1ULGA

Cgl2 in complex with thomsen-friedenreich antigen
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
MLYHLFVNNQVKLQNDFKPESVAAIRSSAFNSKGGTTVFNFLSAGENILLHISIRPGENVIVFNSRLKNGAWGPEERIPYAEKFRPPNPSITVIDHGDRFQIRFDYGTSIYYNKRIKENAAAIAYNAENSLFSSPVTVDVHGLLPPLPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords galectin-2
publication title Structure and Functional Analysis of the Fungal Galectin CGL2
pubmed doi rcsb
source organism Coprinopsis cinerea
molecule tags Sugar binding protein
total genus 35
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ulgA00
1A8DA 2Q5TA 3JU9A 1IKQA 1QMJA 3KM5A 3OY8A 5KXEA 5JOZA 1BYHA 3W58A 4FPLA 1R1ZA 1SLTA 3PVOA 4BM8A 5GZDA 4XE9A 3UL2A 4AVVA 1Q8VA 2E6VA 4XBNA 1QOSA 4FPKA 4FOQA 4XBQA 4CTEA 2GNMA 4Q26A 3B69A 1ULCA 3AP9A 1AVBA 2EF6A 1Q8SA 1H9WA 4Q8LA 4Q1PA 4XHXA 5IK8A 2PHXA 1N3OA 2ZGKA 4XXAA 4BPZA 4M3CF 1UAIA 2D3RA 3LCPA 1W6NB 5CAZA 1CJPA 4YGDA 1LHVA 1QDCA 2D43A 4XTMA 5GZCA 1YRZA 2P3JA 3ZXLA 1W0OA 4P9XA 3O0WA 5AVAA 2VH9A 3ZPYA 3OJBA 2JJ6A 1AX1A 4TYSA 3UJOA 4AVTA 5GZEA 1DFQA 3BOPA 1V6MA 1WLWA 2ZA9A 1UPSA 4NOTA 5JLVA 1MVEA 1QOOA 1AXYA 1W6OA 1LULA 1JXNA 5GJ6A 1GNHA 3I8TA 3O12A 1KQRA 1ULFA 4BLIA 1F5FA 3AZZA 1V6JA 4PQ9A 1VAMA 1G9BA 3MEPA 5JMCA 3APBA 2C5DA 1LOEA 1QGLA 1N3PA 1ENSA 3R4UA 5T5LA 2A5ZA 2A3XA 2VUAA 3VKLA 4AWDA 3RMXA 1WLCA 2LTNA 2EAKA 4XILA 3WOGA 2GNBA 2WJSA 4FPEA 3AZVA 1Z78A 1GKBA 5HCAA 3GALA 2A75A 4TZDA 4WVVA 3B9CA 2DVGA 4IQPA 1CQ9A 1N1SA 4HANA 1NLSA 1Q8QA 2VXRA 4FQZA 5IT6A 3IMNA 4FP3A 4FPCA 3AX4A 1S0GA 5L73A 5CNAA 1GYKA 4M3CA 4XBLA 5T54A 1QF3A 1GZ9A 3T1LA 3RS6A 3AYDA 2ZGQA 4XHBA 3RG0A 1DZQA 4PF5A 1MS3A 2ENRA 2WT1A 2WNEA 1S0CA 1S0IA 3T2TA 3USUB 3CNAA 4ASMB 2D6LX 2PHRA 3V0BA 1JN2P 4PBPA 4XIKA 3M3QA 1LGCA 5F5QA 4XMAA 2W39A 4YGEA 4U36A 2Z42A 4BOWA 1BXHA 2XG3A 1DQ4A 1DGLA 1LHNA 5H9RA 1V6OA 2ZACA 1AZDA 1A3KA 3QLQA 4BMBA 2RHPA 4LBMA 1DLLA 1V6KA 1WCSA 1TEIA 3N36A 3IM0A 1JBCA 2CTVA 1ENQA 2HYKA 3POWA 4LBKA 3V65A 4FOVA 2NMNA 3LSEA 1LESA 4XJ8A 3W59A 2YY1A 5GM0A 5CBLA 4FPHA 2UU8A 1CR7A 1FV2A 4BQ1A 2CL2A 1BQPA 2ZHKA 4RL7A 3AZXA 3WDWA 4Y20A 2WSVA 5HCBA 4GA9A 2R1DA 3IKWA 1UZZA 3ZXKA 3AK0A 1ONAA 1OQ1A 4YZ2A 1SLLA 2DUPA 2A6XA 1GZWA 2EALA 3M1HA 2P3KA 3ILFA 1D2SA 1NXD1 4RA0A 3O0XA 4FOWA 1QU0A 4FPYA 1W6PA 2XB6C 2WLQA 1WBFA 2P3IA 4C1WA 5H9PA 5F9TA 3GNEA 3HN1A 4R9BA 2NP0A 5KXCA 3WDYA 4Y1XA 4WVWA 2JKBA 5T5PA 3WDUA 1N47A 3IPVB 3VKOA 1BKZA 3V0AB 4UW3A 4Q8KA 2OUHA 3O0VA 3FBYA 2AR6A 1WD3A 2ZHNA 4NO4A 5DZFA 3FUOA 3OYWA 1WUVA 1AXZA 1I1EA 1W6QA 2ZZJA 4Y1VA 2E7QA 2ZHMA 5IK5A 4Y1ZA 3OY8B 1G9AA 5T5JA 3NV1A 4YW5A 3VKNA 3ZVXA 1FATA 4AGVA 4YM1A 2ZGMA 4XJ9A 5JVVA 3WLUA 2YZ4A 2FHRA 2ZGLA 3M3CA 5JOWA 4Y1UA 1RITA 3OGGA 2E7TA 5GLTA 1N1YA 1S0FA 2AYHA 1MS1A 3U4XA 4YZ5A 3WDVA 1JOJA 3OPZA 4XTPA 4YGCA 2CY6A 1IS5A 1DQ2A 4I30A 3BTAA 3M3EA 1LOGA 3VUOA 1FAYA 5T55A 2NN8A 1S1AA 5EXOA 3N3HA 1WD4A 1YI7A 4XIOA 4R9AA 1MZ5A 4ZKTB 2DVFA 1YO8A 1LECA 2NYYA 3B3QE 2EXKA 3NV4A 1APNA 1ZA4A 1GBGA 4P9WA 5CB7A 4D69A 1EPWA 2A3YA 2TEPA 1YXWA 5CA6A 1QNWA 4GKXA 5EYXA 3A4UA 4K1YA 1W6OB 2ZABA 4CRQA 5H9SA 3BODA 2DVBA 5DG1A 4XJUA 3POYA 5T5OA 1DBNA 4Y22B 2PELA 3O5SA 3WCSA 1YIFA 1H9PA 2DTYA 4WZFA 1LODA 1IS4A 4PBOA 2VY0A 1LHOA 1Q8OA 1DQ5A 4FPOB 3RQ0A 1F31A 2NMOA 3UK9A 2VW1A 4F83A 2JE7A 3UJQA 1X50A 5JOXA 4P14A 1IKPA 3OBRA 3SLIA 2WKKA 1XQNA 3AP7A 4YGBA 2ARBA 2A70A 3DUIA 3ILRA 2D6PA 2ZGTA 2AH2A 1PZ8A 4Z8BA 2OW4A 4M3CB 4ITCA 4XMIA 4YZ3A 1QOTA 5DZEA 2GMMA 4XJZA 4GALA 3ZSJA 2DU1A 2VU9A 3ZYPA 1SBDA 1LGBA 1MACA 3WZ1A 3AXDA 3SISA 4YM3A 2OUJA 1YYNA 4GWNA 4DS0A 1MS8A 3AP5A 2YXSA 5GLZA 3PVNA 1FV3A 3WUCA 2P2KA 1AF9A 2GN7A 3ASIA 1IOAA 2UWAA 3MW4A 1LGNA 1FNYA 1Q8PA 3WG2A 3QCWA 1DQ0A 2ZGOA 1C1FA 1RIRA 1UX6A 3AYCA 4XXPA 4YG6A 2GNDA 2GMEA 1LEMA 5IUQA 5JDBA 2A6ZA 3INAA 3MW2A 1O4ZA 4H55A 5DXDA 3PVEA 5DG2A 1SLAA 3VV1A 1LOCA 1S0BA 2W08A 2WT0A 3N7MA 4XJWA 1SCSA 1KJRA 1MS9A 1QNYA 4YZ1A 4YG0A 4GXLA 1JW6A 4LBQB 1BJQA 1ULGA 4YFWA 3TB0A 4DRRA 1KRIA 1ULDA 2GN3A 1LEDA 1G9DA 5IK7A 1W6MB 1JYCA 1LOFC 3FLRA 4XYXA 3WG1A 3VKMA 2AUYA 1J1TA 4UW5A 4WV8A 5T52A 1CPMA 1S0EA 4PCRA 1GZWB 1UN1A 2ZGSA 1G7YA 1AXKA 4BMEA 1LU2A 2KM2A 4OZXA 4YFZA 3WG3A 3SH4A 2C9AA 2LALA 1Q56A 1W6PB 1C57A 1N1VA 3LSDA 2DTWA 3NV3A 2D44A 3PJQA 3JUUA 3WHUA 1KJLA 4ATEA 2DV9A 1SFYA 5GZGA 4FP2A 1LOAA 1VAVA 2ES3A 1G9FA 3C2UA 1C1LA 4LBQD 4AVSA 3AYAA 3A0KA 5GLVA 2FMDA 2CWMA 2VW0A 3WDTA 2WQZC 1A78A 4JC1A 4Y1YA 1MZ6A 4XJAA 2UWCA 1MS5A 1GNZA 3AP4A 3OYWB 4UW4A 3ZYRA 2I2SA 5IK4A 1JYIA 3FUQA 3I4IA 4GKYA 2R1BA 1W6QB 3V0AA 2YROA 2B7YA 2VW2A 1LHWA 2SBAA 2EXJA 1UZYA 3NV2A 2ZKNA 2D6NA 1OKQA 4Q2FA 4Y26A 1LENA 2NZ9A 5KXBA 1U0AA 2NM1A 4YG3A 3Q9OA 2PHTA 1F9KA 3IN9A 4R9CA 4M00A 3ZXJA 5E8AA 1IS3A 2ZBJA 4M3CE 3WG4A 4UW6A 5H9QA 2DU0A 2UURA 5FRAA 1CPNA 1LOBA 5DUXA 4LBJA 5T50A 3VKFC 1Y7BA 1FYUA 1PZ7A 4K21A 1SLIA 1VLNA 3FFZA 4P9YA 4FPFA 2ZGRA 4ISRA 3AFKA 3D4KA 4YW3A 3AJZA 2CNAA 3SH3A 1W6NA 3OBTA 4YW1A 2D3PA 5GLUA 1V6LA 4BLJA 3R4SA 1LTEA 4AGRA 3MW3A 2YMZA 1SCRA 3N7JA 4DQAA 5EYYA 3WHTA 4YZ4A 2D7FA 2DYCA 3AJYA 3ZSKA 1KITA 2EXIA 3B01A 3ZXFA 1HKDA 3AXEA 1MVQA 2YV8A 4ZXKA 3B00A 1O4YA 1CESA 3WDXA 3ATGA 2ZMKA 3RSJA 1DIWA 4HL0A 3TAYA 5LK5A 3D6EA 1V00A 2W52A 1HLCA 1GZCA 2E53A 4GWMA 4SLIA 3BIWE 1N1TA 2P34A 3SITA 4XOGA 3AZYA 4K1ZA 4Y24A 2JE9A 1V6IA 2DUOA 4Y22A 1KDMA 2WT2A 1S0DA 2R0HA 5GZFA 4FPJA 4YM2A 2A3WA 3FLTA 1SBFA 2A6WA 1RINA 2DVAA 2AGSA 2ZGUA 5DUWA 2ZGNA 5DZGA 1VALA 1AX0A 5GLWA 3RRDA 4AYUA 3N7KA 5JOYA 1QDOA 2R49A 4Q27A 1G8WA 2V73A 2AREA 1LU1A 4W65A 3DGTA 2JDZA 2DWRA 2R0FA 2W68A 3HR9A 1B09A 4LBNA 3V0BB 2PHUA 1GV9A 1CONA 1SACA 5KXDA 1QKQA 1FNZA 1SLBA 1DYPA 1G86A 2A6VA 2H0BA 1CIWA 2DUQA 3ILNA 3L2YA 3M2MA 1UKGA 4L8QA 2ZGPA 1URXA 1BZWA 3USUA 1MR5A 1SLCA 3ZSMA 4DRVA 3M3OA 2D6MA 2DURA 2ERFA 4MYEA 4XDQA 5DUVA 1D0HA 1JHNA 1MS4A 3V64A 4FVVA 1CN1A 1JUIA 1Z0HA 2V5YA 1CVNA 1AJOA 2ZHLA 4DPNA 2WSUA 1N3QA 1ZM1A 3D5OA 2P37A 2D6OX 1GLHA 1MS0A 3R05A 5EWSA 1KDKA 1LJ7A 1WW4A 1WW7A 2AENA 5FREA 3WCRA 2A7AA 2CWSA 2ARXA 3ENRA 4FPGA 3AP6A 2EIGA 5DUUA 3POSA 3ZSLA 4CZSA 1G9CA 3MPPG 1DQ6A 2GDFA 1H30A 2BQPA 2D6KA 4Y20B 2DVDA 2EXHA 4YW4A 5SV8A 2ZMNA 3SNMA 1HQLA 1LHUA 1AJKA 3FLPA 4KBBA 4XZPA 1GSLA 1OFSA 2ZMLA 3WV6A 3ZXEA 1UMZA 3A0NA 1S0JA 1AX2A 2CYFA 1DQ1A 3RMYA 2A71A 1DYKA 1FX5A 2OVUA 1VIWB 4JCKA 4LBOA 5BYNA 1SBEA 1HDKA 2JECA 4LBQA 1WW6A 2UWBA 1WLDA 3AYEA 1GANA 2G4IA 2SLIA 2ZAAA 3T1MA 3PMEA 4K20A 4YW2A 5HCFA 1W6MA 1WW5A 3AZWA 4C1XA 1V6NA 3KQRA 1LCLA 4AGGA 4ATFA 3WNXA 1UL9A 1GICA 1ENRA 1WBLA 3N35A 2PHWA 3NWKA 3WVJA 3H0OA 1ULEA 4JRAA 2GALA 2PHFA 4DFSA 4Q1RA 3IPVA 5E88A 2A6YA 2JD4A 3N7LA 2E51A 4ISQA 3SH5A 4R9DA 4FOYA 1DHKB 1LOFA 5GALA 3HMYA 4U2AA 5E89A 2GMPA 1IS6A 1HQWA 1PZ9A 2GNTA 4LBLA 4YM0A 3WUDA 2R16A 1I3HA 1W0PA 4M01A 1C4RA 4YLZA 2D3SA 4FQ4A
chains in the Genus database with same CATH superfamily
3JU9A 5LASA 3VL9A 4YYOA 4COZA 1YQ6A 2VMFA 4Q0UA 1QQP3 3HQRA 1W28A 5D8AC 2G9FA 1Y3TA 4BE3A 3GBGA 1SLTA 1RUD2 4XE9A 5CKMA 1I9RA 2W91A 3J7NA 4N53C 4XBNA 4A6OA 2ZEWA 3WNOA 2R073 4I09A 3L2HA 1RUD1 1W04A 4Q26A 2QDRA 2WA3A 3PIJA 3AP9A 1Q8SA 4AEJA 2GH8A 5BNPB 4CDQC 4Q1PA 4BHPA 2BPA2 5FK8A 1UAIA 4YGDA 3ZN6A 2HWF3 3O1MA 1RUE3 4HPKB 5DPNA 2W87A 5LBCA 3S5AA 2PAMA 3VBFC 4D7TA 5GZCA 2WWUA 1W0OA 4E8CA 1OPOA 4DY3A 3FC0A 1RVF2 4JAAA 4LUMA 3VDDC 3UJOA 5JXGA 1OUSA 3BCWA 1DFQA 3RGBA 1WLWA 4K40A 1RVF1 4LNVA 1AL22 3WP3A 5JLVA 1MVEA 4XFAA 1EY2A 1W6OA 1LULA 1JXNA 1IQDC 1GNHA 1HJFA 2DBNA 2WNUB 3J9SA 3P3PA 3DXUA 1ULFA 3Q8CA 1F5FA 5EJZB 3WW3A 1YHFA 1V6JA 4HXCA 4AI3A 3AM2A 5FMOS 3WNKA 3AKPA 5TSWA 1GOGA 1F4HA 4PLOA 1B35A 4IE0A 1N3PA 3R4UA 4OMCA 3PU3A 2PMWB 1MPXA 4AWDA 2VUAA 3AMMA 2A1XA 4RFRB 1UOJA 2PLV2 3J7LA 4IEPA 1Z78A 3HT1A 4DUXA 2FZ1A 1W3VA 4AK3A 4NE9A 2B42B 5FY9A 3P1IA 4JRLA 4TZDA 1YFWA 4ARXA 1CQ9A 2WNVB 2QZ3A 1NLSA 1Q8QA 1YLLA 2PLV1 2VXRA 5IT6A 4Q4W2 1NZIA 3AX4A 4AL9A 4IEUA 4MGYE 5T54A 1UYZA 5ACA3 4MGZE 4Q4W1 3KT4A 3LEGA 3I3QA 4UBHA 1GZTA 1PGL2 3RS6A 3AYDA 4BQYA 4IEQA 4XHBA 1DZQA 3T2TA 1S0CA 1S0IA 2BOJA 1QY4A 3CNAA 3V0BA 4HN1A 3ZFGA 4AQ2A 3KCXA 4HFSA 3TEXA 4PT6A 4XMAA 3PL0A 3FWEA 4P5YA 4NHLA 1BXHA 2XG3A 1HRV3 3IIAA 1DGLA 1US3A 3AMPA 1U5XA 4NIAA 2ZACA 1AZDA 3ACFA 3VZKA 4HBNA 1YJKA 2RHPA 4LULA 4DNYA 3DYOA 1JU4A 1WCSA 3FMGA 5FZ9A 5EV7A 4BYYA 3ACHA 2X5IC 4AVBA 5JR7B 3VBUC 1NCRC 3UT0A 3MIEA 2W3JA 4UAPA 2IXKA 2WN3A 4H2AA 3V65A 4OHVA 4GJZA 3T2OA 1OVPA 2KD7A 5JSOA 3H7JA 3NNLA 3LSEA 3W59A 1X36A 3SC7X 5GM0A 2G9GA 2J1AA 2VECA 4H3WA 3I3MA 5FZAA 5LZ6A 5FP9A 3KVBA 4GA9A 4AHWA 2R1DA 3ORJA 5J98B 1UKRA 1CAWB 4OQ8A 1W8HA 4UWDA 4JV4A 1SLLA 1HQNA 4AFAA 1UNBA 2P3KA 3ILFA 4K8RB 4M4PA 5A32A 4MADA 2VZPA 4HN0A 2YBSA 5A7NA 4FPYA 2XLAA 1MZEA 1C3HA 1E5SA 1WBFA 1R082 4CDUA 4UFHA 3EHKA 1AL0G 2HEWF 4IE7A 3DEMA 3T0BA 1EAH2 2P3IA 5C8CB 2FMYA 3GNEA 5F9TA 3W5NA 4Y1XA 3H1MA 5HPOA 3KHCA 4EE2A 3LOIA 1R081 1K45A 4UW3A 2C4XA 4HVOA 3O0VA 3FBYA 1NAEA 5F7UA 1DDLA 5BNPC 2BWCA 3N9LA 5DZFA 3ZN4A 4NJ4A 4HLTA 4TLGA 1FMD1 4ES8A 3FL7A 1WUVA 4CXWA 1AXZA 3MO4A 4LO6B 4CCEA 1GOHA 1QXRA 5F3EA 3WNPA 3MZHA 1FPN1 3A22A 1I5PA 1W8UA 2ZHMA 1V0AA 1KS4A 1ZBA1 4PIYA 4Y1ZA 3VKNA 4BA6A 4C0BA 1W2UA 1FATA 2OPWA 4URAA 5LRSA 3UESA 1CZSA 5F39A 3RJ2X 1NT0A 3ZYJB 4I0WB 2ZGLA 3O14A 3HAGA 1GWKA 4KWUA 3ZOIA 1OLQA 1RITA 4GAZA 5C8WA 4QPGA 3C7OA 2E7TA 1SPPA 1SFPA 3ES4A 2WNUC 4IE4A 1MS1A 2ZEYA 4A3ZA 5DAWA 5F1RA 5JZGA 5CVRA 3WP5A 2ET7A 1DQ2A 1OOPA 4UFKA 4ET7A 3ZN6B 4YNIA 1WCDJ 5T55A 1E5RA 1W9SA 1ZX5A 3MIHA 1YI7A 2Q8DA 4XIOA 5JI9A 1MZ5A 3T4HB 3T4VA 4BQ5A 1YO8A 2QTWB 1KFXL 3B3QE 4XDOA 4LR4A 1VBA2 4D69A 4OFGA 5FZ0A 2TEPA 1UYYA 1YXWA 2RR12 2WNVC 5EYXA 1VBA1 1W6OB 3BTZA 3W21A 1SEFA 5EFUA 1O91A 4XFHA 4Y5Z0 5E16A 3BODA 5H9SA 4GMP3 2RR11 5DG1A 1POV0 4AVAA 1DBNA 2HWC3 2PELA 4FTBA 5J09A 4WZFA 3A7QA 1B35B 1FOD2 1OHFA 1LODA 3NNFA 2VD7A 1Q8OA 2ORXA 2LW8A 1J3QA 4OI2A 3D0SA 3QD6A 2VNGA 2VW1A 1F15A 2EVXA 4F83A 2O1QA 1E5HA 3N9PA 5FY5A 3UJQA 5JOXA 3W5MA 2YPDA 3EMRA 4P14A 4LT5A 3O7OA 1CAUA 4N43A 3SLIA 3TN92 1QIQA 1EAH3 4FFHA 3LIGA 3ILRA 3GBFA 1TMF3 1ZA7A 4Z8BA 1OPMA 1T6GC 4YZ3A 3ZSJA 4F7ZA 1QOTA 3P3NA 4XJZA 1W0NA 3TN91 1Z7S2 1OXCA 1QJY2 2VOTA 4XQWA 4OI1A 1TE1B 3ZYPA 1LGBA 3LD8A 5A7WA 3T09A 2XJVA 2K0GA 1Z7S1 1QJY1 2I07B 4LITA 3ZFGB 1RUF3 2OUJA 4Y4YA 1NZCA 3RNSA 3J7HA 4GWNA 3GZTB 2PAKA 3ZYHA 3IMMA 4OUMA 2RS32 2Y6GA 4DS0A 1ZRFA 5C3QA 4IEVA 3WUCA 3DV8A 2QJVA 4QPWA 4K7JA 2GN7A 3ASIA 5FYHA 1IOAA 1H2LA 2UWAA 3MW4A 5FOBB 3U14A 2RS31 4AG4A 1OF3A 3WG2A 3WY6A 3QCWA 3WF3A 3DF0A 1RIRA 5FMDA 2RDRA 1QJZA 3ETPA 2GMEA 3I2FA 1LEMA 1BCXA 2VPVA 3INAA 2CHHA 4E4SA 4H55A 2C6SA 3ZMOA 1W9FA 4A42A 1ACCA 3VV1A 1AYM2 1S0BA 1YQ5A 3HNBM 4EQVA 4CCOA 4LXLA 1LNSA 2XGXA 2LRPA 3LKJA 1KJRA 5C8CC 1AYM1 1QJX2 1QNYA 3N4MA 2JG9B 1XYOA 4LBQB 3ZFFA 3TB0A 4OI0A 1KRIA 1X8EA 4AZZA 1AYN3 1ULDA 3MGUA 4BU2A 1QJX1 3KZ4C 4ORFA 2RJKA 1JYCA 1D7PM 2W47A 3OUJA 3R0RA 4X6RB 1ZNPA 3DL3A 3WG1A 1RXGA 2AUYA 4EN6B 1DG6A 4WV8A 5T52A 1S0EA 5CKNA 2FDIA 2MNGA 2QQIA 5A32B 2KM2A 4LEJA 4OZXA 4YFZA 1PX4A 1X7NA 1C8M2 1GP4A 4CDUB 1W2OA 2XXZA 5DAVA 4MSVA 4M0NA 2DCKA 1C8M1 1KJLA 2VOKA 3VHRA 3VD4A 3BUCA 2DV9A 5FCCA 4FP2A 1OLRA 1VAVA 3SXWA 4Z2AA 5FOJB 4PF1A 4Q4V2 3EJKA 1D4M2 2VW0A 3WDTA 1POV1 4XJAA 2AEZA 2F17A 2WO1A 4CSWA 4UW4A 1XNAA 3N9NA 2ADDA 4Q4V1 4QDRA 3VBSB 1D4M1 1W9WA 2RJ2A 3I4IA 4D94A 3V0AA 3O1VA 1NUKA 1UZYA 3VDAA 3OTFA 2YBKA 1R64A 2JICA 1LENA 2R7EB 2G19A 3KV9A 3MFCA 1AR63 3UGGA 3S57A 5KHGA 4CCNA 4XDPA 2ETEA 4M00A 1PIV2 3WG4A 3H3ZA 4M3CE 4IE5A 2BDRA 2XJQA 4MH0E 3CHXA 1YFUA 2UURA 2VCAA 1CPNA 1LOBA 3GHMA 1PIV1 4LBJA 1J1LA 1SPPB 4UYBA 5DUXA 3VKFC 3AVSA 5J96B 4ZZ5A 3ALQA 1QXJA 4P9YA 1D4VB 3NNJA 4KH9A 4AVCA 1OOPB 1H1AA 4YW3A 5A7OA 1QJFA 3MIFA 2VMEA 1RUG3 1B35C 5FZ6A 1EV13 3FJSA 3E97A 3JBG3 5ABJA 3R4SA 1LTEA 2YMZA 4LORA 3M3IA 5IAXA 2ZX2A 5FUNA 2JIGA 3VZJA 4COUA 3ZX7A 3VGIA 1M06G 2QDNA 2WRAA 1KITA 4G4FA 2KXLA 1XE8A 4ZXKA 3AXEA 2X05A 2YV8A 3I2GA 4Y4RA 1VBD2 3HNYM 4N8MA 3G7DA 1DIWA 4HL0A 3TAYA 4QHZA 1RJ7A 2Q1FA 1V00A 2W52A 4QQ2A 4GWMA 4RQPA 3ZSEA 4AQSA 2MPFA 1N1TA 2P34A 2BERA 3GM8A 3MV01 3OB8A 5JXJA 2W1UA 5L9RA 3ZFGC 2E31A 4Y24A 5K7PA 5GZFA 1S0DA 4FPJA 4YM2A 1VPHA 4NIHA 1CAUB 2ZX0A 3FLTA 4N43B 5F6KA 2DVAA 5A3MA 2AGSA 5DUWA 5IVYA 1PM7A 3N7KA 2R49A 5E6HA 3VZNA 4Q27A 1PNFA 5FYVA 3VZOA 1LU1A 3I49A 4JTNA 3K4DA 3FN9A 1B09A 3HT2A 2EIEA 5AFBA 2WABA 4JKKA 5AVPA 1M4WA 5A7WB 2X8KA 3AKRA 1SLBA 3KF5A 3BVCA 1G86A 1RGSA 2OZ6A 1CIWA 4S2HA 2OPKA 1O5LA 1OD3A 1BZWA 3USUA 1WCUA 3WSOA 1MR5A 4WBBA 3ZFEA 3UGHA 3ZSMA 5FK7A 2ZAHA 4YVSA 4XETA 1O7FA 1OQDA 4LE4A 4MYEA 2XPJA 1D0HA 1T2XA 2JG9C 1HB2A 3AKQA 3V64A 4FVVA 1CN1A 5KHJA 1WZXA 1QJU2 1AJOA 1D2QA 2ZHLA 1PMIA 5F8PA 4OUSA 4DPNA 5T3NA 4QX2A 4Q0SA 4Z1VA 3ZXAC 5HV0A 4I3GA 1QJU1 3H8RA 3GGLA 2ARAA 1XJAA 2BU9A 4EZHA 3LOBA 4Q4Y3 2ARXA 4P02B 4FPGA 2HWB3 3E1F1 3OBAA 1G9CA 2Z79A 3ZSLA 2DF7A 4QT6A 2GDFA 4CDUC 1GOFA 2DVDA 4YW4A 1HQLA 4KBBA 3VHPA 2ZX3A 5CKQA 1L7LA 1GSLA 2ZMLA 3ZFFB 3WV6A 3WW4A 4W6YA 5LY2A 1P8JA 1CWPA 2JIJA 2CYFA 4P9GA 1VIWB 2VNRA 4QX3A 5FFOC 3DKWA 3A21A 4QX1A 2W94A 3VBSC 4I2OA 2UWBA 5FO8B 4YRDA 2PYTA 2FQPA 4CEWA 5HCFA 1W6MA 3AZWA 4CPBD 4BCUA 2MEV2 5C7GA 1IPKA 5IVBA 5FPLA 1WBLA 3N35A 3P6BA 1XYNA 3NNMA 4X6QB 5BNNA 4KNCA 2NPIA 2RMU3 4XUNA 4D6RA 4E2SA 2VCMA 5FZMA 3RZJA 2XMLA 4FTEA 4FXKB 2WO3A 5LK7B 3IDCB 2YUEA 2JD4A 2RS53 4IEYA 5FO7B 2VBPA 4P5HA 4I01A 4NR1A 4R9DA 4WZCA 2P3YA 1HX6A 4COYA 4Z2WA 1LOFA 1OOPC 3HMYA 5I0UA 4XUPA 4GWJA 3KT1A 4YM0A 1PZ9A 1AR72 4MGIE 1JU3A 4AQTA 3RSJA 4A4AA 4C0HA 1UU5A 2P2KA 2VJXA 2ZTNA 4FQ4A 5C9AB 1IKQA 4INDA 4QPIB 5IAVA 1AR71 5CIRA 2BUKA 3UYJA 1QH6A 1UD1A 3VN4A 1S2EA 3W58A 4YARA 1OLME 4X8PA 5GZDA 3UL2A 4PHZA 3QACA 4MX3A 2IVIB 2PAEA 2WIIB 2O14A 3LA2A 2IFWA 3UGFA 2JDKA 4K8FA 3MPBA 5HV4A 2Z2SB 5A3TA 2O8OA 4KGGA 4Q8LA 1EUTA 2R063 4CEYA 2RS12 1N3OA 3CU7A 4J25A 4WVMA 2WLPA 4XF4A 4XXAA 1JHJA 3LCPA 4B1MA 4BPZA 5JI7A 5I0TA 3VZLA 2D43A 5CEHA 3MBWA 2WQ8A 4PLNA 5JWPA 2P3JA 4DXRA 2FDKA 4MXVA 4QAWA 3D3AA 3S7EA 5AVAA 3U10A 1WWYA 4B4RA 1JZ4A 2JJ6A 1AX1A 4GIQA 2FDFA 4FFGA 4N43C 1GNYA 1EP0A 2HYXA 1UPSA 1UWWA 2ZA9A 3POEA 1AXYA 1HRI2 4IXLA 3H50A 4BISA 2WYSA 2Y60A 3AZZA 3TOJA 4PQ9A 4RQPB 3AL6A 1HRI1 3APBA 1RUC2 2BP6A 4QMAA 1ENSA 3BIEA 4MGQA 1REDA 5FZKA 5JPMB 2WJSA 3AZVA 2MEV3 5HCAA 3Q8EA 3HIFA 2W0XA 1UY2A 1N1SA 3C7EA 4FI9A 2YDEA 2R6QA 4FQZA 3HNMA 4FP3A 4UF0A 1QQP2 3EYPA 5CNAA 4O65A 4CCMA 1UOFA 1GYKA 2YB7A 3BOWA 5IATA 2E33A 2V5DA 3JQXA 1DU3D 4FFIA 3K3OA 2WO2A 3S6PA 1QQP1 2J1SA 1XC6A 1GZ9A 2R072 3AVRA 3T1LA 3R6SA 1A34A 5EIYB 2WT1A 3USUB 3ZR6A 2VCBA 2D6LX 5FZBA 1JN2P 2R071 4PBPA 1GQGA 4QPYA 4XIKA 1D0GA 2W39A 3ZFFC 2BGOA 2HWF2 1DQ4A 1GQPA 1LHNA 5H9RA 1RUE2 3T0AA 1XE7A 1YWKA 4L99A 4CDXA 5JXHA 2Y33A 1H8TA 1DP0A 1O6UA 4WVZA 2HWF1 2Y6JA 4BMBA 1RUE1 2F4PA 4GZ9A 2J1TA 4LBMA 1DLLA 1V6KA 2YGMA 5IW0A 1YJLA 3UKTA 1PGW2 2Y34A 5HXVA 1V9U3 3WF0A 1W90A 4Q29A 3IM0A 4AEDA 4GH4A 4IL7A 2HYKA 2AEYA 2L9LA 1UU6A 1XSRA 1PGW1 3B93A 1UXXX 3LGRA 2QQJA 1LESA 2YY1A 3WINE 5AFEA 5CBLA 2C26A 1QXPA 3CJIA 2BTVC 2FDGA 2B4KA 3PLQA 4RL7A 5FBZA 1UF2C 3AZXA 4Y20A 4QHBA 5HCBA 4DUWA 1JZ5A 5C5TA 1DLCA 5FZIA 5FYCA 4AOCA 2G1MA 1ZRRA 2VVFA 4CXYA 4SBVA 4YZ2A 5D2AA 3NMBA 2DUPA 2A6XA 5CFDA 1W8OA 1STMA 3M1HA 3LPFA 1JYXA 1D2SA 1NXD1 2HEYF 4RA0A 5C9AC 1O5UA 3DECA 4QPIC 1UY1A 3O1PA 3N9QA 4OHXA 5ACA2 3U75A 2ZPXA 4JQTA 3BPZA 3OPWA 5KXCA 3WDYA 3OBZA 5T5PA 1CAVA 3OPTA 1NKGA 3RI8A 5J1XA 4Y3OA 2Q8CA 1X9PA 3VHNA 3VKOA 4EJRA 2XOMA 1PMJX 5ACA1 3S0MA 1IPSA 4NHYA 2OUHA 2YC4A 3MYXA 2VNOA 4CP1A 2XL7A 3OD0A 4XQ4A 3OYWA 3DKQA 1O3RA 5J37A 1HRV2 2ZZJA 2E7QA 5IK5A 4UT5A 2HBTA 4IV3A 5T5JA 3NV1A 2VMHA 4YW5A 4PI2A 4AGVA 4YM1A 4E27A 1HRV1 2FCTA 4XJ9A 5JVVA 5BNOA 1XNBA 1UY4A 3WW1A 4W50A 3OGGA 1GP6A 1O3SA 2AYHA 1SHWB 4GMP0 3U4XA 3WDVA 1JOJA 4WVMB 4YGCA 1IS5A 2NLRA 3FE5A 4I30A 1W3XA 1CX4A 1O8PA 2DFCA 3M3EA 4RQPC 3I2HA 3VUOA 1FAYA 3MIDA 2A73B 4CDWB 2NN8A 5EXOA 4GJYA 3POIA 4R9AA 1XNDA 4MUVA 2DVFA 1FI2A 1CZTA 4ZU7A 2FD8A 1LECA 3GF6A 3H8UA 3Q8AA 4QGNA 3RI9A 2EXKA 2VE1A 1APNA 3GCXA 4BWOA 2EIDA 3KVAA 4MLOA 5FZOA 4XFCA 1AL21 1OH3A 1UMHA 2QCSB 3TNQA 2ZABA 3O1OA 4BQ2A 1KXGA 2W9XA 4EN8B 5BY5A 4MHUA 4H7LA 3POYA 3ZYFA 3AMQA 3O5SA 1YIFA 2DCYA 3LAGA 2VY0A 1LHOA 3RQ0A 1DQ5A 4FPOB 4H7MA 1JH5A 1F31A 5A33A 3UK9A 4DUVA 4CP0A 4N9HA 1ZZ6A 1IG3A 3K46A 3OBRA 4HT1T 2WKKA 5DABA 4A44A 1XQNA 4YGBA 1HN0A 1W8ZA 4XFGA 1PZ8A 2JB8A 2XJTA 2VZ3A 3CLPA 4OZOA 4ITCA 4Q5OA 4IGQA 5DZEA 1V70A 1LKNA 2DCTA 3BN6A 2E9QA 1LR5A 3HQUA 2PFWA 2VU9A 3K2OA 4FXGB 1RUI3 2LS6A 3OG2A 1MACA 2J1VA 2Z4FA 3ZXGA 1PGL1 1RHI3 3KGZA 4CCDA 4Z07A 3UKNA 3SISA 2WBKA 5F5CA 5LA9A 5I0SA 3KSCA 5C3SA 4BQXA 1MS8A 4UFLA 3I97A 3O1RA 3VBHA 2YFUA 3DCQA 4QDSA 3PVNA 3VBOA 4CDXB 2Y38A 2J22A 1L7RA 2GSYA 1H8TB 4KWLA 4ZU5A 2ZGOA 4DB5A 1C1FA 2VGDA 2K9ZA 5ISLA 1UX6A 2GNDA 3ZO0B 4C91A 3B5LB 3J8F3 4AFMA 5IUQA 1ND3B 1IQAA 2BJSA 4AEDB 3MF6A 4J6GA 1W8NA 4UXAA 2XR4A 4C8DA 1DGWX 1LOCA 2K46A 1OC1A 1RMU3 4YVWA 4AE2A 1OUXA 3CJIB 2VQUA 2CU5A 5FWEA 1BLZA 1LB2A 4JQRA 2HWC2 4HVQA 1BK1A 4HK8A 4LIVA 4QQOA 4GXLA 3POJA 4P9IA 4MGSA 4GMP1 5FP4A 1G9DA 4DXTA 2HWC1 1H0BA 3AMHA 3C3VA 2BWAA 5FLHA 4QQHA 2GP3A 1LOFC 1TME3 2VZ1A 1UQXA 4ASKA 2EA7A 5CFDB 1UN1A 3CO2A 1PK6A 4BMEA 1EPZA 3J7MA 5FY0A 1HXS3 1TMF2 3NNGA 2JDAA 2DTWA 3JB8A 1EAH1 1QHDA 4LO7A 1PO23 1JUHA 3FFQA 1W8WA 2UYBA 3LA7A 3WHUA 1CAVB 2J7MA 1G9FA 4NUBA 5JPNB 4RN5A 4AHZA 2OS2A 2CAVA 1MEC3 2WAAA 4A7YA 3B9IA 4JGZA 1A78A 1RUF2 1MZ6A 3ROUA 1MS5A 1GNZA 2I74A 3OYWB 4CUGA 5IK4A 2VZOA 3IB3A 2JE8A 3FUQA 1JYIA 4GKYA 1RUF1 4CDWC 2YROA 1J84A 2D6NA 1OKQA 4Y26A 5EQUA 5KXBA 3BI3A 1J59A 1DGRA 1BEV3 4YG3A 5FZFA 5BNOB 1F9KA 5A1AA 2ADEA 3IN9A 2E63A 3KHBA 5M0TA 3VDBA 5E8AA 1IS3A 1RYYA 4FT8A 1UOBA 5H9QA 2P6CA 5FRAA 4OI4A 2HBUA 4NPLA 1FYUA 1PZ7A 1SLIA 4QM8A 4AI9A 3OD4A 5F37A 1JZ8A 2ZGRA 1GUIA 3AFKA 4ISRA 3U07A 4ARYA 2YU1A 3D4KA 1KGYA 2JWPA 2O8QA 2IFRA 4DIQA 5FYSA 1W6NA 3U11A 2QQKA 2D3PA 5GLUA 1JZ7A 1AYN2 1V6LA 2QE3A 3KGLA 1HB3A 2HWE3 2VOXA 3E6DA 4LK6A 4NRMA 5A7SA 1UO9A 4WM8A 1EYBA 5EP9A 2WS93 4AGRA 1UY3A 3DN7A 3N7JA 3VHOA 3J4UH 1JZ2A 4P9LA 5FZOB 2D7FA 2W2IA 2CAUA 5FZCA 4QDQA 2K2SA 3AJYA 5I0RA 3B01A 4YWAA 4M4RA 3ZXFA 1HKDA 3CEWA 1MVQA 5A1LA 1ST8A 3WDXA 3ATGA 2ZMKA 1TG7A 2R043 5A6YA 1AR93 5FO9B 2RVAA 3BPSA 5LK5A 2BFUS 3D6EA 3I59A 3LPGA 1FOD1 2BNNA 3Q8BA 3IDEA 5A3UA 3AZYA 2XKPA 1ZZ7A 4K1ZA 1VRH3 2DUOA 4Y22A 4HONA 4ZONA 1LAJA 1R1A3 5DAPA 5FZEA 2WZPP 3CMGA 3RRDA 4CDXC 1VALA 2VMIA 5GLWA 3ACGA 1H8TC 2V73A 1AR62 5J48A 4JTOA 3WQ7A 3ZIXA 4XAAA 3LDRA 3V0BB 2V09A 4JDMA 1COV3 3LA3A 1CONA 1ND3C 2YHJA 1AR61 1DGWA 4AEDC 3JD73 1QKQA 1FNZA 2VM9A 3WF1A 1UZ0A 2DUQA 3ILNA 2ET1A 3JZVA 2WAOA 1A6CA 1JTZX 3ITQA 1CIYA 1VB4A 1GFF2 2KA3A 1VB2A 3CJIC 2VULA 5FUIA 2IUWA 4XUTA 2DURA 1H2NA 1JMUB 2D6MA 4RR3A 4I0BA 4XDQA 3VBOB 5FYIA 1RUG2 5IWFA 1EV12 1FPN3 2V5YA 1CVNA 4QXCA 2GZWA 3SCFA 3JBG2 4Q4X3 1RUG1 2WSUA 1N3QA 5IVJA 3D5OA 2Z5WA 1MQTA 2P37A 1GLHA 1MS0A 1EV11 2W95A 3R05A 5JXIA 3I2DA 1KDKA 1LJ7A 1WW4A 2ILMA 2VNVA 3KD4A 3JBG1 5FREA 5LBBA 5CFDC 3HD8B 2CWSA 2GH2A 3IZOA 3ZKYA 2EIGA 3GZUC 3POSA 5DUUA 5I8SA 3MPPG 4YVWB 1H30A 1CD3G 2EXHA 3OGSA 1C8NA 4V1PA 4EN0A 3SNMA 3RZHA 5I91A 2E26A 3PUSA 4JHTA 2VTXA 4XZPA 2X29A 4AFCA 1X8MA 4NHMA 5JUVA 1PO13 4LKDA 1S0JA 1AX2A 1DQ1A 5A3NA 1FX5A 4LBOA 2VQAA 4XF3A 2OKXA 2JECA 1HDKA 4EN9B 3TEWA 2BRTA 1W2AX 1Y9GA 1JZ6A 2IZWA 3EQEA 1PK6B 5FV3A 1WLDA 3AYEA 1GANA 2G4IA 4CP9A 2ZAAA 3F95A 3PMEA 4K20A 1SFNA 1HV1A 1WW5A 2XUMA 2RV9A 4YSFA 4W8JA 1K3IA 3PUHA 1VRBA 4ATFA 1JI6A 4LQRA 5BNOC 1ENRA 2ZXQA 3J26N 1ULPA 1XSQA 4JZRA 4L11A 1SZBA 2E7AA 4QGMA 3O1UA 3NWKA 5FYTA 2GC3A 3LZZA 4HSJA 4NVPA 3K48A 2PQSA 3KS7A 3WP4A 1X9TA 4JGZB 2HWD3 4Q1RA 2QBXA 5E88A 4DFSA 4J1XA 1CX1A 2H0VA 2B9VA 2E51A 4XW3A 3ZMNA 4RSUA 4META 1DHKB 1NX9A 4U2AA 5E89A 5IFPA 1HQWA 4CUCA 2GNTA 3RYKA 2BEOA 1ZRCA 2R16A 1I3HA 1U5IA 1W0PA 1C4RA 4K1YA 4M01A 4QB1A 2WL1A 2D3SA 1A8DA 3KM5A 4NROA 3RFRA 4B3NA 4QPGB 1Q5OA 4XCBA 1JYVA 1ND2A 3IDAA 3TEYA 1T6BX 1IPJA 1R1ZA 2Q4SA 2XBO3 5IVCA 5C6CA 1UW8A 5JZGB 2PQQA 4MGTA 2JB4A 1QOSA 1ZRDA 4FPKA 4Q4Y2 3MUZ1 5FP7A 4FOQA 2B9UA 4QD2A 1CAXA 1NCQA 2GNMA 2HWB2 3DPRA 4XBQA 5A7QA 2VZUA 5LBEA 3B69A 4UBGA 5BXXA 5B2GB 1ULCA 3GZEA 1AVBA 1HB4A 2EF6A 4LHLA 4Q4Y1 2Y0OA 4D6QA 1PMHX 4XHXA 2PHXA 2ZGKA 3R4DB 4GULA 4E4ZA 4M3CF 2D3RA 1DCSA 1W6NB 2YPJA 1CJPA 1LHVA 4G3YC 4EZ4A 3MICA 4CU8A 1CGPA 1JZ3A 4DOUA 4ONUA 1YRZA 4WM8B 3ZXLA 5EJ1B 4P9XA 3SKVA 1GP5A 1PVC3 3ME2A 3T30A 2YBPA 3OJBA 4LUKA 5FY4A 3JXSA 3A23A 3KCCA 4CCCA 5CG8A 4CCLA 4QX0A 4R4XA 4ZZ8A 3BGAA 5KC6A 1RC6A 1VBD1 3KV6A 4BDVB 1QOOA 5A1FA 1WCKA 4NAOA 4QGLA 4RGGA 4JGYA 1KQRA 4XZUG 2Z69A 1VAMA 1K42A 2RMU2 2UY9A 1G9BA 3MEPA 5JMCA 3LWCA 1RUH3 2C5DA 5DDJ3 3POFA 3RWKX 4IEXA 2V4AA 2BW8A 1WMDA 2RS52 2RMU1 3RZKA 3VKLA 5FMBA 1WLCA 4QKFA 2EAKA 3MF9A 5BPXA 1XNCA 4FPEA 1F5JA 2RS51 3N9MA 2XJSA 1GKBA 5LWBA 2VZQA 3VBOC 4EWDA 3VBFA 2A75A 4WVVA 3BU7A 2DVGA 4IQPA 3ZIWA 4HANA 4E2GA 5IYYA 2QKDA 1U5YA 3IMNA 5KWRA 3CJXA 4FPCA 4UFJA 1S0GA 4IEOA 2HH9A 5DQ0A 3AFGA 3VBRA 3LEIA 4M3CA 5FZ8A 5L9BA 3S5QA 1XOYA 1E57A 2XQRA 3MHZA 2WWSA 4RHV3 2XJUA 4PF5A 5FXVA 1MS3A 1QEXA 2WNEA 1J83A 4YVWC 3OGRA 3TBDA 4ASMB 2PHRA 3GJAA 4AAXA 2FCUA 2R062 3M3QA 4KG0A 4RR3B 4ZS2A 4GB33 4U36A 5HXMA 1W9YA 4QXHA 2BV4A 3TNPB 2ZJCA 1LRHA 2R061 1SDWA 3SCGA 3K77A 4DZGA 1OURA 3BALA 5A70A 1PK6C 3N36A 3K75B 4AHXA 3VZMA 2QQOA 4ZHNA 1WGPA 1BVVA 1JBCA 1GMMA 2XHKA 3AKSA 4LBKA 3LB9A 1L3JA 2WZR3 4FOVA 2NMNA 2XDVA 4XJ8A 2XONA 1TNRA 2UU8A 4OYUA 2Y6KA 3HN3A 1FV2A 1WMXA 2QZ2A 4BQ1A 2CL2A 2D5HA 2ZEZA 3H8OA 1BQPA 5LRRA 2WSVA 2BYVE 4JGZC 4Y5SA 3U78A 4KBZA 1C5IA 1DZRA 1W8TA 2IXJA 3LIHA 4RS5A 4C90A 2P1BA 4B7EA 3ZXKA 1OQ1A 5FKCA 4DMIA 5LBFA 4NHKA 1SQ4A 4CP9B 4TTGA 3M4FA 1GZWA 3GCWA 4LHNA 5D1IA 4BQ3A 2MEV1 4QPGC 1W6PA 5JMOA 2XB6C 1OA2A 2WLQA 4ZY9A 1ODMA 5A6XA 1PHMA 5B4NA 3RWNA 2X5IA 4KL1A 4C1WA 4A7KA 5JZGC 4R9BA 5I93A 4ZPIA 4LOTA 2JKBA 3OUIA 4WVWA 3ST7A 1N47A 4AF9A 5FMOL 2DBIA 3V0AB 4Q8KA 3PTRB 4OLLA 1ZZ8A 3U4SA 5L36A 2AR6A 2Q30A 1WD3A 1O3TA 2QQWA 5DN2A 3FUOA 3WEZA 1YFYA 1ZRIA 1I1EA 3THCA 4QB2A 3RZZA 1NXMA 2WUHA 1QH7A 2ZKLA 4QKDA 3THTA 4ASLA 2VOWA 1G9AA 4TWTA 4J1WA 4WM8C 3ZVXA 2XUEA 5FDBA 2ZGMA 4EWAA 2O0OA 4NN0A 3WLUA 2YZ4A 2VUCA 3ZYIB 4HG6B 4QKBA 1V9U2 1NA1A 2RDSA 1Y9MA 2H6CA 3M3CA 1CAXB 4QHOA 4Y1UA 5JIUA 3DPRB 4XFBA 5JOWA 4QKNA 5HCHA 4A7ZA 3ZLIA 5GLTA 1S0FA 1V9U1 3B02A 3CIHA 3BYWA 2RS11 3OPZA 4Z82A 5ABJB 2XVKA 1VAKA 1LOGA 4HK9A 4LE3A 2WFF2 4NIGA 4EWEA 1WD4A 4NWVA 3MI8A 3DYMA 4MHRA 5CYYA 2V72A 2NYYA 2ZEXA 3PJYA 2XVLA 3K4ZA 3PDQA 2CV6A 3ETQA 4P9WA 4HPKA 1AR83 1E5IA 2A3YA 1ZBE3 3AMNA 4IE6A 5C5UA 2WNOA 5LA2A 5JCTA 3DXTA 4GKXA 3T08A 4D7SA 2I45A 4JGYB 5KBFA 1MZFA 2PXJA 2VC9A 2WDBA 2DVBA 4NRQA 4AQ6A 2WO7A 2OQ6A 1YC61 3JQWA 1UX7A 3H3LA 3WCSA 4NIDA 2DTYA 1RUC1 3G6JB 3LDKA 1RB8G 2B46X 2ARCA 2Y6HA 2WNUA 4PBOA 5EZWA 5FYYA 4A2UA 2QUOA 1REEA 2RM23 3RYPA 1ZREA 4L92A 4JKLA 5F6LB 4LO5B 4RR3C 4XF0A 1X50A 4E2QA 1NE6A 3RPQA 1YNAA 3D8CA 1QWRA 2QQLA 2WN2A 3S7IA 2IXHA 4OQ9A 2B45X 2ORZA 2JENA 2ARBA 4N9IA 3WNMA 1UXZA 2AH2A 3VBRB 3EBRA 2OW4A 1SG3A 4M3CB 4CXXA 2R32A 2B8MA 2C0ZA 2GMMA 4GALA 1OLMA 2DU1A 5FZ4A 1OI6A 3ZFEB 2W1QA 1OT5A 1SBDA 2GU9A 4GWIA 4YVSB 3GYDA 4FO9A 3WZ1A 2D93A 3ZR5A 3C7GA 5C3OA 4LHKA 4YM3A 1TNFA 1YYNA 4IGOA 3ES1A 4NWWA 4B4PA 4BIOA 2YXSA 1NG0A 3WNLA 5A3LA 1JYWA 1J58A 1FV3A 1WA6X 3UETA 1AF9A 2VVEA 2WFPA 3FBMA 4RGAA 1LGNA 2GAUA 1FNYA 1Q8PA 2Q8EA 3ECQA 1DQ0A 2VZRA 4HKWA 4K6BA 4TN7A 3PTYA 4XXPA 5C33A 5DAXA 2A6ZA 1O4ZA 5DXDA 4CE8A 2QQPA 1WKYA 1JS9A 4QM9A 3PVEA 5DG2A 2WINB 2OIIA 3PU8A 5ANQA 2W08A 3Q8FA 2WFF3 3I2IA 3N7MA 4XJWA 4CPBA 2ZZQA 3WW2A 4FAGA 1SCSA 4OVEA 4D3WA 3HQXA 1ZZBA 1MS9A 5FPUA 4YZ1A 4DY5A 4YG0A 5LW9A 3POGA 3S30A 1JW6A 4XCAA 4HSLA 1ULGA 3VD3A 4DRRA 1KFUL 2GN3A 1LEDA 2YU2A 4AFDA 3MDPA 4BK5A 4CU7A 2HJIA 4R52A 4CEWB 1RL3A 2VUDA 2XQXA 1W6MB 4QWNA 4RS5B 3FLRA 3H42B 4IGPA 2IVJA 3VKMA 1J1TA 1R093 3AB0A 1CPMA 1GZWB 1G7YA 1AXKA 5BNNB 1LU2A 2RJLA 1J3RA 3WG3A 2LALA 4NMIA 1Q56A 1IGOA 1W6PB 4HMZA 4DXZA 1AUYA 1YQ2A 4V2VA 4BQWA 1N1VA 1W06A 3LSDA 4W4ZA 4A3XA 5C71A 1WMFA 4IEWA 3EO6A 3DYPA 2VL4A 3JUUA 3LFIA 1IHMA 4ATEA 1PVXA 1RUI2 1H1IA 2XWJB 5FY1A 2ES3A 4XAEA 3C2UA 1C1LA 1RHI2 3DPRC 4LBQD 5GLVA 4RGKA 2FCVA 1ASJ3 3CZUA 3KT7A 5B4XA 2ZOEB 2UWCA 5G04L 2ID4A 4JDNA 1RHI1 5ABJC 5FP3A 1X82A 3I2JA 2XWBB 3CKHA 4Z92B 2ATFA 2R1BA 4XUQA 3NV2A 2EXJA 2J1EA 5ANNA 2C24A 5FZDA 2BGPA 3D0JA 1U0AA 2Y6LA 4BK4A 2Q1ZB 3Q9OA 2PHTA 3QH6A 4R9CA 3ZXJA 5F32A 3MLKA 2ZBJA 1RUOA 3J8F2 4EROA 1UIJA 1NA1B 2X10A 4W6XA 4LO4B 4CEYB 2DU0A 2D5FA 5T50A 2F4LA 2J1RA 2LM3A 3J8F1 3PURA 4LKFA 1XYPA 4K21A 5AC93 1RMU2 4FTSA 4JGYC 4MO3M 4LA2A 5FLJA 3TEZA 4ZS3A 1VBC3 1RUJ3 3AJZA 1RMU1 1TVGA 2CNAA 3WP6A 1C5HA 3FHIB 3C8XA 3PUQA 1OBNA 4IV1A 3H9AA 1TME2 1VBB3 2P4EA 1SCRA 3ZKUA 4DQAA 3PVBB 1BBT3 3HVDA 5EYYA 3WHTA 4DEQA 1UMIA 1CZVA 3MUY1 4Q0PA 3ZSKA 1TME1 4DO0A 3NKTA 1JODA 1VBE3 2W1SA 3PUIA 4PIZA 1HXS2 1OSGA 3B00A 1O4YA 1CESA 3VBRC 3HBZA 3TRSB 1PO22 3ZFEC 1Y4WA 3NRUA 1UU4A 4JDOA 1HXS1 4LK7A 1HLCA 2E53A 2QQVA 4XABA 4YVSC 5IVVA 3BIWE 2GC0A 1MEC2 1PO21 2VUJA 2WZ8A 5FJHA 5IJRA 3V56A 3MLLA 4XOGA 2DDUA 1CJDA 3CDZB 1V6IA 5F3IA 2AACA 4UF0B 2WT2A 2R0HA 2B5HA 2JDMA 3MIGA 2D98A 1MEC1 3GZAA 5FMCA 2A3WA 1SBFA 1SDDB 1W05A 2A6WA 2ZGUA 3QH7A 5DZGA 2Q8OA 3VL8A 1H2MA 2W46A 2XKOA 4AYUA 1VJ2A 4B8EA 3AKTA 4KQ7A 2Y6FA 1BEV2 4W65A 1GWMA 3JCIA 2DWRA 5CU1A 2R0FA 3HR9A 4LBNA 3WR0A 1OMIA 2PHUA 4QU1A 2CDPA 3F2ZA 1SACA 3GDBA 1BEV1 2QNKA 3E6BA 3NL1A 2VCCA 4O9EA 4CVUA 3TYJA 2GC2A 3ZM8A 4COVA 3M2MA 3I54A 1UKGA 3LQCA 2ZGPA 3E5XA 1URXA 5FZ3A 1FXZA 5FZLA 4CCJA 2BOIA 3IT8A 2MHFA 4DRVA 4XEZA 2YC0A 4HKOA 3CL1A 1OA3A 1UY0A 2ERFA 1VMFA 3SCHA 1MS4A 2XJRA 4IDZA 3UV9A 2JX9A 1S2BA 1YCIA 1JUIA 3BKZA 2HWE2 4CCKA 4GH4B 4H14A 1AHSA 4CEWC 2VMDA 4IETA 2WS92 4RS5C 5A7PA 1ZM1A 5LATA 2CGPA 1YFXA 3JB4C 2D6OX 5EWSA 5L19A 2HWE1 1RUD3 1WW7A 2AENA 5FXWA 3WCRA 2A7AA 3IIIA 2BNOA 2WS91 5GKAC 4MXWA 5BNNC 3AP6A 2VO5A 4CZSA 4LOSA 1I5ZA 2W1WA 1TZOA 2BQPA 4Y20B 2R042 4DEVA 1AR92 2XHNA 1XRUA 3FLPA 5JSPA 2AC1A 3ZXEA 1XE0A 4F3JA 1IG0A 1UMZA 2R041 4XQDA 3VB9A 1AR91 1PGSA 2F6BA 1F8VA 5D21A 2RDNA 1C28A 3IWZA 5CZKA 3RMYA 5JR2A 5F3CA 2OVUA 1BVP1 4N7UA 1VRH2 4XUOA 4B1LA 5JAXA 1SBEA 2VXJA 2JG9A 5FZ1A 1RVF3 1R1A2 2Y64A 4IERA 4LBQA 4GQ7A 1HIXA 1PX3A 5BUVA 2R30A 4LIUA 1VRH1 4GD4A 3HEIA 2JKXA 5FP8A 1R1A1 3M8LA 1AL23 1TMF1 1V6NA 1XU1A 2CSGA 3NO8A 4TLFA 4C1XA 1LCLA 2PTMA 3KB5A 1GICA 3SEPA 2ZCWA 5A6QA 3L9JT 1COV2 2PHWA 4P00B 1NA1C 3RJRA 4JKMA 3H0OA 3H3UA 3JD72 1H8VA 4CEYC 2WR9A 3NVCA 4UI9L 1I6XA 3IPVA 1COV1 2A6YA 2JEMA 3PIGA 2EICA 4ISQA 3SH5A 4IV3B 3JD71 3D82A 5C70A 4FOYA 3ZYBA 1RUNA 5GALA 2PLV3 1PM4A 1POQA 1FMD2 4COWA 4LBLA 5K0UA 3THPA 5KR7A 1O3QA 1W2NA 4YLZA 1FPN2 1NY72 2Q5TA 4QX7A 1QMJA 4KWKA 1ZBA2 1ZZ9A 3NAPA 3OY8A 5KXEA 4Q4W3 4Q4X2 5F2WA 3VBSA 4HKLA 5FYBA 5JOZA 1BYHA 5G05L 4FPLA 2PHDA 1NY71 2VAUA 3PVOA 4BM8A 5J3UA 4AVVA 3LFMA 1Q8VA 4OCTA 2E6VA 4Q4X1 1O4TA 3BTXA 2AZ5A 3RZLA 2D40A 4WM7A 1BHGA 1H6XA 1XPWA 3NJZA 3OUHA 4L9BA 2OQ7A 1H9WA 4XACA 1ZYBA 5IK8A 3MLJA 3UKVA 2NQYA 5CAZA 3IDBB 1QDCA 5EPAA 1PO12 1AYN1 4PJYA 2IXIA 4NHXA 4IV1B 4XTMA 1PO11 3O0WA 2VH9A 2WZEA 3I2KA 5FPAA 3ZPYA 5CFCA 4NAMA 4TYSA 1QJEA 4AVTA 2Q1MA 5GZEA 5JSRA 4AI1A 1OQEA 4FBFA 3SMHA 3BOPA 1V6MA 2JG8A 3E6CC 1S4CA 4NOTA 2TNFA 3HWJA 5FWJA 5GJ6A 3ACLA 3I8TA 4KU8A 3O12A 5A33B 4BLIA 4CU6A 4BH9A 5FBJA 2BVVA 4JHZA 4AHYA 4CUAA 1BMV2 4PDWA 2VZSA 1DGRN 2XVGA 1LOEA 3P5BA 1GQHA 1QGLA 3RYRA 3USSA 2HWD2 2V4VA 4KGQA 5T5LA 2OZJA 2A5ZA 5A3PA 2A3XA 1H4HA 1BMV1 5F5IA 3RMXA 2LTNA 4KWJA 3LDBA 4XILA 3WOGA 5CADA 2GNBA 3LEKA 4KG8A 2HWD1 2BVBA 3NW4A 4QXBA 3GALA 1HJGA 4BXFA 5KC5A 4S2GA 3B9CA 2YGLA 4Y5TA 4QB6A 1S55A 4GH4C 2Y8KA 3NQHA 5L73A 4QX5A 1R083 2XBO2 5APAA 3NSTA 4XBLA 1XU2A 2VBBA 4NRPA 1YQ8A 2D97A 3MFAA 5FYZA 1QF3A 5KHIA 1KS5A 3O1TA 5FPVA 3VBHB 2ZGQA 2XBO1 3RG0A 2KR2A 2OXBA 1FMD3 2ENRA 2VTXJ 4UFIA 5FPZA 4E8DA 1UOGA 2JDPA 3H1WA 1GU3A 4ES9A 1RXFA 4LA3A 3O1SA 1LGCA 1ZBA3 2GC1A 2YYOA 5F5QA 2XLFA 4YGEA 2Z42A 4BOWA 4F8AA 4CTEA 4OHYA 5F5AA 3EB7A 1V6OA 4MOAA 4I02A 1A3KA 3QLQA 5KHHA 4URTA 3WX5A 1PVC2 4LLOA 2XLGA 2Y0IA 3FX3A 3WQBA 1TEIA 2CGOA 4MXWB 4IUGA 1OFNA 2VQ0A 1PVC1 4LTAA 3POWA 2CTVA 1ENQA 4BB3A 1ALYA 3NJYA 1DZTA 3EXUA 2QQUA 3PMSA 1HW5A 4FPHA 5J36A 1ZZCA 1CR7A 4Y33A 2JDYA 1RUH2 5DDJ2 2ZHKA 5C4WA 3I2OA 3WDWA 3LEMA 4S2DA 1ZVFA 1H1MA 3HOBA 2VBDA 3IKWA 3WD5A 1UZZA 1Y43B 1RUH1 4IV3C 5DDJ1 3UNPA 3H1YA 3AK0A 1ONAA 4JX0A 1Y9QA 1VBA3 1WMEA 2VZTA 4OMDA 3NKGA 2EALA 1VR3A 2RR13 4L2NA 2RE9A 3O0XA 4FOWA 1F35A 4MZUA 5FUPA 1QU0A 3OEAA 2VMCA 5E1RA 2NP0A 5H9PA 3HN1A 2XL9A 2CDOA 3WXPA 3WDUA 4FFFA 1FOD3 3IPVB 4RHV2 1BKZA 3TWIA 2EAAA 5I0DA 4XVHA 2BZDA 1K5MA 4RFT0 5EHDA 2ZHNA 3VD7A 4NO4A 3WT3A 3T0DA 4RHV1 5A3WA 4A45A 4EN7B 4GB32 2VQTA 5K0UB 4K9SA 2JDUA 4D6SA 1W6QA 2LROA 3K51A 2JD9A 1O8SA 4Y1VA 3TN93 4CU9A 5LEKA 2YC2A 3NAPB 3OY8B 3OGVA 4IV1C 4GB31 3RDIA 1HV0A 2C9KA 1HB1A 4XF9A 5IHRA 4NPMA 1US2A 5BNQA 1Z7S3 2VR4A 2PA7A 3ABZA 1QJY3 2TUNA 2FHRA 3E5UA 5C9AA 3BTYA 2IXCA 2HWB1 4QPIA 2FDHA 2HLEA 4WM7B 1YIPA 4B7KA 4DXSA 1A8MA 3RZGA 2WZR2 1N1YA 3GHNA 5FY7A 5DMYA 1XNKA 4YZ5A 5F2SA 2VTFA 3OOXA 2CY6A 2P17A 4M0HA 4NIIA 2WZR1 3BTAA 5C3RA 3CF6E 2RS33 4IEZA 4Q0VA 1OF4A 1U12A 1S1AA 5L7OA 4K3UA 3N3HA 3ZDVA 3WQ0A 2CGNA 3WNNA 4ZKTB 4B4QA 4LPLA 4XPVA 1ODNA 4HVRA 5D8AA 5CFCB 2OT7A 3ZYGA 3NV4A 1ZA4A 1GBGA 5CB7A 1G6NA 1EPWA 2GP5A 4N53A 2JG8B 3I59B 3KLSA 5CA6A 1QNWA 2WA4A 3A4UA 3WQ1A 1AYM3 3I3DA 5F3GA 4CRQA 2ZS6B 3SQOA 4JVAA 2W92A 4XJUA 4R4ZA 2UYAA 5T5OA 1UZWA 4CDQA 2OX0A 1QJX3 4Y22B 5FPXA 1OD5A 4PDWB 4O7XA 3M70A 1H9PA 4BIFA 3T2PA 4RD7A 2OYZA 3VBHC 1IS4A 3AL5A 2Q0AA 4QQLA 2NMOA 2X09A 4I0AA 1OA4A 4OULA 2RG4A 5FAXA 4OHZA 4P08A 2JE7A 4LMFA 3N9OA 1IKPA 3VDDA 3C7HA 1VMHA 4BJ0A 1NLQA 1VP6A 3KV4A 2UY8A 3AP7A 4YPJA 5SV5A 2A70A 3DUIA 3HBKA 1C8M3 4O9GA 2D6PA 2WYFA 2YFZA 2ZGTA 4AEMA 4CYDA 4D8MA 4EV0A 5FQ0A 5LEJA 5BV6A 4XMIA 5LCWL 3THDA 3CBNA 1POV3 1YEWA 4MVTA 2JDHA 1HN1A 4AR2A 3ZN5A 1L7QA 3PNAA 4Q4V3 4G9SB 3AXDA 1O59A 1D4M3 1NYWA 5FLIA 1UYPA 3POBA 5I8YA 5C3PA 5FJKA 3AP5A 4TXWA 2YG0A 4A41A 1MQTB 2WWJA 5GLZA 4ZXEA 4XFFA 4FCAA 4QX8A 1NQJA 5L9VA 2VMGA 1W8FA 4AI2A 4P9JA 3VDCA 3AYCA 4YG6A 1PIV3 3OGJA 3QOPA 4PIXA 5JDBA 3MW2A 1AR82 3ZXDA 1ZBE2 5IFTA 1XNTA 4TSVA 4HETA 1VE0A 3KQ4B 1SLAA 2WT0A 1AR81 1ZBE1 3E5QA 3AC0A 5A3OA 1UYXA 3VD9A 2J1UA 3W20A 3NJVA 4D7YA 3KMHA 1REFA 4LJHA 1BJQA 4KU7A 4XF1A 1DYOA 4YFWA 5C4WB 4LKEA 1OKOA 5IK7A 2RM22 1RJ8A 1WA4A 4N90A 3T3YA 4XYXA 3IAQA 4UW5A 5DAQA 4QXKA 5CISA 1UZVA 2RM21 4PCRA 5K0UC 2ZGSA 1YQCA 4XC9A 1RTVA 3VBUA 1NCRA 5LB6A 2C9AA 2EIBA 3NAPC 3SH4A 5FR3A 2BBVA 1C57A 1VBD3 1Q3EA 3W9AA 3GJBA 1NQDA 2DCZA 3WF4A 2P5BA 3NV3A 5FY8A 2D44A 3PJQA 1NOVA 4MGKE 1F4AA 2JDNA 2W5FA 5GZGA 1SFYA 4BZ4A 1LOAA 2PHLA 2XJPA 3URFA 4CUBA 4AVSA 4WM7C 3AYAA 3A0KA 2FMDA 4DINB 2CWMA 1K5MB 2WQZC 4KI5M 4JC1A 4Y1YA 3OF1A 1W9TA 3AP4A 2LUWA 1X33A 3ZYRA 4AAPA 2I2SA 4MV2A 4ZU4A 1ND2B 1OVSA 2QQMA 3I7DA 3U37A 1KD7A 1W6QB 1BK0A 2B7YA 2VW2A 1LHWA 2SBAA 4Q2FA 5HI0A 1DF0A 2ZKNA 5ERLA 3U1XA 5LA1A 4N7IA 2NZ9A 1W39A 5FZ7A 5CG9A 1WLTA 3K4AA 1NCQB 2NM1A 4CA9A 2BGCA 3FZ3A 5CFCC 2FDJA 4R8HA 5J7MA 2WC2A 5FTTC 4UW6A 4E4HA 5IVEA 2DFBA 5IVFA 2FBEA 2JG8C 2IWGB 3IBMA 4AXOA 1Y7BA 2TBVA 4HOOA 4Q0QA 4BXSV 1H4GA 1VLNA 3FFZA 1UIKA 4FPFA 4AI8A 5A80A 3OEBA 5BNPA 2BBAA 5JIAA 2Y26A 2G9ZA 2WFF1 5L7OB 1YUDA 3BB6A 4PDWC 3SH3A 3OBTA 4YW1A 4CP2A 3ON7A 1UCXA 1QJU3 4PI0A 1YI9A 4BLJA 1GWLA 5D8AB 4AFBA 3MW3A 3MV11 5FPBA 4CDWA 1R092 2H6BA 2IXLA 3NJXA 4NPRA 4N53B 3U0ZA 4YZ4A 1J3PA 2DYCA 4E9KA 3MIBA 3T2QA 5K9YA 2EXIA 3PUAA 5K4LA 2QQNA 1R091 3CZJA 1PNGA 1KEXA 3SKJE 4LHSA 4CDQB 2PN5A 2VVDA 5HBAA 1GZCA 4SLIA 1H6YA 3GXUA 1Q43A 2OA2A 3VD5A 1XXNA 3VBFB 4FAHA 3HPNA 3PHMA 3SITA 4FSJA 1ASJ2 2QVSB 1NE4A 3GBWA 1UPIA 2JE9A 3ACIA 3H7YA 3ZDSA 1KDMA 2HEVF 3KWVA 1VMJA 4YW7A 1EUUA 3HJRA 4QU2A 3VDDB 1ASJ1 1U5ZA 1MQTC 1K5JA 1RINA 2C1FA 3B94A 2ZGNA 1AX0A 5JOYA 4YW6A 4XURA 1QDOA 2BNMA 3K3NA 5FQ0B 1G8WA 1S2KA 2AREA 2WNVA 3KCYA 4I3PA 4PLMA 3X29B 3FHAA 4IW3A 3DGTA 2JDZA 2HKXA 4B29A 2W68A 4E4DX 3I3BA 4KMQA 1GV9A 2FZ2A 4LKSA 2ZX1A 2QFEA 5KXDA 1DYPA 2A6VA 2H0BA 1JOPA 3L2YA 4L8QA 3SEEA 3LF7A 4X8NA 5AC92 1W99A 3FHQA 4MG2A 1SLCA 5FKBA 4AI0A 5FXXA 3M3OA 5FYMA 3VLBB 4L97A 1GR3A 1RUJ2 1VBC2 1JYNA 5DUVA 5AC91 5LY1A 1AR73 1JHNA 1JOBA 4UFMA 4QQPA 5C4WC 1Z0HA 2B39A 2JXAA 1VBC1 1RUJ1 2VZVA 4AW7A 2E32A 3RZMA 3BU0A 2ZX4A 5A6ZA 1VBB2 1SMVA 2X53S 1ULOA 3CQOA 1BBT2 3IAPA 4AEKA 4EYUA 4LLFA 1XBFA 1WCQA 1VBB1 3ENRA 2WQ4A 4OUEA 1BBT1 1VBE2 1DQ6A 1W03A 2D6KA 4RYDA 1ND3A 3H8XA 5FZHA 5SV8A 2ZMNA 3SHRA 4IESA 1LHUA 1AJKA 1VBE1 2J42A 2RS13 5EJ3A 1OFSA 1H2KA 3A0NA 4S2FA 3WF2A 3OSDA 3OCPA 1XB9A 1K5MC 4OHWA 2A71A 1DYKA 4JCKA 3ELNA 5KHKA 3KF3A 5BYNA 3C7FA 5LA0A 1JYTA 3KV5A 1CAWA 5FIXA 5FZGA 1ND2C 3RVHA 1WW6A 2X5IB 1FT9A 2SLIA 3T1MA 1NCRB 3VBUB 4L0PA 4YW2A 4HZFA 4O61A 4A6SA 1NCQC 3KQRA 1HRI3 4AGGA 5FYUA 3WNXA 1UL9A 5K8SA 4UOJA 2RDQA 1K12A 3ZPOA 1RUI1 5C8CA 3WVJA 2P6HA 4PQQA 2IC1A 1ULEA 3M7AA 2BFUL 4JRAA 1ENXA 1RUC3 2GALA 2N7GA 1OH4A 2PHFA 2DCJA 3QBQA 1TQ5A 2VOVA 1IZ3A 3I3EA 3LE0A 3N7LA 4D0QA 3B7MA 1F2NA 2XH6A 5I8TA 5FXZA 4XFIA 4V2WA 1NLRA 4W6WA 2GMPA 2VG9A 1IS6A 1W2TA 4LO8A 3WUDA 4BQ4A 5L7OC 4XTPA
chains in the Genus database with same CATH topology
3JU9A 3VL9A 4YYOA 4COZA 4Q0UA 1QQP3 5D8AC 2G9FA 1Y3TA 4BE3A 3GBGA 1SLTA 1RUD2 4XE9A 1I9RA 4N53C 4XBNA 2R073 4I09A 3L2HA 1RUD1 4Q26A 2QDRA 2WA3A 3AP9A 1Q8SA 4AEJA 2GH8A 5BNPB 4CDQC 4Q1PA 4BHPA 2BPA2 1UAIA 4YGDA 3ZN6A 2HWF3 1RUE3 4HPKB 2PAMA 3VBFC 4D7TA 5GZCA 1W0OA 1OPOA 4DY3A 3FC0A 1RVF2 4JAAA 4LUMA 3VDDC 3UJOA 3BCWA 1DFQA 1WLWA 4K40A 1RVF1 4LNVA 1AL22 3WP3A 5JLVA 1MVEA 4XFAA 1EY2A 1W6OA 1LULA 1JXNA 2WNUB 1GNHA 3J9SA 3P3PA 4FTSA 1ULFA 1F5FA 3WW3A 1YHFA 1V6JA 4AI3A 3AM2A 5FMOS 3AKPA 5TSWA 4PLOA 1B35A 1N3PA 3R4UA 4AWDA 2VUAA 3AMMA 2PLV2 4IEPA 1Z78A 3HT1A 2FZ1A 4AK3A 2B42B 4TZDA 4JRLA 1YFWA 1CQ9A 2WNVB 2QZ3A 1NLSA 1Q8QA 1YLLA 2PLV1 2VXRA 5IT6A 4Q4W2 3AX4A 4IEUA 4MGYE 5T54A 5ACA3 4MGZE 4Q4W1 3KT4A 4UBHA 1PGL2 3RS6A 3AYDA 4IEQA 4XHBA 1DZQA 3T2TA 1S0CA 1S0IA 1QY4A 3CNAA 3V0BA 4HN1A 3ZFGA 4AQ2A 3KCXA 4HFSA 4XMAA 3FWEA 4NHLA 1BXHA 2XG3A 1HRV3 3IIAA 1DGLA 3AMPA 1U5XA 2ZACA 1AZDA 3VZKA 4HBNA 1YJKA 2RHPA 4LULA 4DNYA 3FMGA 1WCSA 4BYYA 5EV7A 4AVBA 2X5IC 5JR7B 3VBUC 1NCRC 3MIEA 2IXKA 3V65A 4OHVA 5JSOA 3H7JA 3LSEA 3W59A 1X36A 5GM0A 2G9GA 2VECA 4H3WA 4GA9A 4AHWA 2R1DA 5J98B 1UKRA 1CAWB 4JV4A 1SLLA 1HQNA 4AFAA 2P3KA 3ILFA 5A32A 4HN0A 4FPYA 2XLAA 1MZEA 1C3HA 1WBFA 4CDUA 1R082 3EHKA 1AL0G 2HEWF 1EAH2 2P3IA 5C8CB 2FMYA 3GNEA 5F9TA 4Y1XA 3H1MA 3LOIA 1R081 4UW3A 4HVOA 3O0VA 3FBYA 1DDLA 5BNPC 2BWCA 5DZFA 3ZN4A 4HLTA 1FMD1 4ES8A 1WUVA 1AXZA 4LO6B 3MZHA 1QXRA 1FPN1 2ZHMA 4Y1ZA 1KS4A 1ZBA1 4PIYA 3VKNA 4BA6A 4C0BA 1W2UA 1FATA 5LRSA 3RJ2X 3ZYJB 4I0WB 2ZGLA 3O14A 3HAGA 1OLQA 1RITA 5C8WA 4QPGA 2E7TA 3ES4A 2WNUC 1MS1A 5JZGA 5F1RA 5CVRA 3WP5A 2ET7A 1DQ2A 1OOPA 3ZN6B 4YNIA 1WCDJ 5T55A 1ZX5A 3MIHA 1YI7A 5JI9A 4XIOA 1MZ5A 1YO8A 3B3QE 1KFXL 4LR4A 1VBA2 4D69A 4OFGA 2TEPA 1YXWA 2RR12 2WNVC 5EYXA 1VBA1 1W6OB 1SEFA 5EFUA 1O91A 4XFHA 4Y5Z0 5E16A 3BODA 5H9SA 4GMP3 2RR11 5DG1A 1POV0 4AVAA 1DBNA 2HWC3 2PELA 4FTBA 5J09A 4WZFA 1B35B 1FOD2 1OHFA 1LODA 1Q8OA 1J3QA 4OI2A 3D0SA 3QD6A 2VNGA 2VW1A 2EVXA 4F83A 2O1QA 3UJQA 5JOXA 4P14A 4LT5A 3O7OA 1CAUA 4N43A 3SLIA 3TN92 1EAH3 3ILRA 3GBFA 1TMF3 4Z8BA 1OPMA 1T6GC 4YZ3A 3ZSJA 4F7ZA 1QOTA 3P3NA 4XJZA 3TN91 1Z7S2 1QJY2 4OI1A 4XQWA 1TE1B 3ZYPA 1LGBA 2XJVA 2K0GA 1Z7S1 1QJY1 2I07B 3ZFGB 1RUF3 2OUJA 4Y4YA 1NZCA 3RNSA 4GWNA 3GZTB 2PAKA 4DS0A 4OUMA 2RS32 1ZRFA 4IEVA 3WUCA 3DV8A 2QJVA 4K7JA 2GN7A 3ASIA 1IOAA 1H2LA 2UWAA 3MW4A 5FOBB 2RS31 4AG4A 3WG2A 3WY6A 3QCWA 3DF0A 1RIRA 1QJZA 2GMEA 1LEMA 1BCXA 2VPVA 3INAA 4E4SA 4H55A 3ZMOA 3VV1A 1AYM2 1S0BA 2XGXA 3LKJA 1KJRA 5C8CC 1AYM1 1QJX2 1QNYA 3N4MA 2JG9B 1XYOA 4LBQB 3ZFFA 3TB0A 4OI0A 1KRIA 1X8EA 1AYN3 1ULDA 3MGUA 1QJX1 3KZ4C 4ORFA 2RJKA 1JYCA 4X6RB 3R0RA 1ZNPA 3DL3A 3WG1A 2AUYA 4EN6B 1DG6A 4WV8A 5T52A 1S0EA 2MNGA 5A32B 2KM2A 4LEJA 4OZXA 4YFZA 1X7NA 1C8M2 4CDUB 4MSVA 4M0NA 1C8M1 2DCKA 2VOKA 1KJLA 3VHRA 2DV9A 5FCCA 4FP2A 1OLRA 1VAVA 3SXWA 5FOJB 4Q4V2 3EJKA 1D4M2 2VW0A 3WDTA 1POV1 4XJAA 4UW4A 4Q4V1 3VBSB 1D4M1 3I4IA 4D94A 3V0AA 1UZYA 3OTFA 2JICA 1LENA 3MFCA 1AR63 5KHGA 2ETEA 4M00A 1PIV2 3WG4A 3H3ZA 4M3CE 2XJQA 4MH0E 1YFUA 2UURA 1CPNA 1LOBA 3GHMA 1PIV1 4LBJA 1J1LA 5DUXA 3VKFC 5J96B 3ALQA 1QXJA 4P9YA 1D4VB 4KH9A 4AVCA 1OOPB 1H1AA 4YW3A 3MIFA 1RUG3 1B35C 1EV13 3FJSA 3E97A 3JBG3 5ABJA 3R4SA 1LTEA 2YMZA 3M3IA 2ZX2A 3VZJA 4COUA 3ZX7A 3VGIA 1M06G 2QDNA 1KITA 4G4FA 2KXLA 1XE8A 4ZXKA 3AXEA 2YV8A 1VBD2 3G7DA 1DIWA 4HL0A 3TAYA 1RJ7A 1V00A 2W52A 4QQ2A 4GWMA 4RQPA 3ZSEA 4AQSA 2MPFA 1N1TA 2P34A 3ZFGC 4Y24A 5K7PA 5GZFA 1S0DA 4FPJA 4YM2A 1CAUB 2ZX0A 3FLTA 4N43B 5F6KA 2DVAA 5A3MA 2AGSA 5DUWA 1PM7A 3N7KA 2R49A 3VZNA 4Q27A 1PNFA 3VZOA 1LU1A 4JTNA 1B09A 3HT2A 5AFBA 5AVPA 1M4WA 2X8KA 3AKRA 1SLBA 1G86A 1RGSA 2OZ6A 1CIWA 4S2HA 2OPKA 1O5LA 1BZWA 3USUA 3ZFEA 1MR5A 4WBBA 3ZSMA 2ZAHA 4YVSA 4XETA 1O7FA 1OQDA 4LE4A 4MYEA 2XPJA 1D0HA 2JG9C 3AKQA 3V64A 4FVVA 1CN1A 5KHJA 1QJU2 1AJOA 1D2QA 2ZHLA 1PMIA 4DPNA 4OUSA 5T3NA 4Q0SA 4Z1VA 3ZXAC 4I3GA 1QJU1 3LOBA 4Q4Y3 2ARXA 4FPGA 2HWB3 1G9CA 2Z79A 3ZSLA 2DF7A 4QT6A 2GDFA 4CDUC 2DVDA 4YW4A 1HQLA 4KBBA 3VHPA 2ZX3A 1GSLA 2ZMLA 3ZFFB 3WV6A 3WW4A 4W6YA 2CYFA 4P9GA 1VIWB 2VNRA 5FFOC 3DKWA 3VBSC 4I2OA 2UWBA 5FO8B 4YRDA 2PYTA 2FQPA 4CEWA 5HCFA 1W6MA 3AZWA 4BCUA 2MEV2 1IPKA 1WBLA 3N35A 1XYNA 4X6QB 5BNNA 4KNCA 2NPIA 2RMU3 4E2SA 4FTEA 4FXKB 5LK7B 3IDCB 2YUEA 2JD4A 2RS53 4IEYA 5FO7B 4P5HA 4I01A 4NR1A 4R9DA 4WZCA 4COYA 1HX6A 4Z2WA 1LOFA 1OOPC 3HMYA 5I0UA 3KT1A 4YM0A 1PZ9A 1AR72 4MGIE 4AQTA 3RSJA 4C0HA 1UU5A 2P2KA 2ZTNA 4FQ4A 5C9AB 1IKQA 4INDA 4QPIB 1AR71 5CIRA 2BUKA 3VN4A 1QH6A 1UD1A 3W58A 4YARA 4X8PA 5GZDA 3UL2A 3QACA 4MX3A 2PAEA 2WIIB 3LA2A 2IFWA 4K8FA 3MPBA 2Z2SB 2O8OA 4KGGA 4Q8LA 2R063 4CEYA 2RS12 1N3OA 3CU7A 4WVMA 4XXAA 2WLPA 4XF4A 4BPZA 3LCPA 5JI7A 5I0TA 3VZLA 2D43A 4PLNA 5JWPA 2P3JA 4MXVA 3S7EA 5AVAA 3U10A 4B4RA 2JJ6A 1AX1A 4GIQA 4N43C 1EP0A 2ZA9A 1UPSA 1AXYA 1HRI2 4IXLA 3H50A 3AZZA 3TOJA 4PQ9A 4RQPB 1HRI1 3APBA 1RUC2 4QMAA 1ENSA 1REDA 5JPMB 2WJSA 3AZVA 2MEV3 5HCAA 3HIFA 2W0XA 1N1SA 2YDEA 2R6QA 4FQZA 4FP3A 1QQP2 5CNAA 3BOWA 1GYKA 3JQXA 1DU3D 3S6PA 1QQP1 1GZ9A 2R072 3T1LA 3R6SA 2WT1A 3USUB 2D6LX 1JN2P 2R071 4PBPA 1GQGA 4QPYA 4XIKA 1D0GA 2W39A 3ZFFC 2HWF2 1DQ4A 1LHNA 5H9RA 1RUE2 1XE7A 1YWKA 4L99A 4CDXA 1H8TA 4WVZA 2HWF1 4BMBA 1RUE1 2F4PA 3UKTA 4LBMA 1DLLA 1V6KA 2YGMA 1YJLA 1PGW2 5HXVA 1V9U3 4Q29A 3IM0A 4AEDA 4GH4A 4IL7A 2HYKA 1UU6A 3B93A 1PGW1 3LGRA 1LESA 2YY1A 3WINE 5AFEA 5CBLA 1QXPA 3CJIA 2BTVC 3PLQA 4RL7A 5FBZA 1UF2C 3AZXA 4Y20A 4QHBA 5HCBA 1ZRRA 2VVFA 4SBVA 4YZ2A 2DUPA 2A6XA 5CFDA 3M1HA 1D2SA 1NXD1 2HEYF 4RA0A 5C9AC 1O5UA 4QPIC 4OHXA 5ACA2 2ZPXA 3BPZA 5KXCA 3WDYA 5T5PA 1CAVA 3RI8A 3VHNA 3VKOA 4EJRA 5ACA1 3S0MA 2OUHA 3MYXA 2VNOA 4CP1A 2XL7A 3OD0A 4XQ4A 3OYWA 1O3RA 5J37A 1HRV2 2ZZJA 2E7QA 5IK5A 4IV3A 5T5JA 3NV1A 2VMHA 4YW5A 4AGVA 4YM1A 4E27A 1HRV1 4XJ9A 5JVVA 5BNOA 1XNBA 3WW1A 3OGGA 1O3SA 2AYHA 4GMP0 3U4XA 3WDVA 1JOJA 4WVMB 4YGCA 1IS5A 2NLRA 3FE5A 4I30A 4RQPC 1CX4A 3M3EA 2DFCA 3VUOA 1FAYA 3MIDA 2A73B 4CDWB 2NN8A 5EXOA 4R9AA 1XNDA 4MUVA 2DVFA 1FI2A 4ZU7A 1LECA 3GF6A 3H8UA 4QGNA 3RI9A 2EXKA 1APNA 4BWOA 4MLOA 4XFCA 1AL21 2QCSB 3TNQA 2ZABA 1KXGA 4EN8B 5BY5A 4H7LA 3POYA 3AMQA 3O5SA 1YIFA 2DCYA 3LAGA 2VY0A 1LHOA 3RQ0A 1DQ5A 4FPOB 4H7MA 1JH5A 1F31A 5A33A 3UK9A 4CP0A 4N9HA 1ZZ6A 3OBRA 4HT1T 2WKKA 1XQNA 4YGBA 4XFGA 1PZ8A 2XJTA 4E4DX 3CLPA 1RB8G 4ITCA 5DZEA 1V70A 1LKNA 2DCTA 2E9QA 1LR5A 4FXGB 2PFWA 2VU9A 1RUI3 1MACA 1PGL1 3ZXGA 1RHI3 3KGZA 4Z07A 3UKNA 3SISA 5I0SA 3KSCA 1MS8A 3VBHA 3PVNA 3VBOA 4CDXB 2Y38A 2GSYA 1H8TB 4KWLA 4ZU5A 2ZGOA 4DB5A 1C1FA 2VGDA 2K9ZA 1UX6A 2GNDA 3ZO0B 4C91A 3B5LB 3J8F3 4AFMA 5IUQA 1ND3B 1IQAA 4AEDB 3MF6A 4J6GA 4UXAA 1DGWX 1LOCA 1RMU3 4YVWA 4AE2A 3CJIB 1LB2A 4JQRA 2HWC2 4HVQA 1BK1A 4HK8A 4QQOA 4GXLA 4P9IA 4GMP1 1G9DA 2HWC1 1H0BA 3AMHA 3C3VA 2BWAA 5FLHA 4QQHA 1LOFC 1TME3 2EA7A 5CFDB 1UN1A 3CO2A 1PK6A 4BMEA 1EPZA 1HXS3 1TMF2 2DTWA 3JB8A 1EAH1 1QHDA 4LO7A 1PO23 1JUHA 3FFQA 3WHUA 2UYBA 3LA7A 1CAVB 1G9FA 5JPNB 4AHZA 2CAVA 1MEC3 4A7YA 3B9IA 4JGZA 1A78A 1RUF2 1MZ6A 3ROUA 1MS5A 1GNZA 2I74A 3OYWB 5IK4A 1JYIA 3FUQA 4GKYA 1RUF1 4CDWC 2YROA 2D6NA 1OKQA 4Y26A 5KXBA 1J59A 1DGRA 1BEV3 4YG3A 5BNOB 1F9KA 3IN9A 2E63A 5E8AA 1IS3A 4FT8A 5H9QA 5FRAA 4OI4A 1FYUA 1PZ7A 1SLIA 4QM8A 3OD4A 2ZGRA 4ISRA 3AFKA 3U07A 3D4KA 2O8QA 2IFRA 1W6NA 3U11A 2D3PA 5GLUA 1AYN2 1V6LA 2QE3A 3KGLA 2HWE3 2VOXA 3E6DA 4WM8A 1EYBA 2WS93 4AGRA 3N7JA 3DN7A 3VHOA 3J4UH 4P9LA 2D7FA 2CAUA 5I0RA 2K2SA 3AJYA 3B01A 3ZXFA 1HKDA 3CEWA 1MVQA 3WDXA 3ATGA 2ZMKA 2R043 1AR93 5FO9B 5LK5A 2BFUS 3D6EA 3I59A 1FOD1 2BNNA 3IDEA 3AZYA 2XKPA 1ZZ7A 4K1ZA 1VRH3 2DUOA 4Y22A 1R1A3 2WZPP 3RRDA 4CDXC 1VALA 2VMIA 5GLWA 1H8TC 2V73A 1AR62 5J48A 4JTOA 3WQ7A 3ZIXA 3V0BB 2V09A 4JDMA 1COV3 3LA3A 2YHJA 1CONA 1ND3C