2QQKA

Neuropilin-2 a1a2b1b2 domains in complex with a semaphorin-blocking fab
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
568
structure length
541
Chain Sequence
PCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVYAPEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSMLYIKFTSDQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDLYDWLDIWDGIPHVGPLIGKYCGTKTPSELRSSTGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEWSPSAARLVSSRSGWFPRIPQAQPGEEWLQVDLGTPKTVKGVIIQGARARAFVRKFKVSYSLNGKDWEYIQDPRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural studies of neuropilin/antibody complexes provide insights into semaphorin and VEGF binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Neuropilin-2
total genus 122
structure length 541
sequence length 568
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00431 CUB CUB domain
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2qqkA03
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2qqkA04
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 2qqkA02
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 2qqkA01
4KWUA 4A44A 3WNMA 1WKYA 4M4RA 3BGAA 1JZ4A 3A22A 2EIEA 2RV9A 1JU4A 3WF1A 4AG4A 1GNYA 2VZPA 2WUHA 2ZXQA 3OGRA 3HJRA 4E8CA 2WZ8A 3OEBA 1JZ3A 2E26A 4QDQA 4YPJA 3NJXA 2W46A 3VD3A 5G05L 1KGYA 3A21A 4HG6B 2EIBA 3VD4A 1SPPB 2XHNA 4MGQA 4PT6A 2VCCA 2VZTA 1XPWA 1UXZA 5JXGA 2W92A 4W8JA 3OG2A 5JXIA 3E1F1 2HYXA 4QDSA 4TTGA 4PF1A 2VCBA 1PX3A 5IJRA 2R7EB 1JZ5A 4W50A 1W8NA 1JZ7A 4E8DA 2CDPA 3JXSA 1UYXA 1SHWB 1W9TA 4BJ0A 2J7MA 3LPFA 3I2JA 3POIA 1SDDB 3I2IA 2L9LA 1UZ0A 3IAQA 1UY1A 2LS6A 2VOTA 2QQIA 3GGLA 4QX2A 4A45A 1W9WA 4GWIA 2VO5A 3C7FA 3WNKA 5IFTA 3W5NA 2WZEA 2VL4A 4OUEA 3SEPA 2VZUA 2VQUA 5CKNA 3SKVA 2YFUA 3HNYM 4XUOA 1W99A 1XNTA 3NNGA 1PMJX 2W47A 2W91A 3T0DA 5EJ1B 1DYOA 2QQNA 1JYXA 4JKLA 4A3ZA 5JXHA 3POBA 1OF4A 2WO3A 3LEGA 2VQTA 2C4XA 2Z4FA 4D8MA 1WCQA 1BHGA 5DMYA 3I2GA 2LW8A 1MPXA 2E32A 2WABA 1JZ2A 5F7UA 2VZSA 4DXTA 4LHSA 3THDA 3NQHA 3U37A 1ULOA 3OB8A 2J1SA 1H6YA 2BBAA 2J1VA 3ABZA 4L0PA 5CYYA 3UNPA 2QQMA 5CKQA 3HNMA 3J7HA 1NUKA 2RJ2A 3WNPA 4ARYA 2YC2A 4MO3M 4CVUA 4QB2A 2DCKA 2E33A 3K4ZA 5C7GA 4P5YA 4QX3A 1F4HA 2WAOA 3K46A 5A1AA 1D7PM 3CZJA 1O59A 4MOAA 1SZBA 3LQCA 5DPNA 2VMDA 1DP0A 1JZ8A 3C7OA 3WQBA 2W1UA 4XUPA 5IYYA 1UYZA 5IHRA 4W4ZA 3NJVA 1JYVA 1NKGA 3MUY1 4A42A 4RYDA 2BERA 1HN1A 2VMEA 1K45A 3ETPA 5HXMA 2CDOA 2Y6HA 2Y64A 3HN3A 1L7QA 2ZEWA 1OH4A 4BDVB 1K42A 3T2PA 1JU3A 4QB6A 2ZEXA 5DQ0A 3A23A 1TG7A 1W9SA 1XNAA 2WN2A 3HOBA 2V4VA 1CZVA 2WQ8A 4CU9A 1UWWA 1NZIA 3CZUA 1TVGA 3HEIA 1GOFA 1OT5A 4CUBA 1XC6A 3WF2A 4TXWA 2QQKA 1F4AA 2V5DA 2X09A 3KQ4B 3WSOA 1OF3A 2VZ3A 5J1XA 1UMIA 4DUVA 4PQQA 1K3IA 4LKSA 4CU6A 2XOMA 3MBWA 2VTFA 4ZZ8A 4JKMA 5EIYB 1EUUA 2YB7A 1R64A 3PUIA 3DYOA 2VZOA 4A4AA 3THCA 4LOSA 1OD3A 2VR4A 2BZDA 2VZVA 3LEIA 2WAAA 3FL7A 5JR2A 3FHAA 5I0DA 4DEVA 1IQDC 2QBXA 1NAEA 4QAWA 2YG0A 1LNSA 3VD9A 5DN2A 3C7GA 4MGSA 2VC9A 2VZRA 2W9XA 2XQXA 4ZZ5A 4UAPA 1GUIA 3POEA 1GU3A 1SPPA 4XUTA 4LOTA 5B4NA 1L7RA 3CKHA 1UY2A 3HPNA 3ECQA 3I3BA 2QQOA 1UY3A 1UYYA 5C70A 3POFA 3T09A 4D0QA 2VM9A 3T2OA 3BN6A 5IFPA 2QQJA 3DYPA 2PQSA 2ZEZA 3NRUA 3IDAA 2W3JA 3VDCA 2WO1A 3LEKA 1UXXX 3I2KA 3OGVA 2JKXA 1K12A 4QDRA 5CKMA 4ARXA 2Y6LA 4OMCA 5HPOA 4CU7A 3K77A 3MO4A 2X05A 3W5MA 4JHZA 3C8XA 2WN3A 4OMDA 3CMGA 2J1EA 2DDUA 2BGPA 2RVAA 3DEMA 4XUQA 3K4DA 3K4AA 3IIIA 4P08A 3VD5A 4BXSV 2WNOA 3AC0A 4DEQA 4XUNA 3FHQA 1JYWA 3CIHA 4XZUG 5LA1A 4ZY9A 2W1QA 2WYSA 2X10A 3DYMA 3UESA 1J84A 4CUCA 2JE8A 3K75B 3OGSA 4BK4A 5CZKA 3UETA 4KMQA 5JMOA 3EYPA 1RYYA 1GMMA 2C9KA 2EIDA 2J1AA 3WF0A 3LE0A 4LQRA 1O8SA 2V72A 3I3EA 2VZQA 3I2FA 1US3A 5JUVA 4LMFA 3F2ZA 4A6OA 4A41A 3VDBA 1GQPA 4P00B 1ULPA 4GWJA 4OZOA 1NT0A 3SEEA 2VMFA 2Y6GA 3WNLA 1P8JA 4DXRA 2JD9A 2WO2A 4ZXEA 5G04L 4QX0A 3POGA 4UI9L 3I97A 2W87A 2W95A 4LORA 4QB1A 3GM8A 3IB3A 2E31A 4JKKA 2W1SA 1T2XA 4LPLA 5LCWL 1GOGA 4XURA 4Z2AA 3CDZB 1JI6A 2VJXA 4FI9A 2Y8KA 2ZEYA 3WEZA 2JDAA 5EJZB 1JYNA 2YFZA 2Y6KA 1SG3A 3ACIA 4QX1A 2B9VA 2VCAA 3T0BA 4P02B 2W94A 3DECA 4M4PA 2J1RA 3MV11 3T2QA 3ACHA 2KD7A 4IUGA 2YC4A 3I2HA 1CX1A 3WNOA 3T08A 1UY0A 1NX9A 2J1UA 1YQ2A 3P6BA 3C7EA 4AAXA 1PMHX 3A7QA 4UOJA 3ZM8A 1I5PA 3SKJE 5CISA 3FN9A 4JX0A 1J83A 3POJA 4OYUA 2XONA 2VMCA 3LPGA 3WF4A 3ACGA 2BGOA 1PX4A 5C71A 4DUWA 1O8PA 4CU8A 4QPWA 2ID4A 5B4XA 3MV01 1UX7A 2B4KA 5FUIA 2HLEA 4DUXA 4RN5A 3VDAA 1UY4A 4XVHA 2EICA 1W0NA 1US2A 3GDBA 4KI5M 1JHJA 2W5FA 3C7HA 3WF3A 2WBKA 5LA2A 4DXSA 1UMHA 2WDBA 3ACFA 2DCJA 3D3AA 5JXJA 4ET7A 3EB7A 2ORZA 2QQLA 3OEAA 4CUAA 1CZSA 3PUHA 1CIYA 1CZTA 3CQOA 3OBAA 1SFPA 1DLCA 3MUZ1 2Y6JA 3IAPA 3VD7A 5LA0A 3HNBM 2J1TA 2J22A 1KEXA 2VZ1A 3P1IA 3GXUA 3T0AA 2W1WA 1JZ6A 2ORXA 4GZ9A 2C26A 2OKXA 1W8OA 1GOHA 1H6XA 1EUTA 3WNNA 3I3DA 4BK5A 4MADA
chains in the Genus database with same CATH superfamily
2UWAA 3PNAA 1GYKA 3BGAA 4UXAA 4GB31 4CCLA 1D4M2 3WF1A 1QMJA 4Q27A 1G6NA 1UU4A 2O8QA 2VQ0A 5FV3A 4GMP0 4BU2A 3WZ1A 3ZVXA 4ITCA 3VKFC 4E8CA 1V70A 1OSGA 5A6YA 3ZFEA 5FZ7A 5KC5A 3WINE 4YPJA 3H1MA 3NNJA 4AR2A 3ZSKA 1MR5A 4IV3C 2RMU3 1N1TA 3L2HA 5G05L 1KGYA 4LLOA 4M00A 3N7MA 4JDNA 3QACA 2EIBA 2F6BA 2IXKA 4NJ4A 3VD4A 2D6PA 4FSJA 4Z92B 1S0CA 1SMVA 3FZ3A 5D8AA 1PK6C 2XLFA 5JXGA 1RUC3 3ILRA 4UF0A 1QJU3 3U11A 4META 4XYXA 4O9GA 2BOJA 4CDUB 2RMU1 3POSA 1ULEA 5ISLA 1QGLA 2B46X 3GHNA 2VCBA 1PX3A 4FFGA 3UKNA 4UW6A 4Y1XA 4V2WA 1AR92 1LHVA 1MS1A 1RUF3 1RUD3 1YI9A 1ULFA 3BYWA 1RHI1 4YGBA 4XJ8A 4NUBA 5FP9A 1IOAA 2VMIA 2PHDA 5FP8A 1POV3 2WIIB 3DN7A 4Y33A 2D40A 2JXAA 1J58A 3I2IA 2L9LA 4URTA 3ZFFA 1UY1A 3VN4A 3WY6A 2XL9A 2OVUA 2VOTA 3B01A 3GGLA 1W9WA 2A71A 4HONA 2VBPA 2WA3A 3FC0A 4OUMA 4CCJA 1CWPA 1XSRA 3B69A 4QX7A 4S2GA 2DFCA 1H8TB 3WD5A 2VL4A 4OUEA 4Y3OA 5A80A 2DV9A 3SEPA 3WW3A 1RUD2 1S0FA 2VQUA 4HBNA 4LBJA 5EYYA 3SKVA 5FZOA 3SHRA 4CZSA 1PVC3 1XNTA 1XNDA 4QM8A 3NNGA 3WDTA 1VBE3 2W91A 2ARXA 4AEDC 1ZA4A 1QXJA 3JBG1 2Y38A 4GD4A 3AFGA 3T0DA 4XJZA 1QF3A 4U2AA 2XHKA 5F3CA 1Q56A 2R041 1CPNA 5JXHA 5DUUA 2VVEA 4BQ2A 3RYPA 1AXKA 2VQTA 2Z4FA 5DUWA 5F3EA 2RM21 1LHNA 2YV8A 3MIGA 1WCQA 3MFCA 4MXWB 2RR11 1BHGA 3S5AA 1ZM1A 3KS7A 5I93A 4IE0A 3I2GA 1A34A 4XC9A 3ZYRA 1MPXA 2JEMA 1VMFA 3RZJA 3WDUA 1AZDA 3R0RA 2JECA 1I5ZA 1G8WA 3E6DA 5JMCA 2BV4A 3H7YA 5ACA1 2RS13 5BXXA 1RJ7A 2Y34A 2XQRA 4IV1C 4LKEA 2WS93 1CAWA 1PGW2 5ABJC 2J1VA 4BQ3A 3FFZA 4P9LA 4JQRA 4KWKA 3LD8A 1MZ6A 5J48A 3TYJA 3H8UA 2ZX4A 2VULA 5LBFA 4BQYA 2YC2A 4CVUA 1DCSA 4K9SA 2VUJA 2DCKA 3Q8EA 4AEMA 4EN9B 2O14A 3OSDA 4J25A 4XACA 4ZKTB 1TME1 3N9NA 1D7PM 4Y24A 1O59A 1RITA 2QVSB 4MOAA 5A33B 1F35A 3LQCA 1DZTA 3EBRA 4N43A 3GCWA 4NRQA 2CV6A 3ZYFA 4ISQA 3WQBA 2W1UA 5C4WB 5A7NA 3HIFA 5A7SA 1HJFA 2RDRA 3B94A 3SH5A 4C8DA 4FXGB 4CDXB 4URAA 1UYZA 5C5UA 5IYYA 4FTBA 5IHRA 3QBQA 1F5JA 1QJX1 3AXDA 4F3JA 4IGOA 4A42A 4I30A 4AI2A 4RYDA 2VMEA 1K45A 1RMU1 3BKZA 5ANNA 5HXMA 5JOXA 2D6KA 4NPLA 5K9YA 1AR71 2CDOA 1VIWB 2QDNA 1CJDA 2Y64A 3E97A 2DVAA 4YM0A 1VRH1 5SV5A 1H2MA 4QPGB 1LEDA 1W04A 1VBB3 2K46A 1WW5A 2ZEWA 4RQPC 3PU3A 3V56A 2E63A 2W68A 5FPVA 3O1UA 3ZN6A 4XJWA 2BWCA 4LIVA 4LKDA 1WCKA 1LR5A 2ERFA 1WBLA 1H4GA 1YHFA 3VDDB 1OXCA 5FMDA 2ARCA 2H6CA 4Y22A 3ZSLA 1QJEA 2XJUA 1LHUA 3OPZA 4H2AA 4EV0A 2YGLA 4AVBA 1HLCA 3LA2A 4HPKA 1QQP3 4JAAA 2Z2SB 5FMBA 2V4VA 4CU9A 4LHNA 1UWWA 3AP6A 1BCXA 1TVGA 4WVMB 5C4WC 1CD3G 1HB4A 1OT5A 4LKFA 4CDXC 4GJYA 1CONA 4IESA 4B3NA 5FCCA 4XDQA 1EP0A 1KXGA 1ZZ9A 4H3WA 2IZWA 3KQ4B 2DU0A 3D4KA 4GWNA 4MGYE 4XF1A 1OF3A 2VZ3A 4OCTA 1D4M1 5J1XA 1QEXA 4PLOA 4LKSA 4CU6A 5E89A 4Q2FA 1SLBA 1DQ1A 2PLV3 1JUIA 1NCRC 4Y5Z0 3WDVA 2VTFA 3KV9A 3RZKA 4ZZ8A 2MEV3 4P9IA 3LCPA 1R64A 2DFBA 2C1FA 1GR3A 2VZOA 3THCA 2VR4A 4Y26A 2BZDA 2DVBA 2PHRA 5JR2A 4FVVA 1FXZA 4EN0A 1R082 3PIJA 1GSLA 2RS12 4KBZA 4QAWA 5L9VA 4E27A 5CFCA 4YW5A 1LNSA 1B09A 3VD9A 4CXWA 3ZFEC 4AXOA 2GDFA 3ALQA 1MQTC 2G9GA 3VZNA 2ADDA 4MGSA 2VZRA 4DRRA 2PHXA 4EN6B 1FAYA 4D69A 1OLMA 2CHHA 4ZZ5A 1GUIA 4HANA 5IT6A 4CEWB 2XBO3 3J4UH 3OY8B 1GU3A 1O5UA 4L97A 2YUEA 5B4NA 2OZJA 2YBSA 1X82A 5FPUA 4YFWA 2EALA 3W59A 3I3BA 4NVPA 1E57A 2B5HA 1AJKA 4YW4A 1QOOA 3VDDA 2JX9A 3X29B 3VBRB 2ZGKA 1QJY3 1REDA 1DYKA 3I54A 4GB33 4MHUA 1VRH2 2JG9C 5FBJA 5JOYA 4B7KA 1NA1C 1A8MA 2WFF2 2ZEZA 3AK0A 4Q1PA 1D2SA 1HQWA 4XCBA 3W21A 4EZ4A 1VAKA 1YFWA 4UFLA 5IVJA 1VP6A 1JH5A 2NPIA 1CAXB 5FTTC 1EAH1 1UN1A 1TMF2 1YI7A 1ENXA 2WO1A 3VKMA 5CAZA 3HD8B 3MIEA 1H8VA 1SLLA 1UXXX 3I2KA 4Q4V1 3ZFFC 5GLWA 1HRI1 5J3UA 2Y6LA 4LK6A 2RDQA 4OMCA 3ZFEB 4CU7A 3K77A 1QNYA 3MO4A 2X05A 1DGWX 1WMXA 3IDEA 4JHZA 4K21A 4DPNA 1VBD3 3AM2A 5IWFA 1MZ5A 1KD7A 2PLV1 3U1XA 3L9JT 4W6YA 1OVPA 2WNUB 3CMGA 1KS4A 2J1EA 3JB8A 2RVAA 1V6IA 4XUQA 4BXSV 1AL0G 4WVWA 3H8XA 1SLCA 4QKNA 4DEQA 2GC2A 3ZYPA 2IXCA 3ST7A 5K8SA 3J7NA 3JB4C 3FMGA 1G9FA 3CJIA 1HXS1 3FUOA 4M3CB 2YGMA 2W1QA 5EV7A 3DYMA 3PVOA 5FBZA 1Q8OA 4XFFA 1J84A 2ZZJA 4GA9A 1SEFA 2JE8A 3K75B 4TSVA 1FOD2 4BK4A 3LOBA 2OW4A 3IZOA 2FDKA 1NY71 2ENRA 2GH8A 1NG0A 2VNOA 1RYYA 1GMMA 4OI0A 2OUJA 2BFUL 2UY9A 1UF2C 4RS5B 1REEA 2V72A 1CJPA 1LOAA 1ND2A 1RHI3 3D82A 4IEYA 1AX0A 3J8F1 5JUVA 5FWEA 4GWMA 2CWMA 3GNEA 3OGJA 5FYYA 4XIKA 3WG2A 1W6MA 5K0UB 5CADA 3HQXA 4A6OA 1I1EA 4A41A 3DPRA 3RS6A 3LIGA 4I0BA 5FMOL 1AR93 5J96B 5KXBA 5FKBA 4YG0A 4IV1A 1AHSA 4OZOA 1ENRA 4XW3A 5A3PA 2VMFA 5A6ZA 1GANA 3J8F3 1ZRCA 3WX5A 5FXXA 2JD9A 2WO2A 3WXPA 4AQ2A 4UFJA 3VBSB 4FPCA 3WP6A 3POGA 3A0NA 4XHXA 1AX1A 2VBDA 3JU9A 2KA3A 1LGCA 4NE9A 1W8UA 3I7DA 3PUSA 1C5HA 1HB2A 1V0AA 4X6RB 5FYBA 3S57A 1T2XA 3AXEA 1RMU2 4LPLA 2WT1A 5F2SA 1OOPA 1GQGA 4P9GA 2D43A 2ZGOA 3B5LB 1X8EA 5BNNC 1QJU2 1H30A 2RS31 3RWKX 1W39A 4RD7A 5L9RA 4AEJA 5BNOC 1BYHA 1GP5A 4QQOA 3CDZB 4RS5C 4CYDA 4AHWA 2BDRA 2VJXA 4XXAA 5F3IA 2ET7A 2Y8KA 3INAA 1PNFA 2ZEYA 3WEZA 1ULDA 3J8F2 4YVSA 4XOGA 2LROA 1QXRA 1ULCA 4PCRA 5EJZB 4GULA 2E53A 4PI2A 3G7DA 1Q8VA 1FMD3 2R0HA 3CNAA 2B9VA 2FMYA 2WT2A 3PMSA 3OTFA 2Z79A 4P02B 3WR0A 3W9AA 4S2HA 4HKLA 2JDKA 3KV4A 5GZCA 1S0GA 2QFEA 3H9AA 2AZ5A 4XQ4A 2B8MA 1W2OA 3T4VA 4P9YA 2OT7A 5CNAA 2E7TA 2W08A 3VBUB 3JZVA 3AL6A 4D3WA 5IK4A 1EV13 1NYWA 4AVAA 2X5IC 1YQ2A 3PDQA 5A32B 1KFUL 2R1BA 2PN5A 5FYIA 4LBQD 1OH3A 2K2SA 3FWEA 4UOJA 5A33A 3B9IA 2ZKLA 1Y43B 3CJXA 3PURA 3CEWA 5A6XA 5C9AA 5HI0A 1JHNA 2HH9A 1VB2A 2F17A 3ZR6A 4EWDA 4Y4RA 4COWA 4AYUA 1HQLA 2LALA 3CU7A 5JVVA 4LITA 4LXLA 1J83A 3POJA 4DB5A 4M3CE 2FCTA 4FOYA 5K7PA 3N7LA 1X9TA 4DO0A 1HV0A 4QGLA 4GB32 1PX4A 1VJ2A 1YQCA 2GP5A 3KGLA 3MIHA 4QGNA 3ZO0B 3WHTA 4QPWA 1AR62 1UX7A 4LNVA 1YQ6A 2B4KA 4OUSA 3LA3A 2ZX0A 1D2QA 3ES4A 3G6JB 2HLEA 2RJLA 1QHDA 5FYMA 2HWF3 4KG8A 2D5FA 3RMYA 1OLQA 3AZXA 3BODA 3VBUC 4CXYA 1JHJA 2W5FA 3C7HA 5A7QA 3ZYBA 4DZGA 3H3LA 3D3AA 2DCJA 3N4MA 5FPXA 2VXJA 4ET7A 2Q1ZB 2I07B 2ORZA 3ITQA 3KV6A 3RI8A 1IPJA 5CIRA 2DBNA 3PUAA 3R4DB 3UYJA 3AP7A 4I2OA 1PK6B 4XILA 2AYHA 4YG6A 3CLPA 1AF9A 3I59B 5I0SA 1FOD3 2YY1A 4FOVA 2ETEA 5FXWA 5C8CC 1HRV3 3AMPA 3PUQA 4NR1A 2Q8DA 4HN1A 3AL5A 3O1MA 1JZ6A 2ORXA 3ZXDA 3U4XA 1YFUA 4CCEA 4RR3A 3HR9A 4ZU4A 1AR91 4N9HA 2TUNA 2MNGA 5M0TA 3QD6A 5FMOS 2WNVB 2RR13 4YVWC 1XSQA 4V1PA 5E8AA 1CESA 3GZAA 2UWBA 2V73A 2QKDA 2R49A 1WLDA 1NA1A 4OI4A 1I6XA 2W39A 1HW5A 3MPPG 4A44A 3M1HA 3H8RA 1Y3TA 4HL0A 4M4RA 1H1AA 4WVVA 5DAQA 3A22A 1PIV1 2EIEA 2ZHKA 1BEV2 1HX6A 5DUVA 1QY4A 4YZ5A 1RUJ2 4AE2A 3VBFC 2OPKA 1H8TC 3AKPA 5HCHA 2P37A 1VR3A 4ZU7A 2ZXQA 5FZKA 1KFXL 3OGRA 1MS5A 3HJRA 3SNMA 4PLMA 2WZ8A 3NV4A 4Y20B 5FZ0A 5GM0A 5L7OB 2GALA 4BM8A 1JZ3A 2VOKA 1ASJ3 3B7MA 4XTMA 1BZWA 1PO22 1YYNA 2FZ1A 4Q1RA 4AEDB 4XABA 1A8DA 4UW5A 4B8EA 3MW4A 4M01A 2RR12 3IT8A 3O0VA 3OY8A 1UIKA 4C0HA 1CAVA 2FBEA 5IVFA 5LBCA 3MF6A 1RUG2 3O0WA 1DQ6A 1XPWA 2VZTA 1UXZA 5T5PA 4S2DA 3RRDA 1GFF2 4BLJA 5JXIA 4KWJA 4MGKE 1XRUA 1CAUA 3MIFA 4IXLA 4QDSA 2P17A 1LTEA 5F5AA 4PF1A 3GF6A 1VBD1 3VGIA 2ZGRA 2G1MA 1VMJA 1ZA7A 4XF9A 1RUD1 1B35A 4E9KA 2VCMA 5BUVA 1AYM3 1VBA3 4IEOA 1SHWB 2JDUA 3TN91 2AH2A 2P3IA 3I2JA 1O91A 4EQVA 5KXCA 1SDDB 4WM7A 4CEYC 1C4RA 3AP4A 5ABJB 1XOYA 1QOTA 5KHIA 5L7OC 1RUF1 2VMGA 4LT5A 5DDJ3 4ORFA 1GZ9A 4GWIA 4OFGA 2Y33A 4A7KA 3IN9A 2XWBB 1QJY1 1YIFA 4K20A 3I2DA 3KV5A 4HFSA 1Y9QA 1WLTA 3D5OA 4X6QB 3VKLA 1DGWA 4OI1A 2ZGUA 1JYCA 2YU2A 3I2OA 2NZ9A 5DDJ1 1MEC1 2A75A 1OKOA 5GZFA 4FT8A 3M8LA 2Z5WA 1YIPA 3LDRA 5EJ1B 1OA4A 5KXEA 2QQNA 4XF4A 4TZDA 1W0PA 2VUAA 3LIHA 2HJIA 4JKLA 5F32A 2VH9A 5FY0A 3VBHB 5LEKA 2YDEA 2VNRA 3TEWA 1VBB2 4XAAA 4RGKA 1FPN2 2C4XA 2FCVA 1ZBE2 3MHZA 3SXWA 3EMRA 2DU1A 2HWB3 3PMEA 4LBMA 3V0BA 3PLQA 4Q26A 1J1LA 1NQJA 1SCSA 4RS5A 5FZIA 2P5BA 1MZFA 3LAGA 5DMYA 2D93A 3NAPA 4BMBA 5DXDA 4YVSC 4Q4X1 2E32A 3GZEA 1JZ2A 2P3KA 2JIGA 5F7UA 4UFHA 2MEV1 2VZSA 4YYOA 5C3RA 1G9BA 2DBIA 4BIFA 5J7MA 4LR4A 2CWSA 1RJ8A 2QNKA 1UPIA 3DPRB 2HWF1 2QZ2A 3KVBA 5TSWA 1GP4A 1PM4A 1XBFA 3NQHA 3O5SA 4FBFA 1BEV1 4QPIC 1ULOA 2Q1FA 3OB8A 4KG0A 4QHZA 2J1SA 3S30A 1D4M3 2D3RA 4O61A 2YYOA 4L0PA 4NWVA 3ZFGA 3UNPA 4WZCA 4YGEA 3D0SA 5A70A 3BI3A 3J7HA 1W6NA 1NUKA 2I45A 1H9PA 1B35B 1ND3C 3K3NA 3WW2A 1BQPA 2VBBA 4QB2A 2PYTA 2R1DA 1EAH3 1HRV2 3K4ZA 2E33A 3VBHC 4DNYA 5C7GA 1FATA 3POYA 1X36A 1LOCA 4QX3A 2JG8B 3U78A 3VBFA 2PLV2 4IDZA 5A1AA 1NQDA 2VQAA 5C9AC 5LA9A 1AR82 1SZBA 2WWUA 4NAOA 4NWWA 4XBLA 4XMIA 2ZMLA 4AVSA 2IXHA 5LZ6A 3QOPA 4FPLA 4N90A 4Q4V2 3WCRA 4QXKA 2PELA 1BEV3 2OS2A 4WM8A 1HV1A 2FDGA 2AEYA 1M4WA 3NJVA 1ACCA 1PVC1 1NKGA 3MUY1 5F2WA 4GH4A 4JTNA 1A6CA 5AVAA 1HN1A 4Q8KA 3VHNA 4ATFA 3LEMA 3NNMA 1JODA 1NE6A 1OFSA 2W2IA 5F6KA 1RHI2 1UOJA 1RXFA 2B9UA 4PIZA 5FXZA 4CP9B 4LBOA 1UYPA 2GN7A 4XQWA 1K5MC 1W2AX 4BDVB 4A6SA 2JDHA 2ZKNA 3VZJA 1QDCA 1J3QA 3NMBA 1XNCA 1MS9A 2XKOA 2IVJA 2Q4SA 2XGXA 2ZEXA 3RVHA 4MGTA 3O1OA 5FP4A 1PZ9A 4RHV2 1QNWA 2D6OX 5EWSA 1OI6A 1IS3A 1RUG3 5HCFA 1CQ9A 3FLTA 1XNAA 4IW3A 4BCUA 4NMIA 2IFWA 1E5HA 3I3QA 1CZVA 1O4YA 2WQ8A 1MEC3 4FFFA 1NZIA 1WA6X 2E9QA 2PTMA 5D8AB 5JSOA 5LB6A 3ATGA 1UKGA 3N9LA 5CVRA 4BIOA 1H0BA 4CEYB 4CUBA 1XC6A 3WF2A 4OHXA 2D6NA 2QQKA 1F4AA 3EXUA 4QPGA 4JTOA 1YC61 2YROA 2RJKA 1QDOA 3WSOA 5FO7B 1UCXA 3NL1A 4RR3C 3WLUA 4FPFA 1EYBA 1RUH2 2R30A 2XBO1 3BALA 1Q8PA 1NCQC 2HEWF 1NXD1 1W9FA 3ZKUA 1W6QA 4BYYA 5C3PA 4YVWA 3O14A 4PLNA 3VZOA 3ZFFB 2H0VA 1BVVA 4CEWC 4JKMA 1WLWA 1F2NA 2WYFA 5EP9A 2WA4A 5K4LA 3S0MA 4F8AA 2VECA 3DYOA 1DQ5A 4QGMA 3O1SA 4A4AA 2QQWA 4YZ1A 4QD2A 4Y1ZA 5LEJA 1UZWA 2VZVA 3AVSA 2GN3A 2JB4A 3I49A 2CY6A 2IVIB 2WNUC 4JV4A 2JE9A 2WAAA 1H8TA 3H3ZA 1WMDA 2BRTA 1V00A 3FHAA 3M70A 4IQPA 4KNCA 3MGUA 3NSTA 1AYM1 2QBXA 3I4IA 2VTXJ 2P3JA 4IE7A 1E5RA 4GMP1 1QH6A 1VBE2 2LM3A 2D44A 1X8MA 1S55A 3LZZA 3C7GA 3VB9A 2VC9A 4GH4B 4B1MA 3AMHA 1WWYA 2W9XA 5A7WA 2XQXA 1QU0A 1FMD1 2VGDA 4YFZA 4D7TA 5CG8A 1TQ5A 2YZ4A 1EAH2 1GZTA 3OUJA 3PU8A 5LK5A 1QJX3 5DAWA 3N3HA 4CP9A 3OPTA 4DS0A 4HMZA 1U5XA 4FP2A 4H14A 4RL7A 4KGGA 5C70A 1ENQA 2NLRA 3PL0A 5GLVA 1BXHA 4XFCA 5DAXA 2FDJA 2VM9A 3ZXFA 2A5ZA 4YWAA 2KXLA 3BIEA 2PQSA 5FZDA 4UW4A 1DHKB 1HRI3 1R092 3GJBA 2VNGA 4IEQA 4OULA 2FQPA 1SCRA 2TEPA 1D4VB 1LJ7A 4AW7A 2C5DA 5DG2A 2XMLA 4P5HA 3K48A 5EHDA 3UKVA 1W3XA 1W8ZA 1K12A 4K6BA 1V6OA 2X53S 4L8QA 4R8HA 3SITA 3VL9A 4ASLA 3W5MA 2DYCA 4YZ4A 2Q8EA 4C1WA 2C6SA 3J7LA 4AQTA 3ZSJA 5ACA3 1F9KA 2ZGNA 1TME2 3C8XA 1LU2A 4OMDA 4L11A 2NMNA 3MFAA 1U0AA 5F5IA 3ZXJA 2V5YA 4EYUA 3DEMA 1LHWA 1AVBA 1GZWB 1AX2A 3K4AA 1UPSA 1U12A 1T6GC 1W6PB 2ZTNA 1R093 1PMIA 1DGRN 3NO8A 2A6YA 2B45X 2TNFA 1GLHA 3GHMA 2TBVA 2DUQA 3ME2A 1CAUB 1Q8SA 4XUNA 4IEWA 3OF1A 4HSJA 5K0UC 1JYWA 3HBKA 5GJ6A 4P14A 4RFRB 2WYSA 5FIXA 4I0AA 4FFHA 3Q9OA 2R071 1DZQA 4Y1VA 2R043 2KM2A 3WV6A 4AGRA 4CE8A 4N43C 3ORJA 4O9EA 5DAPA 3SH4A 2EIDA 5A6QA 3AP5A 1U5YA 1APNA 3MIBA 3WF0A 1TE1B 4IE4A 2WWJA 4NHXA 3S5QA 1OA3A 3O12A 4BQ5A 3RFRA 1US3A 2G4IA 3DGTA 2GU9A 3BU0A 1WCUA 3F2ZA 2PFWA 4KL1A 2Q8OA 1AUYA 4Y22B 3RPQA 2HWC3 4QPIA 2RG4A 5KC6A 5D2AA 1ULPA 2LRPA 5APAA 2JICA 1N47A 1RUE2 1YRZA 4HK9A 2Y6GA 4I3PA 5L9BA 3ZYHA 2WFF1 2XB6C 3N7JA 3WNLA 1AYN1 4DXRA 1VBA2 5D1IA 1NCQB 5FZCA 1LOFC 2XPJA 3K3OA 3HVDA 4JZRA 3MF9A 1FYUA 2ZX3A 1RUH3 2Y0IA 3S7IA 3H1YA 1HB3A 2WSUA 3GM8A 2E31A 4JKKA 1PGL1 2GC1A 3T1LA 5LCWL 1Q5OA 1GBGA 1QJX2 2BEOA 3RZLA 3O1VA 1C5IA 2XJRA 4BH9A 5F9TA 5C4WA 1O3QA 1W6MB 1NCRB 4CDXA 5JWPA 4AI8A 3OYWA 4PHZA 2BFUS 4PDWB 1VBE1 4AWDA 4QX8A 4FOQA 4GH4C 1AYM2 1W3VA 2ILMA 1IPSA 2WFF3 2Y6KA 4XF0A 4Y5SA 2D98A 3VHRA 3WG1A 4LEJA 5CFDA 1YJLA 3ACIA 2IXIA 4QX1A 4D94A 2WC2A 3N9QA 3TB0A 4QU2A 3RZMA 2W94A 5LW9A 3KSCA 2J1RA 3VZLA 4N7UA 2Q5TA 1IQAA 1ZZ7A 2WKKA 4Q4W3 1C1LA 3ACHA 1FPN3 4IUGA 4B7EA 2E6VA 2YC4A 2ZMNA 2G9ZA 3ENRA 3I2HA 4LIUA 4BQXA 2F4LA 5AC91 3RZHA 2DWRA 3AJZA 4IGQA 3P3PA 5BNPC 2XLAA 3UJOA 4U36A 2XBO2 5FJHA 1YFYA 3P6BA 3C7EA 1YLLA 1PMHX 2OXBA 3DCQA 3PJQA 1YJKA 2HWF2 4TN7A 5FZEA 3A7QA 3Q8AA 4QQPA 2JB8A 4LUMA 2D3PA 4XTPA 1C8M1 5CFCC 3KVAA 4EZHA 3NW4A 5LATA 3GBFA 3T2TA 4FPOB 4DRVA 2WSVA 4NHMA 1MQTA 1JW6A 4QKBA 1RVF1 5CA6A 3DKWA 1V6LA 1DDLA 1COV1 4PF5A 2A3YA 2CYFA 3MLJA 2QJVA 3ACGA 2XUEA 4XZPA 3SMHA 3TNPB 4UFKA 5F6LB 2BPA2 3JQWA 2WLPA 4IEXA 4QPGC 1GWMA 1FPN1 3VKNA 4JVAA 3T4HB 3ZYGA 2E51A 1BMV1 4YZ2A 2R042 2VY0A 4DUXA 2KR2A 4AVVA 2G19A 3MIDA 3VDAA 1UY4A 3VDDC 4XVHA 5T55A 5T5JA 2EICA 1ZBE3 1W0NA 3ASIA 1US2A 4YNIA 1QQP1 5LA2A 2D3SA 4LA3A 4XXPA 1VBC1 1C28A 5FXVA 2ZGPA 2BTVC 1F8VA 2ZAHA 1UZYA 3HT2A 3MPBA 3PUHA 5BPXA 4Q29A 2WNVC 4KH9A 4TLFA 4XEZA 5DZFA 4CDWA 4CCDA 1SBFA 3OBAA 4LJHA 4H7LA 4XPVA 3ZPYA 5FDBA 4MZUA 1RUF2 3KMHA 2PAMA 3H3UA 1R1A3 3ZDVA 1OBNA 1HXS3 1W06A 5LY2A 4DQAA 1CAXA 1OUXA 3JBG3 3WP3A 1SQ4A 3RSJA 2J22A 4ISRA 3AYAA 1UD1A 2VZ1A 3VBSC 1AR81 3GXUA 2W1WA 1J3RA 1O3TA 1GP6A 1OLME 1BK0A 1URXA 4CPBD 4OHYA 1GOHA 2A1XA 1UOBA 1VAVA 4Q4V3 5FYCA 5IVVA 4FOWA 1EUTA 4LBQB 3ETQA 4UFMA 3S6PA 1R1ZA 4INDA 1YEWA 2I2SA 5E6HA 3CJIC 5FZ4A 1HN0A 4MADA 4E4HA 4OI2A 3BTYA 1VE0A 1WD4A 2Q1MA 1HDKA 3WNMA 2GZWA 1RUG1 4DIQA 3MDPA 5F39A 4XFGA 1Y9GA 2P3YA 3NV3A 1JZ4A 1G9DA 1NLRA 3B9CA 1JU4A 2P34A 2OQ7A 4YW6A 3OD4A 1DZRA 1MQTB 2ZGLA 4YGDA 4OHWA 5DG1A 4K1ZA 4BLIA 1ND2C 2B39A 1POQA 2YMZA 1OVSA 4QDQA 1ZRFA 4IE6A 1GKBA 4XIOA 4ES9A 2W46A 2EAKA 4FPYA 2JDYA 3AZWA 1I9RA 3V64A 3TEXA 5JZGA 4HG6B 4SBVA 4FXKB 5JOWA 5AFBA 1SPPB 4CP2A 3IMMA 2HBTA 1WMFA 3TRSB 1YUDA 4PT6A 1FNZA 3NJYA 2VCCA 2PHWA 4I01A 4PQ9A 3OG2A 4EE2A 4NO4A 2ZPXA 3AYDA 3E1F1 5K0UA 5I8YA 1EPWA 4HPKB 2ZX1A 5JI7A 3LFMA 2CTVA 1W8FA 4FQ4A 4OQ8A 1S2KA 1V6NA 1IKQA 4AHXA 1S0JA 1XU2A 1MEC2 2GC3A 4Q4Y2 3J7MA 3BUCA 3M3EA 1ST8A 2WS92 5FP7A 4E8DA 3THTA 4JHTA 5EPAA 2CDPA 2ZA9A 1ODNA 1XE0A 4P9WA 4XFIA 1BBT2 1ZBA2 2X29A 3T3YA 1AR63 1W8HA 3ILFA 5BNNA 4CCOA 3I3MA 5HCBA 3RG0A 1DFQA 1WGPA 2GNDA 2ZOEB 3POIA 3ES1A 4RSUA 4QXBA 4DY5A 2NYYA 2YBPA 2QQIA 3QCWA 3MI8A 5A1FA 5FWJA 2D6MA 1NE4A 2ATFA 2BWAA 2JENA 3WNKA 3CO2A 1OOPB 3VBOB 4AL9A 4EWAA 5A7PA 1PGL2 1UIJA 2WINB 2GMPA 3BTAA 5FZMA 3RWNA 3N9MA 1NLSA 1G9CA 3QH7A 2ZACA 1VB4A 1JMUB 1LECA 2PXJA 2BNNA 2BYVE 2WRAA 3NKTA 4HXCA 5FY5A 5FZGA 4KWLA 3HNYM 5BY5A 2R063 3DXUA 3FBMA 1K5JA 4HOOA 1W99A 4HT1T 4XUOA 2JE7A 4E4SA 2CGNA 4WVMA 1JYTA 1PMJX 2CSGA 1VPHA 1ZVFA 1H2LA 4FPHA 4YM2A 1DYOA 2X5IA 2HWB1 1BK1A 1JYXA 1KRIA 1AL23 3POBA 4R4ZA 3UT0A 1ASJ1 3W20A 3UGGA 1C57A 2WO3A 3FHIB 1IG3A 3PJYA 2UU8A 4KU7A 1H2KA 3AZYA 3USSA 3CL1A 3ZSMA 4D8MA 4N9IA 5T52A 2WT0A 5LWBA 4FTEA 3NWKA 5HV0A 5F5QA 1MACA 2P6HA 1W6OA 5HXVA 2D7FA 5SV8A 4Q4X2 2VUDA 5T54A 5BV6A 2WWSA 1NY72 5KHHA 4Z2WA 2DTWA 1A78A 3N7KA 4DXTA 3T1MA 1H9WA 4LHSA 3TBDA 3QLQA 3THDA 1CPMA 3AFKA 4JGZB 5LK7B 3ZPOA 4NIHA 5J98B 4E2QA 3E5XA 3GZUC 1M06G 1UNBA 2HWC1 1YNAA 2EAAA 2BBAA 2ZGTA 5F37A 5CYYA 2XJQA 2QDRA 5FY7A 1G86A 4LE3A 3HNMA 3VBUA 2XJPA 2RJ2A 3KCYA 1COV3 1O5LA 3WNPA 3JBG2 4ARYA 1VMHA 4MO3M 4XHBA 4ZPIA 4GJZA 3DV8A 1ENSA 2JIJA 1VAMA 2K9ZA 4OHZA 2ZGSA 5FY9A 2A73B 3K46A 3H8OA 3BCWA 5LY1A 3CZJA 3IIAA 3U0ZA 3NAPB 2IUWA 5I0UA 3AKTA 5DPNA 4QMAA 3AMQA 2VMDA 4WZFA 4BZ4A 5A3OA 4EN8B 5FK7A 1JZ8A 3VBOA 3OYWB 4YRDA 3A0KA 5C8CA 2FZ2A 5GZGA 4W4ZA 4ONUA 5JI9A 5FZ8A 2LTNA 2D5HA 3B02A 4PIXA 4M3CA 5T5LA 4OQ9A 1QXPA 1PGSA 3I8TA 2QTWB 4K8RB 1GNHA 5A7OA 3KM5A 3UKTA 3OBRA 1BBT3 1ZBA3 3WNXA 3AYEA 4ZU5A 1UOGA 4AF9A 3BTXA 4AOCA 4CUGA 5F1RA 4UFIA 1OH4A 5GALA 1AXYA 4BISA 4B29A 1F5FA 3AMNA 3TOJA 4CTEA 2BP6A 4W6XA 1RUE1 1JU3A 4QB6A 3ROUA 3T2PA 4MV2A 4BHPA 4CRQA 3A23A 1TG7A 4FFIA 1VRBA 1QKQA 3DUIA 1BMV2 2DCYA 3AKRA 4P9XA 2DCZA 2WNVA 3RJ2X 3LSDA 5FREA 4CDWC 3JUUA 1V9U3 4GAZA 1OMIA 4NIIA 2V09A 1S2EA 4DMIA 1OQEA 2R062 3CZUA 3LF7A 3SISA 4LUKA 3HEIA 4N7IA 1RVF2 4COZA 1PO21 3B00A 3WCSA 2O1QA 4FPKA 4JGZA 4FAGA 4L99A 4TXWA 1MS4A 4LA2A 3VBSA 1IHMA 4I09A 1RXGA 2EXJA 3E5QA 2V5DA 5A3TA 5FY1A 1QOSA 4EJRA 5FQ0A 1PIV2 1UMIA 4DUVA 4NROA 1IS4A 1AR73 4PQQA 2EVXA 2EF6A 5KR7A 1YO8A 2XOMA 4ATEA 3WP5A 3MBWA 4XFHA 4E2GA 2WR9A 4W65A 2W0XA 5EIYB 1LODA 1EUUA 2YB7A 3PHMA 1JXNA 3WHUA 5CG9A 2DURA 1LGNA 4XAEA 2VW0A 2BVBA 3R4SA 1OD3A 1RUC2 5EQUA 3CBNA 4OHVA 2H6BA 4Y1YA 1ONAA 3ON7A 3H50A 2JJ6A 2ZGMA 5FZBA 5I0DA 1IQDC 2GNBA 1Y9MA 1NAEA 4CEYA 5A1LA 5A3LA 1DIWA 5L7OA 4YW2A 1IKPA 3GALA 5T3NA 5DN2A 4LO6B 1ZRRA 2JDZA 5ERLA 2FDHA 3AVRA 3O0XA 5IAVA 4LO7A 1TNRA 3AKQA 4XFAA 5FZAA 1UZZA 3NNFA 2AEZA 4UAPA 4AI3A 1CAVB 2ZHNA 5JZGC 3POEA 3M3CA 1MS3A 4P9JA 1RGSA 4RHV1 2UWCA 4XUTA 2F4PA 3BOPA 1R091 1UU6A 1W6QB 1MVEA 4YVWB 1W28A 3HPNA 4IV3B 1YFXA 4UYBA 3V0AB 2BVVA 2ZHLA 1OURA 2PMWB 2DUOA 1UYYA 4LBQA 4ZS2A 4BPZA 3POFA 2JG8C 2PQQA 3FJSA 5HV4A 3KT7A 1MS0A 3H0OA 4OLLA 4YVSB 2YXSA 3H7JA 4CPBA 3BN6A 4XFBA 1O7FA 2QQJA 5IFPA 3VBFB 1RUOA 4COVA 3OPWA 5IW0A 2C9AA 1N1VA 3EJKA 3NVCA 2BJSA 3UV9A 4AAPA 3O1PA 4TWTA 1LAJA 1ZX5A 3KQRA 1AL21 3HAGA 3ZXAC 1XNKA 2A7AA 3O1TA 4N53A 1EV11 1GICA 5CEHA 4Q0SA 3HN1A 4NN0A 2JKXA 4JQTA 3NAPC 1Z78A 2PAKA 4L9BA 4QDRA 5CKMA 1WMEA 5HPOA 4A3XA 3LGRA 3SLIA 4ASMB 5JIAA 1IZ3A 4B1LA 3IKWA 1XJAA 4LHKA 2X8KA 2B7YA 4FPEA 4B4PA 2YU1A 4N43B 1O6UA 2BGPA 5FYVA 2XUMA 3V0BB 4QQ2A 4MG2A 3VD5A 4P08A 2R072 4CDQA 5DZEA 1LESA 4EWEA 1NLQA 3ZFGC 1TEIA 4PJYA 1UZVA 1RB8G 4L2NA 1BVP1 3J9SA 4UF0B 5F5CA 1HXS2 1IG0A 2OIIA 1ND3A 2ZMKA 5F8PA 1LULA 2Z42A 1OQDA 3CIHA 2HWC2 5LA1A 2X10A 3UESA 2XL7A 3VBHA 2JD4A 3USUB 2OX0A 3TEYA 3RMXA 1S0IA 1DQ2A 1WA4A 2JKBA 3ZMOA 5BNNB 1KDMA 1DF0A 2IC1A 4GKYA 1J3PA 3ZXGA 5FK8A 3JQXA 4KMQA 3ZN6B 3EYPA 3SCFA 3WG4A 4CCCA 1PIV3 3LB9A 4LQRA 3O1RA 1O8SA 3VV1A 1LHOA 1ODMA 1DGRA 4BQ1A 2QQPA 5EFUA 3I3EA 4RR3B 4IE5A 2VZQA 3I2FA 2ZX2A 1E5IA 4IETA 4NPMA 4YW3A 1A3KA 5CFDC 3BB6A 4LMFA 4XJ9A 5FRAA 3RI9A 1ZRIA 1N3QA 4G3YC 4RHV3 3WT3A 3V0AA 5KHGA 1UMZA 1GQPA 1QJU1 4H7MA 4Q4Y3 4FPGA 5FYTA 3BPSA 4GWJA 3URFA 3H1WA 5H9PA 1NT0A 1V9U2 3MZHA 1UX6A 3PVEA 5H9QA 3BTZA 5D8AC 1UAIA 5FZOB 3FBYA 1P8JA 4NRPA 1UO9A 1MZEA 1S4CA 3BU7A 4L92A 4Q0QA 4ZXEA 4QX0A 1LCLA 2QQVA 4MSVA 4F83A 3TWIA 4UI9L 4YGCA 1VBA1 5FYZA 4CXXA 4XJUA 1AR72 4QXHA 4QB1A 4IGPA 3A4UA 3IB3A 1SBDA 2XG3A 5LRRA 1C8M3 1O4TA 2CAUA 5AFEA 1I3HA 3N36A 4IEPA 3MLLA 4Z2AA 1JOJA 4IEVA 1LOGA 4PBOA 4GKXA 1W8TA 4MVTA 4AFCA 2IFRA 4DINB 5EZWA 3RJRA 1CX4A 2A6ZA 1SFNA 2OYZA 4OZXA 1JYNA 4PI0A 3V65A 4D6QA 2YFZA 2NQYA 5H9RA 5AC93 5CB7A 3THPA 1SG3A 4H55A 4JDMA 2BQPA 4QPYA 3OUIA 1PZ7A 3DECA 4HKWA 4M4PA 3ZKYA 3J26N 1NCQA 4QU1A 1ND3B 2HBUA 3LA7A 4QX5A 2KD7A 3AYCA 4XJAA 4GMP3 1CX1A 3NKGA 4CEWA 2PHUA 5FR3A 1IGOA 4MXWA 2ARBA 2QZ3A 3USUA 3T08A 1UY0A 1XE8A 5H9SA 4RQPB 1NX9A 5A3WA 1AJOA 2J1UA 2WQ4A 2OQ6A 5FP3A 2N7GA 3KF5A 5ACA2 1OD5A 2WNUA 3DXTA 1WD3A 2HWE2 4AAXA 3E6BA 3TNQA 3GBWA 1GNZA 3ZN5A 2VVFA 2MEV2 3E5UA 4X8NA 3WUCA 3IDBB 3U10A 4DXZA 4PDWA 3SC7X 3LOIA 4JRLA 4AI0A 3IM0A 4YM1A 5A3UA 4XBNA 1XQNA 2E7AA 2VUCA 3FN9A 3PVNA 4HVQA 5BNOB 1VBC3 2XONA 4AFMA 2VMCA 2ZGQA 3WF4A 1RUJ1 2BGOA 3ZOIA 1HRI2 5C71A 4LE4A 4Q8LA 2VTXA 5JAXA 3W58A 4BE3A 1L3JA 1ZBE1 4BOWA 4CU8A 1OFNA 2ID4A 1PM7A 1VBB1 5FFOC 1SACA 5FUNA 1ASJ2 5FUIA 4Q5OA 1TMF1 1X33A 1AL22 1LKNA 2MHFA 4WM7B 1KDKA 4RN5A 1GV9A 5ABJA 1PVXA 2XXZA 4FPJA 5JR7B 4C0BA 1LOBA 2VOVA 4KQ7A 3GDBA 4KI5M 2P2KA 2XJVA 4RGAA 3WF3A 1ZZCA 1DYPA 1TME3 5DDJ2 4DXSA 2WDBA 4YW7A 2AC1A 1OC1A 3GYDA 2WLQA 1DLLA 1STMA 2WZR1 4JRAA 3EB7A 4MUVA 4PIYA 2QQLA 4CUAA 2ZZQA 3C2UA 1CAWB 1CZSA 1X50A 2Q30A 1CIYA 2RDSA 4NOTA 1CZTA 2Y26A 1PVC2 2P1BA 1SFPA 1PO13 2HEVF 3KT4A 1J59A 4KBBA 2Y6JA 1GQHA 3CHXA 3CF6E 2VD7A 5JSPA 5IK5A 4QHBA 4Y4YA 3VD7A 5LA0A 1KJLA 2J42A 1DQ4A 1LB2A 2J1TA 4X8PA 3KHBA 2VW1A 5FMCA 2WZR2 3NV2A 3T0AA 4GZ9A 3H42B 2C26A 5FPLA 2AACA 1MS8A 2DVDA 4UW3A 2OKXA 1XU1A 2WS91 5JPMB 2BW8A 5CU1A 2GNTA 1Y7BA 2RS52 2ZBJA 3BPZA 1H6XA 4Q4Y1 3MICA 1VBD2 2XKPA 1OLRA 4RQPA 3I3DA 5IVYA 3WNNA 4BK5A 4YM3A 3EQEA 2QE3A 4KWUA 3FLRA 4Q0VA 3NNLA 1WKYA 1PGW1 1PO11 5J09A 1C3HA 1RUH1 2GMEA 3FFQA 3POWA 1VALA 4WM8B 5EXOA 2JG9B 5FKCA 3ZLIA 2RV9A 4C1XA 3TN93 2SLIA 5C33A 4AG4A 2IXLA 4DY3A 5C9AB 1GNYA 1RUE3 2RHPA 2VZPA 2WUHA 1VLNA 2FMDA 3LFIA 4N53C 4Q4W2 5FPBA 3ZXKA 4B4QA 3OUHA 1X7NA 2HWD2 1DGLA 3OEBA 1AYN3 2K0GA 1N3OA 5JIUA 1UKRA 3GJAA 3S7EA 2E26A 3PVBB 1C1FA 1YWKA 3ZMNA 4D7YA 4MH0E 1RC6A 3NJXA 4WBBA 1CGPA 3VD3A 4LTAA 4V2VA 1U5ZA 1REFA 1YQ8A 3A21A 5FLIA 1OUSA 4BXFA 3KD4A 5B2GB 2WJSA 2FDFA 1V6KA 2PHLA 1CN1A 2XHNA 3LKJA 4MGQA 4CDQC 1ZREA 1W6PA 3MW2A 2NM1A 3WW1A 1KS5A 4Q4X3 3WOGA 4COYA 4EROA 2W92A 4W8JA 4FTSA 1Z7S1 3VKOA 4AZZA 2HYXA 3UGFA 4TTGA 1RUNA 4FO9A 3LSEA 1POV1 2AREA 3OGGA 1LOFA 2DVFA 3IDCB 4LULA 1CIWA 3UL2A 3ZXEA 4AI1A 5CFCB 3Q8CA 2VNVA 5IJRA 4CA9A 1JN2P 2R7EB 1KQRA 2B42B 1JZ5A 2PHFA 4JGYC 2XDVA 1W8NA 4W50A 1JZ7A 1RTVA 3AP9A 2ZJCA 3JXSA 1WZXA 2ZAAA 2XR4A 2FDIA 1UYXA 1W9TA 1ZZ8A 4BJ0A 3IPVA 4FAHA 2J7MA 3LPFA 4HETA 1N3PA 2HEYF 1UZ0A 3AB0A 4JDOA 3IAQA 2LS6A 5DABA 5IVBA 3BIWE 1WUVA 4QX2A 5IAXA 1HKDA 4A45A 2VXRA 2VO5A 3C7FA 2VVDA 1FT9A 3LDBA 3KB5A 2A3WA 3AKSA 3ZYJB 4R9CA 3ZX7A 5BNQA 4XBQA 5J37A 5IFTA 3W5NA 3KZ4C 4O65A 3SCGA 5LRSA 2WZEA 1UQXA 2UYBA 4CDQB 4J1XA 1VBC2 2BGCA 2VZUA 3U14A 5CKNA 2YFUA 1YQ5A 2PAEA 4DFSA 4CSWA 2W47A 3RYRA 3AMMA 4E4DX 1YXWA 3TEZA 5BNPA 3I59A 2XH6A 4OVEA 3WQ7A 2JG9A 1Z0HA 2QUOA 4A3ZA 3EO6A 4A7ZA 1OF4A 4Z07A 3LEGA 4MGZE 5F3GA 5A7WB 2GP3A 3BOWA 3UK9A 4K40A 1SDWA 4NIDA 3AZVA 2SBAA 1OKQA 3WG3A 1COV2 4XE9A 1KITA 4XDOA 5LASA 2EA7A 1XYPA 1QJZA 3VBRA 4MXVA 2YPJA 4CCNA 2LW8A 2Y60A 2WABA 3FX3A 1JTZX 4ES8A 4AQSA 3M4FA 2W52A 5IUQA 3HT1A 1PHMA 2EIGA 3CJIB 3NV1A 1POV0 4AI9A 1RUJ3 1DG6A 5I8SA 4UT5A 1FNYA 2WO7A 3U37A 4C91A 5I91A 2BNOA 2XJSA 2HYKA 1H6YA 2QQUA 2RM22 3RNSA 3OOXA 4MLOA 4BQ4A 2VG9A 4WV8A 5FZHA 4QKFA 3ABZA 1R083 1WW4A 2VMHA 4NIAA 2GAUA 2QQMA 5CKQA 1D0GA 4M0HA 3ZR5A 4HKOA 5GLUA 4D7SA 3ELNA 3R4UA 2UURA 1XNBA 1G7YA 4MX3A 4XMAA 5DUXA 1ND2B 2DF7A 2RS53 2RS51 1ZZ6A 3ZSEA 3DL3A 5C3OA 1HIXA 3T30A 3ZN4A 3AX4A 4P5YA 1F4HA 1H1MA 2GH2A 2WAOA 3M7AA 4K1YA 5D21A 2WZPP 5GLZA 1HB1A 1W6OB 2VOWA 4G4FA 4JC1A 4HLTA 2MPFA 2RE9A 1QIQA 5IVCA 2OZ6A 1PNGA 1XYNA 5IK7A 4PDWC 1DP0A 3RGBA 3C7OA 4NHLA 3VUOA 4IV1B 1QJY2 4XUPA 4AEKA 4QKDA 1VRH3 2YBKA 1AXZA 4RFT0 4WVZA 3WDWA 4A7YA 2VW2A 1JYVA 1W9YA 1W03A 2BERA 4FCAA 5ANQA 2G9FA 3ETPA 4M0NA 4CDWB 3TN92 4QQLA 3DPRC 2Y6FA 4IEZA 4Y20A 4AVTA 2Y6HA 3HN3A 3L2YA 1L7QA 1BBT1 1ZBA1 2PHTA 2HKXA 3IMNA 3WQ1A 4QHOA 4BQWA 5BNPB 2QCSB 3QH6A 3M3OA 3KHCA 1Q3EA 3KCXA 4KU8A 4AFBA 1K42A 1CR7A 2A6XA 5C8WA 5DQ0A 3VL8A 3FE5A 3JD71 3JD73 1JBCA 1OPOA 1X9PA 2R6QA 1SFYA 1W9SA 2JWPA 5JOZA 3ZDSA 4JGYB 2WN2A 1AR61 1OOPC 4B4RA 3RZGA 3HOBA 4LO5B 2DUPA 2CGPA 3E6CC 2OUHA 3OBTA 1SLAA 3KWVA 1W2NA 4NAMA 4NPRA 4YW1A 1OPMA 5BNOA 3RQ0A 1GOFA 3D0JA 5GZDA 2XWJB 5FYHA 3KLSA 1W05A 4F7ZA 2HWD1 1C8M2 3N9OA 1RUC1 2P4EA 5FLHA 5FAXA 5A3MA 2X09A 2UY8A 4Q4W1 4AGGA 1H4HA 2FHRA 2HWE1 4N8MA 2YPDA 4CP0A 2YHJA 2R0FA 5FPZA 2GMMA 1Y4WA 1K3IA 4XF3A 2DCTA 5E1RA 3SCHA 5FLJA 3UJQA 2C0ZA 5JZGB 3ZYIB 1SLTA 5AC92 1O3RA 2IWGB 3PUIA 4QQHA 4ZHNA 3WW4A 3B93A 4LOSA 4YZ3A 3PTRB 2XVLA 3LEIA 4D6SA 2FD8A 1NZCA 2H0BA 1RINA 3FL7A 2AGSA 2CGOA 1MVQA 4DEVA 2ZS6B 4DOUA 3D6EA 2RM23 4IL7A 1Z7S3 3K51A 2YG0A 5C6CA 4I02A 4LBLA 2R061 3M3QA 4QWNA 4Q0UA 5KBFA 1IPKA 1BKZA 5HBAA 4Z82A 2D97A 1W6NB 1RUI1 5FZ6A 2VE1A 3U4SA 3HBZA 4R52A 2X5IB 2ET1A 4AHZA 2E7QA 2RS32 1RMU3 2A70A 1SPPA 1ULGA 4JCKA 2WFPA 4LOTA 1ZRDA 1L7RA 2I74A 3CKHA 2BU9A 4E4ZA 1UY2A 3ECQA 1WCDJ 1TNFA 2QQOA 3JCIA 2IXJA 2DVGA 5DZGA 4COUA 5E16A 1UY3A 1XXNA 3HQRA 1QH7A 3T09A 4TYSA 4CDUA 1QQP2 3PIGA 4D0QA 4UBGA 3WDXA 3T2OA 3U75A 2LUWA 4AGVA 3DYPA 3R6SA 2R073 4JGYA 4IEUA 1IS6A 4I3GA 3NRUA 1R1A2 4A2UA 3OJBA 4XDPA 4E2SA 3IDAA 2GC0A 2W3JA 4BMEA 1JOBA 2Q0AA 3VDCA 3ZFGB 1RL3A 3RYKA 2ARAA 3Q8FA 1HQNA 3AZZA 3LEKA 2BOIA 3HQUA 4YG3A 3BVCA 1W2TA 2VU9A 3IWZA 3M3IA 3OGVA 4TLGA 3ZIXA 5FY8A 4RGGA 3UGHA 3OBZA 4ARXA 1UL9A 3U07A 4AVCA 1S2BA 4QT6A 5GZEA 1OHFA 2RS11 1XYOA 5KHJA 4IV3A 4C90A 2WN3A 5L73A 4LK7A 2DDUA 1GWKA 1HRV1 3KCCA 4LBNA 3VHOA 4ZXKA 3K4DA 1OQ1A 3IIIA 2AUYA 4MGIE 2WNOA 3AC0A 2CU5A 4I0WB 5FZLA 4Z8BA 4R9AA 1PK6A 2ZABA 3APBA 4HVOA 1U5IA 2NP0A 2BUKA 2CAVA 1FV3A 5CFDB 3KF3A 1QWRA 3KGZA 3FHQA 1S0EA 2ZCWA 4HSLA 3HWJA 2V4AA 4AQ6A 4XZUG 4BWOA 4ZY9A 1RVF3 1E5SA 1UOFA 2WZR3 3AJYA 1OA2A 2JDNA 4GQ7A 4CUCA 5C3QA 4MHRA 5FUPA 4HZFA 3OGSA 4CP1A 3F95A 5CZKA 4GALA 1KJRA 1LENA 2R16A 2WQZC 3IPVB 3UETA 5JMOA 2C9KA 2J1AA 1UU5A 4J6GA 3GBGA 3MW3A 4NHKA 2VPVA 3LE0A 5T50A 2BNMA 3VBOC 2OA2A 4HN0A 4NHYA 3VBRC 3ZIWA 1F15A 1RIRA 2YC0A 2XLGA 3B3QE 1JOPA 1ZNPA 1NA1B 2ES3A 3ACLA 3VZKA 5JSRA 1EPZA 1QJFA 1T6BX 2JDPA 1AR83 1BJQA 4ZS3A 3N35A 3VDBA 3P5BA 3ILNA 1WCSA 2NMOA 2RDNA 4R9BA 1W0OA 4YLZA 3O7OA 4XCAA 3JD72 4M3CF 4P00B 1C8NA 5KHKA 5C5TA 1XB9A 3SEEA 4GIQA 5IK8A 5C8CB 5T5OA 1ALYA 3RDIA 4FP3A 4GXLA 3DF0A 4O7XA 5C3SA 5G04L 2O8OA 4AEDA 3LDKA 4XETA 3WVJA 5FO9B 1PO23 3GCXA 1H1IA 4Z1VA 3I97A 2W87A 2W95A 3P3NA 4LORA 1AYN2 3ZXLA 1WW7A 4HVRA 1O3SA 2Z69A 5FZ3A 2W1SA 5FOBB 1V9U1 2NN8A 2BBVA 1B35C 1NOVA 1Q43A 1GOGA 1J1TA 1CVNA 2AENA 4XURA 4AK3A 5A32A 1G9AA 1JS9A 2DTYA 4WM7C 3SH3A 5J36A 1JI6A 1RUI2 3D8CA 3VLBB 4FI9A 4HK8A 1D0HA 3GZTB 2ADEA 1F31A 2JDAA 4JGZC 2HWE3 1WW6A 2GNMA 3OD0A 5JDBA 1LGBA 1S0DA 1R081 5JPNB 2GSYA 3WUDA 4XQDA 4ASKA 2VCAA 3T0BA 4CCKA 3K2OA 2Q8CA 4UWDA 5FZ1A 5CBLA 3WP4A 1FOD1 2UYAA 1Q8QA 1ZYBA 3MV11 3T2QA 5FO8B 2ZHMA 2XVGA 4D6RA 2RS33 2D6LX 4W6WA 1Z7S2 3MLKA 4LHLA 1SBEA 5FPAA 3WNOA 3R05A 2AR6A 5GKAC 4UBHA 5AVPA 1V6JA 4LBKA 2CNAA 5JCTA 1N1YA 1WBFA 2VOXA 1K5MB 4SLIA 4J1WA 4AHYA 1H2NA 3MYXA 2JDMA 1XE7A 2CL2A 4RA0A 1GZWA 3VZMA 1I5PA 3ZM8A 4QM9A 5FYUA 3SKJE 3DKQA 1IS5A 3EHKA 5CISA 5IVEA 3LWCA 5KWRA 5FY4A 4KGQA 4JX0A 1TMF3 1GWLA 1LEMA 2A6VA 4OYUA 4ZONA 4K8FA 3LPGA 1JYIA 3KT1A 3HMYA 1W8WA 1WLCA 2Y0OA 4MYEA 4Y5TA 2XVKA 2PA7A 1HJGA 1V6MA 4YSFA 4DUWA 5I8TA 1O8PA 4QXCA 1LRHA 1PO12 2VAUA 1EV12 5FJKA 5B4XA 3MV01 3RZZA 2A6WA 3VHPA 5FQ0B 1S0BA 4EN7B 1O4ZA 2FCUA 5E88A 1LU1A 1ZZBA 4N53B 4K3UA 2HWB2 2JG8A 1R1A1 5L36A 5LBBA 2EXIA 5EJ3A 3N9PA 2WL1A 1DU3D 5GLTA 2EXHA 2R32A 1BLZA 3OCPA 4AFAA 2WBKA 4R9DA 4BA6A 1UMHA 2O0OA 1FX5A 3ACFA 4LO8A 4Y1UA 5FZFA 3WDYA 4BB3A 5JXJA 4AFDA 4FQZA 3C3VA 1W2UA 4IERA 4LLFA 4R4XA 3NJZA 3OEAA 5IATA 1GZCA 4QPIB 3SQOA 1YCIA 1FV2A 1SLIA 3FUQA 4NRMA 1FI2A 5BYNA 5L19A 1DQ0A 3CQOA 5KXDA 3PTYA 5FZ9A 5JLVA 1NXMA 1DLCA 4Q0PA 1FMD2 3MUZ1 5LBEA 3WQ0A 5FOJB 2A3XA 4CCMA 2C24A 3IAPA 3FLPA 3M2MA 3MEPA 4G9SB 5I0TA 4K7JA 1JUHA 4WM8C 3HNBM 1KEXA 1N1SA 2OPWA 3P1IA 5HCAA 2HWD3 5EYXA 1W90A 1L7LA 1W8OA 1S1AA 3IBMA 2XJTA 1EY2A 3Q8BA 2P6CA 4NIGA 5FYSA 1UW8A 5I0RA 4YARA 1PZ8A 3TAYA 2WNEA 1LOEA 2EXKA 4CDUC 2RMU2 4PBPA 1NCRA 1TZOA 5DAVA 4LO4B 1RUI3 1K5MA 1DBNA 5A3NA 4S2FA
chains in the Genus database with same CATH topology
4KWUA 4A44A 3WNMA 1WKYA 4M4RA 3BGAA 1JZ4A 3A22A 2EIEA 2RV9A 1JU4A 3WF1A 4AG4A 1GNYA 2VZPA 2WUHA 2ZXQA 3OGRA 3HJRA 4E8CA 2WZ8A 3OEBA 1JZ3A 2E26A 4QDQA 4YPJA 3NJXA 2W46A 3VD3A 5G05L 1KGYA 3A21A 4HG6B 2EIBA 3VD4A 1SPPB 2XHNA 4MGQA 4PT6A 2VCCA 2VZTA 1XPWA 1UXZA 5JXGA 2W92A 4W8JA 3OG2A 5JXIA 3E1F1 2HYXA 4QDSA 4TTGA 4PF1A 2VCBA 1PX3A 5IJRA 2R7EB 1JZ5A 4W50A 1W8NA 1JZ7A 4E8DA 2CDPA 3JXSA 1UYXA 1SHWB 1W9TA 4BJ0A 2J7MA 3LPFA 3I2JA 3POIA 1SDDB 3I2IA 2L9LA 1UZ0A 3IAQA 1UY1A 2LS6A 2VOTA 2QQIA 3GGLA 4QX2A 4A45A 1W9WA 4GWIA 2VO5A 3C7FA 3WNKA 5IFTA 3W5NA 2WZEA 2VL4A 4OUEA 3SEPA 2VZUA 2VQUA 5CKNA 3SKVA 2YFUA 3HNYM 4XUOA 1W99A 1XNTA 3NNGA 1PMJX 2W47A 2W91A 3T0DA 5EJ1B 1DYOA 2QQNA 1JYXA 4JKLA 4A3ZA 5JXHA 3POBA 1OF4A 2WO3A 3LEGA 2VQTA 2C4XA 2Z4FA 4D8MA 1WCQA 1BHGA 5DMYA 3I2GA 2LW8A 1MPXA 2E32A 2WABA 1JZ2A 5F7UA 2VZSA 4DXTA 4LHSA 3THDA 3NQHA 3U37A 1ULOA 3OB8A 2J1SA 1H6YA 2BBAA 2J1VA 3ABZA 4L0PA 5CYYA 3UNPA 2QQMA 5CKQA 3HNMA 3J7HA 1NUKA 2RJ2A 3WNPA 4ARYA 2YC2A 4MO3M 4CVUA 4QB2A 2DCKA 2E33A 3K4ZA 5C7GA 4P5YA 4QX3A 1F4HA 2WAOA 3K46A 5A1AA 1D7PM 3CZJA 1O59A 4MOAA 1SZBA 3LQCA 5DPNA 2VMDA 1DP0A 1JZ8A 3C7OA 3WQBA 2W1UA 4XUPA 5IYYA 1UYZA 5IHRA 4W4ZA 3NJVA 1JYVA 1NKGA 3MUY1 4A42A 4RYDA 2BERA 1HN1A 2VMEA 1K45A 3ETPA 5HXMA 2CDOA 2Y6HA 2Y64A 3HN3A 1L7QA 2ZEWA 1OH4A 4BDVB 1K42A 3T2PA 1JU3A 4QB6A 2ZEXA 5DQ0A 3A23A 1TG7A 1W9SA 1XNAA 2WN2A 3HOBA 2V4VA 1CZVA 2WQ8A 4CU9A 1UWWA 1NZIA 3CZUA 1TVGA 3HEIA 1GOFA 1OT5A 4CUBA 1XC6A 3WF2A 4TXWA 2QQKA 1F4AA 2V5DA 2X09A 3KQ4B 3WSOA 1OF3A 2VZ3A 5J1XA 1UMIA 4DUVA 4PQQA 1K3IA 4LKSA 4CU6A 2XOMA 3MBWA 2VTFA 4ZZ8A 4JKMA 5EIYB 1EUUA 2YB7A 1R64A 3PUIA 3DYOA 2VZOA 4A4AA 3THCA 4LOSA 1OD3A 2VR4A 2BZDA 2VZVA 3LEIA 2WAAA 3FL7A 5JR2A 3FHAA 5I0DA 4DEVA 1IQDC 2QBXA 1NAEA 4QAWA 2YG0A 1LNSA 3VD9A 5DN2A 3C7GA 4MGSA 2VC9A 2VZRA 2W9XA 2XQXA 4ZZ5A 4UAPA 1GUIA 3POEA 1GU3A 1SPPA 4XUTA 4LOTA 5B4NA 1L7RA 3CKHA 1UY2A 3HPNA 3ECQA 3I3BA 2QQOA 1UY3A 1UYYA 5C70A 3POFA 3T09A 4D0QA 2VM9A 3T2OA 3BN6A 5IFPA 2QQJA 3DYPA 2PQSA 2ZEZA 3NRUA 3IDAA 2W3JA 3VDCA 2WO1A 3LEKA 1UXXX 3I2KA 3OGVA 2JKXA 1K12A 4QDRA 5CKMA 4ARXA 2Y6LA 4OMCA 5HPOA 4CU7A 3K77A 3MO4A 2X05A 3W5MA 4JHZA 3C8XA 2WN3A 4OMDA 3CMGA 2J1EA 2DDUA 2BGPA 2RVAA 3DEMA 4XUQA 3K4DA 3K4AA 3IIIA 4P08A 3VD5A 4BXSV 2WNOA 3AC0A 4DEQA 4XUNA 3FHQA 1JYWA 3CIHA 4XZUG 5LA1A 4ZY9A 2W1QA 2WYSA 2X10A 3DYMA 3UESA 1J84A 4CUCA 2JE8A 3K75B 3OGSA 4BK4A 5CZKA 3UETA 4KMQA 5JMOA 3EYPA 1RYYA 1GMMA 2C9KA 2EIDA 2J1AA 3WF0A 3LE0A 4LQRA 1O8SA 2V72A 3I3EA 2VZQA 3I2FA 1US3A 5JUVA 4LMFA 3F2ZA 4A6OA 4A41A 3VDBA 1GQPA 4P00B 1ULPA 4GWJA 4OZOA 1NT0A 3SEEA 2VMFA 2Y6GA 3WNLA 1P8JA 4DXRA 2JD9A 2WO2A 4ZXEA 5G04L 4QX0A 3POGA 4UI9L 3I97A 2W87A 2W95A 4LORA 4QB1A 3GM8A 3IB3A 2E31A 4JKKA 2W1SA 1T2XA 4LPLA 5LCWL 1GOGA 4XURA 4Z2AA 3CDZB 1JI6A 2VJXA 4FI9A 2Y8KA 2ZEYA 3WEZA 2JDAA 5EJZB 1JYNA 2YFZA 2Y6KA 1SG3A 3ACIA 4QX1A 2B9VA 2VCAA 3T0BA 4P02B 2W94A 3DECA 4M4PA 2J1RA 3MV11 3T2QA 3ACHA 2KD7A 4IUGA 2YC4A 3I2HA 1CX1A 3WNOA 3T08A 1UY0A 1NX9A 2J1UA 1YQ2A 3P6BA 3C7EA 4AAXA 1PMHX 3A7QA 4UOJA 3ZM8A 1I5PA 3SKJE 5CISA 3FN9A 4JX0A 1J83A 3POJA 4OYUA 2XONA 2VMCA 3LPGA 3WF4A 3ACGA 2BGOA 1PX4A 5C71A 4DUWA 1O8PA 4CU8A 4QPWA 2ID4A 5B4XA 3MV01 1UX7A 2B4KA 5FUIA 2HLEA 4DUXA 4RN5A 3VDAA 1UY4A 4XVHA 2EICA 1W0NA 1US2A 3GDBA 4KI5M 1JHJA 2W5FA 3C7HA 3WF3A 2WBKA 5LA2A 4DXSA 1UMHA 2WDBA 3ACFA 2DCJA 3D3AA 5JXJA 4ET7A 3EB7A 2ORZA 2QQLA 3OEAA 4CUAA 1CZSA 3PUHA 1CIYA 1CZTA 3CQOA 3OBAA 1SFPA 1DLCA 3MUZ1 2Y6JA 3IAPA 3VD7A 5LA0A 3HNBM 2J1TA 2J22A 1KEXA 2VZ1A 3P1IA 3GXUA 3T0AA 2W1WA 1JZ6A 2ORXA 4GZ9A 2C26A 2OKXA 1W8OA 1GOHA 1H6XA 1EUTA 3WNNA 3I3DA 4BK5A 4MADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KWU A;  4A44 A;  3WNM A;  1WKY A;  4M4R A;  3BGA A;  1JZ4 A;  3A22 A;  2EIE A;  2RV9 A;  1JU4 A;  3WF1 A;  4AG4 A;  1GNY A;  2VZP A;  2WUH A;  2ZXQ A;  3OGR A;  3HJR A;  4E8C A;  2WZ8 A;  3OEB A;  1JZ3 A;  2E26 A;  4QDQ A;  4YPJ A;  3NJX A;  2W46 A;  3VD3 A;  5G05 L;  1KGY A;  3A21 A;  4HG6 B;  2EIB A;  3VD4 A;  1SPP B;  2XHN A;  4MGQ A;  4PT6 A;  2VCC A;  2VZT A;  1XPW A;  1UXZ A;  5JXG A;  2W92 A;  4W8J A;  3OG2 A;  5JXI A;  3E1F 1;  2HYX A;  4QDS A;  4TTG A;  4PF1 A;  2VCB A;  1PX3 A;  5IJR A;  2R7E B;  1JZ5 A;  4W50 A;  1W8N A;  1JZ7 A;  4E8D A;  2CDP A;  3JXS A;  1UYX A;  1SHW B;  1W9T A;  4BJ0 A;  2J7M A;  3LPF A;  3I2J A;  3POI A;  1SDD B;  3I2I A;  2L9L A;  1UZ0 A;  3IAQ A;  1UY1 A;  2LS6 A;  2VOT A;  2QQI A;  3GGL A;  4QX2 A;  4A45 A;  1W9W A;  4GWI A;  2VO5 A;  3C7F A;  3WNK A;  5IFT A;  3W5N A;  2WZE A;  2VL4 A;  4OUE A;  3SEP A;  2VZU A;  2VQU A;  5CKN A;  3SKV A;  2YFU A;  3HNY M;  4XUO A;  1W99 A;  1XNT A;  3NNG A;  1PMJ X;  2W47 A;  2W91 A;  3T0D A;  5EJ1 B;  1DYO A;  2QQN A;  1JYX A;  4JKL A;  4A3Z A;  5JXH A;  3POB A;  1OF4 A;  2WO3 A;  3LEG A;  2VQT A;  2C4X A;  2Z4F A;  4D8M A;  1WCQ A;  1BHG A;  5DMY A;  3I2G A;  2LW8 A;  1MPX A;  2E32 A;  2WAB A;  1JZ2 A;  5F7U A;  2VZS A;  4DXT A;  4LHS A;  3THD A;  3NQH A;  3U37 A;  1ULO A;  3OB8 A;  2J1S A;  1H6Y A;  2BBA A;  2J1V A;  3ABZ A;  4L0P A;  5CYY A;  3UNP A;  2QQM A;  5CKQ A;  3HNM A;  3J7H A;  1NUK A;  2RJ2 A;  3WNP A;  4ARY A;  2YC2 A;  4MO3 M;  4CVU A;  4QB2 A;  2DCK A;  2E33 A;  3K4Z A;  5C7G A;  4P5Y A;  4QX3 A;  1F4H A;  2WAO A;  3K46 A;  5A1A A;  1D7P M;  3CZJ A;  1O59 A;  4MOA A;  1SZB A;  3LQC A;  5DPN A;  2VMD A;  1DP0 A;  1JZ8 A;  3C7O A;  3WQB A;  2W1U A;  4XUP A;  5IYY A;  1UYZ A;  5IHR A;  4W4Z A;  3NJV A;  1JYV A;  1NKG A;  3MUY 1;  4A42 A;  4RYD A;  2BER A;  1HN1 A;  2VME A;  1K45 A;  3ETP A;  5HXM A;  2CDO A;  2Y6H A;  2Y64 A;  3HN3 A;  1L7Q A;  2ZEW A;  1OH4 A;  4BDV B;  1K42 A;  3T2P A;  1JU3 A;  4QB6 A;  2ZEX A;  5DQ0 A;  3A23 A;  1TG7 A;  1W9S A;  1XNA A;  2WN2 A;  3HOB A;  2V4V A;  1CZV A;  2WQ8 A;  4CU9 A;  1UWW A;  1NZI A;  3CZU A;  1TVG A;  3HEI A;  1GOF A;  1OT5 A;  4CUB A;  1XC6 A;  3WF2 A;  4TXW A;  2QQK A;  1F4A A;  2V5D A;  2X09 A;  3KQ4 B;  3WSO A;  1OF3 A;  2VZ3 A;  5J1X A;  1UMI A;  4DUV A;  4PQQ A;  1K3I A;  4LKS A;  4CU6 A;  2XOM A;  3MBW A;  2VTF A;  4ZZ8 A;  4JKM A;  5EIY B;  1EUU A;  2YB7 A;  1R64 A;  3PUI A;  3DYO A;  2VZO A;  4A4A A;  3THC A;  4LOS A;  1OD3 A;  2VR4 A;  2BZD A;  2VZV A;  3LEI A;  2WAA A;  3FL7 A;  5JR2 A;  3FHA A;  5I0D A;  4DEV A;  1IQD C;  2QBX A;  1NAE A;  4QAW A;  2YG0 A;  1LNS A;  3VD9 A;  5DN2 A;  3C7G A;  4MGS A;  2VC9 A;  2VZR A;  2W9X A;  2XQX A;  4ZZ5 A;  4UAP A;  1GUI A;  3POE A;  1GU3 A;  1SPP A;  4XUT A;  4LOT A;  5B4N A;  1L7R A;  3CKH A;  1UY2 A;  3HPN A;  3ECQ A;  3I3B A;  2QQO A;  1UY3 A;  1UYY A;  5C70 A;  3POF A;  3T09 A;  4D0Q A;  2VM9 A;  3T2O A;  3BN6 A;  5IFP A;  2QQJ A;  3DYP A;  2PQS A;  2ZEZ A;  3NRU A;  3IDA A;  2W3J A;  3VDC A;  2WO1 A;  3LEK A;  1UXX X;  3I2K A;  3OGV A;  2JKX A;  1K12 A;  4QDR A;  5CKM A;  4ARX A;  2Y6L A;  4OMC A;  5HPO A;  4CU7 A;  3K77 A;  3MO4 A;  2X05 A;  3W5M A;  4JHZ A;  3C8X A;  2WN3 A;  4OMD A;  3CMG A;  2J1E A;  2DDU A;  2BGP A;  2RVA A;  3DEM A;  4XUQ A;  3K4D A;  3K4A A;  3III A;  4P08 A;  3VD5 A;  4BXS V;  2WNO A;  3AC0 A;  4DEQ A;  4XUN A;  3FHQ A;  1JYW A;  3CIH A;  4XZU G;  5LA1 A;  4ZY9 A;  2W1Q A;  2WYS A;  2X10 A;  3DYM A;  3UES A;  1J84 A;  4CUC A;  2JE8 A;  3K75 B;  3OGS A;  4BK4 A;  5CZK A;  3UET A;  4KMQ A;  5JMO A;  3EYP A;  1RYY A;  1GMM A;  2C9K A;  2EID A;  2J1A A;  3WF0 A;  3LE0 A;  4LQR A;  1O8S A;  2V72 A;  3I3E A;  2VZQ A;  3I2F A;  1US3 A;  5JUV A;  4LMF A;  3F2Z A;  4A6O A;  4A41 A;  3VDB A;  1GQP A;  4P00 B;  1ULP A;  4GWJ A;  4OZO A;  1NT0 A;  3SEE A;  2VMF A;  2Y6G A;  3WNL A;  1P8J A;  4DXR A;  2JD9 A;  2WO2 A;  4ZXE A;  5G04 L;  4QX0 A;  3POG A;  4UI9 L;  3I97 A;  2W87 A;  2W95 A;  4LOR A;  4QB1 A;  3GM8 A;  3IB3 A;  2E31 A;  4JKK A;  2W1S A;  1T2X A;  4LPL A;  5LCW L;  1GOG A;  4XUR A;  4Z2A A;  3CDZ B;  1JI6 A;  2VJX A;  4FI9 A;  2Y8K A;  2ZEY A;  3WEZ A;  2JDA A;  5EJZ B;  1JYN A;  2YFZ A;  2Y6K A;  1SG3 A;  3ACI A;  4QX1 A;  2B9V A;  2VCA A;  3T0B A;  4P02 B;  2W94 A;  3DEC A;  4M4P A;  2J1R A;  3MV1 1;  3T2Q A;  3ACH A;  2KD7 A;  4IUG A;  2YC4 A;  3I2H A;  1CX1 A;  3WNO A;  3T08 A;  1UY0 A;  1NX9 A;  2J1U A;  1YQ2 A;  3P6B A;  3C7E A;  4AAX A;  1PMH X;  3A7Q A;  4UOJ A;  3ZM8 A;  1I5P A;  3SKJ E;  5CIS A;  3FN9 A;  4JX0 A;  1J83 A;  3POJ A;  4OYU A;  2XON A;  2VMC A;  3LPG A;  3WF4 A;  3ACG A;  2BGO A;  1PX4 A;  5C71 A;  4DUW A;  1O8P A;  4CU8 A;  4QPW A;  2ID4 A;  5B4X A;  3MV0 1;  1UX7 A;  2B4K A;  5FUI A;  2HLE A;  4DUX A;  4RN5 A;  3VDA A;  1UY4 A;  4XVH A;  2EIC A;  1W0N A;  1US2 A;  3GDB A;  4KI5 M;  1JHJ A;  2W5F A;  3C7H A;  3WF3 A;  2WBK A;  5LA2 A;  4DXS A;  1UMH A;  2WDB A;  3ACF A;  2DCJ A;  3D3A A;  5JXJ A;  4ET7 A;  3EB7 A;  2ORZ A;  2QQL A;  3OEA A;  4CUA A;  1CZS A;  3PUH A;  1CIY A;  1CZT A;  3CQO A;  3OBA A;  1SFP A;  1DLC A;  3MUZ 1;  2Y6J A;  3IAP A;  3VD7 A;  5LA0 A;  3HNB M;  2J1T A;  2J22 A;  1KEX A;  2VZ1 A;  3P1I A;  3GXU A;  3T0A A;  2W1W A;  1JZ6 A;  2ORX A;  4GZ9 A;  2C26 A;  2OKX A;  1W8O A;  1GOH A;  1H6X A;  1EUT A;  3WNN A;  3I3D A;  4BK5 A;  4MAD A; 
#chains in the Genus database with same CATH topology
 2UWA A;  3PNA A;  1GYK A;  3BGA A;  4UXA A;  4GB3 1;  4CCL A;  1D4M 2;  3WF1 A;  1QMJ A;  4Q27 A;  1G6N A;  1UU4 A;  2O8Q A;  2VQ0 A;  5FV3 A;  4GMP 0;  4BU2 A;  3WZ1 A;  3ZVX A;  4ITC A;  3VKF C;  4E8C A;  1V70 A;  1OSG A;  5A6Y A;  3ZFE A;  5FZ7 A;  5KC5 A;  3WIN E;  4YPJ A;  3H1M A;  3NNJ A;  4AR2 A;  3ZSK A;  1MR5 A;  4IV3 C;  2RMU 3;  1N1T A;  3L2H A;  5G05 L;  1KGY A;  4LLO A;  4M00 A;  3N7M A;  4JDN A;  3QAC A;  2EIB A;  2F6B A;  2IXK A;  4NJ4 A;  3VD4 A;  2D6P A;  4FSJ A;  4Z92 B;  1S0C A;  1SMV A;  3FZ3 A;  5D8A A;  1PK6 C;  2XLF A;  5JXG A;  1RUC 3;  3ILR A;  4UF0 A;  1QJU 3;  3U11 A;  4MET A;  4XYX A;  4O9G A;  2BOJ A;  4CDU B;  2RMU 1;  3POS A;  1ULE A;  5ISL A;  1QGL A;  2B46 X;  3GHN A;  2VCB A;  1PX3 A;  4FFG A;  3UKN A;  4UW6 A;  4Y1X A;  4V2W A;  1AR9 2;  1LHV A;  1MS1 A;  1RUF 3;  1RUD 3;  1YI9 A;  1ULF A;  3BYW A;  1RHI 1;  4YGB A;  4XJ8 A;  4NUB A;  5FP9 A;  1IOA A;  2VMI A;  2PHD A;  5FP8 A;  1POV 3;  2WII B;  3DN7 A;  4Y33 A;  2D40 A;  2JXA A;  1J58 A;  3I2I A;  2L9L A;  4URT A;  3ZFF A;  1UY1 A;  3VN4 A;  3WY6 A;  2XL9 A;  2OVU A;  2VOT A;  3B01 A;  3GGL A;  1W9W A;  2A71 A;  4HON A;  2VBP A;  2WA3 A;  3FC0 A;  4OUM A;  4CCJ A;  1CWP A;  1XSR A;  3B69 A;  4QX7 A;  4S2G A;  2DFC A;  1H8T B;  3WD5 A;  2VL4 A;  4OUE A;  4Y3O A;  5A80 A;  2DV9 A;  3SEP A;  3WW3 A;  1RUD 2;  1S0F A;  2VQU A;  4HBN A;  4LBJ A;  5EYY A;  3SKV A;  5FZO A;  3SHR A;  4CZS A;  1PVC 3;  1XNT A;  1XND A;  4QM8 A;  3NNG A;  3WDT A;  1VBE 3;  2W91 A;  2ARX A;  4AED C;  1ZA4 A;  1QXJ A;  3JBG 1;  2Y38 A;  4GD4 A;  3AFG A;  3T0D A;  4XJZ A;  1QF3 A;  4U2A A;  2XHK A;  5F3C A;  1Q56 A;  2R04 1;  1CPN A;  5JXH A;  5DUU A;  2VVE A;  4BQ2 A;  3RYP A;  1AXK A;  2VQT A;  2Z4F A;  5DUW A;  5F3E A;  2RM2 1;  1LHN A;  2YV8 A;  3MIG A;  1WCQ A;  3MFC A;  4MXW B;  2RR1 1;  1BHG A;  3S5A A;  1ZM1 A;  3KS7 A;  5I93 A;  4IE0 A;  3I2G A;  1A34 A;  4XC9 A;  3ZYR A;  1MPX A;  2JEM A;  1VMF A;  3RZJ A;  3WDU A;  1AZD A;  3R0R A;  2JEC A;  1I5Z A;  1G8W A;  3E6D A;  5JMC A;  2BV4 A;  3H7Y A;  5ACA 1;  2RS1 3;  5BXX A;  1RJ7 A;  2Y34 A;  2XQR A;  4IV1 C;  4LKE A;  2WS9 3;  1CAW A;  1PGW 2;  5ABJ C;  2J1V A;  4BQ3 A;  3FFZ A;  4P9L A;  4JQR A;  4KWK A;  3LD8 A;  1MZ6 A;  5J48 A;  3TYJ A;  3H8U A;  2ZX4 A;  2VUL A;  5LBF A;  4BQY A;  2YC2 A;  4CVU A;  1DCS A;  4K9S A;  2VUJ A;  2DCK A;  3Q8E A;  4AEM A;  4EN9 B;  2O14 A;  3OSD A;  4J25 A;  4XAC A;  4ZKT B;  1TME 1;  3N9N A;  1D7P M;  4Y24 A;  1O59 A;  1RIT A;  2QVS B;  4MOA A;  5A33 B;  1F35 A;  3LQC A;  1DZT A;  3EBR A;  4N43 A;  3GCW A;  4NRQ A;  2CV6 A;  3ZYF A;  4ISQ A;  3WQB A;  2W1U A;  5C4W B;  5A7N A;  3HIF A;  5A7S A;  1HJF A;  2RDR A;  3B94 A;  3SH5 A;  4C8D A;  4FXG B;  4CDX B;  4URA A;  1UYZ A;  5C5U A;  5IYY A;  4FTB A;  5IHR A;  3QBQ A;  1F5J A;  1QJX 1;  3AXD A;  4F3J A;  4IGO A;  4A42 A;  4I30 A;  4AI2 A;  4RYD A;  2VME A;  1K45 A;  1RMU 1;  3BKZ A;  5ANN A;  5HXM A;  5JOX A;  2D6K A;  4NPL A;  5K9Y A;  1AR7 1;  2CDO A;  1VIW B;  2QDN A;  1CJD A;  2Y64 A;  3E97 A;  2DVA A;  4YM0 A;  1VRH 1;  5SV5 A;  1H2M A;  4QPG B;  1LED A;  1W04 A;  1VBB 3;  2K46 A;  1WW5 A;  2ZEW A;  4RQP C;  3PU3 A;  3V56 A;  2E63 A;  2W68 A;  5FPV A;  3O1U A;  3ZN6 A;  4XJW A;  2BWC A;  4LIV A;  4LKD A;  1WCK A;  1LR5 A;  2ERF A;  1WBL A;  1H4G A;  1YHF A;  3VDD B;  1OXC A;  5FMD A;  2ARC A;  2H6C A;  4Y22 A;  3ZSL A;  1QJE A;  2XJU A;  1LHU A;  3OPZ A;  4H2A A;  4EV0 A;  2YGL A;  4AVB A;  1HLC A;  3LA2 A;  4HPK A;  1QQP 3;  4JAA A;  2Z2S B;  5FMB A;  2V4V A;  4CU9 A;  4LHN A;  1UWW A;  3AP6 A;  1BCX A;  1TVG A;  4WVM B;  5C4W C;  1CD3 G;  1HB4 A;  1OT5 A;  4LKF A;  4CDX C;  4GJY A;  1CON A;  4IES A;  4B3N A;  5FCC A;  4XDQ A;  1EP0 A;  1KXG A;  1ZZ9 A;  4H3W A;  2IZW A;  3KQ4 B;  2DU0 A;  3D4K A;  4GWN A;  4MGY E;  4XF1 A;  1OF3 A;  2VZ3 A;  4OCT A;  1D4M 1;  5J1X A;  1QEX A;  4PLO A;  4LKS A;  4CU6 A;  5E89 A;  4Q2F A;  1SLB A;  1DQ1 A;  2PLV 3;  1JUI A;  1NCR C;  4Y5Z 0;  3WDV A;  2VTF A;  3KV9 A;  3RZK A;  4ZZ8 A;  2MEV 3;  4P9I A;  3LCP A;  1R64 A;  2DFB A;  2C1F A;  1GR3 A;  2VZO A;  3THC A;  2VR4 A;  4Y26 A;  2BZD A;  2DVB A;  2PHR A;  5JR2 A;  4FVV A;  1FXZ A;  4EN0 A;  1R08 2;  3PIJ A;  1GSL A;  2RS1 2;  4KBZ A;  4QAW A;  5L9V A;  4E27 A;  5CFC A;  4YW5 A;  1LNS A;  1B09 A;  3VD9 A;  4CXW A;  3ZFE C;  4AXO A;  2GDF A;  3ALQ A;  1MQT C;  2G9G A;  3VZN A;  2ADD A;  4MGS A;  2VZR A;  4DRR A;  2PHX A;  4EN6 B;  1FAY A;  4D69 A;  1OLM A;  2CHH A;  4ZZ5 A;  1GUI A;  4HAN A;  5IT6 A;  4CEW B;  2XBO 3;  3J4U H;  3OY8 B;  1GU3 A;  1O5U A;  4L97 A;  2YUE A;  5B4N A;  2OZJ A;  2YBS A;  1X82 A;  5FPU A;  4YFW A;  2EAL A;  3W59 A;  3I3B A;  4NVP A;  1E57 A;  2B5H A;  1AJK A;  4YW4 A;  1QOO A;  3VDD A;  2JX9 A;  3X29 B;  3VBR B;  2ZGK A;  1QJY 3;  1RED A;  1DYK A;  3I54 A;  4GB3 3;  4MHU A;  1VRH 2;  2JG9 C;  5FBJ A;  5JOY A;  4B7K A;  1NA1 C;  1A8M A;  2WFF 2;  2ZEZ A;  3AK0 A;  4Q1P A;  1D2S A;  1HQW A;  4XCB A;  3W21 A;  4EZ4 A;  1VAK A;  1YFW A;  4UFL A;  5IVJ A;  1VP6 A;  1JH5 A;  2NPI A;  1CAX B;  5FTT C;  1EAH 1;  1UN1 A;  1TMF 2;  1YI7 A;  1ENX A;  2WO1 A;  3VKM A;  5CAZ A;  3HD8 B;  3MIE A;  1H8V A;  1SLL A;  1UXX X;  3I2K A;  4Q4V 1;  3ZFF C;  5GLW A;  1HRI 1;  5J3U A;  2Y6L A;  4LK6 A;  2RDQ A;  4OMC A;  3ZFE B;  4CU7 A;  3K77 A;  1QNY A;  3MO4 A;  2X05 A;  1DGW X;  1WMX A;  3IDE A;  4JHZ A;  4K21 A;  4DPN A;  1VBD 3;  3AM2 A;  5IWF A;  1MZ5 A;  1KD7 A;  2PLV 1;  3U1X A;  3L9J T;  4W6Y A;  1OVP A;  2WNU B;  3CMG A;  1KS4 A;  2J1E A;  3JB8 A;  2RVA A;  1V6I A;  4XUQ A;  4BXS V;  1AL0 G;  4WVW A;  3H8X A;  1SLC A;  4QKN A;  4DEQ A;  2GC2 A;  3ZYP A;  2IXC A;  3ST7 A;  5K8S A;  3J7N A;  3JB4 C;  3FMG A;  1G9F A;  3CJI A;  1HXS 1;  3FUO A;  4M3C B;  2YGM A;  2W1Q A;  5EV7 A;  3DYM A;  3PVO A;  5FBZ A;  1Q8O A;  4XFF A;  1J84 A;  2ZZJ A;  4GA9 A;  1SEF A;  2JE8 A;  3K75 B;  4TSV A;  1FOD 2;  4BK4 A;  3LOB A;  2OW4 A;  3IZO A;  2FDK A;  1NY7 1;  2ENR A;  2GH8 A;  1NG0 A;  2VNO A;  1RYY A;  1GMM A;  4OI0 A;  2OUJ A;  2BFU L;  2UY9 A;  1UF2 C;  4RS5 B;  1REE A;  2V72 A;  1CJP A;  1LOA A;  1ND2 A;  1RHI 3;  3D82 A;  4IEY A;  1AX0 A;  3J8F 1;  5JUV A;  5FWE A;  4GWM A;  2CWM A;  3GNE A;  3OGJ A;  5FYY A;  4XIK A;  3WG2 A;  1W6M A;  5K0U B;  5CAD A;  3HQX A;  4A6O A;  1I1E A;  4A41 A;  3DPR A;  3RS6 A;  3LIG A;  4I0B A;  5FMO L;  1AR9 3;  5J96 B;  5KXB A;  5FKB A;  4YG0 A;  4IV1 A;  1AHS A;  4OZO A;  1ENR A;  4XW3 A;  5A3P A;  2VMF A;  5A6Z A;  1GAN A;  3J8F 3;  1ZRC A;  3WX5 A;  5FXX A;  2JD9 A;  2WO2 A;  3WXP A;  4AQ2 A;  4UFJ A;  3VBS B;  4FPC A;  3WP6 A;  3POG A;  3A0N A;  4XHX A;  1AX1 A;  2VBD A;  3JU9 A;  2KA3 A;  1LGC A;  4NE9 A;  1W8U A;  3I7D A;  3PUS A;  1C5H A;  1HB2 A;  1V0A A;  4X6R B;  5FYB A;  3S57 A;  1T2X A;  3AXE A;  1RMU 2;  4LPL A;  2WT1 A;  5F2S A;  1OOP A;  1GQG A;  4P9G A;  2D43 A;  2ZGO A;  3B5L B;  1X8E A;  5BNN C;  1QJU 2;  1H30 A;  2RS3 1;  3RWK X;  1W39 A;  4RD7 A;  5L9R A;  4AEJ A;  5BNO C;  1BYH A;  1GP5 A;  4QQO A;  3CDZ B;  4RS5 C;  4CYD A;  4AHW A;  2BDR A;  2VJX A;  4XXA A;  5F3I A;  2ET7 A;  2Y8K A;  3INA A;  1PNF A;  2ZEY A;  3WEZ A;  1ULD A;  3J8F 2;  4YVS A;  4XOG A;  2LRO A;  1QXR A;  1ULC A;  4PCR A;  5EJZ B;  4GUL A;  2E53 A;  4PI2 A;  3G7D A;  1Q8V A;  1FMD 3;  2R0H A;  3CNA A;  2B9V A;  2FMY A;  2WT2 A;  3PMS A;  3OTF A;  2Z79 A;  4P02 B;  3WR0 A;  3W9A A;  4S2H A;  4HKL A;  2JDK A;  3KV4 A;  5GZC A;  1S0G A;  2QFE A;  3H9A A;  2AZ5 A;  4XQ4 A;  2B8M A;  1W2O A;  3T4V A;  4P9Y A;  2OT7 A;  5CNA A;  2E7T A;  2W08 A;  3VBU B;  3JZV A;  3AL6 A;  4D3W A;  5IK4 A;  1EV1 3;  1NYW A;  4AVA A;  2X5I C;  1YQ2 A;  3PDQ A;  5A32 B;  1KFU L;  2R1B A;  2PN5 A;  5FYI A;  4LBQ D;  1OH3 A;  2K2S A;  3FWE A;  4UOJ A;  5A33 A;  3B9I A;  2ZKL A;  1Y43 B;  3CJX A;  3PUR A;  3CEW A;  5A6X A;  5C9A A;  5HI0 A;  1JHN A;  2HH9 A;  1VB2 A;  2F17 A;  3ZR6 A;  4EWD A;  4Y4R A;  4COW A;  4AYU A;  1HQL A;  2LAL A;  3CU7 A;  5JVV A;  4LIT A;  4LXL A;  1J83 A;  3POJ A;  4DB5 A;  4M3C E;  2FCT A;  4FOY A;  5K7P A;  3N7L A;  1X9T A;  4DO0 A;  1HV0 A;  4QGL A;  4GB3 2;  1PX4 A;  1VJ2 A;  1YQC A;  2GP5 A;  3KGL A;  3MIH A;  4QGN A;  3ZO0 B;  3WHT A;  4QPW A;  1AR6 2;  1UX7 A;  4LNV A;  1YQ6 A;  2B4K A;  4OUS A;  3LA3 A;  2ZX0 A;  1D2Q A;  3ES4 A;  3G6J B;  2HLE A;  2RJL A;  1QHD A;  5FYM A;  2HWF 3;  4KG8 A;  2D5F A;  3RMY A;  1OLQ A;  3AZX A;  3BOD A;  3VBU C;  4CXY A;  1JHJ A;  2W5F A;  3C7H A;  5A7Q A;  3ZYB A;  4DZG A;  3H3L A;  3D3A A;  2DCJ A;  3N4M A;  5FPX A;  2VXJ A;  4ET7 A;  2Q1Z B;  2I07 B;  2ORZ A;  3ITQ A;  3KV6 A;  3RI8 A;  1IPJ A;  5CIR A;  2DBN A;  3PUA A;  3R4D B;  3UYJ A;  3AP7 A;  4I2O A;  1PK6 B;  4XIL A;  2AYH A;  4YG6 A;  3CLP A;  1AF9 A;  3I59 B;  5I0S A;  1FOD 3;  2YY1 A;  4FOV A;  2ETE A;  5FXW A;  5C8C C;  1HRV 3;  3AMP A;  3PUQ A;  4NR1 A;  2Q8D A;  4HN1 A;  3AL5 A;  3O1M A;  1JZ6 A;  2ORX A;  3ZXD A;  3U4X A;  1YFU A;  4CCE A;  4RR3 A;  3HR9 A;  4ZU4 A;  1AR9 1;  4N9H A;  2TUN A;  2MNG A;  5M0T A;  3QD6 A;  5FMO S;  2WNV B;  2RR1 3;  4YVW C;  1XSQ A;  4V1P A;  5E8A A;  1CES A;  3GZA A;  2UWB A;  2V73 A;  2QKD A;  2R49 A;  1WLD A;  1NA1 A;  4OI4 A;  1I6X A;  2W39 A;  1HW5 A;  3MPP G;  4A44 A;  3M1H A;  3H8R A;  1Y3T A;  4HL0 A;  4M4R A;  1H1A A;  4WVV A;  5DAQ A;  3A22 A;  1PIV 1;  2EIE A;  2ZHK A;  1BEV 2;  1HX6 A;  5DUV A;  1QY4 A;  4YZ5 A;  1RUJ 2;  4AE2 A;  3VBF C;  2OPK A;  1H8T C;  3AKP A;  5HCH A;  2P37 A;  1VR3 A;  4ZU7 A;  2ZXQ A;  5FZK A;  1KFX L;  3OGR A;  1MS5 A;  3HJR A;  3SNM A;  4PLM A;  2WZ8 A;  3NV4 A;  4Y20 B;  5FZ0 A;  5GM0 A;  5L7O B;  2GAL A;  4BM8 A;  1JZ3 A;  2VOK A;  1ASJ 3;  3B7M A;  4XTM A;  1BZW A;  1PO2 2;  1YYN A;  2FZ1 A;  4Q1R A;  4AED B;  4XAB A;  1A8D A;  4UW5 A;  4B8E A;  3MW4 A;  4M01 A;  2RR1 2;  3IT8 A;  3O0V A;  3OY8 A;  1UIK A;  4C0H A;  1CAV A;  2FBE A;  5IVF A;  5LBC A;  3MF6 A;  1RUG 2;  3O0W A;  1DQ6 A;  1XPW A;  2VZT A;  1UXZ A;  5T5P A;  4S2D A;  3RRD A;  1GFF 2;  4BLJ A;  5JXI A;  4KWJ A;  4MGK E;  1XRU A;  1CAU A;  3MIF A;  4IXL A;  4QDS A;  2P17 A;  1LTE A;  5F5A A;  4PF1 A;  3GF6 A;  1VBD 1;  3VGI A;  2ZGR A;  2G1M A;  1VMJ A;  1ZA7 A;  4XF9 A;  1RUD 1;  1B35 A;  4E9K A;  2VCM A;  5BUV A;  1AYM 3;  1VBA 3;  4IEO A;  1SHW B;  2JDU A;  3TN9 1;  2AH2 A;  2P3I A;  3I2J A;  1O91 A;  4EQV A;  5KXC A;  1SDD B;  4WM7 A;  4CEY C;  1C4R A;  3AP4 A;  5ABJ B;  1XOY A;  1QOT A;  5KHI A;  5L7O C;  1RUF 1;  2VMG A;  4LT5 A;  5DDJ 3;  4ORF A;  1GZ9 A;  4GWI A;  4OFG A;  2Y33 A;  4A7K A;  3IN9 A;  2XWB B;  1QJY 1;  1YIF A;  4K20 A;  3I2D A;  3KV5 A;  4HFS A;  1Y9Q A;  1WLT A;  3D5O A;  4X6Q B;  3VKL A;  1DGW A;  4OI1 A;  2ZGU A;  1JYC A;  2YU2 A;  3I2O A;  2NZ9 A;  5DDJ 1;  1MEC 1;  2A75 A;  1OKO A;  5GZF A;  4FT8 A;  3M8L A;  2Z5W A;  1YIP A;  3LDR A;  5EJ1 B;  1OA4 A;  5KXE A;  2QQN A;  4XF4 A;  4TZD A;  1W0P A;  2VUA A;  3LIH A;  2HJI A;  4JKL A;  5F32 A;  2VH9 A;  5FY0 A;  3VBH B;  5LEK A;  2YDE A;  2VNR A;  3TEW A;  1VBB 2;  4XAA A;  4RGK A;  1FPN 2;  2C4X A;  2FCV A;  1ZBE 2;  3MHZ A;  3SXW A;  3EMR A;  2DU1 A;  2HWB 3;  3PME A;  4LBM A;  3V0B A;  3PLQ A;  4Q26 A;  1J1L A;  1NQJ A;  1SCS A;  4RS5 A;  5FZI A;  2P5B A;  1MZF A;  3LAG A;  5DMY A;  2D93 A;  3NAP A;  4BMB A;  5DXD A;  4YVS C;  4Q4X 1;  2E32 A;  3GZE A;  1JZ2 A;  2P3K A;  2JIG A;  5F7U A;  4UFH A;  2MEV 1;  2VZS A;  4YYO A;  5C3R A;  1G9B A;  2DBI A;  4BIF A;  5J7M A;  4LR4 A;  2CWS A;  1RJ8 A;  2QNK A;  1UPI A;  3DPR B;  2HWF 1;  2QZ2 A;  3KVB A;  5TSW A;  1GP4 A;  1PM4 A;  1XBF A;  3NQH A;  3O5S A;  4FBF A;  1BEV 1;  4QPI C;  1ULO A;  2Q1F A;  3OB8 A;  4KG0 A;  4QHZ A;  2J1S A;  3S30 A;  1D4M 3;  2D3R A;  4O61 A;  2YYO A;  4L0P A;  4NWV A;  3ZFG A;  3UNP A;  4WZC A;  4YGE A;  3D0S A;  5A70 A;  3BI3 A;  3J7H A;  1W6N A;  1NUK A;  2I45 A;  1H9P A;  1B35 B;  1ND3 C;  3K3N A;  3WW2 A;  1BQP A;  2VBB A;  4QB2 A;  2PYT A;  2R1D A;  1EAH 3;  1HRV 2;  3K4Z A;  2E33 A;  3VBH C;  4DNY A;  5C7G A;  1FAT A;  3POY A;  1X36 A;  1LOC A;  4QX3 A;  2JG8 B;  3U78 A;  3VBF A;  2PLV 2;  4IDZ A;  5A1A A;  1NQD A;  2VQA A;  5C9A C;  5LA9 A;  1AR8 2;  1SZB A;  2WWU A;  4NAO A;  4NWW A;  4XBL A;  4XMI A;  2ZML A;  4AVS A;  2IXH A;  5LZ6 A;  3QOP A;  4FPL A;  4N90 A;  4Q4V 2;  3WCR A;  4QXK A;  2PEL A;  1BEV 3;  2OS2 A;  4WM8 A;  1HV1 A;  2FDG A;  2AEY A;  1M4W A;  3NJV A;  1ACC A;  1PVC 1;  1NKG A;  3MUY 1;  5F2W A;  4GH4 A;  4JTN A;  1A6C A;  5AVA A;  1HN1 A;  4Q8K A;  3VHN A;  4ATF A;  3LEM A;  3NNM A;  1JOD A;  1NE6 A;  1OFS A;  2W2I A;  5F6K A;  1RHI 2;  1UOJ A;  1RXF A;  2B9U A;  4PIZ A;  5FXZ A;  4CP9 B;  4LBO A;  1UYP A;  2GN7 A;  4XQW A;  1K5M C;  1W2A X;  4BDV B;  4A6S A;  2JDH A;  2ZKN A;  3VZJ A;  1QDC A;  1J3Q A;  3NMB A;  1XNC A;  1MS9 A;  2XKO A;  2IVJ A;  2Q4S A;  2XGX A;  2ZEX A;  3RVH A;  4MGT A;  3O1O A;  5FP4 A;  1PZ9 A;  4RHV 2;  1QNW A;  2D6O X;  5EWS A;  1OI6 A;  1IS3 A;  1RUG 3;  5HCF A;  1CQ9 A;  3FLT A;  1XNA A;  4IW3 A;  4BCU A;  4NMI A;  2IFW A;  1E5H A;  3I3Q A;  1CZV A;  1O4Y A;  2WQ8 A;  1MEC 3;  4FFF A;  1NZI A;  1WA6 X;  2E9Q A;  2PTM A;  5D8A B;  5JSO A;  5LB6 A;  3ATG A;  1UKG A;  3N9L A;  5CVR A;  4BIO A;  1H0B A;  4CEY B;  4CUB A;  1XC6 A;  3WF2 A;  4OHX A;  2D6N A;  2QQK A;  1F4A A;  3EXU A;  4QPG A;  4JTO A;  1YC6 1;  2YRO A;  2RJK A;  1QDO A;  3WSO A;  5FO7 B;  1UCX A;  3NL1 A;  4RR3 C;  3WLU A;  4FPF A;  1EYB A;  1RUH 2;  2R30 A;  2XBO 1;  3BAL A;  1Q8P A;  1NCQ C;  2HEW F;  1NXD 1;  1W9F A;  3ZKU A;  1W6Q A;  4BYY A;  5C3P A;  4YVW A;  3O14 A;  4PLN A;  3VZO A;  3ZFF B;  2H0V A;  1BVV A;  4CEW C;  4JKM A;  1WLW A;  1F2N A;  2WYF A;  5EP9 A;  2WA4 A;  5K4L A;  3S0M A;  4F8A A;  2VEC A;  3DYO A;  1DQ5 A;  4QGM A;  3O1S A;  4A4A A;  2QQW A;  4YZ1 A;  4QD2 A;  4Y1Z A;  5LEJ A;  1UZW A;  2VZV A;  3AVS A;  2GN3 A;  2JB4 A;  3I49 A;  2CY6 A;  2IVI B;  2WNU C;  4JV4 A;  2JE9 A;  2WAA A;  1H8T A;  3H3Z A;  1WMD A;  2BRT A;  1V00 A;  3FHA A;  3M70 A;  4IQP A;  4KNC A;  3MGU A;  3NST A;  1AYM 1;  2QBX A;  3I4I A;  2VTX J;  2P3J A;  4IE7 A;  1E5R A;  4GMP 1;  1QH6 A;  1VBE 2;  2LM3 A;  2D44 A;  1X8M A;  1S55 A;  3LZZ A;  3C7G A;  3VB9 A;  2VC9 A;  4GH4 B;  4B1M A;  3AMH A;  1WWY A;  2W9X A;  5A7W A;  2XQX A;  1QU0 A;  1FMD 1;  2VGD A;  4YFZ A;  4D7T A;  5CG8 A;  1TQ5 A;  2YZ4 A;  1EAH 2;  1GZT A;  3OUJ A;  3PU8 A;  5LK5 A;  1QJX 3;  5DAW A;  3N3H A;  4CP9 A;  3OPT A;  4DS0 A;  4HMZ A;  1U5X A;  4FP2 A;  4H14 A;  4RL7 A;  4KGG A;  5C70 A;  1ENQ A;  2NLR A;  3PL0 A;  5GLV A;  1BXH A;  4XFC A;  5DAX A;  2FDJ A;  2VM9 A;  3ZXF A;  2A5Z A;  4YWA A;  2KXL A;  3BIE A;  2PQS A;  5FZD A;  4UW4 A;  1DHK B;  1HRI 3;  1R09 2;  3GJB A;  2VNG A;  4IEQ A;  4OUL A;  2FQP A;  1SCR A;  2TEP A;  1D4V B;  1LJ7 A;  4AW7 A;  2C5D A;  5DG2 A;  2XML A;  4P5H A;  3K48 A;  5EHD A;  3UKV A;  1W3X A;  1W8Z A;  1K12 A;  4K6B A;  1V6O A;  2X53 S;  4L8Q A;  4R8H A;  3SIT A;  3VL9 A;  4ASL A;  3W5M A;  2DYC A;  4YZ4 A;  2Q8E A;  4C1W A;  2C6S A;  3J7L A;  4AQT A;  3ZSJ A;  5ACA 3;  1F9K A;  2ZGN A;  1TME 2;  3C8X A;  1LU2 A;  4OMD A;  4L11 A;  2NMN A;  3MFA A;  1U0A A;  5F5I A;  3ZXJ A;  2V5Y A;  4EYU A;  3DEM A;  1LHW A;  1AVB A;  1GZW B;  1AX2 A;  3K4A A;  1UPS A;  1U12 A;  1T6G C;  1W6P B;  2ZTN A;  1R09 3;  1PMI A;  1DGR N;  3NO8 A;  2A6Y A;  2B45 X;  2TNF A;  1GLH A;  3GHM A;  2TBV A;  2DUQ A;  3ME2 A;  1CAU B;  1Q8S A;  4XUN A;  4IEW A;  3OF1 A;  4HSJ A;  5K0U C;  1JYW A;  3HBK A;  5GJ6 A;  4P14 A;  4RFR B;  2WYS A;  5FIX A;  4I0A A;  4FFH A;  3Q9O A;  2R07 1;  1DZQ A;  4Y1V A;  2R04 3;  2KM2 A;  3WV6 A;  4AGR A;  4CE8 A;  4N43 C;  3ORJ A;  4O9E A;  5DAP A;  3SH4 A;  2EID A;  5A6Q A;  3AP5 A;  1U5Y A;  1APN A;  3MIB A;  3WF0 A;  1TE1 B;  4IE4 A;  2WWJ A;  4NHX A;  3S5Q A;  1OA3 A;  3O12 A;  4BQ5 A;  3RFR A;  1US3 A;  2G4I A;  3DGT A;  2GU9 A;  3BU0 A;  1WCU A;  3F2Z A;  2PFW A;  4KL1 A;  2Q8O A;  1AUY A;  4Y22 B;  3RPQ A;  2HWC 3;  4QPI A;  2RG4 A;  5KC6 A;  5D2A A;  1ULP A;  2LRP A;  5APA A;  2JIC A;  1N47 A;  1RUE 2;  1YRZ A;  4HK9 A;  2Y6G A;  4I3P A;  5L9B A;  3ZYH A;  2WFF 1;  2XB6 C;  3N7J A;  3WNL A;  1AYN 1;  4DXR A;  1VBA 2;  5D1I A;  1NCQ B;  5FZC A;  1LOF C;  2XPJ A;  3K3O A;  3HVD A;  4JZR A;  3MF9 A;  1FYU A;  2ZX3 A;  1RUH 3;  2Y0I A;  3S7I A;  3H1Y A;  1HB3 A;  2WSU A;  3GM8 A;  2E31 A;  4JKK A;  1PGL 1;  2GC1 A;  3T1L A;  5LCW L;  1Q5O A;  1GBG A;  1QJX 2;  2BEO A;  3RZL A;  3O1V A;  1C5I A;  2XJR A;  4BH9 A;  5F9T A;  5C4W A;  1O3Q A;  1W6M B;  1NCR B;  4CDX A;  5JWP A;  4AI8 A;  3OYW A;  4PHZ A;  2BFU S;  4PDW B;  1VBE 1;  4AWD A;  4QX8 A;  4FOQ A;  4GH4 C;  1AYM 2;  1W3V A;  2ILM A;  1IPS A;  2WFF 3;  2Y6K A;  4XF0 A;  4Y5S A;  2D98 A;  3VHR A;  3WG1 A;  4LEJ A;  5CFD A;  1YJL A;  3ACI A;  2IXI A;  4QX1 A;  4D94 A;  2WC2 A;  3N9Q A;  3TB0 A;  4QU2 A;  3RZM A;  2W94 A;  5LW9 A;  3KSC A;  2J1R A;  3VZL A;  4N7U A;  2Q5T A;  1IQA A;  1ZZ7 A;  2WKK A;  4Q4W 3;  1C1L A;  3ACH A;  1FPN 3;  4IUG A;  4B7E A;  2E6V A;  2YC4 A;  2ZMN A;  2G9Z A;  3ENR A;  3I2H A;  4LIU A;  4BQX A;  2F4L A;  5AC9 1;  3RZH A;  2DWR A;  3AJZ A;  4IGQ A;  3P3P A;  5BNP C;  2XLA A;  3UJO A;  4U36 A;  2XBO 2;  5FJH A;  1YFY A;  3P6B A;  3C7E A;  1YLL A;  1PMH X;  2OXB A;  3DCQ A;  3PJQ A;  1YJK A;  2HWF 2;  4TN7 A;  5FZE A;  3A7Q A;  3Q8A A;  4QQP A;  2JB8 A;  4LUM A;  2D3P A;  4XTP A;  1C8M 1;  5CFC C;  3KVA A;  4EZH A;  3NW4 A;  5LAT A;  3GBF A;  3T2T A;  4FPO B;  4DRV A;  2WSV A;  4NHM A;  1MQT A;  1JW6 A;  4QKB A;  1RVF 1;  5CA6 A;  3DKW A;  1V6L A;  1DDL A;  1COV 1;  4PF5 A;  2A3Y A;  2CYF A;  3MLJ A;  2QJV A;  3ACG A;  2XUE A;  4XZP A;  3SMH A;  3TNP B;  4UFK A;  5F6L B;  2BPA 2;  3JQW A;  2WLP A;  4IEX A;  4QPG C;  1GWM A;  1FPN 1;  3VKN A;  4JVA A;  3T4H B;  3ZYG A;  2E51 A;  1BMV 1;  4YZ2 A;  2R04 2;  2VY0 A;  4DUX A;  2KR2 A;  4AVV A;  2G19 A;  3MID A;  3VDA A;  1UY4 A;  3VDD C;  4XVH A;  5T55 A;  5T5J A;  2EIC A;  1ZBE 3;  1W0N A;  3ASI A;  1US2 A;  4YNI A;  1QQP 1;  5LA2 A;  2D3S A;  4LA3 A;  4XXP A;  1VBC 1;  1C28 A;  5FXV A;  2ZGP A;  2BTV C;  1F8V A;  2ZAH A;  1UZY A;  3HT2 A;  3MPB A;  3PUH A;  5BPX A;  4Q29 A;  2WNV C;  4KH9 A;  4TLF A;  4XEZ A;  5DZF A;  4CDW A;  4CCD A;  1SBF A;  3OBA A;  4LJH A;  4H7L A;  4XPV A;  3ZPY A;  5FDB A;  4MZU A;  1RUF 2;  3KMH A;  2PAM A;  3H3U A;  1R1A 3;  3ZDV A;  1OBN A;  1HXS 3;  1W06 A;  5LY2 A;  4DQA A;  1CAX A;  1OUX A;  3JBG 3;  3WP3 A;  1SQ4 A;  3RSJ A;  2J22 A;  4ISR A;  3AYA A;  1UD1 A;  2VZ1 A;  3VBS C;  1AR8 1;  3GXU A;  2W1W A;  1J3R A;  1O3T A;  1GP6 A;  1OLM E;  1BK0 A;  1URX A;  4CPB D;  4OHY A;  1GOH A;  2A1X A;  1UOB A;  1VAV A;  4Q4V 3;  5FYC A;  5IVV A;  4FOW A;  1EUT A;  4LBQ B;  3ETQ A;  4UFM A;  3S6P A;  1R1Z A;  4IND A;  1YEW A;  2I2S A;  5E6H A;  3CJI C;  5FZ4 A;  1HN0 A;  4MAD A;  4E4H A;  4OI2 A;  3BTY A;  1VE0 A;  1WD4 A;  2Q1M A;  1HDK A;  3WNM A;  2GZW A;  1RUG 1;  4DIQ A;  3MDP A;  5F39 A;  4XFG A;  1Y9G A;  2P3Y A;  3NV3 A;  1JZ4 A;  1G9D A;  1NLR A;  3B9C A;  1JU4 A;  2P34 A;  2OQ7 A;  4YW6 A;  3OD4 A;  1DZR A;  1MQT B;  2ZGL A;  4YGD A;  4OHW A;  5DG1 A;  4K1Z A;  4BLI A;  1ND2 C;  2B39 A;  1POQ A;  2YMZ A;  1OVS A;  4QDQ A;  1ZRF A;  4IE6 A;  1GKB A;  4XIO A;  4ES9 A;  2W46 A;  2EAK A;  4FPY A;  2JDY A;  3AZW A;  1I9R A;  3V64 A;  3TEX A;  5JZG A;  4HG6 B;  4SBV A;  4FXK B;  5JOW A;  5AFB A;  1SPP B;  4CP2 A;  3IMM A;  2HBT A;  1WMF A;  3TRS B;  1YUD A;  4PT6 A;  1FNZ A;  3NJY A;  2VCC A;  2PHW A;  4I01 A;  4PQ9 A;  3OG2 A;  4EE2 A;  4NO4 A;  2ZPX A;  3AYD A;  3E1F 1;  5K0U A;  5I8Y A;  1EPW A;  4HPK B;  2ZX1 A;  5JI7 A;  3LFM A;  2CTV A;  1W8F A;  4FQ4 A;  4OQ8 A;  1S2K A;  1V6N A;  1IKQ A;  4AHX A;  1S0J A;  1XU2 A;  1MEC 2;  2GC3 A;  4Q4Y 2;  3J7M A;  3BUC A;  3M3E A;  1ST8 A;  2WS9 2;  5FP7 A;  4E8D A;  3THT A;  4JHT A;  5EPA A;  2CDP A;  2ZA9 A;  1ODN A;  1XE0 A;  4P9W A;  4XFI A;  1BBT 2;  1ZBA 2;  2X29 A;  3T3Y A;  1AR6 3;  1W8H A;  3ILF A;  5BNN A;  4CCO A;  3I3M A;  5HCB A;  3RG0 A;  1DFQ A;  1WGP A;  2GND A;  2ZOE B;  3POI A;  3ES1 A;  4RSU A;  4QXB A;  4DY5 A;  2NYY A;  2YBP A;  2QQI A;  3QCW A;  3MI8 A;  5A1F A;  5FWJ A;  2D6M A;  1NE4 A;  2ATF A;  2BWA A;  2JEN A;  3WNK A;  3CO2 A;  1OOP B;  3VBO B;  4AL9 A;  4EWA A;  5A7P A;  1PGL 2;  1UIJ A;  2WIN B;  2GMP A;  3BTA A;  5FZM A;  3RWN A;  3N9M A;  1NLS A;  1G9C A;  3QH7 A;  2ZAC A;  1VB4 A;  1JMU B;  1LEC A;  2PXJ A;  2BNN A;  2BYV E;  2WRA A;  3NKT A;  4HXC A;  5FY5 A;  5FZG A;  4KWL A;  3HNY M;  5BY5 A;  2R06 3;  3DXU A;  3FBM A;  1K5J A;  4HOO A;  1W99 A;  4HT1 T;  4XUO A;  2JE7 A;  4E4S A;  2CGN A;  4WVM A;  1JYT A;  1PMJ X;  2CSG A;  1VPH A;  1ZVF A;  1H2L A;  4FPH A;  4YM2 A;  1DYO A;  2X5I A;  2HWB 1;  1BK1 A;  1JYX A;  1KRI A;  1AL2 3;  3POB A;  4R4Z A;  3UT0 A;  1ASJ 1;  3W20 A;  3UGG A;  1C57 A;  2WO3 A;  3FHI B;  1IG3 A;  3PJY A;  2UU8 A;  4KU7 A;  1H2K A;  3AZY A;  3USS A;  3CL1 A;  3ZSM A;  4D8M A;  4N9I A;  5T52 A;  2WT0 A;  5LWB A;  4FTE A;  3NWK A;  5HV0 A;  5F5Q A;  1MAC A;  2P6H A;  1W6O A;  5HXV A;  2D7F A;  5SV8 A;  4Q4X 2;  2VUD A;  5T54 A;  5BV6 A;  2WWS A;  1NY7 2;  5KHH A;  4Z2W A;  2DTW A;  1A78 A;  3N7K A;  4DXT A;  3T1M A;  1H9W A;  4LHS A;  3TBD A;  3QLQ A;  3THD A;  1CPM A;  3AFK A;  4JGZ B;  5LK7 B;  3ZPO A;  4NIH A;  5J98 B;  4E2Q A;  3E5X A;  3GZU C;  1M06 G;  1UNB A;  2HWC 1;  1YNA A;  2EAA A;  2BBA A;  2ZGT A;  5F37 A;  5CYY A;  2XJQ A;  2QDR A;  5FY7 A;  1G86 A;  4LE3 A;  3HNM A;  3VBU A;  2XJP A;  2RJ2 A;  3KCY A;  1COV 3;  1O5L A;  3WNP A;  3JBG 2;  4ARY A;  1VMH A;  4MO3 M;  4XHB A;  4ZPI A;  4GJZ A;  3DV8 A;  1ENS A;  2JIJ A;  1VAM A;  2K9Z A;  4OHZ A;  2ZGS A;  5FY9 A;  2A73 B;  3K46 A;  3H8O A;  3BCW A;  5LY1 A;  3CZJ A;  3IIA A;  3U0Z A;  3NAP B;  2IUW A;  5I0U A;  3AKT A;  5DPN A;  4QMA A;  3AMQ A;  2VMD A;  4WZF A;  4BZ4 A;  5A3O A;  4EN8 B;  5FK7 A;  1JZ8 A;  3VBO A;  3OYW B;  4YRD A;  3A0K A;  5C8C A;  2FZ2 A;  5GZG A;  4W4Z A;  4ONU A;  5JI9 A;  5FZ8 A;  2LTN A;  2D5H A;  3B02 A;  4PIX A;  4M3C A;  5T5L A;  4OQ9 A;  1QXP A;  1PGS A;  3I8T A;  2QTW B;  4K8R B;  1GNH A;  5A7O A;  3KM5 A;  3UKT A;  3OBR A;  1BBT 3;  1ZBA 3;  3WNX A;  3AYE A;  4ZU5 A;  1UOG A;  4AF9 A;  3BTX A;  4AOC A;  4CUG A;  5F1R A;  4UFI A;  1OH4 A;  5GAL A;  1AXY A;  4BIS A;  4B29 A;  1F5F A;  3AMN A;  3TOJ A;  4CTE A;  2BP6 A;  4W6X A;  1RUE 1;  1JU3 A;  4QB6 A;  3ROU A;  3T2P A;  4MV2 A;  4BHP A;  4CRQ A;  3A23 A;  1TG7 A;  4FFI A;  1VRB A;  1QKQ A;  3DUI A;  1BMV 2;  2DCY A;  3AKR A;  4P9X A;  2DCZ A;  2WNV A;  3RJ2 X;  3LSD A;  5FRE A;  4CDW C;  3JUU A;  1V9U 3;  4GAZ A;  1OMI A;  4NII A;  2V09 A;  1S2E A;  4DMI A;  1OQE A;  2R06 2;  3CZU A;  3LF7 A;  3SIS A;  4LUK A;  3HEI A;  4N7I A;  1RVF 2;  4COZ A;  1PO2 1;  3B00 A;  3WCS A;  2O1Q A;  4FPK A;  4JGZ A;  4FAG A;  4L99 A;  4TXW A;  1MS4 A;  4LA2 A;  3VBS A;  1IHM A;  4I09 A;  1RXG A;  2EXJ A;  3E5Q A;  2V5D A;  5A3T A;  5FY1 A;  1QOS A;  4EJR A;  5FQ0 A;  1PIV 2;  1UMI A;  4DUV A;  4NRO A;  1IS4 A;  1AR7 3;  4PQQ A;  2EVX A;  2EF6 A;  5KR7 A;  1YO8 A;  2XOM A;  4ATE A;  3WP5 A;  3MBW A;  4XFH A;  4E2G A;  2WR9 A;  4W65 A;  2W0X A;  5EIY B;  1LOD A;  1EUU A;  2YB7 A;  3PHM A;  1JXN A;  3WHU A;  5CG9 A;  2DUR A;  1LGN A;  4XAE A;  2VW0 A;  2BVB A;  3R4S A;  1OD3 A;  1RUC 2;  5EQU A;  3CBN A;  4OHV A;  2H6B A;  4Y1Y A;  1ONA A;  3ON7 A;  3H50 A;  2JJ6 A;  2ZGM A;  5FZB A;  5I0D A;  1IQD C;  2GNB A;  1Y9M A;  1NAE A;  4CEY A;  5A1L A;  5A3L A;  1DIW A;  5L7O A;  4YW2 A;  1IKP A;  3GAL A;  5T3N A;  5DN2 A;  4LO6 B;  1ZRR A;  2JDZ A;  5ERL A;  2FDH A;  3AVR A;  3O0X A;  5IAV A;  4LO7 A;  1TNR A;  3AKQ A;  4XFA A;  5FZA A;  1UZZ A;  3NNF A;  2AEZ A;  4UAP A;  4AI3 A;  1CAV B;  2ZHN A;  5JZG C;  3POE A;  3M3C A;  1MS3 A;  4P9J A;  1RGS A;  4RHV 1;  2UWC A;  4XUT A;  2F4P A;  3BOP A;  1R09 1;  1UU6 A;  1W6Q B;  1MVE A;  4YVW B;  1W28 A;  3HPN A;  4IV3 B;  1YFX A;  4UYB A;  3V0A B;  2BVV A;  2ZHL A;  1OUR A;  2PMW B;  2DUO A;  1UYY A;  4LBQ A;  4ZS2 A;  4BPZ A;  3POF A;  2JG8 C;  2PQQ A;  3FJS A;  5HV4 A;  3KT7 A;  1MS0 A;  3H0O A;  4OLL A;  4YVS B;  2YXS A;  3H7J A;  4CPB A;  3BN6 A;  4XFB A;  1O7F A;  2QQJ A;  5IFP A;  3VBF B;  1RUO A;  4COV A;  3OPW A;  5IW0 A;  2C9A A;  1N1V A;  3EJK A;  3NVC A;  2BJS A;  3UV9 A;  4AAP A;  3O1P A;  4TWT A;  1LAJ A;  1ZX5 A;  3KQR A;  1AL2 1;  3HAG A;  3ZXA C;  1XNK A;  2A7A A;  3O1T A;  4N53 A;  1EV1 1;  1GIC A;  5CEH A;  4Q0S A;  3HN1 A;  4NN0 A;  2JKX A;  4JQT A;  3NAP C;  1Z78 A;  2PAK A;  4L9B A;  4QDR A;  5CKM A;  1WME A;  5HPO A;  4A3X A;  3LGR A;  3SLI A;  4ASM B;  5JIA A;  1IZ3 A;  4B1L A;  3IKW A;  1XJA A;  4LHK A;  2X8K A;  2B7Y A;  4FPE A;  4B4P A;  2YU1 A;  4N43 B;  1O6U A;  2BGP A;  5FYV A;  2XUM A;  3V0B B;  4QQ2 A;  4MG2 A;  3VD5 A;  4P08 A;  2R07 2;  4CDQ A;  5DZE A;  1LES A;  4EWE A;  1NLQ A;  3ZFG C;  1TEI A;  4PJY A;  1UZV A;  1RB8 G;  4L2N A;  1BVP 1;  3J9S A;  4UF0 B;  5F5C A;  1HXS 2;  1IG0 A;  2OII A;  1ND3 A;  2ZMK A;  5F8P A;  1LUL A;  2Z42 A;  1OQD A;  3CIH A;  2HWC 2;  5LA1 A;  2X10 A;  3UES A;  2XL7 A;  3VBH A;  2JD4 A;  3USU B;  2OX0 A;  3TEY A;  3RMX A;  1S0I A;  1DQ2 A;  1WA4 A;  2JKB A;  3ZMO A;  5BNN B;  1KDM A;  1DF0 A;  2IC1 A;  4GKY A;  1J3P A;  3ZXG A;  5FK8 A;  3JQX A;  4KMQ A;  3ZN6 B;  3EYP A;  3SCF A;  3WG4 A;  4CCC A;  1PIV 3;  3LB9 A;  4LQR A;  3O1R A;  1O8S A;  3VV1 A;  1LHO A;  1ODM A;  1DGR A;  4BQ1 A;  2QQP A;  5EFU A;  3I3E A;  4RR3 B;  4IE5 A;  2VZQ A;  3I2F A;  2ZX2 A;  1E5I A;  4IET A;  4NPM A;  4YW3 A;  1A3K A;  5CFD C;  3BB6 A;  4LMF A;  4XJ9 A;  5FRA A;  3RI9 A;  1ZRI A;  1N3Q A;  4G3Y C;  4RHV 3;  3WT3 A;  3V0A A;  5KHG A;  1UMZ A;  1GQP A;  1QJU 1;  4H7M A;  4Q4Y 3;  4FPG A;  5FYT A;  3BPS A;  4GWJ A;  3URF A;  3H1W A;  5H9P A;  1NT0 A;  1V9U 2;  3MZH A;  1UX6 A;  3PVE A;  5H9Q A;  3BTZ A;  5D8A C;  1UAI A;  5FZO B;  3FBY A;  1P8J A;  4NRP A;  1UO9 A;  1MZE A;  1S4C A;  3BU7 A;  4L92 A;  4Q0Q A;  4ZXE A;  4QX0 A;  1LCL A;  2QQV A;  4MSV A;  4F83 A;  3TWI A;  4UI9 L;  4YGC A;  1VBA 1;  5FYZ A;  4CXX A;  4XJU A;  1AR7 2;  4QXH A;  4QB1 A;  4IGP A;  3A4U A;  3IB3 A;  1SBD A;  2XG3 A;  5LRR A;  1C8M 3;  1O4T A;  2CAU A;  5AFE A;  1I3H A;  3N36 A;  4IEP A;  3MLL A;  4Z2A A;  1JOJ A;  4IEV A;  1LOG A;  4PBO A;  4GKX A;  1W8T A;  4MVT A;  4AFC A;  2IFR A;  4DIN B;  5EZW A;  3RJR A;  1CX4 A;  2A6Z A;  1SFN A;  2OYZ A;  4OZX A;  1JYN A;  4PI0 A;  3V65 A;  4D6Q A;  2YFZ A;  2NQY A;  5H9R A;  5AC9 3;  5CB7 A;  3THP A;  1SG3 A;  4H55 A;  4JDM A;  2BQP A;  4QPY A;  3OUI A;  1PZ7 A;  3DEC A;  4HKW A;  4M4P A;  3ZKY A;  3J26 N;  1NCQ A;  4QU1 A;  1ND3 B;  2HBU A;  3LA7 A;  4QX5 A;  2KD7 A;  3AYC A;  4XJA A;  4GMP 3;  1CX1 A;  3NKG A;  4CEW A;  2PHU A;  5FR3 A;  1IGO A;  4MXW A;  2ARB A;  2QZ3 A;  3USU A;  3T08 A;  1UY0 A;  1XE8 A;  5H9S A;  4RQP B;  1NX9 A;  5A3W A;  1AJO A;  2J1U A;  2WQ4 A;  2OQ6 A;  5FP3 A;  2N7G A;  3KF5 A;  5ACA 2;  1OD5 A;  2WNU A;  3DXT A;  1WD3 A;  2HWE 2;  4AAX A;  3E6B A;  3TNQ A;  3GBW A;  1GNZ A;  3ZN5 A;  2VVF A;  2MEV 2;  3E5U A;  4X8N A;  3WUC A;  3IDB B;  3U10 A;  4DXZ A;  4PDW A;  3SC7 X;  3LOI A;  4JRL A;  4AI0 A;  3IM0 A;  4YM1 A;  5A3U A;  4XBN A;  1XQN A;  2E7A A;  2VUC A;  3FN9 A;  3PVN A;  4HVQ A;  5BNO B;  1VBC 3;  2XON A;  4AFM A;  2VMC A;  2ZGQ A;  3WF4 A;  1RUJ 1;  2BGO A;  3ZOI A;  1HRI 2;  5C71 A;  4LE4 A;  4Q8L A;  2VTX A;  5JAX A;  3W58 A;  4BE3 A;  1L3J A;  1ZBE 1;  4BOW A;  4CU8 A;  1OFN A;  2ID4 A;  1PM7 A;  1VBB 1;  5FFO C;  1SAC A;  5FUN A;  1ASJ 2;  5FUI A;  4Q5O A;  1TMF 1;  1X33 A;  1AL2 2;  1LKN A;  2MHF A;  4WM7 B;  1KDK A;  4RN5 A;  1GV9 A;  5ABJ A;  1PVX A;  2XXZ A;  4FPJ A;  5JR7 B;  4C0B A;  1LOB A;  2VOV A;  4KQ7 A;  3GDB A;  4KI5 M;  2P2K A;  2XJV A;  4RGA A;  3WF3 A;  1ZZC A;  1DYP A;  1TME 3;  5DDJ 2;  4DXS A;  2WDB A;  4YW7 A;  2AC1 A;  1OC1 A;  3GYD A;  2WLQ A;  1DLL A;  1STM A;  2WZR 1;  4JRA A;  3EB7 A;  4MUV A;  4PIY A;  2QQL A;  4CUA A;  2ZZQ A;  3C2U A;  1CAW B;  1CZS A;  1X50 A;  2Q30 A;  1CIY A;  2RDS A;  4NOT A;  1CZT A;  2Y26 A;  1PVC 2;  2P1B A;  1SFP A;  1PO1 3;  2HEV F;  3KT4 A;  1J59 A;  4KBB A;  2Y6J A;  1GQH A;  3CHX A;  3CF6 E;  2VD7 A;  5JSP A;  5IK5 A;  4QHB A;  4Y4Y A;  3VD7 A;  5LA0 A;  1KJL A;  2J42 A;  1DQ4 A;  1LB2 A;  2J1T A;  4X8P A;  3KHB A;  2VW1 A;  5FMC A;  2WZR 2;  3NV2 A;  3T0A A;  4GZ9 A;  3H42 B;  2C26 A;  5FPL A;  2AAC A;  1MS8 A;  2DVD A;  4UW3 A;  2OKX A;  1XU1 A;  2WS9 1;  5JPM B;  2BW8 A;  5CU1 A;  2GNT A;  1Y7B A;  2RS5 2;  2ZBJ A;  3BPZ A;  1H6X A;  4Q4Y 1;  3MIC A;  1VBD 2;  2XKP A;  1OLR A;  4RQP A;  3I3D A;  5IVY A;  3WNN A;  4BK5 A;  4YM3 A;  3EQE A;  2QE3 A;  4KWU A;  3FLR A;  4Q0V A;  3NNL A;  1WKY A;  1PGW 1;  1PO1 1;  5J09 A;  1C3H A;  1RUH 1;  2GME A;  3FFQ A;  3POW A;  1VAL A;  4WM8 B;  5EXO A;  2JG9 B;  5FKC A;  3ZLI A;  2RV9 A;  4C1X A;  3TN9 3;  2SLI A;  5C33 A;  4AG4 A;  2IXL A;  4DY3 A;  5C9A B;  1GNY A;  1RUE 3;  2RHP A;  2VZP A;  2WUH A;  1VLN A;  2FMD A;  3LFI A;  4N53 C;  4Q4W 2;  5FPB A;  3ZXK A;  4B4Q A;  3OUH A;  1X7N A;  2HWD 2;  1DGL A;  3OEB A;  1AYN 3;  2K0G A;  1N3O A;  5JIU A;  1UKR A;  3GJA A;  3S7E A;  2E26 A;  3PVB B;  1C1F A;  1YWK A;  3ZMN A;  4D7Y A;  4MH0 E;  1RC6 A;  3NJX A;  4WBB A;  1CGP A;  3VD3 A;  4LTA A;  4V2V A;  1U5Z A;  1REF A;  1YQ8 A;  3A21 A;  5FLI A;  1OUS A;  4BXF A;  3KD4 A;  5B2G B;  2WJS A;  2FDF A;  1V6K A;  2PHL A;  1CN1 A;  2XHN A;  3LKJ A;  4MGQ A;  4CDQ C;  1ZRE A;  1W6P A;  3MW2 A;  2NM1 A;  3WW1 A;  1KS5 A;  4Q4X 3;  3WOG A;  4COY A;  4ERO A;  2W92 A;  4W8J A;  4FTS A;  1Z7S 1;  3VKO A;  4AZZ A;  2HYX A;  3UGF A;  4TTG A;  1RUN A;  4FO9 A;  3LSE A;  1POV 1;  2ARE A;  3OGG A;  1LOF A;  2DVF A;  3IDC B;  4LUL A;  1CIW A;  3UL2 A;  3ZXE A;  4AI1 A;  5CFC B;  3Q8C A;  2VNV A;  5IJR A;  4CA9 A;  1JN2 P;  2R7E B;  1KQR A;  2B42 B;  1JZ5 A;  2PHF A;  4JGY C;  2XDV A;  1W8N A;  4W50 A;  1JZ7 A;  1RTV A;  3AP9 A;  2ZJC A;  3JXS A;  1WZX A;  2ZAA A;  2XR4 A;  2FDI A;  1UYX A;  1W9T A;  1ZZ8 A;  4BJ0 A;  3IPV A;  4FAH A;  2J7M A;  3LPF A;  4HET A;  1N3P A;  2HEY F;  1UZ0 A;  3AB0 A;  4JDO A;  3IAQ A;  2LS6 A;  5DAB A;  5IVB A;  3BIW E;  1WUV A;  4QX2 A;  5IAX A;  1HKD A;  4A45 A;  2VXR A;  2VO5 A;  3C7F A;  2VVD A;  1FT9 A;  3LDB A;  3KB5 A;  2A3W A;  3AKS A;  3ZYJ B;  4R9C A;  3ZX7 A;  5BNQ A;  4XBQ A;  5J37 A;  5IFT A;  3W5N A;  3KZ4 C;  4O65 A;  3SCG A;  5LRS A;  2WZE A;  1UQX A;  2UYB A;  4CDQ B;  4J1X A;  1VBC 2;  2BGC A;  2VZU A;  3U14 A;  5CKN A;  2YFU A;  1YQ5 A;  2PAE A;  4DFS A;  4CSW A;  2W47 A;  3RYR A;  3AMM A;  4E4D X;  1YXW A;  3TEZ A;  5BNP A;  3I59 A;  2XH6 A;  4OVE A;  3WQ7 A;  2JG9 A;  1Z0H A;  2QUO A;  4A3Z A;  3EO6 A;  4A7Z A;  1OF4 A;  4Z07 A;  3LEG A;  4MGZ E;  5F3G A;  5A7W B;  2GP3 A;  3BOW A;  3UK9 A;  4K40 A;  1SDW A;  4NID A;  3AZV A;  2SBA A;  1OKQ A;  3WG3 A;  1COV 2;  4XE9 A;  1KIT A;  4XDO A;  5LAS A;  2EA7 A;  1XYP A;  1QJZ A;  3VBR A;  4MXV A;  2YPJ A;  4CCN A;  2LW8 A;  2Y60 A;  2WAB A;  3FX3 A;  1JTZ X;  4ES8 A;  4AQS A;  3M4F A;  2W52 A;  5IUQ A;  3HT1 A;  1PHM A;  2EIG A;  3CJI B;  3NV1 A;  1POV 0;  4AI9 A;  1RUJ 3;  1DG6 A;  5I8S A;  4UT5 A;  1FNY A;  2WO7 A;  3U37 A;  4C91 A;  5I91 A;  2BNO A;  2XJS A;  2HYK A;  1H6Y A;  2QQU A;  2RM2 2;  3RNS A;  3OOX A;  4MLO A;  4BQ4 A;  2VG9 A;  4WV8 A;  5FZH A;  4QKF A;  3ABZ A;  1R08 3;  1WW4 A;  2VMH A;  4NIA A;  2GAU A;  2QQM A;  5CKQ A;  1D0G A;  4M0H A;  3ZR5 A;  4HKO A;  5GLU A;  4D7S A;  3ELN A;  3R4U A;  2UUR A;  1XNB A;  1G7Y A;  4MX3 A;  4XMA A;  5DUX A;  1ND2 B;  2DF7 A;  2RS5 3;  2RS5 1;  1ZZ6 A;  3ZSE A;  3DL3 A;  5C3O A;  1HIX A;  3T30 A;  3ZN4 A;  3AX4 A;  4P5Y A;  1F4H A;  1H1M A;  2GH2 A;  2WAO A;  3M7A A;  4K1Y A;  5D21 A;  2WZP P;  5GLZ A;  1HB1 A;  1W6O B;  2VOW A;  4G4F A;  4JC1 A;  4HLT A;  2MPF A;  2RE9 A;  1QIQ A;  5IVC A;  2OZ6 A;  1PNG A;  1XYN A;  5IK7 A;  4PDW C;  1DP0 A;  3RGB A;  3C7O A;  4NHL A;  3VUO A;  4IV1 B;  1QJY 2;  4XUP A;  4AEK A;  4QKD A;  1VRH 3;  2YBK A;  1AXZ A;  4RFT 0;  4WVZ A;  3WDW A;  4A7Y A;  2VW2 A;  1JYV A;  1W9Y A;  1W03 A;  2BER A;  4FCA A;  5ANQ A;  2G9F A;  3ETP A;  4M0N A;  4CDW B;  3TN9 2;  4QQL A;  3DPR C;  2Y6F A;  4IEZ A;  4Y20 A;  4AVT A;  2Y6H A;  3HN3 A;  3L2Y A;  1L7Q A;  1BBT 1;  1ZBA 1;  2PHT A;  2HKX A;  3IMN A;  3WQ1 A;  4QHO A;  4BQW A;  5BNP B;  2QCS B;  3QH6 A;  3M3O A;  3KHC A;  1Q3E A;  3KCX A;  4KU8 A;  4AFB A;  1K42 A;  1CR7 A;  2A6X A;  5C8W A;  5DQ0 A;  3VL8 A;  3FE5 A;  3JD7 1;  3JD7 3;  1JBC A;  1OPO A;  1X9P A;  2R6Q A;  1SFY A;  1W9S A;  2JWP A;  5JOZ A;  3ZDS A;  4JGY B;  2WN2 A;  1AR6 1;  1OOP C;  4B4R A;  3RZG A;  3HOB A;  4LO5 B;  2DUP A;  2CGP A;  3E6C C;  2OUH A;  3OBT A;  1SLA A;  3KWV A;  1W2N A;  4NAM A;  4NPR A;  4YW1 A;  1OPM A;  5BNO A;  3RQ0 A;  1GOF A;  3D0J A;  5GZD A;  2XWJ B;  5FYH A;  3KLS A;  1W05 A;  4F7Z A;  2HWD 1;  1C8M 2;  3N9O A;  1RUC 1;  2P4E A;  5FLH A;  5FAX A;  5A3M A;  2X09 A;  2UY8 A;  4Q4W 1;  4AGG A;  1H4H A;  2FHR A;  2HWE 1;  4N8M A;  2YPD A;  4CP0 A;  2YHJ A;  2R0F A;  5FPZ A;  2GMM A;  1Y4W A;  1K3I A;  4XF3 A;  2DCT A;  5E1R A;  3SCH A;  5FLJ A;  3UJQ A;  2C0Z A;  5JZG B;  3ZYI B;  1SLT A;  5AC9 2;  1O3R A;  2IWG B;  3PUI A;  4QQH A;  4ZHN A;  3WW4 A;  3B93 A;  4LOS A;  4YZ3 A;  3PTR B;  2XVL A;  3LEI A;  4D6S A;  2FD8 A;  1NZC A;  2H0B A;  1RIN A;  3FL7 A;  2AGS A;  2CGO A;  1MVQ A;  4DEV A;  2ZS6 B;  4DOU A;  3D6E A;  2RM2 3;  4IL7 A;  1Z7S 3;  3K51 A;  2YG0 A;  5C6C A;  4I02 A;  4LBL A;  2R06 1;  3M3Q A;  4QWN A;  4Q0U A;  5KBF A;  1IPK A;  1BKZ A;  5HBA A;  4Z82 A;  2D97 A;  1W6N B;  1RUI 1;  5FZ6 A;  2VE1 A;  3U4S A;  3HBZ A;  4R52 A;  2X5I B;  2ET1 A;  4AHZ A;  2E7Q A;  2RS3 2;  1RMU 3;  2A70 A;  1SPP A;  1ULG A;  4JCK A;  2WFP A;  4LOT A;  1ZRD A;  1L7R A;  2I74 A;  3CKH A;  2BU9 A;  4E4Z A;  1UY2 A;  3ECQ A;  1WCD J;  1TNF A;  2QQO A;  3JCI A;  2IXJ A;  2DVG A;  5DZG A;  4COU A;  5E16 A;  1UY3 A;  1XXN A;  3HQR A;  1QH7 A;  3T09 A;  4TYS A;  4CDU A;  1QQP 2;  3PIG A;  4D0Q A;  4UBG A;  3WDX A;  3T2O A;  3U75 A;  2LUW A;  4AGV A;  3DYP A;  3R6S A;  2R07 3;  4JGY A;  4IEU A;  1IS6 A;  4I3G A;  3NRU A;  1R1A 2;  4A2U A;  3OJB A;  4XDP A;  4E2S A;  3IDA A;  2GC0 A;  2W3J A;  4BME A;  1JOB A;  2Q0A A;  3VDC A;  3ZFG B;  1RL3 A;  3RYK A;  2ARA A;  3Q8F A;  1HQN A;  3AZZ A;  3LEK A;  2BOI A;  3HQU A;  4YG3 A;  3BVC A;  1W2T A;  2VU9 A;  3IWZ A;  3M3I A;  3OGV A;  4TLG A;  3ZIX A;  5FY8 A;  4RGG A;  3UGH A;  3OBZ A;  4ARX A;  1UL9 A;  3U07 A;  4AVC A;  1S2B A;  4QT6 A;  5GZE A;  1OHF A;  2RS1 1;  1XYO A;  5KHJ A;  4IV3 A;  4C90 A;  2WN3 A;  5L73 A;  4LK7 A;  2DDU A;  1GWK A;  1HRV 1;  3KCC A;  4LBN A;  3VHO A;  4ZXK A;  3K4D A;  1OQ1 A;  3III A;  2AUY A;  4MGI E;  2WNO A;  3AC0 A;  2CU5 A;  4I0W B;  5FZL A;  4Z8B A;  4R9A A;  1PK6 A;  2ZAB A;  3APB A;  4HVO A;  1U5I A;  2NP0 A;  2BUK A;  2CAV A;  1FV3 A;  5CFD B;  3KF3 A;  1QWR A;  3KGZ A;  3FHQ A;  1S0E A;  2ZCW A;  4HSL A;  3HWJ A;  2V4A A;  4AQ6 A;  4XZU G;  4BWO A;  4ZY9 A;  1RVF 3;  1E5S A;  1UOF A;  2WZR 3;  3AJY A;  1OA2 A;  2JDN A;  4GQ7 A;  4CUC A;  5C3Q A;  4MHR A;  5FUP A;  4HZF A;  3OGS A;  4CP1 A;  3F95 A;  5CZK A;  4GAL A;  1KJR A;  1LEN A;  2R16 A;  2WQZ C;  3IPV B;  3UET A;  5JMO A;  2C9K A;  2J1A A;  1UU5 A;  4J6G A;  3GBG A;  3MW3 A;  4NHK A;  2VPV A;  3LE0 A;  5T50 A;  2BNM A;  3VBO C;  2OA2 A;  4HN0 A;  4NHY A;  3VBR C;  3ZIW A;  1F15 A;  1RIR A;  2YC0 A;  2XLG A;  3B3Q E;  1JOP A;  1ZNP A;  1NA1 B;  2ES3 A;  3ACL A;  3VZK A;  5JSR A;  1EPZ A;  1QJF A;  1T6B X;  2JDP A;  1AR8 3;  1BJQ A;  4ZS3 A;  3N35 A;  3VDB A;  3P5B A;  3ILN A;  1WCS A;  2NMO A;  2RDN A;  4R9B A;  1W0O A;  4YLZ A;  3O7O A;  4XCA A;  3JD7 2;  4M3C F;  4P00 B;  1C8N A;  5KHK A;  5C5T A;  1XB9 A;  3SEE A;  4GIQ A;  5IK8 A;  5C8C B;  5T5O A;  1ALY A;  3RDI A;  4FP3 A;  4GXL A;  3DF0 A;  4O7X A;  5C3S A;  5G04 L;  2O8O A;  4AED A;  3LDK A;  4XET A;  3WVJ A;  5FO9 B;  1PO2 3;  3GCX A;  1H1I A;  4Z1V A;  3I97 A;  2W87 A;  2W95 A;  3P3N A;  4LOR A;  1AYN 2;  3ZXL A;  1WW7 A;  4HVR A;  1O3S A;  2Z69 A;  5FZ3 A;  2W1S A;  5FOB B;  1V9U 1;  2NN8 A;  2BBV A;  1B35 C;  1NOV A;  1Q43 A;  1GOG A;  1J1T A;  1CVN A;  2AEN A;  4XUR A;  4AK3 A;  5A32 A;  1G9A A;  1JS9 A;  2DTY A;  4WM7 C;  3SH3 A;  5J36 A;  1JI6 A;  1RUI 2;  3D8C A;  3VLB B;  4FI9 A;  4HK8 A;  1D0H A;  3GZT B;  2ADE A;  1F31 A;  2JDA A;  4JGZ C;  2HWE 3;  1WW6 A;  2GNM A;  3OD0 A;  5JDB A;  1LGB A;  1S0D A;  1R08 1;  5JPN B;  2GSY A;  3WUD A;  4XQD A;  4ASK A;  2VCA A;  3T0B A;  4CCK A;  3K2O A;  2Q8C A;  4UWD A;  5FZ1 A;  5CBL A;  3WP4 A;  1FOD 1;  2UYA A;  1Q8Q A;  1ZYB A;  3MV1 1;  3T2Q A;  5FO8 B;  2ZHM A;  2XVG A;  4D6R A;  2RS3 3;  2D6L X;  4W6W A;  1Z7S 2;  3MLK A;  4LHL A;  1SBE A;  5FPA A;  3WNO A;  3R05 A;  2AR6 A;  5GKA C;  4UBH A;  5AVP A;  1V6J A;  4LBK A;  2CNA A;  5JCT A;  1N1Y A;  1WBF A;  2VOX A;  1K5M B;  4SLI A;  4J1W A;  4AHY A;  1H2N A;  3MYX A;  2JDM A;  1XE7 A;  2CL2 A;  4RA0 A;  1GZW A;  3VZM A;  1I5P A;  3ZM8 A;  4QM9 A;  5FYU A;  3SKJ E;  3DKQ A;  1IS5 A;  3EHK A;  5CIS A;  5IVE A;  3LWC A;  5KWR A;  5FY4 A;  4KGQ A;  4JX0 A;  1TMF 3;  1GWL A;  1LEM A;  2A6V A;  4OYU A;  4ZON A;  4K8F A;  3LPG A;  1JYI A;  3KT1 A;  3HMY A;  1W8W A;  1WLC A;  2Y0O A;  4MYE A;  4Y5T A;  2XVK A;  2PA7 A;  1HJG A;  1V6M A;  4YSF A;  4DUW A;  5I8T A;  1O8P A;  4QXC A;  1LRH A;  1PO1 2;  2VAU A;  1EV1 2;  5FJK A;  5B4X A;  3MV0 1;  3RZZ A;  2A6W A;  3VHP A;  5FQ0 B;  1S0B A;  4EN7 B;  1O4Z A;  2FCU A;  5E88 A;  1LU1 A;  1ZZB A;  4N53 B;  4K3U A;  2HWB 2;  2JG8 A;  1R1A 1;  5L36 A;  5LBB A;  2EXI A;  5EJ3 A;  3N9P A;  2WL1 A;  1DU3 D;  5GLT A;  2EXH A;  2R32 A;  1BLZ A;  3OCP A;  4AFA A;  2WBK A;  4R9D A;  4BA6 A;  1UMH A;  2O0O A;  1FX5 A;  3ACF A;  4LO8 A;  4Y1U A;  5FZF A;  3WDY A;  4BB3 A;  5JXJ A;  4AFD A;  4FQZ A;  3C3V A;  1W2U A;  4IER A;  4LLF A;  4R4X A;  3NJZ A;  3OEA A;  5IAT A;  1GZC A;  4QPI B;  3SQO A;  1YCI A;  1FV2 A;  1SLI A;  3FUQ A;  4NRM A;  1FI2 A;  5BYN A;  5L19 A;  1DQ0 A;  3CQO A;  5KXD A;  3PTY A;  5FZ9 A;  5JLV A;  1NXM A;  1DLC A;  4Q0P A;  1FMD 2;  3MUZ 1;  5LBE A;  3WQ0 A;  5FOJ B;  2A3X A;  4CCM A;  2C24 A;  3IAP A;  3FLP A;  3M2M A;  3MEP A;  4G9S B;  5I0T A;  4K7J A;  1JUH A;  4WM8 C;  3HNB M;  1KEX A;  1N1S A;  2OPW A;  3P1I A;  5HCA A;  2HWD 3;  5EYX A;  1W90 A;  1L7L A;  1W8O A;  1S1A A;  3IBM A;  2XJT A;  1EY2 A;  3Q8B A;  2P6C A;  4NIG A;  5FYS A;  1UW8 A;  5I0R A;  4YAR A;  1PZ8 A;  3TAY A;  2WNE A;  1LOE A;  2EXK A;  4CDU C;  2RMU 2;  4PBP A;  1NCR A;  1TZO A;  5DAV A;  4LO4 B;  1RUI 3;  1K5M A;  1DBN A;  5A3N A;  4S2F A; 
#chains in the Genus database with same CATH homology
 4KWU A;  4A44 A;  3WNM A;  1WKY A;  4M4R A;  3BGA A;  1JZ4 A;  3A22 A;  2EIE A;  2RV9 A;  1JU4 A;  3WF1 A;  4AG4 A;  1GNY A;  2VZP A;  2WUH A;  2ZXQ A;  3OGR A;  3HJR A;  4E8C A;  2WZ8 A;  3OEB A;  1JZ3 A;  2E26 A;  4QDQ A;  4YPJ A;  3NJX A;  2W46 A;  3VD3 A;  5G05 L;  1KGY A;  3A21 A;  4HG6 B;  2EIB A;  3VD4 A;  1SPP B;  2XHN A;  4MGQ A;  4PT6 A;  2VCC A;  2VZT A;  1XPW A;  1UXZ A;  5JXG A;  2W92 A;  4W8J A;  3OG2 A;  5JXI A;  3E1F 1;  2HYX A;  4QDS A;  4TTG A;  4PF1 A;  2VCB A;  1PX3 A;  5IJR A;  2R7E B;  1JZ5 A;  4W50 A;  1W8N A;  1JZ7 A;  4E8D A;  2CDP A;  3JXS A;  1UYX A;  1SHW B;  1W9T A;  4BJ0 A;  2J7M A;  3LPF A;  3I2J A;  3POI A;  1SDD B;  3I2I A;  2L9L A;  1UZ0 A;  3IAQ A;  1UY1 A;  2LS6 A;  2VOT A;  2QQI A;  3GGL A;  4QX2 A;  4A45 A;  1W9W A;  4GWI A;  2VO5 A;  3C7F A;  3WNK A;  5IFT A;  3W5N A;  2WZE A;  2VL4 A;  4OUE A;  3SEP A;  2VZU A;  2VQU A;  5CKN A;  3SKV A;  2YFU A;  3HNY M;  4XUO A;  1W99 A;  1XNT A;  3NNG A;  1PMJ X;  2W47 A;  2W91 A;  3T0D A;  5EJ1 B;  1DYO A;  2QQN A;  1JYX A;  4JKL A;  4A3Z A;  5JXH A;  3POB A;  1OF4 A;  2WO3 A;  3LEG A;  2VQT A;  2C4X A;  2Z4F A;  4D8M A;  1WCQ A;  1BHG A;  5DMY A;  3I2G A;  2LW8 A;  1MPX A;  2E32 A;  2WAB A;  1JZ2 A;  5F7U A;  2VZS A;  4DXT A;  4LHS A;  3THD A;  3NQH A;  3U37 A;  1ULO A;  3OB8 A;  2J1S A;  1H6Y A;  2BBA A;  2J1V A;  3ABZ A;  4L0P A;  5CYY A;  3UNP A;  2QQM A;  5CKQ A;  3HNM A;  3J7H A;  1NUK A;  2RJ2 A;  3WNP A;  4ARY A;  2YC2 A;  4MO3 M;  4CVU A;  4QB2 A;  2DCK A;  2E33 A;  3K4Z A;  5C7G A;  4P5Y A;  4QX3 A;  1F4H A;  2WAO A;  3K46 A;  5A1A A;  1D7P M;  3CZJ A;  1O59 A;  4MOA A;  1SZB A;  3LQC A;  5DPN A;  2VMD A;  1DP0 A;  1JZ8 A;  3C7O A;  3WQB A;  2W1U A;  4XUP A;  5IYY A;  1UYZ A;  5IHR A;  4W4Z A;  3NJV A;  1JYV A;  1NKG A;  3MUY 1;  4A42 A;  4RYD A;  2BER A;  1HN1 A;  2VME A;  1K45 A;  3ETP A;  5HXM A;  2CDO A;  2Y6H A;  2Y64 A;  3HN3 A;  1L7Q A;  2ZEW A;  1OH4 A;  4BDV B;  1K42 A;  3T2P A;  1JU3 A;  4QB6 A;  2ZEX A;  5DQ0 A;  3A23 A;  1TG7 A;  1W9S A;  1XNA A;  2WN2 A;  3HOB A;  2V4V A;  1CZV A;  2WQ8 A;  4CU9 A;  1UWW A;  1NZI A;  3CZU A;  1TVG A;  3HEI A;  1GOF A;  1OT5 A;  4CUB A;  1XC6 A;  3WF2 A;  4TXW A;  2QQK A;  1F4A A;  2V5D A;  2X09 A;  3KQ4 B;  3WSO A;  1OF3 A;  2VZ3 A;  5J1X A;  1UMI A;  4DUV A;  4PQQ A;  1K3I A;  4LKS A;  4CU6 A;  2XOM A;  3MBW A;  2VTF A;  4ZZ8 A;  4JKM A;  5EIY B;  1EUU A;  2YB7 A;  1R64 A;  3PUI A;  3DYO A;  2VZO A;  4A4A A;  3THC A;  4LOS A;  1OD3 A;  2VR4 A;  2BZD A;  2VZV A;  3LEI A;  2WAA A;  3FL7 A;  5JR2 A;  3FHA A;  5I0D A;  4DEV A;  1IQD C;  2QBX A;  1NAE A;  4QAW A;  2YG0 A;  1LNS A;  3VD9 A;  5DN2 A;  3C7G A;  4MGS A;  2VC9 A;  2VZR A;  2W9X A;  2XQX A;  4ZZ5 A;  4UAP A;  1GUI A;  3POE A;  1GU3 A;  1SPP A;  4XUT A;  4LOT A;  5B4N A;  1L7R A;  3CKH A;  1UY2 A;  3HPN A;  3ECQ A;  3I3B A;  2QQO A;  1UY3 A;  1UYY A;  5C70 A;  3POF A;  3T09 A;  4D0Q A;  2VM9 A;  3T2O A;  3BN6 A;  5IFP A;  2QQJ A;  3DYP A;  2PQS A;  2ZEZ A;  3NRU A;  3IDA A;  2W3J A;  3VDC A;  2WO1 A;  3LEK A;  1UXX X;  3I2K A;  3OGV A;  2JKX A;  1K12 A;  4QDR A;  5CKM A;  4ARX A;  2Y6L A;  4OMC A;  5HPO A;  4CU7 A;  3K77 A;  3MO4 A;  2X05 A;  3W5M A;  4JHZ A;  3C8X A;  2WN3 A;  4OMD A;  3CMG A;  2J1E A;  2DDU A;  2BGP A;  2RVA A;  3DEM A;  4XUQ A;  3K4D A;  3K4A A;  3III A;  4P08 A;  3VD5 A;  4BXS V;  2WNO A;  3AC0 A;  4DEQ A;  4XUN A;  3FHQ A;  1JYW A;  3CIH A;  4XZU G;  5LA1 A;  4ZY9 A;  2W1Q A;  2WYS A;  2X10 A;  3DYM A;  3UES A;  1J84 A;  4CUC A;  2JE8 A;  3K75 B;  3OGS A;  4BK4 A;  5CZK A;  3UET A;  4KMQ A;  5JMO A;  3EYP A;  1RYY A;  1GMM A;  2C9K A;  2EID A;  2J1A A;  3WF0 A;  3LE0 A;  4LQR A;  1O8S A;  2V72 A;  3I3E A;  2VZQ A;  3I2F A;  1US3 A;  5JUV A;  4LMF A;  3F2Z A;  4A6O A;  4A41 A;  3VDB A;  1GQP A;  4P00 B;  1ULP A;  4GWJ A;  4OZO A;  1NT0 A;  3SEE A;  2VMF A;  2Y6G A;  3WNL A;  1P8J A;  4DXR A;  2JD9 A;  2WO2 A;  4ZXE A;  5G04 L;  4QX0 A;  3POG A;  4UI9 L;  3I97 A;  2W87 A;  2W95 A;  4LOR A;  4QB1 A;  3GM8 A;  3IB3 A;  2E31 A;  4JKK A;  2W1S A;  1T2X A;  4LPL A;  5LCW L;  1GOG A;  4XUR A;  4Z2A A;  3CDZ B;  1JI6 A;  2VJX A;  4FI9 A;  2Y8K A;  2ZEY A;  3WEZ A;  2JDA A;  5EJZ B;  1JYN A;  2YFZ A;  2Y6K A;  1SG3 A;  3ACI A;  4QX1 A;  2B9V A;  2VCA A;  3T0B A;  4P02 B;  2W94 A;  3DEC A;  4M4P A;  2J1R A;  3MV1 1;  3T2Q A;  3ACH A;  2KD7 A;  4IUG A;  2YC4 A;  3I2H A;  1CX1 A;  3WNO A;  3T08 A;  1UY0 A;  1NX9 A;  2J1U A;  1YQ2 A;  3P6B A;  3C7E A;  4AAX A;  1PMH X;  3A7Q A;  4UOJ A;  3ZM8 A;  1I5P A;  3SKJ E;  5CIS A;  3FN9 A;  4JX0 A;  1J83 A;  3POJ A;  4OYU A;  2XON A;  2VMC A;  3LPG A;  3WF4 A;  3ACG A;  2BGO A;  1PX4 A;  5C71 A;  4DUW A;  1O8P A;  4CU8 A;  4QPW A;  2ID4 A;  5B4X A;  3MV0 1;  1UX7 A;  2B4K A;  5FUI A;  2HLE A;  4DUX A;  4RN5 A;  3VDA A;  1UY4 A;  4XVH A;  2EIC A;  1W0N A;  1US2 A;  3GDB A;  4KI5 M;  1JHJ A;  2W5F A;  3C7H A;  3WF3 A;  2WBK A;  5LA2 A;  4DXS A;  1UMH A;  2WDB A;  3ACF A;  2DCJ A;  3D3A A;  5JXJ A;  4ET7 A;  3EB7 A;  2ORZ A;  2QQL A;  3OEA A;  4CUA A;  1CZS A;  3PUH A;  1CIY A;  1CZT A;  3CQO A;  3OBA A;  1SFP A;  1DLC A;  3MUZ 1;  2Y6J A;  3IAP A;  3VD7 A;  5LA0 A;  3HNB M;  2J1T A;  2J22 A;  1KEX A;  2VZ1 A;  3P1I A;  3GXU A;  3T0A A;  2W1W A;  1JZ6 A;  2ORX A;  4GZ9 A;  2C26 A;  2OKX A;  1W8O A;  1GOH A;  1H6X A;  1EUT A;  3WNN A;  3I3D A;  4BK5 A;  4MAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...