1ULGA

Cgl2 in complex with thomsen-friedenreich antigen
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
MLYHLFVNNQVKLQNDFKPESVAAIRSSAFNSKGGTTVFNFLSAGENILLHISIRPGENVIVFNSRLKNGAWGPEERIPYAEKFRPPNPSITVIDHGDRFQIRFDYGTSIYYNKRIKENAAAIAYNAENSLFSSPVTVDVHGLLPPLPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords galectin-2
publication title Structure and Functional Analysis of the Fungal Galectin CGL2
pubmed doi rcsb
source organism Coprinopsis cinerea
total genus 35
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ulgA00
1G9FA 4LBQD 1O4ZA 1APNA 4M3CE 5GALA 2DVAA 1GV9A 4H55A 1LU1A 2UWCA 3AK0A 4GWMA 3SH3A 4Y20A 4GWNA 1S0FA 1RITA 1WW7A 1VAMA 3PVEA 1J1TA 1N1VA 4R9CA 3V64A 3WG2A 1G7YA 1S0DA 2D6PA 1UZYA 4XTPA 2R1DA 2A6WA 2D6LX 4PF5A 4WZFA 1LEDA 1N47A 2E7TA 2GN3A 2NMOA 3OPZA 1G9DA 1FYUA 1ULDA 3FLRA 2EF6A 3AJZA 3WG4A 1UZZA 3OBTA 3LCPA 3RRDA 5DG2A 4XILA 1ENRA 5L73A 1DYPA 1DQ6A 1UAIA 2GDFA 3HN1A 1S1AA 2A6ZA 4K1ZA 1MS3A 2GALA 1R1ZA 2EALA 1YXWA 1SBEA 4Q1RA 1GZWA 5CNAA 3AZVA 3INAA 2H0BA 2ZA9A 3IPVA 2D6OX 3ATGA 3A0KA 1YI7A 2D43A 2WT2A 2ZGKA 1W6OA 4AVTA 4Y1XA 4YFZA 4Q8KA 1V00A 5CBLA 4GALA 1GZWB 1DQ5A 3U4XA 5T5LA 5DUWA 4XDQA 3IPVB 3WV6A 3ZYPA 3KQRA 2P3KA 1W6OB 1W6NA 3LSEA 3WUDA 4CZSA 1G86A 1JYIA 4P9YA 3T1MA 1LGBA 2ZACA 2ZGQA 2E53A 1Q8SA 2R0HA 4XIKA 3AYAA 2C9AA 3O12A 3POWA 4JCKA 3O0XA 4JC1A 2D6MA 2Q5TA 5T5JA 5GZFA 4LBQA 2A6YA 2JDZA 1W6NB 2NP0A 3VV1A 1VIWB 2SLIA 3AYEA 4P14A 2PHUA 4RA0A 4Q8LA 2WSVA 2GMEA 2GNBA 1WW4A 2WNEA 3ILRA 3SH4A 1PZ9A 2DVBA 3BIWE 4FP2A 3NWKA 5CB7A 2EXKA 3SITA 1OFSA 1HQLA 2XG3A 2A75A 2DTWA 1QDOA 2CYFA 1MS8A 1N3QA 3O0VA 2PHFA 3N7LA 1LHNA 4FPGA 1SCRA 4LBMA 1S0GA 1VAVA 4BPZA 3IMNA 2AH2A 1KJRA 3ZSKA 4YZ1A 5KXEA 3D5OA 3WHTA 2R0FA 3WZ1A 5DG1A 5FREA 1WCSA 3UK9A 1CPMA 4IQPA 1WUVA 3T1LA 1CJPA 3ZSMA 2ZGPA 5F9TA 1RIRA 5EWSA 1ZA4A 1ULCA 1LOBA 3M2MA 1V6KA 2OUJA 1GSLA 3RMXA 2CL2A 5FRAA 1OKQA 5T50A 4R9DA 4FQZA 4YZ4A 3L2YA 4CRQA 1ENSA 1WLWA 1I1EA 3AJYA 1ENQA 3VKNA 1KITA 4ZKTB 1W6MA 3MW4A 1MVEA 4Q2FA 2A6VA 4Y1UA 4FPEA 5EYYA 1FX5A 3AFKA 1LHWA 3PVOA 3RS6A 1LHOA 1MS0A 1LOGA 1KQRA 4WVVA 3ZSJA 3A0NA 5SV8A 2PHTA 2EAKA 2A71A 1C4RA 1W6MB 2P3JA 4ITCA 4UW6A 4XHBA 5E88A 3IKWA 4YGEA 3AP4A 4YM3A 4PCRA 1FNYA 4FPCA 4Y22B 2DTYA 1Z0HA 1S0IA 2WJSA 5CA6A 4XIOA 1SLBA 3WG3A 2A3XA 1N1SA 1W6QA 3AYDA 4K1YA 4FPYA 4M3CB 1AVBA 2R1BA 3HMYA 3CNAA 4WVWA 5EXOA 3WDTA 2AREA 2P3IA 2ZGUA 3WCRA 1MZ5A 1CQ9A 2EXHA 4XJ9A 2V73A 2DURA 2GNTA 5E89A 4C1XA 1O4YA 1H9WA 4NO4A 1GNHA 1UKGA 4XMAA 3WDYA 3ILNA 2DUQA 1F5FA 4DRVA 1BJQA 2YMZA 3N7KA 1QKQA 5JOXA 2D3RA 1IOAA 3USUB 4AGRA 3WVJA 5T54A 1AXYA 2CY6A 1LULA 1KJLA 1W6PB 3POYA 2AUYA 4YGDA 5IK5A 1D2SA 1AX2A 1G9CA 4U2AA 1LECA 3D6EA 5H9RA 1CESA 1SBDA 2TEPA 1LGCA 1ULEA 2ZGMA 4I30A 1SLCA 4YW1A 5T52A 3SLIA 2ZGLA 4FPOB 4BM8A 4XZPA 4YZ2A 2WKKA 4DPNA 4FP3A 3GNEA 4Z8BA 3R4SA 3I8TA 2ZHMA 4FOQA 4U36A 1LODA 3UL2A 2NN8A 2P37A 3ZXFA 5H9SA 3WDXA 1DQ4A 2EIGA 4AGGA 4GKYA 1N3OA 4K21A 4Q27A 5T55A 3ZYRA 5LK5A 4YW3A 3WDVA 5DZGA 1DGLA 1DLLA 3QLQA 1W0PA 1D0HA 2LTNA 4RL7A 4XTMA 3ZSLA 2A3WA 2WQZC 2WT0A 3MPPG 1F31A 4XJUA 5DXDA 5JOWA 2YXSA 3APBA 2AENA 4FVVA 2YZ4A 2ZAAA 2WLQA 1NLSA 1WW6A 2D6NA 4DS0A 2VUAA 1JHNA 1YIFA 1V6LA 1QMJA 2DV9A 4YZ5A 1FNZA 3KM5A 2ZGOA 3RMYA 1LOEA 2D6KA 2ARBA 5E8AA 3N36A 4YW4A 5DUVA 1DQ1A 1CN1A 1LHUA 3GALA 4CTEA 3H0OA 1AF9A 4M00A 1XQNA 1Y7BA 2EXJA 2ERFA 1PZ7A 3FFZA 2DVFA 1CONA 1SFYA 4ATFA 4DRRA 1MS4A 2UU8A 4AVSA 1AXZA 3UJOA 1V6OA 1X50A 5CAZA 4XOGA 4Q26A 1IS5A 3B9CA 3AZZA 3FLPA 4YG6A 5JOYA 1G9AA 4LBLA 3TB0A 4BOWA 2VU9A 5IUQA 1A78A 3BOPA 4XHXA 2W08A 4BMBA 1N1TA 2I2SA 1C57A 2ZHKA 5JVVA 4AVVA 2DU0A 4L8QA 4LBKA 1LGNA 3ZXLA 2E6VA 2GMPA 2VY0A 3AZWA 5GLZA 3VKOA 1GZCA 4FPHA 3OGGA 5EYXA 2V5YA 2VW2A 1KDMA 1S0BA 3NV3A 1DBNA 5GJ6A 2VW0A 4NOTA 3WNXA 3OJBA 2ZGRA 1GICA 5GLWA 2GN7A 3V65A 2YY1A 4P9WA 4BMEA 1LCLA 5IT6A 2JE9A 3R4UA 1A8DA 4YM2A 5GZEA 3VKMA 3N35A 1IKQA 1CIWA 3DUIA 2PHWA 3D4KA 1Q8VA 1IS3A 3FBYA 2WT1A 5IK7A 2DUOA 3W59A 3IM0A 3R05A 2ZABA 3VUOA 4HL0A 2R49A 5JMCA 1B09A 1BQPA 1TEIA 3AYCA 5GZDA 1PZ8A 4M01A 1AJKA 3WCSA 1W0OA 4Y1YA 3Q9OA 4YG3A 4FPJA 5H9QA 2ZMLA 2D3PA 2G4IA 4AGVA 4Y22A 4ASMB 4C1WA 1BKZA 1OQ1A 2ZGNA 2DUPA 1WBLA 4OZXA 4M3CA 1G8WA 2Z42A 5GZGA 1SCSA 1LOAA 4FPLA 3FUOA 1MR5A 2AGSA 1I3HA 1Z78A 2NM1A 4JRAA 4XMIA 1AJOA 1G9BA 1KDKA 1GLHA 4YG0A 4XBQA 1WLDA 4GA9A 1F9KA 5IK8A 1GANA 1Q8OA 3AP7A 3WUCA 1MACA 1FV2A 3QCWA 3DGTA 2KM2A 2NMNA 2ZHNA 3USUA 2WSUA 3PMEA 5T5PA 4PBPA 3SNMA 4XJWA 5JOZA 3LSDA 4MYEA 3N7MA 4M3CF 4TZDA 1YYNA 1W6PA 2GNDA 1UPSA 2OUHA 1U0AA 1V6JA 4XE9A 5BYNA 1GKBA 2YV8A 4GXLA 1N1YA 2GMMA 2R16A 3SISA 3PJQA 5GZCA 3O0WA 1WW5A 2YROA 3M3EA 1JOJA 1YO8A 3B3QE 2PHRA 3AX4A 3OYWB 2JKBA 2B7YA 1HKDA 3ZXEA 5JDBA 2A6XA 1WD4A 4XJZA 3MEPA 1IKPA 3VKLA 4LBNA 2A3YA 3OBRA 1N3PA 1DQ2A 4YGCA 1Q8QA 3VKFC 3MW3A 3ILFA 2VXRA 1V6IA 1WD3A 5F5QA 1QOTA 4YM0A 4Y1VA 2AYHA 3I4IA 4FQ4A 1DZQA 1LJ7A 1ULFA 3WHUA 1RINA 2CNAA 2DVDA 3BODA 3B01A 1YRZA 1SBFA 3M3QA 2W68A 2ZKNA 4Y20B 1QDCA 1H9PA 5DZFA 3SH5A 4YFWA 2JE7A 1SLTA 1QU0A 4UW4A 1GYKA 4XXAA 4DQAA 1QOSA 1CR7A 4FPFA 5GLVA 4BLIA 2UWBA 4FOVA 4UW5A 5HCBA 2W52A 4YZ3A 3V0AA 2DVGA 4XJ8A 5IK4A 2ZBJA 3UJQA 4ZXKA 4K20A 1S0JA 1GBGA 1AX0A 3M3OA 2P2KA 3ASIA 4LBOA 2VW1A 2ZHLA 4D69A 4XJAA 3ZXKA 3B69A 2E51A 4TYSA 1SLAA 1LTEA 2CWMA 1KRIA 2A5ZA 5KXCA 1JUIA 4ISRA 3BTAA 3MW2A 1QNYA 2D7FA 1WBFA 3ZXJA 5KXBA 3WG1A 4AWDA 3N7JA 3V0BA 3NV4A 1SACA 3ZPYA 2ARXA 1HQWA 1WLCA 3POSA 1MZ6A 1DIWA 1DFQA 1CPNA 3HR9A 1S0CA 3ENRA 2UURA 5AVAA 3WOGA 3V0BB 1UMZA 5DUUA 2UWAA 5H9PA 1LENA 1Q8PA 3WLUA 1JN2P 4DFSA 2DU1A 4BQ1A 3C2UA 1MS9A 3JU9A 2D3SA 2PHXA 1A3KA 1AZDA 2SBAA 4LBQB 2AR6A 3WDUA 2OVUA 3FLTA 3WDWA 2D44A 2ZMKA 3NV1A 1LESA 4YGBA 2EXIA 2ZMNA 1ULGA 3A4UA 1EPWA 2DWRA 1HLCA 3RSJA 4Q1PA 4W65A 4WV8A 1AX1A 1QOOA 3W58A 4XXPA 2NZ9A 2W39A 1QGLA 2HYKA 1C1FA 2E7QA 2P34A 1SLIA 2ZGSA 5GLUA 3TAYA 3ZVXA 5HCAA 1S0EA 2LALA 2ZGTA 4R9BA 4R9AA 1BZWA 2FMDA 4PQ9A 4GKXA 3IN9A 3NV2A 2XB6C 4YLZA 4HANA 1BYHA 2PELA 1JBCA 1SLLA 1CVNA 5GM0A 2JD4A 2NYYA 5T5OA 2BQPA 1JW6A 4P9XA 4XYXA 1MS5A 4ATEA 3AP5A 2GNMA 4KBBA 3AXEA 4FPKA 3OY8A 1LOCA 4PBOA 1DYKA 2A70A 4AYUA 4YM1A 4FOWA 1FV3A 1IS4A 2C5DA 5HCFA 1UX6A 3AZXA 1DHKB 1AXKA 1LHVA 2A7AA 3OY8B 4UW3A 4FOYA 3JUUA 4XBLA 3O5SA 4XBNA 1NXD1 3AP9A 5GLTA 1FAYA 1H30A 1LOFA 1BXHA 4Y24A 1LEMA 1MS1A 1Q56A 3AXDA 1GZ9A 3AP6A 4LBJA 4Y26A 3B00A 1V6NA 1IS6A 1V6MA 2ZZJA 3FUQA 1VLNA 1JYCA 4YW2A 3V0AB 1VALA 3OYWA 3RQ0A 2ES3A 1C1LA 4SLIA 1HDKA 5JLVA 4Y1ZA 2OW4A 1DQ0A 1MVQA 1ONAA 3T2TA 3M1HA 2CWSA 4ISQA 1QF3A 3M3CA 2CTVA 3PVNA 2JJ6A 2VH9A 1URXA 1QNWA 5DZEA 4YW5A 4BLJA 5KXDA 2DYCA 4F83A 1ZM1A 5DUXA 1FATA 3AZYA 1W6QB 1LOFC 1UL9A 2RHPA 1GNZA 2ENRA 2FHRA 3N3HA 1LU2A 3RG0A 1JXNA 2JECA 1UN1A
chains in the Genus database with same CATH superfamily
3AMMA 1APNA 2RR12 1DG6A 3SMHA 4IESA 5EV7A 4BQYA 3NAPB 4P9JA 4Y20A 1RITA 3BGAA 5FY8A 5KR7A 1KXGA 2WFF1 3PVEA 5FPAA 3V64A 5BUVA 1J1LA 4CCMA 2JG9B 2D6PA 1PO12 2FDGA 3WW3A 3GYDA 1AL21 3LD8A 2R1DA 2WYFA 2D6LX 2R071 1R64A 1DP0A 4PF5A 4WZFA 3ZYHA 1LEDA 2XJRA 3NNGA 3OPZA 5JZGA 3ZYIB 1FYUA 1SHWB 1ULDA 3J7LA 2EF6A 2Q4SA 3NAPC 1UZZA 4Q4Y2 4NIIA 3ZFEC 1O5LA 1ENRA 1DQ6A 1VBC2 2GDFA 2O8QA 4MXWB 1S1AA 2JG9C 4XC9A 2A6ZA 3WX5A 4BYYA 4K1ZA 1MS3A 4TXWA 5DAVA 5A70A 2EALA 1OFNA 1YXWA 2HWC3 4XDPA 5FZCA 5D21A 1EY2A 3HAGA 1TNFA 1RUE2 2WIIB 2WS91 3RZHA 3OTFA 1O6UA 2VCAA 5FYMA 1W6OA 1VBE1 1PGW1 3H7YA 5IVYA 4RGAA 4NR1A 4NHXA 4GALA 3VBSB 5T5LA 5DUWA 4GZ9A 1JU4A 4QQLA 1UZVA 3WV6A 2VQAA 4MGIE 1TME3 1CZSA 5AFBA 2JDYA 5F3CA 1UXXX 2DDUA 4JHZA 3T1MA 1LGBA 1WKYA 4NVPA 5EFUA 4AEJA 1WZXA 1PX4A 1O59A 4ORFA 4AHXA 4CCLA 2D6MA 3VBSC 1HN0A 3BPZA 4M0NA 5GZFA 2NP0A 1POV1 4JGYA 2JWPA 2WNVB 4IW3A 2PA7A 2OZJA 2VM9A 4XF0A 4WM7A 4B29A 3EJKA 2HH9A 2E7AA 4P14A 1CAVB 4CP9B 4LQRA 1VRBA 2GMEA 1OLMA 2XONA 3C3VA 5DQ0A 1U5ZA 2WNEA 4KG8A 3QOPA 3SH4A 5ACA1 2JDMA 1U12A 5FO8B 3SITA 4FAHA 2WNVC 1HQLA 3C7FA 3BTXA 1MZFA 1RUH1 3MZHA 1DGWA 2PHFA 3FWEA 5HV4A 1SCRA 1S0GA 5C9AA 1GUIA 4DB5A 3ZN4A 4BXSV 4BPZA 3IMNA 3VL8A 3ZSKA 1PVC2 2YYOA 3ACIA 2R0FA 1QJU3 3WHTA 5C8CB 2K0GA 3WZ1A 5J48A 1Y43B 1QJFA 4HONA 3D8CA 1DYOA 3PU8A 2PHLA 4MGKE 1UU5A 2FBEA 3KGZA 2OYZA 2X10A 3KD4A 1CJPA 2XBO3 3PDQA 3T1LA 3NNMA 2VBBA 5F9TA 3N9LA 1K12A 1DZTA 4CEYA 4IEYA 4OUMA 2YU1A 5C8CC 4URTA 1KS4A 3M2MA 5A6YA 4W8JA 4NPLA 5CKMA 3S5AA 3V56A 4ZPIA 3CJXA 1RYYA 2BEOA 4AHYA 1HXS3 1D2QA 3B9IA 3AJYA 1ENQA 1OOPB 2FDJA 4ZKTB 2AEYA 1NLRA 1SMVA 1F35A 4LE4A 2VMCA 3ZYBA 2BFUL 4BQ3A 3V0AA 3MHZA 3O14A 3I59A 2GP5A 2V09A 4CDWB 1KQRA 3GZUC 3K75B 5F5CA 2Q1ZB 2BWCA 4S2DA 4CCJA 2A71A 1C4RA 2P3JA 2O1QA 4UW6A 3IKWA 1J83A 2VNRA 4FPCA 1ZBE3 1OOPC 2WJSA 4PCRA 1S0IA 1WA4A 4Y22B 3WG3A 1SLBA 2A3XA 2R32A 4K6BA 1NCRB 5A1LA 4IL7A 4FPYA 1HRV3 1AVBA 4Q0QA 4CDWC 1JI6A 3NKGA 3BN6A 1GR3A 2I45A 3WDTA 4IEQA 3TN92 3AMNA 4I0WB 4A3ZA 3CIHA 3NW4A 4KG0A 1A6CA 4XJ9A 4UF0A 5A7WA 3VDBA 2GNTA 4JQTA 4SBVA 1O4YA 5E89A 5JSPA 3WDYA 4B7EA 1H4GA 3J8F3 1NCRC 1PM7A 2DUQA 4QX7A 3RZZA 3U75A 1MPXA 3VB9A 4QHOA 4IV1B 1BBT3 1YCIA 2D3RA 4MHUA 1OHFA 1UIKA 5A3TA 1OLRA 1RVF1 2F6BA 1AR83 3MIEA 1R083 5T54A 5C5UA 1UD1A 4ZU7A 3ACGA 3HNYM 3LWCA 1W6PB 5JR7B 2HEWF 1ZRRA 1AHSA 1NX9A 5FPXA 1W8TA 2BDRA 1D2SA 5FZDA 4A7ZA 1P8JA 4U2AA 1G9CA 4QQ2A 5CFCB 4IV1C 3T0BA 4N7IA 2W2IA 4P00B 2TEPA 2DFCA 3SCFA 2XHNA 5FP4A 1W9WA 4LO6B 1UY4A 3SLIA 3ZM8A 4YZ2A 3KV5A 4FP3A 3WINE 1AL0G 3R4SA 4Z8BA 2P5BA 5FZOA 2QJVA 3I3BA 2IXIA 2P37A 2RS31 5H9SA 1J3RA 2EIGA 3IBMA 1WMFA 5CFCC 1N3OA 3LGRA 1K3IA 4JKLA 4YW3A 3WDVA 1I6XA 2H6CA 2VZ1A 1DGLA 3HEIA 2XHKA 1PIV1 1JMUB 2WQZC 1US3A 1DF0A 2WT0A 4YW6A 5DXDA 2ZKLA 4FVVA 1K5JA 1WW6A 3VBUB 1KS5A 2J1AA 1JHNA 1PNFA 1VBD2 2H0VA 1VBB3 1NCQC 2R30A 2D6KA 5CISA 2RV9A 1B35B 3VZOA 5FXWA 1CN1A 1LHUA 3LIGA 3GALA 3ZYJB 3GBGA 1AR72 3I3EA 4M00A 1TMF3 1PZ7A 2ERFA 4IGQA 2DVFA 4Q0PA 3VBUC 1CONA 1SFYA 2AACA 1XNDA 2NPIA 3E6DA 4PIYA 4CCOA 1MS4A 2UU8A 1V6OA 2VD7A 5CAZA 5FLIA 4XOGA 1R1A2 4Q26A 3T08A 2YB7A 1B35C 1K5MA 2F4PA 2Q8CA 3AZZA 4BU2A 5T3NA 4E4SA 4NIGA 2BNMA 2QQMA 4B4RA 4H2AA 5FY7A 1G9AA 4LBLA 3GCWA 1QJZA 3AL5A 4P9IA 5LA2A 1J3QA 2LROA 2ORXA 3I7DA 4Q4W2 2YFZA 5EPAA 2J7MA 1QY4A 4AQ6A 5FYSA 4HMZA 3POEA 1UW8A 3WP6A 1ASJ1 5BNPA 5ERLA 1W9SA 3ZXLA 1BEV1 3AZWA 5BNOC 2FDKA 1HIXA 4R4ZA 1OA2A 3VKOA 1GZCA 2OPKA 1YUDA 4QKDA 2VGDA 5EYXA 3MLKA 1S0BA 3LEGA 2VW0A 4KU8A 3OJBA 2GZWA 1FMD3 4P9WA 4D7SA 4IGOA 2JE9A 5A33B 1A8DA 1AYN3 3NMBA 4L11A 2Y6HA 3X29B 1JZ5A 4Z1VA 4IGPA 4Q4X2 1Q8VA 4K40A 2HWE2 4MGZE 5FZKA 5HI0A 2DUOA 4WZCA 3R05A 3ZOIA 2EAAA 1R093 1REFA 1Z7S3 3ZFFB 4C90A 5JMCA 1BQPA 3ZKUA 3IDEA 3J26N 5CYYA 4M01A 5C33A 4PHZA 3WCSA 1W0OA 3DECA 5DPNA 2VBPA 1LB2A 5H9QA 3VBFB 3TEZA 4AVBA 3FFQA 5C3PA 1RUNA 5F2SA 2HEYF 1O8SA 1JZ6A 3P3NA 2ZGNA 4A3XA 1VB2A 3ZFFC 2K2SA 4OZXA 4BK4A 1V9U2 1GOGA 1LOAA 1VP6A 4FPLA 2B9UA 4JRLA 4RFRB 2AGSA 1DDLA 1AJOA 4FI9A 4XFCA 1WCKA 2QTWB 2VMFA 3VHOA 2VZSA 5LBCA 1FI2A 2ZX1A 4DXZA 3K2OA 1Q8OA 4MH0E 4QPYA 3WUCA 4F7ZA 1ZRDA 5I8YA 1RUD2 1ZYBA 5LBBA 3DGTA 2NMNA 2ZHNA 4MSVA 1XNKA 3SNMA 2IC1A 1EAH2 4UFMA 4XJWA 1L7RA 1OQDA 3Q8CA 3ZMOA 1QXJA 4XUOA 1V6JA 2WO2A 3LDKA 1JZ3A 5C7GA 1UOJA 2JX9A 4OVEA 1N1YA 1SDDB 3CDZB 2R16A 3SISA 3PJQA 3VLBB 4AHZA 2UYAA 3O0WA 2BUKA 3FL7A 1ZZ6A 4JTOA 1IQDC 4X8NA 2YHJA 1AYM1 1JOJA 4XUTA 3T0AA 3AX4A 3OYWB 4LIUA 3R0RA 2R7EB 3G7DA 1HKDA 3A7QA 4FT8A 5JDBA 4H7LA 4QXCA 1WD4A 1ODMA 2PAKA 4GQ7A 1IKPA 4NN0A 5JXIA 4G4FA 3WW1A 2PMWB 5FPUA 1KD7A 3OBRA 5LBEA 3H1MA 4A6SA 3U11A 1PO11 3MW3A 3WNOA 3RI9A 2Y34A 5JWPA 5C6CA 3AVRA 3I2GA 3GZAA 5F5QA 5K8SA 1DLCA 4YM0A 4CPBA 1W8NA 4YVSA 3I4IA 3LAGA 1YHFA 1F5JA 3FX3A 5F5IA 2RM23 2E9QA 1VBC1 3B01A 4KWJA 4OYUA 1EV12 4OMDA 2W68A 2ZKNA 4RFT0 1QDCA 1H9PA 2WFF3 4LUMA 5DZFA 4LA2A 5FYUA 4YFWA 4Y5TA 1AL23 1NA1A 4XXAA 4DQAA 3TEYA 1MEC2 3E5QA 4Q0UA 5IVCA 2R073 3VZNA 2ID4A 5AC92 1JYXA 4UW5A 3POJA 1RUF2 1QH6A 1C5IA 3UJQA 4CDQA 4K20A 1S0JA 2QQLA 2WFPA 2XL9A 2P2KA 5A3LA 2WZPP 4LBOA 2ZHLA 2GC1A 2XQXA 1JODA 5CG9A 3B69A 4HVQA 1UMHA 1KEXA 4OQ8A 1LTEA 2JDHA 5EP9A 2E32A 2A5ZA 1GZTA 1JUIA 3BTAA 2WS93 5JXHA 1WBFA 2W1WA 4NHKA 5KBFA 3ZYGA 4YNIA 4AWDA 4C0BA 2C1FA 2Y6KA 3VHPA 1NG0A 3NV4A 3HBKA 4AQSA 1HX6A 1ZRIA 4LTAA 1H2KA 2ORZA 1VBA2 4INDA 3POSA 3LEIA 3KT1A 1CPNA 1S0CA 4NIAA 2WINB 2YGMA 5IHRA 5D8AB 1M4WA 2VOXA 3WQ7A 3SC7X 5K0UA 3I2JA 1WMXA 2UWAA 5FFOC 5JUVA 4DFSA 2DU1A 2RS53 3C2UA 1ALYA 1MS9A 3JU9A 1JZ4A 4LBQB 5FAXA 2Q1FA 2TNFA 4AAPA 3FLTA 4CCNA 3ZXAC 1QJY2 3M3IA 2D44A 5FZ4A 4E4ZA 1LESA 1W90A 4QHZA 5FKBA 4JHTA 1PVC1 5D8AC 4P5HA 3H9AA 2WAOA 5I0UA 3ZFGA 1IPKA 2WWSA 5ACA3 4CA9A 1W8HA 4LORA 5F6LB 4BH9A 2VNVA 3W58A 1HV0A 5DDJ2 1JHJA 1RUH3 5FK8A 3TAYA 3QH7A 4Y4YA 2Y0IA 3CHXA 3MF6A 4UI9L 4D8MA 1FOD2 2XJUA 4PQ9A 2RMU3 3IN9A 4H7MA 4JAAA 4PI2A 3VZJA 3E6BA 1CJDA 4QQHA 2JG8B 3RJ2X 1JBCA 1SLLA 2ZEXA 1XOYA 5GM0A 2Y38A 5LA9A 4QX0A 1SPPA 2VNOA 5G05L 5F1RA 5JIAA 2VZQA 2QNKA 1WA6X 3CBNA 2OT7A 2YBKA 5F39A 1GMMA 4XEZA 1XXNA 4CDUA 2OXBA 4ZZ8A 5HCFA 2VL4A 2ILMA 1DHKB 2JG8C 4DZGA 2A7AA 3OY8B 1AR62 4UT5A 4CDXA 4DO0A 4BQ2A 3VBRB 2A1XA 1RGSA 5I93A 2V4VA 3MDPA 3TBDA 4LEJA 5GLTA 4YRDA 1BXHA 4EN6B 2XKOA 4XUPA 1Q56A 4LBJA 1TG7A 4B1LA 1E5IA 3B00A 1JH5A 2BNOA 1V6MA 2HLEA 3L9JT 1VLNA 4XDOA 1ZX5A 2AEZA 1VALA 1UYYA 3TN91 2VNGA 4XETA 3JBG2 1QXPA 1UY0A 2EIBA 2VOWA 2OW4A 4LHNA 4Y1ZA 1ONAA 4M4RA 1U5XA 3AMHA 2WAAA 2CTVA 4WVMA 4RSUA 2CGNA 2GH2A 2BWAA 4UAPA 4BLJA 5KXDA 2JXAA 2KA3A 2WO7A 2R042 1ZM1A 2XWJB 3W20A 1IQAA 5DUXA 4DIQA 4CXWA 4E4HA 3ZFEA 1FPN3 4CP1A 2RHPA 1HB3A 4PQQA 5EHDA 1LU2A 1PMJX 1OH3A 1UN1A 2JECA 2JG9A 1AUYA 4NAOA 1GV9A 2UWCA 1CAUB 3SH3A 1IHMA 1WW7A 2W1SA 3VBHB 3WG2A 4BE3A 4WM8A 4XTPA 5FLJA 2OZ6A 5HBAA 2BNNA 2A6WA 1RVF3 2VZ3A 3EBRA 4KI5M 4MXWA 2Z2SB 2K9ZA 3ZKYA 4MO3M 2NMOA 1VE0A 2RVAA 3ZFFA 1COV1 3RRDA 5L73A 3E97A 3VBHC 1UOFA 4EN9B 1BHGA 1KFXL 2JDAA 1NE6A 3HN1A 1PX3A 1HRI3 2GALA 3ACFA 4NRQA 1ZZ9A 1VJ2A 2IWGB 3IIIA 3BU0A 1X7NA 3AZVA 3INAA 2MEV2 3ORJA 5BNNA 3BUCA 3VD4A 3LOIA 3ETQA 3OD0A 1OKOA 1OPOA 2RS33 2RJKA 3ZR5A 1F2NA 4AVTA 3BKZA 3F95A 3KGLA 5D1IA 5FYBA 1V00A 2DCYA 5JCTA 1ZBA3 1GZWB 1DQ5A 1PM4A 1T6BX 3KF3A 4XCBA 3IPVB 3C8XA 2BOIA 1TVGA 1PIV3 1H1MA 1NY72 1AR71 3K3NA 1CWPA 4CZSA 3THDA 2WNVA 5IFTA 3GM8A 4CE8A 1Q8SA 3CJIC 1K45A 2R0HA 4I0BA 3POWA 3Q8BA 4JX0A 4CP9A 1RJ8A 1VMHA 1HB2A 2Q5TA 3NO8A 2LS6A 3VV1A 5KC5A 1GQPA 1VIWB 3WNNA 2PLV1 4KWUA 1XB9A 1UYZA 3U37A 5FKCA 4GMP0 4AAXA 1I5ZA 2UY8A 1X33A 4BXFA 2G19A 4Q4W1 3AKTA 5C8WA 2GNBA 1WW4A 4JTNA 2J42A 3ILRA 3WNMA 3O1TA 4QU2A 4FP2A 4DOUA 2YG0A 2PTMA 1H2MA 1US2A 3WEZA 4KMQA 1MS8A 3UT0A 1N3QA 3O0VA 5K7PA 2FZ2A 2E26A 4TSVA 3GHMA 1LHNA 4FPGA 4B3NA 3ZYFA 1RUJ1 4LBMA 3K4DA 3TYJA 1QJX2 1J84A 2VZRA 2HWD3 2AH2A 1KJRA 5L7OA 4JVAA 1XE8A 5J96B 2YPDA 4CU6A 2PN5A 2CSGA 1ASJ3 1WCSA 2HWE1 4E27A 4D0QA 1BEV3 2XUEA 4N9HA 1CPMA 5DAWA 3IAPA 3LE0A 2HWB3 4OMCA 5FZAA 4XABA 1UIJA 3ACLA 3D3AA 4XQDA 5LCWL 1RIRA 3MF9A 5I8SA 4L9BA 1ZA4A 3GCXA 3J4UH 5FUIA 2I74A 2OUJA 3LF7A 5FPLA 1GSLA 2LM3A 3RMXA 2CL2A 4OCTA 1PGL2 5FRAA 4META 4AQTA 1OKQA 1W8FA 4R9DA 3L2YA 4J25A 4UBGA 5FMOL 5CADA 3BIEA 1J3PA 1E5HA 4OUEA 5L36A 4Q2FA 5FPVA 4Y1UA 1XYNA 1SZBA 2YBPA 4FPEA 3PVOA 1LHWA 3SHRA 4EZHA 1ZRCA 2XJQA 1MS0A 3OGJA 4AL9A 4XZUG 2GC2A 2KR2A 3MO4A 2FDFA 4JDNA 5GKAC 2CDOA 2B39A 2PHTA 5SV8A 1YIPA 1Z0HA 3POIA 3HOBA 3KSCA 3K48A 1W6QA 3AYDA 3EHKA 4DMIA 4K1YA 4M3CB 2BBAA 1EAH1 1TNRA 2R1BA 3W9AA 4GMP3 5EXOA 3I3DA 4JV4A 3WCRA 1MZ5A 5FXVA 1ND2B 4LOSA 1PO22 2VZPA 2DURA 1RHI3 3JZVA 3FN9A 1XYOA 1WMEA 3MPBA 3N4MA 3P3PA 4LHKA 1RC6A 5J36A 2WN3A 4IE5A 1F5FA 4K9SA 4Q4V2 1BJQA 2ZX3A 3AMPA 3N7KA 1RUOA 4AI2A 3WQ1A 3USUB 4AGRA 2YGLA 3VD7A 4FXKB 3WVJA 5AVPA 1ND2C 1AXYA 1RUG2 4AE2A 4E4DX 4E8CA 4EN7B 1F15A 3DV8A 1MQTB 1KJLA 1RTVA 2VOKA 4WBBA 2QQNA 3RJRA 3POYA 4COZA 1W06A 2F17A 1GP6A 2VR4A 4YGDA 3ITQA 4DY5A 3BOWA 2DCJA 3D6EA 2X5IA 4J1XA 3ZLIA 4AG4A 5FZGA 1LGCA 1ULEA 1ODNA 1AYM3 1VPHA 1SLCA 4J6GA 4IV3B 1BMV1 4AFBA 4ARYA 2JIGA 2QQJA 2RS11 1NCQA 1MQTC 3KCYA 4RS5B 3RDIA 3LA3A 3I8TA 1Y3TA 3JQWA 3UL2A 2RDSA 3ZN6B 1EV11 1YJLA 2WWJA 1DQ4A 1OUSA 3SKJE 5CZKA 4AQ2A 5IYYA 3ZYRA 3R4DB 4Q27A 3AKSA 2DCKA 1F4AA 1Q5OA 3VBUA 1MEC1 3I2FA 3SCGA 3VDCA 3UNPA 3KF5A 3T2PA 4K7JA 4RS5C 5FY4A 1RUF1 2FMYA 4QPGB 2AENA 1B35A 3MLLA 4P9LA 3ALQA 2D6NA 3ETPA 5TSWA 1OPMA 4N43B 2YU2A 2ZEYA 4A45A 1TME2 2VCMA 2ZGOA 3RMYA 4XFFA 2BBVA 1PK6B 1DQ1A 1PMIA 2IXHA 4URAA 4GB33 5LZ6A 4QPGC 3H0OA 4RR3A 1Y7BA 2EXJA 3FFZA 5F7UA 5AC93 1PNGA 5BNOA 1JYVA 2QE3A 2DBNA 4ATFA 4DRRA 1LRHA 4AVSA 4N43C 5CFDA 4LKFA 3OG2A 5I91A 3NNFA 1YFWA 1PK6C 4E8DA 5JOYA 1VBA1 4HXCA 2LUWA 1J58A 2BP6A 1QQP1 1YLLA 2VU9A 4FCAA 2Q8DA 4BMBA 4ES8A 4AI8A 4EWEA 3L2HA 1C57A 4HVOA 4AZZA 1H4HA 2ZHKA 5JVVA 4DXSA 4LBKA 3IDCB 5HXVA 1LGNA 1NUKA 5IVEA 3ROUA 2GMPA 1QJY1 2VY0A 3JD71 3JQXA 4COWA 3O1SA 1EPZA 1UOBA 4DUXA 1QJU2 4NHMA 1KDMA 2CGOA 1DBNA 3WNXA 1GICA 5GLWA 1GQHA 2GN7A 1Q43A 4BMEA 3NNJA 4AFAA 4XW3A 4BISA 4YM2A 2BYVE 3VKMA 2XBO2 1IKQA 2XLAA 1CIWA 3DUIA 3LFIA 4LITA 5DDJ1 5F3EA 3D4KA 3UV9A 3FBYA 4R8HA 2WT1A 5I0TA 3ES1A 4OQ9A 1FOD1 1OA4A 2QQVA 4N8MA 5F5AA 3PUQA 3VUOA 1AR93 4HL0A 1PMHX 4L0PA 1B09A 5C3OA 4GIQA 1PZ8A 1VAKA 4AFMA 5A1AA 2VQUA 1FT9A 2Q0AA 2V5DA 4E2GA 1HXS2 2PXJA 4FPJA 2Z4FA 5CG8A 2D3PA 3SEPA 4LO5B 4C1WA 4HK9A 1X9TA 4H14A 1UX7A 1L3JA 1BKZA 1AR61 5L19A 3K51A 5JPNB 4LIVA 1SCSA 4QM8A 3D0JA 1MR5A 2G1MA 3BVCA 1Z78A 1QIQA 2NM1A 3NJYA 3URFA 4FSJA 2WZR2 1YFYA 4BDVB 2P1BA 2BVVA 3RVHA 4PDWB 5LY2A 1HRV2 3LPFA 1E57A 1GANA 5E1RA 1MACA 1FV2A 4QX2A 5IFPA 2FDHA 5IAVA 3DYOA 2KM2A 1SQ4A 5FUNA 2HWF2 3JBG1 1G6NA 5JOZA 1ST8A 1YYNA 5KHHA 2K46A 3LEKA 1U0AA 1YQ5A 2BGOA 1IPSA 3PVBB 5BYNA 1BBT2 1GKBA 1RMU1 2VUCA 3HPNA 4BQ4A 2R041 3PTYA 4RHV1 1AR82 4JKKA 1R082 1RUC1 2YROA 5FDBA 2IXLA 3LZZA 3PL0A 4P08A 4I02A 5APAA 3LA7A 1U5IA 4IE7A 2B7YA 2AC1A 2W95A 2A6XA 2NQYA 2R061 2PYTA 4YVWA 4C8DA 5DAQA 2VUDA 4XJZA 5JXJA 3MEPA 1CZTA 1C8NA 2W5FA 2WDBA 2A3YA 4LE3A 1W2TA 1N3PA 2JDPA 5DAXA 4YGCA 1Q8QA 4XAEA 3S6PA 5C70A 2XDVA 1QOTA 5FJHA 4QDQA 2AYHA 5FV3A 4FQ4A 4AVAA 4HKLA 2J1VA 5A7QA 3GF6A 5G04L 4JQRA 2HBTA 4N90A 3WHUA 1C5HA 2DVDA 4E2QA 3Q8AA 1W39A 1C3HA 2VMIA 4XFAA 2BERA 1HB1A 1YRZA 4RQPA 4Q0VA 2W3JA 4Y20B 2B9VA 3ZX7A 5A3MA 1GWMA 3B02A 4HVRA 1VRH3 5FXZA 5A6XA 4QWNA 4H3WA 2ARCA 4FPFA 1HJFA 3FZ3A 5GLVA 4UWDA 4FOVA 5FO7B 1VBB2 5HCBA 4AK3A 4BLIA 3DN7A 5JZGB 1WCDJ 4HZFA 4RD7A 1COV3 4CUBA 1H8TA 4CVUA 5IK4A 1ENXA 3T4HB 3O1RA 1EP0A 4O61A 2QDRA 4K3UA 1AX0A 3M3OA 2VTXJ 3POBA 2WNUA 1M06G 5EZWA 3CU7A 5FP8A 1TMF2 2VW1A 5A7OA 4XJAA 1NY71 3LPGA 4D69A 2G9FA 2OQ7A 3VDDA 5JZGC 5FYHA 5KXCA 4ISRA 3MW2A 2JDNA 2Y60A 4XQWA 2I07B 3CEWA 5JSRA 4N53B 1YI9A 4EN0A 4COVA 4NPRA 4MOAA 2WQ8A 3N7JA 4EWDA 1SACA 5FP7A 5FWEA 3M7AA 1AR73 4M0HA 4KL1A 1DFQA 2QQOA 1JYWA 2YBSA 4XAAA 4RGKA 2UURA 3V0BB 1XPWA 1UMZA 5DUUA 4N53C 5FCCA 1NQDA 3T2QA 3H3ZA 1Q8PA 4AEMA 4BB3A 4BQ5A 4OHZA 4PI0A 2BOJA 1S4CA 4BQ1A 1C8M1 3WDUA 1AZDA 1I5PA 2WABA 2WQ4A 3LEMA 3MI8A 2PLV3 5FZFA 2QUOA 1FMD2 2O0OA 3GJBA 3H50A 3NV1A 5EIYB 1S2BA 3TRSB 1WLTA 3H8OA 1AYN2 1OVPA 1GWKA 4OHXA 1EPWA 1GNYA 1HLCA 4KU7A 2XMLA 3RSJA 5L9RA 4HPKB 5HXMA 1RUI1 2NZ9A 2BTVC 4DEQA 1NAEA 1C1FA 1R092 2J1UA 1SLIA 2TUNA 3HVDA 1D4M2 1Z7S2 3S7IA 5JR2A 2HEVF 1S0EA 4S2HA 1ULOA 1RUJ3 2LALA 2ZGTA 2WL1A 2FMDA 4R9BA 2PAMA 4GKXA 1QXRA 1T6GC 1MZEA 2XB6C 4V1PA 4YLZA 4ZU5A 5LK7B 2PELA 4GJZA 3C7HA 2VMDA 3H8XA 1TZOA 3E1F1 2BV4A 4GULA 4ATEA 2BQPA 1PGL1 2C9KA 4XVHA 4KBBA 4FPKA 4XFGA 3OY8A 1LOCA 4IEVA 4PBOA 3SEEA 4BZ4A 2FD8A 4YM1A 4YYOA 3USSA 3WY6A 4EZ4A 3VBFC 5BNQA 1YQ8A 1IS4A 3FC0A 1UKRA 1XE7A 3AZXA 3C7OA 2LRPA 4UW3A 1HJGA 3WF2A 4CEYB 1PVXA 5JAXA 1JYTA 3I3MA 1HV1A 1NXD1 4N7UA 4E9KA 2Y6JA 4BIFA 4Y24A 1LEMA 1A8MA 3AP6A 4Y26A 3ECQA 2ZZJA 4CEYC 5D2AA 3V0AB 1RXGA 3KT4A 3RQ0A 2HYXA 4SLIA 4XUQA 4LO4B 1HDKA 1WMDA 3VBOB 2J1EA 3IWZA 3HWJA 3M1HA 4ISQA 1QF3A 3M3CA 4A7KA 2J22A 3ON7A 3PVNA 2JJ6A 2VH9A 2VTXA 3U1XA 5A32A 3EXUA 1QNWA 5EJ1B 4Q4V1 1CD3G 2DYCA 2RR11 4F83A 2VO5A 2ET7A 3MFAA 2H6BA 5FOBB 2VUJA 2JEMA 1POV0 3OGRA 4G9SB 1LOFC 4I3PA 3VBOC 3WP4A 4X8PA 5CKQA 1GQGA 4D7TA 1RUG1 1UYPA 2VBDA 3GZTB 1XC6A 3RG0A 1JXNA 1G9FA 5FJKA 4LBQD 2Z5WA 5GALA 2W87A 3IT8A 2DVAA 5A7WB 4GWMA 4IUGA 4GWNA 5FMOS 4W50A 1VAMA 5LA0A 4R9CA 4Q4Y1 1NE4A 1OSGA 1G7YA 3RYKA 5I8TA 5F37A 2TBVA 3BTYA 5FYIA 2RM22 3UESA 4KH9A 3GJAA 1N47A 2GN3A 3H7JA 4DY3A 3FLRA 1W8UA 3AJZA 3U07A 2UY9A 3LCPA 5DG2A 4XILA 3WNKA 1LKNA 2CHHA 1DYPA 1UAIA 1LR5A 5J09A 4G3YC 1RUE1 1OMIA 2R072 2MPFA 2CDPA 3CJIA 3LKJA 3IIAA 3T30A 4UBHA 1PGSA 2IZWA 2R6QA 2WA4A 1GZWA 5CKNA 2RS13 2WR9A 4NHLA 4GH4A 2VVEA 3MIHA 4CSWA 3IPVA 2X53S 2ZA9A 5FBJA 2D6OX 3ATGA 4QX8A 3A0KA 1W05A 2XXZA 2RJ2A 1K42A 1EV13 2D43A 2W0XA 5LATA 4Y1XA 3KV4A 4YFZA 5J98B 4OI4A 3O1MA 5CBLA 3LOBA 4FFGA 3U4XA 4XQ4A 5ABJA 3WNPA 3ZYPA 3KQRA 1VBE3 2WS92 5FIXA 2P3KA 1CX1A 3VD9A 1G86A 1PGW2 4JGZA 1JYIA 2ZACA 2G9ZA 2OKXA 2Y33A 4BQXA 4D7YA 4QGNA 1H1AA 4JC1A 5T5JA 3UYJA 2JDZA 1W6NB 3ZDVA 4Q0SA 3KCCA 4QKBA 2SLIA 3GDBA 4QMAA 4FBFA 3OOXA 3PIGA 4RA0A 5FY9A 1VR3A 2B5HA 4PT6A 3AKRA 2PAEA 5BV6A 5I0SA 4Q8LA 1POV3 2RS52 2QQUA 4A4AA 4XFIA 4LO7A 3OPWA 1NYWA 1PZ9A 3OUIA 3PUHA 4W4ZA 3NWKA 5HCHA 3DCQA 2W9XA 4CP0A 2XG3A 2A75A 2DTWA 4IEZA 5IVJA 2CYFA 2VOTA 1J59A 4I01A 5FR3A 1K5MB 3N7LA 2VZVA 4HT1T 1Y9MA 3KMHA 5ACA2 2D5FA 5J3UA 1QQP3 1ZA7A 1VAVA 1ULPA 2UYBA 3HQRA 4YZ1A 3CLPA 3RZLA 2BGPA 2LW8A 2WUHA 4AEDB 3D5OA 1RUH2 4OI0A 2NLRA 5DG1A 3AKPA 4CYDA 4IEOA 3O1PA 1XJAA 1K5MC 2RMU2 3K77A 4LA3A 3JD73 4IQPA 5BNPB 1WUVA 4BCUA 1TE1B 2D40A 2VMEA 3A23A 3ZO0B 1ND3A 4AFCA 2VPVA 3PUAA 3H42B 5IVFA 5EWSA 2JD9A 4AEDC 1ULCA 3M4FA 1LOBA 3EQEA 3MUZ1 4CEWA 4MZUA 2HKXA 3U78A 5BNPC 4TTGA 3OUHA 2X29A 4FQZA 4I0AA 1CX4A 2D98A 1FOD3 1I1EA 2N7GA 5C4WA 1KITA 4PLMA 1Y4WA 4OUSA 4DINB 5EYYA 1FX5A 2ATFA 3AFKA 4LKEA 3RS6A 1D0GA 1LHOA 2WZR1 3EO6A 1LOGA 4HN1A 3O1VA 3A0NA 2EAKA 3DPRB 1W6MB 2XVGA 4XHBA 5E88A 3P6BA 4QXBA 3AP4A 3VBRC 1FNYA 2DTYA 3KB5A 2VQ0A 2XJVA 4CU7A 1JUHA 3OEAA 3QACA 4IE4A 2PFWA 2HWF1 4OZOA 4CXYA 3HMYA 3CNAA 4WVWA 4D6RA 4F8AA 1W2NA 3ES4A 4HN0A 4EV0A 2P3IA 3DPRC 4QKNA 5IVVA 2V73A 2IVJA 3NAPA 3B94A 1H9WA 2V4AA 1GNHA 1UKGA 4QT6A 4UFJA 4XMAA 1FPN2 5L9BA 1AR81 2Z79A 2W92A 4LHSA 2YMZA 4DRVA 1QKQA 1QH7A 5JOXA 4FTBA 4LT5A 5FY5A 4JDMA 3PU3A 4L2NA 4DXRA 2CY6A 1LULA 3VHNA 1RMU3 5FZLA 2WZEA 4HG6B 5IJRA 1JYNA 5IK5A 2ARAA 3MIGA 4RHV3 1RVF2 1LECA 3VHRA 3OD4A 2OQ6A 4LLOA 1RUC3 1SBDA 1KGYA 3N9PA 5FXXA 3WSOA 4IERA 2QKDA 4YW1A 5FPBA 4FPOB 2VVDA 4QB6A 4XZPA 3MIBA 2WKKA 1O3RA 4LK7A 3F2ZA 1S2EA 2R063 1XU1A 4FOQA 4U36A 2NN8A 1HRI2 2XOMA 3VZKA 3NVCA 3HNMA 4QGLA 3VBSA 1UOGA 3LDRA 4GKYA 3FBMA 4K21A 4QPGA 4S2FA 3GHNA 5T55A 1OI6A 5LK5A 4OLLA 4KNCA 1GOHA 1UF2C 1DLLA 3AMQA 3QLQA 1W0PA 2BVBA 1VBD1 2LTNA 5SV5A 4XTMA 3ZSLA 1CGPA 2RS32 3Q8EA 1F31A 4GJYA 2CAVA 5JOWA 4YVSB 2YXSA 3APBA 4PJYA 1ZBA2 2WLQA 2ZAAA 4MVTA 4P9GA 4XCAA 4LJHA 4N9IA 2VUAA 3JXSA 4MXVA 1XYPA 1YIFA 4MUVA 4Y5SA 4YZ5A 4O9GA 1PIV2 4DNYA 4YARA 1TMF1 3WF1A 3RFRA 2GAUA 2O14A 5E8AA 4YW4A 4MGSA 1CAVA 4Q5OA 1NA1B 2W91A 1R1A1 4YVSC 4IE0A 1NZIA 1OH4A 2RDNA 5FP3A 2VMGA 5JIUA 1TQ5A 2VZTA 1AXZA 2DBIA 3MLJA 4EROA 1QWRA 2IVIB 5A3WA 4CDQB 5E6HA 3FLPA 1NA1C 2QVSB 3CO2A 2PHDA 4GAZA 4Y5Z0 3KVAA 2QQPA 4BOWA 4NE9A 2MHFA 4B1MA 5IUQA 1A78A 4XHXA 1ZZBA 5C3SA 5FMBA 1N1TA 4CU8A 5C8CA 4AGGA 3IB3A 4CCKA 4AI9A 2DU0A 1REDA 2E6VA 4KQ7A 2HWD2 3WR0A 1FMD1 1W8OA 3WT3A 4AFDA 5FZHA 4EQVA 3SQOA 4Q4X1 1O5UA 1IGOA 3NV3A 5E16A 4BHPA 2ZGRA 1BEV2 1LCLA 2C4XA 3P5BA 5IT6A 3R4UA 2YDEA 2HWB2 3KT7A 5GZEA 5K0UB 3EMRA 2OIIA 5B4NA 2XJSA 1D4M1 1C8M3 1YQ2A 2W46A 4XF9A 1UO9A 3TWIA 3H3LA 4B4PA 3K4ZA 3ZIXA 1JU3A 1OOPA 2ZJCA 3W59A 5IK7A 3W5NA 4KGQA 3S0MA 2GC3A 2B42B 2ZEZA 5GZDA 4CDWA 5K0UC 5DABA 4TN7A 4YG3A 3Q9OA 2Y0OA 1RUI3 1BVP1 1V9U1 3DYMA 1OD5A 3OBZA 2IFWA 3BALA 4Y22A 4KWKA 1UY3A 4ASMB 3W21A 3DYPA 1NCRA 1CZVA 1WBLA 2ZX4A 4MADA 1G8WA 3IDAA 1H8VA 3LA2A 5GZGA 1A34A 4XMIA 4JRAA 2B46X 1RUD1 1UCXA 5F32A 1SPPB 5CEHA 1KDKA 2QQKA 1XNBA 1GLHA 1W8ZA 1E5SA 3CZUA 4LLFA 4YG0A 5F2WA 2J1SA 5KC6A 4XBQA 2ADEA 1WLDA 4GA9A 1F9KA 2RE9A 4YPJA 4CDUB 2PQQA 3QCWA 4IV1A 4O7XA 1FXZA 1UWWA 3PLQA 2Q30A 3D0SA 1NLQA 4LPLA 4PBPA 1RHI2 3VL9A 4LMFA 3N7MA 3FHAA 4M3CF 4TZDA 2XJTA 1W6PA 2EA7A 5A7SA 1UPSA 2OUHA 2DF7A 3KLSA 3WQ0A 1JS9A 4XE9A 3NRUA 3RNSA 2ZCWA 5FP9A 1W8WA 2YV8A 3HD8B 3J9SA 4GXLA 4CDUC 5CFCA 2GMMA 3CZJA 3SXWA 1HQNA 5LEKA 1CAXB 3OBAA 3VZLA 1YO8A 3B3QE 2PHRA 4Z07A 5F3IA 3I2DA 1GWLA 3HJRA 1OD3A 2XGXA 1AYM2 4WVMB 3MIDA 2RR13 3ILFA 2VXRA 1WD3A 2RM21 3VN4A 2EIEA 2HWC2 3ZFEB 5J7MA 1Y9GA 1RUG3 2P3YA 1PO13 1ULFA 5DMYA 2CNAA 5K4LA 4XFHA 1YJKA 3BODA 4IV3C 4QPIB 3BB6A 2XQRA 2FQPA 5J1XA 1SBFA 3R6SA 3NJXA 5AC91 5IAXA 5HPOA 2Y6GA 4Q4Y3 1OVSA 3SH5A 4XF1A 2JE7A 3UKTA 4NPMA 4IETA 3OEBA 4WM8B 1GYKA 1VBC3 1QOSA 4OULA 4GWIA 3KCXA 1CAWB 2UWBA 2QFEA 2QCSB 2W52A 4QPIC 2DVGA 3I2HA 3WF4A 3WW2A 4E2SA 2VMHA 1L7LA 4XJ8A 4NJ4A 3DXUA 4ZXKA 1RUE3 4GB32 3AL6A 2X05A 4QM9A 3ASIA 4GD4A 4WM8C 3SKVA 3U10A 5KHIA 3MIFA 3UKVA 3ZXKA 4HLTA 4N53A 1KFUL 1GFF2 4L92A 4LNVA 2CWMA 3IMMA 4CCCA 2J1TA 2QQIA 2C0ZA 5BNNB 2HJIA 2VZOA 3DKQA 4COUA 2D7FA 3VD5A 3T09A 4XUNA 3ZXJA 5C3QA 1ZZ8A 1DZRA 1EUTA 3WG1A 3HQUA 3V0BA 3POFA 3MV11 3ZPYA 3LFMA 2ARXA 3RYPA 2XH6A 1MZ6A 4NWWA 2RS51 3HR9A 1NT0A 4NRMA 5BNNC 1XBFA 3ENRA 3ZXGA 4I2OA 1I9RA 3KWVA 5A33A 3E5XA 3WOGA 1OQEA 5H9PA 1LENA 5AFEA 5LY1A 4QPWA 1X36A 1H1IA 3ZIWA 2PHXA 3PJYA 1A3KA 2E33A 2SBAA 3NNLA 3ZR6A 2OVUA 5A80A 4HPKA 2ZMKA 2OA2A 5F8PA 4YGBA 5FQ0B 5FZBA 5FZEA 3OCPA 4NHYA 2DFBA 1UY1A 4NIDA 1GU3A 1IG0A 4PLNA 3MBWA 4ZHNA 3H8RA 3AFGA 4Q1PA 1ACCA 3BYWA 1QOOA 4W65A 4WV8A 5FYTA 2RMU1 3VBFA 1PVC3 3J7HA 2W39A 4W6XA 4XXPA 2ZGSA 1AR92 1OA3A 2Q1MA 3LIHA 5CIRA 2VC9A 5FZ0A 2WRAA 2W1QA 1DU3D 5IWFA 4P02B 1DGWX 3I2IA 3THTA 5A7NA 1D4VB 2JENA 4EJRA 2HBUA 3CMGA 5L7OB 5ANQA 1CVNA 1NZCA 2JD4A 2Y64A 3H8UA 3MYXA 1H6YA 4P9XA 4RYDA 4ASKA 4FTSA 3AP5A 4UYBA 1WCUA 4MV2A 2XKPA 4QQPA 1O3SA 4MGTA 4QU1A 4CU9A 4TLGA 1HB4A 1ZBE2 2BJSA 2XWBB 4OHYA 2C5DA 3THPA 5L7OC 1AXKA 3ZN5A 4NMIA 4XF4A 4CCDA 2WA3A 4NRPA 4QX1A 4XBLA 3O5SA 5JPMB 4IEXA 3AP9A 2J1RA 1FAYA 1H30A 1LOFA 2X09A 3PIJA 3HT1A 3VBOA 3FHIB 4QDSA 1W2OA 1V6NA 1IS6A 3FUQA 3J8F2 2CAUA 3B5LB 4PDWC 4UFIA 3KVBA 4ZS2A 3KV6A 3OYWA 5LB6A 3RZGA 2WZR3 2YC4A 3OGSA 1W2AX 4QX5A 2ES3A 1IZ3A 1U5YA 5JLVA 2BFUS 5FZ6A 2OS2A 1DQ0A 2P6HA 3MICA 4YW7A 1W99A 3PNAA 3NJVA 1FPN1 5FZ7A 3WF0A 3TN93 5M0TA 3MUY1 1OF3A 2VXJA 4YW5A 4ARXA 4TLFA 1OBNA 4ET7A 1LAJA 2HWF3 1FATA 2BW8A 2CU5A 4BQWA 1W6QB 4NIHA 1W2UA 1GNZA 2ENRA 2FHRA 3N3HA 4HOOA 5FZ3A 2BPA2 4YG6A 5FYVA 1O4ZA 1V70A 3ZMNA 1JOBA 3PTRB 2VECA 4LR4A 4M3CE 4EN8B 4H55A 1F8VA 1LU1A 3AK0A 3DEMA 5IATA 4NAMA 1S0FA 2IXKA 3OPTA 4FO9A 5BY5A 1S55A 3HT2A 1J1TA 1N1VA 3O7OA 1STMA 1S0DA 2ZTNA 1UZYA 4QD2A 3PURA 5I0DA 1JZ8A 1XU2A 5FYCA 4FAGA 5FBZA 3T4VA 2E7TA 1W9YA 1G9DA 1HRI1 4K8FA 4Z92B 4XPVA 5EJ3A 2QBXA 3WG4A 3U14A 3OBTA 1VRH2 2MNGA 2MEV1 5FWJA 5DN2A 2WZ8A 5FZMA 3TEXA 2X5IB 1W9TA 1R1ZA 3GGLA 3NQHA 3QH6A 3QBQA 2KXLA 1SBEA 4QHBA 4Q1RA 2WO3A 1IPJA 4RGGA 5FMCA 3UGGA 3WP3A 4K8RB 5CNAA 1COV2 2VZUA 1SG3A 3POGA 4O9EA 1ZBA1 4D94A 1YFUA 2H0BA 3FE5A 1NCQB 1JZ2A 1YI7A 2WT2A 2ZGKA 4Q8KA 2X5IC 2GU9A 2P17A 3T0DA 2ZPXA 2JIJA 2FCUA 4XDQA 1OT5A 1LNSA 1H2LA 1VBD3 1W6OB 1W6NA 3LSEA 4QX3A 3WUDA 1W28A 5D8AA 4P9YA 2E31A 2ZGQA 2E53A 4XIKA 3JCIA 1O91A 3DL3A 3AYAA 2C9AA 2QZ2A 3O12A 4JCKA 3RZMA 3O0XA 2B45X 2GP3A 3FHQA 1ZRFA 4LBQA 2A6YA 4JDOA 3I49A 2GH8A 3M70A 3WNLA 3DF0A 3AYEA 3HNBM 2PHUA 1R1A3 4MGQA 2WSVA 4TWTA 1REEA 3AC0A 4RR3B 4JGYB 4IXLA 5C3RA 4AHWA 5BNOB 2DVBA 3BIWE 3FJSA 1QJX1 2PLV2 3KQ4B 5EQUA 1VMJA 2WNOA 2EXKA 4WM7B 4Z82A 5CB7A 1OFSA 5CFDB 2HWD1 4Q4W3 4AEDA 1QDOA 1NXMA 5FO9B 4LULA 5FTTC 3DXTA 4RR3C 1NOVA 4JGYC 3K46A 2JG8A 1DGRA 5KXEA 2HWB1 1CIYA 4WM7C 3THCA 3OF1A 3O1OA 5FREA 5CFDC 1RUJ2 4V2WA 2WO1A 4QB2A 5C9AB 3UK9A 3WD5A 4HFSA 2IFRA 4V2VA 2XVKA 3UGHA 3ZSMA 2ZGPA 4Q4X3 4QDRA 1E5RA 2JKXA 2HWE3 3I97A 3M8LA 4C0HA 1H2NA 1F4HA 2O8OA 3FMGA 3VBRA 4FFFA 1V6KA 5JI9A 1UY2A 2XR4A 4LOTA 5C9AC 1D4M3 5T50A 5IVBA 2QQWA 3GZEA 4YZ4A 4ZU4A 3VDAA 4CRQA 1ENSA 1WLWA 3VKNA 3DPRA 1W6MA 1UU4A 1MVEA 3MW4A 2A6VA 2FZ1A 2DCZA 2WLPA 4GWJA 4BA6A 1W3VA 4OHWA 5CVRA 2IUWA 5KWRA 1UPIA 3PUSA 4DEVA 1WWYA 3IZOA 5IW0A 4WVVA 3ZSJA 5LASA 1O3QA 1V9U3 4MX3A 2YFUA 1UZ0A 1W04A 2Q8OA 4PLOA 1H6XA 4LKSA 4KGGA 1OC1A 4ITCA 3WQBA 4ES9A 4YM3A 2IXCA 3PUIA 4YGEA 4GMP1 5FZ8A 3ELNA 5A3OA 5JSOA 5FZIA 5CA6A 3I59B 4XIOA 3OSDA 1N1SA 1PO21 3GBFA 1RHI1 5EJZB 5FMDA 4DUVA 2B8MA 1RUD3 2AREA 2ZGUA 2EXHA 1CQ9A 2JICA 1X9PA 2Z69A 3B7MA 1CAUA 1EAH3 4NROA 4NO4A 4C1XA 3VD3A 4O65A 3VBHA 3ILNA 4COYA 3KHCA 4BIOA 3WXPA 3KS7A 3AVSA 1IOAA 4UF0B 4Q29A 4C91A 1SDWA 3EYPA 3ACHA 2C6SA 4X6QB 5A3NA 5ANNA 1BLZA 1YQCA 4LO8A 4AOCA 3RGBA 4R52A 2AUYA 1AX2A 2X8KA 2OPWA 3G6JB 1CESA 5H9RA 2WFF2 5A1FA 2VJXA 2VOVA 3CL1A 2HWC1 2ZGMA 4I30A 4XACA 4JZRA 5A7PA 2W1UA 3H3UA 5T52A 4AI1A 2ZGLA 1AL22 2VTFA 4BM8A 1UQXA 4P5YA 4DPNA 2F4LA 3GNEA 3JB4C 2YUEA 4JKMA 2ZHMA 4AI3A 1LODA 4YVWB 3ZXFA 1JOPA 3WDXA 4UXAA 5ISLA 3GBWA 1BMV2 2JDUA 1RL3A 2RS12 4KWLA 1PHMA 4D6QA 5DZGA 4LK6A 4RL7A 2QDNA 1D0HA 5FZOB 1EYBA 2A3WA 3MPPG 1TME1 4XJUA 5JXGA 1O8PA 2WN2A 1YQ6A 2YZ4A 3P1IA 4YVWC 4R4XA 1NLSA 1MEC3 4DS0A 1JZ7A 1RXFA 3NKTA 2C26A 1V6LA 4GB31 4Z2AA 1QMJA 1S2KA 2DV9A 1FNZA 1OXCA 1VBE2 3A22A 1RUF3 3I2KA 3KM5A 2YC0A 2YC2A 1O7FA 4LHLA 4RQPB 1LOEA 4F3JA 2CGPA 1UXZA 2ARBA 3N36A 4S2GA 2G9GA 2VQTA 4FXGB 4IE6A 5DUVA 5KHKA 4IEUA 4CTEA 3Q8FA 1AF9A 1XQNA 1ZVFA 4B8EA 4UFKA 3E5UA 3K4AA 5JMOA 2FCTA 4Y4RA 1QHDA 1UMIA 3OUJA 3UJOA 4RQPC 1H8TB 1X50A 3MGUA 2BRTA 5LA1A 4NWVA 2A73B 5FYZA 1IS5A 2QZ3A 5LRRA 3B9CA 4ASLA 2XPJA 5A3PA 2WNUB 1W0NA 3ZXDA 3TB0A 4Y3OA 1XNAA 5BXXA 3BOPA 5CU1A 2W08A 4AF9A 5FY0A 2W94A 3VDDB 3ZDSA 3BI3A 2I2SA 3IAQA 1VBA3 1VB4A 1QJU1 4HKOA 4LKDA 1H8TC 1YC61 4AVVA 5FY1A 4L8QA 2FCVA 1QQP2 2WWUA 2WNUC 1XNTA 3TEWA 3WP5A 5GLZA 3SCHA 1YNAA 2XBO1 3CQOA 3MV01 4FPHA 3OGGA 2V5YA 2VW2A 2ZZQA 5GJ6A 3VDDC 1W3XA 1POQA 2Y26A 4NOTA 1QJY3 3V65A 2YY1A 4AEKA 4Y33A 4KBZA 3JD72 4XF3A 3TNPB 1YEWA 2BGCA 2ZS6B 3BU7A 3KV9A 3N35A 1AR91 2EICA 3OB8A 4EE2A 3HIFA 2PHWA 1OURA 1IS3A 4HSJA 1W9FA 4HKWA 2B4KA 1HXS1 2ZEWA 3ST7A 4AR2A 1GOFA 4ZS3A 3IM0A 2ZABA 4D6SA 5DDJ3 1HN1A 2R49A 4ZY9A 2ETEA 1YFXA 3AYCA 1TEIA 1UYXA 4UFLA 2Q8EA 4A2UA 5DAPA 3S5QA 1AJKA 3NL1A 5LWBA 3S30A 4Y1YA 2C24A 3CF6E 3UKNA 2XJPA 2ZMLA 1ZZCA 1BVVA 1D7PM 3JB8A 2G4IA 1OLME 4AGVA 3IDBB 1ZBE1 1OQ1A 2XVLA 3I2OA 2DUPA 3PHMA 4PIZA 4CPBD 2Y6LA 4ONUA 4M3CA 1GP5A 2Z42A 4XFBA 5F3GA 3FUOA 1HRV1 1I3HA 1G9BA 3PMSA 2RDQA 2YPJA 2W47A 1ND2A 1AR63 4DUWA 2E63A 2ZX2A 5I0RA 4HBNA 2WC2A 2DCTA 4HSLA 1BK1A 5LW9A 1XSRA 5IK8A 3AP7A 3J8F1 4ZZ5A 2VCCA 4OHVA 1XE0A 3K3OA 3VGIA 3J7MA 4YWAA 1BBT1 3USUA 1IG3A 2WSUA 3PMEA 5T5PA 4EWAA 4OI2A 4CUCA 3LSDA 4MYEA 1R081 1Y9QA 4AI0A 1MQTA 4BWOA 1CAXA 1OUXA 2GNDA 1RJ7A 3JBG3 1XSQA 2XUMA 2BU9A 2AZ5A 2VE1A 4J1WA 4WVZA 3HN3A 5GZCA 3LDBA 1WW5A 3BTZA 1UU6A 3M3EA 2FDIA 5LEJA 4IV3A 3I3QA 4EYUA 2R043 4RS5A 3KHBA 2JKBA 1OLQA 1RMU2 5BPXA 3U4SA 5KHGA 3ZXEA 2JE8A 3ABZA 4RHV2 5LRSA 4UOJA 3ZN6A 1RUC2 1JTZX 2ZAHA 4LBNA 3VKLA 3C7GA 4ZONA 2VAUA 4FFHA 2D5HA 5A32B 1DQ2A 3A21A 1UZWA 3VKFC 4YSFA 3RZKA 1NQJA 3VZMA 3TNQA 1ZREA 4QPIA 3N9NA 1V6IA 2BZDA 1O3TA 2R062 2IXJA 5FLHA 2VG9A 2OX0A 4Y1VA 4A42A 3J7NA 1DZQA 1LJ7A 2ZOEB 4OFGA 1RINA 1VRH1 4XURA 3S57A 4D3WA 1Q3EA 4N43A 3M3QA 2ZX0A 1CAWA 1QJEA 1VBB1 3CKHA 3RZJA 5A6QA 4IDZA 1C28A 3AKQA 1PK6A 1QU0A 1SLTA 4UW4A 4A7YA 3WW4A 3MFCA 5C5TA 5JI7A 2L9LA 2ZXQA 1CR7A 5A6ZA 4YZ3A 3I54A 2JB4A 3HBZA 1W03A 3TOJA 4I09A 3RWKX 2MEV3 2ZBJA 2JB8A 3ME2A 1GBGA 2GC0A 2P4EA 5LBFA 1L7QA 1X8EA 3W5MA 3OGVA 3CJIB 4HETA 5FK7A 4MGYE 2E51A 4TYSA 1SLAA 3RYRA 1GP4A 1WGPA 1UNBA 1KRIA 4GH4B 2XLFA 1YWKA 4MLOA 1QNYA 4IEWA 1XRUA 3AM2A 3RPQA 5KXBA 2PQSA 2V72A 4W6YA 3BPSA 3UETA 2JDKA 4ZXEA 1ZZ7A 1HQWA 2RJLA 5ABJB 1WLCA 1OF4A 4X6RB 4IEPA 4OI1A 5K9YA 1DIWA 3WF3A 4GH4C 4CDQC 5L9VA 3B93A 4JGZB 2XLGA 4LXLA 5AVAA 5KHJA 3RWNA 5FQ0A 2Y6FA 4CP2A 3N9OA 1V0AA 3WLUA 1O4TA 1JN2P 1AYN1 3DKWA 3HQXA 1XNCA 2D3SA 1ASJ2 2AR6A 4L99A 5ABJC 2VULA 3WDWA 3U0ZA 5FZ1A 4CUGA 4DXTA 2EXIA 4FFIA 1R091 4QQOA 2ZMNA 1T2XA 1ULGA 1DGRN 4JGZC 1Z7S1 4BJ0A 3A4UA 2P6CA 1C8M2 2DWRA 4A6OA 4CCEA 1BCXA 4QB1A 1QJX3 2EIDA 1AX1A 1QEXA 4AW7A 4A44A 4Z2WA 1QGLA 2HYKA 2E7QA 2P34A 2D93A 3LB9A 5GLUA 3ZVXA 3C7EA 5HCAA 3O1UA 1DCSA 3H1WA 4RN5A 3ZFGB 4QKFA 2ET1A 4R9AA 1BZWA 1NKGA 3EB7A 4PF1A 3NV2A 5C71A 4MHRA 4QXKA 4HANA 1RUI2 5FYYA 3BCWA 1BYHA 1SFPA 4AVCA 4CXXA 1EUUA 1WCQA 4W6WA 4L97A 4MG2A 2NYYA 2VCBA 5T5OA 1JW6A 2VVFA 4HK8A 1MS5A 3LQCA 4LUKA 4XYXA 2GNMA 3AB0A 3AXEA 2RDRA 4PDWA 1DYKA 2A70A 2CV6A 3ZFGC 4QXHA 4AYUA 3E6CC 4UFHA 4B4QA 2D97A 4FOWA 1FV3A 4M4PA 5FZ9A 4PIXA 1ND3B 1UX6A 1LHVA 1VMFA 4A41A 4FOYA 3JUUA 5F6KA 4CEWB 3GXUA 1HW5A 4QAWA 2ADDA 4NUBA 4AXOA 4XBNA 2GSYA 1X8MA 3UGFA 2XL7A 5HV0A 3N9QA 5FOJB 1MS1A 3D82A 1SFNA 3AXDA 1BK0A 1GZ9A 1ND3C 2Y8KA 5FUPA 5B4XA 4CDXB 2KD7A 5C4WB 1JYCA 4YW2A 3KZ4C 3T3YA 4BK5A 4CEWC 1SEFA 1C1LA 4FTEA 3T2OA 4QGMA 5FPZA 3ZPOA 4CUAA 1MVQA 3T2TA 5A3UA 2CWSA 3ZSEA 2RG4A 3N9MA 1X82A 5B2GB 4CDXC 1URXA 1ZNPA 3RI8A 3NJZA 3NSTA 4I3GA 5DZEA 4B7KA 2WBKA 5C4WC 1PO23 1H0BA 3H1YA 1RB8G 2WYSA 2EVXA 3AZYA 3QD6A 1UL9A 5J37A 4Q4V3 3S7EA
chains in the Genus database with same CATH topology
3AMMA 1APNA 2RR12 1DG6A 3SMHA 4IESA 5EV7A 3NAPB 4P9JA 4Y20A 1RITA 1KXGA 2WFF1 3PVEA 3V64A 5BUVA 1J1LA 2JG9B 2D6PA 1PO12 3WW3A 3GYDA 1AL21 2R1DA 2D6LX 2R071 4PF5A 4WZFA 5JZGA 1LEDA 2XJRA 3OPZA 3ZYIB 1FYUA 1ULDA 4Q4Y2 3NAPC 2EF6A 2Q4SA 3ZFEC 1UZZA 1O5LA 1ENRA 1DQ6A 1VBC2 2GDFA 2O8QA 4MXWB 1S1AA 2JG9C 2A6ZA 3WX5A 4BYYA 4K1ZA 1MS3A 2EALA 1OFNA 1YXWA 2HWC3 1EY2A 3HAGA 1TNFA 1RUE2 2WIIB 2WS91 3OTFA 1W6OA 1VBE1 1PGW1 3H7YA 4RGAA 4NR1A 4GALA 3VBSB 5T5LA 5DUWA 4QQLA 3WV6A 2VQAA 4MGIE 1TME3 5AFBA 3T1MA 1LGBA 4NVPA 5EFUA 4AEJA 4AHXA 4ORFA 2D6MA 3VBSC 3BPZA 4M0NA 5GZFA 2NP0A 1POV1 4JGYA 2WNVB 2PA7A 2OZJA 4XF0A 4WM7A 4B29A 3EJKA 4P14A 2E7AA 1CAVB 2GMEA 3C3VA 1U5ZA 2WNEA 4KG8A 3QOPA 3SH4A 5ACA1 1U12A 5FO8B 3SITA 4FAHA 2WNVC 1HQLA 1MZFA 1RUH1 3MZHA 1DGWA 2PHFA 3FWEA 1SCRA 1S0GA 5C9AA 4DB5A 3ZN4A 4BPZA 3IMNA 3VL8A 3ZSKA 1PVC2 2YYOA 3WHTA 2R0FA 1QJU3 5C8CB 5J48A 2K0GA 3WZ1A 1Y43B 3D8CA 2PHLA 4MGKE 1UU5A 2FBEA 3KGZA 2OYZA 3KD4A 1CJPA 2XBO3 3T1LA 5F9TA 1DZTA 4CEYA 4IEYA 4OUMA 5C8CC 4URTA 1KS4A 3M2MA 3V56A 3CJXA 2BEOA 4AHYA 1HXS3 1D2QA 3B9IA 3AJYA 1ENQA 1OOPB 4ZKTB 4LE4A 1NLRA 1SMVA 3V0AA 2BFUL 3O14A 3I59A 2V09A 4CDWB 1KQRA 3GZUC 2Q1ZB 2BWCA 4S2DA 2A71A 1C4RA 2P3JA 2O1QA 4UW6A 3IKWA 2VNRA 4FPCA 1ZBE3 1OOPC 2WJSA 4PCRA 1S0IA 1WA4A 4Y22B 3WG3A 1SLBA 2A3XA 2R32A 4K6BA 1NCRB 4IL7A 4FPYA 1HRV3 1AVBA 4Q0QA 4CDWC 3NKGA 1GR3A 2I45A 3WDTA 4IEQA 3TN92 3AMNA 4I0WB 3NW4A 4KG0A 1A6CA 4XJ9A 2GNTA 5E89A 4SBVA 1O4YA 5JSPA 3WDYA 4B7EA 1H4GA 3J8F3 1NCRC 1PM7A 2DUQA 3RZZA 4IV1B 1BBT3 1YCIA 2D3RA 1OHFA 1UIKA 1OLRA 1RVF1 2F6BA 1AR83 3MIEA 1R083 5T54A 1UD1A 4ZU7A 3LWCA 1W6PB 5JR7B 2HEWF 1ZRRA 1AHSA 5FPXA 1D2SA 4A7ZA 1G9CA 4U2AA 4QQ2A 5CFCB 4IV1C 4N7IA 3SCFA 2TEPA 2DFCA 4LO6B 3SLIA 4YZ2A 4FP3A 3WINE 1AL0G 3R4SA 4Z8BA 2QJVA 2IXIA 2P37A 2RS31 5H9SA 1J3RA 2EIGA 3IBMA 1WMFA 5CFCC 1N3OA 3LGRA 4YW3A 3WDVA 1I6XA 2H6CA 1DGLA 2XHKA 1PIV1 2WQZC 2WT0A 1DF0A 5DXDA 2ZKLA 4FVVA 1WW6A 3VBUB 1KS5A 1JHNA 1PNFA 1VBD2 2H0VA 1VBB3 1NCQC 2R30A 2D6KA 1B35B 3VZOA 1CN1A 1LHUA 3GALA 3ZYJB 3GBGA 1AR72 4M00A 1TMF3 1PZ7A 2ERFA 2DVFA 4Q0PA 3VBUC 1CONA 1SFYA 2NPIA 1XNDA 3E6DA 4PIYA 1MS4A 2UU8A 1V6OA 5CAZA 5FLIA 4XOGA 1R1A2 4Q26A 4E4SA 1B35C 1K5MA 2F4PA 3AZZA 5T3NA 2BNMA 4B4RA 1G9AA 4LBLA 1QJZA 4P9IA 1J3QA 3I7DA 4Q4W2 4AQ6A 1QY4A 4HMZA 1UW8A 3WP6A 1ASJ1 5BNPA 3ZXLA 1BEV1 3AZWA 5BNOC 1HIXA 4R4ZA 1OA2A 3VKOA 1GZCA 2OPKA 1YUDA 2VGDA 5EYXA 3MLKA 1S0BA 2VW0A 4KU8A 3OJBA 2GZWA 1FMD3 4P9WA 4D7SA 2JE9A 5A33B 1A8DA 1AYN3 4L11A 3X29B 4Z1VA 4Q4X2 1Q8VA 4K40A 2HWE2 4MGZE 5HI0A 2DUOA 4WZCA 3R05A 2EAAA 1R093 1REFA 1Z7S3 3ZFFB 4C90A 5JMCA 1BQPA 3IDEA 3J26N 4M01A 5C33A 3WCSA 1W0OA 1LB2A 5H9QA 3VBFB 4AVBA 3FFQA 1RUNA 2HEYF 3P3NA 2ZGNA 4A3XA 1VB2A 3ZFFC 2K2SA 4OZXA 1V9U2 4FPLA 1LOAA 1VP6A 1DDLA 2B9UA 4JRLA 2AGSA 1AJOA 4XFCA 1WCKA 3VHOA 1FI2A 2ZX1A 4DXZA 1Q8OA 4MH0E 4QPYA 3WUCA 4F7ZA 1ZRDA 5I8YA 1RUD2 1ZYBA 3DGTA 2NMNA 2ZHNA 4MSVA 1XNKA 3SNMA 2IC1A 1EAH2 4XJWA 1OQDA 3ZMOA 1QXJA 1V6JA 2JX9A 4OVEA 1N1YA 3SISA 2R16A 3VLBB 3PJQA 4AHZA 2UYAA 3O0WA 2BUKA 1ZZ6A 4JTOA 4X8NA 2YHJA 1AYM1 1JOJA 3AX4A 3OYWB 3R0RA 3G7DA 1HKDA 4FT8A 5JDBA 4H7LA 1WD4A 2PAKA 4GQ7A 1IKPA 4NN0A 4G4FA 3WW1A 1KD7A 3OBRA 3H1MA 3U11A 1PO11 3MW3A 3RI9A 5C6CA 3GZAA 5F5QA 5K8SA 4YM0A 4YVSA 3I4IA 3LAGA 1YHFA 1F5JA 3FX3A 2RM23 2E9QA 1VBC1 3B01A 4KWJA 1EV12 4RFT0 2W68A 2ZKNA 1QDCA 1H9PA 2WFF3 4LUMA 5DZFA 4LA2A 4YFWA 1AL23 1NA1A 4XXAA 4DQAA 1MEC2 3E5QA 4Q0UA 2R073 3VZNA 5AC92 4UW5A 1RUF2 1QH6A 1C5IA 3UJQA 4CDQA 4K20A 1S0JA 2WFPA 2XL9A 2P2KA 5A3LA 2WZPP 4LBOA 2ZHLA 2GC1A 5CG9A 3B69A 4HVQA 1LTEA 2A5ZA 1JUIA 3BTAA 2WS93 1WBFA 4NHKA 5KBFA 3ZYGA 4YNIA 4AWDA 4C0BA 2C1FA 3VHPA 1NG0A 3NV4A 4AQSA 1HX6A 4LTAA 1H2KA 1VBA2 4INDA 3POSA 3KT1A 1CPNA 1S0CA 2WINB 2YGMA 5D8AB 1M4WA 2VOXA 3WQ7A 5K0UA 2UWAA 5FFOC 4DFSA 2DU1A 2RS53 3C2UA 1ALYA 1MS9A 3JU9A 4LBQB 5FAXA 2TNFA 3FLTA 3ZXAC 1QJY2 3M3IA 2D44A 4E4ZA 1LESA 1PVC1 5D8AC 4P5HA 3H9AA 5I0UA 3ZFGA 1IPKA 2WWSA 5ACA3 5F6LB 4BH9A 3W58A 1HV0A 5DDJ2 1RUH3 3TAYA 3QH7A 4Y4YA 2Y0IA 3MF6A 2XJUA 1FOD2 4PQ9A 2RMU3 3IN9A 4H7MA 4JAAA 3VZJA 3E6BA 1CJDA 4QQHA 2JG8B 3RJ2X 1JBCA 1SLLA 5GM0A 2Y38A 2VNOA 5F1RA 5JIAA 2QNKA 4XEZA 1XXNA 4CDUA 5HCFA 2ILMA 1DHKB 2JG8C 4DZGA 2A7AA 3OY8B 1AR62 4CDXA 3VBRB 1RGSA 5I93A 3MDPA 3TBDA 4LEJA 5GLTA 4YRDA 1BXHA 4EN6B 2XKOA 1Q56A 4LBJA 3B00A 1JH5A 2BNOA 1V6MA 3L9JT 1VLNA 1ZX5A 1VALA 3TN91 2VNGA 4XETA 3JBG2 1QXPA 2VOWA 4Y1ZA 2OW4A 4LHNA 1ONAA 1U5XA 3AMHA 2CTVA 4WVMA 4RSUA 2CGNA 2GH2A 2BWAA 4BLJA 5KXDA 2JXAA 2KA3A 2R042 1ZM1A 2XWJB 1IQAA 5DUXA 3ZFEA 1FPN3 4CP1A 2RHPA 1LU2A 2JG9A 2JECA 1UN1A 1AUYA 1GV9A 2UWCA 1CAUB 3SH3A 1IHMA 1WW7A 3VBHB 3WG2A 4BE3A 4WM8A 4XTPA 5FLJA 2OZ6A 5HBAA 2BNNA 2A6WA 1RVF3 3EBRA 4MXWA 2Z2SB 2K9ZA 2NMOA 1COV1 3RRDA 5L73A 3E97A 3VBHC 4EN9B 1KFXL 3HN1A 1NE6A 1HRI3 2GALA 1ZZ9A 1VJ2A 2IWGB 1X7NA 3AZVA 3INAA 2MEV2 5BNNA 3LOIA 3ETQA 3OD0A 1OPOA 2RS33 2RJKA 4AVTA 1F2NA 5D1IA 3KGLA 1V00A 2DCYA 5JCTA 1ZBA3 1GZWB 1DQ5A 3IPVB 1PIV3 1H1MA 1NY72 1AR71 4CZSA 2WNVA 1Q8SA 3CJIC 2R0HA 4I0BA 3POWA 1RJ8A 2Q5TA 3NO8A 3VV1A 5KC5A 1VIWB 2PLV1 4GMP0 1I5ZA 2UY8A 1X33A 4Q4W1 3AKTA 5C8WA 2GNBA 1WW4A 4JTNA 3ILRA 4QU2A 4FP2A 4DOUA 2PTMA 1H2MA 1MS8A 1N3QA 3O0VA 5K7PA 2FZ2A 4TSVA 3GHMA 1LHNA 4FPGA 4B3NA 1RUJ1 4LBMA 3TYJA 1QJX2 2HWD3 2AH2A 1KJRA 5L7OA 4JVAA 1XE8A 5J96B 2PN5A 1ASJ3 1WCSA 2HWE1 4E27A 1BEV3 4N9HA 1CPMA 2HWB3 1UIJA 3ACLA 4XQDA 1RIRA 3MF9A 5I8SA 4L9BA 1ZA4A 3J4UH 2I74A 2OUJA 1GSLA 2LM3A 3RMXA 2CL2A 1PGL2 5FRAA 4META 4AQTA 1OKQA 4R9DA 3L2YA 4UBGA 5CADA 1J3PA 5L36A 4Q2FA 4Y1UA 1XYNA 4FPEA 3SHRA 1ZRCA 3PVOA 1LHWA 2XJQA 1MS0A 3OGJA 2GC2A 4JDNA 5GKAC 5SV8A 2B39A 2PHTA 1YIPA 1Z0HA 3KSCA 3K48A 1W6QA 3AYDA 3EHKA 4DMIA 4K1YA 4M3CB 3W9AA 1EAH1 1TNRA 2R1BA 4GMP3 5EXOA 4JV4A 3WCRA 1MZ5A 1ND2B 1PO22 2DURA 1RHI3 3JZVA 3N4MA 1XYOA 1WMEA 3MPBA 3P3PA 4LHKA 1RC6A 5J36A 1F5FA 4K9SA 4Q4V2 1BJQA 2ZX3A 3AMPA 3N7KA 1RUOA 4AI2A 3WQ1A 3USUB 4AGRA 2YGLA 3WVJA 4FXKB 5AVPA 1ND2C 1AXYA 1RUG2 4AE2A 4E4DX 4EN7B 3DV8A 1MQTB 1KJLA 1RTVA 2VOKA 4WBBA 3RJRA 4COZA 3POYA 4YGDA 4DY5A 3BOWA 2DCJA 3D6EA 2X5IA 4J1XA 4AG4A 1LGCA 1ULEA 1AYM3 1SLCA 4J6GA 4IV3B 1BMV1 4AFBA 2RS11 1NCQA 1MQTC 3KCYA 4RS5B 3RDIA 3LA3A 3I8TA 1Y3TA 3JQWA 3UL2A 3ZN6B 1EV11 1YJLA 1DQ4A 4AQ2A 3ZYRA 3R4DB 4Q27A 3AKSA 2DCKA 1Q5OA 3VBUA 1MEC1 3SCGA 4K7JA 4RS5C 1RUF1 2FMYA 4QPGB 2AENA 1B35A 3MLLA 4P9LA 3ALQA 2D6NA 5TSWA 1OPMA 4N43B 1TME2 2ZGOA 3RMYA 4XFFA 2BBVA 1PK6B 1DQ1A 1PMIA 2IXHA 4GB33 4QPGC 3H0OA 4RR3A 1Y7BA 2EXJA 3FFZA 1PNGA 5BNOA 2QE3A 4ATFA 4DRRA 1LRHA 4AVSA 4N43C 5CFDA 5I91A 1YFWA 1PK6C 5JOYA 1VBA1 2LUWA 1J58A 1QQP1 1YLLA 2VU9A 4FCAA 4BMBA 4ES8A 4AI8A 4EWEA 3L2HA 1C57A 4HVOA 1H4HA 2ZHKA 5JVVA 4LBKA 3IDCB 5HXVA 1LGNA 3ROUA 2GMPA 1QJY1 2VY0A 3JD71 3JQXA 4COWA 1EPZA 1QJU2 4NHMA 1KDMA 2CGOA 1DBNA 3WNXA 1GICA 5GLWA 1GQHA 2GN7A 1Q43A 4BMEA 4AFAA 4XW3A 4YM2A 2BYVE 3VKMA 2XBO2 1IKQA 2XLAA 1CIWA 3DUIA 5DDJ1 3ZFFA 3UV9A 3D4KA 3FBYA 4R8HA 2WT1A 5I0TA 3ES1A 1FOD1 1OA4A 3VUOA 1AR93 4HL0A 1B09A 4GIQA 1PZ8A 1VAKA 4AFMA 1FT9A 2Q0AA 4E2GA 1HXS2 4FPJA 5CG8A 2D3PA 4LO5B 4C1WA 4HK9A 4H14A 1L3JA 1BKZA 1AR61 5L19A 3K51A 5JPNB 1SCSA 4QM8A 3D0JA 1MR5A 1Z78A 2NM1A 3URFA 4FSJA 2WZR2 1YFYA 2BVVA 4PDWB 1HRV2 1E57A 1GANA 5E1RA 1MACA 1FV2A 2KM2A 1SQ4A 2HWF2 3JBG1 1G6NA 5JOZA 1YYNA 5KHHA 1U0AA 3PVBB 5BYNA 1BBT2 1GKBA 1RMU1 2R041 3PTYA 4RHV1 1AR82 1R082 1RUC1 2YROA 5FDBA 2IXLA 3LZZA 4I02A 3LA7A 1U5IA 2B7YA 2A6XA 2NQYA 2R061 2PYTA 4YVWA 4XJZA 3MEPA 1C8NA 2A3YA 4LE3A 3S6PA 1N3PA 4YGCA 1Q8QA 1QOTA 4AVAA 2AYHA 4FQ4A 4HKLA 3WHUA 3GF6A 4JQRA 4N90A 4E2QA 1C5HA 2DVDA 1W39A 1C3HA 2VMIA 4XFAA 1YRZA 4RQPA 4Q0VA 4Y20B 3ZX7A 5A3MA 3B02A 4HVRA 1VRH3 4H3WA 4FPFA 3FZ3