3NKTA

Crystal structure of salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans adducts with naphthoate
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
364
structure length
364
Chain Sequence
EKLDHESVTQAMQPKDTPELRALYKSFEEESIIPLWTQLGDLMPIHPKSKAVPHVWKWSTLLRLARKSGELVPVGRGGERRALGLANPGLGGNAYISPTMWAGIQYLGPRETAPEHRHSQNAFRFVVEGEGVWTVVNGDPVRMSRGDLLLTPGWCFHGHMNDTDQPMAWIDGLDIPFSQQMDVGFFEFGSDRVTDYATPNFSRGERLWCHPGLRPLSGLQNTVASPIGAYRWEFTDRALTEQLLLEDEGQPATVAPGHAAIRYVNPTTGGDVMPTLRCEFHRLRAGTETATRNEVGSTVFQVFEGAGAVVMNGETTKLEKGDMFVVPSWVPWSLQAETQFDLFRFSDAPIMEALSFMRTKIEGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gentisate 1,2-Dioxygenase
publication title Crystal structures of salicylate 1,2-dioxygenase-substrates adducts: A step towards the comprehension of the structural basis for substrate selection in class III ring cleaving dioxygenases.
pubmed doi rcsb
source organism Pseudaminobacter salicylatoxidans
molecule tags Oxidoreductase
total genus 101
structure length 364
sequence length 364
ec nomenclature ec 1.13.11.4: Gentisate 1,2-dioxygenase.
pdb deposition date 2010-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3nktA01
2I45A 2ET1A 2XLAA 5KBFA 4KWKA 3GYDA 3EBRA 1UIKA 1IPJA 2E9QA 5LRSA 5JR7B 2O8QA 3M3IA 3CO2A 3CL1A 3H1MA 1I5ZA 3H7JA 1XRUA 3MDPA 3RNSA 3E6CC 3B02A 4Q0SA 4F7ZA 1NXMA 4IERA 2XL9A 4KU8A 3OD0A 4OLLA 2QNKA 2ET7A 2IXCA 1QXJA 1O4TA 3KGLA 1YFWA 3SCGA 3RDIA 1CX4A 4XEZA 4XF9A 1ZZ6A 4LUKA 1X8EA 4R8HA 5FQ0A 1SFNA 3H1WA 1DZTA 2ATFA 1RUOA 4I09A 2Q0AA 1U12A 5FLHA 3H8UA 4IEZA 4QGNA 3SHRA 4JTOA 4LUMA 4HN0A 3RYPA 3H3UA 2ETEA 1YHFA 1CAWB 3I54A 5LEJA 1XE8A 3LAGA 2PFWA 4XF0A 1ZNPA 4NVPA 4P9GA 3D0JA 4AXOA 5F1RA 3CLPA 2XLFA 1YWKA 1ZX5A 4I3PA 3CJXA 4I02A 2K9ZA 3HQXA 4QGLA 1ZZ9A 4I0AA 4EWEA 4QMAA 4MGYE 4DINB 5T3NA 4Q0PA 2IC1A 1CAUB 1SQ4A 2BNMA 3BU7A 5FDBA 1OD5A 2MNGA 5C6CA 1J58A 3E6DA 2Q30A 3H50A 4AQ6A 5AVPA 1CAXA 4PIYA 2GC3A 1ZREA 1YFYA 3JZVA 1CAVB 2ZCWA 1VP6A 5C8WA 5I8SA 4IEWA 2QVSB 2Z2SB 3KGZA 3MZHA 4J1XA 1LRHA 3I7DA 4MX3A 3HIFA 4HSLA 3RZZA 2Q1ZB 4IEPA 4X6QB 1O7FA 1CGPA 2O1QA 1PMIA 2EA7A 5JAXA 5BV6A 3LA2A 2UYAA 4XFBA 3SCHA 3MPBA 1RL3A 2XLGA 1UPIA 4HVQA 3RYKA 3UKTA 1O3QA 5CADA 1J3QA 4AQ2A 4QX5A 2H6CA 5J3UA 3QOPA 4IETA 3IWZA 5FPXA 3OTFA 3C3VA 1UCXA 4MV2A 4AVCA 1O3RA 2D5HA 4LA2A 4IEYA 4TLFA 4D7TA 1QXRA 3IIAA 4I0BA 2CV6A 2H6BA 4PJYA 3R6SA 3CEWA 4LEJA 2H0VA 1LKNA 3GBFA 4WVZA 1EPZA 1O5UA 5I8YA 3ES1A 2UY9A 4ONUA 1RTVA 4YRDA 4A2UA 3E5UA 1J59A 4Z82A 4HVOA 2XHKA 2DCTA 1SEFA 4QGMA 3FFQA 1UIJA 2PAMA 4QXKA 4JTNA 4ZU5A 3NJZA 1OMIA 5I0TA 2WC2A 3E5XA 3WW3A 4R52A 1X82A 5CVRA 5FQ0B 5KHIA 4HMZA 2UYBA 1Y3TA 3EHKA 5JSOA 1ZZBA 3D0SA 4XF1A 4H7LA 2BNOA 2PTMA 2FMYA 2Y0OA 2GH2A 2OPKA 4B29A 1HW5A 3M70A 4BIFA 4GULA 4UXAA 4JVAA 1G6NA 4KU7A 2D5FA 1YLLA 2BGCA 4L11A 1NZCA 1UD1A 2IXLA 5KHHA 5D1IA 3LA7A 2VECA 2D93A 5KHJA 1IPKA 1ZZ8A 3WW1A 2V09A 3ZDSA 2QJVA 4WBBA 5EZWA 4UBGA 5I93A 4E2GA 4PIXA 3BB6A 4E2SA 4PIZA 2Q4SA 1NYWA 1ZZCA 2B5HA 2GU9A 2OZJA 4RD7A 4KWJA 3U11A 3VHRA 4XF3A 4ZU7A 1CAXB 4XFIA 4D7SA 4CYDA 1DZRA 1FXZA 4LULA 3PLQA 3H7YA 1OFNA 1Y9QA 2D40A 3PNAA 5I8TA 3S7IA 2GAUA 3E6BA 3PVBB 2PA7A 4ZU4A 3USSA 1GQGA 3WW4A 4XFHA 2OA2A 4N9IA 2WFPA 3DL3A 5EFUA 5JSRA 3S0MA 1EP0A 2CGPA 3E5QA 5E1RA 2VPVA 3E97A 5BUVA 2PHLA 3IDBB 1H1MA 3I59A 3TNPB 4XFGA 5BPXA 1CAVA 1YFXA 3OCPA 4UBHA 3SMHA 4HLTA 3EJKA 2GC2A 2MHFA 3HT1A 1RUNA 3BALA 3IDCB 3D82A 3NSTA 3EO6A 3FHIB 3FX3A 3SCFA 4META 5J48A 4Z07A 1Q3EA 2QCSB 2PQQA 1EYBA 3CF6E 2KXLA 3UKNA 4MGIE 3DV8A 2PAKA 2UY8A 2C0ZA 4YYOA 4FT8A 1VR3A 1NE4A 4Q0VA 4YSFA 4MUVA 2EAAA 1FI2A 1XE7A 1QWRA 1O3SA 3OF1A 3O14A 3LOIA 2MPFA 2OZ6A 3BPZA 2XKOA 3NL1A 5I91A 4LLOA 4MZUA 1ZRFA 2K0GA 1L3JA 3FWEA 4IEQA 4Q29A 3S7EA 4HBNA 4O9EA 1LB2A 2IXJA 1ZRDA 2XGXA 3LWCA 5LRRA 3ACLA 4MGZE 2VQAA 1O3TA 5JCTA 5BXXA 4FBFA 2PYTA 3ELNA 1TQ5A 4IEOA 3G7DA 1FT9A 4K8FA 4BYYA 1NE6A 4Q0UA 4E2QA 5I0SA 2QDRA 3OGJA 1ZRRA 3KMHA 3RYRA 4JV4A 3H9AA 3BCWA 4YARA 2XKPA 1WA4A 1RGSA 3HT2A 3ETQA 2ZKLA 4O9GA 3U0ZA 2IXIA 4FAHA 1WGPA 4J1WA 4L2NA 1PM7A 3NW4A 3ST7A 1H1IA 1J3RA 1GQHA 4KWLA 3FZ3A 2GC1A 2OYZA 1ZVFA 1DGRA 2BNNA 4OFGA 1CAWA 3KCCA 1UW8A 3TNQA 2B8MA 2EVXA 2IXKA 4LA3A 4BH9A 5HI0A 2N7GA 3LZZA 4IESA 4IEUA 1ZRCA 1X8MA 4Q0QA 4I2OA 3ROUA 2HKXA 4BHPA 4F8AA 1DGWA 3SXWA 4KL1A 4WZCA 3QACA 5K8SA 3N4MA 3UKVA 3EQEA 1YUDA 4HZFA 4MGKE 5E16A 1CAUA 1J3PA 5J7MA 1VJ2A 3ES4A 1EY2A 1LR5A 2PAEA 4XFFA 5FLIA 5I0UA 2BYVE 2PHDA 4EWAA 4I01A 3KSCA 1RC6A 3H1YA 1JUHA 5I0RA 4AVAA 5JSPA 3I59B 5FLJA 4YNIA 1I6XA 4X6RB 1Q43A 4XF4A 4XFCA 2CAVA 5FCCA 4FAGA 4EWDA 4EROA 3FJSA 3H3ZA 4IEXA 2B9UA 2IXHA 1WLTA 3DN7A 2P17A 1V70A 4XETA 2CAUA 4AVBA 3WW2A 3FE5A 5KHKA 5KHGA 2Z69A 1ZZ7A 4HVRA 2F4PA 1J1LA 1O5LA 2FQPA 3NVCA 5CU1A 3L2HA 4IEVA 3U10A 5LEKA 3DKWA 5BY5A 2GZWA 4HN1A 2XL7A 4N9HA 2GC0A 3LA3A 2HJIA 4QM9A 4HSJA 5FPZA 3RPQA 1YFUA 4ORFA 4MH0E 3MYXA 1Q5OA 1X7NA 4LTAA 4XFAA 1OI6A 4QM8A 4EV0A 1QY4A 3IBMA 3NKTA 2BEOA
chains in the Genus database with same CATH superfamily
1REDA 1NLRA 4XUPA 3SQOA 2Q5TA 3CNAA 3AZZA 3WG2A 2ZGRA 5KBFA 1XU2A 2DVAA 1Z7S3 1RUH1 1XSQA 4J25A 3HNMA 3ZYBA 1OQDA 5LRSA 2Y6HA 4RA0A 2VQTA 3RJRA 4EZ4A 5A7SA 2O8QA 4JRLA 3D3AA 4JC1A 1XYPA 2XJQA 4FXGB 3AJYA 5DABA 1LGNA 1H9WA 3CO2A 1I5ZA 3RNSA 2FMDA 3MDPA 2RG4A 1NX9A 1SDDB 3B02A 1OLQA 3MLKA 5DXDA 4E8CA 4C1XA 4KGQA 3P1IA 4FPGA 4XYXA 5L9RA 2Y34A 3T0DA 4PDWC 5GJ6A 1HXS2 3AP4A 3AYAA 4FFHA 3SCGA 2VUJA 2VCAA 4XEZA 4CEYC 2LRPA 4LUKA 3NRUA 5HCAA 1SFPA 1PNFA 4R8HA 4OUMA 5KWRA 4YZ5A 1CR7A 1CZTA 1DFQA 2BU9A 1TE1B 2HWE1 2PHWA 2WNOA 2XBO1 2VZTA 5JIUA 2V73A 1RUOA 1HB3A 1V6KA 3KS7A 2QQPA 2XONA 4FOWA 2DU1A 1WW7A 2ARXA 1U12A 5FLHA 3I8TA 5C33A 4P00B 2P1BA 4JTOA 5FUNA 2CTVA 2QUOA 2ZHLA 1OLMA 3H3UA 3FUOA 3I54A 4Y26A 1KS5A 2J1TA 2OXBA 5C3RA 3T2OA 1QKQA 3DPRC 4YLZA 4YW5A 2VO5A 4R9CA 1RYYA 1ZNPA 4NVPA 5F2SA 4QDQA 2XLFA 3POGA 4XOGA 3POJA 2VNGA 4QPWA 2QZ2A 3ILRA 4IL7A 4I02A 4S2GA 4RR3C 1AR92 2K9ZA 4QX0A 3VLBB 5C9AC 2Y6JA 1J83A 4CXWA 3GJBA 4I0AA 4M4RA 1ENRA 1MS1A 4QMAA 4AQSA 4XQDA 1SCSA 2WNEA 3C7FA 1VRH3 2Y38A 5A3OA 3I3BA 4QPGB 1CAUB 1SQ4A 3WINE 3ZFFA 5FDBA 5HBAA 3CDZB 3NNJA 5A32B 1HB2A 1JH5A 1QJZA 4KGGA 4FFGA 1J58A 1GP5A 1S2EA 1PO12 5FZMA 1A6CA 3WVJA 4KG8A 2D43A 4N53A 2A75A 4ZZ5A 4ZS3A 3O1SA 1PIV1 2A1XA 4CUGA 3MO4A 1ZREA 1YFYA 3H8XA 2P3IA 2WINB 5EWSA 2Z79A 2W3JA 1DQ1A 2E7TA 5I8SA 3RJ2X 2Z2SB 5HCHA 3MZHA 2R49A 2AUYA 4OQ9A 4J1XA 1LRHA 2XVKA 3I4IA 2D6KA 1JMUB 4GH4C 3BOWA 2F4LA 4MX3A 5DN2A 1DQ4A 1XOYA 3LCPA 3OPWA 4BQ2A 5C71A 4IEPA 1HX6A 1O7FA 1R083 1AYN1 3LF7A 3H3LA 1RUF3 5F3EA 5IVJA 5BV6A 4XFBA 5FY0A 3SCHA 3O1UA 1W2UA 3BTZA 3MPBA 1RL3A 2HWC3 1WMEA 2XLGA 1Y9MA 3PDQA 1SLCA 4PF5A 5EJ1B 4W6XA 1VBA1 5IVEA 1XE0A 1JYCA 3AP7A 1GICA 2R30A 2ZMKA 1XU1A 1V6MA 3IPVA 2PHTA 1RMU1 5EP9A 4Q1RA 1AR61 3O1OA 3AMHA 3IIIA 4IETA 3O12A 1GWLA 4FPLA 3N7LA 2BP6A 3LIHA 4HK8A 4LE4A 3WNXA 1FX5A 4D0QA 1RUJ3 1K5MB 1UCXA 1NCRB 4MV2A 3BTAA 1PGW2 1N47A 2D5HA 4JCKA 1CPNA 3AP5A 5DDJ1 5C4WB 2ZX3A 3MIBA 2OVUA 5GLTA 3OB8A 5FY8A 4MXVA 5EXOA 4LO4B 3IIAA 4WVMA 2CV6A 5F37A 5FPVA 3R6SA 4QX2A 4AGGA 2VE1A 3KV6A 3ZXKA 1U5XA 4CDWC 1N3OA 4QQ2A 1EPZA 2WDBA 1R1A2 1NQJA 5FZOA 5IAVA 4BA6A 5FZIA 2J1EA 3WX5A 2RJ2A 4OHZA 4IXLA 1ULDA 1UWWA 4Y5SA 2TUNA 5FY7A 2WO3A 3ES1A 2RS51 2YV8A 1LOFA 1WMFA 1XNKA 3AYDA 4OHVA 5H9QA 1E5RA 3E5UA 3VKOA 4A2UA 1MR5A 3HN3A 4NMIA 2VUCA 2W91A 1G9CA 1BK1A 1CZVA 4YVSC 1VALA 2WJSA 3LDKA 1POV3 1I5PA 2O0OA 3FFQA 3WF2A 4P02B 3FBMA 1US2A 4MLOA 4RFT0 4COYA 1NOVA 2WLQA 4ZU5A 2ZGLA 1OMIA 5A3LA 1OPOA 4CZSA 4OULA 3NNFA 4CP9A 2DFCA 4OI2A 4QU1A 3BI3A 4SLIA 2VCCA 1G9FA 1O6UA 4UFKA 1X82A 1Z7S2 3VBRC 5CVRA 4HMZA 3VBFC 5G04L 1POV0 3WNOA 1DGWX 1Y3TA 4AG4A 3EHKA 3AL5A 3OPZA 3WUCA 4Y3OA 3OPTA 2AR6A 1NA1B 1VRBA 3AFGA 3KT1A 4NO4A 3NV4A 3ZXAC 4S2FA 2GNDA 1SPPB 2BNOA 2QQKA 3F95A 4H7MA 4URTA 2Y0OA 4YZ4A 2O8OA 2GH2A 4HOOA 5HXVA 3UYJA 1RB8G 3ZR6A 3M3OA 4UFHA 2QDNA 4HANA 3RG0A 5FYSA 2DWRA 4D6QA 1H8TA 5FJKA 1ENQA 3APBA 5LA1A 4YG0A 1VAKA 3O1VA 4IE0A 4DB5A 4YM1A 1H4GA 4P14A 2JX9A 2ZGQA 4X8PA 3VB9A 1YLLA 2E7AA 4V2VA 1OKOA 4Y22A 1CD3G 4NIAA 4N43B 3USUA 2BGCA 1JOBA 1NZCA 2AEYA 5KHHA 1YQ5A 5JIAA 4R4ZA 4YZ1A 4YVWB 2VZOA 5FO8B 1UY2A 1XNTA 2JE9A 2Q1FA 3MF9A 4MHRA 4D6SA 3RZHA 5JOYA 3RVHA 5AVAA 1RUE3 5LBBA 2ZEWA 3PUHA 3H8RA 2FDIA 4WBBA 5EZWA 3WDXA 1XNCA 1UU5A 2GDFA 3N9LA 4W6YA 1OF3A 1AR91 4GIQA 3U4SA 3BB6A 4CXXA 1H2NA 1S0FA 4E2SA 4PIZA 2Q4SA 4ET7A 2ARCA 4D94A 1ZZCA 2NP0A 4WM8A 5F8PA 2OZJA 4BWOA 2JICA 4N53B 4KWJA 2K46A 1GSLA 3U11A 3VZMA 2JENA 4XF3A 1J1TA 4D7SA 3NAPA 4NHYA 1S0BA 3ZKUA 4CYDA 4EN0A 2DYCA 1OFNA 2YBPA 2W52A 1MZ5A 2JD4A 4L99A 3VBHC 2A71A 5I8TA 1PO11 4M3CA 1S2BA 1AJOA 2Y60A 4PQQA 5HCBA 1N1SA 2IZWA 4UW5A 1UZWA 3DL3A 5LK7B 1VRH2 2PHFA 4AI8A 4G3YC 4QPIB 5C3QA 1HDKA 1UZZA 2BWAA 1TNFA 4IV3C 2ES3A 1ALYA 4I3GA 4DEQA 5K0UC 1WUVA 3S6PA 2PHLA 4YM2A 4QQOA 3I59A 3WT3A 5BPXA 3ATGA 1PZ7A 3WSOA 1CAVA 2YGLA 2BPA2 3AKTA 4UOJA 3SMHA 3VDDA 3NJYA 3EJKA 3WF4A 2XG3A 3HT1A 3FMGA 2R32A 4XXAA 5A3MA 4ATEA 2A6WA 2Q1MA 3BODA 3IDCB 2JDYA 3E1F1 3LOBA 3ZPYA 4AFDA 3EO6A 1Q8QA 5FJHA 3H42B 1VBB3 2IFRA 4IE6A 3W59A 4ZXKA 5J48A 4Z07A 1R082 1RJ8A 3VDAA 2QCSB 1IKQA 1RUF2 3AKSA 3KHBA 3MGUA 4M4PA 4O61A 5LW9A 2HWC2 3DV8A 2C0ZA 3M3EA 4FT8A 4PI0A 5FWJA 1CZSA 3OBTA 1D4M2 1PGW1 1C57A 4BQ1A 1OSGA 1OXCA 4MUVA 5FZOB 2Z5WA 4E4ZA 5FREA 3B9CA 1C8M1 3O14A 4IGQA 4Y24A 3ZFGC 2JG9C 1FMD3 1IQDC 3BPZA 3BIEA 2WUHA 5I91A 4LE3A 4MZUA 5CA6A 1FNZA 1ZRFA 1RUJ2 4RFRB 2XBO3 3AK0A 1GNYA 1RVF3 4PI2A 1R1A1 2YMZA 3DUIA 3FWEA 5T50A 2B46X 3LEKA 3SKJE 1UZ0A 1XB9A 2JE7A 2WNVA 4O9EA 4WM7A 3NNLA 3LSDA 4LBMA 2P6CA 5CEHA 1XSRA 2AH2A 4MGZE 4CEWC 3POSA 2VQAA 3AFKA 2WYSA 2Y8KA 4X8NA 5BXXA 4CP9B 4FBFA 4LHLA 2PYTA 5TSWA 3PIGA 1TQ5A 4IEOA 3G7DA 5CISA 4NE9A 1FT9A 1UX7A 4BYYA 2JG8B 3MICA 3KQ4B 3O0WA 4Q0UA 4ZONA 1D0HA 3DECA 4N90A 3JD73 3KMHA 1UKGA 4E27A 3RYRA 2WT2A 3VGIA 2VQUA 3H9AA 2UWCA 3ZIXA 1Z7S1 3AXEA 2FHRA 3QH7A 3VZOA 4TN7A 1YQ8A 4K9SA 5L9BA 2GP5A 1RGSA 1QQP3 2D3RA 5IATA 3U07A 5FZ7A 3T08A 4Y5TA 1BK0A 1VBD1 1GWKA 1ND2C 3IB3A 4IQPA 4F83A 4FAHA 2ADEA 1WGPA 5AC93 4YGEA 4J1WA 4D3WA 5I0DA 2WZPP 3RSJA 3USUB 4DQAA 3AMQA 3NW4A 1VBE2 4UF0A 1QH6A 1AVBA 3VBOB 4OUSA 4MGQA 4DXSA 1W2TA 2D6LX 2BFUS 3AP9A 1GQHA 4FOVA 3FZ3A 1HQWA 4UFJA 4RS5C 4B3NA 2WWUA 1AXYA 1IKPA 4QKFA 3K4DA 5H9PA 1EV13 1OH4A 2VXRA 3MUY1 1RXGA 5GZCA 3DYOA 3FC0A 2EVXA 1FV3A 5FWEA 3J8F1 4YFWA 3A4UA 1IS6A 4LA3A 3SC7X 4GD4A 3LZZA 3GZEA 2R6QA 5FYUA 1ZRCA 1R093 3AMMA 3BGAA 4WM8B 1S1AA 1FYUA 1DIWA 1GNHA 1GMMA 3GXUA 3MF6A 4CDUC 4I2OA 3CKHA 5FTTC 1E5HA 4P5HA 3BOPA 2XQRA 3NAPB 4KL1A 2XUEA 3QACA 5K8SA 2RMU3 3N4MA 2A6VA 1W90A 3EQEA 4QXHA 1W8HA 4OUEA 4C8DA 4MGKE 5E16A 3ZSKA 4K20A 4AI1A 1RMU3 1CIYA 1J3PA 3S30A 1Y43B 1AR63 1RUE2 1W0OA 5SV8A 4XW3A 3WD5A 3I2FA 2W1SA 3JUUA 4EN7B 1G8WA 1LR5A 4XFFA 5FMOS 3W20A 5I0UA 1BVP1 1WLCA 3M7AA 4ISQA 3ZMNA 4PDWA 4BCUA 4CDQC 1UKRA 3PTRB 4H3WA 5JXGA 1B35C 3GGLA 3H1YA 4ZXEA 4ASLA 5DZEA 2HH9A 5A33A 3I59B 4CEYA 2BW8A 4CCCA 1W9FA 4LMFA 1RUI3 1LCLA 1XXNA 1W6QB 2JIJA 1VRH1 2VBBA 1I6XA 3GHNA 4OHXA 3VDDB 4NHXA 4XABA 2QQMA 1HJGA 1KFXL 2CAVA 2DDUA 2VBPA 5FCCA 1IOAA 3MIDA 4AFCA 4EROA 4JX0A 4IE7A 5BNNC 2V72A 2B9UA 3FFZA 4QHBA 5FZDA 4LOSA 5FK8A 2QQVA 1PK6C 5L7OC 1WW5A 3DN7A 2PHUA 2W1QA 4XETA 2YFZA 1G9BA 3GJAA 2D3PA 4XHBA 4E9KA 3A0KA 2RS33 1APNA 1LHNA 3DPRA 2ORZA 1LU1A 1OOPA 2I07B 5GZEA 2B42B 4BQ5A 1MZEA 2VUDA 1OD3A 5FOBB 1F2NA 2D6PA 3MFCA 3NVCA 4FO9A 4LK6A 1UU4A 5CU1A 1O8SA 3DKWA 4UW4A 3SITA 1F31A 4RR3A 3ZXFA 3RZMA 3ZIWA 2XH6A 5C9AA 5FY5A 4HSJA 5FPZA 3RPQA 1RUF1 2JEMA 4TYSA 3VHOA 3HWJA 3UL2A 5FY1A 3O0VA 5DPNA 1E5IA 1Q5OA 2G4IA 3WF1A 5JVVA 1D4M1 3K2OA 5F7UA 2CSGA 3DXUA 1OI6A 1VBB2 4RSUA 3I3QA 3FLRA 4QM8A 3V56A 4B4PA 2WNVB 5IK4A 1M4WA 1GBGA 3ACHA 2JD9A 2OT7A 2XLAA 2IVIB 1RUJ1 1SDWA 1CN1A 2C24A 1C4RA 3ZXLA 3BU0A 1IPJA 2E9QA 1DHKB 4M3CE 3ZSJA 3T0AA 1HJFA 2Y33A 1Y7BA 1NLSA 2FDFA 1FMD2 3CL1A 1CESA 3H1MA 1VAVA 3LEGA 2P5BA 3VV1A 3VL8A 4YZ3A 1NZIA 4IERA 2WIIB 2VD7A 4O65A 2XL9A 3LPGA 4KU8A 2XBO2 1RVF2 4OLLA 5A6QA 5IK8A 4YGCA 1OT5A 2ET7A 1DDLA 1QXJA 1O4TA 3KGLA 3CBNA 1F35A 1K5JA 2TNFA 5FYTA 4ZY9A 4AYUA 3LEMA 3B3QE 3RDIA 1PGSA 1X8EA 5FQ0A 4CDXC 4BXFA 1SFNA 3RWKX 3J26N 5F39A 3ORJA 3H1WA 5EYXA 1IG0A 2P37A 3OYWA 4QX1A 3CJIA 5BNOC 2Q0AA 4UF0B 1AHSA 1NCQC 2VNOA 4W4ZA 3SHRA 1ENXA 1QDOA 1W9SA 4AQTA 3JD72 2EXIA 3MIHA 4O7XA 3Q8CA 2HEVF 2ETEA 1YHFA 1N1VA 5LEJA 1C28A 2HLEA 4FFIA 1VBE1 3MW4A 2PFWA 1AZDA 1AX1A 1QQP2 1PMJX 1UY0A 2AACA 2ZX1A 4P9GA 4XF0A 3WZ1A 4AXOA 3R05A 1A8MA 3CLPA 4CDWA 5F1RA 1YWKA 3NV1A 1S4CA 4LKDA 4XC9A 5F6KA 5FMDA 3WG4A 1S0GA 2VW2A 1UAIA 4RQPC 2Q8DA 5AC92 2ID4A 1OHFA 1W6OA 1AUYA 4XJ9A 3OGVA 2DBNA 2C26A 3I2KA 3HQXA 2EIBA 2VMHA 2ZEYA 3FBYA 5LWBA 4E8DA 2CNAA 5DZFA 2A3XA 4MGYE 1W03A 4FOYA 4TXWA 2WAOA 4CP2A 5T3NA 4YVSA 3WQ1A 2B45X 1JHNA 2DBIA 3POWA 1EV12 1QU0A 2ARBA 2MNGA 3E6DA 1BZWA 2V5YA 3IN9A 1GZTA 4PDWB 4AQ6A 1R092 4AVSA 4PIYA 5FZBA 4XACA 5F5CA 3VBRA 4CA9A 1W05A 2ZCWA 1VP6A 3N9PA 3VBFA 5FZ1A 5F2WA 1UF2C 4IEWA 2QVSB 3MV01 3KGZA 2EIGA 2VVFA 2W2IA 2RMU2 3I7DA 1UOFA 1AL23 4R4XA 5ANNA 2WA4A 2P3JA 1SHWB 3HVDA 4COZA 3HIFA 1DQ0A 5DUVA 4DXRA 1RMU2 3RZZA 4JDMA 2Q1ZB 4L92A 5B4XA 1AR62 3VBSC 1C8M3 4ZZ8A 1OUXA 1PMIA 3IDAA 1URXA 4AAPA 3D8CA 4B4RA 1W6NA 4FPEA 1UPIA 4HVQA 3T30A 3DPRB 5FXWA 3LFMA 1OOPB 5EJZB 3U1XA 4COVA 4LORA 5J3UA 4XJ8A 2HEWF 1RUI2 4KNCA 5FPXA 4C91A 1QF3A 5LB6A 1UYXA 3LQCA 1O3RA 2ZTNA 3TBDA 3HEIA 4L0PA 1LAJA 3KB5A 5DG2A 5D21A 1KFUL 2WL1A 4WVVA 4TZDA 3MFAA 5CKMA 5A7NA 3U78A 1AXZA 4DPNA 4I0BA 2PMWB 2A6ZA 2H6BA 1W04A 3CEWA 4LEJA 2RS32 3GBFA 4NPMA 5FZFA 3U75A 4ES8A 4WVZA 1V00A 1O5UA 4OZOA 1KDMA 4YPJA 3JXSA 4GJYA 5D8AB 4AL9A 1VBB1 3KWVA 4K21A 5FKBA 5LBEA 3AX4A 1U5YA 4ONUA 1JODA 1LEMA 1VBD3 2PELA 4H55A 4XCBA 4Z8BA 3VBHA 3EYPA 1HN1A 1Z0HA 4HVOA 1WCUA 2XHKA 3ZFEB 1S0JA 1CX1A 1IGOA 2GSYA 1SEFA 2OUHA 2VAUA 4QGMA 1A34A 5DZGA 1KRIA 4EYUA 3TOJA 5DAQA 2WQ8A 3D4KA 3TEWA 5JOWA 4JTNA 3NJZA 4XBNA 2DUPA 5I0TA 4IV3A 1W6PA 5J37A 3PJYA 2VOXA 5K0UA 3VKNA 3WR0A 2WC2A 3E5XA 1FMD1 3MPPG 1VMJA 3K48A 4R52A 1LOAA 5JPMB 1ULFA 2BOIA 2RHPA 5FQ0B 3J8F3 2WFF3 5KHIA 5FZHA 5KR7A 1RVF1 1ZZBA 3OYWB 4LBKA 1LENA 2XOMA 3CJIB 5HCFA 5A6ZA 1ULPA 2LTNA 3D0SA 4H7LA 3AKRA 2KM2A 4U2AA 4YW4A 1CJPA 4BXSV 2IFWA 2OPKA 3LGRA 5A7OA 2WAAA 4A3ZA 5A3NA 1RJ7A 4Y1UA 1MPXA 2QE3A 2PN5A 4N8MA 5FYMA 3MEPA 3WQBA 5FPBA 1RIRA 4CRQA 4CVUA 1G6NA 5FP7A 3ZXJA 2D5FA 3HBZA 3JD71 4OQ8A 2CDOA 2YUEA 4CDWB 1IS4A 3Q8FA 3ENRA 4L11A 3PJQA 4QKDA 2W46A 3MBWA 1VAMA 4LHKA 1HRI3 3O5SA 2X5IB 1DF0A 4NHMA 2FDHA 2R073 4CCDA 5KHJA 2FZ2A 1IPKA 1YO8A 3WW1A 2JG9A 2OQ7A 3ZFGA 2ORXA 2GN7A 4Y33A 1QQP1 3VKLA 4OI1A 1QIQA 3HJRA 4BK5A 1VPHA 2E6VA 2C4XA 1L7LA 4CUBA 3CIHA 4UBGA 4YVSB 2RV9A 1H8VA 3ECQA 5AC91 1UOJA 4DRVA 4OZXA 2R7EB 3B94A 5GKAC 4XUQA 2YPDA 3I2DA 5BNPC 2ZHNA 4E4DX 2B5HA 2GU9A 1TME3 5FYCA 4D7YA 4NIDA 2XJTA 3ILFA 4CEWA 1OVPA 1GANA 5FUPA 3KV9A 3SISA 3V64A 3VHRA 2ZX0A 5B4NA 1ACCA 2CGOA 4R9BA 5L19A 1FXZA 1HB4A 2ZZQA 3MW3A 4LULA 1EV11 2G19A 2VOTA 3H7YA 4ZPIA 1ASJ3 2D40A 2JXAA 1JOJA 5L73A 1Q8SA 3KQRA 2R0FA 1OUSA 2E33A 2PA7A 4RGKA 3N36A 3USSA 4AEDC 1AR72 3WW4A 2AYHA 5LZ6A 1JZ7A 1I9RA 4G4FA 1R091 2OA2A 4XFHA 2WFPA 4JGYA 5EFUA 3S0MA 3KF3A 2WNUB 4PT6A 3AZYA 4B7KA 1HRV3 3WOGA 5JI9A 2CGPA 2HWF3 1TEIA 1H6XA 1ND3B 5G05L 1FV2A 5E1RA 2EXHA 2V5DA 1JBCA 2P3KA 3AL6A 1W6NB 3E97A 3R4DB 4LXLA 4Q4W1 2WZR3 4HK9A 2RMU1 1PM4A 3RMXA 5M0TA 1ND2A 1D4M3 5FZAA 2X53S 2VOWA 4XTPA 5IW0A 3J7LA 2RS13 2VTXA 4QKBA 2ENRA 2X29A 3OUJA 1W2AX 1W8UA 4NAMA 2YC0A 4RGGA 3BALA 3D82A 3AVRA 3WDWA 1EUTA 3AM2A 4V1PA 3WQ0A 1LNSA 2JDMA 1AL22 1BCXA 2EALA 4RS5A 3OGSA 2QQIA 4K1ZA 4A4AA 1J84A 2VZ1A 2BBVA 2BDRA 2VMEA 4B7EA 3FX3A 2J1RA 1W6MA 3N9OA 3SCFA 1LOBA 1YC61 3ZDVA 1UY3A 1C8M2 1RUI1 2UWAA 5A7PA 4CE8A 1BKZA 3CF6E 2KXLA 5GLUA 2CGNA 2PAKA 2UY8A 2WKKA 2YG0A 4I0WB 1GYKA 3N3HA 4MADA 5CFDB 3N9NA 1ONAA 1PGL2 1S0EA 3VD4A 1YI7A 2DVDA 1DCSA 4YSFA 1Q8VA 4FTSA 1WW6A 2RE9A 1QWRA 2CDPA 3OF1A 5IAXA 2P6HA 1KD7A 3AVSA 2MPFA 3NL1A 4S2HA 2XKOA 3OEAA 5LA9A 4YW7A 2RS31 4JGZA 3D6EA 1E5SA 3ZN6A 2D6NA 1GZWA 4HT1T 1SLBA 2J7MA 1L3JA 4C0BA 1OVSA 2RVAA 5IFPA 1U0AA 3S7EA 3KD4A 1MS0A 4CU9A 1LB2A 2IXJA 4LNVA 4U36A 1GZ9A 2VZVA 2XGXA 1HV0A 2VL4A 2WWJA 1QJFA 4LOTA 4XJAA 4ZS2A 4CDQA 1PZ9A 3GDBA 1B35A 2ERFA 3LE0A 4GWIA 2A7AA 2ZA9A 3BN6A 4BLJA 2L9LA 3WNMA 1VBE3 1NLQA 3NV2A 4NOTA 1XYNA 4UW6A 2PQSA 2G9GA 1DQ6A 3ILNA 3WDTA 2C9AA 3T2PA 5J09A 1VBD2 5JPNB 1OURA 4M01A 3KV4A 3ZN5A 5L7OA 3BCWA 3AP6A 3IKWA 2HWB1 3KF5A 5CNAA 3HQRA 2W87A 3HT2A 2ZKLA 4LQRA 5C3PA 2IXIA 2W5FA 4QQLA 4XMAA 1SFYA 2DF7A 2CWSA 4A41A 3AJZA 1QJX1 5ISLA 1SZBA 1PX3A 5DUUA 1S2KA 2QQWA 3RZGA 5F32A 3HOBA 2AZ5A 4IV1A 3J8F2 2WFF2 3I3DA 2ZBJA 4FQ4A 3QD6A 4CCNA 4KWLA 3JQXA 1JI6A 5GALA 5LA2A 3ZFGB 1DGRA 1ZM1A 3OSDA 2ZGSA 3RWNA 1ZRIA 1JYWA 4N7UA 5LBFA 3IDEA 2B8MA 1S0CA 1C3HA 4M3CF 2E51A 4GB33 4UW3A 3WNKA 3JB8A 3SH5A 2WBKA 3MLLA 4P08A 2LM3A 4YM0A 3ZFFB 4BH9A 4CP1A 5HI0A 2N7GA 3THCA 2UU8A 4XZPA 1HN0A 1VBC3 1X8MA 4Q0QA 4SBVA 3SEPA 4AFBA 4GWMA 4CEWB 5ABJA 5DQ0A 4BHPA 2GNTA 2J1VA 3BPSA 4XILA 4F8AA 1CPMA 1K5MC 2OIIA 4WZCA 1HRI2 1NCRC 4V2WA 1D7PM 4B4QA 1JTZX 1AJKA 1QNYA 2R072 5C4WC 5GLZA 1YUDA 4Y1XA 5J98B 4BQWA 1ZYBA 3VBUC 5J7MA 5K4LA 4AR2A 5A70A 4UT5A 1VJ2A 3LPFA 4JGYB 4PLOA 1KXGA 4H14A 2DU0A 1DLLA 1UOGA 2F6BA 2OPWA 5ACA1 4EWAA 3UV9A 1D4VB 5FZ8A 4L8QA 4I01A 4HKOA 1US3A 2ZGOA 4ES9A 2TEPA 5I0RA 1TME2 1BMV2 1QJY3 1AR71 1O59A 1ND2B 2WA3A 3M2MA 3IPVB 4MGSA 4XIOA 2XPJA 4X6RB 3ZYJB 2VMGA 5BNOA 1K3IA 1AYM3 4FXKB 1NCQA 3VKMA 4EWDA 5J1XA 1ASJ2 5A7QA 2SLIA 3FJSA 5DAPA 1PO22 5CKQA 3WP3A 5FOJB 1A8DA 1YIPA 1PX4A 3VZLA 1SACA 1V70A 3IM0A 1GOHA 4QU2A 4QX7A 5T55A 4Q4V3 4AEKA 4AVTA 1HRV2 3SH3A 1WWYA 2HWF2 2LW8A 1SLIA 3FE5A 3HNYM 1WKYA 3ITQA 4JKKA 1CVNA 4XAAA 4IDZA 4Y1VA 3EMRA 4FVVA 4WVMB 4MHUA 1BHGA 1J1LA 2WZR2 2FQPA 2ZGPA 2G1MA 2C5DA 4QKNA 1AL21 3UGGA 3WUDA 5JXHA 5LEKA 5A1AA 3TRSB 3OJBA 4RQPA 4HN1A 1BYHA 1NA1C 2RS12 4JDNA 4N9HA 2X05A 2HJIA 4QHZA 4YM3A 5C3SA 2JECA 3CU7A 3D5OA 1VB4A 5DAWA 1YFUA 1H1AA 3OBZA 3A23A 5F5QA 3MYXA 3WLUA 4JGZB 1RITA 1HV1A 3MUZ1 5T5OA 4YWAA 3ZN6B 1PGL1 1MZ6A 1GZWB 5EYYA 4K7JA 1ULGA 3KT7A 2PHXA 2KR2A 2WO7A 3K3NA 4Z1VA 3MHZA 3NKTA 2BEOA 3IAPA 3T2TA 2FDJA 2V4AA 4BDVB 4N43C 5L36A 4M0NA 1LHWA 2R063 2XXZA 4ZHNA 1LECA 3WXPA 3KT4A 4YVWC 4NRPA 3ZXDA 4CDQB 3WDVA 3KZ4C 3GYDA 5CZKA 1UIKA 1QDCA 5GM0A 5C70A 5A7WA 2YROA 2ZABA 5CAZA 4F3JA 1MQTA 1U5IA 2Y6KA 1GLHA 2Y64A 4HL0A 4L9BA 2YYOA 2WT0A 1XRUA 3E6CC 5LCWL 4AF9A 1REEA 4AHWA 2YBKA 3OD0A 5FP8A 5T5JA 1CIWA 1U5ZA 1GWMA 2QNKA 5AFEA 5L7OB 3V0AA 3VBSA 1PHMA 5FFOC 5CFCC 3J9SA 1YFWA 1SBDA 3J7MA 3WY6A 3F2ZA 1WD4A 1I1EA 4DUVA 1H8TB 1CX4A 4XF9A 4EE2A 1VB2A 1ZZ6A 3AB0A 3T09A 4AEMA 5IVFA 2JDPA 1XC6A 4Y22B 1DZTA 2ATFA 3OUIA 4IUGA 5IVYA 4I09A 4IV1B 3ZN4A 5EPAA 1BLZA 4CP0A 3H8UA 1OBNA 4IEZA 4QGNA 2XJPA 3C2UA 3C7GA 1LULA 2DVFA 4JHZA 2XHNA 2A73B 4PHZA 4HN0A 1KS4A 3RYPA 4QPIC 2VVDA 3N9MA 1COV3 3ZXGA 5KC6A 1KDKA 3UJOA 1UYYA 3OEBA 1GOGA 4UWDA 2WFF1 3LAGA 4JQRA 3B9IA 3HR9A 4COUA 1QMJA 4CCMA 1H2MA 3KM5A 4ATFA 5FR3A 1LHOA 1ZX5A 2LALA 3NQHA 4LBQD 4I3PA 4OMDA 1DGLA 4QB2A 1W06A 2PXJA 3J7NA 4EN6B 5ABJB 4HPKA 1ODNA 4Q4W3 4LHNA 2GNMA 4KG0A 2QTWB 3L9JT 3SEEA 2XR4A 4M3CB 4Q0PA 3WP4A 4RHV3 2IC1A 4RN5A 2BNMA 4ZKTB 4LIVA 3PTYA 1LGCA 2Y6FA 4GB32 1CONA 2ZX4A 1AX0A 5C6CA 2VR4A 1JYXA 1HRI1 1DQ2A 2UURA 1DZQA 3S5AA 5CIRA 2R071 3QH6A 3V65A 1S0IA 1EUUA 1CAXA 3VDBA 1VBC2 4OYUA 3M3QA 1OH3A 2GC3A 3GZUC 5FZ0A 4BJ0A 1CAVB 5F3IA 5FZCA 5C8WA 4B1LA 3W5MA 2W39A 3R4SA 2D6OX 1JXNA 3THPA 5BNOB 4Q4X3 3WG1A 4Q1PA 1PMHX 2ADDA 4JKMA 5GLWA 1NCQB 1XJAA 3K3OA 2GP3A 3UESA 4LKSA 1UL9A 4YGBA 1BMV1 1N1YA 2NQYA 1TME1 4CU8A 2XWJB 4FCAA 5HV4A 4G9SB 3EXUA 1CGPA 2O1QA 2DUOA 2VZUA 4Y4RA 1UX6A 4PLNA 2GH8A 2UYAA 3B93A 3GCXA 3LA2A 1UN1A 4FPOB 3RI9A 4AI0A 1JZ4A 2RJKA 3ZYFA 1G7YA 4C0HA 4HETA 1ASJ1 3RRDA 1MS3A 1QH7A 5CADA 1J3QA 4BPZA 1T6GC 2JG8C 3NNMA 1IG3A 1QJY2 1PO21 3T1LA 4QX5A 1QXPA 2H6CA 5FY4A 2WSUA 4DZGA 3FN9A 3SNMA 4C1WA 1NY71 1OLRA 2F17A 3IWZA 5FV3A 5LBCA 4OI0A 1T6BX 1HRV1 1W9WA 2E31A 3NJVA 2HWF1 2D3SA 4ASKA 4CCOA 2WS91 1AYM2 3C3VA 2WR9A 4LO5B 5APAA 4L97A 1LJ7A 3THDA 3I97A 4MXWA 2WZR1 2FBEA 4LK7A 2FCTA 3SH4A 5E6HA 1XYOA 4BB3A 4IEYA 4QDSA 2R043 2RS11 1W9YA 1QXRA 2ARAA 4WM7B 4Q4V2 1BEV3 2R0HA 2WSVA 2H0VA 1LKNA 1SLTA 2C6SA 4LBLA 2GMEA 1YQCA 2ILMA 2QQNA 2RM23 3VBOC 5GZGA 1G9AA 2A6XA 2HWB3 2BGOA 5B2GB 2VC9A 5I8YA 3VN4A 4COWA 5JUVA 5A7WB 2UY9A 3POYA 2QBXA 4YRDA 3ZYGA 3AMPA 1QJX3 1MQTB 3T3YA 4Z82A 1ZBE3 4GH4A 4AEDA 2VY0A 2DCTA 4NRQA 2DV9A 1UIJA 4AZZA 1R64A 4E4SA 2PAMA 2I74A 4URAA 1SMVA 4QXKA 1DGRN 1JZ6A 3V0AB 4WM8C 3ACIA 1BVVA 1GKBA 4HKLA 4P9YA 4K3UA 2XVGA 4AHXA 3ZM8A 4AFMA 4Q8LA 4QPYA 3AYCA 4CXYA 4OI4A 4NIHA 2R062 5AFBA 5JMOA 4MGTA 5JSOA 3ZYIB 5FPLA 4MO3M 1LOCA 1S55A 4KBBA 5FMBA 3OBRA 3LEIA 5A80A 5HPOA 1Q56A 5C5UA 4DUXA 1WLWA 5FXZA 1HW5A 2P4EA 3M70A 4NN0A 2FDGA 3B7MA 1ODMA 3ZYHA 3O7OA 4WZFA 1JN2P 4UXAA 1BBT3 4N7IA 4GKYA 5CB7A 3ZX7A 4GALA 5IK7A 4KU7A 4XQWA 4FTEA 3T0BA 4XUTA 5JMCA 4W8JA 5FIXA 1RINA 1UD1A 4IGPA 2VNVA 4Z2WA 2VMDA 1ST8A 3T4VA 5ACA3 1KJRA 2PLV3 3IT8A 4LHSA 4XJZA 5FMCA 2D93A 4ARYA 5JZGC 1X9PA 2ZJCA 4HPKB 1ZZ8A 4XBLA 2YXSA 1AR73 2VVEA 3BIWE 4LPLA 5FRAA 3ZSMA 4DOUA 5E8AA 2XWBB 4D8MA 1RXFA 1F15A 5I93A 2CYFA 2J42A 2BWCA 3ON7A 4GMP3 3JQWA 5EV7A 4OCTA 4E2GA 1COV2 1V6NA 2X09A 2HEYF 1RUD1 2Z42A 4YG6A 1FPN3 1NYWA 2VM9A 2ZAHA 2CHHA 1D2QA 4RD7A 5IJRA 4BZ4A 1W8FA 5H9SA 3ALQA 3JB4C 4ZU7A 1OA3A 2VZ3A 1CAXB 3FHAA 3AKPA 2JWPA 3LD8A 4XBQA 2E53A 3KV5A 4CEYB 4DEVA 1DZRA 5A33B 5A3UA 4GMP0 3PLQA 1Y9QA 3NWKA 4GB31 4J6GA 1V6IA 1FOD3 3S7IA 3E6BA 1LEDA 3PVBB 4Q4W2 4QB6A 4ZU4A 1XPWA 2ZMLA 1EAH3 3R4UA 2WNVC 2EAKA 4TWTA 1VBC1 3U4XA 3S5QA 3K46A 4RHV2 4NIIA 5JSRA 2Y26A 3CHXA 2QQOA 5FZLA 1S0DA 4Y4YA 1H0BA 2XJUA 5FP4A 3VL9A 1GUIA 4XJWA 1JHJA 3IDBB 1SG3A 3TNPB 4XFGA 2A70A 2XUMA 3UETA 1LGBA 1MVEA 1Z78A 2TBVA 3KLSA 3OCPA 4UBHA 3PU8A 4MYEA 2RJLA 4HLTA 2GC2A 2ZAAA 2BERA 2YHJA 3UK9A 2WQZC 3FHQA 2R16A 2VZQA 4Q8KA 5IFTA 4UFIA 4FTBA 3K77A 2WO1A 1RHI3 2W1UA 3P3NA 4RR3B 2Q8CA 2VMIA 3WDUA 4Q4X2 1YJKA 4AAXA 5C9AB 1JYTA 1YQ2A 3JBG3 4Y20A 5HXMA 4NWWA 3TEYA 3J4UH 2JDKA 2A6YA 4MXWB 1QJY1 1N3PA 1NAEA 3NV3A 5FY9A 5KXCA 1YI9A 1VMFA 1Q3EA 2EXKA 4A44A 1ZA4A 1OPMA 3ZOIA 2PQQA 1EYBA 2Y0IA 4H2AA 3ZR5A 5C7GA 5LY1A 1AYM1 4YYOA 3HBKA 1Q8OA 4UAPA 5FUIA 1VR3A 1UPSA 1NE4A 2VOKA 1ULEA 4Q0VA 3OUHA 1OQEA 1RUC1 1XE7A 2IVJA 3N7MA 4XMIA 4DXTA 1K5MA 3LOIA 1GP6A 1NCRA 4YW6A 2OZ6A 3NJXA 4Q4V1 5C4WA 5FKCA 4LBQA 3TEXA 4EQVA 4DIQA 4LBOA 1V9U3 2BQPA 3VD3A 1F5JA 3VBUA 4GH4B 3PUQA 4IEQA 4Q29A 3WF3A 1YRZA 4DS0A 1H30A 1MS5A 3TEZA 4HBNA 1P8JA 1WW4A 4AFAA 2VUAA 2H0BA 3Q8BA 2R042 3RFRA 1XNBA 4GXLA 4GAZA 5CYYA 5FZ4A 1BEV2 2GMPA 2VMFA 4DNYA 4LO8A 4A45A 3O1RA 5JCTA 1O3TA 2RM22 1W8NA 3CMGA 4GZ9A 2HWB2 1W0NA 1WLDA 1OQ1A 3KVAA 4LKFA 4E2QA 1LTEA 1KITA 2W9XA 3CQOA 3WNPA 2QDRA 1POQA 3OGJA 4NUBA 1NT0A 4YZ2A 1AR83 1MS4A 1QJX2 2JKBA 4JV4A 1M06G 1ZBE2 2Q8OA 4YGDA 3HAGA 2R061 1JYIA 4YARA 5BNQA 2XKPA 1WA4A 4OVEA 5A6YA 3ETQA 4IGOA 4O9GA 3B5LB 3W5NA 3U0ZA 1C5IA 3RZJA 1X36A 5IVBA 1LHVA 1C1LA 1HQNA 4HG6B 4Y1YA 4YFZA 3A7QA 4A6SA 1IS5A 5IVVA 2GN3A 1YJLA 4ITCA 3WCRA 3C7EA 1FATA 1PVC3 4L2NA 2VU9A 5C8CC 5KXEA 1PM7A 3I2GA 1F8VA 1NA1A 1H1IA 1CQ9A 4K1YA 1VE0A 1SPPA 1W6OB 3WF0A 3J7HA 5EHDA 2W08A 2OYZA 4TTGA 2BNNA 4OFGA 1CAWA 2D98A 3VD9A 3TNQA 1A78A 5L9VA 5GZFA 1GZCA 3HN1A 4IE4A 4ISRA 1TMF1 1L7QA 1YYNA 5T5PA 2E7QA 2BOJA 2JE8A 1GQPA 1OOPC 4FP3A 4XAEA 4BMEA 1LOGA 4FI9A 4IESA 4IEUA 2ZGMA 1BBT2 4N43A 2AREA 1OKQA 4YVWA 3NKGA 3I49A 3BTXA 3IAQA 1V6JA 3AKQA 1C8NA 5FZ6A 1LESA 2BFUL 4JRAA 3UGHA 1WZXA 1K45A 1COV1 2PLV2 3GHMA 3VBRB 5ACA2 3VBFB 1JW6A 5F5IA 4CU6A 1VIWB 3BKZA 4XDOA 3AC0A 1PO23 4CUCA 4KQ7A 2DVBA 4K8RB 1W8OA 3ES4A 2G9FA 5T5LA 4LIUA 3KVBA 2QFEA 5FLIA 2BV4A 1W39A 2WS93 2ZGKA 1FPN2 4A7KA 5DAXA 2VBDA 1DP0A 3C7HA 4D69A 1RC6A 2VZSA 5J36A 2AC1A 1JUIA 1X33A 3L2YA 3PUAA 4TSVA 5D8AC 4AVAA 4GQ7A 2BVBA 5JSPA 3ETPA 4P9JA 4YNIA 1AXKA 5KXDA 3TAYA 1E57A 4QQPA 4RHV1 2XVLA 1Q43A 1UY4A 4XF4A 1OF4A 5FBJA 2CU5A 4BOWA 3ZFEC 3OGGA 2WT1A 1FOD2 2CL2A 3H3ZA 5T54A 4JHTA 1W3XA 4IEXA 3WCSA 2IXHA 1EAH2 4MOAA 3AZXA 4QPIA 4Y20B 3W58A 5FYYA 2P17A 3WP5A 1JZ2A 2XJRA 5FMOL 1QOTA 2CAUA 5CG8A 4Q4Y3 4BQYA 5FPUA 3BVCA 4OMCA 1QEXA 1ZZ7A 4HVRA 2XDVA 4Q4X1 3WDYA 4LBNA 3T1MA 3L2HA 4IEVA 3P5BA 3U10A 3U37A 1IQAA 1X50A 2NPIA 3CJIC 4Y5Z0 4CDUA 4DY5A 4EN8B 4BU2A 2GALA 3LA3A 5FXXA 4MG2A 3DF0A 3MIGA 4GJZA 4P9IA 1TNRA 1RHI2 3JU9A 1OA2A 4ORFA 4FQZA 1X7NA 3RZLA 3RS6A 4LBQB 2EF6A 4UFMA 3VBHB 3VZNA 1HLCA 2QKDA 2FCUA 4LTAA 3JBG2 4R9AA 4XFAA 5JI7A 3VBUB 2B39A 1MS9A 1TG7A 1QY4A 2CWMA 3AXDA 4AI3A 3IBMA 4HONA 2BGPA 3PUIA 1B09A 1V0AA 1WMDA 2DCZA 2I45A 2ZGNA 5DUWA 5FP9A 1G9DA 2ET1A 1XNAA 2HWD3 1QJU3 1W6PB 4IV3B 4KWKA 2X5IC 2VZPA 4NRMA 3T4HB 1AX2A 3HQUA 5K0UB 3POBA 3EBRA 4XZUG 2BVVA 1X9TA 1YNAA 5JR7B 3HD8B 1WBFA 4DUWA 4A7YA 2DURA 2D7FA 3M3IA 3UT0A 4CU7A 2D44A 2R041 3KCXA 1RUG3 1GR3A 3H7JA 1N3QA 4JQTA 3MI8A 2UWBA 4QPGC 1BEV1 5LK5A 4Q0SA 4F7ZA 1NXMA 5BNNA 1SBFA 2NMNA 1V9U2 4BIOA 2RM21 5HV0A 3HNBM 1PK6A 2IXCA 1KEXA 2QZ3A 4AEJA 3BTYA 2RDRA 1ULCA 2G9ZA 4W65A 4WV8A 4RYDA 4AK3A 1DU3D 2ZHMA 3MIEA 4BQ4A 2EICA 4BE3A 2JG8A 4FOQA 2WZ8A 1ZBE1 1UZYA 2DCJA 4FPKA 1RUD3 3Q8EA 5FZEA 3LDBA 1W2NA 4XHXA 1QGLA 3KCYA 2VCMA 1HXS1 2VNRA 3ACFA 3O1PA 4WVWA 1GU3A 1KQRA 2BUKA 2WNUC 4LUMA 2FD8A 5CFDA 2JG9B 2Y6GA 4P9XA 3VZJA 1AR82 2O14A 1DG6A 1ND3C 2RR13 4DY3A 1CAWB 5E89A 1XE8A 3LSEA 2J1SA 1ZBA3 4PF1A 4LR4A 1QOSA 1A3KA 1JZ8A 1UMIA 1MEC3 3D0JA 4YW3A 1WBLA 3CZJA 2ZMNA 1NG0A 1UO9A 1YQ6A 2HBTA 5FBZA 3VBOA 1WA6X 3RMYA 2ZHKA 2JDAA 3I3MA 1F9KA 3CJXA 2VG9A 3HMYA 2DVGA 3ZYPA 4IW3A 1PVC2 1XNDA 4FPYA 4XDQA 4AE2A 2WLPA 3O1TA 1AF9A 3AZWA 4GA9A 4QGLA 4CSWA 2WRAA 5H9RA 1ZZ9A 3TN93 3O0XA 3ZYRA 4EWEA 4JKLA 1DYOA 4CCLA 2V4VA 4YW1A 3ZMOA 4OHYA 1BBT1 4NWVA 4CTEA 4DINB 2QQLA 4Z92B 5JR2A 3BU7A 3NO8A 4YW2A 5CFDC 1OD5A 2PLV1 5EIYB 2Q30A 3K75B 3H50A 1UOBA 2AEZA 3I2HA 3BYWA 4QHOA 3IMMA 5AVPA 5A3TA 5JLVA 5KC5A 2DCYA 5FAXA 3JZVA 4CDXA 3PHMA 5ERLA 2MEV3 3WQ7A 4GMP1 3A0NA 3LFIA 1WMXA 4AGVA 4CCKA 5DG1A 1FPN1 3NNGA 2X8KA 5IK5A 3K4ZA 4HSLA 3VD7A 4W6WA 4DMIA 1JZ3A 1RUC3 3WV6A 4X6QB 1WCKA 2BBAA 3GF6A 1HB1A 4RS5B 3T2QA 2W0XA 4BQ3A 5JAXA 2EA7A 5CG9A 3O1MA 1NY72 1EPWA 1W6MB 2XJSA 5FYHA 3RYKA 3UKTA 2WS92 1MVQA 3WHTA 3R0RA 5FYBA 4AHZA 1O3QA 2W47A 3INAA 1FOD1 1W6QA 1UY1A 1UYZA 1SLAA 2JDZA 2VULA 3MW2A 3N7JA 4AQ2A 1EAH1 4EZHA 4C90A 2YC2A 3MIFA 4LO6B 3QOPA 5DUXA 3B69A 1OLME 2W1WA 4QDRA 5FPAA 3SKVA 2W68A 2NM1A 4B8EA 4CDUB 4E4HA 3M3CA 2A5ZA 1JU3A 2JB8A 5IYYA 2BZDA 3OTFA 4BQXA 1Q8PA 2YU1A 2BRTA 1BQPA 5JZGA 1RUH3 4AVCA 4OHWA 4BM8A 4NPLA 4EN9B 1WCDJ 4DRRA 1TZOA 2K2SA 4NJ4A 2VH9A 4LA2A 4KWUA 4QX8A 4XE9A 4TLFA 3FL7A 1OFSA 4D7TA 5JXJA 2ZXQA 4PJYA 4Q4Y2 4UFLA 2YGMA 4A3XA 1NXD1 1O91A 2JJ6A 1UMHA 1RHI1 3P6BA 4A42A 1NKGA 1C1FA 3I2JA 5LASA 1BJQA 4DFSA 4FSJA 1B35B 3IMNA 3JBG1 3A21A 4NR1A 4AOCA 1IS3A 3GM8A 1JU4A 1F4AA 2RDNA 1UU6A 1RTVA 3V0BA 4QWNA 2VW1A 1J59A 1SLLA 4JDOA 2HWE3 3ACGA 4NHLA 1XQNA 3ZFFC 5BNNB 4FPJA 3ZO0B 5A3WA 2P34A 5FZGA 3ZLIA 2JIGA 4BMBA 3EB7A 3RI8A 3W21A 1PK6B 1O4YA 3LDRA 4XUOA 5FYZA 5GLVA 3ZKYA 1ZA7A 4N53C 5EQUA 1DQ5A 3N7KA 2A3WA 1H6YA 3WW3A 3S57A 2VMCA 2HWD2 1QJU2 4LJHA 3N35A 4Q2FA 5GZDA 1TMF3 3GNEA 5JOZA 1V6LA 1V9U1 2XJVA 5FXVA 2UYBA 2NYYA 3B01A 4W50A 4QT6A 1D2SA 1H2LA 2YDEA 2ZEXA 2XMLA 4XF1A 4CUAA 1RUG2 3DCQA 4JGYC 1FAYA 2PTMA 1GP4A 2FMYA 3GBWA 4B29A 2B9VA 4MSVA 4NROA 4PBOA 4BIFA 4CPBD 4D6RA 1PNGA 3NMBA 1NQDA 4GULA 1JYVA 4JVAA 4XTMA 3FLPA 2FZ1A 2QQJA 3P3PA 1KGYA 1G86A 2LROA 2ZPXA 2J1AA 4Y1ZA 3VKFC 1JZ5A 5FZ3A 1AR81 2W94A 3MLJA 2IXLA 4NPRA 3GBGA 2YBSA 1OA4A 2AENA 5LATA 5D1IA 3LA7A 2VECA 2WN2A 5FYVA 3PURA 1RUD2 3DKQA 2JDHA 2JDNA 4LKEA 1PIV3 5CKNA 2DUQA 2V09A 2XB6C 4PCRA 4DO0A 2ZZJA 4HFSA 3ZDSA 4LO7A 2RDSA 1KJLA 4AI9A 2QJVA 2C9KA 4XURA 5CFCA 5FZKA 2R1BA 2RR12 1W8ZA 4QAWA 2HYXA 2VZRA 2WO2A 2FCVA 1PVC1 3I2IA 3PVOA 3OBAA 4PIXA 3UJQA 5JXIA 1MS8A 1ZBA2 3ME2A 1I3HA 3VDCA 1UXZA 1HIXA 3K51A 3W9AA 5FP3A 3WG3A 4AWDA 1WCSA 1REFA 1MEC2 1XBFA 1AYN3 5J96B 1W99A 1CJDA 3QBQA 4XFIA 2J22A 2ZX2A 3GZAA 4XQ4A 3WNLA 3AMNA 5FO7B 1UZVA 4CDXB 1VBA3 1LOFC 2P2KA 5EJ3A 3FLTA 3PNAA 4A6OA 2OKXA 4JGZC 1W3VA 2GAUA 4AGRA 4BK4A 4BLIA 3TN92 1GQGA 3Q9OA 2YC4A 2E63A 1HKDA 4LBJA 1SCRA 5FK7A 4N9IA 3THTA 1H2KA 5A1LA 2AGSA 3PUSA 2OX0A 1EP0A 2VJXA 4RGAA 2WZEA 2B7YA 3E5QA 1F5FA 1K12A 1GOFA 2EXJA 4LITA 3I3EA 3C7OA 4YG3A 3ZSEA 2DCKA 2VPVA 1CWPA 3JCIA 2VTFA 5BUVA 1H1MA 2OQ6A 4XVHA 5DDJ3 2EIDA 2C1FA 3U14A 1YFXA 5JWPA 1O8PA 2MHFA 1PZ8A 2RDQA 3DGTA 1RUNA 5C8CA 3DXTA 4UI9L 2SBAA 5DMYA 4XPVA 1W8WA 4RQPB 2MEV2 1L7RA 4NAOA 1UNBA 4AVVA 2Y6LA 3NSTA 3PIJA 5JZGB 4I30A 4FPCA 3RQ0A 2WQ4A 4P9WA 2DTYA 1QNWA 3FHIB 2YFUA 3C8XA 3SLIA 5A3PA 2W92A 1STMA 3WW2A 2RS53 4LT5A 1RUC2 4META 3VUOA 3G6JB 2YB7A 2YY1A 4QB1A 1BXHA 1H8TC 5F3CA 1Y9GA 3OY8A 2BTVC 4GKXA 1W28A 4A7ZA 3UKNA 5D2AA 4MGIE 5BNPA 2PHRA 3K4AA 4CCJA 4IV1C 3H0OA 3Q8AA 2YPJA 1DYKA 2QQUA 2EAAA 1FI2A 5JOXA 2IWGB 3VD5A 1ENSA 1R081 3OG2A 2VCBA 4PBPA 2KA3A 3WEZA 3I2OA 1O3SA 1W0PA 4Z2AA 4M00A 4XCAA 3OOXA 2ZOEB 3TB0A 2VGDA 3PU3A 2HWC1 2VW0A 4Q4Y1 5IHRA 3M4FA 4LLOA 1WCQA 3V0BB 3VZKA 1RUH2 2K0GA 4TLGA 4AW7A 5K9YA 5A6XA 5IT6A 4JZRA 5IVCA 4FPHA 4P9LA 3AZVA 1HXS3 4INDA 2HBUA 3QCWA 1ZRDA 1IPSA 3LWCA 3VBSB 2ZEZA 3VHPA 3GZTB 5E88A 3ACLA 1UYPA 5LRRA 1GNZA 4Q26A 5F6LB 4HXCA 3ZXEA 2VTXJ 5D8AA 5ABJC 3NAPC 3ELNA 4QD2A 5C5TA 4K8FA 1MACA 4KH9A 1NE6A 3RGBA 4QQHA 1UQXA 2OW4A 3PVEA 3ZFEA 5I0SA 1LHUA 4FP2A 1W8TA 2D6MA 3A22A 4CCEA 2DTWA 1ZRRA 4QXCA 1JYNA 3PMSA 4B1MA 4JAAA 5T52A 2HWE2 1R1ZA 3OGRA 3PVNA 5FYIA 2HWD1 1QJU1 2LUWA 1VMHA 1DYPA 2YU2A 4UYBA 1IHMA 4QXBA 5C3OA 2A3YA 2NN8A 4P5YA 2X10A 4KI5M 3QLQA 3ASIA 4EJRA 3RZKA 2ZS6B 1ULOA 1RUG1 3N9QA 2ZACA 3VDDC 4AI2A 5F9TA 2GNBA 5CBLA 1AR93 2ZGTA 1NUKA 2JB4A 3URFA 1QJEA 1POV1 1TMF2 1PVXA 3ST7A 5BYNA 4BISA 1V6OA 1J3RA 2NZ9A 3PL0A 2P3YA 2GC1A 2B4KA 3GCWA 2WYFA 1ZVFA 4NIGA 3KCCA 3LIGA 2WWSA 2EIEA 2Z4FA 1UW8A 3LB9A 1HQLA 4S2DA 1F4HA 1VLNA 2D97A 2XQXA 4PLMA 4XUNA 5CFCB 1PO13 2IXKA 3LKJA 3KHCA 2VQ0A 4AHYA 2VOVA 3ABZA 2WN3A 2FDKA 1WD3A 1IZ3A 2NLRA 1OC1A 2OUJA 4Q5OA 2E26A 1W9TA 5DAVA 3ROUA 2W95A 4HKWA 2X5IA 5FO9B 1SBEA 2HKXA 2J1UA 4GWJA 2RR11 1DGWA 3SXWA 5LA0A 3UKVA 3IZOA 1ZBA1 4XIKA 2KD7A 5A1FA 1PIV2 1JS9A 1YEWA 4HZFA 4DXZA 4QPGA 1CAUA 5F3GA 2LS6A 3DYMA 1MEC1 1YIFA 5A32A 4WM7C 1EY2A 2ZGUA 4MVTA 2PAEA 3TYJA 1LODA 2JKXA 3AYEA 2BYVE 2PHDA 3WNNA 1TVGA 1DLCA 1LOEA 5IWFA 1H9PA 1JOPA 3CZUA 2ZKNA 3KSCA 3M1HA 3H8OA 3PMEA 1JUHA 3TN91 2YZ4A 4R9DA 1YXWA 4ARXA 3UGFA 1RUE1 5FLJA 4PQ9A 1AYN2 1T2XA 2OS2A 3POFA 5FZ9A 3VHNA 3POEA 1MQTC 5C8CB 1QHDA 4XFCA 4K6BA 4FAGA 1VBA2 3FUQA 3M8LA 1D0GA 4GWNA 4K40A 2Q8EA 3WHUA 5LY2A 5SV5A 4NHKA 2HYKA 2WNUA 4XDPA 4LLFA 1WLTA 2GMMA 3DYPA 1ND3A 3DEMA 5ANQA 4KBZA 4RL7A 3ZPOA 1GV9A 4XJUA 2JDUA 2R1DA 4AVBA 3X29B 3OD4A 4XXPA 3HPNA 2MEV1 1LU2A 5KHKA 2I2SA 5KHGA 3OY8B 1UMZA 2Z69A 1R1A3 2F4PA 4Q27A 2WABA 5DDJ2 1O5LA 1UXXX 2IUWA 5BNPB 4QX3A 1Y4WA 4CPBA 2NMOA 1W2OA 1H4HA 3ZVXA 5BY5A 2GZWA 1QOOA 2CY6A 4ASMB 3GALA 2XL7A 5KXBA 1N1TA 2GC0A 3ZSLA 2E32A 1MZFA 1C5HA 4QM9A 5IUQA 1AL0G 5K7PA 5JDBA 1FNYA 4FPFA 5F5AA 3WP6A 3BUCA 1K42A 4KMQA 2VXJA 4MH0E 1GFF2 3MV11 1YCIA 1DBNA 4AEDB 3B00A 1O4ZA 4FFFA 4IE5A 3UNPA 2BJSA 2RS52 4EV0A 3TWIA 2DFBA 4M0HA 3POIA
chains in the Genus database with same CATH topology
1REDA 1NLRA 3WG2A 2Q5TA 3CNAA 3AZZA 2ZGRA 5KBFA 1XU2A 2DVAA 1Z7S3 1RUH1 1OQDA 5LRSA 4RA0A 3RJRA 2O8QA 4JRLA 4JC1A 1XYPA 2XJQA 4FXGB 3AJYA 1LGNA 1H9WA 3CO2A 1I5ZA 3RNSA 2FMDA 3MDPA 3B02A 1OLQA 3MLKA 5DXDA 4C1XA 4KGQA 4FPGA 4XYXA 4PDWC 5GJ6A 1HXS2 3AP4A 3AYAA 3SCGA 2VUJA 4XEZA 5HCAA 4CEYC 4LUKA 1PNFA 4R8HA 4OUMA 5KWRA 4YZ5A 1CR7A 2HWE1 1DFQA 2XBO1 1TE1B 2PHWA 5JIUA 2V73A 1RUOA 1V6KA 3KS7A 2QQPA 4FOWA 2DU1A 1WW7A 2ARXA 1U12A 5FLHA 3I8TA 5C33A 4JTOA 2CTVA 2QUOA 2ZHLA 3H3UA 3FUOA 3I54A 4Y26A 1KS5A 1QKQA 3DPRC 4YLZA 4YW5A 4R9CA 1ZNPA 4NVPA 2XLFA 4XOGA 2VNGA 2QZ2A 3ILRA 4IL7A 4I02A 4S2GA 4RR3C 1AR92 2K9ZA 5C9AC 3VLBB 4I0AA 1ENRA 1MS1A 4QMAA 4AQSA 4XQDA 1SCSA 2WNEA 1VRH3 2Y38A 4QPGB 1CAUB 1SQ4A 3WINE 3ZFFA 5FDBA 5HBAA 5A32B 1JH5A 1QJZA 4KGGA 1J58A 1PO12 1A6CA 3WVJA 4KG8A 2D43A 4N53A 2A75A 1PIV1 1ZREA 1YFYA 2P3IA 2WINB 5EWSA 2Z79A 1DQ1A 2E7TA 5I8SA 3RJ2X 2Z2SB 3MZHA 2R49A 2AUYA 4J1XA 1LRHA 2XVKA 3I4IA 2D6KA 4GH4C 4MX3A 3BOWA 1DQ4A 3LCPA 4IEPA 1HX6A 1O7FA 1R083 1AYN1 1RUF3 5BV6A 4XFBA 3SCHA 1W2UA 3MPBA 1RL3A 2HWC3 1WMEA 2XLGA 4PF5A 4B4RA 1SLCA 4W6XA 1VBA1 1JYCA 3AP7A 1GICA 2R30A 2ZMKA 1XU1A 1V6MA 3IPVA 2PHTA 1RMU1 4Q1RA 1AR61 3AMHA 4IETA 3O12A 4FPLA 3N7LA 4HK8A 4LE4A 3WNXA 1FX5A 1RUJ3 1K5MB 1UCXA 1NCRB 4MV2A 3BTAA 1PGW2 1N47A 2D5HA 4JCKA 1CPNA 3AP5A 5DDJ1 5C4WB 2ZX3A 3MIBA 2OVUA 5GLTA 4MXVA 5EXOA 4LO4B 3IIAA 4WVMA 2CV6A 3R6SA 4AGGA 3ZXKA 4CDWC 1U5XA 1N3OA 4QQ2A 1EPZA 1R1A2 1NQJA 4BA6A 3WX5A 4OHZA 4IXLA 1ULDA 2TUNA 3ES1A 2RS51 2YV8A 1LOFA 1WMFA 1XNKA 3AYDA 4OHVA 5H9QA 3VKOA 3E5UA 4A2UA 1MR5A 1G9CA 1BK1A 4YVSC 1VALA 2WJSA 1POV3 3FFQA 2O0OA 3FBMA 4MLOA 4RFT0 4COYA 1NOVA 2WLQA 4ZU5A 2ZGLA 1OMIA 5A3LA 1OPOA 4CZSA 4OULA 2DFCA 4OI2A 4SLIA 1G9FA 3VBRC 1X82A 1Z7S2 5CVRA 4HMZA 3VBFC 1POV0 4AG4A 1DGWX 1Y3TA 3EHKA 3OPZA 3WUCA 2AR6A 1NA1B 3AFGA 3KT1A 4NO4A 3ZXAC 3NV4A 4S2FA 2GNDA 2BNOA 4H7MA 4URTA 2Y0OA 4YZ4A 2O8OA 2GH2A 5HXVA 1RB8G 3M3OA 2QDNA 4HANA 3RG0A 2DWRA 1H8TA 1ENQA 3APBA 4YG0A 1VAKA 4DB5A 4YM1A 1H4GA 4P14A 2JX9A 2ZGQA 4X8PA 1YLLA 2E7AA 4Y22A 1CD3G 4N43B 3USUA 2BGCA 1NZCA 5KHHA 5JIAA 4R4ZA 4YZ1A 4YVWB 5FO8B 2JE9A 3MF9A 5JOYA 5AVAA 1RUE3 4WBBA 5EZWA 3WDXA 1XNCA 1UU5A 2GDFA 4W6YA 1AR91 4GIQA 3BB6A 1H2NA 1S0FA 4E2SA 4PIZA 2Q4SA 4D94A 1ZZCA 2NP0A 4WM8A 2OZJA 2JICA 4N53B 4KWJA 1GSLA 3U11A 3VZMA 2JENA 4XF3A 1J1TA 4D7SA 3NAPA 1S0BA 4EN0A 4CYDA 2DYCA 1OFNA 2W52A 1MZ5A 2JD4A 4L99A 3VBHC 2A71A 5I8TA 1PO11 4M3CA 1S2BA 1AJOA 5HCBA 1N1SA 2IZWA 4UW5A 3DL3A 5LK7B 1VRH2 2PHFA 4AI8A 4G3YC 4QPIB 1HDKA 1UZZA 2BWAA 1TNFA 4IV3C 2ES3A 1ALYA 4I3GA 5K0UC 1WUVA 3S6PA 2PHLA 4YM2A 4QQOA 3I59A 3WT3A 5BPXA 3ATGA 1PZ7A 1CAVA 2YGLA 2BPA2 3AKTA 3VDDA 3SMHA 3EJKA 2XG3A 3HT1A 3FMGA 2R32A 4XXAA 5A3MA 4ATEA 2A6WA 2Q1MA 3BODA 3IDCB 3LOBA 3ZPYA 4AFDA 3EO6A 1Q8QA 1VBB3 2IFRA 3W59A 5J48A 4ZXKA 4Z07A 1R082 1RJ8A 2QCSB 1IKQA 1RUF2 3AKSA 3MGUA 2HWC2 3DV8A 2C0ZA 3M3EA 4FT8A 3OBTA 1D4M2 1PGW1 1C57A 4BQ1A 1OSGA 4MUVA 2Z5WA 4E4ZA 5FREA 3B9CA 1C8M1 3O14A 4Y24A 3ZFGC 2JG9C 1FMD3 3BPZA 5I91A 4LE3A 4MZUA 5CA6A 1FNZA 1ZRFA 1RUJ2 2XBO3 3AK0A 1RVF3 1R1A1 2YMZA 3DUIA 3FWEA 5T50A 2B46X 2WNVA 2JE7A 4WM7A 4O9EA 3LSDA 4LBMA 2AH2A 4MGZE 4CEWC 3POSA 2VQAA 3AFKA 4X8NA 5BXXA 4FBFA 4LHLA 2PYTA 5TSWA 1TQ5A 4IEOA 3G7DA 1FT9A 4BYYA 2JG8B 3MICA 3O0WA 4Q0UA 1D0HA 4N90A 3JD73 3KMHA 1UKGA 4E27A 3RYRA 2WT2A 3VGIA 3H9AA 2UWCA 3ZIXA 1Z7S1 3AXEA 2FHRA 3QH7A 3VZOA 4K9SA 1RGSA 1QQP3 2D3RA 3U07A 1VBD1 4IQPA 1ND2C 4F83A 4FAHA 1WGPA 5AC93 4YGEA 4J1WA 2WZPP 3RSJA 3USUB 4DQAA 3AMQA 3NW4A 1VBE2 3VBOB 1QH6A 1AVBA 4OUSA 2D6LX 2BFUS 3AP9A 1GQHA 4FOVA 3FZ3A 1HQWA 4RS5C 4B3NA 1AXYA 1IKPA 5H9PA 1EV13 2VXRA 5GZCA 3FC0A 2EVXA 1FV3A 3J8F1 4YFWA 3A4UA 1IS6A 4LA3A 3LZZA 2R6QA 1ZRCA 1R093 3AMMA 4WM8B 1S1AA 1FYUA 1DIWA 1GNHA 3MF6A 4CDUC 4I2OA 5FTTC 4P5HA 3BOPA 3NAPB 4KL1A 3QACA 5K8SA 3N4MA 2RMU3 2A6VA 3EQEA 4MGKE 5E16A 3ZSKA 4K20A 4AI1A 1RMU3 1J3PA 3S30A 1Y43B 1AR63 1RUE2 1W0OA 5SV8A 4XW3A 3WD5A 3JUUA 4EN7B 1G8WA 1LR5A 4XFFA 5FMOS 5I0UA 1BVP1 1WLCA 3M7AA 4ISQA 3ZMNA 4PDWA 4BCUA 4CDQC 1UKRA 4H3WA 1B35C 3H1YA 4ASLA 5DZEA 5A33A 3I59B 4CEYA 2BW8A 1RUI3 1LCLA 1XXNA 1W6QB 3GHNA 1VRH1 4OHXA 1I6XA 3VDDB 1KFXL 2CAVA 5FCCA 1IOAA 3MIDA 4AFCA 4EROA 5BNNC 2B9UA 3FFZA 4QHBA 5L7OC 1PK6C 1WW5A 3DN7A 2PHUA 4XETA 1G9BA 2D3PA 4XHBA 4E9KA 3A0KA 2RS33 1APNA 1LHNA 3DPRA 5GZEA 1LU1A 1OOPA 2I07B 3ZSLA 2B42B 1MZEA 5FOBB 1F2NA 2D6PA 3MFCA 3NVCA 4FO9A 5CU1A 1UU4A 3DKWA 4UW4A 3SITA 1F31A 4RR3A 3ZXFA 3ZIWA 2XH6A 5C9AA 4HSJA 5FPZA 3RPQA 1RUF1 2JEMA 4TYSA 3VHOA 3HWJA 3UL2A 3O0VA 1Q5OA 2G4IA 5JVVA 1D4M1 1OI6A 1VBB2 4RSUA 4QM8A 3FLRA 4B4PA 3V56A 2WNVB 5IK4A 1M4WA 1GBGA 2XLAA 1RUJ1 1SDWA 1CN1A 1C4RA 3ZXLA 1IPJA 2E9QA 1DHKB 4M3CE 3ZSJA 1Y7BA 1NLSA 1FMD2 3CL1A 1CESA 3H1MA 1VAVA 3VV1A 3VL8A 4YZ3A 4IERA 2WIIB 2XL9A 4KU8A 2XBO2 1RVF2 4OLLA 5IK8A 4YGCA 2ET7A 1DDLA 1QXJA 1O4TA 3KGLA 2TNFA 4AYUA 3B3QE 3RDIA 1PGSA 1X8EA 5FQ0A 4CDXC 1SFNA 3J26N 3H1WA 5EYXA 3OYWA 2P37A 5BNOC 3CJIA 2Q0AA 1AHSA 1NCQC 2VNOA 3SHRA 1ENXA 1QDOA 4AQTA 3JD72 2EXIA 3MIHA 2HEVF 2ETEA 1YHFA 1N1VA 5LEJA 1C28A 1VBE1 3MW4A 2PFWA 1AZDA 1AX1A 1QQP2 2ZX1A 4XF0A 3WZ1A 4P9GA 5F1RA 4AXOA 3R05A 1A8MA 3CLPA 4CDWA 1YWKA 3NV1A 5F6KA 3WG4A 1S0GA 2VW2A 1UAIA 4RQPC 5AC92 1OHFA 1W6OA 1AUYA 4XJ9A 3HQXA 3FBYA 2VMHA 2CNAA 5DZFA 2A3XA 4MGYE 4FOYA 4CP2A 5T3NA 4YVSA 3WQ1A 2B45X 1JHNA 3POWA 1EV12 1QU0A 2ARBA 2MNGA 3E6DA 1BZWA 2V5YA 3IN9A 4PDWB 4AQ6A 1R092 4AVSA 4PIYA 3VBRA 2ZCWA 1VP6A 3VBFA 1UF2C 4IEWA 2QVSB 3KGZA 2EIGA 2VVFA 2RMU2 3I7DA 1AL23 4R4XA 2WA4A 2P3JA 4COZA 3HIFA 1DQ0A 5DUVA 1RMU2 3RZZA 4JDMA 2Q1ZB 4L92A 1AR62 3VBSC 1C8M3 1PMIA 1URXA 3D8CA 1W6NA 4FPEA 1UPIA 4HVQA 3DPRB 1OOPB 4COVA 5J3UA 4XJ8A 2HEWF 1RUI2 4KNCA 5FPXA 4C91A 1QF3A 1O3RA 2ZTNA 3TBDA 3KB5A 5DG2A 1KFUL 2WL1A 4WVVA 4TZDA 3MFAA 1AXZA 4DPNA 4I0BA 2A6ZA 2H6BA 3CEWA 4LEJA 2RS32 3GBFA 4ES8A 4WVZA 1V00A 1O5UA 1KDMA 5D8AB 1VBB1 4K21A 3AX4A 1U5YA 4ONUA 1LEMA 1VBD3 2PELA 4H55A 4Z8BA 3VBHA 1Z0HA 4HVOA 3ZFEB 2XHKA 1S0JA 1IGOA 2GSYA 1SEFA 2OUHA 4QGMA 1KRIA 5DZGA 3TOJA 3D4KA 5JOWA 4JTNA 3NJZA 4XBNA 2DUPA 5I0TA 4IV3A 1W6PA 5J37A 3PJYA 2VOXA 5K0UA 3VKNA 3WR0A 2WC2A 3E5XA 1FMD1 3MPPG 4R52A 3K48A 1LOAA 5JPMB 1ULFA 5FQ0B 2RHPA 5KHIA 3J8F3 2WFF3 1RVF1 1ZZBA 3OYWB 4LBKA 1LENA 3CJIB 5HCFA 2LTNA 3D0SA 4H7LA 3AKRA 2KM2A 4U2AA 4YW4A 1CJPA 2IFWA 2OPKA 3LGRA 1RJ7A 4Y1UA 2PN5A 2QE3A 3MEPA 1RIRA 4CRQA 1G6NA 3ZXJA 2D5FA 3HBZA 3JD71 2YUEA 4CDWB 1IS4A 3ENRA 4L11A 3PJQA 1VAMA 4LHKA 1HRI3 3O5SA 2X5IB 1DF0A 4NHMA 2R073 5KHJA 2FZ2A 1IPKA 1YO8A 3WW1A 2JG9A 3ZFGA 2GN7A 1QQP1 3VKLA 4OI1A 2E6VA 4UBGA 4YVSB 1H8VA 3ECQA 5AC91 4DRVA 4OZXA 3B94A 5GKAC 3I2DA 5BNPC 2ZHNA 4E4DX 2B5HA 2GU9A 1TME3 4D7YA 2XJTA 3ILFA 4CEWA 1GANA 3SISA 3V64A 3VHRA 2ZX0A 2CGOA 4R9BA 5L19A 1FXZA 2ZZQA 3MW3A 4LULA 1EV11 3H7YA 1ASJ3 2D40A 2JXAA 1JOJA 5L73A 1Q8SA 3KQRA 2R0FA 2PA7A 3N36A 3USSA 4AEDC 1AR72 3WW4A 2AYHA 1I9RA 4G4FA 1R091 2OA2A 4XFHA 2WFPA 4JGYA 5EFUA 3S0MA 2WNUB 3AZYA 4B7KA 1HRV3 3WOGA 5JI9A 2CGPA 2HWF3 1TEIA 1ND3B 1FV2A 5E1RA 2EXHA 3E97A 1JBCA 2P3KA 1W6NB 4Q4W1 3R4DB 2WZR3 4HK9A 2RMU1 3RMXA 1ND2A 1D4M3 2X53S 2VOWA 4XTPA 2RS13 2ENRA 2X29A 2YC0A 4RGGA 3BALA 3D82A 3WDWA 3AM2A 4V1PA 3WQ0A 1AL22 1BCXA 2EALA 4RS5A 4K1ZA 2BBVA 4B7EA 3FX3A 3SCFA 1W6MA 1LOBA 1C8M2 1RUI1 2UWAA 1BKZA 3CF6E 2KXLA 5GLUA 2CGNA 2PAKA 2UY8A 2WKKA 4I0WB 5CFDB 1GYKA 3N3HA 1ONAA 1PGL2 1S0EA 1YI7A 2DVDA 4YSFA 1Q8VA 4FTSA 1WW6A 2RE9A 1QWRA 3OF1A 1KD7A 2MPFA 3NL1A 4S2HA 2XKOA 2RS31 4JGZA 3D6EA 3ZN6A 2D6NA 1GZWA 4HT1T 1SLBA 1L3JA 4C0BA 1U0AA 3S7EA 3KD4A 1MS0A 1LB2A 2IXJA 4LNVA 4U36A 1GZ9A 2XGXA 1HV0A 4XJAA 4CDQA 1PZ9A 1B35A 2ERFA 2A7AA 2ZA9A 4BLJA 1VBE3 3NV2A 4NOTA 1XYNA 4UW6A 2G9GA 1DQ6A 3ILNA 3WDTA 2C9AA 5J09A 1VBD2 5JPNB 4M01A 3ZN5A 5L7OA 3BCWA 3AP6A 3IKWA 2HWB1 5CNAA 3HT2A 2ZKLA 2IXIA 4QQLA 4XMAA 1SFYA 2DF7A 2CWSA 3AJZA 1QJX1 5DUUA 1S2KA 4IV1A 2AZ5A 3J8F2 2WFF2 2ZBJA 4FQ4A 3QD6A 4KWLA 3JQXA 5GALA 3ZFGB 1DGRA 1ZM1A 2ZGSA 3RWNA 4N7UA 3IDEA 2B8MA 1S0CA 1C3HA 4M3CF 2E51A 4GB33 4UW3A 3JB8A 3SH5A 3MLLA 2LM3A 4YM0A 3ZFFB 4BH9A 4CP1A 5HI0A 2N7GA 2UU8A 4XZPA 1VBC3 1X8MA 4Q0QA 4SBVA 4AFBA 4GWMA 4CEWB 5ABJA 4BHPA 2GNTA 4XILA 4F8AA 1CPMA 1K5MC 2OIIA 4WZCA 1HRI2 1NCRC 4B4QA 1JTZX 1AJKA 1QNYA 2R072 5C4WC 5GLZA 1YUDA 4Y1XA 5J98B 1ZYBA 3VBUC 5J7MA 1VJ2A 4JGYB 4PLOA 1KXGA 4H14A 2DU0A 1DLLA 2F6BA 5ACA1 4EWAA 3UV9A 1D4VB 4L8QA 4I01A 4HKOA 1BMV2 2ZGOA 4ES9A 2TEPA 5I0RA 1TME2 1QJY3 1AR71 1ND2B 2WA3A 3M2MA 3IPVB 4XIOA 2XPJA 4X6RB 3ZYJB 2VMGA 5BNOA 1AYM3 4FXKB 1NCQA 3VKMA 4EWDA 1ASJ2 2SLIA 3FJSA 1PO22 3WP3A 5FOJB 1A8DA 1YIPA 3VZLA 1SACA 1V70A 3IM0A 4QU2A 4AEKA 5T55A 4AVTA 4Q4V3 1HRV2 3SH3A 2HWF2 3WW2A 3FE5A 1SLIA 1CVNA 4Y1VA 4FVVA 4WVMB 1J1LA 2WZR2 2FQPA 2ZGPA 2C5DA 1AL21 3WUDA 5LEKA 3TRSB 3OJBA 4RQPA 4HN1A 1BYHA 1NA1C 2RS12 4JDNA 4N9HA 2HJIA 4YM3A 2JECA 3CU7A 3D5OA 1VB4A 1YFUA 1H1AA 5F5QA 3MYXA 3WLUA 4JGZB 1RITA 1HV1A 5T5OA 3ZN6B 1PGL1 1MZ6A 1GZWB 5EYYA 4K7JA 1ULGA 3KT7A 2PHXA 4Z1VA 3NKTA 2BEOA 3T2TA 4N43C 5L36A 4M0NA 1LHWA 2R063 1LECA 3WXPA 3KT4A 4YVWC 3ZXDA 4CDQB 3WDVA 3KZ4C 3GYDA 1UIKA 1QDCA 5GM0A 2YROA 2ZABA 5CAZA 4F3JA 1MQTA 1U5IA 4HL0A 1GLHA 4L9BA 2YYOA 2WT0A 1XRUA 3E6CC 4AF9A 1REEA 4AHWA 3OD0A 5T5JA 1CIWA 1U5ZA 5AFEA 2QNKA 5L7OB 3V0AA 3VBSA 1PHMA 5FFOC 3J9SA 1YFWA 1SBDA 3WY6A 1WD4A 1I1EA 1H8TB 1CX4A 4XF9A 1VB2A 1ZZ6A 3AB0A 4AEMA 4Y22B 1DZTA 2ATFA 4I09A 4IV1B 3ZN4A 4CP0A 3H8UA 4IEZA 4QGNA 2XJPA 3C2UA 1LULA 2DVFA 2A73B 4HN0A 1KS4A 3RYPA 4QPIC 2VVDA 1COV3 3ZXGA 5KC6A 1KDKA 3UJOA 2WFF1 3LAGA 4JQRA 3B9IA 3HR9A 4COUA 1QMJA 1H2MA 3KM5A 4ATFA 1LHOA 1ZX5A 2LALA 4LBQD 4I3PA 1DGLA 4EN6B 5ABJB 4HPKA 4Q4W3 4LHNA 2GNMA 4KG0A 3L9JT 4M3CB 3WP4A 4Q0PA 4RHV3 2IC1A 2BNMA 4ZKTB 3PTYA 1LGCA 4GB32 1CONA 2ZX4A 1AX0A 5C6CA 1DQ2A 1HRI1 2UURA 1DZQA 5CIRA 2R071 3QH6A 3V65A 1S0IA 1CAXA 1VBC2 3M3QA 2GC3A 3GZUC 1CAVB 5C8WA 2W39A 3R4SA 2D6OX 1JXNA 3THPA 5BNOB 4Q4X3 3WG1A 4Q1PA 5GLWA 1NCQB 1UL9A 4YGBA 1BMV1 1N1YA 2NQYA 1TME1 2XWJB 4FCAA 4G9SB 3EXUA 1CGPA 2O1QA 2DUOA 1UX6A 4PLNA 2GH8A 2UYAA 3B93A 3LA2A 1UN1A 4FPOB 3RI9A 4AI0A 2RJKA 1G7YA 4C0HA 4HETA 1ASJ1 3RRDA 1MS3A <