1UKGA

Pterocarps angolensis lectin pal in complex with methyl-alpha-mannose
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
240
structure length
240
Chain Sequence
EDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSPLSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPGTAQNTSANQVIAVEFDTFYAQDSNTWDPNYPHIGIDVNSIRSVKTVKWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords lectin
publication title Structural Basis of Oligomannose Recognition by the Pterocarpus angolensis Seed Lectin
pubmed doi rcsb
total genus 51
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ukgA00
4GALA 1DGLA 1G9BA 1YRZA 3VV1A 1NXD1 2LALA 4M00A 3ZXLA 3OJBA 1GZWB 1PZ9A 2CL2A 2WLQA 3INAA 2GN7A 1SBFA 3O12A 5GZDA 5HCFA 3PJQA 1AX0A 1JHNA 1YYNA 1JBCA 2DTYA 4XTMA 3ZXEA 2DVAA 4GKXA 2ZGLA 1EPWA 2A6ZA 5KXBA 3WHUA 1N3OA 2YXSA 2YZ4A 2GNBA 3D6EA 3OYWB 2WSVA 1AJOA 1WW4A 2DURA 1WUVA 2P3KA 4YLZA 1WBFA 1IS5A 1YI7A 2PHFA 2ENRA 5T55A 4BPZA 3VKOA 2R1DA 3V64A 5JLVA 1SLCA 2P34A 2ZGKA 4AGVA 1Q8VA 4Y24A 2P3JA 3RS6A 1BQPA 3RQ0A 2OUJA 5GLWA 1AJKA 1V6LA 3UJOA 3WG2A 3V0BB 3AZWA 1DBNA 2A6WA 3M3QA 5CNAA 4C1XA 4TZDA 4LBLA 1KITA 2DWRA 5DUVA 2JKBA 2AR6A 3WG1A 2YV8A 4HL0A 3OY8B 4M3CB 3SLIA 3WUDA 3MPPG 4UW4A 3FUOA 3AP7A 3FBYA 2VH9A 1LHOA 2AYHA 4XDQA 3W59A 1H9WA 2GN3A 2DVBA 3M3OA 2JD4A 2UU8A 2NP0A 4M3CE 1N3PA 4CRQA 4Y22A 3T2TA 1QGLA 3M1HA 3O5SA 3RSJA 1Y7BA 1ULDA 1W0PA 1YIFA 2A5ZA 2EIGA 1CVNA 1LOAA 2R1BA 4LBKA 4Y1ZA 2PHUA 1Q8SA 5CB7A 1HKDA 2EF6A 3AX4A 3ENRA 1V6MA 4PQ9A 1FV3A 1N1TA 4YFZA 4BQ1A 2D3RA 3B9CA 4PBOA 4I30A 2W39A 1ULFA 1QMJA 1W6NA 2YY1A 5JVVA 5HCAA 2H0BA 2ZHNA 2ZZJA 4IQPA 3WCSA 5IK4A 4FPKA 4FOVA 3SH5A 1MS3A 3GALA 3N7MA 3ZSJA 1IOAA 2AREA 2DVGA 2ZABA 2XB6C 1X50A 5F9TA 1LOBA 1CPMA 1W0OA 2OW4A 1UMZA 3BIWE 1MR5A 3W58A 3JUUA 3ZSKA 2ZGMA 2GMPA 4W65A 4Y20B 2DVFA 3AP4A 2E7QA 1DHKB 1PZ7A 3CNAA 4XJ8A 4FVVA 2P3IA 5DUXA 3N7LA 1B09A 3AZVA 1S0CA 4P9YA 2I2SA 2WT1A 4ZKTB 3ASIA 3D4KA 2WNEA 1ENQA 3R4UA 1GICA 2DU1A 4Q1PA 2E51A 4YGBA 3BOPA 3B01A 2A6YA 1WD3A 3ZSLA 3V0AB 3WCRA 2NYYA 2PHTA 1FYUA 1CR7A 1FX5A 5DZGA 1H30A 2YROA 1WLCA 1MS5A 3BODA 2R0FA 3O0WA 3ZVXA 3SH4A 4YZ3A 3AYAA 1S0IA 5EYXA 5T5OA 1S0FA 1A8DA 2ZGOA 3C2UA 4WV8A 4D69A 5T5LA 1LEMA 4XHXA 2JE9A 2C5DA 3FUQA 1GZWA 5HCBA 5FREA 2JECA 3AXEA 1SCSA 3ZXFA 1F9KA 2ZHLA 4TYSA 3A4UA 4WVWA 1KRIA 3VKLA 5H9QA 2ZGSA 5EYYA 2DU0A 2NMNA 5DG1A 4FPYA 2D43A 1V00A 2DVDA 1MS8A 2ZHMA 3HR9A 1LOFC 1S0BA 4WZFA 3VKMA 1YXWA 4BLIA 5H9SA 4DFSA 4Q8KA 3SITA 4YGEA 1DFQA 3LSEA 3QCWA 4K21A 3TB0A 3AYCA 2ZMNA 3N36A 4LBQB 1LENA 1XQNA 1R1ZA 2VU9A 4WVVA 4XMIA 4FOQA 2WJSA 2ARBA 1KJRA 4YM3A 1IS6A 2EXHA 4ITCA 3BTAA 3VKNA 2D6PA 2DTWA 4ISRA 3ATGA 1HLCA 1KQRA 4FQ4A 4YG6A 2VW0A 3NWKA 4XJAA 1GSLA 1WLWA 1MVQA 1DZQA 1IS3A 4Y26A 3ZXKA 2WT0A 1G86A 3M3EA 4LBJA 3NV4A 1DQ2A 2BQPA 2ZBJA 3AP6A 4GKYA 5GLTA 2R0HA 2FMDA 5GM0A 1LHWA 2GDFA 2ZGQA 3B00A 1D0HA 1UL9A 1DYKA 4DRRA 2D44A 4XIKA 5EWSA 1AXZA 2DV9A 2ZGPA 1LGBA 1JW6A 2GMMA 2NN8A 4ATEA 2FHRA 4CTEA 1GNZA 5GJ6A 2OUHA 4XE9A 4P9XA 1W6QB 1LESA 4LBQD 1LHNA 4Q1RA 2E7TA 3PMEA 4LBOA 1AF9A 1SLAA 3AJYA 1LU1A 2D7FA 1SLTA 5EXOA 4BOWA 1LECA 1S0GA 4AVSA 1LTEA 1DQ4A 3PVEA 4FPEA 1VALA 1LGNA 2B7YA 1WW5A 1IS4A 3O0XA 3POYA 1QKQA 4FPFA 4DPNA 2NM1A 1LJ7A 2A71A 4C1WA 1MS0A 3DUIA 5GZFA 5JOYA 2JJ6A 1GLHA 1I3HA 1TEIA 1UX6A 4K1ZA 4L8QA 3AP5A 3MW3A 4XJ9A 4AYUA 2GNMA 2W68A 4XOGA 4Y1VA 1LHUA 2W08A 3V65A 1Z0HA 4Y20A 2D6OX 4GWMA 3KM5A 3WLUA 4ISQA 4M3CF 4UW5A 2VW1A 1A3KA 1F31A 5E89A 1A78A 1DQ0A 1GZ9A 1LGCA 1ULCA 4XIOA 3WHTA 1SLBA 3WVJA 3R4SA 2KM2A 1W6OB 4BMEA 2DUQA 1V6NA 3AZXA 1C57A 5DUWA 5H9PA 4CZSA 2PHRA 2D3SA 1OKQA 4KBBA 4YZ1A 1UPSA 1DIWA 4RL7A 2UWBA 2UWCA 4FP2A 4FPOB 4YZ2A 2NMOA 1RIRA 3USUB 3MEPA 1AVBA 1AXYA 1W6PB 4XXAA 2LTNA 2C9AA 1CQ9A 1V6IA 2NZ9A 3FLPA 5IT6A 3SH3A 4YZ5A 3AJZA 2ZMKA 1LOGA 3IN9A 1LHVA 4F83A 2A7AA 2ARXA 1JUIA 2HYKA 3KQRA 4BLJA 1F5FA 1FAYA 4Y1XA 1QU0A 4R9CA 5GZEA 3NV1A 1VAMA 4HANA 5T5PA 2P37A 1WW6A 3AZZA 1WD4A 2A3YA 3MW4A 1SBDA 1U0AA 4M01A 1C4RA 4NOTA 3WDXA 4PBPA 1AZDA 1AXKA 4MYEA 4YW5A 2TEPA 5DXDA 3N35A 4XJWA 1CPNA 1OQ1A 4XJUA 4LBQA 4Z8BA 1MS9A 2R16A 4DQAA 3H0OA 1QF3A 2AH2A 4K1YA 4YM2A 1HQLA 2V73A 3O0VA 5GLUA 4P14A 3B69A 2CYFA 4YW4A 2ZACA 2UWAA 1LODA 1DQ1A 1QOOA 3HN1A 3AZYA 1GANA 3OYWA 5E8AA 1AX1A 3RRDA 5LK5A 1N1YA 1KDMA 3B3QE 4U36A 4AWDA 1I1EA 3OBTA 1J1TA 1G7YA 1VLNA 2D6NA 3ILRA 3I4IA 2CWSA 5DG2A 1G9DA 4FOWA 2DUPA 5SV8A 5T50A 5JOZA 1V6KA 1CONA 1JYIA 1Q8OA 4FPHA 1LULA 3A0NA 3ILNA 5DZEA 5GLVA 4Q2FA 5CAZA 3ZXJA 1Q56A 2A6XA 4XMAA 4AVTA 5GZCA 3V0BA 1QDCA 2WSUA 1BKZA 1G9FA 2JDZA 3MW2A 4Q27A 3POSA 2ES3A 5AVAA 1QOTA 4YM1A 4JRAA 4FPLA 3R05A 2OVUA 4PF5A 1MVEA 3N3HA 1ONAA 3OBRA 3WV6A 1CJPA 5F5QA 3T1LA 1GYKA 3OY8A 4M3CA 1LU2A 1V6JA 4XBLA 4XJZA 4NO4A 5JOWA 3A0KA 2G4IA 3IMNA 3M3CA 3SISA 4DS0A 3L2YA 1LEDA 2SLIA 1YO8A 3VUOA 4P9WA 4YW3A 5GALA 1UKGA 4R9BA 1RINA 4ZXKA 2YMZA 1CIWA 2CTVA 3DGTA 3IPVB 2JE7A 1JN2P 3WDTA 3WG3A 1BZWA 3AP9A 4RA0A 1JXNA 4FOYA 1S0JA 3AK0A 1W6MB 2A6VA 2AENA 1ENRA 2EALA 1G9CA 2ZA9A 5JDBA 1S0EA 5IK7A 4GA9A 4PCRA 4GXLA 3RMXA 3D5OA 2WT2A 1JYCA 1RITA 2DYCA 2R49A 1SBEA 3LCPA 1LCLA 3VKFC 1SLIA 2PELA 1W6OA 4K20A 1QOSA 2ZGUA 5IK5A 2VY0A 3AXDA 4OZXA 3WUCA 1QNWA 2P2KA 2ZGRA 3IM0A 1O4ZA 1Q8QA 2CY6A 2E53A 1ENSA 4R9AA 4Q8LA 1JOJA 3USUA 1APNA 3Q9OA 2AGSA 1FNYA 1QNYA 1W6PA 2CWMA 4YGDA 4DRVA 2A75A 5E88A 5KXCA 1GKBA 1S1AA 5GLZA 1MZ6A 2EXKA 4GWNA 5JMCA 1GBGA 1VIWB 3OGGA 4JCKA 2Z42A 1FATA 4AGGA 5FRAA 3ZYPA 3OPZA 4XZPA 2PHXA 1KJLA 1V6OA 4JC1A 5T52A 3UJQA 3N7KA 4FP3A 1KDKA 3RMYA 1URXA 2PHWA 3APBA 4LBNA 2D6MA 3V0AA 3FFZA 1MS1A 4FQZA 2ZKNA 4FPJA 3PVOA 3AYEA 4XHBA 4XYXA 4UW3A 2WQZC 3ZPYA 2EXJA 4FPCA 1DQ6A 1WBLA 5IUQA 3UL2A 4U2AA 3N7JA 3M2MA 1ZA4A 4YFWA 2ZGTA 1WW7A 2A70A 2VUAA 3T1MA 2ZAAA 1G9AA 2ZMLA 2EXIA 4XBNA 4YGCA 1BXHA 2XG3A 1LOCA 2GMEA 2GNDA 5T54A 2VXRA 1CESA 2W52A 2ZGNA 1WCSA 1HDKA 1GV9A 2VW2A 1MZ5A 5GZGA 4Q26A 2D3PA 1H9PA 1UZYA 3HMYA 3QLQA 1MACA 3U4XA 2DUOA 3SNMA 2GNTA 3WDVA 1ZM1A 4Y22B 2RHPA 1N47A 4YG3A 4XBQA 1N1VA 1QDOA 3POWA 1SLLA 3I8TA 4LBMA 3UK9A 2WKKA 1IKQA 1OFSA 4R9DA 3ZYRA 1G8WA 1Z78A 1FV2A 2GALA 4Y1UA 1AX2A 1LOFA 4XXPA 1CN1A 4YW1A 2ERFA 2AUYA 1W6NB 4XILA 4BMBA 1BJQA 1DQ5A 3WDWA 2D6LX 3FLRA 3IKWA 4YZ4A 1UZZA 1C1FA 4FPGA 5DZFA 3GNEA 1WLDA 5BYNA 4YM0A 1UN1A 2A3WA 3JU9A 2V5YA 5IK8A 1NLSA 2A3XA 4ASMB 1N3QA 2E6VA 2SBAA 3PVNA 4XTPA 3NV3A 1BYHA 1D2SA 4YW2A 3LSDA 3WNXA 5T5JA 1PZ8A 1SCRA 1LOEA 4Y1YA 4H55A 3RG0A 5KXDA 4SLIA 4YG0A 2Q5TA 1SFYA 1Q8PA 3WZ1A 1IKPA 3IPVA 3WG4A 4AVVA 1ULGA 3ZSMA 1S0DA 5L73A 2D6KA 1O4YA 1W6QA 3TAYA 5H9RA 2ZHKA 3AYDA 2EAKA 1SACA 4AGRA 1W6MA 1FNZA 2UURA 3ILFA 5JOXA 4BM8A 1GNHA 1N1SA 2CNAA 1ULEA 3FLTA 5CBLA 4UW6A 1GZCA 1HQWA 1C1LA 5KXEA 3WDYA 1DLLA 1MS4A 3NV2A 1VAVA 3WOGA 1DYPA 5DUUA 3WDUA 5CA6A 3AFKA 4ATFA 1UAIA
chains in the Genus database with same CATH superfamily
5IHRA 4HKLA 4GB33 2G9FA 4BIOA 3O1UA 3ZXLA 1AR61 1CAXA 1LR5A 1GZWB 2WLQA 2YPJA 2ZAHA 3OJBA 2GN7A 1BHGA 2JG8B 4HN0A 4Z2AA 1CD3G 3PJQA 3T0DA 5KHKA 2EIEA 2FMYA 4CDUB 5DN2A 2A6ZA 2XBO1 3KHBA 5FZFA 2VBDA 4YVSA 4RFT0 1VE0A 4Z1VA 2BRTA 1AJOA 2P3KA 4NHLA 2VCMA 4IDZA 5FUPA 1WMDA 3PUAA 1IS5A 2OT7A 3BTZA 2PHFA 2ENRA 5T55A 2R1DA 1VBA2 2BNNA 3PIJA 2P34A 2XWJB 3PTYA 2VMGA 4AGVA 1A8MA 1H4GA 1RUG1 2B39A 4BK5A 2WDBA 3VDAA 3WP5A 2JDHA 2B5HA 3RQ0A 4UBGA 3VBFC 1AJKA 3V0BB 1US2A 1DBNA 3DYPA 5FBJA 1W0NA 4C1XA 2IVIB 4LBLA 2O8QA 3GBWA 4K9SA 1H8TB 3GF6A 4A6SA 2YC0A 3LAGA 2YV8A 2BU9A 4COWA 4M3CB 1L7QA 5EJZB 3WUDA 3S57A 4MGSA 4HK8A 4UW4A 1RUOA 4FTSA 4AEDB 4D6QA 3U07A 5FP9A 5ANQA 2YYOA 3PJYA 3K3OA 4XF0A 1H9WA 4NIIA 1W90A 2CGNA 4M3CE 4PLOA 3NQHA 4Y22A 4CEYB 1RUE1 2VPVA 5AVPA 3E6BA 1Y7BA 1W0PA 1YIFA 2EIGA 4Y1ZA 2PHUA 2W94A 3MI8A 3OGJA 5FO9B 3ELNA 5BNNC 2HWF2 1N1TA 1RHI1 2F4LA 2D3RA 4X8NA 5L7OB 2JENA 2R073 4Q4X3 5JVVA 3T08A 2W39A 1W6NA 3S30A 2ZHNA 4IQPA 5KR7A 4FPKA 2ORXA 3MV01 3BTYA 5F39A 3N7MA 1W8WA 2J1RA 2DVGA 3ZSJA 3HJRA 2ZABA 2F4PA 1X50A 1RUD1 5F9TA 4IGPA 1CPMA 1Y9MA 1YFUA 1UMZA 3BIWE 5ABJC 1MR5A 1QJY1 4FFHA 5HXVA 5L9BA 2BGOA 4JGYB 4DUXA 4NHXA 1E5RA 3JUUA 4LIVA 1IGOA 2ZGMA 3E97A 2Y6GA 3P3NA 1E5IA 4Y20B 2DVFA 4KU8A 5FYVA 2E7QA 2OZJA 3CNAA 3DYOA 4E2GA 1XNBA 2P3IA 4DY3A 5DAPA 3AZVA 2I2SA 3ON7A 2DFCA 1OXCA 3D4KA 5BNOA 2J42A 2ADEA 1GICA 2DU1A 2P17A 4JHZA 3Q8FA 4KH9A 3VZMA 4GB31 3VBOC 4HT1T 4XFGA 4ORFA 5FZ1A 4EZ4A 5A6QA 4H14A 5FP8A 3CF6E 4KMQA 3OUIA 2BNOA 3PIGA 3BODA 2R0FA 3O0WA 2WZEA 3SH4A 4YZ3A 3ZFFB 4OUMA 4CXWA 4D6SA 5DAQA 3ZO0B 1DZRA 5T5OA 3S6PA 2RR13 3FHAA 1RUC2 5JXHA 5IFTA 1MZFA 1JZ8A 1ZRIA 2XGXA 2AACA 3IDEA 3MUZ1 1MEC2 1EAH1 3C7HA 2J1UA 2JECA 3MF6A 3SEPA 3HNYM 5H9QA 5EYYA 2DU0A 1RUI2 4I2OA 3FC0A 1JZ5A 1V00A 2GH2A 2XHNA 3MDPA 1GQHA 3DXTA 3IZOA 5FXVA 3UESA 2BOJA 1LOFC 1Q43A 1YXWA 4XQWA 3ORJA 4BLIA 1DGWA 1NE6A 3N9LA 1YQ2A 3ZKYA 2XPJA 3U11A 1IG3A 1VJ2A 3SITA 4YGEA 3HNBM 4OUSA 5LWBA 1HB4A 3K4DA 3AYCA 2ZMNA 4JHTA 3R0RA 4LO8A 4LBQB 4X6RB 3O1TA 5FYUA 1LENA 4WVVA 2HWC2 1OA4A 2EIDA 4OI2A 3C7FA 2PLV3 2WJSA 4CDQC 2PAEA 2WS93 4NRPA 2EXHA 1RUF3 4XFAA 2E26A 4YW7A 2D6PA 3VKNA 2DTWA 1PK6C 4D6RA 5HCHA 3HNMA 3Q8EA 4LHLA 3NWKA 3TRSB 3UV9A 1MVQA 1H2KA 3CJIC 2B8MA 3ZXKA 2WT0A 2H6BA 2HLEA 3USSA 2ZBJA 3J4UH 2PA7A 4GAZA 2JEMA 3LKJA 3EHKA 3PUQA 5GM0A 1JYVA 1XJAA 4J6GA 1ZVFA 2BBVA 5FZGA 2MNGA 4L99A 4X6QB 3B00A 1UL9A 1XSRA 2ZX3A 3LEMA 3T4VA 5E1RA 5EWSA 5FOJB 2DCKA 1AXZA 1YFWA 1W9FA 5FUNA 1MQTC 2R071 3T2QA 4EWDA 1JW6A 2NN8A 1NE4A 3MUY1 4JDNA 4YPJA 4N90A 4GMP0 1NAEA 5GJ6A 2OUHA 4XZUG 1LESA 2IZWA 4Q1RA 1OH3A 3KHCA 4LBOA 1R1A2 4Q4V2 1X33A 3FL7A 2OIIA 1TME3 1S2BA 4V2WA 1ULOA 4FO9A 2IXLA 1VBC3 3KWVA 1UXZA 3Q8AA 1OURA 3UGFA 1LTEA 1DQ4A 5JXIA 3I54A 3VHNA 1UW8A 4FPEA 1LGNA 1YIPA 2B7YA 1WW5A 2ET7A 3NAPB 4EQVA 5J98B 1S2EA 2XWBB 1VR3A 4MLOA 1JYTA 1J84A 1MS0A 2QZ3A 3DUIA 3KGZA 4HONA 4L11A 5FO7B 5JOYA 4CEWB 1W8OA 1I3HA 1TEIA 3LA3A 3ZFGC 3AP5A 4XJ9A 2AEZA 2GNMA 5SV5A 4BQXA 3KZ4C 2X5IC 1H8VA 1KFUL 2WN3A 3V65A 5J48A 4YVWB 5HCAA 3GCXA 2ZX4A 3ZMNA 3KM5A 3WLUA 4DY5A 4RHV2 4QQLA 4LE4A 2VW1A 5K0UA 2HYXA 1A3KA 1PMHX 5L19A 3IWZA 2Q4SA 1AYN3 3EQEA 4IGOA 4XIOA 5FYZA 5ABJA 1QJX1 2RR11 3VDDC 2PAMA 1OPMA 2XDVA 2YGMA 1PMJX 2KM2A 2Y6HA 4QB1A 4BMEA 4AEJA 3AZXA 4QDRA 1C57A 5LBEA 2PHRA 5FP3A 2XJVA 1OKQA 5F37A 2Y34A 3HEIA 4PI2A 1RGSA 5EV7A 2UWCA 2RJLA 3NNFA 5ANNA 5FYBA 4GD4A 1RIRA 1AVBA 5EP9A 2W1QA 4AOCA 2HWB2 4CUCA 1V6IA 5A1AA 1M06G 3PDQA 5KWRA 3L9JT 1PO11 2CHHA 2CGOA 1GMMA 3VBOA 2BVVA 5I0RA 5I8SA 2HBTA 4XURA 4DUVA 1LHVA 2ARXA 4AQ6A 1JUIA 4QB6A 4BLJA 4H2AA 2VAUA 1QU0A 2BVBA 1J58A 1VRH2 3LF7A 4QHBA 2PYTA 1VAMA 5T5PA 4A42A 1WW6A 3AZZA 4BCUA 1IPKA 3J7MA 2A3YA 3MW4A 4M01A 1O4TA 1U0AA 4Y5Z0 3I2HA 4UBHA 1AZDA 1AXKA 4MYEA 2HEYF 2V72A 4YW5A 1WLTA 1YI9A 4CDWB 4BXFA 5FYIA 2JIGA 1HRV1 1CPNA 2BUKA 3KGLA 4QGMA 1RMU2 2WAAA 1OFNA 1WCUA 2P4EA 4DQAA 5K7PA 1W9WA 1VB2A 3IB3A 2G9GA 4P00B 1RUJ1 2F17A 4INDA 1HQLA 4AI1A 1F8VA 3K4ZA 4V1PA 4IV1C 4BK4A 4UF0B 1BBT3 1YHFA 4AQTA 2UWAA 4I3PA 2CGPA 1QOOA 3AZYA 5LBBA 4PT6A 3UETA 1PO21 3QH7A 5C3SA 3U1XA 3N9MA 1OOPB 2WO1A 5FPAA 5I0UA 4CDQA 5C5TA 3AMHA 3WF3A 4GIQA 3FBMA 2CWSA 3I4IA 4IE6A 5SV8A 2DUPA 1PK6A 3OBAA 5T3NA 5J37A 1E57A 2BFUS 2OKXA 1TME1 3ZXJA 3NJZA 3CJIA 4CP9A 1UZ0A 2RS51 4XMAA 4KWLA 1VBD3 4GMP3 2VG9A 3JBG3 4XQDA 3MW2A 5BNPC 4GQ7A 2ES3A 5AVAA 5IVFA 2ZXQA 3L2HA 5DPNA 1QOTA 2VCBA 2C1FA 1LKNA 4OVEA 4YM1A 2BERA 1RUNA 3NJVA 3R05A 1H1MA 1K12A 3KVAA 4FPLA 1VBE3 4PF5A 2RS11 5FZLA 2HWE3 4ZONA 1J83A 4IEVA 4CU8A 1MQTA 1CJPA 1W9TA 4JVAA 1LU2A 4YYOA 1V6JA 4XBLA 2I74A 4B4RA 1K42A 1VAKA 2JDNA 3A0KA 5CFDB 1Y9GA 3SISA 3E6CC 1POV0 3AKQA 3C3VA 4HBNA 4FFGA 4D7SA 1YO8A 3VD3A 4YW3A 5GALA 4LKSA 5FYMA 1RINA 1CX4A 1XE7A 4WVMA 4ARYA 4NHKA 3IPVB 3I2DA 2JXAA 3J9SA 1AYM3 4A7ZA 3ZYGA 4NVPA 1FT9A 1JXNA 3LDKA 3MPBA 3AK0A 4N53B 4PF1A 3LIHA 2LROA 2WWJA 2A6VA 2EALA 2GSYA 5A33A 1JZ7A 2ZA9A 1G9CA 5IK7A 2R041 3I2FA 4GXLA 2QNKA 3HVDA 5FTTC 5FZHA 1JYCA 1RITA 2DYCA 3KV6A 4Z82A 3ZFEC 5IVCA 2VZRA 3LCPA 5FFOC 2YB7A 3WF1A 1WMEA 1SLIA 2EAAA 2PELA 4K20A 5FYTA 3EO6A 1QJU1 2X5IA 1UIKA 2QQWA 1ZBE1 2VY0A 4OZXA 5F32A 1UOFA 2ZGRA 4KGQA 2E53A 3GCWA 2IXJA 3USUA 3Q9OA 4QKNA 1FNYA 3KLSA 2CWMA 4ASKA 4Y4YA 3I59A 3VDDA 3BKZA 2C24A 2EXKA 3DKQA 4J1WA 3ETQA 4JCKA 4RQPB 5FZBA 1BEV1 3OPZA 5A7PA 1KJLA 2IFRA 5KC5A 2VNRA 4NPMA 4OMCA 4MZUA 4COVA 5C4WB 4NIGA 2Y8KA 1PHMA 4PJYA 3RMYA 1C8M3 2ZKNA 4A6OA 3CHXA 5I93A 1ODNA 2VVEA 3H3ZA 2WQZC 4IEPA 3GDBA 1BBT1 5JSPA 3O1RA 1PIV1 3M2MA 1ZA4A 5DMYA 1WW7A 2VUAA 3C7EA 3MFCA 2ZAAA 4Q0SA 5LB6A 5C8CC 2LW8A 4C0HA 5JIUA 2EXIA 4XBNA 5J1XA 1COV2 2ID4A 2JB4A 3MLKA 2JWPA 1LOCA 1O5UA 5FYHA 3S0MA 5A6YA 5G04L 3FWEA 3QACA 5T54A 1CESA 4JTNA 2TUNA 2OYZA 1GV9A 1AR92 2OPWA 2JDKA 4LO6B 4Q26A 2KD7A 1REFA 3WP4A 1QXRA 2JKXA 1L3JA 5LBFA 3WDVA 3S7EA 4YG3A 1ZNPA 1N1VA 2VOXA 2DF7A 3JBG1 3FHIB 3LPGA 3RDIA 2BWAA 1I5PA 4OULA 1AL23 4ZU5A 1JOBA 1Z78A 1ND3C 1AR83 3K4AA 4COZA 5A3OA 4Y1UA 4HXCA 2AZ5A 4HSLA 1AX2A 4CPBD 1T6GC 1UU4A 3OTFA 5EIYB 2GC0A 3ACIA 3URFA 4MH0E 3CZJA 3B9IA 2DCYA 2D6LX 1DZTA 5FPBA 2RDNA 1NXMA 4FPGA 5BYNA 3WP6A 3MFAA 4YM0A 4WM7C 4DXSA 3R4DB 2VULA 5FJKA 4RR3C 2SBAA 3IDAA 1AYM1 1W3XA 2W3JA 1BYHA 4OYUA 1R083 3MIDA 2ARCA 5A7WB 1WMFA 1POV3 3PVBB 1B35B 4EN7B 5BNPA 3VL8A 4H55A 4SLIA 1XYPA 4P9GA 4YG0A 2B45X 1FMD2 1HN0A 1H2LA 1SFYA 1IKPA 2R063 3Q8CA 3WG4A 3U0ZA 3RYKA 3ZSMA 3TAYA 1XU1A 2EAKA 4AXOA 3ZKUA 4AE2A 2ZTNA 2O0OA 1X36A 2JG8C 1W2OA 2VOTA 5CU1A 4BM8A 4CDUC 2CNAA 3G7DA 5FPVA 2WQ4A 2D5HA 5C71A 4NHYA 1DLLA 1MS4A 1VAVA 4Q4W2 1DYPA 3WDUA 3AFKA 1NA1B 1JU4A 1UAIA 3PMEA 1ODMA 4GALA 4OCTA 1YRZA 3GZEA 1HRI1 5HCFA 2CL2A 3INAA 1FOD3 4HPKB 1JHNA 1ZRFA 5FQ0A 5JR2A 2BOIA 3ZFEA 5IWFA 1CGPA 4X8PA 3CBNA 3D6EA 3OYWB 1W28A 1WW4A 2DURA 4CA9A 1OD5A 1UOJA 1W8NA 3JQWA 3EMRA 1NQDA 4EYUA 3VKOA 3M8LA 4O61A 5JZGB 2BZDA 3POIA 4E4SA 2KR2A 1QQP1 2R30A 4AHZA 2HWD3 1H8TC 2RV9A 5FLHA 3I2OA 1Q8VA 3NW4A 2VZPA 4LTAA 5CIRA 5FK8A 5FPUA 2OUJA 3QD6A 5GLWA 1V6LA 2UYBA 2WAOA 3AZWA 4CP1A 5B4NA 4GJZA 2D98A 1UX7A 3AVSA 3M3QA 4JDOA 1W8TA 5CNAA 1ND2B 5LA9A 3O1OA 4TZDA 4CEYC 4TTGA 4IXLA 1KITA 2D40A 4QM9A 3RGBA 2JKBA 4JKKA 3NNLA 1CAVB 4LUMA 3P5BA 1AR63 2RS32 3EXUA 3LQCA 3OY8B 4LE3A 3SLIA 4FAGA 3MPPG 3SCGA 3AP7A 1OF3A 4QB2A 3FBYA 4N9IA 1AR81 1YQ5A 1LHOA 2GZWA 3W59A 5L7OC 1K5MC 3M3OA 5C8CA 4J1XA 1XPWA 1GUIA 3JXSA 4RSUA 3M1HA 4DXZA 2LRPA 3ZDVA 3RWNA 1ULDA 4LBKA 1F2NA 5HBAA 2EF6A 4PQ9A 1FV3A 1UY1A 3MLJA 1RUG3 2XR4A 4FTBA 3M7AA 4IE5A 3AM2A 1QMJA 1VMJA 4JGYC 3T3YA 5HV0A 1NY71 5FYSA 3RI8A 2H0BA 2WNVC 2WR9A 1QHDA 1SG3A 2ZZJA 3WCSA 4LHKA 1YCIA 3D0JA 2VTFA 3MLLA 5EFUA 3ZM8A 4FOVA 1KS5A 1MS3A 3GALA 1POV1 3JD71 4C8DA 5A6XA 4NROA 1IOAA 2AREA 2CU5A 3JZVA 5CZKA 1ND3A 4BB3A 3ZXDA 2K2SA 4MX3A 1SFPA 4BQYA 2OW4A 4XUTA 2DFBA 2WNOA 4N43B 5CVRA 2VCCA 3PTRB 4NWVA 4ZHNA 4LHNA 4CDXB 2XJQA 3ZSKA 3WW3A 3OEAA 3HPNA 5DAWA 4S2HA 3AP4A 4FFFA 1DHKB 1PZ7A 4IEXA 4XJ8A 4HVOA 3THCA 2DBNA 3ZFFC 5LW9A 3HN3A 1W05A 2JB8A 4WM7A 1RUE3 4ZKTB 2ILMA 1DU3D 4UAPA 4Q1PA 3O1SA 4LXLA 4YGBA 3BOPA 5LATA 5JUVA 2WFF3 2EIBA 3B01A 4MO3M 1RJ8A 5FXXA 3UT0A 3V0AB 2NYYA 4DB5A 1FYUA 1RHI3 1H30A 2YROA 1REDA 4RGKA 1ZYBA 4P9JA 2QVSB 5FZ6A 4QKBA 1F4AA 2AC1A 2NQYA 3AYAA 3BGAA 5EYXA 1LRHA 2VNVA 4JGZB 4Q4X2 3C2UA 2QUOA 4UFHA 5T5LA 4CCDA 2C5DA 1GZWA 1HB1A 3FJSA 2JG8A 2RMU3 4GH4B 3ZXFA 3A4UA 1JS9A 1KRIA 4OHZA 1UWWA 4CDUA 3FHQA 2NMNA 3J8F1 4MXVA 1QJY3 2BNMA 4FPYA 2D43A 5E6HA 2VMIA 3S5AA 1YEWA 3WEZA 5FMDA 3DYMA 5HV4A 4AI3A 4CU7A 4Q8KA 1ZBA2 2W95A 3BALA 3FZ3A 5FY8A 4BE3A 3WF4A 4YSFA 3TN92 1DFQA 4K21A 4QQPA 2GP5A 4B7EA 1O3TA 1Z7S1 5FZ8A 1GZTA 4XACA 2VU9A 3VD4A 1W2TA 4JX0A 1UYZA 4LA3A 2WN2A 1JU3A 4FOQA 4MHRA 1VRBA 4YM3A 1ASJ3 1IS6A 3DF0A 3RYRA 1X9PA 2XH6A 1GR3A 5FZ0A 3K48A 1RUH1 4IETA 4ISRA 2FCTA 2VW0A 4XJAA 1GSLA 4CU6A 1IS3A 3HQUA 3J7HA 1H8TA 1G86A 5LK7B 3M3EA 4YWAA 1D7PM 2BQPA 2VZ1A 2Y6JA 3C7OA 3CIHA 1EAH3 4LKEA 5DDJ1 4CUAA 2FMDA 1OBNA 4I3GA 1LB2A 2GDFA 5EQUA 5F5AA 4AVBA 4D8MA 1PVC1 1D0HA 3JQXA 1DYKA 4PLNA 5A7NA 5C6CA 4XUQA 4LO5B 1I9RA 3SKJE 3GZTB 3T2OA 3N9OA 2ZGPA 1LGBA 3NKTA 3SEEA 3B02A 3NRUA 3PUHA 4QX1A 1C5IA 4CTEA 1NT0A 1GNZA 3WINE 1JZ3A 3N4MA 4XE9A 1CAUB 3NNJA 1W6QB 2JG9B 3NAPC 4P9XA 3ZN4A 1W8HA 1AR71 3ZYHA 1LHNA 2J1SA 1H6XA 2E7TA 1AF9A 1SLAA 2MHFA 3LOBA 2WWUA 4N9HA 1YQ8A 2D7FA 2XVKA 3C7GA 5LEKA 1ZREA 1K5MA 1RTVA 5EXOA 1QJFA 5J7MA 2RM22 2VCAA 2PLV2 3E5UA 3OB8A 2ZEZA 5LA2A 5EPAA 2WS92 1UPIA 2N7GA 3WD5A 1RUF2 5FZDA 1VALA 3H50A 3EYPA 3WNLA 1IS4A 3POYA 1E5SA 1QKQA 3HQRA 4KU7A 2ZX0A 2NM1A 1CAXB 2A71A 4K8FA 4Q4Y2 2PQQA 4FAHA 2TBVA 1ZX5A 1GLHA 1FPN3 4AR2A 3KD4A 4LA2A 4JGYA 3MW3A 3ACFA 4AYUA 4LULA 2WNVA 3NNMA 4YVSB 4QD2A 2RJKA 1Z0HA 2WFF1 4Y20A 3VZKA 2XVGA 5I91A 4M3CF 2NLRA 5JPMB 3KV4A 4AI0A 2HEWF 1F31A 5F3GA 4S2GA 5ACA3 1VB4A 4AQSA 4B4PA 1A78A 1DQ0A 1QY4A 1YQCA 4DZGA 4QX0A 4QGLA 1SLBA 4NN0A 3AMNA 3RPQA 3HWJA 5FIXA 3WF2A 4P02B 1DG6A 2DUQA 2XVLA 3AKTA 5DUWA 2EA7A 4CZSA 2RMU1 2MPFA 4IEOA 3VD9A 3ZFFA 5AC92 3KSCA 1IPJA 4RL7A 1TMF2 4YZ2A 2QJVA 3MEPA 3MIFA 4QPGB 2HBUA 1AXYA 2JDUA 3TOJA 5BXXA 3AC0A 4ZZ8A 4JQTA 1VBC2 2NZ9A 2VQ0A 3BN6A 3FLPA 4DINB 3SH3A 2YFUA 4MXWA 4XFCA 1WKYA 1OVSA 1NCQB 4ZPIA 4CU9A 1KS4A 2BW8A 1NZIA 2W5FA 1FAYA 1PGW1 1ZZ9A 2Z4FA 5GZEA 3ZMOA 4ES8A 1BMV2 2XLFA 1WD4A 3FMGA 5JR7B 3WDXA 3BCWA 3POJA 4PBPA 1ASJ1 4MGZE 1Q5OA 3MIBA 2TEPA 5FZEA 3N35A 4XJWA 4AG4A 4RS5B 4E9KA 3UNPA 4XJUA 1W9YA 1QJX3 2WNUA 2R16A 4LBQA 5C9AB 3VD5A 1ENXA 1X8MA 1AYN2 1TQ5A 2AH2A 4K1YA 4NRMA 1OOPC 2Y60A 1CAWB 3BB6A 3PNAA 4I0AA 4YM2A 2E9QA 1POQA 2V73A 2PAKA 1K3IA 3OCPA 4P14A 2CYFA 2XHKA 1H1AA 3PU3A 3EJKA 5FLJA 2RDSA 3VBRA 1LODA 1ZZCA 1REEA 2P1BA 1GANA 1AX1A 1XNKA 2BYVE 3RRDA 1BK1A 1GWKA 1N1YA 1PO13 2XJTA 3B3QE 4P5YA 4U36A 5J09A 2ADDA 1J1TA 1VLNA 2W46A 3LEKA 3PLQA 2FDIA 3AL6A 5DG2A 1G9DA 1XE0A 4NPLA 5T50A 2Q1ZB 2VNOA 4XUOA 4XAEA 2GU9A 2A73B 5DZEA 1GQGA 5GLVA 4I0BA 5CAZA 1Q56A 2A6XA 4H7LA 2A1XA 1JOPA 3DECA 3UGGA 1IQAA 5FOBB 1BCXA 2YPDA 5LZ6A 5CFDC 3TEZA 1FI2A 2ZX2A 1HW5A 1BKZA 1G9FA 1HRV3 4QX5A 2XL9A 3POSA 1VMFA 2XKOA 3LA7A 4JRAA 1P8JA 4QMAA 2E33A 4NWWA 4E8DA 5A32B 1RUJ3 1FPN1 3N3HA 3OBRA 4XFIA 3WV6A 1CZTA 4B1MA 4D94A 1GYKA 4N53C 1C8NA 2J1TA 4XJZA 3VBFA 5JOWA 4OHXA 2FDFA 3IMNA 3M3CA 4BISA 2GH8A 4TXWA 1PO23 2PMWB 1NZCA 2OQ6A 4P9WA 1GOFA 3VBHB 1UKGA 4R9BA 1UMHA 1U5ZA 4MUVA 2YMZA 3W21A 5ACA1 1NUKA 3WNOA 3MO4A 4SBVA 1JN2P 3X29B 3RJRA 3CL1A 3WG3A 3WDTA 1S0JA 3O7OA 3H8UA 2VR4A 1W6MB 2CSGA 1ENRA 2VXJA 2YFZA 4Y4RA 5FY9A 3E6DA 2QQUA 3VDBA 4D7TA 4NIAA 2H0VA 2RS53 1W9SA 1ZZBA 3D5OA 1D4M1 2FCVA 2HWF3 1RVF1 1PNGA 1SBEA 3PUIA 3U4SA 3OBZA 4RQPC 1VBD2 5JPNB 4YW6A 2C26A 1QOSA 3IT8A 3MZHA 4HSJA 4PLMA 4XQ4A 3WUCA 3THDA 5BNNA 5C4WC 3IM0A 1Q8QA 2WFPA 2RS13 3W9AA 3EBRA 4Q8LA 1JOJA 2JD9A 2ZKLA 1W3VA 1AHSA 3HOBA 1VBE2 2IXCA 4AFBA 2AGSA 1QNYA 2HWE2 3TEWA 2QQKA 4DRVA 3PHMA 2OQ7A 3J7LA 1VIWB 2FDKA 1FATA 2JDYA 5IAXA 5FPLA 2YHJA 4JC1A 2MEV1 5T52A 2Q8DA 3ABZA 4RD7A 5KHGA 1QEXA 4DEQA 4FP3A 1URXA 3APBA 1XYNA 3FFZA 1MS1A 2R32A 4OFGA 1Y3TA 4XHBA 3CJXA 2R043 2EXJA 1NLQA 1WBLA 3UL2A 3QBQA 2WUHA 4U2AA 1PGSA 2D93A 1DDLA 1UNBA 1QJU3 4YGCA 1BXHA 4NUBA 2XG3A 1ZBE3 1QJZA 2GNDA 1QXJA 4MGTA 2FZ2A 2VXRA 4URAA 2OA2A 1MEC3 1WGPA 1HDKA 4HETA 4A41A 5C8WA 1H9PA 1UZYA 1EV12 1OT5A 1UYYA 1VBA1 2ZZQA 5FMOL 3ZYPA 3CQOA 2OPKA 1BEV3 1XU2A 4QDSA 5JAXA 4LBMA 3POWA 3I8TA 4I02A 3UK9A 5CYYA 5FKCA 5AFEA 2WKKA 4ZU4A 1JHJA 1HJGA 1OFSA 2G19A 3GZUC 4G3YC 4B3NA 3VZOA 2UY8A 3NL1A 1FV2A 4BJ0A 5K0UB 1LOFA 2JIJA 2W0XA 1CN1A 4OUEA 2X09A 2BGCA 2ERFA 4LUKA 1C8M2 1JI6A 4W6YA 1BJQA 1HIXA 3CLPA 5DAVA 1PIV3 3IKWA 1US3A 4ZXEA 3WDWA 4YZ4A 1H2NA 1UZZA 2E7AA 3DCQA 1JZ2A 4GJYA 3GNEA 3NKGA 4LIUA 4QX8A 3U10A 3BVCA 2V5YA 1RXGA 5IK8A 1XNCA 1IG0A 1OA2A 2VZQA 3WNKA 2WZR2 3WY6A 1J3RA 4XTPA 1F5JA 5CFDA 2I07B 2WWSA 2YBKA 4COUA 4E4DX 3ZYJB 2KA3A 4PI0A 5IW0A 3M3IA 2VUCA 5KXDA 5BNQA 3VBOB 3BUCA 2Q5TA 2XLAA 2V5DA 3VDCA 2W91A 2HWF1 1WCKA 3IPVA 4QPWA 3WNPA 3H8XA 4DXRA 1ULGA 1NA1C 1QJEA 1PGL2 3OUJA 1HXS2 3NO8A 1UO9A 5JI7A 3ZLIA 5F3CA 1SACA 4A7KA 4AQ2A 1E5HA 4OHWA 3VHPA 1AL22 1EUUA 2JX9A 2VNGA 5CBLA 1R1A3 1GZCA 2VMCA 4Q4V3 5BUVA 1KEXA 3OG2A 3WDYA 2UYAA 1DYOA 4OHVA 2WZPP 5CA6A 4CCLA 3AYEA 2Q30A 1G9BA 4FXGB 4LOTA 2WIIB 3VV1A 2KXLA 3RZJA 1NXD1 4M00A 5GZDA 1PZ9A 1W8FA 3KT7A 2V09A 4CXXA 1SBFA 5JZGC 4NHMA 1AX0A 1YYNA 2B9UA 1JBCA 2FZ1A 2VMHA 2VOVA 4XTMA 3ZXEA 1YJKA 5HPOA 4GKXA 2ZGLA 2QE3A 2P5BA 2WL1A 3WHUA 5KXBA 3LB9A 4B7KA 2YZ4A 4LMFA 2GNBA 4WM8B 4RQPA 2P6HA 3ECQA 3LWCA 5A3LA 1R082 5FYCA 1WUVA 1YLLA 1H0BA 2QFEA 1WBFA 1UKRA 2RE9A 1YI7A 2RG4A 4JQRA 1VBB2 4JRLA 3ZN6B 5C4WA 2IVJA 3ZYBA 4CDQB 1ND2C 2G9ZA 3V64A 2VZOA 5JLVA 5FJHA 3ALQA 4D0QA 5HXMA 1SLCA 4AHYA 3ZFGA 2R062 2WA3A 2ZGKA 4MGKE 4AFAA 2VBBA 2P3JA 4Y24A 3RS6A 3WF0A 3U78A 1RUC1 4LKDA 3I3EA 4XC9A 4C90A 3ACGA 2RDQA 3WG2A 3UJOA 1SMVA 2WO7A 3GJAA 1MEC1 5FY4A 1EYBA 3H1WA 1X82A 2QQPA 1UXXX 4B1LA 4JDMA 3RWKX 3T0BA 1RUI1 3I2KA 5C3OA 5DUVA 1AL0G 2AR6A 3C8XA 5D1IA 1HRI3 4XFHA 3QOPA 3WG1A 2HWB3 4Q0QA 1DCSA 3NMBA 4HL0A 4IESA 1KXGA 4W6XA 3FUOA 4ZY9A 1FOD2 2D5FA 2VH9A 4XDQA 2UU8A 4IEUA 2FD8A 4LITA 1T2XA 4S2FA 4XFBA 5F6KA 2D97A 3KF3A 5DABA 3THPA 2HWC1 1GOGA 4XUPA 3CMGA 1YNAA 2A5ZA 3AMPA 2R1BA 2LUWA 4KWUA 2BPA2 4CCNA 1QQP3 3H7JA 1EY2A 2GAUA 3AX4A 1V6MA 4BQ1A 5A33B 3B9CA 2Q0AA 4N43C 2HWD2 4XVHA 1UY2A 5IVJA 4PBOA 1RMU3 1XOYA 2YBPA 4OMDA 4B4QA 4CDXC 5I0DA 3I3QA 5IK4A 4EROA 3MBWA 5JSRA 5I8YA 3SH5A 2VD7A 2CDOA 5FZ9A 3WW1A 5A7QA 3A7QA 4H3WA 1O8PA 2ETEA 5D8AB 2VC9A 4QHOA 3UKTA 2HEVF 3W58A 4IV1A 1AR62 1W99A 4QPIB 1O3QA 1Y43B 3VDDB 4MSVA 4W6WA 5CKMA 2RJ2A 5E16A 3POGA 3WX5A 1JMUB 2XBO2 2Z2SB 4IV3B 3WNNA 1W2NA 3N7LA 1B09A 1R1A1 4Q4V1 2HKXA 5C3QA 4JGZC 3ZSEA 3ASIA 5L9RA 4WZCA 1ENQA 3R4UA 2E51A 3O1PA 1DGRN 4LKFA 4R4ZA 5A1LA 2BWCA 3KCCA 2A6YA 2JE8A 5F7UA 4GH4C 4J25A 5JMOA 2PHLA 2WQ8A 1FX5A 3KF5A 5DZGA 2ET1A 1V9U2 1MS5A 2W9XA 3ZVXA 3OD4A 3P6BA 5F5IA 1RUG2 1S0FA 1A8DA 2X29A 2ZGOA 1DGRA 4G4FA 4WV8A 3DPRB 1NA1A 4E8CA 1I6XA 3JD73 4Y33A 4IUGA 1H6YA 3CKHA 3H42B 5HCBA 3GHMA 2ZEXA 1NCRB 3AXEA 4HPKA 1O7FA 1F9KA 1OPOA 2ZHLA 4HMZA 4TYSA 4WVWA 3RFRA 1S4CA 5FPZA 2BP6A 2ZGSA 4FXKB 2DCJA 3NSTA 4RHV1 1YWKA 3VD7A 5CFCB 3TEYA 1MS8A 4NIDA 4UFMA 3VKMA 2YUEA 4QHZA 2OXBA 3HD8B 2FQPA 4PQQA 4CUGA 4DFSA 5JZGA 5L9VA 1LAJA 1UZWA 1GP4A 2K0GA 1HQNA 1ACCA 2WBKA 3K51A 4NMIA 3N36A 1RUE2 3S7IA 1XQNA 1R1ZA 3ZR5A 4XF4A 3IDBB 4XMIA 2ARBA 3ZR6A 4QAWA 2HWB1 5A3PA 1WMXA 3BTAA 1RHI2 3U37A 4ES9A 3VBSB 3B94A 1KQRA 1W03A 4FQ4A 2IUWA 1ND2A 4GWJA 4YG6A 1WLWA 5FZ4A 1DZQA 4IE7A 3LDBA 5LY1A 1Y9QA 1C3HA 4Y26A 3VB9A 1SPPB 5FWJA 1UYPA 1VRH1 3AP6A 4GKYA 4AK3A 4HOOA 3KB5A 3VBUB 1C5HA 2JG9C 1OHFA 1Y4WA 4JKMA 4AHWA 1RUD2 2CDPA 3J8F3 3E5QA 4WVZA 1UY0A 2XJRA 2YU1A 3T0AA 1UMIA 2D44A 3H1YA 5BNPB 1UY4A 1QJY2 2C9KA 1RMU1 5K4LA 3OGSA 3E1F1 3N9PA 5FZOB 3Q8BA 4AEDC 1IPSA 1PNFA 2Z79A 5FZ3A 1LNSA 4HK9A 5I0TA 4F7ZA 2R7EB 1Z7S3 1LU1A 3RZGA 4K40A 3ITQA 1SLTA 2J22A 1R092 4KBZA 3U75A 4BOWA 4CCOA 3BU0A 1LECA 1OD3A 4IEWA 4EV0A 4GB32 4A7YA 2DCZA 1S0GA 4RGAA 4YVSC 1GQPA 4AVSA 4B8EA 1RUH3 1UQXA 4UI9L 5FMCA 3PVEA 1GWLA 4N8MA 3WW4A 1SHWB 2ARAA 4O65A 3P3PA 2YC2A 4DPNA 1DP0A 1LJ7A 4C1WA 5FR3A 5GZFA 2JJ6A 5DDJ3 5D2AA 2IWGB 4K1ZA 3AFGA 2CAUA 2VOWA 3WXPA 5FQ0B 3ZFEB 1EAH2 4XEZA 1WCDJ 5AFBA 2X8KA 1LHUA 1ULPA 5CG8A 2ZCWA 4D7YA 2D6OX 1PVC3 1OLQA 4GWMA 1U5XA 2DCTA 4ISQA 4UT5A 5K9YA 1GU3A 2HJIA 1OLMA 4QPGC 5EJ3A 2QQLA 5E89A 1BVVA 2EVXA 1IHMA 4FCAA 1LGCA 1ULCA 1GZ9A 2WA4A 4UWDA 3WHTA 4K8RB 2FCUA 5D21A 2VMDA 5I8TA 4QXKA 1W6OB 1AR73 4YRDA 1V6NA 1NCQC 4NJ4A 3ETPA 4KG0A 5JXGA 4EN0A 2CV6A 1ST8A 1O5LA 2OX0A 5EJ1B 1DIWA 2UWBA 4FP2A 4FPOB 3GJBA 4M0NA 4JGZA 1W6PB 4XXAA 1CQ9A 3HBZA 4UFJA 3LPFA 3K3NA 5F3EA 5IT6A 2WRAA 4YZ5A 5C7GA 2VZSA 3ACHA 3ZYIB 4GH4A 2ZMKA 2NPIA 1D4VB 1GOHA 3KT4A 4RS5C 5A3NA 2XLGA 4F83A 2A7AA 4BA6A 5C9AC 3KQRA 3SC7X 2PTMA 4Y1XA 4RR3A 2OZ6A 1VBB1 1FMD3 4HANA 4ZZ5A 1DGWX 2P37A 1QWRA 3I97A 1SBDA 2XQXA 4A2UA 3DV8A 5F3IA 5DXDA 4AW7A 4WBBA 2W87A 4XCBA 2LS6A 1OQ1A 4QDQA 2GC2A 2J7MA 2R072 1MS9A 1X8EA 2R6QA 1W8ZA 4AAXA 3LGRA 3H0OA 1QF3A 2ZEWA 1S2KA 4Q4W3 1TG7A 3O0VA 4QT6A 5IJRA 5BPXA 2VECA 3WQBA 2V4VA 4HZFA 3V56A 4YW4A 5JSOA 5FBZA 4QXBA 2PQSA 4K6BA 3HN1A 2VBPA 4IGQA 1ZRCA 2H6CA 1ND3B 5LK5A 1KDMA 3H3UA 1I1EA 3HQXA 3VLBB 3VHOA 4AWDA 5DAXA 1UOGA 4LK6A 2L9LA 3ILRA 2Y6KA 1GNYA 1UYXA 5FKBA 5FMBA 2BDRA 3IMMA 4EWAA 1CONA 4IEYA 1Q8OA 1HV0A 2ZOEB 3A0NA 1HN1A 1VP6A 2K46A 1RL3A 1TE1B 1UU5A 2JICA 3ILNA 4Q2FA 3WW2A 4CP0A 4AVTA 1BK0A 1XC6A 5CISA 3BTXA 5J36A 2DDUA 5FXZA 4F8AA 3V0BA 2W2IA 1COV1 3HT1A 3T09A 1CAUA 1O3RA 2JG9A 2WSUA 4IEQA 4Q27A 2QKDA 5CADA 1CIYA 1F35A 1XXNA 3VBHC 1OQDA 3IDCB 2F6BA 4KNCA 4QX3A 1QJX2 2RR12 1MVEA 5LEJA 3RZMA 1AR91 1ONAA 5KBFA 3W5MA 4M3CA 3K77A 3SCFA 4AEDA 1X9TA 2ZJCA 1C28A 3L2YA 4BQ2A 2SLIA 3AVRA 2QQOA 4R52A 4CEYA 4ZXKA 3MHZA 1CIWA 5FZCA 4A3XA 2JE7A 1PO12 5DQ0A 1BZWA 3AP9A 3NVCA 4RA0A 1OC1A 2FBEA 3BI3A 5BY5A 2AENA 2O14A 5F8PA 2B4KA 4XUNA 3TBDA 5L7OA 1ALYA 3SMHA 4CEWC 4PCRA 4PDWB 2JDMA 2QCSB 3BOWA 4NPRA 4Q29A 2WT2A 4AFDA 2O8OA 3I7DA 3KS7A 1W06A 1V9U1 2BV4A 4YVWC 3VKFC 2QTWB 2QBXA 2G1MA 1XRUA 4A45A 2WO2A 2ZGUA 1JH5A 1HRV2 2XQRA 1HJFA 1CJDA 2IXKA 3AXDA 3OPWA 5IK5A 3A23A 1O4ZA 4XCAA 5FWEA 4R9AA 1QH6A 4QPGA 3ZIXA 1W8UA 3SXWA 3KCYA 1RUJ2 1FMD1 1UIJA 2PXJA 4XF9A 3GHNA 5E88A 5KXCA 1S1AA 3KCXA 4GWNA 4KL1A 5GLZA 5JMCA 5KHHA 1NCQA 4UOJA 2YU2A 4HG6B 4QWNA 5FRAA 1PMIA 2PHXA 1V6OA 1EP0A 4BZ4A 3K75B 4LJHA 4YARA 1PO22 2QZ2A 3CU7A 2B46X 5LY2A 3N7KA 3OEBA 3I3BA 3HAGA 5JWPA 4LT5A 4LBNA 2D6MA 4FPJA 4UFLA 3RI9A 4E2SA 4Q4W1 4QPYA 3PVOA 1K5JA 1WA6X 4UW3A 3ZPYA 4KQ7A 3VZLA 4YFWA 1D4M3 3N7JA 4RS5A 1RVF3 1TME2 2PN5A 2A70A 4IEZA 5C9AA 1NQJA 2RS52 4TN7A 5FUIA 5KHIA 3UKNA 2BEOA 1JUHA 1CAWA 4JZRA 5J96B 2K9ZA 4CDWC 1J1LA 1K5MB 1Q3EA 2XMLA 2GMEA 2FDJA 2GP3A 5FY0A 4EJRA 5CKQA 2ZGNA 1O6UA 2W52A 5A3MA 5LA1A 1WCSA 2RS12 3NJYA 2C4XA 1MZ5A 3VZNA 5K0UC 3NJXA 2D3PA 1UD1A 3D8CA 5FPXA 5FLIA 3R6SA 3HMYA 3B7MA 5I0SA 4URTA 2DUOA 3U4XA 4MV2A 2Y33A 2RHPA 1N47A 2XXZA 4Y22B 3LFMA 3IAQA 5GKAC 1SLLA 4BU2A 1IKQA 2MEV3 3ZYRA 2WNVB 1O8SA 1G8WA 3N9NA 1BVP1 1ZBA3 4AEKA 2GALA 4TLFA 3TN93 4XXPA 1H4HA 1AUYA 1WWYA 1W6NB 2AUYA 3H3LA 4XILA 4BMBA 4XABA 3VZJA 4OQ8A 2FDHA 1DQ5A 1R091 2RS31 2R042 1C1FA 3LE0A 2XONA 4IE4A 4XDOA 3M4FA 5DZFA 1WLDA 5L36A 4AAPA 1UN1A 3JU9A 4HVRA 4UYBA 5A32A 5K8SA 2TNFA 4MGIE 5ERLA 4EWEA 2A3XA 4QXHA 5A3UA 4HKWA 1N3QA 2C6SA 2E6VA 2Z5WA 1QJU2 3KT1A 5LA0A 1OF4A 3NV3A 1ZBE2 4OQ9A 3KVBA 3ZIWA 3LSDA 3E5XA 1J3QA 4R8HA 4M0HA 3OPTA 1SCRA 3RVHA 5IVVA 1G6NA 4IERA 4MXWB 3VBHA 1VBA3 1OI6A 1OA3A 1Q8PA 3WZ1A 4MHUA 3JCIA 3LZZA 4AVVA 2XL7A 5BNOB 5L73A 1O4YA 4MOAA 2ZHKA 1BEV2 3AYDA 4LEJA 4NE9A 1W6MA 4A3ZA 5IVYA 1NLRA 4JTOA 1QIQA 4AVAA 3CZUA 4P9LA 2HH9A 1GNHA 1N1SA 2ZPXA 3FLTA 3HBKA 1HQWA 4ZU7A 1C1LA 3RNSA 3OGRA 2VTXA 4WM8C 3I2GA 4Q0UA 5DUUA 1R64A 2E31A 2WNUB 4NR1A 3WSOA 4B29A 2RM23 1DGLA 1BBT2 3NAPA 2FDGA 1FXZA 1M4WA 1PIV2 2LALA 3OUHA 5FCCA 3VL9A 4EN9B 1EPZA 3J7NA 3O12A 5FXWA 3ES1A 4YFZA 4AZZA 4BXSV 4CEWA 2DTYA 2DVAA 4I01A 1EPWA 3VBRB 5EHDA 3CDZB 4Q4Y3 1N3OA 2YXSA 3T30A 1A6CA 4YVWA 2WSVA 3J26N 4KWJA 1NKGA 5LBCA 1HB2A 4YLZA 3PL0A 1T6BX 4AI9A 4PIZA 4BPZA 3T4HB 1U5YA 5IATA 2QQJA 4L0PA 2VQAA 1VPHA 3ZX7A 5IFPA 1IZ3A 3JBG2 4Q4X1 5A80A 5KHJA 3D0SA 4RFRB 4CPBA 1BQPA 3GBFA 4MADA 1H2MA 1YFXA 3LFIA 3F2ZA 2A6WA 4A44A 4F3JA 2Z69A 4FI9A 5AC93 2X53S 3GBGA 1TMF3 3A21A 4K7JA 2DWRA 3PUSA 2WINB 4W8JA 2IC1A 2VTXJ 4LLOA 1A34A 1O91A 1XNTA 4S2DA 3VBFB 4DNYA 2AYHA 5LRRA 1OVPA 1ZBA1 1ZZ8A 1XNDA 2GN3A 2DVBA 2VZVA 2JD4A 1QH7A 4LK7A 3TN91 1AYM2 1N3PA 1X7NA 3B93A 2NP0A 4CRQA 1SQ4A 4FT8A 3T2TA 4LO4B 1OH4A 4CDWA 1QGLA 3O5SA 3RSJA 1YJLA 3FX3A 3I2IA 1CVNA 1LOAA 4QU2A 5CB7A 1Q8SA 3AKSA 2DBIA 1HKDA 3ENRA 3K46A 3AB0A 1RJ7A 3IIIA 4QM8A 5D8AC 2J1AA 1D0GA 4GULA 1OQEA 4I30A 4KG8A 1ULFA 1RUC3 2YY1A 4A4AA 2XKPA 3D82A 4QPIC 4UF0A 5C5UA 4CUBA 1PX3A 2BFUL 4CCEA 3WP3A 2XUEA 5F6LB 4IV3C 3DN7A 3M70A 2XB6C 1RUI3 1LOBA 2VOKA 4HN1A 4O9EA 4AFMA 4BWOA 5BNNB 1W0OA 1OOPA 4QGNA 1MPXA 1W2UA 3KQ4B 2QQIA 2Y26A 2GC1A 1HRI2 1PM4A 2ATFA 1DF0A 2GMPA 4W65A 3WR0A 2W47A 3TNPB 5IVBA 1S55A 4C0BA 2VQUA 4FVVA 2B9VA 4L92A 4NIHA 3POEA 1YC61 1STMA 5DUXA 4E4ZA 1JYXA 1S0CA 4P9YA 4DMIA 2WT1A 3GXUA 3POBA 3DPRC 2HWC3 3DXUA 4XW3A 2WNEA 4CYDA 5ABJB 2WC2A 1B35C 4HFSA 2RM21 1KGYA 2VJXA 3DL3A 1WD3A 1NCRC 4TWTA 3ZSLA 2PLV1 3WCRA 2PHTA 1CR7A 2WS91 3UGHA 1RUF1 1QQP2 1WLCA 4NRQA 3GGLA 5APAA 4TSVA 5CFCC 1HX6A 1S0IA 1SZBA 4OLLA 4Q0PA 4Q4Y1 3N9QA 3KV9A 4D69A 2W1UA 2QQNA 3BIEA 1LEMA 4L2NA 1RB8G 4XHXA 4HKOA 2Q8OA 2JE9A 3FUQA 3GM8A 2LM3A 3O1MA 5FREA 1RC6A 3JB8A 3UYJA 4ARXA 1SCSA 2IXHA 2OS2A 4JV4A 4BQ3A 4PHZA 3VKLA 5DG1A 3RZLA 2VVFA 2DVDA 4QKFA 3HR9A 2WLPA 2ZHMA 4N53A 4D3WA 4GZ9A 3RYPA 4WM8A 1S0BA 3EB7A 4WZFA 3TNQA 1TZOA 3FE5A 5CKNA 1JYNA 4Q0VA 1RXFA 2VUDA 4OZOA 4UFIA 4MVTA 3FN9A 4Y5TA 1AR82 5H9SA 3VBSC 4L97A 3ZN6A 5HI0A 5LCWL 4K3UA 2C0ZA 3AMQA 5FO8B 3LSEA 3QCWA 2WO3A 3TB0A 5IAVA 1UZVA 5AC91 1BLZA 3LIGA 1TMF1 2PHDA 2RVAA 2W92A 3CO2A 3MICA 2GC3A 3VBUC 4BIFA 3H1MA 1KJRA 3AMMA 4M4PA 1VBC1 4O7XA 4ITCA 5FMOS 1K45A 4NAMA 3DKWA 3ATGA 1HLCA 1UOBA 4Z07A 3RZHA 2YBSA 3H8OA 1U5IA 3I2JA 1NY72 4PIXA 2EICA 3BPZA 4LBJA 2WABA 4XF1A 3NV4A 1DQ2A 5GLTA 4E2QA 5J3UA 1OSGA 2R0HA 1BMV1 3JD72 2ZS6B 4Z2WA 4QKDA 1LHWA 3THTA 4C91A 4P08A 3VGIA 1OMIA 4RHV3 2ZGQA 5C3RA 5LRSA 1MZEA 4MG2A 1PK6B 4DRRA 5ISLA 4I0WB 4XIKA 3ZDSA 5IYYA 3O1VA 1OUXA 2DV9A 1YUDA 3CJIB 1KFXL 2GMMA 3LEGA 4XDPA 4CP9B 4E4HA 1CX1A 4ATEA 1AYN1 1UCXA 2FHRA 3H9AA 3F95A 3OF1A 1SFNA 4LBQD 4YNIA 5EZWA 4BYYA 5F1RA 1PM7A 3MYXA 4V2VA 3AJYA 4HVQA 2Q8CA 3SHRA 1TVGA 1TNRA 3BU7A 2QDRA 1MQTB 1XE8A 4DO0A 4QQHA 4CVUA 1TNFA 2BGPA 1NX9A 5BV6A 5CEHA 5FDBA 4AEMA 4EZHA 1JYWA 4QU1A 2WYSA 4IW3A 4DIQA 3O0XA 4FPFA 2AEYA 1GP6A 4AI8A 5M0TA 5D8AA 3HT2A 4XAAA 4ZS2A 1VRH3 3SCHA 4WVMB 3RJ2X 1UX6A 1GWMA 4L8QA 1EV13 2YDEA 5F2WA 4QPIA 1OKOA 1OUSA 1U12A 2W68A 4XETA 4XOGA 4Y1VA 2W08A 4FTEA 3TEXA 2VVDA 4TLGA 3J8F2 4UW5A 4DEVA 4IV3A 2YG0A 5A3TA 4CCCA 1HV1A 2Y0OA 4XPVA 5FZAA 4DUWA 4AF9A 4P9IA 3ES4A 3MIHA 4L9BA 3WVJA 1WZXA 3R4SA 3ZFGB 5KC6A 4Z92B 5FV3A 2VL4A 2X5IB 5H9PA 2D3SA 4KBBA 2I45A 4YZ1A 1UPSA 1Z7S2 1ZRRA 1ZZ6A 2VZ3A 2PFWA 4IE0A 1XSQA 2NMOA 3USUB 1WA4A 1XNAA 4Y3OA 5FK7A 3MIGA 4CSWA 3T2PA 3DPRA 2LTNA 2C9AA 4META 5A7WA 3I59B 1B35A 1KD7A 2WZR3 1RUH2 1UY3A 1V0AA 3AJZA 2Y0IA 1L7RA 1NCRA 4QQ2A 2WYFA 4LQRA 1LOGA 1JTZX 5JIAA 3IN9A 3MF9A 3ST7A 2HYKA 3U14A 2Y6LA 3MGUA 5CFCA 1F5FA 4AHXA 4R9CA 5DDJ2 3NV1A 4OI0A 1NOVA 1YFYA 4NOTA 1C4RA 1NYWA 3AKPA 3ZPOA 4BH9A 2P3YA 5G05L 1HXS3 2XJUA 4EN6B 4EE2A 1VBD1 4GMP1 1PVC2 3A22A 3D3AA 1O3SA 2VGDA 5FZIA 3NNGA 2B42B 2X05A 4Z8BA 2E63A 2Y6FA 1J59A 1VBE1 2HWE1 4OI4A 4FFIA 3BPSA 4H7MA 5GLUA 1AR72 2P6CA 3B69A 2ZACA 3VBSA 1DQ1A 2BBAA 3ACLA 4CXYA 3OD0A 2ZX1A 1I5ZA 4IL7A 1CZSA 2XJPA 3AL5A 3OYWA 1SPPA 4KGGA 4LORA 4PIYA 5E8AA 4I09A 4UXAA 5C33A 2JDAA 2WZ8A 4P5HA 2J1EA 2VUJA 5A6ZA 1SEFA 3OBTA 3VBUA 1G7YA 2D6NA 3IAPA 1SDWA 4IV1B 3PURA 4FOWA 4R4XA 5JOZA 2VQTA 2VZTA 4G9SB 1V6KA 1JYIA 1VBB3 4FPHA 1LULA 4QX2A 5FY5A 1H1IA 3OGVA 4JKLA 1GP5A 5GZCA 5A7OA 5FZOA 4COYA 1XYOA 2WFF2 3KV5A 1QDCA 4BQWA 1VMHA 3O14A 2ZEYA 2JDZA 1D2QA 3POFA 1EUTA 2BJSA 2Q1FA 4BQ5A 2JDPA 4EN8B 1W2AX 4QQOA 5B4XA 4DOUA 2XOMA 5A1FA 4CCJA 2OVUA 1CAVA 2VMEA 3LEIA 5A70A 4KI5M 4GWIA 3T1LA 5F5QA 3WQ7A 3MIEA 1EV11 3OY8A 3IIAA 1IQDC 4NO4A 2QQVA 2RMU2 3BYWA 2G4IA 4DS0A 2J1VA 2E32A 3K2OA 1LEDA 1O59A 4PDWC 3MV11 1QXPA 4LNVA 4FBFA 4LO7A 3H7YA 3VUOA 4DXTA 3PU8A 1UU6A 3ZXAC 2CTVA 2O1QA 3DGTA 3H8RA 2VO5A 4LHSA 4W4ZA 3PMSA 3ZN5A 2YC4A 4FOYA 3S5QA 1C8M1 3SQOA 3QH6A 1SDDB 2VZUA 4CP2A 4MGYE 5JDBA 1PGW2 1S0EA 1XB9A 3P1IA 4GA9A 4LOSA 3VN4A 2RDRA 3RMXA 1J3PA 1GFF2 5JXJA 1CWPA 2R49A 2Y38A 1ZZ7A 1ZA7A 2YGLA 4Y5SA 3WT3A 1COV3 5IVEA 1LCLA 1ASJ2 1W6OA 4N7UA 2WZR1 4HLTA 5LASA 1OLRA 1QNWA 2P2KA 2Y64A 1JODA 4M4RA 2CY6A 5FZKA 3G6JB 1ENSA 3LDRA 1AR93 3UKVA 4N43A 5C3PA 3GYDA 1APNA 4ASLA 3WQ1A 4BDVB 3AKRA 1W6PA 3KMHA 4CDXA 4YGDA 1NG0A 2A75A 1GKBA 3FFQA 1MZ6A 1JZ6A 4CCKA 1GBGA 3I3DA 3OGGA 3ROUA 2Z42A 3B5LB 1HXS1 4AGGA 1PGL1 3VHRA 4XZPA 5F5CA 3WNMA 1PVXA 3ZXGA 4OHYA 3ME2A 4CCMA 2X10A 4LPLA 3IBMA 1ZRDA 2IXIA 1AL21 4O9GA 2VE1A 3UJQA 2VMFA 2XBO3 1KDKA 4KWKA 4AVCA 2PHWA 3W20A 5FYYA 3V0AA 2UY9A 4FQZA 1XBFA 3CEWA 1DLCA 4XYXA 4FPCA 1CZVA 1DQ6A 5IUQA 2ORZA 3ZYFA 4MGQA 4NAOA 5F2SA 2ZGTA 4ET7A 1V9U3 3LA2A 3T1MA 1G9AA 4ZS3A 2ZMLA 3RZZA 3LD8A 1W39A 4UFKA 5FP4A 5C70A 5JCTA 5JI9A 1R081 3OOXA 2VW2A 3WQ0A 3W5NA 1FPN2 5GZGA 5FZMA 1F15A 5C8CB 3QLQA 1MACA 4QX7A 2GNTA 1V70A 3SNMA 1ZM1A 5FY7A 2R061 4QXCA 2W1WA 4XBQA 3RZKA 1QDOA 2CAVA 4N7IA 4R9DA 5B2GB 5ACA2 1PX4A 5A7SA 4FSJA 3LOIA 4RYDA 1L7LA 5CG9A 3I49A 3I3MA 4YW1A 3TWIA 4XFFA 4RGGA 5TSWA 3FLRA 1RYYA 1OLME 2XJSA 1D4M2 4W50A 1RVF2 2Q1MA 4AL9A 2A3WA 4LR4A 1FOD1 2W1SA 4BQ4A 5BNOC 3JB4C 1NLSA 2XUMA 4ASMB 3PVNA 2BTVC 3OSDA 5FZ7A 2V4AA 1F4HA 5FY1A 1D2SA 4YW2A 4XF3A 4CE8A 5FAXA 2QDNA 3WNXA 5T5JA 1PZ8A 4ONUA 1LOEA 4Y1YA 1W04A 2Q8EA 3RG0A 4AFCA 1RUD3 2IFWA 4JAAA 4OI1A 4WM7B 2QQMA 2WNUC 1S0DA 2D6KA 1W6QA 2HWD1 4RR3B 5H9RA 3DEMA 3TYJA 4AGRA 4RN5A 1JZ4A 1FNZA 3GZAA 4Q5OA 4BHPA 2MEV2 2UURA 3ILFA 5JOXA 1YQ6A 1HB3A 4PDWA 4LLFA 1ULEA 3VBRC 3ZOIA 4UW6A 5FP7A 4E27A 1UF2C 3SKVA 4AI2A 2VM9A 1WCQA 3HIFA 5A3WA 5KXEA 3NV2A 3WOGA 1R093 4ATFA 2RS33
chains in the Genus database with same CATH topology
4HKLA 4GB33 2G9FA 4BIOA 3ZXLA 1AR61 1CAXA 1LR5A 1GZWB 2YPJA 2WLQA 2ZAHA 3OJBA 2GN7A 4HN0A 2JG8B 1CD3G 3PJQA 5KHKA 2FMYA 4CDUB 2A6ZA 2XBO1 4YVSA 4RFT0 4Z1VA 1AJOA 2P3KA 4NHLA 1WMDA 1IS5A 2PHFA 2ENRA 5T55A 2R1DA 1VBA2 2BNNA 2P34A 2XWJB 3PTYA 2VMGA 4AGVA 1A8MA 1H4GA 1RUG1 2B39A 3WP5A 2B5HA 3RQ0A 4UBGA 3VBFC 1AJKA 3V0BB 1DBNA 4C1XA 4LBLA 2O8QA 3GBWA 4K9SA 1H8TB 3GF6A 2YC0A 3LAGA 2YV8A 4COWA 4M3CB 1RUOA 4FTSA 3WUDA 4HK8A 4UW4A 4AEDB 3U07A 2YYOA 3PJYA 4XF0A 1H9WA 2CGNA 4M3CE 4PLOA 4Y22A 4CEYB 1RUE1 2VPVA 5AVPA 3E6BA 1Y7BA 1W0PA 1YIFA 2EIGA 4Y1ZA 2PHUA 3MI8A 3OGJA 5FO9B 3ELNA 5BNNC 2HWF2 1N1TA 1RHI1 2D3RA 4X8NA 5L7OB 2JENA 2R073 4Q4X3 5JVVA 2W39A 1W6NA 3S30A 2ZHNA 4IQPA 4FPKA 3N7MA 3ZSJA 2DVGA 2ZABA 2F4PA 1X50A 1RUD1 5F9TA 1CPMA 1YFUA 1UMZA 3BIWE 5ABJC 1MR5A 1QJY1 5HXVA 4JGYB 3JUUA 1IGOA 2ZGMA 3E97A 3P3NA 4Y20B 2DVFA 4KU8A 2E7QA 2OZJA 3CNAA 4E2GA 1XNBA 2P3IA 4DY3A 3AZVA 2I2SA 2DFCA 5BNOA 3D4KA 1GICA 2DU1A 2P17A 4KH9A 3VZMA 4GB31 3VBOC 4HT1T 4XFGA 4ORFA 4H14A 3CF6E 3WR0A 2BNOA 3BODA 2R0FA 3O0WA 3ZFFB 3SH4A 4YZ3A 4OUMA 3ZO0B 1DZRA 5T5OA 3S6PA 2RR13 1RUC2 1MZFA 2XGXA 3IDEA 1MEC2 1EAH1 2JECA 3MF6A 5H9QA 5EYYA 2DU0A 1RUI2 4I2OA 3FC0A 1V00A 2GH2A 3MDPA 1GQHA 1LOFC 1Q43A 1YXWA 4XQWA 4BLIA 1DGWA 1NE6A 2XPJA 3U11A 1VJ2A 3SITA 4YGEA 4OUSA 3AYCA 2ZMNA 3R0RA 4LO8A 4LBQB 4X6RB 1LENA 4WVVA 2HWC2 1OA4A 4OI2A 2PLV3 2WJSA 4CDQC 2PAEA 2WS93 2EXHA 1RUF3 4XFAA 3VKNA 2D6PA 2DTWA 1PK6C 3TRSB 4LHLA 3NWKA 3UV9A 1MVQA 1H2KA 3CJIC 2B8MA 3ZXKA 2WT0A 2H6BA 3USSA 2ZBJA 3J4UH 2PA7A 2JEMA 3LKJA 3EHKA 5GM0A 4J6GA 1ZVFA 2BBVA 2MNGA 4L99A 4X6QB 3B00A 1UL9A 2ZX3A 5E1RA 5EWSA 5FOJB 2DCKA 1AXZA 1YFWA 1MQTC 2R071 4EWDA 1JW6A 2NN8A 1NE4A 4JDNA 4N90A 4GMP0 5GJ6A 2OUHA 1LESA 2IZWA 4Q1RA 4LBOA 1R1A2 4Q4V2 1X33A 2OIIA 1TME3 1S2BA 4FO9A 2IXLA 1VBC3 1LTEA 1DQ4A 3I54A 3VHNA 1UW8A 4FPEA 1LGNA 1YIPA 2B7YA 1WW5A 2ET7A 3NAPB 5J98B 2XWBB 4MLOA 1VR3A 1MS0A 3DUIA 2QZ3A 3KGZA 4L11A 5JOYA 5FO7B 4CEWB 1I3HA 1TEIA 3LA3A 3ZFGC 3AP5A 4XJ9A 2GNMA 5SV5A 3KZ4C 2X5IC 1H8VA 1KFUL 3V65A 5J48A 4YVWB 2ZX4A 3ZMNA 3KM5A 3WLUA 4DY5A 4RHV2 4QQLA 4LE4A 2VW1A 5K0UA 1A3KA 5L19A 3IWZA 2Q4SA 1AYN3 3EQEA 4XIOA 5ABJA 1QJX1 2RR11 3VDDC 2PAMA 1OPMA 2YGMA 2KM2A 4BMEA 4AEJA 3AZXA 1C57A 2PHRA 2XJVA 1OKQA 1RGSA 5EV7A 2UWCA 2RJLA 1RIRA 1AVBA 2HWB2 1M06G 1V6IA 5KWRA 3L9JT 1PO11 2CGOA 3VBOA 2BVVA 5I0RA 5I8SA 1LHVA 2ARXA 4AQ6A 1JUIA 4BLJA 4QHBA 1QU0A 2BVBA 1J58A 1VRH2 2PYTA 1VAMA 5T5PA 1WW6A 3AZZA 4BCUA 1IPKA 2A3YA 3MW4A 4M01A 1O4TA 1U0AA 4Y5Z0 4UBHA 1AZDA 1AXKA 4MYEA 2HEYF 4YW5A 1WLTA 1YI9A 4CDWB 1HRV1 1CPNA 2BUKA 3KGLA 4QGMA 1RMU2 4DQAA 1OFNA 5K7PA 1VB2A 2G9GA 1RUJ1 4INDA 4AI1A 1HQLA 1F8VA 4V1PA 4IV1C 1BBT3 1YHFA 4AQTA 2UWAA 4I3PA 2CGPA 1QOOA 3AZYA 1PO21 3QH7A 1OOPB 5I0UA 4CDQA 3AMHA 4GIQA 3FBMA 2CWSA 3I4IA 5SV8A 2DUPA 1PK6A 5T3NA 5J37A 1E57A 2BFUS 1TME1 3ZXJA 3NJZA 3CJIA 4XMAA 2RS51 4KWLA 1VBD3 4GMP3 2VG9A 3JBG3 4XQDA 3MW2A 5BNPC 4GQ7A 2ES3A 5AVAA 3L2HA 1QOTA 4OVEA 2C1FA 1LKNA 4YM1A 1RUNA 4FPLA 3R05A 1H1MA 4PF5A 1VBE3 2RS11 2HWE3 4IEVA 1MQTA 1CJPA 4JVAA 1LU2A 4YYOA 1V6JA 4XBLA 2I74A 4B4RA 1VAKA 3A0KA 5CFDB 3E6CC 3SISA 1POV0 3AKQA 3C3VA 4HBNA 4D7SA 1YO8A 4YW3A 5GALA 1RINA 1CX4A 1XE7A 4WVMA 4NHKA 3IPVB 3I2DA 2JXAA 3J9SA 1AYM3 4A7ZA 3ZYGA 4NVPA 1FT9A 1JXNA 3MPBA 4N53B 3AK0A 2A6VA 2EALA 2GSYA 5A33A 1G9CA 2ZA9A 5IK7A 2R041 4GXLA 2QNKA 5FTTC 1JYCA 1RITA 2DYCA 4Z82A 3ZFEC 3LCPA 5FFOC 1WMEA 1SLIA 2EAAA 2PELA 4K20A 3EO6A 1QJU1 2X5IA 1UIKA 1ZBE1 2VY0A 4OZXA 2ZGRA 4KGQA 2E53A 2IXJA 3USUA 3Q9OA 1FNYA 3KLSA 2CWMA 4Y4YA 3I59A 3VDDA 2EXKA 4RQPB 4J1WA 3ETQA 4JCKA 1BEV1 3OPZA 1KJLA 2IFRA 5KC5A 2VNRA 5C4WB 4MZUA 4COVA 1PHMA 4PJYA 3RMYA 1C8M3 2ZKNA 5I93A 2VVEA 3H3ZA 2WQZC 4IEPA 1BBT1 5JSPA 1PIV1 3M2MA 1ZA4A 1WW7A 2VUAA 3MFCA 4Q0SA 2ZAAA 5C8CC 5JIUA 4C0HA 2EXIA 4XBNA 1COV2 3MLKA 1LOCA 1O5UA 3S0MA 3FWEA 3QACA 5T54A 1CESA 4JTNA 2TUNA 2OYZA 1GV9A 1AR92 4Q26A 4LO6B 1REFA 3WP4A 1QXRA 1L3JA 3WDVA 3S7EA 4YG3A 1ZNPA 1N1VA 2VOXA 2DF7A 3JBG1 3FHIB 3RDIA 2BWAA 4OULA 1AL23 4ZU5A 1Z78A 1ND3C 1AR83 4COZA 4Y1UA 2AZ5A 4HSLA 1AX2A 1T6GC 1UU4A 3OTFA 2GC0A 3URFA 4MH0E 3B9IA 2DCYA 2D6LX 1DZTA 1NXMA 4FPGA 5BYNA 3WP6A 3MFAA 4YM0A 4WM7C 3R4DB 2VULA 4RR3C 2SBAA 1AYM1 1BYHA 1R083 3MIDA 1WMFA 1POV3 3PVBB 1B35B 4EN7B 5BNPA 3VL8A 4H55A 4SLIA 1XYPA 4P9GA 4YG0A 2B45X 1FMD2 1H2LA 1SFYA 1IKPA 2R063 3WG4A 3U0ZA 3RYKA 3ZSMA 3TAYA 1XU1A 2EAKA 4AXOA 4AE2A 2ZTNA 2O0OA 1X36A 2JG8C 5CU1A 4BM8A 4CDUC 2CNAA 3G7DA 2WQ4A 2D5HA 1DLLA 1MS4A 1VAVA 4Q4W2 1DYPA 3WDUA 3AFKA 1NA1B 1UAIA 3PMEA 4GALA 1YRZA 1HRI1 5HCFA 2CL2A 3INAA 1FOD3 4HPKB 1JHNA 1ZRFA 5FQ0A 3ZFEA 1CGPA 4X8PA 3D6EA 3OYWB 1WW4A 2DURA 1OD5A 3JQWA 1NQDA 3VKOA 3M8LA 5JZGB 4E4SA 1QQP1 2R30A 4AHZA 2HWD3 1H8TC 5FLHA 1Q8VA 3NW4A 4LTAA 5CIRA 2OUJA 3QD6A 5GLWA 1V6LA 2UYBA 4CP1A 3AZWA 2D98A 3M3QA 4JDOA 5CNAA 1ND2B 4TZDA 4CEYC 4IXLA 1KITA 2D40A 4QM9A 2JKBA 4LUMA 1CAVB 1AR63 2RS32 3EXUA 3OY8B 4LE3A 3SLIA 4FAGA 3MPPG 3SCGA 3AP7A 3FBYA 4N9IA 1AR81 1LHOA 2GZWA 3W59A 5L7OC 1K5MC 3M3OA 5C8CA 4J1XA 4RSUA 3M1HA 4DXZA 3RWNA 1ULDA 4LBKA 1F2NA 5HBAA 2EF6A 4PQ9A 1FV3A 3MLJA 1RUG3 4FTBA 3M7AA 3AM2A 1QMJA 4JGYC 1NY71 3RI8A 5HCAA 2H0BA 2WNVC 1QHDA 2ZZJA 3WCSA 4LHKA 1YCIA 3D0JA 3MLLA 5EFUA 4FOVA 1KS5A 1MS3A 3GALA 1POV1 3JD71 1IOAA 2AREA 3JZVA 1ND3A 3ZXDA 2K2SA 4MX3A 2OW4A 2DFBA 4N43B 5CVRA 4NWVA 4LHNA 4CDXB 2XJQA 3ZSKA 3WW3A 4S2HA 3AP4A 4IEXA 1DHKB 1PZ7A 4XJ8A 3ZFFC 4HVOA 4WM7A 1RUE3 4ZKTB 2ILMA 1DU3D 4Q1PA 4YGBA 3BOPA 2WFF3 3B01A 1RJ8A 3V0AB 2NYYA 4DB5A 1FYUA 1RHI3 1H30A 2YROA 1REDA 1ZYBA 4P9JA 2QVSB 3AYAA 2NQYA 5EYXA 1LRHA 4JGZB 4Q4X2 3C2UA 2QUOA 5T5LA 2C5DA 1GZWA 3FJSA 2JG8A 2RMU3 4GH4B 3ZXFA 3A4UA 1KRIA 4OHZA 4CDUA 3J8F1 2NMNA 4MXVA 1QJY3 2BNMA 4FPYA 2D43A 2VMIA 4AI3A 4YSFA 4Q8KA 1ZBA2 3BALA 3FZ3A 4BE3A 3TN92 1DFQA 4K21A 4QQPA 4B7EA 1O3TA 1Z7S1 2VU9A 4LA3A 4FOQA 4YM3A 1ASJ3 1IS6A 3DF0A 3RYRA 2XH6A 1GR3A 3K48A 1RUH1 4IETA 4ISRA 2VW0A 4XJAA 1GSLA 1IS3A 5LK7B 1H8TA 1G86A 3M3EA 2BQPA 5DDJ1 1EAH3 2FMDA 4I3GA 1LB2A 2GDFA 4AVBA 1PVC1 1D0HA 3JQXA 1DYKA 4PLNA 5C6CA 4LO5B 1I9RA 3GZTB 2ZGPA 1LGBA 3NKTA 3B02A 1C5IA 4CTEA 3WINE 1GNZA 3N4MA 4XE9A 1CAUB 4P9XA 1W6QB 2JG9B 3NAPC 3ZN4A 1AR71 1LHNA 2E7TA 1AF9A 1SLAA 2MHFA 3LOBA 4N9HA 2D7FA 2XVKA 1ZREA 5LEKA 1K5MA 1RTVA 5EXOA 5J7MA 2RM22 2PLV2 3E5UA 3WD5A 2WS92 1UPIA 2N7GA 1RUF2 1VALA 3H50A 1IS4A 3POYA 1QKQA 4KU7A 2ZX0A 2NM1A 1CAXB 2A71A 4K8FA 4Q4Y2 2PQQA 4FAHA 2TBVA 1ZX5A 1GLHA 1FPN3 3KD4A 4LA2A 4JGYA 3MW3A 4AYUA 4LULA 2WNVA 4YVSB 4QD2A 2RJKA 1Z0HA 2WFF1 4Y20A 2XVGA 5I91A 4M3CF 2NLRA 5JPMB 4AI0A 2HEWF 1F31A 4S2GA 5ACA3 1VB4A 4AQSA 4B4PA 1A78A 1DQ0A 1QY4A 4DZGA 4QGLA 1SLBA 4NN0A 3AMNA 3RPQA 3HWJA 1DG6A 2DUQA 2XVLA 3AKTA 5DUWA 2EA7A 4CZSA 2RMU1 2MPFA 4IEOA 3ZFFA 5AC92 3KSCA 1IPJA 4RL7A 1TMF2 4YZ2A 2QJVA 3MEPA 3MIFA 4QPGB 1AXYA 3TOJA 5BXXA 1VBC2 2NZ9A 2VQ0A 3FLPA 4DINB 3SH3A 4MXWA 4XFCA 1NCQB 1KS4A 2BW8A 1FAYA 1PGW1 1ZZ9A 5GZEA 3ZMOA 4ES8A 1BMV2 2XLFA 1WD4A 3FMGA 5JR7B 3WDXA 3BCWA 4PBPA 1ASJ1 4MGZE 1Q5OA 3MIBA 2TEPA 3N35A 4XJWA 4AG4A 4RS5B 4E9KA 4XJUA 4LBQA 1QJX3 2WNUA 2R16A 5C9AB 1ENXA 1X8MA 1AYN2 1TQ5A 2AH2A 4K1YA 1OOPC 3BB6A 1CAWB 4I0AA 3PNAA 4YM2A 2E9QA 2V73A 2PAKA 3OCPA 4P14A 2CYFA 2XHKA 1H1AA 3EJKA 5FLJA 3VBRA 1LODA 1ZZCA 1REEA 1GANA 1AX1A 1XNKA 2BYVE 3RRDA 1BK1A 1N1YA 2XJTA 1PO13 3B3QE 4U36A 5J09A 1J1TA 1VLNA 3PLQA 1G9DA 5DG2A 5T50A 2Q1ZB 2VNOA 2GU9A 2A73B 5DZEA 1GQGA 5GLVA 4I0BA 5CAZA 1Q56A 2A6XA 4H7LA 1IQAA 5FOBB 1BCXA 5CFDC 1FI2A 2ZX2A 1HW5A 1BKZA 1G9FA 1HRV3 4QX5A 2XL9A 3POSA 2XKOA 3LA7A 4JRAA 4QMAA 4NWWA 5A32B 1RUJ3 1FPN1 3N3HA 3OBRA 4XFIA 3WV6A 4D94A 1GYKA 4N53C 1C8NA 4XJZA 3VBFA 5JOWA 4OHXA 3IMNA 3M3CA 2GH8A 1PO23 1NZCA 4P9WA 3VBHB 1UKGA 4R9BA 4MUVA <