2QQKA

Neuropilin-2 a1a2b1b2 domains in complex with a semaphorin-blocking fab
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
568
structure length
541
Chain Sequence
PCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVYAPEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSMLYIKFTSDQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDLYDWLDIWDGIPHVGPLIGKYCGTKTPSELRSSTGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEWSPSAARLVSSRSGWFPRIPQAQPGEEWLQVDLGTPKTVKGVIIQGARARAFVRKFKVSYSLNGKDWEYIQDPRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neuropilin-2
publication title Structural studies of neuropilin/antibody complexes provide insights into semaphorin and VEGF binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 122
structure length 541
sequence length 568
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00431 CUB CUB domain
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2qqkA03
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2qqkA04
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 2qqkA02
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 2qqkA01
4MGQA 2LS6A 1J83A 4YPJA 1UX7A 2C9KA 1F4HA 1K12A 2W95A 3KQ4B 1GOGA 3MO4A 4XURA 2J22A 4IUGA 3J7HA 3NNGA 3T0BA 4DXTA 3K75B 3OEAA 3K4ZA 1W9WA 2VZVA 3CDZB 4A45A 1KGYA 3D3AA 1L7RA 4XZUG 4UI9L 2BZDA 3OBAA 3K4DA 4MADA 2WZ8A 5EJZB 5HXMA 3I2GA 3UETA 1D7PM 3I2HA 4CU6A 3VD7A 1SZBA 5DN2A 5G04L 1JU4A 2YFUA 3CZJA 3WF3A 4QX1A 3C8XA 1CZVA 4QDRA 1US3A 1K42A 2ZXQA 2YC4A 1RYYA 2B4KA 1JZ2A 4XUQA 3I97A 4D8MA 1UXZA 2DCJA 3IAQA 4OZOA 3DYOA 3IB3A 4BK5A 3I3BA 1JHJA 2QQJA 2WO2A 2WYSA 4DUVA 3POJA 1CZTA 4UOJA 1SDDB 3GGLA 2ORZA 1JI6A 3WNOA 1NT0A 5DMYA 2RJ2A 2VZUA 2WBKA 3CIHA 2WABA 3T0DA 2W1QA 5LCWL 1UY3A 3FHQA 3OG2A 2OKXA 5IYYA 2VQUA 3LEGA 1H6YA 2C26A 5C70A 2ORXA 5C71A 3OB8A 2QBXA 2EIBA 2J1AA 3IAPA 1SFPA 1SG3A 4CUAA 3MUY1 3ACIA 4LMFA 5CYYA 4BK4A 2VZOA 2ID4A 2VMDA 1UWWA 2XQXA 3SEPA 4ET7A 1L7QA 2J1VA 2YFZA 4JKKA 1OF4A 4DXRA 4DUWA 4L0PA 4JX0A 4ARYA 4LHSA 3WF4A 2VR4A 2PQSA 2YG0A 2VZTA 3OGVA 1NUKA 3ACFA 2XONA 1SHWB 3MUZ1 1W99A 2ZEZA 3POGA 1EUUA 1LNSA 3AC0A 4M4RA 2VCBA 4A4AA 1XNTA 1US2A 2VTFA 2WDBA 1I5PA 3FHAA 3GXUA 2EIDA 1O8SA 2VL4A 4QDSA 5JXJA 4A42A 3ECQA 1HN1A 2Y6KA 3WQBA 4KI5M 4OMCA 2VM9A 4QB6A 1PMHX 4CU9A 5LA2A 1W9SA 3SKVA 4MGSA 2W9XA 5F7UA 1UY1A 3A21A 2V4VA 3C7FA 4ARXA 2QQIA 4PF1A 3LQCA 5IFPA 4UAPA 4TXWA 3ZM8A 1WCQA 3WF0A 1DLCA 2VZRA 3P1IA 5EJ1B 1UYYA 5CKMA 2WAOA 3NJXA 2WUHA 1UXXX 1JZ6A 1IQDC 3CMGA 2J1TA 3I2KA 1JZ3A 4CUBA 3THCA 5JR2A 5JUVA 1PX3A 3VDCA 5CISA 2JDAA 1JZ7A 2BGOA 3I3EA 3MBWA 5LA0A 1JYXA 4MOAA 3C7OA 2W1WA 3VD4A 1CX1A 3BN6A 4W50A 3VDAA 3WNMA 2R7EB 2VMFA 3DEMA 3A22A 4LQRA 4LOSA 5G05L 3VD5A 1NX9A 2W1SA 1PX4A 3POBA 2JD9A 2W3JA 3SEEA 2QQNA 1UZ0A 2VCCA 5B4NA 2CDPA 2W46A 5C7GA 1JYVA 4GWJA 5I0DA 3GDBA 2XOMA 2W92A 3CKHA 2QQMA 4OUEA 2VZPA 4P00B 3HN3A 2J1SA 4AG4A 5J1XA 3VDBA 4XUPA 2W87A 1EUTA 3VD3A 3DYPA 1XNAA 2VCAA 2W5FA 1UY0A 3IDAA 1GOHA 1YQ2A 4QAWA 2WAAA 1JZ4A 1SPPB 3PUHA 3JXSA 3WF2A 1UY4A 4ZZ5A 4XUNA 2Y6LA 4E8CA 1W9TA 1SPPA 3FL7A 1JYWA 3LPFA 2VJXA 3HOBA 3CZUA 3U37A 4D0QA 4XUTA 4E8DA 1GOFA 1CIYA 3HPNA 3F2ZA 4LOTA 3FN9A 3A7QA 3LEIA 4RN5A 3WNLA 3I3DA 1W0NA 5LA1A 4LPLA 1J84A 1OT5A 4HG6B 4QB1A 4GWIA 2Y6HA 5EIYB 1GU3A 4JKMA 1TG7A 4CUCA 1GUIA 1PMJX 3ACHA 4ZZ8A 3NRUA 1O59A 2J1EA 3NQHA 1W8OA 4PQQA 1OD3A 3LE0A 4JKLA 3P6BA 3OEBA 4CVUA 2WZEA 1F4AA 1O8PA 3DECA 4QDQA 4QPWA 2BGPA 3OGRA 1JZ5A 1T2XA 3HNBM 2X05A 4BDVB 2XHNA 3SKJE 5CKQA 2W1UA 3C7GA 2J1UA 2CDOA 3I2IA 1K3IA 2Z4FA 2QQLA 5DPNA 2Y8KA 1XC6A 3UNPA 1K45A 2W91A 3OGSA 3MV01 4KMQA 3CQOA 1UMHA 2VZ1A 3T09A 4BXSV 1JYNA 4AAXA 3WEZA 5JMOA 2X09A 3BGAA 3T2OA 3PUIA 4CU8A 2ZEWA 2ZEYA 2QQKA 5HPOA 3WNPA 2EICA 3ETPA 4BJ0A 4Z2AA 5B4XA 2VZ3A 3GM8A 1UY2A 2VOTA 1NAEA 1UYZA 2JKXA 3K77A 2VQTA 4P5YA 3W5MA 4PT6A 4CU7A 2YB7A 3I2JA 3IIIA 4A3ZA 4DXSA 3W5NA 1UYXA 4KWUA 2W94A 5A1AA 5JXHA 1NZIA 1JU3A 3UESA 1W8NA 2QQOA 3ABZA 4QX3A 4P08A 2WN3A 2DDUA 4QX2A 5DQ0A 3C7HA 1UMIA 5JXGA 2EIEA 1CZSA 1GQPA 4A41A 2VO5A 4JHZA 4LORA 1JZ8A 3LEKA 2Y6GA 4P02B 1WKYA 1DYOA 2KD7A 4DEVA 3VD9A 3POIA 3C7EA 2J1RA 3WSOA 2BERA 1H6XA 2VMCA 3T08A 2VZSA 4XVHA 3T2QA 2JE8A 1BHGA 3HNMA 2WNOA 2YC2A 5IHRA 5IFTA 2E26A 4QX0A 4W4ZA 4TTGA 2VZQA 4GZ9A 4MO3M 4ZXEA 2J7MA 3I2FA 2E31A 3LPGA 4DUXA 4A6OA 5FUIA 4ZY9A 2C4XA 3HNYM 3T2PA 5JXIA 2W47A 2B9VA 4A44A 3WNKA 1KEXA 3HJRA 3HEIA 4QB2A 3DYMA 3POFA 1ULPA 4OYUA 1DP0A 5IJRA 3POEA 3WF1A 1P8JA 2V72A 1OH4A 1R64A 1TVGA 2BBAA 1MPXA 3K46A 5CKNA 2HLEA 2WQ8A 3NJVA 3MV11 4LKSA 2ZEXA 1NKGA 2E32A 2Y6JA 4RYDA 3A23A 3K4AA 4W8JA 2L9LA 1GMMA 3WNNA 1XPWA 2WO1A 2HYXA 3E1F1 4FI9A 2VMEA 2E33A 1OF3A 3EYPA 2DCKA 2RVAA 4OMDA 4DEQA 4XUOA 2Y64A 5CZKA 2V5DA 1GNYA 2WN2A 4M4PA 2WO3A 2RV9A 3ACGA 3THDA 2LW8A 3T0AA 1ULOA 3EB7A 2X10A 2VC9A
chains in the Genus database with same CATH superfamily
1BEV3 1EV11 4ATFA 1SLAA 3DL3A 4HL0A 4PQ9A 1R1A3 5F5IA 2ZHNA 3VB9A 4AVVA 1MACA 1KQRA 1C1FA 3JBG1 4QM8A 3JD73 5F5QA 4M3CF 1TME1 1ENQA 1GOGA 3WOGA 4XBNA 4YG3A 5FJKA 5A7QA 1APNA 3J8F3 1FV2A 1FV3A 4YM3A 3V64A 4L92A 5BNPB 3ILRA 1W6NA 3D4KA 1PO12 3UV9A 1UOFA 4DXTA 3IZOA 2DBNA 3K4ZA 1YFXA 4XJWA 4XAEA 4CDXA 5ERLA 5JI9A 1W9WA 1KFUL 2VZVA 5EP9A 4K1YA 3IDBB 1G7YA 1WBFA 3ZSMA 3VBFB 4UI9L 3NO8A 3N9OA 4AEKA 3HQUA 2D6KA 4NWVA 2BJSA 3K4DA 3BIEA 2HWE1 4S2GA 2FDHA 3I3MA 4LIUA 5HXMA 4QKBA 1VBC2 2ARCA 4JTNA 4BZ4A 3ZFGB 3U10A 5LK7B 5DN2A 1O3SA 4YVWB 5FZ9A 1JBCA 4CEWC 3AX4A 3WF3A 2EIGA 3OUIA 1US3A 3RYKA 4WVMB 2ZXQA 2E7QA 3I97A 5F3GA 4FTBA 2DCJA 3IAQA 3RG0A 1Y9QA 5T55A 4UYBA 1JHJA 1B35C 1MEC2 2WYSA 1PO13 3AXEA 4DUVA 1UU6A 1SDDB 4QHOA 3GGLA 4XFBA 1WCDJ 1O7FA 3MF9A 1OOPC 1XNCA 1PNFA 2QJVA 4FFHA 2R061 2JG8A 2D3SA 2WT0A 5DMYA 2RJ2A 2VZUA 4XQWA 2WBKA 3ZXGA 5FMDA 1W8UA 4XF0A 3VKMA 1CD3G 1V6IA 2BP6A 4I0AA 4ASMB 5A3UA 3T0DA 4LBQB 2W1QA 3FX3A 1VBC3 4PJYA 3FHQA 4N7UA 1Y7BA 1GYKA 1V70A 5J09A 3LEGA 4FP2A 2IC1A 4EN9B 1AL22 3TEYA 5C71A 3NJZA 1QGLA 1AX2A 4OFGA 2J1AA 1EV13 3FBYA 4AVSA 1CAVA 1SG3A 3RI8A 4KGQA 4CUAA 2CU5A 2E6VA 2IXJA 1H2MA 5ACA2 5FUPA 1QNYA 1NLSA 4COZA 1PGL2 1H1MA 4FPYA 2VZOA 3W59A 1JOBA 2ID4A 2YUEA 5L9RA 3GALA 1CPNA 2VCMA 4FP3A 3O7OA 4PDWA 3CJIA 3AMNA 1O4YA 1XXNA 3AZZA 3AVRA 4RD7A 4HVRA 3RJRA 4YZ1A 5L19A 4AAPA 2XR4A 4MHUA 1KS5A 3RZLA 3UKNA 5A32A 2NLRA 4XXPA 5LA9A 1JTZX 3O5SA 5IAXA 3GJAA 4N53C 4C0HA 3M2MA 2JIGA 1IKPA 1QXPA 4U2AA 3WVJA 2GH8A 1AL23 1NUKA 2MEV1 5DXDA 3CNAA 3ORJA 3UGGA 1JYCA 5LRSA 5AC93 1AJKA 2ZX1A 4O65A 1ZZCA 3ZN5A 1W99A 4MGYE 1YIPA 5KXDA 3POGA 2WS91 5FZ0A 5JSRA 4DS0A 1BBT1 1N1VA 1QJX2 1OUSA 5ACA3 3OJBA 5C4WB 4CEYC 2RM21 4IXLA 4QQ2A 4FAGA 1RHI1 3ST7A 4EWEA 5JZGB 3V0AB 1XNKA 1XNTA 4QU2A 1VRH1 3FHAA 1I5ZA 5C8CC 4NRPA 5F8PA 3RZJA 2VL4A 2TNFA 4P9IA 4TN7A 3PVNA 4CPBA 2AGSA 3WQBA 2KR2A 2ARXA 2WWUA 1ND3A 5BNNA 1M06G 1RVF1 4K21A 2WC2A 1DQ2A 4N43A 2OZ6A 2Y26A 4OLLA 1PHMA 2VU9A 5EYYA 1OPMA 5FWEA 5GALA 2DCYA 3A21A 4A3XA 1RMU2 2V4VA 2ZGPA 2HWB1 2QQIA 4K7JA 5FYYA 3QLQA 2Q8EA 2ZMNA 1HB2A 1RUE2 1RUH1 3GZTB 4Z2WA 4Q1PA 5FZ8A 3PTRB 1G8WA 3WG3A 4NIDA 3VBUC 1D4M1 1QJX3 2X8KA 2O1QA 3M3IA 3WQ1A 4KWLA 1GV9A 1ZZ7A 3X29B 3JCIA 4BE3A 3O1SA 2WUHA 2Q5TA 2QE3A 2J1TA 3BTAA 3I2KA 4Q29A 2NM1A 4KU7A 1HRV1 3B9IA 5E1RA 2EALA 1GKBA 5FZOA 3RGBA 5KC6A 3ALQA 5CISA 5ABJC 2A6ZA 4QPGB 1S0JA 4CEWB 4B7EA 4HVQA 5L7OA 2AC1A 2BGOA 4EV0A 1IPJA 5CFDA 5LA0A 2WWJA 1ODNA 1RMU3 2W1WA 1UQXA 5DDJ1 4RFRB 3PTYA 1CX1A 1W2AX 2Y60A 4KG8A 3BN6A 3AZWA 4Q4X1 5DAWA 4AHYA 4K1ZA 3DEMA 4V2VA 5LZ6A 1I3HA 5EWSA 3SMHA 4CP9A 1CAWB 2EVXA 3LIGA 5IWFA 5A3TA 4P9YA 1A8MA 1QJFA 1POV0 2W1SA 3LOBA 1PNGA 1YFYA 2DFCA 2QQNA 3VDDC 3ZN4A 3VBHA 5FPZA 3VHOA 5B4NA 5BNOB 4HBNA 4ZU7A 5D8AC 5C7GA 4XF9A 5I0DA 1PO23 2HEYF 1YRZA 5IK4A 1W8TA 2W92A 1LECA 2C1FA 3N7JA 2E51A 2PHTA 3DXUA 4CRQA 2UY8A 2ZS6B 4UFHA 4K6BA 4XUPA 3B01A 5DZFA 4XW3A 3W9AA 5CFCB 4LBQA 3BPZA 5FYMA 5FO8B 1VALA 3EBRA 3O0WA 1GOHA 3ZYJB 1S1AA 4PI2A 4IV3A 3G6JB 3JXSA 3WF2A 1UY4A 4JDOA 4ZZ5A 2PLV2 2XVLA 4NPLA 4NUBA 4E8CA 1REDA 2VTXJ 5HV0A 4YGEA 4E27A 5IVFA 3G7DA 3HT1A 4I2OA 3FL7A 1JYWA 3GNEA 4GJYA 5JOXA 1ZRIA 2BGCA 4ZU5A 5FYHA 1STMA 2RDNA 5GLZA 5K0UC 2YU1A 3BVCA 3MZHA 5F3IA 4E8DA 5LY2A 3NNMA 2OW4A 4AE2A 4XJZA 3GF6A 1CWPA 5LATA 1DYPA 1W2UA 5FP9A 5H9SA 2H0VA 2ZX4A 4GWMA 1HXS2 4RS5C 2HWC2 1NCQB 2BNNA 1LOFC 4Q4Y3 4YM2A 3HQXA 1J84A 2ZGSA 4PI0A 1YIFA 5EIYB 1PK6A 2CV6A 3EHKA 4H2AA 4JCKA 3VBRC 1GUIA 3MYXA 3H1MA 3J4UH 2VW1A 3ACHA 4XQDA 1W05A 2CGOA 1ST8A 3EJKA 2FQPA 1DGRA 3NQHA 2J1EA 1W8OA 4PQQA 4OCTA 3EMRA 2PLV3 2R0HA 1OD3A 3LE0A 4Z1VA 2ZOEB 1S0IA 2A1XA 3AL5A 3ZFFA 3KZ4C 4BQ4A 5BY5A 1NA1B 4MGIE 1J1TA 1YI9A 1Z7S2 4COVA 4CVUA 1M4WA 2GP5A 1O8PA 4YYOA 4PF5A 3OGRA 1JZ5A 1HX6A 5FKBA 5A7OA 4P9JA 1O3QA 3HT2A 4CSWA 4GQ7A 2V73A 3H1YA 4WM8B 2B9UA 2ZKNA 3KSCA 1SBDA 3OY8B 4Y5TA 2HWC3 2WA4A 3MFCA 1PIV1 5DPNA 2QQLA 1YJLA 4U36A 5JDBA 3ZXFA 3RNSA 5C3QA 4CCEA 2WINB 3WY6A 4LKEA 1POV1 4M01A 4NHKA 3GYDA 2W91A 4BQWA 1WCSA 1MZ6A 4LA2A 1Q8SA 1YEWA 2JDNA 3MGUA 1VAMA 5FRAA 3VZLA 1UOJA 3CQOA 3MLKA 4KMQA 2VZ1A 1W2OA 2XJSA 5D1IA 5IUQA 5JPMB 2QVSB 5FKCA 4XYXA 4YVSC 1KFXL 4BQXA 4Y20A 3WEZA 2X09A 4L2NA 3H8XA 1Z7S3 1CJDA 1LRHA 2Y6FA 4CCCA 3HWJA 4R9AA 5CBLA 4LHKA 2QQKA 5HPOA 2WT1A 2ZGLA 3ETPA 1QNWA 5DAQA 2MHFA 2Y38A 2GC3A 3I8TA 3KCCA 3O14A 2X5IC 3E5XA 3ZVXA 2RG4A 1UOBA 1NAEA 2HWD3 1V6OA 1RUC2 1DZRA 4IGOA 1SLBA 4JV4A 1CN1A 4XPVA 2VUDA 3J7LA 2JDMA 5FY7A 3W5MA 1YO8A 1AR61 4ZKTB 4ISQA 5FZ4A 2YB7A 2D6MA 1YYNA 2HEVF 4LBLA 3THTA 4OULA 5JSPA 1G9DA 3ZFEA 1RUF3 4GH4B 1W04A 2AYHA 5DZGA 4PLNA 1N1TA 2DTYA 3KF3A 3T1MA 1V9U1 1PZ7A 1UYXA 4KWUA 1W6MA 3FBMA 4PHZA 2R0FA 1BKZA 4LEJA 1H2LA 1HRI1 2UURA 2W2IA 4GMP0 5DABA 4ATEA 5JXHA 3BYWA 3S7IA 5A7SA 4FVVA 1JU3A 1V6JA 2EXHA 2BVBA 4P08A 1SLLA 4JRLA 3WW1A 4DXZA 1GWKA 1MS9A 3HBZA 4Q26A 4JAAA 2QQPA 4E2GA 2CNAA 2P17A 2DDUA 2WN3A 5DQ0A 2WA3A 1GP6A 1UF2C 3AMQA 4GKYA 3LA2A 4AEDC 4IL7A 2XJTA 4JDNA 2YGLA 2G19A 1KS4A 2EAKA 2GC0A 3WQ7A 5C8WA 2VO5A 1YLLA 4M3CA 1F5JA 1JZ8A 3SNMA 1ZBA2 1F35A 1OPOA 2GMEA 2QDRA 1DQ0A 3AP4A 4MHRA 4UW5A 5CADA 3N7MA 5C3PA 1UZWA 5IVBA 1H9WA 1WKYA 3POIA 1LHVA 1AHSA 4BLIA 4DEVA 1ZNPA 2JENA 1HKDA 3OCPA 2VGDA 1VBA3 4H14A 3WSOA 2BERA 3LD8A 3OOXA 3ZMNA 1QDOA 4EJRA 1G9BA 3M3QA 3T08A 4AZZA 1PVXA 4EWAA 4FPGA 3VBSA 3TNQA 5LASA 2XBO2 4YW1A 4Q4V2 3VKOA 2GZWA 3R4DB 3ZPYA 5A7WA 2RR12 3OUJA 4RR3A 2V09A 3DF0A 2R1DA 2WNUA 3V56A 3TEZA 1BHGA 1FI2A 2RS33 2WNOA 1W6OB 3HIFA 2JDUA 3VBOC 4PCRA 5C9AB 2BRTA 5CNAA 2XKOA 3IN9A 4I30A 4QPYA 4CCOA 1LGBA 4QX0A 1S0GA 4W4ZA 4M0NA 3U07A 1AR82 2XLGA 5IAVA 4C8DA 2J7MA 1EAH2 1OBNA 1ZBA3 1KITA 2I07B 3H7YA 3N36A 4XJ9A 4QT6A 4E2QA 3KM5A 3NKTA 1MQTA 4LO7A 4DUXA 4ZY9A 4FTSA 1VAVA 2UY9A 4NRQA 4QQOA 5FO7B 4AHWA 4A7YA 5JXIA 2W47A 4XIOA 4NAOA 3B9CA 4A44A 5LW9A 1UD1A 2R16A 2VVDA 5GKAC 1BK0A 1DQ5A 4IGPA 4QB2A 3BU0A 3O1TA 2XBO3 4Q4V3 2RMU1 2PHFA 4QPIC 1H2NA 3H1WA 2RR13 2VQAA 2HWF3 1OH4A 3N3HA 4ZU4A 1VRBA 2VBPA 4C90A 2FHRA 3R4SA 3K46A 2HLEA 2XL9A 3IWZA 4CP1A 4C91A 3WNXA 1E5SA 1V00A 1FOD2 4LKSA 1CIWA 1D2SA 4Q1RA 1OLQA 2OA2A 3MF6A 1NKGA 4H7LA 2Y6JA 3AYDA 3APBA 4XFHA 4GMP1 1QJU2 3O0XA 2DU0A 1GMMA 1AR83 1XPWA 3WNNA 2HYXA 3E1F1 3OBZA 5GM0A 1EAH3 1C5IA 4I0BA 4TLFA 1RB8G 4YZ2A 4XCBA 5FWJA 2QQVA 5LEJA 3HVDA 3LOIA 2YBKA 3M4FA 4BQ1A 3U78A 2XWJB 1QKQA 2ILMA 1WW5A 1UZYA 4XHXA 5JR7B 1IOAA 1GNYA 2YY1A 2GC2A 4AL9A 1ND3C 4MYEA 4WM7C 1XE7A 3V65A 2YGMA 3IPVA 3MFAA 3DV8A 2E7AA 2FBEA 5CVRA 2AEZA 4XABA 3EB7A 2JDYA 2X10A 3IM0A 4AVBA 3VV1A 3NNJA 4MGQA 1NCRC 1G6NA 1MVQA 2LS6A 2ZGRA 2DFBA 3E5UA 4EZ4A 1DQ6A 1FOD3 1ZVFA 2VXJA 3N35A 5F5AA 1R082 3MPPG 5BNQA 4LIVA 4PLOA 3BUCA 5FBZA 4AOCA 1QJU3 3UJOA 1LU1A 3HBKA 2W95A 3KQ4B 2QCSB 1W6NB 3THPA 4W65A 1W90A 4P5HA 2OXBA 4K8RB 2P2KA 1LOCA 2JIJA 4CDXB 4Q4W2 4HANA 4XIKA 3UGHA 3J7HA 3WDVA 3T0BA 5BNPC 5E88A 2RS11 2ADEA 4KH9A 1LU2A 3ENRA 2BW8A 4IEZA 5T52A 5KC5A 4NIGA 1BQPA 4RQPA 2RDRA 3ON7A 2BOIA 1RUJ2 2FMYA 1UZZA 3OSDA 3VBFC 3SQOA 2XVKA 2P37A 3E5QA 5DG2A 1OLRA 5EJZB 5GJ6A 4KL1A 3VHPA 2A75A 3I2GA 3N9NA 3UETA 1D7PM 2LRPA 1LHNA 3I2HA 2VMHA 1AYM2 4XJ8A 2WLPA 3VD7A 2DTWA 4H3WA 3ZFGC 1DBNA 4JGZA 2EF6A 4YVWC 5FZ6A 1AR73 1AR93 2JDZA 3C8XA 4QDRA 1R083 1UIKA 1QHDA 1K42A 3AMHA 5F3EA 3CLPA 1XYOA 4YNIA 1UXZA 4OHYA 1HV0A 4XFFA 1ULFA 1UKGA 5LBCA 4BK5A 5EZWA 4Q4W3 4XMIA 1UL9A 2O8QA 1LCLA 1X82A 2QQJA 5BPXA 1EPWA 2JG8B 4Q0UA 4BOWA 2VH9A 5M0TA 2TEPA 4Y4RA 3VBHC 4BMEA 5FPUA 3WNOA 3N9LA 2C0ZA 2P5BA 2FDIA 1RUJ3 1VBD2 2XL7A 2ZX3A 5FZLA 4IESA 1BEV1 1YC61 2A5ZA 1QU0A 1R1A1 1YQ6A 5FTTC 4IEVA 3ZSJA 1VR3A 3WT3A 5I8TA 1LTEA 4B3NA 3O1VA 3OG2A 3JD71 1AYM3 3ZYFA 3LIHA 2VQUA 1U5XA 3SC7X 3FC0A 2C26A 1CAVB 2ZA9A 3PJQA 2BOJA 4FPEA 4IV3C 3OB8A 1OKQA 3WW4A 1FATA 1CVNA 3J8F1 3GZEA 3VHRA 1DIWA 2DVGA 2LALA 3SCFA 2IXIA 4TYSA 4F83A 1FMD2 1GZ9A 5I0SA 3H8UA 4PDWB 3C2UA 5JVVA 3CJIB 2IFWA 2E53A 1DDLA 1F2NA 1ASJ2 1UWWA 1OI6A 2DVFA 2XQXA 3SEPA 1FT9A 1TQ5A 2P3YA 4LKFA 4DFSA 5A32B 3LEMA 4AVCA 1W9FA 2Q1ZB 4LO4B 1L7QA 3IT8A 1VBD3 1X36A 2PXJA 4PIYA 3WXPA 3I4IA 4JKKA 5E16A 4FAHA 5F3CA 4Z92B 1ZRDA 5K4LA 5A7PA 4AI2A 1ZZBA 3JB8A 3RZHA 4QXKA 5GLTA 1RUI3 4LHSA 5FXVA 1CAXA 1NY72 1SCRA 3QH7A 2GAUA 2VZTA 3OGVA 2IUWA 3AP9A 4UW3A 4LLOA 5FO9B 3ACFA 1HB3A 4BXFA 2XONA 5F6KA 1PO11 3ZXAC 4COUA 1WMFA 1ND2A 3OGJA 1EUUA 3AC0A 4I3PA 4M4RA 1ALYA 5C4WC 2I2SA 3K2OA 1BYHA 4E4HA 1ASJ3 1UIJA 2PN5A 2ZZQA 4O9EA 4OI4A 2R042 1UCXA 2NP0A 4A4AA 1CGPA 4CP2A 5JZGC 1X9PA 1I5PA 3GXUA 3KV5A 1S0EA 4AI0A 4E2SA 3LFMA 5BNNB 1VBC1 2GC1A 4A42A 3ECQA 2Y6KA 4N43B 1QJY2 2VW2A 2G9ZA 2VUAA 2LUWA 2WZR3 4IGQA 4OMCA 1WGPA 1EYBA 1SFYA 1COV3 3VZJA 4QB6A 5KWRA 2Y0IA 1ZX5A 1DGWA 3FZ3A 3R0RA 1TEIA 4LO5B 1BZWA 5F7UA 5A3PA 5FV3A 1YQ8A 3C7FA 1LOBA 3NV2A 4XFAA 3T1LA 2R072 1YCIA 1TMF2 1BVVA 5FDBA 3WDTA 4PF1A 4FOWA 2BU9A 2VNRA 3B93A 4LE3A 4YM1A 4YW3A 3RDIA 5IFPA 4AFCA 4QKNA 4XMAA 3ZKYA 3PHMA 3SCGA 1DLCA 2VZRA 3PU3A 5EJ1B 1UYYA 3ASIA 4MGKE 5CKMA 3AMPA 1MS3A 5T5JA 2JG9A 2W0XA 4QKFA 4MV2A 2BBVA 1UXXX 5I91A 2HKXA 2XJPA 5K8SA 3NNFA 5A3NA 1CONA 5C6CA 4HPKA 2GN3A 5FZOB 3H7JA 2D43A 1WA4A 1W03A 3K3OA 4I0WB 2HJIA 5JUVA 1H4HA 1QJY3 5L7OB 3KV6A 3K51A 1AL21 2B46X 3USUA 4LHLA 2PFWA 5CFDB 1GP4A 4YFZA 2JECA 4QPGC 5AC91 1NQJA 2FZ1A 3I3EA 1YWKA 1HB1A 3MBWA 4M3CE 4XDPA 4AHZA 1R1ZA 2VBDA 1MS4A 1Q8QA 3M1HA 4CUGA 1SMVA 5ACA1 1PGL1 2XDVA 2FCUA 1WMEA 4W50A 4CP9B 3WNMA 4OZXA 2O14A 2VPVA 1FXZA 2OQ6A 5SV8A 4DZGA 2RJLA 2K46A 5BV6A 5FPBA 1XU2A 3VBHB 5G05L 2VVEA 2VOVA 5HBAA 3VD5A 1C8M2 2A7AA 1PVC2 2Y34A 2W3JA 1DQ4A 2QDNA 2J42A 5GZEA 3AMMA 3ZYBA 2VUCA 4CP0A 4KG0A 5BNOC 2XHKA 3D0SA 1KDMA 2XOMA 4LUKA 1GICA 3B00A 3B7MA 3WG2A 4F3JA 4P00B 4TZDA 3WLUA 2J1SA 4L9BA 4AG4A 3VDBA 3VGIA 2W87A 2XLFA 4IQPA 5C3RA 4WZCA 3I59A 4IV3B 4JZRA 5CFCC 4NIIA 1TME2 4QX8A 4O7XA 3KCXA 3KWVA 5FYIA 2F6BA 4LK6A 3Q9OA 4OHVA 1QJX1 2QQUA 3PUHA 1VPHA 3WW2A 1DGRN 1YFWA 3LKJA 4IETA 4KU8A 1SPPA 3ZXJA 4LUMA 1FNZA 2WNUC 2P3KA 3GBWA 3LPFA 3BOPA 4FPLA 1MEC3 2VJXA 2CHHA 3INAA 1N3PA 3QH6A 5FLIA 2PMWB 1A6CA 1C8M3 3PVEA 4NIAA 2WR9A 5FAXA 1PVC3 4QWNA 1HV1A 3LDRA 4XUTA 2WWSA 1GOFA 5A80A 5C5TA 4J6GA 5EFUA 4PLMA 3HPNA 4CZSA 4IV1A 1VBE2 3WCRA 2OS2A 3MLJA 1PM4A 1C1LA 4ORFA 4YW6A 5FQ0A 3H8RA 1PK6B 3IMNA 1NCQC 1SBFA 1QMJA 1W0NA 4JTOA 4E4SA 3OYWB 1RMU1 4GWIA 2DURA 2Y6HA 5T5PA 1RUE1 4JKMA 4TSVA 1RIRA 1HDKA 1S0DA 1X8MA 1PMJX 2D7FA 2G4IA 5ANNA 3O1PA 3ZFFB 3MW4A 4R4ZA 1IZ3A 2DVAA 1UN1A 2A6YA 3AXDA 2K9ZA 4E4DX 5TSWA 5CEHA 1LJ7A 1W0PA 1OQDA 4NHXA 3ES4A 1RXFA 4GA9A 3D82A 1YQCA 1NA1C 1AX0A 2ES3A 2R062 3IKWA 3KD4A 3WDXA 2H0BA 1PO21 3DECA 4QDQA 5KR7A 1D4VB 4YGCA 1T2XA 4JGYA 3BTYA 3JB4C 2X05A 4BDVB 4BB3A 1VBE3 4ES8A 2J1UA 4WM8C 2VD7A 3RWNA 3GZUC 2OZJA 2B42B 1WLWA 4R9DA 4YW7A 3SH3A 2JKBA 4RGKA 2BNOA 1VLNA 4Q0QA 1BK1A 4CDQA 1XC6A 3SCHA 3P3PA 2ZCWA 2DVBA 1K45A 4EE2A 3PUSA 3BTXA 1VMFA 3MV01 3UK9A 1NQDA 1C3HA 1REEA 3UGFA 2R49A 4Y20B 1N3QA 1UMHA 2CGNA 4NMIA 4RSUA 3RQ0A 4BXSV 1CPMA 4AAXA 3ZIWA 3BGAA 2EXJA 5EYXA 1MZEA 5FZAA 1IG0A 4NWWA 5FXWA 2WFF2 3ZXDA 4D6SA 4Y5SA 5J98B 2EICA 4Q4Y1 2A3YA 5HXVA 5B4XA 1RJ8A 1UNBA 2D6PA 1UY2A 3ES1A 2JKXA 5B2GB 5J96B 3FLRA 2VQTA 3ZFEB 3OUHA 3TB0A 2YMZA 4P5YA 2MEV2 2K2SA 2XJRA 1BLZA 3I2JA 1SQ4A 2YYOA 5CU1A 3ZOIA 1W6MB 4R9BA 2PLV1 3QBQA 4DXSA 1OQEA 2D5FA 4GH4C 4XF4A 3W5NA 1AXKA 4RFT0 1RUE3 1JHNA 1YXWA 2LTNA 4UFMA 5K9YA 2RM22 2W94A 4H7MA 4YG0A 5H9PA 3U75A 5A1AA 3RWKX 1RHI2 2AACA 2C6SA 1NZIA 4Y1YA 5IK8A 4UWDA 3OD4A 1W8NA 1VRH2 2Q4SA 2UYBA 5CB7A 5FY1A 3CU7A 2WFF3 3AYCA 1HXS1 2HWC1 3WP5A 3C7HA 3CBNA 4Q5OA 3JUUA 3H8OA 4M3CB 3GBFA 4BQ3A 3WG4A 2R32A 3I2OA 4G9SB 4JHZA 1XBFA 1D0GA 2CY6A 3ZYIB 2IFRA 4E4ZA 3LA3A 1JOPA 2Y6GA 2AREA 3KVAA 2KD7A 1DYOA 4XILA 3LWCA 1FAYA 5GZFA 3VBSB 4AFAA 2OIIA 2Y0OA 4COWA 5A7WB 4BIOA 1Z7S1 3KVBA 4RR3B 4XVHA 2WNUB 1WLCA 4ZS2A 2VULA 3B94A 3RMYA 3T4VA 4YRDA 3PVBB 1E5RA 3MW3A 2XPJA 5E8AA 4QKDA 5A33A 5GZCA 2P6CA 1HRV2 4LE4A 4I09A 2HWD1 2WNVA 2W52A 2B7YA 2D40A 4PBOA 5C9AC 1MQTB 2H6CA 1DG6A 1H1IA 1RUF1 4GZ9A 4XDQA 2P34A 4DINB 2VNOA 2IXCA 4MLOA 4XFCA 4BPZA 2JJ6A 3I2FA 2E31A 3LPGA 5T3NA 4BM8A 3LA7A 1U5IA 5DDJ2 3HNYM 3PMEA 5DAPA 3WR0A 4QXCA 3OYWA 1HW5A 3OPTA 1WBLA 4NHYA 4Q4X2 3H42B 4UFJA 1ZRRA 4ES9A 1RXGA 4A7ZA 3ZDVA 3SISA 3OPWA 3BTZA 3OF1A 4OYUA 1DP0A 3GZAA 4ASLA 1QWRA 4K20A 3GCXA 1P8JA 1K5MA 3M3EA 5HCAA 5FOJB 1R64A 4ZS3A 4CCMA 2BBAA 2CAUA 1WD3A 2R1BA 3BODA 3NJVA 2OYZA 5C3OA 1MZFA 2ZEXA 1OSGA 4OUSA 3U1XA 4B1MA 1JUHA 4RA0A 3EO6A 3A23A 1HXS3 4K40A 5FY5A 4CXWA 4DIQA 2BVVA 2QNKA 1GNZA 1VBA1 4AXOA 1NXD1 4LJHA 4DO0A 4CDUA 3AKSA 4X6RB 2GMPA 2Z42A 2ZGNA 3VHNA 2EAAA 2XVGA 3OBTA 4QQHA 4FXGB 2ZGQA 4Z07A 5LEKA 1OF3A 2YDEA 5AVAA 2E7TA 2Y64A 4IEQA 4FFGA 4XDOA 1LODA 2QKDA 3IPVB 2V5DA 1KDKA 4AR2A 3AZXA 4M4PA 3TN92 1UO9A 2RS31 3ELNA 3NAPA 2ARBA 3M70A 1LULA 2ZGUA 3NV3A 1PGW1 5EHDA 1H8TA 2RV9A 3IDCB 2JWPA 1S0FA 2ZGOA 3C3VA 1AJOA 1MZ5A 5A1LA 3T0AA 1ULOA 3PU8A 3WX5A 3WINE 4BMBA 1J83A 2DUPA 1AXZA 4IEUA 1FNYA 1UX7A 1ZBA1 1QOTA 4LO8A 4CXXA 4XC9A 1C57A 1DLLA 2ARAA 2ET1A 3M8LA 4D7SA 4ZHNA 4XURA 5JIAA 2J22A 2TBVA 4L97A 3VZOA 4CDXC 3RJ2X 4RQPB 3K75B 2XBO1 3OEAA 4INDA 4Q4V1 3TOJA 2DBIA 3AVSA 1H4GA 1RTVA 5FZKA 4X6QB 2A3XA 2RR11 3CDZB 4A45A 1KGYA 3FUOA 4AI8A 2HWF1 5LWBA 3D3AA 1L7RA 1OFNA 3TN93 3DGTA 4Q0SA 2BZDA 1N47A 2BPA2 4HOOA 1S0CA 1VJ2A 4GJZA 3DN7A 1JZ2A 4JGZB 4BCUA 1SZBA 1UX6A 1GR3A 3Q8AA 5HCBA 4CU6A 1ZZ8A 1JU4A 4I3GA 3AZYA 4NPRA 1AR81 2YFUA 3CZJA 1OH3A 4S2DA 1EAH1 1WMXA 5KXCA 3WG1A 1ZZ9A 4NAMA 1RUC3 2PHLA 1ZM1A 1ZZ6A 2YC4A 2B4KA 2WNEA 1GWMA 4XUQA 1TZOA 4BISA 4XE9A 4OZOA 4D8MA 2NMOA 3M3CA 5FBJA 4C1XA 1QOOA 4IERA 2JD4A 3DYOA 3IB3A 3NKGA 1W6QA 5FP3A 4B4RA 1HQLA 3POJA 5FR3A 1CZTA 4UOJA 5KXEA 2ORZA 4ASKA 2JG8C 1RUD2 1B35A 1JI6A 3ZSLA 1NT0A 3LZZA 4UXAA 1OD5A 4BH9A 1L7LA 1OA2A 1HN0A 1OOPA 3MLLA 1QQP2 4Y1XA 1ZYBA 4B4PA 3P5BA 3F95A 3KQRA 2F4PA 3W20A 1ZBE2 1WCUA 1A34A 1FOD1 1AZDA 2WQZC 4XFIA 3I54A 2YHJA 3POYA 3K48A 4Y5Z0 3HAGA 4LXLA 3E6DA 3GHNA 2EXKA 4W6YA 3RFRA 3WW3A 1QJU1 2A3WA 3TEXA 1PZ9A 3KT4A 3WHUA 1H6YA 5C70A 5F37A 1GBGA 3O1OA 2GNTA 3R05A 2XJVA 1YNAA 4HK9A 2QBXA 2B39A 1GZWA 4FSJA 4QGNA 3KB5A 2OX0A 5FUNA 2DWRA 2PAKA 4IEWA 3CHXA 5DG1A 3T3YA 1YJKA 4GB32 1S2BA 3MUY1 3ACIA 2Q0AA 4V1PA 1DZQA 1WLTA 5CYYA 1W8ZA 3B5LB 4BK4A 2FDKA 2UWAA 4PDWC 2C9AA 3CJIC 2VBBA 1DYKA 2GN7A 4KBBA 2RS52 5J3UA 1X8EA 4KWJA 5A3OA 3MICA 3T2TA 2YBPA 3DPRA 1ODMA 3PIJA 1QQP3 4XCAA 5JI7A 1N1SA 2YFZA 4DUWA 4DXRA 3MDPA 1OMIA 3UT0A 1ZBE3 1DGWX 1FPN2 1CAXB 2ZABA 2HYKA 1AR71 1AR91 1OVPA 3CJXA 1R081 1S2EA 3TYJA 2AH2A 2V4AA 3FMGA 3WF4A 2VR4A 4N53A 4C0BA 1KJRA 1WW6A 5A6ZA 3LFIA 1LHWA 4AEMA 1EP0A 1ND2B 4P9GA 4Q4W1 5KBFA 5F9TA 3U0ZA 1UPSA 4K9SA 1SHWB 3N7KA 4EZHA 1SBEA 5I0RA 2ZEZA 4GAZA 4GB33 4RHV2 3ITQA 3Q8FA 1LNSA 3NVCA 3ZX7A 2WRAA 3USSA 3MPBA 2C5DA 5LY1A 1U0AA 1RUJ1 4D6RA 1W8WA 1AVBA 3AP6A 4AI9A 3KGLA 2WLQA 4QHBA 1QH6A 4LK7A 5I0UA 2WDBA 3CEWA 4FXKB 4DRVA 3O1RA 3S57A 4DOUA 2EIDA 2WYFA 3N9PA 4Y22A 1I9RA 1RUG2 4L8QA 4I01A 2WIIB 1AYM1 5BNNC 5C8CA 1O6UA 1PMIA 3O1MA 5FY4A 1FPN3 4N43C 4XHBA 1OC1A 2WKKA 4B8EA 5IVCA 4GIQA 2WJSA 1ENRA 3ROUA 2ETEA 2XQRA 1PMHX 4LBKA 3WP3A 1LAJA 3A0NA 3SKVA 3KT1A 4MGSA 1UMZA 3AP5A 5L73A 5BUVA 3I49A 1GQGA 3IBMA 1UW8A 4ARXA 4OHWA 4YZ5A 4DNYA 4IW3A 2JE9A 1OUXA 5FIXA 5IVYA 2BEOA 4MUVA 5FYBA 4UAPA 2E63A 2IVJA 2OPKA 4UBGA 4TXWA 2D97A 3ZM8A 1WCQA 2JG9B 2AEYA 3GBGA 5T50A 5F1RA 1SACA 2DCTA 4EQVA 4LHNA 4HPKB 3NSTA 3VBUA 2WAOA 5A3LA 1VBD1 4OQ9A 3NJXA 1JZ6A 4P14A 3KS7A 1IQDC 3JZVA 3WHTA 3KMHA 3CMGA 2W39A 4GKXA 4OI2A 5IK7A 4YW5A 2P3IA 2PTMA 1JZ3A 4CUBA 3USUB 1RUG3 2Q1MA 4AVAA 5FREA 2RE9A 1RUI1 3J7NA 3PURA 4LT5A 3AYEA 5CAZA 5L7OC 5JLVA 1PX3A 5T5LA 2FDFA 3VDCA 1JS9A 1W2TA 3T30A 5CFDC 1JZ7A 1R092 5FK8A 2VE1A 1VMJA 3I7DA 5ABJA 3E6BA 4BQYA 1XQNA 2ZHKA 4MOAA 5FMOS 2FDJA 1FMD1 3C7OA 3WDUA 1GNHA 3RZKA 5E89A 1Q8VA 4K3UA 3ZXEA 5DUXA 2X29A 4OI1A 1ASJ1 2R7EB 4K8FA 3A22A 5FMCA 4LA3A 3S0MA 4URAA 2HH9A 1DF0A 4LOSA 3B69A 2RDQA 4LQRA 5AVPA 2ZX0A 3NJYA 3ZYPA 4CCLA 3TRSB 1NE6A 4NHMA 2JD9A 2ZHMA 4Y24A 4OHXA 4XFGA 3O12A 5CG9A 5FXXA 2CDPA 2WZR1 4GWJA 3VDDA 1COV1 4KNCA 5D8AA 3CKHA 2QQMA 4OUEA 1NY71 1I6XA 1O5LA 1QH7A 2PHDA 3BALA 3HN3A 3I59B 2YROA 5FZBA 4D3WA 3ZDSA 2LM3A 3VD3A 5FZIA 3DYPA 5F5CA 4A2UA 2VCAA 1W6PA 1UY0A 2W5FA 2CGPA 5JOZA 5GLUA 1CJPA 1N1YA 3O0VA 1E5HA 1YUDA 1JYTA 4IEXA 2WAAA 4QAWA 1SPPB 1JZ4A 1HJFA 4O61A 1F15A 1EPZA 5FZ1A 4IDZA 4XUNA 2PA7A 5FPXA 4EROA 3NV1A 1W9TA 4OHZA 1RL3A 2Q8DA 2ZZJA 3PMSA 4IEPA 4F8AA 5C3SA 5LBEA 4FCAA 3CZUA 3BB6A 4IV1B 1DCSA 2YXSA 2WNVC 3QACA 3R4UA 2GMMA 5FFOC 1NG0A 1CIYA 1GZCA 2FDGA 1QJY1 4HLTA 4LOTA 4UW6A 5FQ0B 5FYZA 2XKPA 2VQ0A 3FN9A 3A7QA 3AYAA 1VBB2 3RZMA 4HKWA 3MIBA 4RN5A 1JH5A 3I3DA 4BQ5A 4RS5A 5LA1A 1PK6C 4AQ2A 1OT5A 1LOFA 2RHPA 4QB1A 4MXWA 2ZAHA 1GU3A 1TMF1 2KM2A 2KA3A 3FFQA 1TG7A 4Z82A 5HCFA 5F39A 3VBRA 4IE6A 2OUHA 5C33A 4AFDA 3NRUA 4AGGA 4AGRA 4D7YA 1O59A 1QXJA 2QZ2A 1OA4A 1F5FA 3ZFFC 5KHHA 3UKTA 5FZMA 2G9GA 1CAUA 2D6NA 1FMD3 5HV4A 2DVDA 5I0TA 4QX7A 5A3WA 4EN0A 2VVFA 4JKLA 3P6BA 4FFIA 4WVVA 3ZSKA 5KHIA 3RMXA 4UW4A 4JGYB 5FMOL 4MXVA 3U11A 3A4UA 5FZDA 1C8NA 2WZEA 1OLME 1F4AA 1H8VA 2VNVA 4X8PA 2Q8OA 2BGPA 1YFUA 3HNBM 2JDKA 1R1A2 4HN1A 3SKJE 1J3RA 4XEZA 2W1UA 5CKQA 1U5ZA 2XUEA 3OBRA 4CDQB 3ZR6A 1Q8PA 1VBB3 3JD72 2BV4A 3I2IA 5A6XA 1F8VA 2Z4FA 1WZXA 2WO7A 4CDUC 2XLAA 5EQUA 5FPAA 3GJBA 4Y4YA 1XB9A 3J8F2 2ZHLA 1S0BA 1AUYA 1TNFA 1LR5A 1QXRA 3OGSA 4V2WA 3H9AA 3AKTA 4QU1A 4WVZA 1XYPA 3POSA 1W39A 2QTWB 1UAIA 4LO6B 1MEC1 2ZJCA 3T09A 1W3XA 4HKOA 1C8M1 1VMHA 4JC1A 4CE8A 1H8TC 1PVC1 4Q8LA 4FBFA 2BUKA 4META 5JCTA 4YVSA 3T2OA 3PUIA 1AYN2 3MIGA 2R043 1GQHA 5LK5A 2ZEYA 1O91A 4AQTA 1OQ1A 1TE1B 2I45A 2D6OX 3WNPA 3FUQA 1RJ7A 4ITCA 4QD2A 4LTAA 1HIXA 2VAUA 5L9VA 2ZKLA 3AP7A 4FQ4A 2X5IA 2Z79A 1N3OA 4COYA 3ZFEC 1Y43B 1T6BX 4PT6A 4CU7A 1WD4A 2G9FA 4NE9A 3IIIA 3WD5A 1IS3A 4A3ZA 2NQYA 1NYWA 5F2WA 4Y3OA 4OI0A 2LROA 3N4MA 2A70A 2R073 5LRRA 1TMF3 3NW4A 4FPCA 4KBZA 4HSJA 1ZRCA 4CTEA 4QGMA 2DYCA 4YGBA 1J3QA 1ULDA 2D6LX 3KLSA 3UESA 4AK3A 1UU4A 1Z78A 3LSDA 2QQOA 2XWBB 4QX3A 4OQ8A 5F2SA 1Q56A 1VBE1 2WQ4A 4RGAA 1AYN3 2WZPP 3DKQA 2ZGTA 2RDSA 2FCTA 2ZGMA 1RC6A 5I93A 3RYRA 4HVOA 1GQPA 5F32A 2XJUA 4YLZA 4QMAA 1EV12 4AEDA 4UT5A 4LORA 4HMZA 3ILFA 4I02A 4WBBA 2A6XA 3JBG2 1XNDA 3SXWA 3PDQA 5FMBA 4FOVA 3SITA 1UOGA 2I74A 3VD9A 2AR6A 1W8HA 1BCXA 1H9PA 4XBQA 2MNGA 3C7EA 4UBHA 5KHGA 2J1RA 4YW4A 1F9KA 2Q1FA 3VBSC 4MH0E 2VZSA 3PNAA 4BA6A 3SH4A 2WSVA 2FMDA 4RR3C 5DZEA 5A33B 1F31A 1IPKA 1IHMA 4YG6A 2WNVB 1ENSA 1IKQA 2JE8A 4J25A 4LULA 4FPJA 4FPOB 1BXHA 4WV8A 3HNMA 2P6HA 2EXIA 3VKNA 3DXTA 3M7AA 1ZRFA 1VB4A 2HWE2 1LGNA 1LHOA 2YC2A 4LKDA 1HJGA 1YI7A 3KF5A 4LBNA 1G9FA 2D3RA 1T6GC 5LBFA 3VBOA 4AVTA 4NJ4A 2B5HA 5AC92 4TTGA 5FP7A 1MQTC 1OHFA 4MO3M 3URFA 3AJZA 3LGRA 3ZR5A 4CCJA 4DQAA 3WP6A 3JBG3 3UJQA 2R6QA 5FUIA 1SDWA 4A6SA 2AUYA 1H1AA 3T2PA 2OPWA 3ATGA 4LBOA 1TME3 4XF3A 2JE7A 2DCZA 2VMGA 1MS8A 2WL1A 1AF9A 3ZN6A 1O4ZA 1CX4A 1Q8OA 4KWKA 3DPRC 1AXYA 4R4XA 1ONAA 2ADDA 4Q0VA 3SH5A 1KEXA 3EXUA 3HJRA 3HEIA 4NR1A 1K5MB 3DYMA 3POFA 1O3TA 2NMNA 1D2QA 2WSUA 1ULPA 2WFF1 4LITA 5IJRA 2D44A 2XXZA 2ZMKA 3LSEA 1ULGA 2ZX2A 3POEA 1YHFA 2JICA 3JU9A 4GXLA 2Q8CA 1V6KA 3U4XA 4QPIA 5DUVA 5FZHA 5J7MA 1TVGA 1WMDA 3VZNA 2CAVA 1WW7A 2A6WA 5CKNA 4AYUA 3NWKA 5LB6A 4MX3A 3GCWA 4CDWB 1RGSA 3MV11 3IDEA 2HWE3 4O9GA 2O0OA 4FQZA 2IVIB 1G86A 5FP4A 4B4QA 4YWAA 3K4AA 1NLRA 3AK0A 4YM0A 4W8JA 3KV4A 4XJUA 2L9LA 3ACLA 3QD6A 4CDUB 2WO1A 3FFZA 4R8HA 1Y4WA 4IE7A 3RPQA 2D98A 5JPNB 3RRDA 5FCCA 3AKRA 4JRAA 4Q0PA 5KXBA 4QXBA 1W0OA 2WT2A 1X9TA 4DPNA 3NAPB 3K3NA 3FE5A 5CZKA 1H8TB 4MSVA 4D94A 3RZGA 2PHUA 4XACA 2WO3A 1LB2A 2GU9A 1Q43A 4XETA 2UWCA 1XSRA 3ACGA 3THDA 2XMLA 2R063 3AKQA 4UF0A 3PLQA 1DGLA 4WM7A 1RITA 4CU9A 1XOYA 1IPSA 1E5IA 2K0GA 1OKOA 5H9QA 4JQTA 1JMUB 3TEWA 5DAVA 4AEJA 2UWBA 3V0BA 2UYAA 4YPJA 4NPMA 3R6SA 3AZVA 2C9KA 1I1EA 1NCRA 1F4HA 2A73B 1BMV2 2ET7A 1VB2A 4NN0A 5EPAA 3GHMA 1K12A 3CL1A 3PIGA 3MO4A 4JDMA 2CSGA 2ZTNA 4IUGA 3H3UA 3NNGA 5FXZA 1A8DA 1IS4A 1IS5A 1QF3A 4RQPC 1NZCA 5BNPA 4KQ7A 2WS92 3AL6A 5FYCA 1BBT2 1SLCA 2ATFA 4MGZE 2GDFA 1NE4A 2D5HA 4XZUG 3SLIA 4QGLA 3UL2A 2BYVE 2JB4A 1PO22 3ZIXA 2Z69A 3OBAA 4N9IA 5JOYA 1RUOA 4GWNA 4MADA 2HEWF 3ZPOA 2WZ8A 1WLDA 2NPIA 5GLVA 3VBFA 3VUOA 1Y3TA 4M00A 1WA6X 5D21A 4ZONA 4JGZC 4KGGA 2HBUA 5G04L 2F17A 4CYDA 5J36A 1W06A 4L99A 1O3RA 2ZMLA 4AFBA 1E57A 3OPZA 5FYSA 4DMIA 1RVF2 4QX1A 3ZFGA 1LGCA 3E6CC 1CZVA 3Q8BA 4FO9A 1JUIA 4YVWA 3H0OA 5FZEA 3UYJA 2CYFA 2QZ3A 1RYYA 1LHUA 3KCYA 1KXGA 1W6QB 1ZA7A 4QQPA 2A6VA 4YARA 2MEV3 4WVMA 2HWB2 3Q8EA 1B35B 3S30A 5H9RA 3I3BA 1RUH2 2WO2A 1DU3D 1OOPB 2YU2A 1DQ1A 2KXLA 2Z2SB 2ZAAA 3VZMA 5IVJA 2WS93 1IS6A 4ONUA 1BBT3 1D4M2 3KT7A 2XB6C 3I2DA 5CA6A 1HQNA 2CWSA 2RM23 4AHXA 3T4HB 1RHI3 1CESA 1L3JA 3CIHA 3EQEA 1QDCA 2OVUA 1XYNA 3UKVA 4NIHA 1VRH3 2WABA 4Q4Y2 1KD7A 4LR4A 5LCWL 3O1UA 4YZ4A 1UY3A 2OKXA 1GSLA 2JXAA 3BOWA 1GZWB 5IYYA 2ORXA 3ZXLA 5L36A 1RVF3 2PAMA 2EIBA 5FYVA 1VIWB 1LOGA 4G4FA 4LLFA 3IAPA 1SFPA 2XG3A 5A1FA 3MIDA 4LMFA 2HWB3 4JHTA 1NXMA 2VMDA 1RUH3 1Q5OA 4PIXA 3U14A 2BTVC 3DPRB 3JQWA 2VECA 3TN91 4R9CA 1X33A 2PAEA 1D4M3 1HLCA 3KHCA 4ZXKA 4ET7A 1QIQA 4HZFA 5IW0A 2J1VA 4D69A 1OF4A 2PHXA 4FPFA 4QXHA 4M0HA 4EN8B 4L0PA 1PM7A 3MIFA 2E9QA 4JX0A 1OA3A 4N53B 4XJAA 2CL2A 1D0HA 2GH2A 2VUJA 5ANQA 3U4SA 4ARYA 1HRV3 1ACCA 1U12A 3RSJA 5JSOA 2DUQA 3H3ZA 4J1WA 1RUC1 4NHLA 2PQSA 2YG0A 3WUCA 4BHPA 2TUNA 1XE0A 1B09A 3ZYHA 1ZA4A 4CDWA 4CPBD 4EYUA 2IXHA 1ND2C 2YV8A 4FT8A 3KGZA 3MUZ1 3VL8A 4QX5A 4HETA 5FLHA 3NL1A 4FFFA 5GZDA 3W58A 4BIFA 1ENXA 2BNMA 2OT7A 4CEYB 3JQXA 5DDJ3 4MVTA 3TWIA 1NOVA 2CWMA 5CIRA 4Q4X3 3AM2A 2NZ9A 4AWDA 2VCBA 1MS1A 3BKZA 1VE0A 4OVEA 1S55A 4Y22B 5C4WA 5A70A 1US2A 2VTFA 4HXCA 3ZKUA 5C8CB 1GZTA 3MHZA 1X7NA 5SV5A 1O8SA 5JZGA 3V0AA 1OLMA 2QQWA 4QDSA 4EWDA 5JXJA 1HQWA 5FPVA 4AGVA 1HN1A 2HWD2 1IGOA 1WCKA 2VW0A 4KI5M 3WUDA 5F6LB 2H6BA 2VM9A 4QQLA 4W6WA 4YFWA 1LENA 3H3LA 2GSYA 1RUF2 1W9SA 3ETQA 2W9XA 3FLPA 1UY1A 4Y1UA 5LA2A 2XUMA 4AFMA 1C28A 1VAKA 1HB4A 4N7IA 3DKWA 3L9JT 3LQCA 5JWPA 3S5AA 5T54A 3VBUB 1LEMA 1RUD1 3WF0A 4AI1A 4AI3A 1UKRA 2Y33A 2JG9C 3P1IA 3AKPA 2JDHA 1LESA 3ZXKA 1Y9GA 1QQP1 3DUIA 4AW7A 2VOWA 3PUQA 4B1LA 2YBSA 2XH6A 4RGGA 1ZBE1 1IQAA 2QFEA 3BCWA 2FD8A 3THCA 4YSFA 4XF1A 3WZ1A 1GWLA 5JR2A 4AQSA 5AFBA 2GALA 2BFUS 3NMBA 5L9BA 5ABJB 4UFKA 2JDAA 4N9HA 4IE4A 5CG8A 2VY0A 4C1WA 2GP3A 1PIV2 4HFSA 5A7NA 2IWGB 1JYXA 4GB31 4QPGA 4WVWA 4CEWA 1VBA2 2F4LA 2SLIA 4CCKA 1GP5A 4BWOA 3VD4A 4SBVA 1A78A 2B8MA 3VDAA 2SBAA 5J37A 4MG2A 2IZWA 2G1MA 2VMFA 3D5OA 3POWA 2N7GA 2RS51 4Z8BA 2BWCA 4LBQD 2VMIA 5IK5A 4GD4A 1NX9A 2DV9A 1PX4A 2NYYA 3POBA 2W68A 3VDDB 2RS32 3SEEA 1UZ0A 2VCCA 1H0BA 3PUAA 1CAWA 1PGW2 3N9QA 2UU8A 5D8AB 1FPN1 2W46A 3NNLA 3OD0A 4IEYA 4Q2FA 3Q8CA 1JYVA 5FZGA 3LDKA 1KRIA 4FTEA 2YPJA 3GDBA 5BNOA 4RL7A 3IIAA 2VZPA 4XTPA 1PGSA 4PIZA 1W6PB 3FJSA 5J1XA 1EUTA 5ISLA 1PIV3 1CR7A 1XNAA 3FWEA 4W6XA 5K7PA 1REFA 3FLTA 2P1BA 1SFNA 3HN1A 3IDAA 4RHV1 1AR62 1S4CA 4LBJA 1YQ2A 5CFCA 1POV3 3BPSA 3TAYA 4X8NA 1OXCA 4B7KA 2Y6LA 4YZ3A 2CTVA 1QOSA 1V9U2 4TLGA 1WW4A 4NVPA 5K0UB 2XGXA 3U37A 3HOBA 3W21A 4D0QA 1J59A 2HWF2 1HRI2 5FPLA 1RUD3 1RUG1 3AJYA 3I3QA 4IV1C 2FZ2A 3QCWA 2YPDA 3J26N 5C5UA 5J48A 3BI3A 3F2ZA 1Z0HA 5APAA 4RS5B 3RZZA 3D0JA 4Y26A 1XU1A 4MXWB 1SCSA 3LEIA 5D2AA 1GLHA 1H30A 3WNLA 1QEXA 5HCHA 5I8SA 1OURA 4Q27A 2PHRA 4LPLA 4CA9A 1LOAA 4HG6B 4DY5A 3VBRB 1NCQA 3AFGA 4J1XA 1O5UA 1V0AA 3S7EA 2DUOA 4EN6B 3A0KA 2PYTA 4URTA 3VL9A 4CUCA 3J9SA 5FZFA 5IATA 4MZUA 1CAUB 1AR63 2A71A 1XSQA 2VNGA 3PJYA 3RYPA 4ZZ8A 1QY4A 2BFUL 3CF6E 1V6LA 1K5JA 2R30A 1URXA 4Q8KA 2EA7A 1V9U3 1W3VA 3B3QE 4P9LA 3WDYA 1LOEA 1SLTA 1ULCA 3OEBA 5BXXA 1HRI3 4JGYC 4HONA 1GANA 1NA1A 4CEYA 1KJLA 2P4EA 2RS53 4QPWA 4TWTA 5A6QA 1G9CA 4JVAA 2ZGKA 1POQA 2XHNA 2GNMA 3C7GA 2VC9A 4XTMA 4QM9A 2CDOA 4Y33A 1R091 4NRMA 2ZBJA 4CDQC 5EXOA 1K3IA 4WM8A 4FOQA 2Y8KA 1JYIA 3LDBA 3OY8A 5E6HA 1JOJA 1UZVA 3WP4A 1Y9MA 3UNPA 4BQ2A 2VG9A 5IT6A 3VN4A 2YC0A 3CO2A 4H55A 1AL0G 5FY9A 2D3PA 2VXRA 2ENRA 4YVSB 5FZ3A 4RHV3 1JYNA 1MS0A 3WCSA 4B29A 2AENA 5JAXA 5JMOA 3LF7A 5JMCA 1LEDA 5FZCA 4GULA 1A3KA 5EV7A 1C4RA 3P3NA 4CU8A 3ZSEA 1WWYA 3ILNA 2RMU2 2ZEWA 4DRRA 5GZGA 4EN7B 4L11A 4Y1ZA 1W28A 4BJ0A 5IVEA 2X5IB 3E97A 5FJHA 1UYPA 3RVHA 4Z2AA 1AR72 1AR92 2V5YA 2VZ3A 1RINA 3MIHA 1C5HA 3GM8A 2VOTA 1UYZA 3K77A 3KV9A 2B45X 4NOTA 1QJEA 1CQ9A 2IXLA 3OTFA 3LAGA 2IXKA 3TNPB 1W8FA 3SHRA 1J58A 2VOKA 5I8YA 1XRUA 3TBDA 5BYNA 2AZ5A 1UPIA 4NROA 1S2KA 4IE0A 1SEFA 4LBMA 1YQ5A 2DF7A 3MI8A 5FP8A 3RS6A 5AFEA 3FHIB 3L2YA 4GH4A 4QHZA 4S2HA 4Y1VA 3ME2A 5A3MA 5DUUA 3HMYA 2ZACA 2RJKA 5FY8A 5T5OA 3ZYRA 3ABZA 3DCQA 1FYUA 3MEPA 5FK7A 4FPHA 1BMV1 5EJ3A 2JEMA 2RMU3 5FLJA 1VBB1 3IMMA 4QX2A 1V6MA 1UMIA 4AEDB 5JXGA 3M3OA 2EIEA 1CZSA 2GNBA 3WV6A 2PQQA 4A41A 3PVOA 4E9KA 1W9YA 1XNBA 2P3JA 3ZYGA 3HR9A 3S5QA 2Q30A 3LEKA 2BWAA 2D93A 3HQRA 4N8MA 1R093 1G9AA 4GMP3 4MGTA 1PZ8A 3B02A 4P02B 3WQ0A 4R52A 1AX1A 3KHBA 4IEOA 1V6NA 1H6XA 3D8CA 5DAXA 2NN8A 4P9XA 4XAAA 2VMCA 1JW6A 1BVP1 2RS12 3OGGA 4S2FA 4D7TA 1TNRA 1JODA 1GFF2 2R041 3T2QA 1ULEA 2QUOA 1IG3A 4NO4A 4ISRA 1LKNA 4HK8A 4AQ6A 5KHKA 4D6QA 4FPKA 5K0UA 3VBOB 3MW2A 3VZKA 1RUI2 5KHJA 5HI0A 1W2NA 3WDWA 4SLIA 1BJQA 2WFPA 4HKLA 2DU1A 1RUNA 5IHRA 4XZPA 1W6OA 2ZPXA 3PL0A 2E26A 5IFTA 4XXAA 5C9AA 2VZQA 4FOYA 5DUWA 4ZXEA 4CCDA 5LBBA 4G3YC 3ZN6B 1NLQA 5IVVA 2OQ7A 1DFQA 1J3PA 2ERFA 4A6OA 2R071 3QOPA 4A7KA 2C4XA 1X50A 4GALA 1OVSA 3LCPA 2B9VA 3VLBB 2MPFA 5FYTA 4IE5A 3WNKA 5FZ7A 4AF9A 2BQPA 2W08A 3ZLIA 4YGDA 1VP6A 1SLIA 2RS13 4UFIA 4DY3A 5JIUA 1AYN1 4QPIB 1K5MC 2PELA 4P9WA 4BYYA 1QJZA 2GNDA 3WF1A 1JXNA 2V72A 2WZR2 1UU5A 2X53S 4LNVA 1MPXA 2BDRA 4ZPIA 1COV2 1BEV2 2PHWA 2JDPA 2WQ8A 2JX9A 3MIEA 3N7LA 4HSLA 3J7MA 4CXYA 4WZFA 3VKLA 4N90A 3ZMOA 4CDWC 2FCVA 2E32A 1MR5A 4RYDA 1FX5A 1O4TA 2HBTA 3H50A 4UFLA 5GLWA 5A6YA 1DHKB 2C24A 1MS5A 1U5YA 1JN2P 3AB0A 3HD8B 1EY2A 4JQRA 4XBLA 5FY0A 3AFKA 3BIWE 4FI9A 3N9MA 1DZTA 2YZ4A 1J1LA 2VMEA 4OUMA 4DB5A 2E33A 3D6EA 4PBPA 1WUVA 3BU7A 2DCKA 2RVAA 2VTXA 3EYPA 4HT1T 4OMDA 4XUOA 3S6PA 4DEQA 4BLJA 1XJAA 5FYUA 3NAPC 3RI9A 4BU2A 3ZO0B 1XE8A 2WN2A 3LB9A 2O8OA 1ND3B 4UF0B 2JB8A 4WM7B 4XQ4A 4YW2A 5JOWA 2OUJA 3NV4A 1Q3EA 2XJQA 5FOBB 1OFSA 2VOXA 3VKFC 1H2KA 4CCNA 4HN0A 2LW8A 4F7ZA 3V0BB 1ZREA 3L2HA 1MVEA 2Z5WA 1NCRB 4XOGA
chains in the Genus database with same CATH topology
4MGQA 2LS6A 1J83A 4YPJA 1UX7A 2C9KA 1F4HA 1K12A 2W95A 3KQ4B 1GOGA 3MO4A 4XURA 2J22A 4IUGA 3J7HA 3NNGA 3T0BA 4DXTA 3K75B 3OEAA 3K4ZA 1W9WA 2VZVA 3CDZB 4A45A 1KGYA 3D3AA 1L7RA 4XZUG 4UI9L 2BZDA 3OBAA 3K4DA 4MADA 2WZ8A 5EJZB 5HXMA 3I2GA 3UETA 1D7PM 3I2HA 4CU6A 3VD7A 1SZBA 5DN2A 5G04L 1JU4A 2YFUA 3CZJA 3WF3A 4QX1A 3C8XA 1CZVA 4QDRA 1US3A 1K42A 2ZXQA 2YC4A 1RYYA 2B4KA 1JZ2A 4XUQA 3I97A 4D8MA 1UXZA 2DCJA 3IAQA 4OZOA 3DYOA 3IB3A 4BK5A 3I3BA 1JHJA 2QQJA 2WO2A 2WYSA 4DUVA 3POJA 1CZTA 4UOJA 1SDDB 3GGLA 2ORZA 1JI6A 3WNOA 1NT0A 5DMYA 2RJ2A 2VZUA 2WBKA 3CIHA 2WABA 3T0DA 2W1QA 5LCWL 1UY3A 3FHQA 3OG2A 2OKXA 5IYYA 2VQUA 3LEGA 1H6YA 2C26A 5C70A 2ORXA 5C71A 3OB8A 2QBXA 2EIBA 2J1AA 3IAPA 1SFPA 1SG3A 4CUAA 3MUY1 3ACIA 4LMFA 5CYYA 4BK4A 2VZOA 2ID4A 2VMDA 1UWWA 2XQXA 3SEPA 4ET7A 1L7QA 2J1VA 2YFZA 4JKKA 1OF4A 4DXRA 4DUWA 4L0PA 4JX0A 4ARYA 4LHSA 3WF4A 2VR4A 2PQSA 2YG0A 2VZTA 3OGVA 1NUKA 3ACFA 2XONA 1SHWB 3MUZ1 1W99A 2ZEZA 3POGA 1EUUA 1LNSA 3AC0A 4M4RA 2VCBA 4A4AA 1XNTA 1US2A 2VTFA 2WDBA 1I5PA 3FHAA 3GXUA 2EIDA 1O8SA 2VL4A 4QDSA 5JXJA 4A42A 3ECQA 1HN1A 2Y6KA 3WQBA 4KI5M 4OMCA 2VM9A 4QB6A 1PMHX 4CU9A 5LA2A 1W9SA 3SKVA 4MGSA 2W9XA 5F7UA 1UY1A 3A21A 2V4VA 3C7FA 4ARXA 2QQIA 4PF1A 3LQCA 5IFPA 4UAPA 4TXWA 3ZM8A 1WCQA 3WF0A 1DLCA 2VZRA 3P1IA 5EJ1B 1UYYA 5CKMA 2WAOA 3NJXA 2WUHA 1UXXX 1JZ6A 1IQDC 3CMGA 2J1TA 3I2KA 1JZ3A 4CUBA 3THCA 5JR2A 5JUVA 1PX3A 3VDCA 5CISA 2JDAA 1JZ7A 2BGOA 3I3EA 3MBWA 5LA0A 1JYXA 4MOAA 3C7OA 2W1WA 3VD4A 1CX1A 3BN6A 4W50A 3VDAA 3WNMA 2R7EB 2VMFA 3DEMA 3A22A 4LQRA 4LOSA 5G05L 3VD5A 1NX9A 2W1SA 1PX4A 3POBA 2JD9A 2W3JA 3SEEA 2QQNA 1UZ0A 2VCCA 5B4NA 2CDPA 2W46A 5C7GA 1JYVA 4GWJA 5I0DA 3GDBA 2XOMA 2W92A 3CKHA 2QQMA 4OUEA 2VZPA 4P00B 3HN3A 2J1SA 4AG4A 5J1XA 3VDBA 4XUPA 2W87A 1EUTA 3VD3A 3DYPA 1XNAA 2VCAA 2W5FA 1UY0A 3IDAA 1GOHA 1YQ2A 4QAWA 2WAAA 1JZ4A 1SPPB 3PUHA 3JXSA 3WF2A 1UY4A 4ZZ5A 4XUNA 2Y6LA 4E8CA 1W9TA 1SPPA 3FL7A 1JYWA 3LPFA 2VJXA 3HOBA 3CZUA 3U37A 4D0QA 4XUTA 4E8DA 1GOFA 1CIYA 3HPNA 3F2ZA 4LOTA 3FN9A 3A7QA 3LEIA 4RN5A 3WNLA 3I3DA 1W0NA 5LA1A 4LPLA 1J84A 1OT5A 4HG6B 4QB1A 4GWIA 2Y6HA 5EIYB 1GU3A 4JKMA 1TG7A 4CUCA 1GUIA 1PMJX 3ACHA 4ZZ8A 3NRUA 1O59A 2J1EA 3NQHA 1W8OA 4PQQA 1OD3A 3LE0A 4JKLA 3P6BA 3OEBA 4CVUA 2WZEA 1F4AA 1O8PA 3DECA 4QDQA 4QPWA 2BGPA 3OGRA 1JZ5A 1T2XA 3HNBM 2X05A 4BDVB 2XHNA 3SKJE 5CKQA 2W1UA 3C7GA 2J1UA 2CDOA 3I2IA 1K3IA 2Z4FA 2QQLA 5DPNA 2Y8KA 1XC6A 3UNPA 1K45A 2W91A 3OGSA 3MV01 4KMQA 3CQOA 1UMHA 2VZ1A 3T09A 4BXSV 1JYNA 4AAXA 3WEZA 5JMOA 2X09A 3BGAA 3T2OA 3PUIA 4CU8A 2ZEWA 2ZEYA 2QQKA 5HPOA 3WNPA 2EICA 3ETPA 4BJ0A 4Z2AA 5B4XA 2VZ3A 3GM8A 1UY2A 2VOTA 1NAEA 1UYZA 2JKXA 3K77A 2VQTA 4P5YA 3W5MA 4PT6A 4CU7A 2YB7A 3I2JA 3IIIA 4A3ZA 4DXSA 3W5NA 1UYXA 4KWUA 2W94A 5A1AA 5JXHA 1NZIA 1JU3A 3UESA 1W8NA 2QQOA 3ABZA 4QX3A 4P08A 2WN3A 2DDUA 4QX2A 5DQ0A 3C7HA 1UMIA 5JXGA 2EIEA 1CZSA 1GQPA 4A41A 2VO5A 4JHZA 4LORA 1JZ8A 3LEKA 2Y6GA 4P02B 1WKYA 1DYOA 2KD7A 4DEVA 3VD9A 3POIA 3C7EA 2J1RA 3WSOA 2BERA 1H6XA 2VMCA 3T08A 2VZSA 4XVHA 3T2QA 2JE8A 1BHGA 3HNMA 2WNOA 2YC2A 5IHRA 5IFTA 2E26A 4QX0A 4W4ZA 4TTGA 2VZQA 4GZ9A 4MO3M 4ZXEA 2J7MA 3I2FA 2E31A 3LPGA 4DUXA 4A6OA 5FUIA 4ZY9A 2C4XA 3HNYM 3T2PA 5JXIA 2W47A 2B9VA 4A44A 3WNKA 1KEXA 3HJRA 3HEIA 4QB2A 3DYMA 3POFA 1ULPA 4OYUA 1DP0A 5IJRA 3POEA 3WF1A 1P8JA 2V72A 1OH4A 1R64A 1TVGA 2BBAA 1MPXA 3K46A 5CKNA 2HLEA 2WQ8A 3NJVA 3MV11 4LKSA 2ZEXA 1NKGA 2E32A 2Y6JA 4RYDA 3A23A 3K4AA 4W8JA 2L9LA 1GMMA 3WNNA 1XPWA 2WO1A 2HYXA 3E1F1 4FI9A 2VMEA 2E33A 1OF3A 3EYPA 2DCKA 2RVAA 4OMDA 4DEQA 4XUOA 2Y64A 5CZKA 2V5DA 1GNYA 2WN2A 4M4PA 2WO3A 2RV9A 3ACGA 3THDA 2LW8A 3T0AA 1ULOA 3EB7A 2X10A 2VC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MGQ A;  2LS6 A;  1J83 A;  4YPJ A;  1UX7 A;  2C9K A;  1F4H A;  1K12 A;  2W95 A;  3KQ4 B;  1GOG A;  3MO4 A;  4XUR A;  2J22 A;  4IUG A;  3J7H A;  3NNG A;  3T0B A;  4DXT A;  3K75 B;  3OEA A;  3K4Z A;  1W9W A;  2VZV A;  3CDZ B;  4A45 A;  1KGY A;  3D3A A;  1L7R A;  4XZU G;  4UI9 L;  2BZD A;  3OBA A;  3K4D A;  4MAD A;  2WZ8 A;  5EJZ B;  5HXM A;  3I2G A;  3UET A;  1D7P M;  3I2H A;  4CU6 A;  3VD7 A;  1SZB A;  5DN2 A;  5G04 L;  1JU4 A;  2YFU A;  3CZJ A;  3WF3 A;  4QX1 A;  3C8X A;  1CZV A;  4QDR A;  1US3 A;  1K42 A;  2ZXQ A;  2YC4 A;  1RYY A;  2B4K A;  1JZ2 A;  4XUQ A;  3I97 A;  4D8M A;  1UXZ A;  2DCJ A;  3IAQ A;  4OZO A;  3DYO A;  3IB3 A;  4BK5 A;  3I3B A;  1JHJ A;  2QQJ A;  2WO2 A;  2WYS A;  4DUV A;  3POJ A;  1CZT A;  4UOJ A;  1SDD B;  3GGL A;  2ORZ A;  1JI6 A;  3WNO A;  1NT0 A;  5DMY A;  2RJ2 A;  2VZU A;  2WBK A;  3CIH A;  2WAB A;  3T0D A;  2W1Q A;  5LCW L;  1UY3 A;  3FHQ A;  3OG2 A;  2OKX A;  5IYY A;  2VQU A;  3LEG A;  1H6Y A;  2C26 A;  5C70 A;  2ORX A;  5C71 A;  3OB8 A;  2QBX A;  2EIB A;  2J1A A;  3IAP A;  1SFP A;  1SG3 A;  4CUA A;  3MUY 1;  3ACI A;  4LMF A;  5CYY A;  4BK4 A;  2VZO A;  2ID4 A;  2VMD A;  1UWW A;  2XQX A;  3SEP A;  4ET7 A;  1L7Q A;  2J1V A;  2YFZ A;  4JKK A;  1OF4 A;  4DXR A;  4DUW A;  4L0P A;  4JX0 A;  4ARY A;  4LHS A;  3WF4 A;  2VR4 A;  2PQS A;  2YG0 A;  2VZT A;  3OGV A;  1NUK A;  3ACF A;  2XON A;  1SHW B;  3MUZ 1;  1W99 A;  2ZEZ A;  3POG A;  1EUU A;  1LNS A;  3AC0 A;  4M4R A;  2VCB A;  4A4A A;  1XNT A;  1US2 A;  2VTF A;  2WDB A;  1I5P A;  3FHA A;  3GXU A;  2EID A;  1O8S A;  2VL4 A;  4QDS A;  5JXJ A;  4A42 A;  3ECQ A;  1HN1 A;  2Y6K A;  3WQB A;  4KI5 M;  4OMC A;  2VM9 A;  4QB6 A;  1PMH X;  4CU9 A;  5LA2 A;  1W9S A;  3SKV A;  4MGS A;  2W9X A;  5F7U A;  1UY1 A;  3A21 A;  2V4V A;  3C7F A;  4ARX A;  2QQI A;  4PF1 A;  3LQC A;  5IFP A;  4UAP A;  4TXW A;  3ZM8 A;  1WCQ A;  3WF0 A;  1DLC A;  2VZR A;  3P1I A;  5EJ1 B;  1UYY A;  5CKM A;  2WAO A;  3NJX A;  2WUH A;  1UXX X;  1JZ6 A;  1IQD C;  3CMG A;  2J1T A;  3I2K A;  1JZ3 A;  4CUB A;  3THC A;  5JR2 A;  5JUV A;  1PX3 A;  3VDC A;  5CIS A;  2JDA A;  1JZ7 A;  2BGO A;  3I3E A;  3MBW A;  5LA0 A;  1JYX A;  4MOA A;  3C7O A;  2W1W A;  3VD4 A;  1CX1 A;  3BN6 A;  4W50 A;  3VDA A;  3WNM A;  2R7E B;  2VMF A;  3DEM A;  3A22 A;  4LQR A;  4LOS A;  5G05 L;  3VD5 A;  1NX9 A;  2W1S A;  1PX4 A;  3POB A;  2JD9 A;  2W3J A;  3SEE A;  2QQN A;  1UZ0 A;  2VCC A;  5B4N A;  2CDP A;  2W46 A;  5C7G A;  1JYV A;  4GWJ A;  5I0D A;  3GDB A;  2XOM A;  2W92 A;  3CKH A;  2QQM A;  4OUE A;  2VZP A;  4P00 B;  3HN3 A;  2J1S A;  4AG4 A;  5J1X A;  3VDB A;  4XUP A;  2W87 A;  1EUT A;  3VD3 A;  3DYP A;  1XNA A;  2VCA A;  2W5F A;  1UY0 A;  3IDA A;  1GOH A;  1YQ2 A;  4QAW A;  2WAA A;  1JZ4 A;  1SPP B;  3PUH A;  3JXS A;  3WF2 A;  1UY4 A;  4ZZ5 A;  4XUN A;  2Y6L A;  4E8C A;  1W9T A;  1SPP A;  3FL7 A;  1JYW A;  3LPF A;  2VJX A;  3HOB A;  3CZU A;  3U37 A;  4D0Q A;  4XUT A;  4E8D A;  1GOF A;  1CIY A;  3HPN A;  3F2Z A;  4LOT A;  3FN9 A;  3A7Q A;  3LEI A;  4RN5 A;  3WNL A;  3I3D A;  1W0N A;  5LA1 A;  4LPL A;  1J84 A;  1OT5 A;  4HG6 B;  4QB1 A;  4GWI A;  2Y6H A;  5EIY B;  1GU3 A;  4JKM A;  1TG7 A;  4CUC A;  1GUI A;  1PMJ X;  3ACH A;  4ZZ8 A;  3NRU A;  1O59 A;  2J1E A;  3NQH A;  1W8O A;  4PQQ A;  1OD3 A;  3LE0 A;  4JKL A;  3P6B A;  3OEB A;  4CVU A;  2WZE A;  1F4A A;  1O8P A;  3DEC A;  4QDQ A;  4QPW A;  2BGP A;  3OGR A;  1JZ5 A;  1T2X A;  3HNB M;  2X05 A;  4BDV B;  2XHN A;  3SKJ E;  5CKQ A;  2W1U A;  3C7G A;  2J1U A;  2CDO A;  3I2I A;  1K3I A;  2Z4F A;  2QQL A;  5DPN A;  2Y8K A;  1XC6 A;  3UNP A;  1K45 A;  2W91 A;  3OGS A;  3MV0 1;  4KMQ A;  3CQO A;  1UMH A;  2VZ1 A;  3T09 A;  4BXS V;  1JYN A;  4AAX A;  3WEZ A;  5JMO A;  2X09 A;  3BGA A;  3T2O A;  3PUI A;  4CU8 A;  2ZEW A;  2ZEY A;  2QQK A;  5HPO A;  3WNP A;  2EIC A;  3ETP A;  4BJ0 A;  4Z2A A;  5B4X A;  2VZ3 A;  3GM8 A;  1UY2 A;  2VOT A;  1NAE A;  1UYZ A;  2JKX A;  3K77 A;  2VQT A;  4P5Y A;  3W5M A;  4PT6 A;  4CU7 A;  2YB7 A;  3I2J A;  3III A;  4A3Z A;  4DXS A;  3W5N A;  1UYX A;  4KWU A;  2W94 A;  5A1A A;  5JXH A;  1NZI A;  1JU3 A;  3UES A;  1W8N A;  2QQO A;  3ABZ A;  4QX3 A;  4P08 A;  2WN3 A;  2DDU A;  4QX2 A;  5DQ0 A;  3C7H A;  1UMI A;  5JXG A;  2EIE A;  1CZS A;  1GQP A;  4A41 A;  2VO5 A;  4JHZ A;  4LOR A;  1JZ8 A;  3LEK A;  2Y6G A;  4P02 B;  1WKY A;  1DYO A;  2KD7 A;  4DEV A;  3VD9 A;  3POI A;  3C7E A;  2J1R A;  3WSO A;  2BER A;  1H6X A;  2VMC A;  3T08 A;  2VZS A;  4XVH A;  3T2Q A;  2JE8 A;  1BHG A;  3HNM A;  2WNO A;  2YC2 A;  5IHR A;  5IFT A;  2E26 A;  4QX0 A;  4W4Z A;  4TTG A;  2VZQ A;  4GZ9 A;  4MO3 M;  4ZXE A;  2J7M A;  3I2F A;  2E31 A;  3LPG A;  4DUX A;  4A6O A;  5FUI A;  4ZY9 A;  2C4X A;  3HNY M;  3T2P A;  5JXI A;  2W47 A;  2B9V A;  4A44 A;  3WNK A;  1KEX A;  3HJR A;  3HEI A;  4QB2 A;  3DYM A;  3POF A;  1ULP A;  4OYU A;  1DP0 A;  5IJR A;  3POE A;  3WF1 A;  1P8J A;  2V72 A;  1OH4 A;  1R64 A;  1TVG A;  2BBA A;  1MPX A;  3K46 A;  5CKN A;  2HLE A;  2WQ8 A;  3NJV A;  3MV1 1;  4LKS A;  2ZEX A;  1NKG A;  2E32 A;  2Y6J A;  4RYD A;  3A23 A;  3K4A A;  4W8J A;  2L9L A;  1GMM A;  3WNN A;  1XPW A;  2WO1 A;  2HYX A;  3E1F 1;  4FI9 A;  2VME A;  2E33 A;  1OF3 A;  3EYP A;  2DCK A;  2RVA A;  4OMD A;  4DEQ A;  4XUO A;  2Y64 A;  5CZK A;  2V5D A;  1GNY A;  2WN2 A;  4M4P A;  2WO3 A;  2RV9 A;  3ACG A;  3THD A;  2LW8 A;  3T0A A;  1ULO A;  3EB7 A;  2X10 A;  2VC9 A; 
#chains in the Genus database with same CATH topology
 1BEV 3;  1EV1 1;  4ATF A;  1SLA A;  3DL3 A;  4HL0 A;  4PQ9 A;  1R1A 3;  5F5I A;  2ZHN A;  3VB9 A;  4AVV A;  1MAC A;  1KQR A;  1C1F A;  3JBG 1;  4QM8 A;  3JD7 3;  5F5Q A;  4M3C F;  1TME 1;  1ENQ A;  1GOG A;  3WOG A;  4XBN A;  4YG3 A;  5FJK A;  5A7Q A;  1APN A;  3J8F 3;  1FV2 A;  1FV3 A;  4YM3 A;  3V64 A;  4L92 A;  5BNP B;  3ILR A;  1W6N A;  3D4K A;  1PO1 2;  3UV9 A;  1UOF A;  4DXT A;  3IZO A;  2DBN A;  3K4Z A;  1YFX A;  4XJW A;  4XAE A;  4CDX A;  5ERL A;  5JI9 A;  1W9W A;  1KFU L;  2VZV A;  5EP9 A;  4K1Y A;  3IDB B;  1G7Y A;  1WBF A;  3ZSM A;  3VBF B;  4UI9 L;  3NO8 A;  3N9O A;  4AEK A;  3HQU A;  2D6K A;  4NWV A;  2BJS A;  3K4D A;  3BIE A;  2HWE 1;  4S2G A;  2FDH A;  3I3M A;  4LIU A;  5HXM A;  4QKB A;  1VBC 2;  2ARC A;  4JTN A;  4BZ4 A;  3ZFG B;  3U10 A;  5LK7 B;  5DN2 A;  1O3S A;  4YVW B;  5FZ9 A;  1JBC A;  4CEW C;  3AX4 A;  3WF3 A;  2EIG A;  3OUI A;  1US3 A;  3RYK A;  4WVM B;  2ZXQ A;  2E7Q A;  3I97 A;  5F3G A;  4FTB A;  2DCJ A;  3IAQ A;  3RG0 A;  1Y9Q A;  5T55 A;  4UYB A;  1JHJ A;  1B35 C;  1MEC 2;  2WYS A;  1PO1 3;  3AXE A;  4DUV A;  1UU6 A;  1SDD B;  4QHO A;  3GGL A;  4XFB A;  1WCD J;  1O7F A;  3MF9 A;  1OOP C;  1XNC A;  1PNF A;  2QJV A;  4FFH A;  2R06 1;  2JG8 A;  2D3S A;  2WT0 A;  5DMY A;  2RJ2 A;  2VZU A;  4XQW A;  2WBK A;  3ZXG A;  5FMD A;  1W8U A;  4XF0 A;  3VKM A;  1CD3 G;  1V6I A;  2BP6 A;  4I0A A;  4ASM B;  5A3U A;  3T0D A;  4LBQ B;  2W1Q A;  3FX3 A;  1VBC 3;  4PJY A;  3FHQ A;  4N7U A;  1Y7B A;  1GYK A;  1V70 A;  5J09 A;  3LEG A;  4FP2 A;  2IC1 A;  4EN9 B;  1AL2 2;  3TEY A;  5C71 A;  3NJZ A;  1QGL A;  1AX2 A;  4OFG A;  2J1A A;  1EV1 3;  3FBY A;  4AVS A;  1CAV A;  1SG3 A;  3RI8 A;  4KGQ A;  4CUA A;  2CU5 A;  2E6V A;  2IXJ A;  1H2M A;  5ACA 2;  5FUP A;  1QNY A;  1NLS A;  4COZ A;  1PGL 2;  1H1M A;  4FPY A;  2VZO A;  3W59 A;  1JOB A;  2ID4 A;  2YUE A;  5L9R A;  3GAL A;  1CPN A;  2VCM A;  4FP3 A;  3O7O A;  4PDW A;  3CJI A;  3AMN A;  1O4Y A;  1XXN A;  3AZZ A;  3AVR A;  4RD7 A;  4HVR A;  3RJR A;  4YZ1 A;  5L19 A;  4AAP A;  2XR4 A;  4MHU A;  1KS5 A;  3RZL A;  3UKN A;  5A32 A;  2NLR A;  4XXP A;  5LA9 A;  1JTZ X;  3O5S A;  5IAX A;  3GJA A;  4N53 C;  4C0H A;  3M2M A;  2JIG A;  1IKP A;  1QXP A;  4U2A A;  3WVJ A;  2GH8 A;  1AL2 3;  1NUK A;  2MEV 1;  5DXD A;  3CNA A;  3ORJ A;  3UGG A;  1JYC A;  5LRS A;  5AC9 3;  1AJK A;  2ZX1 A;  4O65 A;  1ZZC A;  3ZN5 A;  1W99 A;  4MGY E;  1YIP A;  5KXD A;  3POG A;  2WS9 1;  5FZ0 A;  5JSR A;  4DS0 A;  1BBT 1;  1N1V A;  1QJX 2;  1OUS A;  5ACA 3;  3OJB A;  5C4W B;  4CEY C;  2RM2 1;  4IXL A;  4QQ2 A;  4FAG A;  1RHI 1;  3ST7 A;  4EWE A;  5JZG B;  3V0A B;  1XNK A;  1XNT A;  4QU2 A;  1VRH 1;  3FHA A;  1I5Z A;  5C8C C;  4NRP A;  5F8P A;  3RZJ A;  2VL4 A;  2TNF A;  4P9I A;  4TN7 A;  3PVN A;  4CPB A;  2AGS A;  3WQB A;  2KR2 A;  2ARX A;  2WWU A;  1ND3 A;  5BNN A;  1M06 G;  1RVF 1;  4K21 A;  2WC2 A;  1DQ2 A;  4N43 A;  2OZ6 A;  2Y26 A;  4OLL A;  1PHM A;  2VU9 A;  5EYY A;  1OPM A;  5FWE A;  5GAL A;  2DCY A;  3A21 A;  4A3X A;  1RMU 2;  2V4V A;  2ZGP A;  2HWB 1;  2QQI A;  4K7J A;  5FYY A;  3QLQ A;  2Q8E A;  2ZMN A;  1HB2 A;  1RUE 2;  1RUH 1;  3GZT B;  4Z2W A;  4Q1P A;  5FZ8 A;  3PTR B;  1G8W A;  3WG3 A;  4NID A;  3VBU C;  1D4M 1;  1QJX 3;  2X8K A;  2O1Q A;  3M3I A;  3WQ1 A;  4KWL A;  1GV9 A;  1ZZ7 A;  3X29 B;  3JCI A;  4BE3 A;  3O1S A;  2WUH A;  2Q5T A;  2QE3 A;  2J1T A;  3BTA A;  3I2K A;  4Q29 A;  2NM1 A;  4KU7 A;  1HRV 1;  3B9I A;  5E1R A;  2EAL A;  1GKB A;  5FZO A;  3RGB A;  5KC6 A;  3ALQ A;  5CIS A;  5ABJ C;  2A6Z A;  4QPG B;  1S0J A;  4CEW B;  4B7E A;  4HVQ A;  5L7O A;  2AC1 A;  2BGO A;  4EV0 A;  1IPJ A;  5CFD A;  5LA0 A;  2WWJ A;  1ODN A;  1RMU 3;  2W1W A;  1UQX A;  5DDJ 1;  4RFR B;  3PTY A;  1CX1 A;  1W2A X;  2Y60 A;  4KG8 A;  3BN6 A;  3AZW A;  4Q4X 1;  5DAW A;  4AHY A;  4K1Z A;  3DEM A;  4V2V A;  5LZ6 A;  1I3H A;  5EWS A;  3SMH A;  4CP9 A;  1CAW B;  2EVX A;  3LIG A;  5IWF A;  5A3T A;  4P9Y A;  1A8M A;  1QJF A;  1POV 0;  2W1S A;  3LOB A;  1PNG A;  1YFY A;  2DFC A;  2QQN A;  3VDD C;  3ZN4 A;  3VBH A;  5FPZ A;  3VHO A;  5B4N A;  5BNO B;  4HBN A;  4ZU7 A;  5D8A C;  5C7G A;  4XF9 A;  5I0D A;  1PO2 3;  2HEY F;  1YRZ A;  5IK4 A;  1W8T A;  2W92 A;  1LEC A;  2C1F A;  3N7J A;  2E51 A;  2PHT A;  3DXU A;  4CRQ A;  2UY8 A;  2ZS6 B;  4UFH A;  4K6B A;  4XUP A;  3B01 A;  5DZF A;  4XW3 A;  3W9A A;  5CFC B;  4LBQ A;  3BPZ A;  5FYM A;  5FO8 B;  1VAL A;  3EBR A;  3O0W A;  1GOH A;  3ZYJ B;  1S1A A;  4PI2 A;  4IV3 A;  3G6J B;  3JXS A;  3WF2 A;  1UY4 A;  4JDO A;  4ZZ5 A;  2PLV 2;  2XVL A;  4NPL A;  4NUB A;  4E8C A;  1RED A;  2VTX J;  5HV0 A;  4YGE A;  4E27 A;  5IVF A;  3G7D A;  3HT1 A;  4I2O A;  3FL7 A;  1JYW A;  3GNE A;  4GJY A;  5JOX A;  1ZRI A;  2BGC A;  4ZU5 A;  5FYH A;  1STM A;  2RDN A;  5GLZ A;  5K0U C;  2YU1 A;  3BVC A;  3MZH A;  5F3I A;  4E8D A;  5LY2 A;  3NNM A;  2OW4 A;  4AE2 A;  4XJZ A;  3GF6 A;  1CWP A;  5LAT A;  1DYP A;  1W2U A;  5FP9 A;  5H9S A;  2H0V A;  2ZX4 A;  4GWM A;  1HXS 2;  4RS5 C;  2HWC 2;  1NCQ B;  2BNN A;  1LOF C;  4Q4Y 3;  4YM2 A;  3HQX A;  1J84 A;  2ZGS A;  4PI0 A;  1YIF A;  5EIY B;  1PK6 A;  2CV6 A;  3EHK A;  4H2A A;  4JCK A;  3VBR C;  1GUI A;  3MYX A;  3H1M A;  3J4U H;  2VW1 A;  3ACH A;  4XQD A;  1W05 A;  2CGO A;  1ST8 A;  3EJK A;  2FQP A;  1DGR A;  3NQH A;  2J1E A;  1W8O A;  4PQQ A;  4OCT A;  3EMR A;  2PLV 3;  2R0H A;  1OD3 A;  3LE0 A;  4Z1V A;  2ZOE B;  1S0I A;  2A1X A;  3AL5 A;  3ZFF A;  3KZ4 C;  4BQ4 A;  5BY5 A;  1NA1 B;  4MGI E;  1J1T A;  1YI9 A;  1Z7S 2;  4COV A;  4CVU A;  1M4W A;  2GP5 A;  1O8P A;  4YYO A;  4PF5 A;  3OGR A;  1JZ5 A;  1HX6 A;  5FKB A;  5A7O A;  4P9J A;  1O3Q A;  3HT2 A;  4CSW A;  4GQ7 A;  2V73 A;  3H1Y A;  4WM8 B;  2B9U A;  2ZKN A;  3KSC A;  1SBD A;  3OY8 B;  4Y5T A;  2HWC 3;  2WA4 A;  3MFC A;  1PIV 1;  5DPN A;  2QQL A;  1YJL A;  4U36 A;  5JDB A;  3ZXF A;  3RNS A;  5C3Q A;  4CCE A;  2WIN B;  3WY6 A;  4LKE A;  1POV 1;  4M01 A;  4NHK A;  3GYD A;  2W91 A;  4BQW A;  1WCS A;  1MZ6 A;  4LA2 A;  1Q8S A;  1YEW A;  2JDN A;  3MGU A;  1VAM A;  5FRA A;  3VZL A;  1UOJ A;  3CQO A;  3MLK A;  4KMQ A;  2VZ1 A;  1W2O A;  2XJS A;  5D1I A;  5IUQ A;  5JPM B;  2QVS B;  5FKC A;  4XYX A;  4YVS C;  1KFX L;  4BQX A;  4Y20 A;  3WEZ A;  2X09 A;  4L2N A;  3H8X A;  1Z7S 3;  1CJD A;  1LRH A;  2Y6F A;  4CCC A;  3HWJ A;  4R9A A;  5CBL A;  4LHK A;  2QQK A;  5HPO A;  2WT1 A;  2ZGL A;  3ETP A;  1QNW A;  5DAQ A;  2MHF A;  2Y38 A;  2GC3 A;  3I8T A;  3KCC A;  3O14 A;  2X5I C;  3E5X A;  3ZVX A;  2RG4 A;  1UOB A;  1NAE A;  2HWD 3;  1V6O A;  1RUC 2;  1DZR A;  4IGO A;  1SLB A;  4JV4 A;  1CN1 A;  4XPV A;  2VUD A;  3J7L A;  2JDM A;  5FY7 A;  3W5M A;  1YO8 A;  1AR6 1;  4ZKT B;  4ISQ A;  5FZ4 A;  2YB7 A;  2D6M A;  1YYN A;  2HEV F;  4LBL A;  3THT A;  4OUL A;  5JSP A;  1G9D A;  3ZFE A;  1RUF 3;  4GH4 B;  1W04 A;  2AYH A;  5DZG A;  4PLN A;  1N1T A;  2DTY A;  3KF3 A;  3T1M A;  1V9U 1;  1PZ7 A;  1UYX A;  4KWU A;  1W6M A;  3FBM A;  4PHZ A;  2R0F A;  1BKZ A;  4LEJ A;  1H2L A;  1HRI 1;  2UUR A;  2W2I A;  4GMP 0;  5DAB A;  4ATE A;  5JXH A;  3BYW A;  3S7I A;  5A7S A;  4FVV A;  1JU3 A;  1V6J A;  2EXH A;  2BVB A;  4P08 A;  1SLL A;  4JRL A;  3WW1 A;  4DXZ A;  1GWK A;  1MS9 A;  3HBZ A;  4Q26 A;  4JAA A;  2QQP A;  4E2G A;  2CNA A;  2P17 A;  2DDU A;  2WN3 A;  5DQ0 A;  2WA3 A;  1GP6 A;  1UF2 C;  3AMQ A;  4GKY A;  3LA2 A;  4AED C;  4IL7 A;  2XJT A;  4JDN A;  2YGL A;  2G19 A;  1KS4 A;  2EAK A;  2GC0 A;  3WQ7 A;  5C8W A;  2VO5 A;  1YLL A;  4M3C A;  1F5J A;  1JZ8 A;  3SNM A;  1ZBA 2;  1F35 A;  1OPO A;  2GME A;  2QDR A;  1DQ0 A;  3AP4 A;  4MHR A;  4UW5 A;  5CAD A;  3N7M A;  5C3P A;  1UZW A;  5IVB A;  1H9W A;  1WKY A;  3POI A;  1LHV A;  1AHS A;  4BLI A;  4DEV A;  1ZNP A;  2JEN A;  1HKD A;  3OCP A;  2VGD A;  1VBA 3;  4H14 A;  3WSO A;  2BER A;  3LD8 A;  3OOX A;  3ZMN A;  1QDO A;  4EJR A;  1G9B A;  3M3Q A;  3T08 A;  4AZZ A;  1PVX A;  4EWA A;  4FPG A;  3VBS A;  3TNQ A;  5LAS A;  2XBO 2;  4YW1 A;  4Q4V 2;  3VKO A;  2GZW A;  3R4D B;  3ZPY A;  5A7W A;  2RR1 2;  3OUJ A;  4RR3 A;  2V09 A;  3DF0 A;  2R1D A;  2WNU A;  3V56 A;  3TEZ A;  1BHG A;  1FI2 A;  2RS3 3;  2WNO A;  1W6O B;  3HIF A;  2JDU A;  3VBO C;  4PCR A;  5C9A B;  2BRT A;  5CNA A;  2XKO A;  3IN9 A;  4I30 A;  4QPY A;  4CCO A;  1LGB A;  4QX0 A;  1S0G A;  4W4Z A;  4M0N A;  3U07 A;  1AR8 2;  2XLG A;  5IAV A;  4C8D A;  2J7M A;  1EAH 2;  1OBN A;  1ZBA 3;  1KIT A;  2I07 B;  3H7Y A;  3N36 A;  4XJ9 A;  4QT6 A;  4E2Q A;  3KM5 A;  3NKT A;  1MQT A;  4LO7 A;  4DUX A;  4ZY9 A;  4FTS A;  1VAV A;  2UY9 A;  4NRQ A;  4QQO A;  5FO7 B;  4AHW A;  4A7Y A;  5JXI A;  2W47 A;  4XIO A;  4NAO A;  3B9C A;  4A44 A;  5LW9 A;  1UD1 A;  2R16 A;  2VVD A;  5GKA C;  1BK0 A;  1DQ5 A;  4IGP A;  4QB2 A;  3BU0 A;  3O1T A;  2XBO 3;  4Q4V 3;  2RMU 1;  2PHF A;  4QPI C;  1H2N A;  3H1W A;  2RR1 3;  2VQA A;  2HWF 3;  1OH4 A;  3N3H A;  4ZU4 A;  1VRB A;  2VBP A;  4C90 A;  2FHR A;  3R4S A;  3K46 A;  2HLE A;  2XL9 A;  3IWZ A;  4CP1 A;  4C91 A;  3WNX A;  1E5S A;  1V00 A;  1FOD 2;  4LKS A;  1CIW A;  1D2S A;  4Q1R A;  1OLQ A;  2OA2 A;  3MF6 A;  1NKG A;  4H7L A;  2Y6J A;  3AYD A;  3APB A;  4XFH A;  4GMP 1;  1QJU 2;  3O0X A;  2DU0 A;  1GMM A;  1AR8 3;  1XPW A;  3WNN A;  2HYX A;  3E1F 1;  3OBZ A;  5GM0 A;  1EAH 3;  1C5I A;  4I0B A;  4TLF A;  1RB8 G;  4YZ2 A;  4XCB A;  5FWJ A;  2QQV A;  5LEJ A;  3HVD A;  3LOI A;  2YBK A;  3M4F A;  4BQ1 A;  3U78 A;  2XWJ B;  1QKQ A;  2ILM A;  1WW5 A;  1UZY A;  4XHX A;  5JR7 B;  1IOA A;  1GNY A;  2YY1 A;  2GC2 A;  4AL9 A;  1ND3 C;  4MYE A;  4WM7 C;  1XE7 A;  3V65 A;  2YGM A;  3IPV A;  3MFA A;  3DV8 A;  2E7A A;  2FBE A;  5CVR A;  2AEZ A;  4XAB A;  3EB7 A;  2JDY A;  2X10 A;  3IM0 A;  4AVB A;  3VV1 A;  3NNJ A;  4MGQ A;  1NCR C;  1G6N A;  1MVQ A;  2LS6 A;  2ZGR A;  2DFB A;  3E5U A;  4EZ4 A;  1DQ6 A;  1FOD 3;  1ZVF A;  2VXJ A;  3N35 A;  5F5A A;  1R08 2;  3MPP G;  5BNQ A;  4LIV A;  4PLO A;  3BUC A;  5FBZ A;  4AOC A;  1QJU 3;  3UJO A;  1LU1 A;  3HBK A;  2W95 A;  3KQ4 B;  2QCS B;  1W6N B;  3THP A;  4W65 A;  1W90 A;  4P5H A;  2OXB A;  4K8R B;  2P2K A;  1LOC A;  2JIJ A;  4CDX B;  4Q4W 2;  4HAN A;  4XIK A;  3UGH A;  3J7H A;  3WDV A;  3T0B A;  5BNP C;  5E88 A;  2RS1 1;  2ADE A;  4KH9 A;  1LU2 A;  3ENR A;  2BW8 A;  4IEZ A;  5T52 A;  5KC5 A;  4NIG A;  1BQP A;  4RQP A;  2RDR A;  3ON7 A;  2BOI A;  1RUJ 2;  2FMY A;  1UZZ A;  3OSD A;  3VBF C;  3SQO A;  2XVK A;  2P37 A;  3E5Q A;  5DG2 A;  1OLR A;  5EJZ B;  5GJ6 A;  4KL1 A;  3VHP A;  2A75 A;  3I2G A;  3N9N A;  3UET A;  1D7P M;  2LRP A;  1LHN A;  3I2H A;  2VMH A;  1AYM 2;  4XJ8 A;  2WLP A;  3VD7 A;  2DTW A;  4H3W A;  3ZFG C;  1DBN A;  4JGZ A;  2EF6 A;  4YVW C;  5FZ6 A;  1AR7 3;  1AR9 3;  2JDZ A;  3C8X A;  4QDR A;  1R08 3;  1UIK A;  1QHD A;  1K42 A;  3AMH A;  5F3E A;  3CLP A;  1XYO A;  4YNI A;  1UXZ A;  4OHY A;  1HV0 A;  4XFF A;  1ULF A;  1UKG A;  5LBC A;  4BK5 A;  5EZW A;  4Q4W 3;  4XMI A;  1UL9 A;  2O8Q A;  1LCL A;  1X82 A;  2QQJ A;  5BPX A;  1EPW A;  2JG8 B;  4Q0U A;  4BOW A;  2VH9 A;  5M0T A;  2TEP A;  4Y4R A;  3VBH C;  4BME A;  5FPU A;  3WNO A;  3N9L A;  2C0Z A;  2P5B A;  2FDI A;  1RUJ 3;  1VBD 2;  2XL7 A;  2ZX3 A;  5FZL A;  4IES A;  1BEV 1;  1YC6 1;  2A5Z A;  1QU0 A;  1R1A 1;  1YQ6 A;  5FTT C;  4IEV A;  3ZSJ A;  1VR3 A;  3WT3 A;  5I8T A;  1LTE A;  4B3N A;  3O1V A;  3OG2 A;  3JD7 1;  1AYM 3;  3ZYF A;  3LIH A;  2VQU A;  1U5X A;  3SC7 X;  3FC0 A;  2C26 A;  1CAV B;  2ZA9 A;  3PJQ A;  2BOJ A;  4FPE A;  4IV3 C;  3OB8 A;  1OKQ A;  3WW4 A;  1FAT A;  1CVN A;  3J8F 1;  3GZE A;  3VHR A;  1DIW A;  2DVG A;  2LAL A;  3SCF A;  2IXI A;  4TYS A;  4F83 A;  1FMD 2;  1GZ9 A;  5I0S A;  3H8U A;  4PDW B;  3C2U A;  5JVV A;  3CJI B;  2IFW A;  2E53 A;  1DDL A;  1F2N A;  1ASJ 2;  1UWW A;  1OI6 A;  2DVF A;  2XQX A;  3SEP A;  1FT9 A;  1TQ5 A;  2P3Y A;  4LKF A;  4DFS A;  5A32 B;  3LEM A;  4AVC A;  1W9F A;  2Q1Z B;  4LO4 B;  1L7Q A;  3IT8 A;  1VBD 3;  1X36 A;  2PXJ A;  4PIY A;  3WXP A;  3I4I A;  4JKK A;  5E16 A;  4FAH A;  5F3C A;  4Z92 B;  1ZRD A;  5K4L A;  5A7P A;  4AI2 A;  1ZZB A;  3JB8 A;  3RZH A;  4QXK A;  5GLT A;  1RUI 3;  4LHS A;  5FXV A;  1CAX A;  1NY7 2;  1SCR A;  3QH7 A;  2GAU A;  2VZT A;  3OGV A;  2IUW A;  3AP9 A;  4UW3 A;  4LLO A;  5FO9 B;  3ACF A;  1HB3 A;  4BXF A;  2XON A;  5F6K A;  1PO1 1;  3ZXA C;  4COU A;  1WMF A;  1ND2 A;  3OGJ A;  1EUU A;  3AC0 A;  4I3P A;  4M4R A;  1ALY A;  5C4W C;  2I2S A;  3K2O A;  1BYH A;  4E4H A;  1ASJ 3;  1UIJ A;  2PN5 A;  2ZZQ A;  4O9E A;  4OI4 A;  2R04 2;  1UCX A;  2NP0 A;  4A4A A;  1CGP A;  4CP2 A;  5JZG C;  1X9P A;  1I5P A;  3GXU A;  3KV5 A;  1S0E A;  4AI0 A;  4E2S A;  3LFM A;  5BNN B;  1VBC 1;  2GC1 A;  4A42 A;  3ECQ A;  2Y6K A;  4N43 B;  1QJY 2;  2VW2 A;  2G9Z A;  2VUA A;  2LUW A;  2WZR 3;  4IGQ A;  4OMC A;  1WGP A;  1EYB A;  1SFY A;  1COV 3;  3VZJ A;  4QB6 A;  5KWR A;  2Y0I A;  1ZX5 A;  1DGW A;  3FZ3 A;  3R0R A;  1TEI A;  4LO5 B;  1BZW A;  5F7U A;  5A3P A;  5FV3 A;  1YQ8 A;  3C7F A;  1LOB A;  3NV2 A;  4XFA A;  3T1L A;  2R07 2;  1YCI A;  1TMF 2;  1BVV A;  5FDB A;  3WDT A;  4PF1 A;  4FOW A;  2BU9 A;  2VNR A;  3B93 A;  4LE3 A;  4YM1 A;  4YW3 A;  3RDI A;  5IFP A;  4AFC A;  4QKN A;  4XMA A;  3ZKY A;  3PHM A;  3SCG A;  1DLC A;  2VZR A;  3PU3 A;  5EJ1 B;  1UYY A;  3ASI A;  4MGK E;  5CKM A;  3AMP A;  1MS3 A;  5T5J A;  2JG9 A;  2W0X A;  4QKF A;  4MV2 A;  2BBV A;  1UXX X;  5I91 A;  2HKX A;  2XJP A;  5K8S A;  3NNF A;  5A3N A;  1CON A;  5C6C A;  4HPK A;  2GN3 A;  5FZO B;  3H7J A;  2D43 A;  1WA4 A;  1W03 A;  3K3O A;  4I0W B;  2HJI A;  5JUV A;  1H4H A;  1QJY 3;  5L7O B;  3KV6 A;  3K51 A;  1AL2 1;  2B46 X;  3USU A;  4LHL A;  2PFW A;  5CFD B;  1GP4 A;  4YFZ A;  2JEC A;  4QPG C;  5AC9 1;  1NQJ A;  2FZ1 A;  3I3E A;  1YWK A;  1HB1 A;  3MBW A;  4M3C E;  4XDP A;  4AHZ A;  1R1Z A;  2VBD A;  1MS4 A;  1Q8Q A;  3M1H A;  4CUG A;  1SMV A;  5ACA 1;  1PGL 1;  2XDV A;  2FCU A;  1WME A;  4W50 A;  4CP9 B;  3WNM A;  4OZX A;  2O14 A;  2VPV A;  1FXZ A;  2OQ6 A;  5SV8 A;  4DZG A;  2RJL A;  2K46 A;  5BV6 A;  5FPB A;  1XU2 A;  3VBH B;  5G05 L;  2VVE A;  2VOV A;  5HBA A;  3VD5 A;  1C8M 2;  2A7A A;  1PVC 2;  2Y34 A;  2W3J A;  1DQ4 A;  2QDN A;  2J42 A;  5GZE A;  3AMM A;  3ZYB A;  2VUC A;  4CP0 A;  4KG0 A;  5BNO C;  2XHK A;  3D0S A;  1KDM A;  2XOM A;  4LUK A;  1GIC A;  3B00 A;  3B7M A;  3WG2 A;  4F3J A;  4P00 B;  4TZD A;  3WLU A;  2J1S A;  4L9B A;  4AG4 A;  3VDB A;  3VGI A;  2W87 A;  2XLF A;  4IQP A;  5C3R A;  4WZC A;  3I59 A;  4IV3 B;  4JZR A;  5CFC C;  4NII A;  1TME 2;  4QX8 A;  4O7X A;  3KCX A;  3KWV A;  5FYI A;  2F6B A;  4LK6 A;  3Q9O A;  4OHV A;  1QJX 1;  2QQU A;  3PUH A;  1VPH A;  3WW2 A;  1DGR N;  1YFW A;  3LKJ A;  4IET A;  4KU8 A;  1SPP A;  3ZXJ A;  4LUM A;  1FNZ A;  2WNU C;  2P3K A;  3GBW A;  3LPF A;  3BOP A;  4FPL A;  1MEC 3;  2VJX A;  2CHH A;  3INA A;  1N3P A;  3QH6 A;  5FLI A;  2PMW B;  1A6C A;  1C8M 3;  3PVE A;  4NIA A;  2WR9 A;  5FAX A;  1PVC 3;  4QWN A;  1HV1 A;  3LDR A;  4XUT A;  2WWS A;  1GOF A;  5A80 A;  5C5T A;  4J6G A;  5EFU A;  4PLM A;  3HPN A;  4CZS A;  4IV1 A;  1VBE 2;  3WCR A;  2OS2 A;  3MLJ A;  1PM4 A;  1C1L A;  4ORF A;  4YW6 A;  5FQ0 A;  3H8R A;  1PK6 B;  3IMN A;  1NCQ C;  1SBF A;  1QMJ A;  1W0N A;  4JTO A;  4E4S A;  3OYW B;  1RMU 1;  4GWI A;  2DUR A;  2Y6H A;  5T5P A;  1RUE 1;  4JKM A;  4TSV A;  1RIR A;  1HDK A;  1S0D A;  1X8M A;  1PMJ X;  2D7F A;  2G4I A;  5ANN A;  3O1P A;  3ZFF B;  3MW4 A;  4R4Z A;  1IZ3 A;  2DVA A;  1UN1 A;  2A6Y A;  3AXD A;  2K9Z A;  4E4D X;  5TSW A;  5CEH A;  1LJ7 A;  1W0P A;  1OQD A;  4NHX A;  3ES4 A;  1RXF A;  4GA9 A;  3D82 A;  1YQC A;  1NA1 C;  1AX0 A;  2ES3 A;  2R06 2;  3IKW A;  3KD4 A;  3WDX A;  2H0B A;  1PO2 1;  3DEC A;  4QDQ A;  5KR7 A;  1D4V B;  4YGC A;  1T2X A;  4JGY A;  3BTY A;  3JB4 C;  2X05 A;  4BDV B;  4BB3 A;  1VBE 3;  4ES8 A;  2J1U A;  4WM8 C;  2VD7 A;  3RWN A;  3GZU C;  2OZJ A;  2B42 B;  1WLW A;  4R9D A;  4YW7 A;  3SH3 A;  2JKB A;  4RGK A;  2BNO A;  1VLN A;  4Q0Q A;  1BK1 A;  4CDQ A;  1XC6 A;  3SCH A;  3P3P A;  2ZCW A;  2DVB A;  1K45 A;  4EE2 A;  3PUS A;  3BTX A;  1VMF A;  3MV0 1;  3UK9 A;  1NQD A;  1C3H A;  1REE A;  3UGF A;  2R49 A;  4Y20 B;  1N3Q A;  1UMH A;  2CGN A;  4NMI A;  4RSU A;  3RQ0 A;  4BXS V;  1CPM A;  4AAX A;  3ZIW A;  3BGA A;  2EXJ A;  5EYX A;  1MZE A;  5FZA A;  1IG0 A;  4NWW A;  5FXW A;  2WFF 2;  3ZXD A;  4D6S A;  4Y5S A;  5J98 B;  2EIC A;  4Q4Y 1;  2A3Y A;  5HXV A;  5B4X A;  1RJ8 A;  1UNB A;  2D6P A;  1UY2 A;  3ES1 A;  2JKX A;  5B2G B;  5J96 B;  3FLR A;  2VQT A;  3ZFE B;  3OUH A;  3TB0 A;  2YMZ A;  4P5Y A;  2MEV 2;  2K2S A;  2XJR A;  1BLZ A;  3I2J A;  1SQ4 A;  2YYO A;  5CU1 A;  3ZOI A;  1W6M B;  4R9B A;  2PLV 1;  3QBQ A;  4DXS A;  1OQE A;  2D5F A;  4GH4 C;  4XF4 A;  3W5N A;  1AXK A;  4RFT 0;  1RUE 3;  1JHN A;  1YXW A;  2LTN A;  4UFM A;  5K9Y A;  2RM2 2;  2W94 A;  4H7M A;  4YG0 A;  5H9P A;  3U75 A;  5A1A A;  3RWK X;  1RHI 2;  2AAC A;  2C6S A;  1NZI A;  4Y1Y A;  5IK8 A;  4UWD A;  3OD4 A;  1W8N A;  1VRH 2;  2Q4S A;  2UYB A;  5CB7 A;  5FY1 A;  3CU7 A;  2WFF 3;  3AYC A;  1HXS 1;  2HWC 1;  3WP5 A;  3C7H A;  3CBN A;  4Q5O A;  3JUU A;  3H8O A;  4M3C B;  3GBF A;  4BQ3 A;  3WG4 A;  2R32 A;  3I2O A;  4G9S B;  4JHZ A;  1XBF A;  1D0G A;  2CY6 A;  3ZYI B;  2IFR A;  4E4Z A;  3LA3 A;  1JOP A;  2Y6G A;  2ARE A;  3KVA A;  2KD7 A;  1DYO A;  4XIL A;  3LWC A;  1FAY A;  5GZF A;  3VBS B;  4AFA A;  2OII A;  2Y0O A;  4COW A;  5A7W B;  4BIO A;  1Z7S 1;  3KVB A;  4RR3 B;  4XVH A;  2WNU B;  1WLC A;  4ZS2 A;  2VUL A;  3B94 A;  3RMY A;  3T4V A;  4YRD A;  3PVB B;  1E5R A;  3MW3 A;  2XPJ A;  5E8A A;  4QKD A;  5A33 A;  5GZC A;  2P6C A;  1HRV 2;  4LE4 A;  4I09 A;  2HWD 1;  2WNV A;  2W52 A;  2B7Y A;  2D40 A;  4PBO A;  5C9A C;  1MQT B;  2H6C A;  1DG6 A;  1H1I A;  1RUF 1;  4GZ9 A;  4XDQ A;  2P34 A;  4DIN B;  2VNO A;  2IXC A;  4MLO A;  4XFC A;  4BPZ A;  2JJ6 A;  3I2F A;  2E31 A;  3LPG A;  5T3N A;  4BM8 A;  3LA7 A;  1U5I A;  5DDJ 2;  3HNY M;  3PME A;  5DAP A;  3WR0 A;  4QXC A;  3OYW A;  1HW5 A;  3OPT A;  1WBL A;  4NHY A;  4Q4X 2;  3H42 B;  4UFJ A;  1ZRR A;  4ES9 A;  1RXG A;  4A7Z A;  3ZDV A;  3SIS A;  3OPW A;  3BTZ A;  3OF1 A;  4OYU A;  1DP0 A;  3GZA A;  4ASL A;  1QWR A;  4K20 A;  3GCX A;  1P8J A;  1K5M A;  3M3E A;  5HCA A;  5FOJ B;  1R64 A;  4ZS3 A;  4CCM A;  2BBA A;  2CAU A;  1WD3 A;  2R1B A;  3BOD A;  3NJV A;  2OYZ A;  5C3O A;  1MZF A;  2ZEX A;  1OSG A;  4OUS A;  3U1X A;  4B1M A;  1JUH A;  4RA0 A;  3EO6 A;  3A23 A;  1HXS 3;  4K40 A;  5FY5 A;  4CXW A;  4DIQ A;  2BVV A;  2QNK A;  1GNZ A;  1VBA 1;  4AXO A;  1NXD 1;  4LJH A;  4DO0 A;  4CDU A;  3AKS A;  4X6R B;  2GMP A;  2Z42 A;  2ZGN A;  3VHN A;  2EAA A;  2XVG A;  3OBT A;  4QQH A;  4FXG B;  2ZGQ A;  4Z07 A;  5LEK A;  1OF3 A;  2YDE A;  5AVA A;  2E7T A;  2Y64 A;  4IEQ A;  4FFG A;  4XDO A;  1LOD A;  2QKD A;  3IPV B;  2V5D A;  1KDK A;  4AR2 A;  3AZX A;  4M4P A;  3TN9 2;  1UO9 A;  2RS3 1;  3ELN A;  3NAP A;  2ARB A;  3M70 A;  1LUL A;  2ZGU A;  3NV3 A;  1PGW 1;  5EHD A;  1H8T A;  2RV9 A;  3IDC B;  2JWP A;  1S0F A;  2ZGO A;  3C3V A;  1AJO A;  1MZ5 A;  5A1L A;  3T0A A;  1ULO A;  3PU8 A;  3WX5 A;  3WIN E;  4BMB A;  1J83 A;  2DUP A;  1AXZ A;  4IEU A;  1FNY A;  1UX7 A;  1ZBA 1;  1QOT A;  4LO8 A;  4CXX A;  4XC9 A;  1C57 A;  1DLL A;  2ARA A;  2ET1 A;  3M8L A;  4D7S A;  4ZHN A;  4XUR A;  5JIA A;  2J22 A;  2TBV A;  4L97 A;  3VZO A;  4CDX C;  3RJ2 X;  4RQP B;  3K75 B;  2XBO 1;  3OEA A;  4IND A;  4Q4V 1;  3TOJ A;  2DBI A;  3AVS A;  1H4G A;  1RTV A;  5FZK A;  4X6Q B;  2A3X A;  2RR1 1;  3CDZ B;  4A45 A;  1KGY A;  3FUO A;  4AI8 A;  2HWF 1;  5LWB A;  3D3A A;  1L7R A;  1OFN A;  3TN9 3;  3DGT A;  4Q0S A;  2BZD A;  1N47 A;  2BPA 2;  4HOO A;  1S0C A;  1VJ2 A;  4GJZ A;  3DN7 A;  1JZ2 A;  4JGZ B;  4BCU A;  1SZB A;  1UX6 A;  1GR3 A;  3Q8A A;  5HCB A;  4CU6 A;  1ZZ8 A;  1JU4 A;  4I3G A;  3AZY A;  4NPR A;  1AR8 1;  2YFU A;  3CZJ A;  1OH3 A;  4S2D A;  1EAH 1;  1WMX A;  5KXC A;  3WG1 A;  1ZZ9 A;  4NAM A;  1RUC 3;  2PHL A;  1ZM1 A;  1ZZ6 A;  2YC4 A;  2B4K A;  2WNE A;  1GWM A;  4XUQ A;  1TZO A;  4BIS A;  4XE9 A;  4OZO A;  4D8M A;  2NMO A;  3M3C A;  5FBJ A;  4C1X A;  1QOO A;  4IER A;  2JD4 A;  3DYO A;  3IB3 A;  3NKG A;  1W6Q A;  5FP3 A;  4B4R A;  1HQL A;  3POJ A;  5FR3 A;  1CZT A;  4UOJ A;  5KXE A;  2ORZ A;  4ASK A;  2JG8 C;  1RUD 2;  1B35 A;  1JI6 A;  3ZSL A;  1NT0 A;  3LZZ A;  4UXA A;  1OD5 A;  4BH9 A;  1L7L A;  1OA2 A;  1HN0 A;  1OOP A;  3MLL A;  1QQP 2;  4Y1X A;  1ZYB A;  4B4P A;  3P5B A;  3F95 A;  3KQR A;  2F4P A;  3W20 A;  1ZBE 2;  1WCU A;  1A34 A;  1FOD 1;  1AZD A;  2WQZ C;  4XFI A;  3I54 A;  2YHJ A;  3POY A;  3K48 A;  4Y5Z 0;  3HAG A;  4LXL A;  3E6D A;  3GHN A;  2EXK A;  4W6Y A;  3RFR A;  3WW3 A;  1QJU 1;  2A3W A;  3TEX A;  1PZ9 A;  3KT4 A;  3WHU A;  1H6Y A;  5C70 A;  5F37 A;  1GBG A;  3O1O A;  2GNT A;  3R05 A;  2XJV A;  1YNA A;  4HK9 A;  2QBX A;  2B39 A;  1GZW A;  4FSJ A;  4QGN A;  3KB5 A;  2OX0 A;  5FUN A;  2DWR A;  2PAK A;  4IEW A;  3CHX A;  5DG1 A;  3T3Y A;  1YJK A;  4GB3 2;  1S2B A;  3MUY 1;  3ACI A;  2Q0A A;  4V1P A;  1DZQ A;  1WLT A;  5CYY A;  1W8Z A;  3B5L B;  4BK4 A;  2FDK A;  2UWA A;  4PDW C;  2C9A A;  3CJI C;  2VBB A;  1DYK A;  2GN7 A;  4KBB A;  2RS5 2;  5J3U A;  1X8E A;  4KWJ A;  5A3O A;  3MIC A;  3T2T A;  2YBP A;  3DPR A;  1ODM A;  3PIJ A;  1QQP 3;  4XCA A;  5JI7 A;  1N1S A;  2YFZ A;  4DUW A;  4DXR A;  3MDP A;  1OMI A;  3UT0 A;  1ZBE 3;  1DGW X;  1FPN 2;  1CAX B;  2ZAB A;  2HYK A;  1AR7 1;  1AR9 1;  1OVP A;  3CJX A;  1R08 1;  1S2E A;  3TYJ A;  2AH2 A;  2V4A A;  3FMG A;  3WF4 A;  2VR4 A;  4N53 A;  4C0B A;  1KJR A;  1WW6 A;  5A6Z A;  3LFI A;  1LHW A;  4AEM A;  1EP0 A;  1ND2 B;  4P9G A;  4Q4W 1;  5KBF A;  5F9T A;  3U0Z A;  1UPS A;  4K9S A;  1SHW B;  3N7K A;  4EZH A;  1SBE A;  5I0R A;  2ZEZ A;  4GAZ A;  4GB3 3;  4RHV 2;  3ITQ A;  3Q8F A;  1LNS A;  3NVC A;  3ZX7 A;  2WRA A;  3USS A;  3MPB A;  2C5D A;  5LY1 A;  1U0A A;  1RUJ 1;  4D6R A;  1W8W A;  1AVB A;  3AP6 A;  4AI9 A;  3KGL A;  2WLQ A;  4QHB A;  1QH6 A;  4LK7 A;  5I0U A;  2WDB A;  3CEW A;  4FXK B;  4DRV A;  3O1R A;  3S57 A;  4DOU A;  2EID A;  2WYF A;  3N9P A;  4Y22 A;  1I9R A;  1RUG 2;  4L8Q A;  4I01 A;  2WII B;  1AYM 1;  5BNN C;  5C8C A;  1O6U A;  1PMI A;  3O1M A;  5FY4 A;  1FPN 3;  4N43 C;  4XHB A;  1OC1 A;  2WKK A;  4B8E A;  5IVC A;  4GIQ A;  2WJS A;  1ENR A;  3ROU A;  2ETE A;  2XQR A;  1PMH X;  4LBK A;  3WP3 A;  1LAJ A;  3A0N A;  3SKV A;  3KT1 A;  4MGS A;  1UMZ A;  3AP5 A;  5L73 A;  5BUV A;  3I49 A;  1GQG A;  3IBM A;  1UW8 A;  4ARX A;  4OHW A;  4YZ5 A;  4DNY A;  4IW3 A;  2JE9 A;  1OUX A;  5FIX A;  5IVY A;  2BEO A;  4MUV A;  5FYB A;  4UAP A;  2E63 A;  2IVJ A;  2OPK A;  4UBG A;  4TXW A;  2D97 A;  3ZM8 A;  1WCQ A;  2JG9 B;  2AEY A;  3GBG A;  5T50 A;  5F1R A;  1SAC A;  2DCT A;  4EQV A;  4LHN A;  4HPK B;  3NST A;  3VBU A;  2WAO A;  5A3L A;  1VBD 1;  4OQ9 A;  3NJX A;  1JZ6 A;  4P14 A;  3KS7 A;  1IQD C;  3JZV A;  3WHT A;  3KMH A;  3CMG A;  2W39 A;  4GKX A;  4OI2 A;  5IK7 A;  4YW5 A;  2P3I A;  2PTM A;  1JZ3 A;  4CUB A;  3USU B;  1RUG 3;  2Q1M A;  4AVA A;  5FRE A;  2RE9 A;  1RUI 1;  3J7N A;  3PUR A;  4LT5 A;  3AYE A;  5CAZ A;  5L7O C;  5JLV A;  1PX3 A;  5T5L A;  2FDF A;  3VDC A;  1JS9 A;  1W2T A;  3T30 A;  5CFD C;  1JZ7 A;  1R09 2;  5FK8 A;  2VE1 A;  1VMJ A;  3I7D A;  5ABJ A;  3E6B A;  4BQY A;  1XQN A;  2ZHK A;  4MOA A;  5FMO S;  2FDJ A;  1FMD 1;  3C7O A;  3WDU A;  1GNH A;  3RZK A;  5E89 A;  1Q8V A;  4K3U A;  3ZXE A;  5DUX A;  2X29 A;  4OI1 A;  1ASJ 1;  2R7E B;  4K8F A;  3A22 A;  5FMC A;  4LA3 A;  3S0M A;  4URA A;  2HH9 A;  1DF0 A;  4LOS A;  3B69 A;  2RDQ A;  4LQR A;  5AVP A;  2ZX0 A;  3NJY A;  3ZYP A;  4CCL A;  3TRS B;  1NE6 A;  4NHM A;  2JD9 A;  2ZHM A;  4Y24 A;  4OHX A;  4XFG A;  3O12 A;  5CG9 A;  5FXX A;  2CDP A;  2WZR 1;  4GWJ A;  3VDD A;  1COV 1;  4KNC A;  5D8A A;  3CKH A;  2QQM A;  4OUE A;  1NY7 1;  1I6X A;  1O5L A;  1QH7 A;  2PHD A;  3BAL A;  3HN3 A;  3I59 B;  2YRO A;  5FZB A;  4D3W A;  3ZDS A;  2LM3 A;  3VD3 A;  5FZI A;  3DYP A;  5F5C A;  4A2U A;  2VCA A;  1W6P A;  1UY0 A;  2W5F A;  2CGP A;  5JOZ A;  5GLU A;  1CJP A;  1N1Y A;  3O0V A;  1E5H A;  1YUD A;  1JYT A;  4IEX A;  2WAA A;  4QAW A;  1SPP B;  1JZ4 A;  1HJF A;  4O61 A;  1F15 A;  1EPZ A;  5FZ1 A;  4IDZ A;  4XUN A;  2PA7 A;  5FPX A;  4ERO A;  3NV1 A;  1W9T A;  4OHZ A;  1RL3 A;  2Q8D A;  2ZZJ A;  3PMS A;  4IEP A;  4F8A A;  5C3S A;  5LBE A;  4FCA A;  3CZU A;  3BB6 A;  4IV1 B;  1DCS A;  2YXS A;  2WNV C;  3QAC A;  3R4U A;  2GMM A;  5FFO C;  1NG0 A;  1CIY A;  1GZC A;  2FDG A;  1QJY 1;  4HLT A;  4LOT A;  4UW6 A;  5FQ0 B;  5FYZ A;  2XKP A;  2VQ0 A;  3FN9 A;  3A7Q A;  3AYA A;  1VBB 2;  3RZM A;  4HKW A;  3MIB A;  4RN5 A;  1JH5 A;  3I3D A;  4BQ5 A;  4RS5 A;  5LA1 A;  1PK6 C;  4AQ2 A;  1OT5 A;  1LOF A;  2RHP A;  4QB1 A;  4MXW A;  2ZAH A;  1GU3 A;  1TMF 1;  2KM2 A;  2KA3 A;  3FFQ A;  1TG7 A;  4Z82 A;  5HCF A;  5F39 A;  3VBR A;  4IE6 A;  2OUH A;  5C33 A;  4AFD A;  3NRU A;  4AGG A;  4AGR A;  4D7Y A;  1O59 A;  1QXJ A;  2QZ2 A;  1OA4 A;  1F5F A;  3ZFF C;  5KHH A;  3UKT A;  5FZM A;  2G9G A;  1CAU A;  2D6N A;  1FMD 3;  5HV4 A;  2DVD A;  5I0T A;  4QX7 A;  5A3W A;  4EN0 A;  2VVF A;  4JKL A;  3P6B A;  4FFI A;  4WVV A;  3ZSK A;  5KHI A;  3RMX A;  4UW4 A;  4JGY B;  5FMO L;  4MXV A;  3U11 A;  3A4U A;  5FZD A;  1C8N A;  2WZE A;  1OLM E;  1F4A A;  1H8V A;  2VNV A;  4X8P A;  2Q8O A;  2BGP A;  1YFU A;  3HNB M;  2JDK A;  1R1A 2;  4HN1 A;  3SKJ E;  1J3R A;  4XEZ A;  2W1U A;  5CKQ A;  1U5Z A;  2XUE A;  3OBR A;  4CDQ B;  3ZR6 A;  1Q8P A;  1VBB 3;  3JD7 2;  2BV4 A;  3I2I A;  5A6X A;  1F8V A;  2Z4F A;  1WZX A;  2WO7 A;  4CDU C;  2XLA A;  5EQU A;  5FPA A;  3GJB A;  4Y4Y A;  1XB9 A;  3J8F 2;  2ZHL A;  1S0B A;  1AUY A;  1TNF A;  1LR5 A;  1QXR A;  3OGS A;  4V2W A;  3H9A A;  3AKT A;  4QU1 A;  4WVZ A;  1XYP A;  3POS A;  1W39 A;  2QTW B;  1UAI A;  4LO6 B;  1MEC 1;  2ZJC A;  3T09 A;  1W3X A;  4HKO A;  1C8M 1;  1VMH A;  4JC1 A;  4CE8 A;  1H8T C;  1PVC 1;  4Q8L A;  4FBF A;  2BUK A;  4MET A;  5JCT A;  4YVS A;  3T2O A;  3PUI A;  1AYN 2;  3MIG A;  2R04 3;  1GQH A;  5LK5 A;  2ZEY A;  1O91 A;  4AQT A;  1OQ1 A;  1TE1 B;  2I45 A;  2D6O X;  3WNP A;  3FUQ A;  1RJ7 A;  4ITC A;  4QD2 A;  4LTA A;  1HIX A;  2VAU A;  5L9V A;  2ZKL A;  3AP7 A;  4FQ4 A;  2X5I A;  2Z79 A;  1N3O A;  4COY A;  3ZFE C;  1Y43 B;  1T6B X;  4PT6 A;  4CU7 A;  1WD4 A;  2G9F A;  4NE9 A;  3III A;  3WD5 A;  1IS3 A;  4A3Z A;  2NQY A;  1NYW A;  5F2W A;  4Y3O A;  4OI0 A;  2LRO A;  3N4M A;  2A70 A;  2R07 3;  5LRR A;  1TMF 3;  3NW4 A;  4FPC A;  4KBZ A;  4HSJ A;  1ZRC A;  4CTE A;  4QGM A;  2DYC A;  4YGB A;  1J3Q A;  1ULD A;  2D6L X;  3KLS A;  3UES A;  4AK3 A;  1UU4 A;  1Z78 A;  3LSD A;  2QQO A;  2XWB B;  4QX3 A;  4OQ8 A;  5F2S A;  1Q56 A;  1VBE 1;  2WQ4 A;  4RGA A;  1AYN 3;  2WZP P;  3DKQ A;  2ZGT A;  2RDS A;  2FCT A;  2ZGM A;  1RC6 A;  5I93 A;  3RYR A;  4HVO A;  1GQP A;  5F32 A;  2XJU A;  4YLZ A;  4QMA A;  1EV1 2;  4AED A;  4UT5 A;  4LOR A;  4HMZ A;  3ILF A;  4I02 A;  4WBB A;  2A6X A;  3JBG 2;  1XND A;  3SXW A;  3PDQ A;  5FMB A;  4FOV A;  3SIT A;  1UOG A;  2I74 A;  3VD9 A;  2AR6 A;  1W8H A;  1BCX A;  1H9P A;  4XBQ A;  2MNG A;  3C7E A;  4UBH A;  5KHG A;  2J1R A;  4YW4 A;  1F9K A;  2Q1F A;  3VBS C;  4MH0 E;  2VZS A;  3PNA A;  4BA6 A;  3SH4 A;  2WSV A;  2FMD A;  4RR3 C;  5DZE A;  5A33 B;  1F31 A;  1IPK A;  1IHM A;  4YG6 A;  2WNV B;  1ENS A;  1IKQ A;  2JE8 A;  4J25 A;  4LUL A;  4FPJ A;  4FPO B;  1BXH A;  4WV8 A;  3HNM A;  2P6H A;  2EXI A;  3VKN A;  3DXT A;  3M7A A;  1ZRF A;  1VB4 A;  2HWE 2;  1LGN A;  1LHO A;  2YC2 A;  4LKD A;  1HJG A;  1YI7 A;  3KF5 A;  4LBN A;  1G9F A;  2D3R A;  1T6G C;  5LBF A;  3VBO A;  4AVT A;  4NJ4 A;  2B5H A;  5AC9 2;  4TTG A;  5FP7 A;  1MQT C;  1OHF A;  4MO3 M;  3URF A;  3AJZ A;  3LGR A;  3ZR5 A;  4CCJ A;  4DQA A;  3WP6 A;  3JBG 3;  3UJQ A;  2R6Q A;  5FUI A;  1SDW A;  4A6S A;  2AUY A;  1H1A A;  3T2P A;  2OPW A;  3ATG A;  4LBO A;  1TME 3;  4XF3 A;  2JE7 A;  2DCZ A;  2VMG A;  1MS8 A;  2WL1 A;  1AF9 A;  3ZN6 A;  1O4Z A;  1CX4 A;  1Q8O A;  4KWK A;  3DPR C;  1AXY A;  4R4X A;  1ONA A;  2ADD A;  4Q0V A;  3SH5 A;  1KEX A;  3EXU A;  3HJR A;  3HEI A;  4NR1 A;  1K5M B;  3DYM A;  3POF A;  1O3T A;  2NMN A;  1D2Q A;  2WSU A;  1ULP A;  2WFF 1;  4LIT A;  5IJR A;  2D44 A;  2XXZ A;  2ZMK A;  3LSE A;  1ULG A;  2ZX2 A;  3POE A;  1YHF A;  2JIC A;  3JU9 A;  4GXL A;  2Q8C A;  1V6K A;  3U4X A;  4QPI A;  5DUV A;  5FZH A;  5J7M A;  1TVG A;  1WMD A;  3VZN A;  2CAV A;  1WW7 A;  2A6W A;  5CKN A;  4AYU A;  3NWK A;  5LB6 A;  4MX3 A;  3GCW A;  4CDW B;  1RGS A;  3MV1 1;  3IDE A;  2HWE 3;  4O9G A;  2O0O A;  4FQZ A;  2IVI B;  1G86 A;  5FP4 A;  4B4Q A;  4YWA A;  3K4A A;  1NLR A;  3AK0 A;  4YM0 A;  4W8J A;  3KV4 A;  4XJU A;  2L9L A;  3ACL A;  3QD6 A;  4CDU B;  2WO1 A;  3FFZ A;  4R8H A;  1Y4W A;  4IE7 A;  3RPQ A;  2D98 A;  5JPN B;  3RRD A;  5FCC A;  3AKR A;  4JRA A;  4Q0P A;  5KXB A;  4QXB A;  1W0O A;  2WT2 A;  1X9T A;  4DPN A;  3NAP B;  3K3N A;  3FE5 A;  5CZK A;  1H8T B;  4MSV A;  4D94 A;  3RZG A;  2PHU A;  4XAC A;  2WO3 A;  1LB2 A;  2GU9 A;  1Q43 A;  4XET A;  2UWC A;  1XSR A;  3ACG A;  3THD A;  2XML A;  2R06 3;  3AKQ A;  4UF0 A;  3PLQ A;  1DGL A;  4WM7 A;  1RIT A;  4CU9 A;  1XOY A;  1IPS A;  1E5I A;  2K0G A;  1OKO A;  5H9Q A;  4JQT A;  1JMU B;  3TEW A;  5DAV A;  4AEJ A;  2UWB A;  3V0B A;  2UYA A;  4YPJ A;  4NPM A;  3R6S A;  3AZV A;  2C9K A;  1I1E A;  1NCR A;  1F4H A;  2A73 B;  1BMV 2;  2ET7 A;  1VB2 A;  4NN0 A;  5EPA A;  3GHM A;  1K12 A;  3CL1 A;  3PIG A;  3MO4 A;  4JDM A;  2CSG A;  2ZTN A;  4IUG A;  3H3U A;  3NNG A;  5FXZ A;  1A8D A;  1IS4 A;  1IS5 A;  1QF3 A;  4RQP C;  1NZC A;  5BNP A;  4KQ7 A;  2WS9 2;  3AL6 A;  5FYC A;  1BBT 2;  1SLC A;  2ATF A;  4MGZ E;  2GDF A;  1NE4 A;  2D5H A;  4XZU G;  3SLI A;  4QGL A;  3UL2 A;  2BYV E;  2JB4 A;  1PO2 2;  3ZIX A;  2Z69 A;  3OBA A;  4N9I A;  5JOY A;  1RUO A;  4GWN A;  4MAD A;  2HEW F;  3ZPO A;  2WZ8 A;  1WLD A;  2NPI A;  5GLV A;  3VBF A;  3VUO A;  1Y3T A;  4M00 A;  1WA6 X;  5D21 A;  4ZON A;  4JGZ C;  4KGG A;  2HBU A;  5G04 L;  2F17 A;  4CYD A;  5J36 A;  1W06 A;  4L99 A;  1O3R A;  2ZML A;  4AFB A;  1E57 A;  3OPZ A;  5FYS A;  4DMI A;  1RVF 2;  4QX1 A;  3ZFG A;  1LGC A;  3E6C C;  1CZV A;  3Q8B A;  4FO9 A;  1JUI A;  4YVW A;  3H0O A;  5FZE A;  3UYJ A;  2CYF A;  2QZ3 A;  1RYY A;  1LHU A;  3KCY A;  1KXG A;  1W6Q B;  1ZA7 A;  4QQP A;  2A6V A;  4YAR A;  2MEV 3;  4WVM A;  2HWB 2;  3Q8E A;  1B35 B;  3S30 A;  5H9R A;  3I3B A;  1RUH 2;  2WO2 A;  1DU3 D;  1OOP B;  2YU2 A;  1DQ1 A;  2KXL A;  2Z2S B;  2ZAA A;  3VZM A;  5IVJ A;  2WS9 3;  1IS6 A;  4ONU A;  1BBT 3;  1D4M 2;  3KT7 A;  2XB6 C;  3I2D A;  5CA6 A;  1HQN A;  2CWS A;  2RM2 3;  4AHX A;  3T4H B;  1RHI 3;  1CES A;  1L3J A;  3CIH A;  3EQE A;  1QDC A;  2OVU A;  1XYN A;  3UKV A;  4NIH A;  1VRH 3;  2WAB A;  4Q4Y 2;  1KD7 A;  4LR4 A;  5LCW L;  3O1U A;  4YZ4 A;  1UY3 A;  2OKX A;  1GSL A;  2JXA A;  3BOW A;  1GZW B;  5IYY A;  2ORX A;  3ZXL A;  5L36 A;  1RVF 3;  2PAM A;  2EIB A;  5FYV A;  1VIW B;  1LOG A;  4G4F A;  4LLF A;  3IAP A;  1SFP A;  2XG3 A;  5A1F A;  3MID A;  4LMF A;  2HWB 3;  4JHT A;  1NXM A;  2VMD A;  1RUH 3;  1Q5O A;  4PIX A;  3U14 A;  2BTV C;  3DPR B;  3JQW A;  2VEC A;  3TN9 1;  4R9C A;  1X33 A;  2PAE A;  1D4M 3;  1HLC A;  3KHC A;  4ZXK A;  4ET7 A;  1QIQ A;  4HZF A;  5IW0 A;  2J1V A;  4D69 A;  1OF4 A;  2PHX A;  4FPF A;  4QXH A;  4M0H A;  4EN8 B;  4L0P A;  1PM7 A;  3MIF A;  2E9Q A;  4JX0 A;  1OA3 A;  4N53 B;  4XJA A;  2CL2 A;  1D0H A;  2GH2 A;  2VUJ A;  5ANQ A;  3U4S A;  4ARY A;  1HRV 3;  1ACC A;  1U12 A;  3RSJ A;  5JSO A;  2DUQ A;  3H3Z A;  4J1W A;  1RUC 1;  4NHL A;  2PQS A;  2YG0 A;  3WUC A;  4BHP A;  2TUN A;  1XE0 A;  1B09 A;  3ZYH A;  1ZA4 A;  4CDW A;  4CPB D;  4EYU A;  2IXH A;  1ND2 C;  2YV8 A;  4FT8 A;  3KGZ A;  3MUZ 1;  3VL8 A;  4QX5 A;  4HET A;  5FLH A;  3NL1 A;  4FFF A;  5GZD A;  3W58 A;  4BIF A;  1ENX A;  2BNM A;  2OT7 A;  4CEY B;  3JQX A;  5DDJ 3;  4MVT A;  3TWI A;  1NOV A;  2CWM A;  5CIR A;  4Q4X 3;  3AM2 A;  2NZ9 A;  4AWD A;  2VCB A;  1MS1 A;  3BKZ A;  1VE0 A;  4OVE A;  1S55 A;  4Y22 B;  5C4W A;  5A70 A;  1US2 A;  2VTF A;  4HXC A;  3ZKU A;  5C8C B;  1GZT A;  3MHZ A;  1X7N A;  5SV5 A;  1O8S A;  5JZG A;  3V0A A;  1OLM A;  2QQW A;  4QDS A;  4EWD A;  5JXJ A;  1HQW A;  5FPV A;  4AGV A;  1HN1 A;  2HWD 2;  1IGO A;  1WCK A;  2VW0 A;  4KI5 M;  3WUD A;  5F6L B;  2H6B A;  2VM9 A;  4QQL A;  4W6W A;  4YFW A;  1LEN A;  3H3L A;  2GSY A;  1RUF 2;  1W9S A;  3ETQ A;  2W9X A;  3FLP A;  1UY1 A;  4Y1U A;  5LA2 A;  2XUM A;  4AFM A;  1C28 A;  1VAK A;  1HB4 A;  4N7I A;  3DKW A;  3L9J T;  3LQC A;  5JWP A;  3S5A A;  5T54 A;  3VBU B;  1LEM A;  1RUD 1;  3WF0 A;  4AI1 A;  4AI3 A;  1UKR A;  2Y33 A;  2JG9 C;  3P1I A;  3AKP A;  2JDH A;  1LES A;  3ZXK A;  1Y9G A;  1QQP 1;  3DUI A;  4AW7 A;  2VOW A;  3PUQ A;  4B1L A;  2YBS A;  2XH6 A;  4RGG A;  1ZBE 1;  1IQA A;  2QFE A;  3BCW A;  2FD8 A;  3THC A;  4YSF A;  4XF1 A;  3WZ1 A;  1GWL A;  5JR2 A;  4AQS A;  5AFB A;  2GAL A;  2BFU S;  3NMB A;  5L9B A;  5ABJ B;  4UFK A;  2JDA A;  4N9H A;  4IE4 A;  5CG8 A;  2VY0 A;  4C1W A;  2GP3 A;  1PIV 2;  4HFS A;  5A7N A;  2IWG B;  1JYX A;  4GB3 1;  4QPG A;  4WVW A;  4CEW A;  1VBA 2;  2F4L A;  2SLI A;  4CCK A;  1GP5 A;  4BWO A;  3VD4 A;  4SBV A;  1A78 A;  2B8M A;  3VDA A;  2SBA A;  5J37 A;  4MG2 A;  2IZW A;  2G1M A;  2VMF A;  3D5O A;  3POW A;  2N7G A;  2RS5 1;  4Z8B A;  2BWC A;  4LBQ D;  2VMI A;  5IK5 A;  4GD4 A;  1NX9 A;  2DV9 A;  1PX4 A;  2NYY A;  3POB A;  2W68 A;  3VDD B;  2RS3 2;  3SEE A;  1UZ0 A;  2VCC A;  1H0B A;  3PUA A;  1CAW A;  1PGW 2;  3N9Q A;  2UU8 A;  5D8A B;  1FPN 1;  2W46 A;  3NNL A;  3OD0 A;  4IEY A;  4Q2F A;  3Q8C A;  1JYV A;  5FZG A;  3LDK A;  1KRI A;  4FTE A;  2YPJ A;  3GDB A;  5BNO A;  4RL7 A;  3IIA A;  2VZP A;  4XTP A;  1PGS A;  4PIZ A;  1W6P B;  3FJS A;  5J1X A;  1EUT A;  5ISL A;  1PIV 3;  1CR7 A;  1XNA A;  3FWE A;  4W6X A;  5K7P A;  1REF A;  3FLT A;  2P1B A;  1SFN A;  3HN1 A;  3IDA A;  4RHV 1;  1AR6 2;  1S4C A;  4LBJ A;  1YQ2 A;  5CFC A;  1POV 3;  3BPS A;  3TAY A;  4X8N A;  1OXC A;  4B7K A;  2Y6L A;  4YZ3 A;  2CTV A;  1QOS A;  1V9U 2;  4TLG A;  1WW4 A;  4NVP A;  5K0U B;  2XGX A;  3U37 A;  3HOB A;  3W21 A;  4D0Q A;  1J59 A;  2HWF 2;  1HRI 2;  5FPL A;  1RUD 3;  1RUG 1;  3AJY A;  3I3Q A;  4IV1 C;  2FZ2 A;  3QCW A;  2YPD A;  3J26 N;  5C5U A;  5J48 A;  3BI3 A;  3F2Z A;  1Z0H A;  5APA A;  4RS5 B;  3RZZ A;  3D0J A;  4Y26 A;  1XU1 A;  4MXW B;  1SCS A;  3LEI A;  5D2A A;  1GLH A;  1H30 A;  3WNL A;  1QEX A;  5HCH A;  5I8S A;  1OUR A;  4Q27 A;  2PHR A;  4LPL A;  4CA9 A;  1LOA A;  4HG6 B;  4DY5 A;  3VBR B;  1NCQ A;  3AFG A;  4J1X A;  1O5U A;  1V0A A;  3S7E A;  2DUO A;  4EN6 B;  3A0K A;  2PYT A;  4URT A;  3VL9 A;  4CUC A;  3J9S A;  5FZF A;  5IAT A;  4MZU A;  1CAU B;  1AR6 3;  2A71 A;  1XSQ A;  2VNG A;  3PJY A;  3RYP A;  4ZZ8 A;  1QY4 A;  2BFU L;  3CF6 E;  1V6L A;  1K5J A;  2R30 A;  1URX A;  4Q8K A;  2EA7 A;  1V9U 3;  1W3V A;  3B3Q E;  4P9L A;  3WDY A;  1LOE A;  1SLT A;  1ULC A;  3OEB A;  5BXX A;  1HRI 3;  4JGY C;  4HON A;  1GAN A;  1NA1 A;  4CEY A;  1KJL A;  2P4E A;  2RS5 3;  4QPW A;  4TWT A;  5A6Q A;  1G9C A;  4JVA A;  2ZGK A;  1POQ A;  2XHN A;  2GNM A;  3C7G A;  2VC9 A;  4XTM A;  4QM9 A;  2CDO A;  4Y33 A;  1R09 1;  4NRM A;  2ZBJ A;  4CDQ C;  5EXO A;  1K3I A;  4WM8 A;  4FOQ A;  2Y8K A;  1JYI A;  3LDB A;  3OY8 A;  5E6H A;  1JOJ A;  1UZV A;  3WP4 A;  1Y9M A;  3UNP A;  4BQ2 A;  2VG9 A;  5IT6 A;  3VN4 A;  2YC0 A;  3CO2 A;  4H55 A;  1AL0 G;  5FY9 A;  2D3P A;  2VXR A;  2ENR A;  4YVS B;  5FZ3 A;  4RHV 3;  1JYN A;  1MS0 A;  3WCS A;  4B29 A;  2AEN A;  5JAX A;  5JMO A;  3LF7 A;  5JMC A;  1LED A;  5FZC A;  4GUL A;  1A3K A;  5EV7 A;  1C4R A;  3P3N A;  4CU8 A;  3ZSE A;  1WWY A;  3ILN A;  2RMU 2;  2ZEW A;  4DRR A;  5GZG A;  4EN7 B;  4L11 A;  4Y1Z A;  1W28 A;  4BJ0 A;  5IVE A;  2X5I B;  3E97 A;  5FJH A;  1UYP A;  3RVH A;  4Z2A A;  1AR7 2;  1AR9 2;  2V5Y A;  2VZ3 A;  1RIN A;  3MIH A;  1C5H A;  3GM8 A;  2VOT A;  1UYZ A;  3K77 A;  3KV9 A;  2B45 X;  4NOT A;  1QJE A;  1CQ9 A;  2IXL A;  3OTF A;  3LAG A;  2IXK A;  3TNP B;  1W8F A;  3SHR A;  1J58 A;  2VOK A;  5I8Y A;  1XRU A;  3TBD A;  5BYN A;  2AZ5 A;  1UPI A;  4NRO A;  1S2K A;  4IE0 A;  1SEF A;  4LBM A;  1YQ5 A;  2DF7 A;  3MI8 A;  5FP8 A;  3RS6 A;  5AFE A;  3FHI B;  3L2Y A;  4GH4 A;  4QHZ A;  4S2H A;  4Y1V A;  3ME2 A;  5A3M A;  5DUU A;  3HMY A;  2ZAC A;  2RJK A;  5FY8 A;  5T5O A;  3ZYR A;  3ABZ A;  3DCQ A;  1FYU A;  3MEP A;  5FK7 A;  4FPH A;  1BMV 1;  5EJ3 A;  2JEM A;  2RMU 3;  5FLJ A;  1VBB 1;  3IMM A;  4QX2 A;  1V6M A;  1UMI A;  4AED B;  5JXG A;  3M3O A;  2EIE A;  1CZS A;  2GNB A;  3WV6 A;  2PQQ A;  4A41 A;  3PVO A;  4E9K A;  1W9Y A;  1XNB A;  2P3J A;  3ZYG A;  3HR9 A;  3S5Q A;  2Q30 A;  3LEK A;  2BWA A;  2D93 A;  3HQR A;  4N8M A;  1R09 3;  1G9A A;  4GMP 3;  4MGT A;  1PZ8 A;  3B02 A;  4P02 B;  3WQ0 A;  4R52 A;  1AX1 A;  3KHB A;  4IEO A;  1V6N A;  1H6X A;  3D8C A;  5DAX A;  2NN8 A;  4P9X A;  4XAA A;  2VMC A;  1JW6 A;  1BVP 1;  2RS1 2;  3OGG A;  4S2F A;  4D7T A;  1TNR A;  1JOD A;  1GFF 2;  2R04 1;  3T2Q A;  1ULE A;  2QUO A;  1IG3 A;  4NO4 A;  4ISR A;  1LKN A;  4HK8 A;  4AQ6 A;  5KHK A;  4D6Q A;  4FPK A;  5K0U A;  3VBO B;  3MW2 A;  3VZK A;  1RUI 2;  5KHJ A;  5HI0 A;  1W2N A;  3WDW A;  4SLI A;  1BJQ A;  2WFP A;  4HKL A;  2DU1 A;  1RUN A;  5IHR A;  4XZP A;  1W6O A;  2ZPX A;  3PL0 A;  2E26 A;  5IFT A;  4XXA A;  5C9A A;  2VZQ A;  4FOY A;  5DUW A;  4ZXE A;  4CCD A;  5LBB A;  4G3Y C;  3ZN6 B;  1NLQ A;  5IVV A;  2OQ7 A;  1DFQ A;  1J3P A;  2ERF A;  4A6O A;  2R07 1;  3QOP A;  4A7K A;  2C4X A;  1X50 A;  4GAL A;  1OVS A;  3LCP A;  2B9V A;  3VLB B;  2MPF A;  5FYT A;  4IE5 A;  3WNK A;  5FZ7 A;  4AF9 A;  2BQP A;  2W08 A;  3ZLI A;  4YGD A;  1VP6 A;  1SLI A;  2RS1 3;  4UFI A;  4DY3 A;  5JIU A;  1AYN 1;  4QPI B;  1K5M C;  2PEL A;  4P9W A;  4BYY A;  1QJZ A;  2GND A;  3WF1 A;  1JXN A;  2V72 A;  2WZR 2;  1UU5 A;  2X53 S;  4LNV A;  1MPX A;  2BDR A;  4ZPI A;  1COV 2;  1BEV 2;  2PHW A;  2JDP A;  2WQ8 A;  2JX9 A;  3MIE A;  3N7L A;  4HSL A;  3J7M A;  4CXY A;  4WZF A;  3VKL A;  4N90 A;  3ZMO A;  4CDW C;  2FCV A;  2E32 A;  1MR5 A;  4RYD A;  1FX5 A;  1O4T A;  2HBT A;  3H50 A;  4UFL A;  5GLW A;  5A6Y A;  1DHK B;  2C24 A;  1MS5 A;  1U5Y A;  1JN2 P;  3AB0 A;  3HD8 B;  1EY2 A;  4JQR A;  4XBL A;  5FY0 A;  3AFK A;  3BIW E;  4FI9 A;  3N9M A;  1DZT A;  2YZ4 A;  1J1L A;  2VME A;  4OUM A;  4DB5 A;  2E33 A;  3D6E A;  4PBP A;  1WUV A;  3BU7 A;  2DCK A;  2RVA A;  2VTX A;  3EYP A;  4HT1 T;  4OMD A;  4XUO A;  3S6P A;  4DEQ A;  4BLJ A;  1XJA A;  5FYU A;  3NAP C;  3RI9 A;  4BU2 A;  3ZO0 B;  1XE8 A;  2WN2 A;  3LB9 A;  2O8O A;  1ND3 B;  4UF0 B;  2JB8 A;  4WM7 B;  4XQ4 A;  4YW2 A;  5JOW A;  2OUJ A;  3NV4 A;  1Q3E A;  2XJQ A;  5FOB B;  1OFS A;  2VOX A;  3VKF C;  1H2K A;  4CCN A;  4HN0 A;  2LW8 A;  4F7Z A;  3V0B B;  1ZRE A;  3L2H A;  1MVE A;  2Z5W A;  1NCR B;  4XOG A; 
#chains in the Genus database with same CATH homology
 4MGQ A;  2LS6 A;  1J83 A;  4YPJ A;  1UX7 A;  2C9K A;  1F4H A;  1K12 A;  2W95 A;  3KQ4 B;  1GOG A;  3MO4 A;  4XUR A;  2J22 A;  4IUG A;  3J7H A;  3NNG A;  3T0B A;  4DXT A;  3K75 B;  3OEA A;  3K4Z A;  1W9W A;  2VZV A;  3CDZ B;  4A45 A;  1KGY A;  3D3A A;  1L7R A;  4XZU G;  4UI9 L;  2BZD A;  3OBA A;  3K4D A;  4MAD A;  2WZ8 A;  5EJZ B;  5HXM A;  3I2G A;  3UET A;  1D7P M;  3I2H A;  4CU6 A;  3VD7 A;  1SZB A;  5DN2 A;  5G04 L;  1JU4 A;  2YFU A;  3CZJ A;  3WF3 A;  4QX1 A;  3C8X A;  1CZV A;  4QDR A;  1US3 A;  1K42 A;  2ZXQ A;  2YC4 A;  1RYY A;  2B4K A;  1JZ2 A;  4XUQ A;  3I97 A;  4D8M A;  1UXZ A;  2DCJ A;  3IAQ A;  4OZO A;  3DYO A;  3IB3 A;  4BK5 A;  3I3B A;  1JHJ A;  2QQJ A;  2WO2 A;  2WYS A;  4DUV A;  3POJ A;  1CZT A;  4UOJ A;  1SDD B;  3GGL A;  2ORZ A;  1JI6 A;  3WNO A;  1NT0 A;  5DMY A;  2RJ2 A;  2VZU A;  2WBK A;  3CIH A;  2WAB A;  3T0D A;  2W1Q A;  5LCW L;  1UY3 A;  3FHQ A;  3OG2 A;  2OKX A;  5IYY A;  2VQU A;  3LEG A;  1H6Y A;  2C26 A;  5C70 A;  2ORX A;  5C71 A;  3OB8 A;  2QBX A;  2EIB A;  2J1A A;  3IAP A;  1SFP A;  1SG3 A;  4CUA A;  3MUY 1;  3ACI A;  4LMF A;  5CYY A;  4BK4 A;  2VZO A;  2ID4 A;  2VMD A;  1UWW A;  2XQX A;  3SEP A;  4ET7 A;  1L7Q A;  2J1V A;  2YFZ A;  4JKK A;  1OF4 A;  4DXR A;  4DUW A;  4L0P A;  4JX0 A;  4ARY A;  4LHS A;  3WF4 A;  2VR4 A;  2PQS A;  2YG0 A;  2VZT A;  3OGV A;  1NUK A;  3ACF A;  2XON A;  1SHW B;  3MUZ 1;  1W99 A;  2ZEZ A;  3POG A;  1EUU A;  1LNS A;  3AC0 A;  4M4R A;  2VCB A;  4A4A A;  1XNT A;  1US2 A;  2VTF A;  2WDB A;  1I5P A;  3FHA A;  3GXU A;  2EID A;  1O8S A;  2VL4 A;  4QDS A;  5JXJ A;  4A42 A;  3ECQ A;  1HN1 A;  2Y6K A;  3WQB A;  4KI5 M;  4OMC A;  2VM9 A;  4QB6 A;  1PMH X;  4CU9 A;  5LA2 A;  1W9S A;  3SKV A;  4MGS A;  2W9X A;  5F7U A;  1UY1 A;  3A21 A;  2V4V A;  3C7F A;  4ARX A;  2QQI A;  4PF1 A;  3LQC A;  5IFP A;  4UAP A;  4TXW A;  3ZM8 A;  1WCQ A;  3WF0 A;  1DLC A;  2VZR A;  3P1I A;  5EJ1 B;  1UYY A;  5CKM A;  2WAO A;  3NJX A;  2WUH A;  1UXX X;  1JZ6 A;  1IQD C;  3CMG A;  2J1T A;  3I2K A;  1JZ3 A;  4CUB A;  3THC A;  5JR2 A;  5JUV A;  1PX3 A;  3VDC A;  5CIS A;  2JDA A;  1JZ7 A;  2BGO A;  3I3E A;  3MBW A;  5LA0 A;  1JYX A;  4MOA A;  3C7O A;  2W1W A;  3VD4 A;  1CX1 A;  3BN6 A;  4W50 A;  3VDA A;  3WNM A;  2R7E B;  2VMF A;  3DEM A;  3A22 A;  4LQR A;  4LOS A;  5G05 L;  3VD5 A;  1NX9 A;  2W1S A;  1PX4 A;  3POB A;  2JD9 A;  2W3J A;  3SEE A;  2QQN A;  1UZ0 A;  2VCC A;  5B4N A;  2CDP A;  2W46 A;  5C7G A;  1JYV A;  4GWJ A;  5I0D A;  3GDB A;  2XOM A;  2W92 A;  3CKH A;  2QQM A;  4OUE A;  2VZP A;  4P00 B;  3HN3 A;  2J1S A;  4AG4 A;  5J1X A;  3VDB A;  4XUP A;  2W87 A;  1EUT A;  3VD3 A;  3DYP A;  1XNA A;  2VCA A;  2W5F A;  1UY0 A;  3IDA A;  1GOH A;  1YQ2 A;  4QAW A;  2WAA A;  1JZ4 A;  1SPP B;  3PUH A;  3JXS A;  3WF2 A;  1UY4 A;  4ZZ5 A;  4XUN A;  2Y6L A;  4E8C A;  1W9T A;  1SPP A;  3FL7 A;  1JYW A;  3LPF A;  2VJX A;  3HOB A;  3CZU A;  3U37 A;  4D0Q A;  4XUT A;  4E8D A;  1GOF A;  1CIY A;  3HPN A;  3F2Z A;  4LOT A;  3FN9 A;  3A7Q A;  3LEI A;  4RN5 A;  3WNL A;  3I3D A;  1W0N A;  5LA1 A;  4LPL A;  1J84 A;  1OT5 A;  4HG6 B;  4QB1 A;  4GWI A;  2Y6H A;  5EIY B;  1GU3 A;  4JKM A;  1TG7 A;  4CUC A;  1GUI A;  1PMJ X;  3ACH A;  4ZZ8 A;  3NRU A;  1O59 A;  2J1E A;  3NQH A;  1W8O A;  4PQQ A;  1OD3 A;  3LE0 A;  4JKL A;  3P6B A;  3OEB A;  4CVU A;  2WZE A;  1F4A A;  1O8P A;  3DEC A;  4QDQ A;  4QPW A;  2BGP A;  3OGR A;  1JZ5 A;  1T2X A;  3HNB M;  2X05 A;  4BDV B;  2XHN A;  3SKJ E;  5CKQ A;  2W1U A;  3C7G A;  2J1U A;  2CDO A;  3I2I A;  1K3I A;  2Z4F A;  2QQL A;  5DPN A;  2Y8K A;  1XC6 A;  3UNP A;  1K45 A;  2W91 A;  3OGS A;  3MV0 1;  4KMQ A;  3CQO A;  1UMH A;  2VZ1 A;  3T09 A;  4BXS V;  1JYN A;  4AAX A;  3WEZ A;  5JMO A;  2X09 A;  3BGA A;  3T2O A;  3PUI A;  4CU8 A;  2ZEW A;  2ZEY A;  2QQK A;  5HPO A;  3WNP A;  2EIC A;  3ETP A;  4BJ0 A;  4Z2A A;  5B4X A;  2VZ3 A;  3GM8 A;  1UY2 A;  2VOT A;  1NAE A;  1UYZ A;  2JKX A;  3K77 A;  2VQT A;  4P5Y A;  3W5M A;  4PT6 A;  4CU7 A;  2YB7 A;  3I2J A;  3III A;  4A3Z A;  4DXS A;  3W5N A;  1UYX A;  4KWU A;  2W94 A;  5A1A A;  5JXH A;  1NZI A;  1JU3 A;  3UES A;  1W8N A;  2QQO A;  3ABZ A;  4QX3 A;  4P08 A;  2WN3 A;  2DDU A;  4QX2 A;  5DQ0 A;  3C7H A;  1UMI A;  5JXG A;  2EIE A;  1CZS A;  1GQP A;  4A41 A;  2VO5 A;  4JHZ A;  4LOR A;  1JZ8 A;  3LEK A;  2Y6G A;  4P02 B;  1WKY A;  1DYO A;  2KD7 A;  4DEV A;  3VD9 A;  3POI A;  3C7E A;  2J1R A;  3WSO A;  2BER A;  1H6X A;  2VMC A;  3T08 A;  2VZS A;  4XVH A;  3T2Q A;  2JE8 A;  1BHG A;  3HNM A;  2WNO A;  2YC2 A;  5IHR A;  5IFT A;  2E26 A;  4QX0 A;  4W4Z A;  4TTG A;  2VZQ A;  4GZ9 A;  4MO3 M;  4ZXE A;  2J7M A;  3I2F A;  2E31 A;  3LPG A;  4DUX A;  4A6O A;  5FUI A;  4ZY9 A;  2C4X A;  3HNY M;  3T2P A;  5JXI A;  2W47 A;  2B9V A;  4A44 A;  3WNK A;  1KEX A;  3HJR A;  3HEI A;  4QB2 A;  3DYM A;  3POF A;  1ULP A;  4OYU A;  1DP0 A;  5IJR A;  3POE A;  3WF1 A;  1P8J A;  2V72 A;  1OH4 A;  1R64 A;  1TVG A;  2BBA A;  1MPX A;  3K46 A;  5CKN A;  2HLE A;  2WQ8 A;  3NJV A;  3MV1 1;  4LKS A;  2ZEX A;  1NKG A;  2E32 A;  2Y6J A;  4RYD A;  3A23 A;  3K4A A;  4W8J A;  2L9L A;  1GMM A;  3WNN A;  1XPW A;  2WO1 A;  2HYX A;  3E1F 1;  4FI9 A;  2VME A;  2E33 A;  1OF3 A;  3EYP A;  2DCK A;  2RVA A;  4OMD A;  4DEQ A;  4XUO A;  2Y64 A;  5CZK A;  2V5D A;  1GNY A;  2WN2 A;  4M4P A;  2WO3 A;  2RV9 A;  3ACG A;  3THD A;  2LW8 A;  3T0A A;  1ULO A;  3EB7 A;  2X10 A;  2VC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...