3NKTA

Crystal structure of salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans adducts with naphthoate
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
364
structure length
364
Chain Sequence
b'EKLDHESVTQAMQPKDTPELRALYKSFEEESIIPLWTQLGDLMPIHPKSKAVPHVWKWSTLLRLARKSGELVPVGRGGERRALGLANPGLGGNAYISPTMWAGIQYLGPRETAPEHRHSQNAFRFVVEGEGVWTVVNGDPVRMSRGDLLLTPGWCFHGHMNDTDQPMAWIDGLDIPFSQQMDVGFFEFGSDRVTDYATPNFSRGERLWCHPGLRPLSGLQNTVASPIGAYRWEFTDRALTEQLLLEDEGQPATVAPGHAAIRYVNPTTGGDVMPTLRCEFHRLRAGTETATRNEVGSTVFQVFEGAGAVVMNGETTKLEKGDMFVVPSWVPWSLQAETQFDLFRFSDAPIMEALSFMRTKIEGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gentisate 1,2-Dioxygenase
molecule tags Oxidoreductase
source organism Pseudaminobacter salicylatoxidans
publication title Crystal structures of salicylate 1,2-dioxygenase-substrates adducts: A step towards the comprehension of the structural basis for substrate selection in class III ring cleaving dioxygenases.
pubmed doi rcsb
total genus 101
structure length 364
sequence length 364
ec nomenclature ec 1.13.11.4: Gentisate 1,2-dioxygenase.
pdb deposition date 2010-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3nktA01
4B29A 3FZ3A 3H1WA 3OGJA 1EY2A 1YLLA 3RZZA 4EWEA 4LTAA 5JCTA 4H7LA 3SCHA 5I0UA 5I91A 4IEOA 3QACA 2QCSB 3NW4A 3BU7A 4FAGA 1YFXA 5FLHA 4F7ZA 5K8SA 2CGPA 4EWAA 4XF3A 4XF4A 5F1RA 1ZZ8A 4IEYA 4K8FA 4I02A 2PHLA 4JVAA 1NXMA 5KHKA 4L2NA 2I45A 4ZU5A 2VQAA 4LA2A 2F4PA 3R6SA 2IXCA 1DGWA 3CJXA 4MH0E 1Y9QA 5BXXA 3H7JA 1GQGA 4PJYA 2GC1A 1VJ2A 1Q43A 1HW5A 4HMZA 2QDRA 3RYPA 2H6BA 2UYAA 1UIKA 3ACLA 1SFNA 4BHPA 4EROA 5JSPA 5T3NA 5CU1A 2CV6A 3KMHA 4XF1A 5CADA 2H6CA 3CO2A 1XE8A 4L11A 4Q0UA 2FQPA 2PHDA 3DV8A 1VP6A 2XLAA 4ORFA 2B8MA 5LRRA 5EZWA 1UIJA 2CAUA 2HKXA 4Q29A 2GZWA 1VR3A 2Q4SA 4R8HA 4P9GA 5KHIA 3FWEA 1O3TA 5E1RA 4FBFA 3H9AA 1CAUA 1LB2A 3WW3A 2OA2A 4Z82A 3MDPA 3ES4A 4RD7A 2D40A 4BH9A 1RGSA 4YSFA 1ZZ9A 4MZUA 2KXLA 5KHGA 4JTNA 3HT2A 4TLFA 3I59B 4YYOA 3IWZA 3SHRA 1LKNA 3D0SA 1YFWA 4AQ2A 1SEFA 3U0ZA 2Y0OA 3MYXA 1DZRA 3PNAA 3HIFA 3LOIA 1CAVB 4HN0A 3LA3A 4BIFA 5LRSA 5I8TA 2GC0A 2IXJA 2PTMA 5I0SA 4O9EA 3N4MA 2XKOA 4YARA 3SCGA 4PIYA 1O4TA 2BGCA 1NE6A 3H3UA 1H1MA 4F8AA 3UKTA 3OD0A 2PAEA 3TNPB 1OMIA 2XLFA 3TNQA 3BB6A 2EAAA 2PQQA 1O3SA 1ZRCA 4QGNA 4XF0A 3PLQA 1LR5A 4MUVA 4PIZA 4LUKA 1X82A 3O14A 4IEQA 2UY9A 2EA7A 4D7TA 2PAMA 3IIAA 4KWKA 1RTVA 4OFGA 5FQ0B 4AXOA 1NZCA 5J7MA 2H0VA 5CVRA 2MNGA 1Y3TA 4IETA 3LAGA 1CAXB 2EVXA 3E5UA 2B5HA 3I54A 2IXHA 2P17A 1YUDA 5AVPA 2BNNA 1J59A 5JR7B 3ETQA 3FHIB 1CAWA 5JSOA 3S0MA 1I6XA 2VPVA 4IEWA 3D82A 4E2SA 3M70A 4IEUA 3RYRA 3C3VA 1X8EA 5EFUA 4D7SA 3OF1A 1GQHA 3IBMA 1ZZCA 1NE4A 1CAUB 3FX3A 3U10A 5KBFA 2XL9A 4J1WA 4J1XA 3EHKA 2BNOA 4ONUA 3EJKA 3H1YA 2UY8A 5J3UA 1Q3EA 4UBGA 1ZRRA 5FDBA 1EPZA 3NVCA 2GU9A 1YWKA 5LEKA 1H1IA 2WFPA 3KGLA 1ZZ7A 4LUMA 2IXIA 2OPKA 1DGRA 3HQXA 1FT9A 3BCWA 1UW8A 4UBHA 4QM9A 3U11A 2ET7A 3WW4A 2XL7A 1UPIA 3KCCA 2PFWA 2PAKA 2WC2A 4E2GA 4IEVA 1QWRA 3RPQA 2CAVA 3E5XA 3OTFA 4I09A 1IPJA 2K9ZA 4IEZA 3NJZA 4MGKE 4XFHA 5E16A 3I7DA 4XFAA 1J3PA 1EP0A 1X7NA 3FFQA 1RUOA 4O9GA 4QX5A 1XRUA 4LA3A 2ATFA 5HI0A 2N7GA 3QOPA 3KSCA 1EYBA 5FLIA 1CX4A 4Q0QA 2IC1A 1YFYA 5C6CA 1CGPA 2QVSB 2DCTA 4N9HA 4I0BA 4CYDA 4X6QB 1RL3A 4HN1A 5FQ0A 1U12A 2V09A 4YRDA 4QGMA 1Q5OA 1RC6A 2BNMA 2MPFA 2E9QA 2XLGA 2XKPA 2ZKLA 4LLOA 2IXLA 1ZZBA 2MHFA 1G6NA 2OZ6A 5D1IA 2B9UA 1ZX5A 2ZCWA 4X6RB 2Q0AA 4JV4A 2IXKA 1SQ4A 5FPXA 3PVBB 3RNSA 4XFIA 1JUHA 4Q0SA 3ROUA 4XETA 1PMIA 3H7YA 1V70A 4QM8A 2C0ZA 1ZZ6A 2D5HA 3ZDSA 3FJSA 4IESA 3HT1A 3IDCB 4WZCA 4Z07A 4KWJA 4BYYA 3EBRA 1YHFA 1OFNA 3UKVA 4KU8A 4HZFA 5LEJA 4I01A 4ZU7A 5KHJA 5I0TA 4QGLA 2PYTA 4XFBA 4IEXA 3S7EA 3H50A 2OZJA 4KWLA 3M3IA 2Q1ZB 4HVQA 3G7DA 2QNKA 1LRHA 1QXRA 5BPXA 1UCXA 3NSTA 4YNIA 5JAXA 3GBFA 4GULA 4META 3WW2A 3H3ZA 1DZTA 3SCFA 5I0RA 3I59A 4LULA 4QMAA 3S7IA 2OYZA 5KHHA 1ZRFA 3JZVA 2PA7A 3DN7A 3E6CC 1WA4A 3IDBB 3BALA 5J48A 4AVCA 1CAVA 2XGXA 2D93A 4JTOA 4FAHA 1PM7A 2ET1A 4NVPA 1O3QA 3L2HA 1TQ5A 3BPZA 1WGPA 3ELNA 1YFUA 1O7FA 4A2UA 3FE5A 2GC2A 4HSJA 2O8QA 3MZHA 2GH2A 2BYVE 5JSRA 2ETEA 1ZREA 4I2OA 4HBNA 4AVBA 1O3RA 2HJIA 1I5ZA 1QXJA 2QJVA 2VECA 3LA2A 4E2QA 3NL1A 3SMHA 1FI2A 1O5LA 4MGIE 4XFFA 2D5FA 4I0AA 4XFGA 4HVRA 3CEWA 3EQEA 4MGZE 4N9IA 2GAUA 2Z69A 2BEOA 3UKNA 5C8WA 5FLJA 5I8YA 3LZZA 4R52A 5I93A 3LA7A 3H8UA 4KL1A 4LEJA 3E6DA 1CAWB 4IEPA 4QXKA 5FCCA 3RDIA 3MPBA 4DINB 1FXZA 4PIXA 3ST7A 4ZU4A 4EV0A 5BV6A 3E97A 3EO6A 4HVOA 3SXWA 3D0JA 1J58A 1QY4A 2FMYA 2GC3A 4OLLA 1ZVFA 5BY5A 1CAXA 2Q30A 3RYKA 4XFCA 4HSLA 4MV2A 1J1LA 4WBBA 5FPZA 4IERA 4Q0VA 1J3QA 1UD1A 3CF6E 3WW1A 2UYBA 3ES1A 1RUNA 4UXAA 4I3PA 3CLPA 5BUVA 4FT8A 1X8MA 3DKWA 1XE7A 2XHKA 1OD5A 3E5QA 4XEZA 1L3JA 1IPKA 2K0GA 3CL1A 3H1MA 3VHRA 4MGYE 1ZRDA 3E6BA 1WLTA 1ZNPA 4KU7A 3USSA 4AQ6A 2Z2SB 3KGZA 1O5UA 4EWDA 3GYDA 3DL3A 1NYWA 4MX3A 4XF9A 3OCPA 1J3RA 4HLTA 4Q0PA 4AVAA 4WVZA 5I8SA 3LWCA 1OI6A 3B02A 3NKTA 2O1QA
chains in the Genus database with same CATH superfamily
3FZ3A 2KD7A 3OGJA 4YVWB 1QEXA 3ZMNA 1W0NA 2RDNA 4XCAA 5FWEA 1DGRN 1LOBA 2WNOA 3I2FA 4HKLA 4K1YA 1REFA 4TN7A 1KEXA 4WM8B 1N1VA 5FK8A 5FZ0A 3TEXA 3I49A 2PLV2 4WVWA 4I30A 3QACA 2QCSB 3NW4A 4YZ2A 3M3EA 5C3SA 5A7QA 1RMU2 2VZOA 2ZTNA 3WHUA 1BK1A 1OD3A 2GP5A 5K8SA 3PUAA 3VDCA 3WX5A 3ILFA 4NO4A 5T50A 4XF4A 4YGEA 5FKBA 3WF3A 1NY71 1UOBA 3AKRA 1ACCA 4HOOA 1W8OA 1RIRA 4I02A 3BGAA 2PHLA 2JXAA 2XOMA 4JVAA 3RSJA 4XE9A 1JU4A 4BJ0A 4YZ1A 1ODNA 4IV3C 5FYBA 2RHPA 4CXXA 4WM7A 2XBO2 4LHLA 1KITA 3M3OA 3VD4A 2BTVC 2WZEA 5F3IA 4YW3A 3THDA 1AR73 1XNTA 1OURA 5FP4A 4XILA 2K46A 3N36A 1W0PA 2IXCA 3S57A 3CJXA 1VBB1 2CNAA 1AZDA 2ZAHA 3JQWA 3ZOIA 5K0UC 1HB1A 4PJYA 4ARYA 4AGRA 2BFUL 1BVP1 3N7MA 4YM1A 5IVYA 2R071 4HMZA 5IVVA 4BXSV 1RUH2 1RUD1 3D6EA 4ISQA 4DFSA 1W04A 3LPFA 3HBZA 3ZFGC 1S1AA 2HH9A 2UYAA 4D0QA 2EIGA 1UIKA 1SFNA 1NLRA 4WM7C 2PHTA 3WNNA 4ET7A 4FXGB 3A4UA 3WNMA 1H8VA 2DDUA 5E89A 3CO2A 3OBAA 1LNSA 2QFEA 2V4VA 3OJBA 3ACHA 2BP6A 4Q0UA 3J26N 4IUGA 5JOXA 5K7PA 1LGNA 1JYXA 2FQPA 5LASA 2PHDA 2WR9A 4HT1T 1VP6A 2XLAA 2ZGTA 1REEA 1UIJA 2CAUA 3AFGA 3M1HA 3GCXA 4LO7A 3ZSJA 5ACA2 3V0BB 1H8TC 4S2GA 3MIGA 3UL2A 3OEAA 1HX6A 1AYM3 5FPLA 1GICA 1W6MA 2BERA 1LHWA 4FPJA 1FOD1 2FMDA 1OUXA 3GBGA 4LJHA 5C3RA 2VULA 3H9AA 2OW4A 3TRSB 2JE9A 1PZ7A 1WCUA 1VB4A 5KC5A 3WF4A 2OQ7A 2D6LX 1J1TA 1Z7S1 2D6MA 2VZSA 4FOVA 5AVAA 4ISRA 2RS53 4OZXA 4BQ1A 3VKLA 4YG3A 4UW6A 2R042 1ND2A 4JTNA 4Y20B 4URTA 3HT2A 3WSOA 4TLFA 3I59B 3WZ1A 3IWZA 4H2AA 3D0SA 1VIWB 2Y6FA 4GJZA 4S2DA 1YFWA 5FXZA 1IPSA 4FI9A 1SEFA 4RSUA 2Y0OA 2G9GA 4AFMA 3KV9A 2ZBJA 1OA2A 3KHBA 1RUJ2 1V6MA 3DXTA 3HIFA 4CUBA 1KD7A 1CAVB 1OOPB 4LNVA 1KQRA 5FYZA 1ONAA 5I8TA 2WUHA 2XVKA 2IXJA 3N9PA 4FFIA 4L8QA 2ZGPA 1AJOA 1BLZA 2W1SA 5FKCA 2R7EB 1TZOA 4XAEA 5F7UA 4YARA 3VHPA 4A7ZA 3I2OA 5IAXA 2ORXA 2CTVA 4RGKA 2SBAA 2ZMLA 3P1IA 3H3UA 3FL7A 5JUVA 3UKTA 1OH3A 2PN5A 4BZ4A 1H4HA 3V0AB 2PAEA 3TNPB 4B7EA 1OMIA 2FZ1A 2XLFA 5F5CA 4K9SA 4CCKA 4ZZ5A 3EXUA 1QQP2 3MF9A 4XYXA 4NE9A 1TNFA 2QQUA 4GWMA 2Q8OA 2EXKA 1ZRCA 4MO3M 2WJSA 1DBNA 2PHWA 3O12A 3PLQA 4MUVA 4SBVA 4YW4A 4PIZA 1AX0A 4DQAA 5F3CA 1JI6A 1F9KA 2P1BA 1BHGA 4X8PA 5L7OB 2WYSA 3IM0A 2A70A 2J1RA 4LKDA 4D7TA 3WQ1A 3ZKYA 4KWKA 1AR72 1AHSA 2DCZA 2GNDA 3C2UA 3IPVB 4UW3A 1OXCA 5FQ0B 3CNAA 4QXHA 5J7MA 2H0VA 2B45X 1VBD3 2VMFA 3AFKA 1RXFA 2VQUA 1U5IA 2MNGA 1SLTA 4IETA 4QAWA 5CVRA 5E8AA 5HV4A 4HL0A 1L7RA 1CAXB 2EVXA 3N9NA 4LMFA 1RUF2 4O7XA 4TXWA 4LOSA 5GM0A 3UGFA 2MEV2 2IXHA 2B46X 2VUCA 4YZ3A 5AVPA 3HMYA 1QDCA 2QZ2A 2ARXA 4OI4A 4QXBA 4IGOA 3POIA 4FPOB 5JSOA 1I6XA 1JOPA 2VPVA 2DU0A 1ENQA 4NRQA 2E6VA 3M70A 1C28A 4JHTA 3T4HB 5DMYA 2YGMA 4OQ9A 1MS0A 1ASJ2 3J8F1 4R4ZA 4E4SA 4Y5SA 4CP9B 5LWBA 2YBKA 4KGGA 5HXVA 1SLAA 4UFMA 1D2QA 2WQZC 1ZZCA 2HWC2 1A78A 1OQ1A 1ND2C 1HQWA 3TBDA 4FCAA 3O1VA 3LSEA 4AI3A 2CWSA 2QQWA 4Y4RA 1ZM1A 2R072 1MZEA 1OA3A 3H1YA 3MLLA 2ZACA 4H14A 2UY8A 3P3PA 3WQ7A 5FPBA 4IGQA 5JPNB 3OY8B 3THTA 1XB9A 1JTZX 2GU9A 4V2WA 1B35B 2QQLA 2HWB2 4JKMA 1IGOA 1H4GA 1OBNA 4D8MA 2WFF3 3KGLA 1MS9A 5CFCA 3HAGA 4IW3A 1DGRA 5EJZB 4BU2A 1VB2A 5GZDA 5HCFA 4Q5OA 4QM9A 1MVQA 1XXNA 3WCRA 5FMOL 1ZBA1 1IS6A 2ET7A 3LEIA 4D94A 3O1MA 1FMD3 1PO23 4H7MA 2C9AA 5FMOS 4CDXA 2IFRA 1UPIA 1ENRA 2XHNA 1EAH2 2PAKA 3AM2A 4TLGA 3WHTA 1F8VA 2JDAA 2G9ZA 1QWRA 2Q8DA 3E5XA 1GZWA 4MGKE 1N1YA 2QDNA 5SV5A 5FOBB 5CKMA 1W90A 3KLSA 4XFAA 3IT8A 1FV2A 1O4ZA 1OPOA 2GNTA 4XABA 3ZYBA 5KXDA 2A1XA 2WABA 4QX5A 2WZR2 4PLMA 4QX0A 4GH4B 5JVVA 4WZFA 4CEYB 1PGL1 5FR3A 4YVSC 1H8TA 1N3OA 4Y33A 5GZCA 4QT6A 1UYXA 2FBEA 4Q0QA 2IC1A 5HCBA 2VGDA 1YO8A 5C6CA 4QB1A 1KFXL 4WV8A 1LEDA 5F39A 4I0BA 5DUXA 2ZMNA 3LGRA 3USUA 3POBA 2KR2A 4NWVA 1RL3A 5FQ0A 1LCLA 3VBRC 2V09A 4YRDA 3AP9A 2YZ4A 3O1SA 1CJPA 3O7OA 1RHI2 1S2BA 1A8MA 1XOYA 2AGSA 1NLSA 4OUSA 2IXLA 4QDSA 1AXZA 4M01A 3DYMA 2JDMA 3WEZA 1AR82 1ODMA 1G8WA 1RUG3 1H30A 1LGBA 1G6NA 2ZEWA 4Q4X3 5FZBA 2RM21 3R4SA 1LEMA 4EYUA 2B9UA 4QHZA 1DYPA 2OIIA 1AR71 2P3JA 2VW1A 2VQTA 3AXEA 4G9SB 4W4ZA 3ZFEB 4COUA 5FYYA 2EIBA 2D98A 4Q8KA 3TEZA 1PMHX 4JZRA 1YJLA 4JDMA 3AP7A 4QM8A 4Z8BA 1ZZ6A 2DCYA 1R1ZA 2VOWA 2WAAA 3PUSA 3ZDSA 2CY6A 3FJSA 4CU7A 2DFCA 1AUYA 2BVVA 3KT4A 4WZCA 3ZXGA 3GZUC 3I3MA 3VBRA 2YC0A 4FFHA 2WLPA 2YFZA 3ME2A 3EBRA 3ZN6B 4DEQA 1GU3A 3UKVA 5LEJA 3JBG2 1PGW2 5KHJA 3ZSMA 5I0TA 4TTGA 3OG2A 2W1WA 2VCCA 4Y1XA 2Y8KA 3ACGA 2ZS6B 3KV6A 3WG4A 4MXVA 5IAVA 1SFPA 2XJSA 2R061 3IB3A 3M3IA 2Q1ZB 4KWLA 1QF3A 1V6LA 4PI0A 4XDPA 4CP1A 2QNKA 5A6XA 1GP6A 1LRHA 5HBAA 1B09A 1MVEA 3LB9A 4K7JA 1CR7A 3VBHC 4YNIA 4A41A 3WF0A 5JAXA 3GBFA 2NZ9A 3B69A 2KM2A 3ZXLA 4IV1A 3UGHA 2Y26A 3VLBB 2HWB3 3H3ZA 3NV3A 2XJRA 4GJYA 4QMAA 2V5DA 2OYZA 2FCVA 2WQ4A 5KHHA 1HQNA 3JZVA 1ZRFA 1I1EA 2RS52 3KF3A 2RS31 3WCSA 4CDUB 5LB6A 5FZ7A 2KA3A 4LBQD 3E6CC 1YIFA 3IDBB 2X05A 3BALA 3WF1A 4AVCA 5IFPA 4FP3A 5DUUA 3ZFFC 2D93A 3C7HA 3HPNA 5FY1A 3HBKA 3A21A 5FYHA 3ZYPA 1QQP1 1TQ5A 3GXUA 4TWTA 1WGPA 2W3JA 4NIHA 1UYPA 5FTTC 4B1LA 2GSYA 4OHZA 4DRVA 1O7FA 3IN9A 4A2UA 3H8OA 2GC2A 3AB0A 4XMIA 3MO4A 3AVRA 2O8QA 3K3NA 5K0UB 4XBQA 3ZMOA 5C4WC 3K4AA 2W95A 1DQ5A 1GUIA 1NA1C 1RUE1 4Q26A 5JI9A 5FZ9A 1LULA 1QJU3 4IV1B 1DYKA 1UWWA 3PJQA 4P02B 3ZFFA 3ZFGB 3BTAA 2QJVA 2QQOA 5AFBA 3L2YA 2ZAAA 3NMBA 2VECA 1GZCA 2PQSA 2GMPA 1FI2A 3B5LB 2NMOA 4RA0A 2WQ8A 3KB5A 4XFGA 2C24A 4BE3A 5FMDA 1H9WA 1DQ4A 4CRQA 1IS3A 4N9IA 5FXVA 1ENSA 2Z69A 3VZKA 3K3OA 1JZ3A 3IMMA 1F35A 3T30A 4NHXA 4KL1A 1OA4A 4Q2FA 4AOCA 4CDQA 1D4M3 2Y6HA 4IEPA 4LT5A 3RDIA 5FCCA 3MPBA 2QUOA 2YC4A 5FP3A 4CP2A 5DDJ3 1QOTA 4M3CA 1LTEA 4DO0A 1XQNA 4ZU4A 1GANA 3IPVA 4A4AA 3UETA 2NP0A 1WUVA 5A3WA 5BNOC 3E97A 3EO6A 3OOXA 3J7NA 1GZ9A 1ZVFA 4OLLA 2EF6A 4RS5A 4WVMA 3AJYA 3CBNA 3W20A 5BY5A 2VCMA 1J1LA 2V4AA 4WBBA 1W3XA 2HLEA 4Q4W1 3LFMA 1L7QA 4QX8A 4Z2AA 1UD1A 2C1FA 2AH2A 2XONA 2WSUA 1RVF1 3S30A 3CLPA 3VBUA 5B4NA 3JXSA 5K0UA 4JGZB 3M3CA 4AVVA 2WA4A 4QQHA 2VUJA 1GOFA 2Z79A 4DPNA 1BEV3 4NIIA 1POV1 1VMHA 2VZQA 4Y3OA 3WNXA 3H1MA 4CDUA 4XUOA 1NQJA 2RM22 3NAPB 4M0NA 4RL7A 3VHRA 2QTWB 3J7HA 1ZRDA 1SZBA 2HWF3 3E6BA 2WFF2 1RB8G 4AVTA 4AAPA 3MLKA 1O5UA 2WSVA 4KQ7A 5FZFA 5GLVA 2FHRA 4BMBA 3ZO0B 5GLZA 3GYDA 2FDJA 4EWDA 1M06G 1SLBA 4FPYA 1BQPA 3NJVA 5DAVA 4GMP3 2GN3A 4QPGB 1QDOA 4UFHA 1LU2A 1S0FA 4JQRA 4KH9A 2EXJA 1HDKA 1PZ8A 5I8SA 1UOGA 2A71A 1DG6A 3WD5A 3S6PA 4CVUA 4BK4A 4H3WA 5ABJA 3LWCA 5CFDC 3B02A 4EZ4A 4NPRA 1BZWA 2WNVC 4AEDA 5FPUA 2Y6KA 4GWNA 4LBLA 4B29A 1AXYA 4CCJA 5C5TA 5K4LA 4PDWC 1EY2A 2BBVA 1DGWX 3U78A 1XPWA 2WYFA 3EYPA 1V00A 4LTAA 5JMOA 2C5DA 3GHMA 4MHRA 4IEOA 2WWUA 4LO5B 1AL21 3AZZA 3BU7A 3UJQA 1TMF1 1YFXA 1WCDJ 4JGZC 3VBFB 5FZHA 4A3ZA 4EWAA 2CGPA 2HWF1 1FATA 2J1VA 1G9CA 2LW8A 2PMWB 2WNEA 4OCTA 1AF9A 4HXCA 4ES9A 5JZGA 4P9LA 4E4DX 5FZMA 1OLRA 2E31A 1QKQA 4FPLA 3WDWA 4GMP1 4FOWA 5G04L 4DUWA 1Q8OA 3H42B 4PF5A 3AKSA 1VBA1 2ZEZA 4Y20A 2E32A 3H3LA 4Q4Y2 3S5QA 4BQ4A 5KHKA 4NHKA 1HB3A 3AZWA 2QQMA 4LBJA 2PLV3 2I45A 3POWA 4AWDA 1WLDA 4XQDA 5L9RA 3WF2A 1DCSA 2BU9A 4MH0E 2JIGA 2GNMA 1N3QA 5BXXA 3J8F3 4JKKA 2VVDA 4DXRA 3ZR6A 2ZKNA 1DLLA 4AL9A 1VJ2A 3NKGA 5F32A 4R9DA 4A45A 3A7QA 1HQLA 2VNOA 2BGPA 2XJTA 3PVEA 5IK5A 3C8XA 2HYXA 3GJBA 1W6PA 2WNVB 4HK9A 4C91A 2QDRA 1IG3A 2R32A 5FPAA 2DTYA 4D6QA 1C3HA 3ACLA 1OOPC 3GM8A 2BZDA 5T3NA 5A3MA 3KMHA 4GA9A 5CG9A 4D7YA 2YPJA 4UFIA 4EN6B 4L11A 4J6GA 3GZAA 1W6QA 3BUCA 1HLCA 5A80A 5FP9A 5DG1A 1GP4A 3DV8A 2PHXA 3Q8FA 2ZEYA 1W6NB 3D3AA 2A73B 2W39A 5F8PA 5LBEA 5LRRA 5EZWA 4CZSA 3BODA 5EIYB 2HKXA 3BTXA 3QH6A 4Q29A 2R041 4KBZA 4U2AA 2GZWA 5C71A 2XJVA 1D0GA 4UW5A 3V56A 1UN1A 2WO3A 4DIQA 3RFRA 5CFCC 4R8HA 5GALA 2VCBA 5KHIA 4JX0A 4BISA 1WW4A 3RRDA 3W5MA 1PVXA 4FBFA 1PGSA 1CAUA 3MDPA 2Y6JA 3ES4A 4RD7A 1CPMA 1CQ9A 2D40A 4A6SA 1IQDC 4GKXA 4BH9A 3K75B 4YSFA 2VW2A 5A7WA 4KMQA 1F2NA 3X29B 1JYWA 5KHGA 1OH4A 1KJLA 1YNAA 2VQ0A 4A7YA 4NN0A 2P3IA 4Q4Y1 4ZHNA 3UESA 2DCKA 1KS5A 1MS8A 4YYOA 2ZGRA 3LEKA 5IVCA 5CNAA 3IIIA 1RVF3 3ZSEA 3VBRB 4QKDA 1MZFA 2DCJA 5LA1A 1MACA 4XOGA 3U0ZA 4OHYA 3B93A 3HN3A 1DZRA 3ZYRA 4Z1VA 5C8CC 4XJ9A 1W8HA 1MZ6A 1S0DA 4R9AA 3CZUA 1NCQC 4LKEA 1VBC1 1YEWA 2JECA 1W8WA 2HWD2 2GC0A 2VOKA 4AK3A 3T0AA 2OS2A 5I0SA 2W52A 4RQPC 1XU1A 2YDEA 5GLUA 2R49A 2RS12 2FDHA 4YW5A 2VBPA 5LW9A 4ITCA 1W9FA 1UY4A 4DUXA 1VBC2 1RMU3 1IZ3A 1OUSA 4CU8A 2HWE1 4AFCA 1BMV1 3AVSA 3J4UH 3D4KA 5FV3A 3RZKA 1HB4A 1G9AA 4YFWA 5DZGA 4C0HA 2BUKA 4GB33 3O0XA 2EAAA 2PQQA 1PK6A 5JLVA 2UWBA 1DGLA 4ZXKA 3U07A 3ZFGA 4XF0A 4CDXB 3VBSB 1OHFA 1FPN2 1OVPA 1AYM1 1W2AX 1QIQA 1UU4A 2QKDA 4LUKA 5C33A 1N1TA 1NLQA 2RMU2 4YPJA 3T1MA 5A6YA 3SKJE 2W0XA 2K2SA 3POJA 1VBE1 1GFF2 3POSA 5FUPA 4OFGA 4ES8A 4FTBA 5FZ4A 4IE6A 2W68A 1DU3D 2RR11 2YHJA 2RJ2A 4UAPA 4RS5B 1TME2 4YM0A 1DQ0A 3QH7A 3E5UA 3EMRA 2LUWA 5ACA3 1HXS2 2PXJA 3KT7A 1CIYA 5IK8A 2P17A 2BNNA 4M0HA 1C4RA 2OPWA 2ZGOA 4QHOA 5FZGA 1J59A 3ETQA 3WP5A 3VZNA 2F17A 4CDUC 3T08A 1EV13 1K5MB 1NKGA 2BGOA 3AMMA 5D21A 1K3IA 5LATA 5A3NA 1R082 4IEUA 3RYRA 3C3VA 1X8EA 3ZFFB 4K1ZA 1Y9MA 4LHSA 3ZYJB 3OF1A 2DUQA 3LSDA 4F83A 5C9AB 1W6MB 3MBWA 4AEMA 1W8FA 2I07B 1MEC2 2FCTA 4IV3A 5JXHA 3FX3A 3NRUA 5FZIA 3KF5A 5KBFA 4RYDA 3VDAA 2YXSA 1PGL2 5FJHA 4JCKA 2BNOA 1HXS1 1ULGA 2A6YA 4UFJA 1UZZA 4ONUA 4K40A 4XC9A 5FBZA 2XXZA 2WL1A 1SLIA 4KGQA 4RFT0 2OQ6A 5FBJA 1EPZA 1R1A2 4WM8C 5GZGA 3DPRC 4IE5A 3WP4A 5LEKA 1QH7A 3T1LA 1H1IA 1APNA 1LGCA 1ZZ7A 4LUMA 4BQ5A 2X29A 4CUCA 1COV1 2IXIA 4QU1A 3K2OA 4QB6A 2JE7A 3ILNA 4BQWA 4M3CB 5APAA 1UW8A 5B4XA 5C70A 3O1OA 4Q4V3 3U11A 2OUJA 1Y4WA 2VC9A 4LHNA 2Z5WA 3WW4A 1W8UA 2R043 4YVWA 4B1MA 4JDNA 3POYA 1MEC1 2AREA 2WIIB 1D2SA 2ZABA 3KCCA 4IL7A 5ERLA 1XBFA 3TN93 5CEHA 3AMNA 1WCKA 3LF7A 3AXDA 1SCRA 3FBMA 1IPJA 3OTFA 4WVMB 5FZ8A 2E7QA 3H0OA 4OUMA 4Q4X1 5AC91 2CDPA 3MI8A 3AZXA 5IJRA 5D2AA 4AF9A 1K5MC 1NCRA 1VRH2 3I4IA 3KD4A 4M00A 4XW3A 3RZHA 3OPWA 4YG6A 1MS3A 5DAWA 1ZBE3 5F5AA 1XRUA 2YGLA 4LA3A 3QLQA 3VL8A 1CN1A 4IXLA 5FXWA 2ATFA 3HOBA 3KWVA 5DAQA 5J09A 2ARAA 4QX2A 1JYTA 3TAYA 1TME1 1JZ6A 3KSCA 3VHOA 5C9AC 1YRZA 2NPIA 1B35A 5J98B 2D7FA 2YG0A 2IVJA 3GJAA 4R9CA 1IKPA 5A7SA 2FZ2A 2ZGUA 3VZMA 1VBD2 2BOIA 1Y7BA 1SBEA 1JZ2A 3WT3A 2QVSB 1YQCA 1I3HA 2ZX1A 3ON7A 4GB32 4JC1A 4X6QB 2W47A 4CYDA 3DPRB 2ZX0A 1BBT3 3B01A 5HPOA 2EIEA 1H2MA 2GN7A 4QGMA 4FQZA 2XLGA 1XNCA 2E9QA 2XKPA 2YPDA 1W8ZA 2ZKLA 2ENRA 4LBKA 4LBNA 3UT0A 3ZIWA 4AE2A 5JZGB 1W6PB 2MHFA 1JOBA 3MV01 1NA1A 1PIV1 3B00A 2OX0A 4N53A 1LOAA 1ULCA 4IE4A 1KJRA 1UXXX 4ASMB 1SLCA 4XHBA 5FO8B 3HR9A 3FC0A 4X6RB 1MPXA 4R4XA 2WZPP 4BXFA 2HBUA 4NHLA 5J37A 4HKWA 3CQOA 2O0OA 3ROUA 2JDYA 3ZVXA 2D5HA 5GZFA 1HRI3 1AYN2 3O0VA 3POEA 3K77A 3HT1A 1W39A 3OGVA 4RFRB 1RUD3 3ZPOA 3AZVA 1W3VA 4Z07A 4KWJA 3WLUA 3WQBA 5FJKA 4AI0A 3ZX7A 2RE9A 1AXKA 1OFNA 1QJFA 2QE3A 4K6BA 2E7AA 4ZU7A 2RR13 3N7KA 1WZXA 3PMEA 3SISA 5C4WB 1RJ7A 3PU8A 4YW2A 4IEXA 1UMIA 2BW8A 1GLHA 4IV1C 3RVHA 3TEWA 3LOBA 5FYMA 1PK6C 1JH5A 1SMVA 2E63A 3Q8CA 4CTEA 3G7DA 3HQRA 4PDWB 3ZYGA 1QXRA 5BPXA 3MUY1 3NSTA 5BNQA 1SBDA 1S2EA 1W6OA 4NUBA 1FAYA 1QJX2 1GNHA 3HVDA 4QX7A 4KG8A 1XSRA 1K45A 3N9QA 4LORA 4QHBA 3N7JA 1VBB2 4LULA 3WXPA 2VCAA 1SDWA 4W6XA 3OBZA 5LCWL 1WD3A 2CSGA 1LENA 4C0BA 3HWJA 3BKZA 3DN7A 4LXLA 5IW0A 2BDRA 5ABJC 3IKWA 5J48A 5F9TA 2JB8A 2XGXA 4N8MA 4FAHA 1PM7A 2P3KA 2ZHMA 2ET1A 4NVPA 2A6VA 2BPA2 2RS51 2XR4A 1W05A 5BYNA 3RMXA 3N35A 1GZTA 1JUIA 4CU9A 3CKHA 4OQ8A 3VL9A 3ELNA 1E5RA 1D4M1 2C9KA 4QKNA 1E57A 5FY8A 4YM2A 3VBOA 2HWE2 3LDKA 3B9IA 4Y24A 1OC1A 1Z0HA 1V6KA 1O59A 3QBQA 1LHOA 2BYVE 1ULEA 4MXWB 2Z42A 2JE8A 3THPA 1E5SA 4ZKTB 5DUVA 3LD8A 4EN8B 2RS13 2SLIA 4Q8LA 1O8SA 5JI7A 4LITA 3C7FA 2X5IA 1UX6A 1PK6B 5FRAA 4RGGA 1QXJA 2VE1A 2W08A 3DYPA 3PU3A 5AC92 3RZLA 2WWJA 3SMHA 2YV8A 3M7AA 2ZX3A 1UL9A 4UOJA 1MQTA 4XFFA 2D5FA 4I0AA 2WS92 2F6BA 3CMGA 1LECA 3VZOA 4CCLA 2ADDA 4MGZE 3INAA 2B39A 1FPN3 1ULOA 2C6SA 3AX4A 3DF0A 4AW7A 3CJIC 2LM3A 2GAUA 4GB31 1VMFA 3LCPA 5F5QA 5H9RA 3BYWA 3GNEA 4CEWA 2BEOA 2ZGQA 4W65A 5EJ1B 5BNOA 1VBD1 2VOVA 4L0PA 2O8OA 3FLRA 2JENA 5I93A 4LEJA 1RUG2 3I2HA 1CPNA 1AL0G 1UMHA 2DVAA 4XBNA 5IWFA 1NG0A 2G9FA 1FOD2 2NN8A 2NQYA 5FIXA 4DINB 2JDPA 4NPLA 1TME3 5F3EA 3CIHA 1PIV2 4EV0A 4NPMA 3OGSA 4GD4A 4N43B 3VBHA 1GR3A 5CFDB 1W9SA 4C1XA 1G9DA 3ACIA 5EJ3A 3SXWA 1VBA2 2Q8CA 3RZGA 1HRI2 5IFTA 4W50A 1DYOA 2Q30A 1O6UA 1ULFA 2ZGLA 4HSLA 3IZOA 4FOYA 4MV2A 3RYKA 3TWIA 2RG4A 1W8NA 1K42A 1S0EA 2VO5A 2ZXQA 2VZRA 3R0RA 1RUC2 2CYFA 5H9PA 3T3YA 3ZXAC 3JBG3 5FZAA 4A42A 3SLIA 2E51A 5GKAC 1JZ5A 3ES1A 1FV3A 1RUNA 1HRI1 2E33A 3J7MA 1AYN1 1DIWA 4MXWA 4FT8A 1JODA 1JW6A 2XHKA 5KWRA 1TVGA 2QQNA 4Y1ZA 1OD5A 4FOQA 1LODA 3N3HA 3T2PA 1L3JA 1G9FA 1R1A3 1VALA 2J1UA 1W99A 2K0GA 1SG3A 2ZGKA 4GZ9A 5DN2A 3SQOA 2J1SA 1UZVA 5FYTA 5T5LA 3WNKA 1MR5A 5A32B 2DUPA 1ULDA 4E8DA 2J1AA 2WKKA 2ZZQA 2Z2SB 3ZKUA 4TYSA 3AKTA 4Y22A 1MZ5A 4CUGA 4YGCA 1CWPA 4Q4V2 3NQHA 2VTFA 3W21A 5A6ZA 4MX3A 2A75A 3OCPA 1MQTC 4CEWB 4XUPA 3PTRB 4V2VA 4WVZA 4AVAA 5JPMB 1QU0A 3PVNA 2OVUA 1ENXA 1IHMA 2Y6GA 3PUHA 3NKTA 4NIDA 1OKQA 1VRH3 3WDXA 5A3PA 3APBA 3H1WA 1CZSA 3C7EA 1UXZA 5FREA 2GMEA 1WW5A 3RZZA 5FYIA 1C5IA 5LK5A 4AQTA 3MW2A 3L9JT 1YQ2A 1PZ9A 1BCXA 4H7LA 1YCIA 2XBO3 5I0UA 5I91A 3BTZA 3POGA 4E8CA 1RITA 3SEPA 3KM5A 4QDQA 5JOWA 3CJIA 2VUAA 3WG2A 5IT6A 1N47A 2JD4A 3GDBA 4F7ZA 3AJZA 1ZYBA 3VHNA 4UW4A 4AAXA 1Y9GA 1WWYA 1QMJA 1UU5A 2P6HA 5F1RA 2BWCA 1V6NA 1V9U3 4IEYA 4XJ8A 3WINE 2VXJA 4LK6A 4LQRA 4XDQA 4K8FA 4PBOA 1S2KA 5FOJB 1CX1A 1DDLA 1OT5A 4CDQB 3UYJA 2VNGA 4XJUA 3BIEA 2X8KA 3BPSA 3KZ4C 1H2KA 2JG8C 1BBT2 4XMAA 1ZBA2 2B4KA 4BOWA 5ISLA 2D6PA 2E26A 4FQ4A 4W8JA 2HEVF 2ZOEB 4RQPA 2VQAA 3ZR5A 3UV9A 2DURA 2F4PA 3VV1A 3MIFA 4AEDB 2WT0A 4H55A 1DZQA 1Y9QA 4A44A 1UYYA 1GQGA 4Z92B 3VBUC 5FZCA 1GOGA 2GC1A 5T52A 2IWGB 1SPPB 4P9YA 1Q43A 4NHYA 1AJKA 1UY1A 4GH4A 1RYYA 5C8CB 3RYPA 3PJYA 3O0WA 4URAA 3VBUB 1AYM2 4QB2A 5J36A 3B94A 4M3CF 1X36A 3ZIXA 1XYPA 2W87A 2J1TA 4EROA 5JSPA 1OQDA 1R091 2R6QA 2WA3A 5I0DA 2WWSA 3I97A 4EN9B 4L97A 5T54A 3NJYA 1YI7A 3J8F2 4OI1A 3WUCA 4JGYB 1XNDA 4IDZA 1GNZA 1W2OA 3LIHA 3PIGA 3VBSA 2D3PA 3CU7A 3URFA 1AL23 5FO9B 2XVLA 5B2GB 3BN6A 4Y4YA 2ZGNA 3NNFA 4E4ZA 3DCQA 4TSVA 4BQYA 2ZX4A 1S4CA 4JGYC 2XH6A 2D3SA 1QJX3 4RN5A 4CP9A 3GZEA 4MLOA 3VBOC 4NJ4A 4XXPA 5E1RA 4CDXC 1F15A 4N53B 4PDWA 1LB2A 4FSJA 2XWJB 1UAIA 4Z82A 4AG4A 4NAOA 1LOCA 1K5JA 5FUIA 5BNPB 3ZM8A 3ZXDA 3T09A 1CJDA 5FY0A 3ZLIA 1Q8PA 1ZZ9A 3W5NA 2KXLA 2VNRA 1PO13 1BEV1 3LQCA 1NCQA 2I74A 4SLIA 1R64A 2LALA 1SHWB 4PF1A 2VMGA 1LKNA 3VKMA 2C26A 5JXIA 1XNAA 2ES3A 3ZSKA 4AQ2A 3RZJA 1BYHA 1L7LA 1RINA 2Y6LA 3OB8A 4N90A 2BV4A 3MFAA 3PNAA 3LOIA 4D3WA 1QHDA 4ZY9A 2Y60A 1QQP3 1H2NA 2EXIA 3GZTB 4ASLA 3LA3A 3GCWA 1GWMA 5FMCA 3VKOA 3RWNA 2YBPA 2LRPA 1LHNA 1RUE3 1TMF2 1NT0A 2DVFA 2X5IB 4O9EA 2DFBA 3FLTA 1FMD2 3N4MA 3PUIA 2XKOA 2D44A 3SCGA 4LR4A 5ACA1 4Z2WA 2AEYA 1O4TA 5IVJA 3SH4A 1KDMA 1NE6A 1Q56A 2F4LA 3MHZA 5T5JA 1HV0A 2VZUA 1OF4A 1H1MA 4F8AA 1VRH1 2OT7A 1SCSA 3O1UA 1CVNA 1HN0A 2XUMA 4OHXA 2VJXA 4NRMA 1PNFA 1LHVA 4QD2A 4B8EA 1QJU1 3ZXJA 1IQAA 4XIOA 4GKYA 1ND3A 4FPEA 4QGNA 4RR3C 2W46A 5IATA 3Q8EA 5HCAA 1NUKA 1X82A 2YY1A 5FMBA 1HRV1 1V6OA 3U14A 4M4RA 4IEQA 2UY9A 4HFSA 4UI9L 3V0BA 2EA7A 2PAMA 3IIAA 1RTVA 1UX7A 5JIAA 1LESA 2AENA 4M3CE 1JOJA 2NYYA 4QPIB 5DG2A 4QQ2A 2QQKA 4EE2A 1US3A 2ILMA 4JQTA 4PLOA 2YYOA 3VD9A 3W58A 4COWA 2VXRA 5JMCA 2PLV1 3OSDA 1JN2P 3KVBA 3I8TA 4MADA 3I54A 4YZ4A 1YUDA 1PO21 1YQ8A 2BBAA 5JR7B 4CCMA 1RHI3 1W6NA 4LO4B 2A6WA 2OKXA 3WDUA 1CAWA 5D8AB 2RMU3 3E1F1 4IEWA 4LO6B 5C7GA 1AR83 4G3YC 1RXGA 3SKVA 3RQ0A 2X53S 5EFUA 1S0CA 3FN9A 3AL5A 1E5HA 5FO7B 5L9VA 4BA6A 1W0OA 2ARBA 2TUNA 5G05L 4P9JA 4QPGC 4KWUA 1R092 1OQEA 1CAUB 1BKZA 3UNPA 4ZZ8A 5LA2A 5EWSA 4B4RA 2RV9A 1JBCA 2YROA 3EHKA 2QQPA 1QH6A 3CHXA 3NNLA 5FPVA 3AMQA 3EJKA 4K20A 1WMFA 3VDDA 4BIOA 1Q3EA 4UBGA 1EV12 5FDBA 4CCNA 3WG3A 4GXLA 5F6KA 4DY3A 1YWKA 1CONA 2BQPA 4NMIA 1QXPA 4XQ4A 1O8PA 1UO9A 4P5YA 4ZXEA 4AGGA 3PIJA 5HXMA 2OPKA 3JUUA 3HQXA 1CIWA 1FT9A 4LHKA 4CE8A 4UBHA 3R4UA 4EN0A 4GIQA 3K46A 1RHI1 4ZPIA 3O1RA 3FFZA 2GDFA 2Y38A 3P5BA 3T2QA 5A1LA 4MVTA 2AYHA 2XL7A 4NHMA 1K5MA 1QJY2 5FZDA 2WBKA 4QPYA 5CBLA 2WC2A 3T2TA 4E2GA 2RDSA 2XPJA 2XUEA 4IEVA 1WMDA 3MUZ1 5KXEA 4YGBA 2ADEA 5A3LA 1C5HA 2XQXA 3FBYA 1RUI1 1UPSA 4IEZA 4BQ3A 1ASJ1 2V73A 1X9TA 3U4XA 4XFHA 5FZ3A 3VUOA 1JS9A 2A7AA 3VBFA 5BNNB 2W91A 5F5IA 2JX9A 3I7DA 4HPKA 2DV9A 1EP0A 1X7NA 5JR2A 2ZHNA 2WO1A 2WRAA 1TMF3 2VBDA 4S2HA 4NROA 4D6RA 1GWKA 1JZ7A 4IQPA 2R063 3QOPA 3WG1A 4P00B 5EYYA 5FYVA 1EYBA 3M2MA 3KVAA 1VBC3 4Q4X2 1YFYA 2I2SA 2VTXJ 4PT6A 1ULPA 3KCXA 1H6XA 2HBTA 5FZKA 2WT2A 1PVC1 1V9U2 5FY4A 5LBBA 5CB7A 3M3QA 1GSLA 3UJOA 2J22A 1O91A 4FTSA 2G4IA 1HXS3 1U12A 2VBBA 2DTWA 3AC0A 1Q5OA 3GGLA 2BNMA 2MPFA 1RC6A 2WS91 4LLOA 4YVWC 1YXWA 2QZ3A 2YUEA 1ZZBA 4AQSA 2XVGA 2VMIA 5DZEA 2ID4A 5FY9A 1S0GA 1AR63 2BFUS 4D6SA 2HWB1 4CPBA 4CXYA 4XUQA 2FDGA 3R05A 4E27A 1SQ4A 2R0FA 3PVBB 4UFKA 3NAPC 4C90A 1VBE2 2QQIA 1UF2C 4XFIA 1MS1A 1JUHA 4Q0SA 1STMA 3RNSA 1V6IA 1J83A 3UGGA 1PMIA 4QKFA 5ANQA 5BNNC 4PLNA 2R073 4IESA 1F4HA 5KC6A 2HWC1 3IDCB 2GMMA 2WLQA 2ZJCA 5IVEA 5IVFA 3AZYA 3V64A 4AHWA 5C9AA 2EXHA 3RG0A 3I3DA 1YHFA 2JDNA 3IDEA 4FXKB 4GWJA 4KU8A 1MQTB 4B3NA 4I01A 5CISA 4CEWC 3MF6A 4QGLA 5LY1A 1S0IA 2JDHA 3H50A 4UYBA 3D5OA 1MS4A 1W2NA 2OZJA 1XSQA 5H9SA 3T2OA 5CKNA 3NNGA 1P8JA 4CPBD 2VAUA 4HVQA 1PO22 2DVBA 4ZS3A 1T2XA 4LBOA 1EAH3 1DQ1A 1UCXA 1UY2A 1KGYA 4AVSA 4EN7B 4GULA 4CDWB 1TEIA 1NXD1 4FFFA 1K12A 4KG0A 4CA9A 4XIKA 1KFUL 1NCRC 3VD7A 4META 3WW2A 3SCFA 1D0HA 1X50A 4FPKA 3NJXA 3WY6A 4AEKA 1RUJ1 5HCHA 3S7IA 3MFCA 3VBFC 1RJ8A 4LIVA 5GLWA 2PA7A 4QQOA 5FP7A 5C3OA 5CFDA 4Q1RA 3ECQA 1OLME 3AYEA 2XBO1 1FPN1 3I2KA 1SLLA 2DVDA 4QKBA 3VD3A 5CIRA 1QJY3 3OBTA 1N3PA 2RS32 5F6LB 3LIGA 3L2HA 2PELA 3BPZA 1H0BA 5LK7B 1JHNA 4LLFA 5C3PA 1H8TB 1YFUA 4COZA 4AR2A 1ND2B 3I3EA 3UK9A 4KNCA 4WVVA 5L7OC 4AHZA 3AP6A 1W28A 4L99A 2BVBA 1O4YA 4HSJA 3PDQA 1QGLA 2JB4A 2NLRA 4LBQB 4QPGA 4Y1UA 4ATEA 1A8DA 2DWRA 4IE0A 1RUE2 1VE0A 2JIJA 4JAAA 3U1XA 5JSRA 3FUOA 1ZA7A 1OLQA 3ALQA 4HBNA 1D7PM 2AZ5A 4CDWA 2WDBA 4AVBA 3KV4A 3NAPA 4YFZA 1I5ZA 1DLCA 2VR4A 3AKPA 4PHZA 4RS5C 3MICA 5F2SA 5KR7A 3ETPA 1D4M2 5FWJA 3LA2A 4YZ5A 4E2QA 4BWOA 1H9PA 1ST8A 2XDVA 3JBG1 2HWE3 2XJUA 4CSWA 5F37A 1UYZA 2WNUB 4HANA 1YYNA 3OUIA 4LIUA 3ABZA 3AMPA 4D69A 3D8CA 5A70A 2DU1A 1QJY1 2JWPA 1W9WA 4HVRA 4GMP0 3EQEA 1UNBA 1XJAA 1S0JA 4BK5A 1LJ7A 2DUOA 4F3JA 3DYOA 4AGVA 2W94A 4XACA 3ZXEA 4YM3A 2WNUC 4DZGA 3UKNA 3OY8A 5C8WA 5FLJA 5I8YA 4BMEA 1PVC3 5L19A 3LZZA 4R52A 3WVJA 4AFDA 3H8UA 2Q1MA 3R4DB 3KCYA 1FNYA 3E6DA 1CAWB 4XURA 5D8AA 3JQXA 4AI9A 4DEVA 4HONA 5FZLA 4PIXA 3ST7A 2X09A 3MW3A 1ZA4A 1H1AA 2O14A 3OBRA 2R1BA 1RUH3 1OFSA 2WS93 5C4WA 1C1LA 5BV6A 2QQVA 1OVSA 1VLNA 4UWDA 3V65A 3WP3A 5FY5A 4RHV3 1J58A 2YU1A 2FMYA 1AR92 3DECA 2GC3A 2DBIA 4UFLA 5FP8A 2JDZA 5A3UA 5JIUA 1XE0A 3VB9A 1T6GC 3MPPG 4XTPA 1OF3A 4LBMA 3VBSC 4I0WB 3LE0A 4N43C 1POQA 1GKBA 3PURA 4LK7A 4IE7A 4XCBA 3WNLA 3FHQA 4L9BA 4Q4W2 4AI2A 4Q27A 1WCQA 2B7YA 3CF6E 1LOGA 2TNFA 3BIWE 3SNMA 4MGTA 2UYBA 1PM4A 2VY0A 4CCCA 4I3PA 5BUVA 2VMDA 1F4AA 3WNPA 1JZ4A 3DXUA 1PO11 1X8MA 1WLWA 3DKWA 3DUIA 1OLMA 3ZXKA 3PUQA 1X9PA 4J25A 3E5QA 4CUAA 3LKJA 4XEZA 5E88A 2V72A 2ZX2A 5CZKA 1S0BA 3RJ2X 3WUDA 2B9VA 2WFF1 4RQPB 3A0KA 3CL1A 4CDQC 2XJQA 3ZFEC 3ZSLA 1A34A 4QPIA 1IS5A 5CA6A 2P3YA 2RDRA 2EAKA 4FFGA 4M4PA 3O1TA 4YVSB 1VBB3 1WLTA 1ZNPA 4Y26A 1F31A 3KGZA 3MIBA 4YLZA 3USUB 5EXOA 3A22A 5EP9A 5C8CA 4FO9A 3O5SA 3RGBA 5JDBA 1HRV2 2JDKA 5GJ6A 3DL3A 3OEBA 3OD4A 4UT5A 4XF9A 1J3RA 4U36A 1Q8VA 4XZUG 4RR3B 1ZRIA 2VVFA 3AL6A 3QD6A 4QQPA 4AHYA 4AEJA 2IUWA 4DY5A 1AX2A 2VZPA 4JGYA 1OI6A 5DDJ1 3W59A 3I2GA 1GNYA 1NY72 2WINB 2O1QA 1KS4A 4FPHA 5HV0A 2OUHA 2ZHKA 2D97A 3HN1A 4BQXA 1YLLA 3VDDC 2A3WA 1UU6A 2ORZA 3I2JA 3JU9A 3I3BA 2CWMA 1B35C 4EWEA 5A33B 2MEV1 5JCTA 3SCHA 1OKOA 1UY3A 2YMZA 5DZFA 2ZPXA 1GZWB 1VAVA 4FAGA 4HPKB 1LU1A 3NWKA 4XPVA 5FLHA 3VDDB 1OOPA 2XWBB 4XF3A 3SITA 3ZN5A 1PX4A 1DF0A 2A5ZA 4NAMA 1ZZ8A 5A7OA 5D8AC 3ZDVA 1AX1A 5A3TA 5T5PA 1CZTA 1PHMA 4JRLA 5FAXA 5IVBA 2RMU1 4QPWA 1NXMA 1WD4A 2XG3A 2J7MA 3V0AA 1UMZA 4NRPA 4BB3A 4L2NA 4YW6A 1NOVA 1TNRA 4N53C 4ZU5A 3WDVA 2YBSA 1Q8QA 1W9YA 4LA2A 1F5JA 3R6SA 5LZ6A 4GH4C 1DGWA 4O65A 1AR62 3AYDA 5AFEA 1KDKA 3H7JA 1RUC3 1QJEA 5DABA 3ATGA 2QQJA 2JKXA 4OHVA 1M4WA 3PVOA 3MLJA 1HW5A 1JYCA 1PIV3 4NR1A 3T4VA 2AACA 2P5BA 5FZ1A 4FVVA 4Q4Y3 2XJPA 2H6BA 2LROA 1ND3C 2EICA 4RR3A 4BHPA 4RHV2 4JGZA 4IGPA 5CU1A 2CV6A 3I3QA 4XF1A 5FZEA 4OVEA 3VZLA 2D43A 3GF6A 5CADA 2H6CA 5FUNA 4CXWA 3S5AA 2Q1FA 3FHAA 5ABJB 5L36A 2C4XA 3N9MA 1GOHA 1XE8A 1G9BA 3LEGA 1YQ5A 1JMUB 5JZGC 1ND3B 5EPAA 2HWC3 2CGNA 4LOTA 4ORFA 2B8MA 3Q8BA 4RHV1 5A33A 2D6KA 3HEIA 5A3OA 5A1AA 1VR3A 4YVSA 1QJZA 1T6BX 2Q4SA 3FMGA 4AFAA 1Z7S2 1Q8SA 4P9GA 3THCA 5EV7A 3FWEA 1O3TA 2FCUA 4XXAA 4Y22B 4B4PA 1ASJ3 1CZVA 1TG7A 2XB6C 4YW7A 2OA2A 2A3YA 2CHHA 1BK0A 4RGAA 3W9AA 3WW3A 4ARXA 1UY0A 2A3XA 2HWD3 1RGSA 4E4HA 4BQ2A 4MZUA 1F5FA 3IAPA 2P6CA 3VBOB 2VU9A 3T0BA 1US2A 2VW0A 1VAMA 4XTMA 3RJRA 1OPMA 1HRV3 2JJ6A 3FLPA 5BNPC 1W2TA 2RS33 2ZGMA 4QDRA 4QX3A 1QNYA 4W6YA 3RI8A 3SHRA 4DXTA 2FDKA 2W1UA 3MYXA 4LBQA 3ITQA 4K21A 1PGW1 5DAPA 4DRRA 4YGDA 2WN3A 2FDIA 1JHJA 1WMEA 1U5YA 4HN0A 5FY7A 1DFQA 4BIFA 5EYXA 5LRSA 2WZR3 2CU5A 3KV5A 3OYWA 1N1SA 2PTMA 2WO7A 4PI2A 4DS0A 5JOYA 1H2LA 1Y43B 2RS11 3LPGA 3U75A 4NIGA 1WMXA 3VN4A 2IZWA 4EQVA 2VOXA 1PNGA 2AUYA 1C8M1 2VZVA 3BI3A 4PIYA 4PCRA 1W06A 2BGCA 3B9CA 1UKRA 1XYOA 1W6OB 3IDAA 5TSWA 3OUHA 3WOGA 3K4DA 5FFOC 5FK7A 3P3NA 4HKOA 4LE3A 3ZYIB 1DHKB 1WCSA 3OD0A 4ATFA 2P34A 1AR61 4COYA 3TNQA 3PTYA 1YIPA 1AR81 4JRAA 2PHFA 3BB6A 4B4QA 2ZA9A 4E9KA 2VTXA 3LDRA 3ZYFA 3JB4C 1O3SA 1G7YA 5IHRA 3VDBA 1LR5A 2MEV3 3FUQA 5A1FA 2VZ1A 1Z78A 3O14A 2HEWF 1ZBA3 3N7LA 3BOWA 4DXSA 1PVC2 1V9U1 3POFA 3OPZA 4L92A 4P5HA 4K8RB 1V0AA 4AXOA 4HETA 4CCDA 1NZCA 3ASIA 3DPRA 4Y1YA 4Q1PA 2BJSA 5K9YA 2WT1A 5ANNA 4CDWC 1DQ2A 1WKYA 1Y3TA 5BNNA 5LA0A 1UKGA 3ZN4A 5CG8A 3JD73 1C8M3 3LAGA 4B7KA 3BU0A 2WO2A 4LE4A 2JDUA 3A0NA 5CAZA 1REDA 1UOFA 1UZWA 2B5HA 4C8DA 1HN1A 5EHDA 3ZXFA 5M0TA 3JCIA 1W2UA 1VPHA 3C7GA 4PQQA 4V1PA 5IYYA 1AR93 2TBVA 2D6OX 1HV1A 3FHIB 3NO8A 1KXGA 2GP3A 2D6NA 5T55A 4XJAA 3S0MA 4FTEA 2VM9A 3D82A 4E2SA 1SBFA 3RS6A 1WBLA 1RUI3 2ZEXA 4ASKA 4JDOA 5DXDA 3C7OA 1RUC1 4D7SA 3T0DA 3DEMA 1GQHA 4MHUA 1POV3 4Q4W3 3NV4A 1GWLA 2YC2A 3IBMA 1HKDA 2Y0IA 1NE4A 4MG2A 3AKQA 4XQWA 4KBBA 1CESA 2DBNA 4GWIA 3U10A 3MIDA 1AL22 2XL9A 1S55A 4J1WA 4J1XA 3H8XA 3MGUA 1PX3A 4ZS2A 2JD9A 3J7LA 3RZMA 1AYN3 3AMHA 1U5XA 2RVAA 3B7MA 3HNMA 3TN92 5J3UA 4MYEA 2RJKA 1COV2 1MS5A 1ZRRA 4OI2A 5FXXA 3WR0A 5BNOB 3NVCA 1HIXA 4Y1VA 5T5OA 2WFPA 1R1A1 2YB7A 4I3GA 1RUG1 4P9XA 1A6CA 2VOTA 5FZ6A 4TZDA 4OMCA 4EJRA 2FD8A 2AR6A 1ZBE2 3BCWA 3HJRA 2ZHLA 4Y5TA 5IK4A 1EUTA 2P37A 4XVHA 4AHXA 2G1MA 3WDYA 5JWPA 1BBT1 4N43A 4WM7B 5EQUA 1PO12 3CZJA 1IKQA 1G86A 4OI0A 2Y34A 4PQ9A 3TB0A 2PFWA 2R0HA 2VZTA 3RWKX 3WP6A 2EIDA 1UZ0A 3RPQA 2CAVA 3OYWB 4GAZA 2VMHA 4I09A 4PBPA 2K9ZA 2PHRA 1JXNA 3CJIB 5C5UA 3NJZA 3MW4A 2HEYF 3KQ4B 4CEYC 2VUDA 2JG8B 1R081 3SC7X 1HB2A 1NZIA 3MV11 5E16A 3OPTA 4DB5A 1J3PA 3I2DA 4YWAA 1RUOA 3FFQA 1YC61 2JKBA 3I2IA 4O9GA 1I9RA 4FP2A 3RI9A 2Y33A 2WNVA 2GALA 2D3RA 4AEDC 5L73A 3BVCA 1LOFC 1X33A 2AEZA 2GNBA 1GBGA 4N7UA 2GH8A 2N7GA 5HI0A 1U0AA 3AYCA 3HQUA 1IG0A 3IMNA 2R1DA 2ARCA 4ZONA 3TOJA 2HWD1 4WM8A 5FLIA 3ACFA 4GALA 1CX4A 2DYCA 3A23A 4XUTA 4GQ7A 1W6QB 3Q9OA 4AI1A 1CGPA 4A6OA 4FPFA 1C57A 2DCTA 3F95A 3Q8AA 2UURA 2ZMKA 4N9HA 3LFIA 3N9OA 1SACA 3QCWA 3NNJA 3P6BA 4OULA 3WNOA 2IFWA 3H8RA 4S2FA 3SEEA 4HN1A 2RJLA 1QOOA 1IOAA 2YFUA 1QJU2 1ALYA 1RUF1 3VKFC 1KRIA 2A6ZA 1R083 2W5FA 4OMDA 2WAOA 2CGOA 1JU3A 3HD8B 1W03A 1BVVA 2HYKA 2OZ6A 1POV0 2ZGSA 2G19A 5D1IA 2RR12 5AC93 1UOJA 3OGRA 1VRBA 2ZCWA 1ZX5A 3K48A 4R9BA 5DAXA 2Q0AA 2W2IA 4JV4A 2IXKA 2VL4A 5FPXA 5A7WB 5CKQA 5CFCB 4XDOA 4BLIA 1MEC3 2ERFA 1GQPA 4CU6A 1C8M2 4XETA 3H7YA 2P4EA 1V70A 2C0ZA 5E6HA 1GMMA 2JG9B 5FZOA 5C3QA 3K4ZA 1NX9A 4LO8A 4JHZA 1YQ6A 4P9IA 3SH5A 4AI8A 2UWAA 1XNBA 3NV1A 2YU2A 4C1WA 3ZPYA 4BYYA 1UQXA 3F2ZA 1YJKA 3BTYA 4HZFA 5IUQA 2WNUA 2JG9C 3RMYA 4LKFA 3VBHB 2PYTA 2QBXA 1U5ZA 4XFBA 3S7EA 5KXBA 1DQ6A 2RDQA 2W92A 1BMV2 1R093 2LS6A 1AR91 1PMJX 4MSVA 1I5PA 4XUNA 4DMIA 5BNPA 2X10A 2P2KA 4CEYA 2VNVA 4QWNA 5JXJA 2DVGA 2EALA 2CL2A 1Z7S3 5F2WA 3OGGA 1C8NA 4QX1A 3JD71 3ORJA 2RM23 2X5IC 5GLTA 5LY2A 1LAJA 1NAEA 4O61A 2VZ3A 1DZTA 1QJX1 4XJWA 5I0RA 3KT1A 1C1FA 3ENRA 3I59A 4X8NA 4BDVB 2V5YA 4P14A 3G6JB 3EB7A 5JXGA 2JG9A 2A6XA 2Z4FA 4YG0A 2VMCA 1V6JA 1LOEA 4LPLA 4MGSA 1GP5A 2L9LA 1AVBA 2PHUA 2VG9A 1WA4A 1NCRB 4OZOA 5L7OA 4COVA 1CAVA 4XZPA 2VH9A 4JTOA 1BEV2 2WN2A 1VMJA 2W1QA 1O3QA 3PL0A 5J96B 2Y64A 1FX5A 1H6YA 5JOZA 1JYVA 2BWAA 4CCEA 1NA1B 3MIHA 3GALA 4BCUA 2UWCA 1EUUA 1JZ8A 1QNWA 1XU2A 4YW1A 2HWF2 3FE5A 1D4VB 2Q5TA 3MEPA 3VZJA 3ZFEA 3AP4A 5DQ0A 1CD3G 1RMU1 1J84A 2VD7A 2J42A 5L9BA 4DXZA 3MZHA 2GH2A 1WA6X 1FMD1 2ETEA 1YI9A 1LHUA 1RUH1 1WW6A 1ZREA 4I2OA 3JB8A 3PHMA 1E5IA 4NWWA 2B42B 3NNMA 4HK8A 2CDOA 2R062 1O3RA 2NM1A 4A7KA 2HJIA 4MGQA 4BLJA 3SH3A 3ZN6A 3KHCA 2XQRA 1OSGA 1XC6A 5DUWA 1A3KA 4BM8A 5A32A 1XNKA 4NOTA 4QQLA 3AK0A 2W9XA 5FYUA 3J9SA 5LBCA 1EPWA 3NL1A 5DDJ2 1O5LA 4FPGA 4MGIE 4CCOA 3NV2A 4W6WA 3TYJA 1VBE3 2BRTA 2TEPA 3KS7A 1FYUA 3U37A 5KXCA 2JEMA 4KI5M 1EAH1 1WW7A 3VKNA 4QXCA 2E53A 2LTNA 3CEWA 4CP0A 1UZYA 5A7PA 3WDTA 5A6QA 1NCQB 3N9LA 3DGTA 3HNBM 1RUD2 1DP0A 1IS4A 4FPCA 1TE1B 2Q8EA 2R30A 4Y5Z0 4AZZA 5H9QA 3LA7A 3PMSA 5IK7A 4DNYA 2AC1A 4QXKA 1WBFA 3VGIA 1FXZA 5FYCA 5FZOB 5A7NA 3JD72 4XBLA 3K51A 1WLCA 4AFBA 1EV11 3AP5A 1FNZA 3CDZB 2BOJA 3ILRA 1HJGA 4JKLA 4P08A 1RUF3 4DUVA 4HVOA 1VAKA 3D0JA 2H0BA 1QY4A 1QOSA 4OHWA 3M8LA 4UF0B 1CAXA 4XFCA 2OXBA 4OYUA 3TEYA 2UU8A 5FPZA 1RUI2 4IERA 5CYYA 3BOPA 4Q0VA 4BPZA 4MOAA 1J3QA 1FOD3 3OUJA 2ZZJA 3WW1A 4G4FA 4DOUA 5GZEA 4P9WA 4UXAA 5FYSA 3B3QE 4NIAA 3WQ0A 2WZ8A 4QPIC 1GYKA 2R16A 1XE7A 3GBWA 3AYAA 3LEMA 4XJZA 2FDFA 4K3UA 5DPNA 1VBA3 1JYIA 1XYNA 1SFYA 2WZR1 3O1PA 1IPKA 2JICA 4INDA 1COV3 5LBFA 3VD5A 1GV9A 3LDBA 4OUEA 5J1XA 4N7IA 4IV3B 4MGYE 2XMLA 1SPPA 2VVEA 3U4SA 4QU2A 4KU7A 4EZHA 3TN91 3USSA 4AQ6A 3KQRA 1JYNA 1LOFA 4XHXA 4AYUA 5SV8A 3HNYM 1HJFA 1SDDB 1BXHA 1W9TA 4LKSA 3ZYHA 2VMEA 2J1EA 1NYWA 4XAAA 3MIEA 5F3GA 4UF0A 2JG8A 5LA9A 1BJQA 3M4FA 4Q4V1 4HG6B 3GHNA 1RVF2 2DF7A 4HLTA 1URXA 2NMNA 4Q0PA 1ZBE1 1W8TA 3WV6A 1RUJ3 2IVIB 4A3XA 3IAQA 2E7TA 1NQDA 3DKQA
chains in the Genus database with same CATH topology
3FZ3A 3OGJA 4YVWB 3ZMNA 1DGRN 1LOBA 4HKLA 4K1YA 4WM8B 1REFA 1N1VA 2PLV2 4WVWA 4I30A 3QACA 2QCSB 3NW4A 4YZ2A 3M3EA 1RMU2 2ZTNA 3WHUA 1BK1A 5K8SA 3WX5A 3ILFA 4NO4A 5T50A 4XF4A 4YGEA 1NY71 3AKRA 1RIRA 4I02A 2PHLA 2JXAA 4JVAA 3RSJA 4XE9A 4YZ1A 4IV3C 2RHPA 4WM7A 2XBO2 4LHLA 1KITA 3M3OA 2BTVC 4YW3A 1AR73 4XILA 3N36A 1W0PA 2IXCA 3CJXA 1VBB1 2CNAA 1AZDA 2ZAHA 3JQWA 5K0UC 4PJYA 4AGRA 2BFUL 1BVP1 3N7MA 4YM1A 2R071 4HMZA 1RUH2 1RUD1 3D6EA 4ISQA 4DFSA 3HBZA 3ZFGC 1S1AA 2UYAA 2EIGA 1UIKA 1SFNA 1NLRA 4WM7C 2PHTA 4FXGB 3A4UA 1H8VA 5E89A 3CO2A 2QFEA 3OJBA 4Q0UA 3J26N 5JOXA 5K7PA 1LGNA 2FQPA 2PHDA 4HT1T 1VP6A 2XLAA 2ZGTA 1REEA 1UIJA 2CAUA 3AFGA 3M1HA 4LO7A 3ZSJA 5ACA2 3V0BB 1H8TC 4S2GA 3MIGA 3UL2A 1HX6A 1AYM3 1GICA 1W6MA 1LHWA 4FPJA 1FOD1 2FMDA 3GBGA 2VULA 3H9AA 2OW4A 3TRSB 2JE9A 1PZ7A 1VB4A 5KC5A 2D6LX 1J1TA 1Z7S1 2D6MA 4FOVA 5AVAA 4ISRA 2RS53 4OZXA 4BQ1A 3VKLA 4YG3A 4UW6A 2R042 1ND2A 4JTNA 4Y20B 4URTA 3HT2A 4TLFA 3I59B 3WZ1A 3IWZA 3D0SA 1VIWB 4S2DA 1YFWA 1SEFA 4RSUA 2Y0OA 2G9GA 4AFMA 2ZBJA 1OA2A 1RUJ2 1V6MA 3HIFA 1KD7A 1CAVB 1OOPB 4LNVA 1KQRA 1ONAA 5I8TA 2XVKA 2IXJA 4L8QA 2ZGPA 1AJOA 4YARA 3VHPA 4A7ZA 2CTVA 2SBAA 2ZMLA 3H3UA 3UKTA 2PN5A 4BZ4A 1H4HA 3V0AB 2PAEA 3TNPB 4B7EA 1OMIA 2FZ1A 2XLFA 4K9SA 3EXUA 1QQP2 3MF9A 4XYXA 1TNFA 4GWMA 2Q8OA 2EXKA 1ZRCA 2WJSA 1DBNA 2PHWA 3O12A 3PLQA 4MUVA 4SBVA 4YW4A 4PIZA 1AX0A 4DQAA 1F9KA 5L7OB 4X8PA 3IM0A 2A70A 4D7TA 3WQ1A 4KWKA 1AR72 1AHSA 2DCZA 2GNDA 3C2UA 3IPVB 4UW3A 5FQ0B 3CNAA 5J7MA 2H0VA 2B45X 1VBD3 3AFKA 5CVRA 1U5IA 2MNGA 1SLTA 4IETA 5E8AA 4HL0A 1CAXB 2EVXA 1RUF2 5GM0A 2IXHA 2MEV2 2B46X 4YZ3A 5AVPA 3HMYA 1QDCA 2QZ2A 2ARXA 4OI4A 4FPOB 5JSOA 1I6XA 2VPVA 2DU0A 1ENQA 2E6VA 3M70A 1C28A 2YGMA 1MS0A 1ASJ2 3J8F1 4R4ZA 4E4SA 4KGGA 5HXVA 1SLAA 1D2QA 2WQZC 1ZZCA 2HWC2 1A78A 1OQ1A 1ND2C 1HQWA 3TBDA 4FCAA 3LSEA 4AI3A 2CWSA 1ZM1A 2R072 1MZEA 1OA3A 3H1YA 3MLLA 2ZACA 4H14A 2UY8A 3P3PA 3WQ7A 5JPNB 3OY8B 3THTA 1JTZX 2GU9A 1B35B 2HWB2 1IGOA 1H4GA 2WFF3 3KGLA 1MS9A 5CFCA 3HAGA 1DGRA 1VB2A 5GZDA 5HCFA 4QM9A 1MVQA 1XXNA 3WCRA 5FMOL 1ZBA1 1IS6A 2ET7A 4D94A 1FMD3 1PO23 4H7MA 2C9AA 5FMOS 4CDXA 2IFRA 1UPIA 1ENRA 1EAH2 2PAKA 3AM2A 3WHTA 1F8VA 1QWRA 3E5XA 1GZWA 4MGKE 1N1YA 2QDNA 5SV5A 5FOBB 3KLSA 4XFAA 3IT8A 1FV2A 1O4ZA 1OPOA 2GNTA 5KXDA 4QX5A 2WZR2 4PLMA 4GH4B 5JVVA 4WZFA 4CEYB 1PGL1 4YVSC 1H8TA 1N3OA 5GZCA 4QT6A 2FBEA 4Q0QA 2IC1A 5HCBA 2VGDA 1YO8A 5C6CA 1KFXL 4WV8A 1LEDA 4I0BA 5DUXA 2ZMNA 3LGRA 3USUA 4NWVA 1RL3A 5FQ0A 1LCLA 3VBRC 2V09A 4YRDA 3AP9A 2YZ4A 1CJPA 3O7OA 1RHI2 1S2BA 1A8MA 2AGSA 1NLSA 4OUSA 2IXLA 1AXZA 4M01A 1AR82 1G8WA 1RUG3 1H30A 1LGBA 1G6NA 4Q4X3 2RM21 3R4SA 1LEMA 2B9UA 1DYPA 2OIIA 1AR71 2P3JA 2VW1A 3AXEA 3ZFEB 4G9SB 4COUA 4Q8KA 2D98A 1YJLA 4JDMA 3AP7A 4QM8A 4Z8BA 1ZZ6A 2DCYA 1R1ZA 2VOWA 3ZDSA 2CY6A 3FJSA 2DFCA 1AUYA 2BVVA 3KT4A 4WZCA 3GZUC 3VBRA 2YC0A 2WLPA 3ME2A 3EBRA 3ZN6B 3UKVA 5LEJA 3JBG2 1PGW2 5KHJA 3ZSMA 5I0TA 4Y1XA 2ZS6B 3WG4A 4MXVA 2XJSA 2R061 3M3IA 4KWLA 2Q1ZB 1QF3A 1V6LA 4CP1A 2QNKA 1LRHA 5HBAA 1MVEA 1B09A 3LB9A 4K7JA 1CR7A 3VBHC 4YNIA 5JAXA 3GBFA 2NZ9A 3B69A 2KM2A 3ZXLA 4IV1A 2Y26A 3VLBB 2HWB3 3H3ZA 3NV3A 2XJRA 4QMAA 2OYZA 2WQ4A 5KHHA 1HQNA 3JZVA 1ZRFA 1I1EA 2RS52 4CDUB 2RS31 3WCSA 2KA3A 4LBQD 3E6CC 1YIFA 3IDBB 3BALA 4AVCA 4FP3A 5DUUA 3ZFFC 2D93A 1QQP1 1TQ5A 4TWTA 1WGPA 5FTTC 2GSYA 4OHZA 4DRVA 1O7FA 3IN9A 4A2UA 2GC2A 3AB0A 4XMIA 2O8QA 5K0UB 4XBQA 3ZMOA 5C4WC 1DQ5A 1NA1C 1RUE1 4Q26A 5JI9A 1LULA 1QJU3 4IV1B 1DYKA 3PJQA 3ZFFA 3ZFGB 3BTAA 2QJVA 5AFBA 3L2YA 2ZAAA 2VECA 1GZCA 2GMPA 1FI2A 3B5LB 2NMOA 4RA0A 3KB5A 4XFGA 4BE3A 1H9WA 1DQ4A 4CRQA 1IS3A 4N9IA 1ENSA 2Z69A 3VZKA 4KL1A 1OA4A 4Q2FA 4CDQA 1D4M3 4IEPA 4LT5A 3RDIA 5FCCA 3MPBA 2QUOA 4CP2A 5DDJ3 1QOTA 4M3CA 1LTEA 1XQNA 4ZU4A 1GANA 3IPVA 2NP0A 1WUVA 5BNOC 3E97A 3EO6A 1GZ9A 1ZVFA 4OLLA 2EF6A 4RS5A 4WVMA 3AJYA 5BY5A 1J1LA 4WBBA 4Q4W1 1UD1A 2C1FA 2AH2A 2WSUA 1RVF1 3S30A 3CLPA 3VBUA 5K0UA 4JGZB 3M3CA 4AVVA 2WA4A 4QQHA 2VUJA 2Z79A 4DPNA 1BEV3 1POV1 3WNXA 3H1MA 4CDUA 1NQJA 2RM22 3NAPB 4M0NA 4RL7A 3VHRA 1ZRDA 2HWF3 3E6BA 2WFF2 1RB8G 4AVTA 4BMBA 3MLKA 1O5UA 2WSVA 4KQ7A 5GLVA 2FHRA 3ZO0B 5GLZA 3GYDA 4EWDA 1M06G 1SLBA 4FPYA 1BQPA 4GMP3 2GN3A 4QPGB 1QDOA 1LU2A 1S0FA 4JQRA 4KH9A 2EXJA 1HDKA 1PZ8A 5I8SA 3WD5A 2A71A 1DG6A 5ABJA 3S6PA 4H3WA 3LWCA 5CFDC 3B02A 4NPRA 1BZWA 2WNVC 4AEDA 4GWNA 4LBLA 4B29A 1AXYA 4PDWC 1EY2A 2BBVA 1DGWX 1V00A 4LTAA 2C5DA 3GHMA 4IEOA 4LO5B 1AL21 3AZZA 3BU7A 3UJQA 1TMF1 1YFXA 1WCDJ 4JGZC 3VBFB 2CGPA 4EWAA 2HWF1 1FATA 1G9CA 2WNEA 1AF9A 4ES9A 5JZGA 4P9LA 4E4DX 1OLRA 4FPLA 1QKQA 3WDWA 4GMP1 4FOWA 1Q8OA 4PF5A 3AKSA 1VBA1 5KHKA 4Y20A 4Q4Y2 4NHKA 3AZWA 4LBJA 2PLV3 2I45A 3POWA 4AWDA 1WLDA 4XQDA 4MH0E 2GNMA 1N3QA 5BXXA 3J8F3 2VVDA 2ZKNA 1DLLA 1VJ2A 3NKGA 4R9DA 1HQLA 2VNOA 2XJTA 3PVEA 5IK5A 1W6PA 2WNVB 4HK9A 4C91A 2QDRA 2R32A 2DTYA 1C3HA 3ACLA 1OOPC 5T3NA 5A3MA 3KMHA 4GA9A 5CG9A 4D7YA 2YPJA 4EN6B 4L11A 4J6GA 3GZAA 1W6QA 1HLCA 5DG1A 3DV8A 2PHXA 1W6NB 2A73B 2W39A 5LRRA 5EZWA 4CZSA 3BODA 2HKXA 3QH6A 4Q29A 2R041 4U2AA 2GZWA 2XJVA 1D0GA 4UW5A 3V56A 1UN1A 5CFCC 4R8HA 5GALA 5KHIA 1WW4A 3RRDA 1PVXA 4FBFA 1PGSA 1CAUA 3MDPA 3ES4A 4RD7A 1CPMA 1CQ9A 2D40A 4GKXA 4BH9A 4YSFA 2VW2A 3X29B 1F2NA 5KHGA 1KJLA 1YNAA 2VQ0A 4A7YA 4NN0A 2P3IA 4Q4Y1 2DCKA 1KS5A 1MS8A 4YYOA 2ZGRA 5CNAA 1RVF3 3ZSEA 3VBRB 1MZFA 2DCJA 4OHYA 1MACA 4XOGA 3U0ZA 3B93A 1DZRA 3ZYRA 4Z1VA 5C8CC 4XJ9A 1MZ6A 1S0DA 4R9AA 1NCQC 1VBC1 2JECA 2HWD2 2GC0A 2VOKA 4AK3A 5I0SA 2W52A 4RQPC 1XU1A 2YDEA 5GLUA 2R49A 2RS12 4YW5A 4ITCA 1VBC2 1RMU3 1IZ3A 2HWE1 4AFCA 1BMV1 3J4UH 3D4KA 1G9AA 4YFWA 5DZGA 4C0HA 2BUKA 4GB33 3O0XA 2EAAA 2PQQA 1PK6A 5JLVA 2UWBA 1DGLA 4ZXKA 3U07A 3ZFGA 4XF0A 4CDXB 3VBSB 1OHFA 1FPN2 1AYM1 1UU4A 2QKDA 4LUKA 5C33A 1N1TA 2RMU2 3T1MA 4ES8A 2W0XA 2K2SA 1VBE1 1GFF2 3POSA 4FTBA 4OFGA 2W68A 1DU3D 2RR11 2YHJA 4YM0A 4RS5B 1TME2 1DQ0A 3QH7A 3E5UA 2LUWA 5ACA3 1HXS2 3KT7A 5IK8A 2P17A 2BNNA 4M0HA 1C4RA 1J59A 2ZGOA 3ETQA 3WP5A 3VZNA 4CDUC 1EV13 1K5MB 3AMMA 1R082 4IEUA 3RYRA 3C3VA 1X8EA 3ZFFB 4K1ZA 3ZYJB 3OF1A 2DUQA 3LSDA 4F83A 5C9AB 1W6MB 4AEMA 4IV3A 2I07B 1MEC2 3FX3A 5KBFA 2YXSA 1PGL2 4JCKA 2BNOA 1HXS1 1ULGA 2A6YA 3WT3A 1UZZA 4ONUA 4K40A 5FBZA 2WL1A 1SLIA 4KGQA 4RFT0 1EPZA 1R1A2 4WM8C 5GZGA 3DPRC 3WP4A 5LEKA 1QH7A 3T1LA 1H1IA 1APNA 1LGCA 1ZZ7A 4LUMA 2X29A 1COV1 2IXIA 2JE7A 3ILNA 4M3CB 1UW8A 4Q4V3 3U11A 2OUJA 4LHNA 2Z5WA 3WW4A 4YVWA 2R043 4JDNA 3POYA 1MEC1 2AREA 2WIIB 1D2SA 2ZABA 3KCCA 4IL7A 3TN93 3AMNA 1WCKA 4WVMB 3AXDA 1SCRA 3FBMA 1IPJA 3OTFA 2E7QA 3H0OA 4OUMA 4Q4X1 5AC91 3MI8A 3AZXA 4AF9A 1K5MC 1NCRA 1VRH2 3I4IA 3KD4A 4M00A 4XW3A 4YG6A 1MS3A 1ZBE3 1XRUA 2YGLA 4LA3A 3QLQA 3VL8A 1CN1A 4IXLA 2ATFA 5J09A 3TAYA 1TME1 3KSCA 3VHOA 5C9AC 1YRZA 2NPIA 1B35A 5J98B 2D7FA 4R9CA 1IKPA 2FZ2A 2ZGUA 3VZMA 1VBD2 1Y7BA 1SBEA 2QVSB 1I3HA 2ZX1A 4GB32 4JC1A 4X6QB 4CYDA 3DPRB 2ZX0A 1BBT3 3B01A 1H2MA 2GN7A 4QGMA 4FQZA 2XLGA 1XNCA 2E9QA 2XKPA 2ZKLA 4LBKA 4LBNA 2ENRA 5JZGB 3ZIWA 4AE2A 1W6PB 2MHFA 1NA1A 1PIV1 3B00A 4N53A 1LOAA 1ULCA 1KJRA 4ASMB 1SLCA 4XHBA 5FO8B 3HR9A 3FC0A 4X6RB 4R4XA 2WZPP 5J37A 4NHLA 4HKWA 2O0OA 3ROUA 3ZVXA 2D5HA 5GZFA 1HRI3 1AYN2 3O0VA 3HT1A 1W39A 1RUD3 3AZVA 4Z07A 3WLUA 4KWJA 4AI0A 3ZX7A 2RE9A 1AXKA 1OFNA 2QE3A 4K6BA 2E7AA 4ZU7A 2RR13 3N7KA 3PMEA 3SISA 5C4WB 1RJ7A 4YW2A 4IEXA 2BW8A 1GLHA 4IV1C 3LOBA 1PK6C 1JH5A 1SMVA 2E63A 4CTEA 3G7DA 4PDWB 3ZYGA 1QXRA 5BPXA 3NSTA 5BNQA 1SBDA 1W6OA 1FAYA 1QJX2 1GNHA 4KG8A 4QHBA 3N7JA 1VBB2 4LULA 3WXPA 1SDWA 4W6XA 1WD3A 1LENA 4C0BA 3HWJA 3DN7A 5ABJC 3IKWA 5J48A 5F9TA 2XGXA 4FAHA 1PM7A 2P3KA 2ZHMA 2ET1A 4NVPA 2A6VA 2BPA2 2RS51 5BYNA 3RMXA 3N35A 1JUIA 3VL9A 3ELNA 1D4M1 1E57A 4YM2A 3VBOA 2HWE2 3B9IA 4Y24A 1Z0HA 1V6KA 3QBQA 1LHOA 2BYVE 1ULEA 4MXWB 2Z42A 3THPA 4ZKTB 5DUVA 4EN8B 2RS13 2SLIA 4Q8LA 5JI7A 2X5IA 1UX6A 1PK6B 5FRAA 4RGGA 1QXJA 2W08A 5AC92 3SMHA 2YV8A 3M7AA 2ZX3A 1UL9A 1MQTA 4XFFA 2D5FA 4I0AA 2WS92 2F6BA 3VZOA 1LECA 4MGZE 3INAA 2B39A 1FPN3 3AX4A 3DF0A 4AW7A 3CJIC 2LM3A 2GAUA 4GB31 3LCPA 5H9RA 5F5QA 3GNEA 4CEWA 2BEOA 2ZGQA 4W65A 5BNOA 1VBD1 2VOVA 2O8OA 3FLRA 2JENA 5I93A 4LEJA 1RUG2 1CPNA 1AL0G 2DVAA 4XBNA 1NG0A 2G9FA 1FOD2 2NN8A 2NQYA 4DINB 1TME3 1PIV2 4EV0A 4N43B 3VBHA 1GR3A 5CFDB 1G9DA 4C1XA 5EJ3A 3SXWA 1VBA2 1HRI2 2Q30A 2ZGLA 1ULFA 3RYKA 4HSLA 4FOYA 4MV2A 3TWIA 1S0EA 3ZXAC 3R0RA 5H9PA 1RUC2 2CYFA 3JBG3 3SLIA 2E51A 5GKAC 3ES1A 1FV3A 1RUNA 1HRI1 4MXWA 1AYN1 1DIWA 4FT8A 1JW6A 2XHKA 5KWRA 4Y1ZA 1OD5A 4FOQA 1LODA 3N3HA 1L3JA 1G9FA 1R1A3 1VALA 2K0GA 2ZGKA 5T5LA 1MR5A 5A32B 2DUPA 1ULDA 2WKKA 2ZZQA 2Z2SB 4TYSA 3AKTA 4Y22A 1MZ5A 4YGCA 4Q4V2 4MX3A 2A75A 3OCPA 1MQTC 4CEWB 4AVAA 4WVZA 5JPMB 1QU0A 3PVNA 2OVUA 1ENXA 1IHMA 3NKTA 1OKQA 1VRH3 3WDXA 3APBA 3H1WA 5FREA 2GMEA 1WW5A 3RZZA 1C5IA 5LK5A 4AQTA 3MW2A 3L9JT 1PZ9A 1BCXA 4H7LA 1YCIA 2XBO3 5I0UA 5I91A 1RITA 3KM5A 5JOWA 3CJIA 2VUAA 3WG2A 5IT6A 1N47A 2JD4A 4F7ZA 3AJZA 1ZYBA 3VHNA 4UW4A 1QMJA 1UU5A 5F1RA 2BWCA 1V6NA 1V9U3 4IEYA 4XJ8A 3WINE 4XDQA 4K8FA 4PBOA 1S2KA 5FOJB 1DDLA 4CDQB 2VNGA 4XJUA 2X8KA 3KZ4C 1H2KA 2JG8C 1BBT2 4XMAA 1ZBA2 4BOWA 2D6PA 4FQ4A 2HEVF 2ZOEB 4RQPA 2VQAA 3UV9A 2DURA 2F4PA 3VV1A 3MIFA 4AEDB 2WT0A 4H55A 1DZQA 1Y9QA 1GQGA 4Z92B 3VBUC 2GC1A 5T52A 2IWGB 4P9YA 1Q43A 1AJKA 4GH4A 5C8CB 3RYPA 3PJYA 3O0WA 3VBUB 1AYM2 5J36A 3B94A 4M3CF 1X36A 3ZIXA 1XYPA 4EROA 5JSPA 1OQDA 1R091 2R6QA 2WA3A 2WWSA 4EN9B 4L97A 5T54A 1YI7A 3J8F2 4OI1A 3WUCA 4JGYB 1XNDA 1GNZA 3VBSA 2D3PA 3CU7A 3URFA 1AL23 5FO9B 2XVLA 5B2GB 4Y4YA 2ZGNA 4E4ZA 4TSVA 2ZX4A 4JGYC 2XH6A 2D3SA 1QJX3 4MLOA 3VBOC 4XXPA 5E1RA 4CDXC 4FSJA 4N53B 4PDWA 1LB2A 2XWJB 1UAIA 4Z82A 4AG4A 1LOCA 5BNPB 3ZXDA 1CJDA 1Q8PA 1ZZ9A 2KXLA 2VNRA 1PO13 1BEV1 1NCQA 2I74A 4SLIA 2LALA 3VKMA 2VMGA 1LKNA 2ES3A 3ZSKA 4AQ2A 1BYHA 1RINA 4N90A 3MFAA 3PNAA 3LOIA 4D3WA 1QHDA 1QQP3 1H2NA 2EXIA 3GZTB 4ASLA 3LA3A 3VKOA 3RWNA 1LHNA 1RUE3 1TMF2 2DVFA 2X5IB 4O9EA 2DFBA 3FLTA 1FMD2 3N4MA 2XKOA 2D44A 3SCGA 4LR4A 5ACA1 4Z2WA 1O4TA 3SH4A 1KDMA 1NE6A 1Q56A 3ZYPA 5T5JA 1HV0A 1H1MA 4F8AA 1VRH1 1SCSA 1CVNA 2XUMA 4OHXA 1PNFA 1LHVA 4QD2A 4B8EA 1QJU1 3ZXJA 1IQAA 4XIOA 4GKYA 1ND3A 4FPEA 4QGNA 4RR3C 5HCAA