA 4HZFA 3RQIA 1AYM2 2JUCA 2CNAA 1G9BA 1OQ1A 2XGCA 1ZZCA 4UI9L 1CR7A 2OTLI 4U87A 5FLVA 2PELA 4LQRA 4YW5A 4A3XA 4YVWB 3T08A 3KE2A 2TCTA 3FBNB 1BBYA 2QA4I 2XASA 3SKJE 3CJIB 3BOQA 2VKEA 2XAUA 4EN9B 3KWVA 2NMOA 4GMP1 4HANA 1WCKA 2RS13 3HGGA 3OYFA 2CJJA 4C0HA 5F0CA 4PJNA 5FZ1A 1AL21 1Q8VA 4CCOA 4EM1A 2LH9A 1KD7A 1WBLA 1IUFA 4A3BJ 3CZJA 1TNTA 1GUUA 1KGSA 2Y33A 1W36D 3BROA 3VBSC 2C26A 5CJ9A 2DDUA 1BEV1 3PM1A 1H30A 4QPIA 5A3LA 1R091 1MMNA 1YITI 1L7QA 5HDKA 2M5WA 1TNFA 4CDXB 2R0QC 4RAYA 4GB32 4XMIA 5FY5A 3DPRB 1PK6C 1IF1A 4RYDA 2F5DA 3H8RA 4BE1A 3BOWA 1BI0A 3ZXJA 2JG8C 3WOGA 2FD8A 1S7EA 2J1SA 1KRIA 4JZRA 4HLTA 4FETA 5D8KB 4C2TA 1OA2A 3H35A 3K4BA 1MZBA 4QKFA 1UW8A 5BQTA 5F6FA 1KQ9A 3KEOA 4E4SA 3J7AO 1P2FA 3J7NA 1SG3A 1BLZA 2FBIA 1ITYA 3WHCA 5D5WB 4QDSA 2WAEA 1BBT3 3GZTB 3ZO0B 2IXKA 1KS4A 3MLLA 2BGCA 3WW2A 1RIOH 2DA3A 3KP2A 2B9VA 4KA4A 3U0ZA 1JT0A 1O3TA 4OAZA 4MGQA 5E88A 5F5AA 2OV7A 3G6JB 3U21A 2EIGA 4PJMA 5JUVA 3PUQA 1FNNA 4HSLA 4MIMA 1S1AA 2ZOEB 1QJU2 4P9WA 1W6QB 4E7SA 2W84A 2CDOA 3IMNA 1ND3A 2K9MA 2NN8A 2LYCA 3UKTA 2EXKA 5JLWA 1RKWA 2ZGNA 2JK3A 4II2A 3SEPA 5JMOA 2F6CA 3AMMA 2VCAA 5D5UB 4QQLA 3T8TA 4MTDA 3RTRA 1OLQA 1EV11 3HPNA 3N35A 4Y5TA 4COWA 1J2XA 1HKQA 4QQOA 5FZ7A 1F36A 5HCFA 5J48A 5LHIA 2QQLA 3WF0A 3BUCA 3G73A 1BYHA 5KXCA 3WE2A 4NBQA 3AYCA 2P2KA 1DPUA 1MEC2 2RDPA 2D97A 1YFHA 3JRCA 3VD5A 1W9WA 5JI6A 1HB1A 5J6XA 3K70D 4C8DA 3BKZA 1UPSA 2EFWA 3NJYA 2CWEA 4LOCA 4LXLA 1YI7A 3M8JA 2CW7A 3S15J 4RGUA 3WNLA 1LEBA 1SPPB 5CFCC 3WDWA 4EWEA 4MXVA 4KNYA 2Q4SA 3CTAA 4NNJA 5FZIA 1H0BA 2NS8A 4IXAA 3QQAA 5FPLA 3F6VA 1OYWA 1UIJA 4GH4C 3FXKA 3WNOA 3TL4X 4RFRB 2OIIA 5CA6A 4LBKA 3VBRC 1IXCA 1FI2A 5HODA 3RQ4A 4XN3A 3K7AJ 3Q0WA 1O5UA 4BJ6C 2VG9A 1AL0G 1UZVA 3T8RA 1UMHA 2YROA 2HYKA 1RUF2 5I8SA 4XUQA 3ALQA 1VALA 1S72I 3MUY1 2JICA 2LM3A 3PO2J 3I59B 3ASNH 1POV0 5DM7F 5AIQA 4OUMA 3WDVA 2LF8A 1ZRFA 1HBXG 4JRLA 1LOFC 5FV3A 1GBGA 1YS7A 4HAMA 2BFUS 1W6QA 2ZXHA 1QO0D 2VY0A 1XNKA 5A2QZ 1IOAA 5LK7B 2VPVA 2FMDA 3ACFA 5FRNA 1HN1A 1QQP1 4MUVA 5FD5A 2LY1A 3RFRA 4BNCA 2Y48A 2JENA 1TNSA 3VBOB 2K3PA 4NWVA 1Z7LA 1SBFA 1ETWA 2DOAA 2HDWA 2QZ2A 9ANTA 3LF7A 1OISA 1AHSA 4WVZA 3LA3A 1FPQA 5BNQA 5E18F 3ESWB 1T6BX 4M71A 1FV2A 3E97A 2OBPA 2A61A 2OCCH 2D40A 1W6NB 2EXJA 2BV4A 1REDA 4YVSA 1ONAA 2STTA 5DCMA 4XZUG 1JHNA 2IA2A 1R1VA 3IAM2 4XNFA 2Q8EA 3RZZA 1JZ6A 4A0XA 4YW7A 3ZRGA 4YW2A 2DMUA 3BG6A 4KU8A 3HQXA 4PLNA 1AR93 3OS1A 5FCCA 1OKQA 3LCPA 2X6WA 2G0EA 2O0YA 3TEXA 1UU5A 4YPJA 3OUJA 3VHPA 5ACA3 2XJUA 1W6MA 4QGLA 4XYXA 1JUIA 3EB7A 2NP0A 4UUSB 2WS91 2GC0A 2QQIA 3RWNA 1WLDA 1BZWA 4RMNA 4JVAA 4QHBA 1Y56A 3ILRA 5A7PA 1QGLA 4COYA 3I59A 2JRTA 1ETOA 3JD71 4K7JA 2O7OA 3FFQA 1JXSA 2Q1FA 4ABZA 5FOBB 4ZDOA 1AOYA 3K4AA 4PJYA 4K1YA 1QNWA 4E2QA 2NPIA 5FZAA 1Q5OA 3E6BA 1XNTA 2F5FA 3OBZA 1OQEA 3WV6A 3CP8A 3OSGA 4EE2A 1S2BA 3LMMA 2NVXJ 4BBRJ 1RRJA 4E4DX 3CDHA 4E9KA 2QQMA 3HXLA 2FQ4A 2P8TA 4H14A 1YHQI 1OVSA 5E3NA 1ZK8A 2D3PA 2BP6A 1ZBA3 1UOGA 5A70A 4KMUX 2XWJB 1LFUP 3S14J 1DGWA 1Y0NA 3GTLJ 3QH6A 3ZXKA 1HIXA 1W6NA 4CZCA 4YNIA 1H1MA 1YQ5A 2YFUA 2M3AA 2L02A 3ZGKA 2L7FP 1LQ1A 5DZFA 4B48A 3FHZA 4ZHNA 3RJPA 4Q8KA 4UXAA 2VR4A 5KHKA 1H88C 1Y9MA 3KP3A 1TEIA 4BQYA 2YPJA 4E6KG 1GOGA 3H3VK 4HSRA 1K6YA 1YJLA 4O9EA 5DCFA 2EICA 2PTMA 2WR9A 2P5VA 4A3MJ 2VH9A 1DYPA 4CEYC 4UUSA 3WNXA 1VRBA 3MKZA 1PYVA 2GAUA 1VAVA 4JAAA 2UXNA 4AI8A 3MPPG 4B3NA 5EIYB 4KIBA 2V1XA 5KK1A 2X5IB 4XF3A 4ZPIA 3EQLF 4C91A 1H8VA 1C0WA 3D5OA 1RUD1 1U3EM 3I2HA 4P9FA 1UHSA 1EA3A 4D94A 1V9U2 3OYJA 5A33B 1TG7A 1E0EA 2DA5A 2M45A 2O3FA 5EGOB 4R4XA 2W39A 1V3FA 2BW3B 5JVGF 4R79A 1IQDC 1XU1A 2KDOA 4IRIA 4HG6B 3LFUA 2WSUA 4K8RB 1HRI3 1FY7A 3D6EA 3N9LA 1ETVA 3L09A 1LGBA 5J36A 2EZHA 5L3DA 3HVDA 4CPBD 5FZEA 2DT7B 3N97A 3OYHA 2UY9A 1G3TA 1I1GA 5C4WA 2Y6HA 2XF5A 2XUMA 3ZXDA 3N9NA 5FPUA 2TRTA 2XV4S 4ZYGA 3EXUA 2JQ7A 1R9TJ 1AWCA 1YJWI 2DTYA 3OCPA 4AK3A 4RGXA 4FPLA 4BEHB 2YX7A 1ASJ1 2ZEZA 5CVVA 4G4FA 1JU4A 1SVMA 5D5XB 1BC7C 5DXDA 1ENRA 4CTEA 2BNMA 2A68F 1SLIA 5E8IA 2FD5A 2M4KA 2OS2A 1GLNA 2V1UA 2HJIA 5FJ8J 2IPQX 5F9TA 1FNYA 1WPKA 4XFHA 4XQDA 3J7YJ 1HDPA 2VC0A 4Y33A 5BNNC 1Q56A 3K51A 1IS3A 3BPZA 5IFTA 2OUMA 3HMYA 1ZAOA 3FHQA 2MC4A 1MQTB 3N9MA 3O8GA 5GTIC 2QDRA 2FA5A 1W7PD 2ZSHB 4UUTA 4YLZA 3R4SA 2UWCA 1TQMA 3QU6A 1ZZ8A 4XXAA 2DVAA 1B35A 3U1XA 3CIHA 3DECA 3C2BA 1QOOA 3A01B 3P1IA 2DFEA 2Z42A 5GZEA 1PO22 3ZN1A 5GZFA 3O1OA 1X2MA 5JAXA 4UW5A 5IOYA 2XPVA 2VLAA 1GP5A 1S0GA 1TBXA 3TNQA 4LUKA 3NSTA 3MIGA 1HXDA 1HOMA 2KR2A 1RUE1 5CVUA 5LGUA 1L3JA 1RVF2 2P3JA 4IGPA 4Q0SA 2LTPA 1LESA 4IW3A 5IUQA 4S2FA 3M1HA 1H8AC 5FO5A 4R9CA 3N7KA 5C3EJ 4J1XA 1VMHA 3PSFA 2E1MC 1LGCA 4A41A 3V7RA 4HVOA 2A3YA 5JSRA 3HKZA 1OC1A 2IGMA 1G9FA 4ONUA 4EJTA 4ON0A 3ME2A 2QVOA 1ND2B 4JKLA 4YW6A 1N77A 1RYYA 4I2OA 1NCRC 3USUA 1ZREA 2KP6A 1QOTA 2B8MA 1HDKA 3VODA 5JOXA 4D7MA 1GZTA 2D6LX 4CDUB 4D3WA 1QNTA 1GWMA 4RM3A 4BEHA 4XQ4A 2F2EA 4V1PA 1KJRA 5FMCA 4LO8A 1PMHX 3W59A 3KVBA 2BZTA 4A5NA 5SV5A 1PMIA 3TNPB 2DU0A 4KH9A 1HX6A 4XSXF 1MACA 3GO5A 2OUJA 1QZEA 2XJRA 3K77A 5CB7A 2Q8CA 5BYNA 1BM9A 2K46A 4NC8A 1JOBA 3BN6A 1W8ZA 3PJQA 3VKLA 3KP6A 1RGSA 2R30A 4NAOA 1D8KA 2KT0A 5F5CA 1IHMA 3HNYM 1MQTA 4XETA 1N78A 2FE3A 3J26N 1LB2A 4XOTA 3ZXLA 5A1LA 4ORFA 4BHBA 4BQOA 4MADA 2EFQA 5HS8A 4LT5A 4AVAA 2J1AA 2XB0X 5D8AA 3TO6A 1I50J 4O61A 3ZOIA 3GTPJ 1QU3A 1I3HA 3JTHA 4MOAA 3TN93 3IDCB 5JXJA 3D5RC 4ENJA 5DDJ3 1IXSB 3KGLA 3RPQA 4JV4A 4QB1A 2W95A 2QQWA 4AIDA 3OOUA 5FRAA 5CFDB 1K79A 3VBHC 2E1OA 1FSHA 3MKWB 4FOWA 3CU7A 1H9GA 1OCTC 3OYBA 3KCCA 2L7ZA 2ZGUA 3VBUA 5BNPC 3IMMA 5AC92 3X2QH 2LALA 2Y0OA 2J5PA 1YRNA 5HXMA 1KU3A 4IOCF 2PFBA 1F5FA 4RR3A 3BCWA 4CP0A 4EN7B 3W3CA 2WY7Q 4J01A 1POV1 3K2OA 2ZAAA 1PIV2 3LFMA 2A5YB 5FGMA 4QIWN 1O8PA 4HBLA 2E6VA 1XJAA 4NQWA 2QKMB 3AFKA 4WVMB 3AMQA 2JDMA 1R00A 5E79C 3RI8A 4CDUA 5C7GA 1LOBA 5FP8A 4RQPA 2VASA 3KVAA 1JHFA 5ILUA 2HWD3 2DYCA 4TYSA 1BR1A 3UESA 1PGL1 5J1YA 2XVKA 1RUJ2 1YEWA 3SJMA 1OUSA 5K9YA 2YDEA 1IRZA 3S3MA 4YWAA 4NC7A 3DPUA 5A7QA 4MHRA 2A6VA 3JQXA 1JHJA 3O0VA 3OYWB 5C8CB 1RUC1 4L8QA 1OJLA 4LG0B 1A78A 1QKQA 2G7UA 3KZYA 2JWPA 3BG7A 1XU2A 3VKFC 4XUPA 4YW3A 2DTWA 5JR2A 3FBMA 4WCGA 4Q4X3 1BK1A 5C3RA 1PNGA 1IGNA 3ZVXA 4LULA 1YHFA 2L9LA 2X1DA 3I7DA 5J1UA 5F8PA 4EM0B 2QGUA 1GV2A 3THPA 5FXZA 2P17A 4OHYA 2HKXA 1W0PA 2NOJB 5LZ6A 4XOPA 4L92A 4BQQA 2XB6C 1POGA 4IUGA 1DGLA 1O8SA 3P5JA 4UVAA 3SISA 4A6EA 2EA2A 3O1MA 5JHFA 2NS0A 1W3XA 4BIOA 5FYYA 1D5YA 4EZHA 3H42B 1C8M3 2O8KA 2XRLA 1S7OA 1XOYA 2GMMA 2WT1A 5KHIA 5C9AC 3E1SA 3SHFA 1RESA 1HB3A 4XUTA 4M00A 1D2QA 1J3PA 4AYBA 1W8FA 4BJ0A 4HV5A 4HK8A 1TWFJ 4BQAA 3KLSA 2E5ZA 3I3QA 1A36A 4BACA 4JGZC 4YIFA 5D8LB 4LEJA 2XOMA 1ZKGA 1RETA 4M3FA 3OYWA 2EPFA 1QRYA 4KWJA 2H0BA 2WLPA 4GA9A 2DUQA 3QACA 1FPN3 1TVGA 2OZJA 3OY9A 2MEV1 1A8DA 2RS12 5LA9A 4CP9B 3OEAA 2RNJA 4Y4YA 2K9ZA 4B8EA 5FKLA 4QMAA 4F8AA 5FO8B 4LO6B 5GP9A 3T0BA 4LB5A 1BXHA 1WFXA 5H6QA 3QYEA 1HW2A 4E2GA 2HQNA 1JZ4A 3AB0A 2VTXA 2R7RA 2JUGA 5A1FA 2VQUA 4QDRA 1TW2A 3CMMA 2BU9A 3JU9A 2FZ2A 1JUMA 1F31A 1MZ6A 4F52A 1O5LA 3I2DA 1HRV3 1R1A1 4YW4A 2Y2ZA 5FD6A 1LECA 3A03A 4BQWA 1Z7S1 4CCMA 1YS6A 2R7SA 3LEGA 2X51A 4DUVA 5A7WA 4IHWA 1YJ9I 3MW4A 4FFIA 3ZYJB 5CYYA 2VMCA 2PX9A 4AVVA 3IZOA 5K7PA 5SV8A 1K5MC 3T1BA 3FBIB 2ADEA 2WUHA 1H2MA 1YYVA 1JS9A 5E89A 4PJ0C 3WNMA 2ZKNA 3VBSA 2PLV3 4NHMA 1QXPA 3IAPA 3BR5A 1VBE3 4E7KA 3VKNA 2QQPA 5BY5A 5F5IA 1AR62 4RGSA 3POWA 1PK6A 2JA8J 3N05A 4MYEA 5DTDA 3KYDB 2JG8A 5F6LB 1JJ6C 3ELNA 2RDQA 4HRIA 4IV3B 4D6QA 1X3WB 3FX3A 1JZ5A 4W6XA 3LSTA 5CFCB 4ZH4F 3CCJI 3LSHA 4GWNA 3CMGA 2X8KA 3HNMA 2X4HA 5E16A 4L0ZB 4GH4B 3Q8EA 4M73A 2MW8A 2D1HA 2KIMA 3TP0A 1J09A 3T1MA 4ENKA 4EQVA 1IS6A 1Y4WA 3WNPA 1AR71 5DG2A 5ANNA 4B29A 1W0OA 3LFIA 3TWIA 4HN1A 2HTSA 2QWWA 4P1WA 1WI9A 4AFDA 2BHZA 4UFLA 2XLFA 2R061 2JRMA 4XIKA 3GTGJ 3S1QJ 2OC6A 1SLCA 2HWB3 5JR3A 2ZBKA 1MBFA 5TRDA 1W36C 1W05A 4BJTA 5JIUA 1VBB1 3L7WA 5ABJB 2R071 2Y6GA 2JDPA 3KT4A 1XSQA 1VRH3 1MSEC 2Y75A 1BHGA 3KV5A 1CZTA 2BQPA 3JREA 2HEOA 3AKTA 1MBHA 3GHNA 2BE5F 5F1RA 2GIVA 4Y1VA 1E5SA 2MG4A 5C3PA 4UVBA 1W8UA 4UOJA 1MS3A 2JPBA 3RI9A 3DLAA 3UETA 1NHAA 3S2DJ 3JRHA 5L7OC 3QPHA 3HC7A 1DHKB 3G3ZA 1OFCX 1BJAA 3IBMA 2W68A 3M3EA 3L2VA 1YG2A 1D0ZA 5K7HA 1AU7A 2WO7A 4YZ1A 4BK4A 2KRCA 1R36A 1CN1A 1LENA 5JFRA 4B1LA 1APLC 2HKOA 3UL2A 4A3CJ 3UKGA 1LUJB 3CMEI 4MH0E 1OPOA 4JC1A 4META 4XBFA 4CDQB 5CFCA 4QSHA 2VQAA 3MEPA 3ERMA 1VQ5I 3MYXA 4Q4W1 1R5GA 2IVMA 4FPEA 4GH4A 4C1WA 3V0BA 4EV0A 4A3FJ 3VBRA 1VQ4I 3DEWA 2ZMLA 1CX4A 4FFFA 4BS9A 1OOPB 1NK3P 3I55I 1J7KA 4J19A 3B6AA 3K1PA 1OA4A 2D44A 3VYTB 1LU2A 2TNFA 1QJZA 2WA3A 2ZGTA 4IVNA 2WO1A 2O03A 4XAEA 4XACA 1DPRA 4ESBA 2WAFA 1GYKA 1LOFA 2ARCA 1TW3A 3SZPA 3LSKA 2AHQA 4WV8A 1F4KA 3OPTA 2VMGA 5KR7A 4HPQA 3K70C 3BG3A 3HAGA 4LO5B 4SLIA 1AR92 3H3UA 1MMAA 2HOEA 4QLCU 2QEXI 5TGTA 5ACA2 3LSRA 4OHZA 3O1UA 3GYHX 3GDBA 4EROA 1SLLA 1LNSA 3MIEA 2M1BA 4AEKA 2DFIA 4IQ4A 3H1WA 1V6KA 5AVPA 1F4AA 5FP4A 2XB5A 4LNVA 5J47A 3WG1A 1UKGA 4FAHA 3FBYA 4BQ4A 4DRVA 2W25A 1K83J 2ME6A 5L9VA 5C5TA 3GCWA 1KFUL 4DBQA 2QNKA 4FFGA 2QZ8A 4M3BA 2BGOA 2M7AA 5FO9B 4UB6C 4AXOA 3UT0A 1JE8A 5IAVA 5IT9Z 3M3OA 3T5XA 4KNCA 3WZ1A 1S8NA 1CX1A 5FO7B 2EFPA 3HPHA 2MBFA 1POQA 3WY6A 2ZAHA 3ULQB 5JXGA 3VZNA 4A3GJ 4Q0VA 2K86A 1ZM1A 1T6SA 4PK4A 1ETKA 1OOPA 1FOD1 2Q8OA 1HKDA 2M7BA 3MO4A 2P3KA 4CEYB 2UUZA 4JKMA 3LA7A 2WZR1 4RDUA 1JGGA 1LHWA 2R1BA 4E7JA 4N0BA 4CCLA 4AIKA 1TTYA 1AXKA 2JD9A 2DYSH 2LVSA 3ZYIB 2LTNA 2WYSA 3MICA 3ZFEC 3SH3A 3Q8BA 1O7LA 2L2OA 2YFZA 4HK9A 5IVEA 5A7OA 2R16A 4DNYA 3I2KA 2GA2A 3LDRA 1R092 3FMRA 3VWBA 4B43A 2QQUA 4CXWA 2HZDA 5FFOC 3DU5A 2IP2A 2CS3A 5JDBA 4AVBA 2DN0A 1X9PA 3WU2C 4IEQA 2V73A 4QX2A 3WHUA 2JDYA 2ZNZA 2WL1A 3BG5A 1IGOA 1YYNA 4BA6A 1NLSA 5FZOB 2CMPA 3F9KA 3B01A 2HQ5A 3QD6A 4AOCA 2DUOA 1MBJA 2DA4A 4HKLA 3ZX7A 2MHFA 1K4TA 1RI7A 1W4MA 4RN5A 4QGNA 2E7QA 4PBPA 1FATA 1Y1VJ 4ASKA 5JMCA 4LD5A 3I58A 4NE9A 2NNNA 2HR3A 1QVUA 4NHLA 4QHOA 3K4JA 5T5JA 4BDZA 1ORKA 3OL4A 3TO9A 1ZA7A 4LO7A 2WDBA 3Q9SA 3QLQA 1HRI2 2DOEA 2HI3A 4ASNA 1AYM1 3VDBA 3OY8B 1SVOA 1KQ8A 2WA4A 2H1LA 1J1TA 4HW0A 4P96A 5T52A 3CQZJ 2DCYA 2ZNYA 3L2QA 2R5ZB 3DCFA 3F8MA 3RS6A 4YG3A 3BR2A 1JYVA 3H3ZA 4CEYA 1LAJA 4P00B 3FKIJ 1PO13 1WW4A 3PUBA 1W5SA 4Z82A 1WQ2A 2C6YA 5FLJA 3PQJA 4R52A 1OCRH 4GKXA 3WTZA 1X8EA 4B4RA 3A22A 2R7QA 1W8HA 2TBVA 3RMXA 5FYVA 3INAA 4XF9A 3SQOA 4P9UA 3DF0A 4UV9A 4Q5SF 5B4XA 1UYZA 5C6CA 3IL2A 3VDAA 3BTCA 4DEQA 3MI8A 2EA7A 3JBG3 3UJOA 2BYVE 1XC6A 2FMLA 4Y20B 1S2KA 3LOBA 5EZWA 3WTSC 5KCMA 2FDJA 3X29B 1YQ6A 2G9FA 5FP3A 4DBRA 3WG4A 3ZMTA 1ON1A 2BFUL 2PHFA 4WM7C 3HSEA 1S5LC 2ZFUA 2L3DA 1E5HA 2WT2A 5FZOA 3FIWA 1E57A 1F5TA 1QJX3 2I10A 1DGRM 2XBO3 5K8SA 1YC61 3FFZA 1VQ7I 4AEJA 2AREA 1CPNA 1UX7A 3OD4A 4HQMA 2JE7A 2QKDA 3S6PA 5HOOA 3DGTA 3P3NA 2LSOA 2QE3A 3C3WA 3JZVA 1RTVA 4XF1A 3FLTA 4HF0A 1WSUA 2D45A 2XLGA 1XNAA 3C7FA 3NVCA 1HLVA 3I3BA 1W9FA 4QWNA 5BNNA 3ABTA 4Y22B 1C8NA 4LMFA 2NOGA 2QKLB 2R041 1R64A 2BV6A 1YO8A 4COZA 4AZZA 1UYXA 2PMWB 1J9IA 4L5IA 1QJU1 4N7IA 4AGGA 4FBFA 3LE0A 3V8JA 1QH6A 3OJBA 5AVAA 4BLJA 2XGEA 4P9JA 4NB5A 3LB9A 3GYDA 1N3OA 2YYOA 4IEVA 4D6RA 2OJED 3ZFGC 5LWBA 5HBAA 1DBNA 2VULA 5KXEA 1SD7A 1KGYA 2BPA2 2A05A 2SLIA 4Q4Y3 1O7FA 5DAXA 4IGQA 1W3VA 5DZEA 2VO5A 4B44A 3OIPA 3BC8A 3SNMA 5CIRA 2WLQA 2P4EA 1WVRA 2K4JA 4Q4ZF 4NIDA 4IEXA 5BNPB 4BZ4A 1N47A 1NCQB 1MEC1 3IN9A 4QQPA 4Y20A 3MKLA 4YGBA 1PM4A 2K4BA 1BA5A 1DIWA 3POFA 3WG2A 1WZ2A 3HUGA 1FIPA 5DD4A 1GVDA 3OBRA 4XABA 2WAAA 2YU1A 4S0HB 4WX9A 4UNOA 4DYRA 1AJOA 3MIBA 2ZMEC 3O1VA 1BQPA 5C8WA 3H92A 3TN92 2CYYA 2Y31A 4PSWA 1HCRA 3LA2A 5DDJ2 3H1MA 4P55A 1BJQA 5DN2A 1G3SA 4YZ5A 3ZSJA 4AM3A 3GXUA 4G7OF 4H4KC 3CD6I 4FPGA 2R5YB 2E5NA 4BDYA 1B6AA 3AM2A 2KIQA 1VMJA 4QX0A 2KM2A 4QX3A 1RUF1 5ANQA 1X58A 3W6VA 4OUEA 4G6DA 3BALA 4UW3A 2Q8KA 4BLIA 3TYJA 1XS9A 4HOBA 5E3MA 4CUBA 1CONA 3HT2A 4NJ4A 3U11A 5JOYA 4AIJA 3OTFA 3D5LA 1QH7A 3LPFA 2P3IA 4UYBA 3IPVA 2R92J 2QUOA 1K7AA 1ZTRA 1XGMA 1VQ9I 4CEWB 5IFPA 2H0VA 4MGYE 4GO1A 4Y7NJ 4OVEA 2EALA 3AL0B 1MNMC 5EHDA 3TOAA 5I8TA 2HWD2 3RYKA 1GZ9A 4LUMA 4M3CB 2RM23 3DYMA 1WJFA 5A7NA 5KHGA 2J1RA 1DGRA 3CCVI 1B9NA 4F93B 5ICCA 4H0EA 2VL4A 4MV2A 3M8FA 5TSWA 2KFDA 5IOZA 5BNPA 1W2UA 4MGKE 5HV0A 1YRZA 2A73B 2CWSA 3H7JA 5H6RA 4QPOA 2EIDA 3HHHA 3WF3A 2OXBA 2ZGSA 4GYGA 4X0GA 3I3LA 3LDBA 4G8XA 3BY6A 4QDQA 1S29A 1AVBA 4MHGA 5E6HA 2OQ6A 5I0SA 3BJ6A 2QSFX 2EB7A 2EBIA 1G4DA 2YPRA 1OLME 3I97A 1BR2A 1GFF2 3CDZB 1O3SA 4Q0QA 3F8BA 4BUPA 4OIRF 1VBD2 2AEYA 2VJXA 4PJLA 1VPHA 3KS7A 4W50A 1WMEA 5FK8A 4XF0A 2R32A 1WLTA 4HL0A 4ZZDA 3LSEA 4JGZB 4AQSA 3PSIA 2J1TA 1EKEA 4U0YA 4N53C 4NOTA 5FLXZ 4BQNA 3NNJA 5ICFA 1E2XA 5LY1A 1VI0A 3WCSA 4DS0A 1C8M2 2HQAA 5CADA 4LK7A 2E1CA 1XX5A 4JGYC 4S05A 1UY4A 2EV5A 4C90A 2VKHA 3FK7A 3S17J 3QP6A 4DEVA 4YGDA 3I56I 4RAFA 4CCNA 4DINB 3O1SA 3E0JB 4M3CA 1ZZ6A 3HYIA 4ZS3A 4QPIC 1WLCA 5KNLA 3KCXA 4GXLA 1PZ7A 4XKCA 3QODA 1OCZH 3LFKA 4B4QA 4AI2A 2JVGA 3GMEA 1ZARA 1I5ZA 4A69C 2LP0A 1FYUA 4WM8B 5DUWA 3LWCA 1U5TB 2GNDA 2ZJQF 1WJEA 5F2WA 1YUDA 4JX4A 3DBLB 5EEGA 4E7HA 4L9VA 3AKQA 2JSCA 1YQ2A 3D0JA 3ORJA 1V5FA 5BNOB 2VJ5A 1ASJ2 1X36A 2DF7A 1ZYRF 1W0NA 5C71A 5JXHA 5HS7A 3DYOA 5C9AA 5FJKA 4L99A 2KDZA 4XKBA 4IEYA 3IV5A 2DBNA 3J80Z 2GN7A 4GULA 5GZGA 3WR0A 1FIAA 4M6XA 1F43A 2COMA 3O1PA 2FZ1A 1G2HA 4ZTFA 4ISQA 2O9LA 1W28A 2K3FA 2WAOA 4YVWC 2QSHX 4JGZA 1W8WA 4BQ5A 4ASLA 2HZTA 2KJBA 3AXEA 5HPOA 4M9SA 3CJIC 2V6EA 4FX0A 4LOSA 5IT9K 1HRV2 3C7OA 5BOXA 3O14A 4FHTA 3VBFB 5F3GA 3SC7X 4ESJA 2ELKA 2QENA 1YQAA 2M0CA 3QOPA 3W5MA 2IS2A 3RZLA 3GZAA 4E7LA 1H2LA 3TB0A 5F04A 4XMAA 5LBCA 4HQEA 1V9U1 5DUXA 2HWE3 4WVWA 4XPVA 2RNGA 4ISRA 3WD5A 4M4PA 3MIFA 1UCRA 2XC7A 5LEJA 2DA2A 1OD5A 2Y60A 1ETQA 4XMYA 4CDXC 4LITA 5CKQA