1ULGA

Cgl2 in complex with thomsen-friedenreich antigen
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
b'MLYHLFVNNQVKLQNDFKPESVAAIRSSAFNSKGGTTVFNFLSAGENILLHISIRPGENVIVFNSRLKNGAWGPEERIPYAEKFRPPNPSITVIDHGDRFQIRFDYGTSIYYNKRIKENAAAIAYNAENSLFSSPVTVDVHGLLPPLPPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords galectin-2
publication title Structure and Functional Analysis of the Fungal Galectin CGL2
pubmed doi rcsb
source organism Coprinopsis cinerea
molecule tags Sugar binding protein
total genus 35
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ulgA00
2A6YA 1UKGA 1LGBA 4YM3A 1UMZA 1H9PA 4FOYA 1GZWA 5EWSA 1ULFA 2E51A 4WVWA 4Y1UA 2DYCA 3N7KA 4YW4A 4FPLA 1MS3A 5GJ6A 2JJ6A 5T50A 4HL0A 3V0AB 1DHKB 1V00A 2ZGKA 1DLLA 1MVEA 3N3HA 2UWBA 1PZ7A 2ZA9A 5HCFA 1OFSA 1CPNA 2D6OX 2SLIA 1WLCA 1F31A 1Z0HA 2ZGNA 1UAIA 1MACA 4M3CF 3AX4A 4K1ZA 5T5JA 3ZVXA 4ZKTB 3AYDA 4CTEA 4JCKA 1RITA 3V65A 2OUHA 4YFWA 2TEPA 2ZGOA 4YGDA 4FQ4A 5SV8A 3WNXA 4BMEA 4GKXA 1SCRA 2EF6A 4ASMB 4Y26A 4R9DA 3N7LA 1LGNA 2GN7A 3A0KA 4R9AA 1S0IA 4L8QA 1UPSA 1LOFA 1LEMA 3PVNA 4C1XA 1GZWB 4XJUA 4BM8A 4Y1XA 4H55A 2D6LX 4I30A 4TZDA 3UL2A 1AX1A 1MS9A 1JBCA 2AUYA 3NV1A 1KJLA 1LU2A 5HCBA 1V6NA 2R0HA 4XYXA 3T1MA 1LCLA 2V73A 2ZACA 4P14A 3UK9A 1ENRA 1ZA4A 1Q8QA 2ZAAA 3RG0A 1QMJA 1GBGA 3D5OA 4Y22A 2EIGA 2E6VA 3ZXJA 4ATEA 2A70A 5CNAA 3AYCA 1WLWA 1N1YA 5JOZA 1MS0A 4GKYA 4GWMA 4DPNA 3WLUA 2EXHA 1MZ5A 4K1YA 2EXIA 1LTEA 2BQPA 1MVQA 1Q8PA 4AGRA 3OGGA 2DVBA 3PJQA 1W6PB 3DUIA 1LOEA 1WD4A 3AFKA 2GNTA 2PHXA 4R9CA 3NV2A 1G9BA 1JYCA 1LODA 1ENSA 1W6OB 3KM5A 4Q8LA 4RL7A 2UU8A 2JDZA 4LBNA 4XIOA 1HDKA 4DS0A 1N1VA 3FLRA 5EYYA 4NOTA 3N35A 1SBFA 3C2UA 4WV8A 4Y1VA 1VIWB 4R9BA 4XZPA 3ZXEA 1OQ1A 3B9CA 3INAA 1N1TA 3OBTA 1J1TA 2W52A 4FQZA 3WV6A 3O0XA 1AJOA 1SLBA 4LBOA 4YM2A 3ZPYA 1W6NA 1LGCA 4LBMA 2NM1A 1WW7A 2A3XA 4K20A 4YZ2A 3SH3A 3AZWA 3AXDA 4DRRA 1DQ5A 1DYKA 3O5SA 4PCRA 1MS1A 2JECA 2NYYA 3WUDA 3BIWE 4YGEA 3IMNA 4FPYA 3AP4A 1RIRA 1IOAA 4FOVA 4M3CA 1V6IA 2D7FA 4XMIA 3V0BB 1Q8SA 2AENA 3WZ1A 1BKZA 1GZ9A 2VXRA 1WD3A 1LULA 1QDCA 4BOWA 2D3SA 3MW4A 1DQ2A 5JVVA 4JRAA 1IKQA 3FFZA 1YRZA 4XXPA 3USUA 1IKPA 3W58A 2DV9A 3BTAA 3V0AA 2WNEA 1SCSA 3V64A 2ZHKA 2ENRA 2P34A 1S0GA 3B3QE 3O0VA 4IQPA 5IK7A 3T1LA 1CONA 5T5PA 1JW6A 2E7TA 2PHRA 4FPOB 1YIFA 1W0PA 1W6NB 4P9YA 5KXDA 1OKQA 3Q9OA 1CR7A 1MS4A 1KJRA 4YLZA 3GALA 3WUCA 2YV8A 4FOWA 2ZHMA 2JD4A 1CQ9A 2GNDA 1HKDA 2A3YA 5GLUA 2ES3A 2OW4A 1ULCA 1S0FA 3RQ0A 4K21A 2G4IA 3FUQA 1AX2A 4M3CB 3UJQA 3ZSKA 2FHRA 1KDMA 2NZ9A 3WDXA 4XBLA 3WOGA 5DUVA 3RMXA 4ZXKA 5F5QA 1FAYA 4UW3A 3USUB 1QOOA 3MW2A 1SLLA 1I3HA 1U0AA 2D6MA 1KITA 2W08A 3D4KA 3O12A 2YMZA 1N3OA 3ZYRA 1SLCA 3GNEA 1BZWA 2W39A 3OJBA 1DQ1A 3AYEA 5JDBA 1W6MA 1O4YA 2PHWA 4MYEA 5KXEA 4P9WA 5EXOA 1LOFC 1S0DA 4U2AA 4DQAA 4XJAA 1LOBA 3WCSA 3AZXA 1G9FA 1W0OA 1G9AA 2R16A 2C9AA 2AREA 2D3RA 3WVJA 1FATA 1S1AA 3SNMA 3AJZA 3ATGA 3O0WA 4TYSA 2CWSA 2H0BA 1H30A 5T5LA 1FX5A 4YM0A 1F9KA 3WDYA 1DFQA 1W6PA 1PZ8A 2DURA 2LALA 2P3KA 5T5OA 4FPHA 2P2KA 1AVBA 4FP3A 1VAVA 1QDOA 2GMPA 5GZEA 4BMBA 4WZFA 1W6OA 4BQ1A 3PVOA 4KBBA 4FPJA 2CTVA 4LBQB 1LOGA 3JUUA 2B7YA 2DUOA 4Y20B 1BXHA 2XB6C 3BODA 1GNHA 1W6MB 3IM0A 1CJPA 1D2SA 2CWMA 1NLSA 2YXSA 3H0OA 5IK4A 1AX0A 1C57A 2ZHNA 5GLTA 2PELA 5CA6A 1N47A 5GM0A 5JLVA 2CYFA 2P37A 3M3OA 1A8DA 5DXDA 2EXKA 1XQNA 2CY6A 1S0JA 1FNZA 4LBJA 1ULEA 5IK5A 3M3EA 1G8WA 4M00A 4PF5A 2P3JA 1IS6A 1C4RA 3OYWA 2ZGPA 2DU1A 3M3QA 1Q56A 2WT1A 5DUWA 3V0BA 1S0BA 1UL9A 2WT0A 3ENRA 3A4UA 2P3IA 1R1ZA 3N7JA 3M3CA 2AYHA 2R1DA 2ARXA 5DZEA 2WSUA 3VKOA 1YYNA 1ULDA 4YG6A 2VW1A 4CRQA 5H9RA 4FPKA 3AJYA 4XHBA 4GA9A 3QCWA 3HR9A 1MS8A 2D43A 1GICA 2A71A 3ASIA 1MR5A 2ARBA 1CPMA 2ZGTA 1LEDA 2GALA 2NP0A 1LHWA 3CNAA 1DQ4A 2AR6A 2GDFA 3ZXLA 1WBLA 3ZYPA 1Y7BA 2YY1A 2NN8A 4Y1YA 4XXAA 3ZSMA 1V6JA 4XBNA 3SH4A 1Q8VA 1WW6A 3OYWB 1A78A 4YZ5A 4YGCA 2GNBA 4OZXA 1G7YA 2ZGMA 4F83A 5DZGA 2PHFA 3QLQA 1AXYA 2D6NA 4FVVA 2ZZJA 1SACA 5GZFA 2CNAA 1G86A 1B09A 5T52A 3POYA 3VV1A 4FP2A 2FMDA 2GN3A 4FPCA 2ZBJA 2GMMA 1UN1A 4XJWA 4Z8BA 1JOJA 2A6VA 3AZYA 1KDKA 1WW5A 2VH9A 3I8TA 3AZVA 4XHXA 5DZFA 2JE7A 3WG2A 3PMEA 3HMYA 4NO4A 2ERFA 4XJZA 2WQZC 4YFZA 4AYUA 1CN1A 1JUIA 3APBA 3WDTA 1YXWA 3MW3A 1LHNA 2WT2A 2AH2A 4YZ4A 3WHUA 4LBKA 5FRAA 1MS5A 3A0NA 1S0CA 1WUVA 1F5FA 4Q1RA 3VKFC 1KQRA 3LCPA 4ATFA 4XILA 1QF3A 5BYNA 1Z78A 3B01A 1QGLA 1ONAA 1A3KA 2A75A 5GALA 1AJKA 3ZXKA 3IPVB 2A5ZA 4BLJA 3MEPA 1UX6A 2VW2A 3VKMA 1DQ6A 1FV2A 3FUOA 1AXKA 2CL2A 4LBQA 1GANA 4LBLA 1VALA 4P9XA 4Q2FA 4UW5A 4Y20A 4YG3A 3LSEA 1LOCA 2JE9A 3M2MA 5DUXA 2ZGLA 5H9PA 5AVAA 4YGBA 5L73A 1W6QA 1GZCA 1GYKA 3WHTA 1HQLA 4BPZA 1S0EA 2R1BA 3WCRA 3ILRA 4FOQA 1SLAA 4YG0A 2VW0A 2DU0A 3AXEA 1C1LA 2E7QA 5T55A 4YZ3A 1V6LA 3U4XA 1NXD1 1DYPA 1QNWA 2YZ4A 5H9SA 1N3QA 3WDWA 4AGGA 1VLNA 4BLIA 4AGVA 2DVAA 2PHUA 1JXNA 1TEIA 3UJOA 1DZQA 4AVSA 2V5YA 1GNZA 1WW4A 3IN9A 3M1HA 4Q1PA 1QOTA 5LK5A 4XDQA 5CB7A 1G9CA 3AYAA 2OVUA 5GZDA 4YZ1A 2RHPA 3AP7A 1I1EA 4AVTA 1BJQA 2VY0A 2A3WA 5DG2A 1GV9A 4LBQD 5H9QA 4Q27A 5E8AA 1AXZA 4XJ9A 4UW6A 3TB0A 1JYIA 3AP6A 1W6QB 2ZMNA 3RRDA 1WBFA 1AZDA 3SLIA 3VKLA 1JHNA 1D0HA 1MZ6A 1QNYA 2OUJA 3ZXFA 2WLQA 1IS5A 1LECA 5JMCA 1HQWA 2AGSA 1IS3A 2XG3A 1DQ0A 4XOGA 3WG3A 3FBYA 1LESA 5JOWA 1SBDA 1IS4A 2ZMKA 2DVFA 1PZ9A 3AZZA 4PQ9A 4Y24A 4SLIA 4YM1A 2DVGA 4CZSA 5CBLA 3SISA 2Q5TA 2KM2A 1URXA 3L2YA 3ILFA 3ZSJA 3AP9A 1GLHA 2SBAA 5T54A 1JN2P 1Q8OA 1ZM1A 2YROA 1WLDA 1APNA 2UURA 3AK0A 1V6KA 4ISQA 3ZSLA 2DTWA 3BOPA 2D6PA 3VUOA 5DUUA 3D6EA 2UWCA 3KQRA 3OY8A 1LOAA 1QOSA 1RINA 1SLIA 3RS6A 2JKBA 2ZKNA 4WVVA 5IUQA 2D3PA 4W65A 4Q8KA 3RMYA 3R05A 2DWRA 2Z42A 5GLZA 2WJSA 4FPFA 4XTMA 2A7AA 2C5DA 4AWDA 5GLWA 2E53A 1LHVA 4HANA 1UZYA 3R4SA 2DVDA 3NV4A 4U36A 1FNYA 3WDUA 5DG1A 4Y1ZA 2VUAA 5GZGA 1QU0A 1SLTA 3DGTA 4YW5A 1ULGA 5GLVA 2A6ZA 2NMNA 3NWKA 1UZZA 1WCSA 1FYUA 1GKBA 2LTNA 1SFYA 4ITCA 2PHTA 1YI7A 3T2TA 4DRVA 4JC1A 1LENA 1LJ7A 2I2SA 4XTPA 2EXJA 4C1WA 2HYKA 4ISRA 2DUQA 3JU9A 3RSJA 1SBEA 1BQPA 4M3CE 3N36A 1N1SA 4Q26A 3W59A 4D69A 3N7MA 2DTYA 3LSDA 4XIKA 5KXBA 3OY8B 4Y22B 2R0FA 3NV3A 2VU9A 4FPGA 3IPVA 2A6WA 2NMOA 1LU1A 3MPPG 1BYHA 1C1FA 1CIWA 2GMEA 2ZABA 2DUPA 2ZGUA 4RA0A 4XBQA 1GSLA 5EYXA 4YW3A 1YO8A 4GALA 5F9TA 3FLPA 2D6KA 2R49A 2UWAA 4UW4A 4YW2A 2GNMA 2WSVA 3WDVA 1LHOA 3OBRA 3POSA 2ZMLA 3WG4A 1DBNA 1X50A 1KRIA 5GZCA 5HCAA 2ZGSA 5CAZA 1DIWA 1H9WA 1FV3A 1V6OA 2D44A 3B69A 5E89A 3B00A 1DGLA 3FLTA 3SH5A 1G9DA 1CESA 1AF9A 2ZHLA 3OPZA 4GXLA 3HN1A 3ILNA 3TAYA 3VKNA 4XMAA 4XE9A 1V6MA 1LHUA 2A6XA 3POWA 5E88A 3SITA 3R4UA 4XJ8A 5FREA 1HLCA 4FPEA 4GWNA 3PVEA 1QKQA 5IK8A 2EALA 4PBOA 4DFSA 1N3PA 2EAKA 4M01A 2W68A 4YW1A 3AP5A 5JOXA 1CVNA 3I4IA 5KXCA 5IT6A 3IKWA 4AVVA 1O4ZA 2WKKA 2ZGQA 2ZGRA 1VAMA 4PBPA 3WG1A 1ENQA 5JOYA 1EPWA
chains in the Genus database with same CATH superfamily
3OD0A 1NZCA 1UKGA 2VCMA 1UMZA 3AC0A 1RUG3 1GZWA 4Y4RA 5C4WB 4QPIA 3N7KA 3VL9A 3U1XA 5B4XA 1G6NA 4MXWB 1MVEA 4B4QA 1HX6A 1PZ7A 2CU5A 4PI0A 3BI3A 5HCFA 1BMV1 2DF7A 2SLIA 5K0UB 4CYDA 4PI2A 4DINB 4M3CF 2YFUA 3FBMA 4R52A 5T5JA 1PK6B 3ZVXA 5IFPA 1Q3EA 3OGJA 4ZKTB 5BUVA 5C71A 2QQJA 1HRV2 3K51A 3RFRA 3V65A 4QX2A 4A7KA 3G6JB 4NPLA 4YFWA 3JB8A 4FQ4A 4OZOA 1VBD2 1GOGA 4IE0A 4GKXA 5FPZA 5SV8A 4JKKA 3U75A 3ZXAC 3ZKUA 5IAVA 3JD71 2Y0IA 4QHZA 3VBHB 1GOHA 5FMCA 1JODA 3J7LA 3LIHA 3A0KA 4R9AA 1S0IA 3WQ0A 2RDSA 4L8QA 3BVCA 4KWLA 1LOFA 3CEWA 2DCJA 2VQTA 3PVNA 1GZWB 2WRAA 3GCWA 2Q0AA 4BK5A 3T0DA 3ZFEC 3BCWA 3ALQA 3GGLA 4D94A 3IAPA 3UL2A 3LF7A 1OOPB 4OULA 2WWUA 1MS9A 3NV1A 4JGZC 4UYBA 1KJLA 5HCBA 1V6NA 2BGOA 4XYXA 5IAXA 1LCLA 5I8TA 3NJVA 5JCTA 5CFCA 2ZAAA 1ZA4A 2VG9A 2ZS6B 1S2BA 2CGOA 2Z79A 2OQ7A 2HJIA 3I3MA 2VZVA 3I97A 4WM7A 4YSFA 3JBG2 4KNCA 4E9KA 2J1AA 2CAUA 2ZPXA 1WLWA 3AKQA 1MEC1 3PU8A 3NKTA 5DN2A 2Q8OA 4EN0A 5ACA1 1QQP3 1W06A 5BNPA 2HWC2 3NSTA 4N7UA 2YBSA 4FT8A 4K1YA 3Q8EA 2HWD3 4B4RA 3MUZ1 2XKOA 4BQ5A 3HNYM 3OGGA 1GWMA 5A7WA 3MIBA 1J83A 3N4MA 2V4VA 4AR2A 1WD4A 1XSRA 4RQPB 2GH2A 2WAOA 3VZMA 1LODA 1ENSA 1UXZA 2AZ5A 2HWE1 5HPOA 4LBNA 2VZ1A 4RFRB 4MGZE 4P9LA 5EYYA 4NOTA 1FT9A 1SBFA 4NUBA 4Y1VA 4HXCA 1CX4A 5IJRA 3KZ4C 1K5JA 2QNKA 1ZRIA 3OBTA 1AR91 3N9LA 3HQRA 4YM2A 4DUWA 1PGL2 5D2AA 5F37A 1LGCA 4RD7A 3TBDA 2W5FA 2A3XA 4YZ1A 3P3PA 5ABJC 1AR83 5A6YA 3AXDA 3WNOA 1DYKA 4DRRA 2J1VA 5IHRA 4P5YA 2F4LA 4PCRA 5I0RA 1VRH2 2E63A 2ZX3A 4YGEA 2WL1A 5A7WB 3THTA 2C24A 2VUJA 3AP4A 3VBFC 5JPMB 3IZOA 1OF4A 4FOVA 1J84A 5FXZA 2MNGA 4CPBD 1ND2A 1Q8SA 2VCAA 2ZTNA 1JMUB 2VGDA 5BNOB 4ZU7A 4LNVA 1LULA 2CGPA 1NAEA 4KU7A 2D3SA 2R6QA 3SEEA 5LY1A 4L99A 3USUA 3W58A 2DV9A 4HSLA 4IEPA 2BWCA 2XUEA 2YGMA 2P34A 2VQUA 3GBGA 4IEOA 3WQ1A 2FZ2A 2BVVA 3MF9A 1CONA 2Y6GA 1JW6A 2HBTA 4GMP3 2RE9A 3RJ2X 3U14A 4XUTA 4OI2A 5CADA 4YARA 1GFF2 2Y6HA 2Y33A 2YUEA 2W94A 3K4DA 4AI1A 4YLZA 3UGGA 2CDPA 3IB3A 4BH9A 1NA1A 5KHKA 3BTXA 4B7EA 5SV5A 2XJUA 3AKTA 1SQ4A 4GD4A 4LMFA 1CAVA 1ULCA 2P3YA 2RJKA 4NRQA 1SPPB 2PMWB 4K21A 1AL22 2D98A 3RZZA 1HB4A 5KBFA 2FHRA 1Z7S1 3B02A 4N7IA 5A6XA 4UFMA 3DPRC 3TEYA 4MGYE 3NVCA 3KT1A 4Z2WA 1P8JA 1VP6A 2BTVC 4RS5B 4BYYA 1CAWA 1FAYA 2IXHA 4XW3A 1R1A3 5KHJA 1OUXA 3USUB 2GP5A 2W08A 3GHMA 4F7ZA 1VMHA 1W2UA 1AYM2 2J42A 3ZYRA 1SLCA 3VDDC 3GNEA 2EICA 2XVKA 1AR81 4IUGA 3WT3A 3ZSEA 3AYEA 2QQNA 2XDVA 4A7YA 3SKVA 4Y5Z0 1W6MA 3MI8A 5CKNA 4OQ8A 1XNAA 2NQYA 5FPAA 3N9QA 4DQAA 2R043 2WZR3 2XJRA 3P5BA 4QKBA 3AZXA 4Y5TA 3WCSA 1G9AA 5K7PA 3NJYA 1NA1B 3U37A 3WR0A 3VD9A 5L7OC 1ZRFA 2L9LA 2FCVA 3AJZA 3O0WA 4HG6B 1RVF3 5EIYB 3SXWA 5FO9B 3ZDSA 4HBNA 1F9KA 4COZA 1OBNA 1F4AA 4B1LA 1UYYA 2P3KA 4AQTA 1VAVA 4TN7A 5I93A 1UNBA 1UIJA 1ZRRA 4IGPA 4QX3A 3W21A 2HWF2 4WZFA 3KVAA 3KWVA 2BJSA 3X29B 3S5QA 1SG3A 1AR63 1H1MA 1LOGA 2VVFA 2VZSA 2X8KA 1VBC3 3R0RA 4Q4X3 3OGRA 1PVC2 1LNSA 3PIJA 1RUF3 1GNHA 3NJXA 5G05L 1W6MB 3IAQA 2O14A 3WF1A 4MLOA 1TME2 1U5XA 2CWMA 1YJLA 2WFF2 3CJXA 1AX0A 5BPXA 5GLTA 2PELA 1UMIA 1YCIA 4HVRA 5FY7A 3WNLA 4Q4W2 5CA6A 5JLVA 1RUE1 1B35A 4AHWA 1WMEA 1A8DA 1KS4A 2CY6A 3NNJA 4PF1A 4QX7A 2BWAA 5DAXA 4DNYA 2ET7A 2ATFA 1G8WA 1UF2C 4M00A 4PF5A 3LFIA 2XH6A 3H9AA 3ON7A 2XL7A 1VBA3 2P3JA 1IS6A 4LO4B 1M4WA 4PDWA 3RWKX 2FDHA 2DU1A 4QHOA 4AXOA 4IETA 4RR3C 5DUWA 3PTRB 4QM8A 2B42B 2BGCA 2WT0A 4NROA 3A4UA 1X82A 4AFMA 1R1ZA 2VBBA 3N7JA 3LEMA 4URTA 1BBT1 3K77A 5JSOA 2ZOEB 1WWYA 1YFYA 3OPTA 1MQTC 1ULDA 2OA2A 4CRQA 5H9RA 4AOCA 2C0ZA 3CMGA 5LATA 1RUJ2 5L19A 3WNKA 5J98B 3I54A 3HR9A 2D43A 3GZAA 3Q8CA 2BRTA 2A71A 5J3UA 1B35B 2PXJA 1CPMA 1JYNA 1IZ3A 2GALA 4A45A 2WNUA 2UY9A 5F1RA 2GDFA 2ZJCA 3OUIA 3VDBA 4CU9A 1RUNA 3K2OA 3ZYPA 3H3UA 2NN8A 3ZSMA 2W1WA 5E1RA 4CDQC 2BVBA 3E6DA 1XNTA 2QQIA 3SH4A 4AG4A 4PDWB 2XL9A 4ZONA 4B3NA 4F83A 2ZGMA 1VBC1 5LBFA 4BQ3A 2HLEA 3QLQA 1NX9A 2ARAA 4EROA 3EHKA 5L9BA 4FVVA 4OHZA 1RUF1 3LOIA 4LQRA 2WS91 2CNAA 1O59A 1ND3A 1OC1A 2FCUA 4R4XA 5KWRA 2FMDA 2GN3A 5D21A 2ZBJA 1D4M3 4D6QA 1YQ2A 2J22A 2J1TA 4XJWA 3RWNA 2RS52 1JOJA 2C6SA 2XJTA 3OF1A 2QUOA 3FX3A 3AZYA 4S2FA 1EY2A 3P6BA 2HBUA 3B5LB 2HKXA 2ERFA 4FAGA 1U5IA 3EBRA 1J58A 1U12A 4Z2AA 1RUI3 1JUIA 2WNUB 4QXCA 1VBA1 3I2GA 1AYN1 1UYPA 3J8F1 4IW3A 3VD3A 3M4FA 4IV1C 4G3YC 4LBKA 5FRAA 1PO12 1XYOA 4E4ZA 2BOJA 1F5FA 4Q1RA 5KC6A 3VKFC 1RUC2 1KQRA 4OI4A 4OMCA 4Q0VA 4MGKE 2XBO1 4GZ9A 1XOYA 1RXFA 3L9JT 1BVP1 1ZZ7A 2WNVC 3LEIA 3DV8A 1A3KA 1AJKA 1EV12 2D5FA 3DXTA 3RVHA 2A5ZA 2YC2A 2BU9A 3VKMA 3U0ZA 4N43B 4MGSA 1RC6A 3NNFA 4P9XA 4G4FA 4L92A 5DXDA 4Y20A 5DUXA 5FY9A 3ETPA 3LSEA 4YVSC 3RDIA 3RYRA 1VPHA 3J9SA 5CG9A 1ZNPA 1DZRA 2WIIB 1JOBA 4QB2A 3H1MA 4BPZA 4D6SA 1W03A 3ILRA 4YG0A 5J09A 1A6CA 2DU0A 1JU3A 5FYYA 1WKYA 1ZBE2 1QH6A 5T55A 1HXS1 3AMHA 3U4XA 1NXD1 2YZ4A 5H9SA 4M4RA 1VJ2A 2MEV1 2PHUA 3NJZA 1C8M2 3I7DA 4NIDA 2V5YA 5LRSA 3K4ZA 3IN9A 1I5PA 3M1HA 2X5IB 4Y5SA 4KI5M 1NE4A 1QOTA 2PA7A 3CF6E 5GZDA 3C7FA 1NCRC 4TLFA 3AP7A 1I1EA 4PLNA 2YFZA 5FZ4A 1XNBA 2A3WA 4OHYA 4Y33A 4LBQD 4LHKA 4BB3A 5FQ0A 1RUI1 1W8NA 1W9WA 1JZ2A 3ORJA 2J1EA 3OEAA 4AI9A 4D7SA 2WN2A 4WVMA 1YNAA 1HV0A 1VMJA 1Y9MA 5D8AB 3ZXFA 2WLQA 3SCFA 3VB9A 3DKWA 3RZLA 1DQ0A 1LESA 4L11A 1SBDA 4EN7B 1GMMA 1J3QA 1XBFA 4K40A 5FZ0A 2CHHA 2LROA 5F5IA 2Q5TA 3L2YA 1QJX1 1JHJA 1CAUA 2SBAA 3LGRA 2RR13 1JN2P 1WLDA 3EQEA 2F6BA 1F35A 1HQNA 3OEBA 4NRMA 1TMF3 3BOPA 1UKRA 2DFCA 4YVWA 3F2ZA 1CWPA 1ZBA1 1RINA 2A73B 2JKXA 1LB2A 4WVVA 2Q1FA 5IUQA 4W65A 2R062 5A7QA 3MGUA 5HV4A 2WQ8A 4AFBA 3ZN5A 2AC1A 3D3AA 3R05A 3T3YA 3MFAA 1R082 4WVMB 4FPFA 4M0HA 3PUHA 2BYVE 2WQ4A 4GH4B 4AWDA 1NZIA 2BFUS 3KV5A 3HEIA 3SHRA 2VUAA 4QQPA 2W2IA 4CPBA 1ULGA 2PAMA 4W50A 2NMNA 2VTXA 3VD5A 1GKBA 5FPLA 4ITCA 4Z82A 1W9FA 2JWPA 2GU9A 4JX0A 4JC1A 1LJ7A 3QACA 1RUD1 2BEOA 3MIHA 3BU7A 1VB4A 2CV6A 5DDJ2 5CKQA 3ZFGB 4CCKA 4MG2A 1SBEA 2WWSA 1WA6X 4NAMA 4QD2A 1S2KA 3MLJA 5DABA 3T09A 1N1SA 4Q26A 1GWLA 2V4AA 3LSDA 5KXBA 3H8XA 4Q0PA 2YC4A 4IE4A 4Y22B 2WO7A 3KT4A 1DU3D 1YQ5A 3VBUA 1PGSA 3D8CA 1QH7A 1COV1 5IFTA 2ZGUA 1CD3G 2DUPA 3IWZA 4N8MA 2OZJA 2QTWB 5FAXA 3LDKA 2GNMA 2WSVA 1MPXA 5J48A 2RMU2 1FOD1 1REDA 3AL6A 2VQAA 2RS11 1HJGA 2VTFA 3V56A 4L97A 4P5HA 5GZCA 2ZGSA 1U5YA 2QQKA 2RDQA 3KLSA 1V9U1 5J96B 4TXWA 1JZ3A 2ZHLA 3HN1A 4XETA 2ORXA 1V6MA 1LHUA 2A6XA 4H7LA 5JPNB 5LEJA 4QPGA 2VTXJ 3R4UA 2XQRA 4QX8A 4XJ8A 2ZEXA 5B2GB 5F6LB 5J36A 1NOVA 1O3SA 1BEV3 4OCTA 5F6KA 3SKJE 2DBNA 5FZFA 3RZGA 1RUH2 4WBBA 2QZ2A 4DFSA 4UFLA 1N3PA 4M01A 3ACLA 2OQ6A 2FDJA 5KXCA 4FSJA 1LKNA 4AVVA 4Y4YA 4A42A 1FPN1 4CP1A 4PBPA 3Q8BA 1W8OA 2JIGA 2ADEA 1EPWA 1IQDC 2JB8A 4JV4A 4AFCA 3NMBA 1LGBA 1QJY1 2JG8C 4YM3A 3LB9A 4FOYA 4NHYA 1ULFA 1ASJ2 5FYCA 2E51A 4LIVA 2YYOA 4Y1UA 3DF0A 4Q4V3 2RM22 1NCQB 4HVQA 1C5IA 1MS3A 5GJ6A 3V0AB 3IDCB 3WF4A 3N3HA 2UWBA 1EAH3 3L2HA 1RMU2 1W9YA 3WP5A 4BCUA 4HK8A 4E4DX 1OFSA 2VMFA 4QPGB 5F5AA 2ZGNA 4K9SA 5FZ9A 5DQ0A 3IMMA 4JGYB 1UXXX 3AYDA 4CTEA 2JG9C 2R073 4JCKA 1AR73 1JI6A 2ADDA 2OUHA 2TEPA 3ZYHA 3ZFFC 4XCAA 3HQUA 4BMEA 1SCRA 1MZEA 4CXYA 4Y26A 5I91A 2GZWA 1T2XA 2CGNA 4AFAA 3J4UH 1K5MB 3QH7A 5FK7A 1LGNA 3SEPA 4B4PA 3W5MA 4GQ7A 4D3WA 1UPSA 3VBOA 1YI9A 3H8UA 5F3EA 4ARXA 1DDLA 2Y0OA 2DCYA 3TN91 4Y1XA 4H55A 5IW0A 4JTOA 5IVYA 1RHI1 1AX1A 2QCSB 3KCCA 2AUYA 4L9BA 1LU2A 5EJ1B 4XABA 2R0HA 4AFDA 2V73A 2ZACA 3UK9A 1LAJA 1ENRA 5AC91 4PLMA 4COYA 5C3PA 1H6XA 2EIGA 2XLAA 2E6VA 3ZXJA 2VMHA 3D82A 4IEWA 5FUPA 4CA9A 3I3QA 4TSVA 2IVIB 3HBZA 4GKYA 4GWMA 1PHMA 4FTBA 4AEDC 2EXHA 1E5HA 4TTGA 5FY1A 5A32A 1Q8PA 2LW8A 3FC0A 3O14A 4Q4Y2 3PDQA 1FMD3 4DZGA 1QJU2 1OKOA 2GNTA 3TEZA 2XJVA 2FQPA 4XC9A 1G9BA 1JYCA 4CDXC 1PO21 2JDZA 4XQWA 4DS0A 3KCXA 5LBEA 2VM9A 2W46A 3NW4A 4WV8A 4P9GA 1OURA 1WLTA 4R9BA 1H2LA 4XZPA 1OQ1A 3ZXEA 5FOJB 1NY72 1OSGA 1J1TA 2W52A 2RVAA 5CYYA 1DG6A 1AJOA 4OUSA 1SLBA 2LS6A 3VZLA 2RS31 4GB31 4JVAA 2PLV1 4V2VA 2NM1A 4GB32 3S6PA 5A70A 3KHBA 4PIZA 1RGSA 5I0TA 3J7NA 4D6RA 4YZ2A 4JRLA 3VLBB 3SH3A 1SEFA 1DZTA 2DCKA 5CFDC 5JZGC 1YUDA 1MS1A 5A32B 2NYYA 3WUDA 3ZN4A 3P3NA 4HT1T 1IOAA 3MLLA 1ALYA 2D7FA 3J26N 2IFRA 5K0UC 1K12A 2WDBA 2AENA 2QJVA 1PMIA 4CEWC 1GZ9A 3NRUA 3THPA 4BOWA 1QDCA 4MHRA 2JICA 2GC0A 4E27A 5JVVA 4JRAA 4RHV1 1J1LA 3FFZA 2JIJA 2MHFA 4GULA 5AVPA 5LK7B 1T6BX 4IERA 4MXWA 1QIQA 4N53B 3MUY1 1VBB1 1WCUA 4XACA 3JQXA 3T1LA 1HRV3 2W95A 2PHRA 2VZOA 4FPOB 5T5PA 1YIFA 3VDCA 1PK6A 2XHNA 5C9AA 1OKQA 3Q9OA 1PX3A 1MS4A 1UQXA 1VMFA 1VBD3 1CZTA 2OT7A 4O9GA 4QPIC 4YPJA 1O4TA 4B7KA 2WINB 2JD4A 3DYPA 4HPKA 4AQ6A 1HKDA 5GLUA 4K7JA 2OW4A 1V70A 2GP3A 1S0FA 3RQ0A 4KWUA 3VBHA 2BP6A 2IZWA 2OYZA 1AX2A 5LA9A 3WDXA 5IVCA 5C8CC 3VBRB 2ZX0A 3BB6A 2IC1A 4ZXKA 4CUAA 1KFXL 5HXMA 5A33B 3TYJA 3MW2A 1SHWB 3D4KA 1OOPA 1KITA 3OTFA 2Q8EA 1N3OA 3OBZA 1DGWA 2O0OA 5LZ6A 1H8TB 2EIEA 2HEVF 4V1PA 2Y60A 1BMV2 4KG0A 3JBG3 2OIIA 2PHWA 3AKPA 5KXEA 4P9WA 5C9AB 1LOFC 4RGAA 3O1MA 3QBQA 2HWC3 1G9FA 1KEXA 1W0OA 1YFXA 5CG8A 3NKGA 4HPKB 3UV9A 2AREA 4DY3A 1R091 1TE1B 1PMJX 4BK4A 3WVJA 1S55A 1OQDA 2YGLA 4K3UA 4TYSA 3T0AA 1ZRCA 1CZVA 3JD72 5T5LA 1H30A 2G9GA 5CFCC 1REFA 3KCYA 5KHIA 4KWJA 2VQ0A 4ZS3A 5T5OA 2P2KA 1AVBA 4RQPA 4MGIE 2J1SA 3CHXA 3AM2A 1POV1 2GMPA 3N9PA 5GZEA 4WM7C 1HRI1 4BQ4A 1WZXA 3PNAA 3PVOA 2ZKLA 3KF3A 5TSWA 5FCCA 5DAVA 4LBQB 5BNPC 1F2NA 3RGBA 1NKGA 3GDBA 4EZ4A 1OLMA 1HB1A 1QXPA 3LZZA 5FYUA 3PUIA 4FFIA 2VZQA 5FWEA 2XB6C 3LA3A 2K9ZA 1REEA 4HN0A 1NLSA 1RJ7A 2ZHNA 1JOPA 3R6SA 3WSOA 1N47A 2YU2A 2ZX4A 1R64A 1BHGA 2CYFA 2YBPA 3GZTB 3VHOA 4JZRA 3LIGA 2Z4FA 4IEXA 1VRH3 5FTTC 1XQNA 4CEYB 1S0JA 5ACA2 1MEC2 1RUG1 4IE5A 2B45X 1X36A 4LBJA 5A6ZA 3A23A 3WNMA 2TNFA 5L9VA 3WP3A 5DAWA 4E2QA 5CVRA 1C4RA 2HWB3 5I8YA 1TNRA 1YQ8A 2QQUA 2WT1A 1TQ5A 4I0WB 4A3XA 4GIQA 1W39A 5BNOA 2VMGA 2HWE2 1SDDB 3DYOA 1WA4A 2AYHA 3B94A 2XHKA 4A6SA 1JZ4A 2VO5A 3LFMA 4A7ZA 1VBE3 4XHBA 4NHKA 4PIYA 3ROUA 2BNOA 3OOXA 3GJBA 1AR92 4LOTA 1DGRN 3ASIA 1MR5A 1ND2C 1PMHX 2ARBA 5CZKA 1LEDA 4Q0QA 1LHWA 3CNAA 1DQ4A 3ZXLA 3K75B 2Y38A 1AL23 4XXAA 5FY4A 2J1UA 4QMAA 3DCQA 2EA7A 5FYSA 2VOXA 1E5IA 4UAPA 4E4HA 3Q8AA 5FY5A 1WW6A 1SPPA 4EE2A 1XNKA 4YZ5A 4OZXA 3DN7A 1I5ZA 1HB2A 3S0MA 3GYDA 1UZWA 2VD7A 4XQ4A 3C3VA 1SACA 4K8FA 3VN4A 1AYM3 5T52A 4LULA 4RS5A 3S30A 4D7YA 1W8ZA 4KMQA 2BDRA 1D0GA 4JGZB 5BNQA 3CO2A 4QGNA 4XPVA 5FMOS 3VHNA 4BIFA 5FMBA 5KC5A 2X53S 4LKSA 1QQP1 2VH9A 4ZU5A 3AZVA 4WM8A 4XHXA 5DZFA 1U5ZA 1QQP2 3HQXA 4CP9B 1ODNA 2HWD1 3B93A 3E5UA 3TNQA 3WD5A 2EIDA 4YFZA 2HWD2 1GQGA 1X9TA 1YXWA 5FPVA 3C7OA 2HWB1 2WT2A 1UU4A 2JEMA 1ZX5A 3MYXA 4OUMA 1XYNA 1W90A 1POQA 4IE6A 2WR9A 1E5RA 3WW3A 4CCDA 4DB5A 1X7NA 2P1BA 1RB8G 1CZSA 4I3PA 4KL1A 5BYNA 4XFGA 2HWF3 1Z78A 1VBE1 1Z7S2 3ACIA 4QXHA 5B4NA 1QGLA 3MDPA 5I0UA 4BJ0A 5GALA 3PJYA 2FMYA 1XXNA 3IPVB 4DEVA 4BLJA 3MEPA 2VW2A 1PVC3 3BOWA 1GP6A 4LBLA 1GANA 3CDZB 1TZOA 1VALA 4RN5A 1TME3 1LOCA 3O7OA 1W9SA 2ZGLA 4W6XA 3KV9A 3EMRA 4WM8B 1AR82 3ZOIA 4E2GA 1GYKA 2VULA 1HQLA 2WO3A 3MF6A 5FPXA 1OHFA 5KHHA 3JZVA 2VJXA 2Q30A 2WA3A 2VW0A 2X09A 4EYUA 3WNNA 1C5HA 5ABJB 1V6LA 4MADA 1DYPA 1QNWA 5L9RA 5FR3A 4AGGA 5J7MA 1VLNA 3RZJA 4DO0A 3KV6A 5BV6A 2FD8A 3UJOA 5LBBA 4AVSA 1JTZX 3ZX7A 5A6QA 1CJDA 4UI9L 3VBFB 4A6OA 1F15A 5C3SA 2G9ZA 5C3OA 4XDQA 1SMVA 5CB7A 1OA4A 3AYAA 2F17A 1Y43B 3H3LA 2JDUA 1B35C 3GF6A 4GMP1 5FZLA 2VY0A 1I9RA 1GV9A 4YW7A 1UZVA 1UYZA 4DY5A 1H6YA 4M4PA 4G9SB 3ZPOA 4XJ9A 3AP6A 2XLFA 3MIFA 3CJIA 1ZYBA 2ZMNA 1OI6A 2YDEA 3RRDA 1AZDA 3SLIA 3C7EA 3ZN6A 1GQPA 4BHPA 2Q1MA 3FFQA 1IS5A 2VNOA 4A41A 1OLQA 3OB8A 5JMCA 3UYJA 1K42A 4XCBA 1WGPA 3AFGA 1RUE2 2XG3A 3WG3A 5JOWA 5C7GA 1QEXA 4SLIA 5FYMA 2QZ3A 4ZHNA 3H8OA 4IGQA 5CBLA 2ZEYA 2LUWA 1R1A1 2KM2A 3DEMA 3ZSJA 1YEWA 3AP9A 1GLHA 5T54A 5C5TA 3O1TA 3K48A 2VZPA 3ZSLA 1KGYA 4W4ZA 2D6PA 3DPRB 2W47A 4YWAA 2UWCA 1TVGA 4KH9A 2RS53 1QOSA 2WNUC 1Y9QA 1DCSA 2R041 3MBWA 2WZR1 1JYTA 1BBT2 1JYXA 2ZAHA 5FP3A 3RMYA 3I2DA 2DWRA 3CJIB 3K4AA 4KQ7A 3LOBA 3ZN6B 2WJSA 1JU4A 5LA0A 4COUA 5FV3A 2E53A 5F3GA 1LHVA 3RI9A 1RVF1 3LQCA 2DVDA 3NV4A 2WYFA 3ZIXA 1BCXA 1IPJA 2IXKA 5F5CA 4YW5A 2XUMA 3RZKA 4JQTA 2A6ZA 1ND3C 1PO13 4XFAA 2IVJA 5L7OB 1SFYA 3E5XA 3T2TA 1RUC3 2VL4A 4JAAA 1UOJA 4XTPA 2EXJA 2HYKA 4ISRA 1GNYA 1UPIA 3K3NA 3JU9A 4MX3A 1AR61 3RSJA 4Q4X1 4JHTA 3WY6A 3N36A 3W59A 2AEZA 1EV13 1VBC2 2DTYA 5GKAC 3WP4A 3D0JA 4H7MA 4RFT0 3ZR5A 2R32A 3WX5A 1UIKA 2R0FA 3NV3A 1RUF2 1IGOA 2VU9A 2Y6JA 2WS92 3FHQA 4FPGA 5G04L 2PTMA 2NMOA 4QDQA 1XE0A 1C1FA 4FFGA 2GMEA 2ZABA 4N43A 4RA0A 2B4KA 2B9VA 5EYXA 3MZHA 4YW3A 3T2OA 1YO8A 3ZM8A 2Y8KA 1MQTA 3POBA 1F8VA 2XVGA 2D6KA 2R49A 3C7GA 4V2WA 5CEHA 1LHOA 5FKBA 3WP6A 3POSA 1JZ5A 2ZMLA 4QB6A 3UT0A 1ZBE3 3H8RA 1DBNA 4BA6A 3QH6A 1VBA2 4EZHA 5EFUA 1HW5A 4QU1A 1DIWA 5E89A 1AYN2 1V6OA 3J8F2 4HOOA 1C8M3 2W0XA 4N9IA 4YNIA 4COVA 5FOBB 1XJAA 4ZY9A 1OF3A 4I01A 1BK1A 4NPRA 5F7UA 1G9DA 1MZFA 2UYAA 4CDQA 1CESA 4XFBA 1AF9A 3OPZA 4AK3A 4GXLA 2W87A 4COWA 1XSQA 2PAKA 2X5IA 3TAYA 5A7PA 3VKNA 5C70A 3POWA 2XBO2 1QXJA 3SITA 2VAUA 1ZZ8A 5IYYA 1HLCA 4K8RB 5E6HA 4Z1VA 5FLJA 4GWNA 1EPZA 1YIPA 1QJZA 2EALA 4EV0A 2X10A 2EAKA 4QM9A 4O7XA 4C90A 4YW1A 5KHGA 1MQTB 3IIAA 3VD4A 1SFNA 1OA2A 1X9PA 2VNGA 4IEQA 4OUEA 3OUJA 1GWKA 1S2EA 2VNVA 4S2HA 4UF0B 5ERLA 5D8AA 2YHJA 3WG1A 4NHMA 4P9JA 4BWOA 5BNNA 5HBAA 3VBOC 3W9AA 1AHSA 1XE8A 5C3RA 2GSYA 3I2IA 4WVWA 5JWPA 4XAEA 3T08A 1HXS2 5A1FA 1X8MA 1T6GC 4FPLA 3NL1A 4IV1A 1M06G 3UESA 4CDQB 1DHKB 1ENXA 1V00A 2ZGKA 1DLLA 4AAXA 2MEV2 4AAPA 1D4M1 3FMGA 2XJSA 1IHMA 1F31A 3I2JA 1Z0HA 4QPYA 3ACGA 2R063 3KVBA 3VBSA 1H2KA 1RITA 3UGFA 3U07A 2I74A 3ME2A 4O9EA 4INDA 4CXWA 1RUI2 2ZGOA 4YGDA 4EWDA 3WNXA 5JR7B 2EF6A 1NQDA 3I59A 3J7MA 3LA2A 3UGHA 2VR4A 2IXCA 5BNNB 4GH4A 2GN7A 5IVFA 5FYIA 3J7HA 1KFUL 4EJRA 3WQBA 5A3UA 4EN9B 4XVHA 4YVWC 4QDSA 5F3IA 4BM8A 2BOIA 5DDJ3 1OH3A 4IV1B 2QQPA 3OGVA 5FZHA 4TZDA 3ZFGA 1JBCA 1O91A 3PUAA 2QQLA 3VGIA 1QJX2 2YC0A 4LUMA 4ZU4A 4CDWC 4UBGA 1Q8QA 3LAGA 3AMNA 2WNVB 5BXXA 5LWBA 2EAAA 3VBSB 1GBGA 3D5OA 4HSJA 3NO8A 2WYSA 4UFHA 1DF0A 3HD8B 4Y22A 2A70A 1ZBA2 4MZUA 4OMDA 5A3WA 3AYCA 1H0BA 3N9NA 1N1YA 4CCOA 2ARCA 5JOZA 1MS0A 4AE2A 4I0BA 1ZZBA 2B8MA 3I59B 3WLUA 4DPNA 4YVSB 2RMU3 2EXIA 1LTEA 2P6CA 5FUNA 3WF3A 1D4VB 3ES4A 3M7AA 4XFIA 3ZDVA 2OXBA 1W6PB 5CISA 3PHMA 2PHXA 5ANQA 3BGAA 4W6WA 3KM5A 2VCCA 1W6OB 3OPWA 4Q8LA 4RL7A 3VBUC 4XIOA 4HVOA 4UXAA 2FDIA 2XJPA 4AVCA 1N1VA 3FLRA 1RUD2 1QY4A 3C2UA 5JXGA 1VIWB 4OYUA 3RYKA 5A3NA 2KR2A 3LEGA 3O0XA 4IEUA 4LBOA 1W8HA 1RUH3 4OHXA 1W6NA 2XVLA 1NCRB 3VZOA 1WW7A 2PHDA 2JDYA 4K20A 2QQMA 2VPVA 1COV2 2VZUA 4GWJA 1DLCA 1DQ5A 2VXJA 3O5SA 1OD3A 2MPFA 2C1FA 4NVPA 3AL5A 3BIWE 3IMNA 4JDOA 5FY0A 4FPYA 4FFFA 1WCDJ 4XF0A 1RIRA 3ACFA 1ZREA 1ASJ3 3B7MA 4M3CA 4EN6B 1FOD2 1US3A 4QPGC 4XMIA 5JSRA 3V0BB 1QXRA 2RM23 1XC6A 2RR11 4HMZA 1RXGA 2RS12 3I49A 5EXOA 1XB9A 2NLRA 1TMF1 3MW4A 1NCQA 3O1UA 1RMU3 1IKQA 3H3ZA 4XXPA 4XFHA 3ZFFA 3V0AA 3BTAA 5A1LA 1V9U2 1HIXA 4LEJA 3O0VA 4IQPA 5IK7A 3AVSA 1KS5A 3HN3A 5F2SA 5F39A 5FPBA 2P5BA 1DYOA 3POEA 5FYZA 2E7TA 4JKMA 1CIYA 1PIV3 1W6NB 5KXDA 3K3OA 4JGYA 1UYXA 1KJRA 3I3DA 3VL8A 3O1PA 2XONA 2YV8A 4LKDA 4FOWA 2VVEA 3R4DB 2ZHMA 2GNDA 3KGLA 5M0TA 2A3YA 2DBIA 1FPN2 1K5MA 2G4IA 1O3TA 2RJLA 4M3CB 2QDRA 2QFEA 2Z5WA 1KDMA 2JE8A 3P1IA 4IV3A 4NIAA 3VHPA 4GWIA 3I2OA 4LKFA 3HNMA 1IPSA 3BALA 1QJY2 1W3VA 3WOGA 5FZOA 3W20A 4DXSA 4AQ2A 5F5QA 4XUQA 1PGW1 3ZFFB 1QOOA 2ID4A 1D7PM 1SLLA 3A7QA 4BU2A 3HAGA 5APAA 2YMZA 1GR3A 2IUWA 3AMMA 1DQ1A 2E7AA 3MFCA 5JDBA 4UOJA 4MYEA 4KGGA 4JHZA 2Z2SB 3ACHA 1L3JA 1S0DA 2BFUL 4LLFA 2HEYF 4QAWA 4U2AA 1LOBA 1OXCA 1UU5A 4QDRA 3KV4A 2R16A 2W1SA 2D3RA 4Q4Y3 2G1MA 1FATA 4K6BA 1XYPA 1RUOA 5JMOA 1OUSA 2O8QA 4AI3A 1QJU3 4ET7A 4LR4A 5JXHA 2XWBB 3VHRA 2QE3A 2CWSA 3NAPA 1FX5A 4IV3B 4UT5A 4XFFA 1BVVA 1OLRA 3WDYA 4FPHA 4FP3A 2B39A 1QDOA 5FZOB 1NT0A 4NE9A 2JG8A 4BMBA 3PTYA 4BQ1A 3TN92 3T4HB 4TLGA 4CCEA 2CTVA 5C33A 5LASA 3O1OA 1BEV1 1RHI2 3UETA 3PL0A 2DUOA 4AI0A 3BODA 1ZZCA 1D2SA 4HKOA 3H0OA 2Y34A 1C57A 5AC92 5EZWA 5GM0A 4CP2A 1L7QA 3S7IA 3POFA 2XJQA 3O1RA 1DP0A 2EXKA 4QX1A 3T0BA 1XU2A 4E4SA 2P6HA 4FBFA 1W3XA 3M3EA 4OI1A 4Q4V1 3HT2A 3NAPB 1YWKA 4IEZA 2WLPA 2OX0A 3OYWA 1W8FA 3LKJA 3M3QA 1EAH1 3LA7A 1Q56A 4LE4A 2JG8B 1UL9A 3ENRA 5FZMA 3GCXA 2QQWA 2QVSB 1PO22 2VCBA 2JDKA 2ARXA 4P02B 4LO5B 2R071 4AW7A 1AR71 4XURA 1YYNA 5EHDA 5A3OA 4N53A 2VW1A 3POGA 4AVBA 4FPKA 3JXSA 2BUKA 3QCWA 1OVSA 1GICA 2D5HA 4I2OA 3LWCA 5FZDA 2RS32 4W8JA 4XF1A 4CDUA 2PLV2 2NP0A 2JG9B 4EWAA 3IBMA 5C4WC 3IT8A 4AVAA 4C91A 1Y7BA 2YY1A 1Q5OA 3LE0A 4QX0A 1ZVFA 1GP5A 1V6JA 3OG2A 4XBNA 4AEDA 1YQCA 2HEWF 1IG0A 4CCJA 3KSCA 3OYWB 5F32A 1A78A 4YGCA 4LK6A 4MOAA 2PHFA 4I3GA 2C26A 2D6NA 4LK7A 3RJRA 1PK6C 5LA1A 1Y9GA 2ZZJA 3AB0A 5GZFA 4QQOA 1B09A 2VUCA 2YPJA 3VBRA 4CE8A 4CUBA 5A33A 1UN1A 2D97A 2ORZA 2BGPA 4I02A 4RHV2 3BTZA 3WW4A 4Z8BA 4OQ9A 3HPNA 2A6VA 1JZ6A 1VBB2 1H8TA 1I6XA 1KDKA 4S2GA 3I8TA 3BU0A 1W8WA 3VBHC 1BLZA 2JE7A 3WG2A 3I3BA 3HMYA 3EYPA 2Q4SA 2YPDA 2JX9A 3PUSA 4NO4A 2WQZC 4XJZA 4CDUB 3ABZA 1D2QA 3F95A 4UFKA 1CN1A 1X33A 3RI8A 1FMD1 2WAAA 4MGQA 3WDTA 3HT1A 3N9OA 3MW3A 4ASLA 3I2FA 2AH2A 4AEJA 5LB6A 4B8EA 3FL7A 3T4VA 2I45A 3JD73 1OOPC 1MS5A 1H2NA 3A0NA 1S0CA 2LRPA 4AEDB 4IXLA 1O3QA 4R4ZA 3DKQA 1E57A 4XFCA 2Y6KA 3ITQA 4CSWA 1PNGA 4ATFA 4JQRA 2H6BA 4XILA 3GZEA 4XQDA 3H7YA 3WEZA 5ISLA 2A75A 5LRRA 5FZ3A 2HYXA 4LKEA 4CEWA 4LO6B 4QB1A 5CKMA 4CDXB 4XDPA 1UX6A 4HONA 1VRBA 4XF3A 3CKHA 2TUNA 3FZ3A 4P00B 5FXVA 1DQ6A 1FV2A 4LBQA 2CL2A 4YG3A 2AACA 4META 5FZ6A 5A7SA 2JE9A 5H9PA 1W2AX 5AVAA 4YGBA 1OMIA 5JIUA 1GZCA 4LITA 2KXLA 3U11A 1YC61 5FYHA 3WCRA 4RQPC 1SLAA 5ACA3 1MEC3 1NQJA 1EYBA 2E7QA 2WC2A 3M8LA 4QKFA 3SC7X 2VMIA 4CEYA 3MIDA 3JQWA 1R092 1N3QA 4BLIA 2XMLA 1A34A 2VMCA 4NPMA 4UWDA 5CFDB 5JZGB 2DVAA 1DZQA 1US2A 1GNZA 1WW4A 1JZ8A 2BERA 3H1YA 2Y6FA 1RYYA 4Q1PA 2E32A 5FZBA 5LK5A 5FDBA 2HWE3 1WMXA 4QPWA 1G9CA 1JUHA 2DCZA 2OVUA 1GQHA 1GZTA 1HRV1 1W04A 2ZEWA 4Q0UA 4CEWB 2RHPA 5LY2A 2XQXA 3WQ7A 1HRI2 2DCTA 2XXZA 5C8CA 4NIGA 2P4EA 5DG2A 3U10A 1O8SA 2Q8CA 4E8CA 4Q27A 4EQVA 1JYVA 1VBD1 3BTYA 1WCKA 3GZUC 1AR93 2O8OA 1NYWA 3IDBB 3KS7A 3KF5A 1WBFA 3GM8A 3TEWA 2VUDA 3VKLA 1JHNA 2W91A 4DUXA 1W0NA 5ANNA 1MZ6A 5A3TA 1LECA 2X29A 1HQWA 1RL3A 4X6QB 1NG0A 1QJEA 2AGSA 2B46X 1IS3A 2GC1A 2W9XA 4XOGA 5BNOC 4QPIB 4Y24A 3EB7A 2DVFA 1PZ9A 2WZEA 3U78A 4DMIA 4YM1A 1RUG2 3BN6A 2G9FA 4GJZA 4DXTA 5C3QA 4E8DA 5HI0A 5EPAA 5LCWL 5FZ8A 2YROA 1APNA 1CAXA 2UURA 4ISQA 2DTWA 1NLRA 5IATA 2HH9A 1OH4A 3FHIB 5DUUA 3DYMA 4AZZA 5C8CB 3VUOA 1YJKA 3JBG1 4X6RB 3ZFEA 1SLIA 4KG8A 3RS6A 2JKBA 2D3PA 4NIIA 3AMPA 1ULPA 2HWC1 4JGZA 5D1IA 5FZ1A 5FMDA 4Q8KA 4NR1A 2Z42A 2VBDA 1O6UA 5GLZA 5LEKA 4AI8A 2BV4A 4XTMA 2VC9A 5IWFA 3RYPA 5GLWA 4CP9A 1UZYA 1KXGA 3ZXGA 5GZGA 1FNYA 5IVEA 2G19A 4Y1ZA 1CX1A 2PFWA 1QU0A 1A8MA 1SLTA 1UOGA 1YFUA 2VE1A 3DGTA 3ECQA 1VAKA 4CCLA 1UCXA 1UZZA 2LTNA 3AMQA 4RS5C 5JI9A 3BUCA 4LJHA 1K45A 1YI7A 4DRVA 2ZCWA 3N9MA 1LENA 4AHYA 4H3WA 2CSGA 1F5JA 2Q1ZB 1Z7S3 3TWIA 4HLTA 5JSPA 1BQPA 2XLGA 3ST7A 1CAXB 4LE3A 4QX5A 4WM8C 5F8PA 4D69A 4BQXA 4CU8A 3GJAA 5CFCB 4ONUA 5A7OA 1PGL1 2DFBA 3QD6A 2C4XA 1O8PA 4RGGA 1ACCA 1NXMA 3ZFEB 2GC3A 4BQ2A 4WM7B 1DGWX 3IPVA 2A6WA 3MO4A 4NAOA 3PMSA 3ZR6A 1SZBA 1NA1C 3CBNA 4BQYA 5K8SA 4AEKA 3I3EA 4XBQA 5BNPB 1CIWA 4UFIA 4Z92B 3M3IA 3LPGA 2ZZQA 1VRH1 1WMFA 4RSUA 4EWEA 3FLPA 2UWAA 3WW1A 2K46A 3H42B 3OBRA 1UX7A 3MIEA 3OCPA 3LD8A 4Q29A 5I8SA 3WG4A 4D8MA 5BY5A 2XOMA 1KRIA 1OFNA 1QJFA 3GBWA 1FV3A 2D44A 2ET1A 2HWB2 2ZX2A 3B00A 3B69A 3E6BA 4IGOA 5FZEA 5A7NA 5ABJA 4CVUA 1C28A 3I2HA 3FLTA 4IESA 4OHWA 2Q8DA 1UY3A 3BPZA 4MSVA 3SH5A 4F3JA 3E1F1 1POV0 3FJSA 3VBFA 4D7TA 4XMAA 2OS2A 4XZUG 4LIUA 1VBE2 3OD4A 5FZIA 5EJ3A 3PVEA 1QKQA 3HOBA 4FCAA 3FWEA 4MGTA 1W8TA 1OQEA 2W68A 2WFF3 2RDRA 3A22A 4AF9A 1AUYA 2ZEZA 3I4IA 5FP9A 5JOXA 5C5UA 5EP9A 4Q4W3 1AL21 1O4ZA 2WKKA 2Z69A 2ZGQA 4IEYA 4LO8A 3UKTA 1ENQA 4IEVA 1RUE3 4FXKB 5CU1A 2LM3A 1ND2B 2A6YA 1O5UA 3HIFA 4ZXEA 1H9PA 5EWSA 5J37A 3WW2A 5FYTA 2DYCA 1IPKA 4YW4A 5T50A 1AYM1 4CCCA 2B9UA 2JJ6A 3CLPA 4HL0A 4CUGA 4E2SA 2EVXA 3BPSA 3CJIC 3OSDA 2ZA9A 2FCTA 1ZZ9A 1CPNA 2D6OX 4HZFA 2C9KA 1OT5A 1WLCA 2CDOA 4DEQA 4DXRA 1UAIA 1MACA 3AX4A 4K1ZA 3DPRA 2YG0A 1BBT3 3KGZA 1H2MA 4OVEA 2K2SA 1RUJ3 4WVZA 3THDA 1H1IA 1OLME 3O1SA 3BKZA 3SCGA 3KHCA 5FP7A 3VDDA 3SQOA 4J1WA 3GBFA 1CAVB 4ASMB 4LHNA 4S2DA 5L36A 2R7EB 3ELNA 3BYWA 3PVBB 4PDWC 3N7LA 4R9DA 5HV0A 1Y3TA 4LT5A 3ZMNA 5LA2A 2ETEA 4C1XA 1LEMA 2QQVA 2HWF1 4XJUA 4XF9A 5C6CA 5FPUA 1STMA 2FBEA 1UY4A 1CAWB 5K9YA 5L7OA 2D6LX 4I30A 5JUVA 3E97A 1PX4A 5DAPA 1PM4A 2VBPA 2W3JA 1HV1A 1PVC1 1R1A2 5LW9A 3T1MA 5FMOL 1JH5A 4P14A 1TME1 2WFF1 3IDAA 1HJFA 2WS93 3RPQA 4BXSV 1ODMA 3RG0A 3E5QA 4JDMA 4ZS2A 1QMJA 4Q4W1 5I0SA 4C0HA 2ZX1A 4ATEA 3I2KA 2EIBA 5CNAA 2W1QA 3VZJA 2R042 2WZR2 5FZCA 3VDDB 2E31A 2FDFA 1LR5A 2D40A 3CZUA 5FZ7A 3E6CC 1MZ5A 2BW8A 1ST8A 2BQPA 3SCHA 5FUIA 1MVQA 4MHUA 4C8DA 4AGRA 4NMIA 2DVBA 2YB7A 3PJQA 2FDKA 3DUIA 1AYN3 1LOEA 2Y26A 1RVF2 3AFKA 3J8F3 2VOKA 1JZ7A 3MIGA 2RG4A 4R9CA 3WINE 5A1AA 2VMDA 3NV2A 3WNPA 5F3CA 4QQHA 2JENA 2UU8A 4CP0A 2JDHA 2JDNA 4N43C 1HDKA 3KT7A 1W28A 4XF4A 2ILMA 2XBO3 3N35A 3CIHA 1RUJ1 2XPJA 3POIA 1AR62 4KGQA 4Q4X2 3B9CA 3INAA 4I0AA 1N1TA 3PLQA 3ZXDA 4FQZA 3WV6A 4QQLA 4RR3A 3THCA 3ZPYA 3S5AA 5A3MA 1VE0A 4LBMA 2E33A 2VZRA 3MLKA 3MV11 3CZJA 4PLOA 3AZWA 3WXPA 4LUKA 4CCNA 2KA3A 2JECA 3ZYBA 4UF0A 4NIHA 2WO1A 1NUKA 3MPBA 4MUVA 2RDNA 2X5IC 5FKCA 3URFA 4AHZA 1XNDA 1EP0A 1V6IA 2V72A 4FTSA 1HXS3 4R8HA 3WZ1A 1BKZA 5FZAA 2CAVA 2VXRA 1WD3A 3OUHA 3RZMA 2MEV3 3NNMA 4RYDA 1DQ2A 5A3LA 5FJHA 1UY2A 3AKSA 2RS51 1YRZA 2RV9A 1IKPA 3RNSA 2WNEA 5FP4A 1SCSA 2UY8A 4HK9A 3V64A 2ZHKA 2ENRA 1S0GA 3B3QE 2PYTA 4GMP0 4RR3B 4O65A 5D8AC 4BE3A 5BNNC 2V09A 1W0PA 5T3NA 1PNFA 4P9YA 1OPOA 1UY1A 4AQSA 4QXBA 4YW6A 1CR7A 1W05A 5FZGA 3ZMOA 3DXUA 4Q0SA 3GALA 1J59A 3WUCA 4ASKA 1XRUA 2VOWA 2QKDA 1CQ9A 4OLLA 5F2WA 1UO9A 1XNCA 4B1MA 1PO11 4HETA 3T30A 3ZO0B 2ES3A 1JS9A 2E26A 5FZKA 1RUC1 4DUVA 5FLHA 5DMYA 1Y4WA 3FUQA 4DOUA 3UJQA 3ZSKA 3FHAA 4HN1A 4LOSA 3JCIA 2R30A 1XU1A 3SMHA 2NZ9A 3H7JA 1OA3A 2JB4A 2IWGB 4XBLA 1EV11 5DUVA 3RMXA 3VBSC 1ND3B 3O1VA 3ZLIA 4HFSA 3FN9A 1O3RA 2IFWA 3KD4A 1UZ0A 4L2NA 4UW3A 1QJX3 1I3HA 2D6MA 1U0AA 3O12A 1J3RA 1BZWA 5FYBA 4PQQA 2W39A 1D4M2 3OJBA 4XEZA 4GH4C 4UBHA 2IXLA 3MV01 2H0VA 3CQOA 1O4YA 1ZBA3 4LA2A 3PU3A 4XAAA 5E16A 1KD7A 2WNVA 3S7EA 3ZYFA 4JKLA 2VECA 1ZZ6A 4XJAA 1H8VA 4QT6A 5IVBA 1R083 1ZBE1 2C9AA 3RZHA 5CIRA 4A4AA 2OPWA 1PVXA 3JB4C 4NRPA 1S1AA 4BISA 5LBCA 3ZFGC 3SNMA 1C8M1 3ATGA 4YVSA 4FI9A 1PM7A 4ZPIA 3TEXA 2PHLA 2H0BA 3K46A 3M70A 4L0PA 4YM0A 4IDZA 1DFQA 1PZ8A 1W6PA 2DURA 2LALA 1TG7A 3LEKA 4LPLA 1IG3A 2XKPA 4PHZA 3TRSB 3WF0A 2WA4A 5DAQA 3BIEA 1RUD3 3D0SA 1W6OA 4KBBA 4FPJA 3POJA 4NWWA 3JUUA 2B7YA 1S4CA 4QHBA 2VZ3A 4Y20B 1FI2A 1BXHA 4O61A 3IM0A 1CJPA 2YXSA 3EJKA 4LHLA 5IK4A 1COV3 2W92A 3MICA 3VZKA 3VD7A 1NCRA 2P37A 3DL3A 3M3OA 1Q43A 4NHXA 3S57A 2OPKA 4NN0A 2IXIA 1FNZA 2K0GA 1ULEA 5EV7A 4CUCA 5IK5A 4MVTA 4BIOA 4ORFA 4NJ4A 4GJYA 1FOD3 5FYVA 1W9TA 2RS13 4AEMA 2P17A 2ZGPA 2F4PA 3TOJA 2KD7A 2FZ1A 3G7DA 3V0BA 1S0BA 5FBZA 2WN3A 5A3PA 1RJ8A 2P3IA 2GH8A 3Q8FA 4DXZA 1V9U3 2BNNA 2R061 3ETQA 2R1DA 3M3CA 5FQ0B 1NE6A 2VOTA 4ZZ8A 2RJ2A 5C8WA 5DZEA 4A2UA 2WSUA 3VKOA 3ZIWA 4YG6A 1R081 1YQ6A 5DPNA 3PIGA 5FY8A 3AJYA 1GU3A 1GUIA 4GA9A 2BBAA 4C0BA 4IE7A 3HWJA 1MS8A 3ZYGA 2DDUA 4CDWA 3GXUA 4J25A 2ZGTA 4P08A 1UU6A 4FO9A 2AR6A 5FWJA 1VR3A 1WBLA 4TWTA 1NCQC 4Y1YA 1FPN3 5DDJ1 5FLIA 1O5LA 1UOFA 3VZNA 2JXAA 1H4HA 1W2NA 1Q8VA 2JDAA 4B29A 4CXXA 1CAUB 1QJY3 2GNBA 1G7YA 4QXKA 1UMHA 5DZGA 4F8AA 5FIXA 1AXYA 1QWRA 4YVWB 2JD9A 2RR12 4JGYC 1G86A 3POYA 2GC2A 3VV1A 3EXUA 2BZDA 1TMF2 4FP2A 4FPCA 3ZYJB 4W6YA 2GMMA 2D93A 2YU1A 4PT6A 1TNFA 4LO7A 4H14A 1WW5A 3H1WA 3LDBA 4QGLA 2PQQA 1K5MC 1E5SA 3DECA 2RMU1 3PMEA 4YYOA 4BQWA 3T2PA 4CDWB 2AEYA 1LRHA 4IV3C 4FAHA 4LXLA 4M0NA 4LLOA 4AYUA 3APBA 2YBKA 2W1UA 1LHNA 4YZ4A 3IDEA 1OPMA 1UD1A 4A44A 4ES9A 1ZRDA 1J3PA 3WHUA 4UFJA 1WUVA 3VDAA 3T2QA 2QBXA 4Y3OA 3LCPA 1UOBA 1QF3A 3OBAA 3HNBM 3TN93 4QU2A 3B01A 5K4LA 4QKNA 1XPWA 1ONAA 3NQHA 3ZXKA 1GOFA 1RHI3 1K3IA 1YLLA 3VBUB 1RUH1 4PJYA 4JDNA 1PGW2 2OKXA 5A80A 3FUOA 4PIXA 1AXKA 4UW5A 4Q2FA 2WZPP 2I07B 5FJKA 4JTNA 5L73A 3M2MA 5AC93 1O7FA 3ZKYA 4MXVA 1W6QA 1UY0A 2XGXA 4OHVA 4Q5OA 3NAPC 4X8NA 1JYWA 4N90A 3C7HA 2BPA2 3WHTA 2TBVA 2Y6LA 5FXWA 1S0EA 1UW8A 2R1BA 3EO6A 1H1AA 4FOQA 1W8UA 1WCQA 5JIAA 1ASJ1 4FTEA 3AXEA 3MHZA 4LA3A 1C1LA 2O1QA 2RM21 4YZ3A 2H6CA 4IL7A 1HN1A 1W2TA 3KQ4B 1IQAA 3WDWA 3HVDA 3H50A 4AGVA 3ES1A 4BDVB 5EJZB 1JXNA 1RTVA 1TEIA 2VNRA 4WZCA 5I0DA 1RMU1 4J1XA 5KR7A 3A21A 5IVJA 5JR2A 4HKWA 4LHSA 1PO23 2ZXQA 5AFBA 1C3HA 1PIV1 3UNPA 1CGPA 4AVTA 1BJQA 1PIV2 1BK0A 2VOVA 5FBJA 5H9QA 5E8AA 1EUTA 1AXZA 1BEV2 2X05A 3TB0A 4UW6A 1JYIA 1W6QB 3LPFA 5JAXA 4KBZA 4AHXA 2RS33 4GB33 1L7LA 1HB3A 1QHDA 4XUPA 1WMDA 2PLV3 1D0HA 2OUJA 1QNYA 2JDMA 2J1RA 2WUHA 5J1XA 2UYBA 3CU7A 4ES8A 4QGMA 2JG9A 4YRDA 3FBYA 1IS4A 2ZMKA 3AZZA 3PUQA 4PQ9A 4XUNA 3UKNA 1EUUA 2J7MA 5FFOC 2DVGA 4CZSA 3TNPB 4ZZ5A 2VMEA 3CL1A 3SISA 4N53C 2BBVA 4Q4V2 2VZTA 1URXA 3ILFA 2WZ8A 4KWKA 3U4SA 1Q8OA 1ZM1A 2B5HA 4X8PA 1GP4A 4CU7A 3AK0A 1V6KA 1EAH2 3NNGA 4KU8A 5JXIA 3D6EA 5IVVA 4ARYA 4CDUC 3KQRA 3OY8A 1LOAA 4RHV3 2PN5A 3W5NA 4LORA 1AL0G 1L7RA 2ZKNA 4EN8B 1VBB3 1YHFA 5HCHA 1W2OA 1UWWA 4MV2A 1YFWA 2R072 4J6GA 1AR72 4RGKA 4XUOA 1OVPA 1XE7A 4Q4Y1 2N7GA 2A7AA 2C5DA 3HJRA 4NWVA 2WBKA 1QJU1 4HANA 3R4SA 4U36A 3VBOB 3WDUA 2QDNA 5DG1A 5JI7A 4SBVA 2OZ6A 2XWJB 5GLVA 4AI2A 3NWKA 4HKLA 4URAA 3VBRC 1WCSA 1FYUA 2WWJA 2WO2A 2PHTA 2JDPA 2I2SA 4QQ2A 3C8XA 1HN0A 4C1WA 1ULOA 2QQOA 2DUQA 3KMHA 1H8TC 4GAZA 4M3CE 2WFPA 1NY71 3N7MA 2VVDA 4XIKA 4AL9A 2PAEA 5C9AC 3ZYIB 3OY8B 3AKRA 4I09A 4CU6A 4CDXA 4QWNA 3PURA 2WNOA 1LU1A 1ZA7A 3MPPG 3QOPA 4N9HA 1BYHA 4FFHA 2V5DA 2E9QA 2WABA 4Z07A 1GSLA 3KB5A 1V0AA 4GALA 5F9TA 5FXXA 4YW2A 4UW4A 3IIIA 2FDGA 5EQUA 3WDVA 2GAUA 4DIQA 4A3ZA 3LDRA 4QKDA 4MO3M 4XDOA 1X50A 3B9IA 1R093 1FMD2 1W99A 1DGRA 4FXGB 5FK8A 5CAZA 5HCAA 1H9WA 4P9IA 1FXZA 1X8EA 5C4WA 2BNMA 3FE5A 1DGLA 4NHLA 3WF2A 4D0QA 5CFDA 5JZGA 3AVRA 4LTAA 5FO7B 4OFGA 4OI0A 3ILNA 1NLQA 1POV3 2IXJA 4XE9A 2NPIA 5E88A 4BXFA 1HRI3 3OGSA 3GHNA 4H2AA 5K0UA 1C8NA 3USSA 5FREA 2XR4A 4FPEA 5AFEA 3NNLA 1F4HA 2PQSA 2A1XA 4MH0E 4CEYC 5IK8A 4BZ4A 5JXJA 4PBOA 3UKVA 1OD5A 5FO8B 5HXVA 1VB2A 3AP5A 1CVNA 5IT6A 3IKWA 4CCMA 1SFPA 1SDWA 2ZGRA 1VAMA 5FP8A 2Y64A 5JOYA 3HBKA 1H4GA
chains in the Genus database with same CATH topology
3OD0A 1NZCA 1UKGA 1UMZA 1RUG3 1GZWA 5C4WB 4QPIA 3N7KA 3VL9A 1G6NA 4MXWB 1MVEA 4B4QA 1HX6A 1PZ7A 5HCFA 1BMV1 2DF7A 2SLIA 5K0UB 4DINB 4M3CF 5T5JA 3FBMA 4R52A 1PK6B 3ZVXA 1Q3EA 3OGJA 4ZKTB 5BUVA 1HRV2 3K51A 3V65A 4A7KA 3G6JB 4YFWA 3JB8A 4FQ4A 1VBD2 5SV8A 5FPZA 4GKXA 3ZXAC 3JD71 2Y0IA 3VBHB 3WQ0A 3A0KA 4R9AA 1S0IA 4L8QA 4KWLA 1LOFA 3CEWA 2DCJA 3PVNA 1GZWB 2Q0AA 3ZFEC 3BCWA 3ALQA 4D94A 3UL2A 4OULA 1OOPB 1MS9A 3NV1A 4JGZC 1KJLA 5HCBA 1V6NA 4XYXA 1LCLA 5I8TA 5JCTA 5CFCA 2ZAAA 1ZA4A 2VG9A 2ZS6B 1S2BA 2CGOA 2Z79A 2HJIA 4WM7A 4YSFA 3JBG2 4KNCA 4E9KA 2CAUA 2ZPXA 1WLWA 3AKQA 1MEC1 2Q8OA 3NKTA 4EN0A 5ACA1 5BNPA 1QQP3 2HWC2 3NSTA 4N7UA 4FT8A 4K1YA 2HWD3 4B4RA 2XKOA 3OGGA 3MIBA 3N4MA 1WD4A 4RQPB 2GH2A 3VZMA 1LODA 1ENSA 2AZ5A 2HWE1 4LBNA 4MGZE 4P9LA 5EYYA 4NOTA 1FT9A 1SBFA 4Y1VA 1CX4A 3KZ4C 2QNKA 3OBTA 1AR91 4YM2A 1PGL2 1LGCA 4RD7A 3TBDA 2A3XA 3P3PA 5ABJC 1AR83 3AXDA 4DRRA 1DYKA 4PCRA 5I0RA 1VRH2 2E63A 2ZX3A 4YGEA 2WL1A 3THTA 2VUJA 3AP4A 3VBFC 5JPMB 4FOVA 2MNGA 1ND2A 1Q8SA 2ZTNA 2VGDA 5BNOB 4ZU7A 4LNVA 1LULA 2CGPA 4KU7A 2D3SA 2R6QA 4L99A 3USUA 3W58A 2DV9A 4HSLA 4IEPA 2BWCA 2YGMA 2P34A 3GBGA 4IEOA 3WQ1A 2FZ2A 2BVVA 3MF9A 1CONA 1JW6A 3RJ2X 4GMP3 2RE9A 4OI2A 5CADA 4YARA 1GFF2 2YUEA 4AI1A 4YLZA 4BH9A 1NA1A 5KHKA 4B7EA 5SV5A 2XJUA 3AKTA 1SQ4A 1CAVA 1ULCA 2RJKA 4K21A 1AL22 2D98A 3RZZA 5KBFA 2FHRA 1Z7S1 3B02A 4N7IA 3DPRC 4MGYE 3NVCA 3KT1A 4Z2WA 1VP6A 2BTVC 4RS5B 4BYYA 1CAWA 1FAYA 2IXHA 4XW3A 1R1A3 5KHJA 3USUB 2W08A 3GHMA 4F7ZA 1W2UA 1AYM2 3ZYRA 1SLCA 3VDDC 3GNEA 2XVKA 1AR81 3WT3A 3ZSEA 3AYEA 4A7YA 4Y5Z0 1W6MA 3MI8A 2NQYA 4DQAA 2R043 2WZR3 2XJRA 3WCSA 3AZXA 1G9AA 5K7PA 1NA1B 3WR0A 5L7OC 1ZRFA 3AJZA 3O0WA 1RVF3 3SXWA 5FO9B 3ZDSA 4HBNA 1F9KA 4COZA 2P3KA 4AQTA 1VAVA 5I93A 1UIJA 1ZRRA 2HWF2 4WZFA 3X29B 1AR63 1H1MA 1LOGA 2VVFA 2X8KA 3R0RA 1VBC3 4Q4X3 1PVC2 1RUF3 1GNHA 1W6MB 4MLOA 1TME2 1U5XA 2CWMA 1YJLA 2WFF2 3CJXA 1AX0A 5BPXA 5GLTA 2PELA 4HVRA 1YCIA 5CA6A 4Q4W2 5JLVA 1RUE1 1B35A 4AHWA 1WMEA 1A8DA 1KS4A 2CY6A 2BWAA 2ET7A 2ATFA 1G8WA 1UF2C 4M00A 4PF5A 2XH6A 3H9AA 2XL7A 1VBA3 2P3JA 1IS6A 4LO4B 1M4WA 4PDWA 2DU1A 4AXOA 4IETA 4RR3C 5DUWA 4QM8A 2B42B 2BGCA 2WT0A 3A4UA 1X82A 1R1ZA 3N7JA 4URTA 1BBT1 5JSOA 2ZOEB 1YFYA 1MQTC 1ULDA 2OA2A 4CRQA 5H9RA 5L19A 2C0ZA 1RUJ2 5J98B 3I54A 3HR9A 2D43A 3GZAA 2A71A 5J3UA 1B35B 1CPMA 1IZ3A 2GALA 2WNUA 2UY9A 5F1RA 2GDFA 2ZJCA 1RUNA 3ZYPA 3H3UA 2NN8A 3ZSMA 5E1RA 4CDQC 2BVBA 3E6DA 4AG4A 3SH4A 4PDWB 2XL9A 4B3NA 4F83A 2ZGMA 1VBC1 3QLQA 4EROA 3EHKA 4FVVA 4OHZA 1RUF1 3LOIA 2WS91 2CNAA 1ND3A 4R4XA 5KWRA 2FMDA 2GN3A 2ZBJA 1D4M3 4XJWA 3RWNA 2RS52 1JOJA 2XJTA 3OF1A 2QUOA 3FX3A 3AZYA 4S2FA 1EY2A 3B5LB 2HKXA 2ERFA 4FAGA 1U5IA 3EBRA 1J58A 1U12A 1RUI3 1JUIA 2WNUB 1VBA1 1AYN1 3J8F1 3M4FA 4IV1C 4G3YC 4LBKA 5FRAA 1PO12 1XYOA 4E4ZA 1F5FA 4Q1RA 5KC6A 3VKFC 1RUC2 1KQRA 4OI4A 4Q0VA 4MGKE 2XBO1 3L9JT 1BVP1 1ZZ7A 2WNVC 3DV8A 1A3KA 1AJKA 1EV12 2D5FA 2A5ZA 3U0ZA 3VKMA 4N43B 1RC6A 4P9XA 4G4FA 4L92A 5DXDA 4Y20A 5DUXA 3RYRA 3LSEA 4YVSC 3RDIA 3J9SA 5CG9A 1ZNPA 1DZRA 2WIIB 3H1MA 4BPZA 3ILRA 4YG0A 5J09A 1A6CA 2DU0A 1ZBE2 5T55A 1QH6A 1HXS1 3AMHA 3U4XA 1NXD1 2YZ4A 5H9SA 1VJ2A 2MEV1 2PHUA 3NJZA 1C8M2 3I7DA 2V5YA 5LRSA 3IN9A 3M1HA 2X5IB 1NE4A 1QOTA 2PA7A 3CF6E 5GZDA 1NCRC 4TLFA 3AP7A 1I1EA 4PLNA 1XNBA 2A3WA 4OHYA 4LBQD 4LHKA 5FQ0A 1RUI1 4D7SA 4WVMA 1HV0A 1YNAA 5D8AB 3ZXFA 2WLQA 3SCFA 3DKWA 1DQ0A 1LESA 4L11A 1SBDA 4EN7B 1J3QA 4K40A 2Q5TA 3L2YA 1QJX1 1CAUA 2SBAA 3LGRA 2RR13 1JN2P 1WLDA 3EQEA 2F6BA 1HQNA 1TMF3 3BOPA 1UKRA 2DFCA 4YVWA 1ZBA1 1RINA 2A73B 1LB2A 4WVVA 5IUQA 4W65A 2R062 3MGUA 4AFBA 3ZN5A 3R05A 3MFAA 1R082 4WVMB 4FPFA 4M0HA 2BYVE 2WQ4A 4GH4B 4AWDA 2BFUS 3SHRA 2VUAA 4QQPA 1ULGA 2PAMA 2NMNA 1GKBA 4ITCA 4Z82A 2GU9A 3ZFFC 4JC1A 1LJ7A 3QACA 1RUD1 2BEOA 3MIHA 3BU7A 1VB4A 2CV6A 5DDJ2 3ZFGB 1SBEA 2WWSA 4QD2A 1S2KA 3MLJA 1N1SA 4Q26A 3LSDA 5KXBA 4Q0PA 4Y22B 3KT4A 1DU3D 3VBUA 1PGSA 3D8CA 1QH7A 1COV1 2ZGUA 1CD3G 2DUPA 3IWZA 2OZJA 5FAXA 2GNMA 2WSVA 5J48A 2RMU2 1FOD1 1REDA 2VQAA 2RS11 3V56A 4L97A 4P5HA 5GZCA 2ZGSA 1U5YA 3KLSA 1V9U1 5J96B 2ZHLA 3HN1A 4XETA 1V6MA 1LHUA 2A6XA 4H7LA 5JPNB 5LEJA 4QPGA 3R4UA 4XJ8A 5B2GB 5F6LB 5J36A 1NOVA 1O3SA 1BEV3 5F6KA 1RUH2 4WBBA 2QZ2A 4DFSA 1N3PA 4M01A 3ACLA 5KXCA 4FSJA 1LKNA 4AVVA 4Y4YA 1FPN1 4CP1A 4PBPA 1EPWA 4JV4A 4AFCA 1LGBA 1QJY1 2JG8C 4YM3A 3LB9A 4FOYA 1ULFA 1ASJ2 2E51A 2YYOA 4Y1UA 3DF0A 4Q4V3 2RM22 1NCQB 4HVQA 1C5IA 1MS3A 5GJ6A 3V0AB 3IDCB 3N3HA 2UWBA 1EAH3 3L2HA 1RMU2 3WP5A 4E4DX 4BCUA 4HK8A 1OFSA 4QPGB 2ZGNA 4K9SA 4JGYB 3AYDA 4CTEA 2JG9C 2R073 4JCKA 1AR73 2OUHA 2TEPA 4BMEA 1SCRA 1MZEA 4Y26A 5I91A 2GZWA 2CGNA 4AFAA 4B4PA 3J4UH 1K5MB 3QH7A 1LGNA 4GQ7A 4D3WA 1UPSA 3VBOA 1YI9A 3H8UA 1DDLA 2Y0OA 2DCYA 3TN91 4Y1XA 4H55A 4JTOA 1RHI1 1AX1A 2QCSB 3KCCA 2AUYA 4L9BA 1LU2A 2R0HA 4AFDA 2V73A 2ZACA 3UK9A 1ENRA 5AC91 4PLMA 4COYA 2EIGA 2XLAA 2E6VA 3ZXJA 2VMHA 3D82A 4IEWA 4TSVA 3HBZA 4GKYA 4GWMA 1PHMA 4FTBA 4AEDC 2EXHA 5A32A 1Q8PA 3FC0A 3O14A 4Q4Y2 1FMD3 4DZGA 1QJU2 2GNTA 2XJVA 2FQPA 1G9BA 1JYCA 4CDXC 1PO21 2JDZA 4XQWA 4DS0A 3KCXA 3NW4A 4WV8A 4P9GA 1WLTA 4R9BA 1H2LA 4XZPA 1OQ1A 3ZXEA 5FOJB 1NY72 1OSGA 1J1TA 2W52A 3VZLA 1DG6A 1AJOA 4OUSA 1SLBA 2RS31 4GB31 4JVAA 2PLV1 2NM1A 4GB32 3S6PA 4YZ2A 4PIZA 1RGSA 5I0TA 4JRLA 3VLBB 3SH3A 1SEFA 1DZTA 2DCKA 5CFDC 5JZGC 1YUDA 1MS1A 5A32B 2NYYA 3WUDA 3ZN4A 3P3NA 4HT1T 1IOAA 3MLLA 1ALYA 2D7FA 3J26N 2IFRA 5K0UC 2AENA 2QJVA 1PMIA 4CEWC 1GZ9A 3THPA 4BOWA 1QDCA 2JICA 2GC0A 4E27A 5JVVA 4JRAA 4RHV1 1J1LA 3FFZA 2MHFA 4GULA 5AVPA 5LK7B 4IERA 4MXWA 4N53B 1VBB1 3JQXA 3T1LA 1HRV3 4FPOB 2PHRA 5T5PA 1YIFA 1PK6A 5C9AA 1OKQA 3Q9OA 1MS4A 1VBD3 4O9GA 4QPIC 1O4TA 4B7KA 2WINB 2JD4A 4HPKA 4AQ6A 1HKDA 5GLUA 4K7JA 2OW4A 1V70A 1S0FA 3RQ0A 3VBHA 2IZWA 2OYZA 1AX2A 3WDXA 5C8CC 3VBRB 2ZX0A 3BB6A 2IC1A 4ZXKA 1KFXL 5A33B 3TYJA 3MW2A 3D4KA 1OOPA 1KITA 3OTFA 1N3OA 1DGWA 2O0OA 1H8TB 2HEVF 4V1PA 1BMV2 4KG0A 3JBG3 2OIIA 2PHWA 3AKPA 5KXEA 4P9WA 5C9AB 1LOFC 4RGAA 3QBQA 2HWC3 1G9FA 1W0OA 1YFXA 5CG8A 3NKGA 4HPKB 3UV9A 2AREA 4DY3A 1R091 1TE1B 3WVJA 1S55A 1OQDA 2YGLA 4K3UA 4TYSA 1ZRCA 3JD72 5T5LA 1H30A 2G9GA 5CFCC 1REFA 3KCYA 5KHIA 4KWJA 2VQ0A 5T5OA 2P2KA 1AVBA 4RQPA 4MGIE 3AM2A 1POV1 2GMPA 5GZEA 4WM7C 1HRI1 3PNAA 3PVOA 2ZKLA 5TSWA 5FCCA 4LBQB 5BNPC 1F2NA 3LZZA 1QXPA 2XB6C 3LA3A 2K9ZA 1REEA 4HN0A 1NLSA 1RJ7A 2ZHNA 3R6SA 1N47A 2ZX4A 2CYFA 3GZTB 3VHOA 4IEXA 5FTTC 1VRH3 4CEYB 1XQNA 1S0JA 5ACA2 1MEC2 1RUG1 2B45X 1X36A 4LBJA 2TNFA 3WP3A 4E2QA 5CVRA 1C4RA 2HWB3 5I8YA 1TNRA 2WT1A 1TQ5A 4I0WB 4A3XA 4GIQA 1W39A 5BNOA 2VMGA 2HWE2 1WA4A 2AYHA 3B94A 2XHKA 4A7ZA 1VBE3 4XHBA 4NHKA 4PIYA 3ROUA 2BNOA 1AR92 1DGRN 3ASIA 1MR5A 1ND2C 2ARBA 1LEDA 4Q0QA 1LHWA 3CNAA 1DQ4A 3ZXLA 2Y38A 1AL23 4XXAA 4QMAA 2EA7A 2VOXA 1WW6A 1XNKA 4YZ5A 4OZXA 3DN7A 1I5ZA 3S0MA 3GYDA 4XQ4A 3C3VA 1SACA 4K8FA 3VN4A 1AYM3 5T52A 4LULA 4RS5A 3S30A 4D7YA 1D0GA 4JGZB 5BNQA 3CO2A 4QGNA 4XPVA 5FMOS 3VHNA 4BIFA 5KC5A 2X53S 1QQP1 2VH9A 4ZU5A 3AZVA 4WM8A 4XHXA 5DZFA 1U5ZA 1QQP2 3HQXA 2HWD1 3B93A 3E5UA 3TNQA 3WD5A 4YFZA 2HWD2 1GQGA 1YXWA 2HWB1 2WT2A 1UU4A 2JEMA 1ZX5A 3MYXA 4OUMA 1XYNA 3WW3A 4DB5A 1RB8G 1X7NA 4I3PA 4KL1A 5BYNA 4XFGA 2HWF3 1Z78A 1VBE1 1Z7S2 1QGLA 3MDPA 5I0UA 5GALA 3PJYA 2FMYA 1XXNA 3IPVB 4BLJA 3MEPA 2VW2A 1PVC3 3BOWA 4LBLA 1GANA 1VALA 1TME3 1LOCA 3O7OA 2ZGLA 4W6XA 4WM8B 1AR82 4E2GA 1GYKA 2VULA 1HQLA 3MF6A 5FPXA 1OHFA 5KHHA 3JZVA 2Q30A 2WA3A 2VW0A 1C5HA 5ABJB 1V6LA 1DYPA 1QNWA 5J7MA 4AGGA 1VLNA 5BV6A 3UJOA 4AVSA 1JTZX 3ZX7A 1CJDA 3VBFB 4XDQA 1SMVA 5CB7A 1OA4A 3AYAA 1Y43B 4GMP1 1B35C 3GF6A 2VY0A 1I9RA 1GV9A 4DY5A 4G9SB 4XJ9A 3AP6A 2XLFA 3MIFA 3CJIA 1ZYBA 2ZMNA 1OI6A 2YDEA 3RRDA 1AZDA 3SLIA 3ZN6A 4BHPA 2Q1MA 3FFQA 1IS5A 2VNOA 1OLQA 5JMCA 1WGPA