3MIGA

Oxidized (cu2+) peptidylglycine alpha-hydroxylating monooxygenase (phm) with bound nitrite, obtained in the presence of substrate
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
309
structure length
309
Chain Sequence
ECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peptidyl-glycine alpha-amidating monooxygenase
publication title Differential Reactivity Between the Two Copper Sites of Peptidylglycine alpha-Hydroxylating Monooxygenase (PHM)
pubmed doi rcsb
source organism Rattus norvegicus
total genus 63
structure length 309
sequence length 309
ec nomenclature ec 1.14.17.3: Peptidylglycine monooxygenase.
pdb deposition date 2010-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01082 Cu2_monooxygen Copper type II ascorbate-dependent monooxygenase, N-terminal domain
A PF03712 Cu2_monoox_C Copper type II ascorbate-dependent monooxygenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3migA02
2.60.120.310 Mainly Beta Sandwich Jelly Rolls Copper type II, ascorbate-dependent monooxygenase, N-terminal domain 3migA01
3MLLA 4QHBA 1SDWA 3MIGA 3MIDA 1PNGA 1YIPA 1YJKA 3MIEA 1PGSA 1PHMA 4R4XA 3PMSA 3MLKA 1YJLA 1YI9A 3MICA 3KS7A 4R4ZA 3MIFA 3MLJA 3PHMA 4E4ZA 3MIHA 1OPMA 1PNFA 3MIBA
chains in the Genus database with same CATH superfamily
3KF3A 4H55A 4BH9A 2OA2A 1K42A 4XACA 4P9XA 2W2IA 5FY8A 4CP1A 2HWC3 3GDBA 1LGBA 1OFSA 2P3JA 3G6JB 3SNMA 2EXHA 3W20A 1AYM2 1QEXA 2HWE2 2ZKNA 1LOGA 1UYXA 2R49A 4QQLA 1ZZ8A 2JE9A 2VMFA 3KLSA 4URTA 4AQSA 1ENXA 5CFCC 1R082 2UWAA 1WLTA 4DO0A 3KQRA 2VQAA 4YSFA 2FZ2A 2XUMA 4CCMA 1AYM3 1QOOA 3OY8A 3PHMA 1LKNA 2P4EA 4QPIB 4QU1A 1X36A 2X53S 4I30A 2GP5A 3WCSA 2OQ7A 1TME2 2H0VA 4Q8KA 1BKZA 3HQRA 1SLTA 4KMQA 1JXNA 1UX7A 1WW4A 3ZXFA 1D7PM 1IPKA 1Y4WA 2IXIA 3IB3A 3O0WA 4QKBA 4B7EA 1V6NA 4BQ5A 2ZGQA 3M3CA 5C70A 3BN6A 4WZCA 2VMEA 4AI8A 4YM3A 1W9WA 1RMU1 1LODA 5FZIA 5FPUA 3GJBA 2BTVC 2ARAA 1AR81 4XBLA 1TME3 4YPJA 3VBUB 4CEWA 1O8SA 3G7DA 4GH4B 5FY1A 5T50A 1BBT2 1KFUL 4NUBA 3RQ0A 4CUCA 3A21A 2IFRA 2ZA9A 3AFKA 3O12A 3I3EA 4N53B 2OPWA 4FOYA 1B35C 1U5YA 4XC9A 5C8CC 1U0AA 1W03A 2NN8A 1ODMA 2YC0A 4LUMA 3UGGA 3LB9A 1O4TA 3VBHB 3WHTA 5FQ0A 1PNFA 4CU9A 2VULA 2Z4FA 3KCCA 4L92A 1Z78A 1BBT3 3KT7A 3L2YA 2P1BA 1JUIA 1OH3A 4GXLA 3OEAA 1BQPA 4WVVA 3U4SA 3VBHA 1LU2A 5BNPA 2F4LA 4TTGA 3APBA 5IAVA 2WINB 2VC9A 1UY3A 1PZ8A 2WYSA 4K9SA 3HQUA 4RSUA 2GC0A 1AL21 4NPRA 3I2OA 3CJIA 2ZKLA 1JN2P 4QHZA 1UXXX 1OVPA 2Y6GA 5A80A 1GP6A 5EYXA 3ZKUA 1ULDA 5F3EA 1G9AA 2ZGPA 5ANNA 4CP9B 1JZ2A 1MVEA 1URXA 2RV9A 2XL7A 3D6EA 4XF3A 2FCVA 3I2DA 1VBB1 2QJVA 2JG9C 5HCBA 3RNSA 3VLBB 3WINE 5JLVA 1OUXA 1X50A 4HVOA 4XBQA 2VZTA 1UOBA 2JICA 1DQ1A 4L2NA 1REEA 1YUDA 3T1MA 1DDLA 3K51A 4FSJA 4B4RA 2FDKA 1VLNA 3VDDB 4UW3A 4LJHA 4IUGA 2X10A 1WA6X 3ZXGA 2UYAA 1KD7A 5IK7A 1JYIA 1MZ5A 4JZRA 5EFUA 4Q4W1 5AVPA 1LEDA 2F4PA 4I3GA 3VZLA 1RL3A 4O61A 4PCRA 3WW1A 4CCOA 3LDRA 1N1YA 2E33A 5LBFA 5BNOB 1UYZA 5KC5A 5LA1A 2XB6C 1F15A 3FX3A 3HJRA 1CAWA 4AEDA 5J09A 4Q1RA 3SH4A 2BWAA 3LCPA 3UNPA 5JCTA 4LHKA 5I8YA 1P8JA 2CNAA 2WAAA 4UW5A 1WD3A 4IV1C 1VAMA 1COV2 3BPZA 4KGQA 4KU8A 3RYRA 3VKMA 2JKXA 4LO4B 2JE7A 3ES4A 2CHHA 4AVCA 1VP6A 1H2KA 4QPYA 5J96B 1SMVA 3POIA 3O1PA 1MZ6A 1W0OA 3NRUA 5J1XA 1U5ZA 1UU6A 2J1VA 4UF0B 3RG0A 3CO2A 3K3OA 1JZ8A 5I93A 3EJKA 4F7ZA 1RUJ2 2F17A 1COV3 5IWFA 2YHJA 3ZFGB 3HBKA 3I8TA 4BIOA 5LEJA 3UT0A 1HB1A 1Q8QA 2ZHNA 2TUNA 5F6KA 4O65A 2A75A 4KBZA 4J1WA 4P02B 3VBRA 1I1EA 1PM7A 1AX1A 1Q56A 1OD5A 1RUJ3 3I3DA 4YWAA 3O0VA 1RXFA 4QDRA 3JQWA 2XBO2 1F5FA 1WMEA 1PZ7A 4G3YC 2BU9A 1QJEA 4WVZA 2HBUA 4NVPA 5E89A 3MW3A 4Y24A 3U10A 3TEWA 4RN5A 1AHSA 5JXHA 3PIJA 5HXMA 1UKRA 3C7OA 2FDJA 2YUEA 4NHLA 1PGL2 3BTZA 3NNJA 1AXZA 4ASKA 4YVSA 2Y6JA 4D8MA 3UGHA 2Y0OA 1HQWA 2XBO3 3D4KA 3PVOA 2X5IB 3HEIA 4IE5A 4N43C 2GC1A 2D40A 5HBAA 3Q8BA 2WNVA 2Y8KA 1H1MA 1LHWA 3SITA 2ZPXA 5F8PA 3B00A 3D0JA 5KC6A 1XE8A 1OOPA 1MVQA 1Z7S2 2P3KA 4W65A 5I0DA 5JSOA 5FZ9A 1J83A 4CDXC 2Y34A 4IV3A 1H6YA 1OLME 3SKVA 5JZGA 3H8XA 4MGIE 3IDAA 4FFFA 2Y26A 3T2TA 4AL9A 1A8DA 4PF5A 2R061 2A3WA 1OD3A 4PIZA 4UYBA 3N9MA 2VZSA 3OD4A 5CB7A 1Q8SA 1Y9GA 1Z7S3 2W1WA 5BNNB 5C6CA 4PQQA 1JYTA 4JCKA 1R1A1 1EAH1 1NXMA 3K4ZA 3OUHA 3GZAA 4META 4N9IA 1GR3A 4WM8A 4I09A 5EWSA 1VBE2 2YDEA 2DTWA 3TYJA 3GNEA 4LLOA 4A4AA 3MW2A 2W87A 4ZU5A 1DQ4A 3RJ2X 4OVEA 1H8TC 3NJXA 4PF1A 1CN1A 3DYMA 3I7DA 4B4QA 1UO9A 1HN0A 2EVXA 3MZHA 2D98A 2ZEXA 1W39A 1BVVA 4K3UA 1VBE3 1GANA 4MXVA 4LO6B 4IEXA 1GU3A 2MPFA 5A32B 4CZSA 3HBZA 3WCRA 3EYPA 3DCQA 4W6YA 3GZUC 3M3EA 5L9BA 4DMIA 2GSYA 5A32A 1L3JA 1QXJA 2AENA 3N9PA 4AE2A 1PO11 4AWDA 4OHYA 5FDBA 4AXOA 2EICA 2XWJB 1GP4A 1N47A 1HV1A 1PMIA 3PTYA 4W6XA 3ZXLA 3AKTA 4AFAA 3D0SA 1JS9A 4JQRA 1HJFA 5FZOB 3ACLA 1DHKB 4AGRA 3C7EA 3U75A 4GA9A 1JBCA 1EY2A 3UGFA 1QH7A 1LHUA 2VO5A 3ALQA 3ASIA 4A6SA 4DXSA 5C33A 1WBLA 2H6CA 2XDVA 1F35A 3MLKA 1JYVA 1ZBE1 3GXUA 1NCQC 5DAWA 5EQUA 4YGCA 3ROUA 3R4UA 5B2GB 3H7YA 1JOBA 2DWRA 1ZZ6A 2OPKA 4LQRA 1BK1A 1J3QA 2P2KA 1LJ7A 1SLAA 3B7MA 2DU1A 4ZU4A 4LOSA 4LULA 2UU8A 3ZSKA 2ZOEB 2XLAA 4LK6A 4D6QA 3LEIA 4DB5A 2RM22 5L9VA 4DXZA 4O9EA 3ZDSA 3VZJA 1WW7A 4RQPA 1Q8OA 1FPN2 4EROA 5JZGC 5FPVA 4QKFA 4M0NA 3RS6A 4Z92B 3Q8EA 4EN9B 4ISQA 1O4ZA 2RM23 3CZJA 4WZFA 4QM9A 1FPN3 1W2TA 4BQ1A 3AJZA 2DFBA 3O1UA 3MPBA 1PK6A 1HXS2 5AC92 4YM2A 5IVBA 1GZCA 1LENA 5FMOS 3H8OA 3V56A 2ET7A 1NOVA 3OGSA 1UMZA 4UI9L 1KS4A 3MLLA 5EZWA 1GNZA 3ZDVA 1NYWA 3WNLA 4YG6A 1OA2A 2FMDA 4PJYA 4Y4YA 4AI0A 5C3QA 5ISLA 3LPGA 4FPFA 4OUEA 5A33A 3AM2A 2QQMA 5FUIA 1L7LA 1G9CA 2C24A 4DQAA 3ACGA 1HXS3 1UPIA 2CGPA 3MV01 3CZUA 5FKCA 2IUWA 1CIYA 3MFCA 2YBKA 1QNYA 3LQCA 1GNYA 1HW5A 2WT0A 4IGOA 1YJLA 3I3BA 3BU0A 3PUAA 3E97A 3OGJA 2JG8A 3WNNA 4QHOA 1U5XA 5K9YA 5KXCA 3J7MA 3RZKA 5F2SA 2CU5A 3SEEA 4QPIC 3M8LA 4EE2A 4QD2A 1NCRA 1W90A 1DP0A 4FPEA 3OYWB 2YGMA 2ES3A 2J1EA 1W6QA 4HVRA 1C1LA 2IFWA 2QDNA 4P9GA 4JGYB 2ZHLA 4AGVA 4BMBA 4IXLA 1F4AA 4PDWA 4CEWC 3WT3A 1OMIA 1XNDA 3RZHA 3VHNA 1RUH2 3POWA 1ULOA 5CFCB 2ERFA 2ZMKA 1YI7A 2JDHA 4P9JA 4GH4C 1GBGA 1H2LA 4BCUA 1XRUA 3N9OA 4MUVA 4I0AA 4N53C 2WO3A 2VVEA 1IS5A 3AVRA 2ZEWA 3AYDA 5GZCA 2HWF1 4PLNA 3VBHC 1RUH3 2DBIA 5KHGA 1OURA 2XKPA 5F2WA 5D8AB 5IK4A 1HRI1 1V6JA 3UKTA 2FZ1A 1D2SA 4Q29A 2QQPA 3VD4A 4EZ4A 3F95A 4QKDA 2IVIB 2YG0A 1H9WA 1FOD2 1G9DA 1XXNA 1UW8A 4AW7A 1K45A 1NA1A 5A7SA 4K1YA 1K3IA 2VTXJ 2ARBA 4YNIA 2RS51 3PL0A 4HSLA 1LEMA 1GUIA 4HKOA 2QKDA 2UY8A 2VD7A 2PFWA 3M3OA 1G7YA 3KS7A 5DUWA 5C3OA 2PAMA 4WM7A 1OQDA 5E88A 5SV5A 2BV4A 2E51A 4AI3A 3MHZA 4KWLA 1FOD3 3J8F2 1RVF1 4AFMA 1YIFA 3AMMA 5FZ4A 3VD5A 1UX6A 3VZMA 2ZEYA 2ET1A 3AP9A 3B9IA 2HYXA 2JEMA 3IWZA 4CDUA 2LM3A 4RGAA 1CQ9A 3GBFA 2OZJA 3KVBA 3LEMA 4W6WA 2Q8CA 3I54A 1WGPA 5JSRA 3IBMA 3J8F3 3VD9A 3VDDC 3KHBA 1O3RA 2W1UA 2Y6FA 4GD4A 1TVGA 4BXFA 4E4SA 4EN6B 2EAAA 2Q8EA 3K3NA 4A44A 2W1SA 1NZIA 1LGCA 4FI9A 4QXKA 3SCHA 2YU2A 3IMMA 5FK8A 5C8WA 2OQ6A 4AEDC 2BQPA 4GJYA 3O0XA 4RS5A 5EIYB 2ZBJA 4WVWA 1KFXL 2CY6A 1NT0A 1ULFA 5BNOC 1FI2A 2Q0AA 2RMU1 1PMJX 1RUE2 1Y3TA 2OIIA 3FLRA 2PMWB 5FZGA 3ZXEA 2AACA 4Q4Y1 4KWKA 5FYUA 4Y1ZA 2ADEA 2GMMA 2WAOA 3V65A 1XE7A 1E5HA 3BIEA 4E2QA 2BGPA 3K46A 1YLLA 4HN1A 4RR3B 1QQP2 1C8NA 1OLRA 2VZRA 2BGOA 4FFHA 1L7QA 2JDNA 1LAJA 3HD8B 3KGZA 1ULEA 3ZN6A 2ADDA 4OHWA 1JI6A 5JPMB 5KHIA 5F32A 1RUE3 4LPLA 4RR3A 3OBZA 4QQ2A 4XFIA 1PGSA 5HXVA 3TB0A 3CEWA 1JYXA 3IPVA 3T0AA 1YQ6A 2VCBA 1YEWA 1M06G 1RIRA 4LT5A 1GOHA 1V6LA 2O8QA 3LPFA 1QQP3 1T6BX 1KRIA 4CPBA 2AR6A 1J3RA 4QXCA 3E6BA 4B4PA 2LS6A 5BUVA 4ISRA 4TLGA 4ZY9A 3ZFGC 3VBSA 5JXIA 3VBRC 1UXZA 3C7GA 1ND2B 3NV2A 2XPJA 3T2OA 1U5IA 5FO7B 3OGVA 1PO22 3UKVA 5ABJB 1TG7A 4GIQA 1AF9A 5CVRA 4HLTA 1KS5A 1VMHA 3KCYA 1KDKA 2GNMA 3KHCA 5DZEA 5FY5A 3RYKA 1ASJ1 1ACCA 3CHXA 1POV0 1RINA 1US2A 3B02A 3CMGA 4W4ZA 4YVSC 3U07A 1PO23 2ZHKA 1MS4A 1Q5OA 1Q43A 1US3A 3DYPA 4HZFA 4C1WA 3WDUA 1IKQA 1OF4A 2W46A 1UY1A 3ECQA 4LKEA 4A3ZA 2WNVC 5F3CA 5CG8A 1UD1A 4BLIA 3UV9A 3SHRA 1SQ4A 2X5IC 1QH6A 5JIUA 2W5FA 4L99A 4MADA 2ENRA 1WW5A 1GSLA 3FUOA 4FXGB 3WF0A 1A6CA 1SACA 4EN8B 4R9DA 1T6GC 1OQEA 2A6YA 1PIV2 1RITA 1D0GA 2P6HA 2PN5A 3AMQA 5FV3A 4Q4X3 5J48A 1OC1A 1UOFA 4N90A 5JMOA 1DZTA 3IKWA 4Q1PA 2D5FA 3DPRB 4YW6A 2XVLA 2OXBA 5FUNA 3DUIA 1EPWA 1F2NA 3UETA 3ZMOA 3W5NA 4MGTA 1KDMA 3CU7A 1W9SA 3AZWA 4ZPIA 3HWJA 1GMMA 2B46X 3WQBA 4AVBA 4BYYA 5FK7A 4LA2A 3UESA 1PIV3 3NAPB 4WM8C 4CCDA 1UOJA 3PU8A 1YXWA 2VOKA 3EBRA 3M7AA 3WQ7A 4EJRA 5A70A 5BNNC 5CADA 5DG2A 3KZ4C 4QGMA 2WO2A 1DU3D 2XKOA 1UKGA 1AXYA 1H4HA 1VRH2 2VBBA 3M70A 3PUHA 1FMD2 4HKWA 4JV4A 5FZ7A 3FN9A 1ZZ9A 4K8FA 1X7NA 1LR5A 4R52A 2D93A 2MEV2 5GLVA 3SCFA 5C3SA 1LOEA 2ZX4A 5C5UA 2CAVA 3FLTA 3JBG1 3BVCA 1JOPA 1XQNA 2KA3A 4O7XA 4OULA 1VRH3 1WZXA 3POYA 1V70A 2OUJA 4IE0A 1FMD3 1DQ2A 1R091 1NLRA 1RJ7A 1WA4A 3BOPA 3PMSA 4LXLA 3N3HA 3K4DA 2MEV3 2LALA 5E6HA 4CXYA 2RVAA 1CWPA 2B8MA 1JW6A 3BALA 3SEPA 1OKQA 4B29A 3WNMA 1LOFA 2GU9A 4IEVA 1W06A 3HNYM 1JZ6A 3PTRB 5IVVA 5LB6A 5FZLA 3K75B 2X05A 3NNLA 4LHSA 2J7MA 1ZA4A 1KXGA 1VE0A 2A6ZA 1KJRA 2GZWA 3KV5A 2FDFA 5CFDB 2WYFA 3JB4C 4C90A 2WN3A 4LORA 1UYYA 4COZA 2Q8DA 1YJKA 1T2XA 2JD9A 1E5IA 4MH0E 3WP6A 1IG0A 2DURA 2Z5WA 4XMIA 5CFDA 1ZA7A 4FAHA 1C8M2 2D43A 4XFGA 5F3IA 5JOYA 2AC1A 4QPGA 2VQTA 2ZXQA 4QXHA 1EYBA 1QXPA 3KWVA 5FZ0A 1FXZA 5C9AB 4CDQA 1SZBA 5A1LA 3HNBM 3U14A 3WP4A 2P5BA 2WNEA 4D6SA 2BFUS 1C8M3 2ZGRA 4I02A 5FYVA 2ZX1A 3SKJE 2HWD2 4ARXA 1WBFA 3NJYA 3WLUA 3J9SA 4M3CB 5LW9A 2WZEA 1UY2A 2PHLA 2ZGKA 1UN1A 2HWE1 4IERA 1S55A 2VW2A 2HKXA 2Q1FA 1RUC2 5CKMA 1AX2A 2XMLA 1QU0A 4BIFA 2XJVA 1CONA 3JZVA 3RSJA 1R081 3V0BB 2I74A 1QJZA 2HWD3 1WCKA 4S2FA 4MXWA 1OF3A 2KM2A 3WF2A 5CA6A 2VBPA 5KR7A 1ENQA 1NUKA 1PK6C 1XSRA 2D6PA 4I0BA 2WFF2 2A1XA 2QQJA 4UT5A 5FMDA 2W9XA 3AZYA 4FFIA 3Q9OA 4LIUA 4P9IA 4E4ZA 4BXSV 1RUC3 3QACA 4COYA 3LWCA 1HIXA 5E1RA 5LY1A 1F9KA 2UY9A 5CIRA 5FTTC 3AP4A 4XUTA 1RHI2 5I0TA 1G86A 1W6NA 5A3PA 4KG8A 4RD7A 1POV3 4NR1A 3AZVA 1JYWA 1YFXA 1AYN2 5DUVA 5GZFA 1ZREA 3MIDA 3POBA 2BGCA 4TSVA 3FFZA 3Q8CA 2VH9A 5A1AA 4NRQA 3ZM8A 2EXKA 3ZYHA 2R0HA 4JKKA 3ZSJA 3VDCA 1RHI3 1DZQA 2RS32 1RTVA 1BBT1 3PUSA 3CKHA 3TEXA 1UY0A 4YW7A 4QQPA 1AYN3 2JX9A 2WA3A 2PAEA 2WO7A 1V9U2 5T55A 4NAOA 3MLJA 4N9HA 3DV8A 5DDJ1 3M4FA 3B5LB 2NLRA 3GM8A 3B01A 3GBWA 5C7GA 4EWDA 1XSQA 3J7LA 4FT8A 3CBNA 1IPJA 1NY72 5FZMA 2VNOA 2ZMNA 3NO8A 4HL0A 1TNFA 3IT8A 5FPAA 5HCHA 3PUQA 4MGQA 1ENRA 4L97A 1V9U3 4BOWA 1AR91 4JGYC 3KMHA 1GYKA 1LHOA 2DTYA 2Z2SB 4JX0A 4P5YA 3M3IA 3RWKX 4AF9A 5FPLA 3T09A 4O9GA 4PT6A 4ZZ8A 4S2DA 1KQRA 1OH4A 3WUDA 4U2AA 2SLIA 2CGOA 1AJOA 1O5LA 2RS12 1GQHA 2Y6KA 5FY0A 3RPQA 3OY8B 1PZ9A 5GJ6A 1MR5A 2LRPA 3GZTB 2PLV3 2XUEA 3ZFEA 2VUDA 2PELA 1CZVA 4YW1A 5K4LA 3RDIA 3VKLA 2JWPA 2XQRA 4CCEA 3KM5A 3RZLA 5A3TA 3UJOA 4MGSA 5FP4A 2RS13 4EYUA 3HT1A 5D8AC 4L8QA 1MACA 1QDOA 1GZTA 1REFA 2WA4A 5EV7A 3WNPA 4NPMA 4CEWB 5FO9B 3ZSEA 4IEOA 3S57A 4Y22B 4GMP1 4IQPA 1CAXA 4XUOA 3OBTA 3MDPA 2XG3A 3ZYPA 2R072 1SFYA 3WDTA 4X8PA 2JDMA 2BVBA 2K9ZA 1I9RA 2WBKA 1B09A 2QFEA 4XJUA 4XHXA 4Y22A 5FQ0B 3ACHA 2J22A 2NMNA 3KGLA 2FCTA 4N8MA 2O14A 3POGA 3TNPB 3TWIA 1S0JA 2Q5TA 3ST7A 3WXPA 1JHNA 2MNGA 3IN9A 5EPAA 5A7WA 5BNPB 4EV0A 2R073 4EZHA 1VBD1 3FUQA 4UBHA 5A3WA 4N7UA 4H14A 1K12A 2FCUA 2BBAA 4COWA 3CJIB 5LASA 2VU9A 1YFYA 3LSDA 1QJX2 3RGBA 2Y33A 3UYJA 3NV4A 1OHFA 4XCBA 3FMGA 2GN7A 3BCWA 1ND3A 2OUHA 1IQDC 1GP5A 2K46A 3JU9A 4HFSA 5CG9A 3PVEA 2GALA 4Q4V1 3SH5A 3OBRA 1WCQA 5DZGA 3I2HA 5EXOA 3NJVA 2WZR3 3MIHA 1QJX3 2SBAA 1E5SA 1Y9MA 2EXIA 2VCCA 5LBEA 1GQGA 1Y9QA 3VGIA 3NNGA 1JZ3A 4RR3C 3AYAA 4JKMA 2D6KA 2XJRA 4XUNA 3URFA 1VBC1 2AREA 3E5XA 3PUIA 1C3HA 1KJLA 4U36A 4F8AA 1OKOA 3JB8A 5B4NA 1LECA 4XJWA 3I4IA 1UCXA 1RC6A 3ENRA 4QU2A 5FXXA 1Q8VA 3BTAA 1S2KA 1CAWB 3ELNA 2G1MA 4AEDB 2WWUA 1AUYA 4IEPA 2A73B 3QOPA 4QX2A 1DGWA 3QH6A 1UL9A 1MEC1 1XE0A 2MHFA 3H1MA 2VECA 2FBEA 4F3JA 3J7HA 5E16A 3HIFA 3JUUA 2D6LX 1NZCA 2Z69A 1SLLA 4CEYA 4JDNA 4D94A 2ORZA 4KG0A 4RGGA 1LOBA 1ND2C 5J7MA 2PA7A 3NMBA 3W59A 4BQXA 5D2AA 1N1VA 2AUYA 3FFQA 3USSA 5IHRA 5ABJC 1D0HA 2JJ6A 1Z7S1 1WUVA 1LB2A 2ZEZA 1X33A 2BFUL 4MGZE 2DVFA 4FPYA 1IG3A 1S0CA 1C57A 5DAPA 2DCYA 5CU1A 4ZKTB 4DUXA 3S7EA 3T2PA 5A3UA 1QOSA 2WWJA 5F1RA 2IXJA 1D4VB 5KXDA 5FJHA 1S0BA 4NHMA 2JDPA 5A7NA 1H0BA 4ZS2A 4HOOA 4Q0SA 1O5UA 3AMPA 3T0DA 2YMZA 3WDYA 5CEHA 1GWLA 1OSGA 1AR83 2WNUA 1JYCA 3RFRA 3VBRB 1VBE1 5FLJA 2VM9A 2HLEA 4XQ4A 4C91A 4QB2A 3PIGA 3O14A 4LK7A 2PHWA 5T3NA 1FNZA 5JVVA 3U11A 4M3CE 5DUUA 3N35A 4BZ4A 5FWJA 3S7IA 1LULA 1CIWA 4BE3A 2XHKA 3DPRC 3SH3A 1AL22 1UOGA 4KNCA 1OBNA 1LOCA 3HT2A 3VZKA 4IW3A 3ZO0B 5EJ3A 1N3OA 5I91A 4YVSB 1CESA 1RUF1 3N7LA 4XFCA 5HCAA 1QJY2 2Q1ZB 3I2JA 4HK8A 4E4DX 1XU1A 4AR2A 2G9FA 3NAPC 1JOJA 4AEKA 2WNVB 4Q0UA 2G19A 1W6MA 1AL23 5T5LA 1RYYA 3C8XA 4CA9A 1VBB2 2BERA 1OOPB 2VMDA 2Y64A 2W91A 4LNVA 4OHZA 1QJY3 2WRAA 1SPPA 4XPVA 2ZCWA 4JGZA 5JZGB 4IV3B 4NWWA 3WEZA 4BISA 5K0UA 5AVAA 3OG2A 2ZZJA 5JOZA 3PVNA 5FMCA 1MS0A 4Q4W2 1E5RA 1VBB3 3JD72 2LROA 3OBAA 1A3KA 1GFF2 4FFGA 1WLCA 5IFTA 5T5PA 3PMEA 2VZ3A 2DVGA 2D3PA 4WM8B 1K5MA 2Q30A 1DQ6A 2TEPA 2NZ9A 2WQ4A 3IAQA 3P5BA 4QM8A 3TBDA 4UXAA 3AMNA 1AR61 2AGSA 3T30A 5FYBA 4E8DA 4Q4W3 2VUCA 3JD73 5F9TA 1UNBA 3H8UA 3ZN4A 4FPJA 4FPLA 4BQ2A 5BXXA 4XF0A 4XABA 1DGRA 1CAUA 4GB31 3I59A 5ACA1 1QNWA 2B9VA 5CFDC 3BU7A 4FBFA 2VMCA 1YNAA 4QPGC 5FLIA 1I5PA 4L11A 1Y7BA 2VVFA 5DXDA 1QHDA 2BZDA 1RUD1 4XILA 1DBNA 2VY0A 3FL7A 1R64A 2CYFA 2EIBA 2V5YA 5FAXA 2VXJA 1OT5A 3AZXA 4URAA 1Q8PA 4YRDA 3KCXA 1KEXA 1GOGA 1W99A 1VPHA 1J84A 2WNOA 5AC91 5C9AC 4ATFA 3A23A 1JHJA 4MG2A 5DPNA 3WR0A 2E31A 5KXEA 2DVAA 4GWNA 5DUXA 3U37A 5FPBA 2HWB1 2PTMA 1TQ5A 5IUQA 4AHXA 3DKQA 5HCFA 5K8SA 1W8UA 5D21A 2YYOA 1YQ8A 2CL2A 2ZACA 1J59A 1RJ8A 4KH9A 2VZQA 4NROA 4KGGA 1ZBA1 1ZVFA 5LRRA 2WWSA 2A6VA 4Y20A 2D97A 2ZGTA 5T5JA 3WHUA 4OLLA 4FAGA 4A45A 3TN91 2VXRA 3B94A 3DKWA 3IMNA 5FZHA 4CCJA 4ET7A 3KV4A 1UF2C 4BQ4A 3E5QA 2C4XA 1EUUA 1QXRA 3ILFA 5L36A 2QNKA 5LA0A 2AEYA 2VGDA 4B8EA 2YBSA 4FP2A 4IDZA 2DV9A 2E6VA 2JDAA 4X8NA 1QJU1 5D1IA 5IATA 3HOBA 2QQNA 2BOJA 1LGNA 2WS92 4JRAA 4A7KA 4DXRA 1NAEA 2ZGUA 3ZYBA 3FBYA 4RQPB 4ZXEA 4AZZA 4K20A 1MQTB 2A6WA 1ZNPA 3EMRA 3AYCA 3ES1A 3LFIA 4EN7B 3ZYIB 1FATA 1SCRA 2VL4A 1MQTA 2WS93 4HT1T 2R7EB 4XURA 3T08A 4ES8A 5KBFA 1G8WA 2P34A 3WVJA 4DRVA 5BY5A 3KF5A 2C9KA 3AP7A 1PK6B 1SBFA 1I3HA 2PHDA 1NQJA 4M0HA 4B1LA 4COUA 1X9PA 3TEZA 1EAH2 4WBBA 4HKLA 4OZXA 4COVA 2B4KA 1S0FA 3W58A 2BOIA 3V0AB 4XXPA 4GZ9A 4QX0A 5A33B 1CJDA 2XONA 3FWEA 2VW0A 5HPOA 1Q3EA 3V0AA 2QQUA 2VOWA 4ORFA 1FOD1 2AYHA 2PYTA 1ULCA 1R1A3 1N1TA 1EAH3 1VBA1 1YIPA 2DVDA 2OW4A 2VOVA 1SFPA 3NWKA 3H3UA 1GLHA 4QPWA 4XVHA 1G9FA 4RGKA 1W9YA 3ZFEC 5HI0A 2JG8B 2VAUA 1HN1A 1MPXA 2YPJA 4XFAA 4Z2WA 2VCAA 4XDQA 4JHZA 1W28A 4OHXA 4RYDA 4OI0A 2PAKA 3B69A 1NCRB 3LEKA 2G9GA 4ATEA 1XNTA 1H6XA 1S4CA 1W6QB 1IS6A 1DFQA 3ZXJA 4CUAA 1FV2A 4FPOB 1SHWB 5C3RA 2VBDA 1ZRCA 4PDWB 1XB9A 4IE4A 4FTBA 4D7SA 4XJ8A 4LE4A 4OQ8A 2XLGA 3AZZA 4X6RB 4XTPA 1UWWA 1N3PA 3H3LA 3MPPG 1O6UA 1GOFA 1REDA 5GLTA 1FYUA 3THPA 1UAIA 3VD3A 4CDWA 4IETA 5FZEA 5FYHA 4XF1A 1QKQA 3ZFFA 1ZBE2 1POQA 4XBNA 2EIGA 1DZRA 1PVXA 2JD4A 1HQNA 3ZVXA 4E2SA 4AI9A 3ILNA 3ZXAC 1D4M2 1JU4A 3KB5A 4XW3A 3DL3A 2YZ4A 3NV1A 3VL9A 4XF4A 4JTOA 4NN0A 2NYYA 2VUAA 5FP3A 5BNPC 1ZBE3 5CNAA 4F83A 1QQP1 3I2FA 3KD4A 4XYXA 4Y4RA 1NA1B 2WZPP 1LTEA 4CU7A 4L0PA 3WZ1A 4NIHA 5GLZA 5LY2A 1D4M3 3I3QA 4DEVA 1OI6A 3LSEA 5JXGA 3CJIC 1JODA 5DZFA 2XJUA 4BQWA 4WM7B 1HB4A 4AG4A 1QY4A 4BHPA 1WCSA 5JAXA 5LK7B 2B7YA 2TBVA 4LE3A 1DCSA 2Q4SA 4MYEA 3ABZA 5FKBA 5FZBA 5F39A 2O8OA 4QB6A 4CDUB 1SDDB 2J1TA 4FOQA 1DIWA 4Y1XA 4P9WA 4YLZA 2WSVA 1RUG2 2JDUA 2VE1A 3LIGA 4A41A 1CZSA 1NX9A 1SDWA 2WN2A 3I97A 3WG2A 1W2AX 3EXUA 3ZLIA 3VBOA 4CCCA 4CPBD 2ZTNA 3OPWA 4V2WA 5LA9A 4P08A 3DYOA 5IVCA 3TOJA 1UMHA 2QVSB 3OUIA 3GGLA 4OMCA 1S0GA 2WQZC 4IEZA 4RS5B 1BLZA 1XJAA 1GNHA 2YFZA 1RUG3 4YZ4A 4NHKA 5FP9A 3SC7X 1XNKA 1W6OA 2CTVA 4R8HA 4D0QA 5JOWA 4DRRA 3MIFA 5IVEA 2A5ZA 4DEQA 2D6OX 2ETEA 4CEYC 3KV9A 2QZ2A 1RUI1 1DGLA 2PHUA 3R0RA 2XJSA 2PHRA 1GZWA 4Z2AA 1B35A 3FLPA 1A8MA 2IXHA 3PDQA 5C8CA 4XZPA 2VW1A 3GYDA 3ZN6B 3O1MA 1LOAA 3AP6A 2VPVA 5LATA 1CD3G 4RHV1 2GP3A 1TNRA 2WT1A 2ZGMA 1XC6A 1R1ZA 3IPVB 3MO4A 5T5OA 3R4DB 4FPHA 1VAVA 4R4XA 2W52A 5EHDA 1G9BA 3AC0A 4MGYE 3WDWA 4UOJA 2R041 5FZ3A 4JHTA 4FTSA 1IS3A 1MS5A 3NSTA 4CCKA 3VBSB 3K2OA 3VHRA 2VQ0A 4S2HA 5FZ1A 2KXLA 2DU0A 2OX0A 3MW4A 3VDAA 4DUWA 1UIJA 2XOMA 1BMV2 2DYCA 1AVBA 2WKKA 1FMD1 3AB0A 3LA3A 2GMEA 2GNDA 2QQKA 3MIBA 1HRI2 2J1AA 4QQHA 1TMF2 1W8FA 4XEZA 3ZMNA 4CTEA 3FJSA 3UK9A 4IGPA 1PX3A 4ZZ5A 3QH7A 2VOXA 1WLDA 2R30A 4M4RA 3T1LA 4BK4A 4CYDA 2HWF3 4XAAA 4CU6A 4EWEA 1H1IA 3FE5A 3MIEA 3B93A 4DXTA 2ARXA 2AZ5A 5BNQA 5DMYA 4FTEA 1HRI3 2D44A 3CF6E 5FZ8A 1TMF3 1E57A 2D5HA 4AYUA 5JUVA 1VB4A 1OUSA 3HMYA 3KSCA 1DQ5A 5M0TA 4UWDA 4M4PA 4Q4X2 5J37A 5LBBA 2JENA 5JR2A 4X6QB 2ZGOA 3D8CA 4JGZC 1PGW2 4YGBA 4OI1A 4A42A 4XUPA 2JKBA 2JB4A 3AYEA 4TN7A 5IVYA 1NLSA 3LA7A 1OOPC 4AFCA 4AQTA 2CV6A 4TXWA 3SISA 4NOTA 3OD0A 3WUCA 4IV3C 4ZHNA 4UFJA 5KXBA 3BGAA 5FPZA 2R0FA 3JQXA 3NNFA 4NIGA 2ATFA 3HAGA 2BDRA 3N9QA 5F5CA 5C4WA 1K5MC 4OI4A 3BI3A 2H6BA 4IL7A 1N1SA 3BPSA 4EWAA 2YC2A 4QDQA 2CWSA 3BKZA 1VIWB 2EALA 2RMU2 1LHVA 3WP3A 2IZWA 1H9PA 2ZX0A 2VG9A 3OPZA 4Q4Y2 1JUHA 1UYPA 5FCCA 4Q0PA 2YGLA 5F3GA 1AR72 2GMPA 5FZAA 5KHHA 4BQ3A 1NE6A 2PXJA 5H9RA 1VR3A 1UU4A 4BB3A 4BLJA 1S0EA 4D7TA 5B4XA 4HONA 5KHKA 4AEMA 2RMU3 2LTNA 3QBQA 5T54A 1CJPA 1RUC1 4G9SB 4Y5TA 4Q4Y3 3O1VA 3NV3A 2XLFA 2L9LA 2YPDA 3AKSA 3GCWA 3W5MA 1AR73 1EV11 4LTAA 2UYBA 2QTWB 3ZIWA 4PIYA 3ORJA 2RR11 4V2VA 2CGNA 2ZX2A 3U0ZA 4Y33A 2BYVE 3LDBA 1CAVA 2WFF1 1EPZA 4XUQA 2Q8OA 2XQXA 1X9TA 2HEYF 4I3PA 1CR7A 1PVC1 1UIKA 5LBCA 3HN3A 1RHI1 3T2QA 4QX1A 4N43A 2WDBA 4YVWA 4HG6B 3ZR6A 2PHTA 3DXTA 3WF3A 1DGRN 1PNGA 4KI5M 3VBFB 4YARA 1LU1A 5JI9A 3LFMA 4UFIA 2WC2A 2UURA 3L2HA 4QPGB 3WX5A 1TE1B 2RS31 1YCIA 4XCAA 3ME2A 4GKXA 5IJRA 1AXKA 3VBFA 4LR4A 3ZR5A 5FFOC 4CDXA 1WCDJ 4CDQB 2HWC1 1DYPA 4BU2A 2BNNA 3E5UA 4M01A 4AEJA 1XNAA 1QMJA 4HPKB 2XH6A 4LBQD 2Y6LA 2Z79A 5J36A 5FWEA 5FMBA 2JECA 2ZABA 2VTXA 4HPKA 3ATGA 2XWBB 3A22A 3NNMA 4RQPC 4XTMA 3MEPA 5L73A 4HSJA 3W21A 2P17A 3BOWA 1MQTC 5I0RA 5F6LB 1I6XA 3RVHA 4XOGA 1H2MA 1AYM1 1WWYA 3ILRA 5FBZA 5FREA 4I01A 2QDRA 3VZOA 1W6PA 3H0OA 4MXWB 4DINB 4BQYA 5J3UA 3UJQA 2WSUA 4RA0A 3WNXA 1ODNA 1YQCA 4YG3A 5A6ZA 5L9RA 1JU3A 2XVGA 3N9LA 1RGSA 1F31A 2IC1A 2WL1A 4YG0A 5FZCA 4YZ1A 2WIIB 1KGYA 1YYNA 3WY6A 1O91A 3USUA 1W6NB 2FQPA 5I8TA 1CX1A 2ZS6B 5FOJB 4IE6A 1TME1 1S0IA 3IDCB 4INDA 3VKOA 5LEKA 3MYXA 2ZHMA 5L19A 3PLQA 2XXZA 4AHYA 4Q2FA 1SLIA 3JBG2 4LBQA 5FYMA 3NL1A 4HN0A 2ID4A 2Y6HA 5L7OA 1ZRDA 1MZEA 1ZM1A 3GBGA 2R071 5JI7A 3FHQA 1V6IA 2JG8C 3RRDA 1GWMA 3M1HA 4HMZA 4D7YA 5A3MA 4GWMA 4NJ4A 3H42B 2QBXA 2UWBA 1NCQA 4XMAA 4YW5A 1TZOA 2V4VA 3IDEA 3JBG3 1NCRC 4AQ6A 1VMFA 4J6GA 1RB8G 2WJSA 4C0BA 1FNYA 2X8KA 5CYYA 1VB2A 3GCXA 3AL5A 1A78A 3O1SA 1WMFA 4PDWC 2VQUA 1W8WA 5FUPA 4GMP0 4HK9A 5FYTA 5GLWA 1PM4A 2CWMA 2PLV2 4P9LA 4XDPA 4BM8A 2HH9A 3MF6A 3OF1A 3ZFFC 1YC61 2DCZA 1NKGA 5IVFA 4Y1VA 2KR2A 3LE0A 2EIDA 2XJQA 1LRHA 3GHMA 4GKYA 3ZFEB 3P3NA 4NWVA 1GQPA 1C28A 3A0KA 3S30A 4A7YA 5DAQA 3GHNA 2TNFA 4QQOA 2W95A 4AI1A 4B3NA 5FOBB 5KHJA 1UPSA 3K48A 2WR9A 5A7PA 5LK5A 4UFHA 3SLIA 1C4RA 1X8MA 2FD8A 3LGRA 1RXGA 3RZGA 3EB7A 2WZ8A 2HEWF 4AK3A 5GLUA 2BWCA 3HPNA 5BYNA 3TAYA 3ZN5A 3PURA 1JH5A 1NA1C 4J25A 1EUTA 5EJZB 1CAXB 4MLOA 2W1QA 4C8DA 3J26N 1H1AA 2WFPA 2B39A 3EO6A 2ORXA 3ZX7A 4A6OA 4S2GA 4WM7C 4PI2A 3PU3A 3MGUA 3X29B 1J1LA 1BEV2 4ASLA 1STMA 2W3JA 2HWE3 5A7WB 1FAYA 3BTYA 4OCTA 2GH2A 1X82A 4Q27A 2LW8A 1ZZBA 1DLCA 1M4WA 1R083 2FHRA 1CPNA 4CDUC 3D3AA 4I2OA 4QPIA 4QX3A 1XNBA 3VBOC 2ZAAA 4K1ZA 1BEV3 1SFNA 4IEYA 1FX5A 4DFSA 2PHFA 1DYOA 3TEYA 3DEMA 1DQ0A 1COV1 1S0DA 2OT7A 4IESA 1UZ0A 1ND3B 1W3VA 4KWJA 2RE9A 3VHOA 2WZR2 3R6SA 2R32A 4HETA 1PMHX 2E7TA 1OQ1A 2ZGNA 2D6MA 4QAWA 4RS5C 3WSOA 5LRSA 3N36A 1HRV2 4NPLA 5IAXA 1W05A 3FBMA 3VBUA 2WQ8A 4C1XA 1YWKA 4Q0VA 4JKLA 2BVVA 1RUJ1 3QD6A 4GH4A 4GULA 5DDJ2 3WQ0A 2K2SA 4H7LA 4N53A 4YFWA 1UZZA 3A4UA 3N4MA 4Z1VA 1WLWA 3O7OA 4ASMB 4BK5A 1JZ5A 4LMFA 4AFBA 3Q8AA 3F2ZA 3Q8FA 1HRV3 3E6DA 4XZUG 2LUWA 2NQYA 3WNOA 1AR92 1SG3A 5DDJ3 5SV8A 5F5IA 2XBO1 2ZX3A 4YW3A 4Q5OA 5FY7A 3LF7A 2RHPA 3B9CA 5IK8A 4M3CF 1FV3A 2A7AA 1ONAA 1QJY1 4LHLA 5FRAA 1PGL1 1JTZX 2W0XA 3I2IA 4PIXA 1ENSA 3ETQA 4Z8BA 4TZDA 1AR93 4QGLA 3VBSC 4CCLA 4CU8A 2R6QA 4CEYB 1H8VA 2A3XA 4P00B 3OGGA 3WV6A 2B42B 5LCWL 1XBFA 1GICA 4UW6A 3OB8A 4NE9A 1XNCA 1C5HA 1Y43B 4CP9A 4LEJA 2KD7A 4GAZA 4EQVA 3IIAA 1W9TA 2BW8A 3B3QE 3SXWA 1VALA 4Z07A 4IEQA 5FY9A 3DECA 3AL6A 1HB3A 4MVTA 5A7OA 1RMU2 4YW4A 1AL0G 1GWKA 5H9PA 4E9KA 1MS3A 1AR82 2DFCA 2O1QA 3DF0A 3JD71 4P5HA 1O4YA 3MUY1 3VDDA 2EA7A 3WG4A 3MF9A 3MUZ1 1YFWA 4NMIA 4R4ZA 2Q1MA 2WNUB 2QE3A 4KBBA 2WLPA 2VOTA 3ZXKA 3QCWA 4UAPA 1OA4A 4GMP3 3CL1A 1ALYA 1RMU3 4YYOA 5BNOA 1OPMA 2G9ZA 3S5AA 4YFZA 4K21A 5G05L 2VNGA 1XYPA 2JE8A 3OJBA 5FP7A 3DGTA 5FYSA 4QX7A 1VBD2 4QHBA 4QWNA 3WW3A 2B5HA 3AK0A 4PLOA 5K7PA 3AXEA 3BYWA 2XHNA 2ZZQA 2BNOA 3KV6A 2VMIA 3H7JA 4FQZA 5FYCA 5CISA 2RDNA 5C4WC 3M3QA 4UFMA 1D2QA 3E1F1 1AX0A 4DS0A 5A3LA 3GZEA 4GQ7A 5FYZA 3ZKYA 3O1RA 3LKJA 1VBD3 4FOVA 4MV2A 1W6MB 3HR9A 4Q4V2 4W50A 3ZYRA 5A1FA 1NLQA 1QF3A 3POFA 2EAKA 4UF0A 2AEZA 4G4FA 4YGDA 2CDOA 1SPPB 5FZ6A 4JGZB 3H1YA 3ZFGA 2ZMLA 3OOXA 5K0UB 1VMJA 1XOYA 2DUOA 3VD7A 4Q4V3 4ARYA 4LITA 2A6XA 1VBC2 4AHWA 4YZ5A 2X09A 3PJQA 2IXLA 4XETA 3HQXA 2B45X 1ZRIA 5F5QA 1W2UA 2IXKA 4HXCA 4R9CA 3R05A 4DNYA 1PHMA 2JB8A 2A3YA 4IEUA 2J1RA 1F5JA 3VHPA 5A6XA 5H9SA 3BUCA 1K5MB 1LESA 1V0AA 3POEA 4LKDA 4XJAA 2VJXA 2QQWA 2VCMA 4K40A 1NXD1 1LOFC 1VBC3 3UKNA 1MEC2 1BJQA 1NG0A 3AKRA 4LBJA 5FO8B 4HBNA 5ERLA 1F4HA 4YVWC 3VUOA 1ZZ7A 2WS91 4SLIA 1CAUB 4YZ3A 3I59B 5FXWA 1SBDA 3LAGA 2X5IA 3P1IA 4AQ2A 4MGKE 3KQ4B 3ACIA 5GZGA 4LKFA 4LHNA 2RM21 2VZ1A 1IZ3A 1MEC3 3T4VA 4GWIA 3NW4A 4QB1A 3VBFC 1WW6A 1FPN1 3N7JA 4ITCA 4QX8A 4CE8A 4JAAA 1QWRA 4LBMA 2YV8A 3O1TA 2QZ3A 5A6QA 4XQDA 2JIJA 3QLQA 3IAPA 3CIHA 4MHUA 5FLHA 1UMIA 4AAPA 2YFUA 3NJZA 1I5ZA 3OGRA 4PBPA 4CDQC 4QMAA 3FHIB 4NIIA 5DQ0A 2QQVA 3OPTA 5C71A 1CVNA 5HV4A 4E27A 1HXS1 3N7MA 1V00A 3RWNA 2NMOA 5BNNA 3O1OA 2N7GA 4OFGA 5DAVA 1IPSA 1O8PA 1HQLA 2DCKA 3ZSMA 1W8ZA 1ULPA 4CRQA 4NIDA 1W8TA 1OA3A 1QOTA 3ETPA 5H9QA 3KVAA 4Y20B 4DPNA 3KT1A 1CPMA 5JIAA 1IGOA 2VTFA 3A7QA 4IEWA 5F5AA 1RUNA 2GDFA 3P6BA 2C1FA 4AGGA 1L7RA 1VAKA 1RUF2 3N9NA 3AVSA 5JPNB 3AJYA 1HLCA 2ZAHA 2W08A 4FQ4A 4QT6A 3H50A 2C26A 4SBVA 3H8RA 5F7UA 4MOAA 4JRLA 4XAEA 3MV11 2I2SA 4LO7A 3C7FA 4YM0A 4JDMA 2WT2A 1RUF3 3T0BA 3N7KA 4AVVA 2Y60A 4FOWA 2E26A 2NM1A 4JTNA 5L7OC 5T52A 5FZOA 1TEIA 1K5JA 4LBOA 3RYPA 1RUH1 4Y5SA 3E6CC 4RFT0 2DDUA 2RJ2A 2BUKA 5A6YA 3NVCA 2D6NA 3WF4A 2R062 3MICA 1WD4A 2FDHA 4XXAA 2EIEA 1MS1A 1D4M1 4OUSA 1AR62 4H3WA 4K8RB 1R1A2 4XIKA 1ZZCA 3LA2A 4QX5A 1QJFA 2CDPA 4UBGA 4J1XA 2R063 2WLQA 4GB32 5ACA2 3ZYGA 1XYOA 3WG3A 2IVJA 1RUOA 2DVBA 4MO3M 4D69A 2VZPA 1BXHA 4LUKA 5JXJA 1AR63 2JXAA 2ZJCA 3RJRA 3VKFC 3LOIA 5G04L 5A7QA 1IHMA 1OFNA 4B1MA 1RUD2 4GJZA 4K6BA 4R9AA 2AH2A 1HB2A 2R1DA 4GB33 4LA3A 3THTA 4FP3A 5ACA3 3C3VA 3POJA 1SBEA 2WUHA 3J8F1 1X8EA 3FZ3A 1BK0A 4V1PA 4LO5B 5FXZA 2A70A 3THCA 1PO12 4PBOA 2FDGA 2FDIA 5CKQA 2OKXA 1DG6A 2W68A 2WO1A 5GALA 1RUD3 1RUG1 5FR3A 2DUQA 3GJAA 2HWB2 2J1SA 3HVDA 4M00A 1CGPA 4PQ9A 3PNAA 3AXDA 4CDWB 1JZ4A 5AC93 1ZBA2 4XJ9A 3ZFFB 1YRZA 1PO13 2RJKA 4RL7A 4W8JA 3VZNA 2VMHA 3TN92 1F8VA 2VUJA 3RZZA 3NKGA 2P3IA 2HWB3 4Y1UA 3ZPYA 3VDBA 4XF9A 3VL8A 1IOAA 1J1TA 2DCTA 2GH8A 4Y3OA 1GV9A 4Z82A 2A71A 2YBPA 3H3ZA 2GC2A 1ZBA3 1V6MA 1RUE1 1QJU2 2YB7A 4XE9A 3THDA 5EJ1B 4OI2A 2JIGA 4CUGA 1NQDA 3TN93 3WW4A 3H1WA 4AAXA 1YI9A 4PI0A 2V5DA 3ACFA 4K7JA 4KQ7A 1O3SA 4YZ2A 3BTXA 3ZXDA 1DGWX 3CNAA 3ZYFA 2DBNA 2OS2A 4Q26A 4L9BA 3IZOA 1U12A 3C7HA 3OYWA 3WNKA 5F37A 5JOXA 2D3RA 1WMXA 1QJU3 3AKPA 5A3NA 3T4HB 4JGYA 3I49A 1ND3C 1CZTA 1W9FA 2RJLA 3VBUC 1XYNA 1VRBA 2BPA2 2OVUA 2VMGA 4XIOA 4I0WB 1S1AA 2QCSB 4FVVA 3OCPA 4TWTA 4IE7A 4UW4A 5C3PA 1BVP1 5CFCA 5E8AA 3LEGA 4Q8LA 1SEFA 2VNRA 4ONUA 2PQQA 3BIWE 3S6PA 1BMV1 5IW0A 4QGNA 1UY4A 5EYYA 1W2OA 1W8NA 4ZONA 2DUPA 5FIXA 1TMF1 3LZZA 2P6CA 3VBOB 4DOUA 3UL2A 1PO21 4P9YA 5JWPA 3MFAA 3MI8A 2J1UA 5D8AA 1VBA2 3FHAA 1LHNA 1Z0HA 1HX6A 5FBJA 4N7IA 4BA6A 4DIQA 3W9AA 3U4XA 2JDKA 1W6OB 3CJXA 1YHFA 2XR4A 2VZUA 5CAZA 1MS9A 2G4IA 1FT9A 2Y0IA 4LIVA 1UZYA 2YC4A 4LBLA 1GZWB 4C0HA 1B35B 4CCNA 4XFFA 1BZWA 5LA2A 1VBA3 3GALA 4Q4X1 3ZOIA 1ST8A 5C8CB 5LZ6A 1OXCA 5TSWA 1BCXA 1V6KA 1PGW1 5FJKA 4D6RA 2QUOA 3ITQA 4FCAA 3WP5A 5BV6A 1QGLA 1IS4A 1C1FA 4BMEA 1ZYBA 1W8HA 5I0UA 2W39A 2VR4A 1UU5A 5A3OA 1N3QA 1PIV1 3T3YA 2V4AA 4BJ0A 3AP5A 1O59A 4LBKA 4Y5Z0 4P14A 1HV0A 5DG1A 5FY4A 4ES9A 2XVKA 4XDOA 1G6NA 4B7KA 2V72A 1UZWA 2JDYA 2YROA 4JVAA 5IFPA 1XPWA 3JXSA 2WNUC 2E7QA 2NPIA 4JC1A 5CKNA 2V73A 1YQ5A 4DY5A 1S2EA 2HWF2 2VZVA 3LOBA 2RDQA 1AR71 1VRH1 2D7FA 3GF6A 2JG9B 2P37A 2BEOA 1DYKA 4WVMB 1H30A 4XFBA 4CXXA 5JSPA 2XGXA 5C5TA 1JMUB 1YQ2A 4E8CA 2QQIA 2MEV1 1ZRRA 1A34A 4QKNA 2UWCA 1YFUA 2JG9A 2BBVA 3DN7A 2V09A 4JQTA 4WVMA 3IIIA 3WDXA 4QXBA 3AMHA 4MZUA 5GKAC 2BRTA 3S0MA 4FXKB 2RS52 1SCSA 4GALA 5GZEA 4AVSA 3VN4A 3D82A 2H0BA 4A2UA 4D3WA 1O3TA 1QDCA 3BB6A 1RVF2 4CXWA 1GZ9A 1HJGA 3POSA 4CP0A 4CP2A 3VKNA 1QIQA 2RS53 3ON7A 2BP6A 2JDZA 4CVUA 3I2GA 2Z42A 3U78A 1W2NA 5K0UC 4IV1B 1ND2A 4XFHA 3EQEA 1HDKA 2O0OA 3RI9A 3VV1A 4LLFA 5GZDA 4JDOA 5J98B 5ABJA 5C4WB 5CBLA 1RVF3 4E2GA 2XL9A 1DF0A 4IV1A 4NAMA 2K0GA 3K77A 4YGEA 1C8M1 3SMHA 1ULGA 4AVTA 4FPGA 3LIHA 4NO4A 2FMYA 1WCUA 1APNA 4R9BA 4Y26A 4AI2A 4BDVB 5FYYA 5AFBA 1BYHA 4UFKA 4FPKA 1H2NA 1RUI2 2HEVF 2ZGLA 2GNBA 1WMDA 5DAXA 2XJTA 2I45A 1IQAA 4OZOA 4E4HA 4TYSA 2HWD1 1EP0A 3OEBA 3WW2A 1O3QA 4RHV2 3JCIA 4KU7A 1YO8A 4LKSA 5FXVA 4HVQA 3PJYA 5AFEA 1RUI3 3CLPA 5GM0A 3FC0A 5FMOL 3CQOA 4AFDA 3KT4A 1JYNA 3H9AA 3LD8A 4MX3A 1CAVB 5IT6A 3DPRA 2GNTA 2R042 2GAUA 4A7ZA 3S5QA 2ILMA 2IXCA 4RHV3 1KITA 3AX4A 1POV1 5DN2A 2DF7A 3INAA 5IYYA 1W3XA 1J3PA 4N43B 1GKBA 4YVWB 3WDVA 4AVAA 3AFGA 3NAPA 3WF1A 1DLLA 1S2BA 2VVDA 2R043 1J58A 1UQXA 5LWBA 3J4UH 3LDKA 4BPZA 2B9UA 1AYN1 5FZKA 2Y38A 2BNMA 2E53A 4H2AA 4DUVA 4CDXB 2CAUA 2VNVA 2X29A 1ASJ2 1O7FA 3OSDA 4BWOA 1BHGA 2C0ZA 1WKYA 1NE4A 5EP9A 1XU2A 4XJZA 1OPOA 2W92A 4IGQA 4AOCA 1V9U1 3V64A 1ZRFA 3RI8A 3WQ1A 4ZXKA 1ASJ3 4XQWA 2RDSA 2E9QA 2F6BA 1MS8A 3TNQA 1AJKA 1NY71 1AZDA 3IM0A 1ZX5A 1H8TB 3WG1A 3HN1A 4RFRB 1PX4A 1W6PB 2PLV1 3A0NA 4QDSA 2CSGA 3NQHA 4OUMA 2PQSA 3IDBB 3VB9A 2YXSA 1W0NA 1H8TA 2YU1A 2VZOA 2IWGB 3OTFA 2WABA 3HNMA 3L9JT 3I3MA 1LCLA 2E32A 3SQOA 5HV0A 4ZU7A 2ARCA 3EHKA 2RS11 2HBTA 4NRMA 2GN3A 3RMXA 4CSWA 3RMYA 3USUB 3R4SA 4WV8A 4KWUA 2W94A 5JR7B 4KL1A 4AHZA 4OQ9A 3WOGA 1LNSA 3WD5A 5JDBA 2QQOA 2XJPA 2DCJA 2ZGSA 3PVBB 4FO9A 4MHRA 5C9AA 3I2KA 3ZPOA 1SLCA 3MBWA 2QQLA 2R16A 5JMCA 4LBQB 5I8SA 2C6SA 4GWJA 3MIGA 4Y1YA 5L7OB 2C5DA 4LO8A 4NRPA 2OYZA 3RZMA 3J7NA 4NIAA 3RZJA 2D3SA 4M3CA 5DABA 4OYUA 5I0SA 1EV12 2RDRA 1OLQA 2BJSA 2EF6A 1R092 3CDZB 2RR12 1NCQB 1BEV1 1H4GA 4TLFA 3D5OA 2E7AA 4PHZA 2EXJA 5FPXA 3V0BA 2PHXA 2HYKA 3O5SA 1C5IA 2GC3A 3DXUA 3K4AA 4ZS3A 5FZDA 2P3YA 3AKQA 3U1XA 2C9AA 3TRSB 1PVC2 1EV13 1MZFA 2R1BA 4YM1A 3OUJA 1UZVA 1R093 2RR13 3P3PA 4PLMA 2E63A 2HJIA 3C2UA 2OZ6A 2I07B 2WFF3 3ZSLA 5FYIA 2YY1A 4OHVA 5FP8A 1W0PA 1W04A 1W8OA 5IK5A 2W47A 1SLBA 4LBNA 4NHXA 5ANQA 3ZYJB 5FZFA 4CDWC 4DZGA 4XHBA 2WZR1 4HANA 4DY3A 1QJX1 1PVC3 4OMDA 1V6OA 3M2MA 4CUBA 1JZ7A 5CZKA 3ZIXA 1HRV1 4UFLA 5BPXA 1VJ2A 4H7MA 1OLMA 1HKDA 2HWC2 3NKTA 5APAA 5KWRA 3BODA 4LOTA 4MSVA 1OVSA 4NHYA 4YW2A 3SCGA 4Q0QA 5IVJA 2J42A 1IKPA 4EN0A 2RS33 2RG4A 4A3XA 1CX4A 2NP0A 4FPCA
chains in the Genus database with same CATH topology
4BH9A 4H55A 2OA2A 4P9XA 4CP1A 2HWC3 1LGBA 1OFSA 2P3JA 3G6JB 3SNMA 2EXHA 1AYM2 2HWE2 2ZKNA 1LOGA 2R49A 4QQLA 1ZZ8A 2JE9A 4AQSA 3KLSA 4URTA 1ENXA 5CFCC 1R082 2UWAA 1WLTA 3KQRA 2VQAA 4YSFA 2FZ2A 2XUMA 1AYM3 1QOOA 3OY8A 3PHMA 1LKNA 4QPIB 1X36A 2X53S 4I30A 3WCSA 1TME2 2H0VA 4Q8KA 1BKZA 1SLTA 1JXNA 1WW4A 3ZXFA 2IXIA 1IPKA 3O0WA 4B7EA 1V6NA 2ZGQA 3M3CA 4WZCA 4YM3A 4AI8A 1RMU1 1LODA 2BTVC 1AR81 4XBLA 1TME3 3VBUB 4CEWA 3G7DA 4GH4B 5T50A 1BBT2 1KFUL 3RQ0A 4N53B 2IFRA 2ZA9A 3AFKA 3O12A 4FOYA 1B35C 1U5YA 5C8CC 1U0AA 2NN8A 3VBHB 2YC0A 4LUMA 3LB9A 1O4TA 3WHTA 5FQ0A 1PNFA 2VULA 3KCCA 4L92A 1Z78A 1BBT3 3KT7A 3L2YA 1JUIA 4GXLA 3VBHA 4WVVA 1BQPA 1LU2A 5BNPA 3APBA 2WINB 1PZ8A 4K9SA 4RSUA 2GC0A 1AL21 4NPRA 3CJIA 2ZKLA 1JN2P 5EYXA 1ULDA 1G9AA 2ZGPA 1MVEA 1URXA 2XL7A 3D6EA 4XF3A 3I2DA 1VBB1 2QJVA 2JG9C 5HCBA 3RNSA 3VLBB 3WINE 5JLVA 1X50A 4HVOA 4XBQA 2JICA 1DQ1A 4L2NA 1REEA 1YUDA 3T1MA 1DDLA 3K51A 4FSJA 4B4RA 1VLNA 3VDDB 4UW3A 3ZXGA 2UYAA 1KD7A 5IK7A 1JYIA 1MZ5A 5EFUA 4Q4W1 5AVPA 1LEDA 2F4PA 4I3GA 3VZLA 1RL3A 4PCRA 3WW1A 1N1YA 5KC5A 5BNOB 2XB6C 3FX3A 1CAWA 4AEDA 5J09A 4Q1RA 3SH4A 2BWAA 3LCPA 5JCTA 4LHKA 5I8YA 2CNAA 4UW5A 1WD3A 4IV1C 1VAMA 1COV2 3BPZA 4KGQA 4KU8A 3RYRA 3VKMA 4LO4B 2JE7A 3ES4A 4AVCA 1VP6A 1H2KA 4QPYA 5J96B 1SMVA 1MZ6A 1W0OA 1U5ZA 1UU6A 3RG0A 3CO2A 5I93A 3EJKA 4F7ZA 1RUJ2 1COV3 2YHJA 3ZFGB 3I8TA 4BIOA 5LEJA 1Q8QA 2ZHNA 2TUNA 5F6KA 2A75A 4J1WA 3VBRA 1I1EA 1PM7A 1AX1A 1Q56A 1OD5A 1RUJ3 3O0VA 3JQWA 2XBO2 1F5FA 1WMEA 1PZ7A 4G3YC 4WVZA 4NVPA 5E89A 3MW3A 4Y24A 1AHSA 1UKRA 2YUEA 4NHLA 1PGL2 1AXZA 4YVSA 2Y0OA 1HQWA 2XBO3 3D4KA 3PVOA 2X5IB 4N43C 2GC1A 2D40A 5HBAA 2WNVA 1H1MA 1LHWA 3SITA 2ZPXA 3B00A 3D0JA 5KC6A 1XE8A 1OOPA 1MVQA 1Z7S2 2P3KA 4W65A 5JSOA 4CDXC 5JZGA 4IV3A 4MGIE 2Y26A 3T2TA 1A8DA 4PF5A 2R061 2A3WA 4PIZA 5CB7A 3OD4A 1Q8SA 1Z7S3 5BNNB 5C6CA 4JCKA 1R1A1 1EAH1 1NXMA 4META 4WM8A 3GZAA 4N9IA 1GR3A 5EWSA 4I09A 1VBE2 2YDEA 2DTWA 3TYJA 3GNEA 4LLOA 3MW2A 4ZU5A 1DQ4A 3RJ2X 4OVEA 1H8TC 1CN1A 3I7DA 4B4QA 2EVXA 3MZHA 2D98A 1W39A 1BVVA 4K3UA 1VBE3 1GANA 4MXVA 4LO6B 4IEXA 2MPFA 5A32B 4CZSA 3HBZA 3WCRA 4W6YA 3GZUC 3M3EA 4DMIA 2GSYA 5A32A 1L3JA 1QXJA 2AENA 4AE2A 4AWDA 1PO11 4OHYA 5FDBA 4AXOA 4W6XA 2XWJB 1N47A 1PMIA 1HV1A 3PTYA 3ZXLA 4AFAA 3AKTA 3D0SA 4JQRA 3ACLA 1DHKB 4AGRA 4GA9A 1JBCA 1EY2A 1QH7A 1LHUA 3ALQA 3ASIA 5C33A 1WBLA 2H6CA 3MLKA 1ZBE1 1NCQC 4YGCA 3ROUA 3R4UA 5B2GB 3H7YA 2DWRA 1ZZ6A 2OPKA 2P2KA 1BK1A 1J3QA 1LJ7A 1SLAA 3B7MA 2DU1A 4ZU4A 4LULA 2UU8A 3ZSKA 2ZOEB 2XLAA 4DB5A 2RM22 4DXZA 4O9EA 3ZDSA 3VZJA 1WW7A 4RQPA 1Q8OA 1FPN2 4EROA 4M0NA 3RS6A 4Z92B 4EN9B 4ISQA 1O4ZA 2RM23 4WZFA 4QM9A 1FPN3 4BQ1A 3AJZA 2DFBA 3MPBA 1PK6A 1HXS2 5AC92 4YM2A 1GZCA 1LENA 5FMOS 3V56A 2ET7A 1NOVA 1UMZA 1KS4A 3MLLA 5EZWA 1GNZA 1NYWA 4YG6A 1OA2A 2FMDA 4PJYA 4Y4YA 4AI0A 4FPFA 5A33A 3AM2A 1G9CA 4DQAA 1HXS3 1UPIA 2CGPA 3MFCA 1QNYA 1HW5A 2WT0A 1YJLA 3E97A 3OGJA 2JG8A 5K9YA 1U5XA 5KXCA 4QPIC 3M8LA 4QD2A 1NCRA 4FPEA 3OYWB 2YGMA 2ES3A 1W6QA 4HVRA 1C1LA 2IFWA 2QDNA 4P9GA 4JGYB 2ZHLA 4AGVA 4BMBA 4IXLA 4PDWA 4CEWC 3WT3A 1OMIA 1XNDA 3VHNA 1RUH2 3POWA 5CFCB 2ERFA 2ZMKA 1YI7A 4P9JA 4GH4C 1GBGA 1H2LA 4BCUA 1XRUA 4MUVA 4I0AA 4N53C 2VVEA 1IS5A 3AYDA 5GZCA 2HWF1 4PLNA 3VBHC 1RUH3 5KHGA 2XKPA 5D8AB 5IK4A 1HRI1 1V6JA 3UKTA 2FZ1A 1D2SA 4Q29A 2QQPA 1H9WA 1FOD2 1G9DA 1XXNA 1UW8A 4AW7A 1NA1A 4K1YA 2ARBA 4YNIA 2RS51 4HSLA 1LEMA 4HKOA 2QKDA 2UY8A 3M3OA 2PFWA 1G7YA 3KS7A 5DUWA 2PAMA 4WM7A 1OQDA 5E88A 5SV5A 4AI3A 2E51A 4KWLA 1FOD3 3J8F2 1RVF1 4AFMA 1YIFA 3AMMA 1UX6A 3VZMA 2ET1A 3AP9A 3B9IA 2JEMA 3IWZA 4CDUA 2LM3A 4RGAA 1CQ9A 3GBFA 2OZJA 4W6WA 3I54A 1WGPA 5JSRA 3IBMA 3J8F3 3VDDC 1O3RA 4E4SA 4EN6B 2EAAA 1LGCA 4QXKA 3SCHA 5C8WA 4AEDC 2BQPA 3O0XA 4RS5A 2ZBJA 4WVWA 1KFXL 2CY6A 5BNOC 1ULFA 1FI2A 2Q0AA 2RMU1 1RUE2 1Y3TA 2OIIA 3FLRA 3ZXEA 4Q4Y1 4KWKA 4Y1ZA 2GMMA 3V65A 1XE7A 4E2QA 4HN1A 1YLLA 4RR3B 1QQP2 1C8NA 1OLRA 3HD8B 3KGZA 1ULEA 3ZN6A 4OHWA 5JPMB 5KHIA 1RUE3 4RR3A 4QQ2A 4XFIA 1PGSA 5HXVA 3TB0A 3CEWA 3IPVA 1M06G 1RIRA 4LT5A 1V6LA 2O8QA 1QQP3 1KRIA 2AR6A 1J3RA 3E6BA 4B4PA 5BUVA 4ISRA 3ZFGC 3VBSA 3VBRC 1ND2B 3NV2A 2XPJA 1U5IA 5FO7B 1PO22 3UKVA 5ABJB 4GIQA 1AF9A 5CVRA 4HLTA 1KS5A 3KCYA 1KDKA 2GNMA 5DZEA 3RYKA 1ASJ1 1POV0 1RINA 3B02A 4YVSC 3U07A 1PO23 2ZHKA 1MS4A 1Q5OA 1Q43A 4HZFA 4C1WA 3WDUA 1IKQA 3ECQA 5CG8A 2WNVC 1UD1A 4BLIA 3UV9A 3SHRA 1SQ4A 2X5IC 1QH6A 5JIUA 4L99A 2ENRA 1WW5A 1GSLA 3FUOA 4FXGB 1A6CA 1SACA 4EN8B 4R9DA 1T6GC 1OQEA 2A6YA 1PIV2 1RITA 1D0GA 2PN5A 3AMQA 5J48A 5JZGC 4Q4X3 4N90A 1DZTA 3IKWA 4Q1PA 2D5FA 3DPRB 3ZMOA 2XVLA 3DUIA 1EPWA 1F2NA 1KDMA 3CU7A 3AZWA 3HWJA 2B46X 4BYYA 4AVBA 4LA2A 1PIV3 3NAPB 4WM8C 1YXWA 2VOKA 3EBRA 3M7AA 3WQ7A 4EJRA 5BNNC 5CADA 5DG2A 3KZ4C 4QGMA 2XKOA 1DU3D 1UKGA 1AXYA 1H4HA 1VRH2 3M70A 4HKWA 1FMD2 4JV4A 4K8FA 1ZZ9A 1X7NA 1LR5A 4R52A 2D93A 2MEV2 5GLVA 3SCFA 1LOEA 2ZX4A 2CAVA 3FLTA 3JBG1 4OULA 1XQNA 2KA3A 3U10A 1VRH3 3POYA 1V70A 2OUJA 1FMD3 1DQ2A 1R091 1NLRA 1RJ7A 1WA4A 3BOPA 3PMSA 3N3HA 2MEV3 2LALA 2B8MA 1JW6A 3BALA 1OKQA 4B29A 1LOFA 2GU9A 4IEVA 1ZA4A 1KXGA 2A6ZA 1KJRA 2GZWA 5CFDB 3JB4C 4C90A 4COZA 1YJKA 4MH0E 3WP6A 2DURA 2Z5WA 4XMIA 5CFDA 4FAHA 1C8M2 2D43A 4XFGA 5JOYA 4QPGA 1EYBA 1QXPA 1FXZA 5C9AB 4CDQA 3WP4A 2WNEA 2BFUS 1C8M3 2ZGRA 4I02A 2ZX1A 2HWD2 1WBFA 3WLUA 3J9SA 4M3CB 2PHLA 2ZGKA 1UN1A 2HWE1 4IERA 1S55A 2VW2A 2HKXA 1RUC2 1AX2A 1QU0A 4BIFA 2XJVA 1CONA 3JZVA 3RSJA 1R081 3V0BB 2I74A 1QJZA 2HWD3 1WCKA 4S2FA 4MXWA 2KM2A 5CA6A 1ENQA 2D6PA 1PK6C 4I0BA 2WFF2 3AZYA 4P9IA 3Q9OA 4E4ZA 1RUC3 3QACA 4COYA 3LWCA 1HIXA 5E1RA 1F9KA 2UY9A 5CIRA 5FTTC 3AP4A 1RHI2 5I0TA 1G86A 1W6NA 4KG8A 4RD7A 1POV3 4NR1A 3AZVA 1YFXA 1AYN2 5DUVA 5GZFA 1ZREA 3MIDA 2BGCA 4TSVA 3FFZA 2VH9A 2EXKA 2R0HA 3ZSJA 1RHI3 1DZQA 2RS32 1RTVA 1BBT1 4QQPA 1AYN3 2JX9A 2WA3A 2PAEA 1V9U2 5T55A 3MLJA 4N9HA 3DV8A 5DDJ1 3M4FA 3B5LB 2NLRA 3B01A 3GBWA 4EWDA 4FT8A 1IPJA 1NY72 2VNOA 2ZMNA 3NO8A 4HL0A 1TNFA 3IT8A 1ENRA 4L97A 1V9U3 4BOWA 1AR91 4JGYC 3KMHA 1GYKA 1LHOA 2DTYA 2Z2SB 4AF9A 3M3IA 4O9GA 4S2DA 1KQRA 3WUDA 4U2AA 2SLIA 2CGOA 1AJOA 1O5LA 2RS12 1GQHA 3RPQA 3OY8B 1PZ9A 5GJ6A 1MR5A 3GZTB 2PLV3 3ZFEA 2PELA 4YW1A 3RDIA 3VKLA 3KM5A 3UJOA 2RS13 3HT1A 5D8AC 4L8QA 1MACA 1QDOA 1REFA 2WA4A 5EV7A 4CEWB 5FO9B 3ZSEA 4IEOA 4Y22B 4GMP1 4IQPA 1CAXA 3OBTA 3MDPA 2XG3A 3ZYPA 2R072 1SFYA 3WDTA 4X8PA 2K9ZA 2BVBA 4XHXA 1I9RA 4Y22A 1B09A 2QFEA 4XJUA 5FQ0B 2NMNA 3KGLA 3TNPB 3TWIA 1S0JA 2Q5TA 3ST7A 3WXPA 1JHNA 2MNGA 3IN9A 5BNPB 4EV0A 2R073 1VBD1 3FUQA 4UBHA 4N7UA 4H14A 4COWA 3CJIB 2VU9A 1YFYA 3LSDA 1QJX2 3NV4A 1OHFA 3FMGA 2GN7A 3BCWA 1ND3A 2OUHA 3JU9A 5CG9A 4HFSA 3PVEA 2GALA 4Q4V1 3SH5A 3OBRA 5DZGA 5EXOA 2WZR3 3MIHA 1QJX3 2SBAA 2EXIA 1GQGA 1Y9QA 3VGIA 4RR3C 3AYAA 2D6KA 2XJRA 3URFA 1VBC1 2AREA 3E5XA 1C3HA 1KJLA 4U36A 4F8AA 3JB8A 1LECA 4XJWA 3I4IA 1UCXA 1RC6A 3ENRA 4QU2A 1Q8VA 3BTAA 1S2KA 1CAWB 3ELNA 4AEDB 1AUYA 4IEPA 2A73B 3QOPA 1DGWA 3QH6A 1UL9A 1MEC1 2MHFA 3H1MA 2VECA 2FBEA 4F3JA 5E16A 3HIFA 3JUUA 2D6LX 1NZCA 2Z69A 1SLLA 4CEYA 4JDNA 4D94A 4KG0A 5J7MA 4RGGA 1LOBA 1ND2C 2PA7A 3W59A 1N1VA 2AUYA 3FFQA 3USSA 5ABJC 1D0HA 2JJ6A 1Z7S1 1WUVA 1LB2A 1X33A 2BFUL 4MGZE 2DVFA 4FPYA 1S0CA 1C57A 2DCYA 5CU1A 4ZKTB 3S7EA 1QOSA 5F1RA 2IXJA 1D4VB 5KXDA 1S0BA 4NHMA 1H0BA 4Q0SA 1O5UA 3AMPA 2YMZA 3WDYA 1OSGA 1AR83 2WNUA 1JYCA 3VBRB 1VBE1 5FLJA 4XQ4A 4C91A 3O14A 2PHWA 5T3NA 1FNZA 5JVVA 3U11A 4M3CE 5DUUA 3N35A 4BZ4A 3S7IA 1LULA 1CIWA 4BE3A 2XHKA 3DPRC 3SH3A 1AL22 4KNCA 1LOCA 3HT2A 3VZKA 3ZO0B 5EJ3A 1N3OA 5I91A 4YVSB 1CESA 1RUF1 3N7LA 4XFCA 5HCAA 1QJY2 2Q1ZB 4HK8A 4E4DX 1XU1A 2G9FA 3NAPC 1JOJA 4AEKA 2WNVB 4Q0UA 1W6MA 1AL23 5T5LA 1VBB2 1OOPB 4LNVA 4OHZA 1QJY3 4XPVA 2ZCWA 4JGZA 5JZGB 4IV3B 4NWWA 5K0UA 5AVAA 2ZZJA 5JOZA 3PVNA 1MS0A 4Q4W2 1VBB3 3JD72 1A3KA 1GFF2 1WLCA 5T5PA 3PMEA 2DVGA 2D3PA 4WM8B 1K5MA 2Q30A 1DQ6A 2TEPA 2NZ9A 2WQ4A 4QM8A 3TBDA 4UXAA 3AMNA 1AR61 2AGSA 4Q4W3 3JD73 5F9TA 3H8UA 3ZN4A 4FPJA 4FPLA 5BXXA 4XF0A 1DGRA 1CAUA 4GB31 3I59A 5ACA1 1QNWA 5CFDC 3BU7A 4FBFA 1YNAA 4QPGC 5FLIA 4L11A 1Y7BA 2VVFA 5DXDA 1QHDA 1RUD1 4XILA 1DBNA 2VY0A 2CYFA 2V5YA 5FAXA 3AZXA 1Q8PA 4YRDA 3KCXA 5AC91 5C9AC 4ATFA 3WR0A 5KXEA 2DVAA 4GWNA 5DUXA 2HWB1 2PTMA 1TQ5A 5IUQA 4AHXA 5HCFA 5K8SA 1J59A 2YYOA 2CL2A 2ZACA 1RJ8A 4KH9A 4KGGA 1ZBA1 1ZVFA 5LRRA 2WWSA 2A6VA 4Y20A 2D97A 2ZGTA 5T5JA 3WHUA 4OLLA 4FAGA 3TN91 2VXRA 3B94A 3DKWA 3IMNA 1UF2C 3E5QA 3ILFA 1QXRA 2QNKA 2VGDA 4B8EA 4FP2A 4X8NA 5D1IA 2DV9A 2E6VA 1QJU1 2WS92 1LGNA 4JRAA 4A7KA 2ZGUA 3FBYA 4RQPB 4K20A 1MQTB 2A6WA 1ZNPA 3AYCA 3ES1A 4EN7B 3ZYIB 1FATA 1SCRA 4HT1T 1MQTA 2WS93 4ES8A 5KBFA 1G8WA 2P34A 3WVJA 4DRVA 5BY5A 3AP7A 1PK6B 1SBFA 1I3HA 2PHDA 1NQJA 4M0HA 4COUA 1EAH2 4WBBA 4HKLA 4OZXA 4COVA 3V0AB 1S0FA 3W58A 4XXPA 5A33B 1CJDA 3FWEA 2VW0A 1Q3EA 3V0AA 2VOWA 4ORFA 1FOD1 2AYHA 2PYTA 1ULCA 1R1A3 1N1TA 1EAH3 1VBA1 1YIPA 2DVDA 2OW4A 2VOVA 3NWKA 3H3UA 1GLHA 1G9FA 3ZFEC 5HI0A 2JG8B 2YPJA 4XFAA 4Z2WA 4XDQA 4OHXA 4OI0A 2PAKA 3B69A 1NCRB 2G9GA 4ATEA 1W6QB 1IS6A 1DFQA 3ZXJA 1FV2A 4FPOB 1ZRCA 4PDWB 4FTBA 4D7SA 4XJ8A 4LE4A 2XLGA 3AZZA 4X6RB 4XTPA 1N3PA 3MPPG 1REDA 5GLTA 1FYUA 3THPA 1UAIA 4CDWA 4IETA 4XF1A 1QKQA 3ZFFA 1ZBE2 4XBNA 2EIGA 1DZRA 1PVXA 2JD4A 1HQNA 3ZVXA 4E2SA 3ILNA 3ZXAC 1D4M2 3KB5A 4XW3A 3DL3A 2YZ4A 3NV1A 3VL9A 4XF4A 4JTOA 4NN0A 2NYYA 2VUAA 5BNPC 1ZBE3 5CNAA 4F83A 1QQP1 3KD4A 4XYXA 1NA1B 2WZPP 1LTEA 3WZ1A 5GLZA 1D4M3 1OI6A 3LSEA 3CJIC 5DZFA 2XJUA 4WM7B 4AG4A 1QY4A 4BHPA 1WCSA 5JAXA 5LK7B 2B7YA 2TBVA 4LE3A 2Q4SA 4MYEA 2O8OA 4CDUB 4FOQA 1DIWA 4Y1XA 4P9WA 4YLZA 2WSVA 1RUG2 1SDWA 3WG2A 3EXUA 3VBOA 2ZTNA 3TOJA 2QVSB 1S0GA 2WQZC 4IEZA 4RS5B 5L36A 1GNHA 4YZ4A 1RUG3 4NHKA 1XNKA 1W6OA 2CTVA 4R8HA 5JOWA 4DRRA 3MIFA 2A5ZA 2D6OX 2ETEA 4CEYC 2QZ2A 1RUI1 1DGLA 2PHUA 3R0RA 2XJSA 2PHRA 1GZWA 1B35A 3FLPA 1A8MA 2IXHA 5C8CA 4XZPA 2VW1A 3GYDA 3ZN6B 1LOAA 3AP6A 2VPVA 1CD3G 4RHV1 1TNRA 2WT1A 2ZGMA 1R1ZA 3IPVB 5T5OA 3R4DB 4FPHA 1VAVA 4R4XA 2W52A 1G9BA 4MGYE 3WDWA 2R041 4FTSA 1IS3A 1MS5A 3NSTA 3VBSB 3VHRA 2VQ0A 4S2HA 2KXLA 2DU0A 3MW4A 1UIJA 1BMV2 2DYCA 1AVBA 2WKKA 1FMD1 3AB0A 3LA3A 2GMEA 2GNDA 3MIBA 1HRI2 4QQHA 1TMF2 4XEZA 3ZMNA 4CTEA 3FJSA 3UK9A 3QH7A 2VOXA 1WLDA 2R30A 3T1LA 4CYDA 2HWF3 4EWEA 1H1IA 3FE5A 3MIEA 3B93A 2ARXA 2AZ5A 5BNQA 4FTEA 1HRI3 2D44A 3CF6E 1TMF3 1E57A 2D5HA 4AYUA 1VB4A 3HMYA 3KSCA 1DQ5A 4Q4X2 5J37A 2JENA 4X6QB 2ZGOA 3D8CA 4JGZC 1PGW2 4YGBA 4OI1A 2JKBA 3AYEA 1NLSA 3LA7A 1OOPC 4AFCA 4AQTA 2CV6A 3SISA 4NOTA 3OD0A 3WUCA 4IV3C 5KXBA 5FPZA 2R0FA 3JQXA 2ATFA 3HAGA 5C4WA 1K5MC 4OI4A 2H6BA 4IL7A 1N1SA 4EWAA 2CWSA 1VIWB 2EALA 2RMU2 1LHVA 3WP3A 2IZWA 1H9PA 2ZX0A 2VG9A 3OPZA 4Q4Y2 1JUHA 5FCCA 4Q0PA 2YGLA 5KHHA 1AR72 2GMPA 1NE6A 5H9RA 1VR3A 1UU4A 4BLJA 1S0EA 4D7TA 5KHKA 4AEMA 2RMU3 2LTNA 3QBQA 5T54A 1CJPA 1RUC1 4G9SB 4Q4Y3 3NV3A 2XLFA 3AKSA 1AR73 1EV11 4LTAA 2UYBA 3ZIWA 4PIYA 2RR11 2CGNA 2ZX2A 3U0ZA 2BYVE 1CAVA 2WFF1 1EPZA 2Q8OA 2HEYF 4I3PA 1CR7A 1PVC1 1UIKA 1RHI1 4N43A 4YVWA 2PHTA 1DGRN 1PNGA 3VBFB 4YARA 1LU1A 5JI9A 2WC2A 2UURA 3L2HA 4QPGB 3WX5A 1TE1B 2RS31 1YCIA 3VBFA 3ME2A 4GKXA 4CDXA 1AXKA 4LR4A 5FFOC 1WCDJ 4CDQB 2HWC1 1DYPA 2BNNA 3E5UA 4M01A 4AEJA 1QMJA 4HPKB 2XH6A 4LBQD 2Z79A 5J36A 2JECA 2ZABA 4HPKA 3ATGA 2XWBB 4RQPC 4XTMA 3MEPA 5L73A 4HSJA 2P17A 3BOWA 1MQTC 5I0RA 5F6LB 1I6XA 4XOGA 1H2MA 1AYM1 3ILRA 5FREA 5FBZA 3VZOA 4I01A 2QDRA 4AI2A 1W6PA 3H0OA 4MXWB 4DINB 5J3UA 3UJQA 2WSUA 4RA0A 3WNXA 4YG3A 2XVGA 1RGSA 2WL1A 1F31A 2IC1A 4YG0A 4YZ1A 2WIIB 1YYNA 3WY6A 1O91A 3USUA 1W6NB 2FQPA 5I8TA 2ZS6B 5FOJB 1TME1 1S0IA 3IDCB 4INDA 3VKOA 5LEKA 3MYXA 2ZHMA 5L19A 3PLQA 4AHYA 4Q2FA 1SLIA 3JBG2 4LBQA 3NL1A 4HN0A 5L7OA 1ZRDA 1MZEA 1ZM1A 3GBGA 2R071 5JI7A 3RRDA 1V6IA 2JG8C 4D7YA 3M1HA 5A3MA 4HMZA 4GWMA 2UWBA 4XMAA 1NCQA 4YW5A 3IDEA 3JBG3 4AQ6A 1NCRC 4J6GA 1RB8G 2WJSA 4C0BA 1FNYA 2X8KA 1VB2A 1A78A 1WMFA 4PDWC 4GMP0 4HK9A 5GLWA 2CWMA 2PLV2 4P9LA 4BM8A 3MF6A 3OF1A 3ZFFC 2DCZA 4Y1VA 3ZFEB 2XJQA 1LRHA 3GHMA 4GKYA 3P3NA 4NWVA 1C28A 3A0KA 3S30A 4A7YA 3GHNA 2TNFA 4QQOA 4B3NA 4AI1A 5FOBB 5KHJA 1UPSA 3K48A 5LK5A 3SLIA 1C4RA 1X8MA 3LGRA 2HEWF 4AK3A 5GLUA 2BWCA 5BYNA 3TAYA 3ZN5A 1JH5A 1NA1C 1CAXB 4MLOA 3J26N 1H1AA 2WFPA 2B39A 3EO6A 3ZX7A 4S2GA 4WM7C 3MGUA 3X29B 1J1LA 1BEV2 4ASLA 2HWE3 1FAYA 2GH2A 1X82A 4Q27A 1ZZBA 1M4WA 1R083 2FHRA 4CDUC 1CPNA 4I2OA 4QPIA 3VBOC 1XNBA 2ZAAA 4K1ZA 1BEV3 1SFNA 4IEYA 1FX5A 4DFSA 2PHFA 1DQ0A 1COV1 1S0DA 4IESA 1ND3B 4KWJA 2RE9A 3VHOA 2WZR2 3R6SA 2R32A 4HETA 2E7TA 1OQ1A 2ZGNA 2D6MA 4RS5C 5LRSA 3N36A 1HRV2 3FBMA 3VBUA 4C1XA 1YWKA 4Q0VA 2BVVA 1RUJ1 3QD6A 4GH4A 4GULA 5DDJ2 3WQ0A 2K2SA 4H7LA 4N53A 4YFWA 1UZZA 3A4UA 3N4MA 4Z1VA 1WLWA 3O7OA 4ASMB 4AFBA 1HRV3 3E6DA 2LUWA 2NQYA 1AR92 5DDJ3 5SV8A 2XBO1 2ZX3A 4YW3A 2RHPA 3B9CA 5IK8A 4M3CF 1FV3A 2A7AA 1ONAA 1QJY1 4LHLA 5FRAA 1PGL1 1JTZX 2W0XA 4PIXA 1ENSA 3ETQA 4Z8BA 4TZDA 1AR93 4QGLA 3VBSC 2R6QA 4CEYB 1H8VA 2A3XA 3OGGA 3WV6A 2B42B 1GICA 4UW6A 1XNCA 1C5HA 1Y43B 4LEJA 3IIAA 2BW8A 3B3QE 3SXWA 1VALA 4Z07A 4IEQA 4MVTA 1RMU2 4YW4A 1AL0G 5H9PA 4E9KA 1MS3A 1AR82 2DFCA 2O1QA 3DF0A 3JD71 4P5HA 1O4YA 3VDDA 3WG4A 2EA7A 3MF9A 1YFWA 4R4ZA 2Q1MA 2WNUB 2QE3A 4KBBA 2WLPA 3ZXKA 3QCWA 1OA4A 4GMP3 3CL1A 1ALYA 1RMU3 4YYOA 5BNOA 1OPMA 4YFZA 4K21A 2VNGA 1XYPA 3OJBA 3DGTA 1VBD2 4QHBA 3WW3A 2B5HA 3AK0A 4PLOA 5K7PA 3AXEA 2ZZQA 2BNOA 4FQZA 2VMIA 3H7JA 5C4WC 3M3QA 1D2QA 1AX0A 4DS0A 5A3LA 4GQ7A 3LKJA 1VBD3 4FOVA 4MV2A 1W6MB 3HR9A 4Q4V2 3ZYRA 1QF3A 2EAKA 4G4FA 4YGDA 4JGZB 3H1YA 3ZFGA 2ZMLA 5K0UB 2DUOA 4Q4V3 2A6XA 1VBC2 4AHWA 4YZ5A 3PJQA 2IXLA 4XETA 3HQXA 2B45X 4DNYA 5F5QA 1W2UA 2IXKA 4R9CA 3R05A 1PHMA 4IEUA 2A3YA 1F5JA 3VHPA 5H9SA 1K5MB 1LESA 4XJAA 4K40A 1NXD1 1LOFC 1VBC3 3UKNA 1MEC2 1BJQA 1NG0A