3GXUA

Crystal structure of eph receptor and ephrin complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
175
structure length
171
Chain Sequence
NEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGTCKETFNLYYYESDNDKERFIENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Ephrin type-A receptor 4
publication title Structural characterization of the EphA4-ephrin-B2 complex reveals new features enabling Eph-ephrin binding promiscuity
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 171
sequence length 175
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3gxuA00
2QQLA 2J1TA 2JD9A 4OMCA 1UY2A 3WF1A 3WNLA 2W46A 2ZEWA 2B9VA 2VC9A 3MBWA 3CQOA 5IFTA 2L9LA 1W99A 1JZ2A 4DEVA 4MOAA 5EIYB 1JU3A 2VZUA 1YQ2A 2XHNA 2LS6A 3C7HA 2W5FA 1UMHA 5JXGA 2RVAA 2VMEA 2PQSA 2VZVA 4CU6A 1JZ7A 3ETPA 3K46A 2E26A 4IUGA 2WUHA 1DYOA 1WCQA 2CDOA 4ET7A 2E31A 4QAWA 2VL4A 3WEZA 3UESA 5J1XA 3SEEA 1SHWB 3NJXA 3HNYM 5IHRA 1IQDC 2W3JA 2BGPA 3T09A 4XVHA 1UWWA 1PMHX 3OGSA 3PUHA 3ZM8A 4ARYA 3FN9A 2Y6KA 4KMQA 2ZEZA 3THDA 4XZUG 2VZ3A 3A7QA 1US3A 2C9KA 3WSOA 3HPNA 3I2JA 1JZ6A 2VJXA 1JYNA 4QDRA 3LEKA 1W8NA 4QX3A 3K77A 4GZ9A 1JYWA 1ULOA 3NRUA 1UY1A 3K4ZA 5C7GA 2W92A 2QQNA 2EIDA 1K12A 1XNTA 1OF4A 2BGOA 3I3EA 1SDDB 2J1EA 2VZTA 3VD5A 3SEPA 2CDPA 4AG4A 2W1SA 4PQQA 3MV11 4OUEA 4RYDA 1OH4A 3WF0A 3I2IA 3DYOA 2XONA 1CX1A 1T2XA 3EB7A 4AAXA 3WNMA 2BZDA 4LHSA 2VOTA 1CIYA 1GOFA 2W95A 3LPFA 3CZUA 4XUNA 2EIBA 3K4DA 4P02B 5G05L 1O8PA 4Z2AA 3FHAA 1TVGA 2HYXA 5DPNA 3LEIA 5FUIA 4A6OA 2QQKA 3CZJA 3ACGA 3T0AA 2WDBA 4A41A 4LKSA 2QQMA 3T2OA 3GXUA 3VD4A 4JKLA 4ZXEA 4L0PA 4UOJA 3CMGA 3T0BA 2W47A 4E8DA 1GNYA 1SG3A 2W91A 3HOBA 5EJ1B 1GUIA 3GDBA 2C4XA 3OB8A 4UI9L 1F4AA 5LA0A 5B4XA 1W9SA 5DN2A 1J83A 2J7MA 5C71A 4D0QA 2VZRA 2OKXA 2VQUA 4KWUA 4XURA 4CU7A 2VCBA 3HN3A 4A3ZA 3WQBA 4LQRA 1UYXA 1MPXA 3ECQA 4QB2A 1UXXX 3CIHA 3I3BA 5DQ0A 4GWIA 1EUUA 4M4PA 3WNKA 2W1WA 3VD7A 4BJ0A 3PUIA 2ORXA 1RYYA 2EICA 4JKMA 4OYUA 1OT5A 4DXTA 2YG0A 4DUVA 1EUTA 1O59A 2Y64A 4BDVB 4LPLA 4CUBA 1JZ4A 2VQTA 2BERA 4A4AA 1NKGA 1US2A 2DDUA 2ORZA 4W50A 2QQOA 1UMIA 3OG2A 3LEGA 4TTGA 2QBXA 1LNSA 4PT6A 5JR2A 3C7OA 4ZZ8A 1UYZA 3CDZB 1WKYA 4BK4A 2RJ2A 3P1IA 4M4RA 3LPGA 3VDCA 2J22A 2Y6HA 1UY4A 1W0NA 1XC6A 4PF1A 3WF4A 1GOHA 3GGLA 4CVUA 3EYPA 3J7HA 5JXHA 2V4VA 2JKXA 2E32A 2VMCA 5IFPA 2HLEA 2W1UA 3E1F1 2VMDA 2WAOA 3I2FA 2BBAA 3P6BA 3MUZ1 5HXMA 4CUCA 2VCAA 2VZOA 4DXSA 1OF3A 3I2HA 4HG6B 3LQCA 2RV9A 2YFZA 2EIEA 3AC0A 4QPWA 2J1RA 4P00B 2B4KA 4A45A 2KD7A 3WNPA 3DECA 2QQIA 1J84A 1UY3A 3FL7A 2YFUA 4QDQA 4MGQA 2E33A 1F4HA 3ACHA 3D3AA 3FHQA 5F7UA 4RN5A 2WZEA 3THCA 3W5NA 2XQXA 3IAPA 1H6XA 5IYYA 4QB6A 5JXJA 1CZSA 2ZEYA 2J1SA 1DP0A 2X05A 4UAPA 3C7EA 2W94A 3WF3A 3ACIA 2VMFA 3UETA 2WO2A 2Y6JA 1NAEA 3IDAA 3MV01 4XUTA 1I5PA 2J1VA 4ZZ5A 5JUVA 1ULPA 1DLCA 1JYVA 4JKKA 5C70A 3C7FA 2J1UA 3NNGA 3BN6A 1L7RA 4QDSA 2WN3A 3T2PA 1JI6A 1K3IA 3I97A 2W1QA 5LA1A 1JU4A 1KGYA 4JX0A 4DXRA 2YC2A 4DUWA 1NUKA 4OZOA 5EJZB 4OMDA 2JDAA 1UY0A 2J1AA 2V5DA 2YC4A 4MO3M 5HPOA 3OGVA 3UNPA 2R7EB 2DCJA 3LE0A 1UXZA 4TXWA 3WF2A 5CYYA 3C8XA 1KEXA 4P08A 2QQJA 3OBAA 3SKVA 4A42A 5JXIA 3I2GA 2Z4FA 4ARXA 3DYMA 1K42A 1R64A 4XUPA 4QB1A 1GOGA 2JE8A 1O8SA 2WQ8A 2Y6LA 4P5YA 3ACFA 1W8OA 2WYSA 1CZTA 1L7QA 2WO1A 3OEAA 2VCCA 1HN1A 4A44A 1GU3A 3T2QA 5CZKA 3SKJE 2WO3A 1W9TA 3T08A 2VR4A 2WBKA 1W9WA 5G04L 4QX1A 3K4AA 2XOMA 3A22A 1JYXA 1JZ3A 1OD3A 5DMYA 5IJRA 4CUAA 4BK5A 2VM9A 3VD3A 4MADA 3ABZA 3IIIA 1UYYA 1JZ8A 1GQPA 3I3DA 3I2KA 4XUOA 3MUY1 1UX7A 3A21A 4JHZA 3IAQA 2W9XA 4W4ZA 2VZQA 1D7PM 5LA2A 4ZY9A 1H6YA 4BXSV 2YB7A 2ID4A 2WZ8A 2WN2A 3HEIA 4GWJA 5A1AA 3T0DA 5B4NA 3U37A 2VTFA 4CU8A 2Y8KA 3C7GA 1JHJA 4KI5M 2Y6GA 1BHGA 4QX0A 1PX3A 2C26A 4W8JA 2VZSA 3BGAA 3VDAA 2ZXQA 4QX2A 5I0DA 3WNOA 1XPWA 4DEQA 3K75B 2LW8A 3WNNA 1TG7A 5JMOA 2W87A 1P8JA 1PMJX 3HJRA 2X10A 1NX9A 3MO4A 3OEBA 1K45A 1GMMA 2WAAA 2VZ1A 3GM8A 1CZVA 3CKHA 4XUQA 4CU9A 3OGRA 2V72A 3IB3A 1UZ0A 3NQHA 3VDBA 4FI9A 1PX4A 2ZEXA 2VO5A 3HNBM 2DCKA 3JXSA 4MGSA 3NJVA 3HNMA 1XNAA 1JZ5A 2VZPA 3F2ZA 5LCWL 2X09A 4D8MA 3W5MA 3VD9A 3DYPA 4YPJA 4DUXA 3A23A 2WABA 4E8CA
chains in the Genus database with same CATH superfamily
1JOPA 4TN7A 3AXDA 5CKQA 4XEZA 3N7MA 4XTPA 1X50A 4QX5A 1YXWA 3KV5A 3WF1A 5F3IA 5BXXA 2W46A 4OHYA 1CPMA 4N90A 1LU1A 2WNUC 1Y9MA 3CQOA 4K7JA 1KJLA 2JDKA 3J8F3 4RFRB 1O3TA 4JVAA 3AB0A 4LOTA 1ZRDA 4FSJA 4DEVA 3E5QA 4CDQB 4LBNA 3ZPOA 4CEWC 2VVDA 1VLNA 4BWOA 3JU9A 3GCWA 3NSTA 1JU3A 3PLQA 3VKNA 1YQ2A 1VBA1 3GJAA 2A6YA 1UOGA 2WA3A 3H7YA 4NIIA 1SPPA 1VJ2A 4XIKA 3V0AB 1UMHA 1VIWB 4UT5A 1ZBE1 5FZGA 1Z7S3 1R1A1 4JAAA 1C5IA 1WZXA 5AVPA 2BEOA 4M0NA 3S30A 3ZFFA 2JG8A 2YPJA 3PVEA 2C24A 4YZ3A 1CWPA 1OA4A 2R49A 4RS5C 1ZREA 2E31A 2ZZQA 4Q4X3 2HWD1 3AFGA 4HOOA 3DPRB 3ZSKA 2WL1A 3ZFGB 3L2YA 4PBPA 1C5HA 1OKQA 2HWB2 1WW6A 5IHRA 1O5LA 1W2NA 2RR11 3T1LA 4CPBA 3GZEA 5C3PA 4Y20A 4GD4A 1PVXA 4Z07A 1PNGA 1SFYA 4R4XA 1LGBA 4LJHA 5FPUA 2VPVA 3THDA 1RMU3 4LO5B 4XZUG 3A7QA 2HBTA 4K40A 2B46X 2C9KA 4EWAA 1HV1A 2FBEA 2Y60A 3WP4A 5IAVA 1GP6A 2FDHA 3CJXA 2XVGA 1DGRN 3FLTA 1IG0A 4UXAA 4B7KA 2WWUA 3FZ3A 4FFHA 2QCSB 1HRI2 4QX3A 1AX2A 1CIWA 4GZ9A 1ULOA 3NRUA 4IEYA 4OHZA 4BQ3A 4DPNA 4KWKA 3THTA 1HB3A 1Z78A 3AMPA 5GM0A 1FPN1 3RG0A 3D4KA 1S1AA 4UF0A 3WOGA 4B4QA 1EV11 1LEDA 5C8CC 5T54A 1M06G 5FZDA 1BXHA 3KHBA 4XCBA 1QJU3 5DAWA 1K12A 1LEMA 2QDRA 2YMZA 2XJPA 1LOEA 1W3XA 2ZCWA 4JGYA 1D0GA 3OGJA 4ISRA 2VULA 3IIAA 3CBNA 2BGOA 3H8RA 4MH0E 1W0PA 1Y3TA 2NMNA 3AJYA 2HEVF 3EHKA 5BNNB 2CDPA 3HBKA 4AG4A 4KL1A 1E5RA 1WW5A 2EAAA 3FMGA 4Q0QA 4JDOA 5CADA 4PQQA 2RS31 3MV11 3POBA 4OUEA 1D2QA 4FXGB 1OPOA 4RYDA 2QVSB 1OH4A 4RR3A 3FLPA 3TYJA 3WF0A 4EN8B 3IMMA 3GNEA 1OFSA 1CX1A 2IXCA 4NPLA 4DRRA 1QOTA 4QPIB 2E6VA 2BP6A 1OC1A 1U5XA 2R062 3WDYA 3LPFA 2BTVC 1EY2A 5A80A 5KBFA 3AMNA 2P34A 5GKAC 4XTMA 4UW6A 4XYXA 1QWRA 1TVGA 2HYXA 1ENSA 1VRH3 1NCRC 3LEIA 1K5JA 3FFZA 3IDEA 3LKJA 4A6OA 4RQPC 4CA9A 3ST7A 3ACGA 4OUMA 2WDBA 1RINA 2WIIB 4Y26A 3T2OA 5E16A 3GXUA 1XYPA 2OQ6A 1DQ1A 3VD4A 1NZIA 2AZ5A 4OZXA 1AZDA 1JHNA 4L0PA 5K9YA 1PVC3 1DDLA 2RJKA 1AL21 4GB32 1K5MB 4QXHA 1SFPA 3ZX7A 4UFHA 5F3EA 4FTSA 1G9BA 1IS3A 3RVHA 1ODNA 5E89A 3AP5A 1VBB2 1RUH2 3G7DA 5FJKA 4E8DA 2W91A 3CNAA 1PGL2 1LGNA 4XHBA 1NG0A 4Z8BA 1BK0A 1H2MA 1F4AA 5D8AB 2A3XA 1D4M2 2Q1MA 2VMGA 1C8M1 5GZDA 3RZKA 5I8SA 4PQ9A 1J83A 4QD2A 3UKNA 2G19A 2ZMLA 2SBAA 5FPLA 5J98B 2Y34A 2WNVA 3PUQA 2OKXA 4N53C 4QGLA 2VBDA 5IVVA 2XUEA 1Y43B 5FZ8A 1JS9A 4KWUA 4W65A 3ZXDA 4JGZC 2KM2A 1QXPA 3HN1A 2VCBA 4K20A 4XMIA 3D0JA 2JX9A 1HXS3 1C1FA 5T5JA 1YHFA 4COYA 1MPXA 3AZXA 3VBOC 3ECQA 4RD7A 4QB2A 4AHYA 4Y1VA 2R073 3B93A 3OYWB 3SHRA 1W6OA 5LY2A 1NA1A 4C1XA 2IFRA 2ZGSA 3T1MA 2BRTA 4J1WA 5BNOC 1FX5A 3KVBA 3OUHA 4M4PA 1RUI3 1MZEA 4AEMA 2RMU2 4BJ0A 2K2SA 2A6WA 1MACA 1V6IA 3ZMNA 2B9UA 1H8TA 3WCRA 4P9XA 4CDUC 1OURA 2UY9A 5GLZA 1OUSA 5GLUA 4OYUA 4COUA 2JG9C 3VDDA 5JLVA 3ENRA 1G9CA 4MX3A 4XF1A 5FY7A 4BYYA 4X6RB 5FO8B 2CGPA 1W6NA 3HWJA 3D8CA 1O59A 3OCPA 4JRAA 2Y64A 4XE9A 2NMOA 4BDVB 5HI0A 4Y4RA 2DFCA 1HB2A 2JDPA 1S0FA 2ZMNA 4CSWA 1COV2 4ZONA 1SFNA 4YYOA 2DUOA 2OUJA 1NKGA 4HVRA 2PAMA 2JXAA 3POJA 3NKGA 4HZFA 3W59A 1VBA3 4IE5A 2WA4A 1U5ZA 3VL9A 4JTOA 5GALA 5H9PA 3LEGA 3S5QA 4GULA 2QBXA 4MSVA 1YQ8A 4LULA 5JR2A 1ZBE3 5J37A 2E53A 5FYHA 2OA2A 1VAVA 2IXIA 1R1A3 4J6GA 4OHWA 1IHMA 1OMIA 3CDZB 3LZZA 4D7TA 5A3UA 3I49A 4LEJA 3SXWA 5SV8A 1YLLA 3LPGA 2ZPXA 4Q4V1 2J22A 5K4LA 2PHUA 1XC6A 2P37A 5IATA 3HBZA 5JSRA 2VTXJ 3VZLA 2DBIA 2NLRA 1JMUB 1GOHA 2XB6C 5EHDA 3WV6A 2HWD3 3GGLA 4AYUA 5IK8A 2QQVA 5JCTA 4CVUA 1SMVA 3PTRB 3TNQA 4BIOA 4XJUA 4NIGA 4YW7A 3WW1A 2VMCA 1I1EA 5IFPA 5AVAA 3VHPA 1C57A 3E1F1 2RR13 1FOD2 2B7YA 1PMIA 3P6BA 4Q4Y2 1RHI1 3ZIXA 1J3QA 3B02A 3MUZ1 1MEC1 4TYSA 5BNPA 1H2NA 1X33A 4CUGA 4JTNA 1BEV1 3LD8A 3WZ1A 2MEV1 1SACA 1AXKA 1YFXA 2GN7A 2VCAA 2MHFA 3NV3A 4IEUA 3PJYA 1W6MA 1OF3A 4XBNA 4RFT0 1DZRA 4HG6B 4BH9A 4BQWA 5DAVA 4QPYA 2GMPA 4YG6A 2Q0AA 3NNFA 4I2OA 4AQ6A 4EWDA 2J1RA 2WQZC 5FY8A 3ALQA 4A45A 5A32B 3VBUB 2GH2A 1NYWA 3IN9A 1DGWX 3DECA 4MVTA 5A7NA 1XRUA 4AWDA 5A1LA 2XXZA 4CDWB 5I8TA 5FAXA 1GANA 2VECA 4LHNA 1FPN3 2E33A 4XFFA 5LBEA 1EV13 3AVRA 4CEYB 1LKNA 2A70A 3FHQA 4AVAA 4RN5A 5FYIA 2R0FA 4IEWA 3THCA 4EN6B 2XQXA 4K9SA 4AEDB 3SMHA 5KHGA 4URAA 1KXGA 4WVVA 1ZZ6A 3ZYFA 2NN8A 1CZSA 1PIV2 1RL3A 5CFDB 1CD3G 4LO7A 4KG8A 2JE9A 3H50A 4FO9A 1V9U2 5FZ1A 1AXYA 2GU9A 1CESA 4XOGA 2RS33 5L7OB 4P5HA 2Y6JA 3GBFA 5FQ0B 2DCTA 5FDBA 1NAEA 3IDAA 3MV01 4XUTA 1C1LA 2J1VA 3HD8B 3DF0A 4INDA 3M3IA 1RUC1 1EP0A 2XG3A 1G6NA 2WNUA 2QQUA 3FFQA 3CLPA 2FDKA 1X7NA 2ARAA 3SITA 1ODMA 4NOTA 2GNDA 5BYNA 2WC2A 3I59A 4FOVA 4Y5TA 5JIUA 3NNGA 2J1UA 3B01A 3ILFA 1L7RA 4FFIA 4EZHA 2HEWF 3CL1A 5JAXA 2D3RA 3T2PA 2D5FA 4CEWA 5CBLA 2WT2A 2DTWA 2JDHA 1S0JA 2QFEA 3NNMA 4JX0A 1GWLA 5BPXA 4N7IA 1AR62 2Q4SA 1X8MA 1AVBA 1QJY1 5F5AA 4GXLA 5B2GB 4OZOA 5BUVA 1VALA 3B94A 3PURA 2J1AA 2YC4A 5ACA2 3HVDA 3CU7A 1AL23 2HEYF 2YV8A 1DYPA 4IV3C 1ULFA 4URTA 3RZGA 1W0OA 2R7EB 4NHKA 4RS5A 4CDXB 1UXZA 5EV7A 2JDUA 4QKNA 1S0GA 2BV4A 3WF2A 1NLSA 2V09A 3RWNA 5FPVA 3LA7A 5FUNA 4GMP1 1N1TA 1PK6A 2ZHKA 5IW0A 3KLSA 5A7PA 5GZFA 2PAKA 1I5ZA 1UOBA 2OW4A 3CO2A 4YG3A 1W3VA 5FOBB 1C8M3 4YW3A 5FP8A 4IQPA 2DVGA 1AL0G 2KA3A 2YYOA 3FBMA 2DVAA 2FD8A 5JSPA 2FMYA 1AR71 3KSCA 2GNBA 4C0HA 3ZDSA 1R64A 3PMSA 4MGZE 2EVXA 1GOGA 3POEA 2JE8A 3WLUA 1HN0A 4MXVA 4OQ9A 1DQ4A 3AYEA 3O12A 2V73A 4GJYA 4I3PA 1OVSA 1ZBA1 4E9KA 1BQPA 1WW4A 2WYSA 4AGRA 1ZA4A 4XIOA 3NWKA 3SQOA 4NHLA 2IXHA 1CR7A 5DUVA 4YW2A 2H0VA 3K48A 3P3NA 2VCCA 2OYZA 3E6CC 1NQJA 3JUUA 1GU3A 4Q1PA 1V6MA 2GP3A 5DZFA 3MLJA 5DAQA 1ND3B 2KR2A 3BODA 3JD71 3PVBB 1W9WA 1JODA 1CQ9A 1QF3A 1W6QB 2P3IA 4QXCA 4QX1A 5G04L 3SH4A 3VBFB 5C8CA 2XOMA 1JZ3A 4CXXA 4DINB 4ZKTB 1OD3A 4IV1C 5DMYA 4I02A 2AENA 2YBPA 1AR91 3DEMA 4BK5A 3C3VA 4F8AA 2P2KA 3BKZA 4PI0A 4QQPA 5L73A 3AYDA 3ABZA 1MVQA 4TZDA 1W2OA 2CTVA 4L9BA 1GQPA 3SNMA 1JOBA 2OZ6A 3I2KA 4WM8B 1DGWA 1OA3A 5FZHA 2YGMA 4JHZA 1UX7A 3A21A 3IAQA 4I30A 4B29A 2DTYA 5CA6A 4FFGA 4EJRA 3AK0A 5CG8A 5ANNA 1H6YA 4R4ZA 3H42B 1ZZCA 1OLQA 1W90A 3AFKA 3QCWA 2RDNA 2WZ8A 3R0RA 3VBRB 1FMD1 4KU8A 3H8OA 4AGVA 4Q0PA 3POWA 3T0DA 3KF5A 3ZFEC 3MIBA 1FNYA 2ARCA 4PLNA 2Y8KA 1W06A 2K0GA 1ULCA 5ERLA 4KI5M 1MZ5A 1NCRA 2PYTA 2VG9A 4AI9A 1OBNA 4RQPA 4WZCA 4DO0A 1TMF1 4Q4V3 3KZ4C 5DDJ3 2Q5TA 4B1MA 2TUNA 4BQ4A 3DUIA 4R9BA 1XE0A 4GH4C 2O14A 4CCCA 4DEQA 4NR1A 2WINB 3ZSJA 4K3UA 2A3YA 5JMOA 5K7PA 2OXBA 2W87A 4FPLA 3OOXA 1EAH2 2PN5A 1SPPB 3I4IA 4ZXKA 5DXDA 4KH9A 4R9DA 5A6XA 3WP3A 1RHI3 1HW5A 1F8VA 1MEC3 5I91A 3RZHA 5FUPA 1WCUA 3L2HA 3ZFFB 1BEV3 2JG8B 2RS51 2D6OX 2MEV3 2ZA9A 3ZN5A 3ZOIA 1TNFA 3IDBB 3OGRA 1OH3A 1NZCA 1UZ0A 3OUIA 1NE6A 4XZPA 4XXAA 2XDVA 5FP7A 4XAAA 1ZX5A 1VBC2 2OVUA 4IEVA 1PX4A 3RRDA 2Z2SB 2ZEXA 1ZNPA 3Q9OA 4LE3A 3I8TA 3NNLA 1OVPA 4LE4A 5IVYA 2VVEA 1XNAA 1TME2 4HL0A 4N53A 5FZMA 3ZR6A 1RUF1 1YCIA 2XBO1 4Y20B 2TEPA 4QU1A 3DYPA 3WR0A 4BB3A 1NXD1 4L8QA 3KVAA 4JGZA 4AHXA 4LT5A 3O14A 1DF0A 4E8CA 3U0ZA 2J1TA 5CIRA 2G4IA 3MIDA 4LR4A 4IESA 3VBOA 3WNXA 2YBSA 3WNLA 2AYHA 2B9VA 4QKDA 4YZ4A 5IK4A 2PLV2 5FY4A 3KGZA 5M0TA 5FZBA 2N7GA 2D7FA 3N9NA 5BNOA 5C6CA 4JDMA 3HQXA 1JZ2A 2ZAAA 2A5ZA 5FXWA 4CE8A 1IKQA 4JZRA 5EIYB 4CDUA 1POV1 2XHNA 2LS6A 4FAGA 5F32A 2BNMA 4UF0B 1GSLA 2I07B 2JG9A 2YHJA 4Q8LA 2CAUA 4WBBA 5JXGA 1RUC3 2VMEA 2WZR1 3O1TA 4NRPA 5KXCA 5FPXA 4KG0A 2JDYA 4JGYB 4LA2A 3ZXJA 3E5XA 5GJ6A 3ETPA 3S0MA 5L36A 4UFIA 1LOGA 1OHFA 1UZYA 1VMJA 5CU1A 1VBE1 5DG1A 5FPAA 2NYYA 3ZN6A 5I0RA 4IETA 1C8NA 2P6CA 5KXEA 5FP9A 3FE5A 2R042 2EXIA 4RR3B 3ZLIA 1S2EA 1HLCA 3MGUA 1SHWB 3IWZA 1E57A 1QJY3 1RJ7A 3GHMA 1IQDC 1I3HA 2LUWA 3J7NA 5T50A 2W3JA 2P3YA 2BGPA 2EF6A 3T09A 2CNAA 2F6BA 1VBD1 3ZM8A 3PUHA 4EWEA 3ZYBA 4TSVA 1OD5A 2PELA 3RYPA 2NM1A 4YW6A 1FV3A 1PO22 4H7MA 4KMQA 3ZYIB 5LY1A 2D43A 4JCKA 5CB7A 3AP9A 1LODA 2W52A 2CAVA 3LOIA 2UURA 1ZYBA 5C9AB 4NE9A 5HBAA 1SLCA 3VLBB 3HPNA 2RS12 4I0BA 1JZ6A 4GMP3 3M3EA 1EYBA 1OUXA 3M1HA 5K0UC 3EBRA 4OLLA 1ENQA 1Q8SA 3AXEA 2HWE1 2HWF1 4FTBA 2ZGUA 5IVEA 2R1BA 4QDRA 5FLJA 1W8FA 3IMNA 5D21A 2ZJCA 2RDQA 1OFNA 1UY1A 4XFIA 4DOUA 5J96B 3K4ZA 1BZWA 3HT1A 4J25A 1AR73 3MZHA 2JIJA 2QQNA 4QKFA 1CONA 4WVMA 3J8F2 3Q8EA 4QT6A 1OF4A 1ZBA3 4HXCA 1S0DA 3GYDA 4FCAA 1D0HA 5T5OA 4NIDA 5A33A 1YWKA 2BJSA 1UNBA 2BFUL 2P17A 5JPNB 5FYUA 3LF7A 5FZLA 1S0IA 1ASJ1 2HWB1 1F15A 1VMHA 2W1SA 2WNVB 3VZNA 1S0CA 1MS3A 1J3RA 3JD73 4LLFA 1Z7S2 1UO9A 3DYOA 5J3UA 4AL9A 2BOIA 5CVRA 2ERFA 5FYYA 2WKKA 1DQ5A 1T2XA 2GC0A 4LO8A 3WNMA 2CU5A 2QZ2A 1VP6A 1GOFA 1RUJ3 2WS91 2YGLA 4CCOA 4BQ5A 2I2SA 1AR93 4AR2A 1CAUA 4Q4X2 1IOAA 1MQTA 4ASKA 4NWVA 2JWPA 4LK7A 4NIHA 5F9TA 1W6OB 1UKRA 3WW4A 1NA1B 2QQKA 4K8FA 3NJYA 4JHTA 1S2BA 3VKLA 3WDWA 3TNPB 2QQMA 3UYJA 4W6WA 3O0WA 2VBBA 5FO7B 1H8TB 3NL1A 1FMD3 3P3PA 4Y1ZA 1RMU2 4E4ZA 3VDDB 4UOJA 4YFWA 2WJSA 3T4HB 4SBVA 4H2AA 4YVWB 2XL9A 4KWLA 4RHV1 1F5JA 1MS5A 1W6NB 2QKDA 2ZX1A 4P9IA 3T0BA 1XJAA 2W47A 4DMIA 1RUG2 2FCTA 4Y5Z0 3N7JA 5A7SA 1GUIA 3GDBA 5IVCA 1H1AA 1TMF3 4LBLA 4BE3A 4AQ2A 4XILA 4Y33A 1UKGA 1S0EA 2BNNA 5F5IA 4E27A 4V2WA 4MZUA 4S2FA 2D5HA 2IVIB 4AFCA 3R6SA 2VNVA 1IPKA 1YFUA 5LRSA 3ZYJB 4D0QA 4B4RA 2VZRA 4IV3A 4LIUA 3O1UA 1QJU2 4HSLA 2VQUA 1O4ZA 1BMV2 3BOWA 2XJSA 3O7OA 5A7WA 3TB0A 4XURA 3RWKX 4CU7A 2PHTA 4BPZA 2RS53 4A3ZA 4EN7B 3Q8AA 1REDA 3TEXA 4LHLA 1RUOA 3SCGA 5I0UA 3ON7A 4QHBA 3M4FA 2PAEA 1Q8QA 2JB4A 3KF3A 3OD4A 3H8UA 3QH6A 2BOJA 2Q30A 2XGXA 2WNEA 4HKWA 5DQ0A 4Q27A 4CCNA 2VXRA 3C2UA 4GWIA 4AI0A 2W1WA 1BLZA 4GB31 3VD7A 3V56A 4E2GA 1RUF3 1VR3A 2XBO3 1WMFA 5BNPB 5ANQA 3B3QE 3ZKYA 2ORXA 5FR3A 4QX7A 2JE7A 4PHZA 1IG3A 5GZEA 4GKYA 2XPJA 1RYYA 5HCHA 5F1RA 2P5BA 1VRH2 1W6MB 4GMP0 4I0WB 3S7IA 2B8MA 1RUD1 3PNAA 4WZFA 4BLJA 2B45X 3ETQA 3R05A 3VGIA 2G1MA 5FY5A 2ENRA 3MI8A 4YVSB 3RI8A 1JZ4A 3VKOA 4M3CA 1T6BX 3LB9A 1CAWA 5C4WC 1RXFA 1X82A 2D3SA 2H0BA 1RGSA 4L11A 3PU8A 3ZXKA 1PVC2 3ZYRA 1KRIA 3X29B 1US2A 2DDUA 3NMBA 1NY72 4E4SA 1H9PA 3WY6A 2QQOA 2GAUA 4IV1A 1POV3 1Q8VA 4Z82A 1J59A 1KQRA 4NJ4A 5LATA 4IERA 4DNYA 1Q43A 4FPOB 5FKCA 3PVNA 4IEXA 3JQXA 1XOYA 3KCCA 4D3WA 2WZR3 1UYZA 1WA4A 3U78A 3UGGA 4O9GA 5F2WA 2WLQA 1WKYA 1OI6A 2VAUA 4LUMA 4QHZA 3WDXA 1XXNA 2RJ2A 4M4RA 1HDKA 4XJ8A 2WWJA 2AC1A 1ENXA 2DBNA 2VQAA 2Y6HA 3WP6A 4D7SA 1W0NA 4E4HA 1VBE3 2VTXA 3B9CA 3JBG1 2BNOA 5F5CA 4WVWA 2RMU1 1PGW1 2R6QA 3N3HA 3J7HA 3VZKA 2HYKA 5FRAA 2W1UA 4ES9A 1PGSA 3ZFEA 3I2FA 4PIYA 2AUYA 2WNUB 1VBD3 1XU1A 1HXS2 2UYAA 4CYDA 4D69A 2BYVE 4N9IA 3ZMOA 3I59B 4P9LA 2G9FA 3PDQA 2R072 1KS4A 4DY5A 2LTNA 4P9GA 3V65A 5HV0A 1IS5A 1OQEA 2RV9A 2YFZA 5FZ9A 1MVEA 4GH4A 3VHRA 4CEWB 3AC0A 4MG2A 1LHUA 3ITQA 4QPWA 4GIQA 1RUI2 1V6OA 2TNFA 4P00B 3VB9A 5CFCC 3POIA 5BY5A 1QY4A 3I3MA 3LDBA 1O3QA 1V00A 2W0XA 2B4KA 3PUSA 4K1YA 2HWE3 2HWF3 4Q0VA 1XE8A 4LKDA 1ULDA 1WLDA 3H3LA 3KHCA 1WBFA 2QQIA 3FL7A 2YFUA 4QDQA 1LR5A 3D3AA 4RS5B 5F7UA 1L7LA 2WZEA 3W5NA 4H3WA 3TBDA 4LXLA 4AI2A 5JXJA 1XBFA 2XQRA 4B8EA 1PK6B 2FZ1A 3N35A 2ZEYA 4BA6A 2J1SA 5KHHA 3A0NA 1W39A 5FY1A 2ILMA 4AHZA 4QQ2A 1UOJA 3KQRA 3Q8BA 4FPCA 1ASJ3 2HWB3 1O3SA 1VBA2 2A6XA 3WF3A 5L19A 2ZX2A 3CJIC 5LBBA 1W2TA 1AYM1 3POGA 1QH6A 2DCZA 2WO2A 3RJRA 1XSQA 1ZBE2 2ZS6B 4Q5OA 4C0BA 1R091 1R1A2 4RL7A 1OOPB 5ABJC 3RZJA 1WA6X 2GNTA 1DLCA 2QQWA 1SLTA 3DXUA 3ILRA 4XJ9A 1JYVA 4OFGA 2VUCA 1AXZA 5KWRA 5FZ6A 1GZTA 2WS93 2ZHMA 4ZS2A 1RITA 1UPIA 4Y1XA 4XF3A 5IVJA 3C7FA 4Q8KA 2HWD2 3BN6A 1TQ5A 3R4DB 2WN3A 2JIGA 4YFZA 2ZKLA 1K3IA 4CP0A 2FDIA 1RUE2 2BWCA 4EV0A 3BPZA 3H3ZA 4NRQA 1CAXA 1KGYA 4YSFA 2RR12 5LB6A 5I8YA 1JYCA 5FZ4A 2RDRA 5C8CB 2GMEA 3LAGA 1H4HA 4UW4A 2VOXA 1IS6A 4AE2A 3APBA 3K51A 2NP0A 3TEZA 5EJZB 3B9IA 2XH6A 2ARBA 1UY0A 3I2DA 4OMDA 3V64A 5A1FA 5HPOA 5FZ3A 4HFSA 1WD3A 4NROA 1GNHA 1HQLA 4D6QA 1GZWA 5GZGA 3UNPA 4AZZA 1ZM1A 1FXZA 1LRHA 2E9QA 1QNWA 1DQ6A 1YJKA 2ZGLA 3H0OA 4KNCA 4YARA 3MIEA 4RHV3 3NW4A 1LHWA 4X8NA 3UJOA 2EA7A 1DG6A 4TXWA 3A4UA 5CYYA 3USUA 2IZWA 4Y3OA 5CISA 1POV0 3NAPC 2QNKA 4META 3ZXEA 3USSA 4AVBA 2EXJA 4YM1A 3WDVA 4EN0A 4G4FA 3RPQA 1X9TA 1RVF1 5JXIA 1UU6A 1ND2C 4ARXA 1FPN2 2YPDA 5F3GA 3TN91 3O1RA 1QQP1 1RUNA 3N9MA 3DYMA 3SISA 4OI2A 4AQTA 2VOVA 5FJHA 3HR9A 4XUPA 1O3RA 5FYSA 4N7UA 3SH3A 3VL8A 1NCRB 4AEDC 4COVA 1POQA 3UJQA 5FMCA 4RQPB 4ATEA 5HCBA 4LBJA 4BQXA 5K0UA 2WO1A 1KITA 2ZX3A 2D6KA 3GJBA 3OEAA 1KFUL 2TBVA 1LCLA 4A44A 2RS32 5I0TA 4QPGC 3I54A 4F3JA 2OQ7A 3MF6A 5CZKA 3UKVA 1W9TA 1CPNA 2JDMA 1LOFC 1V6LA 5FTTC 5DDJ1 2BDRA 4QQOA 4AF9A 4GB33 3E6DA 1GZ9A 4MHUA 4UBGA 2HWC1 5AC91 3EJKA 3SCFA 3LEMA 4DIQA 2YDEA 1I6XA 1OXCA 4XJAA 3NO8A 5FOJB 4CUAA 2VM9A 3T30A 1NOVA 2Z5WA 1RUD3 1X36A 3G6JB 4Y24A 4FPHA 2XLGA 1JZ8A 1W8ZA 1H8VA 3AP7A 3I3DA 1YIFA 1OLME 2H6BA 4AFDA 1JYIA 4MXWA 3MUY1 3PHMA 4YZ2A 2W9XA 4N53B 1GYKA 1W9FA 2PFWA 2RM21 1NLRA 2GSYA 2D6MA 5H9RA 1WWYA 4JRLA 3K2OA 3NKTA 2EALA 1AL22 4K21A 3AZZA 3VBHC 2ARXA 4JGZB 5KR7A 4R9CA 4CCJA 1AJKA 3HAGA 4OHXA 1YJLA 3VBOB 2VTFA 4CU8A 3GALA 4HT1T 3C7GA 5DUUA 5K8SA 3ZSLA 2Y6GA 3O0VA 1BHGA 1LULA 5FPZA 1Y9GA 4XDPA 5BNOB 3I2OA 1C8M2 1YFWA 4XCAA 4LKFA 1SLBA 1G9FA 1YQCA 2V5YA 4LA3A 5EJ3A 3VDAA 4B4PA 1BYHA 3U07A 3JBG3 4V2VA 3WNOA 4YW1A 2RMU3 3K75B 4TLFA 4CDUB 4ASMB 3J4UH 3KMHA 3WNNA 1RJ8A 2F4LA 3MIGA 1GZCA 2JG9B 1UYPA 3HJRA 1NX9A 3MO4A 1Y4WA 2XR4A 4KBZA 4XQDA 4WM7C 3ROUA 3BTAA 4AHWA 1JUHA 3M7AA 3ZXGA 1R081 4UBHA 3AKQA 4WV8A 5KHIA 5GLWA 1QMJA 4CP9A 1TE1B 4ISQA 4OCTA 1QH7A 4QGNA 3ZN6B 5BNQA 1CVNA 1R1ZA 3RSJA 2VO5A 3ME2A 5IK7A 2PHLA 4EN9B 2YZ4A 3BALA 3NJVA 4CTEA 5FWJA 2BUKA 1JZ5A 5ISLA 1IGOA 4JQRA 5LCWL 3OBZA 4NHMA 4D8MA 3W5MA 1QXRA 4AFBA 5T52A 1AYN2 1RB8G 3KWVA 1LOCA 3AP4A 3WDUA 4XF4A 1YIPA 2VH9A 3KQ4B 4XABA 4BIFA 4XACA 1W6PA 1Q8PA 4OMCA 1UY2A 2LALA 1N1YA 5LW9A 2D6PA 2ZEWA 1Y9QA 2DF7A 4NUBA 5IFTA 2OT7A 4Q4W1 4YRDA 3OGGA 4ZPIA 4RSUA 3ORJA 1W8WA 2IXLA 3AZVA 5GLTA 2VD7A 5FYVA 3U11A 3ACLA 2VZUA 2ZHLA 4YG0A 3WG4A 1AYM3 1O5UA 1HQNA 1ZRRA 1W8UA 4UFMA 4XC9A 3BUCA 1KS5A 1R093 4M3CE 2RVAA 4WVMB 2LROA 2PQSA 2VZVA 1JZ7A 5A6ZA 4IUGA 1SDWA 2E26A 5A33B 5JZGC 2WUHA 5FV3A 1DYOA 5LEKA 4R8HA 4ET7A 4AQSA 5C4WA 1TME1 2OPKA 1LECA 4YGCA 2VL4A 1YQ5A 1J1LA 4HK9A 4UFJA 2FDGA 3WEZA 5A6YA 3LDRA 4I09A 2CSGA 5L9VA 2BBVA 5J1XA 1RHI2 3SEEA 4E2QA 3NJXA 1MEC2 3HNYM 3ZN4A 4E2SA 1AJOA 3HIFA 1BEV2 2E51A 1UWWA 1PMHX 3OGSA 1VE0A 4PDWC 2Y6KA 3Q8FA 4AI3A 4OUSA 1QJX2 2QZ3A 1MQTB 1NE4A 4O61A 5C5TA 2VZ3A 3KD4A 2R30A 2ADDA 2FZ2A 2WSVA 3ZXFA 1RUJ1 2V4AA 3MLKA 1V9U3 3KGLA 5KXDA 3FBYA 1VPHA 1HRV1 1X9PA 3EQEA 5IVBA 3UKTA 4XMAA 3FUOA 2VBPA 4M00A 5IUQA 4BQ2A 2IWGB 1RVF3 3E6BA 3LEKA 1W8NA 3BOPA 3K77A 4EE2A 1JYWA 1HX6A 2AH2A 3I7DA 3MW2A 3TN93 1QQP3 5T3NA 1U0AA 4F83A 4IXLA 5C7GA 5FREA 2W92A 4QU2A 3DXTA 3S7EA 5FYTA 2EIDA 1KDKA 2CWMA 4XQWA 4K6BA 4YW4A 1A6CA 1OQ1A 4AVSA 2Z79A 5CFCA 1LGCA 3H9AA 2A6ZA 1FV2A 1FATA 4D6RA 2VZTA 5DZGA 3VD5A 3SEPA 2Q8OA 3VBSC 1H1IA 4R9AA 4XDOA 4XAEA 1AR82 1GR3A 2B5HA 4IV3B 2ZGNA 2JEMA 3DN7A 1BJQA 3N9OA 3N9LA 4LTAA 5LEJA 3POYA 1JH5A 3WUDA 1RUC2 1E5HA 2XJRA 2XKPA 2HJIA 1B35C 1SCRA 2HWC3 3EB7A 4GA9A 2BZDA 5A7WB 5AC93 4LHSA 2ZKNA 2W95A 3CZUA 2BW8A 3K4DA 3J26N 2PHFA 3RZMA 2O0OA 2WSUA 2WT1A 4GQ7A 4S2HA 4Z2AA 3FHAA 4O65A 4LNVA 4AI8A 5JOXA 5DPNA 4CP1A 2DVFA 3RDIA 3CJIA 1V6JA 3ASIA 1W2UA 4N9HA 1WLCA 2PA7A 4XW3A 4RR3C 1QJY2 2VW1A 2QTWB 2RM23 3PIGA 4LKSA 4UW5A 3MIFA 1A8DA 5FY9A 2GNMA 2JDZA 5ABJA 3JZVA 2WNOA 4ZXEA 3M3QA 2CWSA 2DVBA 4M0HA 4LBQD 3D5OA 1DZQA 4HK8A 3UL2A 2A73B 2R0HA 4PJYA 5C9AC 2VOKA 3N9PA 4GWNA 1SG3A 4ZU5A 2ZTNA 3HOBA 4HPKA 4BU2A 4M3CB 4G9SB 3OB8A 1CAWB 4UI9L 4QHOA 5A3PA 5B4XA 3INAA 3PVOA 3ZXAC 1W9SA 4XXPA 5DN2A 4K1ZA 5FLIA 4IV1B 5C71A 1H2KA 1AR72 1ENRA 1S2KA 2C9AA 4D7YA 1XQNA 5FMOL 3IBMA 1YFYA 1DGRA 3BIWE 4U2AA 5KHKA 1JOJA 3ZXLA 1S4CA 3IZOA 1RC6A 1N3OA 5JIAA 3CF6E 1ZBA2 3WW2A 5FYZA 3WUCA 1MS8A 4N43C 1LENA 4FPFA 1UN1A 2VU9A 3HN3A 4I0AA 4J1XA 4TWTA 1JBCA 1R083 3MHZA 5LA9A 1W28A 4UWDA 3NAPA 2WFF1 4Q2FA 1V0AA 4BCUA 2C6SA 4QGMA 1UXXX 3OSDA 4HKLA 4P9WA 2DVDA 3CIHA 3JD72 4S2GA 4AK3A 4DFSA 1ND2A 4H7LA 5FXXA 5FO9B 2DFBA 1GBGA 1LJ7A 4AAPA 2KXLA 3WNKA 1PO11 2VY0A 2C1FA 2D3PA 3PUIA 3ZFEB 2P1BA 4FFFA 4EZ4A 2D6NA 1AR92 4FPYA 1BBT1 4XJWA 3ZKUA 4AEDA 4HONA 4GJZA 3OPZA 1STMA 3R4SA 4ONUA 4HN1A 3ZVXA 1RUG1 2EICA 1NCQC 1JUIA 5FZKA 1OT5A 3WD5A 4BXFA 4CCEA 2YG0A 3E97A 4DB5A 3MFCA 4HMZA 3OBRA 4GH4B 3AP6A 1EUTA 2I45A 4YLZA 2WFPA 4QPGA 3W21A 4ZHNA 1CX4A 3KM5A 1HB4A 4LPLA 4LO6B 4CUBA 4Q4W3 2JJ6A 1CN1A 1G7YA 1LOFA 2BERA 3VKMA 4AGGA 4ZS3A 5FQ0A 2I74A 2VQ0A 5LBCA 2GC2A 5J7MA 2PHXA 3OUJA 1FMD2 5HCAA 4W50A 1TEIA 3SCHA 4FQZA 3ZR5A 5CAZA 1B09A 3HMYA 4BOWA 2AGSA 2DU1A 1U5YA 2PHDA 3NV2A 4TTGA 1UPSA 4Q0SA 4IE6A 1NT0A 1LNSA 1UMZA 4HLTA 4XBLA 4YVWC 3C7OA 3PJQA 4CCDA 2ZGTA 4ZZ8A 2YBKA 2X5IC 1TMF2 4QPIC 4BK4A 3POFA 5C3RA 2RG4A 5C8WA 4YWAA 4XFHA 3P1IA 3J9SA 3VDCA 5BV6A 1UY4A 2Y0OA 2P3JA 4PF1A 3TRSB 2ZZJA 1V6NA 3ZYGA 3WHTA 3WQ7A 1TME3 2FQPA 3CHXA 4FBFA 1WCSA 3O5SA 2E63A 5IVFA 1SLAA 3EYPA 3VBHA 1GKBA 1N1VA 2G9ZA 5JXHA 2V4VA 2DWRA 3GF6A 2E32A 4FPGA 5KC5A 4GWMA 4CDQC 4ORFA 2GC1A 1M4WA 4ATFA 2PQQA 5HXMA 5JI9A 3GZAA 2RS52 4PBOA 4XDQA 5JDBA 2GN3A 3O1VA 2XLAA 1GP4A 2ZX4A 3RZLA 3AZYA 3GHNA 1OLMA 3LFIA 3S6PA 3I2HA 4DQAA 2HH9A 2A75A 1C3HA 2YXSA 5EYYA 3KT1A 3GCXA 2FDFA 4BMBA 3PU3A 1OSGA 1W2AX 3WCSA 3AMHA 1RUF2 1HRV3 2MPFA 2XBO2 2FDJA 2LRPA 3RFRA 2KD7A 2ZAHA 1DQ0A 3DPRC 4COWA 2CGNA 3ZFGC 1VB4A 4WM7A 3MW3A 4NO4A 4Y22A 4AXOA 1WD4A 1HRI1 1J84A 2QUOA 1GZWB 1OKOA 4DXZA 2IUWA 3O0XA 2EXKA 5C3OA 2W39A 1QOSA 4DZGA 5F37A 2VVFA 4QM9A 3KV6A 5FY0A 4HKOA 4HVOA 4QWNA 1H6XA 3LDKA 3USUB 5IYYA 1LHOA 3BTXA 3LFMA 1XU2A 1O6UA 4V1PA 4YVSC 2VOWA 3S57A 2IFWA 4X6QB 1DP0A 1KD7A 2WLPA 4UAPA 5DG2A 1DZTA 5T5LA 3V0BA 1OA2A 3NV4A 5A3OA 1LU2A 3QACA 1QU0A 1DYKA 1C28A 3AJZA 1XNCA 1AX0A 1GWKA 2JDNA 3U4SA 3FUQA 1I5PA 3EXUA 1IS4A 1MR5A 2WZR2 2FHRA 2OPWA 4ZZ5A 1PO23 2P4EA 1HB1A 2XJUA 4KBBA 4S2DA 1QOOA 3T4VA 1Q56A 2QJVA 2Y6FA 3LGRA 5FCCA 2R061 1VBE2 4NAMA 2D6LX 5L9BA 3ZO0B 1QXJA 2NPIA 1O4TA 4QDSA 4AI1A 3RJ2X 3AKRA 5IK5A 2W1QA 2Y0IA 5LA1A 1HV0A 4LOSA 3BI3A 3AVSA 4A2UA 1JXNA 1SBDA 4PIZA 3U1XA 2BWAA 3WP5A 5FZ0A 2YUEA 1VBD2 4DUWA 5BNNC 2VNOA 1G9AA 3WG1A 2JDAA 3DCQA 5A3WA 4IEZA 1IPSA 3OGVA 5JZGA 4ZU4A 3RYKA 2DCJA 4JDNA 1PM4A 1T6GC 2WT0A 4MXWB 1VBB1 4MLOA 1RUH1 4P08A 5E8AA 2W2IA 5FPBA 3T2TA 3UK9A 2HWE2 2HWF2 3B69A 3F95A 1PGL1 2QQJA 3OBAA 3SKVA 1VRBA 3JB4C 3KV4A 2GZWA 1A3KA 1D4M1 1QEXA 2Z4FA 4ASLA 3WHUA 2CGOA 2P6HA 2ZGQA 1XE7A 4PI2A 4Z2WA 4FAHA 1BK1A 1K42A 2W68A 4PDWA 4A3XA 3AX4A 3WVJA 2EIGA 1L3JA 1VAKA 2AEYA 3GZTB 1O8SA 4C1WA 4CCLA 2G9GA 3E5UA 4H14A 3UGFA 3URFA 1Y7BA 5FLHA 2Q1FA 3ZYPA 3NVCA 1W8OA 1K5MC 2GALA 3JB8A 1UIJA 1PK6C 3OY8A 4OHVA 1RUE1 5LWBA 4LBKA 4B7EA 1ASJ2 4B3NA 1A8MA 1L7QA 1VAMA 2WFF3 5DUWA 5GZCA 5FZOA 3O1SA 5L9RA 4XPVA 1S55A 2F17A 5E6HA 1CAVA 2WO3A 2RE9A 3U75A 2WBKA 4XFAA 5D8AC 1PO13 3IDCB 3K4AA 1OOPC 2GC3A 4L99A 5DZEA 4U36A 2WS92 2XJTA 5EZWA 1BBT3 2ETEA 5C3SA 4LUKA 5IJRA 1RUG3 3PUAA 4FOWA 3W58A 1WMEA 3VD3A 4CP9B 3FX3A 1D4VB 1WMDA 3IIIA 1UYYA 2ZX0A 1O7FA 3ZSEA 3ES1A 3NJZA 3VBSA 4AW7A 3U14A 3U4XA 2XUMA 1YNAA 2C5DA 3MPBA 3U10A 5A3TA 3TEWA 3D6EA 3VKFC 5A3LA 4XUOA 5KC6A 3BCWA 5FZEA 2XMLA 4XFBA 4A7YA 1DBNA 4W4ZA 2VZQA 1D7PM 3BPSA 1EPWA 4BXSV 1LOAA 2YB7A 3LSDA 1COV1 1B35A 2ZOEB 1UOFA 5CG9A 4LK6A 4BMEA 2WN2A 2CY6A 2X8KA 5A1AA 3ZDVA 3VZMA 1Q8OA 2YROA 1W6PB 4RHV2 4CXWA 2GH8A 1GNZA 4FVVA 4Y5SA 2Y26A 4COZA 3U37A 2XHKA 3B00A 5EP9A 1JHJA 5SV5A 5FBZA 1UD1A 4QX0A 2R1DA 3IPVA 4W8JA 4NIAA 3IM0A 4L97A 3CEWA 1H4GA 3BTZA 5I0SA 2VCMA 4QX2A 1XPWA 4KGGA 2RDSA 2LW8A 2ZABA 3VZOA 3WDTA 3AL5A 1JW6A 3M2MA 1UZVA 4IE0A 1PMJX 1MZ6A 3DKQA 4HSJA 3KV9A 2X10A 2CYFA 5FZ7A 1GFF2 2RHPA 4PF5A 4UW3A 4IDZA 1SLLA 1GMMA 4CXYA 1FOD1 4Y1YA 2VZ1A 4Q4Y1 5C9AA 1TNRA 1CZVA 5JPMB 3LWCA 3CKHA 1UU4A 4D6SA 2ZBJA 2ZACA 3J7MA 4CU9A 1UIKA 3RMXA 5FMDA 1WCKA 4AOCA 3NQHA 5C4WB 3VDBA 3GZUC 4JQTA 1A34A 4QXBA 4JC1A 3HNBM 2DCKA 4P9JA 4AVVA 4OVEA 1E5IA 2P3KA 3HNMA 2YY1A 3WXPA 2B39A 1PZ9A 5FXVA 2VZPA 3F2ZA 1FYUA 2X09A 4P9YA 4CP2A 3B5LB 2XWJB 2EXHA 1FI2A 4N8MA 4XHXA 2Z69A 2Q1ZB 5EQUA 1HRI3 2QQLA 4N43A 1RUD2 2JD9A 3I3QA 4EQVA 2VC9A 4NN0A 1SCSA 2JENA 3ELNA 5F5QA 3MBWA 1FT9A 1SZBA 2ZMKA 5IWFA 3WT3A 1VMFA 5AFBA 2L9LA 1AX1A 5FKBA 1W99A 1N47A 1PIV1 1ULGA 2IXJA 3L9JT 5F6LB 2GMMA 5J09A 2BGCA 4BLIA 2VMIA 2DCYA 4MOAA 3RS6A 4FOQA 2O8QA 4LBQA 4LMFA 1V9U1 3T3YA 1GQHA 3QD6A 5CEHA 4PCRA 3O1OA 3B7MA 3PL0A 4A7KA 4OULA 4QQHA 3C7HA 3SH5A 1NCQA 5C3QA 4MUVA 4XFGA 4FPEA 2W5FA 4FQ4A 3VBUC 4PLMA 2D44A 3AYAA 4CU6A 3ZYHA 4CDWC 2UY8A 1EV12 2DU0A 3K46A 3LA3A 4MV2A 2R063 4NPRA 3SLIA 5CFCB 3ILNA 3JBG2 2ZGMA 1H2LA 4CEYC 1WCQA 2CDOA 5EYXA 5FZAA 4BM8A 1PGW2 3OJBA 4FT8A 4QAWA 4LIVA 3QH7A 2PMWB 2A3WA 1SBEA 3N9QA 4G3YC 2BVVA 2C0ZA 4QMAA 4LHKA 3FLRA 1AYN1 1REFA 4SLIA 1NXMA 2BVBA 5E88A 5CFDC 1G86A 4YM0A 3UESA 4Q0UA 4H55A 2WYFA 1W8HA 2YU2A 4NHXA 4YVWA 1AR61 1C4RA 3HT2A 2ATFA 3WINE 4YM3A 4XVHA 4ARYA 1HJFA 1YYNA 3LIHA 2X5IA 5L7OC 1UU5A 4QPIA 3FN9A 5FZFA 4R52A 4IW3A 5ACA1 1LHVA 1H1MA 5CKNA 1RXGA 1CJPA 2ZEZA 1WLWA 5EWSA 2UWAA 1ALYA 1QHDA 3OPWA 4BQYA 1US3A 1OPMA 3BB6A 3CJIB 1A78A 3HQUA 1HIXA 3WSOA 1VBB3 4I3GA 1RUH3 3I2JA 5T55A 1AHSA 5J36A 2VJXA 1Z0HA 1YO8A 2BQPA 2D40A 5DABA 4CDQA 3D82A 5F8PA 2JD4A 3AMQA 5ABJB 1JYNA 3UT0A 3DL3A 1D4M3 4NWWA 4W6YA 1KJRA 4KU7A 1MS1A 1V6KA 2DURA 3WQ1A 1LOBA 2ZHNA 1WBLA 3AM2A 3H1WA 4LKEA 3V0AA 2Q8DA 1O91A 5JOYA 4FP3A 1J1TA 3Q8CA 3LA2A 3RMYA 3H8XA 1XNTA 4HPKB 1QDCA 5IT6A 1RUE3 3N7KA 3A0KA 3I3EA 1SDDB 2J1EA 2HBUA 1GLHA 4O9EA 4CDXC 1APNA 5LZ6A 3KCYA 1IKPA 1AYM2 4GKXA 1ST8A 4L2NA 3DPRA 3HQRA 3ZFGA 4A7ZA 3K3NA 3VZJA 1R092 5LASA 3MFAA 3I2IA 1XNKA 1QNYA 2DUPA 4MGIE 2XONA 3FC0A 4QQLA 5A7QA 1QJX1 5EPAA 4AAXA 5LBFA 1W04A 2VOTA 1CIYA 1XYNA 5FK7A 1J3PA 4XUNA 3D0SA 2EIBA 3AKTA 4YVSA 4CRQA 3NAPB 4P02B 5G05L 4NAOA 1BMV1 1O8PA 4XETA 4RGGA 2UYBA 4AVTA 2D97A 2E7AA 5FUIA 4Y1UA 1I9RA 2HKXA 1ND2B 4BISA 4CCMA 1W03A 3CZJA 3RZZA 1MS0A 5H9QA 3T0AA 1AUYA 4A41A 4TLGA 3TAYA 1ACCA 1OQDA 5F3CA 1COV3 3O1MA 4JKLA 3M3OA 1F31A 3ZPYA 1S0BA 3J7LA 5JI7A 1ND3C 4AEJA 5J48A 4EYUA 2ZGKA 3DV8A 5FZIA 3CMGA 3VBFC 1H0BA 1WLTA 1MQTC 3W20A 4C90A 1RIRA 5A3MA 2CL2A 4QPGB 3PTYA 1GNYA 4NHYA 4M01A 2VUAA 4D94A 5EJ1B 1PNFA 1AR81 2C4XA 2JICA 5FP3A 1RVF2 4MGTA 4YM2A 5LA0A 2OX0A 5BNNA 4MGKE 2QDNA 2J7MA 3TN92 1GV9A 1QQP2 4W6XA 4WM8C 2PHRA 3M70A 4HVQA 1UX6A 2CV6A 5F2SA 3NV1A 1SLIA 3WG3A 4HBNA 3H3UA 1EAH1 4EROA 4YZ1A 3DGTA 2ET7A 1RTVA 1UAIA 1FOD3 1YEWA 4Q4Y3 4LO4B 2Y38A 3VBRC 1BVVA 4YNIA 1UF2C 3MF9A 3NNJA 1PHMA 3WQBA 4XF9A 4CPBD 4LQRA 1JTZX 2WRAA 5LRRA 5A6QA 5FP4A 1UYXA 3LSEA 1H9WA 1ULEA 2Q8CA 4DRVA 5JOWA 1PZ8A 3VBHB 4Q4V2 3WW3A 3MPPG 1CJDA 2A7AA 3VUOA 1VBC1 1IPJA 3I3BA 1BKZA 5DDJ2 5KXBA 3QBQA 1EUUA 1VB2A 2HWC2 2JECA 2UU8A 5AC92 2XJVA 2WO7A 4AFAA 3EMRA 4Z92B 2E7QA 3ES4A 5F39A 3N7LA 2VMHA 3FWEA 2D93A 3BVCA 1UZWA 1K5MA 4JKMA 1UCXA 3BTYA 5JOZA 1DGLA 4DXTA 4DUVA 3POSA 3VHOA 1GWMA 4LBOA 2MEV2 3TWIA 5HXVA 5CNAA 3ZFFC 2JG8C 1CAUB 2IVJA 2RM22 3JCIA 4FOYA 1ZA7A 1BCXA 2PLV1 2VQTA 2XVKA 3M3CA 3OPTA 4DS0A 1PIV3 1FAYA 4HETA 5D8AA 2DYCA 5FWEA 4A4AA 2BU9A 5JVVA 4FTEA 1OOPA 4Q26A 4LITA 2A71A 2ORZA 4WM7B 4Y22B 2PXJA 2ZGRA 3P5BA 2WZPP 2IXKA 1UMIA 3OG2A 2OUHA 1ZZ8A 2MNGA 2VUDA 4Y4YA 1HKDA 4PT6A 2QE3A 1F9KA 2CHHA 1X8EA 4IE7A 1UW8A 1UQXA 3WF4A 1XB9A 5FFOC 1XNBA 3OYWA 3V0BB 4LORA 4K8RB 4UYBA 2K9ZA 2GP5A 2VGDA 1QKQA 1AYN3 2JKXA 3FJSA 1QJEA 2ET1A 4A6SA 2R041 4F7ZA 2HLEA 1YRZA 4JV4A 3THPA 2VMDA 4YGEA 1MS9A 2WAOA 2BBAA 1AR63 5GLVA 3LCPA 1R082 4BQ1A 2XL7A 4E4DX 5DAXA 5AFEA 4AVCA 2WWSA 5EFUA 1HQWA 4CUCA 1V70A 5ACA3 2VZOA 4DXSA 1N1SA 1PO21 2ES3A 5LK5A 1TZOA 3LQCA 2NQYA 1W9YA 1XNDA 3VV1A 2JB8A 2EIEA 3BU7A 3DKWA 2LM3A 4YGDA 4JGYC 3VD9A 5I93A 3N36A 3QOPA 5A3NA 2OZJA 2RS11 1LHNA 1DHKB 2PHWA 3WNPA 4AFMA 3KT7A 2F4PA 1UL9A 4KGQA 5HV4A 3R4UA 2VXJA 1GP5A 4IEPA 1PZ7A 1UY3A 2B42B 2YU1A 5EXOA 4CCKA 5JZGB 4MGQA 1W05A 5FMOS 1F4HA 2OS2A 3ACHA 4YGBA 3RYRA 1N3QA 4XBQA 4GAZA 4NVPA 3IAPA 4Q4W2 3M8LA 4QB6A 3J8F1 2J42A 5FBJA 3ATGA 5LK7B 4XFCA 2GDFA 1DCSA 5FK8A 2X05A 2IC1A 3C7EA 5DUXA 1N3PA 2W94A 1IZ3A 3S5AA 3IT8A 1DLLA 3ACIA 2XJQA 1F35A 2VMFA 4ITCA 1KFXL 4QX8A 3RI9A 3RNSA 3UETA 4P14A 4PDWB 4X8PA 3VN4A 5C5UA 3WQ0A 4Z1VA 5JUVA 1OLRA 5D1IA 5APAA 1ULPA 4XF0A 1Z7S1 3BU0A 1QJX3 4JKKA 1SQ4A 5C70A 4WVZA 3OY8B 2Q8EA 2XKOA 2VNGA 3H7JA 1REEA 1SEFA 4L92A 1LESA 4HANA 4NRMA 2K46A 2VW0A 3K3OA 1AF9A 2NZ9A 4Q4X1 5FZOB 2R16A 1JI6A 5KHJA 5F6KA 1D2SA 4Q29A 3I97A 1YI7A 1IQAA 1ZZBA 4XJZA 2Z42A 3O1PA 1CAVB 2DV9A 5CKMA 1JU4A 4DXRA 1FNZA 4MYEA 1MS4A 4OI0A 2ZGOA 2YC2A 4FP2A 5A32A 3VBUA 1NUKA 3GBGA 1YQ6A 2V5DA 2WNVC 4MO3M 2D98A 4LBMA 5FIXA 4CDWA 1PM7A 2DUQA 1RMU1 3TOJA 5JSOA 3LE0A 4CEYA 5JWPA 1RUJ2 3LIGA 3VBSB 5IAXA 4XQ4A 4FXKB 3MIHA 3AKSA 1HRV2 3C8XA 1KEXA 2OIIA 4BHPA 5CFDA 1AR83 1YI9A 2H6CA 1U5IA 3JQWA 3MEPA 4MGYE 4A42A 2AEZA 4HN0A 3WG2A 1B35B 4RGAA 3I2GA 2QQPA 1NA1C 1ZZ9A 4Q1RA 4DY3A 3MYXA 1H30A 5L7OA 2ADEA 2BFUS 4RGKA 3PMEA 1MZFA 3IKWA 4OI1A 1EAH3 1W8TA 4QB1A 1QJU1 4KWJA 1H8TC 1Q3EA 2R32A 5FMBA 2WQ8A 1QDOA 4YW5A 3MW4A 2Y6LA 3AKPA 4P5YA 3ACFA 4O7XA 3AZWA 3IPVB 1WW7A 4CZSA 1QIQA 1U12A 2W08A 1YUDA 3KCXA 3SC7X 5FZCA 3VDDC 1CZTA 3ZIWA 1CGPA 2UWCA 2VW2A 1ZRIA 3W9AA 2XWBB 4M3CF 1HN1A 1J58A 1ONAA 2AACA 1QGLA 3OD0A 5TSWA 3T2QA 3SKJE 2AR6A 2YC0A 4AEKA 3H1YA 1VBC3 5FXZA 5H9SA 3MDPA 3RGBA 3T08A 2VR4A 3VHNA 1XYOA 3UV9A 4MHRA 3ZSMA 4OQ8A 2O1QA 3A22A 1JYXA 2BPA2 2ZGPA 3BIEA 3WX5A 1DFQA 2Y33A 4NMIA 2FCUA 2X53S 1WUVA 4MADA 4IE4A 3MLLA 2EAKA 1JYTA 1HJGA 4ZU7A 1VRH1 4CDXA 3EO6A 3N4MA 3GBWA 2XLFA 2WR9A 3AL6A 3AMMA 2PLV3 1QJFA 1ZRCA 1E5SA 1Q5OA 1WGPA 3PIJA 4ZY9A 5LA2A 1F2NA 5FYMA 3KT4A 1G9DA 1URXA 2O8OA 2ID4A 4ES8A 3UGHA 4RA0A 1PVC1 3KB5A 1CAXB 1DIWA 1G8WA 3HEIA 4GWJA 4N43B 1NY71 5B4NA 2VE1A 2WQ4A 5FYCA 2AREA 5JR7B 2FMDA 1NLQA 2E7TA 4NPMA 5BNPC 1NQDA 2FCVA 4IEQA 2SLIA 2VUJA 1YC61 4B1LA 4KQ7A 4OI4A 1ZVFA 1F5FA 1ZZ7A 1PX3A 2C26A 1QJZA 4UFKA 3FHIB 2VZSA 1KDMA 3H1MA 3BGAA 4FPJA 2ZXQA 1WCDJ 4C91A 1ZRFA 1SBFA 5A70A 5I0DA 1DQ2A 4LBQB 4QM8A 1GICA 2XVLA 3QLQA 1LB2A 4QXKA 5T5PA 5C33A 4C8DA 1TG7A 1ND3A 4PIXA 1UZZA 2R043 1NCQB 1P8JA 4IGQA 4LLOA 1W6QA 3VBFA 3OF1A 4GALA 3AYCA 3OEBA 2RJLA 1K45A 4IL7A 2WAAA 1GQGA 3BYWA 2JKBA 1O4YA 1EPZA 3GM8A 5A7OA 2WFF2 1LAJA 4XUQA 4IGOA 5JMCA 1HXS1 1DU3D 4IEOA 2X29A 4I01A 2UWBA 2V72A 3IB3A 3OBTA 2R071 4FI9A 1JN2P 2A1XA 5DAPA 4UFLA 3JXSA 4WM8A 1BVP1 4MGSA 5FYBA 5HCFA 4YZ5A 1PO12 3MICA 3OTFA 5K0UB 1RUI1 2RS13 3RQ0A 1WMXA 1BBT2 1XSRA 4FPKA 4IGPA 2A6VA 5D2AA 5E1RA 4YPJA 1LTEA 4QKBA 3A23A 4BZ4A 4DUXA 2PTMA 2WABA 2X5IB 4PLOA 3TEYA 2VNRA 3VBRA 3KS7A 3LOBA
chains in the Genus database with same CATH topology
2QQLA 2J1TA 2JD9A 4OMCA 1UY2A 3WF1A 3WNLA 2W46A 2ZEWA 2B9VA 2VC9A 3MBWA 3CQOA 5IFTA 2L9LA 1W99A 1JZ2A 4DEVA 4MOAA 5EIYB 1JU3A 2VZUA 1YQ2A 2XHNA 2LS6A 3C7HA 2W5FA 1UMHA 5JXGA 2RVAA 2VMEA 2PQSA 2VZVA 4CU6A 1JZ7A 3ETPA 3K46A 2E26A 4IUGA 2WUHA 1DYOA 1WCQA 2CDOA 4ET7A 2E31A 4QAWA 2VL4A 3WEZA 3UESA 5J1XA 3SEEA 1SHWB 3NJXA 3HNYM 5IHRA 1IQDC 2W3JA 2BGPA 3T09A 4XVHA 1UWWA 1PMHX 3OGSA 3PUHA 3ZM8A 4ARYA 3FN9A 2Y6KA 4KMQA 2ZEZA 3THDA 4XZUG 2VZ3A 3A7QA 1US3A 2C9KA 3WSOA 3HPNA 3I2JA 1JZ6A 2VJXA 1JYNA 4QDRA 3LEKA 1W8NA 4QX3A 3K77A 4GZ9A 1JYWA 1ULOA 3NRUA 1UY1A 3K4ZA 5C7GA 2W92A 2QQNA 2EIDA 1K12A 1XNTA 1OF4A 2BGOA 3I3EA 1SDDB 2J1EA 2VZTA 3VD5A 3SEPA 2CDPA 4AG4A 2W1SA 4PQQA 3MV11 4OUEA 4RYDA 1OH4A 3WF0A 3I2IA 3DYOA 2XONA 1CX1A 1T2XA 3EB7A 4AAXA 3WNMA 2BZDA 4LHSA 2VOTA 1CIYA 1GOFA 2W95A 3LPFA 3CZUA 4XUNA 2EIBA 3K4DA 4P02B 5G05L 1O8PA 4Z2AA 3FHAA 1TVGA 2HYXA 5DPNA 3LEIA 5FUIA 4A6OA 2QQKA 3CZJA 3ACGA 3T0AA 2WDBA 4A41A 4LKSA 2QQMA 3T2OA 3GXUA 3VD4A 4JKLA 4ZXEA 4L0PA 4UOJA 3CMGA 3T0BA 2W47A 4E8DA 1GNYA 1SG3A 2W91A 3HOBA 5EJ1B 1GUIA 3GDBA 2C4XA 3OB8A 4UI9L 1F4AA 5LA0A 5B4XA 1W9SA 5DN2A 1J83A 2J7MA 5C71A 4D0QA 2VZRA 2OKXA 2VQUA 4KWUA 4XURA 4CU7A 2VCBA 3HN3A 4A3ZA 3WQBA 4LQRA 1UYXA 1MPXA 3ECQA 4QB2A 1UXXX 3CIHA 3I3BA 5DQ0A 4GWIA 1EUUA 4M4PA 3WNKA 2W1WA 3VD7A 4BJ0A 3PUIA 2ORXA 1RYYA 2EICA 4JKMA 4OYUA 1OT5A 4DXTA 2YG0A 4DUVA 1EUTA 1O59A 2Y64A 4BDVB 4LPLA 4CUBA 1JZ4A 2VQTA 2BERA 4A4AA 1NKGA 1US2A 2DDUA 2ORZA 4W50A 2QQOA 1UMIA 3OG2A 3LEGA 4TTGA 2QBXA 1LNSA 4PT6A 5JR2A 3C7OA 4ZZ8A 1UYZA 3CDZB 1WKYA 4BK4A 2RJ2A 3P1IA 4M4RA 3LPGA 3VDCA 2J22A 2Y6HA 1UY4A 1W0NA 1XC6A 4PF1A 3WF4A 1GOHA 3GGLA 4CVUA 3EYPA 3J7HA 5JXHA 2V4VA 2JKXA 2E32A 2VMCA 5IFPA 2HLEA 2W1UA 3E1F1 2VMDA 2WAOA 3I2FA 2BBAA 3P6BA 3MUZ1 5HXMA 4CUCA 2VCAA 2VZOA 4DXSA 1OF3A 3I2HA 4HG6B 3LQCA 2RV9A 2YFZA 2EIEA 3AC0A 4QPWA 2J1RA 4P00B 2B4KA 4A45A 2KD7A 3WNPA 3DECA 2QQIA 1J84A 1UY3A 3FL7A 2YFUA 4QDQA 4MGQA 2E33A 1F4HA 3ACHA 3D3AA 3FHQA 5F7UA 4RN5A 2WZEA 3THCA 3W5NA 2XQXA 3IAPA 1H6XA 5IYYA 4QB6A 5JXJA 1CZSA 2ZEYA 2J1SA 1DP0A 2X05A 4UAPA 3C7EA 2W94A 3WF3A 3ACIA 2VMFA 3UETA 2WO2A 2Y6JA 1NAEA 3IDAA 3MV01 4XUTA 1I5PA 2J1VA 4ZZ5A 5JUVA 1ULPA 1DLCA 1JYVA 4JKKA 5C70A 3C7FA 2J1UA 3NNGA 3BN6A 1L7RA 4QDSA 2WN3A 3T2PA 1JI6A 1K3IA 3I97A 2W1QA 5LA1A 1JU4A 1KGYA 4JX0A 4DXRA 2YC2A 4DUWA 1NUKA 4OZOA 5EJZB 4OMDA 2JDAA 1UY0A 2J1AA 2V5DA 2YC4A 4MO3M 5HPOA 3OGVA 3UNPA 2R7EB 2DCJA 3LE0A 1UXZA 4TXWA 3WF2A 5CYYA 3C8XA 1KEXA 4P08A 2QQJA 3OBAA 3SKVA 4A42A 5JXIA 3I2GA 2Z4FA 4ARXA 3DYMA 1K42A 1R64A 4XUPA 4QB1A 1GOGA 2JE8A 1O8SA 2WQ8A 2Y6LA 4P5YA 3ACFA 1W8OA 2WYSA 1CZTA 1L7QA 2WO1A 3OEAA 2VCCA 1HN1A 4A44A 1GU3A 3T2QA 5CZKA 3SKJE 2WO3A 1W9TA 3T08A 2VR4A 2WBKA 1W9WA 5G04L 4QX1A 3K4AA 2XOMA 3A22A 1JYXA 1JZ3A 1OD3A 5DMYA 5IJRA 4CUAA 4BK5A 2VM9A 3VD3A 4MADA 3ABZA 3IIIA 1UYYA 1JZ8A 1GQPA 3I3DA 3I2KA 4XUOA 3MUY1 1UX7A 3A21A 4JHZA 3IAQA 2W9XA 4W4ZA 2VZQA 1D7PM 5LA2A 4ZY9A 1H6YA 4BXSV 2YB7A 2ID4A 2WZ8A 2WN2A 3HEIA 4GWJA 5A1AA 3T0DA 5B4NA 3U37A 2VTFA 4CU8A 2Y8KA 3C7GA 1JHJA 4KI5M 2Y6GA 1BHGA 4QX0A 1PX3A 2C26A 4W8JA 2VZSA 3BGAA 3VDAA 2ZXQA 4QX2A 5I0DA 3WNOA 1XPWA 4DEQA 3K75B 2LW8A 3WNNA 1TG7A 5JMOA 2W87A 1P8JA 1PMJX 3HJRA 2X10A 1NX9A 3MO4A 3OEBA 1K45A 1GMMA 2WAAA 2VZ1A 3GM8A 1CZVA 3CKHA 4XUQA 4CU9A 3OGRA 2V72A 3IB3A 1UZ0A 3NQHA 3VDBA 4FI9A 1PX4A 2ZEXA 2VO5A 3HNBM 2DCKA 3JXSA 4MGSA 3NJVA 3HNMA 1XNAA 1JZ5A 2VZPA 3F2ZA 5LCWL 2X09A 4D8MA 3W5MA 3VD9A 3DYPA 4YPJA 4DUXA 3A23A 2WABA 4E8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQL A;  2J1T A;  2JD9 A;  4OMC A;  1UY2 A;  3WF1 A;  3WNL A;  2W46 A;  2ZEW A;  2B9V A;  2VC9 A;  3MBW A;  3CQO A;  5IFT A;  2L9L A;  1W99 A;  1JZ2 A;  4DEV A;  4MOA A;  5EIY B;  1JU3 A;  2VZU A;  1YQ2 A;  2XHN A;  2LS6 A;  3C7H A;  2W5F A;  1UMH A;  5JXG A;  2RVA A;  2VME A;  2PQS A;  2VZV A;  4CU6 A;  1JZ7 A;  3ETP A;  3K46 A;  2E26 A;  4IUG A;  2WUH A;  1DYO A;  1WCQ A;  2CDO A;  4ET7 A;  2E31 A;  4QAW A;  2VL4 A;  3WEZ A;  3UES A;  5J1X A;  3SEE A;  1SHW B;  3NJX A;  3HNY M;  5IHR A;  1IQD C;  2W3J A;  2BGP A;  3T09 A;  4XVH A;  1UWW A;  1PMH X;  3OGS A;  3PUH A;  3ZM8 A;  4ARY A;  3FN9 A;  2Y6K A;  4KMQ A;  2ZEZ A;  3THD A;  4XZU G;  2VZ3 A;  3A7Q A;  1US3 A;  2C9K A;  3WSO A;  3HPN A;  3I2J A;  1JZ6 A;  2VJX A;  1JYN A;  4QDR A;  3LEK A;  1W8N A;  4QX3 A;  3K77 A;  4GZ9 A;  1JYW A;  1ULO A;  3NRU A;  1UY1 A;  3K4Z A;  5C7G A;  2W92 A;  2QQN A;  2EID A;  1K12 A;  1XNT A;  1OF4 A;  2BGO A;  3I3E A;  1SDD B;  2J1E A;  2VZT A;  3VD5 A;  3SEP A;  2CDP A;  4AG4 A;  2W1S A;  4PQQ A;  3MV1 1;  4OUE A;  4RYD A;  1OH4 A;  3WF0 A;  3I2I A;  3DYO A;  2XON A;  1CX1 A;  1T2X A;  3EB7 A;  4AAX A;  3WNM A;  2BZD A;  4LHS A;  2VOT A;  1CIY A;  1GOF A;  2W95 A;  3LPF A;  3CZU A;  4XUN A;  2EIB A;  3K4D A;  4P02 B;  5G05 L;  1O8P A;  4Z2A A;  3FHA A;  1TVG A;  2HYX A;  5DPN A;  3LEI A;  5FUI A;  4A6O A;  2QQK A;  3CZJ A;  3ACG A;  3T0A A;  2WDB A;  4A41 A;  4LKS A;  2QQM A;  3T2O A;  3GXU A;  3VD4 A;  4JKL A;  4ZXE A;  4L0P A;  4UOJ A;  3CMG A;  3T0B A;  2W47 A;  4E8D A;  1GNY A;  1SG3 A;  2W91 A;  3HOB A;  5EJ1 B;  1GUI A;  3GDB A;  2C4X A;  3OB8 A;  4UI9 L;  1F4A A;  5LA0 A;  5B4X A;  1W9S A;  5DN2 A;  1J83 A;  2J7M A;  5C71 A;  4D0Q A;  2VZR A;  2OKX A;  2VQU A;  4KWU A;  4XUR A;  4CU7 A;  2VCB A;  3HN3 A;  4A3Z A;  3WQB A;  4LQR A;  1UYX A;  1MPX A;  3ECQ A;  4QB2 A;  1UXX X;  3CIH A;  3I3B A;  5DQ0 A;  4GWI A;  1EUU A;  4M4P A;  3WNK A;  2W1W A;  3VD7 A;  4BJ0 A;  3PUI A;  2ORX A;  1RYY A;  2EIC A;  4JKM A;  4OYU A;  1OT5 A;  4DXT A;  2YG0 A;  4DUV A;  1EUT A;  1O59 A;  2Y64 A;  4BDV B;  4LPL A;  4CUB A;  1JZ4 A;  2VQT A;  2BER A;  4A4A A;  1NKG A;  1US2 A;  2DDU A;  2ORZ A;  4W50 A;  2QQO A;  1UMI A;  3OG2 A;  3LEG A;  4TTG A;  2QBX A;  1LNS A;  4PT6 A;  5JR2 A;  3C7O A;  4ZZ8 A;  1UYZ A;  3CDZ B;  1WKY A;  4BK4 A;  2RJ2 A;  3P1I A;  4M4R A;  3LPG A;  3VDC A;  2J22 A;  2Y6H A;  1UY4 A;  1W0N A;  1XC6 A;  4PF1 A;  3WF4 A;  1GOH A;  3GGL A;  4CVU A;  3EYP A;  3J7H A;  5JXH A;  2V4V A;  2JKX A;  2E32 A;  2VMC A;  5IFP A;  2HLE A;  2W1U A;  3E1F 1;  2VMD A;  2WAO A;  3I2F A;  2BBA A;  3P6B A;  3MUZ 1;  5HXM A;  4CUC A;  2VCA A;  2VZO A;  4DXS A;  1OF3 A;  3I2H A;  4HG6 B;  3LQC A;  2RV9 A;  2YFZ A;  2EIE A;  3AC0 A;  4QPW A;  2J1R A;  4P00 B;  2B4K A;  4A45 A;  2KD7 A;  3WNP A;  3DEC A;  2QQI A;  1J84 A;  1UY3 A;  3FL7 A;  2YFU A;  4QDQ A;  4MGQ A;  2E33 A;  1F4H A;  3ACH A;  3D3A A;  3FHQ A;  5F7U A;  4RN5 A;  2WZE A;  3THC A;  3W5N A;  2XQX A;  3IAP A;  1H6X A;  5IYY A;  4QB6 A;  5JXJ A;  1CZS A;  2ZEY A;  2J1S A;  1DP0 A;  2X05 A;  4UAP A;  3C7E A;  2W94 A;  3WF3 A;  3ACI A;  2VMF A;  3UET A;  2WO2 A;  2Y6J A;  1NAE A;  3IDA A;  3MV0 1;  4XUT A;  1I5P A;  2J1V A;  4ZZ5 A;  5JUV A;  1ULP A;  1DLC A;  1JYV A;  4JKK A;  5C70 A;  3C7F A;  2J1U A;  3NNG A;  3BN6 A;  1L7R A;  4QDS A;  2WN3 A;  3T2P A;  1JI6 A;  1K3I A;  3I97 A;  2W1Q A;  5LA1 A;  1JU4 A;  1KGY A;  4JX0 A;  4DXR A;  2YC2 A;  4DUW A;  1NUK A;  4OZO A;  5EJZ B;  4OMD A;  2JDA A;  1UY0 A;  2J1A A;  2V5D A;  2YC4 A;  4MO3 M;  5HPO A;  3OGV A;  3UNP A;  2R7E B;  2DCJ A;  3LE0 A;  1UXZ A;  4TXW A;  3WF2 A;  5CYY A;  3C8X A;  1KEX A;  4P08 A;  2QQJ A;  3OBA A;  3SKV A;  4A42 A;  5JXI A;  3I2G A;  2Z4F A;  4ARX A;  3DYM A;  1K42 A;  1R64 A;  4XUP A;  4QB1 A;  1GOG A;  2JE8 A;  1O8S A;  2WQ8 A;  2Y6L A;  4P5Y A;  3ACF A;  1W8O A;  2WYS A;  1CZT A;  1L7Q A;  2WO1 A;  3OEA A;  2VCC A;  1HN1 A;  4A44 A;  1GU3 A;  3T2Q A;  5CZK A;  3SKJ E;  2WO3 A;  1W9T A;  3T08 A;  2VR4 A;  2WBK A;  1W9W A;  5G04 L;  4QX1 A;  3K4A A;  2XOM A;  3A22 A;  1JYX A;  1JZ3 A;  1OD3 A;  5DMY A;  5IJR A;  4CUA A;  4BK5 A;  2VM9 A;  3VD3 A;  4MAD A;  3ABZ A;  3III A;  1UYY A;  1JZ8 A;  1GQP A;  3I3D A;  3I2K A;  4XUO A;  3MUY 1;  1UX7 A;  3A21 A;  4JHZ A;  3IAQ A;  2W9X A;  4W4Z A;  2VZQ A;  1D7P M;  5LA2 A;  4ZY9 A;  1H6Y A;  4BXS V;  2YB7 A;  2ID4 A;  2WZ8 A;  2WN2 A;  3HEI A;  4GWJ A;  5A1A A;  3T0D A;  5B4N A;  3U37 A;  2VTF A;  4CU8 A;  2Y8K A;  3C7G A;  1JHJ A;  4KI5 M;  2Y6G A;  1BHG A;  4QX0 A;  1PX3 A;  2C26 A;  4W8J A;  2VZS A;  3BGA A;  3VDA A;  2ZXQ A;  4QX2 A;  5I0D A;  3WNO A;  1XPW A;  4DEQ A;  3K75 B;  2LW8 A;  3WNN A;  1TG7 A;  5JMO A;  2W87 A;  1P8J A;  1PMJ X;  3HJR A;  2X10 A;  1NX9 A;  3MO4 A;  3OEB A;  1K45 A;  1GMM A;  2WAA A;  2VZ1 A;  3GM8 A;  1CZV A;  3CKH A;  4XUQ A;  4CU9 A;  3OGR A;  2V72 A;  3IB3 A;  1UZ0 A;  3NQH A;  3VDB A;  4FI9 A;  1PX4 A;  2ZEX A;  2VO5 A;  3HNB M;  2DCK A;  3JXS A;  4MGS A;  3NJV A;  3HNM A;  1XNA A;  1JZ5 A;  2VZP A;  3F2Z A;  5LCW L;  2X09 A;  4D8M A;  3W5M A;  3VD9 A;  3DYP A;  4YPJ A;  4DUX A;  3A23 A;  2WAB A;  4E8C A; 
#chains in the Genus database with same CATH topology
 1JOP A;  4TN7 A;  3AXD A;  5CKQ A;  4XEZ A;  3N7M A;  4XTP A;  1X50 A;  4QX5 A;  1YXW A;  3KV5 A;  3WF1 A;  5F3I A;  5BXX A;  2W46 A;  4OHY A;  1CPM A;  4N90 A;  1LU1 A;  2WNU C;  1Y9M A;  3CQO A;  4K7J A;  1KJL A;  2JDK A;  3J8F 3;  4RFR B;  1O3T A;  4JVA A;  3AB0 A;  4LOT A;  1ZRD A;  4FSJ A;  4DEV A;  3E5Q A;  4CDQ B;  4LBN A;  3ZPO A;  4CEW C;  2VVD A;  1VLN A;  4BWO A;  3JU9 A;  3GCW A;  3NST A;  1JU3 A;  3PLQ A;  3VKN A;  1YQ2 A;  1VBA 1;  3GJA A;  2A6Y A;  1UOG A;  2WA3 A;  3H7Y A;  4NII A;  1SPP A;  1VJ2 A;  4XIK A;  3V0A B;  1UMH A;  1VIW B;  4UT5 A;  1ZBE 1;  5FZG A;  1Z7S 3;  1R1A 1;  4JAA A;  1C5I A;  1WZX A;  5AVP A;  2BEO A;  4M0N A;  3S30 A;  3ZFF A;  2JG8 A;  2YPJ A;  3PVE A;  2C24 A;  4YZ3 A;  1CWP A;  1OA4 A;  2R49 A;  4RS5 C;  1ZRE A;  2E31 A;  2ZZQ A;  4Q4X 3;  2HWD 1;  3AFG A;  4HOO A;  3DPR B;  3ZSK A;  2WL1 A;  3ZFG B;  3L2Y A;  4PBP A;  1C5H A;  1OKQ A;  2HWB 2;  1WW6 A;  5IHR A;  1O5L A;  1W2N A;  2RR1 1;  3T1L A;  4CPB A;  3GZE A;  5C3P A;  4Y20 A;  4GD4 A;  1PVX A;  4Z07 A;  1PNG A;  1SFY A;  4R4X A;  1LGB A;  4LJH A;  5FPU A;  2VPV A;  3THD A;  1RMU 3;  4LO5 B;  4XZU G;  3A7Q A;  2HBT A;  4K40 A;  2B46 X;  2C9K A;  4EWA A;  1HV1 A;  2FBE A;  2Y60 A;  3WP4 A;  5IAV A;  1GP6 A;  2FDH A;  3CJX A;  2XVG A;  1DGR N;  3FLT A;  1IG0 A;  4UXA A;  4B7K A;  2WWU A;  3FZ3 A;  4FFH A;  2QCS B;  1HRI 2;  4QX3 A;  1AX2 A;  1CIW A;  4GZ9 A;  1ULO A;  3NRU A;  4IEY A;  4OHZ A;  4BQ3 A;  4DPN A;  4KWK A;  3THT A;  1HB3 A;  1Z78 A;  3AMP A;  5GM0 A;  1FPN 1;  3RG0 A;  3D4K A;  1S1A A;  4UF0 A;  3WOG A;  4B4Q A;  1EV1 1;  1LED A;  5C8C C;  5T54 A;  1M06 G;  5FZD A;  1BXH A;  3KHB A;  4XCB A;  1QJU 3;  5DAW A;  1K12 A;  1LEM A;  2QDR A;  2YMZ A;  2XJP A;  1LOE A;  1W3X A;  2ZCW A;  4JGY A;  1D0G A;  3OGJ A;  4ISR A;  2VUL A;  3IIA A;  3CBN A;  2BGO A;  3H8R A;  4MH0 E;  1W0P A;  1Y3T A;  2NMN A;  3AJY A;  2HEV F;  3EHK A;  5BNN B;  2CDP A;  3HBK A;  4AG4 A;  4KL1 A;  1E5R A;  1WW5 A;  2EAA A;  3FMG A;  4Q0Q A;  4JDO A;  5CAD A;  4PQQ A;  2RS3 1;  3MV1 1;  3POB A;  4OUE A;  1D2Q A;  4FXG B;  1OPO A;  4RYD A;  2QVS B;  1OH4 A;  4RR3 A;  3FLP A;  3TYJ A;  3WF0 A;  4EN8 B;  3IMM A;  3GNE A;  1OFS A;  1CX1 A;  2IXC A;  4NPL A;  4DRR A;  1QOT A;  4QPI B;  2E6V A;  2BP6 A;  1OC1 A;  1U5X A;  2R06 2;  3WDY A;  3LPF A;  2BTV C;  1EY2 A;  5A80 A;  5KBF A;  3AMN A;  2P34 A;  5GKA C;  4XTM A;  4UW6 A;  4XYX A;  1QWR A;  1TVG A;  2HYX A;  1ENS A;  1VRH 3;  1NCR C;  3LEI A;  1K5J A;  3FFZ A;  3IDE A;  3LKJ A;  4A6O A;  4RQP C;  4CA9 A;  3ST7 A;  3ACG A;  4OUM A;  2WDB A;  1RIN A;  2WII B;  4Y26 A;  3T2O A;  5E16 A;  3GXU A;  1XYP A;  2OQ6 A;  1DQ1 A;  3VD4 A;  1NZI A;  2AZ5 A;  4OZX A;  1AZD A;  1JHN A;  4L0P A;  5K9Y A;  1PVC 3;  1DDL A;  2RJK A;  1AL2 1;  4GB3 2;  1K5M B;  4QXH A;  1SFP A;  3ZX7 A;  4UFH A;  5F3E A;  4FTS A;  1G9B A;  1IS3 A;  3RVH A;  1ODN A;  5E89 A;  3AP5 A;  1VBB 2;  1RUH 2;  3G7D A;  5FJK A;  4E8D A;  2W91 A;  3CNA A;  1PGL 2;  1LGN A;  4XHB A;  1NG0 A;  4Z8B A;  1BK0 A;  1H2M A;  1F4A A;  5D8A B;  2A3X A;  1D4M 2;  2Q1M A;  2VMG A;  1C8M 1;  5GZD A;  3RZK A;  5I8S A;  4PQ9 A;  1J83 A;  4QD2 A;  3UKN A;  2G19 A;  2ZML A;  2SBA A;  5FPL A;  5J98 B;  2Y34 A;  2WNV A;  3PUQ A;  2OKX A;  4N53 C;  4QGL A;  2VBD A;  5IVV A;  2XUE A;  1Y43 B;  5FZ8 A;  1JS9 A;  4KWU A;  4W65 A;  3ZXD A;  4JGZ C;  2KM2 A;  1QXP A;  3HN1 A;  2VCB A;  4K20 A;  4XMI A;  3D0J A;  2JX9 A;  1HXS 3;  1C1F A;  5T5J A;  1YHF A;  4COY A;  1MPX A;  3AZX A;  3VBO C;  3ECQ A;  4RD7 A;  4QB2 A;  4AHY A;  4Y1V A;  2R07 3;  3B93 A;  3OYW B;  3SHR A;  1W6O A;  5LY2 A;  1NA1 A;  4C1X A;  2IFR A;  2ZGS A;  3T1M A;  2BRT A;  4J1W A;  5BNO C;  1FX5 A;  3KVB A;  3OUH A;  4M4P A;  1RUI 3;  1MZE A;  4AEM A;  2RMU 2;  4BJ0 A;  2K2S A;  2A6W A;  1MAC A;  1V6I A;  3ZMN A;  2B9U A;  1H8T A;  3WCR A;  4P9X A;  4CDU C;  1OUR A;  2UY9 A;  5GLZ A;  1OUS A;  5GLU A;  4OYU A;  4COU A;  2JG9 C;  3VDD A;  5JLV A;  3ENR A;  1G9C A;  4MX3 A;  4XF1 A;  5FY7 A;  4BYY A;  4X6R B;  5FO8 B;  2CGP A;  1W6N A;  3HWJ A;  3D8C A;  1O59 A;  3OCP A;  4JRA A;  2Y64 A;  4XE9 A;  2NMO A;  4BDV B;  5HI0 A;  4Y4R A;  2DFC A;  1HB2 A;  2JDP A;  1S0F A;  2ZMN A;  4CSW A;  1COV 2;  4ZON A;  1SFN A;  4YYO A;  2DUO A;  2OUJ A;  1NKG A;  4HVR A;  2PAM A;  2JXA A;  3POJ A;  3NKG A;  4HZF A;  3W59 A;  1VBA 3;  4IE5 A;  2WA4 A;  1U5Z A;  3VL9 A;  4JTO A;  5GAL A;  5H9P A;  3LEG A;  3S5Q A;  4GUL A;  2QBX A;  4MSV A;  1YQ8 A;  4LUL A;  5JR2 A;  1ZBE 3;  5J37 A;  2E53 A;  5FYH A;  2OA2 A;  1VAV A;  2IXI A;  1R1A 3;  4J6G A;  4OHW A;  1IHM A;  1OMI A;  3CDZ B;  3LZZ A;  4D7T A;  5A3U A;  3I49 A;  4LEJ A;  3SXW A;  5SV8 A;  1YLL A;  3LPG A;  2ZPX A;  4Q4V 1;  2J22 A;  5K4L A;  2PHU A;  1XC6 A;  2P37 A;  5IAT A;  3HBZ A;  5JSR A;  2VTX J;  3VZL A;  2DBI A;  2NLR A;  1JMU B;  1GOH A;  2XB6 C;  5EHD A;  3WV6 A;  2HWD 3;  3GGL A;  4AYU A;  5IK8 A;  2QQV A;  5JCT A;  4CVU A;  1SMV A;  3PTR B;  3TNQ A;  4BIO A;  4XJU A;  4NIG A;  4YW7 A;  3WW1 A;  2VMC A;  1I1E A;  5IFP A;  5AVA A;  3VHP A;  1C57 A;  3E1F 1;  2RR1 3;  1FOD 2;  2B7Y A;  1PMI A;  3P6B A;  4Q4Y 2;  1RHI 1;  3ZIX A;  1J3Q A;  3B02 A;  3MUZ 1;  1MEC 1;  4TYS A;  5BNP A;  1H2N A;  1X33 A;  4CUG A;  4JTN A;  1BEV 1;  3LD8 A;  3WZ1 A;  2MEV 1;  1SAC A;  1AXK A;  1YFX A;  2GN7 A;  2VCA A;  2MHF A;  3NV3 A;  4IEU A;  3PJY A;  1W6M A;  1OF3 A;  4XBN A;  4RFT 0;  1DZR A;  4HG6 B;  4BH9 A;  4BQW A;  5DAV A;  4QPY A;  2GMP A;  4YG6 A;  2Q0A A;  3NNF A;  4I2O A;  4AQ6 A;  4EWD A;  2J1R A;  2WQZ C;  5FY8 A;  3ALQ A;  4A45 A;  5A32 B;  3VBU B;  2GH2 A;  1NYW A;  3IN9 A;  1DGW X;  3DEC A;  4MVT A;  5A7N A;  1XRU A;  4AWD A;  5A1L A;  2XXZ A;  4CDW B;  5I8T A;  5FAX A;  1GAN A;  2VEC A;  4LHN A;  1FPN 3;  2E33 A;  4XFF A;  5LBE A;  1EV1 3;  3AVR A;  4CEY B;  1LKN A;  2A70 A;  3FHQ A;  4AVA A;  4RN5 A;  5FYI A;  2R0F A;  4IEW A;  3THC A;  4EN6 B;  2XQX A;  4K9S A;  4AED B;  3SMH A;  5KHG A;  4URA A;  1KXG A;  4WVV A;  1ZZ6 A;  3ZYF A;  2NN8 A;  1CZS A;  1PIV 2;  1RL3 A;  5CFD B;  1CD3 G;  4LO7 A;  4KG8 A;  2JE9 A;  3H50 A;  4FO9 A;  1V9U 2;  5FZ1 A;  1AXY A;  2GU9 A;  1CES A;  4XOG A;  2RS3 3;  5L7O B;  4P5H A;  2Y6J A;  3GBF A;  5FQ0 B;  2DCT A;  5FDB A;  1NAE A;  3IDA A;  3MV0 1;  4XUT A;  1C1L A;  2J1V A;  3HD8 B;  3DF0 A;  4IND A;  3M3I A;  1RUC 1;  1EP0 A;  2XG3 A;  1G6N A;  2WNU A;  2QQU A;  3FFQ A;  3CLP A;  2FDK A;  1X7N A;  2ARA A;  3SIT A;  1ODM A;  4NOT A;  2GND A;  5BYN A;  2WC2 A;  3I59 A;  4FOV A;  4Y5T A;  5JIU A;  3NNG A;  2J1U A;  3B01 A;  3ILF A;  1L7R A;  4FFI A;  4EZH A;  2HEW F;  3CL1 A;  5JAX A;  2D3R A;  3T2P A;  2D5F A;  4CEW A;  5CBL A;  2WT2 A;  2DTW A;  2JDH A;  1S0J A;  2QFE A;  3NNM A;  4JX0 A;  1GWL A;  5BPX A;  4N7I A;  1AR6 2;  2Q4S A;  1X8M A;  1AVB A;  1QJY 1;  5F5A A;  4GXL A;  5B2G B;  4OZO A;  5BUV A;  1VAL A;  3B94 A;  3PUR A;  2J1A A;  2YC4 A;  5ACA 2;  3HVD A;  3CU7 A;  1AL2 3;  2HEY F;  2YV8 A;  1DYP A;  4IV3 C;  1ULF A;  4URT A;  3RZG A;  1W0O A;  2R7E B;  4NHK A;  4RS5 A;  4CDX B;  1UXZ A;  5EV7 A;  2JDU A;  4QKN A;  1S0G A;  2BV4 A;  3WF2 A;  1NLS A;  2V09 A;  3RWN A;  5FPV A;  3LA7 A;  5FUN A;  4GMP 1;  1N1T A;  1PK6 A;  2ZHK A;  5IW0 A;  3KLS A;  5A7P A;  5GZF A;  2PAK A;  1I5Z A;  1UOB A;  2OW4 A;  3CO2 A;  4YG3 A;  1W3V A;  5FOB B;  1C8M 3;  4YW3 A;  5FP8 A;  4IQP A;  2DVG A;  1AL0 G;  2KA3 A;  2YYO A;  3FBM A;  2DVA A;  2FD8 A;  5JSP A;  2FMY A;  1AR7 1;  3KSC A;  2GNB A;  4C0H A;  3ZDS A;  1R64 A;  3PMS A;  4MGZ E;  2EVX A;  1GOG A;  3POE A;  2JE8 A;  3WLU A;  1HN0 A;  4MXV A;  4OQ9 A;  1DQ4 A;  3AYE A;  3O12 A;  2V73 A;  4GJY A;  4I3P A;  1OVS A;  1ZBA 1;  4E9K A;  1BQP A;  1WW4 A;  2WYS A;  4AGR A;  1ZA4 A;  4XIO A;  3NWK A;  3SQO A;  4NHL A;  2IXH A;  1CR7 A;  5DUV A;  4YW2 A;  2H0V A;  3K48 A;  3P3N A;  2VCC A;  2OYZ A;  3E6C C;  1NQJ A;  3JUU A;  1GU3 A;  4Q1P A;  1V6M A;  2GP3 A;  5DZF A;  3MLJ A;  5DAQ A;  1ND3 B;  2KR2 A;  3BOD A;  3JD7 1;  3PVB B;  1W9W A;  1JOD A;  1CQ9 A;  1QF3 A;  1W6Q B;  2P3I A;  4QXC A;  4QX1 A;  5G04 L;  3SH4 A;  3VBF B;  5C8C A;  2XOM A;  1JZ3 A;  4CXX A;  4DIN B;  4ZKT B;  1OD3 A;  4IV1 C;  5DMY A;  4I02 A;  2AEN A;  2YBP A;  1AR9 1;  3DEM A;  4BK5 A;  3C3V A;  4F8A A;  2P2K A;  3BKZ A;  4PI0 A;  4QQP A;  5L73 A;  3AYD A;  3ABZ A;  1MVQ A;  4TZD A;  1W2O A;  2CTV A;  4L9B A;  1GQP A;  3SNM A;  1JOB A;  2OZ6 A;  3I2K A;  4WM8 B;  1DGW A;  1OA3 A;  5FZH A;  2YGM A;  4JHZ A;  1UX7 A;  3A21 A;  3IAQ A;  4I30 A;  4B29 A;  2DTY A;  5CA6 A;  4FFG A;  4EJR A;  3AK0 A;  5CG8 A;  5ANN A;  1H6Y A;  4R4Z A;  3H42 B;  1ZZC A;  1OLQ A;  1W90 A;  3AFK A;  3QCW A;  2RDN A;  2WZ8 A;  3R0R A;  3VBR B;  1FMD 1;  4KU8 A;  3H8O A;  4AGV A;  4Q0P A;  3POW A;  3T0D A;  3KF5 A;  3ZFE C;  3MIB A;  1FNY A;  2ARC A;  4PLN A;  2Y8K A;  1W06 A;  2K0G A;  1ULC A;  5ERL A;  4KI5 M;  1MZ5 A;  1NCR A;  2PYT A;  2VG9 A;  4AI9 A;  1OBN A;  4RQP A;  4WZC A;  4DO0 A;  1TMF 1;  4Q4V 3;  3KZ4 C;  5DDJ 3;  2Q5T A;  4B1M A;  2TUN A;  4BQ4 A;  3DUI A;  4R9B A;  1XE0 A;  4GH4 C;  2O14 A;  4CCC A;  4DEQ A;  4NR1 A;  2WIN B;  3ZSJ A;  4K3U A;  2A3Y A;  5JMO A;  5K7P A;  2OXB A;  2W87 A;  4FPL A;  3OOX A;  1EAH 2;  2PN5 A;  1SPP B;  3I4I A;  4ZXK A;  5DXD A;  4KH9 A;  4R9D A;  5A6X A;  3WP3 A;  1RHI 3;  1HW5 A;  1F8V A;  1MEC 3;  5I91 A;  3RZH A;  5FUP A;  1WCU A;  3L2H A;  3ZFF B;  1BEV 3;  2JG8 B;  2RS5 1;  2D6O X;  2MEV 3;  2ZA9 A;  3ZN5 A;  3ZOI A;  1TNF A;  3IDB B;  3OGR A;  1OH3 A;  1NZC A;  1UZ0 A;  3OUI A;  1NE6 A;  4XZP A;  4XXA A;  2XDV A;  5FP7 A;  4XAA A;  1ZX5 A;  1VBC 2;  2OVU A;  4IEV A;  1PX4 A;  3RRD A;  2Z2S B;  2ZEX A;  1ZNP A;  3Q9O A;  4LE3 A;  3I8T A;  3NNL A;  1OVP A;  4LE4 A;  5IVY A;  2VVE A;  1XNA A;  1TME 2;  4HL0 A;  4N53 A;  5FZM A;  3ZR6 A;  1RUF 1;  1YCI A;  2XBO 1;  4Y20 B;  2TEP A;  4QU1 A;  3DYP A;  3WR0 A;  4BB3 A;  1NXD 1;  4L8Q A;  3KVA A;  4JGZ A;  4AHX A;  4LT5 A;  3O14 A;  1DF0 A;  4E8C A;  3U0Z A;  2J1T A;  5CIR A;  2G4I A;  3MID A;  4LR4 A;  4IES A;  3VBO A;  3WNX A;  2YBS A;  3WNL A;  2AYH A;  2B9V A;  4QKD A;  4YZ4 A;  5IK4 A;  2PLV 2;  5FY4 A;  3KGZ A;  5M0T A;  5FZB A;  2N7G A;  2D7F A;  3N9N A;  5BNO A;  5C6C A;  4JDM A;  3HQX A;  1JZ2 A;  2ZAA A;  2A5Z A;  5FXW A;  4CE8 A;  1IKQ A;  4JZR A;  5EIY B;  4CDU A;  1POV 1;  2XHN A;  2LS6 A;  4FAG A;  5F32 A;  2BNM A;  4UF0 B;  1GSL A;  2I07 B;  2JG9 A;  2YHJ A;  4Q8L A;  2CAU A;  4WBB A;  5JXG A;  1RUC 3;  2VME A;  2WZR 1;  3O1T A;  4NRP A;  5KXC A;  5FPX A;  4KG0 A;  2JDY A;  4JGY B;  4LA2 A;  3ZXJ A;  3E5X A;  5GJ6 A;  3ETP A;  3S0M A;  5L36 A;  4UFI A;  1LOG A;  1OHF A;  1UZY A;  1VMJ A;  5CU1 A;  1VBE 1;  5DG1 A;  5FPA A;  2NYY A;  3ZN6 A;  5I0R A;  4IET A;  1C8N A;  2P6C A;  5KXE A;  5FP9 A;  3FE5 A;  2R04 2;  2EXI A;  4RR3 B;  3ZLI A;  1S2E A;  1HLC A;  3MGU A;  1SHW B;  3IWZ A;  1E57 A;  1QJY 3;  1RJ7 A;  3GHM A;  1IQD C;  1I3H A;  2LUW A;  3J7N A;  5T50 A;  2W3J A;  2P3Y A;  2BGP A;  2EF6 A;  3T09 A;  2CNA A;  2F6B A;  1VBD 1;  3ZM8 A;  3PUH A;  4EWE A;  3ZYB A;  4TSV A;  1OD5 A;  2PEL A;  3RYP A;  2NM1 A;  4YW6 A;  1FV3 A;  1PO2 2;  4H7M A;  4KMQ A;  3ZYI B;  5LY1 A;  2D43 A;  4JCK A;  5CB7 A;  3AP9 A;  1LOD A;  2W52 A;  2CAV A;  3LOI A;  2UUR A;  1ZYB A;  5C9A B;  4NE9 A;  5HBA A;  1SLC A;  3VLB B;  3HPN A;  2RS1 2;  4I0B A;  1JZ6 A;  4GMP 3;  3M3E A;  1EYB A;  1OUX A;  3M1H A;  5K0U C;  3EBR A;  4OLL A;  1ENQ A;  1Q8S A;  3AXE A;  2HWE 1;  2HWF 1;  4FTB A;  2ZGU A;  5IVE A;  2R1B A;  4QDR A;  5FLJ A;  1W8F A;  3IMN A;  5D21 A;  2ZJC A;  2RDQ A;  1OFN A;  1UY1 A;  4XFI A;  4DOU A;  5J96 B;  3K4Z A;  1BZW A;  3HT1 A;  4J25 A;  1AR7 3;  3MZH A;  2JIJ A;  2QQN A;  4QKF A;  1CON A;  4WVM A;  3J8F 2;  3Q8E A;  4QT6 A;  1OF4 A;  1ZBA 3;  4HXC A;  1S0D A;  3GYD A;  4FCA A;  1D0H A;  5T5O A;  4NID A;  5A33 A;  1YWK A;  2BJS A;  1UNB A;  2BFU L;  2P17 A;  5JPN B;  5FYU A;  3LF7 A;  5FZL A;  1S0I A;  1ASJ 1;  2HWB 1;  1F15 A;  1VMH A;  2W1S A;  2WNV B;  3VZN A;  1S0C A;  1MS3 A;  1J3R A;  3JD7 3;  4LLF A;  1Z7S 2;  1UO9 A;  3DYO A;  5J3U A;  4AL9 A;  2BOI A;  5CVR A;  2ERF A;  5FYY A;  2WKK A;  1DQ5 A;  1T2X A;  2GC0 A;  4LO8 A;  3WNM A;  2CU5 A;  2QZ2 A;  1VP6 A;  1GOF A;  1RUJ 3;  2WS9 1;  2YGL A;  4CCO A;  4BQ5 A;  2I2S A;  1AR9 3;  4AR2 A;  1CAU A;  4Q4X 2;  1IOA A;  1MQT A;  4ASK A;  4NWV A;  2JWP A;  4LK7 A;  4NIH A;  5F9T A;  1W6O B;  1UKR A;  3WW4 A;  1NA1 B;  2QQK A;  4K8F A;  3NJY A;  4JHT A;  1S2B A;  3VKL A;  3WDW A;  3TNP B;  2QQM A;  3UYJ A;  4W6W A;  3O0W A;  2VBB A;  5FO7 B;  1H8T B;  3NL1 A;  1FMD 3;  3P3P A;  4Y1Z A;  1RMU 2;  4E4Z A;  3VDD B;  4UOJ A;  4YFW A;  2WJS A;  3T4H B;  4SBV A;  4H2A A;  4YVW B;  2XL9 A;  4KWL A;  4RHV 1;  1F5J A;  1MS5 A;  1W6N B;  2QKD A;  2ZX1 A;  4P9I A;  3T0B A;  1XJA A;  2W47 A;  4DMI A;  1RUG 2;  2FCT A;  4Y5Z 0;  3N7J A;  5A7S A;  1GUI A;  3GDB A;  5IVC A;  1H1A A;  1TMF 3;  4LBL A;  4BE3 A;  4AQ2 A;  4XIL A;  4Y33 A;  1UKG A;  1S0E A;  2BNN A;  5F5I A;  4E27 A;  4V2W A;  4MZU A;  4S2F A;  2D5H A;  2IVI B;  4AFC A;  3R6S A;  2VNV A;  1IPK A;  1YFU A;  5LRS A;  3ZYJ B;  4D0Q A;  4B4R A;  2VZR A;  4IV3 A;  4LIU A;  3O1U A;  1QJU 2;  4HSL A;  2VQU A;  1O4Z A;  1BMV 2;  3BOW A;  2XJS A;  3O7O A;  5A7W A;  3TB0 A;  4XUR A;  3RWK X;  4CU7 A;  2PHT A;  4BPZ A;  2RS5 3;  4A3Z A;  4EN7 B;  3Q8A A;  1RED A;  3TEX A;  4LHL A;  1RUO A;  3SCG A;  5I0U A;  3ON7 A;  4QHB A;  3M4F A;  2PAE A;  1Q8Q A;  2JB4 A;  3KF3 A;  3OD4 A;  3H8U A;  3QH6 A;  2BOJ A;  2Q30 A;  2XGX A;  2WNE A;  4HKW A;  5DQ0 A;  4Q27 A;  4CCN A;  2VXR A;  3C2U A;  4GWI A;  4AI0 A;  2W1W A;  1BLZ A;  4GB3 1;  3VD7 A;  3V56 A;  4E2G A;  1RUF 3;  1VR3 A;  2XBO 3;  1WMF A;  5BNP B;  5ANQ A;  3B3Q E;  3ZKY A;  2ORX A;  5FR3 A;  4QX7 A;  2JE7 A;  4PHZ A;  1IG3 A;  5GZE A;  4GKY A;  2XPJ A;  1RYY A;  5HCH A;  5F1R A;  2P5B A;  1VRH 2;  1W6M B;  4GMP 0;  4I0W B;  3S7I A;  2B8M A;  1RUD 1;  3PNA A;  4WZF A;  4BLJ A;  2B45 X;  3ETQ A;  3R05 A;  3VGI A;  2G1M A;  5FY5 A;  2ENR A;  3MI8 A;  4YVS B;  3RI8 A;  1JZ4 A;  3VKO A;  4M3C A;  1T6B X;  3LB9 A;  1CAW A;  5C4W C;  1RXF A;  1X82 A;  2D3S A;  2H0B A;  1RGS A;  4L11 A;  3PU8 A;  3ZXK A;  1PVC 2;  3ZYR A;  1KRI A;  3X29 B;  1US2 A;  2DDU A;  3NMB A;  1NY7 2;  4E4S A;  1H9P A;  3WY6 A;  2QQO A;  2GAU A;  4IV1 A;  1POV 3;  1Q8V A;  4Z82 A;  1J59 A;  1KQR A;  4NJ4 A;  5LAT A;  4IER A;  4DNY A;  1Q43 A;  4FPO B;  5FKC A;  3PVN A;  4IEX A;  3JQX A;  1XOY A;  3KCC A;  4D3W A;  2WZR 3;  1UYZ A;  1WA4 A;  3U78 A;  3UGG A;  4O9G A;  5F2W A;  2WLQ A;  1WKY A;  1OI6 A;  2VAU A;  4LUM A;  4QHZ A;  3WDX A;  1XXN A;  2RJ2 A;  4M4R A;  1HDK A;  4XJ8 A;  2WWJ A;  2AC1 A;  1ENX A;  2DBN A;  2VQA A;  2Y6H A;  3WP6 A;  4D7S A;  1W0N A;  4E4H A;  1VBE 3;  2VTX A;  3B9C A;  3JBG 1;  2BNO A;  5F5C A;  4WVW A;  2RMU 1;  1PGW 1;  2R6Q A;  3N3H A;  3J7H A;  3VZK A;  2HYK A;  5FRA A;  2W1U A;  4ES9 A;  1PGS A;  3ZFE A;  3I2F A;  4PIY A;  2AUY A;  2WNU B;  1VBD 3;  1XU1 A;  1HXS 2;  2UYA A;  4CYD A;  4D69 A;  2BYV E;  4N9I A;  3ZMO A;  3I59 B;  4P9L A;  2G9F A;  3PDQ A;  2R07 2;  1KS4 A;  4DY5 A;  2LTN A;  4P9G A;  3V65 A;  5HV0 A;  1IS5 A;  1OQE A;  2RV9 A;  2YFZ A;  5FZ9 A;  1MVE A;  4GH4 A;  3VHR A;  4CEW B;  3AC0 A;  4MG2 A;  1LHU A;  3ITQ A;  4QPW A;  4GIQ A;  1RUI 2;  1V6O A;  2TNF A;  4P00 B;  3VB9 A;  5CFC C;  3POI A;  5BY5 A;  1QY4 A;  3I3M A;  3LDB A;  1O3Q A;  1V00 A;  2W0X A;  2B4K A;  3PUS A;  4K1Y A;  2HWE 3;  2HWF 3;  4Q0V A;  1XE8 A;  4LKD A;  1ULD A;  1WLD A;  3H3L A;  3KHC A;  1WBF A;  2QQI A;  3FL7 A;  2YFU A;  4QDQ A;  1LR5 A;  3D3A A;  4RS5 B;  5F7U A;  1L7L A;  2WZE A;  3W5N A;  4H3W A;  3TBD A;  4LXL A;  4AI2 A;  5JXJ A;  1XBF A;  2XQR A;  4B8E A;  1PK6 B;  2FZ1 A;  3N35 A;  2ZEY A;  4BA6 A;  2J1S A;  5KHH A;  3A0N A;  1W39 A;  5FY1 A;  2ILM A;  4AHZ A;  4QQ2 A;  1UOJ A;  3KQR A;  3Q8B A;  4FPC A;  1ASJ 3;  2HWB 3;  1O3S A;  1VBA 2;  2A6X A;  3WF3 A;  5L19 A;  2ZX2 A;  3CJI C;  5LBB A;  1W2T A;  1AYM 1;  3POG A;  1QH6 A;  2DCZ A;  2WO2 A;  3RJR A;  1XSQ A;  1ZBE 2;  2ZS6 B;  4Q5O A;  4C0B A;  1R09 1;  1R1A 2;  4RL7 A;  1OOP B;  5ABJ C;  3RZJ A;  1WA6 X;  2GNT A;  1DLC A;  2QQW A;  1SLT A;  3DXU A;  3ILR A;  4XJ9 A;  1JYV A;  4OFG A;  2VUC A;  1AXZ A;  5KWR A;  5FZ6 A;  1GZT A;  2WS9 3;  2ZHM A;  4ZS2 A;  1RIT A;  1UPI A;  4Y1X A;  4XF3 A;  5IVJ A;  3C7F A;  4Q8K A;  2HWD 2;  3BN6 A;  1TQ5 A;  3R4D B;  2WN3 A;  2JIG A;  4YFZ A;  2ZKL A;  1K3I A;  4CP0 A;  2FDI A;  1RUE 2;  2BWC A;  4EV0 A;  3BPZ A;  3H3Z A;  4NRQ A;  1CAX A;  1KGY A;  4YSF A;  2RR1 2;  5LB6 A;  5I8Y A;  1JYC A;  5FZ4 A;  2RDR A;  5C8C B;  2GME A;  3LAG A;  1H4H A;  4UW4 A;  2VOX A;  1IS6 A;  4AE2 A;  3APB A;  3K51 A;  2NP0 A;  3TEZ A;  5EJZ B;  3B9I A;  2XH6 A;  2ARB A;  1UY0 A;  3I2D A;  4OMD A;  3V64 A;  5A1F A;  5HPO A;  5FZ3 A;  4HFS A;  1WD3 A;  4NRO A;  1GNH A;  1HQL A;  4D6Q A;  1GZW A;  5GZG A;  3UNP A;  4AZZ A;  1ZM1 A;  1FXZ A;  1LRH A;  2E9Q A;  1QNW A;  1DQ6 A;  1YJK A;  2ZGL A;  3H0O A;  4KNC A;  4YAR A;  3MIE A;  4RHV 3;  3NW4 A;  1LHW A;  4X8N A;  3UJO A;  2EA7 A;  1DG6 A;  4TXW A;  3A4U A;  5CYY A;  3USU A;  2IZW A;  4Y3O A;  5CIS A;  1POV 0;  3NAP C;  2QNK A;  4MET A;  3ZXE A;  3USS A;  4AVB A;  2EXJ A;  4YM1 A;  3WDV A;  4EN0 A;  4G4F A;  3RPQ A;  1X9T A;  1RVF 1;  5JXI A;  1UU6 A;  1ND2 C;  4ARX A;  1FPN 2;  2YPD A;  5F3G A;  3TN9 1;  3O1R A;  1QQP 1;  1RUN A;  3N9M A;  3DYM A;  3SIS A;  4OI2 A;  4AQT A;  2VOV A;  5FJH A;  3HR9 A;  4XUP A;  1O3R A;  5FYS A;  4N7U A;  3SH3 A;  3VL8 A;  1NCR B;  4AED C;  4COV A;  1POQ A;  3UJQ A;  5FMC A;  4RQP B;  4ATE A;  5HCB A;  4LBJ A;  4BQX A;  5K0U A;  2WO1 A;  1KIT A;  2ZX3 A;  2D6K A;  3GJB A;  3OEA A;  1KFU L;  2TBV A;  1LCL A;  4A44 A;  2RS3 2;  5I0T A;  4QPG C;  3I54 A;  4F3J A;  2OQ7 A;  3MF6 A;  5CZK A;  3UKV A;  1W9T A;  1CPN A;  2JDM A;  1LOF C;  1V6L A;  5FTT C;  5DDJ 1;  2BDR A;  4QQO A;  4AF9 A;  4GB3 3;  3E6D A;  1GZ9 A;  4MHU A;  4UBG A;  2HWC 1;  5AC9 1;  3EJK A;  3SCF A;  3LEM A;  4DIQ A;  2YDE A;  1I6X A;  1OXC A;  4XJA A;  3NO8 A;  5FOJ B;  4CUA A;  2VM9 A;  3T30 A;  1NOV A;  2Z5W A;  1RUD 3;  1X36 A;  3G6J B;  4Y24 A;  4FPH A;  2XLG A;  1JZ8 A;  1W8Z A;  1H8V A;  3AP7 A;  3I3D A;  1YIF A;  1OLM E;  2H6B A;  4AFD A;  1JYI A;  4MXW A;  3MUY 1;  3PHM A;  4YZ2 A;  2W9X A;  4N53 B;  1GYK A;  1W9F A;  2PFW A;  2RM2 1;  1NLR A;  2GSY A;  2D6M A;  5H9R A;  1WWY A;  4JRL A;  3K2O A;  3NKT A;  2EAL A;  1AL2 2;  4K21 A;  3AZZ A;  3VBH C;  2ARX A;  4JGZ B;  5KR7 A;  4R9C A;  4CCJ A;  1AJK A;  3HAG A;  4OHX A;  1YJL A;  3VBO B;  2VTF A;  4CU8 A;  3GAL A;  4HT1 T;  3C7G A;  5DUU A;  5K8S A;  3ZSL A;  2Y6G A;  3O0V A;  1BHG A;  1LUL A;  5FPZ A;  1Y9G A;  4XDP A;  5BNO B;  3I2O A;  1C8M 2;  1YFW A;  4XCA A;  4LKF A;  1SLB A;  1G9F A;  1YQC A;  2V5Y A;  4LA3 A;  5EJ3 A;  3VDA A;  4B4P A;  1BYH A;  3U07 A;  3JBG 3;  4V2V A;  3WNO A;  4YW1 A;  2RMU 3;  3K75 B;  4TLF A;  4CDU B;  4ASM B;  3J4U H;  3KMH A;  3WNN A;  1RJ8 A;  2F4L A;  3MIG A;  1GZC A;  2JG9 B;  1UYP A;  3HJR A;  1NX9 A;  3MO4 A;  1Y4W A;  2XR4 A;  4KBZ A;  4XQD A;  4WM7 C;  3ROU A;  3BTA A;  4AHW A;  1JUH A;  3M7A A;  3ZXG A;  1R08 1;  4UBH A;  3AKQ A;  4WV8 A;  5KHI A;  5GLW A;  1QMJ A;  4CP9 A;  1TE1 B;  4ISQ A;  4OCT A;  1QH7 A;  4QGN A;  3ZN6 B;  5BNQ A;  1CVN A;  1R1Z A;  3RSJ A;  2VO5 A;  3ME2 A;  5IK7 A;  2PHL A;  4EN9 B;  2YZ4 A;  3BAL A;  3NJV A;  4CTE A;  5FWJ A;  2BUK A;  1JZ5 A;  5ISL A;  1IGO A;  4JQR A;  5LCW L;  3OBZ A;  4NHM A;  4D8M A;  3W5M A;  1QXR A;  4AFB A;  5T52 A;  1AYN 2;  1RB8 G;  3KWV A;  1LOC A;  3AP4 A;  3WDU A;  4XF4 A;  1YIP A;  2VH9 A;  3KQ4 B;  4XAB A;  4BIF A;  4XAC A;  1W6P A;  1Q8P A;  4OMC A;  1UY2 A;  2LAL A;  1N1Y A;  5LW9 A;  2D6P A;  2ZEW A;  1Y9Q A;  2DF7 A;  4NUB A;  5IFT A;  2OT7 A;  4Q4W 1;  4YRD A;  3OGG A;  4ZPI A;  4RSU A;  3ORJ A;  1W8W A;  2IXL A;  3AZV A;  5GLT A;  2VD7 A;  5FYV A;  3U11 A;  3ACL A;  2VZU A;  2ZHL A;  4YG0 A;  3WG4 A;  1AYM 3;  1O5U A;  1HQN A;  1ZRR A;  1W8U A;  4UFM A;  4XC9 A;  3BUC A;  1KS5 A;  1R09 3;  4M3C E;  2RVA A;  4WVM B;  2LRO A;  2PQS A;  2VZV A;  1JZ7 A;  5A6Z A;  4IUG A;  1SDW A;  2E26 A;  5A33 B;  5JZG C;  2WUH A;  5FV3 A;  1DYO A;  5LEK A;  4R8H A;  4ET7 A;  4AQS A;  5C4W A;  1TME 1;  2OPK A;  1LEC A;  4YGC A;  2VL4 A;  1YQ5 A;  1J1L A;  4HK9 A;  4UFJ A;  2FDG A;  3WEZ A;  5A6Y A;  3LDR A;  4I09 A;  2CSG A;  5L9V A;  2BBV A;  5J1X A;  1RHI 2;  3SEE A;  4E2Q A;  3NJX A;  1MEC 2;  3HNY M;  3ZN4 A;  4E2S A;  1AJO A;  3HIF A;  1BEV 2;  2E51 A;  1UWW A;  1PMH X;  3OGS A;  1VE0 A;  4PDW C;  2Y6K A;  3Q8F A;  4AI3 A;  4OUS A;  1QJX 2;  2QZ3 A;  1MQT B;  1NE4 A;  4O61 A;  5C5T A;  2VZ3 A;  3KD4 A;  2R30 A;  2ADD A;  2FZ2 A;  2WSV A;  3ZXF A;  1RUJ 1;  2V4A A;  3MLK A;  1V9U 3;  3KGL A;  5KXD A;  3FBY A;  1VPH A;  1HRV 1;  1X9P A;  3EQE A;  5IVB A;  3UKT A;  4XMA A;  3FUO A;  2VBP A;  4M00 A;  5IUQ A;  4BQ2 A;  2IWG B;  1RVF 3;  3E6B A;  3LEK A;  1W8N A;  3BOP A;  3K77 A;  4EE2 A;  1JYW A;  1HX6 A;  2AH2 A;  3I7D A;  3MW2 A;  3TN9 3;  1QQP 3;  5T3N A;  1U0A A;  4F83 A;  4IXL A;  5C7G A;  5FRE A;  2W92 A;  4QU2 A;  3DXT A;  3S7E A;  5FYT A;  2EID A;  1KDK A;  2CWM A;  4XQW A;  4K6B A;  4YW4 A;  1A6C A;  1OQ1 A;  4AVS A;  2Z79 A;  5CFC A;  1LGC A;  3H9A A;  2A6Z A;  1FV2 A;  1FAT A;  4D6R A;  2VZT A;  5DZG A;  3VD5 A;  3SEP A;  2Q8O A;  3VBS C;  1H1I A;  4R9A A;  4XDO A;  4XAE A;  1AR8 2;  1GR3 A;  2B5H A;  4IV3 B;  2ZGN A;  2JEM A;  3DN7 A;  1BJQ A;  3N9O A;  3N9L A;  4LTA A;  5LEJ A;  3POY A;  1JH5 A;  3WUD A;  1RUC 2;  1E5H A;  2XJR A;  2XKP A;  2HJI A;  1B35 C;  1SCR A;  2HWC 3;  3EB7 A;  4GA9 A;  2BZD A;  5A7W B;  5AC9 3;  4LHS A;  2ZKN A;  2W95 A;  3CZU A;  2BW8 A;  3K4D A;  3J26 N;  2PHF A;  3RZM A;  2O0O A;  2WSU A;  2WT1 A;  4GQ7 A;  4S2H A;  4Z2A A;  3FHA A;  4O65 A;  4LNV A;  4AI8 A;  5JOX A;  5DPN A;  4CP1 A;  2DVF A;  3RDI A;  3CJI A;  1V6J A;  3ASI A;  1W2U A;  4N9H A;  1WLC A;  2PA7 A;  4XW3 A;  4RR3 C;  1QJY 2;  2VW1 A;  2QTW B;  2RM2 3;  3PIG A;  4LKS A;  4UW5 A;  3MIF A;  1A8D A;  5FY9 A;  2GNM A;  2JDZ A;  5ABJ A;  3JZV A;  2WNO A;  4ZXE A;  3M3Q A;  2CWS A;  2DVB A;  4M0H A;  4LBQ D;  3D5O A;  1DZQ A;  4HK8 A;  3UL2 A;  2A73 B;  2R0H A;  4PJY A;  5C9A C;  2VOK A;  3N9P A;  4GWN A;  1SG3 A;  4ZU5 A;  2ZTN A;  3HOB A;  4HPK A;  4BU2 A;  4M3C B;  4G9S B;  3OB8 A;  1CAW B;  4UI9 L;  4QHO A;  5A3P A;  5B4X A;  3INA A;  3PVO A;  3ZXA C;  1W9S A;  4XXP A;  5DN2 A;  4K1Z A;  5FLI A;  4IV1 B;  5C71 A;  1H2K A;  1AR7 2;  1ENR A;  1S2K A;  2C9A A;  4D7Y A;  1XQN A;  5FMO L;  3IBM A;  1YFY A;  1DGR A;  3BIW E;  4U2A A;  5KHK A;  1JOJ A;  3ZXL A;  1S4C A;  3IZO A;  1RC6 A;  1N3O A;  5JIA A;  3CF6 E;  1ZBA 2;  3WW2 A;  5FYZ A;  3WUC A;  1MS8 A;  4N43 C;  1LEN A;  4FPF A;  1UN1 A;  2VU9 A;  3HN3 A;  4I0A A;  4J1X A;  4TWT A;  1JBC A;  1R08 3;  3MHZ A;  5LA9 A;  1W28 A;  4UWD A;  3NAP A;  2WFF 1;  4Q2F A;  1V0A A;  4BCU A;  2C6S A;  4QGM A;  1UXX X;  3OSD A;  4HKL A;  4P9W A;  2DVD A;  3CIH A;  3JD7 2;  4S2G A;  4AK3 A;  4DFS A;  1ND2 A;  4H7L A;  5FXX A;  5FO9 B;  2DFB A;  1GBG A;  1LJ7 A;  4AAP A;  2KXL A;  3WNK A;  1PO1 1;  2VY0 A;  2C1F A;  2D3P A;  3PUI A;  3ZFE B;  2P1B A;  4FFF A;  4EZ4 A;  2D6N A;  1AR9 2;  4FPY A;  1BBT 1;  4XJW A;  3ZKU A;  4AED A;  4HON A;  4GJZ A;  3OPZ A;  1STM A;  3R4S A;  4ONU A;  4HN1 A;  3ZVX A;  1RUG 1;  2EIC A;  1NCQ C;  1JUI A;  5FZK A;  1OT5 A;  3WD5 A;  4BXF A;  4CCE A;  2YG0 A;  3E97 A;  4DB5 A;  3MFC A;  4HMZ A;  3OBR A;  4GH4 B;  3AP6 A;  1EUT A;  2I45 A;  4YLZ A;  2WFP A;  4QPG A;  3W21 A;  4ZHN A;  1CX4 A;  3KM5 A;  1HB4 A;  4LPL A;  4LO6 B;  4CUB A;  4Q4W 3;  2JJ6 A;  1CN1 A;  1G7Y A;  1LOF A;  2BER A;  3VKM A;  4AGG A;  4ZS3 A;  5FQ0 A;  2I74 A;  2VQ0 A;  5LBC A;  2GC2 A;  5J7M A;  2PHX A;  3OUJ A;  1FMD 2;  5HCA A;  4W50 A;  1TEI A;  3SCH A;  4FQZ A;  3ZR5 A;  5CAZ A;  1B09 A;  3HMY A;  4BOW A;  2AGS A;  2DU1 A;  1U5Y A;  2PHD A;  3NV2 A;  4TTG A;  1UPS A;  4Q0S A;  4IE6 A;  1NT0 A;  1LNS A;  1UMZ A;  4HLT A;  4XBL A;  4YVW C;  3C7O A;  3PJQ A;  4CCD A;  2ZGT A;  4ZZ8 A;  2YBK A;  2X5I C;  1TMF 2;  4QPI C;  4BK4 A;  3POF A;  5C3R A;  2RG4 A;  5C8W A;  4YWA A;  4XFH A;  3P1I A;  3J9S A;  3VDC A;  5BV6 A;  1UY4 A;  2Y0O A;  2P3J A;  4PF1 A;  3TRS B;  2ZZJ A;  1V6N A;  3ZYG A;  3WHT A;  3WQ7 A;  1TME 3;  2FQP A;  3CHX A;  4FBF A;  1WCS A;  3O5S A;  2E63 A;  5IVF A;  1SLA A;  3EYP A;  3VBH A;  1GKB A;  1N1V A;  2G9Z A;  5JXH A;  2V4V A;  2DWR A;  3GF6 A;  2E32 A;  4FPG A;  5KC5 A;  4GWM A;  4CDQ C;  4ORF A;  2GC1 A;  1M4W A;  4ATF A;  2PQQ A;  5HXM A;  5JI9 A;  3GZA A;  2RS5 2;  4PBO A;  4XDQ A;  5JDB A;  2GN3 A;  3O1V A;  2XLA A;  1GP4 A;  2ZX4 A;  3RZL A;  3AZY A;  3GHN A;  1OLM A;  3LFI A;  3S6P A;  3I2H A;  4DQA A;  2HH9 A;  2A75 A;  1C3H A;  2YXS A;  5EYY A;  3KT1 A;  3GCX A;  2FDF A;  4BMB A;  3PU3 A;  1OSG A;  1W2A X;  3WCS A;  3AMH A;  1RUF 2;  1HRV 3;  2MPF A;  2XBO 2;  2FDJ A;  2LRP A;  3RFR A;  2KD7 A;  2ZAH A;  1DQ0 A;  3DPR C;  4COW A;  2CGN A;  3ZFG C;  1VB4 A;  4WM7 A;  3MW3 A;  4NO4 A;  4Y22 A;  4AXO A;  1WD4 A;  1HRI 1;  1J84 A;  2QUO A;  1GZW B;  1OKO A;  4DXZ A;  2IUW A;  3O0X A;  2EXK A;  5C3O A;  2W39 A;  1QOS A;  4DZG A;  5F37 A;  2VVF A;  4QM9 A;  3KV6 A;  5FY0 A;  4HKO A;  4HVO A;  4QWN A;  1H6X A;  3LDK A;  3USU B;  5IYY A;  1LHO A;  3BTX A;  3LFM A;  1XU2 A;  1O6U A;  4V1P A;  4YVS C;  2VOW A;  3S57 A;  2IFW A;  4X6Q B;  1DP0 A;  1KD7 A;  2WLP A;  4UAP A;  5DG2 A;  1DZT A;  5T5L A;  3V0B A;  1OA2 A;  3NV4 A;  5A3O A;  1LU2 A;  3QAC A;  1QU0 A;  1DYK A;  1C28 A;  3AJZ A;  1XNC A;  1AX0 A;  1GWK A;  2JDN A;  3U4S A;  3FUQ A;  1I5P A;  3EXU A;  1IS4 A;  1MR5 A;  2WZR 2;  2FHR A;  2OPW A;  4ZZ5 A;  1PO2 3;  2P4E A;  1HB1 A;  2XJU A;  4KBB A;  4S2D A;  1QOO A;  3T4V A;  1Q56 A;  2QJV A;  2Y6F A;  3LGR A;  5FCC A;  2R06 1;  1VBE 2;  4NAM A;  2D6L X;  5L9B A;  3ZO0 B;  1QXJ A;  2NPI A;  1O4T A;  4QDS A;  4AI1 A;  3RJ2 X;  3AKR A;  5IK5 A;  2W1Q A;  2Y0I A;  5LA1 A;  1HV0 A;  4LOS A;  3BI3 A;  3AVS A;  4A2U A;  1JXN A;  1SBD A;  4PIZ A;  3U1X A;  2BWA A;  3WP5 A;  5FZ0 A;  2YUE A;  1VBD 2;  4DUW A;  5BNN C;  2VNO A;  1G9A A;  3WG1 A;  2JDA A;  3DCQ A;  5A3W A;  4IEZ A;  1IPS A;  3OGV A;  5JZG A;  4ZU4 A;  3RYK A;  2DCJ A;  4JDN A;  1PM4 A;  1T6G C;  2WT0 A;  4MXW B;  1VBB 1;  4MLO A;  1RUH 1;  4P08 A;  5E8A A;  2W2I A;  5FPB A;  3T2T A;  3UK9 A;  2HWE 2;  2HWF 2;  3B69 A;  3F95 A;  1PGL 1;  2QQJ A;  3OBA A;  3SKV A;  1VRB A;  3JB4 C;  3KV4 A;  2GZW A;  1A3K A;  1D4M 1;  1QEX A;  2Z4F A;  4ASL A;  3WHU A;  2CGO A;  2P6H A;  2ZGQ A;  1XE7 A;  4PI2 A;  4Z2W A;  4FAH A;  1BK1 A;  1K42 A;  2W68 A;  4PDW A;  4A3X A;  3AX4 A;  3WVJ A;  2EIG A;  1L3J A;  1VAK A;  2AEY A;  3GZT B;  1O8S A;  4C1W A;  4CCL A;  2G9G A;  3E5U A;  4H14 A;  3UGF A;  3URF A;  1Y7B A;  5FLH A;  2Q1F A;  3ZYP A;  3NVC A;  1W8O A;  1K5M C;  2GAL A;  3JB8 A;  1UIJ A;  1PK6 C;  3OY8 A;  4OHV A;  1RUE 1;  5LWB A;  4LBK A;  4B7E A;  1ASJ 2;  4B3N A;  1A8M A;  1L7Q A;  1VAM A;  2WFF 3;  5DUW A;  5GZC A;  5FZO A;  3O1S A;  5L9R A;  4XPV A;  1S55 A;  2F17 A;  5E6H A;  1CAV A;  2WO3 A;  2RE9 A;  3U75 A;  2WBK A;  4XFA A;  5D8A C;  1PO1 3;  3IDC B;  3K4A A;  1OOP C;  2GC3 A;  4L99 A;  5DZE A;  4U36 A;  2WS9 2;  2XJT A;  5EZW A;  1BBT 3;  2ETE A;  5C3S A;  4LUK A;  5IJR A;  1RUG 3;  3PUA A;  4FOW A;  3W58 A;  1WME A;  3VD3 A;  4CP9 B;  3FX3 A;  1D4V B;  1WMD A;  3III A;  1UYY A;  2ZX0 A;  1O7F A;  3ZSE A;  3ES1 A;  3NJZ A;  3VBS A;  4AW7 A;  3U14 A;  3U4X A;  2XUM A;  1YNA A;  2C5D A;  3MPB A;  3U10 A;  5A3T A;  3TEW A;  3D6E A;  3VKF C;  5A3L A;  4XUO A;  5KC6 A;  3BCW A;  5FZE A;  2XML A;  4XFB A;  4A7Y A;  1DBN A;  4W4Z A;  2VZQ A;  1D7P M;  3BPS A;  1EPW A;  4BXS V;  1LOA A;  2YB7 A;  3LSD A;  1COV 1;  1B35 A;  2ZOE B;  1UOF A;  5CG9 A;  4LK6 A;  4BME A;  2WN2 A;  2CY6 A;  2X8K A;  5A1A A;  3ZDV A;  3VZM A;  1Q8O A;  2YRO A;  1W6P B;  4RHV 2;  4CXW A;  2GH8 A;  1GNZ A;  4FVV A;  4Y5S A;  2Y26 A;  4COZ A;  3U37 A;  2XHK A;  3B00 A;  5EP9 A;  1JHJ A;  5SV5 A;  5FBZ A;  1UD1 A;  4QX0 A;  2R1D A;  3IPV A;  4W8J A;  4NIA A;  3IM0 A;  4L97 A;  3CEW A;  1H4G A;  3BTZ A;  5I0S A;  2VCM A;  4QX2 A;  1XPW A;  4KGG A;  2RDS A;  2LW8 A;  2ZAB A;  3VZO A;  3WDT A;  3AL5 A;  1JW6 A;  3M2M A;  1UZV A;  4IE0 A;  1PMJ X;  1MZ6 A;  3DKQ A;  4HSJ A;  3KV9 A;  2X10 A;  2CYF A;  5FZ7 A;  1GFF 2;  2RHP A;  4PF5 A;  4UW3 A;  4IDZ A;  1SLL A;  1GMM A;  4CXY A;  1FOD 1;  4Y1Y A;  2VZ1 A;  4Q4Y 1;  5C9A A;  1TNR A;  1CZV A;  5JPM B;  3LWC A;  3CKH A;  1UU4 A;  4D6S A;  2ZBJ A;  2ZAC A;  3J7M A;  4CU9 A;  1UIK A;  3RMX A;  5FMD A;  1WCK A;  4AOC A;  3NQH A;  5C4W B;  3VDB A;  3GZU C;  4JQT A;  1A34 A;  4QXB A;  4JC1 A;  3HNB M;  2DCK A;  4P9J A;  4AVV A;  4OVE A;  1E5I A;  2P3K A;  3HNM A;  2YY1 A;  3WXP A;  2B39 A;  1PZ9 A;  5FXV A;  2VZP A;  3F2Z A;  1FYU A;  2X09 A;  4P9Y A;  4CP2 A;  3B5L B;  2XWJ B;  2EXH A;  1FI2 A;  4N8M A;  4XHX A;  2Z69 A;  2Q1Z B;  5EQU A;  1HRI 3;  2QQL A;  4N43 A;  1RUD 2;  2JD9 A;  3I3Q A;  4EQV A;  2VC9 A;  4NN0 A;  1SCS A;  2JEN A;  3ELN A;  5F5Q A;  3MBW A;  1FT9 A;  1SZB A;  2ZMK A;  5IWF A;  3WT3 A;  1VMF A;  5AFB A;  2L9L A;  1AX1 A;  5FKB A;  1W99 A;  1N47 A;  1PIV 1;  1ULG A;  2IXJ A;  3L9J T;  5F6L B;  2GMM A;  5J09 A;  2BGC A;  4BLI A;  2VMI A;  2DCY A;  4MOA A;  3RS6 A;  4FOQ A;  2O8Q A;  4LBQ A;  4LMF A;  1V9U 1;  3T3Y A;  1GQH A;  3QD6 A;  5CEH A;  4PCR A;  3O1O A;  3B7M A;  3PL0 A;  4A7K A;  4OUL A;  4QQH A;  3C7H A;  3SH5 A;  1NCQ A;  5C3Q A;  4MUV A;  4XFG A;  4FPE A;  2W5F A;  4FQ4 A;  3VBU C;  4PLM A;  2D44 A;  3AYA A;  4CU6 A;  3ZYH A;  4CDW C;  2UY8 A;  1EV1 2;  2DU0 A;  3K46 A;  3LA3 A;  4MV2 A;  2R06 3;  4NPR A;  3SLI A;  5CFC B;  3ILN A;  3JBG 2;  2ZGM A;  1H2L A;  4CEY C;  1WCQ A;  2CDO A;  5EYX A;  5FZA A;  4BM8 A;  1PGW 2;  3OJB A;  4FT8 A;  4QAW A;  4LIV A;  3QH7 A;  2PMW B;  2A3W A;  1SBE A;  3N9Q A;  4G3Y C;  2BVV A;  2C0Z A;  4QMA A;  4LHK A;  3FLR A;  1AYN 1;  1REF A;  4SLI A;  1NXM A;  2BVB A;  5E88 A;  5CFD C;  1G86 A;  4YM0 A;  3UES A;  4Q0U A;  4H55 A;  2WYF A;  1W8H A;  2YU2 A;  4NHX A;  4YVW A;  1AR6 1;  1C4R A;  3HT2 A;  2ATF A;  3WIN E;  4YM3 A;  4XVH A;  4ARY A;  1HJF A;  1YYN A;  3LIH A;  2X5I A;  5L7O C;  1UU5 A;  4QPI A;  3FN9 A;  5FZF A;  4R52 A;  4IW3 A;  5ACA 1;  1LHV A;  1H1M A;  5CKN A;  1RXG A;  1CJP A;  2ZEZ A;  1WLW A;  5EWS A;  2UWA A;  1ALY A;  1QHD A;  3OPW A;  4BQY A;  1US3 A;  1OPM A;  3BB6 A;  3CJI B;  1A78 A;  3HQU A;  1HIX A;  3WSO A;  1VBB 3;  4I3G A;  1RUH 3;  3I2J A;  5T55 A;  1AHS A;  5J36 A;  2VJX A;  1Z0H A;  1YO8 A;  2BQP A;  2D40 A;  5DAB A;  4CDQ A;  3D82 A;  5F8P A;  2JD4 A;  3AMQ A;  5ABJ B;  1JYN A;  3UT0 A;  3DL3 A;  1D4M 3;  4NWW A;  4W6Y A;  1KJR A;  4KU7 A;  1MS1 A;  1V6K A;  2DUR A;  3WQ1 A;  1LOB A;  2ZHN A;  1WBL A;  3AM2 A;  3H1W A;  4LKE A;  3V0A A;  2Q8D A;  1O91 A;  5JOY A;  4FP3 A;  1J1T A;  3Q8C A;  3LA2 A;  3RMY A;  3H8X A;  1XNT A;  4HPK B;  1QDC A;  5IT6 A;  1RUE 3;  3N7K A;  3A0K A;  3I3E A;  1SDD B;  2J1E A;  2HBU A;  1GLH A;  4O9E A;  4CDX C;  1APN A;  5LZ6 A;  3KCY A;  1IKP A;  1AYM 2;  4GKX A;  1ST8 A;  4L2N A;  3DPR A;  3HQR A;  3ZFG A;  4A7Z A;  3K3N A;  3VZJ A;  1R09 2;  5LAS A;  3MFA A;  3I2I A;  1XNK A;  1QNY A;  2DUP A;  4MGI E;  2XON A;  3FC0 A;  4QQL A;  5A7Q A;  1QJX 1;  5EPA A;  4AAX A;  5LBF A;  1W04 A;  2VOT A;  1CIY A;  1XYN A;  5FK7 A;  1J3P A;  4XUN A;  3D0S A;  2EIB A;  3AKT A;  4YVS A;  4CRQ A;  3NAP B;  4P02 B;  5G05 L;  4NAO A;  1BMV 1;  1O8P A;  4XET A;  4RGG A;  2UYB A;  4AVT A;  2D97 A;  2E7A A;  5FUI A;  4Y1U A;  1I9R A;  2HKX A;  1ND2 B;  4BIS A;  4CCM A;  1W03 A;  3CZJ A;  3RZZ A;  1MS0 A;  5H9Q A;  3T0A A;  1AUY A;  4A41 A;  4TLG A;  3TAY A;  1ACC A;  1OQD A;  5F3C A;  1COV 3;  3O1M A;  4JKL A;  3M3O A;  1F31 A;  3ZPY A;  1S0B A;  3J7L A;  5JI7 A;  1ND3 C;  4AEJ A;  5J48 A;  4EYU A;  2ZGK A;  3DV8 A;  5FZI A;  3CMG A;  3VBF C;  1H0B A;  1WLT A;  1MQT C;  3W20 A;  4C90 A;  1RIR A;  5A3M A;  2CL2 A;  4QPG B;  3PTY A;  1GNY A;  4NHY A;  4M01 A;  2VUA A;  4D94 A;  5EJ1 B;  1PNF A;  1AR8 1;  2C4X A;  2JIC A;  5FP3 A;  1RVF 2;  4MGT A;  4YM2 A;  5LA0 A;  2OX0 A;  5BNN A;  4MGK E;  2QDN A;  2J7M A;  3TN9 2;  1GV9 A;  1QQP 2;  4W6X A;  4WM8 C;  2PHR A;  3M70 A;  4HVQ A;  1UX6 A;  2CV6 A;  5F2S A;  3NV1 A;  1SLI A;  3WG3 A;  4HBN A;  3H3U A;  1EAH 1;  4ERO A;  4YZ1 A;  3DGT A;  2ET7 A;  1RTV A;  1UAI A;  1FOD 3;  1YEW A;  4Q4Y 3;  4LO4 B;  2Y38 A;  3VBR C;  1BVV A;  4YNI A;  1UF2 C;  3MF9 A;  3NNJ A;  1PHM A;  3WQB A;  4XF9 A;  4CPB D;  4LQR A;  1JTZ X;  2WRA A;  5LRR A;  5A6Q A;  5FP4 A;  1UYX A;  3LSE A;  1H9W A;  1ULE A;  2Q8C A;  4DRV A;  5JOW A;  1PZ8 A;  3VBH B;  4Q4V 2;  3WW3 A;  3MPP G;  1CJD A;  2A7A A;  3VUO A;  1VBC 1;  1IPJ A;  3I3B A;  1BKZ A;  5DDJ 2;  5KXB A;  3QBQ A;  1EUU A;  1VB2 A;  2HWC 2;  2JEC A;  2UU8 A;  5AC9 2;  2XJV A;  2WO7 A;  4AFA A;  3EMR A;  4Z92 B;  2E7Q A;  3ES4 A;  5F39 A;  3N7L A;  2VMH A;  3FWE A;  2D93 A;  3BVC A;  1UZW A;  1K5M A;  4JKM A;  1UCX A;  3BTY A;  5JOZ A;  1DGL A;  4DXT A;  4DUV A;  3POS A;  3VHO A;  1GWM A;  4LBO A;  2MEV 2;  3TWI A;  5HXV A;  5CNA A;  3ZFF C;  2JG8 C;  1CAU B;  2IVJ A;  2RM2 2;  3JCI A;  4FOY A;  1ZA7 A;  1BCX A;  2PLV 1;  2VQT A;  2XVK A;  3M3C A;  3OPT A;  4DS0 A;  1PIV 3;  1FAY A;  4HET A;  5D8A A;  2DYC A;  5FWE A;  4A4A A;  2BU9 A;  5JVV A;  4FTE A;  1OOP A;  4Q26 A;  4LIT A;  2A71 A;  2ORZ A;  4WM7 B;  4Y22 B;  2PXJ A;  2ZGR A;  3P5B A;  2WZP P;  2IXK A;  1UMI A;  3OG2 A;  2OUH A;  1ZZ8 A;  2MNG A;  2VUD A;  4Y4Y A;  1HKD A;  4PT6 A;  2QE3 A;  1F9K A;  2CHH A;  1X8E A;  4IE7 A;  1UW8 A;  1UQX A;  3WF4 A;  1XB9 A;  5FFO C;  1XNB A;  3OYW A;  3V0B B;  4LOR A;  4K8R B;  4UYB A;  2K9Z A;  2GP5 A;  2VGD A;  1QKQ A;  1AYN 3;  2JKX A;  3FJS A;  1QJE A;  2ET1 A;  4A6S A;  2R04 1;  4F7Z A;  2HLE A;  1YRZ A;  4JV4 A;  3THP A;  2VMD A;  4YGE A;  1MS9 A;  2WAO A;  2BBA A;  1AR6 3;  5GLV A;  3LCP A;  1R08 2;  4BQ1 A;  2XL7 A;  4E4D X;  5DAX A;  5AFE A;  4AVC A;  2WWS A;  5EFU A;  1HQW A;  4CUC A;  1V70 A;  5ACA 3;  2VZO A;  4DXS A;  1N1S A;  1PO2 1;  2ES3 A;  5LK5 A;  1TZO A;  3LQC A;  2NQY A;  1W9Y A;  1XND A;  3VV1 A;  2JB8 A;  2EIE A;  3BU7 A;  3DKW A;  2LM3 A;  4YGD A;  4JGY C;  3VD9 A;  5I93 A;  3N36 A;  3QOP A;  5A3N A;  2OZJ A;  2RS1 1;  1LHN A;  1DHK B;  2PHW A;  3WNP A;  4AFM A;  3KT7 A;  2F4P A;  1UL9 A;  4KGQ A;  5HV4 A;  3R4U A;  2VXJ A;  1GP5 A;  4IEP A;  1PZ7 A;  1UY3 A;  2B42 B;  2YU1 A;  5EXO A;  4CCK A;  5JZG B;  4MGQ A;  1W05 A;  5FMO S;  1F4H A;  2OS2 A;  3ACH A;  4YGB A;  3RYR A;  1N3Q A;  4XBQ A;  4GAZ A;  4NVP A;  3IAP A;  4Q4W 2;  3M8L A;  4QB6 A;  3J8F 1;  2J42 A;  5FBJ A;  3ATG A;  5LK7 B;  4XFC A;  2GDF A;  1DCS A;  5FK8 A;  2X05 A;  2IC1 A;  3C7E A;  5DUX A;  1N3P A;  2W94 A;  1IZ3 A;  3S5A A;  3IT8 A;  1DLL A;  3ACI A;  2XJQ A;  1F35 A;  2VMF A;  4ITC A;  1KFX L;  4QX8 A;  3RI9 A;  3RNS A;  3UET A;  4P14 A;  4PDW B;  4X8P A;  3VN4 A;  5C5U A;  3WQ0 A;  4Z1V A;  5JUV A;  1OLR A;  5D1I A;  5APA A;  1ULP A;  4XF0 A;  1Z7S 1;  3BU0 A;  1QJX 3;  4JKK A;  1SQ4 A;  5C70 A;  4WVZ A;  3OY8 B;  2Q8E A;  2XKO A;  2VNG A;  3H7J A;  1REE A;  1SEF A;  4L92 A;  1LES A;  4HAN A;  4NRM A;  2K46 A;  2VW0 A;  3K3O A;  1AF9 A;  2NZ9 A;  4Q4X 1;  5FZO B;  2R16 A;  1JI6 A;  5KHJ A;  5F6K A;  1D2S A;  4Q29 A;  3I97 A;  1YI7 A;  1IQA A;  1ZZB A;  4XJZ A;  2Z42 A;  3O1P A;  1CAV B;  2DV9 A;  5CKM A;  1JU4 A;  4DXR A;  1FNZ A;  4MYE A;  1MS4 A;  4OI0 A;  2ZGO A;  2YC2 A;  4FP2 A;  5A32 A;  3VBU A;  1NUK A;  3GBG A;  1YQ6 A;  2V5D A;  2WNV C;  4MO3 M;  2D98 A;  4LBM A;  5FIX A;  4CDW A;  1PM7 A;  2DUQ A;  1RMU 1;  3TOJ A;  5JSO A;  3LE0 A;  4CEY A;  5JWP A;  1RUJ 2;  3LIG A;  3VBS B;  5IAX A;  4XQ4 A;  4FXK B;  3MIH A;  3AKS A;  1HRV 2;  3C8X A;  1KEX A;  2OII A;  4BHP A;  5CFD A;  1AR8 3;  1YI9 A;  2H6C A;  1U5I A;  3JQW A;  3MEP A;  4MGY E;  4A42 A;  2AEZ A;  4HN0 A;  3WG2 A;  1B35 B;  4RGA A;  3I2G A;  2QQP A;  1NA1 C;  1ZZ9 A;  4Q1R A;  4DY3 A;  3MYX A;  1H30 A;  5L7O A;  2ADE A;  2BFU S;  4RGK A;  3PME A;  1MZF A;  3IKW A;  4OI1 A;  1EAH 3;  1W8T A;  4QB1 A;  1QJU 1;  4KWJ A;  1H8T C;  1Q3E A;  2R32 A;  5FMB A;  2WQ8 A;  1QDO A;  4YW5 A;  3MW4 A;  2Y6L A;  3AKP A;  4P5Y A;  3ACF A;  4O7X A;  3AZW A;  3IPV B;  1WW7 A;  4CZS A;  1QIQ A;  1U12 A;  2W08 A;  1YUD A;  3KCX A;  3SC7 X;  5FZC A;  3VDD C;  1CZT A;  3ZIW A;  1CGP A;  2UWC A;  2VW2 A;  1ZRI A;  3W9A A;  2XWB B;  4M3C F;  1HN1 A;  1J58 A;  1ONA A;  2AAC A;  1QGL A;  3OD0 A;  5TSW A;  3T2Q A;  3SKJ E;  2AR6 A;  2YC0 A;  4AEK A;  3H1Y A;  1VBC 3;  5FXZ A;  5H9S A;  3MDP A;  3RGB A;  3T08 A;  2VR4 A;  3VHN A;  1XYO A;  3UV9 A;  4MHR A;  3ZSM A;  4OQ8 A;  2O1Q A;  3A22 A;  1JYX A;  2BPA 2;  2ZGP A;  3BIE A;  3WX5 A;  1DFQ A;  2Y33 A;  4NMI A;  2FCU A;  2X53 S;  1WUV A;  4MAD A;  4IE4 A;  3MLL A;  2EAK A;  1JYT A;  1HJG A;  4ZU7 A;  1VRH 1;  4CDX A;  3EO6 A;  3N4M A;  3GBW A;  2XLF A;  2WR9 A;  3AL6 A;  3AMM A;  2PLV 3;  1QJF A;  1ZRC A;  1E5S A;  1Q5O A;  1WGP A;  3PIJ A;  4ZY9 A;  5LA2 A;  1F2N A;  5FYM A;  3KT4 A;  1G9D A;  1URX A;  2O8O A;  2ID4 A;  4ES8 A;  3UGH A;  4RA0 A;  1PVC 1;  3KB5 A;  1CAX B;  1DIW A;  1G8W A;  3HEI A;  4GWJ A;  4N43 B;  1NY7 1;  5B4N A;  2VE1 A;  2WQ4 A;  5FYC A;  2ARE A;  5JR7 B;  2FMD A;  1NLQ A;  2E7T A;  4NPM A;  5BNP C;  1NQD A;  2FCV A;  4IEQ A;  2SLI A;  2VUJ A;  1YC6 1;  4B1L A;  4KQ7 A;  4OI4 A;  1ZVF A;  1F5F A;  1ZZ7 A;  1PX3 A;  2C26 A;  1QJZ A;  4UFK A;  3FHI B;  2VZS A;  1KDM A;  3H1M A;  3BGA A;  4FPJ A;  2ZXQ A;  1WCD J;  4C91 A;  1ZRF A;  1SBF A;  5A70 A;  5I0D A;  1DQ2 A;  4LBQ B;  4QM8 A;  1GIC A;  2XVL A;  3QLQ A;  1LB2 A;  4QXK A;  5T5P A;  5C33 A;  4C8D A;  1TG7 A;  1ND3 A;  4PIX A;  1UZZ A;  2R04 3;  1NCQ B;  1P8J A;  4IGQ A;  4LLO A;  1W6Q A;  3VBF A;  3OF1 A;  4GAL A;  3AYC A;  3OEB A;  2RJL A;  1K45 A;  4IL7 A;  2WAA A;  1GQG A;  3BYW A;  2JKB A;  1O4Y A;  1EPZ A;  3GM8 A;  5A7O A;  2WFF 2;  1LAJ A;  4XUQ A;  4IGO A;  5JMC A;  1HXS 1;  1DU3 D;  4IEO A;  2X29 A;  4I01 A;  2UWB A;  2V72 A;  3IB3 A;  3OBT A;  2R07 1;  4FI9 A;  1JN2 P;  2A1X A;  5DAP A;  4UFL A;  3JXS A;  4WM8 A;  1BVP 1;  4MGS A;  5FYB A;  5HCF A;  4YZ5 A;  1PO1 2;  3MIC A;  3OTF A;  5K0U B;  1RUI 1;  2RS1 3;  3RQ0 A;  1WMX A;  1BBT 2;  1XSR A;  4FPK A;  4IGP A;  2A6V A;  5D2A A;  5E1R A;  4YPJ A;  1LTE A;  4QKB A;  3A23 A;  4BZ4 A;  4DUX A;  2PTM A;  2WAB A;  2X5I B;  4PLO A;  3TEY A;  2VNR A;  3VBR A;  3KS7 A;  3LOB A; 
#chains in the Genus database with same CATH homology
 2QQL A;  2J1T A;  2JD9 A;  4OMC A;  1UY2 A;  3WF1 A;  3WNL A;  2W46 A;  2ZEW A;  2B9V A;  2VC9 A;  3MBW A;  3CQO A;  5IFT A;  2L9L A;  1W99 A;  1JZ2 A;  4DEV A;  4MOA A;  5EIY B;  1JU3 A;  2VZU A;  1YQ2 A;  2XHN A;  2LS6 A;  3C7H A;  2W5F A;  1UMH A;  5JXG A;  2RVA A;  2VME A;  2PQS A;  2VZV A;  4CU6 A;  1JZ7 A;  3ETP A;  3K46 A;  2E26 A;  4IUG A;  2WUH A;  1DYO A;  1WCQ A;  2CDO A;  4ET7 A;  2E31 A;  4QAW A;  2VL4 A;  3WEZ A;  3UES A;  5J1X A;  3SEE A;  1SHW B;  3NJX A;  3HNY M;  5IHR A;  1IQD C;  2W3J A;  2BGP A;  3T09 A;  4XVH A;  1UWW A;  1PMH X;  3OGS A;  3PUH A;  3ZM8 A;  4ARY A;  3FN9 A;  2Y6K A;  4KMQ A;  2ZEZ A;  3THD A;  4XZU G;  2VZ3 A;  3A7Q A;  1US3 A;  2C9K A;  3WSO A;  3HPN A;  3I2J A;  1JZ6 A;  2VJX A;  1JYN A;  4QDR A;  3LEK A;  1W8N A;  4QX3 A;  3K77 A;  4GZ9 A;  1JYW A;  1ULO A;  3NRU A;  1UY1 A;  3K4Z A;  5C7G A;  2W92 A;  2QQN A;  2EID A;  1K12 A;  1XNT A;  1OF4 A;  2BGO A;  3I3E A;  1SDD B;  2J1E A;  2VZT A;  3VD5 A;  3SEP A;  2CDP A;  4AG4 A;  2W1S A;  4PQQ A;  3MV1 1;  4OUE A;  4RYD A;  1OH4 A;  3WF0 A;  3I2I A;  3DYO A;  2XON A;  1CX1 A;  1T2X A;  3EB7 A;  4AAX A;  3WNM A;  2BZD A;  4LHS A;  2VOT A;  1CIY A;  1GOF A;  2W95 A;  3LPF A;  3CZU A;  4XUN A;  2EIB A;  3K4D A;  4P02 B;  5G05 L;  1O8P A;  4Z2A A;  3FHA A;  1TVG A;  2HYX A;  5DPN A;  3LEI A;  5FUI A;  4A6O A;  2QQK A;  3CZJ A;  3ACG A;  3T0A A;  2WDB A;  4A41 A;  4LKS A;  2QQM A;  3T2O A;  3GXU A;  3VD4 A;  4JKL A;  4ZXE A;  4L0P A;  4UOJ A;  3CMG A;  3T0B A;  2W47 A;  4E8D A;  1GNY A;  1SG3 A;  2W91 A;  3HOB A;  5EJ1 B;  1GUI A;  3GDB A;  2C4X A;  3OB8 A;  4UI9 L;  1F4A A;  5LA0 A;  5B4X A;  1W9S A;  5DN2 A;  1J83 A;  2J7M A;  5C71 A;  4D0Q A;  2VZR A;  2OKX A;  2VQU A;  4KWU A;  4XUR A;  4CU7 A;  2VCB A;  3HN3 A;  4A3Z A;  3WQB A;  4LQR A;  1UYX A;  1MPX A;  3ECQ A;  4QB2 A;  1UXX X;  3CIH A;  3I3B A;  5DQ0 A;  4GWI A;  1EUU A;  4M4P A;  3WNK A;  2W1W A;  3VD7 A;  4BJ0 A;  3PUI A;  2ORX A;  1RYY A;  2EIC A;  4JKM A;  4OYU A;  1OT5 A;  4DXT A;  2YG0 A;  4DUV A;  1EUT A;  1O59 A;  2Y64 A;  4BDV B;  4LPL A;  4CUB A;  1JZ4 A;  2VQT A;  2BER A;  4A4A A;  1NKG A;  1US2 A;  2DDU A;  2ORZ A;  4W50 A;  2QQO A;  1UMI A;  3OG2 A;  3LEG A;  4TTG A;  2QBX A;  1LNS A;  4PT6 A;  5JR2 A;  3C7O A;  4ZZ8 A;  1UYZ A;  3CDZ B;  1WKY A;  4BK4 A;  2RJ2 A;  3P1I A;  4M4R A;  3LPG A;  3VDC A;  2J22 A;  2Y6H A;  1UY4 A;  1W0N A;  1XC6 A;  4PF1 A;  3WF4 A;  1GOH A;  3GGL A;  4CVU A;  3EYP A;  3J7H A;  5JXH A;  2V4V A;  2JKX A;  2E32 A;  2VMC A;  5IFP A;  2HLE A;  2W1U A;  3E1F 1;  2VMD A;  2WAO A;  3I2F A;  2BBA A;  3P6B A;  3MUZ 1;  5HXM A;  4CUC A;  2VCA A;  2VZO A;  4DXS A;  1OF3 A;  3I2H A;  4HG6 B;  3LQC A;  2RV9 A;  2YFZ A;  2EIE A;  3AC0 A;  4QPW A;  2J1R A;  4P00 B;  2B4K A;  4A45 A;  2KD7 A;  3WNP A;  3DEC A;  2QQI A;  1J84 A;  1UY3 A;  3FL7 A;  2YFU A;  4QDQ A;  4MGQ A;  2E33 A;  1F4H A;  3ACH A;  3D3A A;  3FHQ A;  5F7U A;  4RN5 A;  2WZE A;  3THC A;  3W5N A;  2XQX A;  3IAP A;  1H6X A;  5IYY A;  4QB6 A;  5JXJ A;  1CZS A;  2ZEY A;  2J1S A;  1DP0 A;  2X05 A;  4UAP A;  3C7E A;  2W94 A;  3WF3 A;  3ACI A;  2VMF A;  3UET A;  2WO2 A;  2Y6J A;  1NAE A;  3IDA A;  3MV0 1;  4XUT A;  1I5P A;  2J1V A;  4ZZ5 A;  5JUV A;  1ULP A;  1DLC A;  1JYV A;  4JKK A;  5C70 A;  3C7F A;  2J1U A;  3NNG A;  3BN6 A;  1L7R A;  4QDS A;  2WN3 A;  3T2P A;  1JI6 A;  1K3I A;  3I97 A;  2W1Q A;  5LA1 A;  1JU4 A;  1KGY A;  4JX0 A;  4DXR A;  2YC2 A;  4DUW A;  1NUK A;  4OZO A;  5EJZ B;  4OMD A;  2JDA A;  1UY0 A;  2J1A A;  2V5D A;  2YC4 A;  4MO3 M;  5HPO A;  3OGV A;  3UNP A;  2R7E B;  2DCJ A;  3LE0 A;  1UXZ A;  4TXW A;  3WF2 A;  5CYY A;  3C8X A;  1KEX A;  4P08 A;  2QQJ A;  3OBA A;  3SKV A;  4A42 A;  5JXI A;  3I2G A;  2Z4F A;  4ARX A;  3DYM A;  1K42 A;  1R64 A;  4XUP A;  4QB1 A;  1GOG A;  2JE8 A;  1O8S A;  2WQ8 A;  2Y6L A;  4P5Y A;  3ACF A;  1W8O A;  2WYS A;  1CZT A;  1L7Q A;  2WO1 A;  3OEA A;  2VCC A;  1HN1 A;  4A44 A;  1GU3 A;  3T2Q A;  5CZK A;  3SKJ E;  2WO3 A;  1W9T A;  3T08 A;  2VR4 A;  2WBK A;  1W9W A;  5G04 L;  4QX1 A;  3K4A A;  2XOM A;  3A22 A;  1JYX A;  1JZ3 A;  1OD3 A;  5DMY A;  5IJR A;  4CUA A;  4BK5 A;  2VM9 A;  3VD3 A;  4MAD A;  3ABZ A;  3III A;  1UYY A;  1JZ8 A;  1GQP A;  3I3D A;  3I2K A;  4XUO A;  3MUY 1;  1UX7 A;  3A21 A;  4JHZ A;  3IAQ A;  2W9X A;  4W4Z A;  2VZQ A;  1D7P M;  5LA2 A;  4ZY9 A;  1H6Y A;  4BXS V;  2YB7 A;  2ID4 A;  2WZ8 A;  2WN2 A;  3HEI A;  4GWJ A;  5A1A A;  3T0D A;  5B4N A;  3U37 A;  2VTF A;  4CU8 A;  2Y8K A;  3C7G A;  1JHJ A;  4KI5 M;  2Y6G A;  1BHG A;  4QX0 A;  1PX3 A;  2C26 A;  4W8J A;  2VZS A;  3BGA A;  3VDA A;  2ZXQ A;  4QX2 A;  5I0D A;  3WNO A;  1XPW A;  4DEQ A;  3K75 B;  2LW8 A;  3WNN A;  1TG7 A;  5JMO A;  2W87 A;  1P8J A;  1PMJ X;  3HJR A;  2X10 A;  1NX9 A;  3MO4 A;  3OEB A;  1K45 A;  1GMM A;  2WAA A;  2VZ1 A;  3GM8 A;  1CZV A;  3CKH A;  4XUQ A;  4CU9 A;  3OGR A;  2V72 A;  3IB3 A;  1UZ0 A;  3NQH A;  3VDB A;  4FI9 A;  1PX4 A;  2ZEX A;  2VO5 A;  3HNB M;  2DCK A;  3JXS A;  4MGS A;  3NJV A;  3HNM A;  1XNA A;  1JZ5 A;  2VZP A;  3F2Z A;  5LCW L;  2X09 A;  4D8M A;  3W5M A;  3VD9 A;  3DYP A;  4YPJ A;  4DUX A;  3A23 A;  2WAB A;  4E8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...