2XL9A

Structure and metal-loading of a soluble periplasm cupro-protein: zn- cuca-closed (semet)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
235
structure length
231
Chain Sequence
EIHTFDDIPMPKLADPLLIYTPANEIFDIASCSAKDIGFAIAHAQIPPGGGPMPHIHYFINEWFWTPEGGIELFHSTKQYPNMDELPVVGGAGRGDLYSIQSEPKQLIYSPNHYMHGFVNPTDKTLPIVFVWMRNEVAPDFPYHDGGMREYFQAVGPRINLPELTNAQRAAFASEAPKYGINQSSYFMEYVNTISDKLPAQIAKLKNDKDLERMVEVIEAFNRGDKSVTCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SLL1785 PROTEIN
publication title Structure and Metal Loading of a Soluble Periplasm Cuproprotein.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Metal binding protein
total genus 48
structure length 231
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xl9A00
2VPVA 3FWEA 1NXMA 2OA2A 4MUVA 3RYKA 4AVAA 1CAUB 5I91A 1IPKA 3IIAA 4ZU4A 1UPIA 3TNPB 3TNQA 1SQ4A 1OI6A 1J3QA 3E5XA 4H7LA 4O9EA 4META 3KGZA 4Q29A 1CX4A 5BV6A 3DKWA 5FPXA 2OPKA 1Q5OA 2CAVA 4J1XA 5J48A 5JSPA 3FE5A 1CAXA 3WW1A 5KHJA 2IXIA 2BNOA 3QACA 2XL7A 5BXXA 5I93A 5T3NA 3OF1A 1IPJA 4HLTA 5BUVA 2IXLA 2PTMA 4KWLA 4Q0PA 1UIJA 4UXAA 1OD5A 4HN1A 1Q3EA 1O3RA 2BEOA 2KXLA 1SEFA 3IWZA 2O1QA 2QJVA 2Q30A 1J3PA 4YRDA 1ZZ8A 3MDPA 4F7ZA 2Q0AA 4Q0SA 5C8WA 5K8SA 4LULA 3H3ZA 3U11A 2BNNA 3CO2A 2PYTA 3E97A 4EWEA 1VR3A 1U12A 1YHFA 3D0JA 1L3JA 3FJSA 2UY8A 4WBBA 3WW2A 3FX3A 5CADA 4IEQA 3IDCB 4ZU7A 5J3UA 3KSCA 5I0RA 4I0AA 1YFWA 3CL1A 4LUMA 2PHLA 3RNSA 4IETA 2ET7A 4QGNA 1OMIA 3UKTA 1PM7A 2GZWA 3CF6E 4KWKA 4QM8A 4HZFA 4X6RB 1FI2A 1I6XA 1QXJA 3KMHA 4KL1A 4CYDA 4AVCA 3MZHA 4IEXA 4XFHA 2CV6A 3IBMA 3NKTA 4EWAA 2QDRA 4AVBA 2QNKA 3E6DA 1LRHA 4R52A 4FAHA 3HT2A 2Q4SA 4LA3A 5E1RA 2IXKA 4HVOA 4XF3A 1NZCA 4D7TA 4LEJA 4N9HA 5I8SA 3S0MA 2D5HA 2GC2A 3CEWA 4QXKA 3LWCA 1LKNA 1EY2A 1YLLA 2QCSB 3BALA 3MPBA 3SXWA 2ETEA 3O14A 1UIKA 5FLIA 4HN0A 4A2UA 2BNMA 3KCCA 3UKNA 5BPXA 1ZZBA 1O4TA 3H7JA 4E2SA 1VJ2A 4OLLA 2GC3A 1Q43A 3HT1A 4GULA 4AQ2A 3C3VA 5FLJA 1YFUA 1ZNPA 4MGKE 4PJYA 2PA7A 3BU7A 4UBHA 1J59A 4MV2A 1XE8A 5E16A 2EAAA 1VP6A 1PMIA 3ST7A 3CJXA 3BPZA 4IEZA 1FXZA 1XE7A 3RYPA 3WW4A 2EA7A 2CGPA 1ZRRA 2GC0A 1ZRDA 3NSTA 1I5ZA 3FFQA 5AVPA 5I0SA 1DZRA 3I54A 2P17A 3GYDA 3H1MA 3GBFA 4BH9A 3CLPA 5JSOA 4F8AA 2OZ6A 4YNIA 5LRRA 3EJKA 3EO6A 3S7EA 4HBNA 4EROA 3OTFA 2MHFA 3PLQA 4ONUA 4P9GA 4E2QA 3RYRA 1CGPA 1HW5A 4IEOA 3R6SA 3RDIA 3LA3A 4EV0A 1YFYA 1ZVFA 3E5UA 1ZRCA 1YUDA 4HSLA 1EYBA 4KU7A 2Z2SB 3U10A 2XL9A 3HQXA 5FQ0B 2WC2A 4I2OA 4L2NA 1RUNA 2PAEA 4O9GA 1DZTA 1Y9QA 4MGYE 3SCGA 4XETA 3EBRA 5BY5A 3LA7A 5KHHA 4MX3A 3H7YA 4YARA 4IEPA 5CVRA 3D0SA 2Z69A 2D93A 4IEVA 1EPZA 4QMAA 3L2HA 4Q0QA 1NE6A 4IEWA 1QXRA 2K9ZA 2IXHA 5LEKA 2WFPA 2H6CA 3ES4A 2OYZA 1H1MA 3E6CC 1ZZ7A 4QM9A 4MGZE 3ROUA 2OZJA 3ES1A 1WGPA 3SCFA 4PIZA 5JSRA 5FDBA 1WA4A 1FT9A 4HSJA 2E9QA 1YFXA 2BYVE 2D40A 4LUKA 1ZRFA 1DGRA 2HKXA 4K8FA 3H8UA 3E6BA 3B02A 4XF9A 4IESA 2BGCA 1WLTA 1XRUA 2GAUA 2PAKA 3NJZA 3OD0A 3HIFA 2PHDA 1O3TA 4LTAA 2N7GA 4BIFA 5F1RA 3SCHA 2XLGA 3PVBB 2UYAA 3FHIB 1O5LA 3NL1A 5I8TA 3RZZA 3I7DA 4XF0A 4XFBA 2ET1A 5KHKA 5FQ0A 3PNAA 4BHPA 5LRSA 4XF4A 2IC1A 3LAGA 4J1WA 1ZX5A 1TQ5A 4JTNA 4X6QB 4R8HA 4IERA 5HI0A 2GH2A 4KWJA 1RL3A 1O5UA 4PIYA 2C0ZA 3BB6A 1ZZ6A 3ETQA 4NVPA 1H1IA 3M3IA 5EZWA 3LOIA 2B5HA 2XLFA 3VHRA 4QGMA 2H0VA 3D82A 5KHGA 4Z07A 1X7NA 4FT8A 3LA2A 1J58A 1UCXA 1J3RA 3DL3A 2F4PA 1RTVA 4JV4A 1RUOA 4Z82A 4E2GA 2PAMA 3M70A 3MYXA 2B8MA 2Y0OA 3JZVA 3BCWA 1RC6A 2I45A 4I0BA 5KBFA 5I0TA 1QWRA 3U0ZA 4MH0E 4RD7A 5I8YA 3ACLA 3UKVA 1SFNA 2XKOA 4WVZA 3H50A 1GQGA 4I09A 4L11A 3LZZA 3S7IA 4JTOA 4IEYA 2B9UA 3WW3A 2GU9A 3N4MA 5I0UA 1NE4A 2PFWA 2H6BA 4XF1A 3SHRA 4FBFA 4UBGA 4I3PA 1YWKA 5FPZA 4XFGA 1CAWA 3DN7A 1J1LA 4IEUA 3KGLA 2ZKLA 4XEZA 5JAXA 2FMYA 4MGIE 2QVSB 4EWDA 1Y3TA 1O3SA 3OCPA 3USSA 2UYBA 4PIXA 1X8EA 3H1WA 2PQQA 1JUHA 4DINB 2GC1A 3NVCA 1OFNA 2MPFA 4D7SA 4B29A 4QX5A 3DV8A 2V09A 5J7MA 5CU1A 1CAVA 2Q1ZB 4YYOA 3OGJA 5LEJA 1X8MA 4QGLA 3FZ3A 4Q0UA 3I59A 2CAUA 4LA2A 2EVXA 5JR7B 1RGSA 3EHKA 4KU8A 4I02A 4WZCA 4MZUA 4YSFA 1NYWA 1CAXB 1EP0A 2IXCA 2XHKA 5FLHA 1CAUA 1X82A 1ZZ9A 4XFIA 5C6CA 4N9IA 1ZZCA 2O8QA 2XLAA 3SMHA 2FQPA 4HVQA 4AXOA 2IXJA 4FAGA 1DGWA 1UD1A 3H9AA 4LLOA 2VQAA 1CAWB 1G6NA 2D5FA 4ORFA 5D1IA 4AQ6A 1LR5A 4HMZA 1UW8A 2HJIA 2UY9A 5EFUA 4HVRA 2XGXA 2XKPA 4XFCA 1V70A 2ATFA 3ELNA 4I01A 4BYYA 4TLFA 2VECA 4ZU5A 1ZREA 4OFGA 4Q0VA 4XFAA 1O3QA 3NW4A 2K0GA 3RPQA 1O7FA 3IDBB 2DCTA 2ZCWA 3EQEA 3H1YA 1GQHA 3E5QA 5KHIA 1CAVB 4JVAA 5JCTA 2MNGA 3G7DA 3QOPA 4XFFA 5FCCA 1QY4A 3H3UA 1LB2A 3ZDSA 3I59B
chains in the Genus database with same CATH superfamily
1BZWA 4Z2AA 4LE3A 1F35A 3U37A 3WLUA 4Z1VA 3J7LA 3SLIA 1SPPA 1V6OA 2IFWA 2XUEA 2VPVA 3IAQA 2WN3A 5DAVA 1RHI2 1W6OB 3I3MA 1Z78A 4MUVA 3RYKA 4AVAA 4FPGA 1HQWA 3OBRA 1TMF3 3OUJA 2OXBA 4IE6A 4B7EA 4ASLA 1BEV3 2WYFA 1VBB1 4RS5B 1OI6A 3CIHA 1QIQA 1APNA 1NG0A 3E5XA 4JGYC 4LOSA 1AR63 3ZYFA 3RZMA 4META 3LSEA 2E26A 1BVVA 1YQ6A 3CNAA 3BPSA 2NPIA 3ZXKA 1V00A 1O6UA 1NA1C 3VGIA 5BV6A 2OPKA 3GALA 1JZ7A 5J48A 5LA1A 3FE5A 3VBSC 3WW1A 5A3LA 1VBB2 4CDWC 3POIA 5EJZB 5LASA 1S0DA 2GP5A 1RUJ3 4GH4A 1RUD3 2G19A 2G9ZA 3ACHA 4HLTA 2XJSA 4A45A 4QAWA 5FWEA 2AH2A 1WW7A 2X5IA 3OB8A 4QT6A 5HPOA 3MIEA 2ZABA 4XDPA 5FO7B 5JIUA 4OZXA 2KXLA 3AFGA 4BOWA 1J3PA 2A7AA 4HG6B 4YRDA 5CYYA 1W6QB 2WAOA 3WUDA 4AAPA 2QE3A 4KGGA 5C8WA 5K0UA 1ASJ3 4KG0A 3PIGA 3E97A 1Y43B 1W99A 1IZ3A 1S0BA 4XQWA 4PLMA 2R30A 1HXS1 1Q8OA 4MHUA 4L92A 4RFRB 3LE0A 1MVQA 5GM0A 5CFDA 4IE4A 1UY0A 2RV9A 4LOTA 2XHNA 2ZEZA 4CDQB 2DUQA 4QPIA 3DCQA 5LK5A 5EIYB 4ARXA 1O8PA 2DFBA 1UOJA 2WZR3 4N53A 2JENA 3JU9A 3C7OA 3KCXA 3O0WA 3K3NA 5I0RA 2WO2A 1HXS2 1YJLA 4I0AA 4KGQA 4MGQA 1JYTA 2HLEA 3QD6A 4COVA 1QJY1 1LU2A 2PHLA 3TYJA 3RNSA 3T0AA 4BMBA 1W2AX 5JOZA 3U4XA 3VD7A 4V2WA 1HRI3 2CGOA 3ECQA 3IM0A 4FFGA 1FMD1 1HRV1 5F39A 1JZ5A 1UZZA 3ZYIB 3WT3A 1GZ9A 5HCHA 4TN7A 4PDWC 3GCWA 2W1SA 4WM7A 1K5MB 1W9FA 1SLTA 2VXRA 4ZKTB 4KWKA 3HJRA 3USUB 5JWPA 5GLTA 1QXJA 3AK0A 4LBQB 4C0HA 4XBLA 5JXGA 3ZFGB 4BQ3A 5LW9A 1FMD2 1HRV2 4CPBD 1SFYA 3HPNA 4BLJA 3MZHA 4JGZB 1H1AA 3IBMA 3NKTA 4B3NA 4OHXA 4AVBA 4W4ZA 2QNKA 4Q4Y3 1ODMA 4X8PA 3GCXA 5CZKA 2FDIA 5DDJ2 2QQOA 2Z79A 3PTYA 4R52A 4UW3A 2VMFA 3MIGA 4FAHA 3HT2A 2BQPA 4LA3A 4XQDA 4JKKA 1YO8A 4L97A 3SC7X 1W2TA 5GLWA 1EV11 5A1LA 2P5BA 4GB31 5EYYA 2D5HA 4IQPA 4NO4A 5DG1A 4AW7A 5H9SA 4LBJA 5KWRA 1QOOA 2AENA 3J9SA 5FZIA 1EY2A 5A70A 2QCSB 3AP6A 1H6YA 1U0AA 2IUWA 1R1A2 1N1YA 3MPBA 2VMCA 2ETEA 3NV4A 4IGPA 4BIOA 3O14A 1UIKA 2OT7A 1OURA 4FPJA 4K20A 2HEWF 1EAH1 2VCBA 3GHMA 2R042 1EV12 1C1LA 1YI7A 4GKYA 1E5IA 3ENRA 3KCCA 3P5BA 1BK0A 1UY1A 2FCUA 2VNRA 3C7EA 2P34A 2H0BA 4LITA 2JDMA 5APAA 2GC3A 1AR71 3HT1A 2CWSA 3MFCA 4AQ2A 4YZ2A 4PJYA 2ZZJA 4MGKE 5AFBA 1JYCA 4PF5A 4QB6A 5FYUA 4QX3A 2DV9A 1LOEA 2DUPA 2WNVB 4XXAA 2BBVA 4CDQC 3POEA 1ULGA 3GGLA 4P9YA 3KF5A 4MV2A 4FTBA 1XQNA 1SACA 1XE8A 2GH8A 2AUYA 4YWAA 2HWF2 3JB4C 3LQCA 1LHNA 1VP6A 2DCYA 1PMIA 4QXCA 4IEZA 4LKFA 4O65A 2A6YA 3ST7A 3ZSJA 4A6SA 5FZ1A 4BQ2A 1FXZA 3AP5A 4BQWA 5L36A 1LTEA 3OPWA 4IV1B 1ZBA3 4Y20B 1OXCA 2EA7A 2GC0A 2GNDA 2CGPA 3AZVA 4JC1A 3LD8A 1GANA 1ZRDA 3JBG1 3FFQA 1QGLA 2VVDA 4QX0A 5FKCA 4OQ8A 3I2OA 1AYN3 1DZRA 2P17A 1QXPA 3H1MA 1OT5A 3GBFA 1UX7A 3MGUA 1N3QA 5CIRA 2DCZA 3NNFA 4YZ4A 1K5MC 1DG6A 5EP9A 3UL2A 3CLPA 2ZXQA 4BH9A 5IYYA 1WD3A 4N7UA 5L9RA 4F8AA 2C4XA 3IAPA 2OZ6A 3VHNA 4JCKA 4YNIA 5EQUA 3MIFA 5LRRA 3VBHB 2R063 3ZFGC 3ZMOA 5T5JA 2DBNA 1DLLA 2MHFA 1NXD1 2YXSA 3AMHA 3PLQA 4ONUA 4P9GA 4JGZC 4XOGA 2WZPP 3WDVA 5JXJA 3I2JA 1DYOA 3AKTA 4DNYA 1CGPA 1HW5A 3FC0A 3R6SA 5T50A 1ZRCA 1YUDA 4E4SA 4YGDA 3JQWA 1EYBA 2Z42A 3R4DB 4JX0A 1JYIA 2D3PA 3U10A 4EZHA 1PK6C 2XL9A 1OF4A 2RR13 3E6CC 1YIPA 2GP3A 1MZ5A 1N47A 2ZX1A 5ABJB 3J8F2 2O14A 1ULEA 4XETA 4Q8LA 5SV5A 4AK3A 5BNOB 3NKGA 4YGCA 3RWKX 4FPEA 5A7NA 1GWLA 3H7YA 3VBRA 2EXHA 3C2UA 4QQLA 2UU8A 1J83A 4IEPA 4M0HA 5CVRA 3MLKA 3D0SA 1W6NA 4CXXA 2O0OA 1AYM2 1QU0A 1W9TA 2WAAA 3MIBA 1QOTA 3W5NA 2WINB 4IEVA 4BJ0A 1ULFA 1CX1A 3MICA 2ZKNA 1BLZA 1POV3 2WWUA 5FP9A 3UNPA 1NKGA 3ZR5A 3ATGA 5A7QA 5A7SA 3I2DA 1WLWA 1VBC1 1DQ0A 4LMFA 4UOJA 2WNVC 2XVLA 2HYKA 3ZFFA 4B4QA 2F6BA 2WFPA 4J25A 4RA0A 3KV5A 1SCSA 2GNTA 5FXWA 3N7KA 1L7RA 3KLSA 1ZZ7A 4QXBA 4QM9A 3DXUA 2GNMA 1W6MA 1OLQA 1AF9A 1QJZA 3PMSA 1C57A 5IVYA 1R081 1JHJA 1VBC2 3GZUC 4IV1C 4NIDA 3KV4A 4GMP0 3BI3A 1GZWB 2VXJA 4YVSB 4LHKA 3ZN6A 1GQPA 2ZHLA 5JSRA 3ZYGA 5LA0A 3T1LA 1UXZA 4GJYA 3UJQA 4R9DA 3POSA 3WF0A 2AZ5A 2D40A 2D3SA 1R082 2RS51 4AFCA 1DGRA 2JE9A 4QX8A 4AOCA 4CP9A 1ZRIA 2XUMA 3VBHC 4BLIA 1XJAA 2JE8A 1GBGA 4IESA 1XRUA 5GLZA 3ZXDA 4ZZ5A 3NJZA 3KD4A 4QU1A 2EIBA 1K12A 1MQTB 4ATEA 3OD0A 2YBPA 1UL9A 2CY6A 3I49A 1O3TA 3BOPA 3VD5A 2ZGMA 3ZXAC 2RM22 1RUG3 4QHBA 5FY7A 1MEC3 5DDJ3 1GP5A 3T4VA 1HJFA 3U14A 2WN2A 4M00A 4XFBA 5B4XA 4BQ4A 2WNOA 5KHKA 2HWB1 4Q4V3 1T6GC 4V2VA 1UY4A 1COV3 3I3BA 3PNAA 4W6XA 2VW1A 4BHPA 4M3CF 1BMV1 2IC1A 4CEYA 3LAGA 2Y64A 5FZ8A 1B09A 5DXDA 5BNOC 1QMJA 3AYAA 3POFA 1TQ5A 1GNYA 4PHZA 2VMIA 4R8HA 4AVSA 4IERA 1L7QA 1SHWB 2GH2A 5HI0A 3BGAA 3ETQA 2WT1A 4DUVA 2K46A 1JOPA 4YM3A 2HWB2 1VRH3 2B5HA 3DPRB 1X33A 3OBAA 2BV4A 2H0VA 2R043 3FHAA 4BQYA 4DXSA 1BMV2 2VR4A 4K3UA 4LK7A 5JXHA 1X7NA 4DXZA 5GLVA 1SCRA 4FT8A 1RXFA 2R1BA 2VE1A 4MXWB 4UFHA 3POJA 5FZ0A 3C8XA 1REDA 4LXLA 3MLLA 5AFEA 5IATA 5L7OA 4Z82A 3ZDVA 5FR3A 2JDZA 1WBFA 5FZDA 2E31A 1I1EA 3MYXA 3PMEA 1ND2C 4QQPA 4XMAA 1H2MA 3JZVA 2HWF3 2PMWB 3BCWA 1VMJA 2VAUA 2I45A 5EJ3A 3VBUA 1ULOA 2W39A 1U5IA 5ANQA 4YVSC 4AHXA 1JS9A 1F4HA 3PU8A 5I8YA 5DABA 1IS6A 1OOPA 1S0FA 4NROA 4O61A 1NCQB 4OUMA 3ACLA 1UNBA 5CA6A 3UKVA 5IVVA 2DVFA 1PNGA 2Y6GA 3OPTA 3ZYJB 4JAAA 5FZOA 1GQGA 3AFKA 1XNCA 1W6PA 5FY1A 4BXSV 4JTOA 1PZ8A 4FXKB 2VOKA 4AHYA 2ZJCA 1NE4A 2CTVA 2PFWA 3D4KA 2H6BA 2YMZA 4X8NA 4UBGA 4I3PA 4COZA 4H55A 5C3QA 1A8DA 2VY0A 1MQTC 4OVEA 3JUUA 1QJX1 3ASIA 3KGLA 4FQ4A 2TBVA 5FZ3A 1KDKA 1TNFA 2OKXA 3WNXA 5JLVA 4FPYA 4LO7A 5DAQA 1AR91 1QH6A 2WJSA 1VBE1 5F2SA 2GALA 3MPPG 2OQ6A 3AXEA 1S0EA 1O3SA 3NRUA 3JQXA 3SEEA 2BP6A 3USSA 1R093 4OI0A 1PIV2 4RSUA 2W94A 4PIXA 1X8EA 1JUHA 3T08A 3H8OA 2JDYA 3WR0A 2JE7A 3GZTB 4CDXC 2MPFA 2NM1A 4IUGA 3RMXA 4RHV1 1DBNA 1AR92 1LOFC 1N3OA 1US2A 3DV8A 1VBE2 2V09A 3INAA 5GKAC 5F2WA 5FWJA 2O8OA 1UYYA 5FXZA 4R4ZA 2W2IA 1REFA 3WDYA 2Q1ZB 4BPZA 2WZ8A 2RMU1 4ZS3A 1XU1A 3QCWA 2Y26A 2G9FA 1AYM3 2NMOA 1QJU2 1KFXL 3NQHA 4IW3A 4XJ8A 1T6BX 2Q5TA 3C7HA 1DCSA 2DYCA 4LA2A 5DAPA 4RHV2 4NN0A 5JR7B 1RGSA 1BQPA 1MZ6A 1RUI2 2XJPA 4OULA 4Y4YA 5D21A 1DYKA 2VUJA 3DEMA 3IMMA 4MZUA 4D6RA 1V9U3 1YC61 1VAVA 1NYWA 2VTFA 3VZLA 1HB1A 2RMU2 2B46X 2VC9A 1BYHA 4OMCA 5D8AB 4OI2A 1CZTA 4JKMA 5L9VA 4CA9A 2WDBA 4IE5A 4XFIA 1OUXA 4FI9A 1RUF1 5C6CA 4HVQA 1YIFA 2ARCA 2FQPA 2V5DA 1OA4A 5F6KA 1PMHX 3PUHA 1G9AA 4NMIA 1UD1A 2AACA 3N9PA 5HCAA 2YBSA 1D2QA 2YC4A 1B35B 2NQYA 3M3CA 4UI9L 3T09A 1XXNA 3WNMA 1NCQC 4DPNA 3K46A 2PHUA 3BYWA 1UW8A 2HJIA 2XJUA 1K45A 4YW4A 2A6WA 4NUBA 4AGRA 5EFUA 4CU9A 2UWAA 1QH7A 1SLAA 1J84A 2XKPA 4RQPB 1FOD3 4YW3A 3M4FA 1F8VA 4COWA 1M06G 5FYVA 5K0UB 3ME2A 2P1BA 4BYYA 4CCOA 3I8TA 4OHYA 3RZGA 4ZU5A 5JZGA 1MS3A 3J7MA 2GN7A 1KQRA 4FPLA 3MHZA 2ZHMA 4Q0VA 2R7EB 1DGRN 2W68A 2RDSA 4C0BA 1OD3A 2ZCWA 3E5QA 2CWMA 4COUA 2WQ4A 3ZPYA 3G7DA 2DF7A 4XFFA 3LGRA 1QY4A 3HOBA 4P9IA 3ZDSA 2CDOA 2WRAA 5CKMA 3T2TA 2EAKA 4AAXA 5HCBA 1IPSA 3C7FA 2OVUA 1PGL1 1NXMA 2PXJA 5IHRA 2OA2A 4WM7B 4QQOA 3W9AA 3ZKUA 4AI1A 1CAUB 1PO13 1QQP3 4BB3A 4AHWA 2GSYA 3IIAA 4AG4A 4BQ1A 1IQAA 4R9AA 1PZ9A 5DAXA 2WLQA 4ZPIA 2HWD1 4IL7A 3TNQA 5F3EA 1J3QA 5GZGA 5FYCA 4GWIA 1XB9A 4H7LA 1UU5A 5A3NA 1PGL2 1GNZA 1PVXA 1RUJ1 5FMOL 1XNKA 4Q29A 2K2SA 3RVHA 1CX4A 1UYZA 2SLIA 3POWA 3D8CA 3DUIA 1UYPA 3DKWA 4PQ9A 1PVC1 1Q5OA 2BVBA 4XDQA 2CAVA 5C3RA 2C24A 3FBYA 3OUHA 5DZEA 4PCRA 5D8AC 3A23A 2HWD2 3THPA 5E89A 1XNTA 2DDUA 1OH3A 3KVBA 1TME1 2VCAA 1BK1A 2EIEA 3QACA 3VZOA 4HPKB 3MW4A 4IGQA 2XL7A 3T2OA 5T3NA 5FMBA 3OF1A 1GWMA 2BUKA 3AZYA 3KQ4B 4KWLA 1JOBA 4DZGA 1NY71 5FIXA 1C8M3 2QZ2A 2P3IA 5LBFA 4HN1A 5KR7A 2BDRA 3TN93 2X5IC 3U78A 4AFBA 5BYNA 1YEWA 1LHUA 3PJYA 4RQPC 4LKEA 3HNYM 2O1QA 2D6KA 1W8NA 1HB2A 4HKLA 5EPAA 1ZZ8A 3MDPA 4BQXA 3BU0A 2EIDA 4HOOA 1E5RA 2JD9A 1C5IA 3QH7A 4Q0SA 3LSDA 5K0UC 1QKQA 1NY72 5BNQA 5K8SA 1IS3A 3U11A 1DDLA 2PYTA 1H0BA 2X53S 4AQTA 2WBKA 2HWE1 1YQ2A 4LORA 1ZBE3 3O1UA 1IGOA 1XBFA 4GWJA 1AR81 2P2KA 4Y22B 2W87A 3U75A 5CFDC 3B69A 1HQLA 1JUIA 1FPN3 3A7QA 3N7JA 3PU3A 4DQAA 1AJOA 1WZXA 2WT2A 4WBBA 3VHPA 3CBNA 1RUH1 2V4AA 1F5FA 2X29A 3IDCB 5J3UA 1KS5A 2JWPA 3ABZA 1KXGA 1Y9MA 2XWJB 2AC1A 2FDFA 4XBQA 1AR82 4JGYB 5A33B 4H2AA 3DKQA 5F5CA 5CNAA 3CL1A 4LUMA 5C3OA 3IKWA 3RS6A 4K9SA 5DZFA 1PIV3 2RS33 3WXPA 3I2FA 1LODA 4URTA 3T2PA 2ET7A 3U1XA 1OMIA 4WM7C 1RUH2 4P9LA 1VBA3 1PGW1 2JG9A 1PM7A 4AI2A 3VBSB 2TEPA 1A78A 4CDWB 3CQOA 4Q27A 3B93A 3V65A 4XABA 4A41A 1VMFA 4NRQA 4D7YA 4YGBA 2YDEA 5IVFA 3P3NA 5B4NA 1QJU3 4QKBA 4CYDA 1AX0A 1DQ6A 1QJEA 2D6OX 2VOVA 1UOBA 3E1F1 4UFMA 4AVCA 4D6QA 1PGW2 2RS13 3J7NA 1RUI3 2IVJA 2JG8A 2JKBA 3GF6A 1GICA 4AYUA 1S0JA 3BTYA 3E6DA 3LKJA 1W2OA 3WG1A 3AM2A 3LEKA 1OKQA 2NZ9A 2IXKA 5JI7A 4HVOA 1XYNA 1AL21 1Z7S2 5C4WA 4D7TA 4FFHA 2E51A 4LEJA 3JD73 5A80A 3URFA 1CPNA 3VDDA 1F9KA 5DN2A 3S5QA 4EN8B 4P5YA 4QXKA 1GZTA 5FO9B 1OVSA 5E8AA 3U4SA 4IV3A 1UOGA 2QQNA 4INDA 2WFF1 5IFPA 1G9BA 3VBRB 2XQRA 3SXWA 5C8CA 2D6LX 1POQA 2W1QA 3MFAA 1AL22 1US3A 1W6NB 1MS8A 1XU2A 3R4UA 2EXJA 1H9WA 4A2UA 4YZ1A 1LULA 1QF3A 3KT4A 3N9OA 4KQ7A 2VM9A 5CISA 1O4TA 4QKDA 5A7WB 1LOAA 4E2SA 1VJ2A 1Q43A 4FOQA 1SBDA 3VD3A 1HKDA 1YFUA 1ZNPA 2Q1MA 2VTXJ 1S2BA 4R9CA 4WM8A 3ZFFB 4NIGA 5JVVA 2ADEA 3MF6A 4PDWB 1J59A 3HQRA 2VNVA 3RMYA 2Q1FA 4GZ9A 3TAYA 5E16A 1XOYA 3KHCA 3VBOA 2ENRA 4DUXA 4HL0A 4XJZA 4FPCA 3RJRA 2CU5A 2J1UA 4CUAA 1XE7A 4K6BA 3WDWA 5BNPB 1LHOA 5HXVA 2VOXA 4GMP1 1ZRRA 3WDUA 3BTZA 3PDQA 2P6HA 3PL0A 1CD3G 1I5ZA 2QQMA 2R061 3NSTA 4NHMA 3RQ0A 5AVPA 3DXTA 5I0SA 3I54A 3GYDA 3V64A 1H8TA 5FZKA 2HH9A 3ZX7A 1W04A 4BA6A 1WMEA 1OA3A 5JSOA 1VE0A 5BNNB 1YQ8A 3UYJA 3NNGA 1WLDA 2WLPA 1D4VB 2QQLA 3Q8BA 3EJKA 3EO6A 2VL4A 3PVNA 2NMNA 4GKXA 3S7EA 4HBNA 4XBNA 5FFOC 3OTFA 4PLNA 4N43A 4BWOA 3RYRA 4K1YA 1N3PA 2WA4A 4AF9A 1JZ3A 1BCXA 1CONA 5FPVA 3BUCA 3RFRA 4DB5A 4GQ7A 1ZVFA 4JZRA 4HSLA 1UMZA 2VBDA 3AMPA 4PLOA 1TE1B 2KA3A 4BMEA 3W21A 1FAYA 4A6OA 2VJXA 1WMXA 4L2NA 4CCJA 1GR3A 2PAEA 4O9GA 3P6BA 4UAPA 3VKOA 1Y9QA 3N7LA 4TYSA 2Q8OA 5F6LB 3O1PA 4AHZA 3I2IA 2W08A 1JU3A 1Q8SA 3LA7A 4LBMA 5FZBA 4XACA 3VBRC 1AXYA 2CDPA 3WSOA 4R9BA 3WX5A 1UZYA 3MO4A 2OUJA 5IVJA 2XJRA 2Z69A 4WVMB 2PN5A 4AI3A 1JU4A 1UPSA 4UF0B 5LB6A 4CXWA 3GZEA 2LS6A 3WF1A 4LT5A 2QZ3A 2AGSA 2D93A 4GD4A 4NHKA 3T30A 3LDRA 2EICA 1SDWA 3VN4A 5ACA1 4Q0QA 4YM2A 5FP7A 1JYNA 4RGAA 1HJGA 1LJ7A 2YFZA 1BBT1 1RJ8A 3ZFFC 1ONAA 2MEV3 2ZGUA 4LO4B 4RR3B 3THTA 2H6CA 2HWC1 3ES4A 1H1MA 3V0BB 2Y8KA 3WG3A 1K3IA 1QJY2 1YNAA 1OBNA 2ZX2A 5E6HA 3NAPA 1E57A 1QNWA 3SISA 5ACA2 2FHRA 1G9CA 4MGZE 1CN1A 1KDMA 3ROUA 3B5LB 3ES1A 5H9RA 5FYYA 1D7PM 3WCRA 1OOPB 2YYOA 2HWC2 1FT9A 5FY5A 4HSJA 4FTSA 3MF9A 2VZVA 2ZAHA 4NWVA 1YFXA 1DIWA 5FZOB 1DLCA 2Y6JA 1LOBA 4QPGA 1W6PB 1LESA 1YQ5A 2QKDA 2WNUA 3N7MA 3MUZ1 5BNNC 1ZRFA 1PK6B 1ZA4A 1MEC1 2ILMA 4WVWA 3S57A 5DUVA 3WNLA 5AC91 2G4IA 4Y33A 1O4YA 4XW3A 2BGCA 3LEIA 3OSDA 3GJBA 2J1VA 3VKLA 3PURA 3H8RA 1JN2P 4AEJA 1UZWA 4ARYA 2C26A 2P4EA 4QHOA 5F1RA 3PVBB 3B7MA 2UYAA 1W8UA 3FHIB 3NL1A 5I8TA 4NIHA 4GB32 4XILA 2C1FA 4XF0A 5AC92 1IKPA 1KEXA 2PELA 1CIWA 2ET1A 3NO8A 2VULA 1Z7S3 4YW6A 5FQ0A 1URXA 2A3XA 2E6VA 2BVVA 4OCTA 4QKNA 4CEWA 5JXIA 4XF4A 4UWDA 2BW8A 3I2GA 1I9RA 4CRQA 5LRSA 3ZVXA 1S1AA 1H4GA 1VAMA 5ERLA 3RGBA 4CCCA 4X6QB 5T55A 1EAH2 1RL3A 1O5UA 3HWJA 2C0ZA 2XR4A 3BB6A 4JHZA 4LO6B 4NVPA 1FATA 1H1IA 2Q8EA 1G9FA 3WNPA 4AI8A 3LOIA 1NCRA 2VQUA 4CCLA 1E5SA 3ALQA 1AR72 2R073 2W91A 2OQ7A 2WWSA 5FKBA 3WP6A 4ES9A 5KHGA 3MI8A 4Q4W3 3LA2A 2B45X 2UURA 4P9WA 5FPAA 4FCAA 1UX6A 3OY8A 1JH5A 2A3WA 4CDUA 1SBFA 4RR3C 3F95A 1RUOA 2RJLA 4ZY9A 1RHI3 4ASMB 4MOAA 2CGNA 1IG3A 2DVBA 5LATA 3B00A 5FXVA 5FY4A 1FNYA 4A4AA 5C3PA 1RC6A 3EB7A 3FMGA 3JBG2 3R0RA 1R64A 5I0TA 3U0ZA 1WLCA 5IFTA 3V0AA 1OOPC 4CXYA 3F2ZA 4RD7A 3VZJA 3P1IA 4OMDA 1ZYBA 1WCDJ 3WNNA 4F3JA 5CFCA 2PHRA 2JD4A 2XKOA 1NA1A 1AVBA 1NQDA 3NV1A 2YPJA 5IT6A 1VBB3 3BODA 2YFUA 3TB0A 4MO3M 1C5HA 5J36A 3LZZA 4Q1RA 2ARXA 4IEYA 2B9UA 2ZHKA 2JICA 3K3OA 3NJYA 3RI8A 2VVFA 2BZDA 4FBFA 1XNDA 1W8OA 3ZXJA 2B42B 2C9KA 4W8JA 3LOBA 2NYYA 5G04L 3ZXGA 3DN7A 4C1WA 4B4RA 4BK5A 2XWBB 3FFZA 1AUYA 1ENQA 1YQCA 5C9AA 3H0OA 2R0FA 2C6SA 1UZ0A 3HAGA 3OCPA 4KBBA 3VB9A 2ORZA 3PTRB 2UYBA 1QNYA 5KXEA 5IK8A 2JJ6A 4LO8A 1UXXX 1CQ9A 2GC1A 3ZR6A 4PBOA 4KH9A 1ENSA 3HN3A 3LIGA 5CU1A 1LCLA 2KD7A 3TEZA 2P6CA 3OGJA 3RSJA 1ND2B 2ZMLA 2AEZA 2VZQA 1CJDA 1VLNA 3ZFEB 5A3UA 1W9SA 3FZ3A 4EYUA 3AP4A 2W3JA 1HXS3 1QDCA 2KM2A 2ZGLA 3FL7A 2LW8A 4LHLA 4XIKA 2XBO1 4W50A 1NOVA 4YW2A 1N1SA 1WMDA 4WZCA 2VZSA 4YSFA 2WT0A 2VZPA 3WVJA 3POGA 2VQTA 4YW5A 1EP0A 2W47A 2YC2A 4C1XA 2IXCA 2TNFA 2XHKA 1HX6A 2FD8A 4YVWA 3R4SA 5KXCA 2XBO2 1NQJA 4Y3OA 2O8QA 3SMHA 2P3YA 4AGVA 1OF3A 4AGGA 2IXJA 4FAGA 4RS5A 4D0QA 2I2SA 3RZJA 1OH4A 2VQAA 1XYOA 5LBEA 1FMD3 1HRV3 1CAWB 2D5FA 1G6NA 1RMU1 1RVF1 1W03A 2VGDA 2R49A 3AKPA 4NAMA 4Y5TA 4TTGA 2ORXA 5FRAA 2UY9A 3CJIA 4CP1A 5CG8A 1ENXA 4KWUA 2RS52 1XSRA 2QQIA 5FZFA 1RUE1 1V70A 2ATFA 5DUXA 3ELNA 4I01A 4DIQA 3N9MA 2I07B 3N9NA 5I0DA 2JXAA 5EHDA 2WKKA 4XZUG 3LPFA 1RVF2 5JZGC 3AXDA 2VECA 2WS91 3IPVB 4UW4A 4M4RA 5FYMA 3OUIA 3VHOA 2WSVA 2G1MA 1WW5A 2ZMNA 5FZLA 1H30A 3TWIA 5FO8B 1STMA 1LGNA 5A1AA 3FN9A 1POV0 5FZCA 3RPQA 4CDXB 2UWBA 4S2HA 1O7FA 2G9GA 3D3AA 3O5SA 4GIQA 5FMDA 4DOUA 3H1YA 4ITCA 5IK4A 1R1A3 3RJ2X 1CAVB 2A71A 2JEMA 2RDQA 2MNGA 2WS92 3WUCA 4Q26A 2BBAA 1JZ6A 1W6QA 1RUC1 2WO7A 1GFF2 1EV13 4H14A 2ZEWA 3ITQA 1NZIA 1H6XA 1JYXA 1LOGA 3I59B 3L2YA 4BE3A 5CKQA 4E9KA 4JQTA 3RZHA 1OUSA 5LY1A 3PHMA 2AR6A 3PUAA 4E4HA 2E53A 4B1LA 5F37A 2BFUL 3VBFA 1CESA 2X09A 5FREA 2JG9B 1RUC2 1CZSA 5GJ6A 2JDHA 4MXVA 5A7OA 2VMHA 2HEYF 4CDQA 4JKLA 2OPWA 4BZ4A 1W0NA 1UPIA 1S0GA 2OIIA 4ZU4A 1FX5A 5SV8A 3ZFEC 2XVGA 5FUPA 4AEDB 1H4HA 1AR73 3WF4A 4Q4X1 1VMHA 2JIJA 3KGZA 3SKJE 3O1TA 1UU4A 4E4DX 3WNKA 3L9JT 3OBTA 2JG8B 3VKMA 5JOYA 1G7YA 1ACCA 2RDRA 5FPXA 1DU3D 1WCSA 3J7HA 2PHTA 2D3RA 5JSPA 4IGOA 1CAXA 1O4ZA 3LDKA 4DY5A 2IXIA 4DFSA 3AMQA 4Q4X2 1W8WA 1YYNA 2ZAAA 4Y1YA 5FK8A 1K5MA 1EUUA 2BNOA 2BU9A 3B9CA 4Q1PA 5A3PA 3USUA 1RITA 1OA2A 4YGEA 3TOJA 3AL5A 1NUKA 2WO1A 3AVRA 2PTMA 4LIUA 1Q8PA 4M3CA 3JBG3 2DTWA 4LBQA 1OD5A 2A5ZA 1D4M1 4Q0PA 1OSGA 4UXAA 3VL9A 3APBA 3ZFGA 2FBEA 3LFIA 1PHMA 3UETA 3ZIXA 3LPGA 4JGZA 5C8CB 1ZBE1 2P3KA 2D6PA 1F15A 2BEOA 2WA3A 1SEFA 3ILFA 3IWZA 3J26N 3OYWA 4RFT0 2FDKA 4KG8A 5A6XA 3NNLA 1C8NA 4B1MA 2Q0AA 1KJRA 4QD2A 4JDNA 1U5XA 4XDOA 1UQXA 2PHFA 4TXWA 4JDOA 5KXBA 2JB8A 5F8PA 4NRMA 1QJX2 2CSGA 3K4AA 5EXOA 4QKFA 4XTMA 5L19A 4EWEA 1SPPB 4L0PA 1K5JA 4CCMA 1VR3A 3J8F3 4L9BA 1YHFA 3D0JA 5FY8A 2E7AA 2D6MA 3S30A 1M4WA 5ISLA 2LRPA 3FJSA 4FFFA 2WABA 3WW2A 1UWWA 4S2DA 1V6NA 5GZDA 5CADA 2RVAA 3KT1A 4LBOA 4TWTA 5GLUA 1RYYA 3ACGA 1Q8QA 1SLLA 2EIGA 1GOHA 2GMMA 3OGSA 1YFWA 1PO21 4XJAA 3TEXA 1VBD1 3IZOA 3K51A 4XIOA 4BK4A 2VMGA 1GOFA 4FO9A 3CKHA 4IETA 4QPYA 3O7OA 2BWAA 2JG9C 3UKTA 3WF2A 1H8TB 5C7GA 2RS11 2B7YA 1G86A 2PLV1 2WNVA 4ZXKA 4CTEA 3Q8AA 3ZPOA 3DYMA 4LJHA 4UFJA 4X6RB 4DY3A 4GH4B 1GV9A 1PO22 3CZUA 4XZPA 4AEDC 1FI2A 1I6XA 1TEIA 1WCKA 2HBUA 4CSWA 3KMHA 4UFIA 1ND3A 4ZONA 4KNCA 2ZHNA 4OI4A 1VBC3 2Z4FA 2D44A 4QB2A 4Y20A 5KC5A 2XJTA 2X5IB 2JG8C 5DAWA 1OPMA 4HONA 4EWAA 2QDRA 4AI9A 3Q8EA 4NRPA 5FY0A 5CKNA 1RUF2 3SH5A 1BVP1 4YM0A 3VKNA 1HV1A 1HN1A 2ZX3A 2Q4SA 4G9SB 3ZXLA 5C4WC 1R083 4HKOA 3IDAA 2D7FA 4XF3A 1NZCA 3VDDC 2ZPXA 4N9HA 2VZ3A 4NPMA 5I8SA 3AJYA 3VBHA 3S0MA 1X50A 3CEWA 1A3KA 1MR5A 2JB4A 1LKNA 5CFDB 5C8CC 3VDCA 3OGRA 3BALA 3VD9A 3M3OA 1V6KA 5IJRA 2VZ1A 3FHQA 4QPIB 2EALA 3ZN5A 3T3YA 5FLIA 4XVHA 4N53B 2RM23 4OUEA 1DF0A 2YHJA 3O0VA 4BM8A 3MLJA 4XMIA 4PF1A 1TMF1 2BERA 5BPXA 4IXLA 3UT0A 1BEV1 4OLLA 4Z92B 2A75A 4GULA 1AR61 5FLJA 1GP4A 2W0XA 1IQDC 3AMMA 3HR9A 3IT8A 5FMOS 5ABJA 2VUDA 2IFRA 3ZXEA 2E63A 2PA7A 1DQ2A 4UBHA 3O1SA 3OGGA 4Z2WA 2LROA 2HWB3 3NAPB 3NV2A 5FZ7A 2A6ZA 4TLGA 3CJXA 3BPZA 4MGSA 5FUNA 4DEQA 5IW0A 4MGTA 3G6JB 3RYPA 3VZKA 2AREA 4FP2A 1RUD1 2F17A 5FBJA 4ZZ8A 1XYPA 1HIXA 1W3XA 2DVGA 3WINE 3M2MA 5HXMA 1VB4A 3KB5A 5A3WA 2V4VA 1H8TC 2VH9A 3VZMA 4QQ2A 4RN5A 4QU2A 2WL1A 4GH4C 1RUJ2 3ZYHA 3KCYA 2ZEXA 2D43A 1RUD2 4P9XA 1NT0A 1RXGA 2ARBA 4LNVA 5IAVA 5B2GB 5LA2A 3UGFA 4N43C 3WQBA 1HQNA 1ASJ1 1PVC2 4LBQD 4EROA 4EN6B 1NLRA 2VMEA 4E2QA 5HV4A 1I5PA 1GZWA 2RJKA 1VALA 3HBZA 4ISQA 3UGHA 3KM5A 1JBCA 2ZGPA 4IEOA 3LA3A 1TME2 4EV0A 1YFYA 2B39A 4CP0A 4FPOB 2ZGRA 4LR4A 1FYUA 4BISA 2RHPA 4KU7A 1XPWA 4D94A 4P14A 1ASJ2 4P00B 1LECA 4AWDA 5K7PA 3HQXA 5FQ0B 1C1FA 4FP3A 2WZR1 1W8ZA 3HMYA 4A3XA 3AX4A 2OUHA 2DCJA 4E4ZA 3V56A 1YRZA 4GWNA 2A73B 3EBRA 3GBWA 5BY5A 2BWCA 5A32A 5KHHA 1SLBA 1MQTA 4MX3A 1GOGA 1GYKA 4QPIC 4QX7A 4YARA 1HRI1 3AC0A 5FV3A 2DU0A 3JB8A 4HANA 1NCRB 4N53C 2HWE2 5A3OA 3I97A 1UYXA 3RI9A 2Y6HA 3J4UH 3I2HA 3OJBA 3HBKA 2GDFA 3M3QA 1EPZA 4DO0A 2EXIA 1GKBA 2QQKA 3EYPA 2Y60A 2ZS6B 3L2HA 1HRI2 4CDUB 2WZEA 3HN1A 1QXRA 1AHSA 4IEWA 3RWNA 5LA9A 5LEKA 4AL9A 5J37A 2I74A 1AR93 3AKRA 1TVGA 1VBE3 3AKSA 4Q4Y1 1HLCA 4U2AA 3ZYBA 3NAPC 1OLMA 4CP2A 3DPRA 3RZKA 4W6YA 4SLIA 5LY2A 3SCFA 4PIZA 4RHV3 2ZGTA 1W8TA 4LLFA 3NNMA 4Q4Y2 4YZ3A 1WMFA 1O91A 1XSQA 3GNEA 5LBBA 3M1HA 2YY1A 1PZ7A 3ORJA 4XC9A 4CUGA 2D98A 2RMU3 2L9LA 3POBA 5HBAA 2A6VA 2HKXA 5GZFA 4EQVA 1ZM1A 3A21A 4L8QA 5DUUA 3WV6A 3H8UA 4ZHNA 1WKYA 3W20A 3E6BA 4CCKA 3B02A 1R1ZA 2B4KA 4XQ4A 3NWKA 2XXZA 2LM3A 5FMCA 3SH4A 3VKFC 3PJQA 4KI5M 4HK9A 3HIFA 1LEDA 4EZ4A 1NAEA 2C9AA 2PHDA 4OHVA 3ZYRA 1XE0A 4LTAA 3O1RA 4QXHA 5FJHA 5IAXA 4JRAA 1RUF3 5C9AB 2XLGA 3THCA 1O5LA 3RZZA 1ULDA 2QQJA 2Z5WA 1W39A 5J96B 3I3EA 3HD8B 4DRVA 3WP4A 4CEWC 1JZ4A 1JHNA 2WFF2 1UF2C 4ASKA 2PQSA 5JR2A 3WZ1A 1H2LA 1MS0A 3HNMA 3I4IA 4P08A 1ZX5A 1ZBA1 2D97A 2VZTA 4JTNA 5A6QA 2BGOA 3I3QA 1E5HA 4GAZA 1ZZ6A 5GZCA 1NCRC 5EZWA 1AYN1 2OX0A 1ST8A 5F5AA 4FPHA 5LWBA 5LZ6A 1W6MB 2XLFA 1UOFA 1JI6A 3D82A 1YJKA 1UO9A 2FZ1A 2WNEA 1HDKA 4Z07A 4YFZA 1ZBA2 3N35A 2VD7A 3ZN6B 4YW7A 3T1MA 1UCXA 1Q56A 3K2OA 1J3RA 4CDUC 2F4PA 3MIHA 1V6IA 1AYN2 3LCPA 1IG0A 1RTVA 4JV4A 5H9PA 3D6EA 4E2GA 5EJ1B 3VLBB 4YVWB 1W06A 2GMPA 4CP9B 4URAA 2Y6LA 3W59A 2B8MA 3ZO0B 4TSVA 2R062 1X9PA 1PM4A 3BTAA 2VOWA 2VBBA 4XPVA 1QWRA 4GALA 2ES3A 2RR11 4MH0E 4A7YA 5CFCC 5L9BA 3CJIB 3HNBM 5ANNA 2X10A 5A7PA 1GLHA 3MW2A 3KZ4C 1SFNA 4OYUA 1F4AA 1PMJX 4WVZA 5IK5A 3BKZA 1P8JA 4XXPA 2E33A 3BOWA 5F5IA 1VAKA 4I09A 3MUY1 2HWD3 4L11A 4KBZA 1V6JA 2W1WA 2YGMA 5D8AA 3KWVA 1LOCA 4NHYA 3S7IA 1PX3A 2RR12 3WW3A 4O7XA 5CEHA 2Y34A 3LEMA 2DVAA 4PBPA 2DVDA 2QQVA 4CEYB 1MVEA 1IS4A 4XF1A 4N7IA 1YWKA 1SG3A 3R05A 5C5TA 1PVC3 4LBKA 4CU6A 1A34A 1B35A 2YUEA 1POV1 1PX4A 2ZGKA 5BNPA 2DWRA 1W9WA 5CAZA 2SBAA 3K77A 1TME3 4AFAA 2BJSA 3ZM8A 5C9AC 2RJ2A 4RQPA 1CPMA 5C3SA 2VCMA 4YPJA 4MGIE 5JOWA 4EWDA 4B8EA 1SZBA 3AP9A 1N1VA 2LALA 1EPWA 1Y3TA 3HEIA 3P3PA 1GP6A 4XJWA 4MSVA 5DZGA 1YCIA 1JYVA 2YU1A 1Y9GA 3IB3A 4EE2A 1JZ2A 2WR9A 3Q8FA 1PGSA 2GN3A 3VBFB 4DINB 3OBZA 3BIWE 4YLZA 5L7OB 3THDA 3EMRA 1NLSA 4QX5A 1WA6X 3LB9A 5J7MA 2XB6C 5TSWA 4K7JA 3DYOA 2HWE3 1X8MA 4COYA 1TZOA 3VBUB 1BBT2 3GBGA 4K1ZA 4Q0UA 1VB2A 1AR83 5FYHA 2EVXA 3NJVA 4I30A 3EHKA 1N1TA 2AYHA 3H42B 4KU8A 5FTTC 1DYPA 4YZ5A 4LHNA 3S6PA 2ARAA 5FZ9A 4CU8A 1OQDA 1W2UA 5F32A 1CAXB 4YVWC 1RUH3 3VZNA 5FY9A 3OD4A 4A3ZA 4CCDA 5FLHA 5C70A 5FPLA 4K40A 1CAUA 5FYSA 3ZMNA 1X82A 1ZZ9A 2FDJA 5FYIA 4N9IA 1LNSA 1RUG1 1ZZCA 5DDJ1 4RS5C 4K21A 1W28A 2A6XA 1DGWA 1OFSA 2Y6FA 4LLOA 4M3CB 4BQ5A 4L99A 3QH6A 4Y1VA 4C8DA 4Q4V1 2J1RA 1Y4WA 4I3GA 4XHXA 1COV1 1LR5A 1WCQA 3CJIC 3X29B 2UWCA 3PIJA 4NIIA 1C4RA 2FCVA 3MV11 5T5OA 3OYWB 2J22A 4HVRA 1H2NA 4XFCA 1G9DA 1RUG2 1MEC2 1U5YA 2CHHA 2RG4A 3AZZA 1XNBA 4QQHA 1S2KA 1R1A1 1TNRA 2ZGQA 3VUOA 1ALYA 3VV1A 1FV2A 4Q4V2 1VRH1 5LBCA 1J1TA 1COV2 3A22A 3D5OA 4HPKA 2DUOA 2ZGOA 4QDRA 2ZBJA 4CEYC 4OFGA 1AL0G 2R041 2JX9A 4UYBA 1DGLA 4OHWA 2K0GA 2YROA 3MV01 4MYEA 4AR2A 1CIYA 4PT6A 3GJAA 2DCTA 3IDBB 3EQEA 3K48A 4XE9A 3TEYA 1REEA 2VBPA 4FVVA 4FXGB 4JVAA 3WQ1A 1VRH2 1AL23 2VG9A 2XMLA 5JCTA 5T52A 5A3TA 2R0HA 4QDQA 3QOPA 5FCCA 4HFSA 4XJUA 3H3UA 4EN9B 3VDBA 4N90A 1LB2A 4Q2FA 4OQ9A 1BHGA 1QJFA 2HWF1 4W6WA 3T0BA 1UZVA 1NLQA 3VBFC 3VDAA 2WFF3 4XAEA 4XJ9A 3WF3A 5L7OC 4Y22A 2LUWA 1ODNA 3FWEA 1KITA 3QBQA 2FMDA 4ZS2A 4CUBA 1DHKB 4AVVA 2GMEA 4UT5A 5I91A 1IPKA 2QQWA 1DZQA 2YBKA 3NV3A 3UGGA 4JQRA 3TNPB 1H2KA 2WUHA 4FQZA 3VBUC 1SQ4A 2JKXA 5C33A 5CG9A 1ND3B 1WUVA 3N36A 4O9EA 5F3CA 3I3DA 4JGYA 5A33A 3TEWA 4DRRA 3WY6A 5D2AA 3N9QA 4Q8KA 2J7MA 4GWMA 3KS7A 4UW6A 4J1XA 1OQEA 5F3GA 2R32A 5KHJA 4EJRA 3VBSA 4CDWA 4M3CE 4D6SA 4DXTA 3AYEA 4GJZA 5JI9A 4GMP3 5JZGB 3MIDA 5BXXA 5I93A 3FUOA 3C7GA 4QX1A 1IPJA 2XG3A 5BUVA 3RG0A 3T0DA 1JW6A 2IXLA 4D69A 1UIJA 3WHTA 4ZXEA 2X05A 1R091 1H8VA 3EXUA 1Q3EA 5EV7A 4AZZA 4CCNA 1JODA 1OPOA 1WW4A 2BGPA 4LQRA 5T5PA 1O3RA 3H8XA 2VCCA 3AZWA 4XHBA 3J8F1 3NNJA 2QJVA 3WQ0A 2Q30A 3VD4A 1UY2A 3ILNA 2ZA9A 1DQ5A 5FAXA 4F7ZA 2NP0A 4LBLA 3WCSA 3FLTA 4S2FA 1W8HA 4JHTA 3H3ZA 4LULA 4N8MA 5JMCA 2BNNA 3CO2A 1R092 3A0KA 3WP3A 1O8SA 2VO5A 1AYM1 3WP5A 5KC6A 4YG0A 3TRSB 4ES8A 2W95A 3KV6A 1U12A 2J1TA 5GALA 1F2NA 2HYXA 3OGVA 4OZOA 3MBWA 3M3EA 1L3JA 2IVIB 1VRBA 2IWGB 2UY8A 2BOIA 4PI2A 3GHNA 5FOJB 4FSJA 5A6ZA 1CR7A 1V9U1 3WQ7A 3FX3A 4QHZA 4V1PA 3AZXA 4IEQA 4G4FA 1T2XA 3UESA 4ZU7A 1QHDA 5CB7A 1HB3A 5FUIA 3ZN4A 3KSCA 4LIVA 4FPFA 2VZRA 3O1OA 1S2EA 1IS5A 1SLIA 4RYDA 1VIWB 3AB0A 2JECA 1AJKA 5T54A 5A7WA 2QBXA 2A1XA 3FLRA 4H3WA 1SMVA 3N9LA 5FP3A 1V9U2 1CZVA 4QGNA 2J1AA 2YC0A 4FFIA 4S2GA 3WG4A 4HKWA 4AE2A 5IVBA 2WSUA 1W6OA 1SBEA 2GZWA 3ZSLA 4PDWA 3CF6E 3WDTA 3POYA 1RIRA 1FOD1 4HZFA 4QM8A 4EN0A 1QJY3 4DXRA 5ACA3 1ND3C 1LGBA 4A7ZA 5H9QA 2FZ2A 1UKGA 4KL1A 2JDUA 5FYTA 3LEGA 1BBT3 1X36A 4CCEA 2QFEA 2VTXA 3DECA 1ULPA 3LDBA 2P3JA 4IEXA 4XFHA 2CV6A 3SEPA 2J1EA 2ZZQA 4NHXA 3CU7A 2HWC3 1MS9A 5FZ4A 4HXCA 1FOD2 1LRHA 4Y26A 2BTVC 3S5AA 3ZLIA 2XPJA 1W2NA 4Y1UA 5E1RA 4DS0A 2QQUA 2YV8A 3AVSA 5A6YA 1RMU2 5JMOA 1OHFA 1JZ8A 5BNNA 3IIIA 1QDOA 2RM21 3PVEA 4NPLA 3SNMA 1HB4A 2GC2A 2BPA2 4P9JA 4MG2A 3B94A 1RUE2 1YLLA 3LWCA 4IE0A 5A32B 4P5HA 5FZEA 2WQZC 5FZGA 4NWWA 3CHXA 5EYXA 2YU2A 5JUVA 2BFUS 2WYSA 4W65A 3N3HA 2ZX4A 1JTZX 1GUIA 5HCFA 1OQ1A 4HN0A 3BVCA 4DMIA 1PO11 1QQP1 2BNMA 4GB33 5AC93 5FP4A 3UKNA 4QX2A 5FXXA 3IMNA 1ZZBA 4NIAA 4Y1ZA 3H7JA 3RZLA 5AVAA 4DEVA 1O59A 3WHUA 2ZMKA 5ABJC 3C3VA 2TUNA 2DBIA 5T5LA 2XJVA 3I2KA 3PVOA 3A0NA 3LIHA 3BU7A 3DF0A 1EAH3 4PI0A 4QB1A 5JPMB 1D0GA 1PO12 1QQP2 1YI9A 1F31A 1QEXA 4PIYA 1AZDA 2ID4A 5IUQA 2EAAA 4XUTA 3NJXA 4HT1T 4LPLA 4WVMA 1LENA 5FK7A 4UF0A 1JOJA 2JDPA 2XQXA 4XURA 4CE8A 3O12A 3WW4A 4YFWA 4UFLA 4GXLA 1EUTA 3KQRA 4NR1A 1RJ7A 2JDNA 1C8M1 3Q9OA 4LKDA 1JYWA 3TN91 3GXUA 4FOYA 1SFPA 4RR3A 3CMGA 3K4DA 4IE7A 3AMNA 3WG2A 5C4WB 1F5JA 2IZWA 3V0BA 1QOSA 3VDDB 3KF3A 4FPKA 4BDVB 1C8M2 3UV9A 4ET7A 3TN92 4IV3B 4AFDA 2LTNA 2C5DA 3WD5A 5C5UA 3O1VA 3RDIA 3ZIWA 4HK8A 2WQ8A 4AEMA 1BJQA 4XTPA 3E5UA 3SITA 1FPN1 1D0HA 2PHXA 5J09A 2Z2SB 4YG6A 3CDZB 4YM1A 2WWJA 1OVPA 1D4M2 2ZGNA 2EF6A 2QUOA 3AL6A 3IN9A 4M0NA 4Y1XA 1PK6A 2WC2A 1VPHA 4IDZA 4I2OA 3QLQA 3W58A 1ZBE2 3ZYPA 1RUNA 1DZTA 4MGYE 1W3VA 1W90A 1YXWA 3SCGA 4WM8B 1WW6A 3ZXFA 2V73A 1WBLA 1SDDB 1FPN2 2BOJA 4ISRA 4B7KA 1PIV1 3ZSEA 4OUSA 2RS31 2X8KA 1BKZA 3AKQA 5K9YA 1LAJA 2Y38A 2JDAA 1GSLA 1VBA1 3VBOB 3LF7A 3M8LA 4Y5Z0 1DQ4A 1IHMA 1MS1A 1U5ZA 4R4XA 4A44A 5K4LA 4MLOA 2FDGA 3AYDA 4EN7B 5FZHA 3JCIA 2W9XA 1ENRA 3B01A 4QMAA 4LHSA 1OKOA 2R6QA 1NE6A 2RS32 2XOMA 1QJU1 3GDBA 3JXSA 3NMBA 5IVCA 2Y0IA 4MHRA 2K9ZA 1GMMA 3KHBA 2IXHA 1W0PA 2J42A 1OLME 1VBA2 2RDNA 5FPUA 2Y6KA 3BIEA 1PNFA 1IKQA 1RUI1 2QTWB 3UJOA 2P37A 4LO5B 1KRIA 1DQ1A 5M0TA 2OYZA 3DPRC 4DUWA 1HV0A 1S55A 1VBD2 1Z0HA 5DQ0A 4Y4RA 1MACA 1C3HA 1S0CA 3O0XA 4N43B 1V6LA 2CNAA 2OZJA 4NPRA 1WGPA 1A6CA 3JD71 4IV1A 2Y33A 2RS12 1AX1A 5FJKA 2PLV2 3TBDA 4OHZA 5FOBB 1V0AA 2ADDA 5FDBA 1WA4A 2ZACA 2R1DA 2E9QA 2BYVE 5JOXA 2YB7A 2A3YA 3MEPA 4YG3A 2J1SA 3PUSA 1LEMA 2AEYA 3OOXA 1UMIA 2WO3A 4LUKA 5J98B 3FBMA 4K8FA 4Q5OA 2CYFA 3JD72 3MW3A 2XBO3 1KFUL 1OLRA 3ZKYA 4CZSA 1MS5A 2XDVA 3FLPA 2F4LA 1L7LA 2A70A 2VUCA 2DURA 1X9TA 1DGWX 3K75B 3OEAA 1WLTA 4IV3C 4M4PA 2GAUA 4XF9A 2PAKA 2ZOEB 3T2QA 3OG2A 4D3WA 2E7QA 2W1UA 2Q8CA 3SH3A 1LHWA 2E32A 4PQQA 2RS53 1WD4A 2N7GA 4YW1A 1UAIA 3ZSMA 4BIFA 3SCHA 1LHVA 1MPXA 2XJQA 2V5YA 5FZ6A 3H3LA 3T4HB 3I7DA 3ILRA 1AX2A 2W5FA 2V72A 5FZAA 2NLRA 1RVF3 2OS2A 2YG0A 1RMU3 4NHLA 3ZOIA 3A4UA 5CBLA 1I3HA 5EWSA 4WM8C 1JMUB 3K4ZA 4J1WA 2BRTA 4A42A 1RUE3 5BNOA 2VW0A 4UFKA 2YPDA 1KS4A 2EXKA 1UKRA 2YZ4A 3SQOA 4KWJA 1TMF2 3M3IA 3VBOC 5DPNA 2WIIB 4SBVA 2VOTA 1A8MA 1BEV2 2VNGA 2WS93 3VHRA 1GZCA 4QGMA 1BXHA 2W52A 1AR62 5DMYA 3O1MA 2GNBA 4TZDA 4XUPA 1Q8VA 4Y5SA 2VQ0A 5JPNB 1V6MA 1J58A 2XH6A 4WV8A 3DL3A 4A7KA 3OPZA 3WEZA 2B9VA 2PAMA 3M7AA 3M70A 3WOGA 4QPGB 1JXNA 4RGGA 1RUC3 4KMQA 2WNUB 2HBTA 3BN6A 1S0IA 2OW4A 5F3IA 2Y0OA 2VUAA 4BCUA 2DTYA 2VZOA 1ND2A 5JIAA 4I0BA 3ZFEA 5KBFA 4JDMA 2JDKA 1D2SA 3B9IA 4YVSA 2Q8DA 5F5QA 1H9PA 5FZMA 3U07A 4RGKA 5FP8A 1OC1A 5F7UA 3H50A 3GM8A 2W46A 4MADA 4Q4X3 2VU9A 1UN1A 4XCAA 5J1XA 4LK6A 1W0OA 5DUWA 4B4PA 5A3MA 4U36A 2GU9A 3N4MA 5L73A 4XUNA 5I0UA 4CEWB 5GZEA 1W05A 4XYXA 3DYPA 3SHRA 4C90A 4RL7A 4P02B 1B35C 4LKSA 5FPZA 4E8CA 4F83A 5BNPC 4XFGA 1CAWA 1MZFA 3ETPA 1AXKA 2DCKA 2JIGA 1J1LA 2E7TA 4IEUA 1KJLA 4K8RB 5C71A 3BTXA 2ZTNA 2FCTA 2ZKLA 4I0WB 2MEV1 3HQUA 2WZR2 4J6GA 1KGYA 1UY3A 4XEZA 5JAXA 2FMYA 2QVSB 2XONA 2VZUA 2RE9A 4AI0A 1CWPA 4QPWA 1D4M3 3B3QE 3GZAA 4H7MA 4FTEA 1AXZA 4GA9A 1DFQA 3IPVA 1WCUA 1QJX3 3WDXA 1NX9A 3OY8B 3H1WA 2PQQA 4WZFA 3AP7A 3RRDA 3UK9A 2MEV2 3W5MA 3NVCA 1OFNA 4D7SA 4CDXA 4CVUA 1W8FA 1XC6A 2NN8A 2ZGSA 1LOFA 1FNZA 2DU1A 1CAVA 5IK7A 4XUOA 4LE4A 4YYOA 4NAOA 1ULCA 4ATFA 1IOAA 1XNAA 5LEJA 4MVTA 3ACIA 4QGLA 1UU6A 2VVEA 4C91A 4QWNA 3IDEA 1S4CA 2QDNA 4JRLA 1LGCA 3I59A 2CAUA 3V0AB 4MXWA 5CFCB 4LBNA 5F9TA 4CUCA 4NOTA 4BXFA 3KVAA 4I02A 1UMHA 1TG7A 1NA1B 2PHWA 1CVNA 4QPGC 1W9YA 1GU3A 5G05L 4E8DA 4AVTA 1SLCA 2WNUC 1RB8G 1RINA 2VNOA 2VMDA 2ZEYA 1K42A 4Z8BA 2XLAA 1PO23 5A1FA 5LK7B 1G8WA 5DG2A 1VBD3 4AXOA 4AEKA 1KD7A 4XAAA 4NE9A 3H9AA 4AEDA 1MS4A 1GWKA 1ZA7A 1Z7S1 4CPBA 4HETA 5D1IA 2HEVF 3ON7A 4ORFA 4HMZA 3VL8A 3KT7A 4FOWA 4AQ6A 2ERFA 2YGLA 2PLV3 1NCQA 5FPBA 4OI1A 4AQSA 3FUQA 3LFMA 3OEBA 4CU7A 2XGXA 5JDBA 4XCBA 2VW2A 2R16A 5KXDA 2W92A 2KR2A 1HN0A 5LCWL 3SKVA 2ZX0A 4M01A 5FBZA 3ZSKA 4D8MA 1DP0A 3AYCA 1C28A 3Q8CA 4FOVA 4TLFA 4AFMA 5IWFA 1ZREA 2R071 2XVKA 4B29A 4XFAA 4UW5A 3PUIA 1O3QA 1WWYA 3NW4A 5FYBA 4Q4W1 3WNOA 2FDHA 1CJPA 1GNHA 3ACFA 3HVDA 4QDSA 2QQPA 5HV0A 1GQHA 5E88A 5IVEA 4G3YC 4BU2A 1LU1A 5KHIA 1FV3A 3AJZA 3PUQA 2DFCA 4NJ4A 4WVVA 4Y24A 1RHI1 1MZEA 3DGTA 2R072 2CL2A 1Y7BA 3CZJA 5FYZA 3KV9A 4E27A 4XUQA 2D6NA 4Q4W2
chains in the Genus database with same CATH topology
1BZWA 4LE3A 3WLUA 4Z1VA 3SLIA 1V6OA 2IFWA 2VPVA 1RHI2 1W6OB 1Z78A 4MUVA 3RYKA 4AVAA 4FPGA 1HQWA 3OBRA 1TMF3 4B7EA 4ASLA 1BEV3 1VBB1 4RS5B 1OI6A 3E5XA 4JGYC 1APNA 1NG0A 1AR63 4META 3LSEA 1BVVA 3CNAA 3ZXKA 2NPIA 1V00A 3VGIA 1NA1C 5BV6A 2OPKA 3GALA 5J48A 3FE5A 3VBSC 3WW1A 5A3LA 1VBB2 4CDWC 1S0DA 1RUJ3 4GH4A 1RUD3 4HLTA 2XJSA 2AH2A 1WW7A 2X5IA 4QT6A 3MIEA 2ZABA 5FO7B 5JIUA 4OZXA 2KXLA 3AFGA 4BOWA 1J3PA 2A7AA 4YRDA 1W6QB 3WUDA 2QE3A 4KGGA 5C8WA 5K0UA 1ASJ3 4KG0A 3E97A 1Y43B 1IZ3A 1S0BA 4XQWA 4PLMA 2R30A 1HXS1 1Q8OA 4L92A 1MVQA 5GM0A 5CFDA 4CDQB 2DUQA 4QPIA 5LK5A 2DFBA 2WZR3 4N53A 2JENA 3JU9A 3KCXA 3O0WA 5I0RA 1HXS2 1YJLA 4I0AA 4KGQA 3QD6A 4COVA 1QJY1 1LU2A 2PHLA 3TYJA 3RNSA 4BMBA 5JOZA 3U4XA 1HRI3 2CGOA 3ECQA 3IM0A 1FMD1 1HRV1 1UZZA 3ZYIB 3WT3A 1GZ9A 4PDWC 4WM7A 1K5MB 4ZKTB 1SLTA 2VXRA 4KWKA 3USUB 5JWPA 5GLTA 1QXJA 3AK0A 4LBQB 4C0HA 4XBLA 3ZFGB 1FMD2 1HRV2 1SFYA 4BLJA 3MZHA 4JGZB 1H1AA 3IBMA 3NKTA 4B3NA 4OHXA 4AVBA 2QNKA 4Q4Y3 4X8PA 5DDJ2 2Z79A 3PTYA 4R52A 4UW3A 3MIGA 4FAHA 5B2GB 3HT2A 2BQPA 4LA3A 4XQDA 1YO8A 4L97A 5GLWA 1EV11 4GB31 5EYYA 2D5HA 4IQPA 4NO4A 5DG1A 4AW7A 5H9SA 4LBJA 5KWRA 1QOOA 2AENA 3J9SA 1EY2A 2QCSB 3AP6A 1U0AA 1R1A2 1N1YA 3MPBA 3NV4A 2ETEA 4BIOA 3O14A 1UIKA 4FPJA 4K20A 2HEWF 1EAH1 3GHMA 2R042 1EV12 1C1LA 1YI7A 4GKYA 3KCCA 3ENRA 2VNRA 2P34A 2H0BA 2GC3A 1AR71 3HT1A 2CWSA 3MFCA 4AQ2A 4YZ2A 4PJYA 2ZZJA 4MGKE 5AFBA 1JYCA 4PF5A 2DV9A 1LOEA 2DUPA 2WNVB 4XXAA 2BBVA 4CDQC 1ULGA 4P9YA 4MV2A 4FTBA 1XQNA 1SACA 1XE8A 2GH8A 2AUYA 2HWF2 3JB4C 1LHNA 1VP6A 2DCYA 1PMIA 3ST7A 4IEZA 3ZSJA 2A6YA 1FXZA 3AP5A 5L36A 1LTEA 4IV1B 1ZBA3 4Y20B 2EA7A 2GNDA 2GC0A 2CGPA 3AZVA 4JC1A 1ZRDA 1GANA 3JBG1 3FFQA 1QGLA 2VVDA 1AYN3 1DZRA 2P17A 1QXPA 3H1MA 3GBFA 5CIRA 3MGUA 1N3QA 2DCZA 4YZ4A 1K5MC 1DG6A 3UL2A 4BH9A 3CLPA 1WD3A 4N7UA 4F8AA 2OZ6A 3VHNA 4JCKA 4YNIA 3MIFA 5LRRA 3VBHB 2R063 3ZFGC 3ZMOA 5T5JA 1DLLA 2MHFA 1NXD1 2YXSA 3AMHA 3PLQA 4ONUA 4P9GA 4JGZC 4XOGA 2WZPP 3WDVA 4DNYA 1CGPA 3AKTA 1HW5A 3FC0A 3R6SA 5T50A 1ZRCA 1YUDA 4E4SA 4YGDA 3JQWA 1EYBA 2Z42A 3R4DB 1JYIA 2D3PA 3U10A 1PK6C 2XL9A 2RR13 1YIPA 1MZ5A 1N47A 2ZX1A 5ABJB 3J8F2 1ULEA 4XETA 4Q8LA 5SV5A 4AK3A 5BNOB 3NKGA 4YGCA 4FPEA 3H7YA 3VBRA 2EXHA 3C2UA 4QQLA 2UU8A 4IEPA 4M0HA 5CVRA 3MLKA 3D0SA 1W6NA 2O0OA 1AYM2 1QU0A 3MIBA 1QOTA 2WINB 4IEVA 1ULFA 3MICA 2ZKNA 1POV3 3ATGA 3I2DA 1WLWA 1VBC1 1DQ0A 2WNVC 2XVLA 2HYKA 3ZFFA 4B4QA 2F6BA 2WFPA 4RA0A 1SCSA 2GNTA 3N7KA 3KLSA 1ZZ7A 4QM9A 2GNMA 1W6MA 1OLQA 1AF9A 1QJZA 3PMSA 1C57A 1R081 3GZUC 1VBC2 4IV1C 4GMP0 1GZWB 4YVSB 3ZN6A 4LHKA 2ZHLA 5JSRA 3ZYGA 3T1LA 3UJQA 4R9DA 3POSA 2AZ5A 2D40A 2D3SA 1R082 2RS51 4AFCA 1DGRA 2JE9A 2XUMA 3VBHC 4BLIA 1GBGA 4IESA 1XRUA 5GLZA 3ZXDA 3NJZA 3KD4A 4ATEA 1MQTB 3OD0A 1UL9A 2CY6A 1O3TA 3BOPA 2ZGMA 3ZXAC 2RM22 1RUG3 4QHBA 1MEC3 5DDJ3 4XFBA 4M00A 5KHKA 2HWB1 4Q4V3 1T6GC 1COV3 3PNAA 4W6XA 4BHPA 2VW1A 4M3CF 1BMV1 2IC1A 4CEYA 3LAGA 1B09A 5DXDA 5BNOC 1QMJA 3AYAA 1TQ5A 2VMIA 4R8HA 4AVSA 4IERA 5HI0A 2GH2A 3ETQA 2WT1A 4YM3A 2HWB2 1VRH3 2B5HA 3DPRB 1X33A 2H0VA 2R043 1BMV2 4K3UA 1X7NA 4DXZA 5GLVA 1SCRA 4FT8A 4MXWB 2R1BA 1REDA 3MLLA 5AFEA 5L7OA 4Z82A 2JDZA 1WBFA 1I1EA 3MYXA 3PMEA 1ND2C 4QQPA 4XMAA 1H2MA 3JZVA 2HWF3 3BCWA 2I45A 5EJ3A 3VBUA 2W39A 1U5IA 4YVSC 4AHXA 5I8YA 1IS6A 1OOPA 1S0FA 1NCQB 4OUMA 3ACLA 5CA6A 3UKVA 2DVFA 1PNGA 3ZYJB 4JAAA 1GQGA 3AFKA 1XNCA 1W6PA 4JTOA 1PZ8A 4FXKB 2VOKA 4AHYA 2ZJCA 1NE4A 2CTVA 2PFWA 3D4KA 2H6BA 2YMZA 4X8NA 4UBGA 4I3PA 4COZA 4H55A 1A8DA 2VY0A 1MQTC 4OVEA 3JUUA 1QJX1 3ASIA 3KGLA 4FQ4A 2TBVA 1KDKA 1TNFA 3WNXA 5JLVA 4FPYA 4LO7A 1AR91 1QH6A 2WJSA 1VBE1 2GALA 3MPPG 3AXEA 1S0EA 1O3SA 3JQXA 3USSA 1R093 4OI0A 1PIV2 4RSUA 4PIXA 1X8EA 1JUHA 3WR0A 2JE7A 3GZTB 4CDXC 2MPFA 2NM1A 3RMXA 4RHV1 1DBNA 1AR92 1LOFC 1N3OA 3DV8A 3ZSLA 1VBE2 2V09A 3INAA 5GKAC 2O8OA 4R4ZA 1REFA 3WDYA 2Q1ZB 4BPZA 2RMU1 1XU1A 3QCWA 2Y26A 1AYM3 2G9FA 2NMOA 1QJU2 1KFXL 4XJ8A 2Q5TA 2DYCA 4LA2A 4RHV2 4NN0A 5JR7B 1RGSA 1BQPA 1MZ6A 1RUI2 2XJPA 4OULA 4Y4YA 1DYKA 2VUJA 4MZUA 1V9U3 1VAVA 1NYWA 3VZLA 2RMU2 2B46X 1BYHA 5D8AB 4OI2A 4XFIA 5C6CA 1RUF1 4HVQA 1YIFA 2FQPA 1OA4A 5F6KA 1G9AA 1UD1A 5HCAA 1D2QA 1B35B 2NQYA 3M3CA 4DPNA 5BNPB 1XXNA 1NCQC 2PHUA 1UW8A 2HJIA 2XJUA 4AGRA 4YW4A 2A6WA 5EFUA 2UWAA 1QH7A 1SLAA 2XKPA 4RQPB 1FOD3 4YW3A 3M4FA 1F8VA 4COWA 1M06G 5K0UB 3ME2A 4BYYA 3I8TA 4OHYA 4ZU5A 5JZGA 1MS3A 2GN7A 1KQRA 4FPLA 2ZHMA 4Q0VA 1DGRN 2W68A 4C0BA 2ZCWA 3E5QA 2CWMA 4COUA 2WQ4A 3ZPYA 3G7DA 2DF7A 4XFFA 3LGRA 1QY4A 4P9IA 3ZDSA 3T2TA 2EAKA 5HCBA 2OVUA 1PGL1 1NXMA 2OA2A 4WM7B 4QQOA 3W9AA 4AI1A 1CAUB 1PO13 1QQP3 4AHWA 2GSYA 3IIAA 4AG4A 4BQ1A 1IQAA 4R9AA 1PZ9A 2WLQA 2HWD1 4IL7A 3TNQA 5GZGA 1J3QA 4H7LA 1UU5A 1PGL2 1GNZA 1PVXA 1RUJ1 5FMOL 1XNKA 4Q29A 2K2SA 1CX4A 2SLIA 3POWA 3D8CA 3DUIA 3DKWA 4PQ9A 1PVC1 1Q5OA 2BVBA 4XDQA 2CAVA 3FBYA 5DZEA 4PCRA 5D8AC 2HWD2 3THPA 5E89A 1TME1 1BK1A 3QACA 3VZOA 4HPKB 3MW4A 2XL7A 5T3NA 3OF1A 2BUKA 3AZYA 4DZGA 4KWLA 1NY71 1C8M3 2QZ2A 2P3IA 4HN1A 3TN93 2X5IC 4AFBA 5BYNA 1LHUA 3PJYA 4RQPC 2O1QA 2D6KA 4HKLA 1ZZ8A 3MDPA 5K0UC 1C5IA 3QH7A 4Q0SA 3LSDA 1QKQA 1NY72 5BNQA 5K8SA 1IS3A 3U11A 1DDLA 2PYTA 1H0BA 2X53S 4AQTA 2HWE1 1ZBE3 1IGOA 4Y22B 1AR81 2P2KA 5CFDC 3B69A 1HQLA 1JUIA 1FPN3 3N7JA 4DQAA 1AJOA 4WBBA 2WT2A 3VHPA 1RUH1 1F5FA 2X29A 3IDCB 5J3UA 1KS5A 1KXGA 2XWJB 4XBQA 1AR82 4JGYB 5A33B 5CNAA 3CL1A 4LUMA 3IKWA 3RS6A 4K9SA 5DZFA 1PIV3 2RS33 3WXPA 1LODA 4URTA 2ET7A 1OMIA 4WM7C 1RUH2 4P9LA 1VBA3 1PGW1 2JG9A 1PM7A 4AI2A 3VBSB 2TEPA 1A78A 4CDWB 4Q27A 3B93A 3V65A 4D7YA 4YGBA 2YDEA 3P3NA 1QJU3 4CYDA 1AX0A 1DQ6A 2D6OX 2VOVA 4AVCA 1PGW2 2RS13 1RUI3 2JKBA 2JG8A 3GF6A 1GICA 4AYUA 1S0JA 3E6DA 3LKJA 3WG1A 3AM2A 1OKQA 2NZ9A 2IXKA 5JI7A 4HVOA 1XYNA 1AL21 1Z7S2 5C4WA 4D7TA 4LEJA 2E51A 3URFA 3JD73 1CPNA 3VDDA 1F9KA 4EN8B 4QXKA 5E8AA 4IV3A 4INDA 2WFF1 1G9BA 3VBRB 3SXWA 5C8CA 2D6LX 3MFAA 1AL22 1W6NB 1MS8A 1XU2A 3R4UA 2EXJA 1H9WA 4A2UA 4YZ1A 1LULA 1QF3A 3KT4A 4KQ7A 1O4TA 4E2SA 1LOAA 1VJ2A 1Q43A 4FOQA 1SBDA 1HKDA 1YFUA 1ZNPA 2Q1MA 1S2BA 4R9CA 4WM8A 3ZFFB 5JVVA 3MF6A 4PDWB 1J59A 3RMYA 3TAYA 5E16A 3VBOA 2ENRA 4HL0A 4XJZA 4FPCA 3RJRA 1XE7A 4K6BA 3WDWA 1LHOA 5HXVA 2VOXA 4GMP1 1ZRRA 3WDUA 1CD3G 1I5ZA 2R061 3NSTA 4NHMA 3RQ0A 5AVPA 5I0SA 3I54A 3GYDA 3V64A 1H8TA 3ZX7A 4BA6A 1WMEA 1OA3A 5JSOA 5BNNB 1WLDA 2WLPA 1D4VB 4GKXA 3EJKA 3EO6A 3PVNA 3S7EA 2NMNA 4HBNA 4XBNA 5FFOC 3OTFA 4PLNA 4N43A 4BWOA 3RYRA 4K1YA 1N3PA 2WA4A 4AF9A 1BCXA 1CONA 4DB5A 4GQ7A 1ZVFA 4HSLA 1UMZA 3AMPA 4PLOA 1TE1B 2KA3A 4BMEA 1FAYA 4L2NA 1GR3A 2PAEA 4O9GA 3VKOA 1Y9QA 3N7LA 4TYSA 2Q8OA 5F6LB 4AHZA 2W08A 1Q8SA 3LA7A 4LBMA 3VBRC 1AXYA 4R9BA 3WX5A 1UZYA 2OUJA 2XJRA 2Z69A 4WVMB 2PN5A 4AI3A 1UPSA 4LT5A 2QZ3A 2AGSA 2D93A 4NHKA 3VN4A 1SDWA 5ACA1 4Q0QA 4YM2A 4RGAA 1LJ7A 1BBT1 1RJ8A 3ZFFC 1ONAA 2MEV3 2ZGUA 4LO4B 4RR3B 3THTA 2H6CA 2HWC1 3ES4A 1H1MA 3V0BB 3WG3A 3E6CC 1YNAA 1QJY2 2ZX2A 3NAPA 1E57A 1QNWA 3SISA 5ACA2 2FHRA 1G9CA 4MGZE 1CN1A 1KDMA 3ROUA 3B5LB 3ES1A 5H9RA 3WCRA 1OOPB 2YYOA 2HWC2 1FT9A 4FTSA 4HSJA 3MF9A 2ZAHA 4NWVA 1YFXA 1DIWA 1LOBA 4QPGA 1W6PB 1LESA 2QKDA 2WNUA 3N7MA 5BNNC 1ZRFA 1PK6B 1ZA4A 1MEC1 2ILMA 4WVWA 5DUVA 5AC91 2G4IA 1O4YA 4XW3A 2BGCA 3VKLA 1JN2P 4AEJA 5F1RA 3PVBB 3B7MA 2UYAA 3FHIB 3NL1A 5I8TA 4GB32 4XILA 2C1FA 4XF0A 5AC92 1IKPA 2PELA 1CIWA 2ET1A 3NO8A 2VULA 1Z7S3 5FQ0A 1URXA 2A3XA 2E6VA 2BVVA 4CEWA 5LRSA 4XF4A 2BW8A 4CRQA 1I9RA 3ZVXA 1S1AA 1H4GA 1VAMA 4X6QB 5T55A 1EAH2 1RL3A 1O5UA 3HWJA 2C0ZA 3BB6A 4LO6B 4NVPA 4PIYA 4A7ZA 1FATA 1H1IA 1G9FA 4AI8A 3LOIA 1NCRA 3ALQA 1AR72 2R073 2WWSA 4ES9A 3WP6A 5KHGA 3MI8A 4Q4W3 3LA2A 2B45X 2UURA 4P9WA 4FCAA 1UX6A 3OY8A 1JH5A 2A3WA 4CDUA 1SBFA 4RR3C 1RUOA 2RJLA 1RHI3 4ASMB 2CGNA 2DVBA 3B00A 1FNYA 1RC6A 3FMGA 3JBG2 3R0RA 5I0TA 3U0ZA 1WLCA 3V0AA 1OOPC 4RD7A 3VZJA 1ZYBA 1WCDJ 5CFCA 4F3JA 2PHRA 2JD4A 2XKOA 1NA1A 1AVBA 1NQDA 3NV1A 2YPJA 5IT6A 1VBB3 3BODA 3TB0A 5J36A 1C5HA 3LZZA 4Q1RA 2ARXA 4IEYA 2B9UA 2ZHKA 2JICA 3RI8A 2VVFA 4FBFA 1XNDA 3ZXJA 2B42B 3LOBA 2NYYA 3ZXGA 3DN7A 4C1WA 4B4RA 2XWBB 3FFZA 1AUYA 1ENQA 5C9AA 3H0OA 2R0FA 3HAGA 3OCPA 4KBBA 2UYBA 1QNYA 5KXEA 2JJ6A 4LO8A 1CQ9A 2GC1A 4PBOA 4KH9A 1ENSA 5CU1A 1LCLA 3OGJA 3RSJA 1ND2B 2ZMLA 1CJDA 1VLNA 3ZFEB 3FZ3A 3AP4A 1HXS3 1QDCA 2KM2A 2ZGLA 4LHLA 4XIKA 2XBO1 1NOVA 4YW2A 1N1SA 1WMDA 4WZCA 4YSFA 2WT0A 3WVJA 4YW5A 1EP0A 4C1XA 2IXCA 2TNFA 2XHKA 1HX6A 4YVWA 3R4SA 5KXCA 2XBO2 1NQJA 3SMHA 2O8QA 4AGVA 4AGGA 2IXJA 4FAGA 4RS5A 2I2SA 2VQAA 1XYOA 2VGDA 1FMD3 1HRV3 1CAWB 1G6NA 1RMU1 1RVF1 2D5FA 3AKPA 2R49A 5FRAA 2UY9A 3CJIA 4CP1A 5CG8A 1ENXA 2RS52 1RUE1 1V70A 2ATFA 5DUXA 3ELNA 4I01A 2I07B 2JXAA 2WKKA 1RVF2 5JZGC 3AXDA 2VECA 2WS91 3IPVB 4UW4A 3VHOA 2WSVA 2ZMNA 1WW5A 3TWIA 1H30A 5FO8B 1LGNA 4CDXB 1POV0 3RPQA 5FO9B 2UWBA 4S2HA 1O7FA 2G9GA 3O5SA 4GIQA 4DOUA 3H1YA 4ITCA 5IK4A 1R1A3 3RJ2X 1CAVB 2A71A 2JEMA 2MNGA 2WS92 3WUCA 4Q26A 1W6QA 1RUC1 1GFF2 1EV13 4H14A 1LOGA 3I59B 3L2YA 4BE3A 4E9KA 3PHMA 2AR6A 2E53A 2BFUL 3VBFA 1CESA 5FREA 2JG9B 1RUC2 5GJ6A 4MXVA 2VMHA 2HEYF 4CDQA 4BZ4A 4ZU4A 1UPIA 1S0GA 2OIIA 5SV8A 1FX5A 3ZFEC 2XVGA 4AEDB 1H4HA 1AR73 4Q4X1 3KGZA 1UU4A 4E4DX 3L9JT 3OBTA 2JG8B 3VKMA 5JOYA 1G7YA 5FPXA 1DU3D 1WCSA 2PHTA 2D3RA 5JSPA 4DY5A 1CAXA 1O4ZA 2IXIA 4DFSA 3AMQA 4Q4X2 4Y1YA 1YYNA 2ZAAA 1K5MA 2BNOA 3B9CA 4Q1PA 3USUA 1RITA 1OA2A 4YGEA 3TOJA 2PTMA 1Q8PA 4M3CA 3JBG3 2DTWA 4LBQA 1OD5A 2A5ZA 1D4M1 4Q0PA 1OSGA 4UXAA 3VL9A 3APBA 3ZFGA 2FBEA 1PHMA 3ZIXA 4JGZA 5C8CB 1ZBE1 2P3KA 2D6PA 2BEOA 2WA3A 1SEFA 3ILFA 3IWZA 3J26N 3OYWA 4RFT0 4KG8A 1C8NA 2Q0AA 1KJRA 4QD2A 4JDNA 1U5XA 2PHFA 4JDOA 5KXBA 1QJX2 5EXOA 5L19A 4XTMA 4EWEA 1VR3A 3J8F3 4L9BA 1YHFA 3D0JA 2E7AA 2D6MA 3S30A 1M4WA 3FJSA 3WW2A 4S2DA 1V6NA 5GZDA 5CADA 3KT1A 4LBOA 4TWTA 5GLUA 1Q8QA 1SLLA 2EIGA 2GMMA 1YFWA 1PO21 4XJAA 1VBD1 3K51A 4XIOA 2VMGA 4FO9A 4IETA 4QPYA 3O7OA 2BWAA 2JG9C 3UKTA 1H8TB 2RS11 2B7YA 1G86A 2PLV1 2WNVA 4ZXKA 4CTEA 4X6RB 4DY3A 4GH4B 1GV9A 1PO22 4XZPA 4AEDC 1FI2A 1I6XA 1TEIA 1WCKA 3KMHA 1ND3A 4KNCA 2ZHNA 4OI4A 1VBC3 2D44A 4Y20A 5KC5A 2XJTA 2X5IB 2JG8C 1OPMA 4EWAA 2QDRA 1RUF2 3SH5A 1BVP1 4YM0A 3VKNA 1HV1A 2ZX3A 2Q4SA 4G9SB 3ZXLA 5C4WC 1R083 4HKOA 2D7FA 4XF3A 1NZCA 3VDDC 2ZPXA 4N9HA