5FBJA

Complex structure of jmjd5 and substrate
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
236
structure length
236
Chain Sequence
GSTVPRLHRPSLQHFREQFLVPGRPVILKGVADHWPCMQKWSLEYIQEIAGCRTVPVEVGSRYTDEEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFDQIPELKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALYPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 8
publication title to be published
rcsb
source organism Homo sapiens
total genus 58
structure length 236
sequence length 236
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2015-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fbjA00
4CCKA 2P5BA 4LXLA 5FZ7A 4BISA 5F3CA 5FZIA 4CCOA 3OPWA 5A80A 5FYIA 4C8DA 5F3GA 3LD8A 3U4SA 3KVAA 5A7QA 3RVHA 4D6RA 3N9QA 5FPLA 5A1LA 5LW9A 2XDVA 2GP5A 5FV3A 5FYHA 3ZPOA 5FZEA 5FWEA 2WWUA 3N9OA 4IGPA 5FY0A 5A3WA 4ASKA 5IVVA 4D6QA 5A1FA 5FZ1A 2OX0A 5FYBA 4TN7A 4UF0B 4GJYA 4CCJA 5FJHA 3KV5A 5IVBA 5FY7A 4XDOA 5FP4A 5K4LA 4CUGA 5A3TA 3PUQA 4IGQA 5F32A 5FYZA 4UF0A 4AAPA 4V2WA 5A3NA 2XUEA 5FJKA 2VD7A 4QXBA 5FPVA 5A7WB 5FWJA 3AL5A 5FXVA 5FZ9A 5IW0A 3NJYA 5FPBA 5F3EA 2YU2A 5F2WA 4EZHA 5FYTA 5A7WA 3UYJA 4V2VA 3K3OA 4BU2A 4CCMA 3PU8A 4GAZA 5FP3A 4LITA 5A7PA 3AL6A 2PXJA 3PTRB 5FY8A 4DIQA 5FUNA 2Q8CA 2OS2A 3PUSA 4LIUA 5FYCA 5F2SA 5FP7A 3DXUA 4Y33A 4IGOA 5FZ6A 5FY5A 2XXZA 4CCLA 4D6SA 2W2IA 5IVFA 5FZHA 3AVSA 5FXZA 5FUPA 4E4HA 2GP3A 2YBPA 5FZKA 5FYUA 2Q8EA 5IVJA 3KV6A 3LDBA 5FZCA 5F37A 2YBSA 5FYYA 5KR7A 4Y4RA 5FZLA 4EYUA 4GJZA 4GD4A 5F5AA 5E6HA 4Y3OA 5FZ4A 5FPUA 3U78A 5F5CA 3PU3A 4QXCA 5IVEA 5FZMA 2YPDA 5A7NA 4AI9A 5FZBA 4QX7A 4EZ4A 5A3PA 5F39A 5FBJA 4DO0A 3ZLIA 2WWJA 3K2OA 3KVBA 3KV4A 5ANQA 5A7SA 5FXWA 2OQ7A 2YU1A 3OPTA 3PDQA 5FZAA 4HONA 5FYMA 3KV9A 4BXFA 5FPAA 5IVCA 5FY4A 5FY9A 5FZOB 2XMLA 4QU1A 5FP8A 4CSWA 1VRBA 3N9MA 5FP9A 5FZGA 4HOOA 5LY2A 5LY1A 2OQ6A 2OT7A 2Q8DA 5F3IA 5FZDA 5FXXA 5CEHA 5FZOA 4URAA 3N9PA 3N9LA 5FYSA 3AVRA 3DXTA 4QXHA 5FZ0A 4QX8A 5FY1A 5ISLA 5FZFA 5A7OA 5FZ8A 5IWFA 5FZ3A 4NUBA 4CCNA 4QWNA 5FYVA 5F5IA 4XDPA 2YBKA 4LIVA 3PURA 3N9NA 3PUAA 3K3NA 5LWBA 5IVYA
chains in the Genus database with same CATH superfamily
2AH2A 2QZ2A 4CCCA 5GLZA 4DXSA 1KS5A 1L3JA 2HEVF 4UFMA 5FZ7A 4GWMA 5HCFA 2C1FA 1CWPA 1JYIA 1CR7A 3BU7A 3J26N 1R082 4Q0UA 1NLQA 3W9AA 1FPN3 5A7QA 4D6RA 3MZHA 1WGPA 2WO3A 1XJAA 4JRLA 4Q0PA 1ND3A 3MI8A 2W5FA 2HBTA 2WO2A 4Q4Y2 4EJRA 3MYXA 3M7AA 4NR1A 4P9YA 2OX0A 3CZJA 2DTWA 5EPAA 1VE0A 4CVUA 5CA6A 4OQ9A 1L7LA 1CVNA 2Q1FA 1W6NA 4KG0A 5FIXA 3DYOA 1AR83 4LKSA 1Q56A 2P3KA 3MW3A 4JCKA 2GDFA 4Q8KA 2BP6A 2QQOA 3N7JA 1UW8A 4WZCA 4D8MA 5AFBA 4IV1B 4AG4A 3FE5A 3WDWA 5L7OA 2VNGA 2Z4FA 3ZDSA 1PVC3 1FT9A 1O5UA 3D5OA 3IIIA 3RYPA 5A32B 2LS6A 2Z42A 4UOJA 3THTA 1O59A 4PJYA 4KU8A 2HWE2 2HWC2 3E6DA 3ON7A 4ZY9A 1ZRRA 2Q5TA 2F17A 2W0XA 5C8WA 2P2KA 1KDMA 2LTNA 4EN8B 5J37A 5FY8A 1K5MA 4I3PA 4ARYA 4CDXB 3BYWA 1EUTA 4YVSB 2W3JA 3J7LA 2Q8CA 1KRIA 3AP4A 1UZZA 1BHGA 5FZ6A 4CCLA 1VAVA 2VJXA 4OI4A 3OUIA 3ACGA 4JKLA 1NG0A 2RR13 2E7AA 4RHV1 2WT0A 1XSRA 3VDAA 3J7MA 1IPJA 4XUNA 4FFHA 1HB1A 1RUI2 1LGBA 5T5PA 1OT5A 3ZVXA 4COVA 2V5DA 5FUIA 2WABA 1S1AA 4SBVA 4OI1A 1UD1A 2P6HA 1ZNPA 5KR7A 5FZLA 1GNHA 4CU7A 2EICA 5K8SA 3RDIA 3CHXA 1ULOA 1BMV1 3JQWA 4Y3OA 3I3BA 4OUMA 3K4AA 4Q0VA 4Y20A 3SLIA 2UU8A 4YGBA 2EXKA 4LBQB 2Q1ZB 4LO7A 3BTXA 3LSEA 2FCVA 3D6EA 3GBGA 4XTPA 5CNAA 2ZACA 2K0GA 4CDXC 3J9SA 2WWSA 4IE7A 3SMHA 5F39A 4QDSA 1LHNA 3K2OA 3FMGA 3Q8EA 4Q8LA 1ZBE2 3H8UA 4NJ4A 3K75B 2XHKA 4LHSA 1VALA 4AEMA 1RXGA 4HN1A 1B35B 1P8JA 3AP7A 1ODNA 5H9QA 3I54A 1VP6A 4DPNA 5DG2A 3VD7A 5DAQA 3HQRA 1ZVFA 2VTFA 4QB1A 5E1RA 2ZX2A 4LOTA 1MS9A 2HWE3 2HWC3 3KQRA 3UL2A 3WNMA 1CAUA 1RUD1 2VUCA 1XXNA 2OT7A 4HKWA 4FVVA 2J42A 4XABA 5CKMA 2QQPA 1CN1A 1OQDA 2GZWA 3EB7A 4RA0A 3W20A 2YB7A 4LORA 5JSOA 3KQ4B 2N7GA 1H8TB 3MDPA 3AVRA 2AZ5A 3LDRA 4MGQA 3H7YA 5LBBA 2WNVA 3LEMA 5CFDC 1OUXA 5CYYA 3MV01 1W04A 1BVVA 3NKTA 2D43A 2MEV2 1OLQA 3A0KA 2J1VA 4GB33 4IESA 2B46X 1YWKA 5IUQA 4FAGA 1UYZA 1XQNA 1VMHA 3GALA 1QJX1 3ME2A 1B35C 1N3QA 2X10A 3JBG2 1AXKA 3I2GA 5ANNA 3RJRA 3WP3A 1NXMA 3KCYA 4WM7B 2VE1A 1UX6A 1DHKB 1QNWA 3JB8A 4XBQA 4AQSA 1QDCA 2TEPA 1FAYA 3M2MA 5KHGA 4WM8A 4IE5A 1UZYA 5F3GA 2G9FA 1C8M2 3LD8A 3WW1A 1VBE3 1RL3A 1RJ8A 1W06A 1RHI3 3N9OA 4IEQA 1A8DA 2PQQA 4UW5A 5A3WA 1WCKA 2X5IA 4JGZB 5FZ1A 1RUE2 1GZCA 1M06G 5HCHA 4EV0A 2E32A 4BH9A 1FXZA 2CAVA 4RQPB 3QH7A 4GWJA 3PIJA 2XUEA 2J1EA 1Q3EA 5D21A 1REDA 1AL22 1ONAA 3WQ7A 1YJKA 1FYUA 2QE3A 2X09A 1FATA 4Q27A 1TZOA 5C71A 4N8MA 1DBNA 3MFCA 2VULA 5D8AB 5AC91 2WAAA 4XQ4A 1JU4A 5FYTA 1BXHA 4V2VA 1TG7A 2DF7A 4OULA 1SLBA 4QGNA 4JGZC 5FP3A 4M3CB 1QOTA 5A7PA 1D2QA 1K12A 3C2UA 2HWB2 4Q4W3 3AYEA 1H1MA 4O61A 1OH3A 4RQPC 1R093 4Q4V3 4AWDA 4IGOA 5IFTA 3GCWA 2XJUA 4IL7A 5E16A 4GH4C 2XH6A 4CDWA 3FUOA 1UNBA 4IV3C 3PJYA 5IJRA 5GLUA 4E9KA 2Y6JA 3WVJA 4LBQD 5G05L 2RMU3 1V6LA 4XJWA 3ZOIA 1XNBA 1CGPA 1HB4A 4Q26A 2Z2SB 5D1IA 5D8AC 4YFWA 3TNQA 3A7QA 5J96B 4BQ2A 2PHXA 2ORXA 4QT6A 4B3NA 5BV6A 5FQ0B 5IAXA 2JIGA 1W28A 1OVSA 4MADA 2OPKA 5FZBA 2D6LX 4HVOA 2IZWA 2Y8KA 3ZXFA 1AR81 2VY0A 2ZEYA 3IDAA 4RD7A 1M4WA 4A3XA 5JSRA 3TRSB 1QEXA 4QDRA 3ZX7A 1NA1B 3J7NA 3O1VA 4HSLA 1NCRB 5BXXA 5FYMA 3O1RA 2PHRA 3T1MA 2WNOA 1ND3B 1O5LA 5FY4A 4BMEA 1RUJ2 4HBNA 1EUUA 3U0ZA 4W6YA 1YQ2A 1PVC1 1JYXA 5LY1A 2DUPA 4XOGA 5F3IA 5IAVA 3USSA 3OUHA 1V6IA 3M70A 3TEYA 2Y0OA 3TNPB 4OZXA 4QX8A 3AYDA 4CDUB 4XJUA 1X9TA 5J7MA 2A70A 1RJ7A 4DINB 4AI0A 1Q5OA 2B7YA 3WX5A 4C0BA 2RR11 1NA1C 4FOVA 4K20A 1KD7A 2YBKA 4N9IA 4A6OA 4X6RB 1UYYA 1OD3A 3OD4A 4LKEA 1J1TA 4LA2A 4NWVA 1Y9GA 4KWJA 5FLJA 1FMD2 3SCGA 5EJZB 3U75A 2A6YA 3I3QA 1EPWA 2XJQA 3SHRA 3KT7A 2FCUA 5A70A 3PVEA 5J98B 4AI2A 2WIIB 4Y1YA 1O3SA 4OHYA 3R4UA 1C8NA 3PTYA 1H4HA 1ULGA 5SV8A 1QHDA 1VMJA 3ZR6A 4BK4A 4KBBA 2E31A 3OGSA 1GLHA 1ZA4A 1MS4A 3ZPYA 1S55A 2ZTNA 3B9CA 1DLCA 5IHRA 2OUHA 4CDUC 4E8CA 3TEWA 1CX1A 1JHJA 1VAMA 4D6QA 3U78A 3LWCA 4LO6B 2XHNA 4M00A 5J3UA 3X29B 3WQ1A 4PLNA 3IAQA 4QB2A 5FP4A 2WNEA 2WJSA 2W1SA 1LESA 1W0NA 5F32A 2QTWB 4PQ9A 3T4VA 4GA9A 4A7YA 2X29A 4DZGA 4PIYA 5J09A 2VBPA 4PCRA 4PF1A 1NKGA 4YZ2A 3ZR5A 3WDVA 4Q1RA 1BYHA 4P00B 2AUYA 2ES3A 4B1MA 2D6KA 4OI2A 1H2MA 2D40A 1EV12 2WO1A 2WA4A 3D4KA 4GKYA 2YYOA 5F8PA 3SNMA 5GKAC 4BJ0A 5LBEA 2XLFA 1SEFA 4FPEA 2W52A 4JDNA 5I0UA 1L7RA 1XYOA 1O3QA 2C9AA 1UN1A 5LZ6A 1QH7A 1SBEA 2IXIA 1JS9A 2ZAHA 1W0PA 3AL6A 2O8QA 2PN5A 4GB31 4HSJA 4PF5A 5DUXA 1LOFA 2R073 3ETPA 2Q30A 4ORFA 2WSUA 3ZFFA 4LBLA 1ST8A 4LUKA 1ZRFA 2XXZA 3A22A 5H9PA 2ZEXA 4E4HA 2DFCA 4FAHA 3UGHA 3OOXA 3WDXA 1Z7S2 5JWPA 5ABJA 4DY5A 2OYZA 3L2YA 4ZZ5A 2WT2A 2E33A 5CIRA 4S2DA 3ST7A 3UKNA 4Y4RA 1VBE1 3OD0A 1RUC2 2IXHA 4RGGA 4GWNA 1DGRN 1RHI1 1SFPA 5FPUA 4ET7A 1WLDA 3TBDA 4XUTA 2VCBA 3DYMA 3DUIA 3NV3A 5IVEA 1FOD3 2JG9A 3POIA 1F4AA 2I74A 3AXEA 1ND2A 4FTSA 1VBC2 5T3NA 1KQRA 3AMMA 2SBAA 3WF3A 1JMUB 4E27A 2J1AA 5ANQA 2E6VA 2P1BA 3PUIA 3VDCA 4QPIA 1D4M3 2EAAA 4G4FA 2YU1A 3FZ3A 3ZDVA 4WM8B 2O14A 3I2OA 3AYAA 1CPNA 2GNMA 1BCXA 3BPSA 2VMFA 2OKXA 4R9AA 2Y6HA 5FY9A 4XUQA 2CV6A 3EBRA 3I49A 4JKMA 2HBUA 4KL1A 2ZHKA 2WNUB 2PFWA 1EPZA 5I0TA 3VBOA 3VKOA 4A7ZA 1WD3A 2QFEA 1W6QB 5DAPA 3F2ZA 2W92A 3VDDA 3MUY1 2WL1A 2K46A 1VB4A 4BHPA 4L9BA 1LKNA 4QD2A 1R64A 2PAKA 3CQOA 2A6WA 3N9LA 5BNPA 3JB4C 2K9ZA 1PZ9A 5FMDA 5FFOC 4Q4W1 5LATA 1AYM2 1H6XA 1QXPA 1W9WA 1R091 2IVJA 1S4CA 4Q4V1 4CEYB 2ADDA 1PNGA 4SLIA 3HR9A 2ZGOA 4DMIA 1MS5A 4P9WA 2BNMA 3ELNA 4XCAA 2YFUA 3RGBA 2VXJA 1AX0A 4CCKA 2JDAA 3V0AA 4JQRA 2RMU1 5JIUA 4Q29A 4LXLA 2WNUC 3OBZA 3VN4A 4LE4A 3VBHC 1YCIA 2H0VA 1HXS2 1UKRA 3HN3A 4BIFA 4C8DA 4E2QA 4G9SB 4ZPIA 1ENSA 5AVAA 3Q8FA 3FBYA 1VBC3 4WZFA 1JW6A 2VQAA 2GP5A 4W6WA 1IQAA 1W03A 4KU7A 4NMIA 1UOJA 5IK4A 4QPGA 1UF2C 3MW4A 4N53A 4CEYC 3VBRA 1W2TA 2AEYA 1MACA 1IKQA 2D3SA 2E53A 2FQPA 3OEBA 4MHUA 1LOEA 3GXUA 5FY7A 3D3AA 4Q2FA 3V0BB 2YG0A 3C7OA 3IMMA 5FMBA 4AR2A 2IC1A 3GHNA 3OG2A 4IGQA 2PHUA 1YEWA 5J1XA 4XF9A 2ORZA 4IDZA 3HJRA 5FPVA 1YFWA 2IXKA 1TMF3 5K0UB 1D0GA 2BZDA 3GCXA 5T5JA 4FCAA 3VGIA 2QNKA 5IW0A 3RS6A 1NY71 3OGJA 2P6CA 1B09A 1OBNA 4MXWB 1S0EA 5C8CA 3H7JA 4FP3A 3KLSA 2WQZC 3URFA 1QWRA 1JUHA 2XWJB 3BODA 2NN8A 3CU7A 4GAZA 1UY1A 3ROUA 3ZXGA 1IG0A 2JB4A 3FLRA 4KH9A 2CDPA 3FHQA 3PJQA 2XONA 1JI6A 1GANA 2JB8A 4FPJA 2W1WA 4FFFA 2VZPA 3ZXLA 1WLWA 1LAJA 4AEJA 3B69A 2XJSA 1PK6A 4NRMA 2WFPA 3NAPA 1RIRA 3RWNA 5APAA 1V6NA 2VUJA 2GC1A 4Y5SA 4Y22B 4FPOB 4JQTA 1NUKA 3MIEA 1TNRA 3IM0A 4K1ZA 3VBUB 3WXPA 1YLLA 4MYEA 4XMIA 4CDQA 2BOJA 2W95A 1JH5A 3R05A 4NRPA 2EALA 3IWZA 4P08A 3EJKA 3LEGA 4IETA 4P9JA 4M4RA 2ZKNA 1TEIA 5HPOA 1UY2A 1C28A 2GC3A 1ZYBA 2AACA 2WUHA 2XB6C 3I2IA 4L11A 4MV2A 4IXLA 1XRUA 5FZMA 1CAVA 3JD73 2HWD3 4NVPA 4EWDA 1ODMA 1X8EA 4L99A 2MHFA 3NRUA 3UK9A 5C3PA 1LENA 5DG1A 3O1SA 3KV4A 1N47A 1X8MA 4CU9A 2A5ZA 3ACIA 1AX2A 3DYPA 1QOOA 4QQHA 5EHDA 3S57A 5JAXA 4I30A 1ZZ6A 4HONA 3WHUA 2RDRA 3VBUC 2C0ZA 4COUA 4RN5A 2RS13 2WLPA 4HKOA 3LFIA 1AR71 2JE8A 4A45A 3CNAA 4YW5A 3N9MA 1CAWB 3LQCA 1ULDA 4NRQA 3ZN5A 5GZDA 2QQWA 3AMHA 4LR4A 4XF4A 2BTVC 2IWGB 4UT5A 3TN93 2JICA 4CP2A 3WOGA 1HRI2 2VUDA 3H3LA 4I02A 5CEHA 3A21A 3OB8A 3O12A 1U5ZA 2WS91 3VKFC 5KXBA 2R071 3HNMA 4V1PA 4CCNA 4QWNA 4LHKA 2E9QA 4Y1VA 3J4UH 3O1OA 4HMZA 5DPNA 3PURA 1RYYA 2E51A 1WZXA 1K3IA 4OHWA 3WEZA 1W8HA 1JHNA 4QQOA 5IVYA 3SH5A 4BCUA 1JBCA 3W59A 4MHRA 1PX4A 4A4AA 4Y4YA 5LBFA 5JOXA 2OZJA 5I0DA 3IMNA 1QMJA 2J22A 2WQ4A 3CBNA 3N3HA 2CSGA 5J48A 3CO2A 1LOGA 1W8FA 3WG2A 2RV9A 5HV4A 3NNGA 4HPKA 4XEZA 4B4RA 1FOD1 3ZFFB 2RS53 3WG4A 3ZIWA 2RS32 2JDHA 1ENRA 4TLFA 5FKBA 3POFA 5ABJB 5JOZA 1D4M1 4BQXA 5JMCA 3O1PA 3AZZA 1SZBA 3I97A 3KF5A 3ZN6B 5A6QA 2HEYF 1QXRA 3FC0A 4UI9L 3N4MA 2BFUL 2WKKA 4UF0A 4UFLA 1XE8A 1VBB3 2KM2A 1IS4A 1OI6A 1RMU2 3WP4A 1GP6A 2VCAA 2ZGRA 1XU2A 4DRVA 2JG9B 2VZVA 1OXCA 1KS4A 2VNOA 5KXCA 1JZ3A 1C1FA 2VL4A 2Y34A 4XFIA 4LQRA 1GZWB 3B94A 1PO23 3ABZA 3ORJA 3I2KA 1V6OA 3U4XA 1S2EA 4CXXA 3H9AA 3ZSEA 4TWTA 1K5JA 5I93A 3PTRB 4QX3A 2FZ2A 3MPPG 1GWKA 1RB8G 5ACA3 1VBA2 4NHLA 4RL7A 5C3QA 1G7YA 1US2A 3WF0A 4EN0A 5FXZA 4LLFA 4C0HA 2W9XA 3OGGA 2BNOA 3VHNA 4D69A 1QJY2 1UY3A 4AHYA 3WSOA 4J6GA 3H8XA 2PA7A 1X82A 1EY2A 1GUIA 4PDWB 3ZFGB 5FZ4A 3DPRA 1DLLA 1E5HA 1H6YA 4AFCA 1W8NA 4K1YA 1V70A 2HWF3 4Z2AA 1VBD2 2FDIA 1W99A 3AZVA 2DDUA 2JDMA 2JE7A 4EZ4A 2GMPA 2XBO3 3M4FA 2A1XA 2VTXJ 4HVRA 3ZFEB 2BWCA 1AVBA 4XXAA 3S7IA 1HJFA 5J36A 2H0BA 1QGLA 1GWLA 3POEA 2VBBA 5FZAA 2GH8A 5LK7B 5DDJ1 1WA4A 5IK5A 1TMF1 3HT2A 5IVCA 2YMZA 4CZSA 2XPJA 4PIXA 1CIYA 3NQHA 5FZOB 1HRV2 1F31A 1NLSA 1V9U3 3AMQA 4QU2A 4PDWC 4HKLA 3ZFGC 1W6OB 4XAEA 2JDUA 3I59A 5BNOC 4COYA 3GBFA 4DOUA 1FX5A 4QHBA 3NJVA 5T52A 2XOMA 3I3MA 1XE0A 1GP5A 2ZX0A 1ACCA 3B3QE 2DWRA 1CD3G 4FPHA 1SHWB 4I0WB 4M4PA 4EN9B 3ITQA 3AMNA 3B9IA 1KITA 2ZZJA 1IS3A 3ZFEC 4DB5A 2DU0A 2UYBA 3VD5A 4YM1A 3SEEA 3T08A 1MS1A 2CHHA 4LKDA 3K3NA 2GN7A 1S0FA 5KHIA 1VB2A 3AK0A 2RDNA 3AZXA 3EYPA 3MFAA 2XQRA 4IEZA 4K8FA 3C7GA 5F3CA 1PX3A 3D82A 5IK7A 1NT0A 4LBMA 1ASJ3 1UCXA 1YQ6A 4GH4A 1OLME 3NKGA 3MF9A 3QD6A 4LO4B 1UPIA 4Q1PA 1D7PM 5EV7A 4CXWA 3K4ZA 4IV3A 4JHZA 2B8MA 2G1MA 4X8NA 4RS5C 3VKLA 1OPMA 3JD71 5FWEA 2HWD1 3OY8B 1WW5A 4CP1A 1VMFA 3NAPB 4Y1ZA 4XF0A 2BVVA 2VMCA 3HBZA 1POV3 5A1FA 1AYN1 1QJU3 3T0DA 2WZR3 4JZRA 1Q8QA 3MIDA 4OHZA 1SLTA 1XOYA 1WMEA 2XJPA 4LBJA 2RS11 4YGEA 3OSDA 5SV5A 4S2FA 1GFF2 5CG9A 5FJKA 2ZKLA 4B4QA 4NIGA 4BIOA 1U12A 2A75A 2ZHNA 4YRDA 2JD4A 2ENRA 3BOPA 5FWJA 1EAH2 4RR3A 5H9RA 3TN91 1UMHA 2B5HA 3PUHA 3GF6A 2XL7A 5F2WA 4QX5A 4EZHA 1QF3A 4CP9A 2CWMA 1O7FA 5C5UA 2BW8A 4KGQA 1YXWA 2VVFA 2BPA2 4N43C 3UGFA 4F83A 4AVCA 1QIQA 2WAOA 1K45A 5KHKA 5EJ3A 1EYBA 2W46A 4YM0A 1DIWA 3PUSA 2NP0A 4Z82A 4H14A 2CGOA 2PELA 4WVMB 5CFCB 1TME3 3PIGA 1RUH2 2Y0IA 3W21A 2YBPA 2Q8EA 1NZCA 3POWA 1LOBA 4JV4A 2EIGA 3GDBA 3VBFA 5DXDA 4ISRA 3WW3A 1W6PA 3K4DA 1YFXA 1L7QA 2VNRA 2R7EB 4JGYB 2JG8A 2RS51 3K46A 3MV11 1HDKA 5DMYA 1HV0A 1PM7A 2QDRA 5FLIA 4YW3A 3ZXEA 1MEC3 3CL1A 5A7NA 4CEWA 1G9BA 4PLMA 3EQEA 4KWUA 2X8KA 1V6KA 1DG6A 3K51A 4FPFA 2EA7A 2WWJA 1CJDA 3VDBA 4LO8A 3GJBA 1REFA 2OZ6A 5CFCC 3OPTA 4RFRB 4XFFA 3IN9A 1VBB1 4QKDA 5DZEA 1R083 3S7EA 2PAEA 4ZS2A 5JZGA 4IV1C 4NPLA 3V65A 2JX9A 4HOOA 2Y6LA 3P3PA 1Y4WA 4Q4Y3 4BM8A 4JGYC 1ZBA2 1GOHA 1PO21 3W5NA 1W6MB 4A41A 2D6MA 2PHWA 2VMHA 3IIAA 1OQ1A 5DUUA 1YJLA 3WZ1A 3KHCA 1PM4A 1DYKA 2O1QA 3J8F2 1WA6X 4K21A 3FLTA 4YVSC 5ACA1 1F9KA 5A6YA 3JZVA 4ZU7A 4P5HA 3IDCB 4GMP3 4AHXA 4DY3A 3MIBA 1PGL2 3MPBA 3OBAA 4YGCA 5F5QA 3BTYA 3G6JB 1QXJA 2WRAA 5JVVA 2DBNA 1OOPB 1BEV2 1MZEA 4IE0A 5BPXA 1DU3D 5LA9A 3U4SA 1XPWA 3E97A 4J1WA 1MQTA 4D7TA 2G19A 2HWF1 4X6QB 5GLVA 1MS8A 4UWDA 1HW5A 2VUAA 2R062 2R6QA 2VNVA 2XBO1 2O8OA 4TN7A 2XL9A 2C24A 1RUI3 2UYAA 4U2AA 3M1HA 2VO5A 5FK7A 5JXIA 1JZ6A 1NX9A 5JR7B 4NE9A 3DPRB 2ARXA 2XKOA 2YC4A 3CIHA 4RGAA 5A7WB 1GU3A 1V9U1 1S0IA 3TOJA 1UXZA 1HV1A 4M0NA 4XQWA 2W08A 1Z78A 2XWBB 3BU0A 2QQNA 5C70A 3O0WA 4BXSV 1NCQA 3J7HA 4OHVA 3N7LA 4KQ7A 1IKPA 1H8TC 4CCMA 4BQ5A 3SQOA 4NWWA 4XHXA 4CUAA 1ZBE3 3FBMA 3RZLA 1GNYA 5HV0A 4FFGA 3UKVA 5F2SA 5FO7B 5LA1A 1BBT2 2UWBA 2ZGUA 1QKQA 2WC2A 4AFMA 3AVSA 4D3WA 5CISA 3I59B 2XG3A 4WM7C 5JCTA 5F6KA 1COV2 2R042 5T5OA 4HN0A 4XFGA 1W2UA 1LOAA 3PHMA 2O0OA 4QQ2A 4CU6A 1U5YA 3H50A 3LDKA 3ZYFA 2V4VA 4YZ3A 3ZIXA 5C4WA 2ETEA 5C9AA 4HL0A 1POV1 2IFWA 1QJU1 2MEV3 3AP5A 3OJBA 4Q4X2 2WZR1 2RM22 2LUWA 2BBAA 4XW3A 4YVWA 1SLIA 4ATFA 1J3QA 2TUNA 3VD9A 1F5FA 3IDEA 1OUSA 3JBG3 4MGIE 1UYPA 4AFAA 4AZZA 4TYSA 4OI0A 1G9AA 4M3CE 1V6MA 5GALA 3BIEA 2NZ9A 2ZAAA 2UWAA 2I2SA 3IT8A 4N7UA 4AFDA 2QDNA 4QKBA 4BLJA 4E4SA 2VR4A 1E5SA 4AHZA 4Z07A 5L9RA 4K40A 3U07A 3JU9A 4DUWA 1C8M3 3E5UA 3IPVB 2C5DA 1IHMA 3INAA 5FP9A 3OYWA 4GULA 1FPN1 2OQ6A 2VZ1A 3BCWA 2ERFA 4GALA 1RUE3 1GP4A 1RUG2 4MGZE 3RZZA 1GYKA 2R30A 2CU5A 3LKJA 4AFBA 2B42B 1RXFA 4FFIA 1QQP2 3HEIA 1S2KA 3TB0A 4AYUA 4OCTA 5I0SA 1DQ5A 5IATA 1HIXA 3GZAA 1KEXA 2V73A 2VMIA 4JVAA 3S30A 3U37A 1TME1 4NOTA 4B7EA 3VUOA 4RR3B 2ZMNA 1AL23 2ILMA 4XJ9A 2FDHA 1MR5A 2DVGA 3UT0A 2VXRA 4F3JA 1H2KA 1SFNA 3KB5A 2JKXA 4XJZA 4BYYA 3VZNA 2YROA 3WF4A 2UY9A 4BA6A 1GMMA 1J84A 2AYHA 4IEOA 1S2BA 1GSLA 2QQJA 2CGNA 3MIFA 3RWKX 4FPLA 4Q4X3 1DQ6A 1Q8VA 1SACA 3KVAA 4FQ4A 3N9QA 4I0BA 4PT6A 3O5SA 4UW4A 5GLTA 3WDUA 5C7GA 2PQSA 2VAUA 3RZJA 1MEC1 2HWB3 1WMFA 2F6BA 2WWUA 1W6NB 3MBWA 5FZEA 1LJ7A 2ET7A 1SG3A 1YO8A 2W68A 2Y64A 4B29A 1Q8PA 5FYBA 4CE8A 3WNLA 4CCJA 3WQBA 3KV5A 3LCPA 3MLJA 4LHLA 5EZWA 1VAKA 1AR92 5FR3A 1Z0HA 4AVSA 3RZMA 4WVVA 3TAYA 4H7MA 1NCRC 5I8TA 4FP2A 1R081 5L7OB 1N1TA 3AB0A 4JHTA 1R1A2 1ND3C 1WD4A 2JG8B 3GM8A 3K77A 2W91A 2E7TA 1W2NA 3NW4A 2VPVA 5TSWA 4C90A 1W2AX 4Q4Y1 1JODA 1RUF2 1BJQA 2AENA 4LE3A 2ARBA 3FUQA 4XMAA 1AR72 3NJYA 1FNZA 1K5MB 4YW6A 5JMOA 2ZHLA 4TZDA 4L92A 1OQEA 3MO4A 1CAXA 4LMFA 4P9LA 4DS0A 5EFUA 5L9BA 2DCTA 3KM5A 2B4KA 4CPBD 4QPYA 4D0QA 4MSVA 3JQXA 1O6UA 1UOGA 3N35A 4GMP1 2NPIA 4BQ1A 5FYCA 4MLOA 2WS92 4E2SA 2WT1A 3H8OA 1IS5A 5L7OC 1RUJ3 1WW4A 3BALA 1JZ4A 1YI9A 4JC1A 1YYNA 4HLTA 2RE9A 1OSGA 4HK8A 5FYUA 2A3YA 1U5IA 3VBSA 5IK8A 1HLCA 1STMA 2BERA 1W3VA 4LOSA 4Y20B 2YBSA 3FLPA 5C33A 5F1RA 2HWE1 2HWC1 2RJKA 4XPVA 2VTXA 1VRH2 4ZU5A 5A33A 3NO8A 1WUVA 1SDDB 4MGSA 2RJ2A 2IXLA 4LA3A 2R16A 4OUSA 1A3KA 2BYVE 3WP5A 5AFEA 1W05A 2Q8OA 4NPRA 3PU3A 3FX3A 1Y9QA 1GICA 2GU9A 2BRTA 1MS3A 3AMPA 1NQDA 4YM3A 1D0HA 2VZ3A 3NWKA 5H9SA 1D4VB 1RUI1 5FBJA 3ZYRA 1XBFA 4LTAA 1J59A 4IE4A 1FMD3 2GN3A 3VV1A 1XNKA 5FMCA 1POQA 3HD8B 2KR2A 1I5ZA 1D2SA 3EXUA 3V64A 2PLV2 1CAUB 1KXGA 4XAAA 4AEDA 3WUCA 2JDKA 3THDA 1LOCA 3VZKA 3JCIA 4KMQA 1YHFA 2VQUA 4XACA 3P6BA 2WNVB 3SKJE 5A6XA 1LB2A 4I0AA 4YZ5A 2TBVA 5IT6A 5DAWA 2CNAA 1ZBE1 2FDJA 4LNVA 4AW7A 2ATFA 2VMDA 4TXWA 5IWFA 5FZ3A 1GQGA 3USUA 3OTFA 2Q0AA 3HWJA 4XETA 2NQYA 4XC9A 3P1IA 2ZX4A 2ZGLA 2A6ZA 1PO12 2GC2A 4LKFA 1OKOA 1TVGA 4BQWA 2XQXA 1O4YA 1W2OA 2VBDA 1ALYA 2YZ4A 5JUVA 4XVHA 5CG8A 1EV13 1Y3TA 5E8AA 4Y5TA 3VZJA 2WNVC 1N1YA 4PI0A 2X5IB 2YUEA 3ACLA 4H55A 4OMCA 5FPLA 1T6BX 4R9BA 5FV3A 1JYWA 4UBHA 2MEV1 2R0HA 4R8HA 4BLIA 2D44A 3O14A 1X33A 2BOIA 3JBG1 3LOIA 4OVEA 4DQAA 1UZWA 1J83A 1XNDA 2P17A 1UIJA 4YSFA 1Z7S3 2D7FA 3RFRA 4WM8C 3LEKA 4QAWA 4AI8A 4LLOA 1C8M1 1CONA 1SDWA 2X05A 1PHMA 1RUC3 4QXBA 1AR62 5G04L 5C4WB 2V5YA 4W8JA 2ARAA 4PIZA 5DDJ2 4K7JA 2DFBA 2ZEWA 3N36A 4JAAA 1UKGA 2JEMA 3MLLA 2LRPA 4PLOA 5FPXA 1PIV2 3GJAA 2VECA 2HJIA 3ETQA 4LITA 4KBZA 5LBCA 5L19A 4CDWB 2OPWA 4NIHA 1BQPA 3M3OA 1AL21 3QACA 3AKSA 1DQ1A 4A44A 3T2PA 1OH4A 3OYWB 3BTZA 2VGDA 2PYTA 1X50A 2C6SA 5FZKA 4RFT0 4AEKA 1SMVA 2UY8A 5JDBA 1IZ3A 4GZ9A 3ZKUA 3LA3A 1DGWA 2HYXA 1O8SA 5FZCA 4LHNA 2BQPA 1PGW2 5EXOA 4GD4A 3LIGA 1LECA 3DV8A 3ILFA 2D93A 2HWB1 3BIWE 1AYM3 2ARCA 4M3CF 4ZXEA 2PTMA 3THCA 2HH9A 1ZZBA 1T6GC 3CJIA 2VOTA 3ENRA 1NQJA 3PL0A 1XYNA 3T3YA 4CDWC 1YQCA 2WFF2 1PMIA 1V6JA 1IPKA 1IGOA 1PNFA 2VCCA 4IEVA 4RS5A 1YRZA 1VJ2A 5C3SA 4S2GA 2VW0A 1GBGA 4FOQA 5JXGA 1AYN2 1AJKA 1SCSA 3AJZA 3R0RA 1YQ8A 1OF3A 1HXS3 2IFRA 2Q4SA 3R4DB 4DXTA 1RVF2 5K0UC 4Z92B 3I3DA 3F95A 4AGGA 1I1EA 4LO5B 3M3IA 4XQDA 5KC6A 1I6XA 2QKDA 5BNNA 2DCYA 2YV8A 3WCRA 2A3WA 3N9PA 1A8MA 1CPMA 3KHBA 5GLWA 1JOPA 1SPPA 1WCQA 4YG0A 3V56A 2VU9A 1H9WA 2AR6A 2HEWF 2WINB 5FREA 3AJYA 5FZ0A 5FK8A 1JYTA 3HNBM 1OA3A 3A0NA 1HB3A 4NUBA 1OPOA 2FHRA 3WNXA 2JWPA 1A6CA 3ZO0B 1DGLA 1K42A 4Y1UA 1RUJ1 1ZZ7A 5F7UA 1JXNA 3WG3A 3C7FA 5LWBA 2QQUA 1X36A 2F4PA 1O4TA 1XNCA 4FXKB 2DCKA 5CB7A 1ULCA 2DCZA 3SCFA 3E6CC 1GR3A 2EIDA 1RINA 1SFYA 2RDSA 4URTA 1W0OA 3VL9A 3BKZA 4P9XA 3VLBB 3OBRA 3KSCA 1UOFA 4H3WA 4EROA 2XDVA 5LRSA 1RITA 1DYOA 1XYPA 5EYXA 4B4PA 2BV4A 5L36A 3RI9A 4BB3A 2I07B 4YYOA 4HETA 5IVVA 4CCEA 1YFUA 4YNIA 5M0TA 1FMD1 1HB2A 3VBSB 2RG4A 2ZGNA 3ECQA 4LEJA 5FOBB 2YC0A 4XYXA 2P37A 3MLKA 3PUQA 1QJFA 2DTYA 1J3RA 3MUZ1 4OFGA 4V2WA 4ZHNA 4J1XA 2P3YA 4YLZA 2A3XA 4QX2A 1LGNA 5GZCA 4RHV2 3Q8BA 5T55A 2BJSA 2ET1A 1F5JA 3AL5A 3E6BA 3WNNA 3AKRA 4UFKA 1A78A 4UYBA 5FCCA 4LK7A 3ZSJA 3FL7A 2VZQA 1KJLA 4PI2A 5BNQA 3BVCA 2EIEA 3HQUA 3K3OA 4BU2A 4IV1A 2XVKA 2A6XA 1CQ9A 3KCXA 1W8WA 4QB6A 1BMV2 2OA2A 3I2FA 1WLCA 2PXJA 2QQIA 5EYYA 5B4NA 2IXCA 1WW7A 4HFSA 2HKXA 3RZHA 1NZIA 4COWA 4MGTA 3RYKA 5HCBA 5FUPA 4CDXA 4TTGA 2D6PA 1HJGA 1EV11 3ZYPA 2ZHMA 4P14A 1HRI3 2P3JA 4BDVB 2D3RA 1PGSA 2VG9A 4J25A 1UYXA 1ND2B 4OLLA 3VD4A 1LOFC 1AX1A 3VZLA 3PVOA 2ZMLA 4N9HA 1LTEA 1LNSA 1UY0A 1XSQA 2WBKA 3UJQA 3WINE 3ZFFC 3TEZA 1CZTA 4QPIB 4YGDA 2GNDA 3GYDA 1RUD2 4GKXA 4AI9A 5GZEA 5JR2A 3KZ4C 5KXDA 2A7AA 5ERLA 5ABJC 1XB9A 1Z7S1 4ZU4A 3ZLIA 4KNCA 5LEJA 1GZ9A 4LBQA 2GSYA 1WW6A 3LAGA 1H0BA 5DAVA 1G9DA 3VBOB 1V0AA 3P3NA 3PMEA 2AEZA 1RUC1 2LROA 2ZGMA 1GWMA 2Y60A 3ILNA 5CFDA 2Z79A 3HVDA 3VDDB 4CRQA 5KWRA 2TNFA 2JG9C 1URXA 4YARA 5BNPB 1QJX2 2BGOA 3H42B 4W65A 3SISA 4QDQA 1ND2C 3PNAA 4XDQA 2E26A 1C3HA 1B35A 1VBC1 2RS33 4I09A 5IYYA 3AC0A 4E2GA 4QPIC 3QH6A 1SBDA 3ZYJB 5JXJA 1RC6A 5CVRA 4ZONA 4Y26A 1Y43B 1DQ2A 4XIKA 2DVFA 3PLQA 1OHFA 5BUVA 1G6NA 1IS6A 1G8WA 2KD7A 3V0AB 2FD8A 1H8TA 2QCSB 1S0GA 3VBOC 1UL9A 2R49A 1RMU3 3GZTB 4L8QA 2JDZA 3VDDC 3GBWA 4XF3A 2WYFA 4P9GA 2P5BA 5BNPC 1U5XA 2FMYA 1LHUA 5FZIA 3ACFA 2EIBA 1FV3A 4QPGB 3OPWA 1WMXA 2LALA 2ZPXA 3QCWA 1UPSA 1O8PA 3O0VA 4N53B 1AYM1 4NIIA 3MF6A 2DUOA 2RJLA 1C4RA 3ACHA 4WM7A 1AZDA 4N90A 3RVHA 3VBRB 3LZZA 4NAOA 3NNFA 2BWAA 1JZ7A 2B9VA 1Q8SA 3FN9A 4IGPA 5HI0A 4ASKA 3RRDA 5LASA 4BPZA 2VOXA 1VBA3 1F4HA 2F4LA 5AC92 1LGCA 1UMIA 4L97A 4MVTA 1GKBA 5FJHA 1H1AA 1WCDJ 1RUOA 2P34A 1DZRA 1QJY3 3S0MA 4JGZA 3SKVA 5A3UA 4IEUA 1HXS1 1W39A 3MEPA 3ZYIB 4AAPA 4B1LA 1MZFA 4QM8A 4F7ZA 4NIDA 2Y38A 4QM9A 2WZ8A 3POBA 3NV1A 3I2JA 4MO3M 5C8CB 4IEPA 3IDBB 2Z5WA 4QPGC 4RQPA 4RSUA 4MG2A 2ADEA 4N53C 3VBRC 4FPCA 1DDLA 1YI7A 3O1MA 3I2HA 1VBD3 4O9EA 1G9FA 4XFHA 3M8LA 4XE9A 2QUOA 3LB9A 2IUWA 1FPN2 1HQLA 1PK6B 4GIQA 5FLHA 1GOGA 4JRAA 1E5RA 1C5IA 3ZSKA 5D8AA 2Q1MA 3SEPA 4DIQA 5F9TA 1Q8OA 5FUNA 1XNAA 2OS2A 3NJZA 3SC7X 1WCSA 4AHWA 1OD5A 4LPLA 1YFYA 3AFGA 5FP7A 3AP9A 4MOAA 4CDQB 4M3CA 3MHZA 3KD4A 4BQ3A 3H1MA 1S0CA 3WT3A 1HRV3 2GP3A 1Y9MA 5T54A 3I3EA 5C8CC 3VZMA 2FMDA 5IVJA 1AR82 2ZGKA 1KJRA 2QQMA 3ES1A 3LDBA 3E5QA 2A71A 4R4XA 3HIFA 2A73B 3THPA 1CAVB 4R9CA 4A7KA 2EXIA 4FPGA 3WNPA 4BE3A 2CYFA 1N3OA 4DNYA 1PK6C 3HAGA 4QXCA 3NAPC 3BOWA 4R4ZA 1PVC2 1GV9A 2YPDA 5FMOS 3RYRA 1HN0A 1SLAA 4H2AA 1ZRDA 5FQ0A 2J1UA 3KVBA 5A7SA 4CDQC 3S6PA 4AQ2A 4C1WA 1S0BA 1WMDA 4DXZA 5A1AA 2JE9A 4KWLA 1H9PA 1LEMA 2LW8A 3WP6A 3R6SA 4GMP0 2RR12 2DCJA 4NPMA 4QU1A 4CSWA 3PVNA 1NA1A 5LA2A 4BQ4A 2YFZA 3M3QA 4EN6B 5LY2A 1NCRA 1KFUL 2WN3A 2XJVA 1N3PA 1J1LA 2JJ6A 2YPJA 3ZSMA 4WV8A 3CEWA 5LRRA 4KI5M 1FI2A 4TLGA 1LU2A 4FPYA 4QXHA 4XUPA 1ULFA 3BN6A 4Q0QA 4AAXA 4BQYA 2YC2A 5F5IA 3CF6E 3LF7A 1FNYA 1NE4A 1ZX5A 1W9TA 1DGWX 4I3GA 4LIVA 2UWCA 4B7KA 4CDUA 3IKWA 2Y33A 1EAH3 4O9GA 1RTVA 3NNMA 4Z8BA 4ES8A 3OUJA 2WLQA 4QXKA 3CZUA 3NJXA 1HRI1 2XR4A 3H3UA 4HPKB 4XF1A 5C5TA 3PMSA 1X7NA 2LM3A 1UZ0A 4CCOA 4CU8A 2FDFA 5JPMB 1UX7A 5FYIA 2HYKA 4I01A 1AL0G 1GQHA 3OF1A 2VCMA 5CU1A 2BDRA 4LUMA 1CZVA 4QHZA 2EXJA 4GQ7A 5A3OA 4QX0A 3HOBA 3RNSA 2XJRA 3FFZA 4UW6A 4UF0B 4AI1A 2ZZQA 4M0HA 5FKCA 3U10A 1RUH3 2G9GA 2CY6A 2VQ0A 3I7DA 4UW3A 4WBBA 1YQ5A 3MIHA 4CUGA 4LK6A 4FPKA 3T1LA 3OGVA 5K9YA 4YZ4A 3VD3A 4GB32 2QBXA 2GNTA 1WBFA 2B45X 1DYPA 4ASLA 2VD7A 4XFAA 3UESA 1W9FA 2ZEZA 4K6BA 5DUVA 5FXVA 5FZ9A 4AVVA 2RS31 3RMYA 3B93A 4L0PA 2YU2A 2QQLA 4WVZA 4XBNA 3UYJA 1DQ4A 1O91A 3KCCA 1H2NA 4D94A 1VBE2 5FBZA 1AHSA 3DKWA 5CFDB 4IEXA 1RHI2 4LULA 3WD5A 4Z1VA 3DKQA 1RMU1 1SQ4A 4Y33A 1C57A 3M3EA 3FJSA 4MH0E 5I91A 4IERA 3C3VA 1QJZA 1G86A 3D8CA 3FWEA 4ITCA 5FZHA 5L9VA 4Z2WA 4ASMB 4YZ1A 4E4DX 1BK0A 2FBEA 5HBAA 5I8YA 1PVXA 1ZBA3 4UFHA 4FBFA 5F37A 1JZ8A 1OOPC 3LGRA 4PBPA 3U1XA 1DP0A 1W8UA 4DEVA 1RGSA 2AC1A 1Y7BA 3LPGA 5JXHA 3J8F3 2C9KA 2D5HA 2XVLA 5F5CA 2X53S 1H4GA 2L9LA 1G9CA 1VBA1 1R1ZA 4XFCA 3FHIB 2QQKA 3UKTA 3ZKYA 4QGMA 5KC5A 1A34A 1ULPA 5FO9B 5DQ0A 3AKTA 4JTNA 3ZYGA 2EVXA 2CGPA 1QJY1 2CTVA 2XKPA 5FAXA 5A6ZA 2H6BA 4C1XA 4Q4W2 3QLQA 5EJ1B 1YC61 2G9ZA 2R1DA 2VZTA 4HANA 4CA9A 1R092 4Q4V2 1BEV3 1NE6A 3DPRC 4CTEA 4BXFA 1JZ2A 1ZZCA 5FTTC 4HK9A 5FP8A 3U14A 1ASJ1 1YIFA 3HQXA 1VBD1 2VMEA 3EO6A 4I2OA 2KA3A 5C3OA 4HVQA 4PBOA 2D98A 2R063 2RMU2 2W39A 3ATGA 4OHXA 1VLNA 4URAA 4Q5OA 2WNUA 5FY1A 2EXHA 1GZTA 5A7OA 1W6QA 3VBHA 1BK1A 2DBIA 1BVP1 4XTMA 3WNOA 5B2GB 5DUWA 2XJTA 3P5BA 1JYCA 3VZOA 4FXGB 2GAUA 1LODA 1UY4A 1HRV1 2R32A 3B01A 3ZXKA 1IQDC 4HXCA 2WZPP 4CUCA 3PUAA 3EHKA 1O3TA 4GH4B 4YW2A 4CEYA 3IBMA 3IAPA 4NHMA 4IV3B 3KGLA 4N7IA 3UV9A 1C5HA 1U0AA 2C4XA 2E63A 3KT4A 4XFBA 3T09A 3ALQA 4BISA 5LA0A 3JXSA 4KWKA 3ZYBA 3RG0A 2IVIB 3E1F1 4LT5A 4ISQA 2YHJA 4QPWA 3LOBA 1UU4A 3AP6A 1NY72 1OFSA 2QVSB 4QGLA 1BBT3 4AVTA 4L2NA 4AL9A 3HMYA 5BYNA 3FHAA 4LJHA 1IPSA 1APNA 1H1IA 3CMGA 5DABA 5A3TA 2D3PA 1COV3 5FYZA 2R043 2BBVA 2W1QA 3LSDA 1MVEA 3HPNA 1JYVA 2WZEA 2V09A 3A4UA 2P3IA 3ILRA 3LIHA 3V0BA 4CP9B 3QOPA 3NVCA 4CUBA 3E5XA 2ZX1A 3MICA 3D0JA 1Q43A 2PMWB 1S0JA 2DVAA 1WKYA 3B02A 3CJXA 3N7MA 2PHTA 2W47A 2RDQA 2RM23 4DUVA 2V72A 1ZRIA 2VVDA 4MXVA 5K0UA 3NMBA 4DRRA 1J3PA 1UMZA 2WDBA 5FDBA 3PU8A 1W9YA 3B5LB 3VB9A 1KFXL 4PQQA 3IZOA 1OC1A 4MXWA 5L73A 4QQLA 4C91A 1HKDA 4LIUA 4YW7A 4RR3C 3OEAA 1TE1B 3K48A 5FY5A 1DF0A 1EAH1 2BFUS 2W2IA 3H1WA 3W5MA 3VBFB 2UURA 5K7PA 1W6PB 2VZUA 1ZZ9A 1LU1A 2PHLA 1VIWB 3NSTA 2OW4A 2XGXA 4RYDA 4YW4A 4OZOA 2JD9A 3IB3A 4D7SA 5E88A 1RUG3 1F15A 4CEWB 5CKNA 1H2LA 2I45A 1OMIA 4Y22A 5F5AA 4NHYA 4CP0A 1REEA 3VBUA 1QQP3 3ZMOA 3N7KA 3R4SA 1W9SA 2BGPA 4BMBA 2JDPA 4G3YC 3VHPA 1DZQA 3H8RA 4QX7A 1RUH1 5T50A 1J58A 1PZ8A 4IE6A 5HCAA 1N1SA 2VMGA 3I8TA 1WLTA 3T30A 2Y6KA 2VC9A 3OBTA 3VBFC 5JZGB 4E4ZA 5JOWA 3HN1A 1TQ5A 2MNGA 5KXEA 2R072 1UIKA 4XZUG 3ZSLA 2VW2A 3MW2A 2JECA 2JG8C 2NYYA 4MGYE 3ZXDA 5BY5A 5EIYB 3MIGA 3T2TA 4CEWC 1VRBA 3JUUA 3VHRA 3OCPA 2C26A 1QU0A 4NROA 1NXD1 4IW3A 2Q8DA 3O0XA 3WDTA 1K5MC 3DECA 1H8VA 5FXXA 1I3HA 1AUYA 3VL8A 2NMOA 1CAWA 2WR9A 3DXTA 5LK5A 2FDGA 5ISLA 5DN2A 2BU9A 2ZA9A 1W8TA 4FOWA 3S5QA 1AR93 2WYSA 4EQVA 4NHKA 1UOBA 2R0FA 4XJAA 1W8ZA 1FOD2 3CDZB 5FYVA 4MX3A 5JZGC 4W4ZA 1JZ5A 1XNTA 1R1A3 1ZRCA 1ZREA 4WVWA 2YGLA 5JSPA 2WSVA 1ZBA1 1D4M2 1RUF3 3LA2A 1MQTB 4JKKA 1AR73 4FSJA 3LE0A 2WQ8A 3RZGA 5JPNB 1LCLA 1XU1A 3SH3A 3Q9OA 3Q8CA 3LPFA 3J8F1 2DV9A 3VHOA 1OKQA 2PHDA 3ASIA 4QQPA 4Y1XA 4H7LA 3BPZA 2ZX3A 1HN1A 3HNYM 5FY0A 2WS93 3WUDA 5FMOL 2CWSA 4AXOA 1PGL1 4E8DA 3AM2A 2CL2A 4XDOA 5CBLA 4FT8A 1DGRA 1QOSA 4OMDA 4XURA 5K4LA 2VZOA 1BEV1 3AXDA 3HBKA 3NV4A 3UGGA 5A3NA 1MQTC 1WWYA 4YW1A 2ZS6B 1VRH3 1NCQB 2BUKA 1UQXA 5JOYA 5GZFA 1MZ5A 4P9IA 3ZN6A 1CZSA 4ZZ8A 1LHOA 4COZA 4D7YA 3D0SA 2R061 5LB6A 2JENA 4JTOA 3H3ZA 2Y6GA 4S2HA 2G4IA 4UBGA 5F3EA 3VKMA 1UU5A 2BVBA 4QHOA 4XCBA 2W94A 1HX6A 1OURA 1NAEA 1LRHA 4MZUA 2ID4A 1GZWA 2PLV3 3Q8AA 4AGRA 3S5AA 2JKBA 3BI3A 3L9JT 1TNFA 3LEIA 1RUNA 1ULEA 4ZKTB 1NCQC 1ZA7A 4A2UA 1KGYA 1UWWA 2OXBA 2ZABA 3LA7A 2B9UA 4XUOA 5C9AB 2YY1A 4DXRA 2FZ1A 3WDYA 2XLGA 3VBHB 4Q0SA 2X5IC 4YVWB 1TMF2 1CIWA 5E6HA 3DN7A 4YM2A 3WW2A 1RUE1 3WQ0A 1KDKA 4UFIA 4XBLA 2FCTA 4A42A 4XZPA 1I5PA 4HG6B 4BK5A 1BBT1 2P4EA 2VM9A 4JX0A 3TWIA 1W8OA 4YG6A 4PDWA 3ZFGA 2B39A 1AXZA 1PO13 5BNOA 3ES4A 5FOJB 2VW1A 1COV1 4QX1A 2R041 3B00A 4AGVA 3KGZA 3PDQA 1US3A 1YNAA 3KV9A 4W6XA 2OVUA 3DEMA 3RZKA 2ZCWA 1QDOA 3ZFEA 5C4WC 2GC0A 5C9AC 4OQ8A 3WHTA 2VH9A 4YVWC 4Q4X1 2DURA 2PAMA 2RM21 4BWOA 2MPFA 2ZGTA 3GGLA 1LR5A 4K8RB 1HQNA 5FZOA 1MVQA 3TEXA 4INDA 5FPZA 4FOYA 4IEWA 4ES9A 1W6OA 3ZYHA 1LULA 1OFNA 2DU1A 2GNBA 2WO7A 3DGTA 1OA2A 3G7DA 1PZ7A 4LBOA 3JD72 2HWD2 4QKFA 4UFJA 1AR63 1ZZ8A 5GM0A 5IFPA 3KF3A 3LFMA 3SITA 5DDJ3 4AOCA 4AK3A 2BGCA 4BZ4A 1GQPA 2D97A 4ATEA 5I8SA 1SCRA 5KHJA 2AREA 2JIJA 1RUG1 4QKNA 3AYCA 2EF6A 1BKZA 1GNZA 1JN2P 1JOJA 4XILA 2RS12 3WF2A 4GXLA 3ZM8A 2CAUA 1ZM1A 1PIV3 1QQP1 1AXYA 2CDOA 4DEQA 2DVDA 5GZGA 2D6NA 5A1LA 1MZ6A 5I0RA 1OLMA 4CCDA 3APBA 3TN92 4CXYA 5D2AA 3WNKA 1W3XA 2Z69A 4META 2SLIA 3KS7A 2ZGSA 1UAIA 3OY8A 4IUGA 1SBFA 1S0DA 3CKHA 4LBNA 3AX4A 4N43A 5EP9A 5LCWL 5DZFA 2VOWA 5CADA 4BOWA 1DCSA 2VZSA 4XXPA 4FTEA 2OUJA 1ENQA 2YXSA 3CLPA 1CAXB 2VOKA 1UZVA 5B4XA 1HQWA 2J1RA 4HT1T 1W90A 1LHWA 1NOVA 1VR3A 2RVAA 2WFF3 4ARXA 4NN0A 4MGKE 4FO9A 4DUXA 5LEKA 1AR91 5HXMA 4LBKA 3T2OA 1C1LA 5F6LB 1OF4A 4PHZA 3SXWA 2D6OX 1AYN3 4K3UA 3NV2A 3UETA 1R1A1 2RS52 3GNEA 4FI9A 5DZGA 3DXUA 2J1SA 1WCUA 2E7QA 1OVPA 1RVF3 5A33B 1RUF1 2JXAA 5E89A 4OUEA 4B8EA 1EP0A 2NLRA 3OPZA 3U11A 5FYYA 4WVMA 3WCSA 5CFCA 1PMJX 4Y5Z0 4GJZA 1UU6A 1VBB2 2H6CA 5JLVA 4EWAA 3GZEA 2XVGA 3RI8A 1O3RA 1YUDA 3NL1A 4R52A 1IOAA 3VBSC 4R9DA 1PO22 4JGYA 1F8VA 2ZGPA 5A3PA 4AEDB 1YIPA 5A32A 4HZFA 2EAKA 5FXWA 3VKNA 4OYUA 3WLUA 4EWEA 1LHVA 1JOBA 1E57A 1VRH1 4K9SA 2PHFA 3WG1A 2J7MA 2VZRA 5ACA2 4IQPA 4UAPA 5FPAA 1JYNA 3I4IA 4KG8A 4YVSA 2XMLA 2YDEA 1NLRA 1XE7A 1T2XA 3RJ2X 4O65A 3BUCA 4W50A 5FZGA 4F8AA 1CX4A 1N1VA 1XC6A 5FZDA 1F35A 2JDNA 4TSVA 5C6CA 5FRAA 3T0BA 1VPHA 4EN7B 3USUB 2AGSA 5A3LA 2GMEA 5JI7A 4NIAA 1AJOA 2W87A 2VQTA 5A3MA 1DZTA 1MS0A 3L2HA 4NO4A 5FZFA 5FZ8A 4AEDC 3DF0A 2PLV1 4MUVA 1W6MA 1QH6A 5DAXA 4YPJA 5FO8B 2HWF2 4XHBA 2XLAA 4AF9A 1F2NA 3GHMA 3BGAA 2XBO2 3UNPA 4YG3A 3N9NA 4CYDA 1DFQA 4RHV3 3HT1A 3C8XA 4IEYA 4O7XA 3RPQA 3ZN4A 4AQTA 3SH4A 4P02B 3KWVA 2BEOA 5HXVA 3H1YA 2Y6FA 2JDYA 1ENXA 5A80A 4YFZA 2GALA 2V4AA 4NHXA 4Y24A 1SLCA 3T4HB 5LW9A 4ZXKA 5FYHA 3T0AA 1V9U2 3ZPOA 1E5IA 3BB6A 1OOPA 1X9PA 5JI9A 4FTBA 3ZMNA 2NM1A 2Y26A 3SCHA 1PO11 2ZMKA 4GJYA 2A6VA 3O1UA 4JDMA 5KHHA 1QNYA 2J1TA 2KXLA 5IVBA 1JTZX 1BLZA 1IG3A 4XIOA 1UXXX 1POV0 4U36A 1GOFA 3RSJA 3ZXJA 2FDKA 2GMMA 1QY4A 3RMXA 4M01A 3O1TA 3WW4A 4JDOA 4RGKA 2BNNA 3DCQA 4FQZA 3NNJA 4AE2A 3POSA 1JUIA 3EMRA 2ZBJA 5FPBA 5BNOB 1RUD3 1H30A 1I9RA 3C7EA 5A7WA 1ASJ2 3B7MA 3RQ0A 3M3CA 4A3ZA 1V00A 3NNLA 5CKQA 4DFSA 4ONUA 1BZWA 3AKPA 5EWSA 3TYJA 1LEDA 1PMHX 3POGA 1AR61 2NMNA 1AF9A 5CAZA 1O4ZA 3POYA 1QJU2 4X8PA 4D6SA 5IVFA 2WZR2 4UXAA 3KMHA 3ZXAC 1OA4A 2D5FA 1QJX3 5T5LA 4AQ6A 2DYCA 1CJPA 2IXJA 5EQUA 3W58A 3KV6A 1SLLA 2QQVA 2VOVA 4ZS3A 1PIV1 3KT1A 4EYUA 1FV2A 1JU3A 3CJIB 4AVBA 4CPBA 4NAMA 1UO9A 2RHPA 5CZKA 4AI3A 3AKQA 5KBFA 2QJVA 4RS5B 2W1UA 1NYWA 3MGUA 3AFKA 2R1BA 3C7HA 3PVBB 2DUQA 1OLRA 4DO0A 3I2DA 2OIIA 2QZ3A 3AZWA 5AVPA 2OQ7A 2YGMA 1CESA 1PGW1 3POJA 3A23A 5C3RA 5BNNB 3WY6A 4P5YA 1TME2 2VVEA 2WN2A 3OGRA 3CJIC 4XJ8A 1SPPB 4QMAA 3DL3A 3GZUC 4A6SA 2WFF1 3WR0A 2DVBA 2GH2A 5GJ6A 3QBQA 1WBLA 1QJEA 2WA3A 2ZJCA 3FFQA 3IPVA 5FYSA 5AC93 1DQ0A 5JIAA 3UJOA 3AZYA 2K2SA 4AVAA 2ZOEB 4N43B 3H0OA 4KGGA 1MEC2 3T2QA 2XUMA 2ZXQA 1RVF1 3BTAA 1MPXA 4XDPA 3O7OA 4YWAA 3WF1A 2ZGQA 4EE2A 2HLEA 3WV6A 5BNNC 4GWIA
chains in the Genus database with same CATH topology
4CCKA 2P5BA 4LXLA 5FZ7A 4BISA 5F3CA 5FZIA 4CCOA 3OPWA 5A80A 5FYIA 4C8DA 5F3GA 3LD8A 3U4SA 3KVAA 5A7QA 3RVHA 4D6RA 3N9QA 5FPLA 5A1LA 5LW9A 2XDVA 2GP5A 5FV3A 5FYHA 3ZPOA 5FZEA 5FWEA 2WWUA 3N9OA 4IGPA 5FY0A 5A3WA 4ASKA 5IVVA 4D6QA 5A1FA 5FZ1A 2OX0A 5FYBA 4TN7A 4UF0B 4GJYA 4CCJA 5FJHA 3KV5A 5IVBA 5FY7A 4XDOA 5FP4A 5K4LA 4CUGA 5A3TA 3PUQA 4IGQA 5F32A 5FYZA 4UF0A 4AAPA 4V2WA 5A3NA 2XUEA 5FJKA 2VD7A 4QXBA 5FPVA 5A7WB 5FWJA 3AL5A 5FXVA 5FZ9A 5IW0A 3NJYA 5FPBA 5F3EA 2YU2A 5F2WA 4EZHA 5FYTA 5A7WA 3UYJA 4V2VA 3K3OA 4BU2A 4CCMA 3PU8A 4GAZA 5FP3A 4LITA 5A7PA 3AL6A 2PXJA 3PTRB 5FY8A 4DIQA 5FUNA 2Q8CA 2OS2A 3PUSA 4LIUA 5FYCA 5F2SA 5FP7A 3DXUA 4Y33A 4IGOA 5FZ6A 5FY5A 2XXZA 4CCLA 4D6SA 2W2IA 5IVFA 5FZHA 3AVSA 5FXZA 5FUPA 4E4HA 2GP3A 2YBPA 5FZKA 5FYUA 2Q8EA 5IVJA 3KV6A 3LDBA 5FZCA 5F37A 2YBSA 5FYYA 5KR7A 4Y4RA 5FZLA 4EYUA 4GJZA 4GD4A 5F5AA 5E6HA 4Y3OA 5FZ4A 5FPUA 3U78A 5F5CA 3PU3A 4QXCA 5IVEA 5FZMA 2YPDA 5A7NA 4AI9A 5FZBA 4QX7A 4EZ4A 5A3PA 5F39A 5FBJA 4DO0A 3ZLIA 2WWJA 3K2OA 3KVBA 3KV4A 5ANQA 5A7SA 5FXWA 2OQ7A 2YU1A 3OPTA 3PDQA 5FZAA 4HONA 5FYMA 3KV9A 4BXFA 5FPAA 5IVCA 5FY4A 5FY9A 5FZOB 2XMLA 4QU1A 5FP8A 4CSWA 1VRBA 3N9MA 5FP9A 5FZGA 4HOOA 5LY2A 5LY1A 2OQ6A 2OT7A 2Q8DA 5F3IA 5FZDA 5FXXA 5CEHA 5FZOA 4URAA 3N9PA 3N9LA 5FYSA 3AVRA 3DXTA 4QXHA 5FZ0A 4QX8A 5FY1A 5ISLA 5FZFA 5A7OA 5FZ8A 5IWFA 5FZ3A 4NUBA 4CCNA 4QWNA 5FYVA 5F5IA 4XDPA 2YBKA 4LIVA 3PURA 3N9NA 3PUAA 3K3NA 5LWBA 5IVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CCK A;  2P5B A;  4LXL A;  5FZ7 A;  4BIS A;  5F3C A;  5FZI A;  4CCO A;  3OPW A;  5A80 A;  5FYI A;  4C8D A;  5F3G A;  3LD8 A;  3U4S A;  3KVA A;  5A7Q A;  3RVH A;  4D6R A;  3N9Q A;  5FPL A;  5A1L A;  5LW9 A;  2XDV A;  2GP5 A;  5FV3 A;  5FYH A;  3ZPO A;  5FZE A;  5FWE A;  2WWU A;  3N9O A;  4IGP A;  5FY0 A;  5A3W A;  4ASK A;  5IVV A;  4D6Q A;  5A1F A;  5FZ1 A;  2OX0 A;  5FYB A;  4TN7 A;  4UF0 B;  4GJY A;  4CCJ A;  5FJH A;  3KV5 A;  5IVB A;  5FY7 A;  4XDO A;  5FP4 A;  5K4L A;  4CUG A;  5A3T A;  3PUQ A;  4IGQ A;  5F32 A;  5FYZ A;  4UF0 A;  4AAP A;  4V2W A;  5A3N A;  2XUE A;  5FJK A;  2VD7 A;  4QXB A;  5FPV A;  5A7W B;  5FWJ A;  3AL5 A;  5FXV A;  5FZ9 A;  5IW0 A;  3NJY A;  5FPB A;  5F3E A;  2YU2 A;  5F2W A;  4EZH A;  5FYT A;  5A7W A;  3UYJ A;  4V2V A;  3K3O A;  4BU2 A;  4CCM A;  3PU8 A;  4GAZ A;  5FP3 A;  4LIT A;  5A7P A;  3AL6 A;  2PXJ A;  3PTR B;  5FY8 A;  4DIQ A;  5FUN A;  2Q8C A;  2OS2 A;  3PUS A;  4LIU A;  5FYC A;  5F2S A;  5FP7 A;  3DXU A;  4Y33 A;  4IGO A;  5FZ6 A;  5FY5 A;  2XXZ A;  4CCL A;  4D6S A;  2W2I A;  5IVF A;  5FZH A;  3AVS A;  5FXZ A;  5FUP A;  4E4H A;  2GP3 A;  2YBP A;  5FZK A;  5FYU A;  2Q8E A;  5IVJ A;  3KV6 A;  3LDB A;  5FZC A;  5F37 A;  2YBS A;  5FYY A;  5KR7 A;  4Y4R A;  5FZL A;  4EYU A;  4GJZ A;  4GD4 A;  5F5A A;  5E6H A;  4Y3O A;  5FZ4 A;  5FPU A;  3U78 A;  5F5C A;  3PU3 A;  4QXC A;  5IVE A;  5FZM A;  2YPD A;  5A7N A;  4AI9 A;  5FZB A;  4QX7 A;  4EZ4 A;  5A3P A;  5F39 A;  5FBJ A;  4DO0 A;  3ZLI A;  2WWJ A;  3K2O A;  3KVB A;  3KV4 A;  5ANQ A;  5A7S A;  5FXW A;  2OQ7 A;  2YU1 A;  3OPT A;  3PDQ A;  5FZA A;  4HON A;  5FYM A;  3KV9 A;  4BXF A;  5FPA A;  5IVC A;  5FY4 A;  5FY9 A;  5FZO B;  2XML A;  4QU1 A;  5FP8 A;  4CSW A;  1VRB A;  3N9M A;  5FP9 A;  5FZG A;  4HOO A;  5LY2 A;  5LY1 A;  2OQ6 A;  2OT7 A;  2Q8D A;  5F3I A;  5FZD A;  5FXX A;  5CEH A;  5FZO A;  4URA A;  3N9P A;  3N9L A;  5FYS A;  3AVR A;  3DXT A;  4QXH A;  5FZ0 A;  4QX8 A;  5FY1 A;  5ISL A;  5FZF A;  5A7O A;  5FZ8 A;  5IWF A;  5FZ3 A;  4NUB A;  4CCN A;  4QWN A;  5FYV A;  5F5I A;  4XDP A;  2YBK A;  4LIV A;  3PUR A;  3N9N A;  3PUA A;  3K3N A;  5LWB A;  5IVY A; 
#chains in the Genus database with same CATH topology
 2AH2 A;  2QZ2 A;  4CCC A;  5GLZ A;  4DXS A;  1KS5 A;  1L3J A;  2HEV F;  4UFM A;  5FZ7 A;  4GWM A;  5HCF A;  2C1F A;  1CWP A;  1JYI A;  1CR7 A;  3BU7 A;  3J26 N;  1R08 2;  4Q0U A;  1NLQ A;  3W9A A;  1FPN 3;  5A7Q A;  4D6R A;  3MZH A;  1WGP A;  2WO3 A;  1XJA A;  4JRL A;  4Q0P A;  1ND3 A;  3MI8 A;  2W5F A;  2HBT A;  2WO2 A;  4Q4Y 2;  4EJR A;  3MYX A;  3M7A A;  4NR1 A;  4P9Y A;  2OX0 A;  3CZJ A;  2DTW A;  5EPA A;  1VE0 A;  4CVU A;  5CA6 A;  4OQ9 A;  1L7L A;  1CVN A;  2Q1F A;  1W6N A;  4KG0 A;  5FIX A;  3DYO A;  1AR8 3;  4LKS A;  1Q56 A;  2P3K A;  3MW3 A;  4JCK A;  2GDF A;  4Q8K A;  2BP6 A;  2QQO A;  3N7J A;  1UW8 A;  4WZC A;  4D8M A;  5AFB A;  4IV1 B;  4AG4 A;  3FE5 A;  3WDW A;  5L7O A;  2VNG A;  2Z4F A;  3ZDS A;  1PVC 3;  1FT9 A;  1O5U A;  3D5O A;  3III A;  3RYP A;  5A32 B;  2LS6 A;  2Z42 A;  4UOJ A;  3THT A;  1O59 A;  4PJY A;  4KU8 A;  2HWE 2;  2HWC 2;  3E6D A;  3ON7 A;  4ZY9 A;  1ZRR A;  2Q5T A;  2F17 A;  2W0X A;  5C8W A;  2P2K A;  1KDM A;  2LTN A;  4EN8 B;  5J37 A;  5FY8 A;  1K5M A;  4I3P A;  4ARY A;  4CDX B;  3BYW A;  1EUT A;  4YVS B;  2W3J A;  3J7L A;  2Q8C A;  1KRI A;  3AP4 A;  1UZZ A;  1BHG A;  5FZ6 A;  4CCL A;  1VAV A;  2VJX A;  4OI4 A;  3OUI A;  3ACG A;  4JKL A;  1NG0 A;  2RR1 3;  2E7A A;  4RHV 1;  2WT0 A;  1XSR A;  3VDA A;  3J7M A;  1IPJ A;  4XUN A;  4FFH A;  1HB1 A;  1RUI 2;  1LGB A;  5T5P A;  1OT5 A;  3ZVX A;  4COV A;  2V5D A;  5FUI A;  2WAB A;  1S1A A;  4SBV A;  4OI1 A;  1UD1 A;  2P6H A;  1ZNP A;  5KR7 A;  5FZL A;  1GNH A;  4CU7 A;  2EIC A;  5K8S A;  3RDI A;  3CHX A;  1ULO A;  1BMV 1;  3JQW A;  4Y3O A;  3I3B A;  4OUM A;  3K4A A;  4Q0V A;  4Y20 A;  3SLI A;  2UU8 A;  4YGB A;  2EXK A;  4LBQ B;  2Q1Z B;  4LO7 A;  3BTX A;  3LSE A;  2FCV A;  3D6E A;  3GBG A;  4XTP A;  5CNA A;  2ZAC A;  2K0G A;  4CDX C;  3J9S A;  2WWS A;  4IE7 A;  3SMH A;  5F39 A;  4QDS A;  1LHN A;  3K2O A;  3FMG A;  3Q8E A;  4Q8L A;  1ZBE 2;  3H8U A;  4NJ4 A;  3K75 B;  2XHK A;  4LHS A;  1VAL A;  4AEM A;  1RXG A;  4HN1 A;  1B35 B;  1P8J A;  3AP7 A;  1ODN A;  5H9Q A;  3I54 A;  1VP6 A;  4DPN A;  5DG2 A;  3VD7 A;  5DAQ A;  3HQR A;  1ZVF A;  2VTF A;  4QB1 A;  5E1R A;  2ZX2 A;  4LOT A;  1MS9 A;  2HWE 3;  2HWC 3;  3KQR A;  3UL2 A;  3WNM A;  1CAU A;  1RUD 1;  2VUC A;  1XXN A;  2OT7 A;  4HKW A;  4FVV A;  2J42 A;  4XAB A;  5CKM A;  2QQP A;  1CN1 A;  1OQD A;  2GZW A;  3EB7 A;  4RA0 A;  3W20 A;  2YB7 A;  4LOR A;  5JSO A;  3KQ4 B;  2N7G A;  1H8T B;  3MDP A;  3AVR A;  2AZ5 A;  3LDR A;  4MGQ A;  3H7Y A;  5LBB A;  2WNV A;  3LEM A;  5CFD C;  1OUX A;  5CYY A;  3MV0 1;  1W04 A;  1BVV A;  3NKT A;  2D43 A;  2MEV 2;  1OLQ A;  3A0K A;  2J1V A;  4GB3 3;  4IES A;  2B46 X;  1YWK A;  5IUQ A;  4FAG A;  1UYZ A;  1XQN A;  1VMH A;  3GAL A;  1QJX 1;  3ME2 A;  1B35 C;  1N3Q A;  2X10 A;  3JBG 2;  1AXK A;  3I2G A;  5ANN A;  3RJR A;  3WP3 A;  1NXM A;  3KCY A;  4WM7 B;  2VE1 A;  1UX6 A;  1DHK B;  1QNW A;  3JB8 A;  4XBQ A;  4AQS A;  1QDC A;  2TEP A;  1FAY A;  3M2M A;  5KHG A;  4WM8 A;  4IE5 A;  1UZY A;  5F3G A;  2G9F A;  1C8M 2;  3LD8 A;  3WW1 A;  1VBE 3;  1RL3 A;  1RJ8 A;  1W06 A;  1RHI 3;  3N9O A;  4IEQ A;  1A8D A;  2PQQ A;  4UW5 A;  5A3W A;  1WCK A;  2X5I A;  4JGZ B;  5FZ1 A;  1RUE 2;  1GZC A;  1M06 G;  5HCH A;  4EV0 A;  2E32 A;  4BH9 A;  1FXZ A;  2CAV A;  4RQP B;  3QH7 A;  4GWJ A;  3PIJ A;  2XUE A;  2J1E A;  1Q3E A;  5D21 A;  1RED A;  1AL2 2;  1ONA A;  3WQ7 A;  1YJK A;  1FYU A;  2QE3 A;  2X09 A;  1FAT A;  4Q27 A;  1TZO A;  5C71 A;  4N8M A;  1DBN A;  3MFC A;  2VUL A;  5D8A B;  5AC9 1;  2WAA A;  4XQ4 A;  1JU4 A;  5FYT A;  1BXH A;  4V2V A;  1TG7 A;  2DF7 A;  4OUL A;  1SLB A;  4QGN A;  4JGZ C;  5FP3 A;  4M3C B;  1QOT A;  5A7P A;  1D2Q A;  1K12 A;  3C2U A;  2HWB 2;  4Q4W 3;  3AYE A;  1H1M A;  4O61 A;  1OH3 A;  4RQP C;  1R09 3;  4Q4V 3;  4AWD A;  4IGO A;  5IFT A;  3GCW A;  2XJU A;  4IL7 A;  5E16 A;  4GH4 C;  2XH6 A;  4CDW A;  3FUO A;  1UNB A;  4IV3 C;  3PJY A;  5IJR A;  5GLU A;  4E9K A;  2Y6J A;  3WVJ A;  4LBQ D;  5G05 L;  2RMU 3;  1V6L A;  4XJW A;  3ZOI A;  1XNB A;  1CGP A;  1HB4 A;  4Q26 A;  2Z2S B;  5D1I A;  5D8A C;  4YFW A;  3TNQ A;  3A7Q A;  5J96 B;  4BQ2 A;  2PHX A;  2ORX A;  4QT6 A;  4B3N A;  5BV6 A;  5FQ0 B;  5IAX A;  2JIG A;  1W28 A;  1OVS A;  4MAD A;  2OPK A;  5FZB A;  2D6L X;  4HVO A;  2IZW A;  2Y8K A;  3ZXF A;  1AR8 1;  2VY0 A;  2ZEY A;  3IDA A;  4RD7 A;  1M4W A;  4A3X A;  5JSR A;  3TRS B;  1QEX A;  4QDR A;  3ZX7 A;  1NA1 B;  3J7N A;  3O1V A;  4HSL A;  1NCR B;  5BXX A;  5FYM A;  3O1R A;  2PHR A;  3T1M A;  2WNO A;  1ND3 B;  1O5L A;  5FY4 A;  4BME A;  1RUJ 2;  4HBN A;  1EUU A;  3U0Z A;  4W6Y A;  1YQ2 A;  1PVC 1;  1JYX A;  5LY1 A;  2DUP A;  4XOG A;  5F3I A;  5IAV A;  3USS A;  3OUH A;  1V6I A;  3M70 A;  3TEY A;  2Y0O A;  3TNP B;  4OZX A;  4QX8 A;  3AYD A;  4CDU B;  4XJU A;  1X9T A;  5J7M A;  2A70 A;  1RJ7 A;  4DIN B;  4AI0 A;  1Q5O A;  2B7Y A;  3WX5 A;  4C0B A;  2RR1 1;  1NA1 C;  4FOV A;  4K20 A;  1KD7 A;  2YBK A;  4N9I A;  4A6O A;  4X6R B;  1UYY A;  1OD3 A;  3OD4 A;  4LKE A;  1J1T A;  4LA2 A;  4NWV A;  1Y9G A;  4KWJ A;  5FLJ A;  1FMD 2;  3SCG A;  5EJZ B;  3U75 A;  2A6Y A;  3I3Q A;  1EPW A;  2XJQ A;  3SHR A;  3KT7 A;  2FCU A;  5A70 A;  3PVE A;  5J98 B;  4AI2 A;  2WII B;  4Y1Y A;  1O3S A;  4OHY A;  3R4U A;  1C8N A;  3PTY A;  1H4H A;  1ULG A;  5SV8 A;  1QHD A;  1VMJ A;  3ZR6 A;  4BK4 A;  4KBB A;  2E31 A;  3OGS A;  1GLH A;  1ZA4 A;  1MS4 A;  3ZPY A;  1S55 A;  2ZTN A;  3B9C A;  1DLC A;  5IHR A;  2OUH A;  4CDU C;  4E8C A;  3TEW A;  1CX1 A;  1JHJ A;  1VAM A;  4D6Q A;  3U78 A;  3LWC A;  4LO6 B;  2XHN A;  4M00 A;  5J3U A;  3X29 B;  3WQ1 A;  4PLN A;  3IAQ A;  4QB2 A;  5FP4 A;  2WNE A;  2WJS A;  2W1S A;  1LES A;  1W0N A;  5F32 A;  2QTW B;  4PQ9 A;  3T4V A;  4GA9 A;  4A7Y A;  2X29 A;  4DZG A;  4PIY A;  5J09 A;  2VBP A;  4PCR A;  4PF1 A;  1NKG A;  4YZ2 A;  3ZR5 A;  3WDV A;  4Q1R A;  1BYH A;  4P00 B;  2AUY A;  2ES3 A;  4B1M A;  2D6K A;  4OI2 A;  1H2M A;  2D40 A;  1EV1 2;  2WO1 A;  2WA4 A;  3D4K A;  4GKY A;  2YYO A;  5F8P A;  3SNM A;  5GKA C;  4BJ0 A;  5LBE A;  2XLF A;  1SEF A;  4FPE A;  2W52 A;  4JDN A;  5I0U A;  1L7R A;  1XYO A;  1O3Q A;  2C9A A;  1UN1 A;  5LZ6 A;  1QH7 A;  1SBE A;  2IXI A;  1JS9 A;  2ZAH A;  1W0P A;  3AL6 A;  2O8Q A;  2PN5 A;  4GB3 1;  4HSJ A;  4PF5 A;  5DUX A;  1LOF A;  2R07 3;  3ETP A;  2Q30 A;  4ORF A;  2WSU A;  3ZFF A;  4LBL A;  1ST8 A;  4LUK A;  1ZRF A;  2XXZ A;  3A22 A;  5H9P A;  2ZEX A;  4E4H A;  2DFC A;  4FAH A;  3UGH A;  3OOX A;  3WDX A;  1Z7S 2;  5JWP A;  5ABJ A;  4DY5 A;  2OYZ A;  3L2Y A;  4ZZ5 A;  2WT2 A;  2E33 A;  5CIR A;  4S2D A;  3ST7 A;  3UKN A;  4Y4R A;  1VBE 1;  3OD0 A;  1RUC 2;  2IXH A;  4RGG A;  4GWN A;  1DGR N;  1RHI 1;  1SFP A;  5FPU A;  4ET7 A;  1WLD A;  3TBD A;  4XUT A;  2VCB A;  3DYM A;  3DUI A;  3NV3 A;  5IVE A;  1FOD 3;  2JG9 A;  3POI A;  1F4A A;  2I74 A;  3AXE A;  1ND2 A;  4FTS A;  1VBC 2;  5T3N A;  1KQR A;  3AMM A;  2SBA A;  3WF3 A;  1JMU B;  4E27 A;  2J1A A;  5ANQ A;  2E6V A;  2P1B A;  3PUI A;  3VDC A;  4QPI A;  1D4M 3;  2EAA A;  4G4F A;  2YU1 A;  3FZ3 A;  3ZDV A;  4WM8 B;  2O14 A;  3I2O A;  3AYA A;  1CPN A;  2GNM A;  1BCX A;  3BPS A;  2VMF A;  2OKX A;  4R9A A;  2Y6H A;  5FY9 A;  4XUQ A;  2CV6 A;  3EBR A;  3I49 A;  4JKM A;  2HBU A;  4KL1 A;  2ZHK A;  2WNU B;  2PFW A;  1EPZ A;  5I0T A;  3VBO A;  3VKO A;  4A7Z A;  1WD3 A;  2QFE A;  1W6Q B;  5DAP A;  3F2Z A;  2W92 A;  3VDD A;  3MUY 1;  2WL1 A;  2K46 A;  1VB4 A;  4BHP A;  4L9B A;  1LKN A;  4QD2 A;  1R64 A;  2PAK A;  3CQO A;  2A6W A;  3N9L A;  5BNP A;  3JB4 C;  2K9Z A;  1PZ9 A;  5FMD A;  5FFO C;  4Q4W 1;  5LAT A;  1AYM 2;  1H6X A;  1QXP A;  1W9W A;  1R09 1;  2IVJ A;  1S4C A;  4Q4V 1;  4CEY B;  2ADD A;  1PNG A;  4SLI A;  3HR9 A;  2ZGO A;  4DMI A;  1MS5 A;  4P9W A;  2BNM A;  3ELN A;  4XCA A;  2YFU A;  3RGB A;  2VXJ A;  1AX0 A;  4CCK A;  2JDA A;  3V0A A;  4JQR A;  2RMU 1;  5JIU A;  4Q29 A;  4LXL A;  2WNU C;  3OBZ A;  3VN4 A;  4LE4 A;  3VBH C;  1YCI A;  2H0V A;  1HXS 2;  1UKR A;  3HN3 A;  4BIF A;  4C8D A;  4E2Q A;  4G9S B;  4ZPI A;  1ENS A;  5AVA A;  3Q8F A;  3FBY A;  1VBC 3;  4WZF A;  1JW6 A;  2VQA A;  2GP5 A;  4W6W A;  1IQA A;  1W03 A;  4KU7 A;  4NMI A;  1UOJ A;  5IK4 A;  4QPG A;  1UF2 C;  3MW4 A;  4N53 A;  4CEY C;  3VBR A;  1W2T A;  2AEY A;  1MAC A;  1IKQ A;  2D3S A;  2E53 A;  2FQP A;  3OEB A;  4MHU A;  1LOE A;  3GXU A;  5FY7 A;  3D3A A;  4Q2F A;  3V0B B;  2YG0 A;  3C7O A;  3IMM A;  5FMB A;  4AR2 A;  2IC1 A;  3GHN A;  3OG2 A;  4IGQ A;  2PHU A;  1YEW A;  5J1X A;  4XF9 A;  2ORZ A;  4IDZ A;  3HJR A;  5FPV A;  1YFW A;  2IXK A;  1TMF 3;  5K0U B;  1D0G A;  2BZD A;  3GCX A;  5T5J A;  4FCA A;  3VGI A;  2QNK A;  5IW0 A;  3RS6 A;  1NY7 1;  3OGJ A;  2P6C A;  1B09 A;  1OBN A;  4MXW B;  1S0E A;  5C8C A;  3H7J A;  4FP3 A;  3KLS A;  2WQZ C;  3URF A;  1QWR A;  1JUH A;  2XWJ B;  3BOD A;  2NN8 A;  3CU7 A;  4GAZ A;  1UY1 A;  3ROU A;  3ZXG A;  1IG0 A;  2JB4 A;  3FLR A;  4KH9 A;  2CDP A;  3FHQ A;  3PJQ A;  2XON A;  1JI6 A;  1GAN A;  2JB8 A;  4FPJ A;  2W1W A;  4FFF A;  2VZP A;  3ZXL A;  1WLW A;  1LAJ A;  4AEJ A;  3B69 A;  2XJS A;  1PK6 A;  4NRM A;  2WFP A;  3NAP A;  1RIR A;  3RWN A;  5APA A;  1V6N A;  2VUJ A;  2GC1 A;  4Y5S A;  4Y22 B;  4FPO B;  4JQT A;  1NUK A;  3MIE A;  1TNR A;  3IM0 A;  4K1Z A;  3VBU B;  3WXP A;  1YLL A;  4MYE A;  4XMI A;  4CDQ A;  2BOJ A;  2W95 A;  1JH5 A;  3R05 A;  4NRP A;  2EAL A;  3IWZ A;  4P08 A;  3EJK A;  3LEG A;  4IET A;  4P9J A;  4M4R A;  2ZKN A;  1TEI A;  5HPO A;  1UY2 A;  1C28 A;  2GC3 A;  1ZYB A;  2AAC A;  2WUH A;  2XB6 C;  3I2I A;  4L11 A;  4MV2 A;  4IXL A;  1XRU A;  5FZM A;  1CAV A;  3JD7 3;  2HWD 3;  4NVP A;  4EWD A;  1ODM A;  1X8E A;  4L99 A;  2MHF A;  3NRU A;  3UK9 A;  5C3P A;  1LEN A;  5DG1 A;  3O1S A;  3KV4 A;  1N47 A;  1X8M A;  4CU9 A;  2A5Z A;  3ACI A;  1AX2 A;  3DYP A;  1QOO A;  4QQH A;  5EHD A;  3S57 A;  5JAX A;  4I30 A;  1ZZ6 A;  4HON A;  3WHU A;  2RDR A;  3VBU C;  2C0Z A;  4COU A;  4RN5 A;  2RS1 3;  2WLP A;  4HKO A;  3LFI A;  1AR7 1;  2JE8 A;  4A45 A;  3CNA A;  4YW5 A;  3N9M A;  1CAW B;  3LQC A;  1ULD A;  4NRQ A;  3ZN5 A;  5GZD A;  2QQW A;  3AMH A;  4LR4 A;  4XF4 A;  2BTV C;  2IWG B;  4UT5 A;  3TN9 3;  2JIC A;  4CP2 A;  3WOG A;  1HRI 2;  2VUD A;  3H3L A;  4I02 A;  5CEH A;  3A21 A;  3OB8 A;  3O12 A;  1U5Z A;  2WS9 1;  3VKF C;  5KXB A;  2R07 1;  3HNM A;  4V1P A;  4CCN A;  4QWN A;  4LHK A;  2E9Q A;  4Y1V A;  3J4U H;  3O1O A;  4HMZ A;  5DPN A;  3PUR A;  1RYY A;  2E51 A;  1WZX A;  1K3I A;  4OHW A;  3WEZ A;  1W8H A;  1JHN A;  4QQO A;  5IVY A;  3SH5 A;  4BCU A;  1JBC A;  3W59 A;  4MHR A;  1PX4 A;  4A4A A;  4Y4Y A;  5LBF A;  5JOX A;  2OZJ A;  5I0D A;  3IMN A;  1QMJ A;  2J22 A;  2WQ4 A;  3CBN A;  3N3H A;  2CSG A;  5J48 A;  3CO2 A;  1LOG A;  1W8F A;  3WG2 A;  2RV9 A;  5HV4 A;  3NNG A;  4HPK A;  4XEZ A;  4B4R A;  1FOD 1;  3ZFF B;  2RS5 3;  3WG4 A;  3ZIW A;  2RS3 2;  2JDH A;  1ENR A;  4TLF A;  5FKB A;  3POF A;  5ABJ B;  5JOZ A;  1D4M 1;  4BQX A;  5JMC A;  3O1P A;  3AZZ A;  1SZB A;  3I97 A;  3KF5 A;  3ZN6 B;  5A6Q A;  2HEY F;  1QXR A;  3FC0 A;  4UI9 L;  3N4M A;  2BFU L;  2WKK A;  4UF0 A;  4UFL A;  1XE8 A;  1VBB 3;  2KM2 A;  1IS4 A;  1OI6 A;  1RMU 2;  3WP4 A;  1GP6 A;  2VCA A;  2ZGR A;  1XU2 A;  4DRV A;  2JG9 B;  2VZV A;  1OXC A;  1KS4 A;  2VNO A;  5KXC A;  1JZ3 A;  1C1F A;  2VL4 A;  2Y34 A;  4XFI A;  4LQR A;  1GZW B;  3B94 A;  1PO2 3;  3ABZ A;  3ORJ A;  3I2K A;  1V6O A;  3U4X A;  1S2E A;  4CXX A;  3H9A A;  3ZSE A;  4TWT A;  1K5J A;  5I93 A;  3PTR B;  4QX3 A;  2FZ2 A;  3MPP G;  1GWK A;  1RB8 G;  5ACA 3;  1VBA 2;  4NHL A;  4RL7 A;  5C3Q A;  1G7Y A;  1US2 A;  3WF0 A;  4EN0 A;  5FXZ A;  4LLF A;  4C0H A;  2W9X A;  3OGG A;  2BNO A;  3VHN A;  4D69 A;  1QJY 2;  1UY3 A;  4AHY A;  3WSO A;  4J6G A;  3H8X A;  2PA7 A;  1X82 A;  1EY2 A;  1GUI A;  4PDW B;  3ZFG B;  5FZ4 A;  3DPR A;  1DLL A;  1E5H A;  1H6Y A;  4AFC A;  1W8N A;  4K1Y A;  1V70 A;  2HWF 3;  4Z2A A;  1VBD 2;  2FDI A;  1W99 A;  3AZV A;  2DDU A;  2JDM A;  2JE7 A;  4EZ4 A;  2GMP A;  2XBO 3;  3M4F A;  2A1X A;  2VTX J;  4HVR A;  3ZFE B;  2BWC A;  1AVB A;  4XXA A;  3S7I A;  1HJF A;  5J36 A;  2H0B A;  1QGL A;  1GWL A;  3POE A;  2VBB A;  5FZA A;  2GH8 A;  5LK7 B;  5DDJ 1;  1WA4 A;  5IK5 A;  1TMF 1;  3HT2 A;  5IVC A;  2YMZ A;  4CZS A;  2XPJ A;  4PIX A;  1CIY A;  3NQH A;  5FZO B;  1HRV 2;  1F31 A;  1NLS A;  1V9U 3;  3AMQ A;  4QU2 A;  4PDW C;  4HKL A;  3ZFG C;  1W6O B;  4XAE A;  2JDU A;  3I59 A;  5BNO C;  4COY A;  3GBF A;  4DOU A;  1FX5 A;  4QHB A;  3NJV A;  5T52 A;  2XOM A;  3I3M A;  1XE0 A;  1GP5 A;  2ZX0 A;  1ACC A;  3B3Q E;  2DWR A;  1CD3 G;  4FPH A;  1SHW B;  4I0W B;  4M4P A;  4EN9 B;  3ITQ A;  3AMN A;  3B9I A;  1KIT A;  2ZZJ A;  1IS3 A;  3ZFE C;  4DB5 A;  2DU0 A;  2UYB A;  3VD5 A;  4YM1 A;  3SEE A;  3T08 A;  1MS1 A;  2CHH A;  4LKD A;  3K3N A;  2GN7 A;  1S0F A;  5KHI A;  1VB2 A;  3AK0 A;  2RDN A;  3AZX A;  3EYP A;  3MFA A;  2XQR A;  4IEZ A;  4K8F A;  3C7G A;  5F3C A;  1PX3 A;  3D82 A;  5IK7 A;  1NT0 A;  4LBM A;  1ASJ 3;  1UCX A;  1YQ6 A;  4GH4 A;  1OLM E;  3NKG A;  3MF9 A;  3QD6 A;  4LO4 B;  1UPI A;  4Q1P A;  1D7P M;  5EV7 A;  4CXW A;  3K4Z A;  4IV3 A;  4JHZ A;  2B8M A;  2G1M A;  4X8N A;  4RS5 C;  3VKL A;  1OPM A;  3JD7 1;  5FWE A;  2HWD 1;  3OY8 B;  1WW5 A;  4CP1 A;  1VMF A;  3NAP B;  4Y1Z A;  4XF0 A;  2BVV A;  2VMC A;  3HBZ A;  1POV 3;  5A1F A;  1AYN 1;  1QJU 3;  3T0D A;  2WZR 3;  4JZR A;  1Q8Q A;  3MID A;  4OHZ A;  1SLT A;  1XOY A;  1WME A;  2XJP A;  4LBJ A;  2RS1 1;  4YGE A;  3OSD A;  5SV5 A;  4S2F A;  1GFF 2;  5CG9 A;  5FJK A;  2ZKL A;  4B4Q A;  4NIG A;  4BIO A;  1U12 A;  2A75 A;  2ZHN A;  4YRD A;  2JD4 A;  2ENR A;  3BOP A;  5FWJ A;  1EAH 2;  4RR3 A;  5H9R A;  3TN9 1;  1UMH A;  2B5H A;  3PUH A;  3GF6 A;  2XL7 A;  5F2W A;  4QX5 A;  4EZH A;  1QF3 A;  4CP9 A;  2CWM A;  1O7F A;  5C5U A;  2BW8 A;  4KGQ A;  1YXW A;  2VVF A;  2BPA 2;  4N43 C;  3UGF A;  4F83 A;  4AVC A;  1QIQ A;  2WAO A;  1K45 A;  5KHK A;  5EJ3 A;  1EYB A;  2W46 A;  4YM0 A;  1DIW A;  3PUS A;  2NP0 A;  4Z82 A;  4H14 A;  2CGO A;  2PEL A;  4WVM B;  5CFC B;  1TME 3;  3PIG A;  1RUH 2;  2Y0I A;  3W21 A;  2YBP A;  2Q8E A;  1NZC A;  3POW A;  1LOB A;  4JV4 A;  2EIG A;  3GDB A;  3VBF A;  5DXD A;  4ISR A;  3WW3 A;  1W6P A;  3K4D A;  1YFX A;  1L7Q A;  2VNR A;  2R7E B;  4JGY B;  2JG8 A;  2RS5 1;  3K46 A;  3MV1 1;  1HDK A;  5DMY A;  1HV0 A;  1PM7 A;  2QDR A;  5FLI A;  4YW3 A;  3ZXE A;  1MEC 3;  3CL1 A;  5A7N A;  4CEW A;  1G9B A;  4PLM A;  3EQE A;  4KWU A;  2X8K A;  1V6K A;  1DG6 A;  3K51 A;  4FPF A;  2EA7 A;  2WWJ A;  1CJD A;  3VDB A;  4LO8 A;  3GJB A;  1REF A;  2OZ6 A;  5CFC C;  3OPT A;  4RFR B;  4XFF A;  3IN9 A;  1VBB 1;  4QKD A;  5DZE A;  1R08 3;  3S7E A;  2PAE A;  4ZS2 A;  5JZG A;  4IV1 C;  4NPL A;  3V65 A;  2JX9 A;  4HOO A;  2Y6L A;  3P3P A;  1Y4W A;  4Q4Y 3;  4BM8 A;  4JGY C;  1ZBA 2;  1GOH A;  1PO2 1;  3W5N A;  1W6M B;  4A41 A;  2D6M A;  2PHW A;  2VMH A;  3IIA A;  1OQ1 A;  5DUU A;  1YJL A;  3WZ1 A;  3KHC A;  1PM4 A;  1DYK A;  2O1Q A;  3J8F 2;  1WA6 X;  4K21 A;  3FLT A;  4YVS C;  5ACA 1;  1F9K A;  5A6Y A;  3JZV A;  4ZU7 A;  4P5H A;  3IDC B;  4GMP 3;  4AHX A;  4DY3 A;  3MIB A;  1PGL 2;  3MPB A;  3OBA A;  4YGC A;  5F5Q A;  3BTY A;  3G6J B;  1QXJ A;  2WRA A;  5JVV A;  2DBN A;  1OOP B;  1BEV 2;  1MZE A;  4IE0 A;  5BPX A;  1DU3 D;  5LA9 A;  3U4S A;  1XPW A;  3E97 A;  4J1W A;  1MQT A;  4D7T A;  2G19 A;  2HWF 1;  4X6Q B;  5GLV A;  1MS8 A;  4UWD A;  1HW5 A;  2VUA A;  2R06 2;  2R6Q A;  2VNV A;  2XBO 1;  2O8O A;  4TN7 A;  2XL9 A;  2C24 A;  1RUI 3;  2UYA A;  4U2A A;  3M1H A;  2VO5 A;  5FK7 A;  5JXI A;  1JZ6 A;  1NX9 A;  5JR7 B;  4NE9 A;  3DPR B;  2ARX A;  2XKO A;  2YC4 A;  3CIH A;  4RGA A;  5A7W B;  1GU3 A;  1V9U 1;  1S0I A;  3TOJ A;  1UXZ A;  1HV1 A;  4M0N A;  4XQW A;  2W08 A;  1Z78 A;  2XWB B;  3BU0 A;  2QQN A;  5C70 A;  3O0W A;  4BXS V;  1NCQ A;  3J7H A;  4OHV A;  3N7L A;  4KQ7 A;  1IKP A;  1H8T C;  4CCM A;  4BQ5 A;  3SQO A;  4NWW A;  4XHX A;  4CUA A;  1ZBE 3;  3FBM A;  3RZL A;  1GNY A;  5HV0 A;  4FFG A;  3UKV A;  5F2S A;  5FO7 B;  5LA1 A;  1BBT 2;  2UWB A;  2ZGU A;  1QKQ A;  2WC2 A;  4AFM A;  3AVS A;  4D3W A;  5CIS A;  3I59 B;  2XG3 A;  4WM7 C;  5JCT A;  5F6K A;  1COV 2;  2R04 2;  5T5O A;  4HN0 A;  4XFG A;  1W2U A;  1LOA A;  3PHM A;  2O0O A;  4QQ2 A;  4CU6 A;  1U5Y A;  3H50 A;  3LDK A;  3ZYF A;  2V4V A;  4YZ3 A;  3ZIX A;  5C4W A;  2ETE A;  5C9A A;  4HL0 A;  1POV 1;  2IFW A;  1QJU 1;  2MEV 3;  3AP5 A;  3OJB A;  4Q4X 2;  2WZR 1;  2RM2 2;  2LUW A;  2BBA A;  4XW3 A;  4YVW A;  1SLI A;  4ATF A;  1J3Q A;  2TUN A;  3VD9 A;  1F5F A;  3IDE A;  1OUS A;  3JBG 3;  4MGI E;  1UYP A;  4AFA A;  4AZZ A;  4TYS A;  4OI0 A;  1G9A A;  4M3C E;  1V6M A;  5GAL A;  3BIE A;  2NZ9 A;  2ZAA A;  2UWA A;  2I2S A;  3IT8 A;  4N7U A;  4AFD A;  2QDN A;  4QKB A;  4BLJ A;  4E4S A;  2VR4 A;  1E5S A;  4AHZ A;  4Z07 A;  5L9R A;  4K40 A;  3U07 A;  3JU9 A;  4DUW A;  1C8M 3;  3E5U A;  3IPV B;  2C5D A;  1IHM A;  3INA A;  5FP9 A;  3OYW A;  4GUL A;  1FPN 1;  2OQ6 A;  2VZ1 A;  3BCW A;  2ERF A;  4GAL A;  1RUE 3;  1GP4 A;  1RUG 2;  4MGZ E;  3RZZ A;  1GYK A;  2R30 A;  2CU5 A;  3LKJ A;  4AFB A;  2B42 B;  1RXF A;  4FFI A;  1QQP 2;  3HEI A;  1S2K A;  3TB0 A;  4AYU A;  4OCT A;  5I0S A;  1DQ5 A;  5IAT A;  1HIX A;  3GZA A;  1KEX A;  2V73 A;  2VMI A;  4JVA A;  3S30 A;  3U37 A;  1TME 1;  4NOT A;  4B7E A;  3VUO A;  4RR3 B;  2ZMN A;  1AL2 3;  2ILM A;  4XJ9 A;  2FDH A;  1MR5 A;  2DVG A;  3UT0 A;  2VXR A;  4F3J A;  1H2K A;  1SFN A;  3KB5 A;  2JKX A;  4XJZ A;  4BYY A;  3VZN A;  2YRO A;  3WF4 A;  2UY9 A;  4BA6 A;  1GMM A;  1J84 A;  2AYH A;  4IEO A;  1S2B A;  1GSL A;  2QQJ A;  2CGN A;  3MIF A;  3RWK X;  4FPL A;  4Q4X 3;  1DQ6 A;  1Q8V A;  1SAC A;  3KVA A;  4FQ4 A;  3N9Q A;  4I0B A;  4PT6 A;  3O5S A;  4UW4 A;  5GLT A;  3WDU A;  5C7G A;  2PQS A;  2VAU A;  3RZJ A;  1MEC 1;  2HWB 3;  1WMF A;  2F6B A;  2WWU A;  1W6N B;  3MBW A;  5FZE A;  1LJ7 A;  2ET7 A;  1SG3 A;  1YO8 A;  2W68 A;  2Y64 A;  4B29 A;  1Q8P A;  5FYB A;  4CE8 A;  3WNL A;  4CCJ A;  3WQB A;  3KV5 A;  3LCP A;  3MLJ A;  4LHL A;  5EZW A;  1VAK A;  1AR9 2;  5FR3 A;  1Z0H A;  4AVS A;  3RZM A;  4WVV A;  3TAY A;  4H7M A;  1NCR C;  5I8T A;  4FP2 A;  1R08 1;  5L7O B;  1N1T A;  3AB0 A;  4JHT A;  1R1A 2;  1ND3 C;  1WD4 A;  2JG8 B;  3GM8 A;  3K77 A;  2W91 A;  2E7T A;  1W2N A;  3NW4 A;  2VPV A;  5TSW A;  4C90 A;  1W2A X;  4Q4Y 1;  1JOD A;  1RUF 2;  1BJQ A;  2AEN A;  4LE3 A;  2ARB A;  3FUQ A;  4XMA A;  1AR7 2;  3NJY A;  1FNZ A;  1K5M B;  4YW6 A;  5JMO A;  2ZHL A;  4TZD A;  4L92 A;  1OQE A;  3MO4 A;  1CAX A;  4LMF A;  4P9L A;  4DS0 A;  5EFU A;  5L9B A;  2DCT A;  3KM5 A;  2B4K A;  4CPB D;  4QPY A;  4D0Q A;  4MSV A;  3JQX A;  1O6U A;  1UOG A;  3N35 A;  4GMP 1;  2NPI A;  4BQ1 A;  5FYC A;  4MLO A;  2WS9 2;  4E2S A;  2WT1 A;  3H8O A;  1IS5 A;  5L7O C;  1RUJ 3;  1WW4 A;  3BAL A;  1JZ4 A;  1YI9 A;  4JC1 A;  1YYN A;  4HLT A;  2RE9 A;  1OSG A;  4HK8 A;  5FYU A;  2A3Y A;  1U5I A;  3VBS A;  5IK8 A;  1HLC A;  1STM A;  2BER A;  1W3V A;  4LOS A;  4Y20 B;  2YBS A;  3FLP A;  5C33 A;  5F1R A;  2HWE 1;  2HWC 1;  2RJK A;  4XPV A;  2VTX A;  1VRH 2;  4ZU5 A;  5A33 A;  3NO8 A;  1WUV A;  1SDD B;  4MGS A;  2RJ2 A;  2IXL A;  4LA3 A;  2R16 A;  4OUS A;  1A3K A;  2BYV E;  3WP5 A;  5AFE A;  1W05 A;  2Q8O A;  4NPR A;  3PU3 A;  3FX3 A;  1Y9Q A;  1GIC A;  2GU9 A;  2BRT A;  1MS3 A;  3AMP A;  1NQD A;  4YM3 A;  1D0H A;  2VZ3 A;  3NWK A;  5H9S A;  1D4V B;  1RUI 1;  5FBJ A;  3ZYR A;  1XBF A;  4LTA A;  1J59 A;  4IE4 A;  1FMD 3;  2GN3 A;  3VV1 A;  1XNK A;  5FMC A;  1POQ A;  3HD8 B;  2KR2 A;  1I5Z A;  1D2S A;  3EXU A;  3V64 A;  2PLV 2;  1CAU B;  1KXG A;  4XAA A;  4AED A;  3WUC A;  2JDK A;  3THD A;  1LOC A;  3VZK A;  3JCI A;  4KMQ A;  1YHF A;  2VQU A;  4XAC A;  3P6B A;  2WNV B;  3SKJ E;  5A6X A;  1LB2 A;  4I0A A;  4YZ5 A;  2TBV A;  5IT6 A;  5DAW A;  2CNA A;  1ZBE 1;  2FDJ A;  4LNV A;  4AW7 A;  2ATF A;  2VMD A;  4TXW A;  5IWF A;  5FZ3 A;  1GQG A;  3USU A;  3OTF A;  2Q0A A;  3HWJ A;  4XET A;  2NQY A;  4XC9 A;  3P1I A;  2ZX4 A;  2ZGL A;  2A6Z A;  1PO1 2;  2GC2 A;  4LKF A;  1OKO A;  1TVG A;  4BQW A;  2XQX A;  1O4Y A;  1W2O A;  2VBD A;  1ALY A;  2YZ4 A;  5JUV A;  4XVH A;  5CG8 A;  1EV1 3;  1Y3T A;  5E8A A;  4Y5T A;  3VZJ A;  2WNV C;  1N1Y A;  4PI0 A;  2X5I B;  2YUE A;  3ACL A;  4H55 A;  4OMC A;  5FPL A;  1T6B X;  4R9B A;  5FV3 A;  1JYW A;  4UBH A;  2MEV 1;  2R0H A;  4R8H A;  4BLI A;  2D44 A;  3O14 A;  1X33 A;  2BOI A;  3JBG 1;  3LOI A;  4OVE A;  4DQA A;  1UZW A;  1J83 A;  1XND A;  2P17 A;  1UIJ A;  4YSF A;  1Z7S 3;  2D7F A;  3RFR A;  4WM8 C;  3LEK A;  4QAW A;  4AI8 A;  4LLO A;  1C8M 1;  1CON A;  1SDW A;  2X05 A;  1PHM A;  1RUC 3;  4QXB A;  1AR6 2;  5G04 L;  5C4W B;  2V5Y A;  4W8J A;  2ARA A;  4PIZ A;  5DDJ 2;  4K7J A;  2DFB A;  2ZEW A;  3N36 A;  4JAA A;  1UKG A;  2JEM A;  3MLL A;  2LRP A;  4PLO A;  5FPX A;  1PIV 2;  3GJA A;  2VEC A;  2HJI A;  3ETQ A;  4LIT A;  4KBZ A;  5LBC A;  5L19 A;  4CDW B;  2OPW A;  4NIH A;  1BQP A;  3M3O A;  1AL2 1;  3QAC A;  3AKS A;  1DQ1 A;  4A44 A;  3T2P A;  1OH4 A;  3OYW B;  3BTZ A;  2VGD A;  2PYT A;  1X50 A;  2C6S A;  5FZK A;  4RFT 0;  4AEK A;  1SMV A;  2UY8 A;  5JDB A;  1IZ3 A;  4GZ9 A;  3ZKU A;  3LA3 A;  1DGW A;  2HYX A;  1O8S A;  5FZC A;  4LHN A;  2BQP A;  1PGW 2;  5EXO A;  4GD4 A;  3LIG A;  1LEC A;  3DV8 A;  3ILF A;  2D93 A;  2HWB 1;  3BIW E;  1AYM 3;  2ARC A;  4M3C F;  4ZXE A;  2PTM A;  3THC A;  2HH9 A;  1ZZB A;  1T6G C;  3CJI A;  2VOT A;  3ENR A;  1NQJ A;  3PL0 A;  1XYN A;  3T3Y A;  4CDW C;  1YQC A;  2WFF 2;  1PMI A;  1V6J A;  1IPK A;  1IGO A;  1PNF A;  2VCC A;  4IEV A;  4RS5 A;  1YRZ A;  1VJ2 A;  5C3S A;  4S2G A;  2VW0 A;  1GBG A;  4FOQ A;  5JXG A;  1AYN 2;  1AJK A;  1SCS A;  3AJZ A;  3R0R A;  1YQ8 A;  1OF3 A;  1HXS 3;  2IFR A;  2Q4S A;  3R4D B;  4DXT A;  1RVF 2;  5K0U C;  4Z92 B;  3I3D A;  3F95 A;  4AGG A;  1I1E A;  4LO5 B;  3M3I A;  4XQD A;  5KC6 A;  1I6X A;  2QKD A;  5BNN A;  2DCY A;  2YV8 A;  3WCR A;  2A3W A;  3N9P A;  1A8M A;  1CPM A;  3KHB A;  5GLW A;  1JOP A;  1SPP A;  1WCQ A;  4YG0 A;  3V56 A;  2VU9 A;  1H9W A;  2AR6 A;  2HEW F;  2WIN B;  5FRE A;  3AJY A;  5FZ0 A;  5FK8 A;  1JYT A;  3HNB M;  1OA3 A;  3A0N A;  1HB3 A;  4NUB A;  1OPO A;  2FHR A;  3WNX A;  2JWP A;  1A6C A;  3ZO0 B;  1DGL A;  1K42 A;  4Y1U A;  1RUJ 1;  1ZZ7 A;  5F7U A;  1JXN A;  3WG3 A;  3C7F A;  5LWB A;  2QQU A;  1X36 A;  2F4P A;  1O4T A;  1XNC A;  4FXK B;  2DCK A;  5CB7 A;  1ULC A;  2DCZ A;  3SCF A;  3E6C C;  1GR3 A;  2EID A;  1RIN A;  1SFY A;  2RDS A;  4URT A;  1W0O A;  3VL9 A;  3BKZ A;  4P9X A;  3VLB B;  3OBR A;  3KSC A;  1UOF A;  4H3W A;  4ERO A;  2XDV A;  5LRS A;  1RIT A;  1DYO A;  1XYP A;  5EYX A;  4B4P A;  2BV4 A;  5L36 A;  3RI9 A;  4BB3 A;  2I07 B;  4YYO A;  4HET A;  5IVV A;  4CCE A;  1YFU A;  4YNI A;  5M0T A;  1FMD 1;  1HB2 A;  3VBS B;  2RG4 A;  2ZGN A;  3ECQ A;  4LEJ A;  5FOB B;  2YC0 A;  4XYX A;  2P37 A;  3MLK A;  3PUQ A;  1QJF A;  2DTY A;  1J3R A;  3MUZ 1;  4OFG A;  4V2W A;  4ZHN A;  4J1X A;  2P3Y A;  4YLZ A;  2A3X A;  4QX2 A;  1LGN A;  5GZC A;  4RHV 2;  3Q8B A;  5T55 A;  2BJS A;  2ET1 A;  1F5J A;  3AL5 A;  3E6B A;  3WNN A;  3AKR A;  4UFK A;  1A78 A;  4UYB A;  5FCC A;  4LK7 A;  3ZSJ A;  3FL7 A;  2VZQ A;  1KJL A;  4PI2 A;  5BNQ A;  3BVC A;  2EIE A;  3HQU A;  3K3O A;  4BU2 A;  4IV1 A;  2XVK A;  2A6X A;  1CQ9 A;  3KCX A;  1W8W A;  4QB6 A;  1BMV 2;  2OA2 A;  3I2F A;  1WLC A;  2PXJ A;  2QQI A;  5EYY A;  5B4N A;  2IXC A;  1WW7 A;  4HFS A;  2HKX A;  3RZH A;  1NZI A;  4COW A;  4MGT A;  3RYK A;  5HCB A;  5FUP A;  4CDX A;  4TTG A;  2D6P A;  1HJG A;  1EV1 1;  3ZYP A;  2ZHM A;  4P14 A;  1HRI 3;  2P3J A;  4BDV B;  2D3R A;  1PGS A;  2VG9 A;  4J25 A;  1UYX A;  1ND2 B;  4OLL A;  3VD4 A;  1LOF C;  1AX1 A;  3VZL A;  3PVO A;  2ZML A;  4N9H A;  1LTE A;  1LNS A;  1UY0 A;  1XSQ A;  2WBK A;  3UJQ A;  3WIN E;  3ZFF C;  3TEZ A;  1CZT A;  4QPI B;  4YGD A;  2GND A;  3GYD A;  1RUD 2;  4GKX A;  4AI9 A;  5GZE A;  5JR2 A;  3KZ4 C;  5KXD A;  2A7A A;  5ERL A;  5ABJ C;  1XB9 A;  1Z7S 1;  4ZU4 A;  3ZLI A;  4KNC A;  5LEJ A;  1GZ9 A;  4LBQ A;  2GSY A;  1WW6 A;  3LAG A;  1H0B A;  5DAV A;  1G9D A;  3VBO B;  1V0A A;  3P3N A;  3PME A;  2AEZ A;  1RUC 1;  2LRO A;  2ZGM A;  1GWM A;  2Y60 A;  3ILN A;  5CFD A;  2Z79 A;  3HVD A;  3VDD B;  4CRQ A;  5KWR A;  2TNF A;  2JG9 C;  1URX A;  4YAR A;  5BNP B;  1QJX 2;  2BGO A;  3H42 B;  4W65 A;  3SIS A;  4QDQ A;  1ND2 C;  3PNA A;  4XDQ A;  2E26 A;  1C3H A;  1B35 A;  1VBC 1;  2RS3 3;  4I09 A;  5IYY A;  3AC0 A;  4E2G A;  4QPI C;  3QH6 A;  1SBD A;  3ZYJ B;  5JXJ A;  1RC6 A;  5CVR A;  4ZON A;  4Y26 A;  1Y43 B;  1DQ2 A;  4XIK A;  2DVF A;  3PLQ A;  1OHF A;  5BUV A;  1G6N A;  1IS6 A;  1G8W A;  2KD7 A;  3V0A B;  2FD8 A;  1H8T A;  2QCS B;  1S0G A;  3VBO C;  1UL9 A;  2R49 A;  1RMU 3;  3GZT B;  4L8Q A;  2JDZ A;  3VDD C;  3GBW A;  4XF3 A;  2WYF A;  4P9G A;  2P5B A;  5BNP C;  1U5X A;  2FMY A;  1LHU A;  5FZI A;  3ACF A;  2EIB A;  1FV3 A;  4QPG B;  3OPW A;  1WMX A;  2LAL A;  2ZPX A;  3QCW A;  1UPS A;  1O8P A;  3O0V A;  4N53 B;  1AYM 1;  4NII A;  3MF6 A;  2DUO A;  2RJL A;  1C4R A;  3ACH A;  4WM7 A;  1AZD A;  4N90 A;  3RVH A;  3VBR B;  3LZZ A;  4NAO A;  3NNF A;  2BWA A;  1JZ7 A;  2B9V A;  1Q8S A;  3FN9 A;  4IGP A;  5HI0 A;  4ASK A;  3RRD A;  5LAS A;  4BPZ A;  2VOX A;  1VBA 3;  1F4H A;  2F4L A;  5AC9 2;  1LGC A;  1UMI A;  4L97 A;  4MVT A;  1GKB A;  5FJH A;  1H1A A;  1WCD J;  1RUO A;  2P34 A;  1DZR A;  1QJY 3;  3S0M A;  4JGZ A;  3SKV A;  5A3U A;  4IEU A;  1HXS 1;  1W39 A;  3MEP A;  3ZYI B;  4AAP A;  4B1L A;  1MZF A;  4QM8 A;  4F7Z A;  4NID A;  2Y38 A;  4QM9 A;  2WZ8 A;  3POB A;  3NV1 A;  3I2J A;  4MO3 M;  5C8C B;  4IEP A;  3IDB B;  2Z5W A;  4QPG C;  4RQP A;  4RSU A;  4MG2 A;  2ADE A;  4N53 C;  3VBR C;  4FPC A;  1DDL A;  1YI7 A;  3O1M A;  3I2H A;  1VBD 3;  4O9E A;  1G9F A;  4XFH A;  3M8L A;  4XE9 A;  2QUO A;  3LB9 A;  2IUW A;  1FPN 2;  1HQL A;  1PK6 B;  4GIQ A;  5FLH A;  1GOG A;  4JRA A;  1E5R A;  1C5I A;  3ZSK A;  5D8A A;  2Q1M A;  3SEP A;  4DIQ A;  5F9T A;  1Q8O A;  5FUN A;  1XNA A;  2OS2 A;  3NJZ A;  3SC7 X;  1WCS A;  4AHW A;  1OD5 A;  4LPL A;  1YFY A;  3AFG A;  5FP7 A;  3AP9 A;  4MOA A;  4CDQ B;  4M3C A;  3MHZ A;  3KD4 A;  4BQ3 A;  3H1M A;  1S0C A;  3WT3 A;  1HRV 3;  2GP3 A;  1Y9M A;  5T54 A;  3I3E A;  5C8C C;  3VZM A;  2FMD A;  5IVJ A;  1AR8 2;  2ZGK A;  1KJR A;  2QQM A;  3ES1 A;  3LDB A;  3E5Q A;  2A71 A;  4R4X A;  3HIF A;  2A73 B;  3THP A;  1CAV B;  4R9C A;  4A7K A;  2EXI A;  4FPG A;  3WNP A;  4BE3 A;  2CYF A;  1N3O A;  4DNY A;  1PK6 C;  3HAG A;  4QXC A;  3NAP C;  3BOW A;  4R4Z A;  1PVC 2;  1GV9 A;  2YPD A;  5FMO S;  3RYR A;  1HN0 A;  1SLA A;  4H2A A;  1ZRD A;  5FQ0 A;  2J1U A;  3KVB A;  5A7S A;  4CDQ C;  3S6P A;  4AQ2 A;  4C1W A;  1S0B A;  1WMD A;  4DXZ A;  5A1A A;  2JE9 A;  4KWL A;  1H9P A;  1LEM A;  2LW8 A;  3WP6 A;  3R6S A;  4GMP 0;  2RR1 2;  2DCJ A;  4NPM A;  4QU1 A;  4CSW A;  3PVN A;  1NA1 A;  5LA2 A;  4BQ4 A;  2YFZ A;  3M3Q A;  4EN6 B;  5LY2 A;  1NCR A;  1KFU L;  2WN3 A;  2XJV A;  1N3P A;  1J1L A;  2JJ6 A;  2YPJ A;  3ZSM A;  4WV8 A;  3CEW A;  5LRR A;  4KI5 M;  1FI2 A;  4TLG A;  1LU2 A;  4FPY A;  4QXH A;  4XUP A;  1ULF A;  3BN6 A;  4Q0Q A;  4AAX A;  4BQY A;  2YC2 A;  5F5I A;  3CF6 E;  3LF7 A;  1FNY A;  1NE4 A;  1ZX5 A;  1W9T A;  1DGW X;  4I3G A;  4LIV A;  2UWC A;  4B7K A;  4CDU A;  3IKW A;  2Y33 A;  1EAH 3;  4O9G A;  1RTV A;  3NNM A;  4Z8B A;  4ES8 A;  3OUJ A;  2WLQ A;  4QXK A;  3CZU A;  3NJX A;  1HRI 1;  2XR4 A;  3H3U A;  4HPK B;  4XF1 A;  5C5T A;  3PMS A;  1X7N A;  2LM3 A;  1UZ0 A;  4CCO A;  4CU8 A;  2FDF A;  5JPM B;  1UX7 A;  5FYI A;  2HYK A;  4I01 A;  1AL0 G;  1GQH A;  3OF1 A;  2VCM A;  5CU1 A;  2BDR A;  4LUM A;  1CZV A;  4QHZ A;  2EXJ A;  4GQ7 A;  5A3O A;  4QX0 A;  3HOB A;  3RNS A;  2XJR A;  3FFZ A;  4UW6 A;  4UF0 B;  4AI1 A;  2ZZQ A;  4M0H A;  5FKC A;  3U10 A;  1RUH 3;  2G9G A;  2CY6 A;  2VQ0 A;  3I7D A;  4UW3 A;  4WBB A;  1YQ5 A;  3MIH A;  4CUG A;  4LK6 A;  4FPK A;  3T1L A;  3OGV A;  5K9Y A;  4YZ4 A;  3VD3 A;  4GB3 2;  2QBX A;  2GNT A;  1WBF A;  2B45 X;  1DYP A;  4ASL A;  2VD7 A;  4XFA A;  3UES A;  1W9F A;  2ZEZ A;  4K6B A;  5DUV A;  5FXV A;  5FZ9 A;  4AVV A;  2RS3 1;  3RMY A;  3B93 A;  4L0P A;  2YU2 A;  2QQL A;  4WVZ A;  4XBN A;  3UYJ A;  1DQ4 A;  1O91 A;  3KCC A;  1H2N A;  4D94 A;  1VBE 2;  5FBZ A;  1AHS A;  3DKW A;  5CFD B;  4IEX A;  1RHI 2;  4LUL A;  3WD5 A;  4Z1V A;  3DKQ A;  1RMU 1;  1SQ4 A;  4Y33 A;  1C57 A;  3M3E A;  3FJS A;  4MH0 E;  5I91 A;  4IER A;  3C3V A;  1QJZ A;  1G86 A;  3D8C A;  3FWE A;  4ITC A;  5FZH A;  5L9V A;  4Z2W A;  4ASM B;  4YZ1 A;  4E4D X;  1BK0 A;  2FBE A;  5HBA A;  5I8Y A;  1PVX A;  1ZBA 3;  4UFH A;  4FBF A;  5F37 A;  1JZ8 A;  1OOP C;  3LGR A;  4PBP A;  3U1X A;  1DP0 A;  1W8U A;  4DEV A;  1RGS A;  2AC1 A;  1Y7B A;  3LPG A;  5JXH A;  3J8F 3;  2C9K A;  2D5H A;  2XVL A;  5F5C A;  2X53 S;  1H4G A;  2L9L A;  1G9C A;  1VBA 1;  1R1Z A;  4XFC A;  3FHI B;  2QQK A;  3UKT A;  3ZKY A;  4QGM A;  5KC5 A;  1A34 A;  1ULP A;  5FO9 B;  5DQ0 A;  3AKT A;  4JTN A;  3ZYG A;  2EVX A;  2CGP A;  1QJY 1;  2CTV A;  2XKP A;  5FAX A;  5A6Z A;  2H6B A;  4C1X A;  4Q4W 2;  3QLQ A;  5EJ1 B;  1YC6 1;  2G9Z A;  2R1D A;  2VZT A;  4HAN A;  4CA9 A;  1R09 2;  4Q4V 2;  1BEV 3;  1NE6 A;  3DPR C;  4CTE A;  4BXF A;  1JZ2 A;  1ZZC A;  5FTT C;  4HK9 A;  5FP8 A;  3U14 A;  1ASJ 1;  1YIF A;  3HQX A;  1VBD 1;  2VME A;  3EO6 A;  4I2O A;  2KA3 A;  5C3O A;  4HVQ A;  4PBO A;  2D98 A;  2R06 3;  2RMU 2;  2W39 A;  3ATG A;  4OHX A;  1VLN A;  4URA A;  4Q5O A;  2WNU A;  5FY1 A;  2EXH A;  1GZT A;  5A7O A;  1W6Q A;  3VBH A;  1BK1 A;  2DBI A;  1BVP 1;  4XTM A;  3WNO A;  5B2G B;  5DUW A;  2XJT A;  3P5B A;  1JYC A;  3VZO A;  4FXG B;  2GAU A;  1LOD A;  1UY4 A;  1HRV 1;  2R32 A;  3B01 A;  3ZXK A;  1IQD C;  4HXC A;  2WZP P;  4CUC A;  3PUA A;  3EHK A;  1O3T A;  4GH4 B;  4YW2 A;  4CEY A;  3IBM A;  3IAP A;  4NHM A;  4IV3 B;  3KGL A;  4N7I A;  3UV9 A;  1C5H A;  1U0A A;  2C4X A;  2E63 A;  3KT4 A;  4XFB A;  3T09 A;  3ALQ A;  4BIS A;  5LA0 A;  3JXS A;  4KWK A;  3ZYB A;  3RG0 A;  2IVI B;  3E1F 1;  4LT5 A;  4ISQ A;  2YHJ A;  4QPW A;  3LOB A;  1UU4 A;  3AP6 A;  1NY7 2;  1OFS A;  2QVS B;  4QGL A;  1BBT 3;  4AVT A;  4L2N A;  4AL9 A;  3HMY A;  5BYN A;  3FHA A;  4LJH A;  1IPS A;  1APN A;  1H1I A;  3CMG A;  5DAB A;  5A3T A;  2D3P A;  1COV 3;  5FYZ A;  2R04 3;  2BBV A;  2W1Q A;  3LSD A;  1MVE A;  3HPN A;  1JYV A;  2WZE A;  2V09 A;  3A4U A;  2P3I A;  3ILR A;  3LIH A;  3V0B A;  4CP9 B;  3QOP A;  3NVC A;  4CUB A;  3E5X A;  2ZX1 A;  3MIC A;  3D0J A;  1Q43 A;  2PMW B;  1S0J A;  2DVA A;  1WKY A;  3B02 A;  3CJX A;  3N7M A;  2PHT A;  2W47 A;  2RDQ A;  2RM2 3;  4DUV A;  2V72 A;  1ZRI A;  2VVD A;  4MXV A;  5K0U A;  3NMB A;  4DRR A;  1J3P A;  1UMZ A;  2WDB A;  5FDB A;  3PU8 A;  1W9Y A;  3B5L B;  3VB9 A;  1KFX L;  4PQQ A;  3IZO A;  1OC1 A;  4MXW A;  5L73 A;  4QQL A;  4C91 A;  1HKD A;  4LIU A;  4YW7 A;  4RR3 C;  3OEA A;  1TE1 B;  3K48 A;  5FY5 A;  1DF0 A;  1EAH 1;  2BFU S;  2W2I A;  3H1W A;  3W5M A;  3VBF B;  2UUR A;  5K7P A;  1W6P B;  2VZU A;  1ZZ9 A;  1LU1 A;  2PHL A;  1VIW B;  3NST A;  2OW4 A;  2XGX A;  4RYD A;  4YW4 A;  4OZO A;  2JD9 A;  3IB3 A;  4D7S A;  5E88 A;  1RUG 3;  1F15 A;  4CEW B;  5CKN A;  1H2L A;  2I45 A;  1OMI A;  4Y22 A;  5F5A A;  4NHY A;  4CP0 A;  1REE A;  3VBU A;  1QQP 3;  3ZMO A;  3N7K A;  3R4S A;  1W9S A;  2BGP A;  4BMB A;  2JDP A;  4G3Y C;  3VHP A;  1DZQ A;  3H8R A;  4QX7 A;  1RUH 1;  5T50 A;  1J58 A;  1PZ8 A;  4IE6 A;  5HCA A;  1N1S A;  2VMG A;  3I8T A;  1WLT A;  3T30 A;  2Y6K A;  2VC9 A;  3OBT A;  3VBF C;  5JZG B;  4E4Z A;  5JOW A;  3HN1 A;  1TQ5 A;  2MNG A;  5KXE A;  2R07 2;  1UIK A;  4XZU G;  3ZSL A;  2VW2 A;  3MW2 A;  2JEC A;  2JG8 C;  2NYY A;  4MGY E;  3ZXD A;  5BY5 A;  5EIY B;  3MIG A;  3T2T A;  4CEW C;  1VRB A;  3JUU A;  3VHR A;  3OCP A;  2C26 A;  1QU0 A;  4NRO A;  1NXD 1;  4IW3 A;  2Q8D A;  3O0X A;  3WDT A;  1K5M C;  3DEC A;  1H8V A;  5FXX A;  1I3H A;  1AUY A;  3VL8 A;  2NMO A;  1CAW A;  2WR9 A;  3DXT A;  5LK5 A;  2FDG A;  5ISL A;  5DN2 A;  2BU9 A;  2ZA9 A;  1W8T A;  4FOW A;  3S5Q A;  1AR9 3;  2WYS A;  4EQV A;  4NHK A;  1UOB A;  2R0F A;  4XJA A;  1W8Z A;  1FOD 2;  3CDZ B;  5FYV A;  4MX3 A;  5JZG C;  4W4Z A;  1JZ5 A;  1XNT A;  1R1A 3;  1ZRC A;  1ZRE A;  4WVW A;  2YGL A;  5JSP A;  2WSV A;  1ZBA 1;  1D4M 2;  1RUF 3;  3LA2 A;  1MQT B;  4JKK A;  1AR7 3;  4FSJ A;  3LE0 A;  2WQ8 A;  3RZG A;  5JPN B;  1LCL A;  1XU1 A;  3SH3 A;  3Q9O A;  3Q8C A;  3LPF A;  3J8F 1;  2DV9 A;  3VHO A;  1OKQ A;  2PHD A;  3ASI A;  4QQP A;  4Y1X A;  4H7L A;  3BPZ A;  2ZX3 A;  1HN1 A;  3HNY M;  5FY0 A;  2WS9 3;  3WUD A;  5FMO L;  2CWS A;  4AXO A;  1PGL 1;  4E8D A;  3AM2 A;  2CL2 A;  4XDO A;  5CBL A;  4FT8 A;  1DGR A;  1QOS A;  4OMD A;  4XUR A;  5K4L A;  2VZO A;  1BEV 1;  3AXD A;  3HBK A;  3NV4 A;  3UGG A;  5A3N A;  1MQT C;  1WWY A;  4YW1 A;  2ZS6 B;  1VRH 3;  1NCQ B;  2BUK A;  1UQX A;  5JOY A;  5GZF A;  1MZ5 A;  4P9I A;  3ZN6 A;  1CZS A;  4ZZ8 A;  1LHO A;  4COZ A;  4D7Y A;  3D0S A;  2R06 1;  5LB6 A;  2JEN A;  4JTO A;  3H3Z A;  2Y6G A;  4S2H A;  2G4I A;  4UBG A;  5F3E A;  3VKM A;  1UU5 A;  2BVB A;  4QHO A;  4XCB A;  2W94 A;  1HX6 A;  1OUR A;  1NAE A;  1LRH A;  4MZU A;  2ID4 A;  1GZW A;  2PLV 3;  3Q8A A;  4AGR A;  3S5A A;  2JKB A;  3BI3 A;  3L9J T;  1TNF A;  3LEI A;  1RUN A;  1ULE A;  4ZKT B;  1NCQ C;  1ZA7 A;  4A2U A;  1KGY A;  1UWW A;  2OXB A;  2ZAB A;  3LA7 A;  2B9U A;  4XUO A;  5C9A B;  2YY1 A;  4DXR A;  2FZ1 A;  3WDY A;  2XLG A;  3VBH B;  4Q0S A;  2X5I C;  4YVW B;  1TMF 2;  1CIW A;  5E6H A;  3DN7 A;  4YM2 A;  3WW2 A;  1RUE 1;  3WQ0 A;  1KDK A;  4UFI A;  4XBL A;  2FCT A;  4A42 A;  4XZP A;  1I5P A;  4HG6 B;  4BK5 A;  1BBT 1;  2P4E A;  2VM9 A;  4JX0 A;  3TWI A;  1W8O A;  4YG6 A;  4PDW A;  3ZFG A;  2B39 A;  1AXZ A;  1PO1 3;  5BNO A;  3ES4 A;  5FOJ B;  2VW1 A;  1COV 1;  4QX1 A;  2R04 1;  3B00 A;  4AGV A;  3KGZ A;  3PDQ A;  1US3 A;  1YNA A;  3KV9 A;  4W6X A;  2OVU A;  3DEM A;  3RZK A;  2ZCW A;  1QDO A;  3ZFE A;  5C4W C;  2GC0 A;  5C9A C;  4OQ8 A;  3WHT A;  2VH9 A;  4YVW C;  4Q4X 1;  2DUR A;  2PAM A;  2RM2 1;  4BWO A;  2MPF A;  2ZGT A;  3GGL A;  1LR5 A;  4K8R B;  1HQN A;  5FZO A;  1MVQ A;  3TEX A;  4IND A;  5FPZ A;  4FOY A;  4IEW A;  4ES9 A;  1W6O A;  3ZYH A;  1LUL A;  1OFN A;  2DU1 A;  2GNB A;  2WO7 A;  3DGT A;  1OA2 A;  3G7D A;  1PZ7 A;  4LBO A;  3JD7 2;  2HWD 2;  4QKF A;  4UFJ A;  1AR6 3;  1ZZ8 A;  5GM0 A;  5IFP A;  3KF3 A;  3LFM A;  3SIT A;  5DDJ 3;  4AOC A;  4AK3 A;  2BGC A;  4BZ4 A;  1GQP A;  2D97 A;  4ATE A;  5I8S A;  1SCR A;  5KHJ A;  2ARE A;  2JIJ A;  1RUG 1;  4QKN A;  3AYC A;  2EF6 A;  1BKZ A;  1GNZ A;  1JN2 P;  1JOJ A;  4XIL A;  2RS1 2;  3WF2 A;  4GXL A;  3ZM8 A;  2CAU A;  1ZM1 A;  1PIV 3;  1QQP 1;  1AXY A;  2CDO A;  4DEQ A;  2DVD A;  5GZG A;  2D6N A;  5A1L A;  1MZ6 A;  5I0R A;  1OLM A;  4CCD A;  3APB A;  3TN9 2;  4CXY A;  5D2A A;  3WNK A;  1W3X A;  2Z69 A;  4MET A;  2SLI A;  3KS7 A;  2ZGS A;  1UAI A;  3OY8 A;  4IUG A;  1SBF A;  1S0D A;  3CKH A;  4LBN A;  3AX4 A;  4N43 A;  5EP9 A;  5LCW L;  5DZF A;  2VOW A;  5CAD A;  4BOW A;  1DCS A;  2VZS A;  4XXP A;  4FTE A;  2OUJ A;  1ENQ A;  2YXS A;  3CLP A;  1CAX B;  2VOK A;  1UZV A;  5B4X A;  1HQW A;  2J1R A;  4HT1 T;  1W90 A;  1LHW A;  1NOV A;  1VR3 A;  2RVA A;  2WFF 3;  4ARX A;  4NN0 A;  4MGK E;  4FO9 A;  4DUX A;  5LEK A;  1AR9 1;  5HXM A;  4LBK A;  3T2O A;  1C1L A;  5F6L B;  1OF4 A;  4PHZ A;  3SXW A;  2D6O X;  1AYN 3;  4K3U A;  3NV2 A;  3UET A;  1R1A 1;  2RS5 2;  3GNE A;  4FI9 A;  5DZG A;  3DXU A;  2J1S A;  1WCU A;  2E7Q A;  1OVP A;  1RVF 3;  5A33 B;  1RUF 1;  2JXA A;  5E89 A;  4OUE A;  4B8E A;  1EP0 A;  2NLR A;  3OPZ A;  3U11 A;  5FYY A;  4WVM A;  3WCS A;  5CFC A;  1PMJ X;  4Y5Z 0;  4GJZ A;  1UU6 A;  1VBB 2;  2H6C A;  5JLV A;  4EWA A;  3GZE A;  2XVG A;  3RI8 A;  1O3R A;  1YUD A;  3NL1 A;  4R52 A;  1IOA A;  3VBS C;  4R9D A;  1PO2 2;  4JGY A;  1F8V A;  2ZGP A;  5A3P A;  4AED B;  1YIP A;  5A32 A;  4HZF A;  2EAK A;  5FXW A;  3VKN A;  4OYU A;  3WLU A;  4EWE A;  1LHV A;  1JOB A;  1E57 A;  1VRH 1;  4K9S A;  2PHF A;  3WG1 A;  2J7M A;  2VZR A;  5ACA 2;  4IQP A;  4UAP A;  5FPA A;  1JYN A;  3I4I A;  4KG8 A;  4YVS A;  2XML A;  2YDE A;  1NLR A;  1XE7 A;  1T2X A;  3RJ2 X;  4O65 A;  3BUC A;  4W50 A;  5FZG A;  4F8A A;  1CX4 A;  1N1V A;  1XC6 A;  5FZD A;  1F35 A;  2JDN A;  4TSV A;  5C6C A;  5FRA A;  3T0B A;  1VPH A;  4EN7 B;  3USU B;  2AGS A;  5A3L A;  2GME A;  5JI7 A;  4NIA A;  1AJO A;  2W87 A;  2VQT A;  5A3M A;  1DZT A;  1MS0 A;  3L2H A;  4NO4 A;  5FZF A;  5FZ8 A;  4AED C;  3DF0 A;  2PLV 1;  4MUV A;  1W6M A;  1QH6 A;  5DAX A;  4YPJ A;  5FO8 B;  2HWF 2;  4XHB A;  2XLA A;  4AF9 A;  1F2N A;  3GHM A;  3BGA A;  2XBO 2;  3UNP A;  4YG3 A;  3N9N A;  4CYD A;  1DFQ A;  4RHV 3;  3HT1 A;  3C8X A;  4IEY A;  4O7X A;  3RPQ A;  3ZN4 A;  4AQT A;  3SH4 A;  4P02 B;  3KWV A;  2BEO A;  5HXV A;  3H1Y A;  2Y6F A;  2JDY A;  1ENX A;  5A80 A;  4YFZ A;  2GAL A;  2V4A A;  4NHX A;  4Y24 A;  1SLC A;  3T4H B;  5LW9 A;  4ZXK A;  5FYH A;  3T0A A;  1V9U 2;  3ZPO A;  1E5I A;  3BB6 A;  1OOP A;  1X9P A;  5JI9 A;  4FTB A;  3ZMN A;  2NM1 A;  2Y26 A;  3SCH A;  1PO1 1;  2ZMK A;  4GJY A;  2A6V A;  3O1U A;  4JDM A;  5KHH A;  1QNY A;  2J1T A;  2KXL A;  5IVB A;  1JTZ X;  1BLZ A;  1IG3 A;  4XIO A;  1UXX X;  1POV 0;  4U36 A;  1GOF A;  3RSJ A;  3ZXJ A;  2FDK A;  2GMM A;  1QY4 A;  3RMX A;  4M01 A;  3O1T A;  3WW4 A;  4JDO A;  4RGK A;  2BNN A;  3DCQ A;  4FQZ A;  3NNJ A;  4AE2 A;  3POS A;  1JUI A;  3EMR A;  2ZBJ A;  5FPB A;  5BNO B;  1RUD 3;  1H30 A;  1I9R A;  3C7E A;  5A7W A;  1ASJ 2;  3B7M A;  3RQ0 A;  3M3C A;  4A3Z A;  1V00 A;  3NNL A;  5CKQ A;  4DFS A;  4ONU A;  1BZW A;  3AKP A;  5EWS A;  3TYJ A;  1LED A;  1PMH X;  3POG A;  1AR6 1;  2NMN A;  1AF9 A;  5CAZ A;  1O4Z A;  3POY A;  1QJU 2;  4X8P A;  4D6S A;  5IVF A;  2WZR 2;  4UXA A;  3KMH A;  3ZXA C;  1OA4 A;  2D5F A;  1QJX 3;  5T5L A;  4AQ6 A;  2DYC A;  1CJP A;  2IXJ A;  5EQU A;  3W58 A;  3KV6 A;  1SLL A;  2QQV A;  2VOV A;  4ZS3 A;  1PIV 1;  3KT1 A;  4EYU A;  1FV2 A;  1JU3 A;  3CJI B;  4AVB A;  4CPB A;  4NAM A;  1UO9 A;  2RHP A;  5CZK A;  4AI3 A;  3AKQ A;  5KBF A;  2QJV A;  4RS5 B;  2W1U A;  1NYW A;  3MGU A;  3AFK A;  2R1B A;  3C7H A;  3PVB B;  2DUQ A;  1OLR A;  4DO0 A;  3I2D A;  2OII A;  2QZ3 A;  3AZW A;  5AVP A;  2OQ7 A;  2YGM A;  1CES A;  1PGW 1;  3POJ A;  3A23 A;  5C3R A;  5BNN B;  3WY6 A;  4P5Y A;  1TME 2;  2VVE A;  2WN2 A;  3OGR A;  3CJI C;  4XJ8 A;  1SPP B;  4QMA A;  3DL3 A;  3GZU C;  4A6S A;  2WFF 1;  3WR0 A;  2DVB A;  2GH2 A;  5GJ6 A;  3QBQ A;  1WBL A;  1QJE A;  2WA3 A;  2ZJC A;  3FFQ A;  3IPV A;  5FYS A;  5AC9 3;  1DQ0 A;  5JIA A;  3UJO A;  3AZY A;  2K2S A;  4AVA A;  2ZOE B;  4N43 B;  3H0O A;  4KGG A;  1MEC 2;  3T2Q A;  2XUM A;  2ZXQ A;  1RVF 1;  3BTA A;  1MPX A;  4XDP A;  3O7O A;  4YWA A;  3WF1 A;  2ZGQ A;  4EE2 A;  2HLE A;  3WV6 A;  5BNN C;  4GWI A; 
#chains in the Genus database with same CATH homology
 4CCK A;  2P5B A;  4LXL A;  5FZ7 A;  4BIS A;  5F3C A;  5FZI A;  4CCO A;  3OPW A;  5A80 A;  5FYI A;  4C8D A;  5F3G A;  3LD8 A;  3U4S A;  3KVA A;  5A7Q A;  3RVH A;  4D6R A;  3N9Q A;  5FPL A;  5A1L A;  5LW9 A;  2XDV A;  2GP5 A;  5FV3 A;  5FYH A;  3ZPO A;  5FZE A;  5FWE A;  2WWU A;  3N9O A;  4IGP A;  5FY0 A;  5A3W A;  4ASK A;  5IVV A;  4D6Q A;  5A1F A;  5FZ1 A;  2OX0 A;  5FYB A;  4TN7 A;  4UF0 B;  4GJY A;  4CCJ A;  5FJH A;  3KV5 A;  5IVB A;  5FY7 A;  4XDO A;  5FP4 A;  5K4L A;  4CUG A;  5A3T A;  3PUQ A;  4IGQ A;  5F32 A;  5FYZ A;  4UF0 A;  4AAP A;  4V2W A;  5A3N A;  2XUE A;  5FJK A;  2VD7 A;  4QXB A;  5FPV A;  5A7W B;  5FWJ A;  3AL5 A;  5FXV A;  5FZ9 A;  5IW0 A;  3NJY A;  5FPB A;  5F3E A;  2YU2 A;  5F2W A;  4EZH A;  5FYT A;  5A7W A;  3UYJ A;  4V2V A;  3K3O A;  4BU2 A;  4CCM A;  3PU8 A;  4GAZ A;  5FP3 A;  4LIT A;  5A7P A;  3AL6 A;  2PXJ A;  3PTR B;  5FY8 A;  4DIQ A;  5FUN A;  2Q8C A;  2OS2 A;  3PUS A;  4LIU A;  5FYC A;  5F2S A;  5FP7 A;  3DXU A;  4Y33 A;  4IGO A;  5FZ6 A;  5FY5 A;  2XXZ A;  4CCL A;  4D6S A;  2W2I A;  5IVF A;  5FZH A;  3AVS A;  5FXZ A;  5FUP A;  4E4H A;  2GP3 A;  2YBP A;  5FZK A;  5FYU A;  2Q8E A;  5IVJ A;  3KV6 A;  3LDB A;  5FZC A;  5F37 A;  2YBS A;  5FYY A;  5KR7 A;  4Y4R A;  5FZL A;  4EYU A;  4GJZ A;  4GD4 A;  5F5A A;  5E6H A;  4Y3O A;  5FZ4 A;  5FPU A;  3U78 A;  5F5C A;  3PU3 A;  4QXC A;  5IVE A;  5FZM A;  2YPD A;  5A7N A;  4AI9 A;  5FZB A;  4QX7 A;  4EZ4 A;  5A3P A;  5F39 A;  5FBJ A;  4DO0 A;  3ZLI A;  2WWJ A;  3K2O A;  3KVB A;  3KV4 A;  5ANQ A;  5A7S A;  5FXW A;  2OQ7 A;  2YU1 A;  3OPT A;  3PDQ A;  5FZA A;  4HON A;  5FYM A;  3KV9 A;  4BXF A;  5FPA A;  5IVC A;  5FY4 A;  5FY9 A;  5FZO B;  2XML A;  4QU1 A;  5FP8 A;  4CSW A;  1VRB A;  3N9M A;  5FP9 A;  5FZG A;  4HOO A;  5LY2 A;  5LY1 A;  2OQ6 A;  2OT7 A;  2Q8D A;  5F3I A;  5FZD A;  5FXX A;  5CEH A;  5FZO A;  4URA A;  3N9P A;  3N9L A;  5FYS A;  3AVR A;  3DXT A;  4QXH A;  5FZ0 A;  4QX8 A;  5FY1 A;  5ISL A;  5FZF A;  5A7O A;  5FZ8 A;  5IWF A;  5FZ3 A;  4NUB A;  4CCN A;  4QWN A;  5FYV A;  5F5I A;  4XDP A;  2YBK A;  4LIV A;  3PUR A;  3N9N A;  3PUA A;  3K3N A;  5LWB A;  5IVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...