3GJAA

Cytc3
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
310
structure length
265
Chain Sequence
b'ANFTFSPEEVARFERDGYIGPVKIFEPEEMTRRWNIIRRQLLDRSLAIYPDSNGKANISNYDRHLDIDLLAEHIMRPEIVDRVGSLIGRNLLCWRSEFFPKYQGDEGTDWHQAATFAHATGKPQIIWPSDEGRPAFIGTITVWTAFTHSTEQNGCLQLMPGTMNYDESAYPMVLKPGEAVIFWSNTMHASLPHTGSKTDYRMGFAARYVPTQVQVYPGTENLTEYGDGINLEKYGAVLTSGVDEYGHNRIARTSQRGYEFVPRQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CytC3
molecule tags Biosynthetic protein
source organism Streptomyces
publication title Structural analysis of an open active site conformation of nonheme iron halogenase CytC3
pubmed doi rcsb
total genus 71
structure length 265
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05721 PhyH Phytanoyl-CoA dioxygenase (PhyH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 3gjaA00
2V4AA 3OUHA 4XC9A 3W21A 5C5UA 4MHUA 5DAXA 5DAQA 5IATA 4J25A 2JIJA 5L9BA 5LASA 2Y33A 3NNJA 4IW3A 5DAVA 2RDQA 4Q5OA 3W20A 2RDRA 4NHYA 2OPWA 2RDNA 2RDSA 2G19A 3OBZA 5ERLA 4XCBA 2FCTA 3HQUA 2Y34A 5DAWA 4ZPIA 4JZRA 2HBUA 3NNLA 4UWDA 3DKQA 5L9RA 5LBCA 4NAOA 4NHMA 5DAPA 5EPAA 4XAAA 4KBZA 4MHRA 4Y5TA 2RG4A 3MGUA 3EMRA 2FCUA 2HBTA 5IAVA 5HV4A 4BQYA 5C5TA 3ITQA 5LBEA 4BQWA 3GJAA 3GJBA 4ZONA 3GZEA 5M0TA 2G1MA 4XABA 4Y5SA 5HV0A 4NMIA 4NHXA 5LA9A 5A3UA 3KT7A 2JIGA 3PL0A 3OUIA 4XACA 5L9VA 3KT1A 3BVCA 3KT4A 2FCVA 2A1XA 3NNMA 3HQRA 5LBBA 4BQXA 4NHLA 3OUJA 4XCAA 5EQUA 5LATA 5IAXA 3NNFA 5EP9A 5LBFA 5LB6A 4NHKA
chains in the Genus database with same CATH superfamily
5FYYA 4Q4V2 4NO4A 4F3JA 4OZOA 2WUHA 3HIFA 5K0UC 3ZYHA 3BGAA 4LULA 4GMP3 3CDZB 1G86A 2ZEZA 4MHUA 5D8AA 3LDRA 1NA1B 1GWLA 4KG8A 1K5MA 5I8TA 1ZRIA 2YY1A 1JH5A 1KFXL 2D93A 4XUPA 4AVVA 3LPFA 2PLV1 2ZOEB 5FBJA 3U11A 4COVA 2ZABA 3DF0A 4NUBA 3ZX7A 2WA3A 1XU2A 1U5XA 2JECA 2VNGA 3KZ4C 2OIIA 4CZSA 5C8WA 3BPSA 1P8JA 4BISA 1A78A 3B02A 3WNKA 2RDNA 3R4DB 4W8JA 2DDUA 2OZJA 3N7LA 4DXRA 5IFPA 4BIOA 3LGRA 1S0GA 2V09A 4OHXA 2QQJA 4S2GA 1MS0A 1AXKA 1EV13 3C3VA 3ZKUA 2OQ7A 4NPMA 4LBJA 5DAWA 5FZ0A 3DKWA 4E4HA 2D6KA 1VALA 1H4GA 4YM3A 2DCZA 3NNLA 1KEXA 1I6XA 1RUE1 4KWJA 5K0UA 1V6KA 1X82A 3RI8A 5LBCA 1KQRA 4FPHA 3RYPA 4AYUA 4B3NA 1AVBA 1W0PA 4GH4A 4W50A 3VBRC 2HKXA 1LHWA 3JCIA 5EPAA 3WVJA 2F6BA 2ZGRA 1JHJA 1XE0A 3FLTA 1JMUB 2ZA9A 1V6IA 2WZ8A 2OUHA 5A3OA 2DVFA 3K48A 1Q3EA 4Q4V3 3CU7A 4Y26A 2XJPA 2YUEA 4XJAA 1DQ6A 2X10A 3CNAA 3H7JA 2O8OA 2HBTA 3L2YA 3CL1A 3LIHA 1SLLA 1W6MB 3MV01 4PBOA 3O1VA 3LWCA 3B3QE 2JG9B 3O0VA 3PHMA 5FK7A 1SLCA 2DU1A 1SBDA 2JG8B 4UFIA 1JXNA 3LDBA 3Q9OA 4XEZA 4ZZ8A 2VNOA 4FAGA 1ZZBA 2HYXA 3OGGA 5FO9B 1OKQA 3PIGA 5GM0A 1WW4A 4LO5B 1BCXA 1HRV1 1RUH2 3OTFA 3ETQA 4GH4B 3GZTB 1J83A 3GZEA 3B00A 4I2OA 4UXAA 1J3RA 4GXLA 4K8RB 4CCMA 4BLJA 4BIFA 3CJIA 4EN7B 3NV3A 1F8VA 1RMU1 3ILRA 2P3KA 4NHXA 2TEPA 1W8TA 1WCQA 5KHIA 4PIXA 3D4KA 3VGIA 1OQDA 2EF6A 2ZZJA 1REEA 1RUG1 3KCYA 1WA6X 3DEMA 4IGQA 2WO1A 4L92A 5LK5A 2WZR3 3U07A 1FOD2 3IB3A 1LTEA 4AGRA 4QPIC 5JZGA 2ZGNA 3BOPA 3KGZA 3HOBA 3MIHA 4OHWA 1N3PA 5I8SA 5JVVA 3RI9A 4BDVB 4LA3A 2JB4A 1NQJA 2D43A 2G9GA 4AFBA 3M7AA 1R082 5JXJA 5E16A 2RR13 1C5HA 2BGPA 4QX0A 4IV1A 1X50A 1W6QB 4Q8KA 4KL1A 4H7LA 2W91A 1CJPA 2VMEA 5I93A 3ZFFC 4IL7A 4L2NA 2RV9A 5BNNA 1U5IA 2DF7A 1GOGA 1UXXX 4RSUA 3GBWA 1BEV1 3HNBM 4RS5C 3AZWA 3OSDA 5H9RA 5A1LA 1VAMA 5FY7A 4CVUA 4FPKA 3W21A 5FYHA 1VBC1 4UI9L 1M4WA 2JDKA 4Q4V1 2EIGA 1G8WA 2QQMA 1W2NA 3E6BA 1RUG2 5D1IA 2WL1A 2OVUA 3AMHA 4EV0A 4EZHA 3O5SA 3WDXA 4FQ4A 1Q8VA 2BNNA 5L9BA 2BBVA 1UQXA 1GZCA 2R062 4CSWA 2I07B 1AYN3 2R041 3ZIXA 4Y1XA 3NNJA 1YQ2A 4PI0A 1AZDA 2GN3A 2R073 2ZXQA 5C4WA 2AR6A 1UIKA 4XFFA 2FQPA 2PXJA 2WNUB 4WVVA 1HDKA 4LE4A 3N9OA 3DXTA 2A6VA 2HWF1 1O6UA 5FMOL 2ZCWA 4LPLA 1LB2A 1WMDA 5FUIA 3T2PA 4XFBA 3VBHA 5FZ9A 3IN9A 4FOYA 4RR3C 3ZXGA 2XUEA 3VDDC 4YZ3A 3FZ3A 4EN9B 1WW5A 4W6XA 3ZSKA 1BVP1 2DFCA 2X5IA 4AK3A 4CDQA 1C28A 2CGOA 4QB1A 4CDXC 3AZXA 1WGPA 3HBKA 4RD7A 3FUQA 3VZLA 4GALA 4JTOA 2BU9A 1FATA 5A7NA 5FY5A 1X7NA 3M3OA 5BNNC 3CZUA 5GLZA 4BCUA 3W5NA 4HMZA 1L7LA 3MLLA 3TN91 1W6PB 1W99A 1DQ5A 2JDAA 3AJYA 3JQXA 5A7WB 4QX2A 1LHNA 3LA7A 4HT1T 5BY5A 3I3DA 1JN2P 2YMZA 3KCXA 4A7KA 4GA9A 1ZBE3 2PN5A 2ZGPA 1OD5A 4QU2A 1HRI2 5D21A 5T5PA 3R4SA 3RMXA 1NKGA 2XG3A 3LQCA 4JCKA 3USSA 1FXZA 4R9DA 5A80A 2BVBA 1AUYA 2RM22 4YW4A 1JBCA 1LCLA 3WUDA 3H3ZA 2HWD1 5FZOB 3B5LB 1GKBA 2XLFA 3SHRA 4YZ2A 5CAZA 4CDQC 2XL9A 3BOWA 1HIXA 2AEZA 2AUYA 3S5AA 3AYAA 3DYPA 1UKGA 3WQ1A 2HWD2 1C1FA 1HQWA 1RVF1 2CWMA 3A0NA 3I3BA 4LIVA 4QHBA 1UZVA 1AX0A 5CEHA 1W8ZA 5SV5A 1X36A 2LROA 3EQEA 4YGBA 1WD3A 4AFDA 4PIYA 2D6MA 5H9SA 1CZVA 4QPGC 1RHI1 3IM0A 4QPIA 1XNTA 5A6YA 4LA2A 3D6EA 2I2SA 1UMHA 4BPZA 5ANNA 4CUGA 4NIGA 4TN7A 1IOAA 3GYDA 2ET7A 1G9BA 2BOIA 1Q5OA 2K2SA 4XJ9A 5CVRA 2J1AA 5BPXA 1ALYA 2P34A 1R1A3 2AH2A 3K46A 1FMD3 3LA3A 3SISA 4B7EA 2QKDA 5FZ4A 2J1SA 5HCHA 2FDFA 2AZ5A 1ACCA 1PO12 2IWGB 4FOWA 4HVQA 5B4XA 1QJEA 1VLNA 2JXAA 2RM21 2XVGA 1EPWA 3B9IA 2Y64A 2GP5A 4IV3B 2WBKA 4NAMA 4RHV3 4UW5A 1T6BX 5J7MA 1PO21 2NLRA 1Y7BA 1MEC3 4P9YA 3ZKYA 4F7ZA 3AKPA 5FLJA 4DO0A 2VOKA 1R092 3THDA 3OG2A 3SCHA 4LJHA 4PQ9A 3AKSA 4Q1RA 5FYMA 5HCFA 5I0UA 4AZZA 5T54A 1S0DA 3C7EA 2YC4A 4LOTA 5A7WA 4XFIA 1SDDB 4UF0A 4AHYA 2A6XA 2UY9A 3MDPA 2P6HA 5F9TA 4GZ9A 1DDLA 1FPN2 2R30A 4ARXA 5FO7B 2YGLA 3WD5A 1WZXA 3GM8A 4XJWA 4GKXA 4PLNA 3ZSEA 1O8SA 2WR9A 3IMNA 4JGYA 4OMCA 2IXCA 3IT8A 3ZDSA 5JR7B 1PO13 5CKNA 4MX3A 3AL5A 1ULGA 1H9WA 3VKFC 2JEMA 4D8MA 4BXFA 1R1A2 2ZEYA 3T0BA 4URAA 1RVF3 3KHBA 2VG9A 4G4FA 3VBSC 4LK6A 3E6CC 3N7JA 4XHBA 1QNWA 2IXHA 3WW3A 4DEQA 3BYWA 3J7MA 1HX6A 1BZWA 4UBHA 4BHPA 2DUQA 1PZ8A 1RGSA 1W6NA 1PX4A 4GMP1 3THCA 4O7XA 3MGUA 3MW2A 1YIPA 2R061 4IEOA 2VL4A 3IAPA 3VD4A 5A6QA 4ZS3A 2KA3A 2ZX0A 4GWNA 2VVEA 3ZDVA 3UJQA 4COYA 1DYKA 3CF6E 4PLMA 4MXVA 1IG0A 1V6JA 5FRAA 5CFDB 2EXHA 1I3HA 4Q8LA 4S2HA 1MZ6A 3IIIA 5FPZA 5J48A 4OCTA 3AZVA 2I45A 4XUNA 5BNQA 1VMHA 4CCKA 2EXJA 1SLTA 1PZ9A 5CNAA 2LALA 1UWWA 1NCRB 4HK8A 5E8AA 5F5AA 5C3SA 5HXMA 5KHJA 2B9VA 5EJZB 4JKKA 1RVF2 4OVEA 4RYDA 2B39A 4XFGA 1ODMA 1YO8A 3ZYBA 4AE2A 1FX5A 1URXA 4YYOA 2JIGA 5DZFA 3EJKA 5FJKA 4I0AA 1V6NA 2PELA 3L2HA 4C90A 2A3XA 1AR62 3POEA 4UFHA 5I0RA 4I30A 1H4HA 2W68A 3MICA 3Q8EA 2WO7A 1SCRA 2WSUA 4QX7A 3ZSMA 4IEVA 1ZVFA 2AYHA 4WVZA 1Y3TA 2WJSA 5K0UB 4GAZA 1ODNA 4IEYA 3V0AA 2W87A 3WXPA 4YG6A 1GV9A 1RUC3 5C33A 1CX4A 1R083 1H1AA 1TMF1 4ZZ5A 1M06G 2B7YA 3RMYA 1KDMA 1ZZCA 4TSVA 4ONUA 1H6XA 1VBA1 2VH9A 1F4HA 4B4QA 4HLTA 4V2VA 2PQSA 4B8EA 2JE8A 3WW4A 1VP6A 2H6BA 4B1LA 3U37A 1JZ2A 4XF3A 2CYFA 4LKFA 3VHRA 2AENA 5FY0A 2W47A 4W6YA 5CFCC 1GWKA 2IFWA 4N8MA 1RL3A 4BQ4A 2IVIB 4D6RA 1K3IA 4XURA 1BVVA 1GP4A 1HKDA 3TNQA 2EALA 3ZXLA 2VMGA 3MZHA 5KC5A 1VB2A 3LKJA 4YGCA 4WM7A 2RS32 1YHFA 4YLZA 1HN0A 1AR91 5FPUA 4BJ0A 5A3PA 1RIRA 3CJIC 1RUOA 3VBHB 5JI9A 1W2TA 3HQXA 5KHKA 4IW3A 3KV6A 4S2DA 2VCAA 3DPRB 2QDRA 3OBAA 3ZYJB 4FAHA 2EIBA 4JV4A 1J3PA 3ZXKA 1RB8G 2RDRA 4XOGA 5FYCA 2VOWA 4IERA 1N1SA 2ZHMA 1IS5A 3IPVB 4PHZA 5FOJB 2YBPA 4ISQA 3I7DA 4Y4YA 5IK4A 5AFEA 3QLQA 1YJKA 3O1SA 3LA2A 1VRH1 5FP8A 1BEV2 1H8TB 4QKDA 2P3JA 4M01A 1BK1A 2R072 1MZEA 2EICA 5DABA 2RM23 1COV3 1W9TA 5FLIA 5A32A 3I2KA 3TEWA 4DS0A 1G9DA 5JIUA 1QDOA 4AI2A 2IC1A 2WYFA 3K51A 2D97A 4C1WA 4N53C 1OD3A 4A42A 1K5JA 1RUD3 2WNVC 3AZYA 4Y5TA 1O5LA 3S7EA 3AP9A 2Y6FA 4LLOA 2JE7A 2ZHKA 5JDBA 2VTFA 4LOSA 1QXRA 1ZRRA 3L9JT 4KU7A 3DL3A 1X8EA 2HEVF 3A23A 4BQ3A 4K8FA 4LLFA 4YVSC 4DY5A 3PNAA 1NAEA 2YROA 4XIKA 5D8AC 2DU0A 3ECQA 4QXBA 5F3IA 4ATEA 4EWEA 1H6YA 4LBQD 5JUVA 1PIV3 1H1IA 5JXGA 2R49A 2ZMNA 5E1RA 1J1LA 4R8HA 5EJ1B 3KCCA 4YW3A 1RUI1 1DGRA 1UNBA 3ATGA 5FYVA 2BPA2 2CWSA 2XVKA 1W9WA 3VHNA 3UJOA 3WNXA 2XQRA 1BBT3 2FHRA 1RUI2 1J59A 4FBFA 1QOTA 2HWC3 2FDIA 1D4M2 3I59B 4LQRA 4PQQA 1QJX2 4QX5A 3CLPA 2XLAA 3MF6A 4N9IA 4KQ7A 2PAMA 3MHZA 2DVDA 2NZ9A 2VNVA 2EIDA 5FP7A 4CP9B 4RS5B 5DPNA 1GYKA 3RZGA 4YFWA 1ENRA 3VL8A 2L9LA 4PBPA 4XF0A 2EXKA 4AI8A 4Q4W3 1HW5A 5FZ8A 5JMOA 1JYIA 4LITA 1GZWB 1E5SA 3AC0A 4CA9A 4M3CE 4NROA 5A1AA 4WV8A 3IIAA 2VJXA 4IE6A 4RFT0 2HWE3 2ARXA 2JG9A 4LKSA 3WP3A 2VMHA 5BNPB 4COWA 1N1YA 2VW2A 1UYYA 2H6CA 4GQ7A 2VW1A 3AFGA 4LUMA 4TYSA 5GALA 1RINA 1JHNA 2QQLA 4INDA 4PF1A 2VOVA 4DFSA 3VBOB 1AL22 2IVJA 2E53A 1K45A 5FXXA 4DOUA 4PLOA 3LZZA 5LK7B 1PMJX 2PHXA 5FZ1A 2NMOA 3ORJA 1E5IA 4UYBA 4CEYA 5T5JA 3G6JB 4HN1A 5T50A 4GJYA 4UW6A 2YU2A 1OLMA 1SLIA 3VDDB 5CU1A 5FUPA 2Q4SA 1VMFA 3ILFA 4J6GA 4ZXEA 3LEGA 4Q29A 3PVBB 4PT6A 4DUXA 3UKTA 1ZBE2 5FPXA 4ES8A 3MI8A 2YFUA 4OI4A 3VDBA 4SLIA 2W5FA 1AJKA 2XKPA 4Q4X1 5KXEA 1UY2A 2G9ZA 3CHXA 4MSVA 1GQGA 3RJ2X 3KV9A 1UD1A 3SH3A 4M3CA 2ZAHA 3P6BA 2UWBA 3X29B 4WM8A 2VO5A 5FMDA 1KS4A 4MH0E 1CQ9A 1Q8QA 1X9TA 2A73B 3OD0A 4CDUB 1VRH2 2FDGA 3PMEA 3TEZA 4QXCA 4JZRA 1K5MB 1GUIA 1OFSA 5LY2A 3UGFA 5FZBA 3O1RA 1QQP2 3ZFEA 1C3HA 4RFRB 2QQVA 3WLUA 1YJLA 5G04L 2A71A 1MQTB 1RUF1 3ZO0B 3P5BA 2CY6A 1HRV3 1KXGA 1C4RA 1OSGA 3TWIA 3B7MA 4XFAA 2RMU1 3SXWA 4FPYA 3S30A 3RZKA 1H1MA 3AKTA 5IAVA 4CP9A 1H8TA 3T0AA 4XF1A 1ASJ3 1DBNA 1V6OA 1IPSA 1WLCA 2P37A 3OYWA 5DG2A 1GSLA 5FY8A 1W2AX 3WCRA 2UWAA 2GSYA 1LHOA 1LNSA 2Z4FA 1LOAA 2ZS6B 3DUIA 4GB33 4RN5A 3I59A 1AR61 5FPLA 5A7PA 3ZSJA 1GR3A 1VBE3 2D6NA 2P4EA 3HN3A 4FT8A 3N7KA 5FZ7A 2WS93 3ZSLA 2X53S 3GJBA 3RNSA 1WW6A 2VMIA 3RYKA 1L7QA 3TNPB 2RS33 3VBFA 2GMPA 1UZZA 2GNDA 1XBFA 2JDNA 3GHMA 2PFWA 1VRH3 1MQTA 1VBD2 2AC1A 1VE0A 3PIJA 3POIA 4ISRA 4IETA 4AHWA 3PVOA 4DUVA 5I0SA 4GMP0 3ZFEB 4LBMA 4ZU7A 4X6RB 5A3UA 2Y8KA 3BIEA 2C5DA 4P14A 2AREA 3VKLA 2B5HA 3NMBA 2X29A 3C2UA 2QQKA 3BVCA 5J96B 1UX7A 4UW3A 2YC0A 5FZOA 3E1F1 4CYDA 3HQRA 2JD4A 1US2A 2WN3A 3CQOA 4OUEA 5BNOC 5DMYA 5F2WA 2OQ6A 3BB6A 3OGRA 4DPNA 2JKXA 4GJZA 5E6HA 1AR71 2BRTA 3ZFFA 5FXVA 3CJXA 2W0XA 3TRSB 4JVAA 5IATA 4AVSA 3POSA 1S0FA 2VZPA 2WQZC 4AEKA 1F4AA 1A8MA 4YW6A 4UFMA 1LOCA 1UAIA 4YWAA 5JOXA 2WZR2 3NJYA 4KBBA 3FHQA 4CXWA 3I3MA 4D3WA 1UY0A 2F17A 2SBAA 2QQWA 2R6QA 1PNGA 3FWEA 2RS51 1OF3A 3SEPA 4A6SA 2ZGMA 3UESA 1G9FA 2ADDA 1AHSA 5FMCA 2VOXA 4YW1A 4CU8A 2B9UA 5L36A 4OMDA 2ZMKA 3NKTA 3BALA 4XZPA 4CU6A 4YNIA 4N43C 5DAQA 3I4IA 1ENSA 4P08A 1V6LA 2BEOA 3C7OA 1CGPA 1K12A 5ACA2 2PQQA 2VZVA 4ITCA 3E5XA 5K8SA 1ULDA 5FO8B 1EY2A 1MACA 4QX1A 1RUH1 3ENRA 5FZDA 1N3QA 2DV9A 1CAWA 5FUNA 2DCJA 2AGSA 1CAWB 2TUNA 4QGMA 4HN0A 4HXCA 5EZWA 2FBEA 3BTAA 2E6VA 3FC0A 2Y6GA 3P3PA 3BIWE 3EBRA 3RGBA 3MUZ1 1COV1 2ZGUA 1SBEA 1UKRA 4MYEA 3NW4A 1NCQA 4R9AA 3ZFGC 3WG1A 3F95A 4P9JA 2PAEA 1O91A 3U1XA 1POV1 3LEKA 1NX9A 1DLLA 4FXGB 4UFLA 3KLSA 1SPPB 1ZZ6A 3D0SA 4XAAA 1DZRA 2VBDA 4XQDA 5FV3A 3RDIA 4XILA 2MNGA 5J98B 1SDWA 3M3EA 3PVEA 1OF4A 3DYMA 1JOBA 2R1DA 3PMSA 2GC1A 3A4UA 1N3OA 2VUJA 4B7KA 1VAKA 2BVVA 4MADA 4XQWA 4BZ4A 2JDPA 4CUBA 5LBEA 2BV4A 5ABJC 5DUWA 1GP6A 1EYBA 2W94A 1W04A 4ORFA 3VV1A 4V1PA 2CV6A 2X05A 2BWCA 3WNOA 1ULOA 3SCFA 4B4PA 1XNKA 3NKGA 4UT5A 4PF5A 3N4MA 1SPPA 5L7OC 2NYYA 3ASIA 3VBRB 4XHXA 1BBT1 5IVYA 3ACLA 1PK6B 3ZM8A 5C8CA 1POQA 2YHJA 1H2MA 2GDFA 2RS12 1VBB2 2WWJA 5AC92 1UMZA 3MBWA 3RZHA 3AM2A 3LCPA 4M00A 1NLSA 2ARAA 1Q8PA 1KITA 2GMEA 3TB0A 1KDKA 2A1XA 2ORXA 3ZN6A 3HD8B 3FL7A 4M0NA 5CB7A 5C6CA 1KJRA 2XJQA 4IV3A 5JWPA 1AL21 2PHTA 5H9PA 4NHLA 2BDRA 2YBKA 3NO8A 3VHPA 1JI6A 4Z1VA 2B45X 2BQPA 1DZQA 5KXBA 1OBNA 1H2LA 4GB31 2A75A 3ES1A 1CVNA 1GZTA 3DECA 4KG0A 1W0NA 2H0BA 3POBA 4AQSA 4NIHA 2CDOA 2YPDA 2P3IA 3QBQA 5EP9A 3H8UA 1MVEA 3IKWA 1ZBE1 5KHHA 1PGW2 2UWCA 2K9ZA 1OXCA 4E4DX 2HEWF 2Y38A 1YLLA 3RJRA 1QOOA 3O1UA 4QPIB 4OQ9A 5AC93 1OH4A 2ET1A 4P5HA 4XC9A 1MS9A 1H8TC 4DXSA 2Z79A 3UKVA 3AL6A 4AWDA 3I2DA 3M8LA 4CEWB 1E57A 4XFCA 4XFHA 1CPNA 1NLQA 4UFJA 3TN92 1BKZA 5GZEA 3ZFFB 2G9FA 4YM0A 3POJA 2A6ZA 4LNVA 1Z7S2 1RXGA 3ABZA 4QGLA 3OBTA 2WNVB 3WDWA 5HXVA 3OY8B 3JXSA 2LW8A 2VMFA 2WC2A 4XAEA 1B09A 4TLFA 4AG4A 1CAXB 2UY8A 5CBLA 1ZA4A 2A6YA 2E7AA 2WFF2 4BOWA 1O3RA 1FMD2 2EA7A 1Q43A 5D8AB 3KHCA 4M4PA 1VBD3 2JKBA 2Q0AA 5HCBA 3T2OA 3MW4A 1NE6A 4AVBA 5F8PA 1U12A 3RSJA 4AEMA 1N1TA 2W92A 2R1BA 2WT1A 2PHRA 5DAPA 2BERA 1W2UA 3FN9A 1BEV3 4QAWA 2WS91 4JTNA 5T55A 4AEJA 4Y20A 3K75B 1FV2A 3DCQA 4C91A 2K0GA 3DGTA 1QJU3 2FCUA 2J1TA 4CUAA 1BJQA 1SQ4A 4K3UA 4YG3A 1S0JA 3ROUA 5AFBA 1CJDA 2V5DA 4NE9A 4QQLA 5FPBA 1F35A 4RR3B 3WF1A 1CD3G 1V0AA 1I1EA 3B01A 5T5OA 3J7NA 3ZXAC 2C9KA 3RWKX 3IAQA 2R32A 1UPSA 3URFA 5A33B 4HL0A 3RZZA 1GZWA 2XVLA 1WMFA 5ISLA 4LXLA 3SITA 3N36A 4EN8B 1X9PA 1UU4A 2ZGTA 2ZJCA 2D3SA 1DGWX 3ZMNA 4Q4X2 2KXLA 2Y60A 3E5UA 4Y5SA 1UMIA 4GD4A 4HFSA 4QU1A 4YM1A 3VL9A 5IVVA 1XOYA 2VU9A 5BNPC 2DUPA 4CDUA 1XPWA 1Y43B 4FVVA 2OW4A 2VULA 2B8MA 5FZMA 4AF9A 3KT1A 1JYXA 5JSPA 1TQ5A 3T1MA 4R9BA 1O59A 1XYPA 3RYRA 4O65A 3WG3A 3CKHA 3KQ4B 3WNMA 2VM9A 3AKQA 2HYKA 2WLPA 3H1WA 1H2KA 2LUWA 4FPFA 2IXKA 2VW0A 2VUCA 4ZU4A 4R4XA 3UNPA 3LSEA 3O12A 4FP2A 4AEDB 5IVCA 4CCDA 5C3PA 4DRRA 3D3AA 2O0OA 2WABA 2J7MA 2YU1A 4MG2A 2CU5A 2PAKA 3B9CA 4CDQB 5AVAA 1Z78A 2W1QA 5FY9A 1ASJ1 1R1ZA 1ST8A 2VMCA 4P9GA 4KGGA 4CCOA 2LRPA 4DZGA 4Q4Y3 1CR7A 1HB2A 3AMNA 4L9BA 4EN6B 1VBD1 3KM5A 4NOTA 2CSGA 1AR63 1PO23 1VBE1 2A70A 4QDSA 4QPGB 4Z8BA 3PVNA 1F5FA 1WCSA 1HRI1 3KMHA 4LORA 1R091 3V56A 1SFYA 4N9HA 4XIOA 3J7HA 3HT1A 4BQ1A 2PTMA 3VBUB 4DXTA 3VD3A 4XXAA 1X33A 3IWZA 2OX0A 3MIDA 2NP0A 5EIYB 3MIFA 2P17A 1RUE3 1AL0G 1YC61 2W1SA 3TOJA 2BZDA 5FPAA 3OEBA 1RUF2 1ZM1A 3WNPA 4IV3C 2BFUS 2FZ1A 1TMF3 2WYSA 4CDWB 1NOVA 4MGTA 1PM7A 1RUC1 2RS13 4H14A 3VZKA 3WF3A 3VB9A 1JOPA 1RUE2 2TBVA 2VGDA 2Y34A 4A4AA 4LBQA 3ZR5A 4BMEA 5FZHA 1E5RA 3VBSA 2VNRA 1AR83 1ENQA 2Q1FA 2UURA 5F1RA 3KB5A 4MGYE 5LZ6A 2YV8A 4UWDA 5CG9A 3AJZA 1ZNPA 3T08A 1IG3A 2Q8CA 5IVBA 3EB7A 4CCNA 3OEAA 4IEUA 4FTSA 4AI0A 1CAXA 2Y6KA 1AYM2 4Y33A 1WCDJ 3I97A 4IE4A 1EV12 1Q56A 2PMWB 1UY3A 2YZ4A 3NSTA 3ZFEC 1XYNA 3ZYIB 5ACA1 1KRIA 1MEC1 4XXPA 4B4RA 1RXFA 4ASKA 1QGLA 2RJ2A 1UCXA 1IS3A 4D7TA 4KWUA 2C26A 2XBO1 3VDCA 1GICA 3VD7A 2CNAA 4NR1A 4RGAA 3SLIA 1H9PA 4WVWA 3CMGA 4LIUA 4CTEA 2J22A 1LODA 3V0AB 3H50A 2VY0A 3PUHA 3D0JA 4KMQA 1IQAA 5FQ0A 1RMU2 2ZX4A 3FFQA 5DUVA 3VLBB 4V2WA 4NIAA 2OPKA 4QGNA 5F5QA 2WDBA 2DURA 4BB3A 1AR82 2G1MA 1YUDA 2D7FA 4X8PA 1W0OA 1XB9A 4YPJA 4FPJA 4IUGA 1CONA 5GKAC 1B35A 3GBFA 3OGSA 1PGL2 2KR2A 1UOBA 1JZ6A 1NCQC 2DCTA 1QWRA 2DYCA 4FPLA 1EP0A 2QQIA 3POWA 1R081 1GFF2 2ZACA 2ENRA 4MXWA 5FMBA 3THTA 1QH7A 1EAH1 2Q8OA 3VBFB 3PLQA 2IXLA 2QQOA 1UIJA 3IDEA 5LBBA 4FO9A 2RJLA 1NCRA 4R52A 4BA6A 1UYZA 2LTNA 1JUIA 2VZUA 3QACA 1XE7A 1VBC3 4XUQA 2JDZA 3GCWA 5EQUA 1LGCA 3KD4A 2GMMA 3AXDA 4P00B 4X6QB 4NIIA 3RQ0A 2VVFA 3CZJA 2HLEA 3MW3A 1VRBA 3DN7A 2BGOA 2OA2A 3IDBB 3EO6A 3AVRA 3NWKA 3MLJA 1ZZ8A 2VMDA 2QDNA 5LBFA 1PGSA 3C7FA 3ZPOA 2D5FA 4QKFA 2O8QA 3MEPA 1O4TA 1JOJA 1LU1A 1MS4A 4WM8C 2JDMA 1HXS3 2ZGKA 1NZCA 1L7RA 1S1AA 4KI5M 2XB6C 1O4YA 1VBB3 3C7HA 4M0HA 4D0QA 4DEVA 1OT5A 1SEFA 1UPIA 1FYUA 3HBZA 3HNMA 4CPBA 5F5IA 5IJRA 4D6SA 4C0BA 1LECA 1AYN2 1SLAA 2RR12 1NQDA 2ZTNA 3NAPC 1QQP3 3M2MA 1GU3A 1CIYA 1GNZA 5FJHA 3VZJA 4QMAA 3U0ZA 4L8QA 4HPKB 4BE3A 5FYBA 4D6QA 1OA3A 1YI9A 1YWKA 4E2GA 1O3SA 2WLQA 1YQ6A 4FFIA 3W20A 1DQ4A 1KS5A 2XPJA 1AL23 1ZRCA 5H9QA 4OI0A 2OPWA 2VECA 1YQCA 3WR0A 5CISA 3RPQA 3H7YA 4BM8A 1UO9A 2ZKNA 3H3LA 2QNKA 4YZ4A 4XCBA 4UAPA 3I2JA 5CFCB 4LTAA 4BU2A 5ABJB 5LA2A 1JZ7A 1YYNA 2ERFA 1W8WA 1SCSA 1W9FA 2ZEXA 3ZIWA 1ZBA3 4JDMA 5BUVA 4FPCA 3VD9A 3Q8CA 2EAAA 4A6OA 5ANQA 3WP5A 3CJIB 2GN7A 4PJYA 3TAYA 3VBHC 1BMV2 1R093 4A7ZA 1ZZ9A 2PHUA 2BW8A 1MS8A 3VKMA 4A45A 2QUOA 3CBNA 1WLTA 2GC0A 2CGNA 1RC6A 1GWMA 2ORZA 3P3NA 2D98A 3BN6A 1QMJA 5BNPA 1D4M3 4YGDA 3UK9A 1BLZA 2OKXA 1QJU2 1OVSA 2VUDA 5C9AA 1DG6A 5HBAA 1XNDA 3J8F2 5FKBA 3SCGA 1TE1B 1HQLA 3WEZA 2PHLA 3WW2A 2VZTA 4EWAA 5JXIA 3WZ1A 1CPMA 3J8F1 1W6NB 3UT0A 5TSWA 4JKLA 4RS5A 5IK5A 2QJVA 4XF4A 2HWF3 3MPPG 4LHKA 4K1ZA 4FOQA 2D6LX 2RVAA 3NV1A 4MO3M 1AR81 4H7MA 1JW6A 3AKRA 1NXD1 4E9KA 5JOYA 2XJSA 2WT2A 1BQPA 1ASJ2 3NJZA 3MYXA 3ETPA 4YVSB 3TEYA 4OHYA 2HWE1 1PO22 1QJX3 3KV4A 1ZREA 4XDOA 1AX1A 1C5IA 2PHWA 4JGYB 4OHVA 3R6SA 1C8M3 3M4FA 1FPN3 1LKNA 3NQHA 4TTGA 4QHOA 3FX3A 1W3XA 2G4IA 4OUSA 4YM2A 5EYYA 1EAH2 4CRQA 4BK5A 3OUJA 1TNFA 1Y9GA 2ZHNA 3N9NA 1DFQA 1COV2 4QPYA 4CCLA 2A3WA 5JI7A 3WF2A 5LRSA 5IAXA 1DF0A 3PJYA 1C8M2 3GF6A 4HKLA 4OI1A 5FZKA 4LHNA 3GALA 3K4ZA 4IE0A 5KWRA 2WAAA 2SLIA 4AGVA 5F3GA 2C24A 3LD8A 1OUXA 4MGQA 4KNCA 1TNRA 4EJRA 1KD7A 3WV6A 2XJUA 3UGHA 5JPMB 3U10A 1WD4A 4UBGA 1JZ5A 2VC9A 3A7QA 5GLWA 2V5YA 3MO4A 2P3YA 2XKOA 1MR5A 1UU5A 5F5CA 3SH5A 1RUJ3 5FXZA 3SKJE 4HONA 2ID4A 5K7PA 3K3OA 4JDNA 4XJUA 1QIQA 4PIZA 4FI9A 4MUVA 1S0IA 2VE1A 5FCCA 5FYUA 3OPWA 1PMHX 1KGYA 4FQZA 1TEIA 3O0WA 4XTMA 3VBOC 1CIWA 2XR4A 4XW3A 5GJ6A 1OFNA 4L11A 4YSFA 4PDWB 2WWSA 4Y24A 2A7AA 1EUTA 1MZ5A 1YEWA 2C4XA 4WM7B 5ERLA 1QJY3 2BFUL 4Y22A 1DCSA 1D0HA 1BYHA 2WZPP 3IMMA 2JENA 3DYOA 1SHWB 5C8CC 2IXIA 3U14A 1QJX1 1N47A 4JKMA 2OT7A 4C1XA 4DXZA 4EE2A 1MZFA 2YG0A 2Z2SB 4OHZA 1ND2B 2CDPA 2VZOA 1YFYA 2W46A 5FWJA 1FT9A 3WP6A 1QOSA 1OH3A 2JDYA 4GKYA 5ABJA 4IE7A 4K6BA 1VMJA 3POGA 4JC1A 2ARCA 5CKMA 1AYM3 3RZLA 2W1WA 1FAYA 2ZKLA 2V4VA 2IFRA 4YGEA 1W8HA 4F8AA 4K21A 1WBLA 5L7OA 3UL2A 5FR3A 4E27A 1G9AA 1STMA 2KD7A 4AEDC 1MQTC 1O7FA 1PGW1 1PIV2 3MFCA 2X5IB 2RS11 1PO11 4XE9A 4FTEA 5J3UA 3TYJA 1LU2A 2VZ1A 3RS6A 4E2SA 1AF9A 1ZA7A 3HWJA 2VCMA 3FHIB 1W9SA 5L73A 3PL0A 2MEV3 1GMMA 3OUIA 5FZ6A 3T30A 1NE4A 5FYSA 4O9GA 3A0KA 3HR9A 1MS5A 4QX8A 3JBG1 4S2FA 3WDVA 3WQ7A 2FCVA 4CDWA 1U5YA 4QQHA 1AR73 2WNUA 4XMIA 4Z07A 4HVOA 3NNGA 1RUD2 1O4ZA 1XSRA 2QVSB 5F6KA 1UF2C 4BQ5A 5FREA 3JD72 1GBGA 1ULFA 2RS53 4ET7A 3E5QA 5ACA3 1F2NA 4FSJA 4Z82A 1GANA 3T3YA 5F3CA 1RJ7A 4Q4W2 4AQTA 2ETEA 2NMNA 3VBUA 1G6NA 1S2KA 5BV6A 4LKDA 2DWRA 5A3LA 2EXIA 2WINB 5LCWL 3J8F3 1A34A 5IUQA 1WBFA 3ZYGA 1PVC3 5F37A 1YFXA 1Y9QA 1DP0A 2GNTA 4MGIE 4JX0A 3R05A 1W8FA 2CTVA 1D7PM 3Q8FA 3PUQA 2XL7A 1OHFA 4UFKA 5BNOB 1R1A1 4I0BA 2RS31 4QKBA 3N9LA 3JQWA 1H0BA 4XDQA 4TXWA 2GH8A 1YIFA 1NY71 3ALQA 3H0OA 4NRMA 1B35B 2W08A 5JZGC 2MPFA 2XJVA 2RHPA 2ZGQA 1IHMA 3ACFA 4IGPA 1QDCA 5DDJ1 5J09A 5GZFA 3O1MA 4EN0A 1A3KA 1OA2A 3JZVA 1W6QA 3POFA 5FZEA 2R0HA 1F5JA 2EVXA 5LASA 1VBA2 3VDAA 1Z7S1 3AVSA 4KWLA 5FBZA 5LW9A 3R4UA 1AX2A 5FZIA 1REFA 3WF4A 4E4ZA 2B42B 2FMYA 3ZMOA 5HI0A 2Q5TA 4A7YA 3S7IA 2GZWA 5E89A 2DCKA 5JPNB 1LEMA 3SH4A 1OURA 5E88A 3M70A 4JDOA 2XBO2 4K20A 4BMBA 4AQ2A 1S2BA 2R16A 4HBNA 1NA1A 1VIWB 1UOJA 1US3A 3I2GA 4YZ1A 3BCWA 2N7GA 1RHI3 4QB2A 3E97A 2DFBA 4HKOA 1LGBA 1H30A 2GP3A 2ZX3A 4L97A 5T3NA 1DQ2A 5EXOA 4D69A 1HXS1 4LUKA 1ENXA 1BMV1 1D4M1 3RWNA 4NN0A 2RG4A 4AAXA 1W06A 3Q8AA 5LRRA 3DPRA 1CN1A 3K2OA 4MLOA 4CP2A 1XNBA 2BJSA 2WIIB 2ZEWA 3FBMA 4QKNA 4BQYA 2QQPA 4HOOA 2BNMA 4A3ZA 1KFUL 4OFGA 3MV11 3ZFGB 4BQWA 1SMVA 1N1VA 4A2UA 2ZX2A 4I0WB 1PVC1 1DZTA 2Y6HA 3JU9A 4L99A 4U36A 3AFKA 3W58A 1VAVA 4FPGA 5A3NA 1NLRA 3DXUA 4RHV1 4ZONA 5FYZA 4DY3A 1SBFA 2FDJA 1OQEA 2GNBA 3H8OA 4META 1DQ0A 1LEDA 1XE8A 5M0TA 1ZBA2 4NIDA 2J1RA 5C9AB 1CX1A 4ATFA 4CXYA 4QD2A 3IZOA 1GZ9A 3KWVA 4XBQA 2Q1MA 3KT7A 2J1VA 5JLVA 2UYBA 5GZGA 2QBXA 2Y0OA 1SFNA 2LM3A 2HH9A 1JZ3A 1C8M1 1DU3D 1UXZA 2WA4A 2XOMA 4IDZA 5F2SA 4RQPC 5CKQA 2BGCA 1QH6A 1LENA 3KVBA 4WM8B 4WZFA 2BOJA 5F7UA 4E2QA 1Z7S3 3NNMA 2VBPA 4M3CB 2RE9A 4JQTA 3VN4A 1KJLA 2O14A 2E26A 5B2GB 2W52A 3HPNA 1QJU1 1JZ8A 3ZYPA 5L7OB 1RUC2 4XCAA 1NA1C 1PK6C 3LSDA 2ZAAA 2BBAA 1XJAA 3BODA 1ND3C 3GDBA 4YVSA 1UYPA 3LF7A 4LEJA 1ZX5A 1QJZA 4FXKB 3T1LA 3ZN4A 1MVQA 1PMIA 1J58A 3I2HA 3S5QA 3RVHA 4AOCA 3C7GA 5B4NA 4NRQA 3WX5A 4CCCA 2JE9A 4M4RA 1LOGA 1T2XA 2WT0A 4D7SA 4LBOA 4N7IA 3I54A 4URTA 3NV2A 1LOFA 2DBIA 4NWVA 3O1OA 2XONA 3LEIA 3OUHA 4RQPA 3N35A 5A6XA 3WG4A 3QH7A 1JYWA 1J84A 1O3TA 3OCPA 2R063 2MEV1 5AVPA 2BUKA 3H3UA 4DMIA 2VTXA 4I09A 4ZU5A 3NVCA 5K4LA 4HKWA 4QWNA 3J7LA 1QJY1 3JD73 3WP4A 3AP7A 3HT2A 1V9U1 4ZS2A 2RMU2 3WQ0A 1VBE2 4QT6A 5FY1A 5I8YA 1OQ1A 2RDQA 3J26N 2PLV2 3RZMA 2W9XA 2ES3A 2QZ3A 4ZXKA 3OOXA 4Q4W1 3BTYA 4XBNA 4MV2A 5FYTA 3WINE 2YGMA 1OMIA 4WVMB 4EROA 4HK9A 4QPGA 3N7MA 1XU1A 2FCTA 4P9LA 2JG9C 4LO6B 2Y26A 2JG8C 3GXUA 2VZSA 3RZJA 4L0PA 1CAVA 1RHI2 4CEWC 4GWMA 2Q8EA 1S0EA 4DB5A 2W3JA 2WZR1 1HRI3 2WN2A 1AYM1 5T5LA 4H3WA 4Q1PA 3O14A 5FYIA 2ZBJA 4GH4C 1RUJ2 2W39A 3WY6A 4AGGA 1GOFA 3CEWA 4C8DA 3HJRA 4P02B 1YI7A 4Y5Z0 4CEYC 1J1TA 4XBLA 1PIV1 4RA0A 3B94A 3AK0A 1SZBA 4HPKA 1V9U2 3ITQA 1QKQA 4QHZA 2E7TA 1TME3 1RJ8A 4JHZA 1JYTA 2E51A 4C0HA 3DV8A 4JGYC 4XMAA 5SV8A 1HLCA 5DZGA 1VBA3 1W8UA 4MGSA 4H55A 4XUTA 4IEXA 1UOGA 4XPVA 5J1XA 2VOTA 5FK8A 1OOPB 3OGJA 1XXNA 1DYOA 5I0DA 3GBGA 2GC2A 5FY4A 5FZGA 3I2OA 3K77A 1ULCA 2E9QA 2KM2A 5F39A 1W6PA 2XWJB 3BTXA 4F83A 5JIAA 4EYUA 2XHNA 5A32B 5LA9A 2Z5WA 5FTTC 3TBDA 1S2EA 3FMGA 3OD4A 3UGGA 1LJ7A 1HXS2 5FAXA 1UY1A 1UX6A 4FFHA 3K4AA 3FHAA 3NL1A 1WMXA 3S0MA 3HMYA 2OXBA 3T09A 4CPBD 3PURA 1HB1A 1NYWA 4MVTA 4ARYA 2WQ4A 2E31A 5GZCA 5JOWA 3CO2A 3GGLA 1FOD1 4WZCA 5C3QA 1FV3A 2YC2A 1JYCA 2HWE2 4OYUA 4M3CF 3E6DA 4KGQA 3U4SA 3UKNA 1IGOA 2RS52 4LBKA 4LBQB 2XH6A 3HAGA 5C7GA 1W6OA 4GIQA 1XNAA 4RL7A 3O1TA 2PHDA 3MFAA 5A3MA 3ON7A 1UYXA 5I0TA 3AX4A 1W05A 5EV7A 2C0ZA 3ZLIA 5LB6A 4P9WA 1PX3A 2XGXA 3H9AA 5IK8A 4ZY9A 5C4WB 2WNUC 4NHKA 1LOFC 3VZMA 3W9AA 4TWTA 4AW7A 4LBLA 2HWC2 3OPTA 4LHLA 5DDJ3 2PA7A 4AFAA 1JS9A 3FFZA 4JRLA 1OA4A 4Q0VA 4BLIA 3TEXA 3M3QA 2AEYA 1MS1A 2RJKA 1XSQA 1GQPA 3HN1A 4XVHA 4AHXA 1YNAA 4BWOA 2Z69A 5FZCA 2HWB2 4B1MA 2ATFA 1R64A 4GWJA 1BXHA 4QB6A 1TZOA 4LO7A 5C8CB 1EAH3 3JBG3 5IVEA 3QCWA 4CDXB 1DQ1A 1RTVA 1ZYBA 2AACA 1POV3 2CGPA 1NT0A 2F4PA 3P1IA 5F6LB 3KSCA 4AHZA 4Q26A 1AR92 4KWKA 4AI3A 2W2IA 2VCBA 1DGLA 2A3YA 2ADEA 5BNNB 5C71A 5A7QA 3I3EA 3WDUA 4YW7A 2G19A 3OBZA 1EUUA 3WNLA 2BTVC 4IEWA 4IV1B 1CZTA 1RYYA 3LFMA 3BI3A 4AVTA 4JGZC 4ZPIA 4AEDA 3LOIA 1W39A 4LKEA 1W90A 1D0GA 3VBUC 3JBG2 3JB4C 3GHNA 4DINB 2FDHA 1W9YA 2WS92 4MOAA 4LO4B 1OUSA 5BNOA 3PUIA 4IE5A 1HV0A 1VPHA 2QZ2A 1VBB1 4KBZA 4OZXA 4A41A 4A44A 5FDBA 4MHRA 3N3HA 1UZWA 3NJXA 5IHRA 1Q8OA 3O1PA 2V73A 3AXEA 4CDWC 3KS7A 3ZYFA 3ZYRA 4G3YC 4XF9A 3AP4A 5HV4A 3WQBA 1AXZA 2XJTA 4OLLA 1O5UA 2VXRA 5FP9A 2VQAA 4XQ4A 2IUWA 1AXYA 1BBT2 1RUF3 4HSJA 1SLBA 2ILMA 1ULEA 2YYOA 3ACIA 5FP3A 3EXUA 1WA4A 2Z42A 2C1FA 2CHHA 3W59A 1YQ8A 2JJ6A 4Q0SA 2RMU3 3VUOA 1S0BA 2HWF2 3OJBA 4CUCA 4QM8A 2BP6A 1JZ4A 1L3JA 3MF9A 2VD7A 1K42A 2H0VA 1JU4A 2OYZA 4XABA 1LHVA 5BXXA 1ZRFA 3F2ZA 1ZBA1 1W6MA 4O9EA 3LEMA 1FI2A 2E63A 3I2IA 3NRUA 4Q0PA 4BXSV 4J1WA 1W28A 3FE5A 3OB8A 4ZHNA 2PYTA 1CESA 1F15A 3H42B 3OF1A 4Z2WA 3IBMA 5L9VA 4XETA 1EPZA 5JAXA 1AYN1 1D2QA 2QQUA 2R043 3OGVA 3SC7X 3SQOA 3O0XA 4QQOA 4R9CA 3FLPA 3T4VA 3I49A 4BQXA 1OPMA 5FQ0B 4CXXA 3D8CA 4K40A 2ZGLA 4OQ8A 4BYYA 1Z0HA 2K46A 3BTZA 4COZA 2HWB3 4XTPA 2JDUA 5JZGB 3ST7A 5LATA 3KGLA 3T4HB 3H8RA 1UU6A 3N9PA 2D44A 5JOZA 4HVRA 1W03A 1DIWA 3WDYA 4BQ2A 2QFEA 3NNFA 4KU8A 1WKYA 3VDDA 5C70A 1W2OA 4FP3A 5CADA 2EIEA 1NCQB 1WLWA 2R042 3PJQA 4HG6B 3OY8A 4A3XA 5J37A 1QU0A 1V9U3 2VZQA 4AFCA 5J36A 4WVMA 2WFF1 4XUOA 3VBFC 1GLHA 2XDVA 3AMMA 1X8MA 1FMD1 2QTWB 2V4AA 2FZ2A 1WMEA 2V72A 5CZKA 2IZWA 2RR11 4YVWC 5C5UA 1NUKA 5DAXA 2DUOA 1HQNA 1XYOA 3APBA 5FXWA 1VBC2 3NAPA 1QXJA 3VBSB 4AR2A 2JG8A 4J25A 3N9QA 4IEZA 4XJZA 1C8NA 3POYA 2JB8A 5JCTA 1POV0 2DVAA 3Q8BA 1QJY2 1GQHA 1DGRN 3INAA 2E33A 5EFUA 4QDQA 4W6WA 5DDJ2 5FOBB 2J1EA 2YFZA 4Y20B 4BH9A 3MUY1 2VPVA 4QX3A 4QPWA 3WOGA 5IFTA 3FUOA 3O7OA 2EAKA 2P1BA 5KC6A 4COUA 4PCRA 4Q4Y2 2MHFA 4OUMA 1S0CA 2GU9A 2ZHLA 4Y1UA 3AYEA 2HWD3 3ILNA 4EZ4A 4JGZA 2VXJA 5FZLA 5A3TA 5CFDC 2B46X 3AP5A 1LULA 3WSOA 3NAPB 4UW4A 2ZGSA 5JSRA 3BPZA 4YVWA 4HSLA 5IYYA 2WAOA 1REDA 1UW8A 5FP4A 4YFZA 5FZAA 2P5BA 3V65A 4YW5A 4NHMA 5IK7A 3BU0A 3EHKA 3UV9A 2JWPA 1GNHA 1OOPA 3WHTA 1W8NA 4B29A 5DUXA 1RUJ1 1UL9A 2NN8A 1D4VB 2ZX1A 4Z92B 3ZXDA 3USUA 2I74A 3KV5A 4XDPA 4LR4A 5FWEA 2WQ8A 4FCAA 1MS3A 4AI9A 3V0BA 5A70A 1TVGA 2X8KA 3JD71 1XC6A 3V0BB 5A6ZA 3A22A 4DQAA 3ZVXA 1JYVA 5FIXA 5A7SA 4CEWA 1BHGA 5G05L 4DIQA 2YBSA 3GJAA 4R4ZA 5KR7A 1JTZX 4XJ8A 1V6MA 3U75A 2XMLA 4I3GA 4JRAA 2VZ3A 2J42A 1Q8SA 1ND3B 3D5OA 2WO3A 4NMIA 3VKOA 2WO2A 2GAUA 3WT3A 3I8TA 4Q2FA 4E4SA 3OPZA 2VUAA 4RHV2 1JUHA 3IDCB 3LDKA 4YRDA 5F3EA 3ZFGA 3AP6A 3FJSA 4TLGA 1W8OA 3PDQA 2WWUA 3H1YA 2VTXJ 1QXPA 1SG3A 2JD9A 2PLV3 2GALA 3B93A 4E8CA 5BYNA 2DVBA 4Y1ZA 3CIHA 3VHOA 2JDHA 3MIEA 3UETA 1QJFA 3VBOA 4ZKTB 4W4ZA 1XQNA 5DUUA 3IDAA 4AI1A 1YXWA 5A33A 4GULA 4JAAA 1IZ3A 3GNEA 1VB4A 5JXHA 5AC91 1G7YA 1TME1 3RG0A 2WFPA 3AMPA 1AJOA 1CAUA 4NJ4A 3B69A 4YARA 1AR72 3AB0A 2B4KA 2WSVA 4LE3A 3DPRC 1CWPA 4QQ2A 1LR5A 2DBNA 3D82A 1LHUA 1T6GC 2Q30A 1UZYA 4CU9A 1LAJA 1U0AA 4QXHA 3H8XA 3LIGA 1A6CA 1NZIA 3NV4A 3WUCA 1HRV2 1S4CA 2XLGA 4GWIA 2WNOA 3MIBA 4K7JA 5F32A 5A7OA 3RFRA 4RGKA 2F4LA 2YDEA 3VZOA 2HJIA 2ZGOA 4I01A 2GH2A 3G7DA 1IKQA 3T2QA 2R0FA 1S55A 2P6CA 4RGGA 4YG0A 5FMOS 5T52A 1C57A 3U4XA 4BK4A 5IVFA 1IQDC 2JIJA 2DTYA 4LHSA 4G9SB 3QOPA 2Q1ZB 2R7EB 3LB9A 2XQXA 4W65A 1HV1A 4N53B 5DAVA 3U78A 5KBFA 1FOD3 3PU8A 3SEEA 3PTRB 4CEYB 2WNVA 1OC1A 1ZRDA 2W95A 4CE8A 2ZPXA 1BK0A 1NY72 2Y6LA 1E5HA 1VR3A 4CDXA 4Q0UA 4MGZE 1F9KA 3HQUA 2DTWA 1QNYA 4XZUG 3OBRA 4K9SA 3FBYA 4NPLA 2NM1A 2VZRA 4Y3OA 5LWBA 3ACHA 2ZMLA 2UYAA 2HBUA 1EV11 2VQ0A 4CP1A 5DZEA 1RUH3 4D94A 1I5PA 1OVPA 2QQNA 5HPOA 1DLCA 3K3NA 1ULPA 2VBBA 1GNYA 1OOPC 3N9MA 5EWSA 5JR2A 2Y0IA 3BU7A 2WNEA 5C3RA 3LAGA 1PGL1 3H1MA 3GCXA 4X8NA 3R0RA 2FMDA 1IS4A 1W3VA 1WLDA 5APAA 3AMQA 3EMRA 4PDWC 1F31A 1RUD1 1CAUB 4XYXA 2TNFA 5I91A 4WM7C 1IKPA 3T2TA 4Q0QA 1DYPA 3ACGA 3LOBA 1APNA 1H8VA 2CL2A 1O8PA 1PVC2 1W6OB 2C9AA 2E7QA 4IEPA 1UY4A 4O61A 4PDWA 4QQPA 3NJVA 1FNZA 2IXJA 4EQVA 1WCUA 4IESA 4YZ5A 4AVAA 5LA0A 3LE0A 3WNNA 1J3QA 4CU7A 1D2SA 1NXMA 1IPKA 3HNYM 5IWFA 3ZN6B 4E8DA 4HZFA 3OYWB 1ND2C 5LY1A 2HWB1 3WG2A 2OUJA 4LBNA 1MPXA 4OI2A 5CIRA 1YFWA 1JODA 4QDRA 2GC3A 1OI6A 1PVXA 3PTYA 4LO8A 3KT4A 4UOJA 4AFMA 1FNYA 2MEV2 4K1YA 3VZNA 5C4WC 5DG1A 2Y6JA 1AR93 1YCIA 1PK6A 1WUVA 5FKCA 2BWAA 1YQ5A 1U5ZA 3VBRA 4LT5A 4D7YA 3ZN5A 1QF3A 1RMU3 3K4DA 5DXDA 3ELNA 1HN1A 3LPGA 3ZXFA 5IT6A 3I3QA 4UF0B 3AZZA 3ZR6A 2X5IC 4H2AA 3PU3A 1ZZ7A 2XBO3 1WWYA 1NG0A 3HVDA 1QQP1 1WCKA 3WDTA 1TME2 2YXSA 1PNFA 1Y9MA 3LFIA 4CCJA 2A5ZA 3KVAA 4I02A 4KH9A 3V64A 3ZPYA 3BKZA 2XHKA 4Q27A 4TZDA 4Z2AA 4JQRA 1XNCA 5GLVA 3AYDA 3QH6A 2J1UA 2OS2A 5L19A 2VQTA 1ONAA 4HETA 4AQ6A 3IPVA 2QCSB 3SMHA 2UU8A 1SFPA 1RITA 5GZDA 4HANA 2VQUA 1GP5A 5CA6A 4FFGA 4IV1C 1GOHA 4Q4Y1 5IVJA 2ARBA 4EWDA 2VAUA 1CAVB 5EJ3A 4JGZB 4CDUC 5JSOA 1Y4WA 2PHFA 2VVDA 1K5MC 4Y1YA 5JMCA 1OLRA 3WW1A 1A8DA 3VKNA 2X09A 3MLKA 2WRAA 3S6PA 3EYPA 4NWWA 1JU3A 2D6OX 2YB7A 2Y33A 3MPBA 1DHKB 2DCYA 2WKKA 3A21A 3SNMA 3AYCA 5GLUA 1MEC2 1PHMA 4N43A 4IQPA 4LMFA 1YFUA 2BNOA 2D3RA 2VCCA 4MGKE 4Q5OA 5A1FA 1TMF2 2NPIA 4FFFA 3PUSA 1VJ2A 4FPOB 4NHYA 3WCSA 2RDSA 1IS6A 4DNYA 1XRUA 4SBVA 5CG8A 3M1HA 2Q8DA 1RUI3 5KHGA 3W5MA 1I9RA 5IW0A 4I3PA 2HWC1 4JHTA 1B35C 4Y4RA 4ASMB 1PM4A 4QXKA 1OPOA 2LS6A 2YPJA 4IXLA 4N7UA 1UOFA 2R071 5DQ0A 3VD5A 4AL9A 1G9CA 3BUCA 4LK7A 5A3WA 4WBBA 2D3PA 1PZ7A 2DVGA 3DKQA 3M3CA 4FPEA 4NAOA 5L9RA 4CP0A 2FD8A 2JX9A 1RUG3 4OULA 3UYJA 3ZXJA 4J1XA 4AVCA 2D5HA 3KF3A 2WFF3 5KXCA 1WW7A 1UZ0A 1LESA 3ZXEA 1LGNA 4NRPA 5D2AA 4ES9A 3S57A 1IPJA 2P2KA 3PUAA 4N53A 5CYYA 5LEJA 4N90A 5EHDA 3I2FA 2BYVE 5C5TA 1ND3A 1V00A 1YRZA 1HJGA 1O3QA 3M3IA 4IGOA 3JB8A 4ASLA 5C3OA 3GZAA 1TG7A 1LRHA 4DRVA 1SACA 4PI2A 2A6WA 5FFOC 5EYXA 3TN93 2GNMA 3J9SA 2D40A 4NVPA 1V70A 1JYNA 1ND2A 2D6PA 5FLHA 3RRDA 1FPN1 4P9XA 4NPRA 5DN2A 3ES4A 5KXDA 1HJFA 2FDKA 1OLQA 2O1QA 2CAUA 3SKVA 2VR4A 1RUNA 4CCEA 2QE3A 5HV0A 2ZZQA 4AXOA 4FTBA 2WZEA 3USUB 3T0DA 1QHDA 4XACA 1CZSA 4Y22B 1LOBA 3MIGA 4Y1VA 5FZ3A 5CFDA 3THPA 5HCAA 4QM9A 2W1UA 5LEKA 2XXZA 1DGWA 3GZUC 5GLTA 3WF0A 4Q4X3 4IEQA 1C1LA 4YVWB 2XWBB 1NCRC 1QEXA 1UN1A 3QD6A 4YW2A 4DUWA 2NQYA 1HB3A 3C8XA 4N43B 5LA1A 1OLME 5FPVA 5K9YA 4RR3A 4P5YA 3WHUA 2C6SA 3KQRA 2CAVA 3HEIA 4FOVA 5C9AC 2XUMA 1H2NA 1HB4A 4P9IA 2XJRA 3J4UH 5FZFA 1OKOA 1QY4A 3JUUA 4GB32 3ZOIA 3ME2A 4U2AA 4RQPB 2E32A 2OZ6A 5CFCA 4MXWB 1I5ZA 3FLRA 1LOEA 2HEYF 4MZUA 3KF5A 2JICA 4AAPA
chains in the Genus database with same CATH topology
2V4AA 3OUHA 4XC9A 3W21A 5C5UA 4MHUA 5DAXA 5DAQA 5IATA 4J25A 2JIJA 5L9BA 5LASA 2Y33A 3NNJA 4IW3A 5DAVA 2RDQA 4Q5OA 3W20A 2RDRA 4NHYA 2OPWA 2RDNA 2RDSA 2G19A 3OBZA 5ERLA 4XCBA 2FCTA 3HQUA 2Y34A 5DAWA 4ZPIA 4JZRA 2HBUA 3NNLA 4UWDA 3DKQA 5L9RA 5LBCA 4NAOA 4NHMA 5DAPA 5EPAA 4XAAA 4KBZA 4MHRA 4Y5TA 2RG4A 3MGUA 3EMRA 2FCUA 2HBTA 5IAVA 5HV4A 4BQYA 5C5TA 3ITQA 5LBEA 4BQWA 3GJAA 3GJBA 4ZONA 3GZEA 5M0TA 2G1MA 4XABA 4Y5SA 5HV0A 4NMIA 4NHXA 5LA9A 5A3UA 3KT7A 2JIGA 3PL0A 3OUIA 4XACA 5L9VA 3KT1A 3BVCA 3KT4A 2FCVA 2A1XA 3NNMA 3HQRA 5LBBA 4BQXA 4NHLA 3OUJA 4XCAA 5EQUA 5LATA 5IAXA 3NNFA 5EP9A 5LBFA 5LB6A 4NHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V4A A;  3OUH A;  4XC9 A;  3W21 A;  5C5U A;  4MHU A;  5DAX A;  5DAQ A;  5IAT A;  4J25 A;  2JIJ A;  5L9B A;  5LAS A;  2Y33 A;  3NNJ A;  4IW3 A;  5DAV A;  2RDQ A;  4Q5O A;  3W20 A;  2RDR A;  4NHY A;  2OPW A;  2RDN A;  2RDS A;  2G19 A;  3OBZ A;  5ERL A;  4XCB A;  2FCT A;  3HQU A;  2Y34 A;  5DAW A;  4ZPI A;  4JZR A;  2HBU A;  3NNL A;  4UWD A;  3DKQ A;  5L9R A;  5LBC A;  4NAO A;  4NHM A;  5DAP A;  5EPA A;  4XAA A;  4KBZ A;  4MHR A;  4Y5T A;  2RG4 A;  3MGU A;  3EMR A;  2FCU A;  2HBT A;  5IAV A;  5HV4 A;  4BQY A;  5C5T A;  3ITQ A;  5LBE A;  4BQW A;  3GJA A;  3GJB A;  4ZON A;  3GZE A;  5M0T A;  2G1M A;  4XAB A;  4Y5S A;  5HV0 A;  4NMI A;  4NHX A;  5LA9 A;  5A3U A;  3KT7 A;  2JIG A;  3PL0 A;  3OUI A;  4XAC A;  5L9V A;  3KT1 A;  3BVC A;  3KT4 A;  2FCV A;  2A1X A;  3NNM A;  3HQR A;  5LBB A;  4BQX A;  4NHL A;  3OUJ A;  4XCA A;  5EQU A;  5LAT A;  5IAX A;  3NNF A;  5EP9 A;  5LBF A;  5LB6 A;  4NHK A; 
#chains in the Genus database with same CATH topology
 5FYY A;  4Q4V 2;  4NO4 A;  4F3J A;  4OZO A;  2WUH A;  3HIF A;  5K0U C;  3ZYH A;  3BGA A;  4LUL A;  4GMP 3;  3CDZ B;  1G86 A;  2ZEZ A;  4MHU A;  5D8A A;  3LDR A;  1NA1 B;  1GWL A;  4KG8 A;  1K5M A;  5I8T A;  1ZRI A;  2YY1 A;  1JH5 A;  1KFX L;  2D93 A;  4XUP A;  4AVV A;  3LPF A;  2PLV 1;  2ZOE B;  5FBJ A;  3U11 A;  4COV A;  2ZAB A;  3DF0 A;  4NUB A;  3ZX7 A;  2WA3 A;  1XU2 A;  1U5X A;  2JEC A;  2VNG A;  3KZ4 C;  2OII A;  4CZS A;  5C8W A;  3BPS A;  1P8J A;  4BIS A;  1A78 A;  3B02 A;  3WNK A;  2RDN A;  3R4D B;  4W8J A;  2DDU A;  2OZJ A;  3N7L A;  4DXR A;  5IFP A;  4BIO A;  3LGR A;  1S0G A;  2V09 A;  4OHX A;  2QQJ A;  4S2G A;  1MS0 A;  1AXK A;  1EV1 3;  3C3V A;  3ZKU A;  2OQ7 A;  4NPM A;  4LBJ A;  5DAW A;  5FZ0 A;  3DKW A;  4E4H A;  2D6K A;  1VAL A;  1H4G A;  4YM3 A;  2DCZ A;  3NNL A;  1KEX A;  1I6X A;  1RUE 1;  4KWJ A;  5K0U A;  1V6K A;  1X82 A;  3RI8 A;  5LBC A;  1KQR A;  4FPH A;  3RYP A;  4AYU A;  4B3N A;  1AVB A;  1W0P A;  4GH4 A;  4W50 A;  3VBR C;  2HKX A;  1LHW A;  3JCI A;  5EPA A;  3WVJ A;  2F6B A;  2ZGR A;  1JHJ A;  1XE0 A;  3FLT A;  1JMU B;  2ZA9 A;  1V6I A;  2WZ8 A;  2OUH A;  5A3O A;  2DVF A;  3K48 A;  1Q3E A;  4Q4V 3;  3CU7 A;  4Y26 A;  2XJP A;  2YUE A;  4XJA A;  1DQ6 A;  2X10 A;  3CNA A;  3H7J A;  2O8O A;  2HBT A;  3L2Y A;  3CL1 A;  3LIH A;  1SLL A;  1W6M B;  3MV0 1;  4PBO A;  3O1V A;  3LWC A;  3B3Q E;  2JG9 B;  3O0V A;  3PHM A;  5FK7 A;  1SLC A;  2DU1 A;  1SBD A;  2JG8 B;  4UFI A;  1JXN A;  3LDB A;  3Q9O A;  4XEZ A;  4ZZ8 A;  2VNO A;  4FAG A;  1ZZB A;  2HYX A;  3OGG A;  5FO9 B;  1OKQ A;  3PIG A;  5GM0 A;  1WW4 A;  4LO5 B;  1BCX A;  1HRV 1;  1RUH 2;  3OTF A;  3ETQ A;  4GH4 B;  3GZT B;  1J83 A;  3GZE A;  3B00 A;  4I2O A;  4UXA A;  1J3R A;  4GXL A;  4K8R B;  4CCM A;  4BLJ A;  4BIF A;  3CJI A;  4EN7 B;  3NV3 A;  1F8V A;  1RMU 1;  3ILR A;  2P3K A;  4NHX A;  2TEP A;  1W8T A;  1WCQ A;  5KHI A;  4PIX A;  3D4K A;  3VGI A;  1OQD A;  2EF6 A;  2ZZJ A;  1REE A;  1RUG 1;  3KCY A;  1WA6 X;  3DEM A;  4IGQ A;  2WO1 A;  4L92 A;  5LK5 A;  2WZR 3;  3U07 A;  1FOD 2;  3IB3 A;  1LTE A;  4AGR A;  4QPI C;  5JZG A;  2ZGN A;  3BOP A;  3KGZ A;  3HOB A;  3MIH A;  4OHW A;  1N3P A;  5I8S A;  5JVV A;  3RI9 A;  4BDV B;  4LA3 A;  2JB4 A;  1NQJ A;  2D43 A;  2G9G A;  4AFB A;  3M7A A;  1R08 2;  5JXJ A;  5E16 A;  2RR1 3;  1C5H A;  2BGP A;  4QX0 A;  4IV1 A;  1X50 A;  1W6Q B;  4Q8K A;  4KL1 A;  4H7L A;  2W91 A;  1CJP A;  2VME A;  5I93 A;  3ZFF C;  4IL7 A;  4L2N A;  2RV9 A;  5BNN A;  1U5I A;  2DF7 A;  1GOG A;  1UXX X;  4RSU A;  3GBW A;  1BEV 1;  3HNB M;  4RS5 C;  3AZW A;  3OSD A;  5H9R A;  5A1L A;  1VAM A;  5FY7 A;  4CVU A;  4FPK A;  3W21 A;  5FYH A;  1VBC 1;  4UI9 L;  1M4W A;  2JDK A;  4Q4V 1;  2EIG A;  1G8W A;  2QQM A;  1W2N A;  3E6B A;  1RUG 2;  5D1I A;  2WL1 A;  2OVU A;  3AMH A;  4EV0 A;  4EZH A;  3O5S A;  3WDX A;  4FQ4 A;  1Q8V A;  2BNN A;  5L9B A;  2BBV A;  1UQX A;  1GZC A;  2R06 2;  4CSW A;  2I07 B;  1AYN 3;  2R04 1;  3ZIX A;  4Y1X A;  3NNJ A;  1YQ2 A;  4PI0 A;  1AZD A;  2GN3 A;  2R07 3;  2ZXQ A;  5C4W A;  2AR6 A;  1UIK A;  4XFF A;  2FQP A;  2PXJ A;  2WNU B;  4WVV A;  1HDK A;  4LE4 A;  3N9O A;  3DXT A;  2A6V A;  2HWF 1;  1O6U A;  5FMO L;  2ZCW A;  4LPL A;  1LB2 A;  1WMD A;  5FUI A;  3T2P A;  4XFB A;  3VBH A;  5FZ9 A;  3IN9 A;  4FOY A;  4RR3 C;  3ZXG A;  2XUE A;  3VDD C;  4YZ3 A;  3FZ3 A;  4EN9 B;  1WW5 A;  4W6X A;  3ZSK A;  1BVP 1;  2DFC A;  2X5I A;  4AK3 A;  4CDQ A;  1C28 A;  2CGO A;  4QB1 A;  4CDX C;  3AZX A;  1WGP A;  3HBK A;  4RD7 A;  3FUQ A;  3VZL A;  4GAL A;  4JTO A;  2BU9 A;  1FAT A;  5A7N A;  5FY5 A;  1X7N A;  3M3O A;  5BNN C;  3CZU A;  5GLZ A;  4BCU A;  3W5N A;  4HMZ A;  1L7L A;  3MLL A;  3TN9 1;  1W6P B;  1W99 A;  1DQ5 A;  2JDA A;  3AJY A;  3JQX A;  5A7W B;  4QX2 A;  1LHN A;  3LA7 A;  4HT1 T;  5BY5 A;  3I3D A;  1JN2 P;  2YMZ A;  3KCX A;  4A7K A;  4GA9 A;  1ZBE 3;  2PN5 A;  2ZGP A;  1OD5 A;  4QU2 A;  1HRI 2;  5D21 A;  5T5P A;  3R4S A;  3RMX A;  1NKG A;  2XG3 A;  3LQC A;  4JCK A;  3USS A;  1FXZ A;  4R9D A;  5A80 A;  2BVB A;  1AUY A;  2RM2 2;  4YW4 A;  1JBC A;  1LCL A;  3WUD A;  3H3Z A;  2HWD 1;  5FZO B;  3B5L B;  1GKB A;  2XLF A;  3SHR A;  4YZ2 A;  5CAZ A;  4CDQ C;  2XL9 A;  3BOW A;  1HIX A;  2AEZ A;  2AUY A;  3S5A A;  3AYA A;  3DYP A;  1UKG A;  3WQ1 A;  2HWD 2;  1C1F A;  1HQW A;  1RVF 1;  2CWM A;  3A0N A;  3I3B A;  4LIV A;  4QHB A;  1UZV A;  1AX0 A;  5CEH A;  1W8Z A;  5SV5 A;  1X36 A;  2LRO A;  3EQE A;  4YGB A;  1WD3 A;  4AFD A;  4PIY A;  2D6M A;  5H9S A;  1CZV A;  4QPG C;  1RHI 1;  3IM0 A;  4QPI A;  1XNT A;  5A6Y A;  4LA2 A;  3D6E A;  2I2S A;  1UMH A;  4BPZ A;  5ANN A;  4CUG A;  4NIG A;  4TN7 A;  1IOA A;  3GYD A;  2ET7 A;  1G9B A;  2BOI A;  1Q5O A;  2K2S A;  4XJ9 A;  5CVR A;  2J1A A;  5BPX A;  1ALY A;  2P34 A;  1R1A 3;  2AH2 A;  3K46 A;  1FMD 3;  3LA3 A;  3SIS A;  4B7E A;  2QKD A;  5FZ4 A;  2J1S A;  5HCH A;  2FDF A;  2AZ5 A;  1ACC A;  1PO1 2;  2IWG B;  4FOW A;  4HVQ A;  5B4X A;  1QJE A;  1VLN A;  2JXA A;  2RM2 1;  2XVG A;  1EPW A;  3B9I A;  2Y64 A;  2GP5 A;  4IV3 B;  2WBK A;  4NAM A;  4RHV 3;  4UW5 A;  1T6B X;  5J7M A;  1PO2 1;  2NLR A;  1Y7B A;  1MEC 3;  4P9Y A;  3ZKY A;  4F7Z A;  3AKP A;  5FLJ A;  4DO0 A;  2VOK A;  1R09 2;  3THD A;  3OG2 A;  3SCH A;  4LJH A;  4PQ9 A;  3AKS A;  4Q1R A;  5FYM A;  5HCF A;  5I0U A;  4AZZ A;  5T54 A;  1S0D A;  3C7E A;  2YC4 A;  4LOT A;  5A7W A;  4XFI A;  1SDD B;  4UF0 A;  4AHY A;  2A6X A;  2UY9 A;  3MDP A;  2P6H A;  5F9T A;  4GZ9 A;  1DDL A;  1FPN 2;  2R30 A;  4ARX A;  5FO7 B;  2YGL A;  3WD5 A;  1WZX A;  3GM8 A;  4XJW A;  4GKX A;  4PLN A;  3ZSE A;  1O8S A;  2WR9 A;  3IMN A;  4JGY A;  4OMC A;  2IXC A;  3IT8 A;  3ZDS A;  5JR7 B;  1PO1 3;  5CKN A;  4MX3 A;  3AL5 A;  1ULG A;  1H9W A;  3VKF C;  2JEM A;  4D8M A;  4BXF A;  1R1A 2;  2ZEY A;  3T0B A;  4URA A;  1RVF 3;  3KHB A;  2VG9 A;  4G4F A;  3VBS C;  4LK6 A;  3E6C C;  3N7J A;  4XHB A;  1QNW A;  2IXH A;  3WW3 A;  4DEQ A;  3BYW A;  3J7M A;  1HX6 A;  1BZW A;  4UBH A;  4BHP A;  2DUQ A;  1PZ8 A;  1RGS A;  1W6N A;  1PX4 A;  4GMP 1;  3THC A;  4O7X A;  3MGU A;  3MW2 A;  1YIP A;  2R06 1;  4IEO A;  2VL4 A;  3IAP A;  3VD4 A;  5A6Q A;  4ZS3 A;  2KA3 A;  2ZX0 A;  4GWN A;  2VVE A;  3ZDV A;  3UJQ A;  4COY A;  1DYK A;  3CF6 E;  4PLM A;  4MXV A;  1IG0 A;  1V6J A;  5FRA A;  5CFD B;  2EXH A;  1I3H A;  4Q8L A;  4S2H A;  1MZ6 A;  3III A;  5FPZ A;  5J48 A;  4OCT A;  3AZV A;  2I45 A;  4XUN A;  5BNQ A;  1VMH A;  4CCK A;  2EXJ A;  1SLT A;  1PZ9 A;  5CNA A;  2LAL A;  1UWW A;  1NCR B;  4HK8 A;  5E8A A;  5F5A A;  5C3S A;  5HXM A;  5KHJ A;  2B9V A;  5EJZ B;  4JKK A;  1RVF 2;  4OVE A;  4RYD A;  2B39 A;  4XFG A;  1ODM A;  1YO8 A;  3ZYB A;  4AE2 A;  1FX5 A;  1URX A;  4YYO A;  2JIG A;  5DZF A;  3EJK A;  5FJK A;  4I0A A;  1V6N A;  2PEL A;  3L2H A;  4C90 A;  2A3X A;  1AR6 2;  3POE A;  4UFH A;  5I0R A;  4I30 A;  1H4H A;  2W68 A;  3MIC A;  3Q8E A;  2WO7 A;  1SCR A;  2WSU A;  4QX7 A;  3ZSM A;  4IEV A;  1ZVF A;  2AYH A;  4WVZ A;  1Y3T A;  2WJS A;  5K0U B;  4GAZ A;  1ODN A;  4IEY A;  3V0A A;  2W87 A;  3WXP A;  4YG6 A;  1GV9 A;  1RUC 3;  5C33 A;  1CX4 A;  1R08 3;  1H1A A;  1TMF 1;  4ZZ5 A;  1M06 G;  2B7Y A;  3RMY A;  1KDM A;  1ZZC A;  4TSV A;  4ONU A;  1H6X A;  1VBA 1;  2VH9 A;  1F4H A;  4B4Q A;  4HLT A;  4V2V A;  2PQS A;  4B8E A;  2JE8 A;  3WW4 A;  1VP6 A;  2H6B A;  4B1L A;  3U37 A;  1JZ2 A;  4XF3 A;  2CYF A;  4LKF A;  3VHR A;  2AEN A;  5FY0 A;  2W47 A;  4W6Y A;  5CFC C;  1GWK A;  2IFW A;  4N8M A;  1RL3 A;  4BQ4 A;  2IVI B;  4D6R A;  1K3I A;  4XUR A;  1BVV A;  1GP4 A;  1HKD A;  3TNQ A;  2EAL A;  3ZXL A;  2VMG A;  3MZH A;  5KC5 A;  1VB2 A;  3LKJ A;  4YGC A;  4WM7 A;  2RS3 2;  1YHF A;  4YLZ A;  1HN0 A;  1AR9 1;  5FPU A;  4BJ0 A;  5A3P A;  1RIR A;  3CJI C;  1RUO A;  3VBH B;  5JI9 A;  1W2T A;  3HQX A;  5KHK A;  4IW3 A;  3KV6 A;  4S2D A;  2VCA A;  3DPR B;  2QDR A;  3OBA A;  3ZYJ B;  4FAH A;  2EIB A;  4JV4 A;  1J3P A;  3ZXK A;  1RB8 G;  2RDR A;  4XOG A;  5FYC A;  2VOW A;  4IER A;  1N1S A;  2ZHM A;  1IS5 A;  3IPV B;  4PHZ A;  5FOJ B;  2YBP A;  4ISQ A;  3I7D A;  4Y4Y A;  5IK4 A;  5AFE A;  3QLQ A;  1YJK A;  3O1S A;  3LA2 A;  1VRH 1;  5FP8 A;  1BEV 2;  1H8T B;  4QKD A;  2P3J A;  4M01 A;  1BK1 A;  2R07 2;  1MZE A;  2EIC A;  5DAB A;  2RM2 3;  1COV 3;  1W9T A;  5FLI A;  5A32 A;  3I2K A;  3TEW A;  4DS0 A;  1G9D A;  5JIU A;  1QDO A;  4AI2 A;  2IC1 A;  2WYF A;  3K51 A;  2D97 A;  4C1W A;  4N53 C;  1OD3 A;  4A42 A;  1K5J A;  1RUD 3;  2WNV C;  3AZY A;  4Y5T A;  1O5L A;  3S7E A;  3AP9 A;  2Y6F A;  4LLO A;  2JE7 A;  2ZHK A;  5JDB A;  2VTF A;  4LOS A;  1QXR A;  1ZRR A;  3L9J T;  4KU7 A;  3DL3 A;  1X8E A;  2HEV F;  3A23 A;  4BQ3 A;  4K8F A;  4LLF A;  4YVS C;  4DY5 A;  3PNA A;  1NAE A;  2YRO A;  4XIK A;  5D8A C;  2DU0 A;  3ECQ A;  4QXB A;  5F3I A;  4ATE A;  4EWE A;  1H6Y A;  4LBQ D;  5JUV A;  1PIV 3;  1H1I A;  5JXG A;  2R49 A;  2ZMN A;  5E1R A;  1J1L A;  4R8H A;  5EJ1 B;  3KCC A;  4YW3 A;  1RUI 1;  1DGR A;  1UNB A;  3ATG A;  5FYV A;  2BPA 2;  2CWS A;  2XVK A;  1W9W A;  3VHN A;  3UJO A;  3WNX A;  2XQR A;  1BBT 3;  2FHR A;  1RUI 2;  1J59 A;  4FBF A;  1QOT A;  2HWC 3;  2FDI A;  1D4M 2;  3I59 B;  4LQR A;  4PQQ A;  1QJX 2;  4QX5 A;  3CLP A;  2XLA A;  3MF6 A;  4N9I A;  4KQ7 A;  2PAM A;  3MHZ A;  2DVD A;  2NZ9 A;  2VNV A;  2EID A;  5FP7 A;  4CP9 B;  4RS5 B;  5DPN A;  1GYK A;  3RZG A;  4YFW A;  1ENR A;  3VL8 A;  2L9L A;  4PBP A;  4XF0 A;  2EXK A;  4AI8 A;  4Q4W 3;  1HW5 A;  5FZ8 A;  5JMO A;  1JYI A;  4LIT A;  1GZW B;  1E5S A;  3AC0 A;  4CA9 A;  4M3C E;  4NRO A;  5A1A A;  4WV8 A;  3IIA A;  2VJX A;  4IE6 A;  4RFT 0;  2HWE 3;  2ARX A;  2JG9 A;  4LKS A;  3WP3 A;  2VMH A;  5BNP B;  4COW A;  1N1Y A;  2VW2 A;  1UYY A;  2H6C A;  4GQ7 A;  2VW1 A;  3AFG A;  4LUM A;  4TYS A;  5GAL A;  1RIN A;  1JHN A;  2QQL A;  4IND A;  4PF1 A;  2VOV A;  4DFS A;  3VBO B;  1AL2 2;  2IVJ A;  2E53 A;  1K45 A;  5FXX A;  4DOU A;  4PLO A;  3LZZ A;  5LK7 B;  1PMJ X;  2PHX A;  5FZ1 A;  2NMO A;  3ORJ A;  1E5I A;  4UYB A;  4CEY A;  5T5J A;  3G6J B;  4HN1 A;  5T50 A;  4GJY A;  4UW6 A;  2YU2 A;  1OLM A;  1SLI A;  3VDD B;  5CU1 A;  5FUP A;  2Q4S A;  1VMF A;  3ILF A;  4J6G A;  4ZXE A;  3LEG A;  4Q29 A;  3PVB B;  4PT6 A;  4DUX A;  3UKT A;  1ZBE 2;  5FPX A;  4ES8 A;  3MI8 A;  2YFU A;  4OI4 A;  3VDB A;  4SLI A;  2W5F A;  1AJK A;  2XKP A;  4Q4X 1;  5KXE A;  1UY2 A;  2G9Z A;  3CHX A;  4MSV A;  1GQG A;  3RJ2 X;  3KV9 A;  1UD1 A;  3SH3 A;  4M3C A;  2ZAH A;  3P6B A;  2UWB A;  3X29 B;  4WM8 A;  2VO5 A;  5FMD A;  1KS4 A;  4MH0 E;  1CQ9 A;  1Q8Q A;  1X9T A;  2A73 B;  3OD0 A;  4CDU B;  1VRH 2;  2FDG A;  3PME A;  3TEZ A;  4QXC A;  4JZR A;  1K5M B;  1GUI A;  1OFS A;  5LY2 A;  3UGF A;  5FZB A;  3O1R A;  1QQP 2;  3ZFE A;  1C3H A;  4RFR B;  2QQV A;  3WLU A;  1YJL A;  5G04 L;  2A71 A;  1MQT B;  1RUF 1;  3ZO0 B;  3P5B A;  2CY6 A;  1HRV 3;  1KXG A;  1C4R A;  1OSG A;  3TWI A;  3B7M A;  4XFA A;  2RMU 1;  3SXW A;  4FPY A;  3S30 A;  3RZK A;  1H1M A;  3AKT A;  5IAV A;  4CP9 A;  1H8T A;  3T0A A;  4XF1 A;  1ASJ 3;  1DBN A;  1V6O A;  1IPS A;  1WLC A;  2P37 A;  3OYW A;  5DG2 A;  1GSL A;  5FY8 A;  1W2A X;  3WCR A;  2UWA A;  2GSY A;  1LHO A;  1LNS A;  2Z4F A;  1LOA A;  2ZS6 B;  3DUI A;  4GB3 3;  4RN5 A;  3I59 A;  1AR6 1;  5FPL A;  5A7P A;  3ZSJ A;  1GR3 A;  1VBE 3;  2D6N A;  2P4E A;  3HN3 A;  4FT8 A;  3N7K A;  5FZ7 A;  2WS9 3;  3ZSL A;  2X53 S;  3GJB A;  3RNS A;  1WW6 A;  2VMI A;  3RYK A;  1L7Q A;  3TNP B;  2RS3 3;  3VBF A;  2GMP A;  1UZZ A;  2GND A;  1XBF A;  2JDN A;  3GHM A;  2PFW A;  1VRH 3;  1MQT A;  1VBD 2;  2AC1 A;  1VE0 A;  3PIJ A;  3POI A;  4ISR A;  4IET A;  4AHW A;  3PVO A;  4DUV A;  5I0S A;  4GMP 0;  3ZFE B;  4LBM A;  4ZU7 A;  4X6R B;  5A3U A;  2Y8K A;  3BIE A;  2C5D A;  4P14 A;  2ARE A;  3VKL A;  2B5H A;  3NMB A;  2X29 A;  3C2U A;  2QQK A;  3BVC A;  5J96 B;  1UX7 A;  4UW3 A;  2YC0 A;  5FZO A;  3E1F 1;  4CYD A;  3HQR A;  2JD4 A;  1US2 A;  2WN3 A;  3CQO A;  4OUE A;  5BNO C;  5DMY A;  5F2W A;  2OQ6 A;  3BB6 A;  3OGR A;  4DPN A;  2JKX A;  4GJZ A;  5E6H A;  1AR7 1;  2BRT A;  3ZFF A;  5FXV A;  3CJX A;  2W0X A;  3TRS B;  4JVA A;  5IAT A;  4AVS A;  3POS A;  1S0F A;  2VZP A;  2WQZ C;  4AEK A;  1F4A A;  1A8M A;  4YW6 A;  4UFM A;  1LOC A;  1UAI A;  4YWA A;  5JOX A;  2WZR 2;  3NJY A;  4KBB A;  3FHQ A;  4CXW A;  3I3M A;  4D3W A;  1UY0 A;  2F17 A;  2SBA A;  2QQW A;  2R6Q A;  1PNG A;  3FWE A;  2RS5 1;  1OF3 A;  3SEP A;  4A6S A;  2ZGM A;  3UES A;  1G9F A;  2ADD A;  1AHS A;  5FMC A;  2VOX A;  4YW1 A;  4CU8 A;  2B9U A;  5L36 A;  4OMD A;  2ZMK A;  3NKT A;  3BAL A;  4XZP A;  4CU6 A;  4YNI A;  4N43 C;  5DAQ A;  3I4I A;  1ENS A;  4P08 A;  1V6L A;  2BEO A;  3C7O A;  1CGP A;  1K12 A;  5ACA 2;  2PQQ A;  2VZV A;  4ITC A;  3E5X A;  5K8S A;  1ULD A;  5FO8 B;  1EY2 A;  1MAC A;  4QX1 A;  1RUH 1;  3ENR A;  5FZD A;  1N3Q A;  2DV9 A;  1CAW A;  5FUN A;  2DCJ A;  2AGS A;  1CAW B;  2TUN A;  4QGM A;  4HN0 A;  4HXC A;  5EZW A;  2FBE A;  3BTA A;  2E6V A;  3FC0 A;  2Y6G A;  3P3P A;  3BIW E;  3EBR A;  3RGB A;  3MUZ 1;  1COV 1;  2ZGU A;  1SBE A;  1UKR A;  4MYE A;  3NW4 A;  1NCQ A;  4R9A A;  3ZFG C;  3WG1 A;  3F95 A;  4P9J A;  2PAE A;  1O91 A;  3U1X A;  1POV 1;  3LEK A;  1NX9 A;  1DLL A;  4FXG B;  4UFL A;  3KLS A;  1SPP B;  1ZZ6 A;  3D0S A;  4XAA A;  1DZR A;  2VBD A;  4XQD A;  5FV3 A;  3RDI A;  4XIL A;  2MNG A;  5J98 B;  1SDW A;  3M3E A;  3PVE A;  1OF4 A;  3DYM A;  1JOB A;  2R1D A;  3PMS A;  2GC1 A;  3A4U A;  1N3O A;  2VUJ A;  4B7K A;  1VAK A;  2BVV A;  4MAD A;  4XQW A;  4BZ4 A;  2JDP A;  4CUB A;  5LBE A;  2BV4 A;  5ABJ C;  5DUW A;  1GP6 A;  1EYB A;  2W94 A;  1W04 A;  4ORF A;  3VV1 A;  4V1P A;  2CV6 A;  2X05 A;  2BWC A;  3WNO A;  1ULO A;  3SCF A;  4B4P A;  1XNK A;  3NKG A;  4UT5 A;  4PF5 A;  3N4M A;  1SPP A;  5L7O C;  2NYY A;  3ASI A;  3VBR B;  4XHX A;  1BBT 1;  5IVY A;  3ACL A;  1PK6 B;  3ZM8 A;  5C8C A;  1POQ A;  2YHJ A;  1H2M A;  2GDF A;  2RS1 2;  1VBB 2;  2WWJ A;  5AC9 2;  1UMZ A;  3MBW A;  3RZH A;  3AM2 A;  3LCP A;  4M00 A;  1NLS A;  2ARA A;  1Q8P A;  1KIT A;  2GME A;  3TB0 A;  1KDK A;  2A1X A;  2ORX A;  3ZN6 A;  3HD8 B;  3FL7 A;  4M0N A;  5CB7 A;  5C6C A;  1KJR A;  2XJQ A;  4IV3 A;  5JWP A;  1AL2 1;  2PHT A;  5H9P A;  4NHL A;  2BDR A;  2YBK A;  3NO8 A;  3VHP A;  1JI6 A;  4Z1V A;  2B45 X;  2BQP A;  1DZQ A;  5KXB A;  1OBN A;  1H2L A;  4GB3 1;  2A75 A;  3ES1 A;  1CVN A;  1GZT A;  3DEC A;  4KG0 A;  1W0N A;  2H0B A;  3POB A;  4AQS A;  4NIH A;  2CDO A;  2YPD A;  2P3I A;  3QBQ A;  5EP9 A;  3H8U A;  1MVE A;  3IKW A;  1ZBE 1;  5KHH A;  1PGW 2;  2UWC A;  2K9Z A;  1OXC A;  4E4D X;  2HEW F;  2Y38 A;  1YLL A;  3RJR A;  1QOO A;  3O1U A;  4QPI B;  4OQ9 A;  5AC9 3;  1OH4 A;  2ET1 A;  4P5H A;  4XC9 A;  1MS9 A;  1H8T C;  4DXS A;  2Z79 A;  3UKV A;  3AL6 A;  4AWD A;  3I2D A;  3M8L A;  4CEW B;  1E57 A;  4XFC A;  4XFH A;  1CPN A;  1NLQ A;  4UFJ A;  3TN9 2;  1BKZ A;  5GZE A;  3ZFF B;  2G9F A;  4YM0 A;  3POJ A;  2A6Z A;  4LNV A;  1Z7S 2;  1RXG A;  3ABZ A;  4QGL A;  3OBT A;  2WNV B;  3WDW A;  5HXV A;  3OY8 B;  3JXS A;  2LW8 A;  2VMF A;  2WC2 A;  4XAE A;  1B09 A;  4TLF A;  4AG4 A;  1CAX B;  2UY8 A;  5CBL A;  1ZA4 A;  2A6Y A;  2E7A A;  2WFF 2;  4BOW A;  1O3R A;  1FMD 2;  2EA7 A;  1Q43 A;  5D8A B;  3KHC A;  4M4P A;  1VBD 3;  2JKB A;  2Q0A A;  5HCB A;  3T2O A;  3MW4 A;  1NE6 A;  4AVB A;  5F8P A;  1U12 A;  3RSJ A;  4AEM A;  1N1T A;  2W92 A;  2R1B A;  2WT1 A;  2PHR A;  5DAP A;  2BER A;  1W2U A;  3FN9 A;  1BEV 3;  4QAW A;  2WS9 1;  4JTN A;  5T55 A;  4AEJ A;  4Y20 A;  3K75 B;  1FV2 A;  3DCQ A;  4C91 A;  2K0G A;  3DGT A;  1QJU 3;  2FCU A;  2J1T A;  4CUA A;  1BJQ A;  1SQ4 A;  4K3U A;  4YG3 A;  1S0J A;  3ROU A;  5AFB A;  1CJD A;  2V5D A;  4NE9 A;  4QQL A;  5FPB A;  1F35 A;  4RR3 B;  3WF1 A;  1CD3 G;  1V0A A;  1I1E A;  3B01 A;  5T5O A;  3J7N A;  3ZXA C;  2C9K A;  3RWK X;  3IAQ A;  2R32 A;  1UPS A;  3URF A;  5A33 B;  4HL0 A;  3RZZ A;  1GZW A;  2XVL A;  1WMF A;  5ISL A;  4LXL A;  3SIT A;  3N36 A;  4EN8 B;  1X9P A;  1UU4 A;  2ZGT A;  2ZJC A;  2D3S A;  1DGW X;  3ZMN A;  4Q4X 2;  2KXL A;  2Y60 A;  3E5U A;  4Y5S A;  1UMI A;  4GD4 A;  4HFS A;  4QU1 A;  4YM1 A;  3VL9 A;  5IVV A;  1XOY A;  2VU9 A;  5BNP C;  2DUP A;  4CDU A;  1XPW A;  1Y43 B;  4FVV A;  2OW4 A;  2VUL A;  2B8M A;  5FZM A;  4AF9 A;  3KT1 A;  1JYX A;  5JSP A;  1TQ5 A;  3T1M A;  4R9B A;  1O59 A;  1XYP A;  3RYR A;  4O65 A;  3WG3 A;  3CKH A;  3KQ4 B;  3WNM A;  2VM9 A;  3AKQ A;  2HYK A;  2WLP A;  3H1W A;  1H2K A;  2LUW A;  4FPF A;  2IXK A;  2VW0 A;  2VUC A;  4ZU4 A;  4R4X A;  3UNP A;  3LSE A;  3O12 A;  4FP2 A;  4AED B;  5IVC A;  4CCD A;  5C3P A;  4DRR A;  3D3A A;  2O0O A;  2WAB A;  2J7M A;  2YU1 A;  4MG2 A;  2CU5 A;  2PAK A;  3B9C A;  4CDQ B;  5AVA A;  1Z78 A;  2W1Q A;  5FY9 A;  1ASJ 1;  1R1Z A;  1ST8 A;  2VMC A;  4P9G A;  4KGG A;  4CCO A;  2LRP A;  4DZG A;  4Q4Y 3;  1CR7 A;  1HB2 A;  3AMN A;  4L9B A;  4EN6 B;  1VBD 1;  3KM5 A;  4NOT A;  2CSG A;  1AR6 3;  1PO2 3;  1VBE 1;  2A70 A;  4QDS A;  4QPG B;  4Z8B A;  3PVN A;  1F5F A;  1WCS A;  1HRI 1;  3KMH A;  4LOR A;  1R09 1;  3V56 A;  1SFY A;  4N9H A;  4XIO A;  3J7H A;  3HT1 A;  4BQ1 A;  2PTM A;  3VBU B;  4DXT A;  3VD3 A;  4XXA A;  1X33 A;  3IWZ A;  2OX0 A;  3MID A;  2NP0 A;  5EIY B;  3MIF A;  2P17 A;  1RUE 3;  1AL0 G;  1YC6 1;  2W1S A;  3TOJ A;  2BZD A;  5FPA A;  3OEB A;  1RUF 2;  1ZM1 A;  3WNP A;  4IV3 C;  2BFU S;  2FZ1 A;  1TMF 3;  2WYS A;  4CDW B;  1NOV A;  4MGT A;  1PM7 A;  1RUC 1;  2RS1 3;  4H14 A;  3VZK A;  3WF3 A;  3VB9 A;  1JOP A;  1RUE 2;  2TBV A;  2VGD A;  2Y34 A;  4A4A A;  4LBQ A;  3ZR5 A;  4BME A;  5FZH A;  1E5R A;  3VBS A;  2VNR A;  1AR8 3;  1ENQ A;  2Q1F A;  2UUR A;  5F1R A;  3KB5 A;  4MGY E;  5LZ6 A;  2YV8 A;  4UWD A;  5CG9 A;  3AJZ A;  1ZNP A;  3T08 A;  1IG3 A;  2Q8C A;  5IVB A;  3EB7 A;  4CCN A;  3OEA A;  4IEU A;  4FTS A;  4AI0 A;  1CAX A;  2Y6K A;  1AYM 2;  4Y33 A;  1WCD J;  3I97 A;  4IE4 A;  1EV1 2;  1Q56 A;  2PMW B;  1UY3 A;  2YZ4 A;  3NST A;  3ZFE C;  1XYN A;  3ZYI B;  5ACA 1;  1KRI A;  1MEC 1;  4XXP A;  4B4R A;  1RXF A;  4ASK A;  1QGL A;  2RJ2 A;  1UCX A;  1IS3 A;  4D7T A;  4KWU A;  2C26 A;  2XBO 1;  3VDC A;  1GIC A;  3VD7 A;  2CNA A;  4NR1 A;  4RGA A;  3SLI A;  1H9P A;  4WVW A;  3CMG A;  4LIU A;  4CTE A;  2J22 A;  1LOD A;  3V0A B;  3H50 A;  2VY0 A;  3PUH A;  3D0J A;  4KMQ A;  1IQA A;  5FQ0 A;  1RMU 2;  2ZX4 A;  3FFQ A;  5DUV A;  3VLB B;  4V2W A;  4NIA A;  2OPK A;  4QGN A;  5F5Q A;  2WDB A;  2DUR A;  4BB3 A;  1AR8 2;  2G1M A;  1YUD A;  2D7F A;  4X8P A;  1W0O A;  1XB9 A;  4YPJ A;  4FPJ A;  4IUG A;  1CON A;  5GKA C;  1B35 A;  3GBF A;  3OGS A;  1PGL 2;  2KR2 A;  1UOB A;  1JZ6 A;  1NCQ C;  2DCT A;  1QWR A;  2DYC A;  4FPL A;  1EP0 A;  2QQI A;  3POW A;  1R08 1;  1GFF 2;  2ZAC A;  2ENR A;  4MXW A;  5FMB A;  3THT A;  1QH7 A;  1EAH 1;  2Q8O A;  3VBF B;  3PLQ A;  2IXL A;  2QQO A;  1UIJ A;  3IDE A;  5LBB A;  4FO9 A;  2RJL A;  1NCR A;  4R52 A;  4BA6 A;  1UYZ A;  2LTN A;  1JUI A;  2VZU A;  3QAC A;  1XE7 A;  1VBC 3;  4XUQ A;  2JDZ A;  3GCW A;  5EQU A;  1LGC A;  3KD4 A;  2GMM A;  3AXD A;  4P00 B;  4X6Q B;  4NII A;  3RQ0 A;  2VVF A;  3CZJ A;  2HLE A;  3MW3 A;  1VRB A;  3DN7 A;  2BGO A;  2OA2 A;  3IDB B;  3EO6 A;  3AVR A;  3NWK A;  3MLJ A;  1ZZ8 A;  2VMD A;  2QDN A;  5LBF A;  1PGS A;  3C7F A;  3ZPO A;  2D5F A;  4QKF A;  2O8Q A;  3MEP A;  1O4T A;  1JOJ A;  1LU1 A;  1MS4 A;  4WM8 C;  2JDM A;  1HXS 3;  2ZGK A;  1NZC A;  1L7R A;  1S1A A;  4KI5 M;  2XB6 C;  1O4Y A;  1VBB 3;  3C7H A;  4M0H A;  4D0Q A;  4DEV A;  1OT5 A;  1SEF A;  1UPI A;  1FYU A;  3HBZ A;  3HNM A;  4CPB A;  5F5I A;  5IJR A;  4D6S A;  4C0B A;  1LEC A;  1AYN 2;  1SLA A;  2RR1 2;  1NQD A;  2ZTN A;  3NAP C;  1QQP 3;  3M2M A;  1GU3 A;  1CIY A;  1GNZ A;  5FJH A;  3VZJ A;  4QMA A;  3U0Z A;  4L8Q A;  4HPK B;  4BE3 A;  5FYB A;  4D6Q A;  1OA3 A;  1YI9 A;  1YWK A;  4E2G A;  1O3S A;  2WLQ A;  1YQ6 A;  4FFI A;  3W20 A;  1DQ4 A;  1KS5 A;  2XPJ A;  1AL2 3;  1ZRC A;  5H9Q A;  4OI0 A;  2OPW A;  2VEC A;  1YQC A;  3WR0 A;  5CIS A;  3RPQ A;  3H7Y A;  4BM8 A;  1UO9 A;  2ZKN A;  3H3L A;  2QNK A;  4YZ4 A;  4XCB A;  4UAP A;  3I2J A;  5CFC B;  4LTA A;  4BU2 A;  5ABJ B;  5LA2 A;  1JZ7 A;  1YYN A;  2ERF A;  1W8W A;  1SCS A;  1W9F A;  2ZEX A;  3ZIW A;  1ZBA 3;  4JDM A;  5BUV A;  4FPC A;  3VD9 A;  3Q8C A;  2EAA A;  4A6O A;  5ANQ A;  3WP5 A;  3CJI B;  2GN7 A;  4PJY A;  3TAY A;  3VBH C;  1BMV 2;  1R09 3;  4A7Z A;  1ZZ9 A;  2PHU A;  2BW8 A;  1MS8 A;  3VKM A;  4A45 A;  2QUO A;  3CBN A;  1WLT A;  2GC0 A;  2CGN A;  1RC6 A;  1GWM A;  2ORZ A;  3P3N A;  2D98 A;  3BN6 A;  1QMJ A;  5BNP A;  1D4M 3;  4YGD A;  3UK9 A;  1BLZ A;  2OKX A;  1QJU 2;  1OVS A;  2VUD A;  5C9A A;  1DG6 A;  5HBA A;  1XND A;  3J8F 2;  5FKB A;  3SCG A;  1TE1 B;  1HQL A;  3WEZ A;  2PHL A;  3WW2 A;  2VZT A;  4EWA A;  5JXI A;  3WZ1 A;  1CPM A;  3J8F 1;  1W6N B;  3UT0 A;  5TSW A;  4JKL A;  4RS5 A;  5IK5 A;  2QJV A;  4XF4 A;  2HWF 3;  3MPP G;  4LHK A;  4K1Z A;  4FOQ A;  2D6L X;  2RVA A;  3NV1 A;  4MO3 M;  1AR8 1;  4H7M A;  1JW6 A;  3AKR A;  1NXD 1;  4E9K A;  5JOY A;  2XJS A;  2WT2 A;  1BQP A;  1ASJ 2;  3NJZ A;  3MYX A;  3ETP A;  4YVS B;  3TEY A;  4OHY A;  2HWE 1;  1PO2 2;  1QJX 3;  3KV4 A;  1ZRE A;  4XDO A;  1AX1 A;  1C5I A;  2PHW A;  4JGY B;  4OHV A;  3R6S A;  1C8M 3;  3M4F A;  1FPN 3;  1LKN A;  3NQH A;  4TTG A;  4QHO A;  3FX3 A;  1W3X A;  2G4I A;  4OUS A;  4YM2 A;  5EYY A;  1EAH 2;  4CRQ A;  4BK5 A;  3OUJ A;  1TNF A;  1Y9G A;  2ZHN A;  3N9N A;  1DFQ A;  1COV 2;  4QPY A;  4CCL A;  2A3W A;  5JI7 A;  3WF2 A;  5LRS A;  5IAX A;  1DF0 A;  3PJY A;  1C8M 2;  3GF6 A;  4HKL A;  4OI1 A;  5FZK A;  4LHN A;  3GAL A;  3K4Z A;  4IE0 A;  5KWR A;  2WAA A;  2SLI A;  4AGV A;  5F3G A;  2C24 A;  3LD8 A;  1OUX A;  4MGQ A;  4KNC A;  1TNR A;  4EJR A;  1KD7 A;  3WV6 A;  2XJU A;  3UGH A;  5JPM B;  3U10 A;  1WD4 A;  4UBG A;  1JZ5 A;  2VC9 A;  3A7Q A;  5GLW A;  2V5Y A;  3MO4 A;  2P3Y A;  2XKO A;  1MR5 A;  1UU5 A;  5F5C A;  3SH5 A;  1RUJ 3;  5FXZ A;  3SKJ E;  4HON A;  2ID4 A;  5K7P A;  3K3O A;  4JDN A;  4XJU A;  1QIQ A;  4PIZ A;  4FI9 A;  4MUV A;  1S0I A;  2VE1 A;  5FCC A;  5FYU A;  3OPW A;  1PMH X;  1KGY A;  4FQZ A;  1TEI A;  3O0W A;  4XTM A;  3VBO C;  1CIW A;  2XR4 A;  4XW3 A;  5GJ6 A;  1OFN A;  4L11 A;  4YSF A;  4PDW B;  2WWS A;  4Y24 A;  2A7A A;  1EUT A;  1MZ5 A;  1YEW A;  2C4X A;  4WM7 B;  5ERL A;  1QJY 3;  2BFU L;  4Y22 A;  1DCS A;  1D0H A;  1BYH A;  2WZP P;  3IMM A;  2JEN A;  3DYO A;  1SHW B;  5C8C C;  2IXI A;  3U14 A;  1QJX 1;  1N47 A;  4JKM A;  2OT7 A;  4C1X A;  4DXZ A;  4EE2 A;  1MZF A;  2YG0 A;  2Z2S B;  4OHZ A;  1ND2 B;  2CDP A;  2VZO A;  1YFY A;  2W46 A;  5FWJ A;  1FT9 A;  3WP6 A;  1QOS A;  1OH3 A;  2JDY A;  4GKY A;  5ABJ A;  4IE7 A;  4K6B A;  1VMJ A;  3POG A;  4JC1 A;  2ARC A;  5CKM A;  1AYM 3;  3RZL A;  2W1W A;  1FAY A;  2ZKL A;  2V4V A;  2IFR A;  4YGE A;  1W8H A;  4F8A A;  4K21 A;  1WBL A;  5L7O A;  3UL2 A;  5FR3 A;  4E27 A;  1G9A A;  1STM A;  2KD7 A;  4AED C;  1MQT C;  1O7F A;  1PGW 1;  1PIV 2;  3MFC A;  2X5I B;  2RS1 1;  1PO1 1;  4XE9 A;  4FTE A;  5J3U A;  3TYJ A;  1LU2 A;  2VZ1 A;  3RS6 A;  4E2S A;  1AF9 A;  1ZA7 A;  3HWJ A;  2VCM A;  3FHI B;  1W9S A;  5L73 A;  3PL0 A;  2MEV 3;  1GMM A;  3OUI A;  5FZ6 A;  3T30 A;  1NE4 A;  5FYS A;  4O9G A;  3A0K A;  3HR9 A;  1MS5 A;  4QX8 A;  3JBG 1;  4S2F A;  3WDV A;  3WQ7 A;  2FCV A;  4CDW A;  1U5Y A;  4QQH A;  1AR7 3;  2WNU A;  4XMI A;  4Z07 A;  4HVO A;  3NNG A;  1RUD 2;  1O4Z A;  1XSR A;  2QVS B;  5F6K A;  1UF2 C;  4BQ5 A;  5FRE A;  3JD7 2;  1GBG A;  1ULF A;  2RS5 3;  4ET7 A;  3E5Q A;  5ACA 3;  1F2N A;  4FSJ A;  4Z82 A;  1GAN A;  3T3Y A;  5F3C A;  1RJ7 A;  4Q4W 2;  4AQT A;  2ETE A;  2NMN A;  3VBU A;  1G6N A;  1S2K A;  5BV6 A;  4LKD A;  2DWR A;  5A3L A;  2EXI A;  2WIN B;  5LCW L;  3J8F 3;  1A34 A;  5IUQ A;  1WBF A;  3ZYG A;  1PVC 3;  5F37 A;  1YFX A;  1Y9Q A;  1DP0 A;  2GNT A;  4MGI E;  4JX0 A;  3R05 A;  1W8F A;  2CTV A;  1D7P M;  3Q8F A;  3PUQ A;  2XL7 A;  1OHF A;  4UFK A;  5BNO B;  1R1A 1;  4I0B A;  2RS3 1;  4QKB A;  3N9L A;  3JQW A;  1H0B A;  4XDQ A;  4TXW A;  2GH8 A;  1YIF A;  1NY7 1;  3ALQ A;  3H0O A;  4NRM A;  1B35 B;  2W08 A;  5JZG C;  2MPF A;  2XJV A;  2RHP A;  2ZGQ A;  1IHM A;  3ACF A;  4IGP A;  1QDC A;  5DDJ 1;  5J09 A;  5GZF A;  3O1M A;  4EN0 A;  1A3K A;  1OA2 A;  3JZV A;  1W6Q A;  3POF A;  5FZE A;  2R0H A;  1F5J A;  2EVX A;  5LAS A;  1VBA 2;  3VDA A;  1Z7S 1;  3AVS A;  4KWL A;  5FBZ A;  5LW9 A;  3R4U A;  1AX2 A;  5FZI A;  1REF A;  3WF4 A;  4E4Z A;  2B42 B;  2FMY A;  3ZMO A;  5HI0 A;  2Q5T A;  4A7Y A;  3S7I A;  2GZW A;  5E89 A;  2DCK A;  5JPN B;  1LEM A;  3SH4 A;  1OUR A;  5E88 A;  3M70 A;  4JDO A;  2XBO 2;  4K20 A;  4BMB A;  4AQ2 A;  1S2B A;  2R16 A;  4HBN A;  1NA1 A;  1VIW B;  1UOJ A;  1US3 A;  3I2G A;  4YZ1 A;  3BCW A;  2N7G A;  1RHI 3;  4QB2 A;  3E97 A;  2DFB A;  4HKO A;  1LGB A;  1H30 A;  2GP3 A;  2ZX3 A;  4L97 A;  5T3N A;  1DQ2 A;  5EXO A;  4D69 A;  1HXS 1;  4LUK A;  1ENX A;  1BMV 1;  1D4M 1;  3RWN A;  4NN0 A;  2RG4 A;  4AAX A;  1W06 A;  3Q8A A;  5LRR A;  3DPR A;  1CN1 A;  3K2O A;  4MLO A;  4CP2 A;  1XNB A;  2BJS A;  2WII B;  2ZEW A;  3FBM A;  4QKN A;  4BQY A;  2QQP A;  4HOO A;  2BNM A;  4A3Z A;  1KFU L;  4OFG A;  3MV1 1;  3ZFG B;  4BQW A;  1SMV A;  1N1V A;  4A2U A;  2ZX2 A;  4I0W B;  1PVC 1;  1DZT A;  2Y6H A;  3JU9 A;  4L99 A;  4U36 A;  3AFK A;  3W58 A;  1VAV A;  4FPG A;  5A3N A;  1NLR A;  3DXU A;  4RHV 1;  4ZON A;  5FYZ A;  4DY3 A;  1SBF A;  2FDJ A;  1OQE A;  2GNB A;  3H8O A;  4MET A;  1DQ0 A;  1LED A;  1XE8 A;  5M0T A;  1ZBA 2;  4NID A;  2J1R A;  5C9A B;  1CX1 A;  4ATF A;  4CXY A;  4QD2 A;  3IZO A;  1GZ9 A;  3KWV A;  4XBQ A;  2Q1M A;  3KT7 A;  2J1V A;  5JLV A;  2UYB A;  5GZG A;  2QBX A;  2Y0O A;  1SFN A;  2LM3 A;  2HH9 A;  1JZ3 A;  1C8M 1;  1DU3 D;  1UXZ A;  2WA4 A;  2XOM A;  4IDZ A;  5F2S A;  4RQP C;  5CKQ A;  2BGC A;  1QH6 A;  1LEN A;  3KVB A;  4WM8 B;  4WZF A;  2BOJ A;  5F7U A;  4E2Q A;  1Z7S 3;  3NNM A;  2VBP A;  4M3C B;  2RE9 A;  4JQT A;  3VN4 A;  1KJL A;  2O14 A;  2E26 A;  5B2G B;  2W52 A;  3HPN A;  1QJU 1;  1JZ8 A;  3ZYP A;  5L7O B;  1RUC 2;  4XCA A;  1NA1 C;  1PK6 C;  3LSD A;  2ZAA A;  2BBA A;  1XJA A;  3BOD A;  1ND3 C;  3GDB A;  4YVS A;  1UYP A;  3LF7 A;  4LEJ A;  1ZX5 A;  1QJZ A;  4FXK B;  3T1L A;  3ZN4 A;  1MVQ A;  1PMI A;  1J58 A;  3I2H A;  3S5Q A;  3RVH A;  4AOC A;  3C7G A;  5B4N A;  4NRQ A;  3WX5 A;  4CCC A;  2JE9 A;  4M4R A;  1LOG A;  1T2X A;  2WT0 A;  4D7S A;  4LBO A;  4N7I A;  3I54 A;  4URT A;  3NV2 A;  1LOF A;  2DBI A;  4NWV A;  3O1O A;  2XON A;  3LEI A;  3OUH A;  4RQP A;  3N35 A;  5A6X A;  3WG4 A;  3QH7 A;  1JYW A;  1J84 A;  1O3T A;  3OCP A;  2R06 3;  2MEV 1;  5AVP A;  2BUK A;  3H3U A;  4DMI A;  2VTX A;  4I09 A;  4ZU5 A;  3NVC A;  5K4L A;  4HKW A;  4QWN A;  3J7L A;  1QJY 1;  3JD7 3;  3WP4 A;  3AP7 A;  3HT2 A;  1V9U 1;  4ZS2 A;  2RMU 2;  3WQ0 A;  1VBE 2;  4QT6 A;  5FY1 A;  5I8Y A;  1OQ1 A;  2RDQ A;  3J26 N;  2PLV 2;  3RZM A;  2W9X A;  2ES3 A;  2QZ3 A;  4ZXK A;  3OOX A;  4Q4W 1;  3BTY A;  4XBN A;  4MV2 A;  5FYT A;  3WIN E;  2YGM A;  1OMI A;  4WVM B;  4ERO A;  4HK9 A;  4QPG A;  3N7M A;  1XU1 A;  2FCT A;  4P9L A;  2JG9 C;  4LO6 B;  2Y26 A;  2JG8 C;  3GXU A;  2VZS A;  3RZJ A;  4L0P A;  1CAV A;  1RHI 2;  4CEW C;  4GWM A;  2Q8E A;  1S0E A;  4DB5 A;  2W3J A;  2WZR 1;  1HRI 3;  2WN2 A;  1AYM 1;  5T5L A;  4H3W A;  4Q1P A;  3O14 A;  5FYI A;  2ZBJ A;  4GH4 C;  1RUJ 2;  2W39 A;  3WY6 A;  4AGG A;  1GOF A;  3CEW A;  4C8D A;  3HJR A;  4P02 B;  1YI7 A;  4Y5Z 0;  4CEY C;  1J1T A;  4XBL A;  1PIV 1;  4RA0 A;  3B94 A;  3AK0 A;  1SZB A;  4HPK A;  1V9U 2;  3ITQ A;  1QKQ A;  4QHZ A;  2E7T A;  1TME 3;  1RJ8 A;  4JHZ A;  1JYT A;  2E51 A;  4C0H A;  3DV8 A;  4JGY C;  4XMA A;  5SV8 A;  1HLC A;  5DZG A;  1VBA 3;  1W8U A;  4MGS A;  4H55 A;  4XUT A;  4IEX A;  1UOG A;  4XPV A;  5J1X A;  2VOT A;  5FK8 A;  1OOP B;  3OGJ A;  1XXN A;  1DYO A;  5I0D A;  3GBG A;  2GC2 A;  5FY4 A;  5FZG A;  3I2O A;  3K77 A;  1ULC A;  2E9Q A;  2KM2 A;  5F39 A;  1W6P A;  2XWJ B;  3BTX A;  4F83 A;  5JIA A;  4EYU A;  2XHN A;  5A32 B;  5LA9 A;  2Z5W A;  5FTT C;  3TBD A;  1S2E A;  3FMG A;  3OD4 A;  3UGG A;  1LJ7 A;  1HXS 2;  5FAX A;  1UY1 A;  1UX6 A;  4FFH A;  3K4A A;  3FHA A;  3NL1 A;  1WMX A;  3S0M A;  3HMY A;  2OXB A;  3T09 A;  4CPB D;  3PUR A;  1HB1 A;  1NYW A;  4MVT A;  4ARY A;  2WQ4 A;  2E31 A;  5GZC A;  5JOW A;  3CO2 A;  3GGL A;  1FOD 1;  4WZC A;  5C3Q A;  1FV3 A;  2YC2 A;  1JYC A;  2HWE 2;  4OYU A;  4M3C F;  3E6D A;  4KGQ A;  3U4S A;  3UKN A;  1IGO A;  2RS5 2;  4LBK A;  4LBQ B;  2XH6 A;  3HAG A;  5C7G A;  1W6O A;  4GIQ A;  1XNA A;  4RL7 A;  3O1T A;  2PHD A;  3MFA A;  5A3M A;  3ON7 A;  1UYX A;  5I0T A;  3AX4 A;  1W05 A;  5EV7 A;  2C0Z A;  3ZLI A;  5LB6 A;  4P9W A;  1PX3 A;  2XGX A;  3H9A A;  5IK8 A;  4ZY9 A;  5C4W B;  2WNU C;  4NHK A;  1LOF C;  3VZM A;  3W9A A;  4TWT A;  4AW7 A;  4LBL A;  2HWC 2;  3OPT A;  4LHL A;  5DDJ 3;  2PA7 A;  4AFA A;  1JS9 A;  3FFZ A;  4JRL A;  1OA4 A;  4Q0V A;  4BLI A;  3TEX A;  3M3Q A;  2AEY A;  1MS1 A;  2RJK A;  1XSQ A;  1GQP A;  3HN1 A;  4XVH A;  4AHX A;  1YNA A;  4BWO A;  2Z69 A;  5FZC A;  2HWB 2;  4B1M A;  2ATF A;  1R64 A;  4GWJ A;  1BXH A;  4QB6 A;  1TZO A;  4LO7 A;  5C8C B;  1EAH 3;  3JBG 3;  5IVE A;  3QCW A;  4CDX B;  1DQ1 A;  1RTV A;  1ZYB A;  2AAC A;  1POV 3;  2CGP A;  1NT0 A;  2F4P A;  3P1I A;  5F6L B;  3KSC A;  4AHZ A;  4Q26 A;  1AR9 2;  4KWK A;  4AI3 A;  2W2I A;  2VCB A;  1DGL A;  2A3Y A;  2ADE A;  5BNN B;  5C71 A;  5A7Q A;  3I3E A;  3WDU A;  4YW7 A;  2G19 A;  3OBZ A;  1EUU A;  3WNL A;  2BTV C;  4IEW A;  4IV1 B;  1CZT A;  1RYY A;  3LFM A;  3BI3 A;  4AVT A;  4JGZ C;  4ZPI A;  4AED A;  3LOI A;  1W39 A;  4LKE A;  1W90 A;  1D0G A;  3VBU C;  3JBG 2;  3JB4 C;  3GHN A;  4DIN B;  2FDH A;  1W9Y A;  2WS9 2;  4MOA A;  4LO4 B;  1OUS A;  5BNO A;  3PUI A;  4IE5 A;  1HV0 A;  1VPH A;  2QZ2 A;  1VBB 1;  4KBZ A;  4OZX A;  4A41 A;  4A44 A;  5FDB A;  4MHR A;  3N3H A;  1UZW A;  3NJX A;  5IHR A;  1Q8O A;  3O1P A;  2V73 A;  3AXE A;  4CDW C;  3KS7 A;  3ZYF A;  3ZYR A;  4G3Y C;  4XF9 A;  3AP4 A;  5HV4 A;  3WQB A;  1AXZ A;  2XJT A;  4OLL A;  1O5U A;  2VXR A;  5FP9 A;  2VQA A;  4XQ4 A;  2IUW A;  1AXY A;  1BBT 2;  1RUF 3;  4HSJ A;  1SLB A;  2ILM A;  1ULE A;  2YYO A;  3ACI A;  5FP3 A;  3EXU A;  1WA4 A;  2Z42 A;  2C1F A;  2CHH A;  3W59 A;  1YQ8 A;  2JJ6 A;  4Q0S A;  2RMU 3;  3VUO A;  1S0B A;  2HWF 2;  3OJB A;  4CUC A;  4QM8 A;  2BP6 A;  1JZ4 A;  1L3J A;  3MF9 A;  2VD7 A;  1K42 A;  2H0V A;  1JU4 A;  2OYZ A;  4XAB A;  1LHV A;  5BXX A;  1ZRF A;  3F2Z A;  1ZBA 1;  1W6M A;  4O9E A;  3LEM A;  1FI2 A;  2E63 A;  3I2I A;  3NRU A;  4Q0P A;  4BXS V;  4J1W A;  1W28 A;  3FE5 A;  3OB8 A;  4ZHN A;  2PYT A;  1CES A;  1F15 A;  3H42 B;  3OF1 A;  4Z2W A;  3IBM A;  5L9V A;  4XET A;  1EPZ A;  5JAX A;  1AYN 1;  1D2Q A;  2QQU A;  2R04 3;  3OGV A;  3SC7 X;  3SQO A;  3O0X A;  4QQO A;  4R9C A;  3FLP A;  3T4V A;  3I49 A;  4BQX A;  1OPM A;  5FQ0 B;  4CXX A;  3D8C A;  4K40 A;  2ZGL A;  4OQ8 A;  4BYY A;  1Z0H A;  2K46 A;  3BTZ A;  4COZ A;  2HWB 3;  4XTP A;  2JDU A;  5JZG B;  3ST7 A;  5LAT A;  3KGL A;  3T4H B;  3H8R A;  1UU6 A;  3N9P A;  2D44 A;  5JOZ A;  4HVR A;  1W03 A;  1DIW A;  3WDY A;  4BQ2 A;  2QFE A;  3NNF A;  4KU8 A;  1WKY A;  3VDD A;  5C70 A;  1W2O A;  4FP3 A;  5CAD A;  2EIE A;  1NCQ B;  1WLW A;  2R04 2;  3PJQ A;  4HG6 B;  3OY8 A;  4A3X A;  5J37 A;  1QU0 A;  1V9U 3;  2VZQ A;  4AFC A;  5J36 A;  4WVM A;  2WFF 1;  4XUO A;  3VBF C;  1GLH A;  2XDV A;  3AMM A;  1X8M A;  1FMD 1;  2QTW B;  2V4A A;  2FZ2 A;  1WME A;  2V72 A;  5CZK A;  2IZW A;  2RR1 1;  4YVW C;  5C5U A;  1NUK A;  5DAX A;  2DUO A;  1HQN A;  1XYO A;  3APB A;  5FXW A;  1VBC 2;  3NAP A;  1QXJ A;  3VBS B;  4AR2 A;  2JG8 A;  4J25 A;  3N9Q A;  4IEZ A;  4XJZ A;  1C8N A;  3POY A;  2JB8 A;  5JCT A;  1POV 0;  2DVA A;  3Q8B A;  1QJY 2;  1GQH A;  1DGR N;  3INA A;  2E33 A;  5EFU A;  4QDQ A;  4W6W A;  5DDJ 2;  5FOB B;  2J1E A;  2YFZ A;  4Y20 B;  4BH9 A;  3MUY 1;  2VPV A;  4QX3 A;  4QPW A;  3WOG A;  5IFT A;  3FUO A;  3O7O A;  2EAK A;  2P1B A;  5KC6 A;  4COU A;  4PCR A;  4Q4Y 2;  2MHF A;  4OUM A;  1S0C A;  2GU9 A;  2ZHL A;  4Y1U A;  3AYE A;  2HWD 3;  3ILN A;  4EZ4 A;  4JGZ A;  2VXJ A;  5FZL A;  5A3T A;  5CFD C;  2B46 X;  3AP5 A;  1LUL A;  3WSO A;  3NAP B;  4UW4 A;  2ZGS A;  5JSR A;  3BPZ A;  4YVW A;  4HSL A;  5IYY A;  2WAO A;  1RED A;  1UW8 A;  5FP4 A;  4YFZ A;  5FZA A;  2P5B A;  3V65 A;  4YW5 A;  4NHM A;  5IK7 A;  3BU0 A;  3EHK A;  3UV9 A;  2JWP A;  1GNH A;  1OOP A;  3WHT A;  1W8N A;  4B29 A;  5DUX A;  1RUJ 1;  1UL9 A;  2NN8 A;  1D4V B;  2ZX1 A;  4Z92 B;  3ZXD A;  3USU A;  2I74 A;  3KV5 A;  4XDP A;  4LR4 A;  5FWE A;  2WQ8 A;  4FCA A;  1MS3 A;  4AI9 A;  3V0B A;  5A70 A;  1TVG A;  2X8K A;  3JD7 1;  1XC6 A;  3V0B B;  5A6Z A;  3A22 A;  4DQA A;  3ZVX A;  1JYV A;  5FIX A;  5A7S A;  4CEW A;  1BHG A;  5G05 L;  4DIQ A;  2YBS A;  3GJA A;  4R4Z A;  5KR7 A;  1JTZ X;  4XJ8 A;  1V6M A;  3U75 A;  2XML A;  4I3G A;  4JRA A;  2VZ3 A;  2J42 A;  1Q8S A;  1ND3 B;  3D5O A;  2WO3 A;  4NMI A;  3VKO A;  2WO2 A;  2GAU A;  3WT3 A;  3I8T A;  4Q2F A;  4E4S A;  3OPZ A;  2VUA A;  4RHV 2;  1JUH A;  3IDC B;  3LDK A;  4YRD A;  5F3E A;  3ZFG A;  3AP6 A;  3FJS A;  4TLG A;  1W8O A;  3PDQ A;  2WWU A;  3H1Y A;  2VTX J;  1QXP A;  1SG3 A;  2JD9 A;  2PLV 3;  2GAL A;  3B93 A;  4E8C A;  5BYN A;  2DVB A;  4Y1Z A;  3CIH A;  3VHO A;  2JDH A;  3MIE A;  3UET A;  1QJF A;  3VBO A;  4ZKT B;  4W4Z A;  1XQN A;  5DUU A;  3IDA A;  4AI1 A;  1YXW A;  5A33 A;  4GUL A;  4JAA A;  1IZ3 A;  3GNE A;  1VB4 A;  5JXH A;  5AC9 1;  1G7Y A;  1TME 1;  3RG0 A;  2WFP A;  3AMP A;  1AJO A;  1CAU A;  4NJ4 A;  3B69 A;  4YAR A;  1AR7 2;  3AB0 A;  2B4K A;  2WSV A;  4LE3 A;  3DPR C;  1CWP A;  4QQ2 A;  1LR5 A;  2DBN A;  3D82 A;  1LHU A;  1T6G C;  2Q30 A;  1UZY A;  4CU9 A;  1LAJ A;  1U0A A;  4QXH A;  3H8X A;  3LIG A;  1A6C A;  1NZI A;  3NV4 A;  3WUC A;  1HRV 2;  1S4C A;  2XLG A;  4GWI A;  2WNO A;  3MIB A;  4K7J A;  5F32 A;  5A7O A;  3RFR A;  4RGK A;  2F4L A;  2YDE A;  3VZO A;  2HJI A;  2ZGO A;  4I01 A;  2GH2 A;  3G7D A;  1IKQ A;  3T2Q A;  2R0F A;  1S55 A;  2P6C A;  4RGG A;  4YG0 A;  5FMO S;  5T52 A;  1C57 A;  3U4X A;  4BK4 A;  5IVF A;  1IQD C;  2JIJ A;  2DTY A;  4LHS A;  4G9S B;  3QOP A;  2Q1Z B;  2R7E B;  3LB9 A;  2XQX A;  4W65 A;  1HV1 A;  4N53 B;  5DAV A;  3U78 A;  5KBF A;  1FOD 3;  3PU8 A;  3SEE A;  3PTR B;  4CEY B;  2WNV A;  1OC1 A;  1ZRD A;  2W95 A;  4CE8 A;  2ZPX A;  1BK0 A;  1NY7 2;  2Y6L A;  1E5H A;  1VR3 A;  4CDX A;  4Q0U A;  4MGZ E;  1F9K A;  3HQU A;  2DTW A;  1QNY A;  4XZU G;  3OBR A;  4K9S A;  3FBY A;  4NPL A;  2NM1 A;  2VZR A;  4Y3O A;  5LWB A;  3ACH A;  2ZML A;  2UYA A;  2HBU A;  1EV1 1;  2VQ0 A;  4CP1 A;  5DZE A;  1RUH 3;  4D94 A;  1I5P A;  1OVP A;  2QQN A;  5HPO A;  1DLC A;  3K3N A;  1ULP A;  2VBB A;  1GNY A;  1OOP C;  3N9M A;  5EWS A;  5JR2 A;  2Y0I A;  3BU7 A;  2WNE A;  5C3R A;  3LAG A;  1PGL 1;  3H1M A;  3GCX A;  4X8N A;  3R0R A;  2FMD A;  1IS4 A;  1W3V A;  1WLD A;  5APA A;  3AMQ A;  3EMR A;  4PDW C;  1F31 A;  1RUD 1;  1CAU B;  4XYX A;  2TNF A;  5I91 A;  4WM7 C;  1IKP A;  3T2T A;  4Q0Q A;  1DYP A;  3ACG A;  3LOB A;  1APN A;  1H8V A;  2CL2 A;  1O8P A;  1PVC 2;  1W6O B;  2C9A A;  2E7Q A;  4IEP A;  1UY4 A;  4O61 A;  4PDW A;  4QQP A;  3NJV A;  1FNZ A;  2IXJ A;  4EQV A;  1WCU A;  4IES A;  4YZ5 A;  4AVA A;  5LA0 A;  3LE0 A;  3WNN A;  1J3Q A;  4CU7 A;  1D2S A;  1NXM A;  1IPK A;  3HNY M;  5IWF A;  3ZN6 B;  4E8D A;  4HZF A;  3OYW B;  1ND2 C;  5LY1 A;  2HWB 1;  3WG2 A;  2OUJ A;  4LBN A;  1MPX A;  4OI2 A;  5CIR A;  1YFW A;  1JOD A;  4QDR A;  2GC3 A;  1OI6 A;  1PVX A;  3PTY A;  4LO8 A;  3KT4 A;  4UOJ A;  4AFM A;  1FNY A;  2MEV 2;  4K1Y A;  3VZN A;  5C4W C;  5DG1 A;  2Y6J A;  1AR9 3;  1YCI A;  1PK6 A;  1WUV A;  5FKC A;  2BWA A;  1YQ5 A;  1U5Z A;  3VBR A;  4LT5 A;  4D7Y A;  3ZN5 A;  1QF3 A;  1RMU 3;  3K4D A;  5DXD A;  3ELN A;  1HN1 A;  3LPG A;  3ZXF A;  5IT6 A;  3I3Q A;  4UF0 B;  3AZZ A;  3ZR6 A;  2X5I C;  4H2A A;  3PU3 A;  1ZZ7 A;  2XBO 3;  1WWY A;  1NG0 A;  3HVD A;  1QQP 1;  1WCK A;  3WDT A;  1TME 2;  2YXS A;  1PNF A;  1Y9M A;  3LFI A;  4CCJ A;  2A5Z A;  3KVA A;  4I02 A;  4KH9 A;  3V64 A;  3ZPY A;  3BKZ A;  2XHK A;  4Q27 A;  4TZD A;  4Z2A A;  4JQR A;  1XNC A;  5GLV A;  3AYD A;  3QH6 A;  2J1U A;  2OS2 A;  5L19 A;  2VQT A;  1ONA A;  4HET A;  4AQ6 A;  3IPV A;  2QCS B;  3SMH A;  2UU8 A;  1SFP A;  1RIT A;  5GZD A;  4HAN A;  2VQU A;  1GP5 A;  5CA6 A;  4FFG A;  4IV1 C;  1GOH A;  4Q4Y 1;  5IVJ A;  2ARB A;  4EWD A;  2VAU A;  1CAV B;  5EJ3 A;  4JGZ B;  4CDU C;  5JSO A;  1Y4W A;  2PHF A;  2VVD A;  1K5M C;  4Y1Y A;  5JMC A;  1OLR A;  3WW1 A;  1A8D A;  3VKN A;  2X09 A;  3MLK A;  2WRA A;  3S6P A;  3EYP A;  4NWW A;  1JU3 A;  2D6O X;  2YB7 A;  2Y33 A;  3MPB A;  1DHK B;  2DCY A;  2WKK A;  3A21 A;  3SNM A;  3AYC A;  5GLU A;  1MEC 2;  1PHM A;  4N43 A;  4IQP A;  4LMF A;  1YFU A;  2BNO A;  2D3R A;  2VCC A;  4MGK E;  4Q5O A;  5A1F A;  1TMF 2;  2NPI A;  4FFF A;  3PUS A;  1VJ2 A;  4FPO B;  4NHY A;  3WCS A;  2RDS A;  1IS6 A;  4DNY A;  1XRU A;  4SBV A;  5CG8 A;  3M1H A;  2Q8D A;  1RUI 3;  5KHG A;  3W5M A;  1I9R A;  5IW0 A;  4I3P A;  2HWC 1;  4JHT A;  1B35 C;  4Y4R A;  4ASM B;  1PM4 A;  4QXK A;  1OPO A;  2LS6 A;  2YPJ A;  4IXL A;  4N7U A;  1UOF A;  2R07 1;  5DQ0 A;  3VD5 A;  4AL9 A;  1G9C A;  3BUC A;  4LK7 A;  5A3W A;  4WBB A;  2D3P A;  1PZ7 A;  2DVG A;  3DKQ A;  3M3C A;  4FPE A;  4NAO A;  5L9R A;  4CP0 A;  2FD8 A;  2JX9 A;  1RUG 3;  4OUL A;  3UYJ A;  3ZXJ A;  4J1X A;  4AVC A;  2D5H A;  3KF3 A;  2WFF 3;  5KXC A;  1WW7 A;  1UZ0 A;  1LES A;  3ZXE A;  1LGN A;  4NRP A;  5D2A A;  4ES9 A;  3S57 A;  1IPJ A;  2P2K A;  3PUA A;  4N53 A;  5CYY A;  5LEJ A;  4N90 A;  5EHD A;  3I2F A;  2BYV E;  5C5T A;  1ND3 A;  1V00 A;  1YRZ A;  1HJG A;  1O3Q A;  3M3I A;  4IGO A;  3JB8 A;  4ASL A;  5C3O A;  3GZA A;  1TG7 A;  1LRH A;  4DRV A;  1SAC A;  4PI2 A;  2A6W A;  5FFO C;  5EYX A;  3TN9 3;  2GNM A;  3J9S A;  2D40 A;  4NVP A;  1V70 A;  1JYN A;  1ND2 A;  2D6P A;  5FLH A;  3RRD A;  1FPN 1;  4P9X A;  4NPR A;  5DN2 A;  3ES4 A;  5KXD A;  1HJF A;  2FDK A;  1OLQ A;  2O1Q A;  2CAU A;  3SKV A;  2VR4 A;  1RUN A;  4CCE A;  2QE3 A;  5HV0 A;  2ZZQ A;  4AXO A;  4FTB A;  2WZE A;  3USU B;  3T0D A;  1QHD A;  4XAC A;  1CZS A;  4Y22 B;  1LOB A;  3MIG A;  4Y1V A;  5FZ3 A;  5CFD A;  3THP A;  5HCA A;  4QM9 A;  2W1U A;  5LEK A;  2XXZ A;  1DGW A;  3GZU C;  5GLT A;  3WF0 A;  4Q4X 3;  4IEQ A;  1C1L A;  4YVW B;  2XWB B;  1NCR C;  1QEX A;  1UN1 A;  3QD6 A;  4YW2 A;  4DUW A;  2NQY A;  1HB3 A;  3C8X A;  4N43 B;  5LA1 A;  1OLM E;  5FPV A;  5K9Y A;  4RR3 A;  4P5Y A;  3WHU A;  2C6S A;  3KQR A;  2CAV A;  3HEI A;  4FOV A;  5C9A C;  2XUM A;  1H2N A;  1HB4 A;  4P9I A;  2XJR A;  3J4U H;  5FZF A;  1OKO A;  1QY4 A;  3JUU A;  4GB3 2;  3ZOI A;  3ME2 A;  4U2A A;  4RQP B;  2E32 A;  2OZ6 A;  5CFC A;  4MXW B;  1I5Z A;  3FLR A;  1LOE A;  2HEY F;  4MZU A;  3KF5 A;  2JIC A;  4AAP A; 
#chains in the Genus database with same CATH homology
 2V4A A;  3OUH A;  4XC9 A;  3W21 A;  5C5U A;  4MHU A;  5DAX A;  5DAQ A;  5IAT A;  4J25 A;  2JIJ A;  5L9B A;  5LAS A;  2Y33 A;  3NNJ A;  4IW3 A;  5DAV A;  2RDQ A;  4Q5O A;  3W20 A;  2RDR A;  4NHY A;  2OPW A;  2RDN A;  2RDS A;  2G19 A;  3OBZ A;  5ERL A;  4XCB A;  2FCT A;  3HQU A;  2Y34 A;  5DAW A;  4ZPI A;  4JZR A;  2HBU A;  3NNL A;  4UWD A;  3DKQ A;  5L9R A;  5LBC A;  4NAO A;  4NHM A;  5DAP A;  5EPA A;  4XAA A;  4KBZ A;  4MHR A;  4Y5T A;  2RG4 A;  3MGU A;  3EMR A;  2FCU A;  2HBT A;  5IAV A;  5HV4 A;  4BQY A;  5C5T A;  3ITQ A;  5LBE A;  4BQW A;  3GJA A;  3GJB A;  4ZON A;  3GZE A;  5M0T A;  2G1M A;  4XAB A;  4Y5S A;  5HV0 A;  4NMI A;  4NHX A;  5LA9 A;  5A3U A;  3KT7 A;  2JIG A;  3PL0 A;  3OUI A;  4XAC A;  5L9V A;  3KT1 A;  3BVC A;  3KT4 A;  2FCV A;  2A1X A;  3NNM A;  3HQR A;  5LBB A;  4BQX A;  4NHL A;  3OUJ A;  4XCA A;  5EQU A;  5LAT A;  5IAX A;  3NNF A;  5EP9 A;  5LBF A;  5LB6 A;  4NHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...