4LK6A

Crystal structure of pseudomonas aeruginosa lectin leca complexed with chlorophenol red-b-d-galactopyranoside at 2.86 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PA-I galactophilic lectin
publication title CH-pi "T-Shape" Interaction with Histidine Explains Binding of Aromatic Galactosides to Pseudomonas aeruginosa Lectin LecA
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 22
structure length 121
sequence length 121
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2013-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4lk6A00
1W8WA 4CPBA 1WZXA 1OH3A 1W8UA 3F95A 1W9FA 2Q1FA 4LK6A 2K46A 1L7LA 4CP9A 3UT0A 1W90A 4CPBD 1OKOA 3ORJA 1GWMA 2C24A 2WYFA 4LKFA 4BQ3A 4AL9A 4BQ2A 2LROA 2LRPA 1GWKA 1WCUA 4YW6A 3ZYBA 4YW7A 2KR2A 4CP9B 1V0AA 4A6SA 4BQ4A 1HN0A 1WMXA 1W8TA 2VXJA 5D21A 4BQ5A 2JWPA 4YWAA 2O14A 1GWLA 1W8ZA 1UOJA 4LJHA 4LKDA 4LK7A 4LKEA 3ZYFA 3ZYHA
chains in the Genus database with same CATH superfamily
1IPSA 3L9JT 5FFOC 4XXPA 3SKVA 1OH3A 1W8UA 4HXCA 1G9FA 1RUD2 4CDUC 1VR3A 2W46A 4M3CF 1LTEA 1OXCA 2W0XA 3BYWA 5FKCA 5FP7A 3UT0A 5C70A 3PJYA 5CYYA 1AX1A 4QHBA 4BMBA 1GP4A 5HBAA 4MGTA 3AMMA 2LS6A 1IG3A 3MLLA 5SV8A 5KHGA 4H7LA 2PMWB 3ZMNA 1CAXA 3FE5A 2Z69A 4NVPA 4B1LA 5C4WB 5IATA 3PUHA 2VUAA 3T0BA 4CU6A 3V0AA 2JDZA 3IPVB 1AR81 5F5CA 4OHZA 2B4KA 4YFWA 2WQ8A 3E6BA 3TRSB 2YYOA 3A4UA 4FPOB 4QPGA 2XQRA 1K5MA 4RGAA 4YVSC 2V73A 3RMXA 3Q8BA 4YPJA 2W39A 2CWMA 4PDWB 1XRUA 3AP6A 3PUIA 4YGBA 1GOGA 4JGYA 1DHKB 2X5IB 2FDKA 3ZYIB 1QY4A 1LODA 5AC91 2MEV3 1GZCA 1KS5A 1RUI1 2C9AA 3ZMOA 4AZZA 3NMBA 5ABJA 4HK8A 4CCDA 3RMYA 1Q3EA 4LNVA 3T2TA 1W6QB 4BM8A 4QU1A 5FZ1A 1RUE3 3AL5A 5F5IA 2WO7A 1YC61 4HN1A 1UYPA 1UMZA 1G6NA 3N9NA 4XUQA 1OFSA 1AR92 3BU7A 5CFDB 1YLLA 4R9CA 2HKXA 1YO8A 1AR63 3DYPA 4OZXA 4GWNA 1UU5A 3J7NA 1WZXA 1VBD3 1COV1 1QOSA 2B9UA 5CG9A 4G9SB 4R4ZA 3WG3A 1V9U1 4NIAA 1W90A 4COUA 4QX1A 5C3SA 5GZGA 2VOVA 4IETA 4A3XA 4QQHA 4D0QA 2JE7A 3PUAA 5KXBA 2CAVA 1PM4A 5ACA2 4X6QB 2TNFA 1FOD3 4A7KA 2CL2A 2FDIA 3JBG1 3RJRA 3RNSA 3GYDA 3J4UH 4V2VA 1JW6A 3D0SA 4E9KA 4R8HA 3LIHA 3OPWA 1LOEA 5I0UA 3MLKA 3FZ3A 1Q43A 5FXXA 1YI7A 3U14A 1I1EA 4IE0A 4YVWB 3VKMA 4J1XA 2E26A 2R32A 3M70A 2A6YA 1ND3C 1OD5A 3OGVA 4IV3C 5EIYB 1TME2 3VBRA 4ORFA 2Y26A 3VL8A 2HWB1 4V2WA 4RQPC 4K8RB 3H8RA 1JYWA 3CBNA 3KV6A 1APNA 3CEWA 4FPGA 4L92A 4QT6A 4N7IA 2JICA 3ZN6A 4AEDA 4HZFA 2IXCA 5LASA 1LU1A 3AJZA 2A3XA 3AL6A 3JQXA 2ERFA 2OUHA 3CHXA 3S7EA 4LEJA 3VBUA 5DG1A 2DFCA 2R1BA 2W1QA 4ZONA 2R0FA 1GWLA 3PURA 4AVVA 1UYYA 2KXLA 1UQXA 4WM8C 5GZFA 3GNEA 1C8NA 4TN7A 3UK9A 3WINE 4YZ3A 5DAVA 3VB9A 1QH6A 1VBC2 3ZPYA 4HVRA 3E6CC 4COZA 4FXKB 3VKNA 3D6EA 1AR82 4Y5SA 1WA6X 5GLUA 3V0BA 2JE9A 2DVDA 1SEFA 1LJ7A 3SH4A 3FUQA 3MHZA 4INDA 2WZPP 3CJXA 2VMEA 3SC7X 1OLQA 1R1ZA 4DY5A 1UPSA 2WAAA 1DGLA 3AKSA 3LA7A 1DQ1A 2IWGB 4IE6A 2BERA 4LBQA 2P3JA 5C5TA 4XF4A 4BQ4A 1QXRA 1JU4A 2EAAA 1GNZA 3C7FA 1RUI2 5LA0A 4AHWA 5B4XA 4CEWC 3AKQA 2PHUA 1D7PM 1MS0A 2GNBA 2R0HA 2VM9A 2PHRA 3DKWA 3PU3A 5FMOS 2RM23 2E63A 5FCCA 1SDWA 3PTYA 4O9EA 2EXKA 4LPLA 1FATA 5LRSA 3RRDA 2ZEYA 1RVF3 4CPBD 5IFPA 5FUNA 3B3QE 2HEWF 5KHHA 5A3MA 4UI9L 2XKPA 3MBWA 5FQ0A 3FC0A 4FP2A 4R9BA 1PMHX 1PK6B 1W06A 2A7AA 4NWVA 5CVRA 4FQ4A 5LBFA 1U5ZA 3C7GA 4FO9A 3B69A 1JYCA 2ZTNA 3C3VA 1ZBA1 1XOYA 4AI2A 5C3QA 3K51A 3MW2A 3VD5A 5IHRA 3HNBM 1CPMA 4K6BA 4D7SA 1SPPB 1PX3A 2QFEA 3NJZA 1XQNA 2PLV3 1LOCA 4QDRA 1TG7A 1HQLA 1VAKA 4SBVA 5HPOA 3VD4A 4MSVA 5D2AA 1AJKA 3BTYA 4CEYB 4JCKA 4OQ8A 1S4CA 2DU0A 1CX1A 2IZWA 4YW3A 2JB8A 2G9GA 4CCOA 2Q8EA 4DUXA 1D4M1 2W91A 5K0UC 1WW7A 1REDA 3JB8A 2B39A 1V6KA 5JIUA 5FYSA 1AZDA 5G04L 2Z79A 3QCWA 2AZ5A 3APBA 3I2KA 2WZ8A 1V6OA 3W5MA 3FHIB 1N1VA 1WCUA 3GGLA 4YW7A 1NXMA 2D6MA 2RJ2A 5E6HA 4AI8A 5LY2A 4NRQA 1H8TB 2HWB2 2XUMA 4MXWA 3U37A 5J36A 4NIDA 3ZXJA 2XKOA 1PZ8A 2AYHA 3IDAA 4MADA 4Y20A 5ANQA 4RSUA 4GZ9A 2R072 3POWA 4DS0A 4XIOA 2EICA 3VDCA 2V72A 2Z2SB 4CP2A 2NP0A 2JDUA 4YZ1A 4Y26A 4PI0A 2XJTA 3ZXEA 4M3CA 3AZXA 1PIV1 2V4AA 2AGSA 2IFRA 1I9RA 1Y43B 2BOJA 3LFIA 3B94A 1K45A 2VTFA 2WNUB 5F9TA 1NCRB 2R041 4AGRA 4CU9A 1C28A 2QTWB 2GMEA 4LA2A 2BNOA 1GNYA 1VRH1 3N7MA 4AXOA 1UD1A 3HD8B 4XFGA 3RJ2X 3SEPA 3AZYA 3VDDC 2OW4A 1EAH2 4Q1PA 1G9DA 1VB2A 1AR93 1XXNA 2HWF2 1HV0A 1Q8PA 1SZBA 1OOPA 2DF7A 1ODNA 1UN1A 2QQLA 2XLGA 1KFXL 3M2MA 4BK5A 1ENRA 2J1SA 2JIGA 1RUH1 3ACGA 3GZAA 4DRRA 5HCFA 4KQ7A 4E8DA 4MGIE 5JI9A 4YGEA 2LTNA 5KBFA 4GA9A 1ZZ8A 2EXIA 4YG0A 3FL7A 4D6RA 1A8MA 3N4MA 4Q4X3 3CF6E 4WM7A 1LGCA 5FZ9A 1H0BA 1WMFA 2D3RA 3UV9A 4MUVA 5LEJA 1FNYA 4XFCA 1MS5A 4NHYA 3B93A 1VRBA 3NNGA 2Z5WA 3Q8CA 5C9AA 5CKNA 4DZGA 4MO3M 3POGA 2ZEZA 5CFCA 2ZKNA 1DBNA 5HV0A 2PAMA 3TB0A 1TME3 4AFBA 2AREA 3HNYM 4XOGA 2PYTA 1NLRA 3N7KA 5A33B 2AUYA 4GJYA 2H0BA 1IQAA 2D3PA 4FPKA 1AX0A 5I8YA 4UW5A 1O91A 3ES1A 4PLOA 1D4M2 2VPVA 1BEV1 3FFQA 4N43C 2RS11 1H1AA 5L7OA 4QXHA 1XC6A 3ZYGA 3ZM8A 1EUUA 2WFF1 5DAPA 1W04A 2JX9A 5FZAA 1GBGA 1OLRA 3NV1A 3POJA 4LE3A 1BVP1 1PO12 3BOWA 4LIVA 5FUPA 4XUPA 2VD7A 3UJOA 5JIAA 4DEVA 1KFUL 2VECA 3WDVA 5KR7A 1NA1C 2B45X 5DAXA 4PQQA 4LBJA 4WZFA 5C7GA 4QKNA 5A6XA 4ZY9A 4RS5C 2BDRA 1NG0A 1WLDA 2IVIB 1FMD1 1AR83 1NX9A 3ASIA 3U4XA 3OEAA 3BODA 3O12A 4OUEA 1YFYA 4OI2A 4BJ0A 1DZTA 3DECA 3J7LA 4K8FA 5IVJA 2WBKA 4AF9A 4UFIA 2V4VA 3MPPG 1IPJA 3H3LA 2ADDA 2CNAA 1W6PB 4IW3A 1JZ4A 2WT0A 3I97A 4JTOA 1YWKA 1W8NA 1WA4A 4M00A 1PIV2 3DKQA 3LKJA 4RA0A 4W65A 4C1WA 1CR7A 5BYNA 4ZU5A 3OOXA 4Y3OA 5FY7A 1VJ2A 2RS52 1I5ZA 5T3NA 4A7YA 5AC93 2CWSA 3UKNA 1RUI3 1UY3A 2A6VA 3I54A 2ZHKA 4HOOA 2CGPA 1VRH2 1JU3A 1TNFA 4HN0A 5KWRA 4B8EA 4CZSA 4QDQA 1PGL1 5I0DA 2CSGA 2NQYA 2JDPA 2XL7A 4LBOA 4YRDA 3QLQA 3E5QA 1YXWA 2O0OA 3JXSA 1ND3B 3C2UA 2VMCA 2TEPA 4ASLA 4NPMA 2CYFA 4OZOA 4QPGC 4XHXA 2XJVA 1K5MC 2XR4A 2D93A 1V6IA 3ZYRA 1COV3 4W4ZA 1L7RA 4LO8A 1UXZA 4S2HA 3POFA 3UGFA 4YFZA 5A32A 4LOSA 4NHKA 3SQOA 3VD9A 1V9U3 5JI7A 4JGYC 3AB0A 3FUOA 2ZEWA 4LMFA 2YMZA 2GNTA 3AZWA 4URAA 3D3AA 3TN91 5ABJC 1FV3A 5F6KA 4EWEA 3H8XA 1NZIA 1E5HA 1V6NA 3BIEA 1XE7A 3OUIA 2YY1A 5A80A 3JBG3 4WM8B 1Q56A 3N9PA 3ZFGA 4YG3A 4YW1A 2OA2A 3M3QA 2XONA 4XBQA 1WCDJ 1X8EA 3HOBA 2PQQA 3OYWA 4PCRA 4V1PA 1FAYA 2YPDA 5FY5A 4CCCA 4QPIA 5JZGA 4LBNA 3WG2A 2D43A 2GC1A 5FZ3A 4CDQA 1Q8OA 3PVEA 4LULA 3VBFB 1LOBA 2ZZQA 2D6OX 1QU0A 2FCVA 1Y7BA 3POYA 4JV4A 3ZXKA 1O5UA 1UX7A 4WVMA 4YGCA 3KM5A 4AYUA 4P9LA 2RJLA 2ZJCA 1YCIA 3D8CA 4QPYA 2HWB3 5JCTA 2VMHA 3LCPA 4PIXA 1U0AA 4CDWA 1LB2A 1OQDA 3FN9A 2V5YA 1AUYA 1UIKA 3LEMA 1BEV2 2D98A 4KBBA 3THTA 2C0ZA 5IW0A 4Q8KA 1ZBE1 2W87A 2F6BA 4K21A 1O4ZA 4CEWB 2XQXA 2WFF2 3SH3A 4CUAA 4C90A 4XHBA 4KU8A 5EJZB 4JQRA 5FZLA 4YW6A 3VHRA 2WZR2 4QX0A 2ARXA 4XQ4A 5IYYA 4OFGA 1QF3A 5A7OA 5JOYA 5FZEA 1N47A 2JECA 1K12A 2PA7A 5GLTA 1KJRA 2YGLA 5JR7B 1LOFA 5FYZA 3AMHA 1FMD2 3VBRC 3WDXA 2JDAA 4XAAA 4WVVA 3QACA 4Q5OA 3KT1A 3RZLA 5DMYA 2QZ3A 4BA6A 5JWPA 4OYUA 4O9GA 3NV2A 4JGZB 1RXFA 4AEDC 4QWNA 2Q4SA 2XWJB 4HPKA 5SV5A 3HBZA 4ZXKA 2UU8A 1GP6A 5F3IA 1OC1A 2GNMA 3VBUC 5KXDA 2W95A 1QQP2 3N36A 4WVWA 4HANA 5FRAA 2ARAA 1PMIA 2CGNA 4HT1T 4FPFA 5FLHA 4C8DA 4XZPA 2VCMA 1XE0A 3J26N 2GMMA 2LUWA 2Y6FA 5JR2A 2VUDA 5FAXA 2E51A 2RE9A 3ELNA 4Z92B 2WN3A 5BNNB 1S0JA 5A3OA 1ZREA 2XGXA 4NHMA 4Q8LA 3ZSJA 1OF4A 3WW2A 3CNAA 2VGDA 4M0HA 5E88A 3VZLA 4MYEA 3ZPOA 2EA7A 1AJOA 2DUQA 4LO7A 4PT6A 5F39A 3UGGA 5FZCA 4CP1A 2WINB 5T5PA 1ZBA3 4W8JA 5A7QA 3AYEA 4NJ4A 2DCYA 2GP3A 1QDOA 2HWE2 2BZDA 4XURA 3TN92 1LENA 3S30A 3OCPA 3OY8B 1W9WA 2R16A 2EAKA 3VZMA 4XMIA 3H8UA 5CKQA 1XJAA 2WNVB 3KT4A 1SBDA 1D4M3 3A0KA 2VOXA 3RZMA 3VKLA 2JG9A 5KC5A 1B35B 2ZMLA 4FPLA 1O5LA 4J6GA 3I8TA 1GOHA 1UAIA 4E2GA 4M0NA 1DQ0A 1QJU1 1M4WA 4IV1B 2BFUS 1POV1 2GDFA 4L9BA 1P8JA 1ULGA 3NKGA 4IESA 2QQIA 1RITA 2RV9A 3ROUA 4K40A 1O4TA 1OUSA 2XJSA 1O4YA 5KHKA 1QWRA 5LB6A 2JWPA 4GMP1 5I8TA 4KGQA 4OHWA 1YFXA 5C8CA 1ZBE2 5C6CA 1XU1A 1TZOA 4NO4A 3TNPB 2QBXA 4DB5A 1JN2P 3KCCA 3QD6A 4FFIA 4ONUA 2WRAA 4IQPA 5IVCA 1VBE2 2J7MA 2R061 1Z78A 1PIV3 2A71A 3ZOIA 3THDA 1QJX2 3RI8A 3QBQA 2ZA9A 1JYIA 1NQJA 4AE2A 4GB31 4EE2A 2R043 1FX5A 1H4GA 2Q8OA 2QQMA 2K0GA 2ZGSA 1VRH3 4XTPA 4AQ2A 3KLSA 4UWDA 5L19A 4X6RB 5FP8A 2VBDA 1QDCA 2VMDA 4XZUG 1IS6A 1RUG2 3E5XA 4HMZA 1IPKA 1HN0A 1RUD1 1W6MA 2JDYA 4HBNA 1WCSA 5I93A 1S55A 3AVRA 3N9MA 1QOOA 3CJIB 2D6NA 1STMA 1QKQA 5FP4A 5T54A 4MHRA 1HQWA 1WBLA 4C0BA 2XG3A 4Y33A 1GV9A 4XJ9A 4Z2WA 2EXHA 1XNTA 3VBOA 3VBSB 1RUH3 2ZAAA 3IAQA 1W0OA 1LGBA 3PMEA 4PBPA 4QXBA 2AEZA 4ISRA 3UYJA 4EV0A 1L7QA 3GHMA 1SBEA 3K3NA 1H1MA 5LATA 4F8AA 4D7TA 4M4PA 3KF3A 2ENRA 3SCHA 3W58A 4EN0A 2BQPA 2CU5A 2ZHLA 5HCBA 2W1WA 4PIZA 2FDHA 4N7UA 4QU2A 1MS8A 1UKRA 1UL9A 4K9SA 3ZXDA 4RS5B 5FDBA 1LU2A 2JB4A 3UJQA 1SCRA 1AYN1 3ZYFA 5DUUA 2DUPA 1JZ2A 1OOPC 4MG2A 2G9FA 3T1MA 1QXPA 1MS1A 2UY9A 2VCAA 3K46A 3VHNA 4F3JA 1L7LA 5EJ1B 5AFBA 1SHWB 3WCRA 4DXSA 5IWFA 5KXEA 4Q4W2 5IFTA 3O14A 1JHJA 1R091 3OGGA 1CZVA 5BV6A 4TWTA 3WV6A 1H1IA 4Y4RA 3WNKA 5FZ6A 2WNOA 1BEV3 1NYWA 2DWRA 4WM7C 5J96B 4Y22B 2RS13 4PQ9A 1AX2A 4Q26A 1IS5A 2UWBA 1XBFA 4XF1A 3ZDVA 2WFF3 5FUIA 3M1HA 5I91A 4BHPA 1GZWB 2A5ZA 3SLIA 2QDNA 5C9AC 3ZFFA 4XF0A 3RG0A 2B7YA 2HBTA 4LKEA 4AGVA 4ZZ8A 4RR3A 4NN0A 3GF6A 1UCXA 1W6OB 4BWOA 4LA3A 5BNQA 4BQWA 5H9QA 4L97A 4AVBA 5CFCC 1UZWA 4XC9A 5ACA1 2VMGA 1DDLA 3CDZB 4XDPA 5HCHA 1FMD3 3MIGA 1JYVA 5CEHA 1MZEA 4QPGB 4FTBA 1JS9A 1D4VB 2YXSA 4GQ7A 2KM2A 1POV0 3RYKA 1US2A 3I2FA 5FXZA 4B4QA 4QQOA 1V6MA 2WDBA 3HAGA 4JVAA 1OBNA 1RUF1 1UOBA 2R062 3KB5A 1QJEA 2GSYA 2ZGMA 5L7OC 3NAPA 1DLCA 1ND2A 3LAGA 3PVBB 4GMP0 4OULA 5FJKA 3L2HA 3ZR5A 5CU1A 1MQTB 3ZSMA 1AR72 1GANA 1I6XA 4LE4A 5KC6A 4EN7B 4Y5TA 1OPOA 1UW8A 4BLJA 5T5JA 1ENQA 5IVBA 1H9WA 5HXMA 3B9CA 1O3SA 1UZYA 1URXA 3ILFA 5BNOB 1ACCA 5A3PA 1IS4A 1GZ9A 4FFHA 4NRPA 3VKFC 3ES4A 3VZJA 1RUNA 3GALA 4YG6A 2JIJA 5E16A 2PN5A 5BUVA 1NAEA 2VZTA 3HEIA 5K4LA 1VBC1 1Q8SA 1CAUA 1O59A 2J1AA 4MGQA 5E89A 4I01A 2A6WA 2VG9A 5F5QA 3WDWA 4I0WB 2VZPA 4KWUA 1YQ8A 4BISA 4XQDA 5FK8A 3TN93 4W50A 1XB9A 3DEMA 3QH7A 5IUQA 1VBA1 3LDRA 3TOJA 5FYUA 4QB6A 5ISLA 3KF5A 1UPIA 1S0EA 2P6CA 5FY9A 5FLIA 1C8M1 1E5IA 2JXAA 4CUBA 5IAXA 1DLLA 1N3OA 1RIRA 3PIGA 4MVTA 4IGOA 4EYUA 4WVZA 4TXWA 1WLCA 4MGKE 5IAVA 1AYN2 3KQ4B 2QUOA 1Y3TA 3AZVA 2ZGNA 3POIA 1JZ8A 3I49A 3KCYA 1DYPA 1WW6A 4Y5Z0 2RDSA 1QJZA 2R7EB 1UNBA 2WT2A 3C8XA 5D8AA 3FLRA 2A3WA 4XFHA 2C6SA 1W9TA 2OZJA 2PHDA 2UWAA 1JZ6A 1R092 2YZ4A 1FYUA 5A3WA 3ZN6B 4XUOA 3WX5A 1AHSA 1LCLA 4NHXA 4GXLA 4XACA 1W0PA 2D3SA 4GWMA 2I74A 4CTEA 3I3BA 3AP5A 3VDBA 2PAKA 1ZBE3 2XBO1 2WNEA 4ARXA 2F4LA 2XLAA 2CGOA 4NRMA 5J98B 3ZFGC 2VZVA 1OKOA 2PFWA 2VXRA 1OI6A 4I30A 4YARA 2ZEXA 5K9YA 1O8SA 4QKFA 3NNMA 2RR12 2ZGPA 2ET7A 4Y1YA 1DQ4A 1JI6A 4Q0SA 5HCAA 3LB9A 4Q0UA 4QPIC 5JZGC 2ORZA 5EZWA 3ZXLA 2OZ6A 4H55A 1PVC1 2BU9A 3B02A 4CDQC 3U0ZA 4XABA 2BBVA 1HXS1 3R05A 3WQ7A 2TUNA 3GJBA 2JDNA 3IN9A 1GP5A 5GZDA 3V56A 2D6PA 2W94A 4AW7A 1FV2A 2A75A 3H3UA 1H6XA 1MEC2 2FMYA 3TWIA 4UAPA 4CE8A 4CDWC 4NHLA 1SBFA 1BCXA 1RUF2 1WBFA 5FZ4A 2P34A 2XHKA 3I3QA 5C4WA 5T52A 5B4NA 5JSOA 3VLBB 2OUJA 2W1UA 3HQUA 2E7QA 5FZBA 4ZHNA 4L2NA 1CAWA 5L9VA 2OPWA 2WAOA 1S0IA 3IPVA 3NV3A 3POSA 4AFMA 4D6SA 2BGOA 2WABA 1ZM1A 3BPZA 4XFBA 3BCWA 3VKOA 3CLPA 1YFWA 2QE3A 1YHFA 2J1EA 1OLMA 2P4EA 4FT8A 1S0GA 3OPTA 4CP9B 5BNPB 1WLTA 1ZRIA 2RG4A 2WIIB 2X29A 3MIEA 4M01A 1K42A 1LOFC 2VXJA 4N9IA 2R071 4PDWA 4BXFA 4QDSA 1NCQB 1ASJ1 4Q2FA 5FWJA 2X5IA 3ACFA 4E4DX 1BVVA 1NLQA 4AI9A 2ZXQA 4XE9A 3V64A 3ZYHA 3I2HA 3I4IA 3A7QA 1VBB2 2BEOA 3ZFEA 4P9JA 5FY0A 4JQTA 1TEIA 2NN8A 5H9RA 3TNQA 1W6QA 3D5OA 2QQUA 3THPA 1J83A 3ETPA 3LWCA 1RTVA 1TNRA 1F4HA 4KBZA 3OB8A 4Q1RA 5J48A 4CDXB 4K20A 3WG1A 1S2KA 5CFDA 3IIAA 1BLZA 1VBA2 3BIWE 3OG2A 4LO4B 3N7LA 5J7MA 5EV7A 3O1OA 1EAH1 1KDKA 1C8M2 1Q8QA 1ZZ7A 2HWF1 4QB2A 4HVQA 2WR9A 5C5UA 4IEOA 3WP4A 5C33A 2BNNA 1MZFA 4J1WA 3AKRA 1W2TA 4FPCA 1RB8G 1W03A 1UX6A 4LBKA 2V5DA 5FYBA 2Q1FA 1QJU3 3AFKA 4AEJA 1POV3 3CO2A 2DYCA 2ZX2A 3S7IA 5DUVA 3MO4A 1EPZA 1UKGA 1VMHA 4RL7A 2P37A 5AVAA 1R081 4S2GA 2CDPA 4XIKA 1JZ7A 4GMP3 3HVDA 3I3EA 4YVWA 2QVSB 2XBO2 2DUOA 3OBRA 4A6SA 3UKTA 2JENA 1DCSA 2P6HA 1Q5OA 2WKKA 2WQ4A 3HT1A 3P5BA 2WSVA 4R52A 3O1SA 4XJUA 1G9AA 1NY72 4LBQD 2R063 3U11A 3MIHA 1GNHA 4CP0A 2K9ZA 1W9SA 3IDCB 2ZMKA 2MNGA 4CXYA 4KNCA 1UOFA 1PVC2 4GB33 4AK3A 1NE6A 4QKBA 1HXS2 3X29B 1CVNA 4L11A 1ULDA 2XDVA 4I2OA 4K3UA 5DDJ2 5A7WA 2HH9A 4GKXA 2WSUA 2QCSB 1VB4A 3IM0A 2FCUA 2IXIA 4GWJA 4I09A 3ZIWA 3U1XA 1RUD3 2OYZA 3WHTA 2R6QA 4P9GA 1A3KA 2AR6A 3M4FA 2NM1A 3VHPA 1OOPB 3BVCA 2AEYA 1PO11 3CKHA 1H6YA 1HRI2 1W05A 5G05L 5C8CC 2VJXA 4LQRA 3O0XA 5CISA 1W8TA 4GALA 2WO2A 4HONA 4RGGA 4IE7A 4P14A 4OVEA 3B7MA 4F83A 1C4RA 1V00A 1JYXA 1VMJA 1T2XA 2Y8KA 3SNMA 3LEKA 4LBMA 4QQPA 5GM0A 4O65A 1ASJ2 1LNSA 4FFFA 1X50A 3IAPA 4HSJA 3ZYPA 1SMVA 3PUSA 3SHRA 1RUJ1 3DGTA 4QKDA 3ZSEA 1U12A 2Q1MA 1X33A 5EXOA 2RS51 1JODA 3HNMA 2NZ9A 3PLQA 3T09A 1AYN3 4O7XA 4GH4B 5FPVA 5BY5A 1OVPA 1J59A 1DGRA 4XUTA 3T30A 1TVGA 5FBZA 3VBOC 2YC0A 5CA6A 3IWZA 1R093 3LE0A 4BPZA 2EXJA 5F1RA 3A0NA 2KA3A 2VZ1A 2XHNA 4GWIA 2H6BA 4YW5A 3R6SA 4E4ZA 4MH0E 4Q29A 5LCWL 3WF4A 3AXDA 4BQYA 4AWDA 4RGKA 4A41A 3MI8A 1ZRFA 4NIHA 1SPPA 2EIDA 3O1VA 4EJRA 3K4ZA 4YM1A 5JSPA 4Y24A 5JUVA 4JDMA 3DYMA 3JZVA 1S2BA 3H7YA 3A23A 4P9WA 1LESA 4YGDA 5GALA 2Y33A 1LEMA 3H8OA 4CDUB 2Q0AA 1XNBA 3T4HB 3KHCA 4LKDA 4P9XA 5ACA3 1R082 3V65A 3WOGA 1H2KA 1UYZA 3ZXGA 4YM3A 1LAJA 1KEXA 3ACHA 1XSRA 1NQDA 5EQUA 3TEWA 1CAVB 5AFEA 2XOMA 4IERA 1TQ5A 3EJKA 3TEZA 1RUC1 2YB7A 2UWCA 2WN2A 1RUF3 1F31A 2W92A 4CU7A 2MPFA 4NPRA 1MVQA 4ZZ5A 2VW1A 4YVSB 3SCFA 1WW4A 2Y34A 5JDBA 3ZFFC 4Z82A 5LBBA 1LEDA 3H0OA 3N9LA 3DCQA 1QOTA 4B7KA 1SFNA 2OQ7A 4HLTA 3GCWA 2VW0A 1ZZ9A 4RR3C 1M06G 1RXGA 2CHHA 3VD7A 1WMEA 2Z4FA 2D40A 4BU2A 1LR5A 1DF0A 4XFFA 3F95A 3ZYJB 2O8QA 5JMCA 1PVXA 4EWDA 2WZR1 2WNUA 1NCRA 1OA3A 1UYXA 2QQOA 3USUB 3WP5A 5JVVA 5EYXA 1VBC3 3OGSA 2QQKA 4RFT0 2BW8A 3I2IA 3KVBA 4FOVA 2NMNA 3NAPC 1ND2C 5J37A 5IK8A 4LTAA 4ASMB 5FMCA 2X8KA 3HPNA 1OQEA 4UF0B 4DOUA 1SLIA 1VBA3 2FQPA 2R30A 2C4XA 4LLFA 5FPBA 5FZIA 5IJRA 2YC4A 4A4AA 4CXWA 3ENRA 3OYWB 1RUJ2 4FPHA 1C8M3 1QEXA 3ATGA 2GU9A 2VULA 3M3CA 1KJLA 1Y4WA 2BBAA 4QPIB 4Y4YA 2LW8A 1SLBA 4JRLA 1IKQA 1JYNA 3SMHA 3T1LA 1QQP1 1VIWB 1O3RA 4E8CA 3HWJA 3WSOA 5FXWA 2DURA 3N35A 3VBHA 2A70A 5FPUA 2VVDA 3DL3A 4CCLA 3TAYA 2LM3A 3VGIA 2X10A 5CIRA 3WDYA 5C8WA 1N3QA 2WFPA 2VE1A 5A7SA 4E4HA 2FD8A 4LO5B 2VNVA 1GWKA 5A3TA 4IV3B 1CZTA 3KV9A 3MUY1 2G4IA 1CONA 5F6LB 1MR5A 2VY0A 1WCQA 3GBFA 4XILA 3LA2A 1W99A 1OUXA 1YJKA 3CQOA 4RYDA 1CX4A 5T55A 2XBO3 1CJDA 4ES9A 2JG8A 4AAXA 2D6LX 4RQPB 4CCKA 4JC1A 5C3PA 1VMFA 1N3PA 3J8F2 5A33A 2HWE1 4FVVA 4KG8A 1QGLA 3OD4A 4QGLA 4BOWA 1O3TA 1DZQA 2I07B 3I59B 4Q4V1 4UW3A 1JH5A 1YQCA 1PVC3 2ET1A 5F7UA 5JXHA 3DUIA 1H2MA 3BB6A 4YNIA 3W20A 4XYXA 1S0FA 5D8AC 3TEXA 1HXS3 4JRAA 2Y6HA 5A6QA 5F37A 1UU4A 5F3CA 3PUQA 2VQTA 3HN3A 3CIHA 1LKNA 5GLZA 1RUC2 3AYCA 4LITA 3WG4A 1JYTA 3H9AA 3AP4A 5CB7A 1X7NA 2BOIA 3T2OA 2ZS6B 2JKBA 1R64A 3HQRA 4Q0VA 2OPKA 2BP6A 5KHIA 2JKXA 3SCGA 1DQ2A 5FZOB 4KGGA 1BKZA 4DY3A 5LEKA 1ZZ6A 1AYM2 5FYTA 1V70A 4JHZA 3U4SA 2GAUA 2VW2A 5A70A 4DXTA 1WKYA 2E32A 1WD3A 1QXJA 1W6PA 2DBNA 3SKJE 5I8SA 1GR3A 2W68A 2WYFA 3U75A 1J3PA 5LRRA 2R073 4FOQA 1KITA 3FLTA 1RHI2 1ASJ3 2GMPA 4JDOA 1W2AX 1UWWA 1GKBA 1VLNA 5F2WA 1VBE1 2DCJA 5E8AA 4OI4A 1ULOA 1MACA 3LOIA 1W8OA 4KG0A 1QJX1 4QPWA 2ZACA 1YEWA 3O1TA 1V6JA 5T5LA 5J1XA 2XVKA 1C57A 1EY2A 4N9HA 4BZ4A 5FZKA 1RUOA 2W52A 4UFJA 5ERLA 4C0HA 4OI1A 2HWC2 4CXXA 1RUG1 1YQ5A 3NL1A 4W6YA 3RYPA 3WQ1A 2XVLA 5C3OA 3WVJA 4FTSA 4I02A 2PAEA 3Q8EA 1EAH3 4LT5A 2HWF3 2HBUA 4PDWC 5FPLA 1DQ5A 2X5IC 3RDIA 1W28A 4P9IA 3IKWA 4AOCA 2FDFA 1LECA 1HV1A 5DZGA 3H1MA 3B00A 4FAHA 3ZFEC 1KRIA 3ILRA 2WWSA 3PHMA 3LDKA 4AL9A 3GHNA 3WEZA 1F2NA 5J09A 4QHOA 5K0UB 5HI0A 1IZ3A 3P6BA 2AH2A 3CZUA 3VZNA 2VZ3A 1R083 4XDOA 1S1AA 1DYOA 1W6NB 2UURA 1QMJA 2VAUA 5FZMA 1BK0A 1BHGA 1JZ5A 5CFDC 4ZS2A 3RPQA 3WW4A 3DF0A 4XJAA 4OCTA 1GWMA 1RL3A 3VBFA 5FYHA 4QQ2A 2LROA 3ILNA 2JD9A 4RHV1 1EP0A 4DXRA 4NIGA 2OT7A 2YBSA 1LHUA 4MGSA 4QX8A 3O1MA 5CG8A 4Q4V2 3WW3A 4Q4W1 1F5FA 2F17A 4LHSA 3K4AA 2ZAHA 3IZOA 2JEMA 5DG2A 1QIQA 2ZGUA 3W5NA 1NXD1 1GQPA 4P5HA 3RFRA 1W6MB 1NE4A 2RHPA 2Y38A 4I3GA 5M0TA 1WLWA 5CAZA 3ZSKA 2XJUA 5L9RA 5LA9A 1PO13 4YVWC 1US3A 1HB2A 2Y0OA 2Y6KA 1WW5A 3VDDB 3P1IA 4KMQA 1O6UA 2YV8A 1DQ6A 3TEYA 1F8VA 3JQWA 1W8ZA 1JTZX 4CRQA 1WD4A 2ZHNA 4QD2A 4JGZA 1BZWA 1PNGA 2DBIA 2ZX1A 4LIUA 5IK7A 4ET7A 1W8WA 2PHWA 2O8OA 5F8PA 1BBT1 4HKWA 3AKTA 4E27A 3OPZA 2IC1A 2ORXA 4JAAA 3BTAA 1O7FA 3KS7A 3K77A 4PIYA 2FZ1A 1RUJ3 5FP9A 1ALYA 1IHMA 5DUXA 4DPNA 3ZR6A 1F5JA 1D2QA 1PZ7A 1XYNA 4TSVA 2DCTA 1E5RA 2RS53 4CVUA 4D69A 1AR71 4TZDA 2JDHA 4UXAA 4XETA 2FZ2A 3OBAA 3O1UA 2JE8A 3KMHA 5FZDA 4OLLA 1AR62 3KHBA 5BNNA 2D6KA 1VP6A 1WMXA 2D5HA 1JHNA 1LHVA 2YPJA 1AVBA 1DGWA 2VU9A 5FBJA 5FZHA 3AFGA 5BXXA 1ZVFA 4OQ9A 3CZJA 3EO6A 5A1LA 3H7JA 2WUHA 1UOGA 4JDNA 1ULPA 2P2KA 2B5HA 3S6PA 2GN7A 3HJRA 2G19A 4K1YA 1LHWA 4IEZA 4LHKA 5LA2A 3VD3A 4BIOA 5DN2A 4QGNA 1GMMA 1AL0G 3THCA 4ZKTB 1LHOA 2C5DA 4AFDA 1GSLA 4CSWA 4IL7A 4XEZA 5L36A 3OY8A 2CTVA 1NKGA 4ATEA 1LRHA 2WWUA 4K1ZA 4N43B 5EJ3A 3I2DA 3I2OA 5EP9A 3BGAA 2WNVA 4QM9A 2LALA 5JPMB 3H3ZA 5A1AA 4ZS3A 3GBGA 1NA1B 5FZGA 5KXCA 3BI3A 1B35A 1H2NA 2DV9A 3E5UA 1ZX5A 2VO5A 3GJAA 5F32A 3HBKA 4IV1A 1RUC3 4QXKA 4FCAA 4RHV2 4MLOA 2K46A 4HKOA 2VMFA 1UY2A 4N90A 4XMAA 2QZ2A 3IB3A 1IKPA 2OQ6A 2J1VA 1JOJA 3HR9A 3RVHA 1ENXA 3INAA 1X9PA 4BQ2A 4RN5A 3GXUA 2ZGRA 4IDZA 3GZEA 5FV3A 5DZFA 4KWJA 4NPLA 3NW4A 5I0RA 5JLVA 2YFZA 5FYVA 5GZCA 2MHFA 2OIIA 1HX6A 4X8NA 5I0TA 1ZRDA 3NVCA 1CAXB 1GQGA 3P3NA 4LJHA 4PLNA 2WZEA 4MOAA 4EQVA 3JD71 3N9QA 2WZR3 3IDEA 5A6ZA 2RR11 3KV5A 2QQNA 3KCXA 2ZMNA 5IT6A 1WGPA 3V0AB 2UYAA 4AVCA 2W47A 3BU0A 3MYXA 2P1BA 3URFA 5K8SA 3Q9OA 4COVA 5K7PA 3E6DA 1PHMA 1K5MB 1LULA 5JXJA 2NYYA 5CKMA 5AVPA 3QH6A 1XU2A 1BBT2 5FY1A 3CJIA 4N53A 1MEC1 2JJ6A 4XBNA 4M3CE 1F4AA 4GIQA 4JGYB 1ULFA 1J58A 4BQ1A 4LOTA 2XXZA 4QXCA 3T2QA 3ZKYA 3AKPA 1UMIA 1ONAA 1X9TA 5ABJB 4GKYA 1REFA 3VBSA 1A6CA 4AI1A 3ZVXA 4F7ZA 1QQP3 4OUMA 1ZYBA 3EYPA 3RS6A 2VNRA 1OHFA 2VVEA 2WNUC 1NCRC 3OUJA 4AQ6A 3RGBA 2RS31 2H6CA 2ARBA 4JKLA 2ADEA 1O8PA 2J22A 2YU2A 4AR2A 2BPA2 4QAWA 1BMV2 2ZZJA 5E1RA 1CESA 4IEUA 5EPAA 2EALA 4CCEA 1D0GA 4FXGB 3R4DB 2EVXA 2PLV2 5F3GA 4UYBA 1VBB1 1QHDA 5DAQA 3C7HA 2RVAA 2WO3A 5F3EA 3POBA 3O0WA 3K3OA 1MZ6A 2XPJA 3N9OA 4MZUA 1UO9A 2KD7A 4LHLA 1UZ0A 1ZRRA 2RMU1 1W2UA 5APAA 2HWE3 1UIJA 2RJKA 1EPWA 1UMHA 1X82A 1CIWA 4KH9A 1DU3D 4LBLA 5GJ6A 4Q4V3 3RYRA 4O61A 4Y1XA 1IGOA 3DXUA 4XPVA 3VBHC 3NSTA 4Y22A 4LUMA 5EYYA 1VALA 3WZ1A 4RD7A 4NIIA 2DTWA 4H2AA 2Q8CA 4AFCA 4MX3A 4QB1A 5CNAA 1GZWA 1Y9GA 1KGYA 5JOWA 1EYBA 3VBRB 5A3UA 2DU1A 3A21A 1XSQA 2WC2A 4FP3A 1U5IA 1CAWB 4LXLA 4XJWA 4DO0A 1W6OA 3AMPA 2P5BA 4HKLA 1OURA 4A6OA 2R49A 2DVAA 1KDMA 2W5FA 2Q8DA 3B9IA 5IVFA 3MZHA 2JG8C 3R4SA 3HIFA 4YWAA 3TYJA 3U78A 3LDBA 2PHLA 1HB4A 4AEDB 2L9LA 3M3IA 1JBCA 2FCTA 3G7DA 3ZN5A 4KWLA 3KVAA 3IT8A 2HJIA 2Y6GA 2OKXA 1ST8A 2JD4A 3VBUB 1T6BX 3B01A 2W9XA 4W6WA 1MS3A 1H30A 2IXLA 4ATFA 2WA3A 1HN1A 4AVAA 1SDDB 1C1FA 3RI9A 3ZFEB 3DPRA 3JD72 1VBE3 1MQTA 1NY71 1K5JA 1UZVA 3WNPA 3NWKA 2HLEA 2VNOA 3AVSA 3OBZA 1QJX3 3FLPA 2VUCA 1AXZA 1YQ2A 1RYYA 2EIEA 2WLPA 4KI5M 3ALQA 3S57A 3V0BB 1DIWA 5DZEA 1C5IA 1YJLA 3JU9A 4YW4A 2VZRA 4JX0A 5BNOA 5GLWA 2WT1A 2VQ0A 1SQ4A 2V09A 3OSDA 1E57A 4CU8A 1IQDC 2BGPA 5DDJ1 2BYVE 4GULA 5FOBB 2ZKLA 2J1RA 3IBMA 1RUG3 3N7JA 2DVGA 2D5FA 4LBQB 4BLIA 3OTFA 2FHRA 4Z8BA 1W9FA 1A8DA 3BN6A 3AMQA 4ZPIA 1IS3A 5FWEA 1S0CA 1HRI1 5DPNA 3ZO0B 4E4SA 3MEPA 1ZRCA 3MGUA 2TBVA 3NQHA 4CCNA 4ITCA 3WHUA 4Q4X2 1CQ9A 3WLUA 2DDUA 3OEBA 4YYOA 4BK4A 4KU7A 3DV8A 5C3RA 4RFRB 2RS32 1B09A 4IEWA 5DUWA 2HEYF 3VDAA 4A45A 2GZWA 4BXSV 5FQ0B 2E31A 3NKTA 4FPJA 1RGSA 1JOPA 1OMIA 1H8VA 1XYPA 3O5SA 4KL1A 5J3UA 3EHKA 3ZXAC 1YRZA 3ST7A 3OF1A 1Z0HA 2P3YA 1OFNA 1YUDA 1HRV1 2CY6A 2RDRA 3BPSA 3D0JA 4P9YA 2XVGA 3BKZA 5ANNA 2E7TA 3O1PA 2PHXA 1Q8VA 2RMU2 4ISQA 4RHV3 3RZGA 5A7NA 2GP5A 2G1MA 2WYSA 1K3IA 2Y6LA 4OMCA 4R9DA 5FYCA 3AMNA 2Q1ZB 3I3DA 1DYKA 2ARCA 2XH6A 4Q4W3 5EHDA 4GJZA 5L9BA 3LOBA 5A7WB 2BRTA 4A2UA 3GZTB 3N3HA 4MGZE 5LK5A 2YROA 1S0DA 1WWYA 4B7EA 5EFUA 5FJHA 2VOKA 2Y6JA 3H42B 1AL21 4XAEA 5C71A 1ZZBA 4CPBA 2ZGTA 4L99A 1FPN1 4URTA 3MW3A 3PU8A 1JOBA 1XNAA 5LBEA 1UY0A 2VH9A 3RWNA 3MFAA 3LSEA 4MXWB 3VBFC 1R1A1 2IXJA 3AP7A 3LEGA 1N1SA 1GU3A 1YFUA 1J1LA 4Y20B 4NOTA 3ZN4A 2VQUA 5FO9B 4P02B 4PF5A 2AACA 1E5SA 4YM2A 5FZ7A 3EB7A 4YZ2A 4IUGA 3WY6A 3MPBA 3U07A 1DFQA 4DEQA 1OD3A 3UL2A 2BWCA 4AQTA 5AC92 1FT9A 4M3CB 1BBT3 1C1LA 3WF0A 4GD4A 1BXHA 3PL0A 4IEYA 3ZLIA 4E2QA 5IVEA 1JZ3A 1T6GC 2YG0A 2BNMA 2ZCWA 3C7OA 1CJPA 1UY4A 3C7EA 2VZOA 3MIFA 2JG9C 1AR73 4UOJA 4CP9A 3HQXA 2XJRA 5BNPA 5CBLA 4Q4Y1 4LHNA 1W0NA 1XNKA 2YGMA 4L0PA 2HYKA 1NCQA 3NNFA 3USSA 4YSFA 2AC1A 4PJYA 5DAWA 2ZBJA 1COV2 1HLCA 4I3PA 1MZ5A 5FPZA 5LZ6A 2BJSA 1V9U2 1W2OA 4XJ8A 2G9ZA 4JGZC 5LW9A 3QOPA 4XVHA 1RJ7A 2PXJA 1HW5A 2R1DA 3KQRA 2YHJA 1QJFA 4X8PA 3AK0A 3ZSLA 2P3KA 1DZRA 1JMUB 1PGW1 3WNMA 1OA2A 4JZRA 5FYYA 3ZKUA 4CDXA 5LA1A 2XLFA 3JBG2 4FAGA 1Z7S1 2J1UA 4C1XA 4TYSA 3KSCA 1SLAA 3I2JA 4WM7B 1HB3A 4NUBA 2QQVA 3EBRA 3LGRA 5HXVA 4YZ4A 3LPGA 3WNNA 3WQ0A 3MICA 3UETA 4PLMA 4Z1VA 3ORJA 5H9SA 5C9AB 5DXDA 1KXGA 1G8WA 5BNNC 2ZABA 4DUWA 2WLQA 1SLCA 2ZGKA 1I3HA 3T0DA 4CUCA 4AQSA 1YNAA 4EZ4A 1HKDA 1GLHA 1HRV2 4AHYA 5CFCB 1H2LA 4R9AA 4QQLA 5FOJB 1S2EA 3UGHA 1SCSA 2C1FA 4MGYE 3PVNA 1KS4A 4U2AA 4XFAA 4XQWA 2YU1A 3PJQA 1PK6A 4AI3A 4JKKA 2BV4A 3LD8A 3WT3A 5FTTC 5A3LA 1X36A 2HYXA 5FMOL 4B29A 4IXLA 5L7OB 2VVFA 1RMU1 3HT2A 1WUVA 3ZIXA 1AL22 4FTEA 3KWVA 2EF6A 3LF7A 1PZ9A 5GKAC 3RZHA 3ACIA 2WNVC 1Y9QA 2VOTA 4B1MA 5F5AA 3GDBA 1FPN2 1LGNA 2VNGA 4W6XA 4AEKA 2A6XA 1YIPA 1AXYA 2PELA 3J8F1 3JD73 3OGRA 1B35C 4HL0A 4QGMA 1MS9A 2RR13 4U36A 1R1A2 1LOAA 4WV8A 4CEYA 2P3IA 3SISA 3AM2A 4IV1C 3SH5A 3MIDA 4CUGA 4IEPA 3E97A 2CDOA 1ENSA 1PX4A 5FREA 1SLLA 3LA3A 3NO8A 2I45A 1G9CA 5BPXA 4HFSA 1CZSA 4R4XA 3I2GA 1JUHA 2VUJA 5FKBA 4AEMA 2BVBA 2RDQA 1MEC3 1YI9A 3T3YA 3WF1A 2WJSA 1A34A 1H8TA 3HN1A 4FPEA 4I0AA 2QQPA 1LHNA 1O3QA 4QX2A 5CZKA 4XW3A 4EROA 1QJY1 3VBHB 4YM0A 3ETQA 4BB3A 1F35A 1BK1A 3IIIA 4Q4Y2 2WS91 3S0MA 1AYM1 4PF1A 4HVOA 2EIBA 1PNFA 2UYBA 2X05A 4COWA 2XB6C 4HSLA 5JMOA 4SLIA 2RS33 1GFF2 4WBBA 4NMIA 3H1YA 2E6VA 2Y0IA 3EXUA 5JSRA 1ZBA2 4Y1ZA 2QQJA 5T50A 1RHI1 4BE3A 3BTXA 1CWPA 2QQWA 3ABZA 4QM8A 2NPIA 3M7AA 4FBFA 4FOYA 1W3XA 5A32B 2JG8B 3CL1A 3CJIC 4N53C 1VBB3 4GH4A 1PGW2 1TMF1 1VE0A 1ZNPA 2BVVA 3MV11 1VAVA 3NNLA 5JOZA 3D4KA 1KD7A 3FX3A 4META 4ASKA 1FXZA 3K4DA 1PGSA 1Z7S2 3MV01 4Y1VA 4XCBA 2ES3A 2RMU3 1U5XA 5F2SA 5A7PA 3U10A 2X53S 3VBSC 1EV11 3MF6A 3PIJA 4A7ZA 3NV4A 2GC0A 1CPNA 2ATFA 1DGRN 2FDJA 2FBEA 2HWC1 3ZFGB 1C3HA 1BYHA 2VTXJ 2XJPA 1GUIA 4LUKA 4WZCA 3WF2A 4IGQA 1CN1A 2HWD1 5JZGB 1OF3A 3WD5A 5LBCA 4CDQB 1ODMA 2K2SA 4P00B 5FMBA 1LOGA 1KQRA 2DVBA 4CDUA 1OA4A 4WVMB 4YZ5A 5IK4A 2GN3A 2C24A 3IMNA 3K75B 4LR4A 3ZX7A 1XYOA 4UW6A 3ITQA 1IG0A 2GH8A 2LRPA 2QJVA 4FFGA 3ME2A 5FK7A 4CDWB 4ARYA 4B3NA 1AF9A 1CAVA 3VUOA 1RC6A 4BQ5A 2RDNA 2WWJA 2A6ZA 1RMU2 4C91A 1PO21 4A3ZA 2IXKA 5IVVA 1J1TA 1HIXA 2GALA 3OJBA 3F2ZA 3W59A 5B2GB 1L3JA 2R042 1GOFA 4Q0PA 4IE4A 3AZZA 1NT0A 1REEA 3H1WA 4YVSA 5T5OA 4EZHA 4IEXA 2ZX3A 1J3QA 1ULEA 4DRVA 4BQXA 2SBAA 2PTMA 3VHOA 3Q8AA 1HJFA 1DG6A 4XXAA 3IMMA 3K2OA 2ZGQA 2JDMA 4XFIA 3KT7A 4DMIA 3NJYA 4GAZA 5DDJ3 3WNOA 1FNZA 4CYDA 4HPKB 4MV2A 1D2SA 1RINA 1J3RA 2A3YA 2IXHA 2W08A 3VZOA 4S2FA 4G3YC 5IVYA 4BH9A 4LORA 2VTXA 1U5YA 3USUA 4AGGA 1RUH2 3GM8A 5FY8A 1HRI3 2OVUA 2Q30A 1QJY2 3AX4A 4LK6A 1MS4A 1ZA4A 1I5PA 2Z42A 2WS92 3DPRC 2VMIA 1MQTC 2XJQA 3FMGA 2ILMA 3CU7A 1ZA7A 5FP3A 5FMDA 1HQNA 2C26A 4FI9A 4UF0A 3KV4A 2GNDA 2W3JA 2YUEA 4FQZA 4KWKA 2VOWA 3VL9A 4LKFA 2ZGOA 3S5AA 1NLSA 5CADA 2MEV1 5BNOC 1QNYA 3RQ0A 2E9QA 2KR2A 3T0AA 2Q5TA 2WQZC 2W1SA 3FHQA 2XWBB 4D6QA 4N8MA 4AHZA 1ZZCA 4LK7A 4XDQA 3JCIA 1RUE1 1TMF2 1HRV3 4G4FA 3WW1A 2WA4A 4DXZA 4EN8B 1UU6A 5C4WC 2FDGA 4UT5A 1POQA 2QDRA 4Y1UA 1PM7A 1AR61 1EV12 2SLIA 4PBOA 1NOVA 4IV3A 3OBTA 4D94A 1ND3A 2CV6A 4XJZA 5EWSA 2RS12 5JOXA 1VBD1 3VV1A 3NJXA 4NR1A 4Q0QA 1XE8A 4QMAA 1D0HA 1OKQA 3K48A 4XUNA 4BQ3A 2XMLA 2VQAA 4HG6B 3WP6A 2VC9A 4ZU4A 2HWD2 4RQPA 2ZHMA 2GC3A 1AL23 2JG9B 4H7MA 3OD0A 3ZXFA 4IEVA 2YBPA 5LWBA 3EMRA 4FOWA 1FPN3 2OS2A 1FOD1 1UY1A 3ZDSA 4AI0A 4AVTA 3IDBB 3I59A 3LSDA 2NMOA 1G86A 3R0RA 4IGPA 4NE9A 3T2PA 2ETEA 4NAMA 1R1A3 3MFCA 4AFAA 5FR3A 4WM8A 3TBDA 3PTRB 3RZJA 4OI0A 2VZSA 1QH7A 2BUKA 3MUZ1 5C8CB 5A1FA 4LO6B 1WCKA 2O1QA 1V6LA 1PO22 3ECQA 2D97A 5JXIA 4B4RA 3I7DA 5FO7B 2E7AA 1GICA 3G6JB 2FMDA 2X09A 1A78A 1SG3A 2D7FA 3PMSA 1DGWX 4OHVA 1OQ1A 1HB1A 4QHZA 2A1XA 4JTNA 5FZOA 4AAPA 4COYA 1PGL2 1CIYA 3W9AA 4LLOA 3AP9A 3RSJA 1JUIA 3FJSA 3HMYA 3NNJA 3WDTA 5FO8B 4TTGA 4Q4Y3 1N1YA 3WQBA 1XNDA 2DCKA 4S2DA 3UESA 4CEWA 2NLRA 3O1RA 2VCBA 3NJVA 5GZEA 3WXPA 4DQAA 4J25A 3WUDA 3CMGA 1BQPA 2BWAA 3MW4A 1EUTA 4HETA 3POEA 2A73B 2J1TA 4ZU7A 5DQ0A 4AVSA 1TE1B 2AENA 1YYNA 2ZOEB 3DN7A 3LQCA 3FBMA 3VZKA 4Q27A 4A42A 5FPAA 4BMEA 2ID4A 3D82A 1BJQA 3EQEA 3VBOB 2DCZA 4P08A 5DABA 3T08A 2I2SA 2VBBA 1OLME 2WO1A 4FPYA 4OUSA 4D8MA 4DINB 1PMJX 1Z7S3 4XF9A 4LKSA 2H0VA 3SXWA 2YBKA 5BNPC 3ON7A 2MEV2 1JXNA 5FYIA 3B5LB 1WMDA 1VAMA 4OHXA 2QNKA 3ACLA 3WNLA 1F9KA 1NCQC 3BTZA 4UFLA 3GBWA 3KD4A 1IOAA 2BTVC 3BOPA 4CA9A 1AXKA 2XUEA 5A6YA 2RM21 4TLGA 5L73A 4E2SA 2YDEA 1RUE2 5D1IA 4UBHA 2EIGA 3L2YA 1RVF1 2WL1A 3KGZA 5K0UA 5TSWA 3M3OA 4IEQA 2PQSA 1VPHA 2IFWA 5FZFA 3S5QA 5D21A 3PVOA 4D3WA 4D7YA 1VBD2 2P17A 1W6NA 4CDXC 2D44A 1BMV1 5I0SA 3W21A 1YIFA 2PHTA 3WCSA 1Y9MA 1C5HA 1W8HA 3UKVA 1OPMA 3WDUA 1OH4A 1RMU3 1ULCA 2PLV1 2ZX0A 3M8LA 4BIFA 2HEVF 3MIBA 3ZFFB 1GQHA 1NUKA 1UXXX 1XPWA 2B9VA 1FOD2 4AG4A 4RR3B 2VR4A 3MLJA 1SFYA 3J8F3 3RZKA 3BALA 2CAUA 4XF3A 4OMDA 2IVJA 3MF9A 5FLJA 4H3WA 5FZ0A 4IE5A 5GLVA 1G7YA 4XBLA 1NZCA 3P3PA 4MHUA 3WUCA 2PHFA 3O0VA 1G9BA 3BUCA 1W39A 3LPFA 4N53B 1SLTA 3AXEA 1XNCA 3VN4A 4DFSA 1PK6C 1CGPA 3OGJA 4UFKA 1RJ8A 2VZQA 4I0BA 3JB4C 2IUWA 1W2NA 1ND2B 3A22A 3NAPB 1X8MA 1OT5A 2QKDA 3VDDA 3DXTA 2XL9A 4YW2A 5A3NA 1F15A 1S0BA 3OUHA 4XTMA 2OXBA 4NROA 2BGCA 3FWEA 2VL4A 4PI2A 1QJY3 3JUUA 4BYYA 4OHYA 3WNXA 4ZXEA 4A44A 4CCJA 1OVSA 1UZZA 4UBGA 2WS93 1GYKA 1AYM3 3PNAA 1H9PA 3FHAA 3LZZA 2BFUL 4CEYC 1MPXA 4P5YA 4QX7A 3ZYBA 4YLZA 3J7HA 4Z07A 4UFMA 5FYMA 4DIQA 3RWKX 3LFMA 1YQ6A 4H14A 4PHZA 4HK9A 4UW4A 3FFZA 3WF3A 1W3VA 2B42B 1GZTA 2E33A 1UF2C 3DYOA 1UOJA 3R4UA 3WP3A 1CD3G 1RHI3 5FZ8A 2ZPXA 2C9KA 1HDKA 1HJGA 3RZZA 2J42A 3AJYA 1SFPA 3FBYA 3Q8FA 1CAUB 4CCMA 1MVEA 5FY4A 4BCUA 5JAXA 1TMF3 2GH2A 1FI2A 1H8TC 1SACA 4K7JA 3SEEA 4DUVA 2F4PA 2DVFA 3UNPA 3MDPA 3LIGA 1AR91 5HV4A 2Y64A 2N7GA 1EV13 3AC0A 2DTYA 4XCAA 4MXVA 2HWC3 4ES8A 3E1F1 2ZGLA 5FPXA 2YFUA 3KZ4C 3GZUC 4QX3A 1QJU2 2RM22 5LY1A 2HWD3 3KGLA 3O7OA 2OX0A 2DFBA 1W8FA 1OSGA 1N1TA 1RVF2 2W2IA 3SITA 3LEIA 4Q4X1 5LK7B 5IK5A 4JKMA 2YC2A 4N43A 5D8AB 2GC2A 3H50A 4EN9B 4AHXA 2B8MA 3J9SA 5JPNB 4GH4C 4M4RA 3AYAA 1QNWA 3WR0A 3T4VA 4JHTA 4BDVB 3GCXA 3J7MA 2UY8A 1NA1A 4NAOA 4NWWA 3PDQA 5JXGA 4QX5A 3NRUA 2B46X 1H4HA 3M3EA 5KHJA 4RS5A 1W9YA 2Y60A 5FXVA 3AYDA 1PO23 1DP0A 2VBPA 1J84A 1TME1 2JDKA 1V0AA 2E53A 2ZX4A 4B4PA 4DNYA 4EN6B 3I3MA 3DPRB 4FSJA 2VCCA 4GB32 2O14A 2VZUA 5H9PA 4TLFA 5FIXA 4Z2AA 4EWAA 4L8QA 4UFHA
chains in the Genus database with same CATH topology
1W8WA 4CPBA 1WZXA 1OH3A 1W8UA 3F95A 1W9FA 2Q1FA 4LK6A 2K46A 1L7LA 4CP9A 3UT0A 1W90A 4CPBD 1OKOA 3ORJA 1GWMA 2C24A 2WYFA 4LKFA 4BQ3A 4AL9A 4BQ2A 2LROA 2LRPA 1GWKA 1WCUA 4YW6A 3ZYBA 4YW7A 2KR2A 4CP9B 1V0AA 4A6SA 4BQ4A 1HN0A 1WMXA 1W8TA 2VXJA 5D21A 4BQ5A 2JWPA 4YWAA 2O14A 1GWLA 1W8ZA 1UOJA 4LJHA 4LKDA 4LK7A 4LKEA 3ZYFA 3ZYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W8W A;  4CPB A;  1WZX A;  1OH3 A;  1W8U A;  3F95 A;  1W9F A;  2Q1F A;  4LK6 A;  2K46 A;  1L7L A;  4CP9 A;  3UT0 A;  1W90 A;  4CPB D;  1OKO A;  3ORJ A;  1GWM A;  2C24 A;  2WYF A;  4LKF A;  4BQ3 A;  4AL9 A;  4BQ2 A;  2LRO A;  2LRP A;  1GWK A;  1WCU A;  4YW6 A;  3ZYB A;  4YW7 A;  2KR2 A;  4CP9 B;  1V0A A;  4A6S A;  4BQ4 A;  1HN0 A;  1WMX A;  1W8T A;  2VXJ A;  5D21 A;  4BQ5 A;  2JWP A;  4YWA A;  2O14 A;  1GWL A;  1W8Z A;  1UOJ A;  4LJH A;  4LKD A;  4LK7 A;  4LKE A;  3ZYF A;  3ZYH A; 
#chains in the Genus database with same CATH topology
 1IPS A;  3L9J T;  5FFO C;  4XXP A;  3SKV A;  1OH3 A;  1W8U A;  4HXC A;  1G9F A;  1RUD 2;  4CDU C;  1VR3 A;  2W46 A;  4M3C F;  1LTE A;  1OXC A;  2W0X A;  3BYW A;  5FKC A;  5FP7 A;  3UT0 A;  5C70 A;  3PJY A;  5CYY A;  1AX1 A;  4QHB A;  4BMB A;  1GP4 A;  5HBA A;  4MGT A;  3AMM A;  2LS6 A;  1IG3 A;  3MLL A;  5SV8 A;  5KHG A;  4H7L A;  2PMW B;  3ZMN A;  1CAX A;  3FE5 A;  2Z69 A;  4NVP A;  4B1L A;  5C4W B;  5IAT A;  3PUH A;  2VUA A;  3T0B A;  4CU6 A;  3V0A A;  2JDZ A;  3IPV B;  1AR8 1;  5F5C A;  4OHZ A;  2B4K A;  4YFW A;  2WQ8 A;  3E6B A;  3TRS B;  2YYO A;  3A4U A;  4FPO B;  4QPG A;  2XQR A;  1K5M A;  4RGA A;  4YVS C;  2V73 A;  3RMX A;  3Q8B A;  4YPJ A;  2W39 A;  2CWM A;  4PDW B;  1XRU A;  3AP6 A;  3PUI A;  4YGB A;  1GOG A;  4JGY A;  1DHK B;  2X5I B;  2FDK A;  3ZYI B;  1QY4 A;  1LOD A;  5AC9 1;  2MEV 3;  1GZC A;  1KS5 A;  1RUI 1;  2C9A A;  3ZMO A;  4AZZ A;  3NMB A;  5ABJ A;  4HK8 A;  4CCD A;  3RMY A;  1Q3E A;  4LNV A;  3T2T A;  1W6Q B;  4BM8 A;  4QU1 A;  5FZ1 A;  1RUE 3;  3AL5 A;  5F5I A;  2WO7 A;  1YC6 1;  4HN1 A;  1UYP A;  1UMZ A;  1G6N A;  3N9N A;  4XUQ A;  1OFS A;  1AR9 2;  3BU7 A;  5CFD B;  1YLL A;  4R9C A;  2HKX A;  1YO8 A;  1AR6 3;  3DYP A;  4OZX A;  4GWN A;  1UU5 A;  3J7N A;  1WZX A;  1VBD 3;  1COV 1;  1QOS A;  2B9U A;  5CG9 A;  4G9S B;  4R4Z A;  3WG3 A;  1V9U 1;  4NIA A;  1W90 A;  4COU A;  4QX1 A;  5C3S A;  5GZG A;  2VOV A;  4IET A;  4A3X A;  4QQH A;  4D0Q A;  2JE7 A;  3PUA A;  5KXB A;  2CAV A;  1PM4 A;  5ACA 2;  4X6Q B;  2TNF A;  1FOD 3;  4A7K A;  2CL2 A;  2FDI A;  3JBG 1;  3RJR A;  3RNS A;  3GYD A;  3J4U H;  4V2V A;  1JW6 A;  3D0S A;  4E9K A;  4R8H A;  3LIH A;  3OPW A;  1LOE A;  5I0U A;  3MLK A;  3FZ3 A;  1Q43 A;  5FXX A;  1YI7 A;  3U14 A;  1I1E A;  4IE0 A;  4YVW B;  3VKM A;  4J1X A;  2E26 A;  2R32 A;  3M70 A;  2A6Y A;  1ND3 C;  1OD5 A;  3OGV A;  4IV3 C;  5EIY B;  1TME 2;  3VBR A;  4ORF A;  2Y26 A;  3VL8 A;  2HWB 1;  4V2W A;  4RQP C;  4K8R B;  3H8R A;  1JYW A;  3CBN A;  3KV6 A;  1APN A;  3CEW A;  4FPG A;  4L92 A;  4QT6 A;  4N7I A;  2JIC A;  3ZN6 A;  4AED A;  4HZF A;  2IXC A;  5LAS A;  1LU1 A;  3AJZ A;  2A3X A;  3AL6 A;  3JQX A;  2ERF A;  2OUH A;  3CHX A;  3S7E A;  4LEJ A;  3VBU A;  5DG1 A;  2DFC A;  2R1B A;  2W1Q A;  4ZON A;  2R0F A;  1GWL A;  3PUR A;  4AVV A;  1UYY A;  2KXL A;  1UQX A;  4WM8 C;  5GZF A;  3GNE A;  1C8N A;  4TN7 A;  3UK9 A;  3WIN E;  4YZ3 A;  5DAV A;  3VB9 A;  1QH6 A;  1VBC 2;  3ZPY A;  4HVR A;  3E6C C;  4COZ A;  4FXK B;  3VKN A;  3D6E A;  1AR8 2;  4Y5S A;  1WA6 X;  5GLU A;  3V0B A;  2JE9 A;  2DVD A;  1SEF A;  1LJ7 A;  3SH4 A;  3FUQ A;  3MHZ A;  4IND A;  2WZP P;  3CJX A;  2VME A;  3SC7 X;  1OLQ A;  1R1Z A;  4DY5 A;  1UPS A;  2WAA A;  1DGL A;  3AKS A;  3LA7 A;  1DQ1 A;  2IWG B;  4IE6 A;  2BER A;  4LBQ A;  2P3J A;  5C5T A;  4XF4 A;  4BQ4 A;  1QXR A;  1JU4 A;  2EAA A;  1GNZ A;  3C7F A;  1RUI 2;  5LA0 A;  4AHW A;  5B4X A;  4CEW C;  3AKQ A;  2PHU A;  1D7P M;  1MS0 A;  2GNB A;  2R0H A;  2VM9 A;  2PHR A;  3DKW A;  3PU3 A;  5FMO S;  2RM2 3;  2E63 A;  5FCC A;  1SDW A;  3PTY A;  4O9E A;  2EXK A;  4LPL A;  1FAT A;  5LRS A;  3RRD A;  2ZEY A;  1RVF 3;  4CPB D;  5IFP A;  5FUN A;  3B3Q E;  2HEW F;  5KHH A;  5A3M A;  4UI9 L;  2XKP A;  3MBW A;  5FQ0 A;  3FC0 A;  4FP2 A;  4R9B A;  1PMH X;  1PK6 B;  1W06 A;  2A7A A;  4NWV A;  5CVR A;  4FQ4 A;  5LBF A;  1U5Z A;  3C7G A;  4FO9 A;  3B69 A;  1JYC A;  2ZTN A;  3C3V A;  1ZBA 1;  1XOY A;  4AI2 A;  5C3Q A;  3K51 A;  3MW2 A;  3VD5 A;  5IHR A;  3HNB M;  1CPM A;  4K6B A;  4D7S A;  1SPP B;  1PX3 A;  2QFE A;  3NJZ A;  1XQN A;  2PLV 3;  1LOC A;  4QDR A;  1TG7 A;  1HQL A;  1VAK A;  4SBV A;  5HPO A;  3VD4 A;  4MSV A;  5D2A A;  1AJK A;  3BTY A;  4CEY B;  4JCK A;  4OQ8 A;  1S4C A;  2DU0 A;  1CX1 A;  2IZW A;  4YW3 A;  2JB8 A;  2G9G A;  4CCO A;  2Q8E A;  4DUX A;  1D4M 1;  2W91 A;  5K0U C;  1WW7 A;  1RED A;  3JB8 A;  2B39 A;  1V6K A;  5JIU A;  5FYS A;  1AZD A;  5G04 L;  2Z79 A;  3QCW A;  2AZ5 A;  3APB A;  3I2K A;  2WZ8 A;  1V6O A;  3W5M A;  3FHI B;  1N1V A;  1WCU A;  3GGL A;  4YW7 A;  1NXM A;  2D6M A;  2RJ2 A;  5E6H A;  4AI8 A;  5LY2 A;  4NRQ A;  1H8T B;  2HWB 2;  2XUM A;  4MXW A;  3U37 A;  5J36 A;  4NID A;  3ZXJ A;  2XKO A;  1PZ8 A;  2AYH A;  3IDA A;  4MAD A;  4Y20 A;  5ANQ A;  4RSU A;  4GZ9 A;  2R07 2;  3POW A;  4DS0 A;  4XIO A;  2EIC A;  3VDC A;  2V72 A;  2Z2S B;  4CP2 A;  2NP0 A;  2JDU A;  4YZ1 A;  4Y26 A;  4PI0 A;  2XJT A;  3ZXE A;  4M3C A;  3AZX A;  1PIV 1;  2V4A A;  2AGS A;  2IFR A;  1I9R A;  1Y43 B;  2BOJ A;  3LFI A;  3B94 A;  1K45 A;  2VTF A;  2WNU B;  5F9T A;  1NCR B;  2R04 1;  4AGR A;  4CU9 A;  1C28 A;  2QTW B;  2GME A;  4LA2 A;  2BNO A;  1GNY A;  1VRH 1;  3N7M A;  4AXO A;  1UD1 A;  3HD8 B;  4XFG A;  3RJ2 X;  3SEP A;  3AZY A;  3VDD C;  2OW4 A;  1EAH 2;  4Q1P A;  1G9D A;  1VB2 A;  1AR9 3;  1XXN A;  2HWF 2;  1HV0 A;  1Q8P A;  1SZB A;  1OOP A;  2DF7 A;  1ODN A;  1UN1 A;  2QQL A;  2XLG A;  1KFX L;  3M2M A;  4BK5 A;  1ENR A;  2J1S A;  2JIG A;  1RUH 1;  3ACG A;  3GZA A;  4DRR A;  5HCF A;  4KQ7 A;  4E8D A;  4MGI E;  5JI9 A;  4YGE A;  2LTN A;  5KBF A;  4GA9 A;  1ZZ8 A;  2EXI A;  4YG0 A;  3FL7 A;  4D6R A;  1A8M A;  3N4M A;  4Q4X 3;  3CF6 E;  4WM7 A;  1LGC A;  5FZ9 A;  1H0B A;  1WMF A;  2D3R A;  3UV9 A;  4MUV A;  5LEJ A;  1FNY A;  4XFC A;  1MS5 A;  4NHY A;  3B93 A;  1VRB A;  3NNG A;  2Z5W A;  3Q8C A;  5C9A A;  5CKN A;  4DZG A;  4MO3 M;  3POG A;  2ZEZ A;  5CFC A;  2ZKN A;  1DBN A;  5HV0 A;  2PAM A;  3TB0 A;  1TME 3;  4AFB A;  2ARE A;  3HNY M;  4XOG A;  2PYT A;  1NLR A;  3N7K A;  5A33 B;  2AUY A;  4GJY A;  2H0B A;  1IQA A;  2D3P A;  4FPK A;  1AX0 A;  5I8Y A;  4UW5 A;  1O91 A;  3ES1 A;  4PLO A;  1D4M 2;  2VPV A;  1BEV 1;  3FFQ A;  4N43 C;  2RS1 1;  1H1A A;  5L7O A;  4QXH A;  1XC6 A;  3ZYG A;  3ZM8 A;  1EUU A;  2WFF 1;  5DAP A;  1W04 A;  2JX9 A;  5FZA A;  1GBG A;  1OLR A;  3NV1 A;  3POJ A;  4LE3 A;  1BVP 1;  1PO1 2;  3BOW A;  4LIV A;  5FUP A;  4XUP A;  2VD7 A;  3UJO A;  5JIA A;  4DEV A;  1KFU L;  2VEC A;  3WDV A;  5KR7 A;  1NA1 C;  2B45 X;  5DAX A;  4PQQ A;  4LBJ A;  4WZF A;  5C7G A;  4QKN A;  5A6X A;  4ZY9 A;  4RS5 C;  2BDR A;  1NG0 A;  1WLD A;  2IVI B;  1FMD 1;  1AR8 3;  1NX9 A;  3ASI A;  3U4X A;  3OEA A;  3BOD A;  3O12 A;  4OUE A;  1YFY A;  4OI2 A;  4BJ0 A;  1DZT A;  3DEC A;  3J7L A;  4K8F A;  5IVJ A;  2WBK A;  4AF9 A;  4UFI A;  2V4V A;  3MPP G;  1IPJ A;  3H3L A;  2ADD A;  2CNA A;  1W6P B;  4IW3 A;  1JZ4 A;  2WT0 A;  3I97 A;  4JTO A;  1YWK A;  1W8N A;  1WA4 A;  4M00 A;  1PIV 2;  3DKQ A;  3LKJ A;  4RA0 A;  4W65 A;  4C1W A;  1CR7 A;  5BYN A;  4ZU5 A;  3OOX A;  4Y3O A;  5FY7 A;  1VJ2 A;  2RS5 2;  1I5Z A;  5T3N A;  4A7Y A;  5AC9 3;  2CWS A;  3UKN A;  1RUI 3;  1UY3 A;  2A6V A;  3I54 A;  2ZHK A;  4HOO A;  2CGP A;  1VRH 2;  1JU3 A;  1TNF A;  4HN0 A;  5KWR A;  4B8E A;  4CZS A;  4QDQ A;  1PGL 1;  5I0D A;  2CSG A;  2NQY A;  2JDP A;  2XL7 A;  4LBO A;  4YRD A;  3QLQ A;  3E5Q A;  1YXW A;  2O0O A;  3JXS A;  1ND3 B;  3C2U A;  2VMC A;  2TEP A;  4ASL A;  4NPM A;  2CYF A;  4OZO A;  4QPG C;  4XHX A;  2XJV A;  1K5M C;  2XR4 A;  2D93 A;  1V6I A;  3ZYR A;  1COV 3;  4W4Z A;  1L7R A;  4LO8 A;  1UXZ A;  4S2H A;  3POF A;  3UGF A;  4YFZ A;  5A32 A;  4LOS A;  4NHK A;  3SQO A;  3VD9 A;  1V9U 3;  5JI7 A;  4JGY C;  3AB0 A;  3FUO A;  2ZEW A;  4LMF A;  2YMZ A;  2GNT A;  3AZW A;  4URA A;  3D3A A;  3TN9 1;  5ABJ C;  1FV3 A;  5F6K A;  4EWE A;  3H8X A;  1NZI A;  1E5H A;  1V6N A;  3BIE A;  1XE7 A;  3OUI A;  2YY1 A;  5A80 A;  3JBG 3;  4WM8 B;  1Q56 A;  3N9P A;  3ZFG A;  4YG3 A;  4YW1 A;  2OA2 A;  3M3Q A;  2XON A;  4XBQ A;  1WCD J;  1X8E A;  3HOB A;  2PQQ A;  3OYW A;  4PCR A;  4V1P A;  1FAY A;  2YPD A;  5FY5 A;  4CCC A;  4QPI A;  5JZG A;  4LBN A;  3WG2 A;  2D43 A;  2GC1 A;  5FZ3 A;  4CDQ A;  1Q8O A;  3PVE A;  4LUL A;  3VBF B;  1LOB A;  2ZZQ A;  2D6O X;  1QU0 A;  2FCV A;  1Y7B A;  3POY A;  4JV4 A;  3ZXK A;  1O5U A;  1UX7 A;  4WVM A;  4YGC A;  3KM5 A;  4AYU A;  4P9L A;  2RJL A;  2ZJC A;  1YCI A;  3D8C A;  4QPY A;  2HWB 3;  5JCT A;  2VMH A;  3LCP A;  4PIX A;  1U0A A;  4CDW A;  1LB2 A;  1OQD A;  3FN9 A;  2V5Y A;  1AUY A;  1UIK A;  3LEM A;  1BEV 2;  2D98 A;  4KBB A;  3THT A;  2C0Z A;  5IW0 A;  4Q8K A;  1ZBE 1;  2W87 A;  2F6B A;  4K21 A;  1O4Z A;  4CEW B;  2XQX A;  2WFF 2;  3SH3 A;  4CUA A;  4C90 A;  4XHB A;  4KU8 A;  5EJZ B;  4JQR A;  5FZL A;  4YW6 A;  3VHR A;  2WZR 2;  4QX0 A;  2ARX A;  4XQ4 A;  5IYY A;  4OFG A;  1QF3 A;  5A7O A;  5JOY A;  5FZE A;  1N47 A;  2JEC A;  1K12 A;  2PA7 A;  5GLT A;  1KJR A;  2YGL A;  5JR7 B;  1LOF A;  5FYZ A;  3AMH A;  1FMD 2;  3VBR C;  3WDX A;  2JDA A;  4XAA A;  4WVV A;  3QAC A;  4Q5O A;  3KT1 A;  3RZL A;  5DMY A;  2QZ3 A;  4BA6 A;  5JWP A;  4OYU A;  4O9G A;  3NV2 A;  4JGZ B;  1RXF A;  4AED C;  4QWN A;  2Q4S A;  2XWJ B;  4HPK A;  5SV5 A;  3HBZ A;  4ZXK A;  2UU8 A;  1GP6 A;  5F3I A;  1OC1 A;  2GNM A;  3VBU C;  5KXD A;  2W95 A;  1QQP 2;  3N36 A;  4WVW A;  4HAN A;  5FRA A;  2ARA A;  1PMI A;  2CGN A;  4HT1 T;  4FPF A;  5FLH A;  4C8D A;  4XZP A;  2VCM A;  1XE0 A;  3J26 N;  2GMM A;  2LUW A;  2Y6F A;  5JR2 A;  2VUD A;  5FAX A;  2E51 A;  2RE9 A;  3ELN A;  4Z92 B;  2WN3 A;  5BNN B;  1S0J A;  5A3O A;  1ZRE A;  2XGX A;  4NHM A;  4Q8L A;  3ZSJ A;  1OF4 A;  3WW2 A;  3CNA A;  2VGD A;  4M0H A;  5E88 A;  3VZL A;  4MYE A;  3ZPO A;  2EA7 A;  1AJO A;  2DUQ A;  4LO7 A;  4PT6 A;  5F39 A;  3UGG A;  5FZC A;  4CP1 A;  2WIN B;  5T5P A;  1ZBA 3;  4W8J A;  5A7Q A;  3AYE A;  4NJ4 A;  2DCY A;  2GP3 A;  1QDO A;  2HWE 2;  2BZD A;  4XUR A;  3TN9 2;  1LEN A;  3S30 A;  3OCP A;  3OY8 B;  1W9W A;  2R16 A;  2EAK A;  3VZM A;  4XMI A;  3H8U A;  5CKQ A;  1XJA A;  2WNV B;  3KT4 A;  1SBD A;  1D4M 3;  3A0K A;  2VOX A;  3RZM A;  3VKL A;  2JG9 A;  5KC5 A;  1B35 B;  2ZML A;  4FPL A;  1O5L A;  4J6G A;  3I8T A;  1GOH A;  1UAI A;  4E2G A;  4M0N A;  1DQ0 A;  1QJU 1;  1M4W A;  4IV1 B;  2BFU S;  1POV 1;  2GDF A;  4L9B A;  1P8J A;  1ULG A;  3NKG A;  4IES A;  2QQI A;  1RIT A;  2RV9 A;  3ROU A;  4K40 A;  1O4T A;  1OUS A;  2XJS A;  1O4Y A;  5KHK A;  1QWR A;  5LB6 A;  2JWP A;  4GMP 1;  5I8T A;  4KGQ A;  4OHW A;  1YFX A;  5C8C A;  1ZBE 2;  5C6C A;  1XU1 A;  1TZO A;  4NO4 A;  3TNP B;  2QBX A;  4DB5 A;  1JN2 P;  3KCC A;  3QD6 A;  4FFI A;  4ONU A;  2WRA A;  4IQP A;  5IVC A;  1VBE 2;  2J7M A;  2R06 1;  1Z78 A;  1PIV 3;  2A71 A;  3ZOI A;  3THD A;  1QJX 2;  3RI8 A;  3QBQ A;  2ZA9 A;  1JYI A;  1NQJ A;  4AE2 A;  4GB3 1;  4EE2 A;  2R04 3;  1FX5 A;  1H4G A;  2Q8O A;  2QQM A;  2K0G A;  2ZGS A;  1VRH 3;  4XTP A;  4AQ2 A;  3KLS A;  4UWD A;  5L19 A;  4X6R B;  5FP8 A;  2VBD A;  1QDC A;  2VMD A;  4XZU G;  1IS6 A;  1RUG 2;  3E5X A;  4HMZ A;  1IPK A;  1HN0 A;  1RUD 1;  1W6M A;  2JDY A;  4HBN A;  1WCS A;  5I93 A;  1S55 A;  3AVR A;  3N9M A;  1QOO A;  3CJI B;  2D6N A;  1STM A;  1QKQ A;  5FP4 A;  5T54 A;  4MHR A;  1HQW A;  1WBL A;  4C0B A;  2XG3 A;  4Y33 A;  1GV9 A;  4XJ9 A;  4Z2W A;  2EXH A;  1XNT A;  3VBO A;  3VBS B;  1RUH 3;  2ZAA A;  3IAQ A;  1W0O A;  1LGB A;  3PME A;  4PBP A;  4QXB A;  2AEZ A;  4ISR A;  3UYJ A;  4EV0 A;  1L7Q A;  3GHM A;  1SBE A;  3K3N A;  1H1M A;  5LAT A;  4F8A A;  4D7T A;  4M4P A;  3KF3 A;  2ENR A;  3SCH A;  3W58 A;  4EN0 A;  2BQP A;  2CU5 A;  2ZHL A;  5HCB A;  2W1W A;  4PIZ A;  2FDH A;  4N7U A;  4QU2 A;  1MS8 A;  1UKR A;  1UL9 A;  4K9S A;  3ZXD A;  4RS5 B;  5FDB A;  1LU2 A;  2JB4 A;  3UJQ A;  1SCR A;  1AYN 1;  3ZYF A;  5DUU A;  2DUP A;  1JZ2 A;  1OOP C;  4MG2 A;  2G9F A;  3T1M A;  1QXP A;  1MS1 A;  2UY9 A;  2VCA A;  3K46 A;  3VHN A;  4F3J A;  1L7L A;  5EJ1 B;  5AFB A;  1SHW B;  3WCR A;  4DXS A;  5IWF A;  5KXE A;  4Q4W 2;  5IFT A;  3O14 A;  1JHJ A;  1R09 1;  3OGG A;  1CZV A;  5BV6 A;  4TWT A;  3WV6 A;  1H1I A;  4Y4R A;  3WNK A;  5FZ6 A;  2WNO A;  1BEV 3;  1NYW A;  2DWR A;  4WM7 C;  5J96 B;  4Y22 B;  2RS1 3;  4PQ9 A;  1AX2 A;  4Q26 A;  1IS5 A;  2UWB A;  1XBF A;  4XF1 A;  3ZDV A;  2WFF 3;  5FUI A;  3M1H A;  5I91 A;  4BHP A;  1GZW B;  2A5Z A;  3SLI A;  2QDN A;  5C9A C;  3ZFF A;  4XF0 A;  3RG0 A;  2B7Y A;  2HBT A;  4LKE A;  4AGV A;  4ZZ8 A;  4RR3 A;  4NN0 A;  3GF6 A;  1UCX A;  1W6O B;  4BWO A;  4LA3 A;  5BNQ A;  4BQW A;  5H9Q A;  4L97 A;  4AVB A;  5CFC C;  1UZW A;  4XC9 A;  5ACA 1;  2VMG A;  1DDL A;  3CDZ B;  4XDP A;  5HCH A;  1FMD 3;  3MIG A;  1JYV A;  5CEH A;  1MZE A;  4QPG B;  4FTB A;  1JS9 A;  1D4V B;  2YXS A;  4GQ7 A;  2KM2 A;  1POV 0;  3RYK A;  1US2 A;  3I2F A;  5FXZ A;  4B4Q A;  4QQO A;  1V6M A;  2WDB A;  3HAG A;  4JVA A;  1OBN A;  1RUF 1;  1UOB A;  2R06 2;  3KB5 A;  1QJE A;  2GSY A;  2ZGM A;  5L7O C;  3NAP A;  1DLC A;  1ND2 A;  3LAG A;  3PVB B;  4GMP 0;  4OUL A;  5FJK A;  3L2H A;  3ZR5 A;  5CU1 A;  1MQT B;  3ZSM A;  1AR7 2;  1GAN A;  1I6X A;  4LE4 A;  5KC6 A;  4EN7 B;  4Y5T A;  1OPO A;  1UW8 A;  4BLJ A;  5T5J A;  1ENQ A;  5IVB A;  1H9W A;  5HXM A;  3B9C A;  1O3S A;  1UZY A;  1URX A;  3ILF A;  5BNO B;  1ACC A;  5A3P A;  1IS4 A;  1GZ9 A;  4FFH A;  4NRP A;  3VKF C;  3ES4 A;  3VZJ A;  1RUN A;  3GAL A;  4YG6 A;  2JIJ A;  5E16 A;  2PN5 A;  5BUV A;  1NAE A;  2VZT A;  3HEI A;  5K4L A;  1VBC 1;  1Q8S A;  1CAU A;  1O59 A;  2J1A A;  4MGQ A;  5E89 A;  4I01 A;  2A6W A;  2VG9 A;  5F5Q A;  3WDW A;  4I0W B;  2VZP A;  4KWU A;  1YQ8 A;  4BIS A;  4XQD A;  5FK8 A;  3TN9 3;  4W50 A;  1XB9 A;  3DEM A;  3QH7 A;  5IUQ A;  1VBA 1;  3LDR A;  3TOJ A;  5FYU A;  4QB6 A;  5ISL A;  3KF5 A;  1UPI A;  1S0E A;  2P6C A;  5FY9 A;  5FLI A;  1C8M 1;  1E5I A;  2JXA A;  4CUB A;  5IAX A;  1DLL A;  1N3O A;  1RIR A;  3PIG A;  4MVT A;  4IGO A;  4EYU A;  4WVZ A;  4TXW A;  1WLC A;  4MGK E;  5IAV A;  1AYN 2;  3KQ4 B;  2QUO A;  1Y3T A;  3AZV A;  2ZGN A;  3POI A;  1JZ8 A;  3I49 A;  3KCY A;  1DYP A;  1WW6 A;  4Y5Z 0;  2RDS A;  1QJZ A;  2R7E B;  1UNB A;  2WT2 A;  3C8X A;  5D8A A;  3FLR A;  2A3W A;  4XFH A;  2C6S A;  1W9T A;  2OZJ A;  2PHD A;  2UWA A;  1JZ6 A;  1R09 2;  2YZ4 A;  1FYU A;  5A3W A;  3ZN6 B;  4XUO A;  3WX5 A;  1AHS A;  1LCL A;  4NHX A;  4GXL A;  4XAC A;  1W0P A;  2D3S A;  4GWM A;  2I74 A;  4CTE A;  3I3B A;  3AP5 A;  3VDB A;  2PAK A;  1ZBE 3;  2XBO 1;  2WNE A;  4ARX A;  2F4L A;  2XLA A;  2CGO A;  4NRM A;  5J98 B;  3ZFG C;  2VZV A;  1OKO A;  2PFW A;  2VXR A;  1OI6 A;  4I30 A;  4YAR A;  2ZEX A;  5K9Y A;  1O8S A;  4QKF A;  3NNM A;  2RR1 2;  2ZGP A;  2ET7 A;  4Y1Y A;  1DQ4 A;  1JI6 A;  4Q0S A;  5HCA A;  3LB9 A;  4Q0U A;  4QPI C;  5JZG C;  2ORZ A;  5EZW A;  3ZXL A;  2OZ6 A;  4H55 A;  1PVC 1;  2BU9 A;  3B02 A;  4CDQ C;  3U0Z A;  4XAB A;  2BBV A;  1HXS 1;  3R05 A;  3WQ7 A;  2TUN A;  3GJB A;  2JDN A;  3IN9 A;  1GP5 A;  5GZD A;  3V56 A;  2D6P A;  2W94 A;  4AW7 A;  1FV2 A;  2A75 A;  3H3U A;  1H6X A;  1MEC 2;  2FMY A;  3TWI A;  4UAP A;  4CE8 A;  4CDW C;  4NHL A;  1SBF A;  1BCX A;  1RUF 2;  1WBF A;  5FZ4 A;  2P34 A;  2XHK A;  3I3Q A;  5C4W A;  5T52 A;  5B4N A;  5JSO A;  3VLB B;  2OUJ A;  2W1U A;  3HQU A;  2E7Q A;  5FZB A;  4ZHN A;  4L2N A;  1CAW A;  5L9V A;  2OPW A;  2WAO A;  1S0I A;  3IPV A;  3NV3 A;  3POS A;  4AFM A;  4D6S A;  2BGO A;  2WAB A;  1ZM1 A;  3BPZ A;  4XFB A;  3BCW A;  3VKO A;  3CLP A;  1YFW A;  2QE3 A;  1YHF A;  2J1E A;  1OLM A;  2P4E A;  4FT8 A;  1S0G A;  3OPT A;  4CP9 B;  5BNP B;  1WLT A;  1ZRI A;  2RG4 A;  2WII B;  2X29 A;  3MIE A;  4M01 A;  1K42 A;  1LOF C;  2VXJ A;  4N9I A;  2R07 1;  4PDW A;  4BXF A;  4QDS A;  1NCQ B;  1ASJ 1;  4Q2F A;  5FWJ A;  2X5I A;  3ACF A;  4E4D X;  1BVV A;  1NLQ A;  4AI9 A;  2ZXQ A;  4XE9 A;  3V64 A;  3ZYH A;  3I2H A;  3I4I A;  3A7Q A;  1VBB 2;  2BEO A;  3ZFE A;  4P9J A;  5FY0 A;  4JQT A;  1TEI A;  2NN8 A;  5H9R A;  3TNQ A;  1W6Q A;  3D5O A;  2QQU A;  3THP A;  1J83 A;  3ETP A;  3LWC A;  1RTV A;  1TNR A;  1F4H A;  4KBZ A;  3OB8 A;  4Q1R A;  5J48 A;  4CDX B;  4K20 A;  3WG1 A;  1S2K A;  5CFD A;  3IIA A;  1BLZ A;  1VBA 2;  3BIW E;  3OG2 A;  4LO4 B;  3N7L A;  5J7M A;  5EV7 A;  3O1O A;  1EAH 1;  1KDK A;  1C8M 2;  1Q8Q A;  1ZZ7 A;  2HWF 1;  4QB2 A;  4HVQ A;  2WR9 A;  5C5U A;  4IEO A;  3WP4 A;  5C33 A;  2BNN A;  1MZF A;  4J1W A;  3AKR A;  1W2T A;  4FPC A;  1RB8 G;  1W03 A;  1UX6 A;  4LBK A;  2V5D A;  5FYB A;  2Q1F A;  1QJU 3;  3AFK A;  4AEJ A;  1POV 3;  3CO2 A;  2DYC A;  2ZX2 A;  3S7I A;  5DUV A;  3MO4 A;  1EPZ A;  1UKG A;  1VMH A;  4RL7 A;  2P37 A;  5AVA A;  1R08 1;  4S2G A;  2CDP A;  4XIK A;  1JZ7 A;  4GMP 3;  3HVD A;  3I3E A;  4YVW A;  2QVS B;  2XBO 2;  2DUO A;  3OBR A;  4A6S A;  3UKT A;  2JEN A;  1DCS A;  2P6H A;  1Q5O A;  2WKK A;  2WQ4 A;  3HT1 A;  3P5B A;  2WSV A;  4R52 A;  3O1S A;  4XJU A;  1G9A A;  1NY7 2;  4LBQ D;  2R06 3;  3U11 A;  3MIH A;  1GNH A;  4CP0 A;  2K9Z A;  1W9S A;  3IDC B;  2ZMK A;  2MNG A;  4CXY A;  4KNC A;  1UOF A;  1PVC 2;  4GB3 3;  4AK3 A;  1NE6 A;  4QKB A;  1HXS 2;  3X29 B;  1CVN A;  4L11 A;  1ULD A;  2XDV A;  4I2O A;  4K3U A;  5DDJ 2;  5A7W A;  2HH9 A;  4GKX A;  2WSU A;  2QCS B;  1VB4 A;  3IM0 A;  2FCU A;  2IXI A;  4GWJ A;  4I09 A;  3ZIW A;  3U1X A;  1RUD 3;  2OYZ A;  3WHT A;  2R6Q A;  4P9G A;  1A3K A;  2AR6 A;  3M4F A;  2NM1 A;  3VHP A;  1OOP B;  3BVC A;  2AEY A;  1PO1 1;  3CKH A;  1H6Y A;  1HRI 2;  1W05 A;  5G05 L;  5C8C C;  2VJX A;  4LQR A;  3O0X A;  5CIS A;  1W8T A;  4GAL A;  2WO2 A;  4HON A;  4RGG A;  4IE7 A;  4P14 A;  4OVE A;  3B7M A;  4F83 A;  1C4R A;  1V00 A;  1JYX A;  1VMJ A;  1T2X A;  2Y8K A;  3SNM A;  3LEK A;  4LBM A;  4QQP A;  5GM0 A;  4O65 A;  1ASJ 2;  1LNS A;  4FFF A;  1X50 A;  3IAP A;  4HSJ A;  3ZYP A;  1SMV A;  3PUS A;  3SHR A;  1RUJ 1;  3DGT A;  4QKD A;  3ZSE A;  1U12 A;  2Q1M A;  1X33 A;  5EXO A;  2RS5 1;  1JOD A;  3HNM A;  2NZ9 A;  3PLQ A;  3T09 A;  1AYN 3;  4O7X A;  4GH4 B;  5FPV A;  5BY5 A;  1OVP A;  1J59 A;  1DGR A;  4XUT A;  3T30 A;  1TVG A;  5FBZ A;  3VBO C;  2YC0 A;  5CA6 A;  3IWZ A;  1R09 3;  3LE0 A;  4BPZ A;  2EXJ A;  5F1R A;  3A0N A;  2KA3 A;  2VZ1 A;  2XHN A;  4GWI A;  2H6B A;  4YW5 A;  3R6S A;  4E4Z A;  4MH0 E;  4Q29 A;  5LCW L;  3WF4 A;  3AXD A;  4BQY A;  4AWD A;  4RGK A;  4A41 A;  3MI8 A;  1ZRF A;  4NIH A;  1SPP A;  2EID A;  3O1V A;  4EJR A;  3K4Z A;  4YM1 A;  5JSP A;  4Y24 A;  5JUV A;  4JDM A;  3DYM A;  3JZV A;  1S2B A;  3H7Y A;  3A23 A;  4P9W A;  1LES A;  4YGD A;  5GAL A;  2Y33 A;  1LEM A;  3H8O A;  4CDU B;  2Q0A A;  1XNB A;  3T4H B;  3KHC A;  4LKD A;  4P9X A;  5ACA 3;  1R08 2;  3V65 A;  3WOG A;  1H2K A;  1UYZ A;  3ZXG A;  4YM3 A;  1LAJ A;  1KEX A;  3ACH A;  1XSR A;  1NQD A;  5EQU A;  3TEW A;  1CAV B;  5AFE A;  2XOM A;  4IER A;  1TQ5 A;  3EJK A;  3TEZ A;  1RUC 1;  2YB7 A;  2UWC A;  2WN2 A;  1RUF 3;  1F31 A;  2W92 A;  4CU7 A;  2MPF A;  4NPR A;  1MVQ A;  4ZZ5 A;  2VW1 A;  4YVS B;  3SCF A;  1WW4 A;  2Y34 A;  5JDB A;  3ZFF C;  4Z82 A;  5LBB A;  1LED A;  3H0O A;  3N9L A;  3DCQ A;  1QOT A;  4B7K A;  1SFN A;  2OQ7 A;  4HLT A;  3GCW A;  2VW0 A;  1ZZ9 A;  4RR3 C;  1M06 G;  1RXG A;  2CHH A;  3VD7 A;  1WME A;  2Z4F A;  2D40 A;  4BU2 A;  1LR5 A;  1DF0 A;  4XFF A;  3F95 A;  3ZYJ B;  2O8Q A;  5JMC A;  1PVX A;  4EWD A;  2WZR 1;  2WNU A;  1NCR A;  1OA3 A;  1UYX A;  2QQO A;  3USU B;  3WP5 A;  5JVV A;  5EYX A;  1VBC 3;  3OGS A;  2QQK A;  4RFT 0;  2BW8 A;  3I2I A;  3KVB A;  4FOV A;  2NMN A;  3NAP C;  1ND2 C;  5J37 A;  5IK8 A;  4LTA A;  4ASM B;  5FMC A;  2X8K A;  3HPN A;  1OQE A;  4UF0 B;  4DOU A;  1SLI A;  1VBA 3;  2FQP A;  2R30 A;  2C4X A;  4LLF A;  5FPB A;  5FZI A;  5IJR A;  2YC4 A;  4A4A A;  4CXW A;  3ENR A;  3OYW B;  1RUJ 2;  4FPH A;  1C8M 3;  1QEX A;  3ATG A;  2GU9 A;  2VUL A;  3M3C A;  1KJL A;  1Y4W A;  2BBA A;  4QPI B;  4Y4Y A;  2LW8 A;  1SLB A;  4JRL A;  1IKQ A;  1JYN A;  3SMH A;  3T1L A;  1QQP 1;  1VIW B;  1O3R A;  4E8C A;  3HWJ A;  3WSO A;  5FXW A;  2DUR A;  3N35 A;  3VBH A;  2A70 A;  5FPU A;  2VVD A;  3DL3 A;  4CCL A;  3TAY A;  2LM3 A;  3VGI A;  2X10 A;  5CIR A;  3WDY A;  5C8W A;  1N3Q A;  2WFP A;  2VE1 A;  5A7S A;  4E4H A;  2FD8 A;  4LO5 B;  2VNV A;  1GWK A;  5A3T A;  4IV3 B;  1CZT A;  3KV9 A;  3MUY 1;  2G4I A;  1CON A;  5F6L B;  1MR5 A;  2VY0 A;  1WCQ A;  3GBF A;  4XIL A;  3LA2 A;  1W99 A;  1OUX A;  1YJK A;  3CQO A;  4RYD A;  1CX4 A;  5T55 A;  2XBO 3;  1CJD A;  4ES9 A;  2JG8 A;  4AAX A;  2D6L X;  4RQP B;  4CCK A;  4JC1 A;  5C3P A;  1VMF A;  1N3P A;  3J8F 2;  5A33 A;  2HWE 1;  4FVV A;  4KG8 A;  1QGL A;  3OD4 A;  4QGL A;  4BOW A;  1O3T A;  1DZQ A;  2I07 B;  3I59 B;  4Q4V 1;  4UW3 A;  1JH5 A;  1YQC A;  1PVC 3;  2ET1 A;  5F7U A;  5JXH A;  3DUI A;  1H2M A;  3BB6 A;  4YNI A;  3W20 A;  4XYX A;  1S0F A;  5D8A C;  3TEX A;  1HXS 3;  4JRA A;  2Y6H A;  5A6Q A;  5F37 A;  1UU4 A;  5F3C A;  3PUQ A;  2VQT A;  3HN3 A;  3CIH A;  1LKN A;  5GLZ A;  1RUC 2;  3AYC A;  4LIT A;  3WG4 A;  1JYT A;  3H9A A;  3AP4 A;  5CB7 A;  1X7N A;  2BOI A;  3T2O A;  2ZS6 B;  2JKB A;  1R64 A;  3HQR A;  4Q0V A;  2OPK A;  2BP6 A;  5KHI A;  2JKX A;  3SCG A;  1DQ2 A;  5FZO B;  4KGG A;  1BKZ A;  4DY3 A;  5LEK A;  1ZZ6 A;  1AYM 2;  5FYT A;  1V70 A;  4JHZ A;  3U4S A;  2GAU A;  2VW2 A;  5A70 A;  4DXT A;  1WKY A;  2E32 A;  1WD3 A;  1QXJ A;  1W6P A;  2DBN A;  3SKJ E;  5I8S A;  1GR3 A;  2W68 A;  2WYF A;  3U75 A;  1J3P A;  5LRR A;  2R07 3;  4FOQ A;  1KIT A;  3FLT A;  1RHI 2;  1ASJ 3;  2GMP A;  4JDO A;  1W2A X;  1UWW A;  1GKB A;  1VLN A;  5F2W A;  1VBE 1;  2DCJ A;  5E8A A;  4OI4 A;  1ULO A;  1MAC A;  3LOI A;  1W8O A;  4KG0 A;  1QJX 1;  4QPW A;  2ZAC A;  1YEW A;  3O1T A;  1V6J A;  5T5L A;  5J1X A;  2XVK A;  1C57 A;  1EY2 A;  4N9H A;  4BZ4 A;  5FZK A;  1RUO A;  2W52 A;  4UFJ A;  5ERL A;  4C0H A;  4OI1 A;  2HWC 2;  4CXX A;  1RUG 1;  1YQ5 A;  3NL1 A;  4W6Y A;  3RYP A;  3WQ1 A;  2XVL A;  5C3O A;  3WVJ A;  4FTS A;  4I02 A;  2PAE A;  3Q8E A;  1EAH 3;  4LT5 A;  2HWF 3;  2HBU A;  4PDW C;  5FPL A;  1DQ5 A;  2X5I C;  3RDI A;  1W28 A;  4P9I A;  3IKW A;  4AOC A;  2FDF A;  1LEC A;  1HV1 A;  5DZG A;  3H1M A;  3B00 A;  4FAH A;  3ZFE C;  1KRI A;  3ILR A;  2WWS A;  3PHM A;  3LDK A;  4AL9 A;  3GHN A;  3WEZ A;  1F2N A;  5J09 A;  4QHO A;  5K0U B;  5HI0 A;  1IZ3 A;  3P6B A;  2AH2 A;  3CZU A;  3VZN A;  2VZ3 A;  1R08 3;  4XDO A;  1S1A A;  1DYO A;  1W6N B;  2UUR A;  1QMJ A;  2VAU A;  5FZM A;  1BK0 A;  1BHG A;  1JZ5 A;  5CFD C;  4ZS2 A;  3RPQ A;  3WW4 A;  3DF0 A;  4XJA A;  4OCT A;  1GWM A;  1RL3 A;  3VBF A;  5FYH A;  4QQ2 A;  2LRO A;  3ILN A;  2JD9 A;  4RHV 1;  1EP0 A;  4DXR A;  4NIG A;  2OT7 A;  2YBS A;  1LHU A;  4MGS A;  4QX8 A;  3O1M A;  5CG8 A;  4Q4V 2;  3WW3 A;  4Q4W 1;  1F5F A;  2F17 A;  4LHS A;  3K4A A;  2ZAH A;  3IZO A;  2JEM A;  5DG2 A;  1QIQ A;  2ZGU A;  3W5N A;  1NXD 1;  1GQP A;  4P5H A;  3RFR A;  1W6M B;  1NE4 A;  2RHP A;  2Y38 A;  4I3G A;  5M0T A;  1WLW A;  5CAZ A;  3ZSK A;  2XJU A;  5L9R A;  5LA9 A;  1PO1 3;  4YVW C;  1US3 A;  1HB2 A;  2Y0O A;  2Y6K A;  1WW5 A;  3VDD B;  3P1I A;  4KMQ A;  1O6U A;  2YV8 A;  1DQ6 A;  3TEY A;  1F8V A;  3JQW A;  1W8Z A;  1JTZ X;  4CRQ A;  1WD4 A;  2ZHN A;  4QD2 A;  4JGZ A;  1BZW A;  1PNG A;  2DBI A;  2ZX1 A;  4LIU A;  5IK7 A;  4ET7 A;  1W8W A;  2PHW A;  2O8O A;  5F8P A;  1BBT 1;  4HKW A;  3AKT A;  4E27 A;  3OPZ A;  2IC1 A;  2ORX A;  4JAA A;  3BTA A;  1O7F A;  3KS7 A;  3K77 A;  4PIY A;  2FZ1 A;  1RUJ 3;  5FP9 A;  1ALY A;  1IHM A;  5DUX A;  4DPN A;  3ZR6 A;  1F5J A;  1D2Q A;  1PZ7 A;  1XYN A;  4TSV A;  2DCT A;  1E5R A;  2RS5 3;  4CVU A;  4D69 A;  1AR7 1;  4TZD A;  2JDH A;  4UXA A;  4XET A;  2FZ2 A;  3OBA A;  3O1U A;  2JE8 A;  3KMH A;  5FZD A;  4OLL A;  1AR6 2;  3KHB A;  5BNN A;  2D6K A;  1VP6 A;  1WMX A;  2D5H A;  1JHN A;  1LHV A;  2YPJ A;  1AVB A;  1DGW A;  2VU9 A;  5FBJ A;  5FZH A;  3AFG A;  5BXX A;  1ZVF A;  4OQ9 A;  3CZJ A;  3EO6 A;  5A1L A;  3H7J A;  2WUH A;  1UOG A;  4JDN A;  1ULP A;  2P2K A;  2B5H A;  3S6P A;  2GN7 A;  3HJR A;  2G19 A;  4K1Y A;  1LHW A;  4IEZ A;  4LHK A;  5LA2 A;  3VD3 A;  4BIO A;  5DN2 A;  4QGN A;  1GMM A;  1AL0 G;  3THC A;  4ZKT B;  1LHO A;  2C5D A;  4AFD A;  1GSL A;  4CSW A;  4IL7 A;  4XEZ A;  5L36 A;  3OY8 A;  2CTV A;  1NKG A;  4ATE A;  1LRH A;  2WWU A;  4K1Z A;  4N43 B;  5EJ3 A;  3I2D A;  3I2O A;  5EP9 A;  3BGA A;  2WNV A;  4QM9 A;  2LAL A;  5JPM B;  3H3Z A;  5A1A A;  4ZS3 A;  3GBG A;  1NA1 B;  5FZG A;  5KXC A;  3BI3 A;  1B35 A;  1H2N A;  2DV9 A;  3E5U A;  1ZX5 A;  2VO5 A;  3GJA A;  5F32 A;  3HBK A;  4IV1 A;  1RUC 3;  4QXK A;  4FCA A;  4RHV 2;  4MLO A;  2K46 A;  4HKO A;  2VMF A;  1UY2 A;  4N90 A;  4XMA A;  2QZ2 A;  3IB3 A;  1IKP A;  2OQ6 A;  2J1V A;  1JOJ A;  3HR9 A;  3RVH A;  1ENX A;  3INA A;  1X9P A;  4BQ2 A;  4RN5 A;  3GXU A;  2ZGR A;  4IDZ A;  3GZE A;  5FV3 A;  5DZF A;  4KWJ A;  4NPL A;  3NW4 A;  5I0R A;  5JLV A;  2YFZ A;  5FYV A;  5GZC A;  2MHF A;  2OII A;  1HX6 A;  4X8N A;  5I0T A;  1ZRD A;  3NVC A;  1CAX B;  1GQG A;  3P3N A;  4LJH A;  4PLN A;  2WZE A;  4MOA A;  4EQV A;  3JD7 1;  3N9Q A;  2WZR 3;  3IDE A;  5A6Z A;  2RR1 1;  3KV5 A;  2QQN A;  3KCX A;  2ZMN A;  5IT6 A;  1WGP A;  3V0A B;  2UYA A;  4AVC A;  2W47 A;  3BU0 A;  3MYX A;  2P1B A;  3URF A;  5K8S A;  3Q9O A;  4COV A;  5K7P A;  3E6D A;  1PHM A;  1K5M B;  1LUL A;  5JXJ A;  2NYY A;  5CKM A;  5AVP A;  3QH6 A;  1XU2 A;  1BBT 2;  5FY1 A;  3CJI A;  4N53 A;  1MEC 1;  2JJ6 A;  4XBN A;  4M3C E;  1F4A A;  4GIQ A;  4JGY B;  1ULF A;  1J58 A;  4BQ1 A;  4LOT A;  2XXZ A;  4QXC A;  3T2Q A;  3ZKY A;  3AKP A;  1UMI A;  1ONA A;  1X9T A;  5ABJ B;  4GKY A;  1REF A;  3VBS A;  1A6C A;  4AI1 A;  3ZVX A;  4F7Z A;  1QQP 3;  4OUM A;  1ZYB A;  3EYP A;  3RS6 A;  2VNR A;  1OHF A;  2VVE A;  2WNU C;  1NCR C;  3OUJ A;  4AQ6 A;  3RGB A;  2RS3 1;  2H6C A;  2ARB A;  4JKL A;  2ADE A;  1O8P A;  2J22 A;  2YU2 A;  4AR2 A;  2BPA 2;  4QAW A;  1BMV 2;  2ZZJ A;  5E1R A;  1CES A;  4IEU A;  5EPA A;  2EAL A;  4CCE A;  1D0G A;  4FXG B;  3R4D B;  2EVX A;  2PLV 2;  5F3G A;  4UYB A;  1VBB 1;  1QHD A;  5DAQ A;  3C7H A;  2RVA A;  2WO3 A;  5F3E A;  3POB A;  3O0W A;  3K3O A;  1MZ6 A;  2XPJ A;  3N9O A;  4MZU A;  1UO9 A;  2KD7 A;  4LHL A;  1UZ0 A;  1ZRR A;  2RMU 1;  1W2U A;  5APA A;  2HWE 3;  1UIJ A;  2RJK A;  1EPW A;  1UMH A;  1X82 A;  1CIW A;  4KH9 A;  1DU3 D;  4LBL A;  5GJ6 A;  4Q4V 3;  3RYR A;  4O61 A;  4Y1X A;  1IGO A;  3DXU A;  4XPV A;  3VBH C;  3NST A;  4Y22 A;  4LUM A;  5EYY A;  1VAL A;  3WZ1 A;  4RD7 A;  4NII A;  2DTW A;  4H2A A;  2Q8C A;  4AFC A;  4MX3 A;  4QB1 A;  5CNA A;  1GZW A;  1Y9G A;  1KGY A;  5JOW A;  1EYB A;  3VBR B;  5A3U A;  2DU1 A;  3A21 A;  1XSQ A;  2WC2 A;  4FP3 A;  1U5I A;  1CAW B;  4LXL A;  4XJW A;  4DO0 A;  1W6O A;  3AMP A;  2P5B A;  4HKL A;  1OUR A;  4A6O A;  2R49 A;  2DVA A;  1KDM A;  2W5F A;  2Q8D A;  3B9I A;  5IVF A;  3MZH A;  2JG8 C;  3R4S A;  3HIF A;  4YWA A;  3TYJ A;  3U78 A;  3LDB A;  2PHL A;  1HB4 A;  4AED B;  2L9L A;  3M3I A;  1JBC A;  2FCT A;  3G7D A;  3ZN5 A;  4KWL A;  3KVA A;  3IT8 A;  2HJI A;  2Y6G A;  2OKX A;  1ST8 A;  2JD4 A;  3VBU B;  1T6B X;  3B01 A;  2W9X A;  4W6W A;  1MS3 A;  1H30 A;  2IXL A;  4ATF A;  2WA3 A;  1HN1 A;  4AVA A;  1SDD B;  1C1F A;  3RI9 A;  3ZFE B;  3DPR A;  3JD7 2;  1VBE 3;  1MQT A;  1NY7 1;  1K5J A;  1UZV A;  3WNP A;  3NWK A;  2HLE A;  2VNO A;  3AVS A;  3OBZ A;  1QJX 3;  3FLP A;  2VUC A;  1AXZ A;  1YQ2 A;  1RYY A;  2EIE A;  2WLP A;  4KI5 M;  3ALQ A;  3S57 A;  3V0B B;  1DIW A;  5DZE A;  1C5I A;  1YJL A;  3JU9 A;  4YW4 A;  2VZR A;  4JX0 A;  5BNO A;  5GLW A;  2WT1 A;  2VQ0 A;  1SQ4 A;  2V09 A;  3OSD A;  1E57 A;  4CU8 A;  1IQD C;  2BGP A;  5DDJ 1;  2BYV E;  4GUL A;  5FOB B;  2ZKL A;  2J1R A;  3IBM A;  1RUG 3;  3N7J A;  2DVG A;  2D5F A;  4LBQ B;  4BLI A;  3OTF A;  2FHR A;  4Z8B A;  1W9F A;  1A8D A;  3BN6 A;  3AMQ A;  4ZPI A;  1IS3 A;  5FWE A;  1S0C A;  1HRI 1;  5DPN A;  3ZO0 B;  4E4S A;  3MEP A;  1ZRC A;  3MGU A;  2TBV A;  3NQH A;  4CCN A;  4ITC A;  3WHU A;  4Q4X 2;  1CQ9 A;  3WLU A;  2DDU A;  3OEB A;  4YYO A;  4BK4 A;  4KU7 A;  3DV8 A;  5C3R A;  4RFR B;  2RS3 2;  1B09 A;  4IEW A;  5DUW A;  2HEY F;  3VDA A;  4A45 A;  2GZW A;  4BXS V;  5FQ0 B;  2E31 A;  3NKT A;  4FPJ A;  1RGS A;  1JOP A;  1OMI A;  1H8V A;  1XYP A;  3O5S A;  4KL1 A;  5J3U A;  3EHK A;  3ZXA C;  1YRZ A;  3ST7 A;  3OF1 A;  1Z0H A;  2P3Y A;  1OFN A;  1YUD A;  1HRV 1;  2CY6 A;  2RDR A;  3BPS A;  3D0J A;  4P9Y A;  2XVG A;  3BKZ A;  5ANN A;  2E7T A;  3O1P A;  2PHX A;  1Q8V A;  2RMU 2;  4ISQ A;  4RHV 3;  3RZG A;  5A7N A;  2GP5 A;  2G1M A;  2WYS A;  1K3I A;  2Y6L A;  4OMC A;  4R9D A;  5FYC A;  3AMN A;  2Q1Z B;  3I3D A;  1DYK A;  2ARC A;  2XH6 A;  4Q4W 3;  5EHD A;  4GJZ A;  5L9B A;  3LOB A;  5A7W B;  2BRT A;  4A2U A;  3GZT B;  3N3H A;  4MGZ E;  5LK5 A;  2YRO A;  1S0D A;  1WWY A;  4B7E A;  5EFU A;  5FJH A;  2VOK A;  2Y6J A;  3H42 B;  1AL2 1;  4XAE A;  5C71 A;  1ZZB A;  4CPB A;  2ZGT A;  4L99 A;  1FPN 1;  4URT A;  3MW3 A;  3PU8 A;  1JOB A;  1XNA A;  5LBE A;  1UY0 A;  2VH9 A;  3RWN A;  3MFA A;  3LSE A;  4MXW B;  3VBF C;  1R1A 1;  2IXJ A;  3AP7 A;  3LEG A;  1N1S A;  1GU3 A;  1YFU A;  1J1L A;  4Y20 B;  4NOT A;  3ZN4 A;  2VQU A;  5FO9 B;  4P02 B;  4PF5 A;  2AAC A;  1E5S A;  4YM2 A;  5FZ7 A;  3EB7 A;  4YZ2 A;  4IUG A;  3WY6 A;  3MPB A;  3U07 A;  1DFQ A;  4DEQ A;  1OD3 A;  3UL2 A;  2BWC A;  4AQT A;  5AC9 2;  1FT9 A;  4M3C B;  1BBT 3;  1C1L A;  3WF0 A;  4GD4 A;  1BXH A;  3PL0 A;  4IEY A;  3ZLI A;  4E2Q A;  5IVE A;  1JZ3 A;  1T6G C;  2YG0 A;  2BNM A;  2ZCW A;  3C7O A;  1CJP A;  1UY4 A;  3C7E A;  2VZO A;  3MIF A;  2JG9 C;  1AR7 3;  4UOJ A;  4CP9 A;  3HQX A;  2XJR A;  5BNP A;  5CBL A;  4Q4Y 1;  4LHN A;  1W0N A;  1XNK A;  2YGM A;  4L0P A;  2HYK A;  1NCQ A;  3NNF A;  3USS A;  4YSF A;  2AC1 A;  4PJY A;  5DAW A;  2ZBJ A;  1COV 2;  1HLC A;  4I3P A;  1MZ5 A;  5FPZ A;  5LZ6 A;  2BJS A;  1V9U 2;  1W2O A;  4XJ8 A;  2G9Z A;  4JGZ C;  5LW9 A;  3QOP A;  4XVH A;  1RJ7 A;  2PXJ A;  1HW5 A;  2R1D A;  3KQR A;  2YHJ A;  1QJF A;  4X8P A;  3AK0 A;  3ZSL A;  2P3K A;  1DZR A;  1JMU B;  1PGW 1;  3WNM A;  1OA2 A;  4JZR A;  5FYY A;  3ZKU A;  4CDX A;  5LA1 A;  2XLF A;  3JBG 2;  4FAG A;  1Z7S 1;  2J1U A;  4C1X A;  4TYS A;  3KSC A;  1SLA A;  3I2J A;  4WM7 B;  1HB3 A;  4NUB A;  2QQV A;  3EBR A;  3LGR A;  5HXV A;  4YZ4 A;  3LPG A;  3WNN A;  3WQ0 A;  3MIC A;  3UET A;  4PLM A;  4Z1V A;  3ORJ A;  5H9S A;  5C9A B;  5DXD A;  1KXG A;  1G8W A;  5BNN C;  2ZAB A;  4DUW A;  2WLQ A;  1SLC A;  2ZGK A;  1I3H A;  3T0D A;  4CUC A;  4AQS A;  1YNA A;  4EZ4 A;  1HKD A;  1GLH A;  1HRV 2;  4AHY A;  5CFC B;  1H2L A;  4R9A A;  4QQL A;  5FOJ B;  1S2E A;  3UGH A;  1SCS A;  2C1F A;  4MGY E;  3PVN A;  1KS4 A;  4U2A A;  4XFA A;  4XQW A;  2YU1 A;  3PJQ A;  1PK6 A;  4AI3 A;  4JKK A;  2BV4 A;  3LD8 A;  3WT3 A;  5FTT C;  5A3L A;  1X36 A;  2HYX A;  5FMO L;  4B29 A;  4IXL A;  5L7O B;  2VVF A;  1RMU 1;  3HT2 A;  1WUV A;  3ZIX A;  1AL2 2;  4FTE A;  3KWV A;  2EF6 A;  3LF7 A;  1PZ9 A;  5GKA C;  3RZH A;  3ACI A;  2WNV C;  1Y9Q A;  2VOT A;  4B1M A;  5F5A A;  3GDB A;  1FPN 2;  1LGN A;  2VNG A;  4W6X A;  4AEK A;  2A6X A;  1YIP A;  1AXY A;  2PEL A;  3J8F 1;  3JD7 3;  3OGR A;  1B35 C;  4HL0 A;  4QGM A;  1MS9 A;  2RR1 3;  4U36 A;  1R1A 2;  1LOA A;  4WV8 A;  4CEY A;  2P3I A;  3SIS A;  3AM2 A;  4IV1 C;  3SH5 A;  3MID A;  4CUG A;  4IEP A;  3E97 A;  2CDO A;  1ENS A;  1PX4 A;  5FRE A;  1SLL A;  3LA3 A;  3NO8 A;  2I45 A;  1G9C A;  5BPX A;  4HFS A;  1CZS A;  4R4X A;  3I2G A;  1JUH A;  2VUJ A;  5FKB A;  4AEM A;  2BVB A;  2RDQ A;  1MEC 3;  1YI9 A;  3T3Y A;  3WF1 A;  2WJS A;  1A34 A;  1H8T A;  3HN1 A;  4FPE A;  4I0A A;  2QQP A;  1LHN A;  1O3Q A;  4QX2 A;  5CZK A;  4XW3 A;  4ERO A;  1QJY 1;  3VBH B;  4YM0 A;  3ETQ A;  4BB3 A;  1F35 A;  1BK1 A;  3III A;  4Q4Y 2;  2WS9 1;  3S0M A;  1AYM 1;  4PF1 A;  4HVO A;  2EIB A;  1PNF A;  2UYB A;  2X05 A;  4COW A;  2XB6 C;  4HSL A;  5JMO A;  4SLI A;  2RS3 3;  1GFF 2;  4WBB A;  4NMI A;  3H1Y A;  2E6V A;  2Y0I A;  3EXU A;  5JSR A;  1ZBA 2;  4Y1Z A;  2QQJ A;  5T50 A;  1RHI 1;  4BE3 A;  3BTX A;  1CWP A;  2QQW A;  3ABZ A;  4QM8 A;  2NPI A;  3M7A A;  4FBF A;  4FOY A;  1W3X A;  5A32 B;  2JG8 B;  3CL1 A;  3CJI C;  4N53 C;  1VBB 3;  4GH4 A;  1PGW 2;  1TMF 1;  1VE0 A;  1ZNP A;  2BVV A;  3MV1 1;  1VAV A;  3NNL A;  5JOZ A;  3D4K A;  1KD7 A;  3FX3 A;  4MET A;  4ASK A;  1FXZ A;  3K4D A;  1PGS A;  1Z7S 2;  3MV0 1;  4Y1V A;  4XCB A;  2ES3 A;  2RMU 3;  1U5X A;  5F2S A;  5A7P A;  3U10 A;  2X53 S;  3VBS C;  1EV1 1;  3MF6 A;  3PIJ A;  4A7Z A;  3NV4 A;  2GC0 A;  1CPN A;  2ATF A;  1DGR N;  2FDJ A;  2FBE A;  2HWC 1;  3ZFG B;  1C3H A;  1BYH A;  2VTX J;  2XJP A;  1GUI A;  4LUK A;  4WZC A;  3WF2 A;  4IGQ A;  1CN1 A;  2HWD 1;  5JZG B;  1OF3 A;  3WD5 A;  5LBC A;  4CDQ B;  1ODM A;  2K2S A;  4P00 B;  5FMB A;  1LOG A;  1KQR A;  2DVB A;  4CDU A;  1OA4 A;  4WVM B;  4YZ5 A;  5IK4 A;  2GN3 A;  2C24 A;  3IMN A;  3K75 B;  4LR4 A;  3ZX7 A;  1XYO A;  4UW6 A;  3ITQ A;  1IG0 A;  2GH8 A;  2LRP A;  2QJV A;  4FFG A;  3ME2 A;  5FK7 A;  4CDW B;  4ARY A;  4B3N A;  1AF9 A;  1CAV A;  3VUO A;  1RC6 A;  4BQ5 A;  2RDN A;  2WWJ A;  2A6Z A;  1RMU 2;  4C91 A;  1PO2 1;  4A3Z A;  2IXK A;  5IVV A;  1J1T A;  1HIX A;  2GAL A;  3OJB A;  3F2Z A;  3W59 A;  5B2G B;  1L3J A;  2R04 2;  1GOF A;  4Q0P A;  4IE4 A;  3AZZ A;  1NT0 A;  1REE A;  3H1W A;  4YVS A;  5T5O A;  4EZH A;  4IEX A;  2ZX3 A;  1J3Q A;  1ULE A;  4DRV A;  4BQX A;  2SBA A;  2PTM A;  3VHO A;  3Q8A A;  1HJF A;  1DG6 A;  4XXA A;  3IMM A;  3K2O A;  2ZGQ A;  2JDM A;  4XFI A;  3KT7 A;  4DMI A;  3NJY A;  4GAZ A;  5DDJ 3;  3WNO A;  1FNZ A;  4CYD A;  4HPK B;  4MV2 A;  1D2S A;  1RIN A;  1J3R A;  2A3Y A;  2IXH A;  2W08 A;  3VZO A;  4S2F A;  4G3Y C;  5IVY A;  4BH9 A;  4LOR A;  2VTX A;  1U5Y A;  3USU A;  4AGG A;  1RUH 2;  3GM8 A;  5FY8 A;  1HRI 3;  2OVU A;  2Q30 A;  1QJY 2;  3AX4 A;  4LK6 A;  1MS4 A;  1ZA4 A;  1I5P A;  2Z42 A;  2WS9 2;  3DPR C;  2VMI A;  1MQT C;  2XJQ A;  3FMG A;  2ILM A;  3CU7 A;  1ZA7 A;  5FP3 A;  5FMD A;  1HQN A;  2C26 A;  4FI9 A;  4UF0 A;  3KV4 A;  2GND A;  2W3J A;  2YUE A;  4FQZ A;  4KWK A;  2VOW A;  3VL9 A;  4LKF A;  2ZGO A;  3S5A A;  1NLS A;  5CAD A;  2MEV 1;  5BNO C;  1QNY A;  3RQ0 A;  2E9Q A;  2KR2 A;  3T0A A;  2Q5T A;  2WQZ C;  2W1S A;  3FHQ A;  2XWB B;  4D6Q A;  4N8M A;  4AHZ A;  1ZZC A;  4LK7 A;  4XDQ A;  3JCI A;  1RUE 1;  1TMF 2;  1HRV 3;  4G4F A;  3WW1 A;  2WA4 A;  4DXZ A;  4EN8 B;  1UU6 A;  5C4W C;  2FDG A;  4UT5 A;  1POQ A;  2QDR A;  4Y1U A;  1PM7 A;  1AR6 1;  1EV1 2;  2SLI A;  4PBO A;  1NOV A;  4IV3 A;  3OBT A;  4D94 A;  1ND3 A;  2CV6 A;  4XJZ A;  5EWS A;  2RS1 2;  5JOX A;  1VBD 1;  3VV1 A;  3NJX A;  4NR1 A;  4Q0Q A;  1XE8 A;  4QMA A;  1D0H A;  1OKQ A;  3K48 A;  4XUN A;  4BQ3 A;  2XML A;  2VQA A;  4HG6 B;  3WP6 A;  2VC9 A;  4ZU4 A;  2HWD 2;  4RQP A;  2ZHM A;  2GC3 A;  1AL2 3;  2JG9 B;  4H7M A;  3OD0 A;  3ZXF A;  4IEV A;  2YBP A;  5LWB A;  3EMR A;  4FOW A;  1FPN 3;  2OS2 A;  1FOD 1;  1UY1 A;  3ZDS A;  4AI0 A;  4AVT A;  3IDB B;  3I59 A;  3LSD A;  2NMO A;  1G86 A;  3R0R A;  4IGP A;  4NE9 A;  3T2P A;  2ETE A;  4NAM A;  1R1A 3;  3MFC A;  4AFA A;  5FR3 A;  4WM8 A;  3TBD A;  3PTR B;  3RZJ A;  4OI0 A;  2VZS A;  1QH7 A;  2BUK A;  3MUZ 1;  5C8C B;  5A1F A;  4LO6 B;  1WCK A;  2O1Q A;  1V6L A;  1PO2 2;  3ECQ A;  2D97 A;  5JXI A;  4B4R A;  3I7D A;  5FO7 B;  2E7A A;  1GIC A;  3G6J B;  2FMD A;  2X09 A;  1A78 A;  1SG3 A;  2D7F A;  3PMS A;  1DGW X;  4OHV A;  1OQ1 A;  1HB1 A;  4QHZ A;  2A1X A;  4JTN A;  5FZO A;  4AAP A;  4COY A;  1PGL 2;  1CIY A;  3W9A A;  4LLO A;  3AP9 A;  3RSJ A;  1JUI A;  3FJS A;  3HMY A;  3NNJ A;  3WDT A;  5FO8 B;  4TTG A;  4Q4Y 3;  1N1Y A;  3WQB A;  1XND A;  2DCK A;  4S2D A;  3UES A;  4CEW A;  2NLR A;  3O1R A;  2VCB A;  3NJV A;  5GZE A;  3WXP A;  4DQA A;  4J25 A;  3WUD A;  3CMG A;  1BQP A;  2BWA A;  3MW4 A;  1EUT A;  4HET A;  3POE A;  2A73 B;  2J1T A;  4ZU7 A;  5DQ0 A;  4AVS A;  1TE1 B;  2AEN A;  1YYN A;  2ZOE B;  3DN7 A;  3LQC A;  3FBM A;  3VZK A;  4Q27 A;  4A42 A;  5FPA A;  4BME A;  2ID4 A;  3D82 A;  1BJQ A;  3EQE A;  3VBO B;  2DCZ A;  4P08 A;  5DAB A;  3T08 A;  2I2S A;  2VBB A;  1OLM E;  2WO1 A;  4FPY A;  4OUS A;  4D8M A;  4DIN B;  1PMJ X;  1Z7S 3;  4XF9 A;  4LKS A;  2H0V A;  3SXW A;  2YBK A;  5BNP C;  3ON7 A;  2MEV 2;  1JXN A;  5FYI A;  3B5L B;  1WMD A;  1VAM A;  4OHX A;  2QNK A;  3ACL A;  3WNL A;  1F9K A;  1NCQ C;  3BTZ A;  4UFL A;  3GBW A;  3KD4 A;  1IOA A;  2BTV C;  3BOP A;  4CA9 A;  1AXK A;  2XUE A;  5A6Y A;  2RM2 1;  4TLG A;  5L73 A;  4E2S A;  2YDE A;  1RUE 2;  5D1I A;  4UBH A;  2EIG A;  3L2Y A;  1RVF 1;  2WL1 A;  3KGZ A;  5K0U A;  5TSW A;  3M3O A;  4IEQ A;  2PQS A;  1VPH A;  2IFW A;  5FZF A;  3S5Q A;  5D21 A;  3PVO A;  4D3W A;  4D7Y A;  1VBD 2;  2P17 A;  1W6N A;  4CDX C;  2D44 A;  1BMV 1;  5I0S A;  3W21 A;  1YIF A;  2PHT A;  3WCS A;  1Y9M A;  1C5H A;  1W8H A;  3UKV A;  1OPM A;  3WDU A;  1OH4 A;  1RMU 3;  1ULC A;  2PLV 1;  2ZX0 A;  3M8L A;  4BIF A;  2HEV F;  3MIB A;  3ZFF B;  1GQH A;  1NUK A;  1UXX X;  1XPW A;  2B9V A;  1FOD 2;  4AG4 A;  4RR3 B;  2VR4 A;  3MLJ A;  1SFY A;  3J8F 3;  3RZK A;  3BAL A;  2CAU A;  4XF3 A;  4OMD A;  2IVJ A;  3MF9 A;  5FLJ A;  4H3W A;  5FZ0 A;  4IE5 A;  5GLV A;  1G7Y A;  4XBL A;  1NZC A;  3P3P A;  4MHU A;  3WUC A;  2PHF A;  3O0V A;  1G9B A;  3BUC A;  1W39 A;  3LPF A;  4N53 B;  1SLT A;  3AXE A;  1XNC A;  3VN4 A;  4DFS A;  1PK6 C;  1CGP A;  3OGJ A;  4UFK A;  1RJ8 A;  2VZQ A;  4I0B A;  3JB4 C;  2IUW A;  1W2N A;  1ND2 B;  3A22 A;  3NAP B;  1X8M A;  1OT5 A;  2QKD A;  3VDD A;  3DXT A;  2XL9 A;  4YW2 A;  5A3N A;  1F15 A;  1S0B A;  3OUH A;  4XTM A;  2OXB A;  4NRO A;  2BGC A;  3FWE A;  2VL4 A;  4PI2 A;  1QJY 3;  3JUU A;  4BYY A;  4OHY A;  3WNX A;  4ZXE A;  4A44 A;  4CCJ A;  1OVS A;  1UZZ A;  4UBG A;  2WS9 3;  1GYK A;  1AYM 3;  3PNA A;  1H9P A;  3FHA A;  3LZZ A;  2BFU L;  4CEY C;  1MPX A;  4P5Y A;  4QX7 A;  3ZYB A;  4YLZ A;  3J7H A;  4Z07 A;  4UFM A;  5FYM A;  4DIQ A;  3RWK X;  3LFM A;  1YQ6 A;  4H14 A;  4PHZ A;  4HK9 A;  4UW4 A;  3FFZ A;  3WF3 A;  1W3V A;  2B42 B;  1GZT A;  2E33 A;  1UF2 C;  3DYO A;  1UOJ A;  3R4U A;  3WP3 A;  1CD3 G;  1RHI 3;  5FZ8 A;  2ZPX A;  2C9K A;  1HDK A;  1HJG A;  3RZZ A;  2J42 A;  3AJY A;  1SFP A;  3FBY A;  3Q8F A;  1CAU B;  4CCM A;  1MVE A;  5FY4 A;  4BCU A;  5JAX A;  1TMF 3;  2GH2 A;  1FI2 A;  1H8T C;  1SAC A;  4K7J A;  3SEE A;  4DUV A;  2F4P A;  2DVF A;  3UNP A;  3MDP A;  3LIG A;  1AR9 1;  5HV4 A;  2Y64 A;  2N7G A;  1EV1 3;  3AC0 A;  2DTY A;  4XCA A;  4MXV A;  2HWC 3;  4ES8 A;  3E1F 1;  2ZGL A;  5FPX A;  2YFU A;  3KZ4 C;  3GZU C;  4QX3 A;  1QJU 2;  2RM2 2;  5LY1 A;  2HWD 3;  3KGL A;  3O7O A;  2OX0 A;  2DFB A;  1W8F A;  1OSG A;  1N1T A;  1RVF 2;  2W2I A;  3SIT A;  3LEI A;  4Q4X 1;  5LK7 B;  5IK5 A;  4JKM A;  2YC2 A;  4N43 A;  5D8A B;  2GC2 A;  3H50 A;  4EN9 B;  4AHX A;  2B8M A;  3J9S A;  5JPN B;  4GH4 C;  4M4R A;  3AYA A;  1QNW A;  3WR0 A;  3T4V A;  4JHT A;  4BDV B;  3GCX A;  3J7M A;  2UY8 A;  1NA1 A;  4NAO A;  4NWW A;  3PDQ A;  5JXG A;  4QX5 A;  3NRU A;  2B46 X;  1H4H A;  3M3E A;  5KHJ A;  4RS5 A;  1W9Y A;  2Y60 A;  5FXV A;  3AYD A;  1PO2 3;  1DP0 A;  2VBP A;  1J84 A;  1TME 1;  2JDK A;  1V0A A;  2E53 A;  2ZX4 A;  4B4P A;  4DNY A;  4EN6 B;  3I3M A;  3DPR B;  4FSJ A;  2VCC A;  4GB3 2;  2O14 A;  2VZU A;  5H9P A;  4TLF A;  5FIX A;  4Z2A A;  4EWA A;  4L8Q A;  4UFH A; 
#chains in the Genus database with same CATH homology
 1W8W A;  4CPB A;  1WZX A;  1OH3 A;  1W8U A;  3F95 A;  1W9F A;  2Q1F A;  4LK6 A;  2K46 A;  1L7L A;  4CP9 A;  3UT0 A;  1W90 A;  4CPB D;  1OKO A;  3ORJ A;  1GWM A;  2C24 A;  2WYF A;  4LKF A;  4BQ3 A;  4AL9 A;  4BQ2 A;  2LRO A;  2LRP A;  1GWK A;  1WCU A;  4YW6 A;  3ZYB A;  4YW7 A;  2KR2 A;  4CP9 B;  1V0A A;  4A6S A;  4BQ4 A;  1HN0 A;  1WMX A;  1W8T A;  2VXJ A;  5D21 A;  4BQ5 A;  2JWP A;  4YWA A;  2O14 A;  1GWL A;  1W8Z A;  1UOJ A;  4LJH A;  4LKD A;  4LK7 A;  4LKE A;  3ZYF A;  3ZYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...