3E5UA

Ocpa complexed cprk (c200s)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
219
structure length
215
Chain Sequence
DFCGAIIPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAGGNSLIGKLYPTGNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNTYNPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLASLKRENILDKIIVYNLGELKHLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of halorespiration control by CprK, a CRP-FNR type transcriptional regulator
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Transcription regulation
molecule keywords Cyclic nucleotide-binding protein
total genus 68
structure length 215
sequence length 219
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e5uA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3e5uA01
2P7CB 3ZMSA 1YUDA 5KK1A 3RYRA 4HX4A 5E1WA 4KIBA 2QNKA 1H9GA 1ZRCA 1KU7A 4LG0B 2UY9A 3EDPA 4HAMA 2J5OA 3BZ6A 3R0AA 5L3FA 1YIOA 2ZFWA 2PMHA 1FPQA 3F3XA 1XE8A 5L3DA 3CTAA 2Q1ZB 2ZXJA 2J5PA 2QJVA 5HLHA 2ETHA 4OIQF 2CSOA 1S7OA 5ED4A 4E2QA 3EJKA 1FZPB 5K5RA 4L0ZB 4GYGA 2LSOA 5K5QA 2MH2A 4ZU5A 1YS6A 1UHMA 4D7SA 1STZA 5FCCA 1T2KA 3I53A 3BOQA 4LB6B 1R00A 3MZHA 1XGOA 1U5TA 3E6MA 2M87A 2GU9A 5J8CA 4X6RB 1NHAA 4L5JA 2M1BA 1YO5C 3LAJA 3M3IA 3L2CA 2VOPA 1Z9CA 4ZZDA 1YFHA 4FHTA 1GQGA 3WE2A 4ZYEA 4IRHA 3V8JA 4AVCA 2PYTA 1Z1DA 1W4MA 4LJZF 1SMTA 2CW0F 3RYPA 4GULA 2CAVA 1CF7A 4DNCA 1J3RA 4HN1A 5LBQA 3EHKA 1UIKA 2CGPA 1ZGJA 4A5NA 3COAC 5ILVA 3F8FA 5HLGA 2N7GA 4YG2F 3Q5FA 2DPUA 3O3KA 4YFKF 2HKOA 5FFXA 3BPVA 1ON2A 4UXNA 4EGYA 1IN5A 4RGRA 4OINF 2BNOA 3GVAA 5IT9K 2VONA 3IC7A 1YW7A 3FZ3A 1YFXA 4L5IA 1QQIA 2NNYA 3L9FA 4KUMA 4M73A 3JSOA 1ODDA 2Z33A 3CF6E 1XSVA 5BMZA 2R3SA 1ZG1A 4HX7A 1ZZBA 1J3QA 2PBIA 4PIXA 5AONA 4EJTA 4IRGA 1J58A 1FYKA 1RL3A 4CDGA 4I0AA 1LJ9A 4KMFA 2NAZA 1BC8C 3KP2A 1QBJA 2D93A 1QNTA 1F1ZA 3CLOA 4MV2A 2XLAA 1XDSA 2RV8A 2VC0A 1HSJA 2ZJ2A 4ZZLA 3DPLC 2CG4A 1BM9A 5JAXA 3FMQA 3WTYC 3KLNA 4LG0A 5I93A 2VBZA 3DPTA 2K02A 2V1UA 5HDNA 1V70A 3VFZA 3RDIA 3CO7C 2Z3YA 5DV5A 3DKWA 4UUVA 2CAUA 4KFCA 2B5HA 5FDBA 2HFHA 1XN7A 2PN6A 4M9ZA 1CAUA 2LDUA 1YQAA 4HMZA 4N9IA 1BI1A 5BXXA 3ELNA 4BHBA 3NW4A 3H1WA 4P9GA 2EA4A 5HI0A 2FRHA 5FB2A 4AVAA 4QGLA 1EH7A 4AIKA 2GC3A 2KKOA 1PP8F 2VBWA 4M9SA 1W5SA 1R36A 1F5TA 1SEFA 1TQMA 4JV4A 2RDPA 2COMA 3TQNA 1CAWA 3W6KB 2QQBA 1WI9A 4GXOA 4B29A 3KMHA 3BDDA 3L7WA 2ZMEB 3F6VA 2VT3A 4YYOA 2BV6A 3DN7A 4HLYA 3HHHA 4HN0A 2KIUA 3GWZA 4Y17A 2PQ8A 3NEUA 2HR3A 1BC7C 3BWGA 4A5MA 3TO6A 4QLCU 4JQFA 2OU2A 4NQWA 1IUYA 4XFCA 5BUVA 1U2WA 2MPFA 5HVQC 2W25A 1SFNA 1J7KA 3SQNA 3BROA 1QWRA 5LHGA 3LA3A 2P5KA 2FMLA 2E7WA 5DUKA 4HVOA 2IJLA 3HYIA 1RZ4A 2QUFA 4J1WA 3FE5A 1O3QA 1UCXA 1ZG5A 1SD5A 2M5WA 3L00A 4EWAA 2HQNA 4RGXA 5D6FA 4LD5A 3EQLF 1JE8A 1BOAA 1LB2A 1OYYA 1E17A 3E5UA 5I91A 3I54A 4Z2YA 2E9QA 3UKTA 4KWLA 5I8TA 4K2EA 2QLZA 4HA8A 5C8WA 1U12A 3H8UA 2GAUA 1Z05A 5FPZA 3GUDA 2W24A 1NZCA 2I45A 1PMIA 3QACA 3DV8A 4A6DA 1P2FA 3MZYA 4ESJA 5I8SA 2PI0A 2F5CA 2OA4A 2QWWA 5LGUA 4IEZA 4L9VA 1ZAOA 2XHKA 2ZKLA 5I0RA 2XAFA 1P4WA 3LFKA 2VXZA 4WXCA 4HQEA 2KIMA 1XMAA 2IVMA 3R0JA 3PVBB 4PZJA 2A68F 5H6QA 3FJSA 4X6QB 3BJ6A 1Z7UA 1ZREA 1IRGA 5E1ZB 4QX5A 1OI6A 3CUQA 4PCQA 1FP2A 3LWCA 1KYWA 3FFQA 4E2GA 3WE3A 2BNMA 2MD5A 2XIGA 3GBFA 1AOYA 1XGMA 3HUGA 4LEJA 1D5VA 3ZMVA 1T39A 4AXOA 1MJBA 3DXJF 2XAQA 2L4MA 1IXCA 4FAHA 1MZBA 2F4PA 3U10A 3MEXA 2QM3A 1TQ5A 3Q9SA 3E5XA 1UHWA 1EH6A 4AWXB 2XASA 4YIFA 1MDMB 2H27A 1H1IA 1VTNC 2PJPA 4META 5E20A 1YTYA 1Q43A 1ZH5A 4XFAA 3S0MA 1UB9A 1FSEA 3KFWX 1XSDA 1A04A 4HX8A 3MDPA 2KXLA 5CVUA 2FF4A 3DEUA 3KEQA 3ZPLA 4F8AA 1DPRA 2QENA 2YSRA 4ZYGA 3NL1A 4KDPA 2XUBA 1HKTA 2LF8A 2PEXA 1EYBA 1LRHA 2LKPA 3GW2A 4EWEA 5FFZA 3SZTA 5F64A 1U3EM 4QGMA 4QM9A 2Q2EA 2IA0A 5DD8A 4G9YA 5D5WB 3HRSA 3JTHA 4EM2A 1LDDA 4XFFA 1OR7A 2CO5A 3QPTA 2C6YA 3K0LA 5HDGA 4YFNF 1PDNC 3CJNA 4LTAA 4IEXA 4ESFA 4KU8A 3SMHA 2EFQA 2GXGA 4CGZA 1I1SA 3Q9VA 4QGNA 4H0EA 2GQQA 2DO7A 1LNWA 3DFGA 4XFIA 5FQ0B 2P4WA 1LQ1A 4EJVA 2A5YB 3OTFA 4MEXF 4A0YA 5BS6A 4H7LA 2GA2A 3BCWA 1J9IA 3G7DA 3USSA 5DCMB 3WW2A 2D40A 3NVCA 2IXIA 1R5HA 1QGPA 3VEPA 2ET1A 4M74A 3TGNA 4HSLA 3EETA 3I64A 3VB2A 2QBYA 3P9IA 2QQAA 1GXPA 3F8NA 3GXOA 3EBRA 3S7EA 2QCSB 3CUOA 4XLPF 1DP7P 3RI4A 3IBMA 1SD4A 3E6CC 3EYIA 3CO6C 4GCVA 4UV8A 4S05A 2ADUA 3WTWC 5L3BA 4EV0A 5IT9Z 3TOBA 1IN8A 1IXRC 5CVVA 1RTVA 5FD6A 1U8RA 5LHHA 5J8FA 4B09A 3FXQA 3ERED 3ZQ7A 1EP0A 1D8KA 2O03A 1XDUA 4LFUA 1DGRA 2ZKZA 4KYWA 2FQ3A 5LGTA 1EPZA 2FQPA 3ZP5A 1QY4A 1JGSA 1O7LA 1FBSA 2A3SA 3K1PA 3C3VA 2FMYA 2H6BA 2GA1A 1WLTA 4KNYA 4HYEA 3REOA 4RAZA 4MUVA 3R4KA 1O3TA 4XBFA 4G6QA 2O8QA 3BP8A 2STTA 5CVRA 2QVOA 1VR3A 4UBHA 4KT5C 2IP2A 2G7UA 1Q1HA 2OYZA 3IKTA 5JCTA 2VQAA 1JHHA 2IA1A 2UXNA 2F5EA 2VN2A 4LULA 5LRRA 4YIIA 1YS7A 2CYYA 2XKPA 3WODF 5CADA 2OQRA 2DU9A 2VPVA 1REPC 2MHFA 2ATFA 1MJ9A 5HLIA 3WTTC 2V79A 3I5UA 4CZZA 1YLFA 1PUEE 5DDGA 4OIRF 1YYVA 3EO6A 1USSA 3T1BA 2P5LC 4XETA 1HKQA 1CAUB 1QPMA 2B9UA 3BPZA 4LA3A 1CF7B 2V6CA 3WG9A 1K79A 1TW3A 3P9KA 2XV4S 3KP3A 4YSFA 2PQQA 1RIOH 1CX4A 5LEKA 2DK8A 1R22A 4CO8A 2HTSA 4MEYF 2XLFA 4Q48A 3GF2A 5TJJA 4E70A 1K6OA 5ICEA 2VOOA 4UNOA 4UVBA 3F8CA 3RKYA 1K78B 2D5FA 4L18B 2IXKA 2HYFA 4IRIA 1S6LA 2MA3A 1TQIA 5KHHA 3GX4X 2H94A 3MPBA 4ASNA 4LB5A 2RC4A 4HQMA 1UPIA 2DAOA 2O6GE 1Q3EA 1H1MA 1O7FA 4EM1A 3DQVC 5FLJA 2Q0OA 2ZMEA 1O5LA 3M9AA 5F1RA 3LAGA 4IEVA 1FYMA 2P6TA 1ZLKA 2FSWA 4OOIA 4ETSA 4AVBA 5ERIA 4HF1A 5CYVA 3SHFA 3H9AA 4AD9A 2GZWA 2O3FA 4G94A 1RI7A 3KETA 4IXAA 3U11A 2O1QA 5D4RA 3BJOA 3DP7A 1QZYA 5LGNA 5D8LB 2DW4A 5ICFA 2OPKA 3HQXA 2VC1A 1IN4A 4PIZA 2H6CA 4EM0B 2NS0A 4N9HA 2JZYA 1U6GA 3WGIA 4AVPA 4ZYDA 2C0ZA 3HTSB 1ZZCA 1BJAA 4EMSA 1B59A 1O5UA 4ENJA 3KGZA 3MAJA 4YARA 2FBHA 4BAYA 1YHFA 2O0YA 4NHJA 2YPRA 2XGXA 4IESA 4YNIA 3WU1B 1X3UA 1UIJA 2F5DA 1Z91A 3GZ6A 4BH9A 4I09A 4Q47A 1YW9A 4O9GA 4ZU4A 2P5VA 4HSJA 4PDKA 2G9WA 3M70A 2MBFA 3L2HA 1BI3A 4XF1A 1OYWA 4M71A 1T38A 4GYIA 2DTRA 1CAXB 3I59A 5JR3A 5D6EA 5KVRA 1FY7A 1XCBA 4B8XA 1GXQA 5DEQA 3J81Z 3D82A 1U78A 2E7XA 1KQ9A 1YLLA 1CAXA 2L54A 1X82A 2MLKA 3FF5A 3ZMDA 1J1LA 4UXAA 4LGWA 2PAMA 4IEWA 1G6NA 2K4BA 4XF3A 3KSCA 4ENMA 2KJBA 5A2QK 2BYVE 2RN7A 5JVTA 2PFWA 3GEZA 2XL9A 4WVZA 5FPXA 3DL3A 3GFIA 3ES4A 5A2QZ 1BIBA 6PAXA 1QXRA 4XFBA 1HW2A 1NE6A 2EVXA 4IERA 1SFUA 3BB6A 2QDRA 3IWZA 4CHUA 1LVAA 4OIOF 4D0PA 1ZRFA 3FHIB 1ZNPA 5J3UA 3LWFA 1WGPA 4UV9A 2A07F 5CLSA 1USTA 2KIFA 2BBYA 2ZNZA 1J5YA 3E3VA 2EA7A 1C0WA 2K0GA 5ILSA 1JHFA 4RGSA 5JSPA 4R79A 2G7HA 2FE3A 2Y75A 1AWCA 4WWCA 5EZWA 3EUHA 2EJRA 3ABUA 3JSPA 4A2UA 1SMYF 2K4JA 2PLYA 4XF4A 1WKMA 4R1HA 2HOEA 1B6AA 2GC1A 4JK1X 1XB4A 3V7CA 4XEZA 3CL1A 1PP7U 5I0SA 4KICA 4MHGA 2PA7A 5E18F 4LUMA 2QZ8A 3FXRA 1RNLA 2DT5A 3WTSC 1S8NA 3ST7A 1J59A 3PFIA 2DK5A 1IPKA 4XFHA 3HRTA 4LK0F 2JSCA 3KP6A 4Q0VA 3MWMA 3LZZA 4RB2C 1H9TA 3BJAA 2VECA 1HXDA 4Z82A 1NXMA 4JTNA 2RKHA 1XD7A 5I0TA 4Q0QA 4G8XA 3L09A 4R52A 1ZX5A 1G3YA 3IHUA 2OA2A 1TQPA 4Q0PA 1Y0UA 1SAXA 2XVCA 4M6YA 4BXUA 4IEOA 5KHGA 2UXXA 3O14A 2DI3A 2WV0A 4BNCA 3HHGA 2FOKA 3C7JA 3I7DA 1P92A 1WRJA 2EFPA 3QAHA 3M7GA 2H09A 3RKXA 2PHLA 1VP6A 5JFRA 1Y9QA 2LNBA 1NYWA 1TBXA 2JRTA 4HVRA 1ZRRA 1YG2A 4P55A 5K1YA 1IRFA 2A61A 4UHTA 3I59B 3H7JA 4IF4A 1V4RA 4XFGA 3H92A 3LA2A 5D1IA 5LEJA 3OD0A 1I27A 1FYLA 2MLGA 4HF2A 3RYKA 5HOOA 3S7IA 3HSEA 4PJYA 5BPIA 2Z69A 2OAZA 3CUQC 1ZG3A 2GIVA 3BU7A 3IKVA 1G3WA 1XGSA 1I6XA 4IHTA 1BIAA 2XAJA 5T3NA 4FX0A 2FBKA 5ICGA 3RTRA 2ESHA 3RNSA 2Z9OA 2UY8A 4RB1A 2IPQX 3M1EA 3P9CA 3JZVA 2K9ZA 4MQVA 4HBNA 1IN6A 4Q0UA 5DCMA 4G7ZF 2PAKA 4U0YA 5BQTA 2M8EA 3ABTA 2IXJA 1J75A 1R5GA 1W7PB 2EFWA 4KIGA 1ONVA 3P7NA 1J0RA 2H0VA 4IHSA 4Q0SA 2B8MA 4HW0A 2DPDA 5K5OA 5L3GA 1MKMA 4MNUA 1O3SA 4PGHA 2IRFG 1TLHB 2D1HA 4LLOA 1OD5A 4LLNA 1L0OC 5E1RA 1ZZ8A 4MZUA 5DYMA 4IEYA 2RVCA 3TO7A 4U7DA 3H1MA 4IEUA 4O3MA 1RC6A 3FMSA 3NSTA 1FWZA 2UYBA 3ACLA 4A6EA 4KA4A 3F8MA 3K9TA 1OKRA 2RNJA 4L9TA 3HSFA 1IXSB 4IEPA 5JI6A 1V3FA 1BBYA 2V9VA 3U0ZA 3FM3A 4ZYHA 5BV6A 2ZCWA 4EWDA 4G7HF 1HKSA 1S3JA 3C18A 1R23A 1R7JA 2GH2A 2FXAA 1UW8A 5D4SA 4AIJA 3WW1A 2V1XA 3EYYA 3MCZA 2TDXA 4KU7A 1T0FA 4BIFA 3IDCB 4OIPF 2E1CA 2PAEA 4A0XA 1CAVA 1BI2A 1MDMA 1LDJA 3UKNA 4BHCA 1BN5A 5E1XA 1RUNA 3QU3A 4P5OA 4HLTA 2ZNYA 2DCTA 4XSZF 3KP5A 2HYGD 3SCHA 3ECHA 4YFXF 4PIYA 3QP6A 3F8BA 4OFGA 3ZDSA 4RD7A 2PMUA 4O6JA 3V7SA 5EEGA 3K1NA 1GQHA 3SHRA 2O61A 1BI0A 4HOBA 1WA4A 1YFWA 2IW5A 2IXHA 4MX3A 1J3PA 2QYOA 4QM8A 1R1TA 1DZTA 2Q0AA 3GLXA 4AQ2A 4EQQA 1VJ2A 2MC3A 3K1MA 2K7LA 1WQ2A 4A0ZA 1EY2A 5CJ9A 2VE8A 1FBUA 3M8EA 3V7RA 2Y48A 2EFOA 4WBBA 4WF2A 1D8JA 2K86A 3MYXA 3N4MA 4MH0E 5CVIA 2STWA 1RGSA 2XAHA 3N97A 3T8RA 4EJUA 1KGSA 3ZMUA 2ACJA 5LLQA 3F21A 3T0YA 3C3WA 4KN4X 4OLLA 3E6DA 1DDNA 2CWEA 3IL2A 3J81K 5E8GA 2EB7A 4HVQA 4M9XA 3FM5A 4HBLA 2GXBA 1B9NA 4RGUA 3FXUA 4I02A 5FGMA 4EJWA 5D5VB 5E17F 2W85A 1B1BA 3KE2A 3QU6A 2QBYB 4G6DA 5I8YA 4LLGF 4MTEA 2NNNA 4I2OA 4D7TA 3ZN0A 3TOAA 5HDKA 4XSXF 4P96A 3WW4A 1KA8A 1EV7A 1H0MA 1FOKA 3U1DA 5FLHA 1X8EA 1G3SA 3WTUC 2R7DA 3IDBB 3NJZA 4KL1A 4YRDA 1KQ8A 1SQ4A 3GO5A 1O4TA 1XSXA 4HLXA 4BHPA 3R60A 2EK5A 1W7PA 2QQ9A 3EQEA 1KU2A 5FD5A 3HIFA 2PG4A 1FLIA 1ZRDA 3WU0A 4U7BA 3F22A 4F7ZA 2DLLA 1OFNA 3C1DA 3TDZC 4EGZA 3CEWA 5BY5A 2EWNA 2XKOA 1IZ1A 1GVJA 4DQ2A 1W5TA 4FT8A 1E2XA 3RIRA 1ZARA 3M8FA 2HJIA 4IETA 5E8IA 5H20A 4O9EA 3T5XA 3LA7A 1GHCA 3GFMA 2OZUA 3ZN1A 3PNAA 2YX7A 4WZCA 1U5TC 3J80K 4E2SA 5J7MA 2DQLA 2AXLA 2RGVA 4U0WA 2IT0A 4LA2A 1B9MA 3J80Z 4L2NA 3QRFF 3KLOA 2X4HA 4MTDA 3KGLA 3TO9A 3BY6A 5TRDA 3LAPA 1FC3A 3CUQB 4JTOA 4U88A 1LEBA 1T6SA 4A12A 5E16A 3CJXA 3W6JB 1P4AA 4LMYA 3U2RA 1R1UA 1O3RA 1B4AA 3OOPA 2V09A 1NE4A 2FBIA 1KQ0A 2Z2SB 1PM7A 2D1VA 4BYYA 4WX9A 1XCVA 4O5VA 2PHDA 5AIQA 3O6BB 2NRAC 5BPDA 4S04A 3VOEA 1YWKA 4M6XA 1HBXG 1UFMA 2HKXA 4XF0A 2L02A 1K78A 3ZMTA 4FAGA 4KMUX 2V1DA 2L4AA 4I0BA 2YX4A 5JSRA 5K8SA 2EV5A 2F2EA 4WK8F 3NRVA 2UWMA 4HV5A 2ISZA 2OQGA 2FA5A 4ONUA 1EH8A 3OCPA 4RS8A 5FLXZ 3PQKA 3ZMZA 3HTUA 3TKYA 1JUHA 3NQOA 3BPXA 3TNPB 4EVIA 3B02A 3LQQA 5KHJA 3H50A 4QMAA 3IRQA 5ICCA 2BNNA 2ZO4A 5LRSA 1QZZA 2BGCA 1ZZ9A 1U5TB 4ENNA 4TLFA 2JPBA 2OBPA 2Y0OA 1TNTA 2VT2A 3RJPA 5FQ0A 1I1GA 3WGHA 1MGTA 2VODA 3V4GA 3ROUA 1I5ZA 2ISYA 1IW7F 3WTVC 2D45A 1HW1A 4KIFA 1HQCA 3FMRA 1IF1A 1ZVFA 4P9FA 2XAGA 4P9UA 2RQPA 2DBBA 4IJAA 1TNSA 2GC2A 3G3ZA 3MQ0A 4OMZA 3CO2A 4IVNA 1KYZA 2LF7A 2P6SA 1IAWA 3ISPA 3B73A 4J1XA 3E97A 3RPQA 1HSTA 5HS8A 3D5LA 3O2PE 4DINB 2AS5F 3ES1A 3UKVA 2ELHA 2EV0A 5BPXA 2F5FA 2XRNA 1HW5A 4FX4A 1YW8A 2YU3A 3HOTA 1IPJA 1ZGAA 3GYHX 3G73A 3RZZA 2CQKA 3KP7A 1LEAA 4MGRA 1FI2A 1FX7A 2OD5A 2HS5A 3GZ5A 4Q5SF 3QOPA 4EROA 5C6CA 2VBYA 3ULQB 1LDKB 1ULYA 1OMIA 3WGGA 1OYIA 2MH9A 4KWKA 2QVSB 5DD4A 2L01A 1IN7A 3IWFA 4RB0A 2OZJA 4JVAA 3TNQA 3KCCA 3D0SA 2HWVA 3ETQA 1MJAA 3QP5A 3R61A 4LUKA 4Y15A 3I0TA 3SXWA 4AQ6A 3SZPA 4L9JA 1F9NA 3WTZA 2EV6A 3FHZA 3I71A 2R7FA 2NYXA 4CXFA 2BEOA 4N0BA 3KP4A 3R6SA 2A6HF 4L0YB 2DFIA 2ZBKA 4HDVA 2Q30A 2D2WA 1ZZ7A 4RAYA 2UYAA 3FZVA 4XLNF 1OPCA 4MGYE 5EFUA 2M30A 4HZFA 3HRUA 2PTMA 2X0LA 2GWRA 1TW2A 5J6XA 2FU4A 2E1NA 3E5QA 2O8XA 1ZZ6A 2XL7A 2KRFA 4MGZE 4Q29A 4M72A 3ELKA 1L3JA 4UBGA 2YR2A 1CGPA 1RUOA 4GO1A 2XLGA 3HRMA 4XRFA 1XE7A 2ETEA 3SCGA 3NKTA 1DUXC 4ZH4F 1QO0D 2A6EF 3JAMZ 4TV7A 1DPUA 1Y3TA 1XMKA 3JAMK 2KJCA 4HDUA 4EJOA 3MFKA 3I4PA 4I01A 3SXYA 4WXHA 1CAWB 2WTEA 2JTVA 4AIHA 3WTXC 2Z99A 2ET7A 1KU3A 1SFEA 4QXKA 3HOSA 1FXZA 1ZHFA 2HTJA 3GFJA 5D5XB 2HEOA 1JXSA 2FEZA 3J7AO 1UCRA 4OMYA 4LLLA 2EFNA 3KZYA 5L3CA 4IPAA 3IIAA 2HZTA 3PLQA 2HQRA 5D8KB 4L11A 1LR5A 4XF9A 1ON1A 5EEHA 2IA2A 3DF8A 1DZRA 1WWXA 3FWEA 3QPHA 2BE5F 4ORFA 3LOIA 3U9GA 1F4KA 3H3ZA 4ESBA 1LKNA 2B0LA 3I58A 4RB3C 5IT3A 4FBFA 4NB5A 1Q5OA 5CU1A 3PQJA 4K8FA 4MGKE 3H3UA 5JHUA 5HS9A 2Y0MA 2WC2A 1SD6A 5HS7A 5AIPA 4R8HA 2MNGA 1Z6RA 3SFZA 1MD0A 4G7OF 3IRRA 2P7VB 1R58A 3CLPA 4WXDA 1X8MA 3ECOA 4IEQA 4KWJA 2JPCA 5L3EA 2M45A 3H1YA 3CDHA 5CVJA 2WWYA 3K2ZA 5DCFA 4UVAA 2XROA 1X7NA 4Y13A 3LSTA 3OF1A 1K7AA 4L9NA 3AAFA 5BOXA 1T98A 2K27A 2WFPA 2OZ6A 3HT1A 2IXLA 1W7PD 2EA2A 4U0VA 2DQRA 2JT1A 3VHRA 5D5UB 2Z5UA 1SFXA 1D3YA 1O57A 2FNPA 4HV6A 5AVPA 1P6RA 2L3DA 4UVCA 4HF0A 4KN7X 4MQ9F 5JR7B 1J2XA 4WCGA 3D0JA 1SD7A 2Q8KA 4QWQA 4Z07A 4I3PA 2VBXA 2UZKA 3VODA 4ENKA 3GFLA 5FLXK 2GC0A 1Z6TA 5ILUA 1XGNA 1S29A 5FLIA 4JBAA 3S2WA 5KBFA 3RKWA 3F6OA 4OU0A 2EAAA 3OGJA 2CFXA 4CYDA 4I7HA 1DGWA 1FBQA 2IC1A 1FT9A 3SCFA 5H6RA 1ZN2A 4LK1F 1XRUA 3TDUC 5DUIA 5FO5A 1S7AA 2P17A 1TTYA 2W57A 3KZZA 1G3TA 1KU9A 2IXCA 3T8TA 2ESNA 3HT2A 3V8KA 4I98B 3HSRA 5JSOA 2HGCA 3ML6A 3RPUA 1FSHA 1CAVB 5KHIA 3BALA 2FNAA 3FX3A 3F72A 4PGGA 3WW3A 1ZLJA 2HDCA 1YFUA 4GGGA 4MGIE 3KEOA 5F6FA 4Q4ZF 1WSUA 4BQAA 3JTGA 2CV6A 1L3LA 3JW4A 2Q4SA 2A69F 1YFYA 3V8LA 3H7YA 1FNNA 2W84A 2VE9A 5KHKA 1UD1A 3GYDA 5I0UA 4ON0A 4ZU7A 5J48A 1QXJA 3E6BA 1FP1D 3LQRA 4CICA 2P8TA 2D5HA 1ZYRF 1P4XA 3OV8A 1G4DA 2PFBA 3F23A 3K69A 1R1VA 4NVPA 5LHIA
chains in the Genus database with same CATH superfamily
4BQ2A 4K7JA 1X36A 4JGZC 2QNKA 3H0OA 2EIGA 2CU7A 1WPKA 4DY3A 3G71I 3BZ6A 2YXSA 3N35A 1YIOA 1FPQA 5J4YA 3O1MA 1DYKA 1XE8A 3CTAA 5L9BA 3VGIA 4AZZA 1DQUA 2ZXJA 4AM3A 1HXS1 2QJVA 4K9SA 1IC8A 5HLHA 1G9CA 2ETHA 5ERLA 3N7LA 3VDBA 1T0FC 1S7OA 4AAXA 4DW6A 3BG7A 4Y1VA 2DFCA 2LSOA 5K5QA 3IKWA 1YS6A 4DIQA 1JYVA 5E8AA 1JTYA 4JGYA 3BOQA 2G4IA 1R00A 1WW4A 1XGOA 1U5TA 1VBC2 3IZOA 4RS5B 5J8CA 1WMEA 4DXRA 2FMDA 1NH3A 2VOPA 3M1CA 4COYA 2OJED 3EYPA 2QSFX 4A3KJ 1B35B 1YFHA 1HA8A 1YRZA 1GQGA 5ACA3 4BACA 3WE2A 5B1AH 4AVCA 2ZX2A 3GDBA 5CFDB 1Z1DA 1GUIA 1W4MA 3RYPA 4HRIA 2VJ4A 5B5EC 2OUJA 1J3RA 5JHFA 2HWF3 3VB9A 2W1WA 3D4KA 1ZGJA 2XHNA 2XUEA 3TMOA 2VOWA 3F8FA 1CPMA 3VL8A 5ANNA 2ZJCA 4YG2F 1NX9A 3KQ4B 1ON2A 4UXNA 3P6BA 5J4VA 1IN5A 4XILA 5F2SA 3O1RA 2WJSA 3AMMA 4OINF 2J1VA 5FZ1A 3MUZ1 1OQDA 4M73A 1WLCA 1ODDA 3BR5A 2MSYA 2R30A 1NCQC 1VRH3 3PUSA 1ZG1A 1GOHA 1ZZBA 1J3QA 2IGOA 2PBIA 2NVQJ 1O4ZA 4IRGA 5GADJ 3K6GA 2QQVA 2WZR3 2QA4I 3WV6A 2RS32 1LJ9A 2NAZA 4JGYC 1QBJA 3AB0A 1D0ZA 2NOJB 2JSPA 2RV8A 2VC0A 5GAGJ 2NLRA 2CG4A 3AFKA 1AF9A 1BM9A 1DP3A 4WVWA 1X1CA 3R0RA 3FMQA 5LA1A 4PI2A 1IDZA 4FE7A 4NHLA 1S9HA 3VBUA 1UX6A 3PTRB 2L0KA 4C3HJ 3ASNH 1JYNA 4YPJA 3DPTA 2V1NA 5C8CB 4NNJA 2QSGX 3RDIA 5EYXA 3KIOA 4CCEA 4M6VA 2CAUA 3C7HA 2VB6A 2B5HA 2NVXJ 2HZDA 1YITI 4XXPA 1H9PA 4N9IA 2QKLB 2LOOA 1RPWA 3NW4A 2AR6A 3UNPA 2BY2A 2FRHA 4B4QA 5FB2A 2GLOA 2VKDA 2FDJA 4YM2A 2ARCA 2DFEA 1RUE3 2XPWA 5DUWA 2VBWA 2VD7A 4CUBA 4P1WA 4JV4A 4LO4B 3IH3A 1PGSA 2B9SA 4BK4A 2HXIA 3HKZA 4B29A 3WHTA 1YQ6A 2CV1A 3BDDA 1E3PA 4YYOA 2EIBA 1ZBA2 4HN0A 2KIUA 1Y43B 3SEEA 3U07A 4BCUA 2HR3A 3THTA 3TO6A 2R0HA 5KWRA 1U9NA 5LY1A 1T6GC 1U2WA 2MPFA 3EB7A 1MBHA 4INDA 4JDMA 1SFNA 3BIEA 2YYOA 1A8DA 3WXPA 1ZRIA 2P5KA 2FMLA 3OYEA 2IJLA 1DZQA 3ZXKA 3VBHC 4J1WA 3Q8EA 4Y3OA 3AG3H 2NVTJ 3BZCA 3TL4X 4P9WA 2M5WA 3HBKA 3J7YJ 4D1QA 3O1PA 2X51A 4YW2A 4LD5A 4GXLA 1E17A 3I54A 4BQWA 4DOZA 3N7JA 3UKTA 3IH2A 3WG4A 5C8WA 2WS93 2HWB3 5FZ9A 1AVBA 1LHVA 5DPNA 3GUDA 1E0EA 2R4GA 2DCYA 1WVRA 5BNPB 2G19A 3DV8A 2CS3A 1QDOA 3PHMA 3MZYA 2ORXA 1HCRA 5FYCA 5K4LA 5LGUA 4L9VA 4HNTA 3IH4A 5IP6A 2ID4A 3HEFA 2WWSA 4WXCA 4HQEA 5JI7A 4EN9B 1XMAA 2IVMA 3R0JA 3KYLA 2A68F 1S0CA 3FJSA 3BJ6A 1Z7UA 3C7FA 2F4LA 4R9BA 3LWCA 1KYWA 1X58A 4F3QA 5EDNA 1XGMA 3HUGA 1HB4A 2HYJA 5CBLA 3ZMVA 1MJBA 3DXJF 3H0GJ 2KDOA 1PNFA 5FREA 2QM3A 3MKYB 3Q9SA 1Q8PA 2RJ2A 5DG1A 3DYMA 2CQXA 3UK9A 3HR9A 5J1RA 5A33B 3OL3A 5E20A 2XQRA 2JG8B 3TAYA 3RZKA 4AHZA 1FSEA 3GTQJ 1XSDA 1Z3XA 2FF4A 3VD7A 3R05A 4ZYGA 2W4SA 1PO11 3NL1A 2E35A 2LKPA 5FFZA 2R49A 2HOAA 1OCCH 1JZ6A 5DD8A 4Y52J 3QLQA 4PLOA 3HJEA 1ENQA 1CX1A 3K0LA 2KD7A 1U8BA 3LIGA 4LTAA 3LL7A 3DPRB 4CTEA 2PLV1 2F17A 3Q9VA 3MW4A 4QGNA 3VYTB 3FL7A 1KS4A 2DTWA 4H0EA 1SACA 2GQQA 1RUD1 4OHYA 2DUPA 3MIDA 4A3XA 4RAFA 3JB4C 4EJVA 1POV1 2JN6A 4XLEA 2BVLA 4A0YA 1UELB 5BS6A 1C3HA 3OYKA 5A7SA 4WM8B 3BCWA 3T4HB 5AFBA 3G7DA 5DCMB 1REEA 4BEHA 3NVCA 1F4HA 3VEPA 2OTLI 4M74A 3VDDA 4HSLA 4JYKA 3AJZA 1V6MA 3UGGA 3K10A 4YZ4A 1VALA 3GXOA 3EBRA 4OAZA 1AYN2 3RI4A 2YC4A 1H2LA 5FLVA 3K4KA 5C9AA 1HN0A 4XN3A 1B35C 4GCVA 4S05A 3LSMA 4W1UA 4XW3A 1DLCA 1IV6A 3FXQA 4EATA 1DGRA 2ZKZA 2FQ3A 5LGTA 1IS6A 5FMCA 3ZP5A 3K1PA 1QJEA 3C3VA 1OUXA 1QHGA 1K4SA 3WT3A 4KNYA 3I3EA 1O3TA 4G6QA 2O8QA 3BP8A 2STTA 2VMDA 2QVOA 4UBHA 4PF5A 1C1LA 1UZWA 1W2NA 1A6QA 1ETKA 3VYRB 3AKRA 1VQOI 4BB3A 3IKTA 1FIAA 1CZVA 2UXNA 2BOJA 3VDDC 1VAVA 4NAMA 1YS7A 1MS0A 2A75A 2OQRA 1LOEA 2VPVA 2ATFA 3WTTC 2AO9A 4DUVA 5C9AC 1USSA 1TT0A 2P5LC 1HKQA 2CH0A 4BK5A 2ZMKA 1HB2A 3UT0A 4IL7A 4CDUA 2PQQA 1R22A 4Q48A 3UNGC 2Y33A 2WBKA 4LKSA 5ICEA 4WM8C 2Q8EA 2BVVA 2ZSHB 1ERDA 4UVBA 5F3CA 3AKQA 3F8CA 5LA0A 3POBA 2D5FA 3BI3A 2W87A 1GV2A 2LRDA 3MICA 2MA3A 2P3KA 4C91A 1Z78A 2E5ZA 3MPBA 2H94A 4CP2A 4QPIA 1POQA 2R6QA 1V6JA 3BYWA 4XBLA 2WZ8A 1C8M1 1S7EA 2ZMEA 5F1RA 2GOMA 3DTKA 4RA0A 3HAGA 4UB8C 1TEIA 3WVJA 4ETSA 4HG2A 5CYVA 3IV5A 2O3FA 3U11A 5D4RA 3OB8A 2HEYF 3OBZA 5LGNA 1UF2C 1TWAJ 2DW4A 1UL9A 5JMCA 1R1A1 2RR12 2VC1A 3VBFA 3JB8A 5FPAA 3RGBA 4AVPA 4EEFG 1RUG3 2KIQA 1XJAA 2V4VA 3HTSB 5IOYA 4CP0A 2M9HA 3ZFEB 4QPGB 3JRAA 1OBNA 2K2SA 5CFCC 4IE0A 1B59A 4IZZA 3GZUC 1OLMA 5FYMA 3I2IA 2OS2A 2CNAA 4NHJA 2WSVA 5C71A 4ASMB 5T55A 3WU1B 4Q4W3 3VKOA 1AR82 3J8F2 1UXXX 1EV12 1Z91A 4BM8A 1YW9A 4O9GA 5B2GB 2DVGA 4MHRA 1MNMC 1NA1A 3O12A 1NA1B 1ZBE2 2E7AA 1C8M3 3GHMA 4LNVA 1GNHA 3L2HA 4XUNA 4M71A 1SBDA 2XUMA 4JX4A 5FPVA 1CAXB 2RMU1 1MH4A 5EG0A 4HKWA 1JOPA 5KVRA 2ZMNA 1K5MC 1FY7A 1XCBA 4EN8B 1GXQA 4H4KC 5HBAA 4A93J 4HXCA 2W5FA 4QPIC 4BQNA 1U78A 2B7YA 2Z42A 2E7XA 2RDSA 2VMFA 3JBG3 5ANQA 1UY3A 2W95A 5F1JA 1CPNA 2FDGA 4EZ4A 2OW4A 2PAMA 4ARXA 4IEWA 3OBAA 3CCUI 3A0BC 3KSCA 2Z1DA 4ENMA 2KJBA 2WAEA 1H6XA 5ACA1 2XL9A 5FPXA 3WG7H 3GFIA 3BT9A 1IS3A 1VBD1 1HW2A 4XUTA 2OCCH 1SC7A 4URTA 2HWC2 1ORKA 4IERA 1SFUA 1MH3A 3BB6A 2TNFA 2QEXI 5B4XA 1UAAA 2DYRH 1VQPI 1PVC3 4D0PA 4BDYA 2E1MB 5J3UA 3DLLF 4PF1A 3TRSB 1BYHA 1SCRA 1E5SA 1RUJ3 3DYPA 5CLSA 1USTA 2WQZC 2ZNZA 1POV0 3E3VA 4IGPA 2K0GA 4LKDA 4A3EJ 5JSPA 1BR1A 2FE3A 2TRTA 3H5NA 5EZWA 3JSPA 5FZ7A 4RQPA 1I39A 2JQ7A 1RHI1 1WKMA 5EP9A 4U87A 2GC1A 2B9VA 4KITB 3K3NA 3H5RA 4E8CA 3CL1A 1PP7U 1Z0HA 2PA7A 4MHGA 5E18F 1A8MA 5LBCA 1KRIA 2K40A 4E7LA 1AXZA 3TOJA 5GP9A 2WFF2 1X19A 3O5SA 2R7OA 1ZGWA 2WNVB 5IHRA 2R071 2JSCA 4FCAA 2V5DA 3MWMA 1V6LA 3POIA 2WB1N 1H9TA 2A70A 1HXDA 2HU9A 4MYEA 2ZXIA 3T0DA 1MEC3 2D3PA 1XD7A 5I0TA 1G7YA 4JP0A 3LPGA 1IRXA 4DEVA 1HDDC 1R4MB 1O4XA 4BJ0A 2ZBJA 5KCMA 4ES8A 1TQPA 1MACA 1F9KA 4AFBA 1SAXA 1GWMA 1YO8A 1AX1A 1JOJA 3C7JA 3I7DA 2NXNB 4XIKA 2XDVA 3NRUA 1Y6IA 1WRJA 1UYXA 3QAHA 1JOBA 3SDGA 4E4HA 2R7UA 5DQ0A 2QZ2A 2LNBA 5C3SA 1NYWA 4PQQA 4HVRA 1ZRRA 1FOWA 2D6LX 2FJ1A 1RUI3 3GZNB 5CNAA 2A61A 1COV2 3B00A 4IF4A 1TWHJ 1V4RA 3CCVI 5K7ZA 1BBT1 1I27A 2MLGA 1AR61 3RYKA 2O0OA 3HSEA 1W90A 3RZOJ 5DAXA 2OAZA 2LS6A 3BU7A 1XYPA 4IHTA 2XAJA 1WBFA 1AHSA 4LOSA 2E32A 2R1DA 3ZPOA 3POYA 2IPQX 3IT8A 1MBKA 3M1EA 1SFOJ 3MBWA 2HWD2 3RZHA 2NMOA 3TB0A 5BQTA 1WUVA 2IXJA 1J75A 1I3AA 1E3HA 1OLQA 3SZGA 5A3WA 4V2GA 4XLAA 2GNBA 2XMLA 3O1TA 2RJLA 4D5CA 3N3HA 3WDTA 5BNPA 4XIOA 2DPDA 4GKYA 4XC9A 5AVAA 1WFXA 5A7OA 2XJSA 1OD5A 2ZGQA 4R9DA 4LLNA 1HRV3 1L0OC 4OUSA 1T08B 1XPXA 4BU2A 4MZUA 3LGRA 1WCDJ 5DYMA 3SDBA 5T50A 1UJ8A 4IEYA 4QX2A 1S2EA 2KA3A 3N7KA 2RVCA 3TO7A 4U7DA 2K9SA 3HN1A 3FMSA 3NSTA 4GKXA 2P2KA 3GXUA 1Q8VA 3PUQA 2RNJA 2DFHA 3O8HA 5JZGB 4YM0A 1V3FA 5JI6A 3G2BA 3U0ZA 3FM3A 1FEXA 4D69A 2J1SA 1AR92 3OYDA 1OFCX 3V65A 4OI2A 5D4SA 1W8UA 1NTCA 2V1XA 4LE3A 2TDXA 1A78A 4LOTA 1T0FA 4OIPF 3OBTA 4M3EA 1VF9A 1NCRA 1LDJA 1YE9A 3VBOB 4Q4V1 2B46X 1XX5A 5IATA 4P5OA 2ZNYA 3L9JT 1A36A 5L9VA 2HYGD 3JQXA 4KISA 2WUHA 2HYXA 3F8BA 4OFGA 3ZDSA 3J8F1 2ADEA 1KITA 2NOGA 4LO8A 5IFTA 2O61A 3T2OA 4LT5A 2D6PA 5FFOC 4MX3A 2R7VA 3QD6A 3LE0A 2QYOA 4ZXEA 5EJZB 2DURA 3KVAA 4K3UA 4G6TB 4QM8A 2XPJA 1JZ5A 4DEQA 1IGNA 1SFYA 2Q0AA 4UAPA 1VJ2A 3K1MA 2ZTNA 1EY2A 5CJ9A 3FLRA 2AEZA 1OSGA 2A6VA 2CW8A 2JG9B 4WBBA 4WF2A 2PJRA 3NWSA 2CV0A 1NKGA 3MYXA 3K4LA 1YQ5A 2V9PA 1IQDC 2DDUA 2R5YA 5CVIA 4NHYA 3U4XA 3KHCA 1KGSA 4MADA 1S2KA 4OLLA 4WM8A 5FYBA 4UW3A 1AR62 3WLUA 3J81K 2EB7A 2YUSA 4YW7A 3FM5A 2WWJA 1U9OA 1RUD3 1FMVA 1AUYA 4E8DA 1PM4A 3QU6A 5A3LA 4G6DA 5J3LA 3WG3A 3LSHA 3G1OA 5HDKA 2ME0A 1KQRA 4P96A 3WW4A 3T0BA 4XOTA 4Q4Y2 3ZQQA 1KA8A 2HPMA 2Y6JA 2ZGTA 1FOKA 3U1DA 5JOZA 2R7DA 3NJZA 5E88A 3AP5A 1KQ8A 2IEKA 3OUJA 3G6JB 4QPOA 1YEWA 4IQ4A 4HLXA 1BR4A 2AQFA 2AYHA 3KQRA 3R60A 1PK6C 3UETA 1AKHA 5FD5A 1PK6A 2JUCA 3NAPC 3GHNA 4XAAA 3WU0A 2H1LA 2A71A 4J25A 4F7ZA 3TDZC 4EGZA 1V6IA 3CEWA 3K3OA 5BY5A 3B01A 2FUG2 5J1XA 4HK8A 1E2XA 3RIRA 1ZARA 4AFCA 2P4EA 2R062 4CDXC 3LA7A 3AL0C 4XUQA 2OZUA 4IE5A 4M0HA 1JU4A 4WZCA 4E2SA 4U0WA 1AR91 2AEYA 3FBYA 1B9MA 3A0NA 4LA2A 3QRFF 2X4HA 4Q5OA 3MKLA 3W20A 2M4KA 5IT6A 2DDAA 2CL2A 4N43C 3CJXA 3BKZA 3PUBA 4Y5Z0 5CFDA 2WNUB 3NWTA 2CWMA 1JXNA 1B4AA 3OOPA 2V09A 2V72A 1MSEC 2Z2SB 1XU2A 2R0FA 2X29A 2CW7A 5AIQA 4M6XA 2F5VA 3CF2A 1PVC1 2W82A 4KMUX 3K4MA 2WO3A 4JQTA 1HJGA 4AI3A 2X1DA 4A3GJ 4CDXB 2ISZA 1FPN2 2A1XA 5KC5A 3OCPA 2VTXJ 3PQKA 3AZZA 3OSDA 3NQOA 3AZXA 5DG2A 4AI0A 2VO5A 4W6YA 1MZ5A 2R7WA 4YVWC 3LQQA 1S0GA 2V9KA 1R5ID 2D3SA 3K2OA 3AMHA 1R081 2HWD1 5ABJB 2JA7J 2JE8A 3KD4A 1ZZ9A 2OVUA 1VBA2 4ENNA 4B8EA 1FMD2 3IN9A 1W8NA 2Y0OA 4LXLA 4MLOA 5FQ0A 1I1GA 4WVVA 5J40A 3V4GA 3ROUA 1RMU2 2ISYA 2M3AA 4OHWA 1SDDB 5FXVA 1IF1A 3OOUA 4UB6C 4Q1PA 1JYIA 1XS9A 3KS7A 4QDSA 2ERFA 2DBBA 4IJAA 4A3FJ 2VW2A 5BNGA 3KV4A 2LMDA 4YELA 4XICA 1GNYA 5IAVA 1KYZA 1IAWA 2XJTA 5LBFA 2J42A 3WD5A 1UZCA 5FZHA 4XJWA 1HSTA 3UKVA 3ES1A 1W2UA 2EV0A 5BPXA 4CPBA 2XRNA 4XKVA 3HOTA 4II3A 2JE9A 3RZZA 3HNBM 2OXBA 5FZ4A 3ZFGB 3KP7A 1WD3A 1LEAA 2HXOA 3WCRA 1FX7A 2HS5A 3PM1A 1YC61 3V42A 2WO1A 3BZKA 2EIKH 4Z2WA 4KWKA 5DD4A 4FPOB 4RB0A 3IWFA 4JVAA 4QIWN 4CEYA 1BW5A 5T54A 4YVWA 3QP5A 2D97A 4LUKA 3ENRA 1HOMA 3ZYJB 4C2MJ 4RDUA 1TME2 3S3MA 2QQWA 1F9NA 3QYFA 3AVSA 3FHZA 3CMMA 3I71A 1B09A 5F0FA 2XJRA 3R6SA 4Y4RA 1OUSA 4IQJA 3WHUA 3L2YA 2VTXA 2D2WA 3TN91 4IHXA 2UYAA 3RSJA 4LBQA 4BA6A 1M1EB 1VBD3 4EJRA 1JS9A 3PSIA 4CSWA 2BY0A 2RJKA 2WINB 2A6ZA 2FU4A 3RZMA 3JREA 3GBGA 4GQ7A 2O8XA 3KWVA 1ZZ6A 3LF7A 1W2OA 2IUWA 4MGZE 3DF0A 3MF6A 4P14A 1XNDA 3WG1A 2OPWA 1CGPA 1RUOA 2DOAA 4A3MJ 4GO1A 3T09A 2XLGA 1ND3B 3HRMA 4XRFA 4DZJA 3SCGA 2DCZA 3IM0A 1UZVA 3N9LA 1N47A 4TV7A 2W7NA 3JAMK 5M5WJ 4XN0A 3MFKA 4PJMA 4BLJA 2NS7A 4WXHA 2YC0A 3KF5A 5B1BH 2BBAA 3CESA 4P9YA 1F2NA 1GWKA 2JTVA 2OF7A 5I0DA 4L99A 3LEKA 5IW0A 2ET7A 4XYXA 2Y64A 4QHOA 3K7AJ 4QXKA 1SBFA 4AFMA 3JRHA 3HOSA 3CCRI 3MIBA 5KXEA 1LKXA 3LFIA 1XSRA 2DA1A 4AG4A 3KZYA 3OS1A 3ZXJA 1OD3A 5AFEA 3R4DB 4NC8A 4OHZA 1LR5A 1NCRB 3ZYGA 2Y6FA 3B69A 1WWXA 3FWEA 3QPHA 2VZSA 4XOGA 3LOIA 3WG2A 2VNOA 3HN3A 5FY4A 5CU1A 4K8FA 3GTMJ 1WW6A 3AZYA 3KT4A 1RC9A 3I9V2 1H8VA 1PZ8A 5C3QA 4AU7A 3FK7A 4PCRA 1UYPA 1JZ2A 5B4NA 1HRV1 4J6GA 1MD0A 1YCIA 3IRRA 1R58A 3PUHA 5BNOA 3ECOA 4IEQA 3RWKX 4ZDOA 1DQ4A 2VTFA 2R7EB 3OYBA 1YI9A 3CDHA 4D5FA 2VJ5A 4NIDA 5JLXA 2JDPA 2VOKA 2ZFUA 3D5RC 2EZIA 4TXWA 4L9NA 1OOPA 2ZAHA 3HG9A 2IXLA 3MV01 1RUJ1 2BY1A 3BVCA 4XMYA 1PVEA 5BNNB 1Y8RB 2BW8A 2TUNA 1QIQA 1SFXA 5IAXA 2BV4A 2KT0A 4EN0A 4FSJA 4KN7X 2RREA 4MQ9F 5JR7B 4WCGA 4IE7A 3ZFFB 3CQZJ 1W03A 2GMPA 2UWAA 3VHNA 2RR13 1EPWA 3PUIA 1MIJA 2Y2ZA 4CDWB 5FLXK 1EAH1 2VJXA 1IS4A 4DPNA 1OKOA 3AYAA 1A3KA 3NNFA 3ZIWA 1S29A 3CZ6A 3DBRB 3IB3A 2CFOA 4N53B 4OHXA 3S2WA 3OYMA 3NJVA 5K9YA 2CYFA 2G9ZA 4I7HA 2WABA 1DGWA 4JC1A 3ZO0B 3SCFA 4Q1RA 2KM2A 3TDUC 1FMD1 3ZR6A 1IOAA 5FO5A 2L2OA 4E4ZA 3R4SA 3BTAA 3NAPB 3NAPA 2VIXA 2IXCA 2ESNA 2XBO2 3V8KA 3HSRA 2HGCA 3RPUA 2FNAA 3HOXJ 2W39A 1ZLJA 3WCSA 4XTMA 4B4RA 3W3CA 3PJYA 2VJJA 4Q4ZF 4BQAA 1UMHA 2CV6A 2RS33 1SAUA 2VE9A 5FZ3A 1NY71 1UD1A 3GYDA 5I0UA 1VBD2 1QXJA 1C5IA 1ZYRF 3OV8A 2ID6A 4NIAA 3VUOA 1HB1A 3F23A 3K69A 2NN8A 4M0NA 4NIGA 4UUSA 2LM3A 1G9AA 4XCBA 1MMDA 1FATA 2JB4A 2P7CB 1AYM2 4N43A 4QU2A 3ZMSA 1YUDA 5KK1A 4KIBA 4BGDA 1H9GA 2JA6J 1KU7A 1A6CA 1NCQB 4H7MA 1OPMA 1QJFA 4CE8A 1P9QC 5L3FA 2R5YB 3F3XA 1JTZX 1D1CA 2Q1ZB 1MR5A 4K40A 3FLPA 2J5PA 1COV1 3SEPA 3CCEI 2XGEA 3SC7X 4N7UA 3GZTB 2YU2A 3N9OA 1FZPB 3OEBA 2YU1A 5DABA 2VJIA 3Q3SA 4L0ZB 2MH2A 1ZR4A 1GICA 3ASIA 1UHMA 4D7SA 1STZA 2RS51 3I56I 1HDKA 1W99A 3MZHA 5LA2A 2ECBA 2M7AA 5LD2C 1NHAA 1S0BA 5D2AA 4S0HB 4NO4A 1YO5C 3M3IA 1EA3A 1VQ7I 4IOAF 4DFSA 4ZZDA 4ANJA 3OGSA 1C4RA 4ZDLA 4RLFA 4ZYEA 4IRHA 3V8JA 1UN1A 2RHPA 3M4FA 4LJZF 2CW0F 1WHUA 3I2JA 4XQFA 5F0CA 2XJPA 5LBQA 1WCKA 4JZRA 1UIKA 4XM3A 2CGPA 3PL0A 4A5NA 1POV3 2BHZA 3LFUA 3LSIA 2D3RA 2AC1A 2ZGMA 1OURA 5FFXA 4EGYA 3WP6A 4QX1A 2XB0X 1L7QA 4TSVA 3G6EI 3ZX7A 3GVAA 3RVHA 2VONA 2XJUA 3IC7A 1YW7A 3QYBA 4IO9F 3FZ3A 1I3QJ 4AHWA 1JZ8A 3CKHA 4IKFA 1QQP3 2JX9A 4P00B 3JSOA 2YZ4A 3HOYJ 4HX7A 3ZQHA 3ZSLA 1BMV1 3AYEA 1JI6A 1RL3A 4CDGA 4I0AA 1XSQA 5GZDA 1K61A 3KP2A 1NZIA 1E5RA 2Y8KA 3CLOA 5A3MA 1W8TA 2XLAA 1HSJA 2ZJ2A 3DPLC 4CEYB 1RUG1 4JKKA 1DGWY 5GTHC 1OCZH 2EIJH 3WTYC 4ZTFA 2AH2A 1Y9MA 2VBZA 4IDZA 4IHWA 1V70A 1QF3A 5T5PA 3FBNB 4IHYA 2DFBA 2UU8A 3HUGB 4JCKA 1NUKA 1XNAA 3VKNA 2LDUA 2PHFA 4HMZA 3ELNA 1OQEA 3O0WA 4Q4Y1 1S55A 5HI0A 1D1AA 2A6XA 1MBEA 4Y4YA 1FJLA 4BQ5A 1OCTC 1K12A 1GLNA 1WJDA 5ABJA 2X1CA 4JDOA 2AACA 5F3EA 5FXWA 2B7EA 4CVUA 3TYJA 2COMA 3TQNA 1RMU3 1NLSA 2LRPA 2QQBA 5FMBA 1BMV2 4GXOA 5G05L 2W0XA 5LK5A 3L7WA 3H8OA 2BV6A 4HLYA 3RG0A 3H9QA 4HNUA 5M3MJ 2P37A 3GWZA 2DA6A 1BC7C 2WNVA 2PXJA 5FMOS 5JIUA 2F6BA 5LWBA 1AZDA 5HVQC 2W25A 4LG3A 1G59A 5DAVA 2D43A 5TGTA 4CRQA 1K45A 4Z8BA 1GZCA 1QWRA 1QZEA 3J7ZI 2X6WA 5LHGA 3ORJA 3WINE 1SFKA 5DUKA 2CDPA 4DXSA 5GJ6A 3FFZA 2QUFA 1WJBA 4R9AA 3THDA 3NO8A 3ZFGA 1HC8A 1SD5A 3S93A 4Y1XA 4XPVA 1RUC1 4RGXA 1JE8A 2VZRA 1OYYA 4Z2YA 4AVSA 2VI6A 2ZHLA 4RMNA 3QH6A 4K2EA 4HA8A 2E2HJ 3NV1A 2A3YA 5L19A 4DUWA 1NAEA 5FPZA 3NJYA 3L2UA 3JCUC 3TBDA 1NZCA 4M4PA 2JB8A 2I45A 2ZHKA 3VZNA 1X2NA 2IS4A 3QACA 2RAEA 1P2FA 2VQ0A 1JBCA 3QBQA 4ESJA 1QJU1 5I8SA 2F5CA 2OA4A 2R92J 2R073 4MGTA 2XHKA 5KAFC 2ZKLA 3UJQA 5I0RA 2JECA 3LFKA 2KIMA 4HL0A 2CU5A 4DXTA 5LA9A 3WZ1A 5E1ZB 1PX4A 2Q8DA 2NM1A 4XHBA 1OI6A 3CUQA 4YLZA 4PCQA 3FFQA 2BNMA 1WH7A 2MD5A 2XIGA 2I07B 4CCCA 1UHSA 2QQ8A 1DQ6A 1LECA 1F8VA 5BNNA 2XAQA 4KGGA 3ONQA 1JYWA 1IXCA 3HKZN 4W6WA 3BCBA 2JDMA 2RVAA 2VXRA 3E5XA 4AWXB 1UYZA 4XZUG 5GZEA 4UFLA 3AFGA 3UV9A 4DBQA 1ZH5A 3KFWX 1QOSA 3BR2A 3KEQA 4Y1ZA 3HGYA 4F8AA 1DPRA 3S1RJ 2HYKA 2YSRA 2GNMA 2XUBA 1HKTA 4UFKA 4AIDA 3GW2A 4EWEA 4JKLA 3ZSEA 4QGMA 3UYJA 3C2BA 2BXYA 4G9YA 5D5WB 3HB9A 2XC7A 3HRSA 5D8AB 4EM2A 1LDDA 4CUCA 4LK7A 5C5TA 3CU7A 3V56A 1GYKA 1W05A 1YIFA 3QPTA 4BDZA 5HDGA 5IK4A 3EMRA 4FXKB 4ESFA 1V6KA 3ZQGA 4KU8A 3SMHA 2EFQA 4B43A 2MYSA 3F0CA 3K2AA 5C7GA 5A7NA 4CCKA 3DKXA 3LB9A 4NRMA 4XLCA 1UMQA 5H9QA 3CJQB 3VDDB 3V0AA 4BL0B 1TMF1 2ZEXA 3R4UA 5ACA2 3RQ4A 4KH9A 4Y20B 4H7LA 2RG4A 2DDBA 3CF5F 2XWBB 4CU9A 4F52A 1UPSA 2VL4A 3TEZA 4UF0B 2E7TA 5BNNC 3B9CA 4PLMA 3EETA 4AI2A 2DMUA 2D98A 1V5EA 3OUHA 2YFUA 3GTJJ 4AEKA 3VB2A 1OR7C 1ULPA 1PGW1 2QBYA 4ZPIA 2VULA 5CFDC 5FKCA 1DP7P 4XLPF 2ADDA 4EZHA 5C8CC 1YRNB 1LJ7A 1AX0A 2VGDA 2ZPXA 3S14J 3E6CC 5HCFA 4QPGA 4BY1J 3WTWC 2J22A 2ZGNA 3OYWA 4FXGB 3MKZA 3ZXSA 3TOBA 1IN8A 1IXRC 5CVVA 1RTVA 4BMBA 1U0AA 5FD6A 2B45X 1ZA7A 5GLWA 4B09A 1HV1A 1BK0A 3ZQ7A 1D8KA 2VXJA 4LFUA 1QQP1 4KYWA 3AP9A 4GIQA 3VD4A 2V73A 3K77A 1JGSA 1O7LA 1FBSA 1KZHA 4WVMB 4C0BA 3CC7I 4DS0A 5FYIA 3OL4A 4HYEA 4E4SA 4RAZA 4MUVA 3R4KA 2CTVA 2IFWA 2XVKA 3OJBA 2VBBA 1RJ8A 1VBE2 4KT5C 4UT5A 1UYYA 2OQ6A 4CDWA 2FDIA 2OYZA 2A05A 4BXFA 3T2TA 5JCTA 1XMXA 3I3QA 2AENA 1JHHA 1OQ1A 2WDBA 2VN2A 3LDRA 4LULA 3AP4A 4RR3B 4BQYA 5CADA 1T56A 3O0VA 4QX8A 2Y0SN 4HSTA 4KT6A 1MJ9A 1MS5A 5HLIA 2V79A 1MVEA 1NA1C 4OZXA 1YYVA 5F0HA 3HVDA 3EO6A 2FBEA 2QQIA 1JKPC 2GNTA 5FZLA 4A44A 4LA3A 5DAQA 3ZN5A 3WG9A 1CJDA 1RUC2 1K79A 3P9KA 3KP3A 4YSFA 2R16A 5LEKA 2DK8A 4CO8A 3W5MA 2E34A 1RR7A 1NQDA 3BTXA 2XLFA 3GF2A 5TJJA 2HQAA 4E70A 2DBIA 4CDQC 1EV11 4YEJA 1H8AC 1ASJ2 2ZXHA 2IXKA 4CXXA 4MVTA 4IRIA 1TQIA 3PFYA 4UFHA 3RI9A 1UPIA 4HQMA 2L7KA 2C5DA 3ZM8A 4GD4A 4NQWB 1O7FA 2Q0OA 2WZR2 4HPKB 1JJ6C 1FYMA 2PLV2 3VBSA 1FV3A 1FOD3 2FSWA 4C30A 3VBSC 4Q4W1 2D7FA 1AL0G 4C0HA 5FV3A 4IXAA 3OYHA 1RI7A 2O1QA 3BJOA 4HPQA 3URFA 4EQVA 1QZYA 2Y69H 4DOUA 4EM0B 2NS0A 3WQ0A 5FKNA 4LE4A 3O1UA 2JZYA 1G8XA 1U6GA 3G1MA 1U5XA 3H8RA 1WW5A 4MHUA 2D6MA 3G4SI 2KL4A 1BJAA 2BERA 4A7ZA 4EMSA 1O5UA 2BRTA 1X4OA 1D1BA 3ACIA 3A21A 3OYNA 3BR6A 1Q8OA 2QQUA 2FBHA 2O0YA 2WWUA 5C4WC 4IESA 4YNIA 2JDHA 4B3AA 3HQRA 2F5DA 5IP7J 1AR72 1NXD1 1DLLA 3HEIA 5F5IA 3GZ6A 2DT7B 2WY8Q 4BH9A 2MFZA 4Q47A 3UL2A 2VQCA 5CISA 4LPLA 4PDKA 2MBFA 1ETXA 1N1VA 4XF1A 1OYWA 2YHJA 4GYIA 2DTRA 2HBUA 4RM3A 2YY1A 2YROA 1STMA 5D6EA 5EQUA 4B8XA 3KVBA 2WA3A 2ZGOA 1BEV2 3H8XA 3CIHA 4MSVA 1YOVB 1NG7A 1K6YA 2J1RA 1HF0A 2GNDA 4UFMA 1YLLA 3LEIA 2L54A 1PVC2 3LOBA 2MLKA 4Q4V2 4UXAA 3C7GA 1WWYA 1WKYA 1G6NA 2K4BA 2VQGA 4BUPA 1W6NB 4XF3A 2X53S 3A02A 4E7SA 5JVTA 1S5LC 1AL21 1AJKA 3GEZA 4WVZA 3O1VA 1IG7A 5A2QZ 2HVSA 2VMIA 4XFBA 3CJIC 3S2HJ 1HRI2 2EVXA 2E2JJ 3N9QA 2RMU3 2PX9A 1JZ3A 3PUAA 1PHMA 3IWZA 4PDWB 1MS3A 4NIHA 3RZDJ 2R5ZA 3LWFA 2RM21 4Y5TA 1WGPA 3CJIB 5EWSA 2ZZQA 3ACFA 2KIFA 1W6MA 3BG5A 1G9BA 3K70D 1W6MB 2BOIA 3LCPA 1AYN3 2DBNA 1PIV2 1MSFC 1OQYA 5FY1A 1GU3A 4R79A 1J83A 2EJRA 1H2NA 3JD72 3ZXLA 4A2UA 2Q8CA 4R1HA 1B6AA 3V7CA 1LULA 4FFIA 2XGCA 2KDZA 3FXRA 2VMHA 1RNLA 2TCTA 4LBKA 2W2IA 3WNOA 1UWWA 1QVUA 2VUDA 1Y0NA 3NKGA 2JMWA 4XBNA 2JKBA 4NDLA 3ZRGA 2LY2A 5F6KA 3LZZA 4RB2C 3BJAA 1OOPC 3PU3A 1NXMA 1GZWB 4QQLA 4JTNA 5J96B 5ISLA 3IAQA 5JPNB 2RKHA 4G8XA 3AJYA 1RUD2 4R52A 2HEVF 2P81A 4R4XA 1LEMA 1G3YA 2LYCA 3IHUA 2R7QA 2OA2A 3WHBA 4XL9A 1JT0A 2A6WA 2XVCA 5J09A 5KHGA 4CCDA 2P0WA 1X50A 5J98B 3ATGA 2IZWA 1PX3A 4LHSA 1OLTA 2VUCA 4J01A 2QUOA 1P92A 4C3JJ 3VYSB 1YIJI 3AYCA 3RKXA 2PHLA 1VP6A 1F15A 4U36A 5DN2A 1ZM1A 1QRYA 1H2MA 3QPLA 3LIHA 5FAXA 3I97A 2L9VA 4KGQA 5FRNA 4UHTA 4Z6YA 3I59B 3H7JA 4XFGA 2K5CA 1JKOC 3OD0A 1F4AA 5E3LA 2BOLA 3MFAA 5HOOA 3S7IA 2LBFA 2BWCA 1NOVA 3FXMA 5BPIA 3DU5A 4C9YA 3CUQC 3AG2H 5CFCB 2Y38A 3VBRC 1XGSA 4NBQA 1I6XA 1Y9GA 1BIAA 5T3NA 4FX0A 5FXZA 5ICGA 1MMNA 4CZSA 3RNSA 1ZTRA 1WBLA 2WLQA 2UY8A 2OKXA 1XQNA 4RB1A 4B47A 3JZVA 2K9ZA 4MQVA 1VQMI 4HBNA 1IN6A 5DCMA 4G7ZF 4AQTA 4U0YA 3ZFFA 2MG4A 1JZ7A 4KIGA 2ZGUA 2WNOA 3HBZA 2WAFA 3DYOA 3L2VA 4QT6A 4UF0A 3ZGKA 4IV1A 3D8CA 1E57A 4F93B 5HLTA 4MNUA 3EUKL 4PGHA 2IRFG 2D1HA 4XQ4A 4LLOA 4RHV3 1YI2I 4IOCF 4XABA 4SLIA 2EAKA 3H1MA 2YBKA 2CUFA 1RC6A 3BR0A 1H9WA 1FWZA 4QX3A 4RFT0 4JOMA 3ACLA 1OKRA 3HSFA 4IEPA 4LQRA 4QDQA 4CXYA 4I30A 1IV8A 4ZYHA 4F92B 1DU3D 2YB7A 4EWDA 2Z4FA 4G7HF 1CWPA 1S3JA 3WUDA 1TMF2 2GH2A 1R7JA 1UW8A 3W6VA 2L9RA 3RMXA 3MGUA 2AZ5A 3IDCB 3USUA 4A0XA 1IKQA 4BHCA 3ILRA 3SH4A 3K4ZA 3SCHA 4YFXF 4PIYA 3QP6A 2PMUA 4BXXJ 1H89C 3AL6A 5EEGA 1O6UA 3D3AA 5FYHA 1BI0A 4HOBA 2YFZA 5EZHA 2W68A 3CCLI 1RITA 2YGMA 2IXHA 4S2GA 1V54H 3BLYA 2ID3A 1W2TA 1QHHD 1W8OA 5C8CA 2JDZA 1UY2A 4QKNA 5EJCA 1DZTA 5IYBJ 4XUOA 2E1OA 4EQQA 1GZTA 1WQ2A 1S0FA 3OIPA 1FBUA 1RR8C 4AGVA 3V7RA 1LOFA 2EFOA 2R0QC 2Q1FA 1D8JA 1YHQI 5CQEA 4GJYA 2BJSA 1W04A 3S1MJ 1BA5A 4QQHA 2P1BA 2KFDA 4MH0E 5JLWA 4AK3A 3CCQI 2JWPA 1ASJ3 5A7WA 4Q27A 3ZMUA 2ZKNA 1D5YA 2ACJA 3F21A 3M8JA 3T0YA 3C3WA 5E89A 1VQKI 2CWEA 3IL2A 4DZGA 2W94A 4M9XA 3VD3A 1F5FA 1B9NA 5M0TA 4B4CA 5D5VB 4YW4A 2VMEA 3GTLJ 4LO7A 2QBYB 3G1LA 2I5UA 3THCA 1B8IA 4XSXF 4FPEA 3A4CA 3ERMA 1HRI3 5FUIA 4M3BA 4ZZ5A 1X8EA 4OAYA 1SG3A 5EXOA 3VBHB 3OPWA 1G3SA 1V55H 1H8TA 5BNQA 3IDBB 1AR81 3VBHA 5JR2A 3OEAA 1AR93 1SQ4A 4NE9A 2E36A 2P34A 1O4TA 3AXEA 1W7PA 2QQ9A 3ZSJA 4XJZA 3EQEA 1MQTA 3IPVB 4LO6B 3NWKA 4OWRB 4U7BA 4LBOA 2DLLA 4BJ5C 1LENA 1GVJA 1W5TA 1X4PA 4FT8A 2E53A 1Y7BA 4IETA 2LTNA 4O9EA 3GFMA 3ZN1A 1JUSA 1G8WA 2JIJA 3PNAA 2DJIA 2P6CA 2W00A 1OLME 3BU0A 2L9SA 3VYUB 1URXA 3J80K 2EIDA 2WNUA 1BR2A 4CZCA 3NNGA 1GBGA 3J80Z 4L2NA 4GZ9A 1RESA 1ULOA 1POGA 3CBNA 3LAPA 1FC3A 4CCOA 5CKNA 4XAEA 1LHOA 1LEBA 1OF4A 4A12A 3N9NA 1P4AA 1V9U1 1P8JA 1FTZA 1KFXL 5IYYA 1ETQA 1VB2A 2BW3B 5GLZA 2BW3A 3IDAA 1PO13 4K1ZA 3KF3A 1NE4A 1KQ0A 1U5IA 2R042 2LW8A 5JVGF 2WFF1 2WSUA 1T8IA 4BYYA 4WX9A 1TE1B 3A0HC 3C2HA 3B93A 3GCWA 3SFIA 2Y34A 3LSRA 3VHPA 2DFFA 5LATA 5BPDA 4S04A 1YWKA 1UFMA 4E7ZA 3UGFA 2DTZA 4AGGA 1X1BA 1GLHA 2L4AA 2DA7A 2ZGSA 4PDWA 2YX4A 4JRLA 1RHI2 1HXS3 4WK8F 3OSGA 1EAH3 5EHDA 2WRAA 3ON7A 5A33A 1Z7S2 4KMQA 2JDUA 2VKEA 2FA5A 4ONUA 4RQPB 4DJAA 2Y9ZA 4YWAA 4AI9A 5FLXZ 1IZ3A 3HTUA 1SLTA 3AM2A 2FD8A 2KP6A 4HKLA 1Z7S3 3QWLA 4JAAA 4YM1A 4K21A 5KHJA 4QMAA 5ICCA 5GM0A 4ATFA 1R1ZA 3SKVA 3KT1A 2GP3A 3OSFA 3VZMA 4LBNA 1TNTA 1JHNA 1SCSA 3T08A 4AYUA 1OVSA 3WGHA 2VODA 1H88C 1OT5A 1HQCA 3FMRA 2VBDA 2VBPA 1KD7A 2XVGA 1ZVFA 5A6QA 2JDKA 1HXS2 4A6SA 4P9UA 2RQPA 3CO2A 3ZN6A 4IVNA 2DVFA 4QB6A 4J1XA 5E3MA 2NS8A 5HS8A 3O2PE 4DINB 1QJX2 3J7LA 4QPWA 1S1AA 4QB2A 1AJOA 3AP7A 1ZGAA 3GYHX 3G73A 3MIEA 4AI8A 3ALQA 5GLTA 2CQKA 4YFWA 2A6TA 4XRMA 4Q5SF 2E71A 1WLDA 3ULQB 1OA4A 1ULYA 1OMIA 3WGGA 2WLPA 2FDKA 5F5CA 2DN0A 1GP6A 1OA2A 2OZJA 2JG9C 2VLAA 4PT6A 2A6YA 2HWVA 4AHYA 1R4NB 3VKMA 1OCRH 3R61A 2YDEA 4D6QA 1SEUA 4L9JA 3CJRB 2X10A 2NYXA 1OLRA 2GMMA 4C2UA 4CXFA 4NUBA 2R5ZB 1JODA 1VI0A 3WNKA 3KP4A 4XKCA 4CH7A 2YUEA 2DFIA 1C28A 3NNMA 4YGDA 2BZDA 1MZEA 3FZVA 1UXZA 4C1WA 4A41A 3DEWA 2OUMA 1GQPA 3WQBA 4XLNF 4TLGA 2F4IA 2FCTA 3MVPA 4JGZB 5EFUA 2M30A 5J47A 2R32A 2YGLA 1N77A 3HOZJ 4JGZA 4O65A 1NLQA 4ZHNA 3FUQA 1IUFA 3SYTA 4BLIA 5H9SA 2AGSA 3CLQA 2KRFA 3E7LA 2HVQA 3OGGA 1D0HA 4M72A 4M3FA 1L3JA 2YR2A 4M3CE 4LOCA 5CG9A 4AVTA 2ETEA 5IPAA 1ACIA 3FK6A 1DUXC 3HDDA 2JG9A 4RHV1 1Y3TA 1XMKA 2KJCA 3I3MA 1N3PA 1GANA 2HI3A 1CAWB 3IMNA 4FFHA 5T52A 1VE0A 1U5ZA 4FTBA 3PU8A 4OULA 2VZ3A 4PFPA 1SFEA 3WP3A 3AK0A 2ZX1A 3AKPA 3WDYA 1FXZA 4AEMA 2GMEA 1JXSA 2HTJA 1UY0A 2MEV3 4GALA 1N1SA 4LLLA 2YBSA 4XKWA 4NMIA 5C3RA 5L3CA 3PLQA 2KMUA 3ZQLA 2HQRA 1SPPA 1I5PA 2VM9A 2ME6A 2JDAA 4XF9A 2JK3A 2HWB2 1N1YA 3DF8A 1DZRA 4XLHA 2BE5F 4ORFA 3H3ZA 1LKNA 2B0LA 5C3EJ 3GGLA 3PJQA 4YVSA 3AL0B 4BPZA 5JHUA 4C1XA 2ZJRF 2Y0MA 5GZGA 4LR4A 4NROA 4A7YA 1SD6A 4WM7A 4FO9A 2MNGA 4ZS3A 3VLBB 1Z6RA 3O0XA 4WM7C 2EBIA 3CLPA 2VQHA 3B9IA 5FWJA 4AR2A 4N7IA 5JDBA 4KWJA 2JPCA 5L3EA 1KS5A 5J1YA 1YX5A 4OI1A 3BTCA 5CVJA 2WWYA 3K2ZA 2OCEA 1J84A 2XROA 4Y13A 3VSLA 3OF1A 5LFAA 3GMEA 3AAFA 1T98A 4XNFA 4AFDA 1W0TA 2W9XA 4DGWB 2M34A 5HCBA 3TWIA 1JW6A 4U0VA 4U2AA 1XOYA 4KG0A 2V5YA 3VHRA 5L7OA 1US3A 3ZKYA 2Z5UA 1E5HA 1O57A 4IL6C 3HPNA 3U75A 4ZTJA 1ITYA 1FOYA 1S0IA 2C9AA 1P6RA 3VKFC 3KCXA 4RR3A 5F08A 2VKHA 1SD7A 4Z07A 4QWQA 2VR4A 2IBDA 4GDFA 4I3PA 1RKTA 2VBXA 5T5JA 3VZOA 1CIYA 4BKXA 1FAYA 1RUI1 1XGNA 2M0CA 2G9FA 4RGGA 4UW6A 4L97A 2ZEWA 3OGJA 2DMNA 4AF9A 5FMDA 1FBQA 1VPHA 1FT9A 2D6OX 4BJ6C 1ZN2A 1XRUA 2ZXWH 1R64A 4CA9A 3FKJA 1QDCA 2P17A 2DUQA 5JPMB 3KZZA 2QE3A 1PIV3 5KAIC 2WT1A 5JSOA 3BALA 1WJ5A 3FX3A 4PGGA 3WW3A 1PUFA 1LOGA 2WB1A 3B94A 2DVDA 5EZGA 1MVQA 3POJA 1L3LA 4COWA 2WBMA 3OG2A 3V8LA 3H7YA 1FNNA 5FY0A 4ZU7A 3S5QA 4RN5A 4DYRA 1FP1D 2WAQA 2ZA9A 3AMQA 1DQ2A 3V0BB 4HANA 1MNDA 1GV5A 1W39A 2OPTA 1G4DA 4P9JA 1ETYA 1VRBA 2P3JA 2R1BA 2HWB1 3KHBA 4NVPA 5EJ1B 3FUOA 5LHIA 5BNPC 3HOBA 3RYRA 2XRLA 2ARBA 3OGVA 3WNLA 2UY9A 2E1MC 3BTJA 4HAMA 5FWEA 1S0JA 2IGKA 3B6AA 2DWRA 4CUGA 4AVZA 3AG4H 3M2MA 5L3DA 1MS9A 2E2IJ 3S15J 3FHNA 1UU6A 2BQPA 1WJAA 1XPWA 1W3VA 2ZZJA 2ZB9A 4H2AA 2CSOA 3LSKA 1FIPA 3EJKA 5K5RA 1XXNA 5J36A 5IK7A 3OS0A 2GOXB 3QH7A 1T2KA 1FOD2 5LZ6A 2BVMA 5A3PA 3GF6A 3SISA 1XC5A 2LP0A 2O8OA 3S3OA 3P1IA 4Y24A 1BJQA 1Y39A 4L5JA 3HWJA 3IUOA 2PHXA 3LAJA 4N4OB 1H0BA 2M4GA 3L2CA 1W28A 2RS11 4BBSJ 1UMIA 1D7PM 2RNGA 5KHDA 2Y60A 1ND2A 1JN2P 1MS8A 4FHTA 1QJY1 1W6NA 2J1TA 1I6HJ 2JA5J 2VKVA 2CAVA 3E1F1 1WCSA 2CGOA 3EHKA 1LGNA 4M3CF 2JUGA 1SMVA 1CONA 5HLGA 5C33A 3Q5FA 3O3KA 5LB6A 5C4XJ 2HKOA 1UZ0A 3BPVA 4CEWA 1DYPA 2M8GX 3GZEA 3PNYA 2R7TA 2X48A 3CDZB 2FHRA 4N90A 2BNOA 2M0MA 5IT9K 4DB5A 2X09A 1TZLA 4S2FA 4M3GA 2C6SA 2NNYA 2YMZA 3L9FA 4KUMA 3NQHA 2YS9A 3D5OA 1X9TA 5GZCA 5K7PA 2R3SA 1A31A 2GP5A 4A3JJ 4Q4V3 1ENRA 3OYLA 3FHQA 4ET7A 5JXIA 3ZXDA 2AQEA 1WW7A 1JUPA 3J8F3 3J7NA 4KMFA 4KI5M 2EPFA 2Y31A 1BC8C 2SLIA 5A3NA 4IXLA 4KG8A 2D93A 1QNTA 1F1ZA 1XDSA 4BQ3A 1ZA4A 4QAWA 4ZZLA 3CMYA 5TSWA 3CQOA 1ULFA 2HOSA 3HPGA 2VG9A 2QQMA 3FBMA 2ZEZA 4MGQA 1T95A 5FZBA 2QGUA 5JIAA 3U14A 1CJPA 4LG0A 4HT1T 5I93A 3VN4A 2K02A 2LY1A 4CA0A 5FBZA 2VCCA 3DKWA 4UUVA 4RGKA 1XYOA 2RS13 2DYCA 4KFCA 3VBRA 2HFHA 1XN7A 1CAUA 4D0QA 5FYYA 1YQAA 2O7OA 3SH3A 4ARYA 4FFFA 5FK8A 5BXXA 5DM6F 3WNXA 3JD73 4ZONA 4YZ3A 1JKQC 1GMMA 3GTOJ 3KYDB 4QGLA 1EH7A 1WJEA 4AIKA 2PMZA 2GC3A 4C8DA 3M1HA 2RM23 4M9SA 1W5SA 5BNOB 5F37A 3LNQA 1SEFA 1KONA 2E31A 1RUF1 2LROA 2RDPA 2WN2A 2MD0A 3OUIA 4YVSC 3WF0A 1WI9A 1RVF3 1ETOA 2XB6C 4XRSA 3KMHA 3WNPA 4XRSG 3DPRC 1ZBE3 3F6VA 3DPRA 2M7BA 1UKGA 1VAMA 1ULGA 5FZKA 3HHHA 3MLJA 3BC8A 1CQ9A 4RS5A 4Y17A 2PQ8A 4RS5C 4JQFA 2OU2A 4ZKTB 3SQOA 2R7RA 3IAPA 5BUVA 1GUUA 1TWFJ 2WS92 3H1CA 1VQ6I 1GP5A 3AL5A 3SQNA 1MS4A 2JWTA 1WZ2A 1QJY2 3ZR5A 3LA3A 1DHKB 1UKRA 3MFCA 3JD71 1QQP2 2BXZA 4HVOA 2NYYA 3JR9A 3HYIA 1RZ4A 4HOOA 3FE5A 1UCXA 5FZIA 1V00A 3FHAA 3ZOBA 5FZEA 1B35A 5DZEA 4KWUA 3UESA 4EWAA 2HQNA 1LB2A 1LFUP 5I91A 1H4GA 2E9QA 4KWLA 4B7KA 4L5EA 4BQ1A 2Y6LA 2QLZA 4BZ4A 1U12A 4HONA 3H8UA 1CIWA 1RUF2 2W24A 3KT7A 3LD8A 5CB7A 5D8AC 3W2WA 4A6DA 2ZX4A 1OC1A 1NLRA 1DGRN 2PI0A 1GV9A 2QWWA 1ZAOA 1MPXA 4H3WA 1P4WA 1DQ5A 3RKQA 1WMDA 4PZJA 5H6QA 3L2QA 4X6QB 1IRGA 4QX5A 2UURA 3ZR8X 1YXWA 4DO0A 2PMZN 4WVMA 1FP2A 3ZYFA 1LESA 4FPJA 5A7QA 3WE3A 4E2GA 1ODNA 5HPOA 4PUSA 1EUUA 3GBFA 1DU0A 2ZX0A 9ANTA 2EQRA 2BFUS 1YQ2A 2D5VA 1W9FA 1W6OB 1D5VA 3RZJA 4P9XA 1T39A 4AXOA 1W6OA 4J00A 2G9GA 2F4PA 3U10A 1XC6A 4QX7A 1UOGA 3MEXA 1TQ5A 2BTVC 4UUSB 4RM2A 1UHWA 1EH6A 4C90A 5T5LA 4BE1A 2XASA 2Q5TA 1TZOA 2FX0A 1MDMB 3RMYA 1H1IA 2PJPA 3VDAA 2JENA 2DCKA 1YTYA 1Q43A 1WCMJ 3S0MA 1OISA 3VBUB 1UB9A 1BK1A 4HX8A 1GDTA 2RS52 4LIVA 3MDPA 2KXLA 5CVUA 3DEUA 2VZUA 3ZPLA 4LORA 3M07A 2QENA 3WY6A 2X05A 1DFQA 2L9LA 2LF8A 1EYBA 1LRHA 4QWNA 4CDXA 5LY2A 4UWDA 3SZTA 4Q2FA 1YQ8A 2JD9A 2OUHA 2IA0A 4CDWC 3JRIA 4DNYA 4XE9A 3B7MA 4LHNA 2ZEYA 1H8TC 1OR7A 2C6YA 2D6NA 4YFNF 1M06G 4IEXA 3B6CA 1O8PA 2KPMA 4AUXA 5CIRA 5FZDA 1G9FA 1C5HA 4A7KA 2DO7A 1VFCA 2VVFA 1LNWA 1RETA 1QKQA 3CNAA 2P4WA 1W1WE 4A6OA 2A5YB 5A7PA 4MEXF 4B4PA 3P5BA 2GA2A 5FYSA 1X1PA 3RZGA 1RVF2 3VBFB 1J9IA 4YM3A 1W6PA 3WW2A 1X3WB 2D40A 2IXIA 3H42B 5KC6A 1QGPA 5IFPA 2XPVA 1WZXA 2LR8A 1LODA 1WJCA 4YW1A 2DCJA 5FUNA 3S57A 1Q56A 1GXPA 3F8NA 3S7EA 2HPIA 2QCSB 3IBMA 4L8QA 1SD4A 2DV9A 1VMJA 4CPBD 3CCMI 5APAA 4CU6A 3CO6C 1MQTB 4GMP0 3LEGA 1FTTA 2ADUA 5L3BA 1UU4A 3ASOH 4A3IJ 5LHHA 2UUZA 5J8FA 3ERED 4V2WA 2O03A 3ZSMA 3J26N 5GPAA 1EPZA 3LEMA 2FQPA 1QY4A 1R49A 2A3SA 2H6BA 5DDJ3 4D9JA 3RWNA 3KV9A 2GA1A 3REOA 4LITA 1SVMA 3KV5A 1TWCJ 5DUXA 5CVRA 3A01A 1TNFA 1SDWA 4X0GA 2IP2A 2XPUA 1F31A 5FY7A 1LAJA 4AOCA 4OYUA 2VQAA 3UR3C 4M01A 2F5EA 5DM7F 5LRRA 3OYCA 2CYYA 2XKPA 2E6VA 3WODF 1FX5A 1K83J 1YX3A 2VZTA 2A7AA 5KR7A 5B66C 4SBVA 3K51A 2ZAAA 1UZZA 3JUUA 2OTJI 3I5UA 4CZZA 1T2XA 1JYTA 1PUEE 4OIRF 2W1SA 3ACHA 4Y7NJ 1OH4A 4E27A 2B9UA 2XVLA 3BPZA 4NRQA 2CY6A 4FPGA 4YGEA 2V6CA 3MKWB 4WZFA 1TT5B 5FJ8J 1CX4A 5H9RA 2HTSA 4MEYF 3RJRA 2IS6A 3MLLA 4PQ9A 2ORZA 1K6OA 2VNRA 2VOOA 4RGAA 2A3XA 4AEDA 3RKYA 1K78B 4YIRX 2HYFA 2X85A 3O8GA 4Q4X2 3C2GA 4HSRA 1RKWA 4Y33A 3MUY1 4LB5A 2RC4A 1ND3A 5F39A 4LIUA 2O6GE 2VASA 3ME2A 1Q3EA 1H1MA 2MABA 4EM1A 3DQVC 3M9AA 2VY0A 4CXWA 4GA9A 1D0XA 3LAGA 4IEVA 3ZYBA 1FNYA 4K8RB 3HC7A 1CZTA 5JXGA 4MIMA 5ERIA 3PL8A 3BG3A 3H9AA 4UUTA 4AD9A 5D21A 3OR2C 2WA4A 1AR83 1CR7A 3KETA 5DDJ1 1R092 2QQPA 4CCNA 2W48A 5CPRB 5FP4A 3LPFA 1IN4A 1L7LA 3FC0A 4PIZA 5A6XA 3PVNA 1AR71 4N9HA 4JHTA 2LY9A 1CN1A 4BOWA 1ZZCA 1E5IA 1EKEA 1QMJA 3M3CA 4YRVA 1KFUL 2ZS6B 1GWLA 1HQNA 1QJU2 4TTGA 2JG8C 3MAJA 4YARA 4LO5B 3BQZA 3VBRB 4BAYA 2YPRA 2I74A 3EUHC 4BMEA 1O59A 2WAQN 2R7ZJ 3FN9A 4I09A 3KCYA 4ES9A 4ZU4A 5IVFA 5HXVA 3MF9A 2G9WA 3M70A 1VBA3 4LKEA 1T38A 3BTZA 5JR3A 1JTXA 4HEA2 1GZ9A 4PLNA 4K6BA 3I2FA 5C5UA 1SVOA 2BBVA 3D82A 4ABZA 3A2KA 2LTPA 1PNGA 1ZR2A 3OYFA 1YJWI 3ZMDA 4P02B 2YV8A 4LBQB 3GTGJ 4PJNA 5JOWA 4EYUA 4PSXA 1Z7LA 1W06A 2FDHA 5EGOB 5JLVA 3N36A 5F5AA 2PFWA 2WT0A 1OJLA 3DL3A 3ES4A 6PAXA 1V9U3 4CEWB 2JG8A 4XTPA 1QXRA 3I2DA 4GH4C 4NWWA 5EEAA 5EF6A 2QDRA 3OYIA 4YW3A 1UNBA 1HV0A 4OIOF 3ZVXA 5EJ3A 2DMPA 3FHIB 3CZJA 2EXHA 4N53C 3WQ7A 2XGDA 2DUOA 4F83A 2A07F 2B4KA 1VQ8I 5A3OA 3K48A 2BBYA 2DVBA 3U1XA 2MC4A 3UGHA 4AE2A 1OKQA 2EA7A 1C0WA 3CJTB 1MEC1 5ILSA 1JHFA 2F6CA 2E5NA 4RGSA 3HOUJ 4RHV2 2O5RA 2Q1MA 3EUHA 3RJ2X 2ZXQA 3ABUA 5CKMA 5LBEA 4Q26A 3WR0A 3RSNA 5FKLA 3MI8A 1SMYF 2K4JA 2PLYA 1WMXA 2GN7A 3NV2A 2HOEA 2COBA 4MFDA 4CDUB 4XEZA 3FKIJ 5I0SA 1GNZA 4KICA 4QPIB 2DA5A 1LCLA 2FQ4A 1HKDA 3BTLA 4G3YC 1UAIA 4BE2A 2DT5A 3WTSC 3WHCA 3ST7A 5GTIC 2JRMA 5GAEJ 3PFIA 4OMDA 2DK5A 1IPKA 4XFHA 4QKFA 5IVEA 4QKBA 1TMF3 3GM8A 4G4FA 3VBOC 3HRTA 2DU0A 4O61A 3VBOA 3ETPA 3H5AA 3DXUA 2JDNA 3OGRA 4LKFA 1GFF2 2VECA 4X6AJ 4Z82A 3LSPA 4XZPA 4F55A 1PO22 3VZKA 1HLCA 3H35A 3F2ZA 2B63J 5EYRA 1RMU1 2ARXA 3I3LA 5C9AB 1NG0A 2QDNA 4OQ8A 4Q0PA 1Y0UA 3DECA 4M6YA 4QPGC 4IEOA 2UXXA 3O14A 2WV0A