5FBJA

Complex structure of jmjd5 and substrate
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
236
structure length
236
Chain Sequence
GSTVPRLHRPSLQHFREQFLVPGRPVILKGVADHWPCMQKWSLEYIQEIAGCRTVPVEVGSRYTDEEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFDQIPELKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALYPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title to be published
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 8
total genus 58
structure length 236
sequence length 236
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2015-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fbjA00
4BISA 2XDVA 5FZIA 4EZ4A 3AVSA 5F32A 5IVJA 4LIVA 5FP4A 5FZ8A 5FZCA 5FY9A 4LIUA 2P5BA 5F5IA 5FPAA 5FY4A 5FY8A 5FXWA 3K2OA 3PUSA 5FZOB 3KVBA 3K3OA 3PURA 4QXCA 4XDOA 3N9OA 5A7SA 2Q8EA 4BXFA 2OS2A 5FZFA 5F37A 3KV9A 5FJHA 5FZ9A 3AL5A 3ZPOA 5IVEA 5CEHA 5FYSA 3PTRB 4LXLA 5FZEA 2Q8CA 4UF0A 5FUNA 2YBPA 4V2WA 5FY1A 5FYMA 4Y33A 5FP3A 5FP7A 5ISLA 3N9QA 4IGQA 3K3NA 3PUAA 5FXZA 3OPTA 3LD8A 4GAZA 3AVRA 2YBKA 2YBSA 5A7NA 3LDBA 5F3GA 2WWJA 3NJYA 5FP9A 4CCOA 4CCNA 3PU8A 2XXZA 4Y4RA 2YU1A 4UF0B 3N9LA 5FYCA 4V2VA 4NUBA 3N9NA 5FPVA 4QX7A 2PXJA 5FY5A 5A7QA 4CCKA 5A3TA 5LWBA 5FZ0A 5FXXA 5F3CA 5FWJA 4URAA 5F5CA 5A7WA 5FYIA 4QU1A 5A1LA 5FZDA 2Q8DA 5A3NA 5FZ3A 3N9MA 4CSWA 4BU2A 2OQ7A 5F5AA 5IVFA 4HOOA 2GP5A 4DIQA 5FV3A 3PU3A 2W2IA 4HONA 5F2WA 5FPBA 3KVAA 5A3PA 5IVYA 5LY1A 5FZ7A 2OX0A 2OT7A 4GJYA 5FZKA 5FZHA 4ASKA 3OPWA 4C8DA 3ZLIA 5LY2A 5IWFA 5FYTA 5IVVA 5IVBA 5FZ6A 4EYUA 5LW9A 2OQ6A 4LITA 4QXBA 4CCJA 4D6RA 1VRBA 5FZLA 4CCLA 4QWNA 5F3EA 5FYBA 2YPDA 3U4SA 5E6HA 3DXUA 3AL6A 3UYJA 5FYHA 4DO0A 5IVCA 5FZMA 4IGOA 5FZ1A 5FUPA 4QX8A 4CCMA 5FZ4A 3PDQA 4XDPA 2XMLA 4E4HA 5FZGA 5FWEA 5FYUA 2GP3A 5FBJA 3KV4A 5A80A 5FPLA 5IW0A 2XUEA 4D6QA 5FYYA 5FPUA 4TN7A 3RVHA 5FJKA 2YU2A 5F39A 5K4LA 4EZHA 5A7PA 4GD4A 4IGPA 5FY0A 5A7WB 2WWUA 4AI9A 3KV5A 4CUGA 3U78A 4Y3OA 5FZBA 5FYVA 5A7OA 3KV6A 5FYZA 3N9PA 5ANQA 5FY7A 5F2SA 5F3IA 4D6SA 4QXHA 5FXVA 3DXTA 5FP8A 4AAPA 3PUQA 5FZOA 5KR7A 5FZAA 5A3WA 4GJZA 2VD7A 5A1FA
chains in the Genus database with same CATH superfamily
4OZXA 3CEWA 4OMDA 2WT1A 4YM3A 5C9AB 1DU3D 1PX4A 4IE6A 2JJ6A 5F32A 5CYYA 4LNVA 2W87A 5M0TA 2JEMA 3TN92 2BBAA 4LORA 3ZSEA 4I2OA 1BBT1 2VGDA 4CDUB 5IK5A 4BXFA 2B46X 2D93A 1F9KA 2ZEXA 3WG3A 4M0HA 3AL5A 1COV3 3SMHA 2F4PA 2FDKA 2ZGMA 2R32A 3MV11 3POEA 2WA4A 4R9AA 1UIJA 1XYPA 3BI3A 3FUQA 1FMD3 5EYYA 4HL0A 1LENA 2RDRA 1FNZA 3AP7A 4EV0A 4LUMA 1DGWX 3CU7A 1CGPA 1L3JA 1YFYA 2VVEA 3AP5A 2DTYA 3LDBA 4R4XA 5IAVA 4Q4W3 5LA9A 2VL4A 2PHUA 4IEWA 4N53A 4J25A 1FNYA 4KWLA 3WUCA 3HQUA 3KT7A 5D21A 1UU5A 2MEV2 3T0BA 3NL1A 1JU4A 2ARBA 4CCEA 2RR13 1EPWA 5IK4A 1WW7A 5E89A 5LWBA 3M8LA 2WZR1 1N3QA 5FXXA 1RUF2 1SEFA 1SFNA 2PMWB 1VBD3 2Q8DA 3MIFA 4YVSA 1LHWA 4XFAA 5IVFA 1M4WA 3NKTA 4HOOA 2HWE3 1QJZA 4FFGA 5JZGC 1K5MB 1HIXA 4MHUA 3KGLA 3KS7A 3ASIA 4KG8A 1S1AA 3KVAA 2W94A 3QACA 4W6XA 4XHBA 5FZ7A 1ENQA 3GHNA 4QMAA 5FOJB 3ZIWA 4C8DA 4MLOA 1MS4A 4UW6A 4Y22B 4AW7A 1AF9A 1POQA 4Z82A 4Q4X3 3LQCA 3WQBA 1L7LA 1B35C 3ACHA 4FPFA 1GZCA 2B8MA 2J22A 4I3PA 4Q4Y1 5FYTA 2L9LA 3O1RA 4Q5OA 4XAEA 1LHNA 2NMOA 2FQPA 3NMBA 3RG0A 1JYWA 1Q8VA 1VRBA 4L11A 1Z7S1 2VULA 4QWNA 2ZGSA 1UKGA 4LHKA 4TYSA 5E6HA 5I0DA 3UETA 4TLGA 3PMSA 1GYKA 5FMCA 1UXZA 2JICA 3CJIB 4AVTA 4FOYA 3BTXA 3OGSA 2AZ5A 5A80A 1H8VA 2XUEA 3J8F2 3MV01 4PCRA 3OEBA 4WM8B 1UQXA 2BQPA 2P6HA 4IERA 4QXKA 1OH4A 1PIV2 3POGA 4QPGA 3U4XA 1AR72 1AYM3 1GP4A 1LEDA 1MQTC 1VMFA 3FMGA 3FUOA 3MEPA 1ND2C 4QB2A 4RYDA 1SLCA 1BK0A 3WW1A 1RUC2 2JXAA 1DGRA 3T3YA 5JR7B 3GBWA 5FYVA 1N1VA 1P8JA 2DUPA 1IOAA 3ACLA 2BW8A 4D6SA 1WCQA 2ZHLA 4TSVA 3ZPYA 4YZ1A 1I5ZA 3KT4A 5L19A 2ZX4A 4IQPA 4N43C 1PVC3 1KFUL 2PAMA 4FPJA 1PMHX 1GZ9A 3DGTA 1WCSA 3T2TA 1WD3A 3MICA 2R042 4JDOA 1H4GA 1ULOA 4JKLA 5J3UA 4XDQA 3O1UA 2BJSA 3NNJA 4YG6A 3ZIXA 4QDSA 3WNXA 3LEMA 3J9SA 4AG4A 4YW7A 5IVVA 4JTOA 4LE3A 2E6VA 1QDCA 3NVCA 3Q8EA 5F37A 2W52A 2LALA 2AEYA 1ZYBA 4D8MA 1VRH1 2HWC3 2DVGA 2QUOA 4AQ2A 2ZHNA 4KU7A 3QH6A 1DFQA 3Q9OA 4XJUA 5GZCA 4UW3A 2XGXA 3S6PA 3WCRA 1VBA2 4Y5SA 3ZYHA 2XKPA 3KD4A 3R4SA 1GWMA 2DCKA 4L2NA 2ZCWA 1NE6A 1XE8A 2GNMA 2X29A 2HWB3 4IV1B 3ZXFA 2XJVA 2GN7A 2BYVE 1NLQA 1EAH3 1HV1A 1W05A 1VAVA 1ZBA1 3I2GA 1LESA 2VQTA 1R1A1 3WNPA 4AFDA 3JQXA 1QF3A 1G6NA 4H14A 2D7FA 4N53B 1QJX2 1NG0A 2VNVA 3O5SA 5DUWA 2JG8C 4IDZA 5CFDA 3VKFC 3I2OA 5L9RA 1AX2A 3UESA 4N7UA 4ZY9A 4NIIA 3KHCA 4BXSV 5CAZA 2J1VA 3HN3A 1JZ4A 5FYIA 5E8AA 3AMHA 1E5HA 4A7KA 2GNTA 3CO2A 5LK7B 1D0HA 2P3IA 4YPJA 4IW3A 5DUXA 3N36A 3CDZB 2Z42A 4JRAA 1S0FA 1NYWA 3J8F3 2WN2A 2UYBA 2C4XA 4QX5A 4E2GA 4HKOA 1CD3G 4CEWC 5FZHA 4CDXB 1NXMA 1EV11 2JDZA 1UF2C 3IT8A 4UFHA 1UD1A 3NNLA 4FQ4A 2WZR3 4Z07A 1H4HA 4M3CE 1PNFA 5F5QA 5T52A 1DZQA 2P37A 4GQ7A 2TNFA 4L97A 3AB0A 4K20A 1MQTB 2JWPA 3QH7A 3RPQA 2XLGA 1TQ5A 2A5ZA 3D0JA 2AGSA 3FFZA 4X6RB 1O5UA 4XW3A 3OBRA 5FLHA 1H8TC 3EXUA 5BNQA 1C8M1 4OHXA 2WO3A 2R061 5DUUA 2BNOA 2FBEA 4XC9A 1MZ5A 2EIGA 4GB31 1K45A 5FZ4A 3VBSB 3VKNA 2DVBA 1AXZA 4CDWB 4E4HA 5K7PA 3RWNA 3W9AA 1UZZA 2Q4SA 2BPA2 4KGQA 3CJIA 5C3RA 2OUJA 1OFNA 2GC3A 1C3HA 3ZO0B 4EZHA 3IMMA 1RUG3 2WFF3 4I30A 1O5LA 1ASJ1 3V64A 4ZXKA 4CU7A 4QM9A 1W2NA 2A71A 3I59A 4PDWA 3SH5A 3N9PA 4G9SB 1VBB2 4C91A 3M7AA 1PK6C 2MPFA 2A6YA 2HH9A 3ZFFC 4XTMA 5FBZA 5SV8A 3CIHA 2D6MA 4MXWB 4Q4V2 1GMMA 2AYHA 3ZXJA 3ZN6B 2VQAA 3TN91 2J42A 1DQ1A 3JUUA 1ZREA 3LDRA 4AVCA 2HWE1 2ZGNA 2P5BA 2KM2A 2NMNA 5FPAA 2WS91 2W95A 1QH6A 1PO21 5FXWA 4QKDA 4PI2A 1WLDA 4E4ZA 4N43A 3A0KA 4LK7A 1RIRA 1HDKA 1LOBA 2VMIA 4YLZA 4YZ3A 2LM3A 3USUB 3BN6A 1Y9MA 1WLCA 3EBRA 1AR61 3AYEA 3ILRA 3BTZA 4GKXA 2PA7A 3ZKUA 3ZXKA 2BGOA 5E1RA 5CKQA 5FMOS 2GU9A 2YC4A 3VBHC 5LA0A 5DUVA 2PHRA 2YDEA 1VALA 4EN8B 1OPOA 1A78A 4QU2A 3IDAA 3VZLA 4J6GA 5JR2A 3H8OA 1XNCA 1UW8A 3HD8B 3WDXA 4E8DA 3AZZA 1POV3 3RYKA 1YFUA 4HPKB 3VBOA 4CCNA 3V0BB 1BXHA 3VD3A 5C8CC 3AM2A 5FYCA 1JYTA 1VRH3 4ZS2A 3ZXEA 5DG2A 1OSGA 1ZBA2 3WHUA 4AVAA 4D3WA 2ZGKA 2XQXA 4LO8A 5FY5A 5CBLA 3K77A 1KDMA 1K42A 3AYCA 2ZACA 4WV8A 1K5JA 4OFGA 4QPIC 1W8ZA 1YLLA 4Q8LA 1QJX3 1WW5A 2JDKA 3FHQA 4KWJA 4P9YA 4NRMA 2RS12 3I2IA 3C7HA 3T30A 1D4M3 1QEXA 1OMIA 5LCWL 1ZZCA 1YQ6A 2A7AA 4HONA 1RMU2 1CAXB 3GGLA 3SEEA 4CUBA 1DLCA 2R7EB 1Y9QA 3QCWA 5BNOB 4CDWC 1ZA4A 1UAIA 5HXVA 3PIJA 3VKOA 3ON7A 3H8XA 2BOIA 1RXGA 4HPKA 3IZOA 5AC91 1H30A 1DG6A 2OQ6A 2Q5TA 2RJKA 2VZTA 2HWC1 3GALA 3PL0A 1UY3A 5D1IA 4CCJA 1DP0A 3LSEA 2XHKA 5JXHA 4XYXA 1F2NA 2RM23 4Y22A 1H6XA 2HWC2 4XFGA 4LT5A 2KD7A 4O9EA 5GJ6A 2VPVA 3WF0A 2ZABA 4IE7A 1JZ7A 1F8VA 2LS6A 2DVDA 3VBHB 3VHPA 4YM2A 3IDBB 4QDQA 3KM5A 3VZKA 3JD73 1WUVA 4KWUA 4B4QA 3TEYA 4QDRA 5DDJ2 2GH2A 2XL9A 1RMU3 3RVHA 4UFJA 4P9JA 4XQWA 4HFSA 2DVAA 3UKTA 3K51A 5I0SA 1COV2 2IWGB 2YG0A 3RJ2X 2WWUA 1SBFA 4AEMA 3ZDSA 2WNEA 1QQP2 4FAGA 1WCUA 4IE0A 3ZSJA 2RS53 1HRV3 3FHIB 2YGMA 2DCYA 3UL2A 3IB3A 4QXHA 5J98B 3DXTA 4DNYA 1WLTA 3W59A 4QB6A 4HLTA 2BGCA 4XF1A 3VBFA 3R05A 4PF1A 2XWJB 2D6PA 1RUD3 1DIWA 2GC0A 4JKKA 2VNGA 2E7TA 4EZ4A 3H9AA 2R1BA 4PDWB 3V0AA 1WMDA 1RHI1 4XUPA 5IVJA 2WAOA 2WSUA 3FN9A 1J84A 3T2QA 1W28A 1NCQA 3SXWA 4WVMA 2XUMA 2YB7A 3BPSA 1GANA 4NAOA 2EAKA 3DECA 4FPOB 3MLKA 1YFXA 4NHMA 3A7QA 2RS32 3PHMA 1PHMA 2DCTA 2OIIA 3O1OA 1QJU1 2VXRA 1NLRA 2XJSA 3W58A 2IFRA 4A3XA 2BFUL 3WG2A 2FDIA 2BGPA 1OT5A 3TEWA 3MDPA 3VDDC 5FYMA 5FRAA 2DURA 3B94A 1B35A 3PTYA 2BVVA 2GC1A 4DZGA 3VB9A 5FK7A 1I5PA 1LECA 4AHXA 1YNAA 5BNPB 2WN3A 3NSTA 3ZR6A 2ZMNA 5F3GA 1IS3A 1RUD2 3WF1A 1A8MA 1QJX1 2QQUA 4G3YC 4O61A 1GP5A 4GALA 5DQ0A 1W9FA 4IV3C 4BPZA 2X09A 5A3MA 4Q29A 2W3JA 3LF7A 4UYBA 3T09A 3QLQA 5BXXA 1IZ3A 5FMBA 1S0JA 2EIBA 1WW6A 3CNAA 3RZZA 1W8UA 5FLJA 4URAA 2MHFA 1J1TA 3GBFA 4DOUA 3PLQA 3DF0A 4S2DA 1JUIA 5EXOA 5A1LA 5K0UB 2VH9A 2ZGUA 3N9MA 1QOTA 5HCFA 3AXEA 4BU2A 4XURA 1XYNA 4XABA 2UWAA 3GYDA 4OHZA 2WNOA 2XJUA 1VJ2A 2VZOA 4OI2A 5FV3A 1VBA3 1RUF3 3ZMNA 4AEDC 2PLV2 2VMGA 5IVYA 3O0WA 4KWKA 3ZLIA 3T2OA 2VZ1A 4MXVA 3DL3A 1NZCA 3NNMA 4BA6A 1TEIA 3QBQA 4FPEA 3WQ7A 1A8DA 1OH3A 1GNZA 4JAAA 4QAWA 5C71A 1T2XA 1LKNA 3KCYA 2HYKA 1PO23 3C8XA 3RZGA 1SFYA 2W47A 1ZRFA 4Y20A 3DXUA 4XBNA 4BQYA 4A6OA 2GNBA 4B7KA 1X9TA 4CXYA 4IGOA 2VMCA 3RZKA 2ZGLA 4Q0SA 4AQSA 1Y43B 4RQPC 2YZ4A 3WZ1A 4BB3A 3T0DA 1XNKA 4M3CB 4COUA 1W2UA 1GUIA 2I74A 3RDIA 2DBIA 5FQ0A 3VD7A 4NRQA 5A33A 4R9CA 1APNA 3WXPA 1GQPA 3TNQA 3PMEA 5I8SA 3VHOA 1W90A 1RUH2 5ACA2 5F39A 3NQHA 1ND3B 4GWMA 1AR62 4FTEA 2PYTA 4MGTA 4UWDA 5C8WA 2R0HA 3OYWB 2VW2A 4DQAA 4IV3A 1SBDA 1QXJA 1GV9A 1IPSA 1HRI3 3AKSA 1COV1 4JHZA 5CKMA 4CDWA 3M3IA 2Q8OA 1I1EA 5A7OA 2HEYF 1QQP1 4XOGA 2V5YA 2XKOA 1BEV3 2VBBA 4B29A 3BU0A 1RUH3 3LA7A 2YC0A 3AYAA 3U0ZA 2QQNA 4XXAA 2XDVA 1LGNA 5LATA 2XJPA 1X9PA 4FPCA 1GOFA 2K46A 1W8FA 5HCHA 3BIEA 2BV4A 4XHXA 2RS31 3PUSA 4DPNA 5IVCA 3NO8A 5IJRA 1JYXA 2WLQA 1PO22 5ANNA 4L0PA 1UZYA 4GIQA 2P4EA 2Y6GA 1ZM1A 2PTMA 3PTRB 5SV5A 5FREA 4GWIA 4IEVA 2YBPA 1RUI3 4MVTA 3B69A 4CU8A 1RVF2 5GALA 4PQ9A 2CYFA 1JU3A 2R6QA 5BNNC 1ULGA 1KJRA 3OY8B 2FMDA 2ZX1A 4LOTA 1OF4A 1OLMA 3J26N 4QM8A 4LOSA 3F95A 2B7YA 4DEVA 4OI1A 1CAVB 4YVWA 3B01A 2HWD3 1OD3A 2RDQA 5L9VA 5FQ0B 4FFHA 5FPVA 5I91A 4YZ5A 5IK7A 4CP9A 1J58A 1O8PA 3VKLA 4YGEA 3OF1A 2JE9A 2E7AA 3V65A 3WP3A 5CFCB 4FSJA 5FWJA 1IS6A 4X8NA 3ZMOA 3B9IA 4LE4A 1FOD1 2D44A 4LBKA 1AZDA 1PVC2 1VR3A 4MG2A 1HXS1 1UKRA 1RUI2 2ES3A 2Q0AA 2YGLA 3BPZA 1XNAA 3PU3A 1OOPC 1I3HA 4NWVA 3VBOC 4FVVA 1FMD2 5LY1A 4IEZA 4GJYA 1QWRA 1FXZA 1RUC3 2XONA 2AEZA 2GAUA 4Q0UA 1UCXA 2GN3A 1PMIA 4YSFA 2QQOA 4K21A 2UU8A 2OXBA 5C70A 1S0IA 1GSLA 1NXD1 2ETEA 2JKXA 1ST8A 2VOTA 1W6MA 4D6RA 5KXCA 1GOHA 2RS33 3WOGA 4YZ2A 3FZ3A 5I0TA 4XQDA 1WMEA 1UY0A 4FOVA 3VHNA 4UBHA 1V6NA 5FZMA 2QTWB 1CIWA 4RS5B 3U10A 1PGSA 3P3NA 2PHLA 2XHNA 3FLRA 3HVDA 2WWSA 3ZXAC 2PHXA 2WFPA 4LR4A 5A3UA 2A6XA 4IXLA 1VAKA 2H6BA 3AMPA 2ARAA 3TB0A 3HEIA 4OCTA 2P17A 5A6QA 5A3LA 3VUOA 1LAJA 5B4NA 4KG0A 3RQ0A 1GFF2 4QX1A 2BERA 1OQ1A 4ZS3A 1OLQA 5A7WB 3T1MA 1TE1B 3WNLA 4GMP1 1MS1A 5ABJA 3AKTA 5JWPA 3N3HA 1ZRCA 3VHRA 1VBD2 3RFRA 5ACA3 1YIFA 4FXKB 1ASJ3 4N9IA 5GZDA 2ORZA 5C9AC 1NCQB 5KR7A 2W91A 4XF9A 2PHDA 4NPMA 3L2HA 1TMF3 4E2QA 1UY2A 4NIGA 4I01A 4CEWB 5I8YA 3N7MA 4NN0A 1GQGA 5LBBA 2BZDA 1O3QA 2QQKA 4AGRA 3KF5A 3WUDA 5CNAA 1N3PA 2LW8A 4QX2A 2J1UA 5F5IA 4CDQB 3WQ0A 2Q8CA 1RINA 3K2OA 4YARA 3EQEA 2UY8A 3KVBA 4QXCA 1W6NB 2WA3A 1SACA 4R4ZA 4NIHA 1BK1A 1BBT2 5JSPA 2EICA 1YIPA 4Q27A 4EN9B 5CEHA 1BMV1 1J83A 1XU2A 3HQRA 1Q8QA 2VG9A 3VGIA 5JSOA 4XJ9A 2AACA 4CCCA 2G9GA 4FPKA 1SPPA 3JD71 4P00B 3OUIA 3ZFFA 3ZFGA 3HNBM 4XMAA 1VBB3 3IIAA 3AZVA 2Y0IA 4A7YA 5J1XA 3WDYA 4M00A 2B42B 2DUQA 4LULA 4W65A 2R072 3KF3A 2W5FA 1JZ8A 3OD4A 4PDWC 3MFAA 5G04L 1J59A 2ET7A 2C26A 3AFKA 3N9LA 4XUOA 4COWA 4AYUA 3KQ4B 3N9NA 2ID4A 1HRV1 1LOGA 3MF9A 5AC93 3OY8A 1YYNA 4AFBA 4LPLA 4CEYA 1AX1A 1W6NA 5C6CA 2HWF3 2VMHA 1BJQA 4XIOA 4ARXA 3ZYJB 1W03A 2RMU2 1WA6X 1AL21 3U14A 4HXCA 1CAXA 4Z92B 1H8TA 1QJEA 2B9VA 4XJZA 2ZHKA 2UWCA 1YFWA 3AMNA 3O1SA 3CZUA 5GZFA 4NHXA 1SPPB 1OA2A 3U37A 2XBO3 3MIHA 2EXHA 3P5BA 2X8KA 4DXSA 1S4CA 4YYOA 2ZJCA 1AR63 1S0CA 4MGSA 3BVCA 5EP9A 3EB7A 3HNYM 2H0VA 2JB8A 5K9YA 3ACIA 2Y38A 5FO9B 2P6CA 5H9SA 2A70A 3SQOA 3AP6A 1CZSA 5AC92 1LRHA 4GH4B 2VTXA 1OPMA 2PQQA 4FOWA 3H3UA 4UFLA 2E31A 1NQDA 1G7YA 2Z2SB 4JX0A 1V6KA 2W0XA 1OI6A 1QJY2 2B4KA 3ZYRA 1JUHA 4P14A 1ZRRA 4E4SA 3GCWA 3EHKA 1F15A 3IM0A 4QHBA 4EJRA 4AHZA 2Z79A 1MEC1 4A2UA 4AFAA 5FWEA 4L92A 1NA1A 1RUJ2 2GP3A 2RS52 1AL0G 3CHXA 3WG4A 4K7JA 1XBFA 4P9LA 2ADEA 1POV0 2Y6JA 3E6BA 5D8AA 4NE9A 5EZWA 1KS4A 4XUTA 3W20A 2C0ZA 1JYCA 5K4LA 3DYPA 4BHPA 3G6JB 4JQRA 3I3BA 2YYOA 1OA4A 2WNVA 5IFPA 4EWAA 2ZMKA 5LBCA 1PIV1 4M3CA 1D4VB 1DF0A 1XYOA 3KV5A 5DXDA 3SHRA 2DDUA 3OUHA 4JC1A 5LA2A 1DZTA 2WNVB 5DABA 5ANQA 3RS6A 2JX9A 3LPGA 3MUZ1 2YC2A 3ZR5A 5HV0A 3E6DA 1SCRA 1ZA7A 4LA3A 4Q1PA 4JZRA 4GJZA 5EIYB 1HW5A 5A1FA 3KWVA 3ENRA 2VMDA 1O4ZA 4NRPA 5T55A 1YQ2A 2J1AA 3WW2A 2VZSA 5C8CB 3VBRB 4NROA 2WLPA 3USSA 4RS5C 2RDNA 3OGRA 4LKDA 3D8CA 3RZMA 1GWLA 5JZGB 3FE5A 4CRQA 1H2NA 1YCIA 3AZWA 3PUIA 3K3OA 2D5FA 2ZKNA 1LHUA 1W9YA 1Q5OA 4P9WA 4BQ2A 3ZYBA 1UIKA 3D3AA 2BTVC 3LWCA 5CISA 3NAPB 4LKFA 4O7XA 4RGAA 4RSUA 4AVVA 2GMMA 1JH5A 5C4WC 2FDFA 4AR2A 5L9BA 1CJDA 3I54A 4H55A 4I09A 1CAVA 4K9SA 4WM7A 5FP3A 3SISA 4NVPA 1WKYA 3N9QA 2R49A 3LCPA 1L7QA 3AP9A 3LD8A 4NR1A 2BVBA 2XJRA 3AKPA 4LHLA 1PZ9A 4XUQA 4C90A 5JOYA 1NA1B 2ZZQA 5CADA 3OGVA 3NJYA 5FP9A 3ZYPA 1MVEA 1FOD3 5DAXA 4CCOA 3PU8A 4L99A 4CP0A 3PNAA 4UF0B 2Q1MA 3P6BA 2QVSB 1WW4A 3BCWA 2ZKLA 3OGGA 5HCBA 3MO4A 4YVSC 5HXMA 2PXJA 4QPGC 4F83A 2Y33A 3JZVA 3WR0A 1HV0A 1FOD2 1NY72 3IAPA 3WP5A 1F35A 3I8TA 4BOWA 2IUWA 4GZ9A 1AL22 2ZEZA 3DKQA 3RGBA 3WCSA 4PLMA 2KR2A 2BDRA 4FFIA 2JG9A 1V00A 2ILMA 3V0AB 4FCAA 4W4ZA 3WQ1A 4B4RA 1QXPA 2A6VA 4YZ4A 4Y1VA 1AR92 1MS8A 1ODNA 1PGL2 3HQXA 4I0WB 3CZJA 4NHLA 4XUNA 1XU1A 2WYFA 4LBMA 1UOBA 4HN0A 1QHDA 1Z7S2 5GLWA 3WNMA 5KHIA 5L36A 3CLPA 1BQPA 3ZOIA 2V4VA 4XBLA 4CDUC 2QNKA 1U5XA 3IDEA 1RUE3 2W08A 3O14A 3WP4A 5JZGA 1ZZ9A 1DYPA 1JZ2A 2NYYA 3DV8A 4YVWC 3I2JA 1UOFA 4IE4A 4Q4W1 1RHI3 4GKYA 2LROA 4MH0E 2QJVA 3WHTA 4OQ9A 2R30A 3WF2A 3PVEA 3M70A 4W6WA 1SCSA 2HYXA 2MEV3 3V56A 2F17A 2HBUA 4ATFA 1QDOA 1YHFA 2VUAA 3E5UA 3ZVXA 4BQ5A 4Y3OA 5FZBA 4CXXA 1ULEA 3POJA 5F2SA 2VOVA 2D6KA 4KU8A 3GM8A 5A6ZA 4Y1UA 2JG8B 5TSWA 2B9UA 4FOQA 4XF3A 3VLBB 4I0BA 5BV6A 1M06G 2WZPP 4BYYA 1HKDA 4HVQA 1BYHA 4YRDA 2QQJA 2EA7A 2AREA 4H3WA 3VBFB 2E32A 1ULDA 1C57A 1UO9A 1CR7A 4LIUA 5T54A 4EN0A 1BVVA 1ALYA 1UYYA 2CL2A 2Y8KA 3PURA 3ELNA 5FPUA 4N9HA 2XL7A 1KS5A 4JGZC 2C24A 2X05A 3KGZA 5DAPA 3WY6A 1MPXA 4BLIA 4RL7A 5C7GA 1LULA 4HETA 3KCXA 4V1PA 1OUSA 3VN4A 4FFFA 4QQHA 1TME2 5F7UA 1IS4A 1W2OA 1NAEA 3AFGA 2I2SA 1H1AA 4Y33A 3J7LA 1TME1 2O8OA 1URXA 1W06A 1YO8A 2CNAA 4IGQA 1US3A 1YJLA 3PUAA 3B3QE 3OEAA 3L9JT 2IZWA 4RR3C 1SHWB 5BNPC 2YBKA 4CP1A 1O8SA 1H2KA 2VZVA 3IPVA 4YM0A 4ZXEA 1ZZ8A 2WWJA 1V9U3 4GULA 4D69A 2EXJA 2BP6A 2PN5A 4XFBA 1YXWA 3S7IA 4RQPA 1JYNA 1VPHA 2E9QA 4OUSA 2JDPA 4OLLA 4NUBA 3D4KA 1QQP3 4DXTA 4HN1A 2GC2A 2YY1A 2CAUA 2VNOA 2YV8A 2WNUC 4U2AA 5A1AA 4Z2WA 4QQ2A 2G1MA 4BQ4A 1R092 4AHYA 5HBAA 3E1F1 3AMQA 3SLIA 4UBGA 1CPNA 1XJAA 1BBT3 5A3NA 3N7LA 4K6BA 5KHJA 2GZWA 1EUUA 3D82A 2JB4A 1Y9GA 4ORFA 4ES8A 2CY6A 2MNGA 2GP5A 1HLCA 2J1TA 3DYOA 4MGQA 1E5RA 3SH3A 2A3YA 4QD2A 5A3PA 1NOVA 4BMEA 5EJ1B 4XF4A 1UMIA 3POFA 4WM8A 3U11A 4AQ6A 5F1RA 2RM22 5BNNA 4J1XA 2QKDA 1XNTA 1XSQA 5CU1A 2PHTA 3JBG2 4Q0PA 2XWBB 1HRI1 2RVAA 3GXUA 3HN1A 4F3JA 1MZFA 5AFEA 2WZEA 1CX1A 4MGZE 2DVFA 3OTFA 4YW4A 3CMGA 4PI0A 4XJWA 2CHHA 3KSCA 2FD8A 2D6LX 1Y7BA 5JOXA 1S2BA 3LIGA 4S2GA 5LBEA 2X5IB 3S0MA 3MYXA 2HWD1 2FCUA 4DEQA 4HBNA 2FDHA 4WBBA 4OHYA 2D3RA 3AC0A 3G7DA 2IVIB 2GMEA 4AEKA 2YFUA 4A45A 3BOPA 2QZ3A 1W2AX 2BU9A 4YWAA 5GZEA 4D6QA 3WP6A 3JXSA 3PVOA 5J37A 4QHOA 1K12A 2OKXA 5CG9A 2BWCA 5A7PA 3JQWA 5A33B 2LUWA 1JZ3A 2OPKA 5LZ6A 4LBLA 2GMPA 2QZ2A 4PLNA 4AI9A 5CFDB 3GZUC 4CUGA 4UXAA 1FV3A 1VBC3 5FMOL 3ZFEC 3KV6A 3C3VA 1ULPA 1VP6A 4GMP3 4CE8A 1NQJA 3BODA 3POIA 4CEWA 3OGJA 1JZ6A 3I3MA 3PUQA 2NPIA 3ROUA 3AXDA 5A3WA 5BNPA 2E33A 4EQVA 3T1LA 4DUXA 3MPPG 3VBHA 1MS9A 3LB9A 4K8FA 3Q8AA 1NCQC 3AVSA 4XFIA 5EJZB 1TMF1 4AI1A 3NJXA 3UJQA 4BWOA 2VUCA 3LGRA 4W8JA 2VW1A 1R1ZA 5JOZA 2VTXJ 1MZ6A 4S2HA 5BNNB 2QQPA 3GCXA 3B7MA 1KQRA 3AZYA 4ZZ5A 4A3ZA 3LEGA 3VBRA 1N1SA 1TVGA 5FJHA 2P3JA 3I59B 1ENXA 4R9DA 2V72A 1EYBA 1HB1A 4LXLA 4MHRA 3OYWA 4FP2A 4MGIE 2XLFA 4GMP0 1RVF1 2HEWF 3LSDA 1OVPA 1Q8SA 1S0EA 3WX5A 1QJU2 2G19A 1W2TA 2QCSB 2WBKA 4KBBA 2JDMA 2X10A 3THDA 1W9WA 3WDVA 3ZXLA 1HQLA 1SQ4A 4Y5Z0 1DQ4A 3I4IA 4WM7C 3THPA 3JD72 1W0PA 1MZEA 3VBUA 4MADA 4LHNA 2DFBA 2ENRA 5J96B 1W8HA 1WMXA 3FX3A 3SCFA 3ZSKA 3BALA 3H1YA 4PQQA 4TZDA 5BUVA 1QJU3 4I0AA 1YC61 1LGBA 1O3TA 4XCBA 1ZBE1 3LFMA 1BLZA 4GWNA 2IXJA 3K48A 4D94A 1RUG2 2WFF2 3POWA 4D7SA 1ZZ6A 2MEV1 3MIEA 4QPGB 2Q30A 4LBNA 5F3CA 1OBNA 2OUHA 3H50A 5F5CA 5H9RA 5A7WA 1DHKB 3I97A 3H8UA 4AEJA 5I0UA 1JZ5A 1OOPB 3VDAA 1K5MC 4QPWA 5KHKA 2D3PA 3WDTA 1UY4A 4LBQA 3DKWA 2N7GA 3EJKA 5K8SA 1H6YA 3KLSA 3WT3A 3Q8CA 3A21A 2CGOA 3OCPA 4META 2DCJA 3ZN6A 1QOSA 3HBKA 4MOAA 3ABZA 5FZKA 5I8TA 3HPNA 4LEJA 3WW3A 1BEV1 1Y4WA 3UT0A 5LA1A 2WNVC 1VIWB 3PVBB 1JOBA 3N35A 1BEV2 3U07A 1PZ7A 4QXBA 3VD9A 4JDNA 2UYAA 2ZTNA 2E7QA 2ZGTA 4Q4Y2 5F9TA 1VB4A 5HI0A 3UNPA 1ACCA 4YW3A 1ZBA3 2BNNA 1JTZX 4ARYA 4DO0A 4DUVA 3NJZA 2CDPA 1MS3A 5FYHA 4JKMA 4WM7B 5BNOA 2KA3A 3O1VA 3JU9A 4MXWA 2A73B 3E5QA 3PJQA 1QJY1 4R52A 1NT0A 4CPBA 3I2FA 5KWRA 5FYUA 1OFSA 1R64A 4X8PA 2Y6KA 3RZLA 4AAXA 2VU9A 5JMOA 2CGPA 4AI2A 3I2HA 4UFIA 4LBQD 1PO12 5FJKA 1WLWA 4OULA 3POSA 4GH4C 4Q2FA 1SLTA 3WSOA 4XFFA 1UOGA 3ILFA 1OC1A 4NPRA 1PO11 2HBTA 1W6OB 5L73A 3A23A 4JDMA 1AYN1 4JGYB 4XZPA 4Y26A 2ORXA 4XFCA 3HOBA 1QY4A 3AJYA 3SKVA 1X36A 1LNSA 3LA2A 1LOFC 2WNUB 5FP8A 3ETPA 2W68A 1DGRN 1OURA 2Y6LA 2PAKA 4Q26A 4DY3A 1VBB1 1BHGA 3T4VA 1SDDB 5D8AC 2LRPA 1JOPA 4EROA 5C4WA 3MI8A 4HK8A 3BB6A 3P3PA 3ZFEB 4OHWA 5DZGA 1LEMA 1RHI2 5JDBA 3C7GA 4IEQA 5LB6A 1IKPA 1A34A 1A6CA 2GALA 2Y6HA 3S7EA 1N3OA 2JIJA 3ETQA 5DAVA 3RMXA 4UFKA 4URTA 4N53C 3I2KA 5I0RA 3SCHA 4ITCA 4ASMB 4NJ4A 3VBUC 2P34A 1QMJA 4V2WA 4TXWA 4RQPB 1O91A 3GBGA 4OZOA 4RFRB 3GZTB 5EWSA 1Q56A 4XAAA 1QNYA 3OPTA 2R071 3I3QA 2UURA 2XBO1 3HR9A 1OLME 3ST7A 4FP3A 3T08A 3OSDA 2Y34A 2YBSA 1GZWB 4EN6B 4WZCA 3AMMA 4RHV3 2OZJA 5JVVA 3M3CA 3MLJA 2VM9A 3ZYIB 4SLIA 2XXZA 3NRUA 1ZBE2 1Z7S3 1QOOA 2WIIB 1NCRC 2QFEA 2FMYA 3ECQA 2P3YA 3N7KA 5J48A 4DXRA 5J7MA 4QX7A 2YUEA 3LOBA 1ENRA 1X82A 3S5QA 3K4AA 3LE0A 3P1IA 1G86A 2HKXA 4HT1T 1RJ8A 4G4FA 5FZ0A 1WZXA 4E9KA 4R9BA 4M4PA 1U12A 1W8TA 1VBC2 4FT8A 5A32A 4RGGA 3I3EA 1XSRA 1TNRA 2WZR2 3DYMA 4P5YA 3LPFA 1LGCA 1L7RA 2DWRA 3B93A 4AZZA 1MEC3 3C7EA 5HCAA 2BBVA 4GWJA 4ZONA 1AL23 3H0OA 4CCDA 2RS11 4ASKA 1FV2A 2OT7A 3NNFA 3PIGA 1B09A 4ONUA 3WEZA 4DXZA 3BTAA 1OOPA 5LY2A 1OXCA 2IVJA 5AVAA 3M2MA 2CWMA 1KRIA 1K3IA 5T5LA 5FPXA 1XOYA 2RR11 5LW9A 4XXPA 2R1DA 2WO1A 3H7JA 1CQ9A 4RGKA 2V09A 3ALQA 3D5OA 4M3CF 4Q0QA 3ZXGA 3MUY1 1U5YA 2VCBA 5DAQA 5F3EA 1PZ8A 3DEMA 2K0GA 3FLTA 4Y1XA 4LO5B 3MW3A 4RR3B 4H7MA 5FZ1A 1GU3A 1RUNA 2VXJA 4IUGA 4NWWA 4XIKA 4PHZA 4OVEA 2WT2A 1U5IA 4QGMA 2TUNA 3HMYA 3KT1A 1W6MB 1GQHA 3HWJA 1SMVA 4XACA 4OI4A 3OUJA 1BKZA 4Q4W2 1BZWA 2C6SA 3L2YA 2Y26A 1RUE2 3ZXDA 3UKNA 1OA3A 3H7YA 3KCCA 4LO7A 4NAMA 3SKJE 4A41A 4HKWA 2WYSA 3KHBA 1X7NA 1V6JA 3JBG3 3T2PA 3O1PA 5I93A 3CF6E 1B35B 2RDSA 4CDQC 1REDA 1VE0A 3BIWE 4XPVA 1R093 4TTGA 5EFUA 2ZA9A 5ABJC 1QNWA 1YUDA 3IPVB 3Q8FA 3ZFGC 1R1A3 4CDXA 4FAHA 4HVOA 5IATA 5C3OA 5C5UA 5FIXA 2R041 4BQ1A 2WO2A 3NV1A 4RFT0 1LODA 4RN5A 4BISA 4DFSA 3WV6A 3NV4A 3CJIC 4LIVA 1F5JA 2W1QA 5FZ8A 1ZRIA 1XPWA 4JHTA 2W92A 1AXKA 1TMF2 4P9IA 5B4XA 1KFXL 2RJ2A 1JHJA 2DFCA 5FY4A 2OYZA 3RWKX 1SLBA 2WUHA 2ZGQA 2J1EA 2A6WA 3FWEA 5F6LB 2KXLA 3BUCA 3NJVA 1HX6A 2GSYA 5C3SA 1GBGA 1PM4A 2CDOA 1G9BA 4FTBA 2R0FA 4CVUA 5FUNA 1VRH2 4XVHA 4P02B 3NAPA 5GLUA 3BKZA 1N1TA 4DINB 5ISLA 2ZEWA 4OUMA 5CVRA 4DRVA 4OI0A 3AVRA 1VLNA 1TME3 5JXGA 3THCA 2Z69A 2QQLA 4B1LA 5IK8A 1ZNPA 5EQUA 2TEPA 2VJXA 1FT9A 3VL8A 4L8QA 5KC6A 4LKSA 4ASLA 1S55A 1YWKA 2D40A 2VNRA 1O59A 3OBTA 4FTSA 1PMJX 4I02A 2E53A 4PT6A 2JDHA 4IESA 3FLPA 1ODMA 1AVBA 3VDCA 1DZRA 3M3EA 4JV4A 1HQNA 3MIBA 1OLRA 4QU1A 1X8EA 2Z5WA 4QQOA 4DUWA 5FR3A 3KQRA 5F5AA 1IPKA 1RMU1 1LTEA 1W8WA 3OJBA 3NV3A 4AOCA 1EV13 2GNDA 3GZAA 4PJYA 4QKNA 1H1IA 4RA0A 2RMU1 1TG7A 2Y6FA 1PVC1 2YHJA 2ZS6B 4Y5TA 5FPBA 2Q1FA 3GJBA 4Y24A 5JUVA 4HK9A 2DYCA 3KB5A 1UPSA 5C3QA 4NOTA 1IQDC 1XXNA 2W1WA 2XOMA 3ILNA 5T5JA 4MYEA 2XVKA 3VD5A 3O7OA 2FHRA 2GH8A 4IEXA 1PGW1 1R082 1RJ7A 4UI9L 2V4AA 1UZVA 3KZ4C 2BOJA 3UGFA 5KC5A 3E5XA 3AL6A 5DDJ3 3SNMA 4AE2A 3VD4A 1ENSA 1CAWB 2ZGPA 3Q8BA 3AYDA 4XILA 2EALA 4YW2A 5LASA 3PDQA 4CCMA 5FZGA 4EWEA 4FPYA 4FPHA 1W3VA 1F31A 4BK4A 2R062 2Z4FA 1UMHA 5FYYA 1G9DA 2AC1A 4B1MA 4E27A 3SEPA 2WINB 4JQTA 2PHFA 3ATGA 5DZEA 1Z78A 3U78A 3NWKA 4UOJA 4AK3A 1TZOA 2V73A 5CKNA 2VOWA 2PHWA 4AEDA 2FZ1A 2VQ0A 1T6BX 1H9WA 4B4PA 4AAPA 1RL3A 4GXLA 3VBRC 5JI9A 3M3OA 5L7OA 3O1TA 1H2MA 2F6BA 2VD7A 3TN93 4BDVB 4H7LA 1O4YA 2XLAA 1GR3A 1FYUA 2RS13 2HLEA 1JN2P 1XQNA 4OMCA 3APBA 1NKGA 4C0HA 2QQWA 2K9ZA 4Z8BA 1V70A 2JDNA 4XETA 2EF6A 4IV1C 5GLVA 4A6SA 4IEPA 4PIYA 1CWPA 2VQUA 2BUKA 2OVUA 4QX0A 2G9FA 2C9AA 3DUIA 2EIDA 5FPZA 4XBQA 5A7SA 4COZA 2ZPXA 3N9OA 4ET7A 5APAA 2OS2A 3JB4C 4KGGA 5FZFA 5L7OC 2XPJA 2OW4A 2VMEA 3M4FA 3T4HB 1JMUB 1HQWA 1Q43A 4LBQB 2WQ8A 5IHRA 2ZGRA 1KXGA 5D2AA 1O3RA 3WD5A 2ZXQA 5J36A 4CP2A 4BQWA 2XVLA 5JMCA 2WDBA 4YG0A 3AKQA 1POV1 2DBNA 1RUD1 4GAZA 3DPRB 4AI0A 1C8M3 1VBA1 1MVQA 4NO4A 2CU5A 4SBVA 1IKQA 1AJKA 1U0AA 3ZM8A 1UPIA 4QKFA 4BMBA 1S2EA 1PM7A 1REEA 1XE7A 3TEZA 3ZN4A 3RZHA 1AYN3 2E63A 5DN2A 2D6NA 2QQMA 1G9CA 4XEZA 2CGNA 1YQ8A 4Q1RA 4AXOA 1EAH2 4E2SA 1DGWA 1SDWA 4LJHA 1S2KA 4OUEA 3U75A 1ZBE3 4AFMA 4JGYC 4QGLA 4B8EA 5IAXA 5IT6A 4YGCA 3HIFA 3TYJA 2A75A 4WZFA 2Q1ZB 1GWKA 1LOCA 1JHNA 3FHAA 3OBZA 3VBFC 1CAUA 3CL1A 4R8HA 4WM8C 2WKKA 1W6QA 4UW4A 4HSLA 4CDUA 1WD4A 1BVP1 2YPJA 1YQ5A 1C1FA 2R043 4YW6A 5LRSA 3ACFA 1Y3TA 2Y64A 5FO8B 1NZIA 1CN1A 3BTYA 1FMD1 4EE2A 3UJOA 2EIEA 5IWFA 2CTVA 5FOBB 2QDNA 4MUVA 4W50A 1J3QA 2RM21 2UWBA 4AI3A 5IVBA 3AX4A 1J3RA 3TOJA 3EMRA 5GLTA 4CCLA 3A0NA 2YROA 1RUJ3 2IXIA 5FYBA 3WW4A 1GICA 1HJFA 1G8WA 3W21A 3ZYFA 1AR81 5FCCA 5FUPA 3W5NA 4O9GA 1AR73 1AYM2 3O0VA 3WNNA 4LMFA 2OPWA 4QQPA 1E57A 4KBZA 3IDCB 5CZKA 3VBUB 3E6CC 4WVMB 5J09A 5HV4A 2C9KA 2R16A 1SLAA 3E97A 4XCAA 5EPAA 4F8AA 3CJXA 3O1MA 3MGUA 3ES4A 1H1MA 2ZAAA 4HZFA 2ZEYA 3H1MA 3LDKA 3TRSB 1AYN2 2LTNA 3ZN5A 4Q8KA 2IXKA 2VUDA 2J1RA 2HEVF 2VCAA 2XJQA 3GJAA 4XE9A 4MSVA 1X8MA 4QQLA 3U1XA 1G9FA 3WG1A 3R6SA 2D6OX 1WMFA 5JXIA 1PO13 1UY1A 5F3IA 1RUC1 3QD6A 5FXVA 1Q8PA 5FZOA 5D8AB 5FZAA 1D0GA 3B00A 2ZX3A 2RMU3 4OYUA 5JI7A 1W0OA 2FDGA 2ZHMA 1XRUA 1IQAA 1UXXX 2VY0A 2ZX2A 1JOJA 1VBE1 4YVWB 2B39A 2NQYA 4QPIA 5FZCA 2JE8A 3I2DA 2W1UA 2RV9A 5A6YA 2VZPA 4XJ8A 2VO5A 4QPIB 2E51A 1DQ6A 2CSGA 2VCCA 3VZMA 1UZ0A 2Y60A 4P9XA 1W6PA 4TLFA 4LKEA 5ERLA 3GDBA 3JB8A 1UU4A 3RYPA 3ZX7A 4CU9A 3QOPA 1JBCA 1CZVA 5DAWA 3WLUA 1LU1A 1EP0A 4JVAA 3FBYA 5FXZA 3WINE 4BLJA 4B7EA 1R1A2 3R4UA 4KI5M 2VVFA 2DUOA 1FAYA 2A6ZA 1N1YA 5A70A 2YU1A 2VZ3A 1KGYA 3R4DB 3B9CA 3BOWA 1NE4A 1QKQA 3LKJA 3ME2A 4ZPIA 1XE0A 1C4RA 1R091 2CAVA 2P2KA 2JENA 3C7OA 4Y4YA 1KEXA 3C7FA 3PVNA 1J3PA 1GKBA 2FCVA 4UT5A 1WA4A 1AHSA 1UYZA 1ULFA 3M1HA 3LAGA 5FDBA 5FUIA 2D3SA 1C28A 1Q3EA 5GLZA 5FZ3A 4CSWA 4N8MA 1RUF1 1CPMA 4TWTA 1RYYA 5FKCA 5GKAC 2NM1A 5AFBA 5E16A 1CESA 2W2IA 5GM0A 2ZAHA 3ZFFB 1F4HA 1RUI1 1XNBA 2PAEA 1V0AA 1R083 5HPOA 2ARCA 3IWZA 5CFCC 1AR83 4A4AA 5C4WB 5FK8A 4CYDA 4CZSA 2WSVA 1OKOA 1FATA 3NAPC 4EYUA 3B02A 4L9BA 1CVNA 4LITA 4MZUA 1H2LA 5FZLA 2VR4A 1MR5A 5JAXA 5JPNB 3LZZA 1SZBA 4HSJA 4GA9A 1DLLA 1JXNA 1PGW2 3U4SA 1OQDA 1C5HA 4IEYA 1VB2A 2P1BA 5DZFA 4KQ7A 1D2SA 2ZMLA 3SCGA 5EJ3A 4QX8A 1H9PA 2JG9B 1XNDA 3PUHA 1A3KA 1HB3A 4LUKA 3VV1A 3WNKA 3ITQA 5C33A 4HVRA 1RUE1 3ZFGB 1MEC2 2W9XA 3CKHA 4HG6B 3ZYGA 3ZSLA 1J1LA 2RS51 2WAAA 4OQ8A 2WC2A 4KL1A 5DDJ1 1W9SA 4INDA 4NPLA 1W0NA 1XB9A 4LTAA 4YFWA 5FY0A 1Q8OA 1VAMA 3D6EA 5ACA1 4XTPA 5K0UC 2JE7A 4LK6A 4NIAA 1LB2A 3LEKA 4Y1YA 2AH2A 2QE3A 3ES1A 4BH9A 1W9TA 1DCSA 4XJAA 2JDAA 4N90A 1OVSA 3K4DA 5FY7A 3VKMA 1O7FA 2O8QA 4CU6A 1UL9A 1OQEA 4RHV2 4C0BA 5BY5A 4DS0A 4QB1A 2PFWA 3OB8A 1EPZA 1C5IA 1RITA 2R073 3NV2A 2HWE2 3I3DA 2PLV3 3K75B 4RHV1 4WVWA 4B3NA 1RXFA 3W5MA 3X29B 2JDYA 2XB6C 5CB7A 4RS5A 2JECA 2WQ4A 1PNGA 4Q4V1 1H8TB 3GHMA 5FY9A 3O0XA 3DPRC 4ISQA 4C1XA 5BPXA 2ZGOA 1LHOA 5DMYA 1CONA 3R0RA 3POYA 1OF3A 2JG8A 4BE3A 5CFDC 2NZ9A 4CPBD 4ZU7A 1XC6A 3J7NA 1JI6A 4CEYB 1E5SA 1D2QA 1LOEA 1LU2A 2VE1A 5DPNA 5FZ9A 4M0NA 1VMHA 4NIDA 4EWDA 5T50A 3O12A 4H2AA 5FKBA 1SLIA 5CG8A 3AK0A 4D0QA 3MW4A 4UF0A 5IUQA 4YGBA 5L7OB 4ZHNA 3TEXA 4JGZB 4OHVA 4Q0VA 1QU0A 1AR93 1JW6A 4CDXC 2G9ZA 2WT0A 3OOXA 1QH7A 1PK6A 2JIGA 3GF6A 2D97A 2RJLA 3AKRA 3WF3A 4AL9A 1JS9A 3WNOA 2QDRA 4C1WA 1I6XA 4COVA 4Y4RA 4U36A 1JYVA 4COYA 3MZHA 4DRRA 4LLFA 1I9RA 2YFZA 3INAA 4Z1VA 2C5DA 3WF4A 2AR6A 2B5HA 4ZU4A 1PVXA 3VZJA 4IETA 5A3TA 5JLVA 1VBC1 2IXLA 3LA3A 3S57A 1IG3A 4MO3M 4Y1ZA 2G4IA 4AEDB 2ADDA 5EYXA 2O1QA 4Q4X1 2WS93 3H1WA 2AENA 1D7PM 4A7ZA 1DBNA 3LIHA 1DQ2A 4Q4X2 1RUOA 1QIQA 1UX7A 4P5HA 1AR91 1DYOA 5A6XA 2HWB1 4LBOA 5F2WA 2Y0OA 1HXS2 3LEIA 1IGOA 5LRRA 2OX0A 2ZX0A 1JODA 4N43B 4BIFA 4Y20B 2ZZJA 5FTTC 1RC6A 1HRI2 5FO7B 1EY2A 2BRTA 1ULCA 1GNYA 1ND2A 1YQCA 4MV2A 1FPN3 4P08A 2IC1A 3RRDA 1ZZ7A 4IV3B 3AJZA 4ZZ8A 1LR5A 3JBG1 1SLLA 4UFMA 4I3GA 4CEYC 3EYPA 1G9AA 1LCLA 4IEUA 1AR82 4KNCA 1QXRA 1UMZA 1US2A 1CIYA 3FL7A 2E26A 4J1WA 3IN9A 5FLIA 3C2UA 5IYYA 4KMQA 3IIIA 2F4LA 1YRZA 1CAUB 3J8F1 5IFTA 2XMLA 5BNOC 4YGDA 3VDDB 4HANA 1AXYA 5FPLA 3K4ZA 3URFA 1STMA 2NP0A 4F7ZA 2ZOEB 3OG2A 1RUJ1 1F4AA 4LA2A 5KXDA 4P9GA 4K8RB 1UX6A 1DQ5A 5FFOC 1MS5A 1NCRA 3N4MA 1CX4A 1FPN1 1LOFA 3D0SA 4BCUA 1ND2B 4FQZA 1WWYA 5FYZA 3TNPB 4BM8A 1NX9A 2DF7A 2CWSA 2VUJA 1S0BA 3N7JA 3NNGA 1O6UA 3GZEA 3MFCA 4K1YA 4XFHA 2ET1A 2XVGA 4YVSB 1MQTA 1TNFA 1FX5A 4JCKA 1W6OA 4E4DX 3H8RA 2BFUS 2O14A 4W6YA 1V6LA 3WVJA 4JGYA 4PIZA 1NA1C 2FCTA 4LLOA 4LQRA 3BU7A 1UYXA 1DYKA 4EN7B 2I07B 2VOXA 5FZOB 1E5IA 1QJFA 1UYPA 4XDOA 4E8CA 1SFPA 1WBLA 2Q8EA 2I45A 3RI9A 2BNMA 5C9AA 3OD0A 3KV9A 1WCDJ 3FJSA 5JOWA 5FYSA 1YEWA 2FDJA 1W8NA 4HMZA 1OKQA 3HT1A 5K0UA 5LK5A 4YFZA 2EXKA 2WRAA 3KMHA 5FP7A 1GOGA 1GP6A 1QJY3 2XQRA 3K3NA 1GLHA 1QGLA 4KH9A 4YG3A 1F5FA 3VBOB 1OD5A 3ZSMA 3MF6A 5JIAA 4AF9A 1O4TA 1YI7A 2W46A 3RSJA 5A7NA 5LEKA 5G05L 4YM1A 1KDKA 3VZNA 1IHMA 5EHDA 4NHYA 4A42A 2IXHA 4LO4B 4QHZA 2WJSA 3OPZA 3MIDA 3UV9A 4A44A 2D43A 5JXJA 1K5MA 2UY9A 1UNBA 5ABJB 4GH4A 1PK6B 1AUYA 4YW5A 5A7QA 3EO6A 3PJYA 4CUAA 4Z2AA 1W6PB 3BGAA 4IE5A 3J7HA 1HRV2 2PQSA 2VBDA 3HBZA 3IKWA 5FMDA 4BQ3A 1RUG1 2WFF1 3I7DA 2BWAA 3RMYA 4QX3A 2YXSA 3H3LA 2K2SA 2VTFA 4NHKA 2JKBA 1LOAA 5JIUA 3A22A 3UGHA 5AVPA 4YNIA 3NW4A 2PLV1 4XZUG 2CV6A 2A3XA 2QQVA 4FPLA 5JSRA 1VBE3 4PBPA 2W39A 1W8OA 1YJKA 1WBFA 4K3UA 1N47A 3OBAA 4PBOA 2JD9A 4AFCA 1IPJA 2HWB2 5A32B 3VBSC 4ZKTB 1UU6A 5JPMB 1X50A 2ARXA 4QKBA 1PGL1 1ONAA 4WVVA 4ATEA 5FZ6A 5T5OA 1KJLA 3RI8A 3J4UH 1RB8G 3CBNA 3IAQA 4X6QB 2FZ2A 2HWD2 2QBXA 3IBMA 3POBA 1CJPA 2VCMA 2VZQA 2RR12 1ND3C 4ISRA 1DGLA 4M01A 2YPDA 1HJGA 2OZ6A 1AYM1 3CQOA 3DCQA 3J7MA 5KBFA 3IMNA 1SBEA 2VAUA 3DN7A 2XG3A 4QT6A 3RNSA 1CZTA 4MGYE 1D4M1 2EAAA 5T3NA 3DPRA 1X33A 4N7IA 1RUH1 3BYWA 3KV4A 5IW0A 1UWWA 2IFWA 1AR71 4GB32 1HN1A 4QPYA 3H42B 4AGGA 4RR3A 2IXCA 2X5IC 4GD4A 4IGPA 1NUKA 2VECA 4K1ZA 1DDLA 2H6CA 4CA9A 3VZOA 2VC9A 2VMFA 4ZU5A 4BK5A 5KHGA 1KITA 1HN0A 1KD7A 4FBFA 3S30A 3MIGA 1V6OA 1W3XA 2RE9A 2VZRA 2XJTA 2NN8A 3HNMA 3K46A 2X53S 1FPN2 2QQIA 2D5HA 3MBWA 3HJRA 1V9U1 1DQ0A 1BCXA 2O0OA 2EXIA 4S2FA 3ZDVA 2GDFA 3UKVA 4CUCA 1H0BA 1NCRB 1VBE2 4AWDA 4AVBA 4BQXA 2WQZC 1V9U2 5FZIA 1HXS3 1AX0A 4AVSA 2D98A 3FFQA 5CA6A 5FP4A 1CAWA 1FI2A 1OUXA 2VOKA 4PLOA 2J7MA 5LEJA 4O65A 5CIRA 5DG1A 4MX3A 5H9PA 4MGKE 2DTWA 2WNUA 3MLLA 4IL7A 3ZKYA 3JCIA 1IG0A 4QGNA 5FY8A 5JCTA 1BMV2 3FC0A 3TAYA 4D7TA 3MPBA 1PIV3 1V6MA 4CTEA 4DY5A 3AZXA 5C3PA 1Z0HA 2WS92 4PF5A 4Q4Y3 5T5PA 4LHSA 4CP9B 3ZPOA 5C8CA 4RD7A 2C1FA 4IV1A 2B45X 5IVEA 3S5AA 2TBVA 5FZEA 2ERFA 4BJ0A 2DV9A 1MACA 5E88A 3TBDA 5BYNA 4UAPA 4ES9A 5FY1A 2V5DA 2XBO2 1W6QB 1AJOA 1YI9A 4XF0A 4AI8A 1PX3A 2J1SA 1OHFA 1ZVFA 2X5IA 1S0DA 4UW5A 3WDWA 5LBFA 4NMIA 5CFCA 4AGVA 1GZTA 5KXBA 2VVDA 2SBAA 1LHVA 4GB33 3VDBA 4JRLA 2R063 2HWF2 3ZFEA 2VW0A 4V2VA 3LFIA 3V0BA 2HWF1 1NY71 1SG3A 3A4UA 3RYRA 1ZX5A 4CXWA 4CCKA 2JDUA 5C5TA 2PELA 5F6KA 2WABA 5H9QA 3RJRA 4AQTA 2WR9A 2XH6A 2VBPA 1GNHA 4HKLA 1O3SA 1EAH1 5FZDA 5GZGA 1WGPA 2OQ7A 5KHHA 2VZUA 1WCKA 4Q4V3 2XR4A 4DIQA 3VBSA 1REFA 4FXGB 4BIOA 2WL1A 2EVXA 4XQ4A 2H0BA 2NLRA 2A1XA 4PIXA 2HJIA 4CDQA 1HB2A 3OPWA 3FBMA 1RVF3 2RG4A 3AP4A 2JG9C 1EV12 2W1SA 1MS0A 1RTVA 1W04A 1S0GA 2DU1A 1IS5A 2SLIA 3B5LB 4LO6B 4FI9A 5KXEA 2DU0A 3HT2A 2BEOA 3LOIA 3M3QA 1JYIA 1T6GC 3H3ZA 4FPGA 3SITA 3WDUA 1UZWA 3T0AA 1W39A 4FO9A 1W99A 1R081 3ACGA 1UN1A 4M4RA 3UYJA 4JGZA 3TWIA 1VMJA 5F8PA 3MHZA 3ORJA 4AHWA 3NKGA 4XDPA 4LBJA 2WO7A 4WVZA 3SH4A 2DCZA 1C1LA 5FAXA 4BZ4A 1C8M2 5FBJA 4XMIA 1D4M2 1ND3A 2ZBJA 3RZJA 4TN7A 1V6IA 1RGSA 2WZ8A 1ASJ2 2JD4A 2YU2A 1UOJA 1HB4A 3MW2A 5EV7A 1VBD1 2AUYA 1LJ7A 1ZZBA 3HAGA 4IEOA 5A3OA 3UGGA 3VDDA 4D7YA 3VL9A 3USUA 2ATFA 3UK9A 2RHPA 3GNEA 3SC7X 1ZRDA 4DMIA 4YW1A 1C8NA 1EUTA 1NLSA 2YMZA 4JTNA 5B2GB 3I49A 3F2ZA 1GZWA 1U5ZA 2A3WA 3THTA 4DB5A 2OA2A 4K40A 2P3KA
chains in the Genus database with same CATH topology
4BISA 2XDVA 5FZIA 4EZ4A 3AVSA 5F32A 5IVJA 4LIVA 5FP4A 5FZ8A 5FZCA 5FY9A 4LIUA 2P5BA 5F5IA 5FPAA 5FY4A 5FY8A 5FXWA 3K2OA 3PUSA 5FZOB 3KVBA 3K3OA 3PURA 4QXCA 4XDOA 3N9OA 5A7SA 2Q8EA 4BXFA 2OS2A 5FZFA 5F37A 3KV9A 5FJHA 5FZ9A 3AL5A 3ZPOA 5IVEA 5CEHA 5FYSA 3PTRB 4LXLA 5FZEA 2Q8CA 4UF0A 5FUNA 2YBPA 4V2WA 5FY1A 5FYMA 4Y33A 5FP3A 5FP7A 5ISLA 3N9QA 4IGQA 3K3NA 3PUAA 5FXZA 3OPTA 3LD8A 4GAZA 3AVRA 2YBKA 2YBSA 5A7NA 3LDBA 5F3GA 2WWJA 3NJYA 5FP9A 4CCOA 4CCNA 3PU8A 2XXZA 4Y4RA 2YU1A 4UF0B 3N9LA 5FYCA 4V2VA 4NUBA 3N9NA 5FPVA 4QX7A 2PXJA 5FY5A 5A7QA 4CCKA 5A3TA 5LWBA 5FZ0A 5FXXA 5F3CA 5FWJA 4URAA 5F5CA 5A7WA 5FYIA 4QU1A 5A1LA 5FZDA 2Q8DA 5A3NA 5FZ3A 3N9MA 4CSWA 4BU2A 2OQ7A 5F5AA 5IVFA 4HOOA 2GP5A 4DIQA 5FV3A 3PU3A 2W2IA 4HONA 5F2WA 5FPBA 3KVAA 5A3PA 5IVYA 5LY1A 5FZ7A 2OX0A 2OT7A 4GJYA 5FZKA 5FZHA 4ASKA 3OPWA 4C8DA 3ZLIA 5LY2A 5IWFA 5FYTA 5IVVA 5IVBA 5FZ6A 4EYUA 5LW9A 2OQ6A 4LITA 4QXBA 4CCJA 4D6RA 1VRBA 5FZLA 4CCLA 4QWNA 5F3EA 5FYBA 2YPDA 3U4SA 5E6HA 3DXUA 3AL6A 3UYJA 5FYHA 4DO0A 5IVCA 5FZMA 4IGOA 5FZ1A 5FUPA 4QX8A 4CCMA 5FZ4A 3PDQA 4XDPA 2XMLA 4E4HA 5FZGA 5FWEA 5FYUA 2GP3A 5FBJA 3KV4A 5A80A 5FPLA 5IW0A 2XUEA 4D6QA 5FYYA 5FPUA 4TN7A 3RVHA 5FJKA 2YU2A 5F39A 5K4LA 4EZHA 5A7PA 4GD4A 4IGPA 5FY0A 5A7WB 2WWUA 4AI9A 3KV5A 4CUGA 3U78A 4Y3OA 5FZBA 5FYVA 5A7OA 3KV6A 5FYZA 3N9PA 5ANQA 5FY7A 5F2SA 5F3IA 4D6SA 4QXHA 5FXVA 3DXTA 5FP8A 4AAPA 3PUQA 5FZOA 5KR7A 5FZAA 5A3WA 4GJZA 2VD7A 5A1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BIS A;  2XDV A;  5FZI A;  4EZ4 A;  3AVS A;  5F32 A;  5IVJ A;  4LIV A;  5FP4 A;  5FZ8 A;  5FZC A;  5FY9 A;  4LIU A;  2P5B A;  5F5I A;  5FPA A;  5FY4 A;  5FY8 A;  5FXW A;  3K2O A;  3PUS A;  5FZO B;  3KVB A;  3K3O A;  3PUR A;  4QXC A;  4XDO A;  3N9O A;  5A7S A;  2Q8E A;  4BXF A;  2OS2 A;  5FZF A;  5F37 A;  3KV9 A;  5FJH A;  5FZ9 A;  3AL5 A;  3ZPO A;  5IVE A;  5CEH A;  5FYS A;  3PTR B;  4LXL A;  5FZE A;  2Q8C A;  4UF0 A;  5FUN A;  2YBP A;  4V2W A;  5FY1 A;  5FYM A;  4Y33 A;  5FP3 A;  5FP7 A;  5ISL A;  3N9Q A;  4IGQ A;  3K3N A;  3PUA A;  5FXZ A;  3OPT A;  3LD8 A;  4GAZ A;  3AVR A;  2YBK A;  2YBS A;  5A7N A;  3LDB A;  5F3G A;  2WWJ A;  3NJY A;  5FP9 A;  4CCO A;  4CCN A;  3PU8 A;  2XXZ A;  4Y4R A;  2YU1 A;  4UF0 B;  3N9L A;  5FYC A;  4V2V A;  4NUB A;  3N9N A;  5FPV A;  4QX7 A;  2PXJ A;  5FY5 A;  5A7Q A;  4CCK A;  5A3T A;  5LWB A;  5FZ0 A;  5FXX A;  5F3C A;  5FWJ A;  4URA A;  5F5C A;  5A7W A;  5FYI A;  4QU1 A;  5A1L A;  5FZD A;  2Q8D A;  5A3N A;  5FZ3 A;  3N9M A;  4CSW A;  4BU2 A;  2OQ7 A;  5F5A A;  5IVF A;  4HOO A;  2GP5 A;  4DIQ A;  5FV3 A;  3PU3 A;  2W2I A;  4HON A;  5F2W A;  5FPB A;  3KVA A;  5A3P A;  5IVY A;  5LY1 A;  5FZ7 A;  2OX0 A;  2OT7 A;  4GJY A;  5FZK A;  5FZH A;  4ASK A;  3OPW A;  4C8D A;  3ZLI A;  5LY2 A;  5IWF A;  5FYT A;  5IVV A;  5IVB A;  5FZ6 A;  4EYU A;  5LW9 A;  2OQ6 A;  4LIT A;  4QXB A;  4CCJ A;  4D6R A;  1VRB A;  5FZL A;  4CCL A;  4QWN A;  5F3E A;  5FYB A;  2YPD A;  3U4S A;  5E6H A;  3DXU A;  3AL6 A;  3UYJ A;  5FYH A;  4DO0 A;  5IVC A;  5FZM A;  4IGO A;  5FZ1 A;  5FUP A;  4QX8 A;  4CCM A;  5FZ4 A;  3PDQ A;  4XDP A;  2XML A;  4E4H A;  5FZG A;  5FWE A;  5FYU A;  2GP3 A;  5FBJ A;  3KV4 A;  5A80 A;  5FPL A;  5IW0 A;  2XUE A;  4D6Q A;  5FYY A;  5FPU A;  4TN7 A;  3RVH A;  5FJK A;  2YU2 A;  5F39 A;  5K4L A;  4EZH A;  5A7P A;  4GD4 A;  4IGP A;  5FY0 A;  5A7W B;  2WWU A;  4AI9 A;  3KV5 A;  4CUG A;  3U78 A;  4Y3O A;  5FZB A;  5FYV A;  5A7O A;  3KV6 A;  5FYZ A;  3N9P A;  5ANQ A;  5FY7 A;  5F2S A;  5F3I A;  4D6S A;  4QXH A;  5FXV A;  3DXT A;  5FP8 A;  4AAP A;  3PUQ A;  5FZO A;  5KR7 A;  5FZA A;  5A3W A;  4GJZ A;  2VD7 A;  5A1F A; 
#chains in the Genus database with same CATH topology
 4OZX A;  3CEW A;  4OMD A;  2WT1 A;  4YM3 A;  5C9A B;  1DU3 D;  1PX4 A;  4IE6 A;  2JJ6 A;  5F32 A;  5CYY A;  4LNV A;  2W87 A;  5M0T A;  2JEM A;  3TN9 2;  2BBA A;  4LOR A;  3ZSE A;  4I2O A;  1BBT 1;  2VGD A;  4CDU B;  5IK5 A;  4BXF A;  2B46 X;  2D93 A;  1F9K A;  2ZEX A;  3WG3 A;  4M0H A;  3AL5 A;  1COV 3;  3SMH A;  2F4P A;  2FDK A;  2ZGM A;  2R32 A;  3MV1 1;  3POE A;  2WA4 A;  4R9A A;  1UIJ A;  1XYP A;  3BI3 A;  3FUQ A;  1FMD 3;  5EYY A;  4HL0 A;  1LEN A;  2RDR A;  1FNZ A;  3AP7 A;  4EV0 A;  4LUM A;  1DGW X;  3CU7 A;  1CGP A;  1L3J A;  1YFY A;  2VVE A;  3AP5 A;  2DTY A;  3LDB A;  4R4X A;  5IAV A;  4Q4W 3;  5LA9 A;  2VL4 A;  2PHU A;  4IEW A;  4N53 A;  4J25 A;  1FNY A;  4KWL A;  3WUC A;  3HQU A;  3KT7 A;  5D21 A;  1UU5 A;  2MEV 2;  3T0B A;  3NL1 A;  1JU4 A;  2ARB A;  4CCE A;  2RR1 3;  1EPW A;  5IK4 A;  1WW7 A;  5E89 A;  5LWB A;  3M8L A;  2WZR 1;  1N3Q A;  5FXX A;  1RUF 2;  1SEF A;  1SFN A;  2PMW B;  1VBD 3;  2Q8D A;  3MIF A;  4YVS A;  1LHW A;  4XFA A;  5IVF A;  1M4W A;  3NKT A;  4HOO A;  2HWE 3;  1QJZ A;  4FFG A;  5JZG C;  1K5M B;  1HIX A;  4MHU A;  3KGL A;  3KS7 A;  3ASI A;  4KG8 A;  1S1A A;  3KVA A;  2W94 A;  3QAC A;  4W6X A;  4XHB A;  5FZ7 A;  1ENQ A;  3GHN A;  4QMA A;  5FOJ B;  3ZIW A;  4C8D A;  4MLO A;  1MS4 A;  4UW6 A;  4Y22 B;  4AW7 A;  1AF9 A;  1POQ A;  4Z82 A;  4Q4X 3;  3LQC A;  3WQB A;  1L7L A;  1B35 C;  3ACH A;  4FPF A;  1GZC A;  2B8M A;  2J22 A;  4I3P A;  4Q4Y 1;  5FYT A;  2L9L A;  3O1R A;  4Q5O A;  4XAE A;  1LHN A;  2NMO A;  2FQP A;  3NMB A;  3RG0 A;  1JYW A;  1Q8V A;  1VRB A;  4L11 A;  1Z7S 1;  2VUL A;  4QWN A;  2ZGS A;  1UKG A;  4LHK A;  4TYS A;  5E6H A;  5I0D A;  3UET A;  4TLG A;  3PMS A;  1GYK A;  5FMC A;  1UXZ A;  2JIC A;  3CJI B;  4AVT A;  4FOY A;  3BTX A;  3OGS A;  2AZ5 A;  5A80 A;  1H8V A;  2XUE A;  3J8F 2;  3MV0 1;  4PCR A;  3OEB A;  4WM8 B;  1UQX A;  2BQP A;  2P6H A;  4IER A;  4QXK A;  1OH4 A;  1PIV 2;  3POG A;  4QPG A;  3U4X A;  1AR7 2;  1AYM 3;  1GP4 A;  1LED A;  1MQT C;  1VMF A;  3FMG A;  3FUO A;  3MEP A;  1ND2 C;  4QB2 A;  4RYD A;  1SLC A;  1BK0 A;  3WW1 A;  1RUC 2;  2JXA A;  1DGR A;  3T3Y A;  5JR7 B;  3GBW A;  5FYV A;  1N1V A;  1P8J A;  2DUP A;  1IOA A;  3ACL A;  2BW8 A;  4D6S A;  1WCQ A;  2ZHL A;  4TSV A;  3ZPY A;  4YZ1 A;  1I5Z A;  3KT4 A;  5L19 A;  2ZX4 A;  4IQP A;  4N43 C;  1PVC 3;  1KFU L;  2PAM A;  4FPJ A;  1PMH X;  1GZ9 A;  3DGT A;  1WCS A;  3T2T A;  1WD3 A;  3MIC A;  2R04 2;  4JDO A;  1H4G A;  1ULO A;  4JKL A;  5J3U A;  4XDQ A;  3O1U A;  2BJS A;  3NNJ A;  4YG6 A;  3ZIX A;  4QDS A;  3WNX A;  3LEM A;  3J9S A;  4AG4 A;  4YW7 A;  5IVV A;  4JTO A;  4LE3 A;  2E6V A;  1QDC A;  3NVC A;  3Q8E A;  5F37 A;  2W52 A;  2LAL A;  2AEY A;  1ZYB A;  4D8M A;  1VRH 1;  2HWC 3;  2DVG A;  2QUO A;  4AQ2 A;  2ZHN A;  4KU7 A;  3QH6 A;  1DFQ A;  3Q9O A;  4XJU A;  5GZC A;  4UW3 A;  2XGX A;  3S6P A;  3WCR A;  1VBA 2;  4Y5S A;  3ZYH A;  2XKP A;  3KD4 A;  3R4S A;  1GWM A;  2DCK A;  4L2N A;  2ZCW A;  1NE6 A;  1XE8 A;  2GNM A;  2X29 A;  2HWB 3;  4IV1 B;  3ZXF A;  2XJV A;  2GN7 A;  2BYV E;  1NLQ A;  1EAH 3;  1HV1 A;  1W05 A;  1VAV A;  1ZBA 1;  3I2G A;  1LES A;  2VQT A;  1R1A 1;  3WNP A;  4AFD A;  3JQX A;  1QF3 A;  1G6N A;  4H14 A;  2D7F A;  4N53 B;  1QJX 2;  1NG0 A;  2VNV A;  3O5S A;  5DUW A;  2JG8 C;  4IDZ A;  5CFD A;  3VKF C;  3I2O A;  5L9R A;  1AX2 A;  3UES A;  4N7U A;  4ZY9 A;  4NII A;  3KHC A;  4BXS V;  5CAZ A;  2J1V A;  3HN3 A;  1JZ4 A;  5FYI A;  5E8A A;  3AMH A;  1E5H A;  4A7K A;  2GNT A;  3CO2 A;  5LK7 B;  1D0H A;  2P3I A;  4YPJ A;  4IW3 A;  5DUX A;  3N36 A;  3CDZ B;  2Z42 A;  4JRA A;  1S0F A;  1NYW A;  3J8F 3;  2WN2 A;  2UYB A;  2C4X A;  4QX5 A;  4E2G A;  4HKO A;  1CD3 G;  4CEW C;  5FZH A;  4CDX B;  1NXM A;  1EV1 1;  2JDZ A;  1UF2 C;  3IT8 A;  4UFH A;  1UD1 A;  3NNL A;  4FQ4 A;  2WZR 3;  4Z07 A;  1H4H A;  4M3C E;  1PNF A;  5F5Q A;  5T52 A;  1DZQ A;  2P37 A;  4GQ7 A;  2TNF A;  4L97 A;  3AB0 A;  4K20 A;  1MQT B;  2JWP A;  3QH7 A;  3RPQ A;  2XLG A;  1TQ5 A;  2A5Z A;  3D0J A;  2AGS A;  3FFZ A;  4X6R B;  1O5U A;  4XW3 A;  3OBR A;  5FLH A;  1H8T C;  3EXU A;  5BNQ A;  1C8M 1;  4OHX A;  2WO3 A;  2R06 1;  5DUU A;  2BNO A;  2FBE A;  4XC9 A;  1MZ5 A;  2EIG A;  4GB3 1;  1K45 A;  5FZ4 A;  3VBS B;  3VKN A;  2DVB A;  1AXZ A;  4CDW B;  4E4H A;  5K7P A;  3RWN A;  3W9A A;  1UZZ A;  2Q4S A;  2BPA 2;  4KGQ A;  3CJI A;  5C3R A;  2OUJ A;  1OFN A;  2GC3 A;  1C3H A;  3ZO0 B;  4EZH A;  3IMM A;  1RUG 3;  2WFF 3;  4I30 A;  1O5L A;  1ASJ 1;  3V64 A;  4ZXK A;  4CU7 A;  4QM9 A;  1W2N A;  2A71 A;  3I59 A;  4PDW A;  3SH5 A;  3N9P A;  4G9S B;  1VBB 2;  4C91 A;  3M7A A;  1PK6 C;  2MPF A;  2A6Y A;  2HH9 A;  3ZFF C;  4XTM A;  5FBZ A;  5SV8 A;  3CIH A;  2D6M A;  4MXW B;  4Q4V 2;  1GMM A;  2AYH A;  3ZXJ A;  3ZN6 B;  2VQA A;  3TN9 1;  2J42 A;  1DQ1 A;  3JUU A;  1ZRE A;  3LDR A;  4AVC A;  2HWE 1;  2ZGN A;  2P5B A;  2KM2 A;  2NMN A;  5FPA A;  2WS9 1;  2W95 A;  1QH6 A;  1PO2 1;  5FXW A;  4QKD A;  4PI2 A;  1WLD A;  4E4Z A;  4N43 A;  3A0K A;  4LK7 A;  1RIR A;  1HDK A;  1LOB A;  2VMI A;  4YLZ A;  4YZ3 A;  2LM3 A;  3USU B;  3BN6 A;  1Y9M A;  1WLC A;  3EBR A;  1AR6 1;  3AYE A;  3ILR A;  3BTZ A;  4GKX A;  2PA7 A;  3ZKU A;  3ZXK A;  2BGO A;  5E1R A;  5CKQ A;  5FMO S;  2GU9 A;  2YC4 A;  3VBH C;  5LA0 A;  5DUV A;  2PHR A;  2YDE A;  1VAL A;  4EN8 B;  1OPO A;  1A78 A;  4QU2 A;  3IDA A;  3VZL A;  4J6G A;  5JR2 A;  3H8O A;  1XNC A;  1UW8 A;  3HD8 B;  3WDX A;  4E8D A;  3AZZ A;  1POV 3;  3RYK A;  1YFU A;  4HPK B;  3VBO A;  4CCN A;  3V0B B;  1BXH A;  3VD3 A;  5C8C C;  3AM2 A;  5FYC A;  1JYT A;  1VRH 3;  4ZS2 A;  3ZXE A;  5DG2 A;  1OSG A;  1ZBA 2;  3WHU A;  4AVA A;  4D3W A;  2ZGK A;  2XQX A;  4LO8 A;  5FY5 A;  5CBL A;  3K77 A;  1KDM A;  1K42 A;  3AYC A;  2ZAC A;  4WV8 A;  1K5J A;  4OFG A;  4QPI C;  1W8Z A;  1YLL A;  4Q8L A;  1QJX 3;  1WW5 A;  2JDK A;  3FHQ A;  4KWJ A;  4P9Y A;  4NRM A;  2RS1 2;  3I2I A;  3C7H A;  3T30 A;  1D4M 3;  1QEX A;  1OMI A;  5LCW L;  1ZZC A;  1YQ6 A;  2A7A A;  4HON A;  1RMU 2;  1CAX B;  3GGL A;  3SEE A;  4CUB A;  1DLC A;  2R7E B;  1Y9Q A;  3QCW A;  5BNO B;  4CDW C;  1ZA4 A;  1UAI A;  5HXV A;  3PIJ A;  3VKO A;  3ON7 A;  3H8X A;  2BOI A;  1RXG A;  4HPK A;  3IZO A;  5AC9 1;  1H30 A;  1DG6 A;  2OQ6 A;  2Q5T A;  2RJK A;  2VZT A;  2HWC 1;  3GAL A;  3PL0 A;  1UY3 A;  5D1I A;  4CCJ A;  1DP0 A;  3LSE A;  2XHK A;  5JXH A;  4XYX A;  1F2N A;  2RM2 3;  4Y22 A;  1H6X A;  2HWC 2;  4XFG A;  4LT5 A;  2KD7 A;  4O9E A;  5GJ6 A;  2VPV A;  3WF0 A;  2ZAB A;  4IE7 A;  1JZ7 A;  1F8V A;  2LS6 A;  2DVD A;  3VBH B;  3VHP A;  4YM2 A;  3IDB B;  4QDQ A;  3KM5 A;  3VZK A;  3JD7 3;  1WUV A;  4KWU A;  4B4Q A;  3TEY A;  4QDR A;  5DDJ 2;  2GH2 A;  2XL9 A;  1RMU 3;  3RVH A;  4UFJ A;  4P9J A;  4XQW A;  4HFS A;  2DVA A;  3UKT A;  3K51 A;  5I0S A;  1COV 2;  2IWG B;  2YG0 A;  3RJ2 X;  2WWU A;  1SBF A;  4AEM A;  3ZDS A;  2WNE A;  1QQP 2;  4FAG A;  1WCU A;  4IE0 A;  3ZSJ A;  2RS5 3;  1HRV 3;  3FHI B;  2YGM A;  2DCY A;  3UL2 A;  3IB3 A;  4QXH A;  5J98 B;  3DXT A;  4DNY A;  1WLT A;  3W59 A;  4QB6 A;  4HLT A;  2BGC A;  4XF1 A;  3VBF A;  3R05 A;  4PF1 A;  2XWJ B;  2D6P A;  1RUD 3;  1DIW A;  2GC0 A;  4JKK A;  2VNG A;  2E7T A;  4EZ4 A;  3H9A A;  2R1B A;  4PDW B;  3V0A A;  1WMD A;  1RHI 1;  4XUP A;  5IVJ A;  2WAO A;  2WSU A;  3FN9 A;  1J84 A;  3T2Q A;  1W28 A;  1NCQ A;  3SXW A;  4WVM A;  2XUM A;  2YB7 A;  3BPS A;  1GAN A;  4NAO A;  2EAK A;  3DEC A;  4FPO B;  3MLK A;  1YFX A;  4NHM A;  3A7Q A;  2RS3 2;  3PHM A;  1PHM A;  2DCT A;  2OII A;  3O1O A;  1QJU 1;  2VXR A;  1NLR A;  2XJS A;  3W58 A;  2IFR A;  4A3X A;  2BFU L;  3WG2 A;  2FDI A;  2BGP A;  1OT5 A;  3TEW A;  3MDP A;  3VDD C;  5FYM A;  5FRA A;  2DUR A;  3B94 A;  1B35 A;  3PTY A;  2BVV A;  2GC1 A;  4DZG A;  3VB9 A;  5FK7 A;  1I5P A;  1LEC A;  4AHX A;  1YNA A;  5BNP B;  2WN3 A;  3NST A;  3ZR6 A;  2ZMN A;  5F3G A;  1IS3 A;  1RUD 2;  3WF1 A;  1A8M A;  1QJX 1;  2QQU A;  4G3Y C;  4O61 A;  1GP5 A;  4GAL A;  5DQ0 A;  1W9F A;  4IV3 C;  4BPZ A;  2X09 A;  5A3M A;  4Q29 A;  2W3J A;  3LF7 A;  4UYB A;  3T09 A;  3QLQ A;  5BXX A;  1IZ3 A;  5FMB A;  1S0J A;  2EIB A;  1WW6 A;  3CNA A;  3RZZ A;  1W8U A;  5FLJ A;  4URA A;  2MHF A;  1J1T A;  3GBF A;  4DOU A;  3PLQ A;  3DF0 A;  4S2D A;  1JUI A;  5EXO A;  5A1L A;  5K0U B;  2VH9 A;  2ZGU A;  3N9M A;  1QOT A;  5HCF A;  3AXE A;  4BU2 A;  4XUR A;  1XYN A;  4XAB A;  2UWA A;  3GYD A;  4OHZ A;  2WNO A;  2XJU A;  1VJ2 A;  2VZO A;  4OI2 A;  5FV3 A;  1VBA 3;  1RUF 3;  3ZMN A;  4AED C;  2PLV 2;  2VMG A;  5IVY A;  3O0W A;  4KWK A;  3ZLI A;  3T2O A;  2VZ1 A;  4MXV A;  3DL3 A;  1NZC A;  3NNM A;  4BA6 A;  1TEI A;  3QBQ A;  4FPE A;  3WQ7 A;  1A8D A;  1OH3 A;  1GNZ A;  4JAA A;  4QAW A;  5C71 A;  1T2X A;  1LKN A;  3KCY A;  2HYK A;  1PO2 3;  3C8X A;  3RZG A;  1SFY A;  2W47 A;  1ZRF A;  4Y20 A;  3DXU A;  4XBN A;  4BQY A;  4A6O A;  2GNB A;  4B7K A;  1X9T A;  4CXY A;  4IGO A;  2VMC A;  3RZK A;  2ZGL A;  4Q0S A;  4AQS A;  1Y43 B;  4RQP C;  2YZ4 A;  3WZ1 A;  4BB3 A;  3T0D A;  1XNK A;  4M3C B;  4COU A;  1W2U A;  1GUI A;  2I74 A;  3RDI A;  2DBI A;  5FQ0 A;  3VD7 A;  4NRQ A;  5A33 A;  4R9C A;  1APN A;  3WXP A;  1GQP A;  3TNQ A;  3PME A;  5I8S A;  3VHO A;  1W90 A;  1RUH 2;  5ACA 2;  5F39 A;  3NQH A;  1ND3 B;  4GWM A;  1AR6 2;  4FTE A;  2PYT A;  4MGT A;  4UWD A;  5C8W A;  2R0H A;  3OYW B;  2VW2 A;  4DQA A;  4IV3 A;  1SBD A;  1QXJ A;  1GV9 A;  1IPS A;  1HRI 3;  3AKS A;  1COV 1;  4JHZ A;  5CKM A;  4CDW A;  3M3I A;  2Q8O A;  1I1E A;  5A7O A;  2HEY F;  1QQP 1;  4XOG A;  2V5Y A;  2XKO A;  1BEV 3;  2VBB A;  4B29 A;  3BU0 A;  1RUH 3;  3LA7 A;  2YC0 A;  3AYA A;  3U0Z A;  2QQN A;  4XXA A;  2XDV A;  1LGN A;  5LAT A;  2XJP A;  1X9P A;  4FPC A;  1GOF A;  2K46 A;  1W8F A;  5HCH A;  3BIE A;  2BV4 A;  4XHX A;  2RS3 1;  3PUS A;  4DPN A;  5IVC A;  3NO8 A;  5IJR A;  1JYX A;  2WLQ A;  1PO2 2;  5ANN A;  4L0P A;  1UZY A;  4GIQ A;  2P4E A;  2Y6G A;  1ZM1 A;  2PTM A;  3PTR B;  5SV5 A;  5FRE A;  4GWI A;  4IEV A;  2YBP A;  1RUI 3;  4MVT A;  3B69 A;  4CU8 A;  1RVF 2;  5GAL A;  4PQ9 A;  2CYF A;  1JU3 A;  2R6Q A;  5BNN C;  1ULG A;  1KJR A;  3OY8 B;  2FMD A;  2ZX1 A;  4LOT A;  1OF4 A;  1OLM A;  3J26 N;  4QM8 A;  4LOS A;  3F95 A;  2B7Y A;  4DEV A;  4OI1 A;  1CAV B;  4YVW A;  3B01 A;  2HWD 3;  1OD3 A;  2RDQ A;  5L9V A;  5FQ0 B;  4FFH A;  5FPV A;  5I91 A;  4YZ5 A;  5IK7 A;  4CP9 A;  1J58 A;  1O8P A;  3VKL A;  4YGE A;  3OF1 A;  2JE9 A;  2E7A A;  3V65 A;  3WP3 A;  5CFC B;  4FSJ A;  5FWJ A;  1IS6 A;  4X8N A;  3ZMO A;  3B9I A;  4LE4 A;  1FOD 1;  2D44 A;  4LBK A;  1AZD A;  1PVC 2;  1VR3 A;  4MG2 A;  1HXS 1;  1UKR A;  1RUI 2;  2ES3 A;  2Q0A A;  2YGL A;  3BPZ A;  1XNA A;  3PU3 A;  1OOP C;  1I3H A;  4NWV A;  3VBO C;  4FVV A;  1FMD 2;  5LY1 A;  4IEZ A;  4GJY A;  1QWR A;  1FXZ A;  1RUC 3;  2XON A;  2AEZ A;  2GAU A;  4Q0U A;  1UCX A;  2GN3 A;  1PMI A;  4YSF A;  2QQO A;  4K21 A;  2UU8 A;  2OXB A;  5C70 A;  1S0I A;  1GSL A;  1NXD 1;  2ETE A;  2JKX A;  1ST8 A;  2VOT A;  1W6M A;  4D6R A;  5KXC A;  1GOH A;  2RS3 3;  3WOG A;  4YZ2 A;  3FZ3 A;  5I0T A;  4XQD A;  1WME A;  1UY0 A;  4FOV A;  3VHN A;  4UBH A;  1V6N A;  5FZM A;  2QTW B;  1CIW A;  4RS5 B;  3U10 A;  1PGS A;  3P3N A;  2PHL A;  2XHN A;  3FLR A;  3HVD A;  2WWS A;  3ZXA C;  2PHX A;  2WFP A;  4LR4 A;  5A3U A;  2A6X A;  4IXL A;  1VAK A;  2H6B A;  3AMP A;  2ARA A;  3TB0 A;  3HEI A;  4OCT A;  2P17 A;  5A6Q A;  5A3L A;  3VUO A;  1LAJ A;  5B4N A;  4KG0 A;  3RQ0 A;  1GFF 2;  4QX1 A;  2BER A;  1OQ1 A;  4ZS3 A;  1OLQ A;  5A7W B;  3T1M A;  1TE1 B;  3WNL A;  4GMP 1;  1MS1 A;  5ABJ A;  3AKT A;  5JWP A;  3N3H A;  1ZRC A;  3VHR A;  1VBD 2;  3RFR A;  5ACA 3;  1YIF A;  4FXK B;  1ASJ 3;  4N9I A;  5GZD A;  2ORZ A;  5C9A C;  1NCQ B;  5KR7 A;  2W91 A;  4XF9 A;  2PHD A;  4NPM A;  3L2H A;  1TMF 3;  4E2Q A;  1UY2 A;  4NIG A;  4I01 A;  4CEW B;  5I8Y A;  3N7M A;  4NN0 A;  1GQG A;  5LBB A;  2BZD A;  1O3Q A;  2QQK A;  4AGR A;  3KF5 A;  3WUD A;  5CNA A;  1N3P A;  2LW8 A;  4QX2 A;  2J1U A;  5F5I A;  4CDQ B;  3WQ0 A;  2Q8C A;  1RIN A;  3K2O A;  4YAR A;  3EQE A;  2UY8 A;  3KVB A;  4QXC A;  1W6N B;  2WA3 A;  1SAC A;  4R4Z A;  4NIH A;  1BK1 A;  1BBT 2;  5JSP A;  2EIC A;  1YIP A;  4Q27 A;  4EN9 B;  5CEH A;  1BMV 1;  1J83 A;  1XU2 A;  3HQR A;  1Q8Q A;  2VG9 A;  3VGI A;  5JSO A;  4XJ9 A;  2AAC A;  4CCC A;  2G9G A;  4FPK A;  1SPP A;  3JD7 1;  4P00 B;  3OUI A;  3ZFF A;  3ZFG A;  3HNB M;  4XMA A;  1VBB 3;  3IIA A;  3AZV A;  2Y0I A;  4A7Y A;  5J1X A;  3WDY A;  4M00 A;  2B42 B;  2DUQ A;  4LUL A;  4W65 A;  2R07 2;  3KF3 A;  2W5F A;  1JZ8 A;  3OD4 A;  4PDW C;  3MFA A;  5G04 L;  1J59 A;  2ET7 A;  2C26 A;  3AFK A;  3N9L A;  4XUO A;  4COW A;  4AYU A;  3KQ4 B;  3N9N A;  2ID4 A;  1HRV 1;  1LOG A;  3MF9 A;  5AC9 3;  3OY8 A;  1YYN A;  4AFB A;  4LPL A;  4CEY A;  1AX1 A;  1W6N A;  5C6C A;  2HWF 3;  2VMH A;  1BJQ A;  4XIO A;  4ARX A;  3ZYJ B;  1W03 A;  2RMU 2;  1WA6 X;  1AL2 1;  3U14 A;  4HXC A;  1CAX A;  4Z92 B;  1H8T A;  1QJE A;  2B9V A;  4XJZ A;  2ZHK A;  2UWC A;  1YFW A;  3AMN A;  3O1S A;  3CZU A;  5GZF A;  4NHX A;  1SPP B;  1OA2 A;  3U37 A;  2XBO 3;  3MIH A;  2EXH A;  3P5B A;  2X8K A;  4DXS A;  1S4C A;  4YYO A;  2ZJC A;  1AR6 3;  1S0C A;  4MGS A;  3BVC A;  5EP9 A;  3EB7 A;  3HNY M;  2H0V A;  2JB8 A;  5K9Y A;  3ACI A;  2Y38 A;  5FO9 B;  2P6C A;  5H9S A;  2A70 A;  3SQO A;  3AP6 A;  1CZS A;  5AC9 2;  1LRH A;  4GH4 B;  2VTX A;  1OPM A;  2PQQ A;  4FOW A;  3H3U A;  4UFL A;  2E31 A;  1NQD A;  1G7Y A;  2Z2S B;  4JX0 A;  1V6K A;  2W0X A;  1OI6 A;  1QJY 2;  2B4K A;  3ZYR A;  1JUH A;  4P14 A;  1ZRR A;  4E4S A;  3GCW A;  3EHK A;  1F15 A;  3IM0 A;  4QHB A;  4EJR A;  4AHZ A;  2Z79 A;  1MEC 1;  4A2U A;  4AFA A;  5FWE A;  4L92 A;  1NA1 A;  1RUJ 2;  2GP3 A;  2RS5 2;  1AL0 G;  3CHX A;  3WG4 A;  4K7J A;  1XBF A;  4P9L A;  2ADE A;  1POV 0;  2Y6J A;  3E6B A;  5D8A A;  4NE9 A;  5EZW A;  1KS4 A;  4XUT A;  3W20 A;  2C0Z A;  1JYC A;  5K4L A;  3DYP A;  4BHP A;  3G6J B;  4JQR A;  3I3B A;  2YYO A;  1OA4 A;  2WNV A;  5IFP A;  4EWA A;  2ZMK A;  5LBC A;  1PIV 1;  4M3C A;  1D4V B;  1DF0 A;  1XYO A;  3KV5 A;  5DXD A;  3SHR A;  2DDU A;  3OUH A;  4JC1 A;  5LA2 A;  1DZT A;  2WNV B;  5DAB A;  5ANQ A;  3RS6 A;  2JX9 A;  3LPG A;  3MUZ 1;  2YC2 A;  3ZR5 A;  5HV0 A;  3E6D A;  1SCR A;  1ZA7 A;  4LA3 A;  4Q1P A;  4JZR A;  4GJZ A;  5EIY B;  1HW5 A;  5A1F A;  3KWV A;  3ENR A;  2VMD A;  1O4Z A;  4NRP A;  5T55 A;  1YQ2 A;  2J1A A;  3WW2 A;  2VZS A;  5C8C B;  3VBR B;  4NRO A;  2WLP A;  3USS A;  4RS5 C;  2RDN A;  3OGR A;  4LKD A;  3D8C A;  3RZM A;  1GWL A;  5JZG B;  3FE5 A;  4CRQ A;  1H2N A;  1YCI A;  3AZW A;  3PUI A;  3K3O A;  2D5F A;  2ZKN A;  1LHU A;  1W9Y A;  1Q5O A;  4P9W A;  4BQ2 A;  3ZYB A;  1UIK A;  3D3A A;  2BTV C;  3LWC A;  5CIS A;  3NAP B;  4LKF A;  4O7X A;  4RGA A;  4RSU A;  4AVV A;  2GMM A;  1JH5 A;  5C4W C;  2FDF A;  4AR2 A;  5L9B A;  1CJD A;  3I54 A;  4H55 A;  4I09 A;  1CAV A;  4K9S A;  4WM7 A;  5FP3 A;  3SIS A;  4NVP A;  1WKY A;  3N9Q A;  2R49 A;  3LCP A;  1L7Q A;  3AP9 A;  3LD8 A;  4NR1 A;  2BVB A;  2XJR A;  3AKP A;  4LHL A;  1PZ9 A;  4XUQ A;  4C90 A;  5JOY A;  1NA1 B;  2ZZQ A;  5CAD A;  3OGV A;  3NJY A;  5FP9 A;  3ZYP A;  1MVE A;  1FOD 3;  5DAX A;  4CCO A;  3PU8 A;  4L99 A;  4CP0 A;  3PNA A;  4UF0 B;  2Q1M A;  3P6B A;  2QVS B;  1WW4 A;  3BCW A;  2ZKL A;  3OGG A;  5HCB A;  3MO4 A;  4YVS C;  5HXM A;  2PXJ A;  4QPG C;  4F83 A;  2Y33 A;  3JZV A;  3WR0 A;  1HV0 A;  1FOD 2;  1NY7 2;  3IAP A;  3WP5 A;  1F35 A;  3I8T A;  4BOW A;  2IUW A;  4GZ9 A;  1AL2 2;  2ZEZ A;  3DKQ A;  3RGB A;  3WCS A;  4PLM A;  2KR2 A;  2BDR A;  4FFI A;  2JG9 A;  1V00 A;  2ILM A;  3V0A B;  4FCA A;  4W4Z A;  3WQ1 A;  4B4R A;  1QXP A;  2A6V A;  4YZ4 A;  4Y1V A;  1AR9 2;  1MS8 A;  1ODN A;  1PGL 2;  3HQX A;  4I0W B;  3CZJ A;  4NHL A;  4XUN A;  1XU1 A;  2WYF A;  4LBM A;  1UOB A;  4HN0 A;  1QHD A;  1Z7S 2;  5GLW A;  3WNM A;  5KHI A;  5L36 A;  3CLP A;  1BQP A;  3ZOI A;  2V4V A;  4XBL A;  4CDU C;  2QNK A;  1U5X A;  3IDE A;  1RUE 3;  2W08 A;  3O14 A;  3WP4 A;  5JZG A;  1ZZ9 A;  1DYP A;  1JZ2 A;  2NYY A;  3DV8 A;  4YVW C;  3I2J A;  1UOF A;  4IE4 A;  4Q4W 1;  1RHI 3;  4GKY A;  2LRO A;  4MH0 E;  2QJV A;  3WHT A;  4OQ9 A;  2R30 A;  3WF2 A;  3PVE A;  3M70 A;  4W6W A;  1SCS A;  2HYX A;  2MEV 3;  3V56 A;  2F17 A;  2HBU A;  4ATF A;  1QDO A;  1YHF A;  2VUA A;  3E5U A;  3ZVX A;  4BQ5 A;  4Y3O A;  5FZB A;  4CXX A;  1ULE A;  3POJ A;  5F2S A;  2VOV A;  2D6K A;  4KU8 A;  3GM8 A;  5A6Z A;  4Y1U A;  2JG8 B;  5TSW A;  2B9U A;  4FOQ A;  4XF3 A;  3VLB B;  4I0B A;  5BV6 A;  1M06 G;  2WZP P;  4BYY A;  1HKD A;  4HVQ A;  1BYH A;  4YRD A;  2QQJ A;  2EA7 A;  2ARE A;  4H3W A;  3VBF B;  2E32 A;  1ULD A;  1C57 A;  1UO9 A;  1CR7 A;  4LIU A;  5T54 A;  4EN0 A;  1BVV A;  1ALY A;  1UYY A;  2CL2 A;  2Y8K A;  3PUR A;  3ELN A;  5FPU A;  4N9H A;  2XL7 A;  1KS5 A;  4JGZ C;  2C24 A;  2X05 A;  3KGZ A;  5DAP A;  3WY6 A;  1MPX A;  4BLI A;  4RL7 A;  5C7G A;  1LUL A;  4HET A;  3KCX A;  4V1P A;  1OUS A;  3VN4 A;  4FFF A;  4QQH A;  1TME 2;  5F7U A;  1IS4 A;  1W2O A;  1NAE A;  3AFG A;  2I2S A;  1H1A A;  4Y33 A;  3J7L A;  1TME 1;  2O8O A;  1URX A;  1W06 A;  1YO8 A;  2CNA A;  4IGQ A;  1US3 A;  1YJL A;  3PUA A;  3B3Q E;  3OEA A;  3L9J T;  2IZW A;  4RR3 C;  1SHW B;  5BNP C;  2YBK A;  4CP1 A;  1O8S A;  1H2K A;  2VZV A;  3IPV A;  4YM0 A;  4ZXE A;  1ZZ8 A;  2WWJ A;  1V9U 3;  4GUL A;  4D69 A;  2EXJ A;  2BP6 A;  2PN5 A;  4XFB A;  1YXW A;  3S7I A;  4RQP A;  1JYN A;  1VPH A;  2E9Q A;  4OUS A;  2JDP A;  4OLL A;  4NUB A;  3D4K A;  1QQP 3;  4DXT A;  4HN1 A;  2GC2 A;  2YY1 A;  2CAU A;  2VNO A;  2YV8 A;  2WNU C;  4U2A A;  5A1A A;  4Z2W A;  4QQ2 A;  2G1M A;  4BQ4 A;  1R09 2;  4AHY A;  5HBA A;  3E1F 1;  3AMQ A;  3SLI A;  4UBG A;  1CPN A;  1XJA A;  1BBT 3;  5A3N A;  3N7L A;  4K6B A;  5KHJ A;  2GZW A;  1EUU A;  3D82 A;  2JB4 A;  1Y9G A;  4ORF A;  4ES8 A;  2CY6 A;  2MNG A;  2GP5 A;  1HLC A;  2J1T A;  3DYO A;  4MGQ A;  1E5R A;  3SH3 A;  2A3Y A;  4QD2 A;  5A3P A;  1NOV A;  4BME A;  5EJ1 B;  4XF4 A;  1UMI A;  3POF A;  4WM8 A;  3U11 A;  4AQ6 A;  5F1R A;  2RM2 2;  5BNN A;  4J1X A;  2QKD A;  1XNT A;  1XSQ A;  5CU1 A;  2PHT A;  3JBG 2;  4Q0P A;  2XWB B;  1HRI 1;  2RVA A;  3GXU A;  3HN1 A;  4F3J A;  1MZF A;  5AFE A;  2WZE A;  1CX1 A;  4MGZ E;  2DVF A;  3OTF A;  4YW4 A;  3CMG A;  4PI0 A;  4XJW A;  2CHH A;  3KSC A;  2FD8 A;  2D6L X;  1Y7B A;  5JOX A;  1S2B A;  3LIG A;  4S2G A;  5LBE A;  2X5I B;  3S0M A;  3MYX A;  2HWD 1;  2FCU A;  4DEQ A;  4HBN A;  2FDH A;  4WBB A;  4OHY A;  2D3R A;  3AC0 A;  3G7D A;  2IVI B;  2GME A;  4AEK A;  2YFU A;  4A45 A;  3BOP A;  2QZ3 A;  1W2A X;  2BU9 A;  4YWA A;  5GZE A;  4D6Q A;  3WP6 A;  3JXS A;  3PVO A;  5J37 A;  4QHO A;  1K12 A;  2OKX A;  5CG9 A;  2BWC A;  5A7P A;  3JQW A;  5A33 B;  2LUW A;  1JZ3 A;  2OPK A;  5LZ6 A;  4LBL A;  2GMP A;  2QZ2 A;  4PLN A;  4AI9 A;  5CFD B;  3GZU C;  4CUG A;  4UXA A;  1FV3 A;  1VBC 3;  5FMO L;  3ZFE C;  3KV6 A;  3C3V A;  1ULP A;  1VP6 A;  4GMP 3;  4CE8 A;  1NQJ A;  3BOD A;  3POI A;  4CEW A;  3OGJ A;  1JZ6 A;  3I3M A;  3PUQ A;  2NPI A;  3ROU A;  3AXD A;  5A3W A;  5BNP A;  2E33 A;  4EQV A;  3T1L A;  4DUX A;  3MPP G;  3VBH A;  1MS9 A;  3LB9 A;  4K8F A;  3Q8A A;  1NCQ C;  3AVS A;  4XFI A;  5EJZ B;  1TMF 1;  4AI1 A;  3NJX A;  3UJQ A;  4BWO A;  2VUC A;  3LGR A;  4W8J A;  2VW1 A;  1R1Z A;  5JOZ A;  2VTX J;  1MZ6 A;  4S2H A;  5BNN B;  2QQP A;  3GCX A;  3B7M A;  1KQR A;  3AZY A;  4ZZ5 A;  4A3Z A;  3LEG A;  3VBR A;  1N1S A;  1TVG A;  5FJH A;  2P3J A;  3I59 B;  1ENX A;  4R9D A;  2V72 A;  1EYB A;  1HB1 A;  4LXL A;  4MHR A;  3OYW A;  4FP2 A;  4MGI E;  2XLF A;  4GMP 0;  1RVF 1;  2HEW F;  3LSD A;  1OVP A;  1Q8S A;  1S0E A;  3WX5 A;  1QJU 2;  2G19 A;  1W2T A;  2QCS B;  2WBK A;  4KBB A;  2JDM A;  2X10 A;  3THD A;  1W9W A;  3WDV A;  3ZXL A;  1HQL A;  1SQ4 A;  4Y5Z 0;  1DQ4 A;  3I4I A;  4WM7 C;  3THP A;  3JD7 2;  1W0P A;  1MZE A;  3VBU A;  4MAD A;  4LHN A;  2DFB A;  2ENR A;  5J96 B;  1W8H A;  1WMX A;  3FX3 A;  3SCF A;  3ZSK A;  3BAL A;  3H1Y A;  4PQQ A;  4TZD A;  5BUV A;  1QJU 3;  4I0A A;  1YC6 1;  1LGB A;  1O3T A;  4XCB A;  1ZBE 1;  3LFM A;  1BLZ A;  4GWN A;  2IXJ A;  3K48 A;  4D94 A;  1RUG 2;  2WFF 2;  3POW A;  4D7S A;  1ZZ6 A;  2MEV 1;  3MIE A;  4QPG B;  2Q30 A;  4LBN A;  5F3C A;  1OBN A;  2OUH A;  3H50 A;  5F5C A;  5H9R A;  5A7W A;  1DHK B;  3I97 A;  3H8U A;  4AEJ A;  5I0U A;  1JZ5 A;  1OOP B;  3VDA A;  1K5M C;  4QPW A;  5KHK A;  2D3P A;  3WDT A;  1UY4 A;  4LBQ A;  3DKW A;  2N7G A;  3EJK A;  5K8S A;  1H6Y A;  3KLS A;  3WT3 A;  3Q8C A;  3A21 A;  2CGO A;  3OCP A;  4MET A;  2DCJ A;  3ZN6 A;  1QOS A;  3HBK A;  4MOA A;  3ABZ A;  5FZK A;  5I8T A;  3HPN A;  4LEJ A;  3WW3 A;  1BEV 1;  1Y4W A;  3UT0 A;  5LA1 A;  2WNV C;  1VIW B;  3PVB B;  1JOB A;  3N35 A;  1BEV 2;  3U07 A;  1PZ7 A;  4QXB A;  3VD9 A;  4JDN A;  2UYA A;  2ZTN A;  2E7Q A;  2ZGT A;  4Q4Y 2;  5F9T A;  1VB4 A;  5HI0 A;  3UNP A;  1ACC A;  4YW3 A;  1ZBA 3;  2BNN A;  1JTZ X;  4ARY A;  4DO0 A;  4DUV A;  3NJZ A;  2CDP A;  1MS3 A;  5FYH A;  4JKM A;  4WM7 B;  5BNO A;  2KA3 A;  3O1V A;  3JU9 A;  4MXW A;  2A73 B;  3E5Q A;  3PJQ A;  1QJY 1;  4R52 A;  1NT0 A;  4CPB A;  3I2F A;  5KWR A;  5FYU A;  1OFS A;  1R64 A;  4X8P A;  2Y6K A;  3RZL A;  4AAX A;  2VU9 A;  5JMO A;  2CGP A;  4AI2 A;  3I2H A;  4UFI A;  4LBQ D;  1PO1 2;  5FJK A;  1WLW A;  4OUL A;  3POS A;  4GH4 C;  4Q2F A;  1SLT A;  3WSO A;  4XFF A;  1UOG A;  3ILF A;  1OC1 A;  4NPR A;  1PO1 1;  2HBT A;  1W6O B;  5L73 A;  3A23 A;  4JDM A;  1AYN 1;  4JGY B;  4XZP A;  4Y26 A;  2ORX A;  4XFC A;  3HOB A;  1QY4 A;  3AJY A;  3SKV A;  1X36 A;  1LNS A;  3LA2 A;  1LOF C;  2WNU B;  5FP8 A;  3ETP A;  2W68 A;  1DGR N;  1OUR A;  2Y6L A;  2PAK A;  4Q26 A;  4DY3 A;  1VBB 1;  1BHG A;  3T4V A;  1SDD B;  5D8A C;  2LRP A;  1JOP A;  4ERO A;  5C4W A;  3MI8 A;  4HK8 A;  3BB6 A;  3P3P A;  3ZFE B;  4OHW A;  5DZG A;  1LEM A;  1RHI 2;  5JDB A;  3C7G A;  4IEQ A;  5LB6 A;  1IKP A;  1A34 A;  1A6C A;  2GAL A;  2Y6H A;  3S7E A;  1N3O A;  2JIJ A;  3ETQ A;  5DAV A;  3RMX A;  4UFK A;  4URT A;  4N53 C;  3I2K A;  5I0R A;  3SCH A;  4ITC A;  4ASM B;  4NJ4 A;  3VBU C;  2P34 A;  1QMJ A;  4V2W A;  4TXW A;  4RQP B;  1O91 A;  3GBG A;  4OZO A;  4RFR B;  3GZT B;  5EWS A;  1Q56 A;  4XAA A;  1QNY A;  3OPT A;  2R07 1;  3I3Q A;  2UUR A;  2XBO 1;  3HR9 A;  1OLM E;  3ST7 A;  4FP3 A;  3T08 A;  3OSD A;  2Y34 A;  2YBS A;  1GZW B;  4EN6 B;  4WZC A;  3AMM A;  4RHV 3;  2OZJ A;  5JVV A;  3M3C A;  3MLJ A;  2VM9 A;  3ZYI B;  4SLI A;  2XXZ A;  3NRU A;  1ZBE 2;  1Z7S 3;  1QOO A;  2WII B;  1NCR C;  2QFE A;  2FMY A;  3ECQ A;  2P3Y A;  3N7K A;  5J48 A;  4DXR A;  5J7M A;  4QX7 A;  2YUE A;  3LOB A;  1ENR A;  1X82 A;  3S5Q A;  3K4A A;  3LE0 A;  3P1I A;  1G86 A;  2HKX A;  4HT1 T;  1RJ8 A;  4G4F A;  5FZ0 A;  1WZX A;  4E9K A;  4R9B A;  4M4P A;  1U12 A;  1W8T A;  1VBC 2;  4FT8 A;  5A32 A;  4RGG A;  3I3E A;  1XSR A;  1TNR A;  2WZR 2;  3DYM A;  4P5Y A;  3LPF A;  1LGC A;  1L7R A;  2DWR A;  3B93 A;  4AZZ A;  1MEC 3;  3C7E A;  5HCA A;  2BBV A;  4GWJ A;  4ZON A;  1AL2 3;  3H0O A;  4CCD A;  2RS1 1;  4ASK A;  1FV2 A;  2OT7 A;  3NNF A;  3PIG A;  1B09 A;  4ONU A;  3WEZ A;  4DXZ A;  3BTA A;  1OOP A;  5LY2 A;  1OXC A;  2IVJ A;  5AVA A;  3M2M A;  2CWM A;  1KRI A;  1K3I A;  5T5L A;  5FPX A;  1XOY A;  2RR1 1;  5LW9 A;  4XXP A;  2R1D A;  2WO1 A;  3H7J A;  1CQ9 A;  4RGK A;  2V09 A;  3ALQ A;  3D5O A;  4M3C F;  4Q0Q A;  3ZXG A;  3MUY 1;  1U5Y A;  2VCB A;  5DAQ A;  5F3E A;  1PZ8 A;  3DEM A;  2K0G A;  3FLT A;  4Y1X A;  4LO5 B;  3MW3 A;  4RR3 B;  4H7M A;  5FZ1 A;  1GU3 A;  1RUN A;  2VXJ A;  4IUG A;  4NWW A;  4XIK A;  4PHZ A;  4OVE A;  2WT2 A;  1U5I A;  4QGM A;  2TUN A;  3HMY A;  3KT1 A;  1W6M B;  1GQH A;  3HWJ A;  1SMV A;  4XAC A;  4OI4 A;  3OUJ A;  1BKZ A;  4Q4W 2;  1BZW A;  2C6S A;  3L2Y A;  2Y26 A;  1RUE 2;  3ZXD A;  3UKN A;  1OA3 A;  3H7Y A;  3KCC A;  4LO7 A;  4NAM A;  3SKJ E;  4A41 A;  4HKW A;  2WYS A;  3KHB A;  1X7N A;  1V6J A;  3JBG 3;  3T2P A;  3O1P A;  5I93 A;  3CF6 E;  1B35 B;  2RDS A;  4CDQ C;  1RED A;  1VE0 A;  3BIW E;  4XPV A;  1R09 3;  4TTG A;  5EFU A;  2ZA9 A;  5ABJ C;  1QNW A;  1YUD A;  3IPV B;  3Q8F A;  3ZFG C;  1R1A 3;  4CDX A;  4FAH A;  4HVO A;  5IAT A;  5C3O A;  5C5U A;  5FIX A;  2R04 1;  4BQ1 A;  2WO2 A;  3NV1 A;  4RFT 0;  1LOD A;  4RN5 A;  4BIS A;  4DFS A;  3WV6 A;  3NV4 A;  3CJI C;  4LIV A;  1F5J A;  2W1Q A;  5FZ8 A;  1ZRI A;  1XPW A;  4JHT A;  2W92 A;  1AXK A;  1TMF 2;  4P9I A;  5B4X A;  1KFX L;  2RJ2 A;  1JHJ A;  2DFC A;  5FY4 A;  2OYZ A;  3RWK X;  1SLB A;  2WUH A;  2ZGQ A;  2J1E A;  2A6W A;  3FWE A;  5F6L B;  2KXL A;  3BUC A;  3NJV A;  1HX6 A;  2GSY A;  5C3S A;  1GBG A;  1PM4 A;  2CDO A;  1G9B A;  4FTB A;  2R0F A;  4CVU A;  5FUN A;  1VRH 2;  4XVH A;  4P02 B;  3NAP A;  5GLU A;  3BKZ A;  1N1T A;  4DIN B;  5ISL A;  2ZEW A;  4OUM A;  5CVR A;  4DRV A;  4OI0 A;  3AVR A;  1VLN A;  1TME 3;  5JXG A;  3THC A;  2Z69 A;  2QQL A;  4B1L A;  5IK8 A;  1ZNP A;  5EQU A;  2TEP A;  2VJX A;  1FT9 A;  3VL8 A;  4L8Q A;  5KC6 A;  4LKS A;  4ASL A;  1S55 A;  1YWK A;  2D40 A;  2VNR A;  1O59 A;  3OBT A;  4FTS A;  1PMJ X;  4I02 A;  2E53 A;  4PT6 A;  2JDH A;  4IES A;  3FLP A;  1ODM A;  1AVB A;  3VDC A;  1DZR A;  3M3E A;  4JV4 A;  1HQN A;  3MIB A;  1OLR A;  4QU1 A;  1X8E A;  2Z5W A;  4QQO A;  4DUW A;  5FR3 A;  3KQR A;  5F5A A;  1IPK A;  1RMU 1;  1LTE A;  1W8W A;  3OJB A;  3NV3 A;  4AOC A;  1EV1 3;  2GND A;  3GZA A;  4PJY A;  4QKN A;  1H1I A;  4RA0 A;  2RMU 1;  1TG7 A;  2Y6F A;  1PVC 1;  2YHJ A;  2ZS6 B;  4Y5T A;  5FPB A;  2Q1F A;  3GJB A;  4Y24 A;  5JUV A;  4HK9 A;  2DYC A;  3KB5 A;  1UPS A;  5C3Q A;  4NOT A;  1IQD C;  1XXN A;  2W1W A;  2XOM A;  3ILN A;  5T5J A;  4MYE A;  2XVK A;  3VD5 A;  3O7O A;  2FHR A;  2GH8 A;  4IEX A;  1PGW 1;  1R08 2;  1RJ7 A;  4UI9 L;  2V4A A;  1UZV A;  3KZ4 C;  2BOJ A;  3UGF A;  5KC5 A;  3E5X A;  3AL6 A;  5DDJ 3;  3SNM A;  4AE2 A;  3VD4 A;  1ENS A;  1CAW B;  2ZGP A;  3Q8B A;  3AYD A;  4XIL A;  2EAL A;  4YW2 A;  5LAS A;  3PDQ A;  4CCM A;  5FZG A;  4EWE A;  4FPY A;  4FPH A;  1W3V A;  1F31 A;  4BK4 A;  2R06 2;  2Z4F A;  1UMH A;  5FYY A;  1G9D A;  2AC1 A;  4B1M A;  4E27 A;  3SEP A;  2WIN B;  4JQT A;  2PHF A;  3ATG A;  5DZE A;  1Z78 A;  3U78 A;  3NWK A;  4UOJ A;  4AK3 A;  1TZO A;  2V73 A;  5CKN A;  2VOW A;  2PHW A;  4AED A;  2FZ1 A;  2VQ0 A;  1T6B X;  1H9W A;  4B4P A;  4AAP A;  1RL3 A;  4GXL A;  3VBR C;  5JI9 A;  3M3O A;  5L7O A;  3O1T A;  1H2M A;  2F6B A;  2VD7 A;  3TN9 3;  4BDV B;  4H7L A;  1O4Y A;  2XLA A;  1GR3 A;  1FYU A;  2RS1 3;  2HLE A;  1JN2 P;  1XQN A;  4OMC A;  3APB A;  1NKG A;  4C0H A;  2QQW A;  2K9Z A;  4Z8B A;  1V70 A;  2JDN A;  4XET A;  2EF6 A;  4IV1 C;  5GLV A;  4A6S A;  4IEP A;  4PIY A;  1CWP A;  2VQU A;  2BUK A;  2OVU A;  4QX0 A;  2G9F A;  2C9A A;  3DUI A;  2EID A;  5FPZ A;  4XBQ A;  5A7S A;  4COZ A;  2ZPX A;  3N9O A;  4ET7 A;  5APA A;  2OS2 A;  3JB4 C;  4KGG A;  5FZF A;  5L7O C;  2XPJ A;  2OW4 A;  2VME A;  3M4F A;  3T4H B;  1JMU B;  1HQW A;  1Q43 A;  4LBQ B;  2WQ8 A;  5IHR A;  2ZGR A;  1KXG A;  5D2A A;  1O3R A;  3WD5 A;  2ZXQ A;  5J36 A;  4CP2 A;  4BQW A;  2XVL A;  5JMC A;  2WDB A;  4YG0 A;  3AKQ A;  1POV 1;  2DBN A;  1RUD 1;  4GAZ A;  3DPR B;  4AI0 A;  1C8M 3;  1VBA 1;  1MVQ A;  4NO4 A;  2CU5 A;  4SBV A;  1IKQ A;  1AJK A;  1U0A A;  3ZM8 A;  1UPI A;  4QKF A;  4BMB A;  1S2E A;  1PM7 A;  1REE A;  1XE7 A;  3TEZ A;  3ZN4 A;  3RZH A;  1AYN 3;  2E63 A;  5DN2 A;  2D6N A;  2QQM A;  1G9C A;  4XEZ A;  2CGN A;  1YQ8 A;  4Q1R A;  4AXO A;  1EAH 2;  4E2S A;  1DGW A;  1SDW A;  4LJH A;  1S2K A;  4OUE A;  3U75 A;  1ZBE 3;  4AFM A;  4JGY C;  4QGL A;  4B8E A;  5IAX A;  5IT6 A;  4YGC A;  3HIF A;  3TYJ A;  2A75 A;  4WZF A;  2Q1Z B;  1GWK A;  1LOC A;  1JHN A;  3FHA A;  3OBZ A;  3VBF C;  1CAU A;  3CL1 A;  4R8H A;  4WM8 C;  2WKK A;  1W6Q A;  4UW4 A;  4HSL A;  4CDU A;  1WD4 A;  1BVP 1;  2YPJ A;  1YQ5 A;  1C1F A;  2R04 3;  4YW6 A;  5LRS A;  3ACF A;  1Y3T A;  2Y64 A;  5FO8 B;  1NZI A;  1CN1 A;  3BTY A;  1FMD 1;  4EE2 A;  3UJO A;  2EIE A;  5IWF A;  2CTV A;  5FOB B;  2QDN A;  4MUV A;  4W50 A;  1J3Q A;  2RM2 1;  2UWB A;  4AI3 A;  5IVB A;  3AX4 A;  1J3R A;  3TOJ A;  3EMR A;  5GLT A;  4CCL A;  3A0N A;  2YRO A;  1RUJ 3;  2IXI A;  5FYB A;  3WW4 A;  1GIC A;  1HJF A;  1G8W A;  3W21 A;  3ZYF A;  1AR8 1;  5FCC A;  5FUP A;  3W5N A;  4O9G A;  1AR7 3;  1AYM 2;  3O0V A;  3WNN A;  4LMF A;  2OPW A;  4QQP A;  1E57 A;  4KBZ A;  3IDC B;  5CZK A;  3VBU B;  3E6C C;  4WVM B;  5J09 A;  5HV4 A;  2C9K A;  2R16 A;  1SLA A;  3E97 A;  4XCA A;  5EPA A;  4F8A A;  3CJX A;  3O1M A;  3MGU A;  3ES4 A;  1H1M A;  2ZAA A;  4HZF A;  2ZEY A;  3H1M A;  3LDK A;  3TRS B;  1AYN 2;  2LTN A;  3ZN5 A;  4Q8K A;  2IXK A;  2VUD A;  2J1R A;  2HEV F;  2VCA A;  2XJQ A;  3GJA A;  4XE9 A;  4MSV A;  1X8M A;  4QQL A;  3U1X A;  1G9F A;  3WG1 A;  3R6S A;  2D6O X;  1WMF A;  5JXI A;  1PO1 3;  1UY1 A;  5F3I A;  1RUC 1;  3QD6 A;  5FXV A;  1Q8P A;  5FZO A;  5D8A B;  5FZA A;  1D0G A;  3B00 A;  2ZX3 A;  2RMU 3;  4OYU A;  5JI7 A;  1W0O A;  2FDG A;  2ZHM A;  1XRU A;  1IQA A;  1UXX X;  2VY0 A;  2ZX2 A;  1JOJ A;  1VBE 1;  4YVW B;  2B39 A;  2NQY A;  4QPI A;  5FZC A;  2JE8 A;  3I2D A;  2W1U A;  2RV9 A;  5A6Y A;  2VZP A;  4XJ8 A;  2VO5 A;  4QPI B;  2E51 A;  1DQ6 A;  2CSG A;  2VCC A;  3VZM A;  1UZ0 A;  2Y60 A;  4P9X A;  1W6P A;  4TLF A;  4LKE A;  5ERL A;  3GDB A;  3JB8 A;  1UU4 A;  3RYP A;  3ZX7 A;  4CU9 A;  3QOP A;  1JBC A;  1CZV A;  5DAW A;  3WLU A;  1LU1 A;  1EP0 A;  4JVA A;  3FBY A;  5FXZ A;  3WIN E;  4BLJ A;  4B7E A;  1R1A 2;  3R4U A;  4KI5 M;  2VVF A;  2DUO A;  1FAY A;  2A6Z A;  1N1Y A;  5A70 A;  2YU1 A;  2VZ3 A;  1KGY A;  3R4D B;  3B9C A;  3BOW A;  1NE4 A;  1QKQ A;  3LKJ A;  3ME2 A;  4ZPI A;  1XE0 A;  1C4R A;  1R09 1;  2CAV A;  2P2K A;  2JEN A;  3C7O A;  4Y4Y A;  1KEX A;  3C7F A;  3PVN A;  1J3P A;  1GKB A;  2FCV A;  4UT5 A;  1WA4 A;  1AHS A;  1UYZ A;  1ULF A;  3M1H A;  3LAG A;  5FDB A;  5FUI A;  2D3S A;  1C28 A;  1Q3E A;  5GLZ A;  5FZ3 A;  4CSW A;  4N8M A;  1RUF 1;  1CPM A;  4TWT A;  1RYY A;  5FKC A;  5GKA C;  2NM1 A;  5AFB A;  5E16 A;  1CES A;  2W2I A;  5GM0 A;  2ZAH A;  3ZFF B;  1F4H A;  1RUI 1;  1XNB A;  2PAE A;  1V0A A;  1R08 3;  5HPO A;  2ARC A;  3IWZ A;  5CFC C;  1AR8 3;  4A4A A;  5C4W B;  5FK8 A;  4CYD A;  4CZS A;  2WSV A;  1OKO A;  1FAT A;  3NAP C;  4EYU A;  3B02 A;  4L9B A;  1CVN A;  4LIT A;  4MZU A;  1H2L A;  5FZL A;  2VR4 A;  1MR5 A;  5JAX A;  5JPN B;  3LZZ A;  1SZB A;  4HSJ A;  4GA9 A;  1DLL A;  1JXN A;  1PGW 2;  3U4S A;  1OQD A;  1C5H A;  4IEY A;  1VB2 A;  2P1B A;  5DZF A;  4KQ7 A;  1D2S A;  2ZML A;  3SCG A;  5EJ3 A;  4QX8 A;  1H9P A;  2JG9 B;  1XND A;  3PUH A;  1A3K A;  1HB3 A;  4LUK A;  3VV1 A;  3WNK A;  3ITQ A;  5C33 A;  4HVR A;  1RUE 1;  3ZFG B;  1MEC 2;  2W9X A;  3CKH A;  4HG6 B;  3ZYG A;  3ZSL A;  1J1L A;  2RS5 1;  2WAA A;  4OQ8 A;  2WC2 A;  4KL1 A;  5DDJ 1;  1W9S A;  4IND A;  4NPL A;  1W0N A;  1XB9 A;  4LTA A;  4YFW A;  5FY0 A;  1Q8O A;  1VAM A;  3D6E A;  5ACA 1;  4XTP A;  5K0U C;  2JE7 A;  4LK6 A;  4NIA A;  1LB2 A;  3LEK A;  4Y1Y A;  2AH2 A;  2QE3 A;  3ES1 A;  4BH9 A;  1W9T A;  1DCS A;  4XJA A;  2JDA A;  4N90 A;  1OVS A;  3K4D A;  5FY7 A;  3VKM A;  1O7F A;  2O8Q A;  4CU6 A;  1UL9 A;  1OQE A;  4RHV 2;  4C0B A;  5BY5 A;  4DS0 A;  4QB1 A;  2PFW A;  3OB8 A;  1EPZ A;  1C5I A;  1RIT A;  2R07 3;  3NV2 A;  2HWE 2;  3I3D A;  2PLV 3;  3K75 B;  4RHV 1;  4WVW A;  4B3N A;  1RXF A;  3W5M A;  3X29 B;  2JDY A;  2XB6 C;  5CB7 A;  4RS5 A;  2JEC A;  2WQ4 A;  1PNG A;  4Q4V 1;  1H8T B;  3GHM A;  5FY9 A;  3O0X A;  3DPR C;  4ISQ A;  4C1X A;  5BPX A;  2ZGO A;  1LHO A;  5DMY A;  1CON A;  3R0R A;  3POY A;  1OF3 A;  2JG8 A;  4BE3 A;  5CFD C;  2NZ9 A;  4CPB D;  4ZU7 A;  1XC6 A;  3J7N A;  1JI6 A;  4CEY B;  1E5S A;  1D2Q A;  1LOE A;  1LU2 A;  2VE1 A;  5DPN A;  5FZ9 A;  4M0N A;  1VMH A;  4NID A;  4EWD A;  5T50 A;  3O12 A;  4H2A A;  5FKB A;  1SLI A;  5CG8 A;  3AK0 A;  4D0Q A;  3MW4 A;  4UF0 A;  5IUQ A;  4YGB A;  5L7O B;  4ZHN A;  3TEX A;  4JGZ B;  4OHV A;  4Q0V A;  1QU0 A;  1AR9 3;  1JW6 A;  4CDX C;  2G9Z A;  2WT0 A;  3OOX A;  1QH7 A;  1PK6 A;  2JIG A;  3GF6 A;  2D97 A;  2RJL A;  3AKR A;  3WF3 A;  4AL9 A;  1JS9 A;  3WNO A;  2QDR A;  4C1W A;  1I6X A;  4COV A;  4Y4R A;  4U36 A;  1JYV A;  4COY A;  3MZH A;  4DRR A;  4LLF A;  1I9R A;  2YFZ A;  3INA A;  4Z1V A;  2C5D A;  3WF4 A;  2AR6 A;  2B5H A;  4ZU4 A;  1PVX A;  3VZJ A;  4IET A;  5A3T A;  5JLV A;  1VBC 1;  2IXL A;  3LA3 A;  3S57 A;  1IG3 A;  4MO3 M;  4Y1Z A;  2G4I A;  4AED B;  2ADD A;  5EYX A;  2O1Q A;  4Q4X 1;  2WS9 3;  3H1W A;  2AEN A;  1D7P M;  4A7Z A;  1DBN A;  3LIH A;  1DQ2 A;  4Q4X 2;  1RUO A;  1QIQ A;  1UX7 A;  4P5H A;  1AR9 1;  1DYO A;  5A6X A;  2HWB 1;  4LBO A;  5F2W A;  2Y0O A;  1HXS 2;  3LEI A;  1IGO A;  5LRR A;  2OX0 A;  2ZX0 A;  1JOD A;  4N43 B;  4BIF A;  4Y20 B;  2ZZJ A;  5FTT C;  1RC6 A;  1HRI 2;  5FO7 B;  1EY2 A;  2BRT A;  1ULC A;  1GNY A;  1ND2 A;  1YQC A;  4MV2 A;  1FPN 3;  4P08 A;  2IC1 A;  3RRD A;  1ZZ7 A;  4IV3 B;  3AJZ A;  4ZZ8 A;  1LR5 A;  3JBG 1;  1SLL A;  4UFM A;  4I3G A;  4CEY C;  3EYP A;  1G9A A;  1LCL A;  4IEU A;  1AR8 2;  4KNC A;  1QXR A;  1UMZ A;  1US2 A;  1CIY A;  3FL7 A;  2E26 A;  4J1W A;  3IN9 A;  5FLI A;  3C2U A;  5IYY A;  4KMQ A;  3III A;  2F4L A;  1YRZ A;  1CAU B;  3J8F 1;  5IFT A;  2XML A;  5BNO C;  4YGD A;  3VDD B;  4HAN A;  1AXY A;  5FPL A;  3K4Z A;  3URF A;  1STM A;  2NP0 A;  4F7Z A;  2ZOE B;  3OG2 A;  1RUJ 1;  1F4A A;  4LA2 A;  5KXD A;  4P9G A;  4K8R B;  1UX6 A;  1DQ5 A;  5FFO C;  1MS5 A;  1NCR A;  3N4M A;  1CX4 A;  1FPN 1;  1LOF A;  3D0S A;  4BCU A;  1ND2 B;  4FQZ A;  1WWY A;  5FYZ A;  3TNP B;  4BM8 A;  1NX9 A;  2DF7 A;  2CWS A;  2VUJ A;  1S0B A;  3N7J A;  3NNG A;  1O6U A;  3GZE A;  3MFC A;  4K1Y A;  4XFH A;  2ET1 A;  2XVG A;  4YVS B;  1MQT A;  1TNF A;  1FX5 A;  4JCK A;  1W6O A;  4E4D X;  3H8R A;  2BFU S;  2O14 A;  4W6Y A;  1V6L A;  3WVJ A;  4JGY A;  4PIZ A;  1NA1 C;  2FCT A;  4LLO A;  4LQR A;  3BU7 A;  1UYX A;  1DYK A;  4EN7 B;  2I07 B;  2VOX A;  5FZO B;  1E5I A;  1QJF A;  1UYP A;  4XDO A;  4E8C A;  1SFP A;  1WBL A;  2Q8E A;  2I45 A;  3RI9 A;  2BNM A;  5C9A A;  3OD0 A;  3KV9 A;  1WCD J;  3FJS A;  5JOW A;  5FYS A;  1YEW A;  2FDJ A;  1W8N A;  4HMZ A;  1OKQ A;  3HT1 A;  5K0U A;  5LK5 A;  4YFZ A;  2EXK A;  2WRA A;  3KMH A;  5FP7 A;  1GOG A;  1GP6 A;  1QJY 3;  2XQR A;  3K3N A;  1GLH A;  1QGL A;  4KH9 A;  4YG3 A;  1F5F A;  3VBO B;  1OD5 A;  3ZSM A;  3MF6 A;  5JIA A;  4AF9 A;  1O4T A;  1YI7 A;  2W46 A;  3RSJ A;  5A7N A;  5LEK A;  5G05 L;  4YM1 A;  1KDK A;  3VZN A;  1IHM A;  5EHD A;  4NHY A;  4A42 A;  2IXH A;  4LO4 B;  4QHZ A;  2WJS A;  3OPZ A;  3MID A;  3UV9 A;  4A44 A;  2D43 A;  5JXJ A;  1K5M A;  2UY9 A;  1UNB A;  5ABJ B;  4GH4 A;  1PK6 B;  1AUY A;  4YW5 A;  5A7Q A;  3EO6 A;  3PJY A;  4CUA A;  4Z2A A;  1W6P B;  3BGA A;  4IE5 A;  3J7H A;  1HRV 2;  2PQS A;  2VBD A;  3HBZ A;  3IKW A;  5FMD A;  4BQ3 A;  1RUG 1;  2WFF 1;  3I7D A;  2BWA A;  3RMY A;  4QX3 A;  2YXS A;  3H3L A;  2K2S A;  2VTF A;  4NHK A;  2JKB A;  1LOA A;  5JIU A;  3A22 A;  3UGH A;  5AVP A;  4YNI A;  3NW4 A;  2PLV 1;  4XZU G;  2CV6 A;  2A3X A;  2QQV A;  4FPL A;  5JSR A;  1VBE 3;  4PBP A;  2W39 A;  1W8O A;  1YJK A;  1WBF A;  4K3U A;  1N47 A;  3OBA A;  4PBO A;  2JD9 A;  4AFC A;  1IPJ A;  2HWB 2;  5A32 B;  3VBS C;  4ZKT B;  1UU6 A;  5JPM B;  1X50 A;  2ARX A;  4QKB A;  1PGL 1;  1ONA A;  4WVV A;  4ATE A;  5FZ6 A;  5T5O A;  1KJL A;  3RI8 A;  3J4U H;  1RB8 G;  3CBN A;  3IAQ A;  4X6Q B;  2FZ2 A;  2HWD 2;  2QBX A;  3IBM A;  3POB A;  1CJP A;  2VCM A;  2VZQ A;  2RR1 2;  1ND3 C;  4ISR A;  1DGL A;  4M01 A;  2YPD A;  1HJG A;  2OZ6 A;  1AYM 1;  3CQO A;  3DCQ A;  3J7M A;  5KBF A;  3IMN A;  1SBE A;  2VAU A;  3DN7 A;  2XG3 A;  4QT6 A;  3RNS A;  1CZT A;  4MGY E;  1D4M 1;  2EAA A;  5T3N A;  3DPR A;  1X33 A;  4N7I A;  1RUH 1;  3BYW A;  3KV4 A;  5IW0 A;  1UWW A;  2IFW A;  1AR7 1;  4GB3 2;  1HN1 A;  4QPY A;  3H42 B;  4AGG A;  4RR3 A;  2IXC A;  2X5I C;  4GD4 A;  4IGP A;  1NUK A;  2VEC A;  4K1Z A;  1DDL A;  2H6C A;  4CA9 A;  3VZO A;  2VC9 A;  2VMF A;  4ZU5 A;  4BK5 A;  5KHG A;  1KIT A;  1HN0 A;  1KD7 A;  4FBF A;  3S30 A;  3MIG A;  1V6O A;  1W3X A;  2RE9 A;  2VZR A;  2XJT A;  2NN8 A;  3HNM A;  3K46 A;  2X53 S;  1FPN 2;  2QQI A;  2D5H A;  3MBW A;  3HJR A;  1V9U 1;  1DQ0 A;  1BCX A;  2O0O A;  2EXI A;  4S2F A;  3ZDV A;  2GDF A;  3UKV A;  4CUC A;  1H0B A;  1NCR B;  1VBE 2;  4AWD A;  4AVB A;  4BQX A;  2WQZ C;  1V9U 2;  5FZI A;  1HXS 3;  1AX0 A;  4AVS A;  2D98 A;  3FFQ A;  5CA6 A;  5FP4 A;  1CAW A;  1FI2 A;  1OUX A;  2VOK A;  4PLO A;  2J7M A;  5LEJ A;  4O65 A;  5CIR A;  5DG1 A;  4MX3 A;  5H9P A;  4MGK E;  2DTW A;  2WNU A;  3MLL A;  4IL7 A;  3ZKY A;  3JCI A;  1IG0 A;  4QGN A;  5FY8 A;  5JCT A;  1BMV 2;  3FC0 A;  3TAY A;  4D7T A;  3MPB A;  1PIV 3;  1V6M A;  4CTE A;  4DY5 A;  3AZX A;  5C3P A;  1Z0H A;  2WS9 2;  4PF5 A;  4Q4Y 3;  5T5P A;  4LHS A;  4CP9 B;  3ZPO A;  5C8C A;  4RD7 A;  2C1F A;  4IV1 A;  2B45 X;  5IVE A;  3S5A A;  2TBV A;  5FZE A;  2ERF A;  4BJ0 A;  2DV9 A;  1MAC A;  5E88 A;  3TBD A;  5BYN A;  4UAP A;  4ES9 A;  5FY1 A;  2V5D A;  2XBO 2;  1W6Q B;  1AJO A;  1YI9 A;  4XF0 A;  4AI8 A;  1PX3 A;  2J1S A;  1OHF A;  1ZVF A;  2X5I A;  1S0D A;  4UW5 A;  3WDW A;  5LBF A;  4NMI A;  5CFC A;  4AGV A;  1GZT A;  5KXB A;  2VVD A;  2SBA A;  1LHV A;  4GB3 3;  3VDB A;  4JRL A;  2R06 3;  2HWF 2;  3ZFE A;  2VW0 A;  4V2V A;  3LFI A;  3V0B A;  2HWF 1;  1NY7 1;  1SG3 A;  3A4U A;  3RYR A;  1ZX5 A;  4CXW A;  4CCK A;  2JDU A;  5C5T A;  2PEL A;  5F6K A;  2WAB A;  5H9Q A;  3RJR A;  4AQT A;  2WR9 A;  2XH6 A;  2VBP A;  1GNH A;  4HKL A;  1O3S A;  1EAH 1;  5FZD A;  5GZG A;  1WGP A;  2OQ7 A;  5KHH A;  2VZU A;  1WCK A;  4Q4V 3;  2XR4 A;  4DIQ A;  3VBS A;  1REF A;  4FXG B;  4BIO A;  2WL1 A;  2EVX A;  4XQ4 A;  2H0B A;  2NLR A;  2A1X A;  4PIX A;  2HJI A;  4CDQ A;  1HB2 A;  3OPW A;  3FBM A;  1RVF 3;  2RG4 A;  3AP4 A;  2JG9 C;  1EV1 2;  2W1S A;  1MS0 A;  1RTV A;  1W04 A;  1S0G A;  2DU1 A;  1IS5 A;  2SLI A;  3B5L B;  4LO6 B;  4FI9 A;  5KXE A;  2DU0 A;  3HT2 A;  2BEO A;  3LOI A;  3M3Q A;  1JYI A;  1T6G C;  3H3Z A;  4FPG A;  3SIT A;  3WDU A;  1UZW A;  3T0A A;  1W39 A;  4FO9 A;  1W99 A;  1R08 1;  3ACG A;  1UN1 A;  4M4R A;  3UYJ A;  4JGZ A;  3TWI A;  1VMJ A;  5F8P A;  3MHZ A;  3ORJ A;  4AHW A;  3NKG A;  4XDP A;  4LBJ A;  2WO7 A;  4WVZ A;  3SH4 A;  2DCZ A;  1C1L A;  5FAX A;  4BZ4 A;  1C8M 2;  5FBJ A;  4XMI A;  1D4M 2;  1ND3 A;  2ZBJ A;  3RZJ A;  4TN7 A;  1V6I A;  1RGS A;  2WZ8 A;  1ASJ 2;  2JD4 A;  2YU2 A;  1UOJ A;  1HB4 A;  3MW2 A;  5EV7 A;  1VBD 1;  2AUY A;  1LJ7 A;  1ZZB A;  3HAG A;  4IEO A;  5A3O A;  3UGG A;  3VDD A;  4D7Y A;  3VL9 A;  3USU A;  2ATF A;  3UK9 A;  2RHP A;  3GNE A;  3SC7 X;  1ZRD A;  4DMI A;  4YW1 A;  1C8N A;  1EUT A;  1NLS A;  2YMZ A;  4JTN A;  5B2G B;  3I49 A;  3F2Z A;  1GZW A;  1U5Z A;  2A3W A;  3THT A;  4DB5 A;  2OA2 A;  4K40 A;  2P3K A; 
#chains in the Genus database with same CATH homology
 4BIS A;  2XDV A;  5FZI A;  4EZ4 A;  3AVS A;  5F32 A;  5IVJ A;  4LIV A;  5FP4 A;  5FZ8 A;  5FZC A;  5FY9 A;  4LIU A;  2P5B A;  5F5I A;  5FPA A;  5FY4 A;  5FY8 A;  5FXW A;  3K2O A;  3PUS A;  5FZO B;  3KVB A;  3K3O A;  3PUR A;  4QXC A;  4XDO A;  3N9O A;  5A7S A;  2Q8E A;  4BXF A;  2OS2 A;  5FZF A;  5F37 A;  3KV9 A;  5FJH A;  5FZ9 A;  3AL5 A;  3ZPO A;  5IVE A;  5CEH A;  5FYS A;  3PTR B;  4LXL A;  5FZE A;  2Q8C A;  4UF0 A;  5FUN A;  2YBP A;  4V2W A;  5FY1 A;  5FYM A;  4Y33 A;  5FP3 A;  5FP7 A;  5ISL A;  3N9Q A;  4IGQ A;  3K3N A;  3PUA A;  5FXZ A;  3OPT A;  3LD8 A;  4GAZ A;  3AVR A;  2YBK A;  2YBS A;  5A7N A;  3LDB A;  5F3G A;  2WWJ A;  3NJY A;  5FP9 A;  4CCO A;  4CCN A;  3PU8 A;  2XXZ A;  4Y4R A;  2YU1 A;  4UF0 B;  3N9L A;  5FYC A;  4V2V A;  4NUB A;  3N9N A;  5FPV A;  4QX7 A;  2PXJ A;  5FY5 A;  5A7Q A;  4CCK A;  5A3T A;  5LWB A;  5FZ0 A;  5FXX A;  5F3C A;  5FWJ A;  4URA A;  5F5C A;  5A7W A;  5FYI A;  4QU1 A;  5A1L A;  5FZD A;  2Q8D A;  5A3N A;  5FZ3 A;  3N9M A;  4CSW A;  4BU2 A;  2OQ7 A;  5F5A A;  5IVF A;  4HOO A;  2GP5 A;  4DIQ A;  5FV3 A;  3PU3 A;  2W2I A;  4HON A;  5F2W A;  5FPB A;  3KVA A;  5A3P A;  5IVY A;  5LY1 A;  5FZ7 A;  2OX0 A;  2OT7 A;  4GJY A;  5FZK A;  5FZH A;  4ASK A;  3OPW A;  4C8D A;  3ZLI A;  5LY2 A;  5IWF A;  5FYT A;  5IVV A;  5IVB A;  5FZ6 A;  4EYU A;  5LW9 A;  2OQ6 A;  4LIT A;  4QXB A;  4CCJ A;  4D6R A;  1VRB A;  5FZL A;  4CCL A;  4QWN A;  5F3E A;  5FYB A;  2YPD A;  3U4S A;  5E6H A;  3DXU A;  3AL6 A;  3UYJ A;  5FYH A;  4DO0 A;  5IVC A;  5FZM A;  4IGO A;  5FZ1 A;  5FUP A;  4QX8 A;  4CCM A;  5FZ4 A;  3PDQ A;  4XDP A;  2XML A;  4E4H A;  5FZG A;  5FWE A;  5FYU A;  2GP3 A;  5FBJ A;  3KV4 A;  5A80 A;  5FPL A;  5IW0 A;  2XUE A;  4D6Q A;  5FYY A;  5FPU A;  4TN7 A;  3RVH A;  5FJK A;  2YU2 A;  5F39 A;  5K4L A;  4EZH A;  5A7P A;  4GD4 A;  4IGP A;  5FY0 A;  5A7W B;  2WWU A;  4AI9 A;  3KV5 A;  4CUG A;  3U78 A;  4Y3O A;  5FZB A;  5FYV A;  5A7O A;  3KV6 A;  5FYZ A;  3N9P A;  5ANQ A;  5FY7 A;  5F2S A;  5F3I A;  4D6S A;  4QXH A;  5FXV A;  3DXT A;  5FP8 A;  4AAP A;  3PUQ A;  5FZO A;  5KR7 A;  5FZA A;  5A3W A;  4GJZ A;  2VD7 A;  5A1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...