2D98A

Structure of vil (extra ki/i2 added)-xylanase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
189
structure length
183
Chain Sequence
TIQPGTGNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSLSVYGWSRNPLIEYYIVENFGTNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDQIVAVEGFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase 2
publication title New methods to prepare iodinated derivatives by vaporizing iodine labelling (VIL) and hydrogen peroxide VIL (HYPER-VIL)
pubmed doi rcsb
total genus 50
structure length 183
sequence length 189
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2d98A00
5K9YA 3WX5A 2D97A 4NPRA 3WXPA 4IXLA 3LB9A 1XYNA 1HV0A 4HKLA 3VZMA 1NLRA 3AKQA 2C1FA 1C5HA 1YNAA 1M4WA 1HIXA 2JICA 3VHOA 3AKTA 2DFCA 4S2FA 2DCYA 2DCKA 4XQDA 1HV1A 2VG9A 3WQ0A 1XYPA 2JENA 2D98A 1REFA 1W2UA 4XQWA 1KS5A 1TE1B 3VHNA 2DFBA 1OA3A 3MF6A 4S2HA 2B42B 1REDA 3RI9A 1OA2A 4HKWA 2BW8A 3MFCA 3WY6A 4HK9A 3WR0A 4S2GA 2B46X 5HXVA 3AKSA 3VZKA 1KS4A 1ENXA 4HKOA 2NLRA 3AKRA 5EJ3A 1UU6A 2NQYA 3VGIA 1OLRA 3VLBB 4XQ4A 1BK1A 2VGDA 3M4FA 1XNKA 3LGRA 3WP6A 1F5JA 3HD8B 1IGOA 2B45X 3WT3A 1H1AA 1H4HA 1XNCA 4XPVA 2VULA 1XNDA 1H4GA 2VUJA 3WQ1A 3MFAA 3AMMA 1BCXA 3O7OA 1AXKA 3WP4A 3B7MA 4S2DA 2Z79A 2DCZA 3AMPA 1PVXA 3RI8A 1QH6A 1C5IA 1OLQA 3WP5A 3VZJA 3VHPA 2QZ3A 2DCJA 1H8VA 2F6BA 2BWAA 3AMHA 1QH7A 3EXUA 3AKPA 3WQ7A 1XNBA 3ZSEA 1BVVA 3VL8A 5K7PA 1REEA 1OA4A 1XYOA 2BVVA 3VZLA 4HK8A 3VL9A 3VZOA 3VZNA 3B5LB 2JEMA 1H0BA 1UKRA 1UU5A 1UU4A 1XXNA 1T6GC 3AMQA 2QZ2A 4H7MA 3WP3A 2BWCA 3AMNA 3MF9A
chains in the Genus database with same CATH superfamily
2FDFA 4YM1A 5F5QA 5FO8B 1JHJA 4QDSA 1O5LA 1UY3A 4P08A 3G7DA 2XKOA 4AI2A 1GV9A 1BVP1 2VQAA 5JLVA 1BYHA 4FSJA 1ZZCA 4XBNA 1HRV3 1YNAA 3BPSA 3PUIA 2XPJA 4K1YA 4Q2FA 4LOSA 4CEWA 1V6LA 5F37A 3KGZA 5I0RA 4I0BA 2NM1A 2P6HA 5FYMA 3N9PA 5LW9A 1JZ4A 4KQ7A 3E5QA 2UYBA 5I91A 2JG9B 1QNYA 3RG0A 3GDBA 2YBPA 3BTAA 4P9GA 1NY71 5C5TA 3VDDB 1S0GA 1BEV1 4OVEA 4EWAA 4EWDA 1RUF1 4IE6A 2YU1A 3ILFA 1IQDC 4GH4C 5JIUA 4XCAA 3LWCA 2JWPA 4HG6B 5FYUA 2HWB3 4YW2A 1QMJA 2EAKA 2UWCA 2ZGLA 4HKWA 1S0DA 1DP0A 2WJSA 4WM8B 3WHUA 1X33A 2BNOA 1UYXA 1H6XA 5JXJA 3H1YA 3HBZA 5FJHA 4AI1A 1KFUL 4DRVA 1PO11 3CBNA 3ETQA 4LITA 1G9DA 1TVGA 5DUVA 3VBRB 1L3JA 3SCGA 2WNUA 4ZY9A 2ZTNA 2VPVA 4OZXA 4Y5SA 2RS31 3T09A 5JR2A 5EP9A 3QD6A 1QOOA 3DYPA 1M06G 1YRZA 5FO9B 4LBMA 4LO4B 1F4HA 4LK6A 2VGDA 2WS92 3FUQA 2VZQA 3WP6A 1F9KA 5LEJA 3I2KA 3LAGA 1W9FA 2EIEA 2RS53 3CHXA 4JGYA 4CP1A 3WT3A 4FTSA 4XPVA 3T2TA 3OJBA 3PUHA 1XNDA 5D8AC 2CY6A 2WA4A 4XETA 1POV1 4WV8A 3IDAA 2HLEA 4QXBA 4F83A 1W8ZA 1AJOA 3MFAA 3AP5A 3IDBB 4UFIA 3KD4A 4NIAA 4TWTA 4Q4Y3 5LA0A 1NT0A 2QQWA 1NZCA 3VBSC 3W20A 1UMHA 1RXFA 1RVF2 3MPPG 3OEAA 1WMEA 1W2NA 1COV2 4RS5B 3MIGA 4XIOA 4Y1ZA 1C5IA 1LHUA 4IL7A 2P17A 4AHWA 3VHPA 2QZ3A 3HOBA 5I8SA 4DXZA 1DQ6A 3POWA 5IK7A 3P5BA 4FPOB 4P9WA 4A2UA 1JBCA 2VUCA 3R4UA 3HQRA 2BRTA 3N9LA 1OUXA 4W6YA 2EXKA 1QJY3 1EAH2 3S7IA 1VMHA 1NXD1 4PIXA 3D0SA 2WLPA 3VBOC 2RJKA 3VKLA 3A7QA 4AI3A 3MGUA 4QPGC 4IEOA 1VMJA 2AEYA 5AC92 5C8CC 3EQEA 1LB2A 3CDZB 5DG2A 2A3WA 3CO2A 1S1AA 1RUOA 3H3LA 3J4UH 4KWJA 4COVA 1RUE1 1OUSA 1XJAA 1UU4A 3GYDA 4FPJA 1IS6A 4I09A 2VNOA 1Q3EA 4KGQA 4TN7A 5LEKA 4NPRA 4R4XA 1J1LA 3ZXGA 1VALA 2VOVA 3LPGA 3SISA 1F15A 4JHZA 3TBDA 5DAVA 5DAQA 2VZPA 2FMDA 1ULDA 3AB0A 1M4WA 4AHYA 2VR4A 3ABZA 3W58A 2E53A 3DYOA 3TN91 3K51A 2WRAA 2RM22 1G7YA 2E63A 5ACA1 5JMCA 1IG3A 2C4XA 3ZM8A 1MS5A 3DEMA 3URFA 2NP0A 5LA1A 1US2A 3ZOIA 3ZSMA 2YZ4A 3DECA 2JDMA 5FOBB 1OVSA 3N7LA 3OPZA 2RHPA 1AYM1 2YDEA 3THDA 1CIWA 1W6QB 2RVAA 2DFBA 4MSVA 5H9RA 3OGJA 1TZOA 3ZYGA 4DMIA 5HCAA 1N3PA 2UY9A 3LD8A 3KSCA 1QHDA 4IEZA 2CTVA 1QKQA 1G9CA 1JYIA 3WZ1A 1CX1A 2PHXA 2YPJA 4FFIA 5FP9A 3SH5A 3LSEA 3OPWA 4FPGA 3IT8A 4D7YA 3N7KA 1DHKB 3AL5A 2ZX3A 3T2OA 1LAJA 4LMFA 2VUDA 3I59A 1JOJA 3O1RA 5FPBA 3WLUA 3AYAA 1DYPA 1NCRA 4CDXA 3T4VA 2HWE3 2XBO1 1GKBA 1Y4WA 2GMMA 2VMGA 3WW1A 3UJQA 3JBG1 4YFZA 2NQYA 2AACA 2VC9A 2D6NA 2RDNA 5JPMB 1GWKA 3G6JB 3H9AA 4LHSA 2HWC1 1J58A 2ZZQA 2WBKA 1WBFA 4A45A 2FDKA 1JU4A 3WD5A 4AGVA 1PK6C 2O1QA 2UYAA 4P5HA 3VDDC 2F4PA 1PZ8A 2ZGMA 4ZU5A 3UKTA 1VRH3 5BNOA 1H4HA 5DMYA 2YBSA 3D8CA 3VBHC 1TNFA 2E9QA 4M3CE 2B7YA 2R072 5KHHA 1UNBA 5CU1A 1TMF2 1J83A 1UYYA 4Y24A 3PTRB 5KHJA 4WM8C 4Y4RA 2ERFA 5LA9A 4K9SA 5I0DA 2QVSB 1ND3A 1OOPB 2Y0IA 2EALA 3GCXA 2BQPA 2B9UA 1UX7A 4ONUA 1OH3A 5CG9A 1X36A 1ODNA 3D3AA 4HONA 4O9EA 1FNYA 1VBA2 2NZ9A 3VDBA 1HB2A 2VVDA 4M0HA 1MQTA 2ZACA 1GZCA 4IERA 2DVAA 2BYVE 4EV0A 3WDWA 2JX9A 4FOQA 1WGPA 3H8OA 1HW5A 3MEPA 5B4XA 3OUIA 3C3VA 3ZSEA 1SLBA 2W52A 4UWDA 2JDKA 2WZR2 1LHOA 3LQCA 3N3HA 1S0JA 2BUKA 2DU1A 1HRV1 4L99A 3LA7A 5JWPA 5IHRA 2RMU2 1NCQB 2GU9A 1UZYA 3VZOA 4F3JA 4NWVA 5CG8A 2ZHMA 1I9RA 1NE6A 3ECQA 5A1LA 3V56A 5FPXA 2RDSA 4N43B 2QZ2A 3EYPA 4NPLA 5GLTA 1KDMA 4O9GA 4QU2A 4YZ3A 5LZ6A 3SITA 3VBHA 4NE9A 1W6MB 5IAXA 2BJSA 1CPNA 4JAAA 1VBE2 4HVOA 2SLIA 4KBBA 3ZKUA 5E89A 2X09A 5C9AC 1V6MA 3KGLA 2HWB1 3AKQA 3OD0A 1OQDA 4FQZA 4JQRA 4LO8A 3RMXA 1C5HA 1CAWB 4GWIA 4GAZA 5IW0A 3WF4A 4A7ZA 4JTOA 3JD72 4Q5OA 4FOVA 3TOJA 4QPIA 4U36A 4EZ4A 4RGGA 1S4CA 2JDNA 3N9MA 2DCKA 2VU9A 4YM0A 2ZEYA 1QNWA 3RRDA 5JZGC 4UFLA 1HN1A 1BZWA 3WCSA 3V0AB 2BOJA 3E5UA 3AZZA 4MZUA 1CIYA 1HXS2 1Z0HA 4IV1B 4AFMA 4FXGB 2VVFA 3ZFGC 2IC1A 5L19A 2W91A 3VHNA 3WW3A 1T6BX 3RZLA 1H8TA 4KG8A 3BKZA 1UOJA 4RR3B 1DGRN 3BCWA 2VO5A 2VMEA 1OA2A 3OGGA 4AQ2A 3OYWA 1AYN2 5BNOC 1CAXB 1DZRA 4BQWA 2AH2A 5CZKA 4GQ7A 2YUEA 2C9KA 2JG8B 2EXIA 2RS51 2V5DA 4MXWB 1AR72 3OY8B 5CNAA 4CSWA 1NX9A 1W6PA 3L9JT 3ZXKA 4Q8LA 1ENXA 4QX8A 4CDWA 3AKRA 4QX1A 1QXJA 5LY2A 5IVVA 4D3WA 2VNRA 1MS0A 1FV3A 4Q4Y1 1R091 2RDQA 4UFMA 1VBB3 3ZSJA 1AL0G 3I2FA 3T0AA 1IG0A 1H30A 2C24A 1F5JA 1DYOA 1S0CA 1O3SA 1V6OA 4QQHA 4QX3A 4NROA 1B35A 1FAYA 2BFUL 2ZX4A 2MHFA 1EPZA 5FY5A 5JZGA 3KVAA 2ADEA 4HT1T 2WZ8A 4FPHA 2HWD3 4CDQA 2WN2A 5KHIA 2I74A 4R4ZA 2K0GA 2OYZA 1AXYA 1QJY1 3W21A 1MZ6A 1ZZ6A 5GZGA 5DUUA 1YIFA 5LATA 1N3OA 5LB6A 4ASKA 4Z82A 2J1RA 3UGFA 2V09A 1LU2A 2GC1A 1R082 4V2WA 5F5IA 2AENA 3UT0A 4CUGA 3ZMNA 4XURA 4R8HA 3NKGA 2E51A 4XFIA 1QF3A 2W9XA 2A75A 5GLVA 3SHRA 4CU9A 1UIKA 4CDUA 1RUG3 2GNBA 3AKPA 3GZAA 4UW5A 2WFPA 3HT2A 4YVSC 1S0IA 4TYSA 2W2IA 2ZGRA 1JZ7A 1CQ9A 3HT1A 3POJA 4BQXA 1NA1C 2OUJA 3ORJA 4HSLA 2WC2A 2DBIA 3OPTA 1NZIA 5C4WB 2W47A 5FWEA 3BALA 5A3PA 3Q9OA 1EPWA 1PO23 3PLQA 4ZS3A 3I7DA 5FQ0A 4IEYA 1UU5A 4O7XA 4M4RA 4IEPA 4Q0QA 4QX2A 4BDVB 2XJUA 3OBZA 1PZ9A 2R49A 3NVCA 4QB2A 4L2NA 4ZS2A 1S2EA 3WG4A 1LOAA 1WW6A 3N35A 2EICA 1UKGA 4RQPA 1F4AA 1SCSA 2ZHKA 3OGSA 3DKWA 4I2OA 1V9U3 4MVTA 1JYNA 1SFYA 2PAEA 4MGYE 4E9KA 3ITQA 1O4TA 3JQXA 3LIGA 3C7OA 2X5IC 1K3IA 1QDOA 2VG9A 1QOTA 1DGLA 1NQJA 4XJUA 5AVAA 2CGOA 2WSVA 1PMJX 5FMCA 1JXNA 2MEV3 2HWE1 5FZKA 2OPKA 4WVZA 4JV4A 3BUCA 3T0BA 4M3CA 3SEEA 3FZ3A 5HV0A 2XJPA 2VNGA 3OTFA 2WYFA 2VXJA 3MIEA 2CAUA 2JE7A 5FYHA 1JU3A 2ZA9A 3VBUB 1NA1A 2FZ2A 2D6LX 1QU0A 1HJGA 4N7UA 1UCXA 4YW6A 2P37A 2P3YA 2D3RA 2EIGA 2XUEA 1VAMA 2ZKNA 5EV7A 4N43C 2WO7A 3RZMA 2ARXA 1XRUA 2WDBA 4YM2A 4N53C 4DPNA 4S2GA 5IFPA 3TEYA 1VRH1 1GMMA 4NUBA 4UT5A 2EF6A 5FAXA 3WG1A 3S57A 2XKPA 1LOFC 1QQP2 2XH6A 1UX6A 2VQUA 1Q43A 3ZIWA 4BQ2A 4IV3C 2YC4A 4BH9A 1MS9A 2D3PA 4AW7A 4C0HA 3H8RA 4QXKA 2VMHA 2XJQA 4OUSA 5EHDA 1F35A 4Q4V2 3T2PA 4N9IA 2IWGB 3FHAA 5FYBA 2E31A 1GYKA 3FBMA 1GR3A 4IV1C 1QJU2 4JDMA 1BJQA 4HXCA 4XZPA 2VXRA 2VULA 5I8TA 4XHXA 1DLLA 1EYBA 3ES4A 3HWJA 3VD3A 5BNNC 1X50A 1D4M2 1GUIA 1RUH2 4DXTA 5FY0A 3I8TA 4QXHA 1ND2A 4XE9A 2DCZA 1Y9GA 3U0ZA 3IWZA 4P14A 4YVWB 1RUF3 2LM3A 1SZBA 2VL4A 4FFGA 4LIVA 1P8JA 3Q8CA 3IM0A 4LKDA 1IS4A 3MHZA 5FYZA 3W9AA 3MUZ1 3NMBA 3E97A 1O5UA 3VZJA 5CKNA 4EN7B 4YW4A 2ZKLA 3U10A 5DUXA 4B3NA 5T52A 1WA4A 2VTFA 2HYXA 4FOWA 1KEXA 4LLOA 4R52A 3UV9A 4IV3A 2PHRA 2QQPA 1JZ5A 2Y6HA 1BLZA 1EV12 2YC2A 1OA4A 4NRMA 1ZZ7A 3N9OA 4Y1YA 4AVCA 5IT6A 2BU9A 5KXEA 2JDUA 2RS33 3L2HA 2C0ZA 2JJ6A 1G9BA 1RVF3 3B5LB 3MPBA 5FPAA 3THCA 1LECA 2B8MA 3E6BA 2WZEA 1COV3 2WNEA 4IGOA 1FXZA 3CKHA 1ZBE1 2DVDA 5CEHA 5FUNA 5EYYA 3M2MA 3NWKA 1WLTA 4D8MA 1MS8A 5K0UA 4LOTA 1V0AA 4OMDA 4Q27A 5FLIA 3WX5A 3LEMA 1ZZBA 3LKJA 3WXPA 3ZN4A 4AFBA 2W46A 5HCHA 2CHHA 2GNDA 1OD3A 4KI5M 4QX5A 5BNNA 2ZGOA 3WDTA 4CEYB 1BBT1 1POV3 1CR7A 1W9YA 4BQ4A 3WNXA 4CCCA 1KRIA 2WFF2 1UZVA 4PDWA 2DFCA 3KWVA 1SBEA 3MI8A 4JRAA 1Z7S1 3RYRA 5AC93 4OUMA 4XEZA 1R1ZA 3K48A 3LDRA 4FPFA 1ZBA2 4LUMA 2DV9A 2JE9A 4AG4A 5F9TA 1O91A 1XYPA 3EBRA 3GXUA 3USUA 3SC7X 5LWBA 2R042 2WIIB 4XQWA 3IIAA 3H7YA 3WSOA 4JZRA 2AREA 2XJSA 1CAVB 1V6NA 3IAQA 4P5YA 2XQRA 1APNA 2RR11 2HWF2 3LDKA 1UOBA 3OOXA 5I0UA 3CJIB 4LBQD 4B1MA 1OT5A 1ZA4A 3I2HA 2PHUA 4CCEA 2XGXA 3SLIA 4AVVA 1DQ0A 2ZMLA 4XDOA 1W2OA 3AYDA 3VZKA 3B93A 5FZOA 4A44A 2OS2A 2IXIA 1RMU2 3QBQA 3FBYA 1W04A 3K4ZA 3N36A 5FPVA 4AEDC 2EXHA 3I2JA 1HX6A 1PVC2 2VOXA 2IZWA 4M01A 5EJ3A 5CFDC 2MPFA 1ALYA 1O6UA 1YHFA 3KZ4C 2F4LA 4FVVA 1BK1A 2QDNA 2HBUA 1ZRDA 5AFEA 2WAOA 3BODA 3LIHA 1W8UA 4AFCA 2I2SA 3N7JA 3UGHA 3KCYA 4EROA 3CZUA 3BI3A 2B39A 1NOVA 4Y22A 1H1AA 4L97A 3AZWA 3TB0A 3T0DA 4UW6A 1GWLA 1RUG1 4Q4W3 4NRQA 1W8OA 4RHV2 5ACA3 1PGW1 1D7PM 3AM2A 3MLKA 4UI9L 5DDJ3 4A7YA 3VBUC 3MLJA 4OUEA 2MNGA 2K2SA 4XABA 3I3EA 3Q8BA 4ATEA 2ZS6B 4YRDA 2D6KA 4KH9A 3OD4A 4KWKA 4ET7A 1AYM3 3WNNA 3HNYM 4BQYA 5JIAA 1VBC3 1XOYA 2JDYA 3VBFC 1YI7A 1PO21 1VBD2 1N1TA 1WLCA 2WINB 3NAPB 2JXAA 3ZXLA 4ZZ8A 1OLQA 4P00B 5A32B 4H55A 2V72A 5FYVA 1CZSA 4XFBA 3ETPA 2ZBJA 3LA2A 4JTNA 1JZ8A 1SFNA 4IESA 3T30A 4Z2WA 5LA2A 1O4YA 2P1BA 1V9U1 4QT6A 4FPYA 4GKYA 4H14A 4YG6A 2BVVA 3GCWA 2VZOA 1LODA 1H2LA 5IAVA 1HQWA 3MDPA 5DG1A 1H0BA 4GWMA 1AF9A 2J1AA 4QKFA 4B4QA 2WNVA 2GC3A 2ZHLA 2WKKA 1GANA 5CKQA 2X05A 3ROUA 5C3OA 4TXWA 5F7UA 1ONAA 2R16A 5KC6A 1WBLA 3LB9A 4CPBD 1JYTA 3M7AA 4COWA 1YLLA 1ASJ3 2PA7A 4YVWC 2ID4A 2WZR3 2P2KA 2Y8KA 4RFRB 4NRPA 3WCRA 2XB6C 3I59B 4LR4A 4ATFA 1RUI2 2HKXA 3PVEA 1NCRB 5F2SA 3W5NA 3BTYA 1WCDJ 4Z07A 5IWFA 2EA7A 2YV8A 4OHWA 4QQPA 5FZ4A 5GLWA 4GMP3 5A7QA 3MW4A 5C71A 1DGWA 2VBBA 4JKKA 4YYOA 1MPXA 3WQ0A 4PIZA 3M3EA 1FV2A 1UY2A 2QQUA 4DXSA 3E5XA 3ZSKA 5KXBA 4B4RA 4DNYA 1O8SA 1UZZA 1F2NA 2DCTA 2ZHNA 3ON7A 4XUQA 1VBE3 3ZDVA 4JRLA 1HJFA 2V73A 3NL1A 4XOGA 4XFFA 4OI1A 5BNOB 1ENRA 2XUMA 1XC6A 4XHBA 1ST8A 4XDPA 2B4KA 4GULA 5KHKA 3ZN6B 4XF0A 1Y9MA 4HK9A 2GSYA 2W08A 3JD73 5C7GA 4LLFA 5DZGA 4D94A 4FPLA 3AKSA 4IUGA 1GZWA 2UWAA 5LBCA 1KXGA 1LOEA 3F95A 3KB5A 3I2DA 1W6OB 3C7HA 3UK9A 1YYNA 2LTNA 3T4HB 4AR2A 4KG0A 5C3QA 4DB5A 2GMEA 1RTVA 1J84A 2WR9A 3RS6A 1H1MA 4XQ4A 4Q29A 2YMZA 3LF7A 5JCTA 1OFNA 2DU0A 1W6NA 3WNPA 5J7MA 2WS91 3KMHA 2AYHA 4QDQA 1AR92 4XAAA 1VPHA 3JB8A 1GQPA 3KM5A 4AQ6A 2FD8A 1QJEA 2G9FA 2ZGUA 3GBFA 4K20A 4L11A 1D0GA 1W0NA 1NYWA 3BB6A 2B45X 5L7OB 2Q8EA 4JGZC 4XUPA 5CFCC 2RDRA 1AR73 2VNVA 2Y33A 2CGNA 4OULA 5I0TA 2K46A 4ARXA 5IVEA 4RYDA 4WM7A 5CKMA 1JZ6A 4NHMA 3RZKA 4UXAA 1C8NA 2Q1MA 1MACA 2XG3A 5FMOL 2PLV2 3TEZA 2GH2A 2Y34A 3TRSB 2BFUS 5J09A 1AL22 3M3CA 1RUD2 5E16A 2ZPXA 1OPMA 2PAMA 1RVF1 2YFUA 2W1SA 2VOTA 4D6QA 1COV1 1UXXX 5ABJC 1DF0A 3BN6A 4XJ8A 5FUPA 2Q8OA 4CU7A 2YC0A 3UKNA 1DFQA 4V1PA 5F8PA 4HPKB 4AK3A 2VBPA 1XNBA 4INDA 4QPIB 4LE3A 3ENRA 2PQSA 4BZ4A 1SLIA 1ULCA 2YYOA 4GALA 1CAUB 5FZ7A 1YJLA 3MIFA 3M1HA 5FO7B 4OZOA 2BPA2 5FZCA 4XCBA 2VZSA 4GH4A 5AC91 5SV8A 1R093 5KBFA 1VB4A 4Q0SA 1WMDA 4FTBA 1C1FA 1UPSA 4MGZE 1QGLA 4EJRA 3AMNA 5CFCA 4Z92B 5LASA 2D97A 3PU8A 5DAXA 2BBAA 2WA3A 1AX0A 3T1MA 5CYYA 4HKLA 2D5HA 5JSOA 1ULGA 4QQLA 5FP8A 1W6PB 4RFT0 4M0NA 1MS3A 5JI7A 3RWKX 3HAGA 4XUTA 1HIXA 3NAPC 3VHOA 4BB3A 4Y20A 3IKWA 1KQRA 4BQ3A 1A78A 1SFPA 4BXFA 3OCPA 2RM21 3ZPOA 4IETA 1HB3A 2C26A 5FTTC 1Q8VA 5A33B 2UWBA 4C8DA 4D6SA 5A6YA 2A6WA 4FAHA 3O1MA 4Q0VA 1L7RA 3DN7A 2O14A 3OSDA 3MF6A 2DF7A 1RUJ2 2W68A 2VE1A 5D8AA 4KBZA 2CGPA 3PMSA 4EN6B 1SPPA 1YIPA 4BE3A 4CP9A 2BTVC 3POYA 1QJZA 2RS12 3MO4A 4LKEA 2VBDA 4FQ4A 3ZR6A 1OHFA 3VBSA 5EXOA 4Q4W1 1W2AX 1QXPA 4XW3A 4YNIA 4IDZA 5FP4A 4JDOA 1NUKA 1IPSA 1PZ7A 5DDJ1 1S55A 5F5AA 5I8YA 5LBFA 3OF1A 3A23A 3WOGA 2QQMA 1C57A 2CAVA 1YC61 3WUCA 2ILMA 1WWYA 2WWJA 1CGPA 1CZTA 2O8QA 4LBQA 3SMHA 1W05A 1WKYA 1K5MC 1VBC1 4GWNA 2J1EA 5BNPC 1FMD3 1XU1A 5G05L 4BYYA 4Y4YA 3VBOA 2BOIA 2WNOA 1U0AA 2PHDA 3I3BA 3O5SA 4FP2A 4QPGA 3V0BB 1CESA 3QLQA 4META 5C8CA 4D6RA 5A7WA 1H2NA 1QQP3 2O8OA 1W9WA 1LESA 2W3JA 2OW4A 5FQ0B 1TMF1 4EN9B 1O7FA 3ILRA 1SLTA 2ZAAA 3ACIA 3TNQA 2GAUA 1UMZA 4IEWA 4OQ9A 1RUE2 3I3QA 4AHXA 4EWEA 4XUOA 5FWJA 1H6YA 2TBVA 4CXXA 3RJ2X 2KR2A 4AE2A 5IVYA 4FP3A 4W8JA 1AHSA 4LHKA 4LKSA 1JOPA 4Q4V3 3O1PA 4K8FA 3WP5A 1E5HA 1LR5A 1H8VA 2JG9C 3K46A 1QJU3 5F6LB 4XF9A 3PIGA 4X6QB 4Q1PA 1H2MA 3J7MA 3WQ7A 1U5ZA 1PNGA 1JZ2A 2VZRA 4LBOA 2IFWA 2VZ3A 3O14A 3B69A 1GSLA 2DURA 2X8KA 3H50A 4MLOA 5A3TA 1ASJ1 1D4M3 1OC1A 1WW4A 2WZR1 2DWRA 1PM4A 1RUH3 3WW2A 4FPKA 1REEA 1VIWB 2EAAA 1J3RA 2D6OX 2ORXA 4M3CB 3SH3A 5BNPA 3CF6E 4JKLA 4GMP1 2AEZA 5KHGA 5A3LA 3LCPA 1NLSA 3OBTA 4Q4X2 2RG4A 3SQOA 5FY8A 4AQSA 5IUQA 2Y6FA 1YQ2A 4C1XA 3FE5A 2OQ6A 3ZFEB 2BGPA 3IIIA 4PF1A 3I3MA 3R0RA 2GALA 1UYPA 1UW8A 3R4DB 3VBRC 5JDBA 2A7AA 3KV5A 3ZYRA 1HV0A 1VBE1 2YB7A 3WEZA 4DQAA 1AR62 4KL1A 4MHUA 5JUVA 2NYYA 2C1FA 3JCIA 2G9GA 2B9VA 1EV13 5EJZB 1FPN2 1XQNA 1QY4A 2ZAHA 1WD3A 2GDFA 3JD71 1ZZ8A 4ASMB 3WF2A 4JHTA 3ZFFB 4QB6A 2D93A 4Q0UA 5FZMA 5IVFA 4W6WA 1JHNA 2JB8A 1LEMA 1BMV1 4M3CF 1REFA 1FYUA 1GNZA 5A80A 1PK6A 1RXGA 2YGMA 4CPBA 2HWC2 2DBNA 3C2UA 4P9IA 4H3WA 3VDDA 5IVJA 2P6CA 4URTA 1LTEA 1IS5A 2HH9A 3M8LA 4A3XA 1GZ9A 5F32A 1Y3TA 2OX0A 4GZ9A 4WVMA 3N7MA 1ZYBA 2R063 1QJX2 4G9SB 3OUHA 4AVBA 5A70A 1AYN1 4FXKB 5DQ0A 1X9PA 2WFF3 3KHCA 3LSDA 5FPZA 1UY4A 3PUSA 4WM8A 1CJDA 2VMFA 5J1XA 3U14A 1ND2B 4RS5C 5FFOC 1AR71 3B02A 3H3ZA 3EO6A 2FDHA 1WLWA 2ZMNA 2PELA 3KCXA 1ZBE3 4HSJA 4I01A 3KT4A 5APAA 5T5LA 4XUNA 3WNMA 1TG7A 3M3QA 2DYCA 2HWF3 1X82A 3H7JA 1N1YA 1XNKA 3DPRB 1YQCA 4J1WA 1N3QA 3ACFA 1DDLA 3LFMA 2WO2A 3I4IA 1MVEA 2TNFA 2XVGA 5F6KA 2GNTA 3HD8B 1LEDA 4CYDA 1BBT3 2ZZJA 4QAWA 4EE2A 3LEIA 4LTAA 3WDVA 1DLCA 2GH8A 1Q8PA 2XOMA 5J98B 3TEWA 5JI9A 5ANQA 1GOFA 1POQA 1Z7S3 2VW2A 5FZGA 2GC2A 1W0PA 2PHWA 2PTMA 4DOUA 4DXRA 2D6PA 1PMHX 3PL0A 4OHVA 4A7KA 2KA3A 1YFYA 1O4ZA 3JB4C 4BOWA 1PVC3 2E7TA 5BV6A 2AR6A 3W5MA 4TLFA 1ZREA 1ZZ9A 2CDPA 2FBEA 5HBAA 4KGGA 1FX5A 4QM9A 4Y5TA 4QHBA 5JOXA 4BWOA 3AMPA 2BVBA 3E1F1 5ERLA 2RR13 1FOD2 4PBOA 3R6SA 1GP4A 5C9AA 1C8M2 5BYNA 1XSQA 3MIDA 3M70A 4XTPA 1ACCA 3LA3A 3NQHA 2R7EB 2VZUA 2XJTA 4YFWA 1GU3A 2JDPA 5E8AA 3UJOA 1BVVA 2EXJA 2IXKA 4IGQA 4RHV3 4XACA 5DZFA 3VL8A 5IVCA 3RPQA 1Q5OA 5L9VA 1N47A 2VH9A 1RJ8A 3IPVB 4AGRA 4ES8A 4DS0A 3USUB 4WVWA 5IJRA 2ZGNA 3ZFGA 2X10A 3TAYA 4PIYA 4AVAA 1JH5A 4CTEA 4IQPA 4IEQA 4EZHA 4LORA 1ODMA 1IZ3A 2D44A 3M3OA 3POIA 3RFRA 1DGRA 3EMRA 1VE0A 2J1UA 2ZABA 5FY9A 1WLDA 5JPNB 3Q8EA 5FY4A 1AUYA 2ZGQA 3T08A 3P1IA 2FDJA 2QDRA 3HQUA 3FUOA 3ZXJA 1SBFA 1T2XA 5FYSA 2HEYF 3WNKA 4L9BA 4FTEA 2QQOA 3J9SA 4JVAA 1UIJA 1W2TA 5A3WA 5FZOB 1XPWA 4XXPA 3BU0A 1OURA 4OHZA 2FCTA 2VCAA 5GKAC 5FV3A 5CBLA 2OPWA 3I49A 3NNLA 5FZDA 2OKXA 1YXWA 2ZGKA 5FLJA 3AFGA 4XQDA 1UZ0A 3GZTB 3AX4A 3GZEA 1G8WA 2JENA 4G4FA 2CV6A 2QKDA 3U4SA 3B9CA 1MEC2 2VOWA 3HR9A 2BERA 1DQ5A 1WMFA 2ES3A 4QKDA 3FL7A 2WL1A 4W4ZA 1W6QA 5C8WA 4K7JA 1ULPA 2BW8A 1G9FA 4LPLA 1VB2A 1FMD1 3MW2A 4NR1A 4XVHA 1LU1A 1OOPC 5GALA 1QWRA 4UAPA 1AR82 4NWWA 5C6CA 1VAKA 2B46X 5LY1A 2JDAA 3R4SA 5CISA 2IXJA 2XONA 2WLQA 5L73A 4OQ8A 2YBKA 1O3QA 1O3TA 4BA6A 1QQP1 3THTA 2LROA 2NLRA 1PGSA 5F1RA 3OG2A 5FZ8A 4NAMA 2Z5WA 4X8NA 3K75B 3WUDA 3RMYA 1IQAA 2V5YA 4DIQA 1E57A 4YVSA 3R05A 2I07B 4AAPA 5BPXA 5FBJA 2C9AA 3U4XA 1NCQC 2UY8A 4Q4V1 4CCLA 3KLSA 1W8TA 3O0XA 5EIYB 2IXLA 5IYYA 1QJU1 2VZTA 2VVEA 1RUNA 2NN8A 1UQXA 3L2YA 3WQ1A 3S30A 1OF4A 2QCSB 4NHYA 3IDEA 4DZGA 1D4M1 4FT8A 3NV1A 2XJRA 1SG3A 1RUH1 1UXZA 5HPOA 3FHQA 5K8SA 2WNVB 3IMNA 5IFTA 1W8WA 1VR3A 2JIJA 2R0FA 1HQNA 2RJLA 1W8NA 2YY1A 4QX7A 4BXSV 1AR93 2QTWB 1PHMA 4QGNA 4U2AA 3J8F2 1OOPA 2AZ5A 1I1EA 3MZHA 4COUA 4UF0B 2WUHA 4A41A 3S7EA 4P02B 4QHOA 1QH7A 4IE5A 1HKDA 1O59A 2Q0AA 1VJ2A 2HJIA 2W1WA 4M00A 3ATGA 3KV9A 1GICA 2X5IA 4EN0A 1C3HA 2JDZA 1IPKA 2OIIA 4YZ1A 1HQLA 2WN3A 4QKNA 1GZTA 5T54A 4RR3C 1EV11 1RUC2 1W9TA 5A7NA 1AL23 1RUD3 2BZDA 4LO7A 2OUHA 4WBBA 2VCCA 2XWJB 2H6BA 2KM2A 3CQOA 4AAXA 1JYXA 3O1OA 3ZYJB 2WS93 1XXNA 5FLHA 5D1IA 2JG8C 1PGL2 2Y26A 4NN0A 3JZVA 2ZGPA 4N43A 4P9JA 4CUBA 4HANA 1RHI2 1F31A 3KQRA 4IEXA 4IXLA 4N53A 3RZZA 2VW1A 3NV2A 1W6MA 3APBA 4CEWB 1OFSA 4UFKA 3CMGA 4J25A 2PHTA 4AZZA 4E4DX 1MZEA 1BQPA 1LOFA 4LEJA 4GIQA 3JUUA 4JDNA 2JICA 2R061 2VMDA 3HQXA 4Q8KA 1ZA7A 2WT0A 3FLRA 3ZVXA 4AVSA 2WFF1 5FP3A 2V4AA 2JKXA 4XC9A 4EYUA 4A3ZA 4AVTA 4NIIA 3RWNA 1H9WA 5L9RA 4NHXA 1UOGA 1ZBA1 4PT6A 2W95A 3GHMA 3N9NA 3BTZA 1WZXA 2W0XA 1W2UA 3I2IA 5KXCA 2FCVA 3NV3A 4XF3A 3RZJA 4XYXA 3SCFA 1RB8G 1R1A2 3OEBA 4IV1A 2B42B 1LOBA 4E8CA 1E5SA 1F8VA 4BIFA 2HWF1 1DCSA 3FLPA 5FCCA 5A7PA 3H8UA 4CCOA 3NNFA 1SBDA 4C91A 4ZZ5A 1EAH3 3AVSA 3PJQA 4W6XA 4HL0A 1CAXA 4FAGA 2P3JA 3CL1A 3BTXA 4I0AA 2WNUB 2JG8A 4MXWA 1DU3D 4DY3A 1KS4A 2Z4FA 3HBKA 1RMU1 3OY8A 4EN8B 4HKOA 4E4ZA 4QU1A 5FXWA 5H9SA 1CJPA 4UBGA 1PVC1 1OLRA 2Q8DA 2Y60A 1RUJ3 5FZ0A 4CZSA 5LRSA 4COZA 2ZGTA 1Y7BA 1DIWA 3CEWA 5A6QA 2PXJA 4JGYB 4LIUA 2WT1A 5C4WC 2UURA 2D3SA 1JYCA 4QD2A 2RS13 2XL9A 1LULA 3M3IA 3V65A 3HPNA 5LBBA 3WVJA 4QHZA 1LOGA 1U12A 5T5JA 2WYSA 1W3VA 2O0OA 3OBAA 4BISA 3UL2A 1HRI2 1XU2A 1GP6A 2RM23 4RHV1 4RSUA 1AX1A 3WG2A 1W90A 4MYEA 1PM7A 5JMOA 1O3RA 1A34A 3J7HA 3WP4A 4S2DA 1DQ2A 3PU3A 4OFGA 4UW3A 2JIGA 5FREA 4CXYA 1UD1A 4I0WB 2GC0A 1PVXA 4RGKA 2HEWF 4RN5A 3VUOA 1VBD1 3RVHA 2BP6A 1CONA 2D40A 4BQ5A 4YZ5A 4CCMA 1AJKA 1RC6A 2GN7A 3D6EA 1H9PA 3IZOA 1SDDB 2QQJA 1OSGA 4N90A 1YEWA 2P5BA 4NOTA 4OYUA 3VD7A 1DBNA 2YXSA 3FLTA 4XJ9A 2PN5A 3OBRA 2ZEXA 5F39A 4I3PA 1JODA 5F3GA 3WHTA 2YG0A 3KCCA 1DZTA 1TME2 4MH0E 4NJ4A 1IKPA 3AXDA 1ZRFA 4YW5A 4BK4A 4OHYA 2C6SA 2ZX2A 3JU9A 2PHFA 5HV4A 2FMYA 2ZMKA 4CP9B 1VBB2 3GF6A 3DV8A 4ITCA 4QXCA 2VD7A 5FZFA 3DCQA 4LQRA 1SLAA 4PHZA 3SH4A 3O1SA 2PAKA 4Q0PA 4IE4A 3HIFA 1NLRA 3ZPYA 1KITA 3PDQA 3D82A 3VBSB 4XJZA 4QB1A 4BPZA 3E6DA 1KFXL 2R073 3WQBA 4AEDA 3AKTA 2EVXA 1TMF3 2K9ZA 4XAEA 5CFDA 4L8QA 1DQ1A 1EUUA 3H1WA 2HWD2 3IMMA 5C70A 5BY5A 2CU5A 2OZJA 2Y6KA 4LBQB 1YFXA 1W8HA 3HN1A 5B4NA 4MADA 3HEIA 1TE1B 1VBA3 3U75A 1YQ6A 1IHMA 5FY1A 1OA3A 3VBOB 2BNMA 3DF0A 4GJYA 5FIXA 4PQ9A 1HB4A 1AR63 2QQKA 3A0NA 2UU8A 1OQ1A 5FZ1A 1OQEA 5ANNA 2Q1FA 5A7WB 3WY6A 3VBUA 5EFUA 3ZDSA 1E5RA 3JXSA 1XSRA 1MS1A 2WABA 3K2OA 4CDXB 2IVJA 5C5UA 4GB32 5E6HA 2RMU3 1BXHA 3VBFA 1QEXA 4TLGA 2XHKA 5DAWA 2WAAA 2FDIA 1O8PA 5DAPA 5FZIA 2RV9A 5J37A 4MGKE 3S5AA 4HN1A 1UU6A 4CCJA 4D7SA 2ZEZA 4CU6A 5JXHA 4ISRA 1UO9A 4C1WA 3VLBB 4BCUA 3S0MA 1BKZA 2E33A 1V00A 2A3XA 5FYYA 1AR91 4PQQA 1LHVA 1QJX3 2A6ZA 4CCKA 3K3NA 4AHZA 3KV4A 3VKNA 3LOIA 4YW7A 4MUVA 1W99A 1BHGA 4XMIA 5FYTA 1XNCA 1GLHA 4K6BA 2AGSA 5H9PA 3AJZA 2ZX1A 2QQNA 4W50A 5A3MA 3C7FA 1DG6A 4Y33A 4PLOA 5IVBA 1PIV2 5GLZA 3AMMA 3O7OA 1ND3B 3H42B 4YGCA 5A1FA 2JDHA 4YZ4A 2ENRA 2XDVA 3MBWA 4IEVA 1HXS3 3B9IA 5FDBA 1ZRCA 2P3IA 4QGLA 1AL21 1RUD1 4R9BA 3B01A 1MQTB 4FO9A 4CEYC 2FQPA 1RITA 2MEV2 4XIKA 1GOGA 2ZOEB 4YVWA 2WNUC 4QMAA 4BJ0A 3KS7A 5FPLA 1J3QA 3H1MA 4ZHNA 4AL9A 1WUVA 3WDXA 5JOYA 4YLZA 1AYN3 3AMHA 3PUQA 5FP7A 4E4SA 4O65A 1UOFA 2CSGA 2ZEWA 4P9XA 4MV2A 1MR5A 4LE4A 3GJBA 1LGNA 5A3OA 4HN0A 2R1DA 4JGYC 3VZLA 3IAPA 1PK6B 2Q4SA 3H8XA 1PX3A 2A1XA 4HBNA 3CJIC 2QFEA 1FOD3 1S0BA 3K4AA 1SQ4A 1C8M3 4XFAA 3VBHB 4YGEA 5BNQA 1D0HA 1WCUA 1S0EA 4WVMB 4LBNA 2BWCA 2ET1A 3AJYA 3HMYA 3FFZA 4LULA 4F8AA 2A3YA 4NIHA 3ACGA 4HOOA 2PMWB 4AEMA 1YWKA 3DUIA 5FMBA 5JR7B 1RIRA 4BQ1A 2CDOA 4LO6B 5FRAA 4AEJA 4B4PA 3VKOA 2H0VA 3NJZA 1H1IA 3O1TA 4LHNA 2EIBA 1WA6X 4FBFA 4CEYA 1EAH1 3J26N 2Q8CA 4IEUA 4UFJA 4E2GA 1E5IA 2DTWA 3KF5A 1NY72 5F5CA 3AP7A 3PVBB 5T55A 1BEV2 2VZVA 1H8TB 3O1VA 4Q1RA 1R083 3U11A 3T3YA 2A5ZA 1RUF2 3AFKA 4JGZA 4S2HA 3OYWB 1RUJ1 1W3XA 1CAVA 5JSRA 5FZLA 3SKJE 1YJKA 3CU7A 5JOWA 1PMIA 5FYIA 5GZEA 5JAXA 2AC1A 1SEFA 1VP6A 1G9AA 3AL6A 4CCDA 1D2SA 1X7NA 4H2AA 3WR0A 4BMBA 3CJIA 2RS11 3AYEA 4AFAA 3NRUA 1A8DA 1PO12 2E6VA 1SDWA 4YPJA 4CDWB 5FZ9A 1VAVA 4Y1XA 5FK7A 1QIQA 3BIEA 3NJYA 4C90A 5T5PA 4DEVA 1OKQA 2W5FA 4D69A 2RS32 5C9AB 3ACLA 1MEC3 2WT2A 4MGIE 4MX3A 3ZYBA 4ES9A 1LHNA 5ABJA 4ZXKA 2TUNA 1F5FA 1NLQA 1NQDA 3B94A 2D43A 3F2ZA 4LKFA 3VGIA 4B7EA 4MOAA 1HN0A 1K5JA 1NXMA 4RA0A 3I54A 3J7LA 4XFGA 2XLGA 2Y64A 2QE3A 5L9BA 1U5YA 1B35B 3NJXA 1N1SA 4Z8BA 1ULOA 2VZ1A 5JZGB 3HN3A 2XHNA 1AR83 4IGPA 5E88A 4C0BA 1CVNA 4CDQB 1R64A 5FZ3A 4QQOA 3ZFGB 4AF9A 2QUOA 2VUJA 4MGTA 4XJAA 4LA3A 2CL2A 2JE8A 1WCSA 4Y1VA 3ZLIA 3WDUA 1K45A 1BCXA 3ZX7A 1AXKA 4QQ2A 1WW5A 1H2KA 1VMFA 3FFQA 1DGWX 4QKBA 3T2QA 3POBA 1Q56A 2SBAA 1SCRA 1ZRRA 4QWNA 4CDXC 1NCRC 4RL7A 1WD4A 2DDUA 3Q8AA 1QOSA 5C3PA 1QH6A 4YWAA 1UWWA 4CDUB 1ZRIA 1OF3A 2A70A 4AI9A 5FY7A 1YCIA 2QJVA 3VDAA 3NAPA 3KQ4B 1ZM1A 3WINE 4BLIA 4BMEA 4XTMA 5A32A 1YFWA 1JI6A 3AZYA 3IBMA 5T3NA 1AXZA 1OD5A 4NIDA 1JYWA 2B5HA 4B29A 3PVOA 5GJ6A 5L36A 3AK0A 5FZAA 3I2OA 2R071 1CPMA 4L92A 5DN2A 4HK8A 4YSFA 1UZWA 2Z42A 4GA9A 4NPMA 1V6JA 4XF4A 4CE8A 5FR3A 2W39A 4GXLA 4MGSA 1BK0A 2RJ2A 1GBGA 3U78A 3VZNA 2BV4A 4LUKA 1C1LA 3J8F3 3SKVA 1EUTA 4YGDA 3ZMOA 1IPJA 1T6GC 4Q4X1 2WZPP 3WP3A 4J1XA 4RQPB 1S2KA 1IOAA 4HVRA 1VBA1 1FNZA 1ND3C 3CJXA 3EHKA 2R30A 1XYNA 2WQ4A 5DPNA 3FWEA 4D7TA 3FC0A 3ZN5A 5A3NA 5J96B 1AR61 2YPDA 1LNSA 1MQTC 4CRQA 4MXVA 3NNJA 4BU2A 1UN1A 3GZUC 1J59A 4ZU4A 2ARAA 1RUC3 1JS9A 4Q4W2 3TN92 1I6XA 2J42A 2XMLA 3ME2A 1FPN1 3U1XA 4XFHA 5ACA2 4WZFA 5DDJ2 2DCYA 5CAZA 3POSA 2RE9A 1HDKA 3FN9A 3MIHA 1TEIA 1K5MA 2RMU1 1XNTA 2ARCA 2D98A 5L7OC 4YVSB 2QNKA 2ORZA 1AYM2 2Q5TA 4KMQA 2BBVA 5GM0A 5KC5A 3THPA 1YQ5A 3VD9A 1XE0A 4ZU7A 1VBC2 1NA1B 2GP3A 1RHI3 3OUJA 5D21A 1UF2C 1CWPA 1REDA 5DXDA 1DYKA 2WWUA 2D7FA 4NHKA 3POEA 1UAIA 1AX2A 1YQ8A 2IFRA 3ALQA 3OGRA 4NVPA 4P9LA 2A73B 3ES1A 4OI0A 3SCHA 4Y3OA 3VHRA 1QJX1 1A8MA 1W8FA 2JD9A 4HLTA 1GNHA 1GWMA 2BGCA 2HEVF 3P3NA 3ZO0B 3MW3A 4W65A 4XMAA 3ZN6A 2JECA 1Q8SA 5FXXA 4PI0A 5FK8A 4XBQA 3PTYA 3MLLA 2WQZC 3DXUA 1KDKA 3PMEA 3POFA 4XBLA 3FMGA 1EY2A 2XBO2 4F7ZA 3ZXEA 2VTXJ 2HYKA 3MV01 3BGAA 4NIGA 3JBG2 5BUVA 1W6OA 3H0OA 3DXTA 3P6BA 1R1A3 2Q30A 3KVBA 2DTYA 2JG9A 3PHMA 4QPIC 5LRRA 1HXS1 3DYMA 3B00A 1RL3A 3KHBA 4BLJA 2CNAA 2WSUA 5F3IA 3O1UA 3LGRA 3TEXA 2X5IB 2V4VA 5TSWA 1DQ4A 5DZEA 4G3YC 4KWUA 4DEQA 2JD4A 4R9CA 3EB7A 1H8TC 3O12A 4HFSA 3HNMA 2OXBA 1ASJ2 4K8RB 4YARA 5F3CA 2GN3A 3LE0A 1AZDA 2VMCA 3LPFA 3WF3A 5L7OA 4ARYA 1URXA 2XVKA 3KT7A 5JXIA 4ZPIA 1ZBA3 4DINB 4ZKTB 1FI2A 2H0BA 1W39A 3B7MA 2R043 3VV1A 3FHIB 1GNYA 1KJRA 3VBRA 4AGGA 4OI4A 2ZJCA 4N53B 5FZHA 1SHWB 2W1UA 2E32A 4CDWC 1FOD1 1C8M1 4TTGA 1G6NA 1I5ZA 2FDGA 2Q1ZB 4M4PA 3C7EA 4GD4A 2BWAA 2Y6GA 3EXUA 3WW4A 5ISLA 4HMZA 2PFWA 1ULFA 2VCBA 4IE0A 4IV3B 4O61A 1UY1A 1HRI3 4R9AA 3AP9A 2D5FA 1MZ5A 2FZ1A 4QM8A 4ZXEA 5BXXA 3TWIA 3S5QA 2R6QA 3LZZA 4HPKA 4JCKA 5K7PA 2QQVA 1HRV2 3POGA 1B35C 2F17A 1RMU3 4SLIA 2IUWA 2HBTA 1CAUA 1NE4A 1NKGA 5D2AA 2ATFA 1BMV2 4N8MA 3VL9A 4LJHA 1GQHA 4CDQC 5GZFA 3PURA 4GKXA 2OZ6A 2FCUA 1N1VA 2PYTA 4WZCA 1RINA 5K0UB 4HZFA 4B1LA 5I0SA 5BNNB 1R081 3RQ0A 1ULEA 2ETEA 4K3UA 1LENA 2X53S 1OLME 3JQWA 3KT1A 4RS5A 5FKBA 3C8XA 4IE7A 2HWB2 3DKQA 3CZJA 1JUIA 2Y6JA 4KWLA 4PDWB 4UYBA 2YROA 1VRBA 1UY0A 5FZ6A 2LS6A 3WV6A 2J1SA 4CDUC 5A3UA 2BDRA 3V64A 1TME3 2GMPA 2IXHA 2DVGA 1QJFA 3UESA 1MS4A 2WWSA 3WDYA 3BYWA 5A6ZA 2YGLA 1CN1A 2Y38A 3A4UA 5FZEA 3LOBA 2LUWA 1KJLA 4DRRA 1HB1A 1KS5A 2IXCA 5A33A 1VBD3 1CZVA 1MEC1 2VY0A 3O0VA 3Q8FA 2X29A 1KGYA 2W1QA 1WMXA 3C7GA 4BM8A 2Z2SB 1GFF2 3CIHA 2D6MA 4MG2A 1GQGA 5FZBA 3NSTA 3ELNA 3D4KA 4PF5A 4QX0A 1KD7A 1GOHA 1LCLA 1OXCA 1QDCA 3SNMA 1JMUB 4Q26A 2RS52 1U5IA 1YI9A 1AR81 4RQPC 4UBHA 4XFCA 5HXVA 3FX3A 2R0HA 2GZWA 4Z1VA 1LGBA 3RYPA 5J3UA 2KD7A 4LBJA 3GBGA 1MZFA 5F2WA 3GGLA 1RYYA 4ORFA 4UW4A 4PI2A 4Q4Y2 1R092 1JOBA 4HETA 4YM3A 4LA2A 4D0QA 4X8PA 2DUOA 3U37A 4L0PA 1SMVA 2LALA 4HVQA 3ZKYA 1ZVFA 5CADA 4Y22B 5A7OA 3NNMA 1SACA 5LBEA 4A6SA 3RSJA 2Y6LA 5C3RA 1RUI3 4K21A 3UETA 4Y5Z0 1H4GA 1XNAA 4FFFA 4GB33 2JKBA 5A7SA 3A22A 1UMIA 4NMIA 1IKQA 1Q8QA 4PJYA 1QJY2 1OMIA 1RGSA 3O0WA 3ZFEC 3WF1A 3ZYIB 2P34A 3ZR5A 3V0BA 1JUHA 2J7MA 3CNAA 1OVPA 1NG0A 4OMCA 3GHNA 4OCTA 1RJ7A 3UNPA 2DVBA 2VQ0A 2A71A 3DL3A 3J8F1 2I45A 3RGBA 3BU7A 5AFBA 1XB9A 3PUAA 3ZFFC 4DFSA 4AEDB 5IATA 5A1AA 4EQVA 3PNAA 4N7IA 4OI2A 4URAA 5CFDB 5FJKA 5KWRA 4SBVA 3VKFC 3CLPA 2XVLA 1SLLA 2DVFA 3PJYA 1Z78A 2FHRA 3P3PA 1PIV3 2J1VA 3AZVA 3QACA 2G19A 3WG3A 2GNMA 4RGAA 4AXOA 3ILNA 5DUWA 1RUC1 1K12A 4YW1A 2W92A 2E7QA 4CU8A 5FUIA 2P3KA 4DUWA 1W0OA 5C3SA 3AMQA 4LO5B 5EJ1B 3T1LA 1JW6A 5EQUA 3MF9A 1ND2C 1PGL1 4A42A 2ZX0A 2ET7A 4I02A 5K9YA 3RNSA 3ST7A 3QH6A 5FMOS 3ZSLA 1FMD2 1RHI1 2W87A 3DGTA 3VKMA 3ASIA 3ZFEA 4LT5A 1QXRA 1LJ7A 5FOJB 5GLUA 1AVBA 3VBFB 3I97A 1W28A 4PCRA 4QGMA 3A21A 3AC0A 1TNRA 1W03A 2NMOA 4MO3M 3DPRC 4FOYA 2KXLA 1I5PA 2PLV3 2VMIA 4YW3A 5HI0A 2XLFA 2XR4A 1HV1A 4X6RB 5H9QA 2ARBA 3H3UA 2R1BA 1Y43B 2HWE2 3HJRA 3ZFFA 4E4HA 3BOPA 5LK5A 1NCQA 4ISQA 1LRHA 5CB7A 3RZGA 4FCAA 1R1A1 1V6IA 4B8EA 5EZWA 4AOCA 3RI9A 5IK8A 3D0JA 1STMA 4XILA 3MFCA 3RJRA 4AI8A 4LHLA 3UYJA 1GZWB 5K0UC 2CWSA 4BIOA 1XE7A 1JTZX 1A6CA 1OBNA 1VRH2 3GNEA 1CD3G 4E27A 2ADDA 2C5DA 3GALA 1X8EA 5I93A 1PX4A 1MVQA 1CAWA 1POV0 2VJXA 4OLLA 4CXWA 1BEV3 3LEGA 2XJVA 3NW4A 4PDWC 5F3EA 3SEPA 1J3PA 2G1MA 1W6NB 4KU7A 2R041 1G86A 2IVIB 3BOWA 3QCWA 3V0AA 3M4FA 2N7GA 5FBZA 3VDCA 3J7NA 3EJKA 4NAOA 4MGQA 3AVRA 4LBLA 1Y9QA 1ZNPA 2VOKA 3DPRA 1IGOA 4QDRA 3ZXAC 4CP0A 1ZX5A 4WM7B 2VUAA 4JX0A 4RR3A 5DABA 1OPOA 4CA9A 1PO13 2VECA 4BHPA 1XE8A 4I3GA 5KXDA 4N9HA 5E1RA 3K77A 4FI9A 4NO4A 1FT9A 2W94A 3A0KA 1HRI1 2OVUA 2Z69A 3VD5A 1B09A 5GZDA 2VCMA 2XLAA 4CUCA 5KR7A 3FJSA 1OLMA 3MIBA 5SV5A 3INAA 1VLNA 4BK5A 3LFIA 4KNCA 3SXWA 2OT7A 2YFZA 2CYFA 4J6GA 4Y26A 3E6CC 1UL9A 2DCJA 3GJAA 3N9QA 4XF1A 3X29B 4COYA 1US3A 1JZ3A 1LGCA 2BNNA 1WCQA 3VN4A 3BPZA 1HLCA 4H7LA 4LXLA 2VM9A 2R062 4JKMA 1JN2P 5JVVA 2A6XA 4YGBA 4AFDA 3IB3A 3AYCA 3AZXA 3HVDA 1LOCA 1IS3A 4GH4B 4FPCA 1JYVA 4DO0A 1OKOA 3IPVA 2QQLA 3MYXA 4WVVA 1ENQA 1OI6A 1TME1 2H6CA 3B3QE 3MUY1 3NJVA 4XZUG 2LRPA 4FPEA 1FATA 4JGZB 3KF3A 4E2QA 5CFCB 5C33A 1ZBE2 4AYUA 3I3DA 2AUYA 4AEKA 4H7MA 3ZXDA 1PNFA 1YFUA 1VBB1 1WW7A 2LW8A 3NNGA 4R9DA 2E7AA 3RZHA 1DZQA 1UYZA 1C28A 4QPYA 4PLNA 4QPWA 3WNOA 3VZMA 5EWSA 1Q8OA 4IW3A 4YG3A 1XBFA 2R32A 4PBPA 4V2VA 4Y20B 1BBT2 2DUPA 1D4VB 2YU2A 3BIWE 3PVNA 4OHXA 3GBWA 4MHRA 4UOJA 5FXVA 1Z7S2 3HNBM 4S2FA 5FKCA 5ABJB 4GJZA 2HWD1 3USSA 4XXAA 3LEKA 1RUE3 1V6KA 4K40A 4AI0A 4AWDA 4LBKA 5CVRA 5C4WA 1LKNA 1C4RA 1SLCA 1W06A 5D8AB 4A6OA 2J1TA 2PHLA 2RR12 3ZIXA 4E8DA 4YZ2A 1SPPB 5IK5A 2JB4A 3D5OA 5HCFA 3NV4A 5GZCA 2YHJA 3WNLA 4YG0A 2L9LA 4LNVA 2VW0A 1ENSA 3OB8A 2WNVC 5FYCA 2WO1A 2P4EA 5FXZA 1UPIA 5CIRA 1U5XA 3TN93 4TSVA 2WQ8A 5FPUA 3ZXFA 4K1ZA 5K4LA 1RUI1 5EYXA 4A4AA 5AVPA 2OA2A 2VQTA 3UKVA 4GB31 1J1TA 2XXZA 2GP5A 1YUDA 3AP6A 3BVCA 1EP0A 2QQIA 4Q4X3 1D2QA 5JOZA 4GMP0 4P9YA 1W9SA 3N4MA 5J48A 2VTXA 1S0FA 1YO8A 1X8MA 1GP5A 2TEPA 3I2GA 3ZYFA 4NHLA 5G04L 4ZONA 3OGVA 4FFHA 3ZYPA 4ASLA 5LK7B 4QPGB 3VD4A 1L7LA 5A6XA 3RYKA 3QOPA 3TNPB 5C8CB 1WCKA 4TZDA 2XWBB 4Z2AA 2VAUA 1RUG2 4DUXA 5LCWL 2A6VA 2EIDA 2NPIA 1FPN3 4CVUA 1PGW2 3UGGA 3QH7A 2XBO3 1L7QA 1A3KA 4GWJA 1OH4A 2XQXA 4LK7A 4CP2A 5T50A 4Y1UA 4UFHA 3JBG3 3VB9A 5HXMA 1PIV1 2CWMA 3WF0A 2ZXQA 2E26A 2Z79A 2BEOA 3GM8A 5EPAA 3MICA 2PQQA 2Y0OA 1LHWA 3NKTA 4XDQA 4RD7A 5T5OA 2HWC3 4CEWC 2J22A 1K42A 1X9TA 2XL7A 4PLMA 1PO22 4JQTA 5M0TA 2MEV1 3RI8A 1V70A 4JC1A 5JSPA 2QBXA 1NAEA 5JXGA 3KV6A 4I30A 2F6BA 4AQTA 3AXEA 4B7KA 2WO3A 2NMNA 4UF0A 3ACHA 2ZGSA 4DY5A 3TYJA 3ZYHA 1V9U2 3NO8A 3K3OA 3MV11 3U07A 2G9ZA 3IDCB 4E2SA 3AP4A 1K5MB 1S2BA 4XJWA 1XYOA 2ZCWA 5FMDA 5BNPB 3IN9A 2OQ7A 4DUVA 4KU8A 4CCNA 4CUAA 2JEMA 4WM7C 2G4IA 2A6YA 2PLV1 3W59A 5CA6A 5IK4A 1CX4A 1UKRA 3S6PA 1TQ5A 1I3HA 5HCBA 5J36A 5B2GB 2BGOA 3RDIA 3K4DA 3PIJA 2DUQA 3LDBA
chains in the Genus database with same CATH topology
4YM1A 5F5QA 5FO8B 1O5LA 3G7DA 2XKOA 4AI2A 1GV9A 1BVP1 2VQAA 5JLVA 1BYHA 4FSJA 1ZZCA 4XBNA 1HRV3 1YNAA 2XPJA 4K1YA 4Q2FA 4CEWA 1V6LA 3KGZA 5I0RA 4I0BA 2NM1A 4KQ7A 3E5QA 2UYBA 5I91A 2JG9B 1QNYA 3RG0A 3BTAA 4P9GA 1NY71 3VDDB 1S0GA 1BEV1 4OVEA 4EWAA 4EWDA 1RUF1 3ILFA 4GH4C 5JIUA 3LWCA 2HWB3 4YW2A 1QMJA 2EAKA 2UWCA 2ZGLA 4HKWA 1S0DA 2WJSA 4WM8B 3WHUA 1X33A 2BNOA 3H1YA 3HBZA 4AI1A 1KFUL 4DRVA 1PO11 3ETQA 1G9DA 5DUVA 3VBRB 1L3JA 3SCGA 2WNUA 2ZTNA 2VPVA 4OZXA 2RS31 3QD6A 1QOOA 1M06G 1YRZA 5FO9B 4LBMA 4LO4B 2VGDA 2WS92 3FUQA 3WP6A 1F9KA 5LEJA 3LAGA 2RS53 4JGYA 4CP1A 3WT3A 4FTSA 4XPVA 3T2TA 3OJBA 1XNDA 5D8AC 2CY6A 2WA4A 4XETA 1POV1 4WV8A 4F83A 1AJOA 3MFAA 3AP5A 3IDBB 3KD4A 4TWTA 4Q4Y3 1NZCA 3VBSC 1RVF2 3MPPG 1WMEA 1COV2 4RS5B 3MIGA 4XIOA 4Y1ZA 1C5IA 1LHUA 4IL7A 2P17A 4AHWA 3VHPA 2QZ3A 4DXZA 1DQ6A 3POWA 5IK7A 4FPOB 4P9WA 4A2UA 1JBCA 3R4UA 4W6YA 2EXKA 1QJY3 1EAH2 3S7IA 1NXD1 4PIXA 3D0SA 2WLPA 3VBOC 2RJKA 3VKLA 4AI3A 3MGUA 4QPGC 4IEOA 5AC92 5C8CC 3EQEA 1LB2A 5DG2A 2A3WA 3CO2A 1S1AA 1RUOA 3J4UH 4KWJA 4COVA 1RUE1 1UU4A 3GYDA 4FPJA 1IS6A 4I09A 2VNOA 1Q3EA 4KGQA 5LEKA 4NPRA 4R4XA 1J1LA 3ZXGA 1VALA 2VOVA 3SISA 3TBDA 2FMDA 1ULDA 3AB0A 1M4WA 4AHYA 3W58A 2E53A 3TN91 3K51A 2RM22 1G7YA 2E63A 5ACA1 5JMCA 1MS5A 3URFA 2NP0A 3ZSMA 5FOBB 2YZ4A 3N7LA 3OPZA 2RHPA 1AYM1 2YDEA 1CIWA 1W6QB 2DFBA 4MSVA 5H9RA 3OGJA 3ZYGA 4DMIA 5HCAA 1N3PA 2UY9A 3KSCA 1QHDA 4IEZA 2CTVA 1QKQA 1G9CA 1JYIA 3WZ1A 2PHXA 2YPJA 3SH5A 3LSEA 4FPGA 3IT8A 4D7YA 3N7KA 1DHKB 2ZX3A 3I59A 1JOJA 3WLUA 3AYAA 1DYPA 1NCRA 4CDXA 2HWE3 2XBO1 1GKBA 3WW1A 2GMMA 2VMGA 3UJQA 3JBG1 4YFZA 2NQYA 2D6NA 5JPMB 3H9AA 3G6JB 2HWC1 1J58A 2ZZQA 1WBFA 3WD5A 4AGVA 1PK6C 2O1QA 2UYAA 4P5HA 3VDDC 2F4PA 1PZ8A 2ZGMA 4ZU5A 3UKTA 1VRH3 5BNOA 1H4HA 3D8CA 3VBHC 1TNFA 2E9QA 4M3CE 2B7YA 2R072 5KHHA 5CU1A 1TMF2 4Y24A 5KHJA 4WM8C 2ERFA 4K9SA 2QVSB 1ND3A 1OOPB 2Y0IA 2EALA 2BQPA 2B9UA 4ONUA 5CG9A 1X36A 4O9EA 1FNYA 1VBA2 2NZ9A 2VVDA 4M0HA 1MQTA 2ZACA 1GZCA 4IERA 2DVAA 2BYVE 4EV0A 3WDWA 2JX9A 4FOQA 1WGPA 1HW5A 3MEPA 3C3VA 3ZSEA 1SLBA 2W52A 2WZR2 1LHOA 3N3HA 1S0JA 2BUKA 2DU1A 1HRV1 4L99A 3LA7A 5JWPA 2RMU2 1NCQB 2GU9A 1UZYA 3VZOA 4F3JA 4NWVA 5CG8A 2ZHMA 1I9RA 1NE6A 3ECQA 3V56A 5FPXA 4N43B 2QZ2A 5GLTA 1KDMA 4O9GA 4QU2A 4YZ3A 3SITA 3VBHA 1W6MB 1CPNA 4JAAA 1VBE2 4HVOA 2SLIA 4KBBA 5C9AC 5E89A 1V6MA 3KGLA 2HWB1 3AKQA 3OD0A 1OQDA 4FQZA 4JQRA 4LO8A 3RMXA 1C5HA 1CAWB 4A7ZA 4JTOA 3JD72 4FOVA 3TOJA 4QPIA 4U36A 4RGGA 4YM0A 2DCKA 2VU9A 1QNWA 3RRDA 5JZGC 1BZWA 3WCSA 3V0AB 3E5UA 3AZZA 4MZUA 1Z0HA 1HXS2 4AFMA 4IV1B 4FXGB 2VVFA 3ZFGC 2IC1A 5L19A 3VHNA 3WW3A 1H8TA 4KG8A 4RR3B 1DGRN 3BCWA 1OA2A 3OGGA 4AQ2A 3OYWA 1AYN2 1CAXB 1DZRA 2AH2A 4GQ7A 2YUEA 2JG8B 2EXIA 2RS51 4MXWB 1AR72 3OY8B 5CNAA 3L9JT 1W6PA 3ZXKA 4Q8LA 1ENXA 4CDWA 3AKRA 1QXJA 4D3WA 2VNRA 1MS0A 1FV3A 4Q4Y1 1R091 3ZSJA 1VBB3 1AL0G 1H30A 1F5JA 1S0CA 1O3SA 1V6OA 4QQHA 1B35A 1FAYA 2BFUL 2ZX4A 2MHFA 1EPZA 5JZGA 4HT1T 4FPHA 2HWD3 4CDQA 5KHIA 2I74A 4R4ZA 2K0GA 2OYZA 1AXYA 1QJY1 1MZ6A 1ZZ6A 5GZGA 5DUUA 1YIFA 1N3OA 4Z82A 2V09A 1LU2A 2GC1A 1R082 2AENA 3ZMNA 4R8HA 3NKGA 2E51A 4XFIA 1QF3A 2A75A 5GLVA 3SHRA 1UIKA 4CDUA 1RUG3 2GNBA 3AKPA 3GZAA 4UW5A 2WFPA 3HT2A 4YVSC 1S0IA 4TYSA 2ZGRA 1CQ9A 3HT1A 1NA1C 2OUJA 4HSLA 2WC2A 5C4WB 3BALA 3Q9OA 1EPWA 1PO23 3PLQA 3I7DA 5FQ0A 4IEYA 1UU5A 4IEPA 4Q0QA 2XJUA 1PZ9A 2R49A 3NVCA 4L2NA 3WG4A 1LOAA 1WW6A 3N35A 1UKGA 4RQPA 1SCSA 2ZHKA 3DKWA 4I2OA 1V9U3 4MVTA 1SFYA 2PAEA 4MGYE 4E9KA 1O4TA 3JQXA 2X5IC 1QDOA 2VG9A 1QOTA 1DGLA 1NQJA 4XJUA 5AVAA 2CGOA 2WSVA 1JXNA 2MEV3 2HWE1 2OPKA 4WVZA 4JV4A 4M3CA 3FZ3A 2XJPA 2VNGA 3OTFA 3MIEA 2CAUA 2JE7A 3VBUB 2ZA9A 2FZ2A 1NA1A 2D6LX 1QU0A 4N7UA 1UCXA 2P37A 2D3RA 2EIGA 1VAMA 2ZKNA 5EV7A 4N43C 2ARXA 1XRUA 4YM2A 4DPNA 4N53C 4S2GA 1VRH1 2EF6A 5FAXA 3WG1A 2XKPA 1LOFC 1QQP2 2XH6A 1UX6A 1Q43A 3ZIWA 4IV3C 4BH9A 1MS9A 2D3PA 4AW7A 4C0HA 4QXKA 2VMHA 2XJQA 4OUSA 4Q4V2 4N9IA 2IWGB 1GYKA 3FBMA 1GR3A 4IV1C 1QJU2 4JDMA 1BJQA 4XZPA 2VXRA 2VULA 5I8TA 4XHXA 1DLLA 1EYBA 3ES4A 3HWJA 5BNNC 1X50A 1D4M2 1RUH2 3I8TA 1ND2A 4XE9A 2DCZA 3U0ZA 3IWZA 4P14A 4YVWB 1RUF3 2LM3A 3IM0A 1IS4A 3W9AA 3E97A 1O5UA 3VZJA 4EN7B 4YW4A 2ZKLA 3U10A 5DUXA 4B3NA 5T52A 1WA4A 4FOWA 4LLOA 4R52A 3UV9A 4IV3A 2PHRA 2QQPA 1EV12 1OA4A 5KXEA 1ZZ7A 5IT6A 4Y1YA 4AVCA 2RS33 3L2HA 2C0ZA 2JJ6A 1G9BA 1RVF3 3B5LB 3MPBA 1LECA 2B8MA 3E6BA 1COV3 2WNEA 1FXZA 1ZBE1 2DVDA 5EYYA 3M2MA 3NWKA 1WLTA 1MS8A 5K0UA 4Q27A 5FLIA 3WX5A 3WXPA 1ZZBA 3LKJA 3ZN4A 4AFBA 2GNDA 5BNNA 4QX5A 2ZGOA 3WDTA 4CEYB 1BBT1 1POV3 1CR7A 3WNXA 1KRIA 2WFF2 4PDWA 2DFCA 4JRAA 1SBEA 3MI8A 1Z7S1 3RYRA 5AC93 4OUMA 4XEZA 1R1ZA 3K48A 4FPFA 1ZBA2 4LUMA 2DV9A 2JE9A 4AG4A 5F9TA 1O91A 1XYPA 3EBRA 3USUA 2R042 2WIIB 4XQWA 3IIAA 3H7YA 2AREA 2XJSA 1CAVB 1V6NA 1APNA 2RR11 2HWF2 5I0UA 3CJIB 4LBQD 1ZA4A 2PHUA 2XGXA 3SLIA 4AVVA 1DQ0A 2ZMLA 3AYDA 3VZKA 3B93A 2IXIA 1RMU2 3QBQA 3FBYA 4AEDC 3N36A 2EXHA 5EJ3A 1HX6A 1PVC2 2VOXA 2IZWA 4M01A 5CFDC 2MPFA 1ALYA 1YHFA 3KZ4C 4FVVA 1BK1A 2QDNA 1ZRDA 5AFEA 3BODA 4AFCA 2I2SA 3N7JA 3KCYA 4EROA 2B39A 1NOVA 4Y22A 1H1AA 4L97A 3AZWA 3TB0A 4UW6A 1RUG1 4Q4W3 4RHV2 5ACA3 1PGW1 3AM2A 3MLKA 5DDJ3 4A7YA 3VBUC 3MLJA 2MNGA 2K2SA 4ATEA 2ZS6B 4YRDA 2D6KA 4KH9A 3OD4A 4KWKA 1AYM3 5JIAA 1VBC3 3VBFC 1YI7A 1PO21 1VBD2 1N1TA 1WLCA 2WINB 3NAPB 2JXAA 3ZXLA 1OLQA 5A32B 4H55A 4XFBA 2ZBJA 3LA2A 4JTNA 1SFNA 4IESA 4Z2WA 1O4YA 4QT6A 1V9U1 4FPYA 4GKYA 4H14A 4YG6A 2BVVA 1LODA 1H2LA 1HQWA 3MDPA 5DG1A 1H0BA 4GWMA 1AF9A 4B4QA 2WNVA 2GC3A 2ZHLA 2WKKA 1GANA 3ROUA 1ONAA 2R16A 5KC6A 1WBLA 3LB9A 3M7AA 4COWA 1YLLA 1ASJ3 2PA7A 4YVWC 2WZR3 2P2KA 3WCRA 2XB6C 3I59B 4LR4A 4ATFA 1RUI2 2HKXA 3PVEA 1NCRB 1WCDJ 4Z07A 2EA7A 2YV8A 4OHWA 4QQPA 5GLWA 4GMP3 3MW4A 1DGWA 4YYOA 3WQ0A 4PIZA 3M3EA 1FV2A 3E5XA 3ZSKA 5KXBA 4B4RA 4DNYA 1UZZA 1F2NA 2DCTA 2ZHNA 1VBE3 4JRLA 2V73A 4XOGA 3NL1A 4OI1A 4XFFA 5BNOB 1ENRA 2XUMA 4XHBA 4GULA 5KHKA 3ZN6B 4XF0A 4HK9A 2GSYA 2W08A 3JD73 4LLFA 5DZGA 4D94A 4FPLA 3AKSA 1GZWA 2UWAA 1KXGA 1LOEA 3KB5A 3I2DA 1W6OB 3UK9A 1YYNA 2LTNA 4KG0A 4DB5A 2GMEA 1RTVA 3RS6A 1H1MA 4XQ4A 4Q29A 2YMZA 5JCTA 1OFNA 2DU0A 1W6NA 5J7MA 2WS91 3KMHA 2AYHA 1AR92 3JB8A 3KM5A 4AQ6A 2G9FA 2ZGUA 3GBFA 4K20A 4L11A 1D0GA 3BB6A 1NYWA 2B45X 5L7OB 4JGZC 5CFCC 1AR73 5I0TA 2CGNA 4OULA 4WM7A 4NHMA 4UXAA 1C8NA 2Q1MA 1MACA 2XG3A 5FMOL 2PLV2 2GH2A 3TRSB 2BFUS 5J09A 1AL22 3M3CA 1RUD2 5E16A 2ZPXA 1OPMA 2PAMA 1RVF1 1COV1 5ABJC 1DF0A 4XJ8A 2Q8OA 2YC0A 3UKNA 1DFQA 4V1PA 4HPKB 4AK3A 1XNBA 4INDA 4QPIB 4LE3A 3ENRA 4BZ4A 1SLIA 1ULCA 2YYOA 4GALA 1CAUB 1YJLA 3MIFA 3M1HA 5FO7B 2BPA2 4GH4A 5AC91 5SV8A 1R093 5KBFA 1VB4A 4Q0SA 1WMDA 4FTBA 1C1FA 1UPSA 4MGZE 1QGLA 4EJRA 3AMNA 5CFCA 4Z92B 2D97A 2WA3A 1AX0A 3T1MA 4HKLA 2D5HA 5JSOA 1ULGA 4QQLA 1W6PB 4RFT0 4M0NA 1MS3A 5JI7A 3HAGA 1HIXA 3NAPC 3VHOA 4Y20A 3IKWA 1KQRA 1A78A 3OCPA 2RM21 4IETA 5FTTC 5A33B 1Q8VA 2UWBA 2A6WA 4FAHA 4Q0VA 3DN7A 3MF6A 2DF7A 1RUJ2 2W68A 2CGPA 5D8AA 3PMSA 4EN6B 1YIPA 4BE3A 2BTVC 3POYA 1QJZA 2RS12 4FQ4A 1OHFA 3VBSA 5EXOA 4Q4W1 1QXPA 4XW3A 4YNIA 4JDOA 1PZ7A 5DDJ1 1S55A 5I8YA 3OF1A 3WOGA 1C57A 2CAVA 3WUCA 2ILMA 1CGPA 2O8QA 4LBQA 3SMHA 1K5MC 1VBC1 4GWNA 5BNPC 1FMD3 1XU1A 4BYYA 4Y4YA 3VBOA 1U0AA 2PHDA 3O5SA 4FP2A 4QPGA 3V0BB 1CESA 3QLQA 4META 5C8CA 1H2NA 1QQP3 2O8OA 1LESA 2OW4A 5FQ0B 1TMF1 4EN9B 1O7FA 3ILRA 1SLTA 2ZAAA 3TNQA 2GAUA 1UMZA 4IEWA 1RUE2 4AHXA 4EWEA 2TBVA 3RJ2X 4AE2A 4FP3A 1AHSA 4LHKA 4Q4V3 4K8FA 3WP5A 1LR5A 1H8VA 2JG9C 1QJU3 5F6LB 4XF9A 4X6QB 4Q1PA 1H2MA 3WQ7A 1U5ZA 1PNGA 4LBOA 2IFWA 3O14A 3B69A 1GSLA 2DURA 2X8KA 3H50A 4MLOA 1ASJ1 1D4M3 1WW4A 2WZR1 2DWRA 1RUH3 3WW2A 4FPKA 1REEA 1VIWB 2EAAA 1J3RA 2D6OX 4M3CB 3SH3A 5BNPA 3CF6E 4GMP1 5KHGA 5A3LA 3LCPA 1NLSA 3OBTA 4Q4X2 4AQSA 5IUQA 4C1XA 3FE5A 3ZFEB 3R0RA 2GALA 3R4DB 1UW8A 3VBRC 5JDBA 2A7AA 4DQAA 3ZYRA 1HV0A 1VBE1 1AR62 4KL1A 2NYYA 2C1FA 3JCIA 2G9GA 1EV13 1FPN2 1XQNA 1QY4A 2ZAHA 1WD3A 2GDFA 3JD71 1ZZ8A 4ASMB 3ZFFB 2D93A 4Q0UA 4W6WA 1JHNA 1LEMA 1BMV1 4M3CF 1REFA 1FYUA 1GNZA 1PK6A 2YGMA 2HWC2 3C2UA 4P9IA 4H3WA 3VDDA 4URTA 1LTEA 1IS5A 4A3XA 3M8LA 1GZ9A 1Y3TA 4WVMA 3N7MA 1ZYBA 2R063 1QJX2 4G9SB 4AVBA 1AYN1 4FXKB 2WFF3 3LSDA 5FPZA 4WM8A 1CJDA 1ND2B 4RS5C 5FFOC 1AR71 3B02A 3H3ZA 3EO6A 1WLWA 2ZMNA 2PELA 3KCXA 1ZBE3 4HSJA 4I01A 3KT4A 5T5LA 3M3QA 2DYCA 2HWF3 1X82A 3H7JA 1N1YA 1XNKA 3DPRB 4J1WA 1N3QA 1DDLA 3I4IA 1MVEA 2TNFA 2XVGA 5F6KA 2GNTA 3HD8B 1LEDA 4CYDA 1BBT3 2ZZJA 4LTAA 3WDVA 2GH8A 5J98B 1Q8PA 5JI9A 1Z7S3 2VW2A 2GC2A 1W0PA 2PHWA 2PTMA 4DOUA 2D6PA 4OHVA 4A7KA 2KA3A 1YFYA 1O4ZA 3JB4C 4BOWA 1PVC3 2E7TA 5BV6A 2AR6A 4TLFA 1ZREA 1ZZ9A 5HBAA 2FBEA 4KGGA 1FX5A 4QM9A 5JOXA 4QHBA 4BWOA 3AMPA 2BVBA 2RR13 1FOD2 4PBOA 3R6SA 5C9AA 1C8M2 5BYNA 3MIDA 3M70A 4XTPA 3LA3A 2XJTA 4YFWA 5E8AA 3UJOA 1BVVA 2EXJA 2IXKA 4RHV3 5DZFA 3VL8A 3RPQA 1Q5OA 1N47A 2VH9A 1RJ8A 3IPVB 4AGRA 4ES8A 4DS0A 3USUB 4WVWA 2ZGNA 3ZFGA 3TAYA 4PIYA 4AVAA 1JH5A 4IQPA 4IEQA 1IZ3A 2D44A 3M3OA 1DGRA 2ZABA 5JPNB 1WLDA 1AUYA 2ZGQA 2QDRA 3FUOA 3ZXJA 1SBFA 2HEYF 4FTEA 4L9BA 4JVAA 3J9SA 1UIJA 4XXPA 4OHZA 5GKAC 5CBLA 1YXWA 2ZGKA 5FLJA 3AFGA 4XQDA 3GZTB 3AX4A 1G8WA 2JENA 4G4FA 2CV6A 2QKDA 3B9CA 1MEC2 2VOWA 3HR9A 1DQ5A 1WMFA 2ES3A 2WL1A 1W6QA 5C8WA 4K7JA 2BW8A 1G9FA 1VB2A 1FMD1 3MW2A 4NR1A 1LU1A 1OOPC 5GALA 1QWRA 1AR82 4NWWA 5C6CA 1VAKA 2B46X 3R4SA 2IXJA 5L73A 2WLQA 1O3TA 1O3QA 4BA6A 1QQP1 3THTA 2NLRA 1PGSA 5F1RA 2Z5WA 4X8NA 3WUDA 3RMYA 1IQAA 2V5YA 1E57A 4YVSA 3R05A 2I07B 5BPXA 3U4XA 2C9AA 1NCQC 2UY8A 4Q4V1 3KLSA 3O0XA 2IXLA 1QJU1 1RUNA 2VVEA 2NN8A 3L2YA 3WQ1A 3S30A 2QCSB 3IDEA 4DZGA 1D4M1 4FT8A 3NV1A 2XJRA 1RUH1 5K8SA 2WNVB 3IMNA 1VR3A 2R0FA 1HQNA 2RJLA 2YY1A 1AR93 4U2AA 1PHMA 4QGNA 3J8F2 1OOPA 2AZ5A 1I1EA 3MZHA 4COUA 3S7EA 1QH7A 4M00A 1HKDA 2Q0AA 1VJ2A 2HJIA 3ATGA 1GICA 2X5IA 4EN0A 1C3HA 2JDZA 1IPKA 2OIIA 4YZ1A 1HQLA 5T54A 4RR3C 1EV11 1RUC2 1AL23 1RUD3 4LO7A 4WBBA 2OUHA 2XWJB 2H6BA 2KM2A 3ZYJB 2WS93 1XXNA 5FLHA 5D1IA 2JG8C 1PGL2 2Y26A 4NN0A 3JZVA 2ZGPA 4N43A 4P9JA 4HANA 1RHI2 1F31A 3KQRA 4IEXA 4IXLA 4N53A 3RZZA 2VW1A 3NV2A 1W6MA 3APBA 4CEWB 1OFSA 4E4DX 2PHTA 1MZEA 1BQPA 1LOFA 4LEJA 4GIQA 3JUUA 4JDNA 2JICA 2R061 4Q8KA 3HQXA 2WT0A 3ZVXA 3FLRA 4AVSA 2WFF1 4AVTA 3RWNA 1H9WA 1ZBA1 3GHMA 2W0XA 1W2UA 5KXCA 3NV3A 4XF3A 4XYXA 3SCFA 1RB8G 1R1A2 4IV1A 2B42B 1LOBA 1F8VA 4BIFA 2HWF1 3FLPA 5FCCA 3H8UA 1SBDA 4C91A 1EAH3 4W6XA 3PJQA 4HL0A 1CAXA 4FAGA 2P3JA 3CL1A 4I0AA 2WNUB 2JG8A 4MXWA 1DU3D 4DY3A 1KS4A 1RMU1 3OY8A 4EN8B 4HKOA 4E4ZA 5H9SA 1CJPA 4UBGA 1PVC1 1OLRA 1RUJ3 4CZSA 5LRSA 4COZA 2ZGTA 1Y7BA 1DIWA 3CEWA 4JGYB 2WT1A 5C4WC 2UURA 2D3SA 1JYCA 4QD2A 2RS13 2XL9A 1LULA 3M3IA 3V65A 3WVJA 1LOGA 1U12A 5T5JA 2O0OA 3UL2A 1HRI2 1XU2A 2RM23 4RHV1 4RSUA 1AX1A 3WG2A 4MYEA 1O3RA 1PM7A 3WP4A 4S2DA 1DQ2A 4OFGA 4UW3A 5FREA 1UD1A 4I0WB 2GC0A 1PVXA 2HEWF 3VUOA 1VBD1 1CONA 2D40A 4YZ5A 1AJKA 1RC6A 2GN7A 3D6EA 1H9PA 1OSGA 4N90A 4NOTA 1DBNA 2YXSA 3FLTA 4XJ9A 2PN5A 3OBRA 4I3PA 3WHTA 3KCCA 1DZTA 1TME2 4MH0E 1IKPA 3AXDA 1ZRFA 4YW5A 4OHYA 2ZX2A 3JU9A 2PHFA 2FMYA 2ZMKA 1VBB2 3GF6A 3DV8A 4ITCA 1SLAA 3SH4A 2PAKA 4Q0PA 3HIFA 1NLRA 3ZPYA 1KITA 3VBSB 3D82A 4XJZA 4BPZA 3E6DA 1KFXL 2R073 4AEDA 3AKTA 2EVXA 1TMF3 2K9ZA 5CFDA 4L8QA 1DQ1A 3H1WA 2HWD2 5BY5A 2OZJA 4LBQB 1YFXA 3HN1A 1TE1B 1VBA3 1IHMA 1OA3A 3VBOB 2BNMA 3DF0A 4PQ9A 1AR63 3A0NA 2UU8A 1OQ1A 1OQEA 3WY6A 3VBUA 5EFUA 3ZDSA 1MS1A 4CDXB 4GB32 2RMU3 1BXHA 3VBFA 2XHKA 5J37A 4MGKE 4HN1A 1UU6A 4D7SA 4ISRA 4C1WA 3VLBB 4BCUA 3S0MA 1BKZA 1V00A 2A3XA 1AR91 1LHVA 1QJX3 2A6ZA 4AHZA 3VKNA 3LOIA 4MUVA 4XMIA 1XNCA 1GLHA 4K6BA 2AGSA 5H9PA 3AJZA 2ZX1A 5A3MA 1DG6A 4PLOA 1PIV2 5GLZA 3AMMA 3O7OA 1ND3B 4YGCA 4YZ4A 2ENRA 4IEVA 1HXS3 3B9IA 5FDBA 1ZRCA 2P3IA 4QGLA 1AL21 1RUD1 4R9BA 3B01A 1MQTB 4FO9A 4CEYC 2FQPA 1RITA 2MEV2 4XIKA 2ZOEB 4YVWA 2WNUC 4QMAA 3KS7A 1J3QA 3H1MA 1WUVA 3WDXA 5JOYA 4YLZA 1AYN3 3AMHA 4E4SA 4P9XA 4MV2A 1MR5A 4LE4A 1LGNA 4HN0A 2R1DA 4JGYC 3VZLA 1PK6B 2Q4SA 4HBNA 3CJIC 2QFEA 1FOD3 1S0BA 1SQ4A 1C8M3 4XFAA 3VBHB 4YGEA 5BNQA 1D0HA 1S0EA 4WVMB 4LBNA 2BWCA 2ET1A 3AJYA 3HMYA 3FFZA 4LULA 4F8AA 2A3YA 4AEMA 1YWKA 3DUIA 5JR7B 1RIRA 4BQ1A 4LO6B 5FRAA 4AEJA 4B4PA 3VKOA 2H0VA 3NJZA 1H1IA 4LHNA 4FBFA 4CEYA 1EAH1 3J26N 4IEUA 4E2GA 2DTWA 1NY72 3AP7A 3PVBB 5T55A 1BEV2 1H8TB 4Q1RA 1R083 3U11A 2A5ZA 1RUF2 3AFKA 4JGZA 4S2HA 3OYWB 1RUJ1 1CAVA 5JSRA 1YJKA 3CU7A 5JOWA 1PMIA 5JAXA 5GZEA 1SEFA 1VP6A 1G9AA 1D2SA 1X7NA 3WR0A 4BMBA 3CJIA 2RS11 3AYEA 4AFAA 1A8DA 1PO12 2E6VA 1SDWA 4CDWB 1VAVA 4Y1XA 4C90A 5T5PA 1OKQA 4D69A 2RS32 5C9AB 3ACLA 1MEC3 2WT2A 4MGIE 4MX3A 4ES9A 1LHNA 5ABJA 4ZXKA 2TUNA 1F5FA 3B94A 1NQDA 3VGIA 2D43A 4B7EA 1NXMA 4RA0A 3I54A 4XFGA 2XLGA 2QE3A 1U5YA 1B35B 1N1SA 4Z8BA 5JZGB 1AR83 5E88A 4C0BA 1CVNA 4CDQB 4QQOA 3ZFGB 4AF9A 2QUOA 2VUJA 4XJAA 4LA3A 2CL2A 1WCSA 4Y1VA 3WDUA 1BCXA 3ZX7A 1AXKA 4QQ2A 1WW5A 1H2KA 3FFQA 1DGWX 1Q56A 2SBAA 1SCRA 1ZRRA 4CDXC 1NCRC 4RL7A 1WD4A 1QOSA 1QH6A 4CDUB 2A70A 1YCIA 2QJVA 3NAPA 1ZM1A 3WINE 4BLIA 4BMEA 4XTMA 5A32A 1YFWA 3AZYA 3IBMA 5T3NA 1AXZA 1OD5