2XL9A

Structure and metal-loading of a soluble periplasm cupro-protein: zn- cuca-closed (semet)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
235
structure length
231
Chain Sequence
EIHTFDDIPMPKLADPLLIYTPANEIFDIASCSAKDIGFAIAHAQIPPGGGPMPHIHYFINEWFWTPEGGIELFHSTKQYPNMDELPVVGGAGRGDLYSIQSEPKQLIYSPNHYMHGFVNPTDKTLPIVFVWMRNEVAPDFPYHDGGMREYFQAVGPRINLPELTNAQRAAFASEAPKYGINQSSYFMEYVNTISDKLPAQIAKLKNDKDLERMVEVIEAFNRGDKSVTCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords SLL1785 PROTEIN
publication title Structure and Metal Loading of a Soluble Periplasm Cuproprotein.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
total genus 48
structure length 231
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xl9A00
5FPZA 4OLLA 3E6CC 2XLGA 3E5XA 1L3JA 1NE6A 4Q0PA 4N9HA 4HN0A 3HT2A 4IEYA 4LUKA 4A2UA 1ZX5A 2WFPA 4N9IA 5I8YA 4HN1A 5J7MA 3EHKA 4AVBA 2GC3A 2CV6A 2PHDA 5CVRA 1GQGA 1LRHA 1I6XA 4WZCA 3FWEA 4HZFA 5FCCA 2O1QA 1OD5A 5CU1A 1DGRA 3CEWA 5FPXA 1H1MA 5KHHA 1O3QA 1I5ZA 3C3VA 5FQ0B 2IC1A 3H9AA 1YUDA 2XLFA 4YSFA 1NXMA 4BIFA 2GZWA 1UIKA 5EFUA 3H8UA 4QGMA 5KHGA 2XL9A 4MGYE 1SFNA 5JAXA 4J1WA 3FX3A 4AVCA 3WW4A 5BXXA 2KXLA 1YWKA 2C0ZA 1H1IA 3IWZA 3E6DA 1DZRA 1CAXA 5JSOA 5I8TA 4Z82A 4PJYA 3G7DA 4KWKA 4J1XA 4MZUA 5C6CA 1FT9A 1UW8A 3RYPA 1UD1A 2H6BA 2Y0OA 4BHPA 4JVAA 1Q3EA 2QDRA 1CAVB 2UY9A 2Q4SA 2WC2A 3CO2A 4ONUA 1OI6A 2H0VA 4LEJA 3OGJA 3WW3A 3KGLA 4XF0A 3E5QA 4FBFA 3L2HA 2QNKA 4Q0VA 1QWRA 2I45A 3H50A 2IXLA 3FHIB 5E1RA 3LA2A 4QGNA 2OZ6A 2VQAA 2PHLA 3FJSA 3UKVA 5BUVA 3I59B 4LTAA 3JZVA 1RGSA 1O3SA 4UXAA 1GQHA 1EP0A 5JR7B 4IEOA 4LUMA 4META 2BNNA 3KCCA 4YYOA 4PIZA 3CF6E 4X6QB 4IEZA 3DV8A 1UCXA 1X7NA 1ZNPA 1SQ4A 5LEKA 1NE4A 5BPXA 3WW1A 2OA2A 4E2GA 1DGWA 4L11A 3U11A 2DCTA 3D0JA 3SCHA 1RUNA 5FQ0A 3ETQA 3DL3A 1O3RA 4IEXA 1U12A 3PLQA 4AXOA 1YFUA 2QCSB 5C8WA 4IEWA 4XF1A 1NYWA 3RYRA 3IDCB 3UKNA 2GU9A 4UBGA 1YFXA 4QM9A 4QM8A 4PIYA 2CGPA 1ZRDA 5LRRA 5KHIA 3LZZA 1J58A 4KU8A 5I8SA 4BH9A 3CLPA 3SMHA 3EJKA 5KHKA 3H3ZA 2D5HA 4XFFA 1X8EA 3B02A 3BB6A 4HSLA 3H7JA 1DZTA 4KL1A 3CJXA 5J3UA 2IXIA 3OTFA 1CAVA 1ZZ9A 1ZRCA 2ZCWA 4LLOA 1HW5A 3TNQA 1J3QA 5JSRA 1QXRA 4MUVA 2O8QA 1CX4A 3BCWA 3U10A 4QGLA 5JCTA 4FT8A 3ES1A 4TLFA 2IXJA 3ACLA 4OFGA 2XKOA 3RPQA 3H7YA 2GC2A 4F7ZA 2PQQA 1RUOA 1ZZBA 1ZRRA 3S7IA 3IDBB 3RZZA 3U0ZA 3MZHA 2K9ZA 1O5LA 4MGZE 2ET1A 1G6NA 4D7TA 3MDPA 3LWCA 4AVAA 5I93A 4YARA 1PMIA 4KWLA 3RDIA 2B9UA 1RL3A 5KHJA 2PAMA 4HVRA 3E6BA 5HI0A 2Q0AA 2XLAA 4AQ6A 4JTOA 5FLHA 2PYTA 2IXHA 4EWAA 1X82A 2EA7A 4I01A 1Y9QA 2MNGA 3M70A 3RYKA 3LA7A 4Q0SA 4H7LA 2Z69A 5I91A 3TNPB 3HIFA 3GBFA 3LOIA 3CL1A 3E5UA 4WVZA 5JSPA 1SEFA 4O9EA 2VPVA 4LA3A 5FLIA 5LRSA 4IESA 2ET7A 1ZRFA 3E97A 4EROA 4IEUA 4XFIA 4QXKA 4I2OA 1TQ5A 4O9GA 3H3UA 1J59A 3PNAA 3R6SA 1XE8A 3O14A 2PA7A 2ATFA 3ROUA 2UYAA 4YRDA 4QX5A 2PAKA 1QY4A 4MGIE 4EV0A 2P17A 4BYYA 2OYZA 4HBNA 2BNOA 2PFWA 1X8MA 3NKTA 1CAXB 1VR3A 4EWEA 3KSCA 2BYVE 1CAWB 4IETA 5CADA 4Q29A 5K8SA 4EWDA 2QJVA 1EYBA 1UPIA 2BGCA 3EQEA 2N7GA 2Z2SB 4Q0UA 2UYBA 3H1WA 3DN7A 4XFGA 1O3TA 2XKPA 2F4PA 3FFQA 3OD0A 3SCGA 3NJZA 1Q43A 3D0SA 3ELNA 1FXZA 4ZU5A 1IPKA 3D82A 2E9QA 4XF3A 4E2SA 3GYDA 3NW4A 1YHFA 2GAUA 3NSTA 4HSJA 3FE5A 1LB2A 4MGKE 4XFAA 1Q5OA 2CAUA 3MYXA 4ZU7A 1ZZCA 2PAEA 3LAGA 4IEQA 2EAAA 4MH0E 3SCFA 1XRUA 1ZZ7A 3EBRA 4XFCA 3LA3A 4KWJA 4IEPA 4I0AA 1O5UA 3HQXA 4L2NA 3OF1A 4ZU4A 2IXKA 3BU7A 1V70A 2K0GA 4UBHA 1XE7A 5I0SA 1LKNA 1WGPA 1LR5A 1ZZ8A 3ZDSA 1J3PA 2MPFA 3BALA 3S0MA 5I0RA 4I0BA 4K8FA 2V09A 2B8MA 3I54A 4I3PA 4LULA 1O4TA 4IEVA 5KBFA 4JV4A 3MPBA 1Y3TA 1QXJA 4PIXA 2FQPA 3FZ3A 4LA2A 5T3NA 3VHRA 4I02A 1J1LA 4Q0QA 2OZJA 4HMZA 1JUHA 2FMYA 3I7DA 2HJIA 3I59A 4Z07A 4YNIA 2MHFA 4NVPA 2H6CA 4XF4A 1VJ2A 4WBBA 1EY2A 1CAUB 2ETEA 3BPZA 3UKTA 3RNSA 3M3IA 1WLTA 1VP6A 5FDBA 2BNMA 4RD7A 3SHRA 3H1MA 5E16A 5F1RA 3IBMA 1YLLA 2D5FA 4XFHA 2QVSB 5FLJA 1PM7A 3IIAA 1CAWA 3OCPA 2CAVA 1YFYA 5D1IA 2GC0A 4IERA 4DINB 2GH2A 3H1YA 3KGZA 2B5HA 3DKWA 2BEOA 3S7EA 1RTVA 1YFWA 4D7SA 5J48A 3WW2A 4B29A 4QMAA 3ST7A 5BV6A 4X6RB 3QOPA 2ZKLA 1FI2A 4HLTA 5BY5A 4XFBA 4XF9A 1ZVFA 1EPZA 4JTNA 4AQ2A 4GULA 4HVQA 4MV2A 5EZWA 2XHKA 1UIJA 4F8AA 4E2QA 1OFNA 5I0UA 4FAGA 1O7FA 4KU7A 5I0TA 3NVCA 4CYDA 2HKXA 2EVXA 1J3RA 3NL1A 4R8HA 3SXWA 4I09A 2UY8A 2IXCA 4MX3A 3N4MA 3EO6A 4XEZA 4HVOA 1CGPA 1ZREA 1IPJA 2XL7A 5AVPA 2Q1ZB 2D40A 2D93A 3HT1A 4ORFA 2GC1A 2OPKA 1NZCA 3QACA 1OMIA 4XETA 2VECA 1WA4A 3KMHA 2XGXA 4P9GA 3PVBB 3ES4A 4FAHA 1ZZ6A 2PTMA 3USSA 1CAUA 4R52A 2Q30A 1RC6A 5LEJA
chains in the Genus database with same CATH superfamily
5FPZA 1S0DA 1K3IA 2HWC3 2ZAAA 3GCWA 1W8FA 5K4LA 2XLGA 5FOJB 3FFZA 3KHBA 1L3JA 3KT7A 4LHKA 4Q0PA 4QT6A 4YG0A 2DUPA 2EIGA 4HN0A 3HT2A 3AM2A 5FFOC 3VL9A 4D3WA 2FDKA 4CP1A 3U78A 1VBA3 3VZLA 2PHFA 4RFRB 2WFPA 3VD3A 4N9IA 3AMQA 3RG0A 1F15A 3ZXLA 2WO2A 4HN1A 1KS5A 5J7MA 1R083 3G6JB 4AVBA 2ZGNA 2JWPA 3GCXA 1GP5A 1PO21 1HJGA 1OUXA 1GQGA 1AL0G 2WJSA 1JZ7A 3M1HA 1SFPA 2NPIA 5CNAA 4CDUC 3DUIA 5FZGA 1I6XA 1XB9A 4AR2A 1N1YA 3RZJA 2W68A 2QZ3A 2CGOA 2CSGA 2XONA 3IDEA 1WBLA 1W99A 1NY72 2ZXQA 5FZ8A 3IPVA 1DGRA 2HLEA 1GZWB 1H1MA 5KHHA 1O3QA 3C3VA 1AR72 4HKWA 4IQPA 5FQ0B 1E5SA 4GMP0 4B4QA 2VMCA 4IV3C 5A3TA 2X05A 5L9VA 5JZGB 4A42A 4QU1A 4A44A 4BIFA 3AMNA 5FK7A 1W9TA 3ZSJA 4RN5A 5IFTA 5EFUA 2IFRA 1QHDA 1OLME 3ZFFB 2VUDA 2BQPA 1T6BX 1S0GA 1LJ7A 4XJUA 5KHGA 1WBFA 5DZFA 4D6SA 1N1VA 1RVF2 1SFNA 3LPGA 1RIRA 4J1WA 4FPGA 2HWD2 2RM22 2P34A 1LOCA 2C5DA 2JB8A 3WP3A 4RR3B 5A7PA 2QQKA 1H1IA 4GXLA 3E6DA 3I2OA 2JDPA 1DHKB 2LM3A 1W2AX 1K5MB 1FMD1 3UYJA 4QPYA 1C8M1 5C6CA 3WDUA 2VTFA 3RYPA 5BNPB 4DRVA 4JZRA 1POV3 1ULCA 3ORJA 3QLQA 2YXSA 1OKQA 4PF1A 2WNUA 4W6WA 3B5LB 4NR1A 1TNRA 2GMPA 4LKDA 3TB0A 4DUVA 5BNPC 2VMDA 3CO2A 2JKBA 2CWMA 4ONUA 1N47A 4MVTA 3A0KA 3B9IA 3MEPA 3OGJA 4LLFA 3ZYBA 3KGLA 5C4WC 5I0DA 3A22A 3AYEA 5D8AA 2FDIA 4H2AA 4MXWA 4YPJA 1MR5A 1SPPA 1YQ6A 4DY5A 4YM3A 1OA4A 1PVC3 4N53B 5IK4A 1QJEA 5L9BA 2R49A 1GNYA 4HT1T 4LBJA 4M3CF 3TOJA 2FBEA 2BFUL 2P37A 4FPYA 4ZY9A 4NAMA 5JIUA 1NUKA 5CIRA 2F4LA 3NV4A 4FOVA 2RV9A 3AYCA 4Q1RA 4DEVA 1MZFA 5C71A 4IDZA 2PHLA 2HBTA 3UKVA 3JUUA 2XUEA 4M0NA 1RGSA 2R071 4AHZA 1WD4A 3JBG1 1GQHA 2ZHMA 1FV2A 2WKKA 1X50A 4IGPA 1AYM2 4IE0A 2VOTA 4IEOA 4LUMA 4MXVA 2Y60A 4META 4AEDA 1QJU2 2GH8A 4Z2WA 4D94A 4XJAA 3VHNA 5IVJA 2E26A 2VTXA 4M4PA 1HRI2 3RJRA 5JXJA 2YC4A 2ZKNA 2G19A 4IEZA 3WDTA 2VW1A 1U0AA 4LORA 1UCXA 3RZHA 1C57A 1H0BA 3RI9A 3SKJE 1VAKA 4CDWA 1ZNPA 5LEKA 4BZ4A 4PT6A 1NE4A 4KQ7A 2QBXA 3LQCA 3T2PA 4BU2A 5J37A 4YLZA 2YBPA 4FTEA 2VBPA 4YGDA 1CESA 1DGWA 4I30A 5LWBA 2VXRA 1TNFA 2DCTA 2ARXA 3D0JA 2X5IB 1RUNA 1QH6A 4GAZA 5A3OA 3DL3A 1W05A 5FY8A 5IYYA 3H8XA 2W9XA 1NLQA 5DAQA 1AXZA 1F35A 2WR9A 4XF1A 5IJRA 3RSJA 1FOD3 1HB1A 3FN9A 3HMYA 3GZUC 3LE0A 5CEHA 4JGYB 5F5AA 3WD5A 2VULA 3V0BA 3VBUB 5LY1A 4CDXA 4J6GA 4NPRA 4AI3A 5FP4A 4D7YA 3OBZA 4QM8A 1XNBA 2EAKA 2D43A 2VMFA 1J83A 5A70A 2JDYA 1CR7A 5C3PA 3OBRA 2BGPA 2PLV3 2HWB3 3CLPA 3Q8CA 3UGFA 1VBD3 3EJKA 1O6UA 5KC6A 4AEDC 4XFFA 1X8EA 4UFLA 3B02A 4COWA 1SLIA 4DXTA 1IGOA 1GUIA 4TLGA 5HV4A 2D7FA 5J3UA 5FYYA 4R9BA 1BMV2 1GV9A 3GJBA 2BOJA 3AFGA 3VKFC 5BNOB 1J3QA 1MS9A 1PM4A 5JSRA 2XQRA 3ACGA 2ARBA 2WA4A 1W6QB 4J25A 3VBFA 3U10A 2G1MA 1RUD1 4QGLA 5F39A 1Y9GA 4YZ1A 5JCTA 1VRH2 2WO7A 3POGA 4FPJA 3QBQA 1JYNA 3POSA 3VLBB 1BZWA 2WABA 4FT8A 3ZIWA 2VBBA 4TLFA 1XJAA 4OFGA 4PLMA 1LOBA 1MZ6A 4GA9A 4ATFA 3H7YA 1NCRB 4DS0A 1WUVA 2ZGLA 2GC2A 1MEC1 1TME2 2WZPP 2JG9B 2VZ3A 1QQP1 1W6NA 3IDBB 5E8AA 1AHSA 2JENA 1RUG2 4CDXC 3UT0A 1QDCA 2R042 3ZXAC 2ARCA 4MGZE 3O1VA 2RDRA 4W6YA 2DVGA 4FP2A 3U75A 4EN0A 1W0OA 2XMLA 3T08A 4YVSB 2B9UA 1RL3A 4PDWC 1MS4A 2XBO2 2JDUA 5SV8A 5KHJA 3VD7A 1REFA 1HB4A 4WM7B 3VDCA 3JB8A 1L7RA 2XLAA 4AQ6A 5C8CB 2Y6LA 3KT1A 4RS5B 2BPA2 3POEA 3PTRB 4WVMB 2PYTA 4XOGA 5DN2A 1Y9QA 4CU8A 3LEGA 1W8NA 3KM5A 3LA7A 3VL8A 3VBFC 4RS5C 2VU9A 4FPKA 4PQ9A 5FZOA 5FYCA 1UPSA 4LOTA 3RWKX 3SH5A 3AYAA 1IG0A 1UN1A 3AXDA 3CQOA 2KA3A 1SG3A 3CMGA 1PZ8A 3D5OA 3ZO0B 3HNBM 4IESA 1QOOA 1S2BA 1OH4A 5LBFA 3HQRA 3WNOA 3RZLA 4IEUA 1GQPA 2P2KA 4Q4Y1 3WF2A 4XFIA 3WF0A 3SEPA 2WZ8A 2GP3A 1JOBA 2RDNA 4M3CB 1OPOA 3U07A 3IM0A 4YZ3A 1DG6A 4AAXA 4O9GA 4I2OA 1GOFA 4E27A 3H3UA 4M0HA 5F7UA 1XE8A 3TWIA 2AEYA 1P8JA 4YRDA 3ZN6A 3ENRA 1W04A 3MIDA 4EV0A 1D4VB 2E7QA 4QDSA 2EIDA 1AL23 2JIGA 4Q27A 3RS6A 3VZOA 1JODA 1AR83 2VUAA 3A0NA 1T2XA 3IDAA 4QX8A 1W3VA 2ZHKA 5GLZA 5FYIA 4CA9A 1X8MA 4D69A 2VZPA 2RVAA 1BLZA 1BVVA 5FPAA 3ZYPA 3EMRA 1W06A 3UNPA 2Y33A 4EWDA 5F3CA 3PU3A 2VH9A 3AMHA 1PGL1 4G3YC 5FXVA 4EWAA 4LK7A 2N7GA 1RUI3 5FUPA 3LIHA 1C4RA 1GOGA 3GZTB 2XQXA 2Y34A 2BGOA 3TN93 2W95A 1RMU1 2KD7A 3IAQA 4QQPA 3PUQA 5LW9A 1S1AA 3SCGA 2A70A 1AX1A 2ZGOA 1O91A 3ALQA 1CJPA 3CIHA 3GBWA 1RUH2 4ZU5A 1O8SA 1BVP1 4AE2A 4CTEA 4FQ4A 5FYTA 2R061 3OGSA 4N43B 5FY1A 4Y1ZA 1G9BA 2DU0A 2EXJA 2SBAA 5F9TA 1ZBA1 4BK4A 4MGKE 2YMZA 1NA1A 1YYNA 4Q4V1 4XFAA 5KXBA 2CNAA 1UMZA 1AYN1 1D4M2 1R093 3AL6A 4COVA 5DG2A 4HK9A 3SH3A 3LAGA 3WQBA 4P9YA 4WM8C 1YQ2A 2WNVB 3O1SA 4IEQA 2BP6A 2FCVA 4YW5A 1OLRA 1Q8QA 4CZSA 3EBRA 2JICA 4BXSV 1XC6A 1AR63 4V2VA 3LA3A 4W8JA 5JIAA 4JKKA 3VKOA 3H3LA 4QKFA 4DXZA 1VIWB 3JCIA 1CIWA 3OF1A 3OUHA 3JQWA 4UBHA 1XE7A 5H9RA 3N36A 4RHV2 1TMF1 2DUQA 3DYMA 4GH4A 1LHUA 1ENRA 4JGZA 4AI1A 5HCAA 1QJFA 1W0NA 3B01A 5BNNB 4IEVA 2GN3A 1PO23 1Y3TA 3MPBA 4QKNA 1EAH1 2FQPA 3AZZA 4LA2A 4Y1YA 2X29A 1AJOA 3CJIB 2VQUA 5B4XA 2YV8A 4GKXA 1HXS1 1QJX2 1RHI1 2OZJA 2R1DA 3VBSC 4ZZ8A 2XJTA 4INDA 1LHOA 2R072 2FMYA 4L92A 2HJIA 5FZMA 5FYZA 4YNIA 2MHFA 1KDKA 2H6CA 2WUHA 1R64A 2BTVC 4XF4A 5F6KA 2JG8C 4AVSA 2G4IA 3OUJA 1KFUL 4ES9A 5FOBB 2K2SA 2YBSA 1T6GC 3LFIA 4Y5SA 1BBT1 5IW0A 3T0BA 4KI5M 3WLUA 5A3WA 3WG1A 3HWJA 3BU0A 4XZUG 1NA1C 3S57A 3ZYHA 3MIFA 3ZYJB 2W1QA 4LXLA 5FP3A 4XAEA 4YZ2A 3MV01 4CDQA 1CJDA 2QFEA 2P4EA 3SHRA 2VR4A 3H1MA 4EYUA 1E5IA 1UYZA 1N3OA 4MOAA 4NIIA 5F1RA 5FWEA 2D5FA 4XFHA 1SLCA 4LJHA 1PIV1 4XXAA 4BA6A 3IIAA 2JDZA 2VQTA 4NPLA 4CXWA 1SCSA 3I2JA 4PI2A 1FMD3 2GH2A 1DGLA 2B5HA 1C8M3 4BQYA 4FSJA 5FZKA 4C90A 1XYPA 1KRIA 3OG2A 1QGLA 4D7SA 5CFCC 4AFDA 4RQPB 4JGZC 3VDDB 4B29A 5BV6A 4S2HA 4XILA 3O5SA 3J7NA 1V6JA 3ZVXA 4LIUA 1FI2A 5T5PA 1NY71 1IHMA 4XAAA 4OZOA 5FZEA 5BY5A 4FTSA 4OHYA 3EYPA 3J7MA 1UU5A 2WSUA 4QKBA 2UU8A 1AR71 1XNAA 3DF0A 1QDOA 3OEBA 4XFBA 3WDWA 3JD71 1DYOA 3KV4A 1KXGA 1YJLA 4MGSA 1OC1A 3BOWA 1AX0A 4P9XA 2VNOA 4UAPA 1UYPA 4XE9A 1LOFC 2A73B 2B4KA 4AFAA 4PBOA 4AI0A 2RE9A 5GALA 5C70A 1V6NA 4P08A 1E5HA 1RVF1 1XYOA 5F32A 4XUPA 1OFNA 2NZ9A 2HWD1 5F2WA 1QF3A 4FAGA 3ZSEA 2CDPA 3AP7A 1O7FA 2W3JA 2I74A 1JI6A 1MACA 4QD2A 5I0TA 2CWSA 4CDQC 2WS93 4XHXA 3PJYA 2F17A 4LO6B 2VL4A 2VCCA 3JBG3 1H8TB 5A6QA 1S55A 2Q8CA 1SDDB 3RZGA 4I09A 4NUBA 2UY8A 4A7YA 1F8VA 2ENRA 4MX3A 4XUNA 4HVOA 5DXDA 2HH9A 3SH4A 1A34A 1HRV3 2Z42A 2CGNA 4PQQA 4QPWA 3ZKUA 4QQOA 3KLSA 4AW7A 3WCRA 1UOBA 1HV0A 1SLBA 1MQTC 3I2IA 2XVGA 5CBLA 4KBBA 2OKXA 2DU1A 3DXUA 5GJ6A 4Y1UA 4FVVA 4TWTA 4HPKA 4E8CA 1CD3G 3HT1A 3POIA 5H9PA 3N9LA 1ONAA 2OPKA 3RGBA 3BI3A 1H9WA 2P3YA 3IIIA 5FREA 1OMIA 4XETA 4Y22B 3WQ0A 4CCDA 3KMHA 3FUOA 2YFUA 1IQAA 2FDHA 4P9JA 1TE1B 2Y26A 5FMDA 2XJVA 2PHWA 3KQ4B 1ZZ6A 1CAUA 5F3EA 4LBQB 5DAXA 2Q30A 2YROA 2XPJA 2A75A 4OLLA 4CVUA 1TEIA 3ON7A 3GZEA 1D0HA 4AVVA 3WG2A 4FFFA 2PHRA 3PU8A 3ZFEB 3CBNA 4IL7A 1OUSA 5FUIA 1AYM1 2W5FA 5FZDA 1CVNA 2OT7A 4ZZ5A 1QJU1 2FCTA 1HB3A 3AJZA 4IEYA 4LUKA 1W2UA 2V5YA 1XYNA 1V6OA 1ZX5A 2Y6HA 3ZPOA 4CEWA 4TTGA 4HKOA 3ZYFA 5ABJB 1I1EA 1HRI1 2DURA 3EHKA 3P5BA 4NPMA 2GC3A 2CV6A 3ZFGA 1IOAA 5LA2A 1YIFA 4AGGA 1PX3A 1Z78A 1S0IA 3CNAA 1BEV3 4IXLA 4QXHA 5AFEA 4XUQA 3FWEA 4QHZA 1W8TA 2GDFA 4HZFA 5FCCA 1OD5A 5CU1A 1U5XA 1EV11 1V6LA 1WW4A 4Q4W2 4QWNA 3UJOA 4NIDA 1LESA 1DZQA 3CEWA 4F83A 5HXVA 5FPXA 4Y26A 2P3KA 3PMSA 5DAWA 5JI7A 2YY1A 1DDLA 5LB6A 3J8F2 3KD4A 4Z8BA 4EN7B 4B3NA 1YC61 1RUD3 1ZRIA 3MIHA 1UIKA 1H2NA 4L8QA 5F2SA 5DQ0A 2VOVA 3DPRA 4FPLA 4CU6A 3Q9OA 4CUGA 3M3EA 3FX3A 4XUTA 4AVCA 3VZKA 5LCWL 2XVKA 4BQ1A 4JKLA 1MEC3 4B7EA 5FZ1A 2KXLA 5BXXA 5LA9A 5K7PA 3APBA 1QQP3 2C0ZA 3IWZA 2OUHA 3K2OA 5DPNA 1CAXA 4FXKB 2XUMA 2D6NA 5I8TA 3IMMA 3LDKA 1PGL2 3NNFA 4Q26A 4Z82A 1B35B 4GALA 1OFSA 5FZBA 2EXHA 1FT9A 1GANA 2ZMKA 1CONA 2TUNA 4AGRA 4CUCA 1UXZA 2ZOEB 2D6PA 2Y0OA 3K3OA 4EQVA 4GZ9A 5FY7A 1ST8A 2GMEA 2A6XA 3DECA 3WNKA 2ORZA 3WP4A 1OQ1A 2UY9A 2YG0A 3MIEA 3LDRA 5JUVA 3ZFGC 1BMV1 3MF6A 4URTA 5LY2A 5A6ZA 1LU2A 1REEA 2WT0A 4LEJA 5FY9A 2WWJA 4XF0A 5AC92 2AGSA 4PHZA 3ACIA 3WY6A 3T1LA 1CN1A 4YW2A 2WSVA 2Y6KA 3E5QA 4FBFA 1NAEA 3MIGA 2B42B 5JMCA 3W21A 3ABZA 2VW0A 1IS3A 2QNKA 3AKRA 3KWVA 4W6XA 1VRH1 3WF3A 4Q0VA 3V0AA 1QWRA 5FBJA 3N7KA 3I4IA 3NAPB 2ARAA 3OPWA 2I45A 3WX5A 4XACA 3B94A 1URXA 1UY4A 2IXLA 5CFDB 2WRAA 3FHIB 3T1MA 4YFZA 1XPWA 4QGNA 3LCPA 4NWWA 1TME1 3M4FA 3T09A 1V6MA 2YYOA 3RZKA 2WFF2 2DCKA 1H2KA 1NZIA 2DV9A 4LTAA 3VBRB 3JZVA 4Q4Y3 3THTA 4CEYB 2ZEWA 1RUG1 5FRAA 4CP9B 1D2QA 3NKGA 4A41A 1Z7S2 5F37A 1VBE2 2RR12 3OPTA 4GMP1 3POJA 3LGRA 4PIZA 4YYOA 5C7GA 2Y6GA 2C4XA 2E33A 2RS53 1UY3A 5FKBA 4L97A 1BK0A 2XG3A 2R16A 4PBPA 2GP5A 4X6QB 4CDUA 3AZWA 1UL9A 4MLOA 4GD4A 4G4FA 1Y43B 3FUQA 1JZ2A 2WLQA 1OD3A 1O59A 2XBO1 5JXIA 3N7LA 3ZXJA 5BPXA 3W9AA 3IB3A 4P9WA 5IAVA 2MEV2 1STMA 1XSQA 4IV1B 1C5IA 1NLRA 2ORXA 4L11A 3U11A 5A1AA 1ND3B 3NQHA 4P9LA 4LBMA 4NJ4A 2V4VA 4JCKA 1GZWA 3D6EA 5FQ0A 4K1ZA 1TZOA 3ETQA 2XHNA 1BBT2 1ENQA 1O3RA 2D3SA 3BTYA 1ZBE1 4IEXA 5EJ3A 1QNWA 1U12A 5GKAC 3SEEA 3ZR5A 4AXOA 3C7OA 1OVSA 4HVQA 1RMU3 3WNLA 1E57A 3ZFFA 2W94A 4GB32 4JQRA 3IDCB 4PLOA 1K45A 3C7HA 2BVBA 2GU9A 2AH2A 2E51A 2AC1A 2DBNA 3QH7A 3ZR6A 4QM9A 2F6BA 1MS3A 2R063 3MFCA 1F2NA 2GSYA 1LEMA 1PIV2 1S0CA 3LZZA 4KU8A 4TXWA 5EJ1B 5I8SA 1H30A 3P6BA 5A1LA 5IK5A 2LS6A 3W5NA 5A32B 2QE3A 2D5HA 3H3ZA 1ZBA3 4E4SA 4YZ5A 4Q4V3 4NRMA 3BB6A 1AYN3 4BLJA 3BTAA 5GZCA 1DZTA 2CL2A 5BNPA 3CJXA 4NE9A 4V2WA 1ZYBA 4ARXA 3JU9A 4EE2A 3R05A 4WVWA 1RUF3 3GNEA 3HAGA 5C4WA 4QQ2A 2IZWA 3V56A 1ZRCA 1I9RA 2JD4A 4LLOA 4K1YA 1F4AA 2RDQA 4BM8A 5K0UB 5A6YA 3M7AA 1VLNA 1LNSA 1CX4A 3SISA 3JD72 4BQ2A 1KDMA 1TMF3 3CDZB 4UW6A 3C2UA 4JRAA 1W8WA 2D6LX 3MF9A 4EN9B 5E89A 5HXMA 1OBNA 1OF4A 1ALYA 4ZXKA 2RMU1 3ACLA 4QB1A 3SNMA 2XKOA 4ES8A 1VBC1 5GLWA 5JZGC 1EAH3 1RJ7A 5CG8A 3MV11 2PQQA 3D4KA 1H1AA 1RUH1 3NNMA 1UU4A 1HQLA 5FPLA 1ZZBA 1HXS3 1RHI3 3FLTA 3ZFFC 1ZRRA 5AVAA 3DXTA 2LROA 2J7MA 3AP5A 1S2EA 1COV2 4XJ9A 2K9ZA 1JHNA 5A7WA 3KCXA 1Q8VA 4RR3C 4Q8LA 5T50A 1QMJA 4XUOA 2BBAA 2X09A 4MO3M 2YZ4A 1D4M1 1JHJA 5FY5A 5F5QA 4ASMB 4JDMA 3MDPA 4AVAA 1RXFA 5I93A 1S0EA 1K5MC 4YGCA 1W90A 3MICA 4KWLA 3RDIA 3J7HA 3VV1A 4A7KA 4GIQA 4CXXA 2PAMA 4DEQA 2QDNA 3E6BA 2Q0AA 2YC0A 4CCOA 1YI9A 4HK8A 3IN9A 2G9FA 4JTOA 5FLHA 2BRTA 4KNCA 1DFQA 4Y1XA 3I3EA 3J9SA 4DPNA 1G86A 1W9YA 5CKQA 5L9RA 4RHV1 2DUOA 3AZYA 1GZCA 1PZ7A 2V4AA 4H7LA 3GZAA 3VD9A 4RFT0 3I2KA 4FOQA 4P9IA 1A6CA 1GICA 4AZZA 3HIFA 3GBFA 2VOWA 4ZS3A 5FIXA 4ZPIA 4N53C 3W59A 5JSPA 1SEFA 1POQA 3B00A 4O9EA 5LRSA 3I3DA 1UOJA 3O1RA 1JU4A 2ET7A 2HEYF 2W1WA 3E97A 3POFA 1QJX1 4QPGB 2VNRA 5CB7A 2QKDA 3GBGA 4JGYA 3VBUA 4NHLA 1WW5A 4EJRA 5CG9A 3WDVA 3TYJA 1U5IA 3PNAA 5JOZA 4NIGA 1MZEA 1VBD2 3O14A 1AR73 1MZ5A 3IAPA 2UYAA 2Y6FA 5A7SA 3ETPA 3HR9A 3OGVA 4LBOA 4BE3A 3NNJA 3THCA 2AEZA 5FAXA 3ATGA 1NCQB 1SBFA 4OI1A 2P17A 5DUUA 1QJZA 5DUXA 1RUE2 1RVF3 4BYYA 4HBNA 5FXXA 2HWD3 2BNOA 2QQNA 2RM23 1SFYA 2PFWA 3NKTA 4C91A 4DXRA 1UZYA 3KT4A 3T4HB 2Y38A 4M01A 1QIQA 1EV12 5CADA 4TZDA 5K8SA 2QJVA 5FXZA 3UL2A 4HONA 2VQ0A 3UETA 1VBB2 3WXPA 1GWLA 5BNOA 1WD3A 1MPXA 5KR7A 2OIIA 1W6QA 2WNUB 2A3WA 2UYBA 4Q0UA 3HPNA 4YGEA 5DG1A 1QJY1 4XFGA 5GZDA 1IQDC 2X5IC 1HV1A 1DIWA 4LITA 1RINA 3FFQA 3OD0A 4P02B 1YEWA 1W6PA 1Q43A 3D0SA 2PXJA 3I97A 1NCRA 3ELNA 1FXZA 1IS5A 1UX7A 5D8AB 4NHMA 5CKNA 1IPKA 1KJRA 1SPPB 2XJSA 2VCAA 4XF3A 4E2SA 3ZSMA 1CX1A 4QAWA 2B7YA 1YRZA 2PN5A 3NW4A 2DFCA 4IE6A 1YQ5A 3NO8A 4JGYC 3NSTA 1Q8PA 5JVVA 3VBUC 4HSJA 1OOPB 1Q5OA 2XXZA 5SV5A 1DCSA 3CKHA 1JXNA 3MYXA 3IZOA 4PDWA 1WW6A 5IK8A 2VW2A 1HQWA 2BVVA 4Y20B 3VN4A 4EZHA 2O8OA 4XQ4A 4IEPA 4OCTA 3GHMA 2ADEA 4NWVA 1LOGA 4ZONA 1W8UA 3TRSB 4L2NA 4WM7A 3AJYA 3NV3A 2IXKA 4QQHA 3HVDA 1JU3A 3BU7A 1V70A 3B9CA 1AYM3 1LOAA 4RS5A 3K46A 4WVMA 2BU9A 1QJU3 1WGPA 4AFBA 1QH7A 1ZZ8A 3ZDSA 3BALA 3IMNA 1WKYA 1WZXA 3AZVA 3WF4A 4AHYA 1MS8A 4I0BA 1W8HA 1R1A2 1HRI3 5BNOC 5FMOL 1FNZA 4CDWB 4S2DA 4JV4A 5KBFA 2ZGSA 1HQNA 4Q1PA 1QXJA 1D7PM 4PIXA 3WNMA 3BKZA 4I02A 5JI9A 1RUJ3 2VZRA 1WMFA 4SLIA 1SCRA 4C0BA 2X53S 3VUOA 1NCRC 3I59A 4M3CA 5FPUA 1S4CA 2VTXJ 5H9SA 2JG9C 1VJ2A 3CHXA 4GWNA 3I3MA 4WBBA 3OY8A 2B45X 3K4AA 4BB3A 5JR2A 1ASJ2 1U5ZA 4GJZA 3JQXA 2ERFA 4LOSA 1G7YA 2FD8A 1SBEA 2A7AA 2ZS6B 1AR82 1KJLA 3R4SA 5IUQA 1VB2A 5EXOA 5LZ6A 3DKQA 3ZMOA 1WLTA 1ODMA 1OHFA 1W9SA 5DAPA 4CUAA 3ILRA 1APNA 3P3NA 2ZZJA 1OXCA 5E16A 5HV0A 4NOTA 3IBMA 4D6QA 4RSUA 5J98B 4A6OA 1XE0A 1PM7A 2E7TA 4YVSC 3O0WA 5ERLA 2RS12 4AI8A 4E8DA 3AFKA 1NT0A 3OCPA 1NKGA 3RI8A 3OYWB 4WM7C 2GC0A 4IERA 5C8CC 1ULGA 3H1YA 4XYXA 1OVPA 2R6QA 1W8ZA 3DKWA 4OI0A 3VGIA 2BEOA 1DP0A 3S7EA 3ZMNA 1ZBE2 1GSLA 2P6CA 1W39A 4EN6B 5J48A 1PK6B 4NIHA 4QMAA 3ST7A 3LIGA 4Q4X2 4X6RB 4UW5A 3S5QA 2IFWA 1ULPA 4MHRA 4EZ4A 4M00A 4K20A 3AB0A 4HLTA 4Q4W1 2W46A 5LA1A 4AHXA 2J22A 4AI9A 2OVUA 5FWJA 2Q1FA 2W1UA 4N43A 3J8F1 2YDEA 1EPZA 4C0HA 4WM8A 4RYDA 4OHXA 1VRH3 2VZ1A 1M06G 4MV2A 4P00B 4R9AA 2JE9A 3AX4A 3O1MA 3T3YA 2WNVA 5T52A 1W6NB 1TME3 1A8DA 3TEWA 2BWCA 3MIBA 4N90A 2HKXA 3KQRA 2WINB 4CYDA 1RB8G 3KV9A 1J3RA 3ZXFA 4BQXA 3NL1A 4H55A 1RUG3 4YW7A 2R043 2YFZA 5FZHA 5L7OB 5F6LB 1DF0A 4GMP3 2VVFA 3U14A 2TEPA 2IXCA 4AK3A 2WZR1 1Y7BA 3EO6A 3MPPG 1UQXA 2RMU2 2PHUA 3ME2A 5M0TA 4LKEA 1V00A 4AFMA 5C5UA 3VBSA 5GZEA 1W8OA 1VBC2 2WN3A 1XU2A 2XBO3 2XL7A 1N3QA 3VBOB 3ITQA 1KS4A 2DBIA 3CJIA 3RJ2X 4B4PA 1DYKA 1V9U1 1WLCA 4BK5A 1XNKA 2KR2A 3AP4A 3N3HA 5FYSA 2D40A 2DYCA 5DUWA 5AC91 1YCIA 2JG8A 1L7QA 2YU2A 3MW2A 4CU7A 1NQJA 3N35A 1NZCA 3PUSA 2GMMA 3LSDA 3MGUA 4OVEA 5LBCA 2LUWA 5BYNA 4N43C 4P9GA 3MW4A 2I2SA 3ES4A 4FAHA 5LA0A 2QQVA 1GKBA 4W50A 4Y24A 4YVWB 4Z92B 1UAIA 2WQ8A 3KZ4C 3R4UA 3USSA 4IE4A 3ZIXA 1RC6A 3U4XA 3Q8FA 2HWC1 4JX0A 2JE7A 5F3GA 2WFF1 2QTWB 1OLQA 3SQOA 4BLIA 3E5XA 3AKSA 2WNVC 3FL7A 1NE6A 5FY0A 3O0VA 4N9HA 1UX6A 1W6OA 3BIWE 5IHRA 1WCKA 5FZ3A 1Z7S1 3ZN6B 3S5AA 4A2UA 1VBE1 2RR11 3WUCA 3WHTA 1R081 3ZXKA 5I8YA 4UFJA 3ZM8A 5CFCA 1TVGA 4CCCA 3VBHB 3FBYA 2PHDA 5KXEA 3WG4A 2NYYA 5FV3A 2UWCA 2ZJCA 4HL0A 4OZXA 5L36A 3L2YA 3POYA 2ZEZA 4WZCA 3VHOA 3ZPYA 3VDDA 2BERA 2VNGA 5FYHA 5BNNC 4UFKA 5KC5A 3MI8A 2MEV1 4UWDA 4XCBA 4R9DA 2J42A 2V73A 3CJIC 4K7JA 3LD8A 4KBZA 1G9CA 2IC1A 5JPMB 2OQ6A 1UF2C 3H9AA 3HQUA 2OXBA 3O12A 1LOFA 3MUZ1 4JHZA 1JOPA 1NXMA 2A1XA 4OUMA 2D6MA 4HOOA 5FO7B 5J96B 2QQMA 2GZWA 4RL7A 4YGBA 1ND2B 2GNTA 4QGMA 2WAOA 3P3PA 5FMBA 3T4VA 2ZZQA 4MGYE 5JAXA 2OPWA 1TG7A 5C9AB 4GB31 4GH4B 3WW4A 2L9LA 3AXEA 3OGRA 4DRRA 5FPVA 3BTXA 1YWKA 1RUH3 4N7UA 1JUIA 3VKLA 3IT8A 3MLLA 3N9PA 4AQ2A 2O0OA 4RGAA 5GLUA 4PJYA 3DEMA 3G7DA 3SLIA 1H8TA 3WSOA 4J1XA 4MSVA 4YFWA 4UF0A 1UW8A 1Z0HA 2HEVF 2XH6A 2LW8A 3FMGA 2WWSA 3OJBA 1UOGA 1HRV2 1QJY2 2WZEA 1D4M3 2H6BA 1MQTA 5F5CA 4BOWA 2ZGQA 2WYSA 4HETA 2EXIA 4JVAA 1LTEA 4AG4A 2QDRA 1CAVB 1AF9A 5C3RA 1IKQA 1ODNA 2DVAA 3AZXA 4DMIA 2RS32 3WZ1A 2VZVA 1WCDJ 4MYEA 3BODA 2H0VA 2HYKA 1JN2P 2E53A 2K46A 4RQPC 4UOJA 2DVDA 3VDDC 1KITA 2XR4A 2G9GA 3L2HA 1S2KA 1US2A 4CPBD 4RHV3 1OQEA 2VNVA 4QHBA 3WCSA 3INAA 2Q8EA 1J1TA 5JDBA 1HDKA 1GZ9A 3VZMA 1NG0A 3H50A 1JZ3A 5IVEA 4XVHA 4ET7A 3ZXGA 1N3PA 3USUB 2ZA9A 2OZ6A 1XBFA 1AR92 3OBTA 4LBQA 4M3CE 1R1ZA 5EJZB 3WINE 4ZS2A 4CUBA 1PO12 1QJX3 2AREA 4FPFA 5BUVA 5EP9A 5G04L 1XNTA 1BCXA 2DCJA 4P14A 4UXAA 2VM9A 4OHZA 1EP0A 2R073 1COV1 5FZ0A 1B09A 2BNNA 5A3NA 4LPLA 4CP2A 4MG2A 2ZX2A 1RUC2 1OA3A 3CF6E 4FFHA 1W3XA 2HWF2 3W20A 2X10A 2ZGRA 1H8TC 5ABJA 2ZBJA 3WNXA 1U5YA 3H8OA 1BK1A 2JDNA 1X7NA 3RMYA 3HN1A 3N9OA 5FO8B 3UGHA 1DBNA 4LMFA 4COZA 1SQ4A 3E1F1 2W91A 4LR4A 1UO9A 3T0DA 2OA2A 1V6KA 4E2GA 1JMUB 3HNYM 4YWAA 1EUTA 2A6YA 1O4ZA 2BOIA 3LEMA 3WP6A 5LK5A 1EPWA 1POV0 2R0FA 5B2GB 5FZCA 4QX7A 1VAVA 1ZM1A 2J1TA 3ZLIA 1YFUA 2GNMA 4IEWA 2YPDA 4JKMA 2NN8A 4BJ0A 1ENSA 4LKFA 5A7NA 1YI7A 5JMOA 2DTWA 1DLLA 1YFXA 2PHTA 2YUEA 3OB8A 1ZA7A 3PVNA 4B1MA 4PIYA 1VALA 2WWUA 4UFHA 4DUWA 2RJKA 5FMOS 5KHIA 3BVCA 2ZGMA 1VBD1 2ADDA 4RA0A 3BGAA 4Z2AA 1RJ8A 3SMHA 5KHKA 3ZFEC 4FPOB 3OBAA 1B35A 3TEZA 3VDAA 4OHVA 1H6YA 4PF5A 4KGGA 5ANNA 2C1FA 2HWE2 4KL1A 5GM0A 2R32A 5DAVA 4LHSA 2DVBA 4IE5A 2DCYA 1RUE1 2R1BA 2UURA 4C8DA 5ABJC 5C3QA 5J09A 1ZZ9A 2W0XA 1HW5A 3TNQA 4GWIA 2E6VA 3B3QE 2A6VA 2WT2A 4XTPA 1F5FA 3PUIA 2O8QA 1UY2A 3MO4A 5ACA2 1VBB1 1AVBA 1SZBA 3BCWA 1FPN2 1ZA4A 1GNZA 4CPBA 2QQPA 1KGYA 4JDNA 3THDA 2VUCA 4DQAA 5DDJ2 3PUHA 1X9TA 3KVBA 2AR6A 3ES1A 4XBNA 1QKQA 3NAPA 1W6MB 5DMYA 3KB5A 4Q8KA 5CFDA 2WNEA 5A33A 2BUKA 1N1SA 1RUOA 3RMXA 3MFAA 4QQLA 2AACA 3TAYA 5JOXA 4BXFA 3KF5A 5EQUA 3OOXA 2W47A 3TEXA 2CDOA 4FQZA 4XJWA 4AQTA 5FZAA 5GZFA 1YO8A 4OYUA 3H42B 3O0XA 3TBDA 1UY1A 1WA6X 1W2NA 4CEYA 1ULFA 4CP9A 1O5LA 1CZVA 1HX6A 1OQDA 2ET1A 4DY3A 4A3ZA 3OPZA 1KQRA 4B8EA 5IVVA 2WZR2 1G6NA 2ES3A 3LWCA 1JYCA 2P3JA 4KG8A 5DUVA 3VKMA 4YARA 1PMIA 4AFCA 1B35C 1LECA 1Y9MA 2NM1A 1WCSA 2C24A 5EPAA 3RVHA 5FZ4A 4XXPA 4HVRA 1A8MA 2D44A 3WUDA 4IE7A 4CCJA 3OD4A 5FP8A 5TSWA 1V9U2 4KWUA 5FYBA 5IT6A 3V65A 2JIJA 2P5BA 3M2MA 3VB9A 2BDRA 3AC0A 3M3OA 2WL1A 4IV1A 5HCFA 2MNGA 1X33A 3M70A 3MW3A 2R30A 3FHAA 1HN1A 1JYIA 4NAOA 1R1A1 3BOPA 3I2GA 5I91A 5A7OA 3N7JA 3LOIA 1LHVA 4D0QA 3AMPA 4QPIB 3C7GA 4DXSA 4WVZA 1WCUA 2AZ5A 2WQZC 2HWC2 1GMMA 2VPVA 4LA3A 4OI4A 5IVBA 4R4XA 4AWDA 3NAPC 3C7EA 1ZRFA 1NOVA 3PTYA 3NMBA 4OUEA 5BNQA 4COYA 4DFSA 4KMQA 5CFDC 1HB2A 3OEAA 4PI0A 4OQ8A 2DFBA 4NHYA 1YQCA 1SLTA 2PELA 4FI9A 4Q4W3 1J59A 2CTVA 1VBA2 4NRQA 1MS1A 1FAYA 3RWNA 2GN7A 2ZGUA 3ROUA 3OGGA 4GKYA 1F9KA 2W2IA 3J8F3 1R082 3PURA 3VBRC 2JEMA 1ASJ1 1S0FA 3DPRB 1YXWA 3NV2A 2PAKA 1QY4A 2B39A 2XB6C 4CEYC 4MGIE 5A32A 5JXGA 4XQWA 2Y0IA 3K77A 1IZ3A 1AR81 5J36A 1H4HA 2Y8KA 2OYZA 2J1VA 3ZN4A 3K4DA 5LK7B 1UKGA 3FLRA 1CAXB 4EWEA 1JZ8A 1LB2A 1CAWB 3X29B 4P5HA 4Q29A 1WMDA 1HLCA 4RGGA 2RS11 4URAA 1X9PA 1GP4A 2LALA 1WLWA 2ZEYA 5FZ6A 1EYBA 1UPIA 5A80A 1GR3A 1LOEA 3EQEA 4XDPA 3ZX7A 5J1XA 2Z2SB 1UKRA 4IV1C 2WO1A 5JZGA 1ND3C 4ISRA 3ZKYA 1O3TA 1PGW2 4E4ZA 2XKPA 4LE4A 2F4PA 1QEXA 2O14A 4FP3A 4Q4X1 2A5ZA 5DABA 4IW3A 3IKWA 2QQJA 4Y5Z0 2VC9A 3PMEA 5CA6A 2Q1MA 2HYXA 5FP9A 1ULOA 4RR3A 5H9QA 2EICA 4BPZA 5AC93 2ZX3A 1AJKA 3AYDA 2YBKA 4Y33A 4XJ8A 2RDSA 3FE5A 3WP5A 2A3YA 3VZJA 1K5MA 1WMEA 2CAUA 1SHWB 2I07B 4ZU7A 1H6XA 1DQ0A 4A6SA 1ZZCA 5EYXA 2EAAA 4QX3A 5CKMA 1D2SA 1AR61 3SCFA 1XRUA 5JOWA 3RFRA 4KWJA 4QXBA 1H2LA 2WFF3 4I0AA 4XIOA 3PUAA 1O5UA 4NHXA 3HQXA 3R4DB 3MUY1 1W28A 4XBLA 4UFIA 4ZU4A 4NO4A 4CCNA 3CZUA 1JYXA 2K0GA 1PVC2 5I0SA 1GU3A 1HIXA 1UMHA 1Z7S3 2J1SA 2NQYA 2ZABA 1VBE3 2RR13 2VZSA 4B1LA 1J3PA 2MPFA 4CDUB 2VMGA 4N53A 3S0MA 3M3QA 5K0UC 2WA3A 4K8FA 4UW3A 5JLVA 3NV1A 2B8MA 3I54A 2NMOA 2W92A 4I3PA 3WG3A 2IUWA 2XWBB 4NROA 1GLHA 5T3NA 3VHRA 3W58A 2D6KA 1J1LA 2DVFA 2ZHLA 3NNLA 1MS0A 4IV3B 4HMZA 4QPGA 2RG4A 4ITCA 1L7LA 5FUNA 4Z1VA 2MEV3 3KF3A 1JZ5A 5T5OA 3ECQA 1C3HA 3UV9A 1SBDA 5L19A 1EY2A 4K6BA 5FK8A 1CZSA 2ETEA 3HBZA 1BBT3 1DGWX 1OPMA 2EALA 3OUIA 3ZXEA 2FDFA 1VPHA 5F5IA 2J1AA 3AVRA 5B4NA 4HG6B 3P1IA 4QX2A 3RNSA 1NCQA 2QUOA 3QCWA 5FDBA 4GB33 2BNMA 5JWPA 1SLAA 3WDXA 3MLKA 1XSRA 1YLLA 1FV3A 3M8LA 2QVSB 4LO5B 3A21A 1YNAA 3POWA 4B7KA 1PIV3 1JOJA 3NWKA 4V1PA 4OHWA 3H0OA 5D1IA 5C3SA 2VVDA 4DINB 2X5IA 1F4HA 3KGZA 5FR3A 5F3IA 4A3XA 2ZMLA 1K5JA 2WN2A 3EXUA 1CPMA 3J4UH 2OUJA 2VOXA 3LFMA 1YFWA 1VMJA 2BZDA 5C4WB 3WW2A 1FOD2 2A6ZA 3J7LA 4O65A 3W5MA 3HEIA 2WBKA 1NQDA 3Q8AA 3IPVB 4LK6A 3QH6A 4XDOA 2ZKLA 4YW3A 2W08A 4Y4RA 5FO9B 5AFBA 4AVTA 5KXCA 5FYUA 3ZXDA 1BYHA 1UWWA 4LT5A 2PLV2 1LULA 2HWB2 3LSEA 4QPGC 1GBGA 3K51A 1Y4WA 4XF9A 4XTMA 4YM1A 1H9PA 1ZVFA 4E4DX 5APAA 2BV4A 4NRPA 3B69A 3JD73 4HFSA 3NRUA 4GULA 1C1LA 1UZWA 4C1XA 1OOPA 4LBKA 1O8PA 4DUXA 1CPNA 1UIJA 4E2QA 2UWAA 4Y20A 1BHGA 5LASA 4KU7A 1K12A 2RJ2A 2WS91 2Z5WA 4F3JA 3ZYGA 1NCQC 1W0PA 3NVCA 4MHUA 4EN8B 5A7WB 2NP0A 4AGVA 1IS4A 2UWBA 4XMIA 3R0RA 3VKNA 4BQ5A 1PMJX 1COV3 3BYWA 1XNDA 2C9AA 4FPEA 3F95A 3SXWA 2ZACA 4BDVB 3D3AA 2DF7A 5IFPA 4GWJA 1HRV1 3AKPA 4XEZA 2E7AA 3GDBA 4XHBA 4COUA 4GWMA 4HKLA 5JOYA 3N4MA 4CCKA 4FFIA 1ZREA 1S0BA 4JDOA 2D98A 1PGSA 1KD7A 2WNUC 2QQIA 2RS31 1IPJA 2VXJA 4QB2A 4XPVA 1LGCA 3GALA 1RUJ2 4QX1A 2OX0A 3ZSKA 4CP0A 5FKCA 1YQ8A 1DYPA 5FYMA 4MXWB 5D21A 2JG9A 1K42A 2D93A 1FATA 5HPOA 4Q5OA 1DQ6A 4XW3A 3KCYA 4QKDA 1JTZX 4AEKA 3QACA 5D8AC 1WA4A 2GNDA 1PHMA 3A23A 1LGBA 2XGXA 3CZJA 2D6OX 1W03A 3DYOA 3K4ZA 3PVBB 5FTTC 1UXXX 3A7QA 1RYYA 3OSDA 1UY0A 5ISLA 2D3PA 5LEJA 1OOPC 2R7EB 1US3A 1AR91 1UU6A 3WHUA 3ZN5A 3E6CC 4YVSA 1CZTA 1PO11 4Y1VA 4FOWA 4AEDB 4DOUA 1I3HA 2QQOA 5A7QA 4ARYA 5C8CA 4CCLA 1O4YA 2VOKA 4OMDA 4YW4A 4ISQA 2JXAA 3BPSA 1M4WA 1RUC1 2VMIA 5FZFA 1RITA 3OYWA 3FLPA 1C28A 1GFF2 2HWF1 5FXWA 4AYUA 2XJPA 4KH9A 5CVRA 1H8VA 1WLDA 5T55A 5HBAA 1OURA 3AKTA 1BEV1 1OF3A 1LRHA 4RGKA 1IG3A 5FJHA 5GLTA 1PK6A 5HCBA 1RUE3 2VVEA 3JXSA 2WIIB 5HCHA 1V6IA 1WCQA 2O1QA 4QDQA 4CDWC 1SACA 1EV13 5IVCA 1F5JA 4BCUA 1I5ZA 2HEWF 1A78A 2WLPA 4A45A 1WW7A 3LOBA 5T5JA 1VBB3 1YUDA 1UOFA 2XLFA 3AP6A 3HBKA 4YSFA 4XABA 4E9KA 1AUYA 4SBVA 2VBDA 5IVYA 1AL22 1IPSA 1W9FA 3H8UA 5KXDA 1W6PB 5FBZA 2VZQA 2XL9A 3LDBA 4MGQA 3V0BB 4FO9A 5EIYB 5CISA 4CDXB 4LHLA 3C7FA 4MGTA 1FNYA 4E4HA 2ZTNA 5L73A 2W1SA 1W9WA 1DZRA 4UI9L 4K9SA 5JSOA 3I2HA 4S2FA 1UYYA 3FC0A 5IATA 1RUI2 2LTNA 1CIYA 3NNGA 4KWKA 4MZUA 2D3RA 4PDWB 4TYSA 2CHHA 5FMCA 5L7OA 4JQTA 2XJUA 5FZIA 3TN92 1UD1A 4BHPA 2HWE1 1Q3EA 2EXKA 3GHNA 4X8NA 4YM0A 1DU3D 2PQSA 1JYVA 2XJRA 2Q4SA 2WC2A 1H2MA 3B93A 4LBLA 2JD9A 2NLRA 1OI6A 5CZKA 5G05L 3VBFB 3GF6A 1PK6C 3HOBA 4LNVA 4XQDA 1PNGA 3VBOA 3WW3A 4AAPA 4FTBA 4U2AA 4UYBA 4UW4A 4OULA 3RRDA 3THPA 5ACA1 4A7ZA 1FPN1 3VDBA 4ZXEA 2VJXA 1R092 2V5DA 2AENA 2YGMA 5DDJ1 4DB5A 5EWSA 5IWFA 3N9NA 2XVLA 3LF7A 1R1A3 3FBMA 1DLCA 2YGLA 3POBA 5E1RA 3LA2A 5A3PA 2ZMNA 2G9ZA 3K3NA 4YG3A 4YVWA 1AR62 2XOMA 2VQAA 4FOYA 4D8MA 4QX0A 3FJSA 3GJAA 2Q8OA 1MVQA 4L0PA 1OKOA 2ZGPA 1A3KA 2VG9A 3I59B 1BKZA 1O3SA 3KVAA 2V72A 5C3OA 5JR7B 3UJQA 3OY8B 3KCCA 2EF6A 2Q5TA 3LPFA 4AEMA 2WQ4A 1QNYA 2RS51 2RJLA 1ASJ3 5FYVA 2AYHA 1C8NA 2H0BA 1PO22 1WMXA 3DV8A 1C1FA 2EIBA 3HNMA 5L7OC 3VBHA 2P1BA 5BNNA 2WDBA 3WOGA 3WV6A 3I2DA 4FPCA 3PVOA 2R0HA 3I8TA 3AVSA 2IWGB 3WW1A 2OW4A 1BXHA 3HN3A 1CWPA 4CSWA 1SLLA 1G9FA 2OS2A 2X8KA 2VGDA 4KGQA 4TSVA 3ZYIB 3SCHA 2RS13 3NJVA 3VBOC 2W39A 1MVEA 3U37A 5FZOB 2PHXA 2HBUA 4G9SB 1Q56A 4AEJA 1D0GA 2VUJA 3J26N 3PVEA 3PLQA 2VMHA 5C8WA 2QCSB 4CCMA 1ZBE3 5FY4A 2DDUA 3V64A 2VAUA 1QOTA 1NYWA 3BIEA 1ND2A 4CE8A 2JX9A 2ZGKA 4I0WB 3RYRA 3B7MA 4IGOA 4Q4X3 4LBQD 4NHKA 3L9JT 4S2GA 5T54A 3UKNA 4UBGA 5C9AA 1GOHA 2DCZA 4YVWC 2XJQA 4A4AA 1QOSA 2FHRA 2IVIB 4XDQA 2CGPA 1ZRDA 5LRRA 1YJKA 1VBA1 4WM8B 1J58A 1FMD2 1MS5A 3ASIA 1VMHA 4BH9A 2BW8A 1C8M2 1KEXA 2C9KA 4IUGA 2CYFA 2YPJA 4BIOA 2Q8DA 5DZEA 2LRPA 4WZFA 2B9VA 4HSLA 4CU9A 3H7JA 2GNBA 1LENA 4HANA 1JZ6A 1GWKA 5EHDA 1RUF1 2IXIA 3OTFA 1VB4A 3I3QA 5GZGA 1CAVA 4RQPA 3WNPA 1FX5A 1GWMA 3VBHC 1ENXA 2ZCWA 4TN7A 2J1EA 3S6PA 4K40A 5D2AA 5GLVA 1QXRA 3MHZA 4MUVA 3ILNA 1Q8OA 2QZ2A 2ZAHA 3WQ1A 4LKSA 1PZ9A 4CCEA 5FPBA 3AK0A 4MADA 3DGTA 4K8RB 2C6SA 2IXJA 2JB4A 3VBSB 3WDYA 1ACCA 2JKXA 3H8RA 1PGW1 3RPQA 2XWJB 2RMU3 3N9QA 1XNCA 4F7ZA 1VBC3 2YHJA 3K75B 1KFXL 4BMEA 3USUA 2QQLA 3MLJA 4K3UA 2JG8B 1ND2C 2OQ7A 2WS92 2YU1A 1OA2A 4C1WA 3S7IA 3RZZA 3SC7X 3U0ZA 3JBG2 2ZHNA 5T5LA 2Z79A 1NXD1 5C9AC 3MZHA 1NA1B 4JHTA 4KG0A 1UZ0A 2VZOA 2VCBA 1POV1 3O1OA 2W52A 2VCMA 5F8PA 4D7TA 1LU1A 3WNNA 3HJRA 3DYPA 4UT5A 1ULEA 4LO8A 4UFMA 2A6WA 2DTYA 2FZ1A 3RQ0A 1JH5A 1DQ4A 1V0AA 1WWYA 3LKJA 1PX4A 5HI0A 1W6OB 1JBCA 4N7IA 3VD4A 4PCRA 1LAJA 4XURA 2JDAA 2BFUS 1OSGA 2YC2A 3BTZA 3KS7A 3PDQA 2IXHA 1BQPA 1PVC1 3T2TA 2TNFA 3GGLA 1X82A 1GP6A 1XOYA 2EA7A 3GM8A 1JS9A 2WYFA 1S0JA 4I01A 4JGZB 5CFCB 1JZ4A 3RYKA 4AF9A 1ULDA 4Q0SA 1AZDA 2Z69A 4Y22A 3TNPB 1IS6A 4GH4C 3CL1A 3E5UA 2VY0A 4FFGA 2E32A 1SMVA 4AOCA 1AX2A 1QXPA 5FLIA 2ZEXA 4OMCA 4LQRA 4JC1A 3AP9A 3CU7A 4XJZA 5FZLA 1E5RA 5LBBA 4B4RA 4EROA 3JB4C 3WR0A 4QXKA 1N1TA 1AXYA 1TQ5A 2JDHA 1HKDA 2XDVA 3ZFEA 2P6HA 3R6SA 4YZ4A 4OUSA 2CU5A 2PA7A 1UZZA 2ATFA 2ZGTA 4BMBA 4CXYA 4FCAA 1VMFA 1DQ2A 3PHMA 4QX5A 5E88A 4DIQA 3FHQA 4LO4B 1YIPA 3UK9A 1XQNA 4Y5TA 4CDQB 3ACHA 4YG6A 1DGRN 1BEV2 3GXUA 1CQ9A 2RM21 3S30A 2VMEA 4ATEA 4AQSA 5KWRA 2GALA 1VR3A 4LIVA 2Y6JA 3KSCA 2FDGA 2BYVE 4IETA 2NMNA 4AHWA 3O7OA 1I5PA 3ZDVA 3O1PA 1UYXA 4UF0B 1HJFA 1DQ5A 5JPNB 2BGCA 2C26A 1RUD2 3AMMA 1MQTB 5C33A 2WT1A 2JDKA 3SKVA 3PIJA 2SLIA 1LEDA 5FZ7A 5IVFA 1Q8SA 3H1WA 1OT5A 3DN7A 1QJY3 4Y4YA 4YW1A 1FOD1 3URFA 3NJZA 3UGGA 1MEC2 1W6MA 2VE1A 2RS33 1QQP2 4XMAA 1OLMA 2A3XA 2B46X 2WAAA 1LCLA 4H7MA 4AI2A 3D82A 2E9QA 5IAXA 4BISA 3GYDA 2PLV1 2HWB1 1YHFA 2GAUA 4GJYA 4IGQA 4W65A 5JXHA 2JECA 2KM2A 3I49A 3AKQA 5E6HA 5LBEA 4NN0A 1NLSA 1VAMA 3WQ7A 3MBWA 4L99A 3LEIA 2BBVA 1XXNA 1JW6A 2PAEA 3D8CA 3T0AA 1G8WA 4N8MA 4YW6A 4QXCA 2P3IA 2DWRA 2FDJA 3C8XA 3F2ZA 4MH0E 1ZZ7A 4XFCA 1PVXA 1PMHX 1AR93 3T2OA 3QD6A 5A1FA 3ZSLA 5FZ9A 5K9YA 1PO13 4GQ7A 4ASLA 1RXGA 4P5YA 4LHNA 2J1RA 5CAZA 4QDRA 2D97A 3ZOIA 1LKNA 3VD5A 1LR5A 1C5HA 1UMIA 4WVVA 5EV7A 4NMIA 2EIEA 5A3UA 5I0RA 1RUC3 2VZUA 2V09A 1XU1A 1W2OA 2HWF3 4LULA 1O4TA 2TBVA 4LBNA 4W4ZA 5A3MA 2YB7A 4BWOA 3FZ3A 2VO5A 3VHPA 4QPIA 4FPHA 2BWAA 1RUJ1 1F31A 4HPKB 4Q0QA 4R4ZA 3U4SA 4DO0A 3KHCA 4Q4Y2 4ZHNA 3ACFA 3T2QA 1JUHA 3I7DA 3NJYA 3N7MA 1GNHA 4M4RA 3I3BA 4Z07A 3VBRA 2WO3A 4NVPA 2BJSA 3O1TA 4U36A 5FJKA 3TEYA 2RS52 1W2TA 2FZ2A 1CAUB 3BPZA 2Z4FA 2ZPXA 4FXGB 3UKTA 5LATA 4LE3A 1LHNA 4LO7A 3HD8B 1G9AA 3M3IA 1VP6A 4DZGA 4RD7A 4QB6A 1LHWA 4BQWA 3LEKA 2AUYA 1H4GA 3WEZA 5FLJA 4CEWB 4OI2A 4BQ4A 1CAWA 4H14A 1J84A 2ID4A 4QHOA 4XCAA 3WT3A 1UZVA 2CAVA 1YFYA 3PIGA 5A3LA 4O61A 1JYWA 1GZTA 1ND3A 1EUUA 3ZFGB 2A71A 2QQWA 3I2FA 3K48A 4L9BA 4CEWC 3EB7A 1AXKA 1RTVA 2IVJA 2JDMA 3PL0A 1RMU2 4JRLA 4XZPA 2HWE3 2ZX4A 3T30A 4R9CA 4XBQA 4DNYA 3Q8EA 4ZKTB 1PNFA 3QOPA 4Y3OA 1SDWA 5FP7A 1LODA 4AL9A 1NX9A 4OQ9A 3RZMA 4QPIC 1JYTA 3U1XA 2R062 2W87A 3LB9A 2ZX0A 5DZGA 3SITA 2JJ6A 2J1UA 3AL5A 5ACA3 3KV6A 5A6XA 1FPN3 1X36A 1ZBA2 2JE8A 2Y64A 2RHPA 4JTNA 4Q4V2 1DQ1A 3VZNA 2ILMA 2VD7A 4HXCA 1AYN2 4WV8A 5DDJ3 2FMDA 3N9MA 1AL21 2ZX1A 5CYYA 5A33B 1BJQA 5EZWA 2XHKA 2E63A 1RUF2 4F8AA 1QU0A 4H3WA 3BN6A 5I0UA 4CRQA 3ILFA 3DPRC 4K21A 5EYYA 3ZYRA 5IK7A 4ASKA 3O1UA 2CY6A 1LGNA 2EVXA 3WVJA 2PMWB 2R041 2WNOA 5K0UA 1RUI1 1REDA 4R8HA 1TMF2 4NIAA 1FYUA 1G9DA 3WF1A 1VRBA 5ANQA 1OH3A 3TN91 5C5TA 2WZR3 2VZTA 4XC9A 1CGPA 3DCQA 4Q2FA 4X8PA 1EAH2 1UNBA 2FCUA 3Q8BA 3M3CA 1HXS2 1RHI2 1HN0A 3PJQA 2E31A 5AVPA 1V9U3 1VE0A 2Q1ZB 4IV3A 4I3GA 3NJXA 4ORFA 3V0AB 3BUCA 4QU2A 2GC1A 2QQUA 3A4UA 4YM2A 2VECA 3KV5A 1R091 4BQ3A 4JAAA 4D6RA 4PLNA 1IKPA 3UESA 2PTMA 1GYKA 4O7XA 4XIKA 4R52A
chains in the Genus database with same CATH topology
5FPZA 1S0DA 2HWC3 2ZAAA 2XLGA 5FOJB 3FFZA 1L3JA 3KT7A 4LHKA 4Q0PA 4QT6A 4YG0A 2DUPA 2EIGA 4HN0A 3HT2A 3AM2A 5FFOC 3VL9A 4D3WA 4CP1A 1VBA3 2PHFA 2WFPA 3ZXLA 4N9IA 3AMQA 3RG0A 4HN1A 1KS5A 5J7MA 1R083 3G6JB 4AVBA 2ZGNA 1PO21 1GQGA 1AL0G 2WJSA 3M1HA 2NPIA 5CNAA 4CDUC 3DUIA 1I6XA 1N1YA 2W68A 2QZ3A 2CGOA 3IDEA 1WBLA 1NY72 3IPVA 1DGRA 1GZWB 1H1MA 5KHHA 1O3QA 3C3VA 1AR72 4HKWA 4IQPA 5FQ0B 4GMP0 4B4QA 4IV3C 5JZGB 4BIFA 3AMNA 3ZSJA 5EFUA 2IFRA 1QHDA 3ZFFB 2BQPA 5KHGA 1S0GA 1LJ7A 4XJUA 1WBFA 5DZFA 1N1VA 1RVF2 1SFNA 4J1WA 1RIRA 4FPGA 2HWD2 2RM22 2P34A 1LOCA 2C5DA 3WP3A 4RR3B 1H1IA 4GXLA 3E6DA 1DHKB 2LM3A 1K5MB 1FMD1 4QPYA 1C8M1 5C6CA 3WDUA 3RYPA 5BNPB 4DRVA 1POV3 1ULCA 3QLQA 2YXSA 1OKQA 2WNUA 4W6WA 3B5LB 4NR1A 1TNRA 2GMPA 3TB0A 5BNPC 3CO2A 2JKBA 2CWMA 4ONUA 1N47A 4MVTA 3A0KA 3B9IA 3MEPA 3OGJA 4LLFA 5C4WC 3KGLA 3AYEA 5D8AA 4MXWA 4YM3A 1MR5A 4DY5A 1OA4A 1PVC3 4N53B 5IK4A 2R49A 4HT1T 4LBJA 4M3CF 3TOJA 2FBEA 2BFUL 2P37A 4FPYA 5JIUA 5CIRA 3NV4A 4FOVA 3AYCA 4Q1RA 1MZFA 2PHLA 3UKVA 3JUUA 4M0NA 1RGSA 2R071 4AHZA 1WD4A 3JBG1 1GQHA 2ZHMA 1FV2A 2WKKA 1X50A 1AYM2 4IEOA 4LUMA 4MXVA 4META 4AEDA 4Z2WA 1QJU2 2GH8A 5JOXA 4D94A 4XJAA 3VHNA 1HRI2 3RJRA 2ZKNA 4IEZA 3WDTA 2VW1A 1U0AA 1UCXA 1C57A 1H0BA 3RI9A 1VAKA 4CDWA 1ZNPA 5LEKA 4BZ4A 1NE4A 4KQ7A 5J37A 4YLZA 4FTEA 4YGDA 1CESA 1DGWA 4I30A 2VXRA 1TNFA 2DCTA 2ARXA 3D0JA 2X5IB 1RUNA 1QH6A 3DL3A 1AXZA 4XF1A 3RSJA 1FOD3 3HMYA 3GZUC 4JGYB 3WD5A 2VULA 3V0BA 3VBUB 4CDXA 4J6GA 4NPRA 4AI3A 4D7YA 4QM8A 1XNBA 2EAKA 2D43A 1CR7A 3OBRA 2PLV3 2HWB3 3CLPA 1VBD3 3EJKA 5KC6A 4AEDC 4XFFA 1X8EA 3B02A 4COWA 1SLIA 1IGOA 2D7FA 5J3UA 4R9BA 1BMV2 1GV9A 3AFGA 3VKFC 5BNOB 1J3QA 1MS9A 5JSRA 3VBFA 2ARBA 2WA4A 1W6QB 3U10A 4YZ1A 1RUD1 4QGLA 5JCTA 1VRH2 4FPJA 3QBQA 3POSA 3VLBB 1BZWA 4FT8A 4TLFA 4OFGA 4PLMA 1LOBA 1MZ6A 4GA9A 4ATFA 3H7YA 1NCRB 4DS0A 1WUVA 2ZGLA 2GC2A 1MEC1 1TME2 2WZPP 2JG9B 1QQP1 1W6NA 3IDBB 5E8AA 1AHSA 2JENA 1RUG2 4CDXC 1QDCA 2R042 3ZXAC 4MGZE 4W6YA 2DVGA 4FP2A 4EN0A 1W0OA 4YVSB 2B9UA 1RL3A 4PDWC 1MS4A 2XBO2 5KHJA 5SV8A 1REFA 4WM7B 3JB8A 5C8CB 2XLAA 4AQ6A 3KT1A 4RS5B 2BPA2 4WVMB 2PYTA 4XOGA 1Y9QA 3KM5A 3LA7A 3VL8A 3VBFC 4RS5C 2VU9A 4FPKA 4PQ9A 1UPSA 3SH5A 3AYAA 1UN1A 3AXDA 2KA3A 1PZ8A 3D5OA 3ZO0B 4IESA 1QOOA 1S2BA 4IEUA 2P2KA 4Q4Y1 4XFIA 3U07A 4M3CB 1OPOA 4I2OA 3IM0A 4YZ3A 1DG6A 4O9GA 4E27A 3H3UA 4M0HA 1XE8A 3TWIA 4YRDA 3ZN6A 3ENRA 3MIDA 4EV0A 1D4VB 2E7QA 1AL23 4Q27A 3RS6A 3VZOA 1AR83 2VUAA 3A0NA 2ZHKA 5GLZA 1X8MA 4D69A 3ZYPA 1BVVA 4EWDA 2VH9A 3AMHA 1PGL1 4G3YC 2N7GA 1RUI3 1C4RA 3GZTB 3TN93 1RMU1 4QQPA 1S1AA 3SCGA 2A70A 1AX1A 2ZGOA 1O91A 3ALQA 1CJPA 3GBWA 1RUH2 4ZU5A 1BVP1 4AE2A 4CTEA 4FQ4A 2R061 4N43B 4Y1ZA 1G9BA 2DU0A 2EXJA 2SBAA 5F9TA 1ZBA1 1LB2A 4MGKE 2YMZA 1NA1A 1YYNA 4Q4V1 4XFAA 1UMZA 2CNAA 1AYN1 1D4M2 1R093 4COVA 5DG2A 4HK9A 3SH3A 3LAGA 4P9YA 4WM8C 2WNVB 4IEQA 4YW5A 1OLRA 1Q8QA 4CZSA 3EBRA 2JICA 1AR63 5JIAA 3LA3A 3VKOA 4DXZA 1VIWB 3JCIA 1CIWA 3OF1A 3JQWA 4UBHA 1XE7A 5H9RA 3N36A 4RHV2 1TMF1 2DUQA 4GH4A 1LHUA 1ENRA 4JGZA 4AI1A 5HCAA 3B01A 5BNNB 4IEVA 2GN3A 1PO23 1Y3TA 3MPBA 1EAH1 2FQPA 3AZZA 4LA2A 4Y1YA 2X29A 1AJOA 3CJIB 2YV8A 4GKXA 1HXS1 1QJX2 1RHI1 2OZJA 2R1DA 3VBSC 2XJTA 4INDA 1LHOA 2R072 2FMYA 4L92A 2HJIA 4YNIA 2MHFA 1KDKA 2H6CA 4XF4A 2BTVC 5F6KA 2JG8C 4AVSA 2G4IA 4ES9A 1KFUL 5FOBB 2K2SA 1T6GC 1BBT1 3WLUA 3WG1A 3HWJA 1NA1C 3MIFA 3ZYJB 4YZ2A 4CDQA 1CJDA 2QFEA 3SHRA 3H1MA 1N3OA 5F1RA 2D5FA 4XFHA 1SLCA 1PIV1 4XXAA 4BA6A 3IIAA 2JDZA 1SCSA 1FMD3 2GH2A 1DGLA 2B5HA 1C8M3 4FSJA 4C90A 1XYPA 1KRIA 1QGLA 4D7SA 5CFCC 4AFDA 4RQPB 4JGZC 3VDDB 4B29A 5BV6A 4S2HA 4XILA 3O5SA 1V6JA 3ZVXA 1FI2A 5T5PA 1NY71 1IHMA 4OHYA 5BY5A 4FTSA 1UU5A 2WSUA 2UU8A 1AR71 3DF0A 4XFBA 1QDOA 3WDWA 3JD71 1KXGA 1YJLA 4XE9A 4HVQA 3BOWA 1AX0A 4P9XA 2VNOA 1LOFC 2A73B 4AFAA 4AI0A 4PBOA 2RE9A 5GALA 1V6NA 1RVF1 1XYOA 1OFNA 2NZ9A 2HWD1 1QF3A 4FAGA 3ZSEA 3AP7A 1O7FA 2I74A 1MACA 4QD2A 5I0TA 2CWSA 4CDQC 2WS93 4XHXA 3PJYA 4LO6B 3JBG3 1H8TB 1S55A 4I09A 2UY8A 4A7YA 1F8VA 2ENRA 4MX3A 4HVOA 5DXDA 3SH4A 1HRV3 2Z42A 2CGNA 4QQOA 3KLSA 4AW7A 3WCRA 1HV0A 1SLBA 1MQTC 5CBLA 2XVGA 4KBBA 2DU1A 5GJ6A 4Y1UA 4FVVA 4TWTA 4HPKA 1CD3G 3HT1A 5H9PA 1ONAA 2OPKA 1H9WA 5FREA 1OMIA 4XETA 4Y22B 3WQ0A 3KMHA 3FUOA 1IQAA 4P9JA 1TE1B 2Y26A 2XJVA 2PHWA 1ZZ6A 1CAUA 4LBQB 2Q30A 2YROA 2XPJA 2A75A 4OLLA 1TEIA 1D0HA 4AVVA 3WG2A 2PHRA 3ZFEB 4IL7A 1AYM1 1CVNA 1QJU1 3AJZA 4IEYA 4LUKA 3ZMOA 1W2UA 2V5YA 1XYNA 1V6OA 1ZX5A 4CEWA 4HKOA 5ABJB 1I1EA 1HRI1 2DURA 3EHKA 2GC3A 2CV6A 3ZFGA 1IOAA 1YIFA 4AGGA 1Z78A 1S0IA 3CNAA 1BEV3 4IXLA 5AFEA 3FWEA 2GDFA 4HZFA 5FCCA 1OD5A 5CU1A 1U5XA 1EV11 1V6LA 1WW4A 4Q4W2 3UJOA 1LESA 1DZQA 3CEWA 4F83A 5HXVA 5FPXA 4Y26A 2P3KA 3PMSA 5JI7A 1DDLA 2YY1A 3J8F2 3KD4A 4Z8BA 4EN7B 4B3NA 1RUD3 3MIHA 1UIKA 1H2NA 4L8QA 2VOVA 3DPRA 4FPLA 3Q9OA 3M3EA 3FX3A 4AVCA 3VZKA 2XVKA 4BQ1A 4B7EA 1MEC3 5BXXA 2KXLA 5K7PA 3APBA 1QQP3 2C0ZA 3IWZA 2OUHA 1CAXA 4FXKB 2XUMA 2D6NA 5I8TA 1PGL2 4Q26A 4Z82A 1B35B 4GALA 1OFSA 2EXHA 1FT9A 1GANA 2ZMKA 1CONA 2TUNA 4AGRA 2ZOEB 2D6PA 2Y0OA 2GMEA 2A6XA 3WP4A 1OQ1A 2UY9A 3MIEA 1BMV1 3ZFGC 3MF6A 4URTA 1LU2A 1REEA 2WT0A 4LEJA 4XF0A 5AC92 2AGSA 3WY6A 3T1LA 1CN1A 4YW2A 2WSVA 3E5QA 4FBFA 3MIGA 2B42B 5JMCA 4W6XA 2VW0A 1IS3A 2QNKA 3AKRA 3V0AA 1VRH1 4Q0VA 1QWRA 3N7KA 3I4IA 3NAPB 2I45A 3WX5A 3B94A 1URXA 2IXLA 5CFDB 3FHIB 3T1MA 4YFZA 4QGNA 3LCPA 4NWWA 1TME1 3M4FA 1V6MA 2YYOA 2WFF2 2DCKA 1H2KA 2DV9A 4LTAA 3VBRB 3JZVA 4Q4Y3 3THTA 4CEYB 1RUG1 5FRAA 1D2QA 3NKGA 1Z7S2 1VBE2 2RR12 4GMP1 4YYOA 3LGRA 4PIZA 2RS53 4L97A 2XG3A 4PBPA 2R16A 4X6QB 4CDUA 3AZWA 1UL9A 4MLOA 4G4FA 1Y43B 3FUQA 2WLQA 2XBO1 3N7LA 3ZXJA 5BPXA 3W9AA 4P9WA 2MEV2 4IV1B 1C5IA 1NLRA 4L11A 3U11A 1ND3B 4P9LA 4LBMA 4JCKA 1GZWA 3D6EA 5FQ0A 4K1ZA 3ETQA 1BBT2 1ENQA 1O3RA 2D3SA 1ZBE1 4IEXA 5EJ3A 1QNWA 1U12A 5GKAC 4AXOA 1RMU3 1E57A 3ZFFA 4GB32 4JQRA 3IDCB 4PLOA 2BVBA 2GU9A 2AH2A 2E51A 3QH7A 4QM9A 2F6BA 1MS3A 2R063 3MFCA 1F2NA 2GSYA 1LEMA 1PIV2 1S0CA 3LZZA 4KU8A 5I8SA 1H30A 5IK5A 5A32B 2QE3A 2D5HA 3H3ZA 1ZBA3 4E4SA 4YZ5A 4Q4V3 3BB6A 1AYN3 4BLJA 3BTAA 5GZCA 1DZTA 2CL2A 5BNPA 3CJXA 1ZYBA 3JU9A 3R05A 4WVWA 1RUF3 3GNEA 3HAGA 5C4WA 4QQ2A 2IZWA 3V56A 1ZRCA 1I9RA 2JD4A 4LLOA 4K1YA 4BM8A 5K0UB 3M7AA 1VLNA 1CX4A 3SISA 3JD72 1KDMA 1TMF3 4UW6A 3C2UA 4JRAA 2D6LX 3MF9A 4EN9B 5E89A 1ALYA 4ZXKA 2RMU1 3ACLA 3SNMA 4ES8A 2XKOA 1VBC1 5GLWA 5JZGC 1EAH3 1RJ7A 5CG8A 2PQQA 3D4KA 1H1AA 1RUH1 1UU4A 1HQLA 1ZZBA 1HXS3 1RHI3 3FLTA 3ZFFC 1ZRRA 5AVAA 3AP5A 1COV2 4XJ9A 2K9ZA 1JHNA 3KCXA 1Q8VA 4RR3C 4Q8LA 5T50A 1QMJA 2YZ4A 1D4M1 5F5QA 4ASMB 4JDMA 3MDPA 4AVAA 5I93A 1S0EA 1K5MC 4YGCA 3MICA 4KWLA 3RDIA 3VV1A 4A7KA 4GIQA 2PAMA 2QDNA 3E6BA 2Q0AA 2YC0A 1YI9A 4HK8A 3IN9A 2G9FA 4JTOA 5FLHA 4KNCA 1DFQA 4Y1XA 3J9SA 4DPNA 1G86A 4RHV1 2DUOA 3AZYA 1GZCA 1PZ7A 4H7LA 3GZAA 4RFT0 4P9IA 4FOQA 1A6CA 1GICA 3HIFA 3GBFA 2VOWA 4N53C 3W59A 5JSPA 1SEFA 3B00A 4O9EA 5LRSA 2HEYF 2ET7A 5CB7A 3E97A 4QPGB 1QJX1 2VNRA 2QKDA 3GBGA 4JGYA 3VBUA 4NHLA 1WW5A 4EJRA 5CG9A 3WDVA 3TYJA 1U5IA 3PNAA 5JOZA 1MZEA 1VBD2 3O14A 1AR73 1MZ5A 2UYAA 3HR9A 4LBOA 4BE3A 5FAXA 3ATGA 1NCQB 1SBFA 4OI1A 2P17A 5DUUA 1QJZA 5DUXA 1RUE2 1RVF3 4BYYA 4HBNA 2HWD3 2BNOA 2RM23 4C91A 1SFYA 2PFWA 3NKTA 1UZYA 3KT4A 2Y38A 4M01A 1EV12 5CADA 4TZDA 5K8SA 2QJVA 3UL2A 2VQ0A 3WXPA 1VBB2 5BNOA 1WD3A 2OIIA 1W6QA 2WNUB 2A3WA 2UYBA 4Q0UA 4YGEA 5DG1A 1QJY1 4XFGA 5GZDA 2X5IC 1HV1A 1DIWA 1RINA 3FFQA 3OD0A 1W6PA 1Q43A 3D0SA 1NCRA 3ELNA 1FXZA 1IS5A 5D8AB 4NHMA 1IPKA 1KJRA 4E2SA 2XJSA 4XF3A 3ZSMA 2B7YA 1YRZA 2PN5A 3NW4A 2DFCA 4JGYC 3NO8A 3NSTA 1Q8PA 5JVVA 3VBUC 4HSJA 1OOPB 1Q5OA 5SV5A 3MYXA 1JXNA 4PDWA 1WW6A 5IK8A 2VW2A 1HQWA 2BVVA 4Y20B 3VN4A 2O8OA 4XQ4A 4IEPA 3GHMA 4NWVA 1LOGA 3TRSB 4L2NA 4WM7A 3AJYA 3NV3A 2IXKA 4QQHA 3BU7A 1V70A 3B9CA 1AYM3 1LOAA 4RS5A 4WVMA 1QJU3 1WGPA 4AFBA 1QH7A 1ZZ8A 3ZDSA 3BALA 3IMNA 4AHYA 3AZVA 5BNOC 1MS8A 4I0BA 1R1A2 1HRI3 5FMOL 1FNZA 4CDWB 4S2DA 4JV4A 5KBFA 2ZGSA 1HQNA 4Q1PA 1QXJA 4PIXA 4I02A 5JI9A 1RUJ3 1WMFA 4SLIA 1SCRA 4C0BA 2X53S 3VUOA 1NCRC 3I59A 4M3CA 5H9SA 2JG9C 1VJ2A 4GWNA 4WBBA 3OY8A 2B45X 1ASJ2 1U5ZA 3JQXA 2ERFA 1G7YA 1SBEA 2A7AA 2ZS6B 1AR82 1KJLA 3R4SA 5IUQA 1VB2A 5EXOA 1WLTA 1OHFA 3ILRA 1APNA 3P3NA 2ZZJA 5E16A 4NOTA 3IBMA 4RSUA 5J98B 1PM7A 2E7TA 4YVSC 3O0WA 5C33A 2RS12 4AI8A 3AFKA 3OCPA 3RI8A 3OYWB 4WM7C 2GC0A 4IERA 5C8CC 1ULGA 3H1YA 4XYXA 2R6QA 3DKWA 4OI0A 3VGIA 2BEOA 3S7EA 3ZMNA 1ZBE2 1GSLA 1W39A 4EN6B 5J48A 1PK6B 4QMAA 3ST7A 4Q4X2 4X6RB 4UW5A 2IFWA 4M00A 4K20A 3AB0A 4HLTA 4Q4W1 4AHXA 2OVUA 4N43A 3J8F1 2YDEA 1EPZA 4C0HA 4WM8A 4OHXA 1VRH3 1M06G 4MV2A 4R9AA 2JE9A 3AX4A 2WNVA 5T52A 1W6NB 1TME3 1A8DA 2BWCA 3MIBA 4N90A 2HKXA 3KQRA 2WINB 4CYDA 1RB8G 1J3RA 3ZXFA 3NL1A 4H55A 1RUG3 2R043 5L7OB 5F6LB 1DF0A 4GMP3 2VVFA 2TEPA 2IXCA 4AK3A 2WZR1 1Y7BA 3EO6A 3MPPG 2RMU2 2PHUA 3ME2A 4AFMA 1V00A 3VBSA 5GZEA 1VBC2 1XU2A 2XBO3 2XL7A 1N3QA 3VBOB 1KS4A 3CJIA 3RJ2X 4B4PA 1DYKA 1V9U1 1WLCA 1XNKA 3AP4A 3N3HA 2D40A 2DYCA 5DUWA 5AC91 1YCIA 2JG8A 3MW2A 1NQJA 3N35A 1NZCA 2GMMA 3LSDA 3MGUA 4OVEA 2LUWA 5BYNA 4N43C 4P9GA 3MW4A 2I2SA 3ES4A 4FAHA 4Z92B 4Y24A 1GKBA 4YVWB 1UAIA 3USSA 3KZ4C 3R4UA 3ZIXA 3U4XA 1RC6A 2HWC1 2JE7A 2WFF1 1OLQA 4BLIA 3E5XA 3AKSA 2WNVC 1NE6A 3O0VA 4N9HA 1UX6A 1W6OA 3BIWE 1WCKA 1Z7S1 3ZN6B 4A2UA 1VBE1 2RR11 3WUCA 3WHTA 1R081 3ZXKA 5I8YA 5CFCA 3VBHB 3FBYA 2PHDA 5KXEA 3WG4A 2NYYA 2UWCA 2ZJCA 4HL0A 4OZXA 5L36A 3L2YA 3POYA 4WZCA 3VHOA 3ZPYA 3VDDA 2VNGA 5BNNC 5KC5A 3MI8A 2MEV1 4R9DA 2V73A 3CJIC 4K7JA 1G9CA 2IC1A 5JPMB 1UF2C 3H9AA 3O12A 1LOFA 1NXMA 4OUMA 2D6MA 5J96B 5FO7B 2GZWA 4RL7A 4YGBA 1ND2B 2GNTA 4QGMA 3P3PA 2ZZQA 4MGYE 5JAXA 5C9AB 4GB31 3WW4A 3AXEA 4DRRA 1YWKA 1RUH3 4N7UA 1JUIA 3VKLA 3IT8A 3MLLA 2O0OA 4RGAA 5GLUA 4PJYA 3G7DA 3SLIA 1H8TA 4J1XA 4MSVA 4YFWA 1UW8A 1Z0HA 2HEVF 2XH6A 3FMGA 3OJBA 2WWSA 3VZLA 3ZIWA 1HRV2 1QJY2 5KXBA 1D4M3 2H6BA 1MQTA 4BOWA 2ZGQA 4HETA 4AG4A 2EXIA 4JVAA 1LTEA 2QDRA 1CAVB 1AF9A 1IKQA 2DVAA 3AZXA 4DMIA 2RS32 3WZ1A 1WCDJ 4MYEA 3BODA 2H0VA 2HYKA 1JN2P 2E53A 4RQPC 2DVDA 3VDDC 1KITA 2G9GA 3L2HA 1S2KA 4RHV3 1OQEA 4QHBA 3WCSA 3INAA 1J1TA 5JDBA 1HDKA 1GZ9A 3VZMA 1NG0A 3H50A 3ZXGA 1N3PA 3USUB 2ZA9A 2OZ6A 1AR92