1VMJA

Crystal structure of a putative thiamin phosphate synthase (tm0723) from thermotoga maritima msb8 at 1.52 a resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
139
structure length
139
Chain Sequence
MKSYRKELWFHTKRRREFINITPLLEECVRESGIKEGLLLCNAMHITASVFINDDEPGLHHDFEVWLEKLAPEKPYSQYKHNDTGEDNADAHLKRTIMGREVVIAITDRKMDLGPWEQVFYGEFDGMRPKRVLVKIIGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords hypothetical protein TM0723
publication title Crystal structure of hypothetical protein (TM0723) from Thermotoga maritima at 1.52 A resolution
rcsb
source organism Thermotoga maritima
total genus 47
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2004-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01894 UPF0047 Uncharacterised protein family UPF0047
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.460 Mainly Beta Sandwich Jelly Rolls YjbQ-like 1vmjA00
1VMHA 1VE0A 1VPHA 2P6HA 1XBFA 2CU5A 1VMJA 2P6CA 1VMFA
chains in the Genus database with same CATH superfamily
2D6NA 2ZMLA 3PVEA 3KV6A 1S2BA 3VBHC 1FAYA 2XJSA 3I8TA 1F4HA 1HQWA 2WINB 1UY3A 3FLPA 1VALA 4GXLA 2AC1A 3OGVA 4CDXA 2BERA 4LBNA 2WZR1 3NNJA 1NA1B 5D1IA 1ZRIA 3THPA 5EZWA 1LHVA 1GZ9A 1RUC3 2D5FA 2XR4A 3PHMA 4COYA 1DQ0A 1WCDJ 4M01A 1QGLA 4IV1A 4DPNA 5FZ0A 2W1WA 1GANA 3FLTA 2EAKA 4HZFA 4AXOA 4TZDA 4LKFA 2QQVA 4UFKA 5AVPA 1AL21 2XKPA 4L8QA 3WW4A 2W0XA 3OPTA 4AQTA 1MZ5A 1JUHA 5D8AA 3RZGA 1S55A 2E7TA 3AVSA 4IQPA 5F39A 3ZSMA 4D6QA 3LKJA 1LOGA 3MFCA 3AMQA 4HOOA 2WNVB 3NV1A 4JCKA 4LO4B 3IDCB 1DG6A 2Y0IA 1UX6A 1H9PA 1POQA 1YJLA 3KD4A 4KMQA 1S0JA 5FZBA 4BHPA 4BQXA 4JAAA 3C8XA 2A6YA 3POWA 4LK6A 5BY5A 5FFOC 1C5HA 1F2NA 1PM7A 1LU2A 1PZ9A 1UAIA 1UOJA 2R0HA 3MF6A 4LO7A 3T09A 1A34A 2DCZA 2AGSA 3R6SA 1WLDA 4BISA 1VBC2 1LODA 4GJZA 4RHV3 3AC0A 3AZVA 2BOJA 3ZXAC 4LLOA 4GMP3 2NMOA 2WT0A 3T4HB 2W9XA 4JKKA 3N9LA 4LBMA 1RMU2 4OHZA 3U0ZA 1S0DA 2P6CA 2VMDA 1WA4A 3CZJA 3GNEA 4FPJA 4QKNA 4DY3A 4XACA 2R073 2E32A 1YNAA 3EBRA 4I0BA 5C4WB 3PUSA 4LBOA 2E53A 5FZFA 5KR7A 2QUOA 3WW1A 5GLVA 1ULEA 2ZX3A 1KITA 3J8F2 4Y3OA 5J48A 1JZ7A 2HWE2 1SLLA 1DU3D 5EYXA 3WV6A 1XOYA 1G7YA 1NA1A 3N9OA 4N7UA 1CWPA 4JVAA 5KHHA 3B9IA 3AP5A 2DVGA 2NZ9A 2RS51 1UX7A 3IDEA 4J1XA 3KLSA 4HKWA 5GLWA 5A80A 1CX1A 1WCUA 2JKXA 4QQ2A 1RUD2 2CWSA 2GH2A 2YGLA 4F3JA 3PVBB 1CIWA 4CU9A 2XGXA 2R063 4YVWC 4OI0A 3AMPA 4YW5A 1L7QA 2JD9A 1NAEA 3QLQA 1W06A 4W4ZA 2VOVA 3JCIA 5DDJ1 2WNVA 4QDRA 1MS1A 3RYRA 2C4XA 2F4PA 3ZO0B 3SQOA 4XF0A 2OZJA 1JU3A 5LBCA 2ZACA 3HIFA 1PHMA 4QT6A 1QOOA 4PQ9A 4ZHNA 1LHWA 5JUVA 4AI8A 5BNNC 2Y34A 5HPOA 1BEV1 1W2AX 4N53A 5DAVA 3KT7A 3NJZA 2WFF1 3FUQA 5LA9A 3M7AA 1SCRA 4COUA 3HVDA 1QJEA 2VQUA 4YW1A 1E5RA 1UZ0A 1MEC2 1G8WA 1DBNA 3I2HA 5L7OA 5FY5A 2JDAA 4E2SA 2YYOA 4RHV1 5ANNA 4NPRA 3S7IA 3HPNA 5IAVA 1QIQA 3D6EA 1LEDA 2I2SA 3PVNA 3FE5A 3VDDC 1QDCA 1V6KA 3KWVA 1R64A 5I0DA 1QJY3 2KXLA 4LO8A 1REFA 1X9PA 2C9KA 2RR12 2WNUB 3NVCA 5A7PA 2PQSA 3V0BB 1RUF3 4BE3A 4DEVA 5JSRA 3R05A 4GH4B 4LIVA 4FAHA 4IEOA 2JJ6A 1HB4A 4Q8KA 3AX4A 3FLRA 2R16A 4NHLA 1OA2A 1QQP2 2RV9A 3H8OA 1DHKB 3H3ZA 1KQRA 3OEBA 3FWEA 4LOTA 4A6SA 4OUEA 3I54A 4GMP0 3BTZA 1MPXA 4IGPA 1WWYA 1MR5A 1XC6A 2EIEA 2IXJA 4CCLA 2A73B 4XMAA 3HBZA 3RZMA 1RXFA 3KCXA 2QQPA 2R6QA 2VW0A 2WABA 2CU5A 3ZXEA 1HXS2 3ZVXA 1RUJ1 3UESA 3GM8A 4MHUA 5FREA 5ANQA 2W1UA 1S1AA 4PDWB 4IUGA 1PO11 1QNWA 4E2QA 3LCPA 3MIGA 2UWCA 4FTEA 2XDVA 1W39A 3Q8BA 3NQHA 1UYXA 1VR3A 1AYN1 2GH8A 5FZ3A 4XAEA 2VZPA 5CZKA 1GQHA 3POIA 5DUUA 4CP2A 3O0WA 1HQNA 2N7GA 4RGAA 3W58A 1VMJA 2BV4A 2YDEA 2JEMA 2XOMA 3KMHA 4GD4A 1C4RA 5FJHA 3K51A 3W20A 2WJSA 4XZPA 4QX2A 2X53S 1VP6A 3AMNA 1RUC2 4QHZA 4RS5A 5I0UA 4GB31 2CDPA 2QQOA 3P3NA 3LOBA 1YUDA 4XFHA 1RINA 3UJQA 2VH9A 1CVNA 4EZ4A 4B7KA 4QXHA 2J1SA 1H2MA 4LBLA 5CBLA 2Q4SA 3OG2A 4Q4W3 3GF6A 1CAUB 2FQPA 3KZ4C 1CX4A 3WOGA 4FOQA 2IXIA 4N9IA 5F5AA 2FZ1A 1NX9A 1REEA 2HWF3 5FPAA 3BU0A 2BTVC 4BQ5A 5F8PA 1X8MA 3A23A 2E6VA 1COV1 3T2TA 1GP5A 4FOVA 5D2AA 5E1RA 5FY0A 4CXWA 5JZGC 1YO8A 2EA7A 3POJA 3KF5A 4MSVA 2ES3A 1VLNA 5C8CB 3AL5A 2W68A 3JD73 4Y4YA 2YB7A 1UYPA 2WL1A 4A3XA 4ZZ5A 1BLZA 1RIRA 2ZHLA 3RVHA 4WZFA 5JXGA 3FBYA 1GOHA 3GZUC 1UKGA 4EYUA 4NIIA 1UKRA 2D40A 1DDLA 2QCSB 2B46X 4TN7A 4CA9A 1VRH2 5GKAC 4EWAA 4G4FA 2GC1A 3NNFA 3UGFA 5DZGA 3UL2A 3VZOA 3KF3A 2Z69A 2OT7A 3M8LA 2RS13 3H3UA 4OI4A 4LE3A 3FZ3A 2RS53 1QEXA 2RS31 4CCNA 2VM9A 4AK3A 4QPIC 1WCQA 4QX5A 1OUXA 1UXZA 2W92A 3VD3A 3ECQA 1ENSA 3MUZ1 1D0GA 3I59B 4HT1T 3BTYA 5IVJA 1H4GA 2LROA 3AJZA 4XFCA 4JGYB 4BK5A 3ZN6B 5EJ1B 1RXGA 2G4IA 1ZREA 1XE0A 3GHNA 1CGPA 5SV5A 1XBFA 1ALYA 2R062 1F5JA 4LBQD 1KXGA 2XVLA 4A7YA 4XQDA 4AEDA 4OQ9A 4OYUA 2FCVA 2JDHA 1JN2P 1V6MA 2JDUA 1UN1A 2C24A 4NWWA 3VBOC 2GNBA 3I2DA 3VD4A 2GN3A 1W6OB 2B9UA 3URFA 4CXYA 1AXZA 4FFGA 1HN0A 2BDRA 1UPIA 4ISQA 1J1TA 2W39A 3IAQA 4AHXA 4LORA 2VCCA 1OH4A 2E33A 1FI2A 4N43B 2DWRA 2HWF1 4L2NA 4AEKA 4HFSA 3U75A 3C7FA 5L9BA 3FFZA 4C90A 3ZDVA 1AUYA 4CTEA 4AZZA 4BB3A 4JRLA 4FPCA 5I91A 4KQ7A 1YQ5A 1JYTA 5CFCC 5L36A 3AKPA 1HJFA 4BU2A 3KQRA 2J1RA 2Y33A 2Y6KA 3JD71 3VUOA 2OUJA 5A7WB 4Q4X2 4NPMA 4C1WA 4XMIA 1LGNA 5K4LA 5AC93 2IUWA 3SEPA 3FC0A 3LA2A 4UFJA 3HQUA 3RRDA 3UETA 1QXPA 3D5OA 3ZFEC 2ZGQA 3U14A 5T50A 2BUKA 3NAPC 2HKXA 1QJY2 4PBOA 3ZDSA 4YVWA 1W6PA 3HMYA 3ACFA 1GNYA 1TQ5A 1RUF2 3NRUA 5C7GA 2WAOA 1NQJA 2ENRA 3Q8CA 4ES8A 4PIYA 1UF2C 1ZYBA 3X29B 5C3SA 2HYXA 3B3QE 5BNOC 4XQWA 3RZZA 2WN3A 1N3OA 2ZEZA 4QPGC 3VBRC 1JS9A 1ULOA 2PLV3 4GQ7A 3ZOIA 2QQWA 4EWDA 2VZUA 2YPDA 4M0HA 4P9JA 1JODA 4PBPA 4Q4Y2 2XHKA 1NLRA 4LKSA 5L73A 4YARA 3MGUA 3PUAA 2V5YA 5KXBA 4NMIA 3NJXA 3WHUA 1B35C 5F5CA 1W04A 3VV1A 3WNLA 1TMF3 1JU4A 3B69A 3K4ZA 1I5PA 1ND3B 2ZAAA 4URTA 2MEV2 1FV3A 3IB3A 2BU9A 2KA3A 1SACA 3AKSA 4B8EA 3ATGA 4F83A 2B42B 5FY7A 3E97A 1MZEA 1R091 3ZSLA 5A7WA 4BQ2A 1BBT2 4QXBA 1FPN2 1W8FA 1QWRA 2YBPA 5CADA 1T6BX 5FZLA 4EROA 1PIV3 2QQKA 3EXUA 2RE9A 3SKJE 1JYCA 3RWKX 1PK6C 2K9ZA 3R4SA 3PTRB 1J58A 2OA2A 1BVP1 4YFWA 4HPKA 5FKCA 5FZOB 3DPRB 4DO0A 4EN6B 5CISA 1N1SA 1UU6A 3CIHA 3ZKUA 2O0OA 3RQ0A 1VBD2 2SLIA 4EN0A 5AC91 2XJRA 1NLQA 2GSYA 2Z42A 2VNOA 4KU8A 2UURA 1W3VA 3PLQA 5F37A 1OVPA 2PAKA 4LHLA 4Q4W2 4M4RA 5ISLA 5H9QA 3VGIA 3BOWA 4Q0UA 5JOWA 5A6XA 5F3GA 1UOBA 2ZEYA 1SLAA 5LB6A 5IK5A 2DVAA 1WMXA 2CGPA 4XABA 3W5MA 1JOJA 1UMIA 1Z0HA 4QB6A 4OULA 3ZXJA 4UYBA 4XVHA 1ZBA3 2PLV1 3WF2A 1W2NA 4AHWA 4CU6A 3A21A 3ENRA 5BYNA 4AVVA 4XHBA 5FZ6A 4L97A 4LHNA 4D69A 4KWJA 5HBAA 4MVTA 3J7HA 1RB8G 2GU9A 1LCLA 1X82A 2BNNA 2G9GA 1TVGA 2IVIB 4IEYA 4M3CB 4Q0PA 2VOWA 4AFMA 2BZDA 2IVJA 1ULCA 4E8CA 1TMF1 2RS12 2XUMA 4LHSA 1O4ZA 4W8JA 4ARYA 5FYVA 2YXSA 3JU9A 1POV3 3LA3A 1QJU3 2QDNA 4IV3B 4N8MA 2PHFA 4Q4V2 3MZHA 4GAZA 2DVFA 4JQRA 1WGPA 1H8TB 4QQOA 5FZOA 3LE0A 3RGBA 1UZYA 4JKMA 2CL2A 3FN9A 5F32A 4UFLA 2ZHNA 4AHZA 1MS3A 3FL7A 4TYSA 5BNPC 1CAVB 4FPLA 4IV1C 2Q8DA 2PXJA 2WIIB 5CG9A 4NOTA 1PNGA 2DF7A 2W46A 1PGW2 1GOFA 5D8AC 5D21A 3VKOA 2Y38A 3WUDA 3J7MA 2VR4A 1OXCA 1C1LA 4JDOA 1Q8OA 5HCFA 2ZOEB 1V6OA 3OOXA 4W6WA 4XJ8A 1WLTA 2ARAA 2RMU3 2WNOA 1HRV3 1FXZA 1RTVA 4DUVA 1KJRA 2P17A 2MHFA 3T2PA 1WD3A 5KXDA 2VVFA 3O1PA 1W8UA 3ABZA 3CQOA 3D8CA 4YG3A 1BCXA 4FPYA 1JW6A 4XFAA 4GZ9A 2W3JA 4Q0VA 3RS6A 3OBZA 3R4DB 5J98B 1MACA 1VAKA 1ZRFA 2TUNA 3WDXA 3VN4A 1Y3TA 4ZPIA 2JE7A 4Y22B 4BQ4A 4M0NA 1ZZBA 2FDGA 3AYCA 3MICA 1HRI1 1FV2A 2XL7A 3AB0A 2ZGOA 5CG8A 1GICA 4M3CA 1H1MA 1YWKA 4QPIA 1RVF3 1ZBA1 4NPLA 2JD4A 2RJLA 4P9IA 4YYOA 2VZQA 4AVCA 4WBBA 3ST7A 1DYOA 3V56A 3N7MA 2JX9A 4CZSA 1LGCA 1OLRA 2WZEA 2XL9A 3AP9A 5CKNA 1QDOA 4UWDA 2CDOA 4IEUA 1IS6A 1UWWA 1NA1C 4YW6A 4D7SA 3OUJA 3FBMA 3TRSB 2D98A 1K5MB 4MXWB 2VZRA 2KD7A 5T52A 2XKOA 3J9SA 4EZHA 1JZ6A 2D3RA 3POEA 2YG0A 3LB9A 4EJRA 2FZ2A 2B8MA 3LOIA 4K1ZA 1CAXA 2VGDA 3AL6A 3B93A 1EPZA 1SPPB 2AEYA 4RSUA 4YVSB 1VBA2 1D4M2 2V72A 2WNVC 3MIDA 2VE1A 2W94A 3A22A 5FYMA 3RI8A 3U07A 4HVQA 5KXEA 2BEOA 1OLQA 2B39A 4HVRA 5JXHA 1WW4A 2VNVA 2P37A 4XAAA 3WF3A 5LBEA 5HV4A 5JLVA 4NHXA 1J83A 3NSTA 4OHXA 2E63A 1QXJA 1IS4A 1UIKA 1J84A 1R1ZA 1QJFA 3O14A 1RMU3 4OHVA 2BBVA 3FX3A 2RMU1 2WKKA 1POV0 2HWD3 5C5TA 3S5AA 4Y22A 5T55A 4RGGA 1CAWB 4KWLA 5FIXA 1PM4A 3DKWA 4L9BA 1AJKA 4AQSA 3S5QA 1RGSA 4YG0A 4AOCA 3J8F3 2YBKA 3P6BA 4XILA 1V9U2 1YEWA 5GZFA 5C4WC 2HWE3 3W9AA 3KB5A 4BOWA 3EQEA 2VZVA 4WVWA 5LWBA 3NAPA 1PIV2 1GU3A 1YJKA 2A71A 2BW8A 3BTXA 4Z8BA 1QOSA 1SLTA 5FV3A 1RUD3 4AVSA 2XLGA 4XTMA 4CDWA 2ILMA 3PU3A 1W9WA 4WM7B 1F15A 5FPUA 4Y33A 4B4PA 3GZEA 1G9CA 4B7EA 3WF1A 3MHZA 5FP7A 3SCHA 4AI2A 5BNOA 4PI2A 3CU7A 1H1IA 2HEWF 4QPGA 3OGSA 5H9PA 1LEMA 1CQ9A 4ZXEA 3VBRA 4AF9A 3HNYM 4WZCA 5A3LA 5DMYA 4W50A 1WW7A 3USUA 4LOSA 4FAGA 2ZJCA 4COZA 3RYPA 4YM0A 3N4MA 5LRRA 3P3PA 2QE3A 2ET1A 3CO2A 3ZYFA 4CDUB 4FPHA 5JXIA 1J3QA 3AYDA 3OB8A 1X9TA 3IZOA 2XB6C 5FZGA 2P4EA 3ZYPA 2D6PA 3O12A 1EP0A 4ZU4A 5FYIA 1UPSA 1IHMA 4CEYB 1KS4A 3ZX7A 3BGAA 2B9VA 4XTPA 3DKQA 3CJIB 4JC1A 4E9KA 4NE9A 1GZWA 4N90A 1HLCA 3AP7A 4I02A 2GMMA 3OCPA 1CAWA 3ZYJB 3MW2A 1AR92 1VBC1 2BWAA 2JWPA 4N9HA 5DG1A 4AWDA 1W6QB 4CE8A 1SBDA 2JDYA 3TBDA 1W8HA 1RMU1 3APBA 1H6YA 1GNHA 1UZZA 2OQ6A 2R042 3ZM8A 4DNYA 5CIRA 1NXD1 1DQ4A 1SLBA 3IWZA 4FO9A 5IVBA 2BPA2 3DV8A 1QJU2 2UWAA 3C7EA 4OI1A 5J1XA 4Q26A 3WP3A 3T2QA 2C6SA 2XXZA 1CJDA 3MEPA 1XYPA 2WO3A 5LY1A 3J8F1 3LEMA 2WNUC 3GBWA 1ZNPA 1HKDA 2HWE1 1CPMA 2P6HA 2ZGNA 2FD8A 1DLCA 3DYMA 4PJYA 3VZJA 5DN2A 5JSPA 1QQP3 1L7LA 2NQYA 4BQYA 4Y5TA 2VO5A 1MS5A 3F95A 3ES1A 2UYAA 1RUD1 1XYOA 1UO9A 2D3SA 1WLCA 4HSLA 2WAAA 4OZXA 1ODMA 4UF0A 4NHKA 2Q1ZB 5F6LB 5FPVA 1WZXA 3ZIWA 4PLOA 4QD2A 2VMHA 4HANA 3NNMA 4CDUA 2Y6GA 3ZIXA 1NY72 4K21A 3BIEA 1Q43A 1S0BA 1H4HA 1HRV2 1HXS3 1OI6A 4AI1A 5CNAA 4RA0A 1AYM2 1XE7A 2JKBA 3AFGA 3O7OA 5HXMA 5GZDA 4QM8A 4ZONA 2JECA 2VECA 1XJAA 1O59A 5C70A 1AR83 1H6XA 2CY6A 3HNMA 4Q29A 5F9TA 3CJIA 4YWAA 3POYA 3T1LA 4NAOA 3E6DA 2ORZA 2WN2A 3HN1A 4V2WA 5FPLA 4I30A 3D4KA 4E4ZA 2FDKA 2VAUA 3BOPA 1IZ3A 3VLBB 2PAMA 1LJ7A 3AJYA 1QXRA 3DYPA 4D94A 3O5SA 4CYDA 1W6QA 1G9BA 3LPGA 3ROUA 1RVF2 3U78A 3EB7A 2BQPA 2LALA 4AEMA 1PO21 2B5HA 3AZZA 1MEC1 1UYZA 1LU1A 2ZX0A 4LKDA 3UJOA 2C9AA 2J1VA 2QQUA 1JYIA 1FOD2 5BNPA 1DCSA 2GC2A 1KD7A 2YGMA 4GALA 3WUCA 5IK7A 5FPBA 3GBGA 5FWEA 3KS7A 3TEYA 3WF4A 3MO4A 1DZQA 1OBNA 1YQ2A 2RR11 1H2LA 4HN1A 3OYWA 4QGMA 1NXMA 2QBXA 4RYDA 1YRZA 4QGNA 5F5IA 5KBFA 4P5YA 4AEDC 5A32A 3KHCA 3VD5A 1OLME 4FP2A 1PGSA 3PMSA 3ETQA 4QQHA 2IXHA 1UL9A 5GLTA 3CJXA 2RVAA 2E7AA 3HEIA 1WLWA 3HOBA 3JBG3 1STMA 3MYXA 3KQ4B 2SBAA 1IQDC 3AYEA 2VTXJ 3LQCA 5C8CC 2AR6A 1KFXL 2JG8B 3IPVA 1JZ4A 1PVXA 4LO5B 5CYYA 3I3QA 3ZXDA 4E2GA 1RJ8A 4MHRA 4NRMA 4YM1A 5FRAA 1VRH3 5FUPA 4Y5SA 2HWD2 5F3CA 1HXS1 3CKHA 3HQXA 4H3WA 1V00A 2XQRA 3FHIB 4IEXA 4XIKA 2Q5TA 4BQ1A 5ABJB 2R49A 3N9NA 2PYTA 3ZR6A 1LTEA 2PQQA 1V6LA 4D6RA 1DYPA 4Y1XA 3ZN4A 4XF3A 1CZTA 2JE8A 3HD8B 4I0WB 2JXAA 1OQDA 1CJPA 2IXCA 3GJAA 4YSFA 1PMJX 3NJVA 4RFRB 2ZTNA 1KFUL 2W2IA 2EIDA 1DGLA 4CUAA 2GP5A 4IEPA 3OY8B 1VB4A 1YFWA 1W6MB 2VQ0A 4JGYC 4LHKA 4A7KA 1DLLA 3IT8A 2AZ5A 2Y6FA 3TAYA 3UKTA 2GNMA 2ARCA 1RUC1 4YGCA 3I2GA 3H1MA 1LOFC 4IE0A 3ITQA 4FPGA 3ORJA 3GYDA 4LKEA 4SBVA 4XDOA 5KHIA 1PVC2 4QQLA 1MQTB 4A44A 1W99A 4CPBA 1Y9GA 4QU1A 5JWPA 2A6XA 2QFEA 1GV9A 3WW2A 1X33A 4HONA 1YQ8A 2VL4A 2YV8A 2JE9A 2E51A 1SG3A 1GSLA 2HEVF 4XBLA 1MS4A 1QJZA 5FKBA 5KWRA 3RMXA 5FDBA 4N43C 3GDBA 1I3HA 5FZ8A 2WYFA 5LK5A 3BALA 1M4WA 1YQCA 3FHQA 2QJVA 5FYHA 3U11A 1PMIA 3ACGA 4Q4X3 2DU1A 3JQWA 1AHSA 2DCKA 4IEZA 4WVVA 5C4WA 3VZKA 1QHDA 2AEZA 3WNNA 4CP0A 3RNSA 4DB5A 4IE4A 3ELNA 4GMP1 4QDQA 2F4LA 1SLCA 1VRH1 4D8MA 1SZBA 2ZGPA 3OUIA 4NO4A 2R071 2VNRA 4IE6A 1BK1A 1K45A 2GNTA 3IDAA 1RJ7A 5HXVA 2RJ2A 2EIBA 5K7PA 3P1IA 3O0VA 1XSRA 1K12A 5DAWA 1MZFA 2I07B 3RZLA 4ZS3A 2ZX2A 2R7EB 2JDKA 5DQ0A 1FNYA 3HQRA 4Q0SA 2OX0A 4Y1VA 2ZABA 1QOTA 1MZ6A 5HV0A 4A45A 5F2SA 1KEXA 3VBSB 4JX0A 5DZEA 2TEPA 2ZZQA 5F5QA 4HL0A 4OMDA 4BZ4A 5I8TA 1S0FA 2XJVA 4J25A 4Q4Y3 4X8PA 1OC1A 5C5UA 3ILRA 4YPJA 2R061 4IE7A 5FZEA 4ZZ8A 4S2HA 1XNAA 1IKPA 4I3PA 5FP8A 4DMIA 1AR73 2J22A 1IPSA 1W9SA 4S2FA 4HMZA 1O8SA 5IJRA 3A4UA 2XVGA 4RR3B 2VMEA 3SH3A 1BXHA 3B01A 1S4CA 2YMZA 1VAVA 2L9LA 3GCWA 2PHLA 1AR82 2MEV3 4WM8B 2LS6A 4YW4A 4A41A 3DL3A 1OT5A 1RC6A 5EJZB 4P9LA 5AFEA 1SLIA 1ND3C 5J96B 2NM1A 4MXVA 1UY0A 1BBT3 1FPN3 5A3UA 1GOGA 4MOAA 3H8RA 3OPZA 2CSGA 5CKQA 3KGLA 4PF1A 3I2IA 2ZHMA 4UW5A 4XCBA 4K9SA 5F6KA 2Y6JA 3H1WA 3KSCA 5IVCA 4Q4X1 4N7IA 2QQLA 2WNUA 3DYOA 2OYZA 3TWIA 4X8NA 1LOBA 1AX1A 3EHKA 1OQEA 5FZ1A 1OD3A 1VBD3 3DPRC 3F2ZA 5DUVA 2WQZC 2ADDA 2FCTA 2MPFA 4PLMA 5KC6A 2VMFA 1LGBA 4GH4A 2VCAA 3VBHB 2Z2SB 3O1OA 5C9AB 1NG0A 2FDJA 4NWVA 3BTAA 2W91A 3LSEA 1QJY1 5FO7B 3S0MA 1XU2A 2XWBB 4YW3A 2VQTA 4CUGA 4I01A 4H14A 4KU7A 3GZTB 4R4XA 1RUF1 3GGLA 4BLJA 1ZZ7A 1YXWA 3LFIA 3MPBA 2FDFA 4ASKA 1RUH2 2R1BA 1N1TA 3OJBA 1YYNA 3WP6A 1HB1A 3ZFGB 2P1BA 1RUNA 5DDJ2 2X05A 4AW7A 3JBG2 3WZ1A 3PIJA 1ENQA 2VW1A 4RR3A 3I2KA 4FFFA 3O1MA 4PDWA 3WNXA 3LDBA 4Q4Y1 1WMEA 3BB6A 3HBKA 1UOFA 3AYAA 4ZU7A 2E26A 1QY4A 1W6NB 4Z2WA 4K8RB 1A3KA 2ARXA 3W59A 4LLFA 3ZFFB 3R0RA 2DU0A 3VZLA 2NYYA 4KH9A 3KV9A 2LW8A 1QF3A 1W28A 5FMOL 1Q8PA 2MEV1 5CFDB 4JTOA 4Q4V3 4CRQA 4K6BA 3FHAA 2A75A 2WRAA 1XNBA 4Q5OA 3UNPA 1ODNA 1FPN1 4IV3C 5FZCA 3DN7A 4LBJA 1W8NA 1OQ1A 1H8TC 3M3OA 4DFSA 4PI0A 2V09A 1D0HA 2YFUA 3POSA 4AQ2A 3AXDA 2QQMA 3E5UA 5I8YA 3L9JT 2RM22 3VD7A 2Z5WA 5C9AA 1A6CA 1DGWA 2BNMA 1G9DA 3FUOA 1CAUA 1IG3A 5FZAA 5IT6A 1BHGA 1QKQA 2PN5A 5FR3A 2E31A 2QTWB 1IOAA 5B4XA 3PMEA 4K3UA 2CV6A 4D7YA 4UFHA 4DXTA 3DXTA 4Q4W1 5C8CA 4HK9A 3U4SA 2G9ZA 3MF9A 3UGHA 4QGLA 3CZUA 2WWSA 3MIEA 5A1FA 4QPWA 4J1WA 1W05A 1XU1A 2V4AA 2RDNA 4SLIA 4NN0A 1W9TA 2EIGA 4FPEA 4BM8A 5FP4A 2ZX1A 1S2KA 1W6NA 4CU7A 3ACIA 1O3QA 3IBMA 1RUJ2 2A3WA 3ZFFA 2YC4A 3WR0A 3I2OA 4B4QA 2X09A 5GM0A 1DQ6A 4XUTA 4L0PA 5CFDA 2ZHKA 2QNKA 2AREA 3JXSA 2XJUA 3LGRA 4JGZB 1FX5A 4AAXA 1OD5A 1HIXA 2VPVA 1HX6A 4RQPB 2AACA 4XQ4A 1YCIA 1IQAA 1RUI3 3I59A 5FCCA 1BJQA 4QX8A 2RS11 2P3IA 4JGYA 3M3CA 3ZN6A 4OUMA 4CDWC 1UZWA 4JKLA 4Q4V1 4A6OA 5EP9A 1WBLA 2PHTA 4TXWA 1LOFA 1N1VA 1K5MC 4AGRA 2R30A 4EQVA 4FFHA 4QX1A 4GB32 1VBA3 1D4M3 3QBQA 1UW8A 1Y9MA 3T08A 2A5ZA 1W6OA 2XLFA 3LF7A 1VBB2 2X5IB 3TOJA 4FPFA 4YVSC 5GLUA 1AF9A 4XCAA 2Q8OA 1PGW1 4C0HA 3TN92 5FWJA 1AR72 1O7FA 4N43A 4R4ZA 5FUIA 1XSQA 2RHPA 2HEYF 4YW2A 4DZGA 2ET7A 3RZJA 3ON7A 1J3RA 2K46A 1BMV2 4YGEA 3WP4A 4IETA 4W6XA 2VG9A 5IW0A 3ZYRA 3ME2A 4HKOA 3AP4A 3ACLA 4DY5A 5JSOA 2E9QA 2IFRA 2JICA 4I0AA 2WZPP 5LATA 3BI3A 1V9U3 2YUEA 3BYWA 1QNYA 4HN0A 2P34A 4XF1A 4DRRA 4CP9B 3DGTA 3D0JA 5A3NA 3O0XA 5A7QA 3ZYBA 3KCYA 3MUY1 3SKVA 5L19A 4NAMA 4XUNA 5DPNA 4LBQB 1JHNA 1JHJA 2A3YA 2IZWA 3ES4A 1F5FA 4HG6B 1FT9A 5C8WA 1CD3G 3AZWA 3I49A 2RS32 1F31A 2B7YA 1APNA 3FJSA 3DEMA 4H2AA 5I0RA 2K0GA 4WM7C 4Q0QA 4EN8B 3E5XA 2XBO3 4QXKA 2XH6A 1GZCA 2XJTA 3KT4A 5IUQA 3J7NA 1RHI2 5T3NA 3VB9A 4K20A 1O4YA 3K46A 3RSJA 1Q3EA 1REDA 2VXJA 3D3AA 2ZA9A 3QACA 4FCAA 4JRAA 2X5IA 4B1MA 1U12A 2W1QA 2GALA 5IVVA 3VZMA 4CDUC 3PJQA 1LOCA 4CCDA 5F7UA 1OKOA 3PURA 4LJHA 2B45X 2V4VA 4YGDA 3DUIA 3WT3A 1U5YA 1D4M1 1GUIA 1YI9A 2JG9B 4O7XA 4QPYA 5FYTA 3LPFA 1OHFA 2UWBA 2E7QA 4HK8A 4CEYC 2V5DA 5JI7A 5A1LA 2EXHA 1ND3A 5FZKA 1PX3A 5FYZA 3CJIC 1PZ8A 2MNGA 2HWC2 2WYSA 3MIFA 1AR93 3K77A 5FQ0B 4CXXA 4J6GA 5LY2A 3MLLA 3OUHA 4S2DA 2XJQA 3IIIA 5FPZA 4X6RB 3ZPOA 5LA1A 1RL3A 2J1EA 2NMNA 3WSOA 4AGVA 2B4KA 2ZEWA 1JBCA 3ZPYA 2R043 4OCTA 1H1AA 2GAUA 1DGRA 2UYBA 5LBBA 1J1LA 3D0SA 5E8AA 2C1FA 2OIIA 4NIHA 4QU2A 5H9RA 4D0QA 1Y9QA 2PA7A 2ZCWA 4LBQA 1OH3A 2VVEA 3SH5A 1UOGA 2WSVA 3DPRA 1LNSA 2PTMA 2HWB2 2TBVA 1V9U1 2OW4A 4IGOA 4YRDA 2G1MA 3E5QA 3VHRA 3KHBA 1PIV1 1J59A 5AVAA 4JDNA 3VKMA 2EVXA 3POGA 5JOXA 5L9RA 2AYHA 5FMCA 3VKLA 5IK4A 3OSDA 2VMIA 3KGZA 2FHRA 4JTNA 3TNQA 1BKZA 4ONUA 4WV8A 4URAA 1AYM3 4JZRA 2VZOA 1RUE3 4C91A 4MV2A 3B9CA 2ZPXA 5LZ6A 1FMD2 3H42B 2JG9A 1V6NA 2P5BA 1EAH2 2PHDA 1JZ2A 1AX2A 4JDMA 5EPAA 1ENXA 1DP0A 4NVPA 4BDVB 2Z79A 4FBFA 5JOZA 1JZ3A 2VBPA 5F1RA 1AJOA 5CVRA 4HBNA 4UW4A 5IFPA 1NUKA 3VKFC 1DQ2A 2X29A 2BVVA 2WQ8A 3N7KA 2Y64A 3WG1A 4OI2A 4GWJA 1ACCA 1SCSA 4IV3A 5BUVA 5T5LA 1AR91 2VUDA 1KDKA 3SCFA 2IC1A 1LOAA 1FOD3 4LMFA 1H8TA 5KC5A 4MGYE 3TEWA 3BODA 2DFBA 3SLIA 1RUI2 2DBIA 5FY4A 4IDZA 5GZGA 2RDRA 1VMFA 2R041 2O14A 1US2A 1CAVA 2NPIA 3VHPA 1H9WA 2WR9A 3V64A 1POV1 3MDPA 1QJU1 5T5JA 5LK7B 4CCEA 2I74A 3VHNA 4IW3A 4BXFA 3G6JB 1WCSA 4CDQB 3WVJA 2WS92 2ZAHA 3ZFEB 4P5HA 1NZIA 5E6HA 2ZGLA 2P3KA 3WD5A 3MV01 2YU1A 3SNMA 2QKDA 1N3QA 2HH9A 1B09A 2DUPA 3VBFB 2DCJA 3JB8A 1MS9A 1NE6A 1K3IA 1U5IA 2D97A 3PL0A 4XURA 2W08A 3JUUA 3ZKYA 1SDDB 4GJYA 4FT8A 4P14A 1NY71 3S6PA 3J7LA 3QH7A 3H8UA 2UU8A 4XFFA 4LPLA 3WQ1A 4LULA 1AX0A 1HRV1 1Z7S2 2JG8C 3L2HA 4NRPA 4V1PA 2BRTA 1Q5OA 4KL1A 3RI9A 1ZZCA 2VBBA 3LDRA 4LXLA 4Q1RA 1IPJA 1ULFA 1W9FA 3KT1A 2FBEA 1H30A 3TNPB 1NKGA 2ZGTA 2PHUA 1OOPB 3HWJA 4XBQA 5FP3A 4XHXA 3Q8AA 2OS2A 2OVUA 5C3OA 3WP5A 1C8M3 1VMHA 3AKQA 2YU2A 4PT6A 2D6LX 4Y20B 5JR2A 3MBWA 2BGPA 4BLIA 5FYUA 1GBGA 2ZMNA 1RVF1 4D3WA 3GJBA 3I2FA 1YLLA 5JAXA 4YM2A 5AFBA 1K5MA 4MXWA 3I7DA 1TME2 2GC0A 1O5UA 2HLEA 4DRVA 3H3LA 2Q8EA 2XBO2 2J7MA 4XF4A 1FOD1 4MO3M 4XJAA 3N7LA 5EWSA 2ORXA 1MS0A 4H55A 1SPPA 1PVC3 3LIHA 4IEVA 4YVSA 2PAEA 1H2NA 3V0BA 4HKLA 3O1UA 1JUIA 3ZXFA 4ARXA 3B02A 4AGGA 3GXUA 1X50A 3IMNA 4I09A 4RFT0 5C71A 5A7OA 3G7DA 1VBE3 2V73A 4EN7B 3NO8A 5FK7A 1XNDA 1D4VB 1R083 2JENA 2ZMKA 5HCBA 1CN1A 2ADEA 3MPPG 1GQPA 2Y0OA 5KHGA 1CPNA 1DF0A 2NLRA 1R1A2 3H0OA 1F4AA 3PU8A 1ND2B 3PVOA 5IVYA 4DXRA 4FPKA 5A33B 2OXBA 1DIWA 4YGBA 5DUXA 1BK0A 4CU8A 2UY8A 3OGJA 3ZSEA 1RYYA 3LAGA 5C3RA 5FMDA 4D7TA 4IL7A 1N47A 1GFF2 3VDBA 1V6JA 2OQ7A 2BGOA 2DDUA 4TLGA 4Y24A 4AAPA 3LSDA 3C7GA 3POBA 5DAQA 1ZA7A 2A3XA 5FZIA 2CAVA 4AVBA 3AVRA 1OLMA 2HWD1 1SFPA 1YIFA 5JIAA 2YBSA 2QQJA 5A1AA 4Y20A 3WX5A 1WCKA 2BJSA 2GZWA 4CPBD 3AFKA 1ZA4A 4L11A 2BFUL 2JDZA 2Q8CA 2RJKA 4WM7A 1C57A 4PF5A 2D6KA 3ZSKA 3NV3A 1XRUA 3VKNA 5CKMA 1GKBA 4KWKA 3J4UH 5K8SA 5HCHA 1JXNA 1Y4WA 1FYUA 2GDFA 3NKGA 3VBUB 5F2WA 4Y5Z0 2O1QA 2R32A 4XIOA 4GH4C 3M3QA 4JV4A 4TLFA 1E5SA 2QZ3A 2VJXA 1AL23 1N3PA 2HBTA 5IWFA 4CDXB 1DYKA 1O91A 2W87A 3VBSC 2C0ZA 2YC0A 3QCWA 3WHTA 5FJKA 3POFA 4BQWA 2K2SA 2G19A 1US3A 2W1SA 4IV1B 1WUVA 3VDCA 4CEYA 3TB0A 4FP3A 1RUE2 3RZHA 1PVC1 4MGQA 1SEFA 3A0KA 4CCJA 3V65A 4RR3C 3IKWA 2VUJA 2VCBA 3OEAA 3N9PA 3QOPA 1XNKA 4FFIA 1EV12 1X7NA 1XE8A 4PDWC 3CDZB 2BYVE 4U2AA 5FXVA 4ZXKA 4CUCA 4DUXA 5LRSA 1OURA 4WM8C 5CA6A 3B00A 2VUCA 2H0VA 3WQ7A 1SFYA 4BK4A 1OF3A 3PNAA 3WCRA 3WY6A 4TTGA 1GNZA 3BUCA 4O9GA 3LIGA 2XUEA 1RUG2 3JZVA 5EIYB 4AHYA 1A8DA 2KR2A 1WMDA 4QM9A 1ZZ8A 3O1RA 4XXAA 4AI9A 5FOJB 3EMRA 1UD1A 1L7RA 3HAGA 4OVEA 1ULDA 3WQ0A 3N9QA 1OFSA 1TNFA 5A3MA 4QX0A 2DCYA 4RD7A 3S30A 2JB8A 2QQIA 2X8KA 3UYJA 3WG3A 3MW3A 3OF1A 5FZMA 5GLZA 4BYYA 3VBUA 1YFXA 3ZYIB 4KG0A 3K75B 2ZGUA 1W3XA 3BN6A 5DXDA 1O5LA 5C9AC 4AFCA 2Y60A 2H6BA 4YZ1A 3O1TA 1HQLA 4ASLA 1DQ1A 1RUH3 4HETA 1EPWA 1OA3A 4V2VA 4UW3A 3RFRA 4UI9L 1I1EA 1YQ6A 3ZSJA 4F8AA 5LEKA 5DDJ3 5FLJA 4Y4RA 1QQP1 3BCWA 4DINB 1CZSA 1S0EA 1PMHX 3NV2A 4NROA 3H8XA 3ZFGC 3EJKA 2ZGRA 3WDTA 3PDQA 2OPKA 5JIUA 2J42A 5G05L 4DUWA 1Q8SA 3OPWA 1JOPA 3UKNA 4CEWA 1NLSA 2XG3A 4XC9A 1IS5A 2VMCA 4R9DA 1AVBA 1WW6A 3N7JA 4DOUA 1FNZA 3CBNA 1YI7A 3WQBA 1OFNA 5KHKA 1BEV3 1I6XA 2WT2A 3RPQA 4M3CF 2OUHA 4C0BA 1AR81 5FAXA 1W90A 2P2KA 2WFF3 2WO1A 5T5OA 3ZFFC 3LD8A 2ZGMA 4AFDA 5LA2A 2VOXA 4NIAA 3ZYHA 5JMCA 4LEJA 1IPKA 1AR62 1GWKA 1ZBE2 2WO2A 2ZKNA 1O3RA 5CFDC 3CNAA 1C8M2 3DECA 1W0PA 2WUHA 3N35A 4XUQA 4BH9A 5FZ4A 4N53B 1AXKA 1TZOA 1KGYA 5JPNB 2D7FA 2ZS6B 1XB9A 3OBTA 5A7NA 5JXJA 4OZOA 4QKDA 1HB2A 2RDSA 1GLHA 4B29A 1UY1A 2RM23 1NCRB 2WZ8A 2WLPA 2WQ4A 2X10A 3C7OA 5DAPA 5GZEA 3PIGA 5L7OB 2YROA 4R9CA 3BKZA 5FO9B 1GP6A 2IFWA 2ZGKA 1HN1A 3FMGA 1JI6A 5CB7A 3RJ2X 1W8WA 3MFAA 1ASJ2 3WNOA 3TYJA 1DZRA 3WG2A 2VC9A 5ACA2 3NJYA 3ILFA 1ULGA 2VOKA 3KCCA 1FATA 2ETEA 3C7HA 5K0UB 5A7SA 4Z2AA 4FVVA 1VBE2 4R52A 4UFIA 4ITCA 3WW3A 3JQXA 1U5XA 4INDA 5APAA 4AI0A 2DVBA 1EY2A 1R082 1RUH1 2JG8A 1VAMA 5J7MA 2VMGA 4YZ2A 1K42A 5FMOS 2OKXA 2AUYA 3UK9A 3GCXA 4Z92B 1RUJ3 5EXOA 5A3TA 3JBG1 3ZXKA 5DUWA 2JDNA 1D2QA 2EXJA 2PHRA 2ZEXA 5FXXA 2A70A 1YIPA 2J1TA 2VXRA 3KVBA 5IFTA 1PO13 1QJX2 2ARBA 4WVMB 5ABJA 5BPXA 1HV1A 5FBZA 2TNFA 1AYN3 1XNTA 5LA0A 4A7ZA 1Q8VA 5A3OA 2BOIA 5B2GB 3ZYGA 3MIHA 4HSJA 4BCUA 5LCWL 4JGZC 3KV4A 5JOYA 4MADA 2FMYA 2G9FA 4QMAA 2OPWA 2Q1FA 4RQPC 4KBBA 4O9EA 4NIGA 4ZU5A 3SISA 4AFAA 3OY8A 1NQDA 3ZMNA 1PO22 3INAA 2PHXA 2GP3A 3I4IA 3U37A 1NZCA 4AL9A 4FPOB 1NCRA 1W6MA 2WZR2 3QH6A 4XETA 4GULA 2FDHA 4GB33 5FXWA 3E6CC 5HCAA 5FY8A 4F7ZA 3IN9A 3AXEA 4W65A 5FYSA 3RJRA 4AR2A 1LKNA 5IVFA 1XYNA 1XNCA 4MGIE 5FZ7A 4CUBA 4P9GA 1VBB3 2W47A 1C28A 2GMPA 1AL22 1MQTA 3H50A 4QX7A 1W2OA 3ASIA 3QD6A 2RM21 2XQXA 3TN93 5HI0A 3T2OA 4XDQA 5C3PA 4RS5B 2X5IC 1S0IA 4PHZA 4CSWA 3WLUA 5J09A 5K0UA 3T0DA 3DF0A 1SBEA 3LEIA 1COV3 1NE4A 1NCQB 4QHBA 3BVCA 3IMMA 2O8QA 4XDPA 4CCOA 2BGCA 5IAXA 2EF6A 3VL8A 4RGKA 1AZDA 3S7EA 3AK0A 1S0GA 2QZ2A 3THTA 4ES9A 5A6QA 1JYVA 2CNAA 5EV7A 3M3EA 1JZ8A 3MV11 4K1YA 2EAAA 3LA7A 4MX3A 1I5ZA 4GIQA 3WDWA 4WVMA 4OUSA 1PGL2 3PUHA 3AZXA 4QQPA 1AL0G 4UXAA 3GHMA 2W52A 3CLPA 3KM5A 1CESA 4O61A 3WNMA 3THCA 4BWOA 3OGGA 4ORFA 2RS33 4ATFA 1PX4A 1UNBA 3SHRA 2DUOA 3LZZA 1ZRCA 2ZKLA 1HJGA 2XJPA 4LK7A 4AE2A 1RHI3 3I3DA 4MYEA 4E4SA 2RS52 3M70A 4FOWA 5A6ZA 4KI5M 4NHYA 5FMBA 4LBKA 5FYYA 5I0TA 3VBSA 4Y1YA 4AYUA 3OTFA 2Z4FA 4DIQA 5IVEA 1E57A 4KNCA 3H7YA 3CF6E 5CEHA 3SXWA 4B3NA 4XJWA 5JDBA 1VIWB 4P00B 4LT5A 1BZWA 3K3OA 3HNBM 1XQNA 3MI8A 4O65A 3VDAA 5SV8A 2GN7A 3RYKA 4CCMA 3Q8EA 1O3TA 3KV5A 1U5ZA 1NCQA 2YY1A 3I3EA 1ZRDA 4AFBA 1V6IA 4LA2A 1VBB1 5DZFA 1IG0A 3A7QA 3GZAA 3Q8FA 4M00A 4WM8A 2QDRA 3TEZA 2JG9C 2HWC3 3WXPA 4AEDB 3TN91 4BMBA 3RWNA 5F3IA 1VPHA 1AR71 1C1FA 3THDA 1XPWA 4W6YA 5EHDA 4EV0A 2CWMA 2PFWA 3AMHA 1BEV2 2R0FA 2J1UA 4KGQA 4A42A 3BU7A 1BMV1 3UKVA 1ZVFA 2WFF2 2VQAA 3I3BA 5KHJA 4UFMA 3ZN5A 4LNVA 2CGOA 5FZHA 2HWB3 4NJ4A 1BBT1 3HJRA 5I8SA 4RHV2 4UBGA 1G6NA 2XWJB 1SDWA 2F17A 4H7LA 4LTAA 1GYKA 1MVQA 5FY9A 5IHRA 2R1DA 3UV9A 1ZZ9A 1Q8QA 3VBHA 5J36A 2R072 3T0BA 2D44A 4MG2A 2Q1MA 4META 4OHWA 1URXA 3HN3A 1PNFA 4P9YA 2CHHA 5T54A 3WG4A 1VBD1 2VCMA 1IGOA 3LWCA 1DQ5A 1PZ7A 1H8VA 3MW4A 4AVAA 3LDKA 2ZZJA 4XE9A 3ZFGA 1W8OA 2ERFA 3WF0A 4D6SA 1RHI1 1DFQA 4YVWB 1W6PB 1FMD3 1S0CA 5M0TA 3E6BA 1NT0A 1N1YA 3Q9OA 4FXGB 4R9AA 5J3UA 1EAH3 1D2SA 4P02B 2JB4A 4Q8LA 5EJ3A 4BJ0A 1V70A 4MGTA 2VVDA 1LHOA 5GZCA 1SMVA 2J1AA 2VD7A 5E16A 1G9AA 1LULA 1UIJA 4TSVA 3M3IA 1QU0A 4U36A 5K9YA 1CIYA 5FYCA 1JH5A 1PO12 4LE4A 4QKFA 1LR5A 1XXNA 2DV9A 3E1F1 3PUIA 4XF9A 5BNNB 2YZ4A 3OD0A 1GR3A 1X8EA 2HWC1 1E5HA 4QWNA 4Z07A 1AYN2 4IESA 1R093 4MZUA 2QVSB 1CONA 4L92A 5C3QA 4P9WA 4BQ3A 2HJIA 4S2GA 1WMFA 1O6UA 1H2KA 1OVSA 1ZM1A 2PHWA 4Q27A 3IM0A 4JQTA 3WDUA 4CEWB 5A3PA 4MGZE 4C1XA 1W03A 4YG6A 4UW6A 5EYYA 2HWB1 2WS93 4Z82A 4L99A 3VDDB 4Q1PA 1SFNA 3V0AB 1L3JA 3I3MA 3HR9A 3M1HA 2P3JA 2WA3A 4XJUA 4YZ4A 1Y7BA 4CDQC 4HPKB 4CCKA 1KJLA 4E27A 1ZZ6A 5H9SA 2H6CA 4K7JA 4RL7A 2YHJA 3TEXA 1UZVA 5FPXA 3VD9A 4LIUA 4LITA 3ZXLA 3USSA 4XBNA 4ISRA 3VBFC 3RMYA 1COV2 3ZLIA 2Y8KA 1W8TA 1WW5A 4FXKB 4PCRA 4QB1A 3BPSA 2EICA 1Z7S3 4BIFA 2DYCA 1HDKA 2A1XA 5LBFA 2YPJA 2CAUA 1TE1B 1LOEA 4ASMB 4QX3A 5C33A 1FMD1 4IEQA 1U0AA 4LQRA 4OHYA 3EO6A 2WLQA 1S2EA 2XONA 3SC7X 5A6YA 1EAH1 1JMUB 3K2OA 4FQ4A 4FOYA 3RDIA 5BNNA 1UXXX 2ZBJA 4Q2FA 1UMHA 1OOPC 4JGZA 5FZDA 4GWMA 2QQNA 4AI3A 4RQPA 1ZX5A 1ULPA 4XZUG 2XVKA 4UT5A 1DGRN 4B4RA 1WBFA 4G3YC 1GWLA 4A3ZA 1TME3 2WC2A 5FBJA 2WWUA 1A8MA 1PGL1 5TSWA 1HW5A 3P5BA 3H7JA 2A7AA 5BV6A 3C3VA 2Y26A 3NNLA 3U1XA 3AKRA 2UY9A 3FFQA 3NMBA 3AM2A 1M06G 1RUI1 3VDDA 5F3EA 1UY4A 2DFCA 2FCUA 4AEJA 3V0AA 1OA4A 2VULA 1DGWX 5A3WA 4HLTA 2JIJA 3MLKA 4B1LA 4DXZA 3W5NA 5FY1A 3T4VA 4RN5A 4KG8A 4MGKE 2BP6A 3SMHA 1JYNA 4PIZA 5IYYA 1HB3A 2XHNA 2XMLA 1BVVA 4Z1VA 3T30A 3R4UA 5DAXA 2WS91 4LUMA 4BA6A 4QHOA 5JI9A 5FK8A 1VBA1 2VZ3A 1KS5A 2D93A 3IAPA 1OF4A 2DTYA 2VU9A 1OPOA 1R1A3 4PIXA 5FUNA 3WNPA 2ATFA 3SCGA 1SHWB 1UYYA 4BMEA 1YHFA 3N3HA 5BXXA 3CHXA 4NR1A 4FI9A 2DUQA 5JZGB 1ND2C 3AKTA 2HWF2 2NN8A 4CP1A 5GJ6A 3OD4A 2YFZA 3BIWE 1W2TA 1NYWA 4GA9A 2VY0A 3U10A 5A70A 5I0SA 2JDMA 3CMGA 5FXZA 4OQ8A 4M4PA 1QMJA 2C26A 1Z7S1 4CP9A 4A2UA 1HRI3 1I9RA 1TG7A 3JD72 3I97A 1EYBA 2EALA 3RZKA 3VZNA 4P9XA 5E89A 3GALA 4EN9B 4EWEA 4HXCA 1VJ2A 1QH6A 3KVAA 3N9MA 5JVVA 5LASA 2DCTA 4NUBA 2Y6LA 4LO6B 4G9SB 4OFGA 4QPIB 3T3YA 3U4XA 2CTVA 3VBUC 4QAWA 1F35A 1HV0A 1ENRA 4XFBA 4DEQA 2VOTA 1TME1 1W0NA 1UY2A 1JYWA 4XYXA 4YW7A 2XLAA 1GWMA 2CGNA 4CDXC 4R8HA 2XBO1 4XFGA 5DABA 4UBHA 2NP0A 3L2YA 2ID4A 4DS0A 4P08A 3WCSA 3ZMOA 4KBZA 3UT0A 1EV13 1E5IA 2RG4A 1YC61 1TEIA 2WBKA 3VBOB 4XJZA 4COWA 1CAXB 2GC3A 4ZY9A 3OBAA 2DURA 1ONAA 3DXUA 4KWUA 5FQ0A 1YFUA 2VTXA 4CEWC 5JZGA 4COVA 1Y43B 4BIOA 1KRIA 2BNOA 4GKYA 4IEWA 5G04L 2C5DA 5FZ9A 1RUG3 2W5FA 2BFUS 1Q56A 1R1A1 1ST8A 1W0OA 2EXIA 4GWIA 1W2UA 4YLZA 3PTYA 4XUOA 3H9AA 4BPZA 1OUSA 1A78A 1EUUA 3N36A 1NOVA 5CAZA 5CU1A 1R092 3JB4C 1UQXA 5FLIA 4NRQA 4QB2A 3T1MA 1C8NA 1OSGA 2JDPA 3HT1A 4YM3A 5CFCB 1JZ5A 1W9YA 3ZXGA 4QDSA 2VTFA 2Y6HA 3A0NA 3MIBA 2O8OA 3WINE 2HYKA 1LRHA 3B5LB 1C3HA 3ETPA 2VNGA 5JR7B 3W21A 2DBNA 4QXCA 2F6BA 3WEZA 2P3YA 4QKBA 2JIGA 4IXLA 3NV4A 4K8FA 4AVTA 4IERA 3O1VA 2D43A 1LB2A 2I45A 4MUVA 5LW9A 2DTWA 3B94A 4LA3A 5AC92 5EFUA 1G86A 1C5IA 3NAPB 1OMIA 4YNIA 5FYBA 4BXSV 2LTNA 4E4HA 2VZSA 3T0AA 4CDWB 3AP6A 2LRPA 1H0BA 3PUQA 2WDBA 1O8PA 4UAPA 2H0BA 4R9BA 2D3PA 5BNQA 2AH2A 1CR7A 2ZX4A 1LESA 1VB2A 4OMCA 5BNOB 1LECA 2IXLA 3VBOA 4QPGB 3VBRB 2A6WA 3NW4A 4E8DA 3USUB 1AYM1 3WDYA 1RUE1 5DG2A 1KDMA 3ALQA 3ACHA 2PLV2 2BBAA 1AXYA 1OPMA 1LENA 1IKQA 1AR63 1O4TA 2A6VA 4XFIA 1EV11 2BWCA 4XW3A 1B35B 1BYHA 1ZBE3 2FDIA 5ABJC 1J3PA 1GQGA 2VZ1A 3IDBB 3C2UA 4YZ5A 1WKYA 2D5HA 1VBC3 2YC2A 1LHNA 4FQZA 4Y1ZA 4ET7A 1IS3A 5FLHA 3VL9A 1K5JA 5CFCA 2IXKA 4JHZA 1RUG1 1GZWB 2Q0AA 1TMF2 4IE5A 5LEJA 4FTSA 4N53C 3CEWA 4Y26A 3ZR5A 3WNKA 3NKTA 1EUTA 1MVEA 2WWJA 1DZTA 1RUOA 2VZTA 3D82A 3WDVA 3SITA 1MS8A 1NCRC 1ASJ3 3ILNA 1W8ZA 2FMDA 3AMMA 3SH4A 1PK6B 3K3NA 1RITA 4CDQA 5L7OC 1SQ4A 5JPMB 4GWNA 3ZFEA 4I3GA 2WFPA 5ACA3 4MH0E 4E4DX 1VE0A 5IATA 4TWTA 4DQAA 3BPZA 3K4DA 4I2OA 4KGGA 4ZKTB 1T2XA 1MQTC 3J26N 4EE2A 3VBFA 4PLNA 2WO7A 5GALA 3EYPA 2WNEA 4WVZA 3VHOA 1O3SA 1CZVA 1GZTA 3LEGA 3MLJA 1X36A 5K0UC 4OLLA 1ZRRA 2D6MA 4M3CE 4H7MA 4CCCA 2XPJA 4XOGA 5FOBB 4UF0B 1QJX3 1G9FA 1UU4A 1JYXA 4HVOA 1YFYA 4XPVA 4NIDA 1GMMA 1LAJA 1OOPA 4NHMA 4C8DA 1WA6X 2KM2A 1B35A 4XUPA 1F9KA 1GP4A 1UCXA 3I2JA 1HRI2 3K4AA 2CYFA 2IWGB 4GKXA 2VBDA 1ZBA2 4XJ9A 4PQQA 1TNRA 1PO23 2OZ6A 1AR61 2LUWA 4AG4A 1MEC3 1D7PM 1T6GC 1ZBE1 4JHTA 2WZR3 3IIAA 2ZGSA 3B7MA 5ERLA 2WT1A 3SEEA 1C8M1 1OKQA 5JMOA 5JCTA 5J37A 5T5PA 1F8VA 1PK6A 3M2MA 3S57A 4X6QB 5B4NA 2DVDA 2GNDA 5FO8B 4CVUA 2RR13 2LM3A 2VW2A 5BNPB 1JOBA 4AQ6A 3OBRA 4XXPA 1JTZX 4FSJA 4ATEA 1ASJ1 1WD4A 2AENA 5EQUA 3GBFA 4YZ3A 2Q30A 3HT2A 4RS5C 3LFMA 5E88A 3AZYA 5D8AB 5ACA1 3K48A 1NCQC 3OGRA 2D6OX 1ND2A 3LEKA 4IGQA 1LHUA 2HBUA 3M4FA 3OYWB 5A33A 3PJYA 2EXKA 4UOJA 1VBE1 2VUAA 2A6ZA 5A32B 2WA4A 5C6CA 5I93A 1R081 1VRBA 3NL1A 4DXSA 5KXCA 2W95A 4MGSA 2RMU2 3O1SA 4ZS2A 1P8JA 1Z78A 4Y1UA 3UGGA 2RDQA 3NNGA 3RG0A 4LUKA 4K40A 5IK8A 2GMEA 3H1YA 1QJX1 1BQPA 1SBFA 1UU5A 3IPVB 3NWKA 2WSUA 4YFZA 4FTBA 1QH7A 4A4AA 5L9VA 2ZXQA 4LR4A 5FP9A 4MLOA 5FTTC 2PMWB 3CL1A 1V0AA 2PELA 1UMZA 2BVBA 3DCQA 4XEZA
chains in the Genus database with same CATH topology
1VMHA 1VE0A 1VPHA 2P6HA 1XBFA 2CU5A 1VMJA 2P6CA 1VMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VMH A;  1VE0 A;  1VPH A;  2P6H A;  1XBF A;  2CU5 A;  1VMJ A;  2P6C A;  1VMF A; 
#chains in the Genus database with same CATH topology
 2D6N A;  2ZML A;  3PVE A;  3KV6 A;  1S2B A;  3VBH C;  1FAY A;  2XJS A;  3I8T A;  1F4H A;  1HQW A;  2WIN B;  1UY3 A;  3FLP A;  1VAL A;  4GXL A;  2AC1 A;  3OGV A;  4CDX A;  2BER A;  4LBN A;  2WZR 1;  3NNJ A;  1NA1 B;  5D1I A;  1ZRI A;  3THP A;  5EZW A;  1LHV A;  1GZ9 A;  1RUC 3;  2D5F A;  2XR4 A;  3PHM A;  4COY A;  1DQ0 A;  1WCD J;  4M01 A;  1QGL A;  4IV1 A;  4DPN A;  5FZ0 A;  2W1W A;  1GAN A;  3FLT A;  2EAK A;  4HZF A;  4AXO A;  4TZD A;  4LKF A;  2QQV A;  4UFK A;  5AVP A;  1AL2 1;  2XKP A;  4L8Q A;  3WW4 A;  2W0X A;  3OPT A;  4AQT A;  1MZ5 A;  1JUH A;  5D8A A;  3RZG A;  1S55 A;  2E7T A;  3AVS A;  4IQP A;  5F39 A;  3ZSM A;  4D6Q A;  3LKJ A;  1LOG A;  3MFC A;  3AMQ A;  4HOO A;  2WNV B;  3NV1 A;  4JCK A;  4LO4 B;  3IDC B;  1DG6 A;  2Y0I A;  1UX6 A;  1H9P A;  1POQ A;  1YJL A;  3KD4 A;  4KMQ A;  1S0J A;  5FZB A;  4BHP A;  4BQX A;  4JAA A;  3C8X A;  2A6Y A;  3POW A;  4LK6 A;  5BY5 A;  5FFO C;  1C5H A;  1F2N A;  1PM7 A;  1LU2 A;  1PZ9 A;  1UAI A;  1UOJ A;  2R0H A;  3MF6 A;  4LO7 A;  3T09 A;  1A34 A;  2DCZ A;  2AGS A;  3R6S A;  1WLD A;  4BIS A;  1VBC 2;  1LOD A;  4GJZ A;  4RHV 3;  3AC0 A;  3AZV A;  2BOJ A;  3ZXA C;  4LLO A;  4GMP 3;  2NMO A;  2WT0 A;  3T4H B;  2W9X A;  4JKK A;  3N9L A;  4LBM A;  1RMU 2;  4OHZ A;  3U0Z A;  1S0D A;  2P6C A;  2VMD A;  1WA4 A;  3CZJ A;  3GNE A;  4FPJ A;  4QKN A;  4DY3 A;  4XAC A;  2R07 3;  2E32 A;  1YNA A;  3EBR A;  4I0B A;  5C4W B;  3PUS A;  4LBO A;  2E53 A;  5FZF A;  5KR7 A;  2QUO A;  3WW1 A;  5GLV A;  1ULE A;  2ZX3 A;  1KIT A;  3J8F 2;  4Y3O A;  5J48 A;  1JZ7 A;  2HWE 2;  1SLL A;  1DU3 D;  5EYX A;  3WV6 A;  1XOY A;  1G7Y A;  1NA1 A;  3N9O A;  4N7U A;  1CWP A;  4JVA A;  5KHH A;  3B9I A;  3AP5 A;  2DVG A;  2NZ9 A;  2RS5 1;  1UX7 A;  3IDE A;  4J1X A;  3KLS A;  4HKW A;  5GLW A;  5A80 A;  1CX1 A;  1WCU A;  2JKX A;  4QQ2 A;  1RUD 2;  2CWS A;  2GH2 A;  2YGL A;  4F3J A;  3PVB B;  1CIW A;  4CU9 A;  2XGX A;  2R06 3;  4YVW C;  4OI0 A;  3AMP A;  4YW5 A;  1L7Q A;  2JD9 A;  1NAE A;  3QLQ A;  1W06 A;  4W4Z A;  2VOV A;  3JCI A;  5DDJ 1;  2WNV A;  4QDR A;  1MS1 A;  3RYR A;  2C4X A;  2F4P A;  3ZO0 B;  3SQO A;  4XF0 A;  2OZJ A;  1JU3 A;  5LBC A;  2ZAC A;  3HIF A;  1PHM A;  4QT6 A;  1QOO A;  4PQ9 A;  4ZHN A;  1LHW A;  5JUV A;  4AI8 A;  5BNN C;  2Y34 A;  5HPO A;  1BEV 1;  1W2A X;  4N53 A;  5DAV A;  3KT7 A;  3NJZ A;  2WFF 1;  3FUQ A;  5LA9 A;  3M7A A;  1SCR A;  4COU A;  3HVD A;  1QJE A;  2VQU A;  4YW1 A;  1E5R A;  1UZ0 A;  1MEC 2;  1G8W A;  1DBN A;  3I2H A;  5L7O A;  5FY5 A;  2JDA A;  4E2S A;  2YYO A;  4RHV 1;  5ANN A;  4NPR A;  3S7I A;  3HPN A;  5IAV A;  1QIQ A;  3D6E A;  1LED A;  2I2S A;  3PVN A;  3FE5 A;  3VDD C;  1QDC A;  1V6K A;  3KWV A;  1R64 A;  5I0D A;  1QJY 3;  2KXL A;  4LO8 A;  1REF A;  1X9P A;  2C9K A;  2RR1 2;  2WNU B;  3NVC A;  5A7P A;  2PQS A;  3V0B B;  1RUF 3;  4BE3 A;  4DEV A;  5JSR A;  3R05 A;  4GH4 B;  4LIV A;  4FAH A;  4IEO A;  2JJ6 A;  1HB4 A;  4Q8K A;  3AX4 A;  3FLR A;  2R16 A;  4NHL A;  1OA2 A;  1QQP 2;  2RV9 A;  3H8O A;  1DHK B;  3H3Z A;  1KQR A;  3OEB A;  3FWE A;  4LOT A;  4A6S A;  4OUE A;  3I54 A;  4GMP 0;  3BTZ A;  1MPX A;  4IGP A;  1WWY A;  1MR5 A;  1XC6 A;  2EIE A;  2IXJ A;  4CCL A;  2A73 B;  4XMA A;  3HBZ A;  3RZM A;  1RXF A;  3KCX A;  2QQP A;  2R6Q A;  2VW0 A;  2WAB A;  2CU5 A;  3ZXE A;  1HXS 2;  3ZVX A;  1RUJ 1;  3UES A;  3GM8 A;  4MHU A;  5FRE A;  5ANQ A;  2W1U A;  1S1A A;  4PDW B;  4IUG A;  1PO1 1;  1QNW A;  4E2Q A;  3LCP A;  3MIG A;  2UWC A;  4FTE A;  2XDV A;  1W39 A;  3Q8B A;  3NQH A;  1UYX A;  1VR3 A;  1AYN 1;  2GH8 A;  5FZ3 A;  4XAE A;  2VZP A;  5CZK A;  1GQH A;  3POI A;  5DUU A;  4CP2 A;  3O0W A;  1HQN A;  2N7G A;  4RGA A;  3W58 A;  1VMJ A;  2BV4 A;  2YDE A;  2JEM A;  2XOM A;  3KMH A;  4GD4 A;  1C4R A;  5FJH A;  3K51 A;  3W20 A;  2WJS A;  4XZP A;  4QX2 A;  2X53 S;  1VP6 A;  3AMN A;  1RUC 2;  4QHZ A;  4RS5 A;  5I0U A;  4GB3 1;  2CDP A;  2QQO A;  3P3N A;  3LOB A;  1YUD A;  4XFH A;  1RIN A;  3UJQ A;  2VH9 A;  1CVN A;  4EZ4 A;  4B7K A;  4QXH A;  2J1S A;  1H2M A;  4LBL A;  5CBL A;  2Q4S A;  3OG2 A;  4Q4W 3;  3GF6 A;  1CAU B;  2FQP A;  3KZ4 C;  1CX4 A;  3WOG A;  4FOQ A;  2IXI A;  4N9I A;  5F5A A;  2FZ1 A;  1NX9 A;  1REE A;  2HWF 3;  5FPA A;  3BU0 A;  2BTV C;  4BQ5 A;  5F8P A;  1X8M A;  3A23 A;  2E6V A;  1COV 1;  3T2T A;  1GP5 A;  4FOV A;  5D2A A;  5E1R A;  5FY0 A;  4CXW A;  5JZG C;  1YO8 A;  2EA7 A;  3POJ A;  3KF5 A;  4MSV A;  2ES3 A;  1VLN A;  5C8C B;  3AL5 A;  2W68 A;  3JD7 3;  4Y4Y A;  2YB7 A;  1UYP A;  2WL1 A;  4A3X A;  4ZZ5 A;  1BLZ A;  1RIR A;  2ZHL A;  3RVH A;  4WZF A;  5JXG A;  3FBY A;  1GOH A;  3GZU C;  1UKG A;  4EYU A;  4NII A;  1UKR A;  2D40 A;  1DDL A;  2QCS B;  2B46 X;  4TN7 A;  4CA9 A;  1VRH 2;  5GKA C;  4EWA A;  4G4F A;  2GC1 A;  3NNF A;  3UGF A;  5DZG A;  3UL2 A;  3VZO A;  3KF3 A;  2Z69 A;  2OT7 A;  3M8L A;  2RS1 3;  3H3U A;  4OI4 A;  4LE3 A;  3FZ3 A;  2RS5 3;  1QEX A;  2RS3 1;  4CCN A;  2VM9 A;  4AK3 A;  4QPI C;  1WCQ A;  4QX5 A;  1OUX A;  1UXZ A;  2W92 A;  3VD3 A;  3ECQ A;  1ENS A;  3MUZ 1;  1D0G A;  3I59 B;  4HT1 T;  3BTY A;  5IVJ A;  1H4G A;  2LRO A;  3AJZ A;  4XFC A;  4JGY B;  4BK5 A;  3ZN6 B;  5EJ1 B;  1RXG A;  2G4I A;  1ZRE A;  1XE0 A;  3GHN A;  1CGP A;  5SV5 A;  1XBF A;  1ALY A;  2R06 2;  1F5J A;  4LBQ D;  1KXG A;  2XVL A;  4A7Y A;  4XQD A;  4AED A;  4OQ9 A;  4OYU A;  2FCV A;  2JDH A;  1JN2 P;  1V6M A;  2JDU A;  1UN1 A;  2C24 A;  4NWW A;  3VBO C;  2GNB A;  3I2D A;  3VD4 A;  2GN3 A;  1W6O B;  2B9U A;  3URF A;  4CXY A;  1AXZ A;  4FFG A;  1HN0 A;  2BDR A;  1UPI A;  4ISQ A;  1J1T A;  2W39 A;  3IAQ A;  4AHX A;  4LOR A;  2VCC A;  1OH4 A;  2E33 A;  1FI2 A;  4N43 B;  2DWR A;  2HWF 1;  4L2N A;  4AEK A;  4HFS A;  3U75 A;  3C7F A;  5L9B A;  3FFZ A;  4C90 A;  3ZDV A;  1AUY A;  4CTE A;  4AZZ A;  4BB3 A;  4JRL A;  4FPC A;  5I91 A;  4KQ7 A;  1YQ5 A;  1JYT A;  5CFC C;  5L36 A;  3AKP A;  1HJF A;  4BU2 A;  3KQR A;  2J1R A;  2Y33 A;  2Y6K A;  3JD7 1;  3VUO A;  2OUJ A;  5A7W B;  4Q4X 2;  4NPM A;  4C1W A;  4XMI A;  1LGN A;  5K4L A;  5AC9 3;  2IUW A;  3SEP A;  3FC0 A;  3LA2 A;  4UFJ A;  3HQU A;  3RRD A;  3UET A;  1QXP A;  3D5O A;  3ZFE C;  2ZGQ A;  3U14 A;  5T50 A;  2BUK A;  3NAP C;  2HKX A;  1QJY 2;  4PBO A;  3ZDS A;  4YVW A;  1W6P A;  3HMY A;  3ACF A;  1GNY A;  1TQ5 A;  1RUF 2;  3NRU A;  5C7G A;  2WAO A;  1NQJ A;  2ENR A;  3Q8C A;  4ES8 A;  4PIY A;  1UF2 C;  1ZYB A;  3X29 B;  5C3S A;  2HYX A;  3B3Q E;  5BNO C;  4XQW A;  3RZZ A;  2WN3 A;  1N3O A;  2ZEZ A;  4QPG C;  3VBR C;  1JS9 A;  1ULO A;  2PLV 3;  4GQ7 A;  3ZOI A;  2QQW A;  4EWD A;  2VZU A;  2YPD A;  4M0H A;  4P9J A;  1JOD A;  4PBP A;  4Q4Y 2;  2XHK A;  1NLR A;  4LKS A;  5L73 A;  4YAR A;  3MGU A;  3PUA A;  2V5Y A;  5KXB A;  4NMI A;  3NJX A;  3WHU A;  1B35 C;  5F5C A;  1W04 A;  3VV1 A;  3WNL A;  1TMF 3;  1JU4 A;  3B69 A;  3K4Z A;  1I5P A;  1ND3 B;  2ZAA A;  4URT A;  2MEV 2;  1FV3 A;  3IB3 A;  2BU9 A;  2KA3 A;  1SAC A;  3AKS A;  4B8E A;  3ATG A;  4F83 A;  2B42 B;  5FY7 A;  3E97 A;  1MZE A;  1R09 1;  3ZSL A;  5A7W A;  4BQ2 A;  1BBT 2;  4QXB A;  1FPN 2;  1W8F A;  1QWR A;  2YBP A;  5CAD A;  1T6B X;  5FZL A;  4ERO A;  1PIV 3;  2QQK A;  3EXU A;  2RE9 A;  3SKJ E;  1JYC A;  3RWK X;  1PK6 C;  2K9Z A;  3R4S A;  3PTR B;  1J58 A;  2OA2 A;  1BVP 1;  4YFW A;  4HPK A;  5FKC A;  5FZO B;  3DPR B;  4DO0 A;  4EN6 B;  5CIS A;  1N1S A;  1UU6 A;  3CIH A;  3ZKU A;  2O0O A;  3RQ0 A;  1VBD 2;  2SLI A;  4EN0 A;  5AC9 1;  2XJR A;  1NLQ A;  2GSY A;  2Z42 A;  2VNO A;  4KU8 A;  2UUR A;  1W3V A;  3PLQ A;  5F37 A;  1OVP A;  2PAK A;  4LHL A;  4Q4W 2;  4M4R A;  5ISL A;  5H9Q A;  3VGI A;  3BOW A;  4Q0U A;  5JOW A;  5A6X A;  5F3G A;  1UOB A;  2ZEY A;  1SLA A;  5LB6 A;  5IK5 A;  2DVA A;  1WMX A;  2CGP A;  4XAB A;  3W5M A;  1JOJ A;  1UMI A;  1Z0H A;  4QB6 A;  4OUL A;  3ZXJ A;  4UYB A;  4XVH A;  1ZBA 3;  2PLV 1;  3WF2 A;  1W2N A;  4AHW A;  4CU6 A;  3A21 A;  3ENR A;  5BYN A;  4AVV A;  4XHB A;  5FZ6 A;  4L97 A;  4LHN A;  4D69 A;  4KWJ A;  5HBA A;  4MVT A;  3J7H A;  1RB8 G;  2GU9 A;  1LCL A;  1X82 A;  2BNN A;  2G9G A;  1TVG A;  2IVI B;  4IEY A;  4M3C B;  4Q0P A;  2VOW A;  4AFM A;  2BZD A;  2IVJ A;  1ULC A;  4E8C A;  1TMF 1;  2RS1 2;  2XUM A;  4LHS A;  1O4Z A;  4W8J A;  4ARY A;  5FYV A;  2YXS A;  3JU9 A;  1POV 3;  3LA3 A;  1QJU 3;  2QDN A;  4IV3 B;  4N8M A;  2PHF A;  4Q4V 2;  3MZH A;  4GAZ A;  2DVF A;  4JQR A;  1WGP A;  1H8T B;  4QQO A;  5FZO A;  3LE0 A;  3RGB A;  1UZY A;  4JKM A;  2CL2 A;  3FN9 A;  5F32 A;  4UFL A;  2ZHN A;  4AHZ A;  1MS3 A;  3FL7 A;  4TYS A;  5BNP C;  1CAV B;  4FPL A;  4IV1 C;  2Q8D A;  2PXJ A;  2WII B;  5CG9 A;  4NOT A;  1PNG A;  2DF7 A;  2W46 A;  1PGW 2;  1GOF A;  5D8A C;  5D21 A;  3VKO A;  2Y38 A;  3WUD A;  3J7M A;  2VR4 A;  1OXC A;  1C1L A;  4JDO A;  1Q8O A;  5HCF A;  2ZOE B;  1V6O A;  3OOX A;  4W6W A;  4XJ8 A;  1WLT A;  2ARA A;  2RMU 3;  2WNO A;  1HRV 3;  1FXZ A;  1RTV A;  4DUV A;  1KJR A;  2P17 A;  2MHF A;  3T2P A;  1WD3 A;  5KXD A;  2VVF A;  3O1P A;  1W8U A;  3ABZ A;  3CQO A;  3D8C A;  4YG3 A;  1BCX A;  4FPY A;  1JW6 A;  4XFA A;  4GZ9 A;  2W3J A;  4Q0V A;  3RS6 A;  3OBZ A;  3R4D B;  5J98 B;  1MAC A;  1VAK A;  1ZRF A;  2TUN A;  3WDX A;  3VN4 A;  1Y3T A;  4ZPI A;  2JE7 A;  4Y22 B;  4BQ4 A;  4M0N A;  1ZZB A;  2FDG A;  3AYC A;  3MIC A;  1HRI 1;  1FV2 A;  2XL7 A;  3AB0 A;  2ZGO A;  5CG8 A;  1GIC A;  4M3C A;  1H1M A;  1YWK A;  4QPI A;  1RVF 3;  1ZBA 1;  4NPL A;  2JD4 A;  2RJL A;  4P9I A;  4YYO A;  2VZQ A;  4AVC A;  4WBB A;  3ST7 A;  1DYO A;  3V56 A;  3N7M A;  2JX9 A;  4CZS A;  1LGC A;  1OLR A;  2WZE A;  2XL9 A;  3AP9 A;  5CKN A;  1QDO A;  4UWD A;  2CDO A;  4IEU A;  1IS6 A;  1UWW A;  1NA1 C;  4YW6 A;  4D7S A;  3OUJ A;  3FBM A;  3TRS B;  2D98 A;  1K5M B;  4MXW B;  2VZR A;  2KD7 A;  5T52 A;  2XKO A;  3J9S A;  4EZH A;  1JZ6 A;  2D3R A;  3POE A;  2YG0 A;  3LB9 A;  4EJR A;  2FZ2 A;  2B8M A;  3LOI A;  4K1Z A;  1CAX A;  2VGD A;  3AL6 A;  3B93 A;  1EPZ A;  1SPP B;  2AEY A;  4RSU A;  4YVS B;  1VBA 2;  1D4M 2;  2V72 A;  2WNV C;  3MID A;  2VE1 A;  2W94 A;  3A22 A;  5FYM A;  3RI8 A;  3U07 A;  4HVQ A;  5KXE A;  2BEO A;  1OLQ A;  2B39 A;  4HVR A;  5JXH A;  1WW4 A;  2VNV A;  2P37 A;  4XAA A;  3WF3 A;  5LBE A;  5HV4 A;  5JLV A;  4NHX A;  1J83 A;  3NST A;  4OHX A;  2E63 A;  1QXJ A;  1IS4 A;  1UIK A;  1J84 A;  1R1Z A;  1QJF A;  3O14 A;  1RMU 3;  4OHV A;  2BBV A;  3FX3 A;  2RMU 1;  2WKK A;  1POV 0;  2HWD 3;  5C5T A;  3S5A A;  4Y22 A;  5T55 A;  4RGG A;  1CAW B;  4KWL A;  5FIX A;  1PM4 A;  3DKW A;  4L9B A;  1AJK A;  4AQS A;  3S5Q A;  1RGS A;  4YG0 A;  4AOC A;  3J8F 3;  2YBK A;  3P6B A;  4XIL A;  1V9U 2;  1YEW A;  5GZF A;  5C4W C;  2HWE 3;  3W9A A;  3KB5 A;  4BOW A;  3EQE A;  2VZV A;  4WVW A;  5LWB A;  3NAP A;  1PIV 2;  1GU3 A;  1YJK A;  2A71 A;  2BW8 A;  3BTX A;  4Z8B A;  1QOS A;  1SLT A;  5FV3 A;  1RUD 3;  4AVS A;  2XLG A;  4XTM A;  4CDW A;  2ILM A;  3PU3 A;  1W9W A;  4WM7 B;  1F15 A;  5FPU A;  4Y33 A;  4B4P A;  3GZE A;  1G9C A;  4B7E A;  3WF1 A;  3MHZ A;  5FP7 A;  3SCH A;  4AI2 A;  5BNO A;  4PI2 A;  3CU7 A;  1H1I A;  2HEW F;  4QPG A;  3OGS A;  5H9P A;  1LEM A;  1CQ9 A;  4ZXE A;  3VBR A;  4AF9 A;  3HNY M;  4WZC A;  5A3L A;  5DMY A;  4W50 A;  1WW7 A;  3USU A;  4LOS A;  4FAG A;  2ZJC A;  4COZ A;  3RYP A;  4YM0 A;  3N4M A;  5LRR A;  3P3P A;  2QE3 A;  2ET1 A;  3CO2 A;  3ZYF A;  4CDU B;  4FPH A;  5JXI A;  1J3Q A;  3AYD A;  3OB8 A;  1X9T A;  3IZO A;  2XB6 C;  5FZG A;  2P4E A;  3ZYP A;  2D6P A;  3O12 A;  1EP0 A;  4ZU4 A;  5FYI A;  1UPS A;  1IHM A;  4CEY B;  1KS4 A;  3ZX7 A;  3BGA A;  2B9V A;  4XTP A;  3DKQ A;  3CJI B;  4JC1 A;  4E9K A;  4NE9 A;  1GZW A;  4N90 A;  1HLC A;  3AP7 A;  4I02 A;  2GMM A;  3OCP A;  1CAW A;  3ZYJ B;  3MW2 A;  1AR9 2;  1VBC 1;  2BWA A;  2JWP A;  4N9H A;  5DG1 A;  4AWD A;  1W6Q B;  4CE8 A;  1SBD A;  2JDY A;  3TBD A;  1W8H A;  1RMU 1;  3APB A;  1H6Y A;  1GNH A;  1UZZ A;  2OQ6 A;  2R04 2;  3ZM8 A;  4DNY A;  5CIR A;  1NXD 1;  1DQ4 A;  1SLB A;  3IWZ A;  4FO9 A;  5IVB A;  2BPA 2;  3DV8 A;  1QJU 2;  2UWA A;  3C7E A;  4OI1 A;  5J1X A;  4Q26 A;  3WP3 A;  3T2Q A;  2C6S A;  2XXZ A;  1CJD A;  3MEP A;  1XYP A;  2WO3 A;  5LY1 A;  3J8F 1;  3LEM A;  2WNU C;  3GBW A;  1ZNP A;  1HKD A;  2HWE 1;  1CPM A;  2P6H A;  2ZGN A;  2FD8 A;  1DLC A;  3DYM A;  4PJY A;  3VZJ A;  5DN2 A;  5JSP A;  1QQP 3;  1L7L A;  2NQY A;  4BQY A;  4Y5T A;  2VO5 A;  1MS5 A;  3F95 A;  3ES1 A;  2UYA A;  1RUD 1;  1XYO A;  1UO9 A;  2D3S A;  1WLC A;  4HSL A;  2WAA A;  4OZX A;  1ODM A;  4UF0 A;  4NHK A;  2Q1Z B;  5F6L B;  5FPV A;  1WZX A;  3ZIW A;  4PLO A;  4QD2 A;  2VMH A;  4HAN A;  3NNM A;  4CDU A;  2Y6G A;  3ZIX A;  1NY7 2;  4K21 A;  3BIE A;  1Q43 A;  1S0B A;  1H4H A;  1HRV 2;  1HXS 3;  1OI6 A;  4AI1 A;  5CNA A;  4RA0 A;  1AYM 2;  1XE7 A;  2JKB A;  3AFG A;  3O7O A;  5HXM A;  5GZD A;  4QM8 A;  4ZON A;  2JEC A;  2VEC A;  1XJA A;  1O59 A;  5C70 A;  1AR8 3;  1H6X A;  2CY6 A;  3HNM A;  4Q29 A;  5F9T A;  3CJI A;  4YWA A;  3POY A;  3T1L A;  4NAO A;  3E6D A;  2ORZ A;  2WN2 A;  3HN1 A;  4V2W A;  5FPL A;  4I30 A;  3D4K A;  4E4Z A;  2FDK A;  2VAU A;  3BOP A;  1IZ3 A;  3VLB B;  2PAM A;  1LJ7 A;  3AJY A;  1QXR A;  3DYP A;  4D94 A;  3O5S A;  4CYD A;  1W6Q A;  1G9B A;  3LPG A;  3ROU A;  1RVF 2;  3U78 A;  3EB7 A;  2BQP A;  2LAL A;  4AEM A;  1PO2 1;  2B5H A;  3AZZ A;  1MEC 1;  1UYZ A;  1LU1 A;  2ZX0 A;  4LKD A;  3UJO A;  2C9A A;  2J1V A;  2QQU A;  1JYI A;  1FOD 2;  5BNP A;  1DCS A;  2GC2 A;  1KD7 A;  2YGM A;  4GAL A;  3WUC A;  5IK7 A;  5FPB A;  3GBG A;  5FWE A;  3KS7 A;  3TEY A;  3WF4 A;  3MO4 A;  1DZQ A;  1OBN A;  1YQ2 A;  2RR1 1;  1H2L A;  4HN1 A;  3OYW A;  4QGM A;  1NXM A;  2QBX A;  4RYD A;  1YRZ A;  4QGN A;  5F5I A;  5KBF A;  4P5Y A;  4AED C;  5A32 A;  3KHC A;  3VD5 A;  1OLM E;  4FP2 A;  1PGS A;  3PMS A;  3ETQ A;  4QQH A;  2IXH A;  1UL9 A;  5GLT A;  3CJX A;  2RVA A;  2E7A A;  3HEI A;  1WLW A;  3HOB A;  3JBG 3;  1STM A;  3MYX A;  3KQ4 B;  2SBA A;  1IQD C;  3AYE A;  2VTX J;  3LQC A;  5C8C C;  2AR6 A;  1KFX L;  2JG8 B;  3IPV A;  1JZ4 A;  1PVX A;  4LO5 B;  5CYY A;  3I3Q A;  3ZXD A;  4E2G A;  1RJ8 A;  4MHR A;  4NRM A;  4YM1 A;  5FRA A;  1VRH 3;  5FUP A;  4Y5S A;  2HWD 2;  5F3C A;  1HXS 1;  3CKH A;  3HQX A;  4H3W A;  1V00 A;  2XQR A;  3FHI B;  4IEX A;  4XIK A;  2Q5T A;  4BQ1 A;  5ABJ B;  2R49 A;  3N9N A;  2PYT A;  3ZR6 A;  1LTE A;  2PQQ A;  1V6L A;  4D6R A;  1DYP A;  4Y1X A;  3ZN4 A;  4XF3 A;  1CZT A;  2JE8 A;  3HD8 B;  4I0W B;  2JXA A;  1OQD A;  1CJP A;  2IXC A;  3GJA A;  4YSF A;  1PMJ X;  3NJV A;  4RFR B;  2ZTN A;  1KFU L;  2W2I A;  2EID A;  1DGL A;  4CUA A;  2GP5 A;  4IEP A;  3OY8 B;  1VB4 A;  1YFW A;  1W6M B;  2VQ0 A;  4JGY C;  4LHK A;  4A7K A;  1DLL A;  3IT8 A;  2AZ5 A;  2Y6F A;  3TAY A;  3UKT A;  2GNM A;  2ARC A;  1RUC 1;  4YGC A;  3I2G A;  3H1M A;  1LOF C;  4IE0 A;  3ITQ A;  4FPG A;  3ORJ A;  3GYD A;  4LKE A;  4SBV A;  4XDO A;  5KHI A;  1PVC 2;  4QQL A;  1MQT B;  4A44 A;  1W99 A;  4CPB A;  1Y9G A;  4QU1 A;  5JWP A;  2A6X A;  2QFE A;  1GV9 A;  3WW2 A;  1X33 A;  4HON A;  1YQ8 A;  2VL4 A;  2YV8 A;  2JE9 A;  2E51 A;  1SG3 A;  1GSL A;  2HEV F;  4XBL A;  1MS4 A;  1QJZ A;  5FKB A;  5KWR A;  3RMX A;  5FDB A;  4N43 C;  3GDB A;  1I3H A;  5FZ8 A;  2WYF A;  5LK5 A;  3BAL A;  1M4W A;  1YQC A;  3FHQ A;  2QJV A;  5FYH A;  3U11 A;  1PMI A;  3ACG A;  4Q4X 3;  2DU1 A;  3JQW A;  1AHS A;  2DCK A;  4IEZ A;  4WVV A;  5C4W A;  3VZK A;  1QHD A;  2AEZ A;  3WNN A;  4CP0 A;  3RNS A;  4DB5 A;  4IE4 A;  3ELN A;  4GMP 1;  4QDQ A;  2F4L A;  1SLC A;  1VRH 1;  4D8M A;  1SZB A;  2ZGP A;  3OUI A;  4NO4 A;  2R07 1;  2VNR A;  4IE6 A;  1BK1 A;  1K45 A;  2GNT A;  3IDA A;  1RJ7 A;  5HXV A;  2RJ2 A;  2EIB A;  5K7P A;  3P1I A;  3O0V A;  1XSR A;  1K12 A;  5DAW A;  1MZF A;  2I07 B;  3RZL A;  4ZS3 A;  2ZX2 A;  2R7E B;  2JDK A;  5DQ0 A;  1FNY A;  3HQR A;  4Q0S A;  2OX0 A;  4Y1V A;  2ZAB A;  1QOT A;  1MZ6 A;  5HV0 A;  4A45 A;  5F2S A;  1KEX A;  3VBS B;  4JX0 A;  5DZE A;  2TEP A;  2ZZQ A;  5F5Q A;  4HL0 A;  4OMD A;  4BZ4 A;  5I8T A;  1S0F A;  2XJV A;  4J25 A;  4Q4Y 3;  4X8P A;  1OC1 A;  5C5U A;  3ILR A;  4YPJ A;  2R06 1;  4IE7 A;  5FZE A;  4ZZ8 A;  4S2H A;  1XNA A;  1IKP A;  4I3P A;  5FP8 A;  4DMI A;  1AR7 3;  2J22 A;  1IPS A;  1W9S A;  4S2F A;  4HMZ A;  1O8S A;  5IJR A;  3A4U A;  2XVG A;  4RR3 B;  2VME A;  3SH3 A;  1BXH A;  3B01 A;  1S4C A;  2YMZ A;  1VAV A;  2L9L A;  3GCW A;  2PHL A;  1AR8 2;  2MEV 3;  4WM8 B;  2LS6 A;  4YW4 A;  4A41 A;  3DL3 A;  1OT5 A;  1RC6 A;  5EJZ B;  4P9L A;  5AFE A;  1SLI A;  1ND3 C;  5J96 B;  2NM1 A;  4MXV A;  1UY0 A;  1BBT 3;  1FPN 3;  5A3U A;  1GOG A;  4MOA A;  3H8R A;  3OPZ A;  2CSG A;  5CKQ A;  3KGL A;  4PF1 A;  3I2I A;  2ZHM A;  4UW5 A;  4XCB A;  4K9S A;  5F6K A;  2Y6J A;  3H1W A;  3KSC A;  5IVC A;  4Q4X 1;  4N7I A;  2QQL A;  2WNU A;  3DYO A;  2OYZ A;  3TWI A;  4X8N A;  1LOB A;  1AX1 A;  3EHK A;  1OQE A;  5FZ1 A;  1OD3 A;  1VBD 3;  3DPR C;  3F2Z A;  5DUV A;  2WQZ C;  2ADD A;  2FCT A;  2MPF A;  4PLM A;  5KC6 A;  2VMF A;  1LGB A;  4GH4 A;  2VCA A;  3VBH B;  2Z2S B;  3O1O A;  5C9A B;  1NG0 A;  2FDJ A;  4NWV A;  3BTA A;  2W91 A;  3LSE A;  1QJY 1;  5FO7 B;  3S0M A;  1XU2 A;  2XWB B;  4YW3 A;  2VQT A;  4CUG A;  4I01 A;  4H14 A;  4KU7 A;  3GZT B;  4R4X A;  1RUF 1;  3GGL A;  4BLJ A;  1ZZ7 A;  1YXW A;  3LFI A;  3MPB A;  2FDF A;  4ASK A;  1RUH 2;  2R1B A;  1N1T A;  3OJB A;  1YYN A;  3WP6 A;  1HB1 A;  3ZFG B;  2P1B A;  1RUN A;  5DDJ 2;  2X05 A;  4AW7 A;  3JBG 2;  3WZ1 A;  3PIJ A;  1ENQ A;  2VW1 A;  4RR3 A;  3I2K A;  4FFF A;  3O1M A;  4PDW A;  3WNX A;  3LDB A;  4Q4Y 1;  1WME A;  3BB6 A;  3HBK A;  1UOF A;  3AYA A;  4ZU7 A;  2E26 A;  1QY4 A;  1W6N B;  4Z2W A;  4K8R B;  1A3K A;  2ARX A;  3W59 A;  4LLF A;  3ZFF B;  3R0R A;  2DU0 A;  3VZL A;  2NYY A;  4KH9 A;  3KV9 A;  2LW8 A;  1QF3 A;  1W28 A;  5FMO L;  1Q8P A;  2MEV 1;  5CFD B;  4JTO A;  4Q4V 3;  4CRQ A;  4K6B A;  3FHA A;  2A75 A;  2WRA A;  1XNB A;  4Q5O A;  3UNP A;  1ODN A;  1FPN 1;  4IV3 C;  5FZC A;  3DN7 A;  4LBJ A;  1W8N A;  1OQ1 A;  1H8T C;  3M3O A;  4DFS A;  4PI0 A;  2V09 A;  1D0H A;  2YFU A;  3POS A;  4AQ2 A;  3AXD A;  2QQM A;  3E5U A;  5I8Y A;  3L9J T;  2RM2 2;  3VD7 A;  2Z5W A;  5C9A A;  1A6C A;  1DGW A;  2BNM A;  1G9D A;  3FUO A;  1CAU A;  1IG3 A;  5FZA A;  5IT6 A;  1BHG A;  1QKQ A;  2PN5 A;  5FR3 A;  2E31 A;  2QTW B;  1IOA A;  5B4X A;  3PME A;  4K3U A;  2CV6 A;  4D7Y A;  4UFH A;  4DXT A;  3DXT A;  4Q4W 1;  5C8C A;  4HK9 A;  3U4S A;  2G9Z A;  3MF9 A;  3UGH A;  4QGL A;  3CZU A;  2WWS A;  3MIE A;  5A1F A;  4QPW A;  4J1W A;  1W05 A;  1XU1 A;  2V4A A;  2RDN A;  4SLI A;  4NN0 A;  1W9T A;  2EIG A;  4FPE A;  4BM8 A;  5FP4 A;  2ZX1 A;  1S2K A;  1W6N A;  4CU7 A;  3ACI A;  1O3Q A;  3IBM A;  1RUJ 2;  2A3W A;  3ZFF A;  2YC4 A;  3WR0 A;  3I2O A;  4B4Q A;  2X09 A;  5GM0 A;  1DQ6 A;  4XUT A;  4L0P A;  5CFD A;  2ZHK A;  2QNK A;  2ARE A;  3JXS A;  2XJU A;  3LGR A;  4JGZ B;  1FX5 A;  4AAX A;  1OD5 A;  1HIX A;  2VPV A;  1HX6 A;  4RQP B;  2AAC A;  4XQ4 A;  1YCI A;  1IQA A;  1RUI 3;  3I59 A;  5FCC A;  1BJQ A;  4QX8 A;  2RS1 1;  2P3I A;  4JGY A;  3M3C A;  3ZN6 A;  4OUM A;  4CDW C;  1UZW A;  4JKL A;  4Q4V 1;  4A6O A;  5EP9 A;  1WBL A;  2PHT A;  4TXW A;  1LOF A;  1N1V A;  1K5M C;  4AGR A;  2R30 A;  4EQV A;  4FFH A;  4QX1 A;  4GB3 2;  1VBA 3;  1D4M 3;  3QBQ A;  1UW8 A;  1Y9M A;  3T08 A;  2A5Z A;  1W6O A;  2XLF A;  3LF7 A;  1VBB 2;  2X5I B;  3TOJ A;  4FPF A;  4YVS C;  5GLU A;  1AF9 A;  4XCA A;  2Q8O A;  1PGW 1;  4C0H A;  3TN9 2;  5FWJ A;  1AR7 2;  1O7F A;  4N43 A;  4R4Z A;  5FUI A;  1XSQ A;  2RHP A;  2HEY F;  4YW2 A;  4DZG A;  2ET7 A;  3RZJ A;  3ON7 A;  1J3R A;  2K46 A;  1BMV 2;  4YGE A;  3WP4 A;  4IET A;  4W6X A;  2VG9 A;  5IW0 A;  3ZYR A;  3ME2 A;  4HKO A;  3AP4 A;  3ACL A;  4DY5 A;  5JSO A;  2E9Q A;  2IFR A;  2JIC A;  4I0A A;  2WZP P;  5LAT A;  3BI3 A;  1V9U 3;  2YUE A;  3BYW A;  1QNY A;  4HN0 A;  2P34 A;  4XF1 A;  4DRR A;  4CP9 B;  3DGT A;  3D0J A;  5A3N A;  3O0X A;  5A7Q A;  3ZYB A;  3KCY A;  3MUY 1;  3SKV A;  5L19 A;  4NAM A;  4XUN A;  5DPN A;  4LBQ B;  1JHN A;  1JHJ A;  2A3Y A;  2IZW A;  3ES4 A;  1F5F A;  4HG6 B;  1FT9 A;  5C8W A;  1CD3 G;  3AZW A;  3I49 A;  2RS3 2;  1F31 A;  2B7Y A;  1APN A;  3FJS A;  3DEM A;  4H2A A;  5I0R A;  2K0G A;  4WM7 C;  4Q0Q A;  4EN8 B;  3E5X A;  2XBO 3;  4QXK A;  2XH6 A;  1GZC A;  2XJT A;  3KT4 A;  5IUQ A;  3J7N A;  1RHI 2;  5T3N A;  3VB9 A;  4K20 A;  1O4Y A;  3K46 A;  3RSJ A;  1Q3E A;  1RED A;  2VXJ A;  3D3A A;  2ZA9 A;  3QAC A;  4FCA A;  4JRA A;  2X5I A;  4B1M A;  1U12 A;  2W1Q A;  2GAL A;  5IVV A;  3VZM A;  4CDU C;  3PJQ A;  1LOC A;  4CCD A;  5F7U A;  1OKO A;  3PUR A;  4LJH A;  2B45 X;  2V4V A;  4YGD A;  3DUI A;  3WT3 A;  1U5Y A;  1D4M 1;  1GUI A;  1YI9 A;  2JG9 B;  4O7X A;  4QPY A;  5FYT A;  3LPF A;  1OHF A;  2UWB A;  2E7Q A;  4HK8 A;  4CEY C;  2V5D A;  5JI7 A;  5A1L A;  2EXH A;  1ND3 A;  5FZK A;  1PX3 A;  5FYZ A;  3CJI C;  1PZ8 A;  2MNG A;  2HWC 2;  2WYS A;  3MIF A;  1AR9 3;  3K77 A;  5FQ0 B;  4CXX A;  4J6G A;  5LY2 A;  3MLL A;  3OUH A;  4S2D A;  2XJQ A;  3III A;  5FPZ A;  4X6R B;  3ZPO A;  5LA1 A;  1RL3 A;  2J1E A;  2NMN A;  3WSO A;  4AGV A;  2B4K A;  2ZEW A;  1JBC A;  3ZPY A;  2R04 3;  4OCT A;  1H1A A;  2GAU A;  1DGR A;  2UYB A;  5LBB A;  1J1L A;  3D0S A;  5E8A A;  2C1F A;  2OII A;  4NIH A;  4QU2 A;  5H9R A;  4D0Q A;  1Y9Q A;  2PA7 A;  2ZCW A;  4LBQ A;  1OH3 A;  2VVE A;  3SH5 A;  1UOG A;  2WSV A;  3DPR A;  1LNS A;  2PTM A;  2HWB 2;  2TBV A;  1V9U 1;  2OW4 A;  4IGO A;  4YRD A;  2G1M A;  3E5Q A;  3VHR A;  3KHB A;  1PIV 1;  1J59 A;  5AVA A;  4JDN A;  3VKM A;  2EVX A;  3POG A;  5JOX A;  5L9R A;  2AYH A;  5FMC A;  3VKL A;  5IK4 A;  3OSD A;  2VMI A;  3KGZ A;  2FHR A;  4JTN A;  3TNQ A;  1BKZ A;  4ONU A;  4WV8 A;  4URA A;  1AYM 3;  4JZR A;  2VZO A;  1RUE 3;  4C91 A;  4MV2 A;  3B9C A;  2ZPX A;  5LZ6 A;  1FMD 2;  3H42 B;  2JG9 A;  1V6N A;  2P5B A;  1EAH 2;  2PHD A;  1JZ2 A;  1AX2 A;  4JDM A;  5EPA A;  1ENX A;  1DP0 A;  4NVP A;  4BDV B;  2Z79 A;  4FBF A;  5JOZ A;  1JZ3 A;  2VBP A;  5F1R A;  1AJO A;  5CVR A;  4HBN A;  4UW4 A;  5IFP A;  1NUK A;  3VKF C;  1DQ2 A;  2X29 A;  2BVV A;  2WQ8 A;  3N7K A;  2Y64 A;  3WG1 A;  4OI2 A;  4GWJ A;  1ACC A;  1SCS A;  4IV3 A;  5BUV A;  5T5L A;  1AR9 1;  2VUD A;  1KDK A;  3SCF A;  2IC1 A;  1LOA A;  1FOD 3;  4LMF A;  1H8T A;  5KC5 A;  4MGY E;  3TEW A;  3BOD A;  2DFB A;  3SLI A;  1RUI 2;  2DBI A;  5FY4 A;  4IDZ A;  5GZG A;  2RDR A;  1VMF A;  2R04 1;  2O14 A;  1US2 A;  1CAV A;  2NPI A;  3VHP A;  1H9W A;  2WR9 A;  3V64 A;  1POV 1;  3MDP A;  1QJU 1;  5T5J A;  5LK7 B;  4CCE A;  2I74 A;  3VHN A;  4IW3 A;  4BXF A;  3G6J B;  1WCS A;  4CDQ B;  3WVJ A;  2WS9 2;  2ZAH A;  3ZFE B;  4P5H A;  1NZI A;  5E6H A;  2ZGL A;  2P3K A;  3WD5 A;  3MV0 1;  2YU1 A;  3SNM A;  2QKD A;  1N3Q A;  2HH9 A;  1B09 A;  2DUP A;  3VBF B;  2DCJ A;  3JB8 A;  1MS9 A;  1NE6 A;  1K3I A;  1U5I A;  2D97 A;  3PL0 A;  4XUR A;  2W08 A;  3JUU A;  3ZKY A;  1SDD B;  4GJY A;  4FT8 A;  4P14 A;  1NY7 1;  3S6P A;  3J7L A;  3QH7 A;  3H8U A;  2UU8 A;  4XFF A;  4LPL A;  3WQ1 A;  4LUL A;  1AX0 A;  1HRV 1;  1Z7S 2;  2JG8 C;  3L2H A;  4NRP A;  4V1P A;  2BRT A;  1Q5O A;  4KL1 A;  3RI9 A;  1ZZC A;  2VBB A;  3LDR A;  4LXL A;  4Q1R A;  1IPJ A;  1ULF A;  1W9F A;  3KT1 A;  2FBE A;  1H30 A;  3TNP B;  1NKG A;  2ZGT A;  2PHU A;  1OOP B;  3HWJ A;  4XBQ A;  5FP3 A;  4XHX A;  3Q8A A;  2OS2 A;  2OVU A;  5C3O A;  3WP5 A;  1C8M 3;  1VMH A;  3AKQ A;  2YU2 A;  4PT6 A;  2D6L X;  4Y20 B;  5JR2 A;  3MBW A;  2BGP A;  4BLI A;  5FYU A;  1GBG A;  2ZMN A;  1RVF 1;  4D3W A;  3GJB A;  3I2F A;  1YLL A;  5JAX A;  4YM2 A;  5AFB A;  1K5M A;  4MXW A;  3I7D A;  1TME 2;  2GC0 A;  1O5U A;  2HLE A;  4DRV A;  3H3L A;  2Q8E A;  2XBO 2;  2J7M A;  4XF4 A;  1FOD 1;  4MO3 M;  4XJA A;  3N7L A;  5EWS A;  2ORX A;  1MS0 A;  4H55 A;  1SPP A;  1PVC 3;  3LIH A;  4IEV A;  4YVS A;  2PAE A;  1H2N A;  3V0B A;  4HKL A;  3O1U A;  1JUI A;  3ZXF A;  4ARX A;  3B02 A;  4AGG A;  3GXU A;  1X50 A;  3IMN A;  4I09 A;  4RFT 0;  5C71 A;  5A7O A;  3G7D A;  1VBE 3;  2V73 A;  4EN7 B;  3NO8 A;  5FK7 A;  1XND A;  1D4V B;  1R08 3;  2JEN A;  2ZMK A;  5HCB A;  1CN1 A;  2ADE A;  3MPP G;  1GQP A;  2Y0O A;  5KHG A;  1CPN A;  1DF0 A;  2NLR A;  1R1A 2;  3H0O A;  1F4A A;  3PU8 A;  1ND2 B;  3PVO A;  5IVY A;  4DXR A;  4FPK A;  5A33 B;  2OXB A;  1DIW A;  4YGB A;  5DUX A;  1BK0 A;  4CU8 A;  2UY8 A;  3OGJ A;  3ZSE A;  1RYY A;  3LAG A;  5C3R A;  5FMD A;  4D7T A;  4IL7 A;  1N47 A;  1GFF 2;  3VDB A;  1V6J A;  2OQ7 A;  2BGO A;  2DDU A;  4TLG A;  4Y24 A;  4AAP A;  3LSD A;  3C7G A;  3POB A;  5DAQ A;  1ZA7 A;  2A3X A;  5FZI A;  2CAV A;  4AVB A;  3AVR A;  1OLM A;  2HWD 1;  1SFP A;  1YIF A;  5JIA A;  2YBS A;  2QQJ A;  5A1A A;  4Y20 A;  3WX5 A;  1WCK A;  2BJS A;  2GZW A;  4CPB D;  3AFK A;  1ZA4 A;  4L11 A;  2BFU L;  2JDZ A;  2Q8C A;  2RJK A;  4WM7 A;  1C57 A;  4PF5 A;  2D6K A;  3ZSK A;  3NV3 A;  1XRU A;  3VKN A;  5CKM A;  1GKB A;  4KWK A;  3J4U H;  5K8S A;  5HCH A;  1JXN A;  1Y4W A;  1FYU A;  2GDF A;  3NKG A;  3VBU B;  5F2W A;  4Y5Z 0;  2O1Q A;  2R32 A;  4XIO A;  4GH4 C;  3M3Q A;  4JV4 A;  4TLF A;  1E5S A;  2QZ3 A;  2VJX A;  1AL2 3;  1N3P A;  2HBT A;  5IWF A;  4CDX B;  1DYK A;  1O91 A;  2W87 A;  3VBS C;  2C0Z A;  2YC0 A;  3QCW A;  3WHT A;  5FJK A;  3POF A;  4BQW A;  2K2S A;  2G19 A;  1US3 A;  2W1S A;  4IV1 B;  1WUV A;  3VDC A;  4CEY A;  3TB0 A;  4FP3 A;  1RUE 2;  3RZH A;  1PVC 1;  4MGQ A;  1SEF A;  3A0K A;  4CCJ A;  3V65 A;  4RR3 C;  3IKW A;  2VUJ A;  2VCB A;  3OEA A;  3N9P A;  3QOP A;  1XNK A;  4FFI A;  1EV1 2;  1X7N A;  1XE8 A;  4PDW C;  3CDZ B;  2BYV E;  4U2A A;  5FXV A;  4ZXK A;  4CUC A;  4DUX A;  5LRS A;  1OUR A;  4WM8 C;  5CA6 A;  3B00 A;  2VUC A;  2H0V A;  3WQ7 A;  1SFY A;  4BK4 A;  1OF3 A;  3PNA A;  3WCR A;  3WY6 A;  4TTG A;  1GNZ A;  3BUC A;  4O9G A;  3LIG A;  2XUE A;  1RUG 2;  3JZV A;  5EIY B;  4AHY A;  1A8D A;  2KR2 A;  1WMD A;  4QM9 A;  1ZZ8 A;  3O1R A;  4XXA A;  4AI9 A;  5FOJ B;  3EMR A;  1UD1 A;  1L7R A;  3HAG A;  4OVE A;  1ULD A;  3WQ0 A;  3N9Q A;  1OFS A;  1TNF A;  5A3M A;  4QX0 A;  2DCY A;  4RD7 A;  3S30 A;  2JB8 A;  2QQI A;  2X8K A;  3UYJ A;  3WG3 A;  3MW3 A;  3OF1 A;  5FZM A;  5GLZ A;  4BYY A;  3VBU A;  1YFX A;  3ZYI B;  4KG0 A;  3K75 B;  2ZGU A;  1W3X A;  3BN6 A;  5DXD A;  1O5L A;  5C9A C;  4AFC A;  2Y60 A;  2H6B A;  4YZ1 A;  3O1T A;  1HQL A;  4ASL A;  1DQ1 A;  1RUH 3;  4HET A;  1EPW A;  1OA3 A;  4V2V A;  4UW3 A;  3RFR A;  4UI9 L;  1I1E A;  1YQ6 A;  3ZSJ A;  4F8A A;  5LEK A;  5DDJ 3;  5FLJ A;  4Y4R A;  1QQP 1;  3BCW A;  4DIN B;  1CZS A;  1S0E A;  1PMH X;  3NV2 A;  4NRO A;  3H8X A;  3ZFG C;  3EJK A;  2ZGR A;  3WDT A;  3PDQ A;  2OPK A;  5JIU A;  2J42 A;  5G05 L;  4DUW A;  1Q8S A;  3OPW A;  1JOP A;  3UKN A;  4CEW A;  1NLS A;  2XG3 A;  4XC9 A;  1IS5 A;  2VMC A;  4R9D A;  1AVB A;  1WW6 A;  3N7J A;  4DOU A;  1FNZ A;  3CBN A;  1YI7 A;  3WQB A;  1OFN A;  5KHK A;  1BEV 3;  1I6X A;  2WT2 A;  3RPQ A;  4M3C F;  2OUH A;  4C0B A;  1AR8 1;  5FAX A;  1W90 A;  2P2K A;  2WFF 3;  2WO1 A;  5T5O A;  3ZFF C;  3LD8 A;  2ZGM A;  4AFD A;  5LA2 A;  2VOX A;  4NIA A;  3ZYH A;  5JMC A;  4LEJ A;  1IPK A;  1AR6 2;  1GWK A;  1ZBE 2;  2WO2 A;  2ZKN A;  1O3R A;  5CFD C;  3CNA A;  1C8M 2;  3DEC A;  1W0P A;  2WUH A;  3N35 A;  4XUQ A;  4BH9 A;  5FZ4 A;  4N53 B;  1AXK A;  1TZO A;  1KGY A;  5JPN B;  2D7F A;  2ZS6 B;  1XB9 A;  3OBT A;  5A7N A;  5JXJ A;  4OZO A;  4QKD A;  1HB2 A;  2RDS A;  1GLH A;  4B29 A;  1UY1 A;  2RM2 3;  1NCR B;  2WZ8 A;  2WLP A;  2WQ4 A;  2X10 A;  3C7O A;  5DAP A;  5GZE A;  3PIG A;  5L7O B;  2YRO A;  4R9C A;  3BKZ A;  5FO9 B;  1GP6 A;  2IFW A;  2ZGK A;  1HN1 A;  3FMG A;  1JI6 A;  5CB7 A;  3RJ2 X;  1W8W A;  3MFA A;  1ASJ 2;  3WNO A;  3TYJ A;  1DZR A;  3WG2 A;  2VC9 A;  5ACA 2;  3NJY A;  3ILF A;  1ULG A;  2VOK A;  3KCC A;  1FAT A;  2ETE A;  3C7H A;  5K0U B;  5A7S A;  4Z2A A;  4FVV A;  1VBE 2;  4R52 A;  4UFI A;  4ITC A;  3WW3 A;  3JQX A;  1U5X A;  4IND A;  5APA A;  4AI0 A;  2DVB A;  1EY2 A;  1R08 2;  1RUH 1;  2JG8 A;  1VAM A;  5J7M A;  2VMG A;  4YZ2 A;  1K42 A;  5FMO S;  2OKX A;  2AUY A;  3UK9 A;  3GCX A;  4Z92 B;  1RUJ 3;  5EXO A;  5A3T A;  3JBG 1;  3ZXK A;  5DUW A;  2JDN A;  1D2Q A;  2EXJ A;  2PHR A;  2ZEX A;  5FXX A;  2A70 A;  1YIP A;  2J1T A;  2VXR A;  3KVB A;  5IFT A;  1PO1 3;  1QJX 2;  2ARB A;  4WVM B;  5ABJ A;  5BPX A;  1HV1 A;  5FBZ A;  2TNF A;  1AYN 3;  1XNT A;  5LA0 A;  4A7Z A;  1Q8V A;  5A3O A;  2BOI A;  5B2G B;  3ZYG A;  3MIH A;  4HSJ A;  4BCU A;  5LCW L;  4JGZ C;  3KV4 A;  5JOY A;  4MAD A;  2FMY A;  2G9F A;  4QMA A;  2OPW A;  2Q1F A;  4RQP C;  4KBB A;  4O9E A;  4NIG A;  4ZU5 A;  3SIS A;  4AFA A;  3OY8 A;  1NQD A;  3ZMN A;  1PO2 2;  3INA A;  2PHX A;  2GP3 A;  3I4I A;  3U37 A;  1NZC A;  4AL9 A;  4FPO B;  1NCR A;  1W6M A;  2WZR 2;  3QH6 A;  4XET A;  4GUL A;  2FDH A;  4GB3 3;  5FXW A;  3E6C C;  5HCA A;  5FY8 A;  4F7Z A;  3IN9 A;  3AXE A;  4W65 A;  5FYS A;  3RJR A;  4AR2 A;  1LKN A;  5IVF A;  1XYN A;  1XNC A;  4MGI E;  5FZ7 A;  4CUB A;  4P9G A;  1VBB 3;  2W47 A;  1C28 A;  2GMP A;  1AL2 2;  1MQT A;  3H50 A;  4QX7 A;  1W2O A;  3ASI A;  3QD6 A;  2RM2 1;  2XQX A;  3TN9 3;  5HI0 A;  3T2O A;  4XDQ A;  5C3P A;  4RS5 B;  2X5I C;  1S0I A;  4PHZ A;  4CSW A;  3WLU A;  5J09 A;  5K0U A;  3T0D A;  3DF0 A;  1SBE A;  3LEI A;  1COV 3;  1NE4 A;  1NCQ B;  4QHB A;  3BVC A;  3IMM A;  2O8Q A;  4XDP A;  4CCO A;  2BGC A;  5IAX A;  2EF6 A;  3VL8 A;  4RGK A;  1AZD A;  3S7E A;  3AK0 A;  1S0G A;  2QZ2 A;  3THT A;  4ES9 A;  5A6Q A;  1JYV A;  2CNA A;  5EV7 A;  3M3E A;  1JZ8 A;  3MV1 1;  4K1Y A;  2EAA A;  3LA7 A;  4MX3 A;  1I5Z A;  4GIQ A;  3WDW A;  4WVM A;  4OUS A;  1PGL 2;  3PUH A;  3AZX A;  4QQP A;  1AL0 G;  4UXA A;  3GHM A;  2W52 A;  3CLP A;  3KM5 A;  1CES A;  4O61 A;  3WNM A;  3THC A;  4BWO A;  3OGG A;  4ORF A;  2RS3 3;  4ATF A;  1PX4 A;  1UNB A;  3SHR A;  2DUO A;  3LZZ A;  1ZRC A;  2ZKL A;  1HJG A;  2XJP A;  4LK7 A;  4AE2 A;  1RHI 3;  3I3D A;  4MYE A;  4E4S A;  2RS5 2;  3M70 A;  4FOW A;  5A6Z A;  4KI5 M;  4NHY A;  5FMB A;  4LBK A;  5FYY A;  5I0T A;  3VBS A;  4Y1Y A;  4AYU A;  3OTF A;  2Z4F A;  4DIQ A;  5IVE A;  1E57 A;  4KNC A;  3H7Y A;  3CF6 E;  5CEH A;  3SXW A;  4B3N A;  4XJW A;  5JDB A;  1VIW B;  4P00 B;  4LT5 A;  1BZW A;  3K3O A;  3HNB M;  1XQN A;  3MI8 A;  4O65 A;  3VDA A;  5SV8 A;  2GN7 A;  3RYK A;  4CCM A;  3Q8E A;  1O3T A;  3KV5 A;  1U5Z A;  1NCQ A;  2YY1 A;  3I3E A;  1ZRD A;  4AFB A;  1V6I A;  4LA2 A;  1VBB 1;  5DZF A;  1IG0 A;  3A7Q A;  3GZA A;  3Q8F A;  4M00 A;  4WM8 A;  2QDR A;  3TEZ A;  2JG9 C;  2HWC 3;  3WXP A;  4AED B;  3TN9 1;  4BMB A;  3RWN A;  5F3I A;  1VPH A;  1AR7 1;  1C1F A;  3THD A;  1XPW A;  4W6Y A;  5EHD A;  4EV0 A;  2CWM A;  2PFW A;  3AMH A;  1BEV 2;  2R0F A;  2J1U A;  4KGQ A;  4A42 A;  3BU7 A;  1BMV 1;  3UKV A;  1ZVF A;  2WFF 2;  2VQA A;  3I3B A;  5KHJ A;  4UFM A;  3ZN5 A;  4LNV A;  2CGO A;  5FZH A;  2HWB 3;  4NJ4 A;  1BBT 1;  3HJR A;  5I8S A;  4RHV 2;  4UBG A;  1G6N A;  2XWJ B;  1SDW A;  2F17 A;  4H7L A;  4LTA A;  1GYK A;  1MVQ A;  5FY9 A;  5IHR A;  2R1D A;  3UV9 A;  1ZZ9 A;  1Q8Q A;  3VBH A;  5J36 A;  2R07 2;  3T0B A;  2D44 A;  4MG2 A;  2Q1M A;  4MET A;  4OHW A;  1URX A;  3HN3 A;  1PNF A;  4P9Y A;  2CHH A;  5T54 A;  3WG4 A;  1VBD 1;  2VCM A;  1IGO A;  3LWC A;  1DQ5 A;  1PZ7 A;  1H8V A;  3MW4 A;  4AVA A;  3LDK A;  2ZZJ A;  4XE9 A;  3ZFG A;  1W8O A;  2ERF A;  3WF0 A;  4D6S A;  1RHI 1;  1DFQ A;  4YVW B;  1W6P B;  1FMD 3;  1S0C A;  5M0T A;  3E6B A;  1NT0 A;  1N1Y A;  3Q9O A;  4FXG B;  4R9A A;  5J3U A;  1EAH 3;  1D2S A;  4P02 B;  2JB4 A;  4Q8L A;  5EJ3 A;  4BJ0 A;  1V70 A;  4MGT A;  2VVD A;  1LHO A;  5GZC A;  1SMV A;  2J1A A;  2VD7 A;  5E16 A;  1G9A A;  1LUL A;  1UIJ A;  4TSV A;  3M3I A;  1QU0 A;  4U36 A;  5K9Y A;  1CIY A;  5FYC A;  1JH5 A;  1PO1 2;  4LE4 A;  4QKF A;  1LR5 A;  1XXN A;  2DV9 A;  3E1F 1;  3PUI A;  4XF9 A;  5BNN B;  2YZ4 A;  3OD0 A;  1GR3 A;  1X8E A;  2HWC 1;  1E5H A;  4QWN A;  4Z07 A;  1AYN 2;  4IES A;  1R09 3;  4MZU A;  2QVS B;  1CON A;  4L92 A;  5C3Q A;  4P9W A;  4BQ3 A;  2HJI A;  4S2G A;  1WMF A;  1O6U A;  1H2K A;  1OVS A;  1ZM1 A;  2PHW A;  4Q27 A;  3IM0 A;  4JQT A;  3WDU A;  4CEW B;  5A3P A;  4MGZ E;  4C1X A;  1W03 A;  4YG6 A;  4UW6 A;  5EYY A;  2HWB 1;  2WS9 3;  4Z82 A;  4L99 A;  3VDD B;  4Q1P A;  1SFN A;  3V0A B;  1L3J A;  3I3M A;  3HR9 A;  3M1H A;  2P3J A;  2WA3 A;  4XJU A;  4YZ4 A;  1Y7B A;  4CDQ C;  4HPK B;  4CCK A;  1KJL A;  4E27 A;  1ZZ6 A;  5H9S A;  2H6C A;  4K7J A;  4RL7 A;  2YHJ A;  3TEX A;  1UZV A;  5FPX A;  3VD9 A;  4LIU A;  4LIT A;  3ZXL A;  3USS A;  4XBN A;  4ISR A;  3VBF C;  3RMY A;  1COV 2;  3ZLI A;  2Y8K A;  1W8T A;  1WW5 A;  4FXK B;  4PCR A;  4QB1 A;  3BPS A;  2EIC A;  1Z7S 3;  4BIF A;  2DYC A;  1HDK A;  2A1X A;  5LBF A;  2YPJ A;  2CAU A;  1TE1 B;  1LOE A;  4ASM B;  4QX3 A;  5C33 A;  1FMD 1;  4IEQ A;  1U0A A;  4LQR A;  4OHY A;  3EO6 A;  2WLQ A;  1S2E A;  2XON A;  3SC7 X;  5A6Y A;  1EAH 1;  1JMU B;  3K2O A;  4FQ4 A;  4FOY A;  3RDI A;  5BNN A;  1UXX X;  2ZBJ A;  4Q2F A;  1UMH A;  1OOP C;  4JGZ A;  5FZD A;  4GWM A;  2QQN A;  4AI3 A;  4RQP A;  1ZX5 A;  1ULP A;  4XZU G;  2XVK A;  4UT5 A;  1DGR N;  4B4R A;  1WBF A;  4G3Y C;  1GWL A;  4A3Z A;  1TME 3;  2WC2 A;  5FBJ A;  2WWU A;  1A8M A;  1PGL 1;  5TSW A;  1HW5 A;  3P5B A;  3H7J A;  2A7A A;  5BV6 A;  3C3V A;  2Y26 A;  3NNL A;  3U1X A;  3AKR A;  2UY9 A;  3FFQ A;  3NMB A;  3AM2 A;  1M06 G;  1RUI 1;  3VDD A;  5F3E A;  1UY4 A;  2DFC A;  2FCU A;  4AEJ A;  3V0A A;  1OA4 A;  2VUL A;  1DGW X;  5A3W A;  4HLT A;  2JIJ A;  3MLK A;  4B1L A;  4DXZ A;  3W5N A;  5FY1 A;  3T4V A;  4RN5 A;  4KG8 A;  4MGK E;  2BP6 A;  3SMH A;  1JYN A;  4PIZ A;  5IYY A;  1HB3 A;  2XHN A;  2XML A;  1BVV A;  4Z1V A;  3T30 A;  3R4U A;  5DAX A;  2WS9 1;  4LUM A;  4BA6 A;  4QHO A;  5JI9 A;  5FK8 A;  1VBA 1;  2VZ3 A;  1KS5 A;  2D93 A;  3IAP A;  1OF4 A;  2DTY A;  2VU9 A;  1OPO A;  1R1A 3;  4PIX A;  5FUN A;  3WNP A;  2ATF A;  3SCG A;  1SHW B;  1UYY A;  4BME A;  1YHF A;  3N3H A;  5BXX A;  3CHX A;  4NR1 A;  4FI9 A;  2DUQ A;  5JZG B;  1ND2 C;  3AKT A;  2HWF 2;  2NN8 A;  4CP1 A;  5GJ6 A;  3OD4 A;  2YFZ A;  3BIW E;  1W2T A;  1NYW A;  4GA9 A;  2VY0 A;  3U10 A;  5A70 A;  5I0S A;  2JDM A;  3CMG A;  5FXZ A;  4OQ8 A;  4M4P A;  1QMJ A;  2C26 A;  1Z7S 1;  4CP9 A;  4A2U A;  1HRI 3;  1I9R A;  1TG7 A;  3JD7 2;  3I97 A;  1EYB A;  2EAL A;  3RZK A;  3VZN A;  4P9X A;  5E89 A;  3GAL A;  4EN9 B;  4EWE A;  4HXC A;  1VJ2 A;  1QH6 A;  3KVA A;  3N9M A;  5JVV A;  5LAS A;  2DCT A;  4NUB A;  2Y6L A;  4LO6 B;  4G9S B;  4OFG A;  4QPI B;  3T3Y A;  3U4X A;  2CTV A;  3VBU C;  4QAW A;  1F35 A;  1HV0 A;  1ENR A;  4XFB A;  4DEQ A;  2VOT A;  1TME 1;  1W0N A;  1UY2 A;  1JYW A;  4XYX A;  4YW7 A;  2XLA A;  1GWM A;  2CGN A;  4CDX C;  4R8H A;  2XBO 1;  4XFG A;  5DAB A;  4UBH A;  2NP0 A;  3L2Y A;  2ID4 A;  4DS0 A;  4P08 A;  3WCS A;  3ZMO A;  4KBZ A;  3UT0 A;  1EV1 3;  1E5I A;  2RG4 A;  1YC6 1;  1TEI A;  2WBK A;  3VBO B;  4XJZ A;  4COW A;  1CAX B;  2GC3 A;  4ZY9 A;  3OBA A;  2DUR A;  1ONA A;  3DXU A;  4KWU A;  5FQ0 A;  1YFU A;  2VTX A;  4CEW C;  5JZG A;  4COV A;  1Y43 B;  4BIO A;  1KRI A;  2BNO A;  4GKY A;  4IEW A;  5G04 L;  2C5D A;  5FZ9 A;  1RUG 3;  2W5F A;  2BFU S;  1Q56 A;  1R1A 1;  1ST8 A;  1W0O A;  2EXI A;  4GWI A;  1W2U A;  4YLZ A;  3PTY A;  4XUO A;  3H9A A;  4BPZ A;  1OUS A;  1A78 A;  1EUU A;  3N36 A;  1NOV A;  5CAZ A;  5CU1 A;  1R09 2;  3JB4 C;  1UQX A;  5FLI A;  4NRQ A;  4QB2 A;  3T1M A;  1C8N A;  1OSG A;  2JDP A;  3HT1 A;  4YM3 A;  5CFC B;  1JZ5 A;  1W9Y A;  3ZXG A;  4QDS A;  2VTF A;  2Y6H A;  3A0N A;  3MIB A;  2O8O A;  3WIN E;  2HYK A;  1LRH A;  3B5L B;  1C3H A;  3ETP A;  2VNG A;  5JR7 B;  3W21 A;  2DBN A;  4QXC A;  2F6B A;  3WEZ A;  2P3Y A;  4QKB A;  2JIG A;  4IXL A;  3NV4 A;  4K8F A;  4AVT A;  4IER A;  3O1V A;  2D43 A;  1LB2 A;  2I45 A;  4MUV A;  5LW9 A;  2DTW A;  3B94 A;  4LA3 A;  5AC9 2;  5EFU A;  1G86 A;  1C5I A;  3NAP B;  1OMI A;  4YNI A;  5FYB A;  4BXS V;  2LTN A;  4E4H A;  2VZS A;  3T0A A;  4CDW B;  3AP6 A;  2LRP A;  1H0B A;  3PUQ A;  2WDB A;  1O8P A;  4UAP A;  2H0B A;  4R9B A;  2D3P A;  5BNQ A;  2AH2 A;  1CR7 A;  2ZX4 A;  1LES A;  1VB2 A;  4OMC A;  5BNO B;  1LEC A;  2IXL A;  3VBO A;  4QPG B;  3VBR B;  2A6W A;  3NW4 A;  4E8D A;  3USU B;  1AYM 1;  3WDY A;  1RUE 1;  5DG2 A;  1KDM A;  3ALQ A;  3ACH A;  2PLV 2;  2BBA A;  1AXY A;  1OPM A;  1LEN A;  1IKQ A;  1AR6 3;  1O4T A;  2A6V A;  4XFI A;  1EV1 1;  2BWC A;  4XW3 A;  1B35 B;  1BYH A;  1ZBE 3;  2FDI A;  5ABJ C;  1J3P A;  1GQG A;  2VZ1 A;  3IDB B;  3C2U A;  4YZ5 A;  1WKY A;  2D5H A;  1VBC 3;  2YC2 A;  1LHN A;  4FQZ A;  4Y1Z A;  4ET7 A;  1IS3 A;  5FLH A;  3VL9 A;  1K5J A;  5CFC A;  2IXK A;  4JHZ A;  1RUG 1;  1GZW B;  2Q0A A;  1TMF 2;  4IE5 A;  5LEJ A;  4FTS A;  4N53 C;  3CEW A;  4Y26 A;  3ZR5 A;  3WNK A;  3NKT A;  1EUT A;  1MVE A;  2WWJ A;  1DZT A;  1RUO A;  2VZT A;  3D82 A;  3WDV A;  3SIT A;  1MS8 A;  1NCR C;  1ASJ 3;  3ILN A;  1W8Z A;  2FMD A;  3AMM A;  3SH4 A;  1PK6 B;  3K3N A;  1RIT A;  4CDQ A;  5L7O C;  1SQ4 A;  5JPM B;  4GWN A;  3ZFE A;  4I3G A;  2WFP A;  5ACA 3;  4MH0 E;  4E4D X;  1VE0 A;  5IAT A;  4TWT A;  4DQA A;  3BPZ A;  3K4D A;  4I2O A;  4KGG A;  4ZKT B;  1T2X A;  1MQT C;  3J26 N;  4EE2 A;  3VBF A;  4PLN A;  2WO7 A;  5GAL A;  3EYP A;  2WNE A;  4WVZ A;  3VHO A;  1O3S A;  1CZV A;  1GZT A;  3LEG A;  3MLJ A;  1X36 A;  5K0U C;  4OLL A;  1ZRR A;  2D6M A;  4M3C E;  4H7M A;  4CCC A;  2XPJ A;  4XOG A;  5FOB B;  4UF0 B;  1QJX 3;  1G9F A;  1UU4 A;  1JYX A;  4HVO A;  1YFY A;  4XPV A;  4NID A;  1GMM A;  1LAJ A;  1OOP A;  4NHM A;  4C8D A;  1WA6 X;  2KM2 A;  1B35 A;  4XUP A;  1F9K A;  1GP4 A;  1UCX A;  3I2J A;  1HRI 2;  3K4A A;  2CYF A;  2IWG B;  4GKX A;  2VBD A;  1ZBA 2;  4XJ9 A;  4PQQ A;  1TNR A;  1PO2 3;  2OZ6 A;  1AR6 1;  2LUW A;  4AG4 A;  1MEC 3;  1D7P M;  1T6G C;  1ZBE 1;  4JHT A;  2WZR 3;  3IIA A;  2ZGS A;  3B7M A;  5ERL A;  2WT1 A;  3SEE A;  1C8M 1;  1OKQ A;  5JMO A;  5JCT A;  5J37 A;  5T5P A;  1F8V A;  1PK6 A;  3M2M A;  3S57 A;  4X6Q B;  5B4N A;  2DVD A;  2GND A;  5FO8 B;  4CVU A;  2RR1 3;  2LM3 A;  2VW2 A;  5BNP B;  1JOB A;  4AQ6 A;  3OBR A;  4XXP A;  1JTZ X;  4FSJ A;  4ATE A;  1ASJ 1;  1WD4 A;  2AEN A;  5EQU A;  3GBF A;  4YZ3 A;  2Q30 A;  3HT2 A;  4RS5 C;  3LFM A;  5E88 A;  3AZY A;  5D8A B;  5ACA 1;  3K48 A;  1NCQ C;  3OGR A;  2D6O X;  1ND2 A;  3LEK A;  4IGQ A;  1LHU A;  2HBU A;  3M4F A;  3OYW B;  5A33 A;  3PJY A;  2EXK A;  4UOJ A;  1VBE 1;  2VUA A;  2A6Z A;  5A32 B;  2WA4 A;  5C6C A;  5I93 A;  1R08 1;  1VRB A;  3NL1 A;  4DXS A;  5KXC A;  2W95 A;  4MGS A;  2RMU 2;  3O1S A;  4ZS2 A;  1P8J A;  1Z78 A;  4Y1U A;  3UGG A;  2RDQ A;  3NNG A;  3RG0 A;  4LUK A;  4K40 A;  5IK8 A;  2GME A;  3H1Y A;  1QJX 1;  1BQP A;  1SBF A;  1UU5 A;  3IPV B;  3NWK A;  2WSU A;  4YFZ A;  4FTB A;  1QH7 A;  4A4A A;  5L9V A;  2ZXQ A;  4LR4 A;  5FP9 A;  4MLO A;  5FTT C;  2PMW B;  3CL1 A;  1V0A A;  2PEL A;  1UMZ A;  2BVB A;  3DCQ A;  4XEZ A; 
#chains in the Genus database with same CATH homology
 1VMH A;  1VE0 A;  1VPH A;  2P6H A;  1XBF A;  2CU5 A;  1VMJ A;  2P6C A;  1VMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...