5CFDA

Crystal structure of dtt treated human cardiovirus safv-3
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
252
structure length
252
Chain Sequence
GVDNAEKGKVSDDNASTDFVAEPVKLPENQTRVSFFYDRSTLSSVLQSTSDVSSKFTPSTAKNLQNSILLTPLPSDIVNNSVLPEQERWISFASPTTQKPPYKTKQDWNFIMFSPFTYYKCDLEVTLSKNDRETISSVVRYVPCGAPSDLSDQTMPQTPSLADTRDPHMWVVGQGTTNQISFVIPYTSPLSVLPSVWFNGFSNFDNSSRFGVAPNADFGRLLLQGQGTFSVHYRYKKMRVFCPRPTVFIPWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords VP1
publication title Structure and Genome Release Mechanism of the Human Cardiovirus Saffold Virus 3.
pubmed doi rcsb
source organism Saffold virus
total genus 45
structure length 252
sequence length 252
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5cfdA00
5C8CC 1MEC2 3FBMA 4CDUB 5C4WB 1QQP2 1RUH2 4AEDA 5CFCC 4RHV3 5C8CB 5BNOB 1MQTA 2R062 3IDEA 1RVF2 5CFCB 1B35C 1NOVA 2HWE1 2R043 2RMU1 5L7OB 1MEC3 4QPGA 1FPN2 1B35B 5BNNC 1ASJ1 1QQP3 1RMU2 1RUH3 1VBD2 2R063 1RVF3 4Y5Z0 4NWWA 3ZXAC 4QPIC 1AYN2 4NWVA 1C8NA 1FPN3 1IHMA 1PO11 1RUC1 3TN92 4QPIB 1NY71 1VBD3 2FZ1A 4Q4V1 1AYN3 4CEYC 1PO22 1F8VA 2XPJA 1QJX1 3TN93 1QJU2 4CEYB 1C8M2 1PVC1 2RS51 1HXS1 5ABJB 1R1A1 4Z92B 4GB31 1PO23 5C4WA 4WM8C 1OOPC 5C8CA 1QJU3 4GH4C 1C8M3 4GMP3 5CFCA 4Q4X2 4RR3C 2RS32 4GH4B 1AR91 4BCUA 1VBE2 1B35A 4RR3B 1VB4A 2RR11 1RUJ1 1AR71 4JGYC 5BNNA 4Q4X3 2RS33 3VBFC 2TBVA 1TME1 3JD72 4JGYB 4YVWC 5A32B 5FOJB 2HWD1 1K5MC 1VBA1 4QPIA 3VBFB 2X5IB 1VBC2 4FTSA 2FZ2A 1K5MB 1POV0 4Q4W2 1BMV2 5JZGC 1X33A 3JD73 3JBG1 4RHV1 5JZGB 1HRV1 2WS92 4CEYA 1VBC3 3JB4C 4Q4W3 4CDXC 1E57A 1AR82 2RS12 4CDXB 1EV12 2WS93 4CDQC 1R091 1OOPA 3ZFEC 4GH4A 5D8AC 4CDQB 1R082 1AL22 1RUF2 4RR3A 2RS13 2MEV1 4WM7C 5D8AB 1PGW1 1EV13 4IV1C 1D4M3 1PIV2 5C9AC 5BNPC 1EAH1 4IV1B 3ZFFC 2HWF2 1OPOA 1R083 2BFUS 4JGYA 5A32A 1RUF3 1AYM2 5C9AB 5BNPB 1TMF2 3VBFA 3ZFFB 2WZR2 1COV1 1ZBA2 2R072 1ZBE2 2BBVA 1K5MA 1PIV3 2BFUL 4PDWC 4Q4Y2 2HWF3 1RUG2 1HQNA 3VBHC 1AYM3 1POV1 4PDWB 5JZGA 1NCRC 2WZR3 1ZBA3 1V9U2 2R073 3VBHB 1ZBE3 1ND2C 2QQPA 2PLV2 1QJZA 1NCRB 1QJY1 4Q4Y3 1NA1C 2WWSA 3J8F2 1RUG3 3HAGA 1ND2B 5BNNB 4CDXA 1NA1B 3NAPC 1V9U3 1W39A 1HRI2 2PLV3 1RMU3 4CDQA 3NAPB 1RUD1 3J8F3 3ZFEA 4N53C 4FSJA 5D8AA 2HWC1 4N53B 1HRI3 4WM7A 4IV1A 2WFF1 5C9AA 5BNPA 2VQ0A 1WCDJ 1VRH1 3ZFFA 1RUE1 4JGZC 1Z7S1 5ACA1 1RHI1 4JGZB 1BBT1 3VBOC 1VBB2 4WM8B 4PDWA 1OOPB 2WS91 3VBOB 1ND3C 2XBO1 2RMU2 3VBHA 5AC91 1RUI1 1NCRA 4CEWC 1ASJ2 1ND2A 1VBB3 5DDJ1 1NA1A 4IV3C 2RMU3 1D4M1 1VBE3 1FOD1 3NAPA 1PO12 1RUC2 1ASJ3 4YVWB 1CJDA 3S6PA 1RUF1 3VBSC 1FMD1 2HWB1 4Q4V2 2ZZQA 3VBSB 4N53A 1PIV1 1AR62 4GMP0 5K0UC 1DDLA 1QJX2 1PO13 1RUC3 1NCQC 5K0UB 1CD3G 1PVC2 2R041 2WZR1 2RS52 4Q4V3 1NCQB 1HXS2 5J98B 4AEDC 1MEC1 1AR63 1R1A2 3CJIC 4GB32 1QQP1 1RUH1 4JGZA 1QJX3 4N43C 4YVSC 4WM8A 3VBRC 2R061 1RVF1 1H8TC 1PVC3 2DF7A 3VBOA 2RS53 4N43B 1V9U1 4YVSB 3VBRB 1HXS3 1AR92 1AR83 3ZFEB 1R1A3 1FPN1 1NG0A 4GB33 2BPA2 1RMU1 1ND3A 1SMVA 4RQPC 1HX6A 1VBD1 2Y26A 2ZTNA 1RUJ2 1AR72 4WM7B 4RQPB 1AYN1 1AL23 1AR93 1TME2 1HRI1 3TN91 4IV3A 2HWD2 4YVWA 1RUJ3 1AR73 2BUKA 3VBSA 3ZFGC 1PO21 1TMF3 1TME3 5CFDC 1QJU1 2HWD3 3JBG2 3ZFGB 3DPRC 1C8M1 1HRV2 1AL0G 4GMP1 5K0UA 5CFDB 3LOBA 1AUYA 1NCQA 4CDUC 3DPRB 4FTBA 5A33B 5BNOC 3JBG3 1HRV3 1VBB1 3CJIA 2GSYA 5L7OC 1R092 2RM22 4Q4X1 2RS31 4N43A 4YVSA 3VBRA 1PGL2 1H8TA 1VBE1 4RS5C 1GFF2 2MEV2 1VAKA 2WLPA 1PGW2 3JB8A 5LK7B 4RS5B 1R093 2RM23 4RFT0 4RQPA 3VDDC 1EAH2 3JD71 4SBVA 3VDDB 2MEV3 4FTEA 1BEV2 1COV2 1VBC1 1BMV1 4Q4W1 1A6CA 1EAH3 4CDWC 1AR61 3ZFGA 2HWE2 1BEV3 1COV3 3M8LA 4CDWB 5CFDA 5ABJC 5GKAC 1X36A 3DPRA 1ND3B 1QJY2 5A33A 3VBUC 1AR81 2RS11 4CEWB 1POV3 4CDUA 1EV11 2HWE3 3VBUB 5BNOA 1RB8G 1OHFA 2GH8A 4IV3B 1R081 1QJY3 1AL21 5L7OA 1RUD2 1NY72 4LLFA 2ZAHA 2HWC2 4RS5A 5J96B 2HWF1 1RUD3 1AYM1 1TMF1 2X5IC 2WFF2 3VDDA 1VRH2 1ZBA1 1RUE2 2HWC3 2R071 1ZBE1 1Z7S2 2IZWA 5ACA2 1RHI2 1MQTC 4Q4Y1 1RUG1 4AEDB 1VB2A 1BBT2 3CJIB 4EJRA 2WFF3 1MQTB 1VRH3 4QPGC 1RUE3 4CDWA 1F2NA 1H8TB 2XBO2 1Z7S3 5AC92 2PLV1 5ACA3 1RHI3 1RUI2 4QPGB 3J8F1 4Y4YA 5ABJA 2RR12 1BBT3 4CEWA 5DDJ2 3VBUA 2XBO3 5AC93 1D4M2 2RM21 1FOD2 1RUI3 1PGL1 1VBA2 2RR13 1FMD2 5DDJ3 2HWB2 5FMOS 1FOD3 1VBA3 4RHV2 1M06G 1FMD3 5FMOL 2HWB3 5C4WC 2R042 1BEV1 2X5IA
chains in the Genus database with same CATH superfamily
3WY6A 5C8CC 1W6QA 4LITA 2KXLA 1MEC2 4P5HA 2VZQA 3I3MA 2HEYF 5CFCC 4RHV3 3BTZA 1WMXA 4DEVA 5JXGA 2XQXA 2R062 5AFEA 2B39A 2RDSA 1VPHA 1ZZ8A 3CL1A 3EBRA 4JDNA 2HWE1 4OZOA 5DUXA 3ZPYA 5LA1A 4XC9A 4AXOA 3EJKA 2W1SA 1UOJA 2L9LA 1VMHA 1LHWA 4QPGA 1W8NA 4C91A 3K3OA 3QLQA 1ASJ1 1XPWA 1WUVA 2D5HA 1JZ7A 4TTGA 3LA7A 2CTVA 4HKLA 5LBCA 1VBD2 2XWBB 1RVF3 4ZHNA 3OGRA 5J09A 1ONAA 2ORXA 3BOPA 4E8CA 1EY2A 3MZHA 1AYN2 2JG9B 3A22A 3AVRA 4WVMA 1H6XA 1IHMA 4QM9A 1RUC1 2E53A 2WAAA 3TEWA 2PELA 5FZHA 1QOTA 2IXLA 1GWMA 2VVEA 5AVPA 1VAVA 2VMFA 2ZA9A 1GP6A 5L73A 3T08A 1BZWA 1F8VA 2XHNA 5LK5A 2OA2A 4XTPA 3I2KA 1GNYA 5E16A 4YLZA 3TN93 1QJU2 3WW1A 2AC1A 4MUVA 1NQDA 5JSOA 2KR2A 4IW3A 1PVC1 1JOJA 2GC0A 2UY9A 5TSWA 5LEKA 1UY2A 2VW2A 2E9QA 3WP3A 3KQ4B 1R1A1 1DFQA 3RI9A 5C4WA 3VHOA 2BZDA 1U5XA 4Q0SA 5F32A 3OBRA 1G9FA 4NOTA 5ANQA 3VZNA 5FZEA 1DBNA 2WRAA 5GJ6A 3W21A 3LA3A 3FFZA 2RS32 4RR3C 2QQJA 5FZGA 3CDZB 2GALA 2VOWA 1VBE2 1B35A 1PZ8A 1CX1A 4I0BA 2ZGLA 3RWNA 3JU9A 2FDHA 4K7JA 4JRAA 3ZKUA 2PN5A 4JC1A 3ECQA 2EXHA 2Y34A 5FY9A 2VZTA 1LULA 2P6CA 3ZSKA 3O1VA 4JGYB 4YVWC 2BW8A 5A32B 5FOJB 2CGNA 3ELNA 3J4UH 1HV0A 2HWD1 3N9NA 1JOBA 1OUXA 2EIEA 4QPIA 3N36A 1MS5A 3ZYIB 4CPBD 1VBC2 3DKQA 4LQRA 2D6KA 3T4HB 4I2OA 1AXYA 5JZGC 1O4TA 2JIGA 2TNFA 2WA4A 1F31A 3NO8A 3N35A 4TN7A 4FOQA 3FZ3A 4NRMA 2OVUA 4JDOA 5K7PA 5LWBA 4RHV1 4CEYA 3K4ZA 5FR3A 3MI8A 4Y3OA 3JB4C 1U12A 2VMGA 1DQ0A 4HOOA 4Q4W3 1ZRDA 1D4VB 3AMHA 5DG1A 1EUUA 1NKGA 1WW5A 4H2AA 1QOSA 3LSDA 4JDMA 3UJOA 4NIHA 1E57A 1AR82 4KWJA 2RS12 2J1TA 3UKNA 2GU9A 4CDXB 3G7DA 5EFUA 1W0NA 5FZKA 1E5SA 2WS93 4NPLA 4Q0QA 4Q8KA 3D0JA 1W03A 5C3SA 1GMMA 2D3PA 2WDBA 3H8UA 3E5UA 2BNMA 3LF7A 5D8AC 2W91A 1I5PA 4QT6A 1MZFA 1PM7A 1WLTA 3OUIA 1PK6C 2ZEYA 4FCAA 1AL22 4P5YA 2JKBA 2KM2A 3RRDA 4A44A 5AFBA 4AW7A 4XETA 1PGW1 2ZX1A 3ILFA 4IV1C 4QXHA 3WW3A 3VD7A 3WDVA 5HV0A 5GLVA 4V2VA 5FZ8A 2HH9A 3LFMA 1H2LA 2K0GA 4J25A 2HWF2 4H7LA 5AVAA 3VKNA 3P5BA 1S0EA 3WDYA 3AMQA 3OPTA 5FKBA 1JZ4A 2WQ4A 2P4EA 3CMGA 3GZEA 3MF9A 3I3QA 3ZFFB 4XF1A 2A71A 4UF0B 2QQWA 2ZHLA 1G86A 1YI9A 4MYEA 3UKVA 4AQTA 2OIIA 3WDWA 1J3RA 2YPDA 1W9YA 3LFIA 1XNBA 3VBHC 1POV1 3RQ0A 2AUYA 3WD5A 3ZVXA 5CKNA 4PDWB 2WZR3 1ZBA3 5E6HA 1V9U2 3U11A 1ZBE3 3WNLA 4XBQA 1ND2C 4OMCA 5T5PA 5LA9A 1QJY1 1WBFA 1A8MA 1NA1C 3F2ZA 3HT1A 2GMMA 3NNMA 5JIUA 1RUG3 4QX3A 4YW2A 5JI7A 4YZ5A 3KGLA 1E5RA 5BNNB 3MICA 4LE3A 2UU8A 3CZJA 4ZKTB 5CEHA 4Q27A 4FOYA 1DGLA 1SLBA 3VZLA 1SPPA 3WHTA 1HRI2 4BQ2A 1FYUA 3GDBA 4BQXA 3AKRA 3RNSA 4CDQA 3IWZA 1W6PB 5FLIA 3KWVA 3J8F3 4R8HA 5LEJA 1FXZA 4Y5TA 1B09A 5HCHA 5A3NA 4PQQA 4FSJA 4MLOA 2JDPA 4MGQA 1HB2A 5A80A 5HCFA 4CP1A 5KWRA 3U14A 2D6LX 2E7QA 4N53B 4NMIA 3J26N 3R6SA 1HLCA 4PBPA 5LB6A 3RMXA 3RZLA 4E2QA 3MIGA 5DZGA 3DUIA 3JZVA 3RPQA 5C70A 2GNMA 1LENA 2Q0AA 1VRH1 4ZS2A 5FREA 3NQHA 4H14A 5IK5A 1SBFA 1GOFA 3ZIXA 1RHI1 1UX6A 2VAUA 3HQXA 2ZEZA 1FX5A 4JGZB 1V0AA 4DMIA 1LRHA 2BVBA 3VBOC 5FO9B 1VBB2 4D7YA 4WM8B 5DAXA 4HPKB 2CSGA 1JTZX 4AHWA 1OOPB 4UFMA 2Q1ZB 2WS91 3L2YA 3NWKA 3T0DA 4E2SA 4H55A 3BIEA 2XDVA 4D7SA 4BQYA 2FDIA 3H7JA 1ZZ7A 1NCRA 4LHNA 4CEWC 1YIFA 5J36A 1DU3D 1UCXA 3HWJA 1ASJ2 3MEPA 4HZFA 3OB8A 4AFBA 5FYBA 2ZGOA 1US2A 2ADDA 4Y22B 5DDJ1 2D6MA 4UT5A 3SEPA 4AVVA 2JG8B 1S2EA 2WNVA 4XDOA 2GZWA 1LR5A 3ALQA 3GBWA 2WN3A 3I3EA 5KR7A 4META 2XVLA 4G4FA 3POYA 4XIKA 1FOD1 1DYKA 1UKRA 1W0OA 1W99A 4A45A 1DIWA 2UWAA 1RUC2 1JUHA 5A1FA 3VBSC 3E1F1 1FMD1 2TEPA 3OGSA 3O0WA 3SMHA 1DP0A 4KBZA 4XHBA 2BDRA 4AGVA 3ZSJA 5BPXA 4HANA 2ZZQA 1JYNA 4AWDA 1AR62 2B5HA 1CPMA 4FPKA 4MADA 4S2DA 2EXKA 3PU8A 5A1AA 2ADEA 2DFCA 3ACIA 4QPYA 1YIPA 5K0UB 3RZGA 1EP0A 1PVC2 3O1PA 2WZR1 3FJSA 2GDFA 4URTA 5J98B 3KV6A 4LIVA 2XLFA 4Z8BA 5KHKA 1R1A2 3USUB 3O5SA 1QQP1 1RUH1 4UFIA 4QQLA 2R32A 2ZX2A 1QJX3 4UFJA 2WYSA 1EPWA 4UI9L 4YVSC 3RZMA 1OVSA 3Q9OA 5IFTA 1HW5A 1DQ1A 1OD5A 3BOWA 4LBKA 1JYCA 3H0OA 1YEWA 2AACA 4B7EA 5CA6A 2PA7A 1RIRA 4L99A 2O1QA 3WG4A 4AOCA 3AL5A 1HB4A 1FPN1 1NE6A 4CCCA 1LOEA 5FZAA 3M3QA 4XFHA 3LZZA 3H1YA 3WQ7A 2B42B 5E88A 2FQPA 1HX6A 2ZTNA 1MVQA 3LD8A 4GAZA 4RQPB 5K8SA 3I2HA 2XL7A 4JKLA 1KFXL 1AR93 3LIHA 4U2AA 2P37A 1S0GA 2BOJA 1C57A 2W1WA 2WSVA 3BB6A 4OULA 4PIYA 2HWD2 3VKLA 2Q4SA 3J9SA 1G6NA 3AZVA 5A7SA 4CXWA 1KGYA 1AR73 4K8RB 1XE8A 3WV6A 4OUMA 3IB3A 5GM0A 1MACA 2H0VA 3HNYM 1QY4A 1RYYA 2BUKA 4Z82A 5JIAA 4BMBA 4PF5A 1LEMA 4PIXA 5FMBA 5JI9A 4MGKE 1S1AA 5FPZA 5E8AA 2VE1A 2GNBA 1UU6A 2NPIA 1Y3TA 3LIGA 1KXGA 5DAWA 3I2JA 5JOWA 3NNJA 3HJRA 3FLPA 3K4DA 3QOPA 4CP9A 3ZMOA 1QXJA 2J22A 4ASKA 1BYHA 1KS5A 1NCQA 4QX8A 3DPRB 4EZ4A 4Y33A 2XHKA 4I0WB 3SNMA 4Q2FA 5EPAA 1KJLA 1BK1A 1CAVB 1FI2A 1F4HA 1UU4A 5A33B 3ZXKA 2VZ3A 3ME2A 1D2QA 1WZXA 2AREA 3PHMA 1X9TA 4N7IA 1XE0A 4IETA 1HRV3 4MXWB 3SH5A 5C3OA 2GSYA 1FNYA 2LW8A 3ZSEA 2QDRA 1MS0A 3U4SA 3VBRA 5LASA 4K8FA 1GANA 1XB9A 2BVVA 2WO2A 5JMOA 2IVJA 3ZO0B 4M3CE 3VV1A 1CAXB 3M3EA 4LUKA 5CZKA 2Z2SB 3JB8A 1PGW2 4UXAA 1OD3A 3O12A 3AJZA 2RM23 1FAYA 1LOCA 3WEZA 2JG9C 5IVBA 3KCYA 3ZXFA 2NLRA 2WSUA 3LGRA 4E9KA 2WC2A 4BXFA 3JD71 3L2HA 1MS8A 2HLEA 1DF0A 4B8EA 4E4ZA 3FUOA 5FY8A 2A73B 1WWYA 3EQEA 4HFSA 5JWPA 5JXJA 3NL1A 3TNPB 4IESA 1S0CA 4YM3A 3ZOIA 4K1YA 4CU6A 4F83A 3T1LA 1BMV1 4M3CF 3FL7A 3AJYA 1EAH3 3KHCA 5C3PA 1V6MA 5KHHA 2WZEA 3V65A 4UFHA 2ZEXA 1BEV3 3M8LA 3QD6A 1RITA 4QU2A 3M3CA 4LULA 5FXVA 1BKZA 1STMA 1V6JA 3BU7A 1X36A 2G9ZA 3H7YA 3KF3A 1ND3B 3POBA 1TEIA 1EUTA 2JB8A 2AEYA 1QJY2 4IGQA 2FDGA 2ERFA 3AKSA 3LCPA 4CDUA 5FZOA 1CVNA 3VBUB 2B4KA 1SHWB 3WUDA 3A7QA 5FYCA 5FJKA 5BNOA 4W6WA 3C7OA 5FIXA 3IKWA 1UD1A 1OQ1A 4I01A 4P9JA 4QX5A 3C2UA 4OHZA 4HKWA 4AI8A 4RN5A 2HBTA 1R081 4QXBA 1W6NA 5L7OA 1UAIA 4Y20A 3URFA 2ATFA 4XF3A 4LK7A 4ET7A 4XQ4A 2LROA 5JAXA 1YWKA 3LQCA 3DECA 2E63A 1GP4A 1UMHA 2BOIA 2BNOA 4FPHA 4QHBA 4BU2A 3H8XA 1PX4A 2QJVA 4R9DA 1F4AA 2EIBA 3R4DB 1BK0A 2CAUA 4MGSA 4Y24A 3TNQA 3T2QA 2Q30A 1Z78A 2Y8KA 3OYWB 4MH0E 4R4XA 4LOTA 1KQRA 4L8QA 1VRH2 3KV4A 3I4IA 3KLSA 2R071 2VO5A 1F35A 1LGCA 2VUCA 1UIJA 1W6QB 2C1FA 2FCUA 1RHI2 1YCIA 5C9AB 1REEA 5F2WA 3ZYRA 1W8ZA 5EWSA 3MIBA 5LY1A 3AP5A 4ZS3A 3ZMNA 1N3PA 3G6JB 3I2DA 3O0XA 1H8TB 4LBJA 4GD4A 4P9GA 1JBCA 2DTWA 4QPGB 2IXKA 1Q43A 2JECA 3C7EA 1Y9MA 5ABJA 5FQ0A 4Q1RA 2XLAA 3MFAA 5FV3A 3KF5A 1V6NA 5KHGA 1AZDA 5DDJ2 3WLUA 4DB5A 3RZJA 4NO4A 2XBO3 3KM5A 2RM21 1IQAA 2OPWA 1FOD2 4LO8A 4W6XA 4WVMB 5FYMA 2RR13 2WR9A 3AB0A 1NLSA 1D0HA 1OKOA 2R6QA 3B93A 3DXTA 4YNIA 3WF4A 3DXUA 1BHGA 1FMD2 1IS4A 3IAPA 1Y43B 3VD4A 3MHZA 3ZN6A 3VHRA 1X9PA 2J1VA 3IM0A 4HBNA 4EN9B 3CIHA 3EYPA 3Q8AA 4JQRA 1HN0A 3BGAA 1L7RA 4YG3A 3GGLA 3I2GA 3NV2A 3VD3A 1Z0HA 4X8PA 4M00A 2YMZA 2WA3A 3J7NA 1BEV1 1CWPA 2X5IA 5FYUA 2OKXA 1W8TA 5BXXA 5C4WB 1NLQA 2BGCA 3ZSLA 1G9DA 3AVSA 1Q3EA 1QQP2 1RUH2 4AEDA 1I1EA 4A7KA 1PVXA 2VZVA 1LHOA 2DBIA 4NPMA 2DV9A 4AVTA 5F37A 3O1OA 1IS6A 1CJPA 2ZACA 2R043 4N9IA 2RMU1 5FKCA 3RJ2X 1IS5A 4BISA 2KA3A 1AXKA 2K2SA 3MBWA 2ZGKA 4DPNA 1CONA 5IK8A 2WT0A 1FPN2 1B35B 3SKJE 5BNNC 4DXRA 1C1FA 1W6MA 5A7QA 4AFAA 2H6CA 4BLIA 4WV8A 3V0BA 3RJRA 4UFKA 1ZREA 3VB9A 4XAAA 4NR1A 3NNGA 3OUJA 3PDQA 3BUCA 2YROA 4AQ6A 3ZXJA 3MV11 4NWVA 5A3WA 5A6YA 1C8NA 1RXGA 4QB6A 4OHVA 1JYWA 2HKXA 2VC9A 2ZMLA 3WSOA 4QPIB 4CUBA 4YM2A 3CLPA 1H9WA 1NY71 4PI2A 3UGFA 1H2MA 3VHPA 1Y9GA 3RSJA 3MV01 4B4QA 2FBEA 4LLOA 5L9RA 2XPJA 1W3VA 1WBLA 4LE4A 4FO9A 5FZDA 3NJXA 1OI6A 4AVSA 4CEYB 2FMDA 3K4AA 5IW0A 3S57A 1YFUA 2RS51 3UK9A 5F9TA 4DEQA 2J1AA 5FWJA 4IEQA 2IXHA 2NMOA 5JOXA 3OD4A 4CE8A 4ARXA 5A70A 1PO23 4AI9A 4WM8C 5I8YA 2B8MA 1OOPC 5C8CA 4GH4C 3OUHA 5BNQA 1C8M3 3NKGA 5CISA 3W5NA 2VPVA 3PUQA 4XBLA 5CFCA 1OFSA 1W8FA 3H3UA 2A6XA 2DURA 5T55A 2Y38A 3D8CA 3DGTA 2R0HA 2ZGNA 2OXBA 4GULA 1GLHA 1UKGA 1QJEA 5KHJA 2RR11 2XONA 5F8PA 4AEJA 1OH4A 2D6OX 1RUJ1 3IAQA 4BE3A 1JUIA 5GLUA 4BDVB 5CAZA 2CU5A 1W2UA 1W90A 1YXWA 4XZPA 1IG0A 4Q4X3 3C7HA 3NW4A 5FP8A 3FE5A 3ZYHA 3PNAA 4D69A 5C8WA 1Q8OA 2TBVA 2ZKLA 3VBFC 3MO4A 3JD72 3DL3A 4COUA 1VMJA 2VW0A 1K5MC 2VNOA 5C3QA 3RFRA 2EAAA 1GNZA 2V4AA 3IDBB 1G9CA 1WLDA 3WF1A 5FZIA 1A34A 1BMV2 1W0PA 4KBBA 3P1IA 3PURA 2QCSB 4H7MA 2VCMA 2Z79A 4HK9A 1N1TA 4EWDA 2A3YA 3KV5A 4XJ8A 3JBG1 1KFUL 1WMFA 4YW5A 1V6LA 3CBNA 3TEXA 1QHDA 3C7FA 2JDAA 3ZPOA 4YM0A 5BYNA 5F6KA 3AP9A 4K6BA 3KS7A 3ZYJB 3ILRA 4HMZA 2YHJA 3NNFA 4Y1VA 2YU2A 2J1EA 4GZ9A 3WVJA 2ZMNA 5FXZA 2E7AA 1QOOA 1R091 2HEVF 1OA3A 4XMAA 3LEIA 1IKQA 2EIDA 4AHYA 1A78A 3D4KA 4CDQB 4KU7A 5I8SA 5FO8B 3VD9A 1R082 2YC4A 1IG3A 2A5ZA 2UYBA 2V5YA 2PHTA 3OCPA 4LORA 1K42A 4RR3A 1K12A 3HVDA 2MEV1 3VLBB 1EV13 5A3LA 3H3ZA 4XCBA 1SCRA 1S0FA 2GC3A 5A7NA 5C9AC 1GU3A 5DUVA 5BNPC 3BN6A 5L36A 1OPOA 1RUF3 4HONA 2QZ2A 2VU9A 2VOTA 2ET7A 3SISA 1COV1 1YRZA 2VXRA 4PCRA 2JDUA 2VNVA 2R072 2JB4A 4XMIA 4NIDA 1PIV3 2ZGRA 5CVRA 3FN9A 2BFUL 2ZX4A 3EO6A 3HMYA 4XTMA 1XNKA 5IVEA 3U10A 1ZX5A 3PUSA 2F6BA 3VGIA 1AYM3 4TLGA 1RL3A 3M1HA 5F39A 4V2WA 2R1DA 3LEGA 5CU1A 5KXBA 5JZGA 2I45A 3WW2A 2OW4A 4K20A 4BB3A 3V0AA 4FP3A 1MZEA 3OPWA 1H8VA 3TEYA 1OT5A 1NCRB 4QKFA 4INDA 4Q4Y3 1E5HA 1DHKB 1PMHX 5IHRA 1Y9QA 2WNVB 1AF9A 2ES3A 3NAPC 4IERA 2LS6A 2VNGA 4QMAA 3R4UA 2DCYA 3I3DA 1W9TA 2PLV3 2W5FA 3AFKA 4YSFA 3KV9A 2JICA 1LOBA 3ZYPA 1QH7A 3Q8FA 3ZX7A 5SV5A 5LCWL 1KDKA 1AXZA 2RJ2A 1PX3A 5D8AA 5H9QA 1PK6A 2ZX0A 3POIA 4H3WA 1O3TA 2WNEA 1DLLA 2QQLA 4JCKA 5L19A 2WNUC 4IV1A 1AX0A 4LHKA 5DAVA 3FBYA 3JXSA 1J58A 2XGXA 4IEUA 5F5AA 2VBBA 2WO7A 2P5BA 4FP2A 1Y7BA 4IE6A 2V09A 2VQ0A 1WCDJ 3AYEA 4U36A 4Q5OA 1LAJA 1DZQA 2DVBA 2R49A 4GXLA 3TRSB 2D98A 3PTRB 3ACHA 1PGSA 2CWMA 2OYZA 5I0UA 3T2TA 2C6SA 4DUWA 1J1TA 1ENXA 3BCWA 4S2HA 4CCEA 4CVUA 4QQ2A 1GSLA 2X8KA 3N7LA 3N9PA 1BBT1 4UBHA 4X6QB 1FATA 2JIJA 2EICA 2WFPA 4MX3A 4OUEA 4ZZ8A 3ETPA 1L7QA 1OFNA 4IUGA 3VL9A 3TAYA 1REDA 3NV4A 4KH9A 5D1IA 4COZA 1ND3C 2NMNA 2RMU2 3VBHA 1V70A 3WHUA 4AAPA 4D94A 3THCA 4HN1A 2G9GA 1U5YA 1E5IA 2VCAA 3QBQA 5LBBA 3ZXGA 5B2GB 4Z07A 2VQUA 1WD4A 4UFLA 5T5LA 2XVKA 2FDKA 1ND2A 2PYTA 4V1PA 5T50A 1JZ6A 3AKTA 2ZEWA 3NV3A 5DN2A 4MG2A 1NA1A 4FPYA 3WG3A 4ITCA 4I0AA 5F1RA 2ZX3A 4YW6A 2EVXA 2XR4A 4AHZA 2DVFA 2ZBJA 2C4XA 2ARBA 5J7MA 1H4HA 1UMZA 3VN4A 1OC1A 3GYDA 3PJYA 1RUF1 2VCBA 5LRRA 4LIUA 4M3CA 1WA4A 2HWB1 1LNSA 1O59A 2H6BA 4Y1ZA 5GZDA 5IAVA 3RGBA 1QJFA 3MF6A 2BGOA 1PIV1 1QNWA 3N7MA 1W8OA 3PVEA 5EJZB 1JU4A 1OMIA 2YXSA 1PO13 4EN6B 3WP5A 1V6OA 2Q1FA 2WO3A 3SLIA 4CU7A 4CP9B 5E89A 4DXZA 2DVGA 2JDKA 1YYNA 1YC61 2RS52 4IE5A 1NCQB 1J1LA 4LUMA 4Q4V3 5EYYA 5CKQA 2D3RA 5FMDA 3DCQA 1WMEA 3GNEA 4HLTA 4KGQA 4J1WA 5EZWA 3CKHA 1RINA 2W94A 5H9RA 2X05A 4N43C 4B1LA 3MW2A 5KC5A 1RVF1 2X53S 1H8TC 3UYJA 5JLVA 2WL1A 5E1RA 2ZJCA 1GOGA 3VBOA 1WMDA 3J7MA 1HXS3 3VBRB 3OGJA 3ZFEB 4LBLA 4GB33 2WT2A 4ZXKA 1ULGA 5DPNA 3SITA 4HL0A 5DQ0A 3WF2A 3W5MA 1RUJ2 3P3PA 4RSUA 1ZYBA 1SBEA 3KB5A 4WM7B 2HYXA 2P34A 5HV4A 4NIGA 3O0VA 3GHNA 2EXIA 2E33A 4YW7A 4ATEA 5F3IA 3H8OA 1UNBA 2E31A 2VMDA 4DXSA 1HN1A 2QQOA 3OF1A 1UXZA 1TE1B 3ABZA 3LPFA 5FUPA 3TN91 4AL9A 5F7UA 5C33A 2D97A 4MHUA 4CYDA 3I97A 3GJAA 3ZN5A 3I59B 5FBJA 5I93A 4KWKA 4XZUG 2H0BA 5DAPA 3VBSA 3ZFGC 3OJBA 1TME3 5CFDC 2FD8A 1SLIA 4AG4A 1C5IA 3JBG2 4EWEA 3WF3A 4JKKA 1CN1A 3K75B 4Q26A 3HNBM 1XYPA 5DG2A 2PHDA 2ARXA 4MZUA 3WDUA 2WLQA 4FTBA 4AGRA 2RE9A 1ULEA 2X09A 1N1VA 4QX0A 3UGGA 3RVHA 2VZOA 3AM2A 1LEDA 3UETA 5GZFA 4LA2A 5LA2A 5FZOB 5CG9A 2Y6LA 2Q8CA 5F5QA 1QIQA 3WOGA 1T2XA 2WIIB 5FYHA 4GKXA 3GM8A 5JR2A 1O7FA 1R092 4EN8B 1RGSA 2XJVA 5JCTA 1LOGA 2QZ3A 1C28A 2QE3A 2D40A 4PBOA 4YVSA 5HXMA 2BYVE 1W6NB 4RS5C 2JD4A 1UN1A 1S2KA 1ODMA 2MEV2 3CZUA 3HEIA 5FP7A 2WLPA 5SV8A 5IVCA 3GJBA 4YGBA 4JHZA 4ZU7A 2A70A 3J7HA 1ZZ6A 4YZ4A 1Q8PA 3VDDC 3VKMA 4A4AA 1GOHA 4XFCA 3QACA 1W6OA 1NZIA 2ZZJA 3ORJA 2UURA 4SBVA 3K46A 4UWDA 5HXVA 5L9VA 3R0RA 4AQSA 1COV2 2VMIA 1SACA 5JMCA 3B9IA 4S2FA 1H1IA 3BIWE 3LDKA 1UMIA 4Q4W1 3ST7A 3SH4A 3MW3A 4MGZE 1WGPA 5HBAA 4XFIA 5L9BA 1MS9A 4QDQA 4OFGA 4CDWC 1J83A 1T6GC 1DGWA 2VCCA 2ZGTA 4D0QA 2P17A 2HWE2 1S0IA 3ON7A 4IE0A 2R1BA 1XYNA 4XACA 2XXZA 3ZR5A 3S7IA 4FOVA 2GNTA 3VKFC 4ARYA 1N1YA 4BH9A 1CIWA 1VP6A 1G8WA 5FQ0B 1JZ3A 2X29A 1L7LA 3WNNA 2F4PA 2LALA 1DQ6A 5F5CA 3RYKA 4AF9A 1ODNA 4FVVA 4A41A 4XE9A 2W08A 5FZ4A 1XYOA 2GH8A 4M0NA 5IAXA 1MS3A 1XNTA 4IV3B 2VTXJ 3ZDSA 1XNDA 1SLLA 4DRRA 1Y4WA 4XUOA 1WA6X 4TYSA 5A6QA 4FFIA 5A3UA 3W9AA 1XQNA 3FMGA 4ISRA 4YG0A 3TEZA 1NT0A 5LRSA 2D93A 4N8MA 2B45X 4IDZA 4MOAA 4P00B 1UY4A 5K4LA 4MGTA 4NIIA 5KBFA 1NX9A 4QB1A 1RUD3 2WN2A 3POFA 4IXLA 5FUIA 2AENA 2ZPXA 3LOIA 4LMFA 4FFHA 4TXWA 1JI6A 4QGLA 1ZBA1 4AFCA 3LEMA 2YUEA 2HWC3 1ZBE1 4PF1A 2P3YA 3OPZA 5G05L 5LW9A 2WUHA 2HJIA 1UW8A 1CGPA 5JSRA 1MQTC 4YFWA 1RUG1 4AEDB 1VB2A 4F3JA 4JX0A 3A4UA 1BBT2 4LKDA 3CJIB 3VZJA 4G3YC 2WFF3 2YZ4A 3CHXA 4ZU4A 2W47A 2V72A 3S5AA 1RUE3 2CDOA 2AEZA 4A3ZA 1YFYA 1Z7S3 5ACA3 1O8PA 3J8F1 3N3HA 2UWBA 4Y4YA 3X29B 3I7DA 1A3KA 2ID4A 5HI0A 1W6MB 3V0BB 3BVCA 4C0HA 5EV7A 5DAQA 5AC93 4CCJA 4LHLA 4WBBA 1RUI3 3M2MA 2JE9A 3MIDA 4ORFA 4XDQA 2ILMA 2DCKA 2YG0A 2XKOA 4B29A 4C90A 1AJOA 3UKTA 3PUHA 2HWB2 2ETEA 1XU1A 1H6YA 1W2AX 1H30A 2EA7A 2P2KA 2A6WA 1O3QA 1SLCA 1F5FA 1UZWA 3B3QE 4AEKA 1YQ6A 3B9CA 1UPIA 4JTNA 1WW4A 4URAA 1JZ2A 1VBA3 4RHV2 1TQ5A 5HCAA 3A0KA 4BMEA 4GJYA 5GLWA 4CU8A 5I0TA 3VUOA 4AI0A 5FMOL 5I8TA 5CG8A 2Y64A 3LDBA 2CV6A 3BTAA 2Y6JA 1VALA 3INAA 2DWRA 3FBMA 1C3HA 2W1QA 2Y6KA 3CNAA 1HDKA 2VBDA 5C8CB 3LSEA 3UGHA 4WVZA 3AX4A 5FY4A 1RVF2 3LDRA 5CFCB 1DQ4A 1NOVA 4N7UA 4WVWA 1IZ3A 1DGRN 2QQUA 2A3WA 4MO3M 1MEC3 4C1WA 3Q8BA 4FXKB 2RHPA 3QCWA 4BQWA 4CXXA 4IEWA 1O6UA 2ZAAA 3MPBA 3UNPA 2I07B 2R063 2WQZC 5LBEA 4XJZA 2AR6A 4LBQA 3H1WA 2G1MA 4I02A 1U5IA 1GICA 2SBAA 2VOVA 1UOFA 1ZA7A 2D6NA 3DF0A 4MXVA 4NRPA 4RGKA 3AMMA 1XSQA 3AP6A 1YFXA 3TN92 5FXXA 5IVJA 4XW3A 2WWJA 3BPSA 2JWPA 1VBD3 5J48A 3ACFA 1GZWA 3IPVA 2EAKA 5C5TA 1AYN3 2D43A 1ST8A 1QJX1 3D0SA 4QPWA 2Q8OA 4FT8A 1JMUB 4W4ZA 4XYXA 4YGCA 3O1MA 3I8TA 1W2OA 1I3HA 1Q56A 1IPJA 3IZOA 3U75A 2VNRA 2Q5TA 4YZ1A 2JXAA 3ASIA 5I0RA 4MGIE 3ILNA 3KT1A 3I3BA 3KHBA 4QXCA 4UW4A 2YGMA 1BXHA 1UYPA 3LKJA 1VLNA 4PT6A 1QJU3 4DNYA 2PXJA 3ZYFA 3GZTB 4GWJA 1S4CA 2WO1A 4GMP3 2BV4A 3WDXA 3M4FA 1JZ8A 4QQHA 1AR91 4KL1A 5F2SA 3AC0A 3KCXA 3AL6A 4XXPA 4YG6A 4AFMA 4NN0A 2R0FA 4BCUA 3MLLA 5JPNB 1LOFC 2XJRA 4RR3B 1VB4A 1W8WA 2BTVC 2VOXA 5F5IA 1AR71 3M70A 2DTYA 1GKBA 3NV1A 4JGYC 3IBMA 5BNNA 5FZLA 3T2PA 2RS33 3VHNA 1ULPA 2VMCA 1R1ZA 1WW6A 3K77A 5FZ3A 2PQQA 5A6XA 1C5HA 1LJ7A 5F3CA 4EZHA 1PNGA 1VBA1 2IXJA 2CNAA 5FK8A 3POEA 2B46X 4L11A 1NXD1 3IMMA 4PLOA 4FTSA 1NUKA 3BTYA 1CPNA 4UAPA 3LWCA 3H3LA 4Q4W2 4EROA 4LBOA 2OZJA 2RJLA 3JUUA 3NJZA 3OEBA 4X6RB 2FHRA 1W05A 2LRPA 1WCUA 1QEXA 1BVVA 3WT3A 4JVAA 1HV1A 1XXNA 2DU0A 4GKYA 1HRV1 2WS92 4LKFA 4NROA 4XDPA 4QHOA 5JZGB 1ZZBA 3V0AB 1X7NA 1VBC3 4P14A 2G9FA 4XPVA 2YB7A 1LHVA 2MNGA 4M4PA 4AEMA 4CDXC 1W06A 2GMEA 3BALA 1XOYA 5KXCA 3K51A 4LK6A 4C0BA 1O3SA 1H2NA 4OUSA 3SCFA 5FZCA 2QQIA 1F15A 1LOAA 1CZSA 3R4SA 4Y1UA 4NVPA 5A7PA 3RYPA 2Y6FA 2DCZA 2JDNA 1OOPA 1H0BA 2XB6C 3ZFEC 4GH4A 3PVNA 4AK3A 2GP5A 3PVOA 3OEAA 3CF6E 1UYZA 1DZRA 1CZTA 2RS13 3USSA 4NHLA 4Y5SA 2J1SA 4WM7C 5D8AB 4E27A 5IVVA 4XOGA 4OMDA 1P8JA 1PK6B 2VG9A 1D4M3 2X10A 1K5JA 4GWNA 1OF4A 2YU1A 4CCOA 4OI0A 1UX7A 2JDHA 1EAH1 4IV1B 5FP9A 1QXRA 1YLLA 2RJKA 2FCVA 5G04L 3ZFFC 1GR3A 2W2IA 5A3PA 3ROUA 2XLGA 1JS9A 4AAXA 2P3IA 4MHRA 2D44A 2D3SA 3PJQA 2W0XA 2D5FA 3VBFA 2W52A 2WZR2 3PU3A 4Q0UA 1ZBA2 4D6SA 4XFGA 1ZBE2 1K5MA 5IATA 1CESA 5HPOA 3H8RA 3WQ0A 4YARA 4PDWC 2DCJA 2HWF3 1YQ5A 2OX0A 4LPLA 4MGYE 1RUG2 3TYJA 4BIFA 1HQNA 2VTXA 2YYOA 5BY5A 3J7LA 4JZRA 1OLQA 2F17A 4NPRA 4XURA 3VBHB 1YQ8A 2C26A 2XOMA 2QQPA 1ENSA 4O9EA 5FDBA 3HQRA 5FFOC 2WWSA 3J8F2 5F6LB 3D5OA 4XJ9A 3HAGA 1ND2B 5GZGA 5CIRA 1ZZCA 4C1XA 1X50A 4LBQD 1NA1B 1DQ5A 1XJAA 3H1MA 4KGGA 3RMYA 3SCHA 1V9U3 3QH6A 5F3EA 2YC0A 2WKKA 4BZ4A 1WLCA 1O3RA 1W39A 4GWIA 4LNVA 3RG0A 1RMU3 4IE4A 2HYKA 2PAKA 2NP0A 4XF4A 4FAGA 2G19A 4RGAA 4XFAA 1ULOA 4QB2A 2C5DA 3IIIA 1CAWA 4N53C 4M3CB 4KQ7A 1V6IA 4PQ9A 3DYMA 4DRVA 1GQHA 4DXTA 3S5QA 2XJSA 4XF0A 3O1TA 2CHHA 1HRI3 5FUNA 2Z42A 5FXWA 2GC1A 3WQ1A 4QAWA 3MUZ1 2PAEA 3MLKA 4K1ZA 4DUVA 5C9AA 5BNPA 2J42A 5EJ1B 5HCBA 1CIYA 2BJSA 1PGL1 5EQUA 2RV9A 2GN7A 4JGZC 1HJGA 2JJ6A 5FPLA 2GH2A 4HVRA 5FRAA 5FY1A 2VY0A 2B9VA 2VBPA 1NLRA 2R16A 5ERLA 1ZZ9A 2VZUA 4LO4B 3AZZA 1KITA 1ULFA 1NE4A 4UBGA 1GV9A 2XBO1 5FYZA 3VBOB 1S0DA 3GF6A 4QD2A 3AFGA 3IT8A 2XJUA 2VZSA 2JG8C 4LEJA 5EJ3A 4ZZ5A 3ITQA 3H42B 4QKDA 1LKNA 1VBB3 4O61A 2BRTA 2ARCA 1UZVA 4EWAA 1VMFA 3AYAA 4IV3C 2VUJA 1D4M1 4XHXA 4EN7B 2AH2A 5C6CA 4XBNA 1J59A 2XKPA 4CCNA 1ZNPA 3NAPA 2Z69A 4BQ1A 1ASJ3 3S6PA 1YI7A 4P9XA 5FLJA 1OSGA 2IC1A 3H50A 3NJVA 2Y0IA 3T09A 3I2IA 2J1UA 2BWAA 3VBSB 2XMLA 3RZZA 4LXLA 4XF9A 2W3JA 3WNKA 3ZN4A 4GMP0 4D3WA 4Q0VA 5K0UC 3PUAA 1OH3A 2CYFA 4LBNA 4PLNA 1QJX2 1QMJA 1RUC3 4IL7A 1DGWX 1AX1A 3PUIA 4AI2A 1DGRA 2OQ6A 1R64A 2WNUA 3DYOA 1H2KA 1LTEA 1CD3G 2R041 4A3XA 1A8DA 5FAXA 1UF2C 3VDBA 3SKVA 4AEDC 4P9LA 4LKEA 1AR63 3AP7A 3N9QA 4OI2A 2V73A 3CJIC 4NIAA 4CTEA 4J1XA 4CA9A 2FDJA 3POJA 2QQKA 2WQ8A 4FPGA 5FY0A 4BK5A 4DY5A 1SPPB 2GN3A 1TZOA 1PVC3 5EYXA 2XL9A 4HG6B 4MSVA 4CZSA 3WDTA 1V9U1 4YVSB 4RA0A 3BI3A 3FC0A 1AR92 1OA4A 3T30A 4CU9A 2TUNA 1R1A3 1UY3A 1NG0A 1H9PA 1Q8SA 3IMNA 2BPA2 1RMU1 1OQDA 4QGMA 1ND3A 4CUAA 1SMVA 5GZCA 4LOSA 4RQPC 4EE2A 4IEPA 3RDIA 4E8DA 3GHMA 1AR72 3OSDA 3S0MA 2GP3A 1D7PM 2LUWA 4PIZA 1UOGA 4IEZA 2A75A 3PTYA 1W6OB 1HRI1 4I09A 3WCSA 4CP0A 1WD3A 4IEXA 1HB1A 1HB3A 4IEVA 4YVWA 3M7AA 3WNXA 2EF6A 4J6GA 1QU0A 2VVDA 2WNOA 1CQ9A 3AYCA 5I0SA 1PO21 1RUOA 1TMF3 2GMPA 3AK0A 4AZZA 2XG3A 4R9AA 2HWD3 2WINB 4OHWA 5FYTA 2VULA 1I6XA 2ZMKA 3DPRC 1C8M1 4DFSA 1HRV2 3B7MA 1AL0G 2OS2A 4WZCA 2K9ZA 4XEZA 2JENA 2QKDA 1AUYA 1WCKA 4HN0A 3ZYBA 4Z2WA 1ENQA 3ETQA 2VZ1A 5FZ0A 5FJHA 3R05A 4IEOA 1KDMA 4W6YA 4QQPA 4OI1A 4P9YA 4B4PA 1VBB1 3D3AA 3E5XA 3LAGA 4ATFA 2ZOEB 2RM22 3HNMA 4Q4X1 2E6VA 3KD4A 3MIFA 5A3TA 4N43A 3DEMA 3FHQA 3KT7A 5FZ7A 5LBFA 1H8TA 2B7YA 2XJTA 1IPKA 4D7TA 1GZTA 1IOAA 2W92A 3GBGA 1GQGA 3P3NA 3PIJA 4XJWA 1BCXA 4AR2A 1HQWA 4QQOA 3HPNA 2ZHKA 4YPJA 3WNPA 2J7MA 4R9BA 4ZXEA 1EAH2 1QNYA 2O0OA 3GXUA 4KI5M 5KHIA 1RC6A 2PMWB 3WUCA 2OUJA 2YDEA 2JEMA 4IE7A 4E4SA 5FBZA 4AVCA 4FTEA 1BEV2 1ZM1A 1ULCA 5FPBA 4RL7A 5FYYA 1A6CA 1NZCA 1DLCA 1QDOA 3W58A 2W9XA 5FZ9A 3V64A 1GP5A 2YC2A 4JQTA 4XJUA 1GZ9A 1AR61 1QXPA 2GC2A 3PVBB 4GQ7A 4COWA 1ZRRA 2ZGUA 3VDAA 3ZFGA 2WJSA 3OBZA 3IDAA 1W2NA 2UYAA 5CFDA 2DVDA 2Q8EA 2PHRA 2RDQA 1DYPA 2D7FA 1RXFA 1JU3A 1SBDA 2JDYA 4A42A 1L3JA 3VBUC 4CRQA 5FPVA 4E4DX 5J3UA 3OBTA 1UYYA 5FZBA 1HQLA 1POV3 4UYBA 1EV11 3EHKA 3GCWA 4HSJA 4BM8A 5FPAA 4CCKA 1YFWA 3V56A 1OA2A 1QKQA 3THDA 1OHFA 1HJFA 4YRDA 1T6BX 4FFFA 1LHNA 4M0HA 4BYYA 5F3GA 3ZXLA 5EIYB 1QJY3 1H1MA 2O8OA 4OHXA 4KWUA 1SDWA 4KG8A 1NY72 4XABA 4LLFA 1ZA4A 2VW1A 1ZRCA 3NVCA 4ASMB 1W3XA 4RS5A 4NRQA 2ZS6B 2IXIA 4IGOA 1MS1A 1XBFA 3LB9A 4O9GA 3OTFA 5JVVA 4QHZA 1HKDA 3NRUA 4GJZA 3PMEA 4JV4A 4QX1A 4TSVA 1AYM1 1RTVA 3D6EA 1TMF1 2O8QA 4Y4RA 2IXCA 2DYCA 4FPFA 2Q8DA 1YQCA 1WLWA 2YBSA 3B01A 3VDDA 3ES4A 1I5ZA 1UY1A 5JXIA 1FNZA 2G4IA 1RUNA 1G9AA 2VZRA 1FV3A 4AHXA 4Q4Y1 3I2FA 3AKQA 4BOWA 4XCAA 3ATGA 4R9CA 5GLTA 4XQWA 1IPSA 3WQBA 3VL8A 1YO8A 1VRH3 4QPGC 5A7OA 2W46A 4TWTA 1QF3A 1F2NA 4PLMA 4CDWA 1OKQA 2XBO2 3H9AA 2E32A 2P3JA 2PLV1 4LHSA 4R4ZA 3U1XA 1MVEA 1RHI3 4AVBA 1GZCA 1YNAA 2VL4A 1OLME 3HBKA 4R52A 3BKZA 2RR12 3BU0A 1VAMA 2F4LA 4L97A 1JYVA 4CEWA 5K9YA 4QGNA 4AGGA 4TZDA 2PHLA 2OT7A 5FTTC 2VGDA 4COVA 4LBQB 1O5UA 4F7ZA 3HQUA 2RDRA 4L2NA 1X82A 1D4M2 1LGNA 2CGPA 3N7JA 5A7WA 4FPOB 3HBZA 4COYA 1TNRA 1N3OA 3KSCA 1OVPA 3B5LB 3PMSA 3Q8CA 4GALA 5FP3A 4YWAA 1JN2P 4B3NA 4YFZA 5DDJ3 4XILA 4G9SB 1W8HA 4KG0A 1GZWB 3IPVB 3BODA 3K2OA 4YZ3A 1FOD3 4AVAA 3GZUC 4IQPA 4Q29A 3WZ1A 5T54A 2JE8A 5KXEA 2QVSB 2ZHNA 4YYOA 2SLIA 1M06G 1LESA 1FMD3 3WP6A 2UY8A 2YPJA 2JDMA 1V6KA 5C4WC 3MIEA 2VD7A 2R042 4B4RA 1F9KA 1O4YA 5JXHA 2A6VA 2Y0OA 4PJYA 3MW4A 4LR4A 1W8UA 4KMQA 1TNFA 2ZGSA 4WVVA 1SCSA 3U37A 4CDUB 3IDCB 3TB0A 2CWSA 1X8EA 1JHJA 2FMYA 3CJXA 3E6CC 2XH6A 5BNOB 2FDFA 1MQTA 3D82A 3IDEA 3E97A 5JDBA 1B35C 1KS4A 5C5UA 3I2OA 3ZR6A 4M4RA 4AI3A 5L7OB 4Y20B 1UY0A 4HXCA 1KJRA 3KVAA 2ENRA 2YFZA 1QQP3 1RMU2 1RUH3 1UPSA 1CAUA 3KVBA 3RZKA 1XNCA 2WT1A 4O65A 1SLAA 3WNMA 3B69A 3DN7A 4L9BA 4NWWA 4Y5Z0 3ZXAC 4QKBA 4UW5A 2EXJA 3FUQA 3MFCA 1OUSA 4KU8A 4LA3A 4Y26A 5FZMA 3RYRA 5BUVA 3U4XA 4QPIC 1GUIA 1LU2A 1VIWB 3APBA 3N9OA 1FPN3 1PO11 1JH5A 4XUTA 1OPMA 1PHMA 2VTFA 3HOBA 4JHTA 4NHXA 4FQ4A 5A3MA 5JOYA 4K21A 3OY8A 2VUDA 2HBUA 2XWJB 1XNAA 2FZ1A 4Q4V1 4JTOA 1LHUA 4ZPIA 4RD7A 5IK7A 4CEYC 1PO22 5IFPA 3NJYA 4F8AA 4EQVA 3BPZA 4OI4A 5B4XA 4NHMA 1LGBA 1C8M2 4LTAA 5IK4A 1BLZA 3MDPA 1AHSA 3Q8EA 1W04A 3AKPA 1HXS1 3UL2A 5ABJB 5GALA 4EV0A 3FHAA 4Z92B 4UOJA 3JCIA 3L9JT 2OQ7A 3O14A 1ALYA 4GB31 3HN3A 1QGLA 4OYUA 1JYXA 4HVOA 1QWRA 3B02A 3E6BA 5FYIA 3EB7A 2WYFA 3WINE 4Q4X2 2R7EB 4HT1T 1CR7A 4GA9A 4GH4B 4TLFA 3THPA 2DUOA 3U07A 1MS4A 2NZ9A 5FZ1A 2ZCWA 4P02B 4PI0A 3ZN6B 4D8MA 5EHDA 2ET1A 2FCTA 4P9WA 1J3PA 2A6YA 3T0AA 4X8NA 1IGOA 1LODA 3F95A 1SFPA 5FLHA 3WW4A 2DDUA 5T5OA 4NHKA 4XUQA 1TME1 2JG9A 5IVFA 4UW6A 3AXEA 1NAEA 4JAAA 3WR0A 4W50A 4HSLA 2JX9A 2VVFA 4NAMA 1H1AA 3VBFB 2EIGA 1WKYA 3WF0A 1JXNA 2IFWA 2DFBA 1OURA 2X5IB 2MHFA 1PM4A 2FZ2A 1YJKA 4OHYA 3GCXA 1K5MB 1O8SA 1POV0 3FLTA 3P6BA 4LO5B 4FPLA 5CNAA 3IN9A 3TOJA 1LB2A 1X33A 2Z5WA 3JD73 4BQ4A 2QTWB 4XJAA 1G9BA 1VJ2A 2VJXA 2EALA 2E51A 3E5QA 1YJLA 2WZ8A 4Y1XA 3B00A 1JW6A 4Q0PA 4XIOA 3CU7A 4Y1YA 1Q8VA 2ARAA 5A3OA 4Q1PA 2JE7A 4O7XA 4W65A 4DY3A 1AX2A 5DMYA 3KQRA 3KCCA 4L0PA 5GLZA 4DQAA 1K3IA 4OZXA 1UU5A 2CL2A 4SLIA 1TVGA 1KD7A 1EV12 1XU2A 5ISLA 1GBGA 1DZTA 4YM1A 4CDQC 3E6DA 3GALA 3HD8B 5FPUA 4BQ3A 2C24A 5LZ6A 4NE9A 1OQEA 3B94A 3MGUA 4LJHA 3ZKYA 3LPGA 1RUF2 2BGPA 4CCMA 5CYYA 1JZ5A 1CAWB 2E7TA 1ENRA 2XUMA 1SFYA 5FOBB 3TWIA 5CBLA 4UW3A 1LOFA 1OXCA 1PIV2 5IJRA 2V4VA 1UXXX 4B1MA 4XFFA 3VD5A 4P9IA 1R083 2E26A 2BFUS 3ES1A 3LA2A 4FPCA 4JGYA 4RYDA 5A32A 1AYM2 2Z4FA 3HIFA 1TMF2 5LATA 2OPKA 1N47A 3VKOA 5BNPB 4PHZA 4HK8A 1UZYA 1EPZA 2GAUA 2I74A 2Q1MA 2VMHA 3K48A 3WXPA 4BXSV 2PAMA 5M0TA 2IUWA 2BBVA 1JYTA 2YV8A 5FY7A 2A3XA 2W1UA 4I3GA 3WNOA 4A7ZA 4Q4Y2 4S2GA 4A6SA 5C7GA 1XRUA 4K40A 2QQNA 4DINB 5I0DA 4CXYA 1ACCA 2C0ZA 1ZRIA 1C1LA 2N7GA 2MPFA 3DYPA 3UESA 1NCRC 2V5DA 5H9PA 1MZ6A 2BWCA 4N90A 3HR9A 3OGGA 3BTXA 2R073 1LU1A 1S0JA 2RDNA 3M3OA 1JODA 2PLV2 2ZXQA 1QJZA 3EXUA 3ZIWA 2Y6HA 2Y33A 5FYSA 1PZ7A 2D6PA 2WNVC 5J37A 4QXKA 2VQAA 2R30A 2NN8A 3N7KA 5IWFA 5CADA 1ZRFA 4CDXA 5D2AA 3RS6A 1GQPA 3U0ZA 1O5LA 5IUQA 5IYYA 1KRIA 3AZXA 4FAHA 2WWUA 1GWKA 3C7GA 1DQ2A 5JSPA 5A6ZA 4XUNA 4I3PA 1Q8QA 1UOBA 3NAPB 1RUD1 1TG7A 3ZLIA 3ZFEA 1SLTA 3SEEA 4YGDA 5FYVA 1AVBA 3WG1A 4LT5A 2HWC1 1IS3A 2VXJA 1D2SA 2ZKNA 3NKTA 5DXDA 4FOWA 1IKPA 3ZXEA 4DS0A 2DVAA 3SC7X 5C3RA 4WM7A 3OG2A 1CZVA 4BJ0A 4QWNA 2WAOA 1JHNA 1UZZA 4E4HA 1DG6A 2VQTA 2VOKA 2WFF1 3VZOA 1N3QA 2I2SA 2B9UA 3LE0A 2WNUB 3CEWA 3ZFFA 3AXDA 2P1BA 1RUE1 1WCQA 4UF0A 2W87A 5FK7A 1Z7S1 5FWEA 4DIQA 2W68A 1SG3A 3S30A 5ACA1 4BA6A 4NUBA 1S55A 3I59A 4ZU5A 5JR7B 4WZFA 1IQDC 1LCLA 1GWLA 3RI8A 4XVHA 4CP2A 5LY2A 2QNKA 4QM8A 4PDWA 5D21A 4AFDA 1APNA 2A6ZA 1MR5A 4IEYA 5AC91 4Z2AA 1RUI1 4YGEA 3GBFA 3N4MA 5DABA 3ENRA 3C3VA 3DV8A 4W8JA 3AYDA 1U0AA 3WG2A 4QDRA 1UYXA 3U78A 2PHFA 2Y6GA 1DCSA 1PNFA 2BP6A 2PHWA 2RMU3 2XJQA 4OLLA 4RFRB 3POGA 1F5JA 1VBE3 4QU1A 1UO9A 1W6PA 3THTA 2ZABA 2YBKA 1PO12 4ES8A 2W39A 4YVWB 1CJDA 5FZFA 3KMHA 2VH9A 1GNHA 4YZ2A 3T3YA 4Q4V2 3DKWA 2XVGA 4FXGB 1DYOA 1WCSA 4N53A 1YUDA 4B7KA 5FY5A 1DDLA 1NCQC 1U5ZA 3MYXA 4BLJA 5ANNA 4M01A 3CQOA 3BYWA 2UWCA 4A7YA 1KEXA 4A2UA 3O1SA 1HXS2 1W2TA 2VMEA 3UV9A 1MEC1 5A1LA 2XQRA 4GB32 5EXOA 3AZWA 4JGZA 1Q5OA 3FFQA 4KNCA 4QX7A 2DUPA 3K3NA 3W59A 3FX3A 5KC6A 4WM8A 3VBRC 2P6HA 4D6QA 2R061 4HPKA 4D6RA 3QH7A 3AMPA 4A6OA 2DF7A 1W9FA 2QUOA 2RS53 4N43B 1SQ4A 3POSA 4NJ4A 1AR83 4OQ8A 1FT9A 2QBXA 3A0NA 1V00A 2J1RA 4FFGA 3NMBA 3I49A 5FP4A 2AYHA 4XQDA 3UJQA 1I9RA 1OLRA 4Y22A 1VBD1 2PQSA 2Y26A 4CCLA 1MPXA 1W9SA 1ULDA 2JG8A 5J1XA 4CUCA 4CSWA 3A23A 2BU9A 4GWMA 3RZHA 1SDDB 1AYN1 1AL23 1UZ0A 5EP9A 1UIKA 1TME2 3AP4A 4IV3A 1QDCA 1JOPA 1HIXA 2JD9A 2WZPP 1RUJ3 2CAVA 4Q8LA 1US3A 3T2OA 3OBAA 3KGZA 5IVYA 3MUY1 4GIQA 1XC6A 4FPEA 3ZXDA 5APAA 2IFRA 5CB7A 4DO0A 1AJKA 4Z1VA 4YW4A 5DZEA 1FV2A 1QJU1 2WABA 3ZFGB 2QDNA 2DU1A 3T0BA 1K45A 4ES9A 4GMP1 5K0UA 1SFNA 3ZSMA 5CFDB 3I54A 1ZVFA 2YY1A 4K9SA 3LOBA 1N1SA 4LKSA 4QKNA 4QX2A 4CDUC 3OGVA 4C8DA 4FQZA 5FZ6A 3USUA 3AZYA 5BNOC 5T3NA 2CGOA 3IIAA 1POQA 2DUQA 4AE2A 3HT2A 3JBG3 1S2BA 1PMJX 3NSTA 3CJIA 5LA0A 3O7OA 5L7OC 2CDPA 4KWLA 3MLJA 2RS31 3M3IA 4NHYA 2JDZA 2A1XA 1PGL2 3ZYGA 1S0BA 4QDSA 1VBE1 1JYIA 4ONUA 1GFF2 3JQWA 4K3UA 4FBFA 5IT6A 1OLMA 1VAKA 2XUEA 4CCDA 4ZONA 5LK7B 2BQPA 1NYWA 4L92A 4RS5B 2RG4A 1R093 3S7EA 4BPZA 4RFT0 2GNDA 4RQPA 5GZEA 3T4VA 3T1MA 2PHUA 3SXWA 2WBKA 5FMCA 3SHRA 3VDDB 4XFBA 4FPJA 2MEV3 3VZMA 1VBC1 3CO2A 1PZ9A 1RB8G 1SZBA 2JKXA 1XE7A 3EMRA 4I30A 3N9MA 1SEFA 4OVEA 1O91A 4RGGA 4HVQA 1W9WA 3KT4A 2BERA 3PIGA 3RWKX 2NM1A 2QFEA 1COV3 4CDWB 2LTNA 5H9SA 1G7YA 5ABJC 3WCRA 2DBNA 5GKAC 4OQ9A 2HEWF 3DPRA 5FCCA 3WP4A 1J3QA 1BVP1 1BQPA 5A33A 1CAVA 5CKMA 1AR81 2AZ5A 2Y60A 2RS11 3POWA 4CEWB 2ZGQA 4JKMA 2VECA 4ISQA 2HWE3 3VDCA 1NXMA 4MXWA 4E2GA 2XJPA 5DUUA 3ACGA 4DOUA 5I91A 2OUHA 1C4RA 5A7WB 1CX4A 4HETA 1AL21 4DUXA 1RUD2 2CY6A 1CAXA 2YBPA 1RJ7A 3C8XA 3N9LA 3PL0A 2ZAHA 1UWWA 2HWC2 2YGLA 2ZGMA 4NAOA 5J96B 4P08A 1OF3A 4CUGA 2VZPA 3ACLA 2ORZA 2HWF1 3ZM8A 3JQXA 1UQXA 2QQMA 2ZHMA 2VR4A 2WFF2 2X5IC 1VRBA 1REFA 4BWOA 5BV6A 3O1UA 1RUE2 1QH6A 4YW3A 1Z7S2 4CPBA 2IZWA 2KD7A 4YW1A 5ACA2 3NNLA 5FPXA 4DZGA 1VE0A 1J84A 1MZ5A 1YQ2A 4N9HA 3ZDVA 4BHPA 3GZAA 5KXDA 5DUWA 5C71A 4EJRA 1XSRA 4BIOA 1MQTB 1OBNA 1BJQA 4XUPA 3W20A 1VR3A 3MPPG 4FI9A 2O14A 3WX5A 5AC92 3FWEA 1O4ZA 2YFUA 4XAEA 1M4WA 1URXA 2A7AA 2LM3A 1RUI2 1EYBA 2VUAA 4OCTA 2C9KA 4IGPA 1CAUB 1BBT3 2P3KA 2OZ6A 3A21A 3SCGA 4ZY9A 3SH3A 3VBUA 2C9AA 4MV2A 5FO7B 4AI1A 4EYUA 4ASLA 1D0GA 2NQYA 4LO6B 2PTMA 1H4GA 1YHFA 2BBAA 3KZ4C 1NQJA 2IVIB 5B4NA 4XXAA 3TBDA 2W95A 1VBA2 2PHXA 1LECA 2VM9A 3FLRA 4JRLA 5DZFA 1UL9A 2RVAA 3MIHA 3FHIB 3AMNA 3OY8B 4LO7A 3O1RA 5JPMB 2PFWA 2ZGPA 3SQOA 3VZKA 1W28A 2DCTA 4BQ5A 2IWGB 3OOXA 5FMOS 3UT0A 1X8MA 2NYYA 5T5JA 3OD0A 1RJ8A 4AYUA 3LEKA 3HN1A 4BK4A 2K46A 4EN0A 2BEOA 2BNNA 3OYWA 1WW7A 3PLQA 4LBMA 2QQVA 4AQ2A 5JUVA 5JOZA 4HKOA 4MVTA 2AGSA 1GYKA 1PMIA 2HWB3 5T52A
chains in the Genus database with same CATH topology
3WY6A 5C8CC 1W6QA 2KXLA 1MEC2 4P5HA 2HEYF 5CFCC 4RHV3 2R062 5AFEA 2B39A 3CL1A 1ZZ8A 3EBRA 4JDNA 3ZPYA 2HWE1 5DUXA 4AXOA 3EJKA 4QPGA 1LHWA 4C91A 3QLQA 1ASJ1 2D5HA 1WUVA 3LA7A 2CTVA 4HKLA 1VBD2 2XWBB 1RVF3 5J09A 1ONAA 3BOPA 1EY2A 3MZHA 1AYN2 2JG9B 4WVMA 1IHMA 4QM9A 1RUC1 2E53A 2PELA 1QOTA 2IXLA 2VVEA 5AVPA 1VAVA 2ZA9A 5L73A 1BZWA 1F8VA 5LK5A 2OA2A 4XTPA 5E16A 3TN93 4YLZA 1QJU2 3WW1A 4MUVA 5JSOA 1NQDA 1PVC1 1JOJA 2GC0A 2UY9A 5TSWA 5LEKA 2VW2A 2E9QA 3WP3A 1R1A1 1DFQA 3RI9A 5C4WA 3VHOA 4Q0SA 1U5XA 3OBRA 1G9FA 4NOTA 3VZNA 1DBNA 5GJ6A 3LA3A 3FFZA 2RS32 4RR3C 2GALA 2VOWA 1VBE2 1B35A 1PZ8A 4I0BA 2ZGLA 3RWNA 3JU9A 4K7JA 4JRAA 2PN5A 4JC1A 3ECQA 2EXHA 3ZSKA 1LULA 4JGYB 4YVWC 2BW8A 5A32B 5FOJB 2CGNA 3ELNA 3J4UH 1HV0A 2HWD1 4QPIA 3N36A 1MS5A 3ZYIB 1VBC2 2D6KA 4I2OA 1AXYA 5JZGC 1O4TA 2TNFA 2WA4A 1F31A 3NO8A 3N35A 4FOQA 3FZ3A 2OVUA 4JDOA 5K7PA 4RHV1 4CEYA 3MI8A 3JB4C 1U12A 2VMGA 1DQ0A 4Q4W3 1ZRDA 1D4VB 3AMHA 5DG1A 3UJOA 1WW5A 4JDMA 1QOSA 3LSDA 1E57A 1AR82 4KWJA 2RS12 3UKNA 2GU9A 4CDXB 3G7DA 5EFUA 4Q0QA 2WS93 4Q8KA 3D0JA 2D3PA 3H8UA 3E5UA 2BNMA 5D8AC 4QT6A 1MZFA 1PM7A 1WLTA 4FCAA 1PK6C 3RRDA 4B4RA 1AL22 5AFBA 2JKBA 2KM2A 4AW7A 4XETA 1PGW1 2ZX1A 3ILFA 4IV1C 3WW3A 3WDVA 5GLVA 1H2LA 2K0GA 5AVAA 2HWF2 4H7LA 3VKNA 1S0EA 3WDYA 3AMQA 2WQ4A 3MF9A 3ZFFB 4XF1A 2A71A 3UKVA 2ZHLA 1G86A 1YI9A 4MYEA 4AQTA 2OIIA 3WDWA 1J3RA 1XNBA 3VBHC 1POV1 3RQ0A 2AUYA 3WD5A 3ZVXA 4PDWB 2WZR3 1ZBA3 1V9U2 3U11A 1ZBE3 4XBQA 1ND2C 5T5PA 1QJY1 1WBFA 1A8MA 1NA1C 3HT1A 2GMMA 5JIUA 1RUG3 4YW2A 5JI7A 4YZ5A 3KGLA 5BNNB 3MICA 4LE3A 2UU8A 4ZKTB 4Q27A 4FOYA 1DGLA 1SLBA 3VZLA 3WHTA 1HRI2 1FYUA 3AKRA 3RNSA 4CDQA 3IWZA 1W6PB 5FLIA 5LEJA 3J8F3 4R8HA 1FXZA 1B09A 4FSJA 4MLOA 5HCFA 4CP1A 5KWRA 2D6LX 2E7QA 4N53B 3R6SA 3J26N 1HLCA 4PBPA 3RMXA 4E2QA 3MIGA 5DZGA 3DUIA 3JZVA 3RPQA 2GNMA 1LENA 2Q0AA 1VRH1 5IK5A 5FREA 4H14A 1SBFA 3ZIXA 1RHI1 1UX6A 3HQXA 1FX5A 4JGZB 4DMIA 1LRHA 2BVBA 3VBOC 5FO9B 1VBB2 4D7YA 4WM8B 4HPKB 1JTZX 4AHWA 1OOPB 2Q1ZB 2WS91 3L2YA 3NWKA 4E2SA 4H55A 4D7SA 3H7JA 1ZZ7A 1NCRA 4LHNA 4CEWC 1YIFA 5J36A 1DU3D 1UCXA 3HWJA 1ASJ2 3MEPA 4HZFA 4AFBA 2ZGOA 4AVVA 4Y22B 5DDJ1 2D6MA 2JG8B 2WNVA 2GZWA 1LR5A 3ALQA 3GBWA 4META 2XVLA 4G4FA 3POYA 4XIKA 1FOD1 1DYKA 1UKRA 1W0OA 1DIWA 2UWAA 1RUC2 1JUHA 3VBSC 1FMD1 2TEPA 3SMHA 3O0WA 4XHBA 4AGVA 3ZSJA 5BPXA 4HANA 2ZZQA 4AWDA 1AR62 2B5HA 1CPMA 4FPKA 4S2DA 2EXKA 2DFCA 4QPYA 1YIPA 5K0UB 1EP0A 1PVC2 2WZR1 3FJSA 2GDFA 4URTA 5J98B 5KHKA 2XLFA 4Z8BA 1R1A2 3USUB 3O5SA 1QQP1 1RUH1 4QQLA 2R32A 2ZX2A 1QJX3 1EPWA 4YVSC 3Q9OA 1HW5A 1DQ1A 1OD5A 3BOWA 4LBKA 1JYCA 3H0OA 4B7EA 5CA6A 2PA7A 1RIRA 4L99A 2O1QA 3WG4A 1FPN1 1NE6A 1LOEA 3M3QA 4XFHA 3LZZA 3H1YA 3WQ7A 2B42B 5E88A 2FQPA 1HX6A 2ZTNA 1MVQA 4RQPB 5K8SA 2XL7A 1KFXL 1AR93 4U2AA 2P37A 1S0GA 3VKLA 1C57A 2WSVA 3BB6A 4OULA 4PIYA 2HWD2 2Q4SA 3J9SA 1G6NA 3AZVA 1AR73 1XE8A 3WV6A 4OUMA 5GM0A 1MACA 2H0VA 4BMBA 1QY4A 2BUKA 4Z82A 5JIAA 4PF5A 1LEMA 4PIXA 5JI9A 4MGKE 1S1AA 5FPZA 5E8AA 2GNBA 1UU6A 2NPIA 1Y3TA 1KXGA 5JOWA 3QOPA 3FLPA 3ZMOA 1QXJA 1BYHA 1KS5A 1NCQA 3DPRB 2XHKA 4I0WB 3SNMA 4Q2FA 5A33B 1KJLA 1BK1A 1CAVB 1FI2A 1UU4A 3ZXKA 3ME2A 1D2QA 2AREA 3PHMA 4N7IA 4IETA 1HRV3 4MXWB 3SH5A 2GSYA 1FNYA 3ZSEA 2QDRA 1MS0A 3VBRA 4K8FA 1GANA 2BVVA 3ZO0B 4M3CE 3VV1A 1CAXB 3M3EA 4LUKA 2Z2SB 3JB8A 1PGW2 4UXAA 3O12A 3AJZA 2RM23 1FAYA 1LOCA 2JG9C 3KCYA 3ZXFA 2NLRA 2WSUA 3LGRA 4E9KA 2WC2A 3JD71 3L2HA 1MS8A 4E4ZA 1DF0A 4B8EA 3FUOA 2A73B 3EQEA 4HFSA 5JWPA 3NL1A 3TNPB 4IESA 1S0CA 4YM3A 4K1YA 4F83A 1BMV1 3T1LA 4M3CF 3AJYA 1EAH3 1V6MA 5KHHA 3V65A 1BEV3 3M8LA 3QD6A 1RITA 4QU2A 3M3CA 4LULA 1BKZA 3BU7A 1V6JA 1X36A 3H7YA 1ND3B 1TEIA 1QJY2 2ERFA 3AKSA 3LCPA 4CDUA 1CVNA 3VBUB 3WUDA 5BNOA 4W6WA 5J7MA 1RB8G 3IKWA 1UD1A 1OQ1A 4I01A 4P9JA 4QX5A 3C2UA 4OHZA 4HKWA 4AI8A 1R081 1W6NA 5L7OA 1UAIA 4Y20A 3URFA 2ATFA 4XF3A 4XQ4A 5JAXA 1YWKA 2E63A 4FPHA 4QHBA 2BNOA 2QJVA 4R9DA 3R4DB 2CAUA 4Y24A 3TNQA 2Q30A 1Z78A 3OYWB 4MH0E 4R4XA 1KQRA 4L8QA 1VRH2 3I4IA 3KLSA 2R071 1LGCA 1UIJA 1W6QB 2C1FA 1RHI2 1YCIA 1REEA 3ZYRA 5EWSA 3MIBA 3AP5A 3ZMNA 1N3PA 3G6JB 3I2DA 3O0XA 1H8TB 4LBJA 4P9GA 1JBCA 2DTWA 4QPGB 2IXKA 1Q43A 2JECA 5FQ0A 5ABJA 4Q1RA 2XLAA 3MFAA 1V6NA 5KHGA 1AZDA 5DDJ2 3WLUA 4DB5A 4NO4A 2XBO3 3KM5A 2RM21 1IQAA 4W6XA 1FOD2 4LO8A 4WVMB 2RR13 3AB0A 3B93A 1NLSA 1D0HA 2R6QA 4YNIA 1FMD2 1IS4A 1Y43B 3ZN6A 3VHRA 3IM0A 4HBNA 4EN9B 4JQRA 4YG3A 3NV2A 1Z0HA 4X8PA 4M00A 2YMZA 2WA3A 1BEV1 2X5IA 5BXXA 5C4WB 2BGCA 1G9DA 3ZSLA 1Q3EA 1QQP2 1RUH2 4AEDA 1I1EA 4A7KA 1PVXA 1LHOA 2DV9A 4AVTA 1IS6A 1CJPA 2ZACA 2R043 4N9IA 2RMU1 3RJ2X 1IS5A 2KA3A 1AXKA 2K2SA 4DPNA 2ZGKA 1CONA 5IK8A 2WT0A 1FPN2 1B35B 5BNNC 1C1FA 1W6MA 4AFAA 2H6CA 4BLIA 4WV8A 3V0BA 3RJRA 1ZREA 4NR1A 2YROA 4AQ6A 3ZXJA 4NWVA 1C8NA 4OHVA 2HKXA 2ZMLA 4QPIB 4YM2A 3CLPA 1H9WA 1NY71 1H2MA 3VHPA 3RSJA 4B4QA 2FBEA 4LLOA 2XPJA 4LE4A 1WBLA 4FO9A 1OI6A 4AVSA 4CEYB 2FMDA 1YFUA 2RS51 3UK9A 5F9TA 5JOXA 4IEQA 2IXHA 2NMOA 3OD4A 1PO23 4WM8C 5I8YA 2B8MA 1OOPC 5C8CA 4GH4C 5BNQA 1C8M3 3NKGA 2VPVA 4XBLA 5CFCA 1OFSA 3H3UA 2A6XA 2DURA 5T55A 2Y38A 3D8CA 3DGTA 2R0HA 2ZGNA 4GULA 1GLHA 1UKGA 5KHJA 2RR11 4AEJA 4BE3A 2D6OX 4BMEA 1RUJ1 5CAZA 1JUIA 5GLUA 1W2UA 1YXWA 4XZPA 4Q4X3 3NW4A 5C8WA 3FE5A 3PNAA 4D69A 1Q8OA 2TBVA 2ZKLA 3VBFC 3JD72 3DL3A 4COUA 2VW0A 1K5MC 2VNOA 1GNZA 2EAAA 3IDBB 1G9CA 1WLDA 1BMV2 1W0PA 4KBBA 2QCSB 4H7MA 2Z79A 4HK9A 1N1TA 4EWDA 2A3YA 4XJ8A 3JBG1 1KFUL 1WMFA 4YW5A 1V6LA 1QHDA 4YM0A 5BYNA 5F6KA 3AP9A 4K6BA 3KS7A 3ZYJB 3ILRA 4HMZA 2YHJA 4Y1VA 3WVJA 2ZMNA 2E7AA 1QOOA 1R091 2HEVF 1OA3A 4XMAA 1IKQA 4AHYA 5FO8B 1A78A 3D4KA 4CDQB 4KU7A 5I8SA 1R082 2A5ZA 2UYBA 2V5YA 3OCPA 2PHTA 4RR3A 2MEV1 3VLBB 1EV13 5A3LA 3H3ZA 1SCRA 1S0FA 2GC3A 5C9AC 5DUVA 5BNPC 5L36A 1OPOA 1RUF3 2QZ2A 2VU9A 2ET7A 3SISA 1COV1 1YRZA 2VXRA 4PCRA 2R072 4XMIA 1PIV3 2ZGRA 5CVRA 2BFUL 2ZX4A 3EO6A 3HMYA 4XTMA 1XNKA 3U10A 1ZX5A 3VGIA 2F6BA 1AYM3 1RL3A 3M1HA 2R1DA 5CU1A 5KXBA 5JZGA 2I45A 3WW2A 2OW4A 4K20A 3V0AA 4FP3A 1MZEA 1H8VA 1NCRB 4INDA 4Q4Y3 1DHKB 1Y9QA 2WNVB 1AF9A 2ES3A 3NAPC 4IERA 2VNGA 4QMAA 3R4UA 2DCYA 2PLV3 3AFKA 4YSFA 2JICA 1LOBA 3ZYPA 1QH7A 3ZX7A 5SV5A 1KDKA 1AXZA 5D8AA 5H9QA 1PK6A 2ZX0A 1O3TA 4H3WA 2WNEA 1DLLA 4JCKA 5L19A 2WNUC 4IV1A 1AX0A 4LHKA 3FBYA 1J58A 2XGXA 4IEUA 4FP2A 1Y7BA 2V09A 2VQ0A 1WCDJ 3AYEA 4U36A 1DZQA 2DVBA 2R49A 4GXLA 3TRSB 2D98A 2OYZA 1PGSA 2CWMA 5I0UA 3T2TA 1J1TA 1ENXA 3BCWA 4S2HA 4QQ2A 1GSLA 2X8KA 3N7LA 4X6QB 1BBT1 4UBHA 1FATA 2WFPA 4MX3A 1OFNA 3VL9A 3TAYA 1REDA 3NV4A 4KH9A 5D1IA 4COZA 1ND3C 2NMNA 2RMU2 3VBHA 1V70A 3WHUA 4D94A 4HN1A 2G9GA 1U5YA 3QBQA 3ZXGA 5B2GB 4Z07A 1WD4A 5T5LA 2XVKA 1ND2A 2PYTA 4V1PA 5T50A 3AKTA 3NV3A 1NA1A 4FPYA 3WG3A 4ITCA 4I0AA 5F1RA 2ZX3A 2EVXA 4AHZA 2DVFA 2ZBJA 2ARBA 1H4HA 1UMZA 3VN4A 3GYDA 3PJYA 1RUF1 5LRRA 4M3CA 1WA4A 2HWB1 2H6BA 4Y1ZA 5GZDA 3MF6A 1PIV1 1QNWA 3N7MA 3PVEA 1OMIA 2YXSA 1PO13 4EN6B 3WP5A 1V6OA 3SLIA 5E89A 4DXZA 2DVGA 1YYNA 2RS52 4Q4V3 1NCQB 1J1LA 4LUMA 5EYYA 2D3RA 1WMEA 3GNEA 4HLTA 4KGQA 4J1WA 5EZWA 1RINA 5H9RA 4N43C 3MW2A 5KC5A 1RVF1 2X53S 1H8TC 5JLVA 2WL1A 5E1RA 2ZJCA 3VBOA 1WMDA 3VBRB 1HXS3 3OGJA 3ZFEB 4LBLA 4GB33 2WT2A 4ZXKA 1ULGA 3SITA 4HL0A 1RUJ2 3P3PA 4RSUA 1ZYBA 1SBEA 3KB5A 4WM7B 2P34A 3O0VA 3GHNA 2EXIA 4ATEA 3OF1A 1TE1B 3TN91 5C33A 2D97A 4CYDA 3ZN5A 3I59B 5I93A 4KWKA 2H0BA 3VBSA 3ZFGC 3OJBA 1TME3 5CFDC 1SLIA 4AG4A 1C5IA 3JBG2 4EWEA 4Q26A 1CN1A 1XYPA 5DG2A 2PHDA 2ARXA 4MZUA 3WDUA 2WLQA 4FTBA 4AGRA 2RE9A 1ULEA 1N1VA 3AM2A 1LEDA 5GZFA 4LA2A 5CG9A 3WOGA 5F5QA 2WIIB 4GKXA 1O7FA 1R092 4EN8B 1RGSA 2XJVA 5JCTA 1LOGA 2QZ3A 1C28A 2QE3A 2D40A 4PBOA 4YVSA 2BYVE 1W6NB 4RS5C 2JD4A 1UN1A 1S2KA 2MEV2 2WLPA 5SV8A 4YGBA 4ZU7A 2A70A 1ZZ6A 4YZ4A 1Q8PA 3VDDC 3VKMA 4XFCA 3QACA 1W6OA 2ZZJA 4SBVA 5HXVA 2UURA 3R0RA 4AQSA 1COV2 2VMIA 1SACA 5JMCA 3B9IA 4S2FA 1H1IA 3BIWE 3ST7A 4Q4W1 3SH4A 3MW3A 4MGZE 1WGPA 5HBAA 4XFIA 1MS9A 4OFGA 4CDWC 1T6GC 1DGWA 2ZGTA 2P17A 2HWE2 1S0IA 2R1BA 1XYNA 3S7IA 4FOVA 2GNTA 3VKFC 1N1YA 4BH9A 1CIWA 1VP6A 1G8WA 5FQ0B 2X29A 2F4PA 2LALA 1DQ6A 3RYKA 4AF9A 4FVVA 4XE9A 2W08A 1XYOA 2GH8A 4M0NA 1MS3A 4IV3B 3ZDSA 1XNDA 1SLLA 4DRRA 4TYSA 3W9AA 1XQNA 3FMGA 4ISRA 4YG0A 5LRSA 2D93A 2B45X 5KBFA 1RUD3 4IXLA 2AENA 2ZPXA 3LOIA 4QGLA 1ZBA1 4AFCA 2YUEA 2HWC3 1ZBE1 3OPZA 2HJIA 1UW8A 1CGPA 5JSRA 1MQTC 4YFWA 1RUG1 4AEDB 1VB2A 4F3JA 3A4UA 1BBT2 3CJIB 3VZJA 4G3YC 2WFF3 2YZ4A 4ZU4A 1RUE3 1YFYA 1Z7S3 5ACA3 3J8F1 3N3HA 2UWBA 4Y4YA 3X29B 3I7DA 1A3KA 5HI0A 1W6MB 3V0BB 4C0HA 5EV7A 5AC93 4LHLA 4WBBA 1RUI3 3M2MA 2JE9A 3MIDA 4ORFA 4XDQA 2ILMA 2DCKA 4B29A 2XKOA 4C90A 1PGL1 1AJOA 3UKTA 2HWB2 2ETEA 1XU1A 1H30A 2EA7A 2P2KA 2A6WA 1O3QA 1SLCA 1F5FA 3B3QE 4AEKA 3B9CA 1UPIA 4JTNA 1WW4A 1VBA3 4RHV2 1TQ5A 5HCAA 3A0KA 5GLWA 5I0TA 3VUOA 4AI0A 5FMOL 5I8TA 5CG8A 2CV6A 3BTAA 1VALA 3INAA 2DWRA 3FBMA 1C3HA 3CNAA 1HDKA 5C8CB 3LSEA 4WVZA 3AX4A 1RVF2 5CFCB 1DQ4A 1NOVA 4N7UA 4WVWA 1IZ3A 1DGRN 2A3WA 1MEC3 4C1WA 4FXKB 2RHPA 3QCWA 4IEWA 3MPBA 2ZAAA 2I07B 2R063 2WQZC 4XJZA 2AR6A 4LBQA 3H1WA 4I02A 1U5IA 1GICA 2SBAA 2VOVA 3DF0A 2D6NA 4MXVA 3AMMA 3AP6A 1YFXA 3TN92 4XW3A 1VBD3 5J48A 1GZWA 3IPVA 2EAKA 1AYN3 2D43A 1QJX1 3D0SA 2Q8OA 4FT8A 4XYXA 4YGCA 3I8TA 1I3HA 1Q56A 1IPJA 2VNRA 2Q5TA 4YZ1A 2JXAA 3ASIA 5I0RA 4MGIE 3ILNA 3KT1A 4UW4A 2YGMA 1BXHA 3LKJA 1VLNA 1QJU3 4DNYA 3GZTB 4GMP3 3WDXA 3M4FA 4QQHA 1AR91 4KL1A 4YG6A 3KCXA 4XXPA 4AFMA 4BCUA 5JPNB 4NN0A 2R0FA 3MLLA 1LOFC 2XJRA 4RR3B 1VB4A 2BTVC 2VOXA 1AR71 3M70A 2DTYA 1GKBA 3NV1A 4JGYC 3IBMA 5BNNA 3VHNA 2RS33 1R1ZA 1WW6A 2PQQA 1C5HA 1LJ7A 1PNGA 2IXJA 1VBA1 2CNAA 2B46X 4L11A 1NXD1 4PLOA 4FTSA 1CPNA 3LWCA 4Q4W2 4EROA 4LBOA 2OZJA 2RJLA 3JUUA 3NJZA 4X6RB 2FHRA 1BVVA 3WT3A 4JVAA 1HV1A 1XXNA 2DU0A 4GKYA 1HRV1 2WS92 5JZGB 1ZZBA 3V0AB 1X7NA 1VBC3 4P14A 2G9FA 4XPVA 1LHVA 2MNGA 4AEMA 4CDXC 2GMEA 3BALA 5KXCA 3K51A 4C0BA 1O3SA 1H2NA 4OUSA 3SCFA 1LOAA 4Y1UA 3R4SA 3RYPA 4NVPA 2DCZA 1OOPA 1H0BA 2XB6C 3ZFEC 4GH4A 3PVNA 4AK3A 3PVOA 3CF6E 1DZRA 2RS13 3USSA 4NHLA 4WM7C 5D8AB 4E27A 4XOGA 1PK6B 2VG9A 1D4M3 4GWNA 4OI0A 1EAH1 4IV1B 1QXRA 1YLLA 2RJKA 3ZFFC 1GR3A 3ROUA 2XLGA 2P3IA 2D44A 2D3SA 3PJQA 2W0XA 2D5FA 3VBFA 2W52A 2WZR2 4Q0UA 1ZBA2 4XFGA 1ZBE2 1K5MA 1CESA 3WQ0A 4YARA 4PDWC 2DCJA 2HWF3 3TYJA 4MGYE 1RUG2 4BIFA 1HQNA 2YYOA 5BY5A 1OLQA 4NPRA 3VBHB 2QQPA 1ENSA 4O9EA 5FDBA 5FFOC 2WWSA 3J8F2 5F6LB 3D5OA 4XJ9A 3HAGA 1ND2B 5GZGA 5CIRA 1ZZCA 4C1XA 1X50A 4LBQD 1NA1B 1DQ5A 3H1MA 3RMYA 4KGGA 3SCHA 1V9U3 3QH6A 2YC0A 2WKKA