3MIGA

Oxidized (cu2+) peptidylglycine alpha-hydroxylating monooxygenase (phm) with bound nitrite, obtained in the presence of substrate
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
309
structure length
309
Chain Sequence
ECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-glycine alpha-amidating monooxygenase
publication title Differential Reactivity Between the Two Copper Sites of Peptidylglycine alpha-Hydroxylating Monooxygenase (PHM)
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 63
structure length 309
sequence length 309
ec nomenclature ec 1.14.17.3: Peptidylglycine monooxygenase.
pdb deposition date 2010-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01082 Cu2_monooxygen Copper type II ascorbate-dependent monooxygenase, N-terminal domain
A PF03712 Cu2_monoox_C Copper type II ascorbate-dependent monooxygenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3migA02
2.60.120.310 Mainly Beta Sandwich Jelly Rolls Copper type II, ascorbate-dependent monooxygenase, N-terminal domain 3migA01
3PMSA 3MIEA 4R4ZA 3MICA 3KS7A 3MLJA 3MIGA 3MIHA 1PNFA 1YJKA 1SDWA 4E4ZA 3PHMA 3MLKA 3MIBA 1YI9A 1PNGA 3MIDA 3MIFA 4QHBA 1PHMA 3MLLA 1PGSA 1OPMA 1YIPA 4R4XA 1YJLA
chains in the Genus database with same CATH superfamily
1SLCA 2G19A 3WG1A 4Z07A 2BZDA 2A70A 4CU9A 1O8SA 1PO11 4TLFA 4UFIA 2QUOA 3PU8A 1LESA 2VUCA 1Y9MA 2JG9C 2HWB1 1MS3A 2O0OA 5FWJA 2HWF3 3DECA 4XJWA 4Z2AA 5T5OA 1NZIA 1WUVA 2DDUA 5HV4A 3I2JA 3I2OA 2QTWB 1A8MA 2XB6C 3AJYA 3PHMA 3QD6A 1CAUA 2Q1MA 3NSTA 4Q0SA 2WWSA 5FO8B 3C3VA 1AR71 1NY72 4YZ1A 3N7MA 4QQ2A 3HN3A 3UYJA 4K8FA 3K2OA 1VPHA 2JICA 4N53C 5A33B 3UT0A 4ZPIA 2YV8A 3JD72 3VBUC 3D6EA 3KGLA 1QU0A 2R6QA 1DQ6A 1ZZ7A 2Y6GA 3ATGA 3KF5A 4Q4X2 4Q4Y2 4XMAA 4Y22A 1J83A 3KT4A 5KC6A 5KWRA 4LKSA 5T5LA 1GV9A 4XJAA 5A7SA 4PJYA 5ANNA 1BMV2 2BUKA 4FP2A 2OYZA 3W58A 4PQQA 4CEWB 3C7OA 2YY1A 3NMBA 2EF6A 1ENRA 3VL9A 4ZU5A 1MS8A 3AP9A 1ZZBA 2Y38A 1BBT2 4ZHNA 2RM22 1TVGA 3AB0A 3LA3A 3MW3A 5JZGC 4FPHA 4FTEA 3WW4A 4XJ8A 3R6SA 3GZTB 3SISA 4AGGA 5IK4A 4PIXA 1YO8A 3AP5A 3GYDA 4N9HA 4QKDA 4CCJA 3BUCA 1FNYA 3AFGA 1ND2C 1ASJ2 5D8AB 4Y4YA 1MEC2 2IXCA 2K0GA 3LOBA 2BPA2 4H2AA 5JR2A 5JUVA 3OJBA 3TYJA 4A2UA 2VOVA 1FNZA 2R071 2R0HA 1FPN1 4AK3A 1G9FA 3UK9A 4DUVA 4CP1A 3KF3A 1Z7S3 4KGGA 2DCJA 1HDKA 3U11A 1QNWA 1CJPA 1EAH3 1Q5OA 1ULGA 4LIUA 3J7LA 1W28A 5JOYA 1NLQA 4CEWA 3L9JT 3HNBM 3KQRA 3WDWA 4NROA 1W0NA 2H0VA 5DAXA 1YIPA 2VULA 4CP9B 2WSUA 3DF0A 1LOFC 3GNEA 3UGFA 3LFIA 2ADEA 1X8EA 1AYN2 2HJIA 4URTA 3PIJA 4AVTA 3PIGA 1S0DA 5FZMA 2EICA 1E57A 1PGW2 2DVDA 2VZQA 5D8AA 5C8CB 3VKFC 1HKDA 1POQA 2ZBJA 3JD73 5HXMA 2Y8KA 1W2AX 4QDSA 4Q4Y3 1W9YA 4Q4X3 4XJUA 1W8ZA 1NX9A 4LMFA 1UYPA 4HLTA 5IFTA 1DFQA 1JOBA 5DXDA 5AVAA 3THTA 1PO23 2G4IA 3DPRA 3EBRA 2VZPA 2OPWA 4M0HA 4MXVA 3SH4A 2DF7A 4MGSA 4LKEA 1GWLA 3IAPA 1US3A 1POV3 1ZVFA 1Z78A 3GBGA 4DPNA 4JGYA 3UKNA 2RM23 4QB6A 3C7EA 3LDRA 4CP9A 2UWCA 5T5JA 4EN7B 1GQPA 2K9ZA 2WWJA 4D94A 5JCTA 1RUI2 1IS5A 4P9LA 3T09A 1LNSA 3ZXJA 2J22A 3H3LA 4PI2A 4GAZA 1G9AA 2UYBA 1QJY1 4QGLA 3VV1A 1C28A 3D0SA 3APBA 1PX4A 2NPIA 1YQCA 1DLCA 3IKWA 3MIDA 4MLOA 1WLCA 3LSEA 4FVVA 1YWKA 1W06A 1IPKA 3FHQA 1HRI2 5FPAA 3VGIA 4E8DA 4J1WA 3GJBA 1WCSA 4LBMA 2BNOA 1IQAA 2AGSA 2QQLA 2BGOA 1UD1A 4GB32 4UFLA 4ZONA 4AF9A 2RHPA 3T2OA 2BOIA 1LHWA 1ODMA 5IVVA 3CZUA 1V0AA 3ABZA 1S0GA 1RINA 3QH6A 4YARA 3ZYPA 3KS7A 2K46A 4BB3A 5FMOS 1PVC2 2RS32 1ZBE1 4DB5A 3ZDVA 4M3CB 2EIBA 4XQ4A 3VBHC 3ZX7A 4EWAA 3KB5A 1AYN3 4S2HA 4AEDC 1HRV3 3HNYM 1UXZA 4Q0PA 5FYYA 3WF3A 1GOGA 5A3PA 1VMHA 3IMNA 3OY8B 2MNGA 1R091 1R1A1 3B7MA 3THPA 4NWWA 4YYOA 2HWC2 4B4QA 2BBVA 1W8TA 5C5UA 2Z79A 3MYXA 5F2WA 2ORXA 3BTYA 3CF6E 4JC1A 2VBPA 4I0BA 5E88A 5F9TA 3OGJA 4U36A 4E4SA 4OI0A 1W6OB 1NQDA 3WT3A 4BXFA 3T30A 1AX0A 2EXKA 2JX9A 4OULA 3ZIXA 4N7UA 4D6RA 4JAAA 4XE9A 1VBC3 4KNCA 1UPSA 4U2AA 3JBG1 3P6BA 4XILA 3UL2A 4YWAA 4K1YA 2AEZA 4XOGA 1ZNPA 2HWE1 5EP9A 3DPRC 4O9GA 1TQ5A 4YM3A 1S0FA 5HPOA 5CKNA 4FPGA 4EV0A 3LGRA 4C0HA 5KC5A 5SV8A 1GOFA 1VALA 2Z42A 2G9FA 3C7FA 4XTMA 1KXGA 5EPAA 4CUAA 5HV0A 3PUAA 1JOPA 4JGYC 5F37A 2QZ3A 1QOTA 5HXVA 3VZMA 4E9KA 2W52A 3OY8A 3CZJA 2JE8A 1XRUA 3CBNA 5JSRA 2IXJA 4NRPA 3N7KA 2GC2A 3TNPB 2Q8OA 4XBLA 3S5AA 2P34A 3O1OA 1J59A 1QXRA 1Y7BA 3ZPYA 5BNPC 1W6OA 3GBFA 4L9BA 3ZXDA 2XLAA 1U5YA 5IHRA 1JYWA 3ILFA 3OYWA 3RFRA 3UKTA 1VBE2 5LEJA 1NCQA 5CG9A 4UW3A 1D4M2 3NNMA 1CX4A 4GB33 3LZZA 4LHLA 5T5PA 3VBFB 1FV2A 5JIUA 4ZY9A 3ZMOA 1XU2A 4QX2A 1OOPC 4UFKA 4XIKA 2A75A 3J26N 4QPGB 5ABJC 5GZCA 2BOJA 3WP5A 1YJLA 3N9OA 4CCMA 4FOQA 1PK6C 1QXPA 1UNBA 2GALA 4I3PA 4QPWA 3AZXA 5CZKA 4IEZA 1LOAA 4XIOA 1VP6A 4GJZA 4PBPA 4K9SA 4NIDA 4DMIA 2G1MA 2MEV1 1JN2P 1ZBA3 3POFA 3KCXA 3OSDA 2RJLA 2HWC3 4JDMA 1DQ1A 1LR5A 4LKFA 1H8VA 3AM2A 5CB7A 5FXXA 4RGAA 1YXWA 2QQUA 3O12A 5LBFA 5KBFA 2CU5A 4XF0A 3ZFGC 1YFWA 1QOSA 5FMCA 1IPJA 3O0VA 1SCSA 5T3NA 4HK9A 5FYBA 1CZSA 1RUC1 2UWBA 2A71A 2IFWA 1XYOA 1G9CA 4O9EA 4H7MA 4Q0QA 3N9LA 2ARXA 5DG2A 5A7NA 1GMMA 1NQJA 1PZ7A 3BALA 2XVKA 3IBMA 2VAUA 4Q1RA 4QPGA 4XFBA 4AVSA 1TME2 2VBDA 1AL22 2OZ6A 1PVC1 2JENA 2JEMA 2XVGA 4KG8A 2R041 3ZSLA 1GANA 4Z82A 1BQPA 5AC91 3OPWA 2XL7A 3DEMA 3WNOA 4OHYA 1LCLA 5GKAC 3K4DA 1LHOA 4IGQA 4M3CE 3SXWA 1SLLA 3MIBA 1NLRA 1U5XA 4BCUA 2VBBA 1AHSA 1BJQA 5FYZA 1BVP1 1AR63 1V70A 4GWIA 3LB9A 2V72A 1C3HA 5CYYA 2IZWA 2WBKA 3J8F1 4GH4B 4JHZA 4YW1A 4UFJA 5LA1A 4NPRA 3UETA 2OQ7A 4CDXB 2DUOA 5JSOA 1SBDA 1UMZA 5LRSA 4AHYA 3MGUA 1AR92 3NNLA 1ULCA 5IVFA 2E51A 3ZN4A 3A0KA 3HR9A 3WCRA 1S0IA 1LTEA 3LSDA 1UU5A 4CU6A 2ID4A 1FMD1 2VOTA 2UU8A 5A3LA 1W9WA 1JYVA 1O6UA 1MZEA 1NCQC 2OUHA 2WRAA 1CONA 3AP7A 4IEWA 4IV3C 4XZPA 1LAJA 2VQAA 2FCUA 2VXJA 2PLV2 2W9XA 3LF7A 3OD4A 4WM7A 4BK5A 1H2NA 1W8OA 2OUJA 5FP3A 2R062 1PVXA 3WG2A 1C57A 5CU1A 4Z1VA 4FQZA 3H8XA 4EQVA 3U07A 2DUPA 1O4YA 1QF3A 2JJ6A 5A7QA 1N3OA 4H55A 5HCFA 4IW3A 4QQOA 2FDKA 1CR7A 2OVUA 4GH4A 2ETEA 4CTEA 3L2YA 1C8M1 1NA1B 5F3GA 4CDXA 3BPSA 5JOZA 5G05L 1XQNA 1Q8PA 4RHV2 2WZPP 4GXLA 5K0UC 1D0HA 5C8WA 1DZQA 3H1MA 2D93A 1LU2A 3LA7A 4K1ZA 4YZ3A 5IVYA 3ZFEB 5J09A 4X6RB 2OA2A 1ULOA 2P4EA 3RZMA 1TME3 4O7XA 3O0WA 3O1MA 1SFNA 4KU7A 4NHKA 1ALYA 3R4SA 4XAEA 2DBIA 3VBRC 4GMP1 3U37A 4ASLA 4RQPB 3D8CA 3ACGA 5DDJ1 3SITA 3KSCA 4OI1A 1EV12 4GMP0 1Y4WA 1HXS1 3HPNA 4XYXA 1UQXA 1DGWX 2NP0A 4FPEA 2FDIA 4JQTA 4F7ZA 2XBO2 4EJRA 1SPPB 2RS11 1V9U1 5LB6A 2B46X 2PHUA 5JIAA 3KCYA 2YBSA 2YUEA 2Y34A 3BODA 4UBGA 1GP4A 1NA1A 2WZR1 3C2UA 1RMU1 4G4FA 4UFMA 5I93A 4PF5A 5FZ1A 2Q8DA 1G9BA 1X33A 2ENRA 4P02B 1NYWA 4PDWB 4E27A 4B7EA 2YPJA 2ZGLA 2VO5A 3HQRA 4SBVA 4AVCA 2EA7A 2VECA 3HMYA 3B69A 3HBKA 3MLLA 2F6BA 5JSPA 2WFF1 5K9YA 1KD7A 1CZTA 4CDQB 2W47A 3KQ4B 3VLBB 2PLV3 1WMFA 1UMIA 3NAPB 4XCAA 4RQPA 4RD7A 2HEYF 5FQ0A 1AYM1 3DKQA 4JTNA 2AC1A 1IG0A 2VVFA 3GF6A 2J1TA 1QWRA 1SPPA 1AXYA 2EIGA 4K6BA 4PBOA 4N43B 1W6NB 4XUPA 2WLPA 2WT2A 2VJXA 1ZZ6A 2W1WA 3BIWE 2UY9A 3IIAA 4XDOA 4Y5Z0 3SLIA 2Y60A 3WG3A 4DO0A 2YMZA 5A32A 4RS5B 3OPZA 1BEV3 2Y6LA 2ZX0A 4M00A 3WDTA 5LBCA 4NIAA 1J3QA 5JPMB 4BA6A 4A42A 4PDWA 3ZR5A 1OPMA 5FJHA 3QBQA 2FZ2A 1C5IA 1NOVA 4X8PA 2X5IB 1W0OA 4BLIA 5FXZA 5IVEA 4CDQA 5LEKA 4KU8A 1ODNA 3ZO0B 4NHMA 1VIWB 3Q8CA 3NAPA 4LBQD 1UY3A 2R061 2V5YA 2ZMLA 3H3UA 3LPFA 1GNYA 5A7PA 5F39A 4EWDA 3GHNA 1H8TB 2WQZC 1QKQA 1REFA 4Q4V1 5L19A 4IGOA 5B2GB 1B35A 3HBZA 4HPKB 4JHTA 3I3BA 4QQHA 2D98A 2PHRA 2VMFA 2XBO3 3I3DA 3KGZA 4FO9A 1WKYA 3Q8FA 4HK8A 5GM0A 4NIHA 2VZVA 1TG7A 5FREA 2VCAA 2OPKA 1W6NA 3AC0A 4FXGB 2EAKA 3FL7A 4N43A 4UW6A 4OVEA 5BXXA 3WVJA 4ZU7A 2SLIA 2HBTA 2LM3A 4D7YA 1TMF1 4CA9A 4RS5A 2WS91 4OZXA 4QDQA 4YM2A 2FDGA 2RR12 5FYMA 2YFUA 4RSUA 3M1HA 4TN7A 4OQ9A 2VUDA 3AKPA 1A3KA 2X5IA 3CJIC 4QPIB 3IDEA 1OKQA 1W39A 4M4RA 4JGZC 4Z8BA 4LOSA 2WZEA 3I3EA 3AYCA 1QJFA 3ZSKA 4IEXA 3QACA 4FPKA 1YI9A 1H8TA 4JRAA 3ES1A 2J42A 1F5JA 2RMU1 3HIFA 4Y1UA 1YEWA 2W94A 5BNNB 5HBAA 1RUJ3 1ULDA 1VAMA 2A3WA 3H0OA 1AR83 2PHDA 1UOJA 2ET1A 2OQ6A 2YPDA 1DDLA 4MGYE 4DXSA 1GSLA 1O3QA 1VRH3 3RZZA 4EN6B 1JOJA 5CAZA 4D0QA 3VKMA 1RUF1 1VBA3 4C0BA 2JXAA 4UBHA 3WW1A 1HV1A 2QKDA 3O1PA 1PZ9A 1MZ6A 2KXLA 1VBB2 1W6PB 3VDDB 2HWD2 5DUUA 3ST7A 3WF4A 4OHZA 2PAKA 2YC4A 3ZXEA 2XJVA 3J7HA 1S0CA 2YB7A 1MS5A 4QU1A 3I2HA 3VHPA 3O1RA 4Q0VA 5GJ6A 2ZGMA 3X29B 1PGL2 3T3YA 4XPVA 2XJPA 4DRVA 2O1QA 4C91A 1H2LA 4PI0A 2DVBA 4CCDA 4W65A 4K8RB 3VL8A 1HW5A 1YYNA 2GNTA 4YGCA 1GYKA 3NNGA 5ACA1 1FXZA 1XNTA 3FFZA 2EALA 1UAIA 4RL7A 4WVZA 1UIKA 1OC1A 1OMIA 3RDIA 2FDHA 5D21A 5T52A 1B35C 1Q8QA 4Q4W2 3U10A 4ET7A 1JZ4A 1I6XA 4OMDA 1RUG1 4WV8A 4YVSB 5EJ3A 1UMHA 4LUMA 3OGVA 5FR3A 4NR1A 1OLMA 4XHBA 1UPIA 1HV0A 1NG0A 2ZHMA 3OUJA 4OUSA 4P9IA 1GFF2 1W6PA 1V6KA 4HN0A 4XVHA 3WHTA 1YFXA 1QJX3 4IE5A 2ZHKA 5FCCA 5A7WA 3OB8A 5DZEA 1UXXX 4Y5SA 1KGYA 2XLFA 2HLEA 2OKXA 4CE8A 5BV6A 1RVF2 1UYZA 2E31A 5A70A 3NJVA 4QX7A 3MBWA 4EWEA 2XQXA 4YNIA 3T2TA 1V6JA 5KXDA 5DG1A 4W4ZA 4JKLA 2XHKA 3S7IA 5H9SA 4AVVA 1XOYA 4QQLA 3KHBA 4E4ZA 1OA2A 2X29A 1VJ2A 3MF9A 2JG8C 3BB6A 5A6QA 1JYXA 5EV7A 3FHIB 2R32A 4NWVA 1VAVA 2LW8A 4YVSA 1ZRCA 2QFEA 4YLZA 1DYOA 2XJSA 5DUVA 4FPLA 2VM9A 4WVVA 5FZKA 1VBB3 1TNRA 4PLOA 2HWD3 2HWF2 1OQEA 2FHRA 1RUE3 4LOTA 4UOJA 4XUOA 1RUD1 2C9KA 4JX0A 5FZCA 5JXJA 2VOWA 3TN93 3FX3A 3A23A 3B94A 2P6HA 4R4ZA 3VBSB 4HG6B 3VD9A 1AVBA 3ILRA 5KXEA 5GALA 2L9LA 2DTYA 5EYYA 4QM8A 1X8MA 4GIQA 4LK7A 4FFFA 1MS1A 3GJAA 1UW8A 1RUNA 4LBKA 2UY8A 3O7OA 4ES9A 4XF4A 2OX0A 1PM7A 3V56A 4O65A 1REDA 2VCCA 1PIV1 2Y0OA 3N36A 3VKLA 2EXHA 4K21A 3AYAA 2B9UA 1VBD3 2RV9A 1H6XA 3AKSA 4OYUA 2WNUC 4YM0A 1W2TA 1LOBA 1D2QA 1Z0HA 2RDSA 4GD4A 1GBGA 2BVVA 3AP6A 2BV4A 4P9JA 4MX3A 5BNOB 1E5IA 2GMMA 4MGTA 4AGRA 1W05A 1XB9A 1H9WA 2PN5A 3KZ4C 3VBSA 1GNZA 4YRDA 3HN1A 1T6GC 4QX3A 1HB1A 1W8HA 3IIIA 1RVF3 1RJ8A 1RXFA 1VR3A 4HVRA 3DUIA 1DP0A 2AACA 1DF0A 2GP3A 1W8NA 3K77A 5LA9A 3WP4A 5CG8A 1BK1A 3AMPA 3QCWA 1PO13 4ISRA 4P08A 3ZR6A 1OHFA 4PLNA 1OUSA 2W95A 2HWB3 3E6DA 2B8MA 1QY4A 3ZXGA 4Q4W1 4BHPA 1Q43A 1Z7S2 4LXLA 4NHYA 1GICA 1EAH2 2GMEA 5LASA 1R082 1COV1 4COWA 5F3EA 2I74A 3FMGA 3ZFFC 2E7TA 2A6VA 1V6OA 5FYCA 4CXWA 3HEIA 3PLQA 2GC1A 4LKDA 2D6KA 4YG0A 3O1VA 1X9TA 2VPVA 2Q0AA 1SDWA 2A1XA 4IUGA 1OLQA 1K5MC 5BNOA 3POJA 1J1LA 2ZEYA 2W91A 1GWMA 3FC0A 4JRLA 4WVMA 4UFHA 1NCRC 1J1TA 4AVAA 2BGCA 4IV1C 4B4PA 2VNRA 5DMYA 2P3KA 2A6XA 4CDWC 4Y33A 4XJ9A 1PX3A 3WQ7A 1RUH1 4QWNA 4QX0A 4OMCA 3FLTA 3WV6A 5J98B 4BOWA 5KHKA 2BU9A 2Y26A 2J7MA 4Q2FA 5F2SA 2QQWA 2QQOA 2R0FA 3DKWA 5ERLA 2XMLA 2ORZA 4J1XA 4OUEA 4OZOA 2W0XA 4QU2A 4ATFA 5F8PA 4CCEA 5I8YA 1LGCA 1PO22 1O8PA 4BZ4A 1ONAA 2KM2A 2VQUA 2JECA 5FZAA 3WXPA 1JHJA 4EZHA 1JH5A 2VQ0A 5A6ZA 5C4WB 4MGKE 3OEAA 2QQMA 5LBBA 1MVEA 1OURA 2X05A 1PMIA 4QKNA 4P9GA 2A6WA 3RJRA 1CD3G 3NRUA 4Q8LA 1SACA 1O3SA 1UWWA 3PTYA 2WJSA 2BTVC 4QGNA 2VZRA 2R073 2VZOA 5CKMA 2AR6A 1FPN3 4GWJA 4XJZA 1KS5A 5FY1A 2OT7A 3ZM8A 5A33A 5A6XA 1TEIA 1GZ9A 1DIWA 1XBFA 3UJOA 2CY6A 3IMMA 1QNYA 3FLRA 1TNFA 3O14A 4KGQA 3WP6A 3BTZA 1DG6A 2WNVB 2C24A 2E9QA 4DUXA 5FP4A 3LIHA 4IE0A 2DFBA 2VQTA 2DCZA 2XH6A 4YGBA 5EJZB 1R083 2D6NA 5EXOA 3TEZA 4DUWA 5H9PA 2WO2A 5C9AC 1I9RA 1MQTB 2ZGTA 3BVCA 1AX1A 2LRPA 1Q56A 2I45A 2JIJA 2UWAA 5C4WA 1JHNA 1SLTA 4HOOA 4AQSA 4GKYA 5FP8A 4WZFA 3LA2A 5E1RA 1HN1A 4NHXA 5FO9B 3KM5A 5FOJB 1HQWA 4HMZA 5CADA 1OVPA 4EN8B 2XJRA 3TB0A 1LRHA 1HRV2 4HKLA 4NJ4A 4WM8B 1KJLA 4P00B 3WNKA 1CJDA 3RZHA 2VW2A 1LEDA 3N3HA 3E97A 2ZPXA 3PL0A 3POWA 5C3RA 4DXTA 2NMNA 4D7TA 3RNSA 2GN3A 5IAVA 2WNVA 4FQ4A 5CFCB 3SC7X 5FKBA 1YFUA 2F4PA 5I8TA 2BWCA 4LORA 1EAH1 2R7EB 1SFYA 4LE3A 3T0BA 2QQIA 1VBC2 3VBOB 1MQTA 3FHAA 5IYYA 1A6CA 3T08A 1SZBA 1UU6A 1XNCA 5J37A 5KHIA 1AX2A 3R4DB 2QVSB 2HEWF 5JXGA 3POGA 4TZDA 2VTFA 1QJY3 1W6MB 2J1AA 3A21A 4CP2A 4HFSA 4I01A 3H1WA 1W3XA 2YC2A 3IAQA 4HSJA 1EPWA 3CDZB 4XURA 1NY71 1NE4A 1DYPA 3R0RA 4GULA 2VVDA 4XC9A 3J4UH 3MLKA 2AREA 4WM8A 1XSRA 4X8NA 5M0TA 3N35A 5FZ0A 5C8CA 2AUYA 4MVTA 1SG3A 1Y3TA 3JD71 4P5HA 2GNMA 5FKCA 5AFBA 4NIGA 1T6BX 2GC0A 5GZEA 5GLZA 2DCYA 5SV5A 4Q4Y1 3W9AA 3ZN6B 4AR2A 4Q4X1 2JDZA 3T4HB 2VZ3A 4COUA 2XPJA 1UOFA 5CFCA 2A6YA 4NMIA 3W5NA 1PM4A 2F17A 3SCFA 3RZLA 1X50A 1GR3A 2FDJA 1BMV1 1TE1B 5JXHA 2GN7A 1ZBE3 1SCRA 4BYYA 3MUY1 4IE6A 3VBOA 3BTXA 4NHLA 3IWZA 4JQRA 4LK6A 4QX5A 1SBFA 2X53S 5FK8A 3OBZA 3MLJA 3NV2A 4BWOA 1BBT1 5ANQA 3PJQA 2RM21 2B9VA 1RL3A 4IERA 4HL0A 1QEXA 1W6MA 3WF1A 4CEWC 4OI4A 1I3HA 3AVSA 2JE7A 5FYTA 1CPMA 2Y6FA 3VHRA 1UY1A 3MUZ1 3ZYIB 1UX7A 3CEWA 4MV2A 3NNJA 4FPOB 1ASJ1 1W2UA 1ZBA2 5DUXA 1MEC1 3ZLIA 1F35A 2ZTNA 2W1UA 3KVBA 5C71A 3BU0A 2E33A 2XJUA 1EUTA 1RGSA 3AXDA 5EQUA 1VLNA 1AL0G 1XC6A 1YHFA 1NZCA 3JBG3 3ZN6A 4D3WA 3SEPA 3S30A 5D8AC 3ZPOA 2JDAA 2HWE3 5HCHA 4LNVA 3U1XA 3PUQA 3EHKA 4CU8A 1XPWA 1JZ3A 4CCLA 3V0AB 1F31A 2JWPA 4AFMA 4DINB 2CNAA 1XE7A 1YQ8A 3RWNA 1HQLA 3IN9A 4J6GA 5IFPA 4DXZA 3ZXLA 1YFYA 3KV9A 5CBLA 3ZSEA 3LDKA 5LY1A 2DUQA 5CKQA 3LQCA 5FTTC 3LEIA 1QH6A 4M3CA 1V00A 1AYN1 2QNKA 2VNGA 3L2HA 4BLJA 2CAVA 5LK5A 1PGW1 2WN2A 3TWIA 2WA3A 2E7AA 3PTRB 1PZ8A 4HVQA 3I97A 4Z2WA 1IS6A 2QZ2A 4FOWA 1AR62 5L7OB 4M4PA 1CPNA 4MZUA 2NQYA 2WABA 1UZ0A 2EIDA 4M3CF 3PVBB 4K20A 3V0AA 1MPXA 1JODA 2ZKLA 4LBQB 5BYNA 2JB4A 1K5JA 3BN6A 3ASIA 4XBNA 1MR5A 4KMQA 1UZZA 2MEV3 4Q1PA 1VRBA 4W50A 1OD5A 2GDFA 4LTAA 3NQHA 1J58A 2QJVA 2ZAHA 2DU1A 4DXRA 2VD7A 3ECQA 2V5DA 4Y1VA 4XEZA 4YZ2A 1K12A 1RUI1 3AVRA 1H1AA 3HQUA 1UZWA 1H0BA 3M4FA 1R64A 3S6PA 2N7GA 3U4SA 1G9DA 4KWLA 3H42B 4L11A 2VW0A 1RIRA 1Q8OA 4RN5A 1ZRFA 1O59A 5H9RA 4XDQA 1CGPA 2GNBA 4S2FA 2HKXA 1X7NA 1HRI1 2ZGQA 1MZFA 1WCDJ 2EIEA 4XFIA 3VHOA 4E4DX 3NO8A 1PNGA 1W6QB 2X10A 5DAWA 5APAA 4KWUA 1MS9A 4AI2A 5FBJA 4CXXA 4YZ5A 2FQPA 2NMOA 5FUNA 2ZXQA 1ZA7A 2R043 4GB31 5AC93 3GBWA 2WC2A 4LBQA 3VBFA 3VD5A 4NAOA 3UV9A 4QXCA 1N3PA 4QHOA 4MO3M 1OF3A 3OG2A 5L73A 2RS31 2XUMA 4RR3B 4TWTA 1KDMA 1G8WA 1DZRA 4AFCA 2ZAAA 2RE9A 2IWGB 3J8F3 4FFIA 2ZHLA 4HZFA 4BJ0A 2UYAA 1ULFA 1UCXA 5CA6A 3JXSA 3MW4A 2HWC1 2AYHA 1RB8G 1IKQA 4QAWA 4H3WA 4TTGA 3DV8A 4QB2A 3VN4A 3WDXA 3ACFA 2ZGNA 4IEQA 3A22A 3AFKA 2W2IA 4G3YC 3U78A 1FMD3 3VZLA 3WCSA 4C1XA 3HVDA 2GAUA 4QMAA 1W6QA 1MS0A 1RYYA 4BPZA 3U14A 3DYMA 3Q8BA 4YVWB 4E8CA 4AEJA 3C8XA 4H14A 1AXZA 2A73B 2DVFA 2ZGKA 3BGAA 3POIA 4BU2A 2VNOA 4IESA 3BKZA 2WAOA 5F6LB 2DV9A 1UN1A 1LGNA 4QXBA 1UKGA 4LITA 5I0SA 3H3ZA 1Y43B 3CJXA 4IE4A 2LROA 3EXUA 1ZM1A 4LR4A 3K75B 3N7LA 2D5HA 1A8DA 2BNMA 3SCGA 3WZ1A 3POEA 4JTOA 1GWKA 3BU7A 3POYA 5DZFA 3MV11 4XFFA 2LTNA 3ELNA 4TYSA 4COYA 3RZKA 3TRSB 5FLJA 3CLPA 1N1SA 3OTFA 3I7DA 3POBA 4IEOA 4MH0E 5FZ9A 5L9BA 4FAHA 1ND3B 1UF2C 4DFSA 3LPGA 2YU1A 4LPLA 2YYOA 4LHKA 4LQRA 2A6ZA 1VBE1 1WD4A 1CIYA 1BEV2 2ARAA 3ENRA 4YVWA 1D4M1 4AE2A 3ZSJA 2B5HA 2XOMA 3A4UA 5FV3A 4LO5B 2CGNA 3KD4A 1WW4A 5CFDB 5AFEA 4EN0A 1O3TA 2VMEA 3I2GA 2RS13 2XLGA 5J3UA 1XE0A 2QQNA 4FI9A 2WQ8A 1GZWB 1V9U3 2GSYA 3OF1A 1OSGA 4LBNA 4QPGC 4TSVA 4AFAA 5FK7A 4I0AA 5A3TA 1G7YA 1RMU3 4HSLA 3VZKA 3E1F1 5I0UA 4A7YA 3S0MA 1SEFA 2XKPA 1KFUL 5FYHA 2JIGA 2J1EA 4JGZB 2RS52 2VR4A 3RYRA 5HI0A 3LWCA 4FOYA 2ZKNA 4N7IA 1NKGA 1ND3A 4UF0B 3RJ2X 3V65A 1D2SA 4MSVA 5JAXA 4COVA 1JZ6A 1YI7A 2WYFA 3Q8EA 5FY7A 1IOAA 4CXYA 4OFGA 2WUHA 5IT6A 2Z69A 4KWJA 2PHFA 2ZGUA 4JCKA 4DRRA 4IXLA 3OGRA 3FLPA 4RA0A 2E26A 3T1LA 3ZFEA 3I2FA 3UNPA 3WNLA 1C1LA 5F5IA 4A45A 1TME1 4R4XA 1AL21 3RVHA 4CEYB 4BK4A 2HBUA 3NKGA 1S2BA 3N4MA 5A3OA 5FZ4A 4MOAA 1L7QA 1GZWA 1NAEA 3GCXA 3MIEA 4O61A 3SH3A 2WT1A 1VAKA 2W08A 4Y5TA 3H8UA 3EMRA 2NM1A 3K4ZA 2D44A 5FZFA 4PQ9A 4WM7C 2B45X 1RUJ2 1ACCA 2VTXJ 4XF1A 1AR82 1ENSA 2XR4A 3CKHA 2BFUL 4Y26A 4LIVA 1O4ZA 4QXHA 1AR91 2HYKA 3U75A 1VRH2 2ZX1A 1F5FA 1VBA2 4AOCA 4B1MA 1RUOA 3DGTA 2XJTA 4GH4C 5C5TA 2XWJB 4FFGA 3ZN5A 3WLUA 4CDXC 1H9PA 2Y6JA 2YU2A 2TUNA 4E4HA 1CN1A 1UKRA 5J36A 3AL6A 4CEYA 4Q4V3 2EAAA 3BI3A 4LULA 3T0DA 3INAA 4LA3A 4BQ3A 3ZKUA 3MICA 4X6QB 2PLV1 4XABA 3VZOA 1NXMA 2BQPA 2C9AA 2G9GA 5LK7B 4D8MA 5T54A 3WUDA 1H4GA 4GALA 4MADA 3SKJE 1JU3A 2RDQA 2WNEA 1TMF3 4FPCA 1JTZX 2E6VA 1GLHA 2QCSB 1JXNA 1QHDA 2DWRA 5I91A 2RS53 1F9KA 1QJU2 5FP9A 2IC1A 1PGSA 4CDUB 2ERFA 3B02A 3ON7A 1IPSA 3PURA 2R1BA 4LEJA 4BISA 3WINE 5FPUA 3MZHA 1OA3A 2PQSA 2JDYA 4HVOA 4RHV1 5IAXA 5IATA 5FZGA 3JB8A 1WW5A 5IUQA 3Q8AA 2ARBA 1NE6A 1ST8A 2YBPA 2A3XA 3M3IA 5D1IA 1NA1C 3CHXA 5I0RA 3PJYA 1AJOA 2PXJA 3H9AA 3J9SA 5FO7B 1QJX2 3WNNA 2RMU3 1W2OA 3AKQA 3EYPA 4NRQA 1LECA 1CVNA 3THCA 4ZXKA 1F4AA 3ZFEC 3DN7A 2WQ4A 1N1YA 1EV11 3FJSA 5L9RA 3S7EA 3O1SA 2WO7A 3CQOA 3E6CC 5JMCA 4BMEA 2R30A 3OBRA 1H4HA 4HPKA 1V6LA 2XBO1 1FOD3 4RQPC 2ILMA 2TEPA 2BW8A 4UT5A 3K3NA 3DYOA 3TEWA 1W04A 4XFCA 3WF2A 2PTMA 3LEKA 2VMGA 1V6NA 3C7GA 3MPBA 3ZXKA 5K7PA 2D3PA 4NUBA 4PF1A 3H7JA 5DABA 2H6BA 3F95A 5LA0A 4M01A 1XE8A 4LBOA 1J3RA 4I09A 1REEA 4QKFA 4Y3OA 1IGOA 3P5BA 1RUE2 3HD8B 4QPIA 2RDRA 2ZMKA 2OZJA 1WZXA 3B9IA 3M3CA 2WL1A 3FBMA 5I0TA 5T55A 1PMHX 2XUEA 2PYTA 4PDWC 3TN92 2GH2A 2VZUA 3SCHA 4XUTA 2WNUB 2ZACA 2Q8CA 1WBFA 1HB4A 2GNDA 4V1PA 3NJXA 4CDQC 1DHKB 2ZMNA 3ROUA 3NAPC 5FYSA 5BNNA 4RFRB 4CVUA 2PAEA 1NUKA 1EY2A 4K3UA 1YIFA 3ETQA 4XFHA 5BUVA 3NNFA 1NXD1 1QJU3 1KJRA 2KA3A 3J7NA 3PVEA 5C3QA 3I54A 1HJGA 4ASKA 1QJEA 1QJZA 4FTBA 1VBD2 1CAWB 2YROA 4N43C 1ENXA 3UJQA 5F5CA 2PELA 1LHVA 1LKNA 3M2MA 4MYEA 2ZA9A 3W20A 3VD7A 4AHXA 3USSA 3RS6A 1US2A 3VDDA 1HN0A 3AZWA 1PMJX 4RS5C 3S5QA 5FUIA 3M70A 1WLTA 3HT2A 1RHI2 3KVAA 1ULPA 3G7DA 1OPOA 3SEEA 1JZ7A 2VXRA 1AF9A 2D7FA 2X5IC 1W8UA 4HXCA 2B4KA 2GU9A 4CRQA 1HQNA 2CWMA 2JG9B 3BPZA 3GXUA 3V0BB 3O1TA 4ISQA 1HIXA 2AZ5A 3NW4A 2P37A 2XDVA 2KR2A 4AI9A 1PO12 2D43A 1Y9GA 3GGLA 3JU9A 3SNMA 1S0JA 3TAYA 2FZ1A 2A5ZA 1H8TC 5BPXA 4Q8KA 4P9XA 1F15A 2HWB2 3K4AA 4OHXA 4LHSA 1N47A 4Q5OA 5FAXA 3VKNA 2JDMA 3H1YA 4CZSA 5DZGA 1RUD3 4Z92B 4N53B 2IVIB 4RGKA 1GZTA 3M3OA 3WNMA 3MO4A 1CAWA 5EFUA 3WY6A 2GH8A 2RR11 1GU3A 3VBUB 1AUYA 5GZDA 1JZ8A 1AR72 2BVBA 2YZ4A 1W9SA 3NV3A 1OFNA 5FY8A 4FBFA 4COZA 1WCQA 1BK0A 4L0PA 5LW9A 4NPMA 3WSOA 4AHWA 4KG0A 1J3PA 4XZUG 1UOBA 4B1LA 3ACHA 5FFOC 4QPIC 1Q8VA 1P8JA 2CDOA 1PNFA 2JG9A 1GZCA 3WG4A 1PIV3 3CU7A 1IS3A 2ATFA 1OVSA 4DNYA 2IXKA 2PQQA 2Q30A 2RDNA 5JZGB 2ZX3A 3AMQA 4PCRA 5LY2A 2VUAA 4Q29A 1QQP3 1W8WA 1OQDA 3U4XA 1M4WA 3IDBB 2WYSA 3WDVA 2Y6KA 4ZS2A 3I8TA 4IQPA 5BNNC 1ND2B 5JXIA 3UGGA 1VE0A 1CX1A 1WGPA 5KHHA 2JDKA 3WW3A 1WWYA 4HETA 3VBUA 3OPTA 1EP0A 4AQ2A 3PNAA 1VBB1 4W8JA 4JKMA 2HWD1 3VB9A 2X09A 5HCAA 2BGPA 2E63A 2P3JA 1RHI3 3TN91 3GHMA 2WSVA 5FMOL 1JYIA 2V4VA 3NJZA 4D6SA 4B4RA 4XAAA 4BQ4A 5GLVA 1PGL1 5DAPA 2R072 2J1VA 4NVPA 2J1UA 3SQOA 5JVVA 1FPN2 5K4LA 4I02A 2P3IA 3DXTA 4F8AA 2IUWA 3VD4A 3IZOA 5F32A 4I2OA 1QMJA 2LUWA 4MGZE 5JZGA 4B3NA 2F4LA 3OGSA 1MVQA 4Y24A 1C5HA 1WCUA 4Y1YA 1CAVB 2EVXA 1KDKA 3P1IA 4IDZA 5JLVA 3NJYA 4AL9A 5FY5A 2WR9A 1ND2A 1U5ZA 1S4CA 1C8NA 1VMJA 3VHNA 3KV5A 2YHJA 2YBKA 1JS9A 1U5IA 5FZBA 1AR73 4JDNA 2JKBA 1YJKA 2LALA 3O5SA 4BQYA 4F83A 5BY5A 5JOWA 1DQ5A 4YVSC 5FPVA 2AENA 1RUH3 4FSJA 4OUMA 4OLLA 1SDDB 2BJSA 1F4HA 2WAAA 3LE0A 5DN2A 2XL9A 4E2SA 5A3MA 2WFPA 2EXJA 1BYHA 1RVF1 2O14A 3B5LB 3MFCA 2PAMA 3SHRA 3M8LA 3AK0A 4NN0A 5FPLA 4GKXA 3RMXA 2HYXA 2JDHA 4Q26A 1SLAA 4LHNA 2E7QA 2YGMA 1LOFA 1UL9A 1CAVA 4KWKA 1W9FA 2A3YA 4UYBA 1OUXA 1I5PA 3URFA 3PVOA 2DFCA 3IB3A 4GA9A 4YW4A 5JI9A 3LKJA 2XXZA 3MFAA 5HCBA 4XF9A 5T50A 5JMOA 5FJKA 3MDPA 4XTPA 4AI3A 2P1BA 1A78A 3AKRA 3I2IA 4NOTA 2TNFA 3THDA 4BQ1A 1CZVA 2HEVF 2HWF1 3KCCA 3QOPA 2C1FA 3ITQA 3PMEA 3I2DA 5A3NA 2BYVE 3JQWA 3J7MA 4OQ8A 1QJY2 2YC0A 1BZWA 2WLQA 1U0AA 5J7MA 1O5LA 2JDNA 1YNAA 2DVAA 4I30A 2P2KA 3ILNA 2FMYA 4YW5A 2G9ZA 3AZVA 4AQTA 4CPBD 4C8DA 3ME2A 2GMPA 2D40A 4AEMA 1OD3A 3VBSC 4ZZ8A 3TNQA 4A7KA 4ATEA 2C26A 4Y4RA 5FZDA 3VBHB 4BIOA 4R9CA 2D5FA 2JE9A 2ADDA 2ZGSA 3KLSA 5FWEA 4AEDB 3CMGA 1H6YA 3FWEA 4IEYA 3ZKYA 4OCTA 1ZYBA 1U12A 4NIIA 3ZMNA 3WDUA 2C6SA 1CQ9A 1ZBE2 2ZX2A 4AZZA 2FDFA 2O8QA 5G04L 2VCMA 4WZCA 1RXGA 1QDOA 1KS4A 4LBLA 4Q0UA 2WIIB 2ZGRA 1R092 2DU0A 1DZTA 1R1A2 5CISA 2NN8A 5FPXA 1K42A 4AI1A 2BDRA 1IS4A 3WUCA 3D4KA 2IFRA 3DYPA 3E6BA 4AAPA 1I1EA 4GWNA 4QKBA 3I59B 1WLWA 4QPYA 3AYEA 3R05A 5GZFA 5BNOC 5C33A 1R1ZA 4P9YA 5F7UA 3EJKA 3JQXA 1DQ0A 3DPRB 4JVAA 5FP7A 5GZGA 3E5XA 3VDCA 2D3SA 2VL4A 1MACA 4A44A 4META 1WA6X 4N9IA 4CCKA 2ZHNA 4V2WA 3JBG2 3VBHA 3ACIA 1O3RA 3HOBA 3MHZA 3FFQA 4JGYB 4AEDA 2XWBB 2HWE2 1Z7S1 2XONA 4R9DA 1GQGA 1V6MA 3AZYA 1R081 3RYPA 4NE9A 3C7HA 3A7QA 5LZ6A 1N1VA 3IM0A 2WZ8A 5J1XA 1BHGA 4UI9L 2YXSA 3NKTA 1O91A 4L8QA 5ISLA 1LHUA 3BOWA 2D6PA 4XACA 2FCTA 4H7LA 5BNPB 2IXIA 2JB8A 2QBXA 3HAGA 2PHTA 4TXWA 3DCQA 2GZWA 4CCCA 3AL5A 3OCPA 3WOGA 3DL3A 1S0EA 1W99A 5DAQA 5FY9A 3OBTA 3I59A 3BTAA 4IEUA 4BQ5A 4FXKB 1OI6A 1DQ2A 4S2DA 1OOPB 3ALQA 3RGBA 1GQHA 5ABJB 1IZ3A 5KR7A 2WKKA 4URAA 4KH9A 1RJ7A 2BRTA 1PK6B 5AVPA 2XKOA 3MEPA 3AMNA 2QQVA 3ETPA 3Q9OA 2QDRA 3WEZA 4IETA 3CO2A 4INDA 1BBT3 2NZ9A 3R4UA 3WP3A 1PO21 2WNOA 1W8FA 3BCWA 2V73A 1UZVA 3KV6A 1SLBA 3ES4A 1K3IA 3TEXA 1UOGA 4UW5A 3MIGA 3ACLA 1POV1 4AWDA 2MEV2 1ASJ3 3ZFGB 1MEC3 1R093 1R1A3 4LO8A 5BNPA 1O7FA 1POV0 1UIJA 2ZGOA 2IXHA 4XDPA 4MXWB 3O0XA 3PU3A 5B4XA 3LDBA 4BQ2A 5C4WC 5C70A 4LO4B 2XJQA 2JDPA 1XNDA 2WWUA 3W21A 1Q3EA 2Q5TA 2TBVA 1YQ2A 4NO4A 4ARYA 4FPJA 1DYKA 1OOPA 4K7JA 4UXAA 5ABJA 2W87A 3IT8A 2P3YA 4BXSV 1RUC2 1PK6A 1QXJA 5DUWA 5FRAA 5JWPA 5FIXA 2ZZJA 4HKOA 3W59A 4QX1A 5FMDA 3PUHA 2B7YA 4ZXEA 5DQ0A 3RG0A 4EYUA 3TOJA 3PDQA 4YFZA 2WNVC 2PFWA 2R042 4HANA 1ZA4A 4XXPA 5AC92 4DIQA 3FE5A 1BLZA 2QQKA 5TSWA 3GZEA 4YM1A 1BXHA 1OT5A 1XNBA 2VUJA 3WQBA 4I3GA 3ZFGA 1MQTC 3AP4A 3RWKX 4AHZA 4MXWA 2VCBA 4HKWA 3RPQA 5A1LA 3WQ1A 3UKVA 1SQ4A 1HRV1 5KHGA 3J8F2 2W3JA 2ZEXA 4WVWA 3T2QA 5IK7A 1W3VA 4R9BA 1J84A 2VZ1A 1MS4A 3OYWB 1NCQB 3F2ZA 3M3EA 5EHDA 1O4TA 4IV3B 3RSJA 4WM8C 3RI8A 3VUOA 5LWBA 3N9MA 5C8CC 1XSQA 1FMD2 4DOUA 1S2EA 4AG4A 4YW2A 4AI8A 4A6OA 1VBC1 3T1MA 4R9AA 1LOEA 2YGLA 4QHBA 2R16A 4ARXA 5CFCC 1RUI3 3O1UA 5IVCA 1WW6A 5FYUA 4BMBA 1FX5A 1UY0A 3VBOC 1IQDC 1N3QA 2PHXA 5L36A 2VNVA 1SHWB 5K0UB 3M7AA 1HRI3 1WBLA 1S55A 1C8M2 1QDCA 1BCXA 2J1RA 1UYYA 2BEOA 3UESA 3V64A 4FTSA 3QLQA 2Q1FA 1ZX5A 2FCVA 1RUC3 4IV3A 2VMCA 3E5QA 4KL1A 3W5MA 2UURA 3VBRB 5L7OA 2ZX4A 4LA2A 2BERA 4GZ9A 4C90A 2MHFA 5C3PA 5C3SA 2VH9A 1ZRIA 1H1IA 3VZNA 3KT1A 2YDEA 4LBJA 3I3MA 5JR7B 3IDCB 3I4IA 2A7AA 4M0NA 4S2GA 1PVC3 1UZYA 2RS33 3EQEA 1BKZA 3OUHA 4QM9A 4C1WA 4E2QA 1JZ5A 4CUCA 3GZAA 2BWAA 4DEQA 5DDJ2 2CV6A 3FBYA 1JU4A 3FZ3A 2ET7A 4A41A 4EE2A 4CCNA 1HXS2 2CGPA 2FMDA 3GM8A 4GQ7A 3OUIA 5F5AA 4YZ4A 2C0ZA 3K51A 4CCOA 4D69A 2D6LX 1AXKA 2B39A 3WDYA 1O5UA 2RS12 4XQDA 2CHHA 3RZJA 1V9U2 2D97A 2FBEA 2QDNA 4NRMA 5E8AA 5K0UA 2VW1A 2R1DA 1ZBA1 3AKTA 3LCPA 4MHRA 1NT0A 2WZR2 4YGEA 3WF0A 1RMU2 1LULA 2Z5WA 4G9SB 3ZDSA 5FOBB 1LGBA 5IWFA 3PUSA 5FUPA 2K2SA 3VBRA 3BOPA 1W03A 1WW7A 3PVNA 4B7KA 3B9CA 1DLLA 2W68A 2WFF2 1SBEA 1DGWA 2E53A 1GNHA 1VMFA 2DCTA 1WMXA 1Y9QA 4PIYA 5FYIA 4QDRA 1LEMA 4AXOA 5A80A 4WM7B 4ORFA 3HT1A 4AGVA 5FZ6A 5A6YA 4WBBA 4K40A 3B01A 1GUIA 4XFGA 4UW4A 1FATA 1AYM2 4AI0A 2KD7A 1YUDA 4XHXA 2ZJCA 5FZIA 1EPZA 2MPFA 3SMHA 4EROA 4RR3A 1L7LA 1YQ6A 3I49A 4CUBA 1JMUB 4GWMA 4V2VA 3D5OA 3ZXFA 4DEVA 4IEPA 4JZRA 1B09A 1S2KA 3B00A 1C8M3 1N1TA 5FY4A 1OA4A 4AAXA 3ZXAC 1VBE3 1QH7A 3WX5A 4L97A 1XNKA 4QGMA 3AMHA 1D4M3 1JUIA 1AR61 2ZEWA 1DGRA 1JW6A 1GP6A 3N9NA 5FZ7A 3MW2A 4MHUA 3WHUA 1IG3A 2Q1ZB 4SLIA 3WQ0A 5KXCA 2VVEA 1NLSA 4CSWA 1URXA 1MZ5A 3NWKA 3VD3A 4IGPA 1W9TA 2VMDA 3LEGA 1KITA 2CSGA 5L7OC 4L99A 3HJRA 4RYDA 3N9QA 1OLRA 3NV1A 4GMP3 4XFAA 1QOOA 5DDJ3 3VZJA 5J48A 5FPBA 5C3OA 3H8OA 3IPVB 2B42B 4BQWA 2WT0A 1V6IA 3RMYA 1HXS3 2O8OA 2W39A 4D6QA 5EWSA 2ZCWA 4GJYA 3JB4C 4Q4V2 5F3IA 1ZZ9A 3GCWA 1UX6A 4Y1ZA 4A3ZA 3VBFC 1TZOA 5DAVA 3LIGA 4F3JA 5IK8A 2WINB 1L3JA 4YGDA 4YSFA 2XGXA 2Z4FA 2LS6A 1H2MA 3FUQA 2WZR3 3MF6A 4FOVA 3SH5A 4LO6B 2R49A 1TMF2 2I07B 1LJ7A 3CJIB 4QB1A 2WS92 1H2KA 1D7PM 2OXBA 4DY3A 5K8SA 3SKVA 1YC61 3U0ZA 2VU9A 2BNNA 2CYFA 4A7ZA 1VB2A 4KQ7A 5B4NA 2WFF3 1WD3A 1AL23 1RITA 2VOKA 3HWJA 4AEKA 4ASMB 4XETA 3ZSMA 2ARCA 4LT5A 3KWVA 3AXEA 2VZSA 5LCWL 5FQ0B 3IPVA 1DGLA 1AYM3 5FYVA 4EZ4A 5IW0A 1D4VB 2RMU2 5CFDA 2DYCA 1STMA 2ZOEB 4A6SA 2JDUA 1ENQA 5BNQA 3M3QA 4LLOA 1JZ2A 4QX8A 3VKOA 1GKBA 5FBZA 1CESA 5LA2A 2VMIA 1X82A 4ES8A 2P6CA 3K3OA 1RC6A 1AR93 1XU1A 2SBAA 4RR3C 5A32B 4E2GA 4TLGA 4ZS3A 3CJIA 1YQ5A 1FOD2 3AZZA 5A3WA 1RUF2 3UGHA 5FXVA 4Q27A 4JGZA 5F3CA 1CWPA 1FI2A 1ZREA 5A1AA 3KMHA 4PHZA 1OH3A 2QQPA 4UF0A 5FXWA 5IVBA 1GP5A 2ZABA 5FZLA 5FZHA 2V4AA 4A3XA 2VC9A 1LB2A 5KXBA 3RI9A 2WO3A 2VGDA 5C7GA 3ZIWA 1HX6A 3B93A 3PMSA 4J25A 2R063 3CIHA 1UO9A 4NAMA 4B29A 1F8VA 4Y20B 1OH4A 4YVWC 5FZ3A 3RYKA 1B35B 2WN3A 4HBNA 3AMMA 4CYDA 1E5RA 1WLDA 2CL2A 1XNAA 2CTVA 2IXLA 2Z2SB 4N8MA 2DCKA 1CAXB 3ORJA 4QT6A 5ACA2 3PUIA 1A34A 3FN9A 1JUHA 4KBZA 4FAGA 4LO7A 1K45A 1UU4A 1UY2A 2ZZQA 3USUB 5F1RA 1RUG2 5JPNB 4RHV3 2EXIA 2WS93 1LOCA 4DS0A 1PHMA 4R8HA 3H7YA 4YPJA 1DCSA 4HN1A 3T4VA 4CP0A 1AZDA 2FD8A 1IKPA 3FUOA 3CL1A 4FT8A 3OOXA 2YG0A 1C4RA 1BEV1 1I5ZA 2CWSA 1UY4A 3ZYRA 1C1FA 5F5QA 3P3NA 1WMEA 1ND3C 2D3RA 2PMWB 4YW7A 5LATA 2W46A 1EV13 4A4AA 4AFBA 1SLIA 4Y20A 3MIHA 1OFSA 5IK5A 2JG8B 5DPNA 5FZEA 4AW7A 4D7SA 2D6MA 3RZGA 3ZYFA 5L9VA 1CAXA 1H1MA 3KHCA 2GC3A 2D6OX 2VG9A 4PLMA 4BIFA 3V0BA 1JI6A 1ZZ8A 2DVGA 1W0PA 3MIFA 2VY0A 4XW3A 2Q8EA 5CFDC 3AYDA 2QE3A 3H50A 3GALA 1EYBA 3USUA 1G86A 1RUF3 3LD8A 4YFWA 4AYUA 1W2NA 2RS51 3GZUC 4OHVA 1QIQA 1H30A 4P14A 4QD2A 4CDUA 3CNAA 3I2KA 5A3UA 3S57A 1RUD2 3D82A 3JUUA 2OS2A 3KV4A 3KT7A 1YLLA 5FDBA 1S0BA 1EUUA 4YW6A 5E16A 4DQAA 4R52A 1JYCA 4LLFA 3VDBA 2P17A 2X8KA 3LEMA 3AX4A 3B3QE 3GDBA 2JG8A 3VDAA 2ZS6B 2J1SA 3D0JA 4XXAA 5ACA3 1X36A 1SFPA 1KQRA 2CGOA 3RRDA 4CEYC 1PIV2 1FV3A 4KBBA 5LBEA 1RUG3 1RUJ1 3I3QA 1FOD1 4PT6A 3MPPG 1RTVA 5CIRA 4AVBA 1AR81 1G6NA 4FCAA 1QQP2 3NVCA 4HONA 1HB3A 2WO1A 2Y64A 1APNA 5I0DA 5FLHA 2W1SA 1VRH1 3ZYHA 4AQ6A 2W1QA 5A7WB 3OD0A 5IVJA 1VBA1 5D2AA 3G6JB 2Q4SA 4QXKA 5FPZA 4MUVA 4XUNA 5EYXA 2DBNA 4L2NA 4AFDA 3P3PA 3LOIA 1KRIA 1DU3D 1HB2A 3N7JA 5E6HA 4CPBA 4FPYA 4QQPA 1GOHA 4RFT0 1WA4A 2H6CA 2Y0IA 3RQ0A 4IEVA 2P5BA 1ZRRA 2WNUA 1OBNA 3ZFFB 1FAYA 3ZYJB 1KEXA 4ZU4A 5JDBA 1Q8SA 1XYNA 4XMIA 1JYTA 2GP5A 2XG3A 5JI7A 1WCKA 1K5MB 5GLUA 1COV2 3T2PA 5EIYB 2ES3A 3WR0A 4OHWA 4XCBA 5EZWA 2RR13 1XJAA 3BIEA 5E89A 5A1FA 1LENA 1NCRB 1QJU1 1LHNA 2CAUA 2JD4A 1ZRDA 4IV1B 2C5DA 3NV4A 3QH7A 4B8EA 4IL7A 4CUGA 4CDWB 4BQXA 2RVAA 2Y6HA 1AJKA 2BBAA 2RJKA 4XQWA 2WA4A 3HQXA 1OF4A 3DXUA 4CDUC 4QHZA 3K46A 5J96B 5KHJA 1YRZA 4I0WB 1M06G 1QJX1 3ZYBA 1FYUA 4MG2A 1RUH2 1S1AA 4DZGA 1OXCA 3K48A 4IE7A 4MGQA 5H9QA 4W6WA 5FLIA 3ZFFA 4CU7A 3HNMA 3ZYGA 2ZGPA 3ZVXA 1LU1A 4UWDA 4L92A 3POSA 4ITCA 5F6KA 5FZOB 2JD9A 5LRRA 1K5MA 3IDAA 1DQ4A 1L7RA 2WDBA 3JZVA 4XF3A 5CVRA 3LFMA 2XHNA 1OKOA 3WNPA 1NCRA 2VTXA 2VZTA 3LAGA 2VMHA 4IV1A 5FY0A 2NYYA 5CNAA 4HT1T 5FZ8A 3TEYA 1KFXL 2W92A 3WW2A 4LE4A 4YW3A 3N9PA 2XVLA 5C6CA 3WD5A 1ZZCA 2PHLA 3EO6A 4N53A 2DURA 4CDWA 3H8RA 4ZZ5A 4ZKTB 4UAPA 1D0GA 2V09A 1FT9A 2CDPA 3D3AA 3JCIA 1JBCA 2OIIA 4FP3A 4JKKA 4LJHA 1RUE1 5CEHA 4P5YA 2AH2A 4FFHA 4BE3A 2I2SA 3A0NA 1WMDA 3WNXA 1UYXA 2VOXA 1HLCA 1LODA 2ZEZA 3OGGA 4N90A 3ZOIA 1W90A 4NPLA 2BFUS 4YG6A 3VDDC 5C9AB 1E5HA 1HJFA 4W6XA 2QQJA 2RJ2A 2W5FA 2E32A 2YFZA 1LOGA 3MV01 4Q4W3 3T0AA 3BYWA 4BDVB 5EJ1B 2HH9A 5FZOA 2C4XA 4BH9A 1COV3 3OEBA 1F2NA 4YG3A 1ULEA 5JOXA 3E5UA 1QQP1 2IVJA 1CIWA 4DY5A 4FPFA 3AJZA 2DTWA 5GLWA 4LUKA 4P9WA 4PIZA 1XXNA 4JDOA 4MGIE 4EN9B 2PHWA 2RG4A 4Y1XA 1BVVA 2OW4A 1DBNA 1OLME 1VBD1 1QGLA 1CAUB 2VE1A 4WVMB 1T2XA 5GLTA 1SMVA 1IHMA 1E5SA 2JKXA 3MI8A 3TBDA 5I8SA 1JYNA 1X9PA 4RGGA 4XBQA 3NL1A 2AEYA 2BP6A 2XQRA 4JV4A 4OI2A 5FMBA 4BM8A 2PA7A 4XUQA 5A7OA 1RHI1 4KI5M 5IJRA 2Y33A 1DGRN 1OQ1A 3OBAA 1VB4A 2H0BA 2NLRA 4W6YA 4ONUA 1YCIA 5C9AA 1XYPA 3EB7A 4Y22B
chains in the Genus database with same CATH topology
1SLCA 3WG1A 4Z07A 2A70A 1PO11 4TLFA 2QUOA 1LESA 2JG9C 2HWB1 1MS3A 2O0OA 2HWF3 4XJWA 5T5OA 1WUVA 2XB6C 1A8MA 3PHMA 3AJYA 3QD6A 1CAUA 2Q1MA 3NSTA 4Q0SA 2WWSA 5FO8B 3C3VA 1AR71 1NY72 4YZ1A 3N7MA 4QQ2A 4K8FA 4N53C 2JICA 5A33B 2YV8A 3JD72 3VBUC 3D6EA 3KGLA 1QU0A 2R6QA 1DQ6A 1ZZ7A 4Q4Y2 3ATGA 4XMAA 4Q4X2 4Y22A 5KWRA 3KT4A 5KC6A 5T5LA 1GV9A 4XJAA 4PJYA 1BMV2 2BUKA 4FP2A 2OYZA 3W58A 4CEWB 2YY1A 2EF6A 1ENRA 3VL9A 4ZU5A 1MS8A 3AP9A 1ZZBA 2Y38A 1BBT2 2RM22 3AB0A 3LA3A 3MW3A 5JZGC 4FTEA 4FPHA 3WW4A 4XJ8A 3R6SA 3GZTB 3SISA 4AGGA 5IK4A 4PIXA 1YO8A 3AP5A 3GYDA 4N9HA 1FNYA 3AFGA 1ND2C 1ASJ2 5D8AB 4Y4YA 1MEC2 2IXCA 2K0GA 3LOBA 2BPA2 3OJBA 3TYJA 4A2UA 2VOVA 1FNZA 2R071 2R0HA 1FPN1 4AK3A 1G9FA 3UK9A 4CP1A 1Z7S3 4KGGA 2DCJA 1HDKA 3U11A 1QNWA 1CJPA 1EAH3 1Q5OA 1ULGA 5JOYA 4CEWA 3L9JT 3KQRA 3WDWA 2H0VA 1YIPA 2VULA 2WSUA 3DF0A 1LOFC 3GNEA 1X8EA 1AYN2 2HJIA 4URTA 4AVTA 1S0DA 1E57A 1PGW2 2DVDA 5D8AA 5C8CB 3VKFC 1HKDA 2ZBJA 3JD73 4Q4Y3 4Q4X3 4XJUA 4HLTA 1DFQA 5DXDA 5AVAA 3THTA 1PO23 2G4IA 3DPRA 3EBRA 4M0HA 4MXVA 3SH4A 2DF7A 1POV3 1ZVFA 1Z78A 3GBGA 4JGYA 3UKNA 2RM23 2UWCA 5T5JA 4EN7B 2K9ZA 4D94A 5JCTA 1RUI2 1IS5A 4P9LA 3ZXJA 1G9AA 2UYBA 1QJY1 4QGLA 3VV1A 1C28A 3D0SA 3APBA 2NPIA 3IKWA 3MIDA 4MLOA 1WLCA 3LSEA 4FVVA 1YWKA 1IPKA 3VGIA 1HRI2 4J1WA 1WCSA 4LBMA 2BNOA 1IQAA 2AGSA 4AF9A 4OI0A 1UD1A 4GB32 2RHPA 1LHWA 1S0GA 1RINA 3QH6A 4YARA 3ZYPA 3KS7A 5FMOS 1PVC2 2RS32 1ZBE1 4DB5A 3ZX7A 4M3CB 3VBHC 4XQ4A 4EWAA 3KB5A 1AYN3 4S2HA 4AEDC 1HRV3 4Q0PA 3IMNA 3OY8B 2MNGA 1R091 1R1A1 3B7MA 3THPA 4NWWA 4YYOA 2HWC2 4B4QA 2BBVA 2Z79A 3MYXA 3CF6E 4JC1A 4I0BA 5E88A 5F9TA 3OGJA 4U36A 4E4SA 1W6OB 1NQDA 3WT3A 1AX0A 2EXKA 2JX9A 4OULA 3ZIXA 4N7UA 4JAAA 4XE9A 1VBC3 4KNCA 1UPSA 4U2AA 3JBG1 3UL2A 4K1YA 4XOGA 1ZNPA 2HWE1 3DPRC 4O9GA 1TQ5A 4YM3A 1S0FA 4FPGA 4EV0A 3LGRA 4C0HA 5KC5A 5SV8A 1VALA 2Z42A 2G9FA 4XTMA 1KXGA 4JGYC 2QZ3A 1QOTA 5HXVA 3VZMA 4E9KA 2W52A 3OY8A 1XRUA 5JSRA 2IXJA 3N7KA 2GC2A 3TNPB 2Q8OA 4XBLA 2P34A 1J59A 1QXRA 1Y7BA 3ZPYA 5BNPC 1W6OA 3GBFA 4L9BA 3ZXDA 2XLAA 1U5YA 3ILFA 3OYWA 1VBE2 5LEJA 1NCQA 5CG9A 4UW3A 1D4M2 4LHLA 1CX4A 4GB33 3LZZA 5T5PA 5JIUA 3VBFB 1FV2A 3ZMOA 1XU2A 1OOPC 4XIKA 2A75A 3J26N 4QPGB 5ABJC 5GZCA 3WP5A 1YJLA 4FOQA 1PK6C 1QXPA 2GALA 4I3PA 3AZXA 4IEZA 1LOAA 4XIOA 1VP6A 4PBPA 4K9SA 4DMIA 2MEV1 1JN2P 1ZBA3 3KCXA 2RJLA 2HWC3 4JDMA 1DQ1A 1LR5A 1H8VA 3AM2A 5CB7A 4RGAA 1YXWA 3O12A 5KBFA 4XF0A 3ZFGC 1YFWA 1QOSA 1IPJA 3O0VA 1SCSA 5T3NA 4HK9A 1RUC1 2UWBA 2A71A 2IFWA 1XYOA 1G9CA 4O9EA 4H7MA 4Q0QA 2ARXA 5DG2A 1NQJA 1PZ7A 3BALA 3IBMA 2XVKA 4Q1RA 4QPGA 4XFBA 4AVSA 5JPMB 1TME2 1AL22 2OZ6A 1PVC1 2JENA 2JEMA 2XVGA 4KG8A 2R041 3ZSLA 1GANA 4Z82A 1BQPA 5AC91 2XL7A 4OHYA 1LCLA 5GKAC 3SXWA 1LHOA 4M3CE 1SLLA 3MIBA 1NLRA 1U5XA 4BCUA 1AHSA 1BJQA 1BVP1 1AR63 1V70A 3LB9A 1C3HA 2IZWA 3J8F1 4GH4B 4YW1A 4NPRA 4CDXB 5JSOA 2DUOA 1SBDA 1UMZA 5LRSA 4AHYA 3MGUA 1AR92 1ULCA 2E51A 3ZN4A 3A0KA 3HR9A 3WCRA 1S0IA 1LTEA 3LSDA 1UU5A 1FMD1 5A3LA 2UU8A 1MZEA 1NCQC 2OUHA 3AP7A 1CONA 4IEWA 4IV3C 4XZPA 2VQAA 2PLV2 3OD4A 4WM7A 1H2NA 2OUJA 2R062 1PVXA 3WG2A 1C57A 5CU1A 4Z1VA 4FQZA 3U07A 2DUPA 1O4YA 1QF3A 2JJ6A 1N3OA 4H55A 5HCFA 4QQOA 1CR7A 2OVUA 4GH4A 2ETEA 4CTEA 3L2YA 1C8M1 1NA1B 4CDXA 5JOZA 1XQNA 1Q8PA 4RHV2 2WZPP 4GXLA 5K0UC 1D0HA 5C8WA 1DZQA 3H1MA 2D93A 1LU2A 3LA7A 4K1ZA 4YZ3A 3ZFEB 5J09A 4X6RB 2OA2A 1TME3 3O0WA 1SFNA 4KU7A 4NHKA 1ALYA 3R4SA 3VBRC 4ASLA 4GMP1 4RQPB 3D8CA 5DDJ1 3SITA 3KSCA 4OI1A 1EV12 4GMP0 1HXS1 4XYXA 1DGWX 2NP0A 4FPEA 4F7ZA 2XBO2 4EJRA 2RS11 1V9U1 2B46X 2PHUA 5JIAA 3KCYA 2YUEA 4UBGA 4DPNA 3BODA 1NA1A 2WZR1 3C2UA 1RMU1 4G4FA 5I93A 4PF5A 1G9BA 1X33A 2ENRA 1NYWA 4PDWB 4E27A 4B7EA 2YPJA 2ZGLA 4SBVA 4AVCA 2EA7A 2VECA 3HMYA 3B69A 3MLLA 5K9YA 2F6BA 5JSPA 2WFF1 1KD7A 4CDQB 3VLBB 2PLV3 1WMFA 3NAPB 4RQPA 4RD7A 2HEYF 5FQ0A 1AYM1 4JTNA 2VVFA 3GF6A 1QWRA 1AXYA 2EIGA 4K6BA 4PBOA 4N43B 1W6NB 2WLPA 2WT2A 3BIWE 1ZZ6A 3IIAA 4Y5Z0 2UY9A 3SLIA 3WG3A 2YMZA 5A32A 4RS5B 3OPZA 1BEV3 2ZX0A 4M00A 3WDTA 1J3QA 4BA6A 4PDWA 1OPMA 3QBQA 2FZ2A 1C5IA 1NOVA 4X8PA 2X5IB 1W0OA 4BLIA 4CDQA 5LEKA 4KU8A 3ZO0B 4NHMA 1VIWB 3NAPA 4LBQD 2R061 2V5YA 2ZMLA 3H3UA 4EWDA 3GHNA 1H8TB 2WQZC 1QKQA 1REFA 4Q4V1 5L19A 5B2GB 1B35A 3HBZA 4HPKB 4QQHA 2D98A 2PHRA 3KGZA 2XBO3 4FO9A 4HK8A 5GM0A 5FREA 2OPKA 1W6NA 4N43A 4FXGB 2EAKA 4UW6A 5BXXA 3WVJA 4OVEA 4ZU7A 2SLIA 2LM3A 4D7YA 1TMF1 4RS5A 2WS91 4OZXA 4YM2A 2RR12 4RSUA 3M1HA 3AKPA 1A3KA 2X5IA 3CJIC 4QPIB 3IDEA 1OKQA 1W39A 4JGZC 4Z8BA 3AYCA 3ZSKA 4IEXA 3QACA 4FPKA 1YI9A 1H8TA 4JRAA 3ES1A 1F5JA 2RMU1 3HIFA 4Y1UA 5HBAA 5BNNB 1RUJ3 1ULDA 1VAMA 2A3WA 3H0OA 1AR83 2PHDA 2ET1A 1DDLA 4MGYE 1GSLA 1O3QA 1VRH3 3RZZA 4EN6B 1JOJA 5CAZA 3VKMA 1RUF1 1VBA3 4C0BA 2JXAA 4UBHA 3WW1A 1HV1A 2QKDA 1PZ9A 1MZ6A 2KXLA 1VBB2 1W6PB 3VDDB 2HWD2 5DUUA 3ST7A 4OHZA 2PAKA 3ZXEA 2XJVA 1S0CA 1MS5A 3VHPA 4Q0VA 5GJ6A 2ZGMA 3X29B 1PGL2 4XPVA 2XJPA 4DRVA 2O1QA 4C91A 1H2LA 2DVBA 4W65A 3VL8A 1HW5A 1YYNA 2GNTA 4YGCA 1GYKA 5ACA1 1FXZA 3FFZA 4RL7A 2EALA 1UAIA 4WVZA 3RDIA 1UIKA 1OMIA 5T52A 1B35C 1Q8QA 4Q4W2 3U10A 1I6XA 4WV8A 1RUG1 4YVSB 5EJ3A 4LUMA 4NR1A 4XHBA 1UPIA 1HV0A 1NG0A 2ZHMA 4OUSA 4P9IA 1GFF2 1W6PA 1V6KA 4HN0A 3WHTA 1YFXA 1QJX3 2ZHKA 5FCCA 5DZEA 2XLFA 5BV6A 1RVF2 4EWEA 4YNIA 3T2TA 1V6JA 5KXDA 5DG1A 2XHKA 3S7IA 5H9SA 4AVVA 4QQLA 4E4ZA 1OA2A 2X29A 1VJ2A 3MF9A 2JG8C 3BB6A 5EV7A 3FHIB 2R32A 4NWVA 1VAVA 4YVSA 1ZRCA 2QFEA 4YLZA 2XJSA 5DUVA 4FPLA 4WVVA 1VBB3 1TNRA 4PLOA 2HWD3 2HWF2 1OQEA 2FHRA 1RUE3 1RUD1 2VOWA 3TN93 3FX3A 3B94A 4R4ZA 3VBSB 1AVBA 3ILRA 5KXEA 5GALA 2DTYA 5EYYA 4QM8A 1X8MA 4GIQA 1MS1A 1UW8A 1RUNA 4LBKA 2UY8A 3O7OA 4ES9A 4XF4A 1PM7A 3V56A 1REDA 1PIV1 2Y0OA 3N36A 3VKLA 2EXHA 4K21A 3AYAA 2B9UA 1VBD3 3AKSA 2WNUC 4YM0A 1LOBA 1D2QA 1Z0HA 1GBGA 2BVVA 3AP6A 4P9JA 4MX3A 5BNOB 2GMMA 4AGRA 1H9WA 2PN5A 3KZ4C 3VBSA 1GNZA 4YRDA 3HN1A 1T6GC 1RVF3 1RJ8A 1VR3A 4HVRA 3DUIA 1DF0A 5CG8A 3WP4A 1BK1A 3AMPA 3QCWA 1PO13 4ISRA 1OHFA 4PLNA 2HWB3 3E6DA 2B8MA 1QY4A 3ZXGA 4Q4W1 4BHPA 1Q43A 1Z7S2 1GICA 1EAH2 2GMEA 1R082 1COV1 4COWA 2I74A 3FMGA 3ZFFC 2E7TA 2A6VA 1V6OA 3PLQA 4YG0A 2GC1A 2D6KA 2VPVA 2Q0AA 1SDWA 1OLQA 1K5MC 5BNOA 1J1LA 3FC0A 4JRLA 4WVMA 1NCRC 1J1TA 4AVAA 2BGCA 4IV1C 4B4PA 2VNRA 2P3KA 2A6XA 4CDWC 4XJ9A 3WQ7A 1RUH1 3FLTA 3WV6A 5J98B 4BOWA 5KHKA 2Y26A 4Q2FA 3DKWA 2R0FA 4J1XA 4QU2A 4ATFA 2W0XA 5I8YA 1LGCA 1PO22 4BZ4A 1ONAA 2KM2A 3WXPA 2JECA 1JH5A 2VQ0A 5C4WB 4MGKE 1MVEA 1PMIA 4P9GA 2A6WA 3RJRA 1CD3G 4Q8LA 1SACA 1O3SA 3PTYA 2WJSA 2BTVC 4QGNA 2R073 2AR6A 1FPN3 4XJZA 1KS5A 5A33A 1TEIA 1GZ9A 1DIWA 3UJOA 2CY6A 3O14A 1QNYA 3FLRA 1TNFA 4KGQA 3WP6A 1DG6A 2WNVB 2E9QA 2DFBA 2XH6A 2DCZA 4YGBA 1R083 2D6NA 5EXOA 5H9PA 5C9AC 1I9RA 1MQTB 2ZGTA 1AX1A 1Q56A 2I45A 2UWAA 5C4WA 1JHNA 1SLTA 4AQSA 4GKYA 4WZFA 3LA2A 5E1RA 5FO9B 3KM5A 5FOJB 1HQWA 4HMZA 5CADA 4EN8B 2XJRA 3TB0A 1LRHA 1HRV2 4HKLA 4WM8B 1KJLA 1CJDA 2VW2A 1LEDA 3N3HA 3E97A 2ZPXA 3POWA 2NMNA 4D7TA 3RNSA 2GN3A 2WNVA 4FQ4A 5CFCB 1YFUA 2F4PA 5I8TA 2BWCA 1EAH1 4LE3A 1SFYA 3VBOB 1VBC2 1MQTA 1A6CA 1UU6A 1XNCA 5J37A 5KHIA 1AX2A 3R4DB 2QVSB 2HEWF 4TZDA 4CP2A 1QJY3 1W6MB 4HFSA 4I01A 3H1WA 4HSJA 1EPWA 1NY71 1NE4A 1DYPA 3R0RA 4GULA 2VVDA 3J4UH 3MLKA 2AREA 4WM8A 4X8NA 3N35A 5C8CA 2AUYA 4MVTA 3JD71 1Y3TA 4P5HA 2GNMA 5AFBA 2GC0A 5GZEA 5GLZA 2DCYA 5SV5A 4Q4Y1 3W9AA 3ZN6B 4Q4X1 2JDZA 4COUA 2XPJA 5CFCA 2A6YA 3SCFA 1X50A 1GR3A 1BMV1 1TE1B 2GN7A 1ZBE3 1SCRA 4BYYA 3VBOA 4NHLA 3IWZA 4JQRA 4QX5A 1SBFA 2X53S 3MLJA 3NV2A 4BWOA 1BBT1 3PJQA 2RM21 1RL3A 4IERA 4HL0A 1W6MA 4CEWC 4OI4A 1I3HA 2JE7A 1CPMA 3VHRA 3ZYIB 3CEWA 4MV2A 4FPOB 1ASJ1 1W2UA 1ZBA2 5DUXA 1MEC1 2ZTNA 2XJUA 3AXDA 1RGSA 1VLNA 1AL0G 1YHFA 1NZCA 3JBG3 3ZN6A 4D3WA 3S30A 5D8AC 2HWE3 4LNVA 3EHKA 3V0AB 1F31A 4AFMA 4DINB 2CNAA 1XE7A 3RWNA 1HQLA 3IN9A 4J6GA 4DXZA 3ZXLA 1YFYA 5CBLA 3ZSEA 2DUQA 5FTTC 1QH6A 4M3CA 1V00A 1AYN1 2QNKA 2VNGA 3L2HA 4BLJA 2CAVA 5LK5A 1PGW1 3TWIA 2WA3A 2E7AA 1PZ8A 4HVQA 4Z2WA 1IS6A 2QZ2A 4FOWA 1AR62 5L7OB 1CPNA 4MZUA 2NQYA 4M3CF 3PVBB 4K20A 3V0AA 2ZKLA 4LBQB 5BYNA 3ASIA 4XBNA 1MR5A 1UZZA 2MEV3 4Q1PA 1OD5A 2GDFA 4LTAA 1J58A 2QJVA 2ZAHA 2DU1A 3ECQA 4Y1VA 4XEZA 4YZ2A 1RUI1 1H1AA 3M4FA 1H0BA 3S6PA 2N7GA 1G9DA 4KWLA 4L11A 2VW0A 1RIRA 1Q8OA 1ZRFA 5H9RA 4XDQA 1CGPA 2GNBA 4S2FA 2HKXA 1X7NA 1HRI1 2ZGQA 1MZFA 1WCDJ 4XFIA 3VHOA 4E4DX 3NO8A 1PNGA 1W6QB 4AI2A 1MS9A 4YZ5A 2FQPA 2NMOA 2R043 4GB31 5AC93 3GBWA 2WC2A 4LBQA 3VBFA 3UV9A 1N3PA 5L73A 2RS31 2XUMA 4RR3B 4TWTA 1KDMA 1G8WA 1DZRA 4AFCA 2ZAAA 2RE9A 2IWGB 3J8F3 2ZHLA 4HZFA 2UYAA 1ULFA 1UCXA 5CA6A 3MW4A 2HWC1 2AYHA 1RB8G 1IKQA 4H3WA 3DV8A 3VN4A 3WDXA 2ZGNA 4IEQA 3AFKA 4G3YC 1FMD3 3VZLA 3WCSA 4C1XA 2GAUA 4QMAA 1W6QA 1MS0A 4BPZA 4YVWB 4AEJA 4H14A 1AXZA 2A73B 2DVFA 2ZGKA 2VNOA 4IESA 5F6LB 2DV9A 1UN1A 1LGNA 1UKGA 5I0SA 3H3ZA 1Y43B 3CJXA 3EXUA 1ZM1A 4LR4A 3N7LA 2D5HA 1A8DA 2BNMA 3SCGA 3WZ1A 4JTOA 3POYA 3BU7A 5DZFA 4XFFA 2LTNA 3ELNA 4TYSA 4COYA 3TRSB 5FLJA 3CLPA 1N1SA 3OTFA 3I7DA 4IEOA 4MH0E 4FAHA 1ND3B 1UF2C 4DFSA 2YYOA 4LHKA 4XILA 2A6ZA 1VBE1 1WD4A 4YVWA 1BEV2 3ENRA 1D4M1 4AE2A 3ZSJA 2B5HA 3A4UA 4LO5B 2CGNA 3KD4A 1WW4A 5CFDB 5AFEA 4EN0A 1O3TA 2RS13 2XLGA 5J3UA 1GZWB 1V9U3 2GSYA 3OF1A 1OSGA 4LBNA 4QPGC 4TSVA 4AFAA 4I0AA 1G7YA 1RMU3 4HSLA 3VZKA 5I0UA 4A7YA 3S0MA 1SEFA 2XKPA 1KFUL 4JGZB 2RS52 3RYRA 5HI0A 3LWCA 4FOYA 2ZKNA 4N7IA 3RJ2X 1ND3A 3V65A 1D2SA 4MSVA 5JAXA 4COVA 1YI7A 1IOAA 4OFGA 5IT6A 2Z69A 4KWJA 2PHFA 2ZGUA 4JCKA 4DRRA 4IXLA 3FLPA 4RA0A 3T1LA 3ZFEA 1C1LA 1TME1 4R4XA 1AL21 4CEYB 3NKGA 1S2BA 3N4MA 1GZWA 3MIEA 3SH3A 2WT1A 1VAKA 2W08A 3H8UA 2NM1A 2D44A 4PQ9A 4WM7C 2B45X 1RUJ2 4XF1A 1AR82 1ENSA 2BFUL 4Y26A 1O4ZA 1AR91 2HYKA 1VRH2 2ZX1A 1F5FA 1VBA2 1RUOA 3DGTA 2XJTA 4GH4C 2XWJB 3ZN5A 3WLUA 4CDXC 1H9PA 2TUNA 1CN1A 1UKRA 5J36A 4CEYA 4Q4V3 2EAAA 4LULA 3INAA 4LA3A 3MICA 4X6QB 2PLV1 3VZOA 1NXMA 2BQPA 2C9AA 2G9GA 5LK7B 5T54A 3WUDA 1H4GA 4GALA 2WNEA 1TMF3 4FPCA 1JTZX 2E6VA 1GLHA 2QCSB 1JXNA 1QHDA 2DWRA 5I91A 2RS53 1F9KA 1QJU2 2IC1A 1PGSA 4CDUB 2ERFA 3B02A 3MZHA 2R1BA 4LEJA 3WINE 1OA3A 4HVOA 4RHV1 3JB8A 1WW5A 5IUQA 2ARBA 1NE6A 3M3IA 2A3XA 5D1IA 1NA1C 5I0RA 3PJYA 1AJOA 3J9SA 3H9AA 5FO7B 1QJX2 2RMU3 3AKQA 1LECA 1CVNA 4ZXKA 3ZFEC 3DN7A 2WQ4A 1N1YA 1EV11 3FJSA 3S7EA 3E6CC 5JMCA 4BMEA 2R30A 3OBRA 1H4HA 4HPKA 1V6LA 2XBO1 1FOD3 4RQPC 2ILMA 2TEPA 2BW8A 4XFCA 2PTMA 2VMGA 1V6NA 3MPBA 3ZXKA 5K7PA 2D3PA 3H7JA 2H6BA 4M01A 1XE8A 4LBOA 1J3RA 4I09A 1REEA 1IGOA 1RUE2 3HD8B 4QPIA 2ZMKA 3M3CA 2OZJA 3B9IA 5T55A 2WL1A 3FBMA 5I0TA 4PDWC 3TN92 2PYTA 2GH2A 3SCHA 2WNUB 2ZACA 1WBFA 2GNDA 4V1PA 4CDQC 1DHKB 2ZMNA 3ROUA 3NAPC 5BNNA 2PAEA 1EY2A 4K3UA 1YIFA 3ETQA 4XFHA 5BUVA 1NXD1 1QJU3 1KJRA 2KA3A 3PVEA 3I54A 1QJZA 4FTBA 1VBD2 1CAWB 2YROA 4N43C 1ENXA 3UJQA 2PELA 1LHVA 1LKNA 3M2MA 4MYEA 2ZA9A 4AHXA 3USSA 3RS6A 3VDDA 3AZWA 4RS5C 3M70A 1WLTA 3HT2A 1RHI2 3G7DA 1OPOA 2VXRA 1AF9A 2D7FA 2X5IC 2GU9A 4CRQA 1HQNA 2CWMA 2JG9B 3BPZA 3V0BB 4ISQA 1HIXA 2AZ5A 3NW4A 2P37A 1PO12 2D43A 3JU9A 3SNMA 1S0JA 3TAYA 2FZ1A 2A5ZA 1H8TC 5BPXA 4Q8KA 4P9XA 2HWB2 4OHXA 1N47A 3VKNA 5FAXA 3H1YA 4CZSA 5DZGA 1RUD3 4Z92B 4N53B 3M3OA 1CAWA 5EFUA 3WY6A 2GH8A 2RR11 3VBUB 1AUYA 5GZDA 1AR72 2BVBA 2YZ4A 3NV3A 4FBFA 1OFNA 4COZA 4AHWA 4KG0A 1J3PA 5FFOC 4QPIC 1Q8VA 1PNFA 2JG9A 1GZCA 3WG4A 1PIV3 3CU7A 1IS3A 2ATFA 4DNYA 3V0BA 2IXKA 2PQQA 2Q30A 5JZGB 2ZX3A 3AMQA 4PCRA 2VUAA 4Q29A 1QQP3 1OQDA 3U4XA 1M4WA 3IDBB 3WDVA 3I8TA 4IQPA 5BNNC 1ND2B 1WGPA 5KHHA 3WW3A 4HETA 3VBUA 1EP0A 4AQ2A 3PNAA 1VBB1 2HWD1 5HCAA 3TN91 2E63A 2P3JA 1RHI3 1JYIA 3GHMA 2WSVA 5FMOL 3NJZA 4B4RA 1PGL1 5GLVA 2R072 4NVPA 5JVVA 1FPN2 4I02A 2P3IA 4F8AA 4I2OA 1QMJA 2LUWA 4MGZE 5JZGA 4B3NA 1MVQA 4Y24A 1C5HA 4Y1YA 1CAVB 1KDKA 2EVXA 5JLVA 1ND2A 1U5ZA 1C8NA 3VHNA 2YHJA 1U5IA 1AR73 4JDNA 2JKBA 1YJKA 2LALA 3O5SA 5BY5A 4F83A 5JOWA 1DQ5A 4YVSC 2AENA 1RUH3 4FSJA 4OUMA 4OLLA 4E2SA 2XL9A 5A3MA 2WFPA 2EXJA 1BYHA 1RVF1 3MFCA 3B5LB 2PAMA 3SHRA 3M8LA 3AK0A 4NN0A 4GKXA 3RMXA 4Q26A 1SLAA 4LHNA 2E7QA 2YGMA 1LOFA 1UL9A 1CAVA 4KWKA 2A3YA 3URFA 3PVOA 2DFCA 4GA9A 4YW4A 5JI9A 3LKJA 3MFAA 5HCBA 4XF9A 5T50A 3MDPA 4XTPA 4AI3A 1A78A 3AKRA 4NOTA 2TNFA 4BQ1A 2HEVF 2HWF1 3KCCA 3QOPA 2C1FA 3PMEA 3I2DA 2BYVE 3JQWA 1QJY2 2YC0A 1BZWA 2WLQA 1U0AA 5J7MA 1O5LA 1YNAA 2DVAA 4I30A 2P2KA 3ILNA 2FMYA 4YW5A 3AZVA 4AQTA 3ME2A 2GMPA 2D40A 4AEMA 3VBSC 3TNQA 4A7KA 4ATEA 4BIOA 3VBHB 4R9CA 2D5FA 2JE9A 2ZGSA 3KLSA 4AEDB 4IEYA 3FWEA 1ZYBA 1U12A 3ZMNA 3WDUA 1CQ9A 1ZBE2 2ZX2A 2O8QA 4WZCA 1QDOA 1KS4A 4LBLA 4Q0UA 2WIIB 2ZGRA 1R092 2DU0A 1DZTA 1R1A2 5FPXA 2NN8A 4AI1A 1IS4A 3WUCA 3D4KA 2IFRA 3E6BA 1I1EA 4GWNA 3I59B 1WLWA 4QPYA 3AYEA 3R05A 5GZFA 5BNOC 5C33A 1R1ZA 4P9YA 3EJKA 3JQXA 1DQ0A 3DPRB 4JVAA 5GZGA 3E5XA 2D3SA 1MACA 4META 4N9IA 2ZHNA 3JBG2 3VBHA 1O3RA 3FFQA 4JGYB 4AEDA 2XWBB 2HWE2 1Z7S1 4R9DA 1GQGA 1V6MA 3AZYA 1R081 3RYPA 1N1VA 3IM0A 2YXSA 3NKTA 1O91A 4L8QA 1LHUA 3BOWA 2D6PA 4H7LA 5BNPB 2IXIA 3HAGA 2PHTA 2GZWA 3OCPA 3WOGA 3DL3A 1S0EA 3OBTA 3I59A 3BTAA 4IEUA 4FXKB 1OI6A 1DQ2A 4S2DA 1OOPB 3ALQA 1GQHA 5ABJB 1IZ3A 2WKKA 4KH9A 1RJ7A 1PK6B 5AVPA 2XKOA 3MEPA 3AMNA 3Q9OA 2QDRA 4IETA 3CO2A 4INDA 1BBT3 2NZ9A 3R4UA 3WP3A 1PO21 3BCWA 2V73A 1SLBA 3ES4A 4UW5A 3MIGA 3ACLA 1POV1 4AWDA 2MEV2 1ASJ3 3ZFGB 1MEC3 1R093 1R1A3 4LO8A 5BNPA 1O7FA 1POV0 1UIJA 2ZGOA 2IXHA 4MXWB 3O0XA 5C4WC 4LO4B 2XJQA 1XNDA 1Q3EA 2Q5TA 2TBVA 4NO4A 4FPJA 1DYKA 1OOPA 4K7JA 4UXAA 5ABJA 3IT8A 1RUC2 1PK6A 1QXJA 5FRAA 5JWPA 2ZZJA 4HKOA 3W59A 3RG0A 2B7YA 3TOJA 4YFZA 2WNVC 2PFWA 2R042 4HANA 1ZA4A 4XXPA 5AC92 3FE5A 5TSWA 4YM1A 1BXHA 3ZFGA 1XNBA 2VUJA 4I3GA 1MQTC 3AP4A 4AHZA 4MXWA 4HKWA 3RPQA 3WQ1A 3UKVA 1SQ4A 1HRV1 5KHGA 3J8F2 4WVWA 5IK7A 4R9BA 1MS4A 3OYWB 1NCQB 3M3EA 1O4TA 4IV3B 3RSJA 4WM8C