3E5UA

Ocpa complexed cprk (c200s)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
219
structure length
215
Chain Sequence
DFCGAIIPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGGNSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNTYNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKIIVYNLGELKHLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclic nucleotide-binding protein
publication title Molecular basis of halorespiration control by CprK, a CRP-FNR type transcriptional regulator
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Transcription regulation
total genus 68
structure length 215
sequence length 219
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e5uA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3e5uA01
4I98B 1DZRA 5IT9Z 1Z05A 1RIOH 2E7WA 1JHHA 4MUVA 3BWGA 1A04A 4PZJA 3WTZA 3C7JA 5T3NA 5KHHA 2DQLA 2VOPA 2KIFA 2LF8A 4AQ6A 1ZX5A 2W25A 2L4AA 2FMYA 3RIRA 4KT5C 4FX0A 4MQVA 2GQQA 5JI6A 1NZCA 1P4AA 2XKPA 3V8KA 2V9VA 3F8MA 4J1WA 2HTSA 4H0EA 3J80K 2K02A 2FMLA 2O03A 3MFKA 4RD7A 1OMIA 3COAC 5HLIA 3C3WA 3F6VA 2QZ8A 1DUXC 1ZZBA 2EAAA 1U5TA 4Q0QA 1YFWA 1BI2A 3H92A 4YFXF 4HN0A 5L3GA 2NS0A 4OMYA 3OOPA 3HHHA 2W84A 4KWKA 2A69F 1XGSA 1P4XA 2F4PA 4G94A 3EUHA 2O1QA 4FHTA 1H1MA 5CVJA 1RL3A 4S05A 1T2KA 1XDSA 2QNKA 4UXNA 4O3MA 4PIXA 1CX4A 4KA4A 1YW8A 4IEPA 2KIMA 1CAWA 5DUIA 1MKMA 4S04A 5I0TA 3TGNA 1BM9A 3MCZA 2XL7A 1W4MA 4EJUA 5H6QA 3WTSC 1TNTA 2VECA 2DQRA 2IVMA 3K1MA 1U5TB 2CSOA 2IXKA 3QOPA 5J8FA 2ZXJA 1Q43A 4M71A 2KXLA 5JR7B 1B9NA 1KGSA 2XROA 4IEVA 2EVXA 3GZ6A 2PA7A 4ETSA 1NE4A 4ESBA 2QENA 1WI9A 2N7GA 4EROA 1ZRDA 3GWZA 4UHTA 1CAWB 1XSVA 4L5IA 3QACA 2A68F 4UV8A 1GXQA 1PUEE 1FI2A 4PIYA 4MEXF 1R5GA 3MDPA 3HYIA 3F23A 3BROA 2H0VA 3WTVC 1S3JA 4WXHA 5LEKA 1O3TA 2MA3A 2ELHA 3ETQA 3ZN0A 3RPQA 4WVZA 3P7NA 2BNMA 4IPAA 1USTA 4RGSA 2M5WA 4M6YA 1NXMA 5FPXA 1C0WA 1G3YA 3BALA 2G7HA 1B9MA 2O8XA 3HIFA 2IP2A 5KHJA 1O3SA 1FBQA 2K27A 2ZKLA 1YHFA 3JZVA 3ULQB 2HZTA 2LF7A 1MD0A 1OR7A 1ZGJA 2MC3A 2QUFA 3ZMUA 3BB6A 2L54A 1YFYA 5K1YA 4UXAA 2KIUA 3ZPLA 3L7WA 2EFWA 4R79A 1Q5OA 1LKNA 4QLCU 2K0GA 4YFNF 3WODF 1PDNC 2ZBKA 3EJKA 3GX4X 4I02A 4HVQA 2Z69A 4O9GA 3E6MA 1ZGAA 4Z07A 3M1EA 1EPZA 1KU2A 1IPJA 5JHUA 2EFQA 1VTNC 5BUVA 2D2WA 1QO0D 4O9EA 2FE3A 1T39A 1BI3A 4IHSA 3Q9VA 5LBQA 2ETEA 2QQAA 5DUKA 5HDNA 1FX7A 2PEXA 3I64A 2Q0AA 4LK1F 5C8WA 4MGKE 3QAHA 4HLTA 2L02A 3W6KB 3JAMZ 3BP8A 3V7RA 1O3RA 4EM1A 4ZU7A 4N0BA 5EEHA 1ZNPA 3CLOA 4ZU5A 4HZFA 3S2WA 1YLLA 2PBIA 4XBFA 2BNOA 4BHPA 1QZZA 3WTXC 3CDHA 2WFPA 1DPUA 5BV6A 3DKWA 1HQCA 4L2NA 2OA2A 2DI3A 4ENMA 4QM9A 2MLKA 3OF1A 3V7SA 1BC8C 4A0ZA 1V4RA 4B09A 4A2UA 4KU8A 4XETA 2QYOA 5DD8A 4BH9A 5FPZA 2CGPA 2Q1ZB 1U12A 3VFZA 1U8RA 4Q0UA 5E18F 4Q4ZF 3LAJA 1L0OC 4OOIA 3ZMZA 4G7HF 1XD7A 2RC4A 3CJXA 2HOEA 3HSRA 1SFUA 4IF4A 3REOA 4BHBA 2YSRA 1ZLJA 4WF2A 1XGOA 1LR5A 3SMHA 2ACJA 3DEUA 1IAWA 3ACLA 4KDPA 4EGYA 3V8LA 4EV0A 2ESNA 1OD5A 1O5LA 3IL2A 2A07F 3ZMSA 2IW5A 1G3SA 4UVCA 5HI0A 3S0MA 2GWRA 1HW2A 1Y9QA 2XLGA 4IEWA 2HFHA 5AIPA 4JK1X 1TQIA 3GUDA 1R00A 1FYLA 1J59A 1R1TA 4EJOA 2KKOA 5ERIA 4KNYA 3LZZA 2FOKA 1KQ0A 5I8SA 4XF1A 4I7HA 2OZJA 5JSRA 3H50A 2GA1A 3R0JA 3WGHA 4RB1A 3EQEA 1KQ9A 1S6LA 3V8JA 2GU9A 5I8YA 1DZTA 2P5LC 3WE2A 2EV0A 4AIHA 4QGMA 1KU3A 5E1RA 3KMHA 3QRFF 3W6JB 1DDNA 3CF6E 1EH7A 4A12A 5LLQA 4RGRA 1JUHA 5KK1A 5DYMA 4D7SA 3DL3A 3HTSB 5F64A 5D5VB 4D7TA 3LWFA 2E7XA 2OYZA 3WU1B 4LK0F 1CF7A 3QPTA 4HF0A 3GVAA 6PAXA 2ZFWA 4IJAA 3VB2A 4XFGA 4OIQF 1FPQA 3L9FA 4Y17A 3OGJA 4XFFA 1T6SA 4GYIA 3MZHA 1QGPA 3BDDA 2CQKA 4J1XA 4RB3C 4U0WA 4KU7A 1XCVA 2ISZA 3NSTA 4PIZA 4P9GA 1FZPB 2ZCWA 1G3WA 1J0RA 5FLXZ 4CDGA 4KIFA 2J5PA 3HRMA 3PLQA 4MEYF 2FBHA 4LLGF 4G7ZF 1FSEA 5H20A 4AXOA 1V3FA 4A5MA 4UUVA 3SQNA 3LAGA 2Q8KA 1D3YA 3HRUA 2R7FA 1CF7B 2QCSB 3TO7A 3MYXA 3G3ZA 4LB6B 2ET1A 1FC3A 4HF2A 4IESA 1XN7A 2V1XA 4EMSA 4WK8F 4KUMA 1QY4A 1HBXG 3TNQA 4U0YA 1MZBA 2Q0OA 4P55A 5BPIA 5LGNA 2Y75A 3FJSA 3R4KA 1QXRA 1PMIA 5ILSA 2X0LA 1Z1DA 3D82A 1XGMA 3FMSA 2QDRA 3KEOA 1RZ4A 3J7AO 3TO9A 4CZZA 5I91A 4Q48A 3MZYA 3TQNA 2IRFG 3G7DA 3PNAA 3OV8A 5K8SA 5KHGA 2QJVA 5FD5A 3N4MA 4OIRF 2L4MA 5L3EA 2UY8A 1QXJA 3C1DA 3E6BA 3U10A 3I54A 3EETA 4JQFA 3R61A 3IC7A 3KSCA 4QGNA 4CHUA 4PCQA 5E1XA 1I1GA 3BPZA 1HXDA 2Y48A 4Z82A 1WQ2A 2V1UA 1ULYA 1VP6A 3E5XA 2BEOA 3FXQA 4KICA 4XRFA 2EFNA 1RI7A 4L5JA 4ZYDA 4BNCA 1SQ4A 4I2OA 2PHLA 1J5YA 1ZARA 4LFUA 4N9IA 3ZMDA 2O0YA 3I71A 2V09A 4AD9A 4IRGA 2ATFA 4XSXF 2XAJA 3RJPA 2NNYA 1YG2A 1ZG5A 2PAMA 2E1CA 1S29A 4B8XA 3GFIA 3O14A 2ZO4A 5DV5A 4MHGA 1U6GA 3T0YA 3F8BA 3J81Z 2VOOA 2CAVA 4NQWA 2STTA 2YR2A 4WWCA 2JRTA 4M9SA 1OKRA 2OU2A 3HOSA 1KU7A 2UYAA 3D0JA 1ZN2A 2O61A 4LG0A 2ZMEA 4HLYA 3IRRA 4RGUA 2C6YA 1O7LA 5FDBA 1YW9A 5TRDA 4LLNA 1DGRA 3BJ6A 2L3DA 3NQOA 1SD5A 1SMYF 1LDJA 1TNSA 2MD5A 3ECHA 1ZG1A 4I3PA 4KN4X 3ES1A 2P4WA 2W57A 3JSPA 5LEJA 1XRUA 1LDKB 4HSJA 2ETHA 2MHFA 3DN7A 4ZU4A 4P9UA 2P17A 3OCPA 4B29A 5D5XB 2CO5A 4HW0A 1O4TA 5CU1A 2OPKA 3KP7A 5IT9K 3IHUA 2DK8A 4KIGA 1F1ZA 2DBBA 3C3VA 1GXPA 2DPUA 4XSZF 3QPHA 2IXIA 2DK5A 1QNTA 2M87A 3R60A 5I0UA 1WLTA 2GC0A 3T8TA 1RTVA 4LG0B 2ZMEB 5IT3A 4HV5A 3MWMA 1JGSA 2OA4A 3R6SA 4EJTA 4JTNA 3HRTA 1J2XA 1D8KA 2JPCA 3PVBB 4Q0SA 4MGYE 3H1WA 1J58A 1EP0A 5HS8A 4XF3A 4NB5A 5JSPA 3QP5A 2QWWA 2XAHA 4YIFA 3LA7A 3TO6A 4HLXA 3GZ5A 3FHZA 2WC2A 3VODA 2XAQA 2UXNA 4IEQA 2A5YB 4E2GA 2JZYA 1TBXA 3H7JA 1DP7P 3NL1A 4ON0A 5L3FA 5CVIA 4AVAA 3RI4A 4M73A 2PFBA 3E97A 3EYYA 4Y15A 3EBRA 1IN4A 2PI0A 5J8CA 1L3LA 3TDUC 3R0AA 1X3UA 4UVAA 1KYWA 3HRSA 4UV9A 4O5VA 1SFEA 1QWRA 1KYZA 1Z91A 5DDGA 5FGMA 5BPXA 1SMTA 1XB4A 4META 3KP5A 1MJ9A 1T0FA 2XVCA 2BGCA 2Q2EA 3L00A 2VXZA 1CAXA 3N97A 1XSDA 5FLHA 1OI6A 3GXOA 5A2QZ 1UB9A 4KL1A 4BAYA 2YU3A 3S7IA 4HN1A 4KFCA 4NVPA 3I4PA 2FBKA 3WW3A 5BY5A 2FRHA 3LA2A 1RNLA 2P7CB 1VR3A 4RB2C 2GXBA 1O57A 4WXCA 2GIVA 1FY7A 2VE8A 1YTYA 4A6DA 4JVAA 2A6EF 2W24A 3F3XA 2DAOA 4YNIA 2FU4A 1GVJA 2HWVA 2Z3YA 5J6XA 2HS5A 3BJOA 3GLXA 5KHIA 4QWQA 4EVIA 4XFAA 3GO5A 1R1UA 3IIAA 4HQMA 5JVTA 4LMYA 1SD6A 2F5CA 3SXYA 3DFGA 3EQLF 1CAXB 2M30A 3TOAA 5D8KB 5HLHA 3M7GA 2DO7A 5AVPA 2ADUA 1JHFA 3LAPA 2B0LA 2CW0F 3HT2A 1W7PD 2V6CA 2ZNYA 2VE9A 2RNJA 2H6CA 1YFXA 4JV4A 4HYEA 3MQ0A 3M70A 3KP2A 1FBSA 2P6TA 3BJAA 3WGGA 4Y13A 2H27A 4MX3A 3I59A 4E70A 5LHIA 4G6QA 4N9HA 3F8CA 3ML6A 2XUBA 2XL9A 4PGGA 1O7FA 4CICA 4R52A 1T38A 2IPQX 2OAZA 1G4DA 1UCXA 1E17A 3ABTA 4DINB 1X8MA 1YS7A 4ZYEA 2Q30A 2D5FA 5I0RA 3ST7A 2O8QA 2HYFA 5JR3A 4LEJA 1XMKA 1JXSA 4IEXA 1XGNA 2F2EA 3ECOA 3CO6C 1ZREA 4ENJA 1EY2A 1R36A 1YUDA 2WV0A 3LQQA 3CJNA 3BOQA 2AS5F 4XLPF 4IEZA 3I58A 5HLGA 3H9AA 1CAUB 2V79A 1R23A 3IWFA 3JAMK 2X4HA 4F8AA 1PP7U 4ASNA 3I59B 1W5TA 1YFUA 3L2HA 1BC7C 1P4WA 1WSUA 3K2ZA 1TQ5A 3K69A 2XASA 4KIBA 3RZZA 4GGGA 1Y0UA 3GFJA 3Q5FA 1ZZ6A 3MAJA 2PAKA 3LQRA 2IXCA 3WW1A 1FNNA 3GFLA 3RNSA 2UWMA 3P9CA 4U7DA 1YO5C 2B9UA 2HKOA 5HS7A 2KJBA 5KVRA 3M3IA 2VPVA 3HQXA 2ZJ2A 3K0LA 1EH6A 1IRGA 3CO7C 2EFOA 4TLFA 5LRSA 1OYYA 4LLLA 2A3SA 2I45A 4L9VA 1QZYA 4RAYA 3F72A 5K5OA 3T1BA 5ILUA 3CUQC 1SD4A 1D8JA 1I5ZA 3ERED 4G7OF 2VT2A 2XKOA 1AOYA 5AIQA 1MJAA 3HHGA 2OQRA 1K6OA 2UXXA 2VT3A 5BOXA 3RKXA 1K7AA 1XE8A 3KGLA 2ZKZA 4MGZE 2DPDA 3QU6A 1OFNA 3CEWA 2Z5UA 2M45A 4E2QA 4HOBA 1O5UA 4LA2A 3VHRA 2MNGA 4CO8A 1P6RA 3ZQ7A 4HDVA 2GXGA 4HSLA 2R3SA 3WTYC 3F22A 3WTWC 3PQJA 1ZG3A 5BPDA 4PJYA 3KFWX 1J3RA 2H6BA 3D5LA 1TW3A 4I01A 3FE5A 4PGHA 1IUYA 5FO5A 4DQ2A 1FWZA 3ZMTA 4KN7X 1J7KA 4EM0B 3WTTC 1ZZ7A 2XHKA 1ON1A 2P6SA 2W85A 3KLNA 5LRRA 2BNNA 4WCGA 3G73A 4HV6A 3DXJF 2G9WA 2YX7A 3RDIA 4LGWA 4UVBA 2QM3A 2VBXA 2HR3A 4Q29A 1TLHB 1LDDA 4IRHA 1T98A 2HKXA 2IA1A 1CAVA 1G3TA 4QGLA 2PTMA 1NHAA 3JW4A 5BMZA 3RPUA 4HDUA 1MJBA 2EK5A 3MPBA 3D0SA 4LD5A 2JPBA 2DTRA 3B02A 5FFZA 4MV2A 2IJLA 3SXWA 1RGSA 1V70A 4ZYHA 2MH9A 1ON2A 2CFXA 4YFKF 2Q4SA 5FLXK 3H7YA 1H0MA 4KMFA 4OMZA 4RS8A 4XF9A 2EV5A 5D4SA 4M72A 4KMUX 3I53A 1B6AA 2B8MA 5BS6A 2ISYA 5HDKA 3AAFA 1K78A 1IXSB 4L11A 5L3DA 4AVCA 2HDCA 3OTFA 2PHDA 3ZN1A 4R8HA 4GXOA 3UKVA 3ES4A 3KZZA 1CAVB 3MEXA 4I0BA 3HSFA 4WZCA 1UD1A 5CVUA 4FBFA 2FA5A 2DU9A 2RDPA 3HTUA 5DCFA 3WGIA 1AWCA 1SFNA 4HX7A 2K7LA 2STWA 3KP6A 4GO1A 1QQIA 4L0ZB 3L2CA 3HT1A 1HSTA 2V1DA 4M9XA 2P5VA 3P9KA 2E9QA 1U2WA 2PYTA 3DQVC 5ICGA 4IEOA 2MPFA 1K78B 5EZWA 2VN2A 3WTUC 3T5XA 3RKYA 2EA4A 1FOKA 2OD5A 5E1ZB 3IKTA 4UBGA 5J7MA 4OLLA 4YRDA 4EM2A 3RKWA 3RYKA 4Q47A 3U11A 4MTDA 1ZRRA 4ZZDA 3IRQA 5EEGA 3F8FA 1R1VA 3ZP5A 2DLLA 3SHRA 1ZVFA 4M74A 5FFXA 1OPCA 5HVQC 5K5RA 2XRNA 2PQQA 2JT1A 1KQ8A 2CAUA 5LGUA 4IEYA 1BOAA 2JTVA 1LRHA 1X8EA 1Y3TA 4FAGA 1WWXA 4EJVA 4K2EA 1GQHA 1J3QA 4HBLA 1J75A 1J3PA 1FBUA 3GFMA 3U0ZA 1ZLKA 4A0XA 1HKSA 4K8FA 5KBFA 4OIPF 2OZ6A 3HOTA 3KP4A 1J9IA 4MH0E 3F6OA 4CXFA 3J81K 4MQ9F 1ZHFA 3UKNA 1X82A 4MGIE 4FX4A 1ZZ8A 2O6GE 2COMA 2EWNA 3TDZC 3H1YA 3SHFA 4NHJA 4HVOA 3ZDSA 2OZUA 5BXXA 1SAXA 4OU0A 4XEZA 2MH2A 4LULA 1L3JA 5FB2A 1XCBA 5CVRA 1XSXA 1S7OA 3LSTA 1R7JA 3V7CA 4Q0VA 2MBFA 4LTAA 3WW2A 4R1HA 1QBJA 5HS9A 4XFIA 4UNOA 2UY9A 4L0YB 5D1IA 4HVRA 1PP8F 1ZH5A 3E3VA 3FFQA 3JTGA 3KP3A 1FYMA 5LHHA 3PFIA 1ZRFA 3J80Z 5CJ9A 2FBIA 4RAZA 2D45A 3KZYA 4ZH4F 2L01A 4PDKA 4P5OA 1U5TC 1BJAA 1Z7UA 1IN6A 4AIJA 5D6FA 5CADA 3SCFA 1Q1HA 4ZZLA 1G6NA 4U0VA 2F5DA 2XLAA 1XMAA 4QMAA 1R22A 2OBPA 1ODDA 1R58A 1YFHA 1RUOA 3UKTA 1KU9A 1Z9CA 2ESHA 3WG9A 1FLIA 5ICFA 3DF8A 2GAUA 3SCHA 3ISPA 1LB2A 3I5UA 3FX3A 1ZZCA 2DCTA 3O6BB 1MGTA 3FWEA 1TQPA 2K4BA 2GC2A 4IHTA 1QPMA 4BQAA 3KLOA 1FXZA 2VQAA 1DGWA 3FXUA 4HBNA 5LHGA 3K1PA 2HJIA 1WRJA 4YSFA 3FMRA 2D1VA 1IZ1A 2H09A 3S7EA 4YIIA 2QQ9A 4YYOA 5LGTA 1B4AA 5CYVA 2PMUA 2PJPA 3HUGA 3NVCA 4QX5A 2IA0A 1Q3EA 3M9AA 1UFMA 5FCCA 3KGZA 3OD0A 3LA3A 4G8XA 4XLNF 1ZZ9A 5KHKA 3TOBA 5DEQA 3SFZA 1SD7A 3K9TA 3KETA 1UCRA 3FZ3A 2VODA 2F5FA 1IW7F 1YW7A 4XFBA 1S7AA 2BYVE 1MDMA 4OFGA 4KYWA 5JSOA 1REPC 3USSA 1IN8A 1TW2A 2KRFA 2LNBA 5EFUA 5A2QK 4IETA 4UBHA 2M8EA 2HTJA 2NRAC 5ICEA 2DT5A 2R7DA 2BE5F 2VBZA 3F8NA 4YG2F 3PQKA 2VC1A 2CV6A 4ESFA 4A6EA 3DPLC 5JCTA 1BIAA 4H7LA 4L9TA 1NYWA 1FSHA 2P8TA 3GW2A 3JSOA 3H3UA 2RGVA 5F6FA 5JFRA 2RN7A 1FP2A 3ABUA 5D4RA 5DCMA 5FLJA 2Z2SB 1ZAOA 4CYDA 3ELKA 1MDMB 5I0SA 1FYKA 4KWLA 1P2FA 1CAUA 4MZUA 3IKVA 4I0AA 4BXUA 3KE2A 2OQGA 2J5OA 5J48A 3H3ZA 4LB5A 3K1NA 2EA2A 4ORFA 1CGPA 3EYIA 5JAXA 3IDCB 2ZNZA 2BBYA 3M8FA 2D1HA 2HYGD 3GF2A 5E20A 1P92A 3ELNA 3B73A 4OIOF 5CVVA 4HF1A 1LJ9A 2BV6A 2FSWA 2FEZA 4AVPA 1IN5A 1TQMA 3WU0A 2ET7A 1UHWA 2VBWA 2XGXA 3FHIB 4JTOA 4YARA 5C6CA 5D6EA 2QVSB 2D5HA 2CWEA 4DNCA 1LVAA 3NEUA 1U78A 5L3BA 1RC6A 1I1SA 4P96A 4L18B 5DCMB 5AONA 1Z6TA 5CLSA 3CO2A 1XDUA 2QVOA 2UZKA 1LNWA 3H1MA 4EJWA 2FQPA 3QP6A 3EHKA 1NE6A 1U3EM 3BZ6A 4WXDA 3BPVA 1VJ2A 4ESJA 4G9YA 2PQ8A 2RVCA 4XF0A 4EWDA 1PM7A 5J3UA 1K79A 1J1LA 1UIJA 3F21A 2PAEA 4HX8A 1BBYA 2UYBA 3TNPB 4GYGA 3IDBB 1HKQA 4XF4A 4Q5SF 4L9JA 3FF5A 1UHMA 3E6CC 4QXKA 4I09A 4IVNA 3SCGA 2XLFA 4M9ZA 3RTRA 4FAHA 2C0ZA 3FMQA 4WX9A 2IA2A 2H94A 2AXLA 2NYXA 3GYHX 1IRFA 4M6XA 3NW4A 1W7PA 2RQPA 2IC1A 3KCCA 4HX4A 3I7DA 3CUQA 3NRVA 1LQ1A 2GH2A 4LUKA 1X7NA 1ZYRF 3T8RA 1SFXA 3SZTA 4U7BA 3CUOA 3E5UA 3WW4A 1YIOA 4AQ2A 1I6XA 4IERA 4GULA 5E8GA 4GCVA 3LFKA 2FNPA 5TJJA 2EA7A 4A5NA 1E2XA 2IXHA 4MNUA 5HOOA 1BI0A 4IEUA 1HKTA 1YYVA 2Y0MA 3I0TA 4U88A 1IN7A 2PN6A 3O2PE 1BIBA 2WWYA 1ONVA 2A61A 3WE3A 2RKHA 5ILVA 4CGZA 4FT8A 3ZMVA 3U9GA 4AIKA 4RGXA 2LDUA 4BYYA 1W7PB 4IRIA 4EWEA 2EB7A 3CUQB 1YS6A 2LSOA 3LOIA 2F5EA 1HW5A 2Y0OA 2GZWA 2HGCA 3O3KA 4JBAA 5I8TA 2B5HA 1WA4A 4G6DA 2EFPA 2VC0A 3VEPA 2XAGA 2K4JA 4MGRA 2NNNA 2RV8A 3M8EA 4LJZF 4X6RB 3FZVA 5E1WA 5L3CA 2QLZA 5FD6A 1IXCA 3LWCA 2K86A 3GEZA 5K5QA 1IF1A 1IXRC 2G7UA 3EO6A 3BCWA 4MTEA 2GA2A 1Z6RA 2HQNA 2DW4A 3HSEA 3ROUA 4HQEA 5H6RA 1I27A 2EV6A 2HEOA 4BIFA 3H8UA 1F9NA 1D5VA 5DD4A 2DFIA 4P9FA 3NKTA 1FP1D 2PFWA 2QBYA 4F7ZA 2VBYA 3IBMA 2XAFA 3BU7A 4HMZA 2XIGA 3E5QA 2Z33A 4O6JA 1FT9A 1B59A 3FXRA 2M1BA 5ED4A 4AWXB 4Z2YA 2PG4A 1RUNA 1STZA 1S8NA 1LEAA 1UW8A 5BQTA 5E17F 1HSJA 1LEBA 2FQ3A 3FM3A 1BN5A 1W5SA 3FM5A 4EWAA 2HQRA 3CTAA 1USSA 4XFCA 1OYIA 2IT0A 4IXAA 5ICCA 5I93A 4EQQA 3TKYA 3CL1A 2CG4A 3QU3A 1H1IA 3E6DA 2QBYB 5F1RA 4WBBA 1GQGA 5E16A 2MLGA 4HAMA 2LKPA 4ENNA 4QM8A 2A6HF 4ENKA 2WTEA 3IWZA 1BI1A 4BHCA 4XFHA 2QQBA 1KA8A 3L09A 1R5HA 1HW1A 2KJCA 3C18A 1B1BA 1ZRCA 2FXAA 2CYYA 4HA8A 1DPRA 2Z9OA 1O3QA 1JE8A 2E1NA 1YWKA 1YLFA 3DPTA 1YQAA 3P9IA 4RB0A 3V4GA 3RYRA 4E2SA 2FF4A 2K9ZA 5FLIA 1WKMA 2TDXA 3BY6A 3U2RA 2PMHA 2GC1A 3RYPA 3Q9SA 3NJZA 1XE7A 1WGPA 2Z99A 4L9NA 1EH8A 2PLYA 5FQ0A 3CLPA 4ZYGA 5E8IA 4D0PA 1UIKA 2P5KA 1TTYA 3KEQA 5HDGA 4ONUA 3U1DA 2GC3A 3EDPA 2D93A 2IXJA 3DP7A 2XV4S 2NAZA 4Q0PA 3BPXA 3JTHA 1IPKA 4A0YA 2D40A 5D8LB 3DV8A 1GHCA 1SEFA 1EV7A 2YX4A 2EJRA 5D5WB 2JSCA 2IXLA 1F5TA 1EYBA 1H9TA 2O3FA 2P7VB 4OINF 2VONA 1UPIA 4KWJA 1H9GA 4X6QB 4TV7A 4AVBA 1OYWA 4LLOA 3VOEA 3SZPA 4LA3A 5D5UB 4EGZA 3GYDA 2YPRA 1F4KA 5FQ0B 3GBFA 4LUMA 2FNAA
chains in the Genus database with same CATH superfamily
2CQXA 1NCRB 2TBVA 5EDNA 3RKQA 3BWGA 1A04A 3WTZA 3KB5A 5LZ6A 1PX3A 1F9KA 5E79C 2Q1FA 1ZX5A 1B72B 2HQ5A 2W91A 4BA6A 2L4AA 1PO11 3INAA 2GQQA 1JJ6C 2VKEA 1JU3A 4XQDA 5M0TA 3F8MA 1G59A 2HTSA 1GNHA 4V2GA 5FPBA 2O03A 1UKGA 3M3OA 3COAC 1LOEA 1YNAA 3ZQQA 1XSQA 4AEDC 4P00B 3UYJA 4H3WA 3B6CA 2EAAA 4R4XA 1U5TA 1OOPA 4FOYA 1YFWA 2VNVA 3POYA 2WIIB 1NT0A 5FXXA 1HB4A 3H5AA 1PMHX 2WA0A 1YX3A 3O1SA 3OBZA 2DVDA 1P4XA 1R082 3BR1A 5J36A 3EUHA 2O1QA 3SLIA 1FIPA 4YW2A 2AC1A 2JD9A 1T2KA 1XDSA 4PIXA 1BXHA 4KA4A 1KRIA 1YQ2A 1FOD3 4HFSA 5DUIA 3GZEA 2Y8KA 1MKMA 2MEV2 4XORA 1BM9A 2ID4A 4PJLA 3S16J 2B9VA 2R7OA 2XL7A 1W4MA 1RIRA 4AL9A 3WTSC 2YV8A 2IVMA 4DUXA 2IXKA 5FY5A 1JZ4A 3QOPA 3OSFA 3C2GA 1Q43A 1T0FC 4UYBA 2WYFA 5JR7B 4S2FA 4BDZA 1KGSA 2XROA 2QQPA 4CP9A 3GZ6A 1GV2A 3WT3A 5E3LA 4ETSA 4AHZA 1MNDA 4JHZA 3MLLA 3GWZA 1E5HA 1CAWB 3OBAA 1W2OA 5G05L 3JBG3 3L2WA 3DECA 2UWAA 1AF9A 1PUEE 2DODA 2RM21 4FE7A 3LSRA 1GZWB 4J19A 3OYGA 4QPGB 1O3TA 4AFMA 2R49A 5GAGJ 2LH9A 3RPQA 4TZDA 5L19A 3PTRB 4WVZA 2RQQA 2BNMA 5JLWA 5CIRA 3A7QA 2M5WA 1BR1A 1SAUA 2HZTA 4AF9A 2LF7A 5GZDA 1NY72 2QUFA 2VNRA 3BB6A 2ZHLA 2L54A 2OUMA 3AKTA 3Q8FA 3O12A 4UUSA 1CVNA 3ZPLA 3L7WA 4LHSA 3AM2A 3OYWA 4G12A 1LKNA 4QLCU 4PJJA 4X6AJ 4I02A 4HVQA 5LBBA 3E6MA 3QBQA 1RUE1 3LFIA 2KP6A 1IKQA 2EFQA 4DEQA 3OR2C 1VTNC 1VQ4I 3RI8A 1ETOA 5BUVA 2D2WA 1QO0D 3PJYA 4QB1A 1ENXA 1P7JA 1TMF2 2PEXA 3SDGA 4ZYAA 2BGOA 2D7FA 2DCYA 3ZRGA 4LK1F 5C8WA 3QAHA 1MMNA 4MGQA 4RL7A 5CKMA 3JRHA 3T0BA 5C9AB 2GSYA 1BBT1 4ZU5A 4XBFA 2BNOA 4UI9L 1QZZA 2J1UA 3CESA 3CDHA 3NNGA 5HV0A 1OBNA 1IZ3A 1HQCA 4H14A 5M5XJ 2MLKA 3WY6A 4A0ZA 1V4RA 2RREA 4A2UA 4KU8A 5DD8A 4XJ8A 4BH9A 5FPZA 2Q1ZB 3RPUD 3VFZA 2O5RA 1PK6B 1XPWA 4GZ9A 4Q4ZF 1XXNA 2ZX3A 4P9XA 2W00A 4CSWA 2VD7A 3A4UA 5B4NA 1OA2A 3HSRA 1SFUA 3REOA 1FNYA 2ZEXA 4BHBA 2YSRA 2W47A 2VNGA 4GALA 1LR5A 1LNSA 1QGLA 2HXOA 2ACJA 3DEUA 3OGSA 4EN7B 3GXUA 1IV8A 4KDPA 4EGYA 4EV0A 3J9SA 2ORZA 1UF2C 2ZAAA 3QQAA 2NS7A 2EAKA 1YI9A 3ZMSA 3NAUA 5JMCA 1PJRA 1PO12 1Y9QA 3LL7A 4IEWA 2YBSA 1TQIA 1R00A 2AZ5A 4JGYB 2VJJA 3GGLA 5K0UB 3ZQIA 1A8MA 2J1AA 1R1TA 4EJOA 2KKOA 3LZZA 1MS4A 2FOKA 5HCAA 4XXPA 5JSRA 3H50A 2GA1A 1KQ9A 4PK4A 1DZTA 4CYCA 4LXLA 3HNBM 2XR4A 5IVEA 3HAGA 3HBLA 1KU3A 4NIIA 1A35A 5K7FA 4A12A 1JUHA 4MVTA 4PLOA 5KK1A 2WABA 4D7SA 2V9PA 1BL0A 5JXJA 4NROA 2JA2A 2YFZA 3LWFA 4QKDA 4LK0F 3UK9A 4HNVA 2XPVA 3S57A 1H1AA 3QPTA 6PAXA 2IGMA 4R9BA 4IJAA 4XFGA 3PHMA 1ZA4A 4OIQF 4BB3A 3MZHA 1W9SA 3BG5A 4HSRA 1STMA 4CDUB 3VL9A 3PL0A 4AEJA 4BQ3A 4J1XA 4RB3C 4U0WA 2XDVA 4PIZA 1T95A 4IGPA 2JJ7A 3Q8CA 4CDGA 2E60A 4QPOA 3FHQA 3JCUC 4MEYF 4GD4A 3USUA 2KRHA 4J6GA 3H3VK 1LHNA 5H20A 2E51A 2FJ1A 4AXOA 5IYDJ 1S2BA 2QCSB 1HX6A 2EXKA 2BZDA 4P14A 4LB6B 1FC3A 2P0WA 5CPRB 2V1XA 4EMSA 1CJPA 3M07A 1JOJA 1AJKA 1AXZA 1HBXG 3TNQA 2JG8C 4XKVA 3NWTA 4TLGA 3JRGA 1MZBA 2Q0OA 4JX6A 5BPIA 1V55H 5LGNA 2RM22 3LDKA 2Y75A 3FJSA 3R4KA 5IFTA 2KQRA 3JR9A 2Z16A 3VD9A 1RZ4A 3MIDA 3TO9A 1U0AA 1Z78A 3MZYA 3G7DA 2QJVA 3N4MA 4OIRF 5J40A 5A1AA 3MICA 1VQKI 5GPCA 3MUY1 5DUVA 4RDUA 1QH7A 4FCAA 3C1DA 4JQFA 3R61A 4QGNA 4ZS2A 4D7YA 5E1XA 1OPMA 1I1GA 3BR6A 5D2AA 4Y5SA 2NN8A 2VJIA 4QXHA 4KICA 4BNCA 4EN6B 3ZMDA 2O0YA 2WZR1 1SLTA 1QOTA 5F6LB 2CQQA 1NK3P 1RUE2 2RAEA 3TN91 5CYYA 1S29A 4B8XA 4GKXA 1SZBA 1B72A 3WP3A 1W8HA 4MHGA 3T0YA 4QX2A 3F8BA 2VW0A 2VOOA 3DCQA 3ZYBA 4CEYB 4M9SA 4PDWB 2YBKA 1OKRA 1UY1A 3ZQFA 1U5XA 3HOBA 2ARXA 1BBT2 5FZBA 2AR6A 1S7EA 1OKQA 4HLYA 2Y6FA 4RGUA 4B48A 2C6YA 1O7LA 5FDBA 3BJ6A 2L3DA 3BG3A 4XILA 3WF4A 1VI0A 2P3IA 2VBDA 3M8JA 4KN4X 1PNFA 2P4WA 5JIAA 2IS4A 3AKZA 4ISQA 4QHBA 4OHXA 4ZU4A 4W6WA 5E8AA 5DM7F 2YC4A 4HW0A 2KZGA 5CU1A 3KP7A 3ME2A 4ASLA 2DK8A 1F1ZA 5A7WB 1UNBA 5I0UA 1WLTA 2DA7A 3FMGA 2JA5J 1YIJI 3ZSMA 4QQOA 4B47A 4E4SA 3BR5A 4YELA 4WM8A 2OA4A 2GLOA 4JTNA 4CU7A 1IV6A 5CG8A 5JXHA 1DP0A 3VPRA 3MD2A 1SMVA 4XF3A 4NB5A 3QP5A 3DWLE 2X5IC 1W9WA 4RFT0 2ECCA 1RUI3 2XAHA 5FYSA 4IQJA 2R7ZJ 2WWUA 4HLXA 4JQRA 2ZGLA 3L1PA 3FHZA 3QPLA 1R1A3 3VODA 1BLZA 1HIXA 5J98B 2XAQA 1IG7A 2BTVC 1ZK8A 4E2GA 4S0HB 1DP7P 4NE9A 5F1JA 4Q4Y1 3N9QA 5CVIA 2Y0SN 1KONA 2NZ9A 3TEZA 4AVAA 1AR83 2XRLA 1Y6IA 4IKFA 3VDDC 1VQ5I 4HG6B 4Y15A 3EBRA 2WL1A 2RMU3 1L3LA 1NCQB 3R0AA 3CCQI 1MZ6A 3LFUA 4I99C 3FFZA 3VDDA 2CJJA 5ANQA 1KYWA 1AX0A 4AEDB 3DYPA 2DT7B 3A02A 4O5VA 5T50A 1QWRA 5DDGA 1Z91A 5H9SA 1XB4A 1UL9A 2JG9C 4META 4FPJA 4XRSA 3BOWA 5A7PA 5F0HA 4IE6A 4P9LA 3ZVXA 3N97A 4AFDA 2JE9A 1OCCH 4L8QA 3W58A 1C8M1 2E19A 2YU3A 3KEYA 3S7IA 4A41A 1LPQA 2VJ5A 4E7HA 4WVMA 2P7CB 1YE9A 2MW8A 3OOUA 4RB2C 4WXCA 2GXBA 2GNTA 1RHI3 4ZZ5A 2ZFUA 1GV9A 5FYYA 4XOGA 1YTYA 4A6DA 2W24A 1V9U3 1WHUA 1YXWA 2C24A 4LORA 5J6XA 3BJOA 3JB8A 1DU3D 5LD2C 1CN1A 4XVHA 1R1UA 2IGKA 1LHOA 3WDYA 3IIAA 2J1TA 3JD73 4ZZ8A 4A3LJ 1ULPA 2Q2EB 4RR3B 1YQ6A 1QJEA 5FYZA 4DRRA 3URFA 1WJCA 1JHFA 2B0LA 2MFZA 3CCSI 3HOWJ 2V6CA 2DYSH 2AH2A 2H6CA 4OMCA 4ZDPA 4HYEA 4WV8A 1ETYA 3BJAA 4Y13A 2H27A 2WFF3 3I59A 2GMPA 3K4CA 1PM4A 4OYUA 3WEZA 3QPSA 2XL9A 2HYXA 3DKXA 1G4DA 1K5MC 1S4CA 3ABTA 2VMDA 2BY2A 1X8MA 2JDNA 1Q56A 2OKXA 2LMDA 1VQOI 2WZR2 2O8QA 1MMDA 2YC2A 2IUWA 5JR3A 1V00A 3L2VA 3JQWA 1EY2A 2VQCA 3FKIJ 4FTEA 1O4YA 1FOWA 3FXMA 3TN92 2ZTNA 1NA1B 2AS5F 2P4EA 2XJRA 4BQ4A 3OYBA 1CAUB 1R23A 3JAMK 2X4HA 4QU1A 3CF2A 3I3LA 1ZQ3P 2IFWA 1OCPA 4ASNA 4BE0A 3RWKX 2DCJA 4KIBA 1RVF3 1Y0UA 4XTPA 5B66C 3D5SC 4A45A 3LQRA 2IXCA 1TME3 3RNSA 1X2NA 2B9UA 2HDDA 1G9DA 1AR91 2YGLA 2HKOA 2TNFA 4FQZA 5FY9A 1JOPA 1EH6A 3S93A 1ODMA 1ULGA 1LE8A 1KDKA 3F72A 4KWUA 5GM0A 1TT0A 1ZR2A 1QJU1 3AP4A 2XKOA 4BQQA 3I2DA 1MJAA 3HHGA 2OQRA 4K20A 2B7EA 4AEKA 3BTZA 3RKXA 2R5ZB 2ZBJA 1XE8A 2ZKZA 4V1PA 4MGZE 2DPDA 5M5YJ 4BE1A 3O0VA 3LSGA 3OY8A 1O5UA 4LA2A 4PSXA 4M3CF 3CU7A 1FMVA 3B5LB 1UWWA 2P37A 2GXGA 4ZC3A 4F55A 5D21A 1LENA 4PGHA 3H9JA 1X58A 2V7FA 2FZ2A 5FO5A 3MKYB 4DQ2A 1MPXA 4KN7X 1J7KA 2ZGNA 5FO7B 4EM0B 1A78A 1QQP3 3MN2A 3WTTC 2FDJA 2XHKA 3ASOH 2P6SA 4BQWA 3CMGA 1ASJ3 1LHVA 4Z92B 4IOCF 4Q4Y2 3HNMA 3OL4A 2XF5A 2YX7A 4ZONA 1AKHB 2BWCA 2D44A 5FRNA 4LGWA 1ZBE1 3DLAA 1MZFA 5FUIA 2HR3A 3CJRB 3QWLA 5LATA 5L7OA 3M2MA 2BBAA 2HH9A 2PTMA 1NHAA 4E7ZA 4LO5B 1GR3A 3VBHA 2EK5A 4A4AA 2E1OA 4JGZC 4RGAA 2M7BA 3IH4A 2IJLA 3CZJA 4RFRB 3SXWA 4XCAA 3EPZA 5CBLA 4ZYHA 5ISLA 3ZXJA 4ASMB 4RS8A 1H8VA 3I53A 3LIGA 1X50A 4F91B 2WS93 5HLTA 2B8MA 1IXSB 2YU1A 1WW6A 1C8M2 5DAWA 2PHTA 1SVOA 3LB9A 4QB2A 1MEC1 3OYHA 3OPZA 2PHDA 4DNYA 1MQTC 4GXOA 1E3PA 3KZZA 4C3IJ 4IGQA 1OLRA 4ZDOA 1FTTA 4IL7A 1DYPA 2LBFB 5CVUA 3LSDA 2DU9A 2RDPA 1HXS1 1AWCA 1SFNA 5GADJ 4HPKB 1POV0 3KP6A 4GO1A 4HPQA 4XBQA 3N7LA 2Q8OA 2BVVA 1HJGA 5FR3A 3M3YJ 1DGRM 1QNWA 3U4XA 3K2OA 4AGVA 2X09A 2L9SA 5FRMA 3ITQA 2KM2A 2PYTA 4I6ZA 4Z2AA 2A73B 2Y30A 1TE1B 2EA4A 1FOKA 1TMF3 4NBQA 2OD5A 1GP5A 2LUWA 4C2MJ 3ZFGB 1OF4A 4Q47A 4MTDA 5JVGF 3ZR5A 2XWJB 3F8FA 2JG8B 4NMIA 4BCUA 3SHRA 3ZN6B 4L92A 3P5BA 5JWPA 1OPCA 1Y9MA 3ZFEC 3VBOA 2JTVA 1WA6X 3MKWB 4FP2A 2PQSA 4K2EA 3ABKH 3PO3J 1J3QA 5H9QA 1JYXA 5KAFC 1FBUA 4UW3A 5F08A 3KZIC 5ACA3 2W1SA 3U0ZA 5FJKA 4A0XA 4CUGA 2SBAA 1Y43B 1GANA 1PNGA 4CXFA 4XR6A 2OQ7A 1V6JA 1ZHFA 4FX4A 3TDZC 2J7MA 1OCTC 4HNUA 3SHFA 3ZDSA 2WRAA 2ZS6B 4D8MA 1AL21 5BXXA 2BQPA 4I0WB 1LFBA 1GKBA 1JU4A 4LULA 4K6BA 4LHNA 4IOAF 1K45A 1IG3A 5CVRA 3LSTA 1AR92 3V7CA 1R7JA 2MBFA 3KV6A 3WW2A 2C9KA 4R1HA 3I4MJ 2K85A 4XZPA 2A70A 3UGFA 3ZPOA 4MHRA 1Y1WJ 2ZGRA 3OYFA 2YXSA 5IK8A 3P6BA 1PP8F 2X6YA 5DAQA 1ZH5A 3MW3A 4WVVA 2GOMA 1HDDC 4EEFG 3TP0A 3DYMA 2K9LA 2E5NA 1H2KA 3ZN4A 2FBIA 2LR8A 1QJU2 4LLFA 5AC91 4E4ZA 2L01A 4TSVA 5A33B 1E0EA 1UY0A 3G6JB 1PIV3 1Z7UA 4AIJA 4E9KA 1V6LA 2ARCA 3N9NA 1YI7A 1JI6A 1YFHA 2YBPA 2CUJA 3UKTA 1BJZA 1KU9A 3SITA 2ESHA 1VRH1 3WG9A 3WLUA 2OIIA 1FLIA 1T8IA 1VQ9I 3SCHA 3I9V2 3I5UA 4S2GA 3S17J 1FJLA 2BOIA 1WD3A 3FWEA 2GIZA 2DV9A 1C4RA 1XYNA 1OKOA 3FXUA 4HBNA 5DUXA 4YSFA 3FMRA 3NARA 2RS33 3BQZA 5TGTA 3S7EA 3ETPA 2QQ9A 1ZBE2 2MC4A 5LGTA 2PMUA 1D7PM 2DCKA 2ZGUA 4QX5A 4AHYA 5EWSA 5B2GB 3LA3A 4G8XA 4XLNF 2ZX4A 1UCRA 3UGHA 3FZ3A 5DPNA 2RM23 2WQ8A 4ZDLA 2F5FA 4YGDA 3K4DA 4BM8A 4MSVA 1IW7F 1S7AA 4KYWA 5JSOA 4QT6A 1H0BA 1IN8A 1J09A 2DJIA 2LNBA 1QVUA 2R7RA 2HYKA 2XB6C 5FZ6A 4CCKA 4O65A 4CCNA 4AGRA 1UY4A 4BXSV 3WHBA 5F3EA 2ZA9A 1AYM3 1IGOA 4YG2F 1MS5A 1MEC2 5JVVA 3PQKA 4COWA 1JUSA 2LALA 2VC1A 3CMMA 2QTWB 4OULA 3VBUA 4L9TA 5E3MA 3JRBA 2P8TA 3O8HA 1HXS2 5J1UA 2M7AA 3PVEA 3H3UA 5JXGA 2WV1A 3FXKA 5F6FA 1S0BA 1ETKA 2JG9B 1QHDA 3MO4A 5FLJA 1FNZA 2LW8A 3R4UA 1NA1A 2DMQA 5A32A 3CDLA 1CAUA 2RNGA 1RMU3 2HVQA 3K1NA 3C2HA 4P08A 5H2FC 1XC5A 5FMOL 1CGPA 5JAXA 2ZACA 1QOSA 3CJIC 3M8FA 2JJ6A 4H2AA 5FK7A 3JB4C 5CVVA 1LJ9A 1Z7S1 1OA4A 2WY7Q 2FSWA 1JZ7A 4AVPA 4JCKA 1TQMA 3LSIA 4JRLA 2DA4A 3WU0A 2W82A 2WNOA 1UHWA 1F4AA 1VQ8I 3CJIA 4JTOA 1ONAA 4YARA 2D5HA 2DTZA 4DYRA 3BTJA 4FPGA 4FOWA 2M4GA 5DCMB 1N3OA 4YVWA 3GTLJ 4JKLA 1U9NA 2DBNA 1XDUA 4CPBD 3EUAA 2GH8A 4PLMA 3QP6A 1NE6A 2PLV1 3FDYA 1GQPA 4AAXA 5FMOS 2XPWA 1BK1A 2DDUA 3NV3A 2RVCA 4XF0A 2WT2A 3DTIA 5LK5A 2JVGA 4IZZA 2JEMA 5J3UA 1K79A 1J1LA 1H9PA 2PMWB 3F21A 3MEPA 5BNOA 1AL22 1VBA1 1WBFA 1OQYA 2VOTA 3ZXDA 1UY2A 2JUCA 1IQDC 1HKQA 1EPWA 4XF4A 4Y20A 1V5EA 1L7QA 4ET7A 1K5MB 4JX0A 4OI4A 5FPLA 3I3QA 2YDEA 5LA0A 3PUIA 4YGBA 1Q8SA 1IG0A 2AXLA 4M6XA 1VMJA 2CGNA 5JDBA 2GH2A 2OQ6A 3PJQA 4LUKA 3CDIA 3T8RA 3NV2A 3WW4A 1POV1 2JA6J 1KGYA 2R7VA 3OUJA 3MFCA 2CU5A 4QDSA 4QKFA 3K3NA 5AC92 3UR3C 5CKQA 2FNPA 5EV7A 4XDPA 2FDGA 4XIDA 5EG0B 2QF7A 4BDYA 3AG1H 5HOOA 3CCVI 1TNFA 1R71A 3V0BB 3HOZJ 3P3NA 3I0TA 4A3FJ 2PHXA 2X85A 1IN7A 5CFCC 1BIBA 3DBHB 4XUOA 1GLHA 2E63A 4H7MA 1BW6A 5F6KA 3A0NA 1VRH2 2FOWA 2LDUA 5CFCA 1W7PB 2WJSA 1YS6A 2LSOA 1HW5A 2WYSA 4E4HA 3O3KA 5IOYA 4M0NA 5IJRA 2B5HA 5A80A 4CP1A 2A6YA 5I0DA 3VEPA 2LM3A 1VB4A 1WD4A 2K4JA 2RV8A 3M8EA 2XXZA 2Z5WA 3RJRA 1RUF1 2R1BA 2DTYA 1IXCA 2DMPA 3K70C 3BTYA 3GEZA 3ZXFA 5D8AA 1H2LA 1I1EA 1IXRC 2RS12 4IE7A 4E27A 3EO6A 3TRSB 1Z6RA 1AA7A 2P6HA 4NNJA 1I27A 2EV6A 2HEOA 5FZOA 1UU6A 2LLKA 1FP1D 1BQPA 2BY3A 4I3GA 4G3YC 1NX9A 4RHV2 5FKOA 3TOJA 2P3KA 3E5QA 2Z33A 1QXPA 1FT9A 1B59A 1FIAA 4Z2YA 2E7TA 2NMOA 1D5YA 5LWBA 4FPOB 1RUNA 1STZA 5LCWL 1EV13 5BQTA 5E17F 2OTJI 2ES3A 2HNHA 4EWAA 4XFCA 1XNKA 2CSGA 2W3JA 4IE0A 1OYIA 1X4PA 5ICCA 1YRZA 3VWBA 1U0JA 3GBGA 3R0RA 4NC6A 4JGZB 2GXAA 4GIQA 3Q8EA 2WAAA 4LOSA 5F1RA 4HEA2 3AKSA 2W08A 2J1VA 3WF2A 4HAMA 4UAPA 4QM8A 2A6HF 2WTEA 1GSLA 4ARXA 3BTCA 4A44A 3CQOA 1KA8A 3C18A 1B1BA 2FXAA 4HA8A 1DPRA 3K4BA 2VCCA 2JA8J 2IXSA 4K9SA 1YWKA 4E7IA 4IHXA 3P9IA 2PN5A 1MQTB 2DBIA 3V4GA 2FF4A 1GDTA 2R7XA 5JZGA 2ZJRF 1Z7S2 4Z2WA 2KL4A 3RYPA 3Q9SA 3NJZA 4BE2A 3I55I 4R4ZA 4DEVA 3BQYA 4D0PA 1K42A 3HBKA 2YU9J 5HDGA 4AYUA 3AL5A 2GC3A 3V65A 2G9ZA 5C4WB 5FYUA 2VKDA 3MHZA 2GOXB 2NAZA 2O7OA 4Q0PA 4K8RB 1GT0C 5D8LB 1ETVA 3FK6A 5F3IA 2PLV2 1SEFA 4FXGB 2EJRA 2GP3A 4ZPIA 3WNPA 1W8FA 3RGBA 2JSCA 2IXLA 2B9SA 2O3FA 5E88A 1AYN3 4Q4W1 2WZEA 4AC0A 3WHUA 2JDHA 2R061 3SZPA 3NJVA 3GYDA 4LA3A 5F5QA 4DOZA 5GAHJ 1E5SA 1PGSA 5FQ0B 2R0HA 1AJOA 1X4OA 4I98B 4XLEA 5IVYA 1VBA2 2E7WA 4FO9A 4AGGA 4MUVA 3ZFEB 3APBA 5FKLA 4PZJA 4OHZA 5KHHA 2DQLA 4AI8A 4AQ6A 1SVMA 2ZHNA 2BRTA 5T55A 1QHHD 2Y6HA 3JREA 4KT5C 4MQVA 4P9YA 5K7HA 4CDQA 4YW1A 2XG3A 4XHXA 1HDPA 3C7GA 2V9VA 4LK7A 1DYKA 4J1WA 2FMLA 3MFKA 1MACA 1W8WA 4C91A 4XM3A 1OMIA 5HLIA 2GNDA 4PLNA 1HV1A 4YPJA 5FPAA 2W1UA 4CA9A 1DUXC 4V2WA 4BQ1A 4XL9A 3ZOIA 3ZSKA 4Q0QA 4LO6B 3H92A 4YFXF 4HN0A 5L3GA 1N1YA 2NS0A 3OOPA 4A3XA 4NRPA 3HHHA 1TP4A 4KWKA 4FPHA 1G9FA 2F4PA 2XJUA 4FHTA 2GBYA 2JKBA 1US2A 5F3GA 2QNKA 4W97A 3OS0A 3FXJA 5C5UA 3J7YJ 4GWMA 2DDAA 4M3DA 1YW8A 2RJKA 2PHUA 3MCZA 1RUC1 1W6PA 2VECA 2DQRA 4EN0A 3K1MA 2CSOA 1YRNB 1RUF2 4AFCA 2Y0SA 1SLCA 3OSDA 3OJBA 3S6PA 4N7IA 1ORKA 4II3A 4Y5TA 4BQ2A 4PSWA 2BOJA 1BR2A 5A3OA 3ZR8X 4C9YA 2J1EA 4A69C 1GOHA 2EXIA 3ZYRA 4W6YA 3PVOA 3DPRC 1LEMA 1ZRDA 5DUUA 4Z1VA 3WNKA 4IEJA 1SLIA 2VR4A 4D1QA 1XSVA 4LT5A 2JENA 4EZHA 5FBJA 3CCYA 4M6VA 5LA1A 1GXQA 4PIYA 1OLQA 3HYIA 3F23A 1HDKA 3WTVC 3AKRA 3K7AJ 5JOZA 3TEXA 4DJAA 1WMDA 2XQXA 3A22A 2MA3A 3ZN0A 4AQTA 3CLQA 5C5TA 2R041 3RSJA 2VCBA 4IPAA 1A6IA 1NXMA 1E5IA 4XQWA 5ABJC 2G7HA 3B94A 1B9MA 1TVGA 3HIFA 2IP2A 1FBQA 3AVSA 3JZVA 2K5CA 3ULQB 4ARYA 4URAA 2LTNA 3AZWA 1MD0A 1XC6A 5EGOA 2W94A 4R9AA 2HWF3 4FFIA 2R0QC 5JOXA 2G9GA 4SBVA 3HB9A 1MH3A 4YM2A 2AYHA 2VZTA 5FY1A 2FDFA 4NIHA 4AR2A 1OLME 2K0GA 1PDNC 3LQCA 2ZBKA 3EJKA 1TL8A 4PFOA 3RQ4A 1OQDA 4Z07A 1EPZA 2YG0A 1JUMA 2NS8A 1FTZA 3AXEA 2DUPA 4HKWA 2ZX0A 5KHDA 2FCUA 4LBOA 4IHSA 4WM7A 3MIBA 2QEXI 4A7YA 2Q0AA 5IWFA 1PUFA 3ABMH 2KLOA 1REDA 2J1RA 1IJWC 4NRMA 3JAMZ 3BP8A 3V7RA 1O3RA 3H5NA 3A21A 4IE5A 2NLRA 1PVC1 2DYRH 5A70A 3CLOA 4RM2A 1R5ID 5B1AH 3MBWA 3S2WA 1AR93 2PBIA 3WTXC 2WFPA 2X29A 1B35A 2KISA 4AHXA 4CP0A 4J01A 2OA2A 4A3BJ 3R4SA 4Y1XA 3V7SA 1B09A 5IPAA 5EG0A 3W5MA 2XH6A 4BJTA 3I2KA 2LREA 3N05A 1UZYA 2VCAA 1SFPA 4GB31 1U12A 4Q0UA 4Q4W2 1QJU3 3LAJA 2QBXA 4OOIA 2RC4A 2R062 3O0XA 5FP4A 4MFDA 4WF2A 1XGOA 4YW7A 4Z8BA 3SMHA 3PUSA 2CDPA 2DYCA 4B4QA 1HRV3 1Q8OA 3T1MA 2ESNA 2JA7J 1WLWA 3AZYA 1OD5A 4AYBN 4YFZA 3RFRA 3N7MA 1W6MA 1N75A 2GWRA 1HW2A 1VBD3 3GUDA 5KWRA 2HU9A 4QX7A 2XONA 3HL2A 1J59A 1HOMA 4AU7A 3UJQA 2KDZA 5FKCA 3B6AA 4XF1A 4I7HA 2OZJA 3IB3A 4XCBA 3TWIA 2ZEWA 1IUFA 3WGHA 4RB1A 1O91A 2GU9A 1GP6A 3BOPA 4LITA 2PHRA 3X29B 2P5LC 1UN1A 3E1SA 1YJWI 3WE2A 2P81A 3K3OA 1NXD1 3HQUA 2L9LA 4OI1A 5E1RA 2V72A 1ZBE3 3B7MA 5LLQA 1VBB3 2IGNA 4RGRA 4OAZA 1W03A 5F64A 2DA1A 2JDZA 1BHGA 5D5VB 1DQ0A 1HRI2 2ERFA 2NVXJ 3LSJA 4YZ5A 4M3CE 4HF0A 3GVAA 2ZFWA 2XOMA 4TN7A 1KQRA 3VBRA 3F95A 2EINH 3QODA 4YW5A 2OC6A 1T6SA 1ND3C 1RUC2 4XOTA 1OF3A 5HODA 2VTXA 1RUG3 1HB1A 4OMDA 4EN9B 2XGCA 1N3PA 4P9GA 1FZPB 1MBGA 2ZCWA 2PHFA 1J0RA 1COV1 1DQ2A 2E34A 3P5JA 2Y6LA 1GP4A 3HRMA 3WX5A 3PLQA 4E4DX 3HKZA 2VVFA 1F36A 3MMYB 5DAPA 2Y31A 4RQPA 4A5MA 5C3QA 3SQNA 3PMSA 3LAGA 5J96B 3CCMI 3B69A 3NMBA 1CF7B 1I3QJ 3ORJA 1HXS3 3TO7A 5EYYA 5DS9A 3TBIA 1UG0A 3G3ZA 2BY0A 2BVBA 1UG2A 4WK8F 4KUMA 2HWC1 1O8SA 2JDKA 4U0YA 4LO7A 1QVTA 4YW3A 2ZSIB 3HOVJ 4NDLA 2QQIA 4P55A 3FUQA 1PMIA 5ILSA 4IV1B 1MS1A 2ZGOA 4UF0A 5IK7A 3J7AO 4JAAA 4CZZA 3HVDA 3TQNA 2XGEA 1FX5A 5K8SA 5C4WA 1R49A 2R042 4OHVA 2Y34A 2P5BA 1AR63 1RUD3 2WLQA 4EQVA 5A7QA 1QXJA 1LOFC 3E6BA 3U10A 3I54A 3MIHA 4Y33A 4CHUA 3NAPC 2CMPA 3WUCA 1WCMJ 1HXDA 1XNAA 2HWB3 4Z82A 3KHCA 1WQ2A 2VMHA 5IP6A 1MS8A 1DQ6A 3E5XA 1US3A 3QH6A 5A6XA 1K83J 3CBNA 5BNNA 1J5YA 1ZARA 4LFUA 3Q0UA 4IRGA 1G86A 4A6OA 3U1KA 1S2KA 3W59A 3AKPA 2NNYA 2PHWA 2CNAA 3K4NA 2BGPA 2VIXA 3O14A 1VQNI 2ZO4A 1U6GA 4QHOA 4NQWA 3OIQA 2STTA 2YR2A 4WWCA 2I8DA 1QMJA 3KF5A 1KEXA 2ZHMA 2R92J 4JX4A 3HOSA 1PVC2 1ZN2A 4NHKA 4YW4A 2ZMEA 2WNVC 4N43C 2RJ2A 4A3IJ 1IHMA 1DGRA 4CZSA 4LLNA 2IAIA 3O5SA 3WXPA 3NQOA 2XGDA 4N4NB 2LRPA 4LMFA 1LDJA 1TNSA 3I56I 5FPVA 5FZKA 2QGUA 3GF6A 4I3PA 3BIEA 4XJAA 2KR2A 2FD5A 2HI3A 2WNVA 3UKGA 4DW6A 1YCIA 1XRUA 3OD4A 2ETHA 1W6QB 4GB32 4P9UA 2VBPA 3UESA 1TWGJ 3CJQB 5FZ7A 3ZSEA 4L5EA 3OCPA 5D5XB 2CO5A 5T5OA 4B29A 1O4TA 5IT9K 3VYUB 2M9HA 2Y6KA 2EZKA 4NUBA 1IRZA 2DBBA 1GXPA 5KR7A 1QJZA 4D3WA 2OVUA 3I4NJ 4BJ6C 2LFBA 4LG0B 5L9VA 5IT3A 4HV5A 2KFDA 2R071 3IMNA 1A3KA 3R6SA 4EJTA 1HQNA 4NIDA 1VRH3 1JXNA 1S0FA 4XICA 3PVBB 4YG3A 1WH5A 2JIJA 4MGYE 5HS8A 5JSPA 1B8IB 1RR8C 2ZHKA 3VZMA 2WDBA 3R4DB 2MG4A 2IGOA 1ND2C 2WC2A 4DZJA 2A3XA 2IFRA 2UXNA 3LEMA 2A5YB 2VJ4A 4XUNA 4FPKA 2K40A 3NL1A 5L3FA 1X3ZB 4E8DA 2DF7A 4BXFA 4ZHNA 4XKBA 1I3HA 2PFBA 3EYYA 5T5JA 4B4CA 5A6YA 3V56A 2KHMA 1IN4A 2ZEYA 2DOFA 5IVVA 2BW3B 4UFKA 3KQ4B 5FV3A 5CFDC 4Q4V3 1WZ2A 1VLNA 2VUMJ 2YPJA 2YGMA 3ZFFA 4DQAA 1WBLA 1FEXA 1KYZA 2DXIA 4O61A 1SMTA 4GMP0 2X10A 5GLVA 2XVCA 2BGCA 2EICA 2CWMA 3L00A 2VXZA 4BL0B 3P3PA 3POEA 4MADA 4BBRJ 1G7YA 1COV2 1HA8A 5FLHA 2WUHA 3CCRI 3O0WA 4KL1A 2MGQA 4BAYA 1RITA 2RV9A 3I4PA 3HPHA 2FBKA 2FRHA 3ERMA 2X9DA 1VR3A 3HOUJ 1FY7A 2VE8A 5HCHA 2BPA2 2JMWA 3F3XA 3N7KA 3K4KA 4BLIA 3CCJI 1NLRA 2HWVA 2HWC2 2HS5A 4YIRX 3RZLA 2CV2A 1W1WE 2E7AA 5JVTA 5F9TA 3MIGA 1WCKA 2F5CA 3WNNA 3SXYA 1CAXB 4GA9A 1SHWB 4ZS3A 2VOKA 2DO7A 2ADUA 1D0HA 1L7RA 1APLC 3ZDVA 5FJ8J 2A6TA 1G8WA 4HXCA 1Z7S3 1JZ2A 1W7PD 2DWRA 1YFXA 4JV4A 3M70A 5CEHA 3DPRB 3KP2A 3OGGA 5GZGA 4MX3A 4E70A 4G6QA 2EIBA 4NHXA 4N9HA 3F8CA 3GALA 4CDXB 3ML6A 5HV4A 4K21A 4CU6A 3HDDA 4URTA 3IV5A 4CICA 4R52A 1T38A 1HJFA 2AACA 1FMD3 3KF3A 5FOBB 1E17A 4DINB 4NJ4A 3LD8A 4ZYEA 2D5FA 3VYTB 1U5ZA 4XMIA 2O8OA 3U21A 3T1LA 3BUCA 4QPIC 3ECOA 1ZREA 4ENJA 1W9FA 2JXAA 3CF5F 1R36A 1NTCA 4CE8A 1C28A 5APAA 1P8JA 5ABJB 2PJRA 4QWNA 2WV0A 3G6EI 4DUWA 2R93J 3I58A 3H9AA 2A3YA 2YZ4A 3IWFA 5FMBA 4F8AA 2GMEA 1VQMI 1YFUA 1Y0NA 1WSUA 1TQ5A 3ZQGA 3B9CA 3IUOA 2C9AA 1JKRC 4FPLA 1YI2I 3MAJA 4OAYA 3QLQA 3GFLA 5A6QA 4DYCA 4BDVB 1YO5C 3LPFA 4JDMA 1LU1A 4KGQA 4Y22A 3VBSA 5HS7A 2JN6A 4MYEA 3Q0WA 5KVRA 3M3IA 3AYCA 4EJRA 2ZJ2A 3AC0A 5J4YA 5LRSA 4NO4A 2E7QA 4L9VA 4AVSA 1X19A 4BQOA 1WMXA 5ILUA 1D8JA 3AYAA 1R64A 2VT2A 2EIMH 1AOYA 1X33A 4CCJA 2ELJA 1K6OA 3AMQA 5JUVA 3ZIXA 2UXXA 2K3FA 4QSHA 3S2DJ 3OEBA 3QU6A 3CEWA 2Z5UA 3GZNB 4E2QA 3KT1A 3VHRA 2G9FA 2VAUA 2MNGA 1P6RA 4CDWA 4B3XA 4Q8KA 1AUYA 1RXGA 1MBKA 2R072 3HPNA 4HSLA 4FSJA 3F22A 4N90A 2M3AA 3M3CA 1ZG3A 2EIKH 3OS1A 1J3RA 2H6BA 4I01A 2RS53 2FCVA 3FE5A 1IUYA 3HG9A 3QYFA 3ABLH 1DG6A 4MXVA 2VZPA 4I30A 2ZGSA 1ZGWA 3VKOA 1FWZA 3ZMTA 2XB5A 1JMUB 2ZABA 5FZEA 1REFA 1ON1A 3FN9A 4IHWA 4IHYA 3WDVA 4IQ4A 3H35A 4HV6A 2DFEA 3DXJF 1UMIA 4RS5C 5IVBA 2B46X 4XAAA 2AQEA 4YVSC 2Y69H 2QM3A 1Z0HA 4Q29A 2JE7A 4IRHA 2HKXA 2WZ8A 1CAVA 2JWTA 1U8BA 1ODNA 4QGLA 4RS5A 3UGGA 3RPUA 4YVSA 1VIWB 3D0SA 5CZKA 2BBVA 1W6NA 3B02A 2CWSA 3S5AA 3ZMNA 4IXLA 4MV2A 1OT5A 2MH9A 1U5YA 4PI2A 1ON2A 3WNOA 2M2EA 3ACHA 5BNPA 2H8RA 3AFGA 4KMFA 1IQAA 1GICA 5D4SA 4XIKA 1LOBA 3OL3A 3AAFA 1K78A 3ZXAC 4X1EA 5L3DA 1WI3A 4LBQB 1OH3A 4Q4X3 1GUUA 3OTFA 4DO0A 5A1LA 4X8PA 1FAYA 2WNUC 3KWVA 3PNYA 2W1QA 2G0EA 2VZ3A 5FYIA 3S30A 1UMZA 5FPUA 1W2NA 3IDEA 3HJRA 4N53B 4AVTA 1RB8G 3HSFA 1H2NA 3PUAA 2QQKA 4AI3A 1ND3B 5DCFA 5FP9A 3NNJA 4PF1A 4P1WA 2WNUA 4QKBA 4HX7A 3E0JB 5CB7A 2VI6A 2UURA 3CIHA 3SFIA 3S2HJ 3FISA 1HSTA 3G2BA 4QQHA 2VXRA 2Y6JA 2P5VA 4IEOA 2MPFA 2E31A 2K3PA 3VYRB 1HQWA 3WDTA 3WTUC 3T5XA 1H8TB 1JKOC 2RE9A 1JZ6A 1ULCA 4OLLA 2YROA 3FUOA 3I49A 2B42B 2VZQA 1SLAA 2NVQJ 3ZP5A 3WU2C 2DLLA 3HBZA 1ZVFA 2X6WA 5CNAA 2NXNB 1UELB 4E7KA 3LGRA 4ZY9A 1D1BA 1F43A 3VD5A 2DJNA 3HOXJ 1UOGA 4AHWA 1WWXA 3H8RA 5C3RA 1J75A 4AE2A 2DCEA 2NYYA 3GFMA 1ZLKA 1MBJA 1PX4A 1HKSA 4Q4W3 5H9RA 4OIPF 4HT1T 3KP4A 1J9IA 3F6OA 4Q27A 3J81K 4MGIE 1VAKA 2JD4A 3H0DA 3NAPB 1W6OB 4QU2A 1C1FA 4GMP1 4HVOA 3OPTA 1S0GA 2OZUA 2A7AA 3WQ1A 4OU0A 1FATA 4XEZA 4N7UA 2WNEA 2NP0A 1OFCX 4JHTA 1L3JA 4RLQA 3RZKA 5A3LA 1XSXA 2OPWA 4LTAA 1QBJA 3ZQCA 4CUBA 9ANTA 3N9LA 3VZKA 2R7WA 3FFQA 3F2ZA 1D0ZA 1P9QC 3KP3A 5C8CB 5LHHA 2JKXA 3RI9A 1GLNA 4XDOA 2LTPA 4A3JJ 4RBOA 5FXWA 2HPIA 4XRSG 4XJZA 1NG6A 2QQUA 1EAH3 4FETA 4PDKA 1OVSA 2ZXWH 2A75A 1U5TC 1OOPC 5C4JJ 1POQA 4PT6A 5CADA 3N36A 4N43B 3ZSLA 3SCFA 1Q1HA 2XLAA 1R22A 3H5RA 3GHMA 3EUHC 3OB8A 4IGOA 1AXKA 4M3EA 2AEZA 5B4XA 2JDAA 1UAAA 5GJ6A 3TEYA 1LHUA 1WJFA 4M3FA 4LOCA 1W90A 3W2WA 2JB8A 1N77A 4P9WA 3NJXA 1F5JA 3ISPA 1TWHJ 2L5QA 1X1BA 5FYMA 4A3GJ 2PMZA 1TQPA 1E57A 3WHTA 1LTEA 2GC2A 5B5EC 1WFXA 3K1PA 2EIEA 1FOD1 5F5AA 1WRJA 1NH3A 2D6MA 1JYVA 2IS6A 3LEGA 3VBFA 5CYVA 2PJPA 1OUXA 1V6IA 3HUGA 1UQXA 4P9IA 2ICWG 2IA0A 1Q3EA 3M9AA 1UFMA 3WF1A 4LHKA 1ZZ9A 3BTLA 1HN0A 3SFZA 4A3KJ 5JXIA 3KETA 2E1MC 1ND2B 3ILFA 2JRMA 1YW7A 2LP0A 4KG8A 2FX0A 5K4LA 3THCA 1REPC 2TRTA 1KZHA 5EFUA 4IETA 1WMEA 2M8EA 2NRAC 2KT0A 2QQVA 2R7DA 3WCSA 3IDAA 2BE5F 1FMWA 4CDXA 5JMOA 4M3CB 1R093 2CV6A 1YYNA 3JBG1 4HL0A 3DPLC 5CFDB 2QZ3A 1H9WA 1HQLA 3VZJA 2YS9A 2RDSA 1NYWA 1FSHA 5JR2A 3A4CA 3ZYIB 5KXCA 3ABUA 3KPHA 5DUWA 5D4RA 3SC7X 3ELKA 1MDMB 5I0SA 1P2FA 5DTDA 1QIQA 3ZXLA 3OG2A 1DQ5A 4GAZA 3CCLI 3ASNH 4BJ0A 5IVCA 3H3ZA 2JDMA 1Z67A 2K9NA 2D97A 5J09A 4NR1A 2ZNZA 2CGOA 3ESWB 3GF2A 1I3AA 1YX5A 5E20A 2DURA 1IS6A 3TEWA 2BV6A 5FZMA 1GNYA 4XMYA 3GMEA 2VBWA 3I2OA 3LSHA 4LJHA 5CAZA 5LFAA 4GH4C 1NAEA 1RC6A 1X1DA 3CO2A 5FZ8A 3VSKA 2XVKA 3H1MA 2LG4A 1U3EM 5M3FJ 4WXDA 3BPVA 1VJ2A 4GH4A 4G9YA 2V5DA 4COUA 2XMLA 1DHKB 5KAIC 5A3PA 1OURA 2PAEA 4HX8A 1BBYA 2C5DA 1XS9A 4DZPA 2HOSA 3K70D 4ES9A 2UWCA 4IV3A 1T33A 1HLVA 3GHNA 2G1MA 3ZXEA 3ASIA 3TBDA 4QXKA 1Z77A 3S14J 4IVNA 1FPN1 1K6YA 4NPRA 2FDKA 4F83A 4X0GA 2H94A 3CP8A 4QPIB 3ZO0B 1V0AA 4CEWA 1ENRA 3SNMA 3NW4A 4ZKTB 2RQPA 2VKVA 3LMMA 3KCCA 3CUQA 5J47A 1CJDA 3NRVA 1LQ1A 1ZYRF 2DFCA 3CUOA 4MXWA 3ZSJA 2ZX2A 1PZ9A 4AQ2A 4KISA 3DF0A 4GULA 5E8GA 3LFKA 2JUGA 5TJJA 1QJX3 5ERLA 4OHYA 2EA7A 4A5NA 4MNUA 4QTRA 3HWJA 3OYLA 1A36A 4U88A 3O2PE 4FVVA 1MMGA 2ARAA 4TYSA 3KCYA 3IAM2 4FASD 1OXCA 1DBNA 4CCDA 3CMAI 3V42A 4RGXA 4C2TA 4IRIA 1ZYBA 3A01B 4XKWA 2EB7A 2ZMKA 2EXHA 2HGCA 4JBAA 1G9AA 3N9MA 2EFPA 2KIQA 3KX2A 3ALQA 2LKXA 4LJZF 2VTXJ 3FZVA 1XSRA 5LW9A 4YM0A 4QXCA 5K5QA 1V6NA 5IT6A 3BLYA 1FOD2 3RZGA 4ZTJA 3BCWA 3OYDA 4MTEA 1BEV3 2GA2A 3ACGA 2EIJH 1F9NA 1VMHA 4DPNA 3NKTA 1D2SA 1SLLA 4F7ZA 2VBYA 2VZOA 3IPVB 3O1TA 2XAFA 2AENA 4HMZA 2XIGA 1K4SA 4O6JA 2JK3A 5ED4A 4A3EJ 1XYPA 2VMCA 2X8KA 3AFKA 4LO4B 1XOYA 1SACA 5F2SA 1S8NA 2M4KA 3JRCA 1JUPA 1BN5A 1W5SA 2XB0X 3SQOA 1CQ9A 1USSA 5GPAA 3T2OA 4FE4A 5FIXA 2Y38A 4LKDA 1G2HA 2VUCA 2IT0A 4QHZA 3JBG2 4IXAA 2HWE3 1QNYA 3TKYA 3CL1A 1GZTA 3N7JA 3E6DA 1GMMA 2QBYB 1KFUL 1SBFA 1EA3A 5F7UA 2KMUA 2CW8A 2F6BA 2FDHA 3IWZA 4BHCA 3T2TA 2QQBA 5C44J 1R5HA 2KJCA 2C26A 1ZRCA 2CYYA 3RMXA 4BEHA 3ZYJB 2HWD3 2E1NA 1YLFA 1ULOA 1WCQA 1UZWA 3RYRA 2J22A 2KRCA 2K9ZA 3ZYFA 1CONA 5FLIA 1S0IA 3BY6A 2PMHA 4OUMA 2VVEA 3I97A 2ID6A 2Z99A 1EH8A 3CLPA 2WB1A 2L9RA 2CRGA 1NCRA 1BVP1 1HCRA 2X6XA 4DBQA 3HEIA 1JKPC 2QE3A 4C8DA 4NWWA 5C8CA 4M3BA 1J83A 4FCYA 1XU1A 3GLLA 4N4OB 3DV8A 5IY5H 1LKXA 1GHCA 4FTHA 5LBEA 1EV7A 3GTGJ 4Q2FA 3V0AB 5KC5A 2E5ZA 4TWTA 4XABA 5FYCA 1EYBA 1H9TA 3D5RC 2VC9A 1VBE3 4OINF 2VONA 4X6QB 1O4XA 1OC1A 4XBLA 1OD3A 2E36A 4EGZA 3H1CA 1F4KA 1AR73 2X1DA 2K9MA 1DZRA 5IT9Z 4QX1A 1Z05A 4GJYA 4K1ZA 1JKQC 3PVNA 1W2TA 2BFUL 5T3NA 1O59A 4XUQA 2ZC2A 2VOPA 3ZYPA 2QFEA 2KIFA 2W25A 1FPN2 2FMYA 5FRAA 1D4M1 3RIRA 1UZCA 5JI6A 1NZCA 1D0XA 1P4AA 2AO9A 2XKPA 3V8KA 4WM8C 2XBO3 3JCIA 2VUDA 4H0EA 3J80K 1G8XA 1DCSA 4RD7A 2ZGQA 4UT5A 3AMPA 4ABZA 5LY2A 4OI0A 2DTWA 1IPSA 2DOEA 1IC8A 4UW5A 2ZGMA 3ACFA 3BC8A 3FLTA 4GWNA 4QX0A 2E26A 2L7FP 2LOOA 1N47A 3GCMA 3ZOBA 4O7XA 2BFUS 2W84A 5GLWA 2A69F 4G94A 5FJHA 3M4OJ 1H1MA 5CVJA 4PJ0C 1RUI1 5EZGA 3KLSA 2WSVA 4K7JA 1EF4A 4IEPA 2IS2A 1CAWA 2OUHA 3TL4X 4S04A 3TGNA 2GNMA 3SJMA 4EJUA 1TNTA 1AR81 4XJUA 3PMEA 1GZWA 1U5TB 1OOPB 5L36A 2G19A 3BN6A 4QPGA 2ZXJA 2RMU1 3VDAA 1Y39A 4YM3A 1F5FA 3IP4B 1W0TA 3UNPA 1URXA 5FKMA 1GUIA 1B9NA 4RA0A 1JYNA 3VV1A 1KJRA 1WMFA 2EVXA 2IVJA 1JOBA 5M5WJ 3AK0A 2CL2A 3O1VA 1NE4A 2QENA 5GZEA 3W21A 5FWJA 2N7GA 3HGYA 4XW3A 5DG2A 2VPLA 3EUKL 3VDBA 1ENQA 3MV11 2V73A 2A68F 4XKCA 3EMRA 3DCFA 4DIQA 4MEXF 2BXZA 1R4NB 3RZOJ 1R5GA 3EYPA 3BROA 2H0VA 1LEDA 1S3JA 5LEKA 1RHI1 3ETQA 4XZUG 5FZ0A 2DFFA 2VL4A 4BKXA 3P7NA 1QOOA 3PU8A 5C9AC 4IHVA 1V9U1 1MBHA 4II2A 4RGSA 4CP9B 2VVDA 5FPXA 4KI5M 1XMXA 1GYKA 1RJ8A 1C0WA 4AIDA 5LA2A 1SANA 3LCPA 1QEXA 1O3SA 2K27A 5C9AA 3RZMA 1S0DA 3JD71 2E1MB 3AL0C 1AL0G 1LGNA 1OR7A 3ZMUA 1WGXA 2PELA 1CZTA 2EZIA 5K1YA 3OYKA 1JTXA 5FY0A 1VBC3 3AJYA 3OSGA 1PK6C 4YFNF 4B7EA 2JICA 3GX4X 2Z69A 1GNZA 1KU2A 1IPJA 5JHUA 2WFF1 1PGL2 2RR11 3HC7A 1PK6A 4O9EA 1A8DA 3Q9VA 3PIGA 2QQAA 1FX7A 3I64A 5DDJ3 4YZ2A 4HLTA 1OA3A 2L02A 3KV4A 3W6KB 4DXZA 3AYEA 3ACIA 4EM1A 1ZBA3 1ZNPA 2LK2A 1ZRIA 4HZFA 1IS4A 4LBQD 2ZB9A 1W8TA 5DN2A 4LOTA 4GRIA 1DPUA 3NNMA 3DKWA 1MS3A 3OYWB 2IEKA 1HV0A 3OF1A 1BC8C 4B09A 3K2AA 4JGYA 3BPSA 5K0UA 2WZPP 2EBIA 4DYQA 4AVVA 4JX5A 3LEKA 2K46A 3QYBA 1U8RA 1PMJX 2QQJA 1RVF1 1X3WB 1L0OC 4B1LA 3ZMZA 3GNEA 5A3MA 2Q1MA 1ZLJA 2OX0A 1YITI 3HPGA 3WNXA 2P3JA 1EKEA 4JC1A 1OCRH 1IAWA 3V8LA 2ZZQA 4ATFA 4DOUA 1XX5A 1CPMA 2A07F 5FY7A 1D4M2 5HI0A 3MLJA 4CDUC 3VKNA 1DIWA 5AIPA 4JK1X 1FYLA 3I3DA 2EPFA 2QQOA 3OUIA 4V2VA 4EN8B 4D94A 1R083 5ERIA 4NHMA 1KQ0A 4CDUA 1W0UA 3I2GA 3R0JA 4JOMA 3BGAA 3EQEA 4LHLA 4XQFA 3WD5A 4RM3A 2XVGA 2FBEA 2EF6A 5I8YA 4XTMA 2I2SA 1O8PA 5HNFA 1JJ8C 2RDNA 4RAGA 1GWLA 2EV0A 3AB0A 2MEV3 2VXDA 4QGMA 3IMMA 5KXEA 2Y64A 3W6JB 3CF6E 1EH7A 3PUFA 4AFBA 4FFGA 1FOYA 4MGTA 1W8NA 4CPBA 1SCRA 3VZLA 3HTSB 1K3IA 4D7TA 2E7XA 2OYZA 3WU1B 1RUI2 4YG6A 1HKDA 3CDZB 5L7OC 1QQP1 5FROA 4JZRA 3ZPYA 1QF3A 3VB2A 3S32A 5JHFA 4Y1YA 3J7HA 1ASJ1 4Y17A 4XFFA 3VBHC 2FHRA 3RZHA 3BDDA 1MS0A 3ZXKA 2CQKA 4XLFA 1AR82 2OCCH 4QX3A 1BW5A 1OVPA 3NSTA 4CYCB 1G3WA 2RMU2 1D0YA 2YFUA 4YFWA 4Y3OA 4KIFA 1N1VA 5C33A 4QIWN 1MZEA 4LLGF 4G7ZF 1N3QA 3C7HA 4D69A 3BODA 4XN3A 4K40A 1BA5A 4UUVA 3PNTA 1D3YA 3HRUA 4UOJA 3PURA 1TZLA 2V4VA 2ET1A 1UOFA 4IESA 1XN7A 2FD8A 3M7AA 4LBJA 2WS91 1IS3A 1QY4A 1FOXA 2ADEA 4JYKA 2I10A 2J1SA 1LODA 1N1TA 1OH4A 1TWCJ 1QXRA 2X0LA 4AQSA 1Z1DA 3D82A 1IOAA 1XGMA 3SKJE 4RLFA 2C6SA 5I91A 1RHI2 4C3JJ 4Q48A 1WKYA 4AAPA 3OV8A 5KHGA 4CEYC 5FD5A 3USUB 1V9U2 4YWAA 2R7QA 1E5RA 5FZHA 2MD0A 4C30A 1SBDA 2WSUA 2I74A 1DGWX 4Y5Z0 4BIOA 1IDYA 5FZIA 3KSCA 4CEYA 4FISA 5FP8A 1K4TA 4PDWA 3TYJA 4PCQA 3JD72 2Y48A 3OYAA 2V1UA 2VW1A 1ULYA 1VP6A 3FBNB 2BEOA 2EILH 3FXQA 4XRFA 1I9RA 5FP3A 4FOQA 2Q8CA 4L5JA 3G71I 1OFSA 4I2OA 4N9IA 4NRQA 3I71A 2GP5A 3VBOC 1MW7A 1XU2A 2ATFA 1D0GA 5JOWA 1JH5A 3BI3A 2WFF2 1OUSA 1D2QA 2E6VA 3IT8A 1YG2A 1ZG5A 2RR12 2PAMA 5DZGA 2A6WA 5IVFA 3GFIA 1JN2P 3G1MA 2BU9A 2BWAA 1C8NA 5FMCA 2VL8A 3D6EA 3KVBA 3J81Z 4RA2A 4CUAA 4XHBA 1DP3A 3BVCA 2OU2A 5A7WA 3POJA 1DZQA 3ZMOA 5ACA1 4Q26A 4FP3A 3H8OA 1K12A 1XTAA 4YZ4A 4EATA 5HCFA 5TRDA 4F93B 1H6YA 2ZJCA 1SMYF 4D7MA 2MD5A 2F4LA 1ZG1A 2D5VA 4PJMA 4HSJA 5LEJA 1LDKB 3O7OA 1AZDA 2MHFA 3PO2J 1PO13 1RVF2 1WCDJ 4HK9A 4FQGA 2OPKA 1TME2 3LOBA 5EHDA 5G04L 3B9IA 1MH4A 3C3VA 1AX2A 4XSZF 3B93A 3GZAA 1NCQC 2IXIA 3OIPA 2M87A 3R60A 4MIMA 1GWMA 2XWBB 2EZLA 4ANJA 4KG0A 3T8TA 4BQ5A 4CXXA 5EEAA 4QKNA 2HEWF 3WVJA 5FAXA 1NCQA 3HRTA 3IH2A 1J2XA 3CQZJ 3TB0A 1D8KA 2JPCA 1VMFA 2Z4FA 3K51A 4Q0SA 3H1WA 1T6BX 4AEDA 1D1AA 1LCLA 4OUEA 1PIV1 1Z3XA 2TEPA 2QWWA 1ETXA 3LA7A 3TO6A 3N9PA 4L9BA 3AP9A 3GZ5A 4TTGA 4BQYA 1SPPB 2DVFA 3SEPA 3WR0A 4IEQA 1W0PA 1JT0A 1TBXA 3H7JA 3S1RJ 3Q9OA 4ON0A 4UFMA 1R1ZA 1YHQI 2RVAA 2VUAA 5FREA 3KS7A 4M73A 1M4WA 3G4SI 4NC7A 3D1NI 3E97A 2V6EA 2ME0A 3KM5A 4IL6C 5FWEA 1NG0A 4WM8B 5J8CA 1BVVA 4QQLA 1VQ6I 3MW2A 4ITCA 3TDUC 3NNLA 1QQP2 3RMYA 2DT6A 4P02B 1X3UA 5JLXA 4QPQA 3I2JA 2RS11 4RR3C 1ASJ2 1HF0A 4UV9A 1SFEA 5FO9B 3S8PA 2RS31 1APNA 3MF6A 3KP5A 2VH9A 3BG6A 1T0FA 1QH6A 4OZXA 2Q2EA 4RR3A 4AI2A 2VE1A 1XSDA 2X5IB 3LIHA 1TZOA 3A0KA 4RHV1 5E3OA 2W0XA 1UB9A 1V54H 2CQ7A 2Y6GA 4HN1A 4NVPA 1F4HA 4UUTA 3WW3A 3H0GJ 4LKSA 2F4OB 1VZ0A 1O57A 1NZIA 1SLBA 1RR7A 3PDQA 4JVAA 1T08B 2A6EF 3KV9A 1CPNA 3VBUC 2NVUB 4BQNA 5DZFA 4YNIA 2FU4A 4P5HA 2GM4A 2WS92 1GVJA 2Z3YA 3VDDB 4H4KC 2CTVA 4B3NA 1AYM1 4QWQA 3GTKJ 4XFAA 3BT9A 3GO5A 2JIGA 3CC2I 2ADDA 3AP7A 3HEFA 4E6KG 4LMYA 1SD6A 1NA1C 1NQJA 5D8KB 5HLHA 3M7GA 5DZEA 2WINB 2ZJPF 3LAPA 3RS6A 3HT2A 2ZXHA 2D3RA 2WBKA 3DXTA 2ZNYA 2VE9A 2RNJA 1MNEA 5J37A 3MQ0A 1QHGA 4WVMB 3WGGA 5SV8A 1RUE3 1RYYA 2BXYA 2VXJA 1RMU1 2A6ZA 4PGGA 3PIPF 1O7FA 2OAZA 3L2YA 1UCXA 1VNDA 2EH3A 5I0RA 3ST7A 4YVWC 2HYFA 1BBT3 1XMKA 3NJYA 3ZYGA 4CA0A 4IEXA 2F2EA 3CO6C 3HNYM 2H8WA 3T08A 5F0FA 2V9KA 2X1CA 4K3UA 5IW0A 1QJFA 4PQQA 1ULEA 3I3MA 3LQQA 1DGWY 4XLPF 4D9JA 3VSLA 3K46A 2V79A 3IIIA 3VN4A 3OGRA 3AL0B 1Y4WA 4AZZA 4JRAA 3I59B 1W5TA 2R5ZA 3L2HA 1BC7C 1P4WA 3K2ZA 3K69A 2XASA 3RZZA 5BNOC 1S0CA 3GFJA 3Q5FA 1MMSA 1ZZ6A 5ACA2 3ZCOA 4PCRA 1KFXL 1FPN3 1FNNA 4DGWB 1UAIA 3P9CA 3N35A 3MIFA 1KITA 1Q8VA 3A0HC 2VPVA 3K0LA 3LKJA 1IRGA 3CO7C 3THDA 2EFOA 3C7EA 3T0DA 1OYYA 4BACA 4LLLA 2ENRA 2I45A 1SDWA 5FMDA 2V4JC 4RAYA 1YEWA 4IO9F 2W9XA 4UFLA 3FC0A 4KGGA 1I5ZA 4EZ4A 5AIQA 2XF7A 3JU9A 3PL8A 1WWYA 5IHRA 1W2UA 2VASA 4OVEA 1AKHA 3EXUA 2M45A 3POWA 3AP6A 3PIJA 4BY7J 4NIGA 3B01A 3O1MA 2F48A 3ZQ7A 4HDVA 3WQBA 3PUQA 3GZTB 3HOYJ 3DBLB 5FXVA 2R3SA 3WTWC 1VB2A 4PBOA 2WA3A 3PQJA 4XK4A 5BPDA 3KFWX 3IKWA 3WDXA 3D5LA 1PIV2 1LE8B 2XVLA 3DEMA 5M3MJ 1JHJA 4B8EA 3ZXGA 3VDXA 4G6TB 2XPUA 1J1TA 1ZZ7A 2VM9A 3WP5A 4GXLA 2ID3A 1A31A 2BNNA