5FBJA

Complex structure of jmjd5 and substrate
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
236
structure length
236
Chain Sequence
b'GSTVPRLHRPSLQHFREQFLVPGRPVILKGVADHWPCMQKWSLEYIQEIAGCRTVPVEVGSRYTDEEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFDQIPELKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALYPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 8
publication title to be published
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 58
structure length 236
sequence length 236
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2015-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fbjA00
5FXVA 5FZ9A 3DXUA 5A7NA 3N9PA 5F3IA 3PTRB 4QXBA 2OT7A 2YU2A 2OS2A 2W2IA 3LD8A 2OQ6A 2Q8EA 5IVCA 4CCLA 4LIVA 2GP5A 2XDVA 3NJYA 4QXCA 5FP8A 5FP7A 5F2SA 5A7WB 5A7QA 4URAA 5FYYA 5FXXA 5FZ4A 3K3OA 5A7OA 5IVVA 4EZHA 4IGQA 4GAZA 5A3WA 4CSWA 2Q8DA 4BISA 2PXJA 5FZAA 5FJHA 2YBKA 5FZOB 4QU1A 3AL6A 3KV5A 5FZCA 5FYUA 5F2WA 5FPBA 4UF0B 2GP3A 3PU3A 5F5AA 5FY4A 5A7SA 5A7PA 5FYZA 5A7WA 3ZPOA 5FPUA 5FZIA 4ASKA 5FPVA 4CCMA 5FYHA 5A80A 5A3PA 2OQ7A 3N9OA 5FPAA 5FWEA 5FXWA 5F5IA 5LY2A 5FBJA 5FZHA 5FY5A 4QXHA 5FZOA 4QWNA 4V2WA 5FZMA 5FZ0A 3PUSA 4TN7A 5FYSA 3K3NA 3OPWA 4UF0A 5A3NA 5IW0A 3OPTA 3N9QA 3UYJA 5LY1A 2XUEA 4HOOA 4XDOA 2YBPA 5FY7A 4Y33A 5CEHA 5FJKA 5A1FA 5FZFA 4AI9A 5FZEA 5FZ8A 5IVJA 5FYCA 4HONA 4GJYA 4QX7A 4DO0A 4Y3OA 4XDPA 3U4SA 5FYTA 3PUAA 5IWFA 5IVYA 5FY1A 5FP9A 4NUBA 5FYIA 4D6SA 5A1LA 4IGPA 5FYBA 5FZ7A 5IVBA 5FY9A 4DIQA 4CUGA 3PUQA 5F3GA 5F5CA 5KR7A 4CCKA 5FZ6A 5ANQA 2YBSA 5FUPA 5FZ1A 4LITA 3ZLIA 4GJZA 4Y4RA 5FZDA 5FZGA 4LIUA 3U78A 5FYMA 5FZLA 3KV4A 4EZ4A 3RVHA 2VD7A 3KV9A 5ISLA 5FZBA 3LDBA 3K2OA 5FZ3A 4LXLA 5F39A 5FV3A 5E6HA 4AAPA 2P5BA 1VRBA 5K4LA 4EYUA 4GD4A 3AVSA 5FYVA 4D6QA 3KV6A 5F37A 5FZKA 5FPLA 4IGOA 4CCNA 4BXFA 4CCOA 3N9NA 5A3TA 2OX0A 5IVEA 5FP4A 2WWUA 5FY0A 5FXZA 4E4HA 3N9LA 3AVRA 5IVFA 5LWBA 3KVBA 3PU8A 4CCJA 4D6RA 5LW9A 3DXTA 5F3EA 2XMLA 3N9MA 3AL5A 4QX8A 2Q8CA 5FWJA 4BU2A 2YU1A 3PDQA 2WWJA 5FUNA 5F3CA 3PURA 5F32A 4C8DA 5FP3A 5FY8A 2YPDA 3KVAA 2XXZA 4V2VA
chains in the Genus database with same CATH superfamily
3J7NA 1SDWA 2F4LA 2R7EB 3AZYA 4QX1A 5FXVA 1GV9A 2DCYA 2WSUA 4AG4A 3A4UA 1KQRA 5GLUA 3WQBA 1K45A 3UK9A 5JI7A 5FPZA 3PTRB 2RS31 1BXHA 5FK7A 4YGDA 1ZNPA 5GZFA 3T2OA 1SLBA 1VBE1 4QPIA 1VBD2 1QJY1 2W0XA 2I74A 1R093 4GWNA 4I3PA 1HRI1 2ET1A 1W6OA 2VTFA 4GWIA 4LA3A 4Z92B 1RUI1 4GMP1 3ACLA 4BXSV 1PVC3 5D2AA 1AL22 1PGL2 1DGLA 4QX0A 1BK1A 1HIXA 4DEQA 4OMDA 4XUQA 2HWB2 2CV6A 4NWVA 1WZXA 4XXPA 1H4HA 2YFZA 2AYHA 2XOMA 3Q8BA 3TN92 3WX5A 5F5QA 2FDKA 4CEYB 5A3OA 1ZZ6A 3GBGA 5LY2A 1LCLA 2HWF1 1PNFA 3O1MA 2WO7A 5K8SA 5T5JA 1OOPB 3CHXA 2XUMA 2E9QA 3T2QA 3ZXJA 1A3KA 3ENRA 5FRAA 4YG6A 2YBPA 5F7UA 2LW8A 4CEYA 3DKWA 1GUIA 3UJQA 4P08A 5F6LB 5FZEA 4FAGA 1AYM3 2H6CA 1H2KA 1D7PM 3I2GA 1W8FA 2Z69A 3ASIA 4AI1A 2Y64A 1QJX3 1OURA 2FCTA 1YFXA 3GALA 2WA3A 5EPAA 2NP0A 3AXDA 3KCXA 1CJPA 1OOPA 1NA1B 1PMJX 2Y6LA 2RR12 3APBA 1EV12 2A6XA 3VBUC 4CPBA 1DYKA 2GALA 2W46A 1UU5A 3ZR6A 4R9CA 1VAKA 1YYNA 4XHBA 3WT3A 1HV0A 1QNWA 4FOWA 2WZR3 4N7IA 2V5DA 5ERLA 3SNMA 4KG0A 5H9PA 5J09A 4Y1XA 4Q4V2 1R091 5BV6A 5E16A 4QQLA 1NA1A 3WVJA 3ZYHA 1PZ8A 4CEWB 1SCRA 5LRRA 2CU5A 3WW2A 1UZZA 3FHQA 5J96B 2QQJA 1PVC1 2SLIA 3ETPA 3U11A 3OGVA 4AEMA 1ULEA 4FPCA 2AUYA 1VRBA 4O61A 1WUVA 4TZDA 2WLPA 4C1WA 4MGIE 5J3UA 2GSYA 1LOEA 3HBKA 1ZBE3 5CFDB 3OD4A 5A3TA 2B9UA 2GMMA 3GZTB 1GP5A 1AR62 3KVBA 1MS0A 4A6OA 3RYPA 2BBAA 1A78A 2XLGA 3N9MA 3VBOC 3O14A 4OVEA 4ORFA 1FX5A 4RGKA 5LA0A 5HCBA 1ULDA 2RMU3 1QIQA 4MOAA 5CIRA 5FP3A 3ZVXA 5CA6A 1LHNA 3BCWA 2FCVA 3AFGA 1LGCA 2IUWA 5CFDA 2WN2A 3WEZA 4AGRA 5AVAA 3VHRA 1CAXA 4GWJA 4ONUA 1J83A 4FXGB 3LCPA 3N7JA 2G9ZA 2ZKNA 1JYCA 2EXJA 1NXMA 2D5FA 1PVXA 1ZBA3 3T4VA 4CP9B 3N9PA 3HR9A 4BK4A 4WM8C 1ENQA 2JKXA 5JSOA 4PF5A 5JZGA 2WAAA 3DCQA 2OT7A 1T2XA 4OHVA 4E4ZA 2Q8EA 1LGNA 1MEC2 1SCSA 2DDUA 4LIVA 5LATA 1AYM1 1RUNA 3ABZA 2XH6A 3IDCB 1S4CA 2HEWF 5FXXA 3ZIWA 1QJX1 4AAXA 5I8YA 3VKLA 2H0VA 2W1UA 4QKNA 1UOJA 4XXAA 4XOGA 3C7OA 4B7KA 4N43C 5A3WA 2Y6GA 3WF2A 4CXYA 1F35A 3EBRA 5IFPA 4FO9A 4COVA 4UBGA 2YBKA 3JB4C 2EXHA 4QU1A 3OBZA 5FZCA 3ZYPA 3VD4A 2P6HA 1Z7S2 2DFBA 3AP9A 4FTSA 1M4WA 2JDNA 1XXNA 1TME3 3GF6A 3TBDA 2PQQA 2WZR1 1BLZA 3CU7A 1S0JA 3U10A 4YW4A 2XONA 1JZ7A 5FPUA 4LO4B 2PHXA 2VUCA 2YPJA 2G4IA 1RXFA 4K9SA 1NKGA 5JXHA 1T6BX 1MPXA 4J25A 5I0UA 1O3QA 3WW1A 1KJLA 1YQCA 4GB33 3ZN6A 3LA3A 4D0QA 1VBA3 3I54A 3J26N 3PUSA 1JMUB 4AOCA 2XKPA 1GOHA 3ZFFB 1X8MA 4QB2A 3CMGA 2XJRA 4AVBA 4ZS2A 2OUHA 4CDQC 5C8WA 1ZBE1 3GHMA 2A6VA 2IVJA 2FDJA 2IWGB 3LSDA 4HOOA 5GKAC 4COZA 3UGFA 4Y33A 3ZFEA 1QU0A 2V4VA 1DQ2A 2WS93 4LK6A 4AEDB 2XG3A 1H6YA 1LEMA 1ZRFA 4Q4Y3 4AI9A 1XNDA 2DF7A 4FT8A 3ZN4A 1B09A 2VUJA 3I59A 5EJZB 3ZYRA 1ULCA 2WINB 3K4AA 1QF3A 2NQYA 4KMQA 1COV2 1QHDA 2RMU1 5JUVA 2D97A 2BZDA 1YO8A 3JB8A 4MGTA 3THDA 2W92A 3P3NA 2LTNA 3AFKA 4MGZE 2CYFA 1W39A 2FBEA 3POFA 1KJRA 3FFZA 1W05A 4FPJA 4JDMA 3FLPA 5FZ6A 1TEIA 5ANQA 4L9BA 4YARA 1ZBA1 3LFMA 3TRSB 3OY8A 1GOGA 4O9GA 4M3CB 5A6QA 1ST8A 4Y20B 1D0HA 5HBAA 2VZTA 3NNGA 1S2EA 2R6QA 2C4XA 4IEXA 2JB8A 4NRPA 4CU8A 1EAH2 4EN9B 2VY0A 1RUOA 3MF9A 3WDYA 2QVSB 2WBKA 3WCRA 1G9CA 2FDHA 1DG6A 1UX7A 3GXUA 2OKXA 3BODA 4COWA 5GZDA 5A6ZA 1FNYA 1W0PA 4EYUA 2Z79A 3GJAA 1TMF3 3MF6A 1GP6A 3DPRC 1C1LA 2WFF2 4Q1RA 4Y20A 3RJ2X 1W6PB 4I30A 3FC0A 1PGW2 2BYVE 4L11A 4Q29A 1TME1 1J84A 3W9AA 1Q8OA 4DPNA 5JXJA 3FBMA 1NZCA 1JODA 1V0AA 4MYEA 4DMIA 5KHIA 4BDVB 1MZEA 3B9CA 4IV3C 5LW9A 4N53B 1RTVA 4E8DA 4W65A 2RDQA 1HLCA 1HX6A 3HT2A 4HMZA 5C5UA 4QX3A 5FOJB 5JAXA 1VR3A 1L3JA 3I7DA 4GB31 3CBNA 4RR3C 1VBA1 1WMFA 2PLV2 5D8AA 2CSGA 2ZKLA 2CDPA 3R0RA 2D98A 3O1PA 3A22A 2RJ2A 4LORA 3WG3A 5A7NA 3K4ZA 4FPGA 3SEPA 2WS91 2WRAA 4HL0A 4N53A 2YU2A 4WM7B 4YRDA 4Q4Y1 2KXLA 3UKVA 4CCLA 2GP5A 2VCAA 3A21A 5FMOL 5FYYA 2OIIA 2XLFA 4CTEA 1XNKA 2GMEA 2ADDA 4ASLA 2VZSA 3AC0A 2F17A 4FOVA 3S7IA 1D2SA 1K5MC 1SLTA 1NY71 5JPMB 1WW4A 4FPLA 2JG9C 3W58A 4WM7A 2GP3A 5FY4A 4R8HA 4FCAA 1YNAA 5A7SA 1UPIA 3TWIA 5CKMA 3QACA 1OFSA 4C0HA 1RVF2 2VMGA 3ZMNA 4FAHA 3TB0A 1Q8QA 4LLFA 2OPWA 5LBBA 4MX3A 2PTMA 2W9XA 1ASJ2 2Y6KA 3RS6A 5L36A 1MQTC 3V0BA 1V6MA 1S0BA 3BPZA 5GZCA 1SEFA 3NAPB 4ZU5A 1GU3A 3VDBA 1QY4A 1TMF1 3WF1A 3H9AA 3CQOA 4CP0A 1UKGA 2QQVA 3AP7A 4NWWA 3UKTA 1IZ3A 4D94A 3O1SA 5T5LA 4DFSA 4YWAA 3ZKYA 2IFWA 1JZ5A 3B7MA 1EY2A 2LUWA 4EWEA 3ZR5A 5EYXA 2DVAA 5FPXA 1CR7A 1WD3A 1VPHA 5SV5A 4BQYA 3DYOA 1PM7A 2UU8A 5H9QA 2JDMA 3KD4A 5FY1A 4I09A 5FP9A 4LJHA 4OUMA 4MH0E 5FYBA 3GZAA 5FMBA 1ZZBA 1CAWB 4CUGA 3SC7X 2R16A 3FMGA 4UAPA 5C4WC 1GWLA 2VL4A 1HB3A 2DFCA 4AHZA 2VZ1A 4UOJA 1Q56A 2D6MA 3U37A 3B3QE 3OTFA 5FZDA 2CY6A 1OLRA 1A34A 2W5FA 1IS3A 3WW3A 3NV4A 2N7GA 4X6QB 4FFFA 2P3KA 4UFMA 5EFUA 1LECA 3J7HA 1QXPA 5ISLA 3RZZA 1H2NA 4BWOA 3B9IA 1QJEA 4KBZA 1CAWA 4Q8LA 5FZ3A 4XVHA 1CGPA 2DBIA 1US2A 5DUWA 1JTZX 1ND3C 2JICA 4ZXKA 5FLHA 4B8EA 5GZGA 4L99A 3S5AA 1REFA 2WL1A 3AZWA 4NIGA 1PK6C 2R062 1NZIA 3RYRA 4YGCA 1W28A 3WV6A 2E7AA 2C0ZA 1NXD1 1QH7A 1HB4A 4HANA 4Y1VA 4MGSA 4DUVA 1SBDA 1DZTA 3LSEA 4I3GA 4D69A 1W99A 3ZOIA 1C8M2 2VNRA 3WDVA 4AL9A 3Q8EA 4D8MA 3EO6A 2HWE2 4YFWA 1CD3G 3D0SA 2EAAA 3ES4A 3O0XA 3RZHA 3IM0A 1KGYA 4IUGA 1RUG2 1XU1A 4INDA 4QHOA 5LCWL 1CJDA 3O1UA 4FOYA 5CZKA 3K48A 3KVAA 1VBB3 2GH8A 3OGGA 5FMOS 1ND2C 5IYYA 3T0DA 4J6GA 2CAVA 3O0VA 5I0RA 3DXUA 2A6ZA 3VBUA 2LS6A 5F3IA 3RG0A 1PO23 1UYYA 2ZAHA 3SXWA 1JYNA 1HKDA 1D4M3 1JYIA 1G9DA 3MW3A 1XQNA 1YC61 3NJYA 4OMCA 4Q0SA 4AEJA 3EXUA 1HRV2 1IKQA 1BKZA 2BGOA 2WYSA 5GZEA 5DDJ2 5IJRA 4BB3A 5JPNB 5DXDA 2BBVA 1X7NA 1KS4A 2Q8DA 2O0OA 2CNAA 4FQZA 2DVGA 3AL6A 4YZ1A 3VHPA 3VBOB 4F3JA 4QDSA 1KFXL 2FHRA 4Y1UA 1GICA 2XJSA 5CBLA 2WT1A 4JQRA 2VBPA 2OYZA 5FYHA 5IAXA 1CN1A 3N9OA 4CUCA 4AW7A 1GNHA 1NCRC 2VZPA 2VMDA 2WR9A 4BE3A 3UNPA 4KWKA 5G04L 3RZJA 4S2GA 3X29B 1O91A 2ZMKA 5FCCA 3VBOA 3ZXEA 3IAQA 2TNFA 2VZQA 4SLIA 2B9VA 1OH3A 5HXMA 3I2OA 4DUXA 5LBEA 3ZXKA 4AFMA 1ENXA 3VD5A 3VDCA 2WT2A 4N43B 3CZJA 1HJFA 3HVDA 4NVPA 5A1FA 4IEUA 3VBHC 3C7EA 3KT4A 2P3JA 2ZMNA 4WM8A 2WWSA 5FYCA 5A6XA 3KT1A 2RM23 5GJ6A 5JSPA 4Y3OA 5CADA 2ZGUA 1HXS2 2DTWA 1JZ3A 1CESA 2Y0OA 5IVYA 2ZAAA 1JXNA 3MIFA 2QDRA 4XMIA 3WDXA 1UY0A 2RE9A 3J9SA 5IVBA 1G7YA 1H9PA 1VBB1 1JZ4A 3T09A 3HBZA 1ULFA 1LODA 4N43A 3WHUA 1E5HA 1YFWA 3BALA 2YBSA 2JG8B 3LDKA 1PO21 2FDFA 1OVSA 1PX3A 2QDNA 1D4M1 2D7FA 3O0WA 5FIXA 2JEMA 4MLOA 3RFRA 4CEWC 3PHMA 1UCXA 4CDUC 4PI0A 4CDQB 1S0CA 1S2KA 3AMHA 1PO12 1JS9A 3WD5A 3IAPA 3LDBA 4DINB 3H7YA 2UYBA 3KZ4C 2Y26A 2FQPA 1DLCA 4QHBA 5HI0A 4CDXC 1ACCA 2JDHA 4ZXEA 2E7TA 4BMEA 5LASA 2RS13 2H0BA 1HQLA 1IPKA 1W6NB 2RS32 1AX1A 3GYDA 3VBSC 2OX0A 4RL7A 1GYKA 4CDQA 4ES8A 3ZXDA 1RUF2 2CGOA 4Y26A 4A7KA 2SBAA 1XJAA 3FJSA 2XMLA 3KMHA 3LOBA 1JYWA 1A6CA 4GWMA 1RUI2 3MEPA 2KD7A 5F3CA 4RA0A 1VLNA 2BPA2 1W9TA 4Q4W3 2ZHNA 2DCJA 4XJUA 2R071 5GALA 3NKGA 2BNOA 2VCCA 3ZXFA 2RJLA 3IDBB 4C1XA 4IDZA 2KA3A 4P14A 3AJYA 1AUYA 3LD8A 3AYEA 3ACIA 2P37A 1N1YA 4QAWA 2RHPA 4KU8A 3M2MA 5JXIA 1UMIA 1GOFA 2WIIB 1US3A 1DYPA 2RM21 4URAA 1W06A 4HBNA 1Q43A 5FZ4A 2CTVA 1ZRCA 1MS9A 2HWF2 2A7AA 2ORZA 4E9KA 1HB2A 3MI8A 4YNIA 4XHXA 3VN4A 4ZZ5A 4LE4A 2WJSA 1DZRA 2GMPA 2L9LA 3SQOA 3ILRA 5FZOB 1UYXA 5FO8B 5FPBA 2WNVC 2XJTA 1N3QA 2W1WA 3NV3A 4ITCA 1JOJA 2AEZA 3ES1A 3VL8A 4KI5M 4O7XA 5DUVA 1QDOA 5T55A 4BQ1A 4AVAA 4K8RB 4RR3B 3DPRA 1OPMA 2OPKA 5KHGA 1GQPA 3PMEA 1L7RA 3A23A 2E53A 4ZU4A 4ASKA 4EROA 3WF4A 4Z8BA 2OQ7A 2CWSA 3FUQA 2VCMA 4LQRA 1L7QA 4IV3A 5FBJA 3WNKA 3ZFFC 1CPMA 5FZOA 2QJVA 5JMOA 3KGLA 2A71A 1OLME 3IMNA 4DRVA 2J7MA 4UFJA 1QWRA 3WQ7A 1ZREA 1VB2A 1MS4A 2BERA 2RS11 2ARCA 2RV9A 1O8PA 2VVFA 4H3WA 2QQIA 4RR3A 4AEDC 4HZFA 3PL0A 4QQOA 3UKNA 4DNYA 1UXZA 5L19A 4JRAA 5FMDA 3NNLA 4IEQA 4UT5A 2ENRA 1K5MB 2JDYA 3VKFC 2XGXA 1R092 5CNAA 1WKYA 2BOIA 2ERFA 4PHZA 3V64A 2F4PA 3VZNA 2O1QA 4CRQA 2R0HA 1FT9A 3RZKA 1IPSA 2AGSA 2Q1FA 3RJRA 2EICA 4LO8A 1GZTA 1U0AA 4LBOA 4Q4W1 3VDDC 5C8CC 1TE1B 1AXZA 3POJA 4FPHA 5JSRA 1OH4A 4YVSC 2DUPA 3DL3A 2ZGPA 2QE3A 1UMHA 1RUJ3 4ZU7A 5DAPA 1K5MA 3MO4A 4YZ5A 1OBNA 2X10A 4NAMA 4OZOA 3WZ1A 3ZSLA 2RS51 1GWKA 2JG9A 3OD0A 1S55A 1LHOA 2IXHA 5C3OA 2ZA9A 3SITA 3WNXA 2QUOA 1AR73 1JYTA 4A7ZA 4YM1A 1UOGA 1W2UA 4FPFA 3I3DA 4EQVA 3AKRA 2JKBA 3K2OA 5C33A 1RINA 4LXLA 1UF2C 2Y34A 4BQ4A 1FMD3 5EWSA 1ALYA 1W8UA 4Q4X3 3ZXAC 3AVSA 5FYVA 2G9GA 3ZDVA 2QFEA 1JHJA 4DY3A 1MQTA 2GNTA 1X9TA 3E5UA 4GH4C 2AENA 2Y6HA 3O7OA 4ATFA 3E6DA 2E33A 4WVMB 3AK0A 4XFHA 2EF6A 2DVDA 5BXXA 4JQTA 1AYM2 5LBFA 1SLLA 1SACA 1QJX2 2LROA 3IDEA 5F3EA 3Q8AA 2VOKA 3AM2A 5A3MA 1QJFA 4NPLA 2YU1A 5KC5A 1FATA 3VD9A 1BMV1 3LEGA 3P1IA 4HKLA 4KU7A 3BI3A 1LHUA 4OI0A 2VXJA 5J7MA 4AQTA 1LOAA 4XJ8A 3VV1A 3BUCA 1RB8G 2XL9A 1PX4A 1XB9A 3L2HA 1AR82 1NCQB 1N3OA 4DXTA 5C4WA 5FO9B 1NAEA 5A3UA 2XKOA 2OS2A 4PIZA 5A6YA 2OQ6A 5IFTA 1OSGA 1PK6B 2VTXA 4NPMA 2W1QA 5FP7A 2R32A 5F2SA 5CG8A 4L97A 3T1LA 1W2NA 2GDFA 2A75A 3F2ZA 2JE7A 1C1FA 2YV8A 2TEPA 4TLFA 4CSWA 1SLAA 4LTAA 2FDGA 3MFCA 3PNAA 1F15A 1ZBE2 3QOPA 2VPVA 1ND3A 4AZZA 1RUJ1 2ZX4A 2X53S 2ZHMA 4QB1A 2Y6FA 4XC9A 5C7GA 1PK6A 4QX2A 2VOVA 5ACA2 1H6XA 2ZZQA 3N36A 1NUKA 2QZ3A 4I02A 1ND2B 1Q5OA 1MS8A 1AR71 5B4NA 4XURA 3LAGA 2EIBA 1DQ6A 5AFBA 3H3LA 2WDBA 1PMIA 1QOSA 4PLMA 1U12A 2RMU2 2VZVA 3NAPC 5F5IA 4E27A 1MZFA 4Y5Z0 1FV2A 3PJQA 1REEA 1FMD1 1CAUA 2VUDA 4Q4X1 1PZ7A 2ZGNA 2XL7A 2J42A 1GP4A 4NN0A 3WSOA 2WO1A 4GMP0 1TG7A 1ZBA2 2C26A 2VNVA 2ARAA 5C9AC 4XF1A 3OBTA 2AZ5A 5EV7A 1ND2A 1JHNA 3BOPA 2NMOA 3MZHA 5IVJA 4RD7A 3THPA 4IESA 4CPBD 2HYXA 2XHNA 4XDPA 1QJU2 3QH7A 2Y0IA 3NSTA 4XJWA 5GLTA 4LNVA 1KD7A 5A1LA 4E2SA 4MGQA 1WA4A 3RZLA 5L9VA 3OCPA 3HQXA 1ZRDA 3AKSA 3WNOA 4BK5A 1NCRB 1TME2 2R042 1CAVB 3MLKA 3CL1A 2R49A 4PLNA 2VG9A 4IE6A 4QXKA 4COUA 4QKFA 4L8QA 4EZ4A 4IERA 2ZGRA 3AKTA 1WA6X 2NYYA 2WQ4A 2PAKA 3OBAA 3B02A 4GB32 1YJLA 2ZTNA 4KQ7A 3O1RA 3GZUC 3M3OA 4OUSA 3VBHB 2OW4A 2X29A 1RUE3 4AAPA 1NCRA 2DUOA 5HCAA 1GWMA 4FTBA 1CAVA 4B4RA 4FPYA 4YM3A 1LRHA 4CCNA 4XJZA 5M0TA 2WS92 4Z82A 2A3WA 1O8SA 2I2SA 4QGNA 5EZWA 3SMHA 4JZRA 1FI2A 1VMJA 1EYBA 4Q4Y2 4BIFA 4AF9A 1M06G 4K3UA 3IBMA 3K51A 1E5SA 3FBYA 3W59A 4Z2WA 2GNDA 4AK3A 1CPNA 3N35A 1LTEA 2P1BA 3BPSA 5FWJA 1DLLA 3ITQA 3VBHA 1X36A 1AJOA 3DN7A 4BPZA 5FY8A 5LZ6A 2H6BA 5KXDA 1O6UA 4WZCA 1NY72 4XFIA 4V2VA 4YLZA 4CDUB 4LLOA 4YSFA 1WCKA 1W9FA 3I49A 2V4AA 1W2OA 4PT6A 3WNLA 2DVBA 4QPGC 2EAKA 3WLUA 3LE0A 1RYYA 4CDXB 4LOTA 2YG0A 3H3UA 4TLGA 2ZGQA 3U75A 4LBMA 4OZXA 4B1LA 1MS1A 2X5IC 2JD4A 1B35C 4HKWA 4PQ9A 4BQWA 1YLLA 2BW8A 2XJQA 1VRH3 5A7OA 3RPQA 4OI1A 3VBSB 1F4AA 1H8TC 4AFAA 4CDUA 4EZHA 2W68A 4QT6A 1KS5A 3HQUA 3M3QA 4RHV3 4J1WA 2J1TA 1TMF2 5KXEA 1L7LA 1I9RA 1AXYA 2HBTA 2BP6A 2A73B 2D3PA 4H55A 1LU2A 1Y7BA 5F5AA 2ZX1A 4UBHA 4CDXA 4BMBA 3ETQA 2PYTA 2JECA 4IE7A 5HPOA 3SH4A 3MDPA 5LA9A 1LU1A 3VBSA 3UGHA 3T2PA 3JXSA 1IG0A 4P9JA 4A44A 5GM0A 1POQA 5A3PA 3L9JT 3WP5A 1AYN3 4KWJA 2VNOA 2ZPXA 3RYKA 2XVGA 1RUE1 5FLIA 2QZ2A 2A70A 2ARXA 5IK4A 3W5NA 3UYJA 1QEXA 2IXCA 5KXCA 1UMZA 5CEHA 4FPKA 2QQLA 4CP9A 2CAUA 2ZCWA 1CZSA 2G9FA 1O3TA 1I5ZA 1JUIA 2PFWA 5DUXA 2K2SA 4E4HA 3I2FA 3KGZA 3VHNA 4HONA 1W8ZA 1BBT3 1SQ4A 2WNVB 1PGSA 5IHRA 3AP6A 4XYXA 4CCDA 3SH3A 4EN7B 5CVRA 1H30A 1RMU3 3M3EA 3TN93 2NMNA 2JG8C 1XOYA 2ZX0A 4CCKA 4PCRA 2WKKA 1JH5A 1WLTA 3LPGA 4G9SB 3KQRA 2VC9A 3NQHA 3SISA 3S6PA 3DGTA 1ZZ8A 1U5ZA 1I5PA 4YM2A 4FOQA 2WNVA 1J1LA 1QXJA 4NOTA 2E6VA 1NX9A 4OCTA 1REDA 2BNMA 4NHXA 4P9IA 1OA3A 1QQP3 1VRH1 2V09A 5JOYA 4XF4A 4RHV1 4XQWA 4WZFA 1RGSA 4GD4A 5G05L 1RUD3 3ROUA 4DEVA 5HCHA 2GAUA 4HPKB 3ZFFA 2MEV3 2XBO3 3BKZA 3N9NA 2PELA 1UY1A 2P17A 3NW4A 3TAYA 4BM8A 5C8CB 5FY0A 3VDDB 5C3QA 2AREA 3J7MA 4AEDA 3KHCA 3SKVA 2PA7A 3GJBA 3P5BA 3THTA 4YVSB 3RQ0A 3P3PA 5C3SA 4L92A 5F9TA 4HKOA 1EV13 1NT0A 3M8LA 2YGLA 1GQHA 1WWYA 2HEVF 2ZZJA 1UD1A 3T30A 1AYN1 1G9FA 3KM5A 4HPKA 2ZEWA 4DZGA 1BVVA 1JZ8A 1QOOA 2VQAA 4G3YC 4NR1A 1O4ZA 2XVKA 4AFBA 1QDCA 5BNOC 5C8CA 3VDDA 3JD72 4Y5SA 5A1AA 2ZGSA 4Q4V3 5D21A 2VMIA 4YVSA 3GBFA 4YG3A 4RGAA 2D40A 4ES9A 4M3CA 1XYPA 2NLRA 1GFF2 3MIHA 1RXGA 3B94A 1BBT1 1EPWA 1NYWA 1ONAA 4XILA 4GH4B 1QH6A 5I93A 4UFIA 5I0DA 1SLCA 1XC6A 2E51A 3JQXA 3NJZA 4GKXA 1RUH3 2W95A 5FREA 2DYCA 3WW4A 4A2UA 3VD7A 4WVVA 1RMU1 1YCIA 4BISA 1DGWX 1U5IA 3VZJA 3J8F3 4JTNA 5FFOC 5FYUA 5FMCA 1BHGA 3KT7A 3POWA 4MZUA 3PU3A 1H8VA 2ZGTA 3UETA 1W6PA 1YIFA 2VQ0A 2XJUA 1OA2A 2DCZA 3B69A 3DF0A 3OB8A 4HN1A 2DURA 2LALA 5JIAA 4R4XA 3HD8B 3WG1A 4GH4A 4YGBA 4A4AA 5ABJC 5IK5A 3EB7A 5L73A 1ZA7A 1CONA 2OZ6A 3U1XA 5B4XA 3TYJA 1QQP1 4CU7A 4B4PA 2VBBA 2XQXA 5E88A 2MHFA 2A5ZA 3SCFA 4AI3A 1VBB2 4ZHNA 1DQ5A 4CCEA 1RUD1 2YY1A 2CGPA 3N9QA 4XFGA 1D2QA 1IG3A 2MEV1 4KGQA 5LK5A 1J3QA 2XBO1 2P3YA 1SMVA 4H14A 5DZGA 3SEEA 2WABA 2BFUL 5A70A 1QKQA 1XNBA 4MXVA 4YZ4A 3RZMA 3IDAA 4BLJA 1A8MA 5K0UB 5CG9A 4XBLA 5FYTA 3UJOA 3VZMA 3WR0A 2KR2A 3E5QA 2VQUA 4R4ZA 1GNYA 2G1MA 5CAZA 1Y9QA 4XJ9A 4JX0A 5T5PA 4NIIA 1OA4A 1DBNA 5FBZA 5C3PA 3ZYIB 3ZX7A 4KWLA 5ABJA 1LEDA 5DAQA 2R1BA 4NMIA 4Q4V1 1LJ7A 1N3PA 3VB9A 1V00A 5A33B 3MUZ1 5FR3A 3BTZA 4MGKE 5C9AB 4LR4A 2WO3A 1BEV2 2R1DA 3JUUA 3S5QA 1URXA 1RUH1 4R9AA 1V6NA 1AR93 4D3WA 5JCTA 1MACA 3LKJA 3H3ZA 1TVGA 1MVQA 2R072 3AKPA 4UFKA 4GXLA 3T4HB 4CXXA 3MW4A 1O5LA 4AYUA 2D6PA 3NAPA 5CKNA 3NJXA 2DU1A 2X05A 3J8F1 2C9AA 3KS7A 4PQQA 1FOD3 3ZN5A 2VMEA 4IGOA 1VAMA 1SFPA 1UW8A 1Q3EA 4YW3A 5GLWA 2ZEXA 4CVUA 1X9PA 2YUEA 1E57A 5FDBA 3BU7A 4XUPA 5C9AA 5IVFA 5LWBA 2PHFA 2VXRA 1EP0A 4COYA 5J1XA 2YB7A 2Q1ZB 2JDUA 3POSA 3H8OA 2A3YA 3BVCA 2EXIA 1R64A 1FPN3 5FUNA 1GZCA 1WLCA 4S2FA 5C5TA 4UW3A 1MS3A 3M1HA 3OG2A 4M0HA 2D6OX 1NCQC 3ILFA 3G7DA 3WDWA 1HJGA 4UI9L 4GQ7A 3QLQA 4GALA 1S1AA 2DCTA 4K40A 3T3YA 4AFDA 3KF5A 4JCKA 4P9YA 1UWWA 1OI6A 1P8JA 1F8VA 2XJVA 3MV01 1PIV2 2GNBA 5EXOA 3F95A 5IVVA 2WFF3 4ZS3A 4DY5A 1UIJA 3DKQA 4LHSA 3ST7A 4OI4A 2Z2SB 2GU9A 5FJHA 2RS12 2XVLA 2PHUA 2VULA 3BIEA 2P2KA 1D4VB 4P9LA 1HN0A 3GZEA 3NRUA 4K20A 3CLPA 1VBC3 2GC3A 4NHKA 1UZWA 1R1A3 1CX1A 1POV3 4OULA 1X33A 4XABA 5FXWA 2UYAA 2CL2A 2VQTA 4AQ2A 1QGLA 3HQRA 1AR91 4FP2A 4Q4W2 1KITA 4QPGB 4TSVA 2JDAA 2D6NA 3FX3A 4XFFA 5FYSA 2HWC2 1Y9GA 1BYHA 2FMDA 3U4XA 4F7ZA 5IW0A 3OPTA 4L0PA 5D1IA 1FOD1 1SZBA 2VU9A 1B35B 2X5IB 3ZDSA 4F83A 4FP3A 2FZ1A 1ZZ7A 4NHLA 1H8TB 1Q8SA 3D3AA 2RS52 1W9YA 3CJXA 2C5DA 4MHRA 3J4UH 1N1SA 4JGZB 2GC2A 1J3RA 4V1PA 4N9HA 1GZWB 3Q9OA 4QPGA 1LR5A 3WY6A 4RS5C 4U36A 2JDZA 4DO0A 4P00B 1FPN1 5DAXA 1OQDA 4NUBA 1WMEA 2BWCA 2P34A 1B35A 1XSQA 2X5IA 3ILNA 3OSDA 5FY9A 3QD6A 2W94A 3PUQA 4QHZA 1H8TA 1N1TA 1DIWA 4IE4A 5HCFA 3U14A 1W6MB 4MSVA 1RVF3 1F5FA 2A6WA 2VH9A 4GJZA 5GLVA 3B00A 4P9XA 1ZVFA 4D7YA 4LE3A 2IZWA 5FYMA 1ZZCA 3ZMOA 4URTA 1ASJ3 5AVPA 2J1UA 2Z4FA 5FZBA 4HK9A 1BMV2 2E32A 2B5HA 1RC6A 2WFF1 3WG2A 2CDOA 2W87A 5FV3A 5LK7B 1OKQA 2JX9A 1FAYA 3OPZA 4X8NA 4UYBA 5CISA 3WNNA 4LBQB 5IT6A 4DOUA 2ZABA 1G6NA 3LF7A 3PVOA 4S2DA 1UOBA 5BNPC 4MVTA 2HEYF 3FL7A 3MPBA 1WLDA 1W8WA 1IGOA 4FFGA 5FP4A 2WWUA 1VBC1 3N9LA 4XQDA 3VLBB 4IXLA 1R1A1 2HWD2 3LGRA 1POV1 2B8MA 3KHBA 5DZFA 1XE8A 4BU2A 3PDQA 3PIGA 2WWJA 3MLJA 4M0NA 4QKDA 5DPNA 4I0BA 3L2YA 1J3PA 4LBQA 4HVRA 4UW5A 5J37A 3RZGA 2ZX3A 1UX6A 1GR3A 1LHVA 4FBFA 1RUJ2 2QNKA 3AZZA 2BVBA 5IAVA 2VE1A 3UT0A 4AVTA 1RITA 2VZOA 2JG8A 3AYAA 2Y33A 1OHFA 3ZYBA 4LHKA 3OBRA 4BZ4A 5IATA 5C71A 2BV4A 5KBFA 3RNSA 4CU9A 2HKXA 1VBE2 2LRPA 5E8AA 1QJY2 2GNMA 2R063 4OI2A 1VIWB 2BJSA 2ILMA 3I3QA 1TNFA 1HRI2 4XUTA 5DUUA 3DUIA 5C6CA 4H7LA 4NRQA 4ZONA 3FFQA 5DMYA 3KV5A 5F2WA 3CO2A 4KGGA 2OXBA 4YW5A 3C7GA 1OLQA 3HIFA 5JR2A 1W6NA 1O3RA 4M4RA 4TYSA 1RUG3 1ULGA 1O5UA 4P5YA 4XZPA 3M4FA 3OOXA 1XE0A 4IL7A 2JE9A 4AI2A 4AWDA 5A80A 3MHZA 5BNOB 2VZ3A 1CIYA 3R4UA 3S57A 4MGYE 4UW6A 2WQZC 3ECQA 1GSLA 3I2DA 3TEWA 4OHYA 2BOJA 2Q30A 2VVDA 4QXHA 1BZWA 1UOFA 2YC4A 4PBOA 3WQ1A 1Q8PA 4Q8KA 1IS5A 4NAOA 5BPXA 5IK8A 1JW6A 3AMNA 2PHDA 3U0ZA 2VJXA 2ZGKA 1D0GA 3MGUA 4HN0A 4PJYA 4HK8A 3OJBA 4GKYA 3VD3A 2WT0A 4CE8A 2V73A 2D44A 4RFRB 4EV0A 5BNOA 5L7OB 3TEYA 2D3RA 5TSWA 5FZ8A 5DDJ3 3RSJA 4E2GA 3HWJA 1U5YA 4CU6A 2FDIA 3NV2A 4IE0A 1X82A 1HQWA 3GGLA 1W9SA 4XFBA 3N4MA 5CB7A 4D6SA 5H9RA 3G6JB 1PHMA 3MUY1 4JDNA 5ABJB 4N90A 4BCUA 1DQ4A 4DIQA 5F3GA 4QGMA 4QGLA 4P02B 3VZKA 2GZWA 4CCCA 2XQRA 2Y60A 4Y1ZA 3VDAA 1RUC3 1W3XA 4IEVA 1YEWA 5LEKA 3MFAA 4YVWC 1S0GA 1EUTA 3ZSEA 4LUKA 4LUMA 2FD8A 1Z78A 4MHUA 2MPFA 1GMMA 1OUXA 3K75B 1W0OA 5JVVA 3EYPA 2R061 2NN8A 3WHTA 3MLLA 1F31A 4YZ2A 4XIOA 3RI9A 2V5YA 2DUQA 2YXSA 1LGBA 3HNBM 5BYNA 4CP1A 4QPWA 4LT5A 2C6SA 2P5BA 5K4LA 1UNBA 4PDWB 1V9U3 1PVC2 3IIIA 4QU2A 1V6IA 5DG2A 1BVP1 2JJ6A 3PIJA 4O9EA 1Z0HA 4I0WB 3GNEA 1LESA 4CUBA 2AEYA 3R05A 4RQPB 1RUG1 2WA4A 3O5SA 1HXS3 1W8TA 2D3SA 2AH2A 2O14A 3EQEA 3OF1A 1DGRN 1OT5A 2Q8CA 1K5JA 2VMCA 4AHWA 1RJ7A 3BGAA 3AB0A 2R30A 2UURA 5JLVA 4WVZA 1LOBA 3WP4A 2ORXA 1YI7A 1NLQA 2Q4SA 4A41A 3PVNA 4R9DA 1MZ6A 3H0OA 4EWDA 3JBG3 3OGRA 3PVBB 3V0AB 4HXCA 3T0AA 2J1VA 5CYYA 5I91A 5BUVA 4B29A 5DDJ1 3TEXA 2QQWA 4HETA 4JRLA 4AFCA 2XR4A 3NO8A 4N9IA 3CEWA 2ZHLA 1PM4A 1DFQA 3AMPA 4GAZA 3ZXGA 1RUE2 4RN5A 3I3BA 1UU6A 3IKWA 4YGEA 3V0AA 5APAA 4LHLA 4XZUG 1ZA4A 5T3NA 1RUF3 3M3CA 2JWPA 1RUC1 5AC93 3ON7A 4RYDA 2B42B 1G86A 1DU3D 4KH9A 2XPJA 3OYWB 4WVMA 2HBUA 5FZIA 3MIEA 4D7SA 4NE9A 5FPVA 4CXWA 4XFCA 2WZR2 1W90A 3ZO0B 3ATGA 4OQ9A 3M70A 4CDWC 5FZHA 3BB6A 4M00A 5FZMA 3D4KA 5FZ0A 4TN7A 5A32B 4F8AA 3POIA 2DV9A 4QDRA 2VOTA 5FKCA 1V9U1 3T1MA 5F1RA 1I1EA 4NROA 1DZQA 3UV9A 5LY1A 2XUEA 2ZXQA 1N47A 1AVBA 1NCQA 3FHAA 4MG2A 5FJKA 1E5IA 5K0UC 1HXS1 2EXKA 1W0NA 2JB4A 1QJZA 4B3NA 5JR7B 3FLRA 2ETEA 1JI6A 1HW5A 1WCUA 2ZMLA 1VRH2 3U4SA 4Z2AA 2EIEA 2I45A 2IVIB 4KWUA 3A7QA 4HSLA 4Y22B 4NPRA 4A7YA 4PI2A 4RHV2 4HG6B 4YPJA 1C28A 4C90A 1R083 3CIHA 3MBWA 4GZ9A 2ZS6B 4NHYA 2B4KA 3GHNA 3JBG1 4K1ZA 2BNNA 5FZ1A 4A3ZA 1KDMA 4BHPA 3AJZA 3VBFC 1LHWA 4ISRA 5FTTC 1E5RA 1OXCA 1XBFA 5DQ0A 3ZM8A 1W6OB 1DQ1A 3AX4A 4DXZA 2VMHA 4XF9A 1SBEA 1AHSA 1AYN2 3NWKA 5JIUA 2DBNA 1OD3A 1C57A 1GANA 3BIWE 1DP0A 4QDQA 2UWCA 4W4ZA 2XJPA 3V56A 1FXZA 3BN6A 3NKTA 1PGL1 4RS5B 1RUF1 2VECA 4MV2A 4DQAA 4A45A 5AC91 2Q5TA 4E4DX 4X6RB 3KSCA 2JE8A 1XE7A 3VKOA 4IEZA 1RHI3 2XWJB 3R4SA 4NIAA 4QQPA 3LEMA 2W47A 3T0BA 2D43A 4FQ4A 3DXTA 1BBT2 4RFT0 1TQ5A 3D82A 3HT1A 4B1MA 4XFAA 5J48A 1UQXA 5LBCA 3D8CA 3CJIC 1YHFA 1RMU2 3HAGA 2WZPP 4RS5A 1SDDB 2BVVA 2ES3A 2WC2A 3WXPA 3HPNA 4AHXA 5L9BA 2J1SA 1VBA2 2VO5A 3I3MA 5DAWA 1GBGA 4PLOA 3E1F1 2VAUA 3UL2A 3TEZA 2W2IA 1V6OA 3NNFA 1S0EA 3AYCA 1YUDA 3K77A 4N8MA 4Q1PA 2IXLA 3LA2A 2ZX2A 1UXXX 1DHKB 3HOBA 4IEYA 2K9ZA 1QQP2 2FCUA 5FO7B 4K21A 5BNPB 4XUNA 2P4EA 5IUQA 4ET7A 3DV8A 2PXJA 2PQSA 1RUD2 1APNA 1KDKA 2BGCA 2GN7A 3AP4A 4LA2A 4QD2A 3WCSA 1R081 2MEV2 2XBO2 2QBXA 4LMFA 1BK0A 3GDBA 2FZ2A 2P3IA 4XAEA 5A3LA 5FYZA 2WNOA 4JDOA 1F4HA 1VMHA 2GC0A 4XBNA 4OQ8A 1H9WA 3E6CC 5BNPA 1AF9A 4JHTA 1LULA 1XNAA 2QQOA 2VW1A 3USSA 2D5HA 5DABA 3PJYA 4YFZA 2KM2A 3WDTA 1AR83 4G4FA 3DECA 3W21A 5JI9A 1NG0A 4DXSA 2WUHA 1YJKA 4ASMB 1CQ9A 4LBNA 4B4QA 1WW6A 3ME2A 4JGZC 3RMXA 5C3RA 1IQDC 4FPEA 4JGYC 3WP3A 5ANNA 1RHI1 1AX2A 1LAJA 2PN5A 3U07A 4AE2A 4XPVA 3MYXA 4GJYA 1UZ0A 2QTWB 4MXWB 1OVPA 2X09A 2RJKA 4UWDA 5BY5A 1RUH2 2AC1A 2QQPA 5E89A 1IPJA 1VMFA 2BU9A 3HMYA 3I97A 1J59A 1CAXB 3BTAA 2JDKA 4LO6B 1JZ2A 3I2IA 4XEZA 3J8F2 2W91A 5ACA3 4LOSA 5JZGB 4LBJA 1H1AA 1OMIA 4EN6B 3HNMA 2DCKA 4LITA 4WV8A 3NNJA 2BUKA 3V65A 1HV1A 3NMBA 4MXWA 3IN9A 4Z1VA 5FZLA 2HH9A 4LKFA 1VBD3 2WNUB 3A0NA 3ZIXA 2VD7A 1JZ6A 4E2QA 1JUHA 3INAA 5KC6A 3RWKX 1F5JA 3LZZA 2IC1A 2W52A 2XWBB 1NQJA 4FFHA 3LA7A 3OUJA 3S7EA 1STMA 1LNSA 2ZEZA 1AL23 5E6HA 1UO9A 4EN0A 4XE9A 3USUB 2HWB3 3IB3A 1HQNA 4YW7A 1V6KA 5FPLA 5DG1A 1AL0G 4K6BA 2CGNA 1BCXA 2BEOA 2WNUA 5LEJA 4AVSA 3BU0A 1SLIA 1QJU3 4D6RA 1DDLA 2QQMA 1NE4A 4Y4YA 2YDEA 1C5HA 3AL5A 4DXRA 3HN1A 1K12A 1JU4A 4A3XA 4ZKTB 3LPFA 3ZN6B 3USUA 2QKDA 4AR2A 2ARBA 2C1FA 2LM3A 2K0GA 2MNGA 1AR81 3ALQA 4OYUA 5DAVA 1CZVA 1NLSA 4YVWB 3PTYA 2R043 2VTXJ 3C3VA 2E26A 5EYYA 5FZ9A 4Z07A 1OQEA 4KBBA 3ZFEB 2B46X 4IEOA 1OFNA 4IEWA 1WW5A 2RDNA 4QXCA 1OKOA 3I59B 2IFRA 4E4SA 5K9YA 2VW2A 2OUJA 1KRIA 1J58A 3GBWA 4YVWA 2RDSA 1AR92 2ZJCA 3THCA 2AACA 1J1TA 4LHNA 3C7HA 5B2GB 2RR13 5JXGA 4HVOA 1ENSA 2P6CA 2R0FA 2RVAA 1FOD2 5ACA1 1GLHA 1DGRA 3OY8B 4LK7A 4TWTA 1A8DA 2BRTA 4JVAA 1PNGA 4PIXA 3ZPOA 3I2KA 2NZ9A 1VBD1 2YFUA 4KNCA 4MO3M 3I2HA 2A1XA 5GLZA 3W20A 1OQ1A 5IK7A 3WNPA 2UWAA 3LWCA 1FPN2 1O7FA 1ZX5A 1UYPA 1NLRA 1Q8VA 2WSVA 1W03A 3KQ4B 4EE2A 4QWNA 1AL21 3K3NA 4IV1C 1OF3A 1ULOA 4BQ5A 1IS4A 2HWB1 3FLTA 1AJKA 4ZPIA 4QB6A 3SLIA 3H1MA 5L7OC 1RJ8A 5FY7A 3POYA 2HLEA 3ELNA 3TN91 1N1VA 4QMAA 3W5MA 3ZXLA 1RIRA 3VZLA 1QJU1 4LEJA 3UESA 2VOXA 1RL3A 1AR63 3LOIA 4OFGA 3WOGA 2ADEA 5E1RA 3ZFGC 4QX7A 3I4IA 4XF3A 3GCWA 1W8OA 4FI9A 5IWFA 4NRMA 1EUUA 3TNQA 2WN3A 3MW2A 3ORJA 5D8AB 5FZ7A 3ZYJB 3BTYA 4YG0A 2R041 2NPIA 4RSUA 5EJ3A 3VBRC 2BTVC 2ZGLA 4XBQA 5FUPA 4XUOA 3VHOA 1UY4A 4CDWB 3P6BA 3SCGA 3N3HA 2ET7A 4K7JA 4N7UA 1VBC2 3MICA 3ACFA 4O65A 1Y3TA 1R1A2 3KV4A 1MEC3 2BQPA 1PO22 1D4M2 4L2NA 3KV9A 4XAAA 3TNPB 2CWMA 1VE0A 1ZYBA 4BYYA 4UFLA 2G19A 2D93A 4MADA 2QQUA 4PDWC 3PLQA 4K8FA 2RR11 5DN2A 1EV11 3RGBA 2VBDA 4CDWA 3ZKUA 4YZ3A 3MV11 4HT1T 4YW1A 3CZUA 4RQPC 1Z7S3 1CWPA 3LDRA 4K1YA 2E63A 1YQ5A 1GKBA 1FYUA 1WBFA 2JXAA 5BNNC 3ZPYA 3K4DA 2WO2A 2WZEA 3O1OA 3N7MA 3IWZA 5K0UA 1XU2A 4IW3A 3WINE 3V0BB 1IKPA 2JD9A 1TNRA 3NJVA 2PMWB 3S30A 3VBFB 1C3HA 5JMCA 1G9BA 3ZSMA 1CZTA 4IQPA 3I3EA 5A3NA 1BJQA 4EJRA 1H2MA 3AZXA 1JYXA 1MVEA 4LKSA 1PZ9A 4QQ2A 1X8EA 5I0SA 1V70A 5FLJA 1UL9A 3PVEA 1XRUA 1OC1A 1YQ8A 2XHKA 4QQHA 2ZBJA 3FWEA 2YROA 4ISQA 1NE6A 5IVCA 1OD5A 3CKHA 2O8OA 5A33A 1AR61 2W39A 2TUNA 1XYOA 3VBFA 3DYMA 2J1AA 4FXKB 5SV8A 4GIQA 2E7QA 3QBQA 2XLAA 1JYVA 3ZSKA 1COV3 3BTXA 4W6WA 2RM22 3HNYM 5FZAA 1FNZA 3CF6E 3RDIA 2QQNA 3C2UA 5CFCC 1CX4A 3LEIA 3H42B 1LKNA 1W2TA 4KL1A 1AXKA 1UPSA 3MIBA 2IXIA 5A7PA 3CJIB 4CZSA 1UU4A 1K3IA 2YYOA 5JDBA 2RDRA 3QH6A 1S0DA 4Y24A 2WQ8A 4B7EA 4XETA 1MEC1 5L9RA 2X8KA 4CUAA 4HVQA 1C4RA 1O3SA 1EAH3 1SHWB 3AMQA 1HDKA 5KHHA 5I0TA 5I8TA 2B7YA 3FHIB 1SG3A 2Q8OA 4V2WA 3JD73 3GCXA 5FQ0B 3CJIA 2Q0AA 4M3CE 2OVUA 2B39A 1Z7S1 4XACA 1VJ2A 1LOFC 1YFUA 3H1YA 1SPPB 1WMDA 5LA2A 1PMHX 1S2BA 1GZ9A 2Y38A 1XYNA 4QKBA 3IZOA 2GC1A 5FKBA 3SCHA 2JIGA 3N7LA 4WVWA 1IHMA 2UWBA 3EJKA 3PUAA 1W9WA 1JOPA 1YQ6A 3WF0A 3MPPG 5FQ0A 4IGPA 2EIGA 2VNGA 3ZYGA 2PLV3 3URFA 1VAVA 4JKKA 1SPPA 3SHRA 4QPIC 2BFUS 3VBUB 3D5OA 4JHZA 4NHMA 3ZLIA 4JTOA 4Y4RA 5FZGA 4XQ4A 4LIUA 4Q0UA 4YW6A 4AVVA 4DRRA 2K46A 2ZGOA 4CP2A 2I07B 3AKQA 4M01A 3RVHA 3N7KA 1ODNA 3J7LA 3PMSA 1MR5A 2BGPA 4MUVA 5EHDA 3O12A 1COV1 4LKDA 4E8CA 1UY3A 4JGYB 5F39A 2VOWA 2TBVA 1EPZA 4LBLA 4AQSA 4C0BA 3AP5A 1I6XA 5FZKA 4BLIA 1WGPA 4BXFA 2ZGMA 3FUOA 4NIHA 3R6SA 4AXOA 5FUIA 3POEA 5FXZA 3AVRA 3POGA 1QNYA 1VP6A 2JIJA 3PU8A 4CEWA 4LBQD 1UYZA 4JGZA 3KWVA 4JGYA 1EAH1 1CVNA 4XIKA 1UN1A 1GZWA 2VUAA 4Y5TA 5F32A 4ZY9A 4C8DA 2VR4A 3JD71 4AI0A 1JN2P 3OGJA 4LBKA 4EWAA 1W8HA 2XXZA 5CKQA 4CYDA 4CEYC 5T50A 4BQ2A 1T6GC 1DQ0A 5HV4A 1RUC2 3HN3A 3OUIA 3H8UA 1OLMA 1PGW1 1W6MA 2VZUA 4QXBA 2WYFA 1WCDJ 4D7TA 1LOGA 4WM8B 3T2TA 1BEV3 1ENRA 2XDVA 1OOPC 2WNEA 3NVCA 1LENA 2VCBA 4OHWA 5FP8A 1FV3A 5H9SA 5A7QA 1MS5A 2R073 4TTGA 2GH2A 3K3OA 3NL1A 1TZOA 1WCSA 2QQKA 3OGSA 1IQAA 5F8PA 3UGGA 3VGIA 5C70A 1ZRIA 1WCQA 1POV0 1DCSA 4R52A 2J1RA 1Y43B 1V9U2 1XNCA 1F2NA 2PLV1 3EHKA 4UF0B 2ZHKA 4ATEA 3JU9A 4FVVA 1NA1C 1OPOA 5KHJA 3O1VA 4M3CF 1CIWA 2XB6C 5T5OA 1C8NA 2UY8A 2UY9A 2B45X 3KB5A 4J1XA 5F6KA 4ARXA 2WZ8A 2BWAA 2HYKA 1YWKA 3LQCA 5JWPA 5FWEA 3HJRA 4AQ6A 5FY5A 2Y8KA 1AR72 4R9BA 4XMAA 4XJAA 1JU3A 2W1SA 3OPWA 4UF0A 3RRDA 2IXJA 4WBBA 2VVEA 4P5HA 1W3VA 2D6KA 3OEBA 2WAOA 3JBG2 1QMJA 1FMD2 2A3XA 2DU0A 3AXEA 4Q4X2 3WNMA 1IS6A 1U5XA 1VALA 1OF4A 4SBVA 1VB4A 4OUEA 3JZVA 4ZZ8A 1C8M3 5FZFA 1PIV3 1YIPA 3IT8A 4XTMA 1O4TA 1WW7A 2HWE3 1RVF1 1UZVA 4Q27A 2PHWA 5LB6A 4OHZA 5CFDC 1UZYA 2EVXA 3R4DB 4HSJA 1S0FA 2J1EA 3B01A 1ASJ1 4Q0QA 2WLQA 2YMZA 5FYIA 3CNAA 4HLTA 4W50A 5LA1A 5JZGC 4FSJA 3C8XA 3RI8A 3ZYFA 1Y4WA 4Q0VA 5J98B 2C24A 3M7AA 4W6XA 5AC92 1QXRA 3KLSA 5JOWA 3POBA 1H0BA 4XCBA 4P9GA 5T54A 2D6LX 2WNUC 4YW2A 1KFUL 3AZVA 4W8JA 3VKNA 5KXBA 3FZ3A 2PAMA 1BEV1 4IV1B 2VZRA 2EIDA 1HN1A 1UAIA 3E97A 1KEXA 5EP9A 3QCWA 3H7JA 2F6BA 2HWC3 1HRV3 4W6YA 2HJIA 1HB1A 4Q5OA 4PF1A 1X50A 5I8SA 3FE5A 3H8RA 1ZM1A 3WG4A 1ZRRA 3OEAA 5HV0A 4D6QA 3ZFGB 2RS53 3KV6A 1LB2A 5F37A 3O1TA 3S0MA 1WBLA 3D6EA 4IE5A 1SFYA 2WFPA 4CCOA 4IV1A 1H1IA 1WLWA 3DPRB 4TXWA 4BA6A 2OZJA 2PHTA 2YZ4A 3ACGA 1ODMA 5IVEA 2Q1MA 5JOXA 4UW4A 2QCSB 4LPLA 5L7OA 5EIYB 1JOBA 2J22A 3VBRB 3WDUA 2ZOEB 3ACHA 4NJ4A 4DS0A 4JAAA 4I0AA 4IV3B 1S0IA 3E5XA 4PBPA 3PURA 4IETA 4LO7A 2DTYA 2ZEYA 3ZFGA 3AMMA 2YPDA 3TOJA 3ZFEC 1W04A 5DZEA 1R082 2W08A 4A6SA 4KG8A 1H1MA 2OA2A 2JENA 2DWRA 2VW0A 3WF3A 1Y9MA 2YC2A 1W6QB 2VMFA 5JOZA 3VBRA 4YYOA 4AVCA 1C8M1 4YM0A 1PIV1 2JDPA 1AZDA 1YQ2A 4XDQA 1WMXA 5EQUA 3WP6A 1XSRA 2HWE1 4BOWA 4FTEA 1YFYA 5A7WB 5KWRA 2Z5WA 4I2OA 1DYOA 1AX0A 3LEKA 3H50A 4P9WA 4X8PA 4BH9A 1W8NA 4BIOA 1YXWA 3FN9A 4IGQA 2ZACA 4XCAA 4CA9A 3OUHA 3KCCA 4DB5A 5BNNB 3Q8FA 3A0KA 1W6QA 4IEPA 2IXKA 3DYPA 4Q2FA 4PDWA 4AHYA 4NO4A 3VL9A 4LULA 1BQPA 3KCYA 4QM8A 3JCIA 3H1WA 2HWD3 2JG9B 2O8QA 1RHI2 5A7WA 2BDRA 2C9KA 4BQ3A 3PUIA 3LFIA 4H2AA 4RQPA 5FAXA 3E6BA 1WD4A 2YHJA 3KF3A 4CCMA 4GULA 1DGWA 3RWNA 1HRV1 2HWC1 5FPAA 3JQWA 1PO13 4BQXA 5BNNA 1JBCA 1G8WA 4I01A 5EJ1B 1V6JA 4NIDA 5HXVA 3VUOA 3IPVB 1MQTB 2ATFA 4LKEA 1F9KA 2Y6JA 4XDOA 3IIAA 2E31A 4A42A 3MIGA 1DF0A 1QOTA 2RS33 5T52A 5J36A 1V6LA 4M4PA 3M3IA 1W2AX 4FPOB 1VBE3 2DVFA 1H2LA 2YC0A 1QJY3 2GN3A 3DEMA 2YGMA 1XNTA 3PUHA 4JKMA 1GQGA 4QX5A 4Y1YA 3VKMA 5CFCB 4FFIA 1HRI3 3MIDA 2W3JA 3AYDA 4GA9A 5LRSA 5D8AC 4AI8A 3WQ0A 1RUI3 4GMP3 4QPYA 3IPVA 4XF0A 1K42A 3H8XA 3IMMA 4HFSA 1GNZA 2ID4A 3B5LB 5FK8A 3K46A 4H7MA 4LO5B 3WUCA 2RG4A 3D0JA 4U2AA 3CDZB 5F5CA 4N53C 5KR7A 4DUWA 3LB9A 1ULPA 5FOBB 4BJ0A 2NM1A 5C4WB 1UIKA 3SKJE 3LIGA 4OLLA 4Q26A 3BYWA 3HEIA 1OUSA 3BOWA 3U78A 5CFCA 3GM8A 3NNMA 3NV1A 1SBFA 2VM9A 4S2HA 4C91A 5BNQA 1NQDA 3OYWA 3I8TA 4JKLA 4META 3T08A 1KXGA 4EN8B 2PAEA 3VZOA 1YI9A 2VGDA 5CU1A 2PHRA 4XW3A 4UXAA 2AR6A 2HWF3 1MZ5A 1R1ZA 4WM7C 2EALA 1ZZ9A 2V72A 3I2JA 4ARYA 1UY2A 4QM9A 1G9AA 1C5IA 1SFNA 4XTPA 5A32A 1ND3B 5AFEA 2FMYA 4AGVA 2EA7A 4UFHA 3B93A 1O4YA 2A6YA 2CHHA 2HWD1 1XPWA 1NOVA 4PIYA 4OHXA 4AEKA 2Z42A 1UKRA 1YRZA 3LIHA 4AGGA 3EMRA 4CCJA 1LOFA 3C7FA 1IOAA 3Q8CA 2PHLA 4JV4A 4QX8A 4RGGA 3ZSJA 4QPIB 1LOCA 3WUDA 3SH5A 1H4GA 1PO11 5KHKA 1O59A 4Q0PA 1CAUB 4Y22A 3RMYA 1I3HA 4JC1A 5K7PA
chains in the Genus database with same CATH topology
5FXVA 5FZ9A 3DXUA 5A7NA 3N9PA 5F3IA 3PTRB 4QXBA 2OT7A 2YU2A 2OS2A 2W2IA 3LD8A 2OQ6A 2Q8EA 5IVCA 4CCLA 4LIVA 2GP5A 2XDVA 3NJYA 4QXCA 5FP8A 5FP7A 5F2SA 5A7WB 5A7QA 4URAA 5FYYA 5FXXA 5FZ4A 3K3OA 5A7OA 5IVVA 4EZHA 4IGQA 4GAZA 5A3WA 4CSWA 2Q8DA 4BISA 2PXJA 5FZAA 5FJHA 2YBKA 5FZOB 4QU1A 3AL6A 3KV5A 5FZCA 5FYUA 5F2WA 5FPBA 4UF0B 2GP3A 3PU3A 5F5AA 5FY4A 5A7SA 5A7PA 5FYZA 5A7WA 3ZPOA 5FPUA 5FZIA 4ASKA 5FPVA 4CCMA 5FYHA 5A80A 5A3PA 2OQ7A 3N9OA 5FPAA 5FWEA 5FXWA 5F5IA 5LY2A 5FBJA 5FZHA 5FY5A 4QXHA 5FZOA 4QWNA 4V2WA 5FZMA 5FZ0A 3PUSA 4TN7A 5FYSA 3K3NA 3OPWA 4UF0A 5A3NA 5IW0A 3OPTA 3N9QA 3UYJA 5LY1A 2XUEA 4HOOA 4XDOA 2YBPA 5FY7A 4Y33A 5CEHA 5FJKA 5A1FA 5FZFA 4AI9A 5FZEA 5FZ8A 5IVJA 5FYCA 4HONA 4GJYA 4QX7A 4DO0A 4Y3OA 4XDPA 3U4SA 5FYTA 3PUAA 5IWFA 5IVYA 5FY1A 5FP9A 4NUBA 5FYIA 4D6SA 5A1LA 4IGPA 5FYBA 5FZ7A 5IVBA 5FY9A 4DIQA 4CUGA 3PUQA 5F3GA 5F5CA 5KR7A 4CCKA 5FZ6A 5ANQA 2YBSA 5FUPA 5FZ1A 4LITA 3ZLIA 4GJZA 4Y4RA 5FZDA 5FZGA 4LIUA 3U78A 5FYMA 5FZLA 3KV4A 4EZ4A 3RVHA 2VD7A 3KV9A 5ISLA 5FZBA 3LDBA 3K2OA 5FZ3A 4LXLA 5F39A 5FV3A 5E6HA 4AAPA 2P5BA 1VRBA 5K4LA 4EYUA 4GD4A 3AVSA 5FYVA 4D6QA 3KV6A 5F37A 5FZKA 5FPLA 4IGOA 4CCNA 4BXFA 4CCOA 3N9NA 5A3TA 2OX0A 5IVEA 5FP4A 2WWUA 5FY0A 5FXZA 4E4HA 3N9LA 3AVRA 5IVFA 5LWBA 3KVBA 3PU8A 4CCJA 4D6RA 5LW9A 3DXTA 5F3EA 2XMLA 3N9MA 3AL5A 4QX8A 2Q8CA 5FWJA 4BU2A 2YU1A 3PDQA 2WWJA 5FUNA 5F3CA 3PURA 5F32A 4C8DA 5FP3A 5FY8A 2YPDA 3KVAA 2XXZA 4V2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FXV A;  5FZ9 A;  3DXU A;  5A7N A;  3N9P A;  5F3I A;  3PTR B;  4QXB A;  2OT7 A;  2YU2 A;  2OS2 A;  2W2I A;  3LD8 A;  2OQ6 A;  2Q8E A;  5IVC A;  4CCL A;  4LIV A;  2GP5 A;  2XDV A;  3NJY A;  4QXC A;  5FP8 A;  5FP7 A;  5F2S A;  5A7W B;  5A7Q A;  4URA A;  5FYY A;  5FXX A;  5FZ4 A;  3K3O A;  5A7O A;  5IVV A;  4EZH A;  4IGQ A;  4GAZ A;  5A3W A;  4CSW A;  2Q8D A;  4BIS A;  2PXJ A;  5FZA A;  5FJH A;  2YBK A;  5FZO B;  4QU1 A;  3AL6 A;  3KV5 A;  5FZC A;  5FYU A;  5F2W A;  5FPB A;  4UF0 B;  2GP3 A;  3PU3 A;  5F5A A;  5FY4 A;  5A7S A;  5A7P A;  5FYZ A;  5A7W A;  3ZPO A;  5FPU A;  5FZI A;  4ASK A;  5FPV A;  4CCM A;  5FYH A;  5A80 A;  5A3P A;  2OQ7 A;  3N9O A;  5FPA A;  5FWE A;  5FXW A;  5F5I A;  5LY2 A;  5FBJ A;  5FZH A;  5FY5 A;  4QXH A;  5FZO A;  4QWN A;  4V2W A;  5FZM A;  5FZ0 A;  3PUS A;  4TN7 A;  5FYS A;  3K3N A;  3OPW A;  4UF0 A;  5A3N A;  5IW0 A;  3OPT A;  3N9Q A;  3UYJ A;  5LY1 A;  2XUE A;  4HOO A;  4XDO A;  2YBP A;  5FY7 A;  4Y33 A;  5CEH A;  5FJK A;  5A1F A;  5FZF A;  4AI9 A;  5FZE A;  5FZ8 A;  5IVJ A;  5FYC A;  4HON A;  4GJY A;  4QX7 A;  4DO0 A;  4Y3O A;  4XDP A;  3U4S A;  5FYT A;  3PUA A;  5IWF A;  5IVY A;  5FY1 A;  5FP9 A;  4NUB A;  5FYI A;  4D6S A;  5A1L A;  4IGP A;  5FYB A;  5FZ7 A;  5IVB A;  5FY9 A;  4DIQ A;  4CUG A;  3PUQ A;  5F3G A;  5F5C A;  5KR7 A;  4CCK A;  5FZ6 A;  5ANQ A;  2YBS A;  5FUP A;  5FZ1 A;  4LIT A;  3ZLI A;  4GJZ A;  4Y4R A;  5FZD A;  5FZG A;  4LIU A;  3U78 A;  5FYM A;  5FZL A;  3KV4 A;  4EZ4 A;  3RVH A;  2VD7 A;  3KV9 A;  5ISL A;  5FZB A;  3LDB A;  3K2O A;  5FZ3 A;  4LXL A;  5F39 A;  5FV3 A;  5E6H A;  4AAP A;  2P5B A;  1VRB A;  5K4L A;  4EYU A;  4GD4 A;  3AVS A;  5FYV A;  4D6Q A;  3KV6 A;  5F37 A;  5FZK A;  5FPL A;  4IGO A;  4CCN A;  4BXF A;  4CCO A;  3N9N A;  5A3T A;  2OX0 A;  5IVE A;  5FP4 A;  2WWU A;  5FY0 A;  5FXZ A;  4E4H A;  3N9L A;  3AVR A;  5IVF A;  5LWB A;  3KVB A;  3PU8 A;  4CCJ A;  4D6R A;  5LW9 A;  3DXT A;  5F3E A;  2XML A;  3N9M A;  3AL5 A;  4QX8 A;  2Q8C A;  5FWJ A;  4BU2 A;  2YU1 A;  3PDQ A;  2WWJ A;  5FUN A;  5F3C A;  3PUR A;  5F32 A;  4C8D A;  5FP3 A;  5FY8 A;  2YPD A;  3KVA A;  2XXZ A;  4V2V A; 
#chains in the Genus database with same CATH topology
 3J7N A;  1SDW A;  2F4L A;  2R7E B;  3AZY A;  4QX1 A;  5FXV A;  1GV9 A;  2DCY A;  2WSU A;  4AG4 A;  3A4U A;  1KQR A;  5GLU A;  3WQB A;  1K45 A;  3UK9 A;  5JI7 A;  5FPZ A;  3PTR B;  2RS3 1;  1BXH A;  5FK7 A;  4YGD A;  1ZNP A;  5GZF A;  3T2O A;  1SLB A;  1VBE 1;  4QPI A;  1VBD 2;  1QJY 1;  2W0X A;  2I74 A;  1R09 3;  4GWN A;  4I3P A;  1HRI 1;  2ET1 A;  1W6O A;  2VTF A;  4GWI A;  4LA3 A;  4Z92 B;  1RUI 1;  4GMP 1;  3ACL A;  4BXS V;  1PVC 3;  5D2A A;  1AL2 2;  1PGL 2;  1DGL A;  4QX0 A;  1BK1 A;  1HIX A;  4DEQ A;  4OMD A;  4XUQ A;  2HWB 2;  2CV6 A;  4NWV A;  1WZX A;  4XXP A;  1H4H A;  2YFZ A;  2AYH A;  2XOM A;  3Q8B A;  3TN9 2;  3WX5 A;  5F5Q A;  2FDK A;  4CEY B;  5A3O A;  1ZZ6 A;  3GBG A;  5LY2 A;  1LCL A;  2HWF 1;  1PNF A;  3O1M A;  2WO7 A;  5K8S A;  5T5J A;  1OOP B;  3CHX A;  2XUM A;  2E9Q A;  3T2Q A;  3ZXJ A;  1A3K A;  3ENR A;  5FRA A;  4YG6 A;  2YBP A;  5F7U A;  2LW8 A;  4CEY A;  3DKW A;  1GUI A;  3UJQ A;  4P08 A;  5F6L B;  5FZE A;  4FAG A;  1AYM 3;  2H6C A;  1H2K A;  1D7P M;  3I2G A;  1W8F A;  2Z69 A;  3ASI A;  4AI1 A;  2Y64 A;  1QJX 3;  1OUR A;  2FCT A;  1YFX A;  3GAL A;  2WA3 A;  5EPA A;  2NP0 A;  3AXD A;  3KCX A;  1CJP A;  1OOP A;  1NA1 B;  1PMJ X;  2Y6L A;  2RR1 2;  3APB A;  1EV1 2;  2A6X A;  3VBU C;  4CPB A;  1DYK A;  2GAL A;  2W46 A;  1UU5 A;  3ZR6 A;  4R9C A;  1VAK A;  1YYN A;  4XHB A;  3WT3 A;  1HV0 A;  1QNW A;  4FOW A;  2WZR 3;  4N7I A;  2V5D A;  5ERL A;  3SNM A;  4KG0 A;  5H9P A;  5J09 A;  4Y1X A;  4Q4V 2;  1R09 1;  5BV6 A;  5E16 A;  4QQL A;  1NA1 A;  3WVJ A;  3ZYH A;  1PZ8 A;  4CEW B;  1SCR A;  5LRR A;  2CU5 A;  3WW2 A;  1UZZ A;  3FHQ A;  5J96 B;  2QQJ A;  1PVC 1;  2SLI A;  3ETP A;  3U11 A;  3OGV A;  4AEM A;  1ULE A;  4FPC A;  2AUY A;  1VRB A;  4O61 A;  1WUV A;  4TZD A;  2WLP A;  4C1W A;  4MGI E;  5J3U A;  2GSY A;  1LOE A;  3HBK A;  1ZBE 3;  5CFD B;  3OD4 A;  5A3T A;  2B9U A;  2GMM A;  3GZT B;  1GP5 A;  1AR6 2;  3KVB A;  1MS0 A;  4A6O A;  3RYP A;  2BBA A;  1A78 A;  2XLG A;  3N9M A;  3VBO C;  3O14 A;  4OVE A;  4ORF A;  1FX5 A;  4RGK A;  5LA0 A;  5HCB A;  1ULD A;  2RMU 3;  1QIQ A;  4MOA A;  5CIR A;  5FP3 A;  3ZVX A;  5CA6 A;  1LHN A;  3BCW A;  2FCV A;  3AFG A;  1LGC A;  2IUW A;  5CFD A;  2WN2 A;  3WEZ A;  4AGR A;  5AVA A;  3VHR A;  1CAX A;  4GWJ A;  4ONU A;  1J83 A;  4FXG B;  3LCP A;  3N7J A;  2G9Z A;  2ZKN A;  1JYC A;  2EXJ A;  1NXM A;  2D5F A;  1PVX A;  1ZBA 3;  3T4V A;  4CP9 B;  3N9P A;  3HR9 A;  4BK4 A;  4WM8 C;  1ENQ A;  2JKX A;  5JSO A;  4PF5 A;  5JZG A;  2WAA A;  3DCQ A;  2OT7 A;  1T2X A;  4OHV A;  4E4Z A;  2Q8E A;  1LGN A;  1MEC 2;  1SCS A;  2DDU A;  4LIV A;  5LAT A;  1AYM 1;  1RUN A;  3ABZ A;  2XH6 A;  3IDC B;  1S4C A;  2HEW F;  5FXX A;  3ZIW A;  1QJX 1;  4AAX A;  5I8Y A;  3VKL A;  2H0V A;  2W1U A;  4QKN A;  1UOJ A;  4XXA A;  4XOG A;  3C7O A;  4B7K A;  4N43 C;  5A3W A;  2Y6G A;  3WF2 A;  4CXY A;  1F35 A;  3EBR A;  5IFP A;  4FO9 A;  4COV A;  4UBG A;  2YBK A;  3JB4 C;  2EXH A;  4QU1 A;  3OBZ A;  5FZC A;  3ZYP A;  3VD4 A;  2P6H A;  1Z7S 2;  2DFB A;  3AP9 A;  4FTS A;  1M4W A;  2JDN A;  1XXN A;  1TME 3;  3GF6 A;  3TBD A;  2PQQ A;  2WZR 1;  1BLZ A;  3CU7 A;  1S0J A;  3U10 A;  4YW4 A;  2XON A;  1JZ7 A;  5FPU A;  4LO4 B;  2PHX A;  2VUC A;  2YPJ A;  2G4I A;  1RXF A;  4K9S A;  1NKG A;  5JXH A;  1T6B X;  1MPX A;  4J25 A;  5I0U A;  1O3Q A;  3WW1 A;  1KJL A;  1YQC A;  4GB3 3;  3ZN6 A;  3LA3 A;  4D0Q A;  1VBA 3;  3I54 A;  3J26 N;  3PUS A;  1JMU B;  4AOC A;  2XKP A;  1GOH A;  3ZFF B;  1X8M A;  4QB2 A;  3CMG A;  2XJR A;  4AVB A;  4ZS2 A;  2OUH A;  4CDQ C;  5C8W A;  1ZBE 1;  3GHM A;  2A6V A;  2IVJ A;  2FDJ A;  2IWG B;  3LSD A;  4HOO A;  5GKA C;  4COZ A;  3UGF A;  4Y33 A;  3ZFE A;  1QU0 A;  2V4V A;  1DQ2 A;  2WS9 3;  4LK6 A;  4AED B;  2XG3 A;  1H6Y A;  1LEM A;  1ZRF A;  4Q4Y 3;  4AI9 A;  1XND A;  2DF7 A;  4FT8 A;  3ZN4 A;  1B09 A;  2VUJ A;  3I59 A;  5EJZ B;  3ZYR A;  1ULC A;  2WIN B;  3K4A A;  1QF3 A;  2NQY A;  4KMQ A;  1COV 2;  1QHD A;  2RMU 1;  5JUV A;  2D97 A;  2BZD A;  1YO8 A;  3JB8 A;  4MGT A;  3THD A;  2W92 A;  3P3N A;  2LTN A;  3AFK A;  4MGZ E;  2CYF A;  1W39 A;  2FBE A;  3POF A;  1KJR A;  3FFZ A;  1W05 A;  4FPJ A;  4JDM A;  3FLP A;  5FZ6 A;  1TEI A;  5ANQ A;  4L9B A;  4YAR A;  1ZBA 1;  3LFM A;  3TRS B;  3OY8 A;  1GOG A;  4O9G A;  4M3C B;  5A6Q A;  1ST8 A;  4Y20 B;  1D0H A;  5HBA A;  2VZT A;  3NNG A;  1S2E A;  2R6Q A;  2C4X A;  4IEX A;  2JB8 A;  4NRP A;  4CU8 A;  1EAH 2;  4EN9 B;  2VY0 A;  1RUO A;  3MF9 A;  3WDY A;  2QVS B;  2WBK A;  3WCR A;  1G9C A;  2FDH A;  1DG6 A;  1UX7 A;  3GXU A;  2OKX A;  3BOD A;  4COW A;  5GZD A;  5A6Z A;  1FNY A;  1W0P A;  4EYU A;  2Z79 A;  3GJA A;  1TMF 3;  3MF6 A;  1GP6 A;  3DPR C;  1C1L A;  2WFF 2;  4Q1R A;  4Y20 A;  3RJ2 X;  1W6P B;  4I30 A;  3FC0 A;  1PGW 2;  2BYV E;  4L11 A;  4Q29 A;  1TME 1;  1J84 A;  3W9A A;  1Q8O A;  4DPN A;  5JXJ A;  3FBM A;  1NZC A;  1JOD A;  1V0A A;  4MYE A;  4DMI A;  5KHI A;  4BDV B;  1MZE A;  3B9C A;  4IV3 C;  5LW9 A;  4N53 B;  1RTV A;  4E8D A;  4W65 A;  2RDQ A;  1HLC A;  1HX6 A;  3HT2 A;  4HMZ A;  5C5U A;  4QX3 A;  5FOJ B;  5JAX A;  1VR3 A;  1L3J A;  3I7D A;  4GB3 1;  3CBN A;  4RR3 C;  1VBA 1;  1WMF A;  2PLV 2;  5D8A A;  2CSG A;  2ZKL A;  2CDP A;  3R0R A;  2D98 A;  3O1P A;  3A22 A;  2RJ2 A;  4LOR A;  3WG3 A;  5A7N A;  3K4Z A;  4FPG A;  3SEP A;  2WS9 1;  2WRA A;  4HL0 A;  4N53 A;  2YU2 A;  4WM7 B;  4YRD A;  4Q4Y 1;  2KXL A;  3UKV A;  4CCL A;  2GP5 A;  2VCA A;  3A21 A;  5FMO L;  5FYY A;  2OII A;  2XLF A;  4CTE A;  1XNK A;  2GME A;  2ADD A;  4ASL A;  2VZS A;  3AC0 A;  2F17 A;  4FOV A;  3S7I A;  1D2S A;  1K5M C;  1SLT A;  1NY7 1;  5JPM B;  1WW4 A;  4FPL A;  2JG9 C;  3W58 A;  4WM7 A;  2GP3 A;  5FY4 A;  4R8H A;  4FCA A;  1YNA A;  5A7S A;  1UPI A;  3TWI A;  5CKM A;  3QAC A;  1OFS A;  4C0H A;  1RVF 2;  2VMG A;  3ZMN A;  4FAH A;  3TB0 A;  1Q8Q A;  4LLF A;  2OPW A;  5LBB A;  4MX3 A;  2PTM A;  2W9X A;  1ASJ 2;  2Y6K A;  3RS6 A;  5L36 A;  1MQT C;  3V0B A;  1V6M A;  1S0B A;  3BPZ A;  5GZC A;  1SEF A;  3NAP B;  4ZU5 A;  1GU3 A;  3VDB A;  1QY4 A;  1TMF 1;  3WF1 A;  3H9A A;  3CQO A;  4CP0 A;  1UKG A;  2QQV A;  3AP7 A;  4NWW A;  3UKT A;  1IZ3 A;  4D94 A;  3O1S A;  5T5L A;  4DFS A;  4YWA A;  3ZKY A;  2IFW A;  1JZ5 A;  3B7M A;  1EY2 A;  2LUW A;  4EWE A;  3ZR5 A;  5EYX A;  2DVA A;  5FPX A;  1CR7 A;  1WD3 A;  1VPH A;  5SV5 A;  4BQY A;  3DYO A;  1PM7 A;  2UU8 A;  5H9Q A;  2JDM A;  3KD4 A;  5FY1 A;  4I09 A;  5FP9 A;  4LJH A;  4OUM A;  4MH0 E;  5FYB A;  3GZA A;  5FMB A;  1ZZB A;  1CAW B;  4CUG A;  3SC7 X;  2R16 A;  3FMG A;  4UAP A;  5C4W C;  1GWL A;  2VL4 A;  1HB3 A;  2DFC A;  4AHZ A;  2VZ1 A;  4UOJ A;  1Q56 A;  2D6M A;  3U37 A;  3B3Q E;  3OTF A;  5FZD A;  2CY6 A;  1OLR A;  1A34 A;  2W5F A;  1IS3 A;  3WW3 A;  3NV4 A;  2N7G A;  4X6Q B;  4FFF A;  2P3K A;  4UFM A;  5EFU A;  1LEC A;  3J7H A;  1QXP A;  5ISL A;  3RZZ A;  1H2N A;  4BWO A;  3B9I A;  1QJE A;  4KBZ A;  1CAW A;  4Q8L A;  5FZ3 A;  4XVH A;  1CGP A;  2DBI A;  1US2 A;  5DUW A;  1JTZ X;  1ND3 C;  2JIC A;  4ZXK A;  5FLH A;  4B8E A;  5GZG A;  4L99 A;  3S5A A;  1REF A;  2WL1 A;  3AZW A;  4NIG A;  1PK6 C;  2R06 2;  1NZI A;  3RYR A;  4YGC A;  1W28 A;  3WV6 A;  2E7A A;  2C0Z A;  1NXD 1;  1QH7 A;  1HB4 A;  4HAN A;  4Y1V A;  4MGS A;  4DUV A;  1SBD A;  1DZT A;  3LSE A;  4I3G A;  4D69 A;  1W99 A;  3ZOI A;  1C8M 2;  2VNR A;  3WDV A;  4AL9 A;  3Q8E A;  4D8M A;  3EO6 A;  2HWE 2;  4YFW A;  1CD3 G;  3D0S A;  2EAA A;  3ES4 A;  3O0X A;  3RZH A;  3IM0 A;  1KGY A;  4IUG A;  1RUG 2;  1XU1 A;  4IND A;  4QHO A;  5LCW L;  1CJD A;  3O1U A;  4FOY A;  5CZK A;  3K48 A;  3KVA A;  1VBB 3;  2GH8 A;  3OGG A;  5FMO S;  1ND2 C;  5IYY A;  3T0D A;  4J6G A;  2CAV A;  3O0V A;  5I0R A;  3DXU A;  2A6Z A;  3VBU A;  2LS6 A;  5F3I A;  3RG0 A;  1PO2 3;  1UYY A;  2ZAH A;  3SXW A;  1JYN A;  1HKD A;  1D4M 3;  1JYI A;  1G9D A;  3MW3 A;  1XQN A;  1YC6 1;  3NJY A;  4OMC A;  4Q0S A;  4AEJ A;  3EXU A;  1HRV 2;  1IKQ A;  1BKZ A;  2BGO A;  2WYS A;  5GZE A;  5DDJ 2;  5IJR A;  4BB3 A;  5JPN B;  5DXD A;  2BBV A;  1X7N A;  1KS4 A;  2Q8D A;  2O0O A;  2CNA A;  4FQZ A;  2DVG A;  3AL6 A;  4YZ1 A;  3VHP A;  3VBO B;  4F3J A;  4QDS A;  1KFX L;  2FHR A;  4Y1U A;  1GIC A;  2XJS A;  5CBL A;  2WT1 A;  4JQR A;  2VBP A;  2OYZ A;  5FYH A;  5IAX A;  1CN1 A;  3N9O A;  4CUC A;  4AW7 A;  1GNH A;  1NCR C;  2VZP A;  2VMD A;  2WR9 A;  4BE3 A;  3UNP A;  4KWK A;  5G04 L;  3RZJ A;  4S2G A;  3X29 B;  1O91 A;  2ZMK A;  5FCC A;  3VBO A;  3ZXE A;  3IAQ A;  2TNF A;  2VZQ A;  4SLI A;  2B9V A;  1OH3 A;  5HXM A;  3I2O A;  4DUX A;  5LBE A;  3ZXK A;  4AFM A;  1ENX A;  3VD5 A;  3VDC A;  2WT2 A;  4N43 B;  3CZJ A;  1HJF A;  3HVD A;  4NVP A;  5A1F A;  4IEU A;  3VBH C;  3C7E A;  3KT4 A;  2P3J A;  2ZMN A;  4WM8 A;  2WWS A;  5FYC A;  5A6X A;  3KT1 A;  2RM2 3;  5GJ6 A;  5JSP A;  4Y3O A;  5CAD A;  2ZGU A;  1HXS 2;  2DTW A;  1JZ3 A;  1CES A;  2Y0O A;  5IVY A;  2ZAA A;  1JXN A;  3MIF A;  2QDR A;  4XMI A;  3WDX A;  1UY0 A;  2RE9 A;  3J9S A;  5IVB A;  1G7Y A;  1H9P A;  1VBB 1;  1JZ4 A;  3T09 A;  3HBZ A;  1ULF A;  1LOD A;  4N43 A;  3WHU A;  1E5H A;  1YFW A;  3BAL A;  2YBS A;  2JG8 B;  3LDK A;  1PO2 1;  2FDF A;  1OVS A;  1PX3 A;  2QDN A;  1D4M 1;  2D7F A;  3O0W A;  5FIX A;  2JEM A;  4MLO A;  3RFR A;  4CEW C;  3PHM A;  1UCX A;  4CDU C;  4PI0 A;  4CDQ B;  1S0C A;  1S2K A;  3AMH A;  1PO1 2;  1JS9 A;  3WD5 A;  3IAP A;  3LDB A;  4DIN B;  3H7Y A;  2UYB A;  3KZ4 C;  2Y26 A;  2FQP A;  1DLC A;  4QHB A;  5HI0 A;  4CDX C;  1ACC A;  2JDH A;  4ZXE A;  2E7T A;  4BME A;  5LAS A;  2RS1 3;  2H0B A;  1HQL A;  1IPK A;  1W6N B;  2RS3 2;  1AX1 A;  3GYD A;  3VBS C;  2OX0 A;  4RL7 A;  1GYK A;  4CDQ A;  4ES8 A;  3ZXD A;  1RUF 2;  2CGO A;  4Y26 A;  4A7K A;  2SBA A;  1XJA A;  3FJS A;  2XML A;  3KMH A;  3LOB A;  1JYW A;  1A6C A;  4GWM A;  1RUI 2;  3MEP A;  2KD7 A;  5F3C A;  4RA0 A;  1VLN A;  2BPA 2;  1W9T A;  4Q4W 3;  2ZHN A;  2DCJ A;  4XJU A;  2R07 1;  5GAL A;  3NKG A;  2BNO A;  2VCC A;  3ZXF A;  2RJL A;  3IDB B;  4C1X A;  4IDZ A;  2KA3 A;  4P14 A;  3AJY A;  1AUY A;  3LD8 A;  3AYE A;  3ACI A;  2P37 A;  1N1Y A;  4QAW A;  2RHP A;  4KU8 A;  3M2M A;  5JXI A;  1UMI A;  1GOF A;  2WII B;  1US3 A;  1DYP A;  2RM2 1;  4URA A;  1W06 A;  4HBN A;  1Q43 A;  5FZ4 A;  2CTV A;  1ZRC A;  1MS9 A;  2HWF 2;  2A7A A;  2ORZ A;  4E9K A;  1HB2 A;  3MI8 A;  4YNI A;  4XHX A;  3VN4 A;  4ZZ5 A;  4LE4 A;  2WJS A;  1DZR A;  2GMP A;  2L9L A;  3SQO A;  3ILR A;  5FZO B;  1UYX A;  5FO8 B;  5FPB A;  2WNV C;  2XJT A;  1N3Q A;  2W1W A;  3NV3 A;  4ITC A;  1JOJ A;  2AEZ A;  3ES1 A;  3VL8 A;  4KI5 M;  4O7X A;  5DUV A;  1QDO A;  5T55 A;  4BQ1 A;  4AVA A;  4K8R B;  4RR3 B;  3DPR A;  1OPM A;  2OPK A;  5KHG A;  1GQP A;  3PME A;  1L7R A;  3A23 A;  2E53 A;  4ZU4 A;  4ASK A;  4ERO A;  3WF4 A;  4Z8B A;  2OQ7 A;  2CWS A;  3FUQ A;  2VCM A;  4LQR A;  1L7Q A;  4IV3 A;  5FBJ A;  3WNK A;  3ZFF C;  1CPM A;  5FZO A;  2QJV A;  5JMO A;  3KGL A;  2A71 A;  1OLM E;  3IMN A;  4DRV A;  2J7M A;  4UFJ A;  1QWR A;  3WQ7 A;  1ZRE A;  1VB2 A;  1MS4 A;  2BER A;  2RS1 1;  2ARC A;  2RV9 A;  1O8P A;  2VVF A;  4H3W A;  2QQI A;  4RR3 A;  4AED C;  4HZF A;  3PL0 A;  4QQO A;  3UKN A;  4DNY A;  1UXZ A;  5L19 A;  4JRA A;  5FMD A;  3NNL A;  4IEQ A;  4UT5 A;  2ENR A;  1K5M B;  2JDY A;  3VKF C;  2XGX A;  1R09 2;  5CNA A;  1WKY A;  2BOI A;  2ERF A;  4PHZ A;  3V64 A;  2F4P A;  3VZN A;  2O1Q A;  4CRQ A;  2R0H A;  1FT9 A;  3RZK A;  1IPS A;  2AGS A;  2Q1F A;  3RJR A;  2EIC A;  4LO8 A;  1GZT A;  1U0A A;  4LBO A;  4Q4W 1;  3VDD C;  5C8C C;  1TE1 B;  1AXZ A;  3POJ A;  4FPH A;  5JSR A;  1OH4 A;  4YVS C;  2DUP A;  3DL3 A;  2ZGP A;  2QE3 A;  1UMH A;  1RUJ 3;  4ZU7 A;  5DAP A;  1K5M A;  3MO4 A;  4YZ5 A;  1OBN A;  2X10 A;  4NAM A;  4OZO A;  3WZ1 A;  3ZSL A;  2RS5 1;  1GWK A;  2JG9 A;  3OD0 A;  1S55 A;  1LHO A;  2IXH A;  5C3O A;  2ZA9 A;  3SIT A;  3WNX A;  2QUO A;  1AR7 3;  1JYT A;  4A7Z A;  4YM1 A;  1UOG A;  1W2U A;  4FPF A;  3I3D A;  4EQV A;  3AKR A;  2JKB A;  3K2O A;  5C33 A;  1RIN A;  4LXL A;  1UF2 C;  2Y34 A;  4BQ4 A;  1FMD 3;  5EWS A;  1ALY A;  1W8U A;  4Q4X 3;  3ZXA C;  3AVS A;  5FYV A;  2G9G A;  3ZDV A;  2QFE A;  1JHJ A;  4DY3 A;  1MQT A;  2GNT A;  1X9T A;  3E5U A;  4GH4 C;  2AEN A;  2Y6H A;  3O7O A;  4ATF A;  3E6D A;  2E33 A;  4WVM B;  3AK0 A;  4XFH A;  2EF6 A;  2DVD A;  5BXX A;  4JQT A;  1AYM 2;  5LBF A;  1SLL A;  1SAC A;  1QJX 2;  2LRO A;  3IDE A;  5F3E A;  3Q8A A;  2VOK A;  3AM2 A;  5A3M A;  1QJF A;  4NPL A;  2YU1 A;  5KC5 A;  1FAT A;  3VD9 A;  1BMV 1;  3LEG A;  3P1I A;  4HKL A;  4KU7 A;  3BI3 A;  1LHU A;  4OI0 A;  2VXJ A;  5J7M A;  4AQT A;  1LOA A;  4XJ8 A;  3VV1 A;  3BUC A;  1RB8 G;  2XL9 A;  1PX4 A;  1XB9 A;  3L2H A;  1AR8 2;  1NCQ B;  1N3O A;  4DXT A;  5C4W A;  5FO9 B;  1NAE A;  5A3U A;  2XKO A;  2OS2 A;  4PIZ A;  5A6Y A;  2OQ6 A;  5IFT A;  1OSG A;  1PK6 B;  2VTX A;  4NPM A;  2W1Q A;  5FP7 A;  2R32 A;  5F2S A;  5CG8 A;  4L97 A;  3T1L A;  1W2N A;  2GDF A;  2A75 A;  3F2Z A;  2JE7 A;  1C1F A;  2YV8 A;  2TEP A;  4TLF A;  4CSW A;  1SLA A;  4LTA A;  2FDG A;  3MFC A;  3PNA A;  1F15 A;  1ZBE 2;  3QOP A;  2VPV A;  1ND3 A;  4AZZ A;  1RUJ 1;  2ZX4 A;  2X53 S;  2ZHM A;  4QB1 A;  2Y6F A;  4XC9 A;  5C7G A;  1PK6 A;  4QX2 A;  2VOV A;  5ACA 2;  1H6X A;  2ZZQ A;  3N36 A;  1NUK A;  2QZ3 A;  4I02 A;  1ND2 B;  1Q5O A;  1MS8 A;  1AR7 1;  5B4N A;  4XUR A;  3LAG A;  2EIB A;  1DQ6 A;  5AFB A;  3H3L A;  2WDB A;  1PMI A;  1QOS A;  4PLM A;  1U12 A;  2RMU 2;  2VZV A;  3NAP C;  5F5I A;  4E27 A;  1MZF A;  4Y5Z 0;  1FV2 A;  3PJQ A;  1REE A;  1FMD 1;  1CAU A;  2VUD A;  4Q4X 1;  1PZ7 A;  2ZGN A;  2XL7 A;  2J42 A;  1GP4 A;  4NN0 A;  3WSO A;  2WO1 A;  4GMP 0;  1TG7 A;  1ZBA 2;  2C26 A;  2VNV A;  2ARA A;  5C9A C;  4XF1 A;  3OBT A;  2AZ5 A;  5EV7 A;  1ND2 A;  1JHN A;  3BOP A;  2NMO A;  3MZH A;  5IVJ A;  4RD7 A;  3THP A;  4IES A;  4CPB D;  2HYX A;  2XHN A;  4XDP A;  1QJU 2;  3QH7 A;  2Y0I A;  3NST A;  4XJW A;  5GLT A;  4LNV A;  1KD7 A;  5A1L A;  4E2S A;  4MGQ A;  1WA4 A;  3RZL A;  5L9V A;  3OCP A;  3HQX A;  1ZRD A;  3AKS A;  3WNO A;  4BK5 A;  1NCR B;  1TME 2;  2R04 2;  1CAV B;  3MLK A;  3CL1 A;  2R49 A;  4PLN A;  2VG9 A;  4IE6 A;  4QXK A;  4COU A;  4QKF A;  4L8Q A;  4EZ4 A;  4IER A;  2ZGR A;  3AKT A;  1WA6 X;  2NYY A;  2WQ4 A;  2PAK A;  3OBA A;  3B02 A;  4GB3 2;  1YJL A;  2ZTN A;  4KQ7 A;  3O1R A;  3GZU C;  3M3O A;  4OUS A;  3VBH B;  2OW4 A;  2X29 A;  1RUE 3;  4AAP A;  1NCR A;  2DUO A;  5HCA A;  1GWM A;  4FTB A;  1CAV A;  4B4R A;  4FPY A;  4YM3 A;  1LRH A;  4CCN A;  4XJZ A;  5M0T A;  2WS9 2;  4Z82 A;  2A3W A;  1O8S A;  2I2S A;  4QGN A;  5EZW A;  3SMH A;  4JZR A;  1FI2 A;  1VMJ A;  1EYB A;  4Q4Y 2;  4BIF A;  4AF9 A;  1M06 G;  4K3U A;  3IBM A;  3K51 A;  1E5S A;  3FBY A;  3W59 A;  4Z2W A;  2GND A;  4AK3 A;  1CPN A;  3N35 A;  1LTE A;  2P1B A;  3BPS A;  5FWJ A;  1DLL A;  3ITQ A;  3VBH A;  1X36 A;  1AJO A;  3DN7 A;  4BPZ A;  5FY8 A;  5LZ6 A;  2H6B A;  5KXD A;  1O6U A;  4WZC A;  1NY7 2;  4XFI A;  4V2V A;  4YLZ A;  4CDU B;  4LLO A;  4YSF A;  1WCK A;  1W9F A;  3I49 A;  2V4A A;  1W2O A;  4PT6 A;  3WNL A;  2DVB A;  4QPG C;  2EAK A;  3WLU A;  3LE0 A;  1RYY A;  4CDX B;  4LOT A;  2YG0 A;  3H3U A;  4TLG A;  2ZGQ A;  3U75 A;  4LBM A;  4OZX A;  4B1L A;  1MS1 A;  2X5I C;  2JD4 A;  1B35 C;  4HKW A;  4PQ9 A;  4BQW A;  1YLL A;  2BW8 A;  2XJQ A;  1VRH 3;  5A7O A;  3RPQ A;  4OI1 A;  3VBS B;  1F4A A;  1H8T C;  4AFA A;  4CDU A;  4EZH A;  2W68 A;  4QT6 A;  1KS5 A;  3HQU A;  3M3Q A;  4RHV 3;  4J1W A;  2J1T A;  1TMF 2;  5KXE A;  1L7L A;  1I9R A;  1AXY A;  2HBT A;  2BP6 A;  2A73 B;  2D3P A;  4H55 A;  1LU2 A;  1Y7B A;  5F5A A;  2ZX1 A;  4UBH A;  4CDX A;  4BMB A;  3ETQ A;  2PYT A;  2JEC A;  4IE7 A;  5HPO A;  3SH4 A;  3MDP A;  5LA9 A;  1LU1 A;  3VBS A;  3UGH A;  3T2P A;  3JXS A;  1IG0 A;  4P9J A;  4A44 A;  5GM0 A;  1POQ A;  5A3P A;  3L9J T;  3WP5 A;  1AYN 3;  4KWJ A;  2VNO A;  2ZPX A;  3RYK A;  2XVG A;  1RUE 1;  5FLI A;  2QZ2 A;  2A70 A;  2ARX A;  5IK4 A;  3W5N A;  3UYJ A;  1QEX A;  2IXC A;  5KXC A;  1UMZ A;  5CEH A;  4FPK A;  2QQL A;  4CP9 A;  2CAU A;  2ZCW A;  1CZS A;  2G9F A;  1O3T A;  1I5Z A;  1JUI A;  2PFW A;  5DUX A;  2K2S A;  4E4H A;  3I2F A;  3KGZ A;  3VHN A;  4HON A;  1W8Z A;  1BBT 3;  1SQ4 A;  2WNV B;  1PGS A;  5IHR A;  3AP6 A;  4XYX A;  4CCD A;  3SH3 A;  4EN7 B;  5CVR A;  1H30 A;  1RMU 3;  3M3E A;  3TN9 3;  2NMN A;  2JG8 C;  1XOY A;  2ZX0 A;  4CCK A;  4PCR A;  2WKK A;  1JH5 A;  1WLT A;  3LPG A;  4G9S B;  3KQR A;  2VC9 A;  3NQH A;  3SIS A;  3S6P A;  3DGT A;  1ZZ8 A;  1U5Z A;  1I5P A;  4YM2 A;  4FOQ A;  2WNV A;  1J1L A;  1QXJ A;  4NOT A;  2E6V A;  1NX9 A;  4OCT A;  1RED A;  2BNM A;  4NHX A;  4P9I A;  1OA3 A;  1QQP 3;  1VRH 1;  2V09 A;  5JOY A;  4XF4 A;  4RHV 1;  4XQW A;  4WZF A;  1RGS A;  4GD4 A;  5G05 L;  1RUD 3;  3ROU A;  4DEV A;  5HCH A;  2GAU A;  4HPK B;  3ZFF A;  2MEV 3;  2XBO 3;  3BKZ A;  3N9N A;  2PEL A;  1UY1 A;  2P17 A;  3NW4 A;  3TAY A;  4BM8 A;  5C8C B;  5FY0 A;  3VDD B;  5C3Q A;  2ARE A;  3J7M A;  4AED A;  3KHC A;  3SKV A;  2PA7 A;  3GJB A;  3P5B A;  3THT A;  4YVS B;  3RQ0 A;  3P3P A;  5C3S A;  4L92 A;  5F9T A;  4HKO A;  1EV1 3;  1NT0 A;  3M8L A;  2YGL A;  1GQH A;  1WWY A;  2HEV F;  2ZZJ A;  1UD1 A;  3T30 A;  1AYN 1;  1G9F A;  3KM5 A;  4HPK A;  2ZEW A;  4DZG A;  1BVV A;  1JZ8 A;  1QOO A;  2VQA A;  4G3Y C;  4NR1 A;  1O4Z A;  2XVK A;  4AFB A;  1QDC A;  5BNO C;  5C8C A;  3VDD A;  3JD7 2;  4Y5S A;  5A1A A;  2ZGS A;  4Q4V 3;  5D21 A;  2VMI A;  4YVS A;  3GBF A;  4YG3 A;  4RGA A;  2D40 A;  4ES9 A;  4M3C A;  1XYP A;  2NLR A;  1GFF 2;  3MIH A;  1RXG A;  3B94 A;  1BBT 1;  1EPW A;  1NYW A;  1ONA A;  4XIL A;  4GH4 B;  1QH6 A;  5I93 A;  4UFI A;  5I0D A;  1SLC A;  1XC6 A;  2E51 A;  3JQX A;  3NJZ A;  4GKX A;  1RUH 3;  2W95 A;  5FRE A;  2DYC A;  3WW4 A;  4A2U A;  3VD7 A;  4WVV A;  1RMU 1;  1YCI A;  4BIS A;  1DGW X;  1U5I A;  3VZJ A;  3J8F 3;  4JTN A;  5FFO C;  5FYU A;  5FMC A;  1BHG A;  3KT7 A;  3POW A;  4MZU A;  3PU3 A;  1H8V A;  2ZGT A;  3UET A;  1W6P A;  1YIF A;  2VQ0 A;  2XJU A;  1OA2 A;  2DCZ A;  3B69 A;  3DF0 A;  3OB8 A;  4HN1 A;  2DUR A;  2LAL A;  5JIA A;  4R4X A;  3HD8 B;  3WG1 A;  4GH4 A;  4YGB A;  4A4A A;  5ABJ C;  5IK5 A;  3EB7 A;  5L73 A;  1ZA7 A;  1CON A;  2OZ6 A;  3U1X A;  5B4X A;  3TYJ A;  1QQP 1;  4CU7 A;  4B4P A;  2VBB A;  2XQX A;  5E88 A;  2MHF A;  2A5Z A;  3SCF A;  4AI3 A;  1VBB 2;  4ZHN A;  1DQ5 A;  4CCE A;  1RUD 1;  2YY1 A;  2CGP A;  3N9Q A;  4XFG A;  1D2Q A;  1IG3 A;  2MEV 1;  4KGQ A;  5LK5 A;  1J3Q A;  2XBO 1;  2P3Y A;  1SMV A;  4H14 A;  5DZG A;  3SEE A;  2WAB A;  2BFU L;  5A70 A;  1QKQ A;  1XNB A;  4MXV A;  4YZ4 A;  3RZM A;  3IDA A;  4BLJ A;  1A8M A;  5K0U B;  5CG9 A;  4XBL A;  5FYT A;  3UJO A;  3VZM A;  3WR0 A;  2KR2 A;  3E5Q A;  2VQU A;  4R4Z A;  1GNY A;  2G1M A;  5CAZ A;  1Y9Q A;  4XJ9 A;  4JX0 A;  5T5P A;  4NII A;  1OA4 A;  1DBN A;  5FBZ A;  5C3P A;  3ZYI B;  3ZX7 A;  4KWL A;  5ABJ A;  1LED A;  5DAQ A;  2R1B A;  4NMI A;  4Q4V 1;  1LJ7 A;  1N3P A;  3VB9 A;  1V00 A;  5A33 B;  3MUZ 1;  5FR3 A;  3BTZ A;  4MGK E;  5C9A B;  4LR4 A;  2WO3 A;  1BEV 2;  2R1D A;  3JUU A;  3S5Q A;  1URX A;  1RUH 1;  4R9A A;  1V6N A;  1AR9 3;  4D3W A;  5JCT A;  1MAC A;  3LKJ A;  3H3Z A;  1TVG A;  1MVQ A;  2R07 2;  3AKP A;  4UFK A;  4GXL A;  3T4H B;  4CXX A;  3MW4 A;  1O5L A;  4AYU A;  2D6P A;  3NAP A;  5CKN A;  3NJX A;  2DU1 A;  2X05 A;  3J8F 1;  2C9A A;  3KS7 A;  4PQQ A;  1FOD 3;  3ZN5 A;  2VME A;  4IGO A;  1VAM A;  1SFP A;  1UW8 A;  1Q3E A;  4YW3 A;  5GLW A;  2ZEX A;  4CVU A;  1X9P A;  2YUE A;  1E57 A;  5FDB A;  3BU7 A;  4XUP A;  5C9A A;  5IVF A;  5LWB A;  2PHF A;  2VXR A;  1EP0 A;  4COY A;  5J1X A;  2YB7 A;  2Q1Z B;  2JDU A;  3POS A;  3H8O A;  2A3Y A;  3BVC A;  2EXI A;  1R64 A;  1FPN 3;  5FUN A;  1GZC A;  1WLC A;  4S2F A;  5C5T A;  4UW3 A;  1MS3 A;  3M1H A;  3OG2 A;  4M0H A;  2D6O X;  1NCQ C;  3ILF A;  3G7D A;  3WDW A;  1HJG A;  4UI9 L;  4GQ7 A;  3QLQ A;  4GAL A;  1S1A A;  2DCT A;  4K40 A;  3T3Y A;  4AFD A;  3KF5 A;  4JCK A;  4P9Y A;  1UWW A;  1OI6 A;  1P8J A;  1F8V A;  2XJV A;  3MV0 1;  1PIV 2;  2GNB A;  5EXO A;  3F95 A;  5IVV A;  2WFF 3;  4ZS3 A;  4DY5 A;  1UIJ A;  3DKQ A;  4LHS A;  3ST7 A;  4OI4 A;  2Z2S B;  2GU9 A;  5FJH A;  2RS1 2;  2XVL A;  2PHU A;  2VUL A;  3BIE A;  2P2K A;  1D4V B;  4P9L A;  1HN0 A;  3GZE A;  3NRU A;  4K20 A;  3CLP A;  1VBC 3;  2GC3 A;  4NHK A;  1UZW A;  1R1A 3;  1CX1 A;  1POV 3;  4OUL A;  1X33 A;  4XAB A;  5FXW A;  2UYA A;  2CL2 A;  2VQT A;  4AQ2 A;  1QGL A;  3HQR A;  1AR9 1;  4FP2 A;  4Q4W 2;  1KIT A;  4QPG B;  4TSV A;  2JDA A;  2D6N A;  3FX3 A;  4XFF A;  5FYS A;  2HWC 2;  1Y9G A;  1BYH A;  2FMD A;  3U4X A;  4F7Z A;  5IW0 A;  3OPT A;  4L0P A;  5D1I A;  1FOD 1;  1SZB A;  2VU9 A;  1B35 B;  2X5I B;  3ZDS A;  4F83 A;  4FP3 A;  2FZ1 A;  1ZZ7 A;  4NHL A;  1H8T B;  1Q8S A;  3D3A A;  2RS5 2;  1W9Y A;  3CJX A;  2C5D A;  4MHR A;  3J4U H;  1N1S A;  4JGZ B;  2GC2 A;  1J3R A;  4V1P A;  4N9H A;  1GZW B;  3Q9O A;  4QPG A;  1LR5 A;  3WY6 A;  4RS5 C;  4U36 A;  2JDZ A;  4DO0 A;  4P00 B;  1FPN 1;  5DAX A;  1OQD A;  4NUB A;  1WME A;  2BWC A;  2P34 A;  1B35 A;  1XSQ A;  2X5I A;  3ILN A;  3OSD A;  5FY9 A;  3QD6 A;  2W94 A;  3PUQ A;  4QHZ A;  1H8T A;  1N1T A;  1DIW A;  4IE4 A;  5HCF A;  3U14 A;  1W6M B;  4MSV A;  1RVF 3;  1F5F A;  2A6W A;  2VH9 A;  4GJZ A;  5GLV A;  3B00 A;  4P9X A;  1ZVF A;  4D7Y A;  4LE3 A;  2IZW A;  5FYM A;  1ZZC A;  3ZMO A;  4URT A;  1ASJ 3;  5AVP A;  2J1U A;  2Z4F A;  5FZB A;  4HK9 A;  1BMV 2;  2E32 A;  2B5H A;  1RC6 A;  2WFF 1;  3WG2 A;  2CDO A;  2W87 A;  5FV3 A;  5LK7 B;  1OKQ A;  2JX9 A;  1FAY A;  3OPZ A;  4X8N A;  4UYB A;  5CIS A;  3WNN A;  4LBQ B;  5IT6 A;  4DOU A;  2ZAB A;  1G6N A;  3LF7 A;  3PVO A;  4S2D A;  1UOB A;  5BNP C;  4MVT A;  2HEY F;  3FL7 A;  3MPB A;  1WLD A;  1W8W A;  1IGO A;  4FFG A;  5FP4 A;  2WWU A;  1VBC 1;  3N9L A;  4XQD A;  3VLB B;  4IXL A;  1R1A 1;  2HWD 2;  3LGR A;  1POV 1;  2B8M A;  3KHB A;  5DZF A;  1XE8 A;  4BU2 A;  3PDQ A;  3PIG A;  2WWJ A;  3MLJ A;  4M0N A;  4QKD A;  5DPN A;  4I0B A;  3L2Y A;  1J3P A;  4LBQ A;  4HVR A;  4UW5 A;  5J37 A;  3RZG A;  2ZX3 A;  1UX6 A;  1GR3 A;  1LHV A;  4FBF A;  1RUJ 2;  2QNK A;  3AZZ A;  2BVB A;  5IAV A;  2VE1 A;  3UT0 A;  4AVT A;  1RIT A;  2VZO A;  2JG8 A;  3AYA A;  2Y33 A;  1OHF A;  3ZYB A;  4LHK A;  3OBR A;  4BZ4 A;  5IAT A;  5C71 A;  2BV4 A;  5KBF A;  3RNS A;  4CU9 A;  2HKX A;  1VBE 2;  2LRP A;  5E8A A;  1QJY 2;  2GNM A;  2R06 3;  4OI2 A;  1VIW B;  2BJS A;  2ILM A;  3I3Q A;  1TNF A;  1HRI 2;  4XUT A;  5DUU A;  3DUI A;  5C6C A;  4H7L A;  4NRQ A;  4ZON A;  3FFQ A;  5DMY A;  3KV5 A;  5F2W A;  3CO2 A;  4KGG A;  2OXB A;  4YW5 A;  3C7G A;  1OLQ A;  3HIF A;  5JR2 A;  1W6N A;  1O3R A;  4M4R A;  4TYS A;  1RUG 3;  1ULG A;  1O5U A;  4P5Y A;  4XZP A;  3M4F A;  3OOX A;  1XE0 A;  4IL7 A;  2JE9 A;  4AI2 A;  4AWD A;  5A80 A;  3MHZ A;  5BNO B;  2VZ3 A;  1CIY A;  3R4U A;  3S57 A;  4MGY E;  4UW6 A;  2WQZ C;  3ECQ A;  1GSL A;  3I2D A;  3TEW A;  4OHY A;  2BOJ A;  2Q30 A;  2VVD A;  4QXH A;  1BZW A;  1UOF A;  2YC4 A;  4PBO A;  3WQ1 A;  1Q8P A;  4Q8K A;  1IS5 A;  4NAO A;  5BPX A;  5IK8 A;  1JW6 A;  3AMN A;  2PHD A;  3U0Z A;  2VJX A;  2ZGK A;  1D0G A;  3MGU A;  4HN0 A;  4PJY A;  4HK8 A;  3OJB A;  4GKY A;  3VD3 A;  2WT0 A;  4CE8 A;  2V73 A;  2D44 A;  4RFR B;  4EV0 A;  5BNO A;  5L7O B;  3TEY A;  2D3R A;  5TSW A;  5FZ8 A;  5DDJ 3;  3RSJ A;  4E2G A;  3HWJ A;  1U5Y A;  4CU6 A;  2FDI A;  3NV2 A;  4IE0 A;  1X82 A;  1HQW A;  3GGL A;  1W9S A;  4XFB A;  3N4M A;  5CB7 A;  4D6S A;  5H9R A;  3G6J B;  1PHM A;  3MUY 1;  4JDN A;  5ABJ B;  4N90 A;  4BCU A;  1DQ4 A;  4DIQ A;  5F3G A;  4QGM A;  4QGL A;  4P02 B;  3VZK A;  2GZW A;  4CCC A;  2XQR A;  2Y60 A;  4Y1Z A;  3VDA A;  1RUC 3;  1W3X A;  4IEV A;  1YEW A;  5LEK A;  3MFA A;  4YVW C;  1S0G A;  1EUT A;  3ZSE A;  4LUK A;  4LUM A;  2FD8 A;  1Z78 A;  4MHU A;  2MPF A;  1GMM A;  1OUX A;  3K75 B;  1W0O A;  5JVV A;  3EYP A;  2R06 1;  2NN8 A;  3WHT A;  3MLL A;  1F31 A;  4YZ2 A;  4XIO A;  3RI9 A;  2V5Y A;  2DUQ A;  2YXS A;  1LGB A;  3HNB M;  5BYN A;  4CP1 A;  4QPW A;  4LT5 A;  2C6S A;  2P5B A;  5K4L A;  1UNB A;  4PDW B;  1V9U 3;  1PVC 2;  3III A;  4QU2 A;  1V6I A;  5DG2 A;  1BVP 1;  2JJ6 A;  3PIJ A;  4O9E A;  1Z0H A;  4I0W B;  3GNE A;  1LES A;  4CUB A;  2AEY A;  3R05 A;  4RQP B;  1RUG 1;  2WA4 A;  3O5S A;  1HXS 3;  1W8T A;  2D3S A;  2AH2 A;  2O14 A;  3EQE A;  3OF1 A;  1DGR N;  1OT5 A;  2Q8C A;  1K5J A;  2VMC A;  4AHW A;  1RJ7 A;  3BGA A;  3AB0 A;  2R30 A;  2UUR A;  5JLV A;  4WVZ A;  1LOB A;  3WP4 A;  2ORX A;  1YI7 A;  1NLQ A;  2Q4S A;  4A41 A;  3PVN A;  4R9D A;  1MZ6 A;  3H0O A;  4EWD A;  3JBG 3;  3OGR A;  3PVB B;  3V0A B;  4HXC A;  3T0A A;  2J1V A;  5CYY A;  5I91 A;  5BUV A;  4B29 A;  5DDJ 1;  3TEX A;  2QQW A;  4HET A;  4JRL A;  4AFC A;  2XR4 A;  3NO8 A;  4N9I A;  3CEW A;  2ZHL A;  1PM4 A;  1DFQ A;  3AMP A;  4GAZ A;  3ZXG A;  1RUE 2;  4RN5 A;  3I3B A;  1UU6 A;  3IKW A;  4YGE A;  3V0A A;  5APA A;  4LHL A;  4XZU G;  1ZA4 A;  5T3N A;  1RUF 3;  3M3C A;  2JWP A;  1RUC 1;  5AC9 3;  3ON7 A;  4RYD A;  2B42 B;  1G86 A;  1DU3 D;  4KH9 A;  2XPJ A;  3OYW B;  4WVM A;  2HBU A;  5FZI A;  3MIE A;  4D7S A;  4NE9 A;  5FPV A;  4CXW A;  4XFC A;  2WZR 2;  1W90 A;  3ZO0 B;  3ATG A;  4OQ9 A;  3M70 A;  4CDW C;  5FZH A;  3BB6 A;  4M00 A;  5FZM A;  3D4K A;  5FZ0 A;  4TN7 A;  5A32 B;  4F8A A;  3POI A;  2DV9 A;  4QDR A;  2VOT A;  5FKC A;  1V9U 1;  3T1M A;  5F1R A;  1I1E A;  4NRO A;  1DZQ A;  3UV9 A;  5LY1 A;  2XUE A;  2ZXQ A;  1N47 A;  1AVB A;  1NCQ A;  3FHA A;  4MG2 A;  5FJK A;  1E5I A;  5K0U C;  1HXS 1;  2EXK A;  1W0N A;  2JB4 A;  1QJZ A;  4B3N A;  5JR7 B;  3FLR A;  2ETE A;  1JI6 A;  1HW5 A;  1WCU A;  2ZML A;  1VRH 2;  3U4S A;  4Z2A A;  2EIE A;  2I45 A;  2IVI B;  4KWU A;  3A7Q A;  4HSL A;  4Y22 B;  4NPR A;  4A7Y A;  4PI2 A;  4RHV 2;  4HG6 B;  4YPJ A;  1C28 A;  4C90 A;  1R08 3;  3CIH A;  3MBW A;  4GZ9 A;  2ZS6 B;  4NHY A;  2B4K A;  3GHN A;  3JBG 1;  4K1Z A;  2BNN A;  5FZ1 A;  4A3Z A;  1KDM A;  4BHP A;  3AJZ A;  3VBF C;  1LHW A;  4ISR A;  5FTT C;  1E5R A;  1OXC A;  1XBF A;  5DQ0 A;  3ZM8 A;  1W6O B;  1DQ1 A;  3AX4 A;  4DXZ A;  2VMH A;  4XF9 A;  1SBE A;  1AHS A;  1AYN 2;  3NWK A;  5JIU A;  2DBN A;  1OD3 A;  1C57 A;  1GAN A;  3BIW E;  1DP0 A;  4QDQ A;  2UWC A;  4W4Z A;  2XJP A;  3V56 A;  1FXZ A;  3BN6 A;  3NKT A;  1PGL 1;  4RS5 B;  1RUF 1;  2VEC A;  4MV2 A;  4DQA A;  4A45 A;  5AC9 1;  2Q5T A;  4E4D X;  4X6R B;  3KSC A;  2JE8 A;  1XE7 A;  3VKO A;  4IEZ A;  1RHI 3;  2XWJ B;  3R4S A;  4NIA A;  4QQP A;  3LEM A;  2W47 A;  3T0B A;  2D43 A;  4FQ4 A;  3DXT A;  1BBT 2;  4RFT 0;  1TQ5 A;  3D82 A;  3HT1 A;  4B1M A;  4XFA A;  5J48 A;  1UQX A;  5LBC A;  3D8C A;  3CJI C;  1YHF A;  1RMU 2;  3HAG A;  2WZP P;  4RS5 A;  1SDD B;  2BVV A;  2ES3 A;  2WC2 A;  3WXP A;  3HPN A;  4AHX A;  5L9B A;  2J1S A;  1VBA 2;  2VO5 A;  3I3M A;  5DAW A;  1GBG A;  4PLO A;  3E1F 1;  2VAU A;  3UL2 A;  3TEZ A;  2W2I A;  1V6O A;  3NNF A;  1S0E A;  3AYC A;  1YUD A;  3K77 A;  4N8M A;  4Q1P A;  2IXL A;  3LA2 A;  2ZX2 A;  1UXX X;  1DHK B;  3HOB A;  4IEY A;  2K9Z A;  1QQP 2;  2FCU A;  5FO7 B;  4K21 A;  5BNP B;  4XUN A;  2P4E A;  5IUQ A;  4ET7 A;  3DV8 A;  2PXJ A;  2PQS A;  1RUD 2;  1APN A;  1KDK A;  2BGC A;  2GN7 A;  3AP4 A;  4LA2 A;  4QD2 A;  3WCS A;  1R08 1;  2MEV 2;  2XBO 2;  2QBX A;  4LMF A;  1BK0 A;  3GDB A;  2FZ2 A;  2P3I A;  4XAE A;  5A3L A;  5FYZ A;  2WNO A;  4JDO A;  1F4H A;  1VMH A;  2GC0 A;  4XBN A;  4OQ8 A;  1H9W A;  3E6C C;  5BNP A;  1AF9 A;  4JHT A;  1LUL A;  1XNA A;  2QQO A;  2VW1 A;  3USS A;  2D5H A;  5DAB A;  3PJY A;  4YFZ A;  2KM2 A;  3WDT A;  1AR8 3;  4G4F A;  3DEC A;  3W21 A;  5JI9 A;  1NG0 A;  4DXS A;  2WUH A;  1YJK A;  4ASM B;  1CQ9 A;  4LBN A;  4B4Q A;  1WW6 A;  3ME2 A;  4JGZ C;  3RMX A;  5C3R A;  1IQD C;  4FPE A;  4JGY C;  3WP3 A;  5ANN A;  1RHI 1;  1AX2 A;  1LAJ A;  2PN5 A;  3U07 A;  4AE2 A;  4XPV A;  3MYX A;  4GJY A;  1UZ0 A;  2QTW B;  4MXW B;  1OVP A;  2X09 A;  2RJK A;  4UWD A;  5BY5 A;  1RUH 2;  2AC1 A;  2QQP A;  5E89 A;  1IPJ A;  1VMF A;  2BU9 A;  3HMY A;  3I97 A;  1J59 A;  1CAX B;  3BTA A;  2JDK A;  4LO6 B;  1JZ2 A;  3I2I A;  4XEZ A;  3J8F 2;  2W91 A;  5ACA 3;  4LOS A;  5JZG B;  4LBJ A;  1H1A A;  1OMI A;  4EN6 B;  3HNM A;  2DCK A;  4LIT A;  4WV8 A;  3NNJ A;  2BUK A;  3V65 A;  1HV1 A;  3NMB A;  4MXW A;  3IN9 A;  4Z1V A;  5FZL A;  2HH9 A;  4LKF A;  1VBD 3;  2WNU B;  3A0N A;  3ZIX A;  2VD7 A;  1JZ6 A;  4E2Q A;  1JUH A;  3INA A;  5KC6 A;  3RWK X;  1F5J A;  3LZZ A;  2IC1 A;  2W52 A;  2XWB B;  1NQJ A;  4FFH A;  3LA7 A;  3OUJ A;  3S7E A;  1STM A;  1LNS A;  2ZEZ A;  1AL2 3;  5E6H A;  1UO9 A;  4EN0 A;  4XE9 A;  3USU B;  2HWB 3;  3IB3 A;  1HQN A;  4YW7 A;  1V6K A;  5FPL A;  5DG1 A;  1AL0 G;  4K6B A;  2CGN A;  1BCX A;  2BEO A;  2WNU A;  5LEJ A;  4AVS A;  3BU0 A;  1SLI A;  1QJU 3;  4D6R A;  1DDL A;  2QQM A;  1NE4 A;  4Y4Y A;  2YDE A;  1C5H A;  3AL5 A;  4DXR A;  3HN1 A;  1K12 A;  1JU4 A;  4A3X A;  4ZKT B;  3LPF A;  3ZN6 B;  3USU A;  2QKD A;  4AR2 A;  2ARB A;  2C1F A;  2LM3 A;  2K0G A;  2MNG A;  1AR8 1;  3ALQ A;  4OYU A;  5DAV A;  1CZV A;  1NLS A;  4YVW B;  3PTY A;  2R04 3;  2VTX J;  3C3V A;  2E26 A;  5EYY A;  5FZ9 A;  4Z07 A;  1OQE A;  4KBB A;  3ZFE B;  2B46 X;  4IEO A;  1OFN A;  4IEW A;  1WW5 A;  2RDN A;  4QXC A;  1OKO A;  3I59 B;  2IFR A;  4E4S A;  5K9Y A;  2VW2 A;  2OUJ A;  1KRI A;  1J58 A;  3GBW A;  4YVW A;  2RDS A;  1AR9 2;  2ZJC A;  3THC A;  2AAC A;  1J1T A;  4LHN A;  3C7H A;  5B2G B;  2RR1 3;  5JXG A;  4HVO A;  1ENS A;  2P6C A;  2R0F A;  2RVA A;  1FOD 2;  5ACA 1;  1GLH A;  1DGR A;  3OY8 B;  4LK7 A;  4TWT A;  1A8D A;  2BRT A;  4JVA A;  1PNG A;  4PIX A;  3ZPO A;  3I2K A;  2NZ9 A;  1VBD 1;  2YFU A;  4KNC A;  4MO3 M;  3I2H A;  2A1X A;  5GLZ A;  3W20 A;  1OQ1 A;  5IK7 A;  3WNP A;  2UWA A;  3LWC A;  1FPN 2;  1O7F A;  1ZX5 A;  1UYP A;  1NLR A;  1Q8V A;  2WSV A;  1W03 A;  3KQ4 B;  4EE2 A;  4QWN A;  1AL2 1;  3K3N A;  4IV1 C;  1OF3 A;  1ULO A;  4BQ5 A;  1IS4 A;  2HWB 1;  3FLT A;  1AJK A;  4ZPI A;  4QB6 A;  3SLI A;  3H1M A;  5L7O C;  1RJ8 A;  5FY7 A;  3POY A;  2HLE A;  3ELN A;  3TN9 1;  1N1V A;  4QMA A;  3W5M A;  3ZXL A;  1RIR A;  3VZL A;  1QJU 1;  4LEJ A;  3UES A;  2VOX A;  1RL3 A;  1AR6 3;  3LOI A;  4OFG A;  3WOG A;  2ADE A;  5E1R A;  3ZFG C;  4QX7 A;  3I4I A;  4XF3 A;  3GCW A;  1W8O A;  4FI9 A;  5IWF A;  4NRM A;  1EUU A;  3TNQ A;  2WN3 A;  3MW2 A;  3ORJ A;  5D8A B;  5FZ7 A;  3ZYJ B;  3BTY A;  4YG0 A;  2R04 1;  2NPI A;  4RSU A;  5EJ3 A;  3VBR C;  2BTV C;  2ZGL A;  4XBQ A;  5FUP A;  4XUO A;  3VHO A;  1UY4 A;  4CDW B;  3P6B A;  3SCG A;  3N3H A;  2ET7 A;  4K7J A;  4N7U A;  1VBC 2;  3MIC A;  3ACF A;  4O65 A;  1Y3T A;  1R1A 2;  3KV4 A;  1MEC 3;  2BQP A;  1PO2 2;  1D4M 2;  4L2N A;  3KV9 A;  4XAA A;  3TNP B;  2CWM A;  1VE0 A;  1ZYB A;  4BYY A;  4UFL A;  2G19 A;  2D93 A;  4MAD A;  2QQU A;  4PDW C;  3PLQ A;  4K8F A;  2RR1 1;  5DN2 A;  1EV1 1;  3RGB A;  2VBD A;  4CDW A;  3ZKU A;  4YZ3 A;  3MV1 1;  4HT1 T;  4YW1 A;  3CZU A;  4RQP C;  1Z7S 3;  1CWP A;  3LDR A;  4K1Y A;  2E63 A;  1YQ5 A;  1GKB A;  1FYU A;  1WBF A;  2JXA A;  5BNN C;  3ZPY A;  3K4D A;  2WO2 A;  2WZE A;  3O1O A;  3N7M A;  3IWZ A;  5K0U A;  1XU2 A;  4IW3 A;  3WIN E;  3V0B B;  1IKP A;  2JD9 A;  1TNR A;  3NJV A;  2PMW B;  3S30 A;  3VBF B;  1C3H A;  5JMC A;  1G9B A;  3ZSM A;  1CZT A;  4IQP A;  3I3E A;  5A3N A;  1BJQ A;  4EJR A;  1H2M A;  3AZX A;  1JYX A;  1MVE A;  4LKS A;  1PZ9 A;  4QQ2 A;  1X8E A;  5I0S A;  1V70 A;  5FLJ A;  1UL9 A;  3PVE A;  1XRU A;  1OC1 A;  1YQ8 A;  2XHK A;  4QQH A;  2ZBJ A;  3FWE A;  2YRO A;  4ISQ A;  1NE6 A;  5IVC A;  1OD5 A;  3CKH A;  2O8O A;  5A33 A;  1AR6 1;  2W39 A;  2TUN A;  1XYO A;  3VBF A;  3DYM A;  2J1A A;  4FXK B;  5SV8 A;  4GIQ A;  2E7Q A;  3QBQ A;  2XLA A;  1JYV A;  3ZSK A;  1COV 3;  3BTX A;  4W6W A;  2RM2 2;  3HNY M;  5FZA A;  1FNZ A;  3CF6 E;  3RDI A;  2QQN A;  3C2U A;  5CFC C;  1CX4 A;  3LEI A;  3H42 B;  1LKN A;  1W2T A;  4KL1 A;  1AXK A;  1UPS A;  3MIB A;  2IXI A;  5A7P A;  3CJI B;  4CZS A;  1UU4 A;  1K3I A;  2YYO A;  5JDB A;  2RDR A;  3QH6 A;  1S0D A;  4Y24 A;  2WQ8 A;  4B7E A;  4XET A;  1MEC 1;  5L9R A;  2X8K A;  4CUA A;  4HVQ A;  1C4R A;  1O3S A;  1EAH 3;  1SHW B;  3AMQ A;  1HDK A;  5KHH A;  5I0T A;  5I8T A;  2B7Y A;  3FHI B;  1SG3 A;  2Q8O A;  4V2W A;  3JD7 3;  3GCX A;  5FQ0 B;  3CJI A;  2Q0A A;  4M3C E;  2OVU A;  2B39 A;  1Z7S 1;  4XAC A;  1VJ2 A;  1LOF C;  1YFU A;  3H1Y A;  1SPP B;  1WMD A;  5LA2 A;  1PMH X;  1S2B A;  1GZ9 A;  2Y38 A;  1XYN A;  4QKB A;  3IZO A;  2GC1 A;  5FKB A;  3SCH A;  2JIG A;  3N7L A;  4WVW A;  1IHM A;  2UWB A;  3EJK A;  3PUA A;  1W9W A;  1JOP A;  1YQ6 A;  3WF0 A;  3MPP G;  5FQ0 A;  4IGP A;  2EIG A;  2VNG A;  3ZYG A;  2PLV 3;  3URF A;  1VAV A;  4JKK A;  1SPP A;  3SHR A;  4QPI C;  2BFU S;  3VBU B;  3D5O A;  4JHZ A;  4NHM A;  3ZLI A;  4JTO A;  4Y4R A;  5FZG A;  4XQ4 A;  4LIU A;  4Q0U A;  4YW6 A;  4AVV A;  4DRR A;  2K46 A;  2ZGO A;  4CP2 A;  2I07 B;  3AKQ A;  4M01 A;  3RVH A;  3N7K A;  1ODN A;  3J7L A;  3PMS A;  1MR5 A;  2BGP A;  4MUV A;  5EHD A;  3O12 A;  1COV 1;  4LKD A;  4E8C A;  1UY3 A;  4JGY B;  5F39 A;  2VOW A;  2TBV A;  1EPZ A;  4LBL A;  4AQS A;  4C0B A;  3AP5 A;  1I6X A;  5FZK A;  4BLI A;  1WGP A;  4BXF A;  2ZGM A;  3FUO A;  4NIH A;  3R6S A;  4AXO A;  5FUI A;  3POE A;  5FXZ A;  3AVR A;  3POG A;  1QNY A;  1VP6 A;  2JIJ A;  3PU8 A;  4CEW A;  4LBQ D;  1UYZ A;  4JGZ A;  3KWV A;  4JGY A;  1EAH 1;  1CVN A;  4XIK A;  1UN1 A;  1GZW A;  2VUA A;  4Y5T A;  5F32 A;  4ZY9 A;  4C8D A;  2VR4 A;  3JD7 1;  4AI0 A;  1JN2 P;  3OGJ A;  4LBK A;  4EWA A;  1W8H A;  2XXZ A;  5CKQ A;  4CYD A;  4CEY C;  5T50 A;  4BQ2 A;  1T6G C;  1DQ0 A;  5HV4 A;  1RUC 2;  3HN3 A;  3OUI A;  3H8U A;  1OLM A;  1PGW 1;  1W6M A;  2VZU A;  4QXB A;  2WYF A;  1WCD J;  4D7T A;  1LOG A;  4WM8 B;  3T2T A;  1BEV 3;  1ENR A;  2XDV A;  1OOP C;  2WNE A;  3NVC A;  1LEN A;  2VCB A;  4OHW A;  5FP8 A;  1FV3 A;  5H9S A;  5A7Q A;  1MS5 A;  2R07 3;  4TTG A;  2GH2 A;  3K3O A;  3NL1 A;  1TZO A;  1WCS A;  2QQK A;  3OGS A;  1IQA A;  5F8P A;  3UGG A;  3VGI A;  5C70 A;  1ZRI A;  1WCQ A;  1POV 0;  1DCS A;  4R52 A;  2J1R A;  1Y43 B;  1V9U 2;  1XNC A;  1F2N A;  2PLV 1;  3EHK A;  4UF0 B;  2ZHK A;  4ATE A;  3JU9 A;  4FVV A;  1NA1 C;  1OPO A;  5KHJ A;  3O1V A;  4M3C F;  1CIW A;  2XB6 C;  5T5O A;  1C8N A;  2UY8 A;  2UY9 A;  2B45 X;  3KB5 A;  4J1X A;  5F6K A;  4ARX A;  2WZ8 A;  2BWA A;  2HYK A;  1YWK A;  3LQC A;  5JWP A;  5FWE A;  3HJR A;  4AQ6 A;  5FY5 A;  2Y8K A;  1AR7 2;  4R9B A;  4XMA A;  4XJA A;  1JU3 A;  2W1S A;  3OPW A;  4UF0 A;  3RRD A;  2IXJ A;  4WBB A;  2VVE A;  4P5H A;  1W3V A;  2D6K A;  3OEB A;  2WAO A;  3JBG 2;  1QMJ A;  1FMD 2;  2A3X A;  2DU0 A;  3AXE A;  4Q4X 2;  3WNM A;  1IS6 A;  1U5X A;  1VAL A;  1OF4 A;  4SBV A;  1VB4 A;  4OUE A;  3JZV A;  4ZZ8 A;  1C8M 3;  5FZF A;  1PIV 3;  1YIP A;  3IT8 A;  4XTM A;  1O4T A;  1WW7 A;  2HWE 3;  1RVF 1;  1UZV A;  4Q27 A;  2PHW A;  5LB6 A;  4OHZ A;  5CFD C;  1UZY A;  2EVX A;  3R4D B;  4HSJ A;  1S0F A;  2J1E A;  3B01 A;  1ASJ 1;  4Q0Q A;  2WLQ A;  2YMZ A;  5FYI A;  3CNA A;  4HLT A;  4W50 A;  5LA1 A;  5JZG C;  4FSJ A;  3C8X A;  3RI8 A;  3ZYF A;  1Y4W A;  4Q0V A;  5J98 B;  2C24 A;  3M7A A;  4W6X A;  5AC9 2;  1QXR A;  3KLS A;  5JOW A;  3POB A;  1H0B A;  4XCB A;  4P9G A;  5T54 A;  2D6L X;  2WNU C;  4YW2 A;  1KFU L;  3AZV A;  4W8J A;  3VKN A;  5KXB A;  3FZ3 A;  2PAM A;  1BEV 1;  4IV1 B;  2VZR A;  2EID A;  1HN1 A;  1UAI A;  3E97 A;  1KEX A;  5EP9 A;  3QCW A;  3H7J A;  2F6B A;  2HWC 3;  1HRV 3;  4W6Y A;  2HJI A;  1HB1 A;  4Q5O A;  4PF1 A;  1X50 A;  5I8S A;  3FE5 A;  3H8R A;  1ZM1 A;  3WG4 A;  1ZRR A;  3OEA A;  5HV0 A;  4D6Q A;  3ZFG B;  2RS5 3;  3KV6 A;  1LB2 A;  5F37 A;  3O1T A;  3S0M A;  1WBL A;  3D6E A;  4IE5 A;  1SFY A;  2WFP A;  4CCO A;  4IV1 A;  1H1I A;  1WLW A;  3DPR B;  4TXW A;  4BA6 A;  2OZJ A;  2PHT A;  2YZ4 A;  3ACG A;  1ODM A;  5IVE A;  2Q1M A;  5JOX A;  4UW4 A;  2QCS B;  4LPL A;  5L7O A;  5EIY B;  1JOB A;  2J22 A;  3VBR B;  3WDU A;  2ZOE B;  3ACH A;  4NJ4 A;  4DS0 A;  4JAA A;  4I0A A;  4IV3 B;  1S0I A;  3E5X A;  4PBP A;  3PUR A;  4IET A;  4LO7 A;  2DTY A;  2ZEY A;  3ZFG A;  3AMM A;  2YPD A;  3TOJ A;  3ZFE C;  1W04 A;  5DZE A;  1R08 2;  2W08 A;  4A6S A;  4KG8 A;  1H1M A;  2OA2 A;  2JEN A;  2DWR A;  2VW0 A;  3WF3 A;  1Y9M A;  2YC2 A;  1W6Q B;  2VMF A;  5JOZ A;  3VBR A;  4YYO A;  4AVC A;  1C8M 1;  4YM0 A;  1PIV 1;  2JDP A;  1AZD A;  1YQ2 A;  4XDQ A;  1WMX A;  5EQU A;  3WP6 A;  1XSR A;  2HWE 1;  4BOW A;  4FTE A;  1YFY A;  5A7W B;  5KWR A;  2Z5W A;  4I2O A;  1DYO A;  1AX0 A;  3LEK A;  3H50 A;  4P9W A;  4X8P A;  4BH9 A;  1W8N A;  4BIO A;  1YXW A;  3FN9 A;  4IGQ A;  2ZAC A;  4XCA A;  4CA9 A;  3OUH A;  3KCC A;  4DB5 A;  5BNN B;  3Q8F A;  3A0K A;  1W6Q A;  4IEP A;  2IXK A;  3DYP A;  4Q2F A;  4PDW A;  4AHY A;  4NO4 A;  3VL9 A;  4LUL A;  1BQP A;  3KCY A;  4QM8 A;  3JCI A;  3H1W A;  2HWD 3;  2JG9 B;  2O8Q A;  1RHI 2;  5A7W A;  2BDR A;  2C9K A;  4BQ3 A;  3PUI A;  3LFI A;  4H2A A;  4RQP A;  5FAX A;  3E6B A;  1WD4 A;  2YHJ A;  3KF3 A;  4CCM A;  4GUL A;  1DGW A;  3RWN A;  1HRV 1;  2HWC 1;  5FPA A;  3JQW A;  1PO1 3;  4BQX A;  5BNN A;  1JBC A;  1G8W A;  4I01 A;  5EJ1 B;  1V6J A;  4NID A;  5HXV A;  3VUO A;  3IPV B;  1MQT B;  2ATF A;  4LKE A;  1F9K A;  2Y6J A;  4XDO A;  3IIA A;  2E31 A;  4A42 A;  3MIG A;  1DF0 A;  1QOT A;  2RS3 3;  5T52 A;  5J36 A;  1V6L A;  4M4P A;  3M3I A;  1W2A X;  4FPO B;  1VBE 3;  2DVF A;  1H2L A;  2YC0 A;  1QJY 3;  2GN3 A;  3DEM A;  2YGM A;  1XNT A;  3PUH A;  4JKM A;  1GQG A;  4QX5 A;  4Y1Y A;  3VKM A;  5CFC B;  4FFI A;  1HRI 3;  3MID A;  2W3J A;  3AYD A;  4GA9 A;  5LRS A;  5D8A C;  4AI8 A;  3WQ0 A;  1RUI 3;  4GMP 3;  4QPY A;  3IPV A;  4XF0 A;  1K42 A;  3H8X A;  3IMM A;  4HFS A;  1GNZ A;  2ID4 A;  3B5L B;  5FK8 A;  3K46 A;  4H7M A;  4LO5 B;  3WUC A;  2RG4 A;  3D0J A;  4U2A A;  3CDZ B;  5F5C A;  4N53 C;  5KR7 A;  4DUW A;  3LB9 A;  1ULP A;  5FOB B;  4BJ0 A;  2NM1 A;  5C4W B;  1UIK A;  3SKJ E;  3LIG A;  4OLL A;  4Q26 A;  3BYW A;  3HEI A;  1OUS A;  3BOW A;  3U78 A;  5CFC A;  3GM8 A;  3NNM A;  3NV1 A;  1SBF A;  2VM9 A;  4S2H A;  4C91 A;  5BNQ A;  1NQD A;  3OYW A;  3I8T A;  4JKL A;  4MET A;  3T08 A;  1KXG A;  4EN8 B;  2PAE A;  3VZO A;  1YI9 A;  2VGD A;  5CU1 A;  2PHR A;  4XW3 A;  4UXA A;  2AR6 A;  2HWF 3;  1MZ5 A;  1R1Z A;  4WM7 C;  2EAL A;  1ZZ9 A;  2V72 A;  3I2J A;  4ARY A;  1UY2 A;  4QM9 A;  1G9A A;  1C5I A;  1SFN A;  4XTP A;  5A32 A;  1ND3 B;  5AFE A;  2FMY A;  4AGV A;  2EA7 A;  4UFH A;  3B93 A;  1O4Y A;  2A6Y A;  2CHH A;  2HWD 1;  1XPW A;  1NOV A;  4PIY A;  4OHX A;  4AEK A;  2Z42 A;  1UKR A;  1YRZ A;  3LIH A;  4AGG A;  3EMR A;  4CCJ A;  1LOF A;  3C7F A;  1IOA A;  3Q8C A;  2PHL A;  4JV4 A;  4QX8 A;  4RGG A;  3ZSJ A;  4QPI B;  1LOC A;  3WUD A;  3SH5 A;  1H4G A;  1PO1 1;  5KHK A;  1O59 A;  4Q0P A;  1CAU B;  4Y22 A;  3RMY A;  1I3H A;  4JC1 A;  5K7P A; 
#chains in the Genus database with same CATH homology
 5FXV A;  5FZ9 A;  3DXU A;  5A7N A;  3N9P A;  5F3I A;  3PTR B;  4QXB A;  2OT7 A;  2YU2 A;  2OS2 A;  2W2I A;  3LD8 A;  2OQ6 A;  2Q8E A;  5IVC A;  4CCL A;  4LIV A;  2GP5 A;  2XDV A;  3NJY A;  4QXC A;  5FP8 A;  5FP7 A;  5F2S A;  5A7W B;  5A7Q A;  4URA A;  5FYY A;  5FXX A;  5FZ4 A;  3K3O A;  5A7O A;  5IVV A;  4EZH A;  4IGQ A;  4GAZ A;  5A3W A;  4CSW A;  2Q8D A;  4BIS A;  2PXJ A;  5FZA A;  5FJH A;  2YBK A;  5FZO B;  4QU1 A;  3AL6 A;  3KV5 A;  5FZC A;  5FYU A;  5F2W A;  5FPB A;  4UF0 B;  2GP3 A;  3PU3 A;  5F5A A;  5FY4 A;  5A7S A;  5A7P A;  5FYZ A;  5A7W A;  3ZPO A;  5FPU A;  5FZI A;  4ASK A;  5FPV A;  4CCM A;  5FYH A;  5A80 A;  5A3P A;  2OQ7 A;  3N9O A;  5FPA A;  5FWE A;  5FXW A;  5F5I A;  5LY2 A;  5FBJ A;  5FZH A;  5FY5 A;  4QXH A;  5FZO A;  4QWN A;  4V2W A;  5FZM A;  5FZ0 A;  3PUS A;  4TN7 A;  5FYS A;  3K3N A;  3OPW A;  4UF0 A;  5A3N A;  5IW0 A;  3OPT A;  3N9Q A;  3UYJ A;  5LY1 A;  2XUE A;  4HOO A;  4XDO A;  2YBP A;  5FY7 A;  4Y33 A;  5CEH A;  5FJK A;  5A1F A;  5FZF A;  4AI9 A;  5FZE A;  5FZ8 A;  5IVJ A;  5FYC A;  4HON A;  4GJY A;  4QX7 A;  4DO0 A;  4Y3O A;  4XDP A;  3U4S A;  5FYT A;  3PUA A;  5IWF A;  5IVY A;  5FY1 A;  5FP9 A;  4NUB A;  5FYI A;  4D6S A;  5A1L A;  4IGP A;  5FYB A;  5FZ7 A;  5IVB A;  5FY9 A;  4DIQ A;  4CUG A;  3PUQ A;  5F3G A;  5F5C A;  5KR7 A;  4CCK A;  5FZ6 A;  5ANQ A;  2YBS A;  5FUP A;  5FZ1 A;  4LIT A;  3ZLI A;  4GJZ A;  4Y4R A;  5FZD A;  5FZG A;  4LIU A;  3U78 A;  5FYM A;  5FZL A;  3KV4 A;  4EZ4 A;  3RVH A;  2VD7 A;  3KV9 A;  5ISL A;  5FZB A;  3LDB A;  3K2O A;  5FZ3 A;  4LXL A;  5F39 A;  5FV3 A;  5E6H A;  4AAP A;  2P5B A;  1VRB A;  5K4L A;  4EYU A;  4GD4 A;  3AVS A;  5FYV A;  4D6Q A;  3KV6 A;  5F37 A;  5FZK A;  5FPL A;  4IGO A;  4CCN A;  4BXF A;  4CCO A;  3N9N A;  5A3T A;  2OX0 A;  5IVE A;  5FP4 A;  2WWU A;  5FY0 A;  5FXZ A;  4E4H A;  3N9L A;  3AVR A;  5IVF A;  5LWB A;  3KVB A;  3PU8 A;  4CCJ A;  4D6R A;  5LW9 A;  3DXT A;  5F3E A;  2XML A;  3N9M A;  3AL5 A;  4QX8 A;  2Q8C A;  5FWJ A;  4BU2 A;  2YU1 A;  3PDQ A;  2WWJ A;  5FUN A;  5F3C A;  3PUR A;  5F32 A;  4C8D A;  5FP3 A;  5FY8 A;  2YPD A;  3KVA A;  2XXZ A;  4V2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...