3GJAA

Cytc3
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
310
structure length
265
Chain Sequence
ANFTFSPEEVARFERDGYIGPVKIFEPEEMTRRWNIIRRQLLDRSLAIYPDSNGKANISNYDRHLDIDLLAEHIMRPEIVDRVGSLIGRNLLCWRSEFFPKYQGDEGTDWHQAATFAHATGKPQIIWPSDEGRPAFIGTITVWTAFTHSTEQNGCLQLMPGTMNYDESAYPMVLKPGEAVIFWSNTMHASLPHTGSKTDYRMGFAARYVPTQVQVYPGTENLTEYGDGINLEKYGAVLTSGVDEYGHNRIARTSQRGYEFVPRQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords CytC3
publication title Structural analysis of an open active site conformation of nonheme iron halogenase CytC3
pubmed doi rcsb
source organism Streptomyces
total genus 71
structure length 265
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05721 PhyH Phytanoyl-CoA dioxygenase (PhyH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 3gjaA00
4NMIA 4UWDA 2Y33A 5DAQA 4ZONA 2RDNA 3NNMA 5DAXA 5LBCA 2RDRA 4NHXA 3NNLA 3GJBA 3PL0A 4BQYA 4XAAA 4IW3A 5LASA 4XCAA 4NHKA 2RDSA 2JIJA 2JIGA 5L9BA 5ERLA 4JZRA 5HV4A 3HQUA 3OUHA 4BQWA 5DAPA 4XACA 3GZEA 3OUJA 3KT4A 5EQUA 4NHMA 3OUIA 4MHUA 4ZPIA 5L9RA 5L9VA 4KBZA 3EMRA 3KT7A 3BVCA 4NHYA 5EP9A 5IAVA 4Y5TA 4XABA 5LBEA 5C5TA 4J25A 2HBTA 5DAVA 5LB6A 2FCUA 5LA9A 2RDQA 4XCBA 3KT1A 5M0TA 5C5UA 5LBBA 4Y5SA 5LATA 2G19A 5IATA 3DKQA 3MGUA 4BQXA 4XC9A 3W21A 3NNFA 2FCTA 3W20A 5EPAA 2RG4A 5DAWA 2A1XA 3OBZA 2FCVA 5IAXA 3ITQA 4NAOA 3HQRA 3GJAA 3NNJA 2HBUA 2OPWA 5HV0A 5LBFA 4Q5OA 2G1MA 4MHRA 5A3UA 2Y34A 4NHLA 2V4AA
chains in the Genus database with same CATH superfamily
3PJQA 3CQOA 1BHGA 2VY0A 4XFAA 2QZ3A 4L99A 4ARYA 5JOWA 4LBQD 5IVFA 1W28A 3BTZA 4QPGC 5FZ7A 2IXJA 5FZ9A 3ETPA 5CU1A 2Q8CA 3KHCA 1F9KA 2WNVA 4NRMA 2BERA 1SLCA 4FVVA 3H8RA 2V73A 3ZN6A 2JDPA 2NZ9A 4Y24A 1UYXA 1REFA 2X53S 4F83A 3R4UA 5DQ0A 5FYHA 4AGRA 5LK7B 1WA4A 1O5LA 4XAAA 1DDLA 1L7RA 1W0NA 1TZOA 2R062 4QDQA 2EIBA 3AFKA 4CU7A 2B9VA 1UY4A 2HWB1 4DPNA 3FUQA 3INAA 4BIOA 3E5XA 3IPVA 1UU6A 1KEXA 4YG6A 4CRQA 2JD4A 2DBIA 4NN0A 1OLQA 2OPKA 2WNVB 2D3PA 1NZIA 2YPDA 3AMNA 3BGAA 1GP4A 3KMHA 5KXBA 3ZN6B 2A75A 3IBMA 4RA0A 1AX0A 1WMEA 2BZDA 2PAEA 1YQ2A 5F37A 3MPBA 4DY3A 1IHMA 5FWEA 3TAYA 4XMAA 1Y4WA 5AC92 2G9GA 1QQP3 3VHPA 1HN1A 1AX1A 2QKDA 2FDFA 5JXJA 4Y4YA 5T50A 2Z79A 2ERFA 4EV0A 1APNA 1YNAA 2X09A 2PTMA 3IPVB 5K4LA 4UFMA 2XBO2 1VBB1 4D0QA 1VBA3 5C5TA 1W8OA 4YM3A 1OLME 2FDIA 5FJHA 2FDJA 1RVF2 3I2KA 4IERA 5JVVA 3S5QA 2E63A 1GNHA 5HXVA 5LB6A 3K3OA 1J58A 2XVGA 4AVSA 2VW0A 2VNGA 3B7MA 4NIIA 2RVAA 1R092 3OSDA 1MS4A 4OMDA 4K20A 4HANA 2ETEA 3AZWA 1VBE2 4K8RB 1WW7A 4P5HA 5C5UA 4LIUA 2UY9A 1QWRA 4HKWA 2XMLA 3CIHA 1HRV1 1NXMA 3TN93 2WRAA 3NSTA 4BK4A 4FXGB 1RUNA 4YW5A 3GYDA 4Q8LA 1TME1 2Y0OA 4JCKA 2FHRA 4AI9A 3K4AA 2VTFA 4IEWA 5E89A 4HKOA 5B4XA 1OT5A 2DTYA 5DZEA 1ZNPA 1DYPA 3GALA 2JKBA 3RI9A 1TE1B 2D43A 5GM0A 3VUOA 1GOGA 1NCRA 1W9SA 2BNOA 3MPPG 3JCIA 3MV11 1XNBA 2OX0A 4IV3C 1OFSA 3W58A 1ZRFA 1DYOA 3LE0A 2Q30A 4M4PA 3LOBA 1SFPA 4PQQA 4DUVA 1LECA 1KGYA 3AK0A 3LAGA 2PHFA 4HONA 4Q4X1 4W6XA 4B8EA 2DBNA 1QXRA 2WQ4A 1IPJA 1C5IA 1SBDA 3NAPC 3O12A 4M0HA 4XE9A 4XZPA 4CEWC 3BIEA 3HN1A 1NA1B 2TUNA 2HWF2 2VL4A 4MYEA 1XE8A 3WR0A 4N7IA 5FZ4A 3WCSA 4GZ9A 2Z69A 3S0MA 5LA0A 3MIHA 2VULA 1Z78A 1WCDJ 3MF9A 1BKZA 2W1WA 3IMMA 1NCRB 5C3SA 3ZX7A 4YVSA 3A22A 1JOBA 5CFDC 2ZS6B 4PIXA 3UL2A 1C3HA 4JGZC 2AACA 3WEZA 2ZAHA 5KHJA 3B3QE 3GXUA 4S2GA 5FJKA 3ZDSA 4BDVB 3AM2A 1SLLA 3GJBA 2DFBA 3H3LA 1UF2C 3PUIA 3PMEA 2WAOA 2MPFA 2XVKA 4QXHA 5FYMA 5FUNA 1SBEA 3A0NA 3IIIA 2IXIA 4XPVA 4CP0A 4YVSB 3VKMA 2DCTA 2VVFA 4E8CA 3WW4A 4FCAA 5A33A 1JH5A 5HCBA 4AI0A 2WT1A 4BU2A 2J1TA 2YFUA 3OUHA 4IE4A 4Y3OA 1G9CA 4NIHA 1SLTA 4QT6A 4TSVA 5JUVA 2ZMLA 1Z7S1 4QPIC 1R1A2 5EQUA 3OUIA 2F4PA 1EY2A 2NM1A 3RQ0A 2HKXA 1EV11 3ILFA 2D6NA 3O1MA 1F15A 3H1YA 1LESA 1ND3A 2ZX1A 3ENRA 1PK6C 1LOFA 5FLJA 5A33B 4EN9B 1JOJA 1DU3D 3I3MA 5FZMA 4QX2A 5FYTA 1PVC3 3RPQA 4YM1A 4AI8A 4QU1A 4BIFA 2D6MA 5KXDA 4QX5A 4RQPA 5EZWA 4J25A 4EWDA 2HBTA 2JDHA 4Z2AA 5IVCA 1U5XA 3TEZA 1VBD2 3Q8AA 3WUDA 5FZDA 2E31A 4ATFA 1RHI3 5FV3A 2J1AA 2RV9A 5ACA2 2BPA2 4B1LA 3B5LB 3GF6A 5FKCA 3NKTA 4OQ8A 4C8DA 1ZZ8A 4FPGA 2UWAA 1ND3B 1JHJA 2OA2A 3U14A 5IK8A 1FOD2 3NJYA 4KH9A 5FPBA 2XH6A 1PIV3 4HMZA 3ZXDA 1IKQA 3K4DA 3O0WA 1S4CA 5FZ8A 1XOYA 3UKVA 3WDUA 4XUPA 3SKJE 4XOGA 1B35A 1AL23 4RQPB 3OBRA 4QKNA 1NT0A 4IL7A 2WN2A 1JZ6A 2EXKA 2ZXQA 2WO7A 2ZA9A 3SXWA 1UX7A 2XKPA 4KI5M 1WWYA 3S7EA 1MEC3 2JG9A 2OQ7A 2PFWA 4KGQA 3VKFC 3HVDA 3PDQA 3DPRC 2WYFA 4CUGA 4A45A 1AR73 1OPMA 2RG4A 2XLGA 1W05A 4LBKA 3WNPA 5DPNA 1WLDA 2FDHA 3LIHA 4XDOA 5KHIA 1FPN2 2XL9A 3ZMOA 3ZN4A 3BUCA 3HQRA 2IC1A 3RVHA 1O4TA 3DYPA 4PHZA 1VRH2 1K5JA 3NNJA 5JXHA 5JXGA 4I2OA 2BVVA 1LHUA 1AYM3 1QXPA 1RMU1 4RGKA 3MF6A 4DFSA 5K8SA 5K9YA 3PUQA 1PZ8A 3H1MA 3BTYA 2CDPA 4NPLA 4JTOA 4CDUA 2HEYF 2WUHA 3FMGA 3BPZA 3L9JT 4NRPA 1K5MA 1ODNA 2Y33A 4ES8A 2WS93 4LKEA 2XPJA 2VAUA 5T5JA 1PZ9A 1S2EA 2RDNA 2XJVA 3NNMA 2H6BA 3NNLA 1VAVA 2WNUA 5DDJ3 4Z82A 1AJOA 3JUUA 2VCMA 2QQIA 3I7DA 3WG3A 2X5IC 4JDMA 5CNAA 2GP3A 3TNQA 2HJIA 1R083 4Y1ZA 1W06A 4G3YC 3OGRA 4RHV3 1ENXA 4YZ3A 5EYXA 2WLQA 5F3IA 5JAXA 1ULDA 2ZAAA 4CDUB 3AC0A 4MSVA 1JODA 4L92A 4JRLA 4COZA 1Z0HA 1COV2 1K5MB 1GWLA 1PM7A 3HJRA 1W6PA 5A70A 1RUJ3 4K40A 4UFKA 2OZJA 3HQUA 5EHDA 2GC0A 5EV7A 3AJZA 2R7EB 4AI2A 4HT1T 4L11A 5FOJB 4A44A 3C7EA 5FZEA 1RUD3 1XNTA 3MEPA 4I30A 3OGGA 1NOVA 4FOVA 4LBNA 2WZEA 4TN7A 3N4MA 1YJKA 3BIWE 4X6RB 4QKDA 3BI3A 2B8MA 2FMDA 3K51A 1DZQA 2VVEA 3LSEA 5DUWA 4YW2A 2WKKA 4OZXA 2H0BA 3DYMA 1W6PB 4PLMA 3Q8CA 3O1UA 1UZYA 4Q27A 4XABA 5FZBA 1F4HA 4TXWA 4QPYA 3KV6A 5I8SA 4N53A 4NUBA 5FY1A 2QQUA 5LRRA 2FMYA 4PDWA 2HWD2 1UD1A 2K0GA 3A7QA 3KV4A 1G7YA 2DWRA 4EJRA 4TLFA 5DUXA 5AFBA 4QAWA 5H9QA 3WF3A 2JXAA 2RR12 2ILMA 4G9SB 4P9GA 2TEPA 3THPA 4I0AA 4ATEA 2EXJA 4FQZA 1ZM1A 1S0IA 3PIGA 4EWAA 1S0JA 3ZXKA 1JZ4A 1H2LA 3IT8A 4FPFA 1PO21 3LA7A 4S2DA 5FZKA 5HCAA 1T2XA 1UWWA 1ZBE1 2GMEA 3KWVA 3WP5A 5A3TA 4IQPA 5C9AC 4W65A 2JD9A 4N53B 4BMEA 4D8MA 2UYBA 1VBB3 3KHBA 5FZCA 5J36A 3LDKA 3KLSA 4GALA 1NCQC 1E5HA 2P3KA 1V6NA 3VZLA 1N47A 3M7AA 2Q0AA 2ADEA 2ARCA 2BJSA 1VB2A 4YZ4A 4B7EA 5I0TA 2D6LX 3PVBB 4E2QA 4RR3A 2OZ6A 2ATFA 1FT9A 3W9AA 1POV1 2EAKA 4FAGA 4XJZA 1QKQA 3QLQA 3R4SA 4LBMA 1JZ8A 3ILRA 4EWEA 2VMFA 4Q8KA 1ZBA1 4R9AA 2JICA 1W9FA 1HRV3 2J1UA 1ND2C 2LM3A 1UMIA 2NN8A 1Q43A 1YYNA 1P8JA 2JEMA 4GAZA 1F4AA 1BCXA 1TME3 1XE0A 4GB32 5LEKA 2XLFA 2C9KA 5JR2A 1H4HA 3VDDA 4DXTA 4NIDA 4LHNA 1HRI3 2RM21 3MIEA 4OHVA 4RR3B 5BXXA 2WSVA 4U2AA 4XUOA 1C5HA 3D0JA 4YLZA 4IGOA 3T0BA 3ZO0B 4HN1A 5BYNA 3ME2A 1VJ2A 4QXBA 1TG7A 3POWA 4Q4V2 1ZA7A 1HXS2 3FZ3A 5J3UA 4K21A 1C8NA 1QMJA 3TB0A 4NAMA 1FATA 3VDDB 4AQSA 1H9PA 4ZXKA 2LROA 4M3CF 4NROA 4CCOA 4LMFA 5JIUA 5LASA 3OOXA 5ABJB 1GMMA 3E6CC 5C8CC 2BP6A 4NHKA 4P08A 3UV9A 4K9SA 1NX9A 3RS6A 5L9BA 5BNPA 5KBFA 1D0GA 3BKZA 5A6XA 1MS5A 5CBLA 2DVDA 1UOBA 3DXUA 4B4PA 3VHNA 2DVBA 1IOAA 4B3NA 4CDQC 3DUIA 3U37A 2YB7A 1OC1A 3A23A 1W6QA 4EN6B 3H0OA 4GH4A 4Y26A 2EICA 3F2ZA 3URFA 1L7LA 3PJYA 2VOKA 1RL3A 1DF0A 1ZZ6A 2VZUA 2NQYA 3OG2A 1YIPA 3MFAA 1J59A 2VCCA 5BNPB 1H0BA 2G9ZA 2QQOA 3VBSC 5IAVA 1EP0A 1T6BX 3NV2A 4MXWA 3POYA 5KR7A 2WZPP 2WZR2 3MBWA 4LUMA 4UFIA 1VBA1 3ZYRA 1S0FA 4IEPA 1W6QB 5FBJA 1RUH3 5BV6A 3LQCA 4GH4B 2VZPA 1BVP1 3MIGA 1Z7S3 2MNGA 2XONA 4N9IA 2AREA 4DEQA 1MR5A 3MO4A 1WMFA 4ASMB 4QHOA 5C3PA 3OBAA 5EFUA 3MIBA 1OH3A 1OMIA 3BYWA 2ENRA 4K3UA 1JXNA 2DUPA 4JKLA 1GNYA 3D6EA 4MXWB 4XDQA 2JB8A 4Y5SA 4PF1A 3TN91 3J7MA 5DG1A 1RUC3 4QXKA 4RS5C 5GJ6A 1XNAA 4HFSA 3P1IA 3AYDA 4BXSV 4R4XA 3IMNA 2FZ2A 4ZS2A 2ZTNA 1O4YA 1GICA 3W20A 4FOQA 4ZKTB 3AJYA 3AP4A 1UNBA 3RDIA 3HQXA 3JD72 5F6KA 1WBLA 5FPUA 1QH6A 1RUF2 4I02A 4ISQA 3FBMA 2QDRA 4IV3A 4A3XA 5CADA 2VZQA 4XDPA 2EXIA 3FJSA 1OFNA 2A6YA 2PHRA 1OUXA 3KB5A 2C1FA 1UCXA 1C28A 4OI2A 3AKSA 1DLCA 4DMIA 3WHTA 4M3CE 4CCMA 3H8OA 5GLTA 2W95A 1CZSA 3HN3A 2QQJA 3DYOA 5CG8A 5D8AC 2E51A 4QB6A 4C1WA 4CA9A 1TEIA 4CEYA 3U10A 1PGW2 2W9XA 4IV3B 4O9EA 4FOWA 4LO4B 5JSRA 3GHNA 2X05A 3T1MA 1BBT1 1O3SA 1RUOA 1R64A 3DEMA 3RFRA 2JG8C 1V6JA 4WVMA 2AYHA 1VBC2 4QXCA 3WX5A 2GMMA 4LJHA 2YC0A 2YY1A 4FFHA 4LA2A 4NHXA 4AEDC 2BBVA 1U5YA 4XJAA 5F3GA 3SLIA 2D6PA 4Z8BA 5F7UA 4QX3A 5LZ6A 4OYUA 3FLTA 3WP6A 2HWE3 2B39A 4Q4W1 1X8MA 1FAYA 1RMU3 1CPMA 1TNRA 1V6IA 3M2MA 2V72A 2W1UA 1V9U1 4V2VA 1FMD1 2OKXA 1KS4A 4AGGA 1RUI1 2H0VA 2P3IA 4CUAA 4D7YA 1BMV2 1N3OA 3QACA 1O3RA 4WVMB 2GAUA 2JDKA 2JWPA 2O1QA 5IK5A 4XBQA 2QE3A 4JZRA 1UMZA 3SEEA 3TNPB 3WOGA 2UWBA 4LKSA 1T6GC 2BVBA 3LD8A 5BNNC 2F4LA 1C8M2 4MGTA 3GZEA 1AL0G 3KT4A 3THTA 3VZMA 2PXJA 1AR91 3GZTB 4NHMA 2R0FA 3OEAA 1QXJA 5JI7A 1RB8G 2JB4A 1TMF1 4XJ8A 5JOYA 1XYPA 2G4IA 5JOXA 1VALA 3AYEA 1SFNA 1UU5A 5FMCA 1KDKA 2R041 1CIWA 1SACA 3J8F1 4E4DX 4NHYA 3KD4A 3DV8A 5JDBA 2BQPA 3P6BA 2Q1FA 5LA1A 4YGDA 2XUMA 3WNLA 3I2IA 2GMPA 1UPSA 3ECQA 1GOFA 4OLLA 5F3EA 4OZOA 4UXAA 2CTVA 2WA4A 4DRVA 2EALA 1RHI1 4XF9A 4XUNA 2OYZA 2RS53 3SH3A 3VBRA 3WD5A 3C3VA 1A78A 2YZ4A 1PO13 3ZSLA 3W5MA 3K2OA 3BODA 3LA3A 3ST7A 2P4EA 2R073 3B93A 1ZA4A 3N9PA 2DCKA 1PIV1 4GULA 5E6HA 3USUA 2AR6A 1GQHA 4QU2A 3ZXAC 4D7TA 5CFCC 2F17A 1YI9A 5LATA 3WZ1A 1LOEA 1U0AA 4QDRA 5LW9A 1S55A 1KDMA 1AL21 1XNKA 5FXWA 1AR83 1QU0A 1UW8A 2ID4A 3WF0A 2XLAA 4XC9A 3USSA 4BQXA 3IAQA 1NY71 1PVC2 1LU2A 1UY0A 3PURA 2D98A 4A41A 3VBRB 2QBXA 1Q8PA 5A6YA 4P9IA 1XU2A 4D7SA 1AYN2 1KJLA 2W47A 5JIAA 1EYBA 1YUDA 2GNMA 5LEJA 2VC9A 1WMXA 2NPIA 3OBZA 1AR71 1HKDA 1WCSA 4QQ2A 4QQPA 1D4M2 1JOPA 3USUB 3ITQA 1O91A 1G6NA 4FTEA 1PO23 4PI2A 3NRUA 2DCJA 3T4VA 3A21A 3H8UA 1UL9A 3PTRB 4P5YA 4JQTA 5I8YA 3FN9A 4NO4A 3EHKA 4BJ0A 3O0VA 4H55A 5GZGA 1ZZBA 5F3CA 4XEZA 2FD8A 4FAHA 4CEYB 3O1VA 2VG9A 1GU3A 1GKBA 1AYM1 1URXA 3I54A 2OS2A 3RYRA 3PIJA 1PMIA 3CNAA 4AHZA 4JVAA 1OVSA 1NQDA 2DUOA 5T3NA 4M4RA 3JU9A 5I93A 1D7PM 5G05L 4BXFA 3N7MA 2R30A 2NMNA 1POV3 4XW3A 1MEC2 1S0BA 4UWDA 3RJ2X 3WLUA 1F31A 2ZEXA 5DAQA 3ZN5A 4B4QA 5KWRA 2CGPA 3RZKA 2J1EA 2YBSA 3FWEA 3H1WA 3ATGA 3WG2A 3NMBA 1ZBA3 4W6YA 3AKRA 3I2JA 3WG1A 4ES9A 2Y38A 1DQ6A 3AKTA 3VBUC 2R1DA 1CPNA 1PMJX 1OQEA 1WKYA 4Q4Y1 1ENSA 2HWC2 2UURA 4LK6A 1HJGA 5DDJ1 4UW6A 1KXGA 2RJLA 4ZS3A 5CVRA 1W6NB 3FFZA 3J7NA 4O7XA 4KQ7A 4EN0A 1I6XA 1JS9A 2DV9A 4F7ZA 5IVVA 1GNZA 4NIGA 2OVUA 5JZGC 5BNOC 2RM23 4YPJA 1WCUA 2BGCA 1DQ0A 4GWIA 3UYJA 3VDCA 2BWCA 4P9WA 3CEWA 1IG3A 5J37A 1JMUB 4MX3A 5J7MA 1AR62 1RUJ1 3HAGA 2WFF2 4MV2A 3U11A 2CSGA 3MDPA 3K75B 2WS92 2MEV2 1RUD1 1M06G 4D3WA 1J83A 1YO8A 2C4XA 1ASJ2 2QJVA 2X5IB 4PIYA 5DN2A 2Y6LA 3ZLIA 3ZPOA 5GKAC 5FY5A 4AFAA 2JDNA 1WBFA 2I74A 3HBKA 4I3GA 5FYBA 1ONAA 1UY3A 1VB4A 4JKMA 1VPHA 1R082 3VZKA 1JZ3A 1RUG3 1S1AA 2D3RA 5DAVA 5F8PA 4KL1A 2ZKLA 5FPLA 3TEYA 3RZJA 1CX1A 3EO6A 3RMYA 1Q8OA 3ORJA 5FK7A 1SBFA 3POIA 5BUVA 1X9TA 3T4HB 4GMP0 2DVAA 4OHZA 2XWJB 3CL1A 1H2KA 1OOPC 1ZRRA 3B01A 2B9UA 5J09A 1SLAA 2XR4A 5CB7A 3UKNA 5I0UA 2UYAA 3IDBB 2P3JA 4FPKA 3P5BA 3RI8A 3SMHA 4FPEA 1UX6A 3T2OA 4GWJA 4AR2A 5L36A 2VNRA 2XBO1 1H8TC 3WT3A 1BXHA 3J7LA 1I9RA 5JR7B 5JOZA 2CL2A 1H8VA 1MZEA 3W5NA 5IWFA 1V0AA 4OUSA 1LEDA 1NLSA 3D8CA 1QJU3 3RRDA 4A3ZA 5HI0A 2HWB2 1NCQA 1X36A 2QFEA 3S30A 4V1PA 4YVWC 3MV01 1UQXA 2QQLA 4JTNA 2Z4FA 4YW7A 5GZDA 2WO1A 1VBE1 5B4NA 4MADA 3MW4A 1UPIA 3O14A 4XFFA 4OUMA 4YZ1A 1W9TA 1J3RA 5C9AB 5C8WA 3HD8B 1Q56A 5K0UA 1GFF2 4WM8C 1NCQB 4MGYE 4BH9A 5IVBA 2ARXA 4PLNA 1NA1A 2WT2A 5FRAA 1CESA 2XKOA 5DZFA 5F5IA 4AW7A 5ABJC 2ZPXA 1VBB2 1MS3A 3AX4A 3T3YA 5JXIA 4GKXA 1HRI1 4KBBA 3WDTA 1IS4A 2ZABA 1TQ5A 2BBAA 3NJZA 4HBNA 4AEMA 3D82A 4JV4A 3MIDA 5KXCA 1QH7A 2YDEA 4Y1VA 3RJRA 3RYPA 4QWNA 3MHZA 4WVVA 3PLQA 1WLWA 2XGXA 3M3IA 5K0UB 2GP5A 4ZXEA 1E57A 3VBOC 2XJUA 3WG4A 1PGSA 3ZFFC 4LXLA 2RMU3 4AVBA 1QDOA 5C33A 5A3MA 4EZHA 4QMAA 5A80A 2VZ3A 3H7JA 1O3QA 2D40A 2VVDA 2A6VA 2I45A 2YBPA 3UJQA 4BE3A 2JDAA 1RXGA 4G4FA 5ERLA 2B42B 1BBT3 2P5BA 3BALA 1DGRN 5D1IA 2R0HA 4OVEA 4XJ9A 4QX0A 4NE9A 2B46X 5FZ3A 4YW6A 3IDEA 3TRSB 1LNSA 2IXCA 3GHMA 2IXLA 1Q8VA 4SLIA 3E5QA 1GLHA 4Q0SA 2IVJA 3AYCA 3P3NA 4Q4X2 4YRDA 3VD5A 2DCYA 5IJRA 4Q4W3 3ACFA 3UNPA 4AEKA 3MI8A 4E2SA 1V9U3 2GU9A 1FMD3 3GCWA 4LKDA 1RUI3 4KU8A 2BV4A 1EUUA 4R4ZA 1UN1A 4XBNA 3AP6A 1DGLA 1QJX3 5FP4A 3VD4A 2GALA 2VMEA 5CISA 2Z42A 2CAUA 3VZNA 1PHMA 1RJ8A 5GZCA 1DLLA 3ZFEC 4LBOA 1RUH1 1OF3A 5FPXA 2GC3A 5IVYA 1AR93 4KWKA 1F8VA 5T55A 2A3WA 4OFGA 1O5UA 4QHZA 1TMF3 4CDXA 3N7JA 4IEXA 1O7FA 2YV8A 4AOCA 1C57A 2XHNA 1JYXA 5CAZA 5FYZA 4LQRA 2R043 1RUE3 1BEV3 4W4ZA 1IPSA 1LOCA 3ZFGC 3CJIA 3OGVA 4FI9A 1KITA 2P3YA 3J8F3 3U4XA 3L2YA 4DQAA 3BU0A 5HCHA 4ISRA 3IAPA 1G86A 2ZJCA 3PVEA 4CDWA 1OHFA 3MICA 1RUC1 3SQOA 4HLTA 1QJY3 5ACA1 3SKVA 1JYTA 1W8ZA 5GALA 2J1VA 5FIXA 1CVNA 1PMHX 3LB9A 1JU3A 2ZMNA 3UJOA 2QDNA 3N9OA 3NVCA 4CDXB 4DUXA 1N1YA 4UF0A 5EJ1B 2VCAA 5CIRA 2O8QA 1O6UA 1Z7S2 1UXXX 2AUYA 1LEMA 3CJIB 1NLQA 3GM8A 1UYZA 4NJ4A 4QKBA 4GMP3 2Y6KA 3WQBA 2PLV3 2KA3A 1GP6A 3JBG1 2VD7A 1EV12 4FP3A 2Y6GA 4CDWB 4EN8B 1OXCA 3J9SA 1SQ4A 4N7UA 5GZFA 4CU9A 5C4WA 5I8TA 4XXAA 4M01A 4CU8A 4UF0B 4MGQA 1H1MA 4LEJA 4M0NA 2R32A 1GZ9A 3Q8BA 3ZIWA 1UIJA 1UOFA 1MVQA 2GNTA 3KV5A 4ZY9A 2V4AA 5FZLA 3LPFA 3WDXA 3CBNA 1MS9A 4JGYC 1I5PA 3CU7A 4K1YA 4AEJA 4QQOA 3I2DA 5E8AA 3RZGA 2AEYA 1CAUB 4AL9A 2DDUA 4LLFA 4FXKB 3GBGA 2ZGPA 3HT2A 3OEBA 5C4WB 4AEDA 2K46A 3ZYFA 2RS33 4BQYA 4LO8A 4PT6A 5L7OA 2YGLA 2HWE1 2OQ6A 1F5FA 4UBGA 2OW4A 4AVTA 3ZSJA 5LRSA 4BA6A 4IGQA 4CPBD 3O1PA 4XILA 2P37A 1AJKA 4QGNA 2Y6FA 5IFTA 3HIFA 3ZIXA 1YXWA 2B45X 3G6JB 4MGIE 1HLCA 4AEDB 2A7AA 1W8UA 1ULCA 4PI0A 3FFQA 3W59A 1U12A 3ZXJA 2YROA 1N1SA 2DUQA 3KCYA 3D5OA 1ZRDA 1O8SA 5L7OB 5ISLA 4Q4Y3 2BEOA 1EAH2 4CE8A 4BQ1A 2RS12 4MG2A 4XFGA 4MLOA 3RZLA 1A8DA 4YWAA 3WQ1A 2V09A 2GNBA 1W3XA 3WDWA 1ZREA 5F6LB 1BLZA 3VBHA 2KR2A 1N3PA 2WQZC 3V64A 4BQ3A 1V6MA 3I2FA 5BNNB 4XZUG 5KHKA 1LKNA 2VZVA 3NQHA 2WA3A 3ON7A 5FP3A 3VL9A 5FPAA 3SCHA 5CEHA 4N43C 4LHKA 3KV9A 4AFMA 3OJBA 1ENRA 2GH8A 5FY4A 4E9KA 2RS51 1WLTA 3J7HA 4AAPA 1BVVA 3A0KA 1XSQA 1YFYA 3AMPA 5F2SA 1PO11 4YFWA 4AFCA 3GGLA 3ZOIA 4E8DA 1NUKA 5A32A 2R071 3VBHB 1QGLA 3GBWA 1GR3A 1W8HA 3AFGA 4FO9A 5A1FA 2A70A 1WGPA 4YG0A 3ZKYA 3C7GA 5KHGA 5H9SA 1AR81 5FZFA 1JZ5A 1US3A 1LAJA 3LZZA 3M3EA 4FBFA 3L2HA 2WNVC 4LO7A 3HBZA 3A4UA 4IEZA 3J26N 2WIIB 3T09A 4DOUA 5A32B 2ZEZA 1W0OA 1PX3A 2BU9A 3JQWA 3AZZA 3VZOA 4CCJA 3WNOA 1FNZA 1RJ7A 3NJXA 1MQTA 4FPHA 2J1RA 1U5IA 4IV1A 1IGOA 3VB9A 3VD3A 2XBO3 4QB1A 1CIYA 1DQ5A 1STMA 3BU7A 1H1AA 4H14A 5FXZA 5H9RA 1BJQA 4K6BA 4LKFA 4MHRA 5JPMB 2VUCA 4WZFA 1HIXA 3C8XA 2XB6C 3HWJA 4XFCA 5I0RA 4IUGA 5FYUA 3N9NA 3ZDVA 2PMWB 1R093 1JYIA 2BFUL 4UYBA 3IWZA 1VBE3 2ARAA 4QKFA 2XOMA 3C2UA 4YGEA 1MQTB 4FOYA 3WF4A 5FR3A 4ZONA 2PAMA 4IV1B 2DTWA 1GZTA 3NWKA 3PUHA 1Y43B 4AHXA 2YFZA 1ULOA 2WWUA 4J6GA 1X50A 1SFYA 2YMZA 4Y22A 2C0ZA 2WC2A 5AVPA 1PO22 1UY1A 3BB6A 4UW4A 3MUZ1 2E7TA 2VQTA 5EXOA 5EYYA 4DO0A 3DGTA 3QH7A 1ZBE2 4HKLA 2Q4SA 2GC2A 2AENA 3POBA 1A3KA 4L97A 4XCAA 5FZOA 4MUVA 5GLZA 4ASLA 1SLIA 3FHAA 1SG3A 2ZGTA 3ROUA 1CAXA 2RDSA 4E27A 1BYHA 2LW8A 4Y20A 1XYOA 3FX3A 2WNOA 1YQ5A 4FTBA 2OT7A 5HV4A 3QH6A 4HSLA 4AFDA 4NRQA 2NP0A 4Y1UA 4KMQA 5FYCA 4LO5B 4OULA 2C6SA 4Y22B 3R4DB 3N35A 1QY4A 1OF4A 4YW3A 3AB0A 2VZOA 4QPGA 4UW5A 2A6XA 3AP5A 5FO9B 2ZX3A 4Z92B 1OA4A 5FZOB 3WV6A 3P3PA 1CAXB 3U07A 4UI9L 4XFHA 4Y20B 1LOAA 4BWOA 5FP7A 3KT7A 2BOJA 3BVCA 1ULGA 1CQ9A 1W2OA 1OSGA 4META 5FO7B 5E1RA 4LPLA 1AZDA 3VBFC 1XPWA 2J1SA 3PVNA 2GNDA 3T1LA 2W39A 4FSJA 2RM22 1IS3A 2ZEWA 3TBDA 2CV6A 2VM9A 1RUG1 2VW2A 3ES1A 3MUY1 3Q8EA 1JYVA 2WR9A 1PNGA 3LDBA 5C71A 4QPGB 2JDUA 2ZEYA 3C7OA 2AEZA 3IM0A 1ULFA 4BISA 4LIVA 1PZ7A 4CCDA 1QOTA 3BOPA 4Q0VA 3NNGA 4B29A 4GJZA 1C1LA 4BPZA 4EN7B 3B94A 1PGL1 1OLRA 3UGGA 5FY9A 1AXKA 4CSWA 2PELA 5F5CA 1Y9GA 4HSJA 3WXPA 4XF1A 2G9FA 1L3JA 3K3NA 1SPPA 2D97A 3BTXA 5IATA 2VCBA 3LIGA 2VMCA 1H8TA 4YVSC 3EXUA 5DG2A 3QBQA 2XJTA 4MZUA 3ZSMA 5T5PA 1DZRA 3EJKA 5FWJA 1YLLA 1ULEA 1QJU1 1WW5A 3THDA 1R1A3 3SNMA 4GIQA 4FPJA 2RJ2A 5EPAA 3LKJA 2ZX4A 3T2TA 4DIQA 3ZPYA 1GWMA 4A6OA 2R1BA 1A8MA 2VQAA 4LTAA 1HJFA 2ZGUA 4L2NA 5FZ0A 3R6SA 1K45A 3AMHA 4A7ZA 4V2WA 1SPPB 2E53A 2P6CA 1UIKA 4BLIA 1J1LA 1H8TB 3ETQA 3U1XA 4FT8A 1QQP2 5LBFA 4XIKA 3AZYA 5A3OA 2HEVF 1QNYA 5ACA3 5I0DA 4DS0A 5A3UA 1NQJA 5ANQA 4RD7A 2E33A 3ZXGA 4LE4A 5FLHA 3GZUC 1DGWA 1DGRA 4GA9A 5D21A 5FTTC 1YEWA 1QF3A 1XB9A 2HLEA 1VBA2 2HH9A 4P9YA 3AKPA 1H4GA 3T0DA 1XNCA 3KCXA 4AI1A 1LU1A 2OIIA 5B2GB 2MHFA 2W1SA 1ND3C 1LOFC 3KCCA 3PL0A 2OXBA 3JBG3 3NAPA 3B00A 4XYXA 2BNMA 1UKGA 1N3QA 2VQ0A 3JXSA 3E5UA 1RIRA 1H1IA 4R9BA 5GLUA 4CEWA 3K4ZA 3ZFFA 1LGCA 5A3PA 4A6SA 4QGLA 4RQPC 2RMU1 4ZU5A 1ZVFA 5FAXA 1VLNA 1UOGA 1PGW1 1W99A 1WCQA 2VZTA 3TN92 4F3JA 1VMJA 3E97A 5J48A 1W2NA 3N7KA 2PAKA 4AVVA 5KC5A 5DZGA 4YARA 1WCKA 3RWNA 3U75A 4BQWA 1VAMA 3NO8A 1FPN3 2QQPA 2XL7A 1HQNA 5CFDA 1GWKA 1W3VA 1ZZCA 1AUYA 1W04A 2XVLA 3NAPB 4Q0UA 4XUQA 1VRH3 3WCRA 4CEWB 2JE7A 2X29A 3DXTA 4JGZA 4ZPIA 3RMXA 4AWDA 1ZRCA 3QCWA 4X8NA 3ZFFB 3K46A 1CGPA 1B35C 1QJFA 3TEXA 3N36A 2PHDA 2WFPA 5FMDA 4IEYA 3ILNA 2PHTA 2IXHA 1BMV1 2A6WA 4AQ2A 4AXOA 1H6YA 2KXLA 5FMBA 1RGSA 2WSUA 4LHLA 1W8NA 4RGAA 2JG9C 3ZKUA 3AVRA 3Q8FA 1GSLA 2V5DA 4DXRA 5CFDB 5IHRA 3JB8A 1HB2A 1QJX1 2VR4A 3I3DA 4C90A 2EA7A 2XQXA 4JGZB 4RYDA 4W6WA 4XTPA 2B4KA 1BBT2 2RDQA 4RSUA 3KT1A 1BZWA 2QVSB 4JC1A 5M0TA 2PHUA 4QPIA 4LT5A 3O0XA 4J1XA 5A7PA 2WINB 1J84A 4EYUA 4BQ5A 1YFWA 3N7LA 1O4ZA 1FI2A 4R8HA 3DF0A 4COWA 2W92A 1O8PA 1RUE1 1BEV1 1COV3 3S5AA 4Q4W2 1S0EA 3UESA 1PK6A 3UETA 1Y7BA 2ZHMA 3N3HA 1FMD2 1OKOA 1W9WA 3FLPA 1IS5A 1RUI2 1XNDA 2PHLA 2VMIA 1GQPA 4CDUC 3S7IA 3WNKA 1LTEA 3KS7A 4DEVA 2UWCA 4HVOA 4E2GA 1K5MC 5F9TA 1QJY1 5JWPA 1IS6A 3UT0A 5A3WA 4QPIB 1XXNA 5FZ6A 5CKMA 5DAWA 4CCNA 5LWBA 2ZX0A 2WNUC 2ZMKA 1W6OA 1AR92 3ZFGB 2D3SA 1DQ4A 1PK6B 1JUIA 1W0PA 4AI3A 5F1RA 2FDKA 4GMP1 4UT5A 2PLV1 5I91A 3I97A 2Y6HA 4IEQA 1LRHA 2IUWA 3J8F2 5C7GA 3PMSA 1DBNA 1W6MA 3EQEA 4NVPA 4ORFA 4PCRA 2SLIA 2LRPA 2VW1A 2RR13 1W2AX 4A7KA 2GZWA 2W0XA 2A5ZA 2H6CA 3ZM8A 2E32A 2WN3A 4NMIA 4I3PA 2W5FA 4QX8A 1W6OB 4TYSA 4A2UA 1YJLA 3VD9A 3BPSA 1L7QA 2BGPA 2VUAA 4XBLA 4YNIA 3DPRA 1RHI2 3OPWA 3DECA 4WM7C 4MO3M 3AZXA 1AF9A 5LBCA 3K48A 1F5JA 4HETA 3NKGA 4OI1A 1NG0A 1UY2A 4W50A 2OUHA 2OUJA 3H50A 4HVQA 4AF9A 1V6KA 2EF6A 2WO2A 4GWNA 2JX9A 1W6MB 1PIV2 3B02A 4NWVA 3RZMA 2RS31 4N53C 2YXSA 2F6BA 5A7QA 4PDWC 2VPVA 1AL22 2JE9A 2VGDA 3CJXA 4JGYB 3ZYJB 5JI9A 1W6NA 3DPRB 1NY72 4Z1VA 4F8AA 4QX1A 2D7FA 1LR5A 3POGA 3WQ7A 3MYXA 3I49A 5T54A 3G7DA 3LEKA 1WMDA 4LBJA 1RINA 5FZIA 3CKHA 1QEXA 3M3QA 5A6ZA 4YG3A 3FBYA 1QDCA 1AR72 2B5HA 4LNVA 3RZZA 1UMHA 3LOIA 4GB33 3WP4A 4CP2A 1PVXA 3M3OA 4ET7A 1AXZA 2WDBA 2PHXA 4ZU7A 1I5ZA 2XG3A 2VU9A 1W03A 2VNOA 5EWSA 4JKKA 2X5IA 1ENQA 1J3PA 3O7OA 5SV5A 1NYWA 3H9AA 5LBEA 3LWCA 5EJ3A 3ZXFA 3OF1A 3C7HA 1RXFA 1DHKB 1G9AA 1AYM2 4RR3C 1OD3A 2Y64A 3PU8A 3VDBA 2WFF1 1JI6A 3O5SA 2Y60A 5LA9A 5A7OA 2D5FA 3POJA 1A6CA 1GANA 5IW0A 3AL6A 2VBBA 3CHXA 3R05A 2ZKNA 2WO3A 5FZ1A 1ASJ1 3AYAA 4BB3A 2AGSA 5LK5A 2YU1A 2B7YA 1US2A 4P9XA 3V0BA 5GZEA 1H2NA 4GXLA 1LHVA 1CZVA 1YQ6A 3X29B 4BMBA 2EIEA 1QHDA 2R061 3VDDC 2CGNA 4IGPA 5DDJ2 4LHSA 2W94A 2DF7A 3ACLA 1EPWA 5FZAA 4INDA 4CTEA 5KHHA 4RHV2 1HV1A 5KC6A 4KG0A 2I07B 5BNQA 4N90A 3FLRA 3VGIA 1REDA 1SLBA 4PBOA 4N43B 4D6QA 2ZGLA 4B1MA 4XAEA 2Q1ZB 4IEUA 4TLGA 3V0BB 2HEWF 1RUJ2 1OA3A 5AC91 1N1VA 5H9PA 3AP7A 5D2AA 3U4SA 2KD7A 2WLPA 3IKWA 1RUD2 3VL8A 1GQGA 2ZACA 4JHZA 4L9BA 2WZR3 2YHJA 3AXDA 3HOBA 5HV0A 4HXCA 1YI7A 2D5HA 5FUPA 4ASKA 5FYVA 1CONA 3HNYM 5BNPC 1XQNA 5C9AA 1RVF1 2QQWA 2VE1A 4O65A 4OHYA 1MZFA 2W68A 3WINE 1LENA 3O1TA 1MS1A 4DINB 1SHWB 1W90A 3ZXLA 1JZ7A 1X33A 1R091 3LSDA 4GH4C 1C4RA 3U78A 1X82A 2ORZA 4WBBA 3PVOA 3VHOA 1RC6A 1Y9QA 2TBVA 4Y1XA 5LY2A 3DKWA 2DVGA 4FPOB 3S6PA 4XHXA 2N7GA 3OBTA 2XWBB 4Z07A 3H8XA 2O14A 4MXVA 4IEOA 1ND2A 1NZCA 3ACIA 2JKXA 1QOOA 2BFUS 1PX4A 3JD73 4HVRA 4XETA 1DZTA 4Z2WA 5IT6A 3MFCA 1RUF3 1ACCA 1EPZA 3BN6A 1LULA 2J22A 4SBVA 2J42A 3DCQA 4IE7A 1UU4A 1OLMA 1V70A 4PJYA 1DQ2A 1VRBA 3LEIA 3MLLA 4FFFA 5JLVA 4JDNA 2YC4A 4YGBA 4UBHA 4BLJA 2WYSA 3UGFA 2HWF1 2YUEA 3ACGA 4YFZA 4XHBA 1ND2B 1NKGA 4IDZA 4IETA 2VMHA 4I01A 1FX5A 2DFCA 2FBEA 3E6DA 4HK8A 2PA7A 1YFUA 4GQ7A 1ZYBA 1D2SA 2X8KA 1HQWA 1YFXA 4BM8A 4ZZ8A 1HRV2 3LCPA 1VMHA 1DQ1A 2HYXA 2QQKA 4Y5TA 5FYSA 2VBPA 1TME2 5C8CA 5FY7A 1MPXA 1VBC3 2ZGRA 4QQLA 1JBCA 4BYYA 3VBFA 2FCUA 1HRI2 4Y1YA 4IE5A 4DXZA 4M00A 3VKNA 1UZZA 5LA2A 2ZHKA 4IXLA 1XU1A 1AHSA 1UKRA 4CDQA 1SMVA 2EIDA 3NJVA 2EXHA 2QUOA 2UY8A 1QJEA 2C24A 4RL7A 4I0WB 2XQRA 4ZHNA 4AHWA 4KWJA 5C8CB 2BTVC 3OYWA 5IYYA 2HYKA 3VBFB 2GH2A 4CEYC 2R16A 2RJKA 4UAPA 3T30A 3T2QA 3LFIA 1YIFA 3CZJA 3EB7A 5FBZA 3VBSA 1C8M3 4AVAA 4AAXA 1KFUL 1V00A 2FQPA 1LOGA 3TOJA 1MZ5A 4CDQB 2NLRA 1R1A1 4R9DA 4KWLA 2CY6A 5FFOC 2QZ2A 2ZGMA 4Q0QA 5HCFA 3OYWB 5FZGA 3FL7A 2RE9A 3BCWA 4OI0A 3AP9A 4MOAA 2QQVA 2O0OA 4ARXA 4H2AA 4DB5A 1JYNA 1W2UA 3OGJA 4IE6A 3VBSB 4A4AA 3VZJA 4PBPA 2C26A 4FFGA 2BUKA 5APAA 2LALA 2VNVA 3ZXEA 1VBD1 2VOXA 5FLIA 1XC6A 4KGGA 4RS5A 5AVAA 1IZ3A 4AZZA 2DU0A 1H6XA 2P34A 5T5LA 3VV1A 5A3NA 3LF7A 2TNFA 3GCXA 4XF4A 3V65A 1GZWA 1ST8A 1FOD1 1LHWA 4OHXA 1RUH2 3WQ0A 4QHBA 5DAXA 4AE2A 1MS0A 3LEGA 1GUIA 1V6OA 2WQ8A 4D94A 1Y9MA 1ZRIA 4XVHA 5DUVA 1W8TA 1BQPA 2VZ1A 3WNNA 4HK9A 2PHWA 4CU6A 5C3QA 1DGWX 1ALYA 1S0DA 5IFPA 4N8MA 1QOSA 1CAUA 4MVTA 2IFRA 2XDVA 4LULA 4TWTA 2Z5WA 4RS5B 2CU5A 5F5AA 2FDGA 3CDZB 5FMOL 1FNYA 4LK7A 1UZ0A 1C1FA 2UU8A 1DP0A 5IK4A 1GZWB 1AYN3 2JIGA 4H3WA 1SEFA 5F2WA 3ALQA 3JQXA 1RUC2 5D8AA 3IN9A 1D4M3 2WL1A 3HR9A 3SITA 3VBRC 4RFT0 2W46A 1WA6X 4WVWA 4CXWA 4GJYA 3OY8A 1JZ2A 3AMQA 2VXJA 2VXRA 1FPN1 1DFQA 4OI4A 4XFIA 4XUTA 2JG8A 4MGSA 3KVAA 2XUEA 4LITA 4MHUA 4XFBA 5L9VA 2LUWA 1VRH1 2O8OA 5IUQA 4B7KA 3MZHA 1S0GA 1K12A 1WZXA 3EMRA 3KQ4B 4HN0A 4XQWA 4LBQA 3WNXA 4OQ9A 5FY0A 1X8EA 3JBG2 4DUWA 2WNEA 3WY6A 5FXVA 5DMYA 4URTA 1O59A 5D8AB 3KGLA 1OD5A 1OI6A 1TVGA 1MACA 2GSYA 3CO2A 4E4SA 4BZ4A 4FTSA 4LE3A 3SH5A 2C5DA 3OY8B 5T52A 5HXMA 3GDBA 1IKPA 4QDSA 2IVIB 5FZHA 2JG8B 4CYDA 1WW6A 5BY5A 1VE0A 2VTXJ 4B4RA 5EJZB 4COYA 1GOHA 1AVBA 1LGBA 3IDAA 1KS5A 2Z2SB 2HWC3 1B35B 5BNNA 4LBQB 3SH4A 1EAH1 2GN3A 3ZVXA 2YYOA 5J1XA 3O1OA 2DU1A 2RS11 2VOWA 2YG0A 2QCSB 2Y8KA 3LGRA 1FV2A 1F35A 1MVEA 3NW4A 4YYOA 1OUSA 3POSA 4CXYA 2JG9B 3ELNA 3NV1A 4E4HA 2A73B 2BW8A 1COV1 2WZ8A 2HWE2 3E6BA 4Q29A 4QM9A 1AR63 3AVSA 1RMU2 5T5OA 4ITCA 2EVXA 2ORXA 3TYJA 4XURA 1LHOA 1G9FA 4BK5A 2WFF3 3WF1A 2Y6JA 2L9LA 4MGZE 2IWGB 1YQ8A 3B9CA 2CNAA 5JSPA 5J98B 3VHRA 2MEV3 3VLBB 3ZSKA 4JQRA 2GC1A 1ASJ3 4XTMA 2A3YA 2FCVA 2VECA 4RFRB 2CWMA 4ONUA 2D6KA 5J96B 1SDDB 1HB4A 5CKQA 3WW3A 1H2MA 1SDWA 2SBAA 2V5YA 1OH4A 3NV4A 4LOTA 4QQHA 5TSWA 2JDZA 1W8WA 2R063 5FKBA 3MLJA 2AH2A 2HBUA 2W08A 1I1EA 1BK1A 1PM4A 1U5ZA 4CCCA 5CFCA 2WABA 3FUOA 3H7YA 2HWD1 4NHLA 4LO6B 4DY5A 3KZ4C 5JPNB 3FHQA 2WT0A 1WD3A 2RR11 3M4FA 2ZGSA 1JTZX 2ZOEB 4NPRA 2WNUB 1RYYA 2D6OX 1XSRA 3DL3A 2XHKA 1S2KA 1NLRA 5AC93 3TEWA 3K77A 1IQDC 1E5RA 3M3CA 3WUCA 3V0AA 1S2BA 2RDRA 4WM7A 3H3UA 4K8FA 2RS52 4UW3A 3SEPA 2BRTA 4C1XA 4FPLA 5GLWA 3WNMA 5CFCB 3KGZA 2VJXA 1PO12 1XYNA 4AFBA 2HWB3 2R072 5A1LA 5JMOA 3IDCB 1RVF3 3KVBA 3VKOA 2CWSA 4DZGA 1A34A 1CX4A 3HNMA 5E16A 3CLPA 2DVFA 4KU7A 1E5SA 1MZ6A 2E7AA 2JIJA 2RHPA 3NL1A 1QIQA 3FC0A 1DIWA 1DYKA 1AR82 4OCTA 1UYPA 1OURA 3ZYHA 2YC2A 4D6SA 3V0AB 3RZHA 3HEIA 4DXSA 4LLOA 4WM7B 1CR7A 4UFLA 4XMIA 3ZYPA 1YRZA 3GBFA 2JE8A 5A7SA 1Y3TA 5FOBB 2BOIA 5FREA 1D2QA 4KBZA 3AMMA 4AHYA 5A1AA 4TZDA 4XF0A 4WV8A 2VOTA 4GB31 4EQVA 3VBUA 4DRRA 4S2FA 4FFIA 1QJZA 1AX2A 4PDWB 3SCFA 4DNYA 1OKQA 3AXEA 2R49A 3I3BA 3PNAA 1UYYA 4P14A 3I59A 2VQUA 5FUIA 5EIYB 1HQLA 5JZGA 5BNOA 3M70A 4URAA 4QD2A 5FO8B 4XQ4A 3M1HA 2Y26A 1LJ7A 1SCSA 1VIWB 1CAWA 2AC1A 2CGOA 4JHTA 4Q4V1 1LODA 4K1ZA 2ZZQA 1HXS1 2HWF3 2ZCWA 1Q5OA 1M4WA 3VBUB 4H7MA 3JZVA 4BQ2A 4CP9A 4KG8A 1NAEA 1POQA 5K0UC 1XBFA 3AL5A 2W3JA 3LEMA 3NV3A 5CZKA 3ZMNA 4YGCA 1CJDA 4I0BA 3FHIB 3I59B 1ZBA2 4NOTA 1NA1C 2YGMA 4O61A 3KM5A 2VUDA 1CJPA 3OGSA 4PQ9A 1D0HA 4XQDA 2G19A 5JZGB 1UO9A 5BNOB 2QTWB 5HPOA 3ZR6A 1GV9A 5F39A 3APBA 3W21A 2WBKA 4NR1A 4PLOA 2P6HA 5FYIA 2K2SA 2QNKA 2AZ5A 2FCTA 1NXD1 1CAWB 1NCRC 1CAVA 4AK3A 2JDYA 5FP9A 3WSOA 3WVJA 1FV3A 3OTFA 4CP9B 5HBAA 5IK7A 2A1XA 4LUKA 1OVPA 4Q4X3 2NMOA 4P02B 2VMGA 4MGKE 5C3OA 4EE2A 5L73A 1OOPA 1E5IA 1EUTA 3KF3A 1UZWA 3QD6A 2J7MA 2I2SA 2XJPA 3M8LA 4Q1RA 2WWJA 2BDRA 2G1MA 1CAVB 2WZR1 3N9LA 1UZVA 4QPWA 2Q8EA 3WDYA 5LCWL 2ZHLA 3HT1A 4FPCA 4AQ6A 3HMYA 3OB8A 2XJRA 4JDOA 2QQNA 3QOPA 3VN4A 3MLKA 4HPKA 5FDBA 2YBKA 5E88A 3AZVA 2XJSA 2LTNA 2W2IA 4YVWA 4P00B 1RUG2 2D93A 1OOPB 1X7NA 2WJSA 5ANNA 1G9DA 3J4UH 2IXKA 2VO5A 3SHRA 5IVJA 3WF2A 3S57A 1PGL2 5DABA 4R52A 3WDVA 1QQP1 1HW5A 1WLCA 3IB3A 2ARBA 4HPKB 4GWMA 1ZZ7A 4JRAA 2ZGOA 2W91A 1VAKA 1GBGA 1VBD3 1LOBA 1YC61 2A6ZA 4R9CA 4WM8A 3I2HA 3T2PA 3WP3A 4CP1A 2IFWA 2P2KA 4KWUA 1JW6A 4YVWB 5FYYA 3SC7X 5CKNA 5KXEA 4Q0PA 3VD7A 3JD71 4LOSA 2ZX2A 1Q3EA 3DN7A 4Q2FA 5ABJA 3POEA 4QGMA 5IVEA 1QJU2 1RUF1 1RITA 2X10A 1XJAA 1TNFA 1FOD3 1W39A 3KF5A 4CDXC 4YW1A 4CPBA 4OHWA 4LBLA 2KM2A 5C3RA 1GYKA 4UFHA 3H42B 1EV13 3HPNA 1KD7A 5FXXA 3MIFA 3WHUA 5JSOA 3KQRA 3LPGA 2ZGQA 2ZZJA 3CJIC 3PU3A 4OMCA 1F2NA 4XJWA 4Q26A 3OD4A 1ZX5A 3UK9A 2CYFA 3WW1A 1G9BA 2PQQA 4CZSA 4YZ2A 4NWWA 5FPVA 4WM8B 2ZHNA 4HOOA 4N9HA 1OBNA 4FPYA 4IEVA 4QB2A 4CDWC 2EAAA 3VBOA 4D69A 5K7PA 3F95A 1NE6A 3JB4C 5EP9A 3RSJA 1ZZ9A 1POV0 3RG0A 1UOJA 4HL0A 1IG0A 1VR3A 3OD0A 1VBC1 3I3EA 2WWSA 5JMCA 1KRIA 3D0SA 3Q9OA 2VUJA 3IZOA 4UOJA 4IESA 4UFJA 4FQ4A 4BCUA 1SCRA 3VBOB 4CCEA 2W52A 5A3LA 1KQRA 1JYWA 3SCGA 3E1F1 4LORA 1J1TA 5C4WC 4PIZA 5IAXA 3PTYA 2ET7A 5JCTA 4YW4A 4GD4A 4AQTA 4CUCA 3FE5A 4LA3A 5FK8A 4ZU4A 3MGUA 4XF3A 2RMU2 2VZSA 3PHMA 4YM0A 5CA6A 4TTGA 1HB3A 1LB2A 1YCIA 3NNFA 4M3CA 3RNSA 1LGNA 1FYUA 3OPTA 5FY8A 1C8M1 1RTVA 2GDFA 5SV8A 1V6LA 3IIAA 1OQDA 2DYCA 3ZYBA 1HB1A 1YHFA 3VDAA 1Q8QA 3ZYIB 4YSFA 2QQMA 1BK0A 1EAH3 5BPXA 3ZFEA 2BGOA 2ADDA 4BOWA 2RS13 2VZRA 4NAOA 3T0AA 5FP8A 1S0CA 3AKQA 3LFMA 3D4KA 3BOWA 4J1WA 2IZWA 2ZGKA 5L7OC 2Q1MA 3ZYGA 4L8QA 1NE4A 2ZGNA 4OUEA 1UXZA 1LHNA 2OPWA 3POFA 1KFXL 1MS8A 1N1TA 1LCLA 2P1BA 3OCPA 4M3CB 3ZFGA 1CWPA 1K42A 4MH0E 1OPOA 2W1QA 1PNFA 2Y0IA 3B69A 4C0HA 3ZSEA 4BQ4A 5AFEA 1V9U2 1G8WA 2Y34A 4I09A 4L0PA 4CVUA 4NIAA 4COVA 2V4VA 3SISA 2C9AA 3N9MA 4U36A 3ACHA 3RWKX 3ZFEB 5I0SA 2YPJA 2XXZA 3GZAA 1QJX2 1HV0A 2BNNA 3VKLA 4CCKA 1W9YA 2VOVA 4YM2A 2PYTA 3LDRA 5FPZA 1HDKA 3T08A 4P9LA 2XJQA 2VTXA 4D6RA 4W8JA 1QNWA 1HN0A 5A7WA 4A7YA 2Q8OA 3LA2A 5L19A 1VP6A 5LY1A 2JDMA 5DUUA 4CXXA 1R1ZA 1TMF2 3WW2A 4CCLA 2D44A 1XRUA 4NPMA 1ODMA 1OQ1A 1K3IA 1WD4A 2FZ1A 4IW3A 3VBHC 4IE0A 4BHPA 2R042 1RUE2 1BEV2 2Q8DA 1O3TA 1PVC1 2HWD3 5CG9A 3BTAA 2NYYA 4O9GA 3PUAA 4EZ4A 1OA2A 1CN1A 3ES4A 4H7LA 3CZUA 2E26A 1AYN1 4P9JA 1SZBA 3C7FA 4XJUA 1B09A 3ABZA 1H30A 1W2TA 5DAPA 1QJY2 3N9QA 5G04L 5A7WB 4Q1PA 4XACA 1X9PA 1D4M1 5F5QA 3UGHA 2DURA 3OUJA 2DCZA 4JAAA 4JGYA 3I2OA 3MW2A 1D4VB 4AVCA 1JN2P 1JU4A 5L9RA 4YZ5A 3MW3A 4AGVA 2A3XA 3I2GA 3D3AA 2JENA 4WVZA 5FCCA 5FMOS 4ZZ5A 1VMFA 5C6CA 2LS6A 2CDOA 2YU2A 3KSCA 2PLV2 3I4IA 4GKYA 4X8PA 3I3QA 2PQSA 1Q8SA 1I3HA 2W87A 3V56A 1JHNA 2E6VA 1XE7A 4Y33A 2A71A 1KJRA 3PUSA 1MEC1 2CHHA 1GZCA 4QM8A 2BWAA 2BYVE 1IQAA 4XCBA 4XIOA 3TWIA 1JYCA 1MQTC 2JECA 2JJ6A 5F32A 4IV1C 4AYUA 3EYPA 4S2HA 4EROA 2HWC1 4KNCA 2E7QA 2E9QA 1JUHA 1UAIA 1ZBE3 4WZCA 5LBBA 5C70A 4AG4A 1HX6A 2Q5TA 3EBRA 3OPZA 1REEA 2VH9A 1H9WA 2GN7A 1WUVA 3O1RA 1AXYA 3CMGA 4PF5A 4QX7A 3DKQA 2WAAA 3THCA 2RS32 1FXZA 1GP5A 5GLVA 3O1SA 1CZTA 3ASIA 2EIGA 2VMDA 4XXPA 3HNBM 4X6QB 1AR61 4FP2A 5FQ0A 5CYYA 3RGBA 5A6QA 4HZFA 1IPKA 3ZR5A 1DG6A 3GNEA 1W8FA 5A7NA 4Q4V3 1HXS3 2WS91 2MEV1 4Y4RA 2ZBJA 1J3QA 3R0RA 5DXDA 4K7JA 4N43A 2ES3A 1ULPA 2CAVA 3GJAA 1YWKA 4HG6B 3H3ZA 2ET1A 2P17A 3B9IA 2K9ZA 3CF6E 1YQCA 1CD3G 2PN5A 4C91A 1WW4A 4Q4Y2 2VBDA 4Q5OA 1R081 1DCSA 5FQ0B 4RHV1 4JX0A 4LR4A 4Y5Z0 4COUA 2R6QA 4RN5A 4RGGA 4C0BA 3I8TA 4A42A 4CUBA 3U0ZA 4E4ZA 3UKTA 3RYKA
chains in the Genus database with same CATH topology
4NMIA 4UWDA 2Y33A 5DAQA 4ZONA 2RDNA 3NNMA 5DAXA 5LBCA 2RDRA 4NHXA 3NNLA 3GJBA 3PL0A 4BQYA 4XAAA 4IW3A 5LASA 4XCAA 4NHKA 2RDSA 2JIJA 2JIGA 5L9BA 5ERLA 4JZRA 5HV4A 3HQUA 3OUHA 4BQWA 5DAPA 4XACA 3GZEA 3OUJA 3KT4A 5EQUA 4NHMA 3OUIA 4MHUA 4ZPIA 5L9RA 5L9VA 4KBZA 3EMRA 3KT7A 3BVCA 4NHYA 5EP9A 5IAVA 4Y5TA 4XABA 5LBEA 5C5TA 4J25A 2HBTA 5DAVA 5LB6A 2FCUA 5LA9A 2RDQA 4XCBA 3KT1A 5M0TA 5C5UA 5LBBA 4Y5SA 5LATA 2G19A 5IATA 3DKQA 3MGUA 4BQXA 4XC9A 3W21A 3NNFA 2FCTA 3W20A 5EPAA 2RG4A 5DAWA 2A1XA 3OBZA 2FCVA 5IAXA 3ITQA 4NAOA 3HQRA 3GJAA 3NNJA 2HBUA 2OPWA 5HV0A 5LBFA 4Q5OA 2G1MA 4MHRA 5A3UA 2Y34A 4NHLA 2V4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NMI A;  4UWD A;  2Y33 A;  5DAQ A;  4ZON A;  2RDN A;  3NNM A;  5DAX A;  5LBC A;  2RDR A;  4NHX A;  3NNL A;  3GJB A;  3PL0 A;  4BQY A;  4XAA A;  4IW3 A;  5LAS A;  4XCA A;  4NHK A;  2RDS A;  2JIJ A;  2JIG A;  5L9B A;  5ERL A;  4JZR A;  5HV4 A;  3HQU A;  3OUH A;  4BQW A;  5DAP A;  4XAC A;  3GZE A;  3OUJ A;  3KT4 A;  5EQU A;  4NHM A;  3OUI A;  4MHU A;  4ZPI A;  5L9R A;  5L9V A;  4KBZ A;  3EMR A;  3KT7 A;  3BVC A;  4NHY A;  5EP9 A;  5IAV A;  4Y5T A;  4XAB A;  5LBE A;  5C5T A;  4J25 A;  2HBT A;  5DAV A;  5LB6 A;  2FCU A;  5LA9 A;  2RDQ A;  4XCB A;  3KT1 A;  5M0T A;  5C5U A;  5LBB A;  4Y5S A;  5LAT A;  2G19 A;  5IAT A;  3DKQ A;  3MGU A;  4BQX A;  4XC9 A;  3W21 A;  3NNF A;  2FCT A;  3W20 A;  5EPA A;  2RG4 A;  5DAW A;  2A1X A;  3OBZ A;  2FCV A;  5IAX A;  3ITQ A;  4NAO A;  3HQR A;  3GJA A;  3NNJ A;  2HBU A;  2OPW A;  5HV0 A;  5LBF A;  4Q5O A;  2G1M A;  4MHR A;  5A3U A;  2Y34 A;  4NHL A;  2V4A A; 
#chains in the Genus database with same CATH topology
 3PJQ A;  3CQO A;  1BHG A;  2VY0 A;  4XFA A;  2QZ3 A;  4L99 A;  4ARY A;  5JOW A;  4LBQ D;  5IVF A;  1W28 A;  3BTZ A;  4QPG C;  5FZ7 A;  2IXJ A;  5FZ9 A;  3ETP A;  5CU1 A;  2Q8C A;  3KHC A;  1F9K A;  2WNV A;  4NRM A;  2BER A;  1SLC A;  4FVV A;  3H8R A;  2V73 A;  3ZN6 A;  2JDP A;  2NZ9 A;  4Y24 A;  1UYX A;  1REF A;  2X53 S;  4F83 A;  3R4U A;  5DQ0 A;  5FYH A;  4AGR A;  5LK7 B;  1WA4 A;  1O5L A;  4XAA A;  1DDL A;  1L7R A;  1W0N A;  1TZO A;  2R06 2;  4QDQ A;  2EIB A;  3AFK A;  4CU7 A;  2B9V A;  1UY4 A;  2HWB 1;  4DPN A;  3FUQ A;  3INA A;  4BIO A;  3E5X A;  3IPV A;  1UU6 A;  1KEX A;  4YG6 A;  4CRQ A;  2JD4 A;  2DBI A;  4NN0 A;  1OLQ A;  2OPK A;  2WNV B;  2D3P A;  1NZI A;  2YPD A;  3AMN A;  3BGA A;  1GP4 A;  3KMH A;  5KXB A;  3ZN6 B;  2A75 A;  3IBM A;  4RA0 A;  1AX0 A;  1WME A;  2BZD A;  2PAE A;  1YQ2 A;  5F37 A;  3MPB A;  4DY3 A;  1IHM A;  5FWE A;  3TAY A;  4XMA A;  1Y4W A;  5AC9 2;  2G9G A;  1QQP 3;  3VHP A;  1HN1 A;  1AX1 A;  2QKD A;  2FDF A;  5JXJ A;  4Y4Y A;  5T50 A;  2Z79 A;  2ERF A;  4EV0 A;  1APN A;  1YNA A;  2X09 A;  2PTM A;  3IPV B;  5K4L A;  4UFM A;  2XBO 2;  1VBB 1;  4D0Q A;  1VBA 3;  5C5T A;  1W8O A;  4YM3 A;  1OLM E;  2FDI A;  5FJH A;  2FDJ A;  1RVF 2;  3I2K A;  4IER A;  5JVV A;  3S5Q A;  2E63 A;  1GNH A;  5HXV A;  5LB6 A;  3K3O A;  1J58 A;  2XVG A;  4AVS A;  2VW0 A;  2VNG A;  3B7M A;  4NII A;  2RVA A;  1R09 2;  3OSD A;  1MS4 A;  4OMD A;  4K20 A;  4HAN A;  2ETE A;  3AZW A;  1VBE 2;  4K8R B;  1WW7 A;  4P5H A;  5C5U A;  4LIU A;  2UY9 A;  1QWR A;  4HKW A;  2XML A;  3CIH A;  1HRV 1;  1NXM A;  3TN9 3;  2WRA A;  3NST A;  4BK4 A;  4FXG B;  1RUN A;  4YW5 A;  3GYD A;  4Q8L A;  1TME 1;  2Y0O A;  4JCK A;  2FHR A;  4AI9 A;  3K4A A;  2VTF A;  4IEW A;  5E89 A;  4HKO A;  5B4X A;  1OT5 A;  2DTY A;  5DZE A;  1ZNP A;  1DYP A;  3GAL A;  2JKB A;  3RI9 A;  1TE1 B;  2D43 A;  5GM0 A;  3VUO A;  1GOG A;  1NCR A;  1W9S A;  2BNO A;  3MPP G;  3JCI A;  3MV1 1;  1XNB A;  2OX0 A;  4IV3 C;  1OFS A;  3W58 A;  1ZRF A;  1DYO A;  3LE0 A;  2Q30 A;  4M4P A;  3LOB A;  1SFP A;  4PQQ A;  4DUV A;  1LEC A;  1KGY A;  3AK0 A;  3LAG A;  2PHF A;  4HON A;  4Q4X 1;  4W6X A;  4B8E A;  2DBN A;  1QXR A;  2WQ4 A;  1IPJ A;  1C5I A;  1SBD A;  3NAP C;  3O12 A;  4M0H A;  4XE9 A;  4XZP A;  4CEW C;  3BIE A;  3HN1 A;  1NA1 B;  2TUN A;  2HWF 2;  2VL4 A;  4MYE A;  1XE8 A;  3WR0 A;  4N7I A;  5FZ4 A;  3WCS A;  4GZ9 A;  2Z69 A;  3S0M A;  5LA0 A;  3MIH A;  2VUL A;  1Z78 A;  1WCD J;  3MF9 A;  1BKZ A;  2W1W A;  3IMM A;  1NCR B;  5C3S A;  3ZX7 A;  4YVS A;  3A22 A;  1JOB A;  5CFD C;  2ZS6 B;  4PIX A;  3UL2 A;  1C3H A;  4JGZ C;  2AAC A;  3WEZ A;  2ZAH A;  5KHJ A;  3B3Q E;  3GXU A;  4S2G A;  5FJK A;  3ZDS A;  4BDV B;  3AM2 A;  1SLL A;  3GJB A;  2DFB A;  3H3L A;  1UF2 C;  3PUI A;  3PME A;  2WAO A;  2MPF A;  2XVK A;  4QXH A;  5FYM A;  5FUN A;  1SBE A;  3A0N A;  3III A;  2IXI A;  4XPV A;  4CP0 A;  4YVS B;  3VKM A;  2DCT A;  2VVF A;  4E8C A;  3WW4 A;  4FCA A;  5A33 A;  1JH5 A;  5HCB A;  4AI0 A;  2WT1 A;  4BU2 A;  2J1T A;  2YFU A;  3OUH A;  4IE4 A;  4Y3O A;  1G9C A;  4NIH A;  1SLT A;  4QT6 A;  4TSV A;  5JUV A;  2ZML A;  1Z7S 1;  4QPI C;  1R1A 2;  5EQU A;  3OUI A;  2F4P A;  1EY2 A;  2NM1 A;  3RQ0 A;  2HKX A;  1EV1 1;  3ILF A;  2D6N A;  3O1M A;  1F15 A;  3H1Y A;  1LES A;  1ND3 A;  2ZX1 A;  3ENR A;  1PK6 C;  1LOF A;  5FLJ A;  5A33 B;  4EN9 B;  1JOJ A;  1DU3 D;  3I3M A;  5FZM A;  4QX2 A;  5FYT A;  1PVC 3;  3RPQ A;  4YM1 A;  4AI8 A;  4QU1 A;  4BIF A;  2D6M A;  5KXD A;  4QX5 A;  4RQP A;  5EZW A;  4J25 A;  4EWD A;  2HBT A;  2JDH A;  4Z2A A;  5IVC A;  1U5X A;  3TEZ A;  1VBD 2;  3Q8A A;  3WUD A;  5FZD A;  2E31 A;  4ATF A;  1RHI 3;  5FV3 A;  2J1A A;  2RV9 A;  5ACA 2;  2BPA 2;  4B1L A;  3B5L B;  3GF6 A;  5FKC A;  3NKT A;  4OQ8 A;  4C8D A;  1ZZ8 A;  4FPG A;  2UWA A;  1ND3 B;  1JHJ A;  2OA2 A;  3U14 A;  5IK8 A;  1FOD 2;  3NJY A;  4KH9 A;  5FPB A;  2XH6 A;  1PIV 3;  4HMZ A;  3ZXD A;  1IKQ A;  3K4D A;  3O0W A;  1S4C A;  5FZ8 A;  1XOY A;  3UKV A;  3WDU A;  4XUP A;  3SKJ E;  4XOG A;  1B35 A;  1AL2 3;  4RQP B;  3OBR A;  4QKN A;  1NT0 A;  4IL7 A;  2WN2 A;  1JZ6 A;  2EXK A;  2ZXQ A;  2WO7 A;  2ZA9 A;  3SXW A;  1UX7 A;  2XKP A;  4KI5 M;  1WWY A;  3S7E A;  1MEC 3;  2JG9 A;  2OQ7 A;  2PFW A;  4KGQ A;  3VKF C;  3HVD A;  3PDQ A;  3DPR C;  2WYF A;  4CUG A;  4A45 A;  1AR7 3;  1OPM A;  2RG4 A;  2XLG A;  1W05 A;  4LBK A;  3WNP A;  5DPN A;  1WLD A;  2FDH A;  3LIH A;  4XDO A;  5KHI A;  1FPN 2;  2XL9 A;  3ZMO A;  3ZN4 A;  3BUC A;  3HQR A;  2IC1 A;  3RVH A;  1O4T A;  3DYP A;  4PHZ A;  1VRH 2;  1K5J A;  3NNJ A;  5JXH A;  5JXG A;  4I2O A;  2BVV A;  1LHU A;  1AYM 3;  1QXP A;  1RMU 1;  4RGK A;  3MF6 A;  4DFS A;  5K8S A;  5K9Y A;  3PUQ A;  1PZ8 A;  3H1M A;  3BTY A;  2CDP A;  4NPL A;  4JTO A;  4CDU A;  2HEY F;  2WUH A;  3FMG A;  3BPZ A;  3L9J T;  4NRP A;  1K5M A;  1ODN A;  2Y33 A;  4ES8 A;  2WS9 3;  4LKE A;  2XPJ A;  2VAU A;  5T5J A;  1PZ9 A;  1S2E A;  2RDN A;  2XJV A;  3NNM A;  2H6B A;  3NNL A;  1VAV A;  2WNU A;  5DDJ 3;  4Z82 A;  1AJO A;  3JUU A;  2VCM A;  2QQI A;  3I7D A;  3WG3 A;  2X5I C;  4JDM A;  5CNA A;  2GP3 A;  3TNQ A;  2HJI A;  1R08 3;  4Y1Z A;  1W06 A;  4G3Y C;  3OGR A;  4RHV 3;  1ENX A;  4YZ3 A;  5EYX A;  2WLQ A;  5F3I A;  5JAX A;  1ULD A;  2ZAA A;  4CDU B;  3AC0 A;  4MSV A;  1JOD A;  4L92 A;  4JRL A;  4COZ A;  1Z0H A;  1COV 2;  1K5M B;  1GWL A;  1PM7 A;  3HJR A;  1W6P A;  5A70 A;  1RUJ 3;  4K40 A;  4UFK A;  2OZJ A;  3HQU A;  5EHD A;  2GC0 A;  5EV7 A;  3AJZ A;  2R7E B;  4AI2 A;  4HT1 T;  4L11 A;  5FOJ B;  4A44 A;  3C7E A;  5FZE A;  1RUD 3;  1XNT A;  3MEP A;  4I30 A;  3OGG A;  1NOV A;  4FOV A;  4LBN A;  2WZE A;  4TN7 A;  3N4M A;  1YJK A;  3BIW E;  4X6R B;  4QKD A;  3BI3 A;  2B8M A;  2FMD A;  3K51 A;  1DZQ A;  2VVE A;  3LSE A;  5DUW A;  4YW2 A;  2WKK A;  4OZX A;  2H0B A;  3DYM A;  1W6P B;  4PLM A;  3Q8C A;  3O1U A;  1UZY A;  4Q27 A;  4XAB A;  5FZB A;  1F4H A;  4TXW A;  4QPY A;  3KV6 A;  5I8S A;  4N53 A;  4NUB A;  5FY1 A;  2QQU A;  5LRR A;  2FMY A;  4PDW A;  2HWD 2;  1UD1 A;  2K0G A;  3A7Q A;  3KV4 A;  1G7Y A;  2DWR A;  4EJR A;  4TLF A;  5DUX A;  5AFB A;  4QAW A;  5H9Q A;  3WF3 A;  2JXA A;  2RR1 2;  2ILM A;  4G9S B;  4P9G A;  2TEP A;  3THP A;  4I0A A;  4ATE A;  2EXJ A;  4FQZ A;  1ZM1 A;  1S0I A;  3PIG A;  4EWA A;  1S0J A;  3ZXK A;  1JZ4 A;  1H2L A;  3IT8 A;  4FPF A;  1PO2 1;  3LA7 A;  4S2D A;  5FZK A;  5HCA A;  1T2X A;  1UWW A;  1ZBE 1;  2GME A;  3KWV A;  3WP5 A;  5A3T A;  4IQP A;  5C9A C;  4W65 A;  2JD9 A;  4N53 B;  4BME A;  4D8M A;  2UYB A;  1VBB 3;  3KHB A;  5FZC A;  5J36 A;  3LDK A;  3KLS A;  4GAL A;  1NCQ C;  1E5H A;  2P3K A;  1V6N A;  3VZL A;  1N47 A;  3M7A A;  2Q0A A;  2ADE A;  2ARC A;  2BJS A;  1VB2 A;  4YZ4 A;  4B7E A;  5I0T A;  2D6L X;  3PVB B;  4E2Q A;  4RR3 A;  2OZ6 A;  2ATF A;  1FT9 A;  3W9A A;  1POV 1;  2EAK A;  4FAG A;  4XJZ A;  1QKQ A;  3QLQ A;  3R4S A;  4LBM A;  1JZ8 A;  3ILR A;  4EWE A;  2VMF A;  4Q8K A;  1ZBA 1;  4R9A A;  2JIC A;  1W9F A;  1HRV 3;  2J1U A;  1ND2 C;  2LM3 A;  1UMI A;  2NN8 A;  1Q43 A;  1YYN A;  1P8J A;  2JEM A;  4GAZ A;  1F4A A;  1BCX A;  1TME 3;  1XE0 A;  4GB3 2;  5LEK A;  2XLF A;  2C9K A;  5JR2 A;  1H4H A;  3VDD A;  4DXT A;  4NID A;  4LHN A;  1HRI 3;  2RM2 1;  3MIE A;  4OHV A;  4RR3 B;  5BXX A;  2WSV A;  4U2A A;  4XUO A;  1C5H A;  3D0J A;  4YLZ A;  4IGO A;  3T0B A;  3ZO0 B;  4HN1 A;  5BYN A;  3ME2 A;  1VJ2 A;  4QXB A;  1TG7 A;  3POW A;  4Q4V 2;  1ZA7 A;  1HXS 2;  3FZ3 A;  5J3U A;  4K21 A;  1C8N A;  1QMJ A;  3TB0 A;  4NAM A;  1FAT A;  3VDD B;  4AQS A;  1H9P A;  4ZXK A;  2LRO A;  4M3C F;  4NRO A;  4CCO A;  4LMF A;  5JIU A;  5LAS A;  3OOX A;  5ABJ B;  1GMM A;  3E6C C;  5C8C C;  2BP6 A;  4NHK A;  4P08 A;  3UV9 A;  4K9S A;  1NX9 A;  3RS6 A;  5L9B A;  5BNP A;  5KBF A;  1D0G A;  3BKZ A;  5A6X A;  1MS5 A;  5CBL A;  2DVD A;  1UOB A;  3DXU A;  4B4P A;  3VHN A;  2DVB A;  1IOA A;  4B3N A;  4CDQ C;  3DUI A;  3U37 A;  2YB7 A;  1OC1 A;  3A23 A;  1W6Q A;  4EN6 B;  3H0O A;  4GH4 A;  4Y26 A;  2EIC A;  3F2Z A;  3URF A;  1L7L A;  3PJY A;  2VOK A;  1RL3 A;  1DF0 A;  1ZZ6 A;  2VZU A;  2NQY A;  3OG2 A;  1YIP A;  3MFA A;  1J59 A;  2VCC A;  5BNP B;  1H0B A;  2G9Z A;  2QQO A;  3VBS C;  5IAV A;  1EP0 A;  1T6B X;  3NV2 A;  4MXW A;  3POY A;  5KR7 A;  2WZP P;  2WZR 2;  3MBW A;  4LUM A;  4UFI A;  1VBA 1;  3ZYR A;  1S0F A;  4IEP A;  1W6Q B;  5FBJ A;  1RUH 3;  5BV6 A;  3LQC A;  4GH4 B;  2VZP A;  1BVP 1;  3MIG A;  1Z7S 3;  2MNG A;  2XON A;  4N9I A;  2ARE A;  4DEQ A;  1MR5 A;  3MO4 A;  1WMF A;  4ASM B;  4QHO A;  5C3P A;  3OBA A;  5EFU A;  3MIB A;  1OH3 A;  1OMI A;  3BYW A;  2ENR A;  4K3U A;  1JXN A;  2DUP A;  4JKL A;  1GNY A;  3D6E A;  4MXW B;  4XDQ A;  2JB8 A;  4Y5S A;  4PF1 A;  3TN9 1;  3J7M A;  5DG1 A;  1RUC 3;  4QXK A;  4RS5 C;  5GJ6 A;  1XNA A;  4HFS A;  3P1I A;  3AYD A;  4BXS V;  4R4X A;  3IMN A;  2FZ2 A;  4ZS2 A;  2ZTN A;  1O4Y A;  1GIC A;  3W20 A;  4FOQ A;  4ZKT B;  3AJY A;  3AP4 A;  1UNB A;  3RDI A;  3HQX A;  3JD7 2;  5F6K A;  1WBL A;  5FPU A;  1QH6 A;  1RUF 2;  4I02 A;  4ISQ A;  3FBM A;  2QDR A;  4IV3 A;  4A3X A;  5CAD A;  2VZQ A;  4XDP A;  2EXI A;  3FJS A;  1OFN A;  2A6Y A;  2PHR A;  1OUX A;  3KB5 A;  2C1F A;  1UCX A;  1C28 A;  4OI2 A;  3AKS A;  1DLC A;  4DMI A;  3WHT A;  4M3C E;  4CCM A;  3H8O A;  5GLT A;  2W95 A;  1CZS A;  3HN3 A;  2QQJ A;  3DYO A;  5CG8 A;  5D8A C;  2E51 A;  4QB6 A;  4C1W A;  4CA9 A;  1TEI A;  4CEY A;  3U10 A;  1PGW 2;  2W9X A;  4IV3 B;  4O9E A;  4FOW A;  4LO4 B;  5JSR A;  3GHN A;  2X05 A;  3T1M A;  1BBT 1;  1O3S A;  1RUO A;  1R64 A;  3DEM A;  3RFR A;  2JG8 C;  1V6J A;  4WVM A;  2AYH A;  1VBC 2;  4QXC A;  3WX5 A;  2GMM A;  4LJH A;  2YC0 A;  2YY1 A;  4FFH A;  4LA2 A;  4NHX A;  4AED C;  2BBV A;  1U5Y A;  4XJA A;  5F3G A;  3SLI A;  2D6P A;  4Z8B A;  5F7U A;  4QX3 A;  5LZ6 A;  4OYU A;  3FLT A;  3WP6 A;  2HWE 3;  2B39 A;  4Q4W 1;  1X8M A;  1FAY A;  1RMU 3;  1CPM A;  1TNR A;  1V6I A;  3M2M A;  2V72 A;  2W1U A;  1V9U 1;  4V2V A;  1FMD 1;  2OKX A;  1KS4 A;  4AGG A;  1RUI 1;  2H0V A;  2P3I A;  4CUA A;  4D7Y A;  1BMV 2;  1N3O A;  3QAC A;  1O3R A;  4WVM B;  2GAU A;  2JDK A;  2JWP A;  2O1Q A;  5IK5 A;  4XBQ A;  2QE3 A;  4JZR A;  1UMZ A;  3SEE A;  3TNP B;  3WOG A;  2UWB A;  4LKS A;  1T6G C;  2BVB A;  3LD8 A;  5BNN C;  2F4L A;  1C8M 2;  4MGT A;  3GZE A;  1AL0 G;  3KT4 A;  3THT A;  3VZM A;  2PXJ A;  1AR9 1;  3GZT B;  4NHM A;  2R0F A;  3OEA A;  1QXJ A;  5JI7 A;  1RB8 G;  2JB4 A;  1TMF 1;  4XJ8 A;  5JOY A;  1XYP A;  2G4I A;  5JOX A;  1VAL A;  3AYE A;  1SFN A;  1UU5 A;  5FMC A;  1KDK A;  2R04 1;  1CIW A;  1SAC A;  3J8F 1;  4E4D X;  4NHY A;  3KD4 A;  3DV8 A;  5JDB A;  2BQP A;  3P6B A;  2Q1F A;  5LA1 A;  4YGD A;  2XUM A;  3WNL A;  3I2I A;  2GMP A;  1UPS A;  3ECQ A;  1GOF A;  4OLL A;  5F3E A;  4OZO A;  4UXA A;  2CTV A;  2WA4 A;  4DRV A;  2EAL A;  1RHI 1;  4XF9 A;  4XUN A;  2OYZ A;  2RS5 3;  3SH3 A;  3VBR A;  3WD5 A;  3C3V A;  1A78 A;  2YZ4 A;  1PO1 3;  3ZSL A;  3W5M A;  3K2O A;  3BOD A;  3LA3 A;  3ST7 A;  2P4E A;  2R07 3;  3B93 A;  1ZA4 A;  3N9P A;  2DCK A;  1PIV 1;  4GUL A;  5E6H A;  3USU A;  2AR6 A;  1GQH A;  4QU2 A;  3ZXA C;  4D7T A;  5CFC C;  2F17 A;  1YI9 A;  5LAT A;  3WZ1 A;  1LOE A;  1U0A A;  4QDR A;  5LW9 A;  1S55 A;  1KDM A;  1AL2 1;  1XNK A;  5FXW A;  1AR8 3;  1QU0 A;  1UW8 A;  2ID4 A;  3WF0 A;  2XLA A;  4XC9 A;  3USS A;  4BQX A;  3IAQ A;  1NY7 1;  1PVC 2;  1LU2 A;  1UY0 A;  3PUR A;  2D98 A;  4A41 A;  3VBR B;  2QBX A;  1Q8P A;  5A6Y A;  4P9I A;  1XU2 A;  4D7S A;  1AYN 2;  1KJL A;  2W47 A;  5JIA A;  1EYB A;  1YUD A;  2GNM A;  5LEJ A;  2VC9 A;  1WMX A;  2NPI A;  3OBZ A;  1AR7 1;  1HKD A;  1WCS A;  4QQ2 A;  4QQP A;  1D4M 2;  1JOP A;  3USU B;  3ITQ A;  1O91 A;  1G6N A;  4FTE A;  1PO2 3;  4PI2 A;  3NRU A;  2DCJ A;  3T4V A;  3A21 A;  3H8U A;  1UL9 A;  3PTR B;  4P5Y A;  4JQT A;  5I8Y A;  3FN9 A;  4NO4 A;  3EHK A;  4BJ0 A;  3O0V A;  4H55 A;  5GZG A;  1ZZB A;  5F3C A;  4XEZ A;  2FD8 A;  4FAH A;  4CEY B;  3O1V A;  2VG9 A;  1GU3 A;  1GKB A;  1AYM 1;  1URX A;  3I54 A;  2OS2 A;  3RYR A;  3PIJ A;  1PMI A;  3CNA A;  4AHZ A;  4JVA A;  1OVS A;  1NQD A;  2DUO A;  5T3N A;  4M4R A;  3JU9 A;  5I93 A;  1D7P M;  5G05 L;  4BXF A;  3N7M A;  2R30 A;  2NMN A;  1POV 3;  4XW3 A;  1MEC 2;  1S0B A;  4UWD A;  3RJ2 X;  3WLU A;  1F31 A;  2ZEX A;  5DAQ A;  3ZN5 A;  4B4Q A;  5KWR A;  2CGP A;  3RZK A;  2J1E A;  2YBS A;  3FWE A;  3H1W A;  3ATG A;  3WG2 A;  3NMB A;  1ZBA 3;  4W6Y A;  3AKR A;  3I2J A;  3WG1 A;  4ES9 A;  2Y38 A;  1DQ6 A;  3AKT A;  3VBU C;  2R1D A;  1CPN A;  1PMJ X;  1OQE A;  1WKY A;  4Q4Y 1;  1ENS A;  2HWC 2;  2UUR A;  4LK6 A;  1HJG A;  5DDJ 1;  4UW6 A;  1KXG A;  2RJL A;  4ZS3 A;  5CVR A;  1W6N B;  3FFZ A;  3J7N A;  4O7X A;  4KQ7 A;  4EN0 A;  1I6X A;  1JS9 A;  2DV9 A;  4F7Z A;  5IVV A;  1GNZ A;  4NIG A;  2OVU A;  5JZG C;  5BNO C;  2RM2 3;  4YPJ A;  1WCU A;  2BGC A;  1DQ0 A;  4GWI A;  3UYJ A;  3VDC A;  2BWC A;  4P9W A;  3CEW A;  1IG3 A;  5J37 A;  1JMU B;  4MX3 A;  5J7M A;  1AR6 2;  1RUJ 1;  3HAG A;  2WFF 2;  4MV2 A;  3U11 A;  2CSG A;  3MDP A;  3K75 B;  2WS9 2;  2MEV 2;  1RUD 1;  1M06 G;  4D3W A;  1J83 A;  1YO8 A;  2C4X A;  1ASJ 2;  2QJV A;  2X5I B;  4PIY A;  5DN2 A;  2Y6L A;  3ZLI A;  3ZPO A;  5GKA C;  5FY5 A;  4AFA A;  2JDN A;  1WBF A;  2I74 A;  3HBK A;  4I3G A;  5FYB A;  1ONA A;  1UY3 A;  1VB4 A;  4JKM A;  1VPH A;  1R08 2;  3VZK A;  1JZ3 A;  1RUG 3;  1S1A A;  2D3R A;  5DAV A;  5F8P A;  4KL1 A;  2ZKL A;  5FPL A;  3TEY A;  3RZJ A;  1CX1 A;  3EO6 A;  3RMY A;  1Q8O A;  3ORJ A;  5FK7 A;  1SBF A;  3POI A;  5BUV A;  1X9T A;  3T4H B;  4GMP 0;  2DVA A;  4OHZ A;  2XWJ B;  3CL1 A;  1H2K A;  1OOP C;  1ZRR A;  3B01 A;  2B9U A;  5J09 A;  1SLA A;  2XR4 A;  5CB7 A;  3UKN A;  5I0U A;  2UYA A;  3IDB B;  2P3J A;  4FPK A;  3P5B A;  3RI8 A;  3SMH A;  4FPE A;  1UX6 A;  3T2O A;  4GWJ A;  4AR2 A;  5L36 A;  2VNR A;  2XBO 1;  1H8T C;  3WT3 A;  1BXH A;  3J7L A;  1I9R A;  5JR7 B;  5JOZ A;  2CL2 A;  1H8V A;  1MZE A;  3W5N A;  5IWF A;  1V0A A;  4OUS A;  1LED A;  1NLS A;  3D8C A;  1QJU 3;  3RRD A;  4A3Z A;  5HI0 A;  2HWB 2;  1NCQ A;  1X36 A;  2QFE A;  3S30 A;  4V1P A;  4YVW C;  3MV0 1;  1UQX A;  2QQL A;  4JTN A;  2Z4F A;  4YW7 A;  5GZD A;  2WO1 A;  1VBE 1;  5B4N A;  4MAD A;  3MW4 A;  1UPI A;  3O14 A;  4XFF A;  4OUM A;  4YZ1 A;  1W9T A;  1J3R A;  5C9A B;  5C8W A;  3HD8 B;  1Q56 A;  5K0U A;  1GFF 2;  4WM8 C;  1NCQ B;  4MGY E;  4BH9 A;  5IVB A;  2ARX A;  4PLN A;  1NA1 A;  2WT2 A;  5FRA A;  1CES A;  2XKO A;  5DZF A;  5F5I A;  4AW7 A;  5ABJ C;  2ZPX A;  1VBB 2;  1MS3 A;  3AX4 A;  3T3Y A;  5JXI A;  4GKX A;  1HRI 1;  4KBB A;  3WDT A;  1IS4 A;  2ZAB A;  1TQ5 A;  2BBA A;  3NJZ A;  4HBN A;  4AEM A;  3D82 A;  4JV4 A;  3MID A;  5KXC A;  1QH7 A;  2YDE A;  4Y1V A;  3RJR A;  3RYP A;  4QWN A;  3MHZ A;  4WVV A;  3PLQ A;  1WLW A;  2XGX A;  3M3I A;  5K0U B;  2GP5 A;  4ZXE A;  1E57 A;  3VBO C;  2XJU A;  3WG4 A;  1PGS A;  3ZFF C;  4LXL A;  2RMU 3;  4AVB A;  1QDO A;  5C33 A;  5A3M A;  4EZH A;  4QMA A;  5A80 A;  2VZ3 A;  3H7J A;  1O3Q A;  2D40 A;  2VVD A;  2A6V A;  2I45 A;  2YBP A;  3UJQ A;  4BE3 A;  2JDA A;  1RXG A;  4G4F A;  5ERL A;  2B42 B;  1BBT 3;  2P5B A;  3BAL A;  1DGR N;  5D1I A;  2R0H A;  4OVE A;  4XJ9 A;  4QX0 A;  4NE9 A;  2B46 X;  5FZ3 A;  4YW6 A;  3IDE A;  3TRS B;  1LNS A;  2IXC A;  3GHM A;  2IXL A;  1Q8V A;  4SLI A;  3E5Q A;  1GLH A;  4Q0S A;  2IVJ A;  3AYC A;  3P3N A;  4Q4X 2;  4YRD A;  3VD5 A;  2DCY A;  5IJR A;  4Q4W 3;  3ACF A;  3UNP A;  4AEK A;  3MI8 A;  4E2S A;  1V9U 3;  2GU9 A;  1FMD 3;  3GCW A;  4LKD A;  1RUI 3;  4KU8 A;  2BV4 A;  1EUU A;  4R4Z A;  1UN1 A;  4XBN A;  3AP6 A;  1DGL A;  1QJX 3;  5FP4 A;  3VD4 A;  2GAL A;  2VME A;  5CIS A;  2Z42 A;  2CAU A;  3VZN A;  1PHM A;  1RJ8 A;  5GZC A;  1DLL A;  3ZFE C;  4LBO A;  1RUH 1;  1OF3 A;  5FPX A;  2GC3 A;  5IVY A;  1AR9 3;  4KWK A;  1F8V A;  5T55 A;  2A3W A;  4OFG A;  1O5U A;  4QHZ A;  1TMF 3;  4CDX A;  3N7J A;  4IEX A;  1O7F A;  2YV8 A;  4AOC A;  1C57 A;  2XHN A;  1JYX A;  5CAZ A;  5FYZ A;  4LQR A;  2R04 3;  1RUE 3;  1BEV 3;  4W4Z A;  1IPS A;  1LOC A;  3ZFG C;  3CJI A;  3OGV A;  4FI9 A;  1KIT A;  2P3Y A;  3J8F 3;  3U4X A;  3L2Y A;  4DQA A;  3BU0 A;  5HCH A;  4ISR A;  3IAP A;  1G86 A;  2ZJC A;  3PVE A;  4CDW A;  1OHF A;  3MIC A;  1RUC 1;  3SQO A;  4HLT A;  1QJY 3;  5ACA 1;  3SKV A;  1JYT A;  1W8Z A;  5GAL A;  2J1V A;  5FIX A;  1CVN A;  1PMH X;  3LB9 A;  1JU3 A;  2ZMN A;  3UJO A;  2QDN A;  3N9O A;  3NVC A;  4CDX B;  4DUX A;  1N1Y A;  4UF0 A;  5EJ1 B;  2VCA A;  5CIR A;  2O8Q A;  1O6U A;  1Z7S 2;  1UXX X;  2AUY A;  1LEM A;  3CJI B;  1NLQ A;  3GM8 A;  1UYZ A;  4NJ4 A;  4QKB A;  4GMP 3;  2Y6K A;  3WQB A;  2PLV 3;  2KA3 A;  1GP6 A;  3JBG 1;  2VD7 A;  1EV1 2;  4FP3 A;  2Y6G A;  4CDW B;  4EN8 B;  1OXC A;  3J9S A;  1SQ4 A;  4N7U A;  5GZF A;  4CU9 A;  5C4W A;  5I8T A;  4XXA A;  4M01 A;  4CU8 A;  4UF0 B;  4MGQ A;  1H1M A;  4LEJ A;  4M0N A;  2R32 A;  1GZ9 A;  3Q8B A;  3ZIW A;  1UIJ A;  1UOF A;  1MVQ A;  2GNT A;  3KV5 A;  4ZY9 A;  2V4A A;  5FZL A;  3LPF A;  3WDX A;  3CBN A;  1MS9 A;  4JGY C;  1I5P A;  3CU7 A;  4K1Y A;  4AEJ A;  4QQO A;  3I2D A;  5E8A A;  3RZG A;  2AEY A;  1CAU B;  4AL9 A;  2DDU A;  4LLF A;  4FXK B;  3GBG A;  2ZGP A;  3HT2 A;  3OEB A;  5C4W B;  4AED A;  2K46 A;  3ZYF A;  2RS3 3;  4BQY A;  4LO8 A;  4PT6 A;  5L7O A;  2YGL A;  2HWE 1;  2OQ6 A;  1F5F A;  4UBG A;  2OW4 A;  4AVT A;  3ZSJ A;  5LRS A;  4BA6 A;  4IGQ A;  4CPB D;  3O1P A;  4XIL A;  2P37 A;  1AJK A;  4QGN A;  2Y6F A;  5IFT A;  3HIF A;  3ZIX A;  1YXW A;  2B45 X;  3G6J B;  4MGI E;  1HLC A;  4AED B;  2A7A A;  1W8U A;  1ULC A;  4PI0 A;  3FFQ A;  3W59 A;  1U12 A;  3ZXJ A;  2YRO A;  1N1S A;  2DUQ A;  3KCY A;  3D5O A;  1ZRD A;  1O8S A;  5L7O B;  5ISL A;  4Q4Y 3;  2BEO A;  1EAH 2;  4CE8 A;  4BQ1 A;  2RS1 2;  4MG2 A;  4XFG A;  4MLO A;  3RZL A;  1A8D A;  4YWA A;  3WQ1 A;  2V09 A;  2GNB A;  1W3X A;  3WDW A;  1ZRE A;  5F6L B;  1BLZ A;  3VBH A;  2KR2 A;  1N3P A;  2WQZ C;  3V64 A;  4BQ3 A;  1V6M A;  3I2F A;  5BNN B;  4XZU G;  5KHK A;  1LKN A;  2VZV A;  3NQH A;  2WA3 A;  3ON7 A;  5FP3 A;  3VL9 A;  5FPA A;  3SCH A;  5CEH A;  4N43 C;  4LHK A;  3KV9 A;  4AFM A;  3OJB A;  1ENR A;  2GH8 A;  5FY4 A;  4E9K A;  2RS5 1;  1WLT A;  3J7H A;  4AAP A;  1BVV A;  3A0K A;  1XSQ A;  1YFY A;  3AMP A;  5F2S A;  1PO1 1;  4YFW A;  4AFC A;  3GGL A;  3ZOI A;  4E8D A;  1NUK A;  5A32 A;  2R07 1;  3VBH B;  1QGL A;  3GBW A;  1GR3 A;  1W8H A;  3AFG A;  4FO9 A;  5A1F A;  2A70 A;  1WGP A;  4YG0 A;  3ZKY A;  3C7G A;  5KHG A;  5H9S A;  1AR8 1;  5FZF A;  1JZ5 A;  1US3 A;  1LAJ A;  3LZZ A;  3M3E A;  4FBF A;  3L2H A;  2WNV C;  4LO7 A;  3HBZ A;  3A4U A;  4IEZ A;  3J26 N;  2WII B;  3T09 A;  4DOU A;  5A32 B;  2ZEZ A;  1W0O A;  1PX3 A;  2BU9 A;  3JQW A;  3AZZ A;  3VZO A;  4CCJ A;  3WNO A;  1FNZ A;  1RJ7 A;  3NJX A;  1MQT A;  4FPH A;  2J1R A;  1U5I A;  4IV1 A;  1IGO A;  3VB9 A;  3VD3 A;  2XBO 3;  4QB1 A;  1CIY A;  1DQ5 A;  1STM A;  3BU7 A;  1H1A A;  4H14 A;  5FXZ A;  5H9R A;  1BJQ A;  4K6B A;  4LKF A;  4MHR A;  5JPM B;  2VUC A;  4WZF A;  1HIX A;  3C8X A;  2XB6 C;  3HWJ A;  4XFC A;  5I0R A;  4IUG A;  5FYU A;  3N9N A;  3ZDV A;  2PMW B;  1R09 3;  1JYI A;  2BFU L;  4UYB A;  3IWZ A;  1VBE 3;  2ARA A;  4QKF A;  2XOM A;  3C2U A;  4YGE A;  1MQT B;  4FOY A;  3WF4 A;  5FR3 A;  4ZON A;  2PAM A;  4IV1 B;  2DTW A;  1GZT A;  3NWK A;  3PUH A;  1Y43 B;  4AHX A;  2YFZ A;  1ULO A;  2WWU A;  4J6G A;  1X50 A;  1SFY A;  2YMZ A;  4Y22 A;  2C0Z A;  2WC2 A;  5AVP A;  1PO2 2;  1UY1 A;  3BB6 A;  4UW4 A;  3MUZ 1;  2E7T A;  2VQT A;  5EXO A;  5EYY A;  4DO0 A;  3DGT A;  3QH7 A;  1ZBE 2;  4HKL A;  2Q4S A;  2GC2 A;  2AEN A;  3POB A;  1A3K A;  4L97 A;  4XCA A;  5FZO A;  4MUV A;  5GLZ A;  4ASL A;  1SLI A;  3FHA A;  1SG3 A;  2ZGT A;  3ROU A;  1CAX A;  2RDS A;  4E27 A;  1BYH A;  2LW8 A;  4Y20 A;  1XYO A;  3FX3 A;  2WNO A;  1YQ5 A;  4FTB A;  2OT7 A;  5HV4 A;  3QH6 A;  4HSL A;  4AFD A;  4NRQ A;  2NP0 A;  4Y1U A;  4KMQ A;  5FYC A;  4LO5 B;  4OUL A;  2C6S A;  4Y22 B;  3R4D B;  3N35 A;  1QY4 A;  1OF4 A;  4YW3 A;  3AB0 A;  2VZO A;  4QPG A;  4UW5 A;  2A6X A;  3AP5 A;  5FO9 B;  2ZX3 A;  4Z92 B;  1OA4 A;  5FZO B;  3WV6 A;  3P3P A;  1CAX B;  3U07 A;  4UI9 L;  4XFH A;  4Y20 B;  1LOA A;  4BWO A;  5FP7 A;  3KT7 A;  2BOJ A;  3BVC A;  1ULG A;  1CQ9 A;  1W2O A;  1OSG A;  4MET A;  5FO7 B;  5E1R A;  4LPL A;  1AZD A;  3VBF C;  1XPW A;  2J1S A;  3PVN A;  2GND A;  3T1L A;  2W39 A;  4FSJ A;  2RM2 2;  1IS3 A;  2ZEW A;  3TBD A;  2CV6 A;  2VM9 A;  1RUG 1;  2VW2 A;  3ES1 A;  3MUY 1;  3Q8E A;  1JYV A;  2WR9 A;  1PNG A;  3LDB A;  5C71 A;  4QPG B;  2JDU A;  2ZEY A;  3C7O A;  2AEZ A;  3IM0 A;  1ULF A;  4BIS A;  4LIV A;  1PZ7 A;  4CCD A;  1QOT A;  3BOP A;  4Q0V A;  3NNG A;  4B29 A;  4GJZ A;  1C1L A;  4BPZ A;  4EN7 B;  3B94 A;  1PGL 1;  1OLR A;  3UGG A;  5FY9 A;  1AXK A;  4CSW A;  2PEL A;  5F5C A;  1Y9G A;  4HSJ A;  3WXP A;  4XF1 A;  2G9F A;  1L3J A;  3K3N A;  1SPP A;  2D97 A;  3BTX A;  5IAT A;  2VCB A;  3LIG A;  2VMC A;  1H8T A;  4YVS C;  3EXU A;  5DG2 A;  3QBQ A;  2XJT A;  4MZU A;  3ZSM A;  5T5P A;  1DZR A;  3EJK A;  5FWJ A;  1YLL A;  1ULE A;  1QJU 1;  1WW5 A;  3THD A;  1R1A 3;  3SNM A;  4GIQ A;  4FPJ A;  2RJ2 A;  5EPA A;  3LKJ A;  2ZX4 A;  3T2T A;  4DIQ A;  3ZPY A;  1GWM A;  4A6O A;  2R1B A;  1A8M A;  2VQA A;  4LTA A;  1HJF A;  2ZGU A;  4L2N A;  5FZ0 A;  3R6S A;  1K45 A;  3AMH A;  4A7Z A;  4V2W A;  1SPP B;  2E53 A;  2P6C A;  1UIK A;  4BLI A;  1J1L A;  1H8T B;  3ETQ A;  3U1X A;  4FT8 A;  1QQP 2;  5LBF A;  4XIK A;  3AZY A;  5A3O A;  2HEV F;  1QNY A;  5ACA 3;  5I0D A;  4DS0 A;  5A3U A;  1NQJ A;  5ANQ A;  4RD7 A;  2E33 A;  3ZXG A;  4LE4 A;  5FLH A;  3GZU C;  1DGW A;  1DGR A;  4GA9 A;  5D21 A;  5FTT C;  1YEW A;  1QF3 A;  1XB9 A;  2HLE A;  1VBA 2;  2HH9 A;  4P9Y A;  3AKP A;  1H4G A;  3T0D A;  1XNC A;  3KCX A;  4AI1 A;  1LU1 A;  2OII A;  5B2G B;  2MHF A;  2W1S A;  1ND3 C;  1LOF C;  3KCC A;  3PL0 A;  2OXB A;  3JBG 3;  3NAP A;  3B00 A;  4XYX A;  2BNM A;  1UKG A;  1N3Q A;  2VQ0 A;  3JXS A;  3E5U A;  1RIR A;  1H1I A;  4R9B A;  5GLU A;  4CEW A;  3K4Z A;  3ZFF A;  1LGC A;  5A3P A;  4A6S A;  4QGL A;  4RQP C;  2RMU 1;  4ZU5 A;  1ZVF A;  5FAX A;  1VLN A;  1UOG A;  1PGW 1;  1W99 A;  1WCQ A;  2VZT A;  3TN9 2;  4F3J A;  1VMJ A;  3E97 A;  5J48 A;  1W2N A;  3N7K A;  2PAK A;  4AVV A;  5KC5 A;  5DZG A;  4YAR A;  1WCK A;  3RWN A;  3U75 A;  4BQW A;  1VAM A;  3NO8 A;  1FPN 3;  2QQP A;  2XL7 A;  1HQN A;  5CFD A;  1GWK A;  1W3V A;  1ZZC A;  1AUY A;  1W04 A;  2XVL A;  3NAP B;  4Q0U A;  4XUQ A;  1VRH 3;  3WCR A;  4CEW B;  2JE7 A;  2X29 A;  3DXT A;  4JGZ A;  4ZPI A;  3RMX A;  4AWD A;  1ZRC A;  3QCW A;  4X8N A;  3ZFF B;  3K46 A;  1CGP A;  1B35 C;  1QJF A;  3TEX A;  3N36 A;  2PHD A;  2WFP A;  5FMD A;  4IEY A;  3ILN A;  2PHT A;  2IXH A;  1BMV 1;  2A6W A;  4AQ2 A;  4AXO A;  1H6Y A;  2KXL A;  5FMB A;  1RGS A;  2WSU A;  4LHL A;  1W8N A;  4RGA A;  2JG9 C;  3ZKU A;  3AVR A;  3Q8F A;  1GSL A;  2V5D A;  4DXR A;  5CFD B;  5IHR A;  3JB8 A;  1HB2 A;  1QJX 1;  2VR4 A;  3I3D A;  4C90 A;  2EA7 A;  2XQX A;  4JGZ B;  4RYD A;  4W6W A;  4XTP A;  2B4K A;  1BBT 2;  2RDQ A;  4RSU A;  3KT1 A;  1BZW A;  2QVS B;  4JC1 A;  5M0T A;  2PHU A;  4QPI A;  4LT5 A;  3O0X A;  4J1X A;  5A7P A;  2WIN B;  1J84 A;  4EYU A;  4BQ5 A;  1YFW A;  3N7L A;  1O4Z A;  1FI2 A;  4R8H A;  3DF0 A;  4COW A;  2W92 A;  1O8P A;  1RUE 1;  1BEV 1;  1COV 3;  3S5A A;  4Q4W 2;  1S0E A;  3UES A;  1PK6 A;  3UET A;  1Y7B A;  2ZHM A;  3N3H A;  1FMD 2;  1OKO A;  1W9W A;  3FLP A;  1IS5 A;  1RUI 2;  1XND A;  2PHL A;  2VMI A;  1GQP A;  4CDU C;  3S7I A;  3WNK A;  1LTE A;  3KS7 A;  4DEV A;  2UWC A;  4HVO A;  4E2G A;  1K5M C;  5F9T A;  1QJY 1;  5JWP A;  1IS6 A;  3UT0 A;  5A3W A;  4QPI B;  1XXN A;  5FZ6 A;  5CKM A;  5DAW A;  4CCN A;  5LWB A;  2ZX0 A;  2WNU C;  2ZMK A;  1W6O A;  1AR9 2;  3ZFG B;  2D3S A;  1DQ4 A;  1PK6 B;  1JUI A;  1W0P A;  4AI3 A;  5F1R A;  2FDK A;  4GMP 1;  4UT5 A;  2PLV 1;  5I91 A;  3I97 A;  2Y6H A;  4IEQ A;  1LRH A;  2IUW A;  3J8F 2;  5C7G A;  3PMS A;  1DBN A;  1W6M A;  3EQE A;  4NVP A;  4ORF A;  4PCR A;  2SLI A;  2LRP A;  2VW1 A;  2RR1 3;  1W2A X;  4A7K A;  2GZW A;  2W0X A;  2A5Z A;  2H6C A;  3ZM8 A;  2E32 A;  2WN3 A;  4NMI A;  4I3P A;  2W5F A;  4QX8 A;  1W6O B;  4TYS A;  4A2U A;  1YJL A;  3VD9 A;  3BPS A;  1L7Q A;  2BGP A;  2VUA A;  4XBL A;  4YNI A;  3DPR A;  1RHI 2;  3OPW A;  3DEC A;  4WM7 C;  4MO3 M;  3AZX A;  1AF9 A;  5LBC A;  3K48 A;  1F5J A;  4HET A;  3NKG A;  4OI1 A;  1NG0 A;  1UY2 A;  4W50 A;  2OUH A;  2OUJ A;  3H50 A;  4HVQ A;  4AF9 A;  1V6K A;  2EF6 A;  2WO2 A;  4GWN A;  2JX9 A;  1W6M B;  1PIV 2;  3B02 A;  4NWV A;  3RZM A;  2RS3 1;  4N53 C;  2YXS A;  2F6B A;  5A7Q A;  4PDW C;  2VPV A;  1AL2 2;  2JE9 A;  2VGD A;  3CJX A;  4JGY B;  3ZYJ B;  5JI9 A;  1W6N A;  3DPR B;  1NY7 2;  4Z1V A;  4F8A A;  4QX1 A;  2D7F A;  1LR5 A;  3POG A;  3WQ7 A;  3MYX A;  3I49 A;  5T54 A;  3G7D A;  3LEK A;  1WMD A;  4LBJ A;  1RIN A;  5FZI A;  3CKH A;  1QEX A;  3M3Q A;  5A6Z A;  4YG3 A;  3FBY A;  1QDC A;  1AR7 2;  2B5H A;  4LNV A;  3RZZ A;  1UMH A;  3LOI A;  4GB3 3;  3WP4 A;  4CP2 A;  1PVX A;  3M3O A;  4ET7 A;  1AXZ A;  2WDB A;  2PHX A;  4ZU7 A;  1I5Z A;  2XG3 A;  2VU9 A;  1W03 A;  2VNO A;  5EWS A;  4JKK A;  2X5I A;  1ENQ A;  1J3P A;  3O7O A;  5SV5 A;  1NYW A;  3H9A A;  5LBE A;  3LWC A;  5EJ3 A;  3ZXF A;  3OF1 A;  3C7H A;  1RXF A;  1DHK B;  1G9A A;  1AYM 2;  4RR3 C;  1OD3 A;  2Y64 A;  3PU8 A;  3VDB A;  2WFF 1;  1JI6 A;  3O5S A;  2Y60 A;  5LA9 A;  5A7O A;  2D5F A;  3POJ A;  1A6C A;  1GAN A;  5IW0 A;  3AL6 A;  2VBB A;  3CHX A;  3R05 A;  2ZKN A;  2WO3 A;  5FZ1 A;  1ASJ 1;  3AYA A;  4BB3 A;  2AGS A;  5LK5 A;  2YU1 A;  2B7Y A;  1US2 A;  4P9X A;  3V0B A;  5GZE A;  1H2N A;  4GXL A;  1LHV A;  1CZV A;  1YQ6 A;  3X29 B;  4BMB A;  2EIE A;  1QHD A;  2R06 1;  3VDD C;  2CGN A;  4IGP A;  5DDJ 2;  4LHS A;  2W94 A;  2DF7 A;  3ACL A;  1EPW A;  5FZA A;  4IND A;  4CTE A;  5KHH A;  4RHV 2;  1HV1 A;  5KC6 A;  4KG0 A;  2I07 B;  5BNQ A;  4N90 A;  3FLR A;  3VGI A;  1RED A;  1SLB A;  4PBO A;  4N43 B;  4D6Q A;  2ZGL A;  4B1M A;  4XAE A;  2Q1Z B;  4IEU A;  4TLG A;  3V0B B;  2HEW F;  1RUJ 2;  1OA3 A;  5AC9 1;  1N1V A;  5H9P A;  3AP7 A;  5D2A A;  3U4S A;  2KD7 A;  2WLP A;  3IKW A;  1RUD 2;  3VL8 A;  1GQG A;  2ZAC A;  4JHZ A;  4L9B A;  2WZR 3;  2YHJ A;  3AXD A;  3HOB A;  5HV0 A;  4HXC A;  1YI7 A;  2D5H A;  5FUP A;  4ASK A;  5FYV A;  1CON A;  3HNY M;  5BNP C;  1XQN A;  5C9A A;  1RVF 1;  2QQW A;  2VE1 A;  4O65 A;  4OHY A;  1MZF A;  2W68 A;  3WIN E;  1LEN A;  3O1T A;  1MS1 A;  4DIN B;  1SHW B;  1W90 A;  3ZXL A;  1JZ7 A;  1X33 A;  1R09 1;  3LSD A;  4GH4 C;  1C4R A;  3U78 A;  1X82 A;  2ORZ A;  4WBB A;  3PVO A;  3VHO A;  1RC6 A;  1Y9Q A;  2TBV A;  4Y1X A;  5LY2 A;  3DKW A;  2DVG A;  4FPO B;  3S6P A;  4XHX A;  2N7G A;  3OBT A;  2XWB B;  4Z07 A;  3H8X A;  2O14 A;  4MXV A;  4IEO A;  1ND2 A;  1NZC A;  3ACI A;  2JKX A;  1QOO A;  2BFU S;  1PX4 A;  3JD7 3;  4HVR A;  4XET A;  1DZT A;  4Z2W A;  5IT6 A;  3MFC A;  1RUF 3;  1ACC A;  1EPZ A;  3BN6 A;  1LUL A;  2J22 A;  4SBV A;  2J42 A;  3DCQ A;  4IE7 A;  1UU4 A;  1OLM A;  1V70 A;  4PJY A;  1DQ2 A;  1VRB A;  3LEI A;  3MLL A;  4FFF A;  5JLV A;  4JDN A;  2YC4 A;  4YGB A;  4UBH A;  4BLJ A;  2WYS A;  3UGF A;  2HWF 1;  2YUE A;  3ACG A;  4YFZ A;  4XHB A;  1ND2 B;  1NKG A;  4IDZ A;  4IET A;  2VMH A;  4I01 A;  1FX5 A;  2DFC A;  2FBE A;  3E6D A;  4HK8 A;  2PA7 A;  1YFU A;  4GQ7 A;  1ZYB A;  1D2S A;  2X8K A;  1HQW A;  1YFX A;  4BM8 A;  4ZZ8 A;  1HRV 2;  3LCP A;  1VMH A;  1DQ1 A;  2HYX A;  2QQK A;  4Y5T A;  5FYS A;  2VBP A;  1TME 2;  5C8C A;  5FY7 A;  1MPX A;  1VBC 3;  2ZGR A;  4QQL A;  1JBC A;  4BYY A;  3VBF A;  2FCU A;  1HRI 2;  4Y1Y A;  4IE5 A;  4DXZ A;  4M00 A;  3VKN A;  1UZZ A;  5LA2 A;  2ZHK A;  4IXL A;  1XU1 A;  1AHS A;  1UKR A;  4CDQ A;  1SMV A;  2EID A;  3NJV A;  2EXH A;  2QUO A;  2UY8 A;  1QJE A;  2C24 A;  4RL7 A;  4I0W B;  2XQR A;  4ZHN A;  4AHW A;  4KWJ A;  5C8C B;  2BTV C;  3OYW A;  5IYY A;  2HYK A;  3VBF B;  2GH2 A;  4CEY C;  2R16 A;  2RJK A;  4UAP A;  3T30 A;  3T2Q A;  3LFI A;  1YIF A;  3CZJ A;  3EB7 A;  5FBZ A;  3VBS A;  1C8M 3;  4AVA A;  4AAX A;  1KFU L;  1V00 A;  2FQP A;  1LOG A;  3TOJ A;  1MZ5 A;  4CDQ B;  2NLR A;  1R1A 1;  4R9D A;  4KWL A;  2CY6 A;  5FFO C;  2QZ2 A;  2ZGM A;  4Q0Q A;  5HCF A;  3OYW B;  5FZG A;  3FL7 A;  2RE9 A;  3BCW A;  4OI0 A;  3AP9 A;  4MOA A;  2QQV A;  2O0O A;  4ARX A;  4H2A A;  4DB5 A;  1JYN A;  1W2U A;  3OGJ A;  4IE6 A;  3VBS B;  4A4A A;  3VZJ A;  4PBP A;  2C26 A;  4FFG A;  2BUK A;  5APA A;  2LAL A;  2VNV A;  3ZXE A;  1VBD 1;  2VOX A;  5FLI A;  1XC6 A;  4KGG A;  4RS5 A;  5AVA A;  1IZ3 A;  4AZZ A;  2DU0 A;  1H6X A;  2P34 A;  5T5L A;  3VV1 A;  5A3N A;  3LF7 A;  2TNF A;  3GCX A;  4XF4 A;  3V65 A;  1GZW A;  1ST8 A;  1FOD 1;  1LHW A;  4OHX A;  1RUH 2;  3WQ0 A;  4QHB A;  5DAX A;  4AE2 A;  1MS0 A;  3LEG A;  1GUI A;  1V6O A;  2WQ8 A;  4D94 A;  1Y9M A;  1ZRI A;  4XVH A;  5DUV A;  1W8T A;  1BQP A;  2VZ1 A;  3WNN A;  4HK9 A;  2PHW A;  4CU6 A;  5C3Q A;  1DGW X;  1ALY A;  1S0D A;  5IFP A;  4N8M A;  1QOS A;  1CAU A;  4MVT A;  2IFR A;  2XDV A;  4LUL A;  4TWT A;  2Z5W A;  4RS5 B;  2CU5 A;  5F5A A;  2FDG A;  3CDZ B;  5FMO L;  1FNY A;  4LK7 A;  1UZ0 A;  1C1F A;  2UU8 A;  1DP0 A;  5IK4 A;  1GZW B;  1AYN 3;  2JIG A;  4H3W A;  1SEF A;  5F2W A;  3ALQ A;  3JQX A;  1RUC 2;  5D8A A;  3IN9 A;  1D4M 3;  2WL1 A;  3HR9 A;  3SIT A;  3VBR C;  4RFT 0;  2W46 A;  1WA6 X;  4WVW A;  4CXW A;  4GJY A;  3OY8 A;  1JZ2 A;  3AMQ A;  2VXJ A;  2VXR A;  1FPN 1;  1DFQ A;  4OI4 A;  4XFI A;  4XUT A;  2JG8 A;  4MGS A;  3KVA A;  2XUE A;  4LIT A;  4MHU A;  4XFB A;  5L9V A;  2LUW A;  1VRH 1;  2O8O A;  5IUQ A;  4B7K A;  3MZH A;  1S0G A;  1K12 A;  1WZX A;  3EMR A;  3KQ4 B;  4HN0 A;  4XQW A;  4LBQ A;  3WNX A;  4OQ9 A;  5FY0 A;  1X8E A;  3JBG 2;  4DUW A;  2WNE A;  3WY6 A;  5FXV A;  5DMY A;  4URT A;  1O59 A;  5D8A B;  3KGL A;  1OD5 A;  1OI6 A;  1TVG A;  1MAC A;  2GSY A;  3CO2 A;  4E4S A;  4BZ4 A;  4FTS A;  4LE3 A;  3SH5 A;  2C5D A;  3OY8 B;  5T52 A;  5HXM A;  3GDB A;  1IKP A;  4QDS A;  2IVI B;  5FZH A;  2JG8 B;  4CYD A;  1WW6 A;  5BY5 A;  1VE0 A;  2VTX J;  4B4R A;  5EJZ B;  4COY A;  1GOH A;  1AVB A;  1LGB A;  3IDA A;  1KS5 A;  2Z2S B;  2HWC 3;  1B35 B;  5BNN A;  4LBQ B;  3SH4 A;  1EAH 1;  2GN3 A;  3ZVX A;  2YYO A;  5J1X A;  3O1O A;  2DU1 A;  2RS1 1;  2VOW A;  2YG0 A;  2QCS B;  2Y8K A;  3LGR A;  1FV2 A;  1F35 A;  1MVE A;  3NW4 A;  4YYO A;  1OUS A;  3POS A;  4CXY A;  2JG9 B;  3ELN A;  3NV1 A;  4E4H A;  2A73 B;  2BW8 A;  1COV 1;  2WZ8 A;  2HWE 2;  3E6B A;  4Q29 A;  4QM9 A;  1AR6 3;  3AVS A;  1RMU 2;  5T5O A;  4ITC A;  2EVX A;  2ORX A;  3TYJ A;  4XUR A;  1LHO A;  1G9F A;  4BK5 A;  2WFF 3;  3WF1 A;  2Y6J A;  2L9L A;  4MGZ E;  2IWG B;  1YQ8 A;  3B9C A;  2CNA A;  5JSP A;  5J98 B;  3VHR A;  2MEV 3;  3VLB B;  3ZSK A;  4JQR A;  2GC1 A;  1ASJ 3;  4XTM A;  2A3Y A;  2FCV A;  2VEC A;  4RFR B;  2CWM A;  4ONU A;  2D6K A;  5J96 B;  1SDD B;  1HB4 A;  5CKQ A;  3WW3 A;  1H2M A;  1SDW A;  2SBA A;  2V5Y A;  1OH4 A;  3NV4 A;  4LOT A;  4QQH A;  5TSW A;  2JDZ A;  1W8W A;  2R06 3;  5FKB A;  3MLJ A;  2AH2 A;  2HBU A;  2W08 A;  1I1E A;  1BK1 A;  1PM4 A;  1U5Z A;  4CCC A;  5CFC A;  2WAB A;  3FUO A;  3H7Y A;  2HWD 1;  4NHL A;  4LO6 B;  4DY5 A;  3KZ4 C;  5JPN B;  3FHQ A;  2WT0 A;  1WD3 A;  2RR1 1;  3M4F A;  2ZGS A;  1JTZ X;  2ZOE B;  4NPR A;  2WNU B;  1RYY A;  2D6O X;  1XSR A;  3DL3 A;  2XHK A;  1S2K A;  1NLR A;  5AC9 3;  3TEW A;  3K77 A;  1IQD C;  1E5R A;  3M3C A;  3WUC A;  3V0A A;  1S2B A;  2RDR A;  4WM7 A;  3H3U A;  4K8F A;  2RS5 2;  4UW3 A;  3SEP A;  2BRT A;  4C1X A;  4FPL A;  5GLW A;  3WNM A;  5CFC B;  3KGZ A;  2VJX A;  1PO1 2;  1XYN A;  4AFB A;  2HWB 3;  2R07 2;  5A1L A;  5JMO A;  3IDC B;  1RVF 3;  3KVB A;  3VKO A;  2CWS A;  4DZG A;  1A34 A;  1CX4 A;  3HNM A;  5E16 A;  3CLP A;  2DVF A;  4KU7 A;  1E5S A;  1MZ6 A;  2E7A A;  2JIJ A;  2RHP A;  3NL1 A;  1QIQ A;  3FC0 A;  1DIW A;  1DYK A;  1AR8 2;  4OCT A;  1UYP A;  1OUR A;  3ZYH A;  2YC2 A;  4D6S A;  3V0A B;  3RZH A;  3HEI A;  4DXS A;  4LLO A;  4WM7 B;  1CR7 A;  4UFL A;  4XMI A;  3ZYP A;  1YRZ A;  3GBF A;  2JE8 A;  5A7S A;  1Y3T A;  5FOB B;  2BOI A;  5FRE A;  1D2Q A;  4KBZ A;  3AMM A;  4AHY A;  5A1A A;  4TZD A;  4XF0 A;  4WV8 A;  2VOT A;  4GB3 1;  4EQV A;  3VBU A;  4DRR A;  4S2F A;  4FFI A;  1QJZ A;  1AX2 A;  4PDW B;  3SCF A;  4DNY A;  1OKQ A;  3AXE A;  2R49 A;  3I3B A;  3PNA A;  1UYY A;  4P14 A;  3I59 A;  2VQU A;  5FUI A;  5EIY B;  1HQL A;  5JZG A;  5BNO A;  3M70 A;  4URA A;  4QD2 A;  5FO8 B;  4XQ4 A;  3M1H A;  2Y26 A;  1LJ7 A;  1SCS A;  1VIW B;  1CAW A;  2AC1 A;  2CGO A;  4JHT A;  4Q4V 1;  1LOD A;  4K1Z A;  2ZZQ A;  1HXS 1;  2HWF 3;  2ZCW A;  1Q5O A;  1M4W A;  3VBU B;  4H7M A;  3JZV A;  4BQ2 A;  4CP9 A;  4KG8 A;  1NAE A;  1POQ A;  5K0U C;  1XBF A;  3AL5 A;  2W3J A;  3LEM A;  3NV3 A;  5CZK A;  3ZMN A;  4YGC A;  1CJD A;  4I0B A;  3FHI B;  3I59 B;  1ZBA 2;  4NOT A;  1NA1 C;  2YGM A;  4O61 A;  3KM5 A;  2VUD A;  1CJP A;  3OGS A;  4PQ9 A;  1D0H A;  4XQD A;  2G19 A;  5JZG B;  1UO9 A;  5BNO B;  2QTW B;  5HPO A;  3ZR6 A;  1GV9 A;  5F39 A;  3APB A;  3W21 A;  2WBK A;  4NR1 A;  4PLO A;  2P6H A;  5FYI A;  2K2S A;  2QNK A;  2AZ5 A;  2FCT A;  1NXD 1;  1CAW B;  1NCR C;  1CAV A;  4AK3 A;  2JDY A;  5FP9 A;  3WSO A;  3WVJ A;  1FV3 A;  3OTF A;  4CP9 B;  5HBA A;  5IK7 A;  2A1X A;  4LUK A;  1OVP A;  4Q4X 3;  2NMO A;  4P02 B;  2VMG A;  4MGK E;  5C3O A;  4EE2 A;  5L73 A;  1OOP A;  1E5I A;  1EUT A;  3KF3 A;  1UZW A;  3QD6 A;  2J7M A;  2I2S A;  2XJP A;  3M8L A;  4Q1R A;  2WWJ A;  2BDR A;  2G1M A;  1CAV B;  2WZR 1;  3N9L A;  1UZV A;  4QPW A;  2Q8E A;  3WDY A;  5LCW L;  2ZHL A;  3HT1 A;  4FPC A;  4AQ6 A;  3HMY A;  3OB8 A;  2XJR A;  4JDO A;  2QQN A;  3QOP A;  3VN4 A;  3MLK A;  4HPK A;  5FDB A;  2YBK A;  5E88 A;  3AZV A;  2XJS A;  2LTN A;  2W2I A;  4YVW A;  4P00 B;  1RUG 2;  2D93 A;  1OOP B;  1X7N A;  2WJS A;  5ANN A;  1G9D A;  3J4U H;  2IXK A;  2VO5 A;  3SHR A;  5IVJ A;  3WF2 A;  3S57 A;  1PGL 2;  5DAB A;  4R52 A;  3WDV A;  1QQP 1;  1HW5 A;  1WLC A;  3IB3 A;  2ARB A;  4HPK B;  4GWM A;  1ZZ7 A;  4JRA A;  2ZGO A;  2W91 A;  1VAK A;  1GBG A;  1VBD 3;  1LOB A;  1YC6 1;  2A6Z A;  4R9C A;  4WM8 A;  3I2H A;  3T2P A;  3WP3 A;  4CP1 A;  2IFW A;  2P2K A;  4KWU A;  1JW6 A;  4YVW B;  5FYY A;  3SC7 X;  5CKN A;  5KXE A;  4Q0P A;  3VD7 A;  3JD7 1;  4LOS A;  2ZX2 A;  1Q3E A;  3DN7 A;  4Q2F A;  5ABJ A;  3POE A;  4QGM A;  5IVE A;  1QJU 2;  1RUF 1;  1RIT A;  2X10 A;  1XJA A;  1TNF A;  1FOD 3;  1W39 A;  3KF5 A;  4CDX C;  4YW1 A;  4CPB A;  4OHW A;  4LBL A;  2KM2 A;  5C3R A;  1GYK A;  4UFH A;  3H42 B;  1EV1 3;  3HPN A;  1KD7 A;  5FXX A;  3MIF A;  3WHU A;  5JSO A;  3KQR A;  3LPG A;  2ZGQ A;  2ZZJ A;  3CJI C;  3PU3 A;  4OMC A;  1F2N A;  4XJW A;  4Q26 A;  3OD4 A;  1ZX5 A;  3UK9 A;  2CYF A;  3WW1 A;  1G9B A;  2PQQ A;  4CZS A;  4YZ2 A;  4NWW A;  5FPV A;  4WM8 B;  2ZHN A;  4HOO A;  4N9H A;  1OBN A;  4FPY A;  4IEV A;  4QB2 A;  4CDW C;  2EAA A;  3VBO A;  4D69 A;  5K7P A;  3F95 A;  1NE6 A;  3JB4 C;  5EP9 A;  3RSJ A;  1ZZ9 A;  1POV 0;  3RG0 A;  1UOJ A;  4HL0 A;  1IG0 A;  1VR3 A;  3OD0 A;  1VBC 1;  3I3E A;  2WWS A;  5JMC A;  1KRI A;  3D0S A;  3Q9O A;  2VUJ A;  3IZO A;  4UOJ A;  4IES A;  4UFJ A;  4FQ4 A;  4BCU A;  1SCR A;  3VBO B;  4CCE A;  2W52 A;  5A3L A;  1KQR A;  1JYW A;  3SCG A;  3E1F 1;  4LOR A;  1J1T A;  5C4W C;  4PIZ A;  5IAX A;  3PTY A;  2ET7 A;  5JCT A;  4YW4 A;  4GD4 A;  4AQT A;  4CUC A;  3FE5 A;  4LA3 A;  5FK8 A;  4ZU4 A;  3MGU A;  4XF3 A;  2RMU 2;  2VZS A;  3PHM A;  4YM0 A;  5CA6 A;  4TTG A;  1HB3 A;  1LB2 A;  1YCI A;  3NNF A;  4M3C A;  3RNS A;  1LGN A;  1FYU A;  3OPT A;  5FY8 A;  1C8M 1;  1RTV A;  2GDF A;  5SV8 A;  1V6L A;  3IIA A;  1OQD A;  2DYC A;  3ZYB A;  1HB1 A;  1YHF A;  3VDA A;  1Q8Q A;  3ZYI B;  4YSF A;  2QQM A;  1BK0 A;  1EAH 3;  5BPX A;  3ZFE A;  2BGO A;  2ADD A;  4BOW A;  2RS1 3;  2VZR A;  4NAO A;  3T0A A;  5FP8 A;  1S0C A;  3AKQ A;  3LFM A;  3D4K A;  3BOW A;  4J1W A;  2IZW A;  2ZGK A;  5L7O C;  2Q1M A;  3ZYG A;  4L8Q A;  1NE4 A;  2ZGN A;  4OUE A;  1UXZ A;  1LHN A;  2OPW A;  3POF A;  1KFX L;  1MS8 A;  1N1T A;  1LCL A;  2P1B A;  3OCP A;  4M3C B;  3ZFG A;  1CWP A;  1K42 A;  4MH0 E;  1OPO A;  2W1Q A;  1PNF A;  2Y0I A;  3B69 A;  4C0H A;  3ZSE A;  4BQ4 A;  5AFE A;  1V9U 2;  1G8W A;  2Y34 A;  4I09 A;  4L0P A;  4CVU A;  4NIA A;  4COV A;  2V4V A;  3SIS A;  2C9A A;  3N9M A;  4U36 A;  3ACH A;  3RWK X;  3ZFE B;  5I0S A;  2YPJ A;  2XXZ A;  3GZA A;  1QJX 2;  1HV0 A;  2BNN A;  3VKL A;  4CCK A;  1W9Y A;  2VOV A;  4YM2 A;  2PYT A;  3LDR A;  5FPZ A;  1HDK A;  3T08 A;  4P9L A;  2XJQ A;  2VTX A;  4D6R A;  4W8J A;  1QNW A;  1HN0 A;  5A7W A;  4A7Y A;  2Q8O A;  3LA2 A;  5L19 A;  1VP6 A;  5LY1 A;  2JDM A;  5DUU A;  4CXX A;  1R1Z A;  1TMF 2;  3WW2 A;  4CCL A;  2D44 A;  1XRU A;  4NPM A;  1ODM A;  1OQ1 A;  1K3I A;  1WD4 A;  2FZ1 A;  4IW3 A;  3VBH C;  4IE0 A;  4BHP A;  2R04 2;  1RUE 2;  1BEV 2;  2Q8D A;  1O3T A;  1PVC 1;  2HWD 3;  5CG9 A;  3BTA A;  2NYY A;  4O9G A;  3PUA A;  4EZ4 A;  1OA2 A;  1CN1 A;  3ES4 A;  4H7L A;  3CZU A;  2E26 A;  1AYN 1;  4P9J A;  1SZB A;  3C7F A;  4XJU A;  1B09 A;  3ABZ A;  1H30 A;  1W2T A;  5DAP A;  1QJY 2;  3N9Q A;  5G04 L;  5A7W B;  4Q1P A;  4XAC A;  1X9P A;  1D4M 1;  5F5Q A;  3UGH A;  2DUR A;  3OUJ A;  2DCZ A;  4JAA A;  4JGY A;  3I2O A;  3MW2 A;  1D4V B;  4AVC A;  1JN2 P;  1JU4 A;  5L9R A;  4YZ5 A;  3MW3 A;  4AGV A;  2A3X A;  3I2G A;  3D3A A;  2JEN A;  4WVZ A;  5FCC A;  5FMO S;  4ZZ5 A;  1VMF A;  5C6C A;  2LS6 A;  2CDO A;  2YU2 A;  3KSC A;  2PLV 2;  3I4I A;  4GKY A;  4X8P A;  3I3Q A;  2PQS A;  1Q8S A;  1I3H A;  2W87 A;  3V56 A;  1JHN A;  2E6V A;  1XE7 A;  4Y33 A;  2A71 A;  1KJR A;  3PUS A;  1MEC 1;  2CHH A;  1GZC A;  4QM8 A;  2BWA A;  2BYV E;  1IQA A;  4XCB A;  4XIO A;  3TWI A;  1JYC A;  1MQT C;  2JEC A;  2JJ6 A;  5F32 A;  4IV1 C;  4AYU A;  3EYP A;  4S2H A;  4ERO A;  2HWC 1;  4KNC A;  2E7Q A;  2E9Q A;  1JUH A;  1UAI A;  1ZBE 3;  4WZC A;  5LBB A;  5C70 A;  4AG4 A;  1HX6 A;  2Q5T A;  3EBR A;  3OPZ A;  1REE A;  2VH9 A;  1H9W A;  2GN7 A;  1WUV A;  3O1R A;  1AXY A;  3CMG A;  4PF5 A;  4QX7 A;  3DKQ A;  2WAA A;  3THC A;  2RS3 2;  1FXZ A;  1GP5 A;  5GLV A;  3O1S A;  1CZT A;  3ASI A;  2EIG A;  2VMD A;  4XXP A;  3HNB M;  4X6Q B;  1AR6 1;  4FP2 A;  5FQ0 A;  5CYY A;  3RGB A;  5A6Q A;  4HZF A;  1IPK A;  3ZR5 A;  1DG6 A;  3GNE A;  1W8F A;  5A7N A;  4Q4V 3;  1HXS 3;  2WS9 1;  2MEV 1;  4Y4R A;  2ZBJ A;  1J3Q A;  3R0R A;  5DXD A;  4K7J A;  4N43 A;  2ES3 A;  1ULP A;  2CAV A;  3GJA A;  1YWK A;  4HG6 B;  3H3Z A;  2ET1 A;  2P17 A;  3B9I A;  2K9Z A;  3CF6 E;  1YQC A;  1CD3 G;  2PN5 A;  4C91 A;  1WW4 A;  4Q4Y 2;  2VBD A;  4Q5O A;  1R08 1;  1DCS A;  5FQ0 B;  4RHV 1;  4JX0 A;  4LR4 A;  4Y5Z 0;  4COU A;  2R6Q A;  4RN5 A;  4RGG A;  4C0B A;  3I8T A;  4A42 A;  4CUB A;  3U0Z A;  4E4Z A;  3UKT A;  3RYK A; 
#chains in the Genus database with same CATH homology
 4NMI A;  4UWD A;  2Y33 A;  5DAQ A;  4ZON A;  2RDN A;  3NNM A;  5DAX A;  5LBC A;  2RDR A;  4NHX A;  3NNL A;  3GJB A;  3PL0 A;  4BQY A;  4XAA A;  4IW3 A;  5LAS A;  4XCA A;  4NHK A;  2RDS A;  2JIJ A;  2JIG A;  5L9B A;  5ERL A;  4JZR A;  5HV4 A;  3HQU A;  3OUH A;  4BQW A;  5DAP A;  4XAC A;  3GZE A;  3OUJ A;  3KT4 A;  5EQU A;  4NHM A;  3OUI A;  4MHU A;  4ZPI A;  5L9R A;  5L9V A;  4KBZ A;  3EMR A;  3KT7 A;  3BVC A;  4NHY A;  5EP9 A;  5IAV A;  4Y5T A;  4XAB A;  5LBE A;  5C5T A;  4J25 A;  2HBT A;  5DAV A;  5LB6 A;  2FCU A;  5LA9 A;  2RDQ A;  4XCB A;  3KT1 A;  5M0T A;  5C5U A;  5LBB A;  4Y5S A;  5LAT A;  2G19 A;  5IAT A;  3DKQ A;  3MGU A;  4BQX A;  4XC9 A;  3W21 A;  3NNF A;  2FCT A;  3W20 A;  5EPA A;  2RG4 A;  5DAW A;  2A1X A;  3OBZ A;  2FCV A;  5IAX A;  3ITQ A;  4NAO A;  3HQR A;  3GJA A;  3NNJ A;  2HBU A;  2OPW A;  5HV0 A;  5LBF A;  4Q5O A;  2G1M A;  4MHR A;  5A3U A;  2Y34 A;  4NHL A;  2V4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...