3NKTA

Crystal structure of salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans adducts with naphthoate
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
364
structure length
364
Chain Sequence
EKLDHESVTQAMQPKDTPELRALYKSFEEESIIPLWTQLGDLMPIHPKSKAVPHVWKWSTLLRLARKSGELVPVGRGGERRALGLANPGLGGNAYISPTMWAGIQYLGPRETAPEHRHSQNAFRFVVEGEGVWTVVNGDPVRMSRGDLLLTPGWCFHGHMNDTDQPMAWIDGLDIPFSQQMDVGFFEFGSDRVTDYATPNFSRGERLWCHPGLRPLSGLQNTVASPIGAYRWEFTDRALTEQLLLEDEGQPATVAPGHAAIRYVNPTTGGDVMPTLRCEFHRLRAGTETATRNEVGSTVFQVFEGAGAVVMNGETTKLEKGDMFVVPSWVPWSLQAETQFDLFRFSDAPIMEALSFMRTKIEGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Gentisate 1,2-Dioxygenase
publication title Crystal structures of salicylate 1,2-dioxygenase-substrates adducts: A step towards the comprehension of the structural basis for substrate selection in class III ring cleaving dioxygenases.
pubmed doi rcsb
source organism Pseudaminobacter salicylatoxidans
total genus 101
structure length 364
sequence length 364
ec nomenclature ec 1.13.11.4: Gentisate 1,2-dioxygenase.
pdb deposition date 2010-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3nktA01
4IEUA 4FT8A 2FQPA 1Q43A 1YUDA 4QXKA 4NVPA 3GYDA 3E5UA 4QGLA 2IXIA 3SHRA 1SEFA 2PQQA 2BNOA 3ACLA 3ETQA 4X6RB 3MPBA 4YSFA 4XFCA 5J48A 5EZWA 4K8FA 3H9AA 1O4TA 5KHHA 2CV6A 3KGZA 5T3NA 1J1LA 4R8HA 1LKNA 3I7DA 5E1RA 2IXJA 4JVAA 5I8SA 1H1MA 2GAUA 1TQ5A 1UD1A 5FQ0B 1UCXA 2N7GA 3L2HA 1CAVA 2VECA 2CAVA 2HJIA 2O8QA 2ZCWA 3KGLA 1CAWB 5BXXA 5JSRA 1CAUB 4Q29A 1ZZ8A 2GC3A 4Z07A 2OYZA 1OD5A 4F7ZA 5J7MA 2QNKA 3FWEA 3ST7A 2PHDA 4HSLA 4J1XA 5FLIA 1RUNA 2ET7A 2GZWA 4OFGA 4IEOA 3O14A 5FLHA 5C8WA 1L3JA 2DCTA 3EHKA 4QGNA 4JV4A 5KHJA 3CO2A 3N4MA 2XGXA 4I0BA 4HVRA 4AVBA 1QXJA 4IERA 1J3RA 4MGKE 4BHPA 3DL3A 4FAHA 1UPIA 4L11A 3LZZA 2O1QA 3OCPA 1Y3TA 1WLTA 1PM7A 5FQ0A 1QXRA 2IC1A 3S7IA 2CGPA 3DKWA 4E2QA 3MDPA 4YARA 5KHKA 4L2NA 3BCWA 1UIKA 1CAUA 3HT1A 1I6XA 1I5ZA 2EVXA 5LRRA 4QMAA 4QGMA 4F8AA 4MGIE 2UYAA 4MZUA 2XKOA 1O5UA 5AVPA 1VR3A 3EBRA 5C6CA 4EV0A 4WVZA 4XFHA 1J3QA 4RD7A 2QCSB 1X8MA 3H7JA 3EO6A 1NZCA 1DGWA 2IXKA 2HKXA 1PMIA 1CAXB 1RGSA 4PIXA 2QVSB 1LB2A 4HSJA 4HVQA 2GC1A 4YRDA 4FAGA 3H1WA 1DGRA 3NSTA 3IIAA 3WW2A 4XFFA 5JSPA 4GULA 3DV8A 5I0TA 3C3VA 5K8SA 1O3RA 2QDRA 4E2GA 4R52A 3ZDSA 4P9GA 1IPKA 1ZZBA 5JR7B 3USSA 2MPFA 4HBNA 5BV6A 5FPZA 4LULA 4MGYE 2PYTA 4J1WA 3OD0A 2FMYA 3BB6A 5LEKA 2Q1ZB 4XF4A 5FLJA 5FDBA 2UY8A 3HT2A 3PLQA 5LEJA 1CAXA 4I0AA 3M70A 4MUVA 2P17A 2D5FA 5I93A 2PAEA 2K0GA 3D82A 3E5QA 1QWRA 3LA7A 1FXZA 1Q3EA 3SCHA 1DZRA 4UXAA 1DZTA 2PAMA 2Q30A 3RYKA 4TLFA 5KHIA 3LWCA 3I54A 2OZJA 3S0MA 2Z2SB 1J59A 4JTOA 4LUKA 5I0UA 3ROUA 3OGJA 4JTNA 3CL1A 3IDBB 4HN1A 2PAKA 4MX3A 1U12A 1EPZA 1ZREA 4IESA 4MGZE 1RC6A 4MH0E 3OF1A 4XFIA 1Q5OA 2BYVE 1XRUA 2PTMA 4FBFA 2BEOA 1XE8A 1OFNA 2MHFA 4IEWA 3RDIA 4META 3FJSA 4I2OA 3NJZA 4HVOA 5BY5A 4HZFA 1FI2A 3QACA 4OLLA 3G7DA 4I01A 1CGPA 4YNIA 3WW4A 1ZRFA 5BUVA 3LA2A 1ZZ9A 5I8YA 2IXHA 2BNNA 3UKTA 4I09A 4IEPA 4QM9A 1GQGA 4IETA 1NE4A 3TNPB 3H3ZA 5I0RA 1CAWA 4KL1A 3LA3A 4IEYA 4AVCA 1O5LA 2XLFA 1YFYA 1JUHA 1O7FA 3HQXA 1O3TA 2C0ZA 1IPJA 3MZHA 1X7NA 4ORFA 3B02A 1NYWA 2Q4SA 2Z69A 3GBFA 4KU8A 2IXCA 4D7SA 2F4PA 4QM8A 4XF0A 4EROA 1OI6A 4Q0VA 3IWZA 2XKPA 1ZVFA 2UYBA 1WA4A 4UBGA 4ZU5A 4D7TA 4QX5A 2I45A 3CLPA 5JSOA 5FPXA 2OA2A 5I8TA 3EJKA 3HIFA 3CF6E 2WFPA 4HLTA 1XE7A 4KWLA 5KHGA 3CEWA 2VPVA 3WW1A 4PIYA 5BPXA 2XL9A 4Z82A 3H1MA 3EQEA 4I3PA 4B29A 2B9UA 3PVBB 1NXMA 3SCFA 1LRHA 2GC0A 5HI0A 3U0ZA 4XFGA 4XF9A 3PNAA 1ZX5A 4EWAA 4O9GA 2PFWA 2OZ6A 2XLAA 1J58A 1VJ2A 4XFAA 3KCCA 4LEJA 1UIJA 1YLLA 2WC2A 2E9QA 2BGCA 1X8EA 3ELNA 4IEZA 4IEQA 5EFUA 4XETA 4KWKA 2XHKA 2PA7A 3E5XA 4CYDA 2ET1A 4BH9A 2H0VA 5F1RA 5FCCA 3OTFA 4ONUA 2D5HA 3S7EA 3NKTA 4A2UA 3FFQA 3H8UA 1J3PA 4YYOA 2GC2A 4AQ2A 2MNGA 1V70A 3QOPA 4PJYA 1RUOA 2K9ZA 2Y0OA 3E6DA 2EAAA 1O3QA 3BALA 1Y9QA 1FT9A 4I02A 1ZRDA 2VQAA 1ZZ6A 5E16A 3NVCA 3R6SA 4WZCA 2H6BA 2H6CA 3KMHA 5JCTA 5CVRA 1ZZCA 3JZVA 1RL3A 1ZZ7A 3NW4A 4AQ6A 3LAGA 4N9HA 1ZRCA 1YFWA 3SCGA 4HN0A 1UW8A 4IEVA 2CAUA 3RZZA 4X6QB 2EA7A 4O9EA 3E6BA 1VP6A 1QY4A 3IDCB 4LA2A 1OMIA 4EWDA 4HMZA 5JAXA 1ZNPA 3H3UA 2XL7A 1G6NA 3SXWA 4AXOA 3I59B 1SFNA 3RNSA 3BU7A 1WGPA 2D93A 4XF1A 2KXLA 2UY9A 4XFBA 5D1IA 3D0JA 2IXLA 4Q0UA 4DINB 3IBMA 2B8MA 4LA3A 4UBHA 3MYXA 1NE6A 4E2SA 5LRSA 2XLGA 3FE5A 1H1IA 3FZ3A 4Q0PA 3ES4A 4Q0SA 5CU1A 4N9IA 3UKNA 2PHLA 4H7LA 4XF3A 4BIFA 4ZU4A 4PIZA 3U10A 4KU7A 5I91A 2GU9A 3E97A 3RYPA 4XEZA 4EWEA 4ZU7A 4WBBA 3CJXA 3BPZA 5J3UA 5CADA 3ES1A 3H7YA 1O3SA 1YFUA 4KWJA 1X82A 3M3IA 1EY2A 1RTVA 3WW3A 4LLOA 2ZKLA 5I0SA 4Q0QA 1YFXA 3I59A 1LR5A 3TNQA 3FX3A 4LTAA 2BNMA 4IEXA 3KSCA 2ATFA 3RYRA 3LOIA 3H1YA 4LUMA 3U11A 3UKVA 1ZRRA 3H50A 3VHRA 1EYBA 2D40A 4BYYA 2V09A 3D0SA 3FHIB 3NL1A 3E6CC 2ETEA 5KBFA 2QJVA 1YWKA 3DN7A 1CAVB 3RPQA 2B5HA 1SQ4A 1EP0A 1YHFA 4MV2A 2GH2A 1CX4A 1HW5A 3SMHA 2Q0AA 4AVAA 2OPKA 1GQHA
chains in the Genus database with same CATH superfamily
4GJZA 4IEUA 2FHRA 4LPLA 1K42A 4B8EA 1I5PA 4JGZA 1RUI2 4HK9A 1H8TC 2BP6A 4GWNA 1EAH2 1ND3A 3KCYA 4CTEA 3GYDA 1AR83 4LITA 3E5UA 3WD5A 4QGLA 3LQCA 5IVVA 4D6RA 5LK7B 2IXIA 4X6RB 3KF5A 2RS51 2D6MA 4PDWB 4XFCA 4CCCA 4K8FA 3SEPA 2W47A 1O4TA 3RQ0A 3ZKUA 1EV13 1GZWA 1UNBA 3ACIA 4J6GA 4ZONA 1QOSA 3J26N 3NKGA 5F9TA 4R8HA 1VPHA 1P8JA 2PLV3 2XBO2 1YO8A 3AXDA 4M0HA 5L9VA 1QF3A 4IV3A 5LA0A 1OPOA 2BQPA 2RV9A 2WNEA 1RUJ1 3ACFA 1H4GA 2O8QA 4L97A 4FP3A 1AL0G 2HWC3 2RDRA 1HJFA 1O4ZA 4LLFA 4ASMB 1PVXA 5CZKA 1AJKA 4WM7A 3WG1A 5J7MA 2QNKA 1MS1A 5JMOA 2A6VA 3ACHA 1W2OA 4QX3A 1BMV2 3PTYA 5FY8A 3DPRC 2RVAA 3ZIWA 2RMU2 5ERLA 2VULA 4OFGA 3J7LA 5LATA 4W50A 3D4KA 5FLHA 3HEIA 4YW3A 1U0AA 3N7MA 5C8WA 3QD6A 3BTYA 1BXHA 2NLRA 1RUF3 3J7NA 2P3JA 5TSWA 3DUIA 2NN8A 3APBA 1WD3A 4JV4A 3WDXA 4PDWA 4Q5OA 1W0OA 1OC1A 1W8HA 2VZRA 2YPJA 2RS11 2HWE3 4IERA 2ORXA 4MGKE 2RM23 1PIV2 1QJU1 1RUC3 2J1EA 1UPIA 3DL3A 5A7WB 5A7NA 2A1XA 3AXEA 1OA4A 2O1QA 4JGYA 1Y3TA 3WF4A 5F5AA 3N3HA 4M3CE 1US3A 1W06A 3POFA 2VOTA 3WT3A 1PM7A 5FK8A 4NIDA 3S7IA 1DGRN 3MDPA 4YARA 4RR3B 4L2NA 1LU1A 1SACA 1GNZA 1KITA 1I6XA 4XDPA 3WF3A 3AZWA 3O1VA 3RZLA 1BYHA 2EVXA 4QGMA 3CMGA 2J1VA 4FXGB 3T2PA 2SLIA 4MGIE 4D6QA 1PO23 2WRAA 1AR81 3NNLA 1OH3A 3M7AA 3N36A 5F6KA 3ZLIA 2UURA 2ZMKA 4XVHA 1NOVA 5CISA 3K4AA 3Q9OA 4YW5A 1VR3A 1KGYA 1UMHA 5LBEA 3O0WA 4AL9A 1CZTA 1VB2A 1JYIA 1G9FA 5F7UA 5JI7A 2J1RA 2ZEYA 2ZHKA 3H7JA 5GKAC 1F5JA 4NHKA 1VMHA 2A6WA 1EV11 4XE9A 2PHWA 4IQPA 2VMGA 2IXKA 1PX3A 1UY0A 1ASJ2 1PK6A 2P3KA 3B01A 1WLCA 2ZABA 5G05L 2QDNA 1IPSA 1IG0A 5GLZA 2PLV1 4C8DA 4LO5B 3THTA 1JYVA 1LOEA 1RGSA 5A7WA 1R082 2QVSB 1KQRA 5IUQA 1RUG1 1W9TA 2C26A 4N7IA 3MW2A 4NRMA 5DUWA 3RZKA 1KRIA 2GC1A 2R32A 3PJQA 4XCAA 2YC2A 4FAGA 3NSTA 5FK7A 5SV5A 4RR3A 3IIAA 2D6KA 3WW2A 4IE5A 1BLZA 4DPNA 3VKMA 4DY3A 1HV0A 5C5UA 3M3QA 3DV8A 1XOYA 2V72A 1DLLA 3C3VA 2HBTA 3SISA 4PLMA 4YW1A 4ASLA 4GB31 5K8SA 4COWA 4AEJA 4EN9B 3NNJA 2XVKA 4Y20B 1D2SA 2YGLA 4XJ9A 3W20A 1DGWX 1JODA 2EAKA 1CONA 2RG4A 1GSLA 3I3EA 4YZ4A 5FZ3A 2UU8A 1OF4A 1IPKA 3IB3A 5JR7B 2WSVA 3ZXJA 4HBNA 1MS4A 4DUWA 3HD8B 3KVBA 4GWIA 1YJKA 2PYTA 1NXD1 5FZFA 3OD0A 3SLIA 2PHFA 4K21A 4DXTA 2ZS6B 2RM21 3IN9A 3BB6A 5LEKA 3WDYA 2VU9A 4LE4A 3VBHC 3VBRC 4AQSA 4HT1T 2F4LA 3UYJA 3ZN6A 4AYUA 2ZMNA 4R4XA 5FYVA 1QJY3 3ZR5A 4DRVA 2Z42A 4BXFA 4AGVA 4TLGA 3WF2A 3A0NA 4UW3A 3AL6A 3FUOA 4CCJA 1NKGA 3SCHA 4Q4Y2 1DZTA 4UXAA 2HEYF 4YPJA 4TLFA 1PO21 2YG0A 2AENA 3T1LA 4FOQA 3CNAA 3PMSA 3TRSB 4LBQB 2FMDA 1FOD2 4XAEA 2DVDA 4DXZA 4N43C 4YVWC 5F3GA 1VBE3 4YFZA 1DQ5A 4HANA 4OUMA 2BFUS 4XDQA 1ENQA 4LO6B 4KH9A 1EPZA 5F5QA 1ULEA 1HX6A 3RI9A 4FXKB 2YGMA 5ANNA 1TME2 2VMEA 3S5AA 2ZEWA 3X29B 1N1SA 4Q4W2 3ILNA 1I3HA 2BYVE 2ES3A 4AVSA 1Z0HA 3P1IA 4PLOA 1W03A 2BEOA 3NNFA 3T3YA 1SLAA 5A1FA 3BTXA 3LD8A 2ZACA 4IE7A 3AKTA 1GWMA 3PTRB 3RDIA 5I0DA 4META 3FJSA 4Q2FA 4Y33A 3UGHA 3WP3A 5G04L 5FUPA 4BB3A 4AFBA 1IHMA 2HWF3 1DP0A 5BY5A 1UY2A 3N9QA 2XJTA 4HZFA 4AOCA 4ES9A 2CU5A 2VCBA 3L9JT 4H14A 3CQOA 1JZ5A 3HQRA 1ZRFA 3WF0A 4C0HA 1S1AA 1GYKA 1ZZ9A 1CESA 1LHUA 2GN3A 2IXHA 3LA2A 4AFCA 3N35A 4NIIA 4CP2A 1TMF2 4QM9A 4CP1A 5FOJB 4IETA 2HWD1 5T52A 4AGGA 1ZA7A 1BHGA 5CNAA 5LW9A 1HRV1 1AF9A 3MO4A 1PMHX 3TNPB 2IFRA 3WV6A 3MICA 1CAWA 3LA3A 4IEYA 5LASA 4GQ7A 4W6XA 2JIGA 1JUHA 1O7FA 1K5JA 2W3JA 3HQXA 2WO3A 3FHAA 1FPN2 3ILFA 3ZFEA 1O3TA 3MZHA 3LCPA 1X7NA 1AR91 4YVSC 3B02A 1NYWA 2G9FA 3ZOIA 2DCJA 3A0KA 1R1A2 2JDAA 2O0OA 4WVMB 5IVFA 2Z69A 5IWFA 1HN1A 4D7SA 1BK1A 4QM8A 4JX0A 4XF0A 3S5QA 3AVSA 2AH2A 3WDTA 1DYPA 1QIQA 3GGLA 2BGOA 2XQXA 3USUB 1WW4A 5K7PA 2VVFA 4RS5C 1ONAA 2XKPA 1LGNA 3JQWA 4C1WA 2UYBA 2VVDA 4ZU5A 4GD4A 3P5BA 2D43A 2I45A 4RYDA 2A6YA 1GKBA 2AR6A 1FX5A 2VVEA 4K7JA 1VALA 3LB9A 1S0GA 3DYPA 2ORZA 4YGBA 5FXVA 1CD3G 3EJKA 4JQRA 1UKGA 2BV4A 1W8TA 1AZDA 2WFF1 3ZX7A 4FI9A 4TTGA 4QQOA 1J83A 1S0FA 3RSJA 1OQDA 3N9PA 4KWLA 1VE0A 3OBRA 5KHGA 1DG6A 3CEWA 3LSEA 2JDNA 2QTWB 4FPGA 4PIYA 3WQ7A 4Z82A 5IVJA 5FZKA 3IKWA 2V73A 1DF0A 5FZAA 4Y1VA 3PVBB 5A3OA 4CCMA 2JWPA 4P00B 5JIUA 1UZWA 2TEPA 1LRHA 3SCFA 4HOOA 1CX1A 2XB6C 3F95A 1N3PA 4EWAA 2GH8A 2CWSA 1RJ8A 5LBFA 4CUCA 1D4M3 2VZVA 3M3OA 4NO4A 4XFAA 3DXUA 3PMEA 3USUA 5F3CA 1JZ4A 1YCIA 4ARXA 2WC2A 3ZM8A 3OBZA 3VBOB 4BQXA 1QDOA 1F35A 1X8EA 5CYYA 2X53S 1RUH2 1W6NA 4IEQA 2RDQA 1G7YA 1ULDA 2DDUA 3ZXEA 3E5XA 4CYDA 3AJZA 5FP9A 2H0VA 3N9MA 1COV3 1CVNA 3HQUA 1UWWA 1W2NA 1W9FA 1OPMA 2D5HA 3KD4A 1RUG2 4ONUA 5FMDA 4CCOA 3H8UA 1W6QA 5IAVA 2GC2A 4AQ2A 1SG3A 3U4SA 5FZIA 2K9ZA 1KXGA 2Y0OA 3GJBA 4UFJA 5C3RA 2EAAA 1V6KA 5CFCC 5DAQA 5FO9B 4INDA 1Y9QA 2F6BA 3ZYGA 2VQAA 3CDZB 3UT0A 4S2HA 4AFAA 1HIXA 4PI0A 1G8WA 1NA1C 1OQEA 3NVCA 4QPIA 1UO9A 4Q8LA 4Q26A 2WS93 1VMFA 3O1RA 4GB32 5IFPA 3W5NA 1KS5A 4FFFA 1ULGA 1RVF2 2H6BA 2Q8DA 3NAPA 2A73B 4DQAA 2AGSA 3GHNA 3HJRA 5JCTA 1IG3A 1RXFA 3NW4A 1HQLA 4AQ6A 2VXRA 2Y6KA 4BISA 2BFUL 2UWAA 2BGPA 4FFGA 4LBOA 5FFOC 1W2UA 1WKYA 5DUXA 1G86A 3JBG1 1PHMA 4AQTA 4HXCA 4LBQD 3VBOA 3RMYA 1EAH3 1TZOA 1UW8A 2RJKA 3OGSA 2JECA 3WOGA 4UFLA 1AYN3 1AL21 2A3XA 3VBUB 4BQ5A 1TG7A 3E6BA 1VP6A 5DZGA 3KT4A 3I3DA 5HPOA 1V6IA 1HDKA 3NJYA 1W3XA 5FO7B 4R9CA 2VC9A 1XE0A 3VBSC 4YW7A 5C3PA 1NCRB 5FZ4A 4MSVA 1D7PM 1NCQB 2WQZC 1ZNPA 2VUJA 3MW3A 1QJX1 4HK8A 5GLUA 3SXWA 3TN92 3I59B 1SFNA 2XBO3 3R4UA 4JDOA 5J09A 4GAZA 5A33B 1U5XA 2KXLA 4MLOA 3OJBA 4C90A 1B35C 5T55A 2IXLA 5DAXA 4DXSA 4Q0UA 4D6SA 4GIQA 5CG9A 3IBMA 1REFA 5FXWA 2B8MA 4P9WA 4QHOA 1L7RA 1D2QA 1C1FA 4BU2A 4NPRA 1CR7A 4IV1A 4E2SA 1OSGA 1A6CA 1KDKA 3MBWA 3JB4C 2ZGSA 4KGQA 4OHZA 3VZMA 4ZS3A 1LENA 2RMU3 1LU2A 5IK5A 4Q0PA 3ES4A 5CU1A 4P9IA 4KI5M 3T4HB 2YY1A 2J1UA 2PHLA 2ZZQA 3FUQA 3VBUA 1CN1A 2ZPXA 2OW4A 4ZU4A 3ZFGC 4AZZA 2YROA 4KU7A 2GU9A 5FZ7A 4CU8A 2YUEA 1SPPA 4Z1VA 2ZX1A 3V0BB 1LODA 4ZU7A 1OOPB 3M8LA 1NCRA 3AYEA 3BPZA 5C4WC 3ES1A 3W5MA 1DGLA 3JQXA 1OA2A 1YFUA 1NCQA 2BJSA 1PIV3 3K48A 3ZXDA 5ACA3 4CSWA 1QQP2 5AC93 2HWD2 1YFXA 3I59A 3MW4A 4WVVA 3GCXA 3AP6A 1LR5A 2J22A 4W65A 4LBNA 3ATGA 5D2AA 1T6GC 1OLME 3FC0A 3FX3A 4LTAA 2XJQA 4IEXA 3KSCA 2E7AA 1N3QA 5DABA 1Z7S1 5F32A 2A3YA 3QLQA 5A3PA 1PMJX 3A21A 4BPZA 1QNWA 4QKNA 2VMCA 3U11A 3SNMA 1MZFA 5JMCA 1ZRRA 3H50A 2Z5WA 2D40A 4E4HA 3MLKA 1AYN1 2X5IB 4RSUA 2WAOA 2JE9A 4LORA 1W9SA 2XWBB 3ZYJB 4FQ4A 2QJVA 3WG2A 1N1TA 1YYNA 2CYFA 2B5HA 2C5DA 1YHFA 3J8F1 1CJDA 1H4HA 2B45X 2WNUC 2WNOA 3PUSA 4IGQA 4MV2A 3THDA 4M4RA 2W1WA 5FYMA 1HW5A 4ASKA 3V0BA 1V00A 1RUE1 5KXEA 4TSVA 3JB8A 3ZXFA 1BEV1 5EYXA 1YQ6A 2HYKA 2FQPA 3V0AB 1KJLA 3MIHA 3Q8CA 5FYBA 3AJYA 4JRAA 5IT6A 1W8UA 5LBBA 2H0BA 5GJ6A 5LK5A 3VL8A 4XBLA 4FTSA 2VMHA 3QBQA 2CL2A 3GM8A 4RA0A 2PQQA 3Q8AA 1LTEA 3H8RA 3ETQA 5IVEA 5JIAA 3ZFFA 2MEV1 5FYSA 2BERA 1VRBA 1YRZA 4TYSA 2IVJA 3AP5A 4OHWA 4QXBA 5FY1A 1S0JA 4W8JA 2R041 5E8AA 5FZOB 4RGAA 5C9AA 4NRPA 5JOYA 5KHHA 5ANQA 5LA1A 1PVC2 3DYOA 3O12A 3PURA 4KNCA 2CV6A 5FXZA 3OYWB 3VL9A 5EJ1B 3N9NA 1AR61 2JICA 4W6WA 5CFDC 1SDWA 2X5IA 1AHSA 3CKHA 4JVAA 1PO12 2GAUA 1US2A 4Z2WA 1XNBA 1UCXA 5FQ0B 1C5IA 1VAVA 4ISRA 2VAUA 2VECA 5FP3A 4YGDA 2DURA 1KD7A 4EN0A 5JSRA 1CAUB 3AP4A 3IMNA 3NMBA 3W58A 4TZDA 3WX5A 5FYCA 2GC3A 4PQ9A 4IE6A 3O1TA 3I8TA 2ARBA 1NLRA 2OYZA 5AC91 4XHBA 5ACA1 4P02B 5KXDA 5ABJC 3RZJA 3FWEA 3WVJA 1SBDA 3V0AA 2GMMA 2PHDA 3DCQA 5FYHA 1SHWB 2ADEA 4HSLA 1ENSA 5DMYA 1RUNA 2D44A 2BVVA 1DQ4A 5DDJ1 4UOJA 5F2WA 1LGBA 5LA9A 4M4PA 3POSA 5A3UA 4YG3A 3VUOA 1S0BA 1FV3A 1GNHA 2Q1MA 5FZDA 3BKZA 2OIIA 1FNYA 1YQ2A 2VW1A 1W2TA 1Z78A 3V64A 2ILMA 3EHKA 4LIUA 1REEA 5KHJA 3N4MA 5C70A 3JCIA 5SV8A 1AX2A 4Q4Y3 5F37A 1FYUA 1XU2A 2Y26A 5DZFA 4ES8A 1A34A 4FPKA 2AZ5A 4IGOA 5JXHA 5C9AC 4W4ZA 3OEAA 3OYWA 2ARAA 2EXJA 2RS32 4SBVA 5EV7A 2OVUA 3PIGA 2A70A 4NRQA 4XDOA 4QX8A 4UW4A 4Q27A 1H2NA 5FQ0A 3I3MA 1JOPA 1TME3 3HMYA 1KFXL 2A7AA 3GALA 4P9LA 4LBLA 2P6CA 3I2FA 4Q4W3 4Y1YA 1SZBA 3HWJA 2WLPA 2YU2A 1CAUA 2KA3A 2VTFA 3HT1A 1K45A 1I5ZA 4BA6A 4ZPIA 4HG6B 4FOYA 4GMP3 4JGZC 4EE2A 4LHSA 2XKOA 4CCNA 1O5UA 1ND3C 2VZUA 2XUEA 4LE3A 2WWJA 5K0UB 5JVVA 4RQPC 5A70A 4OHXA 4ZZ8A 4PF1A 3E1F1 3VZLA 5FR3A 1JZ8A 3WP5A 2C9AA 4EJRA 4HL0A 5J1XA 2QCSB 3NV3A 1TMF3 2XJPA 4QPGB 1X8MA 1Q8OA 3NV2A 3EO6A 2DUQA 2ZBJA 1NZCA 1DGWA 1MZEA 1QOOA 3JD72 3K3OA 4Q4V3 4CU7A 3ORJA 4M3CB 3BTAA 3SQOA 1VBA2 4PIXA 1HKDA 4IV3C 1LEMA 3OY8A 2XWJB 1VBB3 2R072 1WCQA 2BBAA 2QQJA 1JN2P 2RR12 3OGRA 5IK7A 4RL7A 1GUIA 4Z8BA 1DGRA 2RDNA 1JHJA 1POV3 4B1LA 4EN6B 4EYUA 1R1A3 1S2KA 2F17A 4OI1A 5EJZB 1VBC2 1GR3A 1UX7A 3LEGA 1YEWA 4FP2A 2D6NA 4Y1UA 5IVYA 1FMD1 3ZYHA 1UOFA 3OD4A 4LJHA 2WR9A 3T08A 1NG0A 4XILA 5IJRA 1O3RA 4N8MA 2QDRA 4E2GA 5L7OB 2FDJA 5K0UA 2LTNA 4NROA 3WNMA 2ZKNA 5J37A 1R092 3M3CA 3GHMA 2WL1A 3USSA 2P4EA 3PJYA 2I07B 2MPFA 5BV6A 1V6OA 5FPZA 2R16A 1DYKA 2J7MA 4LULA 4MGYE 4J1WA 4QPGA 1RMU3 3SKVA 5T50A 2XPJA 3PU8A 1AR73 5FDBA 3PLQA 4UT5A 4XYXA 1IKPA 2B7YA 4JGYC 4M3CA 5T5JA 5LEJA 4I0AA 2X09A 5JZGC 2QBXA 3OOXA 4E8CA 2C1FA 2P17A 1ST8A 3KV5A 4FOWA 1JU4A 5JR2A 4OI0A 5IW0A 1F15A 1MEC1 2V4VA 2WO7A 4LHLA 4LHKA 1AYM1 2BW8A 1QWRA 1VBD3 3U78A 3OEBA 1C8M3 2YBPA 3DKQA 4HKWA 4JHZA 4C0BA 2VBDA 3GZUC 5DXDA 3N7LA 5F5CA 4COUA 1K12A 1VRH3 2V5DA 4GMP1 4K6BA 5FY7A 3RYKA 1W8WA 3PDQA 3I54A 3FFZA 5HV0A 5JWPA 1MQTC 2Z2SB 4QHZA 1H8TB 1MZ5A 1J59A 3ROUA 1YQ8A 4J25A 4DB5A 5C3SA 1GFF2 4LKEA 1XSQA 1PGW1 1GOFA 5CB7A 2R062 4QDSA 4X8PA 3LPFA 1JU3A 4P14A 1RUE2 2LUWA 2EIDA 3VZNA 4IESA 4XUPA 2FD8A 5LCWL 2VTXA 1GP5A 1RUD3 2G1MA 1ZA4A 1C4RA 1OBNA 4Q4V1 2WZEA 4RHV2 5H9QA 4XZUG 2PTMA 3N7JA 1PK6C 4XAAA 4O61A 4Q4X2 1UZ0A 3VLBB 3KT7A 4QB2A 3KB5A 2MHFA 4IEWA 1UKRA 1UY3A 3FHQA 4M00A 1VBB1 4HVOA 5APAA 1ZBA1 1C5HA 1WCDJ 3A23A 3H0OA 4OLLA 4YNIA 4BK5A 1JZ2A 3UK9A 1UYYA 1G9AA 1HXS3 3HNBM 4D8MA 3ITQA 2BNNA 3QH7A 3AMNA 4IEPA 1GQGA 1UPSA 3V56A 1OUSA 3VN4A 1LJ7A 1VB4A 2DTYA 3BU0A 4XUTA 2Q8OA 2PN5A 3CIHA 4QXCA 1E57A 3LEMA 2D3RA 2RJ2A 4CA9A 4NHXA 3H3ZA 4COZA 2GALA 1H8TA 1XQNA 3DPRB 3ZPYA 1H6XA 3ZPOA 1O5LA 2XLFA 1QU0A 3W9AA 2VBBA 1CZVA 3RS6A 4B4PA 2X10A 1I9RA 4NWWA 4L99A 4BK4A 5AFEA 3NV4A 4FCAA 5JLVA 1NQJA 4LR4A 2IWGB 3P6BA 1JHNA 1W0PA 4C91A 2AC1A 2Q4SA 1DCSA 3GZEA 3ZN4A 1AR71 4QPWA 1W0NA 2IXCA 2F4PA 2WWSA 4NIGA 4LKSA 5A6QA 1K3IA 2D3PA 1OD3A 4NHMA 4YM3A 1QOTA 1N47A 4LKDA 1ULPA 3FMGA 4LO7A 5F3IA 2W0XA 1WA4A 4OYUA 4KMQA 4UBGA 4XW3A 3T2TA 3TN93 4D7TA 2CNAA 2JG9C 2VNRA 3CLPA 4OCTA 1ZBE2 4CP0A 2EICA 5I8TA 3MPPG 3C7OA 3H8OA 1SBEA 5FYIA 2IVIB 1H8VA 3WQBA 1GNYA 3KF3A 4MO3M 1J1TA 2HWC1 5FY9A 4CUGA 2CGNA 4AEDC 3Q8EA 2VO5A 4XXAA 1NUKA 2HWB2 5FP7A 5H9SA 2ZZJA 3DPRA 2ZX0A 5CKQA 2WABA 4LT5A 3WW1A 4XHXA 5EYYA 1SLIA 2B39A 1HRI3 4AK3A 4AVVA 5EHDA 5L36A 2WZR2 1RUD1 3VD3A 1TVGA 2Y38A 3PUAA 5C8CC 2KR2A 4O65A 3SKJE 4YM1A 5IYYA 3PHMA 1NXMA 4P9YA 4YZ2A 1UU5A 2NM1A 5BNPC 2E53A 2BRTA 1RUF1 1WD4A 1F2NA 4XFGA 1ZX5A 2DBIA 3GBGA 1N1VA 3PVNA 2BTVC 2PFWA 2Q1FA 3K51A 4V2VA 2XLAA 4UWDA 4WV8A 4XTPA 2XVLA 2HWE1 1H9WA 1WLWA 1OKOA 1UU4A 2WNVC 3NV1A 1HXS1 1ENXA 1RUC1 1NY71 1UMZA 2C6SA 2NPIA 2LRPA 2VUDA 2W9XA 3ELNA 4DRRA 1V9U2 3WNLA 1K5MC 1ODMA 4KWKA 3MIBA 1ULFA 2PA7A 3AC0A 1Y43B 4BH9A 4IDZA 4U2AA 3D8CA 3LGRA 3TB0A 5FZ9A 3OTFA 1OFSA 4QQHA 2VMFA 1A78A 4XPVA 4YYOA 4NUBA 4ATEA 2XHNA 3QOPA 4R9BA 2DCKA 2VZ3A 1C8NA 5CIRA 1YIFA 3E6DA 4XQDA 3VDCA 3ZFEC 5FYZA 4GZ9A 3TYJA 4NHLA 1O3QA 2WN2A 2OS2A 3ZYPA 3VDBA 5FPBA 1OA3A 1PX4A 1F9KA 5E16A 3WY6A 2JDYA 1AXZA 1W39A 1YNAA 4Y20A 1QNYA 4Y3OA 3R6SA 1STMA 3TWIA 4IUGA 5EP9A 3IMMA 4GH4C 4PHZA 1AX1A 3OGVA 3JZVA 3VBHB 3VBRB 1E5IA 5CAZA 1N3OA 3RG0A 3RZMA 4YW2A 4FPCA 3VGIA 5A80A 5FJKA 1IQDC 1VLNA 2FZ1A 2VQTA 4NE9A 1YFWA 4LBMA 2DBNA 1MS8A 4HN0A 4FO9A 3K4DA 4NPLA 4XQ4A 4BWOA 3WNXA 1VMJA 4IEVA 1GANA 2XVGA 4AEDA 2RS52 4QU1A 3NO8A 2Z79A 2ZGLA 4AI8A 1QY4A 1A3KA 4DS0A 1LHNA 4M3CF 2AUYA 3JXSA 1OMIA 2DYCA 3RGBA 2W92A 3ZXLA 2WIIB 3J7HA 1HRI1 4YVWB 5GZGA 5LWBA 2HH9A 4HMZA 1PVC3 1YQ5A 3AL5A 1LHVA 5B4NA 5JAXA 4OVEA 2VNVA 1XYOA 2E63A 1JMUB 4LBQA 3M3EA 5JPNB 2JB4A 3BU7A 1X50A 5LY1A 2Y0IA 1RUJ2 2NMNA 2UY9A 4CXWA 2NYYA 5FMBA 4Y4RA 3D0JA 3POYA 1AXYA 2ZMLA 2QKDA 5FZLA 1RIRA 1F8VA 5FUNA 3VBHA 2JKXA 3VBRA 1W9YA 2V5YA 5FMOS 1L7LA 4Z2AA 2XLGA 4BQ4A 1M4WA 3GZTB 2AEZA 5A32B 4LBJA 1H1IA 1BQPA 3UKNA 1O8SA 1QJY1 4N9IA 2ZX2A 4E8DA 2JXAA 5AVAA 5I91A 3VD4A 1Q8PA 3O1MA 3E97A 4MHUA 2D6PA 4XEZA 1Q56A 4XIOA 1W90A 2RS12 1GWKA 1O8PA 1XYNA 2ARXA 4EWEA 5JXIA 1UX6A 1MS3A 3CJXA 1RHI3 4BIOA 1QJU2 4XJZA 4YVWA 4E27A 4YFWA 1GWLA 4S2DA 3WW3A 4LLOA 2RS33 4Q0QA 4AW7A 1VBE1 4YVSB 3DGTA 4QPIC 4F83A 1YJLA 3PUQA 2R1BA 3R4DB 4GALA 4CDUB 3NAPC 1S2EA 4GXLA 3B9IA 3BPSA 2PHRA 3SH4A 3TNQA 5J96B 2VZ1A 2ATFA 1BBT3 3WG4A 1DBNA 3LOIA 4QDRA 3H1YA 3ZSEA 1JZ6A 3AZXA 2QQIA 4WVMA 1HV1A 3EMRA 3UKVA 4CDWC 1AR82 2JDMA 1YC61 4BYYA 5HCFA 2Y6LA 1MZ6A 4DFSA 2XJUA 2HWF1 3RJRA 2V09A 2WQ8A 1DQ6A 1LOAA 3N9LA 2Y8KA 5DAWA 3AMPA 5A32A 3AVRA 1XC6A 3ME2A 2YYOA 3E6CC 3BOPA 1W6MB 3IPVB 1NAEA 4A7YA 1MS9A 1CAVB 4QB1A 2CDPA 5FYYA 3RPQA 1EP0A 3HAGA 4OI4A 1EV12 1HQWA 5C71A 3M2MA 4XIKA 4AI0A 4LBKA 5KXCA 1CX4A 5M0TA 1XSRA 1D0GA 2A6ZA 3JD73 2PLV2 1XNAA 3AP9A 2ZJCA 5EPAA 1DQ1A 3MV01 4AI1A 1ND2C 2AEYA 4FT8A 4V1PA 1Q43A 1YUDA 4FPOB 5J98B 4QXKA 4EZHA 5A1AA 3ALQA 4A7ZA 1S0DA 4YVSA 2R073 2RR13 3WUDA 3SHRA 1SEFA 2QQKA 5DAPA 4CDUA 3RWKX 3UESA 3MPBA 4FPYA 3IM0A 4HKOA 1WMFA 4EQVA 1VBC3 4KGGA 3D6EA 2K2SA 2VZQA 5HBAA 3H9AA 3TBDA 3AX4A 1QJEA 4IV1C 3KGZA 2QZ2A 4XMIA 3HNMA 5JUVA 2LM3A 4UF0B 3WNOA 3PIJA 2EIBA 3POWA 4K9SA 3T2OA 4ZY9A 1MS5A 4QQ2A 1R093 4XQWA 1W6MA 1PGSA 2N7GA 3IPVA 4CCDA 1RUI3 4CVUA 1CAVA 3CJIC 5C33A 2HJIA 2ZCWA 4XUOA 1PGL1 2Y6FA 2Y6HA 1RHI1 2DWRA 2RM22 4QQLA 4BZ4A 1SFPA 3T1MA 3ZR6A 4I0WB 3VKOA 3I4IA 1WA6X 1OD5A 2OX0A 4F7ZA 3O7OA 1AUYA 2BWAA 2YHJA 3ZYIB 4OQ9A 2A71A 5CFCB 2ZOEB 3WCRA 4JAAA 1JW6A 4J1XA 4AI3A 1NA1B 3H42B 3IIIA 4IEOA 2WKKA 4AHYA 2VL4A 1JI6A 4URTA 2DCTA 3JU9A 3LDRA 4I30A 3URFA 5DPNA 1W99A 3MIFA 4QGNA 3VB9A 3OUHA 1PO22 3CO2A 4FOVA 5DG2A 4I0BA 4UAPA 1C28A 1H2MA 1RYYA 1PZ8A 4HVRA 2DVFA 4RGGA 1PM4A 1D4M1 4AVBA 4MGSA 1RB8G 1J3RA 1SFYA 4BHPA 4LIVA 3R05A 4A7KA 4CZSA 3LZZA 4K1ZA 4Y24A 3OCPA 5D8AC 2WYFA 1W8ZA 2ZGKA 1WLTA 1ZYBA 2R063 4M01A 5FTTC 3WR0A 2NQYA 3WEZA 1QXRA 1H6YA 3BOWA 2IC1A 3U4XA 2CGPA 1U5YA 1S2BA 4KG8A 2R0FA 2ZEZA 2JX9A 4CEYC 5A3MA 4RFRB 3BCWA 2QQMA 3HBKA 3VBSB 3C2UA 1UIKA 5FMOL 4ATFA 3ZXKA 1MACA 4BDVB 1COV1 3WLUA 4IGPA 1F4HA 1CQ9A 3INAA 3WZ1A 3ZMNA 2VM9A 4K1YA 4CCLA 5CFCA 4NAOA 5K4LA 3ECQA 1OURA 2Q8CA 1X36A 4OHVA 2E26A 5C6CA 1YQCA 3WDWA 1B35B 4WVZA 3ZFFC 3ASIA 1LOBA 2JG8C 2OQ6A 1BZWA 4MHRA 3O1PA 4RD7A 2WS91 5C7GA 1VAMA 2D6OX 1HRV2 1WWYA 1UZVA 5IVBA 1U5IA 1UU6A 4FFIA 4ITCA 4OZXA 5A33A 2VOXA 4DZGA 2VXJA 4CEWC 5ISLA 2YV8A 4Y4YA 5FZGA 4KWUA 4Y5TA 4GMP0 4CU6A 2W46A 3LF7A 4YZ1A 2ADDA 3T30A 4BQ3A 4E4ZA 2R49A 1RUI1 4EN8B 3VZKA 1AR92 2P2KA 3NJVA 3ZFGB 3OBTA 4CPBD 1EAH1 4YRDA 2OUHA 1TNFA 1OH4A 4CDQC 5A3NA 1FAYA 1OVSA 4MGQA 3VBSA 5FP8A 3ZXAC 4B7KA 5JSPA 4GWMA 2BUKA 4GULA 5C4WB 2HEVF 4XTMA 5I0TA 3WUCA 2WJSA 1F31A 4L8QA 4QXHA 1EPWA 2BZDA 1S0CA 3GDBA 1WBFA 5F3EA 5A7QA 3CZUA 1JYNA 3THCA 1OOPA 1ASJ3 3ZDSA 3SITA 4P9GA 3O1UA 2DUOA 2XBO1 4XUQA 5IAXA 3C7GA 2XJSA 2ZX3A 3AP7A 2VQUA 3O0XA 1R083 3VDAA 1Q8QA 3BI3A 4Z92B 3GBWA 4YG0A 4D7YA 1H30A 1H0BA 3EXUA 4MG2A 2WFF2 2E7QA 4ZXEA 1UL9A 1VBE2 2FMYA 3ZSKA 2VW2A 1MR5A 1OT5A 1YXWA 2Q1ZB 5FLJA 2HWB3 2UY8A 1UZYA 3IZOA 3IT8A 5FXXA 4DIQA 2JDUA 3WQ0A 1CIYA 2XJRA 4MUVA 3UNPA 1ZRIA 2Q5TA 1BMV1 2WZR3 2RMU1 1AXKA 5I93A 2PAEA 3AKPA 4CP9B 2VZPA 1ULOA 2WNUB 1NLSA 1SDDB 2WINB 3BVCA 4HPKB 5JOZA 3GJAA 5FOBB 1FXZA 1Q3EA 2PMWB 1LGCA 3KZ4C 2IFWA 5E6HA 5FAXA 5C4WA 2Q30A 3B00A 3WNKA 3AFGA 2WDBA 1E5RA 1KFUL 1T6BX 2YPDA 4FPLA 4ISQA 2W1UA 4LUKA 2P37A 5FZ0A 5BNNB 3CL1A 1PIV1 3IDBB 5FPUA 4HN1A 2PAKA 3F2ZA 2EIGA 4A41A 1ZREA 4JKLA 5H9RA 4MGZE 5LB6A 3I2IA 4B4QA 4MH0E 2DVGA 4NJ4A 4QX7A 3OF1A 2A75A 4XBNA 4XFIA 3ZXGA 3C8XA 1WMXA 4L9BA 4FBFA 2GSYA 4UI9L 1OFNA 3ZN5A 4IE4A 5BNOC 4I2OA 2X8KA 5HXVA 2C9KA 5CFDB 4O7XA 5D21A 2DU0A 4YM2A 1GZCA 4YG6A 5FZOA 4Y22B 4AI9A 3G7DA 1UYZA 2WQ4A 1UQXA 3ETPA 2JD9A 4KQ7A 1W6OB 2G19A 2HLEA 3T2QA 1FOD3 1WBLA 3Q8FA 1W6PB 2DCYA 4QX0A 5FBJA 5I8YA 5LZ6A 3T0DA 4HPKA 2EIEA 4N53B 3U14A 3LPGA 1WMEA 1QEXA 5FPVA 3MLJA 5ABJB 1DYOA 1XNKA 3JBG2 4KL1A 3VBFC 1ENRA 1EUTA 1GMMA 2D97A 5BNNA 1JYTA 3TOJA 1BK0A 1R081 2VJXA 1AL22 2KM2A 1IPJA 2XMLA 2ZGMA 3MFCA 2LALA 2YB7A 1KDMA 2LW8A 2FDHA 4S2FA 4QPGC 3HR9A 1GOHA 1QJZA 1JTZX 2FCUA 3GBFA 1JS9A 4P5YA 2ZGPA 3JUUA 5GZEA 3A4UA 1HN0A 1OKQA 3KQRA 5C9AB 2WYSA 1OI6A 1V0AA 4XJWA 3OPZA 5T5PA 4XXPA 1GP4A 2R1DA 2YU1A 5A3WA 1TNRA 1POQA 2YBSA 2JE8A 1LNSA 3KCXA 3MLLA 1QJX2 3AYAA 1ZVFA 5DG1A 4Y22A 2XONA 3VDDB 2W87A 1V6JA 2JENA 1W6OA 1GOGA 4YZ3A 3AM2A 1QJFA 1UOGA 4A44A 2FDGA 2XDVA 3RZGA 3CZJA 1RUJ3 1W6PA 2QQOA 3PU3A 2CGOA 5FKCA 2VBPA 5FREA 2OA2A 3NRUA 3VD7A 5FPXA 5JSOA 5JXGA 4MXWB 5FWJA 5IK8A 3I2DA 2X05A 1FPN3 4SLIA 3HIFA 2AACA 2O14A 4N53A 3S57A 4PT6A 4QAWA 1HB4A 4A6OA 1UY1A 4HLTA 5AFBA 1ND3B 2A5ZA 2W68A 4CCKA 1IZ3A 1LOFA 4N90A 4OUEA 4QHBA 4RQPB 4WM7C 4Y5SA 1VAKA 4YLZA 2G4IA 4CDXB 2GDFA 4LOSA 2XL9A 3H1MA 2XQRA 2VMDA 3LFIA 3MV11 4I3PA 4WM8B 5FZHA 4B29A 3RRDA 2B9UA 3RWNA 4MYEA 2WSUA 3MFAA 5JDBA 4GWJA 1KS4A 3WDVA 4DEQA 4P9XA 2W94A 3PNAA 2BPA2 4O9GA 3I2GA 1OVPA 2RS13 1XNTA 3PVEA 4Q4Y1 1MVEA 1AVBA 1IGOA 2RE9A 4PDWC 2JD4A 2OZ6A 2OXBA 3S6PA 5KR7A 1VJ2A 4CXYA 1QJU3 3KCCA 4BJ0A 3AK0A 4OUSA 1FOD1 1UIJA 2E9QA 2BGCA 3VDDA 1W04A 4IEZA 4LQRA 4ZHNA 2R7EB 5EFUA 2EXHA 5FMCA 3SC7X 3O5SA 4XETA 3PUIA 5EXOA 1D0HA 3H3LA 4LKFA 3WXPA 5FY5A 5F2SA 5EIYB 2XHKA 4R4ZA 1OQ1A 1BCXA 3HBZA 3LE0A 4E4SA 1TME1 3NNMA 4AR2A 1Z7S2 3O1OA 5FCCA 1CPNA 4Q4W1 4XCBA 5KWRA 1F4AA 5LY2A 3S7EA 4A2UA 1U5ZA 3FFQA 1FATA 2J1AA 1J3PA 3K3NA 4JZRA 4P08A 1NX9A 3WQ1A 2QE3A 2G9GA 4AE2A 5B2GB 5CKNA 2MNGA 4RQPA 1V70A 2JIJA 4CDXA 1AYN2 2XH6A 1X9TA 2YZ4A 4PJYA 1RUOA 3ZYBA 2VNGA 2HBUA 4ZXKA 4WM8A 4I02A 1Y9MA 1JBCA 1ZZ6A 4LOTA 1ZRDA 2ZXQA 4B1MA 5FY0A 4AFDA 5L7OA 3J8F2 4TWTA 1ALYA 4Y26A 1CWPA 3LIGA 2ZHNA 4FQZA 1RUH3 2H6CA 3EB7A 4G4FA 1TMF1 5JOXA 1YI9A 3KMHA 3KS7A 3GCWA 5CVRA 3OGGA 3RVHA 1BEV2 3LAGA 4JGYB 5JZGB 2QQLA 1BVVA 2CWMA 3IDAA 3H8XA 1ZRCA 3KVAA 3K46A 4ZKTB 3SCGA 1RUG3 1AX0A 1R1ZA 5JPMB 1LOGA 5FBZA 1S0IA 3LEKA 3IDEA 4DY5A 2CAUA 1FPN1 2IUWA 2MEV2 1GP6A 2W1SA 1W8OA 3AZZA 1POV1 3IDCB 5DUVA 1R1A1 2R042 4H55A 4RR3C 1MQTB 4BLJA 5L9RA 3T0BA 3AKQA 4EWDA 2VZTA 2C4XA 4GB33 3LOBA 4B3NA 1JXNA 5K9YA 1HQNA 1UYPA 1RVF3 1W2AX 2TNFA 2TUNA 3LKJA 2DVBA 4XJAA 1HB3A 1AR62 1QH7A 3CBNA 2ZGOA 2W39A 1B09A 3AYDA 4Y1XA 2BVBA 1G6NA 1LECA 5B4XA 3RNSA 4AXOA 4D94A 1WGPA 3AMQA 5FUIA 2W52A 4XFBA 4YGCA 1FV2A 5D1IA 1PK6B 3AMMA 2B46X 2WAAA 3VHNA 4BQYA 5GLTA 4IL7A 5T5LA 5T54A 1RMU1 3UGFA 5AC92 3B93A 5GALA 5L73A 5ACA2 2ZA9A 3M4FA 5JZGA 3KM5A 3OPWA 5DDJ2 5LRSA 1IS6A 3POJA 1WW5A 4HETA 2FCVA 3ZVXA 3AMHA 4Q0SA 2PHXA 4AAXA 4FPFA 4H7LA 4XF3A 4K40A 3CU7A 5T5OA 4BIFA 2DTWA 1VBD1 2XOMA 3ILRA 2DFBA 3FLPA 1C8M1 3GXUA 3RYPA 4AVTA 4B4RA 3HVDA 4B7EA 1MQTA 1W28A 1VRH1 4IXLA 1AJOA 3AKSA 2QFEA 2RDSA 1E5SA 5IATA 4WBBA 2FDFA 5J3UA 2OPWA 3V65A 4KWJA 4P5HA 1O3SA 1X82A 1EY2A 1IS3A 1RTVA 3WP6A 2ZKLA 2GP3A 3DYMA 4K3UA 1IOAA 4DMIA 1RUH1 3J7MA 2I74A 4D0QA 4EN7B 4UFKA 2BWCA 2BNMA 5FZ1A 2WZ8A 3ZN6B 4LUMA 5FZEA 2GNBA 4L92A 1Q8VA 3HN1A 2BOJA 2VW0A 3WSOA 2DV9A 3VHRA 1EYBA 2AYHA 4GJYA 2NMOA 4ZZ5A 1DHKB 1RITA 3C7EA 4OHYA 2A6XA 1S0EA 1JYXA 4NMIA 2JG9B 3FHIB 3WCSA 3IAPA 2W5FA 3W59A 2ETEA 4YW4A 5KBFA 2JDKA 2VUCA 1GQPA 1YWKA 5BNQA 1QQP3 1SQ4A 2HWD3 1SCRA 1HLCA 4AEDB 1HRV3 2GH2A 2L9LA 4D69A 1RVF1 5HCBA 3SMHA 2Q0AA 4JC1A 2ZAAA 4AVAA 2DFCA 2NZ9A 2OPKA 1GQHA 2V4AA 3BIEA 3ZYRA 3B5LB 4QWNA 1SLLA 1OF3A 5C8CB 1DU3D 3ZSMA 2R6QA 4NVPA 4LMFA 3D3AA 3WG3A 2VGDA 2OQ7A 1AR93 1C3HA 1CJPA 2PQSA 5BNPB 1UF2C 1C1LA 2BNOA 3ACLA 4BCUA 1REDA 4YSFA 3AZYA 4OZOA 2UWCA 5J48A 1FMD2 1KEXA 5EZWA 1GU3A 2WN3A 2WNVB 4PCRA 1DFQA 2ARCA 3BGAA 1XNDA 4R9DA 3FBYA 3VD9A 5T3NA 2WO2A 4P9JA 1J1LA 1X9PA 4H2AA 3KQ4B 1K5MB 4JKMA 1LKNA 2YFZA 3I7DA 2JG9A 2IXJA 1GZTA 4JDMA 5E1RA 5EWSA 5I8SA 1H1MA 3TN91 1MS0A 4LK7A 1TQ5A 1UD1A 3L2HA 2CAVA 4DOUA 1NLQA 3KGLA 1O91A 2UWBA 3TEXA 1CAWB 3VKNA 5BXXA 2WFF3 1PZ7A 2GP5A 2Y6GA 2ZGNA 1ZZ8A 3OPTA 4Q29A 5DUUA 2JKBA 4Z07A 2RJLA 3NNGA 2ZHMA 3ZFEB 1XPWA 5IFTA 2BU9A 4XURA 3ST7A 3TEZA 2ZGRA 1C57A 3IAQA 5C8CA 4QB6A 2PXJA 2CSGA 2TBVA 5FLIA 2ET7A 4ET7A 2GZWA 3LIHA 3O0VA 1MEC2 3OUIA 2P5BA 4N43B 4TN7A 4XACA 3WP4A 2YC4A 1AYM2 4OULA 3O14A 2CHHA 2J1TA 2WUHA 4PLNA 3KHBA 5DAVA 4DO0A 5BNPA 1JOBA 2QQPA 1OUXA 1M06G 1IS4A 1JUIA 1L3JA 4GH4B 1QKQA 3K75B 4QDQA 5A1LA 3L2YA 1LULA 3WDUA 2VUAA 2PHUA 3MIGA 4XBQA 5A3LA 2XGXA 5JXJA 1PO13 4QD2A 5H9PA 3RZHA 4WVWA 4Y5Z0 5C3OA 1XYPA 2AREA 2WNVA 3FLTA 3BIWE 1QXJA 4QQPA 2EALA 4CU9A 1NT0A 2X29A 5A3TA 4FAHA 1PGW2 4L11A 1DQ0A 1OLQA 4A45A 1K5MA 1G9DA 2VZSA 4GA9A 1UY4A 1QQP1 1X33A 2ZGUA 1S4CA 3LDBA 5A6XA 3ZDVA 5GZFA 1JZ7A 2WA4A 1DQ2A 2JDPA 4N7UA 3MUZ1 3RFRA 3U75A 4Q4V2 2PELA 3PL0A 3DKWA 4JKKA 4NWVA 4E2QA 5KHKA 4DXRA 2VD7A 4JRLA 3NWKA 5GZCA 1DIWA 3DECA 4MVTA 5A6YA 1Y4WA 2W2IA 4Q8KA 2WWUA 5LRRA 5HXMA 4QMAA 1VBB2 4F8AA 1O6UA 1ZBA2 5FZMA 3LSDA 2UYAA 4MZUA 3SEEA 3MEPA 1I1EA 3QCWA 2OUJA 4NIHA 4UFMA 4QT6A 1UMIA 2Z4FA 5AVPA 2YC0A 4N43A 3U37A 4CRQA 2YFUA 3EBRA 4CDUC 4EV0A 4XFHA 1J3QA 3D5OA 4XABA 2WO1A 4GH4A 3UL2A 4LXLA 2D3SA 3P3NA 2C24A 1QH6A 4K8RB 2VMIA 1NQDA 2QZ3A 4U36A 3WHTA 5KXBA 5FIXA 2HKXA 1PMIA 1GLHA 1W6NB 5CKMA 2VG9A 3JBG3 4A42A 1CAXB 3MGUA 4CE8A 3VD5A 3BUCA 2E6VA 1W9WA 1ACCA 2WLQA 3DF0A 4RS5B 4PQQA 4CUAA 2Y60A 1LB2A 4HSJA 2G9ZA 4HVQA 4BMEA 5L19A 1AL23 1RMU2 1ZM1A 3P3PA 3VBOC 3WINE 3ZIXA 1SCSA 2DUPA 3H1WA 5GLWA 5EQUA 4FSJA 1URXA 1AR72 1W6QB 4AHZA 1EUUA 4DEVA 1GZ9A 3BN6A 3K2OA 4XFFA 4XUNA 4A3ZA 2W95A 3HNYM 4FTBA 2D98A 4ZS2A 3DEMA 1MVQA 4OMDA 5IHRA 4FPEA 5E89A 3KLSA 1PVC1 4QPIB 1QJX3 1VBD2 3UJQA 3WHUA 1C8M2 1W05A 4R52A 1PNFA 2JB8A 2NP0A 1Q8SA 5IK4A 1UN1A 4XJ8A 2JDZA 1VRH2 3NAPB 4CPBA 5A7PA 4DUXA 1ZZBA 3POBA 1V6LA 1VBA3 1PO11 3I2OA 1A8DA 3I2KA 5FO8B 2DCZA 1E5HA 1T2XA 4IW3A 4BMBA 3BTZA 3ON7A 2HWC2 2XUMA 4AHWA 2D7FA 3KHCA 4CDWB 2ZTNA 1BJQA 4BQWA 2LROA 4YGEA 1YI7A 5FZ8A 3RJ2X 4FTEA 1TE1B 1RXGA 1ODNA 1UXXX 2K46A 3POGA 4XC9A 2ZEXA 4XF4A 3HT2A 2B42B 4F3JA 4NPMA 4RN5A 3POEA 1CAXA 1RUD2 3M70A 5J36A 4RS5A 3LEIA 4LO8A 2D5FA 3NQHA 1VIWB 1W8FA 5C3QA 3AFKA 2K0GA 3D82A 2Y33A 3E5QA 4XZPA 2VZOA 1RUF2 2Y6JA 1W3VA 3A7QA 3LA7A 2Q8EA 3VBUC 1MPXA 1DZRA 3MF6A 2PAMA 4PF5A 4QU2A 4X8NA 5KHIA 4G3YC 1XJAA 1ULCA 3LWCA 2OZJA 1ND2B 2HWE2 4HONA 4M0NA 3FBMA 3S0MA 3I2JA 1WCUA 1HXS2 1UXZA 1RUC2 1NY72 3AYCA 4JTOA 5FZ6A 5I0UA 3ZSLA 1V6MA 1NCRC 3OGJA 4JTNA 4MOAA 4V2WA 5FP4A 1OHFA 1NCQC 4MX3A 2RS31 1U12A 1WW6A 3LFMA 4GKXA 4ARYA 4BXSV 4CCEA 2XJVA 2XXZA 3PVOA 5FZCA 1RC6A 1JYWA 1BKZA 1Y7BA 4CXXA 1OLMA 1Q5OA 3I3QA 1Z7S3 1SMVA 1WMDA 1XRUA 2BDRA 4CDWA 1XE8A 2DU1A 1BBT1 4IV1B 3R0RA 3ZYFA 2ZAHA 3NJZA 1TEIA 4UFIA 1UOBA 5F39A 4C1XA 3FN9A 4G9SB 1FI2A 3QACA 3S30A 4AHXA 2ID4A 4PBPA 2E7TA 4QPYA 4I01A 4FPJA 2E31A 1CGPA 3WW4A 1WCKA 1SPPB 2W91A 4YWAA 4TXWA 3CJIB 2J1SA 3ACGA 5BUVA 4UF0A 2E32A 1XNCA 3VV1A 3J8F3 3UKTA 3ENRA 4I09A 3FLRA 5F8PA 1HJGA 2DF7A 2GN7A 2ERFA 1RUE3 2QUOA 3BYWA 3TEYA 1NE4A 5FYTA 2P3YA 2JE7A 5BYNA 1YIPA 1ND2A 1BEV3 2VQ0A 2WBKA 2LS6A 4MADA 1JZ3A 3JD71 5I0RA 3WNPA 1G9CA 1H2KA 1RINA 4RHV3 3VKFC 1O59A 2P6HA 4AVCA 1OOPC 4Q4X3 2ZGTA 1QXPA 1YFYA 1WW7A 1VBA1 2WA3A 3ZMOA 1D4VB 2C0ZA 2P34A 3U1XA 2R071 4ORFA 3BODA 4OMCA 2RR11 1QDCA 3AB0A 1WZXA 2MEV3 5L9BA 1NA1A 3UV9A 1JYCA 5FV3A 4PBOA 4BOWA 3TEWA 4KU8A 3HPNA 2R043 2FBEA 2VCMA 4A4AA 4EROA 3WNNA 1VBC1 1HRI2 3NJXA 3AZVA 2HYXA 4Q0VA 5FZBA 3T0AA 2JJ6A 3IWZA 2GNDA 2QQUA 1AR63 1GV9A 1UYXA 2R0HA 3KV6A 5D8AB 4EZ4A 2CY6A 1SLTA 3QH6A 4QX5A 1LESA 3GNEA 2P3IA 3CJIA 2Y64A 2X5IC 4MXVA 3RI8A 2DVAA 1R091 5A7OA 3ZKYA 3T09A 4CEYB 3MIDA 4RFT0 3SH5A 4MGTA 1QMJA 2W1QA 4NAMA 4AAPA 1XU1A 4BE3A 1N1YA 3CF6E 3J9SA 3ZO0B 2WFPA 3VZJA 2OKXA 2VY0A 1DLCA 1XE7A 1H2LA 1J84A 3I3BA 4L0PA 2VPVA 5DDJ3 5HCAA 4KBBA 2O8OA 4OI2A 5BPXA 1H1AA 2GNMA 1QJY2 3ZFFB 1A8MA 3EQEA 4QX2A 2JG8B 5EJ3A 4E9KA 2E33A 2YDEA 4I3GA 4NHYA 3THPA 1WUVA 3KT1A 5DN2A 2GMPA 2GC0A 5HI0A 3N9OA 3UGGA 3U0ZA 1GICA 2EF6A 4XF9A 5FPLA 3MHZA 4CEWB 4FFHA 1B35A 4COYA 4GKYA 4JQTA 1ZBE3 1CPMA 1WCSA 2IZWA 4LO4B 3I2HA 2FCTA 4AEMA 1J58A 1F5FA 1POV0 4WZFA 4NR1A 4URAA 4LEJA 5FJHA 5D8AA 5HV4A 4JCKA 1YLLA 3GF6A 1LCLA 2PHTA 4H3WA 4UFHA 4AEKA 4CDQB 3I97A 2EXKA 2R061 4NN0A 4A6SA 4YZ5A 4CEYA 1O4YA 2ET1A 2FZ2A 4XMAA 4LK6A 3WF1A 3ZFGA 4BQ1A 5F1RA 1JH5A 4K20A 1G9BA 5DQ0A 5FRAA 5CBLA 4RHV1 3NKTA 4Q4X1 2FDKA 3G6JB 1OLRA 3KV4A 5BNNC 2HWF2 1SLBA 2EXIA 2SBAA 2B9VA 1IKQA 4Y1ZA 3BALA 1FT9A 1W8NA 2JG8A 3GZAA 3B69A 5FPAA 3B94A 1GBGA 1PZ9A 1XB9A 5LBCA 3OUJA 1CZSA 2VR4A 3OB8A 3W21A 2RHPA 4LHNA 4S2GA 4WZCA 1V9U3 3POIA 4CEWA 5HCHA 3LDKA 2BBVA 1PNGA 1V6NA 3UETA 1ZZCA 1RL3A 1ZZ7A 4AFMA 1UZZA 1FNZA 3MF9A 1WLDA 3PUHA 4N9HA 4NIAA 5A6ZA 5DZEA 3MIEA 4AGRA 4Q1RA 5IVCA 4E4DX 3M1HA 4X6QB 3RZZA 3T4VA 4CDQA 2EA7A 4O9EA 3Q8BA 4W6YA 4A3XA 3EYPA 4KG0A 2J42A 4N53C 5GLVA 1R64A 4BQ2A 2GMEA 3I49A 4QX1A 4LA2A 4CP9A 1LHOA 2BOIA 1FMD3 1RJ7A 2WNUA 3DXTA 4QKFA 4FPHA 1LOFC 2ZHLA 4D3WA 1LHWA 2I2SA 3FL7A 3O1SA 5FKBA 2A3WA 5CEHA 4FVVA 2GNTA 4IE0A 4HKLA 1CIWA 3H3UA 1OXCA 2YMZA 2ZX4A 2XL7A 4QKBA 2JEMA 4QKDA 4RGKA 3U07A 1ASJ1 3B7MA 4YM0A 5K0UC 4AF9A 1XXNA 2VOVA 1DZQA 2YXSA 3ABZA 4BLIA 2D93A 2WT1A 4XF1A 4DNYA 1PGL2 2VOWA 2VH9A 1HB1A 1RHI2 1ZBE1 2ENRA 5CG8A 1DDLA 5F5IA 3OSDA 5BNOB 4DINB 4DUVA 4UW6A 3VHOA 5KC6A 2RS53 3OY8B 2CTVA 3B9CA 4LA3A 4UBHA 4AWDA 1KJRA 2CDOA 3MYXA 1NE6A 2HWB1 4PI2A 5FWEA 3VDDC 3CHXA 1SBFA 4OQ8A 2XR4A 5GZDA 5KC5A 2WT0A 3FE5A 3HOBA 5F6LB 4BM8A 2FDIA 1MEC3 5C5TA 3FZ3A 1LOCA 2WZR1 5CFDA 4CUBA 1AYM3 1BBT2 2KD7A 2XG3A 4JDNA 4HFSA 3C7FA 4JHTA 4PIZA 1HB2A 1NZIA 4XJUA 3U10A 3VZOA 3KWVA 2Y34A 3J4UH 1APNA 1L7QA 2VOKA 1XBFA 3OBAA 5FY4A 1D4M2 1JOJA 2VCCA 3C7HA 4UYBA 5A7SA 3OG2A 4YW6A 2HEWF 2VTXJ 3VBFB 4CDXC 2JDHA 2WT2A 5CADA 3H7YA 3M3IA 1SLCA 4JGZB 4WM8C 1LEDA 5ABJA 5I0SA 1S55A 2B4KA 3SH3A 5L7OC 2WZPP 3RMXA 3KV9A 1LAJA 3N7KA 1V9U1 5CA6A 5E88A 4Q1PA 2VE1A 3VHPA 2D6LX 5JOWA 4UW5A 2QQVA 2R30A 3R4SA 1IQAA 2P1BA 1COV2 3A22A 4R9AA 3K77A 3RYRA 5BNOA 1UOJA 2VCAA 3UJOA 5JI9A 1QGLA 1GZWB 2QQNA 4AI2A 1ZBA3 3MI8A 1BVP1 4KBZA 3VKLA 3MUY1 1Y9GA 2YBKA 2ZGQA 3D0SA 4IV3B 4NOTA 3NL1A 4COVA 1UAIA 4AG4A 4H7MA 2WS92 3HN3A 4LNVA 3DN7A 1H9PA 1QHDA 2QQWA 3AKRA 5GM0A 3TAYA 4XOGA 5LA2A 2W08A 2OT7A 5FYUA 1IS5A 2E51A 3B3QE 3VBFA 4WM7B 4MXWA 2VNOA 3ZSJA 3K4ZA
chains in the Genus database with same CATH topology
4IEUA 2FHRA 4B8EA 4JGZA 1RUI2 4HK9A 1H8TC 4GWNA 1EAH2 1ND3A 3KCYA 4CTEA 3GYDA 1AR83 3E5UA 3WD5A 4QGLA 5LK7B 2IXIA 4X6RB 2RS51 2D6MA 4PDWB 4XFCA 4K8FA 3RQ0A 1O4TA 1EV13 1GZWA 4J6GA 1QOSA 3J26N 3NKGA 5F9TA 4R8HA 2PLV3 2XBO2 1YO8A 3AXDA 4M0HA 1QF3A 4IV3A 1OPOA 2BQPA 2WNEA 1RUJ1 1H4GA 2O8QA 4L97A 4FP3A 1AL0G 2HWC3 1O4ZA 4LLFA 4ASMB 1PVXA 1AJKA 4WM7A 3WG1A 5J7MA 2QNKA 1MS1A 2A6VA 1BMV2 3PTYA 3DPRC 3ZIWA 2RMU2 2VULA 4OFGA 3D4KA 5FLHA 4YW3A 1U0AA 3N7MA 5C8WA 3QD6A 1BXHA 2NLRA 1RUF3 2P3JA 5TSWA 3DUIA 2NN8A 3APBA 1WD3A 4JV4A 3WDXA 4PDWA 1W0OA 2YPJA 2RS11 2HWE3 4IERA 4MGKE 2RM23 1PIV2 1QJU1 1RUC3 3DL3A 1UPIA 3AXEA 1OA4A 2O1QA 4JGYA 1Y3TA 3N3HA 4M3CE 3WT3A 1PM7A 3S7IA 1DGRN 3MDPA 4YARA 4RR3B 4L2NA 1LU1A 1SACA 1GNZA 1KITA 1I6XA 3AZWA 1BYHA 2EVXA 4QGMA 4FXGB 2SLIA 4MGIE 1PO23 1AR81 3M7AA 3N36A 5F6KA 2UURA 2ZMKA 1NOVA 4YW5A 3Q9OA 1VR3A 3O0WA 1VB2A 1JYIA 1G9FA 5JI7A 5GKAC 2ZHKA 3H7JA 1F5JA 4NHKA 2A6WA 1EV11 4XE9A 2PHWA 4IQPA 2VMGA 2IXKA 2P3KA 3B01A 1ASJ2 1PK6A 5GLZA 5IK5A 1WLCA 2ZABA 2QDNA 2PLV1 4LO5B 3THTA 1LOEA 1RGSA 1R082 2QVSB 1KQRA 5IUQA 1RUG1 4N7IA 3MW2A 5DUWA 1KRIA 2GC1A 2R32A 3PJQA 4FAGA 3NSTA 5SV5A 4RR3A 3IIAA 2D6KA 3WW2A 4DPNA 4DY3A 3VKMA 1HV0A 3M3QA 3DV8A 1DLLA 3C3VA 3SISA 4PLMA 4YW1A 4ASLA 4GB31 5K8SA 4COWA 4AEJA 4EN9B 2XVKA 4Y20B 1D2SA 2YGLA 4XJ9A 1DGWX 2EAKA 1CONA 1GSLA 4YZ4A 2UU8A 1IPKA 5JR7B 2WSVA 3ZXJA 4HBNA 1MS4A 3HD8B 1YJKA 2PYTA 1NXD1 3SLIA 3OD0A 2PHFA 4K21A 2ZS6B 2RM21 3IN9A 3BB6A 5LEKA 3WDYA 2VU9A 4LE4A 3VBHC 3VBRC 4AQSA 4HT1T 3ZN6A 4AYUA 2ZMNA 4R4XA 1QJY3 4DRVA 2Z42A 4AGVA 3A0NA 4UW3A 3FUOA 3SCHA 4Q4Y2 1DZTA 4UXAA 2HEYF 4TLFA 1PO21 2AENA 3T1LA 4FOQA 3CNAA 3PMSA 3TRSB 4LBQB 2FMDA 1FOD2 2DVDA 4DXZA 4N43C 4YVWC 1VBE3 4YFZA 1DQ5A 4HANA 4OUMA 2BFUS 4XDQA 1ENQA 4LO6B 4KH9A 1EPZA 5F5QA 1ULEA 1HX6A 3RI9A 4FXKB 2YGMA 1TME2 3X29B 1N1SA 4Q4W2 3ILNA 1I3HA 2BYVE 2ES3A 4AVSA 1Z0HA 4PLOA 2BEOA 1SLAA 2ZACA 3AKTA 3RDIA 4META 3FJSA 4Q2FA 3WP3A 4AFBA 1IHMA 2HWF3 5BY5A 4HZFA 2XJTA 4ES9A 3L9JT 4H14A 1ZRFA 4C0HA 1S1AA 1GYKA 1ZZ9A 1CESA 1LHUA 2GN3A 2IXHA 3LA2A 4AFCA 3N35A 4CP2A 1TMF2 4QM9A 4CP1A 5FOJB 4IETA 2HWD1 5T52A 4AGGA 5CNAA 1HRV1 1AF9A 3TNPB 2IFRA 3WV6A 3MICA 1CAWA 3LA3A 4IEYA 4GQ7A 4W6XA 1JUHA 1O7FA 3HQXA 3ILFA 1FPN2 3ZFEA 1O3TA 3MZHA 3LCPA 1X7NA 1AR91 4YVSC 3B02A 1NYWA 2G9FA 2DCJA 3A0KA 1R1A2 2O0OA 4WVMB 2Z69A 4D7SA 1BK1A 4QM8A 4XF0A 2AH2A 3WDTA 1DYPA 3USUB 5K7PA 1WW4A 2VVFA 4RS5C 1ONAA 2XKPA 1LGNA 3JQWA 4C1WA 2UYBA 2VVDA 4ZU5A 2D43A 2I45A 2A6YA 1GKBA 2AR6A 1FX5A 2VVEA 4K7JA 1VALA 3LB9A 1S0GA 4YGBA 1CD3G 3EJKA 4JQRA 1UKGA 1AZDA 2WFF1 3ZX7A 4QQOA 1S0FA 3RSJA 1OQDA 4KWLA 3OBRA 5KHGA 1DG6A 3CEWA 3LSEA 4FPGA 4PIYA 3WQ7A 4Z82A 3IKWA 2V73A 1DF0A 4Y1VA 3PVBB 5JIUA 2TEPA 3SCFA 1LRHA 2XB6C 1N3PA 4EWAA 2GH8A 2CWSA 1RJ8A 1D4M3 3M3OA 4NO4A 4XFAA 3PMEA 3USUA 1YCIA 2WC2A 3VBOB 1QDOA 1X8EA 2X53S 1RUH2 1W6NA 4IEQA 1G7YA 1ULDA 3ZXEA 3E5XA 4CYDA 3AJZA 2H0VA 1COV3 1CVNA 4ONUA 1OPMA 2D5HA 3KD4A 1RUG2 3H8UA 1W6QA 2GC2A 4AQ2A 2K9ZA 1KXGA 2Y0OA 5CFCC 2EAAA 1V6KA 5FO9B 4INDA 1Y9QA 2F6BA 3ZYGA 2VQAA 4S2HA 4AFAA 1HIXA 1G8WA 1NA1C 1OQEA 3NVCA 4QPIA 4Q8LA 4Q26A 2WS93 4GB32 1KS5A 1ULGA 1RVF2 2H6BA 3NAPA 2A73B 4DQAA 2AGSA 3GHNA 5JCTA 3NW4A 4AQ6A 1HQLA 2VXRA 2BFUL 2UWAA 4LBOA 5FFOC 1W2UA 5DUXA 1G86A 3JBG1 1PHMA 4AQTA 3VBOA 4LBQD 3RMYA 1EAH3 1UW8A 2RJKA 2JECA 3WOGA 1AYN3 1AL21 2A3XA 3VBUB 3E6BA 1VP6A 5DZGA 3KT4A 1V6IA 1HDKA 5FO7B 4R9CA 3VBSC 1NCRB 4MSVA 1NCQB 2WQZC 1ZNPA 2VUJA 3MW3A 1QJX1 4HK8A 5GLUA 3SXWA 3TN92 3I59B 1SFNA 2XBO3 3R4UA 4JDOA 5J09A 5A33B 1U5XA 2KXLA 4MLOA 3OJBA 4C90A 1B35C 5T55A 2IXLA 4Q0UA 4GIQA 5CG9A 3IBMA 1REFA 2B8MA 4P9WA 1D2QA 1C1FA 4NPRA 1CR7A 4IV1A 4E2SA 1OSGA 1A6CA 1KDKA 3JB4C 2ZGSA 4KGQA 4OHZA 3VZMA 1LENA 2RMU3 1LU2A 4Q0PA 3ES4A 5CU1A 4P9IA 2YY1A 3FUQA 2PHLA 2ZZQA 3VBUA 1CN1A 2ZPXA 2OW4A 4ZU4A 3ZFGC 2YROA 4KU7A 2GU9A 2YUEA 4Z1VA 2ZX1A 3V0BB 1LODA 4ZU7A 1OOPB 3M8LA 1NCRA 3AYEA 3BPZA 5C4WC 3ES1A 1DGLA 3JQXA 1OA2A 1YFUA 1NCQA 3K48A 1PIV3 3ZXDA 5ACA3 5AC93 1QQP2 2HWD2 1YFXA 3I59A 3MW4A 4WVVA 3AP6A 1LR5A 4W65A 4LBNA 3ATGA 1T6GC 3FC0A 3FX3A 4LTAA 2XJQA 4IEXA 3KSCA 2E7AA 1N3QA 1Z7S1 2A3YA 3QLQA 4BPZA 1QNWA 3U11A 3SNMA 1MZFA 5JMCA 1ZRRA 3H50A 2Z5WA 2D40A 3MLKA 1AYN1 2X5IB 4RSUA 2JE9A 2XWBB 3ZYJB 4FQ4A 2QJVA 3WG2A 1N1TA 1YYNA 2CYFA 2B5HA 2C5DA 1YHFA 3J8F1 1CJDA 1H4HA 2B45X 2WNUC 4MV2A 1HW5A 3V0BA 1V00A 1RUE1 5KXEA 4TSVA 3JB8A 3ZXFA 1BEV1 5EYXA 2HYKA 2FQPA 3V0AB 1KJLA 3MIHA 5IT6A 3AJYA 4JRAA 2H0BA 5GJ6A 5LK5A 3VL8A 4XBLA 4FTSA 2VMHA 3QBQA 2CL2A 4RA0A 2PQQA 1LTEA 3ETQA 5JIAA 3ZFFA 2MEV1 1YRZA 4TYSA 3AP5A 4OHWA 1S0JA 5E8AA 2R041 4RGAA 5JOYA 5KHHA 1PVC2 3O12A 4KNCA 2CV6A 3OYWB 3VL9A 1AR61 2JICA 4W6WA 5CFDC 1SDWA 2X5IA 1AHSA 4JVAA 1PO12 2GAUA 4Z2WA 1XNBA 1UCXA 5FQ0B 1C5IA 1VAVA 4ISRA 2VECA 4YGDA 2DURA 1KD7A 4EN0A 5JSRA 1CAUB 3AP4A 3IMNA 3W58A 4TZDA 3WX5A 2GC3A 4PQ9A 3I8TA 2ARBA 1NLRA 2OYZA 5AC91 4XHBA 5ACA1 5KXDA 5ABJC 3FWEA 3WVJA 1SBDA 3V0AA 2GMMA 2PHDA 4HSLA 1ENSA 1RUNA 2D44A 2BVVA 1DQ4A 5DDJ1 1LGBA 3POSA 4YG3A 3VUOA 1S0BA 1FV3A 1GNHA 2Q1MA 2OIIA 1FNYA 2VW1A 3V64A 1Z78A 2ILMA 3EHKA 1REEA 5KHJA 3N4MA 3JCIA 5SV8A 1AX2A 4Q4Y3 1FYUA 1XU2A 2Y26A 5DZFA 4ES8A 4FPKA 2AZ5A 5C9AC 3OYWA 2EXJA 2RS32 4SBVA 5EV7A 2OVUA 2A70A 4UW4A 4Q27A 1H2NA 5FQ0A 3HMYA 1TME3 1KFXL 2A7AA 3GALA 4P9LA 4LBLA 4Q4W3 4Y1YA 3HWJA 2WLPA 1CAUA 2KA3A 3HT1A 1I5ZA 4BA6A 4FOYA 4GMP3 4JGZC 2XKOA 1O5UA 1ND3C 4LE3A 5K0UB 5JVVA 4RQPC 4OHXA 3VZLA 3WP5A 2C9AA 4EJRA 4HL0A 2QCSB 3NV3A 1TMF3 2XJPA 4QPGB 1X8MA 1Q8OA 3NV2A 3EO6A 2DUQA 2ZBJA 1NZCA 1DGWA 1MZEA 1QOOA 3JD72 4Q4V3 4M3CB 3BTAA 1VBA2 4PIXA 1HKDA 4IV3C 1LEMA 3OY8A 2XWJB 1VBB3 2R072 2RR12 1JN2P 5IK7A 4RL7A 4Z8BA 1DGRA 1POV3 4EN6B 1R1A3 1S2KA 4OI1A 1VBC2 1GR3A 4FP2A 2D6NA 4Y1UA 1FMD1 3OD4A 1NG0A 4XILA 1O3RA 2QDRA 4E2GA 5L7OB 5K0UA 2LTNA 2ZKNA 5J37A 1R092 3M3CA 3GHMA 2WL1A 3USSA 3PJYA 2I07B 2MPFA 5BV6A 1V6OA 5FPZA 2R16A 1DYKA 4LULA 4MGYE 4QPGA 4J1WA 1RMU3 5T50A 2XPJA 1AR73 5FDBA 3PLQA 4XYXA 1IKPA 2B7YA 4JGYC 4M3CA 5T5JA 5LEJA 4I0AA 5JZGC 2C1FA 2P17A 4FOWA 4OI0A 1MEC1 4LHLA 4LHKA 1AYM1 2BW8A 1QWRA 1VBD3 1C8M3 4C0BA 4HKWA 3GZUC 5DXDA 3N7LA 4COUA 1VRH3 4GMP1 4K6BA 3RYKA 3I54A 3FFZA 5JWPA 1MQTC 2Z2SB 1H8TB 1MZ5A 1J59A 3ROUA 4DB5A 1GFF2 1PGW1 5CB7A 2R062 4X8PA 4P14A 1RUE2 2LUWA 3VZNA 4IESA 1RUD3 1ZA4A 1C4RA 4Q4V1 4RHV2 5H9QA 2PTMA 3N7JA 1PK6C 3VLBB 4Q4X2 3KT7A 3KB5A 2MHFA 4IEWA 1UKRA 4M00A 1VBB1 4HVOA 1ZBA1 1C5HA 1WCDJ 3H0OA 4OLLA 4YNIA 1G9AA 3UK9A 1HXS3 2BNNA 3QH7A 3AMNA 4IEPA 1GQGA 1UPSA 3V56A 3VN4A 1LJ7A 1VB4A 2DTYA 2Q8OA 2PN5A 1E57A 2D3RA 3H3ZA 4COZA 2GALA 1H8TA 1XQNA 3DPRB 3ZPYA 1O5LA 2XLFA 1QU0A 3W9AA 3RS6A 4B4PA 1I9RA 4NWWA 4L99A 5AFEA 3NV4A 4FCAA 5JLVA 1NQJA 4LR4A 2IWGB 1JHNA 1W0PA 4C91A 2Q4SA 3ZN4A 1AR71 2IXCA 2F4PA 2WWSA 2D3PA 4NHMA 4YM3A 1QOTA 1N47A 3FMGA 4LO7A 2W0XA 1WA4A 4UBGA 3T2TA 3TN93 4XW3A 4D7TA 2CNAA 2JG9C 2VNRA 3CLPA 4CP0A 1ZBE2 5I8TA 3MPPG 1SBEA 1H8VA 1J1TA 2HWC1 2CGNA 4AEDC 4XXAA 2HWB2 5H9SA 2ZZJA 3DPRA 2ZX0A 4LT5A 3WW1A 4XHXA 5EYYA 1SLIA 2B39A 1HRI3 4AK3A 4AVVA 5L36A 2WZR2 1RUD1 2Y38A 5C8CC 4YM1A 3PHMA 1NXMA 4P9YA 4YZ2A 1UU5A 2NM1A 5BNPC 2E53A 1RUF1 1WD4A 1F2NA 4XFGA 1ZX5A 3GBGA 1N1VA 3PVNA 2BTVC 2PFWA 3K51A 2XLAA 4XTPA 4WV8A 2XVLA 2HWE1 1H9WA 1WLWA 1UU4A 2WNVC 3NV1A 1HXS1 1ENXA 1RUC1 1NY71 1UMZA 2NPIA 3ELNA 4DRRA 1V9U2 1K5MC 4KWKA 3MIBA 1ULFA 2PA7A 1Y43B 4BH9A 4U2AA 3D8CA 3LGRA 3TB0A 3OTFA 1OFSA 4QQHA 1A78A 4XPVA 4YYOA 4ATEA 3QOPA 4R9BA 2DCKA 5CIRA 1C8NA 3ZFEC 1YIFA 3E6DA 4XQDA 1O3QA 3TYJA 4NHLA 3ZYPA 1OA3A 1F9KA 5E16A 3WY6A 1AXZA 1W39A 1YNAA 4Y20A 1QNYA 3R6SA 3TWIA 4GH4C 1AX1A 3VBHB 3JZVA 3VBRB 5CAZA 1N3OA 3RG0A 4YW2A 4FPCA 3VGIA 1VLNA 2FZ1A 1YFWA 4LBMA 1MS8A 4HN0A 4FO9A 4XQ4A 4BWOA 3WNXA 4IEVA 1GANA 2XVGA 2RS52 3NO8A 2Z79A 2ZGLA 4AI8A 1QY4A 1A3KA 4DS0A 1LHNA 4M3CF 2AUYA 1OMIA 2DYCA 3ZXLA 2WIIB 1HRI1 4YVWB 5GZGA 4HMZA 1PVC3 1LHVA 5JAXA 4OVEA 1XYOA 2E63A 4LBQA 5JPNB 3M3EA 3BU7A 1X50A 2Y0IA 1RUJ2 2NMNA 2UY9A 2NYYA 3D0JA 3POYA 1AXYA 2ZMLA 2QKDA 1RIRA 1F8VA 3VBHA 3VBRA 2V5YA 5FMOS 2XLGA 1M4WA 3GZTB 5A32B 4LBJA 1H1IA 1BQPA 3UKNA 1QJY1 4N9IA 2ZX2A 2JXAA 5AVAA 5I91A 1Q8PA 3E97A 2D6PA 4XEZA 1Q56A 4XIOA 2RS12 4EWEA 2ARXA 1XYNA 1UX6A 1MS3A 3CJXA 1RHI3 4BIOA 1QJU2 4XJZA 4YVWA 4E27A 4YFWA 4S2DA 3WW3A 4LLOA 2RS33 4Q0QA 4AW7A 1VBE1 4YVSB 3DGTA 4QPIC 4F83A 1YJLA 2R1BA 3R4DB 4GALA 4CDUB 3NAPC 4GXLA 3B9IA 2PHRA 3SH4A 3TNQA 5J96B 2ATFA 1BBT3 3WG4A 1DBNA 3LOIA 3H1YA 3ZSEA 3AZXA 4WVMA 1HV1A 3UKVA 4CDWC 1AR82 4BYYA 5HCFA 4DFSA 1MZ6A 2XJUA 2HWF1 3RJRA 2V09A 1DQ6A 1LOAA 3AMPA 5A32A 3ME2A 2YYOA 3E6CC 3BOPA 1W6MB 3IPVB 4A7YA 1MS9A 1CAVB 3RPQA 1EP0A 3HAGA 4OI4A 1EV12 1HQWA 3M2MA 4XIKA 4AI0A 4LBKA 5KXCA 1CX4A 1D0GA 2A6ZA 3JD73 2PLV2 3AP9A 2ZJCA 1DQ1A 4AI1A 1ND2C 4FT8A 4V1PA 5J98B 1Q43A 1YUDA 4FPOB 4QXKA 3ALQA 4A7ZA 1S0DA 4YVSA 2R073 2RR13 3WUDA 3SHRA 1SEFA 4CDUA 3MPBA 4FPYA 3IM0A 4HKOA 1WMFA 1VBC3 4KGGA 3D6EA 2K2SA 5HBAA 3H9AA 3TBDA 3AX4A 4IV1C 3KGZA 2QZ2A 4XMIA 2LM3A 3POWA 4K9SA 1MS5A 4QQ2A 1R093 4XQWA 1W6MA 1PGSA 2N7GA 3IPVA 1RUI3 1CAVA 3CJIC 5C33A 2HJIA 2ZCWA 1PGL1 1RHI1 2DWRA 2RM22 4QQLA 4BZ4A 3T1MA 4I0WB 3VKOA 3I4IA 1OD5A 4F7ZA 3O7OA 1AUYA 2BWAA 2YHJA 3ZYIB 5CFCB 2A71A 2ZOEB 3WCRA 4JAAA 1JW6A 4J1XA 4AI3A 1NA1B 4IEOA 2WKKA 4AHYA 4URTA 2DCTA 3JU9A 4I30A 3URFA 5HCAA 3MIFA 4QGNA 1PO22 3CO2A 4FOVA 5DG2A 4I0BA 1C28A 1H2MA 1PZ8A 4HVRA 2DVFA 4RGGA 1D4M1 4AVBA 1RB8G 1J3RA 1SFYA 4BHPA 3R05A 4A7KA 4CZSA 3LZZA 4K1ZA 4Y24A 3OCPA 5D8AC 2ZGKA 1WLTA 1ZYBA 2R063 4M01A 5FTTC 3WR0A 2NQYA 1QXRA 3BOWA 3U4XA 2IC1A 2CGPA 1U5YA 1S2BA 4KG8A 2R0FA 2JX9A 4CEYC 5A3MA 3BCWA 3VBSB 3C2UA 1UIKA 5FMOL 4ATFA 3ZXKA 1MACA 1COV1 3WLUA 3WZ1A 1CQ9A 3INAA 3ZMNA 5CFCA 4K1YA 3ECQA 1X36A 4OHVA 5C6CA 3WDWA 1B35B 4WVZA 3ZFFC 3ASIA 1LOBA 2JG8C 1BZWA 4RD7A 2WS91 1VAMA 2D6OX 1HRV2 1U5IA 1UU6A 4ITCA 4OZXA 5A33A 2VOXA 4DZGA 4CEWC 2YV8A 4Y4YA 4GMP0 4YZ1A 4E4ZA 2R49A 1RUI1 4EN8B 3VZKA 1AR92 2P2KA 3ZFGB 3OBTA 1EAH1 4YRDA 2OUHA 1TNFA 4CDQC 1FAYA 3VBSA 3ZXAC 4B7KA 5JSPA 4GWMA 2BUKA 4GULA 5C4WB 2HEVF 4XTMA 5I0TA 3WUCA 2WJSA 1F31A 4L8QA 1EPWA 1S0CA 1WBFA 1OOPA 1ASJ3 3ZDSA