2QQKA

Neuropilin-2 a1a2b1b2 domains in complex with a semaphorin-blocking fab
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
568
structure length
541
Chain Sequence
PCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVYAPEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSMLYIKFTSDQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDLYDWLDIWDGIPHVGPLIGKYCGTKTPSELRSSTGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEWSPSAARLVSSRSGWFPRIPQAQPGEEWLQVDLGTPKTVKGVIIQGARARAFVRKFKVSYSLNGKDWEYIQDPRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural studies of neuropilin/antibody complexes provide insights into semaphorin and VEGF binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Neuropilin-2
total genus 122
structure length 541
sequence length 568
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00431 CUB CUB domain
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2qqkA03
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2qqkA04
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 2qqkA02
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 2qqkA01
2VMFA 3FN9A 1GOFA 3UNPA 4CU8A 3C7EA 3F2ZA 3SKJE 2B4KA 2W1UA 3ACFA 3T2OA 1LNSA 5DMYA 1GOHA 4MGQA 1D7PM 3LPGA 2J1VA 1ULPA 5J1XA 1NT0A 1W9TA 2BZDA 1GMMA 3HNBM 3WNNA 3WNPA 4A6OA 4M4PA 1RYYA 2W92A 1H6YA 2E31A 3LEIA 2WNOA 1I5PA 4XURA 3W5NA 3VD4A 4CUCA 5B4XA 2WN2A 3NJVA 3K77A 3KQ4B 3OGRA 3LPFA 3JXSA 2J1RA 4P5YA 4CU9A 2ZEZA 1KGYA 3HJRA 4A45A 4LORA 4GWIA 1GU3A 3ETPA 3OB8A 3C8XA 4UI9L 2WDBA 3WF3A 3ECQA 2HLEA 2V4VA 4JHZA 2RV9A 2X05A 1DP0A 1OH4A 3DYOA 2J22A 4P00B 1PX3A 3I2HA 3T0DA 2VL4A 4OYUA 2E33A 1NUKA 1JU3A 4LOTA 1W8NA 1O8SA 1SG3A 1T2XA 5DPNA 3WF4A 2KD7A 2VZ1A 2WN3A 2W87A 3E1F1 3I2JA 2VMDA 4QDSA 2EIBA 4PQQA 1F4HA 3T0AA 3VDCA 5JXHA 5LA2A 2VZQA 4GWJA 2QQMA 2VZPA 4BK4A 4PF1A 3T0BA 4W50A 1NX9A 2XONA 3OGVA 3BN6A 5CYYA 1US3A 1P8JA 1K12A 3CZJA 5CKQA 1PMHX 1WCQA 1IQDC 1J83A 2VQTA 2ORXA 2LW8A 1SPPA 2QQNA 5EIYB 2VMEA 3ACIA 3A7QA 3WEZA 2QQLA 1DLCA 3ABZA 1OF4A 1SZBA 3T09A 3C7FA 2WO3A 2DCJA 2ORZA 4XUOA 3LQCA 2WABA 3THCA 5JR2A 5IYYA 1R64A 3FHAA 4KI5M 1UYZA 2QQKA 4W4ZA 4ZY9A 1NZIA 2W1QA 3CMGA 4XVHA 4W8JA 5LA1A 1O59A 2HYXA 2QQIA 4AAXA 2W9XA 4P08A 1JHJA 1JZ8A 4JKKA 3WF0A 2W94A 2R7EB 4BDVB 4YPJA 1UY2A 3GM8A 4DUXA 3HPNA 2VCAA 2RJ2A 4XUNA 3DYPA 3OEAA 3VD7A 5C7GA 5A1AA 1UY4A 1UMIA 1UY3A 1EUUA 1JZ4A 4E8CA 3POJA 5CZKA 2XQXA 3WQBA 1JI6A 1JZ7A 4QB1A 4QDQA 4RN5A 2J1EA 2W3JA 3VDAA 2ZEYA 4KWUA 1NKGA 3BGAA 2BGOA 1UXXX 1W9SA 2CDPA 3POFA 4DXRA 2VMCA 3A22A 2PQSA 4QB6A 1SHWB 4IUGA 3ACHA 2W47A 3T2QA 4PT6A 3WF1A 4ARYA 2DCKA 1PX4A 2J1UA 3SEPA 1UXZA 2V72A 4CU7A 3IB3A 1TG7A 3FHQA 2BGPA 3DYMA 2C4XA 3POIA 3AC0A 4BXSV 4OMDA 1SDDB 3MUY1 2VZ3A 1DYOA 5HPOA 2BBAA 5C71A 1L7RA 4JX0A 3MUZ1 5EJ1B 1UY0A 3OGSA 3I2FA 1CX1A 5IJRA 3VDBA 3DECA 3C7OA 3K4ZA 5FUIA 1GQPA 2WAAA 4DXTA 3POGA 1HN1A 4KMQA 4CU6A 2Y6LA 3NJXA 2VO5A 5C70A 5JXJA 2VQUA 3NNGA 1JYWA 2VZVA 4UOJA 4QB2A 1CZVA 2E32A 3GXUA 4ZZ5A 2VZSA 2VM9A 3CQOA 4A3ZA 4LMFA 1OD3A 2VR4A 4LKSA 2B9VA 5I0DA 1BHGA 3MBWA 3CZUA 3LEGA 3PUIA 3WF2A 3WNKA 2VJXA 2YC4A 2E26A 4JKLA 4XUQA 2QBXA 2WO1A 2JD9A 1JYXA 2WZ8A 4D8MA 1JZ6A 4DUWA 4CUBA 2VZUA 4CVUA 1GNYA 3I2IA 3I2KA 3NRUA 2QQOA 3VD9A 2VCBA 1XPWA 1SPPB 1YQ2A 4GZ9A 3ZM8A 3CIHA 5JUVA 3P1IA 4FI9A 4JKMA 2L9LA 2VZRA 1J84A 3I97A 5EJZB 3IAPA 1K45A 3CKHA 2X09A 3OBAA 1W8OA 1K3IA 2VTFA 2WBKA 4RYDA 3A23A 4ARXA 4ET7A 2WQ8A 3WNOA 1MPXA 1UMHA 2LS6A 3POEA 1K42A 3VD5A 3SEEA 4LPLA 3VD3A 3IIIA 1US2A 2JKXA 4A41A 5G04L 4QX0A 5DN2A 2Y64A 3DEMA 2YB7A 5HXMA 2BERA 4OUEA 3C7GA 4DXSA 2ZEWA 4QX3A 1H6XA 3HEIA 1UYXA 4P02B 1UX7A 2OKXA 2VCCA 3MV11 1JYVA 1WKYA 3IAQA 4QX2A 3T2PA 4QAWA 4ZXEA 2EIDA 4QDRA 2Y6KA 1JU4A 4XUPA 1JZ5A 3UESA 1CZSA 3SKVA 1OT5A 4A44A 4LQRA 4DEQA 1UWWA 1XC6A 4QPWA 2ID4A 3P6BA 1JZ3A 2XHNA 2JE8A 2J1AA 3EYPA 2W1SA 2WO2A 3K4AA 3LEKA 3I2GA 4UAPA 4D0QA 3OG2A 3D3AA 4MADA 4BJ0A 3W5MA 3OEBA 4LHSA 3HNYM 3IDAA 5CKMA 3C7HA 3K46A 1TVGA 2J7MA 4DUVA 3THDA 4HG6B 5LA0A 5CISA 3FL7A 1PMJX 5IHRA 1W99A 3GDBA 2XOMA 2J1SA 3HNMA 4ZZ8A 2YFZA 4BK5A 3HN3A 4TXWA 3PUHA 2VC9A 5DQ0A 5JMOA 3J7HA 2VOTA 2W5FA 4OZOA 3I3EA 3U37A 5B4NA 1XNAA 4XZUG 2CDOA 2ZEXA 2RVAA 3K75B 4TTGA 3WNMA 1UZ0A 2WZEA 2Z4FA 3EB7A 5IFTA 3K4DA 4A4AA 1SFPA 3T08A 2EICA 1ULOA 4MOAA 2EIEA 2WAOA 4AG4A 2Y8KA 2W1WA 5IFPA 1CZTA 4CUAA 1W9WA 2Y6JA 2VZOA 3MV01 3WNLA 1JYNA 2W91A 1L7QA 4MGSA 3WSOA 3GGLA 3CDZB 4MO3M 4LOSA 5CKNA 1O8PA 2V5DA 2C26A 2YFUA 1GOGA 3I3DA 2JDAA 2X10A 1F4AA 2YG0A 1OF3A 2YC2A 3LE0A 4A42A 4Z2AA 2C9KA 5JXIA 4L0PA 3NQHA 1KEXA 4M4RA 1XNTA 3HOBA 1UYYA 1UY1A 2Y6GA 1EUTA 5JXGA 4E8DA 3POBA 2WUHA 1W0NA 1JZ2A 3I3BA 4XUTA 3A21A 2DDUA 2Y6HA 1NAEA 2W95A 3MO4A 1CIYA 2J1TA 2ZXQA 2W46A 4DEVA 3UETA 3ACGA 5F7UA 2VZTA 5G05L 2WYSA 5LCWL 4OMCA 1GUIA 4QX1A 2QQJA
chains in the Genus database with same CATH superfamily
2VCMA 1GOFA 2TBVA 3NAPC 4YRDA 3KSCA 2XWBB 3SKJE 2E53A 3KF3A 2VW0A 4JDMA 4IV1C 1LNSA 5CEHA 5DMYA 5JDBA 2Z42A 2YV8A 1T6GC 3PIJA 4JQTA 5LRRA 1H1MA 4FQZA 4D3WA 4YFZA 1F31A 1AZDA 1K5MA 5LBCA 4Q0VA 2GNBA 1ULPA 2KM2A 4YVWB 5CBLA 5TSWA 1CPNA 4V2VA 1AJOA 1GKBA 4JRLA 2HWD3 2JDUA 2JENA 1RYYA 2W92A 4I30A 4KWJA 4B4RA 1IG3A 5FJHA 2WNOA 3KB5A 1RUH1 2Y33A 4XHBA 1BK1A 2MHFA 4XURA 3VD4A 1BEV3 2X5IB 1QH7A 1U0AA 4HKOA 3NJVA 5FP8A 5FY7A 5BNQA 5C9AB 1AYM1 1UU5A 3THTA 3SCFA 3AZWA 5AC93 2A3XA 2HWF1 4LORA 3RVHA 5FIXA 4GWIA 5IK8A 1GU3A 3DN7A 2YBSA 2YBKA 3ETPA 4I02A 4Y5TA 3RZKA 3C8XA 5I91A 3NAPA 4JHZA 3EJKA 4MV2A 4AGVA 5E89A 2GC3A 4W65A 1TME3 5A7SA 4C0BA 2C1FA 3GJBA 4S2HA 4Y33A 5EQUA 3T0DA 4OLLA 3NV2A 1KFUL 2E33A 4BXFA 5BNNB 3OPZA 2CNAA 1UZWA 3Q8EA 3ZPOA 1YC61 4FPFA 1ND3C 4CCNA 1UOGA 1SG3A 3BU7A 3ZFEA 3MIGA 4FPLA 1XQNA 5I93A 3E1F1 2WLQA 3AKTA 1V6JA 1DDLA 4A3XA 2DV9A 5E1RA 1YFUA 2AUYA 2BVVA 2VZQA 4RHV1 2XWJB 5AVAA 1AX1A 4DIQA 4JTNA 4XJZA 5GZGA 3PU8A 2DYCA 3B5LB 5FZ7A 4URAA 1LEDA 2UYBA 4FFHA 3OGVA 4FP3A 1YCIA 3BN6A 2R6QA 2ARAA 3VZJA 1X8EA 3ZO0B 1MS5A 5CKQA 5F3CA 2SLIA 4NRPA 1PMHX 3SCHA 1LCLA 1MVEA 1HRI2 5AVPA 3USSA 4Y22A 2FDFA 2WS92 2LW8A 4TWTA 5D2AA 4X8NA 3FX3A 4H14A 4CZSA 2E7AA 3IIAA 2ZZJA 4AAPA 3LGRA 2OYZA 4LTAA 1SBDA 1VBC3 3ACIA 4OHVA 2QZ3A 1SLBA 4IXLA 4AW7A 4NPLA 4RGAA 1BQPA 4EZHA 4E2QA 1JS9A 2DTWA 5BPXA 1OF4A 4EN7B 3T09A 5C5TA 1WGPA 5KHKA 2DCJA 3WCRA 2AYHA 4GMP1 2G9FA 1FOD1 3WD5A 3AKPA 4COZA 3VBFC 3B69A 1FPN3 1R081 4HVRA 3WUCA 1FOD2 2WS93 3J4UH 4PI0A 4HN0A 5K0UB 1MVQA 1MQTC 3FHAA 1UYZA 4W4ZA 5K9YA 3ZPYA 3IMNA 4BIOA 3KGZA 4M3CF 5ABJC 1H4HA 4FFGA 4W8JA 5F37A 5KXEA 3WUDA 5LA1A 1PK6B 4GH4B 1RB8G 1O59A 3AP9A 4PQ9A 2HWE1 1VAKA 3LSEA 4XF9A 5A3TA 4HOOA 3ZDSA 4EYUA 1H9WA 2K46A 3ASIA 3KGLA 1HXS1 3GM8A 1NA1A 2RR13 3ZSMA 3HPNA 3ZSJA 3KCYA 3R4SA 4GB33 1X36A 2VCAA 4LO5B 3UT0A 1ZBE3 1NG0A 1XB9A 4XUNA 4YZ3A 3AMQA 3T2TA 3MPBA 1JZ4A 1POV0 3VD7A 5A1AA 2YU1A 5IVYA 1UY4A 5F1RA 1IS6A 1UMIA 4EWAA 4IE5A 1XYOA 1EUUA 1YXWA 1UZZA 3K3NA 3WG3A 1OLRA 2B7YA 1PIV2 1EAH1 1ZBA3 3TWIA 2XQXA 2YZ4A 2NMNA 4NE9A 4QHOA 1I3HA 2XUMA 3LIGA 3OSDA 3QD6A 4QB1A 3AMHA 3ITQA 3ZFGB 1MS9A 2BU9A 5T52A 3H8OA 1GQHA 1WMEA 1OA4A 4FBFA 4RS5A 3WX5A 2VOXA 1QQP3 2JB4A 4KWUA 4RGGA 3SMHA 2Q8EA 3N9OA 4D6SA 4YM0A 1QDCA 4IERA 4RSUA 5DUXA 5LATA 2D44A 4UT5A 4XF3A 4NJ4A 4IUGA 3ACHA 2W47A 4ARYA 2DCKA 2D43A 1CR7A 1PX4A 4XYXA 5FZ8A 2GNDA 1FYUA 1DFQA 2CSGA 1YO8A 2RMU3 2V72A 3O12A 1BBT2 4NPRA 4Z82A 5IATA 2RS11 2H6BA 2RJKA 4IETA 5A3WA 3HT1A 1QKQA 5GZEA 1B09A 5L9RA 1OMIA 1HJFA 1MZEA 2VOWA 3AJYA 3AC0A 3N9PA 2BYVE 3MUY1 4UYBA 5KHHA 4CYDA 1NA1B 1NXMA 1QOSA 2Q5TA 1SFYA 1UIKA 3JBG3 2FQPA 2GH2A 2HEWF 1X82A 4YWAA 3WP5A 4DZGA 2GU9A 1EV11 3MPPG 3IMMA 5FZKA 4IE6A 4KWKA 1XE8A 4CEWB 2FCVA 1R1A1 3DKWA 4XIKA 4RA0A 4BHPA 4YVSB 2OZ6A 2WNUB 1L7RA 2XB6C 2FD8A 4UW6A 2D93A 3MUZ1 5EJ1B 3BVCA 2EALA 2A75A 4TLGA 3FE5A 1OI6A 5A1FA 1H8VA 1O6UA 3VDBA 2EXHA 2A73B 3KT7A 3PHMA 5FUIA 1PK6A 1GQPA 4Q0QA 3I59A 1W6QB 3THPA 3TEWA 2NPIA 3PUQA 2B9UA 2GSYA 3MLLA 2PHRA 2XMLA 2Y6LA 4AEKA 4LA3A 2VO5A 4AQ6A 5C70A 4UOJA 5GLTA 4XJAA 3WZ1A 1RC6A 5FXZA 4CTEA 3TEYA 2JDPA 1ZREA 5HCFA 5E8AA 1RGSA 3BOPA 1LOFC 3U1XA 2XVLA 2E32A 3VBOA 4AVSA 1W39A 3H3UA 4ZZ5A 3AZZA 1A6CA 3BIWE 4N90A 1AR73 2AR6A 1SBEA 2C0ZA 3GCWA 4RS5B 2Q8DA 2PHUA 5LB6A 2VR4A 1RUC3 4GKYA 4BA6A 4QKFA 2CAVA 1RHI1 5I0DA 3AXDA 3OY8A 3ZFFB 3DPRB 4O61A 3PUIA 2IVJA 4QKNA 3IDEA 3WF2A 1SDWA 3WNKA 1CAUB 1VMFA 4CDWC 3I49A 4EN8B 2WZR3 1V00A 3IZOA 2DVFA 3RG0A 3WW3A 4D8MA 4DUWA 4MVTA 2YHJA 4CVUA 1AHSA 5ACA3 3M70A 1NCQB 4UFKA 3AVSA 4KNCA 1ZRFA 3H3LA 1ZBA2 2UY8A 4Q4X3 1NCRC 4LITA 3CLPA 1E5SA 2QDRA 2P37A 3CNAA 3H42B 3OUJA 1CPMA 5I0SA 4CRQA 5DZGA 2L9LA 1QJEA 1MQTA 4HMZA 1W8OA 1AR63 3ZIWA 1PZ7A 4XC9A 1OQ1A 3OF1A 3S57A 1DYKA 4FPGA 4PF5A 2MEV1 2VXJA 2WBKA 3A23A 4ARXA 5FWJA 1SCRA 3CHXA 4ZU7A 3M3IA 3NMBA 4LIVA 4BQ2A 4LT5A 4MUVA 2XDVA 4BQWA 1AXKA 1O5UA 2DTYA 1UMHA 1OPOA 1YHFA 1XOYA 3B02A 4XZPA 2JX9A 4I3GA 1AVBA 2VTXJ 3ZN6A 2VY0A 4E9KA 2HWB3 5IVJA 3WP4A 3PUSA 2BWAA 1N1SA 4LPLA 5C3RA 1UO9A 4OULA 5JLVA 1NCRB 2HWF2 1OH3A 2QQVA 4CP9A 5C8CA 5GLZA 4OZXA 1CX4A 4IV3C 4QMAA 5DUUA 3VDDC 1ZZ9A 2XQRA 5F9TA 3FUQA 2QFEA 3GF6A 3EHKA 4NHXA 1XSRA 3NV4A 1AR81 4DXSA 3S5AA 4NPMA 2UY9A 2VULA 1Q8QA 5FLJA 1URXA 2OQ6A 5A33B 1VB2A 1CESA 2VW1A 2A7AA 2VECA 1AYN3 3GJAA 4P02B 4QPIC 4BQ3A 4E4HA 1CJDA 1F8VA 1XSQA 2ZHKA 4L97A 1PZ9A 5JPMB 4ZONA 1AL23 1WWYA 3N9LA 1Q3EA 3JCIA 1WKYA 4PI2A 3T2PA 3MZHA 1YQ8A 1ULFA 5I8SA 5C33A 3RZJA 1HX6A 4YGBA 2G4IA 3EBRA 5LW9A 3DXTA 4FVVA 1Z7S1 1S0GA 4HN1A 2R061 3B9CA 1CZSA 2QQPA 1H2KA 1UZYA 1OT5A 1V9U3 4A44A 2F4PA 1BMV1 2XH6A 4HK8A 3RPQA 1OUXA 1ACCA 5BY5A 4Q4Y3 2X29A 2QQWA 3ILFA 2Q30A 4IEQA 2ET1A 2PHTA 4LXLA 3B93A 2J42A 3H50A 4MYEA 1W8ZA 4Q4X1 2J1AA 3GZAA 5ANNA 1I9RA 5KBFA 3VBOC 3WR0A 1HV0A 3K4AA 5ACA1 3M2MA 4CEYC 4LA2A 4UFLA 4N43B 5FCCA 5FQ0B 3CBNA 3QBQA 4IGPA 4AI0A 3BPSA 3W5MA 4LHSA 5EHDA 4BM8A 3O7OA 5CKMA 2BPA2 3U4XA 3V0AB 5FZMA 3IN9A 1RHI3 2G9ZA 4HG6B 3J7LA 1LOFA 1RUC1 5IWFA 3THDA 3N9QA 1IG0A 2PHDA 2BW8A 4CDXA 4OHXA 3FL7A 1EY2A 3HNMA 2KA3A 5FY5A 5LZ6A 3KT1A 3POWA 1KD7A 3PJYA 2VW2A 1J59A 3WDTA 1LR5A 4TXWA 2R073 1KITA 4CDQB 2IFRA 4EZ4A 2GMEA 5A7WA 4QXHA 3J7HA 1E5IA 2VOTA 3E6DA 5I8TA 1DG6A 4IGQA 5C3SA 4D6QA 3CJXA 4OVEA 4QPGA 1PGW2 2WT0A 1RUE2 5FYYA 4ATEA 4I2OA 1DQ2A 1XNAA 1J1LA 4Q26A 1TZOA 1FT9A 3TEZA 2ZEXA 3WG4A 4NAOA 4HLTA 2D6OX 5GJ6A 4BWOA 1C8M2 3BU0A 2VG9A 2WZEA 2PHXA 1Y9GA 4DFSA 4N7IA 1OD5A 4LK7A 3EB7A 5IFTA 4XJ9A 2FHRA 1SFPA 1D4M3 2BEOA 3M3OA 1V9U1 3L9JT 4I09A 4YVWA 3M8LA 1QEXA 4KU8A 2RS12 1PO11 4MOAA 1R1A3 2D98A 2YROA 4Q4W2 4R8HA 4QXCA 4RFRB 4YW4A 4AVBA 1GP5A 4BQXA 5FZ1A 2OT7A 5A3OA 2WR9A 4NHYA 4Y3OA 3OD0A 1JYNA 5FYCA 4ORFA 1QXJA 1PGL1 2ZX1A 1L7QA 5A80A 1ND3A 3O1PA 4Q4Y1 4MO3M 4Y1ZA 5JMCA 2ADEA 3BPZA 3MFAA 4GA9A 3VBRA 5GLUA 5DAWA 4AQ2A 5FPXA 2C26A 1Z0HA 1JOJA 4WVVA 2BP6A 1GOGA 2D6KA 2PELA 1AR83 4XDPA 1XJAA 1JOPA 1RUI2 3RGBA 2WO7A 3NV3A 4S2FA 4I01A 4ES9A 1Q8PA 4PLMA 3RZGA 2WL1A 2A6WA 1KEXA 2JDMA 1IS4A 4M4RA 5BUVA 4ZXKA 3ZXDA 3GBFA 5FY0A 3RZZA 3VB9A 1OURA 5AFEA 2MPFA 3POBA 3AMPA 2VTXA 2WUHA 3NNMA 3RMXA 1JZ2A 3ZFFC 2X53S 5FPBA 2LALA 1W6QA 5KHGA 2Y6HA 2BRTA 1I5ZA 2NLRA 3GZTB 3N35A 4GKXA 5I0RA 5I8YA 5CG8A 5A6ZA 4E4DX 3MICA 2VD7A 4TYSA 2J1TA 2XGXA 3PVBB 4AZZA 4EROA 1RVF3 3VBFA 1QDOA 3UETA 2WWUA 2XJQA 2VZTA 4YGEA 3K48A 3LZZA 4LBQD 2XKPA 5C4WA 3GBGA 4OMCA 2GZWA 4FTSA 4CDQA 1KDMA 3HBKA 1HV1A 1RUD3 2VMFA 3J8F2 5J36A 3E6BA 4N53A 2VNOA 4KWLA 2AREA 3RQ0A 2TEPA 1W2OA 1Z78A 2HWE3 3F2ZA 3WG2A 2B4KA 1AYN2 1C8NA 2JG9A 1H1AA 3ACFA 5FUNA 3ZDVA 4D7TA 2WQ4A 2YPDA 3PU3A 2CYFA 2DUQA 4MGQA 5EFUA 1D7PM 1RUJ3 4NIHA 1WMFA 1G9FA 3LPGA 2NMOA 4JZRA 1QGLA 4YM2A 2WS91 1VPHA 5J1XA 1FPN1 1R083 1NT0A 5FZIA 2JE9A 1ZRCA 5FP4A 4LBLA 3HNBM 4LEJA 5D21A 3WNNA 1IPSA 1FOD3 1S0FA 2VVDA 4GMP3 4A6OA 5CFDB 1H30A 4EWEA 5FPAA 1AL22 4P9XA 2RS33 4CPBD 2RR12 5B4XA 1AR82 3K77A 4AVVA 4JGZC 3ZXJA 3FMGA 4DB5A 4B29A 5FOBB 4D7SA 3LPFA 4YGCA 1OQDA 4IV1B 4CDWA 1RXFA 3JXSA 2RS53 2AC1A 2J1RA 4V1PA 4WM8A 4Z1VA 2E9QA 4HXCA 4PLNA 3HJRA 4TSVA 3OB8A 1W04A 1GZ9A 1CGPA 1W8FA 4DMIA 4UI9L 3TOJA 2ZGSA 1OH4A 2X05A 1NCRA 1E57A 5ISLA 1ULGA 1U12A 2VL4A 4OYUA 1IGOA 1UZVA 3WCSA 2YDEA 4LOTA 1W8NA 2W52A 4NHLA 2DVDA 1O8SA 3WF4A 1Y4WA 1FATA 2KD7A 4P9WA 2VZ1A 2SBAA 1XRUA 1W3VA 2WN3A 4MZUA 1UIJA 4OQ8A 4COVA 2VMDA 1SLCA 3T0AA 4META 1OUSA 1RJ7A 4LIUA 4OI4A 1T6BX 1DIWA 4GWJA 1MEC1 2QQMA 4IEVA 4EE2A 3MFCA 2UU8A 4PF1A 3T0BA 3UGHA 4FQ4A 4QQHA 4YVSA 2E7QA 2DBNA 4XFFA 2RDQA 4KG8A 2CU5A 1US3A 3VBFB 2IUWA 1K12A 2E7TA 2ZKNA 3CZJA 1VP6A 1AJKA 2HWE2 1IQDC 1AF9A 1JBCA 4HSLA 5D8AA 2XLFA 2ORXA 3ZKYA 1OBNA 2OA2A 2OZJA 4WVWA 1X9TA 5DUVA 4NWVA 2RDRA 3LDKA 3M1HA 1PK6C 1LHWA 1SPPA 4AGRA 2QQNA 2OX0A 5EIYB 1LODA 3AYCA 1V6LA 4XF4A 3D8CA 2OXBA 2JG9B 3A7QA 1KQRA 4R9CA 4LJHA 1ODNA 1J3QA 2I45A 1BXHA 5JZGB 1VR3A 5FKBA 4M3CB 2XXZA 3KCXA 1W06A 4HANA 1SZBA 1W9YA 3C7FA 4AEDB 3ZYGA 3CU7A 1WLWA 4OHYA 2K0GA 2Y26A 1SCSA 4MGKE 4FXKB 1R64A 1QU0A 3ZYIB 4KI5M 4GB31 2QQKA 1RVF1 2BFUL 5FY4A 4ZY9A 4Q29A 3WLUA 3CMGA 1CAUA 1CQ9A 4K8FA 4NIAA 2RE9A 4AAXA 2ERFA 1EPWA 2VUDA 1MS8A 4LKDA 5AC92 3WINE 2W9XA 4HL0A 4NVPA 3MIDA 3DPRA 1YJKA 3ZX7A 2NZ9A 1F35A 3OBRA 1UY2A 2QVSB 2XJPA 4B1MA 1A8DA 3ZN4A 3VZKA 4CCJA 2G19A 4N9HA 5DG2A 2VVEA 3RI9A 3VBOB 3AKSA 2QTWB 3J26N 5C6CA 1POQA 3DYPA 4XQ4A 3UGGA 2BWCA 3WW1A 2IWGB 4NIGA 4FXGB 2JE7A 2JECA 3I3MA 3NKTA 2JG8C 1VRBA 4XFBA 5FZLA 3VBUC 1QF3A 1ND2B 3BALA 4JDNA 4M0NA 5FREA 1CJPA 2C24A 4E8CA 2FDJA 1WCUA 3FBYA 3ORJA 1M06G 2OVUA 2DU1A 1GWMA 2ARXA 3IWZA 4R52A 4NAMA 2PN5A 4RN5A 5A6QA 4JDOA 2J1EA 4Y4YA 5D8AB 5F32A 1O91A 3WW2A 3K2OA 4BCUA 1RUF3 2W3JA 3VDAA 3DF0A 2ZEYA 3T3YA 1S0DA 4J25A 1Q56A 3AKQA 4YGDA 1LGNA 2BGOA 2CDPA 1W9SA 2WNVB 5C3OA 1ZBE2 2ET7A 2O1QA 4DXRA 2VMCA 3A22A 1CD3G 1DGWA 2PQSA 5FMBA 5IVCA 1SHWB 1UOBA 1PNFA 3JQXA 1W8HA 4H3WA 4S2DA 4YZ4A 4I3PA 2J1UA 2R30A 4YW3A 4PDWB 2LTNA 1VBC1 5FFOC 4FFFA 3VBUB 4JGYC 5ERLA 2D40A 3FWEA 2D3RA 2PHFA 3PURA 3RNSA 4LHKA 1MR5A 3OTFA 4XETA 3FHQA 2I2SA 3DYMA 5L7OB 1W6NB 1DLLA 4CUGA 3LCPA 4C91A 1LHUA 4AYUA 3L2HA 4BQ5A 4OMDA 1DYOA 3O0VA 5FK7A 5A32B 1GZWB 1W6MA 2XHKA 2YY1A 4FOWA 2BTVC 2JIGA 4NHKA 2IXKA 1OFSA 5FBZA 5FZDA 1FPN2 4O65A 3TBDA 4ASMB 5FZBA 3BKZA 1HXS2 2DVAA 2BOIA 3ZYBA 4AI3A 5CFCA 2F17A 4XXPA 2YMZA 1JTZX 1QJX1 4XBQA 3T30A 4JGZA 4JX0A 1YRZA 3VHRA 2JG8A 3V0BA 4ZPIA 1UY0A 5F6LB 2PFWA 1RUD2 1DZQA 3I2FA 2VMIA 5A33A 3GALA 5JVVA 3K4ZA 3OGGA 5FP9A 5FLHA 1YLLA 5FZHA 3ZXEA 4KG0A 4KMQA 5BNPC 3ZYPA 4HKLA 3UJOA 2VQUA 1JYWA 5FKCA 1BK0A 1KJRA 1NCQC 2PQQA 4Y5Z0 3Q8CA 3UKVA 1YQCA 2Q1MA 3FUOA 1MZ5A 3WOGA 2ENRA 2WNUC 5C9AA 1EP0A 1COV2 4Y24A 5HV4A 4QQOA 5HCBA 4UW5A 3I7DA 1UU6A 2C9AA 4FPKA 4QGLA 3RYRA 3SH4A 3MI8A 3U78A 4JRAA 1W0PA 2BV4A 2RS32 4K20A 5FZEA 3LEGA 4XXAA 3KV9A 5DAXA 4MGZE 5I0TA 5JWPA 2E26A 1HW5A 3I54A 2RM22 3NKGA 3IBMA 1BCXA 4IESA 3FHIB 1R1ZA 4NRMA 1JYXA 3E5QA 1HKDA 1NYWA 2ZGOA 1W28A 4CUBA 1REEA 2WFF3 2P3JA 3ES4A 1OFNA 2WT2A 3I59B 1OVPA 3I2KA 1F2NA 3NRUA 2QQOA 4WM8B 2IFWA 1W6NA 2HWD2 3I8TA 2VCBA 1XPWA 3NJZA 1YQ2A 4QX5A 4AFMA 1OOPC 1TME2 4FI9A 4XDOA 1AR93 3ZFEB 2VZRA 3I97A 2Y38A 2QNKA 5GLVA 5CG9A 3OPTA 3CKHA 4BLIA 2AACA 2WSUA 3N7LA 1SACA 2PAEA 2VTFA 5A6XA 3ILNA 3ZSKA 4MXVA 3UK9A 4K3UA 3HN1A 3T4VA 4M00A 1MPXA 3FFZA 3KHCA 1VMJA 2BNOA 1F15A 1S0BA 3POEA 5K0UA 2K9ZA 3MW3A 1B35A 3SHRA 4CXXA 1W6PA 4Q4W1 2Q8CA 4YZ2A 3SEEA 4LLOA 1J3PA 4GH4A 4FT8A 1UYPA 3O1SA 1UN1A 1S2EA 4IE0A 4WM7B 1C8M3 2VVFA 4MH0E 3ZFEC 2YPJA 5CADA 4L2NA 3ZKUA 5DAPA 2ZKLA 1AYM2 2YB7A 5FPZA 2XKOA 4Q0PA 1F9KA 1FXZA 4XTPA 2BERA 4JGZB 4A7KA 4GWMA 4HONA 2IXCA 5A7QA 1RUE1 4Y4RA 1PIV3 4FTBA 4YW7A 5APAA 4LULA 2P6HA 1GR3A 2QQUA 3H1YA 2ADDA 1LGBA 2VCCA 3KVBA 3TN92 5F3GA 3BB6A 4ASLA 2CWSA 2HEYF 3D4KA 2Z2SB 4KBBA 1XU1A 3IAQA 4QQLA 2P3YA 4QX2A 3VBSB 4CA9A 4QAWA 5FP3A 4F83A 4ZKTB 1QOOA 3MHZA 2QE3A 2OPKA 5BNNC 4QDRA 5A3MA 5D1IA 3BTXA 1JU4A 2UWAA 4H7LA 2PLV1 4XBNA 4YM3A 4YG6A 4EN0A 1C57A 3KQRA 4E4ZA 3SKVA 5L19A 1PO21 4O9EA 4DQAA 1ULDA 2R0HA 2IZWA 1W05A 2EXIA 4J6GA 3U11A 3ZXAC 2A3YA 2EVXA 4UFHA 3TNPB 1AL0G 4QPWA 2WYFA 4Z2WA 2P3KA 2GC0A 3I3QA 4QHZA 5H9SA 3AZXA 4LBOA 1K5MC 5L9VA 1IS5A 4FAHA 2R0FA 3SH5A 1I1EA 1OQEA 5FPUA 3I2GA 4UAPA 4QT6A 4AQSA 1RUNA 4D0QA 2R1DA 4FOVA 3RZMA 2FBEA 4QM9A 2QJVA 3U07A 3TB0A 1SMVA 4GXLA 2NP0A 1LECA 2DF7A 5J48A 3WQ1A 1BKZA 4N53C 1VBA1 1H8TA 3NVCA 2OUHA 3POYA 5DG1A 3C7HA 3K46A 1TVGA 1H4GA 4WVMB 1OKOA 1RUG2 5LA0A 5CISA 3RWNA 1VBD3 2DWRA 3KT4A 4FPYA 5IVFA 1CN1A 4YW1A 5JZGC 5IAVA 2VPVA 1PMJX 3ELNA 5C3QA 5IHRA 1W99A 3GDBA 2XOMA 3RJ2X 5JPNB 1UNBA 2FDKA 1AXZA 2YFZA 2PAMA 2P3IA 4Y5SA 4CEYB 1Q5OA 2W5FA 4OZOA 3I3EA 1ASJ2 2OIIA 4PCRA 4GIQA 3BTYA 3A0NA 2IVIB 2FDIA 4RQPB 4AI8A 4XZUG 3J7NA 3DCQA 1LU1A 3VZLA 1W8WA 1G8WA 1FNZA 2RVAA 4QU1A 3JBG1 5IVBA 2DBIA 4C90A 1XE0A 2EF6A 5L9BA 4SBVA 4XQDA 4QM8A 2JJ6A 2NM1A 3LEMA 5GM0A 4CCCA 2VBDA 5L7OC 2H0BA 3V0AA 5FZGA 1RUG1 1ULOA 3OBZA 2EIEA 4RR3C 2W1WA 2XLGA 5IFPA 1BVVA 1J3RA 5EPAA 5CFDA 4CCLA 1HRV1 4CUAA 1WMXA 4AVCA 2VZOA 2VNRA 3H1WA 4PLOA 1C5HA 2JXAA 2GP5A 3WNLA 3AZYA 3TAYA 2CGPA 2DUOA 2D3SA 3S5QA 3ZIXA 3ZLIA 5CA6A 2P17A 3CJIC 3H1MA 3GGLA 2MEV2 5GLWA 2NYYA 3KMHA 1H9PA 1RUG3 3M3QA 3AL6A 3KZ4C 4Q2FA 5A3NA 2ZAAA 1HQNA 2V5DA 4HBNA 1QJU1 4IDZA 1OHFA 4MX3A 4G3YC 4XFIA 2LROA 4DXZA 2YFUA 2PAKA 3I3DA 5BNPB 2XG3A 5T5PA 1EAH3 1ZBA1 5A32A 1W6MB 1L3JA 1JHNA 3R6SA 5IAXA 5DABA 1LU2A 4Z2AA 3O1TA 4L9BA 3VKNA 5FY1A 2WZR2 3RSJA 3CEWA 1WD4A 4E2GA 1H0BA 1LENA 3E97A 3RZHA 1FNYA 2GN7A 1XNTA 3OPWA 1CAVB 4QU2A 1UY1A 3RWKX 4JAAA 1LTEA 2I74A 2FDHA 4XCBA 3W21A 2R49A 3OCPA 4IV3A 4PDWC 5FUPA 5EJ3A 3FLRA 1AR72 3WG1A 2WA3A 4JV4A 5J37A 5C3PA 3FFQA 2VAUA 1MS4A 3R4DB 3OYWA 3R0RA 4QX7A 3NNFA 3MO4A 4YVWC 4XOGA 2HBTA 2OS2A 2VH9A 5FYMA 2ZXQA 2XL7A 2FZ2A 4BE3A 3KF5A 4XABA 4JTOA 4YNIA 4DEVA 4IEOA 2HH9A 2WYSA 5IK7A 4CEWC 2XBO2 1GUIA 4QX1A 2ATFA 3LA2A 3A0KA 1N3PA 5C7GA 1IQAA 3WDUA 1LOAA 3FN9A 3H0OA 1MS3A 1UU4A 1W6OB 1OOPA 4CU8A 1R093 3C7EA 3E5XA 1ONAA 2FMYA 2W1UA 3F95A 2VUCA 4KGGA 5M0TA 1VBA3 4GJZA 4S2GA 3ZN6B 4W6XA 2H6CA 4N9IA 1QJY2 4Y1VA 1SLIA 1ZRRA 1W9TA 3ZFGA 1EV12 1GBGA 4FSJA 2BZDA 1GMMA 3LIHA 4A7ZA 3WNPA 4M4PA 5GALA 2JDKA 2GNMA 1LB2A 2EXJA 1H6YA 1PGW1 3LEIA 4QQ2A 5J98B 3SITA 1GZCA 3ZSLA 1ASJ1 1VRH2 4RS5C 2A1XA 5E16A 2RDNA 4IV3B 1ZX5A 2YGMA 1ZA7A 3NAPB 5FO7B 3TRSB 4CUCA 1PVC3 4YG0A 4Q8KA 1N3OA 4RL7A 4B3NA 2XVKA 2A3WA 1EYBA 2XJUA 3I2OA 1CAVA 4RD7A 4LBMA 2XUEA 4P5YA 5DZEA 3LA3A 1TMF1 5BNOB 5C5UA 1BLZA 4QGMA 1VBB1 5L36A 1KGYA 4A45A 1GWKA 1VLNA 1E5HA 2Q1FA 5BNPA 2WDBA 3WF3A 5CVRA 4IEPA 2VOKA 2HLEA 3ECQA 4L8QA 2RV9A 1WCDJ 1DP0A 3AYAA 4WZCA 2J22A 3W9AA 4P00B 3VZOA 1CAXB 1PX3A 3B7MA 3WW4A 1C4RA 4BMBA 1MACA 4CEWA 4MLOA 1JH5A 1RMU1 1NUKA 2BNMA 4HT1T 1DQ0A 4E27A 5FO8B 3ALQA 2GALA 4AFCA 1PIV1 2O0OA 5LA9A 1T2XA 3H8UA 1KFXL 4R4XA 5DPNA 5T5OA 2BUKA 4EQVA 3M3EA 1YQ5A 2W87A 2Y0IA 3LOIA 2PHLA 3HQXA 1DCSA 1NLSA 2EIBA 4QDSA 3VDCA 1YNAA 5FYIA 4PBPA 1BZWA 5LA2A 2LM3A 1OSGA 5IT6A 2ZGUA 4DPNA 4C1WA 1GICA 4HK9A 4L99A 1COV3 1G6NA 1UX6A 4YW5A 5A70A 1W0OA 1NX9A 3JB8A 4NN0A 4AEDC 3FLTA 2Y34A 1BEV1 4QQPA 1NQJA 2DU0A 1RUH3 2R062 4UBHA 3WDYA 5CYYA 2PLV2 4LBNA 4XJWA 5KXBA 1OLMA 5CNAA 3OUIA 4DOUA 5F5CA 4N8MA 4JCKA 1WW6A 4JQRA 4Y22B 5EYYA 1TNFA 2HWC1 1WCQA 1J83A 2VQTA 1BJQA 3DKQA 5DZFA 2WFF1 1YI9A 4RGKA 1LKNA 2Y60A 3HBZA 2GNTA 2ZGTA 1NY72 5DDJ3 2HJIA 2WWJA 2UWCA 4HKWA 2VMEA 3FLPA 4QGNA 3ST7A 3LDRA 3ME2A 4P14A 3VBHA 3ZFFA 5FP7A 3WEZA 2WINB 1AR91 3MGUA 1UPSA 2QQLA 1DLCA 1ZZBA 2QZ2A 3PVNA 1UPIA 3PLQA 3ABZA 2WO3A 3UJQA 1EPZA 1FV3A 1VBC2 1NCQA 3AM2A 3UL2A 4OFGA 5EP9A 2VMHA 3THCA 3O1RA 4IEUA 4UW3A 4HZFA 4CXWA 3BI3A 5JR2A 2BBVA 1H8TB 3H7JA 2RJLA 4J1WA 3BUCA 2JG8B 3V0BB 1D4M1 4L11A 1HRI3 1D2QA 2W1QA 2YYOA 5FOJB 2Y6FA 2QQIA 1XNKA 2RS52 1VBD1 1DZRA 4O9GA 4PIZA 4P08A 1LRHA 1JOBA 3IPVA 4UF0B 3WF0A 4OCTA 3SH3A 2AGSA 2I07B 3ZYHA 2ZGNA 2TNFA 4BOWA 3VZMA 3T4HB 4DUXA 1SLAA 4BZ4A 3BIEA 1G9BA 2RJ2A 1LOEA 1Y3TA 3VBHC 3IDCB 4FOQA 3LKJA 5LBEA 2O8QA 2PXJA 3OEAA 1ZVFA 4AEDA 1WD3A 1H8TC 1PMIA 4CCKA 5K0UC 2ZAHA 4WZFA 1UY3A 5JOZA 1RUF2 4XE9A 4AHWA 4DY3A 4LE4A 1XBFA 2TUNA 3POJA 5CZKA 1POV3 5LBBA 3ETQA 3WQBA 3ZMOA 2GH8A 4K1ZA 4QDQA 4U36A 4TZDA 1QJFA 1LHNA 1LOCA 2WJSA 2ZHNA 5T54A 2CY6A 3C2UA 4B7KA 2DCZA 5F5AA 4BIFA 4IEZA 4CDUA 1HQLA 1RHI2 3BGAA 1UXXX 3M4FA 3POFA 3VBHB 4CDQC 5H9RA 5FO9B 4Y20A 3V65A 4GAZA 3TN93 5DDJ2 4YW2A 4AVTA 3T2QA 3S30A 1G86A 2WZPP 4K8RB 4KBZA 3WDVA 1A78A 1HB3A 3MLJA 4IW3A 4J1XA 2VU9A 2ZGQA 3KV6A 3SXWA 4CU7A 1C1LA 1TQ5A 1MS1A 1RUF1 1IS3A 3X29B 1TG7A 4I0AA 4P9YA 3H7YA 2BGPA 1KXGA 2C4XA 1RUH2 2R063 1ND2A 3POIA 1C1FA 4BXSV 1KS4A 1SDDB 2OPWA 3WDWA 1WBFA 3JBG2 4XHXA 2D3PA 1U5XA 1QJY3 3LF7A 2H0VA 2JICA 2BNNA 4NOTA 2A6ZA 5BNNA 5K7PA 1AL21 1M4WA 1AXYA 2BBAA 2ZX2A 4TN7A 1O4TA 1UCXA 4UXAA 1R092 2ZGKA 3GZEA 3ILRA 1R1A2 2CGNA 4H2AA 4Q4W3 4BMEA 2RMU2 1X33A 5DAVA 1NE6A 2QKDA 3OGSA 4WBBA 4C8DA 1KJLA 1CX1A 2DUPA 3P5BA 5IJRA 4F8AA 2V5YA 1D4M2 1W2NA 5FYBA 2YXSA 3C7OA 1KDKA 1GFF2 5SV5A 1SQ4A 3VKMA 1MEC2 2WAAA 3BTAA 2AZ5A 4DXTA 1B35C 5F2SA 1HN1A 1QQP2 3TEXA 2XVGA 4CU6A 5KR7A 1W6OA 3NO8A 3R05A 3N4MA 3NWKA 3MDPA 2A70A 3IKWA 3IT8A 3NNGA 1VJ2A 4XIOA 2ZGRA 4LLFA 5K4LA 3WVJA 4QB2A 1CZVA 3OD4A 2D6NA 4IE7A 4MSVA 4Z8BA 4Y20B 1UOJA 5LEJA 4MHUA 2HWB1 4Y1UA 2VZSA 1UOFA 3CQOA 4P9JA 4CSWA 1GZWA 4LBKA 1WA4A 4YVSC 3ZR6A 4U2AA 4A3ZA 4DINB 1RMU2 3SISA 4LMFA 1LULA 4K40A 4LKSA 1FMD1 1BHGA 1VRH3 4K21A 4D94A 4LNVA 2XBO3 1GZTA 3KD4A 4QPYA 2Q1ZB 4A2UA 3VGIA 1AR61 4GQ7A 1S0EA 1Q8SA 4JKLA 4JGYA 4XUQA 2FDGA 1LESA 3AVRA 4AF9A 1OPMA 2JD9A 2HYKA 1TMF2 5LY2A 4FCAA 2WC2A 3NV1A 2VZUA 5FMDA 1EAH2 1YFYA 2ZBJA 3I2IA 1OA2A 1XYPA 2C5DA 1X50A 3W58A 2P4EA 4COUA 5KHIA 1SPPB 3ZM8A 2JDZA 1LOGA 5ABJA 4LKFA 4MGYE 3CIHA 4AOCA 1QMJA 2ARBA 3A4UA 3P1IA 3PIGA 1OA3A 4JKMA 1J84A 1JUHA 2WZR1 3MF6A 3IAPA 4XMIA 1PM4A 5EJZB 5FRAA 2RM21 3HMYA 2X09A 3OBAA 5FR3A 1K3IA 4INDA 5IK5A 1UL9A 4UBGA 3FZ3A 4I0BA 4AFAA 3D6EA 3VBRB 4ET7A 5J96B 2VQ0A 2P2KA 3MEPA 3I2DA 3KVAA 1YYNA 2WQ8A 5LASA 1U5IA 5SV8A 2XPJA 5FZOA 4Q4V3 3WNOA 4F7ZA 2LS6A 4LE3A 4QWNA 2E6VA 2GAUA 3WHTA 1K42A 1JN2P 5FPVA 3VD5A 1HB2A 1QY4A 5CFDC 1HLCA 2WNEA 4CEYA 2X8KA 4EJRA 1DGWX 1PM7A 4CXYA 2DURA 1R082 4QX0A 2ZTNA 3MIBA 3DXUA 2Y64A 2X5IC 3VHPA 2IXIA 1DQ5A 2VOVA 1ENRA 1FI2A 2O8OA 3KS7A 3MIFA 4HPKA 3VL8A 5HXMA 1H2MA 4D7YA 1RIRA 2YC0A 1IPKA 1K5JA 4DNYA 4QX3A 2JG9C 2DFCA 2R043 3HEIA 3WXPA 1RTVA 4QD2A 4OI0A 1DZTA 1UX7A 2D97A 2JD4A 4LO4B 1IKPA 1XNBA 4CDUC 2OKXA 3W59A 1QJX2 4P5HA 4AVAA 4H7MA 1HQWA 5FZ4A 1JYVA 4AQTA 3ZYJB 2PHWA 3D5OA 5C4WC 3I4IA 3LA7A 4XDQA 1FV2A 3G6JB 4ZXEA 1HN0A 3PJQA 3N7KA 2YGLA 2Y6KA 1W03A 4DRRA 2RDSA 3HR9A 5JIAA 4XUPA 3APBA 3VLBB 1JZ5A 4N53B 4P9LA 3UESA 3LAGA 4CCDA 3M7AA 2PA7A 3O1VA 3WP3A 1CWPA 4GH4C 4DEQA 4Y1YA 3PVEA 1O3SA 2EIGA 4W6YA 4N43A 2F6BA 1IOAA 4CCMA 1JXNA 1S0CA 1UWWA 1O3QA 4YZ5A 1WBLA 4QPIB 4RHV2 2RS31 1JZ3A 2OQ7A 3EQEA 1FMD2 1BYHA 1XNCA 1WW7A 2XHNA 4B7EA 1N1YA 3BTZA 3OYWB 4HVOA 1LJ7A 2W1SA 5JOXA 5E6HA 4OUSA 2WO2A 2A6VA 3VBSC 1Y43B 1JYTA 1FX5A 3JB4C 3DL3A 4YM1A 2N7GA 3K51A 5CB7A 1YQ6A 3IDBB 2C6SA 1BBT3 2JB8A 3OG2A 2CAUA 2PMWB 3D3AA 1JW6A 5BXXA 1O3TA 2Q8OA 1RUJ1 1SLLA 5H9QA 3IDAA 5ANQA 3ZXFA 1HB4A 2CTVA 4LBJA 3U4SA 2EA7A 1W9FA 4DUVA 3DGTA 2LRPA 3CF6E 4IQPA 4YLZA 3ZFGC 1XE7A 1RUD1 5LY1A 2J1SA 2BDRA 4KH9A 1W2AX 3E6CC 3PUHA 1MS0A 2VC9A 4ES8A 1WW4A 4ONUA 5JMOA 3O0XA 3AL5A 1N47A 2RR11 2WRAA 1VAMA 3U37A 4XJ8A 2GN3A 3MIHA 4RFT0 3VUOA 1UAIA 4QHBA 2V09A 1UD1A 4LO6B 4QPGB 4CDXB 2D5HA 3K75B 2ZMLA 4FPEA 5BNOA 4TTGA 1Y9MA 3WP6A 4LR4A 2NQYA 3GHMA 2UURA 2HBUA 5EWSA 5F6KA 3H8RA 1WUVA 5GZFA 3U14A 1NE4A 4X6QB 2EICA 2Z79A 3KWVA 1HRV2 1RUC2 3POSA 3SNMA 3OOXA 5JSRA 3ZMNA 4AG4A 1OLQA 3PDQA 1DBNA 4FO9A 1PZ8A 1WMDA 1AX0A 4WV8A 1SLTA 4BH9A 4EN9B 4Z92B 2R072 1CZTA 4AI9A 1IHMA 1PHMA 2IXLA 1DF0A 5JSOA 2R32A 2ZOEB 3AP6A 3AZVA 3PVOA 4MGSA 4I0WB 3T1LA 2HEVF 4A6SA 1O4YA 2B42B 3WSOA 1YEWA 1PGSA 4CDXC 1DGLA 1PO13 1YUDA 2DVGA 2IC1A 4UFIA 4XF1A 5F8PA 1MEC3 1G9DA 2V73A 2ZABA 1Q8VA 4YZ1A 2R041 4Z07A 2OW4A 4F3JA 4AHYA 4IEYA 2X10A 2IXHA 1C28A 1V6NA 2YG0A 1G9CA 4DRVA 4E2SA 1TE1B 4QPIA 4AR2A 3O1UA 4LO8A 2VNGA 4L0PA 5FZ3A 1U5YA 1UYYA 2WSVA 3LWCA 4OI2A 4QX8A 1Z7S2 1GSLA 1L7LA 1NZCA 3ZVXA 4UW4A 1EUTA 5FYZA 4OI1A 2Q0AA 4XF0A 2B8MA 1LAJA 2Z69A 4RHV3 1WLTA 1N3QA 2R042 5K8SA 1RUJ2 4LUKA 4K1YA 3A21A 4Q4V1 5J09A 3WQ7A 4D6RA 1XYNA 1ODMA 3AYEA 1VMHA 2B39A 2RS51 1LGCA 1SEFA 1CIYA 2D6MA 2WWSA 4NMIA 5FAXA 3S7EA 1WCKA 2ZGLA 3UYJA 3ZSEA 1V0AA 2RM23 2D5FA 2W46A 3P3PA 3R4UA 5DXDA 2GC2A 1DQ1A 2R071 4WM8C 5F7UA 5G05L 2P6CA 1APNA 2ZHLA 3N9MA 1IPJA 3QH6A 3VHNA 3WNXA 2XR4A 2JDYA 4B8EA 1CONA 1ENSA 2BFUS 3B01A 1VBB2 3UNPA 1CAWA 4KU7A 2K2SA 5C9AC 1AR92 4BQYA 4QKBA 3RFRA 1W2TA 3T2OA 3AP5A 5A1LA 3VBRC 4CP0A 1GOHA 4OUMA 4AFDA 3VBSA 1V9U2 4Q8LA 1JYCA 1B35B 2J1VA 1OC1A 4ZHNA 3IM0A 1VRH1 5JCTA 3SQOA 1GP6A 4PBOA 2WFF2 1WLDA 1IKQA 2HWC2 2CL2A 2G1MA 1LHOA 1Z7S3 1A8MA 2P5BA 4XEZA 5EZWA 3NJYA 3D82A 2QUOA 2E31A 2XJTA 1ZZ7A 1I5PA 4FPHA 4IE4A 1F5JA 1JMUB 5FDBA 3W5NA 4FPJA 5J7MA 3QCWA 5HV0A 4PDWA 2WN2A 3SCGA 3KQ4B 3PL0A 3OGRA 4XFCA 3B00A 4FAGA 1AYN1 4Y1XA 1ENXA 4CU9A 3BODA 3N36A 2ZEZA 3OY8B 4CDWB 1RL3A 1G7YA 4IL7A 1GLHA 4CDUB 3PMSA 2ARCA 2QDNA 3WHUA 4Q1RA 3PNAA 4AI2A 2GP3A 2V4VA 3USUB 3LDBA 4R4ZA 5KXCA 3DYOA 2JIJA 3GCXA 3JD73 4SLIA 5FWEA 1UKRA 1GP4A 3I2HA 5FYHA 3S0MA 4HETA 5A7PA 1CIWA 1COV1 5EV7A 3MYXA 3JD71 3HAGA 1H2NA 1JU3A 1AX2A 3RS6A 3C3VA 3G7DA 1S55A 3GBWA 5DUWA 3ZXLA 2AH2A 3I2JA 4PQQA 1F4HA 1RXGA 4YW6A 4COYA 5BNOC 1ZRDA 2FZ1A 5JXHA 4LBQA 5IVVA 1MZFA 1VB4A 5FMCA 1HDKA 3FJSA 1QNYA 2DVBA 1CAWB 2DCYA 2VZPA 4K7JA 1HIXA 4BK4A 3MW4A 4BISA 5FYVA 5T55A 4W50A 3VZNA 5GZCA 3T1MA 2XONA 5LEKA 2RHPA 1O3RA 5T5JA 5EYXA 2W0XA 4GULA 2JEMA 3TN91 1P8JA 1YFWA 1RUI1 4WM7C 1KS5A 1MQTB 5HCHA 1VALA 1ND3B 1VBB3 2VGDA 1TMF3 2R16A 4Q27A 5CU1A 1CVNA 4Q1PA 4JVAA 1GWLA 5EXOA 3QACA 1WZXA 3K3OA 4R9AA 2EAKA 3LSDA 2ZMKA 5F3IA 1GV9A 1PVC1 4XTMA 5FXWA 1WCSA 4Y26A 1POV1 2XJRA 2JKBA 4KQ7A 4MGTA 4AK3A 3JU9A 3ZXKA 2G9GA 4GALA 1QIQA 3HT2A 5KHJA 1S0IA 5FZ9A 5JZGA 2ORZA 3Q8FA 2XL9A 4KGQA 4YFWA 4XUOA 3VN4A 3LQCA 3HD8B 2WABA 3MLKA 4FPOB 5F5QA 5FTTC 2JDNA 4KL1A 2MNGA 5FZCA 4AGGA 3EXUA 4GJYA 4RQPC 5IYYA 4FOYA 4GD4A 1D0GA 5F3EA 4YSFA 3S7IA 1D4VB 1NZIA 2W08A 5HCAA 4QPGC 4XVHA 1V6KA 1ND2C 2A6YA 4LUMA 5HI0A 3B9IA 2HYXA 4K6BA 3RMYA 3VL9A 4WVZA 3WT3A 4TLFA 1R091 2BGCA 3QH7A 4EV0A 3AP4A 1JHJA 1JZ8A 1S2BA 4XCAA 4JKKA 5A7NA 5KXDA 5D8AC 2W94A 4MHRA 4B4QA 1DGRA 2R7EB 1W8TA 1AR71 3AKRA 5FYUA 4YPJA 3URFA 4PIXA 1UW8A 4BDVB 4E4SA 1UMZA 3NW4A 1BEV2 1SFNA 1HRI1 3AFKA 3U0ZA 1K5MB 4IEXA 2FCTA 2FCUA 5LBFA 1IZ3A 1S4CA 1W6PB 1YI7A 1VBE1 5JIUA 5J3UA 2UYAA 2HKXA 3Q9OA 1OKQA 2D6LX 2W68A 5KWRA 3CJIB 3MW2A 5ABJB 1DYPA 1UF2C 3SLIA 2EAAA 4PJYA 5FZ0A 2B5HA 4QXKA 2DFBA 4XILA 1SBFA 4NUBA 3JD72 3KV5A 1JI6A 1JZ7A 4L92A 5FV3A 5DDJ1 1TNRA 4LHLA 3WDXA 2IXJA 2BQPA 2A71A 1V6MA 4MGIE 3EO6A 5F5IA 5FYSA 3WY6A 2RS13 3ZN5A 1WA6X 3IPVB 4M01A 4UF0A 4X8PA 5FZOB 1NKGA 2WNUA 3PMEA 5A3PA 1PGL2 2LUWA 3BCWA 4G4FA 1D2SA 4GB32 3PTYA 4QB6A 3NL1A 5FY9A 1OLME 4HPKB 3WF1A 3H9AA 4PT6A 2A5ZA 4AWDA 1V6OA 2QCSB 2CHHA 3SEPA 5FBJA 1QQP1 1UXZA 1WLCA 2YBPA 3ON7A 3RRDA 4QKDA 3IB3A 3INAA 5L7OA 2GDFA 5JR7B 1TEIA 4PHZA 1RJ8A 2WNVA 1ZZCA 2RMU1 2HWC3 4R9BA 2A6XA 2VZ3A 3Q8BA 5T5LA 1NOVA 1HJGA 5HPOA 1QXPA 4N7UA 1RITA 5IUQA 5HBAA 4LO7A 3AMMA 4ZU5A 5CFCB 3LB9A 5IW0A 5C71A 3BOWA 1YJLA 3KCCA 1Y7BA 4XBLA 1ZM1A 1W8UA 3O1MA 4AI1A 3ZYFA 2ZX0A 2Z5WA 4GWNA 1DU3D 2WT1A 3VV1A 4OHWA 1ZRIA 1D0HA 2OUJA 5L73A 4EN6B 1HXS3 2WA4A 1ZYBA 5GZDA 1RINA 3FBMA 3DECA 4XQWA 3ROUA 2ILMA 3AMNA 4LHNA 1GNZA 1X8MA 3NSTA 3POGA 1BVP1 3QOPA 3O14A 3OJBA 3NJXA 2MEV3 5C8WA 4H55A 5JXJA 3ZXGA 2VNVA 1RMU3 4NIIA 2VZVA 3DUIA 5DAQA 4CP1A 1ST8A 3GYDA 1ZBE1 5C8CC 1ASJ3 3WQ0A 2BOJA 1BBT1 1LEMA 3GNEA 1ZA4A 3GXUA 1CAXA 5BV6A 2VM9A 5BYNA 1DQ4A 5FPLA 5ACA2 3RZLA 3WV6A 5HXVA 2WKKA 5E88A 1ULEA 4BYYA 1OD3A 3KV4A 1JUIA 4HFSA 4EWDA 4HVQA 2UWBA 3EMRA 1ALYA 4RQPA 2ZACA 2B9VA 4LK6A 4C0HA 1V70A 3MBWA 3CZUA 4BPZA 3VKOA 2VQAA 2VJXA 2YC4A 1Q8OA 5A6YA 1JYIA 1AUYA 2QBXA 3S6PA 2WO1A 5FXXA 2WZ8A 4M3CA 1JZ6A 1U5ZA 5FJKA 1ZZ8A 4UFMA 4YARA 1GNYA 2CV6A 2JDHA 3U10A 1OXCA 4CP9B 5C8CB 5KC6A 3VD9A 2ZGMA 1H2LA 1JODA 1S0JA 2XLAA 2ZCWA 3AB0A 5FMOL 5JAXA 1DGRN 4GZ9A 1YIPA 2GC1A 3ATGA 4ITCA 5JUVA 1PNGA 1VBE2 3M3CA 4PIYA 2ZMNA 3VDDB 1K45A 1W2UA 3P3NA 4ISRA 5FYTA 1UQXA 1VIWB 2EXKA 4COWA 2VBBA 1VBD2 3DPRC 1ZZ6A 2VMGA 3B3QE 4Q0UA 4RYDA 1J58A 3V56A 4Q0SA 1W3XA 3D0JA 4C1XA 2YU2A 3PUAA 5CIRA 3W20A 5JI7A 3RDIA 3ZR5A 1LHVA 4XMAA 1WW5A 5LK7B 2F4LA 4IGOA 3KLSA 4X6RB 4BB3A 4URTA 3RI8A 1HB1A 3N9NA 4O7XA 4ZS2A 5A3UA 1NLRA 3DV8A 1O5LA 1VAVA 2PYTA 3HIFA 4IEWA 3VKFC 5KC5A 2KR2A 3VD3A 5C4WB 3H8XA 3IIIA 1US2A 2ZGPA 4HSJA 2JKXA 4V2WA 4A41A 4DY5A 5G04L 5DN2A 1EV13 3B94A 3DEMA 1YFXA 1X7NA 4NHMA 4WM7A 1RUE3 1GYKA 5IK4A 4OUEA 2PTMA 1NY71 3C7GA 5FZFA 3UV9A 4LBQB 2ZEWA 3U75A 1QJZA 1OVSA 4CP2A 3HVDA 4LKEA 4D69A 3N3HA 1H1IA 1QJU3 1H6XA 1UYXA 3VKLA 1XXNA 1O7FA 1PVC2 1C8M1 4BQ1A 3QLQA 2P34A 3AX4A 3N7MA 4XJUA 1GNHA 4M3CE 3O0WA 3MV11 4XPVA 4JHTA 3TNQA 4BU2A 4XAEA 1A3KA 1TME1 5FZAA 1UKGA 2EIDA 2HWD1 4ZS3A 1QHDA 2JWPA 1YWKA 3VBUA 3VDDA 4BQ4A 3OBTA 4OQ9A 2ZX4A 1V6IA 1MZ6A 5I0UA 3OUHA 4A7YA 4IV1A 4LQRA 3JZVA 5FMOS 1REDA 4AL9A 2YUEA 4XACA 1XC6A 4XW3A 4YG3A 1G9AA 2ID4A 3P6BA 1X9PA 3RYKA 3SC7X 4AXOA 4AEJA 2XBO1 1W90A 5FZ6A 1Q43A 3O1OA 1FMD3 1STMA 4W6WA 2VUJA 4UWDA 3ENRA 3UKTA 2JE8A 1HRV3 1LOBA 4NROA 4DO0A 3EYPA 5JOWA 2AEZA 4Q4Y2 1XNDA 5AFBA 3LEKA 1Y9QA 2W2IA 5A3LA 3LFMA 2FMDA 5FK8A 2B46X 3Q8AA 4BJ0A 4MADA 2P1BA 1QNWA 1PO22 1ZNPA 3FC0A 2E51A 3OEBA 4K9SA 2BJSA 4YYOA 3HNYM 3ZOIA 1A34A 4B1LA 2GMMA 2J7MA 1GANA 3MIEA 3KM5A 1GQGA 2ZHMA 2ZS6B 3AFGA 4NO4A 4XAAA 2RG4A 3CL1A 2XJSA 3CJIA 3CO2A 4ASKA 3D0SA 4ZU4A 4ZZ8A 4RR3B 1VBE3 5JOYA 3E5UA 5A7OA 3N7JA 3RJRA 2VXRA 4BK5A 5GKAC 3HN3A 1DHKB 2W39A 3LFIA 5DQ0A 2ES3A 2ZJCA 1QXRA 4UFJA 4WVMA 4CCEA 4NR1A 4N43C 4XFAA 5B4NA 1C3HA 2CWMA 4JC1A 3KHBA 1NLQA 4XFHA 1QJY1 2ETEA 4MXWB 2CDOA 3NNLA 3TYJA 4ATFA 3WNMA 1UZ0A 2Y0OA 4GMP0 3LOBA 2Z4FA 5T3NA 1QWRA 5JI9A 1O4ZA 2E63A 2Q4SA 4FFIA 1NXD1 1XU2A 3AJZA 3K4DA 4A4AA 3T08A 1KRIA 1RVF2 3L2YA 3USUA 4CE8A 4NRQA 1PO23 1QJX3 1S1AA 2O14A 2XJVA 2ZX3A 3GZUC 2BVBA 3J8F1 1QH6A 3BYWA 2WAOA 2Y8KA 2VUAA 2R1BA 2PLV3 5FY8A 4ISQA 4P9GA 3HWJA 4AHZA 1W9WA 3ACLA 2NN8A 2Y6JA 1FAYA 2ZA9A 3MV01 5FXVA 3UKNA 3AK0A 5FLIA 4NIDA 3J9SA 3ES1A 3H3ZA 3O5SA 3OGJA 2AENA 2W91A 5LK5A 5T50A 1NQDA 3J8F3 1PVXA 1ENQA 2AEYA 2D7FA 2V4AA 2WLPA 3CDZB 3HQRA 4LOSA 5CKNA 4MG2A 1O8PA 2DCTA 4Q4X2 3RYPA 2WQZC 2CGOA 4AFBA 1I6XA 2ZPXA 2WIIB 4Q5OA 2JDAA 4DS0A 2D6PA 1F4AA 1QOTA 3LD8A 1RUI3 1OF3A 1REFA 1DQ6A 4M0HA 2YC2A 3LE0A 4RR3A 4A42A 4Q4V2 2ZZQA 1BMV2 2C9KA 1VE0A 4OHZA 4BLJA 5JXIA 5F2WA 2WNVC 3JUUA 2KXLA 3NQHA 4FPCA 3GHNA 3HOBA 3AXEA 3MF9A 3VHOA 5F39A 2Y6GA 4G9SB 1C5IA 3PTRB 1AR62 5JXGA 5CAZA 1N1TA 4MXWA 2X5IA 3UGFA 3NNJA 4AHXA 4E8DA 2VBPA 1F5FA 3AP7A 1YIFA 2VE1A 4CCOA 1RUOA 1QJU2 1W0NA 3I3BA 4JGYB 1VBA2 4NWWA 1J1TA 4XUTA 3JQWA 2GMPA 4R9DA 4B4PA 2DDUA 2HWF3 5H9PA 4AEMA 3J7MA 1NAEA 2W95A 5AC91 5IVEA 4XFGA 5JSPA 4QXBA 1AYM3 2HWB2 4P9IA 3ZYRA 1S2KA 1NA1C 5B2GB 1N1VA 2B45X 3AYDA 3V64A 5FQ0A 4FP2A 3ACGA 4CPBA 1ULCA 5CFCC 1E5RA 5LRSA 5LWBA 4AE2A 5LCWL 2WFPA 4FTEA 5A7WB 3HQUA 1PO12 1OOPB 2QQJA
chains in the Genus database with same CATH topology
2VMFA 3FN9A 1GOFA 3UNPA 4CU8A 3C7EA 3F2ZA 3SKJE 2B4KA 2W1UA 3ACFA 3T2OA 1LNSA 5DMYA 1GOHA 4MGQA 1D7PM 3LPGA 2J1VA 1ULPA 5J1XA 1NT0A 1W9TA 2BZDA 1GMMA 3HNBM 3WNNA 3WNPA 4A6OA 4M4PA 1RYYA 2W92A 1H6YA 2E31A 3LEIA 2WNOA 1I5PA 4XURA 3W5NA 3VD4A 4CUCA 5B4XA 2WN2A 3NJVA 3K77A 3KQ4B 3OGRA 3LPFA 3JXSA 2J1RA 4P5YA 4CU9A 2ZEZA 1KGYA 3HJRA 4A45A 4LORA 4GWIA 1GU3A 3ETPA 3OB8A 3C8XA 4UI9L 2WDBA 3WF3A 3ECQA 2HLEA 2V4VA 4JHZA 2RV9A 2X05A 1DP0A 1OH4A 3DYOA 2J22A 4P00B 1PX3A 3I2HA 3T0DA 2VL4A 4OYUA 2E33A 1NUKA 1JU3A 4LOTA 1W8NA 1O8SA 1SG3A 1T2XA 5DPNA 3WF4A 2KD7A 2VZ1A 2WN3A 2W87A 3E1F1 3I2JA 2VMDA 4QDSA 2EIBA 4PQQA 1F4HA 3T0AA 3VDCA 5JXHA 5LA2A 2VZQA 4GWJA 2QQMA 2VZPA 4BK4A 4PF1A 3T0BA 4W50A 1NX9A 2XONA 3OGVA 3BN6A 5CYYA 1US3A 1P8JA 1K12A 3CZJA 5CKQA 1PMHX 1WCQA 1IQDC 1J83A 2VQTA 2ORXA 2LW8A 1SPPA 2QQNA 5EIYB 2VMEA 3ACIA 3A7QA 3WEZA 2QQLA 1DLCA 3ABZA 1OF4A 1SZBA 3T09A 3C7FA 2WO3A 2DCJA 2ORZA 4XUOA 3LQCA 2WABA 3THCA 5JR2A 5IYYA 1R64A 3FHAA 4KI5M 1UYZA 2QQKA 4W4ZA 4ZY9A 1NZIA 2W1QA 3CMGA 4XVHA 4W8JA 5LA1A 1O59A 2HYXA 2QQIA 4AAXA 2W9XA 4P08A 1JHJA 1JZ8A 4JKKA 3WF0A 2W94A 2R7EB 4BDVB 4YPJA 1UY2A 3GM8A 4DUXA 3HPNA 2VCAA 2RJ2A 4XUNA 3DYPA 3OEAA 3VD7A 5C7GA 5A1AA 1UY4A 1UMIA 1UY3A 1EUUA 1JZ4A 4E8CA 3POJA 5CZKA 2XQXA 3WQBA 1JI6A 1JZ7A 4QB1A 4QDQA 4RN5A 2J1EA 2W3JA 3VDAA 2ZEYA 4KWUA 1NKGA 3BGAA 2BGOA 1UXXX 1W9SA 2CDPA 3POFA 4DXRA 2VMCA 3A22A 2PQSA 4QB6A 1SHWB 4IUGA 3ACHA 2W47A 3T2QA 4PT6A 3WF1A 4ARYA 2DCKA 1PX4A 2J1UA 3SEPA 1UXZA 2V72A 4CU7A 3IB3A 1TG7A 3FHQA 2BGPA 3DYMA 2C4XA 3POIA 3AC0A 4BXSV 4OMDA 1SDDB 3MUY1 2VZ3A 1DYOA 5HPOA 2BBAA 5C71A 1L7RA 4JX0A 3MUZ1 5EJ1B 1UY0A 3OGSA 3I2FA 1CX1A 5IJRA 3VDBA 3DECA 3C7OA 3K4ZA 5FUIA 1GQPA 2WAAA 4DXTA 3POGA 1HN1A 4KMQA 4CU6A 2Y6LA 3NJXA 2VO5A 5C70A 5JXJA 2VQUA 3NNGA 1JYWA 2VZVA 4UOJA 4QB2A 1CZVA 2E32A 3GXUA 4ZZ5A 2VZSA 2VM9A 3CQOA 4A3ZA 4LMFA 1OD3A 2VR4A 4LKSA 2B9VA 5I0DA 1BHGA 3MBWA 3CZUA 3LEGA 3PUIA 3WF2A 3WNKA 2VJXA 2YC4A 2E26A 4JKLA 4XUQA 2QBXA 2WO1A 2JD9A 1JYXA 2WZ8A 4D8MA 1JZ6A 4DUWA 4CUBA 2VZUA 4CVUA 1GNYA 3I2IA 3I2KA 3NRUA 2QQOA 3VD9A 2VCBA 1XPWA 1SPPB 1YQ2A 4GZ9A 3ZM8A 3CIHA 5JUVA 3P1IA 4FI9A 4JKMA 2L9LA 2VZRA 1J84A 3I97A 5EJZB 3IAPA 1K45A 3CKHA 2X09A 3OBAA 1W8OA 1K3IA 2VTFA 2WBKA 4RYDA 3A23A 4ARXA 4ET7A 2WQ8A 3WNOA 1MPXA 1UMHA 2LS6A 3POEA 1K42A 3VD5A 3SEEA 4LPLA 3VD3A 3IIIA 1US2A 2JKXA 4A41A 5G04L 4QX0A 5DN2A 2Y64A 3DEMA 2YB7A 5HXMA 2BERA 4OUEA 3C7GA 4DXSA 2ZEWA 4QX3A 1H6XA 3HEIA 1UYXA 4P02B 1UX7A 2OKXA 2VCCA 3MV11 1JYVA 1WKYA 3IAQA 4QX2A 3T2PA 4QAWA 4ZXEA 2EIDA 4QDRA 2Y6KA 1JU4A 4XUPA 1JZ5A 3UESA 1CZSA 3SKVA 1OT5A 4A44A 4LQRA 4DEQA 1UWWA 1XC6A 4QPWA 2ID4A 3P6BA 1JZ3A 2XHNA 2JE8A 2J1AA 3EYPA 2W1SA 2WO2A 3K4AA 3LEKA 3I2GA 4UAPA 4D0QA 3OG2A 3D3AA 4MADA 4BJ0A 3W5MA 3OEBA 4LHSA 3HNYM 3IDAA 5CKMA 3C7HA 3K46A 1TVGA 2J7MA 4DUVA 3THDA 4HG6B 5LA0A 5CISA 3FL7A 1PMJX 5IHRA 1W99A 3GDBA 2XOMA 2J1SA 3HNMA 4ZZ8A 2YFZA 4BK5A 3HN3A 4TXWA 3PUHA 2VC9A 5DQ0A 5JMOA 3J7HA 2VOTA 2W5FA 4OZOA 3I3EA 3U37A 5B4NA 1XNAA 4XZUG 2CDOA 2ZEXA 2RVAA 3K75B 4TTGA 3WNMA 1UZ0A 2WZEA 2Z4FA 3EB7A 5IFTA 3K4DA 4A4AA 1SFPA 3T08A 2EICA 1ULOA 4MOAA 2EIEA 2WAOA 4AG4A 2Y8KA 2W1WA 5IFPA 1CZTA 4CUAA 1W9WA 2Y6JA 2VZOA 3MV01 3WNLA 1JYNA 2W91A 1L7QA 4MGSA 3WSOA 3GGLA 3CDZB 4MO3M 4LOSA 5CKNA 1O8PA 2V5DA 2C26A 2YFUA 1GOGA 3I3DA 2JDAA 2X10A 1F4AA 2YG0A 1OF3A 2YC2A 3LE0A 4A42A 4Z2AA 2C9KA 5JXIA 4L0PA 3NQHA 1KEXA 4M4RA 1XNTA 3HOBA 1UYYA 1UY1A 2Y6GA 1EUTA 5JXGA 4E8DA 3POBA 2WUHA 1W0NA 1JZ2A 3I3BA 4XUTA 3A21A 2DDUA 2Y6HA 1NAEA 2W95A 3MO4A 1CIYA 2J1TA 2ZXQA 2W46A 4DEVA 3UETA 3ACGA 5F7UA 2VZTA 5G05L 2WYSA 5LCWL 4OMCA 1GUIA 4QX1A 2QQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VMF A;  3FN9 A;  1GOF A;  3UNP A;  4CU8 A;  3C7E A;  3F2Z A;  3SKJ E;  2B4K A;  2W1U A;  3ACF A;  3T2O A;  1LNS A;  5DMY A;  1GOH A;  4MGQ A;  1D7P M;  3LPG A;  2J1V A;  1ULP A;  5J1X A;  1NT0 A;  1W9T A;  2BZD A;  1GMM A;  3HNB M;  3WNN A;  3WNP A;  4A6O A;  4M4P A;  1RYY A;  2W92 A;  1H6Y A;  2E31 A;  3LEI A;  2WNO A;  1I5P A;  4XUR A;  3W5N A;  3VD4 A;  4CUC A;  5B4X A;  2WN2 A;  3NJV A;  3K77 A;  3KQ4 B;  3OGR A;  3LPF A;  3JXS A;  2J1R A;  4P5Y A;  4CU9 A;  2ZEZ A;  1KGY A;  3HJR A;  4A45 A;  4LOR A;  4GWI A;  1GU3 A;  3ETP A;  3OB8 A;  3C8X A;  4UI9 L;  2WDB A;  3WF3 A;  3ECQ A;  2HLE A;  2V4V A;  4JHZ A;  2RV9 A;  2X05 A;  1DP0 A;  1OH4 A;  3DYO A;  2J22 A;  4P00 B;  1PX3 A;  3I2H A;  3T0D A;  2VL4 A;  4OYU A;  2E33 A;  1NUK A;  1JU3 A;  4LOT A;  1W8N A;  1O8S A;  1SG3 A;  1T2X A;  5DPN A;  3WF4 A;  2KD7 A;  2VZ1 A;  2WN3 A;  2W87 A;  3E1F 1;  3I2J A;  2VMD A;  4QDS A;  2EIB A;  4PQQ A;  1F4H A;  3T0A A;  3VDC A;  5JXH A;  5LA2 A;  2VZQ A;  4GWJ A;  2QQM A;  2VZP A;  4BK4 A;  4PF1 A;  3T0B A;  4W50 A;  1NX9 A;  2XON A;  3OGV A;  3BN6 A;  5CYY A;  1US3 A;  1P8J A;  1K12 A;  3CZJ A;  5CKQ A;  1PMH X;  1WCQ A;  1IQD C;  1J83 A;  2VQT A;  2ORX A;  2LW8 A;  1SPP A;  2QQN A;  5EIY B;  2VME A;  3ACI A;  3A7Q A;  3WEZ A;  2QQL A;  1DLC A;  3ABZ A;  1OF4 A;  1SZB A;  3T09 A;  3C7F A;  2WO3 A;  2DCJ A;  2ORZ A;  4XUO A;  3LQC A;  2WAB A;  3THC A;  5JR2 A;  5IYY A;  1R64 A;  3FHA A;  4KI5 M;  1UYZ A;  2QQK A;  4W4Z A;  4ZY9 A;  1NZI A;  2W1Q A;  3CMG A;  4XVH A;  4W8J A;  5LA1 A;  1O59 A;  2HYX A;  2QQI A;  4AAX A;  2W9X A;  4P08 A;  1JHJ A;  1JZ8 A;  4JKK A;  3WF0 A;  2W94 A;  2R7E B;  4BDV B;  4YPJ A;  1UY2 A;  3GM8 A;  4DUX A;  3HPN A;  2VCA A;  2RJ2 A;  4XUN A;  3DYP A;  3OEA A;  3VD7 A;  5C7G A;  5A1A A;  1UY4 A;  1UMI A;  1UY3 A;  1EUU A;  1JZ4 A;  4E8C A;  3POJ A;  5CZK A;  2XQX A;  3WQB A;  1JI6 A;  1JZ7 A;  4QB1 A;  4QDQ A;  4RN5 A;  2J1E A;  2W3J A;  3VDA A;  2ZEY A;  4KWU A;  1NKG A;  3BGA A;  2BGO A;  1UXX X;  1W9S A;  2CDP A;  3POF A;  4DXR A;  2VMC A;  3A22 A;  2PQS A;  4QB6 A;  1SHW B;  4IUG A;  3ACH A;  2W47 A;  3T2Q A;  4PT6 A;  3WF1 A;  4ARY A;  2DCK A;  1PX4 A;  2J1U A;  3SEP A;  1UXZ A;  2V72 A;  4CU7 A;  3IB3 A;  1TG7 A;  3FHQ A;  2BGP A;  3DYM A;  2C4X A;  3POI A;  3AC0 A;  4BXS V;  4OMD A;  1SDD B;  3MUY 1;  2VZ3 A;  1DYO A;  5HPO A;  2BBA A;  5C71 A;  1L7R A;  4JX0 A;  3MUZ 1;  5EJ1 B;  1UY0 A;  3OGS A;  3I2F A;  1CX1 A;  5IJR A;  3VDB A;  3DEC A;  3C7O A;  3K4Z A;  5FUI A;  1GQP A;  2WAA A;  4DXT A;  3POG A;  1HN1 A;  4KMQ A;  4CU6 A;  2Y6L A;  3NJX A;  2VO5 A;  5C70 A;  5JXJ A;  2VQU A;  3NNG A;  1JYW A;  2VZV A;  4UOJ A;  4QB2 A;  1CZV A;  2E32 A;  3GXU A;  4ZZ5 A;  2VZS A;  2VM9 A;  3CQO A;  4A3Z A;  4LMF A;  1OD3 A;  2VR4 A;  4LKS A;  2B9V A;  5I0D A;  1BHG A;  3MBW A;  3CZU A;  3LEG A;  3PUI A;  3WF2 A;  3WNK A;  2VJX A;  2YC4 A;  2E26 A;  4JKL A;  4XUQ A;  2QBX A;  2WO1 A;  2JD9 A;  1JYX A;  2WZ8 A;  4D8M A;  1JZ6 A;  4DUW A;  4CUB A;  2VZU A;  4CVU A;  1GNY A;  3I2I A;  3I2K A;  3NRU A;  2QQO A;  3VD9 A;  2VCB A;  1XPW A;  1SPP B;  1YQ2 A;  4GZ9 A;  3ZM8 A;  3CIH A;  5JUV A;  3P1I A;  4FI9 A;  4JKM A;  2L9L A;  2VZR A;  1J84 A;  3I97 A;  5EJZ B;  3IAP A;  1K45 A;  3CKH A;  2X09 A;  3OBA A;  1W8O A;  1K3I A;  2VTF A;  2WBK A;  4RYD A;  3A23 A;  4ARX A;  4ET7 A;  2WQ8 A;  3WNO A;  1MPX A;  1UMH A;  2LS6 A;  3POE A;  1K42 A;  3VD5 A;  3SEE A;  4LPL A;  3VD3 A;  3III A;  1US2 A;  2JKX A;  4A41 A;  5G04 L;  4QX0 A;  5DN2 A;  2Y64 A;  3DEM A;  2YB7 A;  5HXM A;  2BER A;  4OUE A;  3C7G A;  4DXS A;  2ZEW A;  4QX3 A;  1H6X A;  3HEI A;  1UYX A;  4P02 B;  1UX7 A;  2OKX A;  2VCC A;  3MV1 1;  1JYV A;  1WKY A;  3IAQ A;  4QX2 A;  3T2P A;  4QAW A;  4ZXE A;  2EID A;  4QDR A;  2Y6K A;  1JU4 A;  4XUP A;  1JZ5 A;  3UES A;  1CZS A;  3SKV A;  1OT5 A;  4A44 A;  4LQR A;  4DEQ A;  1UWW A;  1XC6 A;  4QPW A;  2ID4 A;  3P6B A;  1JZ3 A;  2XHN A;  2JE8 A;  2J1A A;  3EYP A;  2W1S A;  2WO2 A;  3K4A A;  3LEK A;  3I2G A;  4UAP A;  4D0Q A;  3OG2 A;  3D3A A;  4MAD A;  4BJ0 A;  3W5M A;  3OEB A;  4LHS A;  3HNY M;  3IDA A;  5CKM A;  3C7H A;  3K46 A;  1TVG A;  2J7M A;  4DUV A;  3THD A;  4HG6 B;  5LA0 A;  5CIS A;  3FL7 A;  1PMJ X;  5IHR A;  1W99 A;  3GDB A;  2XOM A;  2J1S A;  3HNM A;  4ZZ8 A;  2YFZ A;  4BK5 A;  3HN3 A;  4TXW A;  3PUH A;  2VC9 A;  5DQ0 A;  5JMO A;  3J7H A;  2VOT A;  2W5F A;  4OZO A;  3I3E A;  3U37 A;  5B4N A;  1XNA A;  4XZU G;  2CDO A;  2ZEX A;  2RVA A;  3K75 B;  4TTG A;  3WNM A;  1UZ0 A;  2WZE A;  2Z4F A;  3EB7 A;  5IFT A;  3K4D A;  4A4A A;  1SFP A;  3T08 A;  2EIC A;  1ULO A;  4MOA A;  2EIE A;  2WAO A;  4AG4 A;  2Y8K A;  2W1W A;  5IFP A;  1CZT A;  4CUA A;  1W9W A;  2Y6J A;  2VZO A;  3MV0 1;  3WNL A;  1JYN A;  2W91 A;  1L7Q A;  4MGS A;  3WSO A;  3GGL A;  3CDZ B;  4MO3 M;  4LOS A;  5CKN A;  1O8P A;  2V5D A;  2C26 A;  2YFU A;  1GOG A;  3I3D A;  2JDA A;  2X10 A;  1F4A A;  2YG0 A;  1OF3 A;  2YC2 A;  3LE0 A;  4A42 A;  4Z2A A;  2C9K A;  5JXI A;  4L0P A;  3NQH A;  1KEX A;  4M4R A;  1XNT A;  3HOB A;  1UYY A;  1UY1 A;  2Y6G A;  1EUT A;  5JXG A;  4E8D A;  3POB A;  2WUH A;  1W0N A;  1JZ2 A;  3I3B A;  4XUT A;  3A21 A;  2DDU A;  2Y6H A;  1NAE A;  2W95 A;  3MO4 A;  1CIY A;  2J1T A;  2ZXQ A;  2W46 A;  4DEV A;  3UET A;  3ACG A;  5F7U A;  2VZT A;  5G05 L;  2WYS A;  5LCW L;  4OMC A;  1GUI A;  4QX1 A;  2QQJ A; 
#chains in the Genus database with same CATH topology
 2VCM A;  1GOF A;  2TBV A;  3NAP C;  4YRD A;  3KSC A;  2XWB B;  3SKJ E;  2E53 A;  3KF3 A;  2VW0 A;  4JDM A;  4IV1 C;  1LNS A;  5CEH A;  5DMY A;  5JDB A;  2Z42 A;  2YV8 A;  1T6G C;  3PIJ A;  4JQT A;  5LRR A;  1H1M A;  4FQZ A;  4D3W A;  4YFZ A;  1F31 A;  1AZD A;  1K5M A;  5LBC A;  4Q0V A;  2GNB A;  1ULP A;  2KM2 A;  4YVW B;  5CBL A;  5TSW A;  1CPN A;  4V2V A;  1AJO A;  1GKB A;  4JRL A;  2HWD 3;  2JDU A;  2JEN A;  1RYY A;  2W92 A;  4I30 A;  4KWJ A;  4B4R A;  1IG3 A;  5FJH A;  2WNO A;  3KB5 A;  1RUH 1;  2Y33 A;  4XHB A;  1BK1 A;  2MHF A;  4XUR A;  3VD4 A;  1BEV 3;  2X5I B;  1QH7 A;  1U0A A;  4HKO A;  3NJV A;  5FP8 A;  5FY7 A;  5BNQ A;  5C9A B;  1AYM 1;  1UU5 A;  3THT A;  3SCF A;  3AZW A;  5AC9 3;  2A3X A;  2HWF 1;  4LOR A;  3RVH A;  5FIX A;  4GWI A;  5IK8 A;  1GU3 A;  3DN7 A;  2YBS A;  2YBK A;  3ETP A;  4I02 A;  4Y5T A;  3RZK A;  3C8X A;  5I91 A;  3NAP A;  4JHZ A;  3EJK A;  4MV2 A;  4AGV A;  5E89 A;  2GC3 A;  4W65 A;  1TME 3;  5A7S A;  4C0B A;  2C1F A;  3GJB A;  4S2H A;  4Y33 A;  5EQU A;  3T0D A;  4OLL A;  3NV2 A;  1KFU L;  2E33 A;  4BXF A;  5BNN B;  3OPZ A;  2CNA A;  1UZW A;  3Q8E A;  3ZPO A;  1YC6 1;  4FPF A;  1ND3 C;  4CCN A;  1UOG A;  1SG3 A;  3BU7 A;  3ZFE A;  3MIG A;  4FPL A;  1XQN A;  5I93 A;  3E1F 1;  2WLQ A;  3AKT A;  1V6J A;  1DDL A;  4A3X A;  2DV9 A;  5E1R A;  1YFU A;  2AUY A;  2BVV A;  2VZQ A;  4RHV 1;  2XWJ B;  5AVA A;  1AX1 A;  4DIQ A;  4JTN A;  4XJZ A;  5GZG A;  3PU8 A;  2DYC A;  3B5L B;  5FZ7 A;  4URA A;  1LED A;  2UYB A;  4FFH A;  3OGV A;  4FP3 A;  1YCI A;  3BN6 A;  2R6Q A;  2ARA A;  3VZJ A;  1X8E A;  3ZO0 B;  1MS5 A;  5CKQ A;  5F3C A;  2SLI A;  4NRP A;  1PMH X;  3SCH A;  1LCL A;  1MVE A;  1HRI 2;  5AVP A;  3USS A;  4Y22 A;  2FDF A;  2WS9 2;  2LW8 A;  4TWT A;  5D2A A;  4X8N A;  3FX3 A;  4H14 A;  4CZS A;  2E7A A;  3IIA A;  2ZZJ A;  4AAP A;  3LGR A;  2OYZ A;  4LTA A;  1SBD A;  1VBC 3;  3ACI A;  4OHV A;  2QZ3 A;  1SLB A;  4IXL A;  4AW7 A;  4NPL A;  4RGA A;  1BQP A;  4EZH A;  4E2Q A;  1JS9 A;  2DTW A;  5BPX A;  1OF4 A;  4EN7 B;  3T09 A;  5C5T A;  1WGP A;  5KHK A;  2DCJ A;  3WCR A;  2AYH A;  4GMP 1;  2G9F A;  1FOD 1;  3WD5 A;  3AKP A;  4COZ A;  3VBF C;  3B69 A;  1FPN 3;  1R08 1;  4HVR A;  3WUC A;  1FOD 2;  2WS9 3;  3J4U H;  4PI0 A;  4HN0 A;  5K0U B;  1MVQ A;  1MQT C;  3FHA A;  1UYZ A;  4W4Z A;  5K9Y A;  3ZPY A;  3IMN A;  4BIO A;  3KGZ A;  4M3C F;  5ABJ C;  1H4H A;  4FFG A;  4W8J A;  5F37 A;  5KXE A;  3WUD A;  5LA1 A;  1PK6 B;  4GH4 B;  1RB8 G;  1O59 A;  3AP9 A;  4PQ9 A;  2HWE 1;  1VAK A;  3LSE A;  4XF9 A;  5A3T A;  4HOO A;  3ZDS A;  4EYU A;  1H9W A;  2K46 A;  3ASI A;  3KGL A;  1HXS 1;  3GM8 A;  1NA1 A;  2RR1 3;  3ZSM A;  3HPN A;  3ZSJ A;  3KCY A;  3R4S A;  4GB3 3;  1X36 A;  2VCA A;  4LO5 B;  3UT0 A;  1ZBE 3;  1NG0 A;  1XB9 A;  4XUN A;  4YZ3 A;  3AMQ A;  3T2T A;  3MPB A;  1JZ4 A;  1POV 0;  3VD7 A;  5A1A A;  2YU1 A;  5IVY A;  1UY4 A;  5F1R A;  1IS6 A;  1UMI A;  4EWA A;  4IE5 A;  1XYO A;  1EUU A;  1YXW A;  1UZZ A;  3K3N A;  3WG3 A;  1OLR A;  2B7Y A;  1PIV 2;  1EAH 1;  1ZBA 3;  3TWI A;  2XQX A;  2YZ4 A;  2NMN A;  4NE9 A;  4QHO A;  1I3H A;  2XUM A;  3LIG A;  3OSD A;  3QD6 A;  4QB1 A;  3AMH A;  3ITQ A;  3ZFG B;  1MS9 A;  2BU9 A;  5T52 A;  3H8O A;  1GQH A;  1WME A;  1OA4 A;  4FBF A;  4RS5 A;  3WX5 A;  2VOX A;  1QQP 3;  2JB4 A;  4KWU A;  4RGG A;  3SMH A;  2Q8E A;  3N9O A;  4D6S A;  4YM0 A;  1QDC A;  4IER A;  4RSU A;  5DUX A;  5LAT A;  2D44 A;  4UT5 A;  4XF3 A;  4NJ4 A;  4IUG A;  3ACH A;  2W47 A;  4ARY A;  2DCK A;  2D43 A;  1CR7 A;  1PX4 A;  4XYX A;  5FZ8 A;  2GND A;  1FYU A;  1DFQ A;  2CSG A;  1YO8 A;  2RMU 3;  2V72 A;  3O12 A;  1BBT 2;  4NPR A;  4Z82 A;  5IAT A;  2RS1 1;  2H6B A;  2RJK A;  4IET A;  5A3W A;  3HT1 A;  1QKQ A;  5GZE A;  1B09 A;  5L9R A;  1OMI A;  1HJF A;  1MZE A;  2VOW A;  3AJY A;  3AC0 A;  3N9P A;  2BYV E;  3MUY 1;  4UYB A;  5KHH A;  4CYD A;  1NA1 B;  1NXM A;  1QOS A;  2Q5T A;  1SFY A;  1UIK A;  3JBG 3;  2FQP A;  2GH2 A;  2HEW F;  1X82 A;  4YWA A;  3WP5 A;  4DZG A;  2GU9 A;  1EV1 1;  3MPP G;  3IMM A;  5FZK A;  4IE6 A;  4KWK A;  1XE8 A;  4CEW B;  2FCV A;  1R1A 1;  3DKW A;  4XIK A;  4RA0 A;  4BHP A;  4YVS B;  2OZ6 A;  2WNU B;  1L7R A;  2XB6 C;  2FD8 A;  4UW6 A;  2D93 A;  3MUZ 1;  5EJ1 B;  3BVC A;  2EAL A;  2A75 A;  4TLG A;  3FE5 A;  1OI6 A;  5A1F A;  1H8V A;  1O6U A;  3VDB A;  2EXH A;  2A73 B;  3KT7 A;  3PHM A;  5FUI A;  1PK6 A;  1GQP A;  4Q0Q A;  3I59 A;  1W6Q B;  3THP A;  3TEW A;  2NPI A;  3PUQ A;  2B9U A;  2GSY A;  3MLL A;  2PHR A;  2XML A;  2Y6L A;  4AEK A;  4LA3 A;  2VO5 A;  4AQ6 A;  5C70 A;  4UOJ A;  5GLT A;  4XJA A;  3WZ1 A;  1RC6 A;  5FXZ A;  4CTE A;  3TEY A;  2JDP A;  1ZRE A;  5HCF A;  5E8A A;  1RGS A;  3BOP A;  1LOF C;  3U1X A;  2XVL A;  2E32 A;  3VBO A;  4AVS A;  1W39 A;  3H3U A;  4ZZ5 A;  3AZZ A;  1A6C A;  3BIW E;  4N90 A;  1AR7 3;  2AR6 A;  1SBE A;  2C0Z A;  3GCW A;  4RS5 B;  2Q8D A;  2PHU A;  5LB6 A;  2VR4 A;  1RUC 3;  4GKY A;  4BA6 A;  4QKF A;  2CAV A;  1RHI 1;  5I0D A;  3AXD A;  3OY8 A;  3ZFF B;  3DPR B;  4O61 A;  3PUI A;  2IVJ A;  4QKN A;  3IDE A;  3WF2 A;  1SDW A;  3WNK A;  1CAU B;  1VMF A;  4CDW C;  3I49 A;  4EN8 B;  2WZR 3;  1V00 A;  3IZO A;  2DVF A;  3RG0 A;  3WW3 A;  4D8M A;  4DUW A;  4MVT A;  2YHJ A;  4CVU A;  1AHS A;  5ACA 3;  3M70 A;  1NCQ B;  4UFK A;  3AVS A;  4KNC A;  1ZRF A;  3H3L A;  1ZBA 2;  2UY8 A;  4Q4X 3;  1NCR C;  4LIT A;  3CLP A;  1E5S A;  2QDR A;  2P37 A;  3CNA A;  3H42 B;  3OUJ A;  1CPM A;  5I0S A;  4CRQ A;  5DZG A;  2L9L A;  1QJE A;  1MQT A;  4HMZ A;  1W8O A;  1AR6 3;  3ZIW A;  1PZ7 A;  4XC9 A;  1OQ1 A;  3OF1 A;  3S57 A;  1DYK A;  4FPG A;  4PF5 A;  2MEV 1;  2VXJ A;  2WBK A;  3A23 A;  4ARX A;  5FWJ A;  1SCR A;  3CHX A;  4ZU7 A;  3M3I A;  3NMB A;  4LIV A;  4BQ2 A;  4LT5 A;  4MUV A;  2XDV A;  4BQW A;  1AXK A;  1O5U A;  2DTY A;  1UMH A;  1OPO A;  1YHF A;  1XOY A;  3B02 A;  4XZP A;  2JX9 A;  4I3G A;  1AVB A;  2VTX J;  3ZN6 A;  2VY0 A;  4E9K A;  2HWB 3;  5IVJ A;  3WP4 A;  3PUS A;  2BWA A;  1N1S A;  4LPL A;  5C3R A;  1UO9 A;  4OUL A;  5JLV A;  1NCR B;  2HWF 2;  1OH3 A;  2QQV A;  4CP9 A;  5C8C A;  5GLZ A;  4OZX A;  1CX4 A;  4IV3 C;  4QMA A;  5DUU A;  3VDD C;  1ZZ9 A;  2XQR A;  5F9T A;  3FUQ A;  2QFE A;  3GF6 A;  3EHK A;  4NHX A;  1XSR A;  3NV4 A;  1AR8 1;  4DXS A;  3S5A A;  4NPM A;  2UY9 A;  2VUL A;  1Q8Q A;  5FLJ A;  1URX A;  2OQ6 A;  5A33 B;  1VB2 A;  1CES A;  2VW1 A;  2A7A A;  2VEC A;  1AYN 3;  3GJA A;  4P02 B;  4QPI C;  4BQ3 A;  4E4H A;  1CJD A;  1F8V A;  1XSQ A;  2ZHK A;  4L97 A;  1PZ9 A;  5JPM B;  4ZON A;  1AL2 3;  1WWY A;  3N9L A;  1Q3E A;  3JCI A;  1WKY A;  4PI2 A;  3T2P A;  3MZH A;  1YQ8 A;  1ULF A;  5I8S A;  5C33 A;  3RZJ A;  1HX6 A;  4YGB A;  2G4I A;  3EBR A;  5LW9 A;  3DXT A;  4FVV A;  1Z7S 1;  1S0G A;  4HN1 A;  2R06 1;  3B9C A;  1CZS A;  2QQP A;  1H2K A;  1UZY A;  1OT5 A;  1V9U 3;  4A44 A;  2F4P A;  1BMV 1;  2XH6 A;  4HK8 A;  3RPQ A;  1OUX A;  1ACC A;  5BY5 A;  4Q4Y 3;  2X29 A;  2QQW A;  3ILF A;  2Q30 A;  4IEQ A;  2ET1 A;  2PHT A;  4LXL A;  3B93 A;  2J42 A;  3H50 A;  4MYE A;  1W8Z A;  4Q4X 1;  2J1A A;  3GZA A;  5ANN A;  1I9R A;  5KBF A;  3VBO C;  3WR0 A;  1HV0 A;  3K4A A;  5ACA 1;  3M2M A;  4CEY C;  4LA2 A;  4UFL A;  4N43 B;  5FCC A;  5FQ0 B;  3CBN A;  3QBQ A;  4IGP A;  4AI0 A;  3BPS A;  3W5M A;  4LHS A;  5EHD A;  4BM8 A;  3O7O A;  5CKM A;  2BPA 2;  3U4X A;  3V0A B;  5FZM A;  3IN9 A;  1RHI 3;  2G9Z A;  4HG6 B;  3J7L A;  1LOF A;  1RUC 1;  5IWF A;  3THD A;  3N9Q A;  1IG0 A;  2PHD A;  2BW8 A;  4CDX A;  4OHX A;  3FL7 A;  1EY2 A;  3HNM A;  2KA3 A;  5FY5 A;  5LZ6 A;  3KT1 A;  3POW A;  1KD7 A;  3PJY A;  2VW2 A;  1J59 A;  3WDT A;  1LR5 A;  4TXW A;  2R07 3;  1KIT A;  4CDQ B;  2IFR A;  4EZ4 A;  2GME A;  5A7W A;  4QXH A;  3J7H A;  1E5I A;  2VOT A;  3E6D A;  5I8T A;  1DG6 A;  4IGQ A;  5C3S A;  4D6Q A;  3CJX A;  4OVE A;  4QPG A;  1PGW 2;  2WT0 A;  1RUE 2;  5FYY A;  4ATE A;  4I2O A;  1DQ2 A;  1XNA A;  1J1L A;  4Q26 A;  1TZO A;  1FT9 A;  3TEZ A;  2ZEX A;  3WG4 A;  4NAO A;  4HLT A;  2D6O X;  5GJ6 A;  4BWO A;  1C8M 2;  3BU0 A;  2VG9 A;  2WZE A;  2PHX A;  1Y9G A;  4DFS A;  4N7I A;  1OD5 A;  4LK7 A;  3EB7 A;  5IFT A;  4XJ9 A;  2FHR A;  1SFP A;  1D4M 3;  2BEO A;  3M3O A;  1V9U 1;  3L9J T;  4I09 A;  4YVW A;  3M8L A;  1QEX A;  4KU8 A;  2RS1 2;  1PO1 1;  4MOA A;  1R1A 3;  2D98 A;  2YRO A;  4Q4W 2;  4R8H A;  4QXC A;  4RFR B;  4YW4 A;  4AVB A;  1GP5 A;  4BQX A;  5FZ1 A;  2OT7 A;  5A3O A;  2WR9 A;  4NHY A;  4Y3O A;  3OD0 A;  1JYN A;  5FYC A;  4ORF A;  1QXJ A;  1PGL 1;  2ZX1 A;  1L7Q A;  5A80 A;  1ND3 A;  3O1P A;  4Q4Y 1;  4MO3 M;  4Y1Z A;  5JMC A;  2ADE A;  3BPZ A;  3MFA A;  4GA9 A;  3VBR A;  5GLU A;  5DAW A;  4AQ2 A;  5FPX A;  2C26 A;  1Z0H A;  1JOJ A;  4WVV A;  2BP6 A;  1GOG A;  2D6K A;  2PEL A;  1AR8 3;  4XDP A;  1XJA A;  1JOP A;  1RUI 2;  3RGB A;  2WO7 A;  3NV3 A;  4S2F A;  4I01 A;  4ES9 A;  1Q8P A;  4PLM A;  3RZG A;  2WL1 A;  2A6W A;  1KEX A;  2JDM A;  1IS4 A;  4M4R A;  5BUV A;  4ZXK A;  3ZXD A;  3GBF A;  5FY0 A;  3RZZ A;  3VB9 A;  1OUR A;  5AFE A;  2MPF A;  3POB A;  3AMP A;  2VTX A;  2WUH A;  3NNM A;  3RMX A;  1JZ2 A;  3ZFF C;  2X53 S;  5FPB A;  2LAL A;  1W6Q A;  5KHG A;  2Y6H A;  2BRT A;  1I5Z A;  2NLR A;  3GZT B;  3N35 A;  4GKX A;  5I0R A;  5I8Y A;  5CG8 A;  5A6Z A;  4E4D X;  3MIC A;  2VD7 A;  4TYS A;  2J1T A;  2XGX A;  3PVB B;  4AZZ A;  4ERO A;  1RVF 3;  3VBF A;  1QDO A;  3UET A;  2WWU A;  2XJQ A;  2VZT A;  4YGE A;  3K48 A;  3LZZ A;  4LBQ D;  2XKP A;  5C4W A;  3GBG A;  4OMC A;  2GZW A;  4FTS A;  4CDQ A;  1KDM A;  3HBK A;  1HV1 A;  1RUD 3;  2VMF A;  3J8F 2;  5J36 A;  3E6B A;  4N53 A;  2VNO A;  4KWL A;  2ARE A;  3RQ0 A;  2TEP A;  1W2O A;  1Z78 A;  2HWE 3;  3F2Z A;  3WG2 A;  2B4K A;  1AYN 2;  1C8N A;  2JG9 A;  1H1A A;  3ACF A;  5FUN A;  3ZDV A;  4D7T A;  2WQ4 A;  2YPD A;  3PU3 A;  2CYF A;  2DUQ A;  4MGQ A;  5EFU A;  1D7P M;  1RUJ 3;  4NIH A;  1WMF A;  1G9F A;  3LPG A;  2NMO A;  4JZR A;  1QGL A;  4YM2 A;  2WS9 1;  1VPH A;  5J1X A;  1FPN 1;  1R08 3;  1NT0 A;  5FZI A;  2JE9 A;  1ZRC A;  5FP4 A;  4LBL A;  3HNB M;  4LEJ A;  5D21 A;  3WNN A;  1IPS A;  1FOD 3;  1S0F A;  2VVD A;  4GMP 3;  4A6O A;  5CFD B;  1H30 A;  4EWE A;  5FPA A;  1AL2 2;  4P9X A;  2RS3 3;  4CPB D;  2RR1 2;  5B4X A;  1AR8 2;  3K77 A;  4AVV A;  4JGZ C;  3ZXJ A;  3FMG A;  4DB5 A;  4B29 A;  5FOB B;  4D7S A;  3LPF A;  4YGC A;  1OQD A;  4IV1 B;  4CDW A;  1RXF A;  3JXS A;  2RS5 3;  2AC1 A;  2J1R A;  4V1P A;  4WM8 A;  4Z1V A;  2E9Q A;  4HXC A;  4PLN A;  3HJR A;  4TSV A;  3OB8 A;  1W04 A;  1GZ9 A;  1CGP A;  1W8F A;  4DMI A;  4UI9 L;  3TOJ A;  2ZGS A;  1OH4 A;  2X05 A;  1NCR A;  1E57 A;  5ISL A;  1ULG A;  1U12 A;  2VL4 A;  4OYU A;  1IGO A;  1UZV A;  3WCS A;  2YDE A;  4LOT A;  1W8N A;  2W52 A;  4NHL A;  2DVD A;  1O8S A;  3WF4 A;  1Y4W A;  1FAT A;  2KD7 A;  4P9W A;  2VZ1 A;  2SBA A;  1XRU A;  1W3V A;  2WN3 A;  4MZU A;  1UIJ A;  4OQ8 A;  4COV A;  2VMD A;  1SLC A;  3T0A A;  4MET A;  1OUS A;  1RJ7 A;  4LIU A;  4OI4 A;  1T6B X;  1DIW A;  4GWJ A;  1MEC 1;  2QQM A;  4IEV A;  4EE2 A;  3MFC A;  2UU8 A;  4PF1 A;  3T0B A;  3UGH A;  4FQ4 A;  4QQH A;  4YVS A;  2E7Q A;  2DBN A;  4XFF A;  2RDQ A;  4KG8 A;  2CU5 A;  1US3 A;  3VBF B;  2IUW A;  1K12 A;  2E7T A;  2ZKN A;  3CZJ A;  1VP6 A;  1AJK A;  2HWE 2;  1IQD C;  1AF9 A;  1JBC A;  4HSL A;  5D8A A;  2XLF A;  2ORX A;  3ZKY A;  1OBN A;  2OA2 A;  2OZJ A;  4WVW A;  1X9T A;  5DUV A;  4NWV A;  2RDR A;  3LDK A;  3M1H A;  1PK6 C;  1LHW A;  1SPP A;  4AGR A;  2QQN A;  2OX0 A;  5EIY B;  1LOD A;  3AYC A;  1V6L A;  4XF4 A;  3D8C A;  2OXB A;  2JG9 B;  3A7Q A;  1KQR A;  4R9C A;  4LJH A;  1ODN A;  1J3Q A;  2I45 A;  1BXH A;  5JZG B;  1VR3 A;  5FKB A;  4M3C B;  2XXZ A;  3KCX A;  1W06 A;  4HAN A;  1SZB A;  1W9Y A;  3C7F A;  4AED B;  3ZYG A;  3CU7 A;  1WLW A;  4OHY A;  2K0G A;  2Y26 A;  1SCS A;  4MGK E;  4FXK B;  1R64 A;  1QU0 A;  3ZYI B;  4KI5 M;  4GB3 1;  2QQK A;  1RVF 1;  2BFU L;  5FY4 A;  4ZY9 A;  4Q29 A;  3WLU A;  3CMG A;  1CAU A;  1CQ9 A;  4K8F A;  4NIA A;  2RE9 A;  4AAX A;  2ERF A;  1EPW A;  2VUD A;  1MS8 A;  4LKD A;  5AC9 2;  3WIN E;  2W9X A;  4HL0 A;  4NVP A;  3MID A;  3DPR A;  1YJK A;  3ZX7 A;  2NZ9 A;  1F35 A;  3OBR A;  1UY2 A;  2QVS B;  2XJP A;  4B1M A;  1A8D A;  3ZN4 A;  3VZK A;  4CCJ A;  2G19 A;  4N9H A;  5DG2 A;  2VVE A;  3RI9 A;  3VBO B;  3AKS A;  2QTW B;  3J26 N;  5C6C A;  1POQ A;  3DYP A;  4XQ4 A;  3UGG A;  2BWC A;  3WW1 A;  2IWG B;  4NIG A;  4FXG B;  2JE7 A;  2JEC A;  3I3M A;  3NKT A;  2JG8 C;  1VRB A;  4XFB A;  5FZL A;  3VBU C;  1QF3 A;  1ND2 B;  3BAL A;  4JDN A;  4M0N A;  5FRE A;  1CJP A;  2C24 A;  4E8C A;  2FDJ A;  1WCU A;  3FBY A;  3ORJ A;  1M06 G;  2OVU A;  2DU1 A;  1GWM A;  2ARX A;  3IWZ A;  4R52 A;  4NAM A;  2PN5 A;  4RN5 A;  5A6Q A;  4JDO A;  2J1E A;  4Y4Y A;  5D8A B;  5F32 A;  1O91 A;  3WW2 A;  3K2O A;  4BCU A;  1RUF 3;  2W3J A;  3VDA A;  3DF0 A;  2ZEY A;  3T3Y A;  1S0D A;  4J25 A;  1Q56 A;  3AKQ A;  4YGD A;  1LGN A;  2BGO A;  2CDP A;  1W9S A;  2WNV B;  5C3O A;  1ZBE 2;  2ET7 A;  2O1Q A;  4DXR A;  2VMC A;  3A22 A;  1CD3 G;  1DGW A;  2PQS A;  5FMB A;  5IVC A;  1SHW B;  1UOB A;  1PNF A;  3JQX A;  1W8H A;  4H3W A;  4S2D A;  4YZ4 A;  4I3P A;  2J1U A;  2R30 A;  4YW3 A;  4PDW B;  2LTN A;  1VBC 1;  5FFO C;  4FFF A;  3VBU B;  4JGY C;  5ERL A;  2D40 A;  3FWE A;  2D3R A;  2PHF A;  3PUR A;  3RNS A;  4LHK A;  1MR5 A;  3OTF A;  4XET A;  3FHQ A;  2I2S A;  3DYM A;  5L7O B;  1W6N B;  1DLL A;  4CUG A;  3LCP A;  4C91 A;  1LHU A;  4AYU A;  3L2H A;  4BQ5 A;  4OMD A;  1DYO A;  3O0V A;  5FK7 A;  5A32 B;  1GZW B;  1W6M A;  2XHK A;  2YY1 A;  4FOW A;  2BTV C;  2JIG A;  4NHK A;  2IXK A;  1OFS A;  5FBZ A;  5FZD A;  1FPN 2;  4O65 A;  3TBD A;  4ASM B;  5FZB A;  3BKZ A;  1HXS 2;  2DVA A;  2BOI A;  3ZYB A;  4AI3 A;  5CFC A;  2F17 A;  4XXP A;  2YMZ A;  1JTZ X;  1QJX 1;  4XBQ A;  3T30 A;  4JGZ A;  4JX0 A;  1YRZ A;  3VHR A;  2JG8 A;  3V0B A;  4ZPI A;  1UY0 A;  5F6L B;  2PFW A;  1RUD 2;  1DZQ A;  3I2F A;  2VMI A;  5A33 A;  3GAL A;  5JVV A;  3K4Z A;  3OGG A;  5FP9 A;  5FLH A;  1YLL A;  5FZH A;  3ZXE A;  4KG0 A;  4KMQ A;  5BNP C;  3ZYP A;  4HKL A;  3UJO A;  2VQU A;  1JYW A;  5FKC A;  1BK0 A;  1KJR A;  1NCQ C;  2PQQ A;  4Y5Z 0;  3Q8C A;  3UKV A;  1YQC A;  2Q1M A;  3FUO A;  1MZ5 A;  3WOG A;  2ENR A;  2WNU C;  5C9A A;  1EP0 A;  1COV 2;  4Y24 A;  5HV4 A;  4QQO A;  5HCB A;  4UW5 A;  3I7D A;  1UU6 A;  2C9A A;  4FPK A;  4QGL A;  3RYR A;  3SH4 A;  3MI8 A;  3U78 A;  4JRA A;  1W0P A;  2BV4 A;  2RS3 2;  4K20 A;  5FZE A;  3LEG A;  4XXA A;  3KV9 A;  5DAX A;  4MGZ E;  5I0T A;  5JWP A;  2E26 A;  1HW5 A;  3I54 A;  2RM2 2;  3NKG A;  3IBM A;  1BCX A;  4IES A;  3FHI B;  1R1Z A;  4NRM A;  1JYX A;  3E5Q A;  1HKD A;  1NYW A;  2ZGO A;  1W28 A;  4CUB A;  1REE A;  2WFF 3;  2P3J A;  3ES4 A;  1OFN A;  2WT2 A;  3I59 B;  1OVP A;  3I2K A;  1F2N A;  3NRU A;  2QQO A;  4WM8 B;  2IFW A;  1W6N A;  2HWD 2;  3I8T A;  2VCB A;  1XPW A;  3NJZ A;  1YQ2 A;  4QX5 A;  4AFM A;  1OOP C;  1TME 2;  4FI9 A;  4XDO A;  1AR9 3;  3ZFE B;  2VZR A;  3I97 A;  2Y38 A;  2QNK A;  5GLV A;  5CG9 A;  3OPT A;  3CKH A;  4BLI A;  2AAC A;  2WSU A;  3N7L A;  1SAC A;  2PAE A;  2VTF A;  5A6X A;  3ILN A;  3ZSK A;  4MXV A;  3UK9 A;  4K3U A;  3HN1 A;  3T4V A;  4M00 A;  1MPX A;  3FFZ A;  3KHC A;  1VMJ A;  2BNO A;  1F15 A;  1S0B A;  3POE A;  5K0U A;  2K9Z A;  3MW3 A;  1B35 A;  3SHR A;  4CXX A;  1W6P A;  4Q4W 1;  2Q8C A;  4YZ2 A;  3SEE A;  4LLO A;  1J3P A;  4GH4 A;  4FT8 A;  1UYP A;  3O1S A;  1UN1 A;  1S2E A;  4IE0 A;  4WM7 B;  1C8M 3;  2VVF A;  4MH0 E;  3ZFE C;  2YPJ A;  5CAD A;  4L2N A;  3ZKU A;  5DAP A;  2ZKL A;  1AYM 2;  2YB7 A;  5FPZ A;  2XKO A;  4Q0P A;  1F9K A;  1FXZ A;  4XTP A;  2BER A;  4JGZ B;  4A7K A;  4GWM A;  4HON A;  2IXC A;  5A7Q A;  1RUE 1;  4Y4R A;  1PIV 3;  4FTB A;  4YW7 A;  5APA A;  4LUL A;  2P6H A;  1GR3 A;  2QQU A;  3H1Y A;  2ADD A;  1LGB A;  2VCC A;  3KVB A;  3TN9 2;  5F3G A;  3BB6 A;  4ASL A;  2CWS A;  2HEY F;  3D4K A;  2Z2S B;  4KBB A;  1XU1 A;  3IAQ A;  4QQL A;  2P3Y A;  4QX2 A;  3VBS B;  4CA9 A;  4QAW A;  5FP3 A;  4F83 A;  4ZKT B;  1QOO A;  3MHZ A;  2QE3 A;  2OPK A;  5BNN C;  4QDR A;  5A3M A;  5D1I A;  3BTX A;  1JU4 A;  2UWA A;  4H7L A;  2PLV 1;  4XBN A;  4YM3 A;  4YG6 A;  4EN0 A;  1C57 A;  3KQR A;  4E4Z A;  3SKV A;  5L19 A;  1PO2 1;  4O9E A;  4DQA A;  1ULD A;  2R0H A;  2IZW A;  1W05 A;  2EXI A;  4J6G A;  3U11 A;  3ZXA C;  2A3Y A;  2EVX A;  4UFH A;  3TNP B;  1AL0 G;  4QPW A;  2WYF A;  4Z2W A;  2P3K A;  2GC0 A;  3I3Q A;  4QHZ A;  5H9S A;  3AZX A;  4LBO A;  1K5M C;  5L9V A;  1IS5 A;  4FAH A;  2R0F A;  3SH5 A;  1I1E A;  1OQE A;  5FPU A;  3I2G A;  4UAP A;  4QT6 A;  4AQS A;  1RUN A;  4D0Q A;  2R1D A;  4FOV A;  3RZM A;  2FBE A;  4QM9 A;  2QJV A;  3U07 A;  3TB0 A;  1SMV A;  4GXL A;  2NP0 A;  1LEC A;  2DF7 A;  5J48 A;  3WQ1 A;  1BKZ A;  4N53 C;  1VBA 1;  1H8T A;  3NVC A;  2OUH A;  3POY A;  5DG1 A;  3C7H A;  3K46 A;  1TVG A;  1H4G A;  4WVM B;  1OKO A;  1RUG 2;  5LA0 A;  5CIS A;  3RWN A;  1VBD 3;  2DWR A;  3KT4 A;  4FPY A;  5IVF A;  1CN1 A;  4YW1 A;  5JZG C;  5IAV A;  2VPV A;  1PMJ X;  3ELN A;  5C3Q A;  5IHR A;  1W99 A;  3GDB A;  2XOM A;  3RJ2 X;  5JPN B;  1UNB A;  2FDK A;  1AXZ A;  2YFZ A;  2PAM A;  2P3I A;  4Y5S A;  4CEY B;  1Q5O A;  2W5F A;  4OZO A;  3I3E A;  1ASJ 2;  2OII A;  4PCR A;  4GIQ A;  3BTY A;  3A0N A;  2IVI B;  2FDI A;  4RQP B;  4AI8 A;  4XZU G;  3J7N A;  3DCQ A;  1LU1 A;  3VZL A;  1W8W A;  1G8W A;  1FNZ A;  2RVA A;  4QU1 A;  3JBG 1;  5IVB A;  2DBI A;  4C90 A;  1XE0 A;  2EF6 A;  5L9B A;  4SBV A;  4XQD A;  4QM8 A;  2JJ6 A;  2NM1 A;  3LEM A;  5GM0 A;  4CCC A;  2VBD A;  5L7O C;  2H0B A;  3V0A A;  5FZG A;  1RUG 1;  1ULO A;  3OBZ A;  2EIE A;  4RR3 C;  2W1W A;  2XLG A;  5IFP A;  1BVV A;  1J3R A;  5EPA A;  5CFD A;  4CCL A;  1HRV 1;  4CUA A;  1WMX A;  4AVC A;  2VZO A;  2VNR A;  3H1W A;  4PLO A;  1C5H A;  2JXA A;  2GP5 A;  3WNL A;  3AZY A;  3TAY A;  2CGP A;  2DUO A;  2D3S A;  3S5Q A;  3ZIX A;  3ZLI A;  5CA6 A;  2P17 A;  3CJI C;  3H1M A;  3GGL A;  2MEV 2;  5GLW A;  2NYY A;  3KMH A;  1H9P A;  1RUG 3;  3M3Q A;  3AL6 A;  3KZ4 C;  4Q2F A;  5A3N A;  2ZAA A;  1HQN A;  2V5D A;  4HBN A;  1QJU 1;  4IDZ A;  1OHF A;  4MX3 A;  4G3Y C;  4XFI A;  2LRO A;  4DXZ A;  2YFU A;  2PAK A;  3I3D A;  5BNP B;  2XG3 A;  5T5P A;  1EAH 3;  1ZBA 1;  5A32 A;  1W6M B;  1L3J A;  1JHN A;  3R6S A;  5IAX A;  5DAB A;  1LU2 A;  4Z2A A;  3O1T A;  4L9B A;  3VKN A;  5FY1 A;  2WZR 2;  3RSJ A;  3CEW A;  1WD4 A;  4E2G A;  1H0B A;  1LEN A;  3E97 A;  3RZH A;  1FNY A;  2GN7 A;  1XNT A;  3OPW A;  1CAV B;  4QU2 A;  1UY1 A;  3RWK X;  4JAA A;  1LTE A;  2I74 A;  2FDH A;  4XCB A;  3W21 A;  2R49 A;  3OCP A;  4IV3 A;  4PDW C;  5FUP A;  5EJ3 A;  3FLR A;  1AR7 2;  3WG1 A;  2WA3 A;  4JV4 A;  5J37 A;  5C3P A;  3FFQ A;  2VAU A;  1MS4 A;  3R4D B;  3OYW A;  3R0R A;  4QX7 A;  3NNF A;  3MO4 A;  4YVW C;  4XOG A;  2HBT A;  2OS2 A;  2VH9 A;  5FYM A;  2ZXQ A;  2XL7 A;  2FZ2 A;  4BE3 A;  3KF5 A;  4XAB A;  4JTO A;  4YNI A;  4DEV A;  4IEO A;  2HH9 A;  2WYS A;  5IK7 A;  4CEW C;  2XBO 2;  1GUI A;  4QX1 A;  2ATF A;  3LA2 A;  3A0K A;  1N3P A;  5C7G A;  1IQA A;  3WDU A;  1LOA A;  3FN9 A;  3H0O A;  1MS3 A;  1UU4 A;  1W6O B;  1OOP A;  4CU8 A;  1R09 3;  3C7E A;  3E5X A;  1ONA A;  2FMY A;  2W1U A;  3F95 A;  2VUC A;  4KGG A;  5M0T A;  1VBA 3;  4GJZ A;  4S2G A;  3ZN6 B;  4W6X A;  2H6C A;  4N9I A;  1QJY 2;  4Y1V A;  1SLI A;  1ZRR A;  1W9T A;  3ZFG A;  1EV1 2;  1GBG A;  4FSJ A;  2BZD A;  1GMM A;  3LIH A;  4A7Z A;  3WNP A;  4M4P A;  5GAL A;  2JDK A;  2GNM A;  1LB2 A;  2EXJ A;  1H6Y A;  1PGW 1;  3LEI A;  4QQ2 A;  5J98 B;  3SIT A;  1GZC A;  3ZSL A;  1ASJ 1;  1VRH 2;  4RS5 C;  2A1X A;  5E16 A;  2RDN A;  4IV3 B;  1ZX5 A;  2YGM A;  1ZA7 A;  3NAP B;  5FO7 B;  3TRS B;  4CUC A;  1PVC 3;  4YG0 A;  4Q8K A;  1N3O A;  4RL7 A;  4B3N A;  2XVK A;  2A3W A;  1EYB A;  2XJU A;  3I2O A;  1CAV A;  4RD7 A;  4LBM A;  2XUE A;  4P5Y A;  5DZE A;  3LA3 A;  1TMF 1;  5BNO B;  5C5U A;  1BLZ A;  4QGM A;  1VBB 1;  5L36 A;  1KGY A;  4A45 A;  1GWK A;  1VLN A;  1E5H A;  2Q1F A;  5BNP A;  2WDB A;  3WF3 A;  5CVR A;  4IEP A;  2VOK A;  2HLE A;  3ECQ A;  4L8Q A;  2RV9 A;  1WCD J;  1DP0 A;  3AYA A;  4WZC A;  2J22 A;  3W9A A;  4P00 B;  3VZO A;  1CAX B;  1PX3 A;  3B7M A;  3WW4 A;  1C4R A;  4BMB A;  1MAC A;  4CEW A;  4MLO A;  1JH5 A;  1RMU 1;  1NUK A;  2BNM A;  4HT1 T;  1DQ0 A;  4E27 A;  5FO8 B;  3ALQ A;  2GAL A;  4AFC A;  1PIV 1;  2O0O A;  5LA9 A;  1T2X A;  3H8U A;  1KFX L;  4R4X A;  5DPN A;  5T5O A;  2BUK A;  4EQV A;  3M3E A;  1YQ5 A;  2W87 A;  2Y0I A;  3LOI A;  2PHL A;  3HQX A;  1DCS A;  1NLS A;  2EIB A;  4QDS A;  3VDC A;  1YNA A;  5FYI A;  4PBP A;  1BZW A;  5LA2 A;  2LM3 A;  1OSG A;  5IT6 A;  2ZGU A;  4DPN A;  4C1W A;  1GIC A;  4HK9 A;  4L99 A;  1COV 3;  1G6N A;  1UX6 A;  4YW5 A;  5A70 A;  1W0O A;  1NX9 A;  3JB8 A;  4NN0 A;  4AED C;  3FLT A;  2Y34 A;  1BEV 1;  4QQP A;  1NQJ A;  2DU0 A;  1RUH 3;  2R06 2;  4UBH A;  3WDY A;  5CYY A;  2PLV 2;  4LBN A;  4XJW A;  5KXB A;  1OLM A;  5CNA A;  3OUI A;  4DOU A;  5F5C A;  4N8M A;  4JCK A;  1WW6 A;  4JQR A;  4Y22 B;  5EYY A;  1TNF A;  2HWC 1;  1WCQ A;  1J83 A;  2VQT A;  1BJQ A;  3DKQ A;  5DZF A;  2WFF 1;  1YI9 A;  4RGK A;  1LKN A;  2Y60 A;  3HBZ A;  2GNT A;  2ZGT A;  1NY7 2;  5DDJ 3;  2HJI A;  2WWJ A;  2UWC A;  4HKW A;  2VME A;  3FLP A;  4QGN A;  3ST7 A;  3LDR A;  3ME2 A;  4P14 A;  3VBH A;  3ZFF A;  5FP7 A;  3WEZ A;  2WIN B;  1AR9 1;  3MGU A;  1UPS A;  2QQL A;  1DLC A;  1ZZB A;  2QZ2 A;  3PVN A;  1UPI A;  3PLQ A;  3ABZ A;  2WO3 A;  3UJQ A;  1EPZ A;  1FV3 A;  1VBC 2;  1NCQ A;  3AM2 A;  3UL2 A;  4OFG A;  5EP9 A;  2VMH A;  3THC A;  3O1R A;  4IEU A;  4UW3 A;  4HZF A;  4CXW A;  3BI3 A;  5JR2 A;  2BBV A;  1H8T B;  3H7J A;  2RJL A;  4J1W A;  3BUC A;  2JG8 B;  3V0B B;  1D4M 1;  4L11 A;  1HRI 3;  1D2Q A;  2W1Q A;  2YYO A;  5FOJ B;  2Y6F A;  2QQI A;  1XNK A;  2RS5 2;  1VBD 1;  1DZR A;  4O9G A;  4PIZ A;  4P08 A;  1LRH A;  1JOB A;  3IPV A;  4UF0 B;  3WF0 A;  4OCT A;  3SH3 A;  2AGS A;  2I07 B;  3ZYH A;  2ZGN A;  2TNF A;  4BOW A;  3VZM A;  3T4H B;  4DUX A;  1SLA A;  4BZ4 A;  3BIE A;  1G9B A;  2RJ2 A;  1LOE A;  1Y3T A;  3VBH C;  3IDC B;  4FOQ A;  3LKJ A;  5LBE A;  2O8Q A;  2PXJ A;  3OEA A;  1ZVF A;  4AED A;  1WD3 A;  1H8T C;  1PMI A;  4CCK A;  5K0U C;  2ZAH A;  4WZF A;  1UY3 A;  5JOZ A;  1RUF 2;  4XE9 A;  4AHW A;  4DY3 A;  4LE4 A;  1XBF A;  2TUN A;  3POJ A;  5CZK A;  1POV 3;  5LBB A;  3ETQ A;  3WQB A;  3ZMO A;  2GH8 A;  4K1Z A;  4QDQ A;  4U36 A;  4TZD A;  1QJF A;  1LHN A;  1LOC A;  2WJS A;  2ZHN A;  5T54 A;  2CY6 A;  3C2U A;  4B7K A;  2DCZ A;  5F5A A;  4BIF A;  4IEZ A;  4CDU A;  1HQL A;  1RHI 2;  3BGA A;  1UXX X;  3M4F A;  3POF A;  3VBH B;  4CDQ C;  5H9R A;  5FO9 B;  4Y20 A;  3V65 A;  4GAZ A;  3TN9 3;  5DDJ 2;  4YW2 A;  4AVT A;  3T2Q A;  3S30 A;  1G86 A;  2WZP P;  4K8R B;  4KBZ A;  3WDV A;  1A78 A;  1HB3 A;  3MLJ A;  4IW3 A;  4J1X A;  2VU9 A;  2ZGQ A;  3KV6 A;  3SXW A;  4CU7 A;  1C1L A;  1TQ5 A;  1MS1 A;  1RUF 1;  1IS3 A;  3X29 B;  1TG7 A;  4I0A A;  4P9Y A;  3H7Y A;  2BGP A;  1KXG A;  2C4X A;  1RUH 2;  2R06 3;  1ND2 A;  3POI A;  1C1F A;  4BXS V;  1KS4 A;  1SDD B;  2OPW A;  3WDW A;  1WBF A;  3JBG 2;  4XHX A;  2D3P A;  1U5X A;  1QJY 3;  3LF7 A;  2H0V A;  2JIC A;  2BNN A;  4NOT A;  2A6Z A;  5BNN A;  5K7P A;  1AL2 1;  1M4W A;  1AXY A;  2BBA A;  2ZX2 A;  4TN7 A;  1O4T A;  1UCX A;  4UXA A;  1R09 2;  2ZGK A;  3GZE A;  3ILR A;  1R1A 2;  2CGN A;  4H2A A;  4Q4W 3;  4BME A;  2RMU 2;  1X33 A;  5DAV A;  1NE6 A;  2QKD A;  3OGS A;  4WBB A;  4C8D A;  1KJL A;  1CX1 A;  2DUP A;  3P5B A;  5IJR A;  4F8A A;  2V5Y A;  1D4M 2;  1W2N A;  5FYB A;  2YXS A;  3C7O A;  1KDK A;  1GFF 2;  5SV5 A;  1SQ4 A;  3VKM A;  1MEC 2;  2WAA A;  3BTA A;  2AZ5 A;  4DXT A;  1B35 C;  5F2S A;  1HN1 A;  1QQP 2;  3TEX A;  2XVG A;  4CU6 A;  5KR7 A;  1W6O A;  3NO8 A;  3R05 A;  3N4M A;  3NWK A;  3MDP A;  2A70 A;  3IKW A;  3IT8 A;  3NNG A;  1VJ2 A;  4XIO A;  2ZGR A;  4LLF A;  5K4L A;  3WVJ A;  4QB2 A;  1CZV A;  3OD4 A;  2D6N A;  4IE7 A;  4MSV A;  4Z8B A;  4Y20 B;  1UOJ A;  5LEJ A;  4MHU A;  2HWB 1;  4Y1U A;  2VZS A;  1UOF A;  3CQO A;  4P9J A;  4CSW A;  1GZW A;  4LBK A;  1WA4 A;  4YVS C;  3ZR6 A;  4U2A A;  4A3Z A;  4DIN B;  1RMU 2;  3SIS A;  4LMF A;  1LUL A;  4K40 A;  4LKS A;  1FMD 1;  1BHG A;  1VRH 3;  4K21 A;  4D94 A;  4LNV A;  2XBO 3;  1GZT A;  3KD4 A;  4QPY A;  2Q1Z B;  4A2U A;  3VGI A;  1AR6 1;  4GQ7 A;  1S0E A;  1Q8S A;  4JKL A;  4JGY A;  4XUQ A;  2FDG A;  1LES A;  3AVR A;  4AF9 A;  1OPM A;  2JD9 A;  2HYK A;  1TMF 2;  5LY2 A;  4FCA A;  2WC2 A;  3NV1 A;  2VZU A;  5FMD A;  1EAH 2;  1YFY A;  2ZBJ A;  3I2I A;  1OA2 A;  1XYP A;  2C5D A;  1X50 A;  3W58 A;  2P4E A;  4COU A;  5KHI A;  1SPP B;  3ZM8 A;  2JDZ A;  1LOG A;  5ABJ A;  4LKF A;  4MGY E;  3CIH A;  4AOC A;  1QMJ A;  2ARB A;  3A4U A;  3P1I A;  3PIG A;  1OA3 A;  4JKM A;  1J84 A;  1JUH A;  2WZR 1;  3MF6 A;  3IAP A;  4XMI A;  1PM4 A;  5EJZ B;  5FRA A;  2RM2 1;  3HMY A;  2X09 A;  3OBA A;  5FR3 A;  1K3I A;  4IND A;  5IK5 A;  1UL9 A;  4UBG A;  3FZ3 A;  4I0B A;  4AFA A;  3D6E A;  3VBR B;  4ET7 A;  5J96 B;  2VQ0 A;  2P2K A;  3MEP A;  3I2D A;  3KVA A;  1YYN A;  2WQ8 A;  5LAS A;  1U5I A;  5SV8 A;  2XPJ A;  5FZO A;  4Q4V 3;  3WNO A;  4F7Z A;  2LS6 A;  4LE3 A;  4QWN A;  2E6V A;  2GAU A;  3WHT A;  1K42 A;  1JN2 P;  5FPV A;  3VD5 A;  1HB2 A;  1QY4 A;  5CFD C;  1HLC A;  2WNE A;  4CEY A;  2X8K A;  4EJR A;  1DGW X;  1PM7 A;  4CXY A;  2DUR A;  1R08 2;  4QX0 A;  2ZTN A;  3MIB A;  3DXU A;  2Y64 A;  2X5I C;  3VHP A;  2IXI A;  1DQ5 A;  2VOV A;  1ENR A;  1FI2 A;  2O8O A;  3KS7 A;  3MIF A;  4HPK A;  3VL8 A;  5HXM A;  1H2M A;  4D7Y A;  1RIR A;  2YC0 A;  1IPK A;  1K5J A;  4DNY A;  4QX3 A;  2JG9 C;  2DFC A;  2R04 3;  3HEI A;  3WXP A;  1RTV A;  4QD2 A;  4OI0 A;  1DZT A;  1UX7 A;  2D97 A;  2JD4 A;  4LO4 B;  1IKP A;  1XNB A;  4CDU C;  2OKX A;  3W59 A;  1QJX 2;  4P5H A;  4AVA A;  4H7M A;  1HQW A;  5FZ4 A;  1JYV A;  4AQT A;  3ZYJ B;  2PHW A;  3D5O A;  5C4W C;  3I4I A;  3LA7 A;  4XDQ A;  1FV2 A;  3G6J B;  4ZXE A;  1HN0 A;  3PJQ A;  3N7K A;  2YGL A;  2Y6K A;  1W03 A;  4DRR A;  2RDS A;  3HR9 A;  5JIA A;  4XUP A;  3APB A;  3VLB B;  1JZ5 A;  4N53 B;  4P9L A;  3UES A;  3LAG A;  4CCD A;  3M7A A;  2PA7 A;  3O1V A;  3WP3 A;  1CWP A;  4GH4 C;  4DEQ A;  4Y1Y A;  3PVE A;  1O3S A;  2EIG A;  4W6Y A;  4N43 A;  2F6B A;  1IOA A;  4CCM A;  1JXN A;  1S0C A;  1UWW A;  1O3Q A;  4YZ5 A;  1WBL A;  4QPI B;  4RHV 2;  2RS3 1;  1JZ3 A;  2OQ7 A;  3EQE A;  1FMD 2;  1BYH A;  1XNC A;  1WW7 A;  2XHN A;  4B7E A;  1N1Y A;  3BTZ A;  3OYW B;  4HVO A;  1LJ7 A;  2W1S A;  5JOX A;  5E6H A;  4OUS A;  2WO2 A;  2A6V A;  3VBS C;  1Y43 B;  1JYT A;  1FX5 A;  3JB4 C;  3DL3 A;  4YM1 A;  2N7G A;  3K51 A;  5CB7 A;  1YQ6 A;  3IDB B;  2C6S A;  1BBT 3;  2JB8 A;  3OG2 A;  2CAU A;  2PMW B;  3D3A A;  1JW6 A;  5BXX A;  1O3T A;  2Q8O A;  1RUJ 1;  1SLL A;  5H9Q A;  3IDA A;  5ANQ A;  3ZXF A;  1HB4 A;  2CTV A;  4LBJ A;  3U4S A;  2EA7 A;  1W9F A;  4DUV A;  3DGT A;  2LRP A;  3CF6 E;  4IQP A;  4YLZ A;  3ZFG C;  1XE7 A;  1RUD 1;  5LY1 A;  2J1S A;  2BDR A;  4KH9 A;  1W2A X;  3E6C C;  3PUH A;  1MS0 A;  2VC9 A;  4ES8 A;  1WW4 A;  4ONU A;  5JMO A;  3O0X A;  3AL5 A;  1N47 A;  2RR1 1;  2WRA A;  1VAM A;  3U37 A;  4XJ8 A;  2GN3 A;  3MIH A;  4RFT 0;  3VUO A;  1UAI A;  4QHB A;  2V09 A;  1UD1 A;  4LO6 B;  4QPG B;  4CDX B;  2D5H A;  3K75 B;  2ZML A;  4FPE A;  5BNO A;  4TTG A;  1Y9M A;  3WP6 A;  4LR4 A;  2NQY A;  3GHM A;  2UUR A;  2HBU A;  5EWS A;  5F6K A;  3H8R A;  1WUV A;  5GZF A;  3U14 A;  1NE4 A;  4X6Q B;  2EIC A;  2Z79 A;  3KWV A;  1HRV 2;  1RUC 2;  3POS A;  3SNM A;  3OOX A;  5JSR A;  3ZMN A;  4AG4 A;  1OLQ A;  3PDQ A;  1DBN A;  4FO9 A;  1PZ8 A;  1WMD A;  1AX0 A;  4WV8 A;  1SLT A;  4BH9 A;  4EN9 B;  4Z92 B;  2R07 2;  1CZT A;  4AI9 A;  1IHM A;  1PHM A;  2IXL A;  1DF0 A;  5JSO A;  2R32 A;  2ZOE B;  3AP6 A;  3AZV A;  3PVO A;  4MGS A;  4I0W B;  3T1L A;  2HEV F;  4A6S A;  1O4Y A;  2B42 B;  3WSO A;  1YEW A;  1PGS A;  4CDX C;  1DGL A;  1PO1 3;  1YUD A;  2DVG A;  2IC1 A;  4UFI A;  4XF1 A;  5F8P A;  1MEC 3;  1G9D A;  2V73 A;  2ZAB A;  1Q8V A;  4YZ1 A;  2R04 1;  4Z07 A;  2OW4 A;  4F3J A;  4AHY A;  4IEY A;  2X10 A;  2IXH A;  1C28 A;  1V6N A;  2YG0 A;  1G9C A;  4DRV A;  4E2S A;  1TE1 B;  4QPI A;  4AR2 A;  3O1U A;  4LO8 A;  2VNG A;  4L0P A;  5FZ3 A;  1U5Y A;  1UYY A;  2WSV A;  3LWC A;  4OI2 A;  4QX8 A;  1Z7S 2;  1GSL A;  1L7L A;  1NZC A;  3ZVX A;  4UW4 A;  1EUT A;  5FYZ A;  4OI1 A;  2Q0A A;  4XF0 A;  2B8M A;  1LAJ A;  2Z69 A;  4RHV 3;  1WLT A;  1N3Q A;  2R04 2;  5K8S A;  1RUJ 2;  4LUK A;  4K1Y A;  3A21 A;  4Q4V 1;  5J09 A;  3WQ7 A;  4D6R A;  1XYN A;  1ODM A;  3AYE A;  1VMH A;  2B39 A;  2RS5 1;  1LGC A;  1SEF A;  1CIY A;  2D6M A;  2WWS A;  4NMI A;  5FAX A;  3S7E A;  1WCK A;  2ZGL A;  3UYJ A;  3ZSE A;  1V0A A;  2RM2 3;  2D5F A;  2W46 A;  3P3P A;  3R4U A;  5DXD A;  2GC2 A;  1DQ1 A;  2R07 1;  4WM8 C;  5F7U A;  5G05 L;  2P6C A;  1APN A;  2ZHL A;  3N9M A;  1IPJ A;  3QH6 A;  3VHN A;  3WNX A;  2XR4 A;  2JDY A;  4B8E A;  1CON A;  1ENS A;  2BFU S;  3B01 A;  1VBB 2;  3UNP A;  1CAW A;  4KU7 A;  2K2S A;  5C9A C;  1AR9 2;  4BQY A;  4QKB A;  3RFR A;  1W2T A;  3T2O A;  3AP5 A;  5A1L A;  3VBR C;  4CP0 A;  1GOH A;  4OUM A;  4AFD A;  3VBS A;  1V9U 2;  4Q8L A;  1JYC A;  1B35 B;  2J1V A;  1OC1 A;  4ZHN A;  3IM0 A;  1VRH 1;  5JCT A;  3SQO A;  1GP6 A;  4PBO A;  2WFF 2;  1WLD A;  1IKQ A;  2HWC 2;  2CL2 A;  2G1M A;  1LHO A;  1Z7S 3;  1A8M A;  2P5B A;  4XEZ A;  5EZW A;  3NJY A;  3D82 A;  2QUO A;  2E31 A;  2XJT A;  1ZZ7 A;  1I5P A;  4FPH A;  4IE4 A;  1F5J A;  1JMU B;  5FDB A;  3W5N A;  4FPJ A;  5J7M A;  3QCW A;  5HV0 A;  4PDW A;  2WN2 A;  3SCG A;  3KQ4 B;  3PL0 A;  3OGR A;  4XFC A;  3B00 A;  4FAG A;  1AYN 1;  4Y1X A;  1ENX A;  4CU9 A;  3BOD A;  3N36 A;  2ZEZ A;  3OY8 B;  4CDW B;  1RL3 A;  1G7Y A;  4IL7 A;  1GLH A;  4CDU B;  3PMS A;  2ARC A;  2QDN A;  3WHU A;  4Q1R A;  3PNA A;  4AI2 A;  2GP3 A;  2V4V A;  3USU B;  3LDB A;  4R4Z A;  5KXC A;  3DYO A;  2JIJ A;  3GCX A;  3JD7 3;  4SLI A;  5FWE A;  1UKR A;  1GP4 A;  3I2H A;  5FYH A;  3S0M A;  4HET A;  5A7P A;  1CIW A;  1COV 1;  5EV7 A;  3MYX A;  3JD7 1;  3HAG A;  1H2N A;  1JU3 A;  1AX2 A;  3RS6 A;  3C3V A;  3G7D A;  1S55 A;  3GBW A;  5DUW A;  3ZXL A;  2AH2 A;  3I2J A;  4PQQ A;  1F4H A;  1RXG A;  4YW6 A;  4COY A;  5BNO C;  1ZRD A;  2FZ1 A;  5JXH A;  4LBQ A;  5IVV A;  1MZF A;  1VB4 A;  5FMC A;  1HDK A;  3FJS A;  1QNY A;  2DVB A;  1CAW B;  2DCY A;  2VZP A;  4K7J A;  1HIX A;  4BK4 A;  3MW4 A;  4BIS A;  5FYV A;  5T55 A;  4W50 A;  3VZN A;  5GZC A;  3T1M A;  2XON A;  5LEK A;  2RHP A;  1O3R A;  5T5J A;  5EYX A;  2W0X A;  4GUL A;  2JEM A;  3TN9 1;  1P8J A;  1YFW A;  1RUI 1;  4WM7 C;  1KS5 A;  1MQT B;  5HCH A;  1VAL A;  1ND3 B;  1VBB 3;  2VGD A;  1TMF 3;  2R16 A;  4Q27 A;  5CU1 A;  1CVN A;  4Q1P A;  4JVA A;  1GWL A;  5EXO A;  3QAC A;  1WZX A;  3K3O A;  4R9A A;  2EAK A;  3LSD A;  2ZMK A;  5F3I A;  1GV9 A;  1PVC 1;  4XTM A;  5FXW A;  1WCS A;  4Y26 A;  1POV 1;  2XJR A;  2JKB A;  4KQ7 A;  4MGT A;  4AK3 A;  3JU9 A;  3ZXK A;  2G9G A;  4GAL A;  1QIQ A;  3HT2 A;  5KHJ A;  1S0I A;  5FZ9 A;  5JZG A;  2ORZ A;  3Q8F A;  2XL9 A;  4KGQ A;  4YFW A;  4XUO A;  3VN4 A;  3LQC A;  3HD8 B;  2WAB A;  3MLK A;  4FPO B;  5F5Q A;  5FTT C;  2JDN A;  4KL1 A;  2MNG A;  5FZC A;  4AGG A;  3EXU A;  4GJY A;  4RQP C;  5IYY A;  4FOY A;  4GD4 A;  1D0G A;  5F3E A;  4YSF A;  3S7I A;  1D4V B;  1NZI A;  2W08 A;  5HCA A;  4QPG C;  4XVH A;  1V6K A;  1ND2 C;  2A6Y A;  4LUM A;  5HI0 A;  3B9I A;  2HYX A;  4K6B A;  3RMY A;  3VL9 A;  4WVZ A;  3WT3 A;  4TLF A;  1R09 1;  2BGC A;  3QH7 A;  4EV0 A;  3AP4 A;  1JHJ A;  1JZ8 A;  1S2B A;  4XCA A;  4JKK A;  5A7N A;  5KXD A;  5D8A C;  2W94 A;  4MHR A;  4B4Q A;  1DGR A;  2R7E B;  1W8T A;  1AR7 1;  3AKR A;  5FYU A;  4YPJ A;  3URF A;  4PIX A;  1UW8 A;  4BDV B;  4E4S A;  1UMZ A;  3NW4 A;  1BEV 2;  1SFN A;  1HRI 1;  3AFK A;  3U0Z A;  1K5M B;  4IEX A;  2FCT A;  2FCU A;  5LBF A;  1IZ3 A;  1S4C A;  1W6P B;  1YI7 A;  1VBE 1;  5JIU A;  5J3U A;  2UYA A;  2HKX A;  3Q9O A;  1OKQ A;  2D6L X;  2W68 A;  5KWR A;  3CJI B;  3MW2 A;  5ABJ B;  1DYP A;  1UF2 C;  3SLI A;  2EAA A;  4PJY A;  5FZ0 A;  2B5H A;  4QXK A;  2DFB A;  4XIL A;  1SBF A;  4NUB A;  3JD7 2;  3KV5 A;  1JI6 A;  1JZ7 A;  4L92 A;  5FV3 A;  5DDJ 1;  1TNR A;  4LHL A;  3WDX A;  2IXJ A;  2BQP A;  2A71 A;  1V6M A;  4MGI E;  3EO6 A;  5F5I A;  5FYS A;  3WY6 A;  2RS1 3;  3ZN5 A;  1WA6 X;  3IPV B;  4M01 A;  4UF0 A;  4X8P A;  5FZO B;  1NKG A;  2WNU A;  3PME A;  5A3P A;  1PGL 2;  2LUW A;  3BCW A;  4G4F A;  1D2S A;  4GB3 2;  3PTY A;  4QB6 A;  3NL1 A;  5FY9 A;  1OLM E;  4HPK B;  3WF1 A;  3H9A A;  4PT6 A;  2A5Z A;  4AWD A;  1V6O A;  2QCS B;  2CHH A;  3SEP A;  5FBJ A;  1QQP 1;  1UXZ A;  1WLC A;  2YBP A;  3ON7 A;  3RRD A;  4QKD A;  3IB3 A;  3INA A;  5L7O A;  2GDF A;  5JR7 B;  1TEI A;  4PHZ A;  1RJ8 A;  2WNV A;  1ZZC A;  2RMU 1;  2HWC 3;  4R9B A;  2A6X A;  2VZ3 A;  3Q8B A;  5T5L A;  1NOV A;  1HJG A;  5HPO A;  1QXP A;  4N7U A;  1RIT A;  5IUQ A;  5HBA A;  4LO7 A;  3AMM A;  4ZU5 A;  5CFC B;  3LB9 A;  5IW0 A;  5C71 A;  3BOW A;  1YJL A;  3KCC A;  1Y7B A;  4XBL A;  1ZM1 A;  1W8U A;  3O1M A;  4AI1 A;  3ZYF A;  2ZX0 A;  2Z5W A;  4GWN A;  1DU3 D;  2WT1 A;  3VV1 A;  4OHW A;  1ZRI A;  1D0H A;  2OUJ A;  5L73 A;  4EN6 B;  1HXS 3;  2WA4 A;  1ZYB A;  5GZD A;  1RIN A;  3FBM A;  3DEC A;  4XQW A;  3ROU A;  2ILM A;  3AMN A;  4LHN A;  1GNZ A;  1X8M A;  3NST A;  3POG A;  1BVP 1;  3QOP A;  3O14 A;  3OJB A;  3NJX A;  2MEV 3;  5C8W A;  4H55 A;  5JXJ A;  3ZXG A;  2VNV A;  1RMU 3;  4NII A;  2VZV A;  3DUI A;  5DAQ A;  4CP1 A;  1ST8 A;  3GYD A;  1ZBE 1;  5C8C C;  1ASJ 3;  3WQ0 A;  2BOJ A;  1BBT 1;  1LEM A;  3GNE A;  1ZA4 A;  3GXU A;  1CAX A;  5BV6 A;  2VM9 A;  5BYN A;  1DQ4 A;  5FPL A;  5ACA 2;  3RZL A;  3WV6 A;  5HXV A;  2WKK A;  5E88 A;  1ULE A;  4BYY A;  1OD3 A;  3KV4 A;  1JUI A;  4HFS A;  4EWD A;  4HVQ A;  2UWB A;  3EMR A;  1ALY A;  4RQP A;  2ZAC A;  2B9V A;  4LK6 A;  4C0H A;  1V70 A;  3MBW A;  3CZU A;  4BPZ A;  3VKO A;  2VQA A;  2VJX A;  2YC4 A;  1Q8O A;  5A6Y A;  1JYI A;  1AUY A;  2QBX A;  3S6P A;  2WO1 A;  5FXX A;  2WZ8 A;  4M3C A;  1JZ6 A;  1U5Z A;  5FJK A;  1ZZ8 A;  4UFM A;  4YAR A;  1GNY A;  2CV6 A;  2JDH A;  3U10 A;  1OXC A;  4CP9 B;  5C8C B;  5KC6 A;  3VD9 A;  2ZGM A;  1H2L A;  1JOD A;  1S0J A;  2XLA A;  2ZCW A;  3AB0 A;  5FMO L;  5JAX A;  1DGR N;  4GZ9 A;  1YIP A;  2GC1 A;  3ATG A;  4ITC A;  5JUV A;  1PNG A;  1VBE 2;  3M3C A;  4PIY A;  2ZMN A;  3VDD B;  1K45 A;  1W2U A;  3P3N A;  4ISR A;  5FYT A;  1UQX A;  1VIW B;  2EXK A;  4COW A;  2VBB A;  1VBD 2;  3DPR C;  1ZZ6 A;  2VMG A;  3B3Q E;  4Q0U A;  4RYD A;  1J58 A;  3V56 A;  4Q0S A;  1W3X A;  3D0J A;  4C1X A;  2YU2 A;  3PUA A;  5CIR A;  3W20 A;  5JI7 A;  3RDI A;  3ZR5 A;  1LHV A;  4XMA A;  1WW5 A;  5LK7 B;  2F4L A;  4IGO A;  3KLS A;  4X6R B;  4BB3 A;  4URT A;  3RI8 A;  1HB1 A;  3N9N A;  4O7X A;  4ZS2 A;  5A3U A;  1NLR A;  3DV8 A;  1O5L A;  1VAV A;  2PYT A;  3HIF A;  4IEW A;  3VKF C;  5KC5 A;  2KR2 A;  3VD3 A;  5C4W B;  3H8X A;  3III A;  1US2 A;  2ZGP A;  4HSJ A;  2JKX A;  4V2W A;  4A41 A;  4DY5 A;  5G04 L;  5DN2 A;  1EV1 3;  3B94 A;  3DEM A;  1YFX A;  1X7N A;  4NHM A;  4WM7 A;  1RUE 3;  1GYK A;  5IK4 A;  4OUE A;  2PTM A;  1NY7 1;  3C7G A;  5FZF A;  3UV9 A;  4LBQ B;  2ZEW A;  3U75 A;  1QJZ A;  1OVS A;  4CP2 A;  3HVD A;  4LKE A;  4D69 A;  3N3H A;  1H1I A;  1QJU 3;  1H6X A;  1UYX A;  3VKL A;  1XXN A;  1O7F A;  1PVC 2;  1C8M 1;  4BQ1 A;  3QLQ A;  2P34 A;  3AX4 A;  3N7M A;  4XJU A;  1GNH A;  4M3C E;  3O0W A;  3MV1 1;  4XPV A;  4JHT A;  3TNQ A;  4BU2 A;  4XAE A;  1A3K A;  1TME 1;  5FZA A;  1UKG A;  2EID A;  2HWD 1;  4ZS3 A;  1QHD A;  2JWP A;  1YWK A;  3VBU A;  3VDD A;  4BQ4 A;  3OBT A;  4OQ9 A;  2ZX4 A;  1V6I A;  1MZ6 A;  5I0U A;  3OUH A;  4A7Y A;  4IV1 A;  4LQR A;  3JZV A;  5FMO S;  1RED A;  4AL9 A;  2YUE A;  4XAC A;  1XC6 A;  4XW3 A;  4YG3 A;  1G9A A;  2ID4 A;  3P6B A;  1X9P A;  3RYK A;  3SC7 X;  4AXO A;  4AEJ A;  2XBO 1;  1W90 A;  5FZ6 A;  1Q43 A;  3O1O A;  1FMD 3;  1STM A;  4W6W A;  2VUJ A;  4UWD A;  3ENR A;  3UKT A;  2JE8 A;  1HRV 3;  1LOB A;  4NRO A;  4DO0 A;  3EYP A;  5JOW A;  2AEZ A;  4Q4Y 2;  1XND A;  5AFB A;  3LEK A;  1Y9Q A;  2W2I A;  5A3L A;  3LFM A;  2FMD A;  5FK8 A;  2B46 X;  3Q8A A;  4BJ0 A;  4MAD A;  2P1B A;  1QNW A;  1PO2 2;  1ZNP A;  3FC0 A;  2E51 A;  3OEB A;  4K9S A;  2BJS A;  4YYO A;  3HNY M;  3ZOI A;  1A34 A;  4B1L A;  2GMM A;  2J7M A;  1GAN A;  3MIE A;  3KM5 A;  1GQG A;  2ZHM A;  2ZS6 B;  3AFG A;  4NO4 A;  4XAA A;  2RG4 A;  3CL1 A;  2XJS A;  3CJI A;  3CO2 A;  4ASK A;  3D0S A;  4ZU4 A;  4ZZ8 A;  4RR3 B;  1VBE 3;  5JOY A;  3E5U A;  5A7O A;  3N7J A;  3RJR A;  2VXR A;  4BK5 A;  5GKA C;  3HN3 A;  1DHK B;  2W39 A;  3LFI A;  5DQ0 A;  2ES3 A;  2ZJC A;  1QXR A;  4UFJ A;  4WVM A;  4CCE A;  4NR1 A;  4N43 C;  4XFA A;  5B4N A;  1C3H A;  2CWM A;  4JC1 A;  3KHB A;  1NLQ A;  4XFH A;  1QJY 1;  2ETE A;  4MXW B;  2CDO A;  3NNL A;  3TYJ A;  4ATF A;  3WNM A;  1UZ0 A;  2Y0O A;  4GMP 0;  3LOB A;  2Z4F A;  5T3N A;  1QWR A;  5JI9 A;  1O4Z A;  2E63 A;  2Q4S A;  4FFI A;  1NXD 1;  1XU2 A;  3AJZ A;  3K4D A;  4A4A A;  3T08 A;  1KRI A;  1RVF 2;  3L2Y A;  3USU A;  4CE8 A;  4NRQ A;  1PO2 3;  1QJX 3;  1S1A A;  2O14 A;  2XJV A;  2ZX3 A;  3GZU C;  2BVB A;  3J8F 1;  1QH6 A;  3BYW A;  2WAO A;  2Y8K A;  2VUA A;  2R1B A;  2PLV 3;  5FY8 A;  4ISQ A;  4P9G A;  3HWJ A;  4AHZ A;  1W9W A;  3ACL A;  2NN8 A;  2Y6J A;  1FAY A;  2ZA9 A;  3MV0 1;  5FXV A;  3UKN A;  3AK0 A;  5FLI A;  4NID A;  3J9S A;  3ES1 A;  3H3Z A;  3O5S A;  3OGJ A;  2AEN A;  2W91 A;  5LK5 A;  5T50 A;  1NQD A;  3J8F 3;  1PVX A;  1ENQ A;  2AEY A;  2D7F A;  2V4A A;  2WLP A;  3CDZ B;  3HQR A;  4LOS A;  5CKN A;  4MG2 A;  1O8P A;  2DCT A;  4Q4X 2;  3RYP A;  2WQZ C;  2CGO A;  4AFB A;  1I6X A;  2ZPX A;  2WII B;  4Q5O A;  2JDA A;  4DS0 A;  2D6P A;  1F4A A;  1QOT A;  3LD8 A;  1RUI 3;  1OF3 A;  1REF A;  1DQ6 A;  4M0H A;  2YC2 A;  3LE0 A;  4RR3 A;  4A42 A;  4Q4V 2;  2ZZQ A;  1BMV 2;  2C9K A;  1VE0 A;  4OHZ A;  4BLJ A;  5JXI A;  5F2W A;  2WNV C;  3JUU A;  2KXL A;  3NQH A;  4FPC A;  3GHN A;  3HOB A;  3AXE A;  3MF9 A;  3VHO A;  5F39 A;  2Y6G A;  4G9S B;  1C5I A;  3PTR B;  1AR6 2;  5JXG A;  5CAZ A;  1N1T A;  4MXW A;  2X5I A;  3UGF A;  3NNJ A;  4AHX A;  4E8D A;  2VBP A;  1F5F A;  3AP7 A;  1YIF A;  2VE1 A;  4CCO A;  1RUO A;  1QJU 2;  1W0N A;  3I3B A;  4JGY B;  1VBA 2;  4NWW A;  1J1T A;  4XUT A;  3JQW A;  2GMP A;  4R9D A;  4B4P A;  2DDU A;  2HWF 3;  5H9P A;  4AEM A;  3J7M A;  1NAE A;  2W95 A;  5AC9 1;  5IVE A;  4XFG A;  5JSP A;  4QXB A;  1AYM 3;  2HWB 2;  4P9I A;  3ZYR A;  1S2K A;  1NA1 C;  5B2G B;  1N1V A;  2B45 X;  3AYD A;  3V64 A;  5FQ0 A;  4FP2 A;  3ACG A;  4CPB A;  1ULC A;  5CFC C;  1E5R A;  5LRS A;  5LWB A;  4AE2 A;  5LCW L;  2WFP A;  4FTE A;  5A7W B;  3HQU A;  1PO1 2;  1OOP B;  2QQJ A; 
#chains in the Genus database with same CATH homology
 2VMF A;  3FN9 A;  1GOF A;  3UNP A;  4CU8 A;  3C7E A;  3F2Z A;  3SKJ E;  2B4K A;  2W1U A;  3ACF A;  3T2O A;  1LNS A;  5DMY A;  1GOH A;  4MGQ A;  1D7P M;  3LPG A;  2J1V A;  1ULP A;  5J1X A;  1NT0 A;  1W9T A;  2BZD A;  1GMM A;  3HNB M;  3WNN A;  3WNP A;  4A6O A;  4M4P A;  1RYY A;  2W92 A;  1H6Y A;  2E31 A;  3LEI A;  2WNO A;  1I5P A;  4XUR A;  3W5N A;  3VD4 A;  4CUC A;  5B4X A;  2WN2 A;  3NJV A;  3K77 A;  3KQ4 B;  3OGR A;  3LPF A;  3JXS A;  2J1R A;  4P5Y A;  4CU9 A;  2ZEZ A;  1KGY A;  3HJR A;  4A45 A;  4LOR A;  4GWI A;  1GU3 A;  3ETP A;  3OB8 A;  3C8X A;  4UI9 L;  2WDB A;  3WF3 A;  3ECQ A;  2HLE A;  2V4V A;  4JHZ A;  2RV9 A;  2X05 A;  1DP0 A;  1OH4 A;  3DYO A;  2J22 A;  4P00 B;  1PX3 A;  3I2H A;  3T0D A;  2VL4 A;  4OYU A;  2E33 A;  1NUK A;  1JU3 A;  4LOT A;  1W8N A;  1O8S A;  1SG3 A;  1T2X A;  5DPN A;  3WF4 A;  2KD7 A;  2VZ1 A;  2WN3 A;  2W87 A;  3E1F 1;  3I2J A;  2VMD A;  4QDS A;  2EIB A;  4PQQ A;  1F4H A;  3T0A A;  3VDC A;  5JXH A;  5LA2 A;  2VZQ A;  4GWJ A;  2QQM A;  2VZP A;  4BK4 A;  4PF1 A;  3T0B A;  4W50 A;  1NX9 A;  2XON A;  3OGV A;  3BN6 A;  5CYY A;  1US3 A;  1P8J A;  1K12 A;  3CZJ A;  5CKQ A;  1PMH X;  1WCQ A;  1IQD C;  1J83 A;  2VQT A;  2ORX A;  2LW8 A;  1SPP A;  2QQN A;  5EIY B;  2VME A;  3ACI A;  3A7Q A;  3WEZ A;  2QQL A;  1DLC A;  3ABZ A;  1OF4 A;  1SZB A;  3T09 A;  3C7F A;  2WO3 A;  2DCJ A;  2ORZ A;  4XUO A;  3LQC A;  2WAB A;  3THC A;  5JR2 A;  5IYY A;  1R64 A;  3FHA A;  4KI5 M;  1UYZ A;  2QQK A;  4W4Z A;  4ZY9 A;  1NZI A;  2W1Q A;  3CMG A;  4XVH A;  4W8J A;  5LA1 A;  1O59 A;  2HYX A;  2QQI A;  4AAX A;  2W9X A;  4P08 A;  1JHJ A;  1JZ8 A;  4JKK A;  3WF0 A;  2W94 A;  2R7E B;  4BDV B;  4YPJ A;  1UY2 A;  3GM8 A;  4DUX A;  3HPN A;  2VCA A;  2RJ2 A;  4XUN A;  3DYP A;  3OEA A;  3VD7 A;  5C7G A;  5A1A A;  1UY4 A;  1UMI A;  1UY3 A;  1EUU A;  1JZ4 A;  4E8C A;  3POJ A;  5CZK A;  2XQX A;  3WQB A;  1JI6 A;  1JZ7 A;  4QB1 A;  4QDQ A;  4RN5 A;  2J1E A;  2W3J A;  3VDA A;  2ZEY A;  4KWU A;  1NKG A;  3BGA A;  2BGO A;  1UXX X;  1W9S A;  2CDP A;  3POF A;  4DXR A;  2VMC A;  3A22 A;  2PQS A;  4QB6 A;  1SHW B;  4IUG A;  3ACH A;  2W47 A;  3T2Q A;  4PT6 A;  3WF1 A;  4ARY A;  2DCK A;  1PX4 A;  2J1U A;  3SEP A;  1UXZ A;  2V72 A;  4CU7 A;  3IB3 A;  1TG7 A;  3FHQ A;  2BGP A;  3DYM A;  2C4X A;  3POI A;  3AC0 A;  4BXS V;  4OMD A;  1SDD B;  3MUY 1;  2VZ3 A;  1DYO A;  5HPO A;  2BBA A;  5C71 A;  1L7R A;  4JX0 A;  3MUZ 1;  5EJ1 B;  1UY0 A;  3OGS A;  3I2F A;  1CX1 A;  5IJR A;  3VDB A;  3DEC A;  3C7O A;  3K4Z A;  5FUI A;  1GQP A;  2WAA A;  4DXT A;  3POG A;  1HN1 A;  4KMQ A;  4CU6 A;  2Y6L A;  3NJX A;  2VO5 A;  5C70 A;  5JXJ A;  2VQU A;  3NNG A;  1JYW A;  2VZV A;  4UOJ A;  4QB2 A;  1CZV A;  2E32 A;  3GXU A;  4ZZ5 A;  2VZS A;  2VM9 A;  3CQO A;  4A3Z A;  4LMF A;  1OD3 A;  2VR4 A;  4LKS A;  2B9V A;  5I0D A;  1BHG A;  3MBW A;  3CZU A;  3LEG A;  3PUI A;  3WF2 A;  3WNK A;  2VJX A;  2YC4 A;  2E26 A;  4JKL A;  4XUQ A;  2QBX A;  2WO1 A;  2JD9 A;  1JYX A;  2WZ8 A;  4D8M A;  1JZ6 A;  4DUW A;  4CUB A;  2VZU A;  4CVU A;  1GNY A;  3I2I A;  3I2K A;  3NRU A;  2QQO A;  3VD9 A;  2VCB A;  1XPW A;  1SPP B;  1YQ2 A;  4GZ9 A;  3ZM8 A;  3CIH A;  5JUV A;  3P1I A;  4FI9 A;  4JKM A;  2L9L A;  2VZR A;  1J84 A;  3I97 A;  5EJZ B;  3IAP A;  1K45 A;  3CKH A;  2X09 A;  3OBA A;  1W8O A;  1K3I A;  2VTF A;  2WBK A;  4RYD A;  3A23 A;  4ARX A;  4ET7 A;  2WQ8 A;  3WNO A;  1MPX A;  1UMH A;  2LS6 A;  3POE A;  1K42 A;  3VD5 A;  3SEE A;  4LPL A;  3VD3 A;  3III A;  1US2 A;  2JKX A;  4A41 A;  5G04 L;  4QX0 A;  5DN2 A;  2Y64 A;  3DEM A;  2YB7 A;  5HXM A;  2BER A;  4OUE A;  3C7G A;  4DXS A;  2ZEW A;  4QX3 A;  1H6X A;  3HEI A;  1UYX A;  4P02 B;  1UX7 A;  2OKX A;  2VCC A;  3MV1 1;  1JYV A;  1WKY A;  3IAQ A;  4QX2 A;  3T2P A;  4QAW A;  4ZXE A;  2EID A;  4QDR A;  2Y6K A;  1JU4 A;  4XUP A;  1JZ5 A;  3UES A;  1CZS A;  3SKV A;  1OT5 A;  4A44 A;  4LQR A;  4DEQ A;  1UWW A;  1XC6 A;  4QPW A;  2ID4 A;  3P6B A;  1JZ3 A;  2XHN A;  2JE8 A;  2J1A A;  3EYP A;  2W1S A;  2WO2 A;  3K4A A;  3LEK A;  3I2G A;  4UAP A;  4D0Q A;  3OG2 A;  3D3A A;  4MAD A;  4BJ0 A;  3W5M A;  3OEB A;  4LHS A;  3HNY M;  3IDA A;  5CKM A;  3C7H A;  3K46 A;  1TVG A;  2J7M A;  4DUV A;  3THD A;  4HG6 B;  5LA0 A;  5CIS A;  3FL7 A;  1PMJ X;  5IHR A;  1W99 A;  3GDB A;  2XOM A;  2J1S A;  3HNM A;  4ZZ8 A;  2YFZ A;  4BK5 A;  3HN3 A;  4TXW A;  3PUH A;  2VC9 A;  5DQ0 A;  5JMO A;  3J7H A;  2VOT A;  2W5F A;  4OZO A;  3I3E A;  3U37 A;  5B4N A;  1XNA A;  4XZU G;  2CDO A;  2ZEX A;  2RVA A;  3K75 B;  4TTG A;  3WNM A;  1UZ0 A;  2WZE A;  2Z4F A;  3EB7 A;  5IFT A;  3K4D A;  4A4A A;  1SFP A;  3T08 A;  2EIC A;  1ULO A;  4MOA A;  2EIE A;  2WAO A;  4AG4 A;  2Y8K A;  2W1W A;  5IFP A;  1CZT A;  4CUA A;  1W9W A;  2Y6J A;  2VZO A;  3MV0 1;  3WNL A;  1JYN A;  2W91 A;  1L7Q A;  4MGS A;  3WSO A;  3GGL A;  3CDZ B;  4MO3 M;  4LOS A;  5CKN A;  1O8P A;  2V5D A;  2C26 A;  2YFU A;  1GOG A;  3I3D A;  2JDA A;  2X10 A;  1F4A A;  2YG0 A;  1OF3 A;  2YC2 A;  3LE0 A;  4A42 A;  4Z2A A;  2C9K A;  5JXI A;  4L0P A;  3NQH A;  1KEX A;  4M4R A;  1XNT A;  3HOB A;  1UYY A;  1UY1 A;  2Y6G A;  1EUT A;  5JXG A;  4E8D A;  3POB A;  2WUH A;  1W0N A;  1JZ2 A;  3I3B A;  4XUT A;  3A21 A;  2DDU A;  2Y6H A;  1NAE A;  2W95 A;  3MO4 A;  1CIY A;  2J1T A;  2ZXQ A;  2W46 A;  4DEV A;  3UET A;  3ACG A;  5F7U A;  2VZT A;  5G05 L;  2WYS A;  5LCW L;  4OMC A;  1GUI A;  4QX1 A;  2QQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...