4O7XA

Crystal structure of human alkbh5 in complex with mn2+
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
219
structure length
210
Chain Sequence
QQLQKEEEARKVKSGIRQMRLFSQDECAKIEARIDEVVSRAEKGLYNEHTVDRAPLRNKYFFGEGYTPGQERLYPPGDVDEIPEWVHQLVIQKLVEHRVIPEGFVNSAVINDYQPGGCIVSHVDPIHIFERPIVSVSFFSDSALCFGCKFQFKPIRVSEPVLSLPVRRGSVTVLSGYAADEITHCIRPQDIKERRAVIILRKTRLDAPRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords RNA demethylase ALKBH5
publication title Crystal structures of the human RNA demethylase Alkbh5 reveal basis for substrate recognition
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 210
sequence length 219
ec nomenclature ec 1.14.11.53: mRNA N(6)-methyladenine demethylase.
pdb deposition date 2013-12-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 4o7xA00
4CXYA 5DABA 4ZS2A 4QKNA 4NIDA 3T3YA 4OCTA 3BI3A 3O1SA 4NRMA 3O1UA 4MG2A 2FDHA 4O7XA 4IE4A 2FDFA 3BKZA 3RZKA 4NIGA 4QHOA 3BTXA 3O1VA 3BTZA 3T4HB 4NPLA 3I3MA 3T4VA 4QKDA 2IUWA 3H8OA 3O1RA 3H8XA 3KHCA 3O1TA 4IE6A 3I49A 4ZHNA 4CXWA 4IE7A 4MGTA 2FDJA 3BIEA 4NRQA 3O1MA 3S57A 4CXXA 3S5AA 4QKBA 2FDGA 3RZHA 3RZMA 4RFRB 3BU0A 4NRPA 2FD8A 4NROA 3I3QA 4NJ4A 4IE5A 3H8RA 4O61A 4IE0A 3I2OA 3RZGA 4IDZA 4ZS3A 4QKFA 4NIIA 3BTYA 4NIHA 2FDKA 3RZLA 3RZJA 2FDIA 3O1OA 4NPMA 3KHBA 5F8PA 4JHTA 3O1PA 3BUCA 3LFMA
chains in the Genus database with same CATH superfamily
5EPAA 2P3JA 5A3WA 3S7IA 1D0HA 1JZ3A 4IXLA 4LOSA 3MIEA 1KS5A 5IK7A 2C1FA 3WQ0A 1CIWA 4BQ5A 3PURA 2JG9A 5IK5A 2EIEA 2Z2SB 1VBD3 2VVEA 4QB1A 3QBQA 5F5CA 4OI0A 2OPKA 2W52A 4URTA 1D2QA 1ND3A 5FMBA 1JBCA 1W6QB 4TLFA 4CU8A 1VRH3 4XTPA 1ULCA 2ZOEB 1W6OB 1AR82 1STMA 3BKZA 1TEIA 1QKQA 1TE1B 5DZFA 4OUMA 1ZBA3 4RGGA 3RS6A 2ZGPA 3WQ1A 1TME2 1LOAA 2VE1A 2OYZA 5ABJA 1UZZA 4QB2A 4BZ4A 3DN7A 1AX2A 2HWE3 1UU4A 4QX8A 3VDDB 4FTBA 2VW2A 3I2DA 3POBA 2XKOA 1LECA 1N3QA 4DINB 1W9SA 2CAUA 3OBRA 2XGXA 1DP0A 2B7YA 1QJY3 4UFJA 1L7QA 2VECA 1DG6A 4O9EA 1ZBE3 2VQUA 2A71A 5FYYA 4ZU4A 1WMDA 2DUQA 1AR81 1R093 4N43C 4JGYB 3QD6A 3H8XA 3N3HA 4I0WB 1RUD3 2LALA 1HB4A 3DF0A 4P02B 2QQJA 2WA4A 1KITA 1V6KA 3P5BA 4XJ9A 2QQUA 1QMJA 2I07B 2VZTA 3I54A 3CJXA 2VMFA 3LEMA 4OYUA 2MEV3 5FYCA 4Z2WA 3FFZA 5KXBA 3HIFA 4YM3A 5K9YA 5F5IA 2NM1A 1GQGA 1NKGA 3W21A 3S57A 1YLLA 4CDQB 3KCXA 3WD5A 2X09A 3VBOA 4JKLA 1W8FA 3NNGA 4PBPA 1SPPA 1GNHA 3LSEA 3I3EA 3VZJA 3POJA 3E6CC 1H30A 3D0SA 4XFAA 1YXWA 2GMEA 1UY0A 3PTRB 3WV6A 4FCAA 3TEZA 2J1UA 2OW4A 3K3OA 4KMQA 4AW7A 2XLGA 4FPYA 4QAWA 4NJ4A 4LBQD 2L9LA 1AYM3 3POGA 2DCKA 4AVSA 4O61A 3T0DA 4ZY9A 3J7LA 3H9AA 5K0UC 4P5HA 1K12A 2PAEA 3ZYRA 2JKBA 2PMWB 3LAGA 1WGPA 3TRSB 1LESA 4MO3M 2ES3A 4GIQA 3SH4A 5I0UA 2GMPA 3NJVA 5A7PA 2BEOA 1MPXA 2CTVA 1X9PA 4TWTA 5HCBA 2YV8A 3OGVA 4BA6A 4UBHA 5FZ8A 4DXSA 3DV8A 2WZEA 1WW6A 1Z78A 4LKEA 5FUPA 5FBZA 2KM2A 4GKYA 3H3ZA 3VBSA 1EAH1 3RZZA 1SLTA 2R30A 5A6ZA 1BJQA 1YCIA 2HBTA 3D5OA 1Y9QA 2CL2A 2YXSA 2XL7A 1GR3A 3I59B 1RUG3 4P9IA 5FZOA 1DYPA 2OKXA 1PVC2 3OGRA 3GZTB 4MZUA 3ZPYA 3RYKA 1DQ5A 5CFDA 5JI9A 1XPWA 4BQYA 1JZ2A 4I01A 5D2AA 3J7HA 3NJYA 1UY4A 4S2FA 2DVDA 2ILMA 2FCTA 5FKCA 1AR91 4XFBA 3OPWA 4AHXA 2AACA 2D6NA 4BLIA 4MLOA 4CEWA 3O1SA 2BGCA 1NQDA 4GMP0 3WDTA 2E6VA 1IQAA 4IQPA 4XETA 4EN6B 1E57A 1PVC1 4QGNA 1YHFA 2W9XA 1CAUB 1RUC2 1PO22 2VMDA 1QJU1 3OD0A 5F3IA 1DHKB 4YYOA 4AEJA 3THPA 4BQ3A 1W05A 3VDBA 2FDFA 1SDDB 3MW3A 2E51A 1JN2P 2XDVA 3U07A 3HQRA 5LEKA 2A6WA 3ACLA 3FWEA 1YQ2A 3NNMA 1BZWA 1UXZA 2VZSA 4QHOA 4DRRA 1REDA 1VLNA 5ANQA 4CEYC 1WCQA 2FZ2A 3A7QA 5FZ0A 1V6IA 3N9OA 3JD73 5DUXA 2PQSA 2VZ3A 3NO8A 5J3UA 4ATEA 2G1MA 3KGZA 3ST7A 4QKDA 4AWDA 2ZZJA 3GJAA 2QTWB 2Z5WA 1KFXL 4AFCA 4RHV2 1MZFA 4QPGC 4QXHA 1QQP2 2K46A 2A6XA 1IPKA 2Q1MA 4A3ZA 1UOJA 1ZA7A 4V1PA 3PLQA 3SH3A 2E7AA 4OUSA 4FFIA 1FYUA 1K45A 3VBHC 2AR6A 4QU2A 4QGLA 4R9AA 1PM4A 2WFF3 5FZFA 3Q9OA 2P4EA 4YW3A 5FXWA 4HETA 5LBEA 5C9AB 1EP0A 4OFGA 4XIOA 2KXLA 1GANA 4LO6B 1IPJA 3WP3A 4COVA 4FPEA 1JHJA 1QQP1 3GALA 3H7YA 4UFLA 4RR3B 1LRHA 3VKMA 1A78A 1RUH3 4TSVA 2XVKA 4XUTA 3U10A 1W90A 1FT9A 5JIUA 2OQ6A 3OOXA 3NNLA 5FZ4A 1UYXA 2VVDA 4K6BA 5A33A 1XYOA 3OF1A 3UESA 4UAPA 1V0AA 1AL21 4RFRB 3RJ2X 3WP5A 3ZFFC 4EROA 1HN0A 3KZ4C 1AVBA 5GLUA 1QJX1 5C8CB 1VMJA 3HQUA 1Z7S1 4K1ZA 1RUI1 3FE5A 2BGOA 4V2WA 3QLQA 5JPNB 1EV12 1W2OA 3KM5A 5CISA 4BDVB 1JU3A 3AZXA 1ZZ9A 1UO9A 1ZRFA 3N35A 2IXKA 1BBT2 2WNUA 4BQ2A 3IMMA 4BMEA 2OT7A 3ZXAC 4ES9A 3V0BB 3T08A 4KNCA 5EJZB 1PX3A 1MS9A 1O5LA 2YB7A 2NZ9A 3I8TA 4LE3A 3WNLA 3VD4A 3HWJA 1FNYA 5A7WB 2FDKA 2W95A 2QUOA 2WRAA 4KU7A 5EP9A 1EV11 1OPMA 3ZYPA 4NE9A 2N7GA 4RL7A 5DN2A 3O0VA 2IXHA 3LPGA 4NPMA 4P5YA 4X6QB 1OQDA 3ACGA 4BHPA 1QU0A 4OQ8A 4RYDA 1YIPA 4HONA 1BBT1 4CCMA 1SLBA 2TBVA 1RIRA 2QQIA 3NV1A 4ZS2A 4OQ9A 3ZDVA 4EWDA 2WN2A 3MZHA 3N9NA 1X7NA 3AMPA 1BVVA 5BNPB 4FFGA 1IS3A 1YO8A 1FPN2 2K9ZA 4OHXA 5GM0A 4W50A 2X29A 3TN92 3NNJA 2ZXQA 1H1IA 5C3QA 3GGLA 1ODNA 2J42A 3VHPA 4Q5OA 4E4ZA 1VMHA 2BNMA 4FTSA 1NXD1 2H6BA 5H9PA 2ZX1A 4CP9B 5L73A 2HYKA 3ON7A 3MFAA 5J37A 1SFPA 4JTOA 4XF1A 2PAKA 3WF0A 3ZFEA 3ZXGA 2GU9A 3LEGA 1FPN1 1Q5OA 2BOJA 1OH3A 2C9AA 2Y6LA 4YVSC 1XNCA 2CY6A 3WW2A 2ZGNA 3TN91 1RMU1 1ZZ7A 3CJIA 3FJSA 3NV3A 4KI5M 3AFKA 2NYYA 1PMIA 5FJKA 3KS7A 4JGZC 3N7KA 3AKQA 2J1VA 1ND2B 5LCWL 5IVBA 1EAH3 2JDNA 3TEXA 3M8LA 2DURA 4CPBD 1NQJA 4V2VA 1H2KA 2J1RA 5CNAA 5FV3A 3PUQA 4UWDA 2QQVA 4JDMA 4CUCA 1R082 1CZSA 2GC3A 3M3QA 4RGKA 3W59A 5FLHA 1DYOA 2IZWA 2EIGA 3VBRA 1AYN3 2ZEXA 3MLLA 2Z42A 3I2IA 3N36A 3LGRA 3CZUA 2JDAA 1BLZA 4UW5A 2VPVA 4PLMA 1D2SA 1F9KA 2VQ0A 1MEC2 2XONA 3KT7A 4EWAA 4F83A 4YGCA 2FDJA 1AR93 5FP7A 4XMIA 3PVNA 2V4VA 4BB3A 2A7AA 4GD4A 4MYEA 1MS0A 4BM8A 4YARA 3QACA 2WAAA 2VW1A 1L7RA 1UKRA 3MIFA 2YFZA 1R081 1TQ5A 2JB8A 1HV0A 5JZGA 2JDZA 3MYXA 2BGPA 1PVC3 1UY2A 3E6BA 4DMIA 1WA4A 4GB32 3FBYA 2PHUA 5F5AA 2Q8OA 1LB2A 2X5IB 1QJU3 3OG2A 1MS8A 2FD8A 1LHOA 1UOBA 1AR63 5FYZA 1AUYA 2HKXA 2C9KA 3LCPA 3WG3A 4AEMA 2P37A 3K3NA 3H8RA 1O3RA 3BOWA 3KMHA 1MEC1 3U78A 4XFGA 5J48A 1QOOA 4FQZA 2JXAA 2YPDA 5D8AB 1I1EA 3I2OA 2RM22 3NNFA 5F5QA 5F1RA 2BQPA 1XE8A 4Q4W3 3RGBA 3AZWA 3WG2A 4D7TA 1KFUL 4PDWC 3KCCA 3TAYA 4DOUA 4LBKA 4CDUB 4JCKA 3RVHA 4Q4Y2 2XBO2 2W1WA 3BN6A 5JOWA 4CA9A 1PNFA 3NV2A 5JIAA 1DU3D 3ZXFA 5KC5A 1G9CA 5I0RA 4EN8B 2D97A 2DCJA 3VBUA 3S30A 5DUUA 3O14A 3TYJA 1QH7A 4XXAA 2FDIA 1UYZA 1OUSA 3R4SA 3WQ7A 2ZAAA 3DKWA 1CAXA 4NWWA 3WNOA 2FCVA 1CVNA 1HXS2 2ETEA 2VU9A 1UL9A 4XTMA 1EUTA 4PCRA 1IS4A 3GBGA 3JBG2 4GH4A 4Y22B 5A3PA 3ZYBA 1COV2 1EPZA 1VP6A 3ENRA 5L7OA 2E7QA 2JWPA 2R072 2XBO1 4Q4Y1 2HEVF 3ZXJA 1BQPA 5J36A 4HFSA 2LRPA 1ENXA 1OQ1A 2UURA 4XCBA 1YJKA 3LFIA 4JKKA 1I9RA 3O0WA 1JOPA 4RFT0 1ZRDA 4QB6A 4M0NA 5FY8A 1AZDA 2GDFA 2FDHA 3QOPA 3W58A 4AXOA 3UNPA 2QDNA 4LUKA 4B1LA 1AL23 1NCRA 1JYTA 4D6QA 1HXS1 2P5BA 2XLFA 1V00A 1RXGA 4HKOA 4HK8A 2MNGA 2BTVC 1IQDC 1QJX3 3NKGA 4LO8A 3JBG1 4ZXKA 2RJKA 1Z7S3 2OVUA 2WO3A 1RUI3 5JAXA 4WM8A 5EQUA 3SEEA 1H9PA 3RZKA 1JOBA 1QJFA 4E4SA 4P14A 2JICA 3C2UA 2R071 1QH6A 4M4PA 4N7UA 3AYAA 3DUIA 5IVFA 4AEDB 2GP5A 3VV1A 2F4PA 1W6PA 2EIDA 1HIXA 3ME2A 5ACA1 1J3PA 4AI9A 5IFPA 3OGGA 3AP5A 4H55A 2YMZA 4A7ZA 1GSLA 4AYUA 2CV6A 2ADEA 1K42A 1H8TA 2IWGB 4LBQA 4IERA 4LK6A 5IVEA 2VBBA 3H3UA 1LOBA 4LO7A 3KVAA 3INAA 4PF1A 3ZSJA 2QZ2A 2VOVA 2YUEA 3D4KA 4UFIA 3AJYA 5G05L 5CA6A 3IAQA 2QVSB 4JQTA 3ZSMA 2WYFA 3DYOA 4CCOA 1U5XA 2FCUA 1F4AA 2CGOA 2PAMA 3DECA 4N53B 2B5HA 4K7JA 4KU8A 4ZU5A 1VPHA 3D3AA 4AI8A 4LBJA 2P3IA 1APNA 3NWKA 1OOPC 4L8QA 3S0MA 4XBQA 4NHKA 4RQPA 3WHTA 1QEXA 1RUOA 3MPPG 2W39A 3VL8A 3EYPA 3O1MA 1G9AA 1S0FA 3LIGA 5C3PA 4QPIC 4QKBA 4YWAA 2RG4A 2Y60A 1M4WA 2XJRA 2DF7A 2BBVA 1ULGA 2JG8A 3FHQA 3SKVA 3WXPA 2HWD2 2GAUA 3B02A 3R4DB 4AHYA 3PVBB 1MS4A 2V72A 1LENA 4QPYA 1UN1A 4FXKB 4LBMA 3S5QA 4HG6B 2BVBA 1XRUA 4G3YC 1UAIA 4L11A 1H1MA 2QE3A 4HKLA 4LHNA 5FYHA 3DPRB 2W91A 3WP6A 1KS4A 1QY4A 1O4TA 2JIJA 4H7MA 4IEYA 5FZMA 3UL2A 4AQ6A 4AVVA 5LRSA 3RZGA 1UNBA 3VZLA 3L2YA 3MHZA 5FP3A 4L97A 3SC7X 3A21A 2DFCA 1IG3A 1RMU3 3VUOA 1IHMA 3AMMA 4KH9A 3EB7A 4AF9A 1HRI1 1W3XA 2A3YA 3Q8FA 2WNEA 4D7YA 1ZVFA 4R9BA 1DYKA 3ZDSA 1IGOA 3BB6A 1LOFA 2WT1A 3GZEA 4BQ1A 4UW6A 4OVEA 1NLRA 1J83A 1PZ9A 1VBC2 4S2DA 5FK8A 1I3HA 1POV3 3USUB 3VBFB 1X33A 1YQ6A 5DAWA 2I74A 5FY9A 1O3QA 5CFCB 4PHZA 2R16A 1FV2A 1UZWA 3PJYA 3POEA 2QKDA 1PGW2 2I45A 2P6HA 2VM9A 1DCSA 2Y34A 1UIKA 2XHKA 4J6GA 5GALA 3LDBA 3O5SA 2BWCA 2BJSA 1OHFA 5GLTA 4BJ0A 3C8XA 3SQOA 2G9FA 1OQEA 4QDQA 4FXGB 1VBC1 4YW5A 4GQ7A 4BXSV 2VMIA 1V9U1 3MBWA 2ZTNA 2WJSA 4DEQA 5DAPA 3OY8B 1B35A 4Q4X2 1E5IA 1R1A2 4Z2AA 4Z92B 2VW0A 1PGW1 5EIYB 4YRDA 1H0BA 2Y26A 4LBLA 3RPQA 2IC1A 5BUVA 1UIJA 2RS32 2GP3A 2R062 3NRUA 1J84A 5GZEA 1ZYBA 4HK9A 5GLWA 5H9RA 2CSGA 4UT5A 2G9ZA 3R05A 1SZBA 3KV5A 1BVP1 2WR9A 1TMF2 1U0AA 2GSYA 3IDBB 5FMOL 3RI8A 4CDXA 2IUWA 5F3GA 4Q4X1 1GMMA 5I8TA 1R1A1 5FZHA 5C71A 4I09A 1NA1A 4OLLA 2X05A 4EZ4A 5JMOA 1RUE2 4R4XA 5FP4A 1FMD1 1UPSA 2RJLA 2VULA 2ZMKA 4XF4A 3KSCA 3ZM8A 1US2A 3WF1A 5DDJ3 1N3OA 1W39A 3N9QA 1K5MA 2Q5TA 2YGMA 4AFAA 1RJ8A 2R061 2QQLA 2SLIA 1UQXA 2GNMA 4YM1A 3JCIA 4FSJA 3EBRA 2B9UA 1F4HA 1TMF1 2VL4A 4Y1XA 4YVWC 4URAA 1N1SA 4UI9L 3POWA 4JDNA 2YG0A 3EXUA 1MQTC 4Q4Y3 2D3PA 5GZCA 1VRBA 2R0FA 2PHTA 4IV1B 4NRQA 3OUHA 1RUE1 4ARXA 2JECA 3WQBA 4CXXA 2PQQA 3E6DA 2PLV2 2QZ3A 1PMJX 3ZSKA 4E4HA 3EHKA 5CBLA 3AMHA 1PK6B 1GV9A 2RS51 2DU1A 3KF5A 4JHZA 2XOMA 3POYA 4AVTA 1LHWA 1JYNA 1S0DA 3ACFA 4Y1ZA 2JG9C 1HRV2 3T1MA 3TNPB 1POQA 1DBNA 4QM8A 5EWSA 2GH2A 1EY2A 4RS5B 1E5RA 4XQWA 4Y3OA 3K51A 2AYHA 3AL6A 1ND3C 2WNOA 4CCJA 4PIXA 1UXXX 1SBDA 3OYWB 4CDWA 3FZ3A 4H7LA 5KXCA 4KQ7A 1S2BA 4YFWA 5EJ1B 2G19A 3T2PA 3UGHA 4LULA 1ZRCA 2CGNA 4XURA 4IDZA 5ACA3 4IEZA 2HLEA 4K3UA 4UXAA 2Q8CA 2V73A 3BOPA 1CZTA 3C7OA 3J26N 3ILFA 3KLSA 5FY4A 5HCFA 1ENSA 3ZIWA 5ABJC 3AXEA 1HRV1 1W0OA 2BNNA 1O59A 5FQ0A 5E6HA 4FPJA 5HXVA 4Y5SA 1GOGA 2Y6JA 3F2ZA 2JENA 2H0VA 3KT1A 1V6MA 4YZ3A 5GLZA 1HW5A 3U0ZA 4M3CB 4MHRA 1NLSA 4YG6A 5F8PA 4YW1A 1PM7A 1LEDA 5FXZA 4C0HA 2WNVB 1TNFA 4YLZA 1Q43A 2JB4A 3CKHA 2AH2A 4C1XA 5BNOA 2VTXJ 5T55A 2XXZA 3U14A 2VXJA 2YC2A 3LEIA 5CYYA 5SV5A 3NAPA 1W6MB 3WDUA 4A4AA 1QXPA 4XC9A 2P1BA 1REEA 1N47A 4IEVA 5BNNB 2BDRA 1FV3A 2P34A 3C7HA 4LO5B 5FXXA 5A3OA 1OF4A 4I3PA 1EPWA 1UWWA 2XLAA 1YWKA 1W04A 3H1MA 1JYWA 4KBBA 5FMDA 1M06G 2YY1A 1P8JA 2OX0A 3MF9A 1GP4A 3ALQA 1MR5A 1VBB3 4Y26A 5JWPA 2W87A 4KWUA 1MQTA 5IVVA 2QJVA 1V6OA 3B9IA 4UBGA 5I0DA 5DG1A 4CCDA 3VN4A 3OPZA 1GUIA 4MXWA 2OA2A 1YI9A 1NCQA 4ISRA 4GJZA 1A8MA 1DGRA 4WM7B 5T50A 3VBOC 3Q8CA 5HXMA 4B1MA 4BH9A 4HOOA 2W08A 4BPZA 2D6OX 4JQRA 4Y20B 3KGLA 3GHNA 4DRVA 2I2SA 1RUF3 3OGSA 1NT0A 3PUHA 1ZREA 2BRTA 1V6LA 1OD3A 1RVF3 1E5SA 2NMOA 2XUEA 5C4WB 2P2KA 2VCBA 1HRI3 4UF0B 1KEXA 4F7ZA 3D82A 2ZA9A 2XMLA 1W6QA 3ZXDA 3KHCA 2HYXA 1FXZA 3WDYA 4BYYA 4DQAA 5HCAA 5JMCA 1W6OA 4QQHA 5JVVA 1JZ8A 3G7DA 4D6SA 1XE7A 5EFUA 1ZX5A 3VBSC 4I02A 3GDBA 2J7MA 3WG1A 5FKBA 3VDDA 4KWKA 4X8NA 4MHUA 2ZX2A 1FATA 5FPXA 4K8FA 3ZFGB 3DYPA 4L99A 3CL1A 5F3EA 2PHWA 3RYRA 5CFDC 4XCAA 4F3JA 2DTWA 1LCLA 5FZKA 1PHMA 3LQCA 1X82A 3ZVXA 1G9FA 1V9U3 3FFQA 5F7UA 2Y64A 1TME1 2ARBA 2P17A 4JGYA 1SFNA 2J1AA 1W8OA 3ZPOA 2IVIB 1X8EA 4CEWC 1SACA 1PO12 4G9SB 2RR12 4R52A 1F8VA 1UYPA 4IGQA 2A1XA 2YC0A 4I30A 2VNRA 3GCXA 2WO7A 5FLJA 3WNPA 2E32A 1YYNA 1QJZA 4YM2A 5JCTA 1E5HA 2R1DA 3FHIB 1S0CA 2DBIA 1QNYA 1AX1A 2JD4A 5FO7B 4YZ4A 5SV8A 1W0NA 5CIRA 3V64A 4IV3B 3WZ1A 3I2KA 3JB8A 4CDQA 4C1WA 1XB9A 4QM9A 1SLAA 1DQ4A 3KB5A 3AYDA 1PO11 3WNNA 1KQRA 4D69A 3H8UA 1FMD3 2ZHMA 3JXSA 5CKMA 5J98B 1UW8A 4HLTA 5HBAA 4OUEA 4HL0A 1MACA 4MOAA 4SBVA 3VGIA 1VBA3 2UWCA 3L9JT 3POIA 5LB6A 1Y3TA 5E8AA 2B46X 4KGGA 4QQOA 3AB0A 1HQLA 1PX4A 1XQNA 2XJQA 3C7FA 3KWVA 1L7LA 2O8OA 2WZ8A 4A7KA 3MV01 4NIDA 1H4HA 1DF0A 1UZYA 1O8SA 1RUE3 4XJZA 1URXA 3VL9A 4XUPA 2VCMA 2DV9A 1U5IA 5I0TA 4YW7A 2UYBA 1CZVA 3BYWA 3IIIA 5FO9B 2ZKNA 4CVUA 2RS53 5ISLA 5EYYA 2R0HA 4Q8KA 1UCXA 5DG2A 1GFF2 2WQZC 3I7DA 3I59A 4IETA 1GZWB 4XPVA 1LOGA 2G9GA 3MIBA 4TXWA 4M3CF 4WVVA 1OSGA 3B69A 2Y38A 2ID4A 5BXXA 2ARXA 3ETPA 3I2HA 2WAOA 4LQRA 2WT0A 4XF0A 5F6KA 5HV4A 1OXCA 5LA1A 4JDOA 4NIAA 2QBXA 4XUOA 2HWB2 2QFEA 4QX1A 5FFOC 3H50A 4EYUA 1WW7A 1VBE3 3ZMNA 2VOKA 2JIGA 2JDPA 1XJAA 3GCWA 1DIWA 4AEKA 4A7YA 3QH6A 5HCHA 1A8DA 1OPOA 4ONUA 4RA0A 4KWLA 1SBFA 4RSUA 5FZBA 5I91A 3GBWA 3PL0A 5L9RA 4XIKA 4GXLA 1CAUA 4HZFA 2WNUC 1BCXA 3LB9A 4JKMA 3RYPA 1ASJ2 1TVGA 1POV0 3T2OA 4AGVA 2A73B 1C1LA 2BFUL 2HH9A 4P9YA 4PQ9A 3LOIA 4N43B 3LD8A 1C8M3 4HMZA 5C33A 4NO4A 4XQDA 2KA3A 5J96B 1GQPA 2VY0A 3SEPA 2OS2A 4TYSA 3DL3A 1RUC1 1PO21 3T0BA 4AQ2A 2VUCA 2Y6FA 2EXKA 3M2MA 5FY1A 1ASJ1 2D43A 4H14A 1OH4A 1HN1A 3AC0A 3BTAA 4LMFA 4NRPA 5FK7A 3ZYIB 3IB3A 2K0GA 3PMSA 3DYMA 1IPSA 1O6UA 4WV8A 5A1LA 4IEPA 3M4FA 5KWRA 3VD9A 2A6YA 4GALA 3CMGA 3I3BA 5F2SA 2Q8DA 4O9GA 2V5DA 5EZWA 2YC4A 1QHDA 2ADDA 1CONA 4AFMA 2EF6A 1PGL2 1X50A 5FRAA 5C9AA 4AE2A 4PIYA 3K48A 1FOD2 2YPJA 3KF3A 4Q26A 4RHV1 3KCYA 1LHUA 4B3NA 2J1SA 4FBFA 5K0UB 2WLPA 3WNMA 5I0SA 4RR3A 4QD2A 4E2SA 3NJXA 4E2QA 4BXFA 4ARYA 3O7OA 3ZFEC 1XU2A 2ET1A 3MIHA 1LU1A 4HN0A 4IGOA 4HVOA 3THTA 4YGDA 5B4NA 5C8CA 3J7NA 3CJIC 2RVAA 3MLKA 1LHNA 1PGL1 1ULFA 1AX0A 4NHXA 2XQRA 2Y0OA 4WVMB 1FOD1 5FY0A 4MVTA 2JDYA 2MPFA 1OKQA 1RGSA 1S0IA 2EAAA 3WW1A 1JH5A 3I4IA 2YZ4A 5FY5A 3ORJA 5T5JA 4COZA 3T3YA 2D3RA 2E26A 1VB4A 2GC0A 3VBRC 3ACHA 4OHVA 4BIFA 1YRZA 2GMMA 4AG4A 1WKYA 3V0BA 1SEFA 3N7JA 3RDIA 1D4VB 3SKJE 2R042 5FO8B 4BWOA 1AR83 5KXEA 3ZKYA 4A2UA 5A7WA 3AZZA 3IDCB 1JYVA 3ZR5A 1TME3 2W5FA 5EXOA 4YW6A 3VZKA 4NMIA 4UFHA 1CPMA 1REFA 1JTZX 1PZ8A 3D0JA 4U2AA 5F37A 3ZMOA 5B2GB 1RINA 5JZGC 3HJRA 3J8F2 3IAPA 1BHGA 3PIJA 2Y6KA 3PTYA 4N8MA 4Q0PA 1K5JA 4HBNA 3SNMA 3VKOA 1K3IA 5BNPA 3HNMA 1LTEA 4W6XA 4CEYB 4XQ4A 3TEWA 1UX7A 3SISA 3AFGA 3ACIA 3FBMA 3B7MA 4INDA 2ARCA 2D6LX 3LIHA 1ULDA 1DZTA 5JXHA 4O65A 5I8SA 1O8PA 1OLME 4AVBA 3CZJA 2VUJA 3Q8EA 4EQVA 3T0AA 4CP9A 1J1TA 1Q8SA 2ZGTA 4QPGB 2PFWA 1FI2A 3AZVA 3APBA 3WEZA 2TEPA 4JTNA 5K4LA 3U4SA 1AJKA 1H4GA 3U37A 2W94A 3S7EA 4Q27A 4FPOB 4BK5A 4EJRA 1MS3A 2CHHA 1WLDA 4FI9A 2CWSA 3VBHB 3VBUC 5CADA 1XYNA 3ZLIA 4MGTA 1AF9A 2RDNA 3P3NA 4K1YA 4YW2A 4OHYA 4JRLA 2OXBA 3HT1A 2VJXA 2WC2A 3KD4A 4KG8A 1IS6A 4P00B 2TUNA 5DMYA 1Q3EA 3D6EA 4GH4C 3UJOA 1YFXA 3V65A 4R8HA 1ND2A 2PHRA 4PI0A 5DQ0A 3WW3A 5L7OC 3AZYA 4COYA 4PI2A 2BV4A 1BXHA 2ARAA 4Q0UA 3VD3A 3WINE 2HWF2 2Y6HA 4NROA 1SFYA 4DY5A 4E27A 5FPUA 1W2NA 1LKNA 2VZRA 1F35A 4LEJA 1NYWA 4Z1VA 3S6PA 3ZFFB 2NP0A 2DTYA 2GN3A 3EO6A 2Q1FA 2WQ4A 1WLCA 2Z4FA 2VOXA 1NCRC 3SHRA 1XYPA 3E5QA 1WBFA 3HD8B 3WUCA 4GMP1 1UKGA 2RHPA 4LBOA 4XBNA 4ZKTB 1CIYA 4QQ2A 2VZ1A 3ETQA 4WM8C 4QT6A 1UX6A 1UYYA 4XZPA 1WMXA 2D6PA 1NLQA 2HWF1 2TNFA 4I2OA 2DVGA 4DUVA 4EN9B 4DXRA 3WF3A 3FC0A 4J1XA 1OKOA 1J58A 2Q0AA 1NZIA 3VD7A 4ATFA 2LW8A 5T5OA 4BLJA 3LA3A 2X5IA 3U1XA 3VZNA 4M01A 1HDKA 2WT2A 5T3NA 4QX3A 1QJEA 4NAMA 1H8TC 4JX0A 1L3JA 3VHNA 1H1AA 4DUXA 3ATGA 4HSLA 4QX2A 1OVPA 2LUWA 4XW3A 5CVRA 5D8AA 3ZR6A 3CIHA 1C4RA 1KD7A 3HVDA 1ZZCA 1JW6A 2W1UA 4LLFA 3O1UA 3AP9A 1D4M2 4GB31 4M3CE 4BQXA 2FMDA 3UETA 5K8SA 4EZHA 1RB8G 1RUC3 1PO23 1CN1A 4LHSA 4CDUA 3MLJA 5FCCA 2UYAA 3UGFA 5C70A 2XH6A 3K77A 1ZM1A 2JDUA 2W92A 1DDLA 3MFCA 1A3KA 4RQPC 2CU5A 1CWPA 2EAKA 4PT6A 2DU0A 4UW4A 2GC2A 4D6RA 3ECQA 2RM21 3PDQA 4N90A 5A32B 2D40A 2A75A 2R1BA 2X53S 3MO4A 4OULA 2JG8C 4Y22A 4XF9A 1D4M1 1GZTA 2DUOA 3I3MA 2UWAA 5I8YA 3OBTA 4Q0SA 1Y7BA 1W2TA 4RHV3 1BEV2 1QQP3 3ZYJB 4W4ZA 5FWEA 2QQOA 3ZO0B 2O8QA 4BCUA 2BERA 3KVBA 2XQXA 4YVSB 1LU2A 3TBDA 5IVCA 1U5YA 3SCFA 3H0OA 3H1YA 1W28A 1Q8OA 3B3QE 4Q4V2 3MW2A 4JGZB 4GWJA 2D6KA 1ODMA 2WIIB 1COV1 2HEWF 3PUSA 4CUGA 4ZHNA 4LK7A 1MZEA 3IKWA 4WVWA 1FOD3 5H9QA 3R0RA 4OMDA 3ZXLA 2WWJA 5G04L 1QOTA 1LOFC 2D98A 1AR72 4K40A 4AEDA 2VXRA 1RHI2 4I0AA 2RS12 3IBMA 5A7QA 4KGQA 2WA3A 4ES8A 1GWKA 5KHGA 5KHJA 3OD4A 2IFRA 2XR4A 4XUQA 2SBAA 4Q4V1 4AI0A 3PIGA 3URFA 4A6OA 2BW8A 3BGAA 4P9LA 3BU0A 4Q1RA 4MGIE 5FY7A 3JZVA 4PQQA 1EV13 1UOGA 2B4KA 3HQXA 4XBLA 4LORA 3UK9A 1F31A 5C3RA 2A3XA 3AP6A 4OHZA 3B9CA 1AR71 3H3LA 5KR7A 2JDKA 2OUHA 3EMRA 2RS11 4N53A 1OBNA 1BBT3 4PIZA 1CAVB 1UU6A 1B35C 4LIUA 1W2AX 2W46A 2C4XA 4BK4A 5I93A 3KQRA 3TWIA 3USSA 4QPWA 1QOSA 4BOWA 5FYMA 2XWJB 5DZEA 3M3IA 4Q0QA 3NV4A 4ZZ8A 4F8AA 4Z82A 2ZEYA 3N9PA 1V70A 3JB4C 1ULEA 2BVVA 5LBBA 4PDWB 3DEMA 2CGPA 5T5PA 1GU3A 1ENRA 2V5YA 1LEMA 5IVJA 4JVAA 3M3EA 4DS0A 2ZMNA 4CDXC 1A34A 1SCSA 1X36A 1C8NA 5DXDA 3AMNA 3MGUA 4HVRA 4P9JA 2PXJA 2W47A 1NA1C 4HT1T 4JAAA 4IESA 4QXCA 3U4XA 3AM2A 4FP3A 2J22A 3DPRA 2OQ7A 3IZOA 1FPN3 4MADA 3WP4A 2WZPP 1W99A 3AJZA 1K5MC 1OLQA 1W06A 2WSVA 3VD5A 3TN93 3BI3A 2HWD1 2JG8B 2IXIA 1VBD2 2OUJA 2ZMLA 2ORZA 3AVRA 4FFHA 2A5ZA 2Q8EA 4W6WA 2BP6A 5AFEA 4JRAA 4L2NA 2ZHNA 2F6BA 1VRH2 2WZR2 2ZS6B 2D93A 5FREA 3T1LA 5JOZA 1CX1A 4CCLA 5F9TA 1Z0HA 4N7IA 3T2QA 3USUA 4CZSA 4XFFA 3AX4A 3BTXA 3VBFA 2R49A 1ZBA2 4A41A 1MZ6A 2ZCWA 1O4ZA 3AKPA 3LEKA 2EALA 3VB9A 5CFCA 1CAWB 4S2GA 2HWE2 1KDKA 4Q1PA 1VBD1 1S0BA 1XU1A 4PJYA 4AAXA 5GZDA 5F32A 2Y0IA 2AUYA 4OI4A 3M70A 1QGLA 1QJY2 1XSQA 1JODA 2RDRA 4LOTA 1VE0A 4AZZA 3IT8A 4OZOA 4ET7A 1DQ2A 1VRH1 2FZ1A 2WZR1 5A6QA 5IAXA 4CDWC 1R083 3LSDA 4FPFA 3LOBA 1SQ4A 1R092 2A3WA 5JUVA 1X8MA 4DXZA 3LDRA 5LRRA 5C6CA 1HB2A 2NPIA 3OY8A 3BUCA 4Z07A 1S1AA 5FP8A 1RUD2 2GNDA 3LWCA 1OF3A 4R9DA 2LM3A 1QNWA 1MEC3 2GNBA 2NMNA 4HPKB 4IE7A 4AQSA 1W0PA 1VR3A 4LJHA 2PN5A 4OHWA 1OLMA 3TNQA 2C5DA 4S2HA 5JXIA 2RE9A 5A7SA 4B8EA 5F39A 3HNBM 1R091 1WZXA 1NG0A 1OOPB 1WLWA 2E9QA 4HXCA 4QQLA 4GB33 5DZGA 3RZHA 1ULPA 3W20A 1LAJA 1BMV2 3ZIXA 1NE4A 3V0AB 1RUD1 5BNOC 5AVAA 3DGTA 2O1QA 1CD3G 4FP2A 4QPIB 3NAPC 5FXVA 3PU3A 4BMBA 5CU1A 1F5JA 4LT5A 4LKSA 4XXPA 2RS31 5FUNA 5C5UA 2RM23 3DXTA 3WDXA 3OJBA 2ZAHA 4FOYA 1AYM2 4ITCA 4PLOA 1U5ZA 4XJWA 3E1F1 2VVFA 4IEUA 4A3XA 3WNXA 4AI3A 4LHLA 2W1QA 3RWKX 1JU4A 1US3A 2XUMA 1GNYA 3P3PA 1Y43B 2AENA 2XBO3 3MIDA 3P6BA 1BK1A 1WBLA 2HJIA 4NHMA 4P08A 1RJ7A 1O7FA 2WFPA 3E5UA 4XF3A 3ZYGA 3BTYA 3ZN5A 1NCQC 4P9XA 5LK5A 4Y5TA 3ZKUA 4K8RB 5JSPA 3NL1A 3UGGA 4AL9A 1J3QA 1PK6A 2XJVA 2F4LA 2QQPA 3E5XA 1HXS3 2D5HA 2VD7A 4MGKE 4AFDA 3ASIA 3GBFA 1W6NB 3JBG3 5CKQA 2CNAA 1RUG2 3A23A 3W5MA 1COV3 4RS5A 3GM8A 4MGQA 1VB2A 2R073 4XE9A 5J7MA 5KHIA 2BZDA 4G4FA 3O12A 3OYWA 1JUHA 1NAEA 3ZYHA 2PLV1 2RMU2 4LUMA 5JXJA 1IKPA 4A44A 5KHHA 2WBKA 4XEZA 2O14A 3BODA 4Y1YA 4META 2B8MA 5JSOA 1WD3A 2VQAA 2VC9A 3B5LB 4Q0VA 3IIAA 4QDRA 1MVQA 3VDDC 2ZHLA 4XYXA 3TEYA 2YROA 2EXJA 1UU5A 4CUAA 1HX6A 1W9FA 3SLIA 4XUNA 5GLVA 4U36A 4COWA 4M3CA 2V09A 4NIGA 1R64A 2RMU1 1CESA 2ZEZA 4RN5A 1OMIA 3HAGA 2WNVA 4FFFA 1ZA4A 1GZCA 4XFIA 4NPLA 5FP9A 1JZ5A 4JGYC 5LBFA 3GZUC 1ALYA 3VLBB 3JD72 1W6MA 1NY72 2VG9A 3GF6A 1R1ZA 2XVGA 1ZNPA 2E63A 3I2GA 5FZLA 5BNNA 3A22A 4PLNA 1MZ5A 2XB6C 5B4XA 4TLGA 4FTEA 2VOWA 3A4UA 1C5HA 4KWJA 3O1TA 1S0JA 3B94A 1F5FA 2NLRA 3K46A 2XPJA 4CXWA 2VOTA 4W65A 1PIV2 2V4AA 3RSJA 3N7MA 3FX3A 3ZN6B 4AK3A 4CDQC 5FZCA 3A0NA 1H6XA 2P3KA 2VTXA 4QXKA 1TNRA 2ZGSA 2ZX3A 3KQ4B 4WM7A 1NY71 5LWBA 2WFF2 1YI7A 1WCUA 3NMBA 2Y6GA 3BIEA 4Y20A 3FN9A 1NE6A 2EVXA 2PTMA 4YZ1A 1I6XA 2FDGA 2VNGA 4ZONA 4YVWB 4FAHA 2HWD3 2DVAA 1RUH2 3RI9A 5IT6A 4XOGA 3POSA 5C4WA 1MQTB 3EJKA 3FLPA 1UZVA 4KG0A 4LPLA 4OZXA 2YBKA 4GZ9A 3IPVB 1UPIA 1PIV1 4UF0A 2BBAA 4R9CA 1JUIA 3ROUA 3T09A 2D6MA 4MXWB 1N1TA 3MI8A 3RWNA 3PHMA 4Y5Z0 3IDAA 2ENRA 2WFF1 5T52A 1SDWA 2W1SA 2ZEWA 3HN3A 3J4UH 2CAVA 3B01A 5E1RA 4EN0A 1VAMA 5TSWA 4YZ5A 5CEHA 2JG9B 5FOJB 3PNAA 5FMOS 3KT4A 3U11A 4ASLA 1BYHA 3WUDA 1RUH1 3CBNA 3POFA 4LITA 1UY3A 5LATA 1ND3B 5IFTA 3M7AA 3E97A 1RYYA 4NOTA 4ZS3A 3ZFGA 1ONAA 1DGRN 1YEWA 1O5UA 2WZR3 3NKTA 5FAXA 5FZ7A 1VBC3 3SXWA 3CLPA 2BUKA 3OEAA 1BK0A 5JR2A 3R4UA 5BV6A 1CX4A 4Y4YA 5ABJB 4J1WA 2C26A 2IXLA 4XABA 2E33A 1FX5A 1H2NA 1YJLA 3GHMA 5ANNA 2CWMA 5DABA 1GNZA 2MHFA 1O4YA 2WKKA 1NOVA 4PBOA 5H9SA 5FZDA 2R32A 2BYVE 5LA9A 2RDQA 2PHLA 4NRMA 2VCCA 1YIFA 1RUJ2 4MG2A 3RMXA 1LGBA 3T2TA 5FLIA 5A6XA 3D8CA 5FMCA 4IV3A 4Q4X3 4ASKA 4EV0A 1R1A3 2IXCA 5LA0A 1IG0A 5F3CA 1OFSA 4FOQA 4QDSA 2RR11 4Y4RA 1LGCA 2KD7A 1D7PM 3WCSA 2A6ZA 4AHZA 3CF6E 3FLRA 2YHJA 4XDQA 1ST8A 2C0ZA 2RS33 4I0BA 5CKNA 2R063 3SCGA 1CGPA 2ZPXA 1XNAA 5FDBA 1JYIA 4FT8A 1RUJ1 1TMF3 4DPNA 1A6CA 1QXJA 3VBOB 1PZ7A 2HWC2 1FNZA 1SPPB 4ORFA 5FYSA 4OI2A 4TZDA 2YBPA 1H6YA 4QU1A 5EHDA 2E31A 4CCEA 2OPWA 3OCPA 3N4MA 1XE0A 2B39A 4XFCA 2BNOA 1LHVA 2YGLA 4BIOA 5T54A 2GN7A 5C9AC 4TN7A 1EAH2 1JZ4A 4K21A 3LA7A 1GP5A 1W2UA 5F2WA 1HQNA 5FZ6A 1V6NA 1HJFA 1SLCA 1GZWA 4RR3C 3TOJA 3SCHA 4KL1A 1AYN2 5KC6A 2HWC1 4B7KA 3QH7A 3I97A 4DUWA 1JS9A 2D5FA 2X8KA 3GXUA 4QHBA 4XMAA 4JC1A 2PLV3 4X6RB 5FZIA 5C8CC 2F17A 4TTGA 5ERLA 1B09A 1AHSA 4MV2A 3VBSB 3AKSA 3S5AA 1AR92 1O3SA 2IXJA 3BCWA 3WHUA 3VKNA 3MPBA 1HRV3 2YYOA 1OFNA 5FZOB 5JOXA 4OI1A 4D7SA 2ZACA 3OEBA 5CFDB 1JYXA 1AYN1 4H3WA 2X10A 4XZUG 1D0GA 1QJU2 1AXYA 4YPJA 4WZCA 1AR62 1WCSA 2PYTA 3AYEA 1KJRA 2H0BA 2NQYA 5JSRA 1DFQA 5LZ6A 2HWB1 1RXFA 3MW4A 4IUGA 2RMU3 4AGGA 4N43A 3AP4A 4CSWA 2VCAA 4MXVA 5A7OA 3IM0A 4CEWB 4B4QA 5AC92 1LULA 5A6YA 3AYCA 1UOFA 4AQTA 3AKTA 1DGWX 2DVFA 2Q30A 3K2OA 4Q4W2 2WN3A 5IJRA 2B42B 5T5LA 2AREA 5FZ3A 1I5PA 5DAQA 4FQ4A 3RG0A 1PGSA 2WLQA 1XSRA 5LY1A 1IOAA 1JOJA 2XHNA 4NAOA 3RQ0A 4D94A 1AR61 1DQ0A 4YGBA 1GWLA 1LGNA 2YDEA 2WQ8A 5DUVA 1CPNA 2EXHA 1OUXA 1SHWB 5D21A 3ZXKA 5BNPC 1DGLA 1QDCA 1NUKA 1XXNA 4XDPA 3SITA 5AC91 4LNVA 4CU9A 4KBZA 1EUUA 2J1EA 4C0BA 4Q4W1 1UMIA 3CNAA 5JXGA 1YQ8A 3Q8AA 2J1TA 2VNOA 1X9TA 2BOIA 4YSFA 1LNSA 3VHOA 2ZGQA 3GNEA 4OMCA 3H7JA 5K0UA 1ZZ8A 1Y9MA 3VDAA 2UWBA 3RJRA 2WYSA 3PVOA 4EN7B 1WW4A 1QF3A 4LKDA 2ZGKA 3W5NA 1PIV3 1AL22 1LJ7A 3WF2A 1JXNA 2ZGMA 1QJX2 1RTVA 3GYDA 3VHRA 3VDCA 5A3NA 1C3HA 2K2SA 1Z7S2 1V6JA 1VALA 1RUI2 3TB0A 3UKTA 3WDVA 2JKXA 1RITA 4WVMA 2XJPA 3G6JB 4XAAA 1YQCA 1ND2C 2WO1A 3BALA 5GZFA 4CCCA 4IEWA 3T4VA 1C1FA 2B9VA 4WZFA 5IK4A 2VUAA 3HBZA 1F15A 5A33B 5A3LA 3N9LA 4DFSA 1Q56A 4CRQA 3H8OA 2ATFA 3OTFA 1OI6A 1YFWA 3AK0A 3NQHA 4XJAA 5L9BA 3IN9A 4DXTA 1YFUA 4C91A 2JDMA 4LLOA 4XHBA 5FYUA 1OA2A 3AMQA 3C3VA 3O1RA 4IEQA 1NXMA 2ZGRA 1H2LA 2EA7A 4AVCA 3LPFA 1EYBA 5IVYA 2VR4A 5FOBB 4BE3A 1HB3A 3WY6A 5HI0A 1YUDA 1YNAA 4YFZA 2WNUB 3M3OA 1H2MA 4A42A 3C7GA 2GH8A 4RGAA 1WW5A 3PUAA 4AR2A 2WSUA 1KGYA 5JOYA 2GNTA 2X5IC 4Y24A 2R041 2JD9A 3NVCA 1SBEA 2JJ6A 2XJUA 4AOCA 4CCNA 4DY3A 2XWBB 4CEYA 4CE8A 5FPZA 4D0QA 3UKNA 5D8AC 2JEMA 3ZSLA 1WA6X 3ZOIA 4E9KA 4Y1VA 1N1YA 1PO13 1WWYA 2YU1A 2RR13 2XVLA 4IL7A 1NX9A 4EWEA 1ZRRA 2OZJA 3AVSA 1C5IA 1OT5A 1U12A 4L9BA 3J8F1 5CZKA 5M0TA 3FUQA 4QPGA 4JZRA 5BPXA 4FPGA 4CDUC 5BNQA 1MS1A 4MH0E 1JZ6A 1UD1A 3AKRA 5EJ3A 2BU9A 1RUJ3 2GC1A 1S0EA 1ZRIA 2NN8A 2W0XA 3OUJA 3HPNA 3VBHA 4C8DA 4CU7A 5E88A 4GJYA 1HJGA 2E7TA 2OIIA 4W8JA 5LW9A 4GWIA 3PJQA 4AGRA 5CAZA 2HBUA 4LO4B 3THDA 1CJPA 1RMU2 4M00A 1GWMA 2DCYA 3RNSA 1GOFA 1W8NA 4AVAA 2DVBA 4CYDA 3VZMA 5D1IA 4GAZA 1WLTA 2VTFA 3ZX7A 1GKBA 2BFUS 5FTTC 2W3JA 3KHBA 5LY2A 5FJHA 5GZGA 4FOWA 5K7PA 3ZFEB 3ZFFA 1TG7A 1G86A 1QDOA 1SLIA 5FWJA 2FMYA 1KJLA 2HWC3 2VBDA 3PVEA 1SLLA 3CJIB 3N7LA 4ISQA 3T30A 1OVSA 1OLRA 4R4ZA 2FHRA 1GBGA 2Z79A 4FPHA 3WCRA 4YNIA 1DLLA 3ZN4A 5IHRA 5C3OA 3FLTA 3ES1A 1VIWB 1W8TA 3OPTA 4FOVA 3WLUA 4A45A 2VAUA 2DUPA 2EIBA 4AEDC 1LODA 1POV1 1W03A 3Q8BA 3RMYA 1UMZA 3VBRB 2YBSA 3OB8A 4N9IA 1RUNA 3MDPA 1Q8VA 3OSDA 4IEXA 1ZZBA 4RD7A 1F2NA 2WWSA 4QGMA 1XNKA 3MF6A 2HWB3 2Q1ZB 3DKQA 3J7MA 3M3CA 1VMFA 3BTZA 2RJ2A 2WABA 5J09A 3P1IA 5IYYA 3MEPA 4LE4A 2G4IA 1C57A 3I2FA 5FYBA 4XJ8A 4JV4A 2WUHA 4AAPA 4NR1A 2YU2A 4BQ4A 2JE8A 5JZGB 3LDKA 3RRDA 5A1FA 1WCKA 1XBFA 2QDRA 4N53C 1JZ7A 4AFBA 4CUBA 2ZABA 3LF7A 3PUIA 2EICA 1ASJ3 2H6CA 1GQHA 1AL0G 1J59A 2XL9A 4NUBA 1TZOA 4CU6A 5DAXA 4WVZA 5DDJ2 3WT3A 2VMHA 2QNKA 1HQWA 3F95A 4UOJA 3JU9A 5A32A 4LA3A 5AC93 1ACCA 5FYIA 5A3MA 2VMCA 1AJOA 2GALA 4LXLA 4BU2A 2QQKA 1IS5A 4NPRA 4DO0A 4ZZ5A 3RZMA 4BISA 1MVEA 5FZAA 3K4ZA 3RFRA 3VBUB 3K4AA 1S2EA 1SCRA 3V56A 2ZHKA 3VZOA 1GICA 4YVSA 1G6NA 5DDJ1 4HANA 3ITQA 4P9WA 3HN1A 2FQPA 1CAXB 3DPRC 4LKFA 4SLIA 3IDEA 5C5TA 4YM0A 1OC1A 2EXIA 4X8PA 3IWZA 4XILA 5LEJA 4IEOA 5CG9A 3MUY1 4GH4B 4JGZA 3B00A 5HV0A 3KV9A 4IE0A 2C24A 5L7OB 5FIXA 4DZGA 1BEV1 3SMHA 5CB7A 5C3SA 3MUZ1 3HOBA 1AXZA 1Q8QA 1VAKA 1WMEA 3HMYA 3UV9A 4AI1A 3GJBA 4ZXEA 2WS92 2ZJCA 3AL5A 4MGYE 5ACA2 4QKFA 1NCRB 2VMEA 4DB5A 3K4DA 2DWRA 3VBFC 4FO9A 1WMFA 5CFCC 5AVPA 1DZQA 4WM8B 3MIGA 4COUA 1UZ0A 5IATA 1XNBA 2DDUA 4PF5A 2DFBA 4QX0A 3CHXA 1AXKA 3CO2A 1YC61 4JHTA 5GJ6A 5IUQA 5A1AA 5L9VA 1JI6A 3I3DA 3HNYM 1FAYA 1RHI1 2VNVA 4LHKA 4MSVA 4BQWA 1UMHA 1W6PB 4NWVA 3THCA 5HPOA 4YG0A 1OA4A 2DBNA 1GZ9A 2WS91 3ZSEA 3EQEA 1MS5A 1CAVA 5KXDA 1GP6A 1SMVA 4QMAA 5JI7A 5LASA 1IKQA 1H8TB 5JLVA 3KV6A 5LBCA 2R043 5A7NA 4E8DA 4LBQB 1GOHA 4Q2FA 2QQNA 4LR4A 4QHZA 5AFBA 1VJ2A 1Q8PA 1DQ1A 4IE4A 4NHYA 1OD5A 1XC6A 4CTEA 5LK7B 3CQOA 5FYVA 1QXRA 4K20A 4HVQA 3CEWA 4PDWA 1VBB2 2IVJA 2Z69A 1DZRA 2GZWA 4FPCA 3ZXEA 1LOCA 1HLCA 5JPMB 3J8F3 2ZBJA 3BVCA 3JQXA 3QCWA 5F6LB 2ZX0A 3O1VA 4RQPB 3DXUA 3JQWA 5FUIA 3R6SA 3T4HB 4XJUA 3BPZA 5C7GA 1DGWA 3HT2A 5A80A 3FL7A 1HB1A 1RUF2 2PELA 3SH5A 3A0KA 4QQPA 1J3RA 1RVF2 1VBB1 4D3WA 2WWUA 2D44A 5EYXA 1SG3A 1C28A 2XKPA 1HRI2 4M0HA 1UF2C 2VGDA 4E2GA 2O0OA 2ERFA 5E89A 2WO2A 3BPSA 4LBNA 1ENQA 1DLCA 3ABZA 4IV1C 2VO5A 1GLHA 1YQ5A 4L0PA 2BWAA 1N3PA 5EV7A 5JDBA 4LIVA 1CJDA 2YFUA 4QXBA 4UFKA 3B93A 1NZCA 5FPAA 4DNYA 1RUF1 1PK6C 4N9HA 4I3GA 4CP2A 1CAWA 2E53A 4HKWA 1RVF1 1W8ZA 3ELNA 2W2IA 4GMP3 4NVPA 1S55A 2UU8A 2IFWA 4RS5C 3MICA 1G9BA 2AEZA 2A70A 2HWF3 1ZBE2 1CR7A 1O3TA 3UT0A 2CDOA 1W9TA 2JDHA 5IWFA 4QX7A 1QIQA 1V9U2 5FR3A 1RC6A 2OZ6A 2C6SA 2Y33A 1ZBA1 4IE5A 4W6YA 5APAA 2UY8A 5KBFA 2WL1A 5JR7B 2XJTA 2HWE1 5FZ1A 4HSJA 1JYCA 3AP7A 1T6GC 1S2KA 5DAVA 1YFYA 1IZ3A 4K9SA 4HPKA 4Z8BA 1QJY1 3ILNA 1G9DA 3HR9A 1ZBE1 2AGSA 2MEV2 2LTNA 2VZOA 3O0XA 5DUWA 4UFMA 2PHFA 4CP0A 1W8UA 5C8WA 4J25A 2ZGOA 1OOPA 2WNVC 1B35B 3RZLA 1W9YA 4Y1UA 5A70A 3U75A 3WDWA 3HBKA 3V0AA 2Y8KA 2R6QA 1OURA 3WNKA 1FMD2 4GULA 4IGPA 2VBPA 3C7EA 4QPIA 3O1PA 2BPA2 4LTAA 3LKJA 1PNGA 5BNNC 4CXYA 4HN1A 3UKVA 1JHNA 2AEYA 4C90A 4B4RA 3WVJA 2MEV1 5FZ9A 1RL3A 5L36A 4M4RA 4FVVA 1VBA2 4QKNA 3HEIA 1D4M3 2D3SA 1KXGA 3AXDA 3OUIA 3GZAA 3J9SA 4Q8LA 4OCTA 4CDXB 5BYNA 4MGZE 3PU8A 1PMHX 1HV1A 2VZQA 4UYBA 3WG4A 1BMV1 1NA1B 4GWNA 4IV1A 1W9WA 2QQWA 3LZZA 3H42B 4FPLA 1VAVA 4ZU7A 1QWRA 3FHAA 2VZVA 4O7XA 4WM7C 1S0GA 3KV4A 4UW3A 4YZ2A 4DEVA 1K5MB 1W8HA 1ULOA 4ASMB 2RS52 1AYM1 1N1VA 2LROA 2P3YA 4AHWA 2P6CA 2ZKLA 1W6NA 1VBA1 3DCQA 1HKDA 1I5ZA 2AZ5A 5C4WC 1BEV3 1XNDA 2JE7A 2DYCA 2WINB 2ZX4A 3WSOA 2ZGUA 1DQ6A 1KDMA 2A6VA 2D7FA 2R7EB 1VBE2 3IMNA 4NHLA 5FPLA 5L19A 3LA2A 3WF4A 4Q4V3 5A3UA 1Y4WA 5LA2A 3LE0A 1RUG1 4B7EA 4B4PA 4YW4A 4IE6A 2VMGA 3OBZA 3NW4A 2RDSA 3I49A 3UJQA 1LOEA 1GYKA 2JE9A 2VZPA 4ZPIA 2VUDA 2CYFA 3CU7A 4LA2A 3FMGA 2VQTA 3ZFGC 4CDWB 5CG8A 4GWMA 2PHDA 1AR73 2XJSA 1WCDJ 3I2JA 1WUVA 4GKXA 1RHI3 2W68A 4MUVA 4DIQA 1KRIA 4XVHA 2B45X 2RS13 4GA9A 3BIWE 5IAVA 4XHXA 4E4DX 1C8M2 2DCZA 1VBE1 2WS93 2VH9A 2PHXA 2PA7A 4YG3A 1W8WA 3FUOA 4AI2A 5BY5A 1UY1A 2WDBA 1H8VA 4A6SA 5GKAC 5IK8A 3MV11 3W9AA 3WW4A 1XOYA 2JX9A 1CQ9A 2AC1A 5FQ0B 4NN0A 3ES4A 5KHKA 2CDPA 4H2AA 3ZYFA 1JMUB 3X29B 5FYTA 3VKLA 3PMEA 2ORXA 1T6BX 3K75B 1S4CA 3I3QA 3NSTA 1WD4A 1LR5A 2HEYF 3M1HA 4XFHA 5FPBA 2RV9A 1C8M1 4IW3A 4L92A 4MX3A 2KR2A 5FZEA 5BNOB 4IV3C 3ZN6A 1XNTA 1Y9GA 2LS6A 3OGJA 4XACA 3NAPB 3JD71 5A3TA 1G8WA 2VZUA 4FPKA 5E16A 4QWNA 3N9MA 4CPBA 2ZGLA 3H1WA 4E8CA 4D8MA 1O91A 4CP1A 3UYJA 4Q29A 4MGSA 3NJZA 4EE2A 1W3VA 4P9GA 4WBBA 4NIIA 4B29A 4NIHA 5FZGA 5J1XA 4YVWA 1BKZA 1T2XA 5FBJA 1J1LA 3JUUA 3L2HA 4YGEA 5FPVA 3WOGA 3WX5A 1G7YA 2FBEA 3RZJA 5DPNA 2QCSB 3WR0A 3BU7A 4QX5A 1ZZ6A 3CDZB 4XDOA 3IPVA 4CCKA 2ZZQA 4FAGA 3O1OA 3OBAA 1OA3A 4Y33A 2UY9A 2XG3A 1H9WA 1NCQB 1PVXA 2ET7A 2Q4SA 4XAEA 5IW0A 2QQMA 3ILRA 3VKFC 2DCTA 3LFMA
chains in the Genus database with same CATH topology
4CXYA 5DABA 4ZS2A 4QKNA 4NIDA 3T3YA 4OCTA 3BI3A 3O1SA 4NRMA 3O1UA 4MG2A 2FDHA 4O7XA 4IE4A 2FDFA 3BKZA 3RZKA 4NIGA 4QHOA 3BTXA 3O1VA 3BTZA 3T4HB 4NPLA 3I3MA 3T4VA 4QKDA 2IUWA 3H8OA 3O1RA 3H8XA 3KHCA 3O1TA 4IE6A 3I49A 4ZHNA 4CXWA 4IE7A 4MGTA 2FDJA 3BIEA 4NRQA 3O1MA 3S57A 4CXXA 3S5AA 4QKBA 2FDGA 3RZHA 3RZMA 4RFRB 3BU0A 4NRPA 2FD8A 4NROA 3I3QA 4NJ4A 4IE5A 3H8RA 4O61A 4IE0A 3I2OA 3RZGA 4IDZA 4ZS3A 4QKFA 4NIIA 3BTYA 4NIHA 2FDKA 3RZLA 3RZJA 2FDIA 3O1OA 4NPMA 3KHBA 5F8PA 4JHTA 3O1PA 3BUCA 3LFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CXY A;  5DAB A;  4ZS2 A;  4QKN A;  4NID A;  3T3Y A;  4OCT A;  3BI3 A;  3O1S A;  4NRM A;  3O1U A;  4MG2 A;  2FDH A;  4O7X A;  4IE4 A;  2FDF A;  3BKZ A;  3RZK A;  4NIG A;  4QHO A;  3BTX A;  3O1V A;  3BTZ A;  3T4H B;  4NPL A;  3I3M A;  3T4V A;  4QKD A;  2IUW A;  3H8O A;  3O1R A;  3H8X A;  3KHC A;  3O1T A;  4IE6 A;  3I49 A;  4ZHN A;  4CXW A;  4IE7 A;  4MGT A;  2FDJ A;  3BIE A;  4NRQ A;  3O1M A;  3S57 A;  4CXX A;  3S5A A;  4QKB A;  2FDG A;  3RZH A;  3RZM A;  4RFR B;  3BU0 A;  4NRP A;  2FD8 A;  4NRO A;  3I3Q A;  4NJ4 A;  4IE5 A;  3H8R A;  4O61 A;  4IE0 A;  3I2O A;  3RZG A;  4IDZ A;  4ZS3 A;  4QKF A;  4NII A;  3BTY A;  4NIH A;  2FDK A;  3RZL A;  3RZJ A;  2FDI A;  3O1O A;  4NPM A;  3KHB A;  5F8P A;  4JHT A;  3O1P A;  3BUC A;  3LFM A; 
#chains in the Genus database with same CATH topology
 5EPA A;  2P3J A;  5A3W A;  3S7I A;  1D0H A;  1JZ3 A;  4IXL A;  4LOS A;  3MIE A;  1KS5 A;  5IK7 A;  2C1F A;  3WQ0 A;  1CIW A;  4BQ5 A;  3PUR A;  2JG9 A;  5IK5 A;  2EIE A;  2Z2S B;  1VBD 3;  2VVE A;  4QB1 A;  3QBQ A;  5F5C A;  4OI0 A;  2OPK A;  2W52 A;  4URT A;  1D2Q A;  1ND3 A;  5FMB A;  1JBC A;  1W6Q B;  4TLF A;  4CU8 A;  1VRH 3;  4XTP A;  1ULC A;  2ZOE B;  1W6O B;  1AR8 2;  1STM A;  3BKZ A;  1TEI A;  1QKQ A;  1TE1 B;  5DZF A;  4OUM A;  1ZBA 3;  4RGG A;  3RS6 A;  2ZGP A;  3WQ1 A;  1TME 2;  1LOA A;  2VE1 A;  2OYZ A;  5ABJ A;  1UZZ A;  4QB2 A;  4BZ4 A;  3DN7 A;  1AX2 A;  2HWE 3;  1UU4 A;  4QX8 A;  3VDD B;  4FTB A;  2VW2 A;  3I2D A;  3POB A;  2XKO A;  1LEC A;  1N3Q A;  4DIN B;  1W9S A;  2CAU A;  3OBR A;  2XGX A;  1DP0 A;  2B7Y A;  1QJY 3;  4UFJ A;  1L7Q A;  2VEC A;  1DG6 A;  4O9E A;  1ZBE 3;  2VQU A;  2A71 A;  5FYY A;  4ZU4 A;  1WMD A;  2DUQ A;  1AR8 1;  1R09 3;  4N43 C;  4JGY B;  3QD6 A;  3H8X A;  3N3H A;  4I0W B;  1RUD 3;  2LAL A;  1HB4 A;  3DF0 A;  4P02 B;  2QQJ A;  2WA4 A;  1KIT A;  1V6K A;  3P5B A;  4XJ9 A;  2QQU A;  1QMJ A;  2I07 B;  2VZT A;  3I54 A;  3CJX A;  2VMF A;  3LEM A;  4OYU A;  2MEV 3;  5FYC A;  4Z2W A;  3FFZ A;  5KXB A;  3HIF A;  4YM3 A;  5K9Y A;  5F5I A;  2NM1 A;  1GQG A;  1NKG A;  3W21 A;  3S57 A;  1YLL A;  4CDQ B;  3KCX A;  3WD5 A;  2X09 A;  3VBO A;  4JKL A;  1W8F A;  3NNG A;  4PBP A;  1SPP A;  1GNH A;  3LSE A;  3I3E A;  3VZJ A;  3POJ A;  3E6C C;  1H30 A;  3D0S A;  4XFA A;  1YXW A;  2GME A;  1UY0 A;  3PTR B;  3WV6 A;  4FCA A;  3TEZ A;  2J1U A;  2OW4 A;  3K3O A;  4KMQ A;  4AW7 A;  2XLG A;  4FPY A;  4QAW A;  4NJ4 A;  4LBQ D;  2L9L A;  1AYM 3;  3POG A;  2DCK A;  4AVS A;  4O61 A;  3T0D A;  4ZY9 A;  3J7L A;  3H9A A;  5K0U C;  4P5H A;  1K12 A;  2PAE A;  3ZYR A;  2JKB A;  2PMW B;  3LAG A;  1WGP A;  3TRS B;  1LES A;  4MO3 M;  2ES3 A;  4GIQ A;  3SH4 A;  5I0U A;  2GMP A;  3NJV A;  5A7P A;  2BEO A;  1MPX A;  2CTV A;  1X9P A;  4TWT A;  5HCB A;  2YV8 A;  3OGV A;  4BA6 A;  4UBH A;  5FZ8 A;  4DXS A;  3DV8 A;  2WZE A;  1WW6 A;  1Z78 A;  4LKE A;  5FUP A;  5FBZ A;  2KM2 A;  4GKY A;  3H3Z A;  3VBS A;  1EAH 1;  3RZZ A;  1SLT A;  2R30 A;  5A6Z A;  1BJQ A;  1YCI A;  2HBT A;  3D5O A;  1Y9Q A;  2CL2 A;  2YXS A;  2XL7 A;  1GR3 A;  3I59 B;  1RUG 3;  4P9I A;  5FZO A;  1DYP A;  2OKX A;  1PVC 2;  3OGR A;  3GZT B;  4MZU A;  3ZPY A;  3RYK A;  1DQ5 A;  5CFD A;  5JI9 A;  1XPW A;  4BQY A;  1JZ2 A;  4I01 A;  5D2A A;  3J7H A;  3NJY A;  1UY4 A;  4S2F A;  2DVD A;  2ILM A;  2FCT A;  5FKC A;  1AR9 1;  4XFB A;  3OPW A;  4AHX A;  2AAC A;  2D6N A;  4BLI A;  4MLO A;  4CEW A;  3O1S A;  2BGC A;  1NQD A;  4GMP 0;  3WDT A;  2E6V A;  1IQA A;  4IQP A;  4XET A;  4EN6 B;  1E57 A;  1PVC 1;  4QGN A;  1YHF A;  2W9X A;  1CAU B;  1RUC 2;  1PO2 2;  2VMD A;  1QJU 1;  3OD0 A;  5F3I A;  1DHK B;  4YYO A;  4AEJ A;  3THP A;  4BQ3 A;  1W05 A;  3VDB A;  2FDF A;  1SDD B;  3MW3 A;  2E51 A;  1JN2 P;  2XDV A;  3U07 A;  3HQR A;  5LEK A;  2A6W A;  3ACL A;  3FWE A;  1YQ2 A;  3NNM A;  1BZW A;  1UXZ A;  2VZS A;  4QHO A;  4DRR A;  1RED A;  1VLN A;  5ANQ A;  4CEY C;  1WCQ A;  2FZ2 A;  3A7Q A;  5FZ0 A;  1V6I A;  3N9O A;  3JD7 3;  5DUX A;  2PQS A;  2VZ3 A;  3NO8 A;  5J3U A;  4ATE A;  2G1M A;  3KGZ A;  3ST7 A;  4QKD A;  4AWD A;  2ZZJ A;  3GJA A;  2QTW B;  2Z5W A;  1KFX L;  4AFC A;  4RHV 2;  1MZF A;  4QPG C;  4QXH A;  1QQP 2;  2K46 A;  2A6X A;  1IPK A;  2Q1M A;  4A3Z A;  1UOJ A;  1ZA7 A;  4V1P A;  3PLQ A;  3SH3 A;  2E7A A;  4OUS A;  4FFI A;  1FYU A;  1K45 A;  3VBH C;  2AR6 A;  4QU2 A;  4QGL A;  4R9A A;  1PM4 A;  2WFF 3;  5FZF A;  3Q9O A;  2P4E A;  4YW3 A;  5FXW A;  4HET A;  5LBE A;  5C9A B;  1EP0 A;  4OFG A;  4XIO A;  2KXL A;  1GAN A;  4LO6 B;  1IPJ A;  3WP3 A;  4COV A;  4FPE A;  1JHJ A;  1QQP 1;  3GAL A;  3H7Y A;  4UFL A;  4RR3 B;  1LRH A;  3VKM A;  1A78 A;  1RUH 3;  4TSV A;  2XVK A;  4XUT A;  3U10 A;  1W90 A;  1FT9 A;  5JIU A;  2OQ6 A;  3OOX A;  3NNL A;  5FZ4 A;  1UYX A;  2VVD A;  4K6B A;  5A33 A;  1XYO A;  3OF1 A;  3UES A;  4UAP A;  1V0A A;  1AL2 1;  4RFR B;  3RJ2 X;  3WP5 A;  3ZFF C;  4ERO A;  1HN0 A;  3KZ4 C;  1AVB A;  5GLU A;  1QJX 1;  5C8C B;  1VMJ A;  3HQU A;  1Z7S 1;  4K1Z A;  1RUI 1;  3FE5 A;  2BGO A;  4V2W A;  3QLQ A;  5JPN B;  1EV1 2;  1W2O A;  3KM5 A;  5CIS A;  4BDV B;  1JU3 A;  3AZX A;  1ZZ9 A;  1UO9 A;  1ZRF A;  3N35 A;  2IXK A;  1BBT 2;  2WNU A;  4BQ2 A;  3IMM A;  4BME A;  2OT7 A;  3ZXA C;  4ES9 A;  3V0B B;  3T08 A;  4KNC A;  5EJZ B;  1PX3 A;  1MS9 A;  1O5L A;  2YB7 A;  2NZ9 A;  3I8T A;  4LE3 A;  3WNL A;  3VD4 A;  3HWJ A;  1FNY A;  5A7W B;  2FDK A;  2W95 A;  2QUO A;  2WRA A;  4KU7 A;  5EP9 A;  1EV1 1;  1OPM A;  3ZYP A;  4NE9 A;  2N7G A;  4RL7 A;  5DN2 A;  3O0V A;  2IXH A;  3LPG A;  4NPM A;  4P5Y A;  4X6Q B;  1OQD A;  3ACG A;  4BHP A;  1QU0 A;  4OQ8 A;  4RYD A;  1YIP A;  4HON A;  1BBT 1;  4CCM A;  1SLB A;  2TBV A;  1RIR A;  2QQI A;  3NV1 A;  4ZS2 A;  4OQ9 A;  3ZDV A;  4EWD A;  2WN2 A;  3MZH A;  3N9N A;  1X7N A;  3AMP A;  1BVV A;  5BNP B;  4FFG A;  1IS3 A;  1YO8 A;  1FPN 2;  2K9Z A;  4OHX A;  5GM0 A;  4W50 A;  2X29 A;  3TN9 2;  3NNJ A;  2ZXQ A;  1H1I A;  5C3Q A;  3GGL A;  1ODN A;  2J42 A;  3VHP A;  4Q5O A;  4E4Z A;  1VMH A;  2BNM A;  4FTS A;  1NXD 1;  2H6B A;  5H9P A;  2ZX1 A;  4CP9 B;  5L73 A;  2HYK A;  3ON7 A;  3MFA A;  5J37 A;  1SFP A;  4JTO A;  4XF1 A;  2PAK A;  3WF0 A;  3ZFE A;  3ZXG A;  2GU9 A;  3LEG A;  1FPN 1;  1Q5O A;  2BOJ A;  1OH3 A;  2C9A A;  2Y6L A;  4YVS C;  1XNC A;  2CY6 A;  3WW2 A;  2ZGN A;  3TN9 1;  1RMU 1;  1ZZ7 A;  3CJI A;  3FJS A;  3NV3 A;  4KI5 M;  3AFK A;  2NYY A;  1PMI A;  5FJK A;  3KS7 A;  4JGZ C;  3N7K A;  3AKQ A;  2J1V A;  1ND2 B;  5LCW L;  5IVB A;  1EAH 3;  2JDN A;  3TEX A;  3M8L A;  2DUR A;  4CPB D;  1NQJ A;  4V2V A;  1H2K A;  2J1R A;  5CNA A;  5FV3 A;  3PUQ A;  4UWD A;  2QQV A;  4JDM A;  4CUC A;  1R08 2;  1CZS A;  2GC3 A;  3M3Q A;  4RGK A;  3W59 A;  5FLH A;  1DYO A;  2IZW A;  2EIG A;  3VBR A;  1AYN 3;  2ZEX A;  3MLL A;  2Z42 A;  3I2I A;  3N36 A;  3LGR A;  3CZU A;  2JDA A;  1BLZ A;  4UW5 A;  2VPV A;  4PLM A;  1D2S A;  1F9K A;  2VQ0 A;  1MEC 2;  2XON A;  3KT7 A;  4EWA A;  4F83 A;  4YGC A;  2FDJ A;  1AR9 3;  5FP7 A;  4XMI A;  3PVN A;  2V4V A;  4BB3 A;  2A7A A;  4GD4 A;  4MYE A;  1MS0 A;  4BM8 A;  4YAR A;  3QAC A;  2WAA A;  2VW1 A;  1L7R A;  1UKR A;  3MIF A;  2YFZ A;  1R08 1;  1TQ5 A;  2JB8 A;  1HV0 A;  5JZG A;  2JDZ A;  3MYX A;  2BGP A;  1PVC 3;  1UY2 A;  3E6B A;  4DMI A;  1WA4 A;  4GB3 2;  3FBY A;  2PHU A;  5F5A A;  2Q8O A;  1LB2 A;  2X5I B;  1QJU 3;  3OG2 A;  1MS8 A;  2FD8 A;  1LHO A;  1UOB A;  1AR6 3;  5FYZ A;  1AUY A;  2HKX A;  2C9K A;  3LCP A;  3WG3 A;  4AEM A;  2P37 A;  3K3N A;  3H8R A;  1O3R A;  3BOW A;  3KMH A;  1MEC 1;  3U78 A;  4XFG A;  5J48 A;  1QOO A;  4FQZ A;  2JXA A;  2YPD A;  5D8A B;  1I1E A;  3I2O A;  2RM2 2;  3NNF A;  5F5Q A;  5F1R A;  2BQP A;  1XE8 A;  4Q4W 3;  3RGB A;  3AZW A;  3WG2 A;  4D7T A;  1KFU L;  4PDW C;  3KCC A;  3TAY A;  4DOU A;  4LBK A;  4CDU B;  4JCK A;  3RVH A;  4Q4Y 2;  2XBO 2;  2W1W A;  3BN6 A;  5JOW A;  4CA9 A;  1PNF A;  3NV2 A;  5JIA A;  1DU3 D;  3ZXF A;  5KC5 A;  1G9C A;  5I0R A;  4EN8 B;  2D97 A;  2DCJ A;  3VBU A;  3S30 A;  5DUU A;  3O14 A;  3TYJ A;  1QH7 A;  4XXA A;  2FDI A;  1UYZ A;  1OUS A;  3R4S A;  3WQ7 A;  2ZAA A;  3DKW A;  1CAX A;  4NWW A;  3WNO A;  2FCV A;  1CVN A;  1HXS 2;  2ETE A;  2VU9 A;  1UL9 A;  4XTM A;  1EUT A;  4PCR A;  1IS4 A;  3GBG A;  3JBG 2;  4GH4 A;  4Y22 B;  5A3P A;  3ZYB A;  1COV 2;  1EPZ A;  1VP6 A;  3ENR A;  5L7O A;  2E7Q A;  2JWP A;  2R07 2;  2XBO 1;  4Q4Y 1;  2HEV F;  3ZXJ A;  1BQP A;  5J36 A;  4HFS A;  2LRP A;  1ENX A;  1OQ1 A;  2UUR A;  4XCB A;  1YJK A;  3LFI A;  4JKK A;  1I9R A;  3O0W A;  1JOP A;  4RFT 0;  1ZRD A;  4QB6 A;  4M0N A;  5FY8 A;  1AZD A;  2GDF A;  2FDH A;  3QOP A;  3W58 A;  4AXO A;  3UNP A;  2QDN A;  4LUK A;  4B1L A;  1AL2 3;  1NCR A;  1JYT A;  4D6Q A;  1HXS 1;  2P5B A;  2XLF A;  1V00 A;  1RXG A;  4HKO A;  4HK8 A;  2MNG A;  2BTV C;  1IQD C;  1QJX 3;  3NKG A;  4LO8 A;  3JBG 1;  4ZXK A;  2RJK A;  1Z7S 3;  2OVU A;  2WO3 A;  1RUI 3;  5JAX A;  4WM8 A;  5EQU A;  3SEE A;  1H9P A;  3RZK A;  1JOB A;  1QJF A;  4E4S A;  4P14 A;  2JIC A;  3C2U A;  2R07 1;  1QH6 A;  4M4P A;  4N7U A;  3AYA A;  3DUI A;  5IVF A;  4AED B;  2GP5 A;  3VV1 A;  2F4P A;  1W6P A;  2EID A;  1HIX A;  3ME2 A;  5ACA 1;  1J3P A;  4AI9 A;  5IFP A;  3OGG A;  3AP5 A;  4H55 A;  2YMZ A;  4A7Z A;  1GSL A;  4AYU A;  2CV6 A;  2ADE A;  1K42 A;  1H8T A;  2IWG B;  4LBQ A;  4IER A;  4LK6 A;  5IVE A;  2VBB A;  3H3U A;  1LOB A;  4LO7 A;  3KVA A;  3INA A;  4PF1 A;  3ZSJ A;  2QZ2 A;  2VOV A;  2YUE A;  3D4K A;  4UFI A;  3AJY A;  5G05 L;  5CA6 A;  3IAQ A;  2QVS B;  4JQT A;  3ZSM A;  2WYF A;  3DYO A;  4CCO A;  1U5X A;  2FCU A;  1F4A A;  2CGO A;  2PAM A;  3DEC A;  4N53 B;  2B5H A;  4K7J A;  4KU8 A;  4ZU5 A;  1VPH A;  3D3A A;  4AI8 A;  4LBJ A;  2P3I A;  1APN A;  3NWK A;  1OOP C;  4L8Q A;  3S0M A;  4XBQ A;  4NHK A;  4RQP A;  3WHT A;  1QEX A;  1RUO A;  3MPP G;  2W39 A;  3VL8 A;  3EYP A;  3O1M A;  1G9A A;  1S0F A;  3LIG A;  5C3P A;  4QPI C;  4QKB A;  4YWA A;  2RG4 A;  2Y60 A;  1M4W A;  2XJR A;  2DF7 A;  2BBV A;  1ULG A;  2JG8 A;  3FHQ A;  3SKV A;  3WXP A;  2HWD 2;  2GAU A;  3B02 A;  3R4D B;  4AHY A;  3PVB B;  1MS4 A;  2V72 A;  1LEN A;  4QPY A;  1UN1 A;  4FXK B;  4LBM A;  3S5Q A;  4HG6 B;  2BVB A;  1XRU A;  4G3Y C;  1UAI A;  4L11 A;  1H1M A;  2QE3 A;  4HKL A;  4LHN A;  5FYH A;  3DPR B;  2W91 A;  3WP6 A;  1KS4 A;  1QY4 A;  1O4T A;  2JIJ A;  4H7M A;  4IEY A;  5FZM A;  3UL2 A;  4AQ6 A;  4AVV A;  5LRS A;  3RZG A;  1UNB A;  3VZL A;  3L2Y A;  3MHZ A;  5FP3 A;  4L97 A;  3SC7 X;  3A21 A;  2DFC A;  1IG3 A;  1RMU 3;  3VUO A;  1IHM A;  3AMM A;  4KH9 A;  3EB7 A;  4AF9 A;  1HRI 1;  1W3X A;  2A3Y A;  3Q8F A;  2WNE A;  4D7Y A;  1ZVF A;  4R9B A;  1DYK A;  3ZDS A;  1IGO A;  3BB6 A;  1LOF A;  2WT1 A;  3GZE A;  4BQ1 A;  4UW6 A;  4OVE A;  1NLR A;  1J83 A;  1PZ9 A;  1VBC 2;  4S2D A;  5FK8 A;  1I3H A;  1POV 3;  3USU B;  3VBF B;  1X33 A;  1YQ6 A;  5DAW A;  2I74 A;  5FY9 A;  1O3Q A;  5CFC B;  4PHZ A;  2R16 A;  1FV2 A;  1UZW A;  3PJY A;  3POE A;  2QKD A;  1PGW 2;  2I45 A;  2P6H A;  2VM9 A;  1DCS A;  2Y34 A;  1UIK A;  2XHK A;  4J6G A;  5GAL A;  3LDB A;  3O5S A;  2BWC A;  2BJS A;  1OHF A;  5GLT A;  4BJ0 A;  3C8X A;  3SQO A;  2G9F A;  1OQE A;  4QDQ A;  4FXG B;  1VBC 1;  4YW5 A;  4GQ7 A;  4BXS V;  2VMI A;  1V9U 1;  3MBW A;  2ZTN A;  2WJS A;  4DEQ A;  5DAP A;  3OY8 B;  1B35 A;  4Q4X 2;  1E5I A;  1R1A 2;  4Z2A A;  4Z92 B;  2VW0 A;  1PGW 1;  5EIY B;  4YRD A;  1H0B A;  2Y26 A;  4LBL A;  3RPQ A;  2IC1 A;  5BUV A;  1UIJ A;  2RS3 2;  2GP3 A;  2R06 2;  3NRU A;  1J84 A;  5GZE A;  1ZYB A;  4HK9 A;  5GLW A;  5H9R A;  2CSG A;  4UT5 A;  2G9Z A;  3R05 A;  1SZB A;  3KV5 A;  1BVP 1;  2WR9 A;  1TMF 2;  1U0A A;  2GSY A;  3IDB B;  5FMO L;  3RI8 A;  4CDX A;  2IUW A;  5F3G A;  4Q4X 1;  1GMM A;  5I8T A;  1R1A 1;  5FZH A;  5C71 A;  4I09 A;  1NA1 A;  4OLL A;  2X05 A;  4EZ4 A;  5JMO A;  1RUE 2;  4R4X A;  5FP4 A;  1FMD 1;  1UPS A;  2RJL A;  2VUL A;  2ZMK A;  4XF4 A;  3KSC A;  3ZM8 A;  1US2 A;  3WF1 A;  5DDJ 3;  1N3O A;  1W39 A;  3N9Q A;  1K5M A;  2Q5T A;  2YGM A;  4AFA A;  1RJ8 A;  2R06 1;  2QQL A;  2SLI A;  1UQX A;  2GNM A;  4YM1 A;  3JCI A;  4FSJ A;  3EBR A;  2B9U A;  1F4H A;  1TMF 1;  2VL4 A;  4Y1X A;  4YVW C;  4URA A;  1N1S A;  4UI9 L;  3POW A;  4JDN A;  2YG0 A;  3EXU A;  1MQT C;  4Q4Y 3;  2D3P A;  5GZC A;  1VRB A;  2R0F A;  2PHT A;  4IV1 B;  4NRQ A;  3OUH A;  1RUE 1;  4ARX A;  2JEC A;  3WQB A;  4CXX A;  2PQQ A;  3E6D A;  2PLV 2;  2QZ3 A;  1PMJ X;  3ZSK A;  4E4H A;  3EHK A;  5CBL A;  3AMH A;  1PK6 B;  1GV9 A;  2RS5 1;  2DU1 A;  3KF5 A;  4JHZ A;  2XOM A;  3POY A;  4AVT A;  1LHW A;  1JYN A;  1S0D A;  3ACF A;  4Y1Z A;  2JG9 C;  1HRV 2;  3T1M A;  3TNP B;  1POQ A;  1DBN A;  4QM8 A;  5EWS A;  2GH2 A;  1EY2 A;  4RS5 B;  1E5R A;  4XQW A;  4Y3O A;  3K51 A;  2AYH A;  3AL6 A;  1ND3 C;  2WNO A;  4CCJ A;  4PIX A;  1UXX X;  1SBD A;  3OYW B;  4CDW A;  3FZ3 A;  4H7L A;  5KXC A;  4KQ7 A;  1S2B A;  4YFW A;  5EJ1 B;  2G19 A;  3T2P A;  3UGH A;  4LUL A;  1ZRC A;  2CGN A;  4XUR A;  4IDZ A;  5ACA 3;  4IEZ A;  2HLE A;  4K3U A;  4UXA A;  2Q8C A;  2V73 A;  3BOP A;  1CZT A;  3C7O A;  3J26 N;  3ILF A;  3KLS A;  5FY4 A;  5HCF A;  1ENS A;  3ZIW A;  5ABJ C;  3AXE A;  1HRV 1;  1W0O A;  2BNN A;  1O59 A;  5FQ0 A;  5E6H A;  4FPJ A;  5HXV A;  4Y5S A;  1GOG A;  2Y6J A;  3F2Z A;  2JEN A;  2H0V A;  3KT1 A;  1V6M A;  4YZ3 A;  5GLZ A;  1HW5 A;  3U0Z A;  4M3C B;  4MHR A;  1NLS A;  4YG6 A;  5F8P A;  4YW1 A;  1PM7 A;  1LED A;  5FXZ A;  4C0H A;  2WNV B;  1TNF A;  4YLZ A;  1Q43 A;  2JB4 A;  3CKH A;  2AH2 A;  4C1X A;  5BNO A;  2VTX J;  5T55 A;  2XXZ A;  3U14 A;  2VXJ A;  2YC2 A;  3LEI A;  5CYY A;  5SV5 A;  3NAP A;  1W6M B;  3WDU A;  4A4A A;  1QXP A;  4XC9 A;  2P1B A;  1REE A;  1N47 A;  4IEV A;  5BNN B;  2BDR A;  1FV3 A;  2P34 A;  3C7H A;  4LO5 B;  5FXX A;  5A3O A;  1OF4 A;  4I3P A;  1EPW A;  1UWW A;  2XLA A;  1YWK A;  1W04 A;  3H1M A;  1JYW A;  4KBB A;  5FMD A;  1M06 G;  2YY1 A;  1P8J A;  2OX0 A;  3MF9 A;  1GP4 A;  3ALQ A;  1MR5 A;  1VBB 3;  4Y26 A;  5JWP A;  2W87 A;  4KWU A;  1MQT A;  5IVV A;  2QJV A;  1V6O A;  3B9I A;  4UBG A;  5I0D A;  5DG1 A;  4CCD A;  3VN4 A;  3OPZ A;  1GUI A;  4MXW A;  2OA2 A;  1YI9 A;  1NCQ A;  4ISR A;  4GJZ A;  1A8M A;  1DGR A;  4WM7 B;  5T50 A;  3VBO C;  3Q8C A;  5HXM A;  4B1M A;  4BH9 A;  4HOO A;  2W08 A;  4BPZ A;  2D6O X;  4JQR A;  4Y20 B;  3KGL A;  3GHN A;  4DRV A;  2I2S A;  1RUF 3;  3OGS A;  1NT0 A;  3PUH A;  1ZRE A;  2BRT A;  1V6L A;  1OD3 A;  1RVF 3;  1E5S A;  2NMO A;  2XUE A;  5C4W B;  2P2K A;  2VCB A;  1HRI 3;  4UF0 B;  1KEX A;  4F7Z A;  3D82 A;  2ZA9 A;  2XML A;  1W6Q A;  3ZXD A;  3KHC A;  2HYX A;  1FXZ A;  3WDY A;  4BYY A;  4DQA A;  5HCA A;  5JMC A;  1W6O A;  4QQH A;  5JVV A;  1JZ8 A;  3G7D A;  4D6S A;  1XE7 A;  5EFU A;  1ZX5 A;  3VBS C;  4I02 A;  3GDB A;  2J7M A;  3WG1 A;  5FKB A;  3VDD A;  4KWK A;  4X8N A;  4MHU A;  2ZX2 A;  1FAT A;  5FPX A;  4K8F A;  3ZFG B;  3DYP A;  4L99 A;  3CL1 A;  5F3E A;  2PHW A;  3RYR A;  5CFD C;  4XCA A;  4F3J A;  2DTW A;  1LCL A;  5FZK A;  1PHM A;  3LQC A;  1X82 A;  3ZVX A;  1G9F A;  1V9U 3;  3FFQ A;  5F7U A;  2Y64 A;  1TME 1;  2ARB A;  2P17 A;  4JGY A;  1SFN A;  2J1A A;  1W8O A;  3ZPO A;  2IVI B;  1X8E A;  4CEW C;  1SAC A;  1PO1 2;  4G9S B;  2RR1 2;  4R52 A;  1F8V A;  1UYP A;  4IGQ A;  2A1X A;  2YC0 A;  4I30 A;  2VNR A;  3GCX A;  2WO7 A;  5FLJ A;  3WNP A;  2E32 A;  1YYN A;  1QJZ A;  4YM2 A;  5JCT A;  1E5H A;  2R1D A;  3FHI B;  1S0C A;  2DBI A;  1QNY A;  1AX1 A;  2JD4 A;  5FO7 B;  4YZ4 A;  5SV8 A;  1W0N A;  5CIR A;  3V64 A;  4IV3 B;  3WZ1 A;  3I2K A;  3JB8 A;  4CDQ A;  4C1W A;  1XB9 A;  4QM9 A;  1SLA A;  1DQ4 A;  3KB5 A;  3AYD A;  1PO1 1;  3WNN A;  1KQR A;  4D69 A;  3H8U A;  1FMD 3;  2ZHM A;  3JXS A;  5CKM A;  5J98 B;  1UW8 A;  4HLT A;  5HBA A;  4OUE A;  4HL0 A;  1MAC A;  4MOA A;  4SBV A;  3VGI A;  1VBA 3;  2UWC A;  3L9J T;  3POI A;  5LB6 A;  1Y3T A;  5E8A A;  2B46 X;  4KGG A;  4QQO A;  3AB0 A;  1HQL A;  1PX4 A;  1XQN A;  2XJQ A;  3C7F A;  3KWV A;  1L7L A;  2O8O A;  2WZ8 A;  4A7K A;  3MV0 1;  4NID A;  1H4H A;  1DF0 A;  1UZY A;  1O8S A;  1RUE 3;  4XJZ A;  1URX A;  3VL9 A;  4XUP A;  2VCM A;  2DV9 A;  1U5I A;  5I0T A;  4YW7 A;  2UYB A;  1CZV A;  3BYW A;  3III A;  5FO9 B;  2ZKN A;  4CVU A;  2RS5 3;  5ISL A;  5EYY A;  2R0H A;  4Q8K A;  1UCX A;  5DG2 A;  1GFF 2;  2WQZ C;  3I7D A;  3I59 A;  4IET A;  1GZW B;  4XPV A;  1LOG A;  2G9G A;  3MIB A;  4TXW A;  4M3C F;  4WVV A;  1OSG A;  3B69 A;  2Y38 A;  2ID4 A;  5BXX A;  2ARX A;  3ETP A;  3I2H A;  2WAO A;  4LQR A;  2WT0 A;  4XF0 A;  5F6K A;  5HV4 A;  1OXC A;  5LA1 A;  4JDO A;  4NIA A;  2QBX A;  4XUO A;  2HWB 2;  2QFE A;  4QX1 A;  5FFO C;  3H50 A;  4EYU A;  1WW7 A;  1VBE 3;  3ZMN A;  2VOK A;  2JIG A;  2JDP A;  1XJA A;  3GCW A;  1DIW A;  4AEK A;  4A7Y A;  3QH6 A;  5HCH A;  1A8D A;  1OPO A;  4ONU A;  4RA0 A;  4KWL A;  1SBF A;  4RSU A;  5FZB A;  5I91 A;  3GBW A;  3PL0 A;  5L9R A;  4XIK A;  4GXL A;  1CAU A;  4HZF A;  2WNU C;  1BCX A;  3LB9 A;  4JKM A;  3RYP A;  1ASJ 2;  1TVG A;  1POV 0;  3T2O A;  4AGV A;  2A73 B;  1C1L A;  2BFU L;  2HH9 A;  4P9Y A;  4PQ9 A;  3LOI A;  4N43 B;  3LD8 A;  1C8M 3;  4HMZ A;  5C33 A;  4NO4 A;  4XQD A;  2KA3 A;  5J96 B;  1GQP A;  2VY0 A;  3SEP A;  2OS2 A;  4TYS A;  3DL3 A;  1RUC 1;  1PO2 1;  3T0B A;  4AQ2 A;  2VUC A;  2Y6F A;  2EXK A;  3M2M A;  5FY1 A;  1ASJ 1;  2D43 A;  4H14 A;  1OH4 A;  1HN1 A;  3AC0 A;  3BTA A;  4LMF A;  4NRP A;  5FK7 A;  3ZYI B;  3IB3 A;  2K0G A;  3PMS A;  3DYM A;  1IPS A;  1O6U A;  4WV8 A;  5A1L A;  4IEP A;  3M4F A;  5KWR A;  3VD9 A;  2A6Y A;  4GAL A;  3CMG A;  3I3B A;  5F2S A;  2Q8D A;  4O9G A;  2V5D A;  5EZW A;  2YC4 A;  1QHD A;  2ADD A;  1CON A;  4AFM A;  2EF6 A;  1PGL 2;  1X50 A;  5FRA A;  5C9A A;  4AE2 A;  4PIY A;  3K48 A;  1FOD 2;  2YPJ A;  3KF3 A;  4Q26 A;  4RHV 1;  3KCY A;  1LHU A;  4B3N A;  2J1S A;  4FBF A;  5K0U B;  2WLP A;  3WNM A;  5I0S A;  4RR3 A;  4QD2 A;  4E2S A;  3NJX A;  4E2Q A;  4BXF A;  4ARY A;  3O7O A;  3ZFE C;  1XU2 A;  2ET1 A;  3MIH A;  1LU1 A;  4HN0 A;  4IGO A;  4HVO A;  3THT A;  4YGD A;  5B4N A;  5C8C A;  3J7N A;  3CJI C;  2RVA A;  3MLK A;  1LHN A;  1PGL 1;  1ULF A;  1AX0 A;  4NHX A;  2XQR A;  2Y0O A;  4WVM B;  1FOD 1;  5FY0 A;  4MVT A;  2JDY A;  2MPF A;  1OKQ A;  1RGS A;  1S0I A;  2EAA A;  3WW1 A;  1JH5 A;  3I4I A;  2YZ4 A;  5FY5 A;  3ORJ A;  5T5J A;  4COZ A;  3T3Y A;  2D3R A;  2E26 A;  1VB4 A;  2GC0 A;  3VBR C;  3ACH A;  4OHV A;  4BIF A;  1YRZ A;  2GMM A;  4AG4 A;  1WKY A;  3V0B A;  1SEF A;  3N7J A;  3RDI A;  1D4V B;  3SKJ E;  2R04 2;  5FO8 B;  4BWO A;  1AR8 3;  5KXE A;  3ZKY A;  4A2U A;  5A7W A;  3AZZ A;  3IDC B;  1JYV A;  3ZR5 A;  1TME 3;  2W5F A;  5EXO A;  4YW6 A;  3VZK A;  4NMI A;  4UFH A;  1CPM A;  1REF A;  1JTZ X;  1PZ8 A;  3D0J A;  4U2A A;  5F37 A;  3ZMO A;  5B2G B;  1RIN A;  5JZG C;  3HJR A;  3J8F 2;  3IAP A;  1BHG A;  3PIJ A;  2Y6K A;  3PTY A;  4N8M A;  4Q0P A;  1K5J A;  4HBN A;  3SNM A;  3VKO A;  1K3I A;  5BNP A;  3HNM A;  1LTE A;  4W6X A;  4CEY B;  4XQ4 A;  3TEW A;  1UX7 A;  3SIS A;  3AFG A;  3ACI A;  3FBM A;  3B7M A;  4IND A;  2ARC A;  2D6L X;  3LIH A;  1ULD A;  1DZT A;  5JXH A;  4O65 A;  5I8S A;  1O8P A;  1OLM E;  4AVB A;  3CZJ A;  2VUJ A;  3Q8E A;  4EQV A;  3T0A A;  4CP9 A;  1J1T A;  1Q8S A;  2ZGT A;  4QPG B;  2PFW A;  1FI2 A;  3AZV A;  3APB A;  3WEZ A;  2TEP A;  4JTN A;  5K4L A;  3U4S A;  1AJK A;  1H4G A;  3U37 A;  2W94 A;  3S7E A;  4Q27 A;  4FPO B;  4BK5 A;  4EJR A;  1MS3 A;  2CHH A;  1WLD A;  4FI9 A;  2CWS A;  3VBH B;  3VBU C;  5CAD A;  1XYN A;  3ZLI A;  4MGT A;  1AF9 A;  2RDN A;  3P3N A;  4K1Y A;  4YW2 A;  4OHY A;  4JRL A;  2OXB A;  3HT1 A;  2VJX A;  2WC2 A;  3KD4 A;  4KG8 A;  1IS6 A;  4P00 B;  2TUN A;  5DMY A;  1Q3E A;  3D6E A;  4GH4 C;  3UJO A;  1YFX A;  3V65 A;  4R8H A;  1ND2 A;  2PHR A;  4PI0 A;  5DQ0 A;  3WW3 A;  5L7O C;  3AZY A;  4COY A;  4PI2 A;  2BV4 A;  1BXH A;  2ARA A;  4Q0U A;  3VD3 A;  3WIN E;  2HWF 2;  2Y6H A;  4NRO A;  1SFY A;  4DY5 A;  4E27 A;  5FPU A;  1W2N A;  1LKN A;  2VZR A;  1F35 A;  4LEJ A;  1NYW A;  4Z1V A;  3S6P A;  3ZFF B;  2NP0 A;  2DTY A;  2GN3 A;  3EO6 A;  2Q1F A;  2WQ4 A;  1WLC A;  2Z4F A;  2VOX A;  1NCR C;  3SHR A;  1XYP A;  3E5Q A;  1WBF A;  3HD8 B;  3WUC A;  4GMP 1;  1UKG A;  2RHP A;  4LBO A;  4XBN A;  4ZKT B;  1CIY A;  4QQ2 A;  2VZ1 A;  3ETQ A;  4WM8 C;  4QT6 A;  1UX6 A;  1UYY A;  4XZP A;  1WMX A;  2D6P A;  1NLQ A;  2HWF 1;  2TNF A;  4I2O A;  2DVG A;  4DUV A;  4EN9 B;  4DXR A;  3WF3 A;  3FC0 A;  4J1X A;  1OKO A;  1J58 A;  2Q0A A;  1NZI A;  3VD7 A;  4ATF A;  2LW8 A;  5T5O A;  4BLJ A;  3LA3 A;  2X5I A;  3U1X A;  3VZN A;  4M01 A;  1HDK A;  2WT2 A;  5T3N A;  4QX3 A;  1QJE A;  4NAM A;  1H8T C;  4JX0 A;  1L3J A;  3VHN A;  1H1A A;  4DUX A;  3ATG A;  4HSL A;  4QX2 A;  1OVP A;  2LUW A;  4XW3 A;  5CVR A;  5D8A A;  3ZR6 A;  3CIH A;  1C4R A;  1KD7 A;  3HVD A;  1ZZC A;  1JW6 A;  2W1U A;  4LLF A;  3O1U A;  3AP9 A;  1D4M 2;  4GB3 1;  4M3C E;  4BQX A;  2FMD A;  3UET A;  5K8S A;  4EZH A;  1RB8 G;  1RUC 3;  1PO2 3;  1CN1 A;  4LHS A;  4CDU A;  3MLJ A;  5FCC A;  2UYA A;  3UGF A;  5C70 A;  2XH6 A;  3K77 A;  1ZM1 A;  2JDU A;  2W92 A;  1DDL A;  3MFC A;  1A3K A;  4RQP C;  2CU5 A;  1CWP A;  2EAK A;  4PT6 A;  2DU0 A;  4UW4 A;  2GC2 A;  4D6R A;  3ECQ A;  2RM2 1;  3PDQ A;  4N90 A;  5A32 B;  2D40 A;  2A75 A;  2R1B A;  2X53 S;  3MO4 A;  4OUL A;  2JG8 C;  4Y22 A;  4XF9 A;  1D4M 1;  1GZT A;  2DUO A;  3I3M A;  2UWA A;  5I8Y A;  3OBT A;  4Q0S A;  1Y7B A;  1W2T A;  4RHV 3;  1BEV 2;  1QQP 3;  3ZYJ B;  4W4Z A;  5FWE A;  2QQO A;  3ZO0 B;  2O8Q A;  4BCU A;  2BER A;  3KVB A;  2XQX A;  4YVS B;  1LU2 A;  3TBD A;  5IVC A;  1U5Y A;  3SCF A;  3H0O A;  3H1Y A;  1W28 A;  1Q8O A;  3B3Q E;  4Q4V 2;  3MW2 A;  4JGZ B;  4GWJ A;  2D6K A;  1ODM A;  2WII B;  1COV 1;  2HEW F;  3PUS A;  4CUG A;  4ZHN A;  4LK7 A;  1MZE A;  3IKW A;  4WVW A;  1FOD 3;  5H9Q A;  3R0R A;  4OMD A;  3ZXL A;  2WWJ A;  5G04 L;  1QOT A;  1LOF C;  2D98 A;  1AR7 2;  4K40 A;  4AED A;  2VXR A;  1RHI 2;  4I0A A;  2RS1 2;  3IBM A;  5A7Q A;  4KGQ A;  2WA3 A;  4ES8 A;  1GWK A;  5KHG A;  5KHJ A;  3OD4 A;  2IFR A;  2XR4 A;  4XUQ A;  2SBA A;  4Q4V 1;  4AI0 A;  3PIG A;  3URF A;  4A6O A;  2BW8 A;  3BGA A;  4P9L A;  3BU0 A;  4Q1R A;  4MGI E;  5FY7 A;  3JZV A;  4PQQ A;  1EV1 3;  1UOG A;  2B4K A;  3HQX A;  4XBL A;  4LOR A;  3UK9 A;  1F31 A;  5C3R A;  2A3X A;  3AP6 A;  4OHZ A;  3B9C A;  1AR7 1;  3H3L A;  5KR7 A;  2JDK A;  2OUH A;  3EMR A;  2RS1 1;  4N53 A;  1OBN A;  1BBT 3;  4PIZ A;  1CAV B;  1UU6 A;  1B35 C;  4LIU A;  1W2A X;  2W46 A;  2C4X A;  4BK4 A;  5I93 A;  3KQR A;  3TWI A;  3USS A;  4QPW A;  1QOS A;  4BOW A;  5FYM A;  2XWJ B;  5DZE A;  3M3I A;  4Q0Q A;  3NV4 A;  4ZZ8 A;  4F8A A;  4Z82 A;  2ZEY A;  3N9P A;  1V70 A;  3JB4 C;  1ULE A;  2BVV A;  5LBB A;  4PDW B;  3DEM A;  2CGP A;  5T5P A;  1GU3 A;  1ENR A;  2V5Y A;  1LEM A;  5IVJ A;  4JVA A;  3M3E A;  4DS0 A;  2ZMN A;  4CDX C;  1A34 A;  1SCS A;  1X36 A;  1C8N A;  5DXD A;  3AMN A;  3MGU A;  4HVR A;  4P9J A;  2PXJ A;  2W47 A;  1NA1 C;  4HT1 T;  4JAA A;  4IES A;  4QXC A;  3U4X A;  3AM2 A;  4FP3 A;  2J22 A;  3DPR A;  2OQ7 A;  3IZO A;  1FPN 3;  4MAD A;  3WP4 A;  2WZP P;  1W99 A;  3AJZ A;  1K5M C;  1OLQ A;  1W06 A;  2WSV A;  3VD5 A;  3TN9 3;  3BI3 A;  2HWD 1;  2JG8 B;  2IXI A;  1VBD 2;  2OUJ A;  2ZML A;  2ORZ A;  3AVR A;  4FFH A;  2A5Z A;  2Q8E A;  4W6W A;  2BP6 A;  5AFE A;  4JRA A;  4L2N A;  2ZHN A;  2F6B A;  1VRH 2;  2WZR 2;  2ZS6 B;  2D93 A;  5FRE A;  3T1L A;  5JOZ A;  1CX1 A;  4CCL A;  5F9T A;  1Z0H A;  4N7I A;  3T2Q A;  3USU A;  4CZS A;  4XFF A;  3AX4 A;  3BTX A;  3VBF A;  2R49 A;  1ZBA 2;  4A41 A;  1MZ6 A;  2ZCW A;  1O4Z A;  3AKP A;  3LEK A;  2EAL A;  3VB9 A;  5CFC A;  1CAW B;  4S2G A;  2HWE 2;  1KDK A;  4Q1P A;  1VBD 1;  1S0B A;  1XU1 A;  4PJY A;  4AAX A;  5GZD A;  5F32 A;  2Y0I A;  2AUY A;  4OI4 A;  3M70 A;  1QGL A;  1QJY 2;  1XSQ A;  1JOD A;  2RDR A;  4LOT A;  1VE0 A;  4AZZ A;  3IT8 A;  4OZO A;  4ET7 A;  1DQ2 A;  1VRH 1;  2FZ1 A;  2WZR 1;  5A6Q A;  5IAX A;  4CDW C;  1R08 3;  3LSD A;  4FPF A;  3LOB A;  1SQ4 A;  1R09 2;  2A3W A;  5JUV A;  1X8M A;  4DXZ A;  3LDR A;  5LRR A;  5C6C A;  1HB2 A;  2NPI A;  3OY8 A;  3BUC A;  4Z07 A;  1S1A A;  5FP8 A;  1RUD 2;  2GND A;  3LWC A;  1OF3 A;  4R9D A;  2LM3 A;  1QNW A;  1MEC 3;  2GNB A;  2NMN A;  4HPK B;  4IE7 A;  4AQS A;  1W0P A;  1VR3 A;  4LJH A;  2PN5 A;  4OHW A;  1OLM A;  3TNQ A;  2C5D A;  4S2H A;  5JXI A;  2RE9 A;  5A7S A;  4B8E A;  5F39 A;  3HNB M;  1R09 1;  1WZX A;  1NG0 A;  1OOP B;  1WLW A;  2E9Q A;  4HXC A;  4QQL A;  4GB3 3;  5DZG A;  3RZH A;  1ULP A;  3W20 A;  1LAJ A;  1BMV 2;  3ZIX A;  1NE4 A;  3V0A B;  1RUD 1;  5BNO C;  5AVA A;  3DGT A;  2O1Q A;  1CD3 G;  4FP2 A;  4QPI B;  3NAP C;  5FXV A;  3PU3 A;  4BMB A;  5CU1 A;  1F5J A;  4LT5 A;  4LKS A;  4XXP A;  2RS3 1;  5FUN A;  5C5U A;  2RM2 3;  3DXT A;  3WDX A;  3OJB A;  2ZAH A;  4FOY A;  1AYM 2;  4ITC A;  4PLO A;  1U5Z A;  4XJW A;  3E1F 1;  2VVF A;  4IEU A;  4A3X A;  3WNX A;  4AI3 A;  4LHL A;  2W1Q A;  3RWK X;  1JU4 A;  1US3 A;  2XUM A;  1GNY A;  3P3P A;  1Y43 B;  2AEN A;  2XBO 3;  3MID A;  3P6B A;  1BK1 A;  1WBL A;  2HJI A;  4NHM A;  4P08 A;  1RJ7 A;  1O7F A;  2WFP A;  3E5U A;  4XF3 A;  3ZYG A;  3BTY A;  3ZN5 A;  1NCQ C;  4P9X A;  5LK5 A;  4Y5T A;  3ZKU A;  4K8R B;  5JSP A;  3NL1 A;  3UGG A;  4AL9 A;  1J3Q A;  1PK6 A;  2XJV A;  2F4L A;  2QQP A;  3E5X A;  1HXS 3;  2D5H A;  2VD7 A;  4MGK E;  4AFD A;  3ASI A;  3GBF A;  1W6N B;  3JBG 3;  5CKQ A;  2CNA A;  1RUG 2;  3A23 A;  3W5M A;  1COV 3;  4RS5 A;  3GM8 A;  4MGQ A;  1VB2 A;  2R07 3;  4XE9 A;  5J7M A;  5KHI A;  2BZD A;  4G4F A;  3O12 A;  3OYW A;  1JUH A;  1NAE A;  3ZYH A;  2PLV 1;  2RMU 2;  4LUM A;  5JXJ A;  1IKP A;  4A44 A;  5KHH A;  2WBK A;  4XEZ A;  2O14 A;  3BOD A;  4Y1Y A;  4MET A;  2B8M A;  5JSO A;  1WD3 A;  2VQA A;  2VC9 A;  3B5L B;  4Q0V A;  3IIA A;  4QDR A;  1MVQ A;  3VDD C;  2ZHL A;  4XYX A;  3TEY A;  2YRO A;  2EXJ A;  1UU5 A;  4CUA A;  1HX6 A;  1W9F A;  3SLI A;  4XUN A;  5GLV A;  4U36 A;  4COW A;  4M3C A;  2V09 A;  4NIG A;  1R64 A;  2RMU 1;  1CES A;  2ZEZ A;  4RN5 A;  1OMI A;  3HAG A;  2WNV A;  4FFF A;  1ZA4 A;  1GZC A;  4XFI A;  4NPL A;  5FP9 A;  1JZ5 A;  4JGY C;  5LBF A;  3GZU C;  1ALY A;  3VLB B;  3JD7 2;  1W6M A;  1NY7 2;  2VG9 A;  3GF6 A;  1R1Z A;  2XVG A;  1ZNP A;  2E63 A;  3I2G A;  5FZL A;  5BNN A;  3A22 A;  4PLN A;  1MZ5 A;  2XB6 C;  5B4X A;  4TLG A;  4FTE A;  2VOW A;  3A4U A;  1C5H A;  4KWJ A;  3O1T A;  1S0J A;  3B94 A;  1F5F A;  2NLR A;  3K46 A;  2XPJ A;  4CXW A;  2VOT A;  4W65 A;  1PIV 2;  2V4A A;  3RSJ A;  3N7M A;  3FX3 A;  3ZN6 B;  4AK3 A;  4CDQ C;  5FZC A;  3A0N A;  1H6X A;  2P3K A;  2VTX A;  4QXK A;  1TNR A;  2ZGS A;  2ZX3 A;  3KQ4 B;  4WM7 A;  1NY7 1;  5LWB A;  2WFF 2;  1YI7 A;  1WCU A;  3NMB A;  2Y6G A;  3BIE A;  4Y20 A;  3FN9 A;  1NE6 A;  2EVX A;  2PTM A;  4YZ1 A;  1I6X A;  2FDG A;  2VNG A;  4ZON A;  4YVW B;  4FAH A;  2HWD 3;  2DVA A;  1RUH 2;  3RI9 A;  5IT6 A;  4XOG A;  3POS A;  5C4W A;  1MQT B;  3EJK A;  3FLP A;  1UZV A;  4KG0 A;  4LPL A;  4OZX A;  2YBK A;  4GZ9 A;  3IPV B;  1UPI A;  1PIV 1;  4UF0 A;  2BBA A;  4R9C A;  1JUI A;  3ROU A;  3T09 A;  2D6M A;  4MXW B;  1N1T A;  3MI8 A;  3RWN A;  3PHM A;  4Y5Z 0;  3IDA A;  2ENR A;  2WFF 1;  5T52 A;  1SDW A;  2W1S A;  2ZEW A;  3HN3 A;  3J4U H;  2CAV A;  3B01 A;  5E1R A;  4EN0 A;  1VAM A;  5TSW A;  4YZ5 A;  5CEH A;  2JG9 B;  5FOJ B;  3PNA A;  5FMO S;  3KT4 A;  3U11 A;  4ASL A;  1BYH A;  3WUD A;  1RUH 1;  3CBN A;  3POF A;  4LIT A;  1UY3 A;  5LAT A;  1ND3 B;  5IFT A;  3M7A A;  3E97 A;  1RYY A;  4NOT A;  4ZS3 A;  3ZFG A;  1ONA A;  1DGR N;  1YEW A;  1O5U A;  2WZR 3;  3NKT A;  5FAX A;  5FZ7 A;  1VBC 3;  3SXW A;  3CLP A;  2BUK A;  3OEA A;  1BK0 A;  5JR2 A;  3R4U A;  5BV6 A;  1CX4 A;  4Y4Y A;  5ABJ B;  4J1W A;  2C26 A;  2IXL A;  4XAB A;  2E33 A;  1FX5 A;  1H2N A;  1YJL A;  3GHM A;  5ANN A;  2CWM A;  5DAB A;  1GNZ A;  2MHF A;  1O4Y A;  2WKK A;  1NOV A;  4PBO A;  5H9S A;  5FZD A;  2R32 A;  2BYV E;  5LA9 A;  2RDQ A;  2PHL A;  4NRM A;  2VCC A;  1YIF A;  1RUJ 2;  4MG2 A;  3RMX A;  1LGB A;  3T2T A;  5FLI A;  5A6X A;  3D8C A;  5FMC A;  4IV3 A;  4Q4X 3;  4ASK A;  4EV0 A;  1R1A 3;  2IXC A;  5LA0 A;  1IG0 A;  5F3C A;  1OFS A;  4FOQ A;  4QDS A;  2RR1 1;  4Y4R A;  1LGC A;  2KD7 A;  1D7P M;  3WCS A;  2A6Z A;  4AHZ A;  3CF6 E;  3FLR A;  2YHJ A;  4XDQ A;  1ST8 A;  2C0Z A;  2RS3 3;  4I0B A;  5CKN A;  2R06 3;  3SCG A;  1CGP A;  2ZPX A;  1XNA A;  5FDB A;  1JYI A;  4FT8 A;  1RUJ 1;  1TMF 3;  4DPN A;  1A6C A;  1QXJ A;  3VBO B;  1PZ7 A;  2HWC 2;  1FNZ A;  1SPP B;  4ORF A;  5FYS A;  4OI2 A;  4TZD A;  2YBP A;  1H6Y A;  4QU1 A;  5EHD A;  2E31 A;  4CCE A;  2OPW A;  3OCP A;  3N4M A;  1XE0 A;  2B39 A;  4XFC A;  2BNO A;  1LHV A;  2YGL A;  4BIO A;  5T54 A;  2GN7 A;  5C9A C;  4TN7 A;  1EAH 2;  1JZ4 A;  4K21 A;  3LA7 A;  1GP5 A;  1W2U A;  5F2W A;  1HQN A;  5FZ6 A;  1V6N A;  1HJF A;  1SLC A;  1GZW A;  4RR3 C;  3TOJ A;  3SCH A;  4KL1 A;  1AYN 2;  5KC6 A;  2HWC 1;  4B7K A;  3QH7 A;  3I97 A;  4DUW A;  1JS9 A;  2D5F A;  2X8K A;  3GXU A;  4QHB A;  4XMA A;  4JC1 A;  2PLV 3;  4X6R B;  5FZI A;  5C8C C;  2F17 A;  4TTG A;  5ERL A;  1B09 A;  1AHS A;  4MV2 A;  3VBS B;  3AKS A;  3S5A A;  1AR9 2;  1O3S A;  2IXJ A;  3BCW A;  3WHU A;  3VKN A;  3MPB A;  1HRV 3;  2YYO A;  1OFN A;  5FZO B;  5JOX A;  4OI1 A;  4D7S A;  2ZAC A;  3OEB A;  5CFD B;  1JYX A;  1AYN 1;  4H3W A;  2X10 A;  4XZU G;  1D0G A;  1QJU 2;  1AXY A;  4YPJ A;  4WZC A;  1AR6 2;  1WCS A;  2PYT A;  3AYE A;  1KJR A;  2H0B A;  2NQY A;  5JSR A;  1DFQ A;  5LZ6 A;  2HWB 1;  1RXF A;  3MW4 A;  4IUG A;  2RMU 3;  4AGG A;  4N43 A;  3AP4 A;  4CSW A;  2VCA A;  4MXV A;  5A7O A;  3IM0 A;  4CEW B;  4B4Q A;  5AC9 2;  1LUL A;  5A6Y A;  3AYC A;  1UOF A;  4AQT A;  3AKT A;  1DGW X;  2DVF A;  2Q30 A;  3K2O A;  4Q4W 2;  2WN3 A;  5IJR A;  2B42 B;  5T5L A;  2ARE A;  5FZ3 A;  1I5P A;  5DAQ A;  4FQ4 A;  3RG0 A;  1PGS A;  2WLQ A;  1XSR A;  5LY1 A;  1IOA A;  1JOJ A;  2XHN A;  4NAO A;  3RQ0 A;  4D94 A;  1AR6 1;  1DQ0 A;  4YGB A;  1GWL A;  1LGN A;  2YDE A;  2WQ8 A;  5DUV A;  1CPN A;  2EXH A;  1OUX A;  1SHW B;  5D21 A;  3ZXK A;  5BNP C;  1DGL A;  1QDC A;  1NUK A;  1XXN A;  4XDP A;  3SIT A;  5AC9 1;  4LNV A;  4CU9 A;  4KBZ A;  1EUU A;  2J1E A;  4C0B A;  4Q4W 1;  1UMI A;  3CNA A;  5JXG A;  1YQ8 A;  3Q8A A;  2J1T A;  2VNO A;  1X9T A;  2BOI A;  4YSF A;  1LNS A;  3VHO A;  2ZGQ A;  3GNE A;  4OMC A;  3H7J A;  5K0U A;  1ZZ8 A;  1Y9M A;  3VDA A;  2UWB A;  3RJR A;  2WYS A;  3PVO A;  4EN7 B;  1WW4 A;  1QF3 A;  4LKD A;  2ZGK A;  3W5N A;  1PIV 3;  1AL2 2;  1LJ7 A;  3WF2 A;  1JXN A;  2ZGM A;  1QJX 2;  1RTV A;  3GYD A;  3VHR A;  3VDC A;  5A3N A;  1C3H A;  2K2S A;  1Z7S 2;  1V6J A;  1VAL A;  1RUI 2;  3TB0 A;  3UKT A;  3WDV A;  2JKX A;  1RIT A;  4WVM A;  2XJP A;  3G6J B;  4XAA A;  1YQC A;  1ND2 C;  2WO1 A;  3BAL A;  5GZF A;  4CCC A;  4IEW A;  3T4V A;  1C1F A;  2B9V A;  4WZF A;  5IK4 A;  2VUA A;  3HBZ A;  1F15 A;  5A33 B;  5A3L A;  3N9L A;  4DFS A;  1Q56 A;  4CRQ A;  3H8O A;  2ATF A;  3OTF A;  1OI6 A;  1YFW A;  3AK0 A;  3NQH A;  4XJA A;  5L9B A;  3IN9 A;  4DXT A;  1YFU A;  4C91 A;  2JDM A;  4LLO A;  4XHB A;  5FYU A;  1OA2 A;  3AMQ A;  3C3V A;  3O1R A;  4IEQ A;  1NXM A;  2ZGR A;  1H2L A;  2EA7 A;  4AVC A;  3LPF A;  1EYB A;  5IVY A;  2VR4 A;  5FOB B;  4BE3 A;  1HB3 A;  3WY6 A;  5HI0 A;  1YUD A;  1YNA A;  4YFZ A;  2WNU B;  3M3O A;  1H2M A;  4A42 A;  3C7G A;  2GH8 A;  4RGA A;  1WW5 A;  3PUA A;  4AR2 A;  2WSU A;  1KGY A;  5JOY A;  2GNT A;  2X5I C;  4Y24 A;  2R04 1;  2JD9 A;  3NVC A;  1SBE A;  2JJ6 A;  2XJU A;  4AOC A;  4CCN A;  4DY3 A;  2XWB B;  4CEY A;  4CE8 A;  5FPZ A;  4D0Q A;  3UKN A;  5D8A C;  2JEM A;  3ZSL A;  1WA6 X;  3ZOI A;  4E9K A;  4Y1V A;  1N1Y A;  1PO1 3;  1WWY A;  2YU1 A;  2RR1 3;  2XVL A;  4IL7 A;  1NX9 A;  4EWE A;  1ZRR A;  2OZJ A;  3AVS A;  1C5I A;  1OT5 A;  1U12 A;  4L9B A;  3J8F 1;  5CZK A;  5M0T A;  3FUQ A;  4QPG A;  4JZR A;  5BPX A;  4FPG A;  4CDU C;  5BNQ A;  1MS1 A;  4MH0 E;  1JZ6 A;  1UD1 A;  3AKR A;  5EJ3 A;  2BU9 A;  1RUJ 3;  2GC1 A;  1S0E A;  1ZRI A;  2NN8 A;  2W0X A;  3OUJ A;  3HPN A;  3VBH A;  4C8D A;  4CU7 A;  5E88 A;  4GJY A;  1HJG A;  2E7T A;  2OII A;  4W8J A;  5LW9 A;  4GWI A;  3PJQ A;  4AGR A;  5CAZ A;  2HBU A;  4LO4 B;  3THD A;  1CJP A;  1RMU 2;  4M00 A;  1GWM A;  2DCY A;  3RNS A;  1GOF A;  1W8N A;  4AVA A;  2DVB A;  4CYD A;  3VZM A;  5D1I A;  4GAZ A;  1WLT A;  2VTF A;  3ZX7 A;  1GKB A;  2BFU S;  5FTT C;  2W3J A;  3KHB A;  5LY2 A;  5FJH A;  5GZG A;  4FOW A;  5K7P A;  3ZFE B;  3ZFF A;  1TG7 A;  1G86 A;  1QDO A;  1SLI A;  5FWJ A;  2FMY A;  1KJL A;  2HWC 3;  2VBD A;  3PVE A;  1SLL A;  3CJI B;  3N7L A;  4ISQ A;  3T30 A;  1OVS A;  1OLR A;  4R4Z A;  2FHR A;  1GBG A;  2Z79 A;  4FPH A;  3WCR A;  4YNI A;  1DLL A;  3ZN4 A;  5IHR A;  5C3O A;  3FLT A;  3ES1 A;  1VIW B;  1W8T A;  3OPT A;  4FOV A;  3WLU A;  4A45 A;  2VAU A;  2DUP A;  2EIB A;  4AED C;  1LOD A;  1POV 1;  1W03 A;  3Q8B A;  3RMY A;  1UMZ A;  3VBR B;  2YBS A;  3OB8 A;  4N9I A;  1RUN A;  3MDP A;  1Q8V A;  3OSD A;  4IEX A;  1ZZB A;  4RD7 A;  1F2N A;  2WWS A;  4QGM A;  1XNK A;  3MF6 A;  2HWB 3;  2Q1Z B;  3DKQ A;  3J7M A;  3M3C A;  1VMF A;  3BTZ A;  2RJ2 A;  2WAB A;  5J09 A;  3P1I A;  5IYY A;  3MEP A;  4LE4 A;  2G4I A;  1C57 A;  3I2F A;  5FYB A;  4XJ8 A;  4JV4 A;  2WUH A;  4AAP A;  4NR1 A;  2YU2 A;  4BQ4 A;  2JE8 A;  5JZG B;  3LDK A;  3RRD A;  5A1F A;  1WCK A;  1XBF A;  2QDR A;  4N53 C;  1JZ7 A;  4AFB A;  4CUB A;  2ZAB A;  3LF7 A;  3PUI A;  2EIC A;  1ASJ 3;  2H6C A;  1GQH A;  1AL0 G;  1J59 A;  2XL9 A;  4NUB A;  1TZO A;  4CU6 A;  5DAX A;  4WVZ A;  5DDJ 2;  3WT3 A;  2VMH A;  2QNK A;  1HQW A;  3F95 A;  4UOJ A;  3JU9 A;  5A32 A;  4LA3 A;  5AC9 3;  1ACC A;  5FYI A;  5A3M A;  2VMC A;  1AJO A;  2GAL A;  4LXL A;  4BU2 A;  2QQK A;  1IS5 A;  4NPR A;  4DO0 A;  4ZZ5 A;  3RZM A;  4BIS A;  1MVE A;  5FZA A;  3K4Z A;  3RFR A;  3VBU B;  3K4A A;  1S2E A;  1SCR A;  3V56 A;  2ZHK A;  3VZO A;  1GIC A;  4YVS A;  1G6N A;  5DDJ 1;  4HAN A;  3ITQ A;  4P9W A;  3HN1 A;  2FQP A;  1CAX B;  3DPR C;  4LKF A;  4SLI A;  3IDE A;  5C5T A;  4YM0 A;  1OC1 A;  2EXI A;  4X8P A;  3IWZ A;  4XIL A;  5LEJ A;  4IEO A;  5CG9 A;  3MUY 1;  4GH4 B;  4JGZ A;  3B00 A;  5HV0 A;  3KV9 A;  4IE0 A;  2C24 A;  5L7O B;  5FIX A;  4DZG A;  1BEV 1;  3SMH A;  5CB7 A;  5C3S A;  3MUZ 1;  3HOB A;  1AXZ A;  1Q8Q A;  1VAK A;  1WME A;  3HMY A;  3UV9 A;  4AI1 A;  3GJB A;  4ZXE A;  2WS9 2;  2ZJC A;  3AL5 A;  4MGY E;  5ACA 2;  4QKF A;  1NCR B;  2VME A;  4DB5 A;  3K4D A;  2DWR A;  3VBF C;  4FO9 A;  1WMF A;  5CFC C;  5AVP A;  1DZQ A;  4WM8 B;  3MIG A;  4COU A;  1UZ0 A;  5IAT A;  1XNB A;  2DDU A;  4PF5 A;  2DFB A;  4QX0 A;  3CHX A;  1AXK A;  3CO2 A;  1YC6 1;  4JHT A;  5GJ6 A;  5IUQ A;  5A1A A;  5L9V A;  1JI6 A;  3I3D A;  3HNY M;  1FAY A;  1RHI 1;  2VNV A;  4LHK A;  4MSV A;  4BQW A;  1UMH A;  1W6P B;  4NWV A;  3THC A;  5HPO A;  4YG0 A;  1OA4 A;  2DBN A;  1GZ9 A;  2WS9 1;  3ZSE A;  3EQE A;  1MS5 A;  1CAV A;  5KXD A;  1GP6 A;  1SMV A;  4QMA A;  5JI7 A;  5LAS A;  1IKQ A;  1H8T B;  5JLV A;  3KV6 A;  5LBC A;  2R04 3;  5A7N A;  4E8D A;  4LBQ B;  1GOH A;  4Q2F A;  2QQN A;  4LR4 A;  4QHZ A;  5AFB A;  1VJ2 A;  1Q8P A;  1DQ1 A;  4IE4 A;  4NHY A;  1OD5 A;  1XC6 A;  4CTE A;  5LK7 B;  3CQO A;  5FYV A;  1QXR A;  4K20 A;  4HVQ A;  3CEW A;  4PDW A;  1VBB 2;  2IVJ A;  2Z69 A;  1DZR A;  2GZW A;  4FPC A;  3ZXE A;  1LOC A;  1HLC A;  5JPM B;  3J8F 3;  2ZBJ A;  3BVC A;  3JQX A;  3QCW A;  5F6L B;  2ZX0 A;  3O1V A;  4RQP B;  3DXU A;  3JQW A;  5FUI A;  3R6S A;  3T4H B;  4XJU A;  3BPZ A;  5C7G A;  1DGW A;  3HT2 A;  5A80 A;  3FL7 A;  1HB1 A;  1RUF 2;  2PEL A;  3SH5 A;  3A0K A;  4QQP A;  1J3R A;  1RVF 2;  1VBB 1;  4D3W A;  2WWU A;  2D44 A;  5EYX A;  1SG3 A;  1C28 A;  2XKP A;  1HRI 2;  4M0H A;  1UF2 C;  2VGD A;  4E2G A;  2O0O A;  2ERF A;  5E89 A;  2WO2 A;  3BPS A;  4LBN A;  1ENQ A;  1DLC A;  3ABZ A;  4IV1 C;  2VO5 A;  1GLH A;  1YQ5 A;  4L0P A;  2BWA A;  1N3P A;  5EV7 A;  5JDB A;  4LIV A;  1CJD A;  2YFU A;  4QXB A;  4UFK A;  3B93 A;  1NZC A;  5FPA A;  4DNY A;  1RUF 1;  1PK6 C;  4N9H A;  4I3G A;  4CP2 A;  1CAW A;  2E53 A;  4HKW A;  1RVF 1;  1W8Z A;  3ELN A;  2W2I A;  4GMP 3;  4NVP A;  1S55 A;  2UU8 A;  2IFW A;  4RS5 C;  3MIC A;  1G9B A;  2AEZ A;  2A70 A;  2HWF 3;  1ZBE 2;  1CR7 A;  1O3T A;  3UT0 A;  2CDO A;  1W9T A;  2JDH A;  5IWF A;  4QX7 A;  1QIQ A;  1V9U 2;  5FR3 A;  1RC6 A;  2OZ6 A;  2C6S A;  2Y33 A;  1ZBA 1;  4IE5 A;  4W6Y A;  5APA A;  2UY8 A;  5KBF A;  2WL1 A;  5JR7 B;  2XJT A;  2HWE 1;  5FZ1 A;  4HSJ A;  1JYC A;  3AP7 A;  1T6G C;  1S2K A;  5DAV A;  1YFY A;  1IZ3 A;  4K9S A;  4HPK A;  4Z8B A;  1QJY 1;  3ILN A;  1G9D A;  3HR9 A;  1ZBE 1;  2AGS A;  2MEV 2;  2LTN A;  2VZO A;  3O0X A;  5DUW A;  4UFM A;  2PHF A;  4CP0 A;  1W8U A;  5C8W A;  4J25 A;  2ZGO A;  1OOP A;  2WNV C;  1B35 B;  3RZL A;  1W9Y A;  4Y1U A;  5A70 A;  3U75 A;  3WDW A;  3HBK A;  3V0A A;  2Y8K A;  2R6Q A;  1OUR A;  3WNK A;  1FMD 2;  4GUL A;  4IGP A;  2VBP A;  3C7E A;  4QPI A;  3O1P A;  2BPA 2;  4LTA A;  3LKJ A;  1PNG A;  5BNN C;  4CXY A;  4HN1 A;  3UKV A;  1JHN A;  2AEY A;  4C90 A;  4B4R A;  3WVJ A;  2MEV 1;  5FZ9 A;  1RL3 A;  5L36 A;  4M4R A;  4FVV A;  1VBA 2;  4QKN A;  3HEI A;  1D4M 3;  2D3S A;  1KXG A;  3AXD A;  3OUI A;  3GZA A;  3J9S A;  4Q8L A;  4OCT A;  4CDX B;  5BYN A;  4MGZ E;  3PU8 A;  1PMH X;  1HV1 A;  2VZQ A;  4UYB A;  3WG4 A;  1BMV 1;  1NA1 B;  4GWN A;  4IV1 A;  1W9W A;  2QQW A;  3LZZ A;  3H42 B;  4FPL A;  1VAV A;  4ZU7 A;  1QWR A;  3FHA A;  2VZV A;  4O7X A;  4WM7 C;  1S0G A;  3KV4 A;  4UW3 A;  4YZ2 A;  4DEV A;  1K5M B;  1W8H A;  1ULO A;  4ASM B;  2RS5 2;  1AYM 1;  1N1V A;  2LRO A;  2P3Y A;  4AHW A;  2P6C A;  2ZKL A;  1W6N A;  1VBA 1;  3DCQ A;  1HKD A;  1I5Z A;  2AZ5 A;  5C4W C;  1BEV 3;  1XND A;  2JE7 A;  2DYC A;  2WIN B;  2ZX4 A;  3WSO A;  2ZGU A;  1DQ6 A;  1KDM A;  2A6V A;  2D7F A;  2R7E B;  1VBE 2;  3IMN A;  4NHL A;  5FPL A;  5L19 A;  3LA2 A;  3WF4 A;  4Q4V 3;  5A3U A;  1Y4W A;  5LA2 A;  3LE0 A;  1RUG 1;  4B7E A;  4B4P A;  4YW4 A;  4IE6 A;  2VMG A;  3OBZ A;  3NW4 A;  2RDS A;  3I49 A;  3UJQ A;  1LOE A;  1GYK A;  2JE9 A;  2VZP A;  4ZPI A;  2VUD A;  2CYF A;  3CU7 A;  4LA2 A;  3FMG A;  2VQT A;  3ZFG C;  4CDW B;  5CG8 A;  4GWM A;  2PHD A;  1AR7 3;  2XJS A;  1WCD J;  3I2J A;  1WUV A;  4GKX A;  1RHI 3;  2W68 A;  4MUV A;  4DIQ A;  1KRI A;  4XVH A;  2B45 X;  2RS1 3;  4GA9 A;  3BIW E;  5IAV A;  4XHX A;  4E4D X;  1C8M 2;  2DCZ A;  1VBE 1;  2WS9 3;  2VH9 A;  2PHX A;  2PA7 A;  4YG3 A;  1W8W A;  3FUO A;  4AI2 A;  5BY5 A;  1UY1 A;  2WDB A;  1H8V A;  4A6S A;  5GKA C;  5IK8 A;  3MV1 1;  3W9A A;  3WW4 A;  1XOY A;  2JX9 A;  1CQ9 A;  2AC1 A;  5FQ0 B;  4NN0 A;  3ES4 A;  5KHK A;  2CDP A;  4H2A A;  3ZYF A;  1JMU B;  3X29 B;  5FYT A;  3VKL A;  3PME A;  2ORX A;  1T6B X;  3K75 B;  1S4C A;  3I3Q A;  3NST A;  1WD4 A;  1LR5 A;  2HEY F;  3M1H A;  4XFH A;  5FPB A;  2RV9 A;  1C8M 1;  4IW3 A;  4L92 A;  4MX3 A;  2KR2 A;  5FZE A;  5BNO B;  4IV3 C;  3ZN6 A;  1XNT A;  1Y9G A;  2LS6 A;  3OGJ A;  4XAC A;  3NAP B;  3JD7 1;  5A3T A;  1G8W A;  2VZU A;  4FPK A;  5E16 A;  4QWN A;  3N9M A;  4CPB A;  2ZGL A;  3H1W A;  4E8C A;  4D8M A;  1O91 A;  4CP1 A;  3UYJ A;  4Q29 A;  4MGS A;  3NJZ A;  4EE2 A;  1W3V A;  4P9G A;  4WBB A;  4NII A;  4B29 A;  4NIH A;  5FZG A;  5J1X A;  4YVW A;  1BKZ A;  1T2X A;  5FBJ A;  1J1L A;  3JUU A;  3L2H A;  4YGE A;  5FPV A;  3WOG A;  3WX5 A;  1G7Y A;  2FBE A;  3RZJ A;  5DPN A;  2QCS B;  3WR0 A;  3BU7 A;  4QX5 A;  1ZZ6 A;  3CDZ B;  4XDO A;  3IPV A;  4CCK A;  2ZZQ A;  4FAG A;  3O1O A;  3OBA A;  1OA3 A;  4Y33 A;  2UY9 A;  2XG3 A;  1H9W A;  1NCQ B;  1PVX A;  2ET7 A;  2Q4S A;  4XAE A;  5IW0 A;  2QQM A;  3ILR A;  3VKF C;  2DCT A;  3LFM A; 
#chains in the Genus database with same CATH homology
 4CXY A;  5DAB A;  4ZS2 A;  4QKN A;  4NID A;  3T3Y A;  4OCT A;  3BI3 A;  3O1S A;  4NRM A;  3O1U A;  4MG2 A;  2FDH A;  4O7X A;  4IE4 A;  2FDF A;  3BKZ A;  3RZK A;  4NIG A;  4QHO A;  3BTX A;  3O1V A;  3BTZ A;  3T4H B;  4NPL A;  3I3M A;  3T4V A;  4QKD A;  2IUW A;  3H8O A;  3O1R A;  3H8X A;  3KHC A;  3O1T A;  4IE6 A;  3I49 A;  4ZHN A;  4CXW A;  4IE7 A;  4MGT A;  2FDJ A;  3BIE A;  4NRQ A;  3O1M A;  3S57 A;  4CXX A;  3S5A A;  4QKB A;  2FDG A;  3RZH A;  3RZM A;  4RFR B;  3BU0 A;  4NRP A;  2FD8 A;  4NRO A;  3I3Q A;  4NJ4 A;  4IE5 A;  3H8R A;  4O61 A;  4IE0 A;  3I2O A;  3RZG A;  4IDZ A;  4ZS3 A;  4QKF A;  4NII A;  3BTY A;  4NIH A;  2FDK A;  3RZL A;  3RZJ A;  2FDI A;  3O1O A;  4NPM A;  3KHB A;  5F8P A;  4JHT A;  3O1P A;  3BUC A;  3LFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...