3GXUA

Crystal structure of eph receptor and ephrin complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
175
structure length
171
Chain Sequence
NEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGTCKETFNLYYYESDNDKERFIENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-A receptor 4
publication title Structural characterization of the EphA4-ephrin-B2 complex reveals new features enabling Eph-ephrin binding promiscuity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 30
structure length 171
sequence length 175
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3gxuA00
1SHWB 2VZTA 2VZRA 4DUWA 1O8PA 2W5FA 1MPXA 3W5MA 4OMCA 3BN6A 3WNKA 3BGAA 3PUHA 3JXSA 4XZUG 3CZUA 3VD3A 3UNPA 3I2HA 2W46A 1OF4A 4ZY9A 2BGPA 1GOFA 4JKKA 4E8DA 4AG4A 2YFZA 2VC9A 3WF1A 2QQKA 2VQUA 1DLCA 1F4HA 3FL7A 3NJXA 4QPWA 3MUZ1 1JZ2A 4XUOA 4QX3A 4CUAA 3IAQA 3K46A 1T2XA 1UYYA 1O59A 4JKMA 2CDPA 1J84A 2YFUA 2XQXA 3LEIA 5EIYB 2WDBA 4KI5M 3VD7A 3ABZA 1US3A 2WN3A 1CX1A 4DUVA 5LA0A 2W1QA 3P6BA 2W94A 2Y6LA 5LCWL 2YC4A 4IUGA 3C8XA 1NAEA 3OBAA 1JU3A 2J1SA 3GGLA 2W1WA 3LE0A 4DEQA 4MADA 4DXSA 2JD9A 1UXXX 2LS6A 4PT6A 3SEEA 1NX9A 1PX3A 3NRUA 2LW8A 2WZ8A 5G04L 2B4KA 5IFPA 3DYPA 1W9SA 4QB2A 4BXSV 3I97A 4DXRA 1JZ3A 3OG2A 3UETA 1TG7A 4QAWA 2KD7A 3C7GA 2W91A 4HG6B 2BZDA 1ULOA 1W8NA 5LA2A 4OYUA 2BGOA 2ZXQA 4LHSA 4JKLA 2DCJA 2YG0A 4D0QA 3EB7A 5F7UA 3SEPA 4Z2AA 2VMCA 3K4DA 5J1XA 3FN9A 1XNAA 1UZ0A 3LPFA 4ET7A 5DMYA 3IDAA 1JZ4A 2ORXA 1RYYA 5FUIA 3UESA 3FHQA 1PMJX 5IJRA 3SKVA 1JYNA 2HYXA 1GOGA 1UMIA 2J7MA 3IIIA 2VMEA 2VZQA 1GUIA 2RJ2A 4A4AA 1XPWA 1W0NA 5LA1A 4P5YA 2W1SA 5A1AA 4CVUA 4XVHA 3EYPA 4KWUA 2W95A 1W8OA 2E26A 5JUVA 4A6OA 3GXUA 3U37A 1JHJA 3IB3A 1JU4A 3GDBA 2Y6GA 3MV11 2VTFA 2W47A 3WNOA 4ZZ8A 1L7RA 2EIEA 2W1UA 2WBKA 3C7EA 3I2JA 1BHGA 3NJVA 3HNBM 4FI9A 4W50A 3ACGA 1K42A 3I2FA 3LEKA 1TVGA 3K4AA 4DXTA 4LPLA 5JMOA 5DN2A 1H6YA 1CZSA 5CYYA 3HPNA 3ZM8A 2L9LA 3DYOA 2J1AA 2X09A 1GNYA 3W5NA 3OEAA 4XUQA 1WCQA 2JE8A 4P08A 1EUTA 2QQJA 3GM8A 4D8MA 2YB7A 3AC0A 3P1IA 3HNYM 4CUCA 2V5DA 4XUNA 2WQ8A 4BK4A 2YC2A 3I3EA 2Y6JA 3I2KA 3MO4A 3T0DA 5C71A 1LNSA 4BJ0A 3WNMA 2E33A 3VD9A 1UX7A 3DECA 3E1F1 4OZOA 3PUIA 5B4NA 3K77A 3LPGA 4MO3M 2VOTA 2Y8KA 3CMGA 2VZOA 2VZSA 3NNGA 2W92A 3C7HA 2EIDA 2X10A 4CU7A 4QDQA 2QQOA 1NKGA 3WNLA 5G05L 4W8JA 2BERA 1KGYA 3WNNA 3CIHA 3FHAA 4MGQA 4W4ZA 1UYZA 2J1UA 2OKXA 2V72A 2VCBA 2VO5A 3T09A 2VR4A 4QB1A 4ZXEA 1HN1A 1PMHX 5IFTA 1CIYA 4JHZA 2BBAA 2VMFA 4UAPA 3F2ZA 2Y64A 4XUPA 1IQDC 2Y6HA 3A23A 3A7QA 4MOAA 4CU6A 2VZVA 5HPOA 5HXMA 3HJRA 1UY3A 1JZ8A 2W3JA 3A22A 1UY4A 2E32A 4QDRA 3ACHA 5IYYA 2WAAA 1JZ7A 2QBXA 2DCKA 4A42A 2C4XA 2VL4A 2C9KA 2XONA 4ARXA 2E31A 3VDCA 3ECQA 1XC6A 1GOHA 3T08A 5JXIA 3ETPA 2VM9A 4ARYA 3C7FA 3LEGA 1R64A 4BK5A 4RYDA 2X05A 4MGSA 4UOJA 1ULPA 1W99A 2ZEYA 5EJ1B 5DPNA 2DDUA 3WEZA 1NUKA 1L7QA 2EICA 3K4ZA 4CU9A 3HOBA 4UI9L 3I3DA 1WKYA 3MUY1 1OF3A 4A41A 5JR2A 1SDDB 2ZEWA 5EJZB 1K12A 5JXGA 2VCCA 2W87A 1XNTA 3CKHA 2J1VA 3ACIA 3VD5A 3WQBA 3T2PA 4P00B 5JXJA 4XURA 1D7PM 3MV01 4QX2A 2WO1A 3D3AA 3CZJA 4GZ9A 2ZEXA 5CZKA 5B4XA 1UXZA 3T0AA 2QQLA 4CU8A 4LQRA 2ZEZA 3HN3A 5C70A 1OT5A 4A45A 4A44A 4PF1A 4QB6A 1K3IA 1UWWA 1DP0A 3DYMA 4QX0A 1UY2A 1SG3A 1GQPA 1JYXA 2VCAA 3J7HA 1UY1A 2WN2A 2XOMA 2HLEA 2RV9A 2JDAA 3VD4A 1KEXA 1P8JA 4M4RA 2WO3A 4DEVA 5IHRA 5I0DA 4KMQA 4GWJA 2VMDA 2Z4FA 3WF4A 3OB8A 3WSOA 5DQ0A 2VZ1A 4YPJA 2WAOA 2QQMA 1UMHA 1EUUA 2WZEA 1UY0A 2J1RA 3OEBA 4BDVB 2VZUA 4CUBA 2ORZA 2VZPA 3CQOA 1GMMA 1OH4A 3OGRA 3VDAA 3WF2A 4XUTA 3K75B 2VQTA 3CDZB 2QQNA 2WUHA 3T2QA 4AAXA 1CZTA 2QQIA 1YQ2A 1JZ5A 4JX0A 4E8CA 3I2GA 1J83A 4QDSA 3SKJE 4OMDA 3WF0A 4M4PA 4TTGA 3HEIA 3IAPA 4L0PA 4DUXA 1H6XA 1W9WA 2CDOA 2JKXA 4P02B 1JYVA 1W9TA 1US2A 3T0BA 3A21A 2V4VA 1DYOA 1UYXA 5C7GA 2VJXA 3C7OA 1JI6A 4PQQA 2WABA 2EIBA 1CZVA 3LQCA 4OUEA 1OD3A 4LKSA 2PQSA 1GU3A 3MBWA 4QX1A 2W9XA 2WO2A 4RN5A 3HNMA 1JZ6A 1K45A 3THCA 3THDA 1F4AA 1JYWA 2ID4A 3ACFA 3WF3A 3WNPA 1I5PA 3OGVA 4GWIA 2C26A 4A3ZA 4TXWA 2B9VA 2RVAA 3VDBA 5JXHA 2R7EB 1PX4A 2WYSA 2XHNA 2Y6KA 3NQHA 4ZZ5A 3I2IA 2J1EA 2J22A 2VZ3A 3I3BA 3T2OA 1O8SA 2J1TA 3OGSA
chains in the Genus database with same CATH superfamily
2VZTA 4EWDA 2OQ7A 1RUG1 3E5QA 3BYWA 3WCSA 1JW6A 1YJKA 3W5MA 2PHRA 4RA0A 5GZEA 4R9AA 2ZGRA 1X82A 3KCXA 4YW3A 3M3EA 5FZLA 4OVEA 3VD3A 1RITA 3UNPA 4OI4A 3I2HA 4KH9A 4ZY9A 4N53C 4DIQA 4MG2A 1OI6A 1NY72 2BGPA 3CJIB 4LKFA 1YJLA 4L11A 3T1LA 5FXXA 4Y3OA 4G3YC 1X8MA 5FZEA 1W9FA 4YW4A 5BNNB 4Q4V3 2QQKA 3ZMNA 2VQUA 5LK5A 1D4M1 2JDMA 4XYXA 2LTNA 3O0WA 4GJZA 4Q4V1 4Y4RA 1BEV2 3NJXA 5D8AA 1F2NA 1BXHA 1AR73 4XBLA 4QX3A 4CUAA 2FDGA 2I07B 2YYOA 1NCRB 2A6WA 3AP6A 1AR71 4JKMA 4L9BA 4EZ4A 1J84A 4YVWC 1A8DA 2YFUA 3LEIA 4XJWA 1CGPA 2XJRA 4JCKA 3SCGA 3PVBB 1UW8A 4Q0SA 1AF9A 2Y6FA 5BXXA 3ABZA 1NCQA 3PVOA 4UW6A 4CYDA 4UF0A 4ZKTB 3UGGA 5I91A 4YARA 1QEXA 1W2OA 5LA0A 2W1QA 4YW6A 1T6BX 1VIWB 2W94A 5LCWL 4YW7A 4B4PA 2YC4A 1LGBA 3ZPOA 4MV2A 3POEA 4IUGA 1HV1A 1U5ZA 1VJ2A 5L36A 1C4RA 2J1SA 3LZZA 3NKGA 4Q0QA 1W6MA 2IVIB 3D5OA 3EQEA 4P9XA 4DEQA 5HBAA 3HD8B 4PT6A 1MS8A 1NX9A 1PX3A 3NRUA 3OBZA 4COWA 1HIXA 1NLSA 3KT4A 3AMNA 3POBA 1GQGA 4XDQA 4XDOA 3CJIC 3PIJA 3EXUA 4LIVA 4IERA 4PLOA 4LHLA 1VALA 4EV0A 3ZYFA 1ALYA 1CAUA 1S0IA 2EA7A 3I8TA 1DF0A 3BTYA 4NIDA 2R1BA 4AFCA 2CWSA 4YVSC 5F5QA 1DDLA 1ULCA 2ZTNA 3G6JB 1TG7A 4QAWA 1F9KA 5E16A 5LW9A 4ZU4A 4MXVA 2C0ZA 2JDHA 2A6VA 3C7GA 5J3UA 2VD7A 4HG6B 2XKPA 1PO12 1ULOA 3A0NA 5T5OA 4CCOA 1DGWX 5CFDA 5FTTC 5ABJB 1QH7A 1QJY2 2VMGA 3LF7A 2BGOA 5T54A 5FLJA 4CDQB 3ZFFC 2JG8A 1O3TA 2DCJA 2X53S 3VL9A 2E7TA 3THPA 3EB7A 2VMCA 2JE9A 2Q8DA 4S2GA 4I2OA 1V6MA 3FN9A 1UZ0A 4XMIA 1NZIA 1JUHA 2ZHMA 3M7AA 4NPLA 2G1MA 4I0BA 5ERLA 2DV9A 4XW3A 3IPVB 1D4VB 1V6NA 5DUVA 5FZDA 3L2YA 5A33B 3FHQA 1Y43B 1XSQA 2WA4A 5JZGA 1GWKA 1ZZBA 3W20A 5K0UC 1W3XA 1GOGA 1D2QA 1POV0 2HWE3 2WWSA 2VMEA 1O4TA 1O5LA 2VZQA 1H8TA 2HWE1 3JBG3 3ZSMA 1XPWA 3E5XA 2EXIA 1O3SA 1CAWA 3JBG1 1MS3A 1A6CA 3EYPA 3M8LA 4KWUA 2W95A 2XBO3 4OHXA 3MF6A 4QXBA 4ES8A 1ULDA 3ZYHA 1S0CA 2XBO1 1JTZX 1LOEA 3U37A 4F7ZA 1EV12 5ABJC 1A8MA 5T55A 4L8QA 1BMV1 3IWZA 4GJYA 3H42B 4CDQC 3GDBA 5A32B 5FO7B 2Y6GA 3AMMA 2VTFA 1XJAA 5HXVA 4YWAA 5BNOA 4NO4A 1W6PA 3BU0A 4AF9A 1PVC2 2DBNA 3POYA 5GLWA 4D69A 3C7EA 1WCUA 2R0FA 2ZHNA 3HNBM 2WNVB 3ACGA 4FI9A 4CDUB 5A6ZA 3I2FA 5A80A 3ZXGA 5L19A 2CL2A 3VBHA 1F5FA 2WT0A 2G19A 4TLFA 5HI0A 4A7KA 3FX3A 2OUHA 2ES3A 4LPLA 5FXWA 5GLTA 5JMOA 5DN2A 3B94A 5FP8A 5CYYA 2BU9A 3HPNA 3PTRB 2L9LA 3Q8CA 3DYOA 2ZHLA 1RUOA 3B9CA 2GP5A 4Z82A 3U11A 4AGGA 2GC3A 4JHTA 4TLGA 4A3XA 1GP5A 3S57A 1HB1A 2MEV3 3JU9A 4O65A 2Y38A 4DXZA 1EUTA 1OH3A 2MEV1 3LGRA 4WVMB 3SHRA 1V6KA 1Y3TA 3VHOA 3OUHA 2V5DA 2K2SA 3RZKA 3QBQA 3S6PA 3OD4A 4BK4A 2YC2A 3I3EA 4U2AA 3VGIA 2D40A 1RUF2 1GP6A 2RE9A 2WLPA 5C71A 3T0DA 2FDHA 3GZTB 1DQ4A 4I02A 1RMU2 1WCSA 1YO8A 2ZAAA 3VD9A 4BHPA 1TMF2 3S0MA 4NMIA 1HV0A 2JB4A 3PU8A 4HOOA 4KBBA 2WNVC 1GNZA 2GSYA 3ILFA 4CDUC 3K77A 3SQOA 3LSDA 2DWRA 1DQ2A 1DU3D 4CDWB 3V65A 4OUSA 2C9AA 5DAPA 2W92A 4KL1A 3C7HA 3HQXA 3URFA 4ATFA 3X29B 3KGZA 2YXSA 2GP3A 4Q4X2 2F6BA 1RUJ3 1NKGA 4MGTA 2E7AA 1RUJ1 4O7XA 4IEUA 5EV7A 4LLOA 2XQRA 3WOGA 3FHAA 3ZSEA 4CCEA 4IESA 2XWBB 2R6QA 5LK7B 4C0HA 3KSCA 3AYDA 1VRH3 2VO5A 3T09A 4QB1A 4ZXEA 3ZKYA 4KWKA 4BQYA 3DXUA 1QXJA 2RS53 1HN1A 1VRH1 1CIYA 1LHOA 2DUQA 1OFNA 2WFF2 1VBB3 2RS51 3F2ZA 1Q5OA 4W6WA 5A7WA 1VBB1 4PF5A 4S2DA 2X5IC 2Y6HA 3A7QA 4CU6A 2AH2A 1AJKA 1C1LA 1ZBE3 4S2FA 4RGGA 5ACA2 3PVEA 5FPLA 2YU1A 1E5SA 4ZU7A 1ZBE1 4FPYA 3HJRA 1JZ8A 2HWF2 2W3JA 3OTFA 1I9RA 2E32A 2WWUA 4RD7A 4WZFA 5EYXA 3RMXA 4QDRA 4C1WA 3AKSA 2AEZA 2WNUA 1KFUL 3KCYA 3TWIA 4CDWC 1W28A 1FATA 3ZXEA 4OHYA 1F35A 1JHNA 5IYYA 1AR92 3FMGA 2QBXA 3KT1A 1Z7S2 3EJKA 4L92A 5JDBA 2C4XA 2KXLA 3WV6A 2VL4A 5A3OA 1OSGA 2Y0IA 4JC1A 3VV1A 3BKZA 1FMD3 3OJBA 1ND2B 2E31A 3LFMA 3NVCA 1FMD1 3TYJA 4MGIE 3NSTA 1XC6A 4DPNA 2XUMA 4O61A 5CVRA 4WM8A 1AJOA 1X36A 1QQP3 4GKYA 1SFNA 1LKNA 1XE7A 1QQP1 3KCCA 3OPWA 5FWJA 1WCKA 1WLTA 4RFT0 1O4YA 2BNNA 1DQ0A 5FV3A 4NRMA 4Q2FA 2DDUA 2WLQA 3GCXA 2JWPA 4CRQA 1L7QA 2P34A 3ES1A 1JUIA 1W2UA 4QMAA 4CTEA 2NYYA 5FYVA 3MIDA 2CSGA 3AB0A 1DGLA 1WKYA 4Q29A 5FYBA 2VULA 4KU8A 5FLIA 2VNGA 3ILRA 5D8AB 2PMWB 1PVXA 4AZZA 4Y20A 5JIUA 5LBCA 4WZCA 2OUJA 1JOBA 4GULA 3RSJA 2VAUA 1QDOA 2BP6A 1R092 2VVDA 3OGJA 1WBFA 2RM22 1N1SA 3H1MA 4DOUA 4AGVA 1SLTA 5H9QA 5DDJ3 1JOPA 1XE0A 3CKHA 5FZFA 3ZXLA 4WBBA 1NCQB 5DAQA 1ND2C 2WL1A 3JZVA 3MEPA 5DDJ1 3WP5A 3WQBA 4DINB 5FXZA 1KJLA 1BJQA 3P3NA 4QX2A 2YROA 1BEV3 2WO1A 2H6BA 3VZNA 4BYYA 3KV6A 4RR3B 5KBFA 2JG9A 1AR63 3SITA 1POQA 2D6NA 1FI2A 1TEIA 4QKDA 4YZ3A 1AR61 4Y1UA 5C70A 2DUPA 4QB6A 3KWVA 4AVVA 4XXPA 2Y33A 1W06A 3AMQA 4QQOA 2R0HA 3VZKA 5LRSA 3JD71 3K48A 4NHMA 4EQVA 1GQPA 1D4M2 3RDIA 1HRI3 1NXMA 4OUMA 3ZOIA 1UY1A 4Q4V2 3O1OA 3O1PA 4E27A 5AFEA 1CAUB 1HRI1 2WN2A 4LHNA 1DGWA 3WDXA 2FCTA 3MLJA 2AEYA 2HLEA 5D8AC 1G9BA 1AR72 2HWB2 5FJHA 3WG2A 4CPBD 3POSA 1W8WA 4AK3A 4ISRA 2XUEA 1KEXA 1ULFA 4MGZE 4DMIA 4M4RA 1ZNPA 2VNOA 1QXPA 5A7QA 5A3LA 2ZX2A 3Q8EA 1TNRA 4DEVA 2WT2A 5BNNA 5I0DA 4UBHA 3WP4A 4GWNA 5FP3A 4AFDA 5DZFA 3KHBA 3MDPA 2UWAA 2Y34A 4JAAA 3E6BA 1UIJA 2ZX0A 1NXD1 2WAOA 4CE8A 1UMHA 2VNRA 1NCRA 4HANA 2R072 2JDKA 2ATFA 1AXZA 1DZTA 2PAEA 5T3NA 1LR5A 1PO13 4YGBA 3USUA 5J48A 1SLBA 1UOFA 3O0XA 2VZUA 1PO11 2ORZA 2VGDA 4BQ3A 1IS5A 4FOVA 4N7IA 2VH9A 2CYFA 3PDQA 5HCBA 3OGRA 3H8UA 3VDAA 5JZGB 1F31A 4XUTA 4AI0A 1LAJA 1LULA 1WZXA 2WUHA 3FLRA 3WG1A 4XJZA 3CO2A 1CZTA 2Z5WA 3O1VA 2ZGTA 1H8TB 1UOJA 2VTXJ 2DVFA 5TSWA 2HWD1 1JZ5A 1FT9A 4LLFA 1MS4A 1UL9A 4QQ2A 1CAWB 3J7NA 4D6RA 2VE1A 3NV3A 2WA3A 3POFA 1UIKA 3OUIA 4YGDA 3SKJE 1HW5A 1JBCA 4PCRA 5A7PA 2XXZA 4K3UA 4E2SA 1RVF1 4OI0A 2RS31 5CFDC 2VW0A 3HEIA 4K1YA 3QCWA 1N3PA 4L0PA 2WR9A 4B7KA 4XC9A 1J1TA 5BNPB 3V0BA 3ZYIB 1YUDA 2JG8C 4IE4A 5FY1A 1ODNA 5BNOB 1UZVA 1W6PB 5DAVA 1US2A 3PMEA 1SQ4A 5IK4A 3T0BA 2PELA 4QQHA 4QX7A 2YDEA 1ULGA 5ANNA 5C7GA 3RGBA 4AOCA 4CZSA 4GKXA 5KC6A 5LASA 1JI6A 1WWYA 2PHWA 4PQQA 5I0UA 3VBHB 4LO8A 1VPHA 1KS4A 4BB3A 2D3SA 3DN7A 4AE2A 2D6KA 4QX1A 2W52A 2DTWA 4RN5A 1JYIA 3BTAA 5IT6A 3HNMA 4CCDA 3IIAA 5C3PA 3ZDSA 5JZGC 4TWTA 4FPEA 3VKLA 1YIPA 4QT6A 1JZ6A 1HQWA 3NNLA 4XBNA 1DYPA 1F4AA 1OLRA 1QU0A 2ID4A 4B7EA 3N4MA 4WVZA 3EO6A 3OGVA 1H8TC 2R063 4NIIA 3AKQA 3BIEA 2QQVA 2D6OX 3WW4A 4HVQA 1ZRDA 2R061 4B8EA 1OVPA 4IETA 3IPVA 4INDA 2VU9A 5JXHA 5F39A 2BTVC 2XBO2 2IVJA 1BMV2 3T2TA 2XHNA 4HK8A 1G6NA 2BQPA 5IAXA 4BZ4A 2ZA9A 3PHMA 1G9FA 2W39A 4HN0A 2NMNA 3WUCA 1YQCA 2WIIB 5FO9B 5JPNB 1OUXA 2BDRA 5BNOC 4XBQA 2A1XA 2HBUA 1SHWB 2VOWA 2VZRA 1CN1A 4DUWA 1O8PA 1GKBA 2ZGKA 1H2MA 1MPXA 2WZR3 5AVPA 4CXYA 5KHHA 4E4SA 3BN6A 2WZR1 2A3YA 2A73B 3PUHA 3VBHC 3ATGA 5FFOC 1BBT3 2D93A 1V70A 3OYWA 4XZUG 4ASKA 4V2WA 2W46A 1OF4A 1Y7BA 1BBT1 3FFQA 4H7MA 3UV9A 5F1RA 3FJSA 4JKKA 1XYNA 1XNBA 4ITCA 4K40A 4O9GA 4EN9B 1TMF3 3I4IA 2YFZA 4PLMA 4DY5A 1GZTA 4YNIA 1BVVA 1TMF1 2Q1FA 4BWOA 1IHMA 1W2AX 2HEYF 2HKXA 4K8FA 4OQ9A 1QY4A 2BOIA 3T4VA 1DLCA 1F4HA 1H9WA 5DZEA 2MEV2 4QPWA 4XUOA 2OVUA 4QHBA 5FCCA 4AFMA 4BMBA 2VBDA 1WA6X 4F83A 1QOTA 1RUI3 3FFZA 3HQRA 3ZXJA 2AGSA 4HXCA 5JLVA 5KHIA 3K51A 1NLQA 1BCXA 2P3JA 1RUI1 3FC0A 5EPAA 2XQXA 5IW0A 2E6VA 1LRHA 1BVP1 3GHNA 3VZOA 4IEOA 4Q4X3 1F5JA 1QMJA 5DUWA 3UGFA 2WT1A 5A7WB 3UK9A 3VZMA 4MHRA 4IGQA 4Q4X1 2XMLA 1UU5A 1Y9QA 4D3WA 5FWEA 1UQXA 1V6JA 1FNYA 3P6BA 4XFAA 2PQQA 1WGPA 3VHNA 3OBAA 3TBDA 5T5PA 3TNQA 3D82A 4QKFA 3S7IA 1HLCA 3LE0A 4UWDA 4MADA 4BISA 3RZLA 1H2LA 2LS6A 1UXXX 5J98B 2WNUB 1ND3B 1XNKA 2DU1A 1VMJA 2B4KA 5E1RA 5IFPA 4M3CE 2B7YA 1RIRA 2UWCA 1RUJ2 1OURA 1MACA 4UW4A 4MLOA 1W2TA 1CJPA 2OA2A 4QB2A 1GICA 3M3CA 3BPZA 2LUWA 2XKOA 4MVTA 1YEWA 2DF7A 4M3CF 4P14A 3WDVA 4BXSV 2V09A 3I97A 1FX5A 4HKOA 1GQHA 1GBGA 2X29A 3GF6A 3UETA 3D4KA 3LWCA 4WM8B 1VRH2 1W05A 1YC61 2KD7A 4YW5A 5FKBA 1YXWA 2W91A 2VG9A 2XJSA 2Z2SB 4FOYA 4U36A 2BZDA 1AR93 2RS52 3BPSA 1OA2A 3UGHA 4BLJA 1EAH1 1VBB2 2RR13 5F5AA 5FYIA 1AR91 5L7OA 5C8CB 4DQAA 2RR11 5IVYA 2O0OA 4D0QA 4Z2AA 5LBFA 4URTA 1W8TA 2BFUL 5I8SA 1CONA 3P5BA 3GBWA 2NPIA 4YZ2A 4Q0VA 1KRIA 1XNAA 4RQPB 4XFGA 4YG3A 4LXLA 3N9LA 4ET7A 5DMYA 2VOVA 4AWDA 1IG0A 1ZYBA 3KF3A 1CAVB 4FPJA 3TB0A 1OC1A 3B3QE 2WNUC 5K8SA 2G9GA 4Y20B 3UESA 4FSJA 1PMJX 2EF6A 1PM7A 1EP0A 4M01A 3SKVA 1JYNA 1R1ZA 4FXGB 4DB5A 2HYXA 3RFRA 1UMZA 2E7QA 1QJX2 4YFZA 1UMIA 2J7MA 1W8ZA 1FMD2 3IT8A 4A4AA 1HQNA 2AUYA 5FYYA 5AFBA 5FZKA 4BM8A 5J37A 3D0JA 2XVLA 5EP9A 4CVUA 5EYYA 3RZJA 2A70A 4LO6B 2JG9B 3ON7A 4WM8C 4DO0A 1XU2A 3L2HA 2IFRA 2PHLA 4ZS3A 1QQP2 1VLNA 3LB9A 1JHJA 1R093 5F6KA 1QIQA 4LHKA 5C6CA 2RM23 2RJLA 4I0AA 3RG0A 1MVEA 1WMDA 1JU4A 2E9QA 1R091 1U12A 3MV11 3U07A 2RM21 4IE5A 2XVGA 5A7NA 2BUKA 3ZR6A 1L7RA 4AEDA 2EIEA 1W6OA 4UFLA 2D3PA 4XZPA 2FD8A 2VNVA 2WBKA 3I2JA 3MIEA 3MW2A 3PU3A 1K42A 4BH9A 4JDOA 4XABA 4GB33 4KNCA 1AXYA 3J9SA 3WY6A 4Z2WA 5FXVA 2QFEA 1SFYA 4GB31 3VHPA 1TVGA 2ZPXA 4IGOA 2BGCA 3B00A 5FZOB 1JMUB 5DABA 4DXTA 3BUCA 3UYJA 1HN0A 4XFHA 4ES9A 1SBEA 1ZZ8A 4EZHA 4XF4A 1URXA 4GMP3 3ZM8A 5DDJ2 1BQPA 1LU2A 2PAMA 1PO22 2VUJA 1D4M3 1WMEA 3MFAA 4QKBA 1QKQA 4GMP1 3WVJA 3O7OA 1UZYA 2QZ3A 4LUKA 3N9MA 2VOXA 2FDKA 1H8VA 5FYZA 3TRSB 5F8PA 3OEAA 1RUH1 3ZLIA 1WCQA 2CGNA 4P08A 2C24A 5CG9A 3H3UA 1YFWA 2YV8A 3GM8A 2ZABA 5GLVA 2HWB3 4FAHA 2JG9C 1AR62 1QOSA 4NIHA 1V00A 2HWB1 2VVFA 4XUNA 2XJUA 4F8AA 3USUB 2IWGB 1RHI3 4Z1VA 5LWBA 1J3QA 4QHZA 4CXWA 2XVKA 3GZUC 3JD72 3I3QA 2BBVA 2ZCWA 1N3OA 4LE3A 1RHI1 3PURA 2Q8OA 5M0TA 5JSRA 2E33A 4M3CB 4Q4Y3 3DECA 3ELNA 3HN1A 1JXNA 3NJZA 4S2HA 1HRI2 4RR3A 4Q4Y1 2ZX4A 1AL0G 2LM3A 3ES4A 4Y1YA 5CB7A 4OQ8A 1H2NA 4UW3A 4UFIA 3KVAA 3FUQA 3MIGA 4R4XA 1PNFA 3LPGA 4P9GA 2D5HA 2R073 4NN0A 4LBQA 3BTZA 5JOZA 2R071 1WD3A 1LU1A 4LO5B 4R4ZA 2JJ6A 3WG3A 1J3PA 2EIDA 1MQTA 2DVDA 1XQNA 2A3XA 1DHKB 1LHVA 4XIOA 4N9HA 2VECA 3WNLA 2YZ4A 3V0BB 2B45X 1Q56A 1KGYA 2DCTA 4W8JA 3WNNA 3MF9A 5BNNC 4CUBA 2OQ6A 4MGQA 4PLNA 3GBFA 4W4ZA 4YGCA 3ZIWA 4XJ9A 3WZ1A 2CHHA 4Y5TA 1C5IA 1PIV1 5L9RA 4XFFA 4XOGA 2DURA 2OKXA 1UPSA 4NAOA 1HB2A 3IDEA 4AI2A 4C8DA 5F3CA 3AZWA 3RS6A 1NCRC 2WYFA 1QJU1 5FBZA 4CUGA 1PMHX 5FQ0A 1S0JA 2AACA 4JHZA 4C0BA 2BBAA 1H1MA 2VMFA 3AVRA 3OD0A 3IDBB 4WM7A 5A3MA 2Y64A 1REDA 1XE8A 1N1YA 2XLAA 4MOAA 4NVPA 4DNYA 4TYSA 3W59A 1X50A 3WP3A 1ZX5A 2DU0A 2PA7A 2UY9A 4IV3A 2HWD2 4AI1A 1NA1B 2OX0A 2ZZJA 5HXMA 4D7SA 4H3WA 1VAVA 2QJVA 4AEMA 1LESA 3AXEA 1GLHA 3ZR5A 3KS7A 3ACLA 3DF0A 3RI8A 1IS6A 5AC92 2IXCA 3ACHA 4N8MA 4R9BA 5FYCA 5A3UA 1RVF2 2RS32 1JZ7A 3AYEA 4QM8A 2GMMA 4LO4B 2A6ZA 2RDSA 3ZX7A 4A42A 2IXIA 3WDYA 3AM2A 3R4DB 3WCRA 3MFCA 2XONA 1QJEA 2CWMA 4XTPA 4AEJA 1H4GA 4UFKA 4GQ7A 2C6SA 1RXGA 1Q8PA 1BK0A 5FY8A 2LRPA 3VDCA 3EMRA 1NLRA 4UFJA 5LB6A 5J96B 1Q8QA 4R9DA 4WV8A 4Z07A 4ARYA 3LEGA 1G8WA 2CGOA 4BK5A 5JVVA 5C9AA 4XJUA 1XRUA 5BNPA 3VBOB 1ULPA 1OQEA 3OYWB 1GYKA 3HT1A 5FOJB 3TEYA 1IGOA 5JOYA 4GD4A 4H55A 1NUKA 1RXFA 3HOBA 3MLLA 3CBNA 4W65A 1VE0A 4DFSA 1S4CA 2R062 5JR2A 3I59A 1SDDB 1TQ5A 5GZFA 4UBGA 1H0BA 4GWMA 4XJAA 4AGRA 2P3IA 5FY7A 4P9LA 1BLZA 3RYKA 3O1RA 1KD7A 4FPOB 2OIIA 2P17A 2PHDA 3O14A 3U14A 5GM0A 1D0GA 1OHFA 4YYOA 4LR4A 4XURA 3MV01 3OOXA 3ZYGA 2KA3A 2NQYA 3D3AA 3CZJA 2QQUA 2VCMA 2FQPA 2WZR2 3T0AA 4CU8A 4AI3A 2ADDA 3HN3A 4JQTA 3VBRA 3DPRA 4A44A 1BBT2 3WR0A 3ZFGB 3BCWA 1W8UA 4PDWA 4MGYE 2VTXA 1S55A 2IC1A 3NW4A 5GZDA 1GFF2 4Q0UA 3WLUA 3LCPA 2BW8A 3IMMA 2VCAA 5I93A 1PGL1 1CQ9A 2AYHA 3BI3A 1LHUA 1CAXA 1RGSA 2Z79A 2PXJA 2EAAA 3Q8AA 3TEWA 2RV9A 4LBMA 2JDAA 2A5ZA 3GALA 4CCMA 5A6YA 2VMHA 3B93A 2DFBA 1RUI2 4RSUA 3NJYA 1D2SA 4LUMA 2BVVA 3LA7A 3I49A 3U4SA 2H0VA 4O9EA 3SMHA 4CP1A 2JENA 1NT0A 5L7OB 2XJVA 2NLRA 3KVBA 2YMZA 3U4XA 5LATA 1LOGA 1YWKA 4KMQA 2JB8A 3LOIA 5LBBA 3D0SA 2Z4FA 4LOTA 2QDNA 5HCAA 2HWC2 1N1TA 1VBC1 1VRBA 3LD8A 5KHJA 1FOD3 1ENXA 1S1AA 1COV1 2RHPA 2WZEA 4Y24A 1FOD1 1G7YA 1ENRA 5C9AC 2A75A 5BYNA 1R083 3H9AA 4BDVB 4HKLA 4R52A 3WQ1A 1FXZA 5IVVA 1R081 2BPA2 5I0SA 3W9AA 1LEMA 3NNJA 2BWAA 3WF2A 1Y9MA 4J6GA 3K75B 1H2KA 1XNDA 3MHZA 1C57A 1G86A 2QQNA 1AVBA 4AAXA 1FNZA 5E88A 5KXDA 3BU7A 1KXGA 3MLKA 1YQ2A 3MGUA 3T1MA 4XHBA 4XQ4A 3ETQA 1K5MA 3ZN6B 1MVQA 3DCQA 3I2GA 5FZIA 1ND3A 1EAH2 2ARXA 1I6XA 2WO7A 1ZZ6A 3NV2A 1DQ5A 3HMYA 2GDFA 3WF0A 2ZX3A 4M4PA 4CCLA 5JAXA 1Q43A 4UW5A 5FZ7A 1MS1A 1SLAA 2RR12 1M4WA 2BWCA 1QJX3 5L7OC 3NL1A 2BRTA 4FTEA 1UD1A 1GWLA 1QJX1 2JKXA 4P02B 2ET7A 2BVBA 4JDNA 4Y22A 4AEDB 4LO7A 1W9TA 3VKMA 1WLCA 1W6OB 3NV4A 4FPCA 3A21A 1PNGA 2WQ4A 1O6UA 1UYXA 1UPIA 4B4RA 2V5YA 3H8XA 4D94A 4D7TA 3UJOA 5A3TA 1C8NA 5FYHA 1LGNA 5ANQA 4LT5A 4XF0A 1V6OA 3QH6A 2C5DA 2WS93 3E97A 4M0HA 5C8CA 5I8TA 1C3HA 2YUEA 2ZKNA 3MBWA 1NZCA 1W8HA 1YLLA 2WS91 5IK7A 1OOPA 1S0EA 5GLUA 3THCA 2D6MA 1AYN3 5FY0A 1V9U3 3THDA 2Q30A 4AQ2A 1AYN1 4RQPA 1V9U1 3BTXA 5C33A 4GWIA 2C26A 5CKQA 1W0OA 2ZACA 3AFGA 4AI9A 4N43A 5A7OA 3H7YA 2B9VA 1CAVA 1ZRRA 5JWPA 2ARCA 3RZHA 3V0AA 1LJ7A 2A7AA 2XGXA 3AP5A 3NNMA 2YY1A 2WYSA 3LSEA 1WCDJ 3LA2A 1CWPA 2J22A 3HT2A 3WXPA 5A1FA 3I3BA 1PO23 1O8SA 1AZDA 2RDRA 5D2AA 3OGSA 1PO21 1HXS3 2ET1A 4AEDC 1RB8G 4QXHA 1HXS1 2IXJA 4JRLA 4COYA 2O1QA 1LEDA 3HVDA 3OGGA 3WT3A 1GZCA 4OMCA 4ORFA 2GH8A 2VQAA 3N7LA 3BGAA 3N9OA 4GB32 3WNKA 2Y0OA 2LALA 1C28A 3A0KA 4CEWB 4NRPA 3SNMA 4CXXA 4LBQB 1OA4A 1VBA3 3CZUA 4IV1B 4N53A 1DG6A 2R32A 2WNOA 4FCAA 1SDWA 2XL7A 3JD73 1VBA1 1AR83 4L2NA 5LEKA 1GOFA 2D44A 1MQTB 3LDRA 4XMAA 1UNBA 3LFIA 3T30A 1AR81 1L3JA 1WUVA 4AVSA 4E8DA 5FZ0A 3E6CC 4AG4A 5I0TA 4NPMA 1OPMA 4GALA 2VC9A 3WF1A 3IM0A 3WQ0A 5CBLA 1RUH2 4YG6A 3MI8A 5JOWA 3TN93 3AVSA 1CPNA 3QACA 1S0BA 2RS13 2AC1A 3TN91 1JZ2A 1BK1A 4RL7A 1JODA 2RS11 1T2XA 1UYYA 3K46A 1RJ8A 1HB4A 2D5FA 3KLSA 5EFUA 5FZOA 4N90A 2CDPA 4YGEA 1W3VA 1SLCA 3LIGA 5FQ0B 5EIYB 1OXCA 4KI5M 5FPVA 4WM7B 4Q27A 5FK8A 1RHI2 1XB9A 4GA9A 4LK6A 1YQ6A 1SCRA 3BOWA 3TEXA 2WN3A 1CX1A 1RJ7A 2XG3A 4IE7A 5KXBA 4GMP0 1NCQC 1WW5A 2CGPA 4Q4Y2 5IATA 5EJ3A 5HV4A 4JDMA 1OMIA 1W04A 1S0FA 3ZSJA 2F4LA 4RR3C 4RS5A 4IV3B 2W0XA 3PUQA 1HKDA 1W6QA 3C8XA 4CDXA 2EXJA 4MZUA 4AL9A 3B5LB 1V6IA 1JU3A 2P6HA 2VPVA 4EE2A 1JOJA 4UFHA 3GGLA 1LOFA 2W1WA 4QM9A 5H9SA 3PTYA 3B02A 4XEZA 4ISQA 3DKQA 5EZWA 2JD9A 4A7ZA 4DXSA 4AQTA 3E6DA 2WZ8A 3MZHA 1WW7A 3GBGA 3POWA 4HFSA 4YZ4A 1MQTC 5FPBA 5G04L 4M3CA 5C4WB 2E53A 5F3IA 2GNBA 2ZGQA 3RMYA 1W9SA 5BPXA 5E6HA 3O1MA 2HWD3 1PIV2 3AKTA 4JGYA 3N36A 4LORA 4Y1VA 4ZPIA 1QGLA 3I2DA 5FZ9A 3TOJA 4FQZA 4DXRA 1J58A 4L97A 1JZ3A 2SBAA 2ZOEB 5A3WA 3OG2A 5FPZA 3PUSA 1QJU2 3SH5A 5AC93 4Y1XA 5D1IA 1VAMA 3ZFEB 1RVF3 4NWWA 1FV2A 2RS33 4LA3A 5AC91 4FQ4A 2Q4SA 5LA2A 4FFGA 1WLWA 3ZFFA 4OYUA 1AUYA 4WM7C 3FE5A 5C9AB 2FDIA 4JKLA 5KR7A 4FP2A 2YG0A 5A7SA 3LAGA 1OQDA 3H7JA 1UAIA 4K6BA 5J1XA 3QH7A 1SLIA 2Y26A 2OYZA 3U78A 4Q4W1 4Q26A 1A34A 5FMCA 1WMXA 3IDAA 2IUWA 2WJSA 5LBEA 1JZ4A 3I59B 2FCVA 3NMBA 5SV8A 1ASJ3 1WBLA 4BCUA 1NG0A 3AP9A 1NYWA 4HSLA 5FUIA 1ASJ1 5IJRA 1XNCA 5K0UA 2ARBA 4PI0A 2VW1A 1JN2P 1LENA 3M2MA 1X8EA 5GJ6A 2JIJA 3WW1A 2R1DA 4B1LA 3FBYA 3UKVA 1SZBA 2Q8EA 1NA1A 5FZ3A 1GUIA 1Z0HA 2C1FA 2O14A 2RJ2A 4YLZA 4YM2A 5FYUA 3VBSA 1DQ1A 2B8MA 1MZEA 3LKJA 5JR7B 4KGQA 1TZOA 2JDUA 5A1AA 2J42A 4C90A 3VHRA 4JV4A 1W8OA 1CJDA 4CCNA 2ETEA 1AYM3 5JUVA 2IXKA 2HEVF 4QGMA 3GXUA 1QWRA 4HVOA 4KWLA 2P37A 1AYM1 1UN1A 1W0PA 1REFA 3AZXA 5D21A 3DPRB 3VBRB 3MIFA 1RUE3 1UYPA 2UY8A 2WNEA 3IN9A 3N7KA 3AZZA 4XPVA 4QKNA 4B29A 5BNPC 3O1UA 3JQXA 4DZGA 4PDWB 5C3OA 1RUE1 3M1HA 5DUXA 4NRQA 3ZXKA 1XYPA 4V1PA 4ZZ8A 1X9TA 1PM4A 3RYRA 1ENQA 4QGLA 2ZKLA 4BPZA 4PIXA 4RHV1 3NJVA 1BHGA 2VVEA 1D0HA 1ZREA 4KG0A 5IK8A 4Q1RA 4COZA 1CAXB 3ZMOA 3FZ3A 2HJIA 5EWSA 3VBOA 2DCZA 2OT7A 3K4AA 5C3QA 1H1AA 1H6YA 5GZCA 3R4SA 4J25A 2CV6A 3HQUA 1O91A 1TE1B 3FUOA 1HRV3 4YZ1A 2DTYA 1KQRA 2J1AA 1PHMA 1AX2A 2X09A 1GNYA 3W5NA 2MHFA 1HRV1 1GZ9A 2DUOA 3H3LA 4NJ4A 5CU1A 3RYPA 3WW2A 5BUVA 3VLBB 4XUQA 5C5UA 2JE8A 1QH6A 5FP4A 2RMU3 3MYXA 4XCAA 2D97A 2YB7A 4CP9A 2RMU1 1WW4A 2ZHKA 5K9YA 3HNYM 3VBFA 3ZDVA 2JICA 5DAWA 4G4FA 4XDPA 2WQ8A 4A2UA 4CP2A 1YFYA 4DRRA 3DL3A 2XJTA 1BKZA 4H2AA 3DPRC 3QOPA 3VBRC 5CKNA 2W08A 3PMSA 2YU2A 3MO4A 1W6NB 1CIWA 4YW1A 2VXRA 4PDWC 3DKWA 4AQSA 3WNMA 1PGL2 1UX7A 2RJKA 2XWJB 3ZIXA 2XLGA 3N3HA 2DVBA 4AVBA 2GH2A 2HWC3 3E1F1 1TME3 5JSOA 1APNA 3ZVXA 5FZ4A 2HWC1 1TME1 2N7GA 2F17A 4JRAA 2ZAHA 3ZO0B 2VOTA 1K5MB 3H50A 4QXKA 3ZFGA 3CMGA 2VZOA 4BQWA 3NNGA 4FOQA 3FLTA 1REEA 1W39A 2PHTA 4IEXA 4SBVA 1C1FA 4E4HA 4NIGA 1IZ3A 4AAPA 5F32A 1O4ZA 2A3WA 4KQ7A 4CPBA 5FY9A 4Q1PA 2ZJCA 2VQ0A 4ASLA 2EXKA 4RFRB 4QU1A 1VBC2 1TNFA 1Z78A 4Y22B 2J1UA 1O5UA 1COV2 4IEVA 5JIAA 3R0RA 3CLPA 1FOD2 2WC2A 4NAMA 2VCBA 4PQ9A 1GZWA 2VR4A 4OI1A 3PIGA 1LODA 5F3EA 5C3SA 1WLDA 1EAH3 3B01A 3I7DA 4MUVA 4FVVA 4OHWA 1T6GC 4L99A 2TBVA 3HIFA 1UX6A 5KWRA 1R082 3ZYRA 2GALA 4XUPA 4NHXA 4EWAA 3A23A 4V2VA 2AREA 2QTWB 5KC5A 1HDKA 5LY2A 2VW2A 1ACCA 1OOPB 2WSUA 3LDBA 2AENA 1H1IA 4IEWA 2VZVA 4FXKB 5C3RA 5F5IA 3AKPA 5FZCA 2Q8CA 1ONAA 3A22A 1W90A 3J4UH 2SLIA 4N43B 2PN5A 4JQRA 2GC2A 4IE6A 1K5MC 3NAPA 4IW3A 3MW4A 3OSDA 4F3JA 1LOCA 3V0AB 3WDUA 1YHFA 5I0RA 2CY6A 1ND3C 5FYTA 2DCKA 1LHNA 4FFFA 3AXDA 3R05A 4LITA 1ZVFA 3U1XA 2C9KA 3VZJA 1DIWA 3C2UA 2IXHA 4P5HA 5KXEA 2JIGA 5F6LB 3UT0A 5CFCA 1ZA7A 5E89A 3KM5A 2RG4A 2XL9A 3ECQA 5GALA 5F2WA 3K3OA 3T08A 3ZN6A 4D6QA 5JXIA 3ETPA 3WUDA 1AXKA 3AP4A 5LRRA 1PK6A 2P6CA 3C7FA 4IEQA 2DCYA 2PFWA 2X05A 4IXLA 3AKRA 1EYBA 2JDPA 2WS92 4NR1A 1W99A 4N53B 5EJ1B 5C8CC 3W21A 3GJBA 5SV5A 3RRDA 4ASMB 4AHYA 2EAKA 3ZN5A 1DBNA 5BNQA 3WEZA 1G9AA 1OOPC 4JZRA 1AYN2 5H9PA 1V9U2 3K4ZA 2K46A 2Q5TA 1AL22 2R16A 3OCPA 1OFSA 3NO8A 4UI9L 3S5AA 2XPJA 2QE3A 4A41A 4QHOA 2P2KA 3DEMA 4RQPC 1GWMA 3LIHA 4M0NA 1CD3G 4N43C 4IEYA 4Y1ZA 2IXLA 5K7PA 3OBTA 3NNFA 1K12A 3ZKUA 2XHKA 4E9KA 2WINB 4YVWB 4NUBA 2VCCA 2TUNA 4YM0A 3CNAA 5DAXA 2Q1MA 4FTSA 3RI9A 5KHGA 2I2SA 1ZA4A 1ENSA 2KM2A 1SCSA 5IAVA 3AZVA 1I3HA 3VD5A 5JPMB 3PJYA 1RUH3 3T2PA 3B9IA 2BJSA 3S7EA 1BYHA 3KHCA 1D7PM 1HXS2 3ZYBA 3R6SA 2XJQA 1DYKA 1LECA 3T4HB 2CTVA 4GZ9A 4RS5B 1UXZA 2QQLA 1W6QB 4CDXB 1LGCA 3POJA 1H4HA 3NWKA 4B3NA 1H9PA 3F95A 4GAZA 4R9CA 4XQDA 1UWWA 1VBA2 4QXCA 2B5HA 3WP6A 2XH6A 3GYDA 3UL2A 5FZMA 3WQ7A 1DP0A 1AR82 3DYMA 5FRAA 3ZXFA 1CX4A 2BNMA 1C8M3 4UFMA 2JX9A 1DQ6A 1QDCA 1SG3A 1E5RA 1C8M1 4Z92B 1MS9A 2GMEA 2V73A 3A4UA 1BZWA 4ATEA 3TN92 4JGYB 5A70A 3N35A 4YVSB 2RS12 2K9ZA 4CEWA 4I01A 1ST8A 4IV1A 3DXTA 3KQRA 4I3PA 2PHFA 3MICA 3KV4A 1IKQA 1P8JA 3OPZA 1PGSA 3E5UA 5FZAA 5A6QA 1J3RA 5ISLA 2UURA 4MGKE 2ZMNA 1LB2A 3ZFFB 5GZGA 5DZGA 3KMHA 4BQXA 2FZ1A 4QPIA 5IHRA 3AL6A 3VDDA 4I09A 2Q1ZB 2GMPA 5FMDA 1PIV3 2AZ5A 2VMDA 1FYUA 5FZBA 1DGRN 5IWFA 2UYAA 3SH4A 1IQAA 2A6XA 4AXOA 5JI7A 3B69A 1Y4WA 1Q8SA 1RTVA 4RS5C 1EUUA 1QJU3 3SCFA 3N9PA 4OI2A 4CDXC 1G9CA 1UY0A 1W9YA 2GU9A 2OPKA 3KZ4C 3OEBA 1LOFC 1RC6A 1GR3A 3ZSLA 1YQ5A 3NKTA 3JCIA 1YI7A 4GH4A 2ZZQA 1YI9A 1GMMA 1U5IA 2JE7A 4Y33A 2QUOA 5K0UB 4XFCA 1OH4A 1UKRA 4B1MA 2MNGA 2VQTA 3CDZB 3T2QA 2EIGA 2ZGPA 4AFBA 3N7JA 2FDJA 4PIZA 4K20A 3VBSB 4JGYC 4MYEA 4OFGA 4FPKA 3ZYJB 4YZ5A 2ZGUA 4QPGA 2Z69A 3L9JT 3UKNA 1V0AA 3Q8BA 4N9IA 5FAXA 1EPWA 5T50A 1J83A 3LA3A 4PBPA 4QDSA 4OMDA 4K1ZA 4R8HA 3BOPA 4XFBA 1E5IA 3ZSKA 3N9QA 1S2EA 5C4WA 1WD4A 2LROA 3ZPYA 4CEYA 5FYSA 4AEKA 4DUXA 2XJPA 1H6XA 3AP7A 4LKDA 1W9WA 2CDOA 2ERFA 4NWVA 4K8RB 5FDBA 5KHKA 2ZGNA 1LCLA 2VUDA 4EJRA 1ZZ7A 1E57A 2E63A 3KV9A 4HKWA 4Q4W2 2V4VA 3OY8B 5DXDA 1DYOA 4AVAA 4FPFA 4K7JA 4YG0A 2ZGMA 5BY5A 2VJXA 3C7OA 4B4QA 1AX1A 1DLLA 1SBDA 1JH5A 1VAKA 2WABA 3ZFEA 1SLLA 4LKSA 2PQSA 2OZJA 3HR9A 1ASJ2 4FP3A 1MS0A 4PJYA 5CIRA 1GU3A 2PHUA 5FZ6A 2HBTA 4BQ4A 3RJRA 1IS4A 1PZ8A 1FPN3 1ZBA2 1SBFA 5J7MA 4NIAA 3RPQA 4SLIA 1FPN1 1K45A 3HBKA 3N7MA 4XJ8A 1HJGA 3PVNA 1JYWA 2JD4A 2ZS6B 5KXCA 2B46X 4QU2A 4QWNA 5F9TA 1B35A 1NA1C 1QJZA 2NM1A 3VBSC 3KQ4B 4TXWA 3AL5A 1YIFA 2RVAA 2YBKA 3VDBA 4HBNA 4MX3A 1DZQA 4FBFA 3KGLA 1S2BA 4OULA 4CP9B 5JI9A 1AYM2 2R7EB 4DRVA 2BYVE 1ODMA 3HWJA 2P3KA 3VBFB 3NQHA 4ZZ5A 3I2IA 4D7YA 2EVXA 1RUE2 1N1VA 1Y9GA 3ORJA 2J1TA 3AMPA 1W03A 2H6CA 4HPKB 4RHV2 1A78A 5CEHA 3POGA 4META 4OLLA 2BV4A 2JECA 2W5FA 4LBJA 1V6LA 3VZLA 4LEJA 3RVHA 2R30A 1PMIA 1RINA 4FFIA 3DGTA 2WKKA 1OVSA 3JXSA 5EXOA 4K21A 1OA3A 1LOAA 1WW6A 2ZGSA 4P9WA 3TAYA 4CP0A 4EN7B 2R49A 3WHTA 3TNPB 3VBOC 2BNOA 1YFXA 4ONUA 4HLTA 2P1BA 4P9IA 5I8YA 1X33A 3N9NA 1UU6A 3U75A 4ZU5A 4BXFA 5HCFA 2OS2A 1HRV2 2D6LX 5T5LA 5BV6A 5CAZA 1UCXA 4H7LA 3WD5A 1IS3A 5FMOL 3FL7A 1UOBA 2O8QA 1SPPB 2RMU2 3MUZ1 5A3PA 4XE9A 4BQ5A 3WW3A 3IAQA 3RZGA 3AX4A 1O59A 1GZWB 2NZ9A 1KFXL 3VBFC 1HJFA 2VBPA 2WDBA 3IBMA 5FKCA 3RWKX 2ZMKA 3M70A 2X5IB 4LBOA 3VD7A 1GANA 1ZRIA 1K5JA 1YRZA 1US3A 3KD4A 5FMBA 1UZZA 4DUVA 4KG8A 1VBC3 4Y5SA 3AK0A 2Y6LA 1COV3 1Q3EA 3J7MA 4AHWA 1OQ1A 1TME2 4IGPA 4KWJA 5DG2A 3WDWA 4ZS2A 3LOBA 1NAEA 3O5SA 4LMFA 2OZ6A 4COVA 3U10A 2X8KA 2WSVA 2EXHA 4XAAA 3JQWA 2NP0A 3SEEA 2ARAA 1NOVA 3NAPB 3ZFGC 1RL3A 1W6NA 2LW8A 2PLV3 4CA9A 5JCTA 2BEOA 1UU4A 1RUNA 4NHYA 5L9VA 2PLV1 3DYPA 4BIFA 2H0BA 2NN8A 5T52A 3RQ0A 2JDZA 1S2KA 3BALA 4UYBA 5FLHA 1YCIA 5CFCB 4XAEA 5J36A 3CEWA 3JB4C 5FK7A 2D98A 4JGZA 4URAA 3O0VA 2ENRA 4LK7A 4NE9A 4DY3A 3SC7X 1OBNA 1PGW2 3KT7A 4G9SB 3VKNA 3FWEA 5JOXA 5DUUA 2G4IA 1O7FA 1PK6B 4OZXA 1W8NA 4NPRA 3R4UA 4OHVA 1Q8OA 3WNXA 2A6YA 2R042 2ZXQA 3I54A 4LHSA 4PBOA 3WG4A 4D6SA 1X9PA 5FR3A 5FJKA 1ZZ9A 2WQZC 5F7UA 1UKGA 3SEPA 4IL7A 4YRDA 4C1XA 4FPGA 2PYTA 3K4DA 1JYCA 1RUD2 4KBZA 1EPZA 5HV0A 4XF9A 3SLIA 1R1A3 2ADEA 3LPFA 3GNEA 1R1A1 1VBE3 1RUC3 4BA6A 5F37A 5A6XA 1VBE1 1RUC1 2ORXA 4XIKA 3NAPC 2YGLA 1RYYA 1U5XA 4IDZA 4NHLA 5K4LA 1C5HA 3W58A 2QNKA 5F3GA 1DZRA 1QNYA 4MXWA 3J8F2 1IPJA 1NE4A 2JDNA 4Q5OA 2Q0AA 1MEC3 1GV9A 2KR2A 3IIIA 3PLQA 4IE0A 4JTNA 1AL23 1MEC1 4AVTA 5CFCC 4Y5Z0 5JMCA 2ILMA 1UO9A 4FTBA 1W0NA 1AL21 1OUSA 3AMHA 1OLQA 4P5YA 2W1SA 3WX5A 5LA1A 3VUOA 2TEPA 1YFUA 4BLIA 4EN0A 4XVHA 4LTAA 1L7LA 1VBD2 3VBUA 4N7UA 2E26A 4C91A 1PK6C 2QVSB 4A6OA 5CISA 3AYAA 5C5TA 1EY2A 3RNSA 1QJFA 4AI8A 2DYCA 3K2OA 3O1SA 3IB3A 1YQ8A 3J7LA 3UJQA 3V64A 1PZ9A 1LOBA 4LKEA 4HN1A 3AJZA 1NQDA 2W47A 3WNOA 5CA6A 4FOWA 4E2QA 4PHZA 2DFCA 2W1UA 3VKFC 2PHXA 4W50A 3WDTA 3VKOA 5FY4A 2D6PA 4M00A 2D43A 4WVVA 4BQ2A 3ME2A 3ZYPA 4QD2A 2IZWA 3ST7A 1N3QA 3FLPA 3LEKA 5A3NA 3CU7A 5FP7A 3EHKA 4UT5A 2YGMA 5T5JA 2B39A 2I74A 1M06G 5FO8B 2OPWA 4ZONA 3ZXDA 1J59A 5F2SA 1CZSA 3RZZA 1NY71 3ZN4A 1S0DA 1OD5A 2UYBA 1ZRFA 3KB5A 4QPIB 4UF0B 1RUG2 3VDDB 4AR2A 4CCKA 4HONA 5FBJA 2CAVA 5IVJA 2QQJA 1BEV1 1DFQA 1MZFA 4D8MA 2ZGLA 4X6QB 2YBSA 3M4FA 3AC0A 3P1IA 3POIA 4YVWA 2D3RA 2VOKA 3H0OA 4CUCA 1AX0A 3MPBA 1W6MB 2BFUS 2YHJA 5IUQA 1SFPA 2Y6JA 5HCHA 2JDYA 3I2KA 4Q8KA 3VB9A 1U0AA 3HAGA 1LNSA 4BJ0A 3Q9OA 1X7NA 4GH4B 1VR3A 4XXAA 1CVNA 3RJ2X 1C8M2 5B2GB 3TEZA 1QHDA 4XFIA 2VY0A 3GCWA 2VXJA 4OZOA 3PUIA 4K9SA 3GHMA 2BOJA 4X6RB 1OLMA 4CSWA 5B4NA 5IVCA 4UXAA 1OKQA 4LNVA 1IPKA 4QPYA 1HX6A 3CF6E 2VUCA 5EQUA 4MO3M 5FY5A 5CADA 4QPGB 4CEWC 2Y8KA 4YFWA 3VN4A 4OHZA 2VZSA 4IV1C 3IKWA 3CJIA 2AR6A 1CR7A 2G9ZA 2X10A 4AW7A 4CU7A 5CFDB 4QDQA 1IKPA 1I1EA 2RDQA 2QQOA 1NE6A 4CEYB 4ZHNA 4HETA 2GC0A 2JG8B 2P4EA 5G05L 2BERA 3HBZA 4QPIC 3PL0A 3CIHA 3VDDC 1UYZA 4J1WA 4KGGA 4MSVA 1QNWA 4YM3A 3SCHA 1I5ZA 2GN3A 4WVWA 4Q8LA 4YVSA 5GLZA 3VL8A 4A7YA 2F4PA 2V72A 3UKTA 3LDKA 4ZXKA 2GNTA 3OF1A 3OUJA 4XACA 1WMFA 5IFTA 1O3QA 2WFPA 4DS0A 2ZMLA 1QJY3 4HL0A 4TN7A 4UAPA 3MW3A 2XLFA 4E2GA 1IQDC 1QJY1 3IZOA 5FUNA 2YPDA 4Y26A 1POV3 2GNMA 4GH4C 3IMNA 1UZWA 3OPTA 3ITQA 3BODA 1POV1 2K0GA 4EN8B 4Q4W3 5GKAC 5HPOA 1UY3A 4BU2A 1KDMA 4IV3C 1B35B 3KF5A 1SMVA 1UY4A 3EBRA 3JB8A 3B7MA 1KDKA 4QQPA 1YYNA 5CG8A 4QPGC 1AHSA 5L9BA 5JSPA 1J1LA 5LZ6A 2FMDA 1W8FA 2WAAA 2RDNA 4QX8A 3S5QA 2DBIA 1G9DA 1ZBA3 2DVGA 3C3VA 3IDCB 1QOOA 3LEMA 3SXWA 4EYUA 4CEYC 5C4WC 1ZBA1 4NHKA 1ZM1A 4ARXA 2QQWA 4HVRA 1UF2C 4LBKA 3APBA 2OXBA 1W2NA 1IOAA 1GOHA 4E4DX 3ASIA 2VM9A 2VMIA 1OKOA 5ABJA 1R64A 3ZFEC 4RYDA 3SH3A 3H3ZA 1EV13 3BIWE 2P3YA 4MGSA 4UOJA 2FDFA 5FZGA 4CDQA 2ZEYA 2ZGOA 1EV11 5DPNA 1ZRCA 1DGRA 2WRAA 1FPN2 4HZFA 4OCTA 4HMZA 2JEMA 4RHV3 1PVC3 2HWE2 2V4AA 4LULA 2EICA 3OY8A 5E8AA 4CU9A 4FPHA 1PVC1 3H1WA 3JBG2 3I3DA 4LA2A 3MUY1 1OF3A 1XOYA 4PIYA 4XTMA 1B35C 4A6SA 4AHXA 2GC1A 1LHWA 5AVAA 3RZMA 2ZX1A 2ZEWA 5EHDA 3ENRA 5EJZB 2GAUA 3MIHA 5FZ8A 5IK5A 5A33A 4NOTA 4XHXA 1QXRA 2PTMA 5JXGA 3USSA 1XSRA 1NQJA 2W87A 1DCSA 4PI2A 1XNTA 2J1VA 2DVAA 2HEWF 3ACIA 4AFAA 3S30A 5C8WA 4P00B 5JXJA 5LY1A 2ZBJA 1H30A 2VUAA 4JTOA 1WA4A 3SISA 2IFWA 2ZEXA 3H8RA 2JXAA 5CZKA 4RGAA 5B4XA 1VMFA 2JKBA 4MH0E 5FP9A 4LQRA 5F5CA 1S0GA 2ZEZA 2FMYA 1U5YA 1IG3A 1OT5A 4YW2A 4A45A 4PF1A 4LIUA 4W6XA 1K3IA 4GIQA 4Q0PA 1E5HA 5DG1A 1RUF3 3WINE 5A32A 1F15A 1O3RA 4IQPA 2XDVA 4AYUA 4XCBA 3GJAA 1GNHA 1RUF1 2CAUA 3BB6A 1RMU3 4LJHA 4QX0A 4XETA 4BMEA 4HPKA 1UY2A 4LBQD 1RMU1 3PJQA 1JYXA 2WNVA 3J7HA 1MR5A 3FBMA 4CDUA 4E4ZA 1KJRA 1XYOA 1MZ5A 2XOMA 1OLME 3JUUA 2QCSB 3AJYA 4JGZB 3VD4A 3PUAA 3THTA 2YC0A 4RGKA 2Z42A 1VMHA 4AVCA 3AZYA 3CL1A 3ZXAC 1JS9A 1LTEA 2G9FA 3DV8A 1XU1A 3RWNA 4FAGA 2WO3A 4LBNA 1STMA 1HB3A 3QLQA 5LEJA 4COUA 4BQ1A 1SACA 1F8VA 2O8OA 1VB2A 2OW4A 4IEZA 3INAA 2D7FA 2HYKA 2Y60A 4GWJA 2MPFA 4NROA 3OB8A 3M3QA 3WF4A 3WSOA 4CCJA 5FIXA 1SPPA 2P5BA 5DQ0A 3M3IA 2VZ1A 4WVMA 4YPJA 3Q8FA 3MIBA 2QQMA 1XBFA 1SEFA 3KV5A 3CHXA 4XQWA 1IPSA 1PGW1 2J1RA 3NV1A 4EROA 2WFF3 2YPJA 5FUPA 2QQPA 4AQ6A 3I3MA 3DUIA 2QDRA 2R043 2WFF1 2X5IA 4FPLA 4HSJA 4JVAA 4XF1A 2PLV2 2VZPA 3J26N 4LE4A 5CKMA 3CQOA 3GZAA 2R041 3M3OA 4EN6B 3AYCA 5ACA3 3O12A 4MXWB 4I0WB 2W68A 4BIOA 4LBLA 5ACA1 1RUD3 2QQIA 3V56A 4FFHA 4W6YA 4FO9A 3U0ZA 4TZDA 2UWBA 2HWF3 1RUD1 4JX0A 1OPOA 2B42B 2A71A 1N47A 3D6EA 3FHIB 4JGZC 2HWF1 4Y4YA 2QZ2A 5FZHA 3P3PA 4CDWA 3O1TA 4E8CA 2I45A 1GP4A 1UOGA 5FOBB 2GZWA 3VBUB 3GZEA 1Z7S3 3H1YA 4QGNA 2PAKA 3ALQA 2B9UA 4TTGA 2WZPP 4J1XA 1PZ7A 1ZZCA 1ULEA 1Z7S1 3J8F3 3IAPA 4P9YA 4I3GA 1MS5A 4IEPA 5FZ1A 3T3YA 1VB4A 2GN7A 2HH9A 3J8F1 1JYTA 1ZBE2 3ILNA 4QQLA 1JYVA 2W2IA 4KU7A 2XR4A 2NMOA 4AHZA 5FPUA 1YNAA 1R1A2 4I30A 1VBD3 4HK9A 3QD6A 2FCUA 3K3NA 2EIBA 1CZVA 1VBE2 1RUC2 1OD3A 1VBD1 2EALA 2WWJA 3LQCA 3MPPG 4OUEA 4XILA 4YSFA 2FHRA 3CJXA 4CCCA 5A1LA 5FPXA 5L73A 3I2OA 1CESA 1VP6A 5FYMA 4EWEA 5FMOS 2CU5A 1FV3A 4LOSA 2W9XA 2WO2A 3D8CA 4Z8BA 1Q8VA 1KITA 5H9RA 4X8PA 2XB6C 5IVFA 5LA9A 5APAA 4MHUA 3H8OA 4GXLA 1GSLA 1MEC2 1KS5A 4HT1T 2E51A 2QKDA 3ACFA 1FAYA 4FT8A 2TNFA 1B09A 4X8NA 3WF3A 3WNPA 1I5PA 1QF3A 4YM1A 5IVBA 4P9JA 4H14A 4XF3A 4A3ZA 5J09A 4BOWA 1HQLA 3OBRA 4QX5A 3AFKA 3BVCA 1A3KA 3WHUA 3VBUC 2VBBA 1PX4A 1MZ6A 2Y6KA 2GNDA 2UU8A 5FREA 3G7DA 4TSVA 4BE3A 2FZ2A 2J1EA 2VZ3A 2FBEA 3PNAA 5IVEA 1CPMA 3T2OA 1ND2A 2YBPA 5FPAA 1XXNA 3ROUA 2CNAA 1RUG3 5CNAA
chains in the Genus database with same CATH topology
1SHWB 2VZTA 2VZRA 4DUWA 1O8PA 2W5FA 1MPXA 3W5MA 4OMCA 3BN6A 3WNKA 3BGAA 3PUHA 3JXSA 4XZUG 3CZUA 3VD3A 3UNPA 3I2HA 2W46A 1OF4A 4ZY9A 2BGPA 1GOFA 4JKKA 4E8DA 4AG4A 2YFZA 2VC9A 3WF1A 2QQKA 2VQUA 1DLCA 1F4HA 3FL7A 3NJXA 4QPWA 3MUZ1 1JZ2A 4XUOA 4QX3A 4CUAA 3IAQA 3K46A 1T2XA 1UYYA 1O59A 4JKMA 2CDPA 1J84A 2YFUA 2XQXA 3LEIA 5EIYB 2WDBA 4KI5M 3VD7A 3ABZA 1US3A 2WN3A 1CX1A 4DUVA 5LA0A 2W1QA 3P6BA 2W94A 2Y6LA 5LCWL 2YC4A 4IUGA 3C8XA 1NAEA 3OBAA 1JU3A 2J1SA 3GGLA 2W1WA 3LE0A 4DEQA 4MADA 4DXSA 2JD9A 1UXXX 2LS6A 4PT6A 3SEEA 1NX9A 1PX3A 3NRUA 2LW8A 2WZ8A 5G04L 2B4KA 5IFPA 3DYPA 1W9SA 4QB2A 4BXSV 3I97A 4DXRA 1JZ3A 3OG2A 3UETA 1TG7A 4QAWA 2KD7A 3C7GA 2W91A 4HG6B 2BZDA 1ULOA 1W8NA 5LA2A 4OYUA 2BGOA 2ZXQA 4LHSA 4JKLA 2DCJA 2YG0A 4D0QA 3EB7A 5F7UA 3SEPA 4Z2AA 2VMCA 3K4DA 5J1XA 3FN9A 1XNAA 1UZ0A 3LPFA 4ET7A 5DMYA 3IDAA 1JZ4A 2ORXA 1RYYA 5FUIA 3UESA 3FHQA 1PMJX 5IJRA 3SKVA 1JYNA 2HYXA 1GOGA 1UMIA 2J7MA 3IIIA 2VMEA 2VZQA 1GUIA 2RJ2A 4A4AA 1XPWA 1W0NA 5LA1A 4P5YA 2W1SA 5A1AA 4CVUA 4XVHA 3EYPA 4KWUA 2W95A 1W8OA 2E26A 5JUVA 4A6OA 3GXUA 3U37A 1JHJA 3IB3A 1JU4A 3GDBA 2Y6GA 3MV11 2VTFA 2W47A 3WNOA 4ZZ8A 1L7RA 2EIEA 2W1UA 2WBKA 3C7EA 3I2JA 1BHGA 3NJVA 3HNBM 4FI9A 4W50A 3ACGA 1K42A 3I2FA 3LEKA 1TVGA 3K4AA 4DXTA 4LPLA 5JMOA 5DN2A 1H6YA 1CZSA 5CYYA 3HPNA 3ZM8A 2L9LA 3DYOA 2J1AA 2X09A 1GNYA 3W5NA 3OEAA 4XUQA 1WCQA 2JE8A 4P08A 1EUTA 2QQJA 3GM8A 4D8MA 2YB7A 3AC0A 3P1IA 3HNYM 4CUCA 2V5DA 4XUNA 2WQ8A 4BK4A 2YC2A 3I3EA 2Y6JA 3I2KA 3MO4A 3T0DA 5C71A 1LNSA 4BJ0A 3WNMA 2E33A 3VD9A 1UX7A 3DECA 3E1F1 4OZOA 3PUIA 5B4NA 3K77A 3LPGA 4MO3M 2VOTA 2Y8KA 3CMGA 2VZOA 2VZSA 3NNGA 2W92A 3C7HA 2EIDA 2X10A 4CU7A 4QDQA 2QQOA 1NKGA 3WNLA 5G05L 4W8JA 2BERA 1KGYA 3WNNA 3CIHA 3FHAA 4MGQA 4W4ZA 1UYZA 2J1UA 2OKXA 2V72A 2VCBA 2VO5A 3T09A 2VR4A 4QB1A 4ZXEA 1HN1A 1PMHX 5IFTA 1CIYA 4JHZA 2BBAA 2VMFA 4UAPA 3F2ZA 2Y64A 4XUPA 1IQDC 2Y6HA 3A23A 3A7QA 4MOAA 4CU6A 2VZVA 5HPOA 5HXMA 3HJRA 1UY3A 1JZ8A 2W3JA 3A22A 1UY4A 2E32A 4QDRA 3ACHA 5IYYA 2WAAA 1JZ7A 2QBXA 2DCKA 4A42A 2C4XA 2VL4A 2C9KA 2XONA 4ARXA 2E31A 3VDCA 3ECQA 1XC6A 1GOHA 3T08A 5JXIA 3ETPA 2VM9A 4ARYA 3C7FA 3LEGA 1R64A 4BK5A 4RYDA 2X05A 4MGSA 4UOJA 1ULPA 1W99A 2ZEYA 5EJ1B 5DPNA 2DDUA 3WEZA 1NUKA 1L7QA 2EICA 3K4ZA 4CU9A 3HOBA 4UI9L 3I3DA 1WKYA 3MUY1 1OF3A 4A41A 5JR2A 1SDDB 2ZEWA 5EJZB 1K12A 5JXGA 2VCCA 2W87A 1XNTA 3CKHA 2J1VA 3ACIA 3VD5A 3WQBA 3T2PA 4P00B 5JXJA 4XURA 1D7PM 3MV01 4QX2A 2WO1A 3D3AA 3CZJA 4GZ9A 2ZEXA 5CZKA 5B4XA 1UXZA 3T0AA 2QQLA 4CU8A 4LQRA 2ZEZA 3HN3A 5C70A 1OT5A 4A45A 4A44A 4PF1A 4QB6A 1K3IA 1UWWA 1DP0A 3DYMA 4QX0A 1UY2A 1SG3A 1GQPA 1JYXA 2VCAA 3J7HA 1UY1A 2WN2A 2XOMA 2HLEA 2RV9A 2JDAA 3VD4A 1KEXA 1P8JA 4M4RA 2WO3A 4DEVA 5IHRA 5I0DA 4KMQA 4GWJA 2VMDA 2Z4FA 3WF4A 3OB8A 3WSOA 5DQ0A 2VZ1A 4YPJA 2WAOA 2QQMA 1UMHA 1EUUA 2WZEA 1UY0A 2J1RA 3OEBA 4BDVB 2VZUA 4CUBA 2ORZA 2VZPA 3CQOA 1GMMA 1OH4A 3OGRA 3VDAA 3WF2A 4XUTA 3K75B 2VQTA 3CDZB 2QQNA 2WUHA 3T2QA 4AAXA 1CZTA 2QQIA 1YQ2A 1JZ5A 4JX0A 4E8CA 3I2GA 1J83A 4QDSA 3SKJE 4OMDA 3WF0A 4M4PA 4TTGA 3HEIA 3IAPA 4L0PA 4DUXA 1H6XA 1W9WA 2CDOA 2JKXA 4P02B 1JYVA 1W9TA 1US2A 3T0BA 3A21A 2V4VA 1DYOA 1UYXA 5C7GA 2VJXA 3C7OA 1JI6A 4PQQA 2WABA 2EIBA 1CZVA 3LQCA 4OUEA 1OD3A 4LKSA 2PQSA 1GU3A 3MBWA 4QX1A 2W9XA 2WO2A 4RN5A 3HNMA 1JZ6A 1K45A 3THCA 3THDA 1F4AA 1JYWA 2ID4A 3ACFA 3WF3A 3WNPA 1I5PA 3OGVA 4GWIA 2C26A 4A3ZA 4TXWA 2B9VA 2RVAA 3VDBA 5JXHA 2R7EB 1PX4A 2WYSA 2XHNA 2Y6KA 3NQHA 4ZZ5A 3I2IA 2J1EA 2J22A 2VZ3A 3I3BA 3T2OA 1O8SA 2J1TA 3OGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SHW B;  2VZT A;  2VZR A;  4DUW A;  1O8P A;  2W5F A;  1MPX A;  3W5M A;  4OMC A;  3BN6 A;  3WNK A;  3BGA A;  3PUH A;  3JXS A;  4XZU G;  3CZU A;  3VD3 A;  3UNP A;  3I2H A;  2W46 A;  1OF4 A;  4ZY9 A;  2BGP A;  1GOF A;  4JKK A;  4E8D A;  4AG4 A;  2YFZ A;  2VC9 A;  3WF1 A;  2QQK A;  2VQU A;  1DLC A;  1F4H A;  3FL7 A;  3NJX A;  4QPW A;  3MUZ 1;  1JZ2 A;  4XUO A;  4QX3 A;  4CUA A;  3IAQ A;  3K46 A;  1T2X A;  1UYY A;  1O59 A;  4JKM A;  2CDP A;  1J84 A;  2YFU A;  2XQX A;  3LEI A;  5EIY B;  2WDB A;  4KI5 M;  3VD7 A;  3ABZ A;  1US3 A;  2WN3 A;  1CX1 A;  4DUV A;  5LA0 A;  2W1Q A;  3P6B A;  2W94 A;  2Y6L A;  5LCW L;  2YC4 A;  4IUG A;  3C8X A;  1NAE A;  3OBA A;  1JU3 A;  2J1S A;  3GGL A;  2W1W A;  3LE0 A;  4DEQ A;  4MAD A;  4DXS A;  2JD9 A;  1UXX X;  2LS6 A;  4PT6 A;  3SEE A;  1NX9 A;  1PX3 A;  3NRU A;  2LW8 A;  2WZ8 A;  5G04 L;  2B4K A;  5IFP A;  3DYP A;  1W9S A;  4QB2 A;  4BXS V;  3I97 A;  4DXR A;  1JZ3 A;  3OG2 A;  3UET A;  1TG7 A;  4QAW A;  2KD7 A;  3C7G A;  2W91 A;  4HG6 B;  2BZD A;  1ULO A;  1W8N A;  5LA2 A;  4OYU A;  2BGO A;  2ZXQ A;  4LHS A;  4JKL A;  2DCJ A;  2YG0 A;  4D0Q A;  3EB7 A;  5F7U A;  3SEP A;  4Z2A A;  2VMC A;  3K4D A;  5J1X A;  3FN9 A;  1XNA A;  1UZ0 A;  3LPF A;  4ET7 A;  5DMY A;  3IDA A;  1JZ4 A;  2ORX A;  1RYY A;  5FUI A;  3UES A;  3FHQ A;  1PMJ X;  5IJR A;  3SKV A;  1JYN A;  2HYX A;  1GOG A;  1UMI A;  2J7M A;  3III A;  2VME A;  2VZQ A;  1GUI A;  2RJ2 A;  4A4A A;  1XPW A;  1W0N A;  5LA1 A;  4P5Y A;  2W1S A;  5A1A A;  4CVU A;  4XVH A;  3EYP A;  4KWU A;  2W95 A;  1W8O A;  2E26 A;  5JUV A;  4A6O A;  3GXU A;  3U37 A;  1JHJ A;  3IB3 A;  1JU4 A;  3GDB A;  2Y6G A;  3MV1 1;  2VTF A;  2W47 A;  3WNO A;  4ZZ8 A;  1L7R A;  2EIE A;  2W1U A;  2WBK A;  3C7E A;  3I2J A;  1BHG A;  3NJV A;  3HNB M;  4FI9 A;  4W50 A;  3ACG A;  1K42 A;  3I2F A;  3LEK A;  1TVG A;  3K4A A;  4DXT A;  4LPL A;  5JMO A;  5DN2 A;  1H6Y A;  1CZS A;  5CYY A;  3HPN A;  3ZM8 A;  2L9L A;  3DYO A;  2J1A A;  2X09 A;  1GNY A;  3W5N A;  3OEA A;  4XUQ A;  1WCQ A;  2JE8 A;  4P08 A;  1EUT A;  2QQJ A;  3GM8 A;  4D8M A;  2YB7 A;  3AC0 A;  3P1I A;  3HNY M;  4CUC A;  2V5D A;  4XUN A;  2WQ8 A;  4BK4 A;  2YC2 A;  3I3E A;  2Y6J A;  3I2K A;  3MO4 A;  3T0D A;  5C71 A;  1LNS A;  4BJ0 A;  3WNM A;  2E33 A;  3VD9 A;  1UX7 A;  3DEC A;  3E1F 1;  4OZO A;  3PUI A;  5B4N A;  3K77 A;  3LPG A;  4MO3 M;  2VOT A;  2Y8K A;  3CMG A;  2VZO A;  2VZS A;  3NNG A;  2W92 A;  3C7H A;  2EID A;  2X10 A;  4CU7 A;  4QDQ A;  2QQO A;  1NKG A;  3WNL A;  5G05 L;  4W8J A;  2BER A;  1KGY A;  3WNN A;  3CIH A;  3FHA A;  4MGQ A;  4W4Z A;  1UYZ A;  2J1U A;  2OKX A;  2V72 A;  2VCB A;  2VO5 A;  3T09 A;  2VR4 A;  4QB1 A;  4ZXE A;  1HN1 A;  1PMH X;  5IFT A;  1CIY A;  4JHZ A;  2BBA A;  2VMF A;  4UAP A;  3F2Z A;  2Y64 A;  4XUP A;  1IQD C;  2Y6H A;  3A23 A;  3A7Q A;  4MOA A;  4CU6 A;  2VZV A;  5HPO A;  5HXM A;  3HJR A;  1UY3 A;  1JZ8 A;  2W3J A;  3A22 A;  1UY4 A;  2E32 A;  4QDR A;  3ACH A;  5IYY A;  2WAA A;  1JZ7 A;  2QBX A;  2DCK A;  4A42 A;  2C4X A;  2VL4 A;  2C9K A;  2XON A;  4ARX A;  2E31 A;  3VDC A;  3ECQ A;  1XC6 A;  1GOH A;  3T08 A;  5JXI A;  3ETP A;  2VM9 A;  4ARY A;  3C7F A;  3LEG A;  1R64 A;  4BK5 A;  4RYD A;  2X05 A;  4MGS A;  4UOJ A;  1ULP A;  1W99 A;  2ZEY A;  5EJ1 B;  5DPN A;  2DDU A;  3WEZ A;  1NUK A;  1L7Q A;  2EIC A;  3K4Z A;  4CU9 A;  3HOB A;  4UI9 L;  3I3D A;  1WKY A;  3MUY 1;  1OF3 A;  4A41 A;  5JR2 A;  1SDD B;  2ZEW A;  5EJZ B;  1K12 A;  5JXG A;  2VCC A;  2W87 A;  1XNT A;  3CKH A;  2J1V A;  3ACI A;  3VD5 A;  3WQB A;  3T2P A;  4P00 B;  5JXJ A;  4XUR A;  1D7P M;  3MV0 1;  4QX2 A;  2WO1 A;  3D3A A;  3CZJ A;  4GZ9 A;  2ZEX A;  5CZK A;  5B4X A;  1UXZ A;  3T0A A;  2QQL A;  4CU8 A;  4LQR A;  2ZEZ A;  3HN3 A;  5C70 A;  1OT5 A;  4A45 A;  4A44 A;  4PF1 A;  4QB6 A;  1K3I A;  1UWW A;  1DP0 A;  3DYM A;  4QX0 A;  1UY2 A;  1SG3 A;  1GQP A;  1JYX A;  2VCA A;  3J7H A;  1UY1 A;  2WN2 A;  2XOM A;  2HLE A;  2RV9 A;  2JDA A;  3VD4 A;  1KEX A;  1P8J A;  4M4R A;  2WO3 A;  4DEV A;  5IHR A;  5I0D A;  4KMQ A;  4GWJ A;  2VMD A;  2Z4F A;  3WF4 A;  3OB8 A;  3WSO A;  5DQ0 A;  2VZ1 A;  4YPJ A;  2WAO A;  2QQM A;  1UMH A;  1EUU A;  2WZE A;  1UY0 A;  2J1R A;  3OEB A;  4BDV B;  2VZU A;  4CUB A;  2ORZ A;  2VZP A;  3CQO A;  1GMM A;  1OH4 A;  3OGR A;  3VDA A;  3WF2 A;  4XUT A;  3K75 B;  2VQT A;  3CDZ B;  2QQN A;  2WUH A;  3T2Q A;  4AAX A;  1CZT A;  2QQI A;  1YQ2 A;  1JZ5 A;  4JX0 A;  4E8C A;  3I2G A;  1J83 A;  4QDS A;  3SKJ E;  4OMD A;  3WF0 A;  4M4P A;  4TTG A;  3HEI A;  3IAP A;  4L0P A;  4DUX A;  1H6X A;  1W9W A;  2CDO A;  2JKX A;  4P02 B;  1JYV A;  1W9T A;  1US2 A;  3T0B A;  3A21 A;  2V4V A;  1DYO A;  1UYX A;  5C7G A;  2VJX A;  3C7O A;  1JI6 A;  4PQQ A;  2WAB A;  2EIB A;  1CZV A;  3LQC A;  4OUE A;  1OD3 A;  4LKS A;  2PQS A;  1GU3 A;  3MBW A;  4QX1 A;  2W9X A;  2WO2 A;  4RN5 A;  3HNM A;  1JZ6 A;  1K45 A;  3THC A;  3THD A;  1F4A A;  1JYW A;  2ID4 A;  3ACF A;  3WF3 A;  3WNP A;  1I5P A;  3OGV A;  4GWI A;  2C26 A;  4A3Z A;  4TXW A;  2B9V A;  2RVA A;  3VDB A;  5JXH A;  2R7E B;  1PX4 A;  2WYS A;  2XHN A;  2Y6K A;  3NQH A;  4ZZ5 A;  3I2I A;  2J1E A;  2J22 A;  2VZ3 A;  3I3B A;  3T2O A;  1O8S A;  2J1T A;  3OGS A; 
#chains in the Genus database with same CATH topology
 2VZT A;  4EWD A;  2OQ7 A;  1RUG 1;  3E5Q A;  3BYW A;  3WCS A;  1JW6 A;  1YJK A;  3W5M A;  2PHR A;  4RA0 A;  5GZE A;  4R9A A;  2ZGR A;  1X82 A;  3KCX A;  4YW3 A;  3M3E A;  5FZL A;  4OVE A;  3VD3 A;  1RIT A;  3UNP A;  4OI4 A;  3I2H A;  4KH9 A;  4ZY9 A;  4N53 C;  4DIQ A;  4MG2 A;  1OI6 A;  1NY7 2;  2BGP A;  3CJI B;  4LKF A;  1YJL A;  4L11 A;  3T1L A;  5FXX A;  4Y3O A;  4G3Y C;  1X8M A;  5FZE A;  1W9F A;  4YW4 A;  5BNN B;  4Q4V 3;  2QQK A;  3ZMN A;  2VQU A;  5LK5 A;  1D4M 1;  2JDM A;  4XYX A;  2LTN A;  3O0W A;  4GJZ A;  4Q4V 1;  4Y4R A;  1BEV 2;  3NJX A;  5D8A A;  1F2N A;  1BXH A;  1AR7 3;  4XBL A;  4QX3 A;  4CUA A;  2FDG A;  2I07 B;  2YYO A;  1NCR B;  2A6W A;  3AP6 A;  1AR7 1;  4JKM A;  4L9B A;  4EZ4 A;  1J84 A;  4YVW C;  1A8D A;  2YFU A;  3LEI A;  4XJW A;  1CGP A;  2XJR A;  4JCK A;  3SCG A;  3PVB B;  1UW8 A;  4Q0S A;  1AF9 A;  2Y6F A;  5BXX A;  3ABZ A;  1NCQ A;  3PVO A;  4UW6 A;  4CYD A;  4UF0 A;  4ZKT B;  3UGG A;  5I91 A;  4YAR A;  1QEX A;  1W2O A;  5LA0 A;  2W1Q A;  4YW6 A;  1T6B X;  1VIW B;  2W94 A;  5LCW L;  4YW7 A;  4B4P A;  2YC4 A;  1LGB A;  3ZPO A;  4MV2 A;  3POE A;  4IUG A;  1HV1 A;  1U5Z A;  1VJ2 A;  5L36 A;  1C4R A;  2J1S A;  3LZZ A;  3NKG A;  4Q0Q A;  1W6M A;  2IVI B;  3D5O A;  3EQE A;  4P9X A;  4DEQ A;  5HBA A;  3HD8 B;  4PT6 A;  1MS8 A;  1NX9 A;  1PX3 A;  3NRU A;  3OBZ A;  4COW A;  1HIX A;  1NLS A;  3KT4 A;  3AMN A;  3POB A;  1GQG A;  4XDQ A;  4XDO A;  3CJI C;  3PIJ A;  3EXU A;  4LIV A;  4IER A;  4PLO A;  4LHL A;  1VAL A;  4EV0 A;  3ZYF A;  1ALY A;  1CAU A;  1S0I A;  2EA7 A;  3I8T A;  1DF0 A;  3BTY A;  4NID A;  2R1B A;  4AFC A;  2CWS A;  4YVS C;  5F5Q A;  1DDL A;  1ULC A;  2ZTN A;  3G6J B;  1TG7 A;  4QAW A;  1F9K A;  5E16 A;  5LW9 A;  4ZU4 A;  4MXV A;  2C0Z A;  2JDH A;  2A6V A;  3C7G A;  5J3U A;  2VD7 A;  4HG6 B;  2XKP A;  1PO1 2;  1ULO A;  3A0N A;  5T5O A;  4CCO A;  1DGW X;  5CFD A;  5FTT C;  5ABJ B;  1QH7 A;  1QJY 2;  2VMG A;  3LF7 A;  2BGO A;  5T54 A;  5FLJ A;  4CDQ B;  3ZFF C;  2JG8 A;  1O3T A;  2DCJ A;  2X53 S;  3VL9 A;  2E7T A;  3THP A;  3EB7 A;  2VMC A;  2JE9 A;  2Q8D A;  4S2G A;  4I2O A;  1V6M A;  3FN9 A;  1UZ0 A;  4XMI A;  1NZI A;  1JUH A;  2ZHM A;  3M7A A;  4NPL A;  2G1M A;  4I0B A;  5ERL A;  2DV9 A;  4XW3 A;  3IPV B;  1D4V B;  1V6N A;  5DUV A;  5FZD A;  3L2Y A;  5A33 B;  3FHQ A;  1Y43 B;  1XSQ A;  2WA4 A;  5JZG A;  1GWK A;  1ZZB A;  3W20 A;  5K0U C;  1W3X A;  1GOG A;  1D2Q A;  1POV 0;  2HWE 3;  2WWS A;  2VME A;  1O4T A;  1O5L A;  2VZQ A;  1H8T A;  2HWE 1;  3JBG 3;  3ZSM A;  1XPW A;  3E5X A;  2EXI A;  1O3S A;  1CAW A;  3JBG 1;  1MS3 A;  1A6C A;  3EYP A;  3M8L A;  4KWU A;  2W95 A;  2XBO 3;  4OHX A;  3MF6 A;  4QXB A;  4ES8 A;  1ULD A;  3ZYH A;  1S0C A;  2XBO 1;  1JTZ X;  1LOE A;  3U37 A;  4F7Z A;  1EV1 2;  5ABJ C;  1A8M A;  5T55 A;  4L8Q A;  1BMV 1;  3IWZ A;  4GJY A;  3H42 B;  4CDQ C;  3GDB A;  5A32 B;  5FO7 B;  2Y6G A;  3AMM A;  2VTF A;  1XJA A;  5HXV A;  4YWA A;  5BNO A;  4NO4 A;  1W6P A;  3BU0 A;  4AF9 A;  1PVC 2;  2DBN A;  3POY A;  5GLW A;  4D69 A;  3C7E A;  1WCU A;  2R0F A;  2ZHN A;  3HNB M;  2WNV B;  3ACG A;  4FI9 A;  4CDU B;  5A6Z A;  3I2F A;  5A80 A;  3ZXG A;  5L19 A;  2CL2 A;  3VBH A;  1F5F A;  2WT0 A;  2G19 A;  4TLF A;  5HI0 A;  4A7K A;  3FX3 A;  2OUH A;  2ES3 A;  4LPL A;  5FXW A;  5GLT A;  5JMO A;  5DN2 A;  3B94 A;  5FP8 A;  5CYY A;  2BU9 A;  3HPN A;  3PTR B;  2L9L A;  3Q8C A;  3DYO A;  2ZHL A;  1RUO A;  3B9C A;  2GP5 A;  4Z82 A;  3U11 A;  4AGG A;  2GC3 A;  4JHT A;  4TLG A;  4A3X A;  1GP5 A;  3S57 A;  1HB1 A;  2MEV 3;  3JU9 A;  4O65 A;  2Y38 A;  4DXZ A;  1EUT A;  1OH3 A;  2MEV 1;  3LGR A;  4WVM B;  3SHR A;  1V6K A;  1Y3T A;  3VHO A;  3OUH A;  2V5D A;  2K2S A;  3RZK A;  3QBQ A;  3S6P A;  3OD4 A;  4BK4 A;  2YC2 A;  3I3E A;  4U2A A;  3VGI A;  2D40 A;  1RUF 2;  1GP6 A;  2RE9 A;  2WLP A;  5C71 A;  3T0D A;  2FDH A;  3GZT B;  1DQ4 A;  4I02 A;  1RMU 2;  1WCS A;  1YO8 A;  2ZAA A;  3VD9 A;  4BHP A;  1TMF 2;  3S0M A;  4NMI A;  1HV0 A;  2JB4 A;  3PU8 A;  4HOO A;  4KBB A;  2WNV C;  1GNZ A;  2GSY A;  3ILF A;  4CDU C;  3K77 A;  3SQO A;  3LSD A;  2DWR A;  1DQ2 A;  1DU3 D;  4CDW B;  3V65 A;  4OUS A;  2C9A A;  5DAP A;  2W92 A;  4KL1 A;  3C7H A;  3HQX A;  3URF A;  4ATF A;  3X29 B;  3KGZ A;  2YXS A;  2GP3 A;  4Q4X 2;  2F6B A;  1RUJ 3;  1NKG A;  4MGT A;  2E7A A;  1RUJ 1;  4O7X A;  4IEU A;  5EV7 A;  4LLO A;  2XQR A;  3WOG A;  3FHA A;  3ZSE A;  4CCE A;  4IES A;  2XWB B;  2R6Q A;  5LK7 B;  4C0H A;  3KSC A;  3AYD A;  1VRH 3;  2VO5 A;  3T09 A;  4QB1 A;  4ZXE A;  3ZKY A;  4KWK A;  4BQY A;  3DXU A;  1QXJ A;  2RS5 3;  1HN1 A;  1VRH 1;  1CIY A;  1LHO A;  2DUQ A;  1OFN A;  2WFF 2;  1VBB 3;  2RS5 1;  3F2Z A;  1Q5O A;  4W6W A;  5A7W A;  1VBB 1;  4PF5 A;  4S2D A;  2X5I C;  2Y6H A;  3A7Q A;  4CU6 A;  2AH2 A;  1AJK A;  1C1L A;  1ZBE 3;  4S2F A;  4RGG A;  5ACA 2;  3PVE A;  5FPL A;  2YU1 A;  1E5S A;  4ZU7 A;  1ZBE 1;  4FPY A;  3HJR A;  1JZ8 A;  2HWF 2;  2W3J A;  3OTF A;  1I9R A;  2E32 A;  2WWU A;  4RD7 A;  4WZF A;  5EYX A;  3RMX A;  4QDR A;  4C1W A;  3AKS A;  2AEZ A;  2WNU A;  1KFU L;  3KCY A;  3TWI A;  4CDW C;  1W28 A;  1FAT A;  3ZXE A;  4OHY A;  1F35 A;  1JHN A;  5IYY A;  1AR9 2;  3FMG A;  2QBX A;  3KT1 A;  1Z7S 2;  3EJK A;  4L92 A;  5JDB A;  2C4X A;  2KXL A;  3WV6 A;  2VL4 A;  5A3O A;  1OSG A;  2Y0I A;  4JC1 A;  3VV1 A;  3BKZ A;  1FMD 3;  3OJB A;  1ND2 B;  2E31 A;  3LFM A;  3NVC A;  1FMD 1;  3TYJ A;  4MGI E;  3NST A;  1XC6 A;  4DPN A;  2XUM A;  4O61 A;  5CVR A;  4WM8 A;  1AJO A;  1X36 A;  1QQP 3;  4GKY A;  1SFN A;  1LKN A;  1XE7 A;  1QQP 1;  3KCC A;  3OPW A;  5FWJ A;  1WCK A;  1WLT A;  4RFT 0;  1O4Y A;  2BNN A;  1DQ0 A;  5FV3 A;  4NRM A;  4Q2F A;  2DDU A;  2WLQ A;  3GCX A;  2JWP A;  4CRQ A;  1L7Q A;  2P34 A;  3ES1 A;  1JUI A;  1W2U A;  4QMA A;  4CTE A;  2NYY A;  5FYV A;  3MID A;  2CSG A;  3AB0 A;  1DGL A;  1WKY A;  4Q29 A;  5FYB A;  2VUL A;  4KU8 A;  5FLI A;  2VNG A;  3ILR A;  5D8A B;  2PMW B;  1PVX A;  4AZZ A;  4Y20 A;  5JIU A;  5LBC A;  4WZC A;  2OUJ A;  1JOB A;  4GUL A;  3RSJ A;  2VAU A;  1QDO A;  2BP6 A;  1R09 2;  2VVD A;  3OGJ A;  1WBF A;  2RM2 2;  1N1S A;  3H1M A;  4DOU A;  4AGV A;  1SLT A;  5H9Q A;  5DDJ 3;  1JOP A;  1XE0 A;  3CKH A;  5FZF A;  3ZXL A;  4WBB A;  1NCQ B;  5DAQ A;  1ND2 C;  2WL1 A;  3JZV A;  3MEP A;  5DDJ 1;  3WP5 A;  3WQB A;  4DIN B;  5FXZ A;  1KJL A;  1BJQ A;  3P3N A;  4QX2 A;  2YRO A;  1BEV 3;  2WO1 A;  2H6B A;  3VZN A;  4BYY A;  3KV6 A;  4RR3 B;  5KBF A;  2JG9 A;  1AR6 3;  3SIT A;  1POQ A;  2D6N A;  1FI2 A;  1TEI A;  4QKD A;  4YZ3 A;  1AR6 1;  4Y1U A;  5C70 A;  2DUP A;  4QB6 A;  3KWV A;  4AVV A;  4XXP A;  2Y33 A;  1W06 A;  3AMQ A;  4QQO A;  2R0H A;  3VZK A;  5LRS A;  3JD7 1;  3K48 A;  4NHM A;  4EQV A;  1GQP A;  1D4M 2;  3RDI A;  1HRI 3;  1NXM A;  4OUM A;  3ZOI A;  1UY1 A;  4Q4V 2;  3O1O A;  3O1P A;  4E27 A;  5AFE A;  1CAU B;  1HRI 1;  2WN2 A;  4LHN A;  1DGW A;  3WDX A;  2FCT A;  3MLJ A;  2AEY A;  2HLE A;  5D8A C;  1G9B A;  1AR7 2;  2HWB 2;  5FJH A;  3WG2 A;  4CPB D;  3POS A;  1W8W A;  4AK3 A;  4ISR A;  2XUE A;  1KEX A;  1ULF A;  4MGZ E;  4DMI A;  4M4R A;  1ZNP A;  2VNO A;  1QXP A;  5A7Q A;  5A3L A;  2ZX2 A;  3Q8E A;  1TNR A;  4DEV A;  2WT2 A;  5BNN A;  5I0D A;  4UBH A;  3WP4 A;  4GWN A;  5FP3 A;  4AFD A;  5DZF A;  3KHB A;  3MDP A;  2UWA A;  2Y34 A;  4JAA A;  3E6B A;  1UIJ A;  2ZX0 A;  1NXD 1;  2WAO A;  4CE8 A;  1UMH A;  2VNR A;  1NCR A;  4HAN A;  2R07 2;  2JDK A;  2ATF A;  1AXZ A;  1DZT A;  2PAE A;  5T3N A;  1LR5 A;  1PO1 3;  4YGB A;  3USU A;  5J48 A;  1SLB A;  1UOF A;  3O0X A;  2VZU A;  1PO1 1;  2ORZ A;  2VGD A;  4BQ3 A;  1IS5 A;  4FOV A;  4N7I A;  2VH9 A;  2CYF A;  3PDQ A;  5HCB A;  3OGR A;  3H8U A;  3VDA A;  5JZG B;  1F31 A;  4XUT A;  4AI0 A;  1LAJ A;  1LUL A;  1WZX A;  2WUH A;  3FLR A;  3WG1 A;  4XJZ A;  3CO2 A;  1CZT A;  2Z5W A;  3O1V A;  2ZGT A;  1H8T B;  1UOJ A;  2VTX J;  2DVF A;  5TSW A;  2HWD 1;  1JZ5 A;  1FT9 A;  4LLF A;  1MS4 A;  1UL9 A;  4QQ2 A;  1CAW B;  3J7N A;  4D6R A;  2VE1 A;  3NV3 A;  2WA3 A;  3POF A;  1UIK A;  3OUI A;  4YGD A;  3SKJ E;  1HW5 A;  1JBC A;  4PCR A;  5A7P A;  2XXZ A;  4K3U A;  4E2S A;  1RVF 1;  4OI0 A;  2RS3 1;  5CFD C;  2VW0 A;  3HEI A;  4K1Y A;  3QCW A;  1N3P A;  4L0P A;  2WR9 A;  4B7K A;  4XC9 A;  1J1T A;  5BNP B;  3V0B A;  3ZYI B;  1YUD A;  2JG8 C;  4IE4 A;  5FY1 A;  1ODN A;  5BNO B;  1UZV A;  1W6P B;  5DAV A;  1US2 A;  3PME A;  1SQ4 A;  5IK4 A;  3T0B A;  2PEL A;  4QQH A;  4QX7 A;  2YDE A;  1ULG A;  5ANN A;  5C7G A;  3RGB A;  4AOC A;  4CZS A;  4GKX A;  5KC6 A;  5LAS A;  1JI6 A;  1WWY A;  2PHW A;  4PQQ A;  5I0U A;  3VBH B;  4LO8 A;  1VPH A;  1KS4 A;  4BB3 A;  2D3S A;  3DN7 A;  4AE2 A;  2D6K A;  4QX1 A;  2W52 A;  2DTW A;  4RN5 A;  1JYI A;  3BTA A;  5IT6 A;  3HNM A;  4CCD A;  3IIA A;  5C3P A;  3ZDS A;  5JZG C;  4TWT A;  4FPE A;  3VKL A;  1YIP A;  4QT6 A;  1JZ6 A;  1HQW A;  3NNL A;  4XBN A;  1DYP A;  1F4A A;  1OLR A;  1QU0 A;  2ID4 A;  4B7E A;  3N4M A;  4WVZ A;  3EO6 A;  3OGV A;  1H8T C;  2R06 3;  4NII A;  3AKQ A;  3BIE A;  2QQV A;  2D6O X;  3WW4 A;  4HVQ A;  1ZRD A;  2R06 1;  4B8E A;  1OVP A;  4IET A;  3IPV A;  4IND A;  2VU9 A;  5JXH A;  5F39 A;  2BTV C;  2XBO 2;  2IVJ A;  1BMV 2;  3T2T A;  2XHN A;  4HK8 A;  1G6N A;  2BQP A;  5IAX A;  4BZ4 A;  2ZA9 A;  3PHM A;  1G9F A;  2W39 A;  4HN0 A;  2NMN A;  3WUC A;  1YQC A;  2WII B;  5FO9 B;  5JPN B;  1OUX A;  2BDR A;  5BNO C;  4XBQ A;  2A1X A;  2HBU A;  1SHW B;  2VOW A;  2VZR A;  1CN1 A;  4DUW A;  1O8P A;  1GKB A;  2ZGK A;  1H2M A;  1MPX A;  2WZR 3;  5AVP A;  4CXY A;  5KHH A;  4E4S A;  3BN6 A;  2WZR 1;  2A3Y A;  2A73 B;  3PUH A;  3VBH C;  3ATG A;  5FFO C;  1BBT 3;  2D93 A;  1V70 A;  3OYW A;  4XZU G;  4ASK A;  4V2W A;  2W46 A;  1OF4 A;  1Y7B A;  1BBT 1;  3FFQ A;  4H7M A;  3UV9 A;  5F1R A;  3FJS A;  4JKK A;  1XYN A;  1XNB A;  4ITC A;  4K40 A;  4O9G A;  4EN9 B;  1TMF 3;  3I4I A;  2YFZ A;  4PLM A;  4DY5 A;  1GZT A;  4YNI A;  1BVV A;  1TMF 1;  2Q1F A;  4BWO A;  1IHM A;  1W2A X;  2HEY F;  2HKX A;  4K8F A;  4OQ9 A;  1QY4 A;  2BOI A;  3T4V A;  1DLC A;  1F4H A;  1H9W A;  5DZE A;  2MEV 2;  4QPW A;  4XUO A;  2OVU A;  4QHB A;  5FCC A;  4AFM A;  4BMB A;  2VBD A;  1WA6 X;  4F83 A;  1QOT A;  1RUI 3;  3FFZ A;  3HQR A;  3ZXJ A;  2AGS A;  4HXC A;  5JLV A;  5KHI A;  3K51 A;  1NLQ A;  1BCX A;  2P3J A;  1RUI 1;  3FC0 A;  5EPA A;  2XQX A;  5IW0 A;  2E6V A;  1LRH A;  1BVP 1;  3GHN A;  3VZO A;  4IEO A;  4Q4X 3;  1F5J A;  1QMJ A;  5DUW A;  3UGF A;  2WT1 A;  5A7W B;  3UK9 A;  3VZM A;  4MHR A;  4IGQ A;  4Q4X 1;  2XML A;  1UU5 A;  1Y9Q A;  4D3W A;  5FWE A;  1UQX A;  1V6J A;  1FNY A;  3P6B A;  4XFA A;  2PQQ A;  1WGP A;  3VHN A;  3OBA A;  3TBD A;  5T5P A;  3TNQ A;  3D82 A;  4QKF A;  3S7I A;  1HLC A;  3LE0 A;  4UWD A;  4MAD A;  4BIS A;  3RZL A;  1H2L A;  2LS6 A;  1UXX X;  5J98 B;  2WNU B;  1ND3 B;  1XNK A;  2DU1 A;  1VMJ A;  2B4K A;  5E1R A;  5IFP A;  4M3C E;  2B7Y A;  1RIR A;  2UWC A;  1RUJ 2;  1OUR A;  1MAC A;  4UW4 A;  4MLO A;  1W2T A;  1CJP A;  2OA2 A;  4QB2 A;  1GIC A;  3M3C A;  3BPZ A;  2LUW A;  2XKO A;  4MVT A;  1YEW A;  2DF7 A;  4M3C F;  4P14 A;  3WDV A;  4BXS V;  2V09 A;  3I97 A;  1FX5 A;  4HKO A;  1GQH A;  1GBG A;  2X29 A;  3GF6 A;  3UET A;  3D4K A;  3LWC A;  4WM8 B;  1VRH 2;  1W05 A;  1YC6 1;  2KD7 A;  4YW5 A;  5FKB A;  1YXW A;  2W91 A;  2VG9 A;  2XJS A;  2Z2S B;  4FOY A;  4U36 A;  2BZD A;  1AR9 3;  2RS5 2;  3BPS A;  1OA2 A;  3UGH A;  4BLJ A;  1EAH 1;  1VBB 2;  2RR1 3;  5F5A A;  5FYI A;  1AR9 1;  5L7O A;  5C8C B;  4DQA A;  2RR1 1;  5IVY A;  2O0O A;  4D0Q A;  4Z2A A;  5LBF A;  4URT A;  1W8T A;  2BFU L;  5I8S A;  1CON A;  3P5B A;  3GBW A;  2NPI A;  4YZ2 A;  4Q0V A;  1KRI A;  1XNA A;  4RQP B;  4XFG A;  4YG3 A;  4LXL A;  3N9L A;  4ET7 A;  5DMY A;  2VOV A;  4AWD A;  1IG0 A;  1ZYB A;  3KF3 A;  1CAV B;  4FPJ A;  3TB0 A;  1OC1 A;  3B3Q E;  2WNU C;  5K8S A;  2G9G A;  4Y20 B;  3UES A;  4FSJ A;  1PMJ X;  2EF6 A;  1PM7 A;  1EP0 A;  4M01 A;  3SKV A;  1JYN A;  1R1Z A;  4FXG B;  4DB5 A;  2HYX A;  3RFR A;  1UMZ A;  2E7Q A;  1QJX 2;  4YFZ A;  1UMI A;  2J7M A;  1W8Z A;  1FMD 2;  3IT8 A;  4A4A A;  1HQN A;  2AUY A;  5FYY A;  5AFB A;  5FZK A;  4BM8 A;  5J37 A;  3D0J A;  2XVL A;  5EP9 A;  4CVU A;  5EYY A;  3RZJ A;  2A70 A;  4LO6 B;  2JG9 B;  3ON7 A;  4WM8 C;  4DO0 A;  1XU2 A;  3L2H A;  2IFR A;  2PHL A;  4ZS3 A;  1QQP 2;  1VLN A;  3LB9 A;  1JHJ A;  1R09 3;  5F6K A;  1QIQ A;  4LHK A;  5C6C A;  2RM2 3;  2RJL A;  4I0A A;  3RG0 A;  1MVE A;  1WMD A;  1JU4 A;  2E9Q A;  1R09 1;  1U12 A;  3MV1 1;  3U07 A;  2RM2 1;  4IE5 A;  2XVG A;  5A7N A;  2BUK A;  3ZR6 A;  1L7R A;  4AED A;  2EIE A;  1W6O A;  4UFL A;  2D3P A;  4XZP A;  2FD8 A;  2VNV A;  2WBK A;  3I2J A;  3MIE A;  3MW2 A;  3PU3 A;  1K42 A;  4BH9 A;  4JDO A;  4XAB A;  4GB3 3;  4KNC A;  1AXY A;  3J9S A;  3WY6 A;  4Z2W A;  5FXV A;  2QFE A;  1SFY A;  4GB3 1;  3VHP A;  1TVG A;  2ZPX A;  4IGO A;  2BGC A;  3B00 A;  5FZO B;  1JMU B;  5DAB A;  4DXT A;  3BUC A;  3UYJ A;  1HN0 A;  4XFH A;  4ES9 A;  1SBE A;  1ZZ8 A;  4EZH A;  4XF4 A;  1URX A;  4GMP 3;  3ZM8 A;  5DDJ 2;  1BQP A;  1LU2 A;  2PAM A;  1PO2 2;  2VUJ A;  1D4M 3;  1WME A;  3MFA A;  4QKB A;  1QKQ A;  4GMP 1;  3WVJ A;  3O7O A;  1UZY A;  2QZ3 A;  4LUK A;  3N9M A;  2VOX A;  2FDK A;  1H8V A;  5FYZ A;  3TRS B;  5F8P A;  3OEA A;  1RUH 1;  3ZLI A;  1WCQ A;  2CGN A;  4P08 A;  2C24 A;  5CG9 A;  3H3U A;  1YFW A;  2YV8 A;  3GM8 A;  2ZAB A;  5GLV A;  2HWB 3;  4FAH A;  2JG9 C;  1AR6 2;  1QOS A;  4NIH A;  1V00 A;  2HWB 1;  2VVF A;  4XUN A;  2XJU A;  4F8A A;  3USU B;  2IWG B;  1RHI 3;  4Z1V A;  5LWB A;  1J3Q A;  4QHZ A;  4CXW A;  2XVK A;  3GZU C;  3JD7 2;  3I3Q A;  2BBV A;  2ZCW A;  1N3O A;  4LE3 A;  1RHI 1;  3PUR A;  2Q8O A;  5M0T A;  5JSR A;  2E33 A;  4M3C B;  4Q4Y 3;  3DEC A;  3ELN A;  3HN1 A;  1JXN A;  3NJZ A;  4S2H A;  1HRI 2;  4RR3 A;  4Q4Y 1;  2ZX4 A;  1AL0 G;  2LM3 A;  3ES4 A;  4Y1Y A;  5CB7 A;  4OQ8 A;  1H2N A;  4UW3 A;  4UFI A;  3KVA A;  3FUQ A;  3MIG A;  4R4X A;  1PNF A;  3LPG A;  4P9G A;  2D5H A;  2R07 3;  4NN0 A;  4LBQ A;  3BTZ A;  5JOZ A;  2R07 1;  1WD3 A;  1LU1 A;  4LO5 B;  4R4Z A;  2JJ6 A;  3WG3 A;  1J3P A;  2EID A;  1MQT A;  2DVD A;  1XQN A;  2A3X A;  1DHK B;  1LHV A;  4XIO A;  4N9H A;  2VEC A;  3WNL A;  2YZ4 A;  3V0B B;  2B45 X;  1Q56 A;  1KGY A;  2DCT A;  4W8J A;  3WNN A;  3MF9 A;  5BNN C;  4CUB A;  2OQ6 A;  4MGQ A;  4PLN A;  3GBF A;  4W4Z A;  4YGC A;  3ZIW A;  4XJ9 A;  3WZ1 A;  2CHH A;  4Y5T A;  1C5I A;  1PIV 1;  5L9R A;  4XFF A;  4XOG A;  2DUR A;  2OKX A;  1UPS A;  4NAO A;  1HB2 A;  3IDE A;  4AI2 A;  4C8D A;  5F3C A;  3AZW A;  3RS6 A;  1NCR C;  2WYF A;  1QJU 1;  5FBZ A;  4CUG A;  1PMH X;  5FQ0 A;  1S0J A;  2AAC A;  4JHZ A;  4C0B A;  2BBA A;  1H1M A;  2VMF A;  3AVR A;  3OD0 A;  3IDB B;  4WM7 A;  5A3M A;  2Y64 A;  1RED A;  1XE8 A;  1N1Y A;  2XLA A;  4MOA A;  4NVP A;  4DNY A;  4TYS A;  3W59 A;  1X50 A;  3WP3 A;  1ZX5 A;  2DU0 A;  2PA7 A;  2UY9 A;  4IV3 A;  2HWD 2;  4AI1 A;  1NA1 B;  2OX0 A;  2ZZJ A;  5HXM A;  4D7S A;  4H3W A;  1VAV A;  2QJV A;  4AEM A;  1LES A;  3AXE A;  1GLH A;  3ZR5 A;  3KS7 A;  3ACL A;  3DF0 A;  3RI8 A;  1IS6 A;  5AC9 2;  2IXC A;  3ACH A;  4N8M A;  4R9B A;  5FYC A;  5A3U A;  1RVF 2;  2RS3 2;  1JZ7 A;  3AYE A;  4QM8 A;  2GMM A;  4LO4 B;  2A6Z A;  2RDS A;  3ZX7 A;  4A42 A;  2IXI A;  3WDY A;  3AM2 A;  3R4D B;  3WCR A;  3MFC A;  2XON A;  1QJE A;  2CWM A;  4XTP A;  4AEJ A;  1H4G A;  4UFK A;  4GQ7 A;  2C6S A;  1RXG A;  1Q8P A;  1BK0 A;  5FY8 A;  2LRP A;  3VDC A;  3EMR A;  1NLR A;  4UFJ A;  5LB6 A;  5J96 B;  1Q8Q A;  4R9D A;  4WV8 A;  4Z07 A;  4ARY A;  3LEG A;  1G8W A;  2CGO A;  4BK5 A;  5JVV A;  5C9A A;  4XJU A;  1XRU A;  5BNP A;  3VBO B;  1ULP A;  1OQE A;  3OYW B;  1GYK A;  3HT1 A;  5FOJ B;  3TEY A;  1IGO A;  5JOY A;  4GD4 A;  4H55 A;  1NUK A;  1RXF A;  3HOB A;  3MLL A;  3CBN A;  4W65 A;  1VE0 A;  4DFS A;  1S4C A;  2R06 2;  5JR2 A;  3I59 A;  1SDD B;  1TQ5 A;  5GZF A;  4UBG A;  1H0B A;  4GWM A;  4XJA A;  4AGR A;  2P3I A;  5FY7 A;  4P9L A;  1BLZ A;  3RYK A;  3O1R A;  1KD7 A;  4FPO B;  2OII A;  2P17 A;  2PHD A;  3O14 A;  3U14 A;  5GM0 A;  1D0G A;  1OHF A;  4YYO A;  4LR4 A;  4XUR A;  3MV0 1;  3OOX A;  3ZYG A;  2KA3 A;  2NQY A;  3D3A A;  3CZJ A;  2QQU A;  2VCM A;  2FQP A;  2WZR 2;  3T0A A;  4CU8 A;  4AI3 A;  2ADD A;  3HN3 A;  4JQT A;  3VBR A;  3DPR A;  4A44 A;  1BBT 2;  3WR0 A;  3ZFG B;  3BCW A;  1W8U A;  4PDW A;  4MGY E;  2VTX A;  1S55 A;  2IC1 A;  3NW4 A;  5GZD A;  1GFF 2;  4Q0U A;  3WLU A;  3LCP A;  2BW8 A;  3IMM A;  2VCA A;  5I93 A;  1PGL 1;  1CQ9 A;  2AYH A;  3BI3 A;  1LHU A;  1CAX A;  1RGS A;  2Z79 A;  2PXJ A;  2EAA A;  3Q8A A;  3TEW A;  2RV9 A;  4LBM A;  2JDA A;  2A5Z A;  3GAL A;  4CCM A;  5A6Y A;  2VMH A;  3B93 A;  2DFB A;  1RUI 2;  4RSU A;  3NJY A;  1D2S A;  4LUM A;  2BVV A;  3LA7 A;  3I49 A;  3U4S A;  2H0V A;  4O9E A;  3SMH A;  4CP1 A;  2JEN A;  1NT0 A;  5L7O B;  2XJV A;  2NLR A;  3KVB A;  2YMZ A;  3U4X A;  5LAT A;  1LOG A;  1YWK A;  4KMQ A;  2JB8 A;  3LOI A;  5LBB A;  3D0S A;  2Z4F A;  4LOT A;  2QDN A;  5HCA A;  2HWC 2;  1N1T A;  1VBC 1;  1VRB A;  3LD8 A;  5KHJ A;  1FOD 3;  1ENX A;  1S1A A;  1COV 1;  2RHP A;  2WZE A;  4Y24 A;  1FOD 1;  1G7Y A;  1ENR A;  5C9A C;  2A75 A;  5BYN A;  1R08 3;  3H9A A;  4BDV B;  4HKL A;  4R52 A;  3WQ1 A;  1FXZ A;  5IVV A;  1R08 1;  2BPA 2;  5I0S A;  3W9A A;  1LEM A;  3NNJ A;  2BWA A;  3WF2 A;  1Y9M A;  4J6G A;  3K75 B;  1H2K A;  1XND A;  3MHZ A;  1C57 A;  1G86 A;  2QQN A;  1AVB A;  4AAX A;  1FNZ A;  5E88 A;  5KXD A;  3BU7 A;  1KXG A;  3MLK A;  1YQ2 A;  3MGU A;  3T1M A;  4XHB A;  4XQ4 A;  3ETQ A;  1K5M A;  3ZN6 B;  1MVQ A;  3DCQ A;  3I2G A;  5FZI A;  1ND3 A;  1EAH 2;  2ARX A;  1I6X A;  2WO7 A;  1ZZ6 A;  3NV2 A;  1DQ5 A;  3HMY A;  2GDF A;  3WF0 A;  2ZX3 A;  4M4P A;  4CCL A;  5JAX A;  1Q43 A;  4UW5 A;  5FZ7 A;  1MS1 A;  1SLA A;  2RR1 2;  1M4W A;  2BWC A;  1QJX 3;  5L7O C;  3NL1 A;  2BRT A;  4FTE A;  1UD1 A;  1GWL A;  1QJX 1;  2JKX A;  4P02 B;  2ET7 A;  2BVB A;  4JDN A;  4Y22 A;  4AED B;  4LO7 A;  1W9T A;  3VKM A;  1WLC A;  1W6O B;  3NV4 A;  4FPC A;  3A21 A;  1PNG A;  2WQ4 A;  1O6U A;  1UYX A;  1UPI A;  4B4R A;  2V5Y A;  3H8X A;  4D94 A;  4D7T A;  3UJO A;  5A3T A;  1C8N A;  5FYH A;  1LGN A;  5ANQ A;  4LT5 A;  4XF0 A;  1V6O A;  3QH6 A;  2C5D A;  2WS9 3;  3E97 A;  4M0H A;  5C8C A;  5I8T A;  1C3H A;  2YUE A;  2ZKN A;  3MBW A;  1NZC A;  1W8H A;  1YLL A;  2WS9 1;  5IK7 A;  1OOP A;  1S0E A;  5GLU A;  3THC A;  2D6M A;  1AYN 3;  5FY0 A;  1V9U 3;  3THD A;  2Q30 A;  4AQ2 A;  1AYN 1;  4RQP A;  1V9U 1;  3BTX A;  5C33 A;  4GWI A;  2C26 A;  5CKQ A;  1W0O A;  2ZAC A;  3AFG A;  4AI9 A;  4N43 A;  5A7O A;  3H7Y A;  2B9V A;  1CAV A;  1ZRR A;  5JWP A;  2ARC A;  3RZH A;  3V0A A;  1LJ7 A;  2A7A A;  2XGX A;  3AP5 A;  3NNM A;  2YY1 A;  2WYS A;  3LSE A;  1WCD J;  3LA2 A;  1CWP A;  2J22 A;  3HT2 A;  3WXP A;  5A1F A;  3I3B A;  1PO2 3;  1O8S A;  1AZD A;  2RDR A;  5D2A A;  3OGS A;  1PO2 1;  1HXS 3;  2ET1 A;  4AED C;  1RB8 G;  4QXH A;  1HXS 1;  2IXJ A;  4JRL A;  4COY A;  2O1Q A;  1LED A;  3HVD A;  3OGG A;  3WT3 A;  1GZC A;  4OMC A;  4ORF A;  2GH8 A;  2VQA A;  3N7L A;  3BGA A;  3N9O A;  4GB3 2;  3WNK A;  2Y0O A;  2LAL A;  1C28 A;  3A0K A;  4CEW B;  4NRP A;  3SNM A;  4CXX A;  4LBQ B;  1OA4 A;  1VBA 3;  3CZU A;  4IV1 B;  4N53 A;  1DG6 A;  2R32 A;  2WNO A;  4FCA A;  1SDW A;  2XL7 A;  3JD7 3;  1VBA 1;  1AR8 3;  4L2N A;  5LEK A;  1GOF A;  2D44 A;  1MQT B;  3LDR A;  4XMA A;  1UNB A;  3LFI A;  3T30 A;  1AR8 1;  1L3J A;  1WUV A;  4AVS A;  4E8D A;  5FZ0 A;  3E6C C;  4AG4 A;  5I0T A;  4NPM A;  1OPM A;  4GAL A;  2VC9 A;  3WF1 A;  3IM0 A;  3WQ0 A;  5CBL A;  1RUH 2;  4YG6 A;  3MI8 A;  5JOW A;  3TN9 3;  3AVS A;  1CPN A;  3QAC A;  1S0B A;  2RS1 3;  2AC1 A;  3TN9 1;  1JZ2 A;  1BK1 A;  4RL7 A;  1JOD A;  2RS1 1;  1T2X A;  1UYY A;  3K46 A;  1RJ8 A;  1HB4 A;  2D5F A;  3KLS A;  5EFU A;  5FZO A;  4N90 A;  2CDP A;  4YGE A;  1W3V A;  1SLC A;  3LIG A;  5FQ0 B;  5EIY B;  1OXC A;  4KI5 M;  5FPV A;  4WM7 B;  4Q27 A;  5FK8 A;  1RHI 2;  1XB9 A;  4GA9 A;  4LK6 A;  1YQ6 A;  1SCR A;  3BOW A;  3TEX A;  2WN3 A;  1CX1 A;  1RJ7 A;  2XG3 A;  4IE7 A;  5KXB A;  4GMP 0;  1NCQ C;  1WW5 A;  2CGP A;  4Q4Y 2;  5IAT A;  5EJ3 A;  5HV4 A;  4JDM A;  1OMI A;  1W04 A;  1S0F A;  3ZSJ A;  2F4L A;  4RR3 C;  4RS5 A;  4IV3 B;  2W0X A;  3PUQ A;  1HKD A;  1W6Q A;  3C8X A;  4CDX A;  2EXJ A;  4MZU A;  4AL9 A;  3B5L B;  1V6I A;  1JU3 A;  2P6H A;  2VPV A;  4EE2 A;  1JOJ A;  4UFH A;  3GGL A;  1LOF A;  2W1W A;  4QM9 A;  5H9S A;  3PTY A;  3B02 A;  4XEZ A;  4ISQ A;  3DKQ A;  5EZW A;  2JD9 A;  4A7Z A;  4DXS A;  4AQT A;  3E6D A;  2WZ8 A;  3MZH A;  1WW7 A;  3GBG A;  3POW A;  4HFS A;  4YZ4 A;  1MQT C;  5FPB A;  5G04 L;  4M3C A;  5C4W B;  2E53 A;  5F3I A;  2GNB A;  2ZGQ A;  3RMY A;  1W9S A;  5BPX A;  5E6H A;  3O1M A;  2HWD 3;  1PIV 2;  3AKT A;  4JGY A;  3N36 A;  4LOR A;  4Y1V A;  4ZPI A;  1QGL A;  3I2D A;  5FZ9 A;  3TOJ A;  4FQZ A;  4DXR A;  1J58 A;  4L97 A;  1JZ3 A;  2SBA A;  2ZOE B;  5A3W A;  3OG2 A;  5FPZ A;  3PUS A;  1QJU 2;  3SH5 A;  5AC9 3;  4Y1X A;  5D1I A;  1VAM A;  3ZFE B;  1RVF 3;  4NWW A;  1FV2 A;  2RS3 3;  4LA3 A;  5AC9 1;  4FQ4 A;  2Q4S A;  5LA2 A;  4FFG A;  1WLW A;  3ZFF A;  4OYU A;  1AUY A;  4WM7 C;  3FE5 A;  5C9A B;  2FDI A;  4JKL A;  5KR7 A;  4FP2 A;  2YG0 A;  5A7S A;  3LAG A;  1OQD A;  3H7J A;  1UAI A;  4K6B A;  5J1X A;  3QH7 A;  1SLI A;  2Y26 A;  2OYZ A;  3U78 A;  4Q4W 1;  4Q26 A;  1A34 A;  5FMC A;  1WMX A;  3IDA A;  2IUW A;  2WJS A;  5LBE A;  1JZ4 A;  3I59 B;  2FCV A;  3NMB A;  5SV8 A;  1ASJ 3;  1WBL A;  4BCU A;  1NG0 A;  3AP9 A;  1NYW A;  4HSL A;  5FUI A;  1ASJ 1;  5IJR A;  1XNC A;  5K0U A;  2ARB A;  4PI0 A;  2VW1 A;  1JN2 P;  1LEN A;  3M2M A;  1X8E A;  5GJ6 A;  2JIJ A;  3WW1 A;  2R1D A;  4B1L A;  3FBY A;  3UKV A;  1SZB A;  2Q8E A;  1NA1 A;  5FZ3 A;  1GUI A;  1Z0H A;  2C1F A;  2O14 A;  2RJ2 A;  4YLZ A;  4YM2 A;  5FYU A;  3VBS A;  1DQ1 A;  2B8M A;  1MZE A;  3LKJ A;  5JR7 B;  4KGQ A;  1TZO A;  2JDU A;  5A1A A;  2J42 A;  4C90 A;  3VHR A;  4JV4 A;  1W8O A;  1CJD A;  4CCN A;  2ETE A;  1AYM 3;  5JUV A;  2IXK A;  2HEV F;  4QGM A;  3GXU A;  1QWR A;  4HVO A;  4KWL A;  2P37 A;  1AYM 1;  1UN1 A;  1W0P A;  1REF A;  3AZX A;  5D21 A;  3DPR B;  3VBR B;  3MIF A;  1RUE 3;  1UYP A;  2UY8 A;  2WNE A;  3IN9 A;  3N7K A;  3AZZ A;  4XPV A;  4QKN A;  4B29 A;  5BNP C;  3O1U A;  3JQX A;  4DZG A;  4PDW B;  5C3O A;  1RUE 1;  3M1H A;  5DUX A;  4NRQ A;  3ZXK A;  1XYP A;  4V1P A;  4ZZ8 A;  1X9T A;  1PM4 A;  3RYR A;  1ENQ A;  4QGL A;  2ZKL A;  4BPZ A;  4PIX A;  4RHV 1;  3NJV A;  1BHG A;  2VVE A;  1D0H A;  1ZRE A;  4KG0 A;  5IK8 A;  4Q1R A;  4COZ A;  1CAX B;  3ZMO A;  3FZ3 A;  2HJI A;  5EWS A;  3VBO A;  2DCZ A;  2OT7 A;  3K4A A;  5C3Q A;  1H1A A;  1H6Y A;  5GZC A;  3R4S A;  4J25 A;  2CV6 A;  3HQU A;  1O91 A;  1TE1 B;  3FUO A;  1HRV 3;  4YZ1 A;  2DTY A;  1KQR A;  2J1A A;  1PHM A;  1AX2 A;  2X09 A;  1GNY A;  3W5N A;  2MHF A;  1HRV 1;  1GZ9 A;  2DUO A;  3H3L A;  4NJ4 A;  5CU1 A;  3RYP A;  3WW2 A;  5BUV A;  3VLB B;  4XUQ A;  5C5U A;  2JE8 A;  1QH6 A;  5FP4 A;  2RMU 3;  3MYX A;  4XCA A;  2D97 A;  2YB7 A;  4CP9 A;  2RMU 1;  1WW4 A;  2ZHK A;  5K9Y A;  3HNY M;  3VBF A;  3ZDV A;  2JIC A;  5DAW A;  4G4F A;  4XDP A;  2WQ8 A;  4A2U A;  4CP2 A;  1YFY A;  4DRR A;  3DL3 A;  2XJT A;  1BKZ A;  4H2A A;  3DPR C;  3QOP A;  3VBR C;  5CKN A;  2W08 A;  3PMS A;  2YU2 A;  3MO4 A;  1W6N B;  1CIW A;  4YW1 A;  2VXR A;  4PDW C;  3DKW A;  4AQS A;  3WNM A;  1PGL 2;  1UX7 A;  2RJK A;  2XWJ B;  3ZIX A;  2XLG A;  3N3H A;  2DVB A;  4AVB A;  2GH2 A;  2HWC 3;  3E1F 1;  1TME 3;  5JSO A;  1APN A;  3ZVX A;  5FZ4 A;  2HWC 1;  1TME 1;  2N7G A;  2F17 A;  4JRA A;  2ZAH A;  3ZO0 B;  2VOT A;  1K5M B;  3H50 A;  4QXK A;  3ZFG A;  3CMG A;  2VZO A;  4BQW A;  3NNG A;  4FOQ A;  3FLT A;  1REE A;  1W39 A;  2PHT A;  4IEX A;  4SBV A;  1C1F A;  4E4H A;  4NIG A;  1IZ3 A;  4AAP A;  5F32 A;  1O4Z A;  2A3W A;  4KQ7 A;  4CPB A;  5FY9 A;  4Q1P A;  2ZJC A;  2VQ0 A;  4ASL A;  2EXK A;  4RFR B;  4QU1 A;  1VBC 2;  1TNF A;  1Z78 A;  4Y22 B;  2J1U A;  1O5U A;  1COV 2;  4IEV A;  5JIA A;  3R0R A;  3CLP A;  1FOD 2;  2WC2 A;  4NAM A;  2VCB A;  4PQ9 A;  1GZW A;  2VR4 A;  4OI1 A;  3PIG A;  1LOD A;  5F3E A;  5C3S A;  1WLD A;  1EAH 3;  3B01 A;  3I7D A;  4MUV A;  4FVV A;  4OHW A;  1T6G C;  4L99 A;  2TBV A;  3HIF A;  1UX6 A;  5KWR A;  1R08 2;  3ZYR A;  2GAL A;  4XUP A;  4NHX A;  4EWA A;  3A23 A;  4V2V A;  2ARE A;  2QTW B;  5KC5 A;  1HDK A;  5LY2 A;  2VW2 A;  1ACC A;  1OOP B;  2WSU A;  3LDB A;  2AEN A;  1H1I A;  4IEW A;  2VZV A;  4FXK B;  5C3R A;  5F5I A;  3AKP A;  5FZC A;  2Q8C A;  1ONA A;  3A22 A;  1W90 A;  3J4U H;  2SLI A;  4N43 B;  2PN5 A;  4JQR A;  2GC2 A;  4IE6 A;  1K5M C;  3NAP A;  4IW3 A;  3MW4 A;  3OSD A;  4F3J A;  1LOC A;  3V0A B;  3WDU A;  1YHF A;  5I0R A;  2CY6 A;  1ND3 C;  5FYT A;  2DCK A;  1LHN A;  4FFF A;  3AXD A;  3R05 A;  4LIT A;  1ZVF A;  3U1X A;  2C9K A;  3VZJ A;  1DIW A;  3C2U A;  2IXH A;  4P5H A;  5KXE A;  2JIG A;  5F6L B;  3UT0 A;  5CFC A;  1ZA7 A;  5E89 A;  3KM5 A;  2RG4 A;  2XL9 A;  3ECQ A;  5GAL A;  5F2W A;  3K3O A;  3T08 A;  3ZN6 A;  4D6Q A;  5JXI A;  3ETP A;  3WUD A;  1AXK A;  3AP4 A;  5LRR A;  1PK6 A;  2P6C A;  3C7F A;  4IEQ A;  2DCY A;  2PFW A;  2X05 A;  4IXL A;  3AKR A;  1EYB A;  2JDP A;  2WS9 2;  4NR1 A;  1W99 A;  4N53 B;  5EJ1 B;  5C8C C;  3W21 A;  3GJB A;  5SV5 A;  3RRD A;  4ASM B;  4AHY A;  2EAK A;  3ZN5 A;  1DBN A;  5BNQ A;  3WEZ A;  1G9A A;  1OOP C;  4JZR A;  1AYN 2;  5H9P A;  1V9U 2;  3K4Z A;  2K46 A;  2Q5T A;  1AL2 2;  2R16 A;  3OCP A;  1OFS A;  3NO8 A;  4UI9 L;  3S5A A;  2XPJ A;  2QE3 A;  4A41 A;  4QHO A;  2P2K A;  3DEM A;  4RQP C;  1GWM A;  3LIH A;  4M0N A;  1CD3 G;  4N43 C;  4IEY A;  4Y1Z A;  2IXL A;  5K7P A;  3OBT A;  3NNF A;  1K12 A;  3ZKU A;  2XHK A;  4E9K A;  2WIN B;  4YVW B;  4NUB A;  2VCC A;  2TUN A;  4YM0 A;  3CNA A;  5DAX A;  2Q1M A;  4FTS A;  3RI9 A;  5KHG A;  2I2S A;  1ZA4 A;  1ENS A;  2KM2 A;  1SCS A;  5IAV A;  3AZV A;  1I3H A;  3VD5 A;  5JPM B;  3PJY A;  1RUH 3;  3T2P A;  3B9I A;  2BJS A;  3S7E A;  1BYH A;  3KHC A;  1D7P M;  1HXS 2;  3ZYB A;  3R6S A;  2XJQ A;  1DYK A;  1LEC A;  3T4H B;  2CTV A;  4GZ9 A;  4RS5 B;  1UXZ A;  2QQL A;  1W6Q B;  4CDX B;  1LGC A;  3POJ A;  1H4H A;  3NWK A;  4B3N A;  1H9P A;  3F95 A;  4GAZ A;  4R9C A;  4XQD A;  1UWW A;  1VBA 2;  4QXC A;  2B5H A;  3WP6 A;  2XH6 A;  3GYD A;  3UL2 A;  5FZM A;  3WQ7 A;  1DP0 A;  1AR8 2;  3DYM A;  5FRA A;  3ZXF A;  1CX4 A;  2BNM A;  1C8M 3;  4UFM A;  2JX9 A;  1DQ6 A;  1QDC A;  1SG3 A;  1E5R A;  1C8M 1;  4Z92 B;  1MS9 A;  2GME A;  2V73 A;  3A4U A;  1BZW A;  4ATE A;  3TN9 2;  4JGY B;  5A70 A;  3N35 A;  4YVS B;  2RS1 2;  2K9Z A;  4CEW A;  4I01 A;  1ST8 A;  4IV1 A;  3DXT A;  3KQR A;  4I3P A;  2PHF A;  3MIC A;  3KV4 A;  1IKQ A;  1P8J A;  3OPZ A;  1PGS A;  3E5U A;  5FZA A;  5A6Q A;  1J3R A;  5ISL A;  2UUR A;  4MGK E;  2ZMN A;  1LB2 A;  3ZFF B;  5GZG A;  5DZG A;  3KMH A;  4BQX A;  2FZ1 A;  4QPI A;  5IHR A;  3AL6 A;  3VDD A;  4I09 A;  2Q1Z B;  2GMP A;  5FMD A;  1PIV 3;  2AZ5 A;  2VMD A;  1FYU A;  5FZB A;  1DGR N;  5IWF A;  2UYA A;  3SH4 A;  1IQA A;  2A6X A;  4AXO A;  5JI7 A;  3B69 A;  1Y4W A;  1Q8S A;  1RTV A;  4RS5 C;  1EUU A;  1QJU 3;  3SCF A;  3N9P A;  4OI2 A;  4CDX C;  1G9C A;  1UY0 A;  1W9Y A;  2GU9 A;  2OPK A;  3KZ4 C;  3OEB A;  1LOF C;  1RC6 A;  1GR3 A;  3ZSL A;  1YQ5 A;  3NKT A;  3JCI A;  1YI7 A;  4GH4 A;  2ZZQ A;  1YI9 A;  1GMM A;  1U5I A;  2JE7 A;  4Y33 A;  2QUO A;  5K0U B;  4XFC A;  1OH4 A;  1UKR A;  4B1M A;  2MNG A;  2VQT A;  3CDZ B;  3T2Q A;  2EIG A;  2ZGP A;  4AFB A;  3N7J A;  2FDJ A;  4PIZ A;  4K20 A;  3VBS B;  4JGY C;  4MYE A;  4OFG A;  4FPK A;  3ZYJ B;  4YZ5 A;  2ZGU A;  4QPG A;  2Z69 A;  3L9J T;  3UKN A;  1V0A A;  3Q8B A;  4N9I A;  5FAX A;  1EPW A;  5T50 A;  1J83 A;  3LA3 A;  4PBP A;  4QDS A;  4OMD A;  4K1Z A;  4R8H A;  3BOP A;  4XFB A;  1E5I A;  3ZSK A;  3N9Q A;  1S2E A;  5C4W A;  1WD4 A;  2LRO A;  3ZPY A;  4CEY A;  5FYS A;  4AEK A;  4DUX A;  2XJP A;  1H6X A;  3AP7 A;  4LKD A;  1W9W A;  2CDO A;  2ERF A;  4NWV A;  4K8R B;  5FDB A;  5KHK A;  2ZGN A;  1LCL A;  2VUD A;  4EJR A;  1ZZ7 A;  1E57 A;  2E63 A;  3KV9 A;  4HKW A;  4Q4W 2;  2V4V A;  3OY8 B;  5DXD A;  1DYO A;  4AVA A;  4FPF A;  4K7J A;  4YG0 A;  2ZGM A;  5BY5 A;  2VJX A;  3C7O A;  4B4Q A;  1AX1 A;  1DLL A;  1SBD A;  1JH5 A;  1VAK A;  2WAB A;  3ZFE A;  1SLL A;  4LKS A;  2PQS A;  2OZJ A;  3HR9 A;  1ASJ 2;  4FP3 A;  1MS0 A;  4PJY A;  5CIR A;  1GU3 A;  2PHU A;  5FZ6 A;  2HBT A;  4BQ4 A;  3RJR A;  1IS4 A;  1PZ8 A;  1FPN 3;  1ZBA 2;  1SBF A;  5J7M A;  4NIA A;  3RPQ A;  4SLI A;  1FPN 1;  1K45 A;  3HBK A;  3N7M A;  4XJ8 A;  1HJG A;  3PVN A;  1JYW A;  2JD4 A;  2ZS6 B;  5KXC A;  2B46 X;  4QU2 A;  4QWN A;  5F9T A;  1B35 A;  1NA1 C;  1QJZ A;  2NM1 A;  3VBS C;  3KQ4 B;  4TXW A;  3AL5 A;  1YIF A;  2RVA A;  2YBK A;  3VDB A;  4HBN A;  4MX3 A;  1DZQ A;  4FBF A;  3KGL A;  1S2B A;  4OUL A;  4CP9 B;  5JI9 A;  1AYM 2;  2R7E B;  4DRV A;  2BYV E;  1ODM A;  3HWJ A;  2P3K A;  3VBF B;  3NQH A;  4ZZ5 A;  3I2I A;  4D7Y A;  2EVX A;  1RUE 2;  1N1V A;  1Y9G A;  3ORJ A;  2J1T A;  3AMP A;  1W03 A;  2H6C A;  4HPK B;  4RHV 2;  1A78 A;  5CEH A;  3POG A;  4MET A;  4OLL A;  2BV4 A;  2JEC A;  2W5F A;  4LBJ A;  1V6L A;  3VZL A;  4LEJ A;  3RVH A;  2R30 A;  1PMI A;  1RIN A;  4FFI A;  3DGT A;  2WKK A;  1OVS A;  3JXS A;  5EXO A;  4K21 A;  1OA3 A;  1LOA A;  1WW6 A;  2ZGS A;  4P9W A;  3TAY A;  4CP0 A;  4EN7 B;  2R49 A;  3WHT A;  3TNP B;  3VBO C;  2BNO A;  1YFX A;  4ONU A;  4HLT A;  2P1B A;  4P9I A;  5I8Y A;  1X33 A;  3N9N A;  1UU6 A;  3U75 A;  4ZU5 A;  4BXF A;  5HCF A;  2OS2 A;  1HRV 2;  2D6L X;  5T5L A;  5BV6 A;  5CAZ A;  1UCX A;  4H7L A;  3WD5 A;  1IS3 A;  5FMO L;  3FL7 A;  1UOB A;  2O8Q A;  1SPP B;  2RMU 2;  3MUZ 1;  5A3P A;  4XE9 A;  4BQ5 A;  3WW3 A;  3IAQ A;  3RZG A;  3AX4 A;  1O59 A;  1GZW B;  2NZ9 A;  1KFX L;  3VBF C;  1HJF A;  2VBP A;  2WDB A;  3IBM A;  5FKC A;  3RWK X;  2ZMK A;  3M70 A;  2X5I B;  4LBO A;  3VD7 A;  1GAN A;  1ZRI A;  1K5J A;  1YRZ A;  1US3 A;  3KD4 A;  5FMB A;  1UZZ A;  4DUV A;  4KG8 A;  1VBC 3;  4Y5S A;  3AK0 A;  2Y6L A;  1COV 3;  1Q3E A;  3J7M A;  4AHW A;  1OQ1 A;  1TME 2;  4IGP A;  4KWJ A;  5DG2 A;  3WDW A;  4ZS2 A;  3LOB A;  1NAE A;  3O5S A;  4LMF A;  2OZ6 A;  4COV A;  3U10 A;  2X8K A;  2WSV A;  2EXH A;  4XAA A;  3JQW A;  2NP0 A;  3SEE A;  2ARA A;  1NOV A;  3NAP B;  3ZFG C;  1RL3 A;  1W6N A;  2LW8 A;  2PLV 3;  4CA9 A;  5JCT A;  2BEO A;  1UU4 A;  1RUN A;  4NHY A;  5L9V A;  2PLV 1;  3DYP A;  4BIF A;  2H0B A;  2NN8 A;  5T52 A;  3RQ0 A;  2JDZ A;  1S2K A;  3BAL A;  4UYB A;  5FLH A;  1YCI A;  5CFC B;  4XAE A;  5J36 A;  3CEW A;  3JB4 C;  5FK7 A;  2D98 A;  4JGZ A;  4URA A;  3O0V A;  2ENR A;  4LK7 A;  4NE9 A;  4DY3 A;  3SC7 X;  1OBN A;  1PGW 2;  3KT7 A;  4G9S B;  3VKN A;  3FWE A;  5JOX A;  5DUU A;  2G4I A;  1O7F A;  1PK6 B;  4OZX A;  1W8N A;  4NPR A;  3R4U A;  4OHV A;  1Q8O A;  3WNX A;  2A6Y A;  2R04 2;  2ZXQ A;  3I54 A;  4LHS A;  4PBO A;  3WG4 A;  4D6S A;  1X9P A;  5FR3 A;  5FJK A;  1ZZ9 A;  2WQZ C;  5F7U A;  1UKG A;  3SEP A;  4IL7 A;  4YRD A;  4C1X A;  4FPG A;  2PYT A;  3K4D A;  1JYC A;  1RUD 2;  4KBZ A;  1EPZ A;  5HV0 A;  4XF9 A;  3SLI A;  1R1A 3;  2ADE A;  3LPF A;  3GNE A;  1R1A 1;  1VBE 3;  1RUC 3;  4BA6 A;  5F37 A;  5A6X A;  1VBE 1;  1RUC 1;  2ORX A;  4XIK A;  3NAP C;  2YGL A;  1RYY A;  1U5X A;  4IDZ A;  4NHL A;  5K4L A;  1C5H A;  3W58 A;  2QNK A;  5F3G A;  1DZR A;  1QNY A;  4MXW A;  3J8F 2;  1IPJ A;  1NE4 A;  2JDN A;  4Q5O A;  2Q0A A;  1MEC 3;  1GV9 A;  2KR2 A;  3III A;  3PLQ A;  4IE0 A;  4JTN A;  1AL2 3;  1MEC 1;  4AVT A;  5CFC C;  4Y5Z 0;  5JMC A;  2ILM A;  1UO9 A;  4FTB A;  1W0N A;  1AL2 1;  1OUS A;  3AMH A;  1OLQ A;  4P5Y A;  2W1S A;  3WX5 A;  5LA1 A;  3VUO A;  2TEP A;  1YFU A;  4BLI A;  4EN0 A;  4XVH A;  4LTA A;  1L7L A;  1VBD 2;  3VBU A;  4N7U A;  2E26 A;  4C91 A;  1PK6 C;  2QVS B;  4A6O A;  5CIS A;  3AYA A;  5C5T A;  1EY2 A;  3RNS A;  1QJF A;  4AI8 A;  2DYC A;  3K2O A;  3O1S A;  3IB3 A;  1YQ8 A;  3J7L A;  3UJQ A;  3V64 A;  1PZ9 A;  1LOB A;  4LKE A;  4HN1 A;  3AJZ A;  1NQD A;  2W47 A;  3WNO A;  5CA6 A;  4FOW A;  4E2Q A;  4PHZ A;  2DFC A;  2W1U A;  3VKF C;  2PHX A;  4W50 A;  3WDT A;  3VKO A;  5FY4 A;  2D6P A;  4M00 A;  2D43 A;  4WVV A;  4BQ2 A;  3ME2 A;  3ZYP A;  4QD2 A;  2IZW A;  3ST7 A;  1N3Q A;  3FLP A;  3LEK A;  5A3N A;  3CU7 A;  5FP7 A;  3EHK A;  4UT5 A;  2YGM A;  5T5J A;  2B39 A;  2I74 A;  1M06 G;  5FO8 B;  2OPW A;  4ZON A;  3ZXD A;  1J59 A;  5F2S A;  1CZS A;  3RZZ A;  1NY7 1;  3ZN4 A;  1S0D A;  1OD5 A;  2UYB A;  1ZRF A;  3KB5 A;  4QPI B;  4UF0 B;  1RUG 2;  3VDD B;  4AR2 A;  4CCK A;  4HON A;  5FBJ A;  2CAV A;  5IVJ A;  2QQJ A;  1BEV 1;  1DFQ A;  1MZF A;  4D8M A;  2ZGL A;  4X6Q B;  2YBS A;  3M4F A;  3AC0 A;  3P1I A;  3POI A;  4YVW A;  2D3R A;  2VOK A;  3H0O A;  4CUC A;  1AX0 A;  3MPB A;  1W6M B;  2BFU S;  2YHJ A;  5IUQ A;  1SFP A;  2Y6J A;  5HCH A;  2JDY A;  3I2K A;  4Q8K A;  3VB9 A;  1U0A A;  3HAG A;  1LNS A;  4BJ0 A;  3Q9O A;  1X7N A;  4GH4 B;  1VR3 A;  4XXA A;  1CVN A;  3RJ2 X;  1C8M 2;  5B2G B;  3TEZ A;  1QHD A;  4XFI A;  2VY0 A;  3GCW A;  2VXJ A;  4OZO A;  3PUI A;  4K9S A;  3GHM A;  2BOJ A;  4X6R B;  1OLM A;  4CSW A;  5B4N A;  5IVC A;  4UXA A;  1OKQ A;  4LNV A;  1IPK A;  4QPY A;  1HX6 A;  3CF6 E;  2VUC A;  5EQU A;  4MO3 M;  5FY5 A;  5CAD A;  4QPG B;  4CEW C;  2Y8K A;  4YFW A;  3VN4 A;  4OHZ A;  2VZS A;  4IV1 C;  3IKW A;  3CJI A;  2AR6 A;  1CR7 A;  2G9Z A;  2X10 A;  4AW7 A;  4CU7 A;  5CFD B;  4QDQ A;  1IKP A;  1I1E A;  2RDQ A;  2QQO A;  1NE6 A;  4CEY B;  4ZHN A;  4HET A;  2GC0 A;  2JG8 B;  2P4E A;  5G05 L;  2BER A;  3HBZ A;  4QPI C;  3PL0 A;  3CIH A;  3VDD C;  1UYZ A;  4J1W A;  4KGG A;  4MSV A;  1QNW A;  4YM3 A;  3SCH A;  1I5Z A;  2GN3 A;  4WVW A;  4Q8L A;  4YVS A;  5GLZ A;  3VL8 A;  4A7Y A;  2F4P A;  2V72 A;  3UKT A;  3LDK A;  4ZXK A;  2GNT A;  3OF1 A;  3OUJ A;  4XAC A;  1WMF A;  5IFT A;  1O3Q A;  2WFP A;  4DS0 A;  2ZML A;  1QJY 3;  4HL0 A;  4TN7 A;  4UAP A;  3MW3 A;  2XLF A;  4E2G A;  1IQD C;  1QJY 1;  3IZO A;  5FUN A;  2YPD A;  4Y26 A;  1POV 3;  2GNM A;  4GH4 C;  3IMN A;  1UZW A;  3OPT A;  3ITQ A;  3BOD A;  1POV 1;  2K0G A;  4EN8 B;  4Q4W 3;  5GKA C;  5HPO A;  1UY3 A;  4BU2 A;  1KDM A;  4IV3 C;  1B35 B;  3KF5 A;  1SMV A;  1UY4 A;  3EBR A;  3JB8 A;  3B7M A;  1KDK A;  4QQP A;  1YYN A;  5CG8 A;  4QPG C;  1AHS A;  5L9B A;  5JSP A;  1J1L A;  5LZ6 A;  2FMD A;  1W8F A;  2WAA A;  2RDN A;  4QX8 A;  3S5Q A;  2DBI A;  1G9D A;  1ZBA 3;  2DVG A;  3C3V A;  3IDC B;  1QOO A;  3LEM A;  3SXW A;  4EYU A;  4CEY C;  5C4W C;  1ZBA 1;  4NHK A;  1ZM1 A;  4ARX A;  2QQW A;  4HVR A;  1UF2 C;  4LBK A;  3APB A;  2OXB A;  1W2N A;  1IOA A;  1GOH A;  4E4D X;  3ASI A;  2VM9 A;  2VMI A;  1OKO A;  5ABJ A;  1R64 A;  3ZFE C;  4RYD A;  3SH3 A;  3H3Z A;  1EV1 3;  3BIW E;  2P3Y A;  4MGS A;  4UOJ A;  2FDF A;  5FZG A;  4CDQ A;  2ZEY A;  2ZGO A;  1EV1 1;  5DPN A;  1ZRC A;  1DGR A;  2WRA A;  1FPN 2;  4HZF A;  4OCT A;  4HMZ A;  2JEM A;  4RHV 3;  1PVC 3;  2HWE 2;  2V4A A;  4LUL A;  2EIC A;  3OY8 A;  5E8A A;  4CU9 A;  4FPH A;  1PVC 1;  3H1W A;  3JBG 2;  3I3D A;  4LA2 A;  3MUY 1;  1OF3 A;  1XOY A;  4PIY A;  4XTM A;  1B35 C;  4A6S A;  4AHX A;  2GC1 A;  1LHW A;  5AVA A;  3RZM A;  2ZX1 A;  2ZEW A;  5EHD A;  3ENR A;  5EJZ B;  2GAU A;  3MIH A;  5FZ8 A;  5IK5 A;  5A33 A;  4NOT A;  4XHX A;  1QXR A;  2PTM A;  5JXG A;  3USS A;  1XSR A;  1NQJ A;  2W87 A;  1DCS A;  4PI2 A;  1XNT A;  2J1V A;  2DVA A;  2HEW F;  3ACI A;  4AFA A;  3S30 A;  5C8W A;  4P00 B;  5JXJ A;  5LY1 A;  2ZBJ A;  1H30 A;  2VUA A;  4JTO A;  1WA4 A;  3SIS A;  2IFW A;  2ZEX A;  3H8R A;  2JXA A;  5CZK A;  4RGA A;  5B4X A;  1VMF A;  2JKB A;  4MH0 E;  5FP9 A;  4LQR A;  5F5C A;  1S0G A;  2ZEZ A;  2FMY A;  1U5Y A;  1IG3 A;  1OT5 A;  4YW2 A;  4A45 A;  4PF1 A;  4LIU A;  4W6X A;  1K3I A;  4GIQ A;  4Q0P A;  1E5H A;  5DG1 A;  1RUF 3;  3WIN E;  5A32 A;  1F15 A;  1O3R A;  4IQP A;  2XDV A;  4AYU A;  4XCB A;  3GJA A;  1GNH A;  1RUF 1;  2CAU A;  3BB6 A;  1RMU 3;  4LJH A;  4QX0 A;  4XET A;  4BME A;  4HPK A;  1UY2 A;  4LBQ D;  1RMU 1;  3PJQ A;  1JYX A;  2WNV A;  3J7H A;  1MR5 A;  3FBM A;  4CDU A;  4E4Z A;  1KJR A;  1XYO A;  1MZ5 A;  2XOM A;  1OLM E;  3JUU A;  2QCS B;  3AJY A;  4JGZ B;  3VD4 A;  3PUA A;  3THT A;  2YC0 A;  4RGK A;  2Z42 A;  1VMH A;  4AVC A;  3AZY A;  3CL1 A;  3ZXA C;  1JS9 A;  1LTE A;  2G9F A;  3DV8 A;  1XU1 A;  3RWN A;  4FAG A;  2WO3 A;  4LBN A;  1STM A;  1HB3 A;  3QLQ A;  5LEJ A;  4COU A;  4BQ1 A;  1SAC A;  1F8V A;  2O8O A;  1VB2 A;  2OW4 A;  4IEZ A;  3INA A;  2D7F A;  2HYK A;  2Y60 A;  4GWJ A;  2MPF A;  4NRO A;  3OB8 A;  3M3Q A;  3WF4 A;  3WSO A;  4CCJ A;  5FIX A;  1SPP A;  2P5B A;  5DQ0 A;  3M3I A;  2VZ1 A;  4WVM A;  4YPJ A;  3Q8F A;  3MIB A;  2QQM A;  1XBF A;  1SEF A;  3KV5 A;  3CHX A;  4XQW A;  1IPS A;  1PGW 1;  2J1R A;  3NV1 A;  4ERO A;  2WFF 3;  2YPJ A;  5FUP A;  2QQP A;  4AQ6 A;  3I3M A;  3DUI A;  2QDR A;  2R04 3;  2WFF 1;  2X5I A;  4FPL A;  4HSJ A;  4JVA A;  4XF1 A;  2PLV 2;  2VZP A;  3J26 N;  4LE4 A;  5CKM A;  3CQO A;  3GZA A;  2R04 1;  3M3O A;  4EN6 B;  3AYC A;  5ACA 3;  3O12 A;  4MXW B;  4I0W B;  2W68 A;  4BIO A;  4LBL A;  5ACA 1;  1RUD 3;  2QQI A;  3V56 A;  4FFH A;  4W6Y A;  4FO9 A;  3U0Z A;  4TZD A;  2UWB A;  2HWF 3;  1RUD 1;  4JX0 A;  1OPO A;  2B42 B;  2A71 A;  1N47 A;  3D6E A;  3FHI B;  4JGZ C;  2HWF 1;  4Y4Y A;  2QZ2 A;  5FZH A;  3P3P A;  4CDW A;  3O1T A;  4E8C A;  2I45 A;  1GP4 A;  1UOG A;  5FOB B;  2GZW A;  3VBU B;  3GZE A;  1Z7S 3;  3H1Y A;  4QGN A;  2PAK A;  3ALQ A;  2B9U A;  4TTG A;  2WZP P;  4J1X A;  1PZ7 A;  1ZZC A;  1ULE A;  1Z7S 1;  3J8F 3;  3IAP A;  4P9Y A;  4I3G A;  1MS5 A;  4IEP A;  5FZ1 A;  3T3Y A;  1VB4 A;  2GN7 A;  2HH9 A;  3J8F 1;  1JYT A;  1ZBE 2;  3ILN A;  4QQL A;  1JYV A;  2W2I A;  4KU7 A;  2XR4 A;  2NMO A;  4AHZ A;  5FPU A;  1YNA A;  1R1A 2;  4I30 A;  1VBD 3;  4HK9 A;  3QD6 A;  2FCU A;  3K3N A;  2EIB A;  1CZV A;  1VBE 2;  1RUC 2;  1OD3 A;  1VBD 1;  2EAL A;  2WWJ A;  3LQC A;  3MPP G;  4OUE A;  4XIL A;  4YSF A;  2FHR A;  3CJX A;  4CCC A;  5A1L A;  5FPX A;  5L73 A;  3I2O A;  1CES A;  1VP6 A;  5FYM A;  4EWE A;  5FMO S;  2CU5 A;  1FV3 A;  4LOS A;  2W9X A;  2WO2 A;  3D8C A;  4Z8B A;  1Q8V A;  1KIT A;  5H9R A;  4X8P A;  2XB6 C;  5IVF A;  5LA9 A;  5APA A;  4MHU A;  3H8O A;  4GXL A;  1GSL A;  1MEC 2;  1KS5 A;  4HT1 T;  2E51 A;  2QKD A;  3ACF A;  1FAY A;  4FT8 A;  2TNF A;  1B09 A;  4X8N A;  3WF3 A;  3WNP A;  1I5P A;  1QF3 A;  4YM1 A;  5IVB A;  4P9J A;  4H14 A;  4XF3 A;  4A3Z A;  5J09 A;  4BOW A;  1HQL A;  3OBR A;  4QX5 A;  3AFK A;  3BVC A;  1A3K A;  3WHU A;  3VBU C;  2VBB A;  1PX4 A;  1MZ6 A;  2Y6K A;  2GND A;  2UU8 A;  5FRE A;  3G7D A;  4TSV A;  4BE3 A;  2FZ2 A;  2J1E A;  2VZ3 A;  2FBE A;  3PNA A;  5IVE A;  1CPM A;  3T2O A;  1ND2 A;  2YBP A;  5FPA A;  1XXN A;  3ROU A;  2CNA A;  1RUG 3;  5CNA A; 
#chains in the Genus database with same CATH homology
 1SHW B;  2VZT A;  2VZR A;  4DUW A;  1O8P A;  2W5F A;  1MPX A;  3W5M A;  4OMC A;  3BN6 A;  3WNK A;  3BGA A;  3PUH A;  3JXS A;  4XZU G;  3CZU A;  3VD3 A;  3UNP A;  3I2H A;  2W46 A;  1OF4 A;  4ZY9 A;  2BGP A;  1GOF A;  4JKK A;  4E8D A;  4AG4 A;  2YFZ A;  2VC9 A;  3WF1 A;  2QQK A;  2VQU A;  1DLC A;  1F4H A;  3FL7 A;  3NJX A;  4QPW A;  3MUZ 1;  1JZ2 A;  4XUO A;  4QX3 A;  4CUA A;  3IAQ A;  3K46 A;  1T2X A;  1UYY A;  1O59 A;  4JKM A;  2CDP A;  1J84 A;  2YFU A;  2XQX A;  3LEI A;  5EIY B;  2WDB A;  4KI5 M;  3VD7 A;  3ABZ A;  1US3 A;  2WN3 A;  1CX1 A;  4DUV A;  5LA0 A;  2W1Q A;  3P6B A;  2W94 A;  2Y6L A;  5LCW L;  2YC4 A;  4IUG A;  3C8X A;  1NAE A;  3OBA A;  1JU3 A;  2J1S A;  3GGL A;  2W1W A;  3LE0 A;  4DEQ A;  4MAD A;  4DXS A;  2JD9 A;  1UXX X;  2LS6 A;  4PT6 A;  3SEE A;  1NX9 A;  1PX3 A;  3NRU A;  2LW8 A;  2WZ8 A;  5G04 L;  2B4K A;  5IFP A;  3DYP A;  1W9S A;  4QB2 A;  4BXS V;  3I97 A;  4DXR A;  1JZ3 A;  3OG2 A;  3UET A;  1TG7 A;  4QAW A;  2KD7 A;  3C7G A;  2W91 A;  4HG6 B;  2BZD A;  1ULO A;  1W8N A;  5LA2 A;  4OYU A;  2BGO A;  2ZXQ A;  4LHS A;  4JKL A;  2DCJ A;  2YG0 A;  4D0Q A;  3EB7 A;  5F7U A;  3SEP A;  4Z2A A;  2VMC A;  3K4D A;  5J1X A;  3FN9 A;  1XNA A;  1UZ0 A;  3LPF A;  4ET7 A;  5DMY A;  3IDA A;  1JZ4 A;  2ORX A;  1RYY A;  5FUI A;  3UES A;  3FHQ A;  1PMJ X;  5IJR A;  3SKV A;  1JYN A;  2HYX A;  1GOG A;  1UMI A;  2J7M A;  3III A;  2VME A;  2VZQ A;  1GUI A;  2RJ2 A;  4A4A A;  1XPW A;  1W0N A;  5LA1 A;  4P5Y A;  2W1S A;  5A1A A;  4CVU A;  4XVH A;  3EYP A;  4KWU A;  2W95 A;  1W8O A;  2E26 A;  5JUV A;  4A6O A;  3GXU A;  3U37 A;  1JHJ A;  3IB3 A;  1JU4 A;  3GDB A;  2Y6G A;  3MV1 1;  2VTF A;  2W47 A;  3WNO A;  4ZZ8 A;  1L7R A;  2EIE A;  2W1U A;  2WBK A;  3C7E A;  3I2J A;  1BHG A;  3NJV A;  3HNB M;  4FI9 A;  4W50 A;  3ACG A;  1K42 A;  3I2F A;  3LEK A;  1TVG A;  3K4A A;  4DXT A;  4LPL A;  5JMO A;  5DN2 A;  1H6Y A;  1CZS A;  5CYY A;  3HPN A;  3ZM8 A;  2L9L A;  3DYO A;  2J1A A;  2X09 A;  1GNY A;  3W5N A;  3OEA A;  4XUQ A;  1WCQ A;  2JE8 A;  4P08 A;  1EUT A;  2QQJ A;  3GM8 A;  4D8M A;  2YB7 A;  3AC0 A;  3P1I A;  3HNY M;  4CUC A;  2V5D A;  4XUN A;  2WQ8 A;  4BK4 A;  2YC2 A;  3I3E A;  2Y6J A;  3I2K A;  3MO4 A;  3T0D A;  5C71 A;  1LNS A;  4BJ0 A;  3WNM A;  2E33 A;  3VD9 A;  1UX7 A;  3DEC A;  3E1F 1;  4OZO A;  3PUI A;  5B4N A;  3K77 A;  3LPG A;  4MO3 M;  2VOT A;  2Y8K A;  3CMG A;  2VZO A;  2VZS A;  3NNG A;  2W92 A;  3C7H A;  2EID A;  2X10 A;  4CU7 A;  4QDQ A;  2QQO A;  1NKG A;  3WNL A;  5G05 L;  4W8J A;  2BER A;  1KGY A;  3WNN A;  3CIH A;  3FHA A;  4MGQ A;  4W4Z A;  1UYZ A;  2J1U A;  2OKX A;  2V72 A;  2VCB A;  2VO5 A;  3T09 A;  2VR4 A;  4QB1 A;  4ZXE A;  1HN1 A;  1PMH X;  5IFT A;  1CIY A;  4JHZ A;  2BBA A;  2VMF A;  4UAP A;  3F2Z A;  2Y64 A;  4XUP A;  1IQD C;  2Y6H A;  3A23 A;  3A7Q A;  4MOA A;  4CU6 A;  2VZV A;  5HPO A;  5HXM A;  3HJR A;  1UY3 A;  1JZ8 A;  2W3J A;  3A22 A;  1UY4 A;  2E32 A;  4QDR A;  3ACH A;  5IYY A;  2WAA A;  1JZ7 A;  2QBX A;  2DCK A;  4A42 A;  2C4X A;  2VL4 A;  2C9K A;  2XON A;  4ARX A;  2E31 A;  3VDC A;  3ECQ A;  1XC6 A;  1GOH A;  3T08 A;  5JXI A;  3ETP A;  2VM9 A;  4ARY A;  3C7F A;  3LEG A;  1R64 A;  4BK5 A;  4RYD A;  2X05 A;  4MGS A;  4UOJ A;  1ULP A;  1W99 A;  2ZEY A;  5EJ1 B;  5DPN A;  2DDU A;  3WEZ A;  1NUK A;  1L7Q A;  2EIC A;  3K4Z A;  4CU9 A;  3HOB A;  4UI9 L;  3I3D A;  1WKY A;  3MUY 1;  1OF3 A;  4A41 A;  5JR2 A;  1SDD B;  2ZEW A;  5EJZ B;  1K12 A;  5JXG A;  2VCC A;  2W87 A;  1XNT A;  3CKH A;  2J1V A;  3ACI A;  3VD5 A;  3WQB A;  3T2P A;  4P00 B;  5JXJ A;  4XUR A;  1D7P M;  3MV0 1;  4QX2 A;  2WO1 A;  3D3A A;  3CZJ A;  4GZ9 A;  2ZEX A;  5CZK A;  5B4X A;  1UXZ A;  3T0A A;  2QQL A;  4CU8 A;  4LQR A;  2ZEZ A;  3HN3 A;  5C70 A;  1OT5 A;  4A45 A;  4A44 A;  4PF1 A;  4QB6 A;  1K3I A;  1UWW A;  1DP0 A;  3DYM A;  4QX0 A;  1UY2 A;  1SG3 A;  1GQP A;  1JYX A;  2VCA A;  3J7H A;  1UY1 A;  2WN2 A;  2XOM A;  2HLE A;  2RV9 A;  2JDA A;  3VD4 A;  1KEX A;  1P8J A;  4M4R A;  2WO3 A;  4DEV A;  5IHR A;  5I0D A;  4KMQ A;  4GWJ A;  2VMD A;  2Z4F A;  3WF4 A;  3OB8 A;  3WSO A;  5DQ0 A;  2VZ1 A;  4YPJ A;  2WAO A;  2QQM A;  1UMH A;  1EUU A;  2WZE A;  1UY0 A;  2J1R A;  3OEB A;  4BDV B;  2VZU A;  4CUB A;  2ORZ A;  2VZP A;  3CQO A;  1GMM A;  1OH4 A;  3OGR A;  3VDA A;  3WF2 A;  4XUT A;  3K75 B;  2VQT A;  3CDZ B;  2QQN A;  2WUH A;  3T2Q A;  4AAX A;  1CZT A;  2QQI A;  1YQ2 A;  1JZ5 A;  4JX0 A;  4E8C A;  3I2G A;  1J83 A;  4QDS A;  3SKJ E;  4OMD A;  3WF0 A;  4M4P A;  4TTG A;  3HEI A;  3IAP A;  4L0P A;  4DUX A;  1H6X A;  1W9W A;  2CDO A;  2JKX A;  4P02 B;  1JYV A;  1W9T A;  1US2 A;  3T0B A;  3A21 A;  2V4V A;  1DYO A;  1UYX A;  5C7G A;  2VJX A;  3C7O A;  1JI6 A;  4PQQ A;  2WAB A;  2EIB A;  1CZV A;  3LQC A;  4OUE A;  1OD3 A;  4LKS A;  2PQS A;  1GU3 A;  3MBW A;  4QX1 A;  2W9X A;  2WO2 A;  4RN5 A;  3HNM A;  1JZ6 A;  1K45 A;  3THC A;  3THD A;  1F4A A;  1JYW A;  2ID4 A;  3ACF A;  3WF3 A;  3WNP A;  1I5P A;  3OGV A;  4GWI A;  2C26 A;  4A3Z A;  4TXW A;  2B9V A;  2RVA A;  3VDB A;  5JXH A;  2R7E B;  1PX4 A;  2WYS A;  2XHN A;  2Y6K A;  3NQH A;  4ZZ5 A;  3I2I A;  2J1E A;  2J22 A;  2VZ3 A;  3I3B A;  3T2O A;  1O8S A;  2J1T A;  3OGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...