4GMP3

Crystal structure of enterovirus 71 strain 1095 procapsid
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
240
structure length
240
Chain Sequence
GFPTELKPGTNQFLTTDDGVSAPILPNFYPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRSGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDASDILQTGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords capsid protein VP0
publication title Structures of the procapsid and mature virion of enterovirus 71 strain 1095.
pubmed doi rcsb
molecule tags Virus
total genus 40
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4gmp300
3JB4C 1FPN1 1VBB3 4BCUA 2RS52 1NA1B 1V9U2 1PGL1 5BNOC 3JD73 2R043 3VBHC 3ZFEA 5ABJA 5CFCC 1RUI2 1AR61 1MQTB 1QQP2 1ND3A 1X36A 1RUG2 1VAKA 4CDQA 3VDDB 1HRV2 1VBA1 1NY72 1NCRC 4Q4Y1 3FBMA 1RUI3 4WM7B 1QQP3 1ZBA2 1VBE3 4NWWA 4N53A 1VBC3 3ZFEC 1QJU2 5ABJC 4NWVA 4IV3B 2X5IA 2XBO1 4Z92B 1TME1 4RHV1 1R1A1 1OHFA 4CDQC 1QJU3 3CJIB 2WFF3 1RVF1 4N43B 2HWB1 4GB31 1HRI1 4QPGB 5BNPB 5GKAC 4IV1A 4CDWA 1D4M2 1FOD1 2RR12 3VBSC 4LLFA 1PO13 1D4M3 1RMU2 2X5IC 2RR13 1MQTA 1A6CA 3ZXAC 1RUF2 3VDDA 4IV1C 4CDWC 1ASJ2 1X33A 4RR3B 1K5MA 1NA1C 1TMF1 4Q4V2 2HWF2 1QJX2 3ZFFB 4IV3A 5C4WB 4FTEA 1AR82 3HAGA 1MQTC 4Q4V3 1IHMA 1RUH2 1QJX3 1RUJ2 3VDDC 1BBT3 3JBG1 4N43A 5C9AB 4YVWB 5K0UB 5ACA2 4QPGA 4WM7C 2PLV2 5BNPA 1E57A 1AR72 1C8M1 4JGYB 5DDJ2 1BMV2 1MEC2 1COV2 1AUYA 1SMVA 4IV3C 3NAPB 1AL21 1AR73 5A33A 3J8F2 1RUD1 4CDUB 4CEYB 1MEC3 1VBD1 1COV3 2RMU3 2WWSA 5AC91 4N43C 4WM8B 1EAH2 1PIV2 3VBOB 4Q4W2 4QPGC 5BNPC 4RR3A 2WZR2 1BEV3 5L7OB 1V9U1 1PVC1 1RUE1 2HWE2 5BNOA 2WS91 3VBHA 3DPRB 3ZFFA 1PO21 1RHI1 2R073 1PGW1 2RS12 2HWE3 1AYM1 1HXS1 1HRV1 1POV1 1NY71 3JD72 1QJY3 3IDEA 2R042 3VBFA 4Y5Z0 1NCRA 4YVWA 1EV12 3TN91 1ZBA1 2RS13 4RR3C 1NG0A 1EV13 3ZFFC 2HWC1 1R083 1AYN1 5C8CB 4CDUA 1FMD1 1VBE2 1DDLA 1Z7S2 1ZBE1 1VBC2 5C9AC 1C8NA 4WM8A 3VBFC 4YVWC 3VBOA 5K0UC 1Z7S3 1AR92 4JGYC 4GH4B 1RUC2 3VBSA 3JB8A 2WFF2 1H8TB 1VRH1 2R061 1AR93 4CDUC 1RUC3 1RUE3 4CEYC 2ZZQA 1RUF1 1HQNA 4WM8C 3VBOC 1PO12 1ASJ1 1B35B 1POV3 1NA1A 2FZ1A 3TN93 1AR81 1FPN3 2IZWA 2RM21 4Q4X1 1NOVA 5JZGB 1RUJ1 1F2NA 2BFUS 2MEV1 1NCQB 2HWC3 1AYN3 5CFDB 5ACA1 2PLV1 1AR63 4WM7A 1R091 4PDWB 5DDJ1 1VBA3 1BMV1 4Q4Y3 2BPA2 3VBUB 1BBT2 4JGZB 5J98B 4GMP1 2HWD1 3J8F1 1W39A 2RS31 4RHV2 3CJIA 1RVF2 1EAH1 2HWB2 4GB32 1HRI2 2XBO3 2R063 4FTBA 2QQPA 1TME3 1WCDJ 4RHV3 1R1A3 1B35A 3ZFGB 1RVF3 4GH4C 2HWB3 4GB33 1OOPB 5FMOS 1HRI3 2RMU2 1H8TC 1FOD3 1VBB1 5JZGA 1BEV2 3CJIC 1NCQA 1ND2B 5A32B 1QJZA 1VB4A 5CFDA 1HX6A 2RM23 4Q4X3 2R072 4PDWA 1B35C 2RS51 2MEV3 4Y4YA 5BNNB 1R093 1AL0G 1QJY2 5C4WA 4AEDB 5J96B 1RUI1 4CEWB 1QQP1 1ND3B 1VBE1 1TMF3 1RUG1 5JZGC 4CDQB 1VBC1 1NCQC 3JBG2 5C9AA 5CFDC 4GMP3 5K0UA 3M8LA 4PDWC 1R082 4N53B 1C8M2 1GFF2 3ZFGA 4JGYA 3JBG3 1OOPA 1QJU1 3S6PA 3VBUC 5C4WC 3NAPA 2XPJA 3LOBA 4EJRA 1C8M3 1RUD2 2WLPA 4CEYA 5FOJB 4RS5B 1AL23 1ND2A 1PO11 4IV1B 1D4M1 1RUD3 1VBD3 5L7OA 2RR11 3ZFGC 5AC93 1PVC2 1RUE2 1OOPC 2WS92 1POV0 5BNNA 1RMU1 3DPRA 3NAPC 1PO22 1RHI2 4AEDA 2RS53 4CEWA 1PGW2 1V9U3 2BUKA 1PVC3 2BFUL 1AYM2 2WS93 1HXS2 1PO23 1RHI3 1ND2C 3TN92 1K5MB 1RUG3 5D8AB 1FPN2 1AYM3 2DF7A 1HXS3 5L7OC 4Q4V1 1HRV3 1PGL2 2HWF1 4RQPB 1QJX1 2Y26A 3VBRB 5BNNC 1ZBA3 3DPRC 1BBT1 2HWC2 2GH8A 4AEDC 1AYN2 4CEWC 5C8CA 1ND3C 4QPIB 1AR62 1FMD2 1RUH1 4CDXB 1ZBE2 1VBA2 4RS5A 4Q4Y2 5LK7B 1FMD3 1AR71 4N53C 5FMOL 1ZBE3 4GH4A 1MEC1 1COV1 2RMU1 1H8TA 2XBO2 5A33B 1VRH2 2R062 5C8CC 1TME2 1RB8G 1BEV1 1R1A2 4YVSB 1RMU3 1CJDA 1PIV1 4RS5C 4Q4W1 1VRH3 2R071 2WZR1 5D8AA 2BBVA 1RUF3 1FOD2 5BNOB 2HWE1 3VBHB 4RQPA 3VBRA 1ASJ3 1QJY1 5CFCB 1F8VA 2RM22 2RS11 4Q4X2 4QPIA 2HWF3 4CDXA 3JD71 2MEV2 2R041 2GSYA 1AR83 1NCRB 3VBFB 4FSJA 1EV11 1R081 1K5MC 1CD3G 1R092 5D8AC 1RUH3 4GMP0 1RUJ3 1TMF2 2TBVA 4FTSA 3ZFEB 4RQPC 3VBRC 5ACA3 2PLV3 5ABJB 3VBUA 4JGZA 1M06G 2HWD2 4QPIC 2RS32 5DDJ3 1Z7S1 4CDXC 4YVSA 4RFT0 2HWD3 3J8F3 2RS33 4SBVA 1AR91 3VBSB 1RUC1 1EAH3 1PIV3 4Q4W3 2WFF1 2VQ0A 2X5IB 4JGZC 1AL22 2WZR3 5CFCA 2FZ2A 1OPOA 1VBB2 2ZAHA 2ZTNA 1VBD2 4YVSC 5AC92 1VB2A 5A32A 4CDWB
chains in the Genus database with same CATH superfamily
3N9LA 1DQ6A 2WWJA 1DZRA 1QMJA 3N7LA 5AFEA 3N35A 1PM4A 1UMIA 2BU9A 3O5SA 4XUOA 4EWDA 5F7UA 5CG8A 1K5JA 5BNOC 4XBLA 2IXCA 3ZFEA 2BOJA 4PBOA 4HMZA 3K3OA 1W0PA 3G7DA 5CU1A 5CFCC 1W8UA 3V56A 2YYOA 1GZWB 2Q4SA 1DQ2A 4QX2A 4UF0A 3WOGA 4BOWA 1K45A 3IM0A 3H9AA 4FAHA 1HW5A 1UKRA 5T55A 1QY4A 4OI4A 4LBLA 5JWPA 3FBMA 4UW5A 5FO8B 3ZXJA 3NV1A 3TNPB 3H8XA 1W0OA 1ENSA 4DUVA 3PU8A 4NWWA 1W6MA 1OUSA 2I74A 3ZPYA 1X7NA 2DDUA 4IERA 1GP6A 2JB8A 3CL1A 4V2VA 4AG4A 3ZN6A 2XJSA 4Q1PA 4NWVA 5ABJC 3DYPA 3RZZA 1FT9A 2X5IA 3AP5A 3UKNA 1TME1 1W2OA 4AI9A 1MVQA 2XONA 3LQCA 1STMA 5A3NA 4CDQC 1C3HA 4MSVA 4OZXA 1QJU3 3WUDA 3OY8B 4B4RA 3HNMA 1ZX5A 2DU1A 4HONA 4LHLA 4PT6A 3OGGA 4QDSA 4O9EA 3DUIA 2YXSA 3UL2A 1BLZA 5GKAC 3ALQA 1WUVA 5ANQA 4QT6A 4FFFA 4XIKA 4OHXA 1U12A 4AZZA 1FOD1 1ZZ9A 4UFKA 3IIAA 2JKXA 4LLFA 5I91A 1KXGA 1JH5A 1PHMA 2VMFA 1GZWA 1YIFA 2ORZA 3BGAA 2B5HA 3DYMA 4CP9B 3D3AA 2F4LA 3C7OA 2J1SA 2W1WA 4E4ZA 1RITA 1VMJA 1ASJ2 5FZ4A 3T4VA 1JYWA 1XNCA 4XHXA 4AHWA 4KGGA 4HSJA 5F5IA 2CTVA 1TMF1 4OQ8A 2VD7A 2E26A 1ENRA 1JZ8A 1LR5A 3NNMA 3DKQA 3GDBA 1QJX2 4D6SA 1W6PB 3HAGA 3MW2A 2B45X 4GD4A 3SHRA 2W9XA 5FV3A 2QNKA 3WNPA 4Q4V3 3GNEA 1UY1A 1X9TA 4L99A 1RUH2 5DAQA 4DY5A 3OY8A 4MXWB 3VDDC 2OVUA 3W9AA 1CVNA 4M0NA 2VNVA 5M0TA 5K0UB 1A78A 1CIYA 2VZ3A 4WM7C 2PAEA 2UWAA 3WVJA 4YZ1A 3WF2A 1VJ2A 2PHWA 4Q0QA 3VDCA 1C8M1 2BBAA 5DDJ2 4FPHA 1N1TA 4IGPA 5FYZA 3PIGA 2C6SA 4BQ1A 1COV2 4IV3C 5BUVA 3Q8CA 2E6VA 4LO4B 1AR73 1YEWA 1YNAA 5F2WA 1OA2A 1RUD1 2OPKA 2R16A 4HSLA 4UWDA 5JOYA 3KCYA 1DLLA 1MEC3 1PVXA 2R49A 4CP9A 1F5FA 1JHJA 3WY6A 5EJ3A 4N43C 1LOFC 1C1FA 1O91A 4QQPA 5I0RA 5C3QA 1MZ6A 4Q4W2 3ACFA 3ACLA 4XJWA 2GP5A 3SC7X 4CCJA 5BNPC 5BYNA 3RZGA 2CAUA 2W68A 2ZGUA 1QXRA 3MEPA 4P5HA 1BEV3 1W6OB 3OBZA 1V9U1 1PVC1 3U10A 1ULOA 1RUE1 2DFCA 2VCMA 3A22A 3W20A 3WNXA 1NLSA 3FC0A 2GC2A 5APAA 3VBHA 5JR2A 4JDMA 4LT5A 2IUWA 3ENRA 1KS5A 1XRUA 4Y1VA 1D4VB 1US3A 2ZX4A 4L8QA 3ZDVA 1H0BA 1OF4A 2OT7A 4A7YA 2RS12 4O65A 3MF6A 1AYM1 1HXS1 1ZREA 1I5PA 3M3QA 4XVHA 1POV1 4RYDA 1BQPA 2RDSA 2TNFA 4MXWA 1NY71 1W9FA 1QJY3 3JD72 2R042 3LGRA 4DOUA 4D6RA 3HOBA 1NCRA 3WCRA 5KHJA 4FT8A 1GYKA 1UIKA 2J1EA 3WXPA 2WNUA 4XMAA 4HG6B 4XFGA 3CHXA 4QQOA 4BLIA 5CKMA 5KXEA 2VZOA 2HWC1 3PVBB 2C5DA 1S0GA 2ZKNA 2WWUA 3CU7A 3QCWA 1W2UA 1IKQA 4XQ4A 2G1MA 5HCAA 4NIHA 3WSOA 2XLGA 4P5YA 1JYVA 4O9GA 4QDRA 2WZ8A 3GZUC 3IMNA 2ZX1A 4YVWC 4DXRA 1ZRIA 1MS3A 3NQHA 2E33A 3QH6A 2PHUA 5FXZA 4QHZA 3O0WA 1JU3A 4YW2A 1UZZA 1W6OA 5DN2A 1SHWB 2BEOA 3G6JB 3NJXA 2VMEA 3JB8A 4QX1A 4KL1A 3R4DB 2BP6A 2VMIA 3ZXFA 1A34A 4HKWA 3PUSA 4Y5SA 3POGA 1VRH1 2R061 3ZIWA 3S30A 1UXZA 1O3TA 4M0HA 4CDUC 2FDGA 2BRTA 2VTXA 3F2ZA 1H2MA 4NVPA 4XF9A 5T5OA 4AHYA 3AB0A 5A3UA 1H2NA 2Y38A 1MACA 1ULCA 4LEJA 1HQNA 4WM8C 2ERFA 3OPTA 3RJRA 1S0FA 2D43A 5IAVA 2AEYA 1UOGA 2GP3A 3AKPA 3B5LB 1B35B 2IFWA 1AX1A 2ZACA 3UV9A 4FPFA 4LHKA 2ENRA 3N4MA 2VCAA 3KWVA 1OSGA 2HYKA 3K2OA 4QGNA 5FO7B 5FZAA 3I4IA 1FPN3 5JOXA 1QGLA 2VZSA 1W9WA 1K12A 5FPZA 2IZWA 1U0AA 1OPMA 2XUEA 5IFPA 3ON7A 1HKDA 2CU5A 2XL9A 4LBJA 4ARXA 1QXPA 1PK6C 1GU3A 1UQXA 4COVA 2FCTA 2WNOA 5KBFA 1DQ0A 3B00A 2VVEA 1SCRA 2P6CA 3WR0A 1XE0A 2YGMA 4A45A 2Q0AA 4LLOA 3O7OA 4GQ7A 2LS6A 4P08A 4OUMA 4DFSA 2C9AA 2QQNA 1QDCA 2AACA 1VPHA 2GC3A 2WYSA 2XJVA 5JR7B 4Q4Y3 5A7PA 3VKFC 4WVVA 1BVP1 3VL8A 3CBNA 4JKMA 1BJQA 1RGSA 2DBNA 5F5CA 1CZTA 2WT0A 3J8F1 5HPOA 5LEJA 1S55A 2RS31 4B1LA 4ATFA 1S0EA 4RHV2 2HBTA 3UNPA 3O1OA 1OFNA 5FO9B 2D6OX 2DYCA 3WDXA 4FPCA 4QPWA 1EAH1 2HWB2 2QUOA 2ARCA 2G9ZA 4GJZA 3CNAA 4QGLA 4U2AA 1WCDJ 4UAPA 3Q8AA 1AXYA 3VD3A 1R1A3 1B35A 2IXJA 1V6KA 1CAVB 2QZ3A 1VLNA 4GH4C 1L7RA 5B4NA 3QH7A 4S2FA 1NYWA 2YG0A 2EVXA 4O61A 4ATEA 2ES3A 2ZHKA 1G9FA 2VCBA 4FPLA 4BZ4A 3ZYGA 3D8CA 2JICA 3MFAA 4FPOB 3BTAA 3URFA 4A6SA 3V0BB 2O0OA 4DXZA 5FZ0A 3N36A 3LA3A 1MZ5A 4P9GA 4W6WA 1ZVFA 1MS4A 3DN7A 3U78A 5A32B 1VB4A 3PDQA 1HX6A 1SFYA 1S0DA 1UOJA 2RM23 2A70A 4Q4X3 3UYJA 3GJAA 4AFDA 2WNVB 2JDNA 4JC1A 4P00B 3O1RA 3KHBA 1V6MA 3AP9A 3N7JA 4ZHNA 1XYOA 5GLZA 5A3WA 1UZ0A 1R093 2PELA 3AJYA 3LSEA 4FPGA 4JX0A 1X50A 2A7AA 2ZMNA 5A7QA 5KR7A 5JZGC 2A6WA 3P3PA 4C1XA 4ASMB 4NMIA 4BQWA 1H6YA 4UYBA 2PYTA 1WBLA 2VZPA 4NAOA 1NCQC 3APBA 5CFDC 2EXJA 3M8LA 2L9LA 1UYYA 2XQXA 3SH3A 4AQTA 4A7KA 2W0XA 3RWNA 4IE0A 4HK9A 2W2IA 4BXFA 5JXJA 1CAVA 1W2AX 1QJU1 2W1SA 2RDQA 4LNVA 3LZZA 4N90A 4INDA 4GJYA 3VBUC 3AP4A 2EIDA 4YW5A 4BMBA 1RIRA 1XC6A 3IDAA 5DZEA 3V0BA 4XXAA 1VIWB 2Y6FA 1J83A 2C9KA 5FOJB 2VUJA 3OOXA 4J6GA 1NZCA 3N9QA 3PUAA 1SFNA 4UXAA 4YW7A 4PBPA 2VMDA 4EN6B 1VBD3 4FOWA 4KBBA 5L7OA 5FZ7A 4AVAA 4AFAA 5LZ6A 4NIIA 2R30A 1VAMA 5J37A 2WS92 3MIFA 3PUHA 4B7KA 4CXYA 5JSOA 1RMU1 5T52A 1PO22 1XOYA 3MW4A 4Y33A 1YQCA 5KXDA 1PGW2 3POWA 1EUTA 4GALA 1W04A 1UWWA 3ES4A 4LO8A 4NE9A 1PZ9A 4XDQA 1CJPA 2OZ6A 3LE0A 3ZXLA 4HN1A 5FYYA 1ACCA 1ND2C 3SISA 1WA6X 5IWFA 1K5MB 1OKQA 2DF7A 3THDA 4K8FA 3PJQA 4Q4V1 3I3QA 3WCSA 4BXSV 2HWF1 3EYPA 4H2AA 4N7IA 1XB9A 4QXKA 2DCTA 3AL6A 4FI9A 5BNNC 5LY1A 3VD7A 3HMYA 3AFGA 2GH8A 1AYN2 1YXWA 5FPAA 1F4HA 1GWKA 5F3EA 3T30A 5C8CA 1BXHA 2OW4A 1FMD2 2V5DA 3WNOA 4LHSA 1NQJA 2XVKA 1ZBE2 2VBPA 3USSA 1C5IA 3AP7A 3AMHA 3LDRA 2OQ7A 4YGEA 3RI9A 4IEUA 4XUTA 4OMDA 4Y4RA 3ZXDA 1AR71 3VD5A 1S4CA 2VOTA 5F6KA 5TSWA 3ACHA 3P5BA 4CP2A 4LOSA 2H0VA 4CUGA 4L11A 1YC61 1ENXA 5LY2A 3U11A 4AI8A 1MEC1 3DGTA 3HNYM 2JG8B 2A6VA 5HI0A 3OBAA 2BERA 3GZAA 1H8TA 1S0JA 3HN1A 3QD6A 4CP0A 2XBO2 3I59B 3WHTA 2NYYA 3RJ2X 2ID4A 3WW3A 3RYPA 2ETEA 5I8SA 1BEV1 3IT8A 3KQ4B 4HETA 2B42B 1CGPA 1KDKA 2W91A 1HB2A 5FYBA 4CCMA 3A4UA 4AHZA 3IKWA 1LHNA 5JLVA 4AHXA 2WO1A 4C0BA 3MIHA 1VMHA 1GQPA 1D2QA 3I2GA 1Q8SA 2JE8A 2VC9A 2DUPA 1QNYA 3ILNA 2D3RA 3SH5A 1BK1A 4BISA 5BNOB 3O1PA 2W94A 3ZYBA 4HK8A 3AMNA 1SLIA 3NW4A 2QQOA 4LK6A 1Y3TA 2IXHA 5FXWA 3MV11 1ASJ3 2FMYA 1QJY1 1R64A 5CFCB 4UFHA 5JMCA 2Z42A 2UY8A 3AZXA 1JUHA 1PZ8A 3A7QA 2X8KA 3HPNA 4COWA 3POEA 5BXXA 2D40A 1C28A 4NR1A 1AHSA 1D7PM 3OUHA 2MEV2 4Q27A 1Q56A 2JG9A 2BGOA 4NOTA 1UZVA 4YW6A 2LTNA 4KU8A 5C5TA 5KC6A 4FSJA 2K46A 4L0PA 1GBGA 1AZDA 5D2AA 4LUMA 5D8AC 2IXLA 3PUQA 5EYXA 5IJRA 1RUH3 4H7MA 4DEVA 4NHYA 1W8OA 3PTYA 4HZFA 3MUZ1 4NJ4A 5FYHA 1NXD1 2JG8A 3LD8A 1ZNPA 2Y33A 4EV0A 5ABJB 3UETA 1OVPA 4DEQA 2N7GA 1ZZCA 2OPWA 1IPSA 3I59A 3UGFA 2HWD2 2D6PA 4HXCA 5DDJ3 2ZKLA 1SQ4A 1RTVA 3QLQA 1W05A 4BHPA 4JVAA 4AVTA 4W50A 2QZ2A 5CNAA 3AYDA 5FBZA 3WHUA 3DXTA 2YPDA 5F3IA 1AVBA 4NPLA 2WAOA 3SEEA 4HN0A 4Q4W3 1PMJX 1BHGA 3OUIA 1UL9A 4D7TA 4IETA 1OC1A 4DRVA 2QJVA 1PZ7A 1XSRA 2JDHA 3VZJA 2PHTA 2D3PA 3P6BA 4E8CA 5CFCA 1GKBA 1I9RA 2DVGA 1IS3A 1LHOA 2ZTNA 5T3NA 2VO5A 5A7WA 2ET7A 2J22A 5I0SA 2D6NA 4S2HA 4A42A 3R0RA 4DUWA 2YFUA 1F5JA 3HEIA 1N1YA 3E6CC 1FPN1 5C6CA 3CF6E 4GA9A 3X29B 5IW0A 3RZLA 2RS52 2QQKA 3WW2A 4XBNA 4FO9A 1PGL1 5FCCA 3I3DA 1GR3A 4G3YC 3JD73 5FK7A 2D6MA 2R043 4LE4A 1W3VA 4J1XA 5ABJA 2WA4A 3IAQA 2J1VA 2XJTA 1RUI2 1W2NA 1YJLA 2R32A 1ND3A 1W6NB 1RUG2 2JDZA 3H7YA 3KV9A 4FPJA 2FDHA 2IVIB 5HCBA 3WG3A 4CDQA 4OI0A 1UOFA 3VDDB 1HRV2 4WV8A 5LBCA 2BVVA 4Q4Y1 4WM7B 1CX4A 1QQP3 3N9OA 3MUY1 1PGSA 4AVCA 1SCSA 4N53A 3BI3A 4AI3A 1WGPA 3AZYA 4I30A 2ZGLA 5L9VA 1JUIA 1DLCA 3BTXA 5FUNA 5IK8A 4NIAA 4IV3B 1F35A 1ZZ8A 4ZPIA 1J3PA 5KC5A 1F4AA 4Z92B 4LHNA 1GZCA 1LOEA 3AVRA 1L3JA 3O0XA 1OH4A 1R1A1 1LEDA 5HXVA 3LEKA 1CR7A 4DNYA 4QWNA 3LFIA 4XTMA 4N43B 4I0AA 4YG0A 5DUVA 2C26A 2F4PA 4F83A 5BNPB 2DUQA 2HEVF 4M4PA 1WCSA 2BNOA 2W5FA 4AVVA 1UU6A 1HB3A 3FFQA 4QKBA 1SG3A 1YO8A 4LIVA 2QKDA 4MGZE 5DZGA 3ZYFA 5BV6A 1AX2A 1QKQA 2K9ZA 4N8MA 4NIGA 5EXOA 5FKCA 4B4QA 3UJQA 5FY8A 1D4M3 2GZWA 3RRDA 3V65A 3ZSJA 5B4XA 1LOBA 3K77A 1DBNA 2EXIA 2RR13 1A6CA 4M3CB 4QX0A 5K9YA 1N1SA 4ET7A 2JDMA 1O7FA 1HLCA 5JUVA 1AF9A 2VQAA 1KD7A 2YBPA 3VDDA 1CAXB 2W47A 3AYEA 2VH9A 1REEA 3RWKX 2SBAA 4E4SA 2QQLA 5FPVA 4CDWC 4Y5TA 5GLTA 3UJOA 4XHBA 5AFBA 4KBZA 3CMGA 1HIXA 1WW6A 5C3OA 1SDWA 2WINB 1DG6A 2ZX3A 1U5XA 1NA1C 1QOTA 3GGLA 4MHRA 3KF3A 5FZKA 2QVSB 3LFMA 1LU2A 1W8FA 2UYAA 5CADA 1PM7A 4URTA 2BQPA 3O1TA 2JXAA 4OHYA 1F31A 3KHCA 3MHZA 4IV3A 4FTEA 1AR82 3J26N 2ZHMA 5T5LA 5K4LA 1SPPB 2JDUA 2WSVA 3QOPA 2CDPA 1RUJ2 4QGMA 2QQWA 3E1F1 4N43A 1LOFA 2QQMA 4GIQA 4MGIE 4YVWB 3LCPA 1H4GA 1W28A 5BNPA 5I8TA 3KD4A 1E57A 3ZR5A 1GNHA 4JCKA 3KVBA 5FXVA 3MLKA 2J1TA 3M1HA 5FZDA 1BMV2 1XXNA 1KDMA 3NVCA 5EHDA 3Q8EA 5BPXA 1SMVA 2D6KA 5CVRA 3S7IA 4B4PA 5FYVA 1QWRA 2WZEA 4K3UA 4KWLA 5A33A 3ECQA 1NZIA 4CDUB 4YGBA 4CUBA 4M3CA 2WO2A 1HB4A 1VBD1 3CIHA 4WM8B 3ZO0B 5IVCA 2P3KA 3AX4A 3LIHA 1CAXA 1S1AA 1Q8VA 4M3CF 3I2OA 5FY4A 2WZR2 3ELNA 2CSGA 4LBKA 2IVJA 2XWJB 1M4WA 3MDPA 4GAZA 5FZ1A 3C7GA 4KNCA 2IWGB 4L97A 5L9BA 5A80A 4YM0A 4LQRA 2Y60A 3DPRB 5JI7A 1Q8PA 3THCA 5B2GB 2G19A 2XVGA 5IYYA 1WCUA 4H7LA 4ISRA 1ODNA 4XXPA 4OQ9A 1W6QB 3RSJA 2WC2A 2HWE3 2J1UA 3I2FA 4HBNA 1UYZA 4PI0A 1SPPA 1PK6B 4XAEA 3AJZA 3IDEA 4XDPA 1K3IA 4YVWA 3TN91 3NL1A 4AEMA 5FK8A 4AGGA 3IWZA 3U4SA 3LOIA 4CYDA 2QDRA 5DAWA 1CX1A 1SACA 5LA2A 1CPMA 1NG0A 4QD2A 3T2PA 1OVSA 2QCSB 1EV13 3PMEA 3ZXGA 4BYYA 1Q3EA 2OS2A 3ZFFC 4RL7A 1J1TA 2VXRA 3UKVA 1GOGA 1YJKA 1V6IA 4TYSA 4MO3M 1OQEA 2Q5TA 4XFBA 2B9UA 4CDUA 4KG8A 1Z7S2 3KV6A 3ZSKA 1VBC2 2AR6A 1IKPA 3GJBA 2LW8A 3NSTA 5C9AC 1C8NA 4WM8A 4MYEA 4EN0A 2BW8A 3FBYA 2R6QA 5A70A 4XACA 3F95A 5C3SA 2W39A 3FHQA 4XCBA 4YW1A 1LOAA 1IQAA 3EXUA 4A41A 3RNSA 1DP0A 4JGYC 4GH4B 3VBSA 3PVEA 4IESA 3WP6A 3MV01 2WFF2 4GWIA 4LO7A 4Y22B 1HJGA 5GALA 2C1FA 1EYBA 1JMUB 3CEWA 4QHBA 2Z2SB 3OEAA 1AR93 1SZBA 4FPEA 1RUC3 3WG4A 1W6QA 3WQBA 4CEYC 2E53A 1S0CA 1VP6A 3AKRA 4RN5A 1PK6A 2JD4A 3MICA 5JI9A 1OA4A 1X8EA 2MPFA 1JYCA 1ASJ1 1PO12 5EIYB 2WSUA 3VD9A 2VZQA 5FY9A 3ZYIB 3K48A 2HYXA 2Y64A 4LXLA 4PLNA 4EN8B 1ST8A 1Y9GA 3ITQA 4K21A 4Q0VA 2WA3A 3ILRA 1EPZA 1BK0A 4OLLA 5FDBA 1UKGA 4FBFA 2BWCA 4LA2A 5F5QA 3KQRA 4ZY9A 2ZGMA 5DG2A 1APNA 2GMEA 1B09A 1NOVA 5JZGB 2Y8KA 1N47A 3ME2A 3MF9A 4AVBA 3C7FA 4ORFA 4PIZA 3FMGA 3OGVA 3RG0A 1NCQB 2YFZA 1AYN3 2XH6A 3J9SA 4FFHA 4XUNA 1ZZ6A 5CFDB 1W3XA 3B94A 1JN2P 1MZEA 1SBFA 1RINA 1GQHA 2RJKA 5JPMB 3OUJA 3IPVB 1BKZA 3VHOA 1BCXA 5DDJ1 4AOCA 1CQ9A 4LORA 3OB8A 4CU9A 4LULA 5IVYA 1DYKA 5FZCA 2Q1MA 4Y22A 3VBUB 1BBT2 4JGZB 5J98B 4GMP1 2FD8A 1XU1A 2ZZJA 3E6BA 3NJVA 4KQ7A 3WG1A 5FMBA 2XBO3 2WBKA 4HT1T 3M3OA 4K1YA 4AFCA 3CO2A 2YUEA 1WMFA 2O8OA 2ZHLA 1UY3A 2PHXA 3PVNA 2UWCA 4OMCA 1RVF3 2EAKA 2YBKA 5DQ0A 2ORXA 4A3ZA 4GB33 4KU7A 1HRI3 2PN5A 5JOWA 4E4HA 1GWLA 3I3MA 4NN0A 3JZVA 3WLUA 2UYBA 2DVFA 3D0SA 2I07B 3FLTA 3HVDA 4BH9A 3AYAA 5JZGA 1CONA 4W4ZA 5A6YA 2VTFA 5FYTA 2VZTA 5CB7A 1NCQA 1ND2B 5DABA 5FTTC 5FZHA 4QB1A 1LECA 1QJFA 3EHKA 4IL7A 5CFDA 4GWMA 4RSUA 3OJBA 5T5JA 5DAPA 3CDZB 5F8PA 2XVLA 2P6HA 3IPVA 3NRUA 3I7DA 1GWMA 2MEV3 2BTVC 2NZ9A 3ZSEA 4Y4YA 4BDVB 1UYXA 2X29A 1JZ6A 3TNQA 4OHVA 5BNNB 1KJLA 2ZGPA 4KH9A 3BYWA 3TBDA 1W6PA 1WLDA 5HXMA 5C5UA 1QQP1 1S0IA 2ZGRA 4ZKTB 3B02A 1U5YA 2P3IA 1OKOA 2VNOA 4IE5A 3WNLA 2XMLA 3HQXA 4ASKA 5J36A 2JDAA 2KD7A 1W90A 2D5FA 2JE9A 2ZHNA 4LMFA 2ILMA 4Y3OA 1YHFA 2Q8EA 4E8DA 5K0UA 4OVEA 2O14A 4PDWC 1R082 2XGXA 1DFQA 2X53S 4QM8A 5FLIA 5KHHA 3VUOA 1C8M2 1V0AA 3JBG3 2PAMA 5IFTA 1H2KA 3I2DA 1YQ8A 4CVUA 3VB9A 4EWEA 2ZAAA 1XSQA 1UY4A 3INAA 4GULA 4Y1ZA 4YWAA 2FBEA 5FBJA 3SMHA 4BB3A 1RUD2 4XQDA 2E51A 1HB1A 3ACIA 2WLPA 3S5QA 3EJKA 4QU1A 3U07A 4AWDA 1KEXA 1I1EA 4A6OA 5FWJA 1ND2A 2P34A 3VZNA 3D82A 3K4ZA 4IEVA 4IV1B 4XQWA 5CBLA 4PF1A 1D4M1 1WMEA 3HNBM 4HKOA 5E8AA 2YZ4A 5FPUA 4NHXA 3DXUA 1Z0HA 2JE7A 2RR11 5A3TA 4ZS3A 1PVC2 3IIIA 1RUE2 2P37A 5IK5A 2VVFA 1O3QA 5C71A 1POV0 4PIYA 4XAAA 3THTA 4IEZA 4B8EA 5BNNA 2OYZA 2E31A 4CUCA 4B1MA 2RS53 4QB2A 4R4ZA 4E9KA 3GHMA 2BUKA 3M3IA 4HL0A 3NNFA 3B69A 1Q8OA 4XFFA 5A3PA 1AYM2 1HXS2 1WLCA 2A75A 2J1RA 4RGKA 4XJ8A 3RI8A 4A2UA 5IK4A 3VKOA 5HV4A 1RHI3 5FIXA 1ONAA 2QQIA 3CQOA 4LBQD 1RUG3 5D8AB 2CV6A 2IXIA 5HCFA 1ULDA 2CHHA 1HRV3 1NUKA 3MBWA 4HVOA 3D5OA 4XFHA 1XNBA 4NHMA 4Q0PA 3PIJA 4LOTA 1A8MA 2VOWA 3DPRC 3T1MA 2HWC2 3KT7A 2GALA 4RFRB 4AEDC 2YHJA 5JVVA 1OBNA 4CEWC 3CJXA 3KGLA 3ZYRA 1AR62 4BA6A 4LO6B 3NWKA 3IDCB 4PF5A 4D94A 2BV4A 1VBA2 3JQXA 4OYUA 2RDNA 1UW8A 3MI8A 3H8RA 2ZGTA 3K3NA 5CG9A 3AXDA 3WP3A 5JSPA 2BNNA 5FREA 2X10A 2X09A 2V09A 4N9IA 3KLSA 1UU5A 2K0GA 3LA2A 3P1IA 2RG4A 3KB5A 4P02B 4OULA 1UD1A 4YW3A 1VRH2 2R062 2ZABA 1IPJA 1WA4A 4FFGA 5CIRA 4LKSA 3LSDA 3NNLA 3NKTA 1SLAA 1PIV1 2EA7A 3GCWA 4JKLA 3Q9OA 4NPMA 5D8AA 2BBVA 3ST7A 1RUNA 1O8SA 2E9QA 3IAPA 2GNDA 1CAWB 4EWAA 2HWE1 1GLHA 3JCIA 3LB9A 1JYXA 4Q0UA 1OH3A 1TEIA 1ZRDA 3ZKYA 4XFIA 4XW3A 5J1XA 4CU8A 2WNEA 4JZRA 2OKXA 2C0ZA 3MIBA 3OTFA 2CL2A 4YNIA 2XDVA 2YMZA 3OCPA 1UCXA 3H1YA 2IXKA 2UY9A 4IW3A 2D6LX 1RYYA 1W03A 2XJQA 2ZX2A 4E2GA 1JOBA 3VBFB 1AR83 5A6XA 4S2GA 5KXCA 1EV11 1JI6A 4B7EA 4CRQA 1Y9MA 1ULPA 3U37A 1JOPA 4JDNA 3E5XA 4LBMA 4QQHA 4CE8A 1RUJ3 2TBVA 2BNMA 3O1MA 2VAUA 1NKGA 3OD0A 4RQPC 4YZ4A 5FFOC 5SV8A 4AF9A 1LJ7A 4IEQA 5F5AA 4AI1A 2P4EA 1G9AA 2Q1ZB 1M06G 3EMRA 4QPIC 2RS32 4RD7A 4AAPA 4V2WA 5K7PA 4ISQA 4JRLA 3KSCA 4CDXC 4I0BA 3K51A 2R0HA 4JQRA 4RFT0 3LKJA 2YY1A 1XQNA 3L9JT 1Q8QA 4OUEA 1YQ6A 4PQQA 1AR91 3W59A 3LWCA 5CKQA 3OGJA 4QM9A 1RUC1 1G86A 4P9LA 2VQ0A 4BIFA 4PLOA 3N7MA 2PHRA 4A3XA 4MV2A 1PNFA 1E5SA 1GANA 1QH7A 1AL22 2WZR3 4JGZC 5FYCA 2WT1A 3T4HB 3U14A 2W1QA 3BTYA 1OPOA 2ZEZA 2ZGOA 4XF0A 2OXBA 2H0BA 1XYNA 5ISLA 1OF3A 3BN6A 3J7LA 4YM2A 5AC92 3H1MA 2HEYF 2A1XA 4GKXA 5F39A 4JHZA 2BOIA 1NQDA 3AFKA 4CDWB 5A32A 4XF4A 4BQ2A 2WIIB 2XJUA 1VBB3 3JB4C 1AXZA 1UOBA 3POYA 4BCUA 4BE3A 1JODA 1NA1B 2WNVA 3WDVA 1KS4A 3GM8A 3HN3A 4JKKA 3AXEA 1OD5A 1YI7A 5DUUA 1Q43A 3VBHC 3GF6A 2VNGA 3MIEA 5JIUA 4YM3A 5LASA 3DL3A 4XJ9A 3PL0A 3ETQA 3IN9A 4YSFA 2W52A 2WR9A 4ZS2A 1XNDA 1YCIA 1VAKA 4MXVA 3H8OA 5DAVA 2UWBA 3W5NA 4M01A 4XFAA 3VLBB 1NCRC 3C2UA 1N3QA 3ZYJB 4URAA 3KCCA 2VU9A 1ZBA2 3MFCA 4Y1UA 4P9JA 4AGVA 2CWMA 4R52A 3IBMA 1QOSA 3POSA 4COYA 3VN4A 1VBC3 1JYNA 4YZ3A 3GCXA 3KMHA 1QJU2 2WUHA 1GZTA 2XBO1 1OLRA 2GN3A 2I2SA 2ZGQA 4YYOA 4G4FA 2A3WA 2B8MA 2A6ZA 4DMIA 1OHFA 2AENA 3CJIB 2WFF3 4GWNA 1RVF1 5F32A 5FXXA 4GB31 1C4RA 1HRI1 3ZR6A 4CDWA 5JPNB 3R05A 3VHPA 2O8QA 4MZUA 3VKLA 4JHTA 3BODA 1RXGA 3DECA 3AM2A 5JIAA 1REFA 2VW1A 2E32A 1PO13 4ZXEA 1RMU2 2VUCA 1OXCA 5FPLA 2W1UA 4LTAA 5F3CA 2ZEXA 3PMSA 1I6XA 2NMOA 1O3SA 1D0GA 1V70A 4L2NA 2CGOA 4R9BA 4QXCA 5JXHA 1RUF2 2PQSA 4X8PA 2H6CA 1G6NA 1U5ZA 1JXNA 3WQ7A 3JU9A 1YFYA 3OD4A 1QDOA 4IV1C 1X33A 1K5MA 3NV4A 2Z5WA 3PURA 2V73A 2VW0A 4YLZA 4Q4V2 4QXBA 4R9CA 4XETA 2HWF2 1G8WA 4MVTA 4CCCA 2XKOA 3ZFFB 2VCCA 3WX5A 5C4WB 5LRSA 1DGRN 4PJYA 4C91A 3KVAA 1CIWA 4FP2A 1MQTC 2HKXA 4ASLA 1JZ5A 4TXWA 3LPGA 3PU3A 1QJX3 3CKHA 5A1FA 4I09A 3FN9A 3LDBA 4IEPA 1BBT3 3JBG1 1YFWA 5C9AB 5JAXA 5KHIA 1F9KA 1CAUB 3P3NA 5ACA2 3HBKA 4NHKA 2PLV2 2YU1A 2HH9A 5GLVA 1AR72 1LEMA 2B39A 5IT6A 1ZRCA 1OMIA 1EPWA 1FYUA 1KFUL 1ZA7A 4JGYB 4W6YA 3WP4A 4ZU4A 1X8MA 3WUCA 4FAGA 4Z1VA 1MEC2 2OX0A 3FX3A 1US2A 4IE4A 1QHDA 1QJEA 3NAPB 3MGUA 1JZ7A 3EO6A 4AI2A 1JYIA 5FZOB 5K8SA 2AYHA 5FZLA 1ULEA 1SLLA 2JKBA 1O5LA 4CEYB 1MS8A 1COV3 5JXGA 1I5ZA 2EIBA 3HWJA 5LA9A 4JTNA 5IVVA 5FPXA 4MLOA 4D0QA 4QPGC 4YG6A 1ZZ7A 2NN8A 3SQOA 1DU3D 1XNKA 1HN1A 1DQ5A 1UO9A 5LRRA 4AQ6A 2JJ6A 4QKFA 5BNOA 1WCQA 1OUXA 4DUXA 2GNBA 3AYCA 2WO3A 4LKFA 3ZFFA 1RHI1 4EN7B 2OIIA 2QQUA 3WW4A 4AGRA 5F1RA 4FOQA 4Y1XA 3H50A 5SV5A 1T6GC 3UK9A 4OUSA 1E5RA 3MIDA 2WYFA 3B01A 1HRV1 5FYIA 1C57A 4CU7A 1FX5A 1OLQA 2DUOA 2ZX0A 4Q29A 4Y5Z0 5DZFA 3BOPA 3RZMA 3PHMA 4AEKA 4XTPA 2RS13 4RR3C 4BWOA 4EN9B 2D7FA 1J84A 1MZFA 1MS1A 1O5UA 2EXKA 4CSWA 4JV4A 2WO7A 1HN0A 4FXKB 3SKJE 1OURA 1BVVA 4KGQA 4MGTA 1R083 2DVAA 4WBBA 1VRBA 5FYSA 1V6NA 4DRRA 3TYJA 4YFWA 5FZOA 4TWTA 3ZMNA 1VBE2 1DDLA 1JZ3A 3S57A 2AREA 3TAYA 3VBFC 2D98A 3MIGA 1HQLA 1O4TA 1C1LA 1L7QA 1VAVA 5FZIA 1P8JA 5DPNA 5A7NA 1MVEA 4XF3A 5EV7A 4AL9A 1IGOA 4TN7A 3QACA 5JXIA 4E2QA 4BLJA 1IS6A 3K4AA 5I0DA 2C24A 2VE1A 4PIXA 1RJ7A 4QX5A 4XURA 1RUE3 4FOYA 4IXLA 4IEWA 4LR4A 2X05A 2SLIA 2ZZQA 3J4UH 2YDEA 1H6XA 2XQRA 3H7JA 3HD8B 2DCYA 4IE6A 3E6DA 4NRQA 3VBOC 2HLEA 3AL5A 5I93A 4YGDA 1OFSA 2F6BA 1UIJA 2VBDA 4XCAA 4DPNA 5F37A 5FUIA 2FCVA 2WT2A 4UBGA 1ZYBA 3VKMA 4A44A 1POV3 3RZHA 1V6LA 5FMCA 3WDYA 2FZ1A 3VV1A 2A5ZA 4LO5B 3ETPA 5EZWA 3PVOA 3AZWA 3O14A 1K42A 1AR81 1YRZA 4MUVA 1YQ5A 2RM21 4Q4X1 3ZXEA 4AFBA 3TEXA 1W6NA 4LK7A 5FLHA 5LA1A 1RUJ1 1F2NA 4Y26A 2I45A 2FDIA 1AX0A 1TNFA 2HWC3 4Z82A 5CZKA 2HJIA 4CCEA 4E27A 4CU6A 1KQRA 5EP9A 1AR63 4WM7A 5LBEA 1R091 4PDWB 1IOAA 4CA9A 4CCNA 1EUUA 3O1UA 2NQYA 5DUWA 4R9AA 5GJ6A 3HT2A 4H14A 4V1PA 1GP5A 1VBA3 3FHAA 3BUCA 2AC1A 3AP6A 1BMV1 4MOAA 1QXJA 2D5HA 4LITA 2QFEA 2GDFA 1W39A 4CPBA 5L73A 2BVBA 1T6BX 3SLIA 1LU1A 4ITCA 4COUA 4COZA 5H9PA 2K2SA 2W46A 5IVEA 3WP5A 2OUHA 3K75B 3M3CA 2R063 2ZMLA 4TZDA 1Y4WA 3PUIA 4RHV3 5FOBB 2GNMA 4MHUA 2RDRA 4I2OA 4C90A 1DHKB 2HEWF 1RUOA 2V4AA 2HWB3 3ACGA 3ROUA 4QX8A 3RQ0A 2P2KA 3S7EA 1LGCA 2RMU2 3FJSA 1H8TC 3NNJA 3K46A 3I49A 2CAVA 3GBWA 2VUAA 4EZHA 3I2IA 1VBB1 2VOXA 1JOJA 1N3OA 4J1WA 3CJIC 4K7JA 2Q8OA 1FV3A 2WLQA 1QJZA 4Y24A 2JDKA 5FZBA 2G9FA 5E88A 2R072 4PDWA 2IFRA 2XHKA 4Z2WA 1YFUA 3J7HA 5IATA 3SH4A 2J42A 3ABZA 5ANNA 3VGIA 2LROA 3FL7A 3T2OA 3GZEA 1AL0G 4K20A 3VZKA 4AEDB 5J96B 4CEWB 5FP7A 1NXMA 1LNSA 3I54A 1VBC1 4U36A 3AKQA 3N9NA 2JG9C 1CWPA 4DZGA 4DB5A 4CXXA 1W8NA 4AYUA 1J58A 1OQDA 2ZOEB 5CA6A 2E63A 3RZJA 1TQ5A 3USUB 3MW3A 4PQ9A 3NJZA 2GAUA 5DUXA 1LRHA 1GFF2 1LENA 1WW4A 3PJYA 4RA0A 3RVHA 1W06A 2B46X 1J3RA 4XDOA 4ES9A 1FV2A 4OHWA 5DMYA 1S2EA 3S6PA 5C4WC 3U75A 5GZGA 2XPJA 2NP0A 3FHIB 1D0HA 3A0KA 4I3GA 3WG2A 2DCZA 4LPLA 4DXSA 3WD5A 4L92A 1GV9A 3I3EA 2WJSA 1AL23 1CZSA 1OQ1A 1ZRFA 1PO11 2DU0A 2PA7A 3GBGA 1UZWA 3FUQA 4FP3A 4XZPA 5IHRA 3HT1A 3AK0A 4LJHA 3ZFGC 1CESA 1H8VA 4XBQA 4AK3A 4BQ5A 4RGGA 2CDOA 2CNAA 5AC93 1OOPC 1AXKA 5GLWA 4EROA 2TEPA 5LB6A 2W87A 1PNGA 3DPRA 3NAPC 4AEDA 3B93A 5CAZA 2DVBA 4I02A 4CEWA 2QBXA 3ZKUA 1NE6A 2BFUL 3BB6A 3MLJA 1GUIA 1FI2A 2WS93 4ZU7A 5JSRA 3LIGA 1PO23 2JDYA 1IS5A 1YYNA 2YV8A 3TN92 4CXWA 4BQ3A 2XR4A 3BVCA 3I97A 1KRIA 2Y0IA 2JWPA 3USUA 4F3JA 2BGCA 2P1BA 1CPNA 5EPAA 1W8WA 2FDJA 2R1BA 4RQPB 1QJX1 3BU0A 4BM8A 1DGLA 3RZKA 1ZBA3 5LBBA 1BBT1 4K40A 4D69A 4N9HA 2LRPA 4C1WA 4LIUA 1UXXX 3LAGA 2VPVA 1ND3C 3BIWE 2H6BA 3OPWA 4JRAA 4Q5OA 2EAAA 4QPIB 3I2JA 4GXLA 1RUH1 4CDXB 4KG0A 2B9VA 4QMAA 5J3UA 2VOVA 4XE9A 3NMBA 4XMIA 5H9QA 1FMD3 4BJ0A 4BK5A 4IEYA 4N53C 4DQAA 5FMOL 5FWEA 1ZBE3 2VULA 3RFRA 2XUMA 2Q30A 5T54A 4GH4A 3AZVA 2NMNA 3QBQA 3WT3A 1COV1 5A1LA 1ZZBA 1UPIA 1JW6A 3HR9A 1URXA 5G04L 4XJAA 1LHWA 4D7YA 3Q8BA 1TME2 3RYKA 3ZDSA 4M3CE 3TEYA 2VUDA 3V0AB 2P3JA 3N7KA 4LBOA 4R8HA 2JD9A 1RMU3 1CJDA 4RS5C 3VKNA 4Q4W1 4P9WA 4I3PA 1VMFA 2VW2A 3SCGA 1IZ3A 3R4UA 4CZSA 3VZLA 2PHFA 4JTOA 4RGAA 5A7OA 1UNBA 5T50A 1RUF3 1FOD2 1SLCA 2OA2A 2R1DA 2VMGA 1SLTA 1NLQA 3ES1A 4TSVA 1H2LA 4RQPA 3VBHB 4H55A 2EICA 4OCTA 3RDIA 4F8AA 3EB7A 4QPYA 2RS11 3I2KA 4P14A 4QPIA 1UPSA 4LKEA 2HWF3 4M4RA 4TLFA 3U0ZA 4CDXA 2UU8A 3JD71 2WN3A 2R041 5HCHA 2GSYA 2D44A 1NCRB 5J48A 4Q8LA 1I3HA 1QF3A 4FFIA 5LEKA 1R081 3WNNA 2WNUB 5E6HA 2PXJA 4GMP0 1YUDA 5FP8A 2KR2A 1TMF2 4YGCA 1J3QA 3VBRC 3EBRA 5ACA3 1WD4A 3H3UA 1NAEA 2PLV3 4DY3A 1TNRA 2VBBA 3LEMA 2GN7A 4JGZA 4XZUG 3VBUA 1WLWA 5GZFA 3VHNA 4YFZA 3VDAA 1E5IA 4E4DX 1MR5A 4QAWA 3V0AA 1WW7A 2Y34A 1HQWA 2Z69A 1POQA 2Z79A 1DQ4A 2RE9A 2HWD3 2VOKA 3ILFA 4MGQA 4FOVA 5JCTA 4F7ZA 2VG9A 4R9DA 5A3MA 4YRDA 4I01A 3DV8A 2DURA 5ERLA 3JXSA 4QDQA 1TVGA 2D93A 4XC9A 2AZ5A 5FP4A 2FCUA 5DAXA 3Q8FA 5FMDA 4FVVA 1S2BA 2FZ2A 2PAKA 1F15A 2XLFA 1VALA 2A6YA 4YVSC 3KT4A 1VB2A 3WNKA 2AGSA 1Y9QA 2BYVE 1BZWA 4JQTA 1DQ1A 1X9PA 2RJLA 4AW7A 4CCDA 5C70A 1G9BA 4EZ4A 1BYHA 1RL3A 4ZZ5A 2VM9A 1IPKA 2ATFA 4HKLA 5L19A 1V9U2 1H9WA 4Z8BA 3AC0A 2AEZA 1C5HA 1W9TA 2VNRA 4YM1A 2LM3A 2MNGA 2YGLA 4J25A 1DGRA 1H1AA 2E7QA 2G4IA 2Q8DA 4CCKA 5C3RA 3H1WA 1AR61 1MQTB 1QQP2 1UF2C 1W8TA 3LEGA 1X36A 5GM0A 3D4KA 3ZIXA 4AQ2A 3O1VA 3M70A 4C0HA 1VBA1 2VR4A 3OF1A 1NY72 5FR3A 1YWKA 3HQRA 3PNAA 4D8MA 1RUI3 5LW9A 2EF6A 1VBE3 3WQ0A 3TB0A 5FYUA 1H1IA 3UGHA 2WQ4A 1FAYA 3KT1A 2E7TA 3ZPOA 1LKNA 1R1ZA 4BU2A 1A8DA 1O4YA 4Q0SA 4OZOA 2ZBJA 3GHNA 4UW4A 3ZFEC 4C8DA 4WVZA 4YZ2A 5A6QA 1HV0A 2YPJA 2WZPP 3DYOA 2CY6A 4DO0A 1GNZA 5DG1A 4RHV1 2Y6LA 5E1RA 3BU7A 4QX7A 4UFLA 2JEMA 4HANA 2HWB1 2R0FA 2VTXJ 1IG0A 1D2SA 2CGNA 2V72A 4HOOA 5FZEA 4GKYA 4QPGB 5FP9A 5FP3A 4P9IA 4IV1A 1D4M2 1L7LA 5IUQA 2A6XA 3C7HA 5T5PA 3V64A 2VMCA 1UMZA 3B9IA 2RR12 2UURA 3VBSC 4UFIA 5C33A 4SLIA 3TEWA 2ARBA 3OEBA 2PTMA 2RVAA 2X5IC 4JAAA 1UY2A 4PCRA 2FQPA 1WBFA 3ZX7A 1MQTA 3GXUA 4R4XA 2GU9A 3LEIA 2EIGA 4YZ5A 3ZXAC 2Y6JA 4CPBD 3BPZA 5GZDA 5A3LA 1UYPA 2RV9A 1WWYA 3OBRA 4AXOA 1DGWA 4QKNA 2WKKA 2JB4A 1GNYA 1H30A 5EJZB 2WQ8A 1ZM1A 1GICA 4RR3B 2CYFA 3JQWA 3FLPA 4P9XA 2E7AA 2QDNA 2VXJA 4MGSA 3IZOA 4TLGA 2NLRA 3TOJA 4A4AA 3WF3A 5LK5A 1QU0A 4IQPA 2KM2A 3T2TA 5A3OA 1V00A 2JIJA 3POBA 5L9RA 3HBZA 1G9DA 5JMOA 4NRPA 5FJHA 3MZHA 5FZ3A 2A71A 1IHMA 3M2MA 3EQEA 1PX4A 2P3YA 5LWBA 1LAJA 4XYXA 4IUGA 3BTZA 3NV3A 3M4FA 3AMPA 4QPGA 2A3XA 1JZ4A 1QOOA 4AE2A 1W99A 2VZUA 3KV4A 2XXZA 1UN1A 4FPKA 2C4XA 2XB6C 4PLMA 2F17A 4B29A 4DIQA 4AQSA 4DXTA 1ZA4A 2FDKA 1AUYA 1CN1A 4FPYA 1MS5A 1OT5A 1AL21 5FUPA 3J8F2 3IMMA 2V5YA 1S2KA 5LA0A 4Z07A 2RMU3 2GC1A 1WW5A 2WWSA 4QQ2A 4W65A 3FFZA 4EE2A 5AC91 1Z78A 4BK4A 1LODA 1EAH2 1PIV2 3VBOB 2P17A 3JUUA 4ARYA 5J7MA 2WABA 1H4HA 1WZXA 5AVPA 4RR3A 4XFCA 3TEZA 5L7OB 3GYDA 2G9GA 4N7UA 1CAWA 2HWE2 4MADA 5CYYA 1OLMA 3IB3A 1DIWA 2WS91 3A23A 3L2HA 4YG3A 3WF0A 1FNYA 5IVJA 2R7EB 1O6UA 1PO21 2QQJA 3MPPG 2R073 4CTEA 3T3YA 2OZJA 2VMHA 2J1AA 1DGWX 4YPJA 1DCSA 1PGW1 3H3ZA 4ZONA 5FZMA 4XEZA 4QQLA 4IEOA 4TTGA 3RMXA 2ADDA 4IDZA 3WDUA 4D7SA 2PFWA 2Q1FA 2VY0A 3VBFA 3ZSLA 3NV2A 1EV12 4AR2A 1ZBA1 2VGDA 4D6QA 2W3JA 4BQYA 2FMDA 1UX6A 1YI9A 2OQ6A 3VD4A 4KWJA 4KMQA 4BMEA 5C7GA 4BPZA 1DYOA 4LBNA 1JYTA 4HFSA 4K1ZA 4HPKB 5H9SA 3U1XA 2FDFA 1AYN1 1KFXL 1QH6A 3NJYA 2ET1A 3DF0A 5C8CB 4IEXA 5CKNA 3H3LA 2DBIA 1V6OA 4KWUA 1FMD1 5CISA 1AJKA 2B7YA 2XOMA 4IE7A 1ZBE1 1WMDA 4XJZA 2GH2A 5BY5A 4MG2A 5F2SA 4XF1A 1Q5OA 2NM1A 4EYUA 2D3SA 1ENQA 2Y6GA 3H42B 5GZCA 3VBOA 1O4ZA 5K0UC 3TRSB 2EIEA 4K8RB 1T2XA 3FWEA 2WNUC 1W8HA 1DYPA 1Z7S3 1ZRRA 1AR92 1XPWA 3BOWA 4META 4MX3A 4OI2A 3BCWA 1RUC2 3WV6A 1WCKA 1YFXA 2QTWB 5E89A 2DWRA 2DCJA 4OI1A 1H8TB 2GNTA 3OGSA 2P5BA 4XUPA 3O0VA 4NRMA 1LTEA 5KHKA 5FZ8A 1REDA 1JBCA 2XHNA 3C3VA 1J59A 5FLJA 3LF7A 5G05L 3VHRA 3RPQA 4B3NA 1RUF1 3J7MA 3KGZA 3R6SA 2Y0OA 3SEPA 4UFJA 1W2TA 1OI6A 5I8YA 2WDBA 4CP1A 2Z4FA 5EJ1B 5FRAA 3ZYPA 4W6XA 2YC2A 2CGPA 4YARA 3SKVA 1RJ8A 4NAMA 2W95A 1NA1A 2ARXA 2NPIA 2XL7A 3KM5A 3O12A 2ZS6B 4XUQA 1JTZX 1XNAA 4HPKA 3TN93 3T2QA 2RJ2A 2XG3A 4YW4A 3RS6A 3T09A 3KZ4C 1QIQA 3MO4A 4WZFA 3M7AA 5EWSA 2DCKA 2WFPA 3CLPA 5IAXA 4QKDA 1JHNA 1GOHA 1ULFA 3PTRB 1SLBA 4FQ4A 2OUJA 3AMMA 3ASIA 2BFUS 2MEV1 3E5UA 2JG9B 4K6BA 5ACA1 2HBUA 2PLV1 5GZEA 2VZRA 2BZDA 2DTWA 2XJPA 1SFPA 2VZVA 2YBSA 1W8ZA 1JU4A 3AMQA 1QEXA 1XE7A 2YROA 3WEZA 3ZOIA 2YU2A 1TE1B 5GLUA 3OSDA 3ZM8A 3OG2A 1IQDC 2BPA2 1UX7A 2HWD1 1KGYA 2GMPA 2QQVA 3J7NA 4E2SA 3NNGA 1LHVA 3BIEA 3CJIA 1RVF2 3ZN5A 1EY2A 4GB32 1LGBA 4P9YA 1HRI2 2PHDA 3S5AA 4FTBA 3D6EA 2QQPA 1TME3 3N9MA 4ZU5A 2BDRA 4XIOA 4XOGA 5FQ0B 5FZGA 1NE4A 5EFUA 3ZFGB 3UESA 5JDBA 1NT0A 2JENA 4QX3A 2W08A 4KI5M 4UI9L 1OLME 1OOPB 4Y20B 4UOJA 5FMOS 3TWIA 1MPXA 5FAXA 2RHPA 3UT0A 2O1QA 2V4VA 1W0NA 5EQUA 3SITA 5D21A 2PMWB 4Y1YA 3H0OA 1G7YA 3A21A 3WW1A 1YLLA 5F6LB 4WVWA 1FOD3 1VE0A 3SCFA 3ZXKA 4FCAA 1O8PA 2JX9A 1S0BA 1BEV2 1MS9A 2MHFA 5DXDA 5A7WB 4QHOA 5D1IA 5A6ZA 4NIDA 4L9BA 2WN2A 3FE5A 3OYWB 4QB6A 2KXLA 3ZVXA 1FXZA 4G9SB 1B35C 4LKDA 2RS51 3RGBA 1CZVA 4BQXA 2ZEWA 1EP0A 4QXHA 3FZ3A 2ZA9A 4X6QB 1GZ9A 1SDDB 5LATA 4Q8KA 1W9YA 1NX9A 1QJY2 5C4WA 1RUI1 1E5HA 1TZOA 3KF5A 4K9SA 1DF0A 5A7SA 1ND3B 1VBE1 3SXWA 1TMF3 1RUG1 2VECA 4HLTA 1Y7BA 2ARAA 3AKTA 4NROA 3WDTA 3ZYHA 4CDQB 4NHLA 4Q26A 4A7ZA 1JS9A 5FYMA 5I0UA 4Z2AA 4MGKE 3JBG2 5C9AA 4D3WA 3KV5A 1CAUA 4GMP3 1SBEA 2BGPA 1N3PA 3ZMOA 1GOFA 1IS4A 1G9CA 2VJXA 3WQ1A 5FQ0A 4N53B 5HBAA 1ALYA 3AVSA 4M00A 3NKGA 3ZFGA 2A3YA 1PMHX 1LESA 1V6JA 4JGYA 2Q8CA 3B3QE 3B9CA 2VZ1A 1OOPA 3B7MA 4Y20A 4CUAA 4XILA 1H1MA 5KXBA 2B4KA 2QE3A 3DCQA 3A0NA 3C8XA 3NAPA 1N1VA 4WVMB 3LOBA 2WQZC 5HV0A 4XJUA 5FJKA 1C8M3 2DVDA 4EJRA 4XABA 1MS0A 5FY0A 3ZSMA 1XU2A 2JIGA 4Q1RA 1AJOA 4CEYA 2DTYA 5H9RA 4AFMA 3POFA 3UGGA 4RS5B 4LBQB 4ONUA 1UAIA 2ZEYA 3OYWA 3W21A 3C7EA 1RUD3 2VQUA 3AZZA 1DZQA 3LDKA 3WDWA 3ZLIA 3POIA 3ATGA 1UU4A 2XKPA 1GQGA 3KS7A 1ODMA 1O3RA 1J1LA 2KA3A 2ZGSA 1RHI2 2AUYA 4H3WA 4ZXKA 3THPA 1LCLA 5FY5A 3CZUA 2J7MA 1V9U3 5FZ6A 1PVC3 1FATA 4FQZA 4MH0E 4UBHA 3M3EA 3DEMA 3VDBA 1NLRA 4CCOA 3WZ1A 2DFBA 3SNMA 1TG7A 3MLLA 2EALA 2XJRA 1X82A 2YC4A 3LA7A 1FPN2 3POJA 5F9TA 1AYM3 1HXS3 2WNVC 4JDOA 4UW6A 2A73B 3IDBB 5L7OC 2TUNA 3FUOA 4NO4A 5I0TA 1PGL2 4AI0A 3VBRB 2Y26A 1LOCA 3LPFA 2ZCWA 3VZOA 4QU2A 4S2DA 4WVMA 3N9PA 1OA3A 5FKBA 4W8JA 1UZYA 3NO8A 3T0AA 2BWAA 5IK7A 3E97A 4IGOA 3K4DA 3AKSA 1JZ2A 5F3GA 2BJSA 4DINB 4RS5A 4LBQA 2WAAA 4Q4Y2 2XLAA 5LK7B 3VL9A 2VL4A 4NPRA 2D97A 3OPZA 1KJRA 2PHLA 3GZTB 4CCLA 2JDPA 4LA3A 5KHGA 4ZZ8A 4HVQA 3S0MA 1HJFA 4UFMA 4I0WB 1WLTA 2RMU1 3KCXA 2JECA 4OFGA 4WZCA 3O1SA 1SBDA 2GMMA 2W92A 1WD3A 1A3KA 3VZMA 5FZ9A 5A33B 5C8CC 4LUKA 5J09A 1OD3A 4IGQA 1RB8G 2CWSA 2VQTA 1U5IA 1R1A2 4AVSA 1XNTA 4YVSB 3W5MA 4XPVA 3I3BA 5FZFA 2EXHA 2ADEA 3MPBA 4GZ9A 4Q2FA 5EYYA 2ZXQA 4BIOA 2LALA 1VRH3 4FXGB 4HVRA 3UKTA 5KWRA 3FLRA 3WF1A 1LOGA 2ZJCA 2R071 3PLQA 2WZR1 4BQ4A 4PI2A 4UW3A 2IC1A 2ZMKA 5L36A 3E5QA 3W58A 3VBRA 1IG3A 1HDKA 1F8VA 5IVBA 3MYXA 4LE3A 1LB2A 2WL1A 1ULGA 3OGRA 3U4XA 2RM22 4Q4X2 5FY7A 3T0BA 2PQQA 3WNMA 4GWJA 5IVFA 1PMIA 3DKWA 4ES8A 2AH2A 4X6RB 5A1AA 4EQVA 1RC6A 2WRAA 1K5MC 1CD3G 1R092 3SCHA 1WKYA 3WINE 4X8NA 4AEJA 1HV1A 3I8TA 1Y43B 2FHRA 3WF4A 2LUWA 3D0JA 3H8UA 3BPSA 3RMYA 2Y6KA 3T0DA 4FTSA 3ZFEB 4PHZA 4OHZA 3HIFA 3ORJA 5FY1A 3HJRA 3L2YA 5C8WA 1XJAA 5FPBA 2DV9A 4UF0B 2YC0A 5LCWL 1PX3A 2XWBB 2ZPXA 3I2HA 1GMMA 3ZN4A 1Z7S1 1XYPA 5JOZA 4YVSA 1LGNA 1FNZA 1SEFA 3R4SA 3T08A 3RYRA 1LULA 4O7XA 2Y6HA 3J8F3 1O59A 2RS33 3BALA 4SBVA 3GBFA 1W6MB 1W9SA 5LBFA 1XBFA 4UT5A 4DS0A 3OBTA 3BKZA 1UY0A 3VBSB 1VR3A 3GALA 1EAH3 1PIV3 4NUBA 3ZN6B 2JG8C 5E16A 2WFF1 4AAXA 5BNQA 1GP4A 4KWKA 2GC0A 2X5IB 4MGYE 3N3HA 5C3PA 1H9PA 1QNWA 1LHUA 1YIPA 1DZTA 1YQ2A 2YB7A 1RXFA 1VBB2 2ZGKA 2VVDA 3HQUA 1KITA 3T1LA 2ZAHA 5CEHA 5AVAA 1VBD2 1WMXA 2ZGNA 1GSLA 3CZJA 1XE8A 1UMHA
chains in the Genus database with same CATH topology
1DQ6A 1DZRA 1QMJA 3N7LA 5AFEA 3N35A 5CG8A 4EWDA 3O5SA 5BNOC 4XBLA 2IXCA 3ZFEA 4PBOA 4HMZA 1W0PA 3G7DA 5CU1A 5CFCC 3V56A 2YYOA 1GZWB 2Q4SA 1DQ2A 4BOWA 3WOGA 3IM0A 3H9AA 4FAHA 1HW5A 1UKRA 5T55A 1QY4A 4OI4A 4LBLA 5JWPA 3FBMA 4UW5A 5FO8B 3ZXJA 3NV1A 3TNPB 1W0OA 1ENSA 4NWWA 1W6MA 3ZPYA 2I74A 1X7NA 4IERA 3CL1A 4AG4A 3ZN6A 2XJSA 4Q1PA 4NWVA 5ABJC 3RZZA 1FT9A 2X5IA 3AP5A 3UKNA 1TME1 1MVQA 4CDQC 1C3HA 4MSVA 4OZXA 1QJU3 3WUDA 3OY8B 4B4RA 1ZX5A 2DU1A 4LHLA 3OGGA 4O9EA 3DUIA 2YXSA 3UL2A 5GKAC 3ALQA 1WUVA 4QT6A 4XIKA 4OHXA 1U12A 1FOD1 1ZZ9A 3IIAA 4LLFA 5I91A 1KXGA 1JH5A 1PHMA 1GZWA 1YIFA 2B5HA 4E4ZA 1RITA 1ASJ2 1XNCA 4XHXA 4AHWA 4KGGA 4HSJA 2CTVA 1TMF1 1ENRA 1LR5A 1QJX2 1W6PB 3HAGA 3MW2A 2B45X 3SHRA 2QNKA 4Q4V3 3GNEA 4DY5A 4L99A 1RUH2 3OY8A 4MXWB 3VDDC 2OVUA 3W9AA 1CVNA 4M0NA 5K0UB 1A78A 4WM7C 2PAEA 2UWAA 3WVJA 4YZ1A 1VJ2A 2PHWA 4Q0QA 1C8M1 5DDJ2 4FPHA 1N1TA 4BQ1A 1COV2 4IV3C 5BUVA 2E6VA 4LO4B 1AR73 1YNAA 1OA2A 1RUD1 2OPKA 2R16A 4HSLA 5JOYA 3KCYA 1DLLA 1MEC3 1PVXA 2R49A 1F5FA 5J48A 3WY6A 5EJ3A 4N43C 1LOFC 1C1FA 1O91A 4QQPA 5I0RA 1MZ6A 4Q4W2 3ACLA 4XJWA 5BNPC 5BYNA 2CAUA 2W68A 2ZGUA 1QXRA 3MEPA 4P5HA 1BEV3 1W6OB 1V9U1 1PVC1 3U10A 1RUE1 2DFCA 3WNXA 1NLSA 3FC0A 2GC2A 3VBHA 4JDMA 4LT5A 3ENRA 1KS5A 1XRUA 4Y1VA 1D4VB 2ZX4A 4L8QA 4A7YA 1H0BA 2RS12 3MF6A 1AYM1 1HXS1 1ZREA 3M3QA 1POV1 1BQPA 2TNFA 4MXWA 1NY71 3JD72 1QJY3 2R042 3LGRA 4DOUA 1NCRA 3WCRA 5KHJA 4FT8A 1GYKA 1UIKA 3WXPA 2WNUA 4XMAA 4XFGA 4QQOA 4BLIA 5KXEA 3PVBB 2HWC1 2C5DA 1S0GA 2ZKNA 3CU7A 3QCWA 1W2UA 1IKQA 4XQ4A 5HCAA 2XLGA 4O9GA 3GZUC 3IMNA 2ZX1A 4YVWC 1MS3A 3QH6A 2PHUA 3O0WA 4YW2A 1UZZA 1W6OA 2BEOA 3G6JB 3JB8A 4KL1A 3R4DB 2VMIA 3ZXFA 4HKWA 3ZIWA 1VRH1 2R061 3S30A 1O3TA 4M0HA 4CDUC 1H2MA 4NVPA 4XF9A 5T5OA 4AHYA 3AB0A 1H2NA 2Y38A 1MACA 1ULCA 4LEJA 1HQNA 4WM8C 2ERFA 3RJRA 1S0FA 2D43A 3AKPA 3B5LB 1B35B 2IFWA 1AX1A 2ZACA 3UV9A 4FPFA 4LHKA 2ENRA 3N4MA 1OSGA 2HYKA 4QGNA 5FO7B 5JOXA 3I4IA 1FPN3 1QGLA 5FPZA 2IZWA 1U0AA 1OPMA 1HKDA 2XL9A 4LBJA 1QXPA 1PK6C 4COVA 5KBFA 1DQ0A 3B00A 2VVEA 1SCRA 3WR0A 2YGMA 2Q0AA 4LLOA 3O7OA 4GQ7A 4DFSA 4OUMA 2C9AA 1QDCA 2GC3A 2XJVA 5JR7B 4Q4Y3 3VKFC 4WVVA 1BVP1 3VL8A 1BJQA 1RGSA 2WT0A 5LEJA 3J8F1 1S55A 2RS31 4ATFA 1S0EA 4RHV2 1OFNA 5FO9B 2D6OX 2DYCA 3WDXA 4FPCA 1EAH1 2HWB2 2QUOA 3CNAA 4QGLA 4U2AA 1WCDJ 1AXYA 1R1A3 1B35A 2IXJA 1V6KA 1CAVB 2QZ3A 1VLNA 4GH4C 3QH7A 4S2FA 1NYWA 2EVXA 4ATEA 2ES3A 2ZHKA 1G9FA 4FPLA 4BZ4A 3ZYGA 3D8CA 2JICA 3MFAA 4FPOB 3BTAA 3URFA 3V0BB 2O0OA 4DXZA 3N36A 3LA3A 1MZ5A 4P9GA 4W6WA 1ZVFA 1MS4A 3DN7A 5A32B 1VB4A 1HX6A 1SFYA 1S0DA 2RM23 4Q4X3 2A70A 4AFDA 2WNVB 4JC1A 1V6MA 3AP9A 3N7JA 1XYOA 5GLZA 2PELA 1R093 3AJYA 3LSEA 4FPGA 1X50A 2A7AA 2ZMNA 5JZGC 2A6WA 3P3PA 4C1XA 4ASMB 2PYTA 1WBLA 1NCQC 3APBA 5CFDC 2EXJA 3M8LA 3SH3A 4AQTA 4A7KA 2W0XA 3RWNA 4HK9A 1CAVA 1QJU1 4LNVA 3LZZA 4N90A 4INDA 3VBUC 3AP4A 4YW5A 4BMBA 1RIRA 5DZEA 3V0BA 4XXAA 1VIWB 5FOJB 2VUJA 4J6GA 1NZCA 1SFNA 4UXAA 4PBPA 4EN6B 1VBD3 4FOWA 4KBBA 5L7OA 4AVAA 4AFAA 2R30A 1VAMA 5J37A 2WS92 3MIFA 4B7KA 5JSOA 1RMU1 5T52A 1PO22 3MW4A 5KXDA 1PGW2 3POWA 4GALA 3ES4A 4LO8A 1PZ9A 4XDQA 1CJPA 2OZ6A 3ZXLA 4HN1A 1ND2C 3SISA 1K5MB 1OKQA 2DF7A 4K8FA 3PJQA 4Q4V1 3WCSA 2HWF1 4N7IA 4QXKA 2DCTA 5BNNC 3HMYA 3AFGA 2GH8A 1AYN2 1YXWA 5C8CA 1BXHA 2OW4A 1FMD2 1NQJA 2XVKA 1ZBE2 3USSA 1C5IA 3AP7A 3AMHA 4YGEA 3RI9A 4IEUA 3ZXDA 1AR71 4CP2A 5TSWA 5F6KA 2H0VA 4L11A 1ENXA 3U11A 4AI8A 1MEC1 3DGTA 2JG8B 2A6VA 5HI0A 3GZAA 1H8TA 1S0JA 3HN1A 3QD6A 4CP0A 2XBO2 3I59B 3WHTA 2NYYA 3RJ2X 3WW3A 3RYPA 2ETEA 5I8SA 1BEV1 3IT8A 4HETA 2B42B 1CGPA 1KDKA 3A4UA 4AHZA 3IKWA 1LHNA 5JLVA 4AHXA 4C0BA 3MIHA 1D2QA 1Q8SA 2DUPA 1QNYA 3ILNA 2D3RA 3SH5A 1BK1A 5BNOB 4HK8A 3AMNA 1SLIA 3NW4A 1Y3TA 2IXHA 1ASJ3 2FMYA 1QJY1 5CFCB 5JMCA 2Z42A 2UY8A 3AZXA 1JUHA 1PZ8A 2X8KA 4COWA 5BXXA 2D40A 1C28A 4NR1A 1AHSA 4Q27A 2MEV2 1Q56A 2JG9A 4NOTA 5KC6A 4FSJA 2LTNA 4KU8A 1GBGA 1AZDA 4LUMA 5D8AC 2IXLA 5EYXA 1RUH3 4H7MA 3PTYA 4HZFA 1NXD1 2JG8A 1ZNPA 4EV0A 5ABJB 2N7GA 1ZZCA 3I59A 2HWD2 2D6PA 5DDJ3 2ZKLA 1SQ4A 1RTVA 3QLQA 4BHPA 4JVAA 4AVTA 2QZ2A 5CNAA 3AYDA 5FBZA 3WHUA 1AVBA 4HN0A 4Q4W3 1UL9A 4D7TA 4IETA 4DRVA 2QJVA 1PZ7A 3VZJA 2PHTA 2D3PA 5CFCA 1GKBA 1I9RA 2DVGA 1IS3A 1LHOA 2ZTNA 5T3NA 2ET7A 5I0SA 2D6NA 4S2HA 3R0RA 1F5JA 1N1YA 3E6CC 1FPN1 5C6CA 3CF6E 4GA9A 3X29B 2RS52 3WW2A 4XBNA 4FO9A 1PGL1 5FCCA 1GR3A 4G3YC 3JD73 2D6MA 2R043 4LE4A 4J1XA 5ABJA 2WA4A 2XJTA 1RUI2 1YJLA 2R32A 1ND3A 1W6NB 1RUG2 2JDZA 3H7YA 4FPJA 5HCBA 3WG3A 4CDQA 4OI0A 3VDDB 1HRV2 4WV8A 2BVVA 4Q4Y1 4WM7B 1CX4A 1QQP3 1PGSA 4AVCA 1SCSA 4N53A 4AI3A 1WGPA 3AZYA 4I30A 2ZGLA 1JUIA 5IK8A 4IV3B 1ZZ8A 5KC5A 1J3PA 4Z92B 4LHNA 1GZCA 1LOEA 1L3JA 3O0XA 1R1A1 5HXVA 1LEDA 1CR7A 4DNYA 4XTMA 4N43B 4I0AA 4YG0A 5DUVA 2F4PA 4F83A 5BNPB 2DUQA 2HEVF 1WCSA 2BNOA 4AVVA 1UU6A 3FFQA 1YO8A 4MGZE 5DZGA 2QKDA 5BV6A 1AX2A 1QKQA 2K9ZA 5EXOA 4B4QA 3UJQA 1D4M3 2GZWA 3RRDA 3V65A 3ZSJA 1LOBA 1DBNA 2EXIA 2RR13 1A6CA 4M3CB 5K9YA 1N1SA 1O7FA 1HLCA 1AF9A 2VQAA 1KD7A 3VDDA 1CAXB 3AYEA 2VH9A 1REEA 4E4SA 2SBAA 4CDWC 5GLTA 3UJOA 4XHBA 5AFBA 1HIXA 1WW6A 1RUNA 1SDWA 2WINB 1DG6A 2ZX3A 1U5XA 1NA1C 1QOTA 2QVSB 1LU2A 2UYAA 5CADA 1PM7A 4URTA 2BQPA 2JXAA 4OHYA 1F31A 4IV3A 4FTEA 1AR82 3J26N 2ZHMA 5T5LA 2WSVA 3QOPA 1RUJ2 4QGMA 4N43A 1LOFA 4MGIE 4GIQA 4YVWB 3LCPA 1H4GA 5BNPA 5I8TA 3KD4A 1E57A 1GNHA 4JCKA 3MLKA 3M1HA 1BMV2 1XXNA 1KDMA 3NVCA 5BPXA 1SMVA 2D6KA 5CVRA 3S7IA 4B4PA 1QWRA 4K3UA 4KWLA 5A33A 3ECQA 4CDUB 4YGBA 4M3CA 1VBD1 4WM8B 3ZO0B 2P3KA 3AX4A 1CAXA 1S1AA 1Q8VA 4M3CF 2WZR2 3ELNA 4LBKA 2XWJB 1M4WA 3MDPA 4KNCA 2IWGB 4L97A 4YM0A 5JI7A 3DPRB 5B2GB 1Q8PA 2XVGA 4H7LA 4ISRA 4XXPA 1W6QB 3RSJA 2WC2A 2HWE3 4HBNA 1PK6B 3AJZA 3IDEA 4YVWA 3TN91 3NL1A 4AEMA 4AGGA 3IWZA 3LOIA 4CYDA 2QDRA 1SACA 1CPMA 1NG0A 4QD2A 3ZXGA 2QCSB 1EV13 3PMEA 4BYYA 1Q3EA 3ZFFC 4RL7A 2VXRA 1J1TA 3UKVA 1YJKA 1V6IA 4TYSA 1OQEA 2Q5TA 4XFBA 2B9UA 4CDUA 4KG8A 1Z7S2 3ZSKA 1VBC2 2AR6A 1IKPA 3NSTA 5C9AC 1C8NA 4WM8A 4MYEA 4EN0A 2BW8A 3FBYA 2R6QA 2W39A 4YW1A 1LOAA 1IQAA 3EXUA 3RNSA 4JGYC 4GH4B 3VBSA 3PVEA 4IESA 3WP6A 2WFF2 4LO7A 4Y22B 5GALA 2C1FA 1EYBA 3CEWA 4QHBA 2Z2SB 1AR93 4FPEA 1RUC3 3WG4A 1W6QA 4CEYC 2E53A 1S0CA 1VP6A 3AKRA 1PK6A 2JD4A 3MICA 5JI9A 1OA4A 1X8EA 2MPFA 1JYCA 1ASJ1 1PO12 2WSUA 3ZYIB 3K48A 4EN8B 4PLNA 4Q0VA 4K21A 2WA3A 3ILRA 1EPZA 4OLLA 5FDBA 1UKGA 4FBFA 2BWCA 4LA2A 5F5QA 3KQRA 2ZGMA 5DG2A 1APNA 2GMEA 1B09A 1NOVA 5JZGB 1N47A 3ME2A 3MF9A 4AVBA 4ORFA 4PIZA 3FMGA 3RG0A 1NCQB 1AYN3 2XH6A 3J9SA 5CFDB 1ZZ6A 3B94A 1JN2P 1MZEA 1SBFA 1RINA 1GQHA 2RJKA 5JPMB 3IPVB 1BKZA 3VHOA 1BCXA 5DDJ1 1CQ9A 4LULA 1DYKA 2Q1MA 4Y22A 3VBUB 1BBT2 4JGZB 5J98B 4GMP1 1XU1A 2ZZJA 3E6BA 4KQ7A 3WG1A 2XBO3 4HT1T 3M3OA 4K1YA 4AFCA 3CO2A 2YUEA 1WMFA 2O8OA 2ZHLA 3PVNA 2PHXA 2UWCA 1RVF3 2EAKA 4GB33 4KU7A 1HRI3 2PN5A 4NN0A 3JZVA 3WLUA 2UYBA 2DVFA 3D0SA 2I07B 3FLTA 4BH9A 3AYAA 5JZGA 1CONA 5CB7A 1NCQA 1ND2B 5FTTC 1LECA 3EHKA 5CFDA 4IL7A 4GWMA 4RSUA 3OJBA 5T5JA 2XVLA 3IPVA 3I7DA 2MEV3 2BTVC 2NZ9A 3ZSEA 4Y4YA 2X29A 3TNQA 4OHVA 5BNNB 1KJLA 2ZGPA 4KH9A 3TBDA 1W6PA 1WLDA 1QQP1 1S0IA 2ZGRA 4ZKTB 3B02A 1U5YA 2P3IA 2VNOA 3HQXA 5J36A 2D5FA 2JE9A 2ZHNA 2ILMA 1YHFA 5K0UA 4OVEA 4PDWC 1R082 2XGXA 1DFQA 2X53S 4QM8A 5FLIA 5KHHA 3VUOA 1C8M2 3JBG3 2PAMA 1H2KA 3I2DA 4EWEA 2ZAAA 3INAA 4GULA 4Y1ZA 2FBEA 3SMHA 1RUD2 4XQDA 2E51A 2WLPA 3EJKA 3U07A 4AWDA 1I1EA 1ND2A 2P34A 3VZNA 3D82A 4IEVA 4IV1B 4XQWA 5CBLA 1D4M1 1WMEA 4HKOA 5E8AA 2YZ4A 1Z0HA 2JE7A 2RR11 1PVC2 1RUE2 2P37A 5IK5A 2VVFA 1O3QA 1POV0 4PIYA 3THTA 4B8EA 4IEZA 5BNNA 2OYZA 2RS53 4R4ZA 4E9KA 3GHMA 2BUKA 3M3IA 4HL0A 3B69A 1Q8OA 4XFFA 1AYM2 1HXS2 1WLCA 2A75A 4XJ8A 3RI8A 4A2UA 5IK4A 3VKOA 1RHI3 1ONAA 4LBQD 1RUG3 5D8AB 2CV6A 2IXIA 5HCFA 1ULDA 1HRV3 4HVOA 4XFHA 3D5OA 1XNBA 4NHMA 4Q0PA 1A8MA 2VOWA 3DPRC 3T1MA 2HWC2 3KT7A 2GALA 4AEDC 2YHJA 5JVVA 4CEWC 3CJXA 3KGLA 3ZYRA 1AR62 4BA6A 4LO6B 3NWKA 3IDCB 4PF5A 4D94A 1VBA2 3JQXA 1UW8A 3MI8A 2ZGTA 3AXDA 3WP3A 5JSPA 2BNNA 5FREA 2V09A 4N9IA 3KLSA 1UU5A 2K0GA 3LA2A 3KB5A 4OULA 1UD1A 4YW3A 1VRH2 2R062 2ZABA 1IPJA 1WA4A 5CIRA 3LSDA 3NKTA 1SLAA 1PIV1 2EA7A 3Q9OA 5D8AA 2BBVA 3ST7A 2E9QA 1CAWB 2GNDA 4EWAA 2HWE1 1GLHA 3JCIA 3LB9A 4Q0UA 1TEIA 1ZRDA 4XFIA 4XW3A 2WNEA 2C0ZA 3MIBA 3OTFA 2CL2A 4YNIA 3OCPA 2YMZA 1UCXA 3H1YA 2IXKA 2UY9A 2D6LX 2XJQA 2ZX2A 4E2GA 3VBFB 1AR83 4S2GA 5KXCA 1EV11 4B7EA 4CRQA 4JDNA 3E5XA 4LBMA 4QQHA 1RUJ3 2TBVA 2BNMA 4YZ4A 5FFOC 3OD0A 4RQPC 5SV8A 4AF9A 1LJ7A 4IEQA 4AI1A 1G9AA 2Q1ZB 1M06G 4QPIC 2RS32 4RD7A 5K7PA 4ISQA 4JRLA 3KSCA 4CDXC 4I0BA 3K51A 2R0HA 4JQRA 4RFT0 3LKJA 2YY1A 1XQNA 3L9JT 1Q8QA 1AR91 3W59A 3LWCA 3OGJA 4QM9A 1RUC1 1G86A 4P9LA 2VQ0A 4BIFA 4PLOA 3N7MA 2PHRA 4A3XA 4MV2A 1PNFA 1QH7A 1GANA 4JGZC 2WZR3 1AL22 2WT1A 1OPOA 2ZGOA 4XF0A 2H0BA 1XYNA 5AC92 4YM2A 3H1MA 2HEYF 4GKXA 5A32A 1NQDA 3AFKA 4CDWB 4XF4A 2WIIB 2XJUA 1VBB3 3JB4C 1AXZA 3POYA 4BCUA 4BE3A 1NA1B 2WNVA 3WDVA 1KS4A 3AXEA 1OD5A 1YI7A 5DUUA 1Q43A 3VBHC 3GF6A 2VNGA 3MIEA 5JIUA 4YM3A 3DL3A 4XJ9A 4YSFA 3ETQA 3IN9A 2W52A 1XNDA 1YCIA 1VAKA 4MXVA 2UWBA 4M01A 4XFAA 3VLBB 1NCRC 3C2UA 1N3QA 3ZYJB 3KCCA 2VU9A 1ZBA2 3MFCA 4Y1UA 4P9JA 4AGVA 2CWMA 4R52A 3IBMA 1QOSA 3POSA 4COYA 3VN4A 1VBC3 4YZ3A 3KMHA 1QJU2 2XBO1 1OLRA 2GN3A 2I2SA 2ZGQA 4YYOA 4G4FA 2A3WA 2B8MA 2A6ZA 4DMIA 1OHFA 2AENA 3CJIB 2WFF3 4GWNA 1RVF1 4GB31 1C4RA 1HRI1 4CDWA 5JPNB 3R05A 3VHPA 2O8QA 4MZUA 3VKLA 3BODA 3AM2A 5JIAA 1REFA 2VW1A 1PO13 1RMU2 4LTAA 3PMSA 1I6XA 2NMOA 1O3SA 1D0GA 1V70A 4L2NA 2CGOA 4R9BA 1RUF2 4X8PA 2H6CA 1G6NA 1U5ZA 1JXNA 3WQ7A 3JU9A 1YFYA 3OD4A 1QDOA 4IV1C 1X33A 1K5MA 3NV4A 2Z5WA 4YLZA 2V73A 2VW0A 4Q4V2 4R9CA 4XETA 2HWF2 1G8WA 4MVTA 2XKOA 3ZFFB 3WX5A 5C4WB 5LRSA 1DGRN 4PJYA 4C91A 1CIWA 4FP2A 1MQTC 2HKXA 4ASLA 1QJX3 4I09A 4IEPA 1BBT3 3JBG1 1YFWA 5C9AB 5JAXA 5KHIA 1F9KA 1CAUB 3P3NA 5ACA2 4NHKA 2PLV2 5GLVA 1AR72 1LEMA 2B39A 5IT6A 1ZRCA 1OMIA 1EPWA 1FYUA 1KFUL 4JGYB 4W6YA 3WP4A 3WUCA 4ZU4A 1X8MA 4FAGA 4Z1VA 1MEC2 3FX3A 1QHDA 3NAPB 3MGUA 3EO6A 4AI2A 1JYIA 5K8SA 2AYHA 1ULEA 1SLLA 2JKBA 1O5LA 4CEYB 1MS8A 1COV3 1I5ZA 3HWJA 4JTNA 5FPXA 4MLOA 4QPGC 4YG6A 1ZZ7A 2NN8A 1DU3D 1XNKA 5LRRA 1DQ5A 4AQ6A 2JJ6A 5BNOA 2GNBA 3AYCA 3ZFFA 1RHI1 4EN7B 2OIIA 3WW4A 4AGRA 5F1RA 4FOQA 4Y1XA 3H50A 5SV5A 1T6GC 3UK9A 4OUSA 3MIDA 3B01A 1HRV1 1C57A 1FX5A 1OLQA 2DUOA 2ZX0A 4Q29A 4Y5Z0 5DZFA 3BOPA 3PHMA 4AEKA 4XTPA 2RS13 4RR3C 4BWOA 4EN9B 2D7FA 1MS1A 1MZFA 1O5UA 2EXKA 4JV4A 4FXKB 1BVVA 4KGQA 1R083 2DVAA 4WBBA 4DRRA <