1BCXA

Mutational and crystallographic analyses of the active site residues of the bacillus circulans xylanase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
185
structure length
185
Chain Sequence
ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATCGYQSSGSSNVTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutational and crystallographic analyses of the active site residues of the Bacillus circulans xylanase.
pubmed rcsb
source organism Bacillus circulans
molecule tags Hydrolase(xylan degradation)
molecule keywords XYLANASE
total genus 49
structure length 185
sequence length 185
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1994-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1bcxA00
1BK1A 1H8VA 3MFCA 1KS4A 3WX5A 1HIXA 1XNCA 4HKOA 2VULA 3B7MA 3AKPA 1XXNA 3VHNA 1ENXA 1OA3A 2F6BA 3WP6A 1H1AA 1HV0A 1C5IA 3AMMA 2DFCA 4XPVA 1QH7A 2JICA 3LB9A 2BWCA 1XNKA 4XQDA 1C5HA 1F5JA 3VZMA 3AMNA 4HKLA 3VHPA 3WXPA 3VZJA 2JEMA 3VL9A 2VG9A 4H7MA 2DCYA 1XNBA 3MFAA 1KS5A 1OLRA 3WP3A 2BVVA 2C1FA 1T6GC 1XYOA 3M4FA 3AMHA 1REDA 1UU5A 2B46X 1OA4A 2QZ2A 2DFBA 2D97A 3AKQA 3EXUA 3O7OA 3RI8A 2VUJA 4S2DA 3WY6A 2NQYA 1BVVA 4S2HA 2DCKA 3VZLA 2BWAA 3VL8A 5K9YA 1TE1B 1UU6A 4HK9A 2JENA 1H4HA 5K7PA 1HV1A 1H0BA 3WR0A 2BW8A 3VLBB 3WQ1A 4S2FA 3MF9A 4S2GA 2D98A 2Z79A 1NLRA 2VGDA 3ZSEA 2QZ3A 3AKTA 1OA2A 4XQ4A 1YNAA 1PVXA 1XYPA 2DCJA 3AKSA 3LGRA 3RI9A 1QH6A 3WQ0A 5HXVA 3VZNA 4NPRA 3MF6A 5EJ3A 3WP4A 1XNDA 1XYNA 1REFA 4HK8A 4HKWA 1AXKA 1UU4A 1H4GA 1BCXA 3VGIA 3AMPA 1W2UA 2B45X 3AMQA 3WQ7A 3AKRA 1OLQA 3B5LB 3VZOA 3HD8B 3VHOA 1REEA 4XQWA 1IGOA 2B42B 3VZKA 3WT3A 1M4WA 3WP5A 1UKRA 2NLRA 4IXLA 2DCZA
chains in the Genus database with same CATH superfamily
2VTFA 1T6BX 1C28A 2VAUA 1C8M3 4E4SA 2ZEZA 1RUJ2 2VCCA 5F5IA 4CEWA 3KCYA 4DNYA 3KT4A 1SQ4A 3UKNA 5A3UA 1BXHA 3RZKA 1UMZA 1BBT2 1TEIA 1WKYA 4XFIA 2CAUA 4Y22B 4NHXA 3MW4A 2OIIA 1R083 3VDDA 2BERA 1NG0A 2B7YA 5FY1A 1URXA 5C3SA 5LWBA 5T50A 5IATA 2WLQA 1XNKA 1KDMA 2P4EA 3N4MA 1UYXA 4OUMA 1QXRA 2HWC3 4YW7A 1W9FA 3WUCA 4QHBA 1ND2B 4AHYA 2E26A 1OT5A 4JVAA 1Q56A 4IEXA 3HMYA 2DCYA 2BEOA 2AUYA 1GQGA 4AI3A 1IPJA 3KF3A 4L8QA 1OLRA 4BDVB 1S0GA 2WIIB 1CJDA 1GBGA 5BY5A 1MVEA 2BQPA 3D4KA 4FOQA 4FPLA 2PHTA 1DGRA 5A3OA 1B35A 5DUUA 3AZZA 1WZXA 2DFBA 5LZ6A 3AKQA 3QD6A 3RI8A 3O7OA 4BQXA 2R073 2NQYA 4Z1VA 3THTA 5GZFA 1W6OA 4GULA 4Y33A 2RM22 2Z69A 3VKNA 4E2GA 2BWAA 2KM2A 4FTBA 5JSRA 5JVVA 1WMXA 5FMOL 4XBNA 4ZZ5A 3ZYGA 3K77A 4NMIA 5L9RA 1YQ2A 2PLV3 1SLBA 3IAPA 4Z07A 4F83A 5LBFA 2PFWA 1UO9A 2Y6LA 4D7YA 5CISA 2WQ4A 5I8SA 5FZ3A 4C1XA 5BNNB 1K5JA 2DBIA 3ZSEA 1OUXA 3OEBA 1U0AA 3GBFA 1RUF3 4IV1B 5A33A 2FDGA 2A5ZA 5LA2A 3T1MA 2VZVA 4YNIA 1PVXA 3CDZB 3FHIB 2NN8A 5FZ6A 5A3NA 4I2OA 1XE7A 2FD8A 3PU8A 4QM9A 2W92A 4UFJA 4AGRA 5C5UA 4XCBA 2RR11 3OBAA 1WUVA 2EVXA 4YZ1A 1NX9A 1ZA7A 3VBSA 2GN3A 1SCRA 4XABA 3S0MA 3RZMA 4KWJA 1NZCA 4CTEA 4BJ0A 3ZXDA 1X50A 5L7OC 4XFCA 4XJ8A 5A1FA 1W39A 1DQ4A 5J96B 1REFA 4HK8A 3T2QA 4R4XA 5FLHA 3THCA 3UV9A 4N53C 4XUTA 3SKVA 4IW3A 4TSVA 5ABJA 3OY8B 1I5PA 5FWEA 4Q4X1 1D4VB 4AAXA 3VKFC 1GP6A 1GZ9A 5CKMA 2FDIA 4DXZA 1Z7S2 1YIPA 1VBC2 4JGYC 1HRV2 1RJ8A 4KG8A 2BGPA 2AYHA 4K3UA 1DG6A 2R043 1D2QA 1WMEA 4QPYA 5AC93 4XZUG 5H9SA 5CFCA 3VZKA 1AL23 2VXRA 4YWAA 1UIJA 3DL3A 4NHMA 4QGNA 3PVEA 1GP4A 3SEEA 2CDPA 1GSLA 1O4TA 1H8VA 5F7UA 2PAMA 3WG3A 4A6OA 3T2TA 4UBGA 1OVSA 2VCBA 2WNVC 1RUI3 2HWD2 3AK0A 2Y6GA 1VAMA 1S0DA 1UZYA 5A7SA 1W06A 1JHNA 5FZHA 3AC0A 1UMHA 3HT2A 4BYYA 4XTPA 4YLZA 3ST7A 4ES8A 2DFCA 5LA9A 3QCWA 4JTNA 2K46A 1OKOA 1WW7A 1PZ9A 2Q1ZB 2YUEA 4LHSA 4RHV1 5LK7B 4CEWB 1CX4A 2UWBA 2AR6A 3JD72 3J7HA 4L2NA 3WLUA 1PVC3 5C9AC 4MXWB 5FK8A 3NW4A 1CQ9A 4F8AA 1FMD3 1F35A 1ND3A 1IOAA 2MHFA 2CTVA 3H50A 4J1WA 2BDRA 5TSWA 1FXZA 3LEIA 3NJXA 1GNHA 4HSLA 4ITCA 3SCGA 5A3MA 4CDQA 4N43B 1POQA 5C5TA 3AYAA 1OA4A 4NIDA 1ZZ7A 1N1SA 4K6BA 3O14A 4MO3M 2Z2SB 3TBDA 3ZM8A 5BNNA 2W1WA 3TN93 2ZBJA 1GUIA 1RUH1 3LFMA 4HT1T 1TVGA 4XF9A 5KHIA 3J8F3 1RUF1 3PURA 3MLKA 1S0FA 5C6CA 1Y3TA 1YUDA 3WDTA 5AVAA 2VQTA 1Q8SA 2A3YA 2TUNA 2XBO2 2XL9A 4QGLA 5K7PA 4COUA 1HV1A 3EO6A 2D6PA 2XJUA 4TXWA 1SBEA 3IB3A 4QDSA 4E4HA 1S0BA 3P5BA 4Q0SA 2YY1A 1UPSA 3NL1A 4SLIA 1IQAA 4FPEA 1PIV2 2TBVA 1O6UA 5F1RA 3PDQA 4FQ4A 1BVP1 4OI4A 4JGZC 1V70A 1W2NA 5HCBA 5FBJA 2Z79A 4E27A 2VGDA 1NOVA 3MLJA 1GWKA 3I7DA 4IQPA 4YM2A 4RL7A 5FV3A 5L73A 5JI9A 2CY6A 5CNAA 5FPVA 1FX5A 2JG8A 1BYHA 1RMU1 5C8WA 1OLMA 1A8MA 1N1YA 2ES3A 2W9XA 3I3BA 3MV11 3OG2A 1RUC2 5D8AA 3WQ0A 5IFTA 2A73B 2FZ2A 3QBQA 4AEKA 2NMNA 3HWJA 2CDOA 1SZBA 5BPXA 2O8OA 2DTWA 4NHLA 5JMCA 3WNOA 3ZIXA 4D7SA 2IC1A 4MGTA 3AB0A 4HKWA 4K9SA 3HVDA 5FUPA 4XVHA 5FKCA 4IE5A 2JDPA 3BIEA 4TZDA 1EY2A 2VOWA 2J1RA 4AVTA 5F3CA 4CEYC 3CZJA 3M8LA 3LPFA 4RS5A 3VDDC 4DUVA 5FYVA 3KGLA 1D0GA 2ZGRA 1H9WA 1OQ1A 4UOJA 1W2UA 1XQNA 4WM7A 5LY2A 3TAYA 3IMNA 1Q8QA 5LATA 1JZ2A 3HD8B 1A78A 3WW1A 3J9SA 5IW0A 4CUAA 1VR3A 4NIGA 2OT7A 1RYYA 3ELNA 1DQ0A 2LALA 3LIHA 2DDUA 4N7IA 2LTNA 2Y64A 2Y6KA 1AYM3 3I8TA 1BK1A 3K75B 1W3VA 4Q4Y3 1GOFA 3NAPB 2DVAA 1G86A 3RG0A 2WFF1 2CGOA 2ZX4A 5DG1A 4G9SB 4HBNA 1OQEA 3T0BA 4ZS3A 4Q0QA 1PNFA 2R30A 3DECA 4AQ6A 1PMIA 4KWLA 4XF4A 2G9GA 2X5IC 4FPGA 4LIUA 3CQOA 1DLCA 3N9PA 3N7MA 4AAPA 4P9WA 5FQ0B 2HWE3 5LY1A 1AYN2 2MEV1 3PTRB 1YFXA 1JUIA 2ARBA 4YRDA 3I49A 4JGZB 2XL7A 1AR91 3MPBA 4A4AA 1LESA 4I02A 4QB6A 2J22A 3A22A 1KXGA 4BWOA 3ZN4A 3W20A 3P1IA 4LK7A 5SV8A 1SPPB 2VG9A 4KBBA 3DCQA 4O9GA 2X8KA 3SMHA 4HETA 2R071 2FHRA 2WNUB 2G19A 2WT0A 1AXZA 2W2IA 4MXVA 4WVWA 4Y3OA 1BEV1 3RNSA 1SG3A 1CIWA 1T6GC 1O4ZA 4RD7A 5A6QA 5IVFA 4QDRA 2P5BA 3UGGA 3KWVA 1W0PA 4AFBA 3HNYM 4HMZA 5FYSA 1UU5A 3EXUA 2PXJA 4KMQA 3PJQA 3C3VA 4ZU7A 1OSGA 1LHUA 1UXXX 2DCKA 3NAPA 3VD9A 1FI2A 5A3PA 2ORXA 3DKWA 3POIA 4O65A 3ZPOA 1O5LA 5FR3A 4COYA 1RUE3 4ZZ8A 1DHKB 2PHLA 1MVQA 2XKOA 1CX1A 1XC6A 2YG0A 3RRDA 4PLMA 3INAA 2OZJA 3LSEA 3LOIA 3WSOA 3ZXKA 4CCNA 3POWA 5LEKA 5EZWA 3I3MA 2ZHKA 4A44A 2VMIA 2P3YA 3KSCA 1WBLA 2XVLA 4B4PA 1RUD3 4DQAA 5F5CA 2BW8A 5FYBA 1UPIA 1H8TB 1OLME 1CZTA 4EN0A 5D2AA 2ZPXA 1W8WA 5AFEA 1CPNA 1H6YA 4L97A 2QVSB 4BPZA 2PAEA 5CG9A 1U5IA 4FOVA 5E88A 3POSA 3MIEA 2VBBA 3O0XA 3THDA 1UOJA 1YI7A 1AR63 2WFF2 4FQZA 1ZBA2 3I54A 5GLWA 5JR7B 2E63A 2J1AA 4XF0A 4ZS2A 4WVZA 2GMPA 1COV1 4GQ7A 3ZR5A 4CDWA 3CJIC 3MDPA 2OYZA 2VOTA 1JU3A 5KXDA 1JYNA 4JKKA 3ZSLA 4HL0A 2QDRA 2GMEA 2JIJA 2YYOA 4KH9A 5J1XA 4Q0VA 5IK7A 3W5NA 1BEV3 1Z0HA 1I9RA 3RFRA 3EQEA 4QB2A 1H4GA 2VQUA 5FYYA 5GALA 1RVF2 3AMPA 1J83A 1CAUB 1STMA 4YW2A 4QQOA 3VZOA 3HJRA 1NA1B 1QU0A 4ATFA 4M3CA 3B01A 5JCTA 1J3QA 2FBEA 4XQWA 2JG8B 1C3HA 2VR4A 5LASA 1FNZA 3PMEA 4XIOA 5F9TA 5JLVA 4XFFA 4P14A 3ZSJA 1PGW1 1ZBE2 2DCZA 4RHV3 2ZGNA 3ETPA 4E4ZA 1H8TA 1DGLA 1EUTA 1NA1C 2W1QA 4LEJA 4META 4Q4V2 4WM8B 1Y9MA 3S5QA 3AL5A 2GNBA 1PO11 3M1HA 2WLPA 3AYCA 3RDIA 2F6BA 4PQQA 1BQPA 1H1AA 4W65A 1QJX2 1X33A 4EWDA 5CADA 3H3UA 1W8HA 3FBMA 1J1LA 4XPVA 4AWDA 2HYXA 4IEZA 3GXUA 3TOJA 2VU9A 2HLEA 1C8M1 2JB4A 1C5HA 3AJYA 3MHZA 4L11A 4C0HA 5BNNC 5A6XA 3H8OA 1ENRA 5GZCA 5CU1A 3J8F1 2QQLA 2G9ZA 4QHOA 3LCPA 3NV3A 4AOCA 4PI0A 1RB8G 3OGVA 2A6WA 2X29A 4LHKA 4AVSA 3MO4A 3JZVA 4NRQA 1W0OA 1AX2A 1V9U2 2VZ1A 1XNBA 3OPTA 3Q8CA 4D3WA 4ZHNA 1OURA 4H14A 5EWSA 3CF6E 4FAGA 2I74A 5DAQA 4D0QA 4LIVA 4Q5OA 2XH6A 3LA2A 2RMU2 4EZHA 1RHI2 3LFIA 2WO2A 4JGZA 4A3XA 4AEMA 1US3A 5F3EA 5FYZA 1TMF1 3ES4A 1LR5A 1V6OA 3ABZA 3UJQA 1XB9A 2DUQA 3DPRC 2BRTA 1PMJX 1RMU3 2CNAA 4HFSA 3HQUA 5FUIA 4HVRA 4QWNA 3V56A 1SDWA 1AR93 3VHRA 1PGL2 2W1UA 4YZ5A 1HDKA 4UBHA 3MYXA 5F32A 2Q8EA 2QQUA 1H4HA 5B2GB 5JDBA 2WZEA 1PO21 4UWDA 1RUNA 1AR73 3K3OA 3WCRA 4AHZA 3FWEA 4NWVA 2YFUA 4XJUA 4BLIA 1GICA 1CN1A 1PO13 3K4AA 5CFDB 4IEYA 1FOD1 1SLTA 3HIFA 3FC0A 5FZLA 4I09A 1SHWB 4LBKA 5ISLA 5C7GA 1GKBA 1XRUA 3KGZA 4YVSB 1WA4A 4A7YA 1DIWA 4INDA 3WNPA 2GP3A 2ZTNA 3K4ZA 4DB5A 2ZGTA 3LEMA 4LJHA 2WS92 4Q4V1 1VBE1 3O12A 5KHHA 4EYUA 2OUHA 2ZAAA 1S2EA 2WN3A 1HN1A 4WZCA 2VY0A 1CVNA 3POBA 4LKSA 5IAVA 3J7MA 1CAWB 2X09A 4C91A 1XJAA 2RS51 5BNPA 4NO4A 5FYIA 4OQ9A 4KL1A 3WW2A 4O61A 1W9WA 4LTAA 1UW8A 5EJZB 1TG7A 5FXWA 3UNPA 1R093 3B9IA 2WINB 5A3WA 3JB4C 4OI1A 4L0PA 1GQHA 4ORFA 2YZ4A 3ZR6A 2XONA 5JWPA 1K5MC 2D6LX 3OTFA 4FXGB 3MIBA 1REEA 2JIGA 2B42B 1QJY2 1Q43A 1AR61 3KB5A 4UW4A 2WZR1 4AGVA 3LEKA 2CGPA 4QDQA 1QOTA 2QQVA 3DPRB 4DUXA 4WM8A 2D6MA 2YPJA 4HKOA 4YM3A 1EV12 4UFKA 1ND2A 1Z7S1 5E6HA 2YBSA 2BU9A 2E51A 2VJXA 2XLGA 1S0CA 2EXHA 3OUJA 3WF2A 1OPOA 2FMDA 4I30A 1U12A 5F3IA 4AFDA 2HWF2 4BCUA 4YVSC 3O1VA 1WWYA 4RQPB 1AYN3 2ZGSA 2HWE2 3W5MA 4YGBA 4CP1A 2FCVA 2CSGA 4Y26A 2X05A 4LOSA 5FREA 2BBAA 3IAQA 1NKGA 4AF9A 3VL9A 5FMOS 2GU9A 1K45A 4Q2FA 4PBOA 1DZRA 3POEA 5IT6A 2RS32 3MUY1 5JMOA 2WJSA 2ZEWA 4CPBA 4P9GA 4FP2A 1FMD1 1YC61 3AMHA 4XZPA 4Y5Z0 5LBCA 4PLNA 5JXGA 3T0AA 3ZXFA 4J25A 2LS6A 1YYNA 2HWB3 2C26A 3V65A 3POYA 5HPOA 3RSJA 2FQPA 2J1UA 4OULA 1Q3EA 5GLZA 1ENSA 4DZGA 4XACA 4AGGA 2B9VA 3UGHA 1RVF1 1ZRDA 3V0BA 2E6VA 4LBLA 2E33A 4DY5A 3KVBA 1TNFA 2ETEA 4DUWA 5JIUA 1NCRA 4LO4B 4UYBA 2CWSA 4P5YA 1PX4A 1D4M1 3JUUA 2FDHA 1GFF2 1W6NB 2WR9A 5T54A 1W9SA 1GV9A 1NQJA 3OF1A 2XB6C 4E8CA 4Y1ZA 3HR9A 1AX1A 3WUDA 3O1SA 3NJZA 4GZ9A 1TME1 1RUG1 2LUWA 3LKJA 1HRI1 5DUVA 4D7TA 4EWAA 2FCTA 3F2ZA 1POV1 5L9VA 2HJIA 4KG0A 1WD3A 2ZHNA 4Q29A 4QXKA 2JE8A 3WV6A 4AI2A 1UOBA 1QJU3 2RDNA 2GC1A 4WV8A 4BU2A 5DPNA 5CAZA 4OI0A 2A3XA 5FY8A 4X8NA 1SLLA 5G04L 5L19A 5C4WB 4MADA 2HEWF 5FPUA 4YG6A 4LE3A 5HI0A 3J8F2 1BLZA 1OOPB 2LW8A 3CKHA 2ZS6B 4YZ4A 5JI7A 1QJFA 4IUGA 4QT6A 1UZ0A 2RVAA 3W21A 1DBNA 3ZVXA 5JSOA 3GZAA 3H1YA 1UNBA 4XF3A 4URAA 3BTXA 2D43A 4AYUA 3JXSA 3K51A 5EYYA 1JZ7A 3D82A 4Z82A 4WZFA 4M00A 4BMEA 3E6CC 4LNVA 3KCXA 3N7JA 4I0AA 4QPGB 4GIQA 2D7FA 4BE3A 3ZFFB 4YM1A 4FOWA 3AKPA 5FZ7A 1O4YA 2Q30A 4NIAA 1KITA 3I2HA 2DUPA 4LLFA 1DU3D 2DV9A 4BXSV 2UY8A 1C5IA 5KWRA 2JICA 2TEPA 4CCOA 1W8TA 4AVBA 3OCPA 4GJYA 2R061 3DPRA 3FFZA 3OGRA 4UW5A 3DGTA 1VBA1 5DQ0A 3PJYA 1AR81 5JXIA 3OYWA 4Q0UA 3O1RA 1MPXA 5KC6A 3ZMOA 2W87A 4Q4W1 1PIV1 3N9NA 2QQPA 5FZIA 5I0SA 1LOGA 3LPGA 1GNZA 3I2GA 5F2SA 4FPFA 5GLVA 2ARAA 2D3SA 3HN3A 1X7NA 1KS5A 2GDFA 2UYBA 4DXTA 2BVVA 2DWRA 2XLFA 2YGMA 4AEDB 2C1FA 1M06G 4QX8A 2R1DA 4HANA 3HBKA 1GLHA 2VZRA 4RR3A 1REDA 2B46X 2WFPA 5F37A 2NYYA 5AC92 3FN9A 3HQRA 3NV1A 2R042 2GH8A 1L7RA 4LBMA 1ZRFA 3GHNA 4AVVA 1HRV3 1S2BA 2OPKA 1VBC3 2EIGA 3ENRA 2P3JA 2YGLA 4JHTA 2GNMA 5FBZA 1XSQA 3JCIA 1W2OA 2QQMA 1QQP2 3ZO0B 3W9AA 1UYPA 5IFPA 1RHI1 3I3DA 3O1PA 1LOAA 4KGGA 5J36A 2PHXA 3GZEA 2WWUA 2F17A 5L7OA 3AZWA 1W2AX 3Q8EA 3N36A 4P9IA 3OUHA 3IBMA 1SEFA 4YARA 2C5DA 3JBG2 4FCAA 4KWUA 5B4XA 4A42A 2B39A 2WL1A 2X53S 2O14A 3FUQA 4ONUA 1MZ5A 3DYOA 5C4WA 2BFUL 1PK6A 5GLUA 1IHMA 1QXJA 3X29B 3ZXAC 4K21A 4QKFA 5CYYA 4XQ4A 3VBOA 5GZEA 1ZZ6A 1MEC3 3ALQA 2FCUA 3AXEA 3MICA 4LBQB 2D5HA 4CU9A 2A1XA 3TWIA 1LB2A 3A4UA 3ACFA 3WHTA 4A45A 2N7GA 2ADEA 5I8YA 5LA0A 3GCWA 2JE7A 1X8MA 1W8OA 3NNLA 5FMBA 4BMBA 2WNVA 1ZM1A 2P3KA 4JC1A 2C9AA 5BYNA 2GSYA 1E5SA 4Y20B 3ZXEA 2ZJCA 4HVQA 2HYKA 2PELA 3MI8A 1ZBE3 1W8NA 4CDXC 5BNPB 1NY71 5CKQA 4Z2WA 4FPCA 3GJAA 2JG9B 5IAXA 1BMV2 4AFAA 2GNTA 3N9LA 1V6LA 2Z5WA 3VBSB 3KHBA 4DMIA 4ASMB 3B9CA 4PDWB 1R1ZA 2XR4A 5ACA2 2VMDA 2RM23 4AZZA 1Q8PA 2ZGPA 3D0SA 1J3PA 1LGCA 2PQQA 3B5LB 3B93A 2PHWA 4GB33 5FMCA 2BNNA 3O0VA 4TYSA 4FFFA 3WHUA 5IVBA 5IHRA 2W94A 4FBFA 4MHUA 4M3CF 1UN1A 2ZHLA 5EFUA 4GMP3 3WT3A 2NLRA 3BN6A 2HEYF 4AEDC 3FUOA 1UY4A 2YU1A 1UOFA 2ZZQA 4L92A 3DEMA 2BBVA 4NHYA 4XDQA 3C7FA 4LR4A 4XILA 1UOGA 5EP9A 5JXHA 1UKGA 3IZOA 2W47A 4EN7B 5FYMA 2WKKA 2ZX2A 3OEAA 4NIHA 1ZBA3 4JDOA 2IXCA 2WFF3 2GN7A 2XVGA 1WMFA 1AR62 2SLIA 5JPNB 3C7GA 3D8CA 1KEXA 2A75A 1ULGA 2BWCA 1I3HA 3VD3A 4EQVA 1RC6A 3PU3A 4CDUC 4PLOA 1RL3A 3IDEA 4Y4RA 3O1MA 1DQ6A 3SCFA 2WRAA 1S2KA 4TN7A 1ZYBA 3BALA 5J98B 3RZZA 3UK9A 1AHSA 1HRV1 2BJSA 4MV2A 1NXMA 1BBT3 4H7MA 1UY2A 4YW1A 4GJZA 5E89A 4M01A 1UXZA 2W5FA 1RUE2 1RUJ3 1LEMA 3APBA 1C8M2 1XYOA 2X5IB 4OMCA 1PMHX 4N43C 3E5QA 2XUEA 5LBEA 3VV1A 1W05A 3PUAA 1MS9A 4XCAA 5IK5A 3BODA 2EXJA 3WCSA 2BVBA 2XG3A 3ACHA 4IEWA 2FDFA 3WD5A 1N3QA 2ZGQA 5JZGA 1IS6A 1TME3 2RR13 4QX5A 4XFHA 4ZY9A 5FDBA 4ZONA 4IGOA 4QPIC 1OKQA 2PMWB 2BOIA 1V6KA 4IV3C 5FPAA 1QGLA 4QKNA 4QQ2A 1VE0A 1WD4A 1W6QB 4HK9A 1O8PA 3FMGA 5FP7A 5CKNA 3HOBA 1AZDA 1UZZA 4FXKB 4J1XA 1GP5A 1H2LA 2J7MA 4YVWC 3O0WA 4Y1XA 1XNAA 4QPIB 3MZHA 4WVMB 2VH9A 1YQ6A 4LO8A 2P34A 2AC1A 3JU9A 3H1MA 3SXWA 1JZ8A 1H2MA 2WO3A 4GB32 1PZ8A 2W95A 1SLIA 5K0UA 3DXTA 3A0KA 4LO5B 3AKTA 2CHHA 3SH4A 1YFUA 4CEWC 1OFNA 1E5HA 3ECQA 3UJOA 4U2AA 2V4VA 4XUNA 3FZ3A 5HXVA 1VRH1 1IS4A 4NPRA 4QKDA 4OQ8A 2EAKA 2ILMA 2LM3A 2R16A 3J26N 4QPGA 4W6XA 3IDAA 4ISQA 2A3WA 2YC4A 1V6IA 1VB2A 3DUIA 1EAH3 3CBNA 5DG2A 4BZ4A 4Q4Y2 4G3YC 1AYM2 3TB0A 2QCSB 1AXKA 1MEC2 2AACA 4FFGA 4LHNA 4W8JA 1WCUA 2BYVE 4K7JA 2I07B 2J1EA 3UYJA 2B45X 2D6KA 3ACGA 4W6YA 5KHJA 3SITA 5EXOA 2FDJA 4LITA 1ODNA 2JWPA 4QD2A 5LRRA 4QX7A 4KWKA 5FY5A 4P02B 1O59A 1LGBA 5KXBA 4AHWA 5CA6A 3LF7A 3ZX7A 1QKQA 2B4KA 1GR3A 3JB8A 4JHZA 1K42A 1KD7A 3CEWA 1RUOA 3ZYJB 4MVTA 3CO2A 1JODA 1HIXA 1AL0G 1QQP3 1W6PB 2VO5A 5LRSA 1OFSA 1X36A 2F4LA 2CL2A 1RUC3 4UW3A 3VHNA 5FZFA 1ENXA 1OOPA 4MUVA 1J3RA 3PHMA 3ZN5A 4YVWB 4B1MA 4B7KA 3H8RA 1DFQA 4QQPA 1CAWA 1LU2A 1X9PA 4RR3C 5J37A 4KQ7A 3BUCA 3KS7A 2OUJA 2Y60A 4TLFA 1RGSA 1RUE1 4K1ZA 1FV2A 2H6BA 3M3EA 3GF6A 3CHXA 5ABJC 1OH3A 1ZRRA 1ULEA 1HJGA 3ZDVA 1SACA 4BQ3A 5FYTA 3VHPA 1FT9A 4CP9B 4Q1RA 3DXUA 5IVVA 5BXXA 3KVAA 4XC9A 1DYPA 1E57A 2JEMA 2V5YA 2H0BA 2HWB1 1UAIA 1X8EA 5GLTA 4WM7B 5IVJA 1SPPA 3WP3A 4PIZA 3MBWA 4X6QB 4AQTA 2WS91 4OI2A 2V09A 1DQ5A 1JUHA 3MGUA 3EBRA 5C4WC 2WWJA 3VBFA 2VQAA 1PK6C 2D6NA 3N9QA 2D97A 2ET1A 4ISRA 2JDUA 3NV2A 2DVDA 3E5XA 3BIWE 4BQYA 3ZKUA 2G1MA 4FPHA 4U36A 2YV8A 3ZFGC 4D6SA 4DEVA 1Q8VA 3KZ4C 3I2OA 4RN5A 2UY9A 4GMP0 4AEJA 2R063 3VBHA 4N53A 1H2KA 4IV1A 4J6GA 3GZUC 3U37A 2XQRA 2EIEA 2VW1A 3LDBA 4CDWC 5FPLA 2ADDA 4Q4X2 2R062 3MUZ1 4W4ZA 3B3QE 2GC2A 1H0BA 4ZU4A 4B8EA 3VLBB 3H8XA 3WQ1A 1KFUL 4S2FA 1QHDA 1NXD1 2ZEXA 4XUQA 1GYKA 2VCMA 5CFCC 1JZ5A 4E2QA 1GWLA 4DXRA 4MGKE 2UWCA 4FFHA 4GXLA 4QX0A 4RGAA 3U4SA 1O3QA 5C8CA 3VBSC 4FVVA 1AYM1 3VDBA 2OZ6A 3ZN6B 5D21A 4BXFA 3S57A 5A70A 3LZZA 3R4SA 1W99A 3B94A 4PIYA 3ZN6A 4FPKA 2HEVF 4GWNA 2P17A 3VZNA 4AEDA 1RXFA 3LAGA 4FTSA 4DXSA 1QJU2 2C9KA 4LORA 5DDJ1 5FIXA 1NAEA 3SLIA 3WDXA 2OVUA 3P3NA 4Z8BA 3QH7A 2WABA 2YC0A 3PLQA 4XBQA 4A6SA 5FFOC 1X9TA 3BKZA 3VBFB 1XYNA 5FPXA 3R4DB 5CFDC 2ZX3A 3Q8FA 1SBFA 2E32A 5JSPA 1W6MB 3E5UA 4X8PA 3WVJA 3ZOIA 2RJLA 4IE4A 5IUQA 2GALA 2K2SA 4XHXA 2P6HA 4FFIA 2Q5TA 2QQJA 3WNKA 1GMMA 4GAZA 4OHYA 3NNGA 2YB7A 2NM1A 3RWNA 2WBKA 2HKXA 2JD9A 2ZMNA 3NNFA 2DU0A 2JXAA 3M70A 4R8HA 4B3NA 2IXIA 3CMGA 3U07A 4E9KA 3VKOA 2EALA 5FJKA 2HBTA 5LBBA 4CDQC 5C71A 3ACLA 5FK7A 3ZLIA 3ZPYA 3PVBB 2VZUA 3K48A 5LEJA 1BHGA 3QACA 4MGSA 2HWE1 1JOBA 2ZKLA 1T2XA 3POGA 1TMF2 4NJ4A 3L9JT 2C6SA 1IPSA 3ZFGB 1ND3B 4BQ1A 4E8DA 3ASIA 5FO9B 2O0OA 1OUSA 1LJ7A 2HWB2 2FZ1A 4EN8B 2HH9A 2D40A 5IJRA 1RUF2 1YRZA 2JDMA 2XJPA 2PHFA 5B4NA 1KQRA 3H3LA 4XEZA 4DO0A 3VBUB 1LOBA 1LU1A 5A6ZA 3IPVA 3BI3A 1PO22 3RYPA 1JZ3A 4MLOA 3VZMA 3VD5A 4IV3A 1VIWB 4YPJA 3R0RA 2C0ZA 1EYBA 1DQ1A 2D3PA 4JDNA 4NUBA 2RS13 4AXOA 3PNAA 1MQTC 4YVWA 5LCWL 2CU5A 1NQDA 4XMAA 1O3TA 4QMAA 3M7AA 1VBB1 1OHFA 2PN5A 2P37A 2PHUA 3LD8A 3OD0A 1ASJ2 3GNEA 5FKBA 1MQTB 3RGBA 3S6PA 1YIFA 2HWF3 1RUJ1 3GBWA 3BOPA 2XOMA 4UFMA 4HG6B 1VRH2 4YW4A 4NR1A 1S55A 1Q8OA 1UY1A 1QJU1 2GC3A 3RVHA 5J7MA 3LEGA 4JX0A 3HNBM 5IVEA 4GH4C 3BU0A 3AVSA 2UU8A 4FPJA 1V9U1 4PT6A 1VMFA 5FP4A 1Y9QA 2C24A 4AQ2A 1Y4WA 2ZAHA 2XJTA 1PHMA 3PUHA 3WG4A 3BU7A 3IDBB 3TYJA 3NJVA 1GZWA 2ATFA 1QF3A 1UU6A 1OMIA 2PAKA 4LQRA 4P00B 5A7QA 5CB7A 1MEC1 1YQ8A 3RZGA 4Q27A 3AFGA 4LMFA 1J59A 4OUSA 1TME2 4Y1VA 4XFGA 5FZEA 2K9ZA 4PI2A 3FL7A 1RUC1 4Y5TA 3RMXA 1W8FA 1V6NA 1XE0A 2Y8KA 3I3QA 4N7UA 2D6OX 3C7HA 4C90A 4FO9A 2EICA 2QJVA 3RS6A 1FATA 1K5MA 3KCCA 1YNAA 3NVCA 4YGEA 3UT0A 5F8PA 2VC9A 3U75A 1XE8A 2VMGA 3NKTA 4M3CE 3V0BB 1G9FA 1L7LA 2VE1A 4CUGA 3WQBA 2D3RA 1OQDA 1P8JA 3T1LA 1JYVA 3PUIA 4I3PA 1S0JA 1G9DA 3TEYA 3HAGA 3I59A 4GB31 5EJ3A 5LK5A 2OKXA 1UYZA 1ND2C 4UF0A 3WZ1A 1VB4A 3QH6A 3VBRC 1LNSA 5C3OA 2VZOA 4CDXB 5C8CB 2HWF1 3Q8BA 4XBLA 3VBUC 3P6BA 5I93A 2WS93 3WEZA 1WCKA 1NE6A 2RV9A 4LBNA 3O1UA 4AR2A 5IYYA 1HJFA 2VZPA 3AKRA 2JDHA 4Q4W2 1LHOA 4V1PA 1W04A 3ZYFA 3GDBA 3W59A 5A6YA 5DAXA 4CU7A 1A3KA 2QFEA 1U5YA 1IGOA 1QMJA 3LA7A 3SISA 1L3JA 3WP5A 4COWA 4LO6B 3L2YA 1JBCA 4BQWA 1AR72 3BPSA 3GJBA 1W9TA 4XIKA 2BGCA 4GWMA 3D0JA 3HT1A 4IV3B 3WX5A 1ZA4A 1AR92 2QQOA 4ARYA 4IE7A 1JMUB 3I3EA 1HQWA 1XPWA 5A80A 4UAPA 2UURA 5I0DA 4GH4B 1VALA 1W6QA 2XJVA 5ACA3 2J1SA 3CJIA 1QDOA 4DS0A 1LTEA 1HW5A 4CU8A 3THPA 2ZZJA 5FZ0A 5I0RA 1CZSA 2WT2A 3ES1A 3FBYA 4TWTA 5T55A 3ZFEA 1WCDJ 3G6JB 2RMU3 1H1IA 4P9JA 3VBHB 4COVA 1EV11 4DFSA 3HPNA 3D3AA 3KT7A 5C3RA 1QJZA 4IV1C 1Y7BA 5AC91 2RJKA 2XKPA 3OUIA 3SQOA 3VKMA 1OVPA 1V9U3 2ZGOA 2ORZA 4OYUA 4P08A 3U1XA 2LRPA 5FYUA 4LLOA 4LE4A 1YLLA 1OD3A 4AFMA 4AQSA 3MIDA 2XXZA 1NCRC 3GCXA 4RGGA 3J7NA 2VVDA 2WN2A 1LOEA 4HVOA 3ZMNA 3IMMA 1YHFA 1CIYA 3JD71 4QU1A 4NRPA 4R9AA 1EP0A 1NLSA 3RYRA 2E7QA 3ZXJA 1Q5OA 3OPWA 4BIOA 1QJX3 2DVBA 2QTWB 3JBG3 2Y6HA 4JCKA 4CP9A 1POV3 3OBTA 4P9YA 4XETA 2Q8CA 4PIXA 3ME2A 4UFHA 3NRUA 5H9QA 3PVNA 4RHV2 4C1WA 1UZWA 4MGYE 4XE9A 3ZYHA 5JIAA 4R52A 2XDVA 1LRHA 2RHPA 2B9UA 1GWMA 2OS2A 3OSDA 2WNVB 2BNMA 5FZCA 5GKAC 4RGKA 4N90A 4D94A 2R49A 3N7KA 1RVF3 1QJEA 4RFT0 1RUH3 1VP6A 3USUB 4DRRA 3R05A 3B69A 1XYPA 3TEXA 3E1F1 3BTYA 2CGNA 4Y5SA 1UY0A 1YQ5A 2VBDA 2A6ZA 3B00A 5JAXA 1A34A 1FPN2 1S0EA 4V2WA 4E2SA 1OPMA 4GKYA 2P1BA 2L9LA 4DIQA 1ZZBA 2CWMA 3UETA 1QIQA 4A7KA 2DURA 3OY8A 1JOPA 2QDNA 4AI1A 2C4XA 1SMVA 1VBD3 4UXAA 4YM0A 2WNUA 1BCXA 4QPWA 4Y1UA 4D69A 3DYMA 5F5AA 3W58A 4JTOA 5ANNA 2JDYA 4LKDA 3EHKA 1JYCA 4CSWA 4CDUB 3T4HB 4XOGA 1XU2A 5L36A 1UKRA 2ZCWA 1RUD2 4Y20A 5ANQA 2Y0OA 5FPBA 2H6CA 4L9BA 1XNCA 3J4UH 1US2A 1W6NA 5FZOB 4LKFA 4KI5M 4O7XA 2ZA9A 3CJIB 1OA3A 2AEYA 2JG9C 4NE9A 1DGRN 2YFZA 5F6LB 5CZKA 1O91A 1AVBA 2OX0A 4PDWC 5DMYA 5HXMA 2ARXA 2WAAA 5FY9A 5BUVA 1UF2C 3FX3A 1HB4A 1NUKA 2QUOA 3H42B 2WZR3 3QLQA 2XHKA 4IETA 5H9PA 5GJ6A 2HWD1 1G9AA 2YBKA 2YDEA 1YEWA 4OZXA 3WOGA 1CAXB 2O1QA 5HV0A 3V0AB 2R0FA 1W6MA 4BHPA 3LSDA 4HN1A 1NZIA 3ZXGA 4K8FA 4LBQA 4AI9A 5F6KA 1F2NA 1C57A 2RM21 4FI9A 1D0HA 5ERLA 3MFAA 3MLLA 1WLCA 1W03A 1WW6A 3KLSA 3WG1A 5FRAA 3M3IA 4XXAA 4CPBD 1F4AA 2ERFA 3VDCA 3AZYA 2RDQA 3MEPA 1JH5A 3RYKA 3RMYA 1EPWA 3OGGA 3Q9OA 4S2DA 3ILFA 1D7PM 4PF5A 2OQ7A 1ULOA 4AVAA 2RS52 2JB8A 4JQTA 4UF0B 4YW3A 2H0VA 3ZSMA 2LROA 2ZXQA 1EPZA 1UIKA 3U78A 1TE1B 5AVPA 1ZX5A 3PIGA 1H1MA 4K8RB 4AK3A 5JPMB 1WBFA 5FOBB 4XJ9A 4MXWA 3VDDB 4FPOB 1VAKA 1GZTA 1ZBA1 5T5OA 2A6YA 1IZ3A 1TNRA 3SHRA 4CDXA 3FFQA 2VOKA 3WW4A 3ZYIB 2J42A 3MF9A 1GQPA 1N3PA 1VPHA 4AG4A 2DYCA 1TQ5A 2R1BA 3N9MA 1UX7A 5CFCB 1F8VA 1H30A 5BV6A 4S2GA 1N1VA 1NE4A 3I2KA 2AZ5A 2V72A 2ZACA 4A41A 1QQP1 4BQ2A 1F9KA 4NVPA 3BPZA 1WA6X 1MZFA 2RS33 4CP2A 1ASJ1 5FJHA 3L2HA 4OUEA 3EMRA 1FYUA 4LUMA 3LGRA 3V64A 5DUWA 5KXCA 3LQCA 3OD4A 4B29A 1NCQC 2R041 1V0AA 2P6CA 3WG2A 4MHRA 3ZIWA 2JDNA 1WW4A 4IEVA 3SCHA 2W68A 1D4M2 1XNDA 3WINE 1E5IA 2WO7A 3CLPA 1WW5A 2R7EB 1W9YA 4YVSA 3KQ4B 4LO7A 1MS5A 1AX0A 2D5FA 2JDZA 1AXYA 1VBB3 1GZWB 3WDYA 5EV7A 1JI6A 3MW3A 3AMQA 4ZU5A 4IEPA 1OLQA 2RDRA 3SKJE 2EAAA 2XUMA 1PIV3 4CDUA 2QNKA 4OHZA 1RITA 1A6CA 2XLAA 1EV13 3VHOA 4UFLA 5AFBA 1GZCA 2VUAA 1OC1A 2ZMLA 2ZX0A 3POFA 3VKLA 1H9PA 2OPWA 4CCKA 5DAVA 5LB6A 1R64A 2JDAA 3DV8A 1F5FA 4XW3A 1KS4A 1QJY3 2PYTA 2V4AA 2VUCA 4IEOA 4Y4YA 4Z92B 1HB1A 2JG8C 5BNOA 3R6SA 4Z2AA 3B7MA 3DN7A 3KHCA 4LOTA 1XXNA 2W3JA 5A33B 2R32A 2WNOA 4RA0A 1DYOA 1VLNA 4YZ2A 1R092 5M0TA 4JKMA 2YU2A 1DF0A 3BCWA 4B7EA 4C0BA 4AHXA 4CXXA 3AP6A 3PVOA 2BFUS 5DZGA 1APNA 3EYPA 5J3UA 1DZTA 4XUPA 4XAAA 3ZKYA 4IEQA 3VB9A 5KHGA 4XFBA 3H3ZA 3KV4A 4YSFA 1H2NA 4GA9A 4R9DA 5IK4A 3HN1A 1PVC2 2CYFA 3N9OA 4IEUA 1O5UA 5K0UB 5FZOA 3ACIA 3PL0A 1SFPA 2W0XA 1ENQA 4XUOA 3A7QA 4YZ3A 3TNPB 3KD4A 5L7OB 4NPMA 4QAWA 5D8AC 1R1A1 5I0UA 4FAHA 4RSUA 5K0UC 1G9BA 1HB3A 1PO12 1PGSA 3FLPA 4MGQA 5JR2A 1JZ4A 4FOYA 4DRVA 3ETQA 3WNLA 1YO8A 5H9RA 1W8ZA 3O5SA 4JAAA 5D8AB 1VBB2 1QWRA 1LOFC 4Q1PA 3M3QA 1RUI2 2HWD3 1JOJA 2ZHMA 4CEYA 4RS5C 1RTVA 1MZEA 2JENA 2VVFA 4N9IA 3VD7A 4BQ5A 4WM7C 2G4IA 3GZTB 1RMU2 4NHKA 3JQXA 1IKQA 3NNMA 2IXHA 3PUQA 3T4VA 1W90A 1D4M3 4BK4A 1AJOA 2Q8DA 3OPZA 1YQCA 2WNUC 4WVMA 4CP0A 4CU6A 2TNFA 2GH2A 1B35C 5FOJB 1O8SA 3DF0A 3IDCB 5FAXA 1RHI3 2YC2A 1YCIA 5T5LA 4P9XA 4M4RA 1CZVA 1UY3A 4BA6A 4BK5A 3BVCA 2FDKA 5FP8A 3GHMA 1UD1A 4ZPIA 3UGFA 1OI6A 1S1AA 3RI9A 1QH6A 1CJPA 1L7QA 4PCRA 3RZJA 4M3CB 4N8MA 4KNCA 4NWWA 2X5IA 5K4LA 2E7TA 2IWGB 5KR7A 3ATGA 4MGIE 4FT8A 4NRMA 2V5DA 4JRAA 4RQPA 2DBNA 2JDKA 3H1WA 3AVRA 4MGZE 4OHWA 5FXXA 1R091 1KRIA 4CVUA 3A21A 1J58A 3FHAA 3NAPC 3AFKA 1G8WA 5A7WB 4IESA 5FZ4A 2A6XA 1CD3G 2RE9A 4BB3A 4D8MA 1UU4A 1LENA 4BISA 1GANA 1OF4A 4PDWA 1AR82 4BOWA 1FNYA 3FE5A 1LULA 4LBQD 4R4ZA 2YHJA 4IE6A 1LHVA 5SV5A 3SH5A 2UYAA 1ALYA 2WDBA 2DVGA 2VPVA 4QX1A 1EAH1 3WQ7A 5KBFA 5JUVA 2PA7A 4MH0E 3K2OA 4C8DA 4XDPA 4Q4V3 4MOAA 5F2WA 2YROA 3F95A 4IXLA 4XAEA 3TNQA 3FHQA 5A7PA 1BMV1 1K5MB 5FYCA 3S7EA 3AZVA 2P3IA 2YMZA 1VJ2A 4IGQA 2XWBB 3WF3A 3WDWA 3GYDA 1MS4A 1JXNA 3AL6A 1C4RA 4HOOA 2MNGA 2ENRA 2XWJB 3FLRA 4NN0A 3USUA 1QEXA 4LULA 3MIFA 1KDKA 2R072 1HV0A 5DZFA 1RUD1 4DINB 4JDMA 1RUI1 3O1OA 1OH4A 4XHBA 1BEV2 3IIIA 1FV3A 3LB9A 5EJ1B 1YWKA 3ITQA 4XQDA 2XBO1 1IG3A 1KJRA 3VN4A 5GZDA 3I2DA 3E97A 4I0WB 5C70A 3VBHC 4CCDA 1N1TA 5FUNA 5C3PA 3JBG1 4YFWA 3WXPA 3PMSA 4BLJA 4ASLA 5DABA 4BH9A 1Y43B 1G6NA 4AFCA 3NWKA 4MZUA 1RJ7A 1HB2A 4RFRB 1QJX1 3QOPA 4XURA 2VOXA 2Q1MA 1UYYA 3PTYA 3ZXLA 2BNOA 1ZRCA 4XFAA 5A7NA 2VECA 3KQRA 1JN2P 4XDOA 1H8TC 1ZZ9A 1HRI2 2Q0AA 2WT1A 2WQ8A 2BTVC 3AP4A 3M4FA 4EN6B 5E1RA 1LOCA 2KR2A 2VZTA 3ROUA 2PHRA 2YPDA 1R082 3I2FA 5I0TA 1HRI3 2EXIA 1V6MA 3CU7A 1LECA 2IXKA 3GGLA 4YGDA 3HBZA 2DTYA 3KV5A 4I01A 2VNRA 4PQ9A 2XGXA 4QHZA 5C9AA 2RMU1 4OZOA 5A3TA 1ULFA 1MS3A 3U0ZA 4GD4A 4A7ZA 3OOXA 4ASKA 1GOGA 4DY3A 4XJZA 3VBRB 2ID4A 1WLDA 1HLCA 4RR3B 5FZ8A 4AW7A 5FMDA 4EZ4A 1FOD3 1FPN3 5JXJA 1G9CA 3NQHA 5GM0A 1YJKA 3ZFEB 5IVYA 4F7ZA 1UCXA 2VOVA 3RZLA 2XPJA 1LGNA 4MX3A 4NAMA 1PGL1 2QZ3A 1C8NA 1NA1A 3AJZA 4HONA 4HZFA 5DN2A 4L99A 3H8UA 4LBOA 3T2OA 3WDVA 3VUOA 1DP0A 5HCAA 3S5AA 1HKDA 1QOOA 3ON7A 3WNXA 4CXYA 1O7FA 1V00A 3DYPA 4B1LA 3C8XA 1ACCA 1KFXL 4CYDA 5CEHA 3H9AA 1QY4A 3Q8AA 2X10A 2WSUA 3JQWA 4PBPA 5FLIA 1BKZA 2VUDA 3U14A 4YG0A 4H2AA 2W46A 4CCLA 5A32A 4NROA 4A3ZA 5DAWA 4QU2A 3BYWA 4D6RA 4Y24A 2AREA 4UI9L 1MS8A 1IS5A 1CR7A 4RS5B 1JS9A 4QPIA 4MSVA 4CCEA 3NO8A 1E5RA 1ZREA 3VD4A 1MS1A 5HBAA 2EIDA 5CIRA 4E4DX 5FO8B 2VZ3A 2AENA 5FZBA 4LT5A 1OXCA 4GKXA 4K20A 3J7LA 2QQWA 1JYIA 4QXCA 1BBT1 1LKNA 2GNDA 1AR83 2MPFA 2Q4SA 5DDJ3 5T5PA 1C1FA 4WBBA 5T3NA 3UKTA 1ZRIA 4FTEA 3CNAA 4CCMA 3OBZA 2MEV2 1MQTA 4V2VA 1J1TA 4OHXA 2IVIB 1MZ6A 1HXS2 2IXJA 3P3PA 3ILRA 2DU1A 1BZWA 1DGWA 2XJSA 1Y9GA 3A0NA 4LXLA 4XF1A 4BIFA 1WCQA 4BQ4A 4K40A 3KV6A 2VNOA 4PHZA 5IWFA 3ZFFA 5JOWA 4QPGC 4EV0A 4COZA 1QJY1 3AM2A 4FP3A 2Z42A 1U5XA 2VZSA 5K8SA 2A7AA 3AMMA 5BNPC 2W52A 1QH7A 4BM8A 2EXKA 4QQLA 2XJRA 3EB7A 3VDAA 1ONAA 2DUOA 2VTXJ 1F5JA 3AXDA 3KMHA 1ST8A 1LOFA 4B4RA 5C8CC 3AMNA 4HKLA 4R9BA 1JYWA 4G4FA 3B02A 5IK8A 5FY0A 2GC0A 1V6JA 4H3WA 3UL2A 2WQZC 1DYKA 3H7YA 3LE0A 3USSA 1D2SA 5A3LA 4M0HA 2I45A 1YFWA 4YYOA 1SCSA 2ZEYA 3RPQA 2EIBA 1S0IA 5JOYA 3T3YA 1RINA 2HBUA 1W2TA 4PF1A 1B09A 5FLJA 3CL1A 1LAJA 4JZRA 1F4HA 1O3RA 5FY7A 4EN9B 2ZOEB 2Z4FA 3ILNA 4IL7A 1TZOA 2ZMKA 4CCCA 5CBLA 3A23A 4LHLA 1WGPA 5EPAA 3N7LA 1MACA 5E16A 3WY6A 1OF3A 1HX6A 1ULPA 2Y0IA 3E6BA 1IS3A 3KT1A 2PHDA 4EROA 1IG0A 3AX4A 1OOPC 5FPZA 3VZLA 2JE9A 3NJYA 3GALA 2JKXA 3ZYBA 1QXPA 2IVJA 2ZGLA 1AUYA 2XBO3 5G05L 2RS31 1S4CA 2D93A 1AYN1 1VBE3 4QXHA 5F3GA 5FYHA 4RQPC 4DPNA 1QNWA 3D5OA 2QQIA 5FTTC 3WNNA 3POJA 1VBA2 1UX6A 1VAVA 3TN92 2KD7A 3MIGA 5A7WA 3WR0A 2KA3A 1BJQA 1YJLA 2B5HA 1NCRB 1PZ7A 4FPYA 1I1EA 3AP9A 3VBUA 2QQNA 4HPKB 3IPVB 1FPN1 2BOJA 4HXCA 4UW6A 2CAVA 1PNGA 3NV4A 4W6WA 1PGW2 2WYFA 4GWJA 2QBXA 2YBPA 4IERA 5FZAA 2NP0A 4HLTA 1KGYA 3I4IA 3T2PA 3N3HA 2DF7A 2GAUA 4SBVA 1HXS1 4LBJA 4MG2A 2VNGA 3K4DA 2ZGUA 2V73A 4NOTA 3RQ0A 1FMD2 5FP9A 3S30A 4ZXEA 2OQ6A 4RYDA 3C7OA 4OVEA 1N3OA 5HCHA 1W0NA 2AGSA 4IGPA 2Y26A 2NPIA 3AZXA 2B8MA 5DUXA 1NCQB 1ULDA 1UL9A 2WO1A 3HQXA 3JD73 2XHNA 3WP4A 5JOZA 3K3NA 2W1SA 1UZVA 4H7LA 3NSTA 3GBGA 2WA4A 1FAYA 1IQDC 5I91A 1SFNA 3OJBA 1W6OB 3KF5A 3UESA 3K46A 1GU3A 2RDSA 1OD5A 4QKBA 1JW6A 2Y6FA 1XNTA 4O9EA 1JZ6A 4CZSA 1NLQA 5FZ1A 4Q26A 4QGMA 3ZFEC 4AL9A 1NT0A 4JRLA 1WLTA 2PTMA 3ORJA 1VRH3 3D6EA 1F31A 4AI8A 1ODMA 2IFRA 5BNQA 4GALA 1RUG3 4M4PA 2J1TA 2A70A 3AP7A 3WF1A 1ASJ3 3H0OA 4OFGA 1AL22 3VBFC 1YI9A 1BK0A 4XJAA 2JX9A 1XU1A 1CAXA 1ZNPA 3V0AA 4Q0PA 2ARCA 1CPMA 5FCCA 3ZFGA 3GM8A 4CRQA 3TEWA 1R081 4Q8LA 2RS12 4ZXKA 5LW9A 1RIRA 4CEYB 1Z7S3 2F4PA 2VW2A 3FJSA 4B4QA 1RXGA 2GMMA 5J09A 1CGPA 2E31A 3RJRA 4EJRA 2WWSA 2EF6A 1PO23 4XMIA 5EIYB 1CONA 5CFDA 3TEZA 2Y33A 4EE2A 1NY72 2O8QA 2VMHA 3MIHA 3ZYRA 4TTGA 2A71A 4ATEA 5JOXA 2WUHA 4XJWA 4DOUA 2BV4A 1DGWX 3LDKA 3SNMA 3MW2A 2OW4A 5EYXA 3OBRA 3VZJA 3NMBA 1DLLA 1K12A 2VD7A 2WYSA 3IWZA 2RJ2A 2ZKNA 4H55A 2NZ9A 1TMF3 2P2KA 1VBD1 4N53B 5EHDA 5FWJA 3AP5A 2J1VA 5FQ0A 2AEZA 1YXWA 1ZBE1 4LUKA 2WZ8A 5CG8A 4KGQA 1GNYA 3I2IA 3KM5A 1NYWA 3O1TA 2RS53 3WF0A 3OB8A 3PIJA 4XYXA 5FXVA 2VUJA 3BB6A 4QX3A 1JTZX 2PLV2 1IKPA 2VMFA 2ZGMA 5FZMA 5T52A 2WZPP 1LHWA 2E7AA 2Q1FA 2E53A 3EJKA 3VL8A 1SBDA 4AE2A 3H7JA 1ZVFA 1Z78A 3BGAA 4YGCA 1SLAA 2JJ6A 5EQUA 3M3CA 2ET7A 2DVFA 2VM9A 5HCFA 3TRSB 1RUG2 4I3GA 3SEPA 4CE8A 1UWWA 4HPKA 4QB1A 2WA3A 2CV6A 2G9FA 1QOSA 2WSVA 5GZGA 3LWCA 3T09A 1XBFA 2JECA 2Q8OA 2WZR2 1JYTA 1NLRA 1DDLA 1W3XA 2VMCA 5F5QA 2PQSA 2FMYA 4P9LA 1OA2A 3OGSA 3IN9A 4UFIA 1HQLA 2VBPA 3AKSA 4UT5A 3PUSA 3CJXA 4R9CA 5FZ9A 3HNMA 4CUBA 4CA9A 3MV01 4ARXA 1W8UA 3WNMA 1X82A 2VTXA 5A1LA 4QX2A 4M0NA 2HWC2 1POV0 3I2JA 2IFWA 2JD4A 1JYXA 1PX3A 4NPLA 4ET7A 1PK6B 4Q4X3 4W50A 1IPKA 2JG9A 5A7OA 1CAVA 3ZFFC 2KXLA 1UMIA 1SFYA 4KBZA 3AYEA 4YW5A 1I5ZA 1JHJA 5DAPA 3VGIA 4FSJA 5DZEA 3OGJA 4OCTA 4I0BA 3CIHA 5CVRA 4JKLA 1PM7A 4JV4A 1N47A 2RS11 4IDZA 4LK6A 3T08A 3ZSKA 1SDDB 2WNEA 3I97A 4WVVA 1VRBA 4EWEA 2BGOA 1VBD2 1XOYA 3M2MA 1K3IA 1M4WA 1WCSA 4QM8A 3NNJA 4Y1YA 5A32B 4F3JA 3URFA 1VBA3 5D1IA 5C3QA 3MFCA 4LA3A 3AYDA 3CZUA 3U10A 1VBE2 4LPLA 2VULA 5ACA1 5I8TA 1MR5A 2SBAA 4GH4A 2PLV1 3C7EA 1CAUA 2ZX1A 2VMEA 5HV4A 2XVKA 3WP6A 2Y34A 1SLCA 1RUH2 1WMDA 4JGYB 5F39A 2ZGKA 3KV9A 3SC7X 5ABJB 3LIGA 2OXBA 2VW0A 4Q4Y1 5KHKA 1DQ2A 4ZKTB 1AR71 4URTA 4JGYA 2OA2A 3RZHA 1LEDA 2DCTA 3VBRA 1A8DA 3G7DA 4AVCA 2YXSA 1KJLA 1DCSA 2AH2A 2VQ0A 4P5HA 4CXWA 1LHNA 5LA1A 4HN0A 4TLGA 3RJ2X 1R1A2 5BNOB 4PJYA 2VNVA 3OYWB 3SH3A 1VBC1 5IVCA 3IT8A 3T30A 5FXZA 4OMDA 4A2UA 1MS0A 3LA3A 4KU8A 1XSRA 4WM8C 2XJQA 1OBNA 5C33A 2W39A 3VBOC 4OLLA 5L9BA 3WF4A 4JQRA 4CDQB 5KXEA 2WAOA 3BOWA 1VMHA 3BTZA 2Y6JA 3U11A 1B35B 2IUWA 1GOHA 2QZ2A 2JKBA 2W08A 2VL4A 5J48A 1W28A 1U5ZA 4CDWB 4ES9A 1COV3 2BP6A 1ZZ8A 2I2SA 3M3OA 4S2HA 1C1LA 1EUUA 2VVEA 2HWC1 4HSJA 5E8AA 4NIIA 1AJKA 3WDUA 3IKWA 5C9AB 4CCJA 2BUKA 5APAA 3NKGA 1PM4A 5K9YA 1NCQA 2E9QA 1CWPA 1HXS3 2QE3A 3I59B 5A1AA 1QNYA 3HEIA 3IIAA 2GZWA 4YG3A 1O3SA 2MEV3 3WW3A 1ND3C 2VXJA 2VZQA 3C2UA 5FZGA 1EAH2 1COV2 2ZABA 4XXPA 2A6VA 5DDJ2 1AF9A 2XQXA 3DKQA 3FLTA 2QQKA 2GP5A 5T5JA 1CAVB 4DEQA 5FY4A 2D98A 4MYEA 3T0DA 5FP3A 4AI0A 4K1YA 4Y22A 4LKEA 1HN0A 1AL21 1I6XA 5FZKA 5KC5A 1LODA 1UQXA 5FO7B 3TN91 4N43A 1ZZCA 3E6DA 2DCJA 5JZGB 4GMP1 4OHVA 3UKVA 2IZWA 3S7IA 2XMLA 1QDCA 2UWAA 2D44A 1R1A3 3MF6A 1WLWA 3MPPG 4Q8KA 5BNOC 5JZGC 2WC2A 5FZDA 1G7YA 2Y38A 1J84A 4KU7A 1ULCA 2RG4A 4QQHA 4XTMA 1CESA 1DZQA 2W91A 2R6QA 1W6PA 2R0HA 4YW6A 4YFZA 3ZDSA 1JU4A 4LA2A 4X6RB 3LOBA 3N35A 3VBOB 4Q4W3 4CUCA 2RR12 2NMOA 2QKDA 1HQNA 1F15A 3ZYPA 3U4XA 4GWIA 2BZDA 4IE0A 1FOD2 4N9HA 2IXLA 1PVC1 1VMJA 3LDRA 3BTAA 1LCLA 2EA7A 3IM0A 3R4UA 4NAOA 2K0GA 4QXBA 1YFYA 5DXDA 4D6QA 1BVVA 2BPA2 1H6XA 3RWKX 2VCAA
chains in the Genus database with same CATH topology
1C28A 1C8M3 4E4SA 1RUJ2 4CEWA 3KCYA 4DNYA 3KT4A 1SQ4A 3UKNA 1BXHA 1UMZA 1BBT2 1TEIA 4XFIA 2CAUA 4Y22B 3MW4A 2OIIA 1R083 3VDDA 1NG0A 2B7YA 1URXA 5T50A 2WLQA 1XNKA 1KDMA 3N4MA 4OUMA 1QXRA 2HWC3 3WUCA 4QHBA 1ND2B 4AHYA 4JVAA 1Q56A 4IEXA 3HMYA 2DCYA 2BEOA 2AUYA 1GQGA 4AI3A 1IPJA 4L8QA 1OLRA 1S0GA 2WIIB 1CJDA 1GBGA 5BY5A 1MVEA 2BQPA 3D4KA 4FOQA 4FPLA 2PHTA 1DGRA 1B35A 5DUUA 3AZZA 2DFBA 3AKQA 3QD6A 3RI8A 3O7OA 2R073 2NQYA 4Z1VA 3THTA 5GZFA 1W6OA 4GULA 2RM22 2Z69A 3VKNA 4E2GA 2BWAA 2KM2A 4FTBA 5JSRA 5JVVA 5FMOL 4XBNA 3ZYGA 2PLV3 1SLBA 4Z07A 4F83A 2PFWA 4D7YA 2WQ4A 4C1XA 5BNNB 3ZSEA 1U0AA 3GBFA 1RUF3 4IV1B 5A33A 2A5ZA 3T1MA 4YNIA 1PVXA 3FHIB 2NN8A 4I2OA 1XE7A 4QM9A 4AGRA 2RR11 1WUVA 2EVXA 4YZ1A 2GN3A 1SCRA 3S0MA 4KWJA 1NZCA 4CTEA 3ZXDA 1X50A 5L7OC 4XFCA 4XJ8A 5J96B 1W39A 1DQ4A 1REFA 4HK8A 4R4XA 5FLHA 3UV9A 4N53C 4TSVA 5ABJA 3OY8B 4Q4X1 1D4VB 3VKFC 1GZ9A 4DXZA 1Z7S2 1YIPA 1VBC2 4JGYC 1HRV2 1RJ8A 4KG8A 2AYHA 4K3UA 1DG6A 2R043 1D2QA 1WMEA 4QPYA 5AC93 5H9SA 5CFCA 3VZKA 1AL23 2VXRA 1UIJA 3DL3A 4NHMA 4QGNA 3PVEA 1GSLA 1O4TA 1H8VA 2PAMA 3WG3A 3T2TA 4UBGA 2WNVC 1RUI3 2HWD2 3AK0A 1VAMA 1S0DA 1UZYA 1JHNA 3HT2A 4BYYA 4XTPA 4YLZA 3ST7A 4ES8A 2DFCA 3QCWA 4JTNA 1WW7A 1PZ9A 2Q1ZB 2YUEA 4RHV1 5LK7B 4CEWB 1CX4A 2UWBA 2AR6A 3JD72 3WLUA 4L2NA 1PVC3 5C9AC 4MXWB 3NW4A 1CQ9A 4F8AA 1FMD3 1ND3A 1IOAA 2CTVA 2MHFA 3H50A 4J1WA 5TSWA 1FXZA 1GNHA 4HSLA 4ITCA 3SCGA 5A3MA 4CDQA 4N43B 3AYAA 1OA4A 1ZZ7A 1N1SA 4K6BA 3O14A 2Z2SB 3TBDA 5BNNA 3TN93 2ZBJA 1RUH1 4HT1T 4XF9A 5KHIA 3J8F3 1RUF1 3MLKA 1S0FA 5C6CA 1Y3TA 1YUDA 3WDTA 5AVAA 1Q8SA 2A3YA 2TUNA 2XBO2 2XL9A 4QGLA 5K7PA 4COUA 1HV1A 3EO6A 2D6PA 2XJUA 1SBEA 1S0BA 4Q0SA 2YY1A 1UPSA 3NL1A 4SLIA 1IQAA 4FPEA 1PIV2 2TBVA 5F1RA 4FQ4A 1BVP1 4OI4A 4JGZC 1V70A 5HCBA 4E27A 2Z79A 2VGDA 1NOVA 3MLJA 3I7DA 4IQPA 4YM2A 4RL7A 5L73A 5JI9A 2CY6A 5CNAA 1FX5A 2JG8A 1BYHA 1RMU1 5C8WA 1A8MA 1N1YA 2ES3A 3WQ0A 5D8AA 1RUC2 2A73B 2FZ2A 3QBQA 4AEKA 2NMNA 3HWJA 5BPXA 2O8OA 2DTWA 4NHLA 5JMCA 3ZIXA 4D7SA 2IC1A 3AB0A 4HKWA 4K9SA 4TZDA 1EY2A 2VOWA 4AVTA 4CEYC 3M8LA 3VDDC 4RS5A 3KGLA 1D0GA 2ZGRA 1H9WA 1OQ1A 1W2UA 1XQNA 4WM7A 3TAYA 3IMNA 1Q8QA 3HD8B 1A78A 3WW1A 3J9SA 1VR3A 3ELNA 1DQ0A 2LALA 4N7IA 2LTNA 1AYM3 3I8TA 1BK1A 4Q4Y3 3NAPB 2DVAA 1G86A 3RG0A 2WFF1 2CGOA 2ZX4A 5DG1A 4G9SB 4HBNA 1OQEA 4Q0QA 1PNFA 2R30A 4AQ6A 1PMIA 4KWLA 4XF4A 2G9GA 2X5IC 4FPGA 3N7MA 4P9WA 5FQ0B 2HWE3 1AYN2 2MEV1 1YFXA 1JUIA 2ARBA 4YRDA 4JGZB 2XL7A 1AR91 3MPBA 1LESA 4I02A 4BWOA 1KXGA 3ZN4A 5SV8A 2VG9A 4KBBA 4O9GA 2X8KA 3SMHA 4HETA 2R071 2FHRA 2WNUB 2WT0A 4MXVA 1AXZA 4WVWA 1BEV1 3RNSA 1CIWA 1T6GC 1O4ZA 4RD7A 1W0PA 4AFBA 4HMZA 1UU5A 3EXUA 3PJQA 3C3VA 4ZU7A 1OSGA 1LHUA 2DCKA 3NAPA 1FI2A 3DKWA 1O5LA 4COYA 1RUE3 1DHKB 2PHLA 1MVQA 2XKOA 3RRDA 4PLMA 3INAA 2OZJA 3LSEA 3LOIA 3ZXKA 5LEKA 3POWA 5EZWA 2ZHKA 2VMIA 3KSCA 1WBLA 2XVLA 4B4PA 1RUD3 4DQAA 2BW8A 1UPIA 1H8TB 4EN0A 2ZPXA 5AFEA 1CPNA 4L97A 4BPZA 2QVSB 2PAEA 5CG9A 1U5IA 4FOVA 5E88A 3POSA 3MIEA 3O0XA 1YI7A 1AR63 2WFF2 4FQZA 1ZBA2 3I54A 5GLWA 5JR7B 2E63A 4XF0A 4WVZA 2GMPA 1COV1 4GQ7A 4CDWA 3CJIC 3MDPA 2OYZA 5KXDA 3ZSLA 4HL0A 2QDRA 2GMEA 2YYOA 4KH9A 5IK7A 4Q0VA 1BEV3 1Z0HA 1I9RA 3EQEA 1H4GA 5GALA 1RVF2 3AMPA 1CAUB 4YW2A 4QQOA 3VZOA 1NA1B 1QU0A 4ATFA 4M3CA 3B01A 5JCTA 1J3QA 2FBEA 4XQWA 2JG8B 1C3HA 5F9TA 5JLVA 1FNZA 3PMEA 4XIOA 4XFFA 4P14A 3ZSJA 1PGW1 1ZBE2 2DCZA 4RHV3 2ZGNA 4E4ZA 1H8TA 1DGLA 1NA1C 4LEJA 4META 4Q4V2 4WM8B 3M1HA 2GNBA 1PO11 2WLPA 3AYCA 3RDIA 2F6BA 1BQPA 1H1AA 4W65A 1QJX2 1X33A 4EWDA 5CADA 3H3UA 3FBMA 1J1LA 4XPVA 4AWDA 4IEZA 3TOJA 2VU9A 3AJYA 1C8M1 4L11A 1C5HA 4C0HA 5BNNC 1ENRA 5GZCA 5CU1A 3J8F1 3LCPA 3NV3A 1RB8G 2A6WA 2X29A 4LHKA 4AVSA 3JZVA 1W0OA 1AX2A 1V9U2 4D3WA 1XNBA 4H14A 5EWSA 3CF6E 4FAGA 2I74A 2XH6A 3LA2A 2RMU2 1RHI2 4JGZA 4A3XA 4AEMA 1TMF1 3ES4A 1LR5A 1V6OA 3UJQA 2DUQA 3DPRC 1RMU3 2CNAA 4HFSA 4HVRA 3V56A 1SDWA 1AR93 3VHRA 1PGL2 4YZ5A 1HDKA 4UBHA 3MYXA 5JDBA 5B2GB 1H4HA 1RUNA 1PO21 1AR73 3WCRA 4AHZA 3FWEA 4NWVA 4XJUA 4BLIA 5CFDB 1GICA 1CN1A 1PO13 4IEYA 1FOD1 1SLTA 3HIFA 3FC0A 4I09A 4LBKA 1GKBA 1XRUA 3KGZA 4YVSB 1WA4A 4A7YA 1DIWA 4INDA 2ZTNA 4DB5A 2ZGTA 4Q4V1 2WS92 1VBE1 3O12A 5KHHA 2OUHA 2ZAAA 4WZCA 2VY0A 1CVNA 1CAWB 4C91A 5BNPA 2RS51 4NO4A 4KL1A 3WW2A 4LTAA 1UW8A 1R093 3B9IA 2WINB 3JB4C 4OI1A 1GQHA 4ORFA 2YZ4A 5JWPA 1K5MC 2D6LX 3OTFA 4FXGB 3MIBA 1REEA 2B42B 1QJY2 1Q43A 1AR61 3KB5A 4UW4A 2WZR1 4AGVA 2CGPA 1QOTA 3DPRB 4WM8A 2D6MA 2YPJA 4HKOA 4YM3A 1EV12 1ND2A 1Z7S1 2E51A 2XLGA 1S0CA 2EXHA 1OPOA 2FMDA 4I30A 1U12A 4AFDA 2HWF2 4BCUA 4YVSC 4RQPB 1AYN3 2ZGSA 2HWE2 4YGBA 4CP1A 4Y26A 5FREA 4AF9A 3VL9A 5FMOS 2GU9A 4Q2FA 4PBOA 1DZRA 5IT6A 2RS32 2WJSA 4P9GA 4FP2A 1FMD1 3AMHA 4XZPA 4Y5Z0 4PLNA 3ZXFA 1YYNA 2HWB3 3V65A 3POYA 3RSJA 2FQPA 5GLZA 4OULA 1Q3EA 1ENSA 4DZGA 4AGGA 1RVF1 1ZRDA 3V0BA 2E6VA 4LBLA 4DY5A 1TNFA 2ETEA 5JIUA 1NCRA 4LO4B 2CWSA 1D4M1 3JUUA 1GFF2 1W6NB 5T54A 1GV9A 1NQJA 3OF1A 2XB6C 4Y1ZA 3HR9A 1AX1A 3WUDA 3NJZA 1TME1 1RUG1 2LUWA 3LKJA 1HRI1 5DUVA 4D7TA 4EWAA 1POV1 2HJIA 4KG0A 1WD3A 2ZHNA 4Q29A 4QXKA 3WV6A 4AI2A 1QJU3 4WV8A 2GC1A 5CAZA 4OI0A 2A3XA 4X8NA 1SLLA 5L19A 5C4WB 2HEWF 4YG6A 4LE3A 5HI0A 3J8F2 1OOPB 2ZS6B 4YZ4A 5JI7A 4QT6A 1DBNA 3ZVXA 5JSOA 3GZAA 3H1YA 4XF3A 2D43A 4AYUA 3K51A 5EYYA 3D82A 4Z82A 4WZFA 4M00A 4BMEA 3E6CC 4LNVA 3KCXA 3N7JA 4I0AA 4QPGB 4GIQA 2D7FA 4BE3A 3ZFFB 4YM1A 4FOWA 3AKPA 1O4YA 2Q30A 1KITA 2DUPA 4LLFA 1DU3D 2DV9A 2UY8A 1C5IA 5KWRA 2JICA 2TEPA 4AVBA 3OCPA 2R061 3DPRA 3FFZA 4UW5A 3DGTA 1VBA1 3PJYA 1AR81 3OYWA 4Q0UA 5KC6A 3ZMOA 4Q4W1 1PIV1 2QQPA 5I0SA 1LOGA 1GNZA 4FPFA 5GLVA 2D3SA 1X7NA 1KS5A 2GDFA 2UYBA 2BVVA 2DWRA 2XLFA 2YGMA 4AEDB 2C1FA 1M06G 2R1DA 4HANA 1GLHA 4RR3A 1REDA 2B46X 2WFPA 2NYYA 5AC92 3NV1A 2R042 2GH8A 4LBMA 1ZRFA 3GHNA 4AVVA 1HRV3 1S2BA 2OPKA 1VBC3 2EIGA 3ENRA 2P3JA 2YGLA 2GNMA 5FBZA 3JCIA 1QQP2 3ZO0B 3W9AA 1RHI1 1LOAA 4KGGA 5J36A 2PHXA 5L7OA 3AZWA 4P9IA 3N36A 3IBMA 1SEFA 4YARA 2C5DA 3JBG2 4FCAA 2B39A 2WL1A 2X53S 3FUQA 4ONUA 1MZ5A 5C4WA 2BFUL 1PK6A 5GLUA 1IHMA 1QXJA 3X29B 3ZXAC 4K21A 4XQ4A 3VBOA 5GZEA 1ZZ6A 1MEC3 3ALQA 3AXEA 3MICA 4LBQB 2D5HA 3TWIA 1LB2A 3A4UA 3WHTA 2N7GA 5I8YA 2JE7A 1X8MA 4BMBA 2WNVA 1ZM1A 2P3KA 4JC1A 2C9AA 5BYNA 2GSYA 4Y20B 3ZXEA 2ZJCA 4HVQA 2HYKA 2PELA 3MI8A 1ZBE3 4CDXC 5BNPB 1NY71 4FPCA 1BMV2 2JG9B 4AFAA 2GNTA 1V6LA 2Z5WA 3VBSB 4DMIA 4ASMB 3B9CA 4PDWB 1R1ZA 5ACA2 2RM23 1Q8PA 2ZGPA 3D0SA 1J3PA 1LGCA 2PQQA 3B5LB 3B93A 2PHWA 4GB33 3VBSA 2BNNA 3O0VA 4TYSA 3WHUA 4FBFA 4M3CF 1UN1A 2ZHLA 5EFUA 4GMP3 3WT3A 2NLRA 2HEYF 4AEDC 3FUOA 2ZZQA 4L92A 2BBVA 4XDQA 4LR4A 4XILA 1UKGA 4EN7B 2WKKA 2ZX2A 1ZBA3 4JDOA 2IXCA 2WFF3 2GN7A 2XVGA 1WMFA 1AR62 2SLIA 5JPNB 3D8CA 2A75A 1ULGA 2BWCA 1I3HA 1RC6A 4CDUC 4PLOA 1RL3A 3IDEA 1DQ6A 3SCFA 1S2KA 1ZYBA 3BALA 5J98B 3RZZA 3UK9A 1AHSA 1HRV1 4MV2A 1NXMA 1BBT3 4H7MA 4YW1A 5E89A 4M01A 1RUE2 1RUJ3 1LEMA 3APBA 1C8M2 1XYOA 2X5IB 4N43C 3E5QA 3VV1A 1MS9A 5IK5A 3BODA 2EXJA 3WCSA 2BVBA 2XG3A 4IEWA 3WD5A 1N3QA 2ZGQA 5JZGA 1IS6A 1TME3 2RR13 4QX5A 4XFHA 5FDBA 4QPIC 1OKQA 1V6KA 4IV3C 5I8SA 1QGLA 4QQ2A 1WD4A 1W6QB 4HK9A 3FMGA 1AZDA 1UZZA 4FXKB 4J1XA 1H2LA 4YVWC 3O0WA 4Y1XA 4QPIB 3MZHA 4WVMB 2VH9A 4LO8A 2P34A 3JU9A 3H1MA 3SXWA 1H2MA 4GB32 1PZ8A 1SLIA 5K0UA 3A0KA 4LO5B 3AKTA 3SH4A 1YFUA 4CEWC 1OFNA 3ECQA 3UJOA 4U2AA 3FZ3A 5HXVA 1VRH1 1IS4A 4NPRA 2EAKA 2ILMA 2LM3A 2R16A 3J26N 4QPGA 4W6XA 4ISQA 2A3WA 1V6IA 1VB2A 3DUIA 1EAH3 5DG2A 4BZ4A 4Q4Y2 4G3YC 1AYM2 3TB0A 2QCSB 1AXKA 1MEC2 4LHNA 2BYVE 4K7JA 2I07B 2B45X 2D6KA 4W6YA 5KHJA 3SITA 5EXOA 4QD2A 5LRRA 4KWKA 5KXBA 1LGBA 4AHWA 5CA6A 3ZX7A 1QKQA 1GR3A 3JB8A 1KD7A 3CEWA 1RUOA 3ZYJB 4MVTA 3CO2A 1HIXA 1AL0G 1QQP3 1W6PB 5LRSA 1OFSA 1X36A 2CL2A 1RUC3 4UW3A 3VHNA 3ZN5A 1ENXA 1OOPA 4MUVA 1J3RA 3PHMA 4B7KA 4YVWB 1DDLA 1DFQA 4QQPA 1CAWA 1LU2A 4RR3C 5J37A 4KQ7A 3KS7A 2OUJA 4TLFA 1RGSA 1RUE1 4K1ZA 1FV2A 2H6BA 3M3EA 3GF6A 5ABJC 1ZRRA 1ULEA 1SACA 3VHPA 1FT9A 4Q1RA 5BXXA 1DYPA 1E57A 2JEMA 2V5YA 2H0BA 2HWB1 1UAIA 1X8EA 5GLTA 4WM7B 3WP3A 4PIZA 4X6QB 4AQTA 2WS91 4OI2A 2V09A 1DQ5A 1JUHA 3MGUA 3EBRA 5C4WC 3VBFA 2VQAA 1PK6C 2D6NA 4ISRA 2D97A 2ET1A 3NV2A 2DVDA 3E5XA 3BIWE 4U36A 4FPHA 3ZFGC 2YV8A 1Q8VA 3KZ4C 2UY9A 4GMP0 4AEJA 2R063 3VBHA 4N53A 1H2KA 4IV1A 4J6GA 3GZUC 4CDWC 2VW1A 4Q4X2 2R062 3B3QE 2GC2A 1H0BA 4ZU4A 4B8EA 3VLBB 3WQ1A 1KFUL 4S2FA 1QHDA 1NXD1 1GYKA 5CFCC 4E2QA 4MGKE 2UWCA 4GXLA 4RGAA 1O3QA 5C8CA 3VBSC 4FVVA 1AYM1 2OZ6A 3ZN6B 3LZZA 3R4SA 3B94A 3ZN6A 4PIYA 4FPKA 2HEVF 4GWNA 2P17A 3VZNA 4AEDA 3LAGA 4FTSA 1QJU2 3SLIA 5DDJ1 3WDXA 2OVUA 3P3NA 4Z8BA 3QH7A 2YC0A 3PLQA 4XBQA 5FFOC 3VBFB 1XYNA 5FPXA 3R4DB 5CFDC 2ZX3A 1SBFA 5JSPA 1W6MB 3E5UA 4X8PA 3WVJA 2RJLA 5IUQA 2GALA 2K2SA 4XHXA 2Q5TA 4OHYA 3RWNA 2NM1A 2HKXA 2ZMNA 2DU0A 2JXAA 3M70A 4R8HA 4B3NA 2IXIA 3U07A 4E9KA 3VKOA 2EALA 4CDQC 3ACLA 3ZPYA 3PVBB 3K48A 5LEJA 3QACA 2HWE1 2ZKLA 1TMF2 3L9JT 3ZFGB 1ND3B 4BQ1A 3ASIA 5FO9B 2O0OA 1LJ7A 2HWB2 2FZ1A 4EN8B 2D40A 1RUF2 1YRZA 2XJPA 2PHFA 1KQRA 4XEZA 3VBUB 1LOBA 1LU1A 3IPVA 1PO22 3RYPA 4MLOA 3VZMA 4IV3A 1VIWB 3R0RA 2C0ZA 1EYBA 1DQ1A 2D3PA 4JDNA 4AXOA 2RS13 3PNAA 1MQTC 4YVWA 1NQDA 4XMAA 1O3TA 4QMAA 3M7AA 1VBB1 1OHFA 2PN5A 2P37A 2PHUA 3OD0A 1ASJ2 3GNEA 1MQTB 3S6PA 1YIFA 2HWF3 1RUJ1 3GBWA 3BOPA 1VRH2 4YW4A 4NR1A 1S55A 1Q8OA 1QJU1 2GC3A 5J7MA 4GH4C 2UU8A 4FPJA 1V9U1 4AQ2A 1Y9QA 2ZAHA 2XJTA 1PHMA 3WG4A 3BU7A 3IDBB 3TYJA 5KC5A 1GZWA 2ATFA 1QF3A 1UU6A 1OMIA 2PAKA 5CB7A 1MEC1 4Q27A 3AFGA 1J59A 4OUSA 1TME2 4Y1VA 4XFGA 2K9ZA 1RUC1 3RMXA 1V6NA 4N7UA 2D6OX 4C90A 4FO9A 2QJVA 3RS6A 1FATA 1K5MA 3KCCA 1YNAA 3NVCA 4YGEA 1XE8A 2VMGA 3NKTA 4M3CE 3V0BB 1G9FA 2D3RA 1OQDA 3T1LA 4I3PA 1S0JA 1G9DA 3HAGA 3I59A 4GB31 5EJ3A 5LK5A 1ND2C 3WZ1A 1VB4A 3QH6A 3VBRC 4CDXB 5C8CB 2HWF1 4XBLA 3VBUC 5I93A 2WS93 1WCKA 1NE6A 4LBNA 3AKRA 4Q4W2 1LHOA 4V1PA 3W59A 1A3KA 2QFEA 1U5YA 1IGOA 1QMJA 3LA7A 3SISA 1L3JA 3WP5A 4COWA 4LO6B 3L2YA 1JBCA 1AR72 4XIKA 2BGCA 4GWMA 3D0JA 3HT1A 4IV3B 3WX5A 1ZA4A 1AR92 1HQWA 2UURA 4GH4B 1VALA 1W6QA 2XJVA 5ACA3 3CJIA 1QDOA 4DS0A 1LTEA 1HW5A 3THPA 2ZZJA 5I0RA 2WT2A 3ES1A 3FBYA 4TWTA 5T55A 3ZFEA 1WCDJ 3G6JB 2RMU3 1H1IA 4P9JA 3VBHB 4COVA 1EV11 4DFSA 3KT7A 1QJZA 4IV1C 1Y7BA 5AC91 2RJKA 2XKPA 3VKMA 1V9U3 2ZGOA 4LLOA 4LE4A 1YLLA 4AQSA 4AFMA 3MIDA 1NCRC 4RGGA 2VVDA 1LOEA 4HVOA 3ZMNA 1YHFA 3JD71 3ZXJA 3RYRA 4R9AA 1EP0A 1NLSA 4BIOA 2E7QA 5C8CC 1Q5OA 1QJX3 2DVBA 3JBG3 4JCKA 1POV3 3OBTA 4P9YA 4XETA 4PIXA 3ME2A 5H9QA 3PVNA 4RHV2 4C1WA 4MGYE 4XE9A 5JIAA 4R52A 1LRHA 2RHPA 2B9UA 2WNVB 2BNMA 5GKAC 4N90A 4D94A 2R49A 3N7KA 1RVF3 4RFT0 1RUH3 1VP6A 3USUB 4DRRA 3R05A 3B69A 1XYPA 2CGNA 2A6ZA 3B00A 5JAXA 1FPN2 1S0EA 4E2SA 1OPMA 4GKYA 1ZZBA 2CWMA 4A7KA 2DURA 3OY8A 2QDNA 4AI1A 1SMVA 1VBD3 4UXAA 4YM0A 2WNUA 1BCXA 4Y1UA 4D69A 3W58A 4JTOA 3EHKA 1JYCA 4CDUB 4XOGA 1XU2A 5L36A 1UKRA 2ZCWA 1RUD2 4Y20A 2Y0OA 2H6CA 4L9BA 1XNCA 3J4UH 1W6NA 2ZA9A 3CJIB 1OA3A 2JG9C 1DGRN 5F6LB 1O91A 1AVBA 4PDWC 2ARXA 5BUVA 1UF2C 3FX3A 2QUOA 2WZR3 3QLQA 2XHKA 4IETA 5H9PA 5GJ6A 2HWD1 1G9AA 2YDEA 4OZXA 3WOGA 1CAXB 2O1QA 3V0AB 2R0FA 1W6MA 4BHPA 3LSDA 4HN1A 3ZXGA 4K8FA 4LBQA 5F6KA 1F2NA 1C57A 2RM21 1D0HA 3MFAA 3MLLA 1WLCA 1WW6A 3KLSA 3WG1A 5FRAA 3M3IA 4XXAA 2ERFA 3AZYA 3MEPA 1JH5A 3RYKA 3RMYA 1EPWA 3OGGA 3Q9OA 4S2DA 3ILFA 4PF5A 4AVAA 2RS52 4YW3A 2H0VA 3ZSMA 1EPZA 1UIKA 1TE1B 5AVPA 1ZX5A 1H1MA 4AK3A 5JPMB 1WBFA 5FOBB 4XJ9A 4MXWA 3VDDB 4FPOB 1VAKA 5T5OA 1ZBA1 2A6YA 1IZ3A 1TNRA 3SHRA 4CDXA 3FFQA 2VOKA 3WW4A 3ZYIB 3MF9A 4AG4A 1N3PA 2DYCA 1TQ5A 2R1BA 5CFCB 1F8VA 1H30A 5BV6A 4S2GA 1N1VA 1NE4A 2AZ5A 2ZACA 1QQP1 1F9KA 4NVPA 3BPZA 2RS33 1MZFA 4CP2A 1ASJ1 3L2HA 1FYUA 4LUMA 3LGRA 3V64A 5DUWA 5KXCA 3OD4A 4B29A 1NCQC 2R041 3WG2A 3ZIWA 1WW4A 4IEVA 3SCHA 2W68A 1D4M2 1XNDA 3WINE 3CLPA 1WW5A 4YVSA 4LO7A 1MS5A 1AX0A 2D5FA 2JDZA 1AXYA 1VBB3 1GZWB 3WDYA 5EV7A 3MW3A 3AMQA 4ZU5A 4IEPA 1OLQA 2EAAA 2XUMA 1PIV3 4CDUA 2QNKA 4OHZA 1RITA 1A6CA 2XLAA 1EV13 3VHOA 5AFBA 1GZCA 2VUAA 2ZMLA 2ZX0A 3VKLA 1H9PA 3DV8A 1F5FA 4XW3A 1KS4A 1QJY3 2PYTA 4IEOA 4Y4YA 4Z92B 2JG8C 5BNOA 3R6SA 3B7MA 3DN7A 5A33B 1XXNA 2R32A 4RA0A 1VLNA 4YZ2A 1R092 1DF0A 3BCWA 4B7EA 4C0BA 4AHXA 3AP6A 3PVOA 2BFUS 5DZGA 1APNA 5J3UA 1DZTA 4IEQA 5KHGA 4XFBA 3H3ZA 4YSFA 1H2NA 4GA9A 4R9DA 5IK4A 3HN1A 1PVC2 2CYFA 4IEUA 1O5UA 5K0UB 2W0XA 4YZ3A 1ENQA 5L7OB 3TNPB 3KD4A 5D8AC 1R1A1 5I0UA 4FAHA 4RSUA 5K0UC 1G9BA 1PO12 1PGSA 3FLPA 4FOYA 4DRVA 3ETQA 1YO8A 5H9RA 4JAAA 3O5SA 5D8AB 1VBB2 1QWRA 1LOFC 4Q1PA 3M3QA 1RUI2 2HWD3 1JOJA 2ZHMA 4CEYA 4RS5C 1RTVA 1MZEA 2JENA 2VVFA 4N9IA 4WM7C 2G4IA 3GZTB 1RMU2 4NHKA 3JQXA 1IKQA 2IXHA 1D4M3 1AJOA 3OPZA 4WVMA 2WNUC 4CP0A 2TNFA 2GH2A 1B35C 5FOJB 3IDCB 3DF0A 5FAXA 1RHI3 1YCIA 5T5LA 4P9XA 4BA6A 3GHMA 1UD1A 1OI6A 1S1AA 3RI9A 1QH6A 1CJPA 4PCRA 4M3CB 4KNCA 4NWWA 2X5IA 2E7TA 2IWGB 3ATGA 4MGIE 4FT8A 4RQPA 4JRAA 1KRIA 3H1WA 4MGZE 4OHWA 1R091 1J58A 3NAPC 3AFKA 1G8WA 4IESA 2A6XA 1CD3G 2RE9A 1UU4A 1LENA 1GANA 4PDWA 1AR82 4BOWA 1FNYA 3FE5A 1LULA 4LBQD 4R4ZA 2YHJA 5SV5A 1LHVA 3SH5A <