3GJAA

Cytc3
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
310
structure length
265
Chain Sequence
ANFTFSPEEVARFERDGYIGPVKIFEPEEMTRRWNIIRRQLLDRSLAIYPDSNGKANISNYDRHLDIDLLAEHIMRPEIVDRVGSLIGRNLLCWRSEFFPKYQGDEGTDWHQAATFAHATGKPQIIWPSDEGRPAFIGTITVWTAFTHSTEQNGCLQLMPGTMNYDESAYPMVLKPGEAVIFWSNTMHASLPHTGSKTDYRMGFAARYVPTQVQVYPGTENLTEYGDGINLEKYGAVLTSGVDEYGHNRIARTSQRGYEFVPRQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CytC3
publication title Structural analysis of an open active site conformation of nonheme iron halogenase CytC3
pubmed doi rcsb
source organism Streptomyces
molecule tags Biosynthetic protein
total genus 71
structure length 265
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05721 PhyH Phytanoyl-CoA dioxygenase (PhyH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 3gjaA00
3GJAA 3NNFA 3OUIA 4MHRA 4XCBA 2JIGA 4NAOA 5DAVA 3GZEA 3MGUA 3KT1A 3OBZA 3EMRA 4KBZA 4XABA 5LBBA 2RG4A 2A1XA 3W20A 5DAWA 2FCUA 2RDSA 2V4AA 3W21A 5A3UA 4BQXA 4MHUA 4XAAA 3GJBA 4XC9A 4BQYA 5M0TA 3DKQA 5EPAA 2RDRA 5EP9A 2HBTA 2G19A 4ZONA 5IAVA 3ITQA 4NHMA 2G1MA 4XACA 5L9RA 4XCAA 4BQWA 3OUJA 4NHXA 5HV4A 4J25A 5LB6A 2Y33A 5LBEA 5L9BA 5ERLA 5EQUA 2Y34A 5DAQA 5DAXA 5LBFA 4Y5TA 5LATA 4UWDA 2RDQA 5LASA 3OUHA 5IAXA 3BVCA 5DAPA 4NMIA 4Y5SA 2RDNA 5C5TA 5IATA 3HQUA 3HQRA 4IW3A 2JIJA 3PL0A 4NHKA 2FCTA 3NNMA 5C5UA 3KT7A 2FCVA 4Q5OA 5LA9A 2HBUA 5LBCA 4ZPIA 4JZRA 4NHYA 4NHLA 3NNJA 2OPWA 5HV0A 3KT4A 3NNLA 5L9VA
chains in the Genus database with same CATH superfamily
2ES3A 4CDWC 4K6BA 1UOJA 4AYUA 3FLPA 2XLAA 3AP9A 4PI0A 3OBRA 3WUDA 4YARA 3UL2A 1X36A 1U0AA 1CZVA 4CZSA 3OYWB 5F3IA 3JB8A 4AQTA 4KI5M 4KGGA 1JU3A 5C3PA 1QEXA 1TVGA 2VGDA 3ME2A 4IV1C 3I2KA 3CU7A 3MEPA 1QJZA 1QNYA 4GXLA 5JXGA 3IDBB 5DUVA 1WLDA 1I1EA 4XABA 2JG8B 4UW5A 4ATFA 5FY8A 1LESA 3C8XA 5EZWA 2JX9A 4C0BA 4LO4B 5JOWA 3W59A 4LT5A 3UYJA 1IQAA 1NZIA 1AR91 1BQPA 1WMXA 2R063 1O4ZA 3ES1A 2HH9A 1U5YA 2V5DA 2XMLA 3GJBA 4CXYA 1AR63 4QXCA 3N9QA 1MZ6A 2HWE2 1OH4A 3JD73 4URTA 4TLGA 3RYRA 4COVA 5BYNA 3TEWA 4MX3A 3GZAA 3FL7A 2W1SA 2WFF1 4LKEA 3WF3A 3DECA 4C0HA 2WZR1 2A75A 4LORA 1LR5A 4H55A 1R1A2 5T52A 1OQEA 1RYYA 2WKKA 4XF3A 4HK8A 4AFCA 1NKGA 3WNOA 1RUD3 5K8SA 3DYPA 4MXVA 2P3IA 4PF5A 5JR2A 5IVFA 4I30A 5B2GB 2Q1MA 4QB2A 3VD7A 2RJLA 2WWUA 2QDNA 1SEFA 1DQ6A 2P2KA 1H4HA 4QKNA 4R4ZA 1GLHA 5EHDA 1K3IA 4HSLA 4HZFA 1VBE1 3VKLA 3ZXGA 1RUE1 1W8FA 4ZKTB 1NA1C 1IS6A 1GNYA 1O4TA 1RUH1 1R092 4Q4Y3 2VULA 2FDFA 2O1QA 4OI4A 1Q8PA 3BODA 3J4UH 1OUXA 2ZGOA 4CEWC 2FHRA 3BOPA 3AZZA 1FMD2 3A22A 5A7PA 4YVWA 1VRH2 1M4WA 3WDWA 1EAH1 1VIWB 5C3OA 1PGL1 3QH7A 2YHJA 2O8QA 3EYPA 4UYBA 1WKYA 1E5IA 1H2MA 3OB8A 4INDA 4M3CB 3THCA 3TAYA 3BTAA 1QQP2 1DGLA 2ADDA 1QIQA 2TNFA 5C5UA 1LHVA 2VECA 3A0NA 1CAUA 3N35A 4W50A 2J1VA 4EWAA 3VBUA 5IVVA 1HV1A 3H8OA 3LQCA 1Q3EA 2Z69A 4NHYA 5FZLA 4DINB 2D6LX 1RL3A 4XDOA 1AR82 2VBDA 3T2QA 5A1LA 4CCOA 4UFHA 2WDBA 2Q5TA 5EWSA 2C4XA 1B35A 1A3KA 4UFKA 4IUGA 3NL1A 4XUQA 4Y5Z0 4AFBA 2VMEA 3QD6A 4GKXA 2UU8A 2XVKA 3DYMA 1AX0A 3GJAA 3MUY1 2D40A 1JTZX 4H2AA 4NE9A 4UBHA 5LWBA 2RS52 5DZGA 2YPDA 4GULA 4YWAA 3LCPA 3MDPA 2IXLA 1O91A 4JKLA 1AL22 1ZBE1 1YXWA 5F5QA 3IAPA 1W9YA 2XKPA 2VUDA 1MS3A 3MV11 3GBFA 5AVPA 1KS5A 3ETQA 5JPMB 3LIGA 4UFIA 4NAMA 5A6XA 4BE3A 1URXA 2R32A 3B9IA 4R4XA 2MPFA 5FZHA 1UY3A 4QKDA 1RVF2 3NQHA 5FZDA 2DU1A 1LCLA 2V4AA 2Y64A 2HEWF 2W1QA 1E5RA 2NPIA 3LA3A 4HETA 5FZIA 4KL1A 1AR93 1YRZA 1S0JA 2P6HA 3SLIA 4RFRB 3ZFFA 5L36A 1KRIA 1S2KA 5KXBA 2P3JA 4XILA 3GZTB 3IZOA 4IETA 4FPKA 1NT0A 1C1LA 3QBQA 3TNPB 1CGPA 4DY3A 4ES9A 3SISA 4LTAA 5FPVA 4JRLA 1W90A 2QQJA 3WV6A 2AC1A 3ZN6B 4ONUA 1Q8OA 1OQ1A 2WFF3 3WSOA 4ZXEA 4RL7A 2TBVA 2HWF2 1YUDA 3MLJA 4R9BA 4XQWA 3H3UA 1D7PM 2WZR3 1VB2A 3ZR5A 5AFEA 4N7UA 4CP0A 5F7UA 3D0JA 2YROA 5FBJA 2ZZJA 5T5OA 4LPLA 2XVGA 2BFUL 5FLHA 5G04L 3SMHA 4BLJA 2BGCA 2AEZA 4BPZA 3HMYA 4YM1A 2VNVA 1ODMA 1V00A 1XB9A 2OZJA 2AACA 3CJIA 3O1VA 1GP6A 2VBBA 4B1MA 1E5HA 2WA4A 1QJU1 4Z92B 2SLIA 4PHZA 2Y34A 2VXRA 3N9OA 3WLUA 3KCCA 1ND3B 1XNBA 4W65A 4CCDA 2QQOA 1VBE3 1RUE3 2XBO2 2SBAA 4MH0E 4AEKA 1DF0A 1KDKA 1RUH3 4A3ZA 1YLLA 4EN7B 4MGQA 2IXIA 2VPVA 1TNFA 2CV6A 1S0EA 2GH2A 3UT0A 5AFBA 5C8CB 2WT0A 2XH6A 4I01A 2QZ3A 4JVAA 2DVBA 3SC7X 5B4XA 4JDOA 1OVSA 4K8FA 1U5IA 3BB6A 1EAH3 4JCKA 4Y5SA 2EIGA 4AXOA 5FR3A 1DZTA 1Y43B 1JYXA 3HQUA 4IEWA 4Y1ZA 4NHKA 5LRSA 2KA3A 1YFYA 3EQEA 4NRPA 4QPIA 3VBHA 5ABJA 4PBOA 2Q30A 5L7OB 1BMV1 3NSTA 2XL9A 2RM22 2CDPA 2OUHA 1OLME 4NHLA 2L9LA 5FP7A 2G9GA 3MZHA 2A70A 2ZX3A 2UY9A 2VOVA 4QWNA 1UN1A 3UV9A 3G7DA 2BNOA 4DO0A 4CYDA 2YZ4A 4N43C 1CONA 2MEV2 3POIA 5LW9A 3NRUA 1GZTA 1OLQA 1EV12 4XFHA 3TBDA 3LGRA 4LBQB 1JZ3A 3BKZA 1DCSA 4AFAA 1WCDJ 4YZ5A 3V0AB 4GZ9A 1WLCA 3OUIA 3LSEA 3RMYA 2WNVB 1J3RA 3B7MA 5FYMA 2EVXA 5GLTA 1K5MB 1PHMA 4LUKA 5LY2A 1ZBE3 1WMFA 2W5FA 4HVOA 3PUIA 4YM3A 3Q8BA 5ISLA 5LCWL 2ZXQA 1CWPA 1SBFA 1SQ4A 3WNLA 2XG3A 1SLCA 3O5SA 3W5NA 3KQRA 4MGKE 1AUYA 1C8NA 2VQTA 4RQPA 2RMU1 3HNYM 5CNAA 3ZM8A 1JHJA 1MVQA 1CN1A 1UZVA 2RDSA 1CPNA 2ZMKA 2PHLA 3MV01 3IDAA 5FYSA 3PJYA 1ZYBA 5DABA 5J1XA 4CXXA 4BA6A 1JN2P 3ZYPA 1JZ7A 4V2WA 2CTVA 2EA7A 2J7MA 3E5XA 3I2JA 4CRQA 1H1IA 5JMCA 5KXDA 2YGMA 4YNIA 3WP6A 4TXWA 1XE0A 1V6KA 3M3EA 4QD2A 4ZXKA 1QXRA 1RC6A 2P37A 3ACIA 3LA2A 4ZS3A 2HLEA 2V73A 5IFPA 2G19A 1W03A 4AI1A 4Q4V1 1NCRC 3C7GA 3BUCA 1ND3C 2JD9A 3CZJA 3ZN5A 4XFCA 4XACA 5E8AA 1MPXA 1YFXA 2C1FA 2QE3A 2QQWA 5FMOS 3AP5A 4K21A 2AR6A 4COYA 1I5ZA 3WR0A 1AL21 4IE4A 3WQ7A 4CCEA 2D5FA 2HWB1 3FLTA 1UIJA 3PVOA 5C8CC 3ZKUA 1S0IA 1PX4A 1OKOA 1YQ5A 4JQTA 3AMNA 5ABJC 1EP0A 5LA2A 2XKOA 4QHZA 1CX4A 5J96B 2W47A 4FFHA 3CZUA 1UMHA 4G3YC 3ST7A 3WDYA 1AXYA 1QJU3 3ILNA 4N53A 5CKMA 4BISA 5IYYA 3TNQA 3CJXA 3ROUA 2PHRA 1NZCA 2UWBA 2GH8A 3ZKYA 5L7OC 3POSA 1LOBA 3KHCA 4NOTA 5FZ0A 3O1PA 2WQZC 2ZBJA 3VZOA 3RPQA 2Y8KA 1C28A 4DNYA 2FDIA 4AVTA 5GZCA 2YB7A 1VALA 3U07A 4Z1VA 1XYNA 1IGOA 3NW4A 1YIFA 3HQXA 3O14A 1XSQA 2W95A 3AP4A 5FJKA 3WUCA 1PNFA 4WVMB 5JZGC 1Z7S2 2V4VA 5FKBA 1N1VA 2WRAA 1C8M1 3KCXA 2VOWA 4YW1A 5BNPA 2CWSA 5F2SA 4IE5A 4DRRA 1CAWB 4YZ2A 5TSWA 2ARXA 1OC1A 5JWPA 3KT7A 5F1RA 1ZM1A 2WABA 2WA3A 1NG0A 2X5IB 2BGPA 4IE0A 3TRSB 5A7QA 4BQ3A 1WCSA 4U2AA 2Z42A 1A6CA 3I3EA 1K5MC 1YQ8A 4LIUA 5A7WA 1HRV2 4E8CA 5FPXA 1YC61 2YV8A 1QDOA 3NNLA 2BW8A 3TN91 3N36A 4CPBD 1JBCA 1ZREA 1OBNA 2XBO1 1ZVFA 2ZPXA 4YZ1A 3AYAA 3RGBA 1MS9A 1VBD1 4MGSA 2HWC1 4A7ZA 3K3NA 2JDKA 4QPWA 2XGXA 4D94A 1Q8QA 4QX7A 5FYYA 4BWOA 1H6YA 2ZX4A 1HQWA 4RA0A 1AX2A 1O8SA 1W8NA 2OQ6A 2PFWA 1J3PA 3PUSA 4RGKA 4Y1VA 3VBUB 2R062 2C26A 3OBZA 3P6BA 1WCQA 1UPIA 1LKNA 2PHDA 3Q9OA 4ITCA 3LFMA 2PAKA 4LHNA 1XNCA 1AR62 4WZFA 1F4AA 4Q0UA 3FC0A 3JD72 5LK5A 1ZRFA 5F6LB 1JYWA 5FZAA 2RMU3 5LEKA 1UWWA 2FCUA 1DZRA 1B35B 5FV3A 1GZWA 3RJ2X 1YCIA 1DLCA 1CPMA 4GH4A 4P02B 1N3PA 3J7HA 4QM9A 1O3RA 4AL9A 1GNHA 5JXJA 5GJ6A 5FZEA 4HKWA 4LE4A 1H9PA 2D6NA 2YDEA 1W9FA 1ZZ8A 4XF9A 3WF2A 1G86A 1MR5A 3K4ZA 4BU2A 4JGZB 5JOZA 1RUD2 2ZHNA 1QKQA 4CE8A 2VMCA 1KITA 2QQNA 3QH6A 2RDRA 3VDDA 4COZA 4DEQA 3JBG1 2D3RA 5T54A 1MZFA 3IBMA 1CAXB 1GU3A 3FHIB 2I74A 1QU0A 4Q4V3 1W8TA 1PIV1 3B01A 2GU9A 2RJ2A 2ARBA 3E6CC 4L11A 4NHXA 5CYYA 4YW5A 3WNPA 1AL23 3A7QA 3LAGA 3MIEA 2HWB3 3RZZA 5JCTA 2QUOA 5LB6A 1W8WA 4GD4A 3MW4A 4Q4Y2 5CBLA 4D6QA 3DCQA 4EZ4A 3VHNA 5FZ9A 1O7FA 4Q0VA 2D93A 2XQRA 5GZDA 4XF4A 3ZXAC 2R6QA 4FOYA 3FHQA 4QQ2A 3LKJA 3WG3A 4IGQA 1WGPA 3POJA 5FPBA 4XJZA 4XF0A 2ID4A 5LY1A 2CGNA 1JS9A 2FMDA 3KCYA 2X5IC 3OBAA 4RGGA 5FP3A 1I9RA 3P3NA 4OI1A 3WF0A 3ZYIB 3CNAA 5KHGA 1QJEA 5C71A 3WW2A 5CA6A 4LBJA 1NCQA 3ZIXA 2BJSA 4JC1A 1BLZA 1KQRA 1U5ZA 5T5LA 3O1MA 1XQNA 3FBMA 3HVDA 1YI9A 5HCAA 4EV0A 4M0HA 1C8M3 4Q8LA 3T0DA 4MSVA 2XWJB 3CJIB 4BOWA 4QXBA 1AF9A 2J1AA 4UXAA 4AVSA 4EQVA 2AH2A 2O0OA 2R071 4FQZA 3J8F1 2W87A 4DIQA 5DZFA 3GNEA 4LBLA 2NM1A 3AP6A 4Z2WA 3Q8EA 2FBEA 3IMMA 4ASKA 1CJPA 1GWKA 4S2GA 2R0FA 1GBGA 3VBUC 4LO7A 5FUPA 1ULEA 1RUJ1 4BIFA 2VNOA 4XPVA 4LKFA 5F37A 3R05A 4YGEA 1QGLA 1A8DA 1LJ7A 4LHKA 5GALA 3TN93 4LK6A 2W68A 3D3AA 1VRBA 1BJQA 1YQ6A 2XBO3 2YC4A 1B35C 2UWAA 3KHBA 3KS7A 2ZAHA 4DMIA 1VBD3 3AZYA 1V6IA 4NUBA 2HWC3 4YYOA 4QPIB 2WSVA 1QWRA 5F32A 1I6XA 4XXPA 3VBHB 3AKRA 3RZJA 1FPN2 4QKBA 2P6CA 1ZA7A 4GWMA 4JGZC 2W9XA 5FPAA 3RYPA 3EMRA 4L99A 1QDCA 2XUMA 4AFMA 2W46A 3PIGA 4Y22A 5JOYA 2IFWA 2PHXA 3VBOB 2OA2A 4OUEA 3C7HA 2LW8A 3H0OA 3H42B 4QX3A 3WG4A 1XXNA 4XJUA 4CDUB 1K45A 3UJOA 4NR1A 1UCXA 2WO3A 5A33B 4FPHA 3KM5A 4RR3A 3POFA 3AC0A 2F4LA 4BQXA 1RMU1 3S57A 1LNSA 1WMDA 3RI8A 2WFF2 4NIDA 4P9XA 4MADA 1JU4A 2WJSA 1JYCA 1VP6A 4XC9A 1D2QA 2DTYA 2BP6A 2DTWA 2WZR2 3IIAA 5BNQA 1KD7A 1PZ9A 1LOEA 3KLSA 3ZYFA 3DKWA 2B45X 1W2UA 5FYHA 1LOCA 1T6BX 1UU6A 2DUQA 2QQVA 3GF6A 1VBA1 3OY8A 3HR9A 4IDZA 4NO4A 4PF1A 4RHV1 2XJUA 3VD5A 1OXCA 1V6MA 4ZONA 3AZVA 3JBG3 3WQBA 1OFSA 1UY4A 4E9KA 4YFWA 1Q43A 3OD4A 4K20A 3LF7A 3ZPYA 1ALYA 3N7MA 1YIPA 3B5LB 4XQDA 1PIV3 5FYTA 1W6PA 4BQ1A 2W0XA 4QGMA 1KGYA 1UX6A 1SBEA 4RFT0 1MVEA 1VBE2 5A7SA 4ISQA 1LHUA 1DZQA 1RUE2 1UZYA 3EXUA 1RUH2 1LB2A 1QHDA 3POBA 3KMHA 2JG9A 2E63A 3A4UA 3H7JA 3EB7A 4I0AA 5GLUA 5FO8B 2WN3A 3WDTA 4IV1B 4AQ2A 1MEC1 3ZN4A 2YBSA 1UKRA 4YM2A 3CJIC 4HVRA 1WWYA 3ZXKA 1EAH2 3L2YA 2V09A 1PGL2 1SBDA 2WAAA 3RZLA 1H1MA 2KR2A 4UF0A 3RS6A 2LS6A 2NZ9A 1W8OA 4QXKA 2WYSA 1PMHX 1OT5A 3JCIA 3BVCA 2WWJA 4R9DA 5DUXA 5T55A 2ZACA 5T5PA 1SLLA 5DAPA 3WNXA 4ARYA 2GZWA 3M70A 2RDNA 5C5TA 1W06A 3E97A 3HQRA 4OI2A 2LUWA 4IW3A 1VMJA 3OF1A 2ZTNA 4X6QB 4LBKA 4OCTA 3VL9A 4OQ8A 3RZKA 1SPPB 1VLNA 3B94A 3H50A 3MYXA 1QOOA 4P5YA 1GOFA 1SACA 4WBBA 5F5IA 4GQ7A 4DS0A 5KR7A 3WP5A 4JZRA 4TZDA 1AVBA 2R073 5CB7A 4L2NA 3WD5A 1UPSA 3J7NA 3J8F3 2GMMA 4QPIC 4Y1UA 2P3KA 3VBHC 3I54A 5CZKA 1UL9A 4EROA 4OHYA 1QNWA 2BDRA 2GN7A 2ZX1A 1GSLA 5EYYA 3R4DB 5J36A 5KHIA 1RUJ3 1UOFA 4H7MA 3VBOC 3DGTA 4LULA 4LJHA 1ZBE2 3VD9A 3D0SA 1LHOA 4H3WA 4CDUC 4IE6A 3OPTA 1Y4WA 2GC0A 3WP3A 5IK7A 1IKQA 1W2OA 4D6RA 4XMAA 5BNPB 1C3HA 2RS31 1PO21 2ZGUA 4QQHA 3POGA 1FX5A 3UETA 4CPBA 4C1XA 5A6YA 1H4GA 1H9WA 4B4RA 2Z2SB 4R9CA 1I3HA 2GP5A 5BNOB 3FWEA 1PO11 4NPMA 1YJLA 4DB5A 1UY2A 1UIKA 1DP0A 2D97A 3A0KA 3IT8A 2R49A 2CDOA 3K2OA 1SDWA 5F2WA 4NIIA 4A44A 5A7WB 3LPGA 1YNAA 2JDYA 4TWTA 3HPNA 2O14A 2YPJA 1L7LA 1AR71 4XVHA 2VOXA 2W1WA 3CQOA 3WNMA 1RMU3 3NAPA 5I0UA 2XJPA 1ST8A 5FP4A 3HEIA 1IKPA 3N9LA 4PQ9A 1TMF1 2YY1A 4AWDA 5FQ0A 2WLPA 1ZBA1 5H9SA 4YZ4A 1N3OA 4NVPA 1PMJX 2DCKA 3B00A 1X7NA 4OVEA 5T5JA 4RS5A 3LOBA 4D7TA 1CX1A 4Y4RA 1XSRA 1VBA3 2BTVC 1VAKA 2QCSB 4KGQA 3WY6A 4RHV3 1EUUA 4CU8A 3ITQA 5FFOC 3AKQA 3J26N 4OHZA 3IPVA 5JI9A 2VJXA 4GWJA 1HJGA 1O5UA 3D5OA 5FK8A 1FPN1 1QJU2 3F2ZA 1ULCA 4YW7A 3ZDVA 5IVEA 2W2IA 4J25A 5I0TA 5FY9A 2PHUA 2VXJA 4NRMA 4FFGA 2XLGA 4GH4B 4RSUA 2R041 4B4QA 1ENQA 3AZXA 5I8SA 1N1YA 2KM2A 5FY5A 5A32B 4A7YA 2RHPA 5C4WB 5CFCB 1LOGA 4CP2A 4NIGA 2HYKA 2GNTA 1J83A 4IV3A 4AEDB 5FO9B 1IG0A 4I02A 1VE0A 4M4RA 1JYIA 1MEC3 2AYHA 4PLNA 4XTMA 2TEPA 2YU2A 1DYKA 3RSJA 4UWDA 4I3PA 4MO3M 4N53C 1AYM1 5CKNA 2Y0IA 4COUA 1ZRIA 4LBNA 3EO6A 1APNA 2ARAA 3GALA 3JZVA 3VD3A 1BMV2 1NE4A 1SLTA 2J1TA 3PUQA 3AFKA 1HV0A 1YYNA 2OPKA 5FZBA 5GM0A 1EYBA 4Q26A 3PL0A 3WXPA 3NNMA 1MACA 5LZ6A 3MW2A 4C1WA 1U5XA 4JDNA 5BNPC 4Z2AA 3VKOA 3ABZA 2R1DA 4XXAA 2RV9A 3GCXA 1GOHA 1TQ5A 2W92A 4MXWA 1W3VA 1UX7A 5BNOC 4BLIA 4W8JA 1TEIA 5FXVA 5HV0A 3SEPA 4WM7A 1O3SA 1FATA 3VHOA 1DHKB 2VZ1A 4L97A 2GC3A 2DYCA 3WNKA 1NCQB 3MIDA 1US2A 4EZHA 1CIYA 5FMBA 4NN0A 4FTBA 2D44A 2WSUA 4QAWA 5J09A 3I2HA 4CEYB 2KD7A 4AF9A 1ZZBA 5F3CA 1J59A 3PHMA 3DN7A 2RS33 1R081 1PO23 2VVDA 2E7AA 1V0AA 4YGDA 2RMU2 1HIXA 2W1UA 3NKTA 3GZEA 1QJX1 3T1LA 3URFA 4E4DX 2OT7A 2X10A 3KT1A 1Y9MA 1PO13 2VNRA 4FPCA 3ZX7A 5FMCA 3THPA 5A3PA 1FXZA 3TB0A 4LKSA 5JPNB 5J37A 1RGSA 2QTWB 3MIGA 1ZZ7A 2XDVA 5E16A 4QQPA 4AFDA 3QCWA 2ERFA 4YG3A 2IWGB 4OQ9A 4IEOA 2E31A 4CDQB 4YVSA 1AR73 5EJ3A 2J1RA 2OVUA 2RVAA 2XR4A 2YGLA 2PELA 2ENRA 3LIHA 5F6KA 1SHWB 2VMFA 1UY0A 3MICA 4Q4V2 1CR7A 4GKYA 4LBOA 5CG9A 3UGGA 3USSA 2RS11 1TMF3 2B8MA 2HWD1 2Q1FA 4GH4C 1ZBA3 4I09A 1UOGA 2Q8OA 3ETPA 3ZYBA 5C4WC 3UJQA 4LOSA 2HWB2 4OYUA 5EP9A 4IXLA 3U4SA 1O4YA 2V72A 4N43B 2DBIA 3LEIA 2BNMA 5IFTA 3M3QA 3CHXA 4AEDC 1F2NA 5L19A 3GZUC 4NHMA 2G1MA 2Q8CA 1AL0G 3HT2A 1H0BA 4Q4W1 1OLMA 1H2NA 3VBRA 2WO1A 2C0ZA 1FPN3 3S7EA 3NV1A 1S55A 2AEYA 5SV5A 2Q8DA 4RR3B 1STMA 4LBMA 4S2HA 1H2LA 1D4M1 2R043 4LXLA 4Y1XA 2AZ5A 3CMGA 1KJLA 2ZKNA 3KD4A 2GN3A 4GA9A 1RXGA 4HKOA 2X53S 3LEGA 3AXEA 5ANQA 1LU1A 4X8PA 3GDBA 1GUIA 1UYXA 1WMEA 4W6WA 2B7YA 5JIAA 4B3NA 4C8DA 1F15A 4XIOA 5IVBA 3PTRB 1AHSA 3N4MA 1C8M2 3V0BA 1LAJA 1AYM3 1S0GA 1ZX5A 5FYIA 4DUXA 1GNZA 3VL8A 4E8DA 2H0VA 1JZ8A 3IN9A 4Q1RA 4L8QA 3MFAA 2WT1A 4ZHNA 5C3QA 3POEA 5GZFA 5FDBA 1FT9A 4QX0A 3ZYRA 1NCQC 4A42A 4EN9B 1W04A 3NJYA 4XEZA 2ZGMA 2XONA 1WUVA 2JG9B 2ZAAA 3K4AA 4A7KA 4CEYC 1XE7A 3AB0A 1NCRB 1BCXA 2Q8EA 3FHAA 3UKTA 1W6NA 5FYCA 3TN92 2A6ZA 4LITA 2BRTA 4AK3A 4FTSA 2CL2A 1ZRCA 3AYCA 3S0MA 2XQXA 4XOGA 5CFDA 4AR2A 1PMIA 1VBD2 3U10A 5K0UA 4E2QA 2HWC2 2OIIA 1VAMA 4OMDA 3O0VA 3MPPG 4B4PA 5I0DA 4XQ4A 1GQGA 3T3YA 2XUEA 4GMP1 2XJRA 1SFPA 1LOFA 5DUWA 1JOJA 1BEV1 5FPLA 4FOWA 3P3PA 4P08A 5C3SA 1W0PA 1XC6A 4JGYA 3LE0A 4I0BA 4JHTA 4O9EA 1EPZA 4CDQC 3RRDA 4CP9A 1X9PA 2WT2A 1OOPB 3WINE 1H8TA 1R083 3AVSA 1WBFA 2VW1A 3AK0A 5DAVA 2QDRA 4PLOA 3T2TA 3GM8A 1X9TA 1QJX3 3NV2A 3NJXA 4PIXA 1Y3TA 3OCPA 3PNAA 4LO5B 1EUTA 1O6UA 3SH4A 5C7GA 1D4VB 4PDWA 3W58A 3MIHA 5FIXA 4EN6B 1WBLA 1WW5A 4QB6A 2RE9A 5JZGB 3H9AA 1SCSA 4R9AA 2ZEZA 1O59A 3W21A 5GZEA 2HKXA 2BPA2 3POYA 4MHUA 1LODA 1XU2A 3DXTA 1F35A 1W8HA 4G9SB 2JB8A 4XAAA 2FQPA 1OA4A 2DCTA 3JBG2 4DY5A 2YBPA 2AUYA 5JI7A 3M3IA 3ZXFA 3IB3A 2OUJA 4RR3C 4KG0A 1G9FA 3X29B 3DKQA 1PIV2 2RS13 1SLBA 2HWD3 3C7OA 5EPAA 5FZ4A 1AX1A 4OZXA 3CEWA 4XFBA 1GICA 1RUI1 2IVJA 4N7IA 5I8YA 1N1SA 2D5HA 1K5JA 4XZPA 3VZMA 4NPRA 2VD7A 3E6BA 5L9RA 1SMVA 2OKXA 1CD3G 3K51A 3OUJA 2DURA 1DQ0A 2JEMA 4Q4W3 5DPNA 5EFUA 4CA9A 3AX4A 4XTPA 1GZ9A 3S5QA 1BHGA 3WVJA 4Z8BA 1VBC1 3USUA 1W39A 2PAMA 4WM8A 5D1IA 1OSGA 5L9BA 3ZXDA 3DUIA 3NAPB 1JW6A 5CVRA 3UGFA 1D4M3 2VW0A 4FFFA 5ERLA 3FX3A 2A6WA 1WW6A 2ZMLA 3G6JB 5FQ0B 5I91A 4N9IA 4EJRA 1BXHA 3N9MA 1H6XA 5DAXA 3FFZA 3L2HA 5BY5A 1UF2C 5KC6A 4LMFA 4QGNA 1W9WA 2JG9C 5A7OA 5I0RA 3W5MA 1T2XA 4EYUA 4HLTA 5FREA 4CDWA 1G9DA 3UNPA 1ZZ9A 1FV3A 3FJSA 5LASA 4IL7A 3LA7A 3PMSA 4P9JA 1OF4A 3OUHA 4BQ4A 5JSPA 1R1ZA 2BUKA 1BVVA 3N7KA 4AHYA 2E7TA 4UW3A 1KFXL 3M2MA 2R072 2D3PA 3J8F2 2E32A 5LK7B 4NRQA 5FKCA 3TWIA 1JZ4A 4Y20A 1IOAA 1BK1A 5FZ8A 2XWBB 4UT5A 5BUVA 3ZMNA 4XHBA 2ZEYA 1DQ5A 3WDXA 1RUJ2 2ZJCA 3ACHA 1IG3A 3TYJA 5FZOA 3ZXLA 4U36A 2PAEA 2LTNA 4IV3B 2Y60A 1OOPC 5JUVA 2PA7A 3LOIA 4WVZA 2VZOA 3RFRA 3PUHA 4ZS2A 4NIAA 4XBLA 4FP3A 3A21A 4ASLA 1W6OA 4AGGA 3SITA 1UQXA 3RWKX 5FYZA 2NP0A 3ASIA 4YM0A 1ULPA 4J6GA 4B7EA 2Z79A 4GMP3 1CAVA 4ZZ5A 2LALA 3DF0A 3J9SA 5LA0A 3RZMA 1WW4A 1BEV3 1NXMA 5FK7A 1OUSA 1BZWA 3KV5A 3WZ1A 5KWRA 5IWFA 1V6LA 1Z78A 1GR3A 1DGWA 1ACCA 2QQMA 4JTOA 4NAOA 2E53A 4XIKA 3ZO0B 4XUTA 2PHTA 1FOD1 2QJVA 4CXWA 2Q0AA 1B09A 1EY2A 3MGUA 4N90A 3WT3A 1JODA 2CGPA 1PGW1 2CAUA 5L73A 1RUF1 1RMU2 3ZSKA 1O3TA 2F4PA 3I59A 5DXDA 3POWA 5JLVA 4MXWB 2DU0A 2YFUA 2RG4A 3LZZA 3VZKA 4UBGA 3HD8B 2DCYA 4CVUA 4QU1A 3DL3A 4P9YA 4YVWB 1WD3A 5HPOA 2FZ1A 2EF6A 3HN3A 1VBA2 3VBSA 2P1BA 1OVPA 4JKKA 4LEJA 3H7YA 1QF3A 1NA1A 4KU7A 4RHV2 4FAHA 1MS1A 4K1ZA 1J84A 2XJQA 4G4FA 5HXMA 4AHWA 1JH5A 1MZ5A 1S0DA 2RR11 2A5ZA 2W3JA 3IM0A 3PTYA 4CEWA 2P34A 4LBQD 4QDRA 3O1SA 2JE8A 3NAPC 4K3UA 1MS5A 1CAUB 4XHXA 3ZMOA 5K9YA 2BERA 2ZHMA 3M7AA 1RUI3 2VZTA 3OGRA 2A6XA 3HBKA 1JUIA 3I3BA 3TEZA 4XFAA 5K4LA 4QX5A 1UOBA 3ACGA 2ZS6B 3THDA 4CUCA 3QLQA 4DUWA 3OSDA 2E7QA 2ZA9A 5J98B 3AKPA 4WVWA 4FQ4A 1HN1A 2WNEA 5HV4A 1G7YA 2QQLA 1MEC2 4N8MA 1UY1A 4IEZA 4KWKA 4AGRA 4NIHA 3ZSJA 5LBEA 2EXKA 4KWLA 4YVSB 1GQPA 1VBC3 2I2SA 3EHKA 3IMNA 3LEMA 5DN2A 3OYWA 2GC2A 4AZZA 4Y33A 5FP9A 4D7SA 3K46A 1F5FA 2QZ2A 3CLPA 4NWWA 4OHXA 4QT6A 4E27A 5GZGA 2BWCA 3T08A 4DRVA 1CQ9A 2JG8A 2QBXA 5FAXA 5FY0A 2K9ZA 3I97A 1DDLA 1WCKA 2JE9A 5BXXA 4AVCA 4IV3C 3E5QA 5HCFA 1RHI1 4C91A 5A6QA 4F83A 1ND2A 5D21A 4XDPA 4DUVA 1XYPA 3AMHA 2C9KA 4LOTA 4XF1A 3FFQA 3MHZA 4ISRA 3B3QE 1C5HA 5EYXA 5DQ0A 3T1MA 3VBRB 4AE2A 3I3DA 3R4UA 2IFRA 2PQQA 1HLCA 4IERA 5A7NA 1DQ1A 1SLIA 2G9FA 2FCTA 3ZFFB 1C1FA 3LPFA 2DCJA 5FWEA 1F31A 2W94A 2OZ6A 2G4IA 1X8EA 2HBUA 1S1AA 2JB4A 5F3GA 3NVCA 2IXCA 5A3LA 4QM8A 4IEVA 5AVAA 4DOUA 2B42B 2VE1A 1O5LA 1KS4A 3AYDA 5F9TA 1UU4A 5FXXA 2R1BA 4AI8A 2BFUS 5KHJA 2Y0OA 2EAKA 5CAZA 4HSJA 2RS32 1PO22 3MI8A 1MS8A 2ADEA 4V1PA 1D0GA 3N7JA 4Q0PA 5KHHA 5EJ1B 1F9KA 5A80A 3NNFA 2VTXJ 1PO12 3BN6A 1HB4A 5HCHA 1BKZA 4YVWC 2XJTA 4AQSA 4F8AA 3C7FA 3CKHA 4AVVA 3IIIA 1W0NA 2EXJA 1FOD3 4FOVA 3VKMA 1W8UA 4DXZA 3KF5A 4D3WA 1AR72 3BPZA 1JZ2A 2XL7A 1RUF3 5A1FA 2D43A 3GHMA 1PX3A 2AGSA 1XNAA 2CNAA 5LBBA 5C6CA 4XFIA 1TMF2 4GALA 1ZBA2 3E6DA 4HXCA 3AZWA 3AKTA 1S0FA 2GNDA 3NMBA 2WNUA 4Q27A 3ZR6A 2WINB 4UFLA 2VBPA 5APAA 1S2BA 1WCUA 3H3ZA 4NROA 4PIZA 3I2OA 2V5YA 1W28A 1RXFA 2D6OX 3AL5A 3AKSA 1LEDA 1TME1 3AM2A 5F5CA 1RINA 3ZSMA 1LGCA 5JIUA 3BPSA 2Y6KA 4YVSC 5ABJB 3NO8A 1YQ2A 5KXCA 2RR13 2PHFA 3WF1A 1H8TB 3CIHA 2IXHA 3OGVA 1REDA 4META 3DEMA 2ZX2A 1ULDA 2F17A 3IWZA 2BBVA 2BNNA 4CUAA 5FLJA 2X09A 1ZRDA 2R042 3RYKA 3RDIA 5G05L 3WHTA 3RVHA 2JENA 4CP1A 5BNNA 1J1TA 4QXHA 3J7LA 1HB3A 3WNNA 4HFSA 5KC5A 3OG2A 3UKNA 4BM8A 4IGPA 1K42A 5JMOA 1SCRA 4OULA 3VLBB 1CIWA 4OHWA 3MIFA 2UYAA 3VKNA 2Q1ZB 2FZ2A 1OHFA 3IDEA 4KG8A 1OF3A 3ZPOA 3VBRC 1SG3A 4BIOA 1AYM2 4CU9A 1UKGA 2VUJA 4QHBA 2AENA 3ZFFC 2J22A 3ZIWA 4BXFA 3BIWE 2AREA 5IHRA 1WW7A 4Y5TA 4AW7A 1PNGA 4NWVA 5DUUA 2IVIB 1WA6X 3Q8FA 1QH6A 3JUUA 3N3HA 1N3QA 2UYBA 4F3JA 4XJ8A 1V9U3 4ZZ8A 1VBB1 1RJ7A 4H14A 1RHI3 5IAXA 3BGAA 3BOWA 4A45A 4DXSA 3HAGA 4RQPB 1Y9QA 2XXZA 4NMIA 1QOSA 4LQRA 5I8TA 3NNGA 2ORXA 2OYZA 1Q5OA 2PTMA 1MQTA 1R64A 4BQ2A 1IPSA 1DQ2A 1NY71 1BBT1 3VUOA 3M3OA 4QMAA 2VC9A 3HNMA 4XUPA 1AYN1 2UURA 2JDNA 4Y4YA 3ZN6A 1CZTA 3BALA 4GWIA 3QOPA 3JB4C 4ZPIA 3WW3A 4R52A 4JAAA 3PVEA 1QJY1 3H1YA 3ECQA 4Q8KA 1W3XA 3GHNA 3HIFA 5FYVA 4M3CE 4E4HA 5C9AA 3O1OA 3NNJA 3ZVXA 5ANNA 5JR7B 3MFCA 1GWMA 4YW4A 5IT6A 2BVVA 3WDUA 3DYOA 4YGBA 1L7QA 4YRDA 3WG1A 1R082 1ULGA 1XPWA 5L9VA 4BQ5A 2FDHA 4CDXA 3H8RA 1QJX2 1QOTA 1PM4A 1W2AX 3OGSA 3B9CA 2NN8A 2VL4A 4Y1YA 3ZSEA 2K0GA 3AYEA 4Y20B 3T4HB 2H6BA 1ND3A 2A73B 2JIGA 2DVGA 5IVYA 4MV2A 1G9CA 3VHRA 1CZSA 3ES4A 2FMYA 1JUHA 4TN7A 1LTEA 1NQJA 1DIWA 3SCGA 3WW1A 4N53B 1BYHA 1GANA 2C24A 5D2AA 2OXBA 2WLQA 1LHNA 4KBZA 1H8TC 3U1XA 4OLLA 3T0AA 5H9RA 3NWKA 2VZPA 1JYNA 2ZKLA 3B69A 2VY0A 3K77A 4OZOA 1IS5A 2RS12 2HWD2 2PHWA 3S30A 5A3UA 4IQPA 1POV1 4YG6A 4TLFA 1D2SA 3PUAA 1IPJA 4PDWC 4XZUG 4HN0A 1M06G 1HRI1 2JDHA 4FP2A 1HXS1 4P00B 5CIRA 5JDBA 3V56A 4P5HA 1MZEA 4BQYA 4OI0A 4BB3A 2WL1A 3BTZA 1HX6A 1KJRA 1TME3 3H3LA 3APBA 1YHFA 4Q4W2 2ZEWA 4XUOA 1RITA 2HBTA 2QQUA 2UWCA 5JAXA 4JX0A 1ZA4A 4BH9A 5IAVA 3C3VA 1E57A 1XU1A 2VOKA 2CGOA 4B1LA 1PZ7A 4BMEA 5CISA 4M0NA 2EALA 3RQ0A 2JKBA 2QNKA 1D4M2 2PLV2 3CO2A 4LBQA 2X05A 3THTA 1JZ5A 1NXD1 1ZNPA 3V0AA 3DV8A 1G6NA 4Q0SA 5ACA1 3SH3A 4HVQA 2VZRA 5GLVA 3CL1A 2E6VA 4RD7A 2VTXA 2VMHA 2WNVA 3GYDA 1CESA 1EPWA 2GC1A 4RQPC 2WWSA 3RNSA 3FUQA 4CCCA 4SBVA 4D69A 3F95A 4HT1T 3OOXA 5I0SA 2B9UA 4GB31 4FPLA 2R7EB 4AEJA 4HONA 2XPJA 2E51A 2ET7A 3OD0A 3ZFGA 1OA2A 1DG6A 1H30A 5T3NA 2WS91 1NQDA 2B9VA 5FRAA 5FOJB 2ZMNA 3VV1A 1OLRA 2W08A 2VNGA 5JXHA 1RUG1 3ZXJA 3V64A 1W8ZA 2XJSA 5FP8A 1P8JA 3O12A 4HKLA 4Q4X1 4AI9A 1VBB3 4IGOA 1ASJ1 2BOJA 4BHPA 2JECA 3UESA 1ZZCA 4Q2FA 4QQOA 3SKVA 1OMIA 2BWAA 5F3EA 1GZWB 1XRUA 4M00A 4MGTA 1QXJA 3N9PA 4UFMA 3VGIA 1RUNA 2B39A 1AXZA 1BBT3 1DYPA 4Q5OA 5E89A 1HJFA 1AYN3 3HOBA 4LNVA 1OI6A 4UW6A 4XMIA 3GXUA 4UFJA 5A1AA 1QJY3 3KZ4C 3NKGA 1BEV2 2JDZA 3ORJA 3VDDB 4BYYA 2OPWA 5LA1A 3KT4A 3WHUA 2DFBA 4AI0A 2VTFA 4CCNA 2GNMA 4E2GA 5I93A 4J1WA 1REFA 1ND2B 1OD5A 5FCCA 5FMOL 4YW2A 4CSWA 4LKDA 5JSOA 4MHRA 5HCBA 2VH9A 2XJVA 2WQ8A 4PJYA 4AHXA 4CCJA 5CG8A 3QACA 2ZGSA 3M3CA 3J7MA 2A3WA 3WDVA 4CTEA 4BK4A 3I4IA 1YO8A 5C3RA 1OH3A 4FSJA 2DDUA 3I49A 2A1XA 3O0XA 5DAWA 3WG2A 1PK6A 1VJ2A 2WAOA 4X6RB 4WVMA 1KFUL 5EXOA 3RZHA 1COV1 4UW4A 2K46A 4GWNA 1S4CA 2CYFA 5D8AA 1CAWA 1POV3 4PBPA 2GNBA 3O7OA 1RUI2 1PZ8A 5EIYB 3AJYA 1HRI3 2EICA 1L7RA 1HXS3 2GSYA 1DBNA 3R0RA 2PN5A 3LSDA 4N9HA 2X5IA 3PLQA 3O1RA 4LE3A 4XURA 3K48A 1T6GC 2P17A 4FAGA 2BVBA 3VBSC 1W6MA 2E26A 2ZCWA 5LRRA 4TTGA 2EIBA 3BYWA 3OTFA 4LO6B 1FV2A 4DXRA 3DPRA 1NOVA 4BXSV 4MG2A 2ZGLA 2EIEA 2ETEA 4P14A 1VBC2 4M3CF 4C90A 4QX2A 5BPXA 1JYVA 1G9BA 2VM9A 1UYZA 3IKWA 5IK8A 3AMQA 4DQAA 3JQWA 4KMQA 4Y26A 1KEXA 2BOIA 3AJZA 5ACA3 2WNUB 3KGZA 5T50A 3VHPA 1HB1A 3D6EA 1LU2A 5FLIA 4PQQA 3S5AA 2YBKA 3WCSA 4B8EA 4P9IA 2GDFA 4MGYE 4QPYA 5EQUA 4GB33 3MF6A 1J3QA 4JTNA 4QU2A 3VBFA 4FPOB 1NLRA 3ACLA 4CCLA 4NJ4A 2WS93 4XFGA 5FZGA 4HBNA 2H6CA 3U11A 1RUC1 2VVEA 4I3GA 2VVFA 3SH5A 1RUG3 2RDQA 4Y22B 3VDAA 1V6NA 3U75A 3ZLIA 1OKQA 3FN9A 5LEJA 1YQCA 2JG8C 3VDDC 4Q4X3 3H8UA 5BNNB 3KVBA 3SKJE 3PDQA 2WYFA 3LD8A 3WP4A 5AC91 1ASJ3 3K75B 4KH9A 3DXUA 1GP4A 3IDCB 3MIBA 2A6YA 3MW3A 5IATA 2VG9A 4JGZA 1POV0 1KXGA 1W6QA 1ND2C 3MLKA 4HPKA 1RTVA 2PLV1 5EV7A 1UNBA 1RIRA 4FPJA 3D8CA 3NV4A 2FDJA 1NX9A 1Z0HA 2P3YA 2WNOA 4AOCA 1CAXA 2YFZA 2ZOEB 1JOBA 2XLFA 4XJWA 4OUMA 2VCMA 2CY6A 1OFNA 2WC2A 3U4XA 2YU1A 3OY8B 3JU9A 4PI2A 2W52A 3CF6E 2ZGPA 1HN0A 4IESA 4P9GA 4AI3A 5DG1A 3NJZA 4QGLA 3E5UA 5IK4A 4ZU5A 5C70A 2R16A 5FUIA 3GBWA 3RWNA 3MUZ1 4SLIA 1W6PB 1FOD2 3A23A 1ULOA 2BEOA 1PGW2 4FXGB 4QDSA 5DDJ1 4MOAA 1YEWA 3M8LA 1RUF2 2Z5WA 1MQTB 2QFEA 2VMIA 2VQUA 4Q1PA 4W6XA 4XUNA 1NLQA 3GGLA 2JD4A 2IUWA 4A6SA 1HRV1 1UMIA 3H8XA 2D6KA 5FBZA 5FXWA 2BZDA 3LDKA 4COWA 3ZFEA 3KV9A 4DFSA 3T30A 4MYEA 3T2PA 4LUMA 3ZYJB 5C9AB 1UO9A 3WW4A 1KDMA 1OA3A 2D6MA 4ORFA 2Y6HA 1QXPA 4UF0B 3W20A 2K2SA 1C4RA 5FZCA 1MS4A 2Q4SA 2RR12 2DWRA 5C8WA 5FY4A 1COV3 4IEQA 2D6PA 4MZUA 4CDXB 1OQDA 4ET7A 1GOGA 2ZGRA 4QX1A 1JMUB 4BK5A 3P5BA 4ATEA 4O61A 2WIIB 2J1EA 2WNUC 3MO4A 1Y9GA 2B4KA 5A70A 4K8RB 5K7PA 4FVVA 3NV3A 4LR4A 1U12A 2VUAA 3W9AA 3AMMA 2QQKA 4J1XA 4TSVA 3I3QA 4YGCA 3D82A 3O1TA 2HWE1 1XNKA 3HNBM 2CHHA 4HL0A 4D7YA 4E4SA 4EN0A 4XE9A 1ZZ6A 3EBRA 1RUOA 1X33A 2VMGA 3I8TA 1XE8A 1DGRN 1CJDA 3ACFA 3SHRA 1R1A1 5BNNC 1PVC2 4FBFA 3SEEA 2YC2A 2NYYA 3Q8AA 1JZ6A 1LGBA 3SCHA 4H7LA 1V9U2 3Q8CA 4A41A 3OPWA 2O8OA 2DFCA 3C7EA 1AJOA 1RHI2 4JV4A 1US3A 4FI9A 3AVRA 3VBOA 4LA3A 4QPGA 1OPOA 2BQPA 1Y7BA 1S2EA 2IC1A 3MBWA 5LATA 4AGVA 2JDPA 5FZ7A 4M01A 4CDUA 2XB6C 3KGLA 1UW8A 5A33A 1RUC3 4WZCA 3KWVA 4IEYA 3WQ0A 4A2UA 4FO9A 1FNZA 4Y24A 1C5IA 4EWDA 1WLWA 2Y38A 3OEBA 2YYOA 4OMCA 1R091 3LDBA 1ONAA 3PVBB 5A3WA 5AC93 5HBAA 5KXEA 2BGOA 1FMD1 2E33A 3JQXA 1VRH1 2LM3A 4PLMA 2PLV3 2WUHA 1LENA 4LLOA 1JHNA 5LBCA 3U78A 4AVAA 4D8MA 2EIDA 1MQTC 5FOBB 4OHVA 1YFWA 3ZFGB 2IXKA 3PMEA 1X50A 3LDRA 2GAUA 4RS5B 4ES8A 1DLLA 1QQP1 3SXWA 4HN1A 5DMYA 3O1UA 3T2OA 2HJIA 1TNRA 1ENXA 1RJ8A 1UMZA 3EJKA 3VZLA 2KXLA 4IE7A 5C9AC 2VZSA 1AR81 3IPVB 1PM7A 2W91A 3M4FA 1IQDC 1W99A 3AXDA 2MHFA 3S6PA 4DPNA 4EWEA 4AI2A 5DDJ3 4IV1A 2UY8A 3UGHA 1ZRRA 2VOTA 5FY7A 4CDXC 1C57A 2CWMA 4UI9L 3C2UA 5CADA 1HRV3 1X82A 3U14A 4ARXA 4JQRA 1UU5A 3SCFA 4NPLA 4P9LA 2RS51 2ATFA 3FBYA 3LB9A 1UXZA 5E88A 4AVBA 2CU5A 1K12A 5EJZB 3VZNA 3FLRA 2PXJA 3ENRA 1XNDA 1XYOA 3MPBA 4Z07A 2WBKA 2H0BA 4FT8A 2X29A 1TME2 2YG0A 1LEMA 1X8MA 2XOMA 4V2VA 4CU6A 5CEHA 2WFPA 1LOAA 5FPUA 1Q56A 1SPPA 2TUNA 3AMPA 4QDQA 3VB9A 3WEZA 1F4HA 3AL6A 4FPEA 1RVF1 3WOGA 2YMZA 4EE2A 5CU1A 5M0TA 1DU3D 2VZVA 1GYKA 3TEYA 1A34A 2A3XA 3LFIA 2DVFA 4B29A 3HN1A 1W9TA 3ILFA 4IEPA 3T0BA 1VB4A 4KU8A 1W05A 4JRAA 3OPZA 1QH7A 2HEYF 3AFGA 2ZEXA 4O65A 3KV6A 2XVLA 3D4KA 3GCWA 2DUPA 2HWE3 5GLZA 4XCAA 3ON7A 4HANA 4BQWA 1HKDA 2HYXA 2ZHLA 4PCRA 2EXHA 4WM7B 4AAXA 1PK6B 2Y6GA 3AP7A 2J42A 5FZFA 2ZGNA 4JKMA 2HWF1 3HT1A 4OUSA 1REEA 3ATGA 5D8AB 2VU9A 2Y33A 1XBFA 4K9SA 4O9GA 2JE7A 1GV9A 1NUKA 1R1A3 1E5SA 3OGGA 2GP3A 2QKDA 3ZYHA 5JSRA 2E9QA 3N7LA 4FOQA 4LHSA 5BNOA 5DAQA 4F7ZA 1VBB2 1YJKA 1N1TA 2DUOA 2WR9A 3WX5A 1LHWA 4MGZE 2WNVC 5J3UA 1W6MB 3PIJA 5HI0A 5FXZA 3MF9A 5E1RA 1H1AA 5FY1A 1G8WA 3DPRB 3TEXA 5IK5A 4HOOA 2IXJA 1FNYA 3ZFGC 3WCRA 1NY72 2VQAA 1BBT2 4RS5C 1UAIA 1AYN2 2VQ0A 3HWJA 2YC0A 4RGAA 4S2DA 1H8VA 1R093 1LRHA 3KV4A 1QJY2 5FYBA 4ZY9A 4GMP0 2XHNA 2VW2A 5CKQA 3KVAA 4YSFA 1FMD3 1NYWA 1NAEA 1HQLA 1UXXX 3FE5A 1L3JA 1UZWA 3JXSA 1VRH3 1JI6A 5DZEA 4D6SA 2CAVA 1GQHA 2VAUA 4LIVA 1IHMA 3VBFB 2YUEA 1PVC1 4I0WB 3R4SA 5JOXA 2F6BA 3B02A 3PVNA 3LWCA 4W4ZA 1OD3A 1QQP3 1V9U1 4Q0QA 4KNCA 4MLOA 4XETA 5C33A 2RM21 2RJKA 1LGNA 2OW4A 3S7IA 2A6VA 2OQ7A 3I2IA 1UYPA 1WA4A 2VR4A 1UZ0A 3M1HA 1AR83 2XHKA 5C4WA 4GIQA 5A32A 1POQA 1IZ3A 4CCKA 5CFCA 2MEV1 3KB5A 2Y6JA 3OGJA 1QJFA 4XCBA 5A6ZA 4AEDA 3ZOIA 1IS3A 1XJAA 1W6QB 4HPKB 1EV11 2QQPA 1QMJA 4S2FA 1J58A 2JDMA 5F39A 3H1MA 2VCBA 5FO7B 1SLAA 2WO7A 5FZKA 2ZABA 4ASMB 4A4AA 4XW3A 1HRI2 2JJ6A 2RS53 4K40A 1HXS2 1SDDB 3U0ZA 1MS0A 3BTXA 5F5AA 1WLTA 3VDCA 4LK7A 3O0WA 3PJQA 4Z82A 3V0BB 4XYXA 1WD4A 5A3MA 5IUQA 5FUNA 2G9ZA 2FDGA 2J1UA 4FPFA 1GWLA 4ZU4A 1A8MA 5BV6A 4WM7C 3GBGA 1PK6C 3SQOA 2BBAA 3BU0A 4I2OA 1NLSA 4JDMA 1BVP1 4W6YA 5D8AC 2ORZA 1RVF3 2A7AA 1IPKA 1W0OA 2B5HA 1Q8VA 1GFF2 4QKFA 2EXIA 2D98A 4PIYA 3RMXA 2ZGTA 2QQIA 5ACA2 3B93A 4QHOA 2N7GA 1W6NB 3ZFEB 2HEVF 1WZXA 4LHLA 4LLFA 4AEMA 1J1LA 4FPYA 2W39A 4BCUA 5FZ3A 1GZCA 5KHKA 1VMFA 2C6SA 5CFDB 1VR3A 3DPRC 1SFYA 5FZMA 3V65A 2DV9A 4GB32 5FZ1A 5K0UB 5GLWA 4Q29A 2VUCA 2A3YA 4M3CA 2C5DA 3SNMA 1ENSA 2JKXA 4CEYA 3RZGA 5CFCC 2HWF3 1RB8G 2WS92 2DVDA 2ZGQA 3NJVA 4QX8A 1JXNA 1F5JA 4CUBA 1RUG2 1S0CA 4JGYB 5JVVA 2MNGA 1IS4A 4L0PA 4GAZA 3I3MA 4Q4X2 4AQ6A 4LO8A 4HK9A 2R30A 3WQ1A 4CP9B 4URAA 3RJRA 5LBFA 1ASJ2 1QY4A 2Z4FA 3BI3A 1UD1A 3KF3A 4AAPA 4CCMA 3FUOA 1LECA 4Y3OA 2EAAA 4RN5A 3VBFC 3E1F1 1N47A 5H9PA 3BU7A 3ZDSA 3ILRA 2DF7A 4PDWB 2OS2A 4CDQA 1D0HA 3KQ4B 4FFIA 1JOPA 2GMEA 5A3NA 1DYOA 1ULFA 1PGSA 3I2FA 4A6OA 4K7JA 1AXKA 2CSGA 2VO5A 2VCCA 3RI9A 3VD4A 4E2SA 3I2DA 1ODNA 2BV4A 1VPHA 4IEXA 1O3QA 3OBTA 2FCVA 5LA9A 4N43A 2D7FA 3ALQA 3INAA 2NMNA 3OJBA 2VZUA 1Z7S1 1AR92 2I07B 3VDBA 1VAVA 2DVAA 1OPMA 2GALA 4XFFA 3P1IA 4DEVA 4BZ4A 2FDKA 1PVC3 4QPGB 5KBFA 4QQLA 2ILMA 4PT6A 2WO2A 4TYSA 2IZWA 2RM23 4FXKB 5A3TA 2WZEA 3FZ3A 1FYUA 4XJAA 3UK9A 2PMWB 2WZPP 4XBNA 2Y6LA 3L9JT 4YW6A 2ZZQA 4CU7A 2JXAA 5IVJA 3K3OA 4KWUA 4D0QA 2MEV3 4FPGA 1W2TA 4ZU7A 3USUB 4OFGA 4WM8B 3VZJA 2P4EA 3H1WA 4AG4A 1EV13 2BU9A 3BCWA 3MLLA 3K4DA 2BYVE 1YFUA 4WVVA 5FPZA 2QVSB 1COV2 3VN4A 1I5PA 4DXTA 5JXIA 4RYDA 2NLRA 3KSCA 4BMBA 1HDKA 4YW3A 3ELNA 3WF4A 1FAYA 3I2GA 3I7DA 2Y26A 2ET1A 4CDWB 2OX0A 3R6SA 1YWKA 2C9AA 1A78A 4KBBA 5GKAC 4GJZA 3ZFEC 1S0BA 4E4ZA 4FTEA 4QB1A 2R061 5FZ6A 4YLZA 5CFDC 2LROA 4UOJA 1JYTA 1AR61 4HG6B 3CBNA 5K0UC 1Q8SA 2FD8A 3ZYGA 1PVXA 3JD71 3ZXEA 5J48A 2NMOA 2Y6FA 1FI2A 4DZGA 2VMDA 1NCRA 4WV8A 1LOFC 5FTTC 1BK0A 1NE6A 1UYYA 4XAEA 2DCZA 5B4NA 1V70A 2J1SA 4JHZA 1DGRA 4JGYC 1DQ4A 2JICA 4L9BA 5HXVA 5FZOB 3FMGA 4XJ9A 1H2KA 4MVTA 4P9WA 5C8CA 1RUD1 1GMMA 2DBNA 2JDAA 3T4VA 4YFZA 4XDQA 1F8VA 2JWPA 3IAQA 2ARCA 3U37A 1GP5A 1VMHA 2PQSA 3LEKA 3PU3A 4YG0A 5DG2A 1W6OB 1YI7A 5H9QA 5IW0A 3VKFC 1XNTA 3CDZB 1V6OA 1AJKA 4MGIE 1V6JA 2I45A 4FCAA 1W9SA 4MUVA 4YZ3A 4AHZA 1HB2A 1DGWX 1CAVB 1ENRA 1OOPA 4KQ7A 4IEUA 5SV8A 5L7OA 1RUC2 1AZDA 4A3XA 1HW5A 5FYUA 1HQNA 2B46X 3PURA 5J7MA 5IJRA 4Q4Y1 2VZQA 4XBQA 4UAPA 5FMDA 2VZ3A 1TG7A 4YPJA 5AC92 3PU8A 2WZ8A 1G9AA 3UKVA 4CUGA 5JZGA 4BDVB 2JDUA 2X8KA 1XOYA 4O7XA 4HMZA 3I59B 2D3SA 2LRPA 2WN2A 4QPGC 2GMPA 1W2NA 2VCAA 5FJHA 4K1YA 4L92A 2R0HA 1TE1B 3HJRA 1LULA 2WQ4A 3N9NA 2ZGKA 4X8NA 3ZSLA 1UZZA 3HBZA 2JIJA 4R8HA 5IVCA 4EN8B 1OURA 3VBSB 2ZHKA 1NA1B 1K5MA 1TZOA 1CVNA 4M4PA 2ZX0A 3RG0A 1O8PA 2P5BA 4GJYA 3BIEA 4WM8C 1Z7S3 2A71A 4CEWB 5A3OA 4KWJA 4BJ0A 1DFQA 4LA2A 5E6HA 2NQYA 3TOJA 5DDJ2 3T09A 1GKBA 3BTYA 2YXSA 5F8PA 2PYTA 5FWJA 1SFNA 3OEAA 4B7KA 1SZBA
chains in the Genus database with same CATH topology
3GJAA 3NNFA 3OUIA 4MHRA 4XCBA 2JIGA 4NAOA 5DAVA 3GZEA 3MGUA 3KT1A 3OBZA 3EMRA 4KBZA 4XABA 5LBBA 2RG4A 2A1XA 3W20A 5DAWA 2FCUA 2RDSA 2V4AA 3W21A 5A3UA 4BQXA 4MHUA 4XAAA 3GJBA 4XC9A 4BQYA 5M0TA 3DKQA 5EPAA 2RDRA 5EP9A 2HBTA 2G19A 4ZONA 5IAVA 3ITQA 4NHMA 2G1MA 4XACA 5L9RA 4XCAA 4BQWA 3OUJA 4NHXA 5HV4A 4J25A 5LB6A 2Y33A 5LBEA 5L9BA 5ERLA 5EQUA 2Y34A 5DAQA 5DAXA 5LBFA 4Y5TA 5LATA 4UWDA 2RDQA 5LASA 3OUHA 5IAXA 3BVCA 5DAPA 4NMIA 4Y5SA 2RDNA 5C5TA 5IATA 3HQUA 3HQRA 4IW3A 2JIJA 3PL0A 4NHKA 2FCTA 3NNMA 5C5UA 3KT7A 2FCVA 4Q5OA 5LA9A 2HBUA 5LBCA 4ZPIA 4JZRA 4NHYA 4NHLA 3NNJA 2OPWA 5HV0A 3KT4A 3NNLA 5L9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GJA A;  3NNF A;  3OUI A;  4MHR A;  4XCB A;  2JIG A;  4NAO A;  5DAV A;  3GZE A;  3MGU A;  3KT1 A;  3OBZ A;  3EMR A;  4KBZ A;  4XAB A;  5LBB A;  2RG4 A;  2A1X A;  3W20 A;  5DAW A;  2FCU A;  2RDS A;  2V4A A;  3W21 A;  5A3U A;  4BQX A;  4MHU A;  4XAA A;  3GJB A;  4XC9 A;  4BQY A;  5M0T A;  3DKQ A;  5EPA A;  2RDR A;  5EP9 A;  2HBT A;  2G19 A;  4ZON A;  5IAV A;  3ITQ A;  4NHM A;  2G1M A;  4XAC A;  5L9R A;  4XCA A;  4BQW A;  3OUJ A;  4NHX A;  5HV4 A;  4J25 A;  5LB6 A;  2Y33 A;  5LBE A;  5L9B A;  5ERL A;  5EQU A;  2Y34 A;  5DAQ A;  5DAX A;  5LBF A;  4Y5T A;  5LAT A;  4UWD A;  2RDQ A;  5LAS A;  3OUH A;  5IAX A;  3BVC A;  5DAP A;  4NMI A;  4Y5S A;  2RDN A;  5C5T A;  5IAT A;  3HQU A;  3HQR A;  4IW3 A;  2JIJ A;  3PL0 A;  4NHK A;  2FCT A;  3NNM A;  5C5U A;  3KT7 A;  2FCV A;  4Q5O A;  5LA9 A;  2HBU A;  5LBC A;  4ZPI A;  4JZR A;  4NHY A;  4NHL A;  3NNJ A;  2OPW A;  5HV0 A;  3KT4 A;  3NNL A;  5L9V A; 
#chains in the Genus database with same CATH topology
 2ES3 A;  4CDW C;  4K6B A;  1UOJ A;  4AYU A;  3FLP A;  2XLA A;  3AP9 A;  4PI0 A;  3OBR A;  3WUD A;  4YAR A;  3UL2 A;  1X36 A;  1U0A A;  1CZV A;  4CZS A;  3OYW B;  5F3I A;  3JB8 A;  4AQT A;  4KI5 M;  4KGG A;  1JU3 A;  5C3P A;  1QEX A;  1TVG A;  2VGD A;  3ME2 A;  4IV1 C;  3I2K A;  3CU7 A;  3MEP A;  1QJZ A;  1QNY A;  4GXL A;  5JXG A;  3IDB B;  5DUV A;  1WLD A;  1I1E A;  4XAB A;  2JG8 B;  4UW5 A;  4ATF A;  5FY8 A;  1LES A;  3C8X A;  5EZW A;  2JX9 A;  4C0B A;  4LO4 B;  5JOW A;  3W59 A;  4LT5 A;  3UYJ A;  1IQA A;  1NZI A;  1AR9 1;  1BQP A;  1WMX A;  2R06 3;  1O4Z A;  3ES1 A;  2HH9 A;  1U5Y A;  2V5D A;  2XML A;  3GJB A;  4CXY A;  1AR6 3;  4QXC A;  3N9Q A;  1MZ6 A;  2HWE 2;  1OH4 A;  3JD7 3;  4URT A;  4TLG A;  3RYR A;  4COV A;  5BYN A;  3TEW A;  4MX3 A;  3GZA A;  3FL7 A;  2W1S A;  2WFF 1;  4LKE A;  3WF3 A;  3DEC A;  4C0H A;  2WZR 1;  2A75 A;  4LOR A;  1LR5 A;  4H55 A;  1R1A 2;  5T52 A;  1OQE A;  1RYY A;  2WKK A;  4XF3 A;  4HK8 A;  4AFC A;  1NKG A;  3WNO A;  1RUD 3;  5K8S A;  3DYP A;  4MXV A;  2P3I A;  4PF5 A;  5JR2 A;  5IVF A;  4I30 A;  5B2G B;  2Q1M A;  4QB2 A;  3VD7 A;  2RJL A;  2WWU A;  2QDN A;  1SEF A;  1DQ6 A;  2P2K A;  1H4H A;  4QKN A;  4R4Z A;  1GLH A;  5EHD A;  1K3I A;  4HSL A;  4HZF A;  1VBE 1;  3VKL A;  3ZXG A;  1RUE 1;  1W8F A;  4ZKT B;  1NA1 C;  1IS6 A;  1GNY A;  1O4T A;  1RUH 1;  1R09 2;  4Q4Y 3;  2VUL A;  2FDF A;  2O1Q A;  4OI4 A;  1Q8P A;  3BOD A;  3J4U H;  1OUX A;  2ZGO A;  4CEW C;  2FHR A;  3BOP A;  3AZZ A;  1FMD 2;  3A22 A;  5A7P A;  4YVW A;  1VRH 2;  1M4W A;  3WDW A;  1EAH 1;  1VIW B;  5C3O A;  1PGL 1;  3QH7 A;  2YHJ A;  2O8Q A;  3EYP A;  4UYB A;  1WKY A;  1E5I A;  1H2M A;  3OB8 A;  4IND A;  4M3C B;  3THC A;  3TAY A;  3BTA A;  1QQP 2;  1DGL A;  2ADD A;  1QIQ A;  2TNF A;  5C5U A;  1LHV A;  2VEC A;  3A0N A;  1CAU A;  3N35 A;  4W50 A;  2J1V A;  4EWA A;  3VBU A;  5IVV A;  1HV1 A;  3H8O A;  3LQC A;  1Q3E A;  2Z69 A;  4NHY A;  5FZL A;  4DIN B;  2D6L X;  1RL3 A;  4XDO A;  1AR8 2;  2VBD A;  3T2Q A;  5A1L A;  4CCO A;  4UFH A;  2WDB A;  2Q5T A;  5EWS A;  2C4X A;  1B35 A;  1A3K A;  4UFK A;  4IUG A;  3NL1 A;  4XUQ A;  4Y5Z 0;  4AFB A;  2VME A;  3QD6 A;  4GKX A;  2UU8 A;  2XVK A;  3DYM A;  1AX0 A;  3GJA A;  3MUY 1;  2D40 A;  1JTZ X;  4H2A A;  4NE9 A;  4UBH A;  5LWB A;  2RS5 2;  5DZG A;  2YPD A;  4GUL A;  4YWA A;  3LCP A;  3MDP A;  2IXL A;  1O91 A;  4JKL A;  1AL2 2;  1ZBE 1;  1YXW A;  5F5Q A;  3IAP A;  1W9Y A;  2XKP A;  2VUD A;  1MS3 A;  3MV1 1;  3GBF A;  5AVP A;  1KS5 A;  3ETQ A;  5JPM B;  3LIG A;  4UFI A;  4NAM A;  5A6X A;  4BE3 A;  1URX A;  2R32 A;  3B9I A;  4R4X A;  2MPF A;  5FZH A;  1UY3 A;  4QKD A;  1RVF 2;  3NQH A;  5FZD A;  2DU1 A;  1LCL A;  2V4A A;  2Y64 A;  2HEW F;  2W1Q A;  1E5R A;  2NPI A;  3LA3 A;  4HET A;  5FZI A;  4KL1 A;  1AR9 3;  1YRZ A;  1S0J A;  2P6H A;  3SLI A;  4RFR B;  3ZFF A;  5L36 A;  1KRI A;  1S2K A;  5KXB A;  2P3J A;  4XIL A;  3GZT B;  3IZO A;  4IET A;  4FPK A;  1NT0 A;  1C1L A;  3QBQ A;  3TNP B;  1CGP A;  4DY3 A;  4ES9 A;  3SIS A;  4LTA A;  5FPV A;  4JRL A;  1W90 A;  2QQJ A;  3WV6 A;  2AC1 A;  3ZN6 B;  4ONU A;  1Q8O A;  1OQ1 A;  2WFF 3;  3WSO A;  4ZXE A;  4RL7 A;  2TBV A;  2HWF 2;  1YUD A;  3MLJ A;  4R9B A;  4XQW A;  3H3U A;  1D7P M;  2WZR 3;  1VB2 A;  3ZR5 A;  5AFE A;  4N7U A;  4CP0 A;  5F7U A;  3D0J A;  2YRO A;  5FBJ A;  2ZZJ A;  5T5O A;  4LPL A;  2XVG A;  2BFU L;  5FLH A;  5G04 L;  3SMH A;  4BLJ A;  2BGC A;  2AEZ A;  4BPZ A;  3HMY A;  4YM1 A;  2VNV A;  1ODM A;  1V00 A;  1XB9 A;  2OZJ A;  2AAC A;  3CJI A;  3O1V A;  1GP6 A;  2VBB A;  4B1M A;  1E5H A;  2WA4 A;  1QJU 1;  4Z92 B;  2SLI A;  4PHZ A;  2Y34 A;  2VXR A;  3N9O A;  3WLU A;  3KCC A;  1ND3 B;  1XNB A;  4W65 A;  4CCD A;  2QQO A;  1VBE 3;  1RUE 3;  2XBO 2;  2SBA A;  4MH0 E;  4AEK A;  1DF0 A;  1KDK A;  1RUH 3;  4A3Z A;  1YLL A;  4EN7 B;  4MGQ A;  2IXI A;  2VPV A;  1TNF A;  2CV6 A;  1S0E A;  2GH2 A;  3UT0 A;  5AFB A;  5C8C B;  2WT0 A;  2XH6 A;  4I01 A;  2QZ3 A;  4JVA A;  2DVB A;  3SC7 X;  5B4X A;  4JDO A;  1OVS A;  4K8F A;  1U5I A;  3BB6 A;  1EAH 3;  4JCK A;  4Y5S A;  2EIG A;  4AXO A;  5FR3 A;  1DZT A;  1Y43 B;  1JYX A;  3HQU A;  4IEW A;  4Y1Z A;  4NHK A;  5LRS A;  2KA3 A;  1YFY A;  3EQE A;  4NRP A;  4QPI A;  3VBH A;  5ABJ A;  4PBO A;  2Q30 A;  5L7O B;  1BMV 1;  3NST A;  2XL9 A;  2RM2 2;  2CDP A;  2OUH A;  1OLM E;  4NHL A;  2L9L A;  5FP7 A;  2G9G A;  3MZH A;  2A70 A;  2ZX3 A;  2UY9 A;  2VOV A;  4QWN A;  1UN1 A;  3UV9 A;  3G7D A;  2BNO A;  4DO0 A;  4CYD A;  2YZ4 A;  4N43 C;  1CON A;  2MEV 2;  3POI A;  5LW9 A;  3NRU A;  1GZT A;  1OLQ A;  1EV1 2;  4XFH A;  3TBD A;  3LGR A;  4LBQ B;  1JZ3 A;  3BKZ A;  1DCS A;  4AFA A;  1WCD J;  4YZ5 A;  3V0A B;  4GZ9 A;  1WLC A;  3OUI A;  3LSE A;  3RMY A;  2WNV B;  1J3R A;  3B7M A;  5FYM A;  2EVX A;  5GLT A;  1K5M B;  1PHM A;  4LUK A;  5LY2 A;  1ZBE 3;  1WMF A;  2W5F A;  4HVO A;  3PUI A;  4YM3 A;  3Q8B A;  5ISL A;  5LCW L;  2ZXQ A;  1CWP A;  1SBF A;  1SQ4 A;  3WNL A;  2XG3 A;  1SLC A;  3O5S A;  3W5N A;  3KQR A;  4MGK E;  1AUY A;  1C8N A;  2VQT A;  4RQP A;  2RMU 1;  3HNY M;  5CNA A;  3ZM8 A;  1JHJ A;  1MVQ A;  1CN1 A;  1UZV A;  2RDS A;  1CPN A;  2ZMK A;  2PHL A;  3MV0 1;  3IDA A;  5FYS A;  3PJY A;  1ZYB A;  5DAB A;  5J1X A;  4CXX A;  4BA6 A;  1JN2 P;  3ZYP A;  1JZ7 A;  4V2W A;  2CTV A;  2EA7 A;  2J7M A;  3E5X A;  3I2J A;  4CRQ A;  1H1I A;  5JMC A;  5KXD A;  2YGM A;  4YNI A;  3WP6 A;  4TXW A;  1XE0 A;  1V6K A;  3M3E A;  4QD2 A;  4ZXK A;  1QXR A;  1RC6 A;  2P37 A;  3ACI A;  3LA2 A;  4ZS3 A;  2HLE A;  2V73 A;  5IFP A;  2G19 A;  1W03 A;  4AI1 A;  4Q4V 1;  1NCR C;  3C7G A;  3BUC A;  1ND3 C;  2JD9 A;  3CZJ A;  3ZN5 A;  4XFC A;  4XAC A;  5E8A A;  1MPX A;  1YFX A;  2C1F A;  2QE3 A;  2QQW A;  5FMO S;  3AP5 A;  4K21 A;  2AR6 A;  4COY A;  1I5Z A;  3WR0 A;  1AL2 1;  4IE4 A;  3WQ7 A;  4CCE A;  2D5F A;  2HWB 1;  3FLT A;  1UIJ A;  3PVO A;  5C8C C;  3ZKU A;  1S0I A;  1PX4 A;  1OKO A;  1YQ5 A;  4JQT A;  3AMN A;  5ABJ C;  1EP0 A;  5LA2 A;  2XKO A;  4QHZ A;  1CX4 A;  5J96 B;  2W47 A;  4FFH A;  3CZU A;  1UMH A;  4G3Y C;  3ST7 A;  3WDY A;  1AXY A;  1QJU 3;  3ILN A;  4N53 A;  5CKM A;  4BIS A;  5IYY A;  3TNQ A;  3CJX A;  3ROU A;  2PHR A;  1NZC A;  2UWB A;  2GH8 A;  3ZKY A;  5L7O C;  3POS A;  1LOB A;  3KHC A;  4NOT A;  5FZ0 A;  3O1P A;  2WQZ C;  2ZBJ A;  3VZO A;  3RPQ A;  2Y8K A;  1C28 A;  4DNY A;  2FDI A;  4AVT A;  5GZC A;  2YB7 A;  1VAL A;  3U07 A;  4Z1V A;  1XYN A;  1IGO A;  3NW4 A;  1YIF A;  3HQX A;  3O14 A;  1XSQ A;  2W95 A;  3AP4 A;  5FJK A;  3WUC A;  1PNF A;  4WVM B;  5JZG C;  1Z7S 2;  2V4V A;  5FKB A;  1N1V A;  2WRA A;  1C8M 1;  3KCX A;  2VOW A;  4YW1 A;  5BNP A;  2CWS A;  5F2S A;  4IE5 A;  4DRR A;  1CAW B;  4YZ2 A;  5TSW A;  2ARX A;  1OC1 A;  5JWP A;  3KT7 A;  5F1R A;  1ZM1 A;  2WAB A;  2WA3 A;  1NG0 A;  2X5I B;  2BGP A;  4IE0 A;  3TRS B;  5A7Q A;  4BQ3 A;  1WCS A;  4U2A A;  2Z42 A;  1A6C A;  3I3E A;  1K5M C;  1YQ8 A;  4LIU A;  5A7W A;  1HRV 2;  4E8C A;  5FPX A;  1YC6 1;  2YV8 A;  1QDO A;  3NNL A;  2BW8 A;  3TN9 1;  3N36 A;  4CPB D;  1JBC A;  1ZRE A;  1OBN A;  2XBO 1;  1ZVF A;  2ZPX A;  4YZ1 A;  3AYA A;  3RGB A;  1MS9 A;  1VBD 1;  4MGS A;  2HWC 1;  4A7Z A;  3K3N A;  2JDK A;  4QPW A;  2XGX A;  4D94 A;  1Q8Q A;  4QX7 A;  5FYY A;  4BWO A;  1H6Y A;  2ZX4 A;  1HQW A;  4RA0 A;  1AX2 A;  1O8S A;  1W8N A;  2OQ6 A;  2PFW A;  1J3P A;  3PUS A;  4RGK A;  4Y1V A;  3VBU B;  2R06 2;  2C26 A;  3OBZ A;  3P6B A;  1WCQ A;  1UPI A;  1LKN A;  2PHD A;  3Q9O A;  4ITC A;  3LFM A;  2PAK A;  4LHN A;  1XNC A;  1AR6 2;  4WZF A;  1F4A A;  4Q0U A;  3FC0 A;  3JD7 2;  5LK5 A;  1ZRF A;  5F6L B;  1JYW A;  5FZA A;  2RMU 3;  5LEK A;  1UWW A;  2FCU A;  1DZR A;  1B35 B;  5FV3 A;  1GZW A;  3RJ2 X;  1YCI A;  1DLC A;  1CPM A;  4GH4 A;  4P02 B;  1N3P A;  3J7H A;  4QM9 A;  1O3R A;  4AL9 A;  1GNH A;  5JXJ A;  5GJ6 A;  5FZE A;  4HKW A;  4LE4 A;  1H9P A;  2D6N A;  2YDE A;  1W9F A;  1ZZ8 A;  4XF9 A;  3WF2 A;  1G86 A;  1MR5 A;  3K4Z A;  4BU2 A;  4JGZ B;  5JOZ A;  1RUD 2;  2ZHN A;  1QKQ A;  4CE8 A;  2VMC A;  1KIT A;  2QQN A;  3QH6 A;  2RDR A;  3VDD A;  4COZ A;  4DEQ A;  3JBG 1;  2D3R A;  5T54 A;  1MZF A;  3IBM A;  1CAX B;  1GU3 A;  3FHI B;  2I74 A;  1QU0 A;  4Q4V 3;  1W8T A;  1PIV 1;  3B01 A;  2GU9 A;  2RJ2 A;  2ARB A;  3E6C C;  4L11 A;  4NHX A;  5CYY A;  4YW5 A;  3WNP A;  1AL2 3;  3A7Q A;  3LAG A;  3MIE A;  2HWB 3;  3RZZ A;  5JCT A;  2QUO A;  5LB6 A;  1W8W A;  4GD4 A;  3MW4 A;  4Q4Y 2;  5CBL A;  4D6Q A;  3DCQ A;  4EZ4 A;  3VHN A;  5FZ9 A;  1O7F A;  4Q0V A;  2D93 A;  2XQR A;  5GZD A;  4XF4 A;  3ZXA C;  2R6Q A;  4FOY A;  3FHQ A;  4QQ2 A;  3LKJ A;  3WG3 A;  4IGQ A;  1WGP A;  3POJ A;  5FPB A;  4XJZ A;  4XF0 A;  2ID4 A;  5LY1 A;  2CGN A;  1JS9 A;  2FMD A;  3KCY A;  2X5I C;  3OBA A;  4RGG A;  5FP3 A;  1I9R A;  3P3N A;  4OI1 A;  3WF0 A;  3ZYI B;  3CNA A;  5KHG A;  1QJE A;  5C71 A;  3WW2 A;  5CA6 A;  4LBJ A;  1NCQ A;  3ZIX A;  2BJS A;  4JC1 A;  1BLZ A;  1KQR A;  1U5Z A;  5T5L A;  3O1M A;  1XQN A;  3FBM A;  3HVD A;  1YI9 A;  5HCA A;  4EV0 A;  4M0H A;  1C8M 3;  4Q8L A;  3T0D A;  4MSV A;  2XWJ B;  3CJI B;  4BOW A;  4QXB A;  1AF9 A;  2J1A A;  4UXA A;  4AVS A;  4EQV A;  2AH2 A;  2O0O A;  2R07 1;  4FQZ A;  3J8F 1;  2W87 A;  4DIQ A;  5DZF A;  3GNE A;  4LBL A;  2NM1 A;  3AP6 A;  4Z2W A;  3Q8E A;  2FBE A;  3IMM A;  4ASK A;  1CJP A;  1GWK A;  4S2G A;  2R0F A;  1GBG A;  3VBU C;  4LO7 A;  5FUP A;  1ULE A;  1RUJ 1;  4BIF A;  2VNO A;  4XPV A;  4LKF A;  5F37 A;  3R05 A;  4YGE A;  1QGL A;  1A8D A;  1LJ7 A;  4LHK A;  5GAL A;  3TN9 3;  4LK6 A;  2W68 A;  3D3A A;  1VRB A;  1BJQ A;  1YQ6 A;  2XBO 3;  2YC4 A;  1B35 C;  2UWA A;  3KHB A;  3KS7 A;  2ZAH A;  4DMI A;  1VBD 3;  3AZY A;  1V6I A;  4NUB A;  2HWC 3;  4YYO A;  4QPI B;  2WSV A;  1QWR A;  5F32 A;  1I6X A;  4XXP A;  3VBH B;  3AKR A;  3RZJ A;  1FPN 2;  4QKB A;  2P6C A;  1ZA7 A;  4GWM A;  4JGZ C;  2W9X A;  5FPA A;  3RYP A;  3EMR A;  4L99 A;  1QDC A;  2XUM A;  4AFM A;  2W46 A;  3PIG A;  4Y22 A;  5JOY A;  2IFW A;  2PHX A;  3VBO B;  2OA2 A;  4OUE A;  3C7H A;  2LW8 A;  3H0O A;  3H42 B;  4QX3 A;  3WG4 A;  1XXN A;  4XJU A;  4CDU B;  1K45 A;  3UJO A;  4NR1 A;  1UCX A;  2WO3 A;  5A33 B;  4FPH A;  3KM5 A;  4RR3 A;  3POF A;  3AC0 A;  2F4L A;  4BQX A;  1RMU 1;  3S57 A;  1LNS A;  1WMD A;  3RI8 A;  2WFF 2;  4NID A;  4P9X A;  4MAD A;  1JU4 A;  2WJS A;  1JYC A;  1VP6 A;  4XC9 A;  1D2Q A;  2DTY A;  2BP6 A;  2DTW A;  2WZR 2;  3IIA A;  5BNQ A;  1KD7 A;  1PZ9 A;  1LOE A;  3KLS A;  3ZYF A;  3DKW A;  2B45 X;  1W2U A;  5FYH A;  1LOC A;  1T6B X;  1UU6 A;  2DUQ A;  2QQV A;  3GF6 A;  1VBA 1;  3OY8 A;  3HR9 A;  4IDZ A;  4NO4 A;  4PF1 A;  4RHV 1;  2XJU A;  3VD5 A;  1OXC A;  1V6M A;  4ZON A;  3AZV A;  3JBG 3;  3WQB A;  1OFS A;  1UY4 A;  4E9K A;  4YFW A;  1Q43 A;  3OD4 A;  4K20 A;  3LF7 A;  3ZPY A;  1ALY A;  3N7M A;  1YIP A;  3B5L B;  4XQD A;  1PIV 3;  5FYT A;  1W6P A;  4BQ1 A;  2W0X A;  4QGM A;  1KGY A;  1UX6 A;  1SBE A;  4RFT 0;  1MVE A;  1VBE 2;  5A7S A;  4ISQ A;  1LHU A;  1DZQ A;  1RUE 2;  1UZY A;  3EXU A;  1RUH 2;  1LB2 A;  1QHD A;  3POB A;  3KMH A;  2JG9 A;  2E63 A;  3A4U A;  3H7J A;  3EB7 A;  4I0A A;  5GLU A;  5FO8 B;  2WN3 A;  3WDT A;  4IV1 B;  4AQ2 A;  1MEC 1;  3ZN4 A;  2YBS A;  1UKR A;  4YM2 A;  3CJI C;  4HVR A;  1WWY A;  3ZXK A;  1EAH 2;  3L2Y A;  2V09 A;  1PGL 2;  1SBD A;  2WAA A;  3RZL A;  1H1M A;  2KR2 A;  4UF0 A;  3RS6 A;  2LS6 A;  2NZ9 A;  1W8O A;  4QXK A;  2WYS A;  1PMH X;  1OT5 A;  3JCI A;  3BVC A;  2WWJ A;  4R9D A;  5DUX A;  5T55 A;  2ZAC A;  5T5P A;  1SLL A;  5DAP A;  3WNX A;  4ARY A;  2GZW A;  3M70 A;  2RDN A;  5C5T A;  1W06 A;  3E97 A;  3HQR A;  4OI2 A;  2LUW A;  4IW3 A;  1VMJ A;  3OF1 A;  2ZTN A;  4X6Q B;  4LBK A;  4OCT A;  3VL9 A;  4OQ8 A;  3RZK A;  1SPP B;  1VLN A;  3B94 A;  3H50 A;  3MYX A;  1QOO A;  4P5Y A;  1GOF A;  1SAC A;  4WBB A;  5F5I A;  4GQ7 A;  4DS0 A;  5KR7 A;  3WP5 A;  4JZR A;  4TZD A;  1AVB A;  2R07 3;  5CB7 A;  4L2N A;  3WD5 A;  1UPS A;  3J7N A;  3J8F 3;  2GMM A;  4QPI C;  4Y1U A;  2P3K A;  3VBH C;  3I54 A;  5CZK A;  1UL9 A;  4ERO A;  4OHY A;  1QNW A;  2BDR A;  2GN7 A;  2ZX1 A;  1GSL A;  5EYY A;  3R4D B;  5J36 A;  5KHI A;  1RUJ 3;  1UOF A;  4H7M A;  3VBO C;  3DGT A;  4LUL A;  4LJH A;  1ZBE 2;  3VD9 A;  3D0S A;  1LHO A;  4H3W A;  4CDU C;  4IE6 A;  3OPT A;  1Y4W A;  2GC0 A;  3WP3 A;  5IK7 A;  1IKQ A;  1W2O A;  4D6R A;  4XMA A;  5BNP B;  1C3H A;  2RS3 1;  1PO2 1;  2ZGU A;  4QQH A;  3POG A;  1FX5 A;  3UET A;  4CPB A;  4C1X A;  5A6Y A;  1H4G A;  1H9W A;  4B4R A;  2Z2S B;  4R9C A;  1I3H A;  2GP5 A;  5BNO B;  3FWE A;  1PO1 1;  4NPM A;  1YJL A;  4DB5 A;  1UY2 A;  1UIK A;  1DP0 A;  2D97 A;  3A0K A;  3IT8 A;  2R49 A;  2CDO A;  3K2O A;  1SDW A;  5F2W A;  4NII A;  4A44 A;  5A7W B;  3LPG A;  1YNA A;  2JDY A;  4TWT A;  3HPN A;  2O14 A;  2YPJ A;  1L7L A;  1AR7 1;  4XVH A;  2VOX A;  2W1W A;  3CQO A;  3WNM A;  1RMU 3;  3NAP A;  5I0U A;  2XJP A;  1ST8 A;  5FP4 A;  3HEI A;  1IKP A;  3N9L A;  4PQ9 A;  1TMF 1;  2YY1 A;  4AWD A;  5FQ0 A;  2WLP A;  1ZBA 1;  5H9S A;  4YZ4 A;  1N3O A;  4NVP A;  1PMJ X;  2DCK A;  3B00 A;  1X7N A;  4OVE A;  5T5J A;  4RS5 A;  3LOB A;  4D7T A;  1CX1 A;  4Y4R A;  1XSR A;  1VBA 3;  2BTV C;  1VAK A;  2QCS B;  4KGQ A;  3WY6 A;  4RHV 3;  1EUU A;  4CU8 A;  3ITQ A;  5FFO C;  3AKQ A;  3J26 N;  4OHZ A;  3IPV A;  5JI9 A;  2VJX A;  4GWJ A;  1HJG A;  1O5U A;  3D5O A;  5FK8 A;  1FPN 1;  1QJU 2;  3F2Z A;  1ULC A;  4YW7 A;  3ZDV A;  5IVE A;  2W2I A;  4J25 A;  5I0T A;  5FY9 A;  2PHU A;  2VXJ A;  4NRM A;  4FFG A;  2XLG A;  4GH4 B;  4RSU A;  2R04 1;  4B4Q A;  1ENQ A;  3AZX A;  5I8S A;  1N1Y A;  2KM2 A;  5FY5 A;  5A32 B;  4A7Y A;  2RHP A;  5C4W B;  5CFC B;  1LOG A;  4CP2 A;  4NIG A;  2HYK A;  2GNT A;  1J83 A;  4IV3 A;  4AED B;  5FO9 B;  1IG0 A;  4I02 A;  1VE0 A;  4M4R A;  1JYI A;  1MEC 3;  2AYH A;  4PLN A;  4XTM A;  2TEP A;  2YU2 A;  1DYK A;  3RSJ A;  4UWD A;  4I3P A;  4MO3 M;  4N53 C;  1AYM 1;  5CKN A;  2Y0I A;  4COU A;  1ZRI A;  4LBN A;  3EO6 A;  1APN A;  2ARA A;  3GAL A;  3JZV A;  3VD3 A;  1BMV 2;  1NE4 A;  1SLT A;  2J1T A;  3PUQ A;  3AFK A;  1HV0 A;  1YYN A;  2OPK A;  5FZB A;  5GM0 A;  1EYB A;  4Q26 A;  3PL0 A;  3WXP A;  3NNM A;  1MAC A;  5LZ6 A;  3MW2 A;  4C1W A;  1U5X A;  4JDN A;  5BNP C;  4Z2A A;  3VKO A;  3ABZ A;  2R1D A;  4XXA A;  2RV9 A;  3GCX A;  1GOH A;  1TQ5 A;  2W92 A;  4MXW A;  1W3V A;  1UX7 A;  5BNO C;  4BLI A;  4W8J A;  1TEI A;  5FXV A;  5HV0 A;  3SEP A;  4WM7 A;  1O3S A;  1FAT A;  3VHO A;  1DHK B;  2VZ1 A;  4L97 A;  2GC3 A;  2DYC A;  3WNK A;  1NCQ B;  3MID A;  1US2 A;  4EZH A;  1CIY A;  5FMB A;  4NN0 A;  4FTB A;  2D44 A;  2WSU A;  4QAW A;  5J09 A;  3I2H A;  4CEY B;  2KD7 A;  4AF9 A;  1ZZB A;  5F3C A;  1J59 A;  3PHM A;  3DN7 A;  2RS3 3;  1R08 1;  1PO2 3;  2VVD A;  2E7A A;  1V0A A;  4YGD A;  2RMU 2;  1HIX A;  2W1U A;  3NKT A;  3GZE A;  1QJX 1;  3T1L A;  3URF A;  4E4D X;  2OT7 A;  2X10 A;  3KT1 A;  1Y9M A;  1PO1 3;  2VNR A;  4FPC A;  3ZX7 A;  5FMC A;  3THP A;  5A3P A;  1FXZ A;  3TB0 A;  4LKS A;  5JPN B;  5J37 A;  1RGS A;  2QTW B;  3MIG A;  1ZZ7 A;  2XDV A;  5E16 A;  4QQP A;  4AFD A;  3QCW A;  2ERF A;  4YG3 A;  2IWG B;  4OQ9 A;  4IEO A;  2E31 A;  4CDQ B;  4YVS A;  1AR7 3;  5EJ3 A;  2J1R A;  2OVU A;  2RVA A;  2XR4 A;  2YGL A;  2PEL A;  2ENR A;  3LIH A;  5F6K A;  1SHW B;  2VMF A;  1UY0 A;  3MIC A;  4Q4V 2;  1CR7 A;  4GKY A;  4LBO A;  5CG9 A;  3UGG A;  3USS A;  2RS1 1;  1TMF 3;  2B8M A;  2HWD 1;  2Q1F A;  4GH4 C;  1ZBA 3;  4I09 A;  1UOG A;  2Q8O A;  3ETP A;  3ZYB A;  5C4W C;  3UJQ A;  4LOS A;  2HWB 2;  4OYU A;  5EP9 A;  4IXL A;  3U4S A;  1O4Y A;  2V72 A;  4N43 B;  2DBI A;  3LEI A;  2BNM A;  5IFT A;  3M3Q A;  3CHX A;  4AED C;  1F2N A;  5L19 A;  3GZU C;  4NHM A;  2G1M A;  2Q8C A;  1AL0 G;  3HT2 A;  1H0B A;  4Q4W 1;  1OLM A;  1H2N A;  3VBR A;  2WO1 A;  2C0Z A;  1FPN 3;  3S7E A;  3NV1 A;  1S55 A;  2AEY A;  5SV5 A;  2Q8D A;  4RR3 B;  1STM A;  4LBM A;  4S2H A;  1H2L A;  1D4M 1;  2R04 3;  4LXL A;  4Y1X A;  2AZ5 A;  3CMG A;  1KJL A;  2ZKN A;  3KD4 A;  2GN3 A;  4GA9 A;  1RXG A;  4HKO A;  2X53 S;  3LEG A;  3AXE A;  5ANQ A;  1LU1 A;  4X8P A;  3GDB A;  1GUI A;  1UYX A;  1WME A;  4W6W A;  2B7Y A;  5JIA A;  4B3N A;  4C8D A;  1F15 A;  4XIO A;  5IVB A;  3PTR B;  1AHS A;  3N4M A;  1C8M 2;  3V0B A;  1LAJ A;  1AYM 3;  1S0G A;  1ZX5 A;  5FYI A;  4DUX A;  1GNZ A;  3VL8 A;  4E8D A;  2H0V A;  1JZ8 A;  3IN9 A;  4Q1R A;  4L8Q A;  3MFA A;  2WT1 A;  4ZHN A;  5C3Q A;  3POE A;  5GZF A;  5FDB A;  1FT9 A;  4QX0 A;  3ZYR A;  1NCQ C;  4A42 A;  4EN9 B;  1W04 A;  3NJY A;  4XEZ A;  2ZGM A;  2XON A;  1WUV A;  2JG9 B;  2ZAA A;  3K4A A;  4A7K A;  4CEY C;  1XE7 A;  3AB0 A;  1NCR B;  1BCX A;  2Q8E A;  3FHA A;  3UKT A;  1W6N A;  5FYC A;  3TN9 2;  2A6Z A;  4LIT A;  2BRT A;  4AK3 A;  4FTS A;  2CL2 A;  1ZRC A;  3AYC A;  3S0M A;  2XQX A;  4XOG A;  5CFD A;  4AR2 A;  1PMI A;  1VBD 2;  3U10 A;  5K0U A;  4E2Q A;  2HWC 2;  2OII A;  1VAM A;  4OMD A;  3O0V A;  3MPP G;  4B4P A;  5I0D A;  4XQ4 A;  1GQG A;  3T3Y A;  2XUE A;  4GMP 1;  2XJR A;  1SFP A;  1LOF A;  5DUW A;  1JOJ A;  1BEV 1;  5FPL A;  4FOW A;  3P3P A;  4P08 A;  5C3S A;  1W0P A;  1XC6 A;  4JGY A;  3LE0 A;  4I0B A;  4JHT A;  4O9E A;  1EPZ A;  4CDQ C;  3RRD A;  4CP9 A;  1X9P A;  2WT2 A;  1OOP B;  3WIN E;  1H8T A;  1R08 3;  3AVS A;  1WBF A;  2VW1 A;  3AK0 A;  5DAV A;  2QDR A;  4PLO A;  3T2T A;  3GM8 A;  1X9T A;  1QJX 3;  3NV2 A;  3NJX A;  4PIX A;  1Y3T A;  3OCP A;  3PNA A;  4LO5 B;  1EUT A;  1O6U A;  3SH4 A;  5C7G A;  1D4V B;  4PDW A;  3W58 A;  3MIH A;  5FIX A;  4EN6 B;  1WBL A;  1WW5 A;  4QB6 A;  2RE9 A;  5JZG B;  3H9A A;  1SCS A;  4R9A A;  2ZEZ A;  1O59 A;  3W21 A;  5GZE A;  2HKX A;  2BPA 2;  3POY A;  4MHU A;  1LOD A;  1XU2 A;  3DXT A;  1F35 A;  1W8H A;  4G9S B;  2JB8 A;  4XAA A;  2FQP A;  1OA4 A;  2DCT A;  3JBG 2;  4DY5 A;  2YBP A;  2AUY A;  5JI7 A;  3M3I A;  3ZXF A;  3IB3 A;  2OUJ A;  4RR3 C;  4KG0 A;  1G9F A;  3X29 B;  3DKQ A;  1PIV 2;  2RS1 3;  1SLB A;  2HWD 3;  3C7O A;  5EPA A;  5FZ4 A;  1AX1 A;  4OZX A;  3CEW A;  4XFB A;  1GIC A;  1RUI 1;  2IVJ A;  4N7I A;  5I8Y A;  1N1S A;  2D5H A;  1K5J A;  4XZP A;  3VZM A;  4NPR A;  2VD7 A;  3E6B A;  5L9R A;  1SMV A;  2OKX A;  1CD3 G;  3K51 A;  3OUJ A;  2DUR A;  1DQ0 A;  2JEM A;  4Q4W 3;  5DPN A;  5EFU A;  4CA9 A;  3AX4 A;  4XTP A;  1GZ9 A;  3S5Q A;  1BHG A;  3WVJ A;  4Z8B A;  1VBC 1;  3USU A;  1W39 A;  2PAM A;  4WM8 A;  5D1I A;  1OSG A;  5L9B A;  3ZXD A;  3DUI A;  3NAP B;  1JW6 A;  5CVR A;  3UGF A;  1D4M 3;  2VW0 A;  4FFF A;  5ERL A;  3FX3 A;  2A6W A;  1WW6 A;  2ZML A;  3G6J B;  5FQ0 B;  5I91 A;  4N9I A;  4EJR A;  1BXH A;  3N9M A;  1H6X A;  5DAX A;  3FFZ A;  3L2H A;  5BY5 A;  1UF2 C;  5KC6 A;  4LMF A;  4QGN A;  1W9W A;  2JG9 C;  5A7O A;  5I0R A;  3W5M A;  1T2X A;  4EYU A;  4HLT A;  5FRE A;  4CDW A;  1G9D A;  3UNP A;  1ZZ9 A;  1FV3 A;  3FJS A;  5LAS A;  4IL7 A;  3LA7 A;  3PMS A;  4P9J A;  1OF4 A;  3OUH A;  4BQ4 A;  5JSP A;  1R1Z A;  2BUK A;  1BVV A;  3N7K A;  4AHY A;  2E7T A;  4UW3 A;  1KFX L;  3M2M A;  2R07 2;  2D3P A;  3J8F 2;  2E32 A;  5LK7 B;  4NRQ A;  5FKC A;  3TWI A;  1JZ4 A;  4Y20 A;  1IOA A;  1BK1 A;  5FZ8 A;  2XWB B;  4UT5 A;  5BUV A;  3ZMN A;  4XHB A;  2ZEY A;  1DQ5 A;  3WDX A;  1RUJ 2;  2ZJC A;  3ACH A;  1IG3 A;  3TYJ A;  5FZO A;  3ZXL A;  4U36 A;  2PAE A;  2LTN A;  4IV3 B;  2Y60 A;  1OOP C;  5JUV A;  2PA7 A;  3LOI A;  4WVZ A;  2VZO A;  3RFR A;  3PUH A;  4ZS2 A;  4NIA A;  4XBL A;  4FP3 A;  3A21 A;  4ASL A;  1W6O A;  4AGG A;  3SIT A;  1UQX A;  3RWK X;  5FYZ A;  2NP0 A;  3ASI A;  4YM0 A;  1ULP A;  4J6G A;  4B7E A;  2Z79 A;  4GMP 3;  1CAV A;  4ZZ5 A;  2LAL A;  3DF0 A;  3J9S A;  5LA0 A;  3RZM A;  1WW4 A;  1BEV 3;  1NXM A;  5FK7 A;  1OUS A;  1BZW A;  3KV5 A;  3WZ1 A;  5KWR A;  5IWF A;  1V6L A;  1Z78 A;  1GR3 A;  1DGW A;  1ACC A;  2QQM A;  4JTO A;  4NAO A;  2E53 A;  4XIK A;  3ZO0 B;  4XUT A;  2PHT A;  1FOD 1;  2QJV A;  4CXW A;  2Q0A A;  1B09 A;  1EY2 A;  3MGU A;  4N90 A;  3WT3 A;  1JOD A;  2CGP A;  1PGW 1;  2CAU A;  5L73 A;  1RUF 1;  1RMU 2;  3ZSK A;  1O3T A;  2F4P A;  3I59 A;  5DXD A;  3POW A;  5JLV A;  4MXW B;  2DU0 A;  2YFU A;  2RG4 A;  3LZZ A;  3VZK A;  4UBG A;  3HD8 B;  2DCY A;  4CVU A;  4QU1 A;  3DL3 A;  4P9Y A;  4YVW B;  1WD3 A;  5HPO A;  2FZ1 A;  2EF6 A;  3HN3 A;  1VBA 2;  3VBS A;  2P1B A;  1OVP A;  4JKK A;  4LEJ A;  3H7Y A;  1QF3 A;  1NA1 A;  4KU7 A;  4RHV 2;  4FAH A;  1MS1 A;  4K1Z A;  1J84 A;  2XJQ A;  4G4F A;  5HXM A;  4AHW A;  1JH5 A;  1MZ5 A;  1S0D A;  2RR1 1;  2A5Z A;  2W3J A;  3IM0 A;  3PTY A;  4CEW A;  2P34 A;  4LBQ D;  4QDR A;  3O1S A;  2JE8 A;  3NAP C;  4K3U A;  1MS5 A;  1CAU B;  4XHX A;  3ZMO A;  5K9Y A;  2BER A;  2ZHM A;  3M7A A;  1RUI 3;  2VZT A;  3OGR A;  2A6X A;  3HBK A;  1JUI A;  3I3B A;  3TEZ A;  4XFA A;  5K4L A;  4QX5 A;  1UOB A;  3ACG A;  2ZS6 B;  3THD A;  4CUC A;  3QLQ A;  4DUW A;  3OSD A;  2E7Q A;  2ZA9 A;  5J98 B;  3AKP A;  4WVW A;  4FQ4 A;  1HN1 A;  2WNE A;  5HV4 A;  1G7Y A;  2QQL A;  1MEC 2;  4N8M A;  1UY1 A;  4IEZ A;  4KWK A;  4AGR A;  4NIH A;  3ZSJ A;  5LBE A;  2EXK A;  4KWL A;  4YVS B;  1GQP A;  1VBC 3;  2I2S A;  3EHK A;  3IMN A;  3LEM A;  5DN2 A;  3OYW A;  2GC2 A;  4AZZ A;  4Y33 A;  5FP9 A;  4D7S A;  3K46 A;  1F5F A;  2QZ2 A;  3CLP A;  4NWW A;  4OHX A;  4QT6 A;  4E27 A;  5GZG A;  2BWC A;  3T08 A;  4DRV A;  1CQ9 A;  2JG8 A;  2QBX A;  5FAX A;  5FY0 A;  2K9Z A;  3I97 A;  1DDL A;  1WCK A;  2JE9 A;  5BXX A;  4AVC A;  4IV3 C;  3E5Q A;  5HCF A;  1RHI 1;  4C91 A;  5A6Q A;  4F83 A;  1ND2 A;  5D21 A;  4XDP A;  4DUV A;  1XYP A;  3AMH A;  2C9K A;  4LOT A;  4XF1 A;  3FFQ A;  3MHZ A;  4ISR A;  3B3Q E;  1C5H A;  5EYX A;  5DQ0 A;  3T1M A;  3VBR B;  4AE2 A;  3I3D A;  3R4U A;  2IFR A;  2PQQ A;  1HLC A;  4IER A;  5A7N A;  1DQ1 A;  1SLI A;  2G9F A;  2FCT A;  3ZFF B;  1C1F A;  3LPF A;  2DCJ A;  5FWE A;  1F31 A;  2W94 A;  2OZ6 A;  2G4I A;  1X8E A;  2HBU A;  1S1A A;  2JB4 A;  5F3G A;  3NVC A;  2IXC A;  5A3L A;  4QM8 A;  4IEV A;  5AVA A;  4DOU A;  2B42 B;  2VE1 A;  1O5L A;  1KS4 A;  3AYD A;  5F9T A;  1UU4 A;  5FXX A;  2R1B A;  4AI8 A;  2BFU S;  5KHJ A;  2Y0O A;  2EAK A;  5CAZ A;  4HSJ A;  2RS3 2;  1PO2 2;  3MI8 A;  1MS8 A;  2ADE A;  4V1P A;  1D0G A;  3N7J A;  4Q0P A;  5KHH A;  5EJ1 B;  1F9K A;  5A80 A;  3NNF A;  2VTX J;  1PO1 2;  3BN6 A;  1HB4 A;  5HCH A;  1BKZ A;  4YVW C;  2XJT A;  4AQS A;  4F8A A;  3C7F A;  3CKH A;  4AVV A;  3III A;  1W0N A;  2EXJ A;  1FOD 3;  4FOV A;  3VKM A;  1W8U A;  4DXZ A;  3KF5 A;  4D3W A;  1AR7 2;  3BPZ A;  1JZ2 A;  2XL7 A;  1RUF 3;  5A1F A;  2D43 A;  3GHM A;  1PX3 A;  2AGS A;  1XNA A;  2CNA A;  5LBB A;  5C6C A;  4XFI A;  1TMF 2;  4GAL A;  1ZBA 2;  3E6D A;  4HXC A;  3AZW A;  3AKT A;  1S0F A;  2GND A;  3NMB A;  2WNU A;  4Q27 A;  3ZR6 A;  2WIN B;  4UFL A;  2VBP A;  5APA A;  1S2B A;  1WCU A;  3H3Z A;  4NRO A;  4PIZ A;  3I2O A;  2V5Y A;  1W28 A;  1RXF A;  2D6O X;  3AL5 A;  3AKS A;  1LED A;  1TME 1;  3AM2 A;  5F5C A;  1RIN A;  3ZSM A;  1LGC A;  5JIU A;  3BPS A;  2Y6K A;  4YVS C;  5ABJ B;  3NO8 A;  1YQ2 A;  5KXC A;  2RR1 3;  2PHF A;  3WF1 A;  1H8T B;  3CIH A;  2IXH A;  3OGV A;  1RED A;  4MET A;  3DEM A;  2ZX2 A;  1ULD A;  2F17 A;  3IWZ A;  2BBV A;  2BNN A;  4CUA A;  5FLJ A;  2X09 A;  1ZRD A;  2R04 2;  3RYK A;  3RDI A;  5G05 L;  3WHT A;  3RVH A;  2JEN A;  4CP1 A;  5BNN A;  1J1T A;  4QXH A;  3J7L A;  1HB3 A;  3WNN A;  4HFS A;  5KC5 A;  3OG2 A;  3UKN A;  4BM8 A;  4IGP A;  1K42 A;  5JMO A;  1SCR A;  4OUL A;  3VLB B;  1CIW A;  4OHW A;  3MIF A;  2UYA A;  3VKN A;  2Q1Z B;  2FZ2 A;  1OHF A;  3IDE A;  4KG8 A;  1OF3 A;  3ZPO A;  3VBR C;  1SG3 A;  4BIO A;  1AYM 2;  4CU9 A;  1UKG A;  2VUJ A;  4QHB A;  2AEN A;  3ZFF C;  2J22 A;  3ZIW A;  4BXF A;  3BIW E;  2ARE A;  5IHR A;  1WW7 A;  4Y5T A;  4AW7 A;  1PNG A;  4NWV A;  5DUU A;  2IVI B;  1WA6 X;  3Q8F A;  1QH6 A;  3JUU A;  3N3H A;  1N3Q A;  2UYB A;  4F3J A;  4XJ8 A;  1V9U 3;  4ZZ8 A;  1VBB 1;  1RJ7 A;  4H14 A;  1RHI 3;  5IAX A;  3BGA A;  3BOW A;  4A45 A;  4DXS A;  3HAG A;  4RQP B;  1Y9Q A;  2XXZ A;  4NMI A;  1QOS A;  4LQR A;  5I8T A;  3NNG A;  2ORX A;  2OYZ A;  1Q5O A;  2PTM A;  1MQT A;  1R64 A;  4BQ2 A;  1IPS A;  1DQ2 A;  1NY7 1;  1BBT 1;  3VUO A;  3M3O A;  4QMA A;  2VC9 A;  3HNM A;  4XUP A;  1AYN 1;  2UUR A;  2JDN A;  4Y4Y A;  3ZN6 A;  1CZT A;  3BAL A;  4GWI A;  3QOP A;  3JB4 C;  4ZPI A;  3WW3 A;  4R52 A;  4JAA A;  3PVE A;  1QJY 1;  3H1Y A;  3ECQ A;  4Q8K A;  1W3X A;  3GHN A;  3HIF A;  5FYV A;  4M3C E;  4E4H A;  5C9A A;  3O1O A;  3NNJ A;  3ZVX A;  5ANN A;  5JR7 B;  3MFC A;  1GWM A;  4YW4 A;  5IT6 A;  2BVV A;  3WDU A;  3DYO A;  4YGB A;  1L7Q A;  4YRD A;  3WG1 A;  1R08 2;  1ULG A;  1XPW A;  5L9V A;  4BQ5 A;  2FDH A;  4CDX A;  3H8R A;  1QJX 2;  1QOT A;  1PM4 A;  1W2A X;  3OGS A;  3B9C A;  2NN8 A;  2VL4 A;  4Y1Y A;  3ZSE A;  2K0G A;  3AYE A;  4Y20 B;  3T4H B;  2H6B A;  1ND3 A;  2A73 B;  2JIG A;  2DVG A;  5IVY A;  4MV2 A;  1G9C A;  3VHR A;  1CZS A;  3ES4 A;  2FMY A;  1JUH A;  4TN7 A;  1LTE A;  1NQJ A;  1DIW A;  3SCG A;  3WW1 A;  4N53 B;  1BYH A;  1GAN A;  2C24 A;  5D2A A;  2OXB A;  2WLQ A;  1LHN A;  4KBZ A;  1H8T C;  3U1X A;  4OLL A;  3T0A A;  5H9R A;  3NWK A;  2VZP A;  1JYN A;  2ZKL A;  3B69 A;  2VY0 A;  3K77 A;  4OZO A;  1IS5 A;  2RS1 2;  2HWD 2;  2PHW A;  3S30 A;  5A3U A;  4IQP A;  1POV 1;  4YG6 A;  4TLF A;  1D2S A;  3PUA A;  1IPJ A;  4PDW C;  4XZU G;  4HN0 A;  1M06 G;  1HRI 1;  2JDH A;  4FP2 A;  1HXS 1;  4P00 B;  5CIR A;  5JDB A;  3V56 A;  4P5H A;  1MZE A;  4BQY A;  4OI0 A;  4BB3 A;  2WL1 A;  3BTZ A;  1HX6 A;  1KJR A;  1TME 3;  3H3L A;  3APB A;  1YHF A;  4Q4W 2;  2ZEW A;  4XUO A;  1RIT A;  2HBT A;  2QQU A;  2UWC A;  5JAX A;  4JX0 A;  1ZA4 A;  4BH9 A;  5IAV A;  3C3V A;  1E57 A;  1XU1 A;  2VOK A;  2CGO A;  4B1L A;  1PZ7 A;  4BME A;  5CIS A;  4M0N A;  2EAL A;  3RQ0 A;  2JKB A;  2QNK A;  1D4M 2;  2PLV 2;  3CO2 A;  4LBQ A;  2X05 A;  3THT A;  1JZ5 A;  1NXD 1;  1ZNP A;  3V0A A;  3DV8 A;  1G6N A;  4Q0S A;  5ACA 1;  3SH3 A;  4HVQ A;  2VZR A;  5GLV A;  3CL1 A;  2E6V A;  4RD7 A;  2VTX A;  2VMH A;  2WNV A;  3GYD A;  1CES A;  1EPW A;  2GC1 A;  4RQP C;  2WWS A;  3RNS A;  3FUQ A;  4CCC A;  4SBV A;  4D69 A;  3F95 A;  4HT1 T;  3OOX A;  5I0S A;  2B9U A;  4GB3 1;  4FPL A;  2R7E B;  4AEJ A;  4HON A;  2XPJ A;  2E51 A;  2ET7 A;  3OD0 A;  3ZFG A;  1OA2 A;  1DG6 A;  1H30 A;  5T3N A;  2WS9 1;  1NQD A;  2B9V A;  5FRA A;  5FOJ B;  2ZMN A;  3VV1 A;  1OLR A;  2W08 A;  2VNG A;  5JXH A;  1RUG 1;  3ZXJ A;  3V64 A;  1W8Z A;  2XJS A;  5FP8 A;  1P8J A;  3O12 A;  4HKL A;  4Q4X 1;  4AI9 A;  1VBB 3;  4IGO A;  1ASJ 1;  2BOJ A;  4BHP A;  2JEC A;  3UES A;  1ZZC A;  4Q2F A;  4QQO A;  3SKV A;  1OMI A;  2BWA A;  5F3E A;  1GZW B;  1XRU A;  4M00 A;  4MGT A;  1QXJ A;  3N9P A;  4UFM A;  3VGI A;  1RUN A;  2B39 A;  1AXZ A;  1BBT 3;  1DYP A;  4Q5O A;  5E89 A;  1HJF A;  1AYN 3;  3HOB A;  4LNV A;  1OI6 A;  4UW6 A;  4XMI A;  3GXU A;  4UFJ A;  5A1A A;  1QJY 3;  3KZ4 C;  3NKG A;  1BEV 2;  2JDZ A;  3ORJ A;  3VDD B;  4BYY A;  2OPW A;  5LA1 A;  3KT4 A;  3WHU A;  2DFB A;  4AI0 A;  2VTF A;  4CCN A;  2GNM A;  4E2G A;  5I93 A;  4J1W A;  1REF A;  1ND2 B;  1OD5 A;  5FCC A;  5FMO L;  4YW2 A;  4CSW A;  4LKD A;  5JSO A;  4MHR A;  5HCB A;  2VH9 A;  2XJV A;  2WQ8 A;  4PJY A;  4AHX A;  4CCJ A;  5CG8 A;  3QAC A;  2ZGS A;  3M3C A;  3J7M A;  2A3W A;  3WDV A;  4CTE A;  4BK4 A;  3I4I A;  1YO8 A;  5C3R A;  1OH3 A;  4FSJ A;  2DDU A;  3I49 A;  2A1X A;  3O0X A;  5DAW A;  3WG2 A;  1PK6 A;  1VJ2 A;  2WAO A;  4X6R B;  4WVM A;  1KFU L;  5EXO A;  3RZH A;  1COV 1;  4UW4 A;  2K46 A;  4GWN A;  1S4C A;  2CYF A;  5D8A A;  1CAW A;  1POV 3;  4PBP A;  2GNB A;  3O7O A;  1RUI 2;  1PZ8 A;  5EIY B;  3AJY A;  1HRI 3;  2EIC A;  1L7R A;  1HXS 3;  2GSY A;  1DBN A;  3R0R A;  2PN5 A;  3LSD A;  4N9H A;  2X5I A;  3PLQ A;  3O1R A;  4LE3 A;  4XUR A;  3K48 A;  1T6G C;  2P17 A;  4FAG A;  2BVB A;  3VBS C;  1W6M A;  2E26 A;  2ZCW A;  5LRR A;  4TTG A;  2EIB A;  3BYW A;  3OTF A;  4LO6 B;  1FV2 A;  4DXR A;  3DPR A;  1NOV A;  4BXS V;  4MG2 A;  2ZGL A;  2EIE A;  2ETE A;  4P14 A;  1VBC 2;  4M3C F;  4C90 A;  4QX2 A;  5BPX A;  1JYV A;  1G9B A;  2VM9 A;  1UYZ A;  3IKW A;  5IK8 A;  3AMQ A;  4DQA A;  3JQW A;  4KMQ A;  4Y26 A;  1KEX A;  2BOI A;  3AJZ A;  5ACA 3;  2WNU B;  3KGZ A;  5T50 A;  3VHP A;  1HB1 A;  3D6E A;  1LU2 A;  5FLI A;  4PQQ A;  3S5A A;  2YBK A;  3WCS A;  4B8E A;  4P9I A;  2GDF A;  4MGY E;  4QPY A;  5EQU A;  4GB3 3;  3MF6 A;  1J3Q A;  4JTN A;  4QU2 A;  3VBF A;  4FPO B;  1NLR A;  3ACL A;  4CCL A;  4NJ4 A;  2WS9 3;  4XFG A;  5FZG A;  4HBN A;  2H6C A;  3U11 A;  1RUC 1;  2VVE A;  4I3G A;  2VVF A;  3SH5 A;  1RUG 3;  2RDQ A;  4Y22 B;  3VDA A;  1V6N A;  3U75 A;  3ZLI A;  1OKQ A;  3FN9 A;  5LEJ A;  1YQC A;  2JG8 C;  3VDD C;  4Q4X 3;  3H8U A;  5BNN B;  3KVB A;  3SKJ E;  3PDQ A;  2WYF A;  3LD8 A;  3WP4 A;  5AC9 1;  1ASJ 3;  3K75 B;  4KH9 A;  3DXU A;  1GP4 A;  3IDC B;  3MIB A;  2A6Y A;  3MW3 A;  5IAT A;  2VG9 A;  4JGZ A;  1POV 0;  1KXG A;  1W6Q A;  1ND2 C;  3MLK A;  4HPK A;  1RTV A;  2PLV 1;  5EV7 A;  1UNB A;  1RIR A;  4FPJ A;  3D8C A;  3NV4 A;  2FDJ A;  1NX9 A;  1Z0H A;  2P3Y A;  2WNO A;  4AOC A;  1CAX A;  2YFZ A;  2ZOE B;  1JOB A;  2XLF A;  4XJW A;  4OUM A;  2VCM A;  2CY6 A;  1OFN A;  2WC2 A;  3U4X A;  2YU1 A;  3OY8 B;  3JU9 A;  4PI2 A;  2W52 A;  3CF6 E;  2ZGP A;  1HN0 A;  4IES A;  4P9G A;  4AI3 A;  5DG1 A;  3NJZ A;  4QGL A;  3E5U A;  5IK4 A;  4ZU5 A;  5C70 A;  2R16 A;  5FUI A;  3GBW A;  3RWN A;  3MUZ 1;  4SLI A;  1W6P B;  1FOD 2;  3A23 A;  1ULO A;  2BEO A;  1PGW 2;  4FXG B;  4QDS A;  5DDJ 1;  4MOA A;  1YEW A;  3M8L A;  1RUF 2;  2Z5W A;  1MQT B;  2QFE A;  2VMI A;  2VQU A;  4Q1P A;  4W6X A;  4XUN A;  1NLQ A;  3GGL A;  2JD4 A;  2IUW A;  4A6S A;  1HRV 1;  1UMI A;  3H8X A;  2D6K A;  5FBZ A;  5FXW A;  2BZD A;  3LDK A;  4COW A;  3ZFE A;  3KV9 A;  4DFS A;  3T30 A;  4MYE A;  3T2P A;  4LUM A;  3ZYJ B;  5C9A B;  1UO9 A;  3WW4 A;  1KDM A;  1OA3 A;  2D6M A;  4ORF A;  2Y6H A;  1QXP A;  4UF0 B;  3W20 A;  2K2S A;  1C4R A;  5FZC A;  1MS4 A;  2Q4S A;  2RR1 2;  2DWR A;  5C8W A;  5FY4 A;  1COV 3;  4IEQ A;  2D6P A;  4MZU A;  4CDX B;  1OQD A;  4ET7 A;  1GOG A;  2ZGR A;  4QX1 A;  1JMU B;  4BK5 A;  3P5B A;  4ATE A;  4O61 A;  2WII B;  2J1E A;  2WNU C;  3MO4 A;  1Y9G A;  2B4K A;  5A70 A;  4K8R B;  5K7P A;  4FVV A;  3NV3 A;  4LR4 A;  1U12 A;  2VUA A;  3W9A A;  3AMM A;  2QQK A;  4J1X A;  4TSV A;  3I3Q A;  4YGC A;  3D82 A;  3O1T A;  2HWE 1;  1XNK A;  3HNB M;  2CHH A;  4HL0 A;  4D7Y A;  4E4S A;  4EN0 A;  4XE9 A;  1ZZ6 A;  3EBR A;  1RUO A;  1X33 A;  2VMG A;  3I8T A;  1XE8 A;  1DGR N;  1CJD A;  3ACF A;  3SHR A;  1R1A 1;  5BNN C;  1PVC 2;  4FBF A;  3SEE A;  2YC2 A;  2NYY A;  3Q8A A;  1JZ6 A;  1LGB A;  3SCH A;  4H7L A;  1V9U 2;  3Q8C A;  4A41 A;  3OPW A;  2O8O A;  2DFC A;  3C7E A;  1AJO A;  1RHI 2;  4JV4 A;  1US3 A;  4FI9 A;  3AVR A;  3VBO A;  4LA3 A;  4QPG A;  1OPO A;  2BQP A;  1Y7B A;  1S2E A;  2IC1 A;  3MBW A;  5LAT A;  4AGV A;  2JDP A;  5FZ7 A;  4M01 A;  4CDU A;  2XB6 C;  3KGL A;  1UW8 A;  5A33 A;  1RUC 3;  4WZC A;  3KWV A;  4IEY A;  3WQ0 A;  4A2U A;  4FO9 A;  1FNZ A;  4Y24 A;  1C5I A;  4EWD A;  1WLW A;  2Y38 A;  3OEB A;  2YYO A;  4OMC A;  1R09 1;  3LDB A;  1ONA A;  3PVB B;  5A3W A;  5AC9 3;  5HBA A;  5KXE A;  2BGO A;  1FMD 1;  2E33 A;  3JQX A;  1VRH 1;  2LM3 A;  4PLM A;  2PLV 3;  2WUH A;  1LEN A;  4LLO A;  1JHN A;  5LBC A;  3U78 A;  4AVA A;  4D8M A;  2EID A;  1MQT C;  5FOB B;  4OHV A;  1YFW A;  3ZFG B;  2IXK A;  3PME A;  1X50 A;  3LDR A;  2GAU A;  4RS5 B;  4ES8 A;  1DLL A;  1QQP 1;  3SXW A;  4HN1 A;  5DMY A;  3O1U A;  3T2O A;  2HJI A;  1TNR A;  1ENX A;  1RJ8 A;  1UMZ A;  3EJK A;  3VZL A;  2KXL A;  4IE7 A;  5C9A C;  2VZS A;  1AR8 1;  3IPV B;  1PM7 A;  2W91 A;  3M4F A;  1IQD C;  1W99 A;  3AXD A;  2MHF A;  3S6P A;  4DPN A;  4EWE A;  4AI2 A;  5DDJ 3;  4IV1 A;  2UY8 A;  3UGH A;  1ZRR A;  2VOT A;  5FY7 A;  4CDX C;  1C57 A;  2CWM A;  4UI9 L;  3C2U A;  5CAD A;  1HRV 3;  1X82 A;  3U14 A;  4ARX A;  4JQR A;  1UU5 A;  3SCF A;  4NPL A;  4P9L A;  2RS5 1;  2ATF A;  3FBY A;  3LB9 A;  1UXZ A;  5E88 A;  4AVB A;  2CU5 A;  1K12 A;  5EJZ B;  3VZN A;  3FLR A;  2PXJ A;  3ENR A;  1XND A;  1XYO A;  3MPB A;  4Z07 A;  2WBK A;  2H0B A;  4FT8 A;  2X29 A;  1TME 2;  2YG0 A;  1LEM A;  1X8M A;  2XOM A;  4V2V A;  4CU6 A;  5CEH A;  2WFP A;  1LOA A;  5FPU A;  1Q56 A;  1SPP A;  2TUN A;  3AMP A;  4QDQ A;  3VB9 A;  3WEZ A;  1F4H A;  3AL6 A;  4FPE A;  1RVF 1;  3WOG A;  2YMZ A;  4EE2 A;  5CU1 A;  5M0T A;  1DU3 D;  2VZV A;  1GYK A;  3TEY A;  1A34 A;  2A3X A;  3LFI A;  2DVF A;  4B29 A;  3HN1 A;  1W9T A;  3ILF A;  4IEP A;  3T0B A;  1VB4 A;  4KU8 A;  1W05 A;  4JRA A;  3OPZ A;  1QH7 A;  2HEY F;  3AFG A;  2ZEX A;  4O65 A;  3KV6 A;  2XVL A;  3D4K A;  3GCW A;  2DUP A;  2HWE 3;  5GLZ A;  4XCA A;  3ON7 A;  4HAN A;  4BQW A;  1HKD A;  2HYX A;  2ZHL A;  4PCR A;  2EXH A;  4WM7 B;  4AAX A;  1PK6 B;  2Y6G A;  3AP7 A;  2J42 A;  5FZF A;  2ZGN A;  4JKM A;  2HWF 1;  3HT1 A;  4OUS A;  1REE A;  3ATG A;  5D8A B;  2VU9 A;  2Y33 A;  1XBF A;  4K9S A;  4O9G A;  2JE7 A;  1GV9 A;  1NUK A;  1R1A 3;  1E5S A;  3OGG A;  2GP3 A;  2QKD A;  3ZYH A;  5JSR A;  2E9Q A;  3N7L A;  4FOQ A;  4LHS A;  5BNO A;  5DAQ A;  4F7Z A;  1VBB 2;  1YJK A;  1N1T A;  2DUO A;  2WR9 A;  3WX5 A;  1LHW A;  4MGZ E;  2WNV C;  5J3U A;  1W6M B;  3PIJ A;  5HI0 A;  5FXZ A;  3MF9 A;  5E1R A;  1H1A A;  5FY1 A;  1G8W A;  3DPR B;  3TEX A;  5IK5 A;  4HOO A;  2IXJ A;  1FNY A;  3ZFG C;  3WCR A;  1NY7 2;  2VQA A;  1BBT 2;  4RS5 C;  1UAI A;  1AYN 2;  2VQ0 A;  3HWJ A;  2YC0 A;  4RGA A;  4S2D A;  1H8V A;  1R09 3;  1LRH A;  3KV4 A;  1QJY 2;  5FYB A;  4ZY9 A;  4GMP 0;  2XHN A;  2VW2 A;  5CKQ A;  3KVA A;  4YSF A;  1FMD 3;  1NYW A;  1NAE A;  1HQL A;  1UXX X;  3FE5 A;  1L3J A;  1UZW A;  3JXS A;  1VRH 3;  1JI6 A;  5DZE A;  4D6S A;  2CAV A;  1GQH A;  2VAU A;  4LIV A;  1IHM A;  3VBF B;  2YUE A;  1PVC 1;  4I0W B;  3R4S A;  5JOX A;  2F6B A;  3B02 A;  3PVN A;  3LWC A;  4W4Z A;  1OD3 A;  1QQP 3;  1V9U 1;  4Q0Q A;  4KNC A;  4MLO A;  4XET A;  5C33 A;  2RM2 1;  2RJK A;  1LGN A;  2OW4 A;  3S7I A;  2A6V A;  2OQ7 A;  3I2I A;  1UYP A;  1WA4 A;  2VR4 A;  1UZ0 A;  3M1H A;  1AR8 3;  2XHK A;  5C4W A;  4GIQ A;  5A32 A;  1POQ A;  1IZ3 A;  4CCK A;  5CFC A;  2MEV 1;  3KB5 A;  2Y6J A;  3OGJ A;  1QJF A;  4XCB A;  5A6Z A;  4AED A;  3ZOI A;  1IS3 A;  1XJA A;  1W6Q B;  4HPK B;  1EV1 1;  2QQP A;  1QMJ A;  4S2F A;  1J58 A;  2JDM A;  5F39 A;  3H1M A;  2VCB A;  5FO7 B;  1SLA A;  2WO7 A;  5FZK A;  2ZAB A;  4ASM B;  4A4A A;  4XW3 A;  1HRI 2;  2JJ6 A;  2RS5 3;  4K40 A;  1HXS 2;  1SDD B;  3U0Z A;  1MS0 A;  3BTX A;  5F5A A;  1WLT A;  3VDC A;  4LK7 A;  3O0W A;  3PJQ A;  4Z82 A;  3V0B B;  4XYX A;  1WD4 A;  5A3M A;  5IUQ A;  5FUN A;  2G9Z A;  2FDG A;  2J1U A;  4FPF A;  1GWL A;  4ZU4 A;  1A8M A;  5BV6 A;  4WM7 C;  3GBG A;  1PK6 C;  3SQO A;  2BBA A;  3BU0 A;  4I2O A;  1NLS A;  4JDM A;  1BVP 1;  4W6Y A;  5D8A C;  2ORZ A;  1RVF 3;  2A7A A;  1IPK A;  1W0O A;  2B5H A;  1Q8V A;  1GFF 2;  4QKF A;  2EXI A;  2D98 A;  4PIY A;  3RMX A;  2ZGT A;  2QQI A;  5ACA 2;  3B93 A;  4QHO A;  2N7G A;  1W6N B;  3ZFE B;  2HEV F;  1WZX A;  4LHL A;  4LLF A;  4AEM A;  1J1L A;  4FPY A;  2W39 A;  4BCU A;  5FZ3 A;  1GZC A;  5KHK A;  1VMF A;  2C6S A;  5CFD B;  1VR3 A;  3DPR C;  1SFY A;  5FZM A;  3V65 A;  2DV9 A;  4GB3 2;  5FZ1 A;  5K0U B;  5GLW A;  4Q29 A;  2VUC A;  2A3Y A;  4M3C A;  2C5D A;  3SNM A;  1ENS A;  2JKX A;  4CEY A;  3RZG A;  5CFC C;  2HWF 3;  1RB8 G;  2WS9 2;  2DVD A;  2ZGQ A;  3NJV A;  4QX8 A;  1JXN A;  1F5J A;  4CUB A;  1RUG 2;  1S0C A;  4JGY B;  5JVV A;  2MNG A;  1IS4 A;  4L0P A;  4GAZ A;  3I3M A;  4Q4X 2;  4AQ6 A;  4LO8 A;  4HK9 A;  2R30 A;  3WQ1 A;  4CP9 B;  4URA A;  3RJR A;  5LBF A;  1ASJ 2;  1QY4 A;  2Z4F A;  3BI3 A;  1UD1 A;  3KF3 A;  4AAP A;  4CCM A;  3FUO A;  1LEC A;  4Y3O A;  2EAA A;  4RN5 A;  3VBF C;  3E1F 1;  1N47 A;  5H9P A;  3BU7 A;  3ZDS A;  3ILR A;  2DF7 A;  4PDW B;  2OS2 A;  4CDQ A;  1D0H A;  3KQ4 B;  4FFI A;  1JOP A;  2GME A;  5A3N A;  1DYO A;  1ULF A;  1PGS A;  3I2F A;  4A6O A;  4K7J A;  1AXK A;  2CSG A;  2VO5 A;  2VCC A;  3RI9 A;  3VD4 A;  4E2S A;  3I2D A;  1ODN A;  2BV4 A;  1VPH A;  4IEX A;  1O3Q A;  3OBT A;  2FCV A;  5LA9 A;  4N43 A;  2D7F A;  3ALQ A;  3INA A;  2NMN A;  3OJB A;  2VZU A;  1Z7S 1;  1AR9 2;  2I07 B;  3VDB A;  1VAV A;  2DVA A;  1OPM A;  2GAL A;  4XFF A;  3P1I A;  4DEV A;  4BZ4 A;  2FDK A;  1PVC 3;  4QPG B;  5KBF A;  4QQL A;  2ILM A;  4PT6 A;  2WO2 A;  4TYS A;  2IZW A;  2RM2 3;  4FXK B;  5A3T A;  2WZE A;  3FZ3 A;  1FYU A;  4XJA A;  3UK9 A;  2PMW B;  2WZP P;  4XBN A;  2Y6L A;  3L9J T;  4YW6 A;  2ZZQ A;  4CU7 A;  2JXA A;  5IVJ A;  3K3O A;  4KWU A;  4D0Q A;  2MEV 3;  4FPG A;  1W2T A;  4ZU7 A;  3USU B;  4OFG A;  4WM8 B;  3VZJ A;  2P4E A;  3H1W A;  4AG4 A;  1EV1 3;  2BU9 A;  3BCW A;  3MLL A;  3K4D A;  2BYV E;  1YFU A;  4WVV A;  5FPZ A;  2QVS B;  1COV 2;  3VN4 A;  1I5P A;  4DXT A;  5JXI A;  4RYD A;  2NLR A;  3KSC A;  4BMB A;  1HDK A;  4YW3 A;  3ELN A;  3WF4 A;  1FAY A;  3I2G A;  3I7D A;  2Y26 A;  2ET1 A;  4CDW B;  2OX0 A;  3R6S A;  1YWK A;  2C9A A;  1A78 A;  4KBB A;  5GKA C;  4GJZ A;  3ZFE C;  1S0B A;  4E4Z A;  4FTE A;  4QB1 A;  2R06 1;  5FZ6 A;  4YLZ A;  5CFD C;  2LRO A;  4UOJ A;  1JYT A;  1AR6 1;  4HG6 B;  3CBN A;  5K0U C;  1Q8S A;  2FD8 A;  3ZYG A;  1PVX A;  3JD7 1;  3ZXE A;  5J48 A;  2NMO A;  2Y6F A;  1FI2 A;  4DZG A;  2VMD A;  1NCR A;  4WV8 A;  1LOF C;  5FTT C;  1BK0 A;  1NE6 A;  1UYY A;  4XAE A;  2DCZ A;  5B4N A;  1V70 A;  2J1S A;  4JHZ A;  1DGR A;  4JGY C;  1DQ4 A;  2JIC A;  4L9B A;  5HXV A;  5FZO B;  3FMG A;  4XJ9 A;  1H2K A;  4MVT A;  4P9W A;  5C8C A;  1RUD 1;  1GMM A;  2DBN A;  2JDA A;  3T4V A;  4YFZ A;  4XDQ A;  1F8V A;  2JWP A;  3IAQ A;  2ARC A;  3U37 A;  1GP5 A;  1VMH A;  2PQS A;  3LEK A;  3PU3 A;  4YG0 A;  5DG2 A;  1W6O B;  1YI7 A;  5H9Q A;  5IW0 A;  3VKF C;  1XNT A;  3CDZ B;  1V6O A;  1AJK A;  4MGI E;  1V6J A;  2I45 A;  4FCA A;  1W9S A;  4MUV A;  4YZ3 A;  4AHZ A;  1HB2 A;  1DGW X;  1CAV B;  1ENR A;  1OOP A;  4KQ7 A;  4IEU A;  5SV8 A;  5L7O A;  1RUC 2;  1AZD A;  4A3X A;  1HW5 A;  5FYU A;  1HQN A;  2B46 X;  3PUR A;  5J7M A;  5IJR A;  4Q4Y 1;  2VZQ A;  4XBQ A;  4UAP A;  5FMD A;  2VZ3 A;  1TG7 A;  4YPJ A;  5AC9 2;  3PU8 A;  2WZ8 A;  1G9A A;  3UKV A;  4CUG A;  5JZG A;  4BDV B;  2JDU A;  2X8K A;  1XOY A;  4O7X A;  4HMZ A;  3I59 B;  2D3S A;  2LRP A;  2WN2 A;  4QPG C;  2GMP A;  1W2N A;  2VCA A;  5FJH A;  4K1Y A;  4L92 A;  2R0H A;  1TE1 B;  3HJR A;  1LUL A;  2WQ4 A;  3N9N A;  2ZGK A;  4X8N A;  3ZSL A;  1UZZ A;  3HBZ A;  2JIJ A;  4R8H A;  5IVC A;  4EN8 B;  1OUR A;  3VBS B;  2ZHK A;  1NA1 B;  1K5M A;  1TZO A;  1CVN A;  4M4P A;  2ZX0 A;  3RG0 A;  1O8P A;  2P5B A;  4GJY A;  3BIE A;  4WM8 C;  1Z7S 3;  2A71 A;  4CEW B;  5A3O A;  4KWJ A;  4BJ0 A;  1DFQ A;  4LA2 A;  5E6H A;  2NQY A;  3TOJ A;  5DDJ 2;  3T09 A;  1GKB A;  3BTY A;  2YXS A;  5F8P A;  2PYT A;  5FWJ A;  1SFN A;  3OEA A;  4B7K A;  1SZB A; 
#chains in the Genus database with same CATH homology
 3GJA A;  3NNF A;  3OUI A;  4MHR A;  4XCB A;  2JIG A;  4NAO A;  5DAV A;  3GZE A;  3MGU A;  3KT1 A;  3OBZ A;  3EMR A;  4KBZ A;  4XAB A;  5LBB A;  2RG4 A;  2A1X A;  3W20 A;  5DAW A;  2FCU A;  2RDS A;  2V4A A;  3W21 A;  5A3U A;  4BQX A;  4MHU A;  4XAA A;  3GJB A;  4XC9 A;  4BQY A;  5M0T A;  3DKQ A;  5EPA A;  2RDR A;  5EP9 A;  2HBT A;  2G19 A;  4ZON A;  5IAV A;  3ITQ A;  4NHM A;  2G1M A;  4XAC A;  5L9R A;  4XCA A;  4BQW A;  3OUJ A;  4NHX A;  5HV4 A;  4J25 A;  5LB6 A;  2Y33 A;  5LBE A;  5L9B A;  5ERL A;  5EQU A;  2Y34 A;  5DAQ A;  5DAX A;  5LBF A;  4Y5T A;  5LAT A;  4UWD A;  2RDQ A;  5LAS A;  3OUH A;  5IAX A;  3BVC A;  5DAP A;  4NMI A;  4Y5S A;  2RDN A;  5C5T A;  5IAT A;  3HQU A;  3HQR A;  4IW3 A;  2JIJ A;  3PL0 A;  4NHK A;  2FCT A;  3NNM A;  5C5U A;  3KT7 A;  2FCV A;  4Q5O A;  5LA9 A;  2HBU A;  5LBC A;  4ZPI A;  4JZR A;  4NHY A;  4NHL A;  3NNJ A;  2OPW A;  5HV0 A;  3KT4 A;  3NNL A;  5L9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...