3NKTA

Crystal structure of salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans adducts with naphthoate
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
364
structure length
364
Chain Sequence
EKLDHESVTQAMQPKDTPELRALYKSFEEESIIPLWTQLGDLMPIHPKSKAVPHVWKWSTLLRLARKSGELVPVGRGGERRALGLANPGLGGNAYISPTMWAGIQYLGPRETAPEHRHSQNAFRFVVEGEGVWTVVNGDPVRMSRGDLLLTPGWCFHGHMNDTDQPMAWIDGLDIPFSQQMDVGFFEFGSDRVTDYATPNFSRGERLWCHPGLRPLSGLQNTVASPIGAYRWEFTDRALTEQLLLEDEGQPATVAPGHAAIRYVNPTTGGDVMPTLRCEFHRLRAGTETATRNEVGSTVFQVFEGAGAVVMNGETTKLEKGDMFVVPSWVPWSLQAETQFDLFRFSDAPIMEALSFMRTKIEGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gentisate 1,2-Dioxygenase
publication title Crystal structures of salicylate 1,2-dioxygenase-substrates adducts: A step towards the comprehension of the structural basis for substrate selection in class III ring cleaving dioxygenases.
pubmed doi rcsb
source organism Pseudaminobacter salicylatoxidans
molecule tags Oxidoreductase
total genus 101
structure length 364
sequence length 364
ec nomenclature ec 1.13.11.4: Gentisate 1,2-dioxygenase.
pdb deposition date 2010-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3nktA01
4DINB 3IBMA 2H0VA 1CGPA 1YUDA 4K8FA 5I91A 1U12A 1ZVFA 2O8QA 3UKNA 4Q0QA 1ZZ6A 1QXRA 3I59B 5FPXA 1VR3A 5E16A 3L2HA 4QXKA 3OD0A 5CADA 4R8HA 3I54A 1UIKA 1EYBA 5C6CA 1J3RA 4EWEA 3O14A 1X8EA 4QX5A 2OA2A 3SCFA 3H1WA 2QVSB 2ET1A 3LOIA 2WFPA 5KHGA 3UKTA 4XF0A 3EHKA 2HJIA 3ST7A 4E2GA 1Y9QA 3OCPA 5KHJA 3DKWA 3ES4A 2XLGA 5FLHA 4BIFA 2I45A 4H7LA 3H8UA 3ZDSA 1Y3TA 3SCHA 5I8TA 3BU7A 2PHLA 5K8SA 2PAEA 3H1MA 5C8WA 1EP0A 1I6XA 4KU8A 1Q5OA 2DCTA 4EV0A 5CU1A 2MNGA 4FAHA 3IWZA 3EBRA 5AVPA 2VECA 4JTNA 2IXIA 1YHFA 4KWJA 4AQ2A 2Z69A 1LR5A 1I5ZA 2CAVA 4BYYA 3KMHA 4I0AA 4XFIA 3E5XA 1CAVA 2ETEA 2XGXA 4IEQA 3D82A 4XFBA 4UXAA 4LA3A 5EZWA 5BV6A 4XFHA 1O5LA 1ZZ7A 4BHPA 1CAWB 2MHFA 2WC2A 4IEXA 1WLTA 4AVCA 2F4PA 2XKPA 3RYPA 3E6DA 2N7GA 3KGZA 4FAGA 1X8MA 3LA7A 1ZZBA 3BB6A 3USSA 2IXHA 3U11A 4XF9A 1OD5A 4META 3H9AA 4KWKA 4XFCA 3OGJA 3FZ3A 1ZZ8A 4CYDA 4AXOA 4FT8A 1QWRA 3IDCB 4AVBA 2B8MA 2ZKLA 3RZZA 3CF6E 1ZX5A 4Q0UA 3EO6A 1ZRRA 4UBHA 1DZTA 5F1RA 3LAGA 5FLIA 3EQEA 3S7IA 1O4TA 1TQ5A 2D5HA 4JVAA 3CO2A 1O5UA 1Q3EA 4TLFA 2BNOA 5JSPA 2UY8A 1SFNA 3CJXA 2IXCA 4YARA 4HZFA 3N4MA 4AVAA 4LA2A 4E2QA 4I0BA 1DGRA 2IC1A 3H3UA 4PIZA 4LUMA 4UBGA 2Q30A 2P17A 4OFGA 3HT1A 4IERA 4YNIA 3KCCA 1UW8A 3RYRA 1ZZ9A 2ET7A 4LUKA 3FX3A 4XFGA 3R6SA 4J1WA 3E6BA 4XF3A 4QGLA 4RD7A 2QJVA 1UPIA 4MV2A 1O7FA 3B02A 3ACLA 4KU7A 4I3PA 2UYAA 2EAAA 1QY4A 4EWDA 3SXWA 4WVZA 1H1IA 4YSFA 2K0GA 1UD1A 4ORFA 3NSTA 2Q4SA 3D0SA 1CAVB 1J3QA 4MUVA 4ZU4A 3ES1A 4XF1A 1FT9A 4L2NA 3E97A 2B9UA 4F7ZA 2K9ZA 4QGNA 4HN1A 3MYXA 5JR7B 2BYVE 4WBBA 5KHIA 1RUOA 4I02A 3U0ZA 1RGSA 1NXMA 2V09A 2PA7A 1X7NA 2XKOA 3FWEA 3ETQA 4KL1A 3M70A 1LRHA 4GULA 5I0SA 3DV8A 1ZRCA 4L11A 2Y0OA 3I7DA 1G6NA 5LRSA 4LEJA 1ZNPA 4N9IA 3U10A 1EPZA 1RUNA 4ZU5A 3H50A 4I2OA 2FQPA 2D40A 1XE7A 1JUHA 3BALA 3H7YA 4I09A 3PNAA 4IEWA 2B5HA 4Q0VA 1NYWA 2PAMA 3RDIA 4HSLA 1RC6A 4XEZA 4F8AA 1VJ2A 3WW3A 5BUVA 3FJSA 5D1IA 5J3UA 3VHRA 3DN7A 3E6CC 2CGPA 1O3TA 5J48A 4FBFA 2GC0A 3WW2A 1YWKA 4P9GA 4J1XA 2EA7A 2E9QA 2GZWA 4HVQA 5LEJA 2Z2SB 2XLFA 2O1QA 4OLLA 2OYZA 2ATFA 4IETA 3TNQA 4X6RB 5I0UA 5FCCA 1XE8A 3CL1A 4MGIE 5LRRA 5JCTA 2BNMA 3D0JA 5FQ0A 4HVOA 1CAXB 1OI6A 3LZZA 5KHKA 4LLOA 3E5QA 4A2UA 3HQXA 1NE4A 4MGZE 3MDPA 1J3PA 4KWLA 2IXKA 3H7JA 4PIYA 1ZZCA 2XL9A 1CAUA 3BPZA 2HKXA 5JSOA 3JZVA 2C0ZA 3RYKA 2QDRA 2PFWA 4D7TA 1YFXA 2PTMA 5I0TA 3ELNA 2GC2A 1DGWA 3LA2A 2PAKA 4IEVA 1WGPA 4HN0A 1WA4A 2Q0AA 3PLQA 5CVRA 5I8SA 4ZU7A 2XL7A 5I0RA 4LULA 1CAXA 5JAXA 1NZCA 1RTVA 2XHKA 3EJKA 2QCSB 3ROUA 4AQ6A 1YFUA 3NVCA 3M3IA 4QM8A 3S7EA 2EVXA 3CEWA 1Q43A 3OF1A 1H1MA 3NW4A 2KXLA 5KBFA 3BCWA 3WW1A 1O3RA 1EY2A 1PM7A 1ZRDA 5EFUA 4O9EA 1PMIA 2BGCA 1FXZA 1ZRFA 5I93A 4Q0SA 3MPBA 4D7SA 4LTAA 1VP6A 3IDBB 2FMYA 3IIAA 3FFQA 2Q1ZB 4E2SA 3SHRA 3OTFA 2UY9A 1IPKA 1YFWA 2MPFA 2BEOA 2GAUA 1IPJA 1SEFA 4XFAA 2BNNA 2OPKA 4IESA 2IXJA 4JTOA 4Z82A 1RL3A 3FE5A 4HVRA 1LKNA 4BH9A 5LEKA 3I59A 3DL3A 1V70A 1J1LA 2H6CA 4MX3A 5BY5A 4N9HA 4Z07A 1HW5A 1QXJA 4YRDA 3HIFA 3LWCA 3S0MA 2GU9A 2D5FA 4JV4A 5BXXA 4QM9A 5KHHA 3RPQA 3MZHA 4Q29A 1UCXA 3KGLA 1O3QA 4IEUA 2XLAA 4IEYA 3RNSA 4XETA 5JSRA 3FHIB 2CAUA 3KSCA 3LA3A 2PYTA 3E5UA 4PJYA 1DZRA 1L3JA 3NKTA 4X6QB 5HI0A 2OZJA 5FQ0B 4I01A 5FLJA 4PIXA 4MGKE 1J58A 1OMIA 1GQGA 3GBFA 4HBNA 3C3VA 3WW4A 1ZREA 5I8YA 1NE6A 4XF4A 1CAUB 1UIJA 4HLTA 2UYBA 3QACA 3CLPA 4HSJA 4MGYE 3NL1A 5E1RA 4QMAA 3TNPB 3H3ZA 2H6BA 5FDBA 1CX4A 1GQHA 2GH2A 3H1YA 4IEPA 3QOPA 3SMHA 1FI2A 5FPZA 2ZCWA 1CAWA 4IEZA 4B29A 4R52A 1YFYA 1XRUA 4YYOA 1O3SA 4MZUA 4ONUA 1YLLA 4Q0PA 3HT2A 3NJZA 2PHDA 5T3NA 4HMZA 1SQ4A 4NVPA 5J7MA 2CV6A 4IEOA 5BPXA 3SCGA 2VPVA 2D93A 2VQAA 1X82A 2GC1A 4XFFA 4EWAA 1OFNA 2PQQA 4MH0E 4O9GA 3GYDA 4EROA 2OZ6A 3G7DA 2QNKA 2IXLA 4QGMA 1J59A 4WZCA 2GC3A 3UKVA 1LB2A 3PVBB
chains in the Genus database with same CATH superfamily
3AYCA 2XR4A 5IWFA 5L7OB 2QDNA 3KD4A 2JB4A 4OQ8A 5F3CA 1CGPA 3RZGA 4L99A 4JDMA 2YBSA 2RR12 1RUD1 1UXXX 2XJQA 2RDRA 3NO8A 5JZGA 1CPNA 2ZABA 1ZVFA 4JRLA 5BNOB 1LU2A 1JU3A 4I30A 4YW7A 3UKNA 4XXPA 5C3OA 2Y6JA 2ZX4A 3I59B 1B35C 3WDYA 2WSVA 1PIV2 2ZBJA 1W6QB 3L2HA 4M4PA 4NROA 1DCSA 3N7JA 3B00A 4K9SA 4C0BA 1KEXA 1HIXA 3I54A 1AYN3 1UIKA 2PHFA 4JGYA 2VW2A 2FZ2A 5C3PA 2GMPA 5M0TA 5F2WA 3MIDA 4XMAA 5A6ZA 3RWNA 3RMXA 1FOD2 2QVSB 3ITQA 4XTPA 1REFA 5A3WA 1Z0HA 3VL9A 2VZPA 4OULA 2UU8A 4CVUA 4W50A 1XE0A 3UKTA 3VKLA 3EHKA 2QQWA 3JQWA 5CFCA 2DBIA 1GMMA 2V4VA 3QH6A 4N53A 1R092 3OCPA 4AFBA 4DXRA 1AJOA 1XJAA 3I2JA 1F4HA 4BIFA 1MEC1 3ZXGA 4H7LA 3IDAA 3ZDSA 4COWA 4YG6A 3Q8EA 4QWNA 1E57A 4C8DA 1AYM3 5I8TA 2FDKA 2B42B 5K8SA 2XVGA 2PAEA 1FV2A 2TNFA 1KJRA 2BOIA 2AEZA 2IVJA 4KU8A 1JOJA 2WS92 2PHXA 4ZZ5A 5DG2A 2ZEWA 4EV0A 5CU1A 4Y26A 1JOPA 1MQTA 3PUIA 4FAHA 4LNVA 4BWOA 3VKOA 1SPPA 4AYUA 3J7MA 1NT0A 2G9ZA 4DRVA 1W6MA 2SBAA 3R4DB 3PURA 5DZGA 1YC61 1AR92 3ENRA 2Z69A 3ZYIB 2DVDA 5C8CC 4N7UA 1LR5A 2HBUA 2VM9A 4K21A 1I5ZA 5IHRA 2VOTA 2CAVA 1F9KA 4I0AA 4CDWB 1K3IA 4AQSA 1FX5A 1D4M1 3VLBB 5BV6A 2R16A 2WWSA 1S2BA 1V6NA 2NPIA 2ERFA 2P37A 2VBBA 4S2HA 1NQJA 3KT4A 3L9JT 5FUPA 4Z8BA 5LK7B 4QX2A 3TEZA 4K6BA 5HXMA 3CNAA 1JYCA 5A3MA 1BBT3 3VHPA 2W0XA 4AVCA 1REDA 5C3SA 4FI9A 3IIIA 3E6DA 5HCFA 3WOGA 5FZMA 2VOXA 2VNRA 3M2MA 3MFAA 3WHTA 4FPCA 3T3YA 1WMDA 1WCDJ 4AWDA 3U11A 3VZLA 1GOGA 5CYYA 3A0NA 4MG2A 2GSYA 4META 4DB5A 2VXJA 3K48A 3H9AA 4KWKA 5EWSA 3WDXA 3ZYHA 2W94A 5DUWA 2WFF1 4MOAA 2E26A 2QQVA 3OGJA 5H9SA 1OOPA 2CWMA 4AXOA 2AR6A 2VY0A 3NNGA 4AVBA 2B8MA 1QQP1 3RZZA 1RUG2 4XW3A 1BQPA 1ST8A 5FZIA 1VBE3 1RUI1 2VMGA 1ZRRA 2D98A 2JDNA 3VBSA 2D6MA 2CU5A 3LDBA 2RVAA 3T2PA 1PX3A 2Q8OA 2BWAA 2BQPA 2WNVA 4GB33 1BXHA 1UY0A 2GMMA 2VMFA 4N8MA 1LESA 3VZMA 4CE8A 4EN9B 1Q3EA 1OPOA 2WIIB 4Y3OA 5DUVA 4W6XA 2G9FA 4GWMA 5C9AC 2J42A 3TOJA 4ASKA 5JSPA 1W6PA 4Y20B 5FMDA 3JXSA 2RS11 4Y4YA 4Q1PA 1KFXL 2WZR2 3KHBA 5IW0A 2WZPP 1ULDA 4CDQA 2VQ0A 3VBRA 4LA2A 4CXWA 5A33B 1W9FA 2Y26A 3VBFA 4ATFA 5A3OA 3CQOA 5F9TA 3BKZA 2IC1A 2FDGA 3H3UA 1HXS2 2BFUL 4C0HA 2G4IA 2WN3A 4PIZA 2EXIA 3WNLA 2B45X 4QU2A 1HB3A 1PGL2 2AREA 3HVDA 3POEA 5F3EA 2YY1A 2B39A 3JD73 1L7RA 3T0AA 4IERA 5F39A 4YWAA 1UW8A 4PHZA 2ET7A 3WNNA 3POFA 1KDMA 5DAXA 5FYHA 1GICA 4D3WA 1H9WA 1NAEA 3VBHC 4FCAA 3N9MA 1VBD1 2HWE3 4YZ4A 2Y60A 2YXSA 5ABJC 4HKWA 4FXGB 5FZ0A 3RVHA 5DPNA 3VD9A 4KU7A 3O12A 5FY0A 2W9XA 5L9BA 1QF3A 2WQ4A 2W68A 2G1MA 4WVZA 3W59A 3DKQA 4AHWA 2ZOEB 4QPWA 5T5PA 1VBA1 4ORFA 4CRQA 2XHNA 1XBFA 5F6LB 3O1VA 2HWF3 1A3KA 5FMCA 3ES1A 5LA9A 5IAXA 1VRH2 3I3DA 3NAPA 5JLVA 2A6ZA 2CGOA 3B69A 5EJ3A 1C1FA 4QGNA 2DU1A 1RUD2 5FWJA 4O61A 1AUYA 2TEPA 4FFIA 2Q5TA 4TWTA 1K5MA 2ZXQA 3L2YA 4B7EA 3K51A 3ZYJB 3OBZA 5JDBA 3V0BB 2YBKA 3I8TA 4MGQA 1UOFA 4I02A 4DS0A 4GWIA 4OMCA 3WG4A 4AOCA 1AL21 2DCYA 1RVF1 4LKEA 2V09A 2X29A 2VAUA 4JGZC 1ACCA 2A3YA 5JR2A 2JG8A 1X7NA 3K2OA 5A7NA 3O1RA 4I0WB 5AC92 1T2XA 2VZTA 2WNOA 2D7FA 2ZHMA 4KL1A 4QQHA 3BGAA 2W1QA 2W39A 1LRHA 1US2A 4GULA 4YVSC 2JIGA 3HD8B 2R6QA 3ZXEA 5BNQA 5I0SA 5FK8A 2WQ8A 1QJU2 2JICA 3WDVA 4NAOA 1RMU3 2DDUA 3I7DA 4AHZA 2ARBA 1G6NA 4QPIB 2CYFA 1ODNA 1G7YA 2JECA 1KS5A 4KG0A 5F3IA 1BEV2 1ZM1A 2ORZA 4JHZA 4NHLA 4RQPB 3P1IA 3EMRA 4WZFA 2QQMA 1E5RA 3WDUA 4I2OA 2ZGOA 2D40A 3WLUA 3PNAA 2KD7A 1I3HA 1WCQA 3A0KA 2R1BA 2R063 1C8M2 3WDWA 2BU9A 5FXWA 1VBC1 1W8TA 3VZOA 1VJ2A 4LBKA 1LOFC 4O7XA 3VHRA 1L7LA 1PVC1 2JKXA 3DN7A 2WNUA 2CGPA 5J48A 1V6IA 3OYWA 4LE4A 2OQ7A 1QJFA 3ZN6B 3GBGA 1W8HA 2CHHA 4DUWA 4Q4Y1 4P9GA 3HN1A 2O0OA 2QQNA 4P14A 3TWIA 4A41A 2EA7A 3QBQA 4AAPA 4RGKA 1W39A 4OZXA 4D94A 4LBMA 3AZVA 1CJDA 1EV12 5DABA 1D4M2 1MS0A 2JDUA 2P3KA 1PNFA 4XUOA 2A71A 3ZYGA 1FYUA 3T08A 2XLFA 2O1QA 4OLLA 5A32A 1GP4A 1ZA4A 2Z5WA 1QJX1 3Q8AA 1OLRA 1PM4A 1OUSA 4LK7A 2RMU1 3TNQA 4KBZA 1LOEA 5A6XA 5C4WB 5IVVA 3RZLA 2Y6LA 2YUEA 3KV5A 1RUE2 4IV3A 1E5SA 1UMHA 4CCNA 1XNTA 3OGGA 5ANQA 3KLSA 4H7MA 1I5PA 2Y33A 1PGW2 4AEKA 4P9IA 3ZPYA 1PZ9A 3NJXA 5C5TA 4BIOA 1BJQA 1GZTA 1RUC1 1W8NA 2XJTA 4MHUA 5CFDA 3VBHB 1BVVA 4A2UA 4W4ZA 1W6OA 2DUPA 3HQXA 5IVFA 2VOKA 3NMBA 4B1MA 2ZGTA 2A1XA 4ZZ8A 3IM0A 3LB9A 4IXLA 4KWLA 3W21A 1NCRA 5L36A 1AF9A 3IKWA 5C3RA 1UOJA 4R4XA 2CY6A 5G04L 2VULA 4K40A 3M1HA 4I3GA 4M3CA 2VMDA 3SH5A 2WFF2 1NLRA 2RM22 2QDRA 3KVBA 1S0BA 1YFXA 2PTMA 4Q2FA 4Y33A 1MS3A 1AR82 5FUIA 5FZGA 2CNAA 1PMHX 4GH4B 3BU0A 2GALA 4GJZA 1XNBA 2GC2A 1H2NA 3V65A 4HN0A 3WF1A 1HKDA 2NM1A 5JOYA 1G9BA 5ERLA 1QQP2 1AR61 4ASLA 1OH3A 5CVRA 1V6KA 2UURA 3VHNA 1R083 1MS8A 5GLTA 5JAXA 1RTVA 3ZR5A 2J1RA 3O1SA 4YW4A 5CKMA 1UMIA 1YFUA 3ZR6A 5HI0A 3M3IA 5HPOA 2GN7A 2PLV2 3CIHA 4XC9A 1RYYA 4BQWA 5FZ9A 3OUHA 1OH4A 1G9CA 3WP6A 1IKQA 1D7PM 4DIQA 4ASMB 1GLHA 2R32A 2DWRA 3LEIA 4LQRA 1W9TA 4RS5C 4YVSB 1C5HA 2RR13 2JDKA 3ZXLA 2RS12 3DECA 1FXZA 2XVLA 4LBQD 4YZ1A 3MPPG 4JHTA 2AZ5A 4Q0SA 4R9CA 4DY3A 5FO8B 4P00B 1VP6A 2AYHA 3V64A 1NCQB 1ENXA 2FMYA 2O8OA 3WQ0A 4B1LA 5IK8A 1WW7A 3VD7A 3IIAA 4BPZA 4C90A 5EQUA 3ZFFB 3JB8A 5JXHA 4Z92B 1UZZA 1APNA 4XUPA 2YU1A 1OF4A 4LO8A 3OBRA 4XCBA 2J1UA 5FR3A 4DY5A 1IG3A 3MV01 4FVVA 4QPGC 4D6RA 2C24A 2VTXA 5KC6A 1VBB2 1FV3A 1YFWA 2BDRA 2MPFA 3B93A 2YU2A 4MO3M 5A70A 4AK3A 1IPJA 1SEFA 5D8AB 3SXWA 3T1LA 2D6LX 4JTOA 1O8PA 4HONA 4H14A 4HVRA 4CDUB 5LW9A 4FPYA 3SH4A 2VCAA 5C5UA 2WAOA 2H6CA 4YM0A 3UGHA 2FDJA 5F5CA 1V0AA 1PK6C 3VDDA 4RR3A 4QKNA 4YM3A 1UOGA 1OD3A 1ZBE2 3PVNA 3ATGA 1DQ4A 5JXIA 4XQWA 1N47A 5D21A 5FPBA 2GU9A 1J83A 1QNWA 5IT6A 2D5FA 4HPKA 2CGNA 4JV4A 4RL7A 4E9KA 4QM9A 1AXYA 4UFKA 3MZHA 2R042 1H8VA 3JBG3 3Q9OA 3ZXAC 2VU9A 1W9YA 4RHV1 4P5HA 4B4RA 3JUUA 3KSCA 4E4HA 4GIQA 2NLRA 4S2FA 2W1WA 3BTXA 2Q8DA 4A3ZA 5J36A 1R1A2 1QOSA 2WNEA 5FLJA 4L97A 4NUBA 5BNNC 2R071 5A7PA 3TEYA 1AL22 2Y6GA 1J58A 2DVBA 5IVEA 1JZ8A 2VW1A 3BUCA 2GNMA 1JHNA 1QNYA 1S0IA 3I97A 1IQAA 3F95A 4FQ4A 2AUYA 3C3VA 4BMBA 5LATA 3M8LA 2EIEA 1ZREA 5FP4A 4GJYA 1ASJ3 4EQVA 1CAUB 3RS6A 2GMEA 2WA3A 1ZBA3 1CX1A 2WO1A 2YC2A 3QACA 3CLPA 3TRSB 2XG3A 3PIGA 3DF0A 4QAWA 5A7OA 4KGQA 1I9RA 4CEWA 3BN6A 2YV8A 1C8NA 2GH2A 3C7HA 3W58A 3LE0A 4EN7B 2WJSA 4IEPA 4KNCA 3AFGA 1BCXA 3WNXA 2RDQA 3AFKA 2Y8KA 3MGUA 3UJQA 1CAWA 5GM0A 3GF6A 2TBVA 4QKBA 3D3AA 4YYOA 3AK0A 2JKBA 3AZZA 2VZOA 3RZKA 4GXLA 1PIV1 4NHXA 3O1OA 4Q0PA 2ZPXA 3U07A 4JQTA 4HMZA 4AQTA 1SQ4A 5IVCA 5J7MA 4Q4Y2 1CD3G 3AXDA 1H4GA 5BPXA 2JE7A 3URFA 4NIHA 1RJ8A 3B3QE 4FPHA 1HQWA 1FOD1 4PI0A 5F3GA 2QQLA 5FPAA 3WSOA 4CCEA 3NNFA 1TME2 2OPWA 2EALA 3WEZA 4PBPA 1UMZA 3ILRA 1JW6A 1YO8A 4JGYB 2HYKA 3O0VA 4QDQA 4C1XA 4KGGA 1R091 1J59A 2C5DA 4M0NA 4NPLA 3IN9A 4WZCA 1LB2A 4DINB 2ES3A 4MYEA 2DURA 4LBLA 1YRZA 3V56A 4AEMA 5IFTA 2MEV2 4FPKA 5GZDA 3VZJA 1SLTA 2QE3A 2ZGQA 5I91A 2E63A 1YQ6A 3MEPA 5CISA 2FZ1A 4ARYA 2WS91 3ZFGA 3ZN4A 4A7KA 2O8QA 4YZ2A 2BP6A 4Q0QA 1YIFA 1HXS3 1W06A 1QXRA 1ZZ6A 5LBBA 1YQ8A 3K3OA 1GZWB 3ILFA 4M0HA 4YW6A 3ZSLA 3AKTA 2B46X 1DGLA 3IPVB 5CADA 1AR91 3SLIA 3OEBA 4P9XA 3S5AA 4R8HA 3GZTB 2FCUA 1HJGA 1POV3 4XPVA 1ZA7A 1SLCA 4GQ7A 5GZFA 4EWEA 2W1SA 4QX5A 2OA2A 5FZFA 3H1WA 3SCFA 3T2TA 4LHLA 4XBLA 1W6MB 2RS52 5HCHA 2WFPA 1S2KA 3IDEA 5L7OC 4XF0A 3MV11 4Q4X1 3GBWA 3RZJA 1JYXA 1EAH3 1AHSA 1MS1A 3WINE 4DFSA 3ES4A 2WLPA 3WP3A 1H6XA 1GP6A 5LBEA 5FY5A 3BU7A 1HRI2 2HWC2 3H1MA 2TUNA 1EP0A 3ABZA 3KF3A 1I6XA 5CNAA 4ITCA 5JVVA 1Q5OA 4AHXA 2I2SA 1EUUA 2DCTA 3LIGA 4B4PA 1IS4A 3N7LA 4B3NA 3JCIA 4NWWA 1DQ6A 4LORA 1P8JA 1RUD3 1Q8QA 2YG0A 2VVDA 1HJFA 2VECA 3EBRA 5AVPA 5ANNA 2YPJA 4DNYA 1OPMA 3I2HA 1O91A 2VZRA 4XJWA 4ZPIA 4E4SA 1YHFA 4P5YA 1JMUB 2WR9A 5EV7A 1Q8VA 2YHJA 1LHNA 3DUIA 2EIBA 3KMHA 2Y64A 3GCXA 2G9GA 3HMYA 1DLCA 4XXAA 1W2TA 3VKFC 1UXZA 3OEAA 4YW5A 3USUB 1CAVA 1LHWA 1RUG1 5E8AA 3ZXJA 2DYCA 4LK6A 3T30A 3ZMOA 1OOPB 4QD2A 4YW1A 1X9PA 1UYYA 4XJUA 4CEYA 3NJYA 2FBEA 2PHWA 2VCCA 5E88A 2XPJA 1LEDA 3LDKA 4JAAA 5FJHA 2F4PA 1S4CA 2JG9A 2XKPA 2XOMA 5FXXA 4TSVA 4FAGA 1X8MA 1HB2A 3LA7A 1V9U2 4NO4A 3VBSB 1MEC3 5A80A 2R0HA 3WG2A 2OIIA 1LOFA 3P6BA 3BB6A 4QQLA 4AI1A 2IVIB 3RI8A 4QB6A 2WZR1 4AI9A 2XB6C 2D6NA 4IV1C 1CN1A 2VXRA 3GXUA 3WY6A 1JYVA 4M00A 1H30A 2Z4FA 4XFCA 3EXUA 3N36A 4AQ6A 1W6PB 3AKSA 1N1YA 2LTNA 2W95A 4N7IA 3GZUC 2WINB 1QKQA 3PTYA 4A6OA 1K42A 5T52A 3ORJA 3POSA 5A1FA 1PGL1 1C4RA 4RHV2 1OVSA 4PDWA 1QWRA 2ILMA 1RXFA 2VMIA 4CDQB 2OXBA 2X5IA 2VCMA 4AFDA 1OLQA 1PZ7A 2I74A 4P08A 5LY2A 3VBFB 4Q0UA 5T5JA 1HRV2 5K0UC 2WO7A 1Z78A 4QB1A 1E5HA 4FFFA 4UBHA 4C91A 4EZHA 1SACA 5FLIA 1O4TA 2LM3A 1V00A 1JYIA 2DVAA 1TQ5A 1D0GA 3LFMA 2D5HA 3GM8A 4TYSA 2BRTA 3WG1A 4NHKA 5HCBA 3WT3A 2I07B 1FPN1 2YZ4A 4V1PA 1Y9GA 1IKPA 3I2OA 3CJXA 4BISA 5FZOA 4R9BA 4FOQA 4YARA 4HZFA 3MICA 1LTEA 4A3XA 4UF0B 2VUJA 3BPSA 1VRH1 4BU2A 1SFYA 1VB2A 1DGRA 2ARAA 5FZDA 3OY8A 1JS9A 4BZ4A 1U5ZA 2DUOA 4UWDA 2WWJA 4LE3A 4XDPA 3TB0A 3K75B 1UY3A 2WFF3 3HT1A 4N43A 4C1WA 1STMA 4WM7A 4YNIA 4MGSA 1CR7A 2VL4A 3NAPB 4P9WA 4GA9A 4BQ4A 5BNPC 1JODA 2A3WA 3SISA 3G6JB 1PZ8A 1PNGA 1KGYA 1QQP3 2XUMA 4OCTA 3A21A 3E6BA 3LQCA 4XJ8A 3H42B 4B7KA 1RUJ2 4B8EA 5AC91 2A70A 3ACGA 3NNMA 4EN0A 3LEGA 1RUI3 4QGLA 1SHWB 1OUXA 4RD7A 1LHVA 1UPSA 4MV2A 1C3HA 4RN5A 4TTGA 3U37A 1QJU1 2BBVA 5LA2A 1UU6A 2OVUA 5IAVA 4YZ5A 3CJIA 1H2MA 1YIPA 4I3PA 1QY4A 2R7EB 1HQLA 1TE1B 4UI9L 2QQIA 4NRQA 4RS5A 1OLME 5JXGA 3FLRA 1W3XA 2VE1A 1BEV1 3GDBA 2K0GA 3AP5A 1WCUA 2J1VA 2RS32 4LOTA 4OUSA 5FPLA 4BDVB 5C70A 3B5LB 3NSTA 2Q4SA 4AFMA 4ZXKA 2XBO2 3KT7A 1J3QA 3N9OA 4MUVA 4ZU4A 1IS6A 4K20A 1X50A 2VQTA 2B9UA 3DXUA 4UW4A 1LULA 4K1YA 4F7ZA 1XB9A 1GOFA 1T6BX 2E7QA 2WYSA 1C8M1 2LUWA 3ZYRA 5KHIA 4Y1UA 3GHMA 5EYYA 1GR3A 4LBOA 4CDXC 1W99A 3WHUA 1J1TA 3CZJA 2DU0A 2RG4A 2UWBA 3ZMNA 5FYBA 4J25A 4R9DA 4YVWA 2CDPA 4Y5SA 1UWWA 3H3LA 1DIWA 4LJHA 3ETQA 4IV1B 3PVEA 5EYXA 1UYPA 1NA1C 3UETA 1EV11 4LOSA 2WBKA 4D8MA 2CTVA 4DO0A 1KJLA 4Y22A 4L11A 4AEDA 4PLNA 2DF7A 4XZUG 3KM5A 1ULCA 3AZWA 3I2GA 1VBD3 2JD9A 2FDIA 4AEJA 2E51A 4Q4X2 4XURA 4UFMA 3NRUA 3PUQA 4LEJA 4OI4A 1ZNPA 1EPZA 3D6EA 3TAYA 2D6KA 1RUE1 3VDBA 4XHBA 2JE9A 3H50A 4QXBA 1SLLA 5K0UB 4MADA 5FP3A 2FQPA 2V72A 1PGW1 3WF2A 2QQPA 5A32B 1JUHA 1W90A 3BALA 3H7YA 1VBA3 3HR9A 1ULFA 5C33A 1YQ2A 1AJKA 2ZX3A 3J7LA 4Q0VA 3ZKUA 3AL6A 4ZKTB 4XEZA 2RJKA 2Y38A 2E31A 5H9QA 3SC7X 1YI9A 2W46A 3VBUA 1ENRA 4LXLA 3PJYA 1W6NB 5DZEA 5JMCA 5JMOA 3E6CC 4QB2A 1QH6A 3SEEA 5J96B 4FBFA 1O3TA 4CZSA 1YWKA 3B94A 2GNBA 1ND2C 2RM21 1TEIA 1W6OB 4AHYA 1AR81 1EUTA 3AXEA 3DGTA 3V0AB 3BIWE 1XYNA 4QPIC 1AL23 1HLCA 1RVF3 2F6BA 1W8FA 2VCBA 4LT5A 1CESA 2VNOA 1UQXA 4QX7A 1ND3C 4RQPC 4JDNA 3RGBA 4YGDA 4M3CB 1WLDA 4LBNA 4GKXA 4TXWA 2RV9A 5JI7A 2OYZA 3C7FA 5FMBA 3GJAA 3OSDA 1MR5A 5I0UA 4IGOA 5FYUA 2EXHA 1YNAA 1ULOA 1XE8A 3CL1A 4FQZA 5FCCA 5B2GB 4GAZA 4OQ9A 1PO22 1WLCA 1ULGA 2PLV1 5TSWA 3R0RA 4A7YA 2R49A 1W9SA 4A42A 5FY4A 2W5FA 1LHOA 3LEKA 5FZ8A 1JYWA 4LLOA 2JIJA 1Y4WA 3MIHA 3MI8A 2WYFA 4EE2A 5FZ1A 4E4DX 3MFCA 3AP9A 4LBQB 2YGLA 4CP9A 1PO12 4MGZE 3O1PA 3JU9A 4EYUA 1LECA 3AJZA 1QDCA 1H2LA 3B9CA 3DCQA 3H7JA 3ZXDA 1GWMA 1VBC3 5E89A 2XUEA 2P6HA 3RYKA 3DPRA 1ULEA 5L9VA 4BQ2A 1GU3A 5I0TA 1WUVA 5AFBA 1H8TA 1PVC3 1V6OA 2DCKA 2ZGPA 3OUIA 4DQAA 1AZDA 2FMDA 4XUQA 1ONAA 1MS5A 2PAKA 4BQ3A 4IEVA 3BTYA 1WGPA 3RQ0A 1WA4A 5C4WC 2XQRA 4H3WA 1NKGA 3PLQA 4AI3A 1VBB1 5I8SA 5I0RA 1ENSA 4LULA 1CAXA 5AFEA 4NOTA 3P5BA 3MO4A 4XQ4A 1MZEA 3EJKA 2QCSB 2ZGRA 1MPXA 3PUAA 3ROUA 3NQHA 3T2QA 3ACIA 1FMD2 1QHDA 1XPWA 2VUAA 1DQ5A 3NVCA 1GNYA 5GLUA 3THTA 2Z79A 3W9AA 1QJX3 1SDWA 2J1AA 1COV2 3Q8BA 4YM2A 3GZEA 4QPYA 2RMU3 4PQQA 3LF7A 5GLVA 3VBOA 4AAXA 5A3TA 4S2DA 2KXLA 5KBFA 1FPN2 5FKCA 1ZBE1 3N9PA 4MXWA 2YPDA 1POV0 3AC0A 1LGNA 1NA1B 4JRAA 4XACA 4XBQA 5A7WA 3WR0A 5LY1A 2BGCA 2WT2A 4GH4C 1Y9MA 5I93A 1RUC3 2JX9A 3ZKYA 2JE8A 2R041 4D7SA 3RJ2X 1DGWX 2VMEA 4QDSA 3ZYPA 3OPWA 1AX1A 5FZLA 1JZ5A 1K5JA 3FFQA 4E2SA 3T1MA 4HPKB 1L7QA 2NQYA 5JUVA 4V2VA 3FBYA 3OTFA 4QHOA 3VV1A 1WCSA 1R1A1 3S30A 2PXJA 1JTZX 1VPHA 5F5QA 4Q8KA 2GAUA 1QJZA 4Q1RA 2BNNA 2GNTA 3K77A 5LWBA 1RL3A 5BNOA 1AR63 2HEVF 1DFQA 1UZWA 4UFJA 5JOWA 4BK4A 1WD3A 4PBOA 2E53A 3BODA 3DL3A 3I59A 4AG4A 3AP4A 2C9AA 1J1LA 1W6QA 3M3CA 3ME2A 1ND2B 4UW5A 4Z07A 4Q4V2 1QXJA 3N9LA 4YRDA 4XDQA 1NCQC 3ASIA 1W0NA 1ND3B 3FUOA 1XU1A 2X53S 3ZSJA 4GMP1 5BXXA 3ZFFC 1FNYA 2NZ9A 1J84A 5KHHA 4FTSA 1H0BA 4P02B 4JKKA 1UCXA 1CJPA 4IEUA 4AR2A 5SV5A 1O3QA 4IEYA 4DEVA 2QUOA 2JB8A 3ZFEC 1CZSA 2VTXJ 3IAPA 3LCPA 4UAPA 2CAUA 4UT5A 4UW3A 4CP2A 3E5UA 4PJYA 5D8AC 5IUQA 5IATA 1DZRA 3NKTA 5A1LA 1H6YA 1KD7A 2OZJA 3HNMA 4G4FA 1MACA 5FQ0B 3TEXA 4CDUC 3Q8FA 5FBZA 5A1AA 2GDFA 3A22A 4BQ1A 4CCOA 3VKMA 5FZ4A 1BYHA 5FZAA 4BQYA 4PIXA 1UZ0A 3AZXA 5FPUA 1OMIA 4AGVA 1OSGA 3UT0A 3ZX7A 4A44A 3BI3A 5A3PA 1GQPA 4HK8A 2YFUA 1TME1 5I8YA 2HWB2 4NRMA 4XE9A 5FYIA 3WXPA 1NE6A 3I3QA 4HG6B 4BQXA 4XF4A 4UOJA 5FMOL 1UIJA 3THPA 4HLTA 4RA0A 3WNMA 4MGYE 3NL1A 5FMOS 3WUDA 3ZO0B 4QMAA 4WM8C 3OUJA 3AZYA 4QDRA 2Y34A 1WWYA 3EYPA 4CDWA 1CX4A 4XVHA 4F3JA 2MEV1 2HWD2 1A6CA 3H1YA 3KB5A 2J1SA 5FO9B 5DAPA 3SMHA 5C3QA 2W91A 1FI2A 5FPZA 4AFAA 2BBAA 3PVOA 4CXYA 1JZ7A 4IEZA 4DZGA 3MIFA 1YFYA 1G9DA 2EAKA 1XRUA 3NV3A 1YLLA 4JQRA 1W05A 2AEYA 4RHV3 2FDFA 3MLKA 1GFF2 4IGPA 3NJZA 3ZFGB 2ZGNA 4CTEA 1M4WA 1Z7S1 2C4XA 4DPNA 1RXGA 3KVAA 1RUF2 3I2FA 5FJKA 3SCGA 2WT1A 4BA6A 4Y1VA 1JU4A 2R073 4UXAA 2RS51 4QX1A 1TMF2 1RUH2 3I4IA 4EWAA 1OFNA 4A4AA 1V6MA 1IS5A 3C7OA 2OZ6A 4AI8A 1OQ1A 2QNKA 4AGGA 4K8RB 4KWUA 4AVVA 3N9QA 1LOCA 4UW6A 2K2SA 2GC3A 2QQJA 4NAMA 4P9JA 4Q26A 1POQA 4CU9A 1XU2A 4IE4A 4KBBA 4TZDA 2EIDA 3UYJA 1BVP1 2H0VA 1OFSA 4Q4W1 2A73B 3BYWA 3VZNA 3GCWA 1HRI1 1Q8OA 2HWC1 5CAZA 3WCRA 1U12A 4MGTA 1KITA 5GALA 2ZAAA 2ZKNA 5L9RA 3O0XA 1F4AA 1B35A 4XMIA 1AYN2 1IGOA 5JXJA 2EXKA 5FPXA 2UWAA 4RGAA 5E16A 5F2SA 2A6VA 2WO2A 1DYPA 1S0DA 1QMJA 1GSLA 4Y24A 1S0FA 1RB8G 3AMMA 1MS4A 4JCKA 1SG3A 1PIV3 1O4ZA 2O14A 1J3RA 4JGYC 4YW3A 3O14A 1X8EA 3K3NA 2VZUA 4FSJA 1JI6A 1F5JA 2XVKA 3KCXA 1CONA 2ET1A 3LOIA 4AF9A 4OHYA 1SDDB 5KHGA 4GWJA 5A33A 2CWSA 3LEMA 2W2IA 4YM1A 3ZFEB 2HJIA 3ST7A 1FOD3 1UAIA 1Q56A 3LDRA 1DQ1A 2E33A 1Y9QA 4Q8LA 5CFCC 5IVBA 4N53C 1AYM2 5KHJA 3UGFA 2XLGA 2I45A 1JYTA 1YJKA 3H8UA 5DAVA 5LA0A 1HB4A 1R093 3LKJA 4E8CA 1UZVA 2DTYA 1GOHA 4XJ9A 5F32A 1BK0A 1V9U1 1JH5A 4CEYB 4DOUA 2HEYF 3BTZA 1ENQA 5HV0A 4FFHA 2VBDA 1LCLA 1GANA 2JG9B 2VNVA 2ZX2A 1URXA 1MQTC 4NIIA 3RRDA 3CDZB 1IHMA 3VDCA 3X29B 1AX2A 1LODA 2WS93 3FUQA 1W04A 2VOVA 4A45A 1CQ9A 1GBGA 1UY4A 3FMGA 5C8CA 4KWJA 2ZMKA 1DQ2A 2ZGUA 2AC1A 4QX8A 4WM8B 4FO9A 4PT6A 2ZACA 3BTAA 2P4EA 3AM2A 5FZ3A 1AR93 4OI2A 1TZOA 3E5XA 2DVFA 2ETEA 2WT0A 2XGXA 3D82A 4IEQA 4AZZA 4LA3A 5EZWA 1BBT2 1HRV1 1XC6A 4XFHA 3ZPOA 1ZZ7A 3AKRA 3OPZA 3N3HA 3VGIA 4BHPA 4CUCA 3WG3A 4AE2A 1YEWA 3KZ4C 2VBPA 1BK1A 1US3A 1K45A 3HJRA 4Q4X3 1JUIA 5EHDA 4AFCA 2OS2A 3V0BA 2FDHA 5JPNB 3RYPA 4FTEA 1MZ6A 1YQCA 2LW8A 3NNLA 4JC1A 3LSDA 1QGLA 2GP3A 4NPMA 2UWCA 2BJSA 1AVBA 3T09A 3APBA 5CKQA 2QKDA 2ZEYA 3UESA 4CU6A 2IXHA 4XF9A 1UF2C 1NQDA 2OW4A 1NZIA 1SZBA 2A5ZA 2VZ1A 1UO9A 1GZ9A 2V73A 1TNFA 4XAAA 4G9SB 3FZ3A 1ZZ8A 1DP0A 4QPIA 5EJZB 1OOPC 1VBE2 4FT8A 2VUDA 3MW3A 1GNZA 2DFBA 4X8NA 1ZX5A 5G05L 4Z1VA 3J7NA 3J8F1 3M3QA 3WP4A 4GB32 3KV9A 1DZTA 5JZGB 1QXPA 5F1RA 3JB4C 5LBFA 4COUA 3S7IA 3EQEA 1RUG3 3IMMA 1RUJ1 4LO4B 4N43B 3VBSC 4WM7B 1GYKA 2QQKA 1W8OA 4JVAA 2BOJA 2WNVC 5KXBA 4LIUA 3WQ7A 5C9AA 3I49A 1XSRA 4INDA 4TLFA 4NIGA 2X8KA 2BNOA 3A23A 3ZN6A 5HXVA 5CBLA 4RSUA 3D5OA 3KQ4B 2UY8A 3ZSMA 2BERA 1WMEA 2RS31 1MS9A 3OGSA 2IXCA 2PN5A 2XBO1 4KH9A 2J1TA 1NLQA 3N4MA 4AVAA 2B4KA 3CJIB 1OT5A 1YI7A 4E2QA 3FL7A 2Y6KA 4YGCA 3JD72 3VBRC 2ZGMA 4CDQC 3W20A 5CFCB 3VBFC 1LOGA 2J1EA 4N53B 2WZR3 4MLOA 1WW5A 4B4QA 4UBGA 2OQ6A 4YZ3A 4OFGA 4BLIA 3UNPA 1OURA 1W2UA 2Y6FA 3P3PA 1WMXA 3PDQA 1V6LA 2SLIA 3KCCA 3RYRA 2P1BA 3ACFA 4LUKA 5FPVA 2HWE2 3FX3A 4XFGA 2HH9A 4PF1A 2ZX0A 3OOXA 3VBHA 1Z7S2 1MQTB 5JOXA 1WCKA 2F17A 1VMFA 1W3VA 1SPPB 2GH8A 2QJVA 3ZM8A 5ABJA 1UPIA 4YVWB 3J7HA 3ACLA 1LGCA 1WLWA 2YDEA 4D6SA 4EJRA 4LKDA 4WVMA 2EAAA 5FP8A 2HWF2 3N35A 2QQUA 4HT1T 4FPEA 4W65A 4M01A 2OUHA 4XUTA 1H1IA 1REEA 4E27A 4NIAA 1UD1A 5L73A 5KXCA 1QJY1 3ZIXA 1UNBA 4QXHA 5HV4A 1SLBA 1WW4A 4OHXA 2V4AA 1W2NA 4Q4W2 4XF1A 3FC0A 4L2NA 4LBJA 2E7TA 4XILA 1UKRA 1JN2P 3NAPC 2XJSA 1A78A 3IZOA 3HQRA 2BYVE 2WLQA 1VRH3 4WBBA 5DQ0A 1K5MC 3P3NA 5J98B 2PHRA 5IK4A 4EN6B 4FPGA 3U0ZA 1CIYA 1RGSA 1XXNA 3RFRA 5IYYA 1ODMA 1G86A 1X33A 2ARXA 3PMSA 4JGZA 4TLGA 2QBXA 1XYPA 1UKGA 3Q8CA 3AMPA 4QKDA 4YG0A 5DG1A 3WP5A 2XKOA 3KWVA 2JG8C 1S0CA 4FP3A 1A8MA 1RMU2 3M70A 2VOWA 4XBNA 4YVSA 2BUKA 3VBUB 1GZCA 3VKNA 3WF4A 3O1UA 1CWPA 1ZRCA 1R1ZA 2D97A 1NXD1 5AC93 2X05A 5ACA1 2Y0OA 2AENA 4P9YA 3AP7A 5CG8A 5F5AA 1EPWA 1QJU3 5IFPA 4N9IA 3U10A 3LIHA 4DXTA 1PO21 1SMVA 1JHJA 4HETA 3I2KA 4NHYA 4PF5A 1RUNA 2R062 1BEV3 1UY2A 4I09A 3GALA 3S6PA 2B5HA 1XOYA 1H1AA 4NIDA 2JJ6A 1QEXA 2PAMA 4XAEA 4HSLA 4AGRA 4QQ2A 1PO11 4KMQA 4EN8B 4F8AA 5BUVA 2WNVB 2R30A 3PIJA 5D1IA 2ZMLA 5DN2A 2R0FA 3RWKX 1W03A 1C8M3 2WNUC 1DZQA 5J1XA 2YFZA 3A4UA 3OBAA 2IWGB 2VR4A 4W6YA 4Y5TA 3FLTA 3NV2A 4J1XA 1SCSA 2BW8A 3MF9A 2E9QA 4FP2A 2YC4A 1S0GA 2GZWA 4GD4A 3VBRB 3H0OA 5FP7A 5LEJA 3RG0A 2Z2SB 3POWA 1QOOA 3DPRB 2PQSA 1BZWA 1F31A 2ZHNA 3MIBA 3ZDVA 2NMOA 1H8TB 2XJUA 4XIKA 1EV13 2ATFA 3T0BA 5DZFA 4W8JA 1D4M3 4X6RB 1FMD1 3ZYFA 4A7ZA 4MGIE 2EXJA 5LRRA 1OLMA 5T5LA 5JCTA 2P3JA 1BMV2 4IV3C 1COV1 5IVJA 3AKPA 1OHFA 3U4XA 2W08A 1CAXB 1OI6A 1K12A 2VNGA 3BVCA 3LZZA 4LKFA 4PLMA 1PVXA 1RUE3 5LB6A 5EIYB 5CG9A 3E5QA 4NN0A 2FCVA 1NE4A 1KQRA 1J3PA 2VUCA 4OVEA 2IXKA 2ORXA 3MHZA 3POYA 4YPJA 1NCRC 1SBFA 1NOVA 2XL9A 5FZCA 3UL2A 2BPA2 1CAUA 1QH7A 5FYSA 4MSVA 1AR71 3JZVA 1WA6X 4L0PA 5H9RA 5JSOA 1W0PA 1LGBA 1O4YA 1QIQA 2ZS6B 4CP1A 4NHMA 1N1SA 4HKOA 3W5MA 3RZMA 1R082 1DG6A 4FPLA 1F5FA 2CL2A 3KV6A 2RM23 3KHCA 3B01A 2Q0AA 4QXCA 1AR83 4E4ZA 3AMNA 3VL8A 3I3EA 5DUUA 2XL7A 1NG0A 1DGRN 3FFZA 3J8F2 4V2WA 4XYXA 2Y6HA 1UU5A 4K7JA 1NLSA 1NZCA 2XQXA 4QU1A 2XHKA 1K5MB 4Q27A 4X8PA 1N3QA 1C1LA 3PUHA 4WV8A 2WAAA 1U0AA 3GNEA 5B4NA 1WW6A 2KM2A 4WVVA 1W2AX 2W47A 2EVXA 3CBNA 3QH7A 3T4HB 1RHI1 2XXZA 4M3CF 3U78A 4E8DA 2RE9A 1S2EA 4D0QA 1SFPA 4G3YC 4OMDA 4Q4V1 2JG8B 3WW1A 1U5YA 1VAVA 3M3EA 1O3RA 1D4VB 1FAYA 2BV4A 2PLV3 4XIOA 1ZRDA 2BTVC 4O9EA 1OQEA 5HBAA 2WZEA 1PMIA 1ZRFA 5J09A 3POBA 4LR4A 2QTWB 4CDXB 3K4ZA 1AL0G 4LTAA 2XONA 4Y1XA 2RS13 2RJ2A 5FIXA 4L8QA 3J26N 1KRIA 2E7AA 1NUKA 1UZYA 2BGPA 2XJVA 1YYNA 2J22A 4LHNA 5FZHA 4BXSV 4QPGA 4F83A 1DQ0A 1F8VA 4COZA 4ARXA 5K7PA 4UFHA 3ZVXA 5I0DA 2BEOA 4DEQA 3CHXA 4IESA 1U5IA 2IXJA 1FNZA 2IZWA 4Z82A 5FK7A 4Z2AA 1MZ5A 1LKNA 1M06G 4R4ZA 1VBB3 5LEKA 3H8RA 1V70A 2HWB1 3FHQA 2LALA 2WNUB 1GZWA 3BOPA 3HNBM 1PK6A 3OYWB 4N9HA 3WNKA 3AP6A 3OD4A 3IPVA 2EF6A 1TG7A 1OC1A 3VDDC 4RR3C 5T54A 1WMFA 4RYDA 5F7UA 1VALA 3LWCA 1DYKA 1OF3A 1UX6A 2WN2A 2XMLA 3JBG2 4CUBA 4NMIA 1QJY2 4QHZA 2HWD1 4HL0A 3PU3A 1ZBE3 2GN3A 5FOJB 3RZHA 1IQDC 1VAMA 2ZMNA 4NWVA 4IQPA 1W8WA 1AXKA 1NY72 3ZOIA 5JPMB 1DDLA 4MHRA 1RINA 4GWNA 4XETA 1A8DA 3KS7A 3PU8A 1KXGA 5HCAA 2HBTA 4CCCA 1PGSA 2R043 1OA4A 2P3IA 2PYTA 4IV3B 5DDJ1 3UK9A 5L19A 4JZRA 3TN91 5FYVA 1WZXA 5BNNA 2AGSA 2RDNA 1XSQA 3UV9A 5IK7A 3A7QA 3UGGA 4FPOB 5CFDB 4YW2A 2JDZA 4HK9A 1DBNA 1RUF1 1ASJ2 4CUAA 4ET7A 1R1A3 5CIRA 1GQGA 3GBFA 1ZBA2 4HXCA 1IS3A 1MVEA 1NCRB 1TMF1 1RUH1 2WDBA 5FFOC 3WW4A 4A6SA 4CA9A 5JWPA 1S0JA 2XH6A 3AMQA 2Q8EA 2A6WA 2UYBA 1W9WA 5ACA2 5E1RA 3OJBA 2WA4A 3VHOA 3MW2A 5CB7A 4CEWC 1GQHA 3C7EA 4IDZA 4OI1A 3T4VA 3NNJA 3VD3A 5ISLA 3WUCA 3USUA 1O59A 2H0BA 1QU0A 4AVSA 3AYEA 3N7MA 4BQ5A 4GMP3 4LO6B 4ZONA 3TBDA 2D3PA 1VLNA 1O3SA 1AYN1 3INAA 1HDKA 5FREA 5C7GA 2IUWA 4K3UA 4AL9A 4ONUA 5EJ1B 5FY9A 3HT2A 1JOBA 4H2AA 2L9LA 2PHDA 3WNPA 5F8PA 2CV6A 1VE0A 1B35B 3M4FA 2F4LA 3JQXA 3OB8A 3TEWA 1BKZA 2VPVA 2VQAA 4LKSA 4BXFA 3AYAA 1OVPA 1N3OA 1X82A 4ZY9A 5GZGA 2PQQA 2VZQA 4Q4Y3 1DLLA 5IK5A 1W2OA 3FHAA 1O8SA 3G7DA 4FOYA 4JDOA 2PHUA 4QGMA 4CPBA 1TME3 2WZ8A 4GKYA 4NPRA 1AYM1 2Z42A 3O0WA 3IBMA 5CZKA 2VW0A 2VQUA 3HAGA 5JI9A 4IE6A 3ZSKA 2JENA 3AL5A 1YUDA 2OX0A 4K8FA 3QCWA 3ZN5A 1CIWA 4YFWA 2MEV3 3VB9A 2BFUS 3ZFGC 4CPBD 5BYNA 3IT8A 2A3XA 1JZ4A 4D6QA 3H8OA 2QQOA 1O6UA 1VR3A 3LSEA 4GALA 3ILNA 2NYYA 3PHMA 2ZX1A 3OD0A 1SLIA 4QXKA 3LGRA 3VDDB 4RR3B 2OUJA 3ZYBA 4QKFA 3WX5A 1AR72 1EYBA 1QJEA 4IE7A 4AI0A 2WABA 2C9KA 2A6YA 5C6CA 2Q1FA 3CU7A 3VD5A 2ZAHA 4CCDA 4RGGA 4LIVA 4LMFA 1LAJA 2PELA 4XUNA 5L7OA 4BK5A 1Z7S3 3HBZA 1EAH2 3ZXKA 4AVTA 4BOWA 4IE5A 2P3YA 1BBT1 2JXAA 4UF0A 5C8CB 4ZS3A 5FXVA 4QT6A 5LK5A 3HNYM 3I2IA 4E2GA 3GZAA 2RS53 4CU8A 5LA1A 2P34A 2ZTNA 3DKWA 3PTRB 2QZ3A 4XABA 5A3LA 5FLHA 1HB1A 5CKNA 5A7SA 2JEMA 2AACA 4NRPA 4IGQA 2VGDA 1QOTA 1Y3TA 3UJOA 3H8XA 3VN4A 3SCHA 1RHI2 5GKAC 2PHLA 3HN3A 5C8WA 3WF3A 1AXZA 2D3RA 4CCKA 4Q4W3 5GLZA 4URAA 5FZBA 5KR7A 5GLWA 1GP5A 1HRI3 1WKYA 2HWC3 2MNGA 5A3NA 2ZZQA 2ZHKA 3IWZA 1UY1A 5FO7B 3MIEA 5FUNA 2ID4A 3WQBA 4JTNA 2IXIA 1JYNA 3D4KA 4NR1A 3AMHA 5GZEA 3CKHA 3R4UA 3ECQA 4AQ2A 4BMEA 4OZOA 4SLIA 5JIUA 1YCIA 4XOGA 2ZEXA 1DF0A 4L92A 5T5OA 3WQ1A 5FV3A 4BYYA 1VBE1 4CEWB 4LHSA 4CUGA 3QLQA 3QD6A 4P9LA 4PCRA 2ADDA 4XFIA 1GWLA 4ISRA 4XFBA 1HV0A 5K9YA 1LNSA 1BLZA 1D2SA 4GZ9A 1O5LA 1H2KA 4GB31 1CAWB 2DCJA 2JDYA 5T55A 2EICA 3MUZ1 4COVA 2ZGSA 2MHFA 2WC2A 4CEYC 4IEXA 1WLTA 3KT1A 1MEC2 1IZ3A 1W8UA 1YXWA 1TNRA 3SKVA 1V6JA 3K46A 2DV9A 2JG9C 2N7GA 4D7YA 2JWPA 2ZHLA 3GHNA 3KGZA 3DEMA 4ES8A 5FXZA 2ENRA 1ZZBA 5B4XA 3S5QA 3THCA 3ETPA 4QX0A 4CXXA 4URTA 1KS4A 3USSA 4IV1A 4KG8A 3J4UH 1OD5A 5A3UA 2KR2A 1V9U3 3S57A 4IE0A 1JZ3A 2B7YA 2NMNA 5C9AB 1A34A 3JD71 1LEMA 3ZSEA 2WUHA 2YMZA 2W52A 1Y7BA 2VD7A 4CYDA 3AVRA 1BHGA 1VIWB 1DHKB 4NE9A 4FPFA 3IDCB 3KCYA 3PUSA 4PDWC 4ZS2A 4OHVA 2P5BA 2ZKLA 5DDJ2 1IG0A 2X5IC 3CF6E 5K0UA 3TN92 3EO6A 2JDHA 2WQZC 2HWE1 1HN0A 3LAGA 4ISQA 4Q5OA 2VVEA 2XDVA 4BJ0A 2FHRA 3M7AA 4JX0A 4N90A 1OA3A 5FTTC 3SQOA 1HRV3 2VH9A 3AB0A 1DU3D 3B9IA 4S2GA 3PL0A 5KXDA 3RMYA 4LITA 3CO2A 4DRRA 1O5UA 5CEHA 1W6NA 4KI5M 4IUGA 4CU7A 3MIGA 2HWF1 1Y43B 4BM8A 2LROA 4J6GA 1VRBA 3NKGA 1SFNA 3V0AA 1XYOA 5ABJB 3C8XA 3ALQA 4FTBA 2IFRA 3SKJE 3EB7A 3LPGA 3CMGA 2DBNA 4WVMB 4I0BA 4XHXA 2XWJB 1WBLA 3C7GA 5LBCA 3NJVA 3ZXFA 1GKBA 1XNAA 4HFSA 2CDOA 2Q30A 4LUMA 3IMNA 2WWUA 3HQUA 2P17A 5GJ6A 1CZTA 5JZGC 5C71A 5KWRA 2ZEZA 4N43C 1CZVA 4WM7C 5BNPA 3K4DA 4DUXA 1ZZ9A 4QQPA 5DXDA 1F35A 1RUI2 3FN9A 4HOOA 3SH3A 3R6SA 5LASA 2VZVA 4J1WA 3GGLA 1WBFA 1YJLA 3RJRA 4LBQA 1RMU1 1OXCA 4XF3A 3J8F3 5A6QA 4Y20A 3CZUA 4NJ4A 1JZ6A 4HKLA 2G19A 4JGZB 1O7FA 4OYUA 3B02A 3PMEA 1RUJ3 2JDPA 1UU4A 2UYAA 1C57A 4EWDA 3CJIC 4OHWA 1XNDA 4YSFA 4LPLA 2DCZA 2W87A 4FOVA 2V5YA 3D8CA 2NP0A 4PLOA 4JKMA 3D0SA 2P2KA 4HANA 2VO5A 1XNCA 1WD4A 1CAVB 5FY1A 1OQDA 1TVGA 2R061 3HWJA 4OHZA 5KXEA 1FT9A 2VC9A 3E97A 2RS33 1GNHA 1N1VA 2K9ZA 2W92A 4HN1A 2XBO3 3MYXA 5JR7B 2WKKA 3POGA 2JD4A 5A6YA 4CDXA 5AVAA 1RUOA 2W1UA 2VVFA 2Q8CA 3HOBA 1H4HA 3AYDA 4FPJA 4M3CE 4YGBA 4SBVA 4ATEA 2E6VA 3FLPA 1OKOA 1NXMA 2Q1MA 2PMWB 2PA7A 3VD4A 4YVWC 5FKBA 4Y1ZA 1OA2A 2DTWA 1CPMA 3FWEA 3O7OA 3I2DA 1NA1A 1VBD2 2D3SA 1C5IA 5SV8A 1H9PA 3DV8A 3N9NA 5DMYA 4XCAA 4Y4RA 1Q8SA 3HEIA 1KDKA 3ON7A 4AEDC 4EZ4A 4MVTA 2ARCA 2V5DA 5LRSA 2GP5A 2WSUA 2DFCA 3LOBA 4PDWB 5FYYA 1GUIA 5FAXA 1RJ7A 1VBA2 1GWKA 2HLEA 2X5IB 1BMV1 1LOAA 4ZU5A 1LOBA 3O1MA 2C26A 1MZFA 3ACHA 1XE7A 5FOBB 2WL1A 3E1F1 4BCUA 5EP9A 4IEWA 1QJY3 4ZHNA 3T0DA 4OI0A 1NYWA 1UX7A 4XTMA 3RDIA 3OG2A 1RC6A 1W8ZA 2C1FA 2NN8A 5IJRA 3WVJA 4XZPA 3WW3A 1HX6A 3FJSA 2YROA 3MLJA 2A75A 4CSWA 5J3UA 1N3PA 4UFLA 3VBUC 4JKLA 3K4AA 2GC0A 3WW2A 1ND2A 1MVQA 1RVF2 1ZYBA 2XJPA 4YG3A 2ZA9A 5FZOB 4AW7A 2BWCA 1PHMA 1R081 2A7AA 1ND3A 2ADEA 4RQPA 1D0HA 1JBCA 1Q8PA 3DYOA 4HVQA 2E32A 3IB3A 4FOWA 5FZ7A 2VZSA 5JIAA 2HYXA 2X09A 3OY8B 1ALYA 2ZJCA 4XQDA 4L9BA 5FY8A 4IL7A 4IETA 1W28A 4GMP0 4PI2A 5ACA3 2YGMA 5CA6A 3MBWA 4CCJA 1IOAA 2DUQA 2BNMA 2QZ2A 3D0JA 3RI9A 5FQ0A 1VMHA 4TN7A 2RR11 1U5XA 4HVOA 5T50A 5KC5A 1LHUA 5FYTA 3SEPA 2BVVA 4MXVA 5KHKA 1PO23 2B9VA 2GNDA 1UOBA 4OUEA 4UYBA 2YB7A 3RSJA 4M4RA 4Y5Z0 4LO7A 1VBC2 3MDPA 3T2OA 1UYXA 4H55A 4XJZA 3R4SA 3C2UA 4PIYA 1ZZCA 2OT7A 1PVC2 4QHBA 1KFUL 4LLFA 4D69A 1PO13 3BPZA 2HKXA 2D44A 4CCLA 2C0ZA 1FATA 2QFEA 4RS5B 2Y0IA 2PFWA 4BB3A 4D7TA 1GV9A 3DPRC 3KQRA 3ELNA 1H8TC 1DGWA 3LA2A 2BZDA 4XDOA 3NV1A 5A7QA 1OBNA 2VTFA 2ZZJA 4ZXEA 5C4WA 2FCTA 3AKQA 4UFIA 1DYOA 2DVGA 4ZU7A 2VG9A 4FXKB 4WVWA 1QJX2 5DAWA 5FYMA 3VDAA 3POJA 4COYA 2HEWF 2RMU2 3VUOA 3OBTA 4QPGB 4QM8A 3S7EA 5FZKA 3TYJA 5EXOA 2ZGLA 1Q43A 3CEWA 3OF1A 3HBKA 4XJAA 5APAA 3U14A 4CCMA 1FMD3 1H1MA 3NW4A 3BCWA 5DUXA 3VBOC 3U1XA 5LZ6A 1RUC2 2RJLA 1EY2A 1COV3 1PM7A 5EFUA 1E5IA 3JBG1 2OKXA 1JZ2A 4GH4A 4ES9A 2W3JA 3KV4A 1FPN3 5FP9A 1PK6B 1SCRA 2IFWA 3B7MA 4Y22B 4W6WA 1JXNA 4AEDB 3MPBA 4RFRB 1NY71 2VMCA 3IDBB 1W0OA 3O1TA 2BVBA 1RIRA 1SBDA 5EPAA 5IVYA 1VB4A 3WNOA 1S55A 4PQ9A 2Q1ZB 3WF0A 1AX0A 4QX3A 1UL9A 3SHRA 1T6GC 2R1DA 1AR73 4U36A 2UY9A 4BLJA 5LCWL 1AR62 5FZEA 1IPKA 2JDAA 3NWKA 4O65A 3WD5A 3W5NA 4XFAA 1ASJ1 4Z2WA 1LENA 2OPKA 3ZLIA 1G9FA 3FE5A 3WCSA 1SBEA 1ZBA1 4BH9A 2EIGA 5BNOC 4U2AA 5BNNB 2JDMA 3I3BA 3IAQA 3BIEA 2D43A 2PHTA 3AVSA 4MX3A 5BY5A 5FYCA 2VMHA 1S0EA 1N1TA 1HW5A 3DYMA 3OPTA 3THDA 1NCQA 4YGEA 2YC0A 1RHI3 3HIFA 3AJYA 4R9AA 3S0MA 3ZFFA 1R64A 4OUMA 1D2QA 5BNPB 4Q4V3 2J7MA 3RPQA 3MUY1 4Q29A 3BOWA 3KGLA 1I1EA 1VAKA 2XLAA 5E6HA 5F5IA 4RFT0 1XQNA 3ZFEA 5F6KA 4AI2A 2A6XA 3RNSA 4BE3A 5JSRA 3FHIB 5D8AA 3LA3A 5FRAA 1LU1A 4CDUA 1L3JA 2LRPA 4LO5B 4X6QB 3J9SA 2WO3A 4K1ZA 4DXZA 5F37A 4I01A 3LFIA 1LJ7A 2AH2A 1OKQA 3PJQA 4MGKE 1HN1A 5D2AA 1CVNA 4CP9B 2VJXA 5H9PA 2P6CA 3FBMA 4HBNA 2KA3A 2WRAA 2D6OX 1SLAA 3SITA 1G9AA 1F15A 1PMJX 1S1AA 3KF5A 3U75A 3F2ZA 3LPFA 3WZ1A 3MF6A 1RITA 3DXTA 3OGRA 4IW3A 2K46A 4HSJA 4WM8A 2HWB3 1IPSA 1QDOA 4QQOA 3TNPB 3HPNA 3O5SA 3H3ZA 5DAQA 2D6PA 2H6BA 5FDBA 4KQ7A 2FD8A 4CDWC 1ZRIA 3OGVA 2RHPA 1ULPA 1UYZA 2X10A 3QOPA 1NX9A 1HQNA 1HXS1 2RDSA 2YBPA 5J37A 4DUVA 5FWEA 3SNMA 1VMJA 3MW4A 2ZCWA 1F2NA 4Y1YA 5JOZA 5FZ6A 2HWD3 2XJRA 4B29A 3AX4A 3I3MA 4R52A 1G8WA 5CFDC 3LD8A 4YFZA 3M3OA 3N7KA 3GJBA 4FFGA 4MZUA 2XWBB 1POV1 5FY7A 1C28A 3VBOB 1X36A 3ZIWA 1PX4A 2R072 4DMIA 5T3NA 2LS6A 5DDJ3 5K4LA 2VZ3A 5GZCA 4MXWB 3TN93 4NVPA 1XNKA 3DYPA 5A7WB 4IEOA 5FBJA 3NV4A 3WDTA 3WV6A 2D93A 1HV1A 4LHKA 2GC1A 1EAH1 1YQ5A 1B09A 4XFFA 4CP0A 1RUF3 4MH0E 3R05A 4O9GA 4YLZA 1UN1A 3GYDA 4EROA 2C6SA 3MLLA 2BGOA 3U4SA 1X9TA 2YYOA 2IXLA 2ZGKA 2CSGA 1TMF3 1RUH3 3POIA 3VZKA 3UKVA 5FYZA 4DXSA 3PVBB
chains in the Genus database with same CATH topology
3AYCA 5L7OB 2QDNA 3KD4A 1CGPA 4L99A 4JDMA 2RR12 1RUD1 2XJQA 3NO8A 5JZGA 1CPNA 2ZABA 1ZVFA 4JRLA 5BNOB 1LU2A 4I30A 3UKNA 4XXPA 2ZX4A 3I59B 1B35C 3WDYA 2WSVA 1PIV2 2ZBJA 1W6QB 3L2HA 3N7JA 4K9SA 3B00A 4C0BA 1HIXA 3I54A 1AYN3 1UIKA 2PHFA 4JGYA 2VW2A 2FZ2A 2GMPA 3MIDA 4XMAA 3RWNA 3RMXA 1FOD2 2QVSB 4XTPA 4BA6A 1REFA 3VL9A 1Z0HA 4OULA 2UU8A 3UKTA 3VKLA 3EHKA 3JQWA 5CFCA 3QH6A 4N53A 1R092 3OCPA 4AFBA 1AJOA 4BIFA 1MEC1 3ZXGA 4H7LA 3ZDSA 4COWA 4YG6A 1E57A 1AYM3 5I8TA 2B42B 5K8SA 2XVGA 2PAEA 1FV2A 2TNFA 1KJRA 4KU8A 1JOJA 2WS92 2PHXA 5DG2A 4EV0A 5CU1A 4Y26A 1MQTA 4FAHA 4LNVA 4BWOA 3VKOA 4AYUA 4DRVA 1W6MA 2SBAA 3R4DB 5DZGA 1AR92 3ENRA 2Z69A 3ZYIB 2DVDA 5C8CC 4N7UA 1LR5A 4K21A 1I5ZA 2CAVA 1F9KA 4I0AA 4CDWB 4AQSA 1FX5A 1D4M1 3VLBB 5BV6A 2WWSA 2R16A 1S2BA 1V6NA 2NPIA 2ERFA 2P37A 4S2HA 4UXAA 1NQJA 3KT4A 3L9JT 4Z8BA 5LK7B 4K6BA 3CNAA 1JYCA 5A3MA 1BBT3 3VHPA 2W0XA 4AVCA 1REDA 3E6DA 5HCFA 3WOGA 2VOXA 2VNRA 3M2MA 3MFAA 3WHTA 4FPCA 1WMDA 1WCDJ 4AWDA 3U11A 3VZLA 3A0NA 2GSYA 4META 4DB5A 3K48A 3H9AA 4KWKA 5EWSA 3WDXA 5DUWA 2WFF1 3OGJA 5H9SA 1OOPA 2CWMA 4AXOA 2AR6A 2VY0A 4AVBA 2B8MA 1QQP1 3RZZA 1RUG2 4XW3A 1BQPA 1VBE3 1RUI1 2VMGA 1ZRRA 2D98A 3VBSA 2D6MA 2Q8OA 2BWAA 2BQPA 2WNVA 4GB33 1BXHA 2GMMA 4EN9B 5BNPB 3VZMA 1LESA 1Q3EA 1OPOA 2WIIB 5DUVA 4W6XA 2G9FA 4GWMA 5C9AC 3TOJA 5JSPA 1W6PA 4Y20B 2RS11 4Y4YA 4Q1PA 1KFXL 2WZR2 2WZPP 1ULDA 4CDQA 2VQ0A 3VBRA 4LA2A 5A33B 3VBFA 2Y26A 4ATFA 5F9TA 2IC1A 3H3UA 1HXS2 2BFUL 4C0HA 2G4IA 4PIZA 2EXIA 2B45X 4QU2A 1PGL2 2AREA 2YY1A 2B39A 3JD73 4IERA 1UW8A 2ET7A 1KDMA 1GICA 4D3WA 1H9WA 3VBHC 4FCAA 1VBD1 2HWE3 4YZ4A 2YXSA 5ABJC 4HKWA 4FXGB 4KU7A 3O12A 1QF3A 2WQ4A 2W68A 4WVZA 3W59A 4AHWA 2ZOEB 5T5PA 1VBA1 4ORFA 4CRQA 5F6LB 2HWF3 1A3KA 3ES1A 1VRH2 3NAPA 5JLVA 2A6ZA 2CGOA 3B69A 5EJ3A 1C1FA 4QGNA 2DU1A 1RUD2 1AUYA 2TEPA 4B7EA 2Q5TA 4TWTA 1K5MA 3L2YA 3K51A 3ZYJB 5JDBA 3V0BB 3I8TA 4I02A 4DS0A 3WG4A 1AL21 2DCYA 1RVF1 2V09A 2X29A 4JGZC 2A3YA 2JG8A 1X7NA 4I0WB 5AC92 4QQHA 2D7FA 2ZHMA 4KL1A 2W39A 1LRHA 4GULA 4YVSC 5BNQA 3HD8B 2R6QA 3ZXEA 5I0SA 1QJU2 2JICA 3WDVA 1RMU3 3I7DA 4AHZA 2ARBA 1G6NA 4QPIB 2CYFA 1G7YA 2JECA 1KS5A 4KG0A 1BEV2 1ZM1A 4NHLA 4RQPB 4WZFA 3WDUA 4I2OA 2ZGOA 2D40A 3WLUA 3PNAA 1I3HA 3A0KA 2R1BA 2R063 1C8M2 3WDWA 1VBC1 3VZOA 1VJ2A 4LBKA 1LOFC 3VHRA 1PVC1 3DN7A 2CGPA 2WNUA 5J48A 1V6IA 3OYWA 4LE4A 3ZN6B 3GBGA 4Q4Y1 4P9GA 3HN1A 2O0OA 3TWIA 4P14A 2EA7A 3QBQA 1W39A 4OZXA 4D94A 4LBMA 3AZVA 1CJDA 1EV12 1D4M2 1MS0A 2P3KA 1PNFA 3ZYGA 2A71A 1FYUA 2XLFA 2O1QA 4OLLA 5A32A 1ZA4A 2Z5WA 1QJX1 1OLRA 2RMU1 3TNQA 1LOEA 5C4WB 2YUEA 1RUE2 4IV3A 3OGGA 3KLSA 4H7MA 1PGW2 4AEKA 4P9IA 3ZPYA 1PZ9A 4BIOA 1BJQA 5CFDA 1RUC1 2XJTA 3VBHB 1BVVA 4A2UA 1W6OA 2DUPA 3HQXA 2VOKA 2ZGTA 3IM0A 3LB9A 4IXLA 4KWLA 1NCRA 5L36A 1AF9A 3IKWA 4R4XA 2CY6A 2VULA 4K40A 3M1HA 4I3GA 4M3CA 3SH5A 5JOXA 2WFF2 2RM22 1NLRA 2QDRA 4Q2FA 1S0BA 1YFXA 2PTMA 4E4SA 1MS3A 1AR82 2CNAA 4GH4B 2GALA 1XNBA 2GC2A 1H2NA 3V65A 4HN0A 1HKDA 2NM1A 5JOYA 1G9BA 1QQP2 1AR61 4ASLA 5CVRA 3VHNA 1V6KA 2UURA 1R083 1MS8A 5GLTA 5JAXA 1RTVA 4YW4A 1YFUA 3M3IA 2GN7A 2PLV2 1G9CA 3WP6A 1IKQA 4ASMB 1GLHA 2R32A 2DWRA 4RS5C 4YVSB 1C5HA 2RR13 3ZXLA 2RS12 1FXZA 2XVLA 4LBQD 4YZ1A 3MPPG 2AZ5A 4Q0SA 4R9CA 4DY3A 5FO8B 1VP6A 2AYHA 3V64A 1NCQB 1ENXA 2FMYA 2O8OA 3WQ0A 5IK8A 1WW7A 4BPZA 3IIAA 4C90A 3ZFFB 3JB8A 4Z92B 1UZZA 1APNA 4LO8A 3OBRA 4DY5A 4FVVA 4QPGC 5KC6A 1VBB2 1FV3A 1YFWA 2MPFA 3B93A 4AK3A 1IPJA 1SEFA 5D8AB 3SXWA 3T1LA 2D6LX 4JTOA 4HVRA 4H14A 4CDUB 4FPYA 3SH4A 2H6CA 4YM0A 1PK6C 3VDDA 4RR3A 4YM3A 1ZBE2 3PVNA 3ATGA 1DQ4A 4XQWA 1N47A 2GU9A 1QNWA 5IT6A 2D5FA 4HPKA 2CGNA 4JV4A 4RL7A 4E9KA 4QM9A 1AXYA 3MZHA 2R042 1H8VA 3JBG3 3Q9OA 3ZXAC 2VU9A 4RHV1 4P5HA 4B4RA 3JUUA 3KSCA 4GIQA 2NLRA 4S2FA 5J36A 1R1A2 1QOSA 2WNEA 5FLJA 4L97A 5BNNC 2R071 1AL22 1J58A 2DVBA 2VW1A 2GNMA 1JHNA 1QNYA 1S0IA 1IQAA 4FQ4A 2AUYA 3C3VA 4BMBA 1ZREA 3M8LA 1ASJ3 1CAUB 3RS6A 2GMEA 2WA3A 1ZBA3 3QACA 3CLPA 3TRSB 2XG3A 3DF0A 4KGQA 1I9RA 4CEWA 2YV8A 1C8NA 2GH2A 3W58A 4EN7B 2WJSA 4IEPA 4KNCA 3AFGA 1BCXA 3WNXA 3AFKA 3MGUA 3UJQA 1CAWA 5GM0A 3GF6A 2TBVA 4YYOA 3AK0A 2JKBA 3AZZA 4GXLA 1PIV1 4Q0PA 2ZPXA 3U07A 4HMZA 4AQTA 1SQ4A 5J7MA 4Q4Y2 1CD3G 3AXDA 1H4GA 5BPXA 2JE7A 3URFA 1RJ8A 3B3QE 4FPHA 1HQWA 1FOD1 1TME2 2EALA 4PBPA 1UMZA 3ILRA 1JW6A 1YO8A 4JGYB 2HYKA 3O0VA 4C1XA 4KGGA 1R091 1J59A 2C5DA 4M0NA 3IN9A 4WZCA 1LB2A 4DINB 2ES3A 4MYEA 2DURA 4LBLA 1YRZA 3V56A 4AEMA 2MEV2 4FPKA 5GZDA 3VZJA 1SLTA 2QE3A 2ZGQA 5I91A 2E63A 3MEPA 2FZ1A 2WS91 3ZFGA 3ZN4A 4A7KA 2O8QA 4YZ2A 4Q0QA 1YIFA 1HXS3 1ZZ6A 1QXRA 1GZWB 3ILFA 4M0HA 3ZSLA 3AKTA 2B46X 1DGLA 3IPVB 5CADA 1AR91 3SLIA 4P9XA 4R8HA 3GZTB 1POV3 4XPVA 1SLCA 4GQ7A 5GZFA 4EWEA 4QX5A 2OA2A 3SCFA 3H1WA 3T2TA 4LHLA 4XBLA 1W6MB 2RS52 2WFPA 1S2KA 3IDEA 5L7OC 4XF0A 4Q4X1 3GBWA 1EAH3 1AHSA 1MS1A 3WINE 3ES4A 2WLPA 3WP3A 3BU7A 1HRI2 2HWC2 3H1MA 2TUNA 1EP0A 5CNAA 1I6XA 4ITCA 5JVVA 1Q5OA 4AHXA 2I2SA 2DCTA 4B4PA 1IS4A 3N7LA 4B3NA 3JCIA 4NWWA 1DQ6A 1RUD3 1Q8QA 3EBRA 2VVDA 2VECA 5AVPA 2YPJA 4DNYA 1OPMA 4XJWA 1O91A 1YHFA 5EV7A 1Q8VA 2YHJA 1LHNA 3DUIA 3KMHA 3HMYA 2G9GA 4XXAA 3VKFC 4YW5A 3USUB 1CAVA 1LHWA 1RUG1 5E8AA 3ZXJA 2DYCA 3ZMOA 1OOPB 4QD2A 4YW1A 4XJUA 4CEYA 2FBEA 2PHWA 5E88A 2XPJA 1LEDA 4JAAA 2F4PA 2JG9A 2XKPA 4TSVA 4FAGA 1X8MA 4NO4A 3LA7A 1V9U2 3VBSB 1MEC3 2R0HA 3WG2A 2OIIA 1LOFA 4AI1A 3BB6A 4QQLA 3RI8A 2WZR1 2XB6C 2D6NA 4IV1C 1CN1A 2VXRA 3WY6A 4M00A 1H30A 4XFCA 3EXUA 3N36A 1W6PB 3AKSA 1N1YA 2LTNA 4N7IA 3GZUC 2WINB 1QKQA 3PTYA 5T52A 3POSA 1PGL1 1C4RA 4RHV2 4PDWA 1QWRA 2ILMA 2VMIA 4CDQB 2X5IA 4AFDA 1OLQA 1PZ7A 2I74A 3VBFB 4Q0UA 5T5JA 1HRV2 5K0UC 1Z78A 4C91A 4UBHA 1SACA 5FLIA 1O4TA 2LM3A 1V00A 1JYIA 2DVAA 1TQ5A 1D0GA 2D5HA 4TYSA 3WG1A 4NHKA 5HCBA 3WT3A 2I07B 1FPN1 2YZ4A 4V1PA 1IKPA 3CJXA 4R9BA 4FOQA 4YARA 4HZFA 3MICA 1LTEA 4A3XA 2VUJA 1VRH1 1SFYA 1VB2A 1DGRA 4BZ4A 3OY8A 1U5ZA 2DUOA 4LE3A 3TB0A 2WFF3 3HT1A 4N43A 4C1WA 4WM7A 4YNIA 1CR7A 3NAPB 4P9WA 4GA9A 5BNPC 2A3WA 3SISA 3G6JB 1PZ8A 1PNGA 1QQP3 2XUMA 5AC91 3E6BA 4XJ8A 4B7KA 1RUJ2 4B8EA 2A70A 4EN0A 1RUI3 4QGLA 4RD7A 1LHVA 1UPSA 4MV2A 1C3HA 1QJU1 2BBVA 1UU6A 2OVUA 4YZ5A 3CJIA 1H2MA 1YIPA 4I3PA 1QY4A 1HQLA 1TE1B 4RS5A 3FLRA 1BEV1 2K0GA 3AP5A 2RS32 4OUSA 3B5LB 3NSTA 2Q4SA 4AFMA 4ZXKA 2XBO2 3KT7A 1J3QA 4MUVA 4ZU4A 1IS6A 4K20A 1X50A 2B9UA 4UW4A 1LULA 4K1YA 4F7ZA 2E7QA 1C8M1 2LUWA 3ZYRA 5KHIA 4Y1UA 3GHMA 5EYYA 1GR3A 4LBOA 4CDXC 3WHUA 1J1TA 2DU0A 2UWBA 3ZMNA 4R9DA 4YVWA 1DIWA 3ETQA 4IV1B 3PVEA 5EYXA 1NA1C 1EV11 2CTVA 1KJLA 4Y22A 4L11A 4AEDA 4PLNA 2DF7A 3KM5A 1ULCA 3AZWA 1VBD3 4AEJA 2E51A 4Q4X2 4LEJA 4OI4A 1ZNPA 1EPZA 3D6EA 3TAYA 2D6KA 1RUE1 4XHBA 2JE9A 3H50A 1SLLA 5K0UB 2FQPA 1PGW1 2QQPA 5A32B 1JUHA 3BALA 3H7YA 1VBA3 3HR9A 1ULFA 5C33A 1AJKA 2ZX3A 4Q0VA 4ZKTB 4XEZA 2RJKA 2Y38A 5H9QA 1YI9A 3VBUA 1ENRA 3PJYA 1W6NB 5DZEA 5JMCA 3E6CC 1O3TA 1QH6A 5J96B 4FBFA 4CZSA 1YWKA 3B94A 2GNBA 1ND2C 2RM21 1TEIA 1W6OB 4AHYA 1AR81 3AXEA 3DGTA 3V0AB 3BIWE 1XYNA 4QPIC 1AL23 1HLCA 1RVF3 2F6BA 4LT5A 1CESA 2VNOA 1ND3C 4RQPC 4JDNA 4YGDA 4M3CB 1WLDA 4LBNA 4GKXA 2OYZA 5JI7A 1MR5A 5I0UA 5B2GB 2EXHA 1YNAA 1XE8A 3CL1A 4FQZA 5FCCA 1PO22 1WLCA 1ULGA 2PLV1 5TSWA 3R0RA 4A7YA 2R49A 1LHOA 4LLOA 3MI8A 3MIHA 4E4DX 3MFCA 3AP9A 4LBQB 2YGLA 1PO12 4MGZE 3JU9A 1LECA 3AJZA 1QDCA 1H2LA 3B9CA 3H7JA 3ZXDA 1VBC3 5E89A 3RYKA 3DPRA 1ULEA 5I0TA 1WUVA 5AFBA 1H8TA 1PVC3 1V6OA 2DCKA 2ZGPA 4DQAA 1AZDA 2FMDA 1ONAA 1MS5A 2PAKA 4IEVA 1WGPA 3RQ0A 1WA4A 5C4WC 4H3WA 3PLQA 4AI3A 1VBB1 5I8SA 5I0RA 1ENSA 4LULA 1CAXA 5AFEA 4NOTA 4XQ4A 1MZEA 3EJKA 2QCSB 2ZGRA 3ROUA 4DFSA 4CDXB 4AQ6A 3THTA 1FMD2 1QHDA 2VUAA 3NVCA 1DQ5A 5GLUA 2Z79A 3W9AA 1QJX3 1SDWA 1COV2 4YM2A 5GLVA 4QPYA 2RMU3 3VBOA 4S2DA 2KXLA 5KBFA 1FPN2 1ZBE1 4MXWA 1POV0 1LGNA 1NA1B 4JRAA 4XBQA 3WR0A 2BGCA 2WT2A 4GH4C 5I93A 1RUC3 2JX9A 2R041 4D7SA 3RJ2X 1DGWX 3ZYPA 1AX1A 3FFQA 4E2SA 3T1MA 4HPKB 2NQYA 3FBYA 3OTFA 3VV1A 1WCSA 1R1A1 3S30A 1JTZX 5F5QA 4Q8KA 2GAUA 1QJZA 4Q1RA 2BNNA 2GNTA 1RL3A 5BNOA 1AR63 2HEVF 1DFQA 5JOWA 1WD3A 4PBOA 2E53A 3BODA 3DL3A 3I59A 4AG4A 3AP4A 2C9AA 1J1LA 1W6QA 3M3CA 3ME2A 1ND2B 4UW5A 4Z07A 4Q4V2 1QXJA 4YRDA 4XDQA 1NCQC 3ASIA 3FUOA 1ND3B 3ZSJA 1XU1A 2X53S 4GMP1 5BXXA 3ZFFC 1FNYA 2NZ9A 5KHHA 4FTSA 1H0BA 1UCXA 1CJPA 4IEUA 1O3QA 5SV5A 4IEYA 2QUOA 3ZFEC 3LCPA 2CAUA 4UW3A 4CP2A 3E5UA 4PJYA 5D8AC 5IUQA 1DZRA 3NKTA 1KD7A 2OZJA 4G4FA 5FQ0B 4CDUC 1MACA 5HI0A 5FBZA 2GDFA 4BQ1A 3VKMA 1BYHA 4PIXA 3AZXA 1OMIA 4AGVA 1OSGA 3ZX7A 4HK8A 1TME1 5I8YA 2HWB2 4XE9A 3WXPA 1NE6A 4XF4A 5FMOL 1UIJA 3THPA 4HLTA 4RA0A 4MGYE 3NL1A 5FMOS 3WUDA 3ZO0B 4QMAA 4WM8C 3AZYA 4CDWA 1CX4A 4F3JA 2MEV1 2HWD2 1A6CA 3H1YA 3KB5A 5FO9B 3SMHA 1FI2A 5FPZA 4AFAA 3PVOA 4IEZA 4DZGA 3MIFA 1YFYA 1G9DA 2EAKA 1XRUA 3NV3A 1YLLA 4JQRA 4RHV3 3MLKA 1GFF2 3NJZA 3ZFGB 2ZGNA 4CTEA 1M4WA 1Z7S1 4DPNA 1RUF2 3SCGA 2WT1A 4Y1VA 2R073 2RS51 1TMF2 1RUH2 3I4IA 4EWAA 1OFNA 1V6MA 1IS5A 2OZ6A 4AI8A 1OQ1A 2QNKA 4AGGA 4AVVA 1LOCA 4UW6A 2K2SA 2GC3A 4P9JA 4Q26A 1XU2A 4TZDA 4KBBA 1BVP1 2H0VA 1OFSA 4Q4W1 2A73B 3VZNA 1HRI1 1Q8OA 2HWC1 5CAZA 3WCRA 1U12A 1KITA 5GALA 2ZAAA 2ZKNA 3O0XA 4XMIA 1B35A 1AYN2 1IGOA 2EXKA 5FPXA 2UWAA 4RGAA 5E16A 2A6VA 1DYPA 1S0DA 1QMJA 1GSLA 4Y24A 1S0FA 1RB8G 3AMMA 1MS4A 4JCKA 1PIV3 1O4ZA 4JGYC 1J3RA 4YW3A 3O14A 1X8EA 4FSJA 1F5JA 2XVKA 3KCXA 1CONA 2ET1A 3LOIA 4AF9A 4OHYA 5KHGA 5A33A 2CWSA 3ZFEB 4YM1A 2HJIA 3ST7A 1FOD3 1UAIA 1Q56A 4Q8LA 1DQ1A 5CFCC 1Y9QA 4N53C 1AYM2 5KHJA 2XLGA 2I45A 1YJKA 3H8UA 1R093 3LKJA 2DTYA 4XJ9A 1V9U1 1JH5A 4CEYB 4DOUA 2HEYF 1ENQA 1LCLA 1GANA 2JG9B 2ZX2A 1URXA 1MQTC 3RRDA 1IHMA 3X29B 1AX2A 1LODA 2WS93 3FUQA 2VOVA 1CQ9A 1GBGA 5C8CA 3FMGA 4KWJA 2ZMKA 1DQ2A 2ZGUA 4WM8B 4FO9A 2ZACA 3BTAA 3AM2A 1AR93 4OI2A 3E5XA 2DVFA 2ETEA 2XGXA 2WT0A 3D82A 4IEQA 4LA3A 5EZWA 1BBT2 1HRV1 4XFHA 1ZZ7A 3AKRA 3OPZA 3N3HA 3VGIA 4BHPA 3WG3A 4AE2A 3KZ4C 1BK1A 3V0BA 4Q4X3 4AFCA 1JUIA 5JPNB 3RYPA 1MZ6A 4JC1A 3LSDA 1QGLA 2UWCA 1AVBA 3APBA 2QKDA 2IXHA 4XF9A 1UF2C 1NQDA 2OW4A 2A5ZA 1GZ9A 2V73A 1TNFA 4G9SB 3FZ3A 1ZZ8A 4QPIA 1OOPC 1VBE2 4FT8A 3MW3A 1GNZA 2DFBA 4X8NA 1ZX5A 4Z1VA 3J8F1 3M3QA 3WP4A 4GB32 1DZTA 5JZGB 1QXPA 5F1RA 3JB4C <