2QQKA

Neuropilin-2 a1a2b1b2 domains in complex with a semaphorin-blocking fab
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
568
structure length
541
Chain Sequence
PCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVYAPEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSMLYIKFTSDQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDLYDWLDIWDGIPHVGPLIGKYCGTKTPSELRSSTGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEWSPSAARLVSSRSGWFPRIPQAQPGEEWLQVDLGTPKTVKGVIIQGARARAFVRKFKVSYSLNGKDWEYIQDPRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Neuropilin-2
publication title Structural studies of neuropilin/antibody complexes provide insights into semaphorin and VEGF binding
pubmed doi rcsb
source organism Homo sapiens
total genus 122
structure length 541
sequence length 568
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00431 CUB CUB domain
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2qqkA03
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2qqkA04
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 2qqkA02
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 2qqkA01
2WYSA 3HNBM 5CKNA 4TTGA 5HXMA 3T2OA 4LPLA 1SFPA 2J1TA 3A23A 2Z4FA 2Y6JA 2DDUA 1JYNA 3IB3A 3K77A 3SKVA 3LEGA 4A4AA 2VZOA 2W91A 1JHJA 1GUIA 4MADA 2YB7A 5DN2A 3UETA 2QBXA 2ZEYA 3POGA 1F4HA 5DMYA 3MUZ1 1UZ0A 4ARYA 3LEIA 3SKJE 1IQDC 2B4KA 3ECQA 2VZSA 4A3ZA 2J1UA 3IAQA 3WF0A 2W1WA 2C9KA 2VZRA 3C7GA 4P00B 4RN5A 5LA0A 2PQSA 3I2HA 4Z2AA 2W94A 4IUGA 2YC4A 1YQ2A 1MPXA 4ET7A 2QQMA 3CMGA 2RVAA 4PT6A 1PX4A 3W5NA 2VO5A 2WDBA 4XUOA 5JR2A 4XUQA 3OEBA 2VM9A 2WZEA 1US3A 2JD9A 4JKLA 2ORXA 3CKHA 5B4XA 2EIEA 1UYXA 3HNYM 4DUWA 5JUVA 4BK5A 4DUVA 3WNOA 2VQTA 1CIYA 3SEPA 3WF4A 3A21A 1US2A 3LPGA 5JXJA 3T0DA 3POJA 4LMFA 3NJXA 1W9SA 4KWUA 1GQPA 3GM8A 4BK4A 1XNAA 4OMCA 2HLEA 4P08A 4D8MA 3I3BA 2JE8A 3ACIA 3I3EA 1GNYA 3DECA 1W9WA 4CVUA 5DQ0A 3WSOA 2WZ8A 4AAXA 3FHAA 3POFA 4MOAA 1W8OA 2DCJA 3JXSA 2VMFA 2VCCA 2QQOA 4XVHA 3CZJA 3IAPA 2C4XA 3ACGA 3OGSA 3DEMA 4QDRA 4OUEA 2QQJA 1H6YA 1JZ6A 5IYYA 5IFPA 2V5DA 1O8SA 3VDBA 2XONA 1CZTA 4MGQA 1KEXA 3BGAA 3NNGA 4MO3M 4PF1A 2ZEWA 2VZQA 4L0PA 1TVGA 4P5YA 3ZM8A 2C26A 4QDSA 1UWWA 5CYYA 3THDA 2OKXA 1OF3A 1NUKA 3ACHA 3HEIA 3DYPA 4QPWA 2Y8KA 3A22A 5C7GA 4JKKA 3WF3A 3UESA 2QQLA 1JZ5A 1OH4A 2ZEZA 1GU3A 5CKQA 4CU9A 4BJ0A 3U37A 1R64A 1XPWA 3K4ZA 4D0QA 5JXIA 3T0AA 1UYYA 1PMJX 4W50A 4ZY9A 1JYVA 2CDOA 2EIDA 3I3DA 1NKGA 3CZUA 1OD3A 4DEQA 2BGPA 3T2QA 1O59A 3WF2A 5F7UA 3KQ4B 1RYYA 2YFZA 1JYWA 2WBKA 2W9XA 3T08A 3OGRA 4AG4A 2E31A 2VR4A 4DXSA 1EUUA 5EJ1B 1JU3A 2HYXA 2WN2A 4PQQA 1XC6A 2ID4A 3I2JA 1CX1A 5LCWL 4XURA 1WKYA 3EYPA 5LA1A 2VZPA 3K4DA 1UYZA 3NRUA 4XUPA 3P6BA 2WO3A 4BXSV 2VCAA 4M4PA 2BZDA 1NX9A 1I5PA 2RJ2A 2VL4A 3WNPA 3FN9A 3MBWA 2W95A 3PUIA 5JXGA 3C8XA 4A41A 3WNLA 2E33A 2LW8A 2ZXQA 1OT5A 4MGSA 2YG0A 3C7FA 4LKSA 4XUNA 2WO1A 2EICA 3C7EA 4OMDA 3DYMA 2VZ3A 1SHWB 1DYOA 3WQBA 3AC0A 4A45A 4ZXEA 2J7MA 3VD3A 5G05L 2E26A 4ZZ5A 5I0DA 3FHQA 1F4AA 3VD5A 2J1AA 3A7QA 1K45A 1JZ2A 2Y64A 4JKMA 3CQOA 3K75B 2EIBA 5IHRA 1K12A 4KMQA 3LE0A 2BGOA 1UXZA 5CISA 2W46A 1UY3A 3K4AA 4LHSA 1SPPB 2W87A 2KD7A 1O8PA 2XHNA 3OB8A 4GWJA 2VC9A 4JHZA 3VD4A 2W1SA 3PUHA 3I2GA 1JZ4A 3T0BA 1UMHA 2VZVA 3K46A 2W1QA 5LA2A 5CZKA 2XQXA 5CKMA 3WNNA 3HPNA 1PX3A 2J1VA 3IIIA 4QAWA 5FUIA 2VCBA 3C7HA 2QQNA 1K3IA 4FI9A 3WEZA 4CU8A 1H6XA 1W8NA 4HG6B 4BDVB 3MUY1 1W99A 1L7QA 1JU4A 4A6OA 2VQUA 4KI5M 4RYDA 3ACFA 2L9LA 3CIHA 4DXRA 4QB1A 3OG2A 2J1RA 4UAPA 2WO2A 2X09A 4UI9L 4LQRA 3P1IA 1J84A 1BHGA 3MV11 2VJXA 4GWIA 3E1F1 3J7HA 3MV01 3WNMA 5G04L 2VMDA 2E32A 1NAEA 4LOTA 2ZEXA 2X10A 3F2ZA 1LNSA 3HOBA 1JYXA 5HPOA 1NT0A 4LORA 2ORZA 2VMCA 3C7OA 3HN3A 1NZIA 1UY1A 3LEKA 4CU7A 2VMEA 3MO4A 4W8JA 2VZUA 2YC2A 3T2PA 3EB7A 2LS6A 2RV9A 4JX0A 2WAOA 2V4VA 4TXWA 1ULOA 2VTFA 3HJRA 4DXTA 1CZVA 4UOJA 2WN3A 4E8DA 1UMIA 1JZ3A 2W47A 4OYUA 1UX7A 4P02B 1XNTA 3GXUA 1D7PM 4E8CA 4XUTA 2WNOA 4CUAA 2DCKA 3I97A 2J1EA 1SDDB 2W92A 1J83A 1P8JA 3HNMA 5DPNA 5EIYB 1KGYA 5JMOA 3W5MA 3OGVA 5A1AA 2J1SA 3FL7A 3I2KA 1UY2A 3T09A 2YFUA 1PMHX 2W5FA 2WUHA 5JXHA 2W1UA 2W3JA 1L7RA 3GDBA 5B4NA 5C70A 3ETPA 1OF4A 1JZ8A 1WCQA 4QX3A 2WABA 2VOTA 3VD7A 1ULPA 3VDCA 4QX0A 1GOFA 3SEEA 2B9VA 2Y6HA 1JI6A 4QB2A 2QQIA 3THCA 2JDAA 1DLCA 4QB6A 2X05A 5IFTA 3OEAA 2VZ1A 3I2FA 1TG7A 4QX1A 3UNPA 1UY4A 4QDQA 3D3AA 4M4RA 1CZSA 1W9TA 4GZ9A 4CU6A 1HN1A 3ABZA 1T2XA 3BN6A 4A42A 4DEVA 3LQCA 3IDAA 1GOHA 3WNKA 3VDAA 3GGLA 4CUCA 4ARXA 2WQ8A 2JKXA 5EJZB 1SPPA 4ZZ8A 1W0NA 2V72A 1GMMA 1K42A 2XOMA 4CUBA 3POEA 1UY0A 4XZUG 1SG3A 3POBA 1GOGA 3NQHA 2Y6LA 3WF1A 2Y6GA 4YPJA 2J22A 4QX2A 4DUXA 2R7EB 2VZTA 2CDPA 2WAAA 4A44A 3I2IA 3OBAA 3VD9A 4OZOA 3NJVA 2Y6KA 2BBAA 5J1XA 3CDZB 1EUTA 4LOSA 2BERA 3DYOA 3POIA 2QQKA 1DP0A 1UXXX 1JZ7A 3LPFA 1SZBA 5IJRA 4W4ZA 5C71A
chains in the Genus database with same CATH superfamily
2GH8A 3IZOA 3RZHA 3MIFA 4MHUA 2JDPA 1C5HA 3T2OA 4I2OA 2J1TA 1R1A2 3A23A 4CDXC 1DIWA 3OY8B 2Y6JA 3PDQA 4IGPA 5DZFA 4HFSA 3UKNA 4CCLA 1EPWA 5GLUA 3S7IA 4AZZA 4CEYA 3K77A 3KGLA 3KVAA 1CJPA 1OA4A 4HBNA 2C9AA 1HJGA 1RUE1 4A4AA 2BDRA 3BUCA 2XJUA 2ZGRA 3D6EA 3ZR5A 3AP5A 2ARXA 3QACA 2C6SA 5DN2A 4LUKA 4LIUA 2AACA 3SCGA 4QGLA 4DZGA 5J98B 4AEKA 3MUZ1 1XE0A 2VMGA 3LEIA 3OBRA 4QM9A 3SKJE 1QF3A 1QEXA 2RS13 5FK7A 4A6SA 2A6WA 2NZ9A 2XLAA 3IAQA 2BFUS 2W1WA 3R6SA 1OVSA 4XZPA 2OZ6A 2PAEA 2ZX3A 4WVZA 2PQSA 3B69A 2D6MA 2JDKA 4R9AA 1MS8A 1DHKB 1O6UA 1E5SA 2DYCA 2YC4A 3SISA 3HT2A 3ZXEA 3KV5A 3GZTB 3I59A 4Z8BA 4CRQA 1F2NA 1QJX3 1UOFA 1QNYA 1Z7S2 2OA2A 4LE4A 3J7MA 1OURA 4FSJA 1UZVA 1PX4A 4OUSA 1BCXA 2VO5A 2WDBA 4LIVA 2QVSB 4XUOA 4XUQA 2JX9A 5FTTC 3ZSMA 2V73A 5ANNA 4KL1A 2WZEA 1CJDA 4AFCA 3LA7A 3BU7A 1PVC3 5FZHA 2JEMA 1BBT1 1RUD1 1NLRA 5B4XA 4XE9A 2YYOA 1BKZA 2EIEA 2WNUA 2BRTA 3FE5A 1NYWA 3HNYM 3KGZA 4ISRA 3TOJA 4DUVA 1I1EA 4D7SA 3WNOA 2Z69A 5F3IA 1YLLA 4GB33 5E16A 5F2WA 2VQTA 1CIYA 5CEHA 3WF4A 3A21A 1RUH2 3KCYA 1POV1 1VBC2 4LO5B 2WJSA 5BNNA 4JZRA 1US2A 4L11A 2RMU2 1AYN1 2F4PA 4L2NA 4YVWB 4R4ZA 3VV1A 1B35C 4OHZA 3RS6A 1HRV3 5LASA 2LTNA 2XVLA 2P5BA 4AVAA 2JE8A 3I3EA 4NUBA 4MYEA 3BIEA 1OI6A 5DQ0A 2WZ8A 1ND3C 1GICA 1ULDA 1S0GA 3POFA 2WFPA 4LR4A 3J8F2 4LXLA 1W8OA 5FZFA 2DCJA 3JXSA 4XF3A 2VMFA 4LHNA 1OC1A 4XVHA 1DQ1A 3IAPA 1RUJ2 1U0AA 3HMYA 3OGSA 2VCMA 1SLBA 4B29A 2A6VA 1DGRA 1HKDA 5FREA 3K48A 3W9AA 1EAH1 1UNBA 3CNAA 2R041 3UGGA 3H3UA 4MUVA 5HBAA 2BVBA 1JZ6A 3OYWB 4E4HA 1O8SA 4PBPA 3VDBA 3JUUA 2XONA 1CZTA 5M0TA 4DRRA 4XFHA 3HT1A 3MFCA 3NNGA 4IERA 2VTXA 4MO3M 5BNQA 3S57A 4PF1A 1FOD1 1Y4WA 2XKPA 5IW0A 1D4M1 4RHV1 1AYM1 1BXHA 1NCQC 4QPIC 1PK6B 3O12A 2XMLA 1XSRA 3JQWA 2LROA 4P5YA 1H1IA 1W3XA 4AL9A 4TZDA 2NQYA 5JI7A 1UWWA 5JCTA 1QJU3 4J1XA 5CYYA 3THDA 2V4AA 4FAHA 5FWJA 1WW6A 5A80A 2GH2A 1HDKA 1NUKA 1F5FA 4R9CA 5CIRA 2YY1A 3HEIA 1CAVA 4QPWA 5TSWA 3AL6A 1MQTB 4HSJA 3M8LA 1NQJA 5T3NA 2I74A 4HVQA 1UL9A 4XQDA 3AKRA 3KV4A 1U5YA 4IEZA 4PF5A 2ZEZA 3ZPOA 1M06G 4L99A 1SBFA 4CU9A 2RE9A 5K4LA 2ZGKA 4DY5A 5JXIA 1XE7A 4X8NA 3HVDA 4RQPA 1O7FA 1TZOA 2G9FA 4Y1ZA 3ZDSA 2HWC1 3EBRA 3O1RA 2ENRA 5FY8A 1IS3A 2EIDA 4HPKB 4M3CF 4CP9B 1I5ZA 3BALA 1ZREA 1WD4A 4DEQA 3FFZA 4LLOA 5F7UA 3ZOIA 1CQ9A 3KQ4B 1RYYA 2YFZA 5F3GA 5FZLA 5A3OA 4Z07A 1NA1A 1PGW2 2BYVE 4FPGA 1MR5A 4LKDA 4QHOA 1XQNA 2QFEA 4LJHA 4AG4A 2DVFA 1KITA 4FFHA 4DXSA 2VNGA 1E5IA 3BYWA 5JDBA 1MVEA 1ZBE1 2XDVA 5EJ1B 2BOIA 1JU3A 3MW4A 4PQQA 2Y26A 3IPVB 1URXA 2OPWA 2OXBA 1XC6A 2WT2A 1OOPC 2ID4A 3S5QA 3P3NA 5BYNA 2UURA 5K7PA 3AJZA 2BOJA 5FQ0A 4FVVA 3ZXGA 1XYOA 5EJ3A 3U4SA 1S2EA 2RR11 3FZ3A 4N43B 3PNAA 4U2AA 2WO3A 3WP3A 2QQUA 4BCUA 3HR9A 1JUHA 3W21A 2ZAAA 4IETA 1VRBA 4EN6B 4WVMB 1MEC2 1FNYA 2PHFA 3FN9A 2DTWA 2LUWA 1AXKA 4NWWA 4ASKA 2I2SA 3MW2A 5BNOC 5FUNA 4FQ4A 2VOXA 2ZX1A 4CZSA 1G9FA 1OT5A 2XR4A 2Q4SA 3B00A 1DGLA 4TSVA 3NMBA 2BNOA 3C7FA 1JBCA 1V6KA 4NAMA 4QU2A 3U75A 4AI0A 4FPJA 2ZACA 4AEMA 4OMDA 3WD5A 3VKLA 1H4GA 4XACA 3AC0A 3BCWA 1MS0A 5GZEA 3LFIA 1PNGA 2RS53 1K5JA 1NXMA 5AC91 4GKXA 5FKCA 5FPXA 5DG2A 2J7MA 4AHZA 4PI0A 3RVHA 2AENA 2E26A 4ZZ5A 5I0DA 4GH4B 5A33B 1IS6A 3AYDA 1AR63 1HX6A 4LBKA 4A2UA 2JKBA 1JMUB 1OKQA 3GNEA 1N1VA 4JAAA 3ACLA 5EWSA 2JDHA 2CHHA 1JZ2A 1RMU1 4CDWC 1DBNA 2Y64A 2D6OX 2HKXA 3K75B 5D8AB 2EIBA 3PUSA 5FYIA 4DFSA 2PHWA 4KG8A 1GANA 2D6PA 1G9AA 1EV11 3U10A 3U07A 3NVCA 3H3ZA 5JZGA 1FMD2 2BGOA 2UWBA 4QQOA 2W0XA 1RVF3 2PHLA 3JD71 1SPPB 2VG9A 2WINB 4XAEA 5FMDA 4CE8A 1BEV3 1AR83 3OB8A 4MSVA 5DAWA 2B7YA 5GM0A 1S0JA 2AEYA 2XBO3 1TMF1 2P34A 4JHZA 4S2HA 4XTMA 3AMMA 3I2GA 3PUHA 4NN0A 4LKFA 5FYTA 4IE7A 3DXTA 1CWPA 1UMHA 1VB4A 3PVNA 4XDOA 1X82A 5FOBB 1S4CA 2TNFA 4IEQA 5E89A 1PX3A 3FC0A 1RB8G 3SC7X 1QJX2 3CF6E 5ERLA 5A3TA 1QOTA 2P6CA 4COWA 5JR7B 1HB4A 4CP2A 5DUVA 1CN1A 2D3SA 2PHTA 1K3IA 2CGNA 2BU9A 2HBUA 4Q2FA 5FXWA 5L19A 1H6XA 4JGZA 1DYPA 1VAKA 4BDVB 5FZ8A 5K0UC 3HBZA 1W99A 4QHBA 3AFGA 2VNRA 3GHMA 3ZMNA 1QJFA 4PLNA 2YDEA 4A6OA 4BYYA 4LUMA 2L9LA 4DXRA 4Q4W1 3GBFA 2F6BA 1KDMA 1LULA 2FD8A 3DKQA 4HMZA 1H2MA 1IPJA 2WO2A 2X09A 1YFWA 3H7JA 5A32B 1WBLA 2R063 3B7MA 2AC1A 2PHDA 3JBG1 2ZPXA 4JTOA 3E1F1 4MXWA 5A7QA 1CAUB 1HRV2 4Y24A 1UPIA 5FZMA 1QIQA 4DINB 2ZHMA 2G9ZA 5I93A 3AMHA 4Q0QA 1LNSA 4EWEA 1WWYA 2A3YA 1UIKA 1UOGA 4JGYC 5HPOA 2ORZA 2VMCA 3AKPA 4UW6A 1MZ6A 3LEKA 4Y1VA 2X8KA 4AW7A 2VMEA 4YM3A 3IM0A 3IDEA 3THPA 3LSEA 4EN9B 1ZM1A 4TXWA 2CAUA 4B1MA 3H1MA 4E27A 4XFCA 3HJRA 4CP9A 1XYNA 2WKKA 2VU9A 1RUF1 4B3NA 4IE4A 2WC2A 1BVP1 1HLCA 2JDMA 4Y1UA 2IVJA 3AZWA 5FYZA 3ZO0B 2WN3A 2R072 1HXS3 1K5MC 1UMIA 4JCKA 5HCBA 3MW3A 5FZOB 4WBBA 2W47A 1JZ3A 3ILNA 1B35B 1GZ9A 1ND2A 2YGMA 3D82A 3P3PA 2DFBA 4LO8A 3VKNA 3VZJA 3IPVA 4QGNA 2R16A 5D1IA 3WDVA 5K9YA 2RDRA 2IC1A 1AL0G 1AR72 1RUG1 2J42A 1RUC2 3VBOA 3FLPA 3BTYA 4NRMA 3HAGA 3P5BA 1QY4A 1POV0 3FL7A 3I2KA 1QJU2 4COYA 1RUE3 3DPRA 3M1HA 1E5HA 3KM5A 1H8VA 3WW4A 4HK9A 4K3UA 3NWKA 1YQCA 2GNDA 1J1TA 4XMAA 1IOAA 1KXGA 1PMHX 5LK5A 1VAVA 2SBAA 4IE5A 2A3WA 5IWFA 4HOOA 2IFWA 1DLLA 1Q3EA 3PIGA 3PTYA 3ZR6A 1WBFA 2B9UA 4BLIA 4A7YA 5B4NA 5C70A 2QQWA 1OF4A 4CP1A 1WCQA 4QX3A 1GP5A 1GP6A 5F6LB 1KFXL 3RZMA 2VXJA 2QQVA 2BW8A 1NCQB 1LOFA 2BGCA 4QPIB 4QX0A 1WMEA 2FDIA 2B9VA 4E4SA 4CXYA 1W0PA 2ARBA 3NNMA 4MGTA 1F9KA 4XFGA 2QQIA 2WFF1 3THCA 2WA3A 5AFEA 1S0BA 4IW3A 4M0HA 4ZHNA 4Y1YA 4D7YA 1S55A 2X05A 3USSA 4C91A 1OQEA 1ENRA 5IFTA 3EXUA 3RI8A 2VZ1A 1AR91 4GH4A 1TG7A 4ATFA 4QX1A 2PLV2 4XAAA 3WDYA 5FY0A 4M4RA 2CL2A 5A3WA 1VIWB 4GULA 4AQ2A 1HRI2 4IEVA 4NHKA 1BK1A 1BBT3 1RUD3 2OW4A 3T2TA 3QCWA 2XH6A 5FBZA 4BM8A 4J25A 1MZ5A 1OXCA 4Q4X1 5GJ6A 4DEVA 3VBHA 1AHSA 1GOHA 4CEWA 1FAYA 1POV3 2OUJA 3GGLA 4G4FA 5FZ0A 3ZN6A 4GWMA 2FZ2A 1SPPA 2JKXA 2ZGOA 1G9BA 1AYN3 4FPCA 3VBSC 3KWVA 1O5UA 2ZABA 4CDXA 3O1OA 1W6MA 1GMMA 2XOMA 2D43A 1AX1A 4PI2A 4CXWA 5JOZA 3ROUA 2DCYA 3Q8BA 3POEA 5A3LA 4DO0A 5LATA 4ZONA 2A7AA 3DCQA 4UYBA 3SH5A 3M2MA 4Q0UA 4RL7A 3POBA 5FYMA 2Q8CA 4W6XA 1CVNA 2Y6LA 4BQ3A 2IXLA 2DBNA 1HQWA 5GLZA 1VMJA 3KF3A 4DUXA 1DQ2A 1OOPB 2HH9A 1DZRA 4UF0B 3T4VA 2CY6A 5F5QA 1OLRA 2VZTA 1H9WA 2ARCA 4PJYA 4A44A 1OA2A 3M3QA 2RS52 1HV0A 1OUXA 1VALA 1EAH3 5IT6A 2R043 2YBPA 4OI4A 5LB6A 1XNCA 3CL1A 1TNFA 1ZZBA 5GLVA 3U0ZA 5GLWA 2DCTA 2JB4A 5C4WC 2FDGA 1LJ7A 3POSA 4FO9A 4Y5TA 1LOAA 4XJZA 4CDQC 4EJRA 1AR62 1BLZA 2GN3A 3ZFGA 3ES4A 3RZKA 1FOD3 2LRPA 1V6JA 1H2KA 4RGGA 1D4M3 4RHV3 1U5ZA 3AMPA 3POIA 1AYM3 1DP0A 1PIV1 3S5AA 1MVQA 3TB0A 1SZBA 1V9U2 1HB2A 3PMEA 2R49A 3ZXAC 2WNVC 2WYSA 3HNBM 2HWE2 4INDA 4NIIA 5CKNA 4BQ2A 4TTGA 1RVF2 4XFAA 5I0RA 2Z4FA 1TME2 1AR82 5IVEA 2XBO2 1QJY1 3IB3A 3NL1A 3SKVA 1CX4A 4RR3C 1WW4A 2E53A 2D40A 3Q9OA 4BB3A 2NMNA 2PN5A 3MEPA 2VH9A 4YRDA 4BE3A 1YHFA 1CESA 2VZOA 2W91A 1YFUA 1PK6C 4LE3A 3J7NA 1GUIA 4ORFA 2YB7A 1B35A 2JE9A 4CDWB 5KC5A 1C4RA 1F4HA 2VVDA 2VTXJ 1W6OB 2IVIB 2BBVA 1WA6X 1SCSA 2HWC3 4OQ9A 1S2KA 1IQDC 3LDRA 2G4IA 1GWLA 4CCEA 4DOUA 1W6PA 3WF0A 4B4PA 1ND3A 2C9KA 2VZRA 3UKTA 2DWRA 4W6WA 5LA0A 4FPKA 1D2QA 3SLIA 3G6JB 4WM7A 4H3WA 5ABJA 2PHUA 2W94A 5FLIA 5LRRA 4ZXKA 3TEZA 4B7KA 1YQ2A 3FBMA 4H7LA 3HBKA 1ZBE3 1ODMA 1OPOA 4K1YA 2EVXA 3OPTA 2G1MA 4YARA 2OS2A 2MPFA 5JR2A 4AHYA 1WMXA 5D2AA 2MEV1 3RG0A 3ZXJA 1SQ4A 3MPBA 4KU7A 4XC9A 4XPVA 2JDZA 3WUDA 4BMEA 2JD9A 2RR13 4JKLA 2BPA2 2ORXA 5JOXA 3MI8A 1OSGA 2EALA 1NCQA 4QPIA 4R9BA 3PURA 4BK5A 3VBUC 1ST8A 4YW3A 5K0UB 1UW8A 3SEPA 1Z78A 3KQRA 3CJIA 3WQ7A 1GYKA 2XWBB 2WLQA 2HJIA 3FBYA 3EQEA 3JB4C 3LPGA 4BIOA 5A6ZA 3T0DA 2P4EA 1JYIA 1XE8A 5KXEA 5D21A 1LESA 4BH9A 5LBBA 1JODA 1RIRA 2XKOA 3NJXA 3DKWA 1HXS2 2DUPA 4QM8A 3NV3A 5HXVA 1N1YA 1XNAA 3L2HA 4P08A 1V6IA 4R52A 1DZTA 4WZCA 3VBRC 2WL1A 5IVYA 4XBNA 4CVUA 3DECA 3IDCB 4YM2A 3WSOA 2P17A 4YSFA 4PIYA 1VR3A 5AC93 1OA3A 4JGYB 3KV6A 5FJKA 5FMCA 3RMYA 3RQ0A 2B46X 1FATA 3TN91 2FDFA 1W0OA 1O5LA 4OLLA 2VCCA 3M70A 1EY2A 5DAPA 2XUEA 5LBFA 2CGPA 2ET1A 1C1LA 2JD4A 3ACGA 1RHI2 1SFYA 1W2OA 3DEMA 1O3RA 3BPZA 3D8CA 1YRZA 4MHRA 2AEZA 2YXSA 1QQP3 3WOGA 1J1LA 1H4HA 1RMU3 3HD8B 4K21A 5LWBA 2JXAA 1LOGA 5IYYA 2V5DA 1K5MB 4XCBA 1OFSA 2BUKA 1EV13 4FXGB 1RJ8A 4XFIA 3O5SA 2H6BA 2PAMA 4MGQA 3V0AB 3BGAA 4TWTA 2ERFA 4KU8A 1N3QA 1W6NA 2EAKA 4WM8C 2NLRA 3AKSA 3JD73 5FXZA 3OTFA 3UT0A 4GIQA 4BZ4A 2BP6A 4K9SA 3PVBB 1OOPA 1TMF3 2VZQA 2DV9A 1XRUA 4Y3OA 2D98A 2Q8DA 3ZM8A 3WV6A 1ENSA 4QDSA 1DFQA 1COV1 4HL0A 3ZN5A 3ES1A 3M4FA 2OKXA 1OF3A 3ZFFA 2HEVF 1GLHA 3ACHA 5CU1A 2X5IA 5HV4A 3DYPA 1WCKA 1UPSA 4PLOA 3BB6A 4CCCA 2UYBA 2Y8KA 4XQWA 3LSDA 1APNA 2VBDA 3A22A 3RWKX 1WLWA 4NR1A 1OVPA 2Y60A 1ZZ6A 3NAPC 2C0ZA 1SLAA 5GKAC 1PNFA 1OLMA 5DDJ1 3LGRA 4QPGC 4AXOA 1WUVA 2B5HA 4CUGA 2EXIA 5KHIA 1RUD2 2NM1A 4IE0A 1GZWA 3OGGA 4B4RA 3MLKA 4BLJA 4D0QA 2JE7A 4RS5C 1W2AX 3T0AA 2ZX2A 2UWAA 5FY9A 1Q8PA 2BFUL 4IV3A 1UMZA 1RUI2 4N53C 4XDPA 1ZYBA 4I0WB 4Q4W3 5L36A 2XJRA 1NKGA 1WLDA 2E7TA 2HWD2 1AYN2 1SMVA 2XJQA 2BGPA 3CZUA 3PL0A 3GYDA 1O59A 3T2QA 2GALA 3JBG3 3J4UH 2DU1A 3WF2A 1ZRFA 5C8WA 5C3QA 1W05A 1Y9GA 4BQ4A 2WBKA 2W9XA 2WS92 1LB2A 1R092 3OGRA 5FZ7A 2WZPP 3SMHA 2VR4A 3FUOA 4YG6A 3I4IA 1CAWA 1RINA 3OBZA 3RYPA 5C9AA 5A70A 2WT0A 2HYXA 2WN2A 3I7DA 3GCXA 2VVEA 4BOWA 5DAQA 4AFDA 4AGVA 5JLVA 1W6OA 4YFWA 3VL8A 1U5XA 4YW7A 5LCWL 4FP2A 3EYPA 1FPN1 5LA1A 1RUF3 1YWKA 2B42B 3TNPB 4AVSA 3NRUA 4XUPA 2YGLA 4FPOB 1AF9A 4BXSV 3AKQA 3VBSB 5B2GB 4Q4Y2 2TBVA 4XDQA 2BZDA 5FR3A 4IGOA 4I30A 3MLLA 2A6ZA 5J96B 4AOCA 4CDUA 4Q8KA 3WW3A 3MIDA 2W08A 3PUIA 3DXUA 4O9EA 1YUDA 4OI1A 4A7ZA 5HV0A 3C8XA 2EF6A 4NIGA 2OT7A 3AVSA 1FOD2 1D4M2 2LW8A 4RHV2 3ZFEA 4QU1A 1OKOA 3SCFA 1CAXB 3VBFC 4F3JA 2JENA 3ZIWA 4MGSA 2JDUA 4PDWA 1RUG3 5IVJA 2HWB1 4LA2A 1D0GA 2WO1A 2WYFA 4NE9A 2EICA 3ZX7A 3C7EA 2VZ3A 3TEXA 1W90A 1VE0A 4A45A 2YUEA 4N8MA 3RJRA 4FP3A 1TNRA 4NMIA 3IKWA 5FYUA 4WVWA 2GDFA 1I9RA 2V09A 1E5RA 2DVGA 2WLPA 1HQNA 3EO6A 3B93A 2Q1MA 1EP0A 1BYHA 4AF9A 1HB1A 1GSLA 2VY0A 2RDSA 5C4WB 4YW5A 1YJLA 4HKOA 4LBQB 2ZAHA 4TLFA 1OLME 3VD5A 1AL21 1R1A1 2J1AA 3GZUC 4CDQB 3KHCA 3V65A 4ZPIA 4HK8A 2P3IA 1WGPA 3N4MA 1BZWA 2RJKA 2IXIA 1XOYA 3OPWA 1NCRB 4GKYA 4K40A 3ST7A 5FCCA 2SLIA 1K12A 3AXEA 3N7KA 1A6CA 4S2DA 5I0TA 2HWC2 5IATA 4KMQA 3DV8A 4O61A 2WFF3 2WNVB 5FZ9A 5T50A 2W46A 3LF7A 1QGLA 4P9LA 1PGL2 1WMDA 1H2LA 5J48A 4ES8A 2KD7A 1IS4A 1O8PA 4JHTA 2W2IA 5T5LA 5HI0A 5T5OA 2VC9A 1PGSA 1GWMA 2ZGSA 2ZMNA 1VBD2 1JZ4A 1AR93 1LR5A 1NY72 4O7XA 2D6LX 2VZVA 2YPJA 3K46A 2VMIA 2W1QA 1UOBA 2JICA 2VMHA 2XQXA 4HONA 3J26N 4K1ZA 2RM22 4M3CB 4QXHA 1SLCA 4RR3B 4SBVA 5FO7B 3PUQA 3WNNA 3K2OA 4NPMA 4D6SA 1ZBE2 2J1VA 1Q43A 4WZFA 1DG6A 1NE6A 3IIIA 1ULCA 3J7LA 4Q4X3 1VBE1 4GMP1 4XQ4A 3C7HA 5L9BA 1X33A 2BQPA 4AI3A 5BNPA 5IVVA 3RRDA 1H8TC 5FP7A 2QQNA 1L7LA 3ZYIB 1O3QA 1RUOA 4FI9A 2KR2A 2R30A 2RR12 2ZGUA 4CU8A 2VE1A 4LO7A 1W8NA 3N7JA 3FFQA 4JDMA 1XU2A 1BMV1 4N90A 5DXDA 1UD1A 2BJSA 3MUY1 4XF4A 2VW1A 4Y20A 1JU4A 2VQUA 5L9RA 4LO4B 4RYDA 1HQLA 4NRPA 2WA4A 2XVKA 4XJ8A 3OG2A 2J1RA 3RZGA 1PM4A 1QOOA 4PBOA 2QCSB 3GBWA 4IV1A 4MGIE 4AEDC 5C3PA 1MZEA 4LQRA 4UI9L 2AR6A 3M7AA 2RHPA 1J84A 1LGBA 1H2NA 2KM2A 1MACA 1LHUA 2ZGPA 5EPAA 3R4DB 2D5FA 1IGOA 1REEA 4FT8A 2WNEA 2ZEXA 3OGJA 1C3HA 3TWIA 4D3WA 4ZU7A 2OQ6A 3HOBA 1JYCA 2JWPA 2AREA 2YPDA 5LBEA 3ALQA 5J36A 5LW9A 2E7AA 2QUOA 3C7OA 3OY8A 3IMNA 2AYHA 1ULEA 1NZIA 3MGUA 4G3YC 1W6QB 1ENXA 1MS5A 1KJLA 2CNAA 4XJUA 3PLQA 1KFUL 1S0DA 2VZUA 2YC2A 3MO4A 3ZLIA 5F37A 1Q5OA 2RV9A 3VBUB 2RDQA 4O65A 2V4VA 5DABA 1ULOA 2IXCA 2VTFA 2P3YA 2VGDA 3MYXA 2B8MA 3WW2A 3GCWA 1Q8OA 5JIAA 1Y43B 4IEWA 1GZCA 1GZTA 1WMFA 2ZX0A 5L7OC 1PIV3 2AH2A 5APAA 5GLTA 5KHHA 4OHVA 3R0RA 1VRH2 1QJZA 1D2SA 4OYUA 1UX7A 4BMBA 4P02B 4JDNA 4E8CA 2WNOA 3ITQA 4XIKA 2K0GA 3VBRB 5KWRA 1CGPA 5JPMB 5IK7A 3OUIA 3T1MA 3AJYA 2P2KA 1P8JA 3NKGA 4OQ8A 1D4VB 1KGYA 1TMF2 2R32A 5A6YA 1QJY3 4LK7A 5JMOA 3KCXA 5KHKA 2BTVC 2DF7A 5K8SA 3A0KA 4V2VA 1U12A 3LDKA 4JTNA 3LFMA 3VBSA 4HN0A 2Z79A 2YFUA 4D94A 1KDKA 2KXLA 1IQAA 4FQZA 2OZJA 2W5FA 4IDZA 4DMIA 1W39A 2CWSA 1GWKA 3T4HB 3UJQA 1RJ7A 1F5JA 4COZA 4QKFA 4DPNA 2OVUA 4JQTA 3KT7A 1YNAA 5EFUA 2CTVA 2O8QA 4WM8B 3RMXA 3WHTA 4JC1A 4E9KA 4M01A 4Y4YA 3I2DA 2PXJA 2ZMLA 4JDOA 2FDHA 1GOFA 5F8PA 3SEEA 2BNNA 2FDKA 4QB2A 1WD3A 1WW7A 4QXKA 3B9IA 2C5DA 4YM0A 4YVWA 1QWRA 4QB6A 4OI0A 5ACA1 5CADA 4CA9A 1QQP1 2DFCA 2JG9B 4ZS3A 3OEAA 4HETA 2VPVA 1MS1A 2A70A 1UY4A 3WCRA 3RZLA 2MEV3 3VL9A 4LBQA 2ADEA 4AQ6A 1CZSA 2GC0A 2D3RA 5F32A 3NAPB 4GZ9A 2RS12 3JQXA 1HN1A 4QPGB 5CNAA 1LCLA 5LEJA 4KWLA 4CCMA 4MGKE 4FAGA 1H0BA 1J3PA 4F83A 4A42A 5F2SA 2F4LA 3LQCA 4QX8A 5FY1A 1QJEA 2VULA 4OFGA 3WNKA 4RS5B 3VDAA 2PYTA 1ULFA 3D5OA 3E6CC 4RFRB 4AEJA 4FOYA 4E4DX 3E5UA 4N53B 4ARXA 1ZA4A 2XHKA 5IVFA 1H9PA 4FFFA 2RS31 4D7TA 2CWMA 1K42A 2XJPA 3OYWA 4NHMA 4LBOA 1SACA 2YU1A 4YLZA 4RR3A 2K2SA 5EV7A 1V6MA 1YXWA 2R6QA 1S0CA 1UY0A 4QKBA 2IFRA 2VOKA 1PVC2 3L9JT 4H2AA 3WUCA 5JAXA 1PK6A 4QQHA 1MEC1 2ZGQA 5FAXA 4FTBA 3AFKA 3HIFA 3TN93 1RC6A 2E51A 1RUG2 4MZUA 4JV4A 5FZCA 1QXRA 3WQ0A 3MFAA 2R7EB 4GB32 4UFIA 5FLHA 2DURA 4DQAA 2W68A 4MGZE 2CDPA 3H8UA 1XNDA 2WNUC 1O3SA 1PO13 3B94A 3KS7A 3OBAA 1YQ8A 4I3GA 5FZ4A 4W65A 5KXCA 3GZAA 1MQTA 4OZOA 5FK8A 2DTYA 3WP4A 1NOVA 4YWAA 1J59A 4XF1A 4J6GA 1YI7A 3NNFA 3VZLA 3T30A 4Q5OA 4XXPA 4LOSA 3SQOA 2GMPA 4XHXA 5H9SA 3A0NA 5JOWA 3LPFA 4X8PA 3WDWA 4Y22B 2DVAA 2WO7A 3Q8FA 3VBFB 5C8CC 4W4ZA 1U5IA 3OUHA 2D3PA 1AZDA 5GZDA 3VHPA 3LEMA 5C71A 1F35A 4KNCA 1FXZA 4YG3A 4HPKA 1Q8SA 4QKNA 1COV3 2WFF2 3KMHA 4LKEA 5KR7A 1XU1A 4B7EA 5BXXA 1R1ZA 3MZHA 4AVCA 2DDUA 3U78A 2O1QA 1JYNA 1AR92 1CPNA 1FMD1 2QDRA 3H7YA 3LEGA 2VUAA 5BPXA 4E4ZA 4YW1A 3SHRA 2VQAA 4E2SA 5DDJ3 3WNXA 4N7UA 4LA3A 2RG4A 1S1AA 1S0FA 1JHJA 2QZ3A 3WG3A 4XFFA 4EN0A 1WCUA 3UETA 4Q4X2 2QBXA 2ZEYA 2ADDA 3POGA 2JIGA 1STMA 4Y26A 5DMYA 3V0BB 2OPKA 1UZ0A 3N7LA 1FT9A 4ARYA 4BHPA 3VBRA 1LKNA 2B4KA 3LCPA 2FCTA 2ZHKA 2VZSA 3N9LA 5FLJA 4N43A 3N35A 3B5LB 1KQRA 5FKBA 2WIIB 4P00B 4RN5A 1XB9A 4W6YA 1L3JA 1A34A 2GN7A 4YGDA 2WZR1 4WVMA 3ZXLA 3I2HA 3KSCA 2FQPA 1Y7BA 4CCDA 5FV3A 4KQ7A 1TE1B 3M3OA 5T5JA 4XABA 1IKPA 1MPXA 1UU6A 3FJSA 2Z5WA 2QQMA 3LIGA 1W8ZA 3PUAA 1HV1A 3N36A 5FZGA 3QH7A 3ZYJB 3I8TA 3B02A 3W5NA 3I3QA 1JS9A 4XCAA 3QH6A 2JDYA 1FPN3 1H8TB 1ZRCA 4XMIA 2DUQA 5FZ3A 1J3RA 4EV0A 4DUWA 4NO4A 2WR9A 4ONUA 3AKTA 4RQPC 4EE2A 1DQ4A 2DU0A 1HJFA 3O1TA 5E8AA 1ONAA 1ZVFA 3E5QA 5A33A 1LOEA 5DAXA 5GALA 5JXJA 1I3HA 3POJA 1YIPA 5F9TA 4HANA 1W9SA 5FMOS 5D8AA 3AYEA 4AEDB 1NA1C 1PIV2 5FXXA 3GM8A 3Q8AA 4BK4A 3LB9A 4GMP0 4HLTA 4EZ4A 5I8TA 1PMIA 2HWB3 1C8M1 3MPPG 4FOQA 2W52A 1BJQA 4D8MA 2DCZA 1QXJA 1X36A 3OOXA 4YZ3A 5H9QA 3Q8EA 3ZPYA 4C0HA 4E2GA 4DNYA 1Y9QA 2W39A 2R071 3H0OA 1FV2A 4MOAA 3FX3A 4BPZA 3AB0A 2QQOA 4K6BA 1QJY2 4IE6A 1OQDA 3CZJA 2LM3A 2UWCA 1YIFA 2C4XA 2VQ0A 3ZVXA 5EZWA 2NP0A 4UT5A 1W8FA 3N9PA 1AL23 1R1A3 2NMOA 3DN7A 4PLMA 1KRIA 3GALA 1AR71 1JW6A 2QQJA 3TYJA 1DDLA 1GKBA 5C6CA 5L7OB 1RUC1 4BU2A 3KT4A 1I6XA 3O7OA 4CP0A 2BNMA 4COUA 3PMSA 4LLFA 3B01A 3O14A 3ZSKA 5IVBA 4UFJA 1S2BA 1KS5A 5A3UA 1LGCA 5FZIA 4LT5A 2YC0A 1TVGA 4XTPA 3KV9A 5A7OA 1LOCA 1XXNA 2C26A 1Q8QA 2ETEA 3JCIA 1LHVA 1NXD1 5A7NA 4YW6A 1T6GC 5A32A 5I8SA 3BU0A 1NE4A 5JMCA 1CAUA 1NCRC 1VBE3 1VBA1 4GMP3 1JTZX 4JVAA 4NHLA 1TQ5A 5C7GA 1JYTA 3UESA 1Y9MA 2MEV2 1AXYA 4S2FA 5EYYA 1YQ5A 3LD8A 2A6YA 1DGWX 1KD7A 5CKQA 3UJOA 2G19A 5A3MA 3VN4A 3GJBA 4KGQA 1LU2A 4GXLA 3ENRA 1XNBA 1R64A 1XPWA 3U37A 1BEV2 2PLV1 4QQ2A 2O14A 4BJ0A 1UYYA 2GMMA 2PMWB 3A4UA 4GA9A 4IEYA 4ZY9A 1JYVA 5A7PA 5JZGC 2RJLA 4PHZA 1HRI1 3ATGA 5IAVA 5FPUA 1O4TA 2ZTNA 4BISA 4AFMA 3FWEA 3CO2A 1IHMA 4NIAA 1YI9A 1ZZ9A 5FPVA 5FZOA 2R1BA 1JYWA 3IBMA 1B09A 1QOSA 4FPLA 1W8TA 4YG0A 3RYKA 3T08A 2A71A 1VBC3 1WCDJ 4P9WA 3UKVA 5I8YA 5JI9A 1WLTA 4GJZA 4Q1PA 1RGSA 4YM1A 1Q56A 4XJ9A 3K51A 1ZZ7A 3GZEA 4L92A 1OHFA 4AVBA 4FPEA 3EMRA 4EN7B 4XXAA 4NVPA 3V0BA 3LOBA 1ASJ1 2OX0A 4HXCA 1EYBA 3OCPA 3E97A 1C57A 2HWF1 1J3QA 2NPIA 3I2JA 4DRVA 1YEWA 1ODNA 4IEXA 1HN0A 2VZPA 3SCHA 2EIGA 5A3PA 1LEMA 1UYZA 4K8FA 3R4UA 2CSGA 3M3EA 4MGYE 4BQYA 4XOGA 2PA7A 4COVA 5FDBA 4IEOA 2R062 2VL4A 3H1WA 4HKLA 2N7GA 1O3TA 3WNPA 3S30A 4QPYA 3MBWA 1LODA 4NHXA 3USUB 1DGWA 3FLTA 1Q8VA 3PTRB 4PCRA 1F8VA 4TLGA 3WNLA 3BPSA 3I59B 3BODA 2E33A 1ZA7A 4RSUA 3BTXA 1CONA 4YVSC 2WT1A 4LKSA 4Y1XA 5E1RA 3BOWA 3KCCA 4BWOA 5JIUA 1BQPA 4I02A 1WW5A 3CBNA 3DYMA 1SHWB 4CSWA 1DYOA 3WQBA 5EP9A 4KBZA 4DS0A 5FWEA 4C0BA 4ZXEA 2Q8OA 2VVFA 1V9U1 2TUNA 2WNUB 2GC1A 5FPZA 1X7NA 2VW2A 3VD3A 2XWJB 3AZVA 2HWE1 4KH9A 3EJKA 4CYDA 4UW4A 4HZFA 4XJWA 2QDNA 5FZDA 3VKOA 5BV6A 1TME1 1R081 3A7QA 3AMNA 3IWZA 4AEDA 2GZWA 5H9RA 1AX2A 4LBLA 3CQOA 1SBEA 5IHRA 1YCIA 3APBA 5FYVA 1ZRDA 4CDXB 1DQ6A 4YZ1A 4I0BA 4OI2A 4Q4V1 3AVRA 5C8CB 4Z82A 1DU3D 4QX7A 5FYHA 2YROA 3LE0A 1LTEA 3BOPA 5CISA 2JG8C 1C1FA 4LBNA 3FUQA 1RUE2 4LHSA 2A1XA 2W87A 1WCSA 3MIGA 2XHNA 1SEFA 1PO11 4EWDA 4GWJA 3VD4A 2W1SA 3VBOC 3M3IA 1SLLA 4K20A 3T0BA 5KXDA 4OCTA 1IPKA 5FPAA 5LA2A 4Q29A 4MLOA 3DPRC 1OD5A 4P5HA 4LHKA 4YGBA 1GR3A 3HPNA 3WT3A 5L7OA 1ACCA 3TEYA 1DF0A 5FUIA 4C1XA 4S2GA 4BXFA 2VNOA 4QX5A 3RSJA 1ZZCA 4UF0A 4UFLA 2QKDA 2YZ4A 3WZ1A 4M0NA 2EA7A 4L97A 1NQDA 1GBGA 4ZU4A 1HB3A 4Q1RA 3AZZA 2JG9C 2RS33 4YGCA 5CFDC 4NIDA 1NLSA 4RD7A 3VKFC 2P3JA 2FCUA 1LENA 3H3LA 5FOJB 5KC6A 4AK3A 3NW4A 4QMAA 4KI5M 1NG0A 3CLPA 4URAA 4AHXA 3CIHA 3DF0A 2P6HA 2VD7A 3KD4A 1QDOA 3MIEA 2D97A 4FPYA 5CA6A 3WY6A 5BNOA 3I3MA 1BBT2 5C5TA 3B3QE 4V1PA 1W28A 5JPNB 3WNMA 1MEC3 2VJXA 1CAVB 1ZX5A 2ZGLA 1CPMA 3AL5A 3J7HA 3MV01 2VMDA 4GWIA 4QXCA 5G04L 5IVCA 1NAEA 2HWB2 3AYCA 3LIHA 4NAOA 3ZDVA 2EXKA 4DXZA 5L9VA 3SXWA 4EZHA 2FHRA 2IXJA 4SLIA 3LKJA 1GP4A 2PHRA 2QE3A 1GNZA 1NT0A 2E63A 3LA3A 1O4YA 4IEUA 2RDNA 4LORA 1OLQA 2EAAA 1YO8A 3VBHC 4CU7A 4NROA 3LOIA 4CEWC 4NPLA 3GHNA 4RQPB 2PHXA 2LS6A 1WLCA 4JX0A 2BWAA 1G9CA 4M00A 4QWNA 1N1TA 2BWCA 4GALA 3PU3A 2R0HA 2VOWA 1CZVA 3H1YA 1AL22 5FZEA 4FPFA 4UOJA 1UKRA 4EQVA 3HN1A 3ZMOA 3SNMA 1QH7A 5JSPA 3MIHA 5FP4A 1J58A 1FI2A 1JUIA 3KLSA 3ZYRA 1NA1B 4CDWA 4QHZA 3VZOA 2I07B 3WDXA 1O91A 1D7PM 1RHI1 1YFXA 2WQZC 1A8DA 3I97A 2X29A 2J1EA 1SDDB 2GC2A 4Q8LA 2YV8A 1ENQA 5CB7A 2W92A 4KBBA 3PHMA 1XSQA 3HNMA 2UU8A 1EAH2 2ZA9A 1OMIA 2R042 5KXBA 5JVVA 4JRLA 5L73A 4AI2A 1FMD3 1YJKA 2JJ6A 3OGVA 5FQ0B 1XJAA 4FBFA 3ZIXA 1UY2A 2GSYA 2YMZA 3T09A 1JHNA 1VBB1 5F3CA 1V00A 2IXKA 5F5AA 2VBPA 1AYM2 3IT8A 3MIBA 3RPQA 1VBE2 3E5XA 5ANQA 3USUA 2AUYA 5CAZA 1TEIA 2W3JA 3UL2A 5JXHA 3WG4A 3N7MA 3GDBA 3ZFGC 1FV3A 5FZKA 1PO21 4JRAA 3ETPA 2Q1ZB 3AZYA 1ZBA1 4OHWA 3LWCA 2VOTA 3DL3A 1GQGA 1QHDA 3OBTA 1BMV2 4NPRA 2V5YA 2WZR3 4FPHA 5K0UA 5FIXA 4ITCA 3O1VA 3ELNA 4QGMA 3ZYBA 4ATEA 2UY9A 5KHGA 4UW3A 2A6XA 3ZKUA 4C90A 2ZOEB 2FMDA 2ATFA 4GJYA 4O9GA 2FZ1A 4U36A 3I49A 5FUPA 1WA4A 5FZAA 1F15A 3JB8A 3I2FA 1RUI1 2BV4A 3UNPA 4K8RB 4QDQA 3I2OA 1LEDA 3MF6A 5SV8A 5HCAA 3AP7A 1W9TA 2CYFA 2HWD1 3FHIB 5FJHA 4P14A 4A7KA 4CU6A 2I45A 2VBBA 3ABZA 3R4SA 1F31A 1LRHA 1C28A 4JGYA 3WXPA 5F39A 2WS91 1R091 4YGEA 3VKMA 5C8CA 5FZ1A 5A7WB 3T3YA 4FOVA 4AI9A 2NN8A 5DUWA 4I0AA 5LZ6A 4RGAA 3OD4A 5JZGB 4IXLA 4CUCA 4J1WA 2C24A 2WQ8A 3QLQA 2XQRA 4Q27A 5EJZB 5A6QA 5JSRA 3KT1A 3AYAA 4ZZ8A 4FTEA 5C33A 1W0NA 4NIHA 2V72A 1LHOA 2ZGMA 1K5MA 2NYYA 2Y6FA 4WM7C 3WCSA 5ABJC 1C8M3 4LTAA 3V0AA 5KBFA 2D6KA 3SITA 1YQ6A 1SG3A 3N9NA 2ZCWA 4Q4Y1 1GOGA 2R073 2Z42A 3VDDC 1Z7S1 2KA3A 3WF1A 2Y6GA 4GQ7A 4XF9A 4B4QA 1UX6A 3D4KA 2J22A 2EXJA 2K46A 2Q5TA 3NNLA 4QX2A 3VUOA 2GNMA 3NJYA 3X29B 2QQPA 4Q0PA 2AGSA 4XJAA 3NNJA 3CU7A 2Y0OA 5T55A 1W06A 3VGIA 2GC3A 1AX0A 2F17A 3CEWA 1QNWA 2WAAA 4KWJA 4Q26A 4XETA 5E6HA 5A1LA 5C3OA 5I0SA 5JWPA 1OFNA 1AR73 4JGZB 3I2IA 4OULA 3LDBA 4Y33A 2ZBJA 3HQRA 1RUC3 1SLIA 3PJYA 2XUMA 3NJVA 5DAVA 3CJIC 1RUH1 1VBC1 1PZ9A 2IWGB 2K9ZA 3CDZB 2CAVA 3H9AA 1EUTA 2RMU1 4HKWA 3AX4A 3PVOA 4HSLA 4IEPA 4BQXA 1JZ7A 3WR0A 1OH3A 1PZ7A 2WSVA 4P9IA 4QKDA 4MXWB 1DQ0A 1HW5A 4YVSB 3KF5A 5FP9A 3QBQA 2WSUA 3S0MA 4URTA 3KB5A 5HXMA 1SFPA 1W8UA 4LPLA 3E6BA 4B1LA 1JOPA 5CFCC 2BEOA 5ACA2 2XJVA 2PFWA 3J8F1 3SH3A 3H8OA 1QQP2 3WDTA 1XBFA 1LECA 5T54A 1RMU2 1VBA3 5LEKA 1OUSA 5J3UA 2H6CA 3M3CA 1RUJ1 2Q0AA 2CGOA 1M4WA 5IK8A 1PGL1 1EV12 3FMGA 3SH4A 4WVVA 2IXHA 3TBDA 4AGGA 1G9DA 4N7IA 3UK9A 1POQA 2JDNA 2JECA 2D44A 3JD72 4QQLA 1VBD1 4FFIA 1NY71 4I01A 4MADA 4OHYA 1W3VA 2PLV3 4NHYA 1ND2B 2RM21 5FYSA 4LITA 1MS9A 3WP6A 2MHFA 1HRI3 3ECQA 4XBLA 3W20A 4X6QB 4A3ZA 5DZGA 3NJZA 4AYUA 3W58A 2J1UA 3WQ1A 4CXXA 3C7GA 3VHRA 2JG8B 3ZN4A 2RS32 1S0IA 4TN7A 4AHWA 2ZKNA 2JIJA 1DZQA 1QXPA 4L8QA 3VBOB 4Q0VA 4Y5Z0 4Z2AA 4IUGA 3C3VA 4NOTA 3ZFFC 1IZ3A 1N3OA 5DZEA 3DPRB 5FP3A 4ET7A 3WG2A 2X5IC 3ZYGA 3GF6A 1C8NA 1CAXA 2GMEA 2RVAA 3CMGA 4PT6A 4X6RB 4EN8B 3ASIA 1ASJ3 2ET7A 5LRSA 3AP9A 3POYA 5SV5A 2CV6A 2HWF3 3BI3A 3CJXA 5ISLA 3OEBA 2VM9A 1HIXA 1XNKA 4AVVA 1G6NA 1US3A 4UFHA 1QKQA 4Q4W2 1N47A 3CKHA 3LAGA 1W9FA 1UYXA 2E7QA 2MNGA 4LBJA 5JOYA 3JBG2 4IV3C 4CEYC 5CFDB 5KHJA 4GD4A 5H9PA 2IZWA 4CCNA 3RNSA 5C4WA 3UGHA 4R8HA 4CDQA 4AQTA 1SDWA 2ZKLA 3GJAA 1UU4A 2XVGA 4LMFA 3MHZA 3C2UA 4CPBA 4KWUA 1GQPA 1FX5A 3VZMA 1PGW1 2ZGNA 1NCRA 2CU5A 4OMCA 1RUNA 2HLEA 2XL7A 1JH5A 3POWA 4R4XA 1X50A 3I3BA 3ZYPA 3K3OA 5AVPA 2WNVA 3ACIA 1GNYA 2HEYF 1W9WA 5C9AC 5T52A 3ZKYA 1RUF2 3HQUA 4ASMB 4Z2WA 2Y33A 4AAXA 5JUVA 3FHAA 1VRH1 4YNIA 4FOWA 1V9U3 5LBCA 5IK4A 5A7WA 4XBQA 4YYOA 1VMHA 3ZSEA 3VBHB 5JSOA 1D0HA 1W2TA 3R05A 4M3CA 1UIJA 3URFA 4CEWB 5GZGA 2HWE3 1LGNA 3ORJA 3ZN6B 5C3SA 4QDRA 2ZMKA 3AP4A 1IKQA 3O0WA 4OUEA 1H30A 3MDPA 1V6OA 3ON7A 1TME3 1R083 4LK6A 4V2WA 1W2NA 3EHKA 1H6YA 1W6MB 4MX3A 5F6KA 3WLUA 4NWVA 5IFPA 4A3XA 1BK0A 1BVVA 3DGTA 1UN1A 4Q4V3 2O8OA 5FY7A 4CDUC 4FFGA 4FCAA 1KEXA 1G8WA 2VECA 2UY8A 1UZWA 3GBGA 3D0JA 4KGGA 2GNTA 3LA2A 3W59A 1RITA 3OJBA 3ZFEC 5CG8A 2VUJA 3RZZA 2ZEWA 2XLFA 4PDWC 1SBDA 2YU2A 3KVBA 4L0PA 5A3NA 4H55A 2WZR2 4BQ1A 1AXZA 2O0OA 3J9SA 1LU1A 3N9OA 2ZZJA 5BNNC 3RGBA 1YYNA 3NSTA 2Y0IA 4XYXA 3TNQA 5FY4A 4MV2A 4MXVA 3PVEA 4KWKA 1E57A 2VUDA 1VJ2A 2ZHLA 4BQ5A 4AE2A 4HVOA 4BQWA 4MH0E 2PAKA 2HBTA 4JKKA 3WF3A 3VZKA 5FPLA 2WWSA 2QQLA 3ZFGB 1JZ5A 1OH4A 1GU3A 4HN1A 5CG9A 3VHOA 1ALYA 4JQRA 1UOJA 1W6QA 3K4ZA 1A3KA 4YVSA 2XJSA 1W8HA 1PMJX 2C1FA 3VBUA 1RTVA 4W50A 4AAPA 3ZYHA 5I91A 1G7YA 2GNBA 2YBKA 3JU9A 5T5PA 2CDOA 3IMMA 2RS11 3I3DA 5FPBA 2R1DA 3AK0A 3V56A 2OIIA 1OD3A 3VHNA 5CVRA 1NLQA 2GP3A 1XYPA 3H8XA 2PTMA 5F5CA 1PM7A 4UBHA 2OQ7A 1C8M2 1QH6A 3N9MA 1UQXA 2E31A 1EPZA 4B8EA 4ZKTB 3UYJA 2XLGA 1EUUA 2LALA 2X53S 2UYAA 2Y38A 4RFT0 1QJX1 4NRQA 4XF0A 1N3PA 1V6NA 1W2UA 3ZYFA 1V70A 4IGQA 4FXKB 2OYZA 1AVBA 1IG3A 2Q8EA 1X8EA 2BVVA 2YHJA 1Z0HA 4YZ5A 5BNPC 1CX1A 4M3CE 4XURA 1WKYA 1PVC1 4P9XA 4LULA 4QQPA 3K4DA 5BY5A 3TEWA 2JG8A 2XJTA 1W6PB 3P6BA 5EHDA 4OVEA 3AP6A 2D93A 1UZYA 1ND3B 2ES3A 3IDBB 2VCAA 4M4PA 1QDCA 1NX9A 1I5PA 2RJ2A 5FYBA 4GB31 4WV8A 2B45X 2ARAA 1X8MA 1RHI3 2WQ4A 4WM7B 5FMOL 5ABJB 2R0FA 2W95A 5JXGA 2ZJCA 3RDIA 2VXRA 4IV1C 1RXGA 3JZVA 4A41A 5FZBA 4XEZA 4WM8A 3U4XA 5FBJA 3VDDB 2PELA 2YBSA 2ZX4A 2ZXQA 3MLJA 3PJQA 1W9YA 4PQ9A 3WINE 4AR2A 1HRV1 2YG0A 1UU5A 2HEWF 5EXOA 4XUNA 3WW1A 3H8RA 1Y3TA 3FLRA 2GU9A 3H50A 2VAUA 4GAZA 2XL9A 1A78A 2QTWB 2ZZQA 4META 1LAJA 3AXDA 2EXHA 1UKGA 1UCXA 1VBB3 2XB6C 3K3NA 1PVXA 4UXAA 2JG9A 4LO6B 3KZ4C 3NO8A 4LNVA 5CFDA 3ZXDA 1VBA2 2FBEA 5G05L 5LY1A 3BTZA 1AJKA 4MG2A 3AMQA 3D0SA 3FHQA 1F4AA 4L9BA 4XILA 2D5HA 3CJIB 1GFF2 4AFBA 3NAPA 1YC61 3NV2A 1PO23 4HVRA 3S6PA 4AFAA 4CCOA 4RA0A 1UAIA 4QPGA 5DUXA 1K45A 1ZBA3 1OQ1A 4R9DA 4JKMA 4P9JA 3ME2A 3RYRA 4RS5A 3VLBB 4G9SB 1DYKA 4EROA 3AZXA 5FO8B 4N53A 1UXZA 4XW3A 3ZSJA 3O1MA 3G7DA 1AUYA 1UY3A 3K4AA 1CD3G 1DGRN 3CHXA 5FZ6A 4AWDA 1LOBA 4F7ZA 2QNKA 4RGKA 3WVJA 5CFCB 1GNHA 4AI8A 4NJ4A 5E88A 3S7EA 1IPSA 3WDUA 5I0UA 1RUI3 3HQXA 3INAA 3I54A 1SCRA 5BNOB 5CZKA 1WZXA 5LK7B 1QJU1 2HWD3 5CKMA 3H42B 3VB9A 4MVTA 4H14A 1UF2C 5A6XA 2P1BA 1MS3A 5GZFA 2WS93 1R093 4QAWA 3NV1A 1MZFA 2VCBA 1ASJ2 2WRAA 5FYCA 3BKZA 3WX5A 1ZZ8A 4HT1T 5IK5A 2HWF2 4YW2A 1DCSA 2ZHNA 1H1MA 2Y34A 3QD6A 1ZNPA 1W6NB 4PIZA 3ILRA 3WEZA 3DUIA 1RL3A 1ULGA 5GZCA 3Q8CA 4HG6B 4LBQD 4ZU5A 1V0AA 1L7QA 2VOVA 4I3PA 3ACFA 4I09A 4CPBD 4QB1A 1JOBA 4YVWC 5A7SA 4UAPA 4Q4Y3 2OUHA 4UW5A 5IUQA 3ZFFB 1Z7S3 1YFYA 2X5IB 3P1IA 3MV11 1BHGA 3OSDA 4Y22A 3VBFA 2WWJA 2E32A 3OF1A 4LOTA 4D6QA 4QT6A 5FP8A 4AI1A 2Q1FA 3RWNA 2X10A 3F2ZA 1SFNA 1SLTA 4E2QA 2DVDA 1JYXA 5ACA3 3VZNA 3HN3A 1GZWB 4BIFA 4EYUA 1UY1A 3ZXKA 1NZCA 4W8JA 5DG1A 3T2PA 3E6DA 1AJOA 3EB7A 4YZ4A 1RUH3 2A5ZA 2WAOA 4IV3B 4CEYB 2A75A 4P9YA 4UWDA 1O4ZA 4DXTA 2RMU3 3RZJA 3WP5A 1FYUA 2QJVA 2WWUA 3ILFA 4DB5A 3ZSLA 5J37A 1PZ8A 4YW4A 4C8DA 1R082 3L2YA 3RFRA 4E8DA 4PIXA 1ZRIA 5F1RA 3LZZA 1VPHA 3U14A 3THTA 3TN92 3MICA 4CTEA 1XNTA 4Q4V2 3GXUA 2ZGTA 4XUTA 4IL7A 4CUAA 2DCKA 2D7FA 3O1UA 1CIWA 1CAWB 1G86A 3NKTA 4XFBA 5A1FA 5C9AB 3HWJA 3AM2A 3ZXFA 2ZS6B 4JGZC 3J8F3 1J83A 1S0EA 3F95A 1PO12 2P3KA 5DPNA 2PQQA 5EIYB 1C5IA 4ZS2A 2E6VA 5F5IA 2E9QA 4OUMA 5J7MA 1RUJ3 3W5MA 5A1AA 1OPMA 2J1SA 3ETQA 2RS51 2H0BA 5FFOC 3V64A 3PIJA 1MQTC 5CBLA 2DBIA 1OBNA 1UO9A 1VBD3 2AZ5A 2WUHA 3KHBA 3QOPA 5IAXA 1REDA 4CCKA 4YZ2A 3O1PA 1JOJA 2W1UA 1QU0A 2QZ2A 5FYYA 1L7RA 2RM23 5DUUA 1AR61 3TRSB 2A3XA 4CDUB 4LHLA 1PHMA 1H8TA 4N9HA 2FCVA 1COV2 3VDDA 5AFBA 1JZ8A 1GV9A 2WABA 4ISQA 3ZFEB 2XPJA 1QMJA 4GWNA 3VD7A 4DIQA 1ULPA 4LEJA 3VDCA 4PDWB 1VMFA 3IIAA 1LHNA 1N1SA 2Y6HA 1JI6A 4UBGA 5BUVA 5FRAA 5FXVA 4CCJA 3U1XA 1X9TA 5BNNB 2JDAA 1RVF1 2DVBA 1IS5A 1DLCA 4Z92B 5DDJ2 5FMBA 1REFA 1BEV1 1AR81 3UGFA 2XBO1 1DQ5A 2Q30A 4OHXA 1ND2C 1ZRRA 2FMYA 1CR7A 3B9CA 2P37A 3D3AA 1VB2A 2FDJA 2GP5A 4LBMA 3RI9A 2Z2SB 1A8MA 3O0VA 3T1LA 1IG0A 1T2XA 3OUJA 4K7JA 5HCFA 4OZXA 5C3RA 4N9IA 4P9GA 3BN6A 4H7MA 1UZZA 1MS4A 5AVAA 5FO9B 3IDAA 4C1WA 5EYXA 4TYSA 2ILMA 3N3HA 4UFMA 1W03A 4EWAA 4N43C 4YFZA 3BVCA 1V6LA 5CFCA 1FNZA 3IN9A 1T6BX 4FTSA 1VAMA 5J09A 3RJ2X 1JXNA 3OD0A 4KG0A 5LA9A 2XG3A 4CUBA 1H1AA 2GAUA 3BTAA 4D69A 4AVTA 2XGXA 4DY3A 5F3EA 5HCHA 4XZUG 3TAYA 4BA6A 2VNVA 4AGRA 4QD2A 1FPN2 3NQHA 5AC92 2HYKA 2JB8A 2R061 4ASLA 3U11A 1VRH3 1UYPA 4YPJA 2XXZA 4XIOA 1LOFC 2A73B 2TEPA 1GQHA 5BNPB 5C5UA 2IUWA 3OPZA 4Y4RA 4UFKA 3WHUA 4D6RA 3WG1A 3BIWE 1W8WA 3N9QA 5EQUA 4Z1VA 2D6NA 1VBB2 4Y5SA 1W04A 3VD9A 1X9PA 1VLNA 4IQPA 2H0VA 4GH4C 4Y20B 2Y6KA 3PU8A 2BBAA 4IESA 5J1XA 3MF9A 2VUCA 4AQSA 4ES9A 4XHBA 5LY2A 1VP6A 1PO22 2BERA 2B39A 4QXBA 1LHWA 2DUOA 3DYOA 1JN2P 4IV1B 5D8AC 1RXFA 3UV9A 1HXS1 1UXXX 1ZBA2 2QQKA 4Q0SA 4F8AA 3NV4A 2VW0A 5IJRA 5FY5A 3O0XA 3O1SA 2G9GA 1KS4A 1KJRA
chains in the Genus database with same CATH topology
2WYSA 3HNBM 5CKNA 4TTGA 5HXMA 3T2OA 4LPLA 1SFPA 2J1TA 3A23A 2Z4FA 2Y6JA 2DDUA 1JYNA 3IB3A 3K77A 3SKVA 3LEGA 4A4AA 2VZOA 2W91A 1JHJA 1GUIA 4MADA 2YB7A 5DN2A 3UETA 2QBXA 2ZEYA 3POGA 1F4HA 5DMYA 3MUZ1 1UZ0A 4ARYA 3LEIA 3SKJE 1IQDC 2B4KA 3ECQA 2VZSA 4A3ZA 2J1UA 3IAQA 3WF0A 2W1WA 2C9KA 2VZRA 3C7GA 4P00B 4RN5A 5LA0A 2PQSA 3I2HA 4Z2AA 2W94A 4IUGA 2YC4A 1YQ2A 1MPXA 4ET7A 2QQMA 3CMGA 2RVAA 4PT6A 1PX4A 3W5NA 2VO5A 2WDBA 4XUOA 5JR2A 4XUQA 3OEBA 2VM9A 2WZEA 1US3A 2JD9A 4JKLA 2ORXA 3CKHA 5B4XA 2EIEA 1UYXA 3HNYM 4DUWA 5JUVA 4BK5A 4DUVA 3WNOA 2VQTA 1CIYA 3SEPA 3WF4A 3A21A 1US2A 3LPGA 5JXJA 3T0DA 3POJA 4LMFA 3NJXA 1W9SA 4KWUA 1GQPA 3GM8A 4BK4A 1XNAA 4OMCA 2HLEA 4P08A 4D8MA 3I3BA 2JE8A 3ACIA 3I3EA 1GNYA 3DECA 1W9WA 4CVUA 5DQ0A 3WSOA 2WZ8A 4AAXA 3FHAA 3POFA 4MOAA 1W8OA 2DCJA 3JXSA 2VMFA 2VCCA 2QQOA 4XVHA 3CZJA 3IAPA 2C4XA 3ACGA 3OGSA 3DEMA 4QDRA 4OUEA 2QQJA 1H6YA 1JZ6A 5IYYA 5IFPA 2V5DA 1O8SA 3VDBA 2XONA 1CZTA 4MGQA 1KEXA 3BGAA 3NNGA 4MO3M 4PF1A 2ZEWA 2VZQA 4L0PA 1TVGA 4P5YA 3ZM8A 2C26A 4QDSA 1UWWA 5CYYA 3THDA 2OKXA 1OF3A 1NUKA 3ACHA 3HEIA 3DYPA 4QPWA 2Y8KA 3A22A 5C7GA 4JKKA 3WF3A 3UESA 2QQLA 1JZ5A 1OH4A 2ZEZA 1GU3A 5CKQA 4CU9A 4BJ0A 3U37A 1R64A 1XPWA 3K4ZA 4D0QA 5JXIA 3T0AA 1UYYA 1PMJX 4W50A 4ZY9A 1JYVA 2CDOA 2EIDA 3I3DA 1NKGA 3CZUA 1OD3A 4DEQA 2BGPA 3T2QA 1O59A 3WF2A 5F7UA 3KQ4B 1RYYA 2YFZA 1JYWA 2WBKA 2W9XA 3T08A 3OGRA 4AG4A 2E31A 2VR4A 4DXSA 1EUUA 5EJ1B 1JU3A 2HYXA 2WN2A 4PQQA 1XC6A 2ID4A 3I2JA 1CX1A 5LCWL 4XURA 1WKYA 3EYPA 5LA1A 2VZPA 3K4DA 1UYZA 3NRUA 4XUPA 3P6BA 2WO3A 4BXSV 2VCAA 4M4PA 2BZDA 1NX9A 1I5PA 2RJ2A 2VL4A 3WNPA 3FN9A 3MBWA 2W95A 3PUIA 5JXGA 3C8XA 4A41A 3WNLA 2E33A 2LW8A 2ZXQA 1OT5A 4MGSA 2YG0A 3C7FA 4LKSA 4XUNA 2WO1A 2EICA 3C7EA 4OMDA 3DYMA 2VZ3A 1SHWB 1DYOA 3WQBA 3AC0A 4A45A 4ZXEA 2J7MA 3VD3A 5G05L 2E26A 4ZZ5A 5I0DA 3FHQA 1F4AA 3VD5A 2J1AA 3A7QA 1K45A 1JZ2A 2Y64A 4JKMA 3CQOA 3K75B 2EIBA 5IHRA 1K12A 4KMQA 3LE0A 2BGOA 1UXZA 5CISA 2W46A 1UY3A 3K4AA 4LHSA 1SPPB 2W87A 2KD7A 1O8PA 2XHNA 3OB8A 4GWJA 2VC9A 4JHZA 3VD4A 2W1SA 3PUHA 3I2GA 1JZ4A 3T0BA 1UMHA 2VZVA 3K46A 2W1QA 5LA2A 5CZKA 2XQXA 5CKMA 3WNNA 3HPNA 1PX3A 2J1VA 3IIIA 4QAWA 5FUIA 2VCBA 3C7HA 2QQNA 1K3IA 4FI9A 3WEZA 4CU8A 1H6XA 1W8NA 4HG6B 4BDVB 3MUY1 1W99A 1L7QA 1JU4A 4A6OA 2VQUA 4KI5M 4RYDA 3ACFA 2L9LA 3CIHA 4DXRA 4QB1A 3OG2A 2J1RA 4UAPA 2WO2A 2X09A 4UI9L 4LQRA 3P1IA 1J84A 1BHGA 3MV11 2VJXA 4GWIA 3E1F1 3J7HA 3MV01 3WNMA 5G04L 2VMDA 2E32A 1NAEA 4LOTA 2ZEXA 2X10A 3F2ZA 1LNSA 3HOBA 1JYXA 5HPOA 1NT0A 4LORA 2ORZA 2VMCA 3C7OA 3HN3A 1NZIA 1UY1A 3LEKA 4CU7A 2VMEA 3MO4A 4W8JA 2VZUA 2YC2A 3T2PA 3EB7A 2LS6A 2RV9A 4JX0A 2WAOA 2V4VA 4TXWA 1ULOA 2VTFA 3HJRA 4DXTA 1CZVA 4UOJA 2WN3A 4E8DA 1UMIA 1JZ3A 2W47A 4OYUA 1UX7A 4P02B 1XNTA 3GXUA 1D7PM 4E8CA 4XUTA 2WNOA 4CUAA 2DCKA 3I97A 2J1EA 1SDDB 2W92A 1J83A 1P8JA 3HNMA 5DPNA 5EIYB 1KGYA 5JMOA 3W5MA 3OGVA 5A1AA 2J1SA 3FL7A 3I2KA 1UY2A 3T09A 2YFUA 1PMHX 2W5FA 2WUHA 5JXHA 2W1UA 2W3JA 1L7RA 3GDBA 5B4NA 5C70A 3ETPA 1OF4A 1JZ8A 1WCQA 4QX3A 2WABA 2VOTA 3VD7A 1ULPA 3VDCA 4QX0A 1GOFA 3SEEA 2B9VA 2Y6HA 1JI6A 4QB2A 2QQIA 3THCA 2JDAA 1DLCA 4QB6A 2X05A 5IFTA 3OEAA 2VZ1A 3I2FA 1TG7A 4QX1A 3UNPA 1UY4A 4QDQA 3D3AA 4M4RA 1CZSA 1W9TA 4GZ9A 4CU6A 1HN1A 3ABZA 1T2XA 3BN6A 4A42A 4DEVA 3LQCA 3IDAA 1GOHA 3WNKA 3VDAA 3GGLA 4CUCA 4ARXA 2WQ8A 2JKXA 5EJZB 1SPPA 4ZZ8A 1W0NA 2V72A 1GMMA 1K42A 2XOMA 4CUBA 3POEA 1UY0A 4XZUG 1SG3A 3POBA 1GOGA 3NQHA 2Y6LA 3WF1A 2Y6GA 4YPJA 2J22A 4QX2A 4DUXA 2R7EB 2VZTA 2CDPA 2WAAA 4A44A 3I2IA 3OBAA 3VD9A 4OZOA 3NJVA 2Y6KA 2BBAA 5J1XA 3CDZB 1EUTA 4LOSA 2BERA 3DYOA 3POIA 2QQKA 1DP0A 1UXXX 1JZ7A 3LPFA 1SZBA 5IJRA 4W4ZA 5C71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WYS A;  3HNB M;  5CKN A;  4TTG A;  5HXM A;  3T2O A;  4LPL A;  1SFP A;  2J1T A;  3A23 A;  2Z4F A;  2Y6J A;  2DDU A;  1JYN A;  3IB3 A;  3K77 A;  3SKV A;  3LEG A;  4A4A A;  2VZO A;  2W91 A;  1JHJ A;  1GUI A;  4MAD A;  2YB7 A;  5DN2 A;  3UET A;  2QBX A;  2ZEY A;  3POG A;  1F4H A;  5DMY A;  3MUZ 1;  1UZ0 A;  4ARY A;  3LEI A;  3SKJ E;  1IQD C;  2B4K A;  3ECQ A;  2VZS A;  4A3Z A;  2J1U A;  3IAQ A;  3WF0 A;  2W1W A;  2C9K A;  2VZR A;  3C7G A;  4P00 B;  4RN5 A;  5LA0 A;  2PQS A;  3I2H A;  4Z2A A;  2W94 A;  4IUG A;  2YC4 A;  1YQ2 A;  1MPX A;  4ET7 A;  2QQM A;  3CMG A;  2RVA A;  4PT6 A;  1PX4 A;  3W5N A;  2VO5 A;  2WDB A;  4XUO A;  5JR2 A;  4XUQ A;  3OEB A;  2VM9 A;  2WZE A;  1US3 A;  2JD9 A;  4JKL A;  2ORX A;  3CKH A;  5B4X A;  2EIE A;  1UYX A;  3HNY M;  4DUW A;  5JUV A;  4BK5 A;  4DUV A;  3WNO A;  2VQT A;  1CIY A;  3SEP A;  3WF4 A;  3A21 A;  1US2 A;  3LPG A;  5JXJ A;  3T0D A;  3POJ A;  4LMF A;  3NJX A;  1W9S A;  4KWU A;  1GQP A;  3GM8 A;  4BK4 A;  1XNA A;  4OMC A;  2HLE A;  4P08 A;  4D8M A;  3I3B A;  2JE8 A;  3ACI A;  3I3E A;  1GNY A;  3DEC A;  1W9W A;  4CVU A;  5DQ0 A;  3WSO A;  2WZ8 A;  4AAX A;  3FHA A;  3POF A;  4MOA A;  1W8O A;  2DCJ A;  3JXS A;  2VMF A;  2VCC A;  2QQO A;  4XVH A;  3CZJ A;  3IAP A;  2C4X A;  3ACG A;  3OGS A;  3DEM A;  4QDR A;  4OUE A;  2QQJ A;  1H6Y A;  1JZ6 A;  5IYY A;  5IFP A;  2V5D A;  1O8S A;  3VDB A;  2XON A;  1CZT A;  4MGQ A;  1KEX A;  3BGA A;  3NNG A;  4MO3 M;  4PF1 A;  2ZEW A;  2VZQ A;  4L0P A;  1TVG A;  4P5Y A;  3ZM8 A;  2C26 A;  4QDS A;  1UWW A;  5CYY A;  3THD A;  2OKX A;  1OF3 A;  1NUK A;  3ACH A;  3HEI A;  3DYP A;  4QPW A;  2Y8K A;  3A22 A;  5C7G A;  4JKK A;  3WF3 A;  3UES A;  2QQL A;  1JZ5 A;  1OH4 A;  2ZEZ A;  1GU3 A;  5CKQ A;  4CU9 A;  4BJ0 A;  3U37 A;  1R64 A;  1XPW A;  3K4Z A;  4D0Q A;  5JXI A;  3T0A A;  1UYY A;  1PMJ X;  4W50 A;  4ZY9 A;  1JYV A;  2CDO A;  2EID A;  3I3D A;  1NKG A;  3CZU A;  1OD3 A;  4DEQ A;  2BGP A;  3T2Q A;  1O59 A;  3WF2 A;  5F7U A;  3KQ4 B;  1RYY A;  2YFZ A;  1JYW A;  2WBK A;  2W9X A;  3T08 A;  3OGR A;  4AG4 A;  2E31 A;  2VR4 A;  4DXS A;  1EUU A;  5EJ1 B;  1JU3 A;  2HYX A;  2WN2 A;  4PQQ A;  1XC6 A;  2ID4 A;  3I2J A;  1CX1 A;  5LCW L;  4XUR A;  1WKY A;  3EYP A;  5LA1 A;  2VZP A;  3K4D A;  1UYZ A;  3NRU A;  4XUP A;  3P6B A;  2WO3 A;  4BXS V;  2VCA A;  4M4P A;  2BZD A;  1NX9 A;  1I5P A;  2RJ2 A;  2VL4 A;  3WNP A;  3FN9 A;  3MBW A;  2W95 A;  3PUI A;  5JXG A;  3C8X A;  4A41 A;  3WNL A;  2E33 A;  2LW8 A;  2ZXQ A;  1OT5 A;  4MGS A;  2YG0 A;  3C7F A;  4LKS A;  4XUN A;  2WO1 A;  2EIC A;  3C7E A;  4OMD A;  3DYM A;  2VZ3 A;  1SHW B;  1DYO A;  3WQB A;  3AC0 A;  4A45 A;  4ZXE A;  2J7M A;  3VD3 A;  5G05 L;  2E26 A;  4ZZ5 A;  5I0D A;  3FHQ A;  1F4A A;  3VD5 A;  2J1A A;  3A7Q A;  1K45 A;  1JZ2 A;  2Y64 A;  4JKM A;  3CQO A;  3K75 B;  2EIB A;  5IHR A;  1K12 A;  4KMQ A;  3LE0 A;  2BGO A;  1UXZ A;  5CIS A;  2W46 A;  1UY3 A;  3K4A A;  4LHS A;  1SPP B;  2W87 A;  2KD7 A;  1O8P A;  2XHN A;  3OB8 A;  4GWJ A;  2VC9 A;  4JHZ A;  3VD4 A;  2W1S A;  3PUH A;  3I2G A;  1JZ4 A;  3T0B A;  1UMH A;  2VZV A;  3K46 A;  2W1Q A;  5LA2 A;  5CZK A;  2XQX A;  5CKM A;  3WNN A;  3HPN A;  1PX3 A;  2J1V A;  3III A;  4QAW A;  5FUI A;  2VCB A;  3C7H A;  2QQN A;  1K3I A;  4FI9 A;  3WEZ A;  4CU8 A;  1H6X A;  1W8N A;  4HG6 B;  4BDV B;  3MUY 1;  1W99 A;  1L7Q A;  1JU4 A;  4A6O A;  2VQU A;  4KI5 M;  4RYD A;  3ACF A;  2L9L A;  3CIH A;  4DXR A;  4QB1 A;  3OG2 A;  2J1R A;  4UAP A;  2WO2 A;  2X09 A;  4UI9 L;  4LQR A;  3P1I A;  1J84 A;  1BHG A;  3MV1 1;  2VJX A;  4GWI A;  3E1F 1;  3J7H A;  3MV0 1;  3WNM A;  5G04 L;  2VMD A;  2E32 A;  1NAE A;  4LOT A;  2ZEX A;  2X10 A;  3F2Z A;  1LNS A;  3HOB A;  1JYX A;  5HPO A;  1NT0 A;  4LOR A;  2ORZ A;  2VMC A;  3C7O A;  3HN3 A;  1NZI A;  1UY1 A;  3LEK A;  4CU7 A;  2VME A;  3MO4 A;  4W8J A;  2VZU A;  2YC2 A;  3T2P A;  3EB7 A;  2LS6 A;  2RV9 A;  4JX0 A;  2WAO A;  2V4V A;  4TXW A;  1ULO A;  2VTF A;  3HJR A;  4DXT A;  1CZV A;  4UOJ A;  2WN3 A;  4E8D A;  1UMI A;  1JZ3 A;  2W47 A;  4OYU A;  1UX7 A;  4P02 B;  1XNT A;  3GXU A;  1D7P M;  4E8C A;  4XUT A;  2WNO A;  4CUA A;  2DCK A;  3I97 A;  2J1E A;  1SDD B;  2W92 A;  1J83 A;  1P8J A;  3HNM A;  5DPN A;  5EIY B;  1KGY A;  5JMO A;  3W5M A;  3OGV A;  5A1A A;  2J1S A;  3FL7 A;  3I2K A;  1UY2 A;  3T09 A;  2YFU A;  1PMH X;  2W5F A;  2WUH A;  5JXH A;  2W1U A;  2W3J A;  1L7R A;  3GDB A;  5B4N A;  5C70 A;  3ETP A;  1OF4 A;  1JZ8 A;  1WCQ A;  4QX3 A;  2WAB A;  2VOT A;  3VD7 A;  1ULP A;  3VDC A;  4QX0 A;  1GOF A;  3SEE A;  2B9V A;  2Y6H A;  1JI6 A;  4QB2 A;  2QQI A;  3THC A;  2JDA A;  1DLC A;  4QB6 A;  2X05 A;  5IFT A;  3OEA A;  2VZ1 A;  3I2F A;  1TG7 A;  4QX1 A;  3UNP A;  1UY4 A;  4QDQ A;  3D3A A;  4M4R A;  1CZS A;  1W9T A;  4GZ9 A;  4CU6 A;  1HN1 A;  3ABZ A;  1T2X A;  3BN6 A;  4A42 A;  4DEV A;  3LQC A;  3IDA A;  1GOH A;  3WNK A;  3VDA A;  3GGL A;  4CUC A;  4ARX A;  2WQ8 A;  2JKX A;  5EJZ B;  1SPP A;  4ZZ8 A;  1W0N A;  2V72 A;  1GMM A;  1K42 A;  2XOM A;  4CUB A;  3POE A;  1UY0 A;  4XZU G;  1SG3 A;  3POB A;  1GOG A;  3NQH A;  2Y6L A;  3WF1 A;  2Y6G A;  4YPJ A;  2J22 A;  4QX2 A;  4DUX A;  2R7E B;  2VZT A;  2CDP A;  2WAA A;  4A44 A;  3I2I A;  3OBA A;  3VD9 A;  4OZO A;  3NJV A;  2Y6K A;  2BBA A;  5J1X A;  3CDZ B;  1EUT A;  4LOS A;  2BER A;  3DYO A;  3POI A;  2QQK A;  1DP0 A;  1UXX X;  1JZ7 A;  3LPF A;  1SZB A;  5IJR A;  4W4Z A;  5C71 A; 
#chains in the Genus database with same CATH topology
 2GH8 A;  3IZO A;  3RZH A;  3MIF A;  4MHU A;  2JDP A;  1C5H A;  3T2O A;  4I2O A;  2J1T A;  1R1A 2;  3A23 A;  4CDX C;  1DIW A;  3OY8 B;  2Y6J A;  3PDQ A;  4IGP A;  5DZF A;  4HFS A;  3UKN A;  4CCL A;  1EPW A;  5GLU A;  3S7I A;  4AZZ A;  4CEY A;  3K77 A;  3KGL A;  3KVA A;  1CJP A;  1OA4 A;  4HBN A;  2C9A A;  1HJG A;  1RUE 1;  4A4A A;  2BDR A;  3BUC A;  2XJU A;  2ZGR A;  3D6E A;  3ZR5 A;  3AP5 A;  2ARX A;  3QAC A;  2C6S A;  5DN2 A;  4LUK A;  4LIU A;  2AAC A;  3SCG A;  4QGL A;  4DZG A;  5J98 B;  4AEK A;  3MUZ 1;  1XE0 A;  2VMG A;  3LEI A;  3OBR A;  4QM9 A;  3SKJ E;  1QF3 A;  1QEX A;  2RS1 3;  5FK7 A;  4A6S A;  2A6W A;  2NZ9 A;  2XLA A;  3IAQ A;  2BFU S;  2W1W A;  3R6S A;  1OVS A;  4XZP A;  2OZ6 A;  2PAE A;  2ZX3 A;  4WVZ A;  2PQS A;  3B69 A;  2D6M A;  2JDK A;  4R9A A;  1MS8 A;  1DHK B;  1O6U A;  1E5S A;  2DYC A;  2YC4 A;  3SIS A;  3HT2 A;  3ZXE A;  3KV5 A;  3GZT B;  3I59 A;  4Z8B A;  4CRQ A;  1F2N A;  1QJX 3;  1UOF A;  1QNY A;  1Z7S 2;  2OA2 A;  4LE4 A;  3J7M A;  1OUR A;  4FSJ A;  1UZV A;  1PX4 A;  4OUS A;  1BCX A;  2VO5 A;  2WDB A;  4LIV A;  2QVS B;  4XUO A;  4XUQ A;  2JX9 A;  5FTT C;  3ZSM A;  2V73 A;  5ANN A;  4KL1 A;  2WZE A;  1CJD A;  4AFC A;  3LA7 A;  3BU7 A;  1PVC 3;  5FZH A;  2JEM A;  1BBT 1;  1RUD 1;  1NLR A;  5B4X A;  4XE9 A;  2YYO A;  1BKZ A;  2EIE A;  2WNU A;  2BRT A;  3FE5 A;  1NYW A;  3HNY M;  3KGZ A;  4ISR A;  3TOJ A;  4DUV A;  1I1E A;  4D7S A;  3WNO A;  2Z69 A;  5F3I A;  1YLL A;  4GB3 3;  5E16 A;  5F2W A;  2VQT A;  1CIY A;  5CEH A;  3WF4 A;  3A21 A;  1RUH 2;  3KCY A;  1POV 1;  1VBC 2;  4LO5 B;  2WJS A;  5BNN A;  4JZR A;  1US2 A;  4L11 A;  2RMU 2;  1AYN 1;  2F4P A;  4L2N A;  4YVW B;  4R4Z A;  3VV1 A;  1B35 C;  4OHZ A;  3RS6 A;  1HRV 3;  5LAS A;  2LTN A;  2XVL A;  2P5B A;  4AVA A;  2JE8 A;  3I3E A;  4NUB A;  4MYE A;  3BIE A;  1OI6 A;  5DQ0 A;  2WZ8 A;  1ND3 C;  1GIC A;  1ULD A;  1S0G A;  3POF A;  2WFP A;  4LR4 A;  3J8F 2;  4LXL A;  1W8O A;  5FZF A;  2DCJ A;  3JXS A;  4XF3 A;  2VMF A;  4LHN A;  1OC1 A;  4XVH A;  1DQ1 A;  3IAP A;  1RUJ 2;  1U0A A;  3HMY A;  3OGS A;  2VCM A;  1SLB A;  4B29 A;  2A6V A;  1DGR A;  1HKD A;  5FRE A;  3K48 A;  3W9A A;  1EAH 1;  1UNB A;  3CNA A;  2R04 1;  3UGG A;  3H3U A;  4MUV A;  5HBA A;  2BVB A;  1JZ6 A;  3OYW B;  4E4H A;  1O8S A;  4PBP A;  3VDB A;  3JUU A;  2XON A;  1CZT A;  5M0T A;  4DRR A;  4XFH A;  3HT1 A;  3MFC A;  3NNG A;  4IER A;  2VTX A;  4MO3 M;  5BNQ A;  3S57 A;  4PF1 A;  1FOD 1;  1Y4W A;  2XKP A;  5IW0 A;  1D4M 1;  4RHV 1;  1AYM 1;  1BXH A;  1NCQ C;  4QPI C;  1PK6 B;  3O12 A;  2XML A;  1XSR A;  3JQW A;  2LRO A;  4P5Y A;  1H1I A;  1W3X A;  4AL9 A;  4TZD A;  2NQY A;  5JI7 A;  1UWW A;  5JCT A;  1QJU 3;  4J1X A;  5CYY A;  3THD A;  2V4A A;  4FAH A;  5FWJ A;  1WW6 A;  5A80 A;  2GH2 A;  1HDK A;  1NUK A;  1F5F A;  4R9C A;  5CIR A;  2YY1 A;  3HEI A;  1CAV A;  4QPW A;  5TSW A;  3AL6 A;  1MQT B;  4HSJ A;  3M8L A;  1NQJ A;  5T3N A;  2I74 A;  4HVQ A;  1UL9 A;  4XQD A;  3AKR A;  3KV4 A;  1U5Y A;  4IEZ A;  4PF5 A;  2ZEZ A;  3ZPO A;  1M06 G;  4L99 A;  1SBF A;  4CU9 A;  2RE9 A;  5K4L A;  2ZGK A;  4DY5 A;  5JXI A;  1XE7 A;  4X8N A;  3HVD A;  4RQP A;  1O7F A;  1TZO A;  2G9F A;  4Y1Z A;  3ZDS A;  2HWC 1;  3EBR A;  3O1R A;  2ENR A;  5FY8 A;  1IS3 A;  2EID A;  4HPK B;  4M3C F;  4CP9 B;  1I5Z A;  3BAL A;  1ZRE A;  1WD4 A;  4DEQ A;  3FFZ A;  4LLO A;  5F7U A;  3ZOI A;  1CQ9 A;  3KQ4 B;  1RYY A;  2YFZ A;  5F3G A;  5FZL A;  5A3O A;  4Z07 A;  1NA1 A;  1PGW 2;  2BYV E;  4FPG A;  1MR5 A;  4LKD A;  4QHO A;  1XQN A;  2QFE A;  4LJH A;  4AG4 A;  2DVF A;  1KIT A;  4FFH A;  4DXS A;  2VNG A;  1E5I A;  3BYW A;  5JDB A;  1MVE A;  1ZBE 1;  2XDV A;  5EJ1 B;  2BOI A;  1JU3 A;  3MW4 A;  4PQQ A;  2Y26 A;  3IPV B;  1URX A;  2OPW A;  2OXB A;  1XC6 A;  2WT2 A;  1OOP C;  2ID4 A;  3S5Q A;  3P3N A;  5BYN A;  2UUR A;  5K7P A;  3AJZ A;  2BOJ A;  5FQ0 A;  4FVV A;  3ZXG A;  1XYO A;  5EJ3 A;  3U4S A;  1S2E A;  2RR1 1;  3FZ3 A;  4N43 B;  3PNA A;  4U2A A;  2WO3 A;  3WP3 A;  2QQU A;  4BCU A;  3HR9 A;  1JUH A;  3W21 A;  2ZAA A;  4IET A;  1VRB A;  4EN6 B;  4WVM B;  1MEC 2;  1FNY A;  2PHF A;  3FN9 A;  2DTW A;  2LUW A;  1AXK A;  4NWW A;  4ASK A;  2I2S A;  3MW2 A;  5BNO C;  5FUN A;  4FQ4 A;  2VOX A;  2ZX1 A;  4CZS A;  1G9F A;  1OT5 A;  2XR4 A;  2Q4S A;  3B00 A;  1DGL A;  4TSV A;  3NMB A;  2BNO A;  3C7F A;  1JBC A;  1V6K A;  4NAM A;  4QU2 A;  3U75 A;  4AI0 A;  4FPJ A;  2ZAC A;  4AEM A;  4OMD A;  3WD5 A;  3VKL A;  1H4G A;  4XAC A;  3AC0 A;  3BCW A;  1MS0 A;  5GZE A;  3LFI A;  1PNG A;  2RS5 3;  1K5J A;  1NXM A;  5AC9 1;  4GKX A;  5FKC A;  5FPX A;  5DG2 A;  2J7M A;  4AHZ A;  4PI0 A;  3RVH A;  2AEN A;  2E26 A;  4ZZ5 A;  5I0D A;  4GH4 B;  5A33 B;  1IS6 A;  3AYD A;  1AR6 3;  1HX6 A;  4LBK A;  4A2U A;  2JKB A;  1JMU B;  1OKQ A;  3GNE A;  1N1V A;  4JAA A;  3ACL A;  5EWS A;  2JDH A;  2CHH A;  1JZ2 A;  1RMU 1;  4CDW C;  1DBN A;  2Y64 A;  2D6O X;  2HKX A;  3K75 B;  5D8A B;  2EIB A;  3PUS A;  5FYI A;  4DFS A;  2PHW A;  4KG8 A;  1GAN A;  2D6P A;  1G9A A;  1EV1 1;  3U10 A;  3U07 A;  3NVC A;  3H3Z A;  5JZG A;  1FMD 2;  2BGO A;  2UWB A;  4QQO A;  2W0X A;  1RVF 3;  2PHL A;  3JD7 1;  1SPP B;  2VG9 A;  2WIN B;  4XAE A;  5FMD A;  4CE8 A;  1BEV 3;  1AR8 3;  3OB8 A;  4MSV A;  5DAW A;  2B7Y A;  5GM0 A;  1S0J A;  2AEY A;  2XBO 3;  1TMF 1;  2P34 A;  4JHZ A;  4S2H A;  4XTM A;  3AMM A;  3I2G A;  3PUH A;  4NN0 A;  4LKF A;  5FYT A;  4IE7 A;  3DXT A;  1CWP A;  1UMH A;  1VB4 A;  3PVN A;  4XDO A;  1X82 A;  5FOB B;  1S4C A;  2TNF A;  4IEQ A;  5E89 A;  1PX3 A;  3FC0 A;  1RB8 G;  3SC7 X;  1QJX 2;  3CF6 E;  5ERL A;  5A3T A;  1QOT A;  2P6C A;  4COW A;  5JR7 B;  1HB4 A;  4CP2 A;  5DUV A;  1CN1 A;  2D3S A;  2PHT A;  1K3I A;  2CGN A;  2BU9 A;  2HBU A;  4Q2F A;  5FXW A;  5L19 A;  1H6X A;  4JGZ A;  1DYP A;  1VAK A;  4BDV B;  5FZ8 A;  5K0U C;  3HBZ A;  1W99 A;  4QHB A;  3AFG A;  2VNR A;  3GHM A;  3ZMN A;  1QJF A;  4PLN A;  2YDE A;  4A6O A;  4BYY A;  4LUM A;  2L9L A;  4DXR A;  4Q4W 1;  3GBF A;  2F6B A;  1KDM A;  1LUL A;  2FD8 A;  3DKQ A;  4HMZ A;  1H2M A;  1IPJ A;  2WO2 A;  2X09 A;  1YFW A;  3H7J A;  5A32 B;  1WBL A;  2R06 3;  3B7M A;  2AC1 A;  2PHD A;  3JBG 1;  2ZPX A;  4JTO A;  3E1F 1;  4MXW A;  5A7Q A;  1CAU B;  1HRV 2;  4Y24 A;  1UPI A;  5FZM A;  1QIQ A;  4DIN B;  2ZHM A;  2G9Z A;  5I93 A;  3AMH A;  4Q0Q A;  1LNS A;  4EWE A;  1WWY A;  2A3Y A;  1UIK A;  1UOG A;  4JGY C;  5HPO A;  2ORZ A;  2VMC A;  3AKP A;  4UW6 A;  1MZ6 A;  3LEK A;  4Y1V A;  2X8K A;  4AW7 A;  2VME A;  4YM3 A;  3IM0 A;  3IDE A;  3THP A;  3LSE A;  4EN9 B;  1ZM1 A;  4TXW A;  2CAU A;  4B1M A;  3H1M A;  4E27 A;  4XFC A;  3HJR A;  4CP9 A;  1XYN A;  2WKK A;  2VU9 A;  1RUF 1;  4B3N A;  4IE4 A;  2WC2 A;  1BVP 1;  1HLC A;  2JDM A;  4Y1U A;  2IVJ A;  3AZW A;  5FYZ A;  3ZO0 B;  2WN3 A;  2R07 2;  1HXS 3;  1K5M C;  1UMI A;  4JCK A;  5HCB A;  3MW3 A;  5FZO B;  4WBB A;  2W47 A;  1JZ3 A;  3ILN A;  1B35 B;  1GZ9 A;  1ND2 A;  2YGM A;  3D82 A;  3P3P A;  2DFB A;  4LO8 A;  3VKN A;  3VZJ A;  3IPV A;  4QGN A;  2R16 A;  5D1I A;  3WDV A;  5K9Y A;  2RDR A;  2IC1 A;  1AL0 G;  1AR7 2;  1RUG 1;  2J42 A;  1RUC 2;  3VBO A;  3FLP A;  3BTY A;  4NRM A;  3HAG A;  3P5B A;  1QY4 A;  1POV 0;  3FL7 A;  3I2K A;  1QJU 2;  4COY A;  1RUE 3;  3DPR A;  3M1H A;  1E5H A;  3KM5 A;  1H8V A;  3WW4 A;  4HK9 A;  4K3U A;  3NWK A;  1YQC A;  2GND A;  1J1T A;  4XMA A;  1IOA A;  1KXG A;  1PMH X;  5LK5 A;  1VAV A;  2SBA A;  4IE5 A;  2A3W A;  5IWF A;  4HOO A;  2IFW A;  1DLL A;  1Q3E A;  3PIG A;  3PTY A;  3ZR6 A;  1WBF A;  2B9U A;  4BLI A;  4A7Y A;  5B4N A;  5C70 A;  2QQW A;  1OF4 A;  4CP1 A;  1WCQ A;  4QX3 A;  1GP5 A;  1GP6 A;  5F6L B;  1KFX L;  3RZM A;  2VXJ A;  2QQV A;  2BW8 A;  1NCQ B;  1LOF A;  2BGC A;  4QPI B;  4QX0 A;  1WME A;  2FDI A;  2B9V A;  4E4S A;  4CXY A;  1W0P A;  2ARB A;  3NNM A;  4MGT A;  1F9K A;  4XFG A;  2QQI A;  2WFF 1;  3THC A;  2WA3 A;  5AFE A;  1S0B A;  4IW3 A;  4M0H A;  4ZHN A;  4Y1Y A;  4D7Y A;  1S55 A;  2X05 A;  3USS A;  4C91 A;  1OQE A;  1ENR A;  5IFT A;  3EXU A;  3RI8 A;  2VZ1 A;  1AR9 1;  4GH4 A;  1TG7 A;  4ATF A;  4QX1 A;  2PLV 2;  4XAA A;  3WDY A;  5FY0 A;  4M4R A;  2CL2 A;  5A3W A;  1VIW B;  4GUL A;  4AQ2 A;  1HRI 2;  4IEV A;  4NHK A;  1BK1 A;  1BBT 3;  1RUD 3;  2OW4 A;  3T2T A;  3QCW A;  2XH6 A;  5FBZ A;  4BM8 A;  4J25 A;  1MZ5 A;  1OXC A;  4Q4X 1;  5GJ6 A;  4DEV A;  3VBH A;  1AHS A;  1GOH A;  4CEW A;  1FAY A;  1POV 3;  2OUJ A;  3GGL A;  4G4F A;  5FZ0 A;  3ZN6 A;  4GWM A;  2FZ2 A;  1SPP A;  2JKX A;  2ZGO A;  1G9B A;  1AYN 3;  4FPC A;  3VBS C;  3KWV A;  1O5U A;  2ZAB A;  4CDX A;  3O1O A;  1W6M A;  1GMM A;  2XOM A;  2D43 A;  1AX1 A;  4PI2 A;  4CXW A;  5JOZ A;  3ROU A;  2DCY A;  3Q8B A;  3POE A;  5A3L A;  4DO0 A;  5LAT A;  4ZON A;  2A7A A;  3DCQ A;  4UYB A;  3SH5 A;  3M2M A;  4Q0U A;  4RL7 A;  3POB A;  5FYM A;  2Q8C A;  4W6X A;  1CVN A;  2Y6L A;  4BQ3 A;  2IXL A;  2DBN A;  1HQW A;  5GLZ A;  1VMJ A;  3KF3 A;  4DUX A;  1DQ2 A;  1OOP B;  2HH9 A;  1DZR A;  4UF0 B;  3T4V A;  2CY6 A;  5F5Q A;  1OLR A;  2VZT A;  1H9W A;  2ARC A;  4PJY A;  4A44 A;  1OA2 A;  3M3Q A;  2RS5 2;  1HV0 A;  1OUX A;  1VAL A;  1EAH 3;  5IT6 A;  2R04 3;  2YBP A;  4OI4 A;  5LB6 A;  1XNC A;  3CL1 A;  1TNF A;  1ZZB A;  5GLV A;  3U0Z A;  5GLW A;  2DCT A;  2JB4 A;  5C4W C;  2FDG A;  1LJ7 A;  3POS A;  4FO9 A;  4Y5T A;  1LOA A;  4XJZ A;  4CDQ C;  4EJR A;  1AR6 2;  1BLZ A;  2GN3 A;  3ZFG A;  3ES4 A;  3RZK A;  1FOD 3;  2LRP A;  1V6J A;  1H2K A;  4RGG A;  1D4M 3;  4RHV 3;  1U5Z A;  3AMP A;  3POI A;  1AYM 3;  1DP0 A;  1PIV 1;  3S5A A;  1MVQ A;  3TB0 A;  1SZB A;  1V9U 2;  1HB2 A;  3PME A;  2R49 A;  3ZXA C;  2WNV C;  2WYS A;  3HNB M;  2HWE 2;  4IND A;  4NII A;  5CKN A;  4BQ2 A;  4TTG A;  1RVF 2;  4XFA A;  5I0R A;  2Z4F A;  1TME 2;  1AR8 2;  5IVE A;  2XBO 2;  1QJY 1;  3IB3 A;  3NL1 A;  3SKV A;  1CX4 A;  4RR3 C;  1WW4 A;  2E53 A;  2D40 A;  3Q9O A;  4BB3 A;  2NMN A;  2PN5 A;  3MEP A;  2VH9 A;  4YRD A;  4BE3 A;  1YHF A;  1CES A;  2VZO A;  2W91 A;  1YFU A;  1PK6 C;  4LE3 A;  3J7N A;  1GUI A;  4ORF A;  2YB7 A;  1B35 A;  2JE9 A;  4CDW B;  5KC5 A;  1C4R A;  1F4H A;  2VVD A;  2VTX J;  1W6O B;  2IVI B;  2BBV A;  1WA6 X;  1SCS A;  2HWC 3;  4OQ9 A;  1S2K A;  1IQD C;  3LDR A;  2G4I A;  1GWL A;  4CCE A;  4DOU A;  1W6P A;  3WF0 A;  4B4P A;  1ND3 A;  2C9K A;  2VZR A;  3UKT A;  2DWR A;  4W6W A;  5LA0 A;  4FPK A;  1D2Q A;  3SLI A;  3G6J B;  4WM7 A;  4H3W A;  5ABJ A;  2PHU A;  2W94 A;  5FLI A;  5LRR A;  4ZXK A;  3TEZ A;  4B7K A;  1YQ2 A;  3FBM A;  4H7L A;  3HBK A;  1ZBE 3;  1ODM A;  1OPO A;  4K1Y A;  2EVX A;  3OPT A;  2G1M A;  4YAR A;  2OS2 A;  2MPF A;  5JR2 A;  4AHY A;  1WMX A;  5D2A A;  2MEV 1;  3RG0 A;  3ZXJ A;  1SQ4 A;  3MPB A;  4KU7 A;  4XC9 A;  4XPV A;  2JDZ A;  3WUD A;  4BME A;  2JD9 A;  2RR1 3;  4JKL A;  2BPA 2;  2ORX A;  5JOX A;  3MI8 A;  1OSG A;  2EAL A;  1NCQ A;  4QPI A;  4R9B A;  3PUR A;  4BK5 A;  3VBU C;  1ST8 A;  4YW3 A;  5K0U B;  1UW8 A;  3SEP A;  1Z78 A;  3KQR A;  3CJI A;  3WQ7 A;  1GYK A;  2XWB B;  2WLQ A;  2HJI A;  3FBY A;  3EQE A;  3JB4 C;  3LPG A;  4BIO A;  5A6Z A;  3T0D A;  2P4E A;  1JYI A;  1XE8 A;  5KXE A;  5D21 A;  1LES A;  4BH9 A;  5LBB A;  1JOD A;  1RIR A;  2XKO A;  3NJX A;  3DKW A;  1HXS 2;  2DUP A;  4QM8 A;  3NV3 A;  5HXV A;  1N1Y A;  1XNA A;  3L2H A;  4P08 A;  1V6I A;  4R52 A;  1DZT A;  4WZC A;  3VBR C;  2WL1 A;  5IVY A;  4XBN A;  4CVU A;  3DEC A;  3IDC B;  4YM2 A;  3WSO A;  2P17 A;  4YSF A;  4PIY A;  1VR3 A;  5AC9 3;  1OA3 A;  4JGY B;  3KV6 A;  5FJK A;  5FMC A;  3RMY A;  3RQ0 A;  2B46 X;  1FAT A;  3TN9 1;  2FDF A;  1W0O A;  1O5L A;  4OLL A;  2VCC A;  3M70 A;  1EY2 A;  5DAP A;  2XUE A;  5LBF A;  2CGP A;  2ET1 A;  1C1L A;  2JD4 A;  3ACG A;  1RHI 2;  1SFY A;  1W2O A;  3DEM A;  1O3R A;  3BPZ A;  3D8C A;  1YRZ A;  4MHR A;  2AEZ A;  2YXS A;  1QQP 3;  3WOG A;  1J1L A;  1H4H A;  1RMU 3;  3HD8 B;  4K21 A;  5LWB A;  2JXA A;  1LOG A;  5IYY A;  2V5D A;  1K5M B;  4XCB A;  1OFS A;  2BUK A;  1EV1 3;  4FXG B;  1RJ8 A;  4XFI A;  3O5S A;  2H6B A;  2PAM A;  4MGQ A;  3V0A B;  3BGA A;  4TWT A;  2ERF A;  4KU8 A;  1N3Q A;  1W6N A;  2EAK A;  4WM8 C;  2NLR A;  3AKS A;  3JD7 3;  5FXZ A;  3OTF A;  3UT0 A;  4GIQ A;  4BZ4 A;  2BP6 A;  4K9S A;  3PVB B;  1OOP A;  1TMF 3;  2VZQ A;  2DV9 A;  1XRU A;  4Y3O A;  2D98 A;  2Q8D A;  3ZM8 A;  3WV6 A;  1ENS A;  4QDS A;  1DFQ A;  1COV 1;  4HL0 A;  3ZN5 A;  3ES1 A;  3M4F A;  2OKX A;  1OF3 A;  3ZFF A;  2HEV F;  1GLH A;  3ACH A;  5CU1 A;  2X5I A;  5HV4 A;  3DYP A;  1WCK A;  1UPS A;  4PLO A;  3BB6 A;  4CCC A;  2UYB A;  2Y8K A;  4XQW A;  3LSD A;  1APN A;  2VBD A;  3A22 A;  3RWK X;  1WLW A;  4NR1 A;  1OVP A;  2Y60 A;  1ZZ6 A;  3NAP C;  2C0Z A;  1SLA A;  5GKA C;  1PNF A;  1OLM A;  5DDJ 1;  3LGR A;  4QPG C;  4AXO A;  1WUV A;  2B5H A;  4CUG A;  2EXI A;  5KHI A;  1RUD 2;  2NM1 A;  4IE0 A;  1GZW A;  3OGG A;  4B4R A;  3MLK A;  4BLJ A;  4D0Q A;  2JE7 A;  4RS5 C;  1W2A X;  3T0A A;  2ZX2 A;  2UWA A;  5FY9 A;  1Q8P A;  2BFU L;  4IV3 A;  1UMZ A;  1RUI 2;  4N53 C;  4XDP A;  1ZYB A;  4I0W B;  4Q4W 3;  5L36 A;  2XJR A;  1NKG A;  1WLD A;  2E7T A;  2HWD 2;  1AYN 2;  1SMV A;  2XJQ A;  2BGP A;  3CZU A;  3PL0 A;  3GYD A;  1O59 A;  3T2Q A;  2GAL A;  3JBG 3;  3J4U H;  2DU1 A;  3WF2 A;  1ZRF A;  5C8W A;  5C3Q A;  1W05 A;  1Y9G A;  4BQ4 A;  2WBK A;  2W9X A;  2WS9 2;  1LB2 A;  1R09 2;  3OGR A;  5FZ7 A;  2WZP P;  3SMH A;  2VR4 A;  3FUO A;  4YG6 A;  3I4I A;  1CAW A;  1RIN A;  3OBZ A;  3RYP A;  5C9A A;  5A70 A;  2WT0 A;  2HYX A;  2WN2 A;  3I7D A;  3GCX A;  2VVE A;  4BOW A;  5DAQ A;  4AFD A;  4AGV A;  5JLV A;  1W6O A;  4YFW A;  3VL8 A;  1U5X A;  4YW7 A;  5LCW L;  4FP2 A;  3EYP A;  1FPN 1;  5LA1 A;  1RUF 3;  1YWK A;  2B42 B;  3TNP B;  4AVS A;  3NRU A;  4XUP A;  2YGL A;  4FPO B;  1AF9 A;  4BXS V;  3AKQ A;  3VBS B;  5B2G B;  4Q4Y 2;  2TBV A;  4XDQ A;  2BZD A;  5FR3 A;  4IGO A;  4I30 A;  3MLL A;  2A6Z A;  5J96 B;  4AOC A;  4CDU A;  4Q8K A;  3WW3 A;  3MID A;  2W08 A;  3PUI A;  3DXU A;  4O9E A;  1YUD A;  4OI1 A;  4A7Z A;  5HV0 A;  3C8X A;  2EF6 A;  4NIG A;  2OT7 A;  3AVS A;  1FOD 2;  1D4M 2;  2LW8 A;  4RHV 2;  3ZFE A;  4QU1 A;  1OKO A;  3SCF A;  1CAX B;  3VBF C;  4F3J A;  2JEN A;  3ZIW A;  4MGS A;  2JDU A;  4PDW A;  1RUG 3;  5IVJ A;  2HWB 1;  4LA2 A;  1D0G A;  2WO1 A;  2WYF A;  4NE9 A;  2EIC A;  3ZX7 A;  3C7E A;  2VZ3 A;  3TEX A;  1W90 A;  1VE0 A;  4A45 A;  2YUE A;  4N8M A;  3RJR A;  4FP3 A;  1TNR A;  4NMI A;  3IKW A;  5FYU A;  4WVW A;  2GDF A;  1I9R A;  2V09 A;  1E5R A;  2DVG A;  2WLP A;  1HQN A;  3EO6 A;  3B93 A;  2Q1M A;  1EP0 A;  1BYH A;  4AF9 A;  1HB1 A;  1GSL A;  2VY0 A;  2RDS A;  5C4W B;  4YW5 A;  1YJL A;  4HKO A;  4LBQ B;  2ZAH A;  4TLF A;  1OLM E;  3VD5 A;  1AL2 1;  1R1A 1;  2J1A A;  3GZU C;  4CDQ B;  3KHC A;  3V65 A;  4ZPI A;  4HK8 A;  2P3I A;  1WGP A;  3N4M A;  1BZW A;  2RJK A;  2IXI A;  1XOY A;  3OPW A;  1NCR B;  4GKY A;  4K40 A;  3ST7 A;  5FCC A;  2SLI A;  1K12 A;  3AXE A;  3N7K A;  1A6C A;  4S2D A;  5I0T A;  2HWC 2;  5IAT A;  4KMQ A;  3DV8 A;  4O61 A;  2WFF 3;  2WNV B;  5FZ9 A;  5T50 A;  2W46 A;  3LF7 A;  1QGL A;  4P9L A;  1PGL 2;  1WMD A;  1H2L A;  5J48 A;  4ES8 A;  2KD7 A;  1IS4 A;  1O8P A;  4JHT A;  2W2I A;  5T5L A;  5HI0 A;  5T5O A;  2VC9 A;  1PGS A;  1GWM A;  2ZGS A;  2ZMN A;  1VBD 2;  1JZ4 A;  1AR9 3;  1LR5 A;  1NY7 2;  4O7X A;  2D6L X;  2VZV A;  2YPJ A;  3K46 A;  2VMI A;  2W1Q A;  1UOB A;  2JIC A;  2VMH A;  2XQX A;  4HON A;  3J26 N;  4K1Z A;  2RM2 2;  4M3C B;  4QXH A;  1SLC A;  4RR3 B;  4SBV A;  5FO7 B;  3PUQ A;  3WNN A;  3K2O A;  4NPM A;  4D6S A;  1ZBE 2;  2J1V A;  1Q43 A;  4WZF A;  1DG6 A;  1NE6 A;  3III A;  1ULC A;  3J7L A;  4Q4X 3;  1VBE 1;  4GMP 1;  4XQ4 A;  3C7H A;  5L9B A;  1X33 A;  2BQP A;  4AI3 A;  5BNP A;  5IVV A;  3RRD A;  1H8T C;  5FP7 A;  2QQN A;  1L7L A;  3ZYI B;  1O3Q A;  1RUO A;  4FI9 A;  2KR2 A;  2R30 A;  2RR1 2;  2ZGU A;  4CU8 A;  2VE1 A;  4LO7 A;  1W8N A;  3N7J A;  3FFQ A;  4JDM A;  1XU2 A;  1BMV 1;  4N90 A;  5DXD A;  1UD1 A;  2BJS A;  3MUY 1;  4XF4 A;  2VW1 A;  4Y20 A;  1JU4 A;  2VQU A;  5L9R A;  4LO4 B;  4RYD A;  1HQL A;  4NRP A;  2WA4 A;  2XVK A;  4XJ8 A;  3OG2 A;  2J1R A;  3RZG A;  1PM4 A;  1QOO A;  4PBO A;  2QCS B;  3GBW A;  4IV1 A;  4MGI E;  4AED C;  5C3P A;  1MZE A;  4LQR A;  4UI9 L;  2AR6 A;  3M7A A;  2RHP A;  1J84 A;  1LGB A;  1H2N A;  2KM2 A;  1MAC A;  1LHU A;  2ZGP A;  5EPA A;  3R4D B;  2D5F A;  1IGO A;  1REE A;  4FT8 A;  2WNE A;  2ZEX A;  3OGJ A;  1C3H A;  3TWI A;  4D3W A;  4ZU7 A;  2OQ6 A;  3HOB A;  1JYC A;  2JWP A;  2ARE A;  2YPD A;  5LBE A;  3ALQ A;  5J36 A;  5LW9 A;  2E7A A;  2QUO A;  3C7O A;  3OY8 A;  3IMN A;  2AYH A;  1ULE A;  1NZI A;  3MGU A;  4G3Y C;  1W6Q B;  1ENX A;  1MS5 A;  1KJL A;  2CNA A;  4XJU A;  3PLQ A;  1KFU L;  1S0D A;  2VZU A;  2YC2 A;  3MO4 A;  3ZLI A;  5F37 A;  1Q5O A;  2RV9 A;  3VBU B;  2RDQ A;  4O65 A;  2V4V A;  5DAB A;  1ULO A;  2IXC A;  2VTF A;  2P3Y A;  2VGD A;  3MYX A;  2B8M A;  3WW2 A;  3GCW A;  1Q8O A;  5JIA A;  1Y43 B;  4IEW A;  1GZC A;  1GZT A;  1WMF A;  2ZX0 A;  5L7O C;  1PIV 3;  2AH2 A;  5APA A;  5GLT A;  5KHH A;  4OHV A;  3R0R A;  1VRH 2;  1QJZ A;  1D2S A;  4OYU A;  1UX7 A;  4BMB A;  4P02 B;  4JDN A;  4E8C A;  2WNO A;  3ITQ A;  4XIK A;  2K0G A;  3VBR B;  5KWR A;  1CGP A;  5JPM B;  5IK7 A;  3OUI A;  3T1M A;  3AJY A;  2P2K A;  1P8J A;  3NKG A;  4OQ8 A;  1D4V B;  1KGY A;  1TMF 2;  2R32 A;  5A6Y A;  1QJY 3;  4LK7 A;  5JMO A;  3KCX A;  5KHK A;  2BTV C;  2DF7 A;  5K8S A;  3A0K A;  4V2V A;  1U12 A;  3LDK A;  4JTN A;  3LFM A;  3VBS A;  4HN0 A;  2Z79 A;  2YFU A;  4D94 A;  1KDK A;  2KXL A;  1IQA A;  4FQZ A;  2OZJ A;  2W5F A;  4IDZ A;  4DMI A;  1W39 A;  2CWS A;  1GWK A;  3T4H B;  3UJQ A;  1RJ7 A;  1F5J A;  4COZ A;  4QKF A;  4DPN A;  2OVU A;  4JQT A;  3KT7 A;  1YNA A;  5EFU A;  2CTV A;  2O8Q A;  4WM8 B;  3RMX A;  3WHT A;  4JC1 A;  4E9K A;  4M01 A;  4Y4Y A;  3I2D A;  2PXJ A;  2ZML A;  4JDO A;  2FDH A;  1GOF A;  5F8P A;  3SEE A;  2BNN A;  2FDK A;  4QB2 A;  1WD3 A;  1WW7 A;  4QXK A;  3B9I A;  2C5D A;  4YM0 A;  4YVW A;  1QWR A;  4QB6 A;  4OI0 A;  5ACA 1;  5CAD A;  4CA9 A;  1QQP 1;  2DFC A;  2JG9 B;  4ZS3 A;  3OEA A;  4HET A;  2VPV A;  1MS1 A;  2A70 A;  1UY4 A;  3WCR A;  3RZL A;  2MEV 3;  3VL9 A;  4LBQ A;  2ADE A;  4AQ6 A;  1CZS A;  2GC0 A;  2D3R A;  5F32 A;  3NAP B;  4GZ9 A;  2RS1 2;  3JQX A;  1HN1 A;  4QPG B;  5CNA A;  1LCL A;  5LEJ A;  4KWL A;  4CCM A;  4MGK E;  4FAG A;  1H0B A;  1J3P A;  4F83 A;  4A42 A;  5F2S A;  2F4L A;  3LQC A;  4QX8 A;  5FY1 A;  1QJE A;  2VUL A;  4OFG A;  3WNK A;  4RS5 B;  3VDA A;  2PYT A;  1ULF A;  3D5O A;  3E6C C;  4RFR B;  4AEJ A;  4FOY A;  4E4D X;  3E5U A;  4N53 B;  4ARX A;  1ZA4 A;  2XHK A;  5IVF A;  1H9P A;  4FFF A;  2RS3 1;  4D7T A;  2CWM A;  1K42 A;  2XJP A;  3OYW A;  4NHM A;  4LBO A;  1SAC A;  2YU1 A;  4YLZ A;  4RR3 A;  2K2S A;  5EV7 A;  1V6M A;  1YXW A;  2R6Q A;  1S0C A;  1UY0 A;  4QKB A;  2IFR A;  2VOK A;  1PVC 2;  3L9J T;  4H2A A;  3WUC A;  5JAX A;  1PK6 A;  4QQH A;  1MEC 1;  2ZGQ A;  5FAX A;  4FTB A;  3AFK A;  3HIF A;  3TN9 3;  1RC6 A;  2E51 A;  1RUG 2;  4MZU A;  4JV4 A;  5FZC A;  1QXR A;  3WQ0 A;  3MFA A;  2R7E B;  4GB3 2;  4UFI A;  5FLH A;  2DUR A;  4DQA A;  2W68 A;  4MGZ E;  2CDP A;  3H8U A;  1XND A;  2WNU C;  1O3S A;  1PO1 3;  3B94 A;  3KS7 A;  3OBA A;  1YQ8 A;  4I3G A;  5FZ4 A;  4W65 A;  5KXC A;  3GZA A;  1MQT A;  4OZO A;  5FK8 A;  2DTY A;  3WP4 A;  1NOV A;  4YWA A;  1J59 A;  4XF1 A;  4J6G A;  1YI7 A;  3NNF A;  3VZL A;  3T30 A;  4Q5O A;  4XXP A;  4LOS A;  3SQO A;  2GMP A;  4XHX A;  5H9S A;  3A0N A;  5JOW A;  3LPF A;  4X8P A;  3WDW A;  4Y22 B;  2DVA A;  2WO7 A;  3Q8F A;  3VBF B;  5C8C C;  4W4Z A;  1U5I A;  3OUH A;  2D3P A;  1AZD A;  5GZD A;  3VHP A;  3LEM A;  5C71 A;  1F35 A;  4KNC A;  1FXZ A;  4YG3 A;  4HPK A;  1Q8S A;  4QKN A;  1COV 3;  2WFF 2;  3KMH A;  4LKE A;  5KR7 A;  1XU1 A;  4B7E A;  5BXX A;  1R1Z A;  3MZH A;  4AVC A;  2DDU A;  3U78 A;  2O1Q A;  1JYN A;  1AR9 2;  1CPN A;  1FMD 1;  2QDR A;  3H7Y A;  3LEG A;  2VUA A;  5BPX A;  4E4Z A;  4YW1 A;  3SHR A;  2VQA A;  4E2S A;  5DDJ 3;  3WNX A;  4N7U A;  4LA3 A;  2RG4 A;  1S1A A;  1S0F A;  1JHJ A;  2QZ3 A;  3WG3 A;  4XFF A;  4EN0 A;  1WCU A;  3UET A;  4Q4X 2;  2QBX A;  2ZEY A;  2ADD A;  3POG A;  2JIG A;  1STM A;  4Y26 A;  5DMY A;  3V0B B;  2OPK A;  1UZ0 A;  3N7L A;  1FT9 A;  4ARY A;  4BHP A;  3VBR A;  1LKN A;  2B4K A;  3LCP A;  2FCT A;  2ZHK A;  2VZS A;  3N9L A;  5FLJ A;  4N43 A;  3N35 A;  3B5L B;  1KQR A;  5FKB A;  2WII B;  4P00 B;  4RN5 A;  1XB9 A;  4W6Y A;  1L3J A;  1A34 A;  2GN7 A;  4YGD A;  2WZR 1;  4WVM A;  3ZXL A;  3I2H A;  3KSC A;  2FQP A;  1Y7B A;  4CCD A;  5FV3 A;  4KQ7 A;  1TE1 B;  3M3O A;  5T5J A;  4XAB A;  1IKP A;  1MPX A;  1UU6 A;  3FJS A;  2Z5W A;  2QQM A;  3LIG A;  1W8Z A;  3PUA A;  1HV1 A;  3N36 A;  5FZG A;  3QH7 A;  3ZYJ B;  3I8T A;  3B02 A;  3W5N A;  3I3Q A;  1JS9 A;  4XCA A;  3QH6 A;  2JDY A;  1FPN 3;  1H8T B;  1ZRC A;  4XMI A;  2DUQ A;  5FZ3 A;  1J3R A;  4EV0 A;  4DUW A;  4NO4 A;  2WR9 A;  4ONU A;  3AKT A;  4RQP C;  4EE2 A;  1DQ4 A;  2DU0 A;  1HJF A;  3O1T A;  5E8A A;  1ONA A;  1ZVF A;  3E5Q A;  5A33 A;  1LOE A;  5DAX A;  5GAL A;  5JXJ A;  1I3H A;  3POJ A;  1YIP A;  5F9T A;  4HAN A;  1W9S A;  5FMO S;  5D8A A;  3AYE A;  4AED B;  1NA1 C;  1PIV 2;  5FXX A;  3GM8 A;  3Q8A A;  4BK4 A;  3LB9 A;  4GMP 0;  4HLT A;  4EZ4 A;  5I8T A;  1PMI A;  2HWB 3;  1C8M 1;  3MPP G;  4FOQ A;  2W52 A;  1BJQ A;  4D8M A;  2DCZ A;  1QXJ A;  1X36 A;  3OOX A;  4YZ3 A;  5H9Q A;  3Q8E A;  3ZPY A;  4C0H A;  4E2G A;  4DNY A;  1Y9Q A;  2W39 A;  2R07 1;  3H0O A;  1FV2 A;  4MOA A;  3FX3 A;  4BPZ A;  3AB0 A;  2QQO A;  4K6B A;  1QJY 2;  4IE6 A;  1OQD A;  3CZJ A;  2LM3 A;  2UWC A;  1YIF A;  2C4X A;  2VQ0 A;  3ZVX A;  5EZW A;  2NP0 A;  4UT5 A;  1W8F A;  3N9P A;  1AL2 3;  1R1A 3;  2NMO A;  3DN7 A;  4PLM A;  1KRI A;  3GAL A;  1AR7 1;  1JW6 A;  2QQJ A;  3TYJ A;  1DDL A;  1GKB A;  5C6C A;  5L7O B;  1RUC 1;  4BU2 A;  3KT4 A;  1I6X A;  3O7O A;  4CP0 A;  2BNM A;  4COU A;  3PMS A;  4LLF A;  3B01 A;  3O14 A;  3ZSK A;  5IVB A;  4UFJ A;  1S2B A;  1KS5 A;  5A3U A;  1LGC A;  5FZI A;  4LT5 A;  2YC0 A;  1TVG A;  4XTP A;  3KV9 A;  5A7O A;  1LOC A;  1XXN A;  2C26 A;  1Q8Q A;  2ETE A;  3JCI A;  1LHV A;  1NXD 1;  5A7N A;  4YW6 A;  1T6G C;  5A32 A;  5I8S A;  3BU0 A;  1NE4 A;  5JMC A;  1CAU A;  1NCR C;  1VBE 3;  1VBA 1;  4GMP 3;  1JTZ X;  4JVA A;  4NHL A;  1TQ5 A;  5C7G A;  1JYT A;  3UES A;  1Y9M A;  2MEV 2;  1AXY A;  4S2F A;  5EYY A;  1YQ5 A;  3LD8 A;  2A6Y A;  1DGW X;  1KD7 A;  5CKQ A;  3UJO A;  2G19 A;  5A3M A;  3VN4 A;  3GJB A;  4KGQ A;  1LU2 A;  4GXL A;  3ENR A;  1XNB A;  1R64 A;  1XPW A;  3U37 A;  1BEV 2;  2PLV 1;  4QQ2 A;  2O14 A;  4BJ0 A;  1UYY A;  2GMM A;  2PMW B;  3A4U A;  4GA9 A;  4IEY A;  4ZY9 A;  1JYV A;  5A7P A;  5JZG C;  2RJL A;  4PHZ A;  1HRI 1;  3ATG A;  5IAV A;  5FPU A;  1O4T A;  2ZTN A;  4BIS A;  4AFM A;  3FWE A;  3CO2 A;  1IHM A;  4NIA A;  1YI9 A;  1ZZ9 A;  5FPV A;  5FZO A;  2R1B A;  1JYW A;  3IBM A;  1B09 A;  1QOS A;  4FPL A;  1W8T A;  4YG0 A;  3RYK A;  3T08 A;  2A71 A;  1VBC 3;  1WCD J;  4P9W A;  3UKV A;  5I8Y A;  5JI9 A;  1WLT A;  4GJZ A;  4Q1P A;  1RGS A;  4YM1 A;  1Q56 A;  4XJ9 A;  3K51 A;  1ZZ7 A;  3GZE A;  4L92 A;  1OHF A;  4AVB A;  4FPE A;  3EMR A;  4EN7 B;  4XXA A;  4NVP A;  3V0B A;  3LOB A;  1ASJ 1;  2OX0 A;  4HXC A;  1EYB A;  3OCP A;  3E97 A;  1C57 A;  2HWF 1;  1J3Q A;  2NPI A;  3I2J A;  4DRV A;  1YEW A;  1ODN A;  4IEX A;  1HN0 A;  2VZP A;  3SCH A;  2EIG A;  5A3P A;  1LEM A;  1UYZ A;  4K8F A;  3R4U A;  2CSG A;  3M3E A;  4MGY E;  4BQY A;  4XOG A;  2PA7 A;  4COV A;  5FDB A;  4IEO A;  2R06 2;  2VL4 A;  3H1W A;  4HKL A;  2N7G A;  1O3T A;  3WNP A;  3S30 A;  4QPY A;  3MBW A;  1LOD A;  4NHX A;  3USU B;  1DGW A;  3FLT A;  1Q8V A;  3PTR B;  4PCR A;  1F8V A;  4TLG A;  3WNL A;  3BPS A;  3I59 B;  3BOD A;  2E33 A;  1ZA7 A;  4RSU A;  3BTX A;  1CON A;  4YVS C;  2WT1 A;  4LKS A;  4Y1X A;  5E1R A;  3BOW A;  3KCC A;  4BWO A;  5JIU A;  1BQP A;  4I02 A;  1WW5 A;  3CBN A;  3DYM A;  1SHW B;  4CSW A;  1DYO A;  3WQB A;  5EP9 A;  4KBZ A;  4DS0 A;  5FWE A;  4C0B A;  4ZXE A;  2Q8O A;  2VVF A;  1V9U 1;  2TUN A;  2WNU B;  2GC1 A;  5FPZ A;  1X7N A;  2VW2 A;  3VD3 A;  2XWJ B;  3AZV A;  2HWE 1;  4KH9 A;  3EJK A;  4CYD A;  4UW4 A;  4HZF A;  4XJW A;  2QDN A;  5FZD A;  3VKO A;  5BV6 A;  1TME 1;  1R08 1;  3A7Q A;  3AMN A;  3IWZ A;  4AED A;  2GZW A;  5H9R A;  1AX2 A;  4LBL A;  3CQO A;  1SBE A;  5IHR A;  1YCI A;  3APB A;  5FYV A;  1ZRD A;  4CDX B;  1DQ6 A;  4YZ1 A;  4I0B A;  4OI2 A;  4Q4V 1;  3AVR A;  5C8C B;  4Z82 A;  1DU3 D;  4QX7 A;  5FYH A;  2YRO A;  3LE0 A;  1LTE A;  3BOP A;  5CIS A;  2JG8 C;  1C1F A;  4LBN A;  3FUQ A;  1RUE 2;  4LHS A;  2A1X A;  2W87 A;  1WCS A;  3MIG A;  2XHN A;  1SEF A;  1PO1 1;  4EWD A;  4GWJ A;  3VD4 A;  2W1S A;  3VBO C;  3M3I A;  1SLL A;  4K20 A;  3T0B A;  5KXD A;  4OCT A;  1IPK A;  5FPA A;  5LA2 A;  4Q29 A;  4MLO A;  3DPR C;  1OD5 A;  4P5H A;  4LHK A;  4YGB A;  1GR3 A;  3HPN A;  3WT3 A;  5L7O A;  1ACC A;  3TEY A;  1DF0 A;  5FUI A;  4C1X A;  4S2G A;  4BXF A;  2VNO A;  4QX5 A;  3RSJ A;  1ZZC A;  4UF0 A;  4UFL A;  2QKD A;  2YZ4 A;  3WZ1 A;  4M0N A;  2EA7 A;  4L97 A;  1NQD A;  1GBG A;  4ZU4 A;  1HB3 A;  4Q1R A;  3AZZ A;  2JG9 C;  2RS3 3;  4YGC A;  5CFD C;  4NID A;  1NLS A;  4RD7 A;  3VKF C;  2P3J A;  2FCU A;  1LEN A;  3H3L A;  5FOJ B;  5KC6 A;  4AK3 A;  3NW4 A;  4QMA A;  4KI5 M;  1NG0 A;  3CLP A;  4URA A;  4AHX A;  3CIH A;  3DF0 A;  2P6H A;  2VD7 A;  3KD4 A;  1QDO A;  3MIE A;  2D97 A;  4FPY A;  5CA6 A;  3WY6 A;  5BNO A;  3I3M A;  1BBT 2;  5C5T A;  3B3Q E;  4V1P A;  1W28 A;  5JPN B;  3WNM A;  1MEC 3;  2VJX A;  1CAV B;  1ZX5 A;  2ZGL A;  1CPM A;  3AL5 A;  3J7H A;  3MV0 1;  2VMD A;  4GWI A;  4QXC A;  5G04 L;  5IVC A;  1NAE A;  2HWB 2;  3AYC A;  3LIH A;  4NAO A;  3ZDV A;  2EXK A;  4DXZ A;  5L9V A;  3SXW A;  4EZH A;  2FHR A;  2IXJ A;  4SLI A;  3LKJ A;  1GP4 A;  2PHR A;  2QE3 A;  1GNZ A;  1NT0 A;  2E63 A;  3LA3 A;  1O4Y A;  4IEU A;  2RDN A;  4LOR A;  1OLQ A;  2EAA A;  1YO8 A;  3VBH C;  4CU7 A;  4NRO A;  3LOI A;  4CEW C;  4NPL A;  3GHN A;  4RQP B;  2PHX A;  2LS6 A;  1WLC A;  4JX0 A;  2BWA A;  1G9C A;  4M00 A;  4QWN A;  1N1T A;  2BWC A;  4GAL A;  3PU3 A;  2R0H A;  2VOW A;  1CZV A;  3H1Y A;  1AL2 2;  5FZE A;  4FPF A;  4UOJ A;  1UKR A;  4EQV A;  3HN1 A;  3ZMO A;  3SNM A;  1QH7 A;  5JSP A;  3MIH A;  5FP4 A;  1J58 A;  1FI2 A;  1JUI A;  3KLS A;  3ZYR A;  1NA1 B;  4CDW A;  4QHZ A;  3VZO A;  2I07 B;  3WDX A;  1O91 A;  1D7P M;  1RHI 1;  1YFX A;  2WQZ C;  1A8D A;  3I97 A;  2X29 A;  2J1E A;  1SDD B;  2GC2 A;  4Q8L A;  2YV8 A;  1ENQ A;  5CB7 A;  2W92 A;  4KBB A;  3PHM A;  1XSQ A;  3HNM A;  2UU8 A;  1EAH 2;  2ZA9 A;  1OMI A;  2R04 2;  5KXB A;  5JVV A;  4JRL A;  5L73 A;  4AI2 A;  1FMD 3;  1YJK A;  2JJ6 A;  3OGV A;  5FQ0 B;  1XJA A;  4FBF A;  3ZIX A;  1UY2 A;  2GSY A;  2YMZ A;  3T09 A;  1JHN A;  1VBB 1;  5F3C A;  1V00 A;  2IXK A;  5F5A A;  2VBP A;  1AYM 2;  3IT8 A;  3MIB A;  3RPQ A;  1VBE 2;  3E5X A;  5ANQ A;  3USU A;  2AUY A;  5CAZ A;  1TEI A;  2W3J A;  3UL2 A;  5JXH A;  3WG4 A;  3N7M A;  3GDB A;  3ZFG C;  1FV3 A;  5FZK A;  1PO2 1;  4JRA A;  3ETP A;  2Q1Z B;  3AZY A;  1ZBA 1;  4OHW A;  3LWC A;  2VOT A;  3DL3 A;  1GQG A;  1QHD A;  3OBT A;  1BMV 2;  4NPR A;  2V5Y A;  2WZR 3;  4FPH A;  5K0U A;  5FIX A;  4ITC A;  3O1V A;  3ELN A;  4QGM A;  3ZYB A;  4ATE A;  2UY9 A;  5KHG A;  4UW3 A;  2A6X A;  3ZKU A;  4C90 A;  2ZOE B;  2FMD A;  2ATF A;  4GJY A;  4O9G A;  2FZ1 A;  4U36 A;  3I49 A;  5FUP A;  1WA4 A;  5FZA A;  1F15 A;  3JB8 A;  3I2F A;  1RUI 1;  2BV4 A;  3UNP A;  4K8R B;  4QDQ A;  3I2O A;  1LED A;  3MF6 A;  5SV8 A;  5HCA A;  3AP7 A;  1W9T A;  2CYF A;  2HWD 1;  3FHI B;  5FJH A;  4P14 A;  4A7K A;  4CU6 A;  2I45 A;  2VBB A;  3ABZ A;  3R4S A;  1F31 A;  1LRH A;  1C28 A;  4JGY A;  3WXP A;  5F39 A;  2WS9 1;  1R09 1;  4YGE A;  3VKM A;  5C8C A;  5FZ1 A;  5A7W B;  3T3Y A;  4FOV A;  4AI9 A;  2NN8 A;  5DUW A;  4I0A A;  5LZ6 A;  4RGA A;  3OD4 A;  5JZG B;  4IXL A;  4CUC A;  4J1W A;  2C24 A;  2WQ8 A;  3QLQ A;  2XQR A;  4Q27 A;  5EJZ B;  5A6Q A;  5JSR A;  3KT1 A;  3AYA A;  4ZZ8 A;  4FTE A;  5C33 A;  1W0N A;  4NIH A;  2V72 A;  1LHO A;  2ZGM A;  1K5M A;  2NYY A;  2Y6F A;  4WM7 C;  3WCS A;  5ABJ C;  1C8M 3;  4LTA A;  3V0A A;  5KBF A;  2D6K A;  3SIT A;  1YQ6 A;  1SG3 A;  3N9N A;  2ZCW A;  4Q4Y 1;  1GOG A;  2R07 3;  2Z42 A;  3VDD C;  1Z7S 1;  2KA3 A;  3WF1 A;  2Y6G A;  4GQ7 A;  4XF9 A;  4B4Q A;  1UX6 A;  3D4K A;  2J22 A;  2EXJ A;  2K46 A;  2Q5T A;  3NNL A;  4QX2 A;  3VUO A;  2GNM A;  3NJY A;  3X29 B;  2QQP A;  4Q0P A;  2AGS A;  4XJA A;  3NNJ A;  3CU7 A;  2Y0O A;  5T55 A;  1W06 A;  3VGI A;  2GC3 A;  1AX0 A;  2F17 A;  3CEW A;  1QNW A;  2WAA A;  4KWJ A;  4Q26 A;  4XET A;  5E6H A;  5A1L A;  5C3O A;  5I0S A;  5JWP A;  1OFN A;  1AR7 3;  4JGZ B;  3I2I A;  4OUL A;  3LDB A;  4Y33 A;  2ZBJ A;  3HQR A;  1RUC 3;  1SLI A;  3PJY A;  2XUM A;  3NJV A;  5DAV A;  3CJI C;  1RUH 1;  1VBC 1;  1PZ9 A;  2IWG B;  2K9Z A;  3CDZ B;  2CAV A;  3H9A A;  1EUT A;  2RMU 1;  4HKW A;  3AX4 A;  3PVO A;  4HSL A;  4IEP A;  4BQX A;  1JZ7 A;  3WR0 A;  1OH3 A;  1PZ7 A;  2WSV A;  4P9I A;  4QKD A;  4MXW B;  1DQ0 A;  1HW5 A;  4YVS B;  3KF5 A;  5FP9 A;  3QBQ A;  2WSU A;  3S0M A;  4URT A;  3KB5 A;  5HXM A;  1SFP A;  1W8U A;  4LPL A;  3E6B A;  4B1L A;  1JOP A;  5CFC C;  2BEO A;  5ACA 2;  2XJV A;  2PFW A;  3J8F 1;  3SH3 A;  3H8O A;  1QQP 2;  3WDT A;  1XBF A;  1LEC A;  5T54 A;  1RMU 2;  1VBA 3;  5LEK A;  1OUS A;  5J3U A;  2H6C A;  3M3C A;  1RUJ 1;  2Q0A A;  2CGO A;  1M4W A;  5IK8 A;  1PGL 1;  1EV1 2;  3FMG A;  3SH4 A;  4WVV A;  2IXH A;  3TBD A;  4AGG A;  1G9D A;  4N7I A;  3UK9 A;  1POQ A;  2JDN A;  2JEC A;  2D44 A;  3JD7 2;  4QQL A;  1VBD 1;  4FFI A;  1NY7 1;  4I01 A;  4MAD A;  4OHY A;  1W3V A;  2PLV 3;  4NHY A;  1ND2 B;  2RM2 1;  5FYS A;  4LIT A;  1MS9 A;  3WP6 A;  2MHF A;  1HRI 3;  3ECQ A;  4XBL A;  3W20 A;  4X6Q B;  4A3Z A;  5DZG A;  3NJZ A;  4AYU A;  3W58 A;  2J1U A;  3WQ1 A;  4CXX A;  3C7G A;  3VHR A;  2JG8 B;  3ZN4 A;  2RS3 2;  1S0I A;  4TN7 A;  4AHW A;  2ZKN A;  2JIJ A;  1DZQ A;  1QXP A;  4L8Q A;  3VBO B;  4Q0V A;  4Y5Z 0;  4Z2A A;  4IUG A;  3C3V A;  4NOT A;  3ZFF C;  1IZ3 A;  1N3O A;  5DZE A;  3DPR B;  5FP3 A;  4ET7 A;  3WG2 A;  2X5I C;  3ZYG A;  3GF6 A;  1C8N A;  1CAX A;  2GME A;  2RVA A;  3CMG A;  4PT6 A;  4X6R B;  4EN8 B;  3ASI A;  1ASJ 3;  2ET7 A;  5LRS A;  3AP9 A;  3POY A;  5SV5 A;  2CV6 A;  2HWF 3;  3BI3 A;  3CJX A;  5ISL A;  3OEB A;  2VM9 A;  1HIX A;  1XNK A;  4AVV A;  1G6N A;  1US3 A;  4UFH A;  1QKQ A;  4Q4W 2;  1N47 A;  3CKH A;  3LAG A;  1W9F A;  1UYX A;  2E7Q A;  2MNG A;  4LBJ A;  5JOY A;  3JBG 2;  4IV3 C;  4CEY C;  5CFD B;  5KHJ A;  4GD4 A;  5H9P A;  2IZW A;  4CCN A;  3RNS A;  5C4W A;  3UGH A;  4R8H A;  4CDQ A;  4AQT A;  1SDW A;  2ZKL A;  3GJA A;  1UU4 A;  2XVG A;  4LMF A;  3MHZ A;  3C2U A;  4CPB A;  4KWU A;  1GQP A;  1FX5 A;  3VZM A;  1PGW 1;  2ZGN A;  1NCR A;  2CU5 A;  4OMC A;  1RUN A;  2HLE A;  2XL7 A;  1JH5 A;  3POW A;  4R4X A;  1X50 A;  3I3B A;  3ZYP A;  3K3O A;  5AVP A;  2WNV A;  3ACI A;  1GNY A;  2HEY F;  1W9W A;  5C9A C;  5T52 A;  3ZKY A;  1RUF 2;  3HQU A;  4ASM B;  4Z2W A;  2Y33 A;  4AAX A;  5JUV A;  3FHA A;  1VRH 1;  4YNI A;  4FOW A;  1V9U 3;  5LBC A;  5IK4 A;  5A7W A;  4XBQ A;  4YYO A;  1VMH A;  3ZSE A;  3VBH B;  5JSO A;  1D0H A;  1W2T A;  3R05 A;  4M3C A;  1UIJ A;  3URF A;  4CEW B;  5GZG A;  2HWE 3;  1LGN A;  3ORJ A;  3ZN6 B;  5C3S A;  4QDR A;  2ZMK A;  3AP4 A;  1IKQ A;  3O0W A;  4OUE A;  1H30 A;  3MDP A;  1V6O A;  3ON7 A;  1TME 3;  1R08 3;  4LK6 A;  4V2W A;  1W2N A;  3EHK A;  1H6Y A;  1W6M B;  4MX3 A;  5F6K A;  3WLU A;  4NWV A;  5IFP A;  4A3X A;  1BK0 A;  1BVV A;  3DGT A;  1UN1 A;  4Q4V 3;  2O8O A;  5FY7 A;  4CDU C;  4FFG A;  4FCA A;  1KEX A;  1G8W A;  2VEC A;  2UY8 A;  1UZW A;  3GBG A;  3D0J A;  4KGG A;  2GNT A;  3LA2 A;  3W59 A;  1RIT A;  3OJB A;  3ZFE C;  5CG8 A;  2VUJ A;  3RZZ A;  2ZEW A;  2XLF A;  4PDW C;  1SBD A;  2YU2 A;  3KVB A;  4L0P A;  5A3N A;  4H55 A;  2WZR 2;  4BQ1 A;  1AXZ A;  2O0O A;  3J9S A;  1LU1 A;  3N9O A;  2ZZJ A;  5BNN C;  3RGB A;  1YYN A;  3NST A;  2Y0I A;  4XYX A;  3TNQ A;  5FY4 A;  4MV2 A;  4MXV A;  3PVE A;  4KWK A;  1E57 A;  2VUD A;  1VJ2 A;  2ZHL A;  4BQ5 A;  4AE2 A;  4HVO A;  4BQW A;  4MH0 E;  2PAK A;  2HBT A;  4JKK A;  3WF3 A;  3VZK A;  5FPL A;  2WWS A;  2QQL A;  3ZFG B;  1JZ5 A;  1OH4 A;  1GU3 A;  4HN1 A;  5CG9 A;  3VHO A;  1ALY A;  4JQR A;  1UOJ A;  1W6Q A;  3K4Z A;  1A3K A;  4YVS A;  2XJS A;  1W8H A;  1PMJ X;  2C1F A;  3VBU A;  1RTV A;  4W50 A;  4AAP A;  3ZYH A;  5I91 A;  1G7Y A;  2GNB A;  2YBK A;  3JU9 A;  5T5P A;  2CDO A;  3IMM A;  2RS1 1;  3I3D A;  5FPB A;  2R1D A;  3AK0 A;  3V56 A;  2OII A;  1OD3 A;  3VHN A;  5CVR A;  1NLQ A;  2GP3 A;  1XYP A;  3H8X A;  2PTM A;  5F5C A;  1PM7 A;  4UBH A;  2OQ7 A;  1C8M 2;  1QH6 A;  3N9M A;  1UQX A;  2E31 A;  1EPZ A;  4B8E A;  4ZKT B;  3UYJ A;  2XLG A;  1EUU A;  2LAL A;  2X53 S;  2UYA A;  2Y38 A;  4RFT 0;  1QJX 1;  4NRQ A;  4XF0 A;  1N3P A;  1V6N A;  1W2U A;  3ZYF A;  1V70 A;  4IGQ A;  4FXK B;  2OYZ A;  1AVB A;  1IG3 A;  2Q8E A;  1X8E A;  2BVV A;  2YHJ A;  1Z0H A;  4YZ5 A;  5BNP C;  1CX1 A;  4M3C E;  4XUR A;  1WKY A;  1PVC 1;  4P9X A;  4LUL A;  4QQP A;  3K4D A;  5BY5 A;  3TEW A;  2JG8 A;  2XJT A;  1W6P B;  3P6B A;  5EHD A;  4OVE A;  3AP6 A;  2D93 A;  1UZY A;  1ND3 B;  2ES3 A;  3IDB B;  2VCA A;  4M4P A;  1QDC A;  1NX9 A;  1I5P A;  2RJ2 A;  5FYB A;  4GB3 1;  4WV8 A;  2B45 X;  2ARA A;  1X8M A;  1RHI 3;  2WQ4 A;  4WM7 B;  5FMO L;  5ABJ B;  2R0F A;  2W95 A;  5JXG A;  2ZJC A;  3RDI A;  2VXR A;  4IV1 C;  1RXG A;  3JZV A;  4A41 A;  5FZB A;  4XEZ A;  4WM8 A;  3U4X A;  5FBJ A;  3VDD B;  2PEL A;  2YBS A;  2ZX4 A;  2ZXQ A;  3MLJ A;  3PJQ A;  1W9Y A;  4PQ9 A;  3WIN E;  4AR2 A;  1HRV 1;  2YG0 A;  1UU5 A;  2HEW F;  5EXO A;  4XUN A;  3WW1 A;  3H8R A;  1Y3T A;  3FLR A;  2GU9 A;  3H50 A;  2VAU A;  4GAZ A;  2XL9 A;  1A78 A;  2QTW B;  2ZZQ A;  4MET A;  1LAJ A;  3AXD A;  2EXH A;  1UKG A;  1UCX A;  1VBB 3;  2XB6 C;  3K3N A;  1PVX A;  4UXA A;  2JG9 A;  4LO6 B;  3KZ4 C;  3NO8 A;  4LNV A;  5CFD A;  3ZXD A;  1VBA 2;  2FBE A;  5G05 L;  5LY1 A;  3BTZ A;  1AJK A;  4MG2 A;  3AMQ A;  3D0S A;  3FHQ A;  1F4A A;  4L9B A;  4XIL A;  2D5H A;  3CJI B;  1GFF 2;  4AFB A;  3NAP A;  1YC6 1;  3NV2 A;  1PO2 3;  4HVR A;  3S6P A;  4AFA A;  4CCO A;  4RA0 A;  1UAI A;  4QPG A;  5DUX A;  1K45 A;  1ZBA 3;  1OQ1 A;  4R9D A;  4JKM A;  4P9J A;  3ME2 A;  3RYR A;  4RS5 A;  3VLB B;  4G9S B;  1DYK A;  4ERO A;  3AZX A;  5FO8 B;  4N53 A;  1UXZ A;  4XW3 A;  3ZSJ A;  3O1M A;  3G7D A;  1AUY A;  1UY3 A;  3K4A A;  1CD3 G;  1DGR N;  3CHX A;  5FZ6 A;  4AWD A;  1LOB A;  4F7Z A;  2QNK A;  4RGK A;  3WVJ A;  5CFC B;  1GNH A;  4AI8 A;  4NJ4 A;  5E88 A;  3S7E A;  1IPS A;  3WDU A;  5I0U A;  1RUI 3;  3HQX A;  3INA A;  3I54 A;  1SCR A;  5BNO B;  5CZK A;  1WZX A;  5LK7 B;  1QJU 1;  2HWD 3;  5CKM A;  3H42 B;  3VB9 A;  4MVT A;  4H14 A;  1UF2 C;  5A6X A;  2P1B A;  1MS3 A;  5GZF A;  2WS9 3;  1R09 3;  4QAW A;  3NV1 A;  1MZF A;  2VCB A;  1ASJ 2;  2WRA A;  5FYC A;  3BKZ A;  3WX5 A;  1ZZ8 A;  4HT1 T;  5IK5 A;  2HWF 2;  4YW2 A;  1DCS A;  2ZHN A;  1H1M A;  2Y34 A;  3QD6 A;  1ZNP A;  1W6N B;  4PIZ A;  3ILR A;  3WEZ A;  3DUI A;  1RL3 A;  1ULG A;  5GZC A;  3Q8C A;  4HG6 B;  4LBQ D;  4ZU5 A;  1V0A A;  1L7Q A;  2VOV A;  4I3P A;  3ACF A;  4I09 A;  4CPB D;  4QB1 A;  1JOB A;  4YVW C;  5A7S A;  4UAP A;  4Q4Y 3;  2OUH A;  4UW5 A;  5IUQ A;  3ZFF B;  1Z7S 3;  1YFY A;  2X5I B;  3P1I A;  3MV1 1;  1BHG A;  3OSD A;  4Y22 A;  3VBF A;  2WWJ A;  2E32 A;  3OF1 A;  4LOT A;  4D6Q A;  4QT6 A;  5FP8 A;  4AI1 A;  2Q1F A;  3RWN A;  2X10 A;  3F2Z A;  1SFN A;  1SLT A;  4E2Q A;  2DVD A;  1JYX A;  5ACA 3;  3VZN A;  3HN3 A;  1GZW B;  4BIF A;  4EYU A;  1UY1 A;  3ZXK A;  1NZC A;  4W8J A;  5DG1 A;  3T2P A;  3E6D A;  1AJO A;  3EB7 A;  4YZ4 A;  1RUH 3;  2A5Z A;  2WAO A;  4IV3 B;  4CEY B;  2A75 A;  4P9Y A;  4UWD A;  1O4Z A;  4DXT A;  2RMU 3;  3RZJ A;  3WP5 A;  1FYU A;  2QJV A;  2WWU A;  3ILF A;  4DB5 A;  3ZSL A;  5J37 A;  1PZ8 A;  4YW4 A;  4C8D A;  1R08 2;  3L2Y A;  3RFR A;  4E8D A;  4PIX A;  1ZRI A;  5F1R A;  3LZZ A;  1VPH A;  3U14 A;  3THT A;  3TN9 2;  3MIC A;  4CTE A;  1XNT A;  4Q4V 2;  3GXU A;  2ZGT A;  4XUT A;  4IL7 A;  4CUA A;  2DCK A;  2D7F A;  3O1U A;  1CIW A;  1CAW B;  1G86 A;  3NKT A;  4XFB A;  5A1F A;  5C9A B;  3HWJ A;  3AM2 A;  3ZXF A;  2ZS6 B;  4JGZ C;  3J8F 3;  1J83 A;  1S0E A;  3F95 A;  1PO1 2;  2P3K A;  5DPN A;  2PQQ A;  5EIY B;  1C5I A;  4ZS2 A;  2E6V A;  5F5I A;  2E9Q A;  4OUM A;  5J7M A;  1RUJ 3;  3W5M A;  5A1A A;  1OPM A;  2J1S A;  3ETQ A;  2RS5 1;  2H0B A;  5FFO C;  3V64 A;  3PIJ A;  1MQT C;  5CBL A;  2DBI A;  1OBN A;  1UO9 A;  1VBD 3;  2AZ5 A;  2WUH A;  3KHB A;  3QOP A;  5IAX A;  1RED A;  4CCK A;  4YZ2 A;  3O1P A;  1JOJ A;  2W1U A;  1QU0 A;  2QZ2 A;  5FYY A;  1L7R A;  2RM2 3;  5DUU A;  1AR6 1;  3TRS B;  2A3X A;  4CDU B;  4LHL A;  1PHM A;  1H8T A;  4N9H A;  2FCV A;  1COV 2;  3VDD A;  5AFB A;  1JZ8 A;  1GV9 A;  2WAB A;  4ISQ A;  3ZFE B;  2XPJ A;  1QMJ A;  4GWN A;  3VD7 A;  4DIQ A;  1ULP A;  4LEJ A;  3VDC A;  4PDW B;  1VMF A;  3IIA A;  1LHN A;  1N1S A;  2Y6H A;  1JI6 A;  4UBG A;  5BUV A;  5FRA A;  5FXV A;  4CCJ A;  3U1X A;  1X9T A;  5BNN B;  2JDA A;  1RVF 1;  2DVB A;  1IS5 A;  1DLC A;  4Z92 B;  5DDJ 2;  5FMB A;  1REF A;  1BEV 1;  1AR8 1;  3UGF A;  2XBO 1;  1DQ5 A;  2Q30 A;  4OHX A;  1ND2 C;  1ZRR A;  2FMY A;  1CR7 A;  3B9C A;  2P37 A;  3D3A A;  1VB2 A;  2FDJ A;  2GP5 A;  4LBM A;  3RI9 A;  2Z2S B;  1A8M A;  3O0V A;  3T1L A;  1IG0 A;  1T2X A;  3OUJ A;  4K7J A;  5HCF A;  4OZX A;  5C3R A;  4N9I A;  4P9G A;  3BN6 A;  4H7M A;  1UZZ A;  1MS4 A;  5AVA A;  5FO9 B;  3IDA A;  4C1W A;  5EYX A;  4TYS A;  2ILM A;  3N3H A;  4UFM A;  1W03 A;  4EWA A;  4N43 C;  4YFZ A;  3BVC A;  1V6L A;  5CFC A;  1FNZ A;  3IN9 A;  1T6B X;  4FTS A;  1VAM A;  5J09 A;  3RJ2 X;  1JXN A;  3OD0 A;  4KG0 A;  5LA9 A;  2XG3 A;  4CUB A;  1H1A A;  2GAU A;  3BTA A;  4D69 A;  4AVT A;  2XGX A;  4DY3 A;  5F3E A;  5HCH A;  4XZU G;  3TAY A;  4BA6 A;  2VNV A;  4AGR A;  4QD2 A;  1FPN 2;  3NQH A;  5AC9 2;  2HYK A;  2JB8 A;  2R06 1;  4ASL A;  3U11 A;  1VRH 3;  1UYP A;  4YPJ A;  2XXZ A;  4XIO A;  1LOF C;  2A73 B;  2TEP A;  1GQH A;  5BNP B;  5C5U A;  2IUW A;  3OPZ A;  4Y4R A;  4UFK A;  3WHU A;  4D6R A;  3WG1 A;  3BIW E;  1W8W A;  3N9Q A;  5EQU A;  4Z1V A;  2D6N A;  1VBB 2;  4Y5S A;  1W04 A;  3VD9 A;  1X9P A;  1VLN A;  4IQP A;  2H0V A;  4GH4 C;  4Y20 B;  2Y6K A;  3PU8 A;  2BBA A;  4IES A;  5J1X A;  3MF9 A;  2VUC A;  4AQS A;  4ES9 A;  4XHB A;  5LY2 A;  1VP6 A;  1PO2 2;  2BER A;  2B39 A;  4QXB A;  1LHW A;  2DUO A;  3DYO A;  1JN2 P;  4IV1 B;  5D8A C;  1RXF A;  3UV9 A;  1HXS 1;  1UXX X;  1ZBA 2;  2QQK A;  4Q0S A;  4F8A A;  3NV4 A;  2VW0 A;  5IJR A;  5FY5 A;  3O0X A;  3O1S A;  2G9G A;  1KS4 A;  1KJR A; 
#chains in the Genus database with same CATH homology
 2WYS A;  3HNB M;  5CKN A;  4TTG A;  5HXM A;  3T2O A;  4LPL A;  1SFP A;  2J1T A;  3A23 A;  2Z4F A;  2Y6J A;  2DDU A;  1JYN A;  3IB3 A;  3K77 A;  3SKV A;  3LEG A;  4A4A A;  2VZO A;  2W91 A;  1JHJ A;  1GUI A;  4MAD A;  2YB7 A;  5DN2 A;  3UET A;  2QBX A;  2ZEY A;  3POG A;  1F4H A;  5DMY A;  3MUZ 1;  1UZ0 A;  4ARY A;  3LEI A;  3SKJ E;  1IQD C;  2B4K A;  3ECQ A;  2VZS A;  4A3Z A;  2J1U A;  3IAQ A;  3WF0 A;  2W1W A;  2C9K A;  2VZR A;  3C7G A;  4P00 B;  4RN5 A;  5LA0 A;  2PQS A;  3I2H A;  4Z2A A;  2W94 A;  4IUG A;  2YC4 A;  1YQ2 A;  1MPX A;  4ET7 A;  2QQM A;  3CMG A;  2RVA A;  4PT6 A;  1PX4 A;  3W5N A;  2VO5 A;  2WDB A;  4XUO A;  5JR2 A;  4XUQ A;  3OEB A;  2VM9 A;  2WZE A;  1US3 A;  2JD9 A;  4JKL A;  2ORX A;  3CKH A;  5B4X A;  2EIE A;  1UYX A;  3HNY M;  4DUW A;  5JUV A;  4BK5 A;  4DUV A;  3WNO A;  2VQT A;  1CIY A;  3SEP A;  3WF4 A;  3A21 A;  1US2 A;  3LPG A;  5JXJ A;  3T0D A;  3POJ A;  4LMF A;  3NJX A;  1W9S A;  4KWU A;  1GQP A;  3GM8 A;  4BK4 A;  1XNA A;  4OMC A;  2HLE A;  4P08 A;  4D8M A;  3I3B A;  2JE8 A;  3ACI A;  3I3E A;  1GNY A;  3DEC A;  1W9W A;  4CVU A;  5DQ0 A;  3WSO A;  2WZ8 A;  4AAX A;  3FHA A;  3POF A;  4MOA A;  1W8O A;  2DCJ A;  3JXS A;  2VMF A;  2VCC A;  2QQO A;  4XVH A;  3CZJ A;  3IAP A;  2C4X A;  3ACG A;  3OGS A;  3DEM A;  4QDR A;  4OUE A;  2QQJ A;  1H6Y A;  1JZ6 A;  5IYY A;  5IFP A;  2V5D A;  1O8S A;  3VDB A;  2XON A;  1CZT A;  4MGQ A;  1KEX A;  3BGA A;  3NNG A;  4MO3 M;  4PF1 A;  2ZEW A;  2VZQ A;  4L0P A;  1TVG A;  4P5Y A;  3ZM8 A;  2C26 A;  4QDS A;  1UWW A;  5CYY A;  3THD A;  2OKX A;  1OF3 A;  1NUK A;  3ACH A;  3HEI A;  3DYP A;  4QPW A;  2Y8K A;  3A22 A;  5C7G A;  4JKK A;  3WF3 A;  3UES A;  2QQL A;  1JZ5 A;  1OH4 A;  2ZEZ A;  1GU3 A;  5CKQ A;  4CU9 A;  4BJ0 A;  3U37 A;  1R64 A;  1XPW A;  3K4Z A;  4D0Q A;  5JXI A;  3T0A A;  1UYY A;  1PMJ X;  4W50 A;  4ZY9 A;  1JYV A;  2CDO A;  2EID A;  3I3D A;  1NKG A;  3CZU A;  1OD3 A;  4DEQ A;  2BGP A;  3T2Q A;  1O59 A;  3WF2 A;  5F7U A;  3KQ4 B;  1RYY A;  2YFZ A;  1JYW A;  2WBK A;  2W9X A;  3T08 A;  3OGR A;  4AG4 A;  2E31 A;  2VR4 A;  4DXS A;  1EUU A;  5EJ1 B;  1JU3 A;  2HYX A;  2WN2 A;  4PQQ A;  1XC6 A;  2ID4 A;  3I2J A;  1CX1 A;  5LCW L;  4XUR A;  1WKY A;  3EYP A;  5LA1 A;  2VZP A;  3K4D A;  1UYZ A;  3NRU A;  4XUP A;  3P6B A;  2WO3 A;  4BXS V;  2VCA A;  4M4P A;  2BZD A;  1NX9 A;  1I5P A;  2RJ2 A;  2VL4 A;  3WNP A;  3FN9 A;  3MBW A;  2W95 A;  3PUI A;  5JXG A;  3C8X A;  4A41 A;  3WNL A;  2E33 A;  2LW8 A;  2ZXQ A;  1OT5 A;  4MGS A;  2YG0 A;  3C7F A;  4LKS A;  4XUN A;  2WO1 A;  2EIC A;  3C7E A;  4OMD A;  3DYM A;  2VZ3 A;  1SHW B;  1DYO A;  3WQB A;  3AC0 A;  4A45 A;  4ZXE A;  2J7M A;  3VD3 A;  5G05 L;  2E26 A;  4ZZ5 A;  5I0D A;  3FHQ A;  1F4A A;  3VD5 A;  2J1A A;  3A7Q A;  1K45 A;  1JZ2 A;  2Y64 A;  4JKM A;  3CQO A;  3K75 B;  2EIB A;  5IHR A;  1K12 A;  4KMQ A;  3LE0 A;  2BGO A;  1UXZ A;  5CIS A;  2W46 A;  1UY3 A;  3K4A A;  4LHS A;  1SPP B;  2W87 A;  2KD7 A;  1O8P A;  2XHN A;  3OB8 A;  4GWJ A;  2VC9 A;  4JHZ A;  3VD4 A;  2W1S A;  3PUH A;  3I2G A;  1JZ4 A;  3T0B A;  1UMH A;  2VZV A;  3K46 A;  2W1Q A;  5LA2 A;  5CZK A;  2XQX A;  5CKM A;  3WNN A;  3HPN A;  1PX3 A;  2J1V A;  3III A;  4QAW A;  5FUI A;  2VCB A;  3C7H A;  2QQN A;  1K3I A;  4FI9 A;  3WEZ A;  4CU8 A;  1H6X A;  1W8N A;  4HG6 B;  4BDV B;  3MUY 1;  1W99 A;  1L7Q A;  1JU4 A;  4A6O A;  2VQU A;  4KI5 M;  4RYD A;  3ACF A;  2L9L A;  3CIH A;  4DXR A;  4QB1 A;  3OG2 A;  2J1R A;  4UAP A;  2WO2 A;  2X09 A;  4UI9 L;  4LQR A;  3P1I A;  1J84 A;  1BHG A;  3MV1 1;  2VJX A;  4GWI A;  3E1F 1;  3J7H A;  3MV0 1;  3WNM A;  5G04 L;  2VMD A;  2E32 A;  1NAE A;  4LOT A;  2ZEX A;  2X10 A;  3F2Z A;  1LNS A;  3HOB A;  1JYX A;  5HPO A;  1NT0 A;  4LOR A;  2ORZ A;  2VMC A;  3C7O A;  3HN3 A;  1NZI A;  1UY1 A;  3LEK A;  4CU7 A;  2VME A;  3MO4 A;  4W8J A;  2VZU A;  2YC2 A;  3T2P A;  3EB7 A;  2LS6 A;  2RV9 A;  4JX0 A;  2WAO A;  2V4V A;  4TXW A;  1ULO A;  2VTF A;  3HJR A;  4DXT A;  1CZV A;  4UOJ A;  2WN3 A;  4E8D A;  1UMI A;  1JZ3 A;  2W47 A;  4OYU A;  1UX7 A;  4P02 B;  1XNT A;  3GXU A;  1D7P M;  4E8C A;  4XUT A;  2WNO A;  4CUA A;  2DCK A;  3I97 A;  2J1E A;  1SDD B;  2W92 A;  1J83 A;  1P8J A;  3HNM A;  5DPN A;  5EIY B;  1KGY A;  5JMO A;  3W5M A;  3OGV A;  5A1A A;  2J1S A;  3FL7 A;  3I2K A;  1UY2 A;  3T09 A;  2YFU A;  1PMH X;  2W5F A;  2WUH A;  5JXH A;  2W1U A;  2W3J A;  1L7R A;  3GDB A;  5B4N A;  5C70 A;  3ETP A;  1OF4 A;  1JZ8 A;  1WCQ A;  4QX3 A;  2WAB A;  2VOT A;  3VD7 A;  1ULP A;  3VDC A;  4QX0 A;  1GOF A;  3SEE A;  2B9V A;  2Y6H A;  1JI6 A;  4QB2 A;  2QQI A;  3THC A;  2JDA A;  1DLC A;  4QB6 A;  2X05 A;  5IFT A;  3OEA A;  2VZ1 A;  3I2F A;  1TG7 A;  4QX1 A;  3UNP A;  1UY4 A;  4QDQ A;  3D3A A;  4M4R A;  1CZS A;  1W9T A;  4GZ9 A;  4CU6 A;  1HN1 A;  3ABZ A;  1T2X A;  3BN6 A;  4A42 A;  4DEV A;  3LQC A;  3IDA A;  1GOH A;  3WNK A;  3VDA A;  3GGL A;  4CUC A;  4ARX A;  2WQ8 A;  2JKX A;  5EJZ B;  1SPP A;  4ZZ8 A;  1W0N A;  2V72 A;  1GMM A;  1K42 A;  2XOM A;  4CUB A;  3POE A;  1UY0 A;  4XZU G;  1SG3 A;  3POB A;  1GOG A;  3NQH A;  2Y6L A;  3WF1 A;  2Y6G A;  4YPJ A;  2J22 A;  4QX2 A;  4DUX A;  2R7E B;  2VZT A;  2CDP A;  2WAA A;  4A44 A;  3I2I A;  3OBA A;  3VD9 A;  4OZO A;  3NJV A;  2Y6K A;  2BBA A;  5J1X A;  3CDZ B;  1EUT A;  4LOS A;  2BER A;  3DYO A;  3POI A;  2QQK A;  1DP0 A;  1UXX X;  1JZ7 A;  3LPF A;  1SZB A;  5IJR A;  4W4Z A;  5C71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...