4LK6A

Crystal structure of pseudomonas aeruginosa lectin leca complexed with chlorophenol red-b-d-galactopyranoside at 2.86 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords PA-I galactophilic lectin
publication title CH-pi "T-Shape" Interaction with Histidine Explains Binding of Aromatic Galactosides to Pseudomonas aeruginosa Lectin LecA
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 22
structure length 121
sequence length 121
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2013-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 4lk6A00
4CP9B 2Q1FA 2KR2A 3ZYFA 1L7LA 3ZYHA 1W9FA 1W8UA 2C24A 2K46A 4LK7A 4CP9A 1GWLA 4BQ4A 4LK6A 4A6SA 3F95A 3UT0A 2JWPA 1OH3A 1GWKA 4CPBA 1V0AA 5D21A 1GWMA 3ZYBA 1UOJA 1W8WA 4CPBD 4YWAA 2VXJA 1OKOA 2LROA 4BQ3A 4LKFA 1W8TA 4YW7A 2LRPA 3ORJA 2O14A 4BQ2A 1W8ZA 1HN0A 4LKDA 4LKEA 1WMXA 1W90A 1WCUA 4LJHA 4YW6A 4BQ5A 1WZXA 2WYFA 4AL9A
chains in the Genus database with same CATH superfamily
1R081 3LA2A 2GDFA 1MS8A 3AYAA 1IKQA 5F5IA 5FXVA 1AZDA 4UBHA 3BUCA 2ARXA 1C8M1 5F5AA 3VUOA 2C26A 3J8F3 5I91A 4QT6A 4N8MA 2QQVA 3LDRA 2CU5A 2XVGA 1AYM2 2HBTA 4YW2A 1BEV3 1E5SA 1RVF2 3H8UA 4QGMA 2XVLA 4CEWB 3RZJA 4RQPB 1QJX1 2R32A 5CG8A 3A21A 4RS5C 2VXJA 5ANQA 4FP2A 4WV8A 2VZQA 2HWD1 1TE1B 4I0BA 1W8ZA 4MGZE 3Q8AA 4YZ3A 3T2TA 3LFIA 1BKZA 1FV2A 4HBNA 1AUYA 1VBC1 4FPHA 1NQDA 5FY5A 3WNMA 3ZXEA 4Q0VA 4CU9A 2WDBA 1O3SA 4YYOA 4IV1B 2BVBA 1BLZA 2ETEA 3DECA 4JTNA 4LBKA 4OCTA 1DGWA 3SEEA 3MIDA 5C8CA 4IERA 4Q2FA 5JZGB 5FR3A 3PJQA 1YEWA 2R7EB 5IVEA 5A3LA 1VIWB 2W92A 1RUI1 1OA2A 3GM8A 1JZ2A 3CJIB 3J7NA 3MHZA 2A71A 1C4RA 5FKCA 1AL23 3LDKA 3HAGA 5FWEA 3KCCA 4N43A 3CHXA 3HJRA 5APAA 5T50A 4X8NA 4I01A 1WMXA 5LBFA 2QDRA 3E1F1 1D0HA 1H1MA 4YFZA 4UFKA 1NLSA 4P9WA 5F39A 4AFMA 5ACA3 1F4HA 2V09A 3BGAA 4L99A 4B4QA 2JDPA 1F15A 3WEZA 3J8F1 4L0PA 4BLJA 2P3JA 3PUHA 2ILMA 4O9GA 2HJIA 3W58A 1AL0G 1BEV1 1XNDA 2X5IC 1OD5A 3S7IA 3WCRA 4IV3C 2WQ8A 3MEPA 4QX5A 3INAA 4UW4A 1QXPA 1CPMA 3DPRA 4XHBA 2VMHA 3VD4A 5IK4A 4WZCA 2NM1A 3VKOA 2ZS6B 3MW3A 2GP5A 3CZJA 1QHDA 1H2NA 4A44A 1Y3TA 3QCWA 3ZSKA 1H2LA 2ET7A 3E6BA 4P9GA 1JOBA 4CUCA 1K5MA 1YUDA 4A42A 4IESA 2E6VA 4DMIA 1GKBA 4XZPA 4BIFA 2CY6A 3KV5A 3LOIA 2SLIA 1V6KA 4NR1A 3D0JA 2DV9A 1AX0A 1Z0HA 2K46A 2PAEA 3TYJA 1RUD2 3VBSB 5ANNA 3OOXA 4DO0A 1RUC3 3T3YA 5JSPA 1AL21 3POGA 4N53B 5L7OA 1KD7A 2H6BA 2JD9A 2O8OA 3AVSA 3ZYBA 1D4VB 1GANA 5DAQA 4TZDA 1Z7S2 1CAXA 1MQTC 2VMIA 3AKQA 3Q8EA 5A7NA 4W65A 4CCEA 2R49A 1JZ5A 1POQA 3F2ZA 1YQ6A 4Z07A 4YZ5A 2A6XA 4A45A 5ACA1 5KC6A 4MLOA 2XPJA 3VD3A 5FXWA 5FO8B 1UXZA 4LOSA 5LRSA 1M06G 1FPN3 4FFGA 5EZWA 4CDQC 1ASJ2 5AC93 2EAAA 4BXFA 4DY3A 3I3BA 3TNPB 1YI7A 3KGLA 3IIAA 5C8CB 1ND2B 3S5QA 2OX0A 4XDQA 4CXWA 1O3TA 1CZTA 4IXLA 4E27A 5IT6A 3HNBM 4BQYA 5A1LA 3FMGA 4W8JA 3SISA 3ZFFA 1R092 2DCKA 1RUJ3 4HANA 1JU4A 4LUKA 1AF9A 4QPGC 3LDBA 3RZGA 3ZPYA 4GMP0 1ULOA 2EF6A 2VTXA 4JVAA 4AQ6A 1UIJA 4Q4W2 4MO3M 1LODA 1LOGA 1YQCA 3OEBA 4Q5OA 4A4AA 3ZMOA 4O65A 4KWJA 3GF6A 3AMNA 1XOYA 1EYBA 2R1BA 3I7DA 4I30A 5GZEA 1AYN3 3UK9A 2FZ1A 5C33A 4P14A 1PK6C 3OF1A 3POJA 4RGAA 1HV1A 2EIBA 2VZRA 3N9QA 5DQ0A 1PNFA 2DYCA 3KQRA 1C1FA 1RUC1 3VBUA 1JODA 3QLQA 5FMOL 2Y26A 5FY4A 3DPRB 3VZMA 4B3NA 1A78A 1DZQA 1GWLA 3DEMA 1AR62 3DYMA 3S0MA 4PQ9A 4QXHA 1BVP1 1RMU2 2HBUA 2RDRA 1KQRA 3B69A 2QQMA 3ES4A 3WDVA 4OQ9A 3JBG2 4G9SB 4FPLA 3RNSA 1FPN1 4AI2A 4OYUA 5AC91 1W8TA 4AF9A 2YBKA 3U4XA 3A22A 3T1LA 2R043 5FPLA 3WX5A 3H7YA 5K8SA 1MEC3 5C3RA 4LJHA 1GNYA 2DU1A 1N1SA 1MS4A 4IUGA 3U10A 1PIV3 2AGSA 1XE7A 4GB33 2CNAA 2XGXA 5JOXA 5JR2A 2ZGKA 2H6CA 1H2KA 1PGW2 1V70A 2QUOA 1RUJ1 5G05L 4Z2AA 1SBEA 2QZ2A 3M3OA 3O1PA 2D6PA 5DAVA 4BMEA 3BYWA 5L7OB 4PIZA 5H9QA 3MUZ1 1VBD2 3R4DB 1EAH2 4AI1A 1S0CA 2VR4A 1MVQA 3EBRA 1SLCA 3GBFA 1JUIA 5FWJA 3WDXA 1C3HA 1AYN1 2BP6A 2VCMA 2WL1A 1H8TA 3HPNA 4FFIA 4A7YA 1N47A 1OOPC 4UBGA 1MZEA 2XUEA 4Y1XA 5FZ6A 4AFAA 3POEA 2F4PA 4DRRA 3LEKA 4Q27A 4ATEA 1S4CA 5DZFA 2ZHLA 1QDOA 4HK9A 1KS4A 5CVRA 4FTBA 2ZMNA 4IE0A 1O91A 2XLFA 1LEDA 5I0UA 2XKPA 4C0BA 3MZHA 3O1SA 4IE6A 4IV1C 4GH4C 3ABZA 4LR4A 5A6QA 4WM7A 1W6QA 5HCHA 4E4SA 2B5HA 4QX7A 3AP4A 3OJBA 1VJ2A 1Q8PA 3KT7A 1WCQA 2R041 4V2VA 1LOFA 1MEC1 1RC6A 1X9TA 4QKDA 3KT4A 2HEVF 3K4DA 2LUWA 1PVC3 5L9RA 1PIV1 5GLWA 3CJIC 4GB31 1DQ6A 2RE9A 1UKRA 3HN1A 4LLFA 1JOPA 4AAXA 3M1HA 3VBUB 4F3JA 4XCBA 2GNMA 3RWNA 2C24A 2TNFA 1O5LA 3ROUA 4ZZ8A 1UO9A 2VZ1A 4FPYA 4JKMA 4ASLA 1AR83 1HV0A 3SMHA 1W8NA 4LITA 4UT5A 4UFIA 4YG0A 4YVWA 1G6NA 5FPAA 5FTTC 5LEJA 2JDAA 2Q1MA 1DDLA 3FBMA 3KGZA 1IOAA 5FZKA 4AE2A 4P9IA 4LBJA 3FC0A 1QNWA 2Y33A 4IEZA 5EWSA 1JW6A 2RJ2A 1H4HA 4XPVA 2VMCA 2ZX2A 4OI4A 3RJ2X 4C1XA 3ENRA 2E7TA 4BXSV 3U4SA 1PO22 3NV3A 2PTMA 3IM0A 3VKMA 3GBGA 1V6JA 1FNYA 4P9LA 5EJ1B 2JG8B 4K3UA 3VBRC 4WVWA 3T4HB 5E6HA 1SBFA 3WINE 4M01A 3QD6A 2TBVA 4YGDA 1GZCA 3OGVA 3MGUA 1LHWA 1PVC1 1YFYA 4NIIA 3VL9A 3X29B 2A75A 2VG9A 3GJBA 2AR6A 4LBQB 5J96B 1UL9A 3B3QE 1LB2A 1SMVA 5JMCA 4JDOA 3CJXA 1AXKA 3A0NA 1OLMA 4UWDA 3ZFEA 2A7AA 3AXEA 3B93A 4RFT0 4CEYA 3S5AA 1L7RA 2JXAA 2Z42A 3NKGA 3OY8A 4NAMA 5FJHA 5EXOA 2MNGA 3BTYA 4S2DA 2EXKA 1AR81 5J37A 4MXWA 3IAPA 4C90A 3BOWA 2WRAA 2ZTNA 1IQAA 2IXKA 3LEIA 1LGBA 1ULCA 1W6QB 3MBWA 5BXXA 2JIJA 1ND2C 2BWAA 4KBBA 2CYFA 3OTFA 3ZN5A 4FOWA 1DZRA 1H9PA 4DPNA 2A70A 2LS6A 3JB4C 4M0HA 5E88A 3THTA 4A7ZA 1BBT3 5GLVA 3HVDA 3Q9OA 4MX3A 3ACHA 5FY8A 1X82A 3HEIA 4CU7A 1AJOA 5IK7A 2WNUA 4HPKA 2PLV3 5KWRA 1C28A 2VZPA 3GZUC 3ZXFA 1POV3 4B4RA 2WA3A 3UKTA 4QX2A 5BNPC 2BOIA 1FOD2 4BZ4A 1UU5A 1MZFA 3NV2A 3ILRA 1S0FA 5FYCA 3O12A 4X6RB 4R8HA 4NAOA 5CISA 1W39A 1UD1A 3NAPA 4IGOA 4JX0A 4NE9A 4NRMA 4FTEA 4E8CA 3H1MA 1YIFA 1KJLA 2XQRA 5HPOA 3POFA 1A34A 3OG2A 2WWUA 2ZX1A 4RA0A 2EALA 3OYWA 3NQHA 3TB0A 1JHJA 2V5DA 1UN1A 4XZUG 5DDJ3 4CUBA 2H0VA 5FV3A 3ZKYA 3IMMA 2BEOA 4DFSA 5I0SA 4JGZA 4FQ4A 4A3XA 3RYKA 4ZHNA 1RITA 2EIEA 4K1ZA 4IEPA 1W8FA 3GGLA 4Y24A 4BMBA 4ZS2A 2CHHA 3AKSA 2DFCA 1HLCA 3JD72 1ZRCA 4N90A 1BBT1 2GP3A 3ZKUA 2QQKA 2ZXQA 4QMAA 2B7YA 1NCQC 2W5FA 1QJY3 1UY0A 4N9IA 2VZSA 2VH9A 5IYYA 3FWEA 4PI2A 4TTGA 4DUVA 4UYBA 4AHYA 4BQ3A 1PMHX 5JXGA 2W1SA 3WW4A 4IEOA 4ITCA 1LKNA 4HXCA 2PLV1 5C71A 5D8AA 1TME3 1VP6A 4XEZA 1POV1 2JDHA 3OY8B 3C7EA 3MF6A 4D69A 3I2KA 4MXWB 2WFF3 4CCCA 4CCJA 4ARYA 4FPGA 5FYZA 4Q8LA 4WBBA 2XBO2 2VQTA 5IFTA 1TVGA 1RJ7A 3ZYIB 1UOBA 3SC7X 4UF0A 3H50A 2E53A 4ZPIA 1DYOA 2Y6JA 5JUVA 2VD7A 3BI3A 3ON7A 4K8RB 4QM9A 3FUOA 1CAWA 2OW4A 1CIWA 3AKTA 2Y6FA 3GALA 4OZXA 3VBFC 1ODMA 1V9U2 3HNYM 3R4UA 2JKXA 2VMFA 1OKOA 4FO9A 5DDJ1 1JH5A 4OULA 1BHGA 1SQ4A 1RYYA 4DS0A 5C7GA 2UYAA 1EPZA 1NA1B 5KHHA 4YVSC 2ZZQA 4D7YA 4YGEA 2YB7A 2VZUA 1ONAA 4ET7A 4M3CA 5T3NA 1C5HA 2X5IA 5I8SA 4XJWA 4IV3A 1HIXA 2DVFA 1HQLA 1HB4A 3RI9A 2ZOEB 3IDEA 3VDBA 1CONA 1QJY1 4EN6B 3VBHC 2WA4A 4IE5A 3M4FA 3MO4A 3HWJA 4LHLA 1XQNA 4X6QB 1COV2 3SH4A 4BDVB 3N36A 1J58A 1W8WA 5BNOB 3BB6A 1TME1 3VL8A 2HEWF 4D7SA 4HN1A 2YPJA 2XDVA 2JDNA 4WM8B 2IXCA 2KD7A 2X8KA 2WNVC 3ZDVA 2WFF1 5EJZB 1JYTA 3K3OA 2X05A 3AFGA 1UZ0A 1W28A 2Q8OA 3WHUA 5CBLA 2KM2A 2ZAHA 5KR7A 4META 3WNKA 3PVOA 2B42B 4M4PA 4NWVA 2VU9A 2VZVA 2Y0IA 4WVZA 3AZXA 2FZ2A 2WBKA 2D6NA 4LK6A 3LE0A 1H0BA 5E8AA 1RHI3 3VHNA 1YXWA 3BODA 1QJU3 4RS5B 1QWRA 2BZDA 4QXKA 5LBCA 3WNLA 4JZRA 2HWF3 4LUMA 1DLLA 2W0XA 3RMXA 1NYWA 1NZCA 2JEMA 2JG8C 4HFSA 4XMIA 4AXOA 2VULA 4AZZA 3AJZA 3VB9A 4MGTA 3AP5A 4EV0A 3NV4A 2WWJA 4OHWA 4BQ2A 4CDQA 3WDYA 1IHMA 1S0EA 1DZTA 5LA0A 3MDPA 3WT3A 2XVKA 1Y9MA 3W20A 1E57A 1IS6A 1QU0A 4QKFA 5ABJC 2QQIA 5FYTA 2BDRA 1BZWA 5F5QA 3ZVXA 1OQDA 1F8VA 1R082 4QPGA 1CAWB 1CESA 1W0OA 2BUKA 3LEGA 5LY2A 3SLIA 1WA6X 4NHKA 1C8M2 3TEYA 2DTWA 3H42B 5FUIA 3ZX7A 1UY2A 4CP0A 3USUA 1OBNA 1KJRA 4WZFA 3M3EA 1D4M3 4AI8A 3RPQA 2HWE3 3IN9A 3D82A 1MS3A 5FKBA 3WG3A 4HLTA 2DUQA 1W6MB 2JE9A 5A3PA 1YFUA 4KQ7A 1PK6A 5C4WC 1QJX2 3WW1A 4BQ5A 4NOTA 4YARA 4N7UA 3V0AA 5FZIA 1ACCA 4JGYC 1SDWA 3EO6A 3KQ4B 4IDZA 4XIKA 1QJFA 4Z82A 4IV3B 1H30A 3ZYHA 2XQXA 1VB4A 1RHI1 1P8JA 1VBC2 1AXYA 1QJU1 5GKAC 1OSGA 3WF3A 4KG8A 5FUNA 1CR7A 2XR4A 1GUIA 4RGGA 2HWF1 1KITA 1PM4A 2VXRA 3C7FA 5DAXA 4QPYA 2JWPA 2WIIB 1HXS1 5FZOA 1U5XA 4MYEA 1ST8A 5D2AA 4YGCA 1DYPA 3KV6A 2Y38A 1Y4WA 1J3QA 2LROA 3GZEA 5B4XA 1PGSA 1LOAA 1RUI2 3C7GA 4DXZA 1XE0A 2Z69A 2OS2A 3ECQA 4P9XA 3VN4A 4ES8A 5IFPA 1R1ZA 2XJRA 4JRLA 4MH0E 2Q8CA 4BK4A 1HB3A 5CFDB 3NW4A 4D94A 4QQOA 5LBBA 1J83A 5DXDA 5SV5A 4Q8KA 4C91A 4ZZ5A 5CB7A 2ZHNA 3NNMA 2QQNA 3J8F2 1UXXX 4E2GA 1GV9A 1MR5A 2RS13 4I3PA 1D4M1 1MQTB 4FAGA 1B35C 1BEV2 2HWE1 1O59A 3E6CC 2JDYA 2AENA 2Y64A 3URFA 2QQOA 5FZ9A 3WF4A 1XNBA 5IVCA 1OOPA 4CDQB 2PYTA 2RV9A 4IEVA 1VBB3 3KCYA 4ZXKA 4EWEA 2IXJA 1HRI3 1UY1A 1QOSA 3TN93 4EJRA 4BIOA 1KRIA 2WT1A 1IZ3A 4CDUC 3ZSLA 5HI0A 1JZ7A 3L2HA 1DGLA 3KZ4C 4LQRA 2EVXA 3O0VA 1QH7A 5T55A 4EZHA 1RL3A 1EY2A 3IWZA 4IV1A 1AHSA 2ARBA 1ENQA 3LIGA 3KT1A 4CVUA 5HCBA 4COZA 3USUB 3T2PA 3OGJA 2BNMA 3MI8A 5IK8A 5J3UA 4FXKB 2E32A 3WR0A 3I54A 5F5CA 1JYXA 1AL22 1I3HA 3CJIA 3VD9A 1PK6B 4Q4X3 1RIRA 1UF2C 2Q0AA 1REDA 1HB1A 5JI7A 2RS33 1DBNA 1ZBA3 4AEDC 1DQ1A 2ZHKA 3E5UA 3M3IA 2JX9A 2RHPA 3K2OA 5FYSA 5ACA2 3W5MA 4BU2A 2VY0A 2VZ3A 2RS11 4LBMA 5LEKA 4AFBA 4UFLA 1AX2A 1XJAA 4QX3A 1J3RA 3K3NA 2AUYA 4YSFA 5FRAA 2O8QA 5DUWA 1ZYBA 4BK5A 1PVXA 3ACIA 4QKBA 5CKQA 3RZZA 1STMA 1Q56A 1N1TA 1VBB1 1HRI1 4Y4YA 5FZ7A 3TN91 5CAZA 3CU7A 1ZRDA 2VE1A 4HETA 4C1WA 2Y6GA 4WVMB 1KFUL 3SNMA 4D0QA 4RFRB 3RZHA 2ZEWA 2GH8A 2BPA2 4TLFA 5A6YA 3WNNA 1FI2A 3H3ZA 3BU0A 4QPWA 3N9MA 1UYZA 4CXYA 3HQUA 1VRH3 4LO8A 1C8NA 1PZ9A 1WLTA 1XNAA 1OH4A 2HH9A 2VUJA 2ZGPA 3D3AA 3BALA 4GA9A 3RG0A 4HSLA 3VBRA 4Q4Y3 1YQ8A 4XJUA 1GMMA 1IG3A 2XWJB 4PJYA 1FATA 1RUC2 3FL7A 3VBSA 1WGPA 4M00A 1EPWA 1NXMA 2YFZA 1LGCA 4Q4X1 4EN8B 3PUSA 1OOPB 1WWYA 1OF4A 4N53A 2RS31 1TNRA 3GZAA 1ZBA1 1Z78A 4LKFA 2DBNA 1KGYA 5IK5A 5J98B 4LKEA 4MVTA 2B45X 2JDZA 2YZ4A 3NNLA 5CEHA 4NHMA 3IKWA 3KLSA 1FPN2 3M8LA 5AC92 4NPLA 4GWJA 5FMOS 1GOHA 3ZXLA 4AK3A 4DIQA 4GH4B 3VLBB 3D5OA 4PDWC 1ULPA 4XQWA 5LA1A 4YGBA 1UQXA 4YRDA 1L3JA 2XJPA 2W08A 4YM3A 1C5IA 1ND2A 3ZIWA 2R30A 2D98A 1K5JA 4HKWA 4LA3A 2D5HA 1HN1A 3MIFA 5JPNB 1VPHA 1RUJ2 1XB9A 4OLLA 3VDCA 1JYNA 4DY5A 3ALQA 1GWMA 4BOWA 4MGSA 5I8YA 1LHOA 3VDAA 2AEYA 4ARXA 3AZYA 1HKDA 3BIEA 4PLNA 3UGFA 2JDKA 2LRPA 5C9AC 1H6XA 1VRH1 4FOYA 4RD7A 3HNMA 1LJ7A 3N4MA 2J1TA 1WW6A 2VQ0A 5A7WB 4B1LA 4XQDA 1AYN2 3SXWA 3CF6E 3T2QA 2C6SA 3VZJA 1QJZA 1PGL1 1UW8A 3KS7A 4Q4Y1 4XBNA 1GFF2 5F3CA 3PVBB 4URTA 3GHMA 4QHBA 2ZGUA 1T2XA 1G9AA 1IS3A 3LIHA 1PO13 1Q8OA 5DPNA 3DXTA 1FT9A 1FNZA 2WKKA 2G9GA 3FBYA 1DFQA 2VTXJ 2KXLA 1XU2A 2X53S 3AM2A 3ME2A 3MPPG 3NSTA 1UPIA 1XSRA 5LK7B 4XYXA 1TEIA 3NJZA 5IVJA 4DUWA 4L2NA 1PNGA 4XCAA 4J25A 5G04L 5EYXA 4CP2A 2R042 4UOJA 4EN9B 3LA7A 1MEC2 3H3LA 5FLHA 3OGSA 4CP9B 1WD3A 2WZ8A 2YC0A 3E5QA 3S30A 4AGRA 1PIV2 1QDCA 2ZEYA 4GB32 1YCIA 4SBVA 5A1FA 2V4AA 3VBRB 4OVEA 4Q0PA 2ZGNA 4JTOA 5CFDC 3BIWE 4YG6A 2TEPA 3DGTA 3LA3A 2XH6A 5CZKA 1HB2A 5A32B 1WMEA 2BU9A 2DF7A 2YY1A 4LO5B 4Y33A 4DQAA 1NCQA 1VB2A 3CBNA 4MGYE 2B4KA 2WN2A 3WUDA 2H0BA 3O1OA 3VZKA 3NNGA 4CCLA 2BQPA 5F3IA 2RJKA 3OGRA 4LORA 2VNGA 1RUE3 2C5DA 4D6SA 4HK8A 1MS0A 2FDJA 1QH6A 2BERA 4QAWA 2JE7A 3BN6A 2QTWB 4LKSA 2JDUA 3AMQA 1OC1A 5BY5A 2P6HA 2XXZA 4P5YA 4W6WA 4XIOA 3VDDC 2UURA 3I3EA 4W50A 5F32A 5IVVA 2P3KA 1WW5A 1PO11 3VZNA 4FSJA 1VALA 1YWKA 3I2JA 3OBRA 1LOEA 2UWBA 1J1TA 1TG7A 2ZGOA 4HN0A 2NP0A 3O1TA 3PDQA 5AVAA 4A6SA 5SV8A 1MVEA 4AFDA 4OI1A 5A3TA 1WBFA 2XJTA 4DRVA 2QQUA 3PUAA 4R9DA 2UWCA 3A0KA 2D6OX 1CX4A 4KU7A 1US2A 2VOWA 2J1RA 2GC1A 1KDKA 3I3DA 1QQP3 2XONA 1PVC2 1DCSA 2VVFA 4YVSA 2FBEA 3WP5A 4ATFA 1ENSA 4NMIA 5BNPB 3RDIA 4JQRA 2RDNA 1LHVA 4XETA 2RDQA 2VJXA 1G9DA 3ZXGA 3MV01 1W6OA 1APNA 2ORXA 5CA6A 4INDA 3ZSMA 3GCXA 5LZ6A 3VBHA 2FDKA 5T5JA 4NRPA 2YMZA 4AWDA 2QVSB 2WZEA 2YU1A 1OA3A 4XMAA 1AR82 3S57A 2BBAA 2JG9C 4G3YC 1RUE1 2W39A 4Y5TA 1GQGA 4K8FA 2NLRA 5GZGA 1K42A 4JRAA 5CKMA 3I2GA 3QH6A 4UW6A 1V00A 3B5LB 5DUXA 2ZGTA 3IPVB 2ENRA 1EP0A 2P34A 4CCOA 1IPSA 1ZRRA 1JZ6A 5IAXA 5JI9A 5BYNA 4Q0SA 3WF0A 4IGQA 1MS5A 1VBA2 2XHKA 4OHZA 2OQ6A 2RMU3 3ZO0B 3AYDA 1G8WA 5JVVA 1AYM1 4CP1A 1JUHA 4R52A 2UWAA 2J7MA 2RM23 3N7KA 1RINA 5KHGA 3KF5A 3CZUA 3WP3A 5FZGA 4X8PA 2RS53 4BISA 5K7PA 4XQ4A 4ZS3A 1BVVA 4FPFA 3VHPA 2BV4A 2EA7A 5JAXA 1NCQB 3NJXA 2BOJA 3AB0A 4PBPA 4B29A 4BQ1A 2WINB 3KB5A 3WW3A 1LECA 2JG8A 3ZR6A 1JYWA 2Q30A 1YYNA 2DUPA 2IXIA 3NJVA 1QQP1 4GAZA 3DN7A 4PT6A 1VAMA 3K48A 4LHKA 2TUNA 3I3MA 1DG6A 2P2KA 2EAKA 3WHTA 1OPMA 2X10A 3U37A 5KXDA 3VZLA 3ZN4A 1F4AA 2AYHA 2O0OA 4LBQA 5DG2A 5FZDA 4AQSA 5F1RA 1W9SA 4TWTA 1JI6A 4UXAA 5FZ1A 1W2TA 4P00B 4XF1A 4AVCA 2PAMA 2NPIA 5A70A 3W21A 1UX7A 2GSYA 3VBFB 3B7MA 4FOQA 1UZYA 5FO9B 1LR5A 1OI6A 3PL0A 5FZ3A 2WABA 2WNEA 2WZR3 4GIQA 2YC4A 3G7DA 1V6IA 3O0XA 3ZYJB 4CCMA 3UKVA 2Y6LA 2A1XA 2IWGB 1NLRA 1OUXA 2VNVA 4E2SA 1SLLA 3PVNA 5FYVA 1BBT2 4ES9A 4YVSB 2RMU1 4BE3A 1CQ9A 5C4WA 1J1LA 2JE8A 4NROA 2GNDA 2RM21 4DXTA 5CFCB 1N3QA 1PX3A 4H7LA 1PZ8A 4JGYA 5T52A 4E4DX 2RS51 2VQAA 4D7TA 1F35A 5A6ZA 5CADA 2VC9A 2CTVA 1W6OB 2WQ4A 2C0ZA 5IVYA 3ZXAC 2PLV2 4O9EA 3VBHB 5FPXA 3PUIA 3U78A 1UMHA 5C8WA 5F37A 3AMPA 3CMGA 5DAWA 4JQTA 1SLTA 4YFWA 4BWOA 1X8MA 4CRQA 2FDGA 2WNVB 5JSOA 3FFZA 1RUF3 5FQ0B 5FYBA 1G9FA 2D5FA 5LRRA 4YW4A 3FN9A 4E4HA 3EYPA 3H8RA 1ND3C 2BW8A 5DAPA 4KNCA 2K0GA 3UJOA 1ZZ6A 5DDJ2 1HDKA 4XUPA 2GN7A 4AR2A 4QDQA 4JKKA 3Q8FA 3E6DA 2X29A 5CKNA 5F2SA 1QOTA 1LTEA 5FK7A 3RZLA 3I2DA 1JMUB 5JCTA 2W94A 3V56A 1S2BA 4Y22B 2EXHA 2WZR1 4LHSA 1H1IA 5F2WA 3LCPA 4XFAA 1SHWB 1GICA 1B35A 2P1BA 4K1YA 2ZBJA 4MGQA 1BMV1 2ZA9A 1GP4A 4DEQA 1QJY2 2PHRA 1LOBA 1REFA 1ENXA 3ORJA 4AHWA 3FZ3A 4XUOA 4FT8A 5F3GA 4AQ2A 4K20A 1LGNA 1WCUA 1HRV3 2WJSA 3PURA 1WMDA 4XTPA 4QGLA 4CDUA 5A3MA 4PF1A 1TME2 2D43A 5KHJA 5ABJB 4LMFA 5JOYA 2Z4FA 3FHIB 2PHXA 5I0TA 4EWDA 5FYMA 4B4PA 2WFF2 4UW3A 2YHJA 1XYOA 1DGRN 4UI9L 1GZWB 1QY4A 2E51A 2UYBA 3G6JB 3HN3A 4ORFA 4XFCA 3OEAA 1PX4A 1X50A 1RUF1 4XUQA 2QFEA 4Y1YA 4YM2A 1W9TA 1OLRA 4AHXA 5F7UA 2WS93 3K77A 2DCTA 4NHLA 5BUVA 5C4WB 4PQQA 3ASIA 1UZWA 3O1MA 4Q1RA 3NKTA 3JUUA 4FPOB 3P3NA 4JGYB 3IIIA 3GJAA 2E7QA 3GYDA 3T0DA 3A4UA 3I59B 4FPKA 4JV4A 5FYUA 1VE0A 4AVAA 1V6NA 1Q3EA 1NA1A 1GP6A 3K46A 5FFOC 3UL2A 1YNAA 4R4XA 4OHYA 4AVSA 3GDBA 5DMYA 4GJZA 1RXFA 3I3QA 2J1SA 3I2IA 4FP3A 4K7JA 3I4IA 4ZU5A 3CLPA 3MIGA 5FY1A 4ZU7A 1RUG3 2R6QA 3BTZA 2VUDA 1X33A 1KS5A 1LOCA 3H1YA 5EV7A 2A3YA 2YROA 2AH2A 3FLRA 1OF3A 1Y9GA 1HRV1 2YGLA 4Y3OA 1POV0 2IXLA 5H9RA 3UESA 5LA2A 2RDSA 1HN0A 4IGPA 3M3CA 5BNOA 3KVBA 2VW0A 4WM8A 1VR3A 3LEMA 3V65A 1O3RA 3MW4A 1NY71 1WA4A 2ADEA 5JXIA 4NUBA 4UFJA 4XUNA 3DYPA 3BU7A 3M2MA 4TXWA 3R4SA 5FZHA 1B35B 3P6BA 2WS91 4QX8A 2GC2A 3ZIXA 3WDTA 1K12A 4Q1PA 4P9YA 1RHI2 2R063 1QJU2 3R6SA 1YJKA 2D93A 2XLAA 4K6BA 1YLLA 2IXHA 2JB4A 2WSVA 4XJ8A 4RS5A 4UFHA 2HWF2 2XLGA 3LQCA 1ULGA 2XOMA 1RXGA 4LE3A 4CDUB 1K5MC 4LKDA 3Q8BA 4CDWC 5I93A 4TYSA 4ONUA 2E63A 5CU1A 3KVAA 1ULEA 2ADDA 2K2SA 3MFAA 4EROA 2C9AA 2FDFA 1URXA 1CAVB 2ID4A 2HWB3 4PDWA 1W8OA 2XB6C 2Z2SB 5I8TA 2FMDA 1RUNA 4MG2A 3NV1A 5FPUA 1DLCA 1RUG1 2VGDA 4GXLA 1EV13 3K4AA 3TOJA 1CVNA 1SFYA 1QEXA 3FLPA 4CA9A 5IVFA 2DWRA 2MEV3 2HWC3 1OD3A 2YC2A 3DXUA 4COWA 2OZJA 3CKHA 5GLZA 4QU2A 1IKPA 3LSEA 5T5OA 4CUGA 3BKZA 1LNSA 3C2UA 3RZKA 5C9AA 5HXMA 1D4M2 4AEDB 2FQPA 3WZ1A 3NO8A 4JHTA 5FK8A 1QNYA 3HR9A 1IGOA 5IW0A 1JBCA 2VOTA 2XG3A 5FREA 1W2UA 2CGNA 2MHFA 3ES1A 1ENRA 2PAKA 1QMJA 1W6MA 1GOGA 3THPA 2ES3A 5JDBA 5GZCA 1ZZBA 3ZYFA 3AP6A 4QPIC 1FMD3 5J09A 4AI0A 1JZ8A 5CFCC 3HT2A 5F9TA 1NCRB 3HT1A 4CDXB 4PF5A 3W5NA 3C3VA 2R061 2JDMA 5H9SA 1UZVA 1WUVA 3ZN6B 3ZYRA 3RGBA 4FQZA 3ZFFC 1N3OA 2A6VA 2HLEA 3ATGA 5A7QA 2D7FA 2D3SA 2DUOA 4IL7A 4QB6A 5FPZA 4AQTA 5A7OA 3ZLIA 2GMEA 4Y1ZA 2PHTA 3RYRA 3FHAA 1NLQA 4AVTA 3WP4A 2W1UA 4J6GA 2VUCA 4QHZA 3NRUA 5F3EA 5IJRA 1CGPA 4KMQA 4MZUA 1AVBA 2WFPA 2HWB1 3CIHA 4MGIE 4PI0A 3ZPOA 3TEZA 4K40A 1MS1A 2VTFA 1IS4A 4LEJA 1OMIA 3ZR5A 4Q0QA 1EV11 1SLIA 4NIAA 1S0GA 1UMIA 2KR2A 3KV4A 2MEV1 5CFDA 3BCWA 2G9ZA 2HWC1 2WT0A 1OVSA 2R0FA 1KXGA 3C8XA 4RR3C 1LAJA 1OFSA 5JR7B 2VPVA 3H1WA 1DQ2A 4ZY9A 2R0HA 2RS12 4Y4RA 1SPPB 2ZCWA 2ARAA 3ZXKA 3OB8A 2WO1A 3HBKA 1MQTA 2P3IA 4RGKA 2FDIA 2FCVA 1W3VA 2I07B 1LENA 4RHV3 1HXS3 4IEWA 5KBFA 5EHDA 1GYKA 4XABA 2GC3A 1VBB2 2WN3A 4J1WA 2O1QA 1DU3D 3RVHA 1HRI2 1GP5A 1SFPA 1D2SA 1FMD1 1LHNA 3PJYA 2BFUL 3TN92 4PDWB 2JIGA 2QQPA 4YZ4A 3IMNA 3WXPA 1N1VA 2D44A 3B02A 2BBVA 4URAA 1QIQA 1N3PA 2ZMKA 1Q8VA 1GQHA 1YI9A 3J7LA 3POSA 4F8AA 1DYKA 5DUVA 5FY0A 3ZYGA 2VZTA 4JC1A 5D21A 4YM1A 3O5SA 1UWWA 5C9AB 1EUTA 3RRDA 1BCXA 2IC1A 5AFEA 1S0BA 4GULA 3T2OA 2YUEA 3UJQA 2QZ3A 4FXGB 1SFNA 2ZAAA 1ZZ9A 3MYXA 1TMF3 1HX6A 4Q4X2 5FZ8A 1S55A 2F4LA 4QX1A 4K9SA 5FPBA 3MUY1 5ERLA 2RS32 2HKXA 5J1XA 4D6QA 4LBQD 3LGRA 4Y1VA 1U0AA 2J1VA 2HWD2 1ULDA 5L9BA 3VHRA 3QOPA 5AFBA 2PQQA 3R05A 4YW3A 1C57A 1UCXA 5KXBA 2QQLA 5FZ0A 2HEYF 1QJEA 2A6WA 4PBOA 3WQ0A 4BQ4A 1FYUA 2V72A 3DL3A 3PTRB 1DQ4A 2HYKA 3VBOC 3TNQA 4LA2A 3HMYA 4WM7C 2QDNA 4RHV1 4EZ4A 4XAEA 1W05A 1O4ZA 3A7QA 1ZREA 3K75B 4AVBA 1OURA 4GD4A 1LOFC 2LW8A 1L7QA 4OZOA 5JSRA 1Y43B 3GCWA 3WF2A 2ZX0A 1DHKB 3LWCA 1LESA 1UAIA 4WVMA 3AMMA 3VZOA 1ZNPA 2C1FA 2P37A 2AACA 3WLUA 2CDOA 4HKOA 4E9KA 1VRH2 1VMFA 5DZGA 3IBMA 4OUEA 5C5TA 2V4VA 4LK7A 2WSUA 2BVVA 1BXHA 5DN2A 1NZIA 4Q4Y2 4I2OA 1C1LA 2PQSA 4XILA 2IFWA 1UYYA 2EICA 4QQ2A 5JLVA 1UOJA 5KXCA 2RJLA 1TMF1 1XSQA 3MLJA 3OBZA 2A3XA 4B1MA 1HQWA 3THCA 3I97A 3VDDB 1NOVA 3U14A 1SDDB 2D6LX 2ZPXA 3D4KA 3N7MA 4OI2A 5T5LA 4IW3A 4OUSA 2RVAA 2YYOA 1JHNA 3E97A 3L9JT 4A41A 5EFUA 1RJ8A 3WOGA 3FHQA 3N9OA 5BPXA 1YHFA 3RI8A 3O1VA 4BQWA 2D3RA 2DVDA 3P5BA 1H9WA 1UY4A 4GH4A 5JWPA 2VCCA 1OLQA 5ISLA 1CWPA 1GLHA 1ZA7A 5T54A 1YFXA 1AR73 3BPZA 2YDEA 4UAPA 1CJDA 2EXIA 4HVRA 4ISRA 1GOFA 1IS5A 4YW5A 1RUH3 4LOTA 5FLJA 5HCFA 3LSDA 3OBAA 5BV6A 1NX9A 3B01A 1S2EA 2E9QA 3ZFEC 2LALA 2OVUA 3NMBA 4UW5A 4AI3A 4CEYC 1G9CA 4HG6B 4LXLA 4XF4A 1F5FA 4D3WA 5A7WA 2W9XA 2G1MA 5DG1A 1OQ1A 1LRHA 3O14A 4RL7A 2JG9B 3K4ZA 3H7JA 2ATFA 3MFCA 1JXNA 2K9ZA 5CIRA 2WO2A 2XL9A 3ILNA 1PO12 1NCRC 4CDXC 4IE7A 4OQ8A 1LCLA 1V0AA 1XNCA 3AKRA 1XNTA 2PFWA 5JPMB 4Z8BA 1T6GC 1WW4A 2GH2A 4D6RA 2WLPA 4GWNA 4F83A 1W04A 3USSA 1A6CA 2A6YA 1RGSA 1X36A 2VOXA 2A3WA 2BGPA 2JJ6A 2KA3A 2R073 3EHKA 3UETA 1LEMA 2WNUC 1JU3A 1PM7A 1R64A 4XUTA 3QACA 3AP7A 4HL0A 4CP9A 4XHXA 1MZ5A 5BNNB 4P02B 4RN5A 3SHRA 1AR71 1UX6A 1MS9A 5FOJB 1IQDC 3WDUA 1RUH1 5A32A 4E4ZA 4YLZA 1DF0A 2YXSA 5DZEA 2EIGA 2RG4A 3WDWA 4BM8A 4YZ1A 1VMHA 2YGMA 4NPMA 5GLUA 1UU4A 4EQVA 5FMCA 5LK5A 1RUE2 4OUMA 1I6XA 5GLTA 2P6CA 5FYIA 4XE9A 2VMDA 3AFKA 5FXXA 3RMYA 2FD8A 5E89A 3ETQA 1Q5OA 1WZXA 2ZGMA 2ZMLA 1F9KA 1R1A3 1ZZ7A 4KWUA 5K9YA 4XDPA 3MLKA 3OBTA 3FE5A 4Y20B 4JGZC 5FZ4A 2UY8A 3WQ7A 3T4VA 3ZOIA 4Z92B 3B94A 5F6KA 1UOFA 4XDOA 5JMOA 2RR13 1DP0A 3MICA 5A7SA 2Q8DA 2CGPA 3WNXA 5DUUA 4AGGA 4FI9A 4KH9A 4QDRA 1AR93 1H8VA 2LTNA 4M0NA 2FCTA 5LCWL 1DGRA 4XJAA 1LU2A 3IZOA 3MIBA 4YZ2A 1JYCA 4FOVA 1XE8A 4XF0A 4YW1A 4CU6A 3AL5A 5HV0A 3NNFA 2CSGA 2R071 3DCQA 1O6UA 1OT5A 2CAUA 3SCHA 2DURA 4KL1A 3GZTB 4S2HA 1QQP2 5D8AC 3T0BA 1ZX5A 1ZVFA 5GALA 5A3OA 4HZFA 1S0JA 4I0WB 2BNNA 1DIWA 1PZ7A 2OPWA 1W2NA 1O3QA 2VBDA 2WAAA 1SLAA 4LHNA 1YRZA 3CNAA 5BNPA 2UU8A 1ZBE3 5FAXA 2VVEA 2SBAA 2Y34A 4OHVA 4XXAA 5K4LA 3RSJA 2OPKA 3UYJA 4JDNA 4NVPA 3KF3A 3AVRA 4IETA 5LWBA 3WG2A 4HVQA 2D97A 1OFNA 3FX3A 1ND3B 3B9IA 4B7EA 2OXBA 3CO2A 4Q4V3 2XJQA 4HSJA 3RYPA 2WO7A 1R1A1 3D8CA 2CV6A 3WG4A 3J9SA 1CAUB 4RSUA 2VZOA 4C8DA 3IPVA 4YPJA 3EXUA 4HOOA 4MXVA 4COYA 4JKLA 2BNOA 2RR11 1W2OA 3ZFGC 5IUQA 2RMU2 2Y60A 2Y0OA 3HQRA 3M3QA 1L7LA 1J3PA 1S0DA 1GZTA 4P08A 4ZXEA 2RM22 3NNJA 1AR91 1HJFA 4ASKA 2RS52 2PHFA 3DKQA 2CGOA 4BYYA 4HVOA 3SH3A 2E26A 3AZWA 5JOWA 3KCXA 2VMGA 2IUWA 2XJSA 3KMHA 2J42A 2PXJA 4Y1UA 4PLOA 3OPTA 1VBE3 4PLMA 2J1UA 2DDUA 2MPFA 4AEJA 4CDWA 2VNRA 4EYUA 1PMIA 3M70A 4FCAA 4L92A 5GZFA 5A3NA 2FCUA 2JD4A 5L19A 1LU1A 2P4EA 2DVBA 1V6LA 3MLLA 1GQPA 2VW2A 4GKXA 4L11A 3WF1A 4LTAA 1ZBE1 3AK0A 3VGIA 5KHKA 3TRSB 2ORZA 2V5YA 3DV8A 5FP7A 5DABA 1CN1A 3U11A 4Y5SA 3FUQA 1AYM3 1W6NA 2OUHA 1RVF3 2QCSB 4N7IA 3UT0A 5KHIA 4AGVA 3TWIA 4Q4V1 1GWKA 3DUIA 3VBFA 4CPBA 1W9YA 3AJYA 1LULA 1HW5A 2WC2A 2WZR2 3VV1A 1DGWX 3OD4A 5EYYA 2XHNA 5J36A 4XXPA 4A3ZA 4JAAA 4BLIA 5FO7B 2Y6HA 4XURA 5B2GB 2XL7A 3BOPA 4KBZA 1BMV2 2FDHA 2YBSA 1YJLA 2P17A 2Z5WA 4I3GA 5KC5A 4QPIA 4GMP3 5CFCA 4EN0A 1SACA 2VBPA 4ISQA 3KM5A 2W3JA 4XTMA 4XFFA 3LOBA 3VD7A 2GN3A 1RTVA 2D6KA 2VOKA 2VMEA 4IE4A 3MPBA 5GJ6A 1VLNA 4Q26A 4QQHA 3PU8A 3NL1A 1VBE1 1JS9A 2DCZA 2ZEZA 4N43B 3H3UA 2ZGRA 1F5JA 1MZ6A 2DFBA 5D1IA 1O5UA 2WYSA 2J1EA 2ZKLA 5FZAA 1O4YA 3AZVA 1RUF2 2WNVA 4HONA 5FZCA 2E31A 5CNAA 5FQ0A 4LPLA 1A8DA 2VECA 2D6MA 1YQ2A 2ZACA 3C7HA 2QBXA 1J84A 4IQPA 2Q1FA 4KI5M 2Q8EA 3RWKX 1RVF1 4NRQA 1BQPA 1QKQA 1U12A 4RR3A 5FLIA 1M4WA 4Z2WA 5EP9A 1QOOA 1G86A 4XC9A 3DF0A 3I49A 3ST7A 4XFHA 4Y22A 5C6CA 4XAAA 4HMZA 5HBAA 2FMYA 2WNOA 3ZM8A 5BNNC 5K0UC 4M4RA 3WY6A 2F6BA 1UZZA 1K5MB 3AL6A 2DTYA 3PHMA 3QBQA 5FJKA 3T09A 4CDWB 2G19A 1W8HA 2VM9A 2VCAA 2C9KA 4R9CA 1IG0A 3OUHA 4GMP1 1CZVA 2W68A 2BRTA 4QHOA 3O1RA 1HRV2 2VL4A 1Y7BA 3O0WA 1WMFA 4QQPA 3WQ1A 3AXDA 1RUD3 5FXZA 5ABJA 1W6NB 4BH9A 1CX1A 2PA7A 1W06A 3SQOA 4XACA 2PHWA 1NY72 2J22A 3E5XA 1NAEA 3WSOA 3IAQA 2A73B 1CAXB 2QJVA 1GNHA 1GZWA 5A1AA 2VO5A 1Z7S3 1ZZCA 2PELA 2QQJA 5FOBB 5FZBA 2V73A 2WS92 4AG4A 4L97A 4B7KA 1SLBA 5FMDA 5J7MA 4CEWC 4RQPC 3ZMNA 3PMEA 3JU9A 5FY7A 2GMMA 5LY1A 1ASJ3 4P5HA 4QPIB 2JENA 2B9VA 2ZZJA 2ZGSA 1Y9QA 2P3YA 2WT2A 3EB7A 1E5RA 1GR3A 3NJYA 5A3WA 3I59A 4AAPA 5F6LB 1NUKA 1US3A 3IDBB 3TBDA 4LBLA 3ZFFB 4FAHA 4OMDA 1CZSA 3VBOA 1R093 1W99A 4LULA 4E2QA 2J1AA 5HV4A 4NWWA 3ACLA 4CZSA 2Q1ZB 4NHXA 3PNAA 2QQWA 4AHZA 1WD4A 4GWMA 4LNVA 5JZGC 1RUG2 5FP8A 3KWVA 5IHRA 3N9PA 4J1XA 4Q4W3 3VD5A 2W47A 4NHYA 3OPWA 5HXVA 1XC6A 4COVA 2XJVA 2PHUA 2ARCA 4JCKA 4GWIA 1QXRA 3H8OA 3J7MA 5FIXA 2WYFA 3APBA 1RUD1 5FP4A 3ZYPA 1Q43A 1SBDA 3AC0A 3MF9A 4KG0A 3W9AA 3ELNA 3C7OA 4MOAA 4RR3B 4AYUA 1I1EA 2IVIB 1W8UA 3HD8B 3TEWA 4W4ZA 1W03A 1AR63 2VQUA 1OQEA 2ZHMA 1Z7S1 5EIYB 2I2SA 4GQ7A 3T1MA 1RMU3 5AVPA 1BYHA 1WW7A 3SKVA 4F7ZA 3PIGA 3AYEA 1XNKA 1W6PA 2DVAA 4GJYA 4QB1A 4TN7A 2R062 5JOZA 4FTSA 3JBG3 5LBEA 4CU8A 4O61A 2WLQA 1ASJ1 2B39A 3KD4A 1QGLA 2XUMA 4YW7A 4G4FA 1ZZ8A 5IWFA 1VBA3 1KFXL 1AXZA 1AJKA 5H9PA 5LASA 1YC61 3FJSA 5C5UA 3P1IA 3B00A 1W2AX 3B9CA 1NG0A 1OLME 1R091 2VBBA 2HWB2 2R1DA 1CAVA 3GNEA 3KHBA 1N1YA 1ULFA 1VBD3 1ZM1A 1EV12 3AX4A 3FFQA 1EAH3 3GXUA 3NVCA 4Q4W1 2OKXA 5FDBA 3ZSJA 4H3WA 4QB2A 2MEV2 2BJSA 3VBSC 1NE6A 3HQXA 4NIDA 2HWC2 3OSDA 1H8TB 3D6EA 4LIVA 1JTZX 1VAVA 4NPRA 4EN7B 1I9RA 1E5IA 4N53C 3POIA 3JB8A 4XBQA 2ZX3A 2W1QA 4AFCA 4M3CF 3RZMA 5F8PA 1VMJA 3WD5A 4GALA 2FHRA 2P5BA 1UU6A 4AEDA 2YBPA 3M7AA 1S2KA 4LIUA 5FUPA 2ZKNA 1AR61 1WBLA 2EXJA 2GU9A 4BCUA 5A6XA 2ZEXA 2NN8A 2VAUA 2ZGLA 3ZSEA 5J48A 2YPDA 4MV2A 2G4IA 4KGQA 1FMD2 1RMU1 3VBOB 5JXHA 4CTEA 4AVVA 1J59A 4WM7B 5C8CC 5E1RA 1NCRA 3THDA 2CAVA 3JBG1 3LKJA 4CDXA 4I0AA 1K3IA 1YQ5A 5FP9A 5A3UA 5C3PA 3ZN6A 3BPSA 3KV9A 3PVEA 1QXJA 3I8TA 5FBZA 1W3XA 1VBA1 3SCGA 4BQXA 2B9UA 4B8EA 4EE2A 3LPGA 5FPVA 3LF7A 2CDPA 2BFUS 3I2HA 5T5PA 4N43C 1PGW1 1HJGA 3I2OA 1UIKA 4DINB 3HOBA 2ZGQA 4OFGA 3IB3A 2PHLA 3FLTA 3RQ0A 2OYZA 1D0GA 1H6YA 2AEZA 1VBD1 1EAH1 3WW2A 4XOGA 2AC1A 4K21A 4QU1A 1SEFA 5A80A 1NQJA 3ACFA 5A33A 4L8QA 3QH7A 4YVWB 3SH5A 4XBLA 1W6PB 1JOJA 1QF3A 2I45A 3PIJA 4JDMA 3DPRC 1D2QA 4GZ9A 4QXCA 4XFGA 4AEMA 4ZKTB 4MUVA 1JYVA 5KXEA 1A3KA 3LB9A 4QX0A 1XPWA 1VRBA 3KHCA 2GNBA 2N7GA 1SPPA 2I74A 3IDAA 1YO8A 4RHV2 2IVJA 1FV3A 1HXS2 2GNTA 3V0BA 3DKWA 5HCAA 3OD0A 3ACGA 5IVBA 2QNKA 1XBFA 1X9PA 4D8MA 4R4ZA 4MHRA 3JXSA 3KSCA 3JQXA 3PTYA 3W59A 5BNQA 3ITQA 1GBGA 1PO23 1NT0A 2F17A 1IPKA 1H4GA 4YM0A 2W46A 4I02A 2W1WA 1NE4A 3IDCB 2VOVA 4NJ4A 5GM0A 1UMZA 2ERFA 3H0OA 3POBA 4FPJA 4C0HA 1RB8G 1HQNA 4QGNA 1OKQA 3R0RA 5L7OC 4AW7A 5FMBA 3HBZA 4YWAA 1AX1A 1OXCA 3BVCA 4QDSA 3ZFEB 4NIHA 2NQYA 4A6OA 4CEYB 4DZGA 5JXJA 3VKLA 1XRUA 2BYVE 2HWE2 1OUSA 3OCPA 2UY9A 2GZWA 1TMF2 3A23A 4Y26A 3O1UA 3WNPA 1ZRIA 5A7PA 2JICA 1O7FA 2YU2A 3K51A 2DVGA 3CQOA 5LA9A 1IPJA 4XF3A 2WUHA 3PU3A 2W52A 4A7KA 1BK0A 4M3CE 3J7HA 4LE4A 2W2IA 1H1AA 4XFBA 3AKPA 1FX5A 3PMSA 5IAVA 2B8MA 4HT1T 4CPBD 3OPZA 1EUUA 4QQLA 4BA6A 1JZ4A 1W0PA 2YV8A 4MGKE 5E16A 2WO3A 3MV11 4DOUA 2HYXA 2O14A 3N3HA 2OZ6A 2WNUB 4HPKB 3N35A 4XFIA 1PO21 2X09A 5FY9A 2GALA 3RJRA 3ZFGA 1B09A 4ASMB 1TQ5A 4E8DA 1JN2P 3LPFA 1F2NA 1UY3A 3ETPA 4O7XA 3ZDSA 4RYDA 1WLDA 4LT5A 1LHUA 4FFFA 1V6MA 1FOD3 1K45A 5A33B 1UYXA 1PHMA 2JECA 3POWA 3VBUC 3WV6A 4V2WA 3NAPB 2E33A 2WZPP 1WLCA 2YFUA 1U5ZA 3OUIA 3VKNA 4KWLA 4R9AA 3EMRA 4Y5Z0 5L73A 3OYWB 1G7YA 3BTXA 5C3SA 2XMLA 4A2UA 1UYPA 3LAGA 3V0BB 3V64A 2GC0A 4PCRA 3MIEA 2NMOA 2VNOA 2Q4SA 4YNIA 4H2AA 4JGZB 4PIYA 5LB6A 3VDDA 2BWCA 3U75A 2G9FA 1REEA 4CSWA 2W95A 4XF9A 3JQWA 3WCSA 1DQ0A 1W9FA 4YG3A 1ODNA 1FXZA 5FP3A 2ET1A 4TLGA 4XJZA 4DXRA 2BGCA 3N9NA 1MACA 3JD73 3LD8A 3MIHA 3U07A 4BPZA 4LLOA 3UGGA 2W91A 3ZXDA 1TZOA 3BTAA 4JHZA 2ZX4A 3MW2A 1OPOA 2VUAA 1AR72 2GAUA 4TSVA 4SLIA 5D8AB 2AZ5A 3L2YA 2OA2A 1V6OA 4UFMA 1RUH2 4S2GA 4AOCA 1H8TC 2OQ7A 1W90A 3U1XA 1T6BX 4YW6A 2QE3A 3N7LA 1FOD1 2XJUA 4IEQA 4MHUA 1JZ3A 1S1AA 4OHXA 2DCJA 5FYHA 4R9BA 3S6PA 1ZBA2 3O7OA 5FZLA 3PLQA 2XBO3 4GKYA 1CD3G 5FZEA 3WUCA 5FZFA 2WQZC 4UF0B 4N9HA 2Y8KA 3EJKA 1TNFA 2JB8A 4NN0A 4CE8A 4COUA 2NYYA 5EPAA 4LO4B 4NO4A 1W0NA 1O8SA 3H9AA 1CIYA 2JG9A 2YG0A 4S2FA 3U0ZA 1OVPA 2C4XA 1V9U3 4LO7A 1UOGA 2VCBA 4W6YA 1DQ5A 1SZBA 2CWMA 2CWSA 4CYDA 3SCFA 5FZMA 5IATA 1WCDJ 4FVVA 4WVVA 1WLWA 5CYYA 4XVHA 1KEXA 2DCYA 3ZFGB 4EWAA 1MPXA 5GZDA 2VVDA 1O8PA 4M3CB 2EIDA 2A6ZA 3UV9A 3ZXJA 1KDMA 4FFHA 2X5IB 1GZ9A 2IZWA 4IEUA 3WG1A 4MSVA 4AEKA 2PN5A 2QKDA 2R072 3JD71 3OUJA 3WNOA 3POYA 4CXXA 4FPEA 4CCKA 2B46X 2CL2A 1X7NA 3J4UH 4LO6B 5K0UA 5BNNA 1UKGA 1PGL2 1ALYA 2DU0A 3JCIA 4V1PA 1COV3 4ZONA 1I5PA 1UNBA 2VW1A 5EJ3A 2BTVC 5TSWA 1GNZA 1VAKA 4MADA 4YVWC 4QWNA 2D3PA 1WCKA 3AMHA 3J26N 2OT7A 3IT8A 3RS6A 4AI9A 1F31A 2NMNA 2XBO1 2R16A 4H14A 3T08A 4KU8A 1R1A2 5JIAA 3WQBA 1S0IA 5LATA 4CCNA 2E7AA 5JIUA 2WR9A 4BHPA 3AP9A 1YFWA 4QD2A 4Y20A 3SITA 1V9U1 5M0TA 2RR12 4XJ9A 2WWSA 1A8MA 3AZZA 2IFRA 1NKGA 1XXNA 1GSLA 4FBFA 3SEPA 1OH3A 1XYPA 4CCDA 1ZRFA 1BJQA 4PIXA 1WCSA 2W87A 1AR92 4NIGA 3AYCA 5B4NA 1Q8QA 4LBNA 5C3QA 4CEWA 2PMWB 4RQPA 4QM8A 1OA4A 4L9BA 3ILFA 4QKNA 1G9BA 2AREA 1UPSA 3VHOA 2WAOA 4BJ0A 4Q29A 4DEVA 3I2FA 2Q5TA 3HIFA 3OGGA 1XYNA 3UGHA 4AL9A 4Z1VA 1FAYA 3RFRA 1X8EA 4W6XA 5C70A 3GHNA 3Q8CA 4U36A 5FYYA 4QPGB 1COV1 3LZZA 1R083 1ZBE2 4Q0UA 2JKBA 2NZ9A 2ZABA 3F95A 1E5HA 1C8M3 5FCCA 5JZGA 2Z79A 1JYIA 5CG9A 3LFMA 4CUAA 5L36A 1H2MA 2L9LA 4U2AA 3T30A 2OUJA 3D0SA 3EQEA 2ZJCA 1D7PM 1ZA4A 5FBJA 3UNPA 3JZVA 2BGOA 3CEWA 4KWKA 1XU1A 4Q4V2 1SG3A 4ZU4A 5C3OA 4H7MA 4OI0A 1ND3A 3V0AB 1SCRA 4PHZA 1OHFA 1QJX3 3WVJA 5I0DA 4DB5A 3N7JA 3T0AA 2HWD3 3NWKA 1CAUA 2A5ZA 2GMPA 1YIPA 4DUXA 4DNYA 1W9WA 4QXBA 1I5ZA 4IEXA 3PUQA 1Q8SA 1NA1C 1VBC3 3UKNA 4OMCA 5L9VA 1CJPA 3S7EA 4FPCA 4H55A 4I09A 1WKYA 5K0UB 1GU3A 2DBIA 3GBWA 5FZOB 2XWBB 3WP6A 3P3PA 3H8XA 1CPNA 2Y6KA 2PHDA 1O4TA 4XW3A 5LW9A 3TEXA 1BK1A 3NAPC 2LM3A 3VKFC 3DYOA 2OIIA 4IEYA 3CDZB 4BB3A 4DXSA 1RUI3 4LBOA 5I0RA 2D40A 1VBE2 1PMJX 1SCSA 1RUOA 5BNOC 1NXD1 3N9LA 3SKJE 4P9JA 1U5YA 4HKLA 4WM8C 3TAYA 1U5IA 4KGGA 2XKOA 3CL1A 5EQUA
chains in the Genus database with same CATH topology
4CP9B 2Q1FA 2KR2A 3ZYFA 1L7LA 3ZYHA 1W9FA 1W8UA 2C24A 2K46A 4LK7A 4CP9A 1GWLA 4BQ4A 4LK6A 4A6SA 3F95A 3UT0A 2JWPA 1OH3A 1GWKA 4CPBA 1V0AA 5D21A 1GWMA 3ZYBA 1UOJA 1W8WA 4CPBD 4YWAA 2VXJA 1OKOA 2LROA 4BQ3A 4LKFA 1W8TA 4YW7A 2LRPA 3ORJA 2O14A 4BQ2A 1W8ZA 1HN0A 4LKDA 4LKEA 1WMXA 1W90A 1WCUA 4LJHA 4YW6A 4BQ5A 1WZXA 2WYFA 4AL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CP9 B;  2Q1F A;  2KR2 A;  3ZYF A;  1L7L A;  3ZYH A;  1W9F A;  1W8U A;  2C24 A;  2K46 A;  4LK7 A;  4CP9 A;  1GWL A;  4BQ4 A;  4LK6 A;  4A6S A;  3F95 A;  3UT0 A;  2JWP A;  1OH3 A;  1GWK A;  4CPB A;  1V0A A;  5D21 A;  1GWM A;  3ZYB A;  1UOJ A;  1W8W A;  4CPB D;  4YWA A;  2VXJ A;  1OKO A;  2LRO A;  4BQ3 A;  4LKF A;  1W8T A;  4YW7 A;  2LRP A;  3ORJ A;  2O14 A;  4BQ2 A;  1W8Z A;  1HN0 A;  4LKD A;  4LKE A;  1WMX A;  1W90 A;  1WCU A;  4LJH A;  4YW6 A;  4BQ5 A;  1WZX A;  2WYF A;  4AL9 A; 
#chains in the Genus database with same CATH topology
 1R08 1;  3LA2 A;  2GDF A;  1MS8 A;  3AYA A;  1IKQ A;  5F5I A;  5FXV A;  1AZD A;  4UBH A;  3BUC A;  2ARX A;  1C8M 1;  5F5A A;  3VUO A;  2C26 A;  3J8F 3;  5I91 A;  4QT6 A;  4N8M A;  2QQV A;  3LDR A;  2CU5 A;  2XVG A;  1AYM 2;  2HBT A;  4YW2 A;  1BEV 3;  1E5S A;  1RVF 2;  3H8U A;  4QGM A;  2XVL A;  4CEW B;  3RZJ A;  4RQP B;  1QJX 1;  2R32 A;  5CG8 A;  3A21 A;  4RS5 C;  2VXJ A;  5ANQ A;  4FP2 A;  4WV8 A;  2VZQ A;  2HWD 1;  1TE1 B;  4I0B A;  1W8Z A;  4MGZ E;  3Q8A A;  4YZ3 A;  3T2T A;  3LFI A;  1BKZ A;  1FV2 A;  4HBN A;  1AUY A;  1VBC 1;  4FPH A;  1NQD A;  5FY5 A;  3WNM A;  3ZXE A;  4Q0V A;  4CU9 A;  2WDB A;  1O3S A;  4YYO A;  4IV1 B;  2BVB A;  1BLZ A;  2ETE A;  3DEC A;  4JTN A;  4LBK A;  4OCT A;  1DGW A;  3SEE A;  3MID A;  5C8C A;  4IER A;  4Q2F A;  5JZG B;  5FR3 A;  3PJQ A;  1YEW A;  2R7E B;  5IVE A;  5A3L A;  1VIW B;  2W92 A;  1RUI 1;  1OA2 A;  3GM8 A;  1JZ2 A;  3CJI B;  3J7N A;  3MHZ A;  2A71 A;  1C4R A;  5FKC A;  1AL2 3;  3LDK A;  3HAG A;  5FWE A;  3KCC A;  4N43 A;  3CHX A;  3HJR A;  5APA A;  5T50 A;  4X8N A;  4I01 A;  1WMX A;  5LBF A;  2QDR A;  3E1F 1;  1D0H A;  1H1M A;  4YFZ A;  4UFK A;  1NLS A;  4P9W A;  5F39 A;  4AFM A;  5ACA 3;  1F4H A;  2V09 A;  3BGA A;  4L99 A;  4B4Q A;  2JDP A;  1F15 A;  3WEZ A;  3J8F 1;  4L0P A;  4BLJ A;  2P3J A;  3PUH A;  2ILM A;  4O9G A;  2HJI A;  3W58 A;  1AL0 G;  1BEV 1;  1XND A;  2X5I C;  1OD5 A;  3S7I A;  3WCR A;  4IV3 C;  2WQ8 A;  3MEP A;  4QX5 A;  3INA A;  4UW4 A;  1QXP A;  1CPM A;  3DPR A;  4XHB A;  2VMH A;  3VD4 A;  5IK4 A;  4WZC A;  2NM1 A;  3VKO A;  2ZS6 B;  3MW3 A;  2GP5 A;  3CZJ A;  1QHD A;  1H2N A;  4A44 A;  1Y3T A;  3QCW A;  3ZSK A;  1H2L A;  2ET7 A;  3E6B A;  4P9G A;  1JOB A;  4CUC A;  1K5M A;  1YUD A;  4A42 A;  4IES A;  2E6V A;  4DMI A;  1GKB A;  4XZP A;  4BIF A;  2CY6 A;  3KV5 A;  3LOI A;  2SLI A;  1V6K A;  4NR1 A;  3D0J A;  2DV9 A;  1AX0 A;  1Z0H A;  2K46 A;  2PAE A;  3TYJ A;  1RUD 2;  3VBS B;  5ANN A;  3OOX A;  4DO0 A;  1RUC 3;  3T3Y A;  5JSP A;  1AL2 1;  3POG A;  4N53 B;  5L7O A;  1KD7 A;  2H6B A;  2JD9 A;  2O8O A;  3AVS A;  3ZYB A;  1D4V B;  1GAN A;  5DAQ A;  4TZD A;  1Z7S 2;  1CAX A;  1MQT C;  2VMI A;  3AKQ A;  3Q8E A;  5A7N A;  4W65 A;  4CCE A;  2R49 A;  1JZ5 A;  1POQ A;  3F2Z A;  1YQ6 A;  4Z07 A;  4YZ5 A;  2A6X A;  4A45 A;  5ACA 1;  5KC6 A;  4MLO A;  2XPJ A;  3VD3 A;  5FXW A;  5FO8 B;  1UXZ A;  4LOS A;  5LRS A;  1M06 G;  1FPN 3;  4FFG A;  5EZW A;  4CDQ C;  1ASJ 2;  5AC9 3;  2EAA A;  4BXF A;  4DY3 A;  3I3B A;  3TNP B;  1YI7 A;  3KGL A;  3IIA A;  5C8C B;  1ND2 B;  3S5Q A;  2OX0 A;  4XDQ A;  4CXW A;  1O3T A;  1CZT A;  4IXL A;  4E27 A;  5IT6 A;  3HNB M;  4BQY A;  5A1L A;  3FMG A;  4W8J A;  3SIS A;  3ZFF A;  1R09 2;  2DCK A;  1RUJ 3;  4HAN A;  1JU4 A;  4LUK A;  1AF9 A;  4QPG C;  3LDB A;  3RZG A;  3ZPY A;  4GMP 0;  1ULO A;  2EF6 A;  2VTX A;  4JVA A;  4AQ6 A;  1UIJ A;  4Q4W 2;  4MO3 M;  1LOD A;  1LOG A;  1YQC A;  3OEB A;  4Q5O A;  4A4A A;  3ZMO A;  4O65 A;  4KWJ A;  3GF6 A;  3AMN A;  1XOY A;  1EYB A;  2R1B A;  3I7D A;  4I30 A;  5GZE A;  1AYN 3;  3UK9 A;  2FZ1 A;  5C33 A;  4P14 A;  1PK6 C;  3OF1 A;  3POJ A;  4RGA A;  1HV1 A;  2EIB A;  2VZR A;  3N9Q A;  5DQ0 A;  1PNF A;  2DYC A;  3KQR A;  1C1F A;  1RUC 1;  3VBU A;  1JOD A;  3QLQ A;  5FMO L;  2Y26 A;  5FY4 A;  3DPR B;  3VZM A;  4B3N A;  1A78 A;  1DZQ A;  1GWL A;  3DEM A;  1AR6 2;  3DYM A;  3S0M A;  4PQ9 A;  4QXH A;  1BVP 1;  1RMU 2;  2HBU A;  2RDR A;  1KQR A;  3B69 A;  2QQM A;  3ES4 A;  3WDV A;  4OQ9 A;  3JBG 2;  4G9S B;  4FPL A;  3RNS A;  1FPN 1;  4AI2 A;  4OYU A;  5AC9 1;  1W8T A;  4AF9 A;  2YBK A;  3U4X A;  3A22 A;  3T1L A;  2R04 3;  5FPL A;  3WX5 A;  3H7Y A;  5K8S A;  1MEC 3;  5C3R A;  4LJH A;  1GNY A;  2DU1 A;  1N1S A;  1MS4 A;  4IUG A;  3U10 A;  1PIV 3;  2AGS A;  1XE7 A;  4GB3 3;  2CNA A;  2XGX A;  5JOX A;  5JR2 A;  2ZGK A;  2H6C A;  1H2K A;  1PGW 2;  1V70 A;  2QUO A;  1RUJ 1;  5G05 L;  4Z2A A;  1SBE A;  2QZ2 A;  3M3O A;  3O1P A;  2D6P A;  5DAV A;  4BME A;  3BYW A;  5L7O B;  4PIZ A;  5H9Q A;  3MUZ 1;  1VBD 2;  3R4D B;  1EAH 2;  4AI1 A;  1S0C A;  2VR4 A;  1MVQ A;  3EBR A;  1SLC A;  3GBF A;  1JUI A;  5FWJ A;  3WDX A;  1C3H A;  1AYN 1;  2BP6 A;  2VCM A;  2WL1 A;  1H8T A;  3HPN A;  4FFI A;  4A7Y A;  1N47 A;  1OOP C;  4UBG A;  1MZE A;  2XUE A;  4Y1X A;  5FZ6 A;  4AFA A;  3POE A;  2F4P A;  4DRR A;  3LEK A;  4Q27 A;  4ATE A;  1S4C A;  5DZF A;  2ZHL A;  1QDO A;  4HK9 A;  1KS4 A;  5CVR A;  4FTB A;  2ZMN A;  4IE0 A;  1O91 A;  2XLF A;  1LED A;  5I0U A;  2XKP A;  4C0B A;  3MZH A;  3O1S A;  4IE6 A;  4IV1 C;  4GH4 C;  3ABZ A;  4LR4 A;  5A6Q A;  4WM7 A;  1W6Q A;  5HCH A;  4E4S A;  2B5H A;  4QX7 A;  3AP4 A;  3OJB A;  1VJ2 A;  1Q8P A;  3KT7 A;  1WCQ A;  2R04 1;  4V2V A;  1LOF A;  1MEC 1;  1RC6 A;  1X9T A;  4QKD A;  3KT4 A;  2HEV F;  3K4D A;  2LUW A;  1PVC 3;  5L9R A;  1PIV 1;  5GLW A;  3CJI C;  4GB3 1;  1DQ6 A;  2RE9 A;  1UKR A;  3HN1 A;  4LLF A;  1JOP A;  4AAX A;  3M1H A;  3VBU B;  4F3J A;  4XCB A;  2GNM A;  3RWN A;  2C24 A;  2TNF A;  1O5L A;  3ROU A;  4ZZ8 A;  1UO9 A;  2VZ1 A;  4FPY A;  4JKM A;  4ASL A;  1AR8 3;  1HV0 A;  3SMH A;  1W8N A;  4LIT A;  4UT5 A;  4UFI A;  4YG0 A;  4YVW A;  1G6N A;  5FPA A;  5FTT C;  5LEJ A;  2JDA A;  2Q1M A;  1DDL A;  3FBM A;  3KGZ A;  1IOA A;  5FZK A;  4AE2 A;  4P9I A;  4LBJ A;  3FC0 A;  1QNW A;  2Y33 A;  4IEZ A;  5EWS A;  1JW6 A;  2RJ2 A;  1H4H A;  4XPV A;  2VMC A;  2ZX2 A;  4OI4 A;  3RJ2 X;  4C1X A;  3ENR A;  2E7T A;  4BXS V;  3U4S A;  1PO2 2;  3NV3 A;  2PTM A;  3IM0 A;  3VKM A;  3GBG A;  1V6J A;  1FNY A;  4P9L A;  5EJ1 B;  2JG8 B;  4K3U A;  3VBR C;  4WVW A;  3T4H B;  5E6H A;  1SBF A;  3WIN E;  4M01 A;  3QD6 A;  2TBV A;  4YGD A;  1GZC A;  3OGV A;  3MGU A;  1LHW A;  1PVC 1;  1YFY A;  4NII A;  3VL9 A;  3X29 B;  2A75 A;  2VG9 A;  3GJB A;  2AR6 A;  4LBQ B;  5J96 B;  1UL9 A;  3B3Q E;  1LB2 A;  1SMV A;  5JMC A;  4JDO A;  3CJX A;  1AXK A;  3A0N A;  1OLM A;  4UWD A;  3ZFE A;  2A7A A;  3AXE A;  3B93 A;  4RFT 0;  4CEY A;  3S5A A;  1L7R A;  2JXA A;  2Z42 A;  3NKG A;  3OY8 A;  4NAM A;  5FJH A;  5EXO A;  2MNG A;  3BTY A;  4S2D A;  2EXK A;  1AR8 1;  5J37 A;  4MXW A;  3IAP A;  4C90 A;  3BOW A;  2WRA A;  2ZTN A;  1IQA A;  2IXK A;  3LEI A;  1LGB A;  1ULC A;  1W6Q B;  3MBW A;  5BXX A;  2JIJ A;  1ND2 C;  2BWA A;  4KBB A;  2CYF A;  3OTF A;  3ZN5 A;  4FOW A;  1DZR A;  1H9P A;  4DPN A;  2A70 A;  2LS6 A;  3JB4 C;  4M0H A;  5E88 A;  3THT A;  4A7Z A;  1BBT 3;  5GLV A;  3HVD A;  3Q9O A;  4MX3 A;  3ACH A;  5FY8 A;  1X82 A;  3HEI A;  4CU7 A;  1AJO A;  5IK7 A;  2WNU A;  4HPK A;  2PLV 3;  5KWR A;  1C28 A;  2VZP A;  3GZU C;  3ZXF A;  1POV 3;  4B4R A;  2WA3 A;  3UKT A;  4QX2 A;  5BNP C;  2BOI A;  1FOD 2;  4BZ4 A;  1UU5 A;  1MZF A;  3NV2 A;  3ILR A;  1S0F A;  5FYC A;  3O12 A;  4X6R B;  4R8H A;  4NAO A;  5CIS A;  1W39 A;  1UD1 A;  3NAP A;  4IGO A;  4JX0 A;  4NE9 A;  4NRM A;  4FTE A;  4E8C A;  3H1M A;  1YIF A;  1KJL A;  2XQR A;  5HPO A;  3POF A;  1A34 A;  3OG2 A;  2WWU A;  2ZX1 A;  4RA0 A;  2EAL A;  3OYW A;  3NQH A;  3TB0 A;  1JHJ A;  2V5D A;  1UN1 A;  4XZU G;  5DDJ 3;  4CUB A;  2H0V A;  5FV3 A;  3ZKY A;  3IMM A;  2BEO A;  4DFS A;  5I0S A;  4JGZ A;  4FQ4 A;  4A3X A;  3RYK A;  4ZHN A;  1RIT A;  2EIE A;  4K1Z A;  4IEP A;  1W8F A;  3GGL A;  4Y24 A;  4BMB A;  4ZS2 A;  2CHH A;  3AKS A;  2DFC A;  1HLC A;  3JD7 2;  1ZRC A;  4N90 A;  1BBT 1;  2GP3 A;  3ZKU A;  2QQK A;  2ZXQ A;  4QMA A;  2B7Y A;  1NCQ C;  2W5F A;  1QJY 3;  1UY0 A;  4N9I A;  2VZS A;  2VH9 A;  5IYY A;  3FWE A;  4PI2 A;  4TTG A;  4DUV A;  4UYB A;  4AHY A;  4BQ3 A;  1PMH X;  5JXG A;  2W1S A;  3WW4 A;  4IEO A;  4ITC A;  1LKN A;  4HXC A;  2PLV 1;  5C71 A;  5D8A A;  1TME 3;  1VP6 A;  4XEZ A;  1POV 1;  2JDH A;  3OY8 B;  3C7E A;  3MF6 A;  4D69 A;  3I2K A;  4MXW B;  2WFF 3;  4CCC A;  4CCJ A;  4ARY A;  4FPG A;  5FYZ A;  4Q8L A;  4WBB A;  2XBO 2;  2VQT A;  5IFT A;  1TVG A;  1RJ7 A;  3ZYI B;  1UOB A;  3SC7 X;  4UF0 A;  3H50 A;  2E53 A;  4ZPI A;  1DYO A;  2Y6J A;  5JUV A;  2VD7 A;  3BI3 A;  3ON7 A;  4K8R B;  4QM9 A;  3FUO A;  1CAW A;  2OW4 A;  1CIW A;  3AKT A;  2Y6F A;  3GAL A;  4OZX A;  3VBF C;  1ODM A;  1V9U 2;  3HNY M;  3R4U A;  2JKX A;  2VMF A;  1OKO A;  4FO9 A;  5DDJ 1;  1JH5 A;  4OUL A;  1BHG A;  1SQ4 A;  1RYY A;  4DS0 A;  5C7G A;  2UYA A;  1EPZ A;  1NA1 B;  5KHH A;  4YVS C;  2ZZQ A;  4D7Y A;  4YGE A;  2YB7 A;  2VZU A;  1ONA A;  4ET7 A;  4M3C A;  5T3N A;  1C5H A;  2X5I A;  5I8S A;  4XJW A;  4IV3 A;  1HIX A;  2DVF A;  1HQL A;  1HB4 A;  3RI9 A;  2ZOE B;  3IDE A;  3VDB A;  1CON A;  1QJY 1;  4EN6 B;  3VBH C;  2WA4 A;  4IE5 A;  3M4F A;  3MO4 A;  3HWJ A;  4LHL A;  1XQN A;  4X6Q B;  1COV 2;  3SH4 A;  4BDV B;  3N36 A;  1J58 A;  1W8W A;  5BNO B;  3BB6 A;  1TME 1;  3VL8 A;  2HEW F;  4D7S A;  4HN1 A;  2YPJ A;  2XDV A;  2JDN A;  4WM8 B;  2IXC A;  2KD7 A;  2X8K A;  2WNV C;  3ZDV A;  2WFF 1;  5EJZ B;  1JYT A;  3K3O A;  2X05 A;  3AFG A;  1UZ0 A;  1W28 A;  2Q8O A;  3WHU A;  5CBL A;  2KM2 A;  2ZAH A;  5KR7 A;  4MET A;  3WNK A;  3PVO A;  2B42 B;  4M4P A;  4NWV A;  2VU9 A;  2VZV A;  2Y0I A;  4WVZ A;  3AZX A;  2FZ2 A;  2WBK A;  2D6N A;  4LK6 A;  3LE0 A;  1H0B A;  5E8A A;  1RHI 3;  3VHN A;  1YXW A;  3BOD A;  1QJU 3;  4RS5 B;  1QWR A;  2BZD A;  4QXK A;  5LBC A;  3WNL A;  4JZR A;  2HWF 3;  4LUM A;  1DLL A;  2W0X A;  3RMX A;  1NYW A;  1NZC A;  2JEM A;  2JG8 C;  4HFS A;  4XMI A;  4AXO A;  2VUL A;  4AZZ A;  3AJZ A;  3VB9 A;  4MGT A;  3AP5 A;  4EV0 A;  3NV4 A;  2WWJ A;  4OHW A;  4BQ2 A;  4CDQ A;  3WDY A;  1IHM A;  1S0E A;  1DZT A;  5LA0 A;  3MDP A;  3WT3 A;  2XVK A;  1Y9M A;  3W20 A;  1E57 A;  1IS6 A;  1QU0 A;  4QKF A;  5ABJ C;  2QQI A;  5FYT A;  2BDR A;  1BZW A;  5F5Q A;  3ZVX A;  1OQD A;  1F8V A;  1R08 2;  4QPG A;  1CAW B;  1CES A;  1W0O A;  2BUK A;  3LEG A;  5LY2 A;  3SLI A;  1WA6 X;  4NHK A;  1C8M 2;  3TEY A;  2DTW A;  3H42 B;  5FUI A;  3ZX7 A;  1UY2 A;  4CP0 A;  3USU A;  1OBN A;  1KJR A;  4WZF A;  3M3E A;  1D4M 3;  4AI8 A;  3RPQ A;  2HWE 3;  3IN9 A;  3D82 A;  1MS3 A;  5FKB A;  3WG3 A;  4HLT A;  2DUQ A;  1W6M B;  2JE9 A;  5A3P A;  1YFU A;  4KQ7 A;  1PK6 A;  5C4W C;  1QJX 2;  3WW1 A;  4BQ5 A;  4NOT A;  4YAR A;  4N7U A;  3V0A A;  5FZI A;  1ACC A;  4JGY C;  1SDW A;  3EO6 A;  3KQ4 B;  4IDZ A;  4XIK A;  1QJF A;  4Z82 A;  4IV3 B;  1H30 A;  3ZYH A;  2XQX A;  1VB4 A;  1RHI 1;  1P8J A;  1VBC 2;  1AXY A;  1QJU 1;  5GKA C;  1OSG A;  3WF3 A;  4KG8 A;  5FUN A;  1CR7 A;  2XR4 A;  1GUI A;  4RGG A;  2HWF 1;  1KIT A;  1PM4 A;  2VXR A;  3C7F A;  5DAX A;  4QPY A;  2JWP A;  2WII B;  1HXS 1;  5FZO A;  1U5X A;  4MYE A;  1ST8 A;  5D2A A;  4YGC A;  1DYP A;  3KV6 A;  2Y38 A;  1Y4W A;  1J3Q A;  2LRO A;  3GZE A;  5B4X A;  1PGS A;  1LOA A;  1RUI 2;  3C7G A;  4DXZ A;  1XE0 A;  2Z69 A;  2OS2 A;  3ECQ A;  4P9X A;  3VN4 A;  4ES8 A;  5IFP A;  1R1Z A;  2XJR A;  4JRL A;  4MH0 E;  2Q8C A;  4BK4 A;  1HB3 A;  5CFD B;  3NW4 A;  4D94 A;  4QQO A;  5LBB A;  1J83 A;  5DXD A;  5SV5 A;  4Q8K A;  4C91 A;  4ZZ5 A;  5CB7 A;  2ZHN A;  3NNM A;  2QQN A;  3J8F 2;  1UXX X;  4E2G A;  1GV9 A;  1MR5 A;  2RS1 3;  4I3P A;  1D4M 1;  1MQT B;  4FAG A;  1B35 C;  1BEV 2;  2HWE 1;  1O59 A;  3E6C C;  2JDY A;  2AEN A;  2Y64 A;  3URF A;  2QQO A;  5FZ9 A;  3WF4 A;  1XNB A;  5IVC A;  1OOP A;  4CDQ B;  2PYT A;  2RV9 A;  4IEV A;  1VBB 3;  3KCY A;  4ZXK A;  4EWE A;  2IXJ A;  1HRI 3;  1UY1 A;  1QOS A;  3TN9 3;  4EJR A;  4BIO A;  1KRI A;  2WT1 A;  1IZ3 A;  4CDU C;  3ZSL A;  5HI0 A;  1JZ7 A;  3L2H A;  1DGL A;  3KZ4 C;  4LQR A;  2EVX A;  3O0V A;  1QH7 A;  5T55 A;  4EZH A;  1RL3 A;  1EY2 A;  3IWZ A;  4IV1 A;  1AHS A;  2ARB A;  1ENQ A;  3LIG A;  3KT1 A;  4CVU A;  5HCB A;  4COZ A;  3USU B;  3T2P A;  3OGJ A;  2BNM A;  3MI8 A;  5IK8 A;  5J3U A;  4FXK B;  2E32 A;  3WR0 A;  3I54 A;  5F5C A;  1JYX A;  1AL2 2;  1I3H A;  3CJI A;  3VD9 A;  1PK6 B;  4Q4X 3;  1RIR A;  1UF2 C;  2Q0A A;  1RED A;  1HB1 A;  5JI7 A;  2RS3 3;  1DBN A;  1ZBA 3;  4AED C;  1DQ1 A;  2ZHK A;  3E5U A;  3M3I A;  2JX9 A;  2RHP A;  3K2O A;  5FYS A;  5ACA 2;  3W5M A;  4BU2 A;  2VY0 A;  2VZ3 A;  2RS1 1;  4LBM A;  5LEK A;  4AFB A;  4UFL A;  1AX2 A;  1XJA A;  4QX3 A;  1J3R A;  3K3N A;  2AUY A;  4YSF A;  5FRA A;  2O8Q A;  5DUW A;  1ZYB A;  4BK5 A;  1PVX A;  3ACI A;  4QKB A;  5CKQ A;  3RZZ A;  1STM A;  1Q56 A;  1N1T A;  1VBB 1;  1HRI 1;  4Y4Y A;  5FZ7 A;  3TN9 1;  5CAZ A;  3CU7 A;  1ZRD A;  2VE1 A;  4HET A;  4C1W A;  2Y6G A;  4WVM B;  1KFU L;  3SNM A;  4D0Q A;  4RFR B;  3RZH A;  2ZEW A;  2GH8 A;  2BPA 2;  4TLF A;  5A6Y A;  3WNN A;  1FI2 A;  3H3Z A;  3BU0 A;  4QPW A;  3N9M A;  1UYZ A;  4CXY A;  3HQU A;  1VRH 3;  4LO8 A;  1C8N A;  1PZ9 A;  1WLT A;  1XNA A;  1OH4 A;  2HH9 A;  2VUJ A;  2ZGP A;  3D3A A;  3BAL A;  4GA9 A;  3RG0 A;  4HSL A;  3VBR A;  4Q4Y 3;  1YQ8 A;  4XJU A;  1GMM A;  1IG3 A;  2XWJ B;  4PJY A;  1FAT A;  1RUC 2;  3FL7 A;  3VBS A;  1WGP A;  4M00 A;  1EPW A;  1NXM A;  2YFZ A;  1LGC A;  4Q4X 1;  4EN8 B;  3PUS A;  1OOP B;  1WWY A;  1OF4 A;  4N53 A;  2RS3 1;  1TNR A;  3GZA A;  1ZBA 1;  1Z78 A;  4LKF A;  2DBN A;  1KGY A;  5IK5 A;  5J98 B;  4LKE A;  4MVT A;  2B45 X;  2JDZ A;  2YZ4 A;  3NNL A;  5CEH A;  4NHM A;  3IKW A;  3KLS A;  1FPN 2;  3M8L A;  5AC9 2;  4NPL A;  4GWJ A;  5FMO S;  1GOH A;  3ZXL A;  4AK3 A;  4DIQ A;  4GH4 B;  3VLB B;  3D5O A;  4PDW C;  1ULP A;  4XQW A;  5LA1 A;  4YGB A;  1UQX A;  4YRD A;  1L3J A;  2XJP A;  2W08 A;  4YM3 A;  1C5I A;  1ND2 A;  3ZIW A;  2R30 A;  2D98 A;  1K5J A;  4HKW A;  4LA3 A;  2D5H A;  1HN1 A;  3MIF A;  5JPN B;  1VPH A;  1RUJ 2;  1XB9 A;  4OLL A;  3VDC A;  1JYN A;  4DY5 A;  3ALQ A;  1GWM A;  4BOW A;  4MGS A;  5I8Y A;  1LHO A;  3VDA A;  2AEY A;  4ARX A;  3AZY A;  1HKD A;  3BIE A;  4PLN A;  3UGF A;  2JDK A;  2LRP A;  5C9A C;  1H6X A;  1VRH 1;  4FOY A;  4RD7 A;  3HNM A;  1LJ7 A;  3N4M A;  2J1T A;  1WW6 A;  2VQ0 A;  5A7W B;  4B1L A;  4XQD A;  1AYN 2;  3SXW A;  3CF6 E;  3T2Q A;  2C6S A;  3VZJ A;  1QJZ A;  1PGL 1;  1UW8 A;  3KS7 A;  4Q4Y 1;  4XBN A;  1GFF 2;  5F3C A;  3PVB B;  4URT A;  3GHM A;  4QHB A;  2ZGU A;  1T2X A;  1G9A A;  1IS3 A;  3LIH A;  1PO1 3;  1Q8O A;  5DPN A;  3DXT A;  1FT9 A;  1FNZ A;  2WKK A;  2G9G A;  3FBY A;  1DFQ A;  2VTX J;  2KXL A;  1XU2 A;  2X53 S;  3AM2 A;  3ME2 A;  3MPP G;  3NST A;  1UPI A;  1XSR A;  5LK7 B;  4XYX A;  1TEI A;  3NJZ A;  5IVJ A;  4DUW A;  4L2N A;  1PNG A;  4XCA A;  4J25 A;  5G04 L;  5EYX A;  4CP2 A;  2R04 2;  4UOJ A;  4EN9 B;  3LA7 A;  1MEC 2;  3H3L A;  5FLH A;  3OGS A;  4CP9 B;  1WD3 A;  2WZ8 A;  2YC0 A;  3E5Q A;  3S30 A;  4AGR A;  1PIV 2;  1QDC A;  2ZEY A;  4GB3 2;  1YCI A;  4SBV A;  5A1F A;  2V4A A;  3VBR B;  4OVE A;  4Q0P A;  2ZGN A;  4JTO A;  5CFD C;  3BIW E;  4YG6 A;  2TEP A;  3DGT A;  3LA3 A;  2XH6 A;  5CZK A;  1HB2 A;  5A32 B;  1WME A;  2BU9 A;  2DF7 A;  2YY1 A;  4LO5 B;  4Y33 A;  4DQA A;  1NCQ A;  1VB2 A;  3CBN A;  4MGY E;  2B4K A;  2WN2 A;  3WUD A;  2H0B A;  3O1O A;  3VZK A;  3NNG A;  4CCL A;  2BQP A;  5F3I A;  2RJK A;  3OGR A;  4LOR A;  2VNG A;  1RUE 3;  2C5D A;  4D6S A;  4HK8 A;  1MS0 A;  2FDJ A;  1QH6 A;  2BER A;  4QAW A;  2JE7 A;  3BN6 A;  2QTW B;  4LKS A;  2JDU A;  3AMQ A;  1OC1 A;  5BY5 A;  2P6H A;  2XXZ A;  4P5Y A;  4W6W A;  4XIO A;  3VDD C;  2UUR A;  3I3E A;  4W50 A;  5F32 A;  5IVV A;  2P3K A;  1WW5 A;  1PO1 1;  3VZN A;  4FSJ A;  1VAL A;  1YWK A;  3I2J A;  3OBR A;  1LOE A;  2UWB A;  1J1T A;  1TG7 A;  2ZGO A;  4HN0 A;  2NP0 A;  3O1T A;  3PDQ A;  5AVA A;  4A6S A;  5SV8 A;  1MVE A;  4AFD A;  4OI1 A;  5A3T A;  1WBF A;  2XJT A;  4DRV A;  2QQU A;  3PUA A;  4R9D A;  2UWC A;  3A0K A;  2D6O X;  1CX4 A;  4KU7 A;  1US2 A;  2VOW A;  2J1R A;  2GC1 A;  1KDK A;  3I3D A;  1QQP 3;  2XON A;  1PVC 2;  1DCS A;  2VVF A;  4YVS A;  2FBE A;  3WP5 A;  4ATF A;  1ENS A;  4NMI A;  5BNP B;  3RDI A;  4JQR A;  2RDN A;  1LHV A;  4XET A;  2RDQ A;  2VJX A;  1G9D A;  3ZXG A;  3MV0 1;  1W6O A;  1APN A;  2ORX A;  5CA6 A;  4IND A;  3ZSM A;  3GCX A;  5LZ6 A;  3VBH A;  2FDK A;  5T5J A;  4NRP A;  2YMZ A;  4AWD A;  2QVS B;  2WZE A;  2YU1 A;  1OA3 A;  4XMA A;  1AR8 2;  3S57 A;  2BBA A;  2JG9 C;  4G3Y C;  1RUE 1;  2W39 A;  4Y5T A;  1GQG A;  4K8F A;  2NLR A;  5GZG A;  1K42 A;  4JRA A;  5CKM A;  3I2G A;  3QH6 A;  4UW6 A;  1V00 A;  3B5L B;  5DUX A;  2ZGT A;  3IPV B;  2ENR A;  1EP0 A;  2P34 A;  4CCO A;  1IPS A;  1ZRR A;  1JZ6 A;  5IAX A;  5JI9 A;  5BYN A;  4Q0S A;  3WF0 A;  4IGQ A;  1MS5 A;  1VBA 2;  2XHK A;  4OHZ A;  2OQ6 A;  2RMU 3;  3ZO0 B;  3AYD A;  1G8W A;  5JVV A;  1AYM 1;  4CP1 A;  1JUH A;  4R52 A;  2UWA A;  2J7M A;  2RM2 3;  3N7K A;  1RIN A;  5KHG A;  3KF5 A;  3CZU A;  3WP3 A;  5FZG A;  4X8P A;  2RS5 3;  4BIS A;  5K7P A;  4XQ4 A;  4ZS3 A;  1BVV A;  4FPF A;  3VHP A;  2BV4 A;  2EA7 A;  5JAX A;  1NCQ B;  3NJX A;  2BOJ A;  3AB0 A;  4PBP A;  4B29 A;  4BQ1 A;  2WIN B;  3KB5 A;  3WW3 A;  1LEC A;  2JG8 A;  3ZR6 A;  1JYW A;  2Q30 A;  1YYN A;  2DUP A;  2IXI A;  3NJV A;  1QQP 1;  4GAZ A;  3DN7 A;  4PT6 A;  1VAM A;  3K48 A;  4LHK A;  2TUN A;  3I3M A;  1DG6 A;  2P2K A;  2EAK A;  3WHT A;  1OPM A;  2X10 A;  3U37 A;  5KXD A;  3VZL A;  3ZN4 A;  1F4A A;  2AYH A;  2O0O A;  4LBQ A;  5DG2 A;  5FZD A;  4AQS A;  5F1R A;  1W9S A;  4TWT A;  1JI6 A;  4UXA A;  5FZ1 A;  1W2T A;  4P00 B;  4XF1 A;  4AVC A;  2PAM A;  2NPI A;  5A70 A;  3W21 A;  1UX7 A;  2GSY A;  3VBF B;  3B7M A;  4FOQ A;  1UZY A;  5FO9 B;  1LR5 A;  1OI6 A;  3PL0 A;  5FZ3 A;  2WAB A;  2WNE A;  2WZR 3;  4GIQ A;  2YC4 A;  3G7D A;  1V6I A;  3O0X A;  3ZYJ B;  4CCM A;  3UKV A;  2Y6L A;  2A1X A;  2IWG B;  1NLR A;  1OUX A;  2VNV A;  4E2S A;  1SLL A;  3PVN A;  5FYV A;  1BBT 2;  4ES9 A;  4YVS B;  2RMU 1;  4BE3 A;  1CQ9 A;  5C4W A;  1J1L A;  2JE8 A;  4NRO A;  2GND A;  2RM2 1;  4DXT A;  5CFC B;  1N3Q A;  1PX3 A;  4H7L A;  1PZ8 A;  4JGY A;  5T52 A;  4E4D X;  2RS5 1;  2VQA A;  4D7T A;  1F35 A;  5A6Z A;  5CAD A;  2VC9 A;  2CTV A;  1W6O B;  2WQ4 A;  2C0Z A;  5IVY A;  3ZXA C;  2PLV 2;  4O9E A;  3VBH B;  5FPX A;  3PUI A;  3U78 A;  1UMH A;  5C8W A;  5F37 A;  3AMP A;  3CMG A;  5DAW A;  4JQT A;  1SLT A;  4YFW A;  4BWO A;  1X8M A;  4CRQ A;  2FDG A;  2WNV B;  5JSO A;  3FFZ A;  1RUF 3;  5FQ0 B;  5FYB A;  1G9F A;  2D5F A;  5LRR A;  4YW4 A;  3FN9 A;  4E4H A;  3EYP A;  3H8R A;  1ND3 C;  2BW8 A;  5DAP A;  4KNC A;  2K0G A;  3UJO A;  1ZZ6 A;  5DDJ 2;  1HDK A;  4XUP A;  2GN7 A;  4AR2 A;  4QDQ A;  4JKK A;  3Q8F A;  3E6D A;  2X29 A;  5CKN A;  5F2S A;  1QOT A;  1LTE A;  5FK7 A;  3RZL A;  3I2D A;  1JMU B;  5JCT A;  2W94 A;  3V56 A;  1S2B A;  4Y22 B;  2EXH A;  2WZR 1;  4LHS A;  1H1I A;  5F2W A;  3LCP A;  4XFA A;  1SHW B;  1GIC A;  1B35 A;  2P1B A;  4K1Y A;  2ZBJ A;  4MGQ A;  1BMV 1;  2ZA9 A;  1GP4 A;  4DEQ A;  1QJY 2;  2PHR A;  1LOB A;  1REF A;  1ENX A;  3ORJ A;  4AHW A;  3FZ3 A;  4XUO A;  4FT8 A;  5F3G A;  4AQ2 A;  4K20 A;  1LGN A;  1WCU A;  1HRV 3;  2WJS A;  3PUR A;  1WMD A;  4XTP A;  4QGL A;  4CDU A;  5A3M A;  4PF1 A;  1TME 2;  2D43 A;  5KHJ A;  5ABJ B;  4LMF A;  5JOY A;  2Z4F A;  3FHI B;  2PHX A;  5I0T A;  4EWD A;  5FYM A;  4B4P A;  2WFF 2;  4UW3 A;  2YHJ A;  1XYO A;  1DGR N;  4UI9 L;  1GZW B;  1QY4 A;  2E51 A;  2UYB A;  3G6J B;  3HN3 A;  4ORF A;  4XFC A;  3OEA A;  1PX4 A;  1X50 A;  1RUF 1;  4XUQ A;  2QFE A;  4Y1Y A;  4YM2 A;  1W9T A;  1OLR A;  4AHX A;  5F7U A;  2WS9 3;  3K77 A;  2DCT A;  4NHL A;  5BUV A;  5C4W B;  4PQQ A;  3ASI A;  1UZW A;  3O1M A;  4Q1R A;  3NKT A;  3JUU A;  4FPO B;  3P3N A;  4JGY B;  3III A;  3GJA A;  2E7Q A;  3GYD A;  3T0D A;  3A4U A;  3I59 B;  4FPK A;  4JV4 A;  5FYU A;  1VE0 A;  4AVA A;  1V6N A;  1Q3E A;  1NA1 A;  1GP6 A;  3K46 A;  5FFO C;  3UL2 A;  1YNA A;  4R4X A;  4OHY A;  4AVS A;  3GDB A;  5DMY A;  4GJZ A;  1RXF A;  3I3Q A;  2J1S A;  3I2I A;  4FP3 A;  4K7J A;  3I4I A;  4ZU5 A;  3CLP A;  3MIG A;  5FY1 A;  4ZU7 A;  1RUG 3;  2R6Q A;  3BTZ A;  2VUD A;  1X33 A;  1KS5 A;  1LOC A;  3H1Y A;  5EV7 A;  2A3Y A;  2YRO A;  2AH2 A;  3FLR A;  1OF3 A;  1Y9G A;  1HRV 1;  2YGL A;  4Y3O A;  1POV 0;  2IXL A;  5H9R A;  3UES A;  5LA2 A;  2RDS A;  1HN0 A;  4IGP A;  3M3C A;  5BNO A;  3KVB A;  2VW0 A;  4WM8 A;  1VR3 A;  3LEM A;  3V65 A;  1O3R A;  3MW4 A;  1NY7 1;  1WA4 A;  2ADE A;  5JXI A;  4NUB A;  4UFJ A;  4XUN A;  3DYP A;  3BU7 A;  3M2M A;  4TXW A;  3R4S A;  5FZH A;  1B35 B;  3P6B A;  2WS9 1;  4QX8 A;  2GC2 A;  3ZIX A;  3WDT A;  1K12 A;  4Q1P A;  4P9Y A;  1RHI 2;  2R06 3;  1QJU 2;  3R6S A;  1YJK A;  2D93 A;  2XLA A;  4K6B A;  1YLL A;  2IXH A;  2JB4 A;  2WSV A;  4XJ8 A;  4RS5 A;  4UFH A;  2HWF 2;  2XLG A;  3LQC A;  1ULG A;  2XOM A;  1RXG A;  4LE3 A;  4CDU B;  1K5M C;  4LKD A;  3Q8B A;  4CDW C;  5I93 A;  4TYS A;  4ONU A;  2E63 A;  5CU1 A;  3KVA A;  1ULE A;  2ADD A;  2K2S A;  3MFA A;  4ERO A;  2C9A A;  2FDF A;  1URX A;  1CAV B;  2ID4 A;  2HWB 3;  4PDW A;  1W8O A;  2XB6 C;  2Z2S B;  5I8T A;  2FMD A;  1RUN A;  4MG2 A;  3NV1 A;  5FPU A;  1DLC A;  1RUG 1;  2VGD A;  4GXL A;  1EV1 3;  3K4A A;  3TOJ A;  1CVN A;  1SFY A;  1QEX A;  3FLP A;  4CA9 A;  5IVF A;  2DWR A;  2MEV 3;  2HWC 3;  1OD3 A;  2YC2 A;  3DXU A;  4COW A;  2OZJ A;  3CKH A;  5GLZ A;  4QU2 A;  1IKP A;  3LSE A;  5T5O A;  4CUG A;  3BKZ A;  1LNS A;  3C2U A;  3RZK A;  5C9A A;  5HXM A;  1D4M 2;  4AED B;  2FQP A;  3WZ1 A;  3NO8 A;  4JHT A;  5FK8 A;  1QNY A;  3HR9 A;  1IGO A;  5IW0 A;  1JBC A;  2VOT A;  2XG3 A;  5FRE A;  1W2U A;  2CGN A;  2MHF A;  3ES1 A;  1ENR A;  2PAK A;  1QMJ A;  1W6M A;  1GOG A;  3THP A;  2ES3 A;  5JDB A;  5GZC A;  1ZZB A;  3ZYF A;  3AP6 A;  4QPI C;  1FMD 3;  5J09 A;  4AI0 A;  1JZ8 A;  5CFC C;  3HT2 A;  5F9T A;  1NCR B;  3HT1 A;  4CDX B;  4PF5 A;  3W5N A;  3C3V A;  2R06 1;  2JDM A;  5H9S A;  1UZV A;  1WUV A;  3ZN6 B;  3ZYR A;  3RGB A;  4FQZ A;  3ZFF C;  1N3O A;  2A6V A;  2HLE A;  3ATG A;  5A7Q A;  2D7F A;  2D3S A;  2DUO A;  4IL7 A;  4QB6 A;  5FPZ A;  4AQT A;  5A7O A;  3ZLI A;  2GME A;  4Y1Z A;  2PHT A;  3RYR A;  3FHA A;  1NLQ A;  4AVT A;  3WP4 A;  2W1U A;  4J6G A;  2VUC A;  4QHZ A;  3NRU A;  5F3E A;  5IJR A;  1CGP A;  4KMQ A;  4MZU A;  1AVB A;  2WFP A;  2HWB 1;  3CIH A;  4MGI E;  4PI0 A;  3ZPO A;  3TEZ A;  4K40 A;  1MS1 A;  2VTF A;  1IS4 A;  4LEJ A;  1OMI A;  3ZR5 A;  4Q0Q A;  1EV1 1;  1SLI A;  4NIA A;  1S0G A;  1UMI A;  2KR2 A;  3KV4 A;  2MEV 1;  5CFD A;  3BCW A;  2G9Z A;  2HWC 1;  2WT0 A;  1OVS A;  2R0F A;  1KXG A;  3C8X A;  4RR3 C;  1LAJ A;  1OFS A;  5JR7 B;  2VPV A;  3H1W A;  1DQ2 A;  4ZY9 A;  2R0H A;  2RS1 2;  4Y4R A;  1SPP B;  2ZCW A;  2ARA A;  3ZXK A;  3OB8 A;  2WO1 A;  3HBK A;  1MQT A;  2P3I A;  4RGK A;  2FDI A;  2FCV A;  1W3V A;  2I07 B;  1LEN A;  4RHV 3;  1HXS 3;  4IEW A;  5KBF A;  5EHD A;  1GYK A;  4XAB A;  2GC3 A;  1VBB 2;  2WN3 A;  4J1W A;  2O1Q A;  1DU3 D;  3RVH A;  1HRI 2;  1GP5 A;  1SFP A;  1D2S A;  1FMD 1;  1LHN A;  3PJY A;  2BFU L;  3TN9 2;  4PDW B;  2JIG A;  2QQP A;  4YZ4 A;  3IMN A;  3WXP A;  1N1V A;  2D44 A;  3B02 A;  2BBV A;  4URA A;  1QIQ A;  1N3P A;  2ZMK A;  1Q8V A;  1GQH A;  1YI9 A;  3J7L A;  3POS A;  4F8A A;  1DYK A;  5DUV A;  5FY0 A;  3ZYG A;  2VZT A;  4JC1 A;  5D21 A;  4YM1 A;  3O5S A;  1UWW A;  5C9A B;  1EUT A;  3RRD A;  1BCX A;  2IC1 A;  5AFE A;  1S0B A;  4GUL A;  3T2O A;  2YUE A;  3UJQ A;  2QZ3 A;  4FXG B;  1SFN A;  2ZAA A;  1ZZ9 A;  3MYX A;  1TMF 3;  1HX6 A;  4Q4X 2;  5FZ8 A;  1S55 A;  2F4L A;  4QX1 A;  4K9S A;  5FPB A;  3MUY 1;  5ERL A;  2RS3 2;  2HKX A;  5J1X A;  4D6Q A;  4LBQ D;  3LGR A;  4Y1V A;  1U0A A;  2J1V A;  2HWD 2;  1ULD A;  5L9B A;  3VHR A;  3QOP A;  5AFB A;  2PQQ A;  3R05 A;  4YW3 A;  1C57 A;  1UCX A;  5KXB A;  2QQL A;  5FZ0 A;  2HEY F;  1QJE A;  2A6W A;  4PBO A;  3WQ0 A;  4BQ4 A;  1FYU A;  2V72 A;  3DL3 A;  3PTR B;  1DQ4 A;  2HYK A;  3VBO C;  3TNQ A;  4LA2 A;  3HMY A;  4WM7 C;  2QDN A;  4RHV 1;  4EZ4 A;  4XAE A;  1W05 A;  1O4Z A;  3A7Q A;  1ZRE A;  3K75 B;  4AVB A;  1OUR A;  4GD4 A;  1LOF C;  2LW8 A;  1L7Q A;  4OZO A;  5JSR A;  1Y43 B;  3GCW A;  3WF2 A;  2ZX0 A;  1DHK B;  3LWC A;  1LES A;  1UAI A;  4WVM A;  3AMM A;  3VZO A;  1ZNP A;  2C1F A;  2P37 A;  2AAC A;  3WLU A;  2CDO A;  4HKO A;  4E9K A;  1VRH 2;  1VMF A;  5DZG A;  3IBM A;  4OUE A;  5C5T A;  2V4V A;  4LK7 A;  2WSU A;  2BVV A;  1BXH A;  5DN2 A;  1NZI A;  4Q4Y 2;  4I2O A;  1C1L A;  2PQS A;  4XIL A;  2IFW A;  1UYY A;  2EIC A;  4QQ2 A;  5JLV A;  1UOJ A;  5KXC A;  2RJL A;  1TMF 1;  1XSQ A;  3MLJ A;  3OBZ A;  2A3X A;  4B1M A;  1HQW A;  3THC A;  3I97 A;  3VDD B;  1NOV A;  3U14 A;  1SDD B;  2D6L X;  2ZPX A;  3D4K A;  3N7M A;  4OI2 A;  5T5L A;  4IW3 A;  4OUS A;  2RVA A;  2YYO A;  1JHN A;  3E97 A;  3L9J T;  4A41 A;  5EFU A;  1RJ8 A;  3WOG A;  3FHQ A;  3N9O A;  5BPX A;  1YHF A;  3RI8 A;  3O1V A;  4BQW A;  2D3R A;  2DVD A;  3P5B A;  1H9W A;  1UY4 A;  4GH4 A;  5JWP A;  2VCC A;  1OLQ A;  5ISL A;  1CWP A;  1GLH A;  1ZA7 A;  5T54 A;  1YFX A;  1AR7 3;  3BPZ A;  2YDE A;  4UAP A;  1CJD A;  2EXI A;  4HVR A;  4ISR A;  1GOF A;  1IS5 A;  4YW5 A;  1RUH 3;  4LOT A;  5FLJ A;  5HCF A;  3LSD A;  3OBA A;  5BV6 A;  1NX9 A;  3B01 A;  1S2E A;  2E9Q A;  3ZFE C;  2LAL A;  2OVU A;  3NMB A;  4UW5 A;  4AI3 A;  4CEY C;  1G9C A;  4HG6 B;  4LXL A;  4XF4 A;  1F5F A;  4D3W A;  5A7W A;  2W9X A;  2G1M A;  5DG1 A;  1OQ1 A;  1LRH A;  3O14 A;  4RL7 A;  2JG9 B;  3K4Z A;  3H7J A;  2ATF A;  3MFC A;  1JXN A;  2K9Z A;  5CIR A;  2WO2 A;  2XL9 A;  3ILN A;  1PO1 2;  1NCR C;  4CDX C;  4IE7 A;  4OQ8 A;  1LCL A;  1V0A A;  1XNC A;  3AKR A;  1XNT A;  2PFW A;  5JPM B;  4Z8B A;  1T6G C;  1WW4 A;  2GH2 A;  4D6R A;  2WLP A;  4GWN A;  4F83 A;  1W04 A;  3USS A;  1A6C A;  2A6Y A;  1RGS A;  1X36 A;  2VOX A;  2A3W A;  2BGP A;  2JJ6 A;  2KA3 A;  2R07 3;  3EHK A;  3UET A;  1LEM A;  2WNU C;  1JU3 A;  1PM7 A;  1R64 A;  4XUT A;  3QAC A;  3AP7 A;  4HL0 A;  4CP9 A;  4XHX A;  1MZ5 A;  5BNN B;  4P02 B;  4RN5 A;  3SHR A;  1AR7 1;  1UX6 A;  1MS9 A;  5FOJ B;  1IQD C;  3WDU A;  1RUH 1;  5A32 A;  4E4Z A;  4YLZ A;  1DF0 A;  2YXS A;  5DZE A;  2EIG A;  2RG4 A;  3WDW A;  4BM8 A;  4YZ1 A;  1VMH A;  2YGM A;  4NPM A;  5GLU A;  1UU4 A;  4EQV A;  5FMC A;  5LK5 A;  1RUE 2;  4OUM A;  1I6X A;  5GLT A;  2P6C A;  5FYI A;  4XE9 A;  2VMD A;  3AFK A;  5FXX A;  3RMY A;  2FD8 A;  5E89 A;  3ETQ A;  1Q5O A;  1WZX A;  2ZGM A;  2ZML A;  1F9K A;  1R1A 3;  1ZZ7 A;  4KWU A;  5K9Y A;  4XDP A;  3MLK A;  3OBT A;  3FE5 A;  4Y20 B;  4JGZ C;  5FZ4 A;  2UY8 A;  3WQ7 A;  3T4V A;  3ZOI A;  4Z92 B;  3B94 A;  5F6K A;  1UOF A;  4XDO A;  5JMO A;  2RR1 3;  1DP0 A;  3MIC A;  5A7S A;  2Q8D A;  2CGP A;  3WNX A;  5DUU A;  4AGG A;  4FI9 A;  4KH9 A;  4QDR A;  1AR9 3;  1H8V A;  2LTN A;  4M0N A;  2FCT A;  5LCW L;  1DGR A;  4XJA A;  1LU2 A;  3IZO A;  3MIB A;  4YZ2 A;  1JYC A;  4FOV A;  1XE8 A;  4XF0 A;  4YW1 A;  4CU6 A;  3AL5 A;  5HV0 A;  3NNF A;  2CSG A;  2R07 1;  3DCQ A;  1O6U A;  1OT5 A;  2CAU A;  3SCH A;  2DUR A;  4KL1 A;  3GZT B;  4S2H A;  1QQP 2;  5D8A C;  3T0B A;  1ZX5 A;  1ZVF A;  5GAL A;  5A3O A;  4HZF A;  1S0J A;  4I0W B;  2BNN A;  1DIW A;  1PZ7 A;  2OPW A;  1W2N A;  1O3Q A;  2VBD A;  2WAA A;  1SLA A;  4LHN A;  1YRZ A;  3CNA A;  5BNP A;  2UU8 A;  1ZBE 3;  5FAX A;  2VVE A;  2SBA A;  2Y34 A;  4OHV A;  4XXA A;  5K4L A;  3RSJ A;  2OPK A;  3UYJ A;  4JDN A;  4NVP A;  3KF3 A;  3AVR A;  4IET A;  5LWB A;  3WG2 A;  4HVQ A;  2D97 A;  1OFN A;  3FX3 A;  1ND3 B;  3B9I A;  4B7E A;  2OXB A;  3CO2 A;  4Q4V 3;  2XJQ A;  4HSJ A;  3RYP A;  2WO7 A;  1R1A 1;  3D8C A;  2CV6 A;  3WG4 A;  3J9S A;  1CAU B;  4RSU A;  2VZO A;  4C8D A;  3IPV A;  4YPJ A;  3EXU A;  4HOO A;  4MXV A;  4COY A;  4JKL A;  2BNO A;  2RR1 1;  1W2O A;  3ZFG C;  5IUQ A;  2RMU 2;  2Y60 A;  2Y0O A;  3HQR A;  3M3Q A;  1L7L A;  1J3P A;  1S0D A;  1GZT A;  4P08 A;  4ZXE A;  2RM2 2;  3NNJ A;  1AR9 1;  1HJF A;  4ASK A;  2RS5 2;  2PHF A;  3DKQ A;  2CGO A;  4BYY A;  4HVO A;  3SH3 A;  2E26 A;  3AZW A;  5JOW A;  3KCX A;  2VMG A;  2IUW A;  2XJS A;  3KMH A;  2J42 A;  2PXJ A;  4Y1U A;  4PLO A;  3OPT A;  1VBE 3;  4PLM A;  2J1U A;  2DDU A;  2MPF A;  4AEJ A;  4CDW A;  2VNR A;  4EYU A;  1PMI A;  3M70 A;  4FCA A;  4L92 A;  5GZF A;  5A3N A;  2FCU A;  2JD4 A;  5L19 A;  1LU1 A;  2P4E A;  2DVB A;  1V6L A;  3MLL A;  1GQP A;  2VW2 A;  4GKX A;  4L11 A;  3WF1 A;  4LTA A;  1ZBE 1;  3AK0 A;  3VGI A;  5KHK A;  3TRS B;  2ORZ A;  2V5Y A;  3DV8 A;  5FP7 A;  5DAB A;  1CN1 A;  3U11 A;  4Y5S A;  3FUQ A;  1AYM 3;  1W6N A;  2OUH A;  1RVF 3;  2QCS B;  4N7I A;  3UT0 A;  5KHI A;  4AGV A;  3TWI A;  4Q4V 1;  1GWK A;  3DUI A;  3VBF A;  4CPB A;  1W9Y A;  3AJY A;  1LUL A;  1HW5 A;  2WC2 A;  2WZR 2;  3VV1 A;  1DGW X;  3OD4 A;  5EYY A;  2XHN A;  5J36 A;  4XXP A;  4A3Z A;  4JAA A;  4BLI A;  5FO7 B;  2Y6H A;  4XUR A;  5B2G B;  2XL7 A;  3BOP A;  4KBZ A;  1BMV 2;  2FDH A;  2YBS A;  1YJL A;  2P17 A;  2Z5W A;  4I3G A;  5KC5 A;  4QPI A;  4GMP 3;  5CFC A;  4EN0 A;  1SAC A;  2VBP A;  4ISQ A;  3KM5 A;  2W3J A;  4XTM A;  4XFF A;  3LOB A;  3VD7 A;  2GN3 A;  1RTV A;  2D6K A;  2VOK A;  2VME A;  4IE4 A;  3MPB A;  5GJ6 A;  1VLN A;  4Q26 A;  4QQH A;  3PU8 A;  3NL1 A;  1VBE 1;  1JS9 A;  2DCZ A;  2ZEZ A;  4N43 B;  3H3U A;  2ZGR A;  1F5J A;  1MZ6 A;  2DFB A;  5D1I A;  1O5U A;  2WYS A;  2J1E A;  2ZKL A;  5FZA A;  1O4Y A;  3AZV A;  1RUF 2;  2WNV A;  4HON A;  5FZC A;  2E31 A;  5CNA A;  5FQ0 A;  4LPL A;  1A8D A;  2VEC A;  2D6M A;  1YQ2 A;  2ZAC A;  3C7H A;  2QBX A;  1J84 A;  4IQP A;  2Q1F A;  4KI5 M;  2Q8E A;  3RWK X;  1RVF 1;  4NRQ A;  1BQP A;  1QKQ A;  1U12 A;  4RR3 A;  5FLI A;  1M4W A;  4Z2W A;  5EP9 A;  1QOO A;  1G86 A;  4XC9 A;  3DF0 A;  3I49 A;  3ST7 A;  4XFH A;  4Y22 A;  5C6C A;  4XAA A;  4HMZ A;  5HBA A;  2FMY A;  2WNO A;  3ZM8 A;  5BNN C;  5K0U C;  4M4R A;  3WY6 A;  2F6B A;  1UZZ A;  1K5M B;  3AL6 A;  2DTY A;  3PHM A;  3QBQ A;  5FJK A;  3T09 A;  4CDW B;  2G19 A;  1W8H A;  2VM9 A;  2VCA A;  2C9K A;  4R9C A;  1IG0 A;  3OUH A;  4GMP 1;  1CZV A;  2W68 A;  2BRT A;  4QHO A;  3O1R A;  1HRV 2;  2VL4 A;  1Y7B A;  3O0W A;  1WMF A;  4QQP A;  3WQ1 A;  3AXD A;  1RUD 3;  5FXZ A;  5ABJ A;  1W6N B;  4BH9 A;  1CX1 A;  2PA7 A;  1W06 A;  3SQO A;  4XAC A;  2PHW A;  1NY7 2;  2J22 A;  3E5X A;  1NAE A;  3WSO A;  3IAQ A;  2A73 B;  1CAX B;  2QJV A;  1GNH A;  1GZW A;  5A1A A;  2VO5 A;  1Z7S 3;  1ZZC A;  2PEL A;  2QQJ A;  5FOB B;  5FZB A;  2V73 A;  2WS9 2;  4AG4 A;  4L97 A;  4B7K A;  1SLB A;  5FMD A;  5J7M A;  4CEW C;  4RQP C;  3ZMN A;  3PME A;  3JU9 A;  5FY7 A;  2GMM A;  5LY1 A;  1ASJ 3;  4P5H A;  4QPI B;  2JEN A;  2B9V A;  2ZZJ A;  2ZGS A;  1Y9Q A;  2P3Y A;  2WT2 A;  3EB7 A;  1E5R A;  1GR3 A;  3NJY A;  5A3W A;  3I59 A;  4AAP A;  5F6L B;  1NUK A;  1US3 A;  3IDB B;  3TBD A;  4LBL A;  3ZFF B;  4FAH A;  4OMD A;  1CZS A;  3VBO A;  1R09 3;  1W99 A;  4LUL A;  4E2Q A;  2J1A A;  5HV4 A;  4NWW A;  3ACL A;  4CZS A;  2Q1Z B;  4NHX A;  3PNA A;  2QQW A;  4AHZ A;  1WD4 A;  4GWM A;  4LNV A;  5JZG C;  1RUG 2;  5FP8 A;  3KWV A;  5IHR A;  3N9P A;  4J1X A;  4Q4W 3;  3VD5 A;  2W47 A;  4NHY A;  3OPW A;  5HXV A;  1XC6 A;  4COV A;  2XJV A;  2PHU A;  2ARC A;  4JCK A;  4GWI A;  1QXR A;  3H8O A;  3J7M A;  5FIX A;  2WYF A;  3APB A;  1RUD 1;  5FP4 A;  3ZYP A;  1Q43 A;  1SBD A;  3AC0 A;  3MF9 A;  4KG0 A;  3W9A A;  3ELN A;  3C7O A;  4MOA A;  4RR3 B;  4AYU A;  1I1E A;  2IVI B;  1W8U A;  3HD8 B;  3TEW A;  4W4Z A;  1W03 A;  1AR6 3;  2VQU A;  1OQE A;  2ZHM A;  1Z7S 1;  5EIY B;  2I2S A;  4GQ7 A;  3T1M A;  1RMU 3;  5AVP A;  1BYH A;  1WW7 A;  3SKV A;  4F7Z A;  3PIG A;  3AYE A;  1XNK A;  1W6P A;  2DVA A;  4GJY A;  4QB1 A;  4TN7 A;  2R06 2;  5JOZ A;  4FTS A;  3JBG 3;  5LBE A;  4CU8 A;  4O61 A;  2WLQ A;  1ASJ 1;  2B39 A;  3KD4 A;  1QGL A;  2XUM A;  4YW7 A;  4G4F A;  1ZZ8 A;  5IWF A;  1VBA 3;  1KFX L;  1AXZ A;  1AJK A;  5H9P A;  5LAS A;  1YC6 1;  3FJS A;  5C5U A;  3P1I A;  3B00 A;  1W2A X;  3B9C A;  1NG0 A;  1OLM E;  1R09 1;  2VBB A;  2HWB 2;  2R1D A;  1CAV A;  3GNE A;  3KHB A;  1N1Y A;  1ULF A;  1VBD 3;  1ZM1 A;  1EV1 2;  3AX4 A;  3FFQ A;  1EAH 3;  3GXU A;  3NVC A;  4Q4W 1;  2OKX A;  5FDB A;  3ZSJ A;  4H3W A;  4QB2 A;  2MEV 2;  2BJS A;  3VBS C;  1NE6 A;  3HQX A;  4NID A;  2HWC 2;  3OSD A;  1H8T B;  3D6E A;  4LIV A;  1JTZ X;  1VAV A;  4NPR A;  4EN7 B;  1I9R A;  1E5I A;  4N53 C;  3POI A;  3JB8 A;  4XBQ A;  2ZX3 A;  2W1Q A;  4AFC A;  4M3C F;  3RZM A;  5F8P A;  1VMJ A;  3WD5 A;  4GAL A;  2FHR A;  2P5B A;  1UU6 A;  4AED A;  2YBP A;  3M7A A;  1S2K A;  4LIU A;  5FUP A;  2ZKN A;  1AR6 1;  1WBL A;  2EXJ A;  2GU9 A;  4BCU A;  5A6X A;  2ZEX A;  2NN8 A;  2VAU A;  2ZGL A;  3ZSE A;  5J48 A;  2YPD A;  4MV2 A;  2G4I A;  4KGQ A;  1FMD 2;  1RMU 1;  3VBO B;  5JXH A;  4CTE A;  4AVV A;  1J59 A;  4WM7 B;  5C8C C;  5E1R A;  1NCR A;  3THD A;  2CAV A;  3JBG 1;  3LKJ A;  4CDX A;  4I0A A;  1K3I A;  1YQ5 A;  5FP9 A;  5A3U A;  5C3P A;  3ZN6 A;  3BPS A;  3KV9 A;  3PVE A;  1QXJ A;  3I8T A;  5FBZ A;  1W3X A;  1VBA 1;  3SCG A;  4BQX A;  2B9U A;  4B8E A;  4EE2 A;  3LPG A;  5FPV A;  3LF7 A;  2CDP A;  2BFU S;  3I2H A;  5T5P A;  4N43 C;  1PGW 1;  1HJG A;  3I2O A;  1UIK A;  4DIN B;  3HOB A;  2ZGQ A;  4OFG A;  3IB3 A;  2PHL A;  3FLT A;  3RQ0 A;  2OYZ A;  1D0G A;  1H6Y A;  2AEZ A;  1VBD 1;  1EAH 1;  3WW2 A;  4XOG A;  2AC1 A;  4K21 A;  4QU1 A;  1SEF A;  5A80 A;  1NQJ A;  3ACF A;  5A33 A;  4L8Q A;  3QH7 A;  4YVW B;  3SH5 A;  4XBL A;  1W6P B;  1JOJ A;  1QF3 A;  2I45 A;  3PIJ A;  4JDM A;  3DPR C;  1D2Q A;  4GZ9 A;  4QXC A;  4XFG A;  4AEM A;  4ZKT B;  4MUV A;  1JYV A;  5KXE A;  1A3K A;  3LB9 A;  4QX0 A;  1XPW A;  1VRB A;  3KHC A;  2GNB A;  2N7G A;  1SPP A;  2I74 A;  3IDA A;  1YO8 A;  4RHV 2;  2IVJ A;  1FV3 A;  1HXS 2;  2GNT A;  3V0B A;  3DKW A;  5HCA A;  3OD0 A;  3ACG A;  5IVB A;  2QNK A;  1XBF A;  1X9P A;  4D8M A;  4R4Z A;  4MHR A;  3JXS A;  3KSC A;  3JQX A;  3PTY A;  3W59 A;  5BNQ A;  3ITQ A;  1GBG A;  1PO2 3;  1NT0 A;  2F17 A;  1IPK A;  1H4G A;  4YM0 A;  2W46 A;  4I02 A;  2W1W A;  1NE4 A;  3IDC B;  2VOV A;  4NJ4 A;  5GM0 A;  1UMZ A;  2ERF A;  3H0O A;  3POB A;  4FPJ A;  4C0H A;  1RB8 G;  1HQN A;  4QGN A;  1OKQ A;  3R0R A;  5L7O C;  4AW7 A;  5FMB A;  3HBZ A;  4YWA A;  1AX1 A;  1OXC A;  3BVC A;  4QDS A;  3ZFE B;  4NIH A;  2NQY A;  4A6O A;  4CEY B;  4DZG A;  5JXJ A;  3VKL A;  1XRU A;  2BYV E;  2HWE 2;  1OUS A;  3OCP A;  2UY9 A;  2GZW A;  1TMF 2;  3A23 A;  4Y26 A;  3O1U A;  3WNP A;  1ZRI A;  5A7P A;  2JIC A;  1O7F A;  2YU2 A;  3K51 A;  2DVG A;  3CQO A;  5LA9 A;  1IPJ A;  4XF3 A;  2WUH A;  3PU3 A;  2W52 A;  4A7K A;  1BK0 A;  4M3C E;  3J7H A;  4LE4 A;  2W2I A;  1H1A A;  4XFB A;  3AKP A;  1FX5 A;  3PMS A;  5IAV A;  2B8M A;  4HT1 T;  4CPB D;  3OPZ A;  1EUU A;  4QQL A;  4BA6 A;  1JZ4 A;  1W0P A;  2YV8 A;  4MGK E;  5E16 A;  2WO3 A;  3MV1 1;  4DOU A;  2HYX A;  2O14 A;  3N3H A;  2OZ6 A;  2WNU B;  4HPK B;  3N35 A;  4XFI A;  1PO2 1;  2X09 A;  5FY9 A;  2GAL A;  3RJR A;  3ZFG A;  1B09 A;  4ASM B;  1TQ5 A;  4E8D A;  1JN2 P;  3LPF A;  1F2N A;  1UY3 A;  3ETP A;  4O7X A;  3ZDS A;  4RYD A;  1WLD A;  4LT5 A;  1LHU A;  4FFF A;  1V6M A;  1FOD 3;  1K45 A;  5A33 B;  1UYX A;  1PHM A;  2JEC A;  3POW A;  3VBU C;  3WV6 A;  4V2W A;  3NAP B;  2E33 A;  2WZP P;  1WLC A;  2YFU A;  1U5Z A;  3OUI A;  3VKN A;  4KWL A;  4R9A A;  3EMR A;  4Y5Z 0;  5L73 A;  3OYW B;  1G7Y A;  3BTX A;  5C3S A;  2XML A;  4A2U A;  1UYP A;  3LAG A;  3V0B B;  3V64 A;  2GC0 A;  4PCR A;  3MIE A;  2NMO A;  2VNO A;  2Q4S A;  4YNI A;  4H2A A;  4JGZ B;  4PIY A;  5LB6 A;  3VDD A;  2BWC A;  3U75 A;  2G9F A;  1REE A;  4CSW A;  2W95 A;  4XF9 A;  3JQW A;  3WCS A;  1DQ0 A;  1W9F A;  4YG3 A;  1ODN A;  1FXZ A;  5FP3 A;  2ET1 A;  4TLG A;  4XJZ A;  4DXR A;  2BGC A;  3N9N A;  1MAC A;  3JD7 3;  3LD8 A;  3MIH A;  3U07 A;  4BPZ A;  4LLO A;  3UGG A;  2W91 A;  3ZXD A;  1TZO A;  3BTA A;  4JHZ A;  2ZX4 A;  3MW2 A;  1OPO A;  2VUA A;  1AR7 2;  2GAU A;  4TSV A;  4SLI A;  5D8A B;  2AZ5 A;  3L2Y A;  2OA2 A;  1V6O A;  4UFM A;  1RUH 2;  4S2G A;  4AOC A;  1H8T C;  2OQ7 A;  1W90 A;  3U1X A;  1T6B X;  4YW6 A;  2QE3 A;  3N7L A;  1FOD 1;  2XJU A;  4IEQ A;  4MHU A;  1JZ3 A;  1S1A A;  4OHX A;  2DCJ A;  5FYH A;  4R9B A;  3S6P A;  1ZBA 2;  3O7O A;  5FZL A;  3PLQ A;  2XBO 3;  4GKY A;  1CD3 G;  5FZE A;  3WUC A;  5FZF A;  2WQZ C;  4UF0 B;  4N9H A;  2Y8K A;  3EJK A;  1TNF A;  2JB8 A;  4NN0 A;  4CE8 A;  4COU A;  2NYY A;  5EPA A;  4LO4 B;  4NO4 A;  1W0N A;  1O8S A;  3H9A A;  1CIY A;  2JG9 A;  2YG0 A;  4S2F A;  3U0Z A;  1OVP A;  2C4X A;  1V9U 3;  4LO7 A;  1UOG A;  2VCB A;  4W6Y A;  1DQ5 A;  1SZB A;  2CWM A;  2CWS A;  4CYD A;  3SCF A;  5FZM A;  5IAT A;  1WCD J;  4FVV A;  4WVV A;  1WLW A;  5CYY A;  4XVH A;  1KEX A;  2DCY A;  3ZFG B;  4EWA A;  1MPX A;  5GZD A;  2VVD A;  1O8P A;  4M3C B;  2EID A;  2A6Z A;  3UV9 A;  3ZXJ A;  1KDM A;  4FFH A;  2X5I B;  1GZ9 A;  2IZW A;  4IEU A;  3WG1 A;  4MSV A;  4AEK A;  2PN5 A;  2QKD A;  2R07 2;  3JD7 1;  3OUJ A;  3WNO A;  3POY A;  4CXX A;  4FPE A;  4CCK A;  2B46 X;  2CL2 A;  1X7N A;  3J4U H;  4LO6 B;  5K0U A;  5BNN A;  1UKG A;  1PGL 2;  1ALY A;  2DU0 A;  3JCI A;  4V1P A;  1COV 3;  4ZON A;  1I5P A;  1UNB A;  2VW1 A;  5EJ3 A;  2BTV C;  5TSW A;  1GNZ A;  1VAK A;  4MAD A;  4YVW C;  4QWN A;  2D3P A;  1WCK A;  3AMH A;  3J26 N;  2OT7 A;  3IT8 A;  3RS6 A;  4AI9 A;  1F31 A;  2NMN A;  2XBO 1;  2R16 A;  4H14 A;  3T08 A;  4KU8 A;  1R1A 2;  5JIA A;  3WQB A;  1S0I A;  5LAT A;  4CCN A;  2E7A A;  5JIU A;  2WR9 A;  4BHP A;  3AP9 A;  1YFW A;  4QD2 A;  4Y20 A;  3SIT A;  1V9U 1;  5M0T A;  2RR1 2;  4XJ9 A;  2WWS A;  1A8M A;  3AZZ A;  2IFR A;  1NKG A;  1XXN A;  1GSL A;  4FBF A;  3SEP A;  1OH3 A;  1XYP A;  4CCD A;  1ZRF A;  1BJQ A;  4PIX A;  1WCS A;  2W87 A;  1AR9 2;  4NIG A;  3AYC A;  5B4N A;  1Q8Q A;  4LBN A;  5C3Q A;  4CEW A;  2PMW B;  4RQP A;  4QM8 A;  1OA4 A;  4L9B A;  3ILF A;  4QKN A;  1G9B A;  2ARE A;  1UPS A;  3VHO A;  2WAO A;  4BJ0 A;  4Q29 A;  4DEV A;  3I2F A;  2Q5T A;  3HIF A;  3OGG A;  1XYN A;  3UGH A;  4AL9 A;  4Z1V A;  1FAY A;  3RFR A;  1X8E A;  4W6X A;  5C70 A;  3GHN A;  3Q8C A;  4U36 A;  5FYY A;  4QPG B;  1COV 1;  3LZZ A;  1R08 3;  1ZBE 2;  4Q0U A;  2JKB A;  2NZ9 A;  2ZAB A;  3F95 A;  1E5H A;  1C8M 3;  5FCC A;  5JZG A;  2Z79 A;  1JYI A;  5CG9 A;  3LFM A;  4CUA A;  5L36 A;  1H2M A;  2L9L A;  4U2A A;  3T30 A;  2OUJ A;  3D0S A;  3EQE A;  2ZJC A;  1D7P M;  1ZA4 A;  5FBJ A;  3UNP A;  3JZV A;  2BGO A;  3CEW A;  4KWK A;  1XU1 A;  4Q4V 2;  1SG3 A;  4ZU4 A;  5C3O A;  4H7M A;  4OI0 A;  1ND3 A;  3V0A B;  1SCR A;  4PHZ A;  1OHF A;  1QJX 3;  3WVJ A;  5I0D A;  4DB5 A;  3N7J A;  3T0A A;  2HWD 3;  3NWK A;  1CAU A;  2A5Z A;  2GMP A;  1YIP A;  4DUX A;  4DNY A;  1W9W A;  4QXB A;  1I5Z A;  4IEX A;  3PUQ A;  1Q8S A;  1NA1 C;  1VBC 3;  3UKN A;  4OMC A;  5L9V A;  1CJP A;  3S7E A;  4FPC A;  4H55 A;  4I09 A;  1WKY A;  5K0U B;  1GU3 A;  2DBI A;  3GBW A;  5FZO B;  2XWB B;  3WP6 A;  3P3P A;  3H8X A;  1CPN A;  2Y6K A;  2PHD A;  1O4T A;  4XW3 A;  5LW9 A;  3TEX A;  1BK1 A;  3NAP C;  2LM3 A;  3VKF C;  3DYO A;  2OII A;  4IEY A;  3CDZ B;  4BB3 A;  4DXS A;  1RUI 3;  4LBO A;  5I0R A;  2D40 A;  1VBE 2;  1PMJ X;  1SCS A;  1RUO A;  5BNO C;  1NXD 1;  3N9L A;  3SKJ E;  4P9J A;  1U5Y A;  4HKL A;  4WM8 C;  3TAY A;  1U5I A;  4KGG A;  2XKO A;  3CL1 A;  5EQU A; 
#chains in the Genus database with same CATH homology
 4CP9 B;  2Q1F A;  2KR2 A;  3ZYF A;  1L7L A;  3ZYH A;  1W9F A;  1W8U A;  2C24 A;  2K46 A;  4LK7 A;  4CP9 A;  1GWL A;  4BQ4 A;  4LK6 A;  4A6S A;  3F95 A;  3UT0 A;  2JWP A;  1OH3 A;  1GWK A;  4CPB A;  1V0A A;  5D21 A;  1GWM A;  3ZYB A;  1UOJ A;  1W8W A;  4CPB D;  4YWA A;  2VXJ A;  1OKO A;  2LRO A;  4BQ3 A;  4LKF A;  1W8T A;  4YW7 A;  2LRP A;  3ORJ A;  2O14 A;  4BQ2 A;  1W8Z A;  1HN0 A;  4LKD A;  4LKE A;  1WMX A;  1W90 A;  1WCU A;  4LJH A;  4YW6 A;  4BQ5 A;  1WZX A;  2WYF A;  4AL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...