3E5UA

Ocpa complexed cprk (c200s)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
219
structure length
215
Chain Sequence
DFCGAIIPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGGNSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNTYNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKIIVYNLGELKHLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of halorespiration control by CprK, a CRP-FNR type transcriptional regulator
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Transcription regulation
molecule keywords Cyclic nucleotide-binding protein
total genus 68
structure length 215
sequence length 219
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e5uA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3e5uA01
2QQAA 3OF1A 1YWKA 4RGUA 1YS6A 3M3IA 3H50A 5D6FA 5D5UB 1KQ8A 2P7VB 2M30A 4I01A 3ZMUA 1O5LA 5LHHA 2FEZA 1EH6A 4KMFA 2G7UA 3LA3A 4E2QA 1IRFA 4QM8A 2ESHA 4LMYA 1U5TB 3FM3A 2P8TA 5JSRA 4U7BA 2A6HF 2E9QA 4OLLA 2VT3A 4EJTA 3SFZA 1B1BA 3EYIA 2XLAA 2XAFA 4P5OA 3OCPA 2ZMEA 3RDIA 3OTFA 1KA8A 5KHKA 4MQ9F 2DO7A 3WG9A 1V3FA 1FT9A 4WF2A 5CVVA 2ATFA 4EM0B 1BI3A 2L4AA 1A04A 4EM2A 2KJCA 2FMLA 3LAPA 5LRRA 2H6CA 4U0VA 1W7PA 3EETA 3I71A 3O6BB 3RKYA 4IHSA 1RIOH 1HKSA 3EO6A 1R23A 4ZU7A 4KIFA 2Y0OA 1BI0A 3I58A 3LQQA 4FT8A 1ZAOA 1XGSA 5LGTA 2Q0AA 1OYIA 2W84A 5H6QA 2CGPA 1LKNA 1DGWA 1Z1DA 4HMZA 3S2WA 1PDNC 2VBXA 3E6MA 3HOSA 4FHTA 1KQ9A 2XLGA 4EMSA 4E70A 4N9IA 1HKTA 1Q5OA 1EP0A 2HFHA 1TQMA 2VT2A 1RTVA 1BI1A 2RN7A 5FLIA 4IJAA 5K5OA 4GYIA 3TOAA 2PQ8A 3KZZA 1ZG5A 2XIGA 2A68F 4EJUA 3OOPA 5LHIA 4ZYHA 3PVBB 3BCWA 3ZMSA 5LBQA 3KP3A 4Q29A 1IN6A 3T8TA 4OMYA 5KHJA 2WFPA 4HAMA 5CADA 3VHRA 3O2PE 4I09A 1TQPA 1Q3EA 5J3UA 1PUEE 3RYKA 5D5XB 1CF7B 1DZTA 3TDUC 4OU0A 1XMKA 1O3RA 2L02A 2OBPA 3CF6E 4O5VA 5KHHA 5FD6A 1Z6TA 1T38A 1UHWA 1S8NA 3CTAA 1DGRA 3JZVA 4XF9A 4XFAA 2HEOA 3ES1A 1XDUA 2QBYB 3U0ZA 2CFXA 3QOPA 2IXKA 1GVJA 2XHKA 1P4XA 2OZUA 4KIGA 2GXBA 2C0ZA 3Q9VA 2LDUA 5FCCA 3KEQA 1KU7A 4B8XA 3VB2A 4GXOA 4XF3A 1NHAA 4L0ZB 2KRFA 3TQNA 1FXZA 1IXSB 3IC7A 5C6CA 4ZZLA 4UNOA 5FQ0A 3WTUC 1P6RA 2XROA 4EWDA 2OA2A 2IT0A 4BHBA 1BN5A 1TW2A 1SD4A 2AS5F 3MEXA 2A3SA 3OGJA 2STTA 2DCTA 5D1IA 4ZZDA 4A12A 2XLFA 1E2XA 4E2GA 1QXRA 3KP4A 2E7WA 3BJ6A 4MEXF 2FBHA 3V7SA 3ZN0A 3IBMA 3DF8A 4IF4A 1BBYA 4S04A 3EDPA 1F5TA 1Y3TA 4ZH4F 3GWZA 3RNSA 2Y0MA 3H9AA 1DDNA 1ZVFA 3CO2A 2M5WA 2GU9A 4CO8A 1HSJA 1GXQA 1J2XA 1G4DA 3FXRA 1AOYA 4HSJA 5CVUA 4NHJA 5L3EA 3ZDSA 2Q30A 3KGZA 2EAAA 5I93A 5TJJA 5HDGA 5LHGA 5HOOA 2GWRA 1Y9QA 5DYMA 1X8EA 3SCFA 1FY7A 2OQGA 2JT1A 2TDXA 4YFXF 1XCBA 1O5UA 4WK8F 3I54A 2OPKA 4N0BA 3E5UA 3H8UA 3RTRA 1J0RA 1QBJA 4DINB 3C7JA 1SAXA 3CEWA 4KN7X 5H20A 3GFIA 2HDCA 1RGSA 5TRDA 2VBZA 3ZPLA 1R5HA 2P5KA 2QVSB 5L3DA 2EFNA 3H1MA 4Z82A 4I7HA 4D7TA 5DUKA 4EGZA 1SD7A 2DU9A 4Y13A 4TV7A 4Z2YA 2GZWA 2OYZA 3BDDA 3AAFA 1BC7C 4KT5C 1IN7A 4A0XA 1G3YA 1UFMA 4XF1A 1FSEA 5HLIA 3DXJF 2QCSB 4AQ2A 5FDBA 3EYYA 2KKOA 4BNCA 2OQRA 3WE3A 3GFJA 1IXCA 3DPLC 3NRVA 4IXAA 2IA0A 2EJRA 5HDNA 4LB6B 4KYWA 1B6AA 4ZU4A 4EJVA 4EWEA 3ZMZA 2KIFA 4QM9A 2O8XA 2PA7A 2PHDA 3V8JA 4LUKA 1XSVA 3KGLA 3PFIA 4M6YA 1P4WA 2ZBKA 2W85A 1U6GA 4XEZA 4Q0UA 3U11A 2H0VA 1W5TA 4FBFA 5I8YA 2HQNA 1O7LA 1MJ9A 1RUOA 1B9NA 1RNLA 1USTA 3EQEA 1WGPA 3CL1A 1YW7A 1W4MA 2MH9A 3WODF 1TTYA 3WW4A 5HI0A 3RPUA 2DLLA 5JSOA 2IVMA 3LAJA 5JFRA 3CLPA 1J1LA 3ZMTA 4BQAA 4PIXA 1GXPA 2PLYA 3RZZA 2F5EA 2GH2A 3ABTA 2EFQA 4XSXF 3VODA 1W5SA 4Q0PA 2JPBA 4HDUA 3E3VA 4A2UA 4CICA 1FI2A 1FYMA 1OI6A 3F23A 2PYTA 2PAMA 3GFLA 3BP8A 5E1RA 2ELHA 1XCVA 3B73A 4MGIE 2CAUA 3MAJA 2VBWA 3FM5A 4KU7A 4MNUA 2QWWA 4EGYA 3USSA 1BI2A 4GO1A 2IP2A 2M45A 1IUYA 5I91A 2QNKA 1GQHA 1H1IA 5BPDA 2D2WA 5ILVA 1H0MA 1OFNA 3QPHA 4IEWA 1HKQA 4AD9A 5E8IA 1YLFA 1KGSA 1IZ1A 5E1XA 1ZZ9A 2FMYA 4A5NA 4HF2A 5A2QZ 1CAVA 1RUNA 1MD0A 1HW1A 2NAZA 5J7MA 2VN2A 4HYEA 2BE5F 2EFPA 3F8FA 4CYDA 3GZ5A 2H27A 1SFNA 1O3TA 1ZN2A 4EQQA 4CXFA 1S3JA 1QZYA 1T2KA 2K9ZA 1LRHA 4P96A 2FBIA 5CVJA 3U2RA 5E1ZB 3TKYA 3D0JA 3I4PA 3BALA 3IL2A 3NVCA 1IPJA 3JSPA 1LB2A 2XAHA 3NSTA 2LKPA 2Q1ZB 2JSCA 2CAVA 5KHIA 5LEKA 4UV8A 3F8BA 1QXJA 3T1BA 2BGCA 1Q43A 2HJIA 3M1EA 2EVXA 1T98A 2X4HA 2IC1A 5LGNA 4FAHA 2PJPA 3FWEA 4IEXA 3GXOA 3N97A 1CAWA 1XDSA 5JAXA 3HRUA 4EWAA 2ZCWA 4U0WA 1G3WA 4KDPA 1RI7A 3CJXA 4OFGA 2HKXA 1VJ2A 1JGSA 3O14A 1HW5A 5LEJA 4YFKF 3F6OA 3P9CA 1LDKB 2ZFWA 1QO0D 3IRRA 1XE7A 3NL1A 1STZA 1L0OC 5L3FA 2IJLA 2HYGD 4IHTA 2K0GA 2HS5A 3T0YA 2KXLA 2YSRA 1LR5A 3CUQB 2VOPA 4RB3C 3F22A 3RKWA 5BV6A 2OAZA 1RL3A 4MHGA 4MUVA 4AVCA 5K8SA 5E8GA 4IEPA 5K5QA 4LB5A 3WW3A 5F1RA 4PGHA 3DL3A 1KYZA 2ZO4A 2ZNYA 1R1UA 1UIKA 2CV6A 3SZTA 2XAGA 1JHHA 2CWEA 2DPDA 2XVCA 3NKTA 2E1NA 1YYVA 1MDMA 2P5VA 1ZLKA 1DUXC 2FQPA 5BY5A 4L2NA 4LEJA 1U78A 2GXGA 3MQ0A 2OZ6A 4G8XA 3WTSC 4ONUA 1SD5A 1XSXA 3R0AA 4XFFA 3LWCA 1MKMA 3QRFF 5ICCA 2HYFA 3UKNA 1JE8A 3WW2A 1CAVB 1ZRFA 3ZMDA 3DN7A 4FX4A 4M9SA 3SMHA 3ML6A 3LA2A 3EHKA 4M73A 3BU7A 1U5TA 1NYWA 4UXAA 3SCHA 1PM7A 2ET1A 2Q2EA 1UD1A 5FLJA 1QPMA 2DW4A 2ZXJA 1BOAA 4MGYE 3ECOA 2O1QA 2NYXA 1R36A 4BH9A 1IAWA 3H1YA 3HHHA 1J5YA 4LJZF 3RPQA 2WC2A 4IERA 4I3PA 4CZZA 2GQQA 4IRGA 3I59A 2IPQX 4O3MA 4M6XA 4IRHA 3MDPA 2NNNA 3W6KB 4L0YB 1P4AA 2C6YA 2LF8A 1AWCA 1QNTA 2UWMA 4O9GA 1FYKA 1WLTA 2VC0A 1YIOA 5I0SA 1Z6RA 4YNIA 3P9KA 2IA1A 4AIKA 3R4KA 2K4JA 1TNTA 1BJAA 3ISPA 3SXYA 3F8CA 1J58A 4L9VA 1R5GA 2OZJA 3ZQ7A 2D1HA 1ZZ6A 2QYOA 2VXZA 5ILUA 2GAUA 4ZYGA 5BUVA 2K27A 1PMIA 4FX0A 1YFYA 1SFEA 5FLXK 3QP6A 2ETEA 4HW0A 2XKPA 3HIFA 4AWXB 2Z33A 4WWCA 2D5HA 2CW0F 4ZYEA 2O03A 4KMUX 5BMZA 2H09A 2FRHA 4L5JA 3KLOA 1IPKA 4QXKA 4E2SA 4M74A 5LRSA 1G3TA 5EZWA 4JTNA 2PFWA 1MZBA 1R00A 3I53A 3G7DA 4QLCU 2FSWA 5BS6A 4HBNA 2VC1A 3KETA 4AIHA 2W57A 2FXAA 3QU3A 1O4TA 5FLHA 4EVIA 1WWXA 4HN0A 1ONVA 3L00A 5E17F 3M70A 4DNCA 4KWKA 3CO6C 4R52A 3WGIA 1U8RA 5D5WB 3EQLF 3KEOA 1QZZA 4LLGF 4AQ6A 1JHFA 2V09A 3BJAA 1MJAA 4LTAA 1QY4A 4IPAA 4B09A 2ETHA 1QGPA 1Z7UA 5JHUA 1EH7A 5JR7B 3V4GA 2V1UA 5BXXA 3L9FA 2EA7A 1FBSA 4YIFA 2HTJA 4GGGA 3CUQA 2BYVE 3COAC 3FHZA 3FZVA 3P9IA 1UHMA 1J3PA 4ON0A 2M8EA 4AVAA 2PFBA 1E17A 1DZRA 4OIRF 2R3SA 4M9ZA 1BIBA 2DT5A 4WCGA 4HX8A 4LA3A 1LNWA 4CGZA 4RGSA 3HSRA 4A5MA 2F5CA 1R22A 2OU2A 2IXCA 3S7IA 3GX4X 2UYBA 4HV5A 3EBRA 1ULYA 5D4RA 1W7PD 4YIIA 1KU3A 4MGZE 3BJOA 4BHCA 1EV7A 4AVBA 2F5FA 2B0LA 3HUGA 1TQ5A 1K7AA 2I45A 1ZRCA 5IT9K 4YYOA 1VP6A 5F64A 3TO6A 1XGOA 4HLTA 3LZZA 1UW8A 4UBHA 1W7PB 3TOBA 2PAEA 2MLKA 1YFXA 1IN5A 4L9JA 1BM9A 1D8KA 3HT2A 3GBFA 2COMA 4XSZF 1NZCA 2Q4SA 2A5YB 2UY9A 1ZG3A 4JVAA 3GYDA 3KZYA 4HSLA 1P2FA 2M1BA 1V70A 2P4WA 5JI6A 1NE4A 3ES4A 4S05A 5BPIA 3KP6A 1DPUA 4U7DA 4HVRA 2P5LC 5L3CA 3SZPA 3V7CA 5H6RA 3GEZA 4X6RB 1YQAA 2F4PA 1UB9A 4MEYF 1CGPA 5K1YA 4HVOA 4CDGA 5BOXA 2PAKA 2QQBA 4B29A 1LEAA 4MQVA 2L4MA 2DPUA 4QGNA 1ZARA 2IA2A 1FP1D 3DV8A 4LULA 2CO5A 4L5IA 3K2ZA 4RB1A 1O3SA 2UXNA 3C3VA 1S29A 4L9TA 2W24A 4JK1X 3ULQB 4JTOA 5ICFA 1XD7A 4IEYA 3F21A 3TGNA 4PCQA 2BEOA 1YUDA 2QQ9A 2F5DA 3QP5A 5BPXA 4R79A 3RI4A 2Z5UA 1IW7F 4UHTA 4PIYA 4EV0A 2IXIA 2CG4A 3MZHA 2RVCA 4F7ZA 4QWQA 2EWNA 2XAJA 2BNNA 4GULA 3NQOA 2GC2A 1H9TA 2EFWA 1H9GA 2J5OA 3K9TA 4KUMA 3DFGA 3ST7A 4L18B 3HRMA 4LLLA 3NW4A 2QLZA 3NEUA 3L2CA 4EJOA 1TBXA 2F2EA 2MH2A 2PEXA 3S0MA 2G7HA 4BHPA 4IETA 2NNYA 2FNPA 3H92A 2R7DA 2A61A 2FE3A 3H3UA 4ORFA 2PMUA 1LDJA 3M7GA 2L54A 1XSDA 4OIPF 1KYWA 3MPBA 3K1PA 1EY2A 3WU0A 1CAUA 1YFHA 2JRTA 3ETQA 2K86A 2QUFA 4RD7A 3GFMA 4PZJA 5I8TA 3ACLA 4OIOF 1WI9A 3F6VA 4RGXA 2IXLA 1WSUA 5KVRA 4KICA 1G3SA 2EV0A 5CVIA 2ISYA 3GZ6A 1ZZ8A 2B8MA 3I64A 4IEQA 2FOKA 1T6SA 1H1MA 1SMTA 4FAGA 1I27A 3L09A 3DKWA 2VE9A 3HTUA 3ZMVA 5FLXZ 1EH8A 3DQVC 4ZYDA 3H7YA 1QQIA 1HW2A 3ZN1A 5I0RA 2KJBA 4P9UA 2UXXA 3U10A 2GA2A 4HZFA 2DTRA 4OIQF 4IEVA 3RKXA 3ELNA 1OYYA 2HZTA 2QZ8A 4A0YA 2Z2SB 4WXDA 1Q1HA 1X8MA 4OINF 2OA4A 4P9GA 4LK1F 2V1XA 4Q47A 2DAOA 2K4BA 1ZX5A 1XRUA 4UVCA 6PAXA 3BB6A 4LLNA 4IEZA 4MTEA 3R6SA 3WTZA 1ZH5A 3V7RA 3C1DA 1ZHFA 1X82A 4HDVA 1F1ZA 5FD5A 4G7HF 2D5FA 1DP7P 1RC6A 3FZ3A 3MFKA 3IKVA 2XGXA 2JTVA 1FOKA 4HV6A 4HLYA 2DFIA 5A2QK 1YFUA 3DEUA 3IWFA 2V9VA 1T39A 5J8CA 5FB2A 4WZCA 4ENJA 2GA1A 4HF0A 2ET7A 3WTWC 4XF0A 1DPRA 2M87A 4Y15A 1K78A 1SEFA 4Q0VA 1XE8A 2DQLA 2HKOA 3WE2A 4UUVA 4MH0E 4G7OF 2YU3A 3G3ZA 2B5HA 2OD5A 2RNJA 1F4KA 1CX4A 2YX4A 4A6EA 3FFQA 2QM3A 3TNQA 5FGMA 4ENMA 2H6BA 1YW8A 1D8JA 1ZREA 3CLOA 5ICEA 2BV6A 1O7FA 4EJWA 2UZKA 1CAUB 3RJPA 5FFXA 1U2WA 4UVBA 2CSOA 2RGVA 5E18F 3J81K 1HXDA 3ROUA 2EFOA 1CAXA 3FXUA 1SQ4A 2JPCA 3C3WA 3JAMZ 1Z9CA 4RGRA 3I5UA 3GF2A 1QWRA 2J5PA 4XBFA 2PG4A 1EYBA 2LSOA 2O6GE 2FQ3A 1ZNPA 4KL1A 3O3KA 3TO9A 4ESFA 3HRSA 2P17A 1YG2A 2O0YA 4QMAA 1J59A 3PQKA 5KK1A 1FC3A 3LA7A 3K0LA 1TQIA 4YFNF 2IRFG 2O8QA 4GYGA 2FA5A 1O57A 2EV6A 5CYVA 4XETA 3CUOA 3HTSB 2RDPA 2V1DA 4ESBA 3EJKA 4IEOA 3OD0A 2L01A 3PLQA 1WRJA 3D5LA 3N4MA 2WV0A 1YO5C 1OYWA 1S6LA 1G6NA 2JZYA 5LLQA 2VBYA 4XFGA 1SFUA 4LG0A 5HS7A 1RZ4A 2VOOA 1HQCA 2V6CA 1ZG1A 3SCGA 3RYPA 4YARA 4Q5SF 3IRQA 1NXMA 5L3GA 1FBUA 2Z99A 2W25A 4M9XA 2IXHA 4RB0A 3FMSA 5FQ0B 1K6OA 4XFBA 4XFIA 4EROA 1U12A 3DPTA 4TLFA 3LFKA 4HBLA 5CVRA 2VECA 5J8FA 3L2HA 5JCTA 5JSPA 1XMAA 2Q8KA 2BNMA 2VONA 5DCMA 1ZZBA 1J7KA 4ENKA 1LVAA 4XRFA 4MGRA 3LQRA 1R1TA 5DD8A 1HSTA 2XL7A 3E97A 1IF1A 2Z9OA 4BYYA 3I59B 2YX7A 3MWMA 5DDGA 4PIZA 3Q5FA 3WTYC 4RB2C 3E6BA 2V79A 5L3BA 3HSEA 1FSHA 2DBBA 4ESJA 5E1WA 1J3QA 3D0SA 4WVZA 1Z91A 1XGMA 4IESA 3M8FA 5AONA 2QJVA 1ON1A 3BOQA 1S7AA 1VTNC 4U88A 3IWZA 4J1WA 3F8MA 2Y48A 3REOA 3KE2A 4M72A 4OOIA 4D7SA 1OR7A 4LFUA 4NVPA 4HQMA 1FBQA 1L3JA 1LQ1A 4K2EA 1J75A 3ABUA 1B9MA 3IHUA 3UKTA 1WKMA 1FZPB 2ZKZA 3T8RA 5CLSA 5FPZA 1OPCA 3M8EA 2XUBA 4H7LA 2QDRA 1V4RA 1L3LA 1TNSA 4G9YA 2MBFA 1ZZCA 1OD5A 5D8LB 2UY8A 1FYLA 3BPXA 4X6QB 2A6EF 5I8SA 4J1XA 2DK8A 1WA4A 1Z05A 4MZUA 1ZGJA 3J80K 1ZYRF 1R1VA 3RYRA 2RC4A 2N7GA 1EPZA 5FFZA 1I1SA 1MDMB 5CJ9A 2A07F 5D4SA 3GLXA 4UXNA 2ADUA 4AVPA 4ETSA 3TO7A 3RIRA 2HWVA 5EEGA 3E5XA 1B4AA 4P9FA 4AXOA 2PN6A 3CJNA 3E5QA 5DD4A 2Y75A 3G73A 3S7EA 3QPTA 1ON2A 3KCCA 1ZZ7A 1ZLJA 3J7AO 3Q9SA 1CAXB 3MZYA 3ZP5A 3IDBB 1YHFA 4LD5A 4WX9A 1R58A 2FF4A 3FHIB 5ERIA 3QAHA 4K8FA 1GHCA 1TW3A 4WXHA 5I0TA 4YG2F 4Y17A 1IRGA 2O3FA 4L11A 5EEHA 4QX5A 4A6DA 3WGHA 3CDHA 1B59A 4XF4A 4HOBA 2PHLA 5J48A 2HR3A 3JSOA 1XGNA 3FMQA 4U0YA 2L3DA 2P6SA 3MYXA 2VPVA 4AIJA 4F8AA 1YTYA 4PJYA 4LG0B 2KIMA 4KWJA 2HOEA 3WTTC 4R8HA 1BIAA 3U1DA 5HDKA 1S7OA 4QGLA 5HS9A 1K79A 4KFCA 1WQ2A 2IW5A 3PNAA 2EK5A 3ECHA 3IKTA 3HOTA 3M9AA 4KU8A 2EV5A 1J9IA 2PQQA 4M71A 3EUHA 3WGGA 5HS8A 2RV8A 4JQFA 3C18A 4LGWA 3FX3A 2NRAC 4LA2A 5JR3A 5FO5A 1ODDA 1CF7A 2O61A 2VQAA 2RQPA 3WTVC 4DQ2A 2D45A 2MLGA 5BQTA 3KMHA 2MHFA 4LUMA 4BAYA 2K02A 2Z69A 3E6CC 3I0TA 3PQJA 1SD6A 3IIAA 3BPZA 2HGCA 1ZRDA 3R61A 5AIQA 5ED4A 5D5VB 5I0UA 4HN1A 3TDZC 1LDDA 1C0WA 4O9EA 4YRDA 2QVOA 2H94A 2FBKA 1REPC 2NS0A 2WWYA 1FWZA 3FF5A 3I7DA 5FPXA 2ZJ2A 5CU1A 3F72A 4QGMA 2HQRA 4RAZA 4H0EA 2DI3A 3HSFA 1YFWA 2RKHA 3BPVA 3JTGA 1I5ZA 3K1MA 3JAMK 3BY6A 2EB7A 3QU6A 3CUQC 4P55A 3LSTA 4WBBA 3HYIA 3VFZA 4Q0SA 1ZGAA 4RS8A 3FE5A 4A0ZA 2FNAA 3KSCA 2EA4A 3LWFA 5DEQA 4HQEA 5T3NA 2G9WA 5D6EA 3L7WA 1YW9A 5HVQC 1R7JA 1FX7A 3FJSA 3TNPB 1FLIA 5IT9Z 1FPQA 1U3EM 3WU1B 2K7LA 3WTXC 5F6FA 5KBFA 2ZKLA 2CQKA 3B02A 2LF7A 1LJ9A 1CAWB 4WXCA 1Y0UA 4HX7A 2P6TA 1LEBA 3IDCB 1PP7U 5HLGA 4ZU5A 2YR2A 3MCZA 2ACJA 3VOEA 3SHRA 2GC0A 2MC3A 4O6JA 5IT3A 2PI0A 4XLNF 3E6DA 1IN8A 4UV9A 5J6XA 4YSFA 4BIFA 5LGUA 1NE6A 5DV5A 1YS7A 2XASA 4I0AA 4XFCA 4KNYA 5E20A 3WW1A 3H3ZA 2FU4A 3ELKA 4HF1A 2DQRA 4Z07A 2KIUA 4NB5A 3ERED 1D3YA 2MNGA 3CO7C 2Q0OA 1KU9A 1YLLA 3SQNA 4HA8A 4NQWA 2D1VA 1BC8C 3LOIA 4IVNA 2XAQA 4HLXA 4KWLA 1J3RA 3T5XA 3OV8A 1XB4A 2PBIA 5EFUA 1P92A 5AIPA 1ZRRA 3HQXA 3FXQA 3W6JB 3BZ6A 3SHFA 4I02A 4MV2A 3U9GA 5HLHA 3HRTA 2Z3YA 5DCMB 1JXSA 4META 4BXUA 1UCRA 2BNOA 5ILSA 3SXWA 5AVPA 2GIVA 4ENNA 4GCVA 2XRNA 1MGTA 2MPFA 5DUIA 2XL9A 1X7NA 3R0JA 2D93A 2X0LA 3LAGA 2GC3A 4UVAA 3V8LA 4CHUA 2AXLA 2ZNZA 1VR3A 4XFHA 5D8KB 5C8WA 2PMHA 2YPRA 2IXJA 2B9UA 4N9HA 3K1NA 1UPIA 3K69A 5KHGA 4I0BA 3F3XA 4MTDA 4I98B 1USSA 2STWA 3F8NA 1KU2A 3KP7A 4KA4A 3UKVA 4MGKE 3GVAA 1I6XA 3KP2A 2P7CB 3V8KA 2CYYA 2VE8A 4RAYA 1OMIA 2XKOA 2ZMEB 3GUDA 1SMYF 1PP8F 1UCXA 3GO5A 4L9NA 2D40A 3QACA 4JBAA 4KN4X 4JV4A 5E16A 1F9NA 1U5TC 3HHGA 2XV4S 1KQ0A 4Q48A 4KIBA 3H7JA 3KP5A 1OKRA 3VEPA 1SFXA 1MJBA 4Q0QA 1FNNA 3JW4A 3BROA 3JTHA 3R60A 2HTSA 2MA3A 1GQGA 2LNBA 4G7ZF 1FP2A 4LK0F 4PGGA 3KLNA 2EA2A 5DCFA 3NJZA 2QBYA 4G6QA 4G94A 4Q4ZF 3J80Z 2DK5A 2A69F 3HT1A 5JVTA 3KFWX 1D5VA 2R7FA 4XLPF 2GC1A 1IXRC 2ISZA 4HVQA 4HX4A 1UIJA 3GYHX 1TLHB 2E7XA 4OMZA 1HBXG 3FMRA 4R1HA 1XN7A 1O3QA 1X3UA 2MD5A 5ICGA 2E1CA 1K78B 4D0PA 3BWGA 1I1GA 5K5RA 3D82A 4IRIA 4PDKA 1JUHA 2PTMA 4EM1A 1IN4A 3H1WA 3DP7A 2ESNA 4ASNA 1T0FA 2QENA 3P7NA 4I2OA 4G6DA 3J81Z 4IEUA 4UBGA 2UYAA 4LLOA 3GW2A 4MX3A 2VODA 2BBYA 2WTEA
chains in the Genus database with same CATH superfamily
3OF1A 2Z79A 5D6FA 2P7VB 2M30A 3KQ4B 2BVMA 5GAHJ 4EN0A 1TMF1 1O5LA 5LHHA 4HPKA 4AM3A 1W99A 3AP4A 3LFMA 2G7UA 2BY2A 5FUIA 2M2EA 1RUD2 3L1PA 5LASA 1JT0A 2P8TA 1E5IA 5JSRA 3R4SA 2CMPA 2Q2EB 1K5MA 4OLLA 2XXZA 2AO9A 5F5QA 1MNDA 3SFZA 1W03A 5IYDJ 3OCPA 4A3BJ 5G05L 3CP2A 2YPJA 2ZMEA 3RDIA 2R071 5KHKA 5C9AC 2VMFA 2DO7A 3WG9A 5T5LA 1OOPC 1RUI2 1FT9A 3I2HA 4GKYA 4FPOB 4QKBA 2Y9YA 1QDOA 4CCMA 4EM0B 1LAJA 3SEZA 1FOD3 1A04A 1VF9A 5LW9A 4EM2A 4XLEA 2FMLA 5LRRA 4U0VA 3EETA 3O0WA 3O6BB 4Y1ZA 2BV4A 3ZCOA 3D6EA 5DS9A 1ZBE3 3ASNH 4D8MA 1R23A 5A32B 1RUD3 1VQOI 4KIFA 2CUEA 4OQ8A 1XGSA 2MEV3 1OYIA 2ZX0A 1UF2C 1IG0A 1Z1DA 1DU0A 5LY2A 1IKPA 2DCYA 1UWWA 3E6MA 3HOSA 4FHTA 4LK7A 2OS2A 1KONA 4EMSA 1KDKA 5GZCA 5JOXA 5CFCC 2HFHA 1VAVA 3VBOB 5FLIA 1DYPA 2PQ8A 3HXLA 2R5YA 4DBQA 3OUIA 3BCWA 2HYXA 5KWRA 4U2AA 1T6GC 2E5ZA 5IW0A 4F52A 4F93B 3S5QA 3FHQA 1IN6A 3IH2A 1U0JA 4E8CA 4MGQA 1VMHA 4OMYA 5KHJA 3KV9A 1NK3P 3ZKYA 1XNDA 4I09A 1SLLA 3OGVA 1K5MC 4RAFA 4XVHA 1PUEE 1WFXA 1XMKA 2L02A 5FD6A 3CJTB 1I1EA 2IS1A 2HWE2 4BJ5C 1Z6TA 5T5OA 4BXFA 4FTBA 5GP9A 3DEWA 1D4M2 1YIPA 2BHYA 3PL8A 2QBYB 1DG6A 2ZEXA 2XHKA 1P4XA 1CQ9A 1S5LC 3VL8A 1Y1WJ 1LNSA 5A1LA 2VE1A 5C8CB 1BCXA 2JDMA 1SFPA 2LDUA 2B39A 2R4GA 1AXKA 4ZZLA 5C6CA 4FPLA 3BTAA 3QYBA 4QD2A 2P5BA 1W05A 5BNNC 1APLC 1NXD1 2JG8A 1HXS2 1TW2A 1LECA 2YFUA 5A3PA 2STTA 3SEQA 3PL0A 4JDMA 3OY8A 1SFOJ 1O6UA 2BGPA 4S2FA 4FI9A 3IBMA 1SCRA 2OF7A 3RKQA 3EDPA 4IV3A 1LOBA 1F5TA 3DPRC 4JAAA 3UETA 1Y3TA 4ZH4F 1SLBA 2GMMA 5C4WA 2Y0MA 5BNOA 1PO12 3UT0A 3JRBA 2EALA 4Q8KA 3CO2A 2GU9A 1ETKA 1SBDA 1GXQA 3FXRA 2XBO2 2K9QA 2D97A 4W1UA 3RGBA 2WBMA 1RUE2 3I3EA 2WAOA 4KBZA 1V6LA 2Q30A 2EZIA 1WZ2A 3IIIA 2EAAA 3MIDA 4Y5SA 5LHGA 3VDBA 1MZ6A 1Y9QA 1X8EA 3SCFA 1VQPI 3T2PA 3AVSA 2OQGA 3UKGA 2JT1A 5EP9A 4IW3A 5E8AA 1O5UA 1Q8SA 2OPKA 4L0PA 4IOCF 5J1UA 4BU2A 1MBJA 3H8UA 1N75A 2HEWF 4ZDPA 4DINB 3M1HA 3C7JA 1W2UA 1GQPA 3G1LA 1ACCA 4JGZC 4LMFA 3CEWA 5CG8A 3VDDB 4RA2A 2HDCA 5A7WA 4FTEA 3AB0A 5TRDA 3ZPLA 1W6MB 1LE8A 4D69A 1R5HA 2QVSB 3GCXA 2WZR3 4XAEA 4I7HA 4D7TA 2WAFA 2DU9A 4Y13A 2ZKNA 4Y1XA 3BDDA 4W6WA 1WD4A 4E4HA 3GZNB 2QQMA 3T09A 2YDEA 2XSJC 2LM3A 3WQ1A 5KXCA 2DV9A 1MMGA 3BZCA 1UFMA 3J7LA 4XF1A 5FY1A 1J1TA 1W9WA 4HKLA 1POQA 2OQRA 4IXAA 1GBGA 2EJRA 4M3CB 1T2XA 2ZGMA 3LIGA 4EJVA 4FPCA 3ZMZA 4EEFG 1FX5A 5DZEA 2O8XA 1XSVA 1TME2 2XJPA 4M6YA 2DBNA 3AVRA 3S1RJ 2ZX3A 5FPUA 3VBHC 5DN2A 2X10A 1ETYA 4QQLA 5I8YA 4LQRA 4XONA 1RUOA 3WP6A 1WGPA 2ZEWA 1LCLA 3FBIB 2W08A 2P3JA 2PELA 1YW7A 2H8RA 1W6OB 2MH9A 3M3OA 3WODF 3PDQA 5FP7A 1DGRN 5JSOA 2IVMA 3LAJA 3CLPA 3Q8BA 1VBD2 3H42B 4II2A 4PIXA 2PLYA 5FMCA 2F5EA 3SEEA 3DTEA 5C4XJ 5EHDA 4XSXF 5K4LA 2Y6HA 5FPBA 2GNMA 1W04A 1AL21 3J4UH 1W5SA 4Q0PA 2GNBA 2DFCA 4QDSA 4P5YA 4HDUA 2WLPA 2CFOA 1FI2A 3CJIC 3W5NA 3F23A 1JKRC 1WW6A 1WWYA 3ZYPA 3BP8A 3C7OA 2ELHA 4NIAA 1RHI2 3KB5A 1RYYA 3INAA 3S15J 2KIQA 2R16A 2QWWA 1FAYA 1DCSA 1W6MA 3FBMA 2IP2A 1UG2A 3KS7A 2Z1DA 2QNKA 1C1FA 3I56I 4IO9F 3ZFGA 1ULPA 3KEYA 3OBAA 1H0MA 1SLAA 3QPHA 5K0UA 1ENHA 1IZ1A 1YRNA 1C4RA 2Y64A 2NZ9A 4WVMB 4A5NA 5A2QZ 2VN2A 2BE5F 2WAAA 3DF0A 1OVSA 2RQQA 4FXGB 4CYDA 3GZ5A 3SH4A 3MIBA 5E89A 3AYEA 2VCCA 1O3TA 1ZN2A 1LEMA 4CXFA 2WABA 1BK1A 4NDLA 3ZQCA 4QQ2A 4IDZA 4YW2A 3MICA 3T0AA 3U2RA 5E1ZB 1R093 4BJ6C 3I4PA 3BALA 3JSPA 3NSTA 4CEWC 2JSCA 5KHIA 1SBFA 2OUJA 4UV8A 3F8BA 3U4XA 4NRPA 4CUGA 1XNBA 2HJIA 4ZZ5A 2A73B 3M1EA 2GMPA 4JX0A 1GP5A 1HV0A 4Y26A 3FWEA 1UY3A 2WSUA 3FLRA 3HRUA 4LHNA 4EWAA 2ZCWA 4FPKA 1N3OA 3W9AA 4U0WA 2HKXA 1ASJ2 3MUZ1 3GTGJ 1RMU3 5KXBA 1F2NA 3PO3J 3RJRA 5EZGA 4CCOA 4C1WA 1LHVA 4YFWA 2XJRA 1L0OC 2E31A 3PUHA 2HYGD 1XYPA 2HS5A 1UL9A 2KXLA 1LR5A 2LTPA 3POYA 1SBEA 3FXOA 4DBRA 4F91B 5C3OA 2OAZA 1UZYA 1REEA 4AVCA 2DTYA 2NM1A 4IEPA 3FK7A 2D5VA 4LB5A 3WW3A 4PGHA 1F36A 1QMJA 1KYZA 1T95A 3ZRGA 1JHHA 1ND2B 4C0BA 2DPDA 3VZMA 1PUFA 5LD2C 3K2OA 3SQOA 3ZFFC 1ZLKA 2L9SA 5F0CA 4L2NA 4LEJA 3U75A 3WOGA 3WTSC 4D6RA 2ECBA 2HOSA 3AZXA 3UGHA 3LWCA 4AEMA 1MKMA 3OYEA 4H7MA 3ZXEA 1GWKA 4KGGA 5FYHA 2HYFA 3ZYBA 1JE8A 3HR9A 3WW2A 2A1XA 2ELKA 1E3PA 3K75B 5K7PA 2ZZQA 3BG5A 3ML6A 2X8KA 2ZJCA 1UD1A 4F3QA 3EXUA 4OAYA 4BA6A 2O1QA 4LO7A 5F1JA 5HLTA 3H1YA 3HHHA 1J5YA 3K4KA 2KLOA 4XLFA 2R7XA 1UMQA 4I3PA 2GQQA 4IRGA 3I59A 1US2A 1MMAA 3MDPA 1RIRA 2NOGA 2C6YA 2MSYA 1AWCA 1ZBA2 1I5PA 2UWMA 2VC0A 2RR13 1VQ6I 2WNVA 5I0SA 4XILA 1Z6RA 4YNIA 3P9KA 4IE4A 5J36A 4XOTA 2YUEA 2IA1A 1QHDA 1NTCA 4AIKA 4NIHA 2K4JA 3POSA 1W2OA 1J58A 4L9VA 3ZQ7A 2D1HA 1GANA 3J9SA 4RS5A 2K27A 4FX0A 3QP6A 3PTYA 2ETEA 2XJQA 3THTA 2BRTA 3HIFA 1MQTA 1RPWA 1SVOA 5D8AA 5C9AA 2D5HA 4ZYEA 4L97A 1QJY2 2H09A 2HQ5A 1VMJA 1E5HA 4CTEA 5GALA 1P7IA 4L5JA 3LSPA 1GZTA 3IP4B 4E2SA 1W0TA 4M74A 5LRSA 5ERLA 5EZWA 4JTNA 2PFWA 1WMXA 4LBKA 3I53A 4QLCU 4HBNA 5DZFA 2FXAA 2I8DA 2XJVA 2C5DA 5A7SA 4JKKA 2DOAA 2UU8A 2E1MC 1X4OA 2PMWB 4R52A 1MS0A 2KZGA 3EUAA 4FP3A 1VZ0A 3EQLF 4MO7A 4LIUA 1QZZA 4LLGF 4AQ6A 4RMNA 1Z0HA 5FP9A 3BJAA 1REDA 4R9BA 4DZGA 4LTAA 1JYVA 1QJY3 5FUNA 3I97A 4RFRB 2FDGA 1QQP3 3VZOA 3EB7A 1X50A 1DU3D 4Q4W2 1HRV1 2DYRH 1Y56A 3PUIA 1A8DA 3OS0A 2KDZA 4BQNA 5FZ7A 3L9FA 2M9HA 4XICA 4PUSA 4YIFA 3V56A 2LKSA 3CUQA 2BYVE 2C9KA 3T2TA 2WBKA 2Y9ZA 2M8EA 2ZX2A 1PO11 3OL4A 2FCTA 5ACA2 5CPRB 3TRSB 1D0GA 2R3SA 5BNOC 1W90A 1LNWA 2JXAA 2Z4FA 4PFOA 3M3QA 4A5MA 3AKRA 1R22A 3FHAA 3GX4X 3UNPA 3KV5A 2G9FA 3BTCA 1W7PD 4H14A 3GLLA 4YIIA 2W7NA 1YXWA 2VCAA 4AVBA 2F5FA 3HUGA 4AK3A 1K7AA 4GH4C 1E5RA 3VBFB 3KPHA 5IT9K 1VQKI 5F64A 1MR5A 3KF5A 1UW8A 4UBHA 1W7PB 3MMYB 4L9JA 3GJBA 1BM9A 2DMPA 1ETOA 3SYTA 1T8IA 5IJRA 3HT2A 1DQ2A 2R041 4PLOA 1VBB1 2VNVA 1X36A 3WUCA 2A5YB 3QLQA 4C0HA 2HWD3 1LODA 4FPJA 3ZIXA 1SPPB 1CJDA 4XBQA 2X5IB 2ARCA 3KZYA 2XQXA 4GJZA 1P2FA 1XX5A 2P4WA 3ZQGA 3ES4A 4Q4Y1 4Z92B 2WDBA 3ZN6B 3KP6A 2ZGUA 1DPUA 4ES9A 5FP8A 1PK6A 4DOZA 3J7YJ 3GEZA 5H6RA 1XSQA 2BWAA 4X6RB 4AEJA 1YQAA 2MD0A 2F4PA 2G19A 5JZGC 1UB9A 2VZ3A 2FJ1A 2PAKA 2WA4A 4Q1PA 2Q8EA 4XRSG 4QPWA 3V0BA 4LULA 1L7QA 3MFCA 3N35A 2CO5A 4L5IA 2M3AA 5C70A 5FRAA 1S29A 4ITCA 1JJ6C 3LB9A 1VBC2 2X1DA 5EIYB 2IXSA 3JU9A 2GN3A 2R1BA 1DBNA 5IYCJ 3BYWA 3A02A 2QQ9A 4XDPA 3ZFGB 4R79A 1XNAA 2Z5UA 4XR6A 1OLTA 2ZXHA 1FTTA 4UHTA 1NUKA 2CG4A 3FKIJ 3K3OA 1VALA 1JH5A 2R0HA 4A3LJ 4GULA 1H9GA 1CQTA 2BTVC 3BC8A 3NW4A 5DMYA 3IAM2 3NEUA 2HWC2 4EJOA 1TBXA 2F2EA 3OYWB 4CDUA 3I4IA 2R7DA 1BEV2 5FYUA 3IB3A 2BOLA 2GH8A 4A3CJ 2L54A 2WA0A 4OIPF 1XC6A 3NWTA 3U4SA 2DVAA 2LLKA 1OLRA 4PI0A 1H4HA 3ETQA 5FJKA 1WHUA 2QUFA 4RD7A 4L8QA 4CU8A 4JGZA 3G6JB 2XHNA 3HNBM 4RGXA 5KVRA 2EV0A 2E63A 1KJRA 1ZZ8A 3ZYFA 1PMJX 5AFEA 1T6SA 1SMTA 1WMFA 1SZBA 2ZTNA 3DKWA 3ZMVA 1AXZA 3JUUA 3H7YA 4K1ZA 3POIA 2WR9A 3ZN1A 3K4DA 3S3MA 4P02B 2LY1A 2UXXA 3U10A 1AJKA 4HZFA 5FZEA 4OIQF 1W8HA 2R93J 2WLQA 1TWHJ 3CCLI 3SLIA 4CH7A 4WXDA 2W82A 2F48A 1BXHA 3RFRA 3IN9A 3A0HC 4TLGA 1UOBA 2DAOA 2W1SA 4ZDLA 2FD8A 4LLNA 1AUYA 1KITA 1FIPA 2PXJA 3R6SA 1ZBE1 1ZHFA 4XNFA 4OVEA 1JODA 3VBOC 3KZ4C 4K40A 3ZXSA 3NMBA 4K21A 1RUG2 3S6PA 3FZ3A 3ETPA 2JTVA 2VKVA 4YWAA 3V64A 5A2QK 2CQQA 3POEA 1C8M2 3DEUA 3Q0UA 4K6BA 4NJ4A 1UAAA 4AR2A 3AYCA 4D6QA 4XIKA 1IS5A 4ENJA 4HF0A 5C5TA 1ETWA 1RVF3 5CBLA 4BGDA 1DPRA 2VMDA 2HKOA 1GZWA 4UUVA 3LIHA 3G2BA 2GOXB 1OJLA 4A6EA 3O12A 3LSHA 2E51A 2QM3A 1ASJ3 2J1VA 1YW8A 3ZYRA 1ZREA 1PVC1 2IUWA 5ICEA 3M3YJ 2B4KA 5FYYA 3PFYA 1O7FA 4ASKA 3RJPA 5GM0A 3A03A 2E53A 4UVBA 2CSOA 2ZGOA 2COBA 3J81K 2NVXJ 1HXDA 4UT5A 4B44A 3ROUA 5JWPA 4A3ZA 4XMIA 2GM4A 1VQ7I 1OISA 4BB3A 4KL1A 2FQ3A 1WJEA 1OPMA 2RS52 3HRSA 4AI8A 3K70C 5KK1A 1FC3A 2GOMA 3AL0C 4E7LA 1MIJA 2O8QA 1TP4A 2QCOA 1O57A 5CFDA 3WHCA 1QVTA 2K40A 4YELA 3PLQA 2RDSA 2CJJA 2WV0A 2OIIA 3FXJA 4M3CE 1S6LA 1UYZA 4A6SA 3A4UA 2JZYA 2ZA9A 4MXWB 4XFGA 1OVPA 5FWEA 5D21A 4RAGA 3AP6A 1GFF2 2Y30A 2AGSA 2D98A 5D8AB 4ZS3A 3MZ8A 2IXHA 2B9SA 4ATEA 5L7OA 1HRI1 3Q3SA 4JGYC 4ISQA 1JYCA 2XR4A 3VBSC 4ZS2A 1A34A 4UI9L 3DPTA 5JXJA 1F5JA 1FOD2 2YZ4A 3LD8A 4PJ0C 2X1CA 5EV7A 5J8FA 4E7IA 4GWIA 5DCMA 1J7KA 3A01A 4HXCA 4ENKA 2DFBA 3MKZA 2VOWA 4N4OB 3F95A 3R0RA 5TGTA 1R1TA 4LKSA 4R9AA 2A6YA 5HNHA 3MWMA 2YBSA 3ZR8X 2RV9A 3VBRC 1HJFA 2HQAA 4RB2C 3C2BA 2DBBA 5E1WA 4QKFA 2ICWG 2BVBA 4MOAA 2DN0A 4P9IA 5AONA 1BQPA 4CUAA 4IQJA 1MEC2 1S7AA 1H1AA 4LO4B 4DUXA 3IWZA 3UL2A 3DCFA 2OTLI 2LY2A 3ZSJA 3F8MA 3THDA 1HLCA 4D7SA 4LFUA 4HQMA 1FBQA 1LQ1A 4K2EA 1J75A 4IOAF 1QXPA 1SEUA 1LGNA 4NIDA 3HM5A 4ITVA 3TL4X 4NRQA 2FDHA 3CJQB 1MS1A 1FZPB 2KD7A 3ZOIA 3HKZN 3T8RA 3VBOA 3OYIA 1D4M3 2XB0X 5DAXA 2FCUA 4HKWA 1E0EA 1XPWA 5FPZA 2XUBA 4H7LA 1V4RA 1L3LA 4G9YA 4D3WA 2D6OX 4GMP1 4BCUA 2R7UA 3NNJA 4MXWA 2W92A 2F4LA 1NCQC 2QQUA 1R1VA 2CSGA 3TAYA 2TUNA 4Y1VA 3LEKA 3GHMA 3GLXA 2P3IA 4UXNA 2ZBJA 3TO7A 1RUF1 5A6QA 2HWVA 2V4AA 3PUSA 1B4AA 3JRFA 2HEYF 5DD4A 2Y75A 3QPTA 1ON2A 4AI2A 1MVEA 1ZLJA 3J7AO 3Q9SA 3VYUB 3M4OJ 3CJIB 1G9CA 2OQ7A 1R58A 2MFZA 4ZXKA 3HOZJ 4MVTA 2CW8A 2GP5A 2DXIA 1IRGA 1ENSA 4A6DA 4KITB 3WGHA 3CDHA 2RMU2 3OSDA 5J48A 1Z3XA 1K61A 4WVVA 1XGNA 1CZTA 3FMQA 5F6KA 3AJZA 2A05A 1QQP1 1H6XA 2HOEA 3L9JT 2JECA 1W6PB 4R8HA 3J7NA 5IK5A 3OUHA 4YW1A 1K79A 3W2VA 4BLJA 3ZLIA 3TP3A 1VRH1 5IP6A 3IKTA 3M9AA 4B4CA 4E6KG 4KU8A 4W50A 1I39A 2MABA 4PJLA 4LGWA 2P3KA 1AF9A 3HD8B 2NRAC 3CZUA 5JR3A 1CF7A 4I30A 1HCRA 2VQAA 2JKBA 2VTFA 3NNMA 4FOYA 5L9BA 2D45A 2BOJA 3RVHA 5BQTA 3KMHA 4BAYA 4H2AA 1KXGA 3DPRB 2WNVC 1HC8A 2LH9A 3IIAA 2J42A 5CYYA 2JA6J 5AIQA 5I0UA 1LDDA 2ZMKA 3A1YA 1AZDA 1YJKA 3N9NA 2H94A 5FAXA 2WWYA 1FWZA 5A7WB 3I7DA 3E1SA 5AC91 5FPXA 2ZJ2A 4DY5A 3SNMA 4AI0A 4QDQA 1OXCA 4H0EA 4PQ9A 2RDNA 4M3CF 2DI3A 1ULGA 3ZYHA 5H9PA 1Y4WA 3N36A 3LFIA 3PUQA 3K1MA 3OIOA 3M8LA 1UYPA 3SKVA 2EB7A 3CMGA 4YPJA 3QODA 3LSTA 4IZZA 2P37A 4R9CA 3HYIA 3VFZA 2R92J 1WCKA 1Z7S1 2RS32 4Q0SA 4OMCA 2VQTA 5J37A 3AM2A 4QQHA 3FE5A 2FNAA 1WW5A 1FEXA 5HCBA 2PHWA 1HN1A 4GH4A 3PTRB 3MEPA 4HQEA 3OBZA 5APAA 3BCAA 2KPMA 5L36A 2ZXIA 1BA5A 2EZKA 1D5YA 3SC7X 1MQTB 3D1NI 2DA2A 5F6FA 1IGOA 2ZKLA 1ZR4A 2RM22 2GSYA 5M5WJ 2NOJB 1JHJA 1X58A 1Y0UA 4KMQA 4XCAA 2P6TA 1MZEA 3OGSA 3FXLA 5E3OA 2UWCA 1G8WA 2EIBA 2JG8C 5A7OA 5GTIC 5IT3A 1IN8A 4UV9A 1P8JA 4W97A 4YSFA 2JDPA 4BIFA 3OYDA 5FMOS 2DTZA 1DGWX 2NS7A 1AYN3 5DV5A 2XASA 4I0AA 4XFCA 4KNYA 4M4RA 5FXVA 3ELKA 4L92A 4DRVA 3J8F3 2Q0OA 2UWAA 1GDTA 1TWFJ 4AG4A 1RINA 4FSJA 1AR62 2XAQA 2DFHA 1YNAA 3T5XA 3OV8A 2PBIA 4D9JA 5EFUA 1P92A 1UU5A 4OWRB 4EQVA 3HQXA 1STMA 3SHFA 1FOWA 2Z3YA 4META 4BXUA 1F4HA 3ALQA 3SXWA 1DYOA 2GIVA 1D0XA 3AKQA 2MPFA 3OSGA 3GTJJ 3N9QA 3OS1A 3NRUA 3J8F2 5C5UA 3V8LA 3ABZA 4CHUA 2ZNZA 1DP3A 2VXDA 4MHUA 4JX6A 1RETA 4KG0A 2B9UA 3K1NA 2WA3A 2F4MB 4YVSA 1G9FA 3HUGB 5KHGA 1H8VA 4QTRA 4MTDA 2W68A 3VBFA 1TG7A 4D5FA 3ACGA 2WY8Q 4MGKE 1I6XA 3A23A 2P7CB 4LJHA 1RMU2 1H2MA 2VE8A 4BXXJ 3LSKA 1WW7A 3DPUA 1PP8F 5FY5A 1X1BA 3QBQA 2PLV2 1XG1A 4KN4X 5JDBA 2VXJA 1F9NA 2V72A 3QH7A 2QSGX 2X05A 4NNJA 2UURA 4GKXA 2YGLA 1X4PA 2XV4S 1KQ0A 2ZXWH 4Q48A 1OKRA 1AR71 2R1DA 1T08B 3W20A 1OSGA 1FNNA 3JTHA 4XKCA 3R60A 1AKHB 1QJU2 1HB4A 3JRHA 2R49A 1GQGA 4G7ZF 3MLKA 2W39A 1DGWY 4LK0F 2CV2A 1IDZA 5AC93 2X53S 1TZOA 3J7HA 1V5FA 3NJZA 3WNOA 2QBYA 2TNFA 1JHNA 5F2SA 5JVTA 2R7FA 1UIJA 4CP9B 2XF5A 1HBXG 4H55A 4DJAA 5ICGA 1XNCA 3D4KA 3BWGA 3H8OA 3D82A 4IRIA 3HOWJ 2ZOEB 2PTMA 1VBA2 3GXUA 1RUC2 4XABA 3DP7A 4WM8C 1T0FA 2QENA 1NQJA 4C30A 1CX1A 3A21A 4MIMA 4UYBA 3OPWA 2FDFA 3VBFC 4MX3A 2EIEA 1Y1VJ 4M00A 3UK9A 4YZ2A 1VQ8I 3O1SA 1RUH3 2JX9A 1YWKA 4RGUA 4LOTA 1RR7A 2VLAA 1KQ8A 2EF6A 4GDFA 4CP2A 3ZMUA 4XBLA 2FEZA 4CEWA 1W3XA 1RJ8A 2TEPA 1QHHD 1XJAA 2QQPA 2RG4A 4OULA 5IVEA 4LMYA 1TC3C 2MG4A 2PX9A 4IGOA 2JEMA 2VT3A 4HKOA 4LK6A 2OCEA 2XPUA 4CU7A 4IGQA 3HWJA 1WUVA 1JUSA 2VMGA 4MQ9F 1OLMA 4QX7A 1V3FA 5A1FA 1MEC3 1MS9A 2YB7A 4NWVA 4JGYA 1EKEA 3LAPA 3ZQIA 1P7JA 4A41A 1HXS3 1MVQA 2BXZA 1RIOH 3MLJA 5EWSA 5HXVA 1URXA 1PIV2 1BI0A 2DA1A 3LKJA 3AJYA 4FT8A 3ITQA 1V5GA 5AVAA 5JVVA 2BGOA 2Q0AA 3WF2A 2W84A 3CMYA 5FYTA 3BLYA 1TVGA 2VBXA 1XNKA 1HQWA 3WNLA 3BUCA 1N1VA 1SLIA 1HKTA 3GCWA 4OZXA 2LY9A 5FZ9A 1QH7A 2RN7A 2M8GX 1VB4A 4IJAA 5K5OA 2R043 3TOAA 3KZZA 1ZG5A 4EJUA 3OOPA 4RS5B 5LHIA 4LBMA 3BIWE 1IDYA 4ZYHA 3PVBB 5F37A 3ZO0B 5LBQA 3KP3A 2XB5A 4AGVA 3NAUA 3W2AA 3T8TA 4HK8A 4HAMA 1OCCH 3VHRA 3O2PE 4I76A 4Y1YA 4NAMA 1V9U1 3RYKA 1CF7B 1DZTA 1X2NA 2XH6A 1O3RA 1F35A 3CF6E 5KHHA 3MKYB 3QYEA 1T38A 4XDOA 4B4RA 1UHWA 3CTAA 2W5FA 2CV0A 1FNYA 3ZFEB 3U0ZA 1ITYA 2CFXA 3QH6A 1GUIA 4KIGA 5FYIA 2F5VA 1W3VA 5GKAC 2GXBA 2C0ZA 4V2WA 1JI6A 5FCCA 3APBA 1KU7A 2FDJA 5JIUA 2C6SA 4OZOA 3FKJA 4GXOA 1NHAA 2D3RA 3TQNA 3IC7A 4UNOA 5FQ0A 4XACA 2XROA 2VH9A 4XIDA 4PLNA 2WFF2 3ZQFA 4DRRA 1BN5A 1ZA7A 4QSHA 5IT6A 2AS5F 4M3FA 3MEXA 2A3SA 5CB7A 2QZ3A 3I9V2 5FMBA 4P14A 5D1IA 4ZZDA 2PMZA 2XLFA 3ZMOA 2JE7A 3HQUA 3C7HA 5CNAA 1HB2A 4AYUA 2LOOA 3WV6A 4COZA 1HRI3 4B48A 1RUH1 3MFAA 3TN91 4C91A 3RNSA 1EAH1 1GP6A 1DDNA 3SKJE 3ZGKA 1OA4A 2D43A 1ZVFA 5ISLA 1HSJA 1J2XA 2F4IA 3OYFA 3TEZA 4P9JA 1N77A 3I2JA 3ZDSA 1VBE1 2V73A 5FO9B 3PIGA 2VQGA 5HOOA 4W6YA 3SITA 1QU3A 3H8XA 2VZSA 1XCBA 4C3HJ 3I54A 4N0BA 4CSWA 1LFUP 1EF4A 1NK2P 3GMEA 5FZHA 3OIPA 5CA6A 4EYUA 2CV1A 4UFJA 3LGRA 3GFIA 3AYAA 4OHXA 3WF3A 4RLFA 4OHZA 3WNKA 2J1EA 1SD7A 5DUUA 2GZWA 3PMEA 3CF5F 3AAFA 4A0XA 1IN7A 2EAKA 4ZZ8A 2YBKA 4NN0A 1IV6A 1FSEA 5HLIA 1PJRA 3DXJF 2QCSB 2VKEA 2X48A 5FDBA 2KKOA 2QQ8A 3WP5A 4XKVA 2JENA 4BNCA 3DPLC 5HDNA 4LB6B 4DYCA 2R073 3RMYA 1B35C 4Q4X2 2HVSA 3DTKA 1U5XA 4EWEA 5DDJ1 2KIFA 3HBZA 2PA7A 3V8JA 4LUKA 3JRGA 3KGLA 1V6JA 5GZGA 3PFIA 3ZSLA 2ORXA 1EV11 1WJBA 3ZXLA 4GJYA 4INDA 4P08A 1JW6A 2OQ6A 4K7JA 4XEZA 3POBA 4Q0UA 2DMTA 3U11A 3EUHC 2H0VA 1W5TA 1UOJA 4FPFA 4FBFA 3T1MA 2HQNA 4TXWA 5FYMA 3K6GA 1USTA 3EQEA 3LDBA 2E6VA 4J01A 3QWLA 4XXAA 4TWTA 3CL1A 1A31A 1W4MA 4RR3A 3VBSB 1KS5A 3BN6A 4LPLA 5HI0A 2QSFX 2IWGB 3ZPYA 4D7NA 3HQRA 2P2KA 4XHXA 2XGCA 2MW8A 1AJOA 4YVWC 1SG3A 3RZZA 4LBLA 2E1OA 2GH2A 1H89C 3K46A 4A7YA 3VODA 2ADDA 1APNA 5F08A 4XLHA 5LB6A 2ME0A 4CICA 2JE9A 3OYCA 2VR4A 1OI6A 4W6XA 3N7LA 2WT2A 3IT8A 1ZR2A 5KNLA 3B73A 1SACA 2VBWA 4BE3A 2WJSA 4V2GA 4KU7A 2F4OB 1WVRA 2HWB1 3O0VA 2JRMA 3KVBA 1JOBA 3USSA 1BI2A 3DKQA 1BMV1 1IUYA 5HCHA 1QF3A 2D2WA 3N9MA 3PVEA 5ILVA 2IS4A 5J1RA 3CF2A 1HKQA 4XCBA 1R081 4AD9A 3LQCA 3AKSA 1YLFA 1FMD3 2PHXA 4AEKA 4RSUA 5E1XA 2CUFA 2VASA 1EV13 1FV3A 3VD9A 2FMYA 3W58A 4PBOA 3WF1A 1RUNA 4LXLA 4HYEA 2EFPA 1MBHA 5J1XA 4AAXA 1FJLA 5L73A 1QPIA 1WLDA 4J6GA 5DM7F 4LHLA 4AVSA 2K9ZA 1X3WB 3JBG2 5FKKA 3GDBA 2LW8A 3IL2A 3NVCA 1IPJA 2XAHA 2LKPA 2Q1ZB 2CAVA 1QJU3 3G1MA 4XMYA 2OUMA 4CXYA 2X4HA 1EV12 1D0YA 5KR7A 3Q0VA 2IC1A 1SVLA 4F3JA 5E6HA 1PX3A 1XDSA 3O8HA 5JAXA 3VBRB 3GF6A 5A7PA 4QPIB 4OFGA 1VJ2A 5FPAA 1DQ4A 3GM8A 1ZBA3 3O14A 1HW5A 1R49A 4KG8A 4LE3A 1WPKA 4YFKF 3F6OA 2BP6A 5KCMA 3PIOF 4BQ2A 1YJ9I 3NL1A 2QQWA 5C4WC 1WCUA 3OD4A 1HJGA 1ENQA 2ZHNA 2HEVF 3CUQB 1ULFA 3F22A 5BV6A 3WHTA 5K5QA 2XF6A 5F1RA 2KDOA 5H9RA 3DL3A 4CP1A 5JOYA 5HODA 5FZ0A 3SZTA 4HOOA 2CWEA 2XVCA 4CCJA 3NKTA 3P3NA 1YYVA 1OPOA 1DUXC 2RDQA 1P9QC 1XSXA 2OT7A 1K6YA 3OR2C 3QRFF 2L9LA 3K3NA 5FPVA 4BM8A 1OOPB 4TTGA 3K4CA 1ZRFA 1Z3YA 5FKNA 3ZMDA 3IKWA 1WMDA 2VAUA 3SMHA 1VAMA 4MXVA 4M73A 4KJZA 4S2GA 3SCHA 2W9XA 2ET1A 2RS11 5FP3A 4AI9A 1BOAA 3ZR6A 4MGYE 4LHKA 2NYXA 3OIQA 1R36A 1RKTA 2OJED 4Y22B 3U1KA 2WV1A 3GTOJ 3Q9OA 4NAOA 3A4CA 4IERA 2ZJPF 1A6CA 3L2RA 1OCTC 4CDWC 1S9HA 2JKXA 1JTXA 2E5NA 5B66C 3A2KA 2PQSA 3MV11 3WNMA 4M6XA 1V9U3 2NNNA 2LS6A 4L0YB 4NWWA 1B8IA 1QNTA 3OYMA 1IG3A 3FC0A 1YIOA 1OA3A 1PZ7A 4K20A 2OC6A 5FMDA 4UFKA 4FE7A 3ZVXA 3TWIA 1R4MB 3R4KA 1PK6B 4HNTA 1TNTA 1BJAA 3CC4I 3SXYA 1W8ZA 1R5GA 2BQPA 3AFHA 3AYDA 4GMP3 1Y8QB 5BUVA 2ZABA 1PMIA 4C8DA 3S57A 4FFFA 3NARA 1FATA 2RVAA 4HNUA 3HN3A 2WIIB 4WWCA 1UAIA 2CW0F 4MYEA 4X8NA 2E7QA 3T08A 4QXCA 1XOYA 3CCEI 1V9U2 4QXKA 1IPKA 3UV9A 2VTXJ 2NMOA 1X9PA 3AP9A 3PUAA 4IHYA 3M4FA 3H9QA 2LALA 4IV1B 3S3NA 4IQ4A 4NROA 1OCRH 3O5SA 5BS6A 2WNOA 3Q0WA 3KETA 2W57A 3QU3A 1O4TA 3S5AA 4HN0A 3H5AA 4DEVA 2FBEA 3TEWA 1BZWA 2N8GA 2HBUA 2DUQA 3JQWA 2LRPA 4E7ZA 5H9QA 1TE1B 4YW7A 1MJAA 2EXHA 1N1YA 4BDZA 5GJ6A 1VB2A 3QPLA 4B09A 5A7QA 5JOWA 3HOVJ 2V4JC 2V1UA 4Q1RA 1CR7A 1FBSA 2EA7A 2VCBA 3NJVA 2HTJA 3JRDA 4CDUC 4GGGA 1TL8A 3FZVA 3EYPA 2G4IA 1J3PA 1JU4A 3OL3A 1DZRA 4YGBA 1H9WA 2GN7A 4UUTA 1UO9A 3VUOA 2DT5A 4WCGA 1VQ5I 3SEPA 1DGLA 4RGSA 1FMD1 2IXCA 2F5CA 3U37A 2CL2A 1RJ7A 2P6CA 2UYBA 5FR3A 4RFT0 2EIJH 5D4RA 4YM2A 3NJYA 2ZAHA 2JD9A 2VOTA 1LHNA 4MGZE 4JHZA 3BJOA 1EV7A 1QNYA 2VKHA 2I45A 3VLBB 2VPRA 1VP6A 2DUPA 1XGOA 2XGDA 3CC2I 4U36A 1AX1A 3I2OA 2LYCA 2TCTA 2WL1A 4BQOA 4XJAA 4XE9A 3IDEA 3GBFA 2VJ4A 1X9TA 2K2SA 1AR83 1WBFA 1NZCA 1YQCA 2UY9A 1NG0A 5FZ1A 4RGAA 5IVYA 4Y22A 5CG9A 2R5ZA 2JDZA 1IQDC 4IXLA 1E5SA 2MEV1 5GTHC 4P00B 1VFCA 3T0BA 4ATFA 3ABLH 5BPIA 1UY1A 5FOJB 4E8DA 4A44A 1BJZA 1I6HJ 4U7DA 5L3CA 3DEMA 2VVFA 1WCSA 3CC7I 4FASD 4O65A 5FY8A 1JKOC 4S2HA 3GTMJ 4EN9B 5K1YA 3P5BA 3H5NA 2KMUA 1GLHA 4P9WA 5LBBA 5BOXA 2VBBA 2OKXA 2L4MA 4EZHA 1D1AA 2DPUA 4QGNA 1ZARA 1Q8PA 5KXEA 2IA2A 1BLZA 3DV8A 3BR2A 1MH4A 3OOXA 3K2ZA 1UOGA 3K4ZA 2UXNA 3DUIA 4MGTA 1XPXA 4I99C 3ULQB 4JTOA 4A4AA 1XD7A 2R7TA 3TGNA 4PCQA 1YUDA 2B63J 4COUA 4LITA 1BW5A 2JDNA 1BMV2 3QP5A 3WG2A 1LULA 5KC6A 3RI4A 3I2FA 1XYOA 1OH4A 4FISA 2EWNA 4QX1A 5J96B 3NQOA 4Z1VA 4N53B 2EFWA 1RKWA 1X3ZB 2J5OA 1TMF3 4PDWA 4B43A 1IRXA 1QGLA 3L2CA 2BPA2 4HETA 2XJSA 4BHPA 2FNPA 3WD5A 1AR63 5AFBA 3HJRA 2M34A 1LDJA 1ZM1A 1KYWA 2O8OA 2VGDA 2XB6C 2KT0A 1TZLA 3ZXGA 4C2UA 1EY2A 2AC1A 5JR2A 1W39A 2K86A 3WU2C 1CVNA 4PZJA 1RITA 5I8TA 3ACLA 1WI9A 1W2TA 4KICA 5CVIA 2VZPA 4W65A 2B8MA 2ZGLA 5DXDA 4DEQA 2L0KA 3I64A 4RQPA 3EMRA 1MMNA 4R9DA 4KGQA 1VBE3 3QYFA 3OGGA 1UXXX 3HTUA 2M0CA 3I2IA 4BQXA 1HW2A 1M4WA 5I0RA 4E4ZA 3S3OA 3UNGC 1L7RA 5JXHA 1OYYA 4A0YA 4BEHB 4OINF 2BFUS 3OYHA 2VQHA 2OA4A 3BCBA 4WM8B 2JA5J 2JA8J 4A3GJ 2A6VA 2L5QA 2JDKA 1PNFA 5A3TA 4IEZA 3I4MJ 3C1DA 1X82A 4NHLA 4HDVA 1F1ZA 4QPGC 5FD5A 4G7HF 5IFTA 3VGIA 4IL6C 2JIJA 1C57A 4UB8C 1QU0A 4CZCA 4U87A 1V6MA 4YGDA 1OKQA 4AU7A 3ESWB 1T39A 3CMMA 2ZGRA 2TRTA 1ZELA 1DZQA 4UW5A 1K78A 3HOYJ 4Q0VA 1LESA 1DGRM 3WE2A 4G7OF 3G3ZA 2B5HA 1ND3B 1CX4A 3FFQA 2BFUL 1X1AA 4D5CA 1AR93 1R6RA 1JZ3A 2BV6A 4M3EA 3CCSI 3GBGA 4JGZB 3FFZA 1H8TB 4JRLA 1SQ4A 2WNUB 3JAMZ 4AL9A 3I5UA 3GF2A 1QWRA 4AVTA 2PG4A 1OKOA 4TYSA 3H9JA 2HU9A 2A3WA 2LSOA 4XQ4A 3QCWA 2YBPA 4QMAA 2W46A 1QJX1 2ZGNA 4B3AA 3ILFA 2P3YA 3I2DA 2IGNA 3RMXA 2EH3A 1PGW2 3B9IA 3K0LA 3CCVI 4BUPA 1AA7A 2WY7Q 3C7GA 2FA5A 3UGGA 4OCTA 2EV6A 5J40A 3HTSB 2P81A 2RDPA 4IEOA 3OD0A 2L01A 4UW4A 3M3EA 1OYWA 4K8RB 2ZC2A 3VD7A 2VIXA 5BYNA 3BR5A 2VBYA 9ANTA 4Z2WA 1SFUA 1RZ4A 4JCKA 1HQCA 4C1XA 2WQ4A 4XKBA 3SCGA 3NO8A 3W6VA 4Q5SF 5C3RA 1FBUA 2W25A 4M9XA 3MUY1 1ACIA 4RB0A 4XJWA 4OI4A 4AW7A 3GZTB 1IG7A 4CCLA 1PO13 5LA1A 2ZHKA 4DUWA 5DM6F 4A45A 4WVMA 2DVFA 4CDWB 3LFKA 4FQ4A 2YPDA 2XBO3 4LO5B 1VRH2 4FQZA 2ZGPA 1XXNA 4JHTA 1XMAA 1AVBA 2W47A 5JHFA 3HJEA 4OHYA 1V54H 4B47A 4CEWB 2ID4A 2GALA 1BVP1 2XVGA 2K9SA 4XRFA 3IMNA 1PIV3 4UFIA 3LQRA 5DD8A 1DLCA 3DBLB 4RHV3 1HRV3 3HPNA 2YX7A 5DDGA 4LO6B 2MGQA 4G6TB 4AFAA 3WR0A 4PIZA 1DQ1A 3LFUA 5FKCA 1S0JA 3LMMA 3Q5FA 2RS12 3E6BA 2EBIA 2ADEA 4CDXA 5TSWA 3JXSA 5A3OA 3D0SA 1Z91A 1XU1A 2QJVA 5FZBA 4FE4A 3BOQA 1B72B 2XPJA 3P1IA 4LBQB 1IS6A 1ETQA 1R1A2 4M72A 1PIV1 2OPTA 4NVPA 1Y8RB 2XMLA 2DCKA 4FPHA 3WSOA 3ABUA 1B9MA 2JVHA 3IHUA 3TP0A 3BR6A 2KRCA 3MF9A 4QQOA 3UKTA 3I49A 1V00A 5SV8A 2LUWA 2LBFA 1GMMA 2ZKZA 5CLSA 2ZGKA 1OPCA 3M8EA 5D2AA 2QDRA 2MBFA 1QIQA 1OD5A 4FETA 3AKPA 1FYLA 4W8JA 3RS6A 2LVSA 2QA4I 1ND3A 1B35B 4BK5A 4MSVA 1ZGJA 3J80K 4OI1A 3RYRA 5IOYA 2RC4A 2N7GA 4XJZA 1CONA 1LOFC 5FFZA 1I1SA 5D4SA 2ES3A 4AVPA 3D5SC 4YVSC 2K3FA 3RIRA 5JPMB 5EEGA 3E5XA 5FRMA 4P9FA 2PN6A 3E5QA 4XXPA 2VD7A 3DBHB 5BNOB 1GV9A 2SBAA 1O8PA 3RCOA 1YI9A 4LO8A 1PO22 4QIWN 4LD5A 3CMAI 5F04A 2VOXA 1JYTA 1H2LA 2GNDA 3QAHA 1LGCA 4K8FA 1TW3A 2DU1A 4Y33A 3N9PA 5I0TA 4YG2F 4QPIA 4N4NB 4L11A 1K4SA 5EEHA 1B59A 1CD3G 2O7OA 4HOBA 1PM4A 4QPQA 4IE7A 1PYVA 3KT7A 2ZSIB 3ZXAC 4U0YA 1RHI3 2L3DA 3PHMA 3A0NA 5GZFA 2P6SA 4V1PA 3MYXA 4F83A 3TBIA 4XN3A 2LTNA 1MS8A 3CJIA 1IC8A 1BIAA 5ABJC 5HDKA 4QGLA 5M3FJ 3OR1C 5HS9A 1N3QA 1PO23 3N3HA 3ZR5A 2FD5A 3J7ZI 3ZSEA 5LBCA 1MPXA 4AQTA 3HOTA 1AR82 1UY2A 3RZMA 1QHGA 3AP7A 5FYVA 4FTHA 4JQFA 2KZVA 3C18A 3TEYA 3FX3A 3AZWA 4LA2A 1U5ZA 5FO5A 1HB3A 1G8XA 2O61A 1D2QA 5A3LA 3VYTB 4XQFA 3PNTA 4GRIA 1BHGA 1OC1A 4LUMA 5EZHA 4QT6A 4P1WA 4BQ4A 2K02A 4Y7NJ 1UZ0A 3T4VA 3HPGA 3I0TA 4Q8LA 1SD6A 1S0GA 4EN7B 2HDDA 2HGCA 4YEJA 1ZRDA 1ONAA 5IOZA 4XLAA 5A80A 1LHWA 4CEYA 2E19A 4GFBA 1C0WA 1SDWA 3E1F1 1OUXA 2B45X 1O4ZA 2WT0A 5IPAA 4XOPA 2QVOA 4QXBA 2FBKA 2NS0A 4XPVA 4YW5A 4PF1A 3ASOH 4YM0A 3F72A 3E0JB 3AMMA 3UYJA 4BL0B 1US3A 2WKKA 4LBNA 3HSFA 1WJ5A 5DDJ3 1SFKA 2RKHA 4FOWA 2A6WA 1I5ZA 3PJYA 4CDXC 3LOBA 5LZ6A 4XRSA 4CA9A 1ZA4A 2ZJQF 3CUQC 4IEJA 1DDLA 1N1TA 1W0OA 4D0QA 3KT1A 1Z7S3 2DCEA 1GLNA 4Z8BA 4RS8A 4QQPA 5SV5A 3OYNA 1FYUA 1MS5A 2EXKA 2OX0A 1ETXA 4Q4V3 4CCKA 2AREA 5D6EA 1R7JA 1W5CC 1FX7A 4KQ7A 3J7MA 5IT9Z 4B1RA 4QX3A 2Y0SA 1Y6IA 2XUMA 3WTXC 2YU9J 5FKBA 3WQ7A 3B02A 5C8CA 2AQFA 1CAWB 4OHWA 3FL7A 2LREA 4XUTA 4A3DJ 4WXCA 4P9XA 5FZKA 3IDCB 2Z16A 2YR2A 5B4XA 5IYBJ 2YFZA 3VOEA 3SHRA 1MSEC 4XLNF 5LGUA 3POFA 4RGKA 2LG4A 1MBFA 2G9GA 2NVUB 1AHDP 3H3ZA 1HN0A 2FU4A 5K9YA 3NJXA 3VDAA 1B09A 2OV7A 2DQRA 2RM21 3HGGA 3ERED 1EAH3 4M01A 3JD71 2X5IC 3ZYIB 3AL5A 1DQ5A 4BQ1A 1OCZH 2ECCA 3OY9A 3BVCA 5C4WB 3HZJA 4LKDA 3WG7H 2YY1A 1G59A 2W1UA 4B1MA 1XB4A 2WWUA 2J22A 2KQRA 2LMDA 3LNQA 5IY5H 1PGL1 2VQLA 2K46A 1H6YA 3HRTA 2E26A 1JXSA 2IBDA 5F9TA 3MF6A 4C2TA 3U21A 1JYWA 5A3UA 4OUSA 4ENNA 3AFKA 5JVGF 2A6ZA 3CLQA 2XL9A 3R0JA 4OMDA 3K51A 2D93A 3HDDA 5CEHA 2FOWA 3LSRA 3FHNA 4IUGA 3LF7A 4GH4B 1LGBA 4II3A 4AVVA 3WP3A 5D8KB 5C8WA 4XZUG 4GALA 2PMHA 2YPRA 3DBRB 3B6CA 2WB1A 4I0BA 3F3XA 4Y4YA 4GWNA 2ZEYA 1GT0C 3N7MA 1USSA 2STWA 3UKVA 5JMCA 4KNCA 4UUSB 3GVAA 1ZQ3P 2XKOA 1K42A 4FOVA 1SMYF 3GO5A 2PN5A 1NLSA 4AFCA 4DO0A 3H1CA 4IV3B 2X85A 3QACA 5T5JA 4JBAA 2WO2A 2VBDA 1LHOA 3HHGA 3CZJA 1NX9A 4KIBA 5E3MA 1SFXA 1G9AA 1RESA 1MJBA 4Q0QA 3RQ4A 3OYWA 3JW4A 3BROA 1LENA 4G9SB 2CS3A 1LOEA 3MKWB 5F3CA 2EA2A 4Y52J 1VBB3 2H0BA 4CDUB 3ZFEA 4G94A 3J80Z 4ZC3A 2A69F 3VBRA 3VZKA 5JZGB 3O0XA 1JTYA 1D5VA 2GC1A 2ISZA 4HX4A 3HNYM 1K4TA 1TLHB 3FMRA 1S0DA 1K12A 1AX0A 1VMFA 4Y1UA 5K5RA 1TWCJ 4KH9A 4PDKA 1BBT2 2CQNA 2G9ZA 1IN4A 4ASLA 3H1WA 4ASNA 2LFBA 4XN0A 3C2GA 1PHMA 2XVLA 4AEDA 4ISRA 4LLOA 3NAPB 3O1RA 4RYDA 2VZVA 3ZPOA 3IZOA 4CVUA 2QQAA 3BU0A 2JJ7A 3M3IA 2HZDA 5IP9J 2JICA 5CKNA 3RZKA 4MFDA 1JOPA 1RUE3 2A71A 3H35A 5F3GA 5LWBA 4AI3A 1DQUA 1EH6A 4KMFA 1CIWA 4E2QA 3F9KA 5FLVA 1VRBA 4QM8A 2ESHA 3AKTA 2LKXA 3B69A 2VUMJ 3I4NJ 1OOPA 1EUTA 2A6HF 2E9QA 2QQIA 3PJRA 3BKZA 4EJTA 3HB9A 2RREA 1LUJB 1B1BA 2CNAA 2X6YA 3EYIA 1ST8A 2XLAA 4XUNA 1WKYA 1EPWA 3OTFA 1KA8A 3LSJA 1C5HA 2WN2A 1GZWB 2HWD2 3D5OA 4HRIA 3VHOA 4WF2A 5CVVA 1AYM1 3JD73 1BI3A 5J98B 2L4AA 2WFF3 4LOCA 1HKDA 2P34A 2DF7A 4BACA 4YG0A 5FTTC 4IHSA 2X51A 2VQ0A 4JP0A 1UJ8A 1UY4A 4ZU7A 2Y0OA 3I58A 5LATA 1YIJI 2D44A 2NS8A 5H6QA 2CGPA 1PGL2 4WVWA 4QB2A 2E35A 3S2WA 1Z0XA 1PDNC 4XC9A 1KQ9A 2XLGA 2GXAA 1TME3 4GMP0 5IVJA 1Q5OA 1JMUB 2ARBA 1TQMA 3CDLA 1RTVA 4YG3A 4GYIA 4M4PA 3LDKA 4RA0A 2XIGA 5A6XA 2A7AA 4Y5TA 3ZMSA 2BBAA 2VO5A 4DQAA 3S16J 2QKMB 4Q4V1 4E7KA 3V0AB 3WP4A 2VOVA 3TMOA 4E4DX 2ZGQA 1VQ9I 3OYAA 3C8XA 2VUAA 2B46X 5EG0A 2V4VA 5D5XB 3KX2A 3TDUC 2J1TA 4OU0A 2OBPA 4BWOA 1MW7A 2R7RA 4WM7B 3HL2A 4ANJA 1S8NA 3FISA 1DGRA 4XF9A 3PVNA 3ZDVA 2P6HA 2DUOA 3QOPA 2IXKA 1GVJA 2BXYA 3ZQLA 5ANNA 2CUZA 3Q9VA 3L2WA 2R7SA 3VB2A 4L0ZB 2FDIA 2KRFA 1FXZA 1IXSB 3P5JA 5FY7A 2C1FA 3WTUC 1P6RA 2IT0A 3D8CA 3ZXFA 2XRLA 1OH3A 4BHBA 4DXRA 5BNPA 2R5ZB 5FMOL 3H0DA 3MD2A 1SD4A 1DQ6A 2VL4A 3OGJA 1LOFA 3ILNA 1V6IA 4AC0A 2GP3A 2YV8A 4BQQA 2WZ8A 5BNNA 2FDKA 3CD6I 3K4BA 1QXRA 3KP4A 2E7WA 1Y9GA 3PSFA 4MEXF 2FBHA 3V7SA 3ZN0A 5M0TA 1UKRA 4IF4A 3ZYJB 1BBYA 2D6MA 2WAQN 4S04A 5EGOB 4GQ7A 1QJU1 2XGEA 3J8F1 3K4JA 1Z77A 2ILMA 4AEDC 1POV0 2M5WA 3T2OA 2UV1A 5DAQA 1AOYA 3K10A 2HWB2 4NHJA 3O1MA 3FUQA 2W91A 4LORA 3H0OA 5C3SA 3KGZA 3ATGA 5TJJA 5BNGA 4YGCA 2GWRA 3JRCA 4S0HB 3V42A 1RMU1 1C3HA 5HCAA 1Y43B 2TDXA 1YHQI 3T3YA 3DGTA 2VI6A 5LY1A 2JG9C 3RTRA 5DDJ2 4ZKTB 1FV2A 2E33A 1MNEA 1PVXA 1GKBA 3D5RC 4KN7X 5H20A 2VW0A 5F3EA 1RGSA 2KL4A 2IEKA 1TNFA 4ES8A 1IPSA 2AEYA 2ZMEC 2C9AA 3PVOA 3FK6A 2P5KA 5L3DA 2BDRA 3RI8A 4EZ4A 4DZPA 1BR4A 4Z2YA 3Q8AA 4PSXA 4P9LA 3ZFFB 1G3YA 2P0WA 1C5IA 3I3MA 2DYSH 2DOEA 4AQ2A 1WH7A 2DMQA 2PHTA 3PUBA 3GFJA 1IXCA 1NAEA 1B6AA 4ZU4A 2RS53 2DOFA 5H2FC 3CJRB 4CP0A 3LEGA 1GOHA 1SHWB 2W85A 4G3YC 3VYRB 3L2VA 2VOKA 4COWA 1RXGA 4JOMA 2CY6A 1O7LA 2DCJA 1MJ9A 1RNLA 2AEZA 1GUUA 3VWBA 3JBG3 4FXKB 3RPUA 5CISA 4C90A 1ZYBA 1HLVA 3WF0A 5JLXA 1NCQB 2YC0A 4PDWB 5JFRA 5LBFA 1EAH2 2QFEA 1DF0A 3KV6A 1AYM2 5FP4A 3J26N 4CCEA 3ZMTA 4BQAA 1GXPA 1ODMA 2HWD1 3WHUA 3PM1A 3DLAA 1AX2A 3F0CA 4BLIA 5FY0A 2JPBA 2Y31A 3AG3H 3E3VA 5CIRA 4A2UA 3AG2H 3O1UA 3BTXA 2PYTA 2PAMA 3QPSA 2XWJB 1MZ5A 1UPSA 4ZXEA 4MGIE 3MAJA 3FM5A 4SBVA 4MNUA 2M4KA 4KISA 1NLRA 4GO1A 1U8BA 5I91A 4BE1A 1GQHA 5BPDA 3POGA 3CNAA 4MLOA 3KT4A 3LSDA 3DYMA 1VBC1 4LR4A 1YI2I 2KP6A 1OFNA 3S2DJ 3RZOJ 3TN92 1I50J 4ARYA 1AXYA 5E8IA 5K7HA 5DABA 2Y34A 1HV1A 1KGSA 4HK9A 3ZN4A 1LHUA 1RR8C 3BG3A 1MACA 4XHBA 4WM8A 1HW1A 1KS4A 3ME2A 1COV1 1WI3A 3WDWA 2DMNA 3Q8EA 1LRHA 3M8JA 4NHMA 4D7YA 1CN1A 5CVJA 2VMCA 5F27A 4OI2A 2R061 2WFF1 3VBSA 3HAGA 3ZYGA 2RMU1 1R1A1 5LEKA 4I3GA 1S72I 1QXJA 3TN93 2A3XA 4HANA 3W3CA 3BOPA 3MW3A 3RRDA 2EVXA 5FYZA 3HOXJ 1QJX3 5GLTA 1WCDJ 2JG8B 4A3FJ 2JA7J 3MBWA 3IAS2 2BW3A 5FFOC 3GXOA 2L9NA 5IK7A 5A3WA 1H8TA 1JUPA 2VZOA 1S0FA 4LKEA 1JYNA 3WCSA 2JVGA 5FV3A 2HOAA 5FYSA 5L7OB 2WNUA 3VDCA 4V19K 3IH4A 2RNGA 5IVVA 3P9CA 3RSJA 2DDUA 2HWF1 1LDKB 4EE2A 2ZFWA 3VHPA 2VNOA 5L3FA 2IJLA 3O1PA 1PZ9A 2BZDA 3AZZA 3T0YA 1RUJ3 3WNXA 2YSRA 2G1MA 3TEDA 3VBUC 4BQWA 2JN6A 3RKWA 3M2MA 1Z7LA 3ASIA 1RL3A 2R7OA 3JB8A 4MUVA 3KCXA 4MO3M 3OPZA 4QPGA 2CQ7A 4A6OA 2W94A 4DPNA 4NO4A 2XAGA 1T33A 2A6XA 4A7KA 2DODA 2VKDA 4DZJA 2E1NA 1UELB 4RBOA 3POJA 1MDMA 2P5VA 5BY5A 1MQTC 4G8XA 1SD5A 2IVIB 3R0AA 2R30A 4XFFA 3VDDA 4XK4A 1ULDA 5ICCA 2JUCA 2L7FP 4PLMA 4FPYA 3O8GA 4IHWA 2JB8A 1HB1A 3DN7A 4A93J 2Y6JA 1LJ7A 4M9SA 3LA2A 3EHKA 5FZAA 1T56A 1U5TA 1C8NA 3DKYA 2HDWA 5ABJB 1PGW1 2EIGA 1PM7A 2ORZA 4GB33 1HQLA 1QPMA 4LNVA 3ECOA 3CHXA 5JLVA 4BH9A 1IAWA 1JZ7A 4YM3A 4D6SA 5DQ0A 4PI2A 3RPQA 1OA2A 2JWTA 2V9KA 2WC2A 4QPIC 3ZM8A 1YEWA 4HT1T 4CZZA 2D6PA 4DGWB 1B35A 3GBWA 2Q1FA 2IPQX 4O3MA 4IRHA 3F2ZA 3W6KB 5IK4A 3SH3A 4BMEA 1P4AA 2LF8A 4O9GA 1FYKA 1MZFA 2M7AA 1Y0NA 5C33A 2W48A 4QB6A 3RZLA 3BR3A 4RS5C 3V65A 3AZYA 4ASMB 1XSRA 4FCYA 2BY1A 1X2MA 3ISPA 3F8CA 3AMHA 4JQRA 1YX5A 4PFPA 3NV2A 3VYSB 2OZJA 1OT5A 2QYOA 5ILUA 1Z78A 1YFYA 1SFEA 4JZRA 4AWXB 2Z33A 1TWGJ 5KXDA 2BBVA 4B7KA 2O03A 5BMZA 5FROA 5F5AA 2IFWA 3OMYA 2LBFB 2FRHA 5C4JJ 3N7KA 3BODA 4B8EA 2YROA 2ZMNA 2ZFUA 4E7JA 1N3PA 2ZPXA 3AX4A 4PCRA 3G7DA 4NUBA 3H3LA 2DBIA 2FSWA 3O1OA 4XORA 4AIHA 5JMOA 5FLHA 1XQNA 3W5MA 4EVIA 4UFLA 1ONVA 3WNNA 5E17F 4Q26A 4DNCA 2QUOA 4KWKA 3WGIA 4UUSA 3S17J 1F43A 1U8RA 1G9DA 1JBCA 1WLCA 1FOXA 1VPHA 2V09A 4AGRA 2BZTA 2ETHA 3MLLA 3B3QE 4XKWA 1QGPA 5JHUA 3AL0B 2G0EA 1EH7A 2YG0A 4BBSJ 4RM2A 5H9SA 3K2AA 3FHZA 5FJ8J 1AR61 3IDAA 3I3QA 4AVAA 3WNPA 3RZJA 1CZSA 4HX8A 1VE0A 4LA3A 4CXWA 3HSRA 2OU2A 1OFSA 1AR81 4HONA 1ULYA 5FK7A 5CFCA 4ZTFA 4OUEA 4NPLA 3BOWA 5GLWA 1F5FA 4BHCA 2B0LA 4M6VA 3AC0A 1TQ5A 3NQHA 1QDCA 1ZRCA 1TT0A 4YYOA 4HSRA 2WUHA 2E32A 4C2MJ 2NMNA 5EPAA 3LZZA 3TOBA 1MNMC 2PAEA 2MLKA 5FKOA 1JKPC 1NA1A 3LDRA 5EYRA 1D8KA 3S93A 1SC7A 1YI7A 2COMA 1IRZA 4XSZF 1R64A 1YRNB 2O0OA 4K9SA 2E60A 1ND2C 2QQNA 1CESA 3I8TA 2PMZN 1C8M1 4JVAA 1LOCA 1UG0A 1GNYA 1H9PA 1LU1A 2IAIA 2M1BA 1NE4A 3WX5A 3C2UA 3ILRA 4PSWA 2P5LC 1PUFB 5FOBB 2IS2A 1ZBE2 4J00A 1A78A 3THPA 2CU7A 2C24A 2E2HJ 4MEYF 1CGPA 4HVOA 3WINE 4XRMA 4B29A 4MQVA 4BISA 5LCWL 3CCUI 4CXXA 5EJ1B 4RB1A 3C3VA 3I3LA 4L9TA 3DTIA 2BU9A 4JK1X 1NT0A 1TNRA 3NNGA 4IEYA 3F21A 3M1CA 3LPFA 2F5DA 5BPXA 2DVBA 1IW7F 4A7ZA 5A33A 1WJFA 2CW7A 3OYBA 2RVCA 4F7ZA 4BE0A 3MZHA 3MV01 4CU6A 3WT3A 2F6BA 2GC2A 4N8MA 1LE8B 3MHZA 1OUSA 2DJNA 4EJRA 3DFGA 1NY71 2ZGSA 1EA3A 3HRMA 4FFIA 2QLZA