1QNWA

Lectin ii from ulex europaeus
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
236
structure length
234
Chain Sequence
SDDLSFNFDKFVPNQKNIIFQGDASVSTTGVLQVTKVSTTTSIGRALYAAPIQIWDSITGKVASFATSFSFVVKADKSDGVDGLAFFLAPANSQIPSGSSAGMFGLFSSSDSKSSNQIIAVEFDTYFGKAYNPWDPDFKHIGIDVNSIKSIKTVKWDWRNGEVADVVITYRAPTKSLTVCLSYPSDGTSNIITASVDLKAILPEWVSVGFSGGVGNAAEFETHDVLSWYFTSNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords CHITIN BINDING LECTIN, UEA-II
publication title Structural Basis of Carbohydrate Recognition by Lectin II from Ulex Europaeus, a Protein with a Promiscuous Carbohydrate Binding Site
pubmed doi rcsb
total genus 55
structure length 234
sequence length 236
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qnwA00
1WLDA 2ZGTA 2ENRA 5IK4A 2OW4A 4XTMA 3SH5A 4K1ZA 1CN1A 1LEDA 2R1DA 2A70A 3W58A 5H9RA 1FX5A 2KM2A 2PHWA 3WG2A 5CAZA 2A5ZA 3T1LA 2H0BA 3SITA 1SACA 2D44A 3WDVA 4LBMA 5GZFA 3B69A 1V6NA 3WDTA 3IPVB 3VUOA 1AF9A 1LHUA 1JBCA 1DYPA 1GBGA 1VIWB 2AYHA 3AK0A 4RL7A 3UK9A 1A3KA 5GJ6A 1FNZA 4K1YA 3MPPG 3U4XA 1DHKB 4GKXA 4LBLA 3I8TA 3WCRA 3BOPA 1DZQA 1GV9A 2WSUA 3IPVA 2EXKA 2GMMA 3AZVA 3RG0A 3B9CA 1AXZA 3WUCA 5DXDA 4XJ8A 1FV2A 3WHUA 4UW5A 1FATA 1ULEA 2HYKA 4R9DA 1VAVA 3C2UA 3IMNA 2ZMKA 4XXPA 1FYUA 3HR9A 1OQ1A 2NZ9A 5L73A 1JN2P 1WBFA 1LHNA 1LOCA 2D6OX 2P3KA 3LSEA 1G9FA 1QDOA 3ILFA 5KXBA 1MVQA 3ILRA 2DUOA 5GLZA 2W68A 3T1MA 2D3RA 4FPLA 3V0BB 4R9AA 1W6OB 1W0OA 2PHFA 1S0EA 4YG6A 4CRQA 3M3OA 3WCSA 2D7FA 4AGRA 2B7YA 4Q8LA 3M3EA 4BQ1A 1AZDA 5FREA 5T54A 5F9TA 1FNYA 3V0BA 5GZGA 1W6OA 1AVBA 2CNAA 1FAYA 4CTEA 1LU2A 1LECA 1V6KA 4HANA 4I30A 4M3CB 3VKFC 3FUOA 3BIWE 3PVEA 1LOAA 1W6NB 1KQRA 2GNTA 4BMBA 1GZ9A 2ZHNA 1KJLA 2GNBA 2C9AA 4H55A 4M3CA 1DQ0A 1U0AA 5DZEA 2JE7A 5DZGA 1JW6A 3OGGA 4YM3A 1W6NA 3PMEA 3WLUA 5HCFA 2W52A 2ZHLA 4GKYA 1G7YA 1YXWA 1QDCA 3ZSJA 2ZGOA 3O0VA 1DQ1A 5GZEA 1IS4A 2ZGKA 2DVGA 4WVWA 2D6PA 2DYCA 4XXAA 1QKQA 2W39A 4FPYA 2GDFA 4BPZA 1MS1A 5JMCA 2ARXA 2A75A 2PHTA 3LCPA 1I3HA 2DU1A 3AZYA 2A6XA 4XMIA 5HCBA 2D6KA 2YMZA 1MACA 1SCSA 4FP3A 4YG3A 3KM5A 5IUQA 2GN3A 1N1TA 1YYNA 4PBPA 3RMYA 5JOWA 4YLZA 2ZKNA 1KRIA 1Y7BA 1W0PA 3AZXA 4YM1A 3ZXJA 3V0AB 2A7AA 1IS3A 1YRZA 1PZ8A 3ZYRA 1MVEA 1UL9A 1URXA 3O0XA 2UURA 2LTNA 3A0NA 1NXD1 5GLUA 1LOFC 3AYEA 2WLQA 1S0DA 3V0AA 1F5FA 4M01A 2E53A 1N47A 4U36A 5CA6A 1SLAA 1MR5A 5T50A 2R0FA 4XIOA 1ULFA 4P9XA 3GNEA 3OYWB 5JVVA 4XHXA 3D4KA 3R4UA 1DQ5A 5EYYA 4XE9A 1AXYA 2UWCA 1JUIA 4M3CF 1SBDA 2E7QA 4FPJA 5GLVA 2ZACA 4XBNA 2ES3A 3WUDA 1LOFA 1A8DA 2VXRA 3OJBA 2ZMLA 2VY0A 4W65A 2ZGQA 3BODA 4Y22B 5E89A 2DVBA 3ILNA 3OYWA 4ITCA 2VW1A 3O0WA 3WDYA 2Z42A 2ZBJA 3WG1A 4Z8BA 4XIKA 1CPMA 3AJYA 5DUWA 5F5QA 5GALA 1LODA 3M3CA 2GMPA 2WKKA 3AZWA 3FUQA 3NWKA 5GZCA 1S0GA 1LENA 4LBQD 4Y22A 1ULCA 1F9KA 2ZGUA 4PQ9A 4GXLA 3USUB 1PZ7A 4ATEA 4FP2A 2DWRA 4AVTA 1C57A 3JUUA 5SV8A 3TB0A 1BYHA 2UU8A 1MS3A 1LEMA 1KDMA 3POSA 3AXEA 4YGEA 2EXJA 4ATFA 5GM0A 3UJOA 2FMDA 2R0HA 3WHTA 2VW0A 4D69A 5LK5A 3AP4A 3USUA 3CNAA 1IKQA 2VUAA 3BTAA 4LBOA 3ZXFA 1JYCA 3L2YA 2V5YA 1CPNA 1EPWA 2EXIA 2GN7A 5DUVA 4XJUA 1QOTA 3AP9A 1LESA 1D2SA 1H9PA 4FPOB 3N7LA 4K21A 4Q1RA 3RSJA 1O4YA 4XJWA 3N7KA 2EAKA 2A6VA 2I2SA 3WZ1A 4FPEA 2RHPA 1G9BA 1C1LA 2GMEA 3MW4A 4ISQA 2EIGA 3W59A 2E51A 5CBLA 1S1AA 2SBAA 2E7TA 1HDKA 1QNWA 1HLCA 4R9CA 3WG3A 1AJKA 1WW6A 4JCKA 4YG0A 4IQPA 2P34A 1BKZA 2ZHMA 1MS8A 3M3QA 2ZABA 3JU9A 3UJQA 1G9CA 2A3WA 1V00A 3NV3A 1GANA 1MS9A 1UZZA 1V6MA 1LOGA 1N1SA 2C5DA 3H0OA 2AH2A 2TEPA 4Y24A 3SNMA 1KJRA 4DQAA 1B09A 5HCAA 4C1XA 4LBJA 1DLLA 1PZ9A 2G4IA 1WW5A 3AX4A 5T52A 1JYIA 2R16A 5EWSA 1IKPA 1LCLA 1J1TA 3QCWA 4YM0A 2A3XA 1Z0HA 3WDXA 1CJPA 1MZ6A 1G9AA 2NMOA 3WNXA 2YROA 4Q2FA 3IKWA 4LBKA 3ZXKA 2DURA 4UW6A 2PHRA 4YW2A 4YFZA 4AVSA 1KDKA 1N1VA 2ZGMA 3PJQA 3OY8B 3WG4A 1Q8OA 5KXCA 2NN8A 3ASIA 4Y1YA 5CB7A 3AP7A 4K20A 1FV3A 2UWBA 5DUXA 1S0CA 2CWMA 4M00A 1BJQA 5JOXA 4SLIA 1QOSA 1CR7A 4FOVA 4YZ4A 3N36A 3WVJA 5JOZA 4GA9A 3QLQA 1UKGA 2ZAAA 4XTPA 5IK7A 3OY8A 4TZDA 4Y26A 5T5PA 1H30A 2JDZA 5CNAA 1W6QB 1WW7A 2DU0A 4PCRA 1GZCA 1WLWA 1SBEA 3FFZA 1F31A 4FPKA 3N7MA 1WLCA 2JE9A 2ZZJA 2PELA 4JRAA 3N3HA 2XB6C 1QF3A 4OZXA 5JDBA 1QMJA 3I4IA 2YZ4A 2AR6A 1H9WA 1WBLA 1ZA4A 3FBYA 5H9QA 3AXDA 2P2KA 1WD4A 4NOTA 2DUQA 5H9SA 4XMAA 4FPGA 2Q5TA 2D3SA 3NV1A 3D5OA 2ZGRA 2P37A 3VKLA 4M3CE 4YGDA 1UZYA 1CESA 1LULA 4YGBA 1GKBA 2YY1A 4P9WA 4CZSA 2BQPA 3RMXA 3SLIA 1LHVA 1DFQA 4YW5A 3RS6A 3Q9OA 4UW4A 1MS4A 1A78A 1C4RA 1GYKA 1TEIA 1QNYA 1V6IA 5GLTA 1CIWA 1Q8VA 2JKBA 2ZGPA 1DQ2A 3R4SA 4XZPA 4Q27A 3VV1A 3WDWA 4BM8A 1QOOA 4YZ5A 3WOGA 1YI7A 1UN1A 3WDUA 1QU0A 2DVDA 1ZM1A 5T5OA 4XHBA 2DV9A 5DG2A 1WW4A 2DVFA 1GICA 5T5JA 3PVNA 4AWDA 3O5SA 1BXHA 4Y1ZA 3SISA 4FOWA 4WZFA 1D0HA 4BLIA 4GALA 4Y1XA 4BLJA 5E8AA 4XJAA 1XQNA 4R9BA 3OPZA 1HKDA 1SLBA 2OUHA 5EXOA 2WNEA 4RA0A 2DTWA 3NV4A 1AXKA 4YW1A 1SLTA 4FPCA 1ENSA 5JOYA 1ONAA 1N1YA 4ZXKA 2W08A 3MW2A 4FOQA 4LBQB 3VKOA 1Z78A 3M1HA 4TYSA 1MS0A 4Y1VA 1G86A 1V6OA 4DRVA 2GALA 3NV2A 1VAMA 1S0BA 2A6WA 3AZZA 1UMZA 3AP5A 2VW2A 4XDQA 1SFYA 4LBQA 1CQ9A 2D6LX 1LU1A 3AYDA 1WCSA 2D3PA 1S0IA 2A71A 1GNZA 3V65A 1YO8A 2OUJA 4DFSA 3M2MA 2A3YA 3INAA 1V6LA 2ZGLA 1N3OA 2PHUA 1X50A 4XBQA 3ZSMA 2FHRA 1SCRA 2DTYA 1LOBA 2PHXA 2D43A 1GNHA 2D6MA 5GZDA 3ZSLA 2JJ6A 3ZYPA 2NP0A 1G9DA 4FQZA 3SH3A 4YGCA 1Q56A 5H9PA 4P9YA 3VKNA 1Q8QA 1KITA 3OBRA 2LALA 2NM1A 2P3IA 4Q8KA 4ISRA 1OKQA 4GWNA 1C1FA 1N3QA 3VKMA 1Q8SA 4HL0A 2WT0A 2NMNA 2YV8A 3MW3A 4WVVA 3AYAA 4YW4A 1UX6A 4DS0A 2AUYA 5FRAA 2DVAA 2WQZC 3N35A 1LHOA 2ZMNA 4FOYA 4JC1A 4AGVA 1DBNA 4AYUA 3ZXEA 1DYKA 3FLRA 3FLTA 5EYXA 1W6PB 1NLSA 1LHWA 1LGCA 2D6NA 3FLPA 2CY6A 2OVUA 4FQ4A 4XOGA 1LGBA 3GALA 2EALA 2VU9A 2E6VA 3ATGA 1SLCA 1UAIA 5IK5A 2WJSA 1V6JA 2ARBA 2AENA 2JECA 3RRDA 1W6PA 4UW3A 4ASMB 4XJZA 5IT6A 1SLLA 2GNDA 2CTVA 1BQPA 2A6ZA 1RITA 1VLNA 2DUPA 3KQRA 1AJOA 3SH4A 5E88A 4YZ1A 4FPFA 3IN9A 1UPSA 2ZHKA 1LOEA 3HMYA 4NO4A 4YZ3A 1CVNA 2AREA 2R1BA 1LJ7A 3ZPYA 2SLIA 3AP6A 4BMEA 4DPNA 1DIWA 1S0FA 1AX0A 1LTEA 1JOJA 1QGLA 1HQWA 4P14A 4YZ2A 2CWSA 3ENRA 3D6EA 5BYNA 1DQ4A 4L8QA 1IOAA 3DGTA 1VALA 1ULGA 2P3JA 4XYXA 2XG3A 1MS5A 4XBLA 5KXDA 1SLIA 4Y20B 3DUIA 1W6QA 1BZWA 4Q26A 4FPHA 3R05A 1ENQA 4YFWA 3APBA 2ZGSA 4LBNA 2WSVA 2UWAA 3HN1A 5IK8A 4MYEA 4Y20A 2GNMA 4PBOA 1LGNA 3ZSKA 4AGGA 2WT1A 1RINA 4ZKTB 3IM0A 2R49A 1N3PA 2CYFA 4BOWA 1WD3A 3POWA 4Y1UA 1YIFA 5T55A 3B01A 1W6MB 2ERFA 5T5LA 1I1EA 3AFKA 1DGLA 1AX1A 1WUVA 4U2AA 4F83A 1IS6A 1RIRA 2CL2A 3O12A 1SBFA 3AYCA 4C1WA 3V64A 3UL2A 4YW3A 1W6MA 1JXNA 2JD4A 3TAYA 2AGSA 1IS5A 2V73A 1CONA 2ZA9A 5DUUA 5DG1A 5DZFA 1GZWB 3RQ0A 2ZGNA 4Q1PA 3POYA 1R1ZA 3T2TA 1ULDA 3PVOA 1ENRA 1O4ZA 5AVAA 1HQLA 4FVVA 3ZXLA 1GLHA 2YXSA 5JLVA 1APNA 4XILA 3A0KA 3A4UA 1G8WA 3ZVXA 1OFSA 4AVVA 4DRRA 3WV6A 1Q8PA 4XJ9A 2NYYA 3B3QE 4WV8A 1DQ6A 2A6YA 4KBBA 3N7JA 3LSDA 1S0JA 1GZWA 3MEPA 1JHNA 1GSLA 2EF6A 1AX2A 4YM2A 3AJZA 2EXHA 3B00A 5GLWA 5KXEA 4GWMA 3OBTA 1MZ5A 4PF5A 2VH9A 2WT2A
chains in the Genus database with same CATH superfamily
1WLDA 3ZFGB 4XTMA 5K0UA 3AMPA 1OOPA 1SFPA 1VBA2 4HPKB 4UF0B 1V70A 4L97A 4HXCA 3WG2A 1OUSA 1PM7A 1PX3A 1AYN1 5IAVA 3RZLA 1POQA 1BK1A 1V0AA 1VJ2A 2KD7A 1ACCA 4IUGA 3ZO0B 5F37A 4NPMA 3VUOA 1IG3A 1OF3A 4X6RB 1DYOA 5LA1A 3AK0A 3JB8A 4XVHA 5ANNA 2QQJA 3JCIA 2OQ6A 4RR3C 4QPWA 1A3KA 4JGZA 3NRUA 4DZGA 2JG8A 3UNPA 1W05A 3IAQA 4K1YA 2P6HA 1DHKB 2JENA 2OIIA 3I8TA 4J6GA 1DZQA 3J8F1 4UFLA 5KWRA 2WA3A 1V9U2 4LNVA 4CCCA 2W46A 2GMMA 4IERA 4RR3B 5FOJB 1OLRA 3AKSA 3MYXA 3WUCA 2WZ8A 1C8M3 1GNYA 1YLLA 4LITA 3NNFA 4IE7A 1US2A 1JH5A 5JI9A 2XL9A 4MG2A 4AEKA 1K5MC 3IMNA 4XXPA 2WNUA 3AKPA 1JOPA 2ET1A 2NZ9A 5L73A 1PGL2 3HVDA 1W3XA 2QQNA 4S2FA 4AG4A 1CAXA 3CEWA 1G9FA 1NQDA 4CPBD 3PDQA 1K5MB 2DUOA 2W68A 4HKLA 3I49A 2D3RA 4RGAA 1TNFA 1QJEA 2R072 2VMDA 1FPN3 1W6OB 3PMSA 4IE6A 1XYNA 1ZRCA 3HIFA 3JBG3 3M3OA 4A45A 5JIAA 2Z69A 5I8SA 2XR4A 2YC4A 3D0JA 2RS51 2XHKA 4B8EA 5LW9A 3M3EA 4BQ1A 1W8TA 2EICA 2QJVA 3S7IA 4AR2A 3RNSA 2Y6KA 5KHIA 3MIDA 1PVC1 5BPXA 3MIBA 1NE6A 1X8EA 2O8OA 1LU2A 2XUMA 4M3CB 5DDJ2 2OZ6A 2WRAA 4S2GA 3VKFC 3LWCA 2CGPA 3ZN4A 5AFEA 4Q4W1 2GNBA 1F35A 4V2WA 4MGSA 2O0OA 4H55A 2GC3A 1VBB1 2JE7A 4F3JA 5A6YA 3WLUA 2CAVA 4GKYA 3PURA 3P1IA 1FOD3 1R64A 4KG8A 1K42A 2O8QA 3SCGA 2RDSA 2ZGOA 5GZEA 5FZ8A 5A3UA 2D6PA 4XXAA 1QKQA 2GDFA 1OFNA 2JG9C 1YFWA 2FZ2A 3BUCA 2BP6A 1UKRA 3E97A 5DAVA 2RS11 3AZYA 5IVCA 3RYRA 2RJ2A 3H50A 5A70A 1K3IA 4XMIA 1Y9MA 3B9IA 1SCSA 1RYYA 2JG9B 4YG3A 5IUQA 1PO21 1N1TA 4P5YA 3TEXA 5JOWA 1RHI1 3BKZA 4YLZA 4A7ZA 1VB4A 5B2GB 2NPIA 4HT1T 4YM1A 4KQ7A 3O7OA 3K4AA 3VGIA 2R063 3K3OA 3I3MA 2FMYA 4CU7A 1YQ8A 1URXA 1Q43A 1XSQA 3O0XA 2O14A 1W2NA 3ST7A 1RXGA 5A3OA 4AFCA 1ULOA 1Y3TA 4DY5A 5A6QA 4QDRA 5GLUA 3KZ4C 2R32A 3LIGA 2DFCA 3JBG2 2VTXJ 3OF1A 2C6SA 2E53A 3ZPOA 5LWBA 1N47A 3JQWA 1XNCA 3J7NA 3CKHA 4IEZA 4XQ4A 3HBZA 4BXFA 4CVUA 5KC5A 5K8SA 3CZJA 4COVA 4LXLA 4CDUA 2HH9A 4Z92B 5A3LA 5JVVA 4QM9A 4XHXA 3X29B 1AXYA 1UIJA 2UWCA 5TSWA 3I3DA 3O14A 2VVDA 3WUDA 4HSJA 3GBFA 4BK5A 1LOFA 2VXRA 2G19A 2VY0A 3KS7A 2ZGQA 3VHOA 1HXS1 1E5IA 2W87A 1UW8A 3LQCA 4LO5B 2R042 5FAXA 3RZKA 1AL23 2VW1A 3O0WA 2WIIB 2Z42A 1RUNA 5F5QA 2JWPA 5GALA 3SCHA 1LODA 2GMPA 4IEUA 5L9BA 2WKKA 3NWKA 5FPBA 1W8UA 2HLEA 4QT6A 3TEWA 5GZCA 2DFBA 4MADA 3FE5A 4QQOA 3NJZA 3RPQA 1F9KA 2BPA2 2EIBA 2A1XA 5CFCA 1RB8G 2C24A 1PZ7A 2LRPA 2W92A 2WWJA 3HNMA 3JUUA 3J7MA 4IEVA 3TB0A 1BYHA 2Q8OA 3PL0A 5L19A 4AEDC 1UY4A 5LEJA 1LEMA 1KDMA 2FDFA 1K5JA 3KVBA 3UJOA 2FMDA 4GMP0 3UKNA 1JU4A 5LK5A 4D69A 4E9KA 2YYOA 4MOAA 4QPIC 4AEDB 5IW0A 1UO9A 4ZONA 2EXIA 2GN7A 5DUVA 2W5FA 2WS93 1OMIA 1HRI1 1QOTA 1W2AX 1ZX5A 2QQMA 3AP9A 3NJVA 2GC2A 4JQTA 4K21A 5SV5A 5DAQA 2OKXA 3WW1A 4K8FA 3BVCA 3H8UA 2FDJA 2XBO1 1TME1 4QPIB 2XJTA 4BQ5A 4FPEA 2RHPA 2GP5A 1CGPA 3W59A 1Y9GA 1RJ7A 2E51A 4M0NA 1GP6A 1HLCA 4R9CA 2BDRA 2J22A 4D6SA 4JCKA 3I2JA 4MHUA 1CAUB 1E5SA 1AR72 1CAVA 1XU1A 2RM21 1RC6A 2ZHMA 1XNDA 3ES4A 3M3QA 1W99A 2Z2SB 1G9CA 5AC91 2Y0IA 3LGRA 1JYVA 1UWWA 2VUJA 3NV3A 3U07A 4W50A 1RUH1 1NZCA 2XWBB 4AQ6A 1LOGA 5CKMA 2AH2A 4Y24A 1X82A 5C8CC 4CCNA 1DLLA 2HWD1 5T52A 4AOCA 1KFXL 1NCQA 2G9FA 5EWSA 3B7MA 1AL22 1DZRA 1LCLA 2XJUA 4RS5A 3UT0A 2RDNA 1C3HA 3QCWA 4XCAA 2HKXA 5FYHA 4YM0A 2A3XA 2VMHA 4IEQA 5C8CB 3BN6A 5F2SA 1CZSA 1CJPA 3KLSA 3MIGA 2JDMA 3CU7A 2YROA 3QH6A 3IKWA 3TN93 4ZPIA 1L7RA 3ZXKA 4YW2A 5E1RA 1PK6C 4BQ3A 5BNPA 5JUVA 1N1VA 2BGPA 4BHPA 2NN8A 3WF2A 5CB7A 4QHZA 2E63A 1IHMA 2CWMA 4OHXA 4M00A 4UFIA 2R30A 3I3QA 5FQ0A 4BQ2A 1PK6B 3LFIA 5FZOA 1T6GC 2WFF3 4Q4Y3 3N36A 2HWF1 4LMFA 2VVFA 4HFSA 5J37A 1UKGA 2VZVA 1C5HA 1OA4A 5CG9A 3G7DA 1GP5A 1WCQA 2WS92 4MGKE 1H30A 2P4EA 2ZAHA 3ZYFA 4EN6B 4B4PA 2W1UA 1GZCA 1SBEA 3ZYBA 4AHXA 2BYVE 3MICA 1WLCA 4AF9A 4LORA 1O3RA 2Q1ZB 4HKWA 4E8CA 1QF3A 5KC6A 3ZDVA 2JDNA 2VQAA 1QMJA 3CHXA 3ELNA 3UKTA 2AR6A 3VBOA 1WBLA 5DN2A 3ZMNA 1VBD2 5JXHA 2CU5A 4COUA 3BTYA 5FZMA 3GYDA 5H9SA 1D4M3 4NUBA 2Q5TA 4XMAA 4MGIE 4LUKA 1R091 3VKLA 5A3MA 3VZMA 5FY9A 3OB8A 4CU6A 3AVRA 3K77A 1AR92 1W28A 5C4WC 3RMXA 1LHVA 3LA7A 4GAZA 1DFQA 2HWC1 3RS6A 3MV11 1BVVA 4UW4A 1C4RA 1TEIA 4IGPA 4YPJA 4BMBA 4XC9A 2VXJA 4LLFA 2VZ1A 5C4WB 1YI7A 2DVDA 4NAMA 4LQRA 3RJRA 3ZM8A 2WA4A 1WGPA 2DV9A 2XKPA 5FYCA 2Q1FA 3DKWA 4ES9A 2WZR3 2Y38A 3KSCA 1JYXA 4N9HA 1QXRA 4AWDA 1A34A 4NN0A 3T0DA 1BXHA 3TN92 2P17A 3E5QA 2HBTA 4META 3PUSA 5E16A 4UXAA 5IVFA 2JB4A 3DF0A 1UXZA 4LHLA 4BLJA 1W90A 4OUSA 1LAJA 1SLBA 2OUHA 3ZOIA 5BUVA 3LPFA 1IGOA 4LA2A 2DTWA 3NV4A 4Q4Y2 1J59A 1XRUA 1SLTA 4FPCA 4EYUA 3AMHA 2W08A 2Y6GA 1ND2A 1Z78A 2BGOA 4TN7A 2OX0A 3M4FA 1G86A 4W4ZA 1AR61 1XB9A 4EWAA 1QJZA 3MF9A 3CIHA 3IMMA 2XVGA 3AZZA 3LEIA 1SFYA 4LBQA 4LE4A 1CQ9A 2ORXA 1XYPA 2D6LX 4XDQA 1XU2A 4FFIA 4IESA 4LOSA 4CCDA 1R081 2LUWA 1PIV3 1UMIA 1GNZA 2DCYA 2IWGB 3V65A 1SFNA 4QB6A 2A3YA 1VBE1 4Y33A 1ZRIA 3RWNA 3W5MA 1V6LA 1UY2A 3UESA 3SKJE 3Q8EA 2PHUA 1UMHA 3I54A 2FHRA 3I7DA 3RI9A 1LOBA 3ZSLA 2D43A 3E6CC 3H1WA 1HRV1 2AC1A 3WNKA 4FQZA 1NLQA 1Q56A 5A33B 3RZJA 4NHMA 4DEQA 5EHDA 2WN3A 1Q8QA 1R1A3 2HEWF 5J09A 3PVBB 1KITA 2Q4SA 4PIYA 1ZRDA 4Q8KA 4ISRA 3SMHA 2W0XA 3VKMA 1SQ4A 1N3QA 3NNLA 1RVF1 1CZVA 4DIQA 1PGW2 1C5IA 3THDA 4WVVA 3ITQA 2WZR2 4CP2A 2AUYA 3VDDC 5LBEA 2BBAA 5JXJA 1LHOA 1YCIA 2ZMNA 3DL3A 3H3UA 1CAWB 1CWPA 2WQ8A 5APAA 5LZ6A 1DYKA 4O7XA 3T4HB 3IZOA 4MZUA 3FLTA 3ZMOA 2HWE3 1W6PB 1J1LA 4IEYA 5A3WA 1NLSA 3VDDB 1LGCA 4BH9A 4URAA 4PIZA 2PQSA 2XJVA 3HBKA 1LGBA 2W47A 3IDAA 2VTXA 2VU9A 1OD5A 3ATGA 3OG2A 2QQOA 3GXUA 5FUNA 5IT6A 4YVSA 2PFWA 1RTVA 4Q0PA 4UW3A 5LA0A 1SHWB 1SLLA 4PDWC 1W2TA 4XFFA 1NA1C 5JXGA 4IV1C 5GKAC 1RITA 2DUPA 5FYUA 1LR5A 3QOPA 4CUBA 3IN9A 1UPSA 4QX3A 1X7NA 1A8MA 1XSRA 4GH4A 4WM8A 3ZFFC 4CP9B 1M4WA 4D0QA 3HMYA 4YZ3A 4PDWB 1CVNA 2R1BA 3FHQA 3CO2A 3ZPYA 1IQAA 1NA1B 2QE3A 4IV1B 3WNPA 1AX0A 4JGYA 1PIV2 1ZBE1 2YU2A 3LEGA 4K8RB 1YQCA 3WT3A 3ZFFB 4A3XA 4ZS2A 1VALA 4PI2A 4NIIA 4CP1A 4BISA 5JZGC 4XYXA 5FYYA 1O5LA 4XBLA 5LRSA 2UY8A 1SLIA 4Y20B 1H6XA 4I01A 4ET7A 1F15A 5FZLA 1JYWA 2BNOA 3KQ4B 5JIUA 3JD71 1H2NA 3CBNA 5JZGB 1QJY3 5DAWA 2UWAA 5FO9B 1PGSA 1LKNA 1R1A2 1RUI3 1RINA 2VM9A 4QDQA 2R49A 4BE3A 3POWA 3AMQA 4J1WA 1RUC3 1E5RA 5I0TA 3PUQA 4AI0A 4CDQA 5FBZA 1HW5A 1OPMA 1S2KA 2ERFA 2JICA 3AFKA 1AX1A 4XFHA 2ARAA 4ONUA 3IWZA 5FZCA 4GMP3 4CU9A 4ASKA 4D7SA 4MV2A 3LB9A 4Q29A 5FXZA 1EV13 1M06G 5FV3A 2RR12 1TMF1 1SBFA 5L9VA 3UYJA 3V64A 2HWE2 1QWRA 4R52A 1W6MA 4PQQA 4NIAA 3F95A 3L9JT 4XURA 3TAYA 4LK6A 2RV9A 3IAPA 4RSUA 5ISLA 4UT5A 5DUUA 2HYXA 3I2DA 5DG1A 3RQ0A 2ZGNA 1AYM3 2HEYF 1R1ZA 3M3IA 1JZ7A 4YWAA 3HPNA 1HQLA 1DDLA 1ZZ8A 2D40A 5D2AA 5F6KA 2J1RA 3DEMA 4WV8A 4CP0A 3Q8BA 4KBBA 5A7WA 3LSDA 2B9UA 3B94A 1GZWA 3MEPA 3PTRB 1GSLA 3B00A 4R4ZA 4OI4A 1JZ5A 2IXHA 4AFMA 4HL0A 2WT2A 2RMU1 3N4MA 1JZ8A 1PO13 4BDVB 5FXWA 4K1ZA 2J1VA 1CN1A 5EJ3A 1LEDA 3VBHA 3NO8A 4AFDA 4EN8B 5H9RA 3NL1A 1FX5A 1XC6A 5C3SA 2E9QA 2MEV3 1SACA 2PAKA 1RMU3 2F17A 4GB31 1VAKA 5GZFA 4D6RA 1V6NA 3WDTA 3Q8FA 3ZFGA 1BMV2 5FTTC 2GSYA 3U4SA 1QJY2 3UK9A 3I2IA 4HPKA 3OGVA 4L99A 4QB1A 4CU8A 5GJ6A 1VRBA 5HV4A 1YQ2A 2X8KA 1UD1A 3JQXA 3U4XA 3OD0A 4XCBA 2YUEA 4GKXA 2ZEWA 4NROA 1RUC2 3B9CA 1WMFA 1FV2A 2B46X 1ALYA 4IV3C 3DYMA 3I2OA 5FPXA 1ULEA 5A7SA 2QDNA 5C5UA 3C2UA 1EV12 2NQYA 5JR7B 3HR9A 1OQ1A 2UYBA 4RR3A 4D8MA 4IV3B 4I0WB 4V1PA 3CLPA 3R4DB 5FZ4A 3WX5A 2B42B 4C0BA 1XNBA 1MVQA 1MZFA 2CV6A 3ILRA 3T1MA 3VHNA 1TE1B 3GJAA 2E31A 1W0OA 3BYWA 1RUD3 2PHFA 4KGGA 4YG6A 4H7LA 3ZR6A 4ZS3A 2X05A 4XABA 3D82A 4W6XA 4C0HA 4AEJA 4L9BA 1MEC1 4AI3A 4CYDA 1K5MA 5T54A 1W6OA 3J9SA 5T3NA 5EFUA 1FAYA 4NVPA 1RUF1 4HANA 2UY9A 2IC1A 2Q8DA 4N43C 4MUVA 2GC1A 1DGRA 1H4GA 1KQRA 3VHPA 3O1UA 1PO12 1RUE3 1VMHA 3E6DA 1AYN3 4P08A 4N43B 2HWB1 4M3CA 4JDOA 1U0AA 2WO2A 4I0BA 4M4PA 5D8AB 2Y33A 1OA3A 2MEV2 3PU3A 4MLOA 4O9GA 1RMU2 4O9EA 5HCFA 2ZHLA 2IXIA 3MO4A 4D94A 1JYNA 3O0VA 1DQ1A 2ZGKA 2Y60A 1ZZBA 5FY0A 3S30A 2DYCA 5FP3A 4AI9A 2V4VA 1CD3G 2CSGA 2Y6LA 1MS1A 3OUJA 4BPZA 2PHTA 2A75A 3LCPA 4AHZA 5HI0A 2DU1A 2QQKA 3CL1A 4P9LA 2LM3A 2VBDA 2PAMA 2D6KA 1RUJ1 3ZX7A 1IQDC 1MACA 4DO0A 1UU5A 2VMFA 4MXVA 2AEZA 4PBPA 3RMYA 3ZLIA 1O8SA 1OUXA 3VZKA 1V9U3 5I0RA 1GMMA 5I0SA 2ZKNA 1KRIA 1NX9A 4LO8A 2ZEXA 1IS3A 2B39A 3K3NA 3SHRA 1YRZA 5FZBA 2FBEA 3ZKYA 5A1AA 4NHKA 4DUXA 4HVRA 3LAGA 4HN0A 1NXD1 2DDUA 2GU9A 2VMCA 2XL7A 1QH6A 1RUD2 1S0DA 5K4LA 1SG3A 2WAAA 5JPMB 1ND3C 3FWEA 5EP9A 1XJAA 1AUYA 1UIKA 1Y43B 1SLAA 5DABA 2R073 4I02A 5T50A 3BPSA 3PU8A 4XIOA 3BPZA 2PHDA 2BEOA 3GNEA 3OYWB 4SBVA 5FUPA 2VMGA 3VL9A 2YG0A 3ZYHA 1JUIA 4KWUA 3RZZA 4M3CF 3WY6A 4TWTA 3VZOA 3WP4A 1RUOA 4B29A 1RUE2 2ZMLA 4Y22B 5F7UA 5E89A 5FYVA 3H1YA 3IDCB 4AAPA 1AYN2 1VBB3 3WDYA 3MLLA 2ZBJA 3SXWA 1HB2A 1D0GA 2GH2A 1Z7S1 2VNRA 1EAH1 3ACFA 5L7OC 3CJIC 1ZRFA 5A6XA 1LENA 4CA9A 1ULCA 3HNYM 4ATEA 2O1QA 5HBAA 5CIRA 4CXYA 2WWUA 1JI6A 1OVSA 5SV8A 1RJ8A 3GZUC 4H7MA 3MUZ1 4IETA 1XE8A 4MGYE 3U1XA 2RS13 5IFPA 1POV1 5L7OB 3CJIB 4P5HA 4PLOA 5LY1A 2GZWA 2VZUA 4ATFA 3W20A 4EN9B 4N9IA 3FBMA 4NRQA 1W9TA 5JI7A 4LO7A 4RQPC 2V5DA 1PO23 1MZEA 2QDRA 3CNAA 1RHI3 2VUAA 3ZXFA 4CDXA 3POJA 1F4HA 2V5YA 2ORZA 1H9PA 4FPOB 4RQPB 2VZSA 3RSJA 1O4YA 4MVTA 3N7KA 2P1BA 2EAKA 3WZ1A 1IG0A 2JDKA 1C1LA 3WINE 4AEDA 5CBLA 3T08A 3OPTA 4NWWA 1KXGA 1YNAA 5LATA 1UOBA 4DOUA 5C8WA 3W9AA 4JX0A 1EYBA 3WNOA 4A2UA 4OQ8A 1YQ5A 4QPIA 4H3WA 1PVC2 2P34A 1H1MA 1BKZA 2VZ3A 4FFHA 2VJXA 3UJQA 1J58A 1ZBA1 2YC2A 2A3WA 3IDEA 4LTAA 1JS9A 1V00A 3TNPB 3J7HA 2ZEYA 2DCZA 1MS9A 2VG9A 3ZXGA 2VGDA 1XYOA 4FTSA 2TEPA 1CAUA 4AI2A 4UAPA 2WYSA 4DQAA 1B09A 1NLRA 4Q4W2 4LBJA 2G4IA 3AX4A 4W8JA 1JYIA 4L11A 4KL1A 1PMJX 2QFEA 4JTNA 3VL8A 1IKPA 1VBB2 4IEXA 2XGXA 4KU8A 3U0ZA 4BJ0A 3VB9A 4NHXA 1YWKA 2F4LA 1MZ6A 1G9AA 2NMOA 2CGNA 3RDIA 3WNXA 2R043 2P5BA 4Q4V1 4LO6B 3U10A 3DXUA 1HN1A 4TXWA 1EP0A 3DV8A 3M7AA 2IXLA 3MIHA 5FO7B 4N53C 3PJQA 3OY8B 2RS12 4CUGA 5KXCA 2GH8A 5C8CA 4K20A 4QMAA 2C26A 4CCJA 3I2FA 1WWYA 3H8XA 1UZWA 2JD9A 2VQUA 1OVPA 4HK9A 4QX7A 1PO22 1QOSA 2PXJA 2D5HA 2PLV1 1RHI2 4FOVA 3WQBA 4B3NA 4H2AA 1HJFA 2ZAAA 5IK7A 4PLMA 5J48A 4TZDA 3OEBA 4JZRA 2W2IA 2G9GA 1UZVA 2JDZA 2W1WA 5J98B 1W6QB 2W1SA 1PK6A 2VULA 4PCRA 3THTA 1F31A 4FPKA 3A23A 1ST8A 2NLRA 4YNIA 3T0BA 5ACA3 5C5TA 2YHJA 2JE9A 3G6JB 5CKQA 3PLQA 1W2UA 1JYTA 5LEKA 4OZXA 5JDBA 5KHGA 4XW3A 3ZDSA 1H6YA 4LJHA 4WM7C 4Q4X1 4FPGA 3UETA 4P00B 4DY3A 3NV1A 3D5OA 4ZHNA 2I74A 2P37A 2YGLA 4ARYA 1RUH3 3WR0A 3OGJA 4A7KA 4YGDA 5L36A 3VD9A 2IVJA 3IT8A 5D21A 1AR73 2FCTA 1O59A 4WM7B 4YGBA 1GKBA 2YY1A 1PMIA 2AZ5A 2BQPA 3SLIA 4CZSA 4YW5A 2L9LA 4UFJA 4QPGC 4OI0A 1MS4A 3EHKA 4K9SA 1GYKA 4L0PA 1RGSA 5F6LB 2WUHA 3R4SA 1F4AA 3WDWA 1ASJ1 1C8M1 1W9FA 3K2OA 3M8LA 4Q27A 1QOOA 1MPXA 4AHYA 3WDUA 2YFZA 4LEJA 1U5XA 1O6UA 5DG2A 2GC0A 4QPGB 2XXZA 4Y5Z0 3VBSC 5T5JA 4CCOA 2B5HA 3ZYJB 2W95A 5IHRA 3SISA 4WZFA 5C9AC 1WA6X 1XE0A 5F39A 5C4WA 3P3PA 2DCKA 2LROA 1OOPC 4HZFA 4LIUA 1AR83 1E57A 1OLME 1FPN1 3C7EA 1TG7A 4LK7A 3VBSB 3GZAA 2HWF3 3GCWA 4RA0A 5C9AB 4FO9A 3CDZB 1YJKA 4ZXKA 5IJRA 1COV3 1OOPB 1G6NA 2QQIA 2TBVA 4FOQA 4TYSA 3NNGA 3OSDA 3E1F1 3FX3A 2FCVA 3SKVA 2JG8C 4DRVA 3HQUA 4KMQA 2C9KA 3AMNA 5LA9A 5ACA2 1O3TA 3GDBA 1DGWA 5CYYA 2A6WA 1UMZA 4RYDA 4QKBA 2FD8A 5KR7A 3AYDA 1WCSA 2JG8B 1S0IA 5F3CA 2DCJA 5FY5A 2OUJA 4OUMA 4DFSA 2RM22 3C8XA 4CXWA 3INAA 2F4PA 2VVEA 1K12A 1NY72 2I45A 2YFUA 3RGBA 1FOD1 5AC92 4XQDA 2ZGLA 2PA7A 4TTGA 4WBBA 4FT8A 3U14A 4XBQA 5GZDA 1SCRA 3ZYPA 1RUH2 3ZN5A 4OHYA 2XKOA 1GOFA 1VBD3 2JJ6A 3LIHA 1G9DA 3MDPA 3SH3A 4YGCA 1B35C 1ZZ7A 2EA7A 1H2KA 4MH0E 2WZEA 5FPZA 3POIA 1PMHX 3FJSA 1UF2C 4QDSA 1AR93 2P3IA 5EJZB 1OKQA 2PYTA 2XVLA 4OI2A 4GWNA 1C1FA 1B35B 2ATFA 2ZOEB 3R0RA 1FMD3 5C70A 3P6BA 2VZPA 4DS0A 1NXMA 1H2MA 1UXXX 2DVAA 2WQZC 1UOJA 3KCYA 5C3OA 4FOYA 3BTXA 2R061 4AGVA 1RUG1 4D6QA 3NAPC 4P9GA 3VD3A 3HN3A 3FLRA 3U75A 5EYXA 3LPGA 1AR82 3I2HA 1VRH1 3FLPA 2OVUA 4QB2A 2YBKA 3W21A 4MX3A 5EQUA 3NAPB 5C71A 2HWF2 3VBFC 5FR3A 1CAWA 2YBSA 3IDBB 1UAIA 3I97A 5IK5A 2WJSA 1COV2 5FWJA 4GWIA 1W6PA 4ASMB 4XJZA 3VD4A 2D93A 2GNDA 4XFGA 3VDDA 3B5LB 3DYPA 2C1FA 3VBFB 2YGMA 3HWJA 3OUIA 1AJOA 4OMCA 4YZ1A 3K75B 2ZHKA 4L2NA 3ZFEC 3H8RA 3U78A 3GZEA 3NVCA 1YC61 1SPPB 1R083 1RL3A 2RDQA 5FMBA 3GBWA 5FZIA 3T09A 4DPNA 2CHHA 1I9RA 1BEV3 1S0FA 1LTEA 3WF0A 1AL21 1JOJA 1QGLA 1HQWA 2JE8A 3I2KA 1VBE3 1L7LA 1J84A 2VNGA 3DGTA 2ET7A 3ZFEB 1ULGA 1UQXA 4CP9A 1ODNA 4YYOA 3VBUC 1QXJA 4PDWA 1W04A 4MHRA 4IL7A 2IZWA 1BVP1 1NA1A 4IV1A 4CCLA 5M0TA 5C6CA 1CJDA 1D4VB 1ENQA 3E5UA 3R05A 4YFWA 5JAXA 4LHSA 3RZGA 3ZFFA 3APBA 2CDOA 1QJX1 2HWC2 3I2GA 4LBNA 3AC0A 3VBUB 4CUCA 5CU1A 4Y20A 1QQP3 2RDRA 3GGLA 2WT1A 5FLHA 4AGGA 2IXJA 1LNSA 4PHZA 4ZKTB 1N3PA 4XFCA 1WD3A 4Y1UA 5JWPA 1VB2A 5T55A 5JZGA 4RGGA 1UZ0A 1FMD2 3LOIA 2WS91 2VTFA 4EQVA 4JKKA 2K0GA 1WUVA 4G3YC 2OQ7A 1VMFA 3VN4A 4QAWA 3ES1A 4YSFA 1RIRA 4LUMA 4MXWB 4YVWC 1FI2A 2H6CA 3UL2A 2YBPA 3POEA 5F3EA 3GF6A 1JXNA 2JD4A 1DG6A 3C7HA 4EN7B 4FBFA 3KGLA 3LD8A 1IS5A 2V73A 4PI0A 3H3ZA 4QX0A 5DZFA 4YVWB 4S2HA 4J1XA 4UFMA 1OSGA 2ILMA 3POYA 4HSLA 4A4AA 4DUVA 2OT7A 4JAAA 3ZXLA 5CKNA 5KHJA 3S7EA 5JLVA 3WXPA 2VL4A 4DRRA 3OBZA 1AR62 3B3QE 4XAAA 4YW6A 3URFA 3EMRA 1JHNA 4NHLA 3MUY1 4CE8A 2BVVA 1R082 2VOTA 3EB7A 3WD5A 4Y4YA 1BEV2 2ZX1A 3MBWA 1VBE2 2ENRA 5FLIA 2VNVA 5IK4A 3WF4A 3SH5A 2XVKA 4QXBA 5I8TA 5J36A 5FPLA 1QHDA 2R1DA 4QQHA 1L7QA 4D7TA 2KM2A 4AZZA 1DF0A 4JKLA 4MGQA 2H0BA 3T1LA 1YUDA 2D44A 3AMMA 3E6BA 4BIOA 4A41A 4BK4A 3IPVB 2ZPXA 1HB1A 1T6BX 1VIWB 2B8MA 3OGRA 1QQP2 2JB8A 2VUCA 3MPPG 4LBLA 4WVMA 2OZJA 3WCRA 3BOPA 2WFF1 2FDHA 5DMYA 3W5NA 3AKQA 2BWAA 3AZVA 3OPWA 5EPAA 1PNFA 4DINB 3O1MA 1AXZA 3LDRA 1X9PA 2F6BA 5DXDA 4QD2A 1FXZA 4UW5A 1FATA 2HYKA 1TMF3 4R9DA 5A80A 2VCCA 1ZYBA 3UGHA 3PNAA 4LR4A 2RG4A 5ERLA 3DPRC 3KB5A 1KFUL 5I93A 5I91A 1LHNA 1LOCA 2D6OX 4AW7A 2P3KA 3LSEA 5G05L 3BCWA 3ILFA 4GJZA 2RR13 2XDVA 2VCMA 4NRPA 1BLZA 3V0BB 3DPRB 4R9AA 5FLJA 2XJQA 1S0EA 3HJRA 1SZBA 4E27A 5J1XA 4CRQA 1VBC3 1D4M1 4OULA 2D7FA 4AGRA 4Q8LA 4FCAA 4RHV3 1AZDA 5FPVA 3H3LA 5FREA 4Q5OA 4XACA 5F9TA 1FNYA 5GZGA 1UY0A 3S57A 2WO7A 1AVBA 1JZ3A 2PHLA 4ORFA 2A73B 4CTEA 1V6KA 2BOIA 3NNMA 3GHMA 1ZBE2 3BIWE 3FUOA 3NJXA 1LOAA 3PVEA 1W6NB 4GQ7A 2GNTA 5FXVA 1NOVA 2ZJCA 4JV4A 4CUAA 1GZ9A 1OBNA 5BV6A 5FZ7A 5FZHA 2XQRA 2VUDA 1KJLA 2ZHNA 1PX4A 4CEYC 1PGW1 1SDDB 5FQ0B 4QQLA 4QX1A 2WZR1 3AB0A 5DZEA 5I0DA 4XFIA 1JW6A 5DZGA 4HMZA 2XLAA 3JD72 4KWKA 4CDWC 4YM3A 1C8NA 5FP7A 4AI1A 3CZUA 3VHRA 3VD5A 4S2DA 1YXWA 1QDCA 4CEYB 3AL5A 4WVWA 2DVGA 3MLJA 4COYA 1SEFA 4AHWA 4N43A 5D8AA 5A3NA 2W39A 4CDWB 3PTYA 1ZREA 5JMCA 2ARXA 3BIEA 4LO4B 1I3HA 4ASLA 4NIDA 1HB3A 3WQ1A 2A6XA 2RJKA 1ZRRA 2YMZA 4Q0QA 2VZTA 4DXZA 2ZS6B 4FP3A 2QQLA 4UBHA 3KM5A 1TMF2 3MF6A 3NJYA 2WO1A 2BFUL 3PUHA 5FBJA 3EYPA 2VC9A 1QJU3 3V0AB 1W0PA 3AZXA 5EV7A 3ZXJA 2FDGA 2V09A 4FAHA 2A7AA 2Y26A 3ZIWA 4KG0A 2ZCWA 4OMDA 2V4AA 3VBRC 1JZ2A 1MVEA 1UL9A 2W1QA 4EZ4A 4GD4A 3A0NA 5EJ1B 4DB5A 4AK3A 3NKGA 2ETEA 3AYEA 1NAEA 5FZ0A 1US3A 2WLQA 1KS4A 1F5FA 3ALQA 4E4SA 4CSWA 1H1AA 1VBC2 4M01A 3VBRB 2WABA 3I59B 1XBFA 4WZCA 3H7YA 4RHV2 2MHFA 1MR5A 2VO5A 5FIXA 2BNMA 3HQXA 2J1UA 3I3BA 1ULFA 3TNQA 3I3EA 2XONA 2ZKLA 1R1A1 1DQ5A 5EYYA 2R7EB 5LRRA 3KD4A 2YU1A 1SBDA 4FPJA 4IEPA 4LE3A 2ZACA 3K4DA 2ES3A 3PIGA 4XBNA 1A8DA 3OJBA 5G04L 4UBGA 1QH7A 1YIPA 3QBQA 3ROUA 2HWB3 3PIJA 3ILNA 5FWEA 1NE4A 3OYWA 4ITCA 2AEYA 2P6CA 2WC2A 4Z8BA 2DF7A 4XIKA 3AJYA 1T2XA 2OS2A 2RVAA 3M3CA 4B4QA 1SDWA 4LBQD 4Y22A 1F8VA 4PQ9A 4I0AA 2EIDA 4GXLA 3USUB 2DWRA 1C57A 1EPZA 1W8HA 2J1SA 3KT7A 4MSVA 2QQVA 2UU8A 2W94A 1MS3A 1OC1A 1W8NA 1UCXA 3POSA 3BU0A 4YGEA 3AXEA 5IYYA 2BVBA 3DN7A 4UF0A 2R0HA 3P5BA 5CEHA 3KV9A 4LBOA 3BTAA 5L9RA 3VDBA 1H1IA 1REEA 1WA4A 2ZEZA 2PN5A 4G4FA 5CVRA 5L7OA 3CJIA 1QJU2 1C28A 4Y5TA 4I09A 5AFBA 1LESA 1D2SA 1XNTA 2BW8A 4XJWA 2DCTA 2RS33 1ZZ6A 4HG6B 2A6VA 3WNMA 5LA2A 4KWLA 5FKCA 2EIGA 1S4CA 1U12A 4OHZA 1J3QA 1S1AA 2SBAA 2E7TA 3WW4A 2WLPA 4RQPA 3WG3A 1AJKA 4LPLA 5JMOA 4NWVA 3S5AA 4BU2A 2Q30A 3N9OA 4QX8A 1XOYA 2ZABA 3JU9A 3LEKA 5F1RA 1H8TC 3VZJA 4G9SB 1GANA 1RUI1 1S2BA 1UZZA 1V6MA 2C5DA 4XUPA 1IPSA 3SNMA 5B4NA 1H8TB 4YVSC 1WW5A 1MQTC 2HWB2 4IGOA 2IUWA 4CPBA 1STMA 1J1TA 3AVSA 2BERA 4GMP1 1DLCA 1EAH3 1Z0HA 1IPJA 1Q3EA 2TUNA 2XJRA 4FTEA 1EV11 2DBNA 3NKTA 3GJBA 4FFGA 4JRLA 1YFXA 4WM8C 4YVSB 4OI1A 1MQTB 2Z4FA 4JVAA 4BQ4A 4E2QA 1GFF2 2PHRA 4AVSA 2ZGMA 5DAXA 3WG4A 3E5XA 1ZA7A 4WM8B 3KF3A 5IATA 3ASIA 1WZXA 2JKXA 1AYM1 2VBBA 3AP7A 4Y1YA 2C4XA 2Y8KA 1FV3A 1W9WA 2UWBA 3KHBA 1S0CA 4BWOA 1O3SA 3U11A 4QGMA 5JSRA 2QTWB 4OYUA 5JOXA 3J8F3 1CR7A 3WVJA 4QQ2A 5CFDC 4GA9A 3QLQA 1D2QA 4XTPA 1YFUA 1EUUA 3OY8A 3U37A 4N53A 5T5PA 3D0SA 3B93A 3LDBA 4Q0VA 3ZXAC 2QKDA 2XQXA 1O3QA 3VD7A 3FFZA 3H9AA 2RS32 5CFDB 4E4ZA 2ZZQA 4XF9A 1WKYA 3N7MA 5F5IA 4YARA 2ZZJA 2PELA 2VZRA 3MLKA 5FUIA 1W0NA 3N3HA 3T30A 4NE9A 4EWEA 5JXIA 1GUIA 2WFPA 2YZ4A 4D7YA 2JG9A 1NQJA 1H0BA 1KD7A 1ZA4A 2MEV1 3FBYA 5H9QA 1RMU1 2FZ1A 2P2KA 1XPWA 4NOTA 2DUQA 2XWJB 2RS53 5F3GA 3ZN6B 2BOJA 1K45A 2WL1A 3FN9A 4IE4A 4O65A 3T2QA 1PVC3 3JZVA 5FZ3A 4EV0A 1BBT1 1UY3A 4RFT0 1ND3B 4COWA 1QNYA 4XFAA 4AVTA 5GLTA 1Q8VA 2JKBA 2EIEA 1DQ2A 3VV1A 5FDBA 4JQRA 2FDKA 1EAH2 4WM7A 4Q4W3 1ZM1A 2XOMA 4XHBA 5T5OA 4ZXEA 4Q4V3 1WW4A 5FK7A 1YJLA 2DVFA 3A21A 3ZN6A 3PVNA 3BU7A 4JHTA 3FHAA 4C8DA 3MFCA 4P9JA 1WMXA 4HETA 4CCMA 1DP0A 4QGNA 3ZIXA 1D0HA 1JOBA 3J26N 4GALA 4Y1XA 3MV01 5E8AA 1VE0A 4M4RA 4QPGA 2WBKA 1HKDA 1OXCA 1NCRC 2KXLA 2H0VA 2YPDA 2VMIA 2WNEA 2PLV3 4RN5A 4YW1A 1NKGA 1NUKA 2VBPA 3J8F2 1U5YA 1ENSA 4GZ9A 1ONAA 5JOYA 3PJYA 3KT4A 3RYPA 3USSA 5F5AA 3MW2A 4HN1A 3VKOA 2PTMA 5C3PA 2ID4A 1MS0A 5I0UA 1NCRB 3B02A 3VBSA 4JHZA 1V6OA 2VZQA 3T4VA 3NV2A 3TRSB 5C9AA 1NG0A 1VAMA 3ON7A 1KEXA 1S0BA 3ME2A 1JZ6A 1RUE1 1TVGA 2VOVA 5FZ6A 4PLNA 4CEWC 1W8OA 2A71A 3MIEA 4AVBA 1X8MA 1YO8A 3CMGA 5ABJC 1H4HA 3QACA 3WQ7A 4Q4X3 1HN0A 5E6HA 2EAAA 1ZBA2 1VBA1 1N3OA 2RS52 1GWKA 4CEWB 3ZSMA 2PHXA 4Y4RA 2NP0A 2D6MA 5ABJB 1WCDJ 1E5HA 1W06A 2ZTNA 2CGOA 1H8VA 3N9PA 4XF0A 5A32B 3OBRA 2NM1A 1ASJ3 2AACA 3EBRA 3IIAA 4LULA 1HXS3 4ZU7A 2IXCA 1V9U1 2J42A 5KHHA 2Q8EA 2YV8A 4JKMA 1QIQA 4Q4V2 1ZZ9A 2TNFA 3N35A 3Q8CA 4JC1A 1IPKA 1DBNA 2XLGA 5A7QA 2WNVC 5C3RA 1B35A 2HEVF 4UOJA 2X5IC 1PGL1 2RE9A 1O4TA 1W3VA 1LHWA 3HEIA 2D6NA 4FQ4A 2CY6A 3GM8A 1CX1A 3THPA 1X9TA 3CJXA 1GWMA 1GOHA 2PLV2 2Y64A 3DYOA 3GBGA 1OT5A 2EALA 2WNVB 1ZZCA 4WVZA 2QQPA 2E6VA 3LA2A 5F3IA 1OD3A 3MZHA 2R071 1H2LA 1V6JA 2X5IB 3RRDA 2AENA 2N7GA 3IIIA 4DUWA 2ADDA 5FKBA 4QQPA 5J96B 1F5JA 5C3QA 1BQPA 2BGCA 4N53B 3NAPA 2BBVA 5E88A 4FPFA 1HRI3 1OI6A 4UYBA 2D5FA 4F8AA 1PM4A 4PIXA 4OZOA 2FCUA 4NO4A 3HQRA 5C7GA 2SLIA 5DDJ1 1DIWA 2JDAA 2XBO3 1TME3 3GHNA 4ZU4A 1UYYA 3AKRA 1S2EA 1KS5A 2VAUA 3C7FA 3SEEA 3VBFA 5FY7A 5BYNA 3D6EA 2Z79A 3R6SA 1Y4WA 4Q4X2 1FT9A 2P3JA 1MS5A 2BNNA 2LW8A 5DPNA 1SPPA 3MHZA 1QXPA 2B9VA 2RM23 2VPVA 5AC93 3ZFEA 2OYZA 4MYEA 3LE0A 4DMIA 3ZSKA 2QZ3A 4AXOA 5FPUA 2RJLA 5BNNC 1ASJ2 1C8M2 3H1MA 3KV6A 3RZMA 2OXBA 3IM0A 2KR2A 4P02B 5CG8A 2CYFA 2PMWB 3ZYIB 1YIFA 3ZXDA 1UPIA 3BOWA 2ADEA 1HXS2 2HWD3 3KGZA 5FXXA 1U5ZA 3SEPA 3TOJA 4RGKA 3S5QA 2JDUA 4N7IA 3VBUA 4DXSA 4EROA 5BNNB 5A3PA 1RUG3 5BNOC 4U2AA 1DU3D 2MNGA 3O1RA 4XF1A 4FSJA 5EIYB 4F7ZA 1FPN2 4E2GA 1VRH3 3T2OA 2Y0OA 2XMLA 4E4DX 5BNOB 4H14A 4MO3M 3O1TA 3WNLA 3S0MA 2ZA9A 4DNYA 4Q1PA 3FHIB 4BQYA 4MXWA 4Z2WA 5K0UC 2QQUA 3PVOA 1ENRA 4QXCA 4XDPA 1O4ZA 3AFGA 4FVVA 4ZU5A 4DXRA 4O61A 3UGFA 1GLHA 2YXSA 4X8PA 3JBG1 3ZVXA 1G8WA 1OFSA 2WINB 4K6BA 1QEXA 2NYYA 1O7FA 4BYYA 2D98A 3POGA 1DQ6A 2A6YA 3BTZA 1OH4A 3OGSA 4K40A 4YVWA 1S0JA 2QNKA 5K0UB 1WCKA 3ORJA 1HRI2 5D1IA 1AX2A 4YM2A 3AJZA 1HB4A 4Z2AA 3K48A 4GWMA 4JGZC 2MPFA 3RWKX 5FYSA 3WW2A 2XBO2 1TME2 2VH9A 2ZX0A 3MFAA 4CDXC 1RXFA 2ZGTA 2OW4A 4KH9A 4OUEA 5FZ1A 1JUHA 3A22A 4C91A 1FOD2 3RFRA 3MGUA 2A70A 4JGZB 3W58A 3N9NA 2PHWA 2QCSB 2R041 2A5ZA 3QH7A 5CAZA 4NIGA 4V2VA 3SITA 3WDVA 4XDOA 4FXKB 1PNGA 1S55A 3HT1A 4LBMA 3B69A 4CDXB 1I5PA 2PAEA 1QJX3 2WNUC 2XJPA 3QD6A 3UGGA 1AF9A 1LHUA 1JBCA 1DYPA 1GBGA 1R093 1BCXA 1W8FA 2AYHA 4RL7A 1XXNA 4B7EA 3TEZA 4CCKA 2E7AA 4NPRA 3S6PA 4BXSV 1FNZA 2WNUB 1AHSA 1GV9A 2BV4A 2HWC3 3THCA 2W3JA 2WSUA 2EXKA 3IPVA 2HWD2 5J3UA 3RG0A 1KGYA 4NAOA 2YB7A 4A6OA 1CAXB 1REDA 4XJ8A 3WHUA 4NJ4A 4FTBA 2R062 4AQ2A 1RUG2 4I3PA 5FZEA 1VAVA 4QXHA 1GWLA 3DCQA 1UY1A 2XJSA 2ZMKA 3N9MA 4JDMA 5ACA1 1FYUA 5AVPA 3OUHA 3HOBA 4GJYA 1JN2P 5A33A 4XZUG 1VRH2 1WBFA 3J7LA 5FP4A 2VR4A 1O91A 3LOBA 3LDKA 1QJFA 4IE5A 5FZ9A 1QDOA 3ZYGA 4AQSA 2VZOA 3ACHA 2BWCA 3BGAA 4LIVA 5GLZA 5KBFA 4FPLA 4HKOA 1UX7A 1XE7A 4IEOA 1NY71 3WCSA 2B7YA 3NNJA 3FC0A 1DZTA 4BIFA 1DGWX 2WAOA 2ARCA 4XEZA 3WP5A 4EWDA 1AR71 2QZ2A 3V0BA 3UV9A 3DPRA 2CNAA 4NRMA 5FYZA 1AR63 1LECA 4I30A 4YW7A 4KNCA 1UOGA 4XAEA 5J7MA 4TLGA 4XUQA 4LKFA 3LF7A 1OH3A 4OLLA 3ACLA 4A7YA 4NR1A 3N9LA 3WP6A 2JDYA 3FZ3A 3IBMA 2C9AA 1DQ0A 2ZX4A 3RJ2X 5A3TA 4QHOA 3OGGA 3H42B 4AE2A 1W6NA 3PMEA 4LKDA 1OA2A 1J3RA 1I6XA 2W52A 1QJX2 1G7YA 4KGQA 2Q1MA 2YDEA 5A7OA 3RI8A 1R092 3ZSJA 4B1MA 5K9YA 1IS4A 3LFMA 1AR81 4TLFA 1HRV3 4UFKA 2VOXA 1LRHA 5IVBA 4FPYA 4AL9A 2E32A 1UOFA 3KMHA 1BHGA 1COV1 1HV1A 5HCBA 4CEYA 2QBXA 5A1FA 4R8HA 4B4RA 2J7MA 3ZKUA 4OFGA 2GN3A 4QKNA 1YYNA 1RVF3 4QU2A 4CDWA 3WF3A 5JR2A 1JODA 1Y7BA 2W91A 1OLMA 4CDUC 2Z5WA 2Y34A 2IFRA 1DGRN 1POV0 1PZ8A 1TNRA 3KV5A 4IE0A 4NPLA 4XF3A 3ZYRA 3ETQA 4A6SA 2UURA 3KWVA 2LTNA 3HT2A 2XPJA 3HAGA 1LOFC 4M0HA 4XUOA 2C0ZA 2OA2A 4CDUB 1UNBA 5LY2A 3V0AA 1YEWA 1JU3A 3F2ZA 1GP4A 2WYFA 4NHYA 3KCXA 3MIFA 5FZAA 4U36A 3K51A 4QGLA 5CA6A 5FZKA 4ZY9A 1VBD1 2R0FA 4BZ4A 4P9XA 5C33A 4AFAA 5F32A 4BA6A 3NQHA 5CFCC 3D4KA 3R4UA 4UWDA 4YRDA 5LCWL 4AAXA 4XE9A 3VBRA 5I8YA 3I59A 1W39A 2E7QA 1AR91 1JHJA 1OPOA 5FCCA 3JXSA 5JSOA 2P3YA 5KXBA 3ABZA 1EUTA 4W65A 3H8OA 1YQ6A 1X36A 2WWSA 3BODA 5GLVA 1ZNPA 2DVBA 5CFCB 1FMD1 1W8WA 4BQXA 1ZBE3 1WMDA 3LZZA 3WG1A 5DUWA 1CPMA 1YHFA 2B4KA 4HONA 3WEZA 2XHNA 3AZWA 3FUQA 1GQHA 1S0GA 2W9XA 4LOTA 3O1SA 2ZGUA 5HV0A 3POFA 5FZGA 4Z1VA 2BJSA 3SCFA 4FP2A 1HRV2 4OHWA 4HVQA 3JD73 2WN2A 3TN91 2WFF2 2J1TA 5FYIA 1L3JA 1XNKA 2HBUA 2XUEA 3C7OA 2VD7A 4XQWA 3OTFA 1XNAA 2EXJA 2VQTA 3OCPA 4W6YA 1JMUB 5GM0A 3WHTA 2VW0A 1ODMA 4BB3A 3AP4A 3M70A 5A7NA 3USUA 1IKQA 3A7QA 2E33A 4A44A 1JYCA 2BZDA 4Q4Y1 1RVF2 4JTOA 3L2YA 1CPNA 1EPWA 2R6QA 4DEVA 5FZDA 4Z82A 2EVXA 4Q1RA 3N7LA 1WLTA 4PF1A 1BEV1 1CAVB 2I2SA 1G9BA 2GMEA 3MW4A 2YPJA 4ISQA 4URTA 2Y6FA 1CZTA 5IFTA 1D4M2 4UFHA 1NZIA 1HDKA 1NCQC 1QNWA 1WW6A 4RS5C 5FYTA 4YG0A 1UYZA 1OKOA 2DBIA 2BRTA 2IVIB 3HNBM 4IQPA 3T2PA 3WW3A 3JB4C 4ZZ5A 1BK0A 3K4ZA 5A1LA 3BI3A 2FDIA 1MS8A 1W9SA 2BU9A 2X29A 1NCQB 1OHFA 4IV3A 4QXKA 1QY4A 3C3VA 4RS5B 5BNPC 1QQP1 5JPNB 2B45X 5BY5A 1N1SA 3H0OA 3MI8A 4QKDA 4IXLA 2UYAA 1KJRA 3FL7A 4X8NA 5HCAA 4C1XA 2Q8CA 1PZ9A 2HJIA 4XF4A 3LEMA 2R16A 3PUAA 4X6QB 4XFBA 3RYKA 2JIJA 2RMU3 3SC7X 5BNPB 2WZPP 4A3ZA 1GZTA 1X33A 2LS6A 2JDPA 3WDXA 4PT6A 2IXKA 4HBNA 3VDAA 2WR9A 1H8TA 4Q2FA 3EXUA 4LBKA 4GB33 2DURA 5FZOB 4IGQA 4UW6A 4W6WA 4AEMA 4YFZA 1OF4A 1OQDA 1KDKA 2H6BA 2VECA 5LBBA 1W2OA 4CCEA 3MPBA 2QVSB 1Q8OA 3OOXA 1LB2A 3VLBB 1GU3A 1J3PA 5DUXA 1MQTA 3TWIA 1BJQA 3VBOC 2BUKA 4SLIA 5HXVA 5HPOA 1IZ3A 4YZ4A 3O1OA 5JOZA 1D7PM 4B1LA 3HD8B 3O1PA 5DQ0A 4QU1A 2J1AA 3PUIA 4XETA 4Y26A 3T0AA 4IW3A 3VBOB 5CNAA 4CXXA 1J83A 1WW7A 2DU0A 3WNNA 2J1EA 1WLWA 4GIQA 1JZ4A 2VMEA 1GQPA 1NYWA 4PJYA 4COZA 5K7PA 4HVOA 1CX4A 4QM8A 4JRAA 4RD7A 2XB6C 3WQ0A 3H7JA 5CISA 4QKFA 1PVXA 3I4IA 1H9WA 1PIV1 4EN0A 2GAUA 5CFDA 4DXTA 5ANQA 3AXDA 1WD4A 5FYBA 2PQQA 2VNOA 4FI9A 2D3SA 3N9QA 4BM8A 4B7KA 2ZGRA 1A6CA 2QQWA 4M3CE 1MEC3 1U5IA 2VOKA 1UZYA 4AQTA 1CESA 1LULA 4D3WA 3K46A 5A7PA 4P9WA 5HCHA 1NT0A 1RUF3 1O5UA 2X10A 1OLQA 4GWJA 5LB6A 5FMOL 3Q9OA 4KI5M 3KV4A 1A78A 1REFA 4OVEA 1V6IA 5IWFA 1CIWA 2RMU2 2Y6HA 2ZGPA 3PHMA 4KWJA 2JIGA 2K46A 4XZPA 4BQWA 5JCTA 4YZ5A 4TSVA 1W03A 1WCUA 3WOGA 1UN1A 1ND2C 1DCSA 1QU0A 2QUOA 4OQ9A 2I07B 3FFQA 5JSPA 1GICA 4FFFA 4AFBA 1ND3A 3O5SA 4GB32 4Y1ZA 2KA3A 5IAXA 2G9ZA 4FOWA 1CIYA 1ND2B 4BLIA 2RR11 3VZLA 3NMBA 2WDBA 4XJAA 2G1MA 5FJKA 5FJHA 3T3YA 1HV0A 4A42A 2HWE1 1XQNA 1Y9QA 1OQEA 2ZX3A 3IB3A 4R9BA 3OPZA 1GQGA 5CZKA 1UU6A 2V72A 5EXOA 1OURA 1VBC1 3CF6E 3D3AA 3P3NA 5FMDA 2GP3A 1AXKA 3AL6A 1N1YA 4RHV1 4LBQB 1PHMA 1RUJ3 2WO3A 3M1HA 2JDHA 4J25A 4AVCA 4Y1VA 2GALA 2E26A 4Z07A 1P8JA 4IDZA 4L92A 4EJRA 3DXTA 5FY8A 1HJGA 3POBA 3VDCA 5HXMA 3AP5A 2VW2A 2VE1A 5FY4A 3ZSEA 1LU1A 2YC0A 2JX9A 1NCRA 2D3PA 3FMGA 4KU7A 4Q0SA 3ACIA 4WVMB 1UU4A 2CAUA 3DECA 3M2MA 1JTZX 1ZVFA 3LA3A 5FYMA 4LHKA 1GOGA 3EQEA 3KHCA 4E8DA 5A6ZA 4LKSA 5FPAA 1X50A 1RUI2 2DTYA 5EZWA 3BB6A 1GNHA 1EY2A 1MEC2 3BALA 4NIHA 4AVAA 1Q5OA 2ZX2A 1BBT3 2VCBA 1VPHA 5H9PA 1BMV1 3OBAA 1RUF2 4P9YA 3VKNA 4NMIA 1QJY1 4KBZA 3TYJA 2X09A 3WP3A 1VP6A 4ARXA 5CADA 2LALA 4CEWA 1SMVA 5IVJA 3CQOA 1WMEA 5IVVA 2VQ0A 5ABJA 3ECQA 5F2WA 3ZR5A 5F5CA 4XUNA 5FZFA 1Q8SA 1RUC1 2XH6A 3AM2A 4QHBA 2WT0A 4LKEA 2NMNA 3MW3A 4YW4A 1QJU1 3AYAA 1UX6A 2CDPA 3DKQA 5FRAA 5A32A 5KHKA 5BXXA 3EJKA 4AYUA 3KCCA 1Z7S3 3L2HA 3ZXEA 5LK7B 1AYM2 4GH4C 5FFOC 4GULA 4P9IA 5LASA 3WSOA 2Q0AA 4XOGA 1TZOA 4JGYC 3OD4A 1HIXA 2X53S 4N90A 3KF5A 1POV3 3GALA 5F8PA 3TEYA 2OPKA 4GH4B 5LBCA 1SLCA 4UI9L 4LA3A 1ENXA 5IVYA 4N7UA 4EZHA 2ARBA 2JECA 1RUJ2 4ES8A 5B4XA 1HQNA 2CTVA 4JGYB 3UKVA 2A6ZA 5D8AC 3LKJA 4XPVA 4MGTA 1VLNA 2XLFA 1I5ZA 3KQRA 2VOWA 3SH4A 2WNVA 4QWNA 4R4XA 1GR3A 4K7JA 4AI8A 3SQOA 4LT5A 1LOEA 3KT1A 3C7GA 3WF1A 2X5IA 3GCXA 1ULPA 2AREA 1LJ7A 3AP6A 4I3GA 4BMEA 4MGZE 4E2SA 5FP8A 4P14A 4YZ2A 1AL0G 2CWSA 2FQPA 3ENRA 3OEAA 1DQ4A 2WQ4A 4HK8A 1IOAA 2OPWA 1VBA3 4L8QA 4N8MA 4Q0UA 3TBDA 1PO11 2JEMA 2XG3A 4CDQC 5KXDA 3GZTB 2K9ZA 3ACGA 2BFUS 3RZHA 3DUIA 1W6QA 1BZWA 1W8ZA 4Q26A 1HX6A 4FPHA 4LLOA 3ETPA 1TQ5A 4CDQB 1F2NA 1BBT2 4HOOA 1ZBA3 5LBFA 4JDNA 2ZGSA 4ZZ8A 2WSVA 2WNOA 3HN1A 4IEWA 5IK8A 1VMJA 2D97A 4BCUA 2GNMA 4FXGB 1LGNA 4PBOA 4XJUA 5DAPA 5FOBB 3NW4A 4BOWA 5FMCA 5IVEA 4XUTA 3VZNA 4E4HA 3B01A 1W6MB 3V56A 5T5LA 3J4UH 1I1EA 1DGLA 1UYXA 5FK8A 3AKTA 1YI9A 4INDA 4F83A 4FAGA 1IS6A 1Z7S2 2CL2A 5FMOS 3O12A 2RS31 4QX5A 4Y3OA 3AYCA 5FY1A 4LHNA 4I2OA 4C1WA 3EO6A 2BTVC 3Q8AA 4YW3A 4C90A 1VR3A 2AGSA 2VCAA 3KVAA 5BNNA 1CONA 1W9YA 5A7WB 3RVHA 1GZWB 3T2TA 4QPYA 1ULDA 5FO8B 5AVAA 3VBHC 1RUD1 3NSTA 1APNA 4XILA 4RFRB 3A0KA 3A4UA 3D8CA 4AVVA 5BNOA 2K2SA 5FP9A 3WV6A 1Q8PA 4XJ9A 4K3UA 3N7JA 1YFYA 3ZFGC 5BNQA 4Y5SA 3O1VA 3VBHB 1UYPA 2EF6A 4OCTA 2EXHA 5GLWA 2IFWA 2Y6JA 5DDJ3 5KXEA 4EE2A 1O8PA 3OBTA 1MZ5A 4PF5A 2ZXQA 4OHVA 4QX2A 2JXAA 4HLTA
chains in the Genus database with same CATH topology
1WLDA 3ZFGB 4XTMA 5K0UA 3AMPA 1OOPA 1VBA2 4HPKB 1V70A 4L97A 3WG2A 1PM7A 1AYN1 1VJ2A 1BK1A 3ZO0B 3VUOA 4X6RB 3AK0A 3JB8A 3JCIA 4RR3C 1A3KA 4JGZA 4DZGA 2JG8A 4K1YA 1DHKB 2JENA 2OIIA 3I8TA 4J6GA 1DZQA 3J8F1 5KWRA 2WA3A 1V9U2 4LNVA 2GMMA 4IERA 4RR3B 5FOJB 1OLRA 3AKSA 3MYXA 3WUCA 1C8M3 1YLLA 5JI9A 1JH5A 2XL9A 4AEKA 1K5MC 3IMNA 4XXPA 2WNUA 3AKPA 2ET1A 2NZ9A 5L73A 1PGL2 4S2FA 4AG4A 1CAXA 3CEWA 1G9FA 1NQDA 1K5MB 2DUOA 2W68A 4HKLA 2D3RA 4RGAA 1TNFA 2R072 1FPN3 1W6OB 3PMSA 1ZRCA 1XYNA 3HIFA 3JBG3 3M3OA 4B8EA 5JIAA 2Z69A 5I8SA 3D0JA 2RS51 2XHKA 3M3EA 4BQ1A 3S7IA 2QJVA 3RNSA 5KHIA 3MIDA 1PVC1 5BPXA 3MIBA 1NE6A 1X8EA 2O8OA 1LU2A 2XUMA 4M3CB 5DDJ2 2OZ6A 4S2GA 3VKFC 3LWCA 2CGPA 3ZN4A 5AFEA 4Q4W1 2GNBA 2O0OA 4H55A 2GC3A 1VBB1 2JE7A 4F3JA 3WLUA 2CAVA 4GKYA 1FOD3 4KG8A 2O8QA 3SCGA 2ZGOA 5GZEA 2D6PA 4XXAA 1QKQA 2GDFA 1OFNA 2JG9C 1YFWA 2FZ2A 1UKRA 3E97A 2RS11 3AZYA 3RYRA 3H50A 4XMIA 3B9IA 1SCSA 2JG9B 4YG3A 5IUQA 1PO21 1N1TA 5JOWA 1RHI1 4YLZA 4A7ZA 1VB4A 5B2GB 2NPIA 4HT1T 4YM1A 4KQ7A 3O7OA 3VGIA 2R063 2FMYA 1URXA 1Q43A 3O0XA 3ST7A 4AFCA 4DY5A 1Y3TA 5GLUA 3KZ4C 2R32A 2DFCA 3JBG2 3OF1A 2E53A 1N47A 3JQWA 1XNCA 4IEZA 4XQ4A 3HBZA 5KC5A 5K8SA 4COVA 4CDUA 4Z92B 5A3LA 5JVVA 4QM9A 4XHXA 3X29B 1AXYA 1UIJA 2UWCA 5TSWA 3O14A 2VVDA 3WUDA 4HSJA 3GBFA 1LOFA 2VXRA 2VY0A 3KS7A 2ZGQA 3VHOA 1HXS1 4LO5B 1UW8A 2R042 5FAXA 1AL23 2VW1A 3O0WA 2WIIB 2Z42A 1RUNA 5F5QA 5GALA 3SCHA 1LODA 2GMPA 4IEUA 2WKKA 3NWKA 4QT6A 5GZCA 2DFBA 3FE5A 4QQOA 3NJZA 3RPQA 1F9KA 2BPA2 5CFCA 1RB8G 1PZ7A 3JUUA 5L19A 4IEVA 3TB0A 1BYHA 2Q8OA 4AEDC 5LEJA 1LEMA 1KDMA 3UJOA 2FMDA 4GMP0 3UKNA 4D69A 5LK5A 4E9KA 2YYOA 4AEDB 4QPIC 2EXIA 2GN7A 5DUVA 2WS93 1OMIA 1HRI1 1QOTA 4XJUA 1ZX5A 3AP9A 5SV5A 2GC2A 4K21A 3WW1A 4K8FA 3H8UA 2XBO1 1TME1 4QPIB 2XJTA 4FPEA 2RHPA 1CGPA 3W59A 4M0NA 1RJ7A 2E51A 1HLCA 4R9CA 4JCKA 1CAUB 1AR72 2RM21 1CAVA 1XU1A 1RC6A 2ZHMA 1XNDA 3ES4A 3M3QA 2Z2SB 1G9CA 5AC91 2Y0IA 3LGRA 2VUJA 3NV3A 3U07A 1RUH1 1NZCA 2XWBB 4AQ6A 1LOGA 2AH2A 4Y24A 1X82A 5C8CC 1DLLA 2HWD1 5T52A 1KFXL 1NCQA 2G9FA 5EWSA 3B7MA 1AL22 1DZRA 1LCLA 2XJUA 4RS5A 3QCWA 1C3HA 2HKXA 4YM0A 2A3XA 2VMHA 4IEQA 5C8CB 1CJPA 3KLSA 3MIGA 3CU7A 2YROA 3QH6A 3IKWA 3TN93 3ZXKA 4YW2A 5E1RA 1PK6C 5BNPA 1N1VA 4BHPA 2NN8A 5CB7A 2E63A 1IHMA 2CWMA 4OHXA 4M00A 2R30A 5FQ0A 1PK6B 1T6GC 2WFF3 4Q4Y3 3N36A 2HWF1 2VVFA 4HFSA 5J37A 1UKGA 1C5HA 1OA4A 5CG9A 3G7DA 2WS92 4MGKE 1H30A 2ZAHA 4EN6B 4B4PA 1GZCA 1SBEA 4AHXA 2BYVE 3MICA 1WLCA 4AF9A 1O3RA 2Q1ZB 4HKWA 1QF3A 5KC6A 3VBOA 2VQAA 1QMJA 3ELNA 3UKTA 3ZMNA 2AR6A 1WBLA 1VBD2 4COUA 3GYDA 5H9SA 1D4M3 4XMAA 2Q5TA 4MGIE 4LUKA 1R091 3VKLA 5A3MA 3VZMA 1AR92 5C4WC 3RMXA 1LHVA 3LA7A 1DFQA 2HWC1 3RS6A 1BVVA 4UW4A 1C4RA 1TEIA 4BMBA 4LLFA 5C4WB 1YI7A 2DVDA 3RJRA 4ES9A 2WA4A 1WGPA 2DV9A 2XKPA 3DKWA 2WZR3 2Y38A 3KSCA 4N9HA 1QXRA 4AWDA 4NN0A 1BXHA 3TN92 2P17A 3E5QA 4META 5E16A 4UXAA 3DF0A 4LHLA 4BLJA 4OUSA 1SLBA 2OUHA 5BUVA 1IGOA 4LA2A 2DTWA 3NV4A 4Q4Y2 1J59A 1XRUA 1SLTA 4FPCA 3AMHA 2W08A 1ND2A 1Z78A 3M4FA 1G86A 1AR61 4EWAA 1QJZA 3MF9A 2XVGA 3AZZA 4LE4A 1SFYA 4LBQA 4XDQA 1CQ9A 1XYPA 2D6LX 1XU2A 4IESA 1R081 2LUWA 1PIV3 2DCYA 1GNZA 2IWGB 3V65A 1SFNA 2A3YA 1VBE1 3RWNA 1V6LA 2PHUA 3I54A 2FHRA 3I7DA 3RI9A 1LOBA 3ZSLA 2D43A 3E6CC 3H1WA 1HRV1 4FQZA 1Q56A 5A33B 4NHMA 5J09A 1Q8QA 1R1A3 2HEWF 3PVBB 1KITA 2Q4SA 4PIYA 1ZRDA 4Q8KA 4ISRA 3SMHA 2W0XA 3VKMA 1SQ4A 1N3QA 1RVF1 1PGW2 1C5IA 4WVVA 2WZR2 4CP2A 2AUYA 3VDDC 1LHOA 1YCIA 2ZMNA 3DL3A 3H3UA 1CAWB 1DYKA 4MZUA 3FLTA 3ZMOA 2HWE3 1W6PB 1J1LA 4IEYA 1NLSA 3VDDB 1LGCA 4BH9A 4PIZA 2XJVA 1LGBA 2VU9A 1OD5A 3ATGA 5IT6A 4YVSA 2PFWA 1RTVA 4Q0PA 4UW3A 1SLLA 4PDWC 4XFFA 1NA1C 4IV1C 5GKAC 1RITA 2DUPA 1LR5A 3QOPA 3IN9A 1UPSA 4WM8A 1X7NA 1A8MA 4GH4A 3ZFFC 1M4WA 3HMYA 4YZ3A 4PDWB 1CVNA 2R1BA 3ZPYA 3CO2A 1IQAA 1NA1B 2QE3A 4IV1B 1AX0A 4JGYA 1PIV2 1ZBE1 3WT3A 3ZFFB 4A3XA 1VALA 4CP1A 5JZGC 4XYXA 5LRSA 1O5LA 4XBLA 2UY8A 1SLIA 4Y20B 4I01A 2BNOA 5JIUA 3JD71 1H2NA 5JZGB 1QJY3 2UWAA 5FO9B 1PGSA 1LKNA 1R1A2 1RUI3 1RINA 2R49A 4BE3A 3POWA 3AMQA 4J1WA 1RUC3 5I0TA 4CDQA 4AI0A 5FBZA 1HW5A 1OPMA 1S2KA 2ERFA 2JICA 3AFKA 1AX1A 4XFHA 4ONUA 3IWZA 4GMP3 4D7SA 4MV2A 3LB9A 4Q29A 1M06G 1EV13 2RR12 1TMF1 1SBFA 3V64A 2HWE2 1QWRA 4R52A 1W6MA 3L9JT 3TAYA 4RSUA 5DUUA 5DG1A 3I2DA 3RQ0A 2ZGNA 1AYM3 2HEYF 1R1ZA 3M3IA 1HQLA 1DDLA 1ZZ8A 2D40A 5F6KA 4WV8A 4CP0A 4KBBA 3LSDA 2B9UA 3B94A 1GZWA 3MEPA 1GSLA 3B00A 4R4ZA 4OI4A 2IXHA 4AFMA 4HL0A 2WT2A 2RMU1 3N4MA 1PO13 4K1ZA 1CN1A 5EJ3A 1LEDA 3VBHA 3NO8A 4AFDA 4EN8B 5H9RA 3NL1A 1FX5A 2E9QA 2MEV3 1SACA 2PAKA 1RMU3 5GZFA 4GB31 1VAKA 1V6NA 3WDTA 3ZFGA 1BMV2 5FTTC 2GSYA 1QJY2 3UK9A 4HPKA 4L99A 5GJ6A 2X8KA 1UD1A 3JQXA 3U4XA 3OD0A 2YUEA 4GKXA 1RUC2 3B9CA 1WMFA 1FV2A 2B46X 1ALYA 4IV3C 5FPXA 1ULEA 2QDNA 3C2UA 1EV12 2NQYA 5JR7B 3HR9A 1OQ1A 2UYBA 4RR3A 4IV3B 4I0WB 4V1PA 3CLPA 3R4DB 3WX5A 2B42B 4C0BA 1XNBA 1MVQA 1MZFA 2CV6A 3ILRA 3T1MA 3VHNA 1TE1B 1W0OA 1RUD3 2PHFA 4KGGA 4YG6A 4H7LA 3D82A 4W6XA 4C0HA 4AEJA 4L9BA 1MEC1 4AI3A 4CYDA 1K5MA 5T54A 1W6OA 3J9SA 5T3NA 5EFUA 1FAYA 4NVPA 1RUF1 4HANA 2UY9A 2IC1A 4N43C 4MUVA 2GC1A 1DGRA 1H4GA 1KQRA 3VHPA 1PO12 1RUE3 3E6DA 1AYN3 4N43B 2HWB1 4M3CA 4JDOA 1U0AA 4I0BA 5D8AB 1OA3A 2MEV2 4MLOA 4O9GA 1RMU2 4O9EA 5HCFA 2ZHLA 2IXIA 4D94A 3O0VA 1DQ1A 2ZGKA 1ZZBA 3S30A 2DYCA 1CD3G 4BPZA 1MS1A 2PHTA 2A75A 3LCPA 4AHZA 5HI0A 2DU1A 3CL1A 4P9LA 2LM3A 2PAMA 2D6KA 1RUJ1 3ZX7A 1MACA 1UU5A 4MXVA 4PBPA 3RMYA 3VZKA 5I0RA 5I0SA 1V9U3 2ZKNA 1KRIA 4LO8A 1IS3A 2B39A 3SHRA 1YRZA 2FBEA 4NHKA 4HVRA 3LAGA 4HN0A 1NXD1 2GU9A 2XL7A 1QH6A 1RUD2 1S0DA 5JPMB 1ND3C 3FWEA 1AUYA 1UIKA 1Y43B 1SLAA 2R073 4I02A 5T50A 4XIOA 3BPZA 2PHDA 2BEOA 3GNEA 3OYWB 4SBVA 2VMGA 3VL9A 1JUIA 3RZZA 4M3CF 3WY6A 4TWTA 3VZOA 3WP4A 1RUOA 4B29A 1RUE2 2ZMLA 4Y22B 5E89A 3H1YA 3IDCB 1AYN2 1VBB3 3WDYA 3MLLA 2ZBJA 3SXWA 1D0GA 2GH2A 1Z7S1 2VNRA 1EAH1 5L7OC 3CJIC 1ZRFA 1LENA 1ULCA 4ATEA 2O1QA 5HBAA 5CIRA 5SV8A 1RJ8A 3GZUC 4H7MA 4IETA 4MGYE 1XE8A 2RS13 1POV1 5L7OB 3CJIB 4P5HA 4PLOA 2GZWA 4ATFA 4EN9B 4N9IA 3FBMA 5JI7A 4LO7A 4RQPC 1PO23 1MZEA 2QDRA 3CNAA 1RHI3 2VUAA 3ZXFA 4CDXA 2V5YA 4FPOB 1H9PA 4RQPB 3RSJA 1O4YA 4MVTA 3N7KA 2EAKA 3WZ1A 1C1LA 3WINE 4AEDA 5CBLA 4NWWA 1KXGA 1YNAA 4DOUA 5C8WA 3W9AA 1EYBA 4A2UA 4QPIA 4H3WA 1PVC2 2P34A 1H1MA 1BKZA 3UJQA 1J58A 1ZBA1 2A3WA 3IDEA 4LTAA 1V00A 3TNPB 2DCZA 1MS9A 2VG9A 3ZXGA 2VGDA 1XYOA 4FTSA 2TEPA 1CAUA 4AI2A 4DQAA 1B09A 1NLRA 4Q4W2 4LBJA 2G4IA 3AX4A 1JYIA 4L11A 4KL1A 4JTNA 2QFEA 3VL8A 1IKPA 1VBB2 4IEXA 2XGXA 4KU8A 3U0ZA 1YWKA 1MZ6A 1G9AA 2NMOA 2CGNA 3RDIA 3WNXA 2R043 4Q4V1 4LO6B 3U10A 1EP0A 3DV8A 3M7AA 2IXLA 3MIHA 5FO7B 4N53C 3PJQA 3OY8B 2RS12 5KXCA 2GH8A 5C8CA 4K20A 4QMAA 4HK9A 1PO22 1QOSA 4FOVA 2D5HA 2PLV1 1RHI2 4B3NA 5IK7A 2ZAAA 4PLMA 5J48A 4TZDA 2G9GA 2JDZA 5J98B 1W6QB 1PK6A 2VULA 4PCRA 3THTA 1F31A 4FPKA 4YNIA 2NLRA 5ACA3 2YHJA 2JE9A 3G6JB 3PLQA 1W2UA 5LEKA 4OZXA 5JDBA 5KHGA 4XW3A 3ZDSA 4WM7C 4Q4X1 4FPGA 4DY3A 3NV1A 3D5OA 2I74A 2P37A 2YGLA 1RUH3 3WR0A 3OGJA 4A7KA 4YGDA 5L36A 3IT8A 1AR73 4WM7B 4YGBA 1GKBA 2YY1A 1PMIA 2AZ5A 2BQPA 3SLIA 4CZSA 4YW5A 4QPGC 4OI0A 1MS4A 3EHKA 4K9SA 1GYKA 1RGSA 5F6LB 3R4SA 3WDWA 4BM8A 1ASJ1 1C8M1 3M8LA 4Q27A 1QOOA 4AHYA 3WDUA 4LEJA 1U5XA 5DG2A 2GC0A 4QPGB 4Y5Z0 3VBSC 5T5JA 2B5HA 3ZYJB 3SISA 4WZFA 5C9AC 5C4WA 3P3PA 2DCKA 1OOPC 4HZFA 1AR83 1E57A 1FPN1 3VBSB 3GZAA 2HWF3 4RA0A 5C9AB 4FO9A 1YJKA 4ZXKA 1COV3 1OOPB 1G6NA 4FOQA 2TBVA 4TYSA 3FX3A 2JG8C 4DRVA 3AMNA 5ACA2 1O3TA 1DGWA 2A6WA 1UMZA 3AYDA 2JG8B 1WCSA 1S0IA 2DCJA 2OUJA 4OUMA 4DFSA 2RM22 3INAA 2F4PA 2VVEA 1NY72 2I45A 5AC92 1FOD1 4XQDA 2ZGLA 2PA7A 4WBBA 4FT8A 4XBQA 5GZDA 1SCRA 3ZYPA 1RUH2 3ZN5A 4OHYA 2XKOA 1VBD3 2JJ6A 1G9DA 3MDPA 3SH3A 4YGCA 1B35C 1ZZ7A 2EA7A 1H2KA 4MH0E 5FPZA 3FJSA 1UF2C 1AR93 2P3IA