3E5UA

Ocpa complexed cprk (c200s)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
219
structure length
215
Chain Sequence
b'DFCGAIIPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGGNSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNTYNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKIIVYNLGELKHLSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclic nucleotide-binding protein
publication title Molecular basis of halorespiration control by CprK, a CRP-FNR type transcriptional regulator
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Transcription regulation
total genus 68
structure length 215
sequence length 219
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e5uA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3e5uA01
3E5UA 2CWEA 3LAPA 3CJXA 2AXLA 4LK1F 1Y3TA 3J81K 1RC6A 3CLOA 2GU9A 4KDPA 2X4HA 1Z7UA 3Q9SA 1YFHA 4G94A 1U12A 1TLHB 2R3SA 3CUQB 5I0TA 2NRAC 4AQ6A 5BMZA 1YFYA 4XF4A 1H0MA 2WWYA 2EV0A 4I09A 3RYRA 3G7DA 5TJJA 4BNCA 3EDPA 1I5ZA 2L4AA 4YSFA 2CAUA 2EFPA 2AS5F 4I0AA 3BCWA 3DP7A 2H94A 4NB5A 1R5GA 1XB4A 1ZHFA 3KLOA 3VB2A 5K5QA 2K9ZA 4UVBA 3PQJA 3CDHA 3I0TA 2MLKA 4ESJA 4XFHA 1CAVB 1E17A 5D6EA 1LDDA 1DZTA 5HDKA 2DQLA 4CHUA 4AD9A 4Z82A 1KU2A 1R22A 4IRIA 2DU9A 3CUQC 1B4AA 2RQPA 3K1NA 3JAMK 4RB1A 4XFBA 2F5FA 3BDDA 3E6DA 1OD5A 4RB2C 1VR3A 2EFNA 1H9TA 5CVVA 4L9TA 1WRJA 3T8TA 3CO2A 3MQ0A 3K2ZA 3TOAA 3ES1A 1P2FA 5E1WA 3ECHA 4IEOA 2VOPA 4DQ2A 2PG4A 1FWZA 2Q30A 2A5YB 4LB6B 4ON0A 3SCGA 1UPIA 1NHAA 1W7PB 2JPCA 4J1XA 5CVUA 4RAYA 1YWKA 4GXOA 2ZMEB 2O0YA 4WWCA 4HMZA 3NVCA 4I2OA 1RUOA 2CQKA 4UBGA 1FC3A 1H1MA 4AVCA 3U10A 2C0ZA 3C18A 2P6TA 3U2RA 2BGCA 3KGLA 5EFUA 1V3FA 3F8FA 2STWA 3FMQA 2OQGA 2UY8A 4A0ZA 4EGZA 1CF7A 1ZZCA 3KP2A 2W24A 3H9AA 1IXCA 2UWMA 1HXDA 1ZRFA 2BV6A 1KU7A 2EA4A 2GAUA 3OOPA 1FPQA 5DUIA 3ZMSA 1HKTA 4E2GA 2LSOA 5DD4A 1LNWA 2VODA 3LSTA 3C3WA 2VC1A 1V4RA 4WXDA 5ERIA 1ZG1A 3VEPA 1FBSA 1B59A 3WTTC 1EH6A 4CGZA 5HS7A 3KSCA 1OPCA 3KCCA 3JW4A 4UNOA 3F8BA 4ENJA 1Z05A 5FCCA 2WFPA 3WTUC 1ZG5A 3LA7A 4QX5A 5I93A 3BJ6A 2DK8A 1ZN2A 2V09A 2DPDA 4O6JA 4YIIA 4LMYA 1USSA 1JGSA 5BOXA 2NNYA 3GFJA 2PHDA 3NQOA 1REPC 2ESNA 5FFZA 2G7UA 2PMHA 1UB9A 3QPTA 1FNNA 4YNIA 5FQ0B 3E6CC 4LGWA 4EJTA 3V8LA 5I91A 1MD0A 1DDNA 4ENKA 1SD4A 2KRFA 4U0YA 2K86A 1FSHA 5F64A 2JSCA 2D93A 2F5CA 2BE5F 1RL3A 1WGPA 4Y15A 1DPRA 2HZTA 1J3QA 2HQRA 2HGCA 5A2QZ 4A0XA 2RC4A 4Q0PA 2PAEA 3FHIB 4GGGA 3O2PE 1YIOA 4LTAA 5ICCA 3RIRA 1Y9QA 3FJSA 1TQIA 1Y0UA 3RTRA 3WTVC 4FX4A 1KA8A 2FRHA 1S6LA 1PDNC 3LOIA 3OD0A 3GFIA 4Q29A 1CGPA 4LG0B 2HKXA 4QWQA 4DINB 2GA2A 4LFUA 3L2CA 2M1BA 1GQGA 1FYKA 2IPQX 2YPRA 2V1UA 3G3ZA 2Q0OA 4KT5C 4LK0F 4M71A 2EJRA 1B6AA 2JPBA 1O5UA 4WCGA 4FHTA 1O3QA 1IN5A 3ZN1A 4YRDA 5ICFA 3EYYA 3NRVA 5E1RA 4M72A 4KFCA 4G8XA 2WC2A 4IEZA 1J2XA 1U6GA 2VPVA 1ZZBA 3ZPLA 5LHHA 1Q3EA 5BXXA 2OZJA 2V9VA 5K5RA 4QMAA 5E8IA 5EEGA 4PDKA 1YFUA 4HVOA 3W6JB 2PFWA 3HIFA 1O3SA 5BPIA 2L54A 2E7XA 3NKTA 4MHGA 3FXUA 4ZYDA 4O5VA 2HDCA 4AVAA 4RD7A 4HX7A 3R0JA 2E1CA 1OKRA 1ODDA 3PFIA 2GXBA 3CEWA 4QGLA 4XEZA 4LUKA 1W7PD 4L9VA 5J3UA 4KNYA 2N7GA 4OIRF 5LEKA 4G6QA 2PLYA 1SFNA 3F6VA 5C8WA 1WWXA 1USTA 3F8NA 3SMHA 1IN4A 1RI7A 3BJAA 5DCFA 3KP7A 3SXYA 1ZGAA 5HDGA 1OMIA 4UV9A 5F6FA 2LKPA 2IXCA 5D1IA 1YS7A 2UXXA 4AQ2A 3OCPA 3U9GA 3V7CA 3SZPA 4AXOA 2E7WA 1X82A 2QQBA 2VQAA 5CU1A 1J75A 2GC0A 3GF2A 3M7GA 3IRQA 1BI1A 1T2KA 1FBQA 1TNSA 5I8SA 3MDPA 1ZNPA 2VT2A 3QOPA 4HA8A 3HHGA 2KIUA 2QLZA 3QP5A 1DZRA 3W6KB 4EVIA 1UCRA 2HYGD 2XV4S 4YFXF 3MPBA 2ELHA 5CJ9A 2MBFA 2DBBA 4CO8A 4QXKA 3LQQA 1P4WA 2D1HA 2XKPA 1LVAA 1RIOH 3MCZA 4XFIA 3WODF 3WU0A 5HLHA 1ON2A 3FM3A 1FY7A 2IC1A 4YG2F 5FO5A 1SQ4A 4FAHA 3F3XA 2UYBA 4WVZA 4G9YA 2ZXJA 1EH8A 2DFIA 4G7HF 1OYYA 2ZJ2A 4OU0A 2XKOA 3IWZA 3I4PA 3P9IA 4XBFA 2CGPA 5E17F 4ORFA 4IRHA 2IW5A 2V1DA 3BP8A 2FNPA 1DUXC 3KP4A 3H7JA 1MDMA 4HZFA 1YW9A 4BYYA 2Y75A 1T39A 4KWLA 4WX9A 3TO9A 1LEBA 2FU4A 4QGMA 1IUYA 3NW4A 3VODA 1IN8A 4AWXB 4LA3A 4QM9A 4H7LA 3O14A 4RB0A 3FZVA 3TO6A 1CX4A 2BBYA 4JBAA 4ZZLA 2LF8A 2ETEA 4JK1X 2P7VB 2Z69A 5F1RA 2GXGA 1UIJA 1RUNA 2BNOA 4RS8A 5FD6A 2O3FA 2LF7A 2KJCA 4HV6A 4M9ZA 1O3TA 1CAXB 3K1PA 4I01A 2FBIA 1ZVFA 1F1ZA 3EQEA 3KZYA 1IW7F 4L5JA 2W25A 2A6EF 3I53A 4BAYA 1BI0A 4HN1A 3FWEA 5K1YA 1ZREA 3LFKA 3H3UA 5FD5A 5JAXA 5AVPA 1WQ2A 3M8EA 3DEUA 2XLGA 5H6RA 5FPXA 2OA4A 2GA1A 3QACA 3Q5FA 1J5YA 3FX3A 2DT5A 3ECOA 3WGGA 1TW3A 2NAZA 3S7EA 4P5OA 5JR3A 2Z33A 3CTAA 4O3MA 2W85A 2XLAA 5ED4A 3SCFA 1G3TA 1CAWB 3LA2A 1VJ2A 3T1BA 4O9EA 4R52A 4BIFA 1I6XA 1KGSA 4HYEA 4HAMA 3HUGA 4HV5A 4LEJA 2CO5A 3FMSA 1UIKA 4BXUA 1BI3A 5HS8A 3D0SA 1R36A 2O61A 2UY9A 2HFHA 1FOKA 4MGZE 1ZZ9A 4QLCU 3NL1A 3WE2A 2A68F 4RB3C 1KYWA 1NZCA 1G3SA 4WBBA 2CAVA 2W57A 3Q9VA 2XL9A 4EWAA 1OI6A 3TO7A 5IT3A 4EM2A 1YLFA 1IPJA 4P9FA 5CVRA 5D5VB 1X7NA 1BBYA 2FBKA 1LKNA 2KKOA 4XSXF 4X6RB 1Z9CA 5LGTA 5D8LB 1EP0A 3WGIA 2UXNA 2O6GE 1XCBA 1KQ0A 3SCHA 1R58A 2VN2A 3EQLF 2D45A 4F8AA 4U0WA 2PJPA 2OPKA 1LR5A 5D5UB 2Q1ZB 1QZYA 1VP6A 1YO5C 1F4KA 4LA2A 3FF5A 2F2EA 2K27A 2CSOA 2QDRA 1SD5A 1DP7P 2VBXA 4HBNA 3LWFA 3COAC 1BC7C 2L4MA 5LBQA 1T38A 3GFLA 4HDUA 3EJKA 3F8MA 2JZYA 3V8KA 3RPUA 1YUDA 3CJNA 5CVJA 4PIXA 1YQAA 1B1BA 3FMRA 4U0VA 4U7BA 2B9UA 3WTWC 4Z07A 1PMIA 2XAGA 1AOYA 4S04A 2A69F 1R1UA 2Y0OA 2IXJA 1ZGJA 2OZUA 1YLLA 2ET1A 1XGNA 4PGGA 4IHSA 1H1IA 1FP2A 1HSTA 3EETA 4EJVA 3ABUA 3IDCB 3RKYA 3C3VA 1XMKA 4UVAA 2FMYA 2Y48A 4UVCA 3IC7A 4Q0UA 4YARA 4MGYE 5CADA 2HTJA 3H1YA 1X8EA 1EV7A 5I0SA 2DQRA 3I59B 1S29A 2ZMEA 3IHUA 4MH0E 5H6QA 2F4PA 1XDSA 2HR3A 3SHRA 2RN7A 2PFBA 1WLTA 2H0VA 5L3CA 4HLYA 4IESA 4R1HA 3H92A 1Z1DA 5L3EA 5DEQA 4ONUA 4PJYA 4B29A 4XLPF 2PAMA 4Z2YA 3ZQ7A 4LLNA 4OMYA 4KL1A 1WSUA 4LLLA 2P8TA 4FT8A 4MNUA 1LDKB 2QYOA 2A61A 1IRFA 2FBHA 3IIAA 1QY4A 1XCVA 2IA2A 3HHHA 4UV8A 2FF4A 3SZTA 1ZAOA 4ZU7A 1SFXA 1HW5A 1T6SA 2EFQA 3HRSA 3RYKA 3S0MA 2Q8KA 5HLIA 4G6DA 3F72A 3BALA 3MAJA 4IEXA 2XVCA 3DPLC 1T0FA 1IXSB 4RGRA 2UYAA 4I98B 3KETA 3N4MA 2QVSB 5H20A 4HOBA 2IA1A 2H27A 4NQWA 3BPZA 3ISPA 2HQNA 3H7YA 3F6OA 1CF7B 3DKWA 5CVIA 2Z5UA 3TDZC 4F7ZA 4UUVA 2ZKZA 2RGVA 3GUDA 1HSJA 1LB2A 5KHGA 2E9QA 2DW4A 2XAQA 3BJOA 4HLXA 2OQRA 4WK8F 1P4XA 4HVRA 5FQ0A 1J3RA 2ZNZA 2H6CA 4HSLA 3JZVA 3R0AA 1TTYA 2M5WA 2RDPA 1DGWA 5DCMA 3FZ3A 3QPHA 2PN6A 1R1TA 1G3WA 3LWCA 2QBYB 3L2HA 3VFZA 2XGXA 2MLGA 5D5WB 1LQ1A 1HKQA 2I45A 5JSRA 3E3VA 1XMAA 4L9JA 5DUKA 1ZRRA 1Q1HA 1QO0D 3CF6E 3VOEA 3HSRA 4HBLA 1AWCA 4JVAA 3LZZA 1ZZ6A 3GYHX 4CYDA 3R60A 2HKOA 5LRSA 1YHFA 4I7HA 5TRDA 2DCTA 2K4JA 3K0LA 4WXCA 1QGPA 3JTHA 5D6FA 3GWZA 1MKMA 3V8JA 2VE8A 1YYVA 4GYGA 4HF0A 1BM9A 1CAUA 2XRNA 3ETQA 2HYFA 5AIPA 3ABTA 1PUEE 4JV4A 1HBXG 2MA3A 1FYMA 4L0YB 1IRGA 3REOA 2Q0AA 3MFKA 2Y0MA 2M30A 1MJBA 3J81Z 2W84A 3DPTA 4M73A 2VT3A 1Z91A 2J5PA 4A5NA 5K5OA 5E18F 2P7CB 4ETSA 2DTRA 2OAZA 2ET7A 4MZUA 5E1XA 5FB2A 1O4TA 4MGIE 3TNQA 2E1NA 4M6YA 1J7KA 5L3BA 3GO5A 1OFNA 3RJPA 5JVTA 3MWMA 1L0OC 2DLLA 2FOKA 1U5TA 3WW2A 4KWJA 1L3JA 2K7LA 3SHFA 3K1MA 2B8MA 4ZYHA 1F9NA 5EZWA 4EROA 1ON1A 3H50A 4D7SA 4M6XA 3MEXA 4L11A 5FLXK 1XSXA 1QNTA 5BQTA 1Q43A 4ASNA 1KU3A 3OTFA 1XGMA 4N9HA 3RKXA 2IT0A 2XAJA 4K2EA 2JT1A 5AONA 4Y13A 5BS6A 2A6HF 4HX8A 5J8FA 3JAMZ 4LULA 1YG2A 1OR7A 2EFWA 5FLIA 3WW1A 2XASA 3H1WA 1BC8C 3IDBB 2CYYA 3D5LA 2CFXA 2Z99A 2EAAA 4KMFA 1U2WA 1W5SA 1OYWA 2IXHA 3P9CA 4E70A 1TQ5A 2PYTA 5FFXA 2MHFA 2LDUA 3SQNA 5FDBA 2QQ9A 1PP8F 2O1QA 2MC3A 2ZFWA 1QBJA 2K4BA 4BHBA 4ZYGA 4IEQA 3ACLA 5ICGA 2B5HA 3WW3A 4P96A 1J58A 3D0JA 2X0LA 2J5OA 1JE8A 1K78B 5D4RA 2PHLA 2XL7A 1IZ1A 4ZU4A 3PQKA 4YIFA 1IF1A 2EVXA 2K0GA 1QZZA 5FPZA 2GZWA 1SAXA 4MGKE 1KQ9A 2IXLA 1PM7A 1SFEA 2PQQA 4KMUX 3BROA 1S8NA 5HOOA 3KLNA 4CXFA 6PAXA 4IPAA 3NSTA 2XAFA 4U88A 3RNSA 4MTEA 4G7OF 2VONA 3TOBA 2HOEA 2EK5A 2YR2A 4MTDA 3G73A 5DDGA 4HVQA 3L09A 4HF2A 1ULYA 1P6RA 3JSPA 3FHZA 3H8UA 3ML6A 3ELNA 5LHIA 1BI2A 2V6CA 3KEOA 3DFGA 5CYVA 5LEJA 4G7ZF 1WKMA 1MJAA 2OYZA 2Z2SB 3JSOA 3IBMA 4LLOA 1U78A 2ISYA 4AIJA 4XSZF 2VOOA 1O3RA 2KXLA 3MZYA 4OLLA 2VE9A 3WTYC 4IF4A 5HDNA 3SXWA 1RTVA 1UHWA 1Q5OA 4EM1A 1R1VA 3I71A 3GFMA 3DF8A 5JSPA 1O5LA 5IT9K 4LLGF 3LQRA 4A2UA 5J6XA 2XIGA 2FA5A 3RDIA 3IRRA 3S2WA 3ZN0A 3CO7C 4MV2A 4OIQF 3WG9A 3LA3A 2VXZA 1SEFA 5ILVA 3U1DA 4HW0A 4EMSA 2OU2A 1KQ8A 4EM0B 2BEOA 1F5TA 3ZMUA 3NEUA 1ZZ8A 4IEPA 4META 5BUVA 1R23A 4E2SA 2D5HA 1TBXA 2CG4A 5L3DA 3L9FA 1IN6A 2Z3YA 5ILUA 4Q47A 2XROA 2DPUA 2GC2A 2RVCA 1YFWA 3KE2A 2K02A 4A5MA 4Q4ZF 1FLIA 2IRFG 2P5LC 3B73A 4ESFA 4P9GA 2QUFA 4IETA 1B9NA 2QJVA 3WW4A 4UXNA 2QM3A 3IKTA 4DNCA 2BYVE 5D4SA 2GWRA 4L9NA 4UXAA 5A2QK 3R6SA 2M87A 2PBIA 2RNJA 4I3PA 2CW0F 4WXHA 5E16A 4JQFA 4ZH4F 5J8CA 4IEYA 4HN0A 4S05A 3EO6A 1W4MA 4ENNA 4AVPA 5FLXZ 3ROUA 5HI0A 4KU8A 5LRRA 3M9AA 4I02A 4OINF 2DAOA 5LLQA 5E8GA 3GXOA 1QXRA 3CUQA 1FZPB 2DK5A 2P17A 1T98A 3TKYA 3H3ZA 3CO6C 2HEOA 2QWWA 4AIKA 4E2QA 2YX4A 4CDGA 1SMTA 3BY6A 4GO1A 4HLTA 3HOTA 3F21A 4QM8A 4BH9A 3M8FA 2NYXA 4EJWA 1EY2A 2HWVA 2ISZA 2FQ3A 3ZMDA 1ZRCA 1EYBA 3BB6A 1JHHA 4GYIA 2FE3A 1U8RA 1CAVA 2C6YA 1IPKA 2IXKA 2P6SA 2D2WA 3T0YA 1XRUA 3HQXA 4A0YA 1LDJA 2QCSB 1XDUA 4EGYA 2BNMA 3U11A 1HW2A 3E5QA 3GZ6A 3GYDA 3F23A 1O57A 1NE4A 2DI3A 2D5FA 5BV6A 4R8HA 2D40A 3FXQA 1S7AA 4H0EA 2P5KA 2ETHA 4ZZDA 5JHUA 1QQIA 1J9IA 4CICA 4EWDA 1XSDA 1UHMA 1G3YA 2OD5A 2MPFA 1KU9A 1ZYRF 4WZCA 3I59A 5ICEA 4A12A 3I54A 1W7PA 3R61A 5KHHA 1RGSA 3BPVA 2KIFA 4IEWA 4O9GA 3UKTA 2A3SA 1ZARA 1UCXA 2ZKLA 2F5EA 2L01A 2FXAA 3HTSB 3UKVA 4LJZF 4HDVA 2Q4SA 1RZ4A 4YFNF 3VHRA 1SD6A 2MNGA 3BU7A 2JTVA 4NHJA 3ZP5A 2JRTA 3V7RA 4XFCA 3IL2A 4TLFA 4EJOA 3HSEA 1X8MA 4JTNA 1R7JA 4QGNA 4MEXF 4L18B 2VBYA 4L0ZB 3I64A 2PTMA 1R00A 1NE6A 2OBPA 4RGSA 1ZLKA 3HRMA 4Q0VA 4PIYA 1LRHA 1XGSA 4RGXA 3E6MA 4EV0A 4GULA 1X3UA 4B09A 1K7AA 2QNKA 4XF0A 4L5IA 3ZMZA 1NYWA 4IEVA 3KP5A 4I0BA 3M3IA 1BN5A 1XSVA 4RGUA 3WU1B 3P7NA 2STTA 3E5XA 3ZMVA 5KHJA 3OF1A 1WI9A 3DL3A 2ADUA 3USSA 3CUOA 5LHGA 4LUMA 1J0RA 4KN4X 3BOQA 1R5HA 4GCVA 2QVOA 3RI4A 1FX7A 3KP3A 1O7LA 1YFXA 4KU7A 5IT9Z 5FGMA 5BPXA 4X6QB 1EH7A 2ZNYA 3C1DA 3M70A 2IVMA 2PEXA 4Y17A 4IJAA 2F5DA 3IWFA 1IXRC 1LEAA 1D5VA 2P5VA 3GEZA 1L3LA 2QBYA 1QPMA 4IVNA 1I1SA 5KBFA 4HQMA 1I27A 3L00A 4M9XA 4IHTA 1XE8A 3HYIA 5LGNA 4XF9A 3L7WA 3BWGA 5L3GA 1TNTA 2YU3A 3UKNA 4HSJA 4KWKA 2LNBA 2HS5A 1HKSA 2IJLA 5LGUA 1MGTA 1K6OA 1ZZ7A 1W5TA 1V70A 4LB5A 3HOSA 2PMUA 1XE7A 3FXRA 4LG0A 1YW8A 4BHCA 1I1GA 3WGHA 4L2NA 2EA2A 3ST7A 5EEHA 3C7JA 5DCMB 1PP7U 3J80K 4OIPF 4Q5SF 4HQEA 4KICA 2O03A 3RKWA 3I58A 3CL1A 1TQPA 2A07F 2MD5A 2V1XA 2L02A 3QU6A 4ESBA 5DD8A 2HTSA 1RNLA 4HF1A 1D8JA 4XFFA 5T3NA 4OIOF 1U3EM 1YS6A 4NVPA 1S7OA 2FNAA 4MX3A 3WE3A 4A6DA 4BHPA 2ZO4A 1GXPA 4MQVA 4RAZA 4P9UA 1Z6TA 4MEYF 2ACJA 4LD5A 1D8KA 4OOIA 5HS9A 2GC1A 5DYMA 4B8XA 3S7IA 3DV8A 1DGRA 4FAGA 2FSWA 1FBUA 4OMZA 1XN7A 3HRUA 3I5UA 2XAHA 3B02A 4IEUA 5HVQC 1CAUB 1SMYF 3GVAA 2WV0A 2GC3A 1J3PA 4OFGA 3D82A 5BPDA 4KIBA 1EPZA 2YX7A 3TNPB 2IA0A 2DO7A 3SFZA 2R7FA 2L3DA 5KHIA 1KYZA 3QRFF 3KGZA 3JTGA 3ES4A 2UZKA 2ATFA 1J59A 1BOAA 2VBWA 2EA7A 1SFUA 3MYXA 1J1LA 2M8EA 2NS0A 4Q0SA 5DV5A 3GZ5A 3V7SA 3ZMTA 1HW1A 1BJAA 2FQPA 1UW8A 3LAGA 5FLHA 2G9WA 1ZLJA 3HTUA 4YYOA 2VC0A 2MH9A 1G6NA 1IAWA 2FEZA 1FYLA 1U5TB 2IXIA 4KIFA 2EWNA 1JHFA 4EWEA 3LAJA 4AIHA 1HQCA 3DXJF 2XUBA 3ULQB 2O8QA 2TDXA 1UD1A 5KK1A 3TGNA 2ESHA 4IXAA 5JI6A 4AVBA 4XETA 4Q48A 1D3YA 1O7FA 5I0RA 2NNNA 1FI2A 1BIBA 3FFQA 1VTNC 2XLFA 1P92A 1DPUA 3M1EA 3N97A 2YSRA 2D1VA 3O6BB 5JSOA 3TDUC 3ZDSA 1GVJA 3KP6A 2VECA 5E20A 3H1MA 3NJZA 5I8YA 1JUHA 2KJBA 4U7DA 5BY5A 4BQAA 1U5TC 2H6BA 4PIZA 1SD7A 4KUMA 1K78A 5ILSA 5K8SA 4J1WA 2V79A 2GH2A 1YW7A 2M45A 1ZX5A 2PAKA 4XLNF 1BIAA 4N0BA 5JR7B 4P55A 1H9GA 3KZZA 1ZH5A 3BPXA 4XF3A 3HSFA 1G4DA 2EFOA 2H09A 1JXSA 3BZ6A 4UHTA 3DN7A 4FX0A 2R7DA 4PGHA 3K9TA 4R79A 3TQNA 1FSEA 4EJUA 3V4GA 5D8KB 3HRTA 2CV6A 1FT9A 3RPQA 3GW2A 1Z6RA 3KMHA 4YFKF 4XFGA 2EB7A 3T8RA 4M74A 5J7MA 4MGRA 1FP1D 1K79A 2P4WA 4Q0QA 3QP6A 1STZA 5E1ZB 5J48A 2IP2A 2KIMA 4TV7A 1FXZA 1IN7A 2XHKA 3E97A 4K8FA 1A04A 3PVBB 3GLXA 5L3FA 3K69A 4CZZA 4KA4A 3DQVC 2HJIA 3E6BA 3F8CA 3ERED 5JFRA 2MH2A 4MQ9F 3EHKA 4IRGA 4PZJA 4EQQA 4ZU5A 5CLSA 3O3KA 3QU3A 1NXMA 4HX4A 4ENMA 3OGJA 2OZ6A 3PNAA 5C6CA 3WTXC 2ZBKA 1MDMB 1CAXA 4XF1A 5I8TA 4M9SA 5FLJA 1XGOA 1TW2A 4IERA 2VBZA 4MUVA 3IKVA 2EV5A 4A6EA 3CLPA 1MZBA 3EBRA 2QENA 4KYWA 4JTOA 3EYIA 3KEQA 5JCTA 1E2XA 3HT2A 3R4KA 4WF2A 4D0PA 3MZHA 3J80Z 4N9IA 5KVRA 2COMA 2FMLA 3ELKA 2RV8A 2BNNA 2Q2EA 1UFMA 4UBHA 5D5XB 1LJ9A 3WTZA 2QQAA 1CAWA 1XD7A 4KIGA 3KFWX 1GXQA 5I0UA 3RZZA 3HT1A 1TQMA 1OYIA 2PQ8A 2ZCWA 3GX4X 1C0WA 2O8XA 3U0ZA 1ZRDA 1B9MA 1YTYA 2GIVA 2RKHA 1ONVA 2QZ8A 2PI0A 2OA2A 5AIQA 4ZYEA 3J7AO 3FE5A 3P9KA 1GHCA 2GQQA 4XFAA 3OV8A 3F22A 2Z9OA 2G7HA 3GBFA 3RYPA 3EUHA 3T5XA 2B0LA 1ZG3A 4PCQA 2PA7A 3PLQA 4D7TA 3I7DA 2WTEA 2EV6A 3QAHA 1QXJA 3AAFA 1WA4A 1P4AA 1S3JA 3FM5A 4FBFA 1GQHA 5HLGA 1MJ9A 1QWRA 4XRFA 5KHKA 4KN7X 3WTSC
chains in the Genus database with same CATH superfamily
3S1NJ 3LAPA 3Q9OA 4FCYA 1U9NA 1OBNA 1WBFA 4MXVA 3TEYA 1KFXL 5FJKA 1R6RA 5CFCB 4Z2WA 3BR1A 3ON7A 2VNRA 4FASD 2CFOA 3BPSA 4XBNA 4G94A 2VXDA 2JECA 1UY0A 2M2EA 1QH7A 3ZR6A 5FOJB 2R3SA 2OIIA 1B8IA 3VYTB 2NRAC 1JODA 3WLUA 4B1LA 2ZGKA 1UJ8A 3OJBA 2WWYA 3OEAA 4I09A 2LY9A 4JGYC 2CDOA 1DF0A 2EFPA 4PK4A 2AS5F 4I0AA 1NXD1 3CMEI 3DP7A 4NB5A 4NRPA 1ZHFA 3KLOA 1F4AA 4TWTA 5JIAA 4BE2A 2F48A 1DQ0A 2B7EA 2O9LA 3K4KA 3GTQJ 2WZR2 1W8HA 4URAA 1DZTA 4AD9A 1GNYA 3I4NJ 1JOJA 3BG5A 2JA7J 2HH9A 5A1AA 3CUQC 1B4AA 3J7ZI 2WNUA 2XGCA 4O61A 3BDDA 1W6NB 3MPPG 4RB2C 1VR3A 4UF0A 3TOAA 3OIQA 4LBQD 3ECHA 4DQ2A 4DW6A 3AKZA 3NV2A 4FPYA 1JKOC 2JJ6A 3OOUA 1FMD1 3B93A 4UFLA 2JPCA 3RGBA 3DYOA 5JOWA 5IVBA 1YWKA 3IB3A 3VBFA 3OSDA 3NVCA 3RKQA 1BR2A 1RUOA 2CQKA 1FC3A 1H1MA 3AP6A 4CDXB 1X2MA 4XKVA 1P7JA 2R92J 1Z3YA 3DUIA 4D69A 3BZKA 1W0TA 3ZQLA 1V3FA 2CUFA 3IPVA 2XOMA 1IC8A 3D5SC 2Y0SA 1E57A 2KM2A 2FCVA 1RMU3 4BDYA 4A0ZA 1LKXA 4EGZA 4N7IA 2VUCA 3VBOA 4QQLA 3H9AA 1KU7A 2HWB1 1UMHA 4JX0A 5B4XA 2EA4A 2RDSA 1NA1A 4BLJA 1REDA 2LSOA 3J7HA 1LNWA 5FYUA 1IS5A 1V4RA 4RGAA 4WXDA 1ZG1A 3GZAA 1B59A 1EH6A 2CV0A 4CGZA 4IXLA 3ZYRA 4UNOA 3F8BA 1VQNI 1JU4A 1HV0A 2WFPA 2R041 4JRAA 1JTZX 3VV1A 4LHSA 2DK8A 2ZGUA 2V09A 4M3CA 2FJ1A 3N9OA 4CDQC 4UI9L 1C8M2 3CJIC 2NQYA 5DUXA 1JGSA 5C4WB 2NNYA 3GFJA 4Y7NJ 2PHDA 3CDZB 3ZFEC 1REPC 3SH4A 1BR1A 2ESNA 1YO8A 5EG0B 2PMHA 1Y6IA 4CP2A 1WCQA 5FQ0B 3T0AA 4CEWB 1DDNA 4ENKA 4U0YA 2F5CA 1T0FC 2DTZA 2HGCA 1LJ7A 4JGZB 2PAEA 3FHIB 2HWF1 4LTAA 2YU9J 2CSGA 5LASA 3FJSA 1TQIA 3RTRA 1RKWA 4FX4A 1SPPB 1KA8A 1PDNC 1S6LA 3OD0A 4XVHA 1CGPA 4LG0B 1OJLA 2GM4A 4LFUA 3VDBA 2W3JA 1TZOA 1GQGA 5EHDA 2YPRA 2JK3A 4LK0F 4KT5C 1YQ6A 4M71A 3CCYA 2WAFA 2JPBA 1O5UA 2BP6A 1W9FA 3FKJA 4IHWA 1C8M1 2G0EA 1OF4A 2VMIA 4M72A 3WX5A 1ULFA 1WCSA 2OS2A 2LY2A 1J83A 4OI1A 2K2SA 2B42B 3FMGA 5BNOA 5BXXA 2OQ6A 1XJAA 1QJFA 5H9PA 3N9QA 2LOOA 4AYBA 2VQ0A 1R4NB 3VDDA 1YJ9I 2WZEA 1DQ6A 3NKTA 3I2OA 3FXUA 4QB2A 3RJRA 2E1CA 1QNWA 3ME2A 1DQ2A 1ODDA 5FYBA 5FZBA 4QGLA 2IGKA 3LIHA 2WWJA 3DPRB 4LUKA 1HXS3 5J3UA 4L9VA 2VW2A 5KR7A 5LEKA 3WP6A 4URTA 2WT2A 3F8NA 3O1UA 2ECBA 1TVGA 1PGW1 5M5YJ 4HSTA 1RI7A 3ZYHA 1LOAA 3R4UA 2IS4A 2HQ5A 5F6FA 2LKPA 1YS7A 2BVBA 5FY9A 2QQBA 1DU6A 2G9GA 4YFWA 3KWVA 4K9SA 5FZ1A 4V2WA 4XQDA 4E7HA 3M7GA 2QFEA 1POQA 3GLLA 1FBQA 1FIAA 3Q8BA 1C5IA 2VZ1A 3MDPA 3JD72 2VT2A 3QOPA 4HA8A 1KITA 3L2VA 1TME3 2KIUA 4QPOA 4ZYAA 3QP5A 2VB6A 3CMMA 2XVLA 1N1VA 2MG4A 3BOWA 1LEDA 3W5NA 3ZIWA 1H6YA 1P4WA 1ENRA 3WG7H 1R082 4F55A 5GADJ 3HOXJ 3K2OA 1ON2A 3HGGA 2JA2A 4E7SA 2YV8A 1LNSA 2IC1A 3VBSA 2OQ7A 4DRVA 3VBRB 4GJZA 4YG2F 4A3BJ 5FO5A 3A21A 1SQ4A 4C1WA 3F3XA 1W06A 1MMSA 1MS0A 4GA9A 2WT0A 2ZHMA 1RUF2 2ZJ2A 4OU0A 1YQ5A 1HRV2 3IWZA 5L36A 5J09A 2D6NA 1S0CA 3UYJA 3K4DA 5E17F 2IW5A 3BP8A 2K5CA 3JD71 1SFPA 1DUXC 3H7JA 3QWLA 1YW9A 3ESWB 1AVBA 4HSRA 2ZGSA 3WHTA 3L2QA 4N53B 2ZC2A 2FU4A 3VB9A 3BG9A 1IN8A 4OUMA 3MBWA 4LA3A 5BNNB 2ZGNA 2DBNA 4XUOA 2JDYA 1PZ8A 2ID3A 3TO6A 1CX4A 2RV9A 4DOZA 1OF3A 4JK1X 2A6XA 2Z69A 3DTIA 3MLJA 2LF7A 1AJKA 1QHGA 4JKKA 2WY8Q 4C2TA 1W36C 1AX1A 1GLHA 2FBIA 4CDUC 3L1PA 3MUZ1 1TMF3 1IW7F 1RUF1 4YW3A 2OXBA 1HRV1 1BI0A 3JQXA 3KZ4C 2P2KA 3AMHA 2OTLI 2EIEA 2NOGA 3S3MA 3DEUA 2XLGA 4GWJA 2DDUA 2XBO3 5H6RA 1TWGJ 1H2MA 4QX3A 2VJ4A 3QACA 4QKNA 1KRIA 3CCLI 2I2SA 3FX3A 3TEDA 1X33A 3ECOA 1KFUL 4D3WA 5C9AC 5JR3A 4O3MA 3CTAA 4K21A 5L9RA 2W85A 4Q2FA 3SCFA 1RETA 4GMP3 4BQOA 4IZZA 2H1KA 5ERLA 3VL8A 3IAM2 3L9JT 4LHNA 4PJMA 2ZEXA 1I6XA 1OHFA 2TRTA 4E4HA 2VZOA 1OA4A 1YCIA 3FMSA 2WAEA 1BI3A 3K4MA 4YVSA 2UY9A 1FOKA 4UY8I 1ZZ9A 1UZ0A 4QLCU 4OHWA 3HPGA 5FUIA 1NG7A 2YB7A 3WE2A 1TT0A 2MW8A 4LT5A 1KYWA 1VBC3 1G3SA 2VNOA 2W57A 4LE4A 4MXWA 1OISA 3LSIA 3VZOA 1C5HA 4D0QA 4IE5A 3DKXA 2ADEA 3VD9A 5CVRA 5DN2A 2R072 4XSXF 3NJYA 4C3IJ 2UXNA 1UZYA 2O6GE 2CQQA 1KQ0A 4W50A 1FX5A 1UU4A 2PJPA 2OPKA 1F8VA 1NG6A 1LR5A 5D5UB 5IHRA 1BBT3 1RPWA 2Q1ZB 4QDRA 5JI9A 1YO5C 1F4KA 4IE7A 5H9QA 2GP5A 2IGMA 2F2EA 5F3GA 2EIJH 3Q8FA 2VBXA 2WA0A 3LWFA 3PL8A 5CKTA 1BC7C 1S1AA 1W6MB 5FUPA 3PUQA 3GFLA 4HDUA 4UW3A 2DA6A 1BW6A 3RPUA 4COWA 3CDLA 2JG9A 4MLOA 3VYUB 4B3XA 1JYXA 1JN2P 4PIXA 2HI3A 1OCOH 4OHZA 2AEYA 5CQEA 1POV0 1B8IB 4K40A 1OH3A 3GCWA 4Z07A 1PMIA 4S04A 4QHBA 5JR2A 1ZGJA 2OZUA 2ET1A 4PGGA 2AC1A 1YHQI 2VBPA 3O8HA 4XMYA 1AYM1 4NPMA 3USUA 3RZDJ 2E19A 1PIV2 3C3VA 1XMKA 3TP0A 5JXJA 2FMYA 1OKOA 2ZX4A 4DYQA 4X1EA 3ZXJA 2R1DA 1X8EA 1EV7A 5FP3A 5FWEA 1O4XA 4YW6A 4CYCA 3IHUA 5A7NA 4C91A 5HXMA 2XC7A 2R7RA 3B6AA 2F4PA 2HR3A 5FYCA 3SHRA 1JOPA 3T0DA 5C4XJ 2WNUB 1UZZA 4IESA 1FOYA 2HOAA 3CF2A 1Z1DA 4UF0B 4XLPF 3ZQ7A 2W48A 2GMEA 3OPTA 1D1BA 2CL2A 2FHRA 2P3IA 5DG1A 2FBEA 3VBUC 3IIAA 3P1IA 3CJIB 2AQEA 3CCQI 3H0OA 5JPMB 3S3NA 2FD8A 3DBLB 4HPQA 5HLIA 4G6DA 1PIV1 5FY4A 2XVCA 3DPLC 3RCOA 4B4CA 1IXSB 2UYAA 5DUWA 1PMJX 3QPSA 2QVSB 5H20A 4F93B 2DU0A 3F95A 3UV9A 4Y22A 4BJ6C 3OSGA 1V6OA 4HNUA 2SBAA 3F6OA 2HYXA 3DKWA 5CVIA 2Z5UA 1LFPA 3GUDA 3A0HC 1HSJA 1LB2A 3IZOA 4Q4W2 2R4GA 2XAQA 5B5EC 3MIDA 4RM2A 2YBKA 4Q4V1 1AZDA 2AENA 3MF6A 2EAKA 2ZOEB 3FZ3A 1JYVA 3LKJA 4IQPA 2AZ5A 4ATEA 3B6CA 3VFZA 1LQ1A 2MLGA 5D5WB 1WUVA 5JSRA 4Z6YA 1XMAA 3WF2A 4ITCA 4M3CB 1QO0D 1QJY2 3CF6E 1OLQA 3I8TA 3TW6A 4Z92B 3LGRA 4XN0A 1AWCA 2W52A 5KHDA 4OHVA 4CYDA 5F08A 2HKOA 4Y4RA 4HPKB 2G9ZA 5LRSA 4XJUA 1Y9MA 1Z7LA 4OMCA 2K4JA 3K0LA 2DA4A 3GNEA 1QGPA 4DUXA 2UWCA 1DP3A 3ZKYA 4AG4A 5HCBA 3DYMA 1TC3C 3TB0A 2JE9A 2HPMA 4GYGA 3EMRA 2HYFA 3SITA 4HONA 4RL7A 4JV4A 1HBXG 1IRGA 1OC1A 3DWLE 3PVOA 2X6XA 5FYHA 2PLV1 3HWJA 5E18F 1PVC2 4H3WA 2WB1A 2ET7A 3WCSA 4AVSA 4AU7A 2BZTA 2ZEWA 1O4TA 3TNQA 1K4TA 4BM8A 5J3LA 1MS9A 2ZSHB 4ARXA 1RINA 3O7OA 2KFDA 2VVDA 2VMHA 4WM7A 5DDJ2 3T4HB 3GJBA 2MEV3 2Q8OA 3WW2A 2A6YA 2JX9A 3K1MA 4JQRA 4AWDA 3K75B 1F9NA 1CPMA 4COZA 4PJ0C 4COVA 3CLQA 1QNTA 2JWPA 4ASNA 1KU3A 1X4PA 1XGMA 3OTFA 1ND3B 5IVFA 4ZY9A 4N9HA 3RKXA 2IT0A 2LY1A 3VDDB 3KQRA 4K2EA 1YJNI 2VZTA 4B7KA 2BWAA 4E8CA 4HXCA 2WO7A 4Y13A 4YG6A 2DFEA 1OOPC 4LOSA 5J8FA 3AMPA 4B4QA 1VQ8I 3AZYA 2M4GA 3ORJA 1JKQC 2Y64A 3CC7I 3NNGA 1ULPA 2CFXA 1E0EA 4JCKA 2Z99A 2EAAA 1N78A 4IQJA 4YGDA 4N4OB 1U2WA 4E70A 2WZR3 2PYTA 2VGDA 5FFXA 4FOQA 5DDJ1 4CZSA 2P37A 5HCHA 1BK1A 2LK2A 4PDWA 2O1QA 2WBKA 1H30A 1DFQA 1HKDA 3U37A 4P9IA 1Y56A 4K8RB 4FE7A 3K2AA 5ICGA 4A3CJ 1D2SA 3K4BA 3SISA 1RR7A 5A3UA 4P96A 1GWMA 1Y39A 1B72A 2CNAA 2J5OA 1JE8A 5D4RA 4V2GA 3O1MA 3ETPA 3MIBA 1XU1A 4AYUA 5L9BA 3K4LA 2EVXA 2Y26A 2K0GA 1SAXA 2V4JC 3JUUA 4EN0A 4CA0A 4MGKE 1LUJB 2IXLA 1SFEA 4XMIA 4XXPA 3KLNA 3A0NA 3NSTA 5FZ0A 2XAFA 5A7WA 3DGTA 4Y1VA 5T5OA 1J84A 1WCUA 2EK5A 3VBSB 1W0UA 3DEEA 2DT6A 4E6KG 1W0NA 4F91B 2D97A 4XAAA 4MTDA 5DUVA 4HVQA 3H5AA 1ULYA 2WAOA 5FPAA 1EUUA 4GWIA 5KC6A 2BPA2 1BVP1 4B4PA 3HBKA 4DXRA 4QPIC 4IHVA 4BJTA 3BIEA 3AMQA 1WKMA 3ZYPA 2R32A 1ZR2A 2D44A 3ZXEA 4OUEA 1H8TC 1IV8A 3OS1A 4AIJA 1S7EA 4OLLA 1DZQA 3IH3A 1JUIA 4UFJA 4JC1A 4DJAA 3VGIA 4PF5A 1WH7A 5GJ6A 1OVSA 5IYDJ 4P02B 5FLVA 3PIOF 1BW5A 2XIGA 4YW5A 2FA5A 3B3QE 1ORKA 2VBDA 5FMOS 3VYSB 1QU0A 1JZ2A 1M4WA 3UT0A 4LKEA 4N7UA 5CBLA 4Q4Y1 2M8GX 2O5RA 1GP4A 3AFGA 2Q2EB 4N90A 5F7UA 1US2A 3ZMUA 2AGSA 1E5IA 2Q1FA 2GNBA 1WLDA 4IEPA 1T56A 4A93J 1D4M3 2ZA9A 4LK7A 1H9WA 3I56I 1KQRA 5J4YA 4Q47A 2XROA 3L2WA 4ESFA 3L2UA 1B9NA 1QPIA 3FBYA 3IKTA 4DNCA 1W9YA 5D4SA 5F5CA 4XCBA 2J1SA 3R6SA 1WJ5A 4Y1ZA 1GP6A 2JG8C 4WXHA 1HQLA 5J8CA 1V6IA 4HN0A 1UY3A 2PJRA 4ENNA 4OZOA 4YVSB 2DYCA 1GU3A 2ZGLA 1ZBE1 1LHOA 5HI0A 4NRMA 4BK5A 3M9AA 4I02A 2DAOA 1HDDC 4B43A 4BQ3A 3FDYA 1FZPB 1T98A 3VD4A 2HEOA 4CP0A 2B9SA 2QWWA 4AIKA 4E2QA 2CYFA 2YX4A 2R5YB 3POBA 1SMTA 5K0UC 1OFSA 1QMJA 4BXFA 2FZ2A 3LSMA 4M4PA 1I9RA 4PLOA 1HB1A 4QKBA 3ZQGA 4HFSA 3MV01 1XOYA 1ZRCA 3ZMDA 1PJRA 2YFZA 2HZDA 2BUKA 1IGOA 3ASIA 2D2WA 4GMP0 5B4NA 2CW7A 3BR3A 4CU6A 3HQXA 4P9JA 2M3AA 4XHXA 2JKXA 1FPN3 4NAOA 4RN5A 1LDJA 1XDUA 2BNMA 1BJQA 2VO5A 2K3FA 2D5FA 5BV6A 3FXQA 1IG0A 4H0EA 2ETHA 2OKXA 1N1TA 5IAVA 4I30A 1QQIA 4EWDA 1UHMA 5CAZA 4XE9A 1KU9A 3I59A 4UFIA 1XXNA 1A8MA 1W7PA 3R61A 5KHHA 4C3JJ 4Y26A 1S0IA 2KIFA 2A3SA 2ZKLA 3HGYA 1GP5A 2R7WA 4II3A 2HQAA 2FXAA 3UKVA 4LJZF 4HDVA 5DTDA 4IV1C 2VZQA 4YFNF 3VHRA 2PMZN 3DBHB 3VD5A 4OVEA 3WG3A 3BU7A 4HKLA 5K7FA 5FYMA 2JTVA 2IS2A 3I9V2 1GZCA 1R083 3ILRA 2JUGA 3V7RA 3IL2A 2IFRA 4TLFA 2WL1A 4M0NA 3HSEA 4YW4A 5KXEA 4TYSA 3I64A 3NO8A 4CYCB 3J8F3 4FOWA 4NIDA 3N35A 2OBPA 4RGSA 5E6HA 1LRHA 4YLZA 4EV0A 2RMU3 1X3UA 3B01A 4PHZA 4QDSA 1G9FA 1OA2A 1BN5A 1XSVA 3VHNA 5KCMA 3K48A 2W9XA 3CD6I 4BUPA 1NOVA 2RDRA 4QPGB 3IH2A 1WCKA 3OY9A 3JRIA 3DL3A 3WCRA 5A7SA 2ADUA 1OURA 5C3PA 3CUOA 5F04A 3W5MA 3I2HA 4LUMA 2AO9A 4KN4X 5CZKA 1DP0A 1VBE2 4LIUA 1PO12 4D8MA 1R5HA 3QLQA 1YFXA 5IYCJ 5FGMA 3OYDA 2BERA 4AF9A 2ZNYA 3C1DA 3FXKA 1MACA 3I3MA 1IXRC 1LEAA 3GEZA 1LENA 1L3LA 3AG4H 2JWTA 1JUPA 5KBFA 4HQMA 5LZ6A 3L00A 2RVAA 4XLFA 3HYIA 3I2IA 5J98B 2YU3A 3MKLA 4D5CA 4AI1A 2LNBA 2IJLA 2CJJA 3I55I 1KEXA 2Y38A 3ZQIA 1BOBA 2QQIA 2QQNA 1UYPA 1OCPA 2ZB9A 5KAFC 1G8XA 1KS4A 3MFAA 3P5JA 1NA1C 3VWBA 3WGHA 1J1TA 4L2NA 3ST7A 2H8WA 5EEHA 3C7JA 1RITA 4IE0A 1UO9A 4Q5SF 3HNMA 2O03A 5FJHA 3MFCA 1ZBA1 2E1MB 3AX4A 2L02A 2VQGA 3QU6A 4ESBA 5DD8A 1PO11 1MMAA 5T3NA 2HBTA 1X36A 1UY1A 2X5IA 2V5YA 2M34A 1WCMJ 4XIKA 4BHPA 4MQVA 4MEYF 2DTWA 1D8KA 4OOIA 4I0WB 4XL9A 5CISA 3KV4A 2J1AA 3ZPOA 4E7ZA 2FSWA 1FBUA 4FISA 4J19A 3HRUA 3I5UA 3C7FA 4IEUA 1SLTA 1N77A 1JZ4A 2WV0A 5IK5A 1JYCA 1J3PA 4QX0A 1N3OA 3D82A 2VASA 2VQCA 3EUAA 2YX7A 1HJFA 2IA0A 4FPOB 5FV3A 2QSFX 3HD8B 1RUC2 2CTVA 3QRFF 3MKYB 5T54A 2XGDA 4ISQA 2R073 3AP7A 5FZKA 1J59A 1OT5A 4M3CF 4UAPA 3WHCA 1GICA 1J1LA 2M8EA 1X1DA 2V9PA 3V7SA 1HB4A 1AR72 4LITA 2FQPA 1MS3A 2E31A 1YJLA 1ZLJA 3BZCA 1ULOA 3A03A 1G6NA 1SACA 1IAWA 4FTHA 3H42B 4D5FA 3DXUA 1NCRA 3KX2A 1IZ3A 4QX1A 3LAJA 4G4FA 4AIHA 3S6PA 2O8QA 1UD1A 5KK1A 1H89C 2CH0A 1KGYA 4HL0A 3QD6A 1AR62 2Q8EA 2DCZA 5L7OC 1BJZA 1T33A 4ZKTB 5LWBA 3LEGA 4BDZA 1DPUA 3M1EA 2D6KA 2E34A 4V19K 2GP3A 1RUC1 3B94A 3K3NA 3N7KA 2HWD2 4BQ2A 3NJZA 2EZHA 2Q1MA 5FP9A 1XPXA 1U5TC 2RG4A 3LOCA 1PIV3 3TMOA 1PNGA 1S0BA 2Y9YA 2A1XA 3OOXA 3RZLA 4C0HA 5K8SA 2V79A 4NIGA 1S0EA 2YPJA 1REEA 1BIAA 2ZGRA 2BY0A 5JR7B 3KZZA 2WYSA 1RESA 1GUIA 1W2AX 4PDWB 2DVDA 3WDYA 4DZJA 4BS9A 2DFFA 2R7DA 3CCJI 3TQNA 1FSEA 2NLRA 1VMFA 2C5DA 2ZSIB 3GW2A 2WN3A 2IZWA 3KMHA 1AR61 4XFGA 2EB7A 5C8CA 4OWRB 4M74A 4CA9A 4C90A 4XUNA 4AVTA 2P4WA 4AEJA 5EDNA 3OUIA 1STZA 2BV4A 1VBD2 1ETVA 5FKKA 1KD7A 4CE8A 1Y8QB 2HWD1 3GLXA 5L3FA 4KA4A 4DZPA 1PVXA 3F8CA 3ERED 2MFZA 2EICA 1VRBA 4ISRA 2MH2A 2KL4A 4MQ9F 5A7WB 3GTOJ 3RG0A 1PZ9A 3ZXDA 4KBZA 2ZGQA 3THDA 3SEEA 4QB6A 2ZBKA 1OKQA 2YDEA 4KNCA 2HXIA 3Q8AA 5IVYA 5EZHA 3M8JA 1RJ8A 1XGOA 2VZ3A 4BCUA 4AEDC 3SNMA 2VBZA 4MUVA 2EV5A 5C71A 4Q4W3 3UETA 3EBRA 5FIXA 3LSHA 4KYWA 4JOMA 3EYIA 2QQLA 1E2XA 2XRLA 3ABMH 3MZHA 3VHPA 2BNNA 1CX1A 1HLVA 1UFMA 4YGEA 1LJ9A 3D4KA 3G6JB 3VKOA 2W91A 1MZEA 5J36A 1MBEA 1XD7A 1VF9A 3RZZA 3HT1A 2WS91 1QJY3 3J7NA 2PQ8A 3LDKA 3KS7A 3BODA 5GZFA 2IXSA 3TYJA 1B9MA 5JLXA 1COV2 1RVF1 1YTYA 4OI4A 2OA2A 3HJRA 3WNLA 4ZYEA 3J7AO 1FIPA 4BQWA 2JB8A 2VUAA 2FDGA 3P9KA 4NC8A 1UZCA 2GQQA 5IK7A 3F22A 2G7HA 4RHV1 5F2WA 5T55A 5C70A 3E0JB 3HOZJ 3OMYA 2XJSA 2B0LA 1VQOI 4PCQA 2W68A 4D7TA 4NIHA 3LSRA 2A6TA 1JU3A 2NVUB 3U14A 1PVC3 4A3ZA 4PT6A 1XSRA 5HLGA 2RS51 1MJ9A 1Z7S1 5KHKA 2E53A 1VBA2 1S0FA 3DKYA 5FYZA 2Q8DA 2CWEA 3CJXA 2ZJQF 5FYVA 3A23A 5DDJ3 2YFUA 4LK1F 3AVRA 1Y3TA 1SC7A 1A31A 1WW4A 1JI8A 3CLOA 5J1XA 2X4HA 3Q9SA 2VUJA 5FFOC 1COV1 3O1RA 2LRDA 4XW3A 1TLHB 2A73B 2VQHA 5BMZA 2BBAA 4AZZA 1H0MA 1MR5A 1MVEA 2DN0A 3KVAA 1TP4A 3A4CA 1NLQA 4BNCA 1I5ZA 2L4AA 2VR4A 3RMYA 4XPVA 3BCWA 4L92A 4NRQA 1R5GA 5K5QA 2YC0A 1MH4A 1UX7A 2JA5J 3SDBA 4ESJA 4XFHA 1YYNA 4D94A 1E17A 1GFF2 2DQLA 1NH3A 3S15J 1AYN1 3LD8A 3URFA 1VBA1 4Z82A 1LU1A 2IGOA 1SCSA 1UF2C 1QOOA 4EN6B 2RQPA 2ILMA 1KDMA 4MOAA 2WNVA 3B5LB 2F5FA 1V6LA 1OD5A 3LQCA 2EFNA 1DIWA 5CVVA 4YM3A 2R93J 3MQ0A 1QJU3 4HKWA 3WG2A 5B66C 2VOPA 5FRAA 2E35A 1DCSA 4Q1RA 2Q30A 4LBMA 5KNLA 2A5YB 4LB6B 2XB0X 1BEV2 1MPXA 4JRLA 2VTXA 3AP4A 1W7PB 4RAGA 4J1XA 5CVUA 4RAYA 2ZMEB 4L8QA 2O0YA 4HMZA 5FPLA 4B47A 3GHMA 2F6CA 1S72I 3U10A 2C0ZA 4Y52J 4UYBA 2P6TA 2WLPA 2YXSA 5FK8A 5HV4A 4JKLA 3PTRB 1S2KA 4AYBN 2JSPA 2L7FP 1XX5A 5A33A 1QH6A 2STWA 3ILNA 2UY8A 4B48A 2DA1A 2ZHLA 2UWMA 1OFCX 4C2UA 1E5SA 4PQQA 2JICA 1FPQA 1D0ZA 1HKTA 3RWNA 3LSTA 4RSUA 3SJMA 5ERIA 3I3BA 3VEPA 3VKMA 2XSJC 4G9SB 3K70C 5GZCA 2DA5A 2VMCA 3WNPA 1BEV1 3O1PA 2M7BA 3QYBA 2Y31A 5FCCA 1ZG5A 3LA7A 4QX5A 5I93A 4UWDA 1ZN2A 4DRRA 1FOWA 1R1ZA 3OSFA 4O6JA 2DPDA 1HB3A 1JHNA 1PK6A 1S55A 1USSA 3G71I 1D0GA 2HXOA 4NPRA 4XRMA 3NQOA 2DOFA 2OF7A 2JIGA 1TWCJ 5FFZA 2CUJA 2G7UA 1UB9A 3MHZA 4ZTFA 1FNNA 4YNIA 3E6CC 4LGWA 1W6OA 4EJTA 1MEC2 1ODMA 1ERDA 4K7JA 4LMFA 4XJ9A 1I50J 5I91A 1MD0A 5F0CA 1ZKGA 4XQFA 2K86A 1PX3A 3UKGA 2BE5F 4UB6C 4BBRJ 1WGPA 5H9SA 3ACIA 1DPRA 1J3QA 2QQMA 2HQRA 1PO22 4A0XA 2RC4A 1RXGA 2W94A 4FE4A 3O2PE 1YIOA 4XJ8A 3FN9A 1Y9QA 2ZAHA 3WTVC 4JDNA 2FRHA 3AFHA 3ZFFC 1CQ9A 4KQ7A 4QXCA 4BJ0A 2NVQJ 4B3NA 3KYLA 2M1BA 2JRMA 4LPLA 2XF7A 1B6AA 3FKIJ 4FHTA 3ZN1A 4DGWB 4S2GA 3NRVA 4CP9A 3RPUD 2X5IB 4G8XA 4IEZA 3WOGA 1J2XA 4QX2A 4ZDLA 5FZLA 3VLBB 1OPMA 1IS4A 3OBRA 3OGSA 1UZVA 3P3NA 2FDHA 5E8IA 2X6WA 4PDKA 2L0KA 4GZ9A 4E8DA 1CWPA 4L0PA 3HIFA 2WUHA 2WQ8A 3CZJA 4BE3A 3V0AA 4MHGA 3K6GA 4Y4YA 4ZYDA 2J1EA 5EGOB 4AVAA 3O1TA 5FJ8J 4RR3A 5FK7A 1VB2A 2DVFA 3PFIA 1SAUA 3CEWA 5C7GA 4XEZA 2D6LX 2VZPA 2GOXB 4KNYA 1F5FA 5D21A 4OIRF 4G6QA 3ABLH 3BTJA 1SFNA 3WDWA 1POV1 3O12A 3BJAA 1E3OC 3SXYA 4XDPA 1J09A 2R7VA 2FDKA 4ASMB 2CY6A 1D1CA 4UV9A 1AHSA 1WJEA 5C5TA 4AQ2A 1V55H 5ACA1 1GZWA 2Y6FA 1JBCA 3CQOA 1GBGA 2VQAA 5DZFA 4A7ZA 5CU1A 3U1KA 3VDCA 1LPQA 5EXOA 3H3LA 1BI1A 3O1VA 2TEPA 1TNSA 3WP4A 3ACGA 1VBB2 3AK0A 2JMWA 5DAPA 2PHUA 1YE9A 1XBFA 1IDYA 2XGEA 3LDRA 1F5JA 2XV4S 4YFXF 1W05A 1JKPC 5C4JJ 3MO4A 3ZQCA 1D4VB 5CKQA 2XKPA 5A1LA 1LVAA 1OH4A 5JXIA 3J7AY 2K9SA 4CCCA 4XFIA 5GPAA 3RQ4A 4P5YA 4XONA 3IH4A 2GN7A 2PXJA 2J22A 4AEDB 1PNFA 2QGUA 2WINB 1MIJA 4WM8B 5FXVA 4G9YA 4GH4A 2JDHA 4AR2A 4O7XA 3A2KA 4G7HF 2ARCA 3PO3J 3RS6A 3LNQA 4CCDA 1RRJA 1RMU2 4ORFA 4IRHA 1W28A 3GZUC 3KM5A 2YUEA 2H8RA 4XMAA 5CFDA 4HZFA 5C8CB 1VFCA 4BYYA 2Y75A 1T39A 1DQ4A 4KWLA 4J25A 4WX9A 4W8JA 4IQ4A 3TO9A 2DVBA 4HK8A 1IUYA 3NW4A 3VODA 1ST8A 1VBE3 1W0OA 2A7AA 4QM9A 3O14A 3PFYA 5FYSA 2BBYA 3S93A 4ZZLA 1F36A 4ZS3A 3W58A 3DKQA 2TCTA 2X1DA 3I2KA 2GXGA 2BNOA 2O3FA 2QQKA 3QBQA 4IV3C 4EN9B 4S2HA 3LIGA 3I3EA 1XNDA 1AU7A 2G19A 1F1ZA 2L9NA 2P5BA 4K20A 3J4UH 1V5GA 3FWEA 2IS6A 5GALA 3DPUA 2ZX2A 1I3QJ 1RMU1 1UQXA 4H14A 4NHXA 1WQ2A 3M8EA 4DPNA 1K61A 5EIYB 2LLKA 2LC2A 4XIDA 2GA1A 4PF1A 1LOGA 1BL0A 4MGTA 1X19A 3WUCA 2DT5A 3WGGA 1TW3A 5FXZA 3ZN4A 3POGA 1JJ8C 2NAZA 4P5OA 2Z33A 1O91A 4I6ZA 2XLAA 4HEA2 5BNPA 3LA2A 1VJ2A 5C3RA 1MW7A 4CDWA 4J00A 2PX9A 4KITB 1KGSA 4M3GA 4II2A 4LEJA 1V00A 2CO5A 5EP9A 2YROA 5HS8A 1R36A 1E3PA 4JHTA 1WZ2A 2B9VA 2QBXA 5IP6A 5DG2A 2V7FA 1D1AA 2DXIA 4Z2AA 1NZCA 3H9GA 4H55A 5FBZA 2MYSA 3AJZA 1CR7A 4FPEA 1JMUB 3Q9VA 4EWAA 5JMCA 1OI6A 3TO7A 1W6PA 3GMEA 1ZA4A 4EM2A 1YLFA 4P9FA 5CFCA 3KPHA 1BBYA 2YC4A 4PLMA 1GANA 1AX2A 1RUC3 3VKNA 4YEJA 1AXYA 2D45A 4U0WA 1APNA 2JDNA 1WMFA 1FYUA 4X0GA 1WH5A 4ES9A 3K4ZA 3J7YJ 1AR73 2RR12 4AIDA 4LA2A 3LDBA 3HDDA 4WVMA 3L2RA 2K27A 3HOUJ 1SD5A 4IL6C 1DP7P 1SLAA 3MIGA 4AOCA 2X09A 2L4MA 5LBQA 4EE2A 3F8MA 2JZYA 3V8KA 2R30A 2HLEA 3S2HJ 2I74A 4G3YC 5CVJA 3I2JA 1B1BA 2OUJA 3FMRA 1OD3A 4OMDA 2ME0A 2VXJA 5HV0A 1YQCA 4U0VA 1N1SA 1K5JA 2ZTNA 4UOJA 4BPZA 1VNDA 1R1UA 2W1SA 2IXJA 2OJED 1FP2A 1HSTA 1Q1VA 4XKWA 4CCMA 3ABUA 4EJVA 5C33A 2DFBA 1U8BA 4C1XA 1SLCA 2PHXA 1R5ID 4A3MJ 1UZWA 2Y48A 3IC7A 1EV12 3ZSJA 3Q8CA 2HTJA 3FLPA 4IE4A 3H1YA 1W2OA 1PUFA 4XZUG 1PGL2 1REFA 1ENXA 3RZJA 5LY2A 2W7NA 1QEXA 2ORXA 1HXS1 2R0QC 5T5LA 2RN7A 4CDXA 2PFBA 1WLTA 3H92A 4D6QA 4JHZA 4AUXA 5DEQA 4FPCA 2WB1N 1XNCA 4DY5A 4Z2YA 4X8NA 4OMYA 4KL1A 5A32A 5A3MA 4LLLA 1OLME 3BN6A 2FCTA 2W4SA 5GTIC 3BTCA 3JRAA 1A6QA 1ETKA 2QYOA 4G12A 1XCVA 2IA2A 2NM1A 3NAPA 4COUA 1HW5A 3RYKA 2VMEA 2Q8KA 1STMA 1VBD3 4Q27A 3F72A 3BALA 5LBBA 2LBFA 3OYEA 4HOBA 3MEPA 1TME1 3AMNA 5E88A 4YW7A 3ISPA 1PGL1 5A33B 4INDA 2BGOA 4R9BA 2QEXI 2WO1A 1NCQA 4UUVA 2W5FA 3DU5A 2HU9A 2XMLA 2OV7A 2RNGA 2WAAA 2E9QA 5F27A 5KHGA 1R64A 2OQRA 2L5QA 5EG0A 1MS8A 2BXYA 4UFMA 2E5ZA 3HBLA 3KYCB 4HVRA 5FQ0A 4CEWA 4QXBA 3R0AA 5DCMA 2K40A 2LROA 1QIQA 4PSXA 2PN6A 5FLMJ 3LWCA 1TMF2 3RSJA 2QBYB 3L2HA 4JGZA 5EZGA 2XGXA 4TLGA 4EJRA 2C24A 4L9JA 2LREA 1Q1HA 4QU1A 1PK6B 5IFTA 1UYXA 3HSRA 1AXKA 3MW3A 3U21A 4JVAA 3LZZA 5FKLA 1AL0G 1DYPA 3BKZA 5FZEA 4P08A 1YHFA 3VN4A 5TRDA 3WNKA 3M3EA 1W6OB 3FFZA 3GWZA 1MKMA 3SDGA 4RM3A 3V8JA 4H2AA 1APLC 4Q4X2 3POWA 5JOYA 2VOKA 4A6SA 1CAUA 3UJOA 1JYWA 3AKRA 2E7AA 1PUEE 1QQP2 2M4KA 1FYMA 2R6QA 4UB8C 3MFKA 4IL7A 4CP1A 3OPZA 2M30A 3QYEA 1MJBA 2FCUA 3CF5F 4UW4A 2VT3A 3DTKA 1WJFA 2J5PA 2PELA 3INAA 3OYNA 3C2UA 1VBC2 4RFT0 1TMF1 1C1FA 3U75A 3WD5A 4CXWA 5FP4A 1VQMI 4OULA 1J7KA 2DMQA 1NAEA 1OFNA 4YM2A 3RJPA 5JVTA 2HWC3 3RI9A 3K10A 1VBA3 2XPVA 3V0BA 2XBO1 3HEIA 3DPRA 2VOTA 4CP9B 3K4NA 5KXBA 3RWKX 2UWAA 2NVXJ 1AF9A 2WKKA 4ZYHA 2A05A 4EROA 4CEYC 3IMMA 3SKVA 4L11A 1XSQA 4GMP1 1XSXA 4NOTA 5J37A 5BQTA 5CYYA 1Q43A 3ZFGB 2LD5A 4ATFA 2XAJA 2JDUA 2VLAA 2JT1A 5JLWA 3JRFA 4RGKA 1QQP1 5AONA 2WBMA 4K6BA 4RR3B 4QDQA 2W1OA 1IV6A 1OR7A 2LS6A 1QVTA 5FLIA 1WGXA 1VBC1 3X2QH 3IDBB 3D5LA 2JDAA 2C1FA 4KMFA 3BTAA 5FPVA 1W5SA 2ZACA 5FY0A 2IXHA 3NV1A 3BYWA 3BR2A 2ZHKA 1OPOA 3CMAI 4DS0A 1VRH2 1AUYA 1PP8F 2YY1A 2MC3A 2ZFWA 3VPRA 1GZWB 3AG2H 5FRMA 2K4BA 2ERFA 5IFPA 5JZGC 2ZEYA 3IUOA 2P34A 3NV4A 1W8ZA 3ACLA 3IAS2 4B3AA 2B5HA 1BBT1 3VBRA 3D0JA 2QQUA 1NCRC 5LD2C 1K78B 2PHLA 2XL7A 3JU9A 1BEV3 4YIFA 1NLSA 1N1YA 1JHJA 1QZZA 2WT1A 2VZVA 5HBAA 1JZ7A 1MNEA 5LA1A 3RVHA 3JRGA 1PM7A 1MQTC 1UKRA 2PQQA 4YZ5A 4XM3A 1QJX3 1VMJA 4KMQA 2DBIA 4U88A 3H8RA 4MTEA 1DQUA 1UY4A 4IEJA 3TOBA 2HOEA 2VOVA 1LGBA 2QZ3A 3OWTA 5T52A 4LBQA 1H1AA 2YR2A 3G73A 1C1LA 1MS5A 2MGQA 5IP7J 4NC6A 1P6RA 4GH4B 2GBYA 2WNOA 3KV6A 3ML6A 3ELNA 3FXMA 1X1AA 5IVVA 3AC0A 2W1WA 3BG6A 3NWTA 3OYWA 4NDLA 2WZPP 2EILH 2Z2SB 4LLOA 5CFDB 1OSGA 5ABJB 4IHYA 2QKLB 5F6KA 3ACHA 2VE9A 1QU3A 4IF4A 2XONA 3P5BA 1KJRA 4XTPA 2EXJA 5FMDA 1O5LA 3M2MA 1DGLA 2J1TA 4A2UA 4FPKA 4PI0A 3RDIA 1Q8VA 1IDZA 3I2GA 2RS12 3CO7C 4MV2A 2I5UA 4OIQF 2EINH 3WG9A 5FAXA 4TN7A 1SEFA 2ZX3A 3OG2A 3FC0A 1MEC3 3TAYA 4R9CA 4AVVA 2OU2A 4EM0B 3ZMNA 2XQXA 3MF9A 2BEOA 3WY6A 3K46A 4ARYA 5E3NA 1PO23 2GNDA 5FXWA 2HWE3 2XUMA 4SBVA 1R23A 4OHXA 4E2SA 2D5HA 2CG4A 2VJIA 5ILUA 2FQ4A 2BOLA 2RVCA 1E3HA 1GSLA 5FZIA 3S5AA 2RREA 4LXLA 3HKZA 5B1AH 4IETA 2A71A 4PSWA 2QJVA 3PVEA 3WW4A 4UXNA 4RS5C 4OYUA 2GWRA 2EF6A 2PBIA 3MMYB 1V9U2 4AGGA 3OYFA 1MSEC 5E16A 4JZRA 4ZH4F 2GLOA 3ZVXA 4S05A 2WZ8A 1W4MA 3SFIA 4AVPA 2IEKA 3DLAA 3SC7X 5FLXZ 2ZKNA 3ROUA 3RFRA 5LRRA 1BQPA 4IUGA 4GB32 4OINF 2EH3A 3CUQA 2VG9A 1YRNA 2DK5A 5FKOA 4MHRA 3GZNB 2MEV2 2WJSA 4TZDA 4FTBA 1BKZA 4CDGA 1I5PA 1AHDP 2J7MA 2XG3A 2R0HA 4R4XA 1W6MA 1W6PB 1KS5A 3M3QA 2CGNA 5E3OA 2ISZA 1EYBA 2UWBA 1S9HA 1U8RA 1WMDA 2C6YA 1SFKA 2P6SA 2AEZA 1X58A 1XRUA 4I3GA 3AZZA 4BY1J 1V9U1 3KD4A 4A0YA 2QCSB 2VOWA 1B35C 4WVMB 1JTXA 2Y2ZA 3F23A 1E5RA 1NE4A 5KWRA 2BZDA 2XJVA 2D40A 1A36A 5LCWL 3SQOA 1VAVA 3M4FA 4MFEA 4ZZDA 1IKQA 1XSDA 3ZMOA 1G3YA 2OD5A 3WDXA 1ZYRF 1RKTA 1WCDJ 2MEV1 4Y24A 2DA7A 5FKMA 1VBB3 1BR4A 3AYCA 1ZARA 1UCXA 2PQSA 4Y20A 2VBBA 2DOEA 5HNHA 1HX6A 2XWBB 3HTSB 1RZ4A 1YNAA 4CUAA 4XYXA 3D6EA 2MNGA 3M1HA 4XIOA 4NHJA 2JJ7A 3GDBA 4TXWA 2JRTA 4XFCA 4EYUA 1X8MA 5CG9A 1R7JA 5LY1A 4UUSB 4RQPC 1PUFB 2VQLA 1YX5A 3CJIA 3UGHA 2HEWF 1URXA 2VNGA 4D7YA 1ZLKA 3AMMA 3ZFEA 1HB2A 3W59A 3VZJA 4QX8A 1VPHA 1YJWI 4B09A 4KI5M 1VMHA 1TWHJ 4I0BA 3ABZA 3M3IA 3WU1B 2VJXA 3HNBM 5GKAC 1OCZH 5CG8A 5K9YA 3HVDA 2WZR1 5D8AC 2BJSA 3WSOA 5JWPA 1O6UA 5A32B 3FISA 1WI9A 2NN8A 1EF4A 3USSA 2BFUL 4FFHA 1VAKA 4XOPA 1YEWA 3MD2A 3NAPB 2QVOA 2ZXWH 4GFBA 3KP3A 3ONQA 1W8OA 5IT9Z 2VPLA 4Y1XA 5BPXA 4GKYA 5GPCA 2LBFB 1W90A 5CKMA 4XCAA 2IGNA 2VQUA 2PEXA 4Y17A 3THPA 4IJAA 3WG4A 1MBGA 2X6YA 3IWFA 3BQYA 3M7AA 2RM22 2CU5A 3UNGC 2E32A 4AHYA 1XE8A 3X29B 1NCQB 3EYPA 3L7WA 5L3GA 2P3JA 1Y1VJ 1SDWA 5IOZA 4YWAA 3AXDA 5LGUA 4HPKA 3BTXA 1MGTA 4KGQA 4E7JA 1K6OA 1V70A 2EZIA 4LB5A 2YS9A 3HJEA 1AJOA 2PMUA 4EN8B 1HA8A 1I1GA 5F5QA 2EA2A 5FKBA 2JDKA 5DCMB 4HQEA 1OXCA 3EB7A 1BXHA 5DZEA 2VXRA 5T5PA 3I58A 3MICA 4QXHA 1D4M2 2A07F 2V1XA 3ZDVA 5JXGA 4OIOF 5CNAA 1YS6A 1S7OA 1CQTA 2FNAA 3H3VK 3PO2J 2EXHA 4QHZA 1WMEA 3SEQA 1RHI3 1GXPA 4LKFA 3PM1A 2JEMA 2VC9A 1UYZA 2ACJA 2RM21 5HS9A 1R71A 5DYMA 1UOGA 2M0CA 3S7IA 1OQ1A 1HN1A 2PMWB 5HVQC 1CAUB 2EIMH 1K5MC 3GVAA 4IGOA 3O8GA 1FMWA 3AVSA 1WW6A 3UJQA 1EPZA 3SFZA 2R7FA 3AG3H 4YRVA 1WKYA 3JRHA 3GZTB 5KHIA 3PTYA 1O4ZA 3ES4A 3O0XA 1ND3A 4A3EJ 2W00A 2UU8A 3W9AA 3BGAA 3ZYFA 1P9QC 3ZXLA 5DV5A 3WR0A 3GZ5A 2BDRA 3ZMTA 1D4M1 1HW1A 3NARA 2VC0A 2ZZQA 2RR13 1OQDA 4L9BA 1FYLA 3V0BB 2IXIA 2RE9A 2XF6A 4C3HJ 3J26N 4P1WA 4BDVB 3ZSMA 3DXJF 3OIOA 4IW3A 1F2NA 2ESHA 1FPN2 4Q48A 1D3YA 3PJRA 1RUE3 2NNNA 1BIBA 2VU9A 4XZPA 3WHUA 3FFQA 2EIKH 4A69C 3H36A 3G1LA 3S1RJ 3N97A 3O6BB 2KD7A 3ZDSA 2HOTA 1GVJA 4QX7A 3KP6A 2VECA 4XUQA 5E20A 4X8PA 3VBHC 5FYYA 2KJBA 4U7DA 1WD3A 2V5DA 2H6BA 1SD7A 3C2HA 4IKFA 5ILSA 4BXXJ 3POYA 1EV13 5I0DA 4NR1A 5FPBA 1FOXA 1F43A 5LBCA 2M45A 3VKFC 1BK0A 3EXUA 3TBIA 4WV8A 4XLNF 3AJYA 4N0BA 1H9GA 3I3LA 4IOCF 4M3EA 1ZH5A 2VAUA 3BPXA 4P00B 3I2FA 5FZ8A 1S0DA 4AFAA 2DUOA 4FX0A 1K83J 1IJWC 3K9TA 1NQJA 3JBG2 2HNHA 3J8F2 4NNJA 1FPN1 5LBFA 2VTXJ 3O1SA 3G4SI 4LK6A 3LOBA 3T8RA 3T30A 1K79A 2RMU2 2DMUA 4EQVA 5KAIC 3QH6A 3S14J 4NWWA 3MIHA 2IVIB 2PHWA 3IMNA 4LLFA 2R16A 1SLIA 4YVWC 2F4IA 2XHKA 4K8FA 5HCFA 2DJIA 4YZ3A 3LEMA 4ZZ5A 2X29A 4CZZA 3ZN5A 5C9AA 1V6MA 4PZJA 3T2QA 1ZTRA 2UV1A 1H6XA 2WNEA 4ZU5A 3O3KA 3QU3A 5CB7A 4A7KA 5C6CA 3PNAA 2EPFA 3KB5A 3WTXC 1MDMB 1CAXA 4LBQB 4XF1A 5I8TA 4BA6A 5FLJA 2VOXA 2VW0A 1I6HJ 3IDEA 3F0CA 3ZXFA 1JYNA 2P3KA 1DYKA 1R081 4FETA 4A6EA 4MVTA 3J7LA 3CLPA 1MZBA 2WQZC 3KEQA 1JUSA 3J8F1 3GZEA 4NMIA 4NUBA 3OYWB 3J80Z 4RS5B 2BHZA 5EYYA 2Q2EA 1XYOA 4QKDA 2FDIA 4UBHA 5D5XB 2RMU1 1OLTA 3WTZA 2VQTA 2YMZA 4AW7A 4NBQA 4S0HB 1IS6A 2XHNA 3BR5A 2EALA 2JVGA 3KFWX 3K3OA 5I0UA 3PNTA 3EPZA 4LR4A 3AZXA 2YGMA 3FXLA 5FZMA 2ZCWA 1FV3A 4M4RA 3BQZA 2O8XA 3TEWA 4AI3A 1ZRDA 1ACCA 1MZFA 5FTTC 3KV9A 2R062 1DU0A 2LMDA 2QZ8A 4M3FA 2PI0A 3RQIA 3ZYGA 3A0KA 1ASJ2 5AIQA 4DIQA 4Q4X3 2FOWA 4XRSA 5EJ3A 3FE5A 1GHCA 1OA3A 1QJEA 1SFYA 1QQP3 1XC5A 1ZG3A 3OS0A 2Y69H 3ZGKA 4JX6A 1LVKA 2EV6A 5FZOA 2E1OA 2DCKA 3AAFA 3POEA 3C7HA 1X50A 1ND2C 1K3IA 4FBFA 4DEQA 4NJ4A 2R5YA 4JGYB 1IO2A 4XRFA 4UUTA 2OUMA 3E5UA 4DXZA 4NIIA 2AXLA 3WQ0A 2LTPA 2VI6A 3UGGA 1P7IA 4XUPA 1YQ8A 4J6GA 2XUEA 5BNPC 4QD2A 1Z7UA 4CDWC 1ZK8A 4FPGA 4GWMA 4N43C 5A3NA 3MUY1 2VL8A 1RUD3 3CUQB 4CCNA 1YRNB 2EZKA 1YFYA 1A5JA 3ZXGA 1CZTA 2JENA 2GNTA 1A3KA 1CIWA 2EV0A 3G7DA 1H8VA 3EDPA 4YSFA 2CAUA 1AR82 2H94A 1XB4A 3GBGA 3VB2A 2K9ZA 3WINE 4UVBA 3PQJA 3POSA 4AK3A 3CDHA 2MLKA 4FPHA 5FYIA 1X3WB 1K45A 3FBNB 1IOAA 1WZXA 5HDKA 3IM0A 1TT5B 1KU2A 1C57A 1BMV2 1CJDA 1R22A 2DU9A 2BY3A 3A0BC 3K1NA 2HEYF 1U5ZA 1VRH3 2R071 2TNFA 1OCCH 3JAMK 1JZ8A 4RB1A 4XXAA 5GLTA 4N4NB 3ZM8A 2JE7A 4E4ZA 3NV3A 1XU2A 4L9TA 5A7QA 3ES1A 4IEOA 3ZR8X 3OYHA 4YM0A 4ON0A 1UPIA 4EZHA 2VH9A 3K51A 1R1A2 4GXOA 1F4HA 4WWCA 2YBPA 4Y20B 3TL4X 3U4XA 4MGQA 4UBGA 2C6SA 1H8AC 1A8DA 2EIDA 5M5XJ 3ZQFA 3IT8A 1JXNA 3LCPA 2BGCA 3OBTA 4QPGA 4BOWA 1FAYA 3WUDA 2KDOA 2CW8A 2OQGA 3LSGA 4CDQB 2XR4A 3LMMA 1ZZCA 4BQYA 3ZX7A 1IXCA 1RUG2 2WV1A 1HXDA 1ZRFA 3ZFEB 3OOPA 4Y33A 3PIGA 3A01A 1RUI2 3WT3A 1SEUA 2TUNA 3KLSA 4E2GA 3C3WA 3N9PA 2VC1A 4P14A 1FBSA 1Q8SA 5GAHJ 3WTTC 3KSCA 1IHMA 3GM8A 3JREA 3KCCA 4CDXC 2WFF3 4ENJA 2NPIA 1GKBA 1Z05A 4XLCA 4RA2A 3HQRA 2E63A 4LOCA 5JMOA 4YIIA 4LMYA 4L5EA 1O4YA 3N36A 3THTA 1CN1A 3LSKA 2E71A 3T1MA 4UT5A 3QPTA 4NPLA 1SVOA 2Z4FA 3ACFA 2DWRA 4BACA 4AM3A 1SD4A 2D93A 5F64A 2RS13 3OY8A 1GR3A 5LATA 3J9SA 1RUI1 3IKWA 5FY8A 5TSWA 4BZ4A 3RIRA 4B7EA 4OQ8A 2XPUA 1ZR4A 3OYLA 3C7OA 2CQNA 4RYDA 5C4WC 1UELB 2HKXA 5TISC 2GA2A 5D2AA 3L2CA 3LFMA 1V5EA 4QKFA 2IPQX 2Y6LA 1AR93 2V1UA 1CVNA 1DBNA 1RUH2 5FUNA 3TN93 3VYRB 3JRDA 1OOPA 2Q0OA 1EPWA 4Q4W1 3MIEA 1QZEA 3OYCA 3GTGJ 4Y1UA 4WCGA 4FOYA 4YRDA 5ICFA 2F4MB 3EYYA 3KT1A 4AAPA 1V9U3 2P4EA 4KFCA 2Y9ZA 5J47A 3A4UA 1U6GA 2VPVA 4JGZC 3ZPLA 4IHXA 3C2GA 5LHHA 4TTGA 1Q3EA 2E60A 2A6ZA 2RDQA 3GTKJ 5FZ7A 1V6KA 5EEGA 1YFUA 4HK9A 3O1OA 1MMDA 3W6JB 5JPNB 4GB33 5BPIA 4L99A 2E7XA 1QJY1 1EUTA 2E2IJ 4E27A 5FPUA 4O5VA 2L9VA 2HDCA 2BQPA 4HX7A 5JOZA 3UNPA 3EUKL 4JQTA 1VQ9I 1KJLA 2VUDA 4V2FA 2N7GA 2JXAA 2DCEA 1GV9A 3DXTA 2DT7B 2PLYA 1WWXA 1IN4A 5DCFA 5A3LA 3KP7A 2YHJA 3KT4A 4GWNA 3WF0A 4W65A 2IXCA 1UOBA 3OCPA 3V7CA 2SLIA 3SZPA 2Y0IA 1Y9GA 1I3AA 1X82A 3U78A 1PVC1 2GC0A 4ZONA 2Z1DA 4BMEA 4B4RA 2QQVA 2W46A 1S2EA 3IRQA 5IYYA 4IOAF 1T2KA 3GTLJ 5I8SA 2XJTA 2VZSA 4LBLA 4JP0A 3DPRC 1ZNPA 2OCCH 1IRXA 3OYBA 5LA2A 5J1RA 1FTZA 5DAVA 3ZXKA 4QPIA 4PCRA 3S16J 3W6KB 1Y0NA 3MPBA 2ELHA 5CJ9A 1QJU2 2YPDA 2MBFA 2DBBA 3K4AA 3LQQA 2R7OA 1H8TA 2CDPA 2VM9A 4BBSJ 5GAEJ 5EYXA 1LOFC 3MCZA 2KP6A 3WODF 1JT0A 5HLHA 3FM3A 1FY7A 4BQQA 1CONA 3PUIA 4NIAA 5FRNA 3FBMA 4XDQA 2CRGA 2WQ4A 5GLVA 3IIIA 4FAHA 1BLZA 2GALA 2DDAA 1HRI2 3OPWA 2KZGA 1DLCA 4FFFA 1EH8A 2DFIA 1SBDA 4RA0A 1S5LC 1A6IA 3I4PA 3P9IA 5FBJA 4F3JA 5FY5A 1CESA 3LSPA 2V1DA 3HB9A 4SLIA 3WNXA 4XN3A 3OL3A 3KP4A 4W6WA 4CDUB 1K42A 3S5QA 1LOCA 1CZSA 3IDAA 1MBFA 5EJZB 3VBRC 3JQWA 1QJU1 4DEVA 3VUOA 1LU2A 1C8NA 4RB0A 4JBAA 1WMXA 5CQGA 4FQGA 2LF8A 1Z21A 2ETEA 2XWJB 3DCQA 5C9AB 1W9WA 3T1LA 1UIJA 1RUNA 5FD6A 3N7LA 4LQRA 2FX0A 2KJCA 5IJRA 2X6OA 2RM23 2V6EA 4M9ZA 3PJYA 1CAXB 3CHXA 1VE0A 3K1PA 1LULA 3SZGA 1ZVFA 2CWMA 3EQEA 3KZYA 4L5JA 1ZYBA 2A6EF 4BAYA 4ET7A 2R5ZB 1D0HA 2QSHX 5K1YA 1ZREA 3LFKA 4N53C 2DMNA 3DTEA 3FLTA 4ZPIA 3AKQA 5FPXA 2OA4A 5BNNC 4M01A 4CCKA 1SZBA 1GNZA 5K0UA 2J1VA 2KT0A 3C2BA 4YZ2A 1GZTA 4I76A 3DF0A 4O9EA 2XPWA 4R52A 5E8AA 4E7IA 1W39A 2E33A 4HYEA 4MADA 4YGBA 3HUGA 2H0BA 2YG0A 2JVHA 1UIKA 4BXUA 1WBLA 3D0SA 5DZGA 2O61A 2KISA 2FD5A 1XNKA 1A35A 1HLCA 4C9YA 5B1BH 4MGZE 4GALA 3KT7A 3GGLA 4DUWA 4LE3A 5FKNA 2WDBA 1NY72 4WBBA 2CAVA 4OAZA 3B7MA 5IT3A 2H1LA 3BVCA 3MVPA 2JE8A 5ANQA 3DU6A 4PJLA 2YU1A 1LKNA 2KKOA 3LB9A 1AL22 3WV6A 4X6RB 1XQNA 3VKLA 3ZYJB 5LGTA 1WPKA 5D8LB 5FZOB 1XCBA 3SCHA 3EQLF 4F8AA 2G9FA 4HNVA 2ZX1A 1V6NA 1SBEA 2JA6J 4IV1A 1FMD2 1QZYA 2CSOA 2D98A 1TNRA 4UW5A 4HBNA 4FSJA 3S32A 3EJKA 3MLLA 3CJNA 2QQOA 2G4IA 5FKCA 1YQAA 4XLEA 4W97A 1G9BA 2WSVA 2GIZA 1V0AA 1NY71 2DCJA 1YIJI 3PHMA 3A22A 2XAGA 1CZVA 2A69F 1YLLA 1XGNA 1JJ6C 1H1IA 2HWB2 2W95A 5M0TA 3EETA 4KG8A 3W20A 3IDCB 3RKYA 4F52A 1SCRA 3WF4A 3ZXAC 1AL21 1H4HA 4UVAA 2Y8KA 2OCEA 4Q0UA 2VTFA 4YARA 5CADA 3VBUB 3WXPA 4FVVA 3B9CA 5I0SA 3I2DA 2ZMEA 2V26A 5H6QA 1VQ5I 5LFAA 1Y7BA 1XDSA 4NC7A 2R042 2H0VA 5L3CA 1ULGA 4D6SA 4R1HA 2OPWA 3PUFA 5L3EA 4ONUA 4PJYA 2PAMA 1F31A 5IVCA 3H8OA 2FUG2 3HQUA 3JBG3 3LFUA 1WSUA 2WN2A 2ZJRF 4FPJA 4AFBA 4XLAA 2DMTA 1H88C 4MNUA 1LDKB 2A61A 2FBHA 1QRYA 4AQSA 1Z67A 4UV8A 4AGVA 2AHQA 3BR0A 1ZAOA 5IUQA 3BCBA 4ZU7A 1T6SA 3H5RA 3HRSA 3S0MA 3ZYBA 2HWF2 5FZDA 2QA4I 1LHWA 3N4MA 2WNUC 2OW4A 2IA1A 5CEHA 3GCMA 4NQWA 2D6MA 3BPZA 4EN7B 4IE6A 3H7YA 3OR2C 4QIWN 1GMMA 3ITQA 4XRSG 2WY7Q 2E2JJ 2ZKZA 3A01B 1FNZA 5SV8A 2VJJA 4YG3A 4HLXA 3WDVA 2E7TA 2Y34A 1W8TA 3VBFC 1P4XA 2ZNZA 4H7MA 2H6CA 5A6ZA 4D9JA 3JZVA 1TTYA 2M5WA 2RDPA 1DGWA 2LG4A 3GBWA 1R1TA 1V5FA 2CGOA 2ID6A 1VALA 4FFGA 5F5IA 2Q5TA 1HKQA 1X9PA 3E3VA 1PZ7A 3T2TA 1UMIA 1ZRRA 5E3LA 2ZJCA 2R7ZJ 1IUFA 1X3ZB 3VBOC 2R1BA 1ZZ6A 1PX4A 1XTAA 2VW1A 3AM2A 2BHYA 4I7HA 3OS2A 2DCTA 4WXCA 3JTHA 2VKHA 5D6FA 4QPWA 2R063 2VE8A 3OY8B 2GMMA 1VBE1 1PGW2 1WVRA 4AVZA 2VUMJ 4HF0A 1BM9A 5AIPA 1L7QA 3H0GJ 1ASJ3 1YITI 3ZSEA 1FNYA 2MA3A 2Q0AA 3T3YA 3REOA 3MW4A 3AG1H 1DDLA 5FWJA 3DPTA 4M73A 3RI8A 4DXTA 5L7OA 5FO7B 3CC2I 4A5NA 4E7KA 3PSFA 4MIMA 3AYAA 2CV2A 2OAZA 4MZUA 5JOXA 5E1XA 5DAXA 5K7PA 1N3QA 4XC9A 1RYYA 5F32A 1OLMA 4M6YA 1A78A 5EGOA 2R7XA 2VVFA 2XJPA 1OOPB 5F6LB 3MWMA 1L0OC 2DLLA 4GXLA 1PM4A 1ZELA 2BY2A 1U5TA 5F2SA 1L3JA 1RB8G 3SHFA 1VB4A 5LBEA 2B8MA 3AL6A 3NWKA 1ON1A