5CFDA

Crystal structure of dtt treated human cardiovirus safv-3
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
252
structure length
252
Chain Sequence
GVDNAEKGKVSDDNASTDFVAEPVKLPENQTRVSFFYDRSTLSSVLQSTSDVSSKFTPSTAKNLQNSILLTPLPSDIVNNSVLPEQERWISFASPTTQKPPYKTKQDWNFIMFSPFTYYKCDLEVTLSKNDRETISSVVRYVPCGAPSDLSDQTMPQTPSLADTRDPHMWVVGQGTTNQISFVIPYTSPLSVLPSVWFNGFSNFDNSSRFGVAPNADFGRLLLQGQGTFSVHYRYKKMRVFCPRPTVFIPWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Genome Release Mechanism of the Human Cardiovirus Saffold Virus 3.
pubmed doi rcsb
source organism Saffold virus
molecule tags Virus
molecule keywords VP1
total genus 45
structure length 252
sequence length 252
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5cfdA00
4NWWA 1V9U3 1ASJ3 1FOD2 1EAH3 4FSJA 5FMOL 1BMV1 1OOPB 1ZBA1 5L7OB 1PO23 1NY71 3ZFGB 1R083 4RQPC 4QPGB 1TMF2 2RS51 1K5MB 1H8TC 4Q4W1 1VBA3 1VBC1 1ZBA3 3VBRB 1MEC3 4Q4W3 2X5IC 1ND2A 1V9U1 3VBSA 4WM8B 1AR62 2RM21 2R071 3ZFGA 1RUI1 4JGZC 3VBOB 1AR93 1NCQC 5DDJ2 1AR81 3JD71 5A32A 1RUJ2 2WZR1 5CFDA 1NCRA 3HAGA 2R061 1PVC3 5C8CC 2HWF1 1W39A 1E57A 1QJX1 2R063 2GH8A 3VBSC 4AEDA 1PO13 1HXS1 4CEWC 1BEV2 1QQP1 5CFDB 2WLPA 1ND2C 2R073 1VRH2 4Q4X2 1X36A 1DDLA 1AR82 1RMU3 3VDDA 3J8F2 3J8F3 2HWE2 1R091 2DF7A 4CDXB 1M06G 4IV1C 3IDEA 3DPRB 3ZFFC 1RUF2 1SMVA 4AEDC 1PIV3 1QQP3 1MEC2 1VBC2 4N43B 2WS93 5C4WC 1HXS3 1BEV1 4YVSA 5BNNB 1AR83 1POV0 1EAH1 1RUG3 1AYM3 1C8NA 1AR61 5C8CA 4IV3B 3VBFC 4RR3A 1RUC3 1R093 3J8F1 2WZR3 2WFF1 4CDUC 1VBC3 1VBA1 3VDDC 4RQPA 1H8TA 5K0UB 5JZGB 2RS31 2RS13 1HRV2 3JBG3 2HWB2 1PGW2 4Q4Y2 1OOPC 5L7OC 1AR63 1TMF3 1QQP2 1VRH1 3S6PA 2TBVA 1ZBE2 5ACA1 1NA1A 1QJZA 1ZBA2 1VBA2 1CD3G 4Z92B 1H8TB 4PDWC 5BNOC 1AR91 2HWC1 1ASJ2 1TMF1 1BBT1 1RMU2 1RVF2 4JGZA 1AL21 5ABJB 4Q4X3 1COV3 1COV2 1PVC1 1F2NA 1PO22 1F8VA 1MEC1 2R043 4NWVA 1QJU3 1RUF1 1B35B 1RUH3 4QPIB 4JGYB 1FOD1 1A6CA 1R081 1TME1 4GH4C 1FPN3 2BPA2 1RUG2 4N43A 4IV1A 2RR11 1Z7S1 1ASJ1 2RMU2 1B35A 3LOBA 4CDWB 1NOVA 1X33A 3ZFEC 4WM7C 4RR3B 3VBHC 1AYN3 5C9AA 3JD73 1VBE1 4QPGA 4Q4W2 4SBVA 4RFT0 1R1A2 5ABJA 2RM22 5BNPA 3VBRA 1RUC2 1NG0A 1PGW1 4Q4V1 1TME2 1FPN1 2HWE1 1C8M3 4AEDB 2PLV1 3JD72 3VBUC 5BNNC 2IZWA 1QJX2 1BBT2 3TN91 1PO21 1VBE2 1WCDJ 2MEV3 2RS12 4Q4X1 1R1A1 1D4M1 4YVWA 2HWC3 4Y4YA 5JZGA 4JGZB 1ND3C 1NCQB 1FMD2 5LK7B 4GMP3 1VBD1 4RS5A 5A33B 5K0UC 4CEWA 3TN92 1R092 4GB33 1AUYA 1RVF3 3JB8A 3VBOA 2BFUS 1AYM2 2RMU3 2MEV2 1D4M2 1ND3A 5CFDC 3CJIB 5D8AB 4RS5B 5A33A 1EAH2 4N53A 4GMP1 4QPIA 4CDQC 1QJY2 2HWB3 4Q4V3 2WFF2 1HRV3 4WM8A 1EV13 4IV3A 1RUH2 1HRI3 4QPIC 4CDQA 4JGYC 4CDXC 3NAPC 4N53C 3CJIA 1HRV1 5D8AA 3ZFFB 1VBE3 1RHI1 2XBO3 5ACA3 1NA1B 2ZTNA 5DDJ1 4Q4Y1 4RHV2 5FMOS 1HX6A 1CJDA 2XPJA 2PLV3 1ZBE3 2R062 1RUD3 5J98B 1TME3 1FMD1 1PGL2 2BBVA 1RMU1 3JBG2 4YVSB 5BNNA 1PVC2 3TN93 2HWC2 4CDUB 4EJRA 5AC92 1MQTC 5FOJB 3VDDB 1VBD2 4CEYB 2HWF2 2HWD1 2ZAHA 4YVWB 2WFF3 1FMD3 1AYN1 5BNPC 5CFCC 1COV1 3DPRA 2VQ0A 5JZGC 1AL0G 4GH4A 5AC93 1RUE1 1RUG1 3NAPA 3VBUB 2MEV1 2WS91 3ZFEA 1R082 4RQPB 2GSYA 1AR72 1AR73 1OHFA 2RM23 2WWSA 2ZZQA 1HQNA 1EV11 1FOD3 2RR12 3VBRC 1RUF3 3VBUA 2R041 5ABJC 5GKAC 1VBB2 2RS53 4PDWA 5BNOA 5CFCA 1RHI2 3VBOC 1NCRC 4RHV1 5DDJ3 5K0UA 1BMV2 1QJU1 1QJY3 1PO11 2FZ1A 1FPN2 4Y5Z0 3M8LA 1PGL1 1RB8G 1RUC1 1RUD1 4GH4B 5C9AC 2PLV2 5AC91 2BFUL 1QJX3 4LLFA 3VBSB 3JBG1 2RS11 3ZFEB 2HWB1 3CJIC 5D8AC 4WM7B 2XBO2 1RUI2 2HWD2 4CDQB 4GB32 1OPOA 4RHV3 1VB4A 1R1A3 2RS33 1QJU2 1AR92 4JGYA 4BCUA 2BUKA 1RVF1 1AL22 3DPRC 1ZBE1 4GMP0 1AR71 1NA1C 4FTEA 1NCQA 3ZFGC 1HXS2 2XBO1 4QPGC 1VAKA 4CDWA 1AL23 3VBFB 3VBHA 1K5MC 1D4M3 4Q4Y3 1AYM1 4YVSC 1Z7S3 1VBD3 1MQTB 2X5IB 1QJY1 2WZR2 1RUJ1 4CEYC 1RHI3 4WM8C 3ZFFA 1PIV1 4YVWC 1ND3B 5BNPB 1HRI2 5CFCB 1RUD2 2RR13 1Z7S2 2RMU1 5C8CB 1RUH1 4FTSA 4CDXA 1GFF2 4GB31 1BBT3 4CDUA 1POV1 4CEWB 1NY72 2Y26A 4RS5C 1RUJ3 4PDWB 5BNOB 2WS92 1C8M2 1ND2B 1PIV2 3VBFA 3ZXAC 4Q4V2 2RS52 5C4WA 1HRI1 3FBMA 2HWF3 2RS32 1NCRB 1B35C 3NAPB 1V9U2 1BEV3 4IV1B 4N53B 1AYN2 1RUE2 2HWD3 1OOPA 5L7OA 1POV3 1RUI3 1VRH3 4CEYA 2R072 4N43C 5C4WB 5C9AB 4WM7A 1VB2A 1PO12 1C8M1 1K5MA 5J96B 4IV3C 4CDWC 4FTBA 5ACA2 2QQPA 4RR3C 3VBHB 1VBB1 2HWE3 2R042 2FZ2A 1MQTA 1EV12 2X5IA 1VBB3 5A32B 3JB4C 1IHMA 1RUE3
chains in the Genus database with same CATH superfamily
5C5TA 5I0RA 1ASJ3 2QQWA 2YBKA 4J6GA 1EAH3 4YM0A 2E33A 5FMOL 1F9KA 1YQ8A 2ZMLA 3LPGA 3UGGA 1OOPB 1QXJA 1NY71 1R083 1QWRA 4RQPC 5A3MA 1NX9A 4QPGB 1CAWB 5H9RA 4CSWA 3U78A 3CF6E 2EXIA 5IFTA 3D6EA 2FCTA 4HK9A 2RS51 4ASLA 1K5MB 3M3CA 1VBC1 5F5QA 3NSTA 4NAMA 1MEC3 3AKQA 4HG6B 5AFEA 4A3ZA 4DXTA 3O1TA 4LMFA 2DDUA 3EO6A 2Y0OA 3S7IA 3VBSA 3UGHA 1Y3TA 1UIKA 2R071 1RUI1 3BOWA 4TLFA 2VCCA 3VBOB 2F6BA 1NCQC 4CP0A 1BCXA 3N36A 5GLZA 2WZR1 1MVEA 3K4AA 5FK8A 1O5LA 3HAGA 3VZJA 3WW2A 1TNFA 4ES9A 5F3GA 5LATA 4HN0A 5G05L 3H3LA 1QJX1 4YZ2A 3MI8A 5FY4A 4Q8KA 5FTTC 3AMPA 1UPIA 4NHLA 1W6PA 3GHNA 2VCMA 4YW2A 4GJZA 3U10A 2R063 4R4XA 1AF9A 2Z79A 3POIA 3THCA 2XB6C 3K46A 4XVHA 1U5IA 4CEWC 1O8PA 1DQ1A 3Q8EA 3ZSLA 5A6QA 3VZMA 1W0NA 1WKYA 3ZX7A 2WLPA 3WG3A 1WW7A 4MGTA 1ND2C 3ZN6A 1VRH2 5JXHA 3JU9A 1UMZA 1V6JA 2BV4A 4OFGA 3WQBA 3IN9A 2B8MA 2JXAA 3R0RA 4TTGA 4KMQA 3J8F3 1VMJA 1ZM1A 2HWE2 1LOFC 4K21A 4UOJA 5EYXA 1JBCA 1M06G 4IV1C 1W9WA 2BZDA 3H1MA 4C0BA 5A3LA 2VMIA 4EV0A 4QXKA 1GNYA 1ULDA 2YC0A 5FYUA 1NZCA 3LFMA 3OGSA 4URTA 1SLCA 2D6MA 5J37A 4P14A 1QQP3 4CU6A 5FO9B 1GNHA 5APAA 4YVSA 4R9DA 2ADDA 1GV9A 2B7YA 1EAH1 3INAA 4AFMA 2QZ3A 2W95A 1RUG3 4LHLA 4N7IA 3KVBA 4AFBA 2YU2A 4YZ3A 1MS4A 4ATFA 5LEKA 5JSPA 4LIVA 3LDBA 4XZPA 1RUC3 2Q8CA 2G9FA 2Y64A 4LKEA 2ZHKA 3BODA 4WVMB 4IGPA 5IK5A 1SBDA 3KCXA 1A8DA 1GP5A 1VBA1 4INDA 5F2SA 3NKGA 4PI2A 2Q30A 4KH9A 4CCLA 5FYHA 3MPPG 4RN5A 3VDAA 5DMYA 1GNZA 1M4WA 4EQVA 2O0OA 3L9JT 5HV0A 3GCXA 4Z1VA 3FX3A 3PU3A 1JTZX 4YARA 2ZEXA 2GDFA 4MGIE 4BQYA 2RS31 3LIGA 4DXRA 5FUIA 3JBG3 2VY0A 3T2PA 4MGQA 5L7OC 1AR63 2R30A 3OYWA 2XR4A 3RMXA 3VDBA 1W05A 2TBVA 1D0GA 2P2KA 3KT1A 1LGNA 4L92A 1HB4A 3FMGA 3I3EA 1ULGA 3RSJA 3AVRA 3GZAA 3S5QA 1ZBA2 3WINE 5ACA1 1L7QA 3IPVB 1P8JA 4JAAA 1Y9GA 3LQCA 1KS4A 4YGBA 1DIWA 2XLFA 2CGNA 2QQJA 2QBXA 2GU9A 2HWC1 3AP5A 3B7MA 4I0AA 5FZ6A 3JQXA 4OQ9A 2SLIA 3ZM8A 2VZ1A 4XFFA 4RGKA 1YO8A 1BZWA 3VKNA 3T2QA 1LHUA 2VQUA 3OCPA 2KM2A 5IVYA 4E4DX 3I3MA 3QACA 1MEC1 1VE0A 3U4SA 1QJU3 3KGZA 1DHKB 5C3SA 3AKPA 3GALA 3CIHA 1A6CA 1W6QA 4HT1T 3NNGA 4B4QA 1XSQA 4XC9A 4B29A 1R081 5FZ4A 2QQOA 3UNPA 5L19A 1TME1 1XBFA 1O6UA 3SKVA 2IVJA 3IDAA 4MGKE 4PQ9A 1OF4A 2E9QA 4LOTA 1Z7S1 2RMU2 4BQ2A 4WVZA 5SV8A 4N9HA 2W39A 1RL3A 1NOVA 1H30A 1R1ZA 4XDQA 3IAQA 3EXUA 4MXVA 2F4PA 2AACA 2WNVB 3EMRA 3MIFA 3T0DA 4H7LA 3FHQA 5C9AA 4TLGA 4IEWA 5FZ8A 3JD73 1VBE1 3J4UH 1XXNA 1POQA 1X8MA 2EIEA 1NT0A 2UYAA 2XVGA 4N9IA 4SBVA 1V00A 4F7ZA 5LY1A 1UY1A 2WSVA 3DKWA 4GKYA 3I2GA 3QD6A 3F2ZA 3TYJA 1HDKA 2HJIA 3HNMA 4XXAA 3J9SA 2J1RA 3IDBB 1RUC2 1SLAA 3E6DA 3ILNA 3WF3A 3WW3A 4DY3A 2LTNA 2GC1A 1FPN1 1CAUA 2HWE1 2VW0A 4AI0A 4LE3A 3BU7A 1W04A 3AL6A 4P5HA 2VZ3A 1VRBA 2C4XA 3OD4A 2A6VA 2C0ZA 3JD72 2GC0A 5JIUA 1JZ3A 3AYDA 1GQHA 4HZFA 3TRSB 3M7AA 4R9AA 5FYYA 3B69A 2VU9A 1F35A 4PJYA 1YUDA 3CO2A 3N7KA 5FZ7A 1T2XA 2YU1A 5FP7A 2BERA 3GDBA 1WLCA 3WDYA 5FLIA 1R1A1 4UAPA 4NO4A 1KDKA 4R9BA 1MACA 3M3QA 4URAA 4P9JA 1CAWA 2GAUA 4G9SB 5FYMA 3NWKA 1O4ZA 4MXWB 3AL5A 5E16A 4ORFA 5LK7B 4ARXA 3MW4A 4GMP3 5B4XA 1W06A 2C1FA 3AKTA 5FKCA 2L9LA 3K51A 1C4RA 2JDKA 4YRDA 2VOXA 4QWNA 3LEKA 3TN92 2UURA 4RD7A 5ISLA 4K1ZA 1HQLA 3H1YA 3JB8A 3KZ4C 3N9MA 3VBOA 3LB9A 4TWTA 3KLSA 1Q8QA 4LHKA 3ITQA 3LD8A 4EYUA 3KGLA 1A8MA 3GXUA 4J1XA 2EIGA 4COUA 1LOCA 5IVCA 4HKLA 2XH6A 3OEAA 3OOXA 2ZACA 3AZVA 3LF7A 3OD0A 2QQNA 4QPIA 3JZVA 1W9TA 2FMYA 3K4DA 4P5YA 4UYBA 1GZ9A 4XF0A 4AGGA 4DEVA 5IVBA 3W58A 1RUH2 3J7HA 5FIXA 3ZN5A 3UKVA 2D6KA 3OPZA 3NAPC 3SNMA 5KXDA 1HRV1 2XDVA 3ZFFB 3ZXFA 4DXSA 3VD5A 3PVBB 4LA3A 4OUSA 4GALA 2VOKA 1UCXA 1NA1B 1WMFA 2CAVA 3FWEA 3EQEA 4J25A 4YW7A 3RFRA 5CG8A 1GZTA 4UFLA 4Q4Y1 4BQXA 1VIWB 5A7WB 1CJDA 2HKXA 2XPJA 1ZBE3 5FV3A 3GM8A 1DU3D 2C9KA 1PZ8A 4K3UA 2D3SA 4OULA 2ZX0A 3NJZA 4FO9A 3KSCA 3PMEA 4FOYA 1E5SA 2PMWB 3AXEA 2ZS6B 4NPRA 3T08A 5LZ6A 1PGL2 2HYXA 3E5UA 3ZXDA 3H42B 3ETPA 2WNEA 3BGAA 4CCEA 2J1EA 1C3HA 3RVHA 4CCJA 2QQLA 1PVXA 2HWF2 1YIFA 3N35A 3KB5A 2WFF3 5GLUA 1OLQA 1NXMA 3OGRA 1SBEA 1COV1 3DPRA 1XU1A 3Q8FA 4QDRA 3WW4A 5BUVA 1PGSA 2DV9A 2PXJA 2YC2A 3S7EA 4E4SA 5AC93 1YI9A 3BTZA 1H2MA 1PX4A 3BTXA 1CPNA 1S0FA 5BYNA 5JPNB 3PVNA 2AREA 4YG3A 4CU7A 5BPXA 4MO3M 5CU1A 5LB6A 3I2OA 3I59B 2X29A 4RQPB 1ZRDA 4BIOA 3MF6A 1I3HA 2ZX1A 2JICA 5FAXA 3HVDA 2JD9A 2RM23 1U5YA 2ZZQA 1GWKA 1GR3A 5H9QA 3MO4A 1H6XA 1NQDA 2NN8A 4CA9A 2E7TA 1BK1A 1MS5A 4IE5A 2ILMA 4QM8A 2BU9A 1OA2A 1W2TA 2CNAA 1Q5OA 1I6XA 2ZHMA 4R8HA 2RS53 5GKAC 5BY5A 3H1WA 3WQ0A 3JXSA 1RHI2 4IW3A 1AX1A 4QMAA 2X05A 1K5JA 1UQXA 3ZYPA 2D3PA 2WYFA 4U2AA 3SEEA 1TNRA 2Y6KA 5GZEA 1BMV2 1RIRA 2JKBA 1PO11 2FZ1A 1FPN2 2XJPA 1Y7BA 3M8LA 4XJWA 1RUC1 2H0VA 3GYDA 1WBFA 3KT4A 5GLWA 2AUYA 5FY5A 2BFUL 5JMOA 1LU2A 2IVIB 2P17A 2QZ2A 3ZFEB 2EXHA 1H1MA 2HWB1 3PIJA 1SPPB 4K1YA 4TSVA 5D8AC 4COZA 2JJ6A 5CG9A 1W2AX 2FCUA 2XBO2 4KG0A 5J3UA 4AOCA 5EZWA 5FQ0B 5FYBA 4CCCA 3DECA 1ODMA 3P6BA 1F4AA 2WRAA 4Q1PA 4RHV3 1CN1A 4ASKA 1BHGA 1J1TA 1R1A3 5DZGA 4FCAA 4DNYA 3AJYA 3VHOA 4BCUA 1VJ2A 2W08A 3UT0A 2UWAA 5LEJA 3TEXA 2ATFA 1DLLA 1O3TA 3GZEA 4GWJA 4QDQA 3U07A 5LA2A 1PM4A 3N7MA 3E1F1 4FTEA 5JIAA 1CX1A 3WNOA 5CZKA 4YZ5A 2WNUC 1NCQA 1ZRIA 1ZZ9A 2VO5A 2P37A 3B9IA 4C90A 2GNBA 2VMGA 5EXOA 4AI1A 3NVCA 2DCZA 5HCAA 1VAKA 1FX5A 4YWAA 5JOXA 3VBFB 4YZ4A 2RV9A 1W90A 5E1RA 1JZ2A 3B3QE 4KBZA 5K8SA 2E7AA 1N1VA 3F95A 2D6OX 2P1BA 2G4IA 3PUHA 2WA3A 1STMA 5T5LA 1D2QA 1QJY1 4CEYC 4GAZA 1RHI3 4A2UA 1PIV1 4YVWC 1JYNA 5DAXA 1EPWA 2NM1A 1W28A 3G6JB 5EYYA 2R1BA 4OZOA 3NJXA 4ONUA 1FT9A 2Q8DA 3T2OA 3C7OA 4IEVA 1LOGA 1QDOA 4P9WA 3ZDVA 2VBPA 5FXVA 1XYOA 1YXWA 3ATGA 5KXEA 2CTVA 2W91A 3AM2A 1JOPA 2PAKA 5I8SA 2LUWA 4DINB 4AHZA 3AZYA 1J59A 3R05A 3M3IA 2DVFA 4WVVA 1BBT3 3OSDA 1IS6A 1GZWB 1EUTA 1POV1 1W03A 2FQPA 2VQTA 4LNVA 3RS6A 4CEWB 4CU8A 5A1LA 3K4ZA 2JDZA 1QU0A 4Z07A 4RS5C 3MZHA 1J83A 2G19A 2WS92 1C8M2 4KNCA 2V4VA 2UYBA 3NV3A 3SLIA 3VBFA 4K20A 1OH4A 3UL2A 1QXRA 3BUCA 4MHUA 5C4WA 4FI9A 2WN3A 3HD8B 3VZNA 5HBAA 2JG8B 3ZPOA 5FZFA 1WA4A 4IETA 1REEA 3O1VA 2HWF3 1ULOA 1NCRB 4NR1A 4RGAA 3GGLA 1BEV3 3SXWA 4XUQA 4ES8A 3I4IA 1XNBA 4FFIA 3UYJA 3NNMA 4AL9A 1JYWA 1REFA 5J09A 2JDPA 2P6CA 1AXYA 1UOGA 4FOWA 3GCWA 4CEYA 1JYVA 2R072 3CBNA 2V5DA 3WG1A 4XXPA 1S2KA 4R52A 2VMFA 3DGTA 5FXZA 1REDA 1S0BA 3H3UA 1V6NA 1C8M1 2D6PA 4JRLA 4LKSA 5J96B 3C3VA 1HKDA 4LBMA 3AYAA 3ZN6B 5JI9A 5ANQA 2WKKA 3DL3A 4IDZA 3NRUA 3IIAA 4YM1A 3VD9A 3PLQA 3J7MA 1K45A 3H9AA 4FAHA 4JQRA 1KGYA 3AX4A 4CXYA 1K12A 2R042 4UW5A 3BKZA 1UU6A 2X5IA 3LSEA 2ARCA 2VZOA 2VMDA 1PNGA 3VL8A 4CCDA 2VZUA 4TYSA 1IHMA 1QJFA 4FQ4A 4ISQA 1XU2A 3T4HB 2CL2A 2VNRA 4LORA 4OVEA 5FYCA 4NWWA 1YQCA 3NJYA 1FXZA 1V9U3 1R64A 3BIEA 4FPJA 4FSJA 1CJPA 1MS9A 4FPHA 3UKTA 1G9FA 4LUKA 4XQ4A 1A34A 2VUCA 4AWDA 2IC1A 2WZEA 5LRSA 1PO23 4XOGA 3LEMA 4FXGB 3SMHA 1X8EA 4EN7B 3POGA 3V0BB 1S1AA 4D7YA 3URFA 3ZYRA 4LBQB 2BGCA 2A75A 1US3A 2PQQA 1UIJA 1LOBA 5CISA 5A7OA 5FWEA 1W8TA 1VBA3 3DEMA 2JG9C 5LRRA 3POWA 4HVOA 4XJ9A 4XFIA 5HXMA 4FFFA 1F15A 4BB3A 4Q4W3 1UPSA 2RG4A 3PTRB 4XJ8A 1IOAA 5A1FA 5H9PA 1GOHA 3MW2A 4LJHA 1SQ4A 1H4GA 4XPVA 1IQAA 4JGZC 4L99A 1AR93 2VVEA 3NO8A 1UW8A 3IT8A 5DDJ2 1AR81 3JD71 1YNAA 2R16A 5CFDA 2WSUA 1NCRA 3ETQA 5J48A 2UWBA 2DUOA 1PVC3 2R061 2BNMA 2RHPA 3ZYBA 2HWF1 5IFPA 3K77A 4HKWA 2E6VA 5A80A 1AX0A 4W6WA 4B4RA 3IMMA 3WNXA 1PX3A 2VULA 3SCGA 2GH8A 1UOJA 2YROA 1F31A 3D8CA 2QQMA 3VBSC 4AEDA 3THDA 1NQJA 2JDAA 2N7GA 4MVTA 1UMHA 2A6WA 4F83A 1WW5A 3PUAA 4AQ6A 4CCOA 5CFDB 2HYKA 4ZY9A 3WG4A 2I74A 5F6KA 3PUSA 3MGUA 4XTPA 2UWCA 4A7KA 1DDLA 2XUMA 1AR82 1RMU3 1N1YA 4Y1ZA 3AB0A 5A1AA 2VAUA 1WCSA 3W5MA 4Q0SA 1W0PA 4QPWA 1R091 4QHOA 3TWIA 4CDXB 1BJQA 3VDCA 4QHZA 3DPRB 3ZYIB 5FZ9A 3CEWA 4CUAA 2DFBA 4AEDC 1X7NA 2K2SA 3MLJA 1HXS3 5C4WC 3BIWE 3CU7A 1AR83 3CLPA 5FY8A 2BOIA 4XJZA 5FZEA 4ASMB 2E26A 3O1MA 3UGFA 1SDDB 2D3RA 3WNMA 2X09A 4QQOA 4Y26A 2LS6A 4AXOA 2KXLA 4IV3B 4B1LA 3VBFC 3VUOA 2OYZA 4QD2A 2A3WA 2GNTA 4HMZA 1BVVA 3U37A 2ZEZA 3DXUA 2CYFA 2WZR3 3IZOA 4CDUC 1Q8SA 1Q8OA 3P5BA 2D6NA 2VBBA 2E7QA 2D6LX 2BNOA 4AE2A 1LHOA 1OLMA 1DQ4A 1XE0A 5KR7A 2WO7A 4DUVA 5FOBB 2OPKA 2VE1A 3ME2A 4RQPA 4DFSA 1LEDA 2BP6A 5K0UB 1UY4A 2B4KA 2VZSA 3ILFA 5JZGB 3BVCA 4KGQA 5FY7A 3AP4A 2NMNA 4MYEA 4Q4Y2 4DQAA 5IHRA 1SBFA 2JDMA 4MV2A 2ZX4A 2W5FA 5GALA 1LB2A 3NV1A 3HPNA 4JKMA 2ARBA 4AVVA 2H0BA 1W8UA 2JIGA 1VBA2 3LCPA 1N1SA 1SLIA 5CKQA 4DO0A 5IK7A 4AZZA 1XE7A 2CWSA 3H50A 2C9AA 3I3BA 4UXAA 3DYMA 1H9PA 4XJAA 3DYPA 3ZYHA 4TXWA 5FFOC 1RMU2 3RDIA 3WR0A 1RVF2 2VPVA 5C3RA 1AL21 3Q8BA 4OCTA 4GWNA 1COV2 4M4RA 2QCSB 1PO22 2VH9A 4W6YA 3KD4A 1JS9A 5EP9A 3USUB 1MR5A 2FD8A 3AZXA 2R043 3N9NA 4NHXA 1Q56A 5FZDA 1DQ0A 1RUF1 2QQVA 4CPBD 2GNDA 3PUIA 2W1SA 3ZXEA 2QDRA 5FPXA 1KEXA 5A6ZA 3RZHA 1GWMA 4TN7A 3ES1A 3WF0A 3G7DA 4NE9A 3OPTA 4DY5A 1WLTA 5FYTA 2XJVA 1KD7A 2BJSA 4YG0A 2TUNA 4GH4C 2BPA2 4HLTA 1RUG2 2VTXJ 5IVFA 1BKZA 2VOVA 4N43A 5C7GA 2RR11 4YPJA 1B35A 2FDJA 5JCTA 4X8PA 1ZZ6A 1X33A 4B8EA 3WT3A 4XMAA 3OB8A 4WM7C 4JTNA 3ECQA 3H7JA 1ULPA 4ZU4A 2BEOA 3AMMA 4KU8A 4UFMA 3IWZA 5A3WA 3TAYA 2VZPA 3C7HA 3NQHA 3HQXA 4Q4W2 3O0XA 2B5HA 4AEMA 4FVVA 2VCAA 1G6NA 1R1A2 4A7YA 1CZTA 4D7SA 2C5DA 4XUNA 1GYKA 5BNPA 5I93A 1NG0A 1DYOA 4Q4V1 1WLDA 3P3PA 2XLAA 3KF5A 2DFCA 1C8M3 3QCWA 4OQ8A 5FY9A 5IJRA 2GP3A 2OUHA 2ES3A 3VD4A 3AYCA 1ZZ7A 3FLPA 1OQEA 2E31A 3A4UA 4IE7A 1BBT2 2A1XA 3TN91 1I9RA 1YEWA 1WMEA 4E2QA 2W1UA 2ZKLA 2FDGA 3Q8AA 1JYCA 4YFWA 2BDRA 3JQWA 2PHDA 2YXSA 3IPVA 1VALA 3K75B 2PAMA 4O65A 3OY8B 1F5FA 5D1IA 1J3QA 1LECA 2H6BA 3FUOA 1NCQB 1FMD2 4KL1A 2G9ZA 4AFAA 5FQ0A 3BCWA 1WLWA 4HETA 3GJBA 2A71A 2WZ8A 3VHPA 5K0UC 2QNKA 2BYVE 4GB33 5FPBA 1AUYA 1SACA 5E88A 1DZTA 1UKRA 2WO3A 1LODA 3I59A 3POFA 4XILA 3U1XA 4B3NA 4QKBA 4XIKA 4F3JA 2Q0AA 2JENA 1JHJA 2VTFA 4BQ5A 3TBDA 4QX0A 1AYM2 1S0IA 4ZONA 2UY8A 3SISA 3U14A 2VVDA 1UXZA 4NMIA 1XRUA 1L3JA 3OBRA 2W68A 3SH5A 4LBNA 1G86A 2ZHLA 3CJIB 4Y1XA 5I0UA 1A3KA 4P9LA 4RS5B 5A33A 4TZDA 1EAH2 4IERA 5LA0A 4GMP1 2VCBA 2G1MA 4BMEA 4LO4B 4XMIA 1QJEA 1XNDA 2HWB3 1UX6A 3JUUA 4G4FA 1N3OA 2WFF2 1HRV3 3KHBA 3WNKA 2JG8C 4C1XA 3OGGA 1RGSA 4XJUA 5IAXA 2XVKA 1K3IA 1DFQA 4CDQA 4JGYC 3WHUA 4HN1A 2PA7A 3FLTA 5D8AA 3NW4A 1VBE3 2BGOA 1RHI1 1BXHA 2XBO3 4FP3A 3T0AA 2JKXA 1Q3EA 2ZTNA 3NL1A 4IGOA 4CUBA 4XETA 2WFPA 4A45A 5DDJ1 5BXXA 5JSRA 1OA4A 1W8OA 4RHV2 3NNJA 2R6QA 2OKXA 2PHLA 5JOZA 1BK0A 4RA0A 3J7NA 4P00B 4COYA 4DOUA 1VMFA 4Q8LA 2XGXA 4QM9A 5DAWA 3ROUA 3SCHA 2VG9A 1TME3 1FMD1 1VR3A 4HPKB 3HNBM 1CVNA 5F3EA 1KRIA 1W2OA 1GOFA 1I5ZA 2A7AA 2DCKA 2R49A 4JDNA 1UY2A 5BNNA 4CDUB 3ZR5A 4NIHA 3BPSA 1MQTC 2DVAA 4YGEA 4FPLA 4AQTA 5FOJB 1XSRA 1XC6A 4HXCA 3A7QA 4CEYB 2HWD1 1MZFA 2ZAHA 2ZZJA 3FHIB 5H9SA 1LAJA 3W9AA 1FMD3 4K9SA 2VUDA 4LTAA 5FZAA 1MPXA 2LROA 1MVQA 4RFRB 3WEZA 2BBAA 2CSGA 2VXRA 5CFCC 3UJOA 2VQ0A 1WW4A 5JZGC 1QHDA 2P3JA 4GH4A 4Z8BA 1OVSA 1LR5A 1RUG1 3NAPA 3VBUB 2XONA 2YG0A 2WT0A 2MEV1 3HJRA 1UXXX 3VKFC 1S0GA 4NJ4A 5GZFA 1D2SA 4LQRA 5F8PA 4CUGA 3B02A 1R082 1W8HA 4PF5A 1OLME 1NE4A 1C5IA 1YFYA 4LBJA 4Z2AA 3TNPB 3AYEA 2VOWA 3C7GA 5DABA 5DUXA 2DTYA 1HQNA 1EV11 3VBRC 4E8CA 1RUF3 1U12A 2W92A 3I3DA 5DN2A 1W9SA 1DYKA 4MSVA 1ZRFA 2ETEA 2PQSA 4L0PA 4A44A 4Q29A 5A7NA 4AQ2A 3TEZA 5FO8B 3ON7A 3VHRA 3QBQA 4JDMA 3RZMA 3A22A 4V2WA 5GLVA 3VBOC 1GQPA 5C6CA 3WHTA 5FZMA 1KXGA 4CE8A 4QGNA 1XNAA 4XHXA 4OUEA 5T5PA 5A3UA 1YFXA 1QJU1 4BWOA 3WLUA 1UAIA 1NAEA 3S0MA 3AKSA 3MUY1 2Y6GA 4YW5A 4EZHA 4EWEA 4N7UA 1H0BA 1OBNA 2ADEA 2NYYA 2VZTA 1BVP1 4JVAA 1IS3A 1LKNA 1WCUA 4Y1UA 2YZ4A 1IPJA 4UW4A 3RNSA 3VZLA 3MV01 5CAZA 5CKMA 4OHZA 2XL7A 1N3PA 2EAKA 5C3PA 4UWDA 3HT1A 4C8DA 2VECA 1RUI2 3NNFA 4K7JA 4AFCA 4CDQB 5GZCA 4GB32 1HJFA 1JW6A 1OPOA 3PURA 3WY6A 3MLLA 4OHVA 1H8VA 1XYNA 4P9XA 2BW8A 5L9RA 3VHNA 2RS33 3NMBA 4X6QB 2GH2A 1W6MA 3AC0A 4LE4A 5EJ3A 5ANNA 1ZVFA 5FZKA 5FPZA 1AL22 1I1EA 4AHXA 4GMP0 4MGZE 2OW4A 4O9GA 5LW9A 1MS1A 4AF9A 3PVEA 4XUOA 4XF9A 3BOPA 4WVMA 4LO7A 4O9EA 4AVSA 1QXPA 2FMDA 1JUIA 1W6MB 1A78A 1CAUB 3VZOA 4AGRA 2K9ZA 1FI2A 2P3KA 4Q4Y3 1W2NA 1AYM1 3POBA 4YVSC 3PJYA 1DQ5A 5JSOA 3KT7A 2GC2A 2KA3A 2VR4A 2WZR2 4LITA 1ND3B 5CEHA 2YUEA 2EAAA 3ORJA 4A6SA 4O61A 1D7PM 5BNPB 4PLMA 3RMYA 2YBPA 3BYWA 4JKLA 5A7PA 1ZRRA 4D7TA 5EJZB 1W8NA 2RR13 4QGLA 4RYDA 5C8CB 5FZOA 1RUH1 2ZJCA 3B5LB 4IQPA 4Q2FA 3UKNA 4QKFA 4EN8B 4Y22B 3ZYGA 5SV5A 2Z5WA 1GU3A 1DGRA 2D5HA 5FZ0A 5LBCA 5KC5A 2O8QA 4PQQA 3KS7A 3HQRA 1O4TA 4OLLA 3ZXGA 2K46A 3M1HA 1CAVB 4CDUA 2VC9A 5FMDA 2IXHA 1L7LA 1ULCA 1NY72 4BZ4A 4LBKA 4MHRA 1DBNA 2FCVA 2Y26A 4PIYA 1JU4A 1LGBA 1RUJ3 2WNVA 3UETA 4DUXA 2WT2A 1ULEA 1S0EA 3I97A 4NRQA 1ZYBA 1TZOA 2R7EB 3GZUC 4E27A 4S2HA 4L8QA 3WP4A 1DQ6A 3I54A 3OF1A 3WG2A 4BQ4A 3GZTB 2E32A 2ZGUA 1FATA 2E51A 2RS32 4DEQA 3WDUA 1KJRA 1V9U2 2BVVA 2V5YA 3CZJA 1LCLA 2HLEA 2V73A 4IV1B 2ZGMA 4N53B 5FP8A 3ZYFA 4ZU7A 4NAOA 1VPHA 3RYPA 4U36A 4DB5A 3POJA 1OOPA 2F17A 1POV3 1RUI3 4E4ZA 5A6YA 3RI8A 1NLSA 1IKQA 2XQRA 3OBAA 3OJBA 4XDPA 5DAQA 3FUQA 3RQ0A 4FPEA 4COVA 5F7UA 5IW0A 4SLIA 4XBNA 4FAGA 1K5MA 4AHYA 3POYA 1IPSA 5HCHA 4E8DA 1O7FA 4CDWC 4FTBA 1FNZA 5HV4A 2DCYA 1OQDA 2Y60A 3GF6A 5ACA2 1EYBA 2QUOA 2WNVC 3RJ2X 3N9PA 4UFKA 3WVJA 1H4HA 1WD4A 5GZDA 2QQPA 3KWVA 1X50A 1HB2A 4XFGA 3K2OA 1QMJA 3BPZA 3O0WA 3V65A 1WW6A 4L11A 2HWE3 1RJ8A 4OHWA 1KJLA 3SEPA 4A42A 5DUWA 3A0KA 1VBB3 3JB4C 1UZWA 1UWWA 2PN5A 2VZVA 1CESA 3KV6A 4IGQA 2D40A 4L2NA 4CP1A 4XCBA 4QU2A 1BMV1 2Y8KA 2FDKA 2WNUB 3MIHA 1ZBA1 4QB2A 2OVUA 2WAOA 5L7OB 4HK8A 3ZSMA 1OUSA 2QKDA 3MIBA 3ZFGB 4HVQA 1KS5A 2MNGA 2P3YA 2GP5A 3MIEA 4ZU5A 3MHZA 2JDUA 1IS4A 3I2IA 1OXCA 3SITA 3FFZA 1UOFA 1E5RA 3UK9A 2CDOA 4C91A 1Y9MA 4PCRA 1ZBA3 3VBRB 4AW7A 1NUKA 2XOMA 4AVTA 1JZ5A 2ZPXA 2X5IC 5DQ0A 5GM0A 1KFUL 1V9U1 2CY6A 4NRMA 4OYUA 4WM8B 1AR62 2WT1A 2RDNA 3I8TA 1JHNA 2X10A 3H7YA 1RUJ2 4DRVA 5A32A 4XACA 2VJXA 2PFWA 4BISA 1ALYA 4JV4A 2RJLA 1G9CA 1W39A 4YW3A 1E57A 3THPA 4FTSA 4NHYA 4OHYA 5JR2A 4I30A 2GZWA 5FZGA 3VN4A 2GNMA 2A6XA 2X8KA 3V0AA 2XLGA 2VL4A 1U0AA 4LHSA 3UJQA 5K9YA 1BEV2 1UX7A 1Q8VA 2VM9A 2GALA 2JDNA 3KF3A 4LK6A 4LBQA 4P02B 4QQHA 5KXBA 1GSLA 5JPMB 2R073 5KWRA 1ZNPA 4ZKTB 5JMCA 1LHWA 1JOBA 3ABZA 4AAPA 3LIHA 4PIZA 4MG2A 1WMDA 1LU1A 2K0GA 1OKQA 5EFUA 1E5IA 4NIGA 2BWCA 1EP0A 3J8F2 2W52A 2DF7A 2RJ2A 4PF1A 3TOJA 5I0TA 1O91A 4YSFA 1FYUA 2Q8OA 4LO6B 3U75A 2EIBA 4OI2A 5IK4A 3HMYA 4PLOA 4WBBA 1BYHA 1RUF2 1AX2A 2YMZA 4XBLA 4A4AA 3RRDA 2HEYF 1VBC2 2WS93 5FP3A 2WQ4A 1KFXL 4I3PA 1BEV1 2Y6FA 2OQ6A 5BNNB 1LJ7A 5EIYB 4I2OA 1K42A 1CR7A 2XVLA 3AKRA 3CQOA 5FYIA 4FPOB 1AYM3 3DF0A 4QB6A 2I45A 4H14A 4FFHA 4NIIA 1AR61 1PK6C 5FJHA 3MLKA 1YC61 4RR3A 4XW3A 1J3PA 1H2KA 1R093 3PIGA 3ZO0B 3J8F1 2WABA 4A7ZA 1JZ8A 3H8RA 3PHMA 4A41A 4LOSA 3RYRA 3BU0A 4JQTA 4QDSA 4PI0A 4BXFA 1KITA 2WINB 3MEPA 5FDBA 2OQ7A 3V56A 1H8TA 3LDRA 1DCSA 3ZMNA 5JWPA 4GXLA 3VGIA 2A6YA 4MZUA 5E6HA 5AVPA 2JG8A 1TQ5A 5T3NA 3GHMA 5FWJA 1OOPC 2JWPA 2WA4A 3MBWA 1QQP2 4QX3A 2BGPA 3S6PA 4UFJA 4AI8A 1ZRCA 3VD7A 1JODA 1OPMA 1QJZA 4BIFA 3T3YA 2B46X 4Z92B 1H8TB 4QKNA 4BMBA 5A3OA 4PDWC 5BNOC 2HEVF 4LBLA 2P5BA 4GWMA 3ZIXA 1ASJ2 4RSUA 2DU0A 4NROA 3AFKA 2IXIA 1J58A 1X9TA 4UBGA 4AVCA 4AVBA 1ZZ8A 3VB9A 1V6MA 1F2NA 4E9KA 3WQ1A 3RG0A 1F8VA 2IXJA 3E6BA 4NWVA 4Q1RA 1B35B 1OUXA 1V6KA 4MUVA 1E5HA 4XURA 1U5ZA 2CHHA 3LA3A 2XMLA 2DCJA 5FYSA 2RDQA 3WCRA 4GZ9A 5C70A 1W2UA 4A3XA 3LWCA 1U5XA 2A6ZA 3ENRA 5EQUA 2PHUA 1OURA 1FPN3 1UU4A 2XHKA 4XYXA 5T54A 3WCSA 4IV1A 1OMIA 5EWSA 3ZXJA 5KHIA 4XIOA 1ASJ1 4Y1VA 5FZBA 1DLCA 3LOBA 5A7QA 5FPUA 2YGLA 3LPFA 1H9WA 2JX9A 4DUWA 5IUQA 1XQNA 4IESA 2Q1ZB 1W6OA 4RR3B 3VBHC 4HSJA 1AYN3 3V64A 2BRTA 4DS0A 1HV1A 4FPYA 1QOOA 3P1IA 1JMUB 3BALA 2OXBA 3MW3A 4WZCA 2QE3A 1QOSA 5KHGA 2RM22 3HN3A 1RJ7A 3KMHA 4ATEA 2FDFA 1SLBA 3VBRA 3N9OA 4D94A 5IATA 4E4HA 5IYYA 1W3VA 1TME2 3OGJA 5JAXA 4ZHNA 4OI4A 3ZKYA 1PZ7A 2GN3A 2J1UA 2PTMA 4UF0B 4D6QA 3ZKUA 2IFRA 2Y6JA 3IBMA 2QJVA 4H2AA 3KCCA 1ZX5A 1IS5A 3FE5A 3VBUC 3I2DA 2XJSA 1S4CA 2IZWA 2Y0IA 1XB9A 3CJXA 2UY9A 2Q1MA 2AC1A 5L73A 5IK8A 1PO21 3IM0A 1LHNA 2Y34A 1VBE2 1NLQA 1W8WA 4QGMA 4QQPA 2RS12 4Q4X1 4IXLA 3T1MA 5FZ3A 5JI7A 3AMQA 1OSGA 1XNTA 4AQSA 1W6PB 4JRAA 1D4M1 4P08A 4YVWA 1SLLA 1NKGA 5T50A 3V0BA 3AK0A 3LA7A 4CZSA 2WQZC 3QLQA 1SG3A 5DUUA 3K48A 4YFZA 5JZGA 2ZKNA 4MGSA 1ND3C 1X82A 2PHTA 3CDZB 1W8ZA 2AEYA 2IFWA 2V09A 2EIDA 3ELNA 1H2NA 1QY4A 4YZ1A 2PYTA 3W59A 3O14A 4CEWA 2IXKA 5F5IA 1QIQA 1UU5A 5DZFA 1W6QB 3HIFA 1YJKA 3D3AA 2QQUA 2YY1A 1JU3A 1HN0A 1HJGA 4KQ7A 5HCBA 4KG8A 1GUIA 3DYOA 5DG1A 2BFUS 3CMGA 4X8NA 3O1PA 1TVGA 3ILRA 4E2SA 5DPNA 1QH7A 1WWYA 2VZRA 1UF2C 4EE2A 1D4M2 4KWKA 2WAAA 5CFDC 4ZS2A 3DCQA 5D21A 3U0ZA 4N53A 2XJQA 3ZOIA 3HBKA 3H8UA 3PMSA 4CRQA 1EV13 1DGLA 1UY0A 2YFUA 3POSA 4IV3A 2ZGKA 1OQ1A 2AR6A 2CAUA 2VQAA 3R4SA 4K8RB 4LEJA 4QAWA 3WF1A 5JDBA 1HRI3 4PT6A 4QPIC 5JXIA 1WBLA 4HONA 4WVWA 3MIGA 4M3CE 1T6BX 1O3RA 2DYCA 2D5FA 4R9CA 1IKPA 5J7MA 4XE9A 2XHNA 4IEOA 4W8JA 4XABA 4NPLA 2D93A 3LKJA 5IVEA 5FKBA 1UNBA 1HX6A 4Y5SA 2F4LA 4PBOA 3E5XA 3I2FA 2PLV3 1MS3A 4NHKA 4Y22A 3HQUA 1HLCA 5IVJA 3APBA 5J98B 5C3OA 4PLNA 3O1RA 3RZLA 2YGMA 3ZDSA 1AHSA 4R4ZA 1RMU1 4V2VA 5LA1A 3AMHA 5I0SA 3C2UA 2ZGRA 2PHFA 2Z4FA 3ES4A 1GZWA 1PVC2 1UO9A 2WNOA 3TN93 4DRRA 1LOEA 5AC92 4Y4RA 3U4XA 3LDKA 2VXJA 3N9LA 4JX0A 3WUDA 3WUCA 3KCYA 4YVWB 4W50A 1C1FA 3N4MA 2QQKA 4QXHA 4BQ1A 5BNPC 2AENA 4W65A 5ERLA 1AJOA 4IUGA 3J7LA 3CKHA 2D43A 2VW2A 4YGCA 2QTWB 1LNSA 2GMMA 1UOBA 1J84A 3CNAA 2J7MA 3IIIA 1B09A 4AR2A 1G8WA 1C57A 1QOTA 1ONAA 2ZCWA 3OEBA 1PZ9A 3WW1A 4EN0A 3RYKA 3R4DB 5FREA 3KV9A 4I0WB 3ZXLA 1DZRA 2GSYA 5FPAA 5TSWA 4QXCA 1AR73 2WWSA 3ZXKA 4BA6A 2YB7A 2JG9B 1AVBA 2NP0A 3P3NA 5CB7A 1FOD3 4FT8A 4XF4A 4YGDA 3AVSA 3EB7A 1PK6A 2OIIA 3VBUA 2R041 5T55A 4D8MA 1HW5A 3WXPA 3W5NA 2WO1A 5CFCA 1NCRC 4I0BA 2DBIA 4RHV1 5C8WA 5E8AA 2ERFA 5KBFA 2ORXA 3V0AB 5K0UA 4AFDA 1W6NA 2ARAA 4Y33A 2WLQA 3WQ7A 3D0JA 4Y5Z0 5JXJA 1VAVA 2OZ6A 1W8FA 1RB8G 1HB1A 1RUD1 4C0HA 3PNAA 5C9AC 4PIXA 1Y43B 3KV4A 5FP9A 5F9TA 1QF3A 1QJX3 1AXKA 4QX5A 3VBSB 4E2GA 3JBG1 4LO8A 5F2WA 5KHHA 5LK5A 3WSOA 1Z78A 2RS11 1L7RA 1WMXA 2FDHA 1N3QA 3CJIC 3NJVA 5IAVA 5F5AA 3WP3A 1V70A 4WM7B 5KHJA 1C1LA 2FBEA 3BB6A 2IWGB 5I8TA 2GN7A 2HWD2 1IQDC 3MIDA 2BVBA 4LA2A 3RWKX 2RJKA 5FZHA 3OBTA 1OF3A 1VB4A 3SCFA 3RI9A 1O5UA 2ZGQA 3RZGA 3LGRA 2WBKA 2B9UA 3RZZA 1QJU2 5FZLA 1AR92 1S0JA 2ZABA 4GKXA 4XUPA 1JUHA 1JI6A 1QNYA 4JGYA 3T4VA 4DPNA 5FZOB 4KU7A 3B00A 4QHBA 2BUKA 3DPRC 1YRZA 1ZBE1 1TEIA 1NA1C 1UY3A 3AFGA 3ZMOA 1CAXA 1N47A 1XPWA 3T0BA 1C5HA 1HB3A 2OS2A 2R0HA 3ZFGC 1C28A 3S30A 1HXS2 3VV1A 2DVDA 2XBO1 4AYUA 4LT5A 3E6CC 5FP4A 1AL23 3M2MA 3VBHA 2DBNA 1K5MC 1ZZBA 2NMOA 3LEIA 4XF1A 4ZZ5A 3FFQA 4LLOA 4B1MA 5A3TA 2ZGNA 1Z7S3 1GLHA 1VBD3 1YFWA 4AI9A 1AZDA 1MQTB 1DF0A 1S0DA 2X53S 5FBZA 2WN2A 5BV6A 2X5IB 1J3RA 1YIPA 4Y24A 4DIQA 4WM8C 1JOJA 1CZVA 1UKGA 2LM3A 2VGDA 4HVRA 3O1OA 5CA6A 3FC0A 1CPMA 4YM3A 4QX1A 1HRI2 5CFCB 1GWLA 4S2GA 3VD3A 4B7KA 1RUD2 5GZGA 5HXVA 1Z7S2 2RE9A 2RMU1 2NZ9A 3ZVXA 4AK3A 2A73B 5CADA 2BBVA 1JXNA 2NQYA 3OGVA 5FYZA 4CDXA 4EZ4A 1GFF2 1Y4WA 2GMEA 4YG6A 1H2LA 2DUQA 1CAXB 2P4EA 4GB31 2QVSB 3O1UA 1YFUA 4C1WA 4RL7A 2W47A 4I3GA 3JCIA 1W0OA 3C8XA 4JC1A 4Y20B 5M0TA 4AHWA 3OUJA 4ITCA 3O5SA 2PAEA 4FPKA 4OZXA 1ND2B 2WC2A 4UT5A 3ZSEA 5FY1A 1YQ2A 3ZXAC 4K8FA 1RYYA 4Q4V2 1ZA4A 1GOGA 4CU9A 3OUIA 1PMHX 5JOYA 2AYHA 3FHAA 3GBGA 2Y38A 2XWJB 4NHMA 4WZFA 4GULA 3SC7X 3WNNA 3WDWA 3MFAA 2ET1A 5EHDA 3NAPB 3IB3A 5DUVA 4XTMA 2ARXA 3N7JA 1O3QA 2NLRA 3CL1A 2XXZA 1RUE2 3IKWA 2HEWF 2HWD3 2VW1A 4FOQA 4LXLA 1VRH3 3CHXA 3RZKA 3FLRA 2XWBB 3MFCA 2Y33A 2J1SA 1PHMA 2VZQA 4N43C 3WNPA 3LSDA 4CXWA 2KR2A 1LRHA 1YLLA 2O1QA 2ZEYA 3GJAA 4Y5TA 4QQLA 4MADA 1WCKA 3HBZA 5C33A 1PK6B 4NOTA 4IV3C 3WNLA 5FJKA 4HSLA 1ENXA 4MGYE 4UFIA 4Y1YA 1LESA 1CX4A 1H1AA 2XL9A 5K4LA 1QGLA 3WP5A 4AVAA 2GMPA 4IE0A 2GC3A 2W1WA 2Q1FA 2ZA9A 1YJLA 2FZ2A 2HBUA 2JDHA 1EV12 5T5OA 4BE3A 1EY2A 3FJSA 3PL0A 1WD3A 3H8OA 1GANA 2FDIA 1SFPA 2LRPA 5KC6A 1FOD2 2WWJA 2B45X 1G7YA 2MPFA 2W0XA 2BOJA 5F3IA 3S57A 5C5UA 1OD5A 4QX7A 4Z82A 4ZS3A 2W2IA 3B9CA 1G9AA 1TMF2 4AGVA 2I2SA 3OPWA 3TB0A 4Q4W1 1H8TC 3LOIA 4HPKA 2QFEA 1S0CA 4KWUA 4XFAA 1W9FA 3ACGA 1SFNA 3AP6A 2YFZA 1JZ4A 2JECA 5I0DA 4IL7A 1ND2A 4NPMA 5J36A 5FLJA 2RM21 2J1VA 3ZFGA 2Q4SA 3DUIA 5GJ6A 2DVBA 2ZAAA 3I2KA 2G9GA 4XAEA 4OI0A 4UW3A 5FZCA 1ENQA 4LR4A 5A7SA 4LO5B 3VZKA 4M3CF 1KDMA 1UZ0A 3L2HA 4Q0PA 5CNAA 5JVVA 2J22A 3THTA 2W3JA 4B4PA 4LKDA 4Z2WA 5C8CC 1F5JA 5LCWL 4Q5OA 5LBEA 1RUOA 1XOYA 4AG4A 4GJYA 4ZXEA 4P9YA 1O3SA 4M3CB 2VTXA 5F32A 4V1PA 3A21A 4XFCA 1PO13 4KGGA 1HXS1 4FPCA 4ZPIA 2NPIA 1XYPA 3LA2A 1QQP1 1H1IA 3WF4A 2W87A 4MXWA 4IEYA 2Q5TA 1DGRN 3LZZA 3WD5A 4YYOA 1PNFA 1GP4A 4NIDA 4QU1A 2VUAA 4Q4X2 1X36A 2XQXA 3POEA 3D4KA 2DWRA 1XJAA 3VDDA 5C71A 3TEYA 3RPQA 3AJZA 1V6LA 5F5CA 5BNQA 4B7EA 1O4YA 1T6GC 2VUJA 5A7WA 3IDEA 3NV4A 1OA3A 4Q0UA 2WIIB 3J26N 3OG2A 3ZFFC 3ALQA 5D2AA 3AZWA 1SMVA 2V72A 5F39A 3VKOA 1PIV3 2XG3A 1MEC2 4OMDA 4N43B 1UL9A 3B93A 4HOOA 1US2A 4JTOA 1POV0 1QEXA 5DXDA 1CIYA 2B42B 2OT7A 3KVAA 3D5OA 4CVUA 1FNYA 3SH4A 4I09A 1C8NA 4M0HA 5A3NA 5L9BA 5C8CA 3T1LA 1SCRA 3RWNA 5IWFA 5J1XA 5A6XA 2BQPA 4D6SA 4PHZA 1PM7A 3DV8A 4LHNA 2ZGPA 5FLHA 5FMCA 2WFF1 5LY2A 3USSA 3BTYA 1SDWA 1VBC3 4XQDA 2PELA 4XFBA 1NZIA 2PHXA 1IZ3A 3M3OA 3VDDC 2ENRA 1HN1A 2A3YA 2OA2A 3ZYJB 1VLNA 4EWDA 1CZSA 4K6BA 3ZN4A 2EXJA 4YLZA 5LBFA 5FO7B 3AXDA 2C6SA 2BWAA 4OMCA 2RS13 4Q26A 1D0HA 1HRV2 4BQWA 2KD7A 4QX8A 1GICA 1LTEA 2HWB2 1PGW2 2WL1A 4H55A 3NKTA 5G04L 3HWJA 1EPZA 2CWMA 3HN1A 2WWUA 1TMF3 1OT5A 2RDSA 1VRH1 3ACLA 3MV11 1TE1B 1ST8A 2W1QA 2ZX2A 4CP9A 2JB8A 1ZBE2 3MF9A 1NA1A 1OKOA 3RZJA 4AEKA 1WUVA 1CD3G 3TEWA 2PHWA 3N9QA 5FYVA 4W4ZA 1AR91 2DTWA 4P9GA 1TMF1 5EJ1B 1BBT1 1OFNA 4IEXA 4BU2A 4PBPA 2RDRA 4DXZA 1JN2P 4JGZA 3D0SA 1YWKA 5ABJB 4Q4X3 1COV3 3BN6A 1PVC1 4LUMA 3ZSJA 4BDVB 3ZPYA 4JHTA 2WUHA 4BPZA 2WYSA 4KWJA 1UMIA 1DP0A 1RUH3 4QPIB 5C3QA 4JGYB 1N1TA 1FOD1 5FPVA 3M70A 2ZOEB 4IE4A 3M3EA 4BH9A 3FL7A 3N3HA 4FP2A 2VMCA 5F37A 4COWA 5F6LB 3UV9A 3PVOA 4YW1A 4X6RB 4BK5A 4OUMA 4UFHA 3KHCA 3O12A 1YI7A 2VNGA 3W20A 2YPDA 3Q9OA 5CBLA 3MYXA 2D44A 1O59A 2OZJA 1XE8A 2JIJA 4CDWB 2IXLA 2YYOA 2TNFA 3ZFEC 5JOWA 4QX2A 5FY0A 1I5PA 3O7OA 3UESA 1CIWA 3OY8A 3WZ1A 4A6OA 3I3QA 4MX3A 5DZEA 4H3WA 1GZCA 4QPGA 3WX5A 2C24A 2A70A 5K7PA 4FQZA 2OUJA 1WGPA 4S2DA 4KWLA 4RFT0 1UD1A 4D0QA 5ABJA 2AEZA 3EJKA 1UYXA 4FFGA 5IT6A 3WDXA 4LPLA 1OD3A 1ZZCA 2VMEA 4META 3VKMA 4D3WA 1PGW1 5AFBA 3PUQA 3C7FA 2O14A 1YCIA 4NUBA 3QH6A 2DURA 4AEDB 2P6HA 3T09A 2ZMNA 4HL0A 4CTEA 1VAMA 3S5AA 1ACCA 3SKJE 2DCTA 2PLV1 5L9VA 1BLZA 2DU1A 3HNYM 4ZZ8A 5BNNC 1QJX2 4ARYA 2R32A 4DMIA 2Z69A 1SFYA 3WOGA 2JE7A 1SEFA 3OTFA 1YQ5A 2E63A 2LW8A 3SHRA 4IEPA 4EWAA 1OH3A 2WQ8A 4CP9B 2YDEA 1GBGA 1JYIA 4XFHA 1IGOA 3SQOA 1WCDJ 2MEV3 3IDCB 1RXGA 4H7MA 5A3PA 2IXCA 3E5QA 1FV2A 4JKKA 3BI3A 2AGSA 2BNNA 4BJ0A 1JYTA 4UBHA 3O0VA 2HWC3 4LBQD 3A23A 1QKQA 4OHXA 1LOAA 1ENSA 4Y4YA 4JGZB 2WO2A 1W99A 4N90A 2SBAA 1UN1A 5HCFA 1VBD1 5LA9A 3OYWB 5CIRA 1W3XA 4RS5A 4BLJA 5A33B 2YPJA 1KQRA 1OC1A 2H6CA 3QOPA 4LULA 1R092 2UU8A 3FBYA 1RTVA 1RVF3 1ZREA 2QDNA 1OVPA 1DZQA 5LBBA 2ZXQA 4MH0E 1RINA 3VLBB 3ZIWA 1LENA 4XBQA 4FPFA 2CGPA 2RMU3 3AP7A 2JB4A 1MS8A 2MEV2 4QPYA 2Y6HA 1ND3A 2J42A 4YNIA 1JZ7A 5D8AB 4P9IA 4UI9L 3DN7A 3FN9A 1GMMA 3LFIA 2VBDA 4IEUA 1AXZA 1QJY2 4CDQC 4Q0VA 1PMIA 1IPKA 1W6OB 3C7EA 3DKQA 4Q4V3 4WM8A 1QDCA 1SPPA 4FXKB 5EV7A 5FMBA 5HPOA 2P34A 2OX0A 3GBFA 4M01A 3SH3A 2EA7A 3AP9A 4CDXC 3PDQA 5EPAA 4UW6A 1MS0A 2ZHNA 2YC4A 1Z0HA 2ZGTA 2W46A 4MLOA 4N53C 3CJIA 2VOTA 4YW6A 3KM5A 2EXKA 4CXXA 4BQ3A 2J1TA 5ACA3 3KQRA 5CKNA 1SZBA 1UYYA 3VKLA 1NYWA 4UF0A 1IG0A 4OI1A 2XJUA 5JR7B 4KBBA 4K40A 1URXA 4M3CA 5FMOS 1X9PA 4FBFA 5I91A 2HBTA 3E97A 2R062 1RUD3 2R0FA 4JZRA 1HV0A 4CCKA 3KV5A 2VVFA 1IG3A 4CUCA 2Z2SB 4EROA 5JXGA 1WA6X 3JBG2 4CCMA 3WV6A 4YVSB 4YW4A 3HT2A 1NE6A 1S2BA 2HWC2 3U11A 4EJRA 2J1AA 1NXD1 3OBZA 3VDDB 1OI6A 1VBD2 1BQPA 2ZMKA 4Y3OA 5LWBA 3D82A 1GP6A 4IE6A 1AYN1 4XQWA 2PHRA 3WP6A 2JE8A 5T5JA 4GQ7A 1AL0G 1WCQA 4ISRA 4XEZA 1DGWX 5B2GB 1W9YA 2WDBA 5FR3A 1RUE1 1CWPA 1XNKA 3T2TA 4LK7A 2ORZA 4HANA 1ULFA 1V0AA 3NV2A 4CP2A 4AI2A 1V6OA 1JYXA 4KI5M 1Y9QA 2WS91 5A70A 2JE9A 3ZFEA 2CV6A 3Q8CA 1CGPA 3CZUA 1AR72 1OHFA 1S55A 1YHFA 2D7FA 3PTYA 5FUNA 1ENRA 2AZ5A 2RR12 2CDPA 2ET7A 4IEQA 1UZYA 5FRAA 4MOAA 4EN6B 5ABJC 2VNVA 1VBB2 4PDWA 5BNOA 1Q8PA 4NN0A 1FV3A 3DXTA 5L36A 1YYNA 1ODNA 1Q43A 2ZGSA 4NVPA 1H6YA 5DDJ3 2Z42A 2WZPP 3ACIA 1DQ2A 5FZIA 5B4NA 3OUHA 1S2EA 4I01A 1QJY3 1UZZA 1OFSA 1G9DA 4QT6A 1PGL1 4GH4B 1LOFA 4BLIA 4LKFA 5AVAA 2PLV2 1WZXA 4EN9B 2XKOA 5AC91 2ZBJA 4LLFA 4Q27A 1G9BA 1PMJX 2XKPA 3ACHA 4GA9A 5LASA 4GIQA 2I07B 3AZZA 3VL9A 2Q8EA 4FOVA 3GBWA 1VMHA 1DGWA 2QQIA 3GNEA 5FPLA 4QXBA 4L97A 5F1RA 5KHKA 2ZX3A 3I7DA 1JZ6A 3USUA 1LULA 4XCAA 3W21A 2OPWA 3KQ4B 3ST7A 3WDTA 2XJRA 3ASIA 4XDOA 3ZSKA 1GKBA 4WV8A 1LEMA 3WF2A 1UYPA 4FPGA 1RVF1 2EALA 4BXSV 2Y6LA 4QQ2A 2R1DA 2RVAA 1AR71 4GD4A 3ZLIA 3BTAA 3IAPA 4JCKA 3LEGA 4QKDA 2VNOA 3QH7A 3H8XA 3ACFA 5FBJA 4AEJA 5T52A 3I49A 1YQ6A 4IEZA 4QPGC 2V4AA 2ZGOA 4HBNA 4BM8A 4CYDA 4ET7A 4YM2A 4CDWA 3H3ZA 5FXWA 4CCNA 2ZGLA 2YV8A 1D4M3 1CQ9A 2VMHA 3O1SA 3FZ3A 3N7LA 4N8MA 2VD7A 2XJTA 2ZEWA 2DVGA 3WDVA 1HIXA 4G3YC 3HEIA 3HR9A 5FCCA 1FAYA 1VP6A 1RUJ1 1CAVA 2A5ZA 3ZFFA 4NIAA 5FK7A 4BK4A 3B01A 5DG2A 2P3IA 1CONA 1MZEA 2C26A 3X29B 1LHVA 2FHRA 2AH2A 2EF6A 3IMNA 4F8AA 5I8YA 2EVXA 1SCSA 4J1WA 3MICA 4M0NA 2YBSA 4CPBA 4XZUG 1OLRA 3HOBA 2B9VA 2IUWA 3EYPA 1W6NB 4LIUA 5DAPA 1XNCA 4HKOA 3I2HA 3ZR6A 4BYYA 3MDPA 5IVVA 5GLTA 2O8OA 3K3OA 3PJQA 5F3CA 5JLVA 3MPBA 4D6RA 5DAVA 1TG7A 3R4UA 3MUZ1 2ID4A 1RC6A 4PDWB 2XUEA 3K3NA 5BNOB 1PIV2 2JDYA 3LAGA 4BOWA 1SLTA 4JHZA 2RS52 3LE0A 3RGBA 2EICA 3EHKA 1HRI1 5CYYA 4LBOA 1HQWA 3FBMA 1UZVA 2YHJA 3H0OA 1GQGA 4GWIA 4W6XA 4ZXKA 4XF3A 1B35C 2B39A 2WR9A 4XUTA 3B94A 2MHFA 1DYPA 1SHWB 4Y20A 1AYN2 2A3XA 1F4HA 4L9BA 2HH9A 4Q0QA 3PU8A 4QB1A 4DZGA 1AJKA 2BTVC 5L7OA 1EUUA 1UYZA 3R6SA 1QH6A 3EBRA 1MZ6A 2W9XA 5C4WB 5HI0A 2DUPA 1QNWA 4S2FA 5C9AB 1APNA 4WM7A 1VB2A 5FUPA 4D69A 2JG9A 4M00A 1PO12 1RXFA 2CU5A 2WJSA 4NRPA 4O7XA 3RJRA 1DG6A 2E53A 3NNLA 1LGCA 1D4VB 2CGOA 1NLRA 3L2YA 3M4FA 2D98A 4BHPA 4XHBA 1J1LA 4JDOA 1MZ5A 4HFSA 4RGGA 2JEMA 4RR3C 5FZ1A 2LALA 3VBHB 1ZA7A 5JUVA 1VBB1 2WNUA 3I2JA 3T30A 2TEPA 4XAAA 3A0NA 4AI3A 1RUNA 1JH5A 4M4PA 1MQTA 2D97A 5FXXA 1O8SA 5KXCA 1RITA 2W94A 5A32B 4I02A 1V6IA 3AMNA 1RUE3 5CVRA 5E89A 3TNQA 2JD4A 4AAXA
chains in the Genus database with same CATH topology
5I0RA 1ASJ3 4J6GA 4YM0A 1EAH3 5FMOL 1F9KA 2ZMLA 1OOPB 1QXJA 1NY71 1R083 1QWRA 4RQPC 5A3MA 4QPGB 5H9RA 1CAWB 3CF6E 2EXIA 3D6EA 4HK9A 2RS51 4ASLA 1K5MB 3M3CA 1VBC1 5F5QA 3NSTA 1MEC3 3AKQA 5AFEA 3EO6A 2Y0OA 3S7IA 3VBSA 1Y3TA 1UIKA 2R071 1RUI1 3BOWA 4TLFA 3VBOB 2F6BA 1NCQC 4CP0A 1BCXA 3N36A 5GLZA 2WZR1 1MVEA 1O5LA 3HAGA 3VZJA 3WW2A 1TNFA 4ES9A 4HN0A 1QJX1 4YZ2A 3MI8A 4Q8KA 5FTTC 3AMPA 1UPIA 4NHLA 1W6PA 3GHNA 4YW2A 3U10A 2R063 4R4XA 1AF9A 2Z79A 2XB6C 4CEWC 1U5IA 1DQ1A 3ZSLA 3VZMA 3ZX7A 2WLPA 3WG3A 1WW7A 1ND2C 3ZN6A 1VRH2 3JU9A 1UMZA 1V6JA 4OFGA 3IN9A 2B8MA 2JXAA 3R0RA 3J8F3 1ZM1A 2HWE2 1LOFC 4K21A 1M06G 5EYXA 1JBCA 4IV1C 3H1MA 4C0BA 5A3LA 2VMIA 4EV0A 4QXKA 2YC0A 1ULDA 1NZCA 4URTA 1SLCA 2D6MA 5J37A 4P14A 1QQP3 5FO9B 1GNHA 4YVSA 4R9DA 1GV9A 2B7YA 1EAH1 3INAA 4AFMA 2QZ3A 4LHLA 1RUG3 4N7IA 4AFBA 4YZ3A 1MS4A 4ATFA 5LEKA 5JSPA 4XZPA 1RUC3 2G9FA 2ZHKA 3BODA 4WVMB 5IK5A 1SBDA 3KCXA 1A8DA 1VBA1 4INDA 3NKGA 2Q30A 4KH9A 3MPPG 1GNZA 1M4WA 2O0OA 3L9JT 4Z1VA 3FX3A 1JTZX 4YARA 2GDFA 4MGIE 2RS31 3JBG3 2VY0A 5L7OC 1AR63 2R30A 3OYWA 3RMXA 2TBVA 1D0GA 2P2KA 3KT1A 1LGNA 4L92A 3FMGA 5ACA1 1ULGA 3RSJA 3GZAA 3WINE 1ZBA2 3IPVB 4JAAA 1KS4A 4YGBA 1DIWA 2XLFA 2CGNA 3AP5A 2GU9A 2HWC1 4I0AA 3B7MA 3JQXA 2SLIA 4XFFA 1YO8A 1BZWA 3VKNA 1LHUA 3OCPA 2KM2A 4E4DX 3QACA 1MEC1 1QJU3 3KGZA 1DHKB 3AKPA 3GALA 1A6CA 1W6QA 4HT1T 4B4QA 4B29A 1R081 5L19A 1TME1 4MGKE 4PQ9A 2E9QA 1Z7S1 2RMU2 4WVZA 5SV8A 4N9HA 2W39A 1RL3A 1NOVA 1H30A 1R1ZA 4XDQA 3EXUA 4MXVA 2F4PA 2WNVB 3MIFA 4H7LA 5C9AA 4IEWA 3JD73 1VBE1 3J4UH 1XXNA 1X8MA 4N9IA 4F7ZA 2XVGA 2UYAA 4SBVA 1V00A 2WSVA 3DKWA 4GKYA 3QD6A 3TYJA 1HDKA 2HJIA 4XXAA 3J9SA 3IDBB 1RUC2 1SLAA 3E6DA 3ILNA 3WW3A 4DY3A 2LTNA 2GC1A 1FPN1 1CAUA 2HWE1 2VW0A 4AI0A 4LE3A 3BU7A 4P5HA 3OD4A 2A6VA 2C0ZA 3JD72 2GC0A 5JIUA 3AYDA 1GQHA 4HZFA 3TRSB 3M7AA 4R9AA 3B69A 2VU9A 4PJYA 1YUDA 3CO2A 3N7KA 1WLCA 3WDYA 5FLIA 1R1A1 4NO4A 1KDKA 4R9BA 1MACA 3M3QA 4P9JA 1CAWA 2GAUA 4G9SB 3NWKA 1O4ZA 4MXWB 5E16A 4ORFA 5LK7B 3MW4A 4GMP3 2C1FA 3AKTA 3K51A 1C4RA 4YRDA 2VOXA 3TN92 2UURA 4RD7A 4K1ZA 1HQLA 3H1YA 3JB8A 3KZ4C 3VBOA 3LB9A 4TWTA 3KLSA 1Q8QA 4LHKA 3KGLA 1A8MA 4J1XA 2EIGA 4COUA 1LOCA 4HKLA 2XH6A 2ZACA 3AZVA 4QPIA 3OD0A 3JZVA 2FMYA 1GZ9A 4XF0A 4AGGA 3W58A 1RUH2 3ZN5A 3UKVA 2D6KA 3OPZA 3NAPC 3SNMA 5KXDA 1HRV1 3ZFFB 3ZXFA 3PVBB 4LA3A 4OUSA 4GALA 2VOKA 1UCXA 1NA1B 1WMFA 2CAVA 3FWEA 3EQEA 5CG8A 4Q4Y1 1VIWB 1CJDA 2HKXA 2XPJA 1ZBE3 1DU3D 1PZ8A 4K3UA 2D3SA 2ZX0A 3NJZA 4FO9A 3KSCA 3PMEA 4FOYA 4NPRA 3AXEA 1PGL2 2ZS6B 3E5UA 3ZXDA 2WNEA 1C3HA 1PVXA 2HWF2 1YIFA 3N35A 3KB5A 2WFF3 5GLUA 1OLQA 1NXMA 1SBEA 1COV1 3DPRA 1XU1A 3WW4A 5BUVA 1PGSA 2DV9A 3S7EA 4E4SA 5AC93 1YI9A 1H2MA 1CPNA 1S0FA 5BYNA 5JPNB 3PVNA 2AREA 4YG3A 5BPXA 5CU1A 3I59B 2X29A 4RQPB 1ZRDA 4BIOA 3MF6A 1I3HA 2ZX1A 2JICA 5FAXA 2RM23 1U5YA 2ZZQA 1GR3A 5H9QA 1NQDA 2NN8A 2E7TA 1BK1A 1MS5A 2ILMA 4QM8A 1OA2A 2CNAA 1Q5OA 1I6XA 2ZHMA 4R8HA 2RS53 5GKAC 5BY5A 3H1WA 3WQ0A 1RHI2 1AX1A 4QMAA 3ZYPA 2D3PA 4U2AA 1TNRA 5GZEA 1BMV2 1RIRA 2JKBA 1PO11 2FZ1A 1FPN2 2XJPA 1Y7BA 3M8LA 4XJWA 1RUC1 2H0VA 3GYDA 1WBFA 3KT4A 5GLWA 2AUYA 2BFUL 1LU2A 2P17A 2QZ2A 3ZFEB 2EXHA 1H1MA 2HWB1 4K1YA 4TSVA 5D8AC 4COZA 2JJ6A 5CG9A 2XBO2 4KG0A 5J3UA 5EZWA 5FQ0B 4Q1PA 4RHV3 1CN1A 1R1A3 1J1TA 5DZGA 4FCAA 4DNYA 3AJYA 3VHOA 4BCUA 1VJ2A 2W08A 2UWAA 5LEJA 2ATFA 1DLLA 1O3TA 3U07A 3N7MA 4FTEA 5JIAA 4YZ5A 2WNUC 1NCQA 1ZZ9A 2P37A 3B9IA 4C90A 2GNBA 2VMGA 5EXOA 4AI1A 3NVCA 2DCZA 5HCAA 1VAKA 1FX5A 5JOXA 3VBFB 4YZ4A 5E1RA 3B3QE 5K8SA 2E7AA 1N1VA 2D6OX 2G4IA 2WA3A 5T5LA 1D2QA 1QJY1 4CEYC 4A2UA 1RHI3 1PIV1 4YVWC 1EPWA 2NM1A 3G6JB 5EYYA 2R1BA 4ONUA 1FT9A 4IEVA 1LOGA 1QDOA 4P9WA 1XYOA 1YXWA 3ATGA 5KXEA 2CTVA 3AM2A 2PAKA 5I8SA 2LUWA 4DINB 4AHZA 3AZYA 1J59A 3R05A 3M3IA 2DVFA 4WVVA 1BBT3 1IS6A 1GZWB 2FQPA 1POV1 4LNVA 3RS6A 4CEWB 2JDZA 1QU0A 4Z07A 4RS5C 3MZHA 2WS92 1C8M2 4KNCA 2UYBA 3NV3A 3SLIA 3VBFA 4K20A 3UL2A 1QXRA 5C4WA 3HD8B 5HBAA 3VZNA 2JG8B 1WA4A 4IETA 1REEA 2HWF3 1NCRB 4NR1A 4RGAA 1BEV3 3SXWA 4ES8A 3I4IA 1XNBA 1REFA 5J09A 1AXYA 4FOWA 4CEYA 2R072 3WG1A 4XXPA 1S2KA 4R52A 3DGTA 1REDA 1S0BA 3H3UA 1V6NA 1C8M1 2D6PA 4JRLA 5J96B 3C3VA 1HKDA 4LBMA 3AYAA 3ZN6B 5JI9A 2WKKA 3DL3A 3IIAA 4YM1A 3PLQA 3H9AA 4FAHA 4JQRA 3AX4A 2R042 4UW5A 1UU6A 2X5IA 3LSEA 1PNGA 3VL8A 4TYSA 1IHMA 4FQ4A 4ISQA 1XU2A 2CL2A 2VNRA 4OVEA 4NWWA 1FXZA 1V9U3 4FPJA 4FSJA 1CJPA 1MS9A 4FPHA 3UKTA 1G9FA 4LUKA 4XQ4A 4AWDA 2IC1A 5LRSA 1PO23 4XOGA 4FXGB 3SMHA 1X8EA 4EN7B 3V0BB 1S1AA 4D7YA 3URFA 3ZYRA 4LBQB 2BGCA 2A75A 2PQQA 1UIJA 1LOBA 5LRRA 1VBA3 2JG9C 3POWA 4HVOA 4XJ9A 4XFIA 4Q4W3 1UPSA 4XJ8A 1IOAA 5H9PA 3MW2A 1SQ4A 1H4GA 4XPVA 1IQAA 4JGZC 4L99A 1AR93 2VVEA 3NO8A 1UW8A 3IT8A 5DDJ2 1AR81 3JD71 1YNAA 2R16A 5CFDA 2WSUA 1NCRA 3ETQA 5J48A 2UWBA 2DUOA 1PVC3 2R061 2BNMA 2RHPA 2HWF1 4HKWA 2E6VA 1AX0A 4W6WA 4B4RA 3WNXA 2VULA 3SCGA 2GH8A 2YROA 1F31A 3D8CA 3VBSC 4AEDA 5C8WA 1NQJA 4MVTA 2N7GA 4F83A 2A6WA 1WW5A 4AQ6A 5CFDB 2HYKA 3WG4A 2I74A 5F6KA 3MGUA 4XTPA 2UWCA 4A7KA 1DDLA 2XUMA 1AR82 1RMU3 1N1YA 4Y1ZA 3AB0A 1WCSA 4Q0SA 1W0PA 1R091 3TWIA 4CDXB 1BJQA 3DPRB 3ZYIB 3CEWA 2DFBA 4AEDC 1X7NA 2K2SA 3MLJA 1HXS3 5C4WC 3BIWE 3CU7A 1AR83 3CLPA 4XJZA 4ASMB 2D3RA 4QQOA 4Y26A 4AXOA 2KXLA 4IV3B 3VBFC 3VUOA 2OYZA 4QD2A 2A3WA 2GNTA 4HMZA 1BVVA 2CYFA 2WZR3 4CDUC 1Q8SA 1Q8OA 2D6NA 2E7QA 2D6LX 2BNOA 4AE2A 1LHOA 1DQ4A 5FOBB 2OPKA 3ME2A 4RQPA 4DFSA 1LEDA 5K0UB 3ILFA 5JZGB 4KGQA 3AP4A 2NMNA 4MYEA 4Q4Y2 4DQAA 1SBFA 4MV2A 2ZX4A 5GALA 1LB2A 3NV1A 4AVVA 2ARBA 2H0BA 1VBA2 3LCPA 1N1SA 1SLIA 5IK7A 1XE7A 2CWSA 3H50A 2C9AA 4UXAA 1H9PA 4XJAA 3WR0A 5FFOC 1RMU2 3RDIA 1RVF2 2VPVA 1AL21 4GWNA 1COV2 3USUB 2QCSB 1PO22 2VH9A 4W6YA 3KD4A 1MR5A 3AZXA 2R043 1Q56A 1DQ0A 1RUF1 2GNDA 3ZXEA 2QDRA 5FPXA 3ES1A 3G7DA 4DY5A 1WLTA 2XJVA 1KD7A 4YG0A 2TUNA 4GH4C 2BPA2 4HLTA 1RUG2 1BKZA 2VOVA 4N43A 2RR11 1B35A 5JCTA 4X8PA 1ZZ6A 1X33A 4B8EA 3WT3A 4XMAA 4WM7C 4JTNA 3ECQA 3H7JA 4ZU4A 2BEOA 3AMMA 4KU8A 3IWZA 3TAYA 4Q4W2 3HQXA 3O0XA 2B5HA 4AEMA 4FVVA 4A7YA 1G6NA 1R1A2 4D7SA 2C5DA 1GYKA 5BNPA 1NG0A 4Q4V1 1WLDA 3P3PA 2XLAA 2DFCA 1C8M3 3QCWA 2OUHA 2ES3A 3AYCA 1ZZ7A 3FLPA 1OQEA 3A4UA 1BBT2 3TN91 1I9RA 4E2QA 1WMEA 2ZKLA 1JYCA 4YFWA 3JQWA 2PHDA 2YXSA 3IPVA 1VALA 2PAMA 3OY8B 1F5FA 5D1IA 1J3QA 1LECA 2H6BA 3FUOA 1NCQB 1FMD2 4KL1A 5FQ0A 4AFAA 3BCWA 1WLWA 4HETA 2A71A 3VHPA 5K0UC 2QNKA 2BYVE 4GB33 1AUYA 1SACA 5E88A 1DZTA 1UKRA 3I59A 1LODA 4XILA 4B3NA 4XIKA 4F3JA 2Q0AA 2JENA 3TBDA 1AYM2 1S0IA 2UY8A 3SISA 2VVDA 1XRUA 1L3JA 3OBRA 2W68A 3SH5A 4LBNA 1G86A 2ZHLA 3CJIB 4Y1XA 5I0UA 1A3KA 4P9LA 4RS5B 5A33A 4TZDA 1EAH2 4IERA 4GMP1 4BMEA 4LO4B 4XMIA 1XNDA 2HWB3 1UX6A 3JUUA 4G4FA 1N3OA 2WFF2 1HRV3 5I93A 2JG8C 4C1XA 3OGGA 1RGSA 4XJUA 2XVKA 1DFQA 4CDQA 4JGYC 3WHUA 4HN1A 2PA7A 3FLTA 5D8AA 3NW4A 1VBE3 1RHI1 1BXHA 2XBO3 4FP3A 1Q3EA 2ZTNA 3NL1A 5JSRA 4XETA 2WFPA 5DDJ1 5BXXA 1OA4A 4RHV2 2R6QA 2PHLA 5JOZA 4RA0A 4DOUA 4COYA 4Q8LA 4QM9A 2XGXA 3ROUA 3SCHA 2VG9A 1TME3 1FMD1 1VR3A 4HPKB 1CVNA 1KRIA 1I5ZA 2A7AA 2DCKA 2R49A 5BNNA 4JDNA 4CDUB 1MQTC 2DVAA 4YGEA 4FPLA 4AQTA 5FOJB 4CEYB 2HWD1 1MZFA 2ZAHA 2ZZJA 3FHIB 5H9SA 3W9AA 1FMD3 4K9SA 4LTAA 1MVQA 5CFCC 2VXRA 3UJOA 2VQ0A 1WW4A 5JZGC 1QHDA 2P3JA 4GH4A 4Z8BA 1LR5A 1RUG1 3NAPA 3VBUB 2WT0A 2MEV1 3VKFC 1S0GA 5GZFA 1D2SA 3B02A 1R082 4PF5A 1NE4A 1C5IA 1YFYA 4LBJA 3TNPB 3AYEA 2VOWA 5DUXA 2DTYA 1HQNA 1EV11 3VBRC 1RUF3 1U12A 1DYKA 4MSVA 1ZRFA 2ETEA 4Q29A 4AQ2A 5FO8B 3VHRA 3QBQA 4JDMA 3VBOC 5GLVA 5C6CA 3WHTA 1KXGA 4QGNA 4XHXA 5T5PA 1YFXA 1QJU1 4BWOA 3WLUA 1UAIA 3S0MA 3AKSA 4YW5A 4EWEA 4N7UA 1H0BA 2NYYA 1BVP1 4JVAA 1IS3A 1LKNA 4Y1UA 2YZ4A 1IPJA 4UW4A 3RNSA 3VZLA 5CAZA 4OHZA 2XL7A 1N3PA 2EAKA 3HT1A 2VECA 1RUI2 4K7JA 4AFCA 4CDQB 5GZCA 4GB32 1JW6A 1OPOA 3WY6A 3MLLA 4OHVA 1H8VA 1XYNA 4P9XA 2BW8A 3VHNA 2RS33 4X6QB 2GH2A 1W6MA 4LE4A 5EJ3A 1ZVFA 5FPZA 1AL22 1I1EA 4AHXA 4GMP0 4MGZE 2OW4A 4O9GA 1MS1A 4AF9A 3PVEA 4XF9A 3BOPA 4WVMA 4LO7A 4O9EA 4AVSA 1QXPA 2FMDA 1JUIA 1W6MB 1A78A 1CAUB 3VZOA 4AGRA 2K9ZA 1FI2A 2P3KA 4Q4Y3 1AYM1 4YVSC 3PJYA 1DQ5A 5JSOA 3KT7A 2GC2A 2KA3A 2WZR2 1ND3B 2YUEA 2EAAA 5BNPB 4PLMA 3RMYA 1ZRRA 4D7TA 2RR13 4QGLA 5C8CB 1RUH1 2ZJCA 3B5LB 4IQPA 4Q2FA 3UKNA 4EN8B 4FTSA 4Y22B 3ZYGA 5SV5A 2Z5WA 1DGRA 2D5HA 5KC5A 2O8QA 3KS7A 3ZXGA 1O4TA 4OLLA 3M1HA 1CAVB 4CDUA 2IXHA 1ULCA 1NY72 4BZ4A 4LBKA 4PIYA 1DBNA 2Y26A 1LGBA 1RUJ3 2WNVA 2WT2A 1ULEA 1S0EA 1ZYBA 3GZUC 4E27A 4S2HA 4L8QA 3WP4A 1DQ6A 3I54A 3OF1A 3WG2A 3GZTB 2ZGUA 1FATA 2E51A 2RS32 3WDUA 1KJRA 1V9U2 2BVVA 2V5YA 4IV1B 1LCLA 4N53B 2V73A 2ZGMA 4ZU7A 3RYPA 4U36A 4DB5A 1OOPA 1POV3 1RUI3 4E4ZA 3RI8A 1NLSA 1IKQA 3OJBA 3FUQA 3RQ0A 4FPEA 4COVA 4SLIA 4XBNA 4FAGA 1K5MA 4AHYA 3POYA 1O7FA 4CDWC 4FTBA 1FNZA 2DCYA 1OQDA 3GF6A 5ACA2 1EYBA 2QUOA 2WNVC 3RJ2X 3WVJA 1H4HA 1WD4A 5GZDA 2QQPA 1X50A 4XFGA 1QMJA 3BPZA 3O0WA 3V65A 1WW6A 4L11A 2HWE3 1RJ8A 4OHWA 1KJLA 5DUWA 3A0KA 1VBB3 3JB4C 2PN5A 1CESA 2D40A 4L2NA 4CP1A 4QU2A 1BMV1 2WNUB 3MIHA 1ZBA1 5L7OB 2OVUA 4HK8A 3ZSMA 2QKDA 3MIBA 3ZFGB 4HVQA 1KS5A 2MNGA 3MIEA 4ZU5A 1IS4A 3SITA 3UK9A 4C91A 3FFZA 4PCRA 1ZBA3 3VBRB 4AW7A 4AVTA 2ZPXA 2X5IC 5GM0A 1KFUL 1V9U1 2CY6A 4WM8B 1AR62 2WT1A 3I8TA 1JHNA 3H7YA 4DRVA 1RUJ2 5A32A 2PFWA 1ALYA 4JV4A 2RJLA 1G9CA 1W39A 4YW3A 1E57A 3THPA 4OHYA 4I30A 2GZWA 3VN4A 2GNMA 2A6XA 2X8KA 3V0AA 2XLGA 1U0AA 3UJQA 5K9YA 1BEV2 1Q8VA 2GALA 5KXBA 4LBQA 4QQHA 1GSLA 5JPMB 2R073 5KWRA 1ZNPA 4ZKTB 5JMCA 1LHWA 4PIZA 1WMDA 1LU1A 2K0GA 1OKQA 5EFUA 2BWCA 1EP0A 3J8F2 2W52A 2DF7A 3TOJA 5I0TA 1O91A 4YSFA 1FYUA 2Q8OA 4LO6B 4OI2A 5IK4A 3HMYA 4PLOA 4WBBA 1BYHA 1RUF2 1AX2A 2YMZA 4XBLA 3RRDA 2HEYF 1VBC2 2WS93 2WQ4A 1KFXL 4I3PA 1BEV1 5BNNB 4I2OA 1LJ7A 1CR7A 2XVLA 3AKRA 4FPOB 1AYM3 3DF0A 2I45A 4H14A 1AR61 1PK6C 3MLKA 4RR3A 4XW3A 1J3PA 1H2KA 1R093 3ZO0B 3J8F1 4A7ZA 3PHMA 3RYRA 1KITA 2WINB 3MEPA 5FDBA 3V56A 1H8TA 3ZMNA 5JWPA 4GXLA 3VGIA 2A6YA 4MZUA 5AVPA 2JG8A 1TQ5A 5T3NA 3GHMA 1OOPC 2WA4A 1QQP2 3S6PA 4AI8A 1ZRCA 1OPMA 1QJZA 4BIFA 2B46X 4Z92B 1H8TB 4BMBA 4PDWC 5BNOC 2HEVF 4LBLA 4GWMA 3ZIXA 1ASJ2 4RSUA 2DU0A 3AFKA 2IXIA 1J58A 4UBGA 4AVCA 4AVBA 1ZZ8A 1V6MA 1F2NA 4E9KA 3WQ1A 3RG0A 1F8VA 2IXJA 3E6BA 4NWVA 4Q1RA 1B35B 1V6KA 4MUVA 1U5ZA 3LA3A 2DCJA 3WCRA 1W2UA 4A3XA 3LWCA 1U5XA 2A6ZA 3ENRA 2PHUA 1FPN3 1UU4A 2XHKA 4XYXA 5T54A 3WCSA 4IV1A 1OMIA 5EWSA 3ZXJA 5KHIA 4XIOA 1ASJ1 4Y1VA 3LOBA 2YGLA 1H9WA 2JX9A 5IUQA 1XQNA 4IESA 2Q1ZB 1W6OA 4RR3B 3VBHC 4HSJA 1AYN3 3V64A 4DS0A 1HV1A 4FPYA 1QOOA 3BALA