2D98A

Structure of vil (extra ki/i2 added)-xylanase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
189
structure length
183
Chain Sequence
TIQPGTGNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSLSVYGWSRNPLIEYYIVENFGTNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDQIVAVEGFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New methods to prepare iodinated derivatives by vaporizing iodine labelling (VIL) and hydrogen peroxide VIL (HYPER-VIL)
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase 2
total genus 50
structure length 183
sequence length 189
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2d98A00
1AXKA 1OA2A 2VGDA 4HK8A 2VG9A 2B45X 4IXLA 1OA3A 2JICA 1T6GC 2BWAA 1REEA 3VL9A 2D97A 3AMPA 3VZLA 1H0BA 4HKWA 2C1FA 4HK9A 1HV1A 1H4GA 4S2FA 2D98A 4XQ4A 1F5JA 3AMHA 1BK1A 1UKRA 2JEMA 1BVVA 1UU4A 2DCYA 1REDA 3WP3A 2QZ2A 3MF9A 3MFAA 2QZ3A 3VGIA 3WQ1A 5HXVA 3AKRA 3M4FA 3RI8A 5K9YA 3VL8A 1REFA 1QH7A 1XYNA 1UU6A 2NLRA 3AMMA 1H1AA 4NPRA 2Z79A 3RI9A 3B7MA 1XYOA 1XNBA 3VZNA 3VZOA 1HV0A 3AMQA 3WR0A 2B46X 1IGOA 1HIXA 3WX5A 3AKPA 2JENA 3VHOA 1XNKA 3WP5A 1PVXA 2B42B 4XQWA 3AKTA 4H7MA 1M4WA 1UU5A 5K7PA 3WT3A 3MFCA 1C5IA 1TE1B 1XXNA 1QH6A 2DCZA 3O7OA 3EXUA 1OLQA 3WP6A 3VLBB 2NQYA 4S2HA 3WQ0A 2VULA 1OA4A 3B5LB 3AKQA 4XQDA 3WXPA 1OLRA 2VUJA 3VZMA 3VHPA 3HD8B 1W2UA 3LB9A 1KS4A 4HKOA 1KS5A 5EJ3A 2DFCA 1H8VA 3MF6A 2BVVA 2BW8A 3WQ7A 1XNDA 1YNAA 4XPVA 1XNCA 1H4HA 1NLRA 3WY6A 1XYPA 2DCKA 3AKSA 2DFBA 3VHNA 3WP4A 3ZSEA 3VZKA 1ENXA 1BCXA 3AMNA 4S2GA 2BWCA 1C5HA 2DCJA 2F6BA 4S2DA 3LGRA 3VZJA 4HKLA
chains in the Genus database with same CATH superfamily
4HONA 1SCSA 1JOBA 3IPVB 2JG8B 3MIEA 4K8FA 5L36A 2HWD1 4ZY9A 4NRPA 1K42A 1NCRC 5AVPA 5A3LA 3KF3A 1IG3A 3LPFA 3OCPA 5FP3A 3TB0A 1ULPA 3I2JA 2C0ZA 4UF0A 5BNPA 3NRUA 2VD7A 1JHNA 4O65A 2DWRA 1QDCA 4HKWA 4QWNA 4DXTA 1CIWA 1WLDA 1LOFA 5FZ1A 1O91A 3AM2A 1W6OB 1ZZ6A 2PFWA 1POV1 3U10A 3TRSB 1UMZA 4AAXA 1JBCA 3AYDA 2A3WA 3VBOC 1W8UA 1JODA 4QQOA 4IEUA 4MHRA 3T2TA 3DKQA 3M4FA 3GBWA 4FXGB 4BB3A 4Q0PA 4Y20A 4NOTA 4P9GA 3RG0A 5K0UB 3MW3A 4YW4A 1GICA 3FJSA 4RHV1 3UV9A 3TWIA 5H9QA 2E7QA 3ZOIA 1EV11 1R1A2 2ARAA 3KGZA 1FYUA 1W8FA 2HWF3 4IE4A 1S2KA 4DFSA 5C8CB 5FWJA 3HAGA 4XZUG 4YVWA 4LT5A 4FP2A 4ZU7A 1WBFA 5H9RA 5A1LA 4CCEA 1A34A 1QJU3 1XC6A 1HRV3 3OUHA 3GHNA 3ZYHA 4QQLA 1TNFA 5IK7A 2ZGLA 2DBIA 3MLKA 1JZ5A 3RZHA 5EHDA 4RA0A 1O4ZA 2PAEA 1UU5A 1FPN3 1VBC1 1SQ4A 1YFWA 2HBTA 4DINB 5K7PA 4HETA 3WV6A 5IATA 3I2FA 5DAPA 5LY1A 2Q0AA 3H8UA 1LENA 3T2QA 2ERFA 4P14A 2JE7A 1YI7A 1GANA 5GM0A 3W20A 4E4SA 4PIYA 4XTMA 2WNOA 4M3CA 1W39A 4DRVA 4EWEA 4AVBA 1HRV2 2YFZA 4XUOA 2VZRA 3LEGA 4NRMA 5LWBA 1LEDA 1SFPA 1K5MA 5A7NA 4YYOA 3I2DA 1GOGA 2DBNA 3RYRA 2RHPA 1XPWA 2GSYA 4QU2A 2ZACA 4JQTA 4LEJA 4B4RA 3VB9A 2JG9B 5A3PA 1O8SA 3RGBA 1J59A 5FY8A 3OUJA 3J26N 1HXS1 1W9SA 2VZTA 5FCCA 3ZFFB 3TEWA 2XR4A 4RHV2 3UESA 5JSRA 1ODNA 1LTEA 3LSDA 5FZ0A 4CDXC 1OOPB 3SQOA 2BERA 2XOMA 2XBO2 2NN8A 2GNTA 4ONUA 2VMCA 3MLJA 2B9VA 4XFGA 4C8DA 1DGWA 1PZ9A 1RUF3 1YQCA 1AR63 5DG2A 5CFDC 5JVVA 2HJIA 2VBBA 2RM23 1MR5A 2DCJA 5JMCA 4OQ8A 2WZR3 5K0UC 3H8XA 3QBQA 3RZMA 1H2KA 1NA1C 2VGDA 2JB8A 2DUQA 3GZAA 5CNAA 1YHFA 2DURA 2BJSA 4W50A 2A6YA 3DYPA 4ZS2A 4FPKA 1HRI1 4NROA 4RS5C 5FRAA 3VBUC 4CRQA 1O3TA 2XLAA 3UK9A 5J48A 2Y34A 4Y5TA 1PO13 3CZJA 1NXD1 3FN9A 2VOXA 5C5UA 1GQGA 2W08A 4GMP0 3H42B 1H0BA 4UT5A 4Z07A 3KLSA 4Y1XA 4XQ4A 1H2NA 1UY3A 3IWZA 4BXSV 1OKOA 1UKRA 2DCYA 4CU6A 1C1LA 3ILRA 3DEMA 2XXZA 2PELA 4IEPA 1RTVA 2HWB3 3E5QA 1WCSA 3OUIA 4M4RA 3SHRA 3SKJE 2CWSA 1UOJA 1KJLA 3NJVA 4K3UA 3WNNA 2JDAA 2VZPA 1YUDA 4KI5M 4OCTA 2R7EB 5IVEA 1HJGA 1NZIA 4BDVB 5I0UA 4QPYA 3MDPA 5A32B 4X8PA 4JRAA 4JGZB 4PF5A 4H14A 4CP1A 1CAWA 2XWJB 4XUPA 4CEWA 1LHVA 2D6LX 4FFHA 1N1VA 3VZOA 1QJX1 4B1LA 1RUG1 4AGRA 5HV4A 2B46X 5BXXA 5FPBA 1BHGA 5ISLA 1AR81 1HIXA 4NHMA 2WDBA 4NAOA 1DYKA 2J1TA 2ZPXA 2RS32 3N9QA 1DFQA 1NOVA 1V9U3 2DF7A 3Q8BA 2AEYA 2OQ7A 4XXPA 1PVXA 4E9KA 3EJKA 3RZJA 4MG2A 3G7DA 2HLEA 5FP7A 5FPLA 4HANA 4MGSA 4W65A 4Q0SA 3AP5A 4LO4B 2P5BA 2YG0A 2YHJA 2LRPA 2RS11 5JXJA 2DCTA 4CA9A 2BZDA 4LKSA 4TYSA 1NUKA 2RG4A 5KHGA 3VKFC 4YARA 4RL7A 5FREA 2ZOEB 4R4ZA 3BUCA 1AUYA 5A3TA 3JB4C 1NLSA 5F6LB 2SLIA 4K21A 5ACA1 4X8NA 1LULA 1NX9A 4AAPA 2ZAHA 1ZBE2 4Q1PA 2W46A 4JGYA 3UGHA 3CJIB 3GBFA 5G04L 3ZXLA 4YVWC 5FZFA 3CF6E 3WW2A 3S0MA 1ZA7A 3VZMA 4EWAA 3K51A 2Y8KA 4MVTA 2CGPA 2E51A 1S0GA 4LLOA 1UW8A 4XJWA 1CD3G 4AEDA 1X33A 2YYOA 1URXA 2OQ6A 2WNVB 2ZABA 4YNIA 4BU2A 4CUAA 5LBBA 2UYAA 4N8MA 5DAXA 1C3HA 2ZTNA 3HEIA 3NL1A 2R063 3NKTA 3MZHA 1CIYA 2DVFA 5FP8A 2GC2A 4DS0A 3H8RA 3C3VA 1CAXA 3IM0A 2HWB1 2XKOA 1QNWA 2EAKA 3MICA 5F2WA 4EN6B 1NLRA 3EB7A 2E6VA 5FZ9A 4LA3A 1W6MA 4N43B 4GAZA 1H8TA 4ISRA 1AL0G 4YPJA 3NJZA 1DQ0A 5HCBA 4CDQB 4G3YC 3VHNA 4DXZA 4HG6B 4AVTA 5HCAA 4JGYC 1PK6C 3KHBA 4AGVA 4NE9A 1EV12 5M0TA 1AXZA 4GXLA 3KD4A 1BKZA 4F8AA 1OFSA 1RUG3 3A7QA 1CAUB 1OA2A 1RMU2 5JMOA 3LFMA 4EWDA 3DKWA 3KS7A 5IT6A 4JTNA 1BEV3 2QQNA 3X29B 3VD9A 4IXLA 2WAOA 4J6GA 5KXEA 5FLHA 3ZFGC 2EXHA 1W8ZA 2JJ6A 4Q0QA 4AI1A 1Z7S2 4K7JA 5I93A 3VD3A 4WVWA 2QQJA 1C8M1 4OI0A 3DPRA 3TNPB 3ZXDA 5FP9A 1H4GA 3KZ4C 1JYTA 1TEIA 2CAUA 2KR2A 4KG0A 4FFGA 4Q0UA 4X6RB 4PT6A 4XFCA 1A3KA 1W04A 2QZ2A 3ZDVA 2ADEA 3BYWA 4I2OA 1LNSA 5SV8A 5FY5A 1GP6A 4WM7A 5IVYA 1WA4A 1PNFA 3POBA 1ALYA 1R091 4YFZA 2Q1ZB 3PDQA 4JX0A 1XYNA 4IEZA 1RUD1 1WLCA 3PU3A 4L0PA 4UW4A 2Q8EA 1NA1B 1VAKA 3AXDA 4L97A 4FBFA 3OBAA 1FOD2 1DIWA 1MEC3 1UU6A 1Y9MA 2W5FA 2WLPA 1QQP2 2P6HA 3L2YA 4LQRA 3OGSA 4J1WA 1JU4A 4ZXKA 3B7MA 5FY9A 4F83A 1OQDA 5F5CA 5FYHA 3WW4A 2VTXA 4AE2A 1TVGA 1QMJA 2VTFA 2GP5A 4RR3A 2QQMA 2W1SA 1DGWX 3RJ2X 1TMF3 1VALA 2XKPA 1QQP1 1Y9GA 2SBAA 4GJZA 4BPZA 1L7RA 3JU9A 1SBEA 4GH4A 1UYYA 5ANNA 4L99A 4Z82A 4Q8KA 3WT3A 5FIXA 4XF4A 4ZKTB 2HH9A 2EXIA 3E1F1 1YFUA 1X8MA 3O0VA 2AGSA 1UYPA 4RFRB 5K0UA 1WCDJ 5FO7B 2W1QA 1RITA 5T3NA 2GP3A 2XJVA 4CUGA 2ILMA 1YQ8A 4FAGA 1OD3A 1PO22 1J3PA 3W21A 4RN5A 3U4XA 4I3GA 5T50A 5JXIA 1GZTA 3GNEA 3BI3A 2VBDA 4NIDA 4FSJA 3AL5A 3POGA 1JTZX 1WKYA 1XU1A 2WQ8A 1CONA 2VUAA 3HD8B 1AX2A 1Q8VA 3VUOA 3O1SA 2XHKA 1IG0A 3LB9A 4JGYB 5DDJ1 2XDVA 4QX0A 4BQWA 5CKNA 5DUWA 3VD4A 1PM7A 2FDJA 1C8M3 5EJ3A 5FBJA 3NO8A 1UO9A 1FNZA 5FLIA 4CUCA 3M2MA 2XL9A 3R4UA 4IESA 4OFGA 2VW1A 2EA7A 1HRI3 1FV3A 2BGCA 5JZGC 4DPNA 1NQJA 3ZFEA 5C4WB 2N7GA 2WT2A 2FZ2A 1QNYA 1VRBA 1HX6A 1YQ5A 2K46A 4IV3A 3PLQA 4FPHA 4HVOA 1W9YA 2FHRA 2UU8A 2WNUA 4C1XA 1BVP1 3Q8FA 2ZGKA 1SLLA 2DVAA 3B00A 4XAEA 3VD7A 1MQTB 3H8OA 2XBO3 4IE6A 1C1FA 2G19A 3LZZA 2O0OA 4PBOA 3HIFA 1S0FA 4LK7A 4LBNA 4NIHA 1Q3EA 1PGL2 2WNVC 4YZ5A 4HL0A 1DQ5A 1H8TB 2BU9A 4N43A 5CIRA 2NMNA 2VZSA 2JG9A 3NJXA 2OA2A 1IQDC 1VB2A 1DU3D 5J98B 1W6NB 2X09A 2IXHA 3IIAA 3MBWA 3CDZB 1OUXA 4E4HA 1ZRDA 4HSLA 2Q8DA 3GALA 3O0WA 4FO9A 3S5AA 1NY71 1W06A 1H1MA 2DYCA 3THTA 3KQRA 3DCQA 1JYVA 1WW5A 3FBMA 3GF6A 2D98A 4M3CB 3WDXA 1BBT3 3ACHA 4CDQC 1WZXA 2Q8CA 3BODA 1V9U1 3P6BA 3T3YA 4CU7A 3RMXA 1PMIA 4GB33 3ZXEA 1RUI1 3M7AA 2FCVA 4DY3A 4HN0A 4KBZA 4MO3M 4QX1A 4CU9A 2VCAA 2WUHA 3JBG2 3PUQA 2J42A 5BNNB 5FUPA 4M3CF 2X5IB 1R64A 3PUSA 4XIOA 3F2ZA 5EFUA 3OBRA 4ITCA 1Q5OA 1SDDB 2W91A 3N9MA 3AZWA 5KHHA 3ZYIB 3MV01 3NNGA 4QMAA 2VNOA 2OKXA 3JUUA 4E2GA 3PHMA 5I0TA 4EZHA 3IDCB 4BH9A 1H9PA 3EMRA 4UWDA 5A6QA 1XBFA 2E31A 3ZYJB 2IFRA 5DMYA 5I8TA 4XHXA 4FP3A 1CZTA 1W6PB 2AUYA 4KNCA 1RINA 5C7GA 1K3IA 1GZCA 3GHMA 3WW1A 5EIYB 3I3MA 1MZEA 4AL9A 2W0XA 1LAJA 2RM21 1C8NA 1EAH2 1LHOA 3O5SA 1KITA 1C5IA 3PJYA 1OI6A 3ZSKA 2J1AA 4E2QA 4LHSA 1XNTA 3GZUC 4N9IA 3B93A 3R4SA 4BE3A 3NNMA 4Y33A 2VZQA 2W3JA 2F17A 5IAVA 4CEYA 2JDKA 5AFEA 3MLLA 3OPZA 1S0DA 1I1EA 3VBSB 4WZFA 1CN1A 4E27A 4ZHNA 3B5LB 4AHZA 2MEV1 1S0CA 2I07B 4L2NA 2NPIA 5E16A 4AR2A 1G8WA 1EAH1 2R16A 4D6QA 5FZOB 3WP5A 2D93A 4XFFA 1H8TC 4BQ3A 1OLME 2FBEA 2ZS6B 3J7MA 1OT5A 1W8HA 2W94A 1W2UA 3LSEA 4BZ4A 2R073 4QGNA 2X8KA 4V2VA 1UKGA 2ZHKA 2DFCA 4QXKA 5IVFA 3LD8A 5FOJB 1XU2A 4AQTA 2RMU1 2BNOA 2ZGPA 5JPNB 2MHFA 2JD4A 4L8QA 1RUI3 3EBRA 2VZ1A 3WUDA 3PMSA 1MVQA 1DG6A 2R043 5T5JA 4CPBA 4XUQA 4AFCA 5BYNA 4CPBD 1PHMA 4XOGA 3DXUA 1NQDA 3H7YA 2A6XA 4HN1A 5JR7B 4BQ2A 1ZZBA 1QJU2 1VB4A 4IE7A 3CU7A 3O0XA 4WM8C 3ZMNA 3MIBA 3TN93 1ENXA 1MS0A 2PYTA 2I2SA 4K6BA 4RR3C 4K9SA 2RS53 2F6BA 3I2KA 3N7LA 5SV5A 1ASJ1 2JD9A 5BNNC 1OH4A 1AR72 1CQ9A 2AENA 3PTYA 3J7LA 4TLFA 1MS4A 3MI8A 3M3IA 3OBZA 2KA3A 2RS12 5LA9A 4FOWA 5FYCA 1UY1A 2BVBA 5CFCB 4NMIA 5JXGA 3IMMA 3N35A 4PJYA 4DOUA 5T5LA 1CX4A 5CFDB 4WM7B 1IS5A 4LKEA 4B7EA 1OOPA 2P17A 1BBT2 1OQEA 2F4LA 4BWOA 5CB7A 2G9FA 3MFAA 3SCFA 2EALA 1GBGA 4XF1A 1PX4A 5H9SA 2UY8A 2HWC1 1DZRA 4MGQA 4BLIA 1REFA 1DDLA 1QH7A 3S30A 1POQA 2LW8A 3NV1A 1ZRRA 3TAYA 4R9AA 5FY4A 1XRUA 5LASA 3WOGA 5B2GB 2DVGA 5FMCA 3K48A 2B39A 1POV0 1S55A 3ON7A 4DRRA 4EV0A 5HBAA 4D69A 4NWVA 1XYOA 4LITA 2VE1A 3VDDA 3CIHA 3H3LA 1AL22 5C3RA 1W6QB 1CWPA 2Y6GA 1DZQA 3DN7A 3I3DA 4NPLA 2Q8OA 4SLIA 1AJOA 3AP6A 4XYXA 3HOBA 3CKHA 4YM2A 4B4QA 5DZGA 1XNKA 1VAVA 4WBBA 2H6BA 4C91A 3ABZA 3PUHA 2P1BA 2OXBA 3PUIA 3BPZA 3ZIWA 4WV8A 4XDQA 3I54A 5KHJA 1FOD3 2XGXA 2J1EA 4AHXA 4LOTA 3SISA 3C7GA 2WBKA 1LGNA 3OEBA 1TE1B 1RJ7A 2RE9A 4YZ4A 5CAZA 4Q8LA 3WG2A 3MIFA 3JD71 1VRH3 5L9RA 4OHWA 1O8PA 1YEWA 2WS93 2Y6LA 4LO8A 3KT7A 4AEDC 4KG8A 3WQBA 1S0BA 2C6SA 5A70A 1BJQA 4PLNA 3EO6A 1D4M2 1LOEA 5FYZA 3J8F1 5DDJ2 5BNQA 2JG8C 2PA7A 2HWD2 4QX8A 4AFMA 4BQ5A 4HMZA 5JOYA 3M3OA 3MHZA 1QDOA 3H50A 1O3QA 1Y7BA 4UXAA 1JHJA 3SC7X 1HB4A 3JQWA 1F31A 1V6OA 3SITA 4Q4W3 4IV3B 4BYYA 4AI2A 1G6NA 1ND3B 1NCQA 4I0AA 3UL2A 1E5HA 5A33A 4BK4A 4RGKA 4Z1VA 1AL21 1XNDA 4XE9A 2JDHA 2LALA 4Z2AA 2CGOA 4B29A 2FMYA 3J9SA 3SLIA 4P9WA 4UFJA 3IDEA 4Q4X2 2WFPA 3HQXA 3SH4A 5IHRA 1NAEA 2VMIA 1TG7A 3I4IA 1RB8G 2YBSA 2JE8A 4A7ZA 2XWBB 1W0PA 4P9LA 1PM4A 3VBRC 4O9EA 4IV1B 4C1WA 1RYYA 4LULA 4XJ9A 4FCAA 5FLJA 5LY2A 2TUNA 5F5IA 5KXDA 3LGRA 5JI7A 2R062 1PGW2 3MPBA 1AR83 3T2PA 1N1YA 4N43C 4IEVA 2JDUA 3ZSMA 2WN3A 3Q8CA 4HPKA 4OI4A 4BXFA 1JU3A 2WT0A 2ZHLA 1WD4A 2WS91 4LE3A 2OT7A 4MXVA 4IL7A 4GALA 1UY2A 1RIRA 4Y5SA 3OGJA 1U0AA 5DDJ3 4DXRA 3ZKUA 5KXBA 2DU1A 1FOD1 3CHXA 3D0SA 4K8RB 1KGYA 4PQ9A 3KGLA 2JECA 3T1MA 4YM1A 5J09A 3GXUA 1MZ6A 1WCUA 3K4ZA 2ETEA 1CAWB 2EIDA 2VCCA 3OBTA 1PVC1 2XG3A 3APBA 4Q1RA 5A32A 2QJVA 4IEQA 2YGMA 1ASJ3 4M01A 4BISA 2CSGA 1W05A 5I8SA 3WNMA 3AP4A 3VBSC 3A0KA 3ZFFA 4AI9A 4OLLA 5IAXA 1H1AA 1AR92 1A8DA 4R9BA 4V1PA 1SFYA 4FQZA 1H9WA 4QM9A 3RQ0A 5J37A 2IVIB 2BBVA 3ZR5A 2WFF3 3TBDA 1WCQA 2OVUA 2VOKA 4Q4V2 5DUUA 5A6ZA 1JYIA 4HZFA 1UMIA 3RRDA 5C9AA 1OOPC 5FXZA 3E97A 1AL23 1UOBA 1YYNA 2D6KA 3RZLA 3O1UA 3J4UH 2IXIA 2ET1A 4IERA 1QJFA 4D7YA 5F8PA 4FPFA 1SHWB 4IGQA 3AKTA 5F3EA 3E5UA 1HW5A 1LOGA 2IXKA 4GA9A 3MFCA 4PF1A 2G9GA 3IT8A 3IB3A 2EAAA 3ACGA 2VNRA 3K77A 2WO1A 5EZWA 5L7OA 4E2SA 5L73A 4AEJA 4QHOA 5GZFA 5BNNA 3EXUA 5FZOA 3RZZA 4LTAA 3WF1A 3HQUA 4FPJA 4NHXA 1W2NA 5FYSA 4COWA 3DPRB 5IK8A 1JZ8A 2B7YA 4NPMA 4EN8B 1SG3A 3N9OA 5GZEA 2E26A 3FFZA 2D5HA 1SCRA 1IHMA 2ZCWA 4PDWB 1CAVB 5FWEA 3T4HB 1ZRCA 2TEPA 1AR93 1NCRA 1JI6A 4EJRA 3K4DA 5FYYA 3VBRB 4YWAA 2D7FA 1B09A 2LUWA 2O8OA 3POIA 4FPGA 1MS1A 3AK0A 1UPSA 4TXWA 5DZFA 1B35B 2PHFA 2OZJA 2Q4SA 3HT2A 4FFFA 2GNMA 5CBLA 1Q8OA 4XW3A 1XNCA 3LPGA 2V4AA 1O3SA 1VRH1 3PNAA 1AYM3 2BGOA 4B4PA 1AR71 2NM1A 1S2EA 4MGZE 4AEDB 3I59A 2DCKA 5ABJA 3WG4A 3AL6A 5C9AB 5JCTA 5C4WC 2YMZA 2MNGA 5LCWL 1IPKA 4QDRA 4KH9A 1GQPA 3RZKA 5F5AA 1E5SA 2OZ6A 5A7SA 3KT4A 5FP4A 1SPPB 4D94A 5C8CC 3MV11 1KDKA 1O3RA 4IV3C 1J83A 1RUE2 2ARXA 5JXHA 1YFYA 1X7NA 4C90A 4LKDA 4OI2A 2XVGA 2IXJA 2WNUB 4BCUA 3KV5A 3R05A 5HXMA 2B5HA 4QU1A 2YXSA 3VDDB 3ASIA 1GWKA 5FZ7A 2VVFA 2R061 5BNOB 1YFXA 1ULOA 1V6IA 1RUH1 4XBQA 4YW7A 3USUB 3WDYA 4EQVA 5CA6A 1PK6A 1VE0A 4NHKA 3IKWA 5T55A 4WVVA 1PZ8A 2WJSA 3LDKA 2FD8A 5KXCA 5FMOL 3VKLA 4PHZA 5FZGA 3N7KA 1MZFA 2DTYA 3BU0A 1SPPA 2UWAA 2WC2A 5JAXA 5C5TA 3IAQA 3I3EA 4JRLA 1I5PA 1G86A 5T52A 3I2OA 4URTA 2AYHA 2WQZC 5BY5A 3HWJA 1RC6A 2WAAA 2BEOA 3VBOB 1IPJA 3V0AB 2E9QA 5D8AB 4UOJA 3SKVA 3NNLA 1NKGA 4N7IA 4XCBA 4CDUB 2Z79A 2Y38A 2A7AA 4XJ8A 3AYEA 4XMIA 1DGRN 2JG9C 2Q30A 2LROA 1ASJ2 3JD73 2ARCA 1LU1A 1VAMA 2RM22 1UQXA 1IZ3A 4UFHA 5FYIA 1LRHA 4R9CA 1D4M3 4GIQA 1CGPA 2OUJA 1RUOA 1G9FA 2K9ZA 2UYBA 3GBGA 2IC1A 1BXHA 4PDWA 5LBEA 3WX5A 2Q1MA 2WWSA 1QJY2 4YM0A 4F3JA 4CEWB 4M3CE 3JQXA 4Q4Y1 3JD72 3U11A 2G1MA 4YW1A 1CJPA 4JHZA 1TME3 1X36A 2VXJA 3N9LA 2R042 4C0BA 4FVVA 5LA1A 1ND3A 3R0RA 4YW5A 3T1LA 1ND2B 2VQUA 4M4PA 4Q26A 1QHDA 4PIXA 3B69A 1QJX2 2W52A 4XILA 1QWRA 1ONAA 1W9WA 1UXZA 2VMGA 3AVSA 4UW6A 1ZX5A 4QPGA 4UW5A 5EXOA 4MOAA 4O9GA 3N36A 1OLQA 1ULGA 3WP6A 2ZMLA 1IS6A 2VPVA 2BRTA 2HYKA 4EN0A 1STMA 5JOWA 3VKOA 4EE2A 1DBNA 2DDUA 2R30A 4IV1A 1W6QA 4YLZA 2VZOA 2VOWA 5FZMA 1W6PA 3OD4A 1W8NA 2GDFA 3K75B 3MGUA 4P00B 4CYDA 1XJAA 3MPPG 3POYA 4HT1T 5ABJC 4LUKA 2WNUC 5JOXA 1MS5A 2A6ZA 1SACA 3MW4A 4NN0A 2A3YA 5FZDA 2R0HA 4OULA 3V56A 3ZYPA 1NZCA 1YWKA 4LHNA 4MV2A 2RJKA 3NMBA 2YU1A 5FXWA 4CE8A 2RDRA 3C7OA 4QB2A 3BTYA 2GZWA 2P3IA 1HJFA 2R6QA 3GGLA 5T54A 1CAVA 2VAUA 5JIAA 5L7OC 2IXCA 3F95A 4ZS3A 2PLV3 3H1MA 5FJKA 3FLPA 1ULFA 1ZYBA 3WY6A 1DP0A 2VNVA 5F37A 4OZOA 3NAPA 4IEOA 2C26A 1SZBA 5F9TA 2P3KA 3LEMA 1W2AX 4Y1YA 4YGBA 3DYMA 1LGBA 3FE5A 3OGVA 3I3QA 1ZBE3 1ZA4A 5APAA 4CCNA 3TEYA 4IGPA 1K45A 2HWF2 3AFGA 4LOSA 2EVXA 4OVEA 4GMP1 1DHKB 4XC9A 3OGRA 2WSUA 3RNSA 1HQLA 2TNFA 2QQVA 1OQ1A 1GNZA 1JZ6A 4Q4Y3 3PVBB 5FDBA 3OJBA 3C7EA 1S0JA 1AYM1 3K4AA 1T6BX 2BWAA 3MEPA 1KFXL 4LHKA 1LECA 1OKQA 2Z69A 1LGCA 1SDWA 2X10A 2DVBA 2VXRA 2WZR1 1V9U2 4NWWA 4JC1A 1W9TA 1WMXA 2CU5A 3VKMA 3KV4A 1IKQA 4I0BA 5GLTA 1WCKA 4GD4A 1KQRA 3MF9A 1BK0A 5F39A 5CFCA 4NO4A 2ZMNA 1VR3A 2K2SA 2AZ5A 3RPQA 4FTEA 3N7MA 3USSA 4GWMA 4YVWB 4ASKA 4D6SA 3VDBA 2BTVC 1NT0A 1ZZ9A 5A7OA 1FV2A 1HRV1 1Q43A 2ZGMA 3GCXA 3N9PA 4MLOA 1XB9A 4FAHA 2P34A 5KC5A 3OY8A 3UJQA 2W1WA 1ZBA2 1RUH3 2R072 3D0JA 5FMOS 3UT0A 2PHTA 2IXLA 4FFIA 1NCQB 5EJZB 1GP5A 2Y64A 5FZAA 4B8EA 1F8VA 2R071 3H1YA 2D6NA 2VZUA 4JGZC 2WA3A 4XIKA 4A7YA 4I02A 2X5IC 1PMHX 3FHQA 3NNFA 1BMV1 5IUQA 3U14A 5FZIA 4P5HA 2R1DA 2WZPP 4A6SA 2J22A 3ZPYA 2D6OX 4OMDA 2XJUA 4KGQA 1YQ2A 2GC0A 4XABA 2ZEXA 2QQWA 2BV4A 5IK5A 1VBB1 1LKNA 5I0DA 2XL7A 1FMD3 4RGGA 3WHUA 3ZFGA 1QJX3 1ENQA 1HRI2 1XE0A 2W92A 3N3HA 1HQNA 2QQUA 4GQ7A 1NCQC 2DCZA 1W2OA 1ZNPA 4TLGA 2XPJA 1UL9A 4AEMA 4RS5B 5FYTA 1RUD2 2XJTA 3LE0A 3SEPA 3ORJA 4KBBA 4L92A 1YLLA 1DLLA 4LBQD 5AC91 3KVBA 1A78A 1J84A 4UF0B 4I09A 5BNPB 5F7UA 4OHXA 1PZ7A 2HEVF 1JYCA 1H2MA 1SBDA 3CLPA 3ETPA 2BBAA 2YZ4A 3VHPA 5FMDA 1S4CA 1TME1 4CCOA 5C3OA 4A41A 4N9HA 2LS6A 1XQNA 1NXMA 2J7MA 3ZIXA 1QJY1 3BTAA 1HXS2 2OX0A 5IK4A 2OS2A 4N90A 3TN91 2E32A 3J8F3 3ACIA 1DQ2A 1JZ2A 3PURA 4UFLA 4CDQA 1HN0A 3OF1A 4FOQA 5B4NA 3L9JT 5GALA 4UYBA 2BQPA 4Q0VA 2VVDA 3WW3A 4AFBA 4AVSA 2BOIA 4K20A 1LODA 1WW4A 1U5XA 3VZKA 4FPEA 2HWE2 3V65A 4QD2A 3SH3A 4H2AA 3O14A 4S2DA 4YRDA 4CDWC 3GCWA 4HKLA 2JIGA 5D8AC 1G9DA 5FO8B 1WMFA 4I3PA 4Q4W2 1NCRB 3RYPA 1CZSA 4BMBA 1MEC2 3PUAA 1I3HA 2JKBA 3POEA 4B1MA 3ZXKA 1FPN2 3RYKA 2ENRA 4AYUA 2YFUA 4OHZA 1PGL1 1CAUA 3DUIA 5AC93 4BIFA 5FK8A 4Z8BA 3UGGA 1NLQA 1GLHA 2EXJA 3AMPA 3WF4A 4IUGA 3Q8AA 1I9RA 4Q2FA 5DABA 1CPNA 1VMJA 1ND2C 2PAMA 4XF9A 3TNQA 4A4AA 5HI0A 3C7HA 5JUVA 2DUPA 4XF3A 5FZEA 5FY7A 2PHUA 3SNMA 4F7ZA 3VBHB 1TZOA 3OYWB 1V00A 4Y1VA 2ZA9A 1H30A 3T0BA 2Y0OA 4XBNA 3T4VA 5FZCA 4IE0A 5KR7A 1S1AA 3S57A 3HBZA 1ND3C 1RMU3 3JBG3 4ZZ5A 1CESA 5JI9A 3ILFA 4I01A 1K5MC 5FZ4A 2VTXJ 4D0QA 3TEXA 3WVJA 4EN7B 1V70A 3PIJA 2EIBA 4CDXB 4P9XA 3VHRA 3WDVA 4Y22B 3ZVXA 1UZ0A 2JWPA 3VBHC 4ORFA 5CU1A 2WR9A 4ZXEA 4XFHA 3DECA 2Z5WA 3LKJA 1M4WA 2ZGUA 1ACCA 3LWCA 1VBC2 2ZMKA 3BIWE 2AEZA 1E5IA 3GM8A 1QJEA 1W2TA 4R52A 4W8JA 3SMHA 4NJ4A 5FPXA 5LW9A 3V0AA 3E6CC 1DYPA 2EF6A 2VOTA 1LJ7A 4HBNA 4U36A 3VD5A 3GYDA 3WQ0A 1KFUL 1M06G 2VULA 4BHPA 5D1IA 3VDAA 2AR6A 4QPIC 2FDGA 3HNYM 2E7TA 3ZSLA 4UW3A 1N1TA 4AI0A 3VDCA 5F3CA 4K1ZA 3NAPC 4XTPA 4CDWB 3BGAA 4YVSA 4XFAA 2VU9A 2VUCA 3ATGA 1AYM2 5ACA2 1COV2 2RS13 4RSUA 2ARBA 3URFA 2VL4A 4YFWA 2UURA 5FXXA 4O7XA 3ST7A 1OVSA 2PQQA 2RV9A 2WZR2 3NJYA 5K4LA 3T08A 5J3UA 4NRQA 1YNAA 4ATEA 1XE7A 5LRRA 4CXYA 2ZXQA 3OPTA 4FXKB 4UFMA 2VO5A 5ACA3 4XF0A 1AVBA 1AR62 1GZWB 4D7TA 1O7FA 3PVEA 1PIV1 1RUC2 1SLTA 3LF7A 3LOIA 3OB8A 4CP9A 4LK6A 3UJOA 3PMEA 3E6BA 4A2UA 2JX9A 1MACA 3V64A 1YJLA 2GH8A 2PQSA 4XURA 1OMIA 3LFIA 3S7EA 2UWBA 4PDWC 5HPOA 1PGW1 3GDBA 1GFF2 2WFF1 5T5PA 5BNOA 3QACA 4FPCA 2Y6JA 1F4AA 1C28A 1MZ5A 2WA4A 1AXKA 5EP9A 2AC1A 3FLRA 2WWJA 2J1UA 5GLUA 3VBUB 1FPN1 1VBC3 3LA7A 2Y26A 4G9SB 2CHHA 4RQPB 2XQXA 1DQ1A 1GUIA 1SLIA 1W8OA 3U07A 4COZA 4DY5A 2XVKA 1Q8SA 1UZZA 4MGYE 1OHFA 3RSJA 3VL9A 4E8CA 2DV9A 4XDPA 4CXWA 4LBQB 2ZKLA 4PI0A 3BTXA 3AJZA 2VVEA 3HN1A 3ZR6A 3A4UA 5LK5A 4KQ7A 4HXCA 3M8LA 3JZVA 4OHYA 4Y24A 1AX1A 3JB8A 3RI8A 3DV8A 5K9YA 4JDOA 2VY0A 2Y6FA 3O1VA 1FMD1 2HWC2 1RHI2 1W28A 1J58A 1XOYA 3AZXA 1H6YA 2NLRA 1QQP3 2VMDA 2IFWA 3H7JA 2VJXA 3AMMA 2GN3A 1BBT1 4OUEA 2D3RA 1ENRA 1AR91 4QQ2A 5LBCA 2UY9A 2XHNA 4JKMA 4KWLA 3WDWA 3HBKA 4QHBA 1NG0A 4IGOA 5CADA 3WR0A 5ABJB 1RUF2 1IGOA 1KDMA 3AKPA 5CG9A 4ZU5A 3BB6A 3VKNA 1N3QA 4QPIB 2J1RA 1HLCA 1O4TA 1FATA 2E7AA 5FQ0B 5AC92 1R082 2D6PA 4UFKA 2JDNA 2P3JA 3J8F2 4JDNA 3I97A 2ZGTA 3AYAA 3KHCA 3BU7A 1BEV2 3JXSA 1QJU1 3I3BA 5FOBB 1PO21 2JDZA 1OF4A 4QX2A 4XDOA 1GV9A 2H0VA 3HMYA 2RS33 1W3VA 3Q9OA 4QPWA 4Y26A 3RJRA 4H3WA 1VBB2 1OA4A 5LBFA 3WNPA 2XH6A 4XQDA 1JYXA 1OVPA 3SEEA 1XNAA 2OIIA 1T2XA 4OYUA 4RD7A 3A22A 2HYXA 4UBGA 1CX1A 2DUOA 3ETQA 2LM3A 3J7NA 4LIVA 5LA0A 5AVAA 5DAQA 4PI2A 1UZWA 2VMHA 2X29A 4FTSA 4RQPA 5IWFA 4QPGB 4HPKB 4CDWA 4OI1A 1KXGA 3DYOA 3WQ7A 3IN9A 4XPVA 4OMCA 4LKFA 1F9KA 5A7WA 4LBLA 4V2WA 2DU0A 3ZYRA 3BIEA 2YDEA 3DF0A 3S5QA 3DXTA 1S0IA 4P5YA 4XEZA 5I0SA 4Q5OA 4AFDA 3J7HA 3BVCA 5KHIA 1UD1A 4UAPA 3TYJA 3ROUA 3ZSEA 2ZX0A 5A7WB 3WF0A 4Y4RA 3ZXGA 2D5FA 1U5IA 1G7YA 2PHDA 4Q4Y2 4I30A 5JZGA 1VRH2 5JPMB 4A3ZA 2ORXA 1WW6A 2K0GA 1YXWA 3PVOA 3KF5A 3R6SA 4N53C 4D7SA 2YPJA 3T2OA 5HV0A 5GLZA 2RS31 2RDQA 3H3UA 1WMEA 1VBD3 5LATA 5FJHA 2D44A 3D8CA 1WBLA 4AHWA 4B3NA 2GN7A 3FLTA 4RR3B 4QKDA 4IEXA 2ZX1A 1UMHA 2WRAA 4JKKA 2QUOA 2XVLA 2X05A 3PVNA 2AACA 4M00A 4AF9A 4DQAA 5CZKA 1REDA 1Y9QA 1LOFC 1KJRA 3LIHA 1US2A 3U75A 4E4ZA 2KM2A 1JOPA 3WG1A 5LEKA 3N9NA 3PU8A 3AKRA 4W6XA 5K8SA 1ZREA 5FUNA 3NVCA 3I59B 2A70A 2XONA 4JQRA 1YIFA 4Z2WA 5JOZA 2QQLA 2C5DA 2FCTA 1D2SA 3THDA 4MX3A 4BQXA 5DUXA 5IFTA 1CAXB 1ZM1A 4XVHA 2YBKA 4N7UA 3MIHA 3B01A 2YUEA 2E33A 5IJRA 1WLTA 3ZKYA 5JLVA 5FTTC 4K40A 2JG8A 2IZWA 1HN1A 1XNBA 4YW6A 2W87A 1LESA 3BCWA 3H0OA 4JKLA 2HWB2 4DUVA 5FFOC 1MQTC 2D43A 1U5YA 5DXDA 5JDBA 2ZX2A 1RUJ1 1HB3A 3HR9A 5GLWA 1KD7A 2W47A 1ULEA 2A1XA 2JDMA 3I2IA 2V73A 1ZVFA 5I8YA 5IVBA 5J7MA 3LA3A 1LHNA 2O8QA 4MGTA 1C4RA 4XAAA 1UIKA 3AVRA 4ZONA 1EAH3 3E5XA 4MSVA 1JH5A 3T0AA 1ZZ7A 2A71A 2P3YA 2ZHMA 3P3NA 3ZO0B 3I2HA 3BOWA 3LDBA 1TME2 1QOTA 1O4YA 1ZBE1 3AFKA 5CFCC 2QCSB 1F35A 3VBRA 3ZYBA 2FDKA 4IW3A 4LBQA 4YZ3A 4GMP3 5JIUA 3CJIC 4FTBA 3POJA 1DYOA 1SMVA 5C8WA 4KU7A 3DPRC 3H9AA 3K3NA 1EUUA 3ALQA 3D4KA 3JBG1 3T30A 4XJAA 3M3QA 4A45A 2WZ8A 1RUI2 3O12A 3CL1A 1UOGA 2VC9A 1HKDA 1XSQA 4QGMA 4RHV3 4LO7A 5IVJA 3E6DA 1OBNA 1GKBA 4LO6B 4DO0A 4XMAA 1VIWB 3INAA 4LIUA 2WINB 4SBVA 4AI3A 1PGSA 4COVA 5BUVA 4ARXA 1Y43B 1G9AA 3H1WA 1UF2C 5J1XA 1R083 4C0HA 2X53S 1QJZA 2P2KA 4XXAA 2WIIB 2BGPA 4QQPA 4GZ9A 3Q8EA 1OUSA 2JB4A 1UWWA 4O61A 1GZWA 3ZN4A 4QPIA 2Y6KA 2XJPA 3W58A 4BQYA 1IS4A 4Y5Z0 3ILNA 1WW7A 3IIIA 3CEWA 2EIEA 4INDA 4S2GA 4CCCA 2FDIA 2QBXA 1QF3A 3K3OA 3N7JA 5FZ6A 4AI8A 5EYYA 5A1AA 4MUVA 5GZCA 3FC0A 5FPZA 3FL7A 4LORA 4OZXA 2VCBA 1H6XA 3THCA 1SBFA 2VG9A 2BNMA 5F3IA 5DZEA 2XJQA 1RUE3 1NY72 5FPAA 1DCSA 2BUKA 4CSWA 2WO2A 4W4ZA 3SCHA 3KCYA 3FUOA 3KSCA 3JCIA 4FPYA 4MGKE 3WDTA 2PHWA 2GAUA 2JDPA 2NP0A 2YPDA 1QXRA 2YU2A 3IMNA 2GNDA 4P9IA 4KWUA 1F5JA 4FPLA 4XBLA 4PCRA 3AMHA 1RUC3 3MIDA 1DZTA 1O5UA 2QFEA 4P9YA 4YW3A 5A1FA 5FYBA 1BEV1 4A44A 4BOWA 3ES4A 3I49A 4XCAA 1ST8A 4JGZA 4ZU4A 4AQ6A 1VJ2A 4A7KA 3D5OA 5EYXA 2WABA 4KMQA 5CYYA 1O59A 1OURA 1J3QA 3CJXA 4DXSA 1S2BA 2C9KA 4QDQA 4A3XA 2XLFA 1OH3A 3A0NA 1JZ3A 5A33B 4PLMA 2R041 5D8AA 1VBA1 1NA1A 3RWNA 2E63A 4AGGA 2ID4A 3OPWA 4QKNA 4NHYA 1VBA2 1W9FA 1R093 1ZZCA 3RS6A 2BPA2 1NE4A 1F15A 4IE5A 4R9DA 4WM8A 3VHOA 2XBO1 3AX4A 3VN4A 3PJQA 4X6QB 1JOJA 4Y1UA 1ENSA 1R081 1W0OA 4Q27A 1U5ZA 2YBPA 4QPGC 4CU8A 1JUHA 1RMU1 2CTVA 5L7OB 3O1OA 4H7MA 3LCPA 4GWJA 2HKXA 1DLCA 4NUBA 1CPMA 2ZX4A 2D3PA 4YG3A 5FQ0A 3N4MA 4YG6A 1RUF1 1BQPA 2CY6A 3ES1A 1PMJX 3W59A 4YZ2A 1JYNA 1COV3 4RFT0 5TSWA 5CEHA 1ZRIA 3AJYA 3THPA 3ZLIA 3RZGA 2BFUL 5E89A 4NAMA 2VQTA 2FZ1A 1X9PA 5F1RA 2XJSA 4LO5B 5A80A 1UOFA 2AH2A 2VW2A 5CKQA 3ZSJA 2VUJA 4CEYB 2AREA 2ZZJA 1PO12 3ZN6A 2PHRA 2P6CA 1US3A 1GOHA 2MPFA 1VP6A 1W03A 4Y4YA 3TEZA 3BKZA 2QVSB 4TN7A 1KRIA 4BA6A 3HNBM 1KS5A 4AVAA 4YGCA 1IKPA 2E53A 4NIGA 2R0FA 3FX3A 1QKQA 2ZZQA 5JSOA 4MZUA 2GMPA 1UCXA 1L3JA 5BV6A 2FMDA 1D7PM 4HVRA 4DUXA 3UNPA 1H4HA 1LOCA 4PIZA 1SLBA 3ME2A 4QX3A 4KGGA 3AC0A 5F6KA 3OSDA 3WEZA 3AKSA 3FFQA 4GJYA 5D21A 2D40A 4D3WA 4QDSA 4CCLA 1YIPA 4DIQA 4EYUA 1LU2A 4BK5A 3WD5A 4CDXA 5KHKA 1AF9A 3KV9A 1WGPA 1PO23 1MQTA 3AMNA 1AZDA 1GMMA 4Q4V3 2X5IA 2C24A 3LEIA 1C5HA 1D0GA 4KWJA 4U2AA 1VMHA 4FQ4A 5ANQA 1UN1A 3VZJA 1X50A 2RR12 4YGDA 2IVJA 1PIV3 2A73B 2D3SA 5FPVA 1QGLA 2ZAAA 1AX0A 4AFAA 1IPSA 1CJDA 1EYBA 5E8AA 3B3QE 4XACA 1W3XA 3AB0A 4FT8A 3WSOA 2OPKA 1W8WA 1T6GC 1UNBA 3IPVA 4LLFA 4A6OA 4CXXA 4EROA 5IVVA 3CNAA 5EWSA 1REEA 2C9AA 3RVHA 3O1PA 1GU3A 2Y33A 3C2UA 5LRSA 1W90A 3ZXAC 1GWMA 2Z42A 3MIGA 4QXCA 1AYN1 5F3GA 2YC2A 5CISA 1N1SA 4LE4A 3PL0A 4W6YA 3RWKX 2LTNA 2GNBA 3WF2A 1COV1 3KCCA 5IYYA 2JKXA 2PN5A 3GZTB 4Q4X1 3LIGA 4WVMB 1UIJA 3ZPOA 2JIJA 4XETA 1RVF1 1CVNA 2TBVA 4CZSA 4NHLA 4QKFA 1QU0A 2DTWA 4AWDA 1G9CA 1FMD2 1I6XA 3ACFA 3C8XA 2J1VA 4D8MA 5LK7B 3BOPA 5KC6A 5LEJA 5IFPA 2FDFA 2VW0A 1RUE1 3IDBB 5A3WA 1RUNA 1GNHA 1FXZA 1X9TA 2PLV1 4MADA 2HWE3 5FKCA 1HB2A 2CL2A 4ES8A 1D2QA 2VZ3A 3WCRA 2IWGB 4LBOA 5DAWA 5C9AC 4AW7A 1Q8PA 1O6UA 2BDRA 2ZEZA 4LBJA 5FYMA 1VBE1 5EV7A 2B42B 1F2NA 1V6JA 2B8MA 1R1A1 5LB6A 2V5YA 3A21A 4HFSA 1HDKA 2J1SA 4YW2A 1KEXA 5DQ0A 5FKBA 5FYVA 4QKBA 1YC61 2RS51 2CWMA 5LZ6A 1N3PA 2I74A 2KD7A 3IAPA 1AXYA 5EQUA 5FZBA 3VBFA 1XXNA 2Y0IA 1AR82 1HXS3 2V09A 1UXXX 3O7OA 4FI9A 4WM7C 1EP0A 1LCLA 4LBMA 5FO9B 3VBOA 1K5JA 3I8TA 2CDPA 4Y1ZA 3WDUA 4BQ1A 4LHLA 2VCMA 1K12A 4LUMA 3IZOA 1JMUB 1APNA 2JXAA 3MYXA 4FOYA 1UYXA 4N53B 1SLAA 1A6CA 3WINE 1W99A 3AKQA 3KB5A 5DAVA 1QXJA 3WXPA 4ASMB 4CVUA 3AZVA 1D4VB 1J1LA 1OLRA 2QQPA 2W9XA 1VBD2 4W6WA 1AR61 2IUWA 2JDYA 5J36A 4JTOA 4Q4X3 4RYDA 2WYSA 5KWRA 1LB2A 4XJZA 1B35A 1KS4A 4UI9L 1OPOA 2WS92 3BALA 1QIQA 4JV4A 3VBSA 5FUIA 5FZLA 4YG0A 3FWEA 1H8VA 3U78A 4GH4B 2MEV3 1UZVA 3ELNA 1GP4A 3NV3A 5B4XA 2HBUA 3I2GA 3CZUA 4QXHA 4DZGA 2B9UA 5C3SA 1RL3A 4J1XA 4ZPIA 2GMEA 1BMV2 2OUHA 4YSFA 3O1RA 2VECA 1FAYA 1UAIA 4HSJA 3HPNA 2HWD3 1LOAA 1MEC1 4GKYA 1RVF2 1W8TA 1VBE3 1DGRA 4CCJA 3NQHA 2ZGOA 4QT6A 2CGNA 3BTZA 1RXGA 1I5ZA 1ZBA1 4MXWB 5FK7A 1HB1A 1HQWA 2R1BA 4KWKA 4P02B 3B94A 2FCUA 4L9BA 5G05L 3WNXA 2MEV2 4NIAA 2HWE1 4JZRA 3QD6A 4JHTA 4QX7A 1S0EA 4HK8A 1RUH2 3ACLA 3I7DA 2GH2A 4K1YA 2RR11 3KT1A 3ZDSA 1YI9A 2B45X 4JDMA 5BNOC 3U37A 4DB5A 2JICA 1IQAA 3C7FA 2QQKA 1J1TA 3FBYA 2ATFA 3HN3A 1Q56A 2C1FA 1W6MB 4JVAA 2BYVE 3NKGA 2P37A 2GC3A 3CO2A 4MYEA 3AP9A 1BK1A 5FZ8A 5BPXA 3FUQA 3ZN6B 3W5NA 1Y4WA 5F5QA 3VGIA 3WQ1A 4AQSA 3ZYGA 4R4XA 4TZDA 5BNPC 3VL8A 2RDNA 5GZGA 3EQEA 4QGLA 1E5RA 1H2LA 5C6CA 3CMGA 3ZFFC 3B02A 1JZ7A 2ZKNA 4NPRA 5DG1A 3WZ1A 1AR73 2F4PA 3FHIB 4IETA 5FZ3A 1YJKA 2RS52 1RJ8A 4TSVA 2NZ9A 5E1RA 4EZ4A 4QHZA 1HV0A 1MS9A 4XUNA 4COUA 3V0BB 1AYN3 4MXWA 2R49A 1VBE2 5C8CA 1FT9A 3IBMA 5F32A 1LEMA 2BP6A 3WNOA 1RUJ2 2CNAA 2ADDA 4XQWA 3UKNA 4CTEA 4G4FA 1V6NA 4CP0A 1JUIA 2PLV2 5DN2A 3KCXA 2QQOA 3D3AA 2W68A 2XLGA 1ODMA 3B9IA 2PXJA 1DQ4A 3POFA 4L11A 4M0HA 5E6HA 4B7KA 1UY4A 5L9VA 2VH9A 2PMWB 2WL1A 3SXWA 4OUSA 2W1UA 1RUJ3 4ET7A 5A3MA 1N47A 1EPWA 3KQ4B 1NYWA 2WQ4A 4LMFA 1FX5A 1QY4A 4PLOA 1D4M1 1JS9A 4S2HA 4AXOA 5L9BA 4CP9B 3TN92 1UY0A 3AP7A 3DGTA 3FHAA 3QLQA 2ZEYA 3ITQA 4CP2A 3RFRA 5FY0A 5DUVA 5KBFA 3H3ZA 4GB31 1YRZA 4BIOA 3P1IA 1R1A3 4Q4V1 2OYZA 2QQIA 2WN2A 4FPOB 1CZVA 2XMLA 4IQPA 1Z7S1 3M1HA 5GLVA 2VZVA 2WT1A 2GMMA 1FI2A 3OTFA 4DUWA 1MVEA 3MF6A 2ES3A 5LA2A 3ZXFA 4CDUC 4P9JA 3RDIA 1POV3 2V72A 4AZZA 3ECQA 4QB6A 3RMYA 4ISQA 3SH5A 3VBFC 1ULDA 4GB32 3LA2A 4AHYA 2CYFA 2PHLA 3ZYFA 3LAGA 1XE8A 4AEKA 2ZJCA 4YVSC 5A3UA 1XYPA 2A75A 5C3PA 4GH4C 4LXLA 4AOCA 5A3OA 5JSPA 3V0BA 1WMDA 2CV6A 2ZGSA 3HVDA 1C57A 3IDAA 2Z4FA 3VBHA 1JYWA 4LR4A 1FNYA 2A5ZA 3WHTA 2DFBA 1QXPA 3PIGA 1QJY3 3UKTA 4URAA 4H55A 1BYHA 2YY1A 3D6EA 3MUZ1 4QB1A 2HWF1 2V5DA 3MW2A 4M0NA 5FAXA 2WKKA 3MO4A 3OY8B 1YCIA 1H1IA 3M70A 1V0AA 1UX7A 4IEWA 5I0RA 2WLQA 3CQOA 2ZEWA 2VQ0A 3FZ3A 3K2OA 1OA3A 1RHI3 3QOPA 4Q29A 2HWC3 1U12A 1WA6X 3TOJA 2Z2SB 4D6RA 4H7LA 4PBPA 3OOXA 5JWPA 2EXKA 3GJBA 1CR7A 3LQCA 3VZLA 4JAAA 2NYYA 3A23A 4LJHA 1EUTA 1X82A 2VM9A 4HK9A 3SCGA 1VMFA 1OC1A 3UETA 2GC1A 1MS3A 1UU4A 2H0BA 4CCMA 1AYN2 2FDHA 2QZ3A 2BFUS 4ES9A 1RXFA 1OD5A 3D82A 5J96B 5A7PA 1GOFA 2VOVA 2YC0A 2YROA 3KVAA 3GZEA 2UWCA 4OHVA 5C33A 1C8M2 2PAKA 4XZPA 1WD3A 4TTGA 1BZWA 3O1TA 1MPXA 3ENRA 1B35C 1DQ6A 3RI9A 4AVVA 4CUBA 2P4EA 2CDOA 2ZX3A 1VBD1 1GZ9A 1K5MB 3KMHA 3LEKA 1PVC2 4WM8B 3U0ZA 4YZ1A 1QOOA 1XSRA 4MGIE 3AMQA 1OFNA 3NAPB 5CFDA 1R092 5GZDA 5C70A 1PNGA 3OG2A 1G9BA 5HCFA 2YGLA 3QH7A 2VNGA 2XUEA 2WFF2 5D2AA 4KU8A 2BOJA 3KV6A 4Y3OA 4UFIA 1SEFA 2NMOA 2RMU2 3VDDC 3FMGA 4CEWC 3WNKA 3WF3A 1LHUA 1OF3A 4NR1A 2H6CA 2CAVA 4LPLA 4RS5A 3W5MA 3LOBA 5FBZA 3WNLA 4MHUA 3M3EA 4CDUA 2JE9A 3T0DA 1W6NA 3U4SA 4COYA 4DEVA 5L19A 4NVPA 2XJRA 4Y20B 4LBKA 5EJ1B 2ORZA 2EICA 3VLBB 3ZX7A 1WLWA 2WSVA 4E4DX 1GNYA 5FZHA 1UPIA 4MH0E 2RVAA 4XJUA 1SLCA 2Q5TA 5ERLA 3B9CA 3CJIA 3R4DB 3UGFA 3L2HA 1UX6A 4HKOA 2W2IA 3VBUA 2D6MA 1ULCA 4IDZA 4HLTA 2KXLA 2QTWB 2ZGRA 3NWKA 4KL1A 1PK6B 3AYCA 2VMEA 2Q1FA 1Y3TA 1NE6A 3M3CA 2Y6HA 4ATFA 1Z78A 2BW8A 1TMF1 5HCHA 4P08A 5CG8A 4XHBA 1GWLA 5FZKA 3OGGA 4BMEA 1W6OA 4GWIA 5C71A 5A3NA 5FY1A 2BNNA 4Z92B 1YO8A 1W0NA 1OPMA 3OD0A 4JCKA 4EN9B 1V6LA 1L7LA 2QE3A 3K46A 4LNVA 1J3RA 3NSTA 3DL3A 3WP4A 3POSA 3KWVA 4DNYA 5JR2A 1UZYA 1VBB3 2WO7A 1OLMA 1EPZA 1VBA3 2A3XA 2XUMA 4N53A 4PQQA 3ZFEC 4AK3A 2BWCA 1Q8QA 2QDNA 4GKXA 5FPUA 2ET7A 2EIGA 1JW6A 3ZFGB 4YM3A 1PIV2 1QOSA 1RUC1 3EHKA 3T09A 1RUG2 2VUDA 1O5LA 3UYJA 4META 1F5FA 1GQHA 2ZGNA 4YVSB 4ARYA 1ZZ8A 3MUY1 2I45A 2O14A 1EV13 3VBFB 4E8DA 5CVRA 1SFNA 2YV8A 3GJAA 3QCWA 3P3PA 4QAWA 5F2SA 1EY2A 4WVZA 5FV3A 3ZN5A 2D97A 5GKAC 1PX3A 4A42A 1OSGA 2B4KA 1GSLA 4QXBA 1HV1A 4S2FA 1TMF2 1V6MA 3ZM8A 2JEMA 2L9LA 1BVVA 2HEWF 2WNEA 5FMBA 2V4VA 3POWA 4NIIA 3WP3A 3VV1A 3USUA 2OPWA 4BJ0A 3HT1A 5FXVA 4CEYC 5HXVA 2ZBJA 2YC4A 3LDRA 4RQPC 1AJKA 2VQAA 5JZGB 1QEXA 2GALA 5I91A 1F4HA 1MS8A 1RHI1 5H9PA 3W9AA 5A6XA 2PHXA 3U1XA 4Y22A 1PO11 3VZNA 1GYKA 1VLNA 4BQ4A 2QKDA 3KM5A 4Q4W1 4BLJA 5FR3A 1UYZA 5EPAA 1GR3A 2Y60A 1DGLA 1JN2P 1WUVA 2OW4A 4QQHA 2RJ2A 3S6PA 5A6YA 1LR5A 2JENA 1RGSA 2QNKA 3EYPA 4UBHA 2C4XA 2QDRA 4GULA 4OUMA 1VPHA 3NW4A 4YGEA 5C3QA 1LHWA 1N3OA 3AXEA 4IEYA 4AVCA 3OEAA 4TWTA 1ZBA3 4FOVA 2R32A 1Z7S3 1V6KA 5FYUA 5GJ6A 3S7IA 3P5BA 5E88A 1R1ZA 2RDSA 3WUCA 3OYWA 2XQRA 3HNMA 1TQ5A 3HQRA 3PTRB 2RJLA 1QH6A 1YQ6A 1AHSA 2PTMA 2O1QA 2RMU3 2RR13 2WZEA 2WO3A 5T5OA 3UKVA 2YB7A 2HEYF 2W39A 4ZZ8A 2FQPA 1OXCA 3BN6A 1X8EA 4QM8A 4XFIA 1D0HA 4HVQA 1DF0A 1P8JA 1LOBA 1WWYA 2NQYA 4OQ9A 4LA2A 5IVCA 2GU9A 4XFBA 3AZYA 3AZZA 3WG3A 2VMFA 1JXNA 1PVC3 1TNRA 5C4WA 1IS3A 3ZFEB 4R8HA 4CCKA 2WWUA 4HOOA 4BM8A 4RGAA 3ZXJA 4DEQA 1E57A 1RUD3 1JZ4A 1ZRFA 4ASLA 4I0WB 2WYFA 2BVVA 2ZGQA 3CBNA 5A7QA 5IW0A 4WZCA 2VBPA 2XB6C 2A6WA 2DVDA 3G6JB 1Z0HA 2WNVA 4QX5A 2A6VA 1ND2A 3HJRA 5CKMA 4J25A 4WVMA 1RVF3 3NV2A 2G9ZA 1L7QA 3QH6A 4XUTA 2VR4A 4AQ2A 3ZMOA 4DMIA 1BLZA 5AFBA 3O1MA 3NV4A 4IV1C 3WCSA 3WLUA 3NNJA 5DPNA 1BCXA 2W95A 2G4IA 4GWNA 1IOAA 2ZHNA 4AG4A 3BPSA 4CCDA 1A8MA
chains in the Genus database with same CATH topology
1SCSA 3IPVB 3MIEA 2JG8B 4K8FA 5L36A 2HWD1 1NCRC 5AVPA 5A3LA 3OCPA 3TB0A 2C0ZA 5BNPA 1JHNA 2DWRA 1QDCA 4HKWA 1CIWA 1WLDA 1LOFA 1O91A 3AM2A 1W6OB 1ZZ6A 2PFWA 1POV1 3U10A 3TRSB 1UMZA 1JBCA 3AYDA 2A3WA 3VBOC 4QQOA 4IEUA 3T2TA 3M4FA 4FXGB 3GBWA 4Q0PA 4Y20A 4NOTA 4P9GA 3RG0A 5K0UB 3MW3A 4YW4A 1GICA 3FJSA 4RHV1 3UV9A 3TWIA 5H9QA 2E7QA 1EV11 1R1A2 3KGZA 1FYUA 2HWF3 1S2KA 4DFSA 5C8CB 3HAGA 4YVWA 4LT5A 4FP2A 4ZU7A 1WBFA 5H9RA 1QJU3 1HRV3 3GHNA 4QQLA 1TNFA 5IK7A 2ZGLA 3MLKA 4RA0A 1O4ZA 1UU5A 1YFWA 1FPN3 1VBC1 1SQ4A 2PAEA 4DINB 5K7PA 4HETA 3WV6A 2Q0AA 3H8UA 1LENA 2ERFA 4P14A 2JE7A 1YI7A 1GANA 5GM0A 4E4SA 4PIYA 4XTMA 4M3CA 1W39A 4DRVA 4EWEA 4AVBA 1HRV2 1LEDA 1K5MA 4YYOA 3I2DA 3RYRA 2RHPA 2GSYA 4QU2A 2ZACA 4LEJA 4B4RA 2JG9B 1J59A 3J26N 1HXS1 5FCCA 3ZFFB 4RHV2 5JSRA 1LTEA 3LSDA 4CDXC 1OOPB 2XBO2 2NN8A 2GNTA 4ONUA 3MLJA 4XFGA 1DGWA 1PZ9A 1RUF3 1AR63 5DG2A 5CFDC 5JVVA 2HJIA 2RM23 1MR5A 2DCJA 5JMCA 2WZR3 5K0UC 3QBQA 1H2KA 1NA1C 2VGDA 2DUQA 3GZAA 5CNAA 1YHFA 2DURA 2A6YA 4FPKA 1HRI1 5FRAA 4RS5C 3VBUC 4CRQA 1O3TA 2XLAA 3UK9A 5J48A 1PO13 1NXD1 2VOXA 1GQGA 2W08A 4GMP0 1H0BA 4Z07A 3KLSA 4Y1XA 4XQ4A 1H2NA 3IWZA 1UKRA 2DCYA 1C1LA 3ILRA 2PELA 4IEPA 1RTVA 2HWB3 3E5QA 1WCSA 3SHRA 2CWSA 1KJLA 4K3UA 1YUDA 5I0UA 4QPYA 3MDPA 5A32B 4X8PA 4JRAA 4JGZB 4PF5A 4H14A 4CP1A 1CAWA 2XWJB 4CEWA 1LHVA 2D6LX 1N1VA 3VZOA 1QJX1 1RUG1 4AGRA 2B46X 5BXXA 1AR81 1HIXA 4NHMA 1DYKA 2ZPXA 2RS32 4XXPA 1DFQA 1NOVA 1V9U3 2DF7A 3WP5A 4E9KA 1PVXA 3EJKA 3G7DA 4HANA 4W65A 4Q0SA 3AP5A 4LO4B 2YHJA 2RS11 2DCTA 4TYSA 5KHGA 3VKFC 4YARA 4RL7A 5FREA 2ZOEB 4R4ZA 1AUYA 3JB4C 1NLSA 5F6LB 2SLIA 4K21A 5ACA1 4X8NA 1LULA 2ZAHA 1ZBE2 4Q1PA 4JGYA 3CJIB 3GBFA 3ZXLA 4YVWC 3CF6E 3WW2A 3VZMA 4EWAA 3K51A 4MVTA 2CGPA 2E51A 1S0GA 4LLOA 1UW8A 4XJWA 1CD3G 4AEDA 1X33A 2YYOA 1URXA 2WNVB 2ZABA 4YNIA 2UYAA 1C3HA 2ZTNA 3NL1A 2R063 3NKTA 3MZHA 2DVFA 2GC2A 4DS0A 3C3VA 1CAXA 3IM0A 2HWB1 2XKOA 1QNWA 2EAKA 3MICA 4EN6B 1NLRA 2E6VA 4LA3A 1W6MA 4N43B 1H8TA 4ISRA 1AL0G 3NJZA 1DQ0A 5HCBA 4CDQB 4G3YC 3VHNA 4DXZA 5HCAA 4AVTA 4JGYC 1PK6C 4AGVA 1EV12 1AXZA 4GXLA 3KD4A 1BKZA 4F8AA 1OFSA 1RUG3 1CAUB 1OA2A 1RMU2 4EWDA 3DKWA 3KS7A 5IT6A 4JTNA 1BEV3 3X29B 4IXLA 4J6GA 5KXEA 5FLHA 3ZFGC 2EXHA 2JJ6A 4Q0QA 4AI1A 1Z7S2 4K7JA 5I93A 4WVWA 1C8M1 4OI0A 3DPRA 3TNPB 3ZXDA 1H4GA 3KZ4C 1TEIA 2CAUA 4KG0A 4X6RB 4Q0UA 4XFCA 1A3KA 2QZ2A 4I2OA 5SV8A 4WM7A 1WA4A 1PNFA 1ALYA 1R091 4YFZA 2Q1ZB 4UW4A 1XYNA 4IEZA 1RUD1 1WLCA 4FBFA 1NA1B 1VAKA 3AXDA 4L97A 1FOD2 1DIWA 1MEC3 1UU6A 2WLPA 1QQP2 3L2YA 4J1WA 4ZXKA 3B7MA 4F83A 1OQDA 3WW4A 4AE2A 1QMJA 4RR3A 1DGWX 3RJ2X 1TMF3 1VALA 2XKPA 1QQP1 2SBAA 4BPZA 3JU9A 1SBEA 4GH4A 4L99A 4Z82A 4Q8KA 3WT3A 4XF4A 4ZKTB 2EXIA 1YFUA 1X8MA 3O0VA 2AGSA 5K0UA 1WCDJ 5FO7B 1RITA 5T3NA 2XJVA 2ILMA 4FAGA 1PO22 1J3PA 3U4XA 4I3GA 5T50A 3GNEA 4FSJA 1JTZX 1XU1A 3HD8B 1CONA 2VUAA 1AX2A 1Q8VA 3VUOA 2XHKA 3LB9A 4JGYB 5DDJ1 5DUWA 1PM7A 1C8M3 5EJ3A 3NO8A 1FNZA 5FLIA 3M2MA 2XL9A 3R4UA 4IESA 4OFGA 2VW1A 2EA7A 1HRI3 1FV3A 2BGCA 5JZGC 4DPNA 1NQJA 3ZFEA 5C4WB 2N7GA 2WT2A 2FZ2A 1QNYA 1HX6A 4IV3A 3PLQA 4FPHA 4HVOA 2FHRA 2UU8A 2WNUA 4C1XA 1BVP1 2ZGKA 1SLLA 2DVAA 3B00A 1MQTB 2XBO3 1C1FA 3LZZA 2O0OA 4PBOA 3HIFA 1S0FA 4LBNA 1PGL2 1Q3EA 2WNVC 4YZ5A 4HL0A 1DQ5A 1H8TB 4N43A 5CIRA 2NMNA 2JG9A 2OA2A 1VB2A 1DU3D 5J98B 1W6NB 2IXHA 3IIAA 1ZRDA 4HSLA 3GALA 3O0WA 4FO9A 1NY71 1H1MA 2DYCA 3THTA 3KQRA 1WW5A 3FBMA 3GF6A 2D98A 4M3CB 3WDXA 1BBT3 4CDQC 3BODA 1V9U1 3RMXA 1PMIA 4GB33 3ZXEA 1RUI1 3M7AA 4DY3A 4HN0A 3JBG2 5BNNB 4M3CF 2X5IB 4XIOA 5EFUA 3OBRA 4ITCA 1Q5OA 3AZWA 5KHHA 3ZYIB 4QMAA 2VNOA 3JUUA 4E2GA 3PHMA 5I0TA 3IDCB 4BH9A 1H9PA 3ZYJB 2IFRA 5I8TA 4XHXA 4FP3A 1W6PB 2AUYA 4KNCA 1RINA 1GZCA 3GHMA 3WW1A 1MZEA 2W0XA 2RM21 1C8NA 1EAH2 1LHOA 3O5SA 1KITA 1C5IA 3PJYA 1OI6A 3ZSKA 4E2QA 3GZUC 4N9IA 3B93A 3R4SA 4BE3A 4CEYA 5AFEA 3MLLA 3OPZA 1S0DA 1I1EA 3VBSB 4WZFA 1CN1A 4E27A 3B5LB 4AHZA 2MEV1 1S0CA 2I07B 4L2NA 2NPIA 5E16A 1G8WA 1EAH1 2R16A 2D93A 4XFFA 1H8TC 2FBEA 2ZS6B 1W2UA 3LSEA 4BZ4A 2R073 4QGNA 2X8KA 1UKGA 2ZHKA 2DFCA 4QXKA 5FOJB 1XU2A 4AQTA 2RMU1 2BNOA 2ZGPA 5JPNB 2MHFA 2JD4A 4L8QA 1RUI3 3EBRA 3WUDA 3PMSA 1MVQA 1DG6A 2R043 5T5JA 4AFCA 5BYNA 1PHMA 4XOGA 1NQDA 3H7YA 2A6XA 4HN1A 5JR7B 1ZZBA 1QJU2 1VB4A 3CU7A 3O0XA 4WM8C 3ZMNA 3MIBA 3TN93 1ENXA 1MS0A 2PYTA 2I2SA 4K6BA 4RR3C 4K9SA 2RS53 2F6BA 3N7LA 5SV5A 1ASJ1 5BNNC 1AR72 1CQ9A 2AENA 3PTYA 4TLFA 1MS4A 3MI8A 3M3IA 2KA3A 2RS12 4FOWA 2BVBA 5CFCB 3N35A 4PJYA 4DOUA 5T5LA 1CX4A 5CFDB 4WM7B 1IS5A 4B7EA 1OOPA 2P17A 1BBT2 1OQEA 4BWOA 5CB7A 2G9FA 3MFAA 3SCFA 2EALA 1GBGA 4XF1A 5H9SA 2UY8A 2HWC1 1DZRA 4BLIA 1REFA 1DDLA 1QH7A 3S30A 3NV1A 1ZRRA 3TAYA 4R9AA 1XRUA 3WOGA 5B2GB 2DVGA 3K48A 2B39A 1POV0 1S55A 4DRRA 4EV0A 5HBAA 4D69A 4NWVA 1XYOA 3VDDA 1AL22 1W6QB 1DZQA 3DN7A 2Q8OA 4SLIA 1AJOA 3AP6A 4XYXA 4YM2A 4B4QA 5DZGA 1XNKA 1VAVA 4WBBA 2H6BA 4C91A 3BPZA 3ZIWA 4WV8A 4XDQA 3I54A 5KHJA 1FOD3 2XGXA 4AHXA 3SISA 1LGNA 1TE1B 1RJ7A 2RE9A 4YZ4A 5CAZA 4Q8LA 3WG2A 3MIFA 3JD71 1VRH3 4OHWA 2WS93 4LO8A 4AEDC 3KT7A 4KG8A 1S0BA 1BJQA 4PLNA 3EO6A 1D4M2 1LOEA 3J8F1 5DDJ2 5BNQA 2JG8C 2PA7A 2HWD2 4AFMA 4HMZA 5JOYA 3M3OA 1QDOA 3H50A 1O3QA 1Y7BA 4UXAA 3JQWA 1F31A 1V6OA 3SITA 4Q4W3 4IV3B 4BYYA 4AI2A 1G6NA 1ND3B 1NCQA 4I0AA 3UL2A 5A33A 4Z1VA 1AL21 1XNDA 4XE9A 2LALA 2CGOA 4B29A 2FMYA 3J9SA 3SLIA 4P9WA 3IDEA 4Q4X2 2WFPA 3HQXA 3SH4A 2VMIA 3I4IA 1RB8G 4A7ZA 2XWBB 1W0PA 4P9LA 3VBRC 4O9EA 4IV1B 4C1WA 4XJ9A 4LULA 5FLJA 4FCAA 2TUNA 5KXDA 3LGRA 5JI7A 2R062 1PGW2 3MPBA 1AR83 1N1YA 4N43C 4IEVA 3ZSMA 4OI4A 4HPKA 2WT0A 2ZHLA 1WD4A 2WS91 4LE3A 4MXVA 4IL7A 4GALA 1RIRA 3OGJA 1U0AA 5DDJ3 5KXBA 2DU1A 1FOD1 3D0SA 4PQ9A 3KGLA 2JECA 3T1MA 4YM1A 5J09A 1MZ6A 2ETEA 1CAWB 3OBTA 1PVC1 2XG3A 3APBA 4Q1RA 5A32A 2QJVA 4IEQA 2YGMA 1ASJ3 4M01A 5I8SA 3AP4A 3VBSC 3A0KA 3ZFFA 4OLLA 1H1AA 1AR92 1A8DA 4R9BA 4V1PA 1SFYA 4FQZA 1H9WA 4QM9A 3RQ0A 5J37A 2BBVA 2WFF3 3TBDA 2OVUA 2VOKA 4Q4V2 5DUUA 1JYIA 4HZFA 5C9AA 3RRDA 1OOPC 3E97A 1AL23 1YYNA 2D6KA 3J4UH 2IXIA 2ET1A 4IERA 4D7YA 4FPFA 3AKTA 3E5UA 1HW5A 1LOGA 2IXKA 4GA9A 3MFCA 2G9GA 3IT8A 2EAAA 5EZWA 2VNRA 5L7OA 4E2SA 5L73A 4AEJA 5GZFA 5BNNA 3EXUA 3RZZA 4LTAA 4COWA 4FPJA 3DPRB 5IK8A 2B7YA 4EN8B 5GZEA 3FFZA 2D5HA 1SCRA 1IHMA 2ZCWA 4PDWB 1CAVB 1ZRCA 2TEPA 1AR93 1NCRA 4EJRA 3VBRB 2D7FA 1B09A 2LUWA 2O8OA 4FPGA 1MS1A 3AK0A 1UPSA 5DZFA 1B35B 2PHFA 2OZJA 2Q4SA 3HT2A 5CBLA 2GNMA 1Q8OA 4XW3A 1XNCA 1O3SA 1VRH1 3PNAA 1AYM3 4B4PA 1AR71 2NM1A 4MGZE 4AEDB 5ABJA 3I59A 2DCKA 5C9AB 3WG4A 5JCTA 5C4WC 2YMZA 2MNGA 1IPKA 4KH9A 2OZ6A 3KT4A 4D94A 5C8CC 1KDKA 1O3RA 4IV3C 1RUE2 2ARXA 1YFYA 1X7NA 4C90A 4OI2A 2XVGA 2IXJA 2WNUB 4BCUA 3R05A 2B5HA 3VDDB 2YXSA 3ASIA 2VVFA 2R061 5BNOB 1YFXA 1V6IA 1RUH1 4XBQA 3WDYA 3USUB 5CA6A 1PK6A 4NHKA 3IKWA 5T55A 4WVVA 1PZ8A 2WJSA 5KXCA 5FMOL 3VKLA 3N7KA 1MZFA 2DTYA 2UWAA 2WC2A 5JAXA 4JRLA 1G86A 5T52A 4URTA 2AYHA 2WQZC 5BY5A 3HWJA 1RC6A 2BEOA 3VBOB 1IPJA 3V0AB 2E9QA 5D8AB 4N7IA 4CDUB 2Z79A 2Y38A 2A7AA 4XJ8A 3AYEA 4XMIA 1DGRN 2JG9C 2Q30A 1ASJ2 3JD73 1LU1A 1VAMA 2RM22 1IZ3A 1LRHA 4R9CA 1D4M3 4GIQA 1CGPA 2OUJA 1RUOA 1G9FA 2K9ZA 2UYBA 3GBGA 2IC1A 1BXHA 4PDWA 3WX5A 4AF9A 2Q1MA 2WWSA 1QJY2 4YM0A 4F3JA 4CEWB 4M3CE 3JQXA 4Q4Y1 3JD72 3U11A 4YW1A 1CJPA 1TME3 1X36A 2R042 4C0BA 4FVVA 1ND3A 3R0RA 4YW5A 3T1LA 1ND2B 4Q26A 1QHDA 4PIXA 3B69A 1QJX2 2W52A 4XILA 1QWRA 1ONAA 2VMGA 4UW6A 1ZX5A 4QPGA 4UW5A 5EXOA 4O9GA 3N36A 1OLQA 1ULGA 3WP6A 2ZMLA 1IS6A 2VPVA 2HYKA 4EN0A 5JOWA 3VKOA 1DBNA 2R30A 4IV1A 1W6QA 4YLZA 2VOWA 1W6PA 3OD4A 2GDFA 4CYDA 3MGUA 3MPPG 3POYA 4HT1T 5ABJC 4LUKA 2WNUC 5JOXA 1MS5A 2A6ZA 1SACA 3MW4A 4NN0A 2A3YA 2R0HA 4OULA 3V56A 3ZYPA 1NZCA 1YWKA 4LHNA 4MV2A 2RJKA 2GZWA 2P3IA 2R6QA 5T54A 1CAVA 5JIAA 5L7OC 2IXCA 2PLV3 3H1MA 3FLPA 1ULFA 1ZYBA 3WY6A 3NAPA 4IEOA 5F9TA 2P3KA 4Y1YA 4YGBA 1LGBA 3FE5A 1ZBE3 1ZA4A 2HWF2 3AFGA 2EVXA 4OVEA 4GMP1 1DHKB 2WSUA 3RNSA 1HQLA 2TNFA 1OQ1A 1GNZA 4Q4Y3 3PVBB 5FDBA 3OJBA 1S0JA 1AYM1 2BWAA 3MEPA 1KFXL 4LHKA 1LECA 2Z69A 1OKQA 1LGCA 1SDWA 2WZR1 2DVBA 2VXRA 1V9U2 4NWWA 4JC1A 3VKMA 1IKQA 4I0BA 5GLTA 1WCKA 1KQRA 3MF9A 5CFCA 4NO4A 2ZMNA 1VR3A 2K2SA 2AZ5A 3RPQA 4FTEA 3N7MA 3USSA 4GWMA 4YVWB 2BTVC 1ZZ9A 1FV2A 1HRV1 1Q43A 2ZGMA 4MLOA 4FAHA 2P34A 5KC5A 3OY8A 3UJQA 1ZBA2 1RUH3 2R072 3D0JA 5FMOS 2PHTA 2IXLA 1F8VA 1NCQB 4B8EA 2R071 3H1YA 2D6NA 4JGZC 2WA3A 4XIKA 4A7YA 4I02A 2X5IC 1BMV1 5IUQA 4P5HA 2R1DA 2WZPP 3ZPYA 2D6OX 2XJUA 4KGQA 2GC0A 5IK5A 1VBB1 1LKNA 2XL7A 1FMD3 4RGGA 3WHUA 3ZFGA 1QJX3 1ENQA 1HRI2 3N3HA 1HQNA 4GQ7A 1NCQC 2DCZA 2XPJA 1ZNPA 1UL9A 4AEMA 4RS5B 1RUD2 2XJTA 4KBBA 4L92A 1YLLA 1DLLA 4LBQD 5AC91 1A78A 5BNPB 4I09A 4OHXA 1PZ7A 2HEVF 3CLPA 1JYCA 1H2MA 1SBDA 3VHPA 2YZ4A 1TME1 4N9HA 1XQNA 1NXMA 3ZIXA 1QJY1 3BTAA 1HXS2 5IK4A 4N90A 3TN91 3J8F3 1DQ2A 4CDQA 3OF1A 4FOQA 3L9JT 5GALA 2BQPA 4Q0VA 2VVDA 3WW3A 4AFBA 4AVSA 4K20A 1LODA 1WW4A 1U5XA 3VZKA 4FPEA 2HWE2 3V65A 4QD2A 3SH3A 3O14A 4S2DA 4YRDA 4CDWC 4HKLA 5D8AC 1G9DA 5FO8B 1WMFA 4I3PA 4Q4W2 1NCRB 3RYPA 4BMBA 1MEC2 1I3HA 2JKBA 3ZXKA 1FPN2 3RYKA 2ENRA 4AYUA 4OHZA 1PGL1 1CAUA 3DUIA 5AC93 4BIFA 4Z8BA 1GLHA 2EXJA 3AMPA 1I9RA 4Q2FA 1CPNA 1ND2C 2PAMA 4XF9A 3TNQA 5HI0A 2DUPA 4XF3A 2PHUA 3SNMA 4F7ZA 3VBHB 3OYWB 1V00A 4Y1VA 2ZA9A 1H30A 2Y0OA 4XBNA 1S1AA 3HBZA 1ND3C 1RMU3 3JBG3 5JI9A 1CESA 3ILFA 4I01A 1K5MC 3WVJA 4EN7B 1V70A 4CDXB 4P9XA 3VHRA 3WDVA 4Y22B 3ZVXA 3VBHC 4ORFA 5CU1A 4XFHA 2Z5WA 3LKJA 1M4WA 2ZGUA 3LWCA 1VBC2 2ZMKA 3BIWE 4R52A 3SMHA 5FPXA 3V0AA 3E6CC 1DYPA 2EF6A 1LJ7A 4HBNA 4U36A 3GYDA 3WQ0A 1KFUL 1M06G 2VULA 4BHPA 5D1IA 2AR6A 4QPIC 3ZSLA 2E7TA 4UW3A 1N1TA 4AI0A 4K1ZA 3NAPC 4XTPA 4CDWB 4YVSA 4XFAA 2VU9A 3ATGA 1AYM2 5ACA2 1COV2 2RS13 4RSUA 2ARBA 3URFA 4YFWA 2UURA 3ST7A 2WZR2 2PQQA 5J3UA 1YNAA 4ATEA 1XE7A 5LRRA 4FXKB 5ACA3 4XF0A 1AVBA 1AR62 1GZWB 4D7TA 1O7FA 3PVEA 1PIV1 1RUC2 1SLTA 3LOIA 3UJOA 3PMEA 3E6BA 4A2UA 2JX9A 1MACA 3V64A 1YJLA 2GH8A 1OMIA 3S7EA 2UWBA 4PDWC 1PGW1 1GFF2 2WFF1 5T5PA 5BNOA 3QACA 4FPCA 1C28A 1MZ5A 2WA4A 1AXKA 3FLRA 5GLUA 3VBUB 1FPN1 1VBC3 3LA7A 2Y26A 4G9SB 4RQPB 1DQ1A 1SLIA 3U07A 4COZA 4DY5A 2XVKA 1Q8SA 1UZZA 4MGYE 1OHFA 3RSJA 3VL9A 2DV9A 4LBQB 2ZKLA 3AJZA 2VVEA 3HN1A 3A4UA 5LK5A 4KQ7A 3M8LA 3JZVA 4OHYA 4Y24A 1AX1A 3JB8A 3RI8A 3DV8A 5K9YA 4JDOA 2VY0A 1FMD1 2HWC2 1RHI2 1J58A 3AZXA 3H7JA 2NLRA 1QQP3 2IFWA 3AMMA 2GN3A 1BBT1 2D3RA 1ENRA 1AR91 4QQ2A 2UY9A 4KWLA 3WDWA 5CADA 4QHBA 1NG0A 3WR0A 5ABJB 1RUF2 1IGOA 1KDMA 3AKPA 5CG9A 4ZU5A 3BB6A 3VKNA 1N3QA 4QPIB 1HLCA 1O4TA 1FATA 2E7AA 5FQ0B 5AC92 1R082 2D6PA 2P3JA 3J8F2 4JDNA 2ZGTA 3AYAA 3BU7A 1BEV2 1QJU1 5FOBB 1PO21 2JDZA 1GV9A 2H0VA 3HMYA 2RS33 3Q9OA 4Y26A 3RJRA 4H3WA 1VBB2 1OA4A 2XH6A 4XQDA 2OIIA 4RD7A 4UBGA 2DUOA 3ETQA 2LM3A 5AVAA 2VMHA 2X29A 4FTSA 4RQPA 4CDWA 4QPGB 4HPKB 4OI1A 1KXGA 3WQ7A 3IN9A 4XPVA 1F9KA 4LBLA 2DU0A 3ZYRA 2YDEA 3DF0A 1S0IA 5I0SA 4XEZA 4AFDA 5KHIA 1UD1A 3TYJA 3ROUA 3ZSEA 2ZX0A 3ZXGA 2D5FA 1U5IA 1G7YA 2PHDA 4Q4Y2 4I30A 5JZGA 1VRH2 5JPMB 1WW6A 2K0GA 1YXWA 3PVOA 3R6SA 4N53C 4D7SA 2YPJA 5GLZA 2RS31 3H3UA 1WMEA 1VBD3 2D44A 3D8CA 1WBLA 4AHWA 4B3NA 2GN7A 3FLTA 4RR3B 4IEXA 2ZX1A 2QUOA 2XVLA 3PVNA 4M00A 4DQAA 1REDA 1Y9QA 1LOFC 1KJRA 4E4ZA 2KM2A 3WG1A 5LEKA 3AKRA 4W6XA 5K8SA 1ZREA 3NVCA 3I59B 2A70A 4JQRA 4Z2WA 1YIFA 5JOZA 2C5DA 1D2SA 4MX3A 5DUXA 1CAXB 1ZM1A 4N7UA 3MIHA 3B01A 2YUEA 1WLTA 5JLVA 5FTTC 4K40A 2IZWA 2JG8A 1XNBA 1LESA 3BCWA 3H0OA 2HWB2 5FFOC 1MQTC 2D43A 1U5YA 5DXDA 5JDBA 2ZX2A 1RUJ1 3HR9A 5GLWA 1KD7A 1ULEA 2V73A 1ZVFA 5I8YA 5J7MA 3LA3A 1LHNA 2O8QA 1C4RA 1UIKA 1EAH3 3E5XA 4MSVA 1JH5A 3ZO0B 1ZZ7A 2A71A 2ZHMA 3P3NA 3BOWA 1TME2 1QOTA 1O4YA 1ZBE1 3AFKA 5CFCC 2QCSB 3VBRA 4LBQA 4YZ3A 4GMP3 5JIUA 3CJIC 4FTBA 1SMVA 5C8WA 4KU7A 3DPRC 3H9AA 3ALQA 3D4KA 3JBG1 4XJAA 3M3QA 1RUI2 3O12A 3CL1A 1HKDA 4QGMA 4RHV3 4LO7A 3E6DA 1GKBA 4LO6B 4XMAA 1VIWB 3INAA 4SBVA 2WINB 4AI3A 1PGSA 4COVA 5BUVA 1Y43B 1G9AA 3H1WA 1UF2C 1R083 4C0HA 2X53S 1QJZA 2P2KA 4XXAA 2WIIB 4QQPA 1GZWA 3ZN4A 4QPIA 2XJPA 3W58A 1IS4A 4Y5Z0 3ILNA 1WW7A 4S2GA 3CEWA 4INDA 1QF3A 3N7JA 5GZCA 4AI8A 5EYYA 4MUVA 3FC0A 5FPZA 4OZXA 1SBFA 2VG9A 2BNMA 5DZEA 2XJQA 1RUE3 1NY72 2BUKA 3SCHA 3KCYA 3FUOA 3KSCA 3JCIA 4FPYA 4MGKE 3WDTA 2PHWA 2GAUA 2NP0A 1QXRA 3IMNA 2GNDA 4P9IA 4XBLA 1F5JA 4FPLA 4PCRA 3AMHA 1RUC3 3MIDA 1DZTA 1O5UA 2QFEA 4P9YA 4YW3A 1BEV1 4BOWA 3ES4A 4JGZA 4ZU4A 4AQ6A 1VJ2A 4A7KA 3D5OA 5EYXA 1J3QA 3CJXA 1S2BA 4A3XA 2XLFA 3A0NA 5A33B 4PLMA 2R041 5D8AA 1VBA1 1NA1A 3RWNA 2E63A 4AGGA 1VBA2 1R093 1ZZCA 3RS6A 2BPA2 1NE4A 4R9DA 4WM8A 3VHOA 2XBO1 3AX4A 3VN4A 3PJQA 4X6QB 1JOJA 4Y1UA 1ENSA 1R081 1W0OA 4Q27A 1U5ZA 4QPGC 1JUHA 1RMU1 2CTVA 5L7OB 4H7MA 3LCPA 2HKXA 4YG3A 3N4MA 1CPMA 2ZX4A 2D3PA 5FQ0A 4YG6A 1RUF1 1BQPA 2CY6A 3ES1A 3W59A 4YZ2A 1COV3 4RFT0 5TSWA 3AJYA 3THPA 2BFUL 5E89A 2FZ1A 5F1RA 2XJSA 4LO5B 2AH2A 2VW2A 3ZSJA 2VUJA 4CEYB 2AREA 2ZZJA 1PO12 3ZN6A 2PHRA 2MPFA 1VP6A 4Y4YA 2QVSB 1KRIA 4BA6A 1KS5A 4AVAA 4YGCA 1IKPA 2E53A 2R0FA 3FX3A 1QKQA 2ZZQA 5JSOA 4MZUA 2GMPA 1UCXA 1L3JA 5BV6A 2FMDA 4HVRA 1H4HA