3E5UA

Ocpa complexed cprk (c200s)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
219
structure length
215
Chain Sequence
DFCGAIIPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGGNSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNTYNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKIIVYNLGELKHLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of halorespiration control by CprK, a CRP-FNR type transcriptional regulator
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Transcription regulation
molecule keywords Cyclic nucleotide-binding protein
total genus 68
structure length 215
sequence length 219
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e5uA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3e5uA01
1HW1A 5L3BA 1KA8A 4OIQF 4YIIA 1FP1D 2ESHA 1OFNA 2H94A 2CSOA 4GYIA 4HW0A 2QWWA 3GYDA 5HDGA 1D3YA 4RGRA 1WWXA 4J1WA 5E17F 2C0ZA 3CEWA 4KNYA 2VOPA 3DEUA 3E3VA 2DK5A 3ZMVA 3I71A 3KP3A 1GXPA 4U0YA 1R1TA 4ENNA 4EM1A 1I5ZA 4CXFA 1ZNPA 4UHTA 3K0LA 2P7CB 1O3RA 1IRGA 4HX8A 2B9UA 4I0BA 3H3ZA 4LGWA 2D2WA 1OI6A 3U0ZA 1LB2A 2VN2A 2OA2A 1J5YA 3LWFA 1STZA 4CGZA 1J0RA 1ZZ6A 4E2GA 4KIGA 2BGCA 4RD7A 3T5XA 3HQXA 3LFKA 4KL1A 4OOIA 2DCTA 4OIRF 3H8UA 2DPDA 1W4MA 4O3MA 4HSLA 1YLFA 1YS7A 3GBFA 2ZFWA 4OFGA 4JTNA 1Y3TA 2FSWA 4A0YA 2OYZA 3KLNA 1RNLA 3H1YA 3PVBB 3F8NA 1ON1A 1FP2A 3BCWA 1W7PA 3DL3A 3SMHA 2UY9A 3K9TA 1O3TA 1SFNA 1Z9CA 4OLLA 4WXHA 3MZYA 5D5XB 3FMQA 3F3XA 2F2EA 1VTNC 4H7LA 3FX3A 3KP6A 3D0SA 2EFOA 2Y0OA 4R79A 1P4AA 1AOYA 3EHKA 2FBIA 1QGPA 5IT9K 3S0MA 2WTEA 1GHCA 4EM0B 2H0VA 2CGPA 5FQ0B 3I59A 1X8EA 3GUDA 2HOEA 2FRHA 4CYDA 1U5TA 2EV5A 4JVAA 1TQMA 2COMA 2ZXJA 3DP7A 4IEYA 1JGSA 3BALA 4ZZDA 2UXNA 4WX9A 2R3SA 2G7UA 3E6DA 3KCCA 5KHGA 1CAVA 1UFMA 4MQ9F 3LA7A 2PFBA 4MQVA 3KETA 2MD5A 4X6QB 5I91A 3TOAA 4UUVA 5AVPA 1CF7A 1S29A 4HVQA 2XAQA 4LFUA 1HSJA 3NVCA 1ZZCA 2DT5A 3WG9A 4ENKA 2IA0A 4O6JA 1VR3A 1S6LA 2YU3A 3C18A 1P92A 3IHUA 1J3QA 4YARA 3ZMSA 4Q48A 2PTMA 4EMSA 2M45A 3M8FA 4AD9A 1P4WA 3SQNA 4BQAA 4YYOA 3KZZA 3FXUA 1U3EM 1IN7A 4BAYA 4LLNA 5HDKA 1G3WA 5CLSA 2M87A 2KKOA 2XUBA 4Q47A 2DQRA 2IPQX 1V70A 4I01A 5FB2A 1A04A 3U9GA 3KLOA 1UHMA 2KIUA 2XAJA 2HEOA 1LR5A 4P96A 5E8IA 3K69A 5FLXK 3BY6A 4LA3A 1SMYF 4P55A 5IT3A 5CVJA 5BV6A 4QM9A 2XL7A 3TKYA 3KE2A 1T0FA 1WLTA 4XFIA 1ZREA 3BU7A 5FLXZ 4Q0QA 4HN1A 2XHKA 4HVOA 1KU7A 5FDBA 3L2CA 4IPAA 4ZU7A 2D1HA 1ZRFA 4BNCA 5EEHA 2A61A 1Z1DA 4F7ZA 2ZNYA 1OYYA 4KMFA 2O03A 1QNTA 5FLJA 1NHAA 2FNAA 2CQKA 2DBBA 2P5KA 1ZN2A 3W6KB 1CAWB 5D1IA 3IDCB 3QOPA 4JK1X 3L7WA 3H50A 3TNPB 4A0ZA 4WXCA 2QLZA 3KP5A 2XKOA 2XLAA 2HZTA 3D5LA 2EFWA 1ZGJA 4N0BA 3WTWC 2F5EA 2OBPA 1CAWA 3H9AA 1ZH5A 4O9EA 4ETSA 2JT1A 3TOBA 3G3ZA 1JE8A 3CLPA 3EQEA 5BS6A 1NYWA 2KJBA 2VT3A 4Q4ZF 4LB5A 3HT1A 2BE5F 3MEXA 4UXNA 1IN6A 2GC1A 1P4XA 2PG4A 2RGVA 4F8AA 2AXLA 1NZCA 1O4TA 1LVAA 3EQLF 2FA5A 3WODF 2B5HA 3WW2A 1Z7UA 4HBNA 1ZZBA 2CYYA 2H6CA 3ECHA 1YHFA 3O3KA 4XSZF 3J81K 5A2QK 2P5VA 3E97A 4KA4A 1FC3A 1I1SA 3JAMZ 3RYPA 5KK1A 4GO1A 4Z2YA 3U11A 4U7BA 5AIQA 2ZMEA 3P9KA 1NXMA 1JXSA 3COAC 2ZKZA 2ZBKA 1XGMA 3CTAA 3PLQA 4M74A 2B0LA 4YFXF 2GZWA 4HYEA 3UKNA 1I27A 3F8BA 2WWYA 2XROA 1T6SA 3VFZA 1FYLA 1B6AA 1YW7A 2A69F 3MFKA 3OV8A 3HYIA 2O61A 5JSPA 5FFXA 1L3LA 3EO6A 2Q8KA 4B8XA 1XN7A 2JSCA 4A5NA 2Q2EA 3ELNA 3ZMZA 3FE5A 4M9ZA 2EA7A 3LWCA 1ZZ8A 4IEQA 4EWEA 5D6FA 1ONVA 3V4GA 3ETQA 2K7LA 2MA3A 1EPZA 3ACLA 2QYOA 1R00A 4B29A 2MH2A 2MLGA 3DN7A 2M8EA 2QCSB 1UW8A 2VPVA 1R58A 4TLFA 4LK1F 2IVMA 3U1DA 5CVVA 2IXIA 4WVZA 4HF0A 3UKTA 3GWZA 2OPKA 1USTA 2A3SA 4UV8A 3F22A 3KP2A 3IWFA 2PMHA 3QP5A 1TW2A 4WCGA 4WF2A 3G73A 4YFKF 2I45A 4P9FA 2F5DA 4RB1A 4GULA 1W7PB 2VC0A 4I3PA 2H27A 4Y17A 4XLNF 3GO5A 2PHLA 2HFHA 3E5XA 1QQIA 1XB4A 3VB2A 4DQ2A 1ZLJA 2RQPA 3QU6A 1KQ9A 5CU1A 1RUNA 2FEZA 1HKTA 2GAUA 4KDPA 3WE2A 3QAHA 3LQQA 5L3CA 4BIFA 1XCVA 2UWMA 2XRNA 4Q0VA 2M5WA 3LQRA 1H9GA 1TBXA 3JSPA 2XLGA 1JHHA 2EFPA 2XAFA 4XF3A 1HKQA 1D8KA 3F21A 3IRQA 2HR3A 1BOAA 2PQ8A 4Z82A 2DK8A 3R0AA 4R1HA 5LGUA 3V8JA 4A6EA 4BH9A 3BP8A 2FOKA 3ZN0A 2W25A 1TW3A 1YFUA 3M70A 3GLXA 2PN6A 3R60A 3R0JA 1LEAA 1W5SA 1UCXA 2OAZA 4OIPF 3VOEA 5H6QA 5LEKA 3MWMA 4G9YA 2PAKA 5TRDA 2Q0OA 1Q3EA 1MJAA 1T38A 4D7SA 3GEZA 4UBGA 2QQ9A 1SAXA 3CJNA 1FT9A 1W5TA 1T2KA 3OD0A 3BWGA 4L9TA 5HVQC 4MHGA 2ZNZA 3SCHA 3C3VA 2LSOA 1Z6RA 2GWRA 3PNAA 2GQQA 4M72A 3ES4A 5A2QZ 2Q30A 4LA2A 3Q5FA 1G3SA 3D82A 1Q43A 5DD8A 2EV6A 4QM8A 4IEVA 2ESNA 2Z3YA 4FX4A 4MTDA 3CUQA 4A0XA 1WA4A 2ISZA 1OYIA 2VBZA 4XSXF 1S8NA 5DCMB 1YTYA 2NNYA 2MNGA 1UIJA 5FFZA 2VOOA 1U5TB 1FY7A 2ADUA 4IEOA 4HVRA 3KEQA 4ENMA 4EJWA 5JHUA 3ZMDA 2W84A 1TQ5A 1U6GA 3DXJF 3I7DA 3BJOA 1YW9A 4G6QA 2UXXA 4S05A 4M6YA 4IRIA 4HZFA 1H0MA 2RN7A 1MKMA 3NJZA 2O3FA 2OZJA 4MEYF 1Z05A 2Z2SB 3GF2A 5HI0A 4G94A 4IEZA 2CAUA 1LKNA 3ISPA 1BI3A 2V79A 4OMZA 5C8WA 3I64A 5H6RA 3DV8A 1LRHA 1HW2A 2K86A 4CZZA 4KU7A 1ZAOA 1X3UA 2JPCA 4HF2A 5KBFA 1IUYA 3QACA 1CAXB 4Y15A 3ZN1A 2Y75A 3RPQA 1R1VA 3E5UA 3HUGA 1AWCA 1MDMA 2M1BA 2QNKA 4ZYDA 1ZHFA 2V1UA 2CO5A 4WK8F 4LEJA 5DCFA 2L54A 1V3FA 3HTSB 2A6EF 2RNJA 1R22A 2HJIA 3GFMA 3HIFA 3O14A 1VP6A 1HW5A 5L3FA 2VQAA 3RKYA 1JUHA 1XE7A 4HAMA 3T8TA 5JVTA 1BN5A 1QY4A 1FWZA 2WFPA 3KP4A 4HBLA 4A12A 4FBFA 2VBXA 1ODDA 1Q1HA 1SFEA 1K78B 3QRFF 5I0UA 4HX4A 3KFWX 2A07F 4KIBA 1ZZ9A 1Z91A 1PM7A 2J5OA 2L3DA 2VODA 4OU0A 3JAMK 2JPBA 5J8CA 2QVSB 4XFCA 1XDSA 5CJ9A 4EJTA 4EJVA 1I6XA 2F5CA 2IA1A 2P5LC 4PIXA 3J81Z 1MDMB 2ET7A 5ILVA 4HDUA 1FNNA 5D5UB 4H0EA 1LDJA 4WWCA 2GA2A 5FD5A 4A6DA 5KVRA 1J1LA 4TV7A 1R5GA 5E20A 1UIKA 4BXUA 1BBYA 2BYVE 2L4MA 2QBYA 2HKOA 4LD5A 2CFXA 3E5QA 3F23A 5J8FA 1OD5A 1CGPA 2V9VA 4KWKA 2MC3A 5JR7B 3BROA 3HSEA 5EFUA 2IW5A 2IXHA 1LDKB 3FF5A 4L0YB 1K6OA 5ILSA 1V4RA 1XGNA 3IWZA 3Q9SA 4META 5D6EA 2W85A 1XD7A 3NSTA 5E1ZB 3OGJA 2EFNA 4HV6A 1EP0A 1K79A 4MV2A 4R52A 1S7AA 3H92A 4O5VA 2GXBA 3ROUA 5J7MA 3P7NA 2Q1ZB 1MJ9A 1KYWA 2UYAA 4U7DA 4KN7X 1B1BA 2KIFA 3TO6A 3MAJA 1PDNC 3H3UA 1HXDA 1S3JA 1F4KA 2CW0F 3HSFA 3JTGA 1KQ8A 4N9HA 2QBYB 4WBBA 4MH0E 3GZ6A 3B73A 5EEGA 3GFJA 2R7FA 1FPQA 4EJOA 2RV8A 3L09A 4HLTA 3RI4A 2JZYA 4Q0UA 4XBFA 1IAWA 3TO7A 4RB2C 3N97A 1LQ1A 3FMRA 1FOKA 3FZ3A 3KMHA 5LHGA 1FI2A 1YUDA 5LGTA 3BB6A 4I98B 5EZWA 5D5VB 2LF7A 4L18B 1BI1A 1BIAA 4EVIA 5FO5A 5BPDA 1WGPA 5BPIA 3EETA 1SD7A 1OPCA 2P4WA 2ATFA 1FBSA 5J48A 3S2WA 4PZJA 3MYXA 2TDXA 3VODA 2O6GE 1QBJA 4FAGA 1RZ4A 4U88A 3WGIA 2IC1A 1FX7A 4Z07A 4X6RB 1D8JA 1IPKA 4PGHA 3N4MA 2ELHA 3HT2A 2ACJA 5JSOA 2XAHA 2UYBA 1O5UA 3L2HA 4ESFA 2QQBA 4YSFA 1U12A 3IL2A 2RKHA 1R5HA 2G7HA 1KQ0A 1LNWA 5HLIA 5JCTA 4U0VA 4DNCA 1J3RA 3FM3A 4RB0A 4RS8A 1FSEA 3E6CC 4M9SA 2IA2A 3BPXA 2VONA 1YWKA 1H1IA 3F72A 4O9GA 5K5OA 1XSVA 4UXAA 4CDGA 1FSHA 4QLCU 1J9IA 2L01A 5BQTA 1TQPA 5L3DA 4ESBA 3SCGA 1CF7B 1CX4A 3LAJA 3AAFA 2N7GA 3W6JB 3IBMA 4IF4A 2F5FA 3WTYC 4U0WA 1XE8A 3BZ6A 1OR7A 2OQGA 3V7CA 2LF8A 1L3JA 2JTVA 4QGMA 5LHHA 1O57A 1GXQA 1U78A 2VE8A 2FQPA 4I7HA 2MPFA 1ZX5A 5J3UA 3FM5A 4XF4A 4IXAA 5KHIA 1B59A 2FNPA 1XCBA 2RC4A 5BUVA 5HLGA 3CDHA 3FXQA 3WW3A 1IN4A 5I0RA 5BPXA 4HF1A 1SD5A 2ZO4A 2V6CA 3K1NA 2K4BA 3WU1B 3PQKA 1QPMA 1IXSB 4FAHA 3EYYA 2HYGD 3RTRA 4XFHA 2KXLA 3LAGA 3BPZA 5LHIA 1RC6A 1FBQA 3SZTA 3ULQB 3SHRA 1SFXA 2HWVA 2MH9A 1YYVA 1U2WA 5E16A 4KT5C 2PQQA 3OCPA 3V7RA 2IXKA 4ESJA 2M30A 4IEPA 1ZRDA 3S7EA 4P9GA 2D5FA 5BXXA 2YX4A 4KUMA 3CO6C 4EM2A 1IZ1A 4NQWA 4ZU5A 4WXDA 3FXRA 2W24A 3RJPA 5H20A 5D8KB 3RKXA 5DCMA 3SHFA 2LKPA 4IHSA 4L9VA 2P17A 4AVPA 2O8XA 1ZG1A 3WTTC 2ISYA 4WZCA 3KGZA 1KGSA 2KIMA 3QPHA 4EROA 4ZYGA 4IVNA 3JZVA 3DPTA 3QU3A 4HQEA 3O2PE 5HOOA 1ZYRF 1B9NA 3DKWA 1UHWA 1KU2A 3DPLC 3TDUC 2Z9OA 4M73A 4FX0A 2PLYA 2BEOA 1SMTA 1SEFA 1XRUA 2UY8A 4LJZF 5AIPA 3I4PA 3G7DA 1WQ2A 3WTUC 1TNTA 1H1MA 3FHIB 4XFGA 5FD6A 3K1PA 5TJJA 3GYHX 2C6YA 4EJUA 4PIYA 4ZYEA 3Q9VA 5FCCA 5FLHA 3PFIA 3F8FA 5E8GA 1YS6A 3BDDA 4LG0B 2Q4SA 1J2XA 4LMYA 3WE3A 1X82A 2FBHA 3NKTA 1DGRA 4I02A 2CV6A 4A2UA 4UVAA 1REPC 3ZMUA 2EA4A 3WGHA 1E17A 6PAXA 4AXOA 1BIBA 5ICEA 3ZMTA 2QUFA 1ZG3A 3F8MA 2LDUA 3USSA 2P8TA 3F8CA 5I8TA 3HRUA 3CUQB 5HS7A 1OMIA 1Z6TA 3CL1A 1MJBA 1J58A 2XGXA 4MGKE 4MNUA 2HQNA 1EYBA 4KWLA 2J5PA 3TNQA 3MPBA 1MD0A 4UBHA 2OQRA 1IF1A 4XFBA 2NRAC 5E1RA 3I58A 1DDNA 4LTAA 2EB7A 3V8KA 2XAGA 2ETEA 1ZRRA 4D7TA 1B4AA 3MQ0A 3GFLA 3NRVA 2OA4A 4RGUA 5DYMA 2YR2A 4HSJA 1U5TC 2PAEA 4AVAA 4HDVA 4ZU4A 2IP2A 4XLPF 3D0JA 1EH6A 1S7OA 2X0LA 3FMSA 4ASNA 5CVUA 1BC7C 3T8RA 3SZPA 2JRTA 3V8LA 3L9FA 4ENJA 1W7PD 4LUMA 4LUKA 4RAYA 1X7NA 3REOA 3TGNA 4RAZA 3NW4A 1R7JA 4M6XA 2CG4A 2O1QA 1OKRA 4AVBA 3IKVA 3U2RA 3IKTA 4AQ2A 2RVCA 2XASA 5I0TA 1XGSA 4EWDA 3ZP5A 2PA7A 1J75A 3OF1A 1XMAA 4P9UA 2L02A 4XF0A 4I09A 4HX7A 1R23A 1UD1A 3KZYA 4LLOA 2HTJA 1YIOA 2YPRA 4AVCA 2W57A 3LA3A 4JQFA 2P7VB 4YRDA 1RL3A 4EWAA 2GC0A 4LB6B 2DI3A 5D8LB 3SXWA 3NEUA 1D5VA 3IC7A 1ZVFA 3V7SA 1TNSA 5LBQA 2E1CA 1G4DA 2IJLA 3R6SA 2K4JA 1G3YA 2PMUA 4XETA 5T3NA 1YG2A 1O3SA 3ZQ7A 1I1GA 1DZRA 4IRHA 1QWRA 2IXJA 3GVAA 2D5HA 2Z5UA 2O8QA 2K9ZA 3QPTA 2Z99A 4YG2F 4XF9A 1SQ4A 4IRGA 2EAAA 3MZHA 1SD4A 4QGLA 3R4KA 2QENA 4Q5SF 2VT2A 3T1BA 4BHBA 4L5IA 4MEXF 5BMZA 2P6TA 2K27A 1BJAA 4KWJA 1NE6A 3UKVA 4AIKA 2GU9A 3HOTA 1RUOA 3KGLA 4Q0SA 1XGOA 3GX4X 5HS8A 1IXRC 2ZKLA 1FZPB 2HGCA 1QO0D 2R7DA 1NE4A 4QX5A 4IHTA 3WTZA 3K2ZA 3MCZA 3TQNA 1GVJA 4FT8A 4I2OA 4XFAA 1XSDA 4E2QA 4IERA 1KYZA 4HOBA 2BV6A 3QP6A 2E7WA 2PJPA 3WTVC 4XRFA 1DZTA 1XSXA 1CAUB 2PYTA 1RI7A 1X8MA 2A68F 2NAZA 5F6FA 4B09A 4PIZA 4CO8A 1EH8A 2BNOA 1Q5OA 1QXJA 1TLHB 5LLQA 1ZGAA 5ED4A 3E6MA 2E7XA 3HTUA 4L9NA 2V1XA 1KU3A 3WTXC 2XLFA 2NNNA 4GCVA 5LGNA 1G3TA 2XKPA 2STWA 2EVXA 4UNOA 3FWEA 4KYWA 4PCQA 1DP7P 2EK5A 2EV0A 4QMAA 2OU2A 1BI0A 4HA8A 3KP7A 4HN0A 3C1DA 1MGTA 4XFFA 1JHFA 2MBFA 2ET1A 4HMZA 4PDKA 2PI0A 2H09A 3RPUA 4M9XA 4AIJA 1HBXG 1QZZA 1UCRA 3I5UA 3SXYA 1DGWA 5E1WA 4OIOF 4D0PA 2D1VA 1EY2A 2IRFG 5K5QA 3FJSA 5FPZA 2XV4S 5DDGA 4KN4X 5LRRA 2FBKA 3ELKA 4HLXA 4OMYA 1H9TA 1J59A 1EV7A 3PQJA 1DPRA 2F4PA 4QWQA 2CAVA 1ZG5A 4GGGA 4LG0A 3BPVA 4K8FA 4AWXB 4IJAA 5JR3A 5K1YA 3WW4A 3HHHA 2FF4A 3RIRA 4JBAA 1CAUA 1UB9A 1YFXA 1XMKA 5JAXA 2IT0A 3JW4A 5L3EA 2VE9A 1FXZA 3HHGA 3DQVC 4L9JA 2OZ6A 4G7ZF 3ML6A 4YIFA 5ICGA 2XIGA 3M8EA 5I8SA 4BYYA 5LEJA 1DPUA 4HQMA 4DINB 5AONA 2PBIA 5KHKA 3J80K 1HQCA 2HYFA 4RB3C 1IRFA 2QJVA 3HRMA 3GZ5A 4L0ZB 2IXCA 3IIAA 4J1XA 4LK0F 3ERED 1U8RA 2IXLA 4CICA 3EYIA 4CHUA 1IN5A 2VECA 3I59B 3LOIA 5BY5A 3ZPLA 2X4HA 2A6HF 1YFWA 2Q0AA 5BOXA 3RYRA 3JSOA 2VBWA 4BHCA 2L4AA 5D4SA 2EA2A 2DAOA 4KFCA 4E2SA 3H7YA 3HSRA 1J3PA 4A5MA 5FPXA 1YO5C 1VJ2A 1OYWA 2VXZA 1RTVA 1HSTA 3F6OA 3K1MA 2V09A 4HLYA 4G6DA 1WRJA 1MZBA 3EJKA 4BHPA 3P9CA 1FYKA 5CADA 3GW2A 4AQ6A 2ZCWA 3U10A 4YNIA 1YFHA 1E2XA 3GXOA 4AIHA 1J7KA 3LZZA 1XDUA 1HKSA 4EV0A 5ERIA 2VBYA 3O6BB 2DU9A 2E9QA 2BNNA 2FQ3A 4MTEA 3ZDSA 1R36A 2GA1A 4I0AA 2DFIA 5F64A 5KHHA 3FHZA 4MZUA 5E1XA 4EGZA 4Q29A 2QDRA 1O5LA 2A5YB 2DTRA 3HOSA 5E18F 1FLIA 2ZMEB 2FMYA 1P2FA 3B02A 2PEXA 3J80Z 4YFNF 4GXOA 3VEPA 5FQ0A 2Y48A 5ICFA 1O7FA 1WI9A 3BJAA 3NL1A 2GH2A 4E70A 3RYKA 3BOQA 3NQOA 3KEOA 3TDZC 4RGXA 1WKMA 3KSCA 4OINF 4G7OF 2QQAA 2NYXA 4MX3A 3EUHA 3CUQC 3M3IA 1LEBA 1ON2A 1LDDA 2DLLA 2DW4A 1IW7F 3T0YA 4K2EA 2G9WA 2Y0MA 4MGYE 3BJ6A 3H1WA 2BBYA 3J7AO 3RDIA 4L5JA 4NVPA 2HDCA 5F1RA 5I93A 2HS5A 4IETA 5ILUA 4QXKA 3VHRA 2KRFA 4UVCA 1LJ9A 2OD5A 2D40A 2GIVA 3EBRA 2RDPA 1EH7A 3M9AA 4EGYA 3JTHA 1SD6A 1T39A 4KIFA 2OZUA 4NB5A 1GQHA 1YQAA 4MGIE 4G7HF 2HTSA 2D45A 3TO9A 3RKWA 2H6BA 2Z69A 2STTA 4LLGF 1P6RA 5C6CA 2UZKA 1L0OC 1R1UA 5JFRA 2EWNA 2P6SA 3DFGA 2EJRA 2QVOA 2FE3A 2K0GA 1G6NA 5ICCA 3F6VA 4LLLA 1IN8A 1TQIA 3RZZA 2O0YA 2HQRA 2Z33A 2GXGA 1USSA 4XF1A 1GQGA 4ORFA 1PP7U 3C3WA 4Q0PA 3FFQA 4ZYHA 5DV5A 4KMUX 3DF8A 3OOPA 1O3QA 3HRSA 5CYVA 3WW1A 2VC1A 4KICA 2EFQA 4M71A 3M1EA 4P5OA 2FMLA 1Y0UA 4JTOA 5DD4A 2QZ8A 4G8XA 3I54A 2GC3A 5K8SA 5JI6A 5I8YA 1CAXA 4UVBA 4NHJA 5L3GA 5HLHA 3H1MA 3C7JA 4R8HA 3SCFA 1ZRCA 1IPJA 1RIOH 4HV5A 1TTYA 5DUKA 2KJCA 2B8MA 1IXCA 2D93A 2ZJ2A 1PUEE 1O7LA 1F1ZA 3LA2A 3CLOA 4ON0A 1YFYA 5FLIA 3WTSC 5HS9A 1ZZ7A 3OTFA 3L00A 3HRTA 3R61A 2PFWA 2YSRA 4IEWA 2BNMA 2QM3A 4XEZA 2DQLA 1BM9A 5DEQA 4IEUA 3RNSA 4QGNA 3CO7C 2DPUA 4IEXA 2LNBA 5IT9Z 1ULYA 3LAPA 2V1DA 4KU8A 3ES1A 5KHJA 4ONUA 3CUOA 1YW8A 3ABUA 4ZH4F 2XL9A 5FGMA 1BC8C 1QZYA 4RGSA 1F5TA 2MHFA 1C0WA 3SFZA 3MDPA 5K5RA 2MLKA 1DUXC 3P9IA 3M7GA 5D5WB 2AS5F 1ZARA 3FZVA 4L2NA 2ETHA 3GFIA 4MUVA 3ST7A 1K78A 4S04A 1BI2A 5LRSA 2WC2A 1PP8F 4ZZLA 5D4RA 3H7JA 2PAMA 1QXRA 1FYMA 2YX7A 3CJXA 5CVIA 4PJYA 5CVRA 4N9IA 1T98A 2CWEA 4PGGA 4MGZE 4Y13A 4L11A 2WV0A 1UPIA 3IDBB 3WGGA 4IESA 2PHDA 3CO2A 5J6XA 4JV4A 5I0SA 3I53A 3CF6E 3ECOA 2FU4A 1K7AA 1CAVB 4UV9A 5JSRA 4LULA 3E6BA 4GYGA 2K02A 4MGRA 5HDNA 3IRRA 4FHTA 5DUIA 1F9NA 2DO7A 1Y9QA 2NS0A 1SFUA 3EDPA 2FXAA 3S7IA 3I0TA 3WU0A 1KU9A 4EQQA 1YLLA 2XVCA 2E1NA 1WSUA 1B9MA 1ZLKA 3LSTA 1PMIA 2HKXA 3ABTA 1RGSA 2GC2A 1FBUA
chains in the Genus database with same CATH superfamily
4YVWA 1KA8A 3Q0VA 1OVSA 3C8XA 4RYDA 1ZTRA 3OSDA 4XORA 4D6SA 3MV01 3LPGA 1OA4A 4GYIA 2SLIA 2L9SA 1Z77A 3GYDA 4KG0A 3KF3A 3K4DA 4C0HA 1WWXA 4J1WA 5FREA 5EHDA 2AUYA 3CEWA 3ZMVA 1GXPA 2TBVA 3WZ1A 1SAUA 1VQLI 2OPWA 1WMFA 3SJMA 1MS5A 2LTNA 4UHTA 2DCKA 2WAEA 1ZGWA 4PBOA 2FDHA 3BQYA 1QPIA 3AX4A 1SLTA 4LGWA 4NQWB 2D2WA 1OI6A 1LB2A 2YMZA 4EN0A 3SDGA 2IEKA 1W36D 5J96B 5GTIC 4BA6A 3HQXA 1Y6IA 4KL1A 2XGDA 1OH3A 3WNKA 3M1CA 3BTAA 4HSLA 1NG7A 5FV3A 4AI9A 3I97A 4A0YA 1Y9MA 2HPIA 1VLNA 1LHOA 3H1YA 2DFFA 1Z7S2 2BGPA 1W6PB 2E51A 1JU3A 4A3ZA 4UFKA 4FASD 3FMQA 3F3XA 2ZJCA 4CCLA 2JRMA 2IFWA 4IV1B 4RS5A 2YU9J 1FX5A 1HDPA 5IT9K 4RDUA 5KR7A 1GHCA 4EN7B 4OHYA 4EM0B 4BE0A 3I59A 4FPOB 1L7LA 2VZTA 3UGGA 3K4BA 3VYTB 1RVF1 3VPRA 2HOEA 1A3KA 2FRHA 1U5TA 1TQMA 2COMA 2ZXJA 3ITQA 4ZZDA 3KCCA 5KHGA 1CAVA 3U14A 1QJY2 1UAAA 3LEGA 2Q8DA 5C3OA 2MD5A 1ZQ3P 5I91A 4FSJA 3PM1A 3BYWA 4E4HA 1ZBE1 1CESA 3NVCA 1N75A 3BQZA 5FMBA 4H2AA 3JRCA 1P92A 3IHUA 4KGGA 2PTMA 1MMSA 4LBQB 3LQCA 2M45A 3O1VA 4BQAA 3S5QA 2GP5A 4HK9A 1U3EM 5FUIA 1VRH2 3L2VA 1HB1A 5GAHJ 1G3WA 2DYRH 5CLSA 2KKOA 5IVCA 2WQ4A 2VO5A 3NNMA 4D3WA 1R083 5FY5A 3DEEA 3J9SA 3POJA 1UHMA 4P96A 5E8IA 3K69A 5FLXK 5DG1A 2FDGA 1W0PA 1XE0A 3S57A 4OMDA 1GOHA 3LGRA 1AR63 3KE2A 1T0FA 2JN6A 1XC5A 1KU7A 5FDBA 3VBRB 4A3MJ 4ZU7A 2HWF1 2D1HA 3VDXA 1ZRFA 4AU7A 2LUWA 3S1QJ 2R0QC 3ZOIA 2O03A 4TN7A 1NCQB 2FNAA 5GPAA 3P6BA 2PMZA 3WG3A 1ETXA 2CL2A 4XQ4A 3QOPA 1ND2C 4RN5A 5FYHA 3GZUC 5IK4A 3KM5A 3D5LA 5HNHA 1ZH5A 2GMMA 2GNBA 4A3FJ 1G9CA 2A70A 1R4MB 4ETSA 2IGOA 1BQPA 2VI6A 3G3ZA 1JE8A 3CLPA 3DPRA 5BS6A 3BZKA 1NYWA 5JMOA 2KJBA 2VT3A 2BE5F 1OBNA 4UXNA 2R043 1IN6A 3J4UH 5JOXA 2RGVA 4F8AA 1R71A 1P9QC 1HQWA 1PHMA 4PJNA 5FP4A 4ET7A 2LW8A 1PIV2 5AFBA 1LNSA 3PUQA 1W6MB 2FA5A 5EJ1B 5LA0A 4QPGB 4W8JA 1OLRA 5T50A 3ECHA 1RUI1 1YHFA 4K1YA 4XSZF 1UX7A 3NWSA 5LBCA 1APNA 1OURA 3ZXGA 5JUVA 1BXHA 3JAMZ 3RYPA 1D1CA 3WP3A 3P9KA 5CKTA 1NXMA 5DAWA 1JXSA 3COAC 1GUIA 2F4IA 3CTAA 1YIFA 4AFAA 1YITI 1PZ9A 2WBKA 4D5CA 2GZWA 4Y3OA 2PMZN 2R7EB 1I27A 1QMJA 3ZYGA 4IQ4A 1T6SA 1YE9A 2BRTA 3HMYA 1GFF2 4HPQA 2Q8KA 4JZRA 4B8XA 2JSCA 3T1LA 4HETA 3P1IA 5DTDA 3FE5A 1GWLA 3A02A 4JGZB 4A3IJ 1ZZ8A 2X1DA 1VRH1 1OXCA 1Z3XA 3A01B 5LBEA 5F9TA 5M5XJ 5HCBA 1EPZA 4XL9A 2CNAA 2L9VA 4LHLA 4M3CF 3ZVXA 4E8CA 5EJ3A 4B29A 2MH2A 1ERDA 1SLIA 2E7QA 1R58A 2K5CA 4OUSA 4FE7A 3I2FA 1VQ4I 4YZ3A 4NHXA 4HF0A 1MMGA 3GWZA 2OPKA 3WU2C 5LK7B 3DF0A 4FPCA 2G1MA 4BY1J 3IWFA 3V64A 5FROA 4WF2A 5FR3A 3G73A 2CHHA 3RZLA 5J1UA 4II3A 2NP0A 3PJYA 3THDA 2ERFA 3HGYA 3T2QA 2TEPA 5EYXA 2PHLA 1YJWI 1XB4A 1A5JA 4NAOA 1VBE2 1KQ9A 1VBD3 1GT0C 1AKHB 4JHZA 5F08A 2WT2A 5L3CA 2NMOA 1XCVA 2VOKA 2E2IJ 4Q0VA 1TBXA 1Z7S3 3ZN4A 3ZKUA 2EFPA 4XE9A 3F21A 1CPNA 4XC9A 4R1HA 3B3QE 3LSPA 1O59A 1YO8A 4MFEA 2LD5A 4HPKA 3ZN0A 4YGBA 2W1WA 1F43A 3OUIA 3D4KA 1W5SA 4XIDA 1BMV1 4OIPF 3VOEA 1VNDA 1ULPA 1IS5A 1RUC1 1DP0A 5JOYA 1MJAA 2A6XA 1T95A 2DT6A 3OEBA 4I30A 4XUNA 2WSVA 3TBIA 2FHRA 5C3EJ 2NS7A 4CDUC 3ZRGA 1UXZA 3ZIXA 4X1EA 5A6YA 3EUKL 2GSYA 4MHGA 1Q8SA 2W00A 3UESA 2X51A 2GWRA 1ZBE3 3PNAA 1F36A 2GQQA 2LROA 4DYCA 1HJGA 3ES4A 4LA2A 2VKDA 1K5MB 2X10A 1E3HA 3BR1A 4ZXKA 3BCAA 3RJ2X 2O14A 2BFUL 2Z3YA 4FX4A 5LATA 1V6OA 4PDWB 2GMPA 3OWTA 4FQGA 4R9DA 3LSHA 4QKDA 4XSXF 1S8NA 3MHZA 1DU6A 5A6QA 4AI8A 2VQLA 2ZABA 1WJAA 2ADUA 1JODA 4EJWA 4PQ9A 1CONA 1PVEA 3ZMDA 1LOFA 4XAEA 3FLPA 5LY1A 5D21A 4G6QA 2UXXA 4S05A 2MC4A 4PFPA 2ZOEB 5J98B 1MKMA 1ZYBA 2O3FA 1JN2P 2LKSA 1QOTA 4MEYF 4OUMA 3BR6A 3QLQA 3IN9A 2B39A 3S17J 1WLWA 3OB8A 4IEZA 5I0DA 1ZM1A 1LKNA 2V79A 5C8WA 3I64A 3DV8A 1HW2A 1PZ7A 3K4KA 1ULCA 1ZAOA 4BQ1A 4HF2A 1NCRA 1DQ5A 1T33A 4HKOA 2RE9A 3ZN1A 5FMCA 2Y75A 1UG0A 3HUGA 2E71A 1MDMA 2RS12 2PLV1 3AM2A 4IHVA 3FBIB 4BDZA 2C6SA 4JDNA 2CDPA 1ZHFA 4FOQA 5C4WB 4NRMA 1HXS2 3ZFFC 3VBFA 2KL4A 2WJSA 3ZFGA 4KNCA 1FOYA 2XONA 3FBYA 3HTSB 2A6EF 1R22A 3GFMA 3HIFA 3O14A 1HW5A 5IP9J 1BZWA 1LGCA 3HUGB 1XE7A 4HAMA 1NLSA 3T8TA 5JVTA 4DZGA 1QY4A 1WGXA 1ODDA 1Q1HA 3ENRA 2A6YA 5I0UA 4HX4A 3S16J 2AH2A 2R7WA 4OU0A 2IUWA 1NY72 1GWKA 1WJFA 1X9TA 4EJTA 3A4CA 3Q8BA 1H9WA 1I6XA 2P5LC 2ECCA 4PIXA 4COUA 2LY1A 1GNYA 3QH6A 5FFOC 3G71I 1XYPA 1PUFA 1TC3C 1RR7A 1AR92 2VJ5A 4WWCA 2GA2A 2C24A 1GOFA 1UIKA 4Y1XA 5A80A 3POBA 3VSLA 2JVGA 1S55A 5GZFA 1ND2B 1OUXA 2MC3A 1MW7A 4AHWA 3PJRA 3FF5A 1BBT2 1VI0A 4L0YB 3BOPA 4NOTA 1IS3A 3OYWB 5ILSA 2LC2A 1BA5A 2L9LA 5D6EA 2W85A 3I2HA 2KRHA 3OJBA 4A4AA 1EP0A 4NIDA 5FXVA 1K79A 4MV2A 2BZTA 1POV0 4Q5OA 2WS91 5JR2A 1MJ9A 4BDVB 2UYAA 4U7DA 3H5NA 3I3QA 4KN7X 2KIFA 4F3JA 3TO6A 4FTBA 2L5QA 3UGFA 4XLAA 2WBMA 1PDNC 1RKTA 1PO22 3WHBA 4B4CA 4K7JA 3HSFA 3KYLA 3B73A 1HV1A 4PF5A 1OQYA 4PDWC 2CGNA 3K51A 3RI4A 1YRNB 4BZ4A 5IT6A 3FKJA 1FIAA 1IAWA 1AHSA 2IGMA 3N97A 2ZJRF 5K7PA 3KMHA 1FI2A 2CW7A 4PCRA 1NLRA 5EYRA 5D5VB 3T3YA 5J40A 5F3CA 3ZQLA 4XKCA 4RFT0 3OPWA 1BJQA 2CDOA 5A7WA 4CP0A 1VBD1 5FAXA 5BPDA 1UQXA 1QJX2 1BK1A 1PK6C 4M01A 3RMXA 1FBSA 3S2WA 3UT0A 2M7AA 1H4HA 3MYXA 2JJ7A 4FAGA 2CU5A 2COBA 1FX7A 1KFUL 1QH7A 3TN91 1W6MA 3DLAA 1AR81 1E3OC 4RAFA 3HT2A 2ACJA 5K9YA 2FDFA 4I0WB 4OQ8A 1T08B 2VOWA 1LULA 2L7ZA 3IL2A 3ILRA 1R5HA 5FY9A 1VE0A 2DN0A 2LOOA 1LNWA 3B9CA 2VQCA 4DNCA 3BR5A 5GADJ 1ACCA 1GSLA 2X9DA 1FPN1 3VBHA 1OCPA 4LBLA 3ZYPA 1SFYA 5LFAA 1HRI1 1C3HA 2IA2A 1CJDA 2HQ5A 4CXYA 3LEMA 2LS6A 1XSVA 4OAZA 2JSPA 4BQQA 1CQTA 2L01A 2ELJA 1UOFA 4DMIA 3AAFA 3WNXA 4GWJA 3V0AA 4IF4A 2EXKA 2F5FA 1XE8A 4LO7A 3PNTA 1Q8VA 1IRXA 4L0PA 3V7CA 1GP5A 3VBUC 5F6LB 1VIWB 4A44A 3OGRA 5EEAA 2KISA 3EB7A 3K7AJ 5J3UA 4IXAA 3E7LA 2DUOA 1J84A 1X1AA 3FXQA 1JMUB 5EV7A 4C1XA 4Y5Z0 1IN4A 5BPXA 5CIRA 3WQBA 4HF1A 1SD5A 1V5EA 2ZO4A 2FX0A 3HKZN 3IDAA 2CUZA 2XBO2 5D8AB 2D6KA 3ZLIA 4TYSA 4FAHA 1H2KA 1VMJA 4YVSA 5DUUA 2KXLA 2HQAA 1RUJ3 3I2GA 2ZEZA 3EMRA 4DO0A 1FBQA 5E3MA 3JBG2 3HQUA 1V55H 1NX9A 5CZKA 1ASJ3 1QQP1 3G6JB 5E16A 2P5BA 2JICA 2PQQA 1WKYA 4GQ7A 1ZRDA 3S7EA 1IOAA 3PJQA 2A6VA 5BXXA 1DDLA 1W0TA 3CO6C 3RMYA 3RJRA 4CCCA 5FJKA 2JD9A 2D7FA 2C5DA 2W1UA 1C57A 4CPBA 5F3GA 5H20A 1D7PM 4E27A 5DCMA 2BW8A 5GLTA 4UF0B 3C2HA 5A3PA 2P17A 1UZZA 2VXRA 4AVPA 4CU8A 2O8XA 3WTTC 3GHNA 3KGZA 5EZHA 2K9QA 4K6BA 5C4WA 3HBLA 3O2PE 1ZYRF 2ZGRA 1B9NA 3DKWA 1UNBA 4QKNA 2DURA 4FX0A 2BEOA 5IVBA 2UY8A 5FBZA 1AL23 2WSUA 5AIPA 2XJPA 1QDCA 1ALYA 1QVTA 2ZGSA 3WTUC 1H1MA 3IPVA 4M0HA 2VC9A 4XFGA 4ZTJA 2C6YA 1WCSA 4ZYEA 1YS6A 2ME0A 1ULDA 2Q4SA 5DAXA 2DCYA 3IAQA 5FKMA 2FBHA 4G9SB 2DDBA 4IGQA 4QHBA 3ZMUA 1Y1VJ 3OGGA 1OJLA 1BIBA 4IX7A 4DPNA 4AR2A 2FD8A 1COV2 5K0UC 1LOFC 2IS6A 3SLIA 3F8MA 5A3WA 1SVOA 4PDWA 4A3BJ 3FXKA 2HQNA 4HPKB 2PMWB 1HX6A 3TNQA 2W5FA 4GAZA 2EXJA 4UBHA 1LJ7A 4OQ9A 3T09A 1BEV3 2HWE3 2WNEA 5C4XJ 2NRAC 2VH9A 5E1RA 1OKQA 1JI6A 4RQPC 1VBA2 3LSGA 2XAGA 2ETEA 2D6OX 2YR2A 1U5TC 1PGSA 4AVAA 4HDVA 4ZU4A 2IP2A 3TEDA 5JOZA 1S7OA 2YROA 2X0LA 4OI0A 3J8F1 3DBHB 1LHUA 1S0CA 5CQGA 2LRPA 3T8RA 2XC7A 3U78A 3SH5A 3L9FA 3PUIA 3KZ4C 2MD0A 1X7NA 2B4KA 3A0HC 3TEWA 4IV3A 4M6XA 1A36A 4DB5A 4AVBA 1VBE1 5A70A 5EJZB 3IZOA 4RA0A 3FKIJ 2Y60A 2RVCA 5I0TA 5IK5A 2ZEYA 4EWDA 3ZP5A 4XIOA 4EN6B 1J75A 1NY71 1XMAA 4DZPA 2L02A 1V9U3 2YG0A 1YX3A 1R23A 2M2EA 3URFA 2HTJA 1YIOA 4NPLA 1CVNA 4AVCA 1JYIA 3WG2A 2W57A 2BY0A 1A8MA 5A1AA 4LB6B 5DZGA 1XSRA 3R4UA 3BTYA 4F92B 5D8LB 1JZ7A 4JGZA 2VBDA 3OIOA 5LBQA 1AXKA 1QJU3 2A3WA 4PBPA 4BQYA 4XJUA 3R6SA 4JQRA 1MMNA 2X8KA 1YG2A 3ZQ7A 1R092 2XSJC 1YIJI 1DZRA 2R7SA 4OMCA 4H4KC 4IRHA 5FPLA 1U5ZA 2D5HA 3H36A 2E33A 4JX0A 1FMWA 4G4FA 4LOSA 3AKQA 3CLQA 4CXXA 4XF9A 4IRGA 5APAA 1SD4A 3P5BA 4QGLA 3TW6A 3VBSB 3ETPA 3MEPA 1UYYA 1IV6A 2FBEA 2K27A 1BJAA 1VF9A 2AO9A 2K85A 1UZWA 2DVAA 1PK6B 4BBSJ 3GALA 2DVBA 2QQWA 3A0KA 3DPRC 5FZDA 2IZWA 4QQ2A 4QPGA 4D5FA 2VE1A 3HOXJ 1FTTA 3GX4X 1JTYA 1K45A 2R072 5FYMA 2R7DA 2JA6J 4UYBA 3K75B 1A35A 4UFHA 3MCZA 1TL8A 5CEHA 4LKDA 3USUB 3HDDA 1TZLA 1S4CA 1XSDA 4NNJA 3AKSA 4XRFA 4HONA 2VY0A 3M3CA 1XNAA 4YGDA 5IWFA 1W5CC 5B66C 3ZMOA 4COVA 1ZGAA 3E6MA 2BY3A 1QJY3 2NNNA 4GCVA 1C8NA 2XKPA 2STWA 1N3PA 3VKFC 5A3NA 4UNOA 4KYWA 2QA4I 2EV0A 4QMAA 2ZX4A 3VLBB 1MGTA 2DCZA 4XFFA 1JHFA 3SEPA 2MBFA 4YW2A 2E1OA 1U8BA 4BUPA 3FBNB 2AENA 4XUOA 2KZVA 1SLAA 1IO2A 4XZPA 1UCRA 2VIXA 1DGWA 3AKPA 5E1WA 4JX5A 5DDJ3 3AG3H 2IRFG 5DUWA 5K5QA 2BERA 3KEYA 4E7IA 1KDMA 2RVAA 2FBKA 1B09A 1CZSA 1JJ8C 2UWBA 1DPRA 3OL3A 4GGGA 4AWXB 3WW4A 2ZMKA 4RL7A 3JUUA 1QGLA 2J1RA 5FLVA 2H1LA 4JBAA 1XMKA 2IT0A 4C30A 5L3EA 2VE9A 3HHGA 4UB8C 3VBUA 2OZ6A 4G7ZF 1BOBA 2RS33 4BPZA 3QPLA 1APLC 2D97A 4G3YC 4EQVA 3WP6A 4DINB 2NZ9A 1AUYA 5KHKA 1IRFA 1EKEA 2QJVA 3E0JB 3IIAA 1H88C 4CU6A 4LK0F 1KEXA 1JJ6C 3PL8A 2WA3A 4IXLA 3NRUA 3I3LA 3OY8B 2QQLA 2RR11 4QD2A 2ZJPF 3FHQA 5E3OA 3PSIA 2A6HF 1WCKA 1YFWA 2Q0AA 1GQPA 4QTRA 3JSOA 2LRDA 2XF7A 2EIGA 5FRAA 2VUMJ 4E2SA 3HSRA 3OSGA 1J3PA 5FPXA 5DAVA 4LHSA 5FZGA 3HQRA 3K1MA 1U0AA 1VBA1 2EICA 2R0FA 4P14A 4G6DA 1WRJA 3OBAA 5HPOA 1PIV3 3Q8CA 1FYKA 4AQ6A 3Q8AA 2NVQJ 3VBSC 4JQTA 4YNIA 4DUXA 1E2XA 5EXOA 4AIHA 3LZZA 3OGVA 4UUSA 1YQ2A 4QQOA 5ERIA 3WP4A 4Q4W1 3O6BB 2VMHA 2FQ3A 2X1EA 2FD5A 4ITCA 4F91B 2GOXB 3VZMA 5FYIA 3ZDSA 1JHJA 4QX7A 5HV0A 2MGQA 5F64A 2A75A 3FHZA 2FOWA 4MZUA 1FPN2 4EGZA 4Q29A 2WQ8A 5CA6A 2HOTA 1MPXA 2ZMEB 3ONQA 1TNRA 1Y43B 2FMYA 3KX2A 2VQUA 4WV8A 3B02A 4YFNF 4RQPA 1T8IA 3RG0A 3AG4H 2YGMA 2ZC2A 4GXOA 3VEPA 2YFZA 3VBFB 3BUCA 1O7FA 1WI9A 1MS9A 3D5OA 5KAIC 4XUPA 3NL1A 3RYKA 2DTWA 1PM4A 4ZXEA 4B3XA 4HG2A 3QH7A 1V9U2 3FDYA 5JLXA 2J1AA 4Z92B 2LP0A 4PUSA 1WD4A 3EUHA 4ISRA 2X6XA 3M3IA 2VCAA 3ECQA 1XS9A 4NMIA 2DW4A 3OUJA 2M9HA 3ZQCA 2Y0MA 4D94A 4L5JA 1D0HA 4YEJA 5I93A 4IETA 5LA9A 1WPKA 3BIWE 1UJ8A 4PLNA 5GZGA 3M3OA 2FCTA 1S5LC 1HB2A 1MNDA 2VXJA 2XPWA 1RB8G 2GIVA 1OHFA 4GIQA 3VKLA 1LFBA 2WWSA 4ASKA 3MZ8A 3EBRA 2VQTA 4U87A 2P81A 5ANQA 1UYXA 2BVVA 1PX3A 2ZTNA 5LZ6A 3A0NA 4CU9A 1QRYA 4HKLA 2HTSA 4GB31 3TO9A 2QFEA 2KHMA 3POYA 3RKWA 2Z69A 3JD71 1Y0NA 1R1UA 2D3RA 5JFRA 2EWNA 2P6SA 5FZCA 1G6NA 2XVLA 3CU7A 5ICCA 3F6VA 4TZDA 1IN8A 1TQIA 2ZMLA 3RZZA 3N05A 4XAAA 4K21A 4HSRA 3L9JT 1RMU3 1G9BA 2Y64A 5IVEA 1PGL1 4Q0PA 1ENHA 2WRAA 2PELA 1PUFB 1TVGA 4ZYHA 4LO4B 1O3QA 2WS93 2EFQA 4M71A 5H9QA 5JZGB 1GU3A 1V6NA 1MVQA 3R4DB 1Y0UA 1HRV1 5DD4A 5F1JA 4IE7A 1EJ9A 3I54A 1W9WA 1D4M2 5HBAA 1WJDA 4UVBA 5L3GA 5HLHA 3H1MA 3A7QA 2ARAA 3DEMA 5FIXA 3ZR8X 2DODA 5JZGA 2WO1A 5J4VA 1JTXA 5JXJA 2RMU1 1TTYA 1AA7A 1HC8A 2QQNA 4FVVA 1US2A 5AVAA 4XILA 5HS9A 2QSHX 1H30A 3OTFA 2XDVA 3HRTA 1Q1VA 3HJRA 2QM3A 4YZ1A 3O1OA 2V26A 3MW2A 3RNSA 5FZ0A 3WG4A 5BNOB 4KQ7A 2DPUA 4Q4V3 4IEXA 1O91A 2CSGA 1VQ6I 2V1DA 5J47A 2BP6A 4XLHA 2QSGX 4KU8A 2ECBA 4COYA 3ABUA 4ZH4F 2YUSA 3AZVA 4RGSA 1F5TA 4QB2A 2MHFA 1C0WA 4DOUA 2QUOA 4BB3A 1QHGA 2ZS6B 5A7SA 5K5RA 1DUXC 3BLYA 5B3SH 1W0NA 5D5WB 3FZVA 2HLEA 5L36A 3GFIA 4DY5A 2CWMA 4GFBA 4MUVA 2JDAA 1PP8F 2YU1A 4FTSA 2E35A 3WSOA 1C8M1 1DQ6A 1X2MA 3IAS2 3CJXA 5CVIA 4PJYA 5CVRA 3T2OA 2CWEA 3POIA 4PGGA 3KCXA 4Y13A 2VTXA 3IV5A 4L11A 2WV0A 1YCIA 4FCYA 3WGGA 4IESA 1SLCA 2RS32 4CDWB 3S2DJ 3ZXAC 2PHDA 4XW3A 3T0BA 5I0SA 1YOVB 3VHOA 3ZXSA 2PXJA 3ECOA 3CF6E 1R1A1 1K7AA 4OYUA 4UV9A 1OSGA 5JSRA 2BXZA 4GYGA 3IKWA 4FHTA 2A6WA 2EQRA 1T6BX 2NS0A 1SFUA 3I0TA 4QX0A 4I76A 2CV1A 3KLSA 1YLLA 2XVCA 1LOGA 4FPFA 3PVOA 2Y2ZA 1RUE1 2RR13 2HKXA 3ABTA 3ZYJB 1RGSA 2HH9A 3WDYA 3JRDA 1HW1A 4GWNA 5H9PA 2WA0A 2ESHA 3RS6A 1S0DA 5IK7A 5HDGA 4XQFA 1XJAA 4RGRA 5IAXA 1ENSA 2V4AA 2WFF3 3M1HA 2IGKA 4LR4A 4KNYA 2VOPA 3E3VA 2DK5A 3I71A 3KP3A 2JA5J 1PX4A 1QJX3 1Q8QA 3CZUA 2HYXA 4B44A 2OCCH 1G86A 2WNOA 3K0LA 2P7CB 1BW6A 1B8IB 4HX8A 4BKXA 3GHMA 2JWTA 1J5YA 5C5TA 2Y6GA 4E2GA 2PX9A 4LKSA 3F0CA 2BGCA 2VCBA 4XHBA 4CVUA 1ORKA 4OOIA 3VBSA 1H1AA 2WZEA 2DPDA 1IS4A 3N36A 3FIWA 5AC93 3GBFA 4WM7C 2ID6A 2ZFWA 4JTNA 1Y3TA 2V4JC 1F5JA 5FLMJ 2PHWA 1ZA7A 3AZYA 3OYBA 3ZM8A 4RAGA 2ZGQA 3PVBB 1HJFA 4QWNA 5J3LA 3DL3A 2H0BA 4QXCA 3WG1A 3W3CA 1SFNA 2HWD2 5LBFA 4WXHA 3MZYA 2F2EA 1FMVA 1VTNC 4H7LA 3FX3A 2EFOA 2RHPA 4AM3A 2FBIA 2R5YB 4NR1A 1V5FA 2H0VA 2CGPA 1QIQA 1VAKA 4TSVA 5FZOA 2XR4A 2HWC2 4DFSA 4CYDA 2EV5A 5F04A 2ME6A 5EYYA 1COV1 3DP7A 4IEYA 4YVSC 2WNVC 1W3XA 2DA1A 2IS4A 4MQ9F 4I6ZA 5FBJA 4B43A 3OBTA 2XJRA 4LFUA 1I9RA 2DT5A 1UU6A 2GH8A 4AEJA 1R1ZA 1OA2A 1RMU2 2JDYA 1FIPA 2TRTA 4O65A 3JCUC 1H2MA 3JBG1 3MIFA 3M8FA 1P4WA 4YYOA 3ACHA 5IP7J 2HU9A 4CDQB 1IN7A 4BAYA 2HWE1 2E5NA 1ENRA 4GWIA 4QU1A 4Q47A 2IPQX 3C2BA 3THPA 2F6CA 4YW7A 3U9GA 2E63A 2KIUA 1LR5A 1X33A 4XN0A 4G6TB 1SMYF 4XQWA 4YFZA 5BV6A 3POEA 3HD8B 5FWJA 2ZJQF 1WJCA 4XFIA 1ZREA 3KZIC 5FLXZ 4Q0QA 3ESWB 4HN1A 2XHKA 3O1RA 3H3VK 1EV12 1TME1 3WUDA 5EEHA 2A61A 4F7ZA 1OYYA 4KMFA 4H7MA 4TWTA 4E8DA 2DBBA 3FFZA 2XJUA 3IDCB 4JK1X 1DGWY 3L7WA 3HOZJ 3H50A 3TNPB 4A0ZA 4WXCA 3WCSA 3VWBA 4XURA 2XKOA 3CJRB 2HZTA 5M5YJ 4ASLA 1YRNA 3ASIA 1LFUP 3LEKA 5FZ8A 2JT1A 1P8JA 3TOBA 1VPHA 4XTPA 3EQEA 4IHXA 4NC8A 4Q4ZF 4LB5A 2DFEA 3HT1A 4RA2A 4LOTA 3AL0B 2GC1A 2VUCA 1P4XA 4OI4A 4LT5A 2JB4A 3VBRA 2AXLA 3TP0A 3EQLF 3BVCA 2B5HA 3RCOA 4QXHA 4IHYA 5IP6A 2Y6JA 1W90A 1BR2A 3CJQB 2JIGA 2P5VA 1QEXA 5BNOA 4D0QA 4MHUA 4GO1A 2E31A 4ZJZA 2VZVA 3U11A 4QT6A 3I3MA 2ZGOA 2ZKZA 2R042 3PLQA 4YFXF 4Q4X3 4B48A 3F8BA 2WWYA 3VFZA 1FYLA 1AXZA 1RHI2 2A69F 3OV8A 5JSPA 4K9SA 1XN7A 2HWF3 3I4NJ 1XQNA 3GNEA 2YU2A 2RR12 2RMU2 1MZFA 4GKYA 5DABA 4XN3A 2Y26A 2ZPXA 4CP1A 1WMEA 4EEFG 1XYNA 1FEXA 1O8PA 1R00A 2VTXJ 4PSXA 4OVEA 3AZZA 3T0AA 2QCSB 3QODA 3IAPA 1D0GA 4TLFA 2P4EA 4LK1F 2IVMA 3U1DA 4C2TA 3H9GA 3LSKA 2Y6KA 3MV11 1J83A 4GMP0 1USTA 2A3SA 2YS9A 3AFKA 3F22A 2O0OA 1QJY1 3QP5A 2IBDA 4WCGA 3BTJA 2KD7A 2K9NA 2I45A 4P9FA 2F5DA 1ZBA2 2FQ4A 4ZZ5A 2P0WA 3ZQQA 4XLNF 3MVPA 4B1LA 4L5EA 3VB2A 3G2BA 2IGNA 5F5AA 1I50J 3WNMA 3ZQHA 1SPPB 3AP7A 1RUNA 2GAUA 4KDPA 3WE2A 3O12A 4NHMA 1T56A 5GJ6A 2UWMA 1BMV2 3LQRA 1H9GA 2K2SA 1V6LA 4N7UA 4XMIA 1UZCA 2XLGA 1C5HA 3RI8A 2NVUB 1MS8A 4XF3A 4CE8A 1HKQA 3IRQA 3NKGA 3B7MA 4BQ4A 4Y4RA 4D1QA 4A6EA 4BH9A 3BP8A 2FOKA 4MFDA 1TW3A 3ZXEA 3GLXA 2PN6A 4JGZC 2RM21 3AYCA 2DA4A 3R0JA 1B72B 3VKOA 1YEWA 1UCXA 1CR7A 3WUCA 5H6QA 3VDBA 5E8AA 5LEKA 2QZ3A 3PFYA 1E5HA 4G9YA 2VBBA 1MS0A 5TRDA 3VYUB 2VQ0A 4DXZA 4D7SA 4PT6A 2RG4A 1YC61 1FT9A 2SBAA 2PLV2 2R063 1W2TA 3V0AB 1W5TA 5FZOB 2R5YA 4HEA2 1MMAA 1XNBA 3VN4A 5HVQC 4XLCA 2HOAA 3M3EA 3ZXJA 2DFBA 2LSOA 1IG3A 4CEYA 2RDSA 1RUC2 3HC7A 4Y1ZA 2NVTJ 5D8AA 1X1BA 1BW5A 3D8CA 1LKXA 3Q5FA 1G3SA 4MLOA 2YZ4A 5DD8A 4LQRA 5A1LA 3RI9A 4IEVA 1S0GA 2ARXA 4LG3A 4MTDA 1H0BA 2E6VA 4BQXA 4M3CE 5IAVA 1UY4A 3AMQA 1NKGA 5F8PA 1OYIA 5GZEA 5DCMB 5FMOS 1NXD1 3CJTB 4CA9A 1RUG2 4AK3A 4Y4YA 1WZ2A 1UIJA 2C4XA 2VOOA 4S2HA 1QQP2 1F9KA 3B6CA 2BVMA 1K4TA 4UUTA 1XPXA 1EF4A 4HVRA 4ENMA 5JHUA 2Q8CA 3VL9A 1Z21A 5T5PA 3C7GA 1X3ZB 2F6BA 3P5JA 4N43C 4MADA 1MEC3 4IRIA 1W8OA 2RN7A 3NAPC 2LM3A 3OS1A 4YG0A 4YIRX 3DPRB 2VOVA 4P1WA 5HI0A 1UPSA 1JZ2A 3Q8EA 2BOIA 3POFA 1BI3A 2UWCA 1X3UA 5KBFA 1IUYA 1CAXB 2B45X 3LSMA 3RZMA 5A6ZA 5GLVA 2QE3A 1R1VA 3E5UA 3WCRA 2M1BA 2QNKA 4S2DA 3W58A 1STMA 3GBWA 5IHRA 3LMMA 3BKZA 1JTZX 2EPFA 1ST8A 2LYCA 4CSWA 4IQPA 3JU9A 5CBLA 3VD9A 1AYM1 1NCQA 4WK8F 2RNJA 1VP6A 5FRMA 5L3FA 3OMYA 2WFPA 3KP4A 4MO7A 4C3HJ 2AR6A 4QPOA 2W46A 4FBFA 1Y8RB 1SFEA 1K78B 3HGGA 3QRFF 4BJ0A 1Z7LA 3KFWX 4KIBA 1ZZ9A 1PM7A 2J5OA 3S93A 3JAMK 2JPBA 2QVSB 3HVDA 3SQOA 2RS13 2OCEA 2LBFA 3LFMA 3WNPA 2ET7A 3ZYIB 2M34A 1GOGA 2RS52 4ISQA 3LOCA 1T6GC 4LBQA 2ZXHA 5GKAC 4JDMA 4BWOA 2F48A 5E20A 5FYSA 4BXUA 2BYVE 2LBFB 5IW0A 2WWUA 1W28A 5M3FJ 1CGPA 2V9VA 1MBFA 4F3QA 5JR7B 3HSEA 2IW5A 2OS2A 2IXHA 2WO3A 3GZTB 4CUGA 1DGLA 2FMDA 2TUNA 2P6CA 5A33B 5IVJA 4FFIA 3IWZA 1WCDJ 1LOEA 1GANA 3I49A 5E1ZB 5FZHA 4HV6A 3EUHC 1EV11 1TME2 4U36A 3CD6I 4F55A 4YPJA 1S7AA 2XAUA 3BT9A 3H92A 5F6KA 5C4JJ 2CGOA 2GXBA 1W8WA 3P7NA 5IYBJ 3VKMA 1I3AA 3KCYA 3DKXA 3PU8A 2X1CA 3H3UA 3LDBA 3BC8A 4XXPA 1HXDA 1F4KA 3JTGA 1KQ8A 3TB0A 3GZ6A 3OR1C 2P3YA 3JRHA 1U9OA 3FXLA 4NROA 5CG9A 4EJOA 3I8TA 3B5LB 4Q0UA 4CCMA 2X09A 5FZKA 4XBFA 4FO9A 3TO7A 1FOKA 3FMRA 5LHGA 2KLOA 4AL9A 4RLQA 1YUDA 3AK0A 3BB6A 2ILMA 4I98B 5EZWA 3OYDA 2DA3A 3LSDA 4A3XA 4N8MA 2DV9A 3I2KA 2OQ6A 1IJWC 2LF7A 1BIAA 3HZJA 3CCYA 3IB3A 3ZYRA 2CQQA 2BV4A 3H35A 1H89C 5DZEA 4AAPA 2ATFA 3CIHA 5J48A 4XJ9A 4ANJA 1FYUA 2TDXA 3VODA 2O6GE 1MZEA 1POV1 2WNUC 2OVUA 2V73A 2W91A 4U88A 1IKPA 4OHXA 5GM0A 2XVGA 1D8JA 1I6HJ 4PGHA 3N4MA 4CYCB 4Q26A 1ND2A 1O5UA 1JOJA 2J1UA 1UMIA 4L99A 4YSFA 5C3RA 5DMYA 1MS1A 5BNNB 5HLIA 5JCTA 2VKVA 4GALA 4QB6A 5FYZA 3FM3A 4RB0A 1CQ9A 1FSEA 4EYUA 1UKRA 3LOBA 4YVWB 2WT0A 1MIJA 2XWBB 2VONA 1RITA 4O9GA 1E5RA 3ZIWA 1FSHA 3BG5A 1W6QA 2WYSA 3MIDA 2WAQN 5BQTA 1TQPA 1CX4A 1KQRA 1W9YA 3WDWA 1TMF3 3T4HB 3MMYB 3K4AA 3MLKA 3U1XA 4FPJA 5BNNA 3WTYC 4U0WA 2WIIB 2XRLA 4AGRA 2E60A 4XKWA 1DGRM 3BZ6A 1RUD1 3RZHA 2VASA 2OQGA 5G04L 1L3JA 2B7EA 2ZZJA 4QGMA 5LHHA 5E79C 2AREA 1GXQA 3NJVA 2Y33A 1D1BA 1U78A 1ZX5A 3TYJA 2FCUA 4FOWA 1Y56A 2W3JA 5IFTA 5F39A 4LPLA 2XH6A 4M3FA 2UWAA 2Y6HA 2HXOA 4Q1PA 4QU2A 1XNDA 4Q4V2 1WWYA 1W9SA 5I0RA 3Q3SA 2GNDA 3TMOA 1WMDA 4AI1A 5CFDC 3HEFA 2R7VA 4ATEA 2DBIA 4LBKA 5EGOA 3HPNA 3W2WA 1BR1A 2JECA 1SPPA 1O4ZA 1CIYA 1QA6A 4XFHA 4QAWA 2V5YA 1CIWA 3NNGA 4UAPA 2BHYA 1RUF3 2RDQA 1RC6A 5EGOB 3SZTA 1MR5A 3TRSB 2EXIA 2MH9A 3MD2A 4YELA 3OCPA 3V7RA 3RWKX 3ZXKA 2XBO1 4IEPA 5T52A 1S9HA 2DMTA 3FK6A 4QX2A 2YX4A 4B3NA 4NQWA 4FP2A 3N35A 2E2JJ 4WXDA 3U75A 1AR62 1HRI3 3MICA 4M00A 3WEZA 1E5SA 1R1A2 3CQZJ 2HPMA 4M0NA 2V72A 2LKPA 4IHSA 3OY8A 3GZEA 4DUVA 4XDOA 3OYAA 1AYM3 1X9PA 4LITA 3JRBA 2VULA 1KGSA 4FPHA 4XJAA 3B01A 2KIMA 1DIWA 2JD4A 5F5CA 1LECA 4IVNA 3DPTA 4BJ6C 4J00A 2MEV3 5HOOA 1WJBA 4QDQA 2W4SA 5L9BA 1UHWA 3CCSI 1FNYA 2JJ6A 2PLYA 3ORJA 1COV3 1SEFA 1XRUA 3BCBA 2XVKA 3O5SA 4IO9F 4E7SA 1U5IA 2W9XA 1AL0G 2BOJA 2CQXA 1TNTA 2XPJA 2WNUB 1GLHA 3ZYHA 1H8TC 1N1SA 3K2OA 2PHRA 4MHRA 5FCCA 1R6RA 3PFIA 2ZMEC 4EZHA 1JYVA 2V6EA 3CCQI 3ZSJA 3NKTA 3ACFA 4A2UA 4UVAA 5BNNC 5LD2C 2XB6C 1FV3A 1PIV1 3H9QA 5JZGC 1NH3A 3KT1A 4WM7A 5ICEA 2ZEXA 1RUJ1 1AL22 3K70C 2BY1A 2LDUA 2P8TA 3J7YJ 1KFXL 3F8CA 5I8TA 4AF9A 4WVWA 4Q4W2 1G2HA 3HRUA 1O8SA 1Z6TA 4X8NA 2OT7A 1J58A 2D5VA 2QQUA 4CDUA 3H5AA 5T54A 4HXCA 3OS2A 1SZBA 3CESA 3V0BB 1PVXA 3DU5A 5CYYA 3KYDB 2I5UA 1PVC2 4NIAA 3MW4A 2BW3B 3OIQA 5T55A 3Q8FA 1K83J 4GZ9A 4J01A 1EAH1 4IW3A 2IVJA 5A7WB 4D7TA 4ZPIA 2Q5TA 3MQ0A 2KR2A 3GFLA 4RGUA 2ZX0A 4XLPF 2I74A 4K3UA 1EH6A 3HR9A 3FMSA 2R1DA 4ASNA 2NQYA 4XJWA 2HWD3 2JVHA 1WBLA 1YYNA 5F5IA 2V9KA 2F17A 3K48A 1W8FA 3MPPG 3ASNH 1AJKA 1LHWA 4ENJA 1W7PD 4D9JA 2NVXJ 3TGNA 4KT6A 3NW4A 2CG4A 1BEV2 1H9PA 3KS7A 2E36A 1Y9GA 4IL7A 3U2RA 3IKTA 1UY1A 1WCMJ 3O8HA 4AQ2A 1RUH3 1D0ZA 2A05A 4BGDA 4I09A 4HX7A 4DJAA 4XYXA 2EIBA 4XZUG 2YPRA 4AW7A 1POV3 4ZC3A 3LA3A 2P7VB 1C1LA 3BU0A 4EWAA 1SDDB 5J1RA 3G6EI 3VL8A 1NA1B 2DOFA 1YJLA 1AJOA 1ZVFA 4BOWA 2W1SA 3V7SA 1TNSA 5JHFA 5HNFA 1WW5A 3IMNA 4C90A 3ZFFA 2K4JA 2PMUA 4YW4A 4S0HB 4MSVA 1O3SA 2ID4A 4NHYA 5CNAA 1VFCA 1I1GA 3GTMJ 3POWA 1K42A 5IATA 3O0WA 2Z5UA 5JMCA 1YX5A 1QU3A 2H8WA 4BMEA 2XJTA 4OAYA 4BQOA 2D43A 1WW6A 4NN0A 3R4KA 4DUWA 3O1SA 4Q5SF 2VT2A 3PO3J 1C8M2 5AC92 1JH5A 2OXBA 1NE6A 3D6EA 4AIKA 2GU9A 1CWPA 1XGOA 1IXRC 1FZPB 1NE4A 4QX5A 3ILNA 2VMEA 2UUZA 4JOMA 4P5YA 4AC0A 3TQNA 4U2AA 1GVJA 4YW1A 4FT8A 4JKLA 3HOWJ 2QQMA 3VDDB 3K3OA 1WCUA 2GNTA 1DZTA 2PYTA 1QZEA 1ZR4A 3RSNA 1K3IA 3HKZA 3M4FA 1JGGA 2FUG2 5F6FA 3PVEA 1RIRA 2BNOA 5JXHA 2BU9A 1TLHB 4GJZA 3HTUA 4L9NA 4JYKA 3WTXC 4GH4A 1RUF1 3JB4C 3ZR6A 1G3TA 4Q27A 3FWEA 3M8LA 4Y20B 4URAA 4C3IJ 5GLWA 2R5ZA 2EK5A 4AGGA 2OU2A 3OSFA 1BI0A 4HA8A 4HN0A 4FPKA 1WW7A 2PI0A 4HSTA 4AIJA 4UT5A 1QZZA 4CDWA 3I5UA 3PMSA 4N7IA 1HOMA 4D0PA 1R5ID 2D1VA 5KC6A 3QYBA 2R7UA 5FPZA 2XV4S 5DPNA 5DDGA 1JYCA 3A0BC 3PTYA 3ELKA 1H9TA 4AWDA 2D6MA 1J59A 1EV7A 4E4SA 1AR72 1O4XA 1ZG5A 4K8FA 4IJAA 2R6QA 4AAXA 3KT7A 4NRPA 1CAUA 1UB9A 3HPHA 1UOJA 2YPJA 1NCRB 5FZ4A 5FZBA 5LB6A 1YFXA 3Q0UA 3HWJA 1X4PA 3JW4A 1PK6A 2YC2A 1SVMA 1HXS3 4XDPA 2DVDA 4YIFA 3M8EA 3PUAA 1RUE3 4BYYA 2VGDA 4LK6A 5LEJA 2F4LA 1VQ7I 3WINE 4ZS2A 4CTEA 4P9JA 3DKYA 2PBIA 1HQCA 4RB3C 5DUVA 3SH4A 3HRMA 3GZ5A 2IXCA 4ZTFA 2WAFA 1SEUA 1NQDA 4NWVA 1U8RA 4UW6A 5FZ9A 3ZPYA 3BG7A 1IN5A 3I59B 1JKRC 3PMEA 2XF5A 1GNZA 2ELKA 1K61A 3ZPLA 2OIIA 1FOD3 5A3LA 3K4MA 4BE2A 5CB7A 5FP8A 2VBWA 2L4AA 4DXSA 4NRQA 4RQPB 5C33A 3VKNA 1IHMA 1G9DA 3SITA 5KHDA 4KBZA 1OYWA 2VXZA 4B7EA 1RTVA 3GZNB 1HSTA 2TCTA 2XUMA 1SHWB 2YFUA 2VKHA 1TWFJ 2V09A 3ZXFA 4YZ5A 1W04A 1MZBA 3LL7A 2HWB2 3P9CA 3GW2A 2Z42A 5B2GB 1UZYA 3K3NA 1VQMI 3GTKJ 1YFHA 1LFPA 1VMHA 4Q4Y3 4UFLA 2X53S 5C5UA 5FKLA 3CBNA 4YVSB 2DU9A 2E9QA 2BNNA 1X2NA 4A42A 1EAH3 1W2UA 1KJLA 3WHTA 3NO8A 2DFIA 1KONA 1R081 5KHHA 3GGLA 5KXBA 5FYUA 4DZJA 1XU2A 3WDVA 1O5LA 3HOSA 5E18F 3KQ4B 5B1AH 3I2OA 3GCWA 1HRV2 2AHQA 3N9OA 3C7FA 1V6MA 1N47A 3DBRB 4B3AA 5FQ0A 2Y48A 2D98A 2WADA 4H3WA 2GH2A 4XQDA 2A6ZA 2K40A 3TDZC 4BCUA 4RGXA 4Y22B 3KSCA 4G7OF 2NYXA 1C4RA 4N4OB 3Q9OA 1V0AA 4XTMA 1GUUA 1ON2A 2I2SA 2JG8C 4UWDA 3O0VA 4MGYE 3BJ6A 3OYNA 1JHNA 4QXKA 3VHRA 1E5IA 2OD5A 2JWPA 2ZX1A 4BJTA 2D40A 2HOSA 2RDPA 4C91A 2DU0A 1S0FA 1RXFA 3JTHA 2OZUA 1GQHA 1YQAA 4MGIE 4Q8LA 3AL5A 5JXGA 1AYN1 4FFGA 4G7HF 2D45A 4XK4A 3VBHC 3JBG3 1A34A 2H6BA 4NHKA 4LLGF 1ASJ2 1FAYA 1WZXA 1LHNA 1N3OA 5K7FA 4LLLA 1JYXA 3DBLB 1W2AX 2HQRA 2DBNA 3TL4X 1USSA 1YNAA 4XF1A 1PP7U 4XRMA 3V65A 3FFQA 4WZFA 3AMPA 2R93J 3DF8A 3OOPA 1R091 2VC1A 3OYKA 3PU3A 1ND3A 2V7FA 5CISA 1IS6A 3RPUD 4N53C 1GV5A 1R64A 2ZGLA 2QZ8A 2CWSA 2WO7A 5JLWA 2B42B 2W48A 4G8XA 4PI2A 5K8SA 3W9AA 2V1NA 5I8YA 1CAXA 3S3MA 3C7JA 2AXTC 4AEDA 3SCFA 3RZOJ 5HODA 1IPJA 3LFUA 4B47A 1FJLA 2WN2A 3CCMI 5FMDA 1TZOA 2KJCA 1OD3A 4LHKA 1IXCA 3PUHA 2D93A 2CUFA 2ZJ2A 1PUEE 1CD3G 2ZGMA 1F1ZA 1YFYA 2HWC1 3IH4A 4UB6C 2Y0IA 3I4IA 3HNBM 3RZKA 1JI8A 4IEWA 3N9MA 4XPVA 2GN7A 4BXFA 4BQ3A 4IEUA 1BM9A 4QHZA 1XNTA 4EN9B 2LNBA 2ADDA 2EXHA 5C70A 5EIYB 5LW9A 3SEQA 3J7AY 4Y24A 1U5YA 3WF4A 1QOSA 3AMHA 5GP9A 4X6AJ 3RZJA 2MG4A 3LCPA 5FGMA 1W8NA 5FJHA 1QF3A 1NCQC 3JD73 4MIMA 3M4OJ 4DW6A 3DCFA 2AGSA 3OPTA 4PSWA 1X58A 2WB1N 3B00A 1ZARA 5C3PA 2L2OA 3JRIA 4AQSA 4RR3C 1AR73 1ZBA1 3DGTA 3ST7A 1BI2A 1WW4A 5H9SA 2PN5A 1N25A 3ABMH 1QQP3 5D4RA 4CEYC 2YX7A 3L1PA 5ACA1 5KCMA 2ES3A 2GMEA 3HOBA 4BACA 3BG3A 1UPIA 2VJXA 1HKDA 1F8VA 3FHAA 3ZSLA 1M1EB 1TWCJ 4GMP1 4CUAA 1XC6A 4LNVA 3I53A 5F2SA 4ITVA 4AFBA 5A3UA 1CAVB 5C3QA 4KITB 5EQUA 4MGRA 5HDNA 4Z8BA 1F9NA 4OCTA 4UW3A 2BOLA 1Y9QA 4B1RA 3S7IA 2ORZA 1OLMA 1H6YA 5ISLA 5CFCA 5GPCA 2E1NA 1WFXA 4R4XA 1UZ0A 4NC6A 5F0HA 1HN1A 3LSTA 3VBHB 1QOOA 1NK2P 3VDDA 1FBUA 4BJ5C 5L3BA 4V19K 4V2GA 1FP1D 5FKNA 1GZCA 4E4ZA 1M4WA 1OFNA 2H94A 2CSOA 5E88A 2QWWA 5TISC 5DZFA 2P3KA 4XCBA 1SBFA 3ON7A 5E17F 3V42A 2VZOA 5JOWA 1OVPA 2C0ZA 4WM8A 2NPIA 3DEUA 3M8JA 5GZDA 3S30A 4A45A 1ETVA 5A32A 4ENNA 2DMNA 4EM1A 3B6AA 1Y39A 2QQOA 4DXTA 2VAUA 4XBNA 1O3RA 3U4XA 1WJEA 3W6VA 2B9UA 4I0BA 5JLVA 3H3ZA 2HEWF 1LOCA 4AFMA 4QSHA 2VN2A 4PJLA 5ABJB 2JG8A 3LWFA 4CGZA 3TEXA 5EWSA 4KIGA 4QQPA 2VUJA 2EIKH 1PGL2 2DCTA 3H8UA 4O3MA 3N9QA 5FZEA 1YLFA 1BEV1 3AG1H 1VAVA 5FP7A 2K9MA 2OYZA 2PHXA 3KLNA 1MSEC 1ON1A 2WNUA 2VVFA 4FP3A 2R073 5T5OA 2K9LA 3JQWA 3K9TA 1VB2A 5BNPB 1K5MA 4QXBA 4KGQA 1NG6A 3GM8A 5D5XB 4MO3M 1OUSA 3J8F3 1DU0A 3D0SA 1HDDC 1IG0A 2Y0OA 1ETWA 1X1PA 4M6VA 4R79A 1AOYA 3ZXLA 2WINB 1VBB3 1QGPA 2D6NA 3S0MA 2X6OA 2WTEA 3MKWB 1TG7A 3DTKA 4UW4A 4XJZA 5EF6A 4XOPA 3WQ0A 3WNOA 4LHNA 2YXSA 1KS5A 3VD5A 2KMUA 5FJ8J 4A3KJ 1JGSA 3BALA 2UXNA 2R3SA 2G7UA 2HXIA 2RAEA 3E6DA 2M7BA 2Z79A 4MQVA 2EIJH 3HOUJ 1XOYA 4RR3B 2WFF1 1V9U1 4X6QB 5AVPA 2P1BA 1CF7A 1S29A 5A3MA 5CKNA 2XAQA 1YJKA 4YW5A 4C2UA 1HSJA 2VW1A 3WG9A 1MNEA 3BN6A 3CCRI 4ENKA 2VVEA 4O6JA 4NPMA 3HNYM 2XUEA 2YU3A 3K46A 1J3QA 1LENA 4YARA 3ZMSA 2WZ8A 4CCJA 4EMSA 2NM1A 2LKXA 2AYHA 4BQWA 5HCHA 5AFEA 1RRJA 3KZZA 2XGCA 4LLNA 3NMBA 5HDKA 4ARYA 3AVRA 1ACIA 2M87A 2OUJA 1URXA 2YYOA 4GRIA 1V70A 1F2NA 2VCCA 4H55A 1A04A 1MBKA 1AR61 3KLOA 2WDBA 1KITA 4E7LA 4P55A 1YHQI 5GAEJ 4LXLA 5IT3A 2ZGUA 5CVJA 1B35B 4OZXA 4QM9A 1WH7A 5JXIA 2XL7A 1HA8A 2VZUA 3TKYA 5BNOC 1WLTA 3AKRA 4TLGA 4XABA 4HVOA 1LCLA 3L2CA 4IZZA 1TT0A 4DEVA 1PYVA 4YG6A 4BNCA 3B94A 2OKXA 3ZQIA 2GALA 2BDRA 1XPWA 4MXVA 1AYM2 5FO8B 1NQJA 3GTOJ 1GZWB 4CP2A 1NHAA 1FOXA 4BEHB 4K1ZA 2MEV2 2CQKA 1EPWA 3OGSA 2P5KA 1S0BA 3K4CA 1F35A 4FPLA 5D1IA 3QBQA 4NO4A 5F0FA 4NDLA 3THCA 2VMCA 2J1VA 2XLAA 2EFWA 2FCVA 2OUHA 1ZGJA 3WTWC 3BTXA 1CAWA 3G4SI 4FI9A 3H9AA 1Q8OA 4O9EA 4IOAF 4D7MA 3RKQA 3LIGA 5LCWL 3L2UA 1I1EA 1HIXA 4X8PA 3MEXA 2Y34A 1BLZA 5LASA 4RS5C 2R7TA 5H2FC 1NZCA 3C2UA 4IQJA 3N7LA 1W1WE 2R041 3TN93 3WW2A 3BI3A 1AR83 1ZZBA 4W50A 2H6CA 1LE8B 4A7KA 4LIVA 3WDTA 2RJLA 5IY5H 5ACA3 4YRVA 1I1SA 2DA5A 4CCKA 4AEDB 5KK1A 4D69A 3ZN6B 4KMQA 3OBRA 5DAPA 5FOBB 5AIQA 2AQEA 2ZMEA 1ND3C 1Z0HA 3QYEA 2OW4A 2ARBA 2DTYA 3CQOA 2ZBKA 4M74A 3AZXA 4Y1YA 2KDOA 5FY7A 4HYEA 3UKNA 4M3DA 5IOZA 2XROA 2ZAAA 4ATFA 3RSJA 1X4OA 1YW7A 3AXEA 3HYIA 1QNYA 4QQHA 2VJJA 1L3LA 5C44J 3EO6A 5B5EC 5IYDJ 5DQ0A 1JOBA 2Q2EA 4YGEA 3ELNA 3ZMZA 4M9ZA 2P37A 2EIDA 2XPVA 3AYAA 2QDNA 4Y5SA 1GDTA 4IEQA 5D6FA 1YI7A 5FXXA 3V4GA 4ARXA 3ETQA 2MA3A 1E57A 3CP2A 1LESA 1I3HA 2MLGA 3DN7A 2M8EA 3K4JA 3W2VA 1RHI1 3HPGA 5J4YA 1UW8A 4OHVA 5DS9A 1IKQA 1AVBA 1CZVA 5CVVA 2ENRA 2ZACA 4WVZA 1UWWA 3UKTA 2CS3A 4UV8A 2BVLA 3KP2A 5FZIA 2PMHA 1WJ5A 4UI9L 3BR2A 3JCIA 5HXMA 4YFKF 1AX1A 4NWWA 1BYHA 1B8IA 3VYRB 3A01A 4IGPA 1W7PB 2VC0A 4A3LJ 2H27A 1G8XA 5CKQA 3GO5A 2HFHA 1QQIA 4NE9A 1HV0A 4DQ2A 1ZLJA 1S2BA 3AXDA 3KVAA 3GXUA 4JGYB 2JDUA 5CU1A 2FEZA 3WXPA 1IC8A 4IV1C 3QAHA 3NV4A 5BNGA 1I3QJ 1Q8PA 2GBYA 1VBC3 4Z1VA 1AHDP 4BIFA 4ZDOA 2XJQA 3S1RJ 3NNJA 2XOMA 1MACA 4BS9A 3JSPA 4B4PA 1JHHA 1RJ8A 2JB8A 1D8KA 4Q4W3 1VQ9I 1H8TA 4V1PA 1BOAA 1KD7A 2PQ8A 2DK8A 4IE5A 1UZVA 5LGUA 1W8HA 1W0UA 2JEMA 4CCDA 1OLQA 3PSFA 1W6NB 3M70A 2E53A 3R60A 4FISA 1LEAA 1VBB1 2OAZA 2A3YA 3CCVI 3CCLI 1A31A 3MWMA 1TMF1 2R7XA 1SFPA 4V2WA 1T38A 3M07A 4UBGA 3A23A 1EUUA 4QPIC 1MMDA 2VZ1A 3T4VA 3H1CA 2VTFA 5K7HA 3OD0A 1MBJA 3CZ6A 4P02B 3U1KA 2ZNZA 1AR91 3SCHA 1AL21 1LAJA 2RQQA 1Z6RA 2ADEA 3E1SA 1CX1A 3UGHA 1BVVA 3R05A 2XXZA 2Z4FA 5A2QZ 4IL6C 2BBAA 3PIJA 1OLTA 4DRVA 3W5MA 3ALQA 3D82A 4CPBD 1MEC2 4A3DJ 4ES9A 4YGCA 4AYBA 3VBOA 2HI3A 2ESNA 1RUH2 1QH6A 3CUQA 3L2WA 4ZS3A 3WF1A 4R9BA 3QQAA 5FP3A 1WA4A 2ISZA 2VBZA 4GB33 2FZ1A 1YTYA 2MNGA 5K4LA 4DOZA 3QOEA 4M3BA 1U5TB 1FY7A 4IEOA 3DPUA 2J1EA 2MFZA 1QKQA 4P9XA 1TQ5A 2V5DA 3DXJF 4XLFA 4P00B 1ZA4A 3BJOA 1C1FA 2QSFX 2ARCA 5L9VA 4M6YA 4XICA 4HZFA 1H0MA 2OZJA 1XU1A 3WP5A 1RR8C 1N77A 1Z05A 4W1UA 5DG2A 2Z2SB 4G94A 4AI2A 2CAUA 3RQ4A 1OCZH 3ISPA 4A69C 2WKKA 4OMZA 1LRHA 4CZZA 2OV7A 4CEYB 4KU7A 1LEMA 1N1TA 2AZ5A 2JPCA 2YBSA 2W82A 4Y15A 3AJYA 2XB0X 3LKJA 5LY2A 3WOGA 3KB5A 2GIZA 1D5YA 4ZYDA 2V1UA 1ONAA 2ZFUA 1Z67A 5FPUA 4UFMA 1ULOA 1VQKI 1WUVA 3FISA 1GNHA 4LEJA 3HB9A 5DCFA 4BK4A 2L54A 2RS53 5G05L 3DXUA 3W21A 2HJIA 4WVVA 3PDQA 4A3EJ 4W6WA 2DVGA 3RKYA 2QEXI 2WFF2 3CMAI 1FWZA 3TW7A 1V54H 1AR82 3TOJA 1LU2A 2X05A 4HBLA 1SC7A 4A12A 3WDXA 3MKLA 1ZKGA 3K77A 1BVP1 1GR3A 1NK3P 1NTCA 2L3DA 3BZCA 2VODA 1TEIA 1TWHJ 2ZMNA 3DYPA 5CJ9A 3DTEA 1GV2A 2F5CA 2IA1A 1QJU1 3J81Z 5C8CB 4CCNA 1MDMB 5ILVA 2YBKA 4HDUA 1YI2I 3KV6A 3PTRB 1QJEA 3ASOH 1R9TJ 4NPRA 4H0EA 1PVC1 1PO11 3W2AA 5FD5A 2Z1DA 5FP9A 3KHCA 1UMHA 2RREA 4TV7A 3GTJJ 1BBYA 4BE3A 4QQLA 2QBYA 4LD5A 4LKFA 3N9PA 3F23A 4KWKA 1MEC1 3BROA 1I39A 5EFUA 3O8GA 2ICWG 4HT1T 2AEZA 4E7ZA 5K7ZA 3CJIA 2DDUA 3S32A 4XOTA 1DHKB 1V4RA 1XGNA 3H0DA 2W94A 2VR4A 2VZSA 3ZYBA 5F3EA 3O1TA 1SFOJ 3NSTA 3OGJA 2W2IA 4FPGA 1R49A 4HL0A 5C9AA 2WZR2 3RZGA 2BBVA 3KV4A 5J7MA 2QQ8A 5K0UB 4XM3A 3PL0A 2HWE2 1SBEA 1K6YA 3ZFFB 2M3AA 5KXEA 3MAJA 3A22A 4AVSA 3WV6A 1S3JA 3FUQA 2K46A 2CW0F 2VKEA 3T2TA 2RJKA 4MH0E 3GFJA 2R7FA 4P9YA 3FLTA 5BNPC 2RV8A 3L09A 3ZFEC 2JZYA 4CDXA 3ZFEB 3RGBA 1LQ1A 3NV3A 4ZY9A 4Y52J 2WAQA 4DXRA 3KWVA 1YXWA 4WVMA 1RESA 2E1MB 3HEIA 2QQKA 2HDWA 2RDNA 4L18B 2W0XA 4QDRA 3ZN6A 2RS11 4BM8A 5F0CA 5FKOA 5FO5A 2BZDA 3DEWA 1WGPA 1UN1A 3EETA 1QU0A 4FQZA 1OPCA 2P4WA 5T5LA 2HVQA 4PZJA 4FCAA 3UV9A 1VZ0A 4L8QA 3KIOA 2O9LA 3WGIA 2CQNA 2JDZA 5FKCA 4Z07A 2Q8OA 4X6RB 2BPA2 4XBLA 1Y7BA 2NLRA 2M4KA 5JSOA 2UYBA 3L2HA 4ESFA 3NWTA 4NUBA 4CEWC 4MXWB 2QQBA 3HOVJ 1U12A 2RKHA 4WVMB 3PUBA 5IUQA 4GMP3 1QJU2 4W6YA 1V00A 1EV13 3VBOC 2WL1A 1EAH2 4RS8A 3E6CC 4M9SA 3WR0A 3BPXA 2G9ZA