3GJAA

Cytc3
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
310
structure length
265
Chain Sequence
b'ANFTFSPEEVARFERDGYIGPVKIFEPEEMTRRWNIIRRQLLDRSLAIYPDSNGKANISNYDRHLDIDLLAEHIMRPEIVDRVGSLIGRNLLCWRSEFFPKYQGDEGTDWHQAATFAHATGKPQIIWPSDEGRPAFIGTITVWTAFTHSTEQNGCLQLMPGTMNYDESAYPMVLKPGEAVIFWSNTMHASLPHTGSKTDYRMGFAARYVPTQVQVYPGTENLTEYGDGINLEKYGAVLTSGVDEYGHNRIARTSQRGYEFVPRQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CytC3
publication title Structural analysis of an open active site conformation of nonheme iron halogenase CytC3
pubmed doi rcsb
source organism Streptomyces
molecule tags Biosynthetic protein
total genus 71
structure length 265
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05721 PhyH Phytanoyl-CoA dioxygenase (PhyH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 3gjaA00
4Y5TA 5LA9A 5LASA 3GJBA 5EQUA 5C5UA 2G19A 2RDNA 5DAXA 5LBEA 4ZPIA 5DAWA 5EPAA 3W20A 3HQRA 2RDQA 2JIJA 4XCBA 4BQWA 3PL0A 5DAQA 2HBTA 3OUHA 4ZONA 5DAVA 3KT4A 3OUIA 3HQUA 3MGUA 2FCVA 3KT1A 5HV0A 3EMRA 2Y33A 5LB6A 2V4AA 4XCAA 4XACA 4XAAA 4BQYA 5LATA 4XC9A 2FCTA 5L9RA 2Y34A 4IW3A 5C5TA 4JZRA 5LBBA 4MHUA 2HBUA 5M0TA 5L9BA 5EP9A 5IATA 4Y5SA 3GZEA 4NAOA 2RDSA 3NNLA 3ITQA 5HV4A 3NNJA 2RDRA 2A1XA 2G1MA 5A3UA 3DKQA 3W21A 5IAVA 4NHXA 2FCUA 5L9VA 2RG4A 3NNFA 3GJAA 5ERLA 4Q5OA 4KBZA 4UWDA 4NHKA 4J25A 4BQXA 5DAPA 3OBZA 3OUJA 5LBFA 4MHRA 4NMIA 4NHLA 4XABA 4NHYA 3BVCA 5LBCA 2JIGA 3KT7A 5IAXA 2OPWA 4NHMA 3NNMA
chains in the Genus database with same CATH superfamily
4CDQC 4LKEA 2R061 4P9YA 4M0HA 4RGGA 4BK5A 3PUSA 4CEYB 4PDWA 2WWUA 1ZX5A 3OYWB 2ENRA 1GWMA 1AR83 1WW4A 3MPBA 3WX5A 5DXDA 3S30A 2VM9A 3OBTA 4XCBA 2CY6A 3PL0A 4I0WB 2C0ZA 3RYRA 4M0NA 2A3WA 1JOBA 3O0WA 1V9U1 3SCHA 1QXPA 2VMHA 1OLME 4LKDA 1UIKA 1LB2A 3OTFA 4N9HA 3RJ2X 4BQ4A 5FY8A 5AFBA 2GMEA 1SBFA 4BQ3A 3B9CA 4HMZA 1TNFA 4FPFA 2GMMA 3U11A 1WD3A 4Q1RA 2QUOA 4KWJA 2JB4A 1X50A 2QQNA 1SFPA 5J48A 4IEZA 2B7YA 4Q4X3 4COWA 2BFUL 1COV2 3TN92 3CHXA 1OSGA 3SH5A 2YFZA 5IYYA 1POV0 2GC3A 2RS33 4LHLA 3VDAA 4PHZA 1GKBA 5A1LA 4CZSA 3P5BA 3POIA 1WMDA 1UY0A 1LU2A 5JCTA 4XJ9A 4TN7A 2LALA 2ZXQA 4IW3A 2XUEA 2WYSA 3D5OA 3VBFB 2WAOA 1D4M1 2QNKA 2XR4A 5BXXA 1JZ4A 3VZJA 3VBSB 3IPVA 2HBUA 1VBB2 1WCUA 1JYIA 4ES9A 1JZ2A 1ZVFA 3O0VA 2X5IC 4AVCA 2DU1A 3ZFFA 3ZXFA 5FMCA 4DFSA 3NJZA 5EP9A 3VL8A 3RS6A 4EWDA 2DTYA 3AYAA 1R091 3IB3A 5JOXA 1HQWA 1SG3A 1GZCA 2WKKA 3BOPA 3MEPA 4J6GA 4Y24A 3J8F1 4ASKA 4XEZA 1RUC3 1HDKA 3VDDC 5C7GA 2W92A 3ATGA 1UIJA 4N90A 3SMHA 1LKNA 3MYXA 4LK7A 4LKSA 3WF0A 2Z2SB 4IETA 3ON7A 3L9JT 4OLLA 1XYOA 4LBQD 1S2BA 1YHFA 3AP6A 2BGPA 2ZEYA 1C5IA 4NAMA 3I2FA 5GLZA 4QKDA 3T1LA 1WGPA 4BXSV 5A7WA 2GC2A 1ZBE2 2V5YA 2FCUA 4P9IA 5L9VA 3V64A 2WFF1 3AL6A 3H8OA 5BNOA 3K51A 3WCRA 4Q0UA 1V6IA 1APNA 1CZSA 1WBLA 2Y6LA 1JZ6A 2WJSA 1BK0A 4BQXA 1J3RA 2R16A 2P17A 4U2AA 2VUCA 1D0HA 1BLZA 1J58A 1YXWA 2DVAA 2Q1ZB 4ISQA 1W6MA 4MHRA 3ZVXA 4RFT0 3IZOA 3GCXA 1W8FA 3ILRA 4QQ2A 5C3SA 2JWPA 5GZGA 1M4WA 3LDKA 3KT7A 4YW1A 1KRIA 4YW7A 4DS0A 1AR81 2BBAA 5FMDA 3AB0A 1C8M1 4DY5A 5L36A 2ERFA 4KL1A 4YZ5A 1J1LA 3NNMA 5T5OA 2XQRA 2BEOA 3PIJA 5FZLA 3NV3A 5FZCA 4BDVB 4Q0VA 3I3EA 1QIQA 4K20A 3WF2A 4OUSA 3GBGA 1AR73 4RSUA 4PJYA 2ET7A 1ND2A 1UN1A 2ZMKA 2MEV2 1QJY3 1MQTB 2OS2A 2Q1MA 3N35A 1E5IA 5JOWA 3THDA 3NAPA 3QLQA 4BH9A 1ZBA1 1JZ3A 1QHDA 1RUH2 1CAXA 1V9U2 4P00B 1BBT2 4QX8A 3MIHA 4ZONA 1LNSA 2JDNA 2PYTA 4UFLA 4Y20B 3T0BA 3IDCB 2DUPA 1OF4A 4I02A 3WHUA 2ZZJA 4W6XA 4JDMA 2RJ2A 4JGZB 3FL7A 3SKVA 2ATFA 4RFRB 2A73B 4A7ZA 3E5QA 1W3XA 1ENRA 4KMQA 4Y4YA 5CISA 3I97A 3KLSA 4MG2A 3TOJA 2C1FA 1YWKA 2VMDA 3RYKA 1UYYA 4XFGA 2PLV2 3PVNA 3NKGA 4HL0A 4GALA 1IQAA 3ZO0B 1CZVA 1RUJ3 3AP7A 4AEDA 5C8WA 5CG9A 1G7YA 3MI8A 3POWA 3AMPA 4HANA 1AR93 2OUJA 3WDXA 5FYMA 2PFWA 2V4VA 2D5FA 5DUVA 3MLKA 1RUG2 5FREA 2WT1A 3I2IA 4JTNA 1UQXA 4NUBA 3N9LA 2JG8A 2W1UA 3S7IA 1XE0A 3THPA 3Q8FA 3BKZA 1LOFA 4CUBA 1US2A 1X82A 4LMFA 5DDJ2 1R092 2XGXA 3FE5A 4L99A 3S5AA 3H9AA 1AXZA 4C91A 1WD4A 4CDQA 4IE0A 5LRSA 2RDSA 1XSQA 2IUWA 2DFCA 2UWBA 1HQNA 3NMBA 3NNLA 5KC6A 3FLPA 1YQCA 5T50A 1LHUA 5BNNA 4PIZA 4K1ZA 5A32A 2RR13 2Y8KA 3B94A 3W5MA 1HXS3 2VC9A 3C7HA 1CAWA 2A1XA 1GZTA 1EV11 3DECA 3F95A 2H0VA 3CLPA 3NQHA 4YPJA 1KJRA 3IT8A 3VZMA 3NRUA 3WP4A 2ZJCA 4RR3B 2RG4A 2UURA 4LOTA 1AR62 1W8ZA 5A3PA 5JZGB 3ABZA 1OLMA 4ZZ8A 4K9SA 1ZRRA 4H2AA 2IXJA 1PGW2 4R9DA 1O4YA 4PQ9A 4A7YA 4TZDA 1CWPA 5CZKA 1S0DA 4IGQA 4Y26A 1CJDA 3ZLIA 5ACA1 4AYUA 4JAAA 3O14A 1AR71 5ANQA 4B1LA 2FDHA 5FY5A 2VGDA 4XTMA 4YG0A 4RHV1 1UKRA 3ASIA 4XFAA 1OC1A 5IK4A 1U0AA 2P37A 5FTTC 1OA4A 5FPXA 2YC4A 4KBBA 2DV9A 1W2AX 2XL9A 4R9CA 4DINB 3R0RA 3U4XA 4OI2A 3AMHA 5LA9A 1TMF3 2IZWA 4HPKA 1V6MA 3OGGA 4AG4A 3GALA 1KD7A 1ZBA2 4HN1A 1LODA 2X5IA 2NP0A 3UL2A 3QH6A 2YG0A 4F8AA 4MGKE 1DLCA 5FZOA 1DDLA 2D6MA 1AYM2 5FMOS 5BNNC 3AMMA 2HBTA 3W9AA 4DO0A 3S0MA 1D2SA 2JDHA 3LIGA 1ND3B 3VDDA 1U5XA 2WT0A 3LAGA 4LO4B 1AXKA 1AF9A 1PMJX 1RUJ1 2W9XA 3ACHA 4OVEA 2YBSA 1Y7BA 1NQJA 4Z92B 4NWWA 3VDCA 3LGRA 1NLSA 2GP5A 4XQ4A 3WW4A 4FT8A 2A70A 1AZDA 4MVTA 3BU0A 5FYUA 1VRBA 1ZM1A 2KR2A 5AVAA 5GZEA 4COVA 4XCAA 2ZGPA 1B35B 2PA7A 3I3BA 3NVCA 1K5MC 3PDQA 4L11A 1XE8A 5K8SA 4QX3A 2OKXA 3WF1A 4M4RA 3I59A 3JB4C 2Q30A 5AFEA 3B00A 2ZGLA 4YM1A 3VBRC 3GZTB 2HJIA 1UX7A 4WM8C 2CV6A 3HPNA 2VW2A 5LBBA 5F3GA 1NLRA 1YFWA 1ST8A 1Z7S1 3AKRA 1MS4A 5DG2A 3LF7A 4FI9A 5IVFA 2VTXA 5KWRA 1O8SA 3ZR6A 1VMJA 4ES8A 5JMCA 3WHTA 5FZGA 2HYXA 5JXJA 5JIUA 2RR11 3R4SA 1BHGA 2Q8CA 4EE2A 4LIVA 2LRPA 4GH4C 5CEHA 1FPN3 3D8CA 4RQPB 2GZWA 4Q4Y2 1A3KA 1W2NA 1QWRA 1W6OB 4AVSA 4CUCA 2UY8A 2PN5A 3TNQA 1W0NA 1SPPA 4X6QB 3D0SA 3X29B 4MGTA 1NUKA 1EV12 3TYJA 5DN2A 5KXEA 2UYAA 3C3VA 5CADA 1NCQB 4F3JA 4YZ4A 3KHCA 4PI0A 5FV3A 4E2SA 1FOD3 3SITA 1E5SA 1W6NB 1S0FA 4A7KA 4QU1A 2B42B 2WO2A 1Y3TA 2SBAA 4BB3A 1DGWX 5J1XA 2GDFA 4XPVA 5FMBA 2ZEWA 3O12A 3LOBA 1MS8A 5F6LB 3N9OA 5JPMB 1RB8G 2GH2A 2W5FA 3VZKA 2HWC3 4QX5A 5I0TA 3POSA 1AJOA 4B4PA 3WNNA 4A6SA 2B9UA 4RHV2 3ACIA 3WDTA 5FXXA 1ZZ9A 2UWAA 2C24A 4O9EA 1RINA 1KITA 2AGSA 1QJFA 2NM1A 4HSLA 1XNCA 4NN0A 5EXOA 3Q8AA 4CP2A 4YVSB 4P9GA 3ZSEA 5FQ0B 3J7MA 2D40A 5APAA 1FMD2 2JEMA 4LHNA 2LS6A 5JOYA 5CFCC 3HNBM 3WQBA 3OGSA 1AL21 1VRH2 2DWRA 5LASA 2CDOA 2HWD2 5LY2A 3MBWA 2QZ2A 3KD4A 4CDUB 5EIYB 3USUB 3VV1A 3KV5A 1H1IA 1FYUA 1XB9A 3H3LA 3NV2A 3UYJA 4YSFA 2AZ5A 1UNBA 2VOTA 1FNZA 2VQ0A 3UJOA 4C8DA 1S1AA 5EPAA 5FXVA 3H42B 3JBG2 4GAZA 1NY71 2RDQA 2AUYA 2JDMA 2JIJA 1VBE2 4X8PA 1GP6A 2J1UA 5D8AB 5FWEA 5IK5A 3WG1A 4IV1B 4R8HA 5FPZA 3T0AA 3ZPOA 1W04A 2D6NA 3ALQA 3GBFA 3I8TA 1CX1A 2ZX0A 1X8MA 1M06G 3WOGA 4XBNA 3KMHA 2BUKA 3IM0A 3PUHA 1BEV2 3J9SA 3HQUA 1GUIA 3LEKA 1XNAA 5F5IA 4OQ9A 3ZKYA 4KWUA 1MZFA 3DL3A 3USSA 1AYN1 5FYSA 1KEXA 1QJU2 3HQXA 2XLGA 1OD5A 1U5YA 4Q8LA 3O0XA 5FYVA 3KCCA 2VQUA 1LENA 3U78A 1MR5A 1N3PA 4OI4A 1SFNA 1W03A 1Z7S2 3IKWA 3T08A 1IPKA 1I6XA 5E8AA 4XDOA 4E27A 3O1PA 3RWKX 1SCSA 2VOWA 4YVWB 2YV8A 1WW7A 1KDMA 1OUSA 3DYOA 4I3PA 5GLVA 1UZZA 3NWKA 4XTPA 5FIXA 5GZFA 4B8EA 4DY3A 1UY2A 4LIUA 1VBD3 5ABJC 2J7MA 4YM0A 2NLRA 3EYPA 2KA3A 4KQ7A 1QNWA 5AC91 1JU3A 4LHSA 2P6CA 1GICA 1SDDB 3SHRA 1F31A 3BOWA 3JD73 4QB6A 4W50A 3AX4A 3B69A 2YBKA 2IVJA 4OMDA 3WSOA 4OZXA 4NIIA 3CNAA 1PO12 2B39A 4QPIC 1LOBA 2D5HA 4EQVA 1C1LA 5A6QA 4OZOA 2DCTA 2VCMA 4UT5A 4AVTA 1HV0A 3CJIC 1EAH1 5DQ0A 5J96B 5BNQA 2RDRA 1E5HA 1QXJA 5F3IA 4BZ4A 5GZCA 4OUEA 1LOCA 4OI1A 2EIDA 4ARYA 1H1MA 2CWMA 4EN8B 2RM21 1Y9QA 3K48A 1L3JA 1RC6A 3DKQA 4HZFA 4ATEA 4LBKA 1DBNA 3POBA 5T5PA 3WW3A 4IERA 3HAGA 1WWYA 2ES3A 1TME3 4NHXA 4RS5A 3RWNA 3VKMA 4BXFA 1RMU2 3DKWA 5FZ7A 1Q43A 1COV3 1EYBA 3MIGA 4MZUA 4MSVA 3WNXA 1PK6A 3H7YA 2WLPA 4GWIA 3T4HB 4YFWA 2HWF3 5KXCA 3I3DA 2WDBA 5F3EA 1QQP1 3I4IA 2GNDA 3AKTA 1Y43B 3FJSA 3OUJA 1AX2A 4NRPA 4XMIA 2ZOEB 4AI3A 3WF4A 3KB5A 3RZHA 1EY2A 2VW0A 3Q8EA 4CUGA 4LA2A 3RDIA 2FZ2A 1VBB3 1K5MA 2GC0A 2JIGA 1ZA4A 5IJRA 4LR4A 4TXWA 1N1SA 3LA3A 4TLFA 2EF6A 3VHPA 1YQ2A 3VBRA 3QOPA 3FWEA 1IGOA 1MEC2 1CD3G 1R081 4LLOA 2AEYA 4WM8A 3ZR5A 1IS6A 4EYUA 4Q4W2 5H9SA 5C8CB 4MYEA 4JRAA 2WINB 3NW4A 3ZN5A 2G19A 3E6BA 2XHKA 5IVVA 1PVC2 3FBYA 3ZYIB 1W9FA 3WG4A 1VMHA 5BYNA 2J1SA 1K12A 3W5NA 1IPJA 1YIFA 3ZSKA 4GH4A 4NIDA 3E5XA 4LUKA 3WD5A 2EVXA 5A3NA 4OFGA 3OBRA 5A7NA 3AP4A 2WWJA 4PF5A 1DIWA 5FJHA 3ZFEA 4CEWB 2IFRA 1ZBE3 5F2WA 5IFPA 3HD8B 2TUNA 1NT0A 2HKXA 4IUGA 2C6SA 2E31A 5IK8A 1REFA 1HJFA 2QQLA 2XBO2 1CQ9A 3KM5A 4CDXB 5HV0A 5LEJA 3DUIA 2BPA2 1NCRB 1A8MA 5H9QA 4E4SA 4KWLA 2GH8A 3OEBA 1GOGA 5C3RA 4XJ8A 1WLDA 5A33A 2ZX3A 2CNAA 4XACA 1G6NA 1UY1A 3HOBA 3RMYA 1REEA 4O9GA 5CYYA 3LSDA 2VNOA 3SKJE 1RUF2 4B7EA 2VBDA 2KXLA 1XNTA 2WBKA 2R063 4YW3A 3VBUC 3O1OA 1DZRA 1TVGA 5KXBA 4L8QA 5E16A 3WCSA 5FP8A 3VUOA 4FQ4A 4FSJA 1C5HA 1ASJ2 3WQ1A 4W4ZA 2D3RA 1ZZ7A 2YU1A 1H2MA 2QBXA 4CP9A 1X9PA 2OXBA 3E6DA 4OULA 4UYBA 2R042 5CFCA 4C0BA 2J1TA 5A1FA 1RUH3 2WWSA 3SH3A 5BUVA 1V9U3 4QHBA 3RMXA 2OX0A 3MV01 1NQDA 1US3A 2C9AA 3OPTA 3OGRA 1IG3A 1ZA7A 2E7TA 3OY8B 3UGGA 1X9TA 3ITQA 5D2AA 4ORFA 2XUMA 1COV1 3KHBA 3DPRB 3NNJA 3TN91 5BNPC 3ZYHA 3BUCA 2V09A 4I09A 2E7QA 2ZKLA 1O4ZA 1Q8QA 4LBOA 2GC1A 3VBOB 1ENQA 4U36A 2DUOA 1GWLA 5FZ6A 4AGGA 2D7FA 4COYA 1LRHA 4QGMA 3ZYGA 1RUE1 3LDBA 5T5JA 1VBB1 1UPIA 3ILFA 4BQ2A 4JDNA 4NROA 2PLV3 4QM8A 3AC0A 4XJWA 1W9WA 4KU8A 4DQAA 1A34A 2HH9A 1S0CA 4XBQA 5HI0A 1BQPA 3POJA 1GLHA 5CKQA 3AL5A 3ETQA 5FZ0A 2GNBA 2QE3A 1BCXA 1RUG3 1SBEA 3EO6A 5KHJA 1OURA 1IKPA 1HB3A 2TEPA 1I1EA 4LOSA 2WNUC 3MPPG 4MUVA 1TEIA 2W47A 1YRZA 3U75A 4LBNA 4CCCA 1EUUA 1YUDA 1CAUA 3FMGA 5FY4A 4F7ZA 3ZFEB 4ZHNA 1C1FA 1O5LA 4GA9A 1R093 4HK9A 4NHMA 4QKBA 3C7EA 3ZXLA 5CBLA 2R1DA 2WRAA 4FP2A 4AVBA 1N1VA 4EN0A 2R072 4QPGC 3MHZA 2Q8DA 4GB32 3APBA 3P6BA 5JIAA 4IEVA 1ZBE1 2VQAA 2WLQA 2JD9A 1OKOA 5ABJA 5FCCA 4FPLA 4WVVA 2ZGTA 3CDZB 4DUVA 5DAWA 5I8SA 4FO9A 3I2GA 1JBCA 2WO1A 4QGLA 1QY4A 1YQ8A 4V2WA 2PHUA 3FLRA 3IWZA 3ZFGC 5F1RA 4Y22B 4QPIA 4I2OA 1NXD1 4S2DA 3OUIA 4BMEA 3OG2A 4FCAA 3NV4A 2UWCA 3CJIA 2AH2A 4C1WA 2K9ZA 4E8DA 2QCSB 4NIAA 3RYPA 5EJ1B 2Y6FA 1HJGA 1MS3A 2QFEA 3RNSA 4JGYB 3T30A 1A8DA 3TNPB 5FO9B 3ZSMA 2I2SA 4FOQA 4QB1A 4B4RA 5C9AC 1W0OA 5JXGA 1RHI1 4B4QA 5GKAC 4NIHA 1AHSA 5FWJA 4CU6A 4YW5A 5I0RA 2WNVA 2WL1A 2I07B 2Y6HA 1W2UA 1C8M3 1OH3A 2VCCA 4XC9A 4EN9B 5JDBA 1YEWA 2MEV1 3FC0A 1AX1A 1QU0A 2VZSA 1MPXA 3GF6A 2E51A 4JKMA 4P08A 1W0PA 4URAA 3IBMA 4D69A 1L7RA 1RUH1 1OOPC 4UFHA 3VZNA 1BBT1 1J84A 1W8TA 5B4XA 4CCMA 1JYWA 4FOYA 2E26A 1VR3A 4UFIA 1R1A2 5T3NA 5HBAA 4YM3A 1OD3A 4HKOA 1ZBA3 1Q3EA 3A21A 5L9BA 3LEGA 4QXBA 1RUNA 2PAKA 5CKMA 5TSWA 1IS3A 2DVDA 3LZZA 3J26N 2QKDA 2JG9B 1AYM3 3EXUA 4CXWA 4CCLA 5C71A 3RFRA 3K3NA 2IXCA 4MO3M 4AHWA 1W8HA 4LO5B 4QKFA 3SCGA 2ZEXA 4M3CE 4IGOA 2WSUA 3ZOIA 3N3HA 1SFYA 4Q0SA 2ZHNA 1J59A 2ZTNA 2PLV1 2Y6JA 2B9VA 3H8UA 4PDWB 3K75B 3AYCA 5BPXA 1S55A 2NN8A 1RUE2 2P2KA 3ES1A 5FZIA 3M3IA 4CRQA 1RUG1 2VR4A 4Q2FA 3VGIA 4AW7A 5ERLA 3BALA 1UY3A 2XJVA 4O65A 3N9MA 2VVFA 3MW3A 5LA2A 4PIYA 5FZ4A 5DDJ1 1UZ0A 5IUQA 4YYOA 1GNHA 1DU3D 3TB0A 4Q27A 4ZXEA 4EV0A 1U5IA 4YZ3A 2CGPA 1HB1A 1SQ4A 4ZU4A 1AVBA 4ARXA 4Z8BA 4JQRA 2ARAA 3VD7A 3NJVA 4R52A 1Q8SA 2A6ZA 3AMQA 1H8TC 1W6PA 1W2OA 4H3WA 1WMFA 1XRUA 1GYKA 4GULA 2FMYA 2OIIA 4RGKA 4RYDA 5H9RA 1OA3A 4XJUA 3U37A 2JJ6A 5A7PA 5FXZA 3VBUA 5KHIA 1JZ5A 2BGCA 3SLIA 2VU9A 3H8XA 3GJBA 5IT6A 2ZGKA 1AJKA 4Y4RA 2VD7A 2X29A 4XUOA 2VMCA 1F8VA 5EQUA 5FLIA 5LZ6A 3IPVB 2JDUA 2W95A 5FDBA 5GLUA 3V0AA 4Y1VA 1AR61 1EV13 4JKKA 2VZUA 2PXJA 4IV3C 3M4FA 4LE3A 4MGSA 3WP6A 2RE9A 2RS12 3VB9A 3ZFFB 3MFCA 1JYVA 1PGW1 1UMIA 1F4AA 2YHJA 1WUVA 3AZWA 4YM2A 4YWAA 3T1MA 4A42A 1ZZ6A 1LECA 2J1VA 5F5QA 5DUWA 1PIV2 4CXXA 1LGCA 2A6YA 1RIRA 2PELA 1QJX2 2VBBA 5BNPA 1Y9GA 2JDKA 3ZYFA 4AVVA 2W2IA 4P02B 4FVVA 3MICA 1UZWA 1RHI2 2WZR2 4AI9A 4D7TA 5ACA3 2O8OA 5FUPA 5LB6A 1DQ4A 2XJPA 4RHV3 5I8TA 3OF1A 2BJSA 3CEWA 4UF0A 3T2TA 1W6QA 3VDBA 3BI3A 5A7WB 1H6XA 4A4AA 1SACA 3KV9A 3CQOA 2R1BA 2ORXA 5CVRA 5BNOB 5FZEA 1RUI1 1SLAA 3BTXA 1AYM1 2WAAA 1DQ5A 1FMD3 2BU9A 1KQRA 1UZYA 2Y38A 3MFAA 4HONA 4Y33A 2Z42A 1VRH3 1H4GA 1OA2A 3NJXA 2HWD3 2VNGA 3V0BA 1DYOA 1XPWA 4XJAA 5A80A 2R32A 4EJRA 3PMSA 2WNUA 5FR3A 1S4CA 4NO4A 1W6MB 3GHNA 3CJXA 4KG0A 4DEVA 3AP9A 1W9SA 1O7FA 5CFDC 1W28A 3JU9A 3K2OA 2VNVA 2BNNA 4E2QA 4IEPA 4KG8A 1UOJA 1VBE3 4FPJA 4QPGA 2EXJA 1VB2A 1RITA 2ADDA 3FZ3A 1C57A 4R9BA 2QJVA 2PAMA 3QD6A 2Y6GA 3T2PA 3WP5A 3ZKUA 5L19A 1DGWA 2XG3A 1ALYA 1BEV3 1ND2B 4XZUG 3S7EA 3VD4A 3N9QA 5FZKA 1Z0HA 2VZTA 3WINE 1RVF2 2XLFA 1I3HA 3NAPB 4IV1C 4CA9A 5JPNB 3WG2A 4X6RB 1NKGA 2PQSA 2W3JA 1CAXB 3H1MA 3M7AA 4I0AA 3I2KA 4LO7A 4QXCA 3ZFGA 3GXUA 4XHBA 1IG0A 3AZVA 1QJU3 4AHZA 2VZRA 4Q5OA 1QJEA 4FOWA 4QPYA 2ZGMA 4N53C 3T0DA 3PUIA 4DXRA 2BP6A 5GJ6A 1PHMA 4CUAA 3PIGA 4KU7A 4PI2A 1Z7S3 3NNGA 4ISRA 1GMMA 1DGLA 1SHWB 2P3YA 2W1QA 2YC2A 2BQPA 2JICA 5C9AA 5FRAA 4Q4Y1 4IESA 5ANNA 4IE6A 2EA7A 4A45A 3PU8A 1JN2P 1XOYA 3WZ1A 1PGSA 4S2HA 4E4HA 3SISA 4K40A 2QQUA 4Q8KA 2QQVA 4D0QA 4Z82A 4AEDB 4HKWA 2ZGQA 3FHQA 4WZFA 1ULGA 4WV8A 4M4PA 1OOPA 1SMVA 3VD5A 4JKLA 4D8MA 3HN3A 1UL9A 4W6WA 3CZUA 5HXVA 2CAVA 2VY0A 3ORJA 3LOIA 3PNAA 4XIOA 4XFFA 2JG8B 3U4SA 5JUVA 4DRVA 2A71A 4TWTA 1SBDA 4CU9A 1CIYA 2GAUA 2OT7A 3I3MA 2DBIA 1LHOA 1OXCA 2HEYF 2XVKA 1VAVA 2Q8EA 3WXPA 5A3MA 1SDWA 3K4ZA 1GQGA 1CZTA 4CDQB 5C3OA 3BGAA 3SCFA 4XUQA 4QQLA 4M3CA 3TWIA 5DMYA 4DMIA 2XDVA 4H7LA 5A1AA 5FO8B 2GU9A 3H50A 5A32B 2V72A 1V70A 1O3TA 1BKZA 1L7LA 2YZ4A 3IAQA 1FMD1 1CAWB 4NWVA 4LBQB 4OMCA 1VRH1 1OMIA 2V4AA 2ZX2A 2HWD1 2GMPA 3S5QA 2ILMA 5LW9A 2GP3A 1KS4A 3PMEA 2QZ3A 1NLQA 5JR2A 1HRV2 1VJ2A 1RUI2 1VE0A 3ZMOA 1HRI2 2FCTA 2E53A 2LW8A 1AL23 1SZBA 2VXRA 3PVEA 4JZRA 5F32A 3AYEA 3JBG1 1MEC3 5FUIA 5KHGA 1VBE1 2JDZA 2JKXA 2ZHMA 3H1WA 2A3YA 4XURA 4Q4V1 4AEMA 3U10A 2CHHA 3AZZA 1TZOA 4Q4W3 5J36A 4QDSA 1QMJA 5DG1A 5FZ1A 4AR2A 2EIBA 3KCYA 1EUTA 1I5PA 3WNPA 1H8TA 5L7OC 5HCAA 4K8RB 4X8NA 1O3SA 2V73A 1BEV1 1GP4A 1Q56A 4AFMA 3ELNA 2Z69A 2RV9A 4CCKA 4DPNA 1JYNA 1TNRA 3GZEA 4NAOA 1LGBA 3VHRA 3WNMA 1AL0G 5FBJA 4Q4X2 3AM2A 4JCKA 1J3QA 2EXHA 1BZWA 1V00A 2JD4A 2DCZA 2Y60A 3BIWE 3M3CA 3CU7A 4JQTA 4AEJA 4HN0A 4ASLA 1E5RA 3LD8A 2X09A 1QJU1 2DVGA 5DZFA 4HPKB 5FP7A 3WQ7A 2VO5A 2HWB2 1F5FA 4H7MA 2FHRA 1J83A 2XJQA 4IV3A 2X5IB 2XBO3 4GWMA 1REDA 1RXGA 1JOJA 1AYN3 5FY1A 4ATFA 5FZOB 5IAVA 4D6SA 3P1IA 2ET1A 4OHVA 4SLIA 3R4DB 3T4VA 1XSRA 3PJYA 2BVVA 4AI1A 2ZBJA 4HVQA 2SLIA 4MOAA 3VDDB 4AQ6A 4CDXC 2JB8A 5K0UC 4CCNA 1YQ5A 5I0DA 5FP3A 3ILNA 3D4KA 3RJRA 4URTA 2WZPP 3LPFA 1TE1B 3VBHC 3RZLA 3PLQA 3ETPA 4NHLA 1FI2A 3I7DA 1W2TA 4Y1ZA 3SQOA 3BTZA 2DU0A 1PO11 2PHTA 1ASJ3 1HW5A 2D6LX 2YFUA 1S0GA 4KNCA 5FXWA 1UW8A 5AC93 4FFGA 1LEDA 4HXCA 5JSOA 4HKLA 4IE5A 4MGYE 3UKTA 3O1MA 1QH7A 1DQ6A 3I59B 1N47A 3OGJA 1HB2A 4P14A 5LA1A 4JX0A 1EAH3 4HLTA 2VUAA 1GQPA 2YYOA 2C9KA 5FP9A 1YI9A 3UV9A 3EBRA 1GR3A 1RMU1 4D6RA 3LFIA 5LBEA 3I2OA 2RM23 1VP6A 4XF3A 5CFDA 2DUQA 3VZLA 5K7PA 2XKPA 2WZ8A 4AHXA 3GNEA 3N36A 5FO7B 4D6QA 4BLIA 4OUMA 1S2EA 3LEIA 3MIBA 3HIFA 3ZDSA 4UFJA 4DB5A 1OF3A 3MIFA 2P34A 3CF6E 1QQP3 1SPPB 3MW2A 4BLJA 2YDEA 2X05A 3MIDA 1VB4A 5FLJA 4WM7C 1MEC1 3A0NA 4XETA 4D94A 4NRQA 1URXA 3JZVA 2VTFA 1D4VB 4Q4W1 5C4WC 1U5ZA 2AYHA 4AXOA 2O8QA 3RGBA 1CVNA 1LESA 1QJY2 2LROA 5D1IA 5F8PA 4N53A 2B5HA 1PVC1 1R083 2XJTA 2XWBB 3LE0A 5FZMA 3S6PA 2VMEA 3MDPA 4Q4V2 1FXZA 1DGRN 1JW6A 3K3OA 5A3WA 3M3OA 4CDWC 3POEA 2K46A 4P9LA 3WW2A 2R073 5L73A 3M2MA 1N3QA 2A3XA 5FZAA 2VH9A 5J98B 2NZ9A 4QKNA 1S2KA 2ZGUA 1SLBA 4MH0E 3THCA 4A44A 2B8MA 4CYDA 4K7JA 5IATA 4N43C 5EYYA 3BYWA 2XBO1 4HVRA 2ZGOA 2EIEA 3KF3A 4FP3A 4SBVA 5F7UA 4Z2AA 2PHXA 5FPUA 4PIXA 1ZZ8A 2BV4A 1V6JA 1YYNA 3WR0A 2R0FA 1DF0A 3N7LA 2ZX4A 5T54A 3HNYM 4CPBA 1NXMA 3ZN6A 3C7GA 2JDAA 1RUF1 2CTVA 3BCWA 4P9JA 4XQDA 4I01A 4CE8A 3MUZ1 4XMAA 3JUUA 4A41A 4IGPA 5B4NA 1NA1C 2UYBA 1S0EA 4KBZA 4LLFA 1ASJ1 5J37A 2XOMA 5J09A 1HLCA 3QACA 1CESA 4YG6A 2O14A 4Q1PA 4RL7A 5I0UA 1J1TA 2P3JA 3HT2A 3ACGA 3BIEA 4CEYC 1AX0A 1GU3A 2R041 3HBKA 3BODA 5F37A 1O3RA 1XYNA 2HEWF 4IDZA 1H9WA 1P8JA 4Q29A 1W3VA 3PTRB 2W1WA 4MXWA 4L0PA 5FUNA 4DUWA 1BK1A 4NPRA 3LCPA 1HXS2 4E4ZA 3DCQA 4HSJA 4E9KA 4GJYA 4META 4QDRA 1WLWA 2JX9A 3KWVA 2VVDA 3INAA 3IMMA 3EHKA 4YLZA 5J3UA 1F4HA 2CWSA 4H14A 4CXYA 3KVAA 2EALA 2JECA 3N7KA 1PZ9A 1V6NA 2VAUA 3K4DA 2ID4A 3I2JA 3DGTA 3TN93 5L7OA 4AZZA 5HCHA 4AFBA 3C7OA 3PUQA 1PGL2 4HOOA 3W58A 1CX4A 1OPOA 1CAVA 3EB7A 4XF0A 1SEFA 2JG9C 5EV7A 3W20A 2HEVF 2NPIA 2NMNA 4BQWA 4O61A 3OJBA 4Q26A 3WEZA 2JDYA 3VZOA 1G9AA 1RTVA 1RUE3 1YJLA 1WMXA 5HXMA 4OHXA 2XWJB 3OPZA 1OQ1A 2QTWB 2BTVC 3C2UA 4NPMA 4J1XA 2D3PA 5FKCA 4CTEA 2ZA9A 2G4IA 2E33A 2BBVA 3VBFC 3VBSC 4NVPA 2E6VA 1EPWA 3ZXKA 5IVJA 4FQZA 1OI6A 4B3NA 5CA6A 1PZ7A 1TMF2 4XZPA 4AL9A 2BRTA 3IDEA 3RI9A 2R071 5BNNB 2VBPA 2DTWA 3DYPA 4GB31 4GJZA 3OEAA 4YFZA 1JOPA 4RS5B 1CGPA 2BWCA 5K0UA 4FPCA 1NYWA 1C28A 4H55A 4QQPA 2OUHA 1PO22 1QDCA 3UESA 5JXHA 3RG0A 4LULA 4AQSA 1PK6B 1V6LA 1G9BA 3VBHA 3OPWA 3WUCA 1RYYA 1GNYA 3TBDA 1PVXA 3UGHA 2D44A 4FXKB 1UZVA 1WCSA 1YFYA 2D97A 3AZXA 3KGLA 1FT9A 5E89A 1K5MB 1O8PA 1R64A 2ADEA 5JVVA 1ULFA 2H6CA 1OH4A 3ES4A 5F39A 5F6KA 2HLEA 1RXFA 1R1ZA 5F5AA 3AVSA 1ZRDA 4LT5A 1RUD1 2RS13 1VBA1 3J7HA 4LO6B 3OSDA 3VBRB 2G9ZA 1JHNA 4CP1A 4DXTA 4WM8B 1ZRFA 4GIQA 4DRRA 1HV1A 3CL1A 3ZYJB 3LEMA 2WSVA 1QJX3 4WVMA 1W05A 2CYFA 1D2QA 1D7PM 3D82A 2A6VA 4HK8A 2RMU2 4J1WA 4L92A 5A3UA 3B7MA 4LK6A 3W21A 4DNYA 1PM4A 4YW2A 1RHI3 4N9IA 1GANA 1W8WA 2H0BA 2J42A 2OPKA 3PUAA 4HT1T 4GH4B 4LXLA 4QX7A 4WVZA 1YLLA 4XQWA 3FFQA 2CDPA 3WUDA 4CU8A 5A6YA 1CR7A 3WNKA 4ZZ5A 2K0GA 2MEV3 4A3ZA 1JUIA 1KGYA 2VECA 4IEQA 4QD2A 1R1A1 4NHKA 4AK3A 3AK0A 3UKVA 1H2LA 4BE3A 1KS5A 3SEPA 4CVUA 4WM7A 1GZWA 1GZ9A 2ARCA 4LE4A 1F9KA 1BBT3 1T2XA 3MV11 1MQTC 4FPKA 5C4WA 4KI5M 4NHYA 2E32A 3ZM8A 4UW3A 1IZ3A 2A6XA 4NOTA 3ZPYA 3N7MA 1ODNA 1YNAA 4LTAA 3O1VA 5A33B 1DZTA 1YC61 4K8FA 4PT6A 4INDA 3WDVA 3GZUC 3URFA 2VQTA 1FOD2 3SH4A 2YGMA 4CDWA 3O1UA 1DLLA 1YI7A 2N7GA 4FTEA 2XLAA 4CCOA 1OLQA 3CO2A 2Q4SA 2LM3A 1Y4WA 4JGZC 1HKDA 3HMYA 5K4LA 2P6HA 2R0HA 5DAXA 3GHMA 3LDRA 2CU5A 1FV2A 4PCRA 4XIKA 4FAGA 4N43A 2HWC2 2IC1A 3I2DA 3NV1A 5IVYA 3R6SA 2C4XA 4CP9B 1UXXX 1RVF3 4JV4A 4FBFA 4RGAA 1NAEA 5BV6A 2HWE2 5CFCB 2IXKA 3ZXGA 5IHRA 3KCXA 3MF9A 2WS92 4CP0A 1K42A 1OUXA 3ZSLA 2XKOA 2Z79A 5DDJ3 4QGNA 1H2NA 3MGUA 4FTSA 3CKHA 2ZGSA 1XYPA 1W90A 1V6OA 1ODMA 1OVSA 3C7FA 2QQWA 3WF3A 1LOGA 5IK7A 1O3QA 1JODA 4LQRA 4TTGA 4LBMA 5SV5A 1X36A 2QDNA 1DYPA 3HJRA 3RZZA 3T2OA 3B02A 2B46X 5FYZA 4OHZA 4JHTA 5T5LA 4BQ5A 1NA1A 1UU5A 4XAAA 4BQYA 2J1RA 2VUJA 5A70A 2Y26A 5C70A 2ETEA 4XXAA 5FY9A 5A3TA 2ZMLA 4CEYA 2XPJA 2GSYA 1QOOA 5C3QA 2RS11 3V56A 5F2SA 3OYWA 1Y9MA 2YPJA 4HFSA 1OQDA 3WV6A 5EZWA 3MLLA 1AR63 3L2YA 1DP0A 1PIV1 3H1YA 3H7JA 5LEKA 1WLCA 4FPOB 1UD1A 5KC5A 2FD8A 1QJX1 3BN6A 3DXTA 1RUD2 1JYCA 1VBA2 2ARXA 3HNMA 3IDAA 1MZ6A 4IEUA 3UNPA 3UJQA 4CU7A 1UPSA 4RR3C 1CAUB 3MUY1 4FFIA 2VCAA 1QGLA 2WZR1 4K6BA 4FPGA 4N7UA 1K45A 1LR5A 4LA3A 5GZDA 1GBGA 1HIXA 5JZGC 4IEXA 4CSWA 2YU2A 4QX2A 3VD9A 4FOVA 4AQTA 1V6KA 1VMFA 2PHDA 4LITA 4BM8A 1N1TA 1POQA 2JENA 2VG9A 2JG9A 4AFAA 1LOAA 2PQQA 4AQ2A 5ABJB 4D3WA 3WP3A 3E6CC 1YQ6A 4S2GA 3WDUA 3H3UA 2VOXA 4IE4A 1JXNA 2EIGA 2DFBA 2WNEA 1VBD2 3VD3A 1BMV2 3EQEA 4XVHA 5JSPA 2BW8A 1MZ5A 4QPIB 3VBFA 1G9CA 4UW5A 1HRV3 1QOSA 1BVVA 2J22A 1RUI3 5FOBB 1OPMA 5FK7A 2YBPA 3ST7A 3VBSA 3CJIB 2PTMA 1HRI3 2W08A 5DAPA 5T52A 3JD72 2JXAA 2DYCA 5I91A 5A3LA 4KH9A 5LBFA 2Q0AA 2K2SA 4XABA 3DXUA 3O1TA 1X33A 1DGRA 5CU1A 1O59A 4NJ4A 1VBC2 1GSLA 2IVIB 3IAPA 2YROA 2WNVB 4QDQA 2ORZA 4QHZA 4Y1XA 1ND3C 1WA6X 2YB7A 4UBHA 3GGLA 4A3XA 3AKQA 1RVF1 1TME2 1ZRCA 4PQQA 3POGA 3PVBB 1LGNA 4AOCA 4GXLA 1G9FA 3FN9A 2XH6A 1ZRIA 2J1AA 3RRDA 5KXDA 2R6QA 3FFZA 1HN1A 3JCIA 2E7AA 1K3IA 2HWF2 2F6BA 1UOBA 2HWB3 4Y1UA 1UYPA 1GV9A 2RHPA 5CKNA 4NPLA 5LRRA 5G05L 3N4MA 1B35C 2C5DA 1VIWB 2NYYA 4NRMA 3GYDA 3D3AA 1XE7A 4P5HA 3KZ4C 5FYBA 2QVSB 1W9YA 5E6HA 4AFCA 5FOJB 2P3KA 2Y6KA 5AVPA 4BYYA 2WC2A 5FPAA 1QNYA 1QOTA 4M01A 2VPVA 4ZU5A 1E57A 3D6EA 4W65A 2Q8OA 5FPBA 2ZPXA 2YMZA 2DCKA 2WNOA 3HWJA 2FCVA 3OCPA 3KT1A 1HN0A 3T2QA 3AP5A 1DG6A 1RUOA 2EXKA 4BISA 3LSEA 3KV4A 4BWOA 4FAHA 2B45X 4I0BA 3MLJA 1LAJA 2WR9A 4XBLA 4Q4Y3 2O0OA 1G9DA 1MS9A 3ACFA 2AC1A 2IXHA 2W0XA 3U14A 3B5LB 2WUHA 4MGZE 4RN5A 5FZFA 2XVLA 4UFMA 1PMIA 2UY9A 4ET7A 2EAKA 1XBFA 3BTAA 3F2ZA 3RI8A 3DV8A 1H2KA 3THTA 4RQPC 5C3PA 1MZEA 4GQ7A 3OBAA 5EJ3A 1DZQA 3WLUA 2IXIA 2WA3A 2CSGA 2QQPA 5FYIA 2WQ4A 3LIHA 3H0OA 1QXRA 4MHUA 1MQTA 5FZDA 2D6PA 1L7QA 3N9PA 2RS51 5FZ9A 1NCQC 1YO8A 1F15A 3FX3A 4WBBA 2BNMA 1JZ7A 4QMAA 3LPGA 1CONA 1O6UA 1W6PB 4O7XA 4Y20A 5FFOC 3OD0A 2XQXA 5KR7A 2JKBA 4QT6A 2Y0OA 3KF5A 4KGQA 4TSVA 1F2NA 5FK8A 4G4FA 5FPLA 3RSJA 3E5UA 3VBUB 2X53S 4JGZA 4BU2A 2A75A 4JDOA 2VZOA 4AI2A 4FPEA 2D43A 2PHWA 4XUTA 1HRV1 2AACA 2VJXA 2YY1A 3ZMNA 2GN3A 3V0AB 2G1MA 2XVGA 1W8OA 1HRI1 1JI6A 2WQZC 3MW4A 3PTYA 4XUPA 2VVEA 2MHFA 2BOIA 2R062 4ZS2A 5H9PA 3J7LA 2QQOA 2E9QA 2GALA 1GOHA 4YVSC 1UMZA 3SEEA 4AI0A 4EROA 2P5BA 4BMBA 1TQ5A 1XC6A 2XMLA 1CIWA 3JBG3 4GZ9A 1IHMA 4CDUC 3L2HA 5BNPB 3BTYA 3IMNA 2OZ6A 3OBZA 4I3GA 4Q4V3 4QQHA 4XF9A 1JYXA 1JYTA 4AVAA 2VZQA 2AENA 1O4TA 3I54A 3GM8A 4Q4X1 4DZGA 5DZGA 1UAIA 5I0SA 5D8AC 2CGNA 4FXGB 2ZAHA 2OPWA 4XAEA 4PLOA 4UOJA 2WT2A 2RS31 4UF0B 4BK4A 1W6QB 4IEYA 2AREA 1BYHA 2JDPA 2HWB1 3UKNA 4DXSA 1XQNA 2ZAAA 1MVEA 2PHFA 4CCJA 2P3IA 3IN9A 1H6YA 1MACA 5F9TA 4LJHA 5FP4A 5G04L 3TRSB 3U0ZA 5C5UA 3TEWA 4LPLA 3V0BB 1NZIA 3O1SA 1UU4A 3ZYBA 3AXEA 4XFIA 4MGIE 1YJKA 2DCJA 2WNUB 4ZY9A 4JHZA 1D4M2 2OVUA 4LORA 1Q5OA 4UW6A 3MZHA 1C4RA 4PLMA 3MF6A 4RR3A 3HEIA 1WLTA 3MIEA 1FAYA 3KQ4B 1XNBA 3OUHA 5E1RA 5FYCA 4DIQA 1UOFA 1X8EA 1NG0A 5D21A 3VKFC 5DAVA 4GKXA 5JZGA 1ENSA 4XE9A 3GDBA 4QPGB 1RUC1 3NJYA 3RVHA 1TG7A 2WO3A 3PVOA 4BJ0A 3KSCA 2VCBA 3O1RA 1RL3A 2CL2A 1UF2C 2YC0A 5A7QA 4YVWC 1GQHA 3KQRA 3EMRA 4UW4A 4XYXA 3ZYPA 2Y33A 5A3OA 3J8F2 4PLNA 3WDWA 5I93A 1DQ0A 1OHFA 1QKQA 1Z78A 4XFCA 4W8JA 5LA0A 1PO13 4AAPA 1UYZA 4N7IA 2UU8A 1F35A 1EP0A 2L9LA 5GM0A 3ZFGB 2PHRA 4MX3A 3DN7A 3I3QA 4AFDA 3WDYA 5L9RA 2W1SA 2Y34A 5C5TA 1XJAA 1BXHA 2BNOA 1BJQA 1CJPA 4LBQA 2RS52 2VMIA 3SNMA 1T6GC 3MO4A 2WFF2 4NE9A 3OB8A 3T3YA 4RD7A 1RMU3 4B29A 1H4HA 1ULDA 2XJRA 3B3QE 5C9AB 4KWKA 2OW4A 4W6YA 2ZABA 3R4UA 4MGQA 4QX1A 2YPDA 3HR9A 1CPNA 2BOJA 1PMHX 2AEZA 5LWBA 1ND3A 2FDJA 2X8KA 4M00A 2QQIA 2WFPA 1DCSA 2QDRA 5DPNA 3Q9OA 5CB7A 2D98A 3BPSA 1H0BA 3P3NA 3ZXEA 5LCWL 3PURA 1V0AA 4COZA 1OOPB 5JAXA 3POYA 1ULEA 5DZEA 5JI9A 1AR82 2QQJA 1C8M2 2BVBA 2ZGRA 5FZ3A 5GLWA 2VMGA 1CN1A 2D6OX 1QJY1 1Q8OA 4A2UA 5FY0A 1PM7A 4OI0A 2W52A 2PMWB 1B35A 2EXIA 4ZS3A 3QCWA 1NZCA 2WABA 2BDRA 2RJLA 3BPZA 1PX3A 5FZ8A 4HVOA 3GJAA 2WQ8A 2GNMA 4QM9A 1W8UA 1ZNPA 5T55A 2LTNA 1PVC3 3PJQA 2FDIA 2OYZA 3H8RA 1PX4A 1XU1A 3G6JB 2QQMA 1YFXA 4J25A 1I5ZA 5C8CC 1HX6A 4M3CB 3CBNA 1PO23 2VULA 4Y3OA 1JTZX 4BIFA 1UYXA 2XJUA 2DDUA 2GNTA 2ZCWA 3TAYA 2BYVE 2RS32 4OCTA 1G8WA 2B4KA 4QQOA 4RS5C 3S57A 4MLOA 5FAXA 3WVJA 2VW1A 1UO9A 4RQPA 5FLHA 4CPBD 1C3HA 5EWSA 1N1YA 1PK6C 1W6OA 4CEWC 2NMOA 1AR91 4LO8A 5F5CA 3J4UH 1QJZA 4JRLA 4YZ2A 5B2GB 4GMP3 3KVBA 4QPWA 4UAPA 3KGZA 1NCQA 3LFMA 3CMGA 5KHKA 1H30A 1IQDC 1NCRC 2P1BA 4S2FA 4BOWA 4CCDA 3AKPA 4HBNA 2OQ6A 4ZPIA 4DOUA 1W6NA 4BCUA 3HQRA 1H8TB 4QXKA 4UBGA 1RUF3 3NL1A 5FZBA 2RMU3 2XXZA 4AAXA 2VOKA 1RUC2 2KD7A 3VHOA 3PHMA 1OT5A 3OD4A 4UI9L 1W06A 3CIHA 5LK7B 1SLIA 4COUA 3LB9A 5FYHA 5HCFA 3KT4A 4GKYA 4IEOA 2W87A 1O5UA 3NSTA 5JWPA 4TYSA 1ENXA 3V65A 3BU7A 3WNLA 4Z1VA 4QWNA 3HBZA 1JUHA 3O5SA 2R043 1HXS1 1ZZCA 3VL9A 5KHHA 4FTBA 4B1MA 4IV3B 1PNGA 4OHWA 4XXPA 1X7NA 2FBEA 2FQPA 2D93A 1JZ8A 4IQPA 3DYMA 4XILA 3WW1A 4YVSA 3ZX7A 5FQ0A 3GZAA 1UXZA 2F4PA 1UY4A 2XL7A 1VAMA 4YGEA 3TEZA 1S0IA 3B01A 1PGL1 5EHDA 4YGDA 4ASMB 4BPZA 4CDUA 4XFHA 3ZIWA 3USUA 2A6WA 2Q1FA 5JI7A 4GWJA 2IFWA 5IVEA 5A7SA 1UWWA 3CZJA 5FMOL 3ZYRA 1VLNA 3B9IA 4Q0PA 1LTEA 3DPRC 2Q5TA 2ZX1A 5FYTA 3RPQA 1LEMA 3LA7A 1LJ7A 1WCDJ 1OQEA 3WNOA 2FZ1A 1S0JA 5D8AA 5DUUA 3TEYA 3IIIA 1KFXL 1MS1A 3VBOC 4R4XA 1DYKA 2JE8A 3A22A 3WT3A 1UOGA 4IV1A 2DF7A 2NQYA 1MS0A 1WW5A 5ACA2 5IVCA 5IW0A 3K46A 3KS7A 2KM2A 1AR72 4YRDA 1FNYA 2A5ZA 5FZHA 4M3CF 4YARA 1DHKB 4R9AA 2FDFA 2DBNA 1TMF1 4XOGA 3D0JA 2HWE3 1WKYA 4XDPA 2WYFA 1OVPA 2WS93 4ZKTB 1PNFA 1A6CA 5BY5A 2VE1A 5JXIA 4G3YC 4YNIA 4AF9A 4E4DX 1C8NA 2VOVA 1DFQA 1PO21 2MNGA 4EWAA 5CFDB 4UFKA 2EAAA 4GB33 5I8YA 3NNFA 2XB6C 3ZFEC 5FKBA 4G9SB 2BERA 2R49A 3AYDA 1Q8PA 1H9PA 4YVWA 3FHAA 3AJYA 4XFBA 2PHLA 1RJ7A 3K77A 3VKLA 3RZKA 1QEXA 3ZSJA 2I74A 4RA0A 1LCLA 4GMP1 4QHOA 1F5JA 1RUJ2 1UCXA 4L9BA 2J1EA 5JSRA 5LBCA 5EJZB 1H8VA 5IAXA 1AR92 4Z2WA 4LHKA 1IS4A 5EYXA 1RUD3 1VBA3 3DEMA 4QAWA 4N53B 4LUMA 4XF4A 3AVRA 1BVP1 2G9GA 2RMU1 4NIGA 5FYYA 1N3OA 3JQXA 1OLRA 5C33A 1IS5A 3NKTA 3AZYA 1GWKA 4IL7A 1DQ1A 4JGYC 5KBFA 5LY1A 4P5YA 1DQ2A 4Q0QA 1SLCA 2DURA 5DAQA 4FFHA 4XW3A 1XXNA 4IXLA 4A6OA 1SCRA 1FPN1 3PU3A 1SLTA 3HVDA 4V2VA 4N8MA 4HG6B 2RR12 1R1A3 2CAUA 4QU2A 5IFTA 3N7JA 1PZ8A 3POFA 4F83A 2C26A 4BHPA 1FATA 1IKQA 3NO8A 2E63A 1JHJA 1VAKA 2Y0IA 3ROUA 1ULCA 4JTOA 5GALA 3GCWA 4PF1A 2QQKA 1FOD1 4K21A 3ZN6B 4HETA 3QH7A 5A6ZA 4E8CA 5LATA 4OQ8A 1JMUB 2ZEZA 4V1PA 4XHXA 2BGOA 2DVBA 2WN3A 2ZGNA 1YCIA 1T6BX 1KDKA 2A7AA 4K1YA 1VBC3 2YXSA 3EJKA 2I45A 3G7DA 4IEWA 5DUXA 3VLBB 5C8CA 1NE4A 1WZXA 2HWC1 3BB6A 3FUOA 4QXHA 3ZXDA 5JLVA 1KFUL 3IDBB 4FFFA 5SV8A 3M3QA 3M3EA 2HWE1 3AXDA 4PDWC 1POV3 4P9WA 1ACCA 3R05A 2WS91 1OBNA 2WNVC 3A0KA 3N9NA 4FPHA 4L97A 4XF1A 3LKJA 5FPVA 4QB2A 4MXWB 5CG8A 4CEWA 4I30A 2TNFA 3RQ0A 1STMA 2IWGB 2WIIB 4LNVA 3TEXA 2Z4FA 2VZ1A 4XUNA 3ME2A 4PBPA 2ZKNA 3A23A 2Z5WA 1LHVA 2IXLA 3SXWA 4CDXA 4CCEA 4ZXKA 5K9YA 1NCRA 3FUQA 3E1F1 1W8NA 4C90A 2VZ3A 5L7OB 3RZJA 4LBLA 4IE7A 1AL22 1KJLA 2R30A 3AMNA 4UXAA 1J3PA 1CAVB 3Q8BA 2PAEA 2D3SA 2VZPA 4WZCA 3ZXAC 3VKOA 2HYKA 4C1XA 3VHNA 4AEKA 5CIRA 1O91A 2W68A 4MV2A 4DUXA 1ULOA 2RJKA 4TLGA 4UWDA 1NY72 5CNAA 1ZREA 3AKSA 3K4AA 4XJZA 2CGOA 2OZJA 3JQWA 2ZHKA 3LWCA 2FDGA 2TBVA 5DABA 1LHWA 4JVAA 1OKQA 5IVBA 3W59A 2XHNA 3ZXJA 1K5JA 1ZZBA 2W91A 4GMP0 4NMIA 1PIV3 1U12A 2H6BA 2RVAA 5J7MA 3RZMA 3BVCA 1MS5A 3RZGA 1HQLA 1FX5A 1LHNA 2W94A 2V5DA 2GN7A 3M70A 4NR1A 3UT0A 4YG3A 3ZFFC 3ZN4A 4EN6B 3A7QA 5JMOA 1WW6A 2W39A 1MVQA 3FLTA 4OYUA 2WZR3 4DEQA 1AYN2 5K0UB 1VPHA 4Y5TA 3OY8A 5IWFA 2JE7A 5CAZA 3ENRA 1GFF2 3DPRA 3WY6A 2VMFA 4EWEA 2WO7A 3AFKA 4R4ZA 3VBHB 4GWNA 2RDNA 3I49A 4Y5Z0 2W46A 4BIOA 1UU6A 1AUYA 1UMHA 1VBD1 2ARBA 4KGGA 2OQ7A 4L2NA 3VBOA 5A6XA 1BMV1 2F17A 1FPN2 2WZEA 1ONAA 1FV3A 3VN4A 1EPZA 3LQCA 3KV6A 4P9XA 2LUWA 3JD71 5HPOA 2BWAA 5EFUA 3E97A 2FDKA 3QBQA 4YW4A 5BNOC 4Y1YA 1Q8VA 4WVWA 4B7KA 1QDOA 1XU2A 5AC92 4AGRA 3HT1A 4AGVA 4LEJA 1GP5A 3WG3A 1VBC1 5GLTA 5HCBA 2X10A 3OGVA 4WVMB 2ZMNA 3VKNA 4K3UA 2BZDA 4AWDA 4EZHA 4MADA 2Y64A 1QF3A 2ZZQA 4EZ4A 4DXZA 1EAH2 1TME1 2D6KA 2VUDA 2ZS6B 1G86A 3H3ZA 3LA2A 1POV1 1YIPA 3UGFA 1YFUA 3U1XA 1WCQA 3A4UA 4FPYA 4AE2A 1JU4A 1W9TA 2WN2A 2RM22 1LOEA 3C8XA 2VNRA 1RGSA 4D7SA 2MPFA 5F3CA 3FHIB 2AR6A 1CPMA 2HWF1 2XONA 3SC7X 4ITCA 3UETA 4LBJA 5M0TA 4PBOA 4WM7B 1GZWB 2P4EA 1ND2C 2YUEA 4XDQA 4EN7B 3M8LA 4D7YA 1ZYBA 2VL4A 1LU1A 1UX6A 2ZHLA 3I2HA 4JC1A 4MXVA 1JH5A 3T09A 3NAPC 5C4WB 1QQP2 3M1HA 4YZ1A 1AXYA 5ISLA 1WBFA 1QH6A 2R7EB 1OFNA 1GOFA 4Y22A 4Y5SA 1D4M3 1W39A 3P3PA 3WQ0A 4ZU7A 1S0BA 2O1QA 3DF0A 5FBZA 2JE9A 1W99A 5FY7A 1RJ8A 3Q8CA 1UKGA 3FBMA 4CDWB 1NOVA 5HV4A 1HB4A 1NX9A 4YGCA 4JGYA 1D0GA 4BQ1A 1R082 4E2GA 1A78A 1GNZA 5C6CA 3GBWA 1XNDA 2VXJA 1WA4A 3IIAA 2BFUS 1IOAA 1WMEA 4LKFA 4YGBA 2EICA 1LULA 4N43B 1H1AA 4C0HA 1KXGA 3J8F3 1B09A 1WCKA 4GD4A 1VALA 3OOXA 5LK5A 2XJSA 4AEDC 3AFGA 2YGLA 3JXSA 3HN1A 2VZVA 4Z07A 5A7OA 1NE6A 1JS9A 1I9RA 4AHYA 1SLLA 1IPSA 2ZACA 3J7NA 1OFSA 4AI8A 2G9FA 2RS53 4BA6A 3AJZA 2JG8C 2WFF3 3B93A 3U07A 3ZDVA 2DVFA 5JR7B 1LOFC 3JB8A 2OA2A 1ULPA 3ACLA 5JOZA 5E88A 3ECQA 1XNKA 2FMDA 4ONUA 4QX0A 1NA1B 2VTXJ 4YW6A 3ZIXA 4OHYA 2WA4A 3UK9A 2F4LA 2DCYA 5FJKA 3O7OA
chains in the Genus database with same CATH topology
4Y5TA 5LA9A 5LASA 3GJBA 5EQUA 5C5UA 2G19A 2RDNA 5DAXA 5LBEA 4ZPIA 5DAWA 5EPAA 3W20A 3HQRA 2RDQA 2JIJA 4XCBA 4BQWA 3PL0A 5DAQA 2HBTA 3OUHA 4ZONA 5DAVA 3KT4A 3OUIA 3HQUA 3MGUA 2FCVA 3KT1A 5HV0A 3EMRA 2Y33A 5LB6A 2V4AA 4XCAA 4XACA 4XAAA 4BQYA 5LATA 4XC9A 2FCTA 5L9RA 2Y34A 4IW3A 5C5TA 4JZRA 5LBBA 4MHUA 2HBUA 5M0TA 5L9BA 5EP9A 5IATA 4Y5SA 3GZEA 4NAOA 2RDSA 3NNLA 3ITQA 5HV4A 3NNJA 2RDRA 2A1XA 2G1MA 5A3UA 3DKQA 3W21A 5IAVA 4NHXA 2FCUA 5L9VA 2RG4A 3NNFA 3GJAA 5ERLA 4Q5OA 4KBZA 4UWDA 4NHKA 4J25A 4BQXA 5DAPA 3OBZA 3OUJA 5LBFA 4MHRA 4NMIA 4NHLA 4XABA 4NHYA 3BVCA 5LBCA 2JIGA 3KT7A 5IAXA 2OPWA 4NHMA 3NNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y5T A;  5LA9 A;  5LAS A;  3GJB A;  5EQU A;  5C5U A;  2G19 A;  2RDN A;  5DAX A;  5LBE A;  4ZPI A;  5DAW A;  5EPA A;  3W20 A;  3HQR A;  2RDQ A;  2JIJ A;  4XCB A;  4BQW A;  3PL0 A;  5DAQ A;  2HBT A;  3OUH A;  4ZON A;  5DAV A;  3KT4 A;  3OUI A;  3HQU A;  3MGU A;  2FCV A;  3KT1 A;  5HV0 A;  3EMR A;  2Y33 A;  5LB6 A;  2V4A A;  4XCA A;  4XAC A;  4XAA A;  4BQY A;  5LAT A;  4XC9 A;  2FCT A;  5L9R A;  2Y34 A;  4IW3 A;  5C5T A;  4JZR A;  5LBB A;  4MHU A;  2HBU A;  5M0T A;  5L9B A;  5EP9 A;  5IAT A;  4Y5S A;  3GZE A;  4NAO A;  2RDS A;  3NNL A;  3ITQ A;  5HV4 A;  3NNJ A;  2RDR A;  2A1X A;  2G1M A;  5A3U A;  3DKQ A;  3W21 A;  5IAV A;  4NHX A;  2FCU A;  5L9V A;  2RG4 A;  3NNF A;  3GJA A;  5ERL A;  4Q5O A;  4KBZ A;  4UWD A;  4NHK A;  4J25 A;  4BQX A;  5DAP A;  3OBZ A;  3OUJ A;  5LBF A;  4MHR A;  4NMI A;  4NHL A;  4XAB A;  4NHY A;  3BVC A;  5LBC A;  2JIG A;  3KT7 A;  5IAX A;  2OPW A;  4NHM A;  3NNM A; 
#chains in the Genus database with same CATH topology
 4CDQ C;  4LKE A;  2R06 1;  4P9Y A;  4M0H A;  4RGG A;  4BK5 A;  3PUS A;  4CEY B;  4PDW A;  2WWU A;  1ZX5 A;  3OYW B;  2ENR A;  1GWM A;  1AR8 3;  1WW4 A;  3MPB A;  3WX5 A;  5DXD A;  3S30 A;  2VM9 A;  3OBT A;  4XCB A;  2CY6 A;  3PL0 A;  4I0W B;  2C0Z A;  3RYR A;  4M0N A;  2A3W A;  1JOB A;  3O0W A;  1V9U 1;  3SCH A;  1QXP A;  2VMH A;  1OLM E;  4LKD A;  1UIK A;  1LB2 A;  3OTF A;  4N9H A;  3RJ2 X;  4BQ4 A;  5FY8 A;  5AFB A;  2GME A;  1SBF A;  4BQ3 A;  3B9C A;  4HMZ A;  1TNF A;  4FPF A;  2GMM A;  3U11 A;  1WD3 A;  4Q1R A;  2QUO A;  4KWJ A;  2JB4 A;  1X50 A;  2QQN A;  1SFP A;  5J48 A;  4IEZ A;  2B7Y A;  4Q4X 3;  4COW A;  2BFU L;  1COV 2;  3TN9 2;  3CHX A;  1OSG A;  3SH5 A;  2YFZ A;  5IYY A;  1POV 0;  2GC3 A;  2RS3 3;  4LHL A;  3VDA A;  4PHZ A;  1GKB A;  5A1L A;  4CZS A;  3P5B A;  3POI A;  1WMD A;  1UY0 A;  1LU2 A;  5JCT A;  4XJ9 A;  4TN7 A;  2LAL A;  2ZXQ A;  4IW3 A;  2XUE A;  2WYS A;  3D5O A;  3VBF B;  2WAO A;  1D4M 1;  2QNK A;  2XR4 A;  5BXX A;  1JZ4 A;  3VZJ A;  3VBS B;  3IPV A;  2HBU A;  1VBB 2;  1WCU A;  1JYI A;  4ES9 A;  1JZ2 A;  1ZVF A;  3O0V A;  2X5I C;  4AVC A;  2DU1 A;  3ZFF A;  3ZXF A;  5FMC A;  4DFS A;  3NJZ A;  5EP9 A;  3VL8 A;  3RS6 A;  4EWD A;  2DTY A;  3AYA A;  1R09 1;  3IB3 A;  5JOX A;  1HQW A;  1SG3 A;  1GZC A;  2WKK A;  3BOP A;  3MEP A;  4J6G A;  4Y24 A;  3J8F 1;  4ASK A;  4XEZ A;  1RUC 3;  1HDK A;  3VDD C;  5C7G A;  2W92 A;  3ATG A;  1UIJ A;  4N90 A;  3SMH A;  1LKN A;  3MYX A;  4LK7 A;  4LKS A;  3WF0 A;  2Z2S B;  4IET A;  3ON7 A;  3L9J T;  4OLL A;  1XYO A;  4LBQ D;  1S2B A;  1YHF A;  3AP6 A;  2BGP A;  2ZEY A;  1C5I A;  4NAM A;  3I2F A;  5GLZ A;  4QKD A;  3T1L A;  1WGP A;  4BXS V;  5A7W A;  2GC2 A;  1ZBE 2;  2V5Y A;  2FCU A;  4P9I A;  5L9V A;  3V64 A;  2WFF 1;  3AL6 A;  3H8O A;  5BNO A;  3K51 A;  3WCR A;  4Q0U A;  1V6I A;  1APN A;  1CZS A;  1WBL A;  2Y6L A;  1JZ6 A;  2WJS A;  1BK0 A;  4BQX A;  1J3R A;  2R16 A;  2P17 A;  4U2A A;  2VUC A;  1D0H A;  1BLZ A;  1J58 A;  1YXW A;  2DVA A;  2Q1Z B;  4ISQ A;  1W6M A;  4MHR A;  3ZVX A;  4RFT 0;  3IZO A;  3GCX A;  1W8F A;  3ILR A;  4QQ2 A;  5C3S A;  2JWP A;  5GZG A;  1M4W A;  3LDK A;  3KT7 A;  4YW1 A;  1KRI A;  4YW7 A;  4DS0 A;  1AR8 1;  2BBA A;  5FMD A;  3AB0 A;  1C8M 1;  4DY5 A;  5L36 A;  2ERF A;  4KL1 A;  4YZ5 A;  1J1L A;  3NNM A;  5T5O A;  2XQR A;  2BEO A;  3PIJ A;  5FZL A;  3NV3 A;  5FZC A;  4BDV B;  4Q0V A;  3I3E A;  1QIQ A;  4K20 A;  3WF2 A;  4OUS A;  3GBG A;  1AR7 3;  4RSU A;  4PJY A;  2ET7 A;  1ND2 A;  1UN1 A;  2ZMK A;  2MEV 2;  1QJY 3;  1MQT B;  2OS2 A;  2Q1M A;  3N35 A;  1E5I A;  5JOW A;  3THD A;  3NAP A;  3QLQ A;  4BH9 A;  1ZBA 1;  1JZ3 A;  1QHD A;  1RUH 2;  1CAX A;  1V9U 2;  4P00 B;  1BBT 2;  4QX8 A;  3MIH A;  4ZON A;  1LNS A;  2JDN A;  2PYT A;  4UFL A;  4Y20 B;  3T0B A;  3IDC B;  2DUP A;  1OF4 A;  4I02 A;  3WHU A;  2ZZJ A;  4W6X A;  4JDM A;  2RJ2 A;  4JGZ B;  3FL7 A;  3SKV A;  2ATF A;  4RFR B;  2A73 B;  4A7Z A;  3E5Q A;  1W3X A;  1ENR A;  4KMQ A;  4Y4Y A;  5CIS A;  3I97 A;  3KLS A;  4MG2 A;  3TOJ A;  2C1F A;  1YWK A;  2VMD A;  3RYK A;  1UYY A;  4XFG A;  2PLV 2;  3PVN A;  3NKG A;  4HL0 A;  4GAL A;  1IQA A;  3ZO0 B;  1CZV A;  1RUJ 3;  3AP7 A;  4AED A;  5C8W A;  5CG9 A;  1G7Y A;  3MI8 A;  3POW A;  3AMP A;  4HAN A;  1AR9 3;  2OUJ A;  3WDX A;  5FYM A;  2PFW A;  2V4V A;  2D5F A;  5DUV A;  3MLK A;  1RUG 2;  5FRE A;  2WT1 A;  3I2I A;  4JTN A;  1UQX A;  4NUB A;  3N9L A;  2JG8 A;  2W1U A;  3S7I A;  1XE0 A;  3THP A;  3Q8F A;  3BKZ A;  1LOF A;  4CUB A;  1US2 A;  1X82 A;  4LMF A;  5DDJ 2;  1R09 2;  2XGX A;  3FE5 A;  4L99 A;  3S5A A;  3H9A A;  1AXZ A;  4C91 A;  1WD4 A;  4CDQ A;  4IE0 A;  5LRS A;  2RDS A;  1XSQ A;  2IUW A;  2DFC A;  2UWB A;  1HQN A;  3NMB A;  3NNL A;  5KC6 A;  3FLP A;  1YQC A;  5T50 A;  1LHU A;  5BNN A;  4PIZ A;  4K1Z A;  5A32 A;  2RR1 3;  2Y8K A;  3B94 A;  3W5M A;  1HXS 3;  2VC9 A;  3C7H A;  1CAW A;  2A1X A;  1GZT A;  1EV1 1;  3DEC A;  3F95 A;  2H0V A;  3CLP A;  3NQH A;  4YPJ A;  1KJR A;  3IT8 A;  3VZM A;  3NRU A;  3WP4 A;  2ZJC A;  4RR3 B;  2RG4 A;  2UUR A;  4LOT A;  1AR6 2;  1W8Z A;  5A3P A;  5JZG B;  3ABZ A;  1OLM A;  4ZZ8 A;  4K9S A;  1ZRR A;  4H2A A;  2IXJ A;  1PGW 2;  4R9D A;  1O4Y A;  4PQ9 A;  4A7Y A;  4TZD A;  1CWP A;  5CZK A;  1S0D A;  4IGQ A;  4Y26 A;  1CJD A;  3ZLI A;  5ACA 1;  4AYU A;  4JAA A;  3O14 A;  1AR7 1;  5ANQ A;  4B1L A;  2FDH A;  5FY5 A;  2VGD A;  4XTM A;  4YG0 A;  4RHV 1;  1UKR A;  3ASI A;  4XFA A;  1OC1 A;  5IK4 A;  1U0A A;  2P37 A;  5FTT C;  1OA4 A;  5FPX A;  2YC4 A;  4KBB A;  2DV9 A;  1W2A X;  2XL9 A;  4R9C A;  4DIN B;  3R0R A;  3U4X A;  4OI2 A;  3AMH A;  5LA9 A;  1TMF 3;  2IZW A;  4HPK A;  1V6M A;  3OGG A;  4AG4 A;  3GAL A;  1KD7 A;  1ZBA 2;  4HN1 A;  1LOD A;  2X5I A;  2NP0 A;  3UL2 A;  3QH6 A;  2YG0 A;  4F8A A;  4MGK E;  1DLC A;  5FZO A;  1DDL A;  2D6M A;  1AYM 2;  5FMO S;  5BNN C;  3AMM A;  2HBT A;  3W9A A;  4DO0 A;  3S0M A;  1D2S A;  2JDH A;  3LIG A;  1ND3 B;  3VDD A;  1U5X A;  2WT0 A;  3LAG A;  4LO4 B;  1AXK A;  1AF9 A;  1PMJ X;  1RUJ 1;  2W9X A;  3ACH A;  4OVE A;  2YBS A;  1Y7B A;  1NQJ A;  4Z92 B;  4NWW A;  3VDC A;  3LGR A;  1NLS A;  2GP5 A;  4XQ4 A;  3WW4 A;  4FT8 A;  2A70 A;  1AZD A;  4MVT A;  3BU0 A;  5FYU A;  1VRB A;  1ZM1 A;  2KR2 A;  5AVA A;  5GZE A;  4COV A;  4XCA A;  2ZGP A;  1B35 B;  2PA7 A;  3I3B A;  3NVC A;  1K5M C;  3PDQ A;  4L11 A;  1XE8 A;  5K8S A;  4QX3 A;  2OKX A;  3WF1 A;  4M4R A;  3I59 A;  3JB4 C;  2Q30 A;  5AFE A;  3B00 A;  2ZGL A;  4YM1 A;  3VBR C;  3GZT B;  2HJI A;  1UX7 A;  4WM8 C;  2CV6 A;  3HPN A;  2VW2 A;  5LBB A;  5F3G A;  1NLR A;  1YFW A;  1ST8 A;  1Z7S 1;  3AKR A;  1MS4 A;  5DG2 A;  3LF7 A;  4FI9 A;  5IVF A;  2VTX A;  5KWR A;  1O8S A;  3ZR6 A;  1VMJ A;  4ES8 A;  5JMC A;  3WHT A;  5FZG A;  2HYX A;  5JXJ A;  5JIU A;  2RR1 1;  3R4S A;  1BHG A;  2Q8C A;  4EE2 A;  4LIV A;  2LRP A;  4GH4 C;  5CEH A;  1FPN 3;  3D8C A;  4RQP B;  2GZW A;  4Q4Y 2;  1A3K A;  1W2N A;  1QWR A;  1W6O B;  4AVS A;  4CUC A;  2UY8 A;  2PN5 A;  3TNQ A;  1W0N A;  1SPP A;  4X6Q B;  3D0S A;  3X29 B;  4MGT A;  1NUK A;  1EV1 2;  3TYJ A;  5DN2 A;  5KXE A;  2UYA A;  3C3V A;  5CAD A;  1NCQ B;  4F3J A;  4YZ4 A;  3KHC A;  4PI0 A;  5FV3 A;  4E2S A;  1FOD 3;  3SIT A;  1E5S A;  1W6N B;  1S0F A;  4A7K A;  4QU1 A;  2B42 B;  2WO2 A;  1Y3T A;  2SBA A;  4BB3 A;  1DGW X;  5J1X A;  2GDF A;  4XPV A;  5FMB A;  2ZEW A;  3O12 A;  3LOB A;  1MS8 A;  5F6L B;  3N9O A;  5JPM B;  1RB8 G;  2GH2 A;  2W5F A;  3VZK A;  2HWC 3;  4QX5 A;  5I0T A;  3POS A;  1AJO A;  4B4P A;  3WNN A;  4A6S A;  2B9U A;  4RHV 2;  3ACI A;  3WDT A;  5FXX A;  1ZZ9 A;  2UWA A;  2C24 A;  4O9E A;  1RIN A;  1KIT A;  2AGS A;  1QJF A;  2NM1 A;  4HSL A;  1XNC A;  4NN0 A;  5EXO A;  3Q8A A;  4CP2 A;  4YVS B;  4P9G A;  3ZSE A;  5FQ0 B;  3J7M A;  2D40 A;  5APA A;  1FMD 2;  2JEM A;  4LHN A;  2LS6 A;  5JOY A;  5CFC C;  3HNB M;  3WQB A;  3OGS A;  1AL2 1;  1VRH 2;  2DWR A;  5LAS A;  2CDO A;  2HWD 2;  5LY2 A;  3MBW A;  2QZ2 A;  3KD4 A;  4CDU B;  5EIY B;  3USU B;  3VV1 A;  3KV5 A;  1H1I A;  1FYU A;  1XB9 A;  3H3L A;  3NV2 A;  3UYJ A;  4YSF A;  2AZ5 A;  1UNB A;  2VOT A;  1FNZ A;  2VQ0 A;  3UJO A;  4C8D A;  1S1A A;  5EPA A;  5FXV A;  3H42 B;  3JBG 2;  4GAZ A;  1NY7 1;  2RDQ A;  2AUY A;  2JDM A;  2JIJ A;  1VBE 2;  4X8P A;  1GP6 A;  2J1U A;  5D8A B;  5FWE A;  5IK5 A;  3WG1 A;  4IV1 B;  4R8H A;  5FPZ A;  3T0A A;  3ZPO A;  1W04 A;  2D6N A;  3ALQ A;  3GBF A;  3I8T A;  1CX1 A;  2ZX0 A;  1X8M A;  1M06 G;  3WOG A;  4XBN A;  3KMH A;  2BUK A;  3IM0 A;  3PUH A;  1BEV 2;  3J9S A;  3HQU A;  1GUI A;  3LEK A;  1XNA A;  5F5I A;  4OQ9 A;  3ZKY A;  4KWU A;  1MZF A;  3DL3 A;  3USS A;  1AYN 1;  5FYS A;  1KEX A;  1QJU 2;  3HQX A;  2XLG A;  1OD5 A;  1U5Y A;  4Q8L A;  3O0X A;  5FYV A;  3KCC A;  2VQU A;  1LEN A;  3U78 A;  1MR5 A;  1N3P A;  4OI4 A;  1SFN A;  1W03 A;  1Z7S 2;  3IKW A;  3T08 A;  1IPK A;  1I6X A;  5E8A A;  4XDO A;  4E27 A;  3O1P A;  3RWK X;  1SCS A;  2VOW A;  4YVW B;  2YV8 A;  1WW7 A;  1KDM A;  1OUS A;  3DYO A;  4I3P A;  5GLV A;  1UZZ A;  3NWK A;  4XTP A;  5FIX A;  5GZF A;  4B8E A;  4DY3 A;  1UY2 A;  4LIU A;  1VBD 3;  5ABJ C;  2J7M A;  4YM0 A;  2NLR A;  3EYP A;  2KA3 A;  4KQ7 A;  1QNW A;  5AC9 1;  1JU3 A;  4LHS A;  2P6C A;  1GIC A;  1SDD B;  3SHR A;  1F31 A;  3BOW A;  3JD7 3;  4QB6 A;  4W50 A;  3AX4 A;  3B69 A;  2YBK A;  2IVJ A;  4OMD A;  3WSO A;  4OZX A;  4NII A;  3CNA A;  1PO1 2;  2B39 A;  4QPI C;  1LOB A;  2D5H A;  4EQV A;  1C1L A;  5A6Q A;  4OZO A;  2DCT A;  2VCM A;  4UT5 A;  4AVT A;  1HV0 A;  3CJI C;  1EAH 1;  5DQ0 A;  5J96 B;  5BNQ A;  2RDR A;  1E5H A;  1QXJ A;  5F3I A;  4BZ4 A;  5GZC A;  4OUE A;  1LOC A;  4OI1 A;  2EID A;  4ARY A;  1H1M A;  2CWM A;  4EN8 B;  2RM2 1;  1Y9Q A;  3K48 A;  1L3J A;  1RC6 A;  3DKQ A;  4HZF A;  4ATE A;  4LBK A;  1DBN A;  3POB A;  5T5P A;  3WW3 A;  4IER A;  3HAG A;  1WWY A;  2ES3 A;  1TME 3;  4NHX A;  4RS5 A;  3RWN A;  3VKM A;  4BXF A;  1RMU 2;  3DKW A;  5FZ7 A;  1Q43 A;  1COV 3;  1EYB A;  3MIG A;  4MZU A;  4MSV A;  3WNX A;  1PK6 A;  3H7Y A;  2WLP A;  4GWI A;  3T4H B;  4YFW A;  2HWF 3;  5KXC A;  3I3D A;  2WDB A;  5F3E A;  1QQP 1;  3I4I A;  2GND A;  3AKT A;  1Y43 B;  3FJS A;  3OUJ A;  1AX2 A;  4NRP A;  4XMI A;  2ZOE B;  4AI3 A;  3WF4 A;  3KB5 A;  3RZH A;  1EY2 A;  2VW0 A;  3Q8E A;  4CUG A;  4LA2 A;  3RDI A;  2FZ2 A;  1VBB 3;  1K5M A;  2GC0 A;  2JIG A;  1ZA4 A;  5IJR A;  4LR4 A;  4TXW A;  1N1S A;  3LA3 A;  4TLF A;  2EF6 A;  3VHP A;  1YQ2 A;  3VBR A;  3QOP A;  3FWE A;  1IGO A;  1MEC 2;  1CD3 G;  1R08 1;  4LLO A;  2AEY A;  4WM8 A;  3ZR5 A;  1IS6 A;  4EYU A;  4Q4W 2;  5H9S A;  5C8C B;  4MYE A;  4JRA A;  2WIN B;  3NW4 A;  3ZN5 A;  2G19 A;  3E6B A;  2XHK A;  5IVV A;  1PVC 2;  3FBY A;  3ZYI B;  1W9F A;  3WG4 A;  1VMH A;  5BYN A;  2J1S A;  1K12 A;  3W5N A;  1IPJ A;  1YIF A;  3ZSK A;  4GH4 A;  4NID A;  3E5X A;  4LUK A;  3WD5 A;  2EVX A;  5A3N A;  4OFG A;  3OBR A;  5A7N A;  3AP4 A;  2WWJ A;  4PF5 A;  1DIW A;  5FJH A;  3ZFE A;  4CEW B;  2IFR A;  1ZBE 3;  5F2W A;  5IFP A;  3HD8 B;  2TUN A;  1NT0 A;  2HKX A;  4IUG A;  2C6S A;  2E31 A;  5IK8 A;  1REF A;  1HJF A;  2QQL A;  2XBO 2;  1CQ9 A;  3KM5 A;  4CDX B;  5HV0 A;  5LEJ A;  3DUI A;  2BPA 2;  1NCR B;  1A8M A;  5H9Q A;  4E4S A;  4KWL A;  2GH8 A;  3OEB A;  1GOG A;  5C3R A;  4XJ8 A;  1WLD A;  5A33 A;  2ZX3 A;  2CNA A;  4XAC A;  1G6N A;  1UY1 A;  3HOB A;  3RMY A;  1REE A;  4O9G A;  5CYY A;  3LSD A;  2VNO A;  3SKJ E;  1RUF 2;  4B7E A;  2VBD A;  2KXL A;  1XNT A;  2WBK A;  2R06 3;  4YW3 A;  3VBU C;  3O1O A;  1DZR A;  1TVG A;  5KXB A;  4L8Q A;  5E16 A;  3WCS A;  5FP8 A;  3VUO A;  4FQ4 A;  4FSJ A;  1C5H A;  1ASJ 2;  3WQ1 A;  4W4Z A;  2D3R A;  1ZZ7 A;  2YU1 A;  1H2M A;  2QBX A;  4CP9 A;  1X9P A;  2OXB A;  3E6D A;  4OUL A;  4UYB A;  2R04 2;  5CFC A;  4C0B A;  2J1T A;  5A1F A;  1RUH 3;  2WWS A;  3SH3 A;  5BUV A;  1V9U 3;  4QHB A;  3RMX A;  2OX0 A;  3MV0 1;  1NQD A;  1US3 A;  2C9A A;  3OPT A;  3OGR A;  1IG3 A;  1ZA7 A;  2E7T A;  3OY8 B;  3UGG A;  1X9T A;  3ITQ A;  5D2A A;  4ORF A;  2XUM A;  1COV 1;  3KHB A;  3DPR B;  3NNJ A;  3TN9 1;  5BNP C;  3ZYH A;  3BUC A;  2V09 A;  4I09 A;  2E7Q A;  2ZKL A;  1O4Z A;  1Q8Q A;  4LBO A;  2GC1 A;  3VBO B;  1ENQ A;  4U36 A;  2DUO A;  1GWL A;  5FZ6 A;  4AGG A;  2D7F A;  4COY A;  1LRH A;  4QGM A;  3ZYG A;  1RUE 1;  3LDB A;  5T5J A;  1VBB 1;  1UPI A;  3ILF A;  4BQ2 A;  4JDN A;  4NRO A;  2PLV 3;  4QM8 A;  3AC0 A;  4XJW A;  1W9W A;  4KU8 A;  4DQA A;  1A34 A;  2HH9 A;  1S0C A;  4XBQ A;  5HI0 A;  1BQP A;  3POJ A;  1GLH A;  5CKQ A;  3AL5 A;  3ETQ A;  5FZ0 A;  2GNB A;  2QE3 A;  1BCX A;  1RUG 3;  1SBE A;  3EO6 A;  5KHJ A;  1OUR A;  1IKP A;  1HB3 A;  2TEP A;  1I1E A;  4LOS A;  2WNU C;  3MPP G;  4MUV A;  1TEI A;  2W47 A;  1YRZ A;  3U75 A;  4LBN A;  4CCC A;  1EUU A;  1YUD A;  1CAU A;  3FMG A;  5FY4 A;  4F7Z A;  3ZFE B;  4ZHN A;  1C1F A;  1O5L A;  4GA9 A;  1R09 3;  4HK9 A;  4NHM A;  4QKB A;  3C7E A;  3ZXL A;  5CBL A;  2R1D A;  2WRA A;  4FP2 A;  4AVB A;  1N1V A;  4EN0 A;  2R07 2;  4QPG C;  3MHZ A;  2Q8D A;  4GB3 2;  3APB A;  3P6B A;  5JIA A;  4IEV A;  1ZBE 1;  2VQA A;  2WLQ A;  2JD9 A;  1OKO A;  5ABJ A;  5FCC A;  4FPL A;  4WVV A;  2ZGT A;  3CDZ B;  4DUV A;  5DAW A;  5I8S A;  4FO9 A;  3I2G A;  1JBC A;  2WO1 A;  4QGL A;  1QY4 A;  1YQ8 A;  4V2W A;  2PHU A;  3FLR A;  3IWZ A;  3ZFG C;  5F1R A;  4Y22 B;  4QPI A;  4I2O A;  1NXD 1;  4S2D A;  3OUI A;  4BME A;  3OG2 A;  4FCA A;  3NV4 A;  2UWC A;  3CJI A;  2AH2 A;  4C1W A;  2K9Z A;  4E8D A;  2QCS B;  4NIA A;  3RYP A;  5EJ1 B;  2Y6F A;  1HJG A;  1MS3 A;  2QFE A;  3RNS A;  4JGY B;  3T30 A;  1A8D A;  3TNP B;  5FO9 B;  3ZSM A;  2I2S A;  4FOQ A;  4QB1 A;  4B4R A;  5C9A C;  1W0O A;  5JXG A;  1RHI 1;  4B4Q A;  5GKA C;  4NIH A;  1AHS A;  5FWJ A;  4CU6 A;  4YW5 A;  5I0R A;  2WNV A;  2WL1 A;  2I07 B;  2Y6H A;  1W2U A;  1C8M 3;  1OH3 A;  2VCC A;  4XC9 A;  4EN9 B;  5JDB A;  1YEW A;  2MEV 1;  3FC0 A;  1AX1 A;  1QU0 A;  2VZS A;  1MPX A;  3GF6 A;  2E51 A;  4JKM A;  4P08 A;  1W0P A;  4URA A;  3IBM A;  4D69 A;  1L7R A;  1RUH 1;  1OOP C;  4UFH A;  3VZN A;  1BBT 1;  1J84 A;  1W8T A;  5B4X A;  4CCM A;  1JYW A;  4FOY A;  2E26 A;  1VR3 A;  4UFI A;  1R1A 2;  5T3N A;  5HBA A;  4YM3 A;  1OD3 A;  4HKO A;  1ZBA 3;  1Q3E A;  3A21 A;  5L9B A;  3LEG A;  4QXB A;  1RUN A;  2PAK A;  5CKM A;  5TSW A;  1IS3 A;  2DVD A;  3LZZ A;  3J26 N;  2QKD A;  2JG9 B;  1AYM 3;  3EXU A;  4CXW A;  4CCL A;  5C71 A;  3RFR A;  3K3N A;  2IXC A;  4MO3 M;  4AHW A;  1W8H A;  4LO5 B;  4QKF A;  3SCG A;  2ZEX A;  4M3C E;  4IGO A;  2WSU A;  3ZOI A;  3N3H A;  1SFY A;  4Q0S A;  2ZHN A;  1J59 A;  2ZTN A;  2PLV 1;  2Y6J A;  2B9V A;  3H8U A;  4PDW B;  3K75 B;  3AYC A;  5BPX A;  1S55 A;  2NN8 A;  1RUE 2;  2P2K A;  3ES1 A;  5FZI A;  3M3I A;  4CRQ A;  1RUG 1;  2VR4 A;  4Q2F A;  3VGI A;  4AW7 A;  5ERL A;  3BAL A;  1UY3 A;  2XJV A;  4O65 A;  3N9M A;  2VVF A;  3MW3 A;  5LA2 A;  4PIY A;  5FZ4 A;  5DDJ 1;  1UZ0 A;  5IUQ A;  4YYO A;  1GNH A;  1DU3 D;  3TB0 A;  4Q27 A;  4ZXE A;  4EV0 A;  1U5I A;  4YZ3 A;  2CGP A;  1HB1 A;  1SQ4 A;  4ZU4 A;  1AVB A;  4ARX A;  4Z8B A;  4JQR A;  2ARA A;  3VD7 A;  3NJV A;  4R52 A;  1Q8S A;  2A6Z A;  3AMQ A;  1H8T C;  1W6P A;  1W2O A;  4H3W A;  1WMF A;  1XRU A;  1GYK A;  4GUL A;  2FMY A;  2OII A;  4RGK A;  4RYD A;  5H9R A;  1OA3 A;  4XJU A;  3U37 A;  2JJ6 A;  5A7P A;  5FXZ A;  3VBU A;  5KHI A;  1JZ5 A;  2BGC A;  3SLI A;  2VU9 A;  3H8X A;  3GJB A;  5IT6 A;  2ZGK A;  1AJK A;  4Y4R A;  2VD7 A;  2X29 A;  4XUO A;  2VMC A;  1F8V A;  5EQU A;  5FLI A;  5LZ6 A;  3IPV B;  2JDU A;  2W95 A;  5FDB A;  5GLU A;  3V0A A;  4Y1V A;  1AR6 1;  1EV1 3;  4JKK A;  2VZU A;  2PXJ A;  4IV3 C;  3M4F A;  4LE3 A;  4MGS A;  3WP6 A;  2RE9 A;  2RS1 2;  3VB9 A;  3ZFF B;  3MFC A;  1JYV A;  1PGW 1;  1UMI A;  1F4A A;  2YHJ A;  1WUV A;  3AZW A;  4YM2 A;  4YWA A;  3T1M A;  4A42 A;  1ZZ6 A;  1LEC A;  2J1V A;  5F5Q A;  5DUW A;  1PIV 2;  4CXX A;  1LGC A;  2A6Y A;  1RIR A;  2PEL A;  1QJX 2;  2VBB A;  5BNP A;  1Y9G A;  2JDK A;  3ZYF A;  4AVV A;  2W2I A;  4P02 B;  4FVV A;  3MIC A;  1UZW A;  1RHI 2;  2WZR 2;  4AI9 A;  4D7T A;  5ACA 3;  2O8O A;  5FUP A;  5LB6 A;  1DQ4 A;  2XJP A;  4RHV 3;  5I8T A;  3OF1 A;  2BJS A;  3CEW A;  4UF0 A;  3T2T A;  1W6Q A;  3VDB A;  3BI3 A;  5A7W B;  1H6X A;  4A4A A;  1SAC A;  3KV9 A;  3CQO A;  2R1B A;  2ORX A;  5CVR A;  5BNO B;  5FZE A;  1RUI 1;  1SLA A;  3BTX A;  1AYM 1;  2WAA A;  1DQ5 A;  1FMD 3;  2BU9 A;  1KQR A;  1UZY A;  2Y38 A;  3MFA A;  4HON A;  4Y33 A;  2Z42 A;  1VRH 3;  1H4G A;  1OA2 A;  3NJX A;  2HWD 3;  2VNG A;  3V0B A;  1DYO A;  1XPW A;  4XJA A;  5A80 A;  2R32 A;  4EJR A;  3PMS A;  2WNU A;  5FR3 A;  1S4C A;  4NO4 A;  1W6M B;  3GHN A;  3CJX A;  4KG0 A;  4DEV A;  3AP9 A;  1W9S A;  1O7F A;  5CFD C;  1W28 A;  3JU9 A;  3K2O A;  2VNV A;  2BNN A;  4E2Q A;  4IEP A;  4KG8 A;  1UOJ A;  1VBE 3;  4FPJ A;  4QPG A;  2EXJ A;  1VB2 A;  1RIT A;  2ADD A;  3FZ3 A;  1C57 A;  4R9B A;  2QJV A;  2PAM A;  3QD6 A;  2Y6G A;  3T2P A;  3WP5 A;  3ZKU A;  5L19 A;  1DGW A;  2XG3 A;  1ALY A;  1BEV 3;  1ND2 B;  4XZU G;  3S7E A;  3VD4 A;  3N9Q A;  5FZK A;  1Z0H A;  2VZT A;  3WIN E;  1RVF 2;  2XLF A;  1I3H A;  3NAP B;  4IV1 C;  4CA9 A;  5JPN B;  3WG2 A;  4X6R B;  1NKG A;  2PQS A;  2W3J A;  1CAX B;  3H1M A;  3M7A A;  4I0A A;  3I2K A;  4LO7 A;  4QXC A;  3ZFG A;  3GXU A;  4XHB A;  1IG0 A;  3AZV A;  1QJU 3;  4AHZ A;  2VZR A;  4Q5O A;  1QJE A;  4FOW A;  4QPY A;  2ZGM A;  4N53 C;  3T0D A;  3PUI A;  4DXR A;  2BP6 A;  5GJ6 A;  1PHM A;  4CUA A;  3PIG A;  4KU7 A;  4PI2 A;  1Z7S 3;  3NNG A;  4ISR A;  1GMM A;  1DGL A;  1SHW B;  2P3Y A;  2W1Q A;  2YC2 A;  2BQP A;  2JIC A;  5C9A A;  5FRA A;  4Q4Y 1;  4IES A;  5ANN A;  4IE6 A;  2EA7 A;  4A45 A;  3PU8 A;  1JN2 P;  1XOY A;  3WZ1 A;  1PGS A;  4S2H A;  4E4H A;  3SIS A;  4K40 A;  2QQU A;  4Q8K A;  2QQV A;  4D0Q A;  4Z82 A;  4AED B;  4HKW A;  2ZGQ A;  3FHQ A;  4WZF A;  1ULG A;  4WV8 A;  4M4P A;  1OOP A;  1SMV A;  3VD5 A;  4JKL A;  4D8M A;  3HN3 A;  1UL9 A;  4W6W A;  3CZU A;  5HXV A;  2CAV A;  2VY0 A;  3ORJ A;  3LOI A;  3PNA A;  4XIO A;  4XFF A;  2JG8 B;  3U4S A;  5JUV A;  4DRV A;  2A71 A;  4TWT A;  1SBD A;  4CU9 A;  1CIY A;  2GAU A;  2OT7 A;  3I3M A;  2DBI A;  1LHO A;  1OXC A;  2HEY F;  2XVK A;  1VAV A;  2Q8E A;  3WXP A;  5A3M A;  1SDW A;  3K4Z A;  1GQG A;  1CZT A;  4CDQ B;  5C3O A;  3BGA A;  3SCF A;  4XUQ A;  4QQL A;  4M3C A;  3TWI A;  5DMY A;  4DMI A;  2XDV A;  4H7L A;  5A1A A;  5FO8 B;  2GU9 A;  3H50 A;  5A32 B;  2V72 A;  1V70 A;  1O3T A;  1BKZ A;  1L7L A;  2YZ4 A;  3IAQ A;  1FMD 1;  1CAW B;  4NWV A;  4LBQ B;  4OMC A;  1VRH 1;  1OMI A;  2V4A A;  2ZX2 A;  2HWD 1;  2GMP A;  3S5Q A;  2ILM A;  5LW9 A;  2GP3 A;  1KS4 A;  3PME A;  2QZ3 A;  1NLQ A;  5JR2 A;  1HRV 2;  1VJ2 A;  1RUI 2;  1VE0 A;  3ZMO A;  1HRI 2;  2FCT A;  2E53 A;  2LW8 A;  1AL2 3;  1SZB A;  2VXR A;  3PVE A;  4JZR A;  5F32 A;  3AYE A;  3JBG 1;  1MEC 3;  5FUI A;  5KHG A;  1VBE 1;  2JDZ A;  2JKX A;  2ZHM A;  3H1W A;  2A3Y A;  4XUR A;  4Q4V 1;  4AEM A;  3U10 A;  2CHH A;  3AZZ A;  1TZO A;  4Q4W 3;  5J36 A;  4QDS A;  1QMJ A;  5DG1 A;  5FZ1 A;  4AR2 A;  2EIB A;  3KCY A;  1EUT A;  1I5P A;  3WNP A;  1H8T A;  5L7O C;  5HCA A;  4K8R B;  4X8N A;  1O3S A;  2V73 A;  1BEV 1;  1GP4 A;  1Q56 A;  4AFM A;  3ELN A;  2Z69 A;  2RV9 A;  4CCK A;  4DPN A;  1JYN A;  1TNR A;  3GZE A;  4NAO A;  1LGB A;  3VHR A;  3WNM A;  1AL0 G;  5FBJ A;  4Q4X 2;  3AM2 A;  4JCK A;  1J3Q A;  2EXH A;  1BZW A;  1V00 A;  2JD4 A;  2DCZ A;  2Y60 A;  3BIW E;  3M3C A;  3CU7 A;  4JQT A;  4AEJ A;  4HN0 A;  4ASL A;  1E5R A;  3LD8 A;  2X09 A;  1QJU 1;  2DVG A;  5DZF A;  4HPK B;  5FP7 A;  3WQ7 A;  2VO5 A;  2HWB 2;  1F5F A;  4H7M A;  2FHR A;  1J83 A;  2XJQ A;  4IV3 A;  2X5I B;  2XBO 3;  4GWM A;  1RED A;  1RXG A;  1JOJ A;  1AYN 3;  5FY1 A;  4ATF A;  5FZO B;  5IAV A;  4D6S A;  3P1I A;  2ET1 A;  4OHV A;  4SLI A;  3R4D B;  3T4V A;  1XSR A;  3PJY A;  2BVV A;  4AI1 A;  2ZBJ A;  4HVQ A;  2SLI A;  4MOA A;  3VDD B;  4AQ6 A;  4CDX C;  2JB8 A;  5K0U C;  4CCN A;  1YQ5 A;  5I0D A;  5FP3 A;  3ILN A;  3D4K A;  3RJR A;  4URT A;  2WZP P;  3LPF A;  1TE1 B;  3VBH C;  3RZL A;  3PLQ A;  3ETP A;  4NHL A;  1FI2 A;  3I7D A;  1W2T A;  4Y1Z A;  3SQO A;  3BTZ A;  2DU0 A;  1PO1 1;  2PHT A;  1ASJ 3;  1HW5 A;  2D6L X;  2YFU A;  1S0G A;  4KNC A;  5FXW A;  1UW8 A;  5AC9 3;  4FFG A;  1LED A;  4HXC A;  5JSO A;  4HKL A;  4IE5 A;  4MGY E;  3UKT A;  3O1M A;  1QH7 A;  1DQ6 A;  3I59 B;  1N47 A;  3OGJ A;  1HB2 A;  4P14 A;  5LA1 A;  4JX0 A;  1EAH 3;  4HLT A;  2VUA A;  1GQP A;  2YYO A;  2C9K A;  5FP9 A;  1YI9 A;  3UV9 A;  3EBR A;  1GR3 A;  1RMU 1;  4D6R A;  3LFI A;  5LBE A;  3I2O A;  2RM2 3;  1VP6 A;  4XF3 A;  5CFD A;  2DUQ A;  3VZL A;  5K7P A;  2XKP A;  2WZ8 A;  4AHX A;  3GNE A;  3N36 A;  5FO7 B;  4D6Q A;  4BLI A;  4OUM A;  1S2E A;  3LEI A;  3MIB A;  3HIF A;  3ZDS A;  4UFJ A;  4DB5 A;  1OF3 A;  3MIF A;  2P34 A;  3CF6 E;  1QQP 3;  1SPP B;  3MW2 A;  4BLJ A;  2YDE A;  2X05 A;  3MID A;  1VB4 A;  5FLJ A;  4WM7 C;  1MEC 1;  3A0N A;  4XET A;  4D94 A;  4NRQ A;  1URX A;  3JZV A;  2VTF A;  1D4V B;  4Q4W 1;  5C4W C;  1U5Z A;  2AYH A;  4AXO A;  2O8Q A;  3RGB A;  1CVN A;  1LES A;  1QJY 2;  2LRO A;  5D1I A;  5F8P A;  4N53 A;  2B5H A;  1PVC 1;  1R08 3;  2XJT A;  2XWB B;  3LE0 A;  5FZM A;  3S6P A;  2VME A;  3MDP A;  4Q4V 2;  1FXZ A;  1DGR N;  1JW6 A;  3K3O A;  5A3W A;  3M3O A;  4CDW C;  3POE A;  2K46 A;  4P9L A;  3WW2 A;  2R07 3;  5L73 A;  3M2M A;  1N3Q A;  2A3X A;  5FZA A;  2VH9 A;  5J98 B;  2NZ9 A;  4QKN A;  1S2K A;  2ZGU A;  1SLB A;  4MH0 E;  3THC A;  4A44 A;  2B8M A;  4CYD A;  4K7J A;  5IAT A;  4N43 C;  5EYY A;  3BYW A;  2XBO 1;  4HVR A;  2ZGO A;  2EIE A;  3KF3 A;  4FP3 A;  4SBV A;  5F7U A;  4Z2A A;  2PHX A;  5FPU A;  4PIX A;  1ZZ8 A;  2BV4 A;  1V6J A;  1YYN A;  3WR0 A;  2R0F A;  1DF0 A;  3N7L A;  2ZX4 A;  5T54 A;  3HNY M;  4CPB A;  1NXM A;  3ZN6 A;  3C7G A;  2JDA A;  1RUF 1;  2CTV A;  3BCW A;  4P9J A;  4XQD A;  4I01 A;  4CE8 A;  3MUZ 1;  4XMA A;  3JUU A;  4A41 A;  4IGP A;  5B4N A;  1NA1 C;  2UYB A;  1S0E A;  4KBZ A;  4LLF A;  1ASJ 1;  5J37 A;  2XOM A;  5J09 A;  1HLC A;  3QAC A;  1CES A;  4YG6 A;  2O14 A;  4Q1P A;  4RL7 A;  5I0U A;  1J1T A;  2P3J A;  3HT2 A;  3ACG A;  3BIE A;  4CEY C;  1AX0 A;  1GU3 A;  2R04 1;  3HBK A;  3BOD A;  5F37 A;  1O3R A;  1XYN A;  2HEW F;  4IDZ A;  1H9W A;  1P8J A;  4Q29 A;  1W3V A;  3PTR B;  2W1W A;  4MXW A;  4L0P A;  5FUN A;  4DUW A;  1BK1 A;  4NPR A;  3LCP A;  1HXS 2;  4E4Z A;  3DCQ A;  4HSJ A;  4E9K A;  4GJY A;  4MET A;  4QDR A;  1WLW A;  2JX9 A;  3KWV A;  2VVD A;  3INA A;  3IMM A;  3EHK A;  4YLZ A;  5J3U A;  1F4H A;  2CWS A;  4H14 A;  4CXY A;  3KVA A;  2EAL A;  2JEC A;  3N7K A;  1PZ9 A;  1V6N A;  2VAU A;  3K4D A;  2ID4 A;  3I2J A;  3DGT A;  3TN9 3;  5L7O A;  4AZZ A;  5HCH A;  4AFB A;  3C7O A;  3PUQ A;  1PGL 2;  4HOO A;  3W58 A;  1CX4 A;  1OPO A;  1CAV A;  3EB7 A;  4XF0 A;  1SEF A;  2JG9 C;  5EV7 A;  3W20 A;  2HEV F;  2NPI A;  2NMN A;  4BQW A;  4O61 A;  3OJB A;  4Q26 A;  3WEZ A;  2JDY A;  3VZO A;  1G9A A;  1RTV A;  1RUE 3;  1YJL A;  1WMX A;  5HXM A;  4OHX A;  2XWJ B;  3OPZ A;  1OQ1 A;  2QTW B;  2BTV C;  3C2U A;  4NPM A;  4J1X A;  2D3P A;  5FKC A;  4CTE A;  2ZA9 A;  2G4I A;  2E33 A;  2BBV A;  3VBF C;  3VBS C;  4NVP A;  2E6V A;  1EPW A;  3ZXK A;  5IVJ A;  4FQZ A;  1OI6 A;  4B3N A;  5CA6 A;  1PZ7 A;  1TMF 2;  4XZP A;  4AL9 A;  2BRT A;  3IDE A;  3RI9 A;  2R07 1;  5BNN B;  2VBP A;  2DTW A;  3DYP A;  4GB3 1;  4GJZ A;  3OEA A;  4YFZ A;  1JOP A;  4RS5 B;  1CGP A;  2BWC A;  5K0U A;  4FPC A;  1NYW A;  1C28 A;  4H55 A;  4QQP A;  2OUH A;  1PO2 2;  1QDC A;  3UES A;  5JXH A;  3RG0 A;  4LUL A;  4AQS A;  1PK6 B;  1V6L A;  1G9B A;  3VBH A;  3OPW A;  3WUC A;  1RYY A;  1GNY A;  3TBD A;  1PVX A;  3UGH A;  2D44 A;  4FXK B;  1UZV A;  1WCS A;  1YFY A;  2D97 A;  3AZX A;  3KGL A;  1FT9 A;  5E89 A;  1K5M B;  1O8P A;  1R64 A;  2ADE A;  5JVV A;  1ULF A;  2H6C A;  1OH4 A;  3ES4 A;  5F39 A;  5F6K A;  2HLE A;  1RXF A;  1R1Z A;  5F5A A;  3AVS A;  1ZRD A;  4LT5 A;  1RUD 1;  2RS1 3;  1VBA 1;  3J7H A;  4LO6 B;  3OSD A;  3VBR B;  2G9Z A;  1JHN A;  4CP1 A;  4DXT A;  4WM8 B;  1ZRF A;  4GIQ A;  4DRR A;  1HV1 A;  3CL1 A;  3ZYJ B;  3LEM A;  2WSV A;  1QJX 3;  4WVM A;  1W05 A;  2CYF A;  1D2Q A;  1D7P M;  3D82 A;  2A6V A;  4HK8 A;  2RMU 2;  4J1W A;  4L92 A;  5A3U A;  3B7M A;  4LK6 A;  3W21 A;  4DNY A;  1PM4 A;  4YW2 A;  1RHI 3;  4N9I A;  1GAN A;  1W8W A;  2H0B A;  2J42 A;  2OPK A;  3PUA A;  4HT1 T;  4GH4 B;  4LXL A;  4QX7 A;  4WVZ A;  1YLL A;  4XQW A;  3FFQ A;  2CDP A;  3WUD A;  4CU8 A;  5A6Y A;  1CR7 A;  3WNK A;  4ZZ5 A;  2K0G A;  2MEV 3;  4A3Z A;  1JUI A;  1KGY A;  2VEC A;  4IEQ A;  4QD2 A;  1R1A 1;  4NHK A;  4AK3 A;  3AK0 A;  3UKV A;  1H2L A;  4BE3 A;  1KS5 A;  3SEP A;  4CVU A;  4WM7 A;  1GZW A;  1GZ9 A;  2ARC A;  4LE4 A;  1F9K A;  1BBT 3;  1T2X A;  3MV1 1;  1MQT C;  4FPK A;  5C4W A;  4KI5 M;  4NHY A;  2E32 A;  3ZM8 A;  4UW3 A;  1IZ3 A;  2A6X A;  4NOT A;  3ZPY A;  3N7M A;  1ODN A;  1YNA A;  4LTA A;  3O1V A;  5A33 B;  1DZT A;  1YC6 1;  4K8F A;  4PT6 A;  4IND A;  3WDV A;  3GZU C;  3URF A;  2VQT A;  1FOD 2;  3SH4 A;  2YGM A;  4CDW A;  3O1U A;  1DLL A;  1YI7 A;  2N7G A;  4FTE A;  2XLA A;  4CCO A;  1OLQ A;  3CO2 A;  2Q4S A;  2LM3 A;  1Y4W A;  4JGZ C;  1HKD A;  3HMY A;  5K4L A;  2P6H A;  2R0H A;  5DAX A;  3GHM A;  3LDR A;  2CU5 A;  1FV2 A;  4PCR A;  4XIK A;  4FAG A;  4N43 A;  2HWC 2;  2IC1 A;  3I2D A;  3NV1 A;  5IVY A;  3R6S A;  2C4X A;  4CP9 B;  1UXX X;  1RVF 3;  4JV4 A;  4FBF A;  4RGA A;  1NAE A;  5BV6 A;  2HWE 2;  5CFC B;  2IXK A;  3ZXG A;  5IHR A;  3KCX A;  3MF9 A;  2WS9 2;  4CP0 A;  1K42 A;  1OUX A;  3ZSL A;  2XKO A;  2Z79 A;  5DDJ 3;  4QGN A;  1H2N A;  3MGU A;  4FTS A;  3CKH A;  2ZGS A;  1XYP A;  1W90 A;  1V6O A;  1ODM A;  1OVS A;  3C7F A;  2QQW A;  3WF3 A;  1LOG A;  5IK7 A;  1O3Q A;  1JOD A;  4LQR A;  4TTG A;  4LBM A;  5SV5 A;  1X36 A;  2QDN A;  1DYP A;  3HJR A;  3RZZ A;  3T2O A;  3B02 A;  2B46 X;  5FYZ A;  4OHZ A;  4JHT A;  5T5L A;  4BQ5 A;  1NA1 A;  1UU5 A;  4XAA A;  4BQY A;  2J1R A;  2VUJ A;  5A70 A;  2Y26 A;  5C70 A;  2ETE A;  4XXA A;  5FY9 A;  5A3T A;  2ZML A;  4CEY A;  2XPJ A;  2GSY A;  1QOO A;  5C3Q A;  2RS1 1;  3V56 A;  5F2S A;  3OYW A;  1Y9M A;  2YPJ A;  4HFS A;  1OQD A;  3WV6 A;  5EZW A;  3MLL A;  1AR6 3;  3L2Y A;  1DP0 A;  1PIV 1;  3H1Y A;  3H7J A;  5LEK A;  1WLC A;  4FPO B;  1UD1 A;  5KC5 A;  2FD8 A;  1QJX 1;  3BN6 A;  3DXT A;  1RUD 2;  1JYC A;  1VBA 2;  2ARX A;  3HNM A;  3IDA A;  1MZ6 A;  4IEU A;  3UNP A;  3UJQ A;  4CU7 A;  1UPS A;  4RR3 C;  1CAU B;  3MUY 1;  4FFI A;  2VCA A;  1QGL A;  2WZR 1;  4K6B A;  4FPG A;  4N7U A;  1K45 A;  1LR5 A;  4LA3 A;  5GZD A;  1GBG A;  1HIX A;  5JZG C;  4IEX A;  4CSW A;  2YU2 A;  4QX2 A;  3VD9 A;  4FOV A;  4AQT A;  1V6K A;  1VMF A;  2PHD A;  4LIT A;  4BM8 A;  1N1T A;  1POQ A;  2JEN A;  2VG9 A;  2JG9 A;  4AFA A;  1LOA A;  2PQQ A;  4AQ2 A;  5ABJ B;  4D3W A;  3WP3 A;  3E6C C;  1YQ6 A;  4S2G A;  3WDU A;  3H3U A;  2VOX A;  4IE4 A;  1JXN A;  2EIG A;  2DFB A;  2WNE A;  1VBD 2;  3VD3 A;  1BMV 2;  3EQE A;  4XVH A;  5JSP A;  2BW8 A;  1MZ5 A;  4QPI B;  3VBF A;  1G9C A;  4UW5 A;  1HRV 3;  1QOS A;  1BVV A;  2J22 A;  1RUI 3;  5FOB B;  1OPM A;  5FK7 A;  2YBP A;  3ST7 A;  3VBS A;  3CJI B;  2PTM A;  1HRI 3;  2W08 A;  5DAP A;  5T52 A;  3JD7 2;  2JXA A;  2DYC A;  5I91 A;  5A3L A;  4KH9 A;  5LBF A;  2Q0A A;  2K2S A;  4XAB A;  3DXU A;  3O1T A;  1X33 A;  1DGR A;  5CU1 A;  1O59 A;  4NJ4 A;  1VBC 2;  1GSL A;  2IVI B;  3IAP A;  2YRO A;  2WNV B;  4QDQ A;  2ORZ A;  4QHZ A;  4Y1X A;  1ND3 C;  1WA6 X;  2YB7 A;  4UBH A;  3GGL A;  4A3X A;  3AKQ A;  1RVF 1;  1TME 2;  1ZRC A;  4PQQ A;  3POG A;  3PVB B;  1LGN A;  4AOC A;  4GXL A;  1G9F A;  3FN9 A;  2XH6 A;  1ZRI A;  2J1A A;  3RRD A;  5KXD A;  2R6Q A;  3FFZ A;  1HN1 A;  3JCI A;  2E7A A;  1K3I A;  2HWF 2;  2F6B A;  1UOB A;  2HWB 3;  4Y1U A;  1UYP A;  1GV9 A;  2RHP A;  5CKN A;  4NPL A;  5LRR A;  5G05 L;  3N4M A;  1B35 C;  2C5D A;  1VIW B;  2NYY A;  4NRM A;  3GYD A;  3D3A A;  1XE7 A;  4P5H A;  3KZ4 C;  5FYB A;  2QVS B;  1W9Y A;  5E6H A;  4AFC A;  5FOJ B;  2P3K A;  2Y6K A;  5AVP A;  4BYY A;  2WC2 A;  5FPA A;  1QNY A;  1QOT A;  4M01 A;  2VPV A;  4ZU5 A;  1E57 A;  3D6E A;  4W65 A;  2Q8O A;  5FPB A;  2ZPX A;  2YMZ A;  2DCK A;  2WNO A;  3HWJ A;  2FCV A;  3OCP A;  3KT1 A;  1HN0 A;  3T2Q A;  3AP5 A;  1DG6 A;  1RUO A;  2EXK A;  4BIS A;  3LSE A;  3KV4 A;  4BWO A;  4FAH A;  2B45 X;  4I0B A;  3MLJ A;  1LAJ A;  2WR9 A;  4XBL A;  4Q4Y 3;  2O0O A;  1G9D A;  1MS9 A;  3ACF A;  2AC1 A;  2IXH A;  2W0X A;  3U14 A;  3B5L B;  2WUH A;  4MGZ E;  4RN5 A;  5FZF A;  2XVL A;  4UFM A;  1PMI A;  2UY9 A;  4ET7 A;  2EAK A;  1XBF A;  3BTA A;  3F2Z A;  3RI8 A;  3DV8 A;  1H2K A;  3THT A;  4RQP C;  5C3P A;  1MZE A;  4GQ7 A;  3OBA A;  5EJ3 A;  1DZQ A;  3WLU A;  2IXI A;  2WA3 A;  2CSG A;  2QQP A;  5FYI A;  2WQ4 A;  3LIH A;  3H0O A;  1QXR A;  4MHU A;  1MQT A;  5FZD A;  2D6P A;  1L7Q A;  3N9P A;  2RS5 1;  5FZ9 A;  1NCQ C;  1YO8 A;  1F15 A;  3FX3 A;  4WBB A;  2BNM A;  1JZ7 A;  4QMA A;  3LPG A;  1CON A;  1O6U A;  1W6P B;  4O7X A;  4Y20 A;  5FFO C;  3OD0 A;  2XQX A;  5KR7 A;  2JKB A;  4QT6 A;  2Y0O A;  3KF5 A;  4KGQ A;  4TSV A;  1F2N A;  5FK8 A;  4G4F A;  5FPL A;  3RSJ A;  3E5U A;  3VBU B;  2X53 S;  4JGZ A;  4BU2 A;  2A75 A;  4JDO A;  2VZO A;  4AI2 A;  4FPE A;  2D43 A;  2PHW A;  4XUT A;  1HRV 1;  2AAC A;  2VJX A;  2YY1 A;  3ZMN A;  2GN3 A;  3V0A B;  2G1M A;  2XVG A;  1W8O A;  1HRI 1;  1JI6 A;  2WQZ C;  3MW4 A;  3PTY A;  4XUP A;  2VVE A;  2MHF A;  2BOI A;  2R06 2;  4ZS2 A;  5H9P A;  3J7L A;  2QQO A;  2E9Q A;  2GAL A;  1GOH A;  4YVS C;  1UMZ A;  3SEE A;  4AI0 A;  4ERO A;  2P5B A;  4BMB A;  1TQ5 A;  1XC6 A;  2XML A;  1CIW A;  3JBG 3;  4GZ9 A;  1IHM A;  4CDU C;  3L2H A;  5BNP B;  3BTY A;  3IMN A;  2OZ6 A;  3OBZ A;  4I3G A;  4Q4V 3;  4QQH A;  4XF9 A;  1JYX A;  1JYT A;  4AVA A;  2VZQ A;  2AEN A;  1O4T A;  3I54 A;  3GM8 A;  4Q4X 1;  4DZG A;  5DZG A;  1UAI A;  5I0S A;  5D8A C;  2CGN A;  4FXG B;  2ZAH A;  2OPW A;  4XAE A;  4PLO A;  4UOJ A;  2WT2 A;  2RS3 1;  4UF0 B;  4BK4 A;  1W6Q B;  4IEY A;  2ARE A;  1BYH A;  2JDP A;  2HWB 1;  3UKN A;  4DXS A;  1XQN A;  2ZAA A;  1MVE A;  2PHF A;  4CCJ A;  2P3I A;  3IN9 A;  1H6Y A;  1MAC A;  5F9T A;  4LJH A;  5FP4 A;  5G04 L;  3TRS B;  3U0Z A;  5C5U A;  3TEW A;  4LPL A;  3V0B B;  1NZI A;  3O1S A;  1UU4 A;  3ZYB A;  3AXE A;  4XFI A;  4MGI E;  1YJK A;  2DCJ A;  2WNU B;  4ZY9 A;  4JHZ A;  1D4M 2;  2OVU A;  4LOR A;  1Q5O A;  4UW6 A;  3MZH A;  1C4R A;  4PLM A;  3MF6 A;  4RR3 A;  3HEI A;  1WLT A;  3MIE A;  1FAY A;  3KQ4 B;  1XNB A;  3OUH A;  5E1R A;  5FYC A;  4DIQ A;  1UOF A;  1X8E A;  1NG0 A;  5D21 A;  3VKF C;  5DAV A;  4GKX A;  5JZG A;  1ENS A;  4XE9 A;  3GDB A;  4QPG B;  1RUC 1;  3NJY A;  3RVH A;  1TG7 A;  2WO3 A;  3PVO A;  4BJ0 A;  3KSC A;  2VCB A;  3O1R A;  1RL3 A;  2CL2 A;  1UF2 C;  2YC0 A;  5A7Q A;  4YVW C;  1GQH A;  3KQR A;  3EMR A;  4UW4 A;  4XYX A;  3ZYP A;  2Y33 A;  5A3O A;  3J8F 2;  4PLN A;  3WDW A;  5I93 A;  1DQ0 A;  1OHF A;  1QKQ A;  1Z78 A;  4XFC A;  4W8J A;  5LA0 A;  1PO1 3;  4AAP A;  1UYZ A;  4N7I A;  2UU8 A;  1F35 A;  1EP0 A;  2L9L A;  5GM0 A;  3ZFG B;  2PHR A;  4MX3 A;  3DN7 A;  3I3Q A;  4AFD A;  3WDY A;  5L9R A;  2W1S A;  2Y34 A;  5C5T A;  1XJA A;  1BXH A;  2BNO A;  1BJQ A;  1CJP A;  4LBQ A;  2RS5 2;  2VMI A;  3SNM A;  1T6G C;  3MO4 A;  2WFF 2;  4NE9 A;  3OB8 A;  3T3Y A;  4RD7 A;  1RMU 3;  4B29 A;  1H4H A;  1ULD A;  2XJR A;  3B3Q E;  5C9A B;  4KWK A;  2OW4 A;  4W6Y A;  2ZAB A;  3R4U A;  4MGQ A;  4QX1 A;  2YPD A;  3HR9 A;  1CPN A;  2BOJ A;  1PMH X;  2AEZ A;  5LWB A;  1ND3 A;  2FDJ A;  2X8K A;  4M00 A;  2QQI A;  2WFP A;  1DCS A;  2QDR A;  5DPN A;  3Q9O A;  5CB7 A;  2D98 A;  3BPS A;  1H0B A;  3P3N A;  3ZXE A;  5LCW L;  3PUR A;  1V0A A;  4COZ A;  1OOP B;  5JAX A;  3POY A;  1ULE A;  5DZE A;  5JI9 A;  1AR8 2;  2QQJ A;  1C8M 2;  2BVB A;  2ZGR A;  5FZ3 A;  5GLW A;  2VMG A;  1CN1 A;  2D6O X;  1QJY 1;  1Q8O A;  4A2U A;  5FY0 A;  1PM7 A;  4OI0 A;  2W52 A;  2PMW B;  1B35 A;  2EXI A;  4ZS3 A;  3QCW A;  1NZC A;  2WAB A;  2BDR A;  2RJL A;  3BPZ A;  1PX3 A;  5FZ8 A;  4HVO A;  3GJA A;  2WQ8 A;  2GNM A;  4QM9 A;  1W8U A;  1ZNP A;  5T55 A;  2LTN A;  1PVC 3;  3PJQ A;  2FDI A;  2OYZ A;  3H8R A;  1PX4 A;  1XU1 A;  3G6J B;  2QQM A;  1YFX A;  4J25 A;  1I5Z A;  5C8C C;  1HX6 A;  4M3C B;  3CBN A;  1PO2 3;  2VUL A;  4Y3O A;  1JTZ X;  4BIF A;  1UYX A;  2XJU A;  2DDU A;  2GNT A;  2ZCW A;  3TAY A;  2BYV E;  2RS3 2;  4OCT A;  1G8W A;  2B4K A;  4QQO A;  4RS5 C;  3S57 A;  4MLO A;  5FAX A;  3WVJ A;  2VW1 A;  1UO9 A;  4RQP A;  5FLH A;  4CPB D;  1C3H A;  5EWS A;  1N1Y A;  1PK6 C;  1W6O A;  4CEW C;  2NMO A;  1AR9 1;  4LO8 A;  5F5C A;  3J4U H;  1QJZ A;  4JRL A;  4YZ2 A;  5B2G B;  4GMP 3;  3KVB A;  4QPW A;  4UAP A;  3KGZ A;  1NCQ A;  3LFM A;  3CMG A;  5KHK A;  1H30 A;  1IQD C;  1NCR C;  2P1B A;  4S2F A;  4BOW A;  4CCD A;  3AKP A;  4HBN A;  2OQ6 A;  4ZPI A;  4DOU A;  1W6N A;  4BCU A;  3HQR A;  1H8T B;  4QXK A;  4UBG A;  1RUF 3;  3NL1 A;  5FZB A;  2RMU 3;  2XXZ A;  4AAX A;  2VOK A;  1RUC 2;  2KD7 A;  3VHO A;  3PHM A;  1OT5 A;  3OD4 A;  4UI9 L;  1W06 A;  3CIH A;  5LK7 B;  1SLI A;  4COU A;  3LB9 A;  5FYH A;  5HCF A;  3KT4 A;  4GKY A;  4IEO A;  2W87 A;  1O5U A;  3NST A;  5JWP A;  4TYS A;  1ENX A;  3V65 A;  3BU7 A;  3WNL A;  4Z1V A;  4QWN A;  3HBZ A;  1JUH A;  3O5S A;  2R04 3;  1HXS 1;  1ZZC A;  3VL9 A;  5KHH A;  4FTB A;  4B1M A;  4IV3 B;  1PNG A;  4OHW A;  4XXP A;  1X7N A;  2FBE A;  2FQP A;  2D93 A;  1JZ8 A;  4IQP A;  3DYM A;  4XIL A;  3WW1 A;  4YVS A;  3ZX7 A;  5FQ0 A;  3GZA A;  1UXZ A;  2F4P A;  1UY4 A;  2XL7 A;  1VAM A;  4YGE A;  3TEZ A;  1S0I A;  3B01 A;  1PGL 1;  5EHD A;  4YGD A;  4ASM B;  4BPZ A;  4CDU A;  4XFH A;  3ZIW A;  3USU A;  2A6W A;  2Q1F A;  5JI7 A;  4GWJ A;  2IFW A;  5IVE A;  5A7S A;  1UWW A;  3CZJ A;  5FMO L;  3ZYR A;  1VLN A;  3B9I A;  4Q0P A;  1LTE A;  3DPR C;  2Q5T A;  2ZX1 A;  5FYT A;  3RPQ A;  1LEM A;  3LA7 A;  1LJ7 A;  1WCD J;  1OQE A;  3WNO A;  2FZ1 A;  1S0J A;  5D8A A;  5DUU A;  3TEY A;  3III A;  1KFX L;  1MS1 A;  3VBO C;  4R4X A;  1DYK A;  2JE8 A;  3A22 A;  3WT3 A;  1UOG A;  4IV1 A;  2DF7 A;  2NQY A;  1MS0 A;  1WW5 A;  5ACA 2;  5IVC A;  5IW0 A;  3K46 A;  3KS7 A;  2KM2 A;  1AR7 2;  4YRD A;  1FNY A;  2A5Z A;  5FZH A;  4M3C F;  4YAR A;  1DHK B;  4R9A A;  2FDF A;  2DBN A;  1TMF 1;  4XOG A;  3D0J A;  2HWE 3;  1WKY A;  4XDP A;  2WYF A;  1OVP A;  2WS9 3;  4ZKT B;  1PNF A;  1A6C A;  5BY5 A;  2VE1 A;  5JXI A;  4G3Y C;  4YNI A;  4AF9 A;  4E4D X;  1C8N A;  2VOV A;  1DFQ A;  1PO2 1;  2MNG A;  4EWA A;  5CFD B;  4UFK A;  2EAA A;  4GB3 3;  5I8Y A;  3NNF A;  2XB6 C;  3ZFE C;  5FKB A;  4G9S B;  2BER A;  2R49 A;  3AYD A;  1Q8P A;  1H9P A;  4YVW A;  3FHA A;  3AJY A;  4XFB A;  2PHL A;  1RJ7 A;  3K77 A;  3VKL A;  3RZK A;  1QEX A;  3ZSJ A;  2I74 A;  4RA0 A;  1LCL A;  4GMP 1;  4QHO A;  1F5J A;  1RUJ 2;  1UCX A;  4L9B A;  2J1E A;  5JSR A;  5LBC A;  5EJZ B;  1H8V A;  5IAX A;  1AR9 2;  4Z2W A;  4LHK A;  1IS4 A;  5EYX A;  1RUD 3;  1VBA 3;  3DEM A;  4QAW A;  4N53 B;  4LUM A;  4XF4 A;  3AVR A;  1BVP 1;  2G9G A;  2RMU 1;  4NIG A;  5FYY A;  1N3O A;  3JQX A;  1OLR A;  5C33 A;  1IS5 A;  3NKT A;  3AZY A;  1GWK A;  4IL7 A;  1DQ1 A;  4JGY C;  5KBF A;  5LY1 A;  4P5Y A;  1DQ2 A;  4Q0Q A;  1SLC A;  2DUR A;  5DAQ A;  4FFH A;  4XW3 A;  1XXN A;  4IXL A;  4A6O A;  1SCR A;  1FPN 1;  3PU3 A;  1SLT A;  3HVD A;  4V2V A;  4N8M A;  4HG6 B;  2RR1 2;  1R1A 3;  2CAU A;  4QU2 A;  5IFT A;  3N7J A;  1PZ8 A;  3POF A;  4F83 A;  2C26 A;  4BHP A;  1FAT A;  1IKQ A;  3NO8 A;  2E63 A;  1JHJ A;  1VAK A;  2Y0I A;  3ROU A;  1ULC A;  4JTO A;  5GAL A;  3GCW A;  4PF1 A;  2QQK A;  1FOD 1;  4K21 A;  3ZN6 B;  4HET A;  3QH7 A;  5A6Z A;  4E8C A;  5LAT A;  4OQ8 A;  1JMU B;  2ZEZ A;  4V1P A;  4XHX A;  2BGO A;  2DVB A;  2WN3 A;  2ZGN A;  1YCI A;  1T6B X;  1KDK A;  2A7A A;  4K1Y A;  1VBC 3;  2YXS A;  3EJK A;  2I45 A;  3G7D A;  4IEW A;  5DUX A;  3VLB B;  5C8C A;  1NE4 A;  1WZX A;  2HWC 1;  3BB6 A;  3FUO A;  4QXH A;  3ZXD A;  5JLV A;  1KFU L;  3IDB B;  4FFF A;  5SV8 A;  3M3Q A;  3M3E A;  2HWE 1;  3AXD A;  4PDW C;  1POV 3;  4P9W A;  1ACC A;  3R05 A;  2WS9 1;  1OBN A;  2WNV C;  3A0K A;  3N9N A;  4FPH A;  4L97 A;  4XF1 A;  3LKJ A;  5FPV A;  4QB2 A;  4MXW B;  5CG8 A;  4CEW A;  4I30 A;  2TNF A;  3RQ0 A;  1STM A;  2IWG B;  2WII B;  4LNV A;  3TEX A;  2Z4F A;  2VZ1 A;  4XUN A;  3ME2 A;  4PBP A;  2ZKN A;  3A23 A;  2Z5W A;  1LHV A;  2IXL A;  3SXW A;  4CDX A;  4CCE A;  4ZXK A;  5K9Y A;  1NCR A;  3FUQ A;  3E1F 1;  1W8N A;  4C90 A;  2VZ3 A;  5L7O B;  3RZJ A;  4LBL A;  4IE7 A;  1AL2 2;  1KJL A;  2R30 A;  3AMN A;  4UXA A;  1J3P A;  1CAV B;  3Q8B A;  2PAE A;  2D3S A;  2VZP A;  4WZC A;  3ZXA C;  3VKO A;  2HYK A;  4C1X A;  3VHN A;  4AEK A;  5CIR A;  1O91 A;  2W68 A;  4MV2 A;  4DUX A;  1ULO A;  2RJK A;  4TLG A;  4UWD A;  1NY7 2;  5CNA A;  1ZRE A;  3AKS A;  3K4A A;  4XJZ A;  2CGO A;  2OZJ A;  3JQW A;  2ZHK A;  3LWC A;  2FDG A;  2TBV A;  5DAB A;  1LHW A;  4JVA A;  1OKQ A;  5IVB A;  3W59 A;  2XHN A;  3ZXJ A;  1K5J A;  1ZZB A;  2W91 A;  4GMP 0;  4NMI A;  1PIV 3;  1U12 A;  2H6B A;  2RVA A;  5J7M A;  3RZM A;  3BVC A;  1MS5 A;  3RZG A;  1HQL A;  1FX5 A;  1LHN A;  2W94 A;  2V5D A;  2GN7 A;  3M70 A;  4NR1 A;  3UT0 A;  4YG3 A;  3ZFF C;  3ZN4 A;  4EN6 B;  3A7Q A;  5JMO A;  1WW6 A;  2W39 A;  1MVQ A;  3FLT A;  4OYU A;  2WZR 3;  4DEQ A;  1AYN 2;  5K0U B;  1VPH A;  4Y5T A;  3OY8 A;  5IWF A;  2JE7 A;  5CAZ A;  3ENR A;  1GFF 2;  3DPR A;  3WY6 A;  2VMF A;  4EWE A;  2WO7 A;  3AFK A;  4R4Z A;  3VBH B;  4GWN A;  2RDN A;  3I49 A;  4Y5Z 0;  2W46 A;  4BIO A;  1UU6 A;  1AUY A;  1UMH A;  1VBD 1;  2ARB A;  4KGG A;  2OQ7 A;  4L2N A;  3VBO A;  5A6X A;  1BMV 1;  2F17 A;  1FPN 2;  2WZE A;  1ONA A;  1FV3 A;  3VN4 A;  1EPZ A;  3LQC A;  3KV6 A;  4P9X A;  2LUW A;  3JD7 1;  5HPO A;  2BWA A;  5EFU A;  3E97 A;  2FDK A;  3QBQ A;  4YW4 A;  5BNO C;  4Y1Y A;  1Q8V A;  4WVW A;  4B7K A;  1QDO A;  1XU2 A;  5AC9 2;  4AGR A;  3HT1 A;  4AGV A;  4LEJ A;  1GP5 A;  3WG3 A;  1VBC 1;  5GLT A;  5HCB A;  2X10 A;  3OGV A;  4WVM B;  2ZMN A;  3VKN A;  4K3U A;  2BZD A;  4AWD A;  4EZH A;  4MAD A;  2Y64 A;  1QF3 A;  2ZZQ A;  4EZ4 A;  4DXZ A;  1EAH 2;  1TME 1;  2D6K A;  2VUD A;  2ZS6 B;  1G86 A;  3H3Z A;  3LA2 A;  1POV 1;  1YIP A;  3UGF A;  1YFU A;  3U1X A;  1WCQ A;  3A4U A;  4FPY A;  4AE2 A;  1JU4 A;  1W9T A;  2WN2 A;  2RM2 2;  1LOE A;  3C8X A;  2VNR A;  1RGS A;  4D7S A;  2MPF A;  5F3C A;  3FHI B;  2AR6 A;  1CPM A;  2HWF 1;  2XON A;  3SC7 X;  4ITC A;  3UET A;  4LBJ A;  5M0T A;  4PBO A;  4WM7 B;  1GZW B;  2P4E A;  1ND2 C;  2YUE A;  4XDQ A;  4EN7 B;  3M8L A;  4D7Y A;  1ZYB A;  2VL4 A;  1LU1 A;  1UX6 A;  2ZHL A;  3I2H A;  4JC1 A;  4MXV A;  1JH5 A;  3T09 A;  3NAP C;  5C4W B;  1QQP 2;  3M1H A;  4YZ1 A;  1AXY A;  5ISL A;  1WBF A;  1QH6 A;  2R7E B;  1OFN A;  1GOF A;  4Y22 A;  4Y5S A;  1D4M 3;  1W39 A;  3P3P A;  3WQ0 A;  4ZU7 A;  1S0B A;  2O1Q A;  3DF0 A;  5FBZ A;  2JE9 A;  1W99 A;  5FY7 A;  1RJ8 A;  3Q8C A;  1UKG A;  3FBM A;  4CDW B;  1NOV A;  5HV4 A;  1HB4 A;  1NX9 A;  4YGC A;  4JGY A;  1D0G A;  4BQ1 A;  1R08 2;  4E2G A;  1A78 A;  1GNZ A;  5C6C A;  3GBW A;  1XND A;  2VXJ A;  1WA4 A;  3IIA A;  2BFU S;  1IOA A;  1WME A;  4LKF A;  4YGB A;  2EIC A;  1LUL A;  4N43 B;  1H1A A;  4C0H A;  1KXG A;  3J8F 3;  1B09 A;  1WCK A;  4GD4 A;  1VAL A;  3OOX A;  5LK5 A;  2XJS A;  4AED C;  3AFG A;  2YGL A;  3JXS A;  3HN1 A;  2VZV A;  4Z07 A;  5A7O A;  1NE6 A;  1JS9 A;  1I9R A;  4AHY A;  1SLL A;  1IPS A;  2ZAC A;  3J7N A;  1OFS A;  4AI8 A;  2G9F A;  2RS5 3;  4BA6 A;  3AJZ A;  2JG8 C;  2WFF 3;  3B93 A;  3U07 A;  3ZDV A;  2DVF A;  5JR7 B;  1LOF C;  3JB8 A;  2OA2 A;  1ULP A;  3ACL A;  5JOZ A;  5E88 A;  3ECQ A;  1XNK A;  2FMD A;  4ONU A;  4QX0 A;  1NA1 B;  2VTX J;  4YW6 A;  3ZIX A;  4OHY A;  2WA4 A;  3UK9 A;  2F4L A;  2DCY A;  5FJK A;  3O7O A; 
#chains in the Genus database with same CATH homology
 4Y5T A;  5LA9 A;  5LAS A;  3GJB A;  5EQU A;  5C5U A;  2G19 A;  2RDN A;  5DAX A;  5LBE A;  4ZPI A;  5DAW A;  5EPA A;  3W20 A;  3HQR A;  2RDQ A;  2JIJ A;  4XCB A;  4BQW A;  3PL0 A;  5DAQ A;  2HBT A;  3OUH A;  4ZON A;  5DAV A;  3KT4 A;  3OUI A;  3HQU A;  3MGU A;  2FCV A;  3KT1 A;  5HV0 A;  3EMR A;  2Y33 A;  5LB6 A;  2V4A A;  4XCA A;  4XAC A;  4XAA A;  4BQY A;  5LAT A;  4XC9 A;  2FCT A;  5L9R A;  2Y34 A;  4IW3 A;  5C5T A;  4JZR A;  5LBB A;  4MHU A;  2HBU A;  5M0T A;  5L9B A;  5EP9 A;  5IAT A;  4Y5S A;  3GZE A;  4NAO A;  2RDS A;  3NNL A;  3ITQ A;  5HV4 A;  3NNJ A;  2RDR A;  2A1X A;  2G1M A;  5A3U A;  3DKQ A;  3W21 A;  5IAV A;  4NHX A;  2FCU A;  5L9V A;  2RG4 A;  3NNF A;  3GJA A;  5ERL A;  4Q5O A;  4KBZ A;  4UWD A;  4NHK A;  4J25 A;  4BQX A;  5DAP A;  3OBZ A;  3OUJ A;  5LBF A;  4MHR A;  4NMI A;  4NHL A;  4XAB A;  4NHY A;  3BVC A;  5LBC A;  2JIG A;  3KT7 A;  5IAX A;  2OPW A;  4NHM A;  3NNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...