2D98A

Structure of vil (extra ki/i2 added)-xylanase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
189
structure length
183
Chain Sequence
TIQPGTGNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSLSVYGWSRNPLIEYYIVENFGTNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDQIVAVEGFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New methods to prepare iodinated derivatives by vaporizing iodine labelling (VIL) and hydrogen peroxide VIL (HYPER-VIL)
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase 2
total genus 50
structure length 183
sequence length 189
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2d98A00
1UU6A 1AXKA 3VZJA 3AMPA 2VGDA 3AKQA 1F5JA 3WR0A 1XNKA 4H7MA 2BWCA 2BVVA 3LB9A 1H8VA 1QH7A 4HK8A 3WP5A 1ENXA 3VL9A 1HV1A 2B42B 3VZLA 1KS5A 1C5HA 4HK9A 4XQDA 3RI9A 1IGOA 2NQYA 3MF9A 3VZMA 2NLRA 3AMHA 4XQ4A 3HD8B 4NPRA 3AMMA 1XNBA 5EJ3A 1OA3A 3WX5A 2DCJA 3AKTA 1XNCA 3AKRA 2JENA 3VGIA 1H1AA 1KS4A 3AKPA 3B5LB 1XYOA 5HXVA 3VL8A 3AMNA 4HKWA 1OA4A 1UU5A 1REDA 1UU4A 4S2FA 2VUJA 5K7PA 3EXUA 3VHNA 4HKOA 2VULA 4XPVA 3VZNA 2JEMA 2DCYA 3WQ0A 3WXPA 1QH6A 2DFBA 1UKRA 2F6BA 1OLQA 2DCKA 1XYNA 1YNAA 2D97A 3MF6A 3M4FA 2BWAA 2B45X 1HV0A 1REFA 1XYPA 1BCXA 1BVVA 3VZKA 3MFCA 3WQ1A 3RI8A 1NLRA 1OLRA 3VLBB 2B46X 3O7OA 2Z79A 3WP4A 3WT3A 4S2DA 1REEA 1BK1A 1H4GA 1HIXA 2QZ2A 3LGRA 4HKLA 1M4WA 4S2GA 3MFAA 1XXNA 2BW8A 4XQWA 2DCZA 4IXLA 3WP3A 3VHPA 1OA2A 2JICA 2D98A 1W2UA 3AMQA 3WP6A 3ZSEA 1C5IA 3B7MA 1T6GC 3VHOA 3WQ7A 4S2HA 2VG9A 3WY6A 5K9YA 1H4HA 3VZOA 2C1FA 3AKSA 1H0BA 1TE1B 1PVXA 2QZ3A 2DFCA 1XNDA
chains in the Genus database with same CATH superfamily
3ZFGA 3ITQA 3APBA 4OI1A 5JOWA 2BQPA 4FFFA 1YC61 4GH4C 1LGCA 5BNPC 1JZ8A 3GBWA 1K3IA 2NM1A 1OD5A 5LRSA 3MIHA 1HW5A 4DINB 4LEJA 4FPFA 4A44A 3P1IA 1H8VA 4KBBA 3KHCA 4NIGA 4HXCA 3MDPA 3THPA 2SBAA 2GMPA 4NIHA 2BFUL 2HBTA 4MYEA 5E6HA 2D43A 2FBEA 2ZGSA 5AFBA 2IXKA 4YZ2A 3GCWA 1LOGA 5ACA3 2I74A 1JMUB 4TWTA 2VJXA 1LESA 4B4QA 4FFHA 1JYWA 4YVWB 1RITA 3CIHA 3I3BA 4ZU7A 5JWPA 2EIBA 3KF3A 4A3XA 3POIA 1OMIA 3Q9OA 3ZOIA 3ZPOA 4A41A 1VJ2A 2VC9A 2AEYA 5IT6A 3RZJA 1SLAA 1GP6A 1SQ4A 3I3EA 4LNVA 5FO9B 4ZHNA 1Y9MA 4WVVA 1W6PA 1X33A 2WS93 2V72A 3DUIA 4UF0B 4MOAA 1D4M3 4Q4W2 2EA7A 2WA4A 2PQSA 1WD3A 2W1WA 4C1XA 4RN5A 4COYA 2GC2A 2UURA 3AZWA 1MVEA 4GMP3 1UU4A 2D6OX 4XFAA 4CP9A 3D5OA 1DQ2A 4GA9A 5FPZA 1OVPA 3O0VA 1HRV3 2JKXA 1CAVB 2JE9A 5C9AB 2BJSA 1D0GA 5FZKA 4YVSB 3KCCA 4IQPA 2DCYA 2Z4FA 1CJDA 1ENSA 1EAH3 3ZXAC 2HWD1 3GZAA 2WFF3 2ZACA 2ZGKA 1MQTB 2RJ2A 3SQOA 1MS1A 2BGCA 2HWC2 4CTEA 2XDVA 4Q4X1 1AL0G 5D8AC 2ERFA 1MVQA 4QX2A 1Q56A 4K21A 1HRI2 2ZHNA 2FDJA 4Q27A 3T0BA 3AYAA 2B7YA 2L9LA 1VBB2 3AZYA 3D0JA 1BCXA 3FUQA 3IB3A 1C8NA 3N35A 3T2OA 3GNEA 1NLRA 2GN3A 2LTNA 1WLWA 4CEWC 4NHMA 3I2DA 1DU3D 4IV3C 1BBT2 4KWLA 1OLRA 4ZXEA 5JIAA 1GR3A 2W3JA 2WN3A 4N9HA 1G9DA 2XL9A 4KI5M 4N9IA 3KQRA 1PMIA 4ZU5A 1UYZA 3O7OA 5A6ZA 5DDJ1 1RUI1 5A6YA 2HWF3 4CDXC 1OFSA 1LOAA 2JB8A 4IE7A 4MGYE 3WW1A 4XAAA 4CUBA 4YARA 2XHNA 5FBJA 2VOTA 3N7MA 3N7JA 2R061 3KVAA 4CCEA 1WLDA 1X9TA 2PA7A 1OURA 2YY1A 1S1AA 5EQUA 2E53A 2R1BA 5FXXA 4AFMA 4EZHA 2K9ZA 4QAWA 4LBMA 4QXCA 4K8RB 4AGRA 5JLVA 1PX4A 2LROA 3C2UA 4Y24A 4LITA 3SXWA 3J8F1 4GZ9A 4OMCA 3VHOA 1IS5A 3PU8A 3ZN6B 4S2HA 2VG9A 4RHV3 4BQ2A 4NRMA 2XUEA 4FT8A 3THDA 4IE5A 5IW0A 5F8PA 4CP2A 1SBDA 1SDDB 3J8F2 5A3LA 5I0SA 3HBKA 3WNKA 4CUCA 1VBC3 1QJX2 4JDOA 2V4AA 4B1MA 5K4LA 2N7GA 1OQDA 3QBQA 4HBNA 4R9CA 5FMCA 3U37A 3ZFEA 3BALA 3M3IA 3AKQA 3LWCA 1HX6A 3ACGA 2P5BA 4IGPA 2PMWB 2HWE2 1VMHA 4A6OA 3TNPB 2FZ1A 4MV2A 3W21A 5A3TA 1OQEA 2VZPA 3ZXDA 3TEXA 4YM1A 1UZVA 2PAMA 2Q0AA 1C8M3 3KT4A 1Q43A 3IDBB 5LBCA 4HK8A 3LPFA 3NL1A 4JTOA 4N8MA 4MHRA 4ZZ8A 2ZEXA 1S0JA 4OI2A 1RUOA 2EALA 4XACA 1OF4A 3G6JB 5FYTA 1IGOA 3K77A 2OXBA 5FYHA 2BGOA 3PDQA 1OLME 3AZZA 1N47A 2WS92 4QGMA 1ASJ3 4GALA 4BISA 4I3PA 1K12A 5JXHA 4CDXB 2A73B 2NP0A 5FK8A 5FP4A 1RUI2 4EJRA 2HYKA 4LUKA 3WX5A 3Q8AA 4NN0A 1WBLA 4N53C 2YU2A 5A3OA 5KHIA 4CPBD 1K45A 2QQUA 5JSRA 1E5RA 2WYSA 1VAVA 2HWF2 5DAPA 4XVHA 3WZ1A 2W9XA 5BNPA 2PHDA 2MPFA 4IEYA 4AF9A 5E88A 3NAPC 4JDMA 1VRBA 3AP4A 3HT2A 1E5IA 1L7QA 2ZZQA 5EIYB 2RJLA 4IL7A 1CIWA 4IDZA 2B4KA 3O0WA 4FPOB 3ZYBA 5C71A 3S7EA 2VZVA 1FI2A 4RS5C 1HN1A 4KGQA 1US3A 4TSVA 4WVMB 3RYPA 2GC3A 4LULA 4Q0VA 2OPKA 4DUVA 1DGRN 3V0AB 4PLOA 1OXCA 2GC0A 1SHWB 2CL2A 1GZWA 1REFA 2PELA 5BNQA 4MXVA 3WQ1A 1JZ4A 3OOXA 5C6CA 1POV0 2VZOA 1TMF1 2Q1FA 4IV3B 4B7KA 4Y1ZA 2WAAA 3OGGA 4Y33A 1YQ2A 2YDEA 2Z42A 4BYYA 1VLNA 3FBMA 1U5XA 3AB0A 1MS3A 3L2HA 3EQEA 1EPWA 1BQPA 1XNAA 2A6WA 2GDFA 5CIRA 2XPJA 3IDCB 2ZX4A 1Q8OA 3B9CA 1PIV2 4JKMA 3PMSA 1TVGA 5CKQA 3M70A 2MNGA 1GQPA 3CZUA 3OEAA 1XRUA 4Y20A 2R1DA 3OPZA 3KB5A 4XUOA 3RFRA 3VDDB 1XXNA 3AJYA 1ZRFA 2Q1ZB 2DVAA 1ZA7A 4JGYC 2RM23 3G7DA 2D5HA 1KFUL 4XJWA 3A22A 1Y9GA 2YMZA 2VZTA 5LBEA 1PMJX 3UKVA 2A6YA 3BIEA 4NRQA 1DIWA 4XILA 2EIEA 5FREA 3U1XA 1RUI3 1FOD3 2HWE3 4AVTA 1ODMA 2Y6HA 2CGPA 5T5LA 4A7ZA 1K5MC 5A1LA 5LK7B 5K0UC 1H8TC 1WGPA 3FZ3A 3LSEA 1UU6A 4DZGA 5K0UB 3KV6A 2J22A 4HETA 2Y38A 2C6SA 4F8AA 3GGLA 5HBAA 1WBFA 3K48A 1YJKA 5IK8A 2BVVA 2ORXA 2W52A 1IPSA 1FNZA 3I3QA 3WUDA 1UCXA 3AL6A 5G05L 5FY9A 5EZWA 3LA3A 3KLSA 4A4AA 1X8EA 2JG9B 3OUIA 5D21A 1R091 4XBLA 3VZLA 4B29A 4HPKA 2JG9C 2QQNA 4L97A 2DV9A 3N3HA 4N43C 4QXBA 3O14A 2KM2A 2NN8A 2WINB 2BNMA 5JOXA 1VBB3 3MF9A 3ZSMA 4Z2WA 1PGSA 4ARYA 4CU7A 1LECA 4OFGA 2LUWA 2XR4A 2Q30A 4CUAA 3Q8CA 4NUBA 1UPIA 1ND2C 2VAUA 4Z07A 2VMHA 3ZLIA 3VDCA 1BK0A 3KM5A 5EYYA 2WS91 1OA3A 2P37A 4X8PA 2DU1A 3JD71 3K4ZA 3OB8A 4TLGA 2D6KA 4BK4A 2VD7A 3ZKUA 3RZMA 4Q0SA 3VGIA 5LA0A 3HQXA 3DEMA 3IIAA 1WA6X 4MADA 1EUTA 5HXVA 1EY2A 4QPYA 1STMA 4GB33 4PDWB 4RD7A 4XW3A 5LATA 3VBRB 1ZM1A 2ZGQA 1MZEA 3LAGA 3DKQA 2O8QA 3EXUA 4HFSA 1A8MA 4HKOA 4IE4A 2VNRA 5B4NA 4UXAA 5SV8A 5FZIA 4CEYA 1YFWA 3BKZA 4IEWA 2HWB2 1JS9A 5I93A 4NIAA 4XXAA 1BMV2 1PVC2 2CGNA 2QVSB 2R062 1LODA 1R1A2 1QJX3 3ZYFA 4MXWB 5J96B 4LO6B 4XC9A 5FY4A 3IMMA 5F32A 1W8NA 5F5AA 5CEHA 3TEYA 1LR5A 1R093 1Q8SA 1YLLA 5FY5A 4Y1UA 5CG9A 1IHMA 3H3LA 4A2UA 3J7MA 5FP3A 4A6SA 1NLSA 3OUJA 4XF4A 4AVSA 2FMYA 2D6LX 3UGHA 2W47A 3H0OA 1KQRA 2JIGA 5GZFA 1IKQA 2VCBA 2F17A 2G19A 2W0XA 4MGSA 4AI0A 5HCHA 5JI7A 3WW2A 3WQBA 1H8TA 4P9GA 5FKBA 3ROUA 3WW4A 2Y6FA 5F3CA 4FXKB 3SITA 3MLLA 3U4SA 4MHUA 4MUVA 3NNJA 1HIXA 1H2MA 3VV1A 5FOBB 3J9SA 4BQWA 4OQ9A 2WZR3 2HWD2 4AQTA 3SH3A 3NJXA 3GZTB 4MGZE 3DPRA 1W6OA 4J1XA 3ME2A 1FPN2 4PQ9A 4L2NA 4BE3A 1QJU1 4QX5A 1D2QA 2FDHA 1OHFA 3NAPB 1WCQA 4UFMA 3MYXA 2G4IA 4XTPA 3N9QA 3UYJA 2XVGA 2XLFA 4WVZA 4AFBA 1N1VA 5C8CB 4CZSA 1NCRB 3WDVA 5LB6A 4P9IA 1SLBA 1DGLA 5A3UA 5I0TA 3AXDA 4XFIA 1V9U2 2XKPA 3LKJA 3TN93 1NYWA 1QWRA 3T4HB 1LHNA 4BXSV 2ZBJA 2D3RA 3P5BA 5FYMA 3P6BA 4CDUB 1QNWA 1HXS1 2E31A 2JG8A 3GBGA 4XJAA 4CDWC 4ES9A 5CISA 1X7NA 5FO8B 3GM8A 1XU2A 4LHNA 4YGCA 3ZSJA 4CDWB 4CXWA 5A1FA 5JMCA 1LOEA 4O7XA 1CZSA 1YYNA 3I2GA 1UOGA 5I8SA 1J1LA 3B9IA 2PYTA 3PU3A 5JOYA 1JYCA 3HBZA 1Q3EA 3RZZA 3DYPA 2W39A 3H50A 4RA0A 3WP5A 1ENXA 2JE7A 1HV1A 1RTVA 3JBG2 4LHSA 1VALA 3B3QE 2XJTA 4M4PA 1VMJA 3WDUA 1YIFA 3NV2A 4DEQA 1SCSA 4UFJA 1HLCA 2AENA 3H8RA 2Y6JA 4COVA 2YV8A 4YW1A 1ZBA2 4NRPA 4CEYB 5LBFA 5CYYA 1HJFA 1CAWA 5BXXA 3WHUA 4E2QA 2VTFA 2B9UA 4QDSA 5JUVA 5ISLA 4PDWA 1Q8PA 1QHDA 4MVTA 4OLLA 1XNBA 1UX7A 1F9KA 3KQ4B 3LSDA 4QD2A 1GICA 2YC0A 3LFMA 1QY4A 2JENA 3DF0A 3GDBA 5FPBA 3V0AA 2QBXA 4NOTA 5A7NA 1XYOA 5I8YA 2Z69A 4QQOA 4AXOA 3SNMA 3HAGA 2R043 2HEWF 1J59A 2VMEA 4K40A 3S6PA 2JG8B 1OBNA 5GM0A 1GOHA 2R063 1R1A3 1JYNA 1GKBA 3AZXA 1RHI3 2WBKA 2WSVA 4KL1A 5EV7A 4FQ4A 5BNNA 5FYIA 1H2NA 5JAXA 1W6MA 3MIGA 3H42B 1NCRA 3DCQA 4JC1A 1JUHA 2NMOA 4M01A 3DKWA 3W58A 3WNLA 4R9AA 1U5IA 2NPIA 2K2SA 4QB2A 5C3RA 5CAZA 1W3VA 2EAAA 3DPRC 4TZDA 3JB8A 1IG0A 2AUYA 5T54A 2RS52 1C3HA 2VOKA 2YPDA 5EPAA 5FFOC 2XBO1 2WO1A 1DHKB 1J3PA 5EHDA 1RUF2 3PIJA 1AR73 4BLIA 3H7JA 1UZYA 4Y1VA 3MI8A 2IXJA 4XJ9A 3T2PA 3VZKA 5DABA 2WWUA 4QPGB 1Q8QA 3ZYRA 1BEV3 4I01A 1PNGA 4CDXA 1AYN1 4NAMA 1AR92 1COV1 2VMDA 5AC92 1JUIA 1AR63 3GBFA 5BNNB 1PO23 4DXSA 2BEOA 4ET7A 4EE2A 5FPUA 3TEZA 1W39A 1XQNA 4Q4W3 4AYUA 2CGOA 3IPVB 4OUMA 1YEWA 3FFZA 1HRV1 3M8LA 4HKLA 1F35A 2QJVA 4XUNA 3RDIA 4KMQA 4HSJA 2JKBA 2ZEZA 2X8KA 5EXOA 4AGGA 3HWJA 2QDRA 3PTYA 4JGYB 2X10A 3USSA 3ZYGA 5T5PA 4BB3A 2ADEA 3I54A 4MGTA 2GNBA 2Y26A 2E32A 1DQ1A 1RUC2 1SFYA 4RSUA 4XZPA 4FO9A 4D6QA 1J58A 1ZBA1 1EAH1 5FJHA 1RUH2 4YG6A 3R6SA 3M3EA 2RS31 2GZWA 1CR7A 2WQZC 2B8MA 4YW7A 1NAEA 4QX1A 2WWJA 2WZEA 2XQRA 2VGDA 4KWKA 5KXCA 3OEBA 4TXWA 5E8AA 1F5JA 3W5MA 4YM2A 5FZLA 3PVNA 3HNBM 1RUD2 5LZ6A 2OT7A 1TG7A 3EMRA 3JQWA 4P14A 5C5TA 5M0TA 2JD9A 4ISRA 1UYPA 1F15A 1W8HA 1NCQA 1PVC3 1YJLA 3KT1A 4E8CA 4Q4V1 1SMVA 1O3QA 4AAPA 4QXHA 3FHIB 2QQJA 1PO12 3H9AA 1COV3 3DGTA 2FDGA 2VH9A 1EV12 2VVEA 2GALA 3E6BA 2IZWA 5IK4A 1C5HA 2ZX2A 4HK9A 4K1ZA 4QPGC 4CP0A 4KBZA 4YLZA 4R52A 5A1AA 3WNXA 4FTBA 1XSRA 4LBLA 4XBNA 3MIFA 5KHHA 1JZ5A 2RR11 4R9DA 1RUF3 1UY0A 2KD7A 1UIKA 3FLTA 3WCRA 3V0BB 2WNEA 5FZ7A 5GZEA 2DVGA 3VKMA 3PUIA 1HJGA 1QMJA 1JYTA 1QJU2 1VBA2 2VMCA 3ACFA 1NQDA 1DG6A 3OGJA 1NCQB 3IAQA 3LOBA 2YG0A 3I2OA 3TOJA 4ORFA 2EVXA 3ZM8A 4PIXA 5LA2A 3O1UA 2J7MA 4IERA 1MQTA 3I2HA 3OSDA 2JG8C 4RHV2 5TSWA 1TME2 1C1FA 1N1SA 2PHFA 3MLKA 1W06A 1JW6A 1W05A 2VBBA 2X05A 3VHNA 2D6NA 1DYKA 1QDCA 1AVBA 4KNCA 4BA6A 4JZRA 4XPVA 1AX1A 4QM9A 3W5NA 5FY7A 5C8WA 3HQRA 1OH3A 1QQP2 3POWA 4IV3A 4LE3A 2A3YA 4WV8A 3USUB 5JMOA 1GWKA 4Y1XA 3VBSA 3ZSLA 4DPNA 5HV4A 1UAIA 2YZ4A 1RUNA 4JDNA 3UJQA 4E2SA 4FP2A 1SEFA 5KHGA 4M4RA 2NMNA 3IKWA 2HWE1 2HKXA 4M3CE 3Q8EA 1OT5A 2R7EB 4CDWA 1R1A1 5A33B 2WJSA 3VD9A 2PHLA 1BMV1 4BPZA 5EJ1B 1PO22 1MEC3 1VAKA 3KF5A 1O4ZA 3N9OA 5FR3A 4LHLA 4W65A 1PGL2 3ZFEB 5H9PA 4CEYC 3SEPA 4OCTA 3ZFGC 4G9SB 2PHRA 2QKDA 5CFCC 1GMMA 3E5QA 3VDAA 5T3NA 4LA2A 2G9GA 1COV2 4D94A 1H4GA 4XETA 3VDDC 2ILMA 4N43A 3T1MA 1S0EA 4RL7A 1PGW1 1ND3C 4BMEA 1M4WA 1DGWA 4AI3A 1C57A 4FPJA 2VU9A 5FLJA 5A3PA 2V4VA 2JDUA 5KXDA 2WZPP 1KXGA 5IK5A 1GBGA 1TME1 1RC6A 3AYDA 2LS6A 3OJBA 5JZGA 1P8JA 1IPKA 1GQHA 4CPBA 5F39A 4FOYA 3NW4A 1NUKA 3WF1A 5DXDA 4AI1A 4LOSA 1K5MB 2Y60A 1ZZ7A 4GJZA 1BBT1 2AC1A 4IV1C 1VBA1 4C90A 1MEC1 4IEUA 4XMIA 1CJPA 1WMXA 2HEYF 1Z7S3 1LEMA 2J1SA 2VBPA 2VECA 1R092 3CO2A 3JZVA 5GJ6A 2JWPA 3M2MA 3VZJA 1RIRA 2JDZA 1QXPA 3HOBA 5FUIA 4I0WB 5C4WC 4H7MA 2A7AA 1O5LA 4OULA 2Y0IA 5H9SA 2WKKA 4LPLA 4XHXA 3T09A 2VOWA 4AG4A 4B4RA 1QH7A 5F3IA 2PTMA 4LBQD 2RS12 3VL9A 3O1MA 4Y3OA 5CA6A 2D40A 1JOPA 2RS53 3C7FA 5DUWA 3VBHA 2ZA9A 3VBUB 3GZEA 3BPSA 1UOBA 3FHQA 4JHTA 4ZY9A 4NHXA 3WG4A 4NJ4A 1HRI3 2VNGA 4FOWA 1LHVA 3OY8B 4UW5A 2VCCA 1OOPB 1XE8A 3NNGA 4WBBA 3BTAA 5GLVA 4Y1YA 1UOJA 4AHZA 3PL0A 3ZYJB 2XMLA 3W59A 4LO5B 4C8DA 1DFQA 1LOFA 1LB2A 1F4AA 1BBT3 2RS32 1ND3B 2DCJA 4DS0A 2JE8A 4QQPA 1RINA 1WA4A 1O8PA 2V73A 3FLPA 5J37A 4MGKE 3VBFC 4DRRA 4LLFA 2O14A 1G7YA 4H7LA 3WINE 3VD4A 5FYUA 3N4MA 4UAPA 3ES4A 4S2FA 3BTXA 4CVUA 4INDA 3VB9A 5K8SA 1AL21 3DXUA 4JAAA 4UBHA 2J1TA 1I1EA 1QJFA 2A75A 5CFCA 2WFF2 4LBQB 4GB32 1VRH3 2Q8EA 1QJY2 2GU9A 2PLV2 3KV5A 3OBTA 4O61A 3DXTA 3FWEA 4IV1B 4R9BA 4OI0A 4CCNA 3ILNA 3I2FA 5L19A 1Y43B 3HT1A 3ELNA 3S30A 4AFCA 1GYKA 1EYBA 1PK6B 1GZWB 1QOTA 2I07B 3MICA 2V5YA 1WWYA 4Y5Z0 1XYNA 3KD4A 5FTTC 3ZYPA 4AFAA 2P1BA 4QKFA 2R0HA 1B35B 4QPIB 1DQ0A 3PHMA 3URFA 4EN6B 1SPPB 3CJIC 4IEOA 3VBSC 1NA1B 1WCDJ 3JCIA 4NPLA 3U75A 3RI8A 4MX3A 2OZ6A 3OPWA 3OD0A 3RJ2X 3KCYA 3ZFGB 2PHWA 3T0AA 1MS0A 2UY9A 2VW2A 4LK7A 1MS5A 4COZA 1O91A 3S7IA 4QMAA 4U36A 2SLIA 1LGBA 1REEA 5FZHA 3UESA 4YFZA 1XPWA 1QEXA 5FXWA 2MEV1 2JB4A 2XVKA 3V64A 3WLUA 1LAJA 3IN9A 1LHOA 1FAYA 1LJ7A 3J8F3 1W03A 2W1QA 4BQXA 1W0PA 3GF6A 4PI2A 5IVYA 3FLRA 4Q4Y3 1W2NA 4XZUG 5LEKA 3LEKA 3POYA 3O12A 1DP0A 1YUDA 5DG1A 2Q8OA 3KMHA 1Z7S2 2D6MA 4IEVA 4Q5OA 4BK5A 1VPHA 1OLMA 2RS33 3H3UA 5C5UA 4YVWA 1GFF2 2VZ1A 4QKNA 4PIYA 4LK6A 3AKSA 4XURA 3WV6A 3PVBB 2JIJA 1CAVA 5JXGA 1EUUA 4LLOA 2R071 4XQDA 5DQ0A 3ILRA 5FZ3A 4QM8A 2VQTA 4PF1A 2QQKA 1GP5A 3WF0A 1LCLA 5CU1A 5JVVA 1OF3A 1F31A 2WT2A 3MHZA 1YQ6A 2H0VA 2E9QA 5CFDB 4LKDA 2PN5A 5HI0A 2H6CA 3NJVA 4D6RA 1Z7S1 2RJKA 1AYM1 5GZCA 2O1QA 1JH5A 2NQYA 2VQ0A 4BJ0A 1RMU3 1QJZA 1LNSA 3JBG3 1AF9A 5FPLA 3VBOB 3MIEA 1NY72 2XJPA 2XL7A 3KGLA 3VHRA 4QX8A 4RFRB 2CYFA 3X29B 5IVJA 3M3CA 5KXEA 1YFYA 4XXPA 3UKNA 3AVRA 4LJHA 3ZN6A 3TN91 1VBD3 4K20A 3VBFB 5IVFA 2I45A 3CJIA 5CBLA 2GP3A 5IFPA 1SFPA 2YPJA 2FDKA 4RGGA 2HEVF 3WDTA 3E1F1 3O1VA 1BXHA 1VMFA 1UU5A 3ZN5A 3TWIA 3RNSA 1GUIA 1LOBA 3B01A 4WM7A 5GLTA 5IVCA 5FP9A 1G86A 1XSQA 3WNNA 2DBIA 4HN1A 4D3WA 3AFKA 1GNHA 3U78A 2V5DA 3DYOA 2JD4A 3W20A 4YSFA 3WG3A 4RGKA 2JEMA 3S5AA 3A4UA 4KGGA 5FZGA 4BLJA 4CDUC 1KEXA 5GLUA 3AP6A 3POEA 3NMBA 2GP5A 5HCBA 2DVDA 3FBYA 1W6PB 4PHZA 2EXKA 3W9AA 5CKNA 3BODA 5C3PA 5IK7A 2OA2A 2B45X 2HWC1 2VL4A 1H6YA 1HV0A 2YC2A 4UFIA 5A7SA 3V65A 4LKFA 4AEDC 2BPA2 3UGGA 1F2NA 4EN0A 4EN9B 3TB0A 4QHBA 4YG3A 1S0FA 4PT6A 1ALYA 2ARAA 1LHWA 4LQRA 1HQNA 5BNNC 2UYAA 1YWKA 5L7OB 4MG2A 1UZWA 1VB2A 1D4M1 3ZFEC 4HVOA 3HMYA 4Q0UA 2IXLA 4P9WA 5L9RA 5T5JA 4DFSA 1RUD1 4Z2AA 4Q1RA 1CX1A 3WP4A 1XE7A 3QLQA 3BU7A 2OQ6A 2RM22 5FV3A 1W9FA 3HR9A 2HWB1 2VUDA 2YYOA 2CTVA 3OF1A 2XKOA 1YHFA 4LBNA 4XF0A 4YW6A 2BW8A 3SEEA 4C1WA 5J7MA 1YCIA 4TYSA 2ZGPA 4AEKA 2X53S 4AWDA 2YGLA 1W2UA 3WG2A 1LGNA 2VE1A 3H1MA 3RRDA 1S2BA 1W6NA 3FUOA 4NAOA 5LRRA 3WQ7A 4CCOA 2B5HA 4RR3C 3IDEA 4CU6A 3AZVA 4MSVA 4D69A 1VBD2 3R4SA 3SISA 5F6LB 5FXZA 3BTYA 1ZYBA 2DUQA 2VXRA 1TE1B 1KITA 3WCSA 2J1RA 3MIBA 1BEV1 5EWSA 2ET7A 1R64A 3BPZA 1UZZA 4NHKA 5BNOC 2XJQA 1F8VA 3LPGA 1QOOA 3OCPA 4GWMA 3RWNA 3UL2A 4AEDA 3RZHA 4FPKA 1QJEA 3MPBA 5F2WA 1CAXB 2HWF1 4K8FA 1MEC2 3WUCA 4GULA 2OW4A 2D7FA 5IAVA 4ZKTB 1W8ZA 2VOVA 3E6DA 2OKXA 2ETEA 1JU4A 2HWB3 3AL5A 2XG3A 1RJ8A 5A6XA 1O3TA 4WM8B 4Z82A 2J1VA 3N36A 3AXEA 3B93A 4DY5A 3ENRA 1Y7BA 1RUD3 2AGSA 2OPWA 5FZBA 4A7KA 5C70A 1T2XA 3ACLA 1QF3A 2ZX0A 1AUYA 1ZVFA 2ZEWA 1ONAA 5T5OA 3IIIA 4QB1A 1VBE3 5CZKA 4WVWA 1PO13 4IGQA 5FY0A 1W6QB 2YFUA 3U07A 4LT5A 4NROA 2ZKNA 2R49A 3QH6A 4WM7B 1WCSA 1VBC1 4D8MA 2H0BA 1LEDA 2OX0A 3A21A 3CQOA 2VW1A 4UF0A 4XF9A 2GSYA 4XJ8A 4QKDA 3U11A 1ULOA 2YROA 1XNCA 2D93A 4JRLA 1GV9A 2ZEYA 4E4DX 2YUEA 5C8CC 3K3NA 4AQ2A 4LOTA 2X09A 1H30A 3MV11 1Z78A 2ZZJA 3K2OA 4Q4Y2 3TEWA 4YPJA 3OPTA 2VXJA 5JR2A 3UT0A 3I3DA 4TTGA 1UWWA 3OBRA 1JZ3A 3AK0A 2E7QA 3BOWA 3P3NA 2R0FA 5GALA 3OBZA 1QJX1 1WW7A 1SACA 1VBD1 3LE0A 3MGUA 2RMU3 2Y6GA 4GH4B 1JHNA 3Q8FA 4QHZA 4W8JA 5EJZB 2IFWA 2PHUA 1NXD1 4WZFA 2JDYA 2CWMA 3NNMA 2XLAA 4GKYA 1QQP1 2JECA 5F7UA 2QE3A 3VD7A 2FD8A 2D97A 4KH9A 4OMDA 4XFBA 5KXBA 2XLGA 4EV0A 3CMGA 4UI9L 1C1LA 2WFPA 2ARXA 4PLNA 3VBUC 4I2OA 1OKQA 3MV01 1H2KA 4AI8A 1ZNPA 3GZUC 1HB1A 1VBE1 4AEJA 1QJU3 4PJYA 4JV4A 4V2VA 5C3OA 5I0RA 1RXFA 2VO5A 3DYMA 2WZR1 1GANA 2G9FA 1W8FA 1ZZ8A 3B02A 4HZFA 1SLCA 2GNDA 1GLHA 4E4ZA 1CIYA 1SBEA 1GU3A 2VVFA 1S0GA 4AOCA 1RUG3 3EHKA 3OD4A 4E8DA 3U14A 4LR4A 4BWOA 1CGPA 5K9YA 4BOWA 3RJRA 2QFEA 4B4PA 1AR83 1W6QA 1S4CA 1XNTA 2BP6A 4YW2A 3B00A 5F6KA 1PNFA 4CP1A 1L3JA 3CZJA 4Q26A 3LF7A 5HV0A 4LE4A 2Y33A 3ZMOA 2BU9A 4W6YA 3PUAA 3I49A 4PQQA 4AK3A 2FCTA 2O8OA 3AMPA 1WCUA 4AHYA 1W6NB 4FVVA 5ANQA 1ULEA 3D6EA 1HXS3 4XABA 5FPVA 2ZXQA 2ZS6B 4N7UA 5FLIA 3H1YA 3CJIB 1U0AA 3L9JT 2OYZA 2W1SA 1KS5A 1LOCA 2O0OA 2RDQA 3RWKX 2QQOA 1XB9A 1NY71 1F5FA 2FCVA 2WIIB 2VOXA 3JB4C 1J83A 3LIGA 3Q8BA 4IV1A 4L9BA 3OG2A 1OKOA 4NVPA 1BLZA 3J26N 4AEMA 2WNUB 4BXFA 4D6SA 4NWVA 2AR6A 2VY0A 4XDQA 1OUXA 5CFCB 2R30A 5ACA1 1PVC1 1W0OA 1T6BX 4IEXA 4B7EA 5IHRA 2D5FA 4AL9A 1E57A 4UBGA 2PQQA 1O8SA 1JYIA 4OHWA 4GKXA 2DF7A 3B5LB 5LASA 1UQXA 5F3GA 2YBSA 3DECA 3MW2A 3S5QA 3VUOA 1ZREA 1ND3A 4QHOA 2NYYA 3AMNA 1AYN2 3VD3A 1BHGA 1RHI2 2W95A 1NKGA 4XCBA 5IVEA 4CCMA 2X5IB 1K5MA 4RGAA 3NNFA 1SCRA 3WSOA 1GWLA 1I5PA 3IZOA 2P3KA 2XBO2 1V6LA 4KWUA 1QU0A 4A3ZA 2RS51 2Q1MA 1PHMA 1IS6A 3MW4A 4HVQA 2DFBA 3I7DA 3WD5A 1UKRA 4L8QA 1IS3A 2BTVC 2ZGMA 1W8WA 1AR61 1WLCA 2OIIA 5JIUA 3CJXA 2BFUS 5FYVA 2IFRA 3T2QA 1LHUA 4NHYA 1WMEA 3OGVA 1U5ZA 4RQPA 5FBZA 5FQ0B 3N9NA 3UV9A 4Y5SA 4QX0A 1KFXL 1XOYA 2JDKA 4P08A 2XJVA 1POV1 1YO8A 1HRI1 1Z0HA 4GMP0 5DZGA 5DN2A 3BU0A 1PM7A 4LBQA 1A6CA 3IBMA 1CN1A 4FXGB 3RS6A 3N9LA 1W9SA 5C3QA 3JD73 3H7YA 4EWEA 1OOPC 4LTAA 1KDKA 1ZBA3 1JU3A 5DDJ3 2DYCA 3M3OA 4M0NA 1QNYA 3FE5A 1SG3A 3SMHA 2BGPA 4J6GA 2WUHA 5F5IA 2A71A 5FMDA 5JDBA 1MR5A 1X8MA 2GC1A 4L0PA 4V2WA 1PK6A 2XWBB 4YW5A 3POJA 4QQ2A 3ETPA 2WNOA 3KSCA 5L9VA 2AACA 4GB31 4P02B 4KG8A 2VZ3A 4FPCA 4YFWA 1PVXA 1H1IA 1UL9A 2QZ3A 5FZ1A 4DXZA 1D4M2 3CU7A 1LKNA 4CSWA 3AM2A 4CDQB 4Q1PA 1AXKA 4RS5B 3EYPA 4P5YA 1KDMA 1UN1A 2E33A 1TME3 2VCMA 2RR13 1UYXA 1OH4A 2WT0A 3PTRB 4LIVA 5A7OA 4ZPIA 3MUY1 3SC7X 1V00A 3N9PA 4XUPA 2UU8A 3RPQA 3FHAA 4DQAA 1ZRDA 4F7ZA 3NQHA 4FFGA 4L92A 1X36A 4UT5A 1CAUA 1ZZCA 4Q4V3 1NA1C 1C8M1 3ZYIB 2XJUA 3IPVA 1SLLA 5F5CA 1VB4A 1UO9A 1OOPA 1WLTA 4TN7A 3OY8A 3CF6E 1XE0A 2VCAA 4Z1VA 1UOFA 1X82A 2A6VA 1WMDA 1AJOA 2WN2A 1GOGA 2EIDA 1YFUA 2EAKA 5GKAC 2IC1A 2J1AA 2PHTA 2VUAA 2ZGOA 5T55A 1L7RA 3VD5A 5AC93 1AR62 1DZQA 1RUF1 4JCKA 5JZGB 1ASJ1 1B35A 4QPIA 1FOD2 4XIOA 1UKGA 1W2TA 3C8XA 5EYXA 4JGZA 2K46A 2P6CA 4LIUA 5DAXA 3LA2A 3UJOA 3ZDSA 5A32A 5A70A 3RYKA 3TN92 1S0BA 4OZOA 5A3MA 1RUJ3 4YW4A 5FOJB 3ASIA 4MGQA 5FP8A 5FIXA 3VBRC 4OQ8A 2BERA 3LOIA 2DURA 2CDPA 1ULFA 1ZX5A 1IPJA 5FK7A 1ZRIA 4LBOA 1BYHA 2YBPA 1QDOA 3ZO0B 2WWSA 5LEJA 3CKHA 3LEIA 4I0BA 1ACCA 3OYWA 5F9TA 3I8TA 1CESA 4N90A 4JQRA 4E27A 2ZGTA 5CFDA 2OS2A 1NT0A 4IEQA 4ISQA 2C24A 2DCKA 1AHSA 2VMGA 4FPYA 4AVAA 4Q8LA 2UWBA 4GQ7A 3A0NA 4IGOA 3KS7A 2ATFA 2P4EA 2J42A 1KJRA 4AI9A 5BV6A 3USUA 4DXTA 1RVF2 3BUCA 2FQPA 1TNFA 4P9YA 4LKSA 4XCAA 3T4VA 3GJAA 2Y8KA 1FMD3 1CVNA 1CONA 4I09A 4ZS3A 4AEDB 5JI9A 1WW6A 2ADDA 3R0RA 4AR2A 4IETA 3H8XA 4BM8A 1PGL1 2GNMA 4CCKA 1Q5OA 2RV9A 1DQ5A 4COUA 5ACA2 1DCSA 2ARCA 3CBNA 1W9TA 4IEZA 4S2GA 5FZ4A 4OVEA 1L7LA 1WD4A 4GIQA 3ZXLA 1JYVA 2IVJA 4XYXA 2JDAA 2JICA 5C33A 3VDBA 2DVBA 4XJUA 1CD3G 1QXRA 2QUOA 3I4IA 1T6GC 4K7JA 4P9JA 3VKLA 3O1RA 2MEV2 3PMEA 1FPN3 1H4HA 1NZCA 3ACIA 3T0DA 2A6ZA 1S2EA 1UF2C 5C9AC 2WL1A 2W91A 5JR7B 2KXLA 1H0BA 2R041 3WEZA 1A34A 2UWCA 1YQCA 1MZ6A 5IAXA 1XNDA 2A6XA 2P17A 3MFAA 1OD3A 3HEIA 5I0UA 1MQTC 1N3PA 2JJ6A 2WRAA 5F5QA 3UK9A 4IESA 2KA3A 2XBO3 4V1PA 5C8CA 4JGZC 2A1XA 3J4UH 2ZX3A 3CEWA 1B35C 1MACA 4QPIC 3POGA 1O6UA 2DUOA 3FX3A 2YXSA 3WNPA 4MLOA 2Z5WA 1UW8A 4KQ7A 1DYPA 2VNVA 4W6WA 3NWKA 2B42B 2BBAA 5FAXA 1VBB1 4J25A 1O7FA 3SCFA 5A3NA 4KU8A 5CNAA 2Q4SA 5GZDA 2HWD3 4KWJA 5I91A 3FJSA 1OPMA 5B2GB 3P3PA 3BGAA 4CCCA 1URXA 4G3YC 1J1TA 5FMOL 1W04A 1FYUA 4OUSA 4Q4X3 3ZXFA 1V6JA 2GNTA 3LEMA 3AMHA 4ASLA 4AVVA 1U12A 3GYDA 2CWSA 3HD8B 4Q0QA 4XQ4A 4CU8A 1LU1A 5FO7B 1I3HA 2Q8DA 2RDRA 5ABJB 3RMXA 2DUPA 3T08A 2YHJA 5ABJC 4B1LA 1I5ZA 2A3XA 2BRTA 1C28A 1VBE2 2TNFA 3I97A 2DBNA 3GJBA 3EBRA 3WHTA 4QB6A 1X50A 2DTYA 2GMMA 3CDZB 1NE6A 1JN2P 1TMF2 4MXWA 4NIDA 1B09A 2E51A 2W2IA 5FY8A 4AW7A 5FYBA 1OPOA 3HN3A 4DY3A 1NE4A 3E5UA 3BCWA 3CLPA 3VZNA 2WO7A 4ASMB 4CDQC 5CADA 3VBHB 1PZ7A 4QKBA 2JXAA 4BIOA 2PFWA 2ZHLA 1GQGA 4NIIA 4QGLA 5APAA 4DIQA 4M3CA 1D7PM 4LHKA 4AQSA 2F6BA 4GWNA 5DPNA 3NO8A 4Y22B 4CRQA 3N7LA 1FMD2 2HH9A 1O59A 3FN9A 3IMNA 4PLMA 1YNAA 4XFFA 4WZCA 4AAXA 4BQ3A 5D8AA 2CAVA 5FYSA 1AR81 4YM0A 2RMU2 4Y5TA 3NKGA 4COWA 2VQUA 2RG4A 1ZZBA 2PAEA 2IWGB 4R8HA 2QNKA 4AHXA 3VBSB 1G9BA 2DVFA 5LCWL 2WO3A 1CPMA 3V0BA 2WLPA 3QACA 4XDOA 5J3UA 5FZOB 1JYXA 4ZXKA 2J1UA 1TZOA 5GLZA 4MZUA 2PXJA 1S55A 5FLHA 4ATFA 1KRIA 3AP7A 1V6IA 2W08A 3SCGA 1JZ2A 1QIQA 1NA1A 2Y6LA 1JOBA 4QPGA 3ZIXA 3ZR5A 3LFIA 4GWJA 4OUEA 5DAQA 4BHPA 1UY2A 4Y4RA 2B39A 2MEV3 2Q8CA 3JUUA 1WZXA 2AEZA 4QDQA 1R081 4YRDA 4QQHA 3WP6A 3ZSEA 4F3JA 3B7MA 2WR9A 4TLFA 1UY3A 3VKFC 3JU9A 3ZXEA 1CAWB 2EXJA 1W6MB 1KD7A 4BDVB 2XXZA 3ZX7A 2LALA 5BY5A 3LZZA 1H8TB 4AVCA 1Y9QA 3MEPA 2D44A 2R6QA 1RUG2 4R4ZA 5LBBA 3WG1A 4CE8A 5LK5A 5H9RA 2E26A 1US2A 5FZOA 3LA7A 3E6CC 2WQ8A 1VRH2 2BVBA 3JBG1 3THTA 5J1XA 1AR82 4IUGA 3ZN4A 4LMFA 2BWCA 2JDNA 3POBA 1PM4A 4DMIA 1F4HA 3NJZA 4D0QA 2JDPA 5A3WA 4PF5A 2TBVA 4LO8A 3ZMNA 4M3CB 3ECQA 5ANNA 1W8TA 2J1EA 1SLIA 3RI9A 1SDWA 2ZAHA 3QCWA 3O1PA 2AZ5A 2ZGRA 1E5HA 1UIJA 1RJ7A 1EV13 1VE0A 4Z8BA 3I2IA 2BOJA 3KWVA 1LULA 4HSLA 1V9U1 4ZS2A 1ND2B 2BDRA 2QCSB 1DBNA 3MBWA 4IE0A 1V6KA 3S57A 1X9PA 3M7AA 1ZZ9A 2RM21 3ZSKA 2WDBA 4DB5A 4XIKA 4DEVA 5FJKA 1ST8A 5GZGA 1TMF3 3AKRA 2GN7A 2B9VA 5LA1A 4CA9A 2JDMA 2WC2A 2ZGUA 1EPZA 2DDUA 2XOMA 2YBKA 4CCDA 2ZMKA 2Y34A 4DXRA 3IDAA 4I3GA 4XUQA 1FV3A 5FP7A 2LM3A 1HN0A 2ZHMA 3UKTA 4O9EA 3ZPYA 4HG6B 1RL3A 4AI2A 1G9CA 4A45A 2XHKA 5KC5A 1DGWX 2RVAA 3VBHC 2RR12 2QQPA 3SCHA 3PIGA 1G8WA 3WQ0A 5T52A 1I9RA 1YI9A 3BYWA 5E89A 5FZEA 3O1TA 3MZHA 2JG9A 3D4KA 3UNPA 5D8AB 1V9U3 3OBAA 4X8NA 2OQ7A 4Q4V2 3ATGA 5JSOA 2C9KA 1W6OB 2BWAA 2C9AA 5HXMA 4FSJA 4XF1A 1H2LA 2WNVC 2OUJA 1PX3A 2WT1A 3HQUA 1G9AA 4N43B 2X29A 4YM3A 1S2KA 2HWC3 1ND2A 2EF6A 3RZLA 2QQWA 1APNA 4XFCA 5LY1A 3VLBB 3WVJA 2ZMLA 1XJAA 4Q4W1 2V09A 3UETA 5FYZA 5DMYA 1A8DA 1HDKA 5JOZA 4FTEA 3C7OA 4GXLA 3WT3A 3VBRA 1E5SA 5JSPA 1AX2A 3IM0A 5LW9A 5JZGC 1NG0A 3ZXKA 1QXJA 2E7TA 5H9QA 5FMBA 5A33A 1W28A 1FV2A 3L2YA 4C91A 5FPAA 2ORZA 4JGYA 4H3WA 5FZFA 5F1RA 1DLCA 1AYM2 4CXXA 3AMQA 4U2AA 4Y22A 4YG0A 1DDLA 4FTSA 3GHNA 2HLEA 1TEIA 5HCAA 1QJY3 3UGFA 1VRH1 4Y20B 1ZRCA 2XWJB 2ZKLA 2VPVA 3HNMA 4FP3A 5JPMB 1DLLA 2C1FA 4NR1A 4Q29A 3S0MA 5FZ6A 4JQTA 1Q8VA 4K3UA 4AVBA 5F37A 3LDRA 1SZBA 1XBFA 3BTZA 4OHYA 4P00B 2WQ4A 3PJYA 4HPKB 5FMOS 3SH4A 1RGSA 1VBC2 4ONUA 4FAHA 5LWBA 4EROA 5SV5A 4P5HA 1G6NA 3HPNA 4BQ4A 1K5JA 3ZR6A 4RHV1 1PK6C 3RVHA 2VZQA 2PHXA 3LB9A 4RQPC 2ZABA 4QDRA 1H6XA 3VKOA 2AYHA 2CU5A 1DGRA 2ZGLA 5DUXA 2ZHKA 1IG3A 5FUPA 4JX0A 2WSUA 2ZPXA 1RB8G 3DL3A 1HB3A 2W92A 2YC4A 4FPGA 4CUGA 3IWZA 1DZTA 1UMHA 2F4LA 3VZMA 4FAGA 3GXUA 4GMP1 2BV4A 1WCKA 4J1WA 4H55A 3QD6A 4AFDA 4XBQA 4HMZA 3T30A 4RFT0 4HOOA 1AR93 3EJKA 3NAPA 4X6QB 5IUQA 4L11A 2RMU1 1ZBE1 3A7QA 1GNZA 1QJY1 1HKDA 4EWDA 3MO4A 3LQCA 2WFF1 1ASJ2 2OUHA 3T1LA 4HKWA 4QPWA 2FHRA 2W5FA 5F2SA 4UW3A 5G04L 1U5YA 3NKTA 1JODA 2ZAAA 4P9XA 1PZ8A 5ERLA 5DAVA 1PIV1 1HQLA 2WYFA 3LD8A 2YFZA 5BYNA 2VULA 1DZRA 1G9FA 1JTZX 1RXGA 3DV8A 4YGBA 4XTMA 1C8M2 2QQMA 4E4SA 5BUVA 3C7GA 2VM9A 4LXLA 1JZ7A 4Z92B 3AP9A 1CAUB 3AYEA 1A78A 1BEV2 3NV1A 2R073 4BQ1A 4ES8A 1H9WA 3CHXA 3INAA 2Y64A 1XC6A 2W87A 4NHLA 4ARXA 3WF3A 2VZSA 4AQ6A 1UMIA 2P3JA 3K3OA 4IW3A 5BPXA 5ABJA 4BH9A 1XYPA 1RMU2 3LIHA 3VDDA 5FZ9A 2Q5TA 4FOVA 1ZBE3 1BJQA 4PBOA 4DNYA 3LDBA 4FQZA 1HXS2 5CKMA 1A3KA 2BOIA 2RE9A 4ATEA 1OVSA 2P3YA 3QH7A 2DWRA 4XDPA 4ZONA 1AYM3 4S2DA 1RUJ1 4FI9A 3JXSA 3AX4A 1Y3TA 3K75B 4E4HA 5J09A 2IXHA 2QZ2A 3RYRA 4Y26A 4C0HA 4FFIA 2D6PA 1CQ9A 2TUNA 4JHZA 4JVAA 1O3RA 3PNAA 4DRVA 1O5UA 1W99A 3ALQA 1UZ0A 1YIPA 4XQWA 4IXLA 5E1RA 3WP3A 1QKQA 3AC0A 3RGBA 5FYYA 4E2GA 3GCXA 3I2KA 2CSGA 3K4AA 2BBVA 1MS8A 1POQA 1R1ZA 1NXMA 2E6VA 2CV6A 2D3SA 2DU0A 2PLV3 3ST7A 4BZ4A 4PDWC 3WY6A 2UY8A 5FWJA 1VBA3 3K51A 2CNAA 1UPSA 1W0NA 4OHZA 1H1MA 3D0SA 2RHPA 2ZJCA 3VZOA 3PVOA 1YI7A 1BZWA 2BUKA 1NQJA 4MH0E 3C3VA 4K1YA 1W8OA 2FCUA 4LBJA 2DTWA 5KWRA 3SH5A 3N7KA 4UOJA 4YWAA 3LCPA 1DYOA 5BNPB 5FZMA 2XQXA 4ZU4A 1OSGA 4QWNA 4RQPB 4B3NA 4A7YA 2VQAA 1AZDA 4UFLA 1I6XA 1FX5A 4L99A 3ZFFC 3R05A 5KR7A 5FYCA 5FDBA 3O1SA 4I30A 3RSJA 1IZ3A 5D2AA 2QTWB 4CDQA 4YGEA 1PO21 4KG0A 1WW5A 2HJIA 2YU1A 4NMIA 5FZ0A 4F83A 4CYDA 5CG8A 5C9AA 4I02A 3NVCA 5IFTA 5FXVA 3GHMA 2X5IA 1HQWA 2D3PA 3AMMA 4QU1A 1LU2A 2QQLA 4XAEA 3OUHA 4XF3A 2ZGNA 3ES1A 1GZ9A 3KCXA 4UFKA 1ENRA 2CHHA 2P34A 2XGXA 3NV3A 2W94A 3AKPA 1M06G 1JHJA 5L9BA 1LRHA 3VL8A 2VBDA 3JD72 3I3MA 4BIFA 2ID4A 3OYWB 3LEGA 1REDA 4FCAA 4PI0A 1UX6A 4CDUA 4RS5A 2CAUA 1OI6A 4EYUA 3M3QA 2X5IC 2ET1A 3MLJA 4XE9A 3AYCA 2WNUA 3ETQA 4D7YA 5EFUA 2GMEA 3BIWE 1VP6A 1AL23 2WABA 2VTXA 4Q0PA 3AP5A 1GOFA 1V6OA 4Q2FA 3JQXA 1YQ5A 3ZFFA 4AE2A 3D3AA 3SHRA 3T3YA 1LENA 2A70A 4JGZB 4OI4A 3HJRA 4M0HA 5C4WB 3DPRB 1LTEA 3U0ZA 3MF6A 3D82A 1CPNA 1GZCA 2LW8A 4HN0A 5J98B 1POV3 4WVMA 1WUVA 1FT9A 2XJRA 5C3SA 1VAMA 2E7AA 3CNAA 3KT7A 5FKCA 5CB7A 1GSLA 3ZXJA 3MUZ1 1WW4A 1V6NA 3NJYA 5DDJ2 4E9KA 2P2KA 4JKKA 2HYXA 3F2ZA 3M1HA 4JRAA 5IATA 3VBOC 4NPMA 5J48A 2FMDA 4QX7A 3MPPG 2B46X 1RUE3 1ZA4A 5HCFA 1W90A 5DUVA 4GAZA 4M3CF 3SLIA 4DOUA 1GP4A 1BK1A 1ODNA 4PCRA 1YRZA 1D4VB 4SLIA 3ZVXA 2FDFA 3TBDA 5A32B 4RR3A 3FMGA 2DCZA 5FQ0A 1K42A 1SLTA 1MZ5A 1CWPA 5B4XA 5FZCA 1J3RA 1RUH1 1FMD1 1CAXA 1IKPA 3PJQA 4CCLA 1EV11 1AXYA 3ACHA 2OVUA 1NX9A 4HANA 2WA3A 3ABZA 1CZTA 2WZ8A 4UW4A 2EICA 3WDYA 4P9LA 3J7HA 3NNLA 2CY6A 4CCJA 3D8CA 1BVP1 2VTXJ 4M00A 1ULPA 4XOGA 5A7WA 2FDIA 1VIWB 3O1OA 2ZMNA 2LRPA 4CP9B 1DQ4A 2BYVE 2Z2SB 2ZCWA 1RUJ2 4AGVA 4DUXA 4QU2A 1WKYA 2PLV1 3ORJA 3PLQA 2C0ZA 1MS4A 2RS13 4FPEA 1YQ8A 5JCTA 4NWWA 1EAH2 4O65A 3A23A 4MGIE 5CVRA 4H2AA 1AL22 4OHVA 5KHJA 1J3QA 4QQLA 1AR91 2PAKA 2OZJA 4DO0A 3H3ZA 1RMU1 5FZDA 2AREA 3KV4A 2YB7A 4FPHA 2WO2A 4LO7A 1CX4A 2W1UA 1W2OA 3OGRA 4CEWB 3FL7A 5BNOA 1V70A 1V0AA 3NRUA 4FPLA 4EZ4A 2EXIA 2XUMA 1ZBE2 4XMAA 3WF2A 1FNYA 4URTA 1IQAA 4HT1T 4GWIA 3BOPA 5J36A 4NPRA 5JXIA 2XVLA 4RYDA 5JXJA 4WM7C 5EJ3A 4Q8KA 1RUG1 1UY1A 3AKTA 1W9WA 2BNNA 5JPNB 4HLTA 1KS4A 3CL1A 3U10A 1Y4WA 5FWEA 1PIV3 1CZVA 1OA4A 1DF0A 2XONA 3J7LA 2RS11 5FCCA 5K0UA 1V6MA 2Y6KA 1R082 2A5ZA 2VUJA 5K7PA 5I8TA 3I2JA 1NCRC 1YXWA 2GAUA 1ULDA 1YFXA 3B94A 4W4ZA 1FXZA 5DZEA 4YZ1A 3WNOA 5FUNA 2R042 2ZTNA 3O5SA 2F4PA 4H14A 4SBVA 3BB6A 3RG0A 4KU7A 1SFNA 3DN7A 3WXPA 4A42A 1D2SA 1QH6A 4Y4YA 1PGW2 1RHI1 1UYYA 2WNVA 3FC0A 3NV4A 1XU1A 5A6QA 1IS4A 3HN1A 1UNBA 2FZ2A 4FBFA 1JOJA 2VZUA 3ILFA 4LBKA 4X6RB 2JDHA 1RUE2 5CFDC 4B8EA 4ASKA 5L7OC 1W3XA 3TRSB 3KZ4C 1HB2A 2VR4A 1PMHX 2XH6A 1JBCA 3KHBA 4IEPA 3OTFA 3VKNA 4NO4A 4DUWA 3C7HA 5DG2A 3K4DA 1AR72 4BQ5A 5EP9A 2W68A 2VVDA 3IAPA 3KVBA 3AVSA 1N3OA 1RVF1 4HL0A 3VN4A 3TNQA 4NE9A 4QXKA 1QGLA 2A3WA 2MHFA 4W6XA 2JX9A 3WNMA 1UY4A 5T50A 1UD1A 5L36A 2KR2A 3LDKA 5LY2A 5C7GA 2VMIA 4N53B 1OA2A 1N1TA 3VHPA 2D98A 3GALA 4D7SA 3WOGA 4K9SA 4XJZA 2G1MA 2YGMA 2W46A 3J7NA 3RZGA 1S0CA 3TYJA 3ZFFB 5AVPA 4PBPA 1W2AX 1O4TA 5FY1A 2VUCA 3KGZA 3QOPA 4ITCA 4QGNA 1PZ9A 4R4XA 1GNYA 5DAWA 1MZFA 3RMYA 1DQ6A 3FFQA 4GH4A 4XEZA 5A80A 4EWAA 5IYYA 5DZFA 4N7IA 4UW6A 2GH8A 5A7WB 2C5DA 1BKZA 3B69A 1FPN1 3PUSA 5F3EA 2DCTA 2DFCA 1ENQA 3THCA 3ZYHA 2G9ZA 5FRAA 2ZX1A 3POFA 4YVSC 5FZ8A 5L73A 5LA9A 2IXCA 1RUH3 3WDXA 4C0BA 1R083 4GJYA 3WR0A 1OUSA 1RUC3 1XNKA 2Y0OA 2ES3A 3MW3A 1O4YA 1AXZA 5IVBA 1ULCA 3POSA 3ZKYA 4CU9A 1KJLA 2UYBA 1JXNA 5KC6A 4W50A 3WW3A 3EB7A 4WM8C 4Q4X2 1H9PA 2QDNA 3MIDA 1OFNA 2ENRA 2WNVB 5GLWA 5FPXA 2I2SA 2UWAA 3H8UA 3O0XA 4D7TA 5I0DA 4O9GA 5IVVA 2RDNA 3ON7A 4YVSA 4YNIA 2EIGA 1PO11 4UWDA 1GWMA 3H1WA 4XFHA 4HONA 4LORA 3BVCA 1RVF3 1W9YA 2C26A 2NLRA 4YGDA 3H8OA 1N1YA 3PVEA 4YVWC 2IVIB 3E97A 1MS9A 2C4XA 1HB4A 4BCUA 4WM8A 3AFGA 1NCQC 3HNYM 2GH2A 1SPPA 4N53A 2BZDA 1VR3A 2VZRA 5DUUA 1H1AA 2R32A 3RQ0A 5A7QA 2QQIA 5A7PA 5C4WA 4IE6A 3VBFA 2AH2A 1RUC1 1N3QA 3ZDVA 4G4FA 1JI6A 4OZXA 3IT8A 4YZ4A 4JTNA 2WZR2 3PUQA 4OYUA 2IXIA 1IOAA 5IJRA 3SKJE 1J84A 1ZZ6A 3F95A 1OQ1A 3EO6A 1AR71 4FOQA 1KGYA 2NZ9A 2WLQA 4XUTA 3VBOA 4EN7B 5HPOA 1S0DA 3ZXGA 2VNOA 2ZOEB 1AYN3 1QOSA 3AJZA 4BQYA 2E63A 5D1IA 2HBUA 2RDSA 1TNRA 4Q4Y1 1HRV2 2XB6C 3A0KA 4URAA 2H6BA 3T2TA 1RUE1 2VW0A 4GD4A 4JKLA 4XFGA 3V56A 3RZKA 1TQ5A 1ZRRA 3PUHA 3PURA 2TEPA 1S0IA 1AX0A 1OLQA 2R16A 1WMFA 4I0AA 4OHXA 4QT6A 2P3IA 1O3SA 4YW3A 4XHBA 3M4FA 1ULGA 3HVDA 1QQP3 3WDWA 5KBFA 5AFEA 3TAYA 3R4UA 5IWFA 1JZ6A 4AZZA 1BVVA 1C4RA 3MFCA 4YZ5A 4BU2A 1UMZA 2R072 1UXZA 2CDOA 4K6BA 3I59B 3SKVA 2IUWA 4MO3M 3BN6A 5E16A 2WNUC 4UFHA 4LA3A 2WAOA 3C7EA 2Z79A 4HVRA 2XJSA 4UYBA 5L7OA 3VBUA 1NZIA 3LGRA 2K0GA 4YZ3A 1AJKA 5AVAA 1EP0A 3OGSA 3R4DB 4PIZA 3HIFA 4EQVA 4CXYA 4LKEA 3K46A 5AC91 4BMBA 5FZAA 5KHKA 1OC1A 1NLQA 3N9MA 3U4XA 1MPXA 2QQVA 1NOVA 2ARBA 3E5XA 4LUMA 4LO4B 4RR3B 2BNOA 1C5IA 1LOFC 3WF4A 4QX3A 3ZIWA 3KV9A 2VMFA 4ZZ5A 3NSTA 1GZTA 4EN8B 4AHWA 1W8UA 1UXXX 3BI3A 4CEWA 5BNOB 4YYOA 1SBFA 1IQDC 1FOD1 2EXHA 1FATA 1D0HA 3I59A 4META 1RYYA 2P6HA
chains in the Genus database with same CATH topology
3ZFGA 3APBA 4OI1A 5JOWA 2BQPA 4GH4C 1LGCA 5BNPC 3GBWA 2NM1A 1OD5A 5LRSA 3MIHA 1HW5A 4DINB 4LEJA 4FPFA 1H8VA 4KBBA 3MDPA 3THPA 2SBAA 2GMPA 2BFUL 4MYEA 2D43A 2FBEA 2ZGSA 5AFBA 2IXKA 4YZ2A 1LOGA 5ACA3 2I74A 4TWTA 4B4QA 1LESA 4YVWB 1RITA 4ZU7A 5JWPA 4A3XA 3Q9OA 1OMIA 1VJ2A 5IT6A 1SLAA 5FO9B 1SQ4A 4LNVA 4WVVA 1W6PA 1X33A 2WS93 3DUIA 4Q4W2 1D4M3 2EA7A 2WA4A 4C1XA 1WD3A 4COYA 2GC2A 2UURA 3AZWA 1MVEA 4GMP3 1UU4A 2D6OX 4XFAA 3D5OA 1DQ2A 4GA9A 5FPZA 3O0VA 1HRV3 5C9AB 1CAVB 2JE9A 1D0GA 4YVSB 3KCCA 4IQPA 2DCYA 3ZXAC 1CJDA 1ENSA 1EAH3 2HWD1 3GZAA 2WFF3 2ZACA 2ZGKA 1MQTB 1MS1A 2BGCA 2HWC2 4CTEA 4Q4X1 1AL0G 5D8AC 2ERFA 1MVQA 1Q56A 4K21A 1HRI2 2ZHNA 3AYAA 2B7YA 1VBB2 3AZYA 3D0JA 1BCXA 3FUQA 3N35A 1C8NA 4AEDB 3GNEA 1NLRA 2GN3A 2LTNA 1WLWA 4CEWC 4NHMA 3I2DA 1DU3D 4IV3C 1BBT2 4KWLA 1OLRA 5JIAA 1G9DA 1GR3A 4N9HA 2XL9A 4N9IA 3KQRA 1PMIA 4ZU5A 3O7OA 5DDJ1 1RUI1 2HWF3 4CDXC 1OFSA 1LOAA 3WW1A 4YARA 4MGYE 4YFZA 3N7MA 3N7JA 2R061 1WLDA 2PA7A 2YY1A 1S1AA 2E53A 2R1BA 4AFMA 2K9ZA 5JLVA 4LBMA 4AGRA 3C2UA 4Y24A 3SXWA 3J8F1 3VHOA 1IS5A 3ZN6B 4S2HA 2VG9A 4RHV3 4FT8A 4CP2A 1SBDA 3J8F2 5A3LA 5I0SA 1VBC3 1QJX2 4JDOA 2N7GA 1OQDA 3QBQA 4HBNA 4R9CA 3ZFEA 3BALA 3M3IA 3AKQA 3LWCA 1HX6A 2HWE2 3TNPB 2FZ1A 4MV2A 1OQEA 3ZXDA 4YM1A 2PAMA 2Q0AA 1C8M3 3KT4A 1Q43A 3IDBB 4HK8A 4JTOA 3NL1A 1S0JA 4OI2A 1RUOA 2EALA 3G6JB 1IGOA 3AZZA 1N47A 2WS92 4QGMA 1ASJ3 4GALA 4I3PA 4CDXB 2A73B 2NP0A 1RUI2 4EJRA 2HYKA 4LUKA 3WX5A 4NN0A 1WBLA 4N53C 5KHIA 5JSRA 1VAVA 2HWF2 5BNPA 3WZ1A 2PHDA 2MPFA 4IEYA 4AF9A 5E88A 3NAPC 4JDMA 3AP4A 3HT2A 2ZZQA 2RJLA 4IL7A 1CIWA 3O0WA 4FPOB 3S7EA 1FI2A 4RS5C 4KGQA 4TSVA 4WVMB 3RYPA 2GC3A 4LULA 4Q0VA 2OPKA 3V0AB 1DGRN 4PLOA 2GC0A 2CL2A 1GZWA 1REFA 2PELA 5BNQA 4MXVA 3WQ1A 5C6CA 1POV0 4IV3B 1TMF1 4B7KA 4Y1ZA 3OGGA 2Z42A 2YDEA 4BYYA 1VLNA 3FBMA 1U5XA 3AB0A 1MS3A 3L2HA 3EQEA 1EPWA 1BQPA 5CIRA 2A6WA 2GDFA 2XPJA 3IDCB 2ZX4A 1Q8OA 3B9CA 1PIV2 3PMSA 3M70A 2MNGA 4Y20A 3VDDB 1XRUA 2R1DA 3OPZA 3KB5A 1ZRFA 1XXNA 3AJYA 2Q1ZB 2DVAA 4JGYC 2RM23 3G7DA 2D5HA 1KFUL 4XJWA 2YMZA 3UKVA 2A6YA 1DIWA 4XILA 5FREA 1RUI3 1FOD3 2HWE3 4AVTA 2CGPA 5T5LA 4A7ZA 1K5MC 5LK7B 5K0UC 1H8TC 1WGPA 3FZ3A 3LSEA 1UU6A 5K0UB 4HETA 2Y38A 4F8AA 5HBAA 1WBFA 3K48A 1YJKA 5IK8A 2BVVA 2W52A 1FNZA 3WUDA 1UCXA 5EZWA 3LA3A 3KLSA 1X8EA 2JG9B 1R091 4XBLA 3VZLA 4B29A 4HPKA 2JG9C 4L97A 2DV9A 3N3HA 4N43C 3O14A 2KM2A 2NN8A 2WINB 2BNMA 5JOXA 1VBB3 3MF9A 3ZSMA 4Z2WA 1PGSA 1LECA 4OFGA 2LUWA 2Q30A 1UPIA 1ND2C 4Z07A 2VMHA 3KM5A 5EYYA 2WS91 1OA3A 2P37A 4X8PA 2DU1A 3JD71 2D6KA 4Q0SA 3VGIA 3HQXA 3IIAA 5HXVA 1EY2A 4QPYA 4GB33 4PDWB 4RD7A 4XW3A 3VBRB 1ZM1A 2ZGQA 1MZEA 3LAGA 2O8QA 3EXUA 4HFSA 1A8MA 4HKOA 2VNRA 4UXAA 5SV8A 4CEYA 1YFWA 4IEWA 2HWB2 5I93A 4XXAA 1BMV2 1PVC2 2CGNA 2QVSB 2R062 1LODA 1R1A2 1QJX3 5J96B 4MXWB 4LO6B 1LR5A 1R093 1Q8SA 1YLLA 4Y1UA 5CG9A 1IHMA 4A2UA 1NLSA 4XF4A 4AVSA 2FMYA 2D6LX 3H0OA 1KQRA 5GZFA 1IKQA 2W0XA 4AI0A 5JI7A 3WW2A 1H8TA 4P9GA 3ROUA 3WW4A 4FXKB 3SITA 3MLLA 4MUVA 1HIXA 1H2MA 3VV1A 5FOBB 3J9SA 2WZR3 2HWD2 4AQTA 3SH3A 3GZTB 4MGZE 3DPRA 1W6OA 4J1XA 3ME2A 1FPN2 4PQ9A 4L2NA 4BE3A 1QJU1 4QX5A 1D2QA 1OHFA 3NAPB 4DZGA 3MYXA 2G4IA 4XTPA 5C8CB 2XVGA 2XLFA 4WVZA 4AFBA 1N1VA 4CZSA 1NCRB 3WDVA 4P9IA 1SLBA 1DGLA 5I0TA 3AXDA 4XFIA 1V9U2 2XKPA 3LKJA 3TN93 1NYWA 1QWRA 1LHNA 2ZBJA 2D3RA 4CDUB 1QNWA 1HXS1 2JG8A 3GBGA 4XJAA 4CDWC 4ES9A 5FO8B 1X7NA 1XU2A 4LHNA 4YGCA 3ZSJA 4CDWB 5JMCA 1LOEA 1YYNA 5I8SA 1J1LA 3B9IA 2PYTA 5JOYA 1JYCA 3HBZA 1Q3EA 3RZZA 3H50A 2W39A 4RA0A 3WP5A 1ENXA 2JE7A 1HV1A 1RTVA 3JBG2 3WDUA 1VALA 3B3QE 2XJTA 1YIFA 3NV2A 1SCSA 1HLCA 2AENA 4COVA 2YV8A 4YW1A 1ZBA2 4CEYB 1CAWA 5BXXA 3WHUA 4E2QA 2B9UA 4PDWA 1Q8PA 1QHDA 4MVTA 4OLLA 1XNBA 1F9KA 3LSDA 4QD2A 1GICA 2YC0A 1QY4A 2JENA 3DF0A 3V0AA 4NOTA 1XYOA 5I8YA 2Z69A 4QQOA 4AXOA 3SNMA 3HAGA 2R043 2HEWF 1J59A 4K40A 3S6PA 2JG8B 5GM0A 2R063 1R1A3 1GKBA 3AZXA 1RHI3 4KL1A 2WSVA 5EV7A 5BNNA 4FQ4A 1H2NA 5JAXA 1W6MA 3MIGA 1NCRA 4JC1A 3W58A 1JUHA 2NMOA 4M01A 3DKWA 4R9AA 1U5IA 2NPIA 2K2SA 5CAZA 2EAAA 3DPRC 4TZDA 3JB8A 2AUYA 5T54A 2RS52 1C3HA 2VOKA 5FFOC 2XBO1 1DHKB 1J3PA 1RUF2 1AR73 4BLIA 3H7JA 1UZYA 4Y1VA 3MI8A 2IXJA 4XJ9A 3VZKA 3ZYRA 4QPGB 1Q8QA 1BEV3 4I01A 1PNGA 4CDXA 1AYN1 1AR92 1COV1 5AC92 1JUIA 1AR63 3GBFA 5BNNB 1PO23 2BEOA 1W39A 1XQNA 4Q4W3 4AYUA 2CGOA 3IPVB 4OUMA 3FFZA 1HRV1 3M8LA 4HKLA 2QJVA 3RDIA 4HSJA 2JKBA 2X8KA 5EXOA 4AGGA 3HWJA 2QDRA 3PTYA 4JGYB 3USSA 3ZYGA 5T5PA 3I54A 2GNBA 2Y26A 1DQ1A 1RUC2 1SFYA 4RSUA 4XZPA 4FO9A 1J58A 1ZBA1 1EAH1 1RUH2 4YG6A 3R6SA 3M3EA 2RS31 2GZWA 1CR7A 2WQZC 2B8MA 4KWKA 5KXCA 2VGDA 5E8AA 1F5JA 4YM2A 3PVNA 1RUD2 3JQWA 4P14A 4ISRA 1NCQA 1PVC3 1YJLA 3KT1A 4Q4V1 1SMVA 1O3QA 3FHIB 1PO12 3H9AA 1COV3 3DGTA 2VH9A 1EV12 2VVEA 2GALA 3E6BA 2IZWA 5IK4A 1C5HA 2ZX2A 4HK9A 4K1ZA 4QPGC 4CP0A 4YLZA 4R52A 3WNXA 4FTBA 4XBNA 4LBLA 5KHHA 3MIFA 2RR11 4R9DA 1RUF3 3WCRA 1UIKA 3FLTA 3V0BB 2WNEA 5GZEA 2DVGA 3VKMA 1QMJA 1QJU2 1VBA2 1NQDA 1DG6A 3OGJA 1NCQB 3LOBA 3TOJA 4ORFA 2EVXA 4PIXA 4IERA 1MQTA 2JG8C 4RHV2 5TSWA 1TME2 1C1FA 1N1SA 2PHFA 3MLKA 1JW6A 3VHNA 2D6NA 1DYKA 1QDCA 1AVBA 4KNCA 4BA6A 4XPVA 1AX1A 4QM9A 5C8WA 1QQP2 3POWA 4IV3A 4LE3A 2A3YA 4WV8A 3USUB 4Y1XA 3VBSA 3ZSLA 4DPNA 1UAIA 2YZ4A 1RUNA 4JDNA 3UJQA 4E2SA 4FP2A 1SEFA 5KHGA 2NMNA 3IKWA 2HWE1 2HKXA 4M3CE 4CDWA 1R1A1 5A33B 2WJSA 2PHLA 1BMV1 4BPZA 1PO22 1MEC3 1VAKA 1O4ZA 4LHLA 4W65A 1PGL2 3ZFEB 5H9PA 4CEYC 3ZFGC 4G9SB 2PHRA 2QKDA 5CFCC 3E5QA 5T3NA 4LA2A 2G9GA 1COV2 4D94A 1H4GA 4XETA 3VDDC 2ILMA 4N43A 3T1MA 1S0EA 4RL7A 1PGW1 1ND3C 4BMEA 1M4WA 1DGWA 4AI3A 1C57A 4FPJA 2VU9A 5FLJA 5KXDA 2WZPP 1KXGA 5IK5A 1GBGA 1TME1 1RC6A 3AYDA 5JZGA 3OJBA 1IPKA 1GQHA 4FOYA 3NW4A 4AI1A 5DXDA 1K5MB 1ZZ7A 1BBT1 4IV1C 1VBA1 4C90A 1MEC1 4IEUA 4XMIA 1CJPA 2VECA 2HEYF 1Z7S3 1LEMA 3JZVA 1R092 3CO2A 5GJ6A 3VZJA 3M2MA 1RIRA 2JDZA 1QXPA 4I0WB 5C4WC 4H7MA 2A7AA 1O5LA 4OULA 2Y0IA 5H9SA 2WKKA 4XHXA 2VOWA 4AG4A 4B4RA 1QH7A 2PTMA 4LBQD 2RS12 3VL9A 5CA6A 2D40A 2RS53 5DUWA 3VBHA 2ZA9A 3VBUB 3WG4A 1HRI3 2VNGA 4FOWA 1LHVA 3OY8B 4UW5A 1OOPB 1XE8A 4WBBA 3BTAA 5GLVA 4Y1YA 4AHZA 3ZYJB 3W59A 4LO5B 1LB2A 1DFQA 1LOFA 1BBT3 2RS32 1ND3B 2DCJA 4DS0A 4QQPA 1RINA 1WA4A 3FLPA 2V73A 5J37A 4MGKE 3VBFC 4DRRA 4LLFA 1G7YA 4H7LA 3WINE 3N4MA 3ES4A 4S2FA 4INDA 5K8SA 1AL21 4JAAA 4UBHA 1I1EA 2A75A 5CFCA 2WFF2 4LBQB 4GB32 1VRH3 1QJY2 2GU9A 2PLV2 3OBTA 4IV1B 3FWEA 4R9BA 4OI0A 3ILNA 5L19A 1Y43B 3HT1A 3ELNA 3S30A 4AFCA 1GYKA 1EYBA 1PK6B 1GZWB 1QOTA 2I07B 3MICA 2V5YA 4Y5Z0 1XYNA 3KD4A 5FTTC 3ZYPA 4AFAA 2R0HA 1B35B 4QPIB 1DQ0A 3PHMA 3URFA 4EN6B 3CJIC 4IEOA 3VBSC 1NA1B 1WCDJ 3JCIA 3RI8A 4MX3A 2OZ6A 3OD0A 3RJ2X 3KCYA 3ZFGB 2PHWA 1MS0A 2UY9A 2VW2A 1MS5A 4COZA 1O91A 3S7IA 4QMAA 4U36A 2SLIA 1LGBA 1REEA 2MEV1 3V64A 2XVKA 3WLUA 3IN9A 1LHOA 1FAYA 1LJ7A 3J8F3 1W0PA 3GF6A 3FLRA 4Q4Y3 5LEKA 3POYA 3O12A 1YUDA 5DG1A 2Q8OA 3KMHA 1Z7S2 2D6MA 4IEVA 2RS33 3H3UA 4YVWA 1GFF2 4PIYA 3AKSA 3PVBB 1CAVA 4LLOA 2R071 4XQDA 3ILRA 4QM8A 1LCLA 5CU1A 5JVVA 1F31A 2WT2A 2H0VA 2E9QA 5CFDB 2PN5A 5HI0A 2H6CA 2RJKA 1Z7S1 1AYM1 5GZCA 2O1QA 1JH5A 2NQYA 2VQ0A 1RMU3 1QJZA 3JBG3 1AF9A 3VBOB 3MIEA 1NY72 2XJPA 2XL7A 3KGLA 3VHRA 3X29B 2CYFA 3M3CA 5KXEA 1YFYA 4XXPA 3UKNA 3ZN6A 3TN91 1VBD3 4K20A 3VBFB 2I45A 3CJIA 5CBLA 2YPJA 4RGGA 2HEVF 3WDTA 1BXHA 3ZN5A 1UU5A 3TWIA 3RNSA 1LOBA 3B01A 4WM7A 5GLTA 1G86A 4HN1A 4D3WA 3AFKA 1GNHA 2JD4A 4YSFA 3WG3A 2JEMA 3A4UA 4KGGA 4BLJA 4CDUC 5GLUA 3AP6A 5HCBA 2DVDA 3FBYA 1W6PB 2EXKA 3W9AA 3BODA 5IK7A 2OA2A 2B45X 2HWC1 4AEDC 1HV0A 2BPA2 3V65A 4EN0A 1F2NA 4EN9B 3TB0A 4QHBA 4YG3A 1S0FA 1ALYA 1LHWA 1HQNA 5BNNC 2UYAA 1YWKA 5L7OB 1VB2A 1D4M1 3ZFEC 4HVOA 3HMYA 4Q0UA 2IXLA 4P9WA 5T5JA 4DFSA 1RUD1 4Q1RA 3WP4A 1XE7A 3QLQA 3BU7A 2RM22 3HR9A 2HWB1 2YYOA 4LBNA 2CTVA 3OF1A 2XKOA 1YHFA 4XF0A 5J7MA 2BW8A 4C1WA 1YCIA 4TYSA 2ZGPA 4AEKA 2X53S 4AWDA 2YGLA 1W2UA 3WG2A 1LGNA 3RRDA 3H1MA 1S2BA 1W6NA 3FUOA 5LRRA 3WQ7A 2B5HA 4RR3C 3IDEA 3AZVA 4MSVA 4D69A 1VBD2 3R4SA 3SISA 5F6LB 1ZYBA 2DUQA 2VXRA 1TE1B 1KITA 3WCSA 3MIBA 1BEV1 5EWSA 2ET7A 3BPZA 5BNOC 1UZZA 4NHKA 1F8VA 2XJQA 4GWMA 1QOOA 3OCPA 3RWNA 3UL2A 4AEDA 4FPKA 3MPBA 1CAXB 2HWF1 4K8FA 1MEC2 3WUCA 4GULA 2OW4A 2D7FA 4ZKTB 2VOVA 3E6DA 2ETEA 2HWB3 2XG3A 1RJ8A 1O3TA 4WM8B 4Z82A 3N36A 3AXEA 3B93A 4DY5A 3ENRA 1Y7BA 1RUD3 2AGSA 4A7KA 3ACLA 1QF3A 2ZX0A 1AUYA 1ZVFA 1ONAA 5T5OA 1VBE3 4WVWA 1PO13 4LT5A 1W6QB 3U07A 2ZKNA 2R49A 3QH6A 4WM7B 1WCSA 1VBC1 2H0BA 1LEDA 4XF9A 2VW1A 2GSYA 4XJ8A 3U11A 2YROA 1XNCA 2D93A 4JRLA 1GV9A 4E4DX 2YUEA 5C8CC 4AQ2A 1H30A 1Z78A 2ZZJA 4Q4Y2 3OBRA 3BOWA 2E7QA 3AK0A 3P3NA 2R0FA 5GALA 1QJX1 1WW7A 1SACA 1VBD1 3MGUA 2RMU3 4GH4B 1JHNA 2IFWA 2PHUA 1NXD1 4WZFA 2CWMA 2XLAA 4GKYA 1QQP1 2JECA 2QE3A 2D97A 4KH9A 4XFBA 5KXBA 2XLGA 4EV0A 1C1LA 2WFPA 2ARXA 4PLNA 3VBUC 4I2OA 1OKQA 1H2KA 4AI8A 1ZNPA 3GZUC 1VBE1 4AEJA 1QJU3 4PJYA 4JV4A 5I0RA 2WZR1 1GANA 2G9FA 1ZZ8A 3B02A 4HZFA 1SLCA 2GNDA 1GLHA 4E4ZA 1SBEA 2VVFA 1S0GA 1RUG3 3EHKA 3OD4A 4LR4A 4BWOA 1CGPA 5K9YA 4BOWA 3RJRA 2QFEA 4B4PA 1AR83 1W6QA 4YW2A 3B00A 5F6KA 1PNFA 4CP1A 1L3JA 4Q26A 4LE4A 3ZMOA 4W6YA 4AK3A 2O8OA 4AHYA 3AMPA 1W6NB 4FVVA 1ULEA 3D6EA 1HXS3 2ZS6B 4N7UA 5FLIA 3H1YA 3CJIB 1U0AA 3L9JT 2OYZA 1KS5A 1LOCA 2O0OA 3JB4C 1NY71 1F5FA 2WIIB 4Q27A 2VOXA 4IV1A 4L9BA 4NVPA 3J26N 4AEMA 2WNUB 4NWVA 2AR6A 2VY0A 4XDQA 5CFCB 2R30A 5ACA1 1PVC1 1W0OA 4IEXA 4B7EA 2D5FA 1E57A 4UBGA 2PQQA 1JYIA 4OHWA 4GKXA 2DF7A 3B5LB 3MW2A 3VUOA 1ZREA 1ND3A 2NYYA 3AMNA 1AYN2 1RHI2 2X5IB 1K5MA 4RGAA 1SCRA 2P3KA 2XBO2 1V6LA 1QU0A 2RS51 2Q1MA 1PHMA 1IS6A 3MW4A 4HVQA 2DFBA 3I7DA 3WD5A 1UKRA 4L8QA 1IS3A 2BTVC 2ZGMA 1WLCA 1AR61 2OIIA 5JIUA 3CJXA 2BFUS 2IFRA 1LHUA 1WMEA 1U5ZA 4RQPA 5FBZA 5FQ0B 3UV9A 1KFXL 2XJVA 1POV1 1YO8A 1HRI1 1Z0HA 4GMP0 5DZGA 1PM7A 4LBQA 1A6CA 3IBMA 1CN1A 4FXGB 3RS6A 3JD73 3H7YA 4EWEA 1OOPC 4LTAA 1KDKA 1ZBA3 5DDJ3 2DYCA 3M3OA 4M0NA 1QNYA 3FE5A 3SMHA 4J6GA 5JDBA 2A71A 1MR5A 1X8MA 2GC1A 1PK6A 2XWBB 4YW5A 4QQ2A 3KSCA 4GB31 4KG8A 4FPCA 4YFWA 1PVXA 1H1IA 1UL9A 2QZ3A 4DXZA 1D4M2 3CU7A 1LKNA 3AM2A 4CDQB 4Q1PA 1AXKA 4RS5B 1KDMA 1UN1A 1TME3 2RR13 2WT0A 1V00A 4DQAA 2UU8A 3RPQA 1ZRDA 4F7ZA 4L92A 1X36A 1CAUA 1ZZCA 4Q4V3 1NA1C 1C8M1 3ZYIB 2XJUA 3IPVA 1SLLA 1VB4A 1OOPA 1WLTA 3OY8A 3CF6E 4Z1VA 1X82A 2A6VA 1WMDA 1AJOA 1YFUA 2EAKA 5GKAC 2IC1A 2PHTA 2VUAA 2ZGOA 5T55A 5AC93 1AR62 1DZQA 1RUF1 4JCKA 5JZGB 1ASJ1 1B35A 4QPIA 1FOD2 4XIOA 1UKGA 5EYXA 4JGZA 3LA2A 3UJOA 3ZDSA 5A32A 3RYKA 3TN92 1S0BA 5A3MA 1RUJ3 4YW4A 5FOJB 3ASIA 3VBRC 3LOIA 2DURA 1ULFA 1ZX5A 1IPJA 4LBOA 1BYHA 1QDOA 3ZO0B 2WWSA 5LEJA 4I0BA 3OYWA 5F9TA 3I8TA 1CESA 4N90A 4JQRA 4E27A 2ZGTA 5CFDA 4IEQA 4ISQA 2DCKA 2VMGA 1AHSA 4FPYA 4AVAA 4Q8LA 2UWBA 4GQ7A 3A0NA 3KS7A 2ATFA 1KJRA 5BV6A 3USUA 1RVF2 2FQPA 1TNFA 4P9YA 1FMD3 1CVNA 1CONA 4I09A 5JI9A 1WW6A 3R0RA 4IETA 4BM8A 1PGL1 2GNMA 1Q5OA 1DQ5A 4COUA 5ACA2 4IEZA 4S2GA 4OVEA 1WD4A 4GIQA 3ZXLA 4XYXA 2JICA 5C33A 2DVBA 4XJUA 1CD3G 1QXRA 2QUOA 3I4IA 1T6GC 4K7JA 4P9JA 3VKLA 2MEV2 3PMEA 1FPN3 1H4HA 1NZCA 2A6ZA 5C9AC 1UF2C 2WL1A 5JR7B 2KXLA 1H0BA 2R041 2UWCA 1MZ6A 1XNDA 2A6XA 2P17A 3MFAA 5I0UA 1MQTC 1N3PA 2JJ6A 5F5QA 3UK9A 4IESA 2KA3A 2XBO3 4V1PA 5C8CA 4JGZC 3J4UH 2ZX3A 3CEWA 1B35C 1MACA 4QPIC 2DUOA 3FX3A 2YXSA 4MLOA 2Z5WA 1UW8A 4KQ7A 1DYPA 4W6WA 3ZFFB 3NWKA 2B42B 5FAXA 1VBB1 3SCFA 1O7FA 4KU8A 5CNAA 2Q4SA 5GZDA 2HWD3 4KWJA 5I91A 3FJSA 1OPMA 5B2GB 3P3PA 1URXA 4G3YC 1J1TA 5FMOL 1FYUA 4OUSA 4Q4X3 3ZXFA 1V6JA 2GNTA 4ASLA 3AMHA 4AVVA 1U12A 3GYDA 2CWSA 3HD8B 4Q0QA 4XQ4A 1LU1A 5FO7B 1I3HA 5ABJB 3RMXA 2DUPA 2YHJA 5ABJC 1I5ZA 2A3XA 1C28A 1VBE2 2TNFA 3EBRA 3WHTA 1X50A 2DTYA 2GMMA 1NE6A 1JN2P 1TMF2 4MXWA 1B09A 2E51A 4AW7A 1OPOA 4DY3A 1NE4A 3E5UA 3BCWA 3CLPA 3VZNA 4ASMB 4CDQC 5CADA 3VBHB 1PZ7A 2JXAA 4BIOA 2PFWA 2ZHLA 1GQGA 4QGLA 4M3CA 4LHKA 4AQSA 2F6BA 4GWNA 3NO8A 4Y22B 4CRQA 3N7LA 1FMD2 4PLMA 3IMNA 1YNAA 4XFFA 4WZCA 5D8AA 2CAVA 1AR81 4YM0A 2RMU2 3NKGA 4COWA 1ZZBA 2PAEA 2IWGB 4R8HA 2QNKA 4AHXA 3VBSB 1G9BA 2DVFA 3V0BA 1CPMA 2WLPA 3QACA 5J3UA 4ZXKA 5GLZA 4ATFA 4MZUA 5FLHA 1S55A 1KRIA 3AP7A 1V6IA 2W08A 3SCGA 1NA1A 4QPGA 3ZIXA 4BHPA 2B39A 2MEV3 3JUUA 1R081 4YRDA 4QQHA 3WP6A 3ZSEA 4F3JA 3B7MA 4TLFA 3VKFC 3JU9A 3ZXEA 1CAWB 2EXJA 1W6MB 1KD7A 3ZX7A 2LALA 5BY5A 3LZZA 1H8TB 4AVCA 1Y9QA 3MEPA 2R6QA 2D44A 1RUG2 4R4ZA 3WG1A 4FAGA 5LK5A 5H9RA 3LA7A 3E6CC 1VRH2 2BVBA 3JBG1 3THTA 1AR82 3ZN4A 2BWCA 4DMIA 3NJZA 4PF5A 2TBVA 4LO8A 3ZMNA 4M3CB 3ECQA 1SLIA 3RI9A 1SDWA 2ZAHA 3QCWA 2AZ5A 2ZGRA 4Z8BA 1UIJA 1RJ7A 1EV13 4HSLA 1LULA 1V9U1 1ND2B 2QCSB 1DBNA 1V6KA 3M7AA 1ZZ9A 2RM21 3ZSKA 4DB5A 4XIKA 5GZGA 1TMF3 3AKRA 2GN7A 2ZGUA 2WC2A 1EPZA 2ZMKA 4I3GA 1FV3A 2LM3A 2ZHMA 3UKTA 4O9EA 3ZPYA 1RL3A 4AI2A 1G9CA 2XHKA 5KC5A 1DGWX 3VBHC 2RR12 2QQPA 3SCHA 1G8WA 3WQ0A 5T52A 1I9RA 1YI9A 5E89A 3MZHA 3D4KA 2JG9A 5D8AB 1V9U3 4X8NA 4Q4V2 3ATGA 5JSOA 1W6OB 2BWAA 2C9AA 4FSJA 4XF1A 1H2LA 2WNVC 2OUJA 2WT1A 1G9AA 4N43B 2X29A 4YM3A 1S2KA 1ND2A 2HWC3 2EF6A 1APNA 4XFCA 3VLBB 3WVJA 2ZMLA 4Q4W1 2V09A 1A8DA 1HDKA 5JOZA 4FTEA 4GXLA