2QQKA

Neuropilin-2 a1a2b1b2 domains in complex with a semaphorin-blocking fab
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
568
structure length
541
Chain Sequence
b'PCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVYAPEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSMLYIKFTSDQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDLYDWLDIWDGIPHVGPLIGKYCGTKTPSELRSSTGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEWSPSAARLVSSRSGWFPRIPQAQPGEEWLQVDLGTPKTVKGVIIQGARARAFVRKFKVSYSLNGKDWEYIQDPRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neuropilin-2
publication title Structural studies of neuropilin/antibody complexes provide insights into semaphorin and VEGF binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 122
structure length 541
sequence length 568
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00431 CUB CUB domain
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2qqkA03
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2qqkA04
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 2qqkA02
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 2qqkA01
4QB6A 2VO5A 1CZSA 2X10A 2WO3A 1K45A 2EIBA 2VZ3A 3CZJA 2QQOA 1W9SA 2XHNA 3CKHA 2J1RA 2VZVA 3K4AA 4LKSA 2WQ8A 1JZ7A 4QAWA 2V72A 4BK4A 1W0NA 2J1VA 3HPNA 1XC6A 4DUVA 3SEEA 1GMMA 1UYYA 1NT0A 1O8PA 2PQSA 1MPXA 2HLEA 3HNYM 1I5PA 2BGOA 2E31A 5C71A 3IB3A 1PMHX 3WNLA 3C7EA 2VR4A 3I2JA 1NX9A 3HOBA 2WO1A 2VZPA 2B9VA 4GWIA 4XVHA 4JKKA 1UY4A 2DDUA 2W1SA 1GQPA 4IUGA 5A1AA 1J83A 2CDPA 1CIYA 3ETPA 3C7FA 4A4AA 4XUOA 4RYDA 4MO3M 4TXWA 5C70A 1UX7A 4PT6A 3VDBA 2ZEZA 4ZZ8A 2VZUA 1O8SA 2JE8A 3OGSA 4A42A 3NQHA 2C26A 1JZ8A 2YC4A 2VMEA 3KQ4B 3HNMA 4UAPA 3ACHA 1JU4A 2W1WA 4PQQA 4KMQA 1J84A 3A21A 2J1TA 3EYPA 3VDCA 2ZEXA 4MGQA 5EJZB 5EIYB 2RV9A 2W91A 3A22A 4D0QA 2ZEYA 2B4KA 2VMCA 3T2PA 4DXSA 3VDAA 1UWWA 4P08A 2WNOA 2BBAA 2WN3A 1PX4A 2JDAA 5HPOA 2BGPA 3NJXA 4LORA 5G04L 1IQDC 4DUXA 4MADA 4ARXA 2VZQA 3A7QA 3HNBM 3HN3A 3I2HA 4JX0A 4LQRA 4CUBA 1GU3A 3POFA 1H6XA 2W87A 4LHSA 2VL4A 4JHZA 1XPWA 5LA0A 5I0DA 4D8MA 2EIEA 3WSOA 3UETA 3FN9A 1UYXA 5G05L 4DXTA 5JXGA 1O59A 5EJ1B 1XNTA 1DLCA 3DYOA 3WNOA 3MV01 1PX3A 2R7EB 3J7HA 5IHRA 2WUHA 3WQBA 4DEVA 5DQ0A 4JKMA 2VZOA 3FL7A 4BJ0A 3BGAA 5DN2A 3OBAA 1JZ4A 1ULPA 3I2FA 4AAXA 1JZ5A 4XZUG 3I3BA 3UESA 4E8CA 2VZRA 1KEXA 1W9TA 2W5FA 5LCWL 4XUPA 3P6BA 3DYMA 1JZ3A 1NKGA 3WNNA 3W5MA 2KD7A 4OYUA 2E26A 2VCCA 4A3ZA 1UMHA 2VQUA 3FHAA 2W1QA 4CU7A 2DCJA 4LOSA 4LMFA 2QQJA 2Y64A 2W94A 3MUZ1 2WO2A 1TVGA 1UXZA 4MGSA 4QPWA 4QX2A 4P5YA 2VJXA 4OMCA 3OGVA 5B4XA 2V5DA 2Y6KA 3BN6A 3IAPA 3NJVA 2Y6GA 4XUTA 2YC2A 1GUIA 1UY3A 3I2GA 2E32A 4Z2AA 4QDQA 3WEZA 2L9LA 2Y8KA 3WF3A 1CZTA 4M4RA 2CDOA 4OZOA 3E1F1 4QDSA 4QDRA 3PUIA 5F7UA 4XURA 3I3EA 2Y6HA 5JMOA 2EIDA 4ZY9A 3OG2A 3MBWA 1DYOA 3NNGA 1OD3A 3OB8A 1JHJA 4KWUA 2WZEA 2VCBA 3C7OA 2J1UA 4LPLA 5LA2A 3SKJE 2W95A 3VD5A 4E8DA 3POEA 3ACGA 5HXMA 3CMGA 5CISA 2J7MA 4UOJA 4YPJA 2VZSA 1GOHA 4W4ZA 4PF1A 5CKQA 5FUIA 5C7GA 4RN5A 2QQMA 2W47A 1F4AA 2E33A 3K46A 4QB2A 1SFPA 1JU3A 3MV11 3VD3A 1GOGA 1R64A 2JKXA 5DMYA 2ORXA 3LEGA 1LNSA 2HYXA 1NZIA 2ORZA 2WZ8A 4L0PA 3WF0A 4QX1A 4BDVB 4GWJA 4A41A 3ECQA 2ZXQA 2X09A 1WCQA 3I2KA 5IJRA 1SZBA 3MUY1 4P00B 2W3JA 5JR2A 3OGRA 2C9KA 2ZEWA 1SPPA 3VD9A 3T2OA 5DPNA 3CDZB 3K77A 1W8OA 3OEBA 1F4HA 2VZ1A 3IDAA 5JUVA 3NRUA 1OF4A 2XQXA 2VMFA 4XUQA 3T08A 3A23A 1K42A 1W8NA 2J1SA 3VD7A 3HEIA 3GXUA 1UY1A 4CU9A 2J1AA 1K3IA 3T0BA 1OT5A 3VD4A 4AG4A 1JI6A 1CZVA 3GDBA 4ZXEA 5IYYA 3MO4A 4OMDA 1BHGA 1HN1A 3HJRA 3POBA 1W9WA 1SHWB 4CVUA 2LS6A 1EUTA 3I97A 3D3AA 1KGYA 2LW8A 2VOTA 3I3DA 2WAOA 4HG6B 3POIA 1UYZA 3W5NA 2WYSA 4A45A 1GNYA 1CX1A 2XONA 3T09A 3LPGA 4OUEA 1UY0A 3THDA 1W99A 3WNKA 4ZZ5A 2EICA 2W92A 2OKXA 4UI9L 1JZ2A 1JYWA 5CKNA 5CYYA 1TG7A 3ACFA 4KI5M 2Y6LA 3ZM8A 1XNAA 3P1IA 3CZUA 3CQOA 3GM8A 1NUKA 2QBXA 1OF3A 4BK5A 3JXSA 2YFZA 5LA1A 2V4VA 5IFPA 3POJA 4QX0A 5CKMA 3LQCA 3LEKA 2WABA 2QQKA 1UZ0A 4GZ9A 1YQ2A 1DP0A 1L7RA 2VC9A 2WN2A 3GGLA 1SPPB 3WF1A 3LPFA 2J22A 3SKVA 4CUAA 3WNMA 3C8XA 3FHQA 5JXHA 2VQTA 1JYXA 3T0DA 2QQNA 5J1XA 4TTGA 3LE0A 1SDDB 3DYPA 1OH4A 1P8JA 2ID4A 3THCA 1GOFA 3K4ZA 3K4DA 4ET7A 2WAAA 3K75B 2Y6JA 2QQIA 4QB1A 1PMJX 1ULOA 1NAEA 1US2A 2W9XA 4A44A 1JYNA 4BXSV 1UMIA 2C4XA 3IIIA 2YB7A 2J1EA 1D7PM 3IAQA 3PUHA 2WBKA 2JD9A 3I2IA 4QX3A 2RVAA 2YG0A 2BZDA 4P02B 3AC0A 4CU8A 3POGA 2X05A 1L7QA 1UY2A 2WDBA 4M4PA 3C7GA 3DEMA 3WF2A 2VZTA 3T0AA 1WKYA 4ARYA 5CZKA 2VM9A 3T2QA 2XOMA 3SEPA 1JZ6A 4W50A 4DEQA 3F2ZA 3DECA 3LEIA 5B4NA 2YFUA 2RJ2A 1SG3A 2BERA 3UNPA 4FI9A 5JXJA 2VCAA 1EUUA 4XUNA 4CUCA 4MOAA 3WF4A 4CU6A 4JKLA 2DCKA 3OEAA 4W8JA 3C7HA 4A6OA 5IFTA 4LOTA 1K12A 4DXRA 3ACIA 1T2XA 2Z4FA 1JYVA 1H6YA 1UXXX 3U37A 3ABZA 3WNPA 1US3A 2VTFA 3CIHA 2W46A 2VMDA 3EB7A 1RYYA 4DUWA 2QQLA 5JXIA 2W1UA
chains in the Genus database with same CATH superfamily
4LIUA 4QB6A 1J3QA 1RIRA 1V6KA 2TEPA 4B8EA 4OVEA 1J3PA 1H2NA 4JGYA 4XF3A 2VZ3A 5FXWA 2MNGA 1AL23 3WW3A 3ZYBA 4E9KA 1V6MA 1AL0G 4M0HA 4FFGA 2JX9A 4CRQA 1QJEA 4NRQA 4DZGA 5IWFA 3DPRC 4SLIA 4M3CF 1KITA 1PGW1 3WP3A 5J96B 4Y26A 4FOWA 5HCHA 2PLV2 2RDRA 2DVBA 2WWSA 3RZMA 2WQ8A 3OUJA 3UL2A 2FZ2A 1SFNA 4XJ8A 1QKQA 1ZM1A 3DKWA 1JZ7A 4D3WA 5H9SA 4FPOB 4XC9A 5F2SA 1RC6A 2GC1A 1FNZA 2V72A 3OCPA 2OXBA 4L8QA 4A3XA 1RUH2 4K1ZA 1J3RA 4V2WA 2VGDA 4XFFA 3H9AA 4DUVA 3B9CA 4Y20A 3SMHA 3WQ7A 1Y9MA 1GMMA 1OFNA 5LEJA 5F1RA 4RS5B 2WT0A 5IT6A 1LOEA 1W6NA 2CY6A 1MPXA 3WG3A 3GHMA 4COYA 1EV13 4NRMA 2HLEA 3MIGA 4AL9A 1X9PA 3HNYM 5LBBA 1ODNA 4IEQA 4TSVA 2BGOA 2ZX2A 5C71A 5M0TA 4CDQB 3O7OA 4LBNA 4JQRA 1GZ9A 1Z7S1 1YFWA 5FY8A 2BVBA 4QX5A 2B9VA 4GWIA 4RFRB 1Q5OA 2DDUA 4CE8A 2E7TA 2DUPA 2WT1A 2ZGNA 2CHHA 4XZPA 4YZ4A 4ASKA 2D3PA 1OHFA 2RS31 1DQ4A 1DGWA 2XUMA 1HB4A 3ETPA 3C7FA 1DZTA 4LXLA 3UJOA 4RYDA 4LBQD 4IGOA 3P5BA 5C70A 1FYUA 3FC0A 3MDPA 2AREA 4AQTA 1CPMA 2JEMA 3VDBA 2ARBA 3FLPA 4AFCA 4K21A 2UY8A 4P9IA 3NWKA 3OF1A 5FO9B 1S0CA 3OGSA 4R9CA 4KWLA 4XTPA 4XQWA 2GAUA 3T1MA 2Y6FA 4A42A 4N90A 3B5LB 2VMEA 2FZ1A 4UAPA 3ACHA 3AZVA 3ATGA 4XPVA 2OA2A 5HV4A 4ZKTB 5DUUA 2RMU3 1GICA 1CWPA 4L2NA 3B7MA 3AXEA 2VPVA 3HBKA 3TEYA 1UNBA 3O0XA 5JWPA 1LHOA 1R1A3 1RUJ3 2OQ7A 2BU9A 3KLSA 4A7KA 5EJZB 3BVCA 4DY3A 5L7OA 2FDGA 5GLWA 3ZFEC 2PAKA 2RV9A 4B7EA 3AVRA 5A1LA 2O14A 3A22A 1UU4A 1BXHA 1LR5A 1I9RA 3ZSLA 3M7AA 2DVFA 4DXSA 2WNOA 3H3LA 1RUNA 1W2NA 3VBOA 1WCSA 2JDAA 5HPOA 4PDWC 2BGPA 2BJSA 3D5OA 3KCXA 5A7PA 1QXPA 3VZNA 2R1DA 3WW4A 4YG0A 5FY9A 4COZA 4LBLA 3WVJA 3MEPA 4YVWB 2ZKLA 2W87A 1GZWA 1G9BA 3I59B 1A8DA 4XBQA 5KHGA 3J9SA 3DL3A 4HANA 3THPA 4FVVA 1ULFA 2YROA 4CPBD 4M3CB 4W6XA 4BQ5A 5F39A 4BIOA 4QWNA 4N8MA 2CWMA 5G05L 1VBD2 2BNNA 1LU2A 5EJ1B 4UYBA 3ILNA 3LAGA 3KV6A 5B2GB 3DYOA 5LWBA 4CP2A 4XXAA 2EXJA 2W2IA 2PYTA 3MV01 1CAXB 1DHKB 2QVSB 1HB1A 2VAUA 2PAEA 2NYYA 3KSCA 1D2QA 1GQGA 2O8QA 3WQBA 4BA6A 4E4DX 5C9AB 2YY1A 4KGGA 2Z79A 3M8LA 4JKMA 3FL7A 1OPOA 1X50A 3IBMA 5ANQA 1ZBA1 2LM3A 3BGAA 1W2OA 3TYJA 3OBAA 3BALA 3VLBB 1ULPA 3M4FA 5CVRA 5F8PA 1CN1A 3KB5A 4Q8KA 4CEYB 4CEWA 1QDCA 1VE0A 2BWCA 1DIWA 1HRI1 1MS4A 4E8CA 5GJ6A 3P6BA 1I5ZA 2CWSA 4IQPA 1W90A 1RUD2 1F9KA 4I01A 4BQ2A 5FIXA 1GP4A 1RITA 1WD3A 2DVGA 1O4TA 3ST7A 2VQUA 2W39A 3NSTA 2NLRA 2QUOA 1N3OA 3KVBA 4E4SA 1CAVA 1H0BA 1ST8A 1LOAA 1W2TA 3A0NA 3KCYA 4QPGB 3ZPOA 2W94A 1H1IA 1F5JA 3AXDA 1NCQA 3VBUA 2HBTA 4S2DA 2ADDA 3PNAA 2HWB2 2VNVA 3OPTA 1G9CA 3ZFFA 1OA2A 4QX2A 3U4SA 2R0HA 1JH5A 1SDWA 1W6PA 3TAYA 1RVF3 2VJXA 3OGVA 4CDWB 3U1XA 2VVEA 1UO9A 1NY72 2VNOA 2Y6KA 3BN6A 3O1OA 2XVLA 1CONA 2Y6GA 2A1XA 2DV9A 4K3UA 5F2WA 5FZGA 1NLRA 4OLLA 3VBHB 5FLHA 3WUCA 3VBFC 3VZLA 5K0UB 2EVXA 1HXS3 1UY3A 4GJYA 3S7IA 2IVJA 4WVZA 1MQTB 4LKEA 4QGNA 3DGTA 4WVMB 5FPZA 3GBGA 4PBPA 4Z2AA 2RS32 3O1MA 2Y8KA 1QDOA 1RUE2 4X6RB 1CZTA 1AX1A 4IL7A 4M4RA 2WO7A 4XFHA 5I91A 3THTA 4C90A 4FQZA 2D6OX 3BB6A 3N7MA 4CEWB 3JB4C 3PUIA 2Q1ZB 4AQ2A 3PJYA 3R4DB 1PIV3 2XJTA 4XURA 3I3EA 4BQ4A 4GXLA 2Y6HA 3EBRA 3FE5A 3A4UA 1JUHA 3N9QA 4AGVA 5JCTA 1OD3A 2YV8A 3EQEA 3LWCA 4QU2A 2SBAA 2YBKA 2ZMLA 2Q4SA 4XE9A 4Q4X1 4ITCA 3WD5A 1H2MA 2VMHA 4YM1A 3AYCA 4HLTA 5LA2A 2XPJA 4RQPB 4QKFA 1W6OA 3U4XA 1POV1 4E8DA 5IVVA 4DRRA 2Z69A 4YW4A 3MPBA 4MX3A 3CMGA 2XKPA 2DCYA 5LZ6A 1KJLA 1MEC1 1RUG2 1ULCA 1STMA 4QPIA 4XBLA 1TMF1 5F37A 1BMV1 3RGBA 1ZZ7A 4PLNA 3BU7A 4GQ7A 1WZXA 1W0OA 1HXS2 1LHVA 1XXNA 1ALYA 3CLPA 4PF1A 4FFHA 1FPN1 4QQLA 2ZGLA 5L7OC 3GZTB 5FZ3A 1LESA 1PZ8A 1FOD3 2A3YA 1CESA 4IV1B 4TYSA 1F4AA 2HEWF 3AMQA 3R4SA 1LEMA 1QIQA 1AR83 3TRSB 2BGCA 3VBOC 2ZAAA 2RM23 3UK9A 1RJ7A 2OZ6A 4NPLA 3TEWA 4UW6A 1SFPA 1BVVA 4INDA 1OKOA 5FPAA 3PU3A 5A3NA 4NIDA 1UX6A 1OLME 3NJYA 4P9LA 1C4RA 3M3QA 4IEXA 2G9FA 1FV3A 1AR63 2Q8DA 3GHNA 2CAVA 2K2SA 1LNSA 2HYXA 2ORZA 2WZ8A 1RINA 2EALA 2Y0IA 2MHFA 2VW2A 2QDRA 2RS51 1FI2A 3LB9A 4J1WA 2IXHA 2B5HA 1C3HA 4GB33 4XFBA 2X09A 5I8SA 3VHOA 5JI7A 1XYOA 3DXTA 3ZYIB 4H14A 1XSRA 1XOYA 5IJRA 1ND2B 1MZFA 1E57A 5JSRA 4CDQA 1VRH3 1CX4A 1WLDA 1S2EA 1AX0A 2ZAHA 3KT1A 4IV3B 5A3LA 2PHRA 1W0PA 1OKQA 5FY5A 3RFRA 5GZCA 3GF6A 3OGRA 5GLTA 5D8AB 2C9KA 2CTVA 2GP5A 4AK3A 2WS93 2WINB 3VD9A 1AZDA 1TZOA 3INAA 2G4IA 4NWWA 3UT0A 3NRUA 2K46A 2PHLA 5C8CB 1W8HA 2XQXA 4Q0VA 5FZAA 4R4ZA 4XJUA 2UWAA 3N4MA 4CEWC 1YLLA 2J1SA 3IZOA 4OI1A 3ZYFA 4FCAA 5DDJ3 3MLKA 1AHSA 4MVTA 3R6SA 2F4LA 4Z1VA 1TNRA 1KFUL 1XBFA 2QTWB 3VD4A 1UQXA 4Q1RA 1S0DA 3GDBA 3IDEA 5IYYA 3MO4A 3H42B 5FYCA 4DO0A 4LO5B 2BP6A 2A7AA 4PI0A 3J7NA 2VOWA 4NPMA 4QGLA 1SHWB 5A32B 1ENRA 4IEUA 1EUTA 1QJX2 3D3AA 1NCQC 3I97A 4N7UA 1O5LA 3VBUC 4ZHNA 2QQPA 4UF0B 2YPJA 1XJAA 1JYIA 1UIJA 2YGMA 1UYZA 3POIA 3ZFFC 3VDDB 3USUA 1CX1A 4B7KA 4BISA 1M06G 2XONA 5FXZA 5L19A 3LPGA 2DURA 2Y38A 4FXGB 1BCXA 2XMLA 2HWD1 4GMP1 1W99A 2QCSB 3JU9A 5T50A 1CR7A 1LGCA 2OKXA 4QQPA 5GZEA 1XNBA 3CO2A 1DYPA 1NZCA 2OIIA 1DQ0A 4ZS2A 2EXHA 2WA3A 3KGLA 4YVWA 3P1IA 3CZUA 4D6QA 5CEHA 3GM8A 3W21A 1REFA 1OF3A 1PO11 4D94A 4UFMA 2JDMA 1RUI1 2YFZA 1E5IA 3POYA 5JDBA 2V4VA 3TB0A 1CGPA 4M3CA 1W39A 4XHXA 3SITA 4V2VA 4F3JA 2R16A 5IFPA 3LKJA 2Y0OA 4H55A 1V6IA 2GDFA 1YEWA 3K51A 3LEKA 4NO4A 5GLZA 3UKVA 1W8TA 4LO4B 3FLRA 1OLMA 1VR3A 3CNAA 3ZMNA 3AK0A 4R9DA 5KXCA 1I6XA 2I2SA 2VOKA 1AYN3 2VC9A 4RR3B 1KQRA 1MS8A 1UPIA 2G9GA 1TMF2 3WF1A 4QM9A 1VBA3 4Y22A 4CUAA 4M01A 4E4HA 1O4YA 4BWOA 3WNMA 4LJHA 1OPMA 2G19A 3U11A 2Q8CA 1SBDA 2R061 4Q4V2 1FPN2 3ZIWA 3LE0A 1OC1A 4QPIC 3L2YA 3M1HA 4FFFA 2D43A 4NR1A 3RYKA 4CEYA 2A70A 5LEKA 4LITA 1P8JA 2GMEA 2ID4A 1GOFA 4XDOA 3ZSMA 4KL1A 1UCXA 2I74A 5JSOA 2D6KA 1GNZA 1QNWA 3AP7A 4AHZA 4ET7A 4CXXA 5KHJA 5FZEA 3K75B 2V09A 2QQUA 2Y6JA 5I8YA 1RUF3 4OFGA 5FZBA 1SQ4A 2D3SA 5FV3A 4C91A 2XJQA 2JG9A 2O1QA 4Q8LA 1JYNA 1UMIA 2JDHA 4BU2A 3AFGA 3SCGA 1W2UA 3IAQA 4K1YA 2DWRA 3I2IA 2XH6A 3WY6A 4QQ2A 1QJY3 2YG0A 1GZTA 1LGNA 1BEV1 2BZDA 4XF1A 3ZSKA 4CDWA 3AC0A 4YZ5A 3LIGA 1W6QB 2X05A 3KM5A 4JTNA 2GH2A 2VXJA 3GJBA 4UBGA 4RS5C 2ZABA 1AYM3 3FUOA 1PNFA 4B4PA 2WL1A 4SBVA 1QNYA 1E5RA 2XOMA 3VBHA 1JODA 1D4M3 4DEQA 4N7IA 1FNYA 3F2ZA 2ZX4A 4O9EA 1HB2A 3BODA 2GNMA 4WVMA 4U2AA 1VAVA 2P3KA 4CDQC 2BERA 3NAPB 2WFF3 3N3HA 4FI9A 1PGL1 1OQDA 4MYEA 4YFWA 1EUUA 3TNPB 2QFEA 2E63A 2OW4A 2R041 1RUOA 1JHNA 1UAIA 3M70A 4LKFA 4MOAA 2RS12 5JOWA 1IGOA 4JKLA 4K20A 5LK5A 2AZ5A 1WBFA 3MHZA 4YM0A 1OH3A 5AFBA 4W8JA 3C7HA 4JZRA 1F2NA 4A6OA 2DBIA 3AYAA 1K12A 3JB8A 3JQXA 4DXRA 1EAH1 3PL0A 4Z2WA 1I1EA 3B9IA 3RNSA 1OA4A 2KR2A 2XL7A 2XWJB 2UY9A 1H6YA 1XE0A 2V4AA 3Q8BA 5EHDA 1HRV2 3QH6A 1LODA 3GNEA 1V6JA 1O3TA 4BMEA 2WZPP 4KU8A 3EB7A 2XJRA 1HKDA 1U5YA 4LE3A 2VMIA 5J7MA 3NO8A 5ACA3 2QQLA 5HI0A 2WC2A 5L73A 3B00A 3B3QE 5H9PA 4CCJA 4B1MA 3UGHA 3BKZA 1J1TA 2X10A 2VE1A 5KHIA 2H0BA 3CZJA 5FZIA 3RJRA 3SQOA 2FDFA 4Y5SA 2RJLA 1AF9A 3IDCB 5EP9A 4AEKA 4HN0A 1R092 5FOJB 1R082 1W6MA 2J1RA 5I93A 4BMBA 1W8WA 2WYFA 2P6CA 4P9JA 5J48A 4Q4W1 4A6SA 2WA4A 4IE4A 4R9AA 5LASA 2X8KA 2NQYA 4H3WA 1SLLA 3AP9A 4IV1A 5FREA 4HVQA 3LOIA 2LRPA 3GBFA 3ZDVA 2J1VA 5HV0A 1E5HA 1PM4A 3HPNA 3BI3A 3JBG3 1HQLA 4S2GA 2ZGUA 4AFMA 1MS3A 1Q8SA 1W9FA 4YVWC 1PHMA 2GNBA 2WNUB 4WVWA 5CFDA 1SACA 1RMU1 1LGBA 3H50A 1O8PA 4DB5A 4RHV3 3MIFA 1BK0A 4FO9A 5CAZA 1DQ6A 2R6QA 3TBDA 3BCWA 1V9U1 2PHTA 1ND3B 1Y4WA 4HSJA 3MW4A 1QJU2 2Z2SB 1YQCA 3C7EA 3WNLA 3AB0A 1FMD1 5A3WA 1ZBE1 3I2JA 2RR13 3ZVXA 4Y3OA 5IUQA 2FDJA 3HIFA 5JI9A 4IV3A 3EHKA 4XVHA 2MEV3 3AKPA 3O12A 2VCMA 1CJPA 4JKKA 3VZKA 1LTEA 4YLZA 2H6BA 2W1SA 2VBPA 3ZFGB 2QQWA 4CTEA 1HX6A 5D8AA 3URFA 4IUGA 1C8M1 1CAWA 1J83A 1DZQA 2CDPA 2YUEA 3WHTA 5A70A 5FAXA 4OULA 1ENXA 4PIYA 3MYXA 3KMHA 2PHWA 5C8CA 2CU5A 4MO3M 1UN1A 4J6GA 4TXWA 3ZYJB 4CEYC 5LW9A 2R073 3GCWA 4PT6A 1Q3EA 1RL3A 1RXFA 3E6CC 1COV2 4Q0UA 4PHZA 2ZEZA 4EV0A 1O8SA 1ZVFA 2JE8A 1IQAA 2ARCA 2C26A 3OOXA 1JOBA 2YC4A 4NRPA 3HNMA 5DZEA 1JU4A 2D97A 5EFUA 4YW7A 3PTRB 3BU0A 5DUXA 1POQA 4FT8A 3WP6A 1BEV2 1PVC3 1WMXA 2JG9C 4QXBA 1B35B 1OBNA 3AP4A 1UZWA 4I0AA 1UPSA 1GQHA 1J84A 3AVSA 3D0JA 4KMQA 3A21A 3TN91 3K3OA 3N9NA 3WDXA 4CCDA 2HWE3 4BLJA 1VBE1 5EIYB 4XIOA 4DMIA 1J58A 3VDDA 2JENA 4CDWC 1HLCA 5FYBA 4FXKB 2ZEYA 1W3XA 5FP8A 5SV5A 4JDOA 3T2PA 5BUVA 3VDAA 4Y1VA 4IEOA 1DBNA 2OZJA 2WN3A 2MEV2 5GLUA 4YRDA 1PGL2 2DU0A 3VBHC 5G04L 3WCRA 4AEJA 3WDYA 2H0VA 4AOCA 3VKFC 3M3IA 2PLV3 5FQ0A 4CUBA 2A71A 3POFA 4MXWA 2RDQA 5A3UA 2ZX3A 2VUDA 1OI6A 2RDNA 2WSVA 5LA0A 4RFT0 2Y33A 4PIXA 1RUH3 4N9HA 2BTVC 3DKQA 1EV11 4CCOA 2A6ZA 4B3NA 5I0SA 5A6ZA 4XBNA 1UZYA 4RS5A 1QQP1 4N9IA 4R52A 3S57A 1DLCA 1U5IA 1YI9A 3VZMA 4K8RB 3AYEA 3PU8A 4NE9A 3WNOA 4IEPA 4JRLA 4NAOA 1LAJA 1F5FA 2WUHA 1TME2 3SISA 4AQ6A 2P3YA 4P14A 2ET7A 3NVCA 4RR3A 1SCSA 5KXEA 2H6CA 1H2KA 1WGPA 2IC1A 4BJ0A 1GBGA 5EQUA 3AM2A 4EN0A 2HKXA 4LR4A 5FYIA 1KS4A 5LATA 2WLQA 1JZ4A 5BYNA 1PZ7A 1G9DA 2WNVB 2ARAA 5IVYA 1A8MA 1LOGA 2P3JA 2RHPA 5GZDA 3USSA 5FZDA 2VVDA 4OHYA 1MZ6A 5C4WB 2VY0A 5JOXA 3IIAA 4YW3A 5LRSA 4J1XA 1JZ3A 3WV6A 1NKGA 1RHI1 3WNNA 5JIUA 1DDLA 2KD7A 5FY1A 3BTXA 1UMHA 3P3NA 4ISRA 2I07B 4CU7A 2BQPA 5EYYA 5L9RA 4LOSA 3RJ2X 1ACCA 1HV0A 4PBOA 3U07A 2PXJA 4OQ9A 2AC1A 2Q8EA 4OCTA 2WO2A 4IV1C 2RMU1 5BXXA 1RMU2 4MGSA 5J98B 4YM2A 1Z0HA 5FPVA 3U14A 4CDUB 5HCAA 4MXVA 5CBLA 3ZKUA 3SH5A 1LU1A 1R1A1 1RUJ1 1V9U2 4OMCA 4P5YA 3UKTA 4LT5A 2HWC2 2ZGQA 4KH9A 4LBOA 5CFDC 1NE4A 2EIGA 5T55A 4AR2A 1YQ5A 4LUMA 5FBJA 3OPZA 3VBFA 1HJGA 3BIEA 5DZGA 2XLAA 1DCSA 3AP5A 1GUIA 3T1LA 4LHKA 5FYTA 1SEFA 2D6LX 2D40A 2XXZA 5FZ9A 4IXLA 2B8MA 3OJBA 4KU7A 1RXGA 3WEZA 5AVAA 4Q2FA 5AC92 4A7ZA 1UMZA 1DFQA 2CDOA 4XJAA 4IV3C 3NAPA 3E5QA 1LRHA 4JGZB 5FZHA 1RUC2 5D8AC 3FHIB 5FR3A 4KG0A 5DUWA 2Q1FA 4JC1A 2VTXJ 5DXDA 5JMOA 2EIDA 3OG2A 1LECA 5DAPA 3IPVA 1DYOA 4LHNA 2VW1A 1EPWA 4MZUA 3WG1A 5C8CC 2VOVA 3WG2A 2CGPA 3OB8A 5FTTC 4IE0A 1UD1A 1YFUA 1S55A 1Y43B 1FATA 2JXAA 5LBCA 1OLRA 3V0BB 5JZGB 1O3RA 3ITQA 1PK6B 5IVCA 3ES1A 1VBD3 4LK6A 1WMEA 2XG3A 3ZYRA 1ZZCA 2BFUS 3VD5A 4A7YA 2UWBA 3POEA 4Q0QA 2WLPA 5FZ7A 1VBE2 4F83A 1BBT2 3OPWA 4UOJA 1OOPB 3N36A 4DINB 1SFYA 5IVFA 4Q4Y2 1FAYA 5A7OA 4LKDA 4XAAA 3HVDA 3MF9A 2VZSA 4QPYA 3AZWA 1CD3G 5JOYA 2E7QA 2JDKA 2G1MA 4R9BA 3VDDC 2FQPA 4N43B 1W04A 2ZX0A 2JIGA 3ILFA 4XILA 4NIIA 3ZXDA 3WT3A 4QX1A 3ETQA 5C7GA 1UOJA 2XBO2 1VMFA 2W47A 3ZSJA 4FPYA 1RUD3 2R30A 2DVDA 2OX0A 1CPNA 2D44A 4IE7A 1YFYA 4QB2A 4CCNA 1G9AA 4NAMA 2JJ6A 3WG4A 1GOGA 1RVF1 5F3EA 5FZLA 4OUSA 3UJQA 4B29A 1QQP2 3LFMA 4AZZA 3LEGA 5FWJA 2WNUA 2HWB3 3Q8EA 4IE6A 2VW0A 4GWJA 3JQWA 2WZR1 4FPKA 1ASJ2 1ZZ9A 2ZXQA 5KHKA 3O1UA 1QJFA 2B7YA 3MPPG 4CXWA 3I2KA 4C1WA 1ND3A 3HT2A 1URXA 3MUY1 2HEVF 3KGZA 3QCWA 5FZFA 4P00B 5DUVA 3VKMA 3M3EA 1NXD1 5FK8A 1WMDA 4JHTA 3B94A 4QD2A 4XXPA 4JDNA 3CBNA 2IXCA 4WVVA 2ZEWA 4RR3C 4AVTA 4TZDA 3ZFGA 3AZZA 5DG1A 3I3MA 5DPNA 1NLSA 3K77A 2RS33 3KWVA 1PIV1 1RUE3 1RHI2 3IDAA 1S0BA 1S0FA 5IK4A 5JUVA 1AXYA 1CAUA 1OF4A 1PGW2 3H3UA 2PTMA 2FCUA 3LD8A 3T08A 1YCIA 2BNOA 4LBQB 2VUAA 3N9MA 4Z07A 1DQ1A 1NA1B 4P9YA 3T2TA 1K3IA 3T0BA 3I54A 4CCCA 4MGIE 4AG4A 4ZXEA 5DAQA 5GM0A 3RZGA 3ZDSA 1HN1A 3IMMA 2WJSA 3OGJA 3OYWB 2E9QA 3HJRA 3POBA 3KHBA 1W9WA 4E2GA 3PMEA 2GNDA 3U78A 2LW8A 1VBC1 3I3DA 5J36A 4BLIA 2A6VA 1K5MA 4HG6B 1GSLA 4YSFA 4NHMA 3W5NA 1GNYA 4Y5Z0 1H8TB 1RUG3 1PGSA 2GALA 4LK7A 3T09A 1MS0A 4OUEA 3RYPA 3RI8A 1Z7S2 4IGPA 1FOD1 4D69A 3AL6A 1K5JA 1WUVA 4ZZ5A 1C1LA 1AR81 3ZX7A 2W92A 3WDVA 4AI8A 4C8DA 2RM21 3N9PA 5CKNA 5CYYA 5FZ1A 2LUWA 2ENRA 1HIXA 3ACFA 4CP9A 2RDSA 1XNAA 3O0WA 4XJWA 3VBSB 4LULA 2XQRA 3QD6A 4FPFA 2ETEA 3CQOA 1NUKA 1X9TA 3NAPC 1XYPA 5E8AA 4BK5A 1NG0A 5LA1A 5F5QA 1BK1A 3HMYA 2AACA 4AVBA 2FD8A 1W2AX 4GB31 3AKQA 1H8VA 2PHDA 5CKMA 1Y7BA 1IKPA 2HBUA 2WABA 2QQKA 1YRZA 3D82A 1VAMA 2GP3A 1W9YA 1UZ0A 2TUNA 4LBMA 4BQWA 3FZ3A 2WN2A 3GGLA 1D0GA 1SPPB 1SBFA 1VB4A 3BYWA 4CZSA 1S1AA 3LPFA 3WNXA 5J09A 4L99A 1EP0A 5F5CA 2Q1MA 3A0KA 3CL1A 5KXDA 2XDVA 3FHQA 5JXHA 3T0DA 2ZZQA 5J1XA 2R0FA 3KHCA 1HQWA 1S2BA 5FFOC 3PURA 3AZYA 2P4EA 4AI1A 5I0UA 2BBVA 5K8SA 3EMRA 4LUKA 1E5SA 4ISQA 1SMVA 4HZFA 2AYHA 3KT4A 4AQSA 3S0MA 3LZZA 2IXKA 1AUYA 4IEYA 2WWUA 4XEZA 4W65A 2AH2A 2QQIA 1SLIA 1IHMA 1PMJX 1ULOA 1NAEA 4GULA 5EXOA 1D0HA 2W9XA 4FPGA 2XUEA 4L92A 1ULEA 2XL9A 4HMZA 1S0JA 4XW3A 4GH4B 2BNMA 2GMPA 2C4XA 5FXXA 5TSWA 3RWNA 4BXSV 4Q29A 2CGOA 2YB7A 1N3QA 1WWYA 2OPKA 1DF0A 4XABA 3PUHA 2WBKA 2JDPA 2JD9A 3I8TA 5FO7B 4IEWA 4QX3A 2B46X 3DPRB 4AEMA 1L3JA 4CU8A 1QJX3 1JTZX 1LOBA 1L7QA 3DEMA 4M4PA 3C7GA 3PJQA 4UFHA 3WF2A 2WNUC 3T0AA 4P9WA 3NMBA 3N7LA 4JRAA 3POSA 5CZKA 4M00A 3WX5A 4IEVA 3SEPA 4PI2A 1VP6A 1MVQA 1MACA 4W50A 5FZOB 4QU1A 3MFCA 5GKAC 4Y33A 1ND3C 1BKZA 1ZBA2 4AI2A 3BOPA 4IGQA 4HXCA 5FKBA 3RZJA 2CL2A 4H2AA 4MUVA 4XHBA 1BJQA 3UNPA 3QBQA 3SCFA 3ZKYA 1HRI2 5ANNA 4K6BA 1XE8A 4LTAA 4JGZA 3ZFGC 3WOGA 1DQ5A 4HPKB 2KM2A 3N35A 4FTBA 3O1VA 2VQ0A 2IWGB 1T2XA 4QX8A 4XFGA 4D7TA 3MIHA 5GLVA 2Z4FA 5E6HA 2BW8A 1JYVA 2XJSA 2G9ZA 2WSUA 4NIGA 2UWCA 2RJKA 4XF9A 3U37A 1O3SA 2ZMKA 4L9BA 3WNPA 1UKRA 3J8F1 3MI8A 4BQ1A 2GN7A 1AYN1 3CIHA 4X8NA 5A6QA 1VBC2 1U0AA 1YXWA 1CVNA 1UOFA 2VMDA 1DGWX 3O0VA 4YZ2A 3WQ0A 4UT5A 3W9AA 4MG2A 2XJUA 4FPEA 3LA7A 5F3IA 1KDKA 2A3WA 4AHWA 1MEC3 1AJKA 3I4IA 1G8WA 1OMIA 2QE3A 1YO8A 1TMF3 1OOPA 5BNNB 5FPBA 2EIBA 2A6WA 3NKTA 4KG8A 2ZGOA 1K5MC 3UYJA 4E2QA 4FFIA 2FMDA 3AMPA 2QQOA 1W9SA 2XHNA 4Q4V3 1FPN3 3CKHA 1PMIA 4M0NA 4K8FA 4BPZA 2VZVA 5FLJA 4QHOA 3ZN6B 3DUIA 4R4XA 3S30A 4LKSA 1PVXA 4NHLA 1RUF1 2GC2A 4JV4A 2VD7A 1ZREA 4BCUA 3LFIA 2B9UA 4CDXB 1REEA 1DQ2A 1D4VB 1XC6A 3LGRA 3ZFEB 3LA3A 2JIJA 4CUGA 3SEEA 1QJY1 3I59A 4YGDA 1XNKA 2ATFA 4HKWA 3WCSA 1NT0A 3N7JA 4ES8A 3JD71 1QGLA 1YI7A 5IVJA 2D3RA 4Q4X2 5IVEA 1AYM1 5BNQA 4FTEA 4BZ4A 1QH6A 5FMCA 1I5PA 2E31A 3IB3A 1LHWA 1PMHX 4FOYA 1WCUA 1LEDA 2VR4A 1AR71 1W3VA 4H7MA 3HOBA 2WO1A 2VZPA 3OD4A 1MEC2 2NPIA 2WFF1 4ONUA 3RZLA 1CAXA 1UY4A 1C28A 4MHUA 2IFRA 1DLLA 5APAA 1BMV2 2D98A 1GQPA 2ZBJA 5C9AA 3T4HB 1V6OA 5C5TA 5A1AA 4AVAA 1YHFA 5C8WA 2TBVA 1QJZA 3N9OA 5EPAA 1CIYA 4XCAA 5KXBA 4A4AA 4OI0A 4HFSA 3LSDA 4XUOA 3VKNA 3RZHA 1UF2C 2K9ZA 1HV1A 5BNPB 2WNVC 3O1SA 2RS13 1LB2A 1UX7A 3IN9A 4OHXA 1JOJA 2BV4A 4ZU5A 3H7JA 4BQ3A 5GZGA 2VZUA 2XR4A 4P5HA 5LBEA 2GU9A 1JZ8A 2C1FA 1ZX5A 4MGYE 3MZHA 3QACA 3AMNA 2W1WA 4DOUA 2DBNA 2VH9A 3OYWA 5ACA1 4QPGA 1HRV3 1WW5A 3ZR5A 4BOWA 2BEOA 2PQQA 4JGYB 4D6RA 1IG0A 3NNJA 2RS52 3VDCA 1A34A 4BM8A 1YIFA 3TNQA 4BYYA 2VULA 1AR91 1NOVA 4CDUC 1N1VA 1CJDA 5BY5A 1IS3A 4ES9A 4D0QA 2GC3A 4EN7B 1DGLA 4QKDA 4GMP3 4LLOA 1PX4A 4B4RA 4FPCA 5K0UA 1R093 3NJXA 1OQEA 3OTFA 1QF3A 1R083 1IQDC 4MV2A 1BLZA 4MADA 3ENRA 1MQTA 4YW1A 4DUXA 1J1LA 5FOBB 3O5SA 2VZQA 4AEDB 3HN3A 4JX0A 4LQRA 3U10A 1ZYBA 4Y20B 2W08A 4Z82A 1GU3A 2OUHA 3AJYA 5KC5A 4UFJA 2VL4A 3ALQA 3VBSA 1DYKA 1PO13 2EXKA 3IWZA 3WR0A 1XPWA 2P2KA 4QM8A 1W6NB 3ZSEA 5JSPA 3J4UH 2VBDA 1KS5A 4JGZC 1IPSA 1APNA 1O91A 2V73A 5F6LB 3RSJA 2I45A 4QHZA 4QX7A 2W68A 2VMGA 1C5HA 3J8F2 4WZFA 5IW0A 4NVPA 4CPBA 5FJHA 4L0PA 5JXGA 1TNFA 2E53A 2DFCA 1XNTA 2AUYA 3H8RA 4OHWA 4CA9A 2Y26A 4FAHA 3X29B 2RR11 2ZTNA 1XSQA 2LROA 5IHRA 1Q43A 4GIQA 1QJU3 4FQ4A 4DEVA 5DQ0A 3NV2A 3E97A 3AFKA 2VZOA 3BPSA 3FWEA 3MICA 2P6HA 4MHRA 1IPKA 4RQPA 5DN2A 4ASLA 3O1RA 4YW2A 3I2FA 1BZWA 2N7GA 5IAVA 4F7ZA 4AAXA 4IERA 1ZRDA 2YGLA 1OLQA 1JZ5A 3I3BA 3UESA 5GZFA 1H4GA 5JVVA 4AVSA 1OOPC 2VZRA 3GCXA 5JLVA 2HWD2 4XUPA 1UU5A 4P9GA 2B45X 1PO21 2E6VA 3ZXJA 3W5MA 4DQAA 1V70A 3FLTA 2E26A 4GKYA 1W8FA 4EWAA 4D7SA 3H3ZA 4Q0SA 1JBCA 5A33B 4LMFA 3JZVA 2QQJA 4OQ8A 3WUDA 1ZZ6A 2C0ZA 2IXIA 4BH9A 3MUZ1 1COV3 5CIRA 5JMCA 1PO12 4XF4A 1PVC1 1TVGA 3FFZA 1RUI2 2XVKA 3V64A 3JD72 1S2KA 4GH4A 5T5PA 3OBTA 2PN5A 3L9JT 4QPWA 2HWF1 2HH9A 4OHZA 4XF0A 1ENSA 4XQDA 5B4XA 1OQ1A 4E4ZA 4C0HA 5KBFA 3SC7X 3PVNA 1BEV3 1HQNA 1O3QA 2EF6A 3IAPA 3LCPA 4E27A 5FZKA 3JCIA 4GALA 3SLIA 4BIFA 4PLOA 5JIAA 3MGUA 3ZXGA 1G86A 4WM8B 4QQHA 5DG2A 3VZJA 1GWLA 5AVPA 5FZOA 2E32A 4I0WB 3ZXAC 1H1MA 1GLHA 1HW5A 1ND2A 4QDQA 2PLV1 2L9LA 3WF3A 2UU8A 1S0IA 2R062 3BPZA 2ZS6B 5BV6A 4OZOA 2ZGSA 3E1F1 1BQPA 4QDSA 1H4HA 3WP5A 1TE1B 1VBB1 2ZHKA 4IDZA 1EPZA 5C9AC 2WRAA 1VPHA 5EWSA 5FZ6A 3CJIB 1RUH1 4AGRA 2FBEA 4DNYA 2AEYA 1MZEA 2VUCA 1X7NA 3DF0A 4GWNA 4ZY9A 4AFBA 3MBWA 3JUUA 3M3CA 5FZCA 4HVOA 4TLGA 4MGTA 5CG9A 3PDQA 2C5DA 3PVEA 3DXUA 4WBBA 1WCDJ 4ASMB 3GALA 2J1UA 1NA1C 1GNHA 2R32A 3ZPYA 3ZYHA 4UBHA 3FBMA 5A7WB 5FYHA 1WLWA 3NV3A 2ZOEB 4JTOA 5HXMA 1JXNA 5CISA 1ULGA 4QPGC 5A32A 1TME3 4META 5I0TA 4YW6A 1WD4A 4ATFA 5FYZA 5FPXA 3K3NA 3EXUA 4RGAA 2NMOA 4YPJA 1AL21 2ZPXA 4GAZA 4UF0A 2XWBB 5CNAA 4AVCA 1OFSA 3PLQA 1MZ5A 4QXKA 2ADEA 2BUKA 1ZA4A 4YGCA 3HN1A 3V65A 2LALA 4GWMA 4AAPA 3UGFA 4AYUA 1KD7A 4U36A 1H8TC 4JVAA 1YJKA 5EJ3A 4G4FA 3FUQA 4A2UA 3ZN6A 3K48A 1KFXL 3K46A 3ORJA 3W20A 3VBUB 4O61A 1DU3D 1JN2P 5K0UC 2R042 2ZHMA 3MLJA 3RRDA 3VB9A 1MQTC 2PELA 3GJAA 3ZLIA 2GSYA 2JDUA 1JU3A 1W6PB 1OUXA 4CDXA 1W8UA 3MV11 2F6BA 3VD3A 4I0BA 5A7SA 4HL0A 2GZWA 3ZXFA 2JKXA 1EAH2 1R64A 3NL1A 5DMYA 1OXCA 3VBSC 2HEYF 2ORXA 3AKRA 4CCEA 1RMU3 1NZIA 2DYCA 4BDVB 5HBAA 1FX5A 2DCZA 5FXVA 4C0BA 4FPLA 3VBRB 3LOBA 1V9U3 3ZYPA 1NCRB 4LHLA 4MGKE 1LKNA 1WCQA 3KZ4C 4I30A 4DFSA 2HWC3 2FDHA 4BB3A 3ZN4A 5F5AA 4URAA 3RG0A 2X29A 5FYSA 3GBWA 5JR2A 4NN0A 4IEZA 2VVFA 3HWJA 3SHRA 4Y1YA 4I2OA 1N3PA 2TNFA 2Z5WA 2ZHLA 3SH3A 4LBJA 1AXKA 2MPFA 3CDZB 4RQPC 5AC93 4XOGA 1PO22 3WINE 4UW4A 1O7FA 1YNAA 3M3OA 2X5IB 5L36A 3A23A 4Q4W2 1RUC3 4XETA 1Q56A 1WA6X 4H7LA 3VD7A 3E5UA 4NMIA 2WQ4A 5BNPA 3GXUA 3ZMOA 5FKCA 4EWEA 4ZONA 2NN8A 1DGRA 1SLCA 3GYDA 4Z92B 4FP3A 4YGBA 4FSJA 1VBD1 3FFQA 1Q8VA 4I09A 2IXJA 2XHKA 5FY7A 3RZKA 1UYPA 2HWF2 4E2SA 1RB8G 3T30A 1MVEA 1UOBA 2RE9A 1OA3A 3V56A 2LS6A 3Q8AA 3TN93 3U75A 3RZZA 3P3PA 3D6EA 4EZ4A 1JMUB 2NMNA 4GH4C 2WAOA 2YU2A 2ZKNA 3AZXA 2CAUA 2WYSA 1VBE3 3ZXEA 4KGQA 2FDKA 5JPNB 3LIHA 1BBT3 3S5QA 3VUOA 4AI0A 2BYVE 1FMD2 2GH8A 2ZGTA 1W6QA 1ZBE2 2O0OA 4Q4Y3 4ZS3A 1UY0A 1XYNA 5F6KA 3ZR6A 4HSLA 3I2OA 5CFCB 2LTNA 2WT2A 3RS6A 1UU6A 4MSVA 2P5BA 4LE4A 2EICA 5L9BA 1RUD1 2EXIA 1ONAA 1S0EA 4ZXKA 1VBB2 5C3RA 1JZ2A 1JYWA 1C8M2 3TWIA 2ILMA 1TG7A 1ND2C 4MH0E 2ZCWA 4KI5M 2XBO3 3ZM8A 4AEDA 2OPWA 2D5HA 4YNIA 4LIVA 5FCCA 2WNEA 1WLCA 3EJKA 3JXSA 3OUHA 4S2FA 4XIKA 2DU1A 2HWB1 3C3VA 3UGGA 5A3OA 5LY2A 2FCVA 5A3MA 2VNGA 2DTYA 3LQCA 3RPQA 2UURA 1QQP3 2IZWA 1BYHA 4LLFA 2YBSA 1NY71 2WQZC 4Y4YA 4GZ9A 1ASJ3 1YQ2A 3HAGA 1DP0A 1L7RA 3TN92 4AFDA 1IKQA 2J22A 4CYDA 3NKGA 3SKVA 4QXCA 1AL22 4CP0A 4CCKA 5C6CA 5LB6A 1NQJA 1RUE1 1JYXA 1GR3A 1R1ZA 4QHBA 5BNOB 2E51A 2VUJA 4GKXA 4LO7A 4MGZE 2OYZA 1G6NA 5ABJB 4ORFA 4NIAA 1VMHA 3THCA 2EA7A 3OGGA 4W6WA 4HOOA 4YM3A 5BNNC 1RHI3 5IATA 3MIDA 3TEXA 1A3KA 1IOAA 2A6YA 4NROA 4QB1A 2A6XA 4N53B 1NLQA 5A33A 1US2A 1EY2A 3KD4A 5LRRA 2HJIA 2FDIA 2XB6C 4HK9A 3LEMA 1IS5A 4IETA 1D7PM 1Y9GA 4DRVA 2P1BA 4AVVA 1EV12 2OT7A 2ZZJA 3HT1A 4ZPIA 3USUB 4CDXC 1TQ5A 3OBRA 5FMOS 2RVAA 5E1RA 3WQ1A 1N1TA 5JR7B 3QLQA 3KV5A 4P02B 3POGA 1RUG1 4GA9A 4TLFA 4XQ4A 4NIHA 1WKYA 1WW4A 1ODMA 3FMGA 2VM9A 3SH4A 2ZA9A 1HXS1 1JZ6A 4RL7A 4WM8A 4EQVA 1JYCA 5B4NA 2NP0A 3B93A 4COUA 1IG3A 3HQUA 4QXHA 1Z7S3 1I3HA 4HKLA 1DG6A 4KWJA 1NXMA 3RDIA 1G9FA 2OS2A 1F8VA 2P17A 2YXSA 1LULA 2VCAA 2ZX1A 5JXJA 3OY8B 2XVGA 4XUNA 4CUCA 3AKTA 3HQXA 3NNLA 1YQ8A 4IW3A 1L7LA 3H1WA 4CU6A 2V5YA 1WA4A 3VZOA 5FPUA 2DCKA 3KQRA 4AI3A 1F35A 1YUDA 3CJIA 3CJXA 4LOTA 1H1AA 4QT6A 2GN3A 4UW3A 3O1TA 2YZ4A 2JICA 4I3GA 5T5LA 4CP1A 1FXZA 4UWDA 5I0RA 4Y4RA 3ON7A 5IK5A 1U5XA 3KT7A 2DVAA 1HN0A 2NM1A 4S2HA 5T54A 5BNPC 3ELNA 2RMU2 5EYXA 3J7MA 5LK7B 1KDMA 1GP5A 2BFUL 2BPA2 1UL9A 4UW5A 2W46A 4OI4A 4Y22B 1O6UA 3RMYA 3ZIXA 1D2SA 2K0GA 2JG8B 3K2OA 5FLIA 1PNGA 4DUWA 5A7WA 1R1A2 1RUJ2 2JWPA 5JXIA 1UW8A 2CYFA 2AGSA 1YYNA 3BTYA 2W1UA 4AF9A 2VO5A 1B35A 2ARXA 1CZSA 3KF5A 2CSGA 3ZXKA 2WO3A 1K45A 1T6GC 1VJ2A 4JGYC 5DABA 3LSEA 3S5AA 5FYMA 1AJOA 1QHDA 1IZ3A 1OURA 1QXJA 4PCRA 1X8MA 4ZU7A 3PVBB 1QWRA 5DAVA 1SLBA 3K4AA 3VN4A 5HCBA 3WLUA 5T5JA 4CCLA 2JG9B 4URTA 3J26N 1NE6A 4QAWA 5FUNA 2VG9A 4AXOA 1F31A 2CGNA 4BK4A 1W0NA 2R49A 4PJYA 5FMOL 5GALA 1IS4A 2JB4A 1C5IA 4MLOA 4YVSB 3AYDA 4AEDC 1QXRA 4WZCA 2ZGKA 1AR61 1WCKA 4FPHA 2VOXA 1XB9A 1UYYA 1YFXA 1QJX1 5LA9A 4UFLA 1T6BX 1FV2A 2PQSA 4EN9B 5KC6A 2WZR3 1H2LA 4HONA 4OZXA 1O4ZA 3IT8A 4XMIA 4UXAA 2QJVA 3VBRA 1H9WA 3D0SA 1NCRA 4K40A 3VHNA 2PAMA 2JECA 4Y1XA 4BHPA 1VRH1 2A3XA 1NX9A 4GD4A 2FMYA 1VMJA 2C9AA 5C3SA 4D6SA 2ZMNA 4EJRA 4WM7B 1YQ6A 3PMSA 2WS91 1ZBA3 1S0GA 1LHNA 1GP6A 3D4KA 1O5UA 1ULDA 2Y60A 4R8HA 5FDBA 3AJZA 3BTAA 2Q5TA 5D21A 2CNAA 2ERFA 3ZO0B 5T5OA 1HRI3 1XRUA 2WNVA 4LA2A 5D2AA 2YYOA 2X5IA 2WR9A 4I3PA 5A7QA 2EAKA 3G6JB 5C33A 4XFCA 5DDJ1 5C4WA 1ZRFA 1GZCA 4HN1A 3T4VA 5FY0A 4ZZ8A 4JAAA 4XAEA 3EO6A 5A3PA 4L97A 1V0AA 2DF7A 2E7AA 3NQHA 3MF6A 3KQ4B 4UFKA 1N47A 1RVF2 4PQQA 2KXLA 3ROUA 3GZUC 3I2DA 2ET1A 4QKNA 1VBC3 2AEZA 5CA6A 3MLLA 2J1TA 3EYPA 2WZR2 4NHYA 1IS6A 1C1FA 2ZEXA 4AFAA 4CDUA 3LDBA 4MGQA 1XNDA 1W6MB 2BWAA 2W91A 4Q4V1 2XJPA 1C8NA 2HYKA 2F4PA 3RI9A 2BDRA 1PZ9A 1QY4A 2B4KA 4FBFA 2VMCA 2PMWB 1LOCA 4NPRA 1UWWA 4P08A 2D7FA 2YDEA 1ZA7A 2BBAA 5C3OA 3OD0A 5CFCA 4M3CE 1VIWB 3HBZA 3PIJA 4NJ4A 4LORA 4XYXA 5IK8A 2IXLA 4WM8C 3CF6E 5J37A 3T3YA 5D1IA 4L11A 3A7QA 3HNBM 4ARXA 5F9TA 3I2HA 2C6SA 1PIV2 1GYKA 3APBA 5SV8A 3H0OA 1H6XA 5HCFA 2ZGPA 3OBZA 2CV6A 1QMJA 1QOOA 4JHZA 3AL5A 4LHSA 5CFDB 5ISLA 2P3IA 1MS1A 4AWDA 2PHFA 2Q30A 4JQTA 5I0DA 1OVSA 3AKSA 4HETA 4O9GA 4D8MA 2EIEA 3WSOA 4O65A 3UETA 3FN9A 2BRTA 3CJIC 1UYXA 4EE2A 4DXTA 2KA3A 1O59A 1VALA 1N1YA 4XMAA 3B02A 1X8EA 1N1SA 4K7JA 5C3QA 1XE7A 4Q4X3 1FT9A 1PX3A 4AW7A 2R7EB 3J7HA 3ME2A 1W06A 4HBNA 4QGMA 5JZGA 3V0BA 1PK6A 3H8OA 4LO6B 1VBA1 2JE9A 1CAWB 4YZ3A 1POV3 2A73B 4EN8B 3AP6A 4G3YC 4F8AA 4XDQA 3CU7A 1QOTA 2Y34A 3ACLA 3Q9OA 2VECA 3FJSA 5BNOA 3AX4A 2XGXA 4XZUG 1B35C 1IPJA 1U12A 2PHXA 5FYVA 4AHXA 1FOD2 1KEXA 1W9TA 2W5FA 5LCWL 1ZZ8A 4UFIA 3DYMA 4DIQA 5ABJA 3O14A 2RS11 1NQDA 1AR82 4BQYA 2VU9A 4OYUA 2RM22 2VCCA 5EV7A 1WLTA 4A3ZA 3FHAA 2W1QA 4N43A 2DCJA 1TEIA 3BTZA 5JAXA 5A3TA 2Y64A 1Y3TA 3ILRA 5FP3A 4N53A 4DY5A 1A78A 3Q8CA 1AR62 3RVHA 1HRV1 1KJRA 1UXZA 3VL8A 5FZMA 5F5IA 3R0RA 2OQ6A 4P9XA 5H9QA 3D8CA 4NOTA 4YWAA 4FP2A 1Q8QA 5E89A 4EWDA 4KBZA 5FRAA 4GB32 1SLAA 2GNTA 4LEJA 4NHKA 3FX3A 2V5DA 1WBLA 4BQXA 3NJVA 1VRH2 1UZZA 2RS53 3IKWA 4PDWB 4AE2A 4XUTA 2YC2A 4YG3A 4X8PA 3I2GA 3UKNA 1D4M1 3MIBA 5FY4A 3VBRC 1JOPA 4Q0PA 1R091 3OUIA 4XJ9A 1LOFA 1R081 1NCRC 3CEWA 2WS92 4KQ7A 4B1LA 5FQ0B 5FP7A 5C3PA 2DFBA 2ZGMA 4Y24A 1QEXA 4MXWB 4PQ9A 3BOWA 4KBBA 2OVUA 3C2UA 3W58A 3KV4A 4FOQA 4QDRA 3OY8A 2XLGA 3F95A 2WWJA 2P37A 3GZAA 3WW2A 2Q0AA 4V1PA 5DDJ2 4XFIA 5F7UA 4QQOA 5FZ4A 5K4LA 2WFPA 4DPNA 2GMMA 3PUAA 5E16A 3NNGA 3VGIA 4RD7A 1JHJA 2X5IC 3KF3A 4KWUA 1H30A 1YC61 2WZEA 2ZGRA 4LBQA 2JB8A 5C4WC 2VCBA 4FAGA 2VTXA 1NA1A 3C7OA 3J8F3 4I02A 1UIKA 5LBFA 4LPLA 3S7EA 3V0AB 3NV4A 1LHUA 1QJU1 2DCTA 3SKJE 1UZVA 4FTSA 2W95A 5A1FA 3NW4A 4DXZA 3ACGA 4LNVA 4G9SB 1J59A 2JG8A 1QU0A 2J7MA 1LCLA 3N9LA 3PVOA 5FYYA 3R4UA 1HB3A 2UYBA 1V00A 3Q8FA 2QDNA 5LY1A 1GFF2 4XFAA 2YHJA 5F3GA 3ZYGA 1GOHA 1Q8PA 4XDPA 4W4ZA 4NWVA 2YMZA 1H8TA 4QMAA 3MW2A 1WW7A 3HD8B 5CKQA 1GWKA 2FCTA 1W03A 5FUIA 4D7YA 4RN5A 2HWD3 3IDBB 1X36A 2QQMA 3NNMA 1JW6A 2C24A 1X33A 2E33A 2AR6A 2B39A 4Q27A 5CFCC 3I7DA 4AI9A 1COV1 2Z42A 4C1XA 2ES3A 4OUMA 5AFEA 5EZWA 1GANA 2XJVA 5CU1A 5JOZA 2Q8OA 3JBG1 2ZJCA 4YVSA 3QOPA 5T52A 4PIZA 2A5ZA 1RUI3 3JD73 3VV1A 4XACA 2VNRA 3VBFB 3WF0A 4RHV1 5FP4A 4A41A 3ECQA 4DS0A 3PUQA 1W8ZA 4COWA 1AYN2 1GWMA 4J25A 2VQAA 1NYWA 1SZBA 2DUOA 1VBA2 3E6DA 4Z8BA 5FP9A 4ZU4A 5KWRA 1GV9A 1AR73 3I49A 1M4WA 3RWKX 1B09A 1AXZA 1OUSA 1VAKA 1REDA 2W3JA 4IE5A 5ERLA 2MEV1 1JS9A 3E6BA 1C57A 5JZGC 1RTVA 1SPPA 3ZXLA 1PK6C 1V6NA 4WM7A 4XCBA 3WDTA 2B42B 3KV9A 5DZFA 3T2OA 1XQNA 5KR7A 1W8OA 1LENA 1DGRN 1F4HA 2VZ1A 3OEBA 2R063 3SXWA 1ZRRA 4NUBA 3IPVB 2VMFA 4XUQA 4TN7A 3LDRA 1OSGA 1F15A 1Q8OA 2JE7A 5BNOC 1WMFA 1K42A 1W8NA 1RUF2 4Y5TA 2R071 4K9SA 3TOJA 4CSWA 5CG8A 3HEIA 5FJKA 5ABJC 2JD4A 3VHPA 1UY1A 3PHMA 1MS5A 4CU9A 2J1AA 3VKLA 1OT5A 1OVPA 1JI6A 1CZVA 3VKOA 2PFWA 2JDNA 4OMDA 4N43C 1BHGA 4NHXA 1YIPA 2IVIB 1U5ZA 3WDWA 4EYUA 1SBEA 4FOVA 3MIEA 3ES4A 3KS7A 1QJY2 4N53C 4KWKA 4CVUA 2QKDA 3H1MA 1DZRA 1TME1 1KGYA 1UKGA 2BVVA 2VOTA 3WZ1A 4RGKA 3L2HA 3PUSA 1G7YA 4EROA 4HVRA 5IVBA 1AYM2 2HWE1 5L7OB 4A45A 1AR93 2D6PA 1ZZBA 1D4M2 2VBBA 4LBKA 1SCRA 3DPRA 3AMMA 2PA7A 1VB2A 4FPJA 4XTMA 4YZ1A 3CHXA 2XKOA 3E5XA 3LDKA 1ENQA 5F32A 3UV9A 3VBOB 1AR72 4W6YA 2DUQA 5FZ8A 2YBPA 5FZ0A 5F3CA 3THDA 2WFF2 4QKBA 1OD5A 2JDZA 3WNKA 3BUCA 3MW3A 1MR5A 2XLFA 4X6QB 4YYOA 4UI9L 1XU1A 5FMDA 3VHRA 3U0ZA 1RJ8A 2VXRA 1LOFC 2RG4A 1KXGA 4PLMA 1GZWB 2Y6LA 2D6MA 3GZEA 4PF5A 1X82A 4Q5OA 3DV8A 4COVA 5C5UA 2W52A 5CB7A 3NJZA 1SLTA 1S4CA 2QBXA 2R043 1XU2A 2IFWA 1Z78A 4CXYA 1POV0 5I8TA 1ZRIA 3RYRA 4HPKA 1RGSA 5J3UA 3NV1A 1W28A 2R1BA 3WP4A 4BXFA 4JDMA 2IUWA 3POJA 1EAH3 4QX0A 2ZHNA 3H8XA 2HWC1 3WW1A 2EAAA 1MS9A 4HT1T 3ASIA 5ACA2 2BOIA 3SCHA 5DAWA 1W05A 3LF7A 3NNFA 5FYUA 3S6PA 5BPXA 5T3NA 5L9VA 2QZ3A 5E88A 1KRIA 3IMNA 4Q26A 1AR92 3C8XA 5AC91 2BOJA 1CAUB 1UOGA 2JG8C 2VQTA 3HR9A 3KCCA 4HKOA 3M2MA 2QQNA 5FWEA 5KHHA 4AHYA 4TTGA 3H8UA 1GKBA 2D5FA 1SDDB 4OI2A 3DYPA 4OHVA 1RUC1 2PHUA 5FBZA 1OH4A 3N7KA 3W59A 5BNNA 1CQ9A 3K4ZA 3K4DA 1PO23 4RGGA 3VL9A 4YGEA 5DAXA 1H9PA 2D93A 3ZOIA 2WAAA 5FUPA 2SLIA 2O8OA 3BIWE 1CAVB 4KNCA 1XNCA 4Q4W3 2FHRA 3ZN5A 3JBG2 2X53S 5A7NA 3WHUA 2DTWA 1NCQB 4QPIB 3FBYA 2A75A 1YJLA 3LA2A 4A44A 4EZHA 4YFZA 3G7DA 3IIIA 3ZFFB 1K5MB 2J1EA 1A6CA 2WKKA 4RHV2 4YW5A 3RMXA 2HWF3 2J42A 4AGGA 1HJFA 2JDYA 4RA0A 3ZFEA 4YVSC 4RSUA 4Y1ZA 1BBT1 4LO8A 1UY2A 1ZNPA 2WDBA 2WIIB 5K7PA 2VZTA 4Q4Y1 2RR12 5FK7A 4ARYA 5K9YA 3IM0A 4PDWA 3J7LA 3T2QA 4BE3A 2YU1A 4Q1PA 5A6XA 3DN7A 4TWTA 4CCMA 3DECA 1V6LA 1FMD3 3LEIA 2YFUA 1ZBE3 2RJ2A 3R05A 1LJ7A 4Y1UA 4CP9B 3B01A 1SG3A 3TEZA 2JKBA 2XBO1 1AX2A 3AMHA 2ZACA 4YG6A 1ZRCA 1QH7A 1VBB3 2UYAA 3H7YA 4LA3A 5H9RA 5IAXA 1VRBA 1JYTA 1Y9QA 3RQ0A 1C8M3 3PIGA 5FPLA 4B4QA 3WF4A 2OUJA 2R072 4WM7C 5JPMB 1BVP1 2NZ9A 2AENA 2W0XA 2GC0A 4O7XA 5FMBA 3OEAA 1YWKA 4IESA 2D6NA 2QQVA 3H1YA 3WXPA 3DCQA 5IFTA 3WDUA 3ACIA 5CADA 2F17A 4HK8A 4WV8A 3QH7A 3O1PA 3SNMA 5A80A 1QOSA 2QNKA 1UXXX 3ABZA 3MFAA 1ASJ1 1PVC2 1JUIA 1US3A 2VTFA 2YC0A 3I3QA 1HDKA 5HXVA 1W6OB 3B69A 4ATEA 5FO8B 1EYBA 1WW6A 1PM7A 1RYYA 3OSDA 3V0AA 3POWA 5IK7A 2QZ2A 2HWE2 4GMP0 4XJZA 3HQRA 4JCKA 1AVBA 3PTYA 2P34A 4EN6B 5A6YA 3KVAA 4GJZA 2YPDA 1VLNA 1CIWA 4YARA
chains in the Genus database with same CATH topology
4QB6A 2VO5A 1CZSA 2X10A 2WO3A 1K45A 2EIBA 2VZ3A 3CZJA 2QQOA 1W9SA 2XHNA 3CKHA 2J1RA 2VZVA 3K4AA 4LKSA 2WQ8A 1JZ7A 4QAWA 2V72A 4BK4A 1W0NA 2J1VA 3HPNA 1XC6A 4DUVA 3SEEA 1GMMA 1UYYA 1NT0A 1O8PA 2PQSA 1MPXA 2HLEA 3HNYM 1I5PA 2BGOA 2E31A 5C71A 3IB3A 1PMHX 3WNLA 3C7EA 2VR4A 3I2JA 1NX9A 3HOBA 2WO1A 2VZPA 2B9VA 4GWIA 4XVHA 4JKKA 1UY4A 2DDUA 2W1SA 1GQPA 4IUGA 5A1AA 1J83A 2CDPA 1CIYA 3ETPA 3C7FA 4A4AA 4XUOA 4RYDA 4MO3M 4TXWA 5C70A 1UX7A 4PT6A 3VDBA 2ZEZA 4ZZ8A 2VZUA 1O8SA 2JE8A 3OGSA 4A42A 3NQHA 2C26A 1JZ8A 2YC4A 2VMEA 3KQ4B 3HNMA 4UAPA 3ACHA 1JU4A 2W1WA 4PQQA 4KMQA 1J84A 3A21A 2J1TA 3EYPA 3VDCA 2ZEXA 4MGQA 5EJZB 5EIYB 2RV9A 2W91A 3A22A 4D0QA 2ZEYA 2B4KA 2VMCA 3T2PA 4DXSA 3VDAA 1UWWA 4P08A 2WNOA 2BBAA 2WN3A 1PX4A 2JDAA 5HPOA 2BGPA 3NJXA 4LORA 5G04L 1IQDC 4DUXA 4MADA 4ARXA 2VZQA 3A7QA 3HNBM 3HN3A 3I2HA 4JX0A 4LQRA 4CUBA 1GU3A 3POFA 1H6XA 2W87A 4LHSA 2VL4A 4JHZA 1XPWA 5LA0A 5I0DA 4D8MA 2EIEA 3WSOA 3UETA 3FN9A 1UYXA 5G05L 4DXTA 5JXGA 1O59A 5EJ1B 1XNTA 1DLCA 3DYOA 3WNOA 3MV01 1PX3A 2R7EB 3J7HA 5IHRA 2WUHA 3WQBA 4DEVA 5DQ0A 4JKMA 2VZOA 3FL7A 4BJ0A 3BGAA 5DN2A 3OBAA 1JZ4A 1ULPA 3I2FA 4AAXA 1JZ5A 4XZUG 3I3BA 3UESA 4E8CA 2VZRA 1KEXA 1W9TA 2W5FA 5LCWL 4XUPA 3P6BA 3DYMA 1JZ3A 1NKGA 3WNNA 3W5MA 2KD7A 4OYUA 2E26A 2VCCA 4A3ZA 1UMHA 2VQUA 3FHAA 2W1QA 4CU7A 2DCJA 4LOSA 4LMFA 2QQJA 2Y64A 2W94A 3MUZ1 2WO2A 1TVGA 1UXZA 4MGSA 4QPWA 4QX2A 4P5YA 2VJXA 4OMCA 3OGVA 5B4XA 2V5DA 2Y6KA 3BN6A 3IAPA 3NJVA 2Y6GA 4XUTA 2YC2A 1GUIA 1UY3A 3I2GA 2E32A 4Z2AA 4QDQA 3WEZA 2L9LA 2Y8KA 3WF3A 1CZTA 4M4RA 2CDOA 4OZOA 3E1F1 4QDSA 4QDRA 3PUIA 5F7UA 4XURA 3I3EA 2Y6HA 5JMOA 2EIDA 4ZY9A 3OG2A 3MBWA 1DYOA 3NNGA 1OD3A 3OB8A 1JHJA 4KWUA 2WZEA 2VCBA 3C7OA 2J1UA 4LPLA 5LA2A 3SKJE 2W95A 3VD5A 4E8DA 3POEA 3ACGA 5HXMA 3CMGA 5CISA 2J7MA 4UOJA 4YPJA 2VZSA 1GOHA 4W4ZA 4PF1A 5CKQA 5FUIA 5C7GA 4RN5A 2QQMA 2W47A 1F4AA 2E33A 3K46A 4QB2A 1SFPA 1JU3A 3MV11 3VD3A 1GOGA 1R64A 2JKXA 5DMYA 2ORXA 3LEGA 1LNSA 2HYXA 1NZIA 2ORZA 2WZ8A 4L0PA 3WF0A 4QX1A 4BDVB 4GWJA 4A41A 3ECQA 2ZXQA 2X09A 1WCQA 3I2KA 5IJRA 1SZBA 3MUY1 4P00B 2W3JA 5JR2A 3OGRA 2C9KA 2ZEWA 1SPPA 3VD9A 3T2OA 5DPNA 3CDZB 3K77A 1W8OA 3OEBA 1F4HA 2VZ1A 3IDAA 5JUVA 3NRUA 1OF4A 2XQXA 2VMFA 4XUQA 3T08A 3A23A 1K42A 1W8NA 2J1SA 3VD7A 3HEIA 3GXUA 1UY1A 4CU9A 2J1AA 1K3IA 3T0BA 1OT5A 3VD4A 4AG4A 1JI6A 1CZVA 3GDBA 4ZXEA 5IYYA 3MO4A 4OMDA 1BHGA 1HN1A 3HJRA 3POBA 1W9WA 1SHWB 4CVUA 2LS6A 1EUTA 3I97A 3D3AA 1KGYA 2LW8A 2VOTA 3I3DA 2WAOA 4HG6B 3POIA 1UYZA 3W5NA 2WYSA 4A45A 1GNYA 1CX1A 2XONA 3T09A 3LPGA 4OUEA 1UY0A 3THDA 1W99A 3WNKA 4ZZ5A 2EICA 2W92A 2OKXA 4UI9L 1JZ2A 1JYWA 5CKNA 5CYYA 1TG7A 3ACFA 4KI5M 2Y6LA 3ZM8A 1XNAA 3P1IA 3CZUA 3CQOA 3GM8A 1NUKA 2QBXA 1OF3A 4BK5A 3JXSA 2YFZA 5LA1A 2V4VA 5IFPA 3POJA 4QX0A 5CKMA 3LQCA 3LEKA 2WABA 2QQKA 1UZ0A 4GZ9A 1YQ2A 1DP0A 1L7RA 2VC9A 2WN2A 3GGLA 1SPPB 3WF1A 3LPFA 2J22A 3SKVA 4CUAA 3WNMA 3C8XA 3FHQA 5JXHA 2VQTA 1JYXA 3T0DA 2QQNA 5J1XA 4TTGA 3LE0A 1SDDB 3DYPA 1OH4A 1P8JA 2ID4A 3THCA 1GOFA 3K4ZA 3K4DA 4ET7A 2WAAA 3K75B 2Y6JA 2QQIA 4QB1A 1PMJX 1ULOA 1NAEA 1US2A 2W9XA 4A44A 1JYNA 4BXSV 1UMIA 2C4XA 3IIIA 2YB7A 2J1EA 1D7PM 3IAQA 3PUHA 2WBKA 2JD9A 3I2IA 4QX3A 2RVAA 2YG0A 2BZDA 4P02B 3AC0A 4CU8A 3POGA 2X05A 1L7QA 1UY2A 2WDBA 4M4PA 3C7GA 3DEMA 3WF2A 2VZTA 3T0AA 1WKYA 4ARYA 5CZKA 2VM9A 3T2QA 2XOMA 3SEPA 1JZ6A 4W50A 4DEQA 3F2ZA 3DECA 3LEIA 5B4NA 2YFUA 2RJ2A 1SG3A 2BERA 3UNPA 4FI9A 5JXJA 2VCAA 1EUUA 4XUNA 4CUCA 4MOAA 3WF4A 4CU6A 4JKLA 2DCKA 3OEAA 4W8JA 3C7HA 4A6OA 5IFTA 4LOTA 1K12A 4DXRA 3ACIA 1T2XA 2Z4FA 1JYVA 1H6YA 1UXXX 3U37A 3ABZA 3WNPA 1US3A 2VTFA 3CIHA 2W46A 2VMDA 3EB7A 1RYYA 4DUWA 2QQLA 5JXIA 2W1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QB6 A;  2VO5 A;  1CZS A;  2X10 A;  2WO3 A;  1K45 A;  2EIB A;  2VZ3 A;  3CZJ A;  2QQO A;  1W9S A;  2XHN A;  3CKH A;  2J1R A;  2VZV A;  3K4A A;  4LKS A;  2WQ8 A;  1JZ7 A;  4QAW A;  2V72 A;  4BK4 A;  1W0N A;  2J1V A;  3HPN A;  1XC6 A;  4DUV A;  3SEE A;  1GMM A;  1UYY A;  1NT0 A;  1O8P A;  2PQS A;  1MPX A;  2HLE A;  3HNY M;  1I5P A;  2BGO A;  2E31 A;  5C71 A;  3IB3 A;  1PMH X;  3WNL A;  3C7E A;  2VR4 A;  3I2J A;  1NX9 A;  3HOB A;  2WO1 A;  2VZP A;  2B9V A;  4GWI A;  4XVH A;  4JKK A;  1UY4 A;  2DDU A;  2W1S A;  1GQP A;  4IUG A;  5A1A A;  1J83 A;  2CDP A;  1CIY A;  3ETP A;  3C7F A;  4A4A A;  4XUO A;  4RYD A;  4MO3 M;  4TXW A;  5C70 A;  1UX7 A;  4PT6 A;  3VDB A;  2ZEZ A;  4ZZ8 A;  2VZU A;  1O8S A;  2JE8 A;  3OGS A;  4A42 A;  3NQH A;  2C26 A;  1JZ8 A;  2YC4 A;  2VME A;  3KQ4 B;  3HNM A;  4UAP A;  3ACH A;  1JU4 A;  2W1W A;  4PQQ A;  4KMQ A;  1J84 A;  3A21 A;  2J1T A;  3EYP A;  3VDC A;  2ZEX A;  4MGQ A;  5EJZ B;  5EIY B;  2RV9 A;  2W91 A;  3A22 A;  4D0Q A;  2ZEY A;  2B4K A;  2VMC A;  3T2P A;  4DXS A;  3VDA A;  1UWW A;  4P08 A;  2WNO A;  2BBA A;  2WN3 A;  1PX4 A;  2JDA A;  5HPO A;  2BGP A;  3NJX A;  4LOR A;  5G04 L;  1IQD C;  4DUX A;  4MAD A;  4ARX A;  2VZQ A;  3A7Q A;  3HNB M;  3HN3 A;  3I2H A;  4JX0 A;  4LQR A;  4CUB A;  1GU3 A;  3POF A;  1H6X A;  2W87 A;  4LHS A;  2VL4 A;  4JHZ A;  1XPW A;  5LA0 A;  5I0D A;  4D8M A;  2EIE A;  3WSO A;  3UET A;  3FN9 A;  1UYX A;  5G05 L;  4DXT A;  5JXG A;  1O59 A;  5EJ1 B;  1XNT A;  1DLC A;  3DYO A;  3WNO A;  3MV0 1;  1PX3 A;  2R7E B;  3J7H A;  5IHR A;  2WUH A;  3WQB A;  4DEV A;  5DQ0 A;  4JKM A;  2VZO A;  3FL7 A;  4BJ0 A;  3BGA A;  5DN2 A;  3OBA A;  1JZ4 A;  1ULP A;  3I2F A;  4AAX A;  1JZ5 A;  4XZU G;  3I3B A;  3UES A;  4E8C A;  2VZR A;  1KEX A;  1W9T A;  2W5F A;  5LCW L;  4XUP A;  3P6B A;  3DYM A;  1JZ3 A;  1NKG A;  3WNN A;  3W5M A;  2KD7 A;  4OYU A;  2E26 A;  2VCC A;  4A3Z A;  1UMH A;  2VQU A;  3FHA A;  2W1Q A;  4CU7 A;  2DCJ A;  4LOS A;  4LMF A;  2QQJ A;  2Y64 A;  2W94 A;  3MUZ 1;  2WO2 A;  1TVG A;  1UXZ A;  4MGS A;  4QPW A;  4QX2 A;  4P5Y A;  2VJX A;  4OMC A;  3OGV A;  5B4X A;  2V5D A;  2Y6K A;  3BN6 A;  3IAP A;  3NJV A;  2Y6G A;  4XUT A;  2YC2 A;  1GUI A;  1UY3 A;  3I2G A;  2E32 A;  4Z2A A;  4QDQ A;  3WEZ A;  2L9L A;  2Y8K A;  3WF3 A;  1CZT A;  4M4R A;  2CDO A;  4OZO A;  3E1F 1;  4QDS A;  4QDR A;  3PUI A;  5F7U A;  4XUR A;  3I3E A;  2Y6H A;  5JMO A;  2EID A;  4ZY9 A;  3OG2 A;  3MBW A;  1DYO A;  3NNG A;  1OD3 A;  3OB8 A;  1JHJ A;  4KWU A;  2WZE A;  2VCB A;  3C7O A;  2J1U A;  4LPL A;  5LA2 A;  3SKJ E;  2W95 A;  3VD5 A;  4E8D A;  3POE A;  3ACG A;  5HXM A;  3CMG A;  5CIS A;  2J7M A;  4UOJ A;  4YPJ A;  2VZS A;  1GOH A;  4W4Z A;  4PF1 A;  5CKQ A;  5FUI A;  5C7G A;  4RN5 A;  2QQM A;  2W47 A;  1F4A A;  2E33 A;  3K46 A;  4QB2 A;  1SFP A;  1JU3 A;  3MV1 1;  3VD3 A;  1GOG A;  1R64 A;  2JKX A;  5DMY A;  2ORX A;  3LEG A;  1LNS A;  2HYX A;  1NZI A;  2ORZ A;  2WZ8 A;  4L0P A;  3WF0 A;  4QX1 A;  4BDV B;  4GWJ A;  4A41 A;  3ECQ A;  2ZXQ A;  2X09 A;  1WCQ A;  3I2K A;  5IJR A;  1SZB A;  3MUY 1;  4P00 B;  2W3J A;  5JR2 A;  3OGR A;  2C9K A;  2ZEW A;  1SPP A;  3VD9 A;  3T2O A;  5DPN A;  3CDZ B;  3K77 A;  1W8O A;  3OEB A;  1F4H A;  2VZ1 A;  3IDA A;  5JUV A;  3NRU A;  1OF4 A;  2XQX A;  2VMF A;  4XUQ A;  3T08 A;  3A23 A;  1K42 A;  1W8N A;  2J1S A;  3VD7 A;  3HEI A;  3GXU A;  1UY1 A;  4CU9 A;  2J1A A;  1K3I A;  3T0B A;  1OT5 A;  3VD4 A;  4AG4 A;  1JI6 A;  1CZV A;  3GDB A;  4ZXE A;  5IYY A;  3MO4 A;  4OMD A;  1BHG A;  1HN1 A;  3HJR A;  3POB A;  1W9W A;  1SHW B;  4CVU A;  2LS6 A;  1EUT A;  3I97 A;  3D3A A;  1KGY A;  2LW8 A;  2VOT A;  3I3D A;  2WAO A;  4HG6 B;  3POI A;  1UYZ A;  3W5N A;  2WYS A;  4A45 A;  1GNY A;  1CX1 A;  2XON A;  3T09 A;  3LPG A;  4OUE A;  1UY0 A;  3THD A;  1W99 A;  3WNK A;  4ZZ5 A;  2EIC A;  2W92 A;  2OKX A;  4UI9 L;  1JZ2 A;  1JYW A;  5CKN A;  5CYY A;  1TG7 A;  3ACF A;  4KI5 M;  2Y6L A;  3ZM8 A;  1XNA A;  3P1I A;  3CZU A;  3CQO A;  3GM8 A;  1NUK A;  2QBX A;  1OF3 A;  4BK5 A;  3JXS A;  2YFZ A;  5LA1 A;  2V4V A;  5IFP A;  3POJ A;  4QX0 A;  5CKM A;  3LQC A;  3LEK A;  2WAB A;  2QQK A;  1UZ0 A;  4GZ9 A;  1YQ2 A;  1DP0 A;  1L7R A;  2VC9 A;  2WN2 A;  3GGL A;  1SPP B;  3WF1 A;  3LPF A;  2J22 A;  3SKV A;  4CUA A;  3WNM A;  3C8X A;  3FHQ A;  5JXH A;  2VQT A;  1JYX A;  3T0D A;  2QQN A;  5J1X A;  4TTG A;  3LE0 A;  1SDD B;  3DYP A;  1OH4 A;  1P8J A;  2ID4 A;  3THC A;  1GOF A;  3K4Z A;  3K4D A;  4ET7 A;  2WAA A;  3K75 B;  2Y6J A;  2QQI A;  4QB1 A;  1PMJ X;  1ULO A;  1NAE A;  1US2 A;  2W9X A;  4A44 A;  1JYN A;  4BXS V;  1UMI A;  2C4X A;  3III A;  2YB7 A;  2J1E A;  1D7P M;  3IAQ A;  3PUH A;  2WBK A;  2JD9 A;  3I2I A;  4QX3 A;  2RVA A;  2YG0 A;  2BZD A;  4P02 B;  3AC0 A;  4CU8 A;  3POG A;  2X05 A;  1L7Q A;  1UY2 A;  2WDB A;  4M4P A;  3C7G A;  3DEM A;  3WF2 A;  2VZT A;  3T0A A;  1WKY A;  4ARY A;  5CZK A;  2VM9 A;  3T2Q A;  2XOM A;  3SEP A;  1JZ6 A;  4W50 A;  4DEQ A;  3F2Z A;  3DEC A;  3LEI A;  5B4N A;  2YFU A;  2RJ2 A;  1SG3 A;  2BER A;  3UNP A;  4FI9 A;  5JXJ A;  2VCA A;  1EUU A;  4XUN A;  4CUC A;  4MOA A;  3WF4 A;  4CU6 A;  4JKL A;  2DCK A;  3OEA A;  4W8J A;  3C7H A;  4A6O A;  5IFT A;  4LOT A;  1K12 A;  4DXR A;  3ACI A;  1T2X A;  2Z4F A;  1JYV A;  1H6Y A;  1UXX X;  3U37 A;  3ABZ A;  3WNP A;  1US3 A;  2VTF A;  3CIH A;  2W46 A;  2VMD A;  3EB7 A;  1RYY A;  4DUW A;  2QQL A;  5JXI A;  2W1U A; 
#chains in the Genus database with same CATH topology
 4LIU A;  4QB6 A;  1J3Q A;  1RIR A;  1V6K A;  2TEP A;  4B8E A;  4OVE A;  1J3P A;  1H2N A;  4JGY A;  4XF3 A;  2VZ3 A;  5FXW A;  2MNG A;  1AL2 3;  3WW3 A;  3ZYB A;  4E9K A;  1V6M A;  1AL0 G;  4M0H A;  4FFG A;  2JX9 A;  4CRQ A;  1QJE A;  4NRQ A;  4DZG A;  5IWF A;  3DPR C;  4SLI A;  4M3C F;  1KIT A;  1PGW 1;  3WP3 A;  5J96 B;  4Y26 A;  4FOW A;  5HCH A;  2PLV 2;  2RDR A;  2DVB A;  2WWS A;  3RZM A;  2WQ8 A;  3OUJ A;  3UL2 A;  2FZ2 A;  1SFN A;  4XJ8 A;  1QKQ A;  1ZM1 A;  3DKW A;  1JZ7 A;  4D3W A;  5H9S A;  4FPO B;  4XC9 A;  5F2S A;  1RC6 A;  2GC1 A;  1FNZ A;  2V72 A;  3OCP A;  2OXB A;  4L8Q A;  4A3X A;  1RUH 2;  4K1Z A;  1J3R A;  4V2W A;  2VGD A;  4XFF A;  3H9A A;  4DUV A;  3B9C A;  4Y20 A;  3SMH A;  3WQ7 A;  1Y9M A;  1GMM A;  1OFN A;  5LEJ A;  5F1R A;  4RS5 B;  2WT0 A;  5IT6 A;  1LOE A;  1W6N A;  2CY6 A;  1MPX A;  3WG3 A;  3GHM A;  4COY A;  1EV1 3;  4NRM A;  2HLE A;  3MIG A;  4AL9 A;  1X9P A;  3HNY M;  5LBB A;  1ODN A;  4IEQ A;  4TSV A;  2BGO A;  2ZX2 A;  5C71 A;  5M0T A;  4CDQ B;  3O7O A;  4LBN A;  4JQR A;  1GZ9 A;  1Z7S 1;  1YFW A;  5FY8 A;  2BVB A;  4QX5 A;  2B9V A;  4GWI A;  4RFR B;  1Q5O A;  2DDU A;  4CE8 A;  2E7T A;  2DUP A;  2WT1 A;  2ZGN A;  2CHH A;  4XZP A;  4YZ4 A;  4ASK A;  2D3P A;  1OHF A;  2RS3 1;  1DQ4 A;  1DGW A;  2XUM A;  1HB4 A;  3ETP A;  3C7F A;  1DZT A;  4LXL A;  3UJO A;  4RYD A;  4LBQ D;  4IGO A;  3P5B A;  5C70 A;  1FYU A;  3FC0 A;  3MDP A;  2ARE A;  4AQT A;  1CPM A;  2JEM A;  3VDB A;  2ARB A;  3FLP A;  4AFC A;  4K21 A;  2UY8 A;  4P9I A;  3NWK A;  3OF1 A;  5FO9 B;  1S0C A;  3OGS A;  4R9C A;  4KWL A;  4XTP A;  4XQW A;  2GAU A;  3T1M A;  2Y6F A;  4A42 A;  4N90 A;  3B5L B;  2VME A;  2FZ1 A;  4UAP A;  3ACH A;  3AZV A;  3ATG A;  4XPV A;  2OA2 A;  5HV4 A;  4ZKT B;  5DUU A;  2RMU 3;  1GIC A;  1CWP A;  4L2N A;  3B7M A;  3AXE A;  2VPV A;  3HBK A;  3TEY A;  1UNB A;  3O0X A;  5JWP A;  1LHO A;  1R1A 3;  1RUJ 3;  2OQ7 A;  2BU9 A;  3KLS A;  4A7K A;  5EJZ B;  3BVC A;  4DY3 A;  5L7O A;  2FDG A;  5GLW A;  3ZFE C;  2PAK A;  2RV9 A;  4B7E A;  3AVR A;  5A1L A;  2O14 A;  3A22 A;  1UU4 A;  1BXH A;  1LR5 A;  1I9R A;  3ZSL A;  3M7A A;  2DVF A;  4DXS A;  2WNO A;  3H3L A;  1RUN A;  1W2N A;  3VBO A;  1WCS A;  2JDA A;  5HPO A;  4PDW C;  2BGP A;  2BJS A;  3D5O A;  3KCX A;  5A7P A;  1QXP A;  3VZN A;  2R1D A;  3WW4 A;  4YG0 A;  5FY9 A;  4COZ A;  4LBL A;  3WVJ A;  3MEP A;  4YVW B;  2ZKL A;  2W87 A;  1GZW A;  1G9B A;  3I59 B;  1A8D A;  4XBQ A;  5KHG A;  3J9S A;  3DL3 A;  4HAN A;  3THP A;  4FVV A;  1ULF A;  2YRO A;  4CPB D;  4M3C B;  4W6X A;  4BQ5 A;  5F39 A;  4BIO A;  4QWN A;  4N8M A;  2CWM A;  5G05 L;  1VBD 2;  2BNN A;  1LU2 A;  5EJ1 B;  4UYB A;  3ILN A;  3LAG A;  3KV6 A;  5B2G B;  3DYO A;  5LWB A;  4CP2 A;  4XXA A;  2EXJ A;  2W2I A;  2PYT A;  3MV0 1;  1CAX B;  1DHK B;  2QVS B;  1HB1 A;  2VAU A;  2PAE A;  2NYY A;  3KSC A;  1D2Q A;  1GQG A;  2O8Q A;  3WQB A;  4BA6 A;  4E4D X;  5C9A B;  2YY1 A;  4KGG A;  2Z79 A;  3M8L A;  4JKM A;  3FL7 A;  1OPO A;  1X50 A;  3IBM A;  5ANQ A;  1ZBA 1;  2LM3 A;  3BGA A;  1W2O A;  3TYJ A;  3OBA A;  3BAL A;  3VLB B;  1ULP A;  3M4F A;  5CVR A;  5F8P A;  1CN1 A;  3KB5 A;  4Q8K A;  4CEY B;  4CEW A;  1QDC A;  1VE0 A;  2BWC A;  1DIW A;  1HRI 1;  1MS4 A;  4E8C A;  5GJ6 A;  3P6B A;  1I5Z A;  2CWS A;  4IQP A;  1W90 A;  1RUD 2;  1F9K A;  4I01 A;  4BQ2 A;  5FIX A;  1GP4 A;  1RIT A;  1WD3 A;  2DVG A;  1O4T A;  3ST7 A;  2VQU A;  2W39 A;  3NST A;  2NLR A;  2QUO A;  1N3O A;  3KVB A;  4E4S A;  1CAV A;  1H0B A;  1ST8 A;  1LOA A;  1W2T A;  3A0N A;  3KCY A;  4QPG B;  3ZPO A;  2W94 A;  1H1I A;  1F5J A;  3AXD A;  1NCQ A;  3VBU A;  2HBT A;  4S2D A;  2ADD A;  3PNA A;  2HWB 2;  2VNV A;  3OPT A;  1G9C A;  3ZFF A;  1OA2 A;  4QX2 A;  3U4S A;  2R0H A;  1JH5 A;  1SDW A;  1W6P A;  3TAY A;  1RVF 3;  2VJX A;  3OGV A;  4CDW B;  3U1X A;  2VVE A;  1UO9 A;  1NY7 2;  2VNO A;  2Y6K A;  3BN6 A;  3O1O A;  2XVL A;  1CON A;  2Y6G A;  2A1X A;  2DV9 A;  4K3U A;  5F2W A;  5FZG A;  1NLR A;  4OLL A;  3VBH B;  5FLH A;  3WUC A;  3VBF C;  3VZL A;  5K0U B;  2EVX A;  1HXS 3;  1UY3 A;  4GJY A;  3S7I A;  2IVJ A;  4WVZ A;  1MQT B;  4LKE A;  4QGN A;  3DGT A;  4WVM B;  5FPZ A;  3GBG A;  4PBP A;  4Z2A A;  2RS3 2;  3O1M A;  2Y8K A;  1QDO A;  1RUE 2;  4X6R B;  1CZT A;  1AX1 A;  4IL7 A;  4M4R A;  2WO7 A;  4XFH A;  5I91 A;  3THT A;  4C90 A;  4FQZ A;  2D6O X;  3BB6 A;  3N7M A;  4CEW B;  3JB4 C;  3PUI A;  2Q1Z B;  4AQ2 A;  3PJY A;  3R4D B;  1PIV 3;  2XJT A;  4XUR A;  3I3E A;  4BQ4 A;  4GXL A;  2Y6H A;  3EBR A;  3FE5 A;  3A4U A;  1JUH A;  3N9Q A;  4AGV A;  5JCT A;  1OD3 A;  2YV8 A;  3EQE A;  3LWC A;  4QU2 A;  2SBA A;  2YBK A;  2ZML A;  2Q4S A;  4XE9 A;  4Q4X 1;  4ITC A;  3WD5 A;  1H2M A;  2VMH A;  4YM1 A;  3AYC A;  4HLT A;  5LA2 A;  2XPJ A;  4RQP B;  4QKF A;  1W6O A;  3U4X A;  1POV 1;  4E8D A;  5IVV A;  4DRR A;  2Z69 A;  4YW4 A;  3MPB A;  4MX3 A;  3CMG A;  2XKP A;  2DCY A;  5LZ6 A;  1KJL A;  1MEC 1;  1RUG 2;  1ULC A;  1STM A;  4QPI A;  4XBL A;  1TMF 1;  5F37 A;  1BMV 1;  3RGB A;  1ZZ7 A;  4PLN A;  3BU7 A;  4GQ7 A;  1WZX A;  1W0O A;  1HXS 2;  1LHV A;  1XXN A;  1ALY A;  3CLP A;  4PF1 A;  4FFH A;  1FPN 1;  4QQL A;  2ZGL A;  5L7O C;  3GZT B;  5FZ3 A;  1LES A;  1PZ8 A;  1FOD 3;  2A3Y A;  1CES A;  4IV1 B;  4TYS A;  1F4A A;  2HEW F;  3AMQ A;  3R4S A;  1LEM A;  1QIQ A;  1AR8 3;  3TRS B;  2BGC A;  3VBO C;  2ZAA A;  2RM2 3;  3UK9 A;  1RJ7 A;  2OZ6 A;  4NPL A;  3TEW A;  4UW6 A;  1SFP A;  1BVV A;  4IND A;  1OKO A;  5FPA A;  3PU3 A;  5A3N A;  4NID A;  1UX6 A;  1OLM E;  3NJY A;  4P9L A;  1C4R A;  3M3Q A;  4IEX A;  2G9F A;  1FV3 A;  1AR6 3;  2Q8D A;  3GHN A;  2CAV A;  2K2S A;  1LNS A;  2HYX A;  2ORZ A;  2WZ8 A;  1RIN A;  2EAL A;  2Y0I A;  2MHF A;  2VW2 A;  2QDR A;  2RS5 1;  1FI2 A;  3LB9 A;  4J1W A;  2IXH A;  2B5H A;  1C3H A;  4GB3 3;  4XFB A;  2X09 A;  5I8S A;  3VHO A;  5JI7 A;  1XYO A;  3DXT A;  3ZYI B;  4H14 A;  1XSR A;  1XOY A;  5IJR A;  1ND2 B;  1MZF A;  1E57 A;  5JSR A;  4CDQ A;  1VRH 3;  1CX4 A;  1WLD A;  1S2E A;  1AX0 A;  2ZAH A;  3KT1 A;  4IV3 B;  5A3L A;  2PHR A;  1W0P A;  1OKQ A;  5FY5 A;  3RFR A;  5GZC A;  3GF6 A;  3OGR A;  5GLT A;  5D8A B;  2C9K A;  2CTV A;  2GP5 A;  4AK3 A;  2WS9 3;  2WIN B;  3VD9 A;  1AZD A;  1TZO A;  3INA A;  2G4I A;  4NWW A;  3UT0 A;  3NRU A;  2K46 A;  2PHL A;  5C8C B;  1W8H A;  2XQX A;  4Q0V A;  5FZA A;  4R4Z A;  4XJU A;  2UWA A;  3N4M A;  4CEW C;  1YLL A;  2J1S A;  3IZO A;  4OI1 A;  3ZYF A;  4FCA A;  5DDJ 3;  3MLK A;  1AHS A;  4MVT A;  3R6S A;  2F4L A;  4Z1V A;  1TNR A;  1KFU L;  1XBF A;  2QTW B;  3VD4 A;  1UQX A;  4Q1R A;  1S0D A;  3GDB A;  3IDE A;  5IYY A;  3MO4 A;  3H42 B;  5FYC A;  4DO0 A;  4LO5 B;  2BP6 A;  2A7A A;  4PI0 A;  3J7N A;  2VOW A;  4NPM A;  4QGL A;  1SHW B;  5A32 B;  1ENR A;  4IEU A;  1EUT A;  1QJX 2;  3D3A A;  1NCQ C;  3I97 A;  4N7U A;  1O5L A;  3VBU C;  4ZHN A;  2QQP A;  4UF0 B;  2YPJ A;  1XJA A;  1JYI A;  1UIJ A;  2YGM A;  1UYZ A;  3POI A;  3ZFF C;  3VDD B;  3USU A;  1CX1 A;  4B7K A;  4BIS A;  1M06 G;  2XON A;  5FXZ A;  5L19 A;  3LPG A;  2DUR A;  2Y38 A;  4FXG B;  1BCX A;  2XML A;  2HWD 1;  4GMP 1;  1W99 A;  2QCS B;  3JU9 A;  5T50 A;  1CR7 A;  1LGC A;  2OKX A;  4QQP A;  5GZE A;  1XNB A;  3CO2 A;  1DYP A;  1NZC A;  2OII A;  1DQ0 A;  4ZS2 A;  2EXH A;  2WA3 A;  3KGL A;  4YVW A;  3P1I A;  3CZU A;  4D6Q A;  5CEH A;  3GM8 A;  3W21 A;  1REF A;  1OF3 A;  1PO1 1;  4D94 A;  4UFM A;  2JDM A;  1RUI 1;  2YFZ A;  1E5I A;  3POY A;  5JDB A;  2V4V A;  3TB0 A;  1CGP A;  4M3C A;  1W39 A;  4XHX A;  3SIT A;  4V2V A;  4F3J A;  2R16 A;  5IFP A;  3LKJ A;  2Y0O A;  4H55 A;  1V6I A;  2GDF A;  1YEW A;  3K51 A;  3LEK A;  4NO4 A;  5GLZ A;  3UKV A;  1W8T A;  4LO4 B;  3FLR A;  1OLM A;  1VR3 A;  3CNA A;  3ZMN A;  3AK0 A;  4R9D A;  5KXC A;  1I6X A;  2I2S A;  2VOK A;  1AYN 3;  2VC9 A;  4RR3 B;  1KQR A;  1MS8 A;  1UPI A;  2G9G A;  1TMF 2;  3WF1 A;  4QM9 A;  1VBA 3;  4Y22 A;  4CUA A;  4M01 A;  4E4H A;  1O4Y A;  4BWO A;  3WNM A;  4LJH A;  1OPM A;  2G19 A;  3U11 A;  2Q8C A;  1SBD A;  2R06 1;  4Q4V 2;  1FPN 2;  3ZIW A;  3LE0 A;  1OC1 A;  4QPI C;  3L2Y A;  3M1H A;  4FFF A;  2D43 A;  4NR1 A;  3RYK A;  4CEY A;  2A70 A;  5LEK A;  4LIT A;  1P8J A;  2GME A;  2ID4 A;  1GOF A;  4XDO A;  3ZSM A;  4KL1 A;  1UCX A;  2I74 A;  5JSO A;  2D6K A;  1GNZ A;  1QNW A;  3AP7 A;  4AHZ A;  4ET7 A;  4CXX A;  5KHJ A;  5FZE A;  3K75 B;  2V09 A;  2QQU A;  2Y6J A;  5I8Y A;  1RUF 3;  4OFG A;  5FZB A;  1SQ4 A;  2D3S A;  5FV3 A;  4C91 A;  2XJQ A;  2JG9 A;  2O1Q A;  4Q8L A;  1JYN A;  1UMI A;  2JDH A;  4BU2 A;  3AFG A;  3SCG A;  1W2U A;  3IAQ A;  4K1Y A;  2DWR A;  3I2I A;  2XH6 A;  3WY6 A;  4QQ2 A;  1QJY 3;  2YG0 A;  1GZT A;  1LGN A;  1BEV 1;  2BZD A;  4XF1 A;  3ZSK A;  4CDW A;  3AC0 A;  4YZ5 A;  3LIG A;  1W6Q B;  2X05 A;  3KM5 A;  4JTN A;  2GH2 A;  2VXJ A;  3GJB A;  4UBG A;  4RS5 C;  2ZAB A;  1AYM 3;  3FUO A;  1PNF A;  4B4P A;  2WL1 A;  4SBV A;  1QNY A;  1E5R A;  2XOM A;  3VBH A;  1JOD A;  1D4M 3;  4DEQ A;  4N7I A;  1FNY A;  3F2Z A;  2ZX4 A;  4O9E A;  1HB2 A;  3BOD A;  2GNM A;  4WVM A;  4U2A A;  1VAV A;  2P3K A;  4CDQ C;  2BER A;  3NAP B;  2WFF 3;  3N3H A;  4FI9 A;  1PGL 1;  1OQD A;  4MYE A;  4YFW A;  1EUU A;  3TNP B;  2QFE A;  2E63 A;  2OW4 A;  2R04 1;  1RUO A;  1JHN A;  1UAI A;  3M70 A;  4LKF A;  4MOA A;  2RS1 2;  5JOW A;  1IGO A;  4JKL A;  4K20 A;  5LK5 A;  2AZ5 A;  1WBF A;  3MHZ A;  4YM0 A;  1OH3 A;  5AFB A;  4W8J A;  3C7H A;  4JZR A;  1F2N A;  4A6O A;  2DBI A;  3AYA A;  1K12 A;  3JB8 A;  3JQX A;  4DXR A;  1EAH 1;  3PL0 A;  4Z2W A;  1I1E A;  3B9I A;  3RNS A;  1OA4 A;  2KR2 A;  2XL7 A;  2XWJ B;  2UY9 A;  1H6Y A;  1XE0 A;  2V4A A;  3Q8B A;  5EHD A;  1HRV 2;  3QH6 A;  1LOD A;  3GNE A;  1V6J A;  1O3T A;  4BME A;  2WZP P;  4KU8 A;  3EB7 A;  2XJR A;  1HKD A;  1U5Y A;  4LE3 A;  2VMI A;  5J7M A;  3NO8 A;  5ACA 3;  2QQL A;  5HI0 A;  2WC2 A;  5L73 A;  3B00 A;  3B3Q E;  5H9P A;  4CCJ A;  4B1M A;  3UGH A;  3BKZ A;  1J1T A;  2X10 A;  2VE1 A;  5KHI A;  2H0B A;  3CZJ A;  5FZI A;  3RJR A;  3SQO A;  2FDF A;  4Y5S A;  2RJL A;  1AF9 A;  3IDC B;  5EP9 A;  4AEK A;  4HN0 A;  1R09 2;  5FOJ B;  1R08 2;  1W6M A;  2J1R A;  5I93 A;  4BMB A;  1W8W A;  2WYF A;  2P6C A;  4P9J A;  5J48 A;  4Q4W 1;  4A6S A;  2WA4 A;  4IE4 A;  4R9A A;  5LAS A;  2X8K A;  2NQY A;  4H3W A;  1SLL A;  3AP9 A;  4IV1 A;  5FRE A;  4HVQ A;  3LOI A;  2LRP A;  3GBF A;  3ZDV A;  2J1V A;  5HV0 A;  1E5H A;  1PM4 A;  3HPN A;  3BI3 A;  3JBG 3;  1HQL A;  4S2G A;  2ZGU A;  4AFM A;  1MS3 A;  1Q8S A;  1W9F A;  4YVW C;  1PHM A;  2GNB A;  2WNU B;  4WVW A;  5CFD A;  1SAC A;  1RMU 1;  1LGB A;  3H50 A;  1O8P A;  4DB5 A;  4RHV 3;  3MIF A;  1BK0 A;  4FO9 A;  5CAZ A;  1DQ6 A;  2R6Q A;  3TBD A;  3BCW A;  1V9U 1;  2PHT A;  1ND3 B;  1Y4W A;  4HSJ A;  3MW4 A;  1QJU 2;  2Z2S B;  1YQC A;  3C7E A;  3WNL A;  3AB0 A;  1FMD 1;  5A3W A;  1ZBE 1;  3I2J A;  2RR1 3;  3ZVX A;  4Y3O A;  5IUQ A;  2FDJ A;  3HIF A;  5JI9 A;  4IV3 A;  3EHK A;  4XVH A;  2MEV 3;  3AKP A;  3O12 A;  2VCM A;  1CJP A;  4JKK A;  3VZK A;  1LTE A;  4YLZ A;  2H6B A;  2W1S A;  2VBP A;  3ZFG B;  2QQW A;  4CTE A;  1HX6 A;  5D8A A;  3URF A;  4IUG A;  1C8M 1;  1CAW A;  1J83 A;  1DZQ A;  2CDP A;  2YUE A;  3WHT A;  5A70 A;  5FAX A;  4OUL A;  1ENX A;  4PIY A;  3MYX A;  3KMH A;  2PHW A;  5C8C A;  2CU5 A;  4MO3 M;  1UN1 A;  4J6G A;  4TXW A;  3ZYJ B;  4CEY C;  5LW9 A;  2R07 3;  3GCW A;  4PT6 A;  1Q3E A;  1RL3 A;  1RXF A;  3E6C C;  1COV 2;  4Q0U A;  4PHZ A;  2ZEZ A;  4EV0 A;  1O8S A;  1ZVF A;  2JE8 A;  1IQA A;  2ARC A;  2C26 A;  3OOX A;  1JOB A;  2YC4 A;  4NRP A;  3HNM A;  5DZE A;  1JU4 A;  2D97 A;  5EFU A;  4YW7 A;  3PTR B;  3BU0 A;  5DUX A;  1POQ A;  4FT8 A;  3WP6 A;  1BEV 2;  1PVC 3;  1WMX A;  2JG9 C;  4QXB A;  1B35 B;  1OBN A;  3AP4 A;  1UZW A;  4I0A A;  1UPS A;  1GQH A;  1J84 A;  3AVS A;  3D0J A;  4KMQ A;  3A21 A;  3TN9 1;  3K3O A;  3N9N A;  3WDX A;  4CCD A;  2HWE 3;  4BLJ A;  1VBE 1;  5EIY B;  4XIO A;  4DMI A;  1J58 A;  3VDD A;  2JEN A;  4CDW C;  1HLC A;  5FYB A;  4FXK B;  2ZEY A;  1W3X A;  5FP8 A;  5SV5 A;  4JDO A;  3T2P A;  5BUV A;  3VDA A;  4Y1V A;  4IEO A;  1DBN A;  2OZJ A;  2WN3 A;  2MEV 2;  5GLU A;  4YRD A;  1PGL 2;  2DU0 A;  3VBH C;  5G04 L;  3WCR A;  4AEJ A;  3WDY A;  2H0V A;  4AOC A;  3VKF C;  3M3I A;  2PLV 3;  5FQ0 A;  4CUB A;  2A71 A;  3POF A;  4MXW A;  2RDQ A;  5A3U A;  2ZX3 A;  2VUD A;  1OI6 A;  2RDN A;  2WSV A;  5LA0 A;  4RFT 0;  2Y33 A;  4PIX A;  1RUH 3;  4N9H A;  2BTV C;  3DKQ A;  1EV1 1;  4CCO A;  2A6Z A;  4B3N A;  5I0S A;  5A6Z A;  4XBN A;  1UZY A;  4RS5 A;  1QQP 1;  4N9I A;  4R52 A;  3S57 A;  1DLC A;  1U5I A;  1YI9 A;  3VZM A;  4K8R B;  3AYE A;  3PU8 A;  4NE9 A;  3WNO A;  4IEP A;  4JRL A;  4NAO A;  1LAJ A;  1F5F A;  2WUH A;  1TME 2;  3SIS A;  4AQ6 A;  2P3Y A;  4P14 A;  2ET7 A;  3NVC A;  4RR3 A;  1SCS A;  5KXE A;  2H6C A;  1H2K A;  1WGP A;  2IC1 A;  4BJ0 A;  1GBG A;  5EQU A;  3AM2 A;  4EN0 A;  2HKX A;  4LR4 A;  5FYI A;  1KS4 A;  5LAT A;  2WLQ A;  1JZ4 A;  5BYN A;  1PZ7 A;  1G9D A;  2WNV B;  2ARA A;  5IVY A;  1A8M A;  1LOG A;  2P3J A;  2RHP A;  5GZD A;  3USS A;  5FZD A;  2VVD A;  4OHY A;  1MZ6 A;  5C4W B;  2VY0 A;  5JOX A;  3IIA A;  4YW3 A;  5LRS A;  4J1X A;  1JZ3 A;  3WV6 A;  1NKG A;  1RHI 1;  3WNN A;  5JIU A;  1DDL A;  2KD7 A;  5FY1 A;  3BTX A;  1UMH A;  3P3N A;  4ISR A;  2I07 B;  4CU7 A;  2BQP A;  5EYY A;  5L9R A;  4LOS A;  3RJ2 X;  1ACC A;  1HV0 A;  4PBO A;  3U07 A;  2PXJ A;  4OQ9 A;  2AC1 A;  2Q8E A;  4OCT A;  2WO2 A;  4IV1 C;  2RMU 1;  5BXX A;  1RMU 2;  4MGS A;  5J98 B;  4YM2 A;  1Z0H A;  5FPV A;  3U14 A;  4CDU B;  5HCA A;  4MXV A;  5CBL A;  3ZKU A;  3SH5 A;  1LU1 A;  1R1A 1;  1RUJ 1;  1V9U 2;  4OMC A;  4P5Y A;  3UKT A;  4LT5 A;  2HWC 2;  2ZGQ A;  4KH9 A;  4LBO A;  5CFD C;  1NE4 A;  2EIG A;  5T55 A;  4AR2 A;  1YQ5 A;  4LUM A;  5FBJ A;  3OPZ A;  3VBF A;  1HJG A;  3BIE A;  5DZG A;  2XLA A;  1DCS A;  3AP5 A;  1GUI A;  3T1L A;  4LHK A;  5FYT A;  1SEF A;  2D6L X;  2D40 A;  2XXZ A;  5FZ9 A;  4IXL A;  2B8M A;  3OJB A;  4KU7 A;  1RXG A;  3WEZ A;  5AVA A;  4Q2F A;  5AC9 2;  4A7Z A;  1UMZ A;  1DFQ A;  2CDO A;  4XJA A;  4IV3 C;  3NAP A;  3E5Q A;  1LRH A;  4JGZ B;  5FZH A;  1RUC 2;  5D8A C;  3FHI B;  5FR3 A;  4KG0 A;  5DUW A;  2Q1F A;  4JC1 A;  2VTX J;  5DXD A;  5JMO A;  2EID A;  3OG2 A;  1LEC A;  5DAP A;  3IPV A;  1DYO A;  4LHN A;  2VW1 A;  1EPW A;  4MZU A;  3WG1 A;  5C8C C;  2VOV A;  3WG2 A;  2CGP A;  3OB8 A;  5FTT C;  4IE0 A;  1UD1 A;  1YFU A;  1S55 A;  1Y43 B;  1FAT A;  2JXA A;  5LBC A;  1OLR A;  3V0B B;  5JZG B;  1O3R A;  3ITQ A;  1PK6 B;  5IVC A;  3ES1 A;  1VBD 3;  4LK6 A;  1WME A;  2XG3 A;  3ZYR A;  1ZZC A;  2BFU S;  3VD5 A;  4A7Y A;  2UWB A;  3POE A;  4Q0Q A;  2WLP A;  5FZ7 A;  1VBE 2;  4F83 A;  1BBT 2;  3OPW A;  4UOJ A;  1OOP B;  3N36 A;  4DIN B;  1SFY A;  5IVF A;  4Q4Y 2;  1FAY A;  5A7O A;  4LKD A;  4XAA A;  3HVD A;  3MF9 A;  2VZS A;  4QPY A;  3AZW A;  1CD3 G;  5JOY A;  2E7Q A;  2JDK A;  2G1M A;  4R9B A;  3VDD C;  2FQP A;  4N43 B;  1W04 A;  2ZX0 A;  2JIG A;  3ILF A;  4XIL A;  4NII A;  3ZXD A;  3WT3 A;  4QX1 A;  3ETQ A;  5C7G A;  1UOJ A;  2XBO 2;  1VMF A;  2W47 A;  3ZSJ A;  4FPY A;  1RUD 3;  2R30 A;  2DVD A;  2OX0 A;  1CPN A;  2D44 A;  4IE7 A;  1YFY A;  4QB2 A;  4CCN A;  1G9A A;  4NAM A;  2JJ6 A;  3WG4 A;  1GOG A;  1RVF 1;  5F3E A;  5FZL A;  4OUS A;  3UJQ A;  4B29 A;  1QQP 2;  3LFM A;  4AZZ A;  3LEG A;  5FWJ A;  2WNU A;  2HWB 3;  3Q8E A;  4IE6 A;  2VW0 A;  4GWJ A;  3JQW A;  2WZR 1;  4FPK A;  1ASJ 2;  1ZZ9 A;  2ZXQ A;  5KHK A;  3O1U A;  1QJF A;  2B7Y A;  3MPP G;  4CXW A;  3I2K A;  4C1W A;  1ND3 A;  3HT2 A;  1URX A;  3MUY 1;  2HEV F;  3KGZ A;  3QCW A;  5FZF A;  4P00 B;  5DUV A;  3VKM A;  3M3E A;  1NXD 1;  5FK8 A;  1WMD A;  4JHT A;  3B94 A;  4QD2 A;  4XXP A;  4JDN A;  3CBN A;  2IXC A;  4WVV A;  2ZEW A;  4RR3 C;  4AVT A;  4TZD A;  3ZFG A;  3AZZ A;  5DG1 A;  3I3M A;  5DPN A;  1NLS A;  3K77 A;  2RS3 3;  3KWV A;  1PIV 1;  1RUE 3;  1RHI 2;  3IDA A;  1S0B A;  1S0F A;  5IK4 A;  5JUV A;  1AXY A;  1CAU A;  1OF4 A;  1PGW 2;  3H3U A;  2PTM A;  2FCU A;  3LD8 A;  3T08 A;  1YCI A;  2BNO A;  4LBQ B;  2VUA A;  3N9M A;  4Z07 A;  1DQ1 A;  1NA1 B;  4P9Y A;  3T2T A;  1K3I A;  3T0B A;  3I54 A;  4CCC A;  4MGI E;  4AG4 A;  4ZXE A;  5DAQ A;  5GM0 A;  3RZG A;  3ZDS A;  1HN1 A;  3IMM A;  2WJS A;  3OGJ A;  3OYW B;  2E9Q A;  3HJR A;  3POB A;  3KHB A;  1W9W A;  4E2G A;  3PME A;  2GND A;  3U78 A;  2LW8 A;  1VBC 1;  3I3D A;  5J36 A;  4BLI A;  2A6V A;  1K5M A;  4HG6 B;  1GSL A;  4YSF A;  4NHM A;  3W5N A;  1GNY A;  4Y5Z 0;  1H8T B;  1RUG 3;  1PGS A;  2GAL A;  4LK7 A;  3T09 A;  1MS0 A;  4OUE A;  3RYP A;  3RI8 A;  1Z7S 2;  4IGP A;  1FOD 1;  4D69 A;  3AL6 A;  1K5J A;  1WUV A;  4ZZ5 A;  1C1L A;  1AR8 1;  3ZX7 A;  2W92 A;  3WDV A;  4AI8 A;  4C8D A;  2RM2 1;  3N9P A;  5CKN A;  5CYY A;  5FZ1 A;  2LUW A;  2ENR A;  1HIX A;  3ACF A;  4CP9 A;  2RDS A;  1XNA A;  3O0W A;  4XJW A;  3VBS B;  4LUL A;  2XQR A;  3QD6 A;  4FPF A;  2ETE A;  3CQO A;  1NUK A;  1X9T A;  3NAP C;  1XYP A;  5E8A A;  4BK5 A;  1NG0 A;  5LA1 A;  5F5Q A;  1BK1 A;  3HMY A;  2AAC A;  4AVB A;  2FD8 A;  1W2A X;  4GB3 1;  3AKQ A;  1H8V A;  2PHD A;  5CKM A;  1Y7B A;  1IKP A;  2HBU A;  2WAB A;  2QQK A;  1YRZ A;  3D82 A;  1VAM A;  2GP3 A;  1W9Y A;  1UZ0 A;  2TUN A;  4LBM A;  4BQW A;  3FZ3 A;  2WN2 A;  3GGL A;  1D0G A;  1SPP B;  1SBF A;  1VB4 A;  3BYW A;  4CZS A;  1S1A A;  3LPF A;  3WNX A;  5J09 A;  4L99 A;  1EP0 A;  5F5C A;  2Q1M A;  3A0K A;  3CL1 A;  5KXD A;  2XDV A;  3FHQ A;  5JXH A;  3T0D A;  2ZZQ A;  5J1X A;  2R0F A;  3KHC A;  1HQW A;  1S2B A;  5FFO C;  3PUR A;  3AZY A;  2P4E A;  4AI1 A;  5I0U A;  2BBV A;  5K8S A;  3EMR A;  4LUK A;  1E5S A;  4ISQ A;  1SMV A;  4HZF A;  2AYH A;  3KT4 A;  4AQS A;  3S0M A;  3LZZ A;  2IXK A;  1AUY A;  4IEY A;  2WWU A;  4XEZ A;  4W65 A;  2AH2 A;  2QQI A;  1SLI A;  1IHM A;  1PMJ X;  1ULO A;  1NAE A;  4GUL A;  5EXO A;  1D0H A;  2W9X A;  4FPG A;  2XUE A;  4L92 A;  1ULE A;  2XL9 A;  4HMZ A;  1S0J A;  4XW3 A;  4GH4 B;  2BNM A;  2GMP A;  2C4X A;  5FXX A;  5TSW A;  3RWN A;  4BXS V;  4Q29 A;  2CGO A;  2YB7 A;  1N3Q A;  1WWY A;  2OPK A;  1DF0 A;  4XAB A;  3PUH A;  2WBK A;  2JDP A;  2JD9 A;  3I8T A;  5FO7 B;  4IEW A;  4QX3 A;  2B46 X;  3DPR B;  4AEM A;  1L3J A;  4CU8 A;  1QJX 3;  1JTZ X;  1LOB A;  1L7Q A;  3DEM A;  4M4P A;  3C7G A;  3PJQ A;  4UFH A;  3WF2 A;  2WNU C;  3T0A A;  4P9W A;  3NMB A;  3N7L A;  4JRA A;  3POS A;  5CZK A;  4M00 A;  3WX5 A;  4IEV A;  3SEP A;  4PI2 A;  1VP6 A;  1MVQ A;  1MAC A;  4W50 A;  5FZO B;  4QU1 A;  3MFC A;  5GKA C;  4Y33 A;  1ND3 C;  1BKZ A;  1ZBA 2;  4AI2 A;  3BOP A;  4IGQ A;  4HXC A;  5FKB A;  3RZJ A;  2CL2 A;  4H2A A;  4MUV A;  4XHB A;  1BJQ A;  3UNP A;  3QBQ A;  3SCF A;  3ZKY A;  1HRI 2;  5ANN A;  4K6B A;  1XE8 A;  4LTA A;  4JGZ A;  3ZFG C;  3WOG A;  1DQ5 A;  4HPK B;  2KM2 A;  3N35 A;  4FTB A;  3O1V A;  2VQ0 A;  2IWG B;  1T2X A;  4QX8 A;  4XFG A;  4D7T A;  3MIH A;  5GLV A;  2Z4F A;  5E6H A;  2BW8 A;  1JYV A;  2XJS A;  2G9Z A;  2WSU A;  4NIG A;  2UWC A;  2RJK A;  4XF9 A;  3U37 A;  1O3S A;  2ZMK A;  4L9B A;  3WNP A;  1UKR A;  3J8F 1;  3MI8 A;  4BQ1 A;  2GN7 A;  1AYN 1;  3CIH A;  4X8N A;  5A6Q A;  1VBC 2;  1U0A A;  1YXW A;  1CVN A;  1UOF A;  2VMD A;  1DGW X;  3O0V A;  4YZ2 A;  3WQ0 A;  4UT5 A;  3W9A A;  4MG2 A;  2XJU A;  4FPE A;  3LA7 A;  5F3I A;  1KDK A;  2A3W A;  4AHW A;  1MEC 3;  1AJK A;  3I4I A;  1G8W A;  1OMI A;  2QE3 A;  1YO8 A;  1TMF 3;  1OOP A;  5BNN B;  5FPB A;  2EIB A;  2A6W A;  3NKT A;  4KG8 A;  2ZGO A;  1K5M C;  3UYJ A;  4E2Q A;  4FFI A;  2FMD A;  3AMP A;  2QQO A;  1W9S A;  2XHN A;  4Q4V 3;  1FPN 3;  3CKH A;  1PMI A;  4M0N A;  4K8F A;  4BPZ A;  2VZV A;  5FLJ A;  4QHO A;  3ZN6 B;  3DUI A;  4R4X A;  3S30 A;  4LKS A;  1PVX A;  4NHL A;  1RUF 1;  2GC2 A;  4JV4 A;  2VD7 A;  1ZRE A;  4BCU A;  3LFI A;  2B9U A;  4CDX B;  1REE A;  1DQ2 A;  1D4V B;  1XC6 A;  3LGR A;  3ZFE B;  3LA3 A;  2JIJ A;  4CUG A;  3SEE A;  1QJY 1;  3I59 A;  4YGD A;  1XNK A;  2ATF A;  4HKW A;  3WCS A;  1NT0 A;  3N7J A;  4ES8 A;  3JD7 1;  1QGL A;  1YI7 A;  5IVJ A;  2D3R A;  4Q4X 2;  5IVE A;  1AYM 1;  5BNQ A;  4FTE A;  4BZ4 A;  1QH6 A;  5FMC A;  1I5P A;  2E31 A;  3IB3 A;  1LHW A;  1PMH X;  4FOY A;  1WCU A;  1LED A;  2VR4 A;  1AR7 1;  1W3V A;  4H7M A;  3HOB A;  2WO1 A;  2VZP A;  3OD4 A;  1MEC 2;  2NPI A;  2WFF 1;  4ONU A;  3RZL A;  1CAX A;  1UY4 A;  1C28 A;  4MHU A;  2IFR A;  1DLL A;  5APA A;  1BMV 2;  2D98 A;  1GQP A;  2ZBJ A;  5C9A A;  3T4H B;  1V6O A;  5C5T A;  5A1A A;  4AVA A;  1YHF A;  5C8W A;  2TBV A;  1QJZ A;  3N9O A;  5EPA A;  1CIY A;  4XCA A;  5KXB A;  4A4A A;  4OI0 A;  4HFS A;  3LSD A;  4XUO A;  3VKN A;  3RZH A;  1UF2 C;  2K9Z A;  1HV1 A;  5BNP B;  2WNV C;  3O1S A;  2RS1 3;  1LB2 A;  1UX7 A;  3IN9 A;  4OHX A;  1JOJ A;  2BV4 A;  4ZU5 A;  3H7J A;  4BQ3 A;  5GZG A;  2VZU A;  2XR4 A;  4P5H A;  5LBE A;  2GU9 A;  1JZ8 A;  2C1F A;  1ZX5 A;  4MGY E;  3MZH A;  3QAC A;  3AMN A;  2W1W A;  4DOU A;  2DBN A;  2VH9 A;  3OYW A;  5ACA 1;  4QPG A;  1HRV 3;  1WW5 A;  3ZR5 A;  4BOW A;  2BEO A;  2PQQ A;  4JGY B;  4D6R A;  1IG0 A;  3NNJ A;  2RS5 2;  3VDC A;  1A34 A;  4BM8 A;  1YIF A;  3TNQ A;  4BYY A;  2VUL A;  1AR9 1;  1NOV A;  4CDU C;  1N1V A;  1CJD A;  5BY5 A;  1IS3 A;  4ES9 A;  4D0Q A;  2GC3 A;  4EN7 B;  1DGL A;  4QKD A;  4GMP 3;  4LLO A;  1PX4 A;  4B4R A;  4FPC A;  5K0U A;  1R09 3;  3NJX A;  1OQE A;  3OTF A;  1QF3 A;  1R08 3;  1IQD C;  4MV2 A;  1BLZ A;  4MAD A;  3ENR A;  1MQT A;  4YW1 A;  4DUX A;  1J1L A;  5FOB B;  3O5S A;  2VZQ A;  4AED B;  3HN3 A;  4JX0 A;  4LQR A;  3U10 A;  1ZYB A;  4Y20 B;  2W08 A;  4Z82 A;  1GU3 A;  2OUH A;  3AJY A;  5KC5 A;  4UFJ A;  2VL4 A;  3ALQ A;  3VBS A;  1DYK A;  1PO1 3;  2EXK A;  3IWZ A;  3WR0 A;  1XPW A;  2P2K A;  4QM8 A;  1W6N B;  3ZSE A;  5JSP A;  3J4U H;  2VBD A;  1KS5 A;  4JGZ C;  1IPS A;  1APN A;  1O91 A;  2V73 A;  5F6L B;  3RSJ A;  2I45 A;  4QHZ A;  4QX7 A;  2W68 A;  2VMG A;  1C5H A;  3J8F 2;  4WZF A;  5IW0 A;  4NVP A;  4CPB A;  5FJH A;  4L0P A;  5JXG A;  1TNF A;  2E53 A;  2DFC A;  1XNT A;  2AUY A;  3H8R A;  4OHW A;  4CA9 A;  2Y26 A;  4FAH A;  3X29 B;  2RR1 1;  2ZTN A;  1XSQ A;  2LRO A;  5IHR A;  1Q43 A;  4GIQ A;  1QJU 3;  4FQ4 A;  4DEV A;  5DQ0 A;  3NV2 A;  3E97 A;  3AFK A;  2VZO A;  3BPS A;  3FWE A;  3MIC A;  2P6H A;  4MHR A;  1IPK A;  4RQP A;  5DN2 A;  4ASL A;  3O1R A;  4YW2 A;  3I2F A;  1BZW A;  2N7G A;  5IAV A;  4F7Z A;  4AAX A;  4IER A;  1ZRD A;  2YGL A;  1OLQ A;  1JZ5 A;  3I3B A;  3UES A;  5GZF A;  1H4G A;  5JVV A;  4AVS A;  1OOP C;  2VZR A;  3GCX A;  5JLV A;  2HWD 2;  4XUP A;  1UU5 A;  4P9G A;  2B45 X;  1PO2 1;  2E6V A;  3ZXJ A;  3W5M A;  4DQA A;  1V70 A;  3FLT A;  2E26 A;  4GKY A;  1W8F A;  4EWA A;  4D7S A;  3H3Z A;  4Q0S A;  1JBC A;  5A33 B;  4LMF A;  3JZV A;  2QQJ A;  4OQ8 A;  3WUD A;  1ZZ6 A;  2C0Z A;  2IXI A;  4BH9 A;  3MUZ 1;  1COV 3;  5CIR A;  5JMC A;  1PO1 2;  4XF4 A;  1PVC 1;  1TVG A;  3FFZ A;  1RUI 2;  2XVK A;  3V64 A;  3JD7 2;  1S2K A;  4GH4 A;  5T5P A;  3OBT A;  2PN5 A;  3L9J T;  4QPW A;  2HWF 1;  2HH9 A;  4OHZ A;  4XF0 A;  1ENS A;  4XQD A;  5B4X A;  1OQ1 A;  4E4Z A;  4C0H A;  5KBF A;  3SC7 X;  3PVN A;  1BEV 3;  1HQN A;  1O3Q A;  2EF6 A;  3IAP A;  3LCP A;  4E27 A;  5FZK A;  3JCI A;  4GAL A;  3SLI A;  4BIF A;  4PLO A;  5JIA A;  3MGU A;  3ZXG A;  1G86 A;  4WM8 B;  4QQH A;  5DG2 A;  3VZJ A;  1GWL A;  5AVP A;  5FZO A;  2E32 A;  4I0W B;  3ZXA C;  1H1M A;  1GLH A;  1HW5 A;  1ND2 A;  4QDQ A;  2PLV 1;  2L9L A;  3WF3 A;  2UU8 A;  1S0I A;  2R06 2;  3BPZ A;  2ZS6 B;  5BV6 A;  4OZO A;  2ZGS A;  3E1F 1;  1BQP A;  4QDS A;  1H4H A;  3WP5 A;  1TE1 B;  1VBB 1;  2ZHK A;  4IDZ A;  1EPZ A;  5C9A C;  2WRA A;  1VPH A;  5EWS A;  5FZ6 A;  3CJI B;  1RUH 1;  4AGR A;  2FBE A;  4DNY A;  2AEY A;  1MZE A;  2VUC A;  1X7N A;  3DF0 A;  4GWN A;  4ZY9 A;  4AFB A;  3MBW A;  3JUU A;  3M3C A;  5FZC A;  4HVO A;  4TLG A;  4MGT A;  5CG9 A;  3PDQ A;  2C5D A;  3PVE A;  3DXU A;  4WBB A;  1WCD J;  4ASM B;  3GAL A;  2J1U A;  1NA1 C;  1GNH A;  2R32 A;  3ZPY A;  3ZYH A;  4UBH A;  3FBM A;  5A7W B;  5FYH A;  1WLW A;  3NV3 A;  2ZOE B;  4JTO A;  5HXM A;  1JXN A;  5CIS A;  1ULG A;  4QPG C;  5A32 A;  1TME 3;  4MET A;  5I0T A;  4YW6 A;  1WD4 A;  4ATF A;  5FYZ A;  5FPX A;  3K3N A;  3EXU A;  4RGA A;  2NMO A;  4YPJ A;  1AL2 1;  2ZPX A;  4GAZ A;  4UF0 A;  2XWB B;  5CNA A;  4AVC A;  1OFS A;  3PLQ A;  1MZ5 A;  4QXK A;  2ADE A;  2BUK A;  1ZA4 A;  4YGC A;  3HN1 A;  3V65 A;  2LAL A;  4GWM A;  4AAP A;  3UGF A;  4AYU A;  1KD7 A;  4U36 A;  1H8T C;  4JVA A;  1YJK A;  5EJ3 A;  4G4F A;  3FUQ A;  4A2U A;  3ZN6 A;  3K48 A;  1KFX L;  3K46 A;  3ORJ A;  3W20 A;  3VBU B;  4O61 A;  1DU3 D;  1JN2 P;  5K0U C;  2R04 2;  2ZHM A;  3MLJ A;  3RRD A;  3VB9 A;  1MQT C;  2PEL A;  3GJA A;  3ZLI A;  2GSY A;  2JDU A;  1JU3 A;  1W6P B;  1OUX A;  4CDX A;  1W8U A;  3MV1 1;  2F6B A;  3VD3 A;  4I0B A;  5A7S A;  4HL0 A;  2GZW A;  3ZXF A;  2JKX A;  1EAH 2;  1R64 A;  3NL1 A;  5DMY A;  1OXC A;  3VBS C;  2HEY F;  2ORX A;  3AKR A;  4CCE A;  1RMU 3;  1NZI A;  2DYC A;  4BDV B;  5HBA A;  1FX5 A;  2DCZ A;  5FXV A;  4C0B A;  4FPL A;  3VBR B;  3LOB A;  1V9U 3;  3ZYP A;  1NCR B;  4LHL A;  4MGK E;  1LKN A;  1WCQ A;  3KZ4 C;  4I30 A;  4DFS A;  2HWC 3;  2FDH A;  4BB3 A;  3ZN4 A;  5F5A A;  4URA A;  3RG0 A;  2X29 A;  5FYS A;  3GBW A;  5JR2 A;  4NN0 A;  4IEZ A;  2VVF A;  3HWJ A;  3SHR A;  4Y1Y A;  4I2O A;  1N3P A;  2TNF A;  2Z5W A;  2ZHL A;  3SH3 A;  4LBJ A;  1AXK A;  2MPF A;  3CDZ B;  4RQP C;  5AC9 3;  4XOG A;  1PO2 2;  3WIN E;  4UW4 A;  1O7F A;  1YNA A;  3M3O A;  2X5I B;  5L36 A;  3A23 A;  4Q4W 2;  1RUC 3;  4XET A;  1Q56 A;  1WA6 X;  4H7L A;  3VD7 A;  3E5U A;  4NMI A;  2WQ4 A;  5BNP A;  3GXU A;  3ZMO A;  5FKC A;  4EWE A;  4ZON A;  2NN8 A;  1DGR A;  1SLC A;  3GYD A;  4Z92 B;  4FP3 A;  4YGB A;  4FSJ A;  1VBD 1;  3FFQ A;  1Q8V A;  4I09 A;  2IXJ A;  2XHK A;  5FY7 A;  3RZK A;  1UYP A;  2HWF 2;  4E2S A;  1RB8 G;  3T30 A;  1MVE A;  1UOB A;  2RE9 A;  1OA3 A;  3V56 A;  2LS6 A;  3Q8A A;  3TN9 3;  3U75 A;  3RZZ A;  3P3P A;  3D6E A;  4EZ4 A;  1JMU B;  2NMN A;  4GH4 C;  2WAO A;  2YU2 A;  2ZKN A;  3AZX A;  2CAU A;  2WYS A;  1VBE 3;  3ZXE A;  4KGQ A;  2FDK A;  5JPN B;  3LIH A;  1BBT 3;  3S5Q A;  3VUO A;  4AI0 A;  2BYV E;  1FMD 2;  2GH8 A;  2ZGT A;  1W6Q A;  1ZBE 2;  2O0O A;  4Q4Y 3;  4ZS3 A;  1UY0 A;  1XYN A;  5F6K A;  3ZR6 A;  4HSL A;  3I2O A;  5CFC B;  2LTN A;  2WT2 A;  3RS6 A;  1UU6 A;  4MSV A;  2P5B A;  4LE4 A;  2EIC A;  5L9B A;  1RUD 1;  2EXI A;  1ONA A;  1S0E A;  4ZXK A;  1VBB 2;  5C3R A;  1JZ2 A;  1JYW A;  1C8M 2;  3TWI A;  2ILM A;  1TG7 A;  1ND2 C;  4MH0 E;  2ZCW A;  4KI5 M;  2XBO 3;  3ZM8 A;  4AED A;  2OPW A;  2D5H A;  4YNI A;  4LIV A;  5FCC A;  2WNE A;  1WLC A;  3EJK A;  3JXS A;  3OUH A;  4S2F A;  4XIK A;  2DU1 A;  2HWB 1;  3C3V A;  3UGG A;  5A3O A;  5LY2 A;  2FCV A;  5A3M A;  2VNG A;  2DTY A;  3LQC A;  3RPQ A;  2UUR A;  1QQP 3;  2IZW A;  1BYH A;  4LLF A;  2YBS A;  1NY7 1;  2WQZ C;  4Y4Y A;  4GZ9 A;  1ASJ 3;  1YQ2 A;  3HAG A;  1DP0 A;  1L7R A;  3TN9 2;  4AFD A;  1IKQ A;  2J22 A;  4CYD A;  3NKG A;  3SKV A;  4QXC A;  1AL2 2;  4CP0 A;  4CCK A;  5C6C A;  5LB6 A;  1NQJ A;  1RUE 1;  1JYX A;  1GR3 A;  1R1Z A;  4QHB A;  5BNO B;  2E51 A;  2VUJ A;  4GKX A;  4LO7 A;  4MGZ E;  2OYZ A;  1G6N A;  5ABJ B;  4ORF A;  4NIA A;  1VMH A;  3THC A;  2EA7 A;  3OGG A;  4W6W A;  4HOO A;  4YM3 A;  5BNN C;  1RHI 3;  5IAT A;  3MID A;  3TEX A;  1A3K A;  1IOA A;  2A6Y A;  4NRO A;  4QB1 A;  2A6X A;  4N53 B;  1NLQ A;  5A33 A;  1US2 A;  1EY2 A;  3KD4 A;  5LRR A;  2HJI A;  2FDI A;  2XB6 C;  4HK9 A;  3LEM A;  1IS5 A;  4IET A;  1D7P M;  1Y9G A;  4DRV A;  2P1B A;  4AVV A;  1EV1 2;  2OT7 A;  2ZZJ A;  3HT1 A;  4ZPI A;  3USU B;  4CDX C;  1TQ5 A;  3OBR A;  5FMO S;  2RVA A;  5E1R A;  3WQ1 A;  1N1T A;  5JR7 B;  3QLQ A;  3KV5 A;  4P02 B;  3POG A;  1RUG 1;  4GA9 A;  4TLF A;  4XQ4 A;  4NIH A;  1WKY A;  1WW4 A;  1ODM A;  3FMG A;  2VM9 A;  3SH4 A;  2ZA9 A;  1HXS 1;  1JZ6 A;  4RL7 A;  4WM8 A;  4EQV A;  1JYC A;  5B4N A;  2NP0 A;  3B93 A;  4COU A;  1IG3 A;  3HQU A;  4QXH A;  1Z7S 3;  1I3H A;  4HKL A;  1DG6 A;  4KWJ A;  1NXM A;  3RDI A;  1G9F A;  2OS2 A;  1F8V A;  2P17 A;  2YXS A;  1LUL A;  2VCA A;  2ZX1 A;  5JXJ A;  3OY8 B;  2XVG A;  4XUN A;  4CUC A;  3AKT A;  3HQX A;  3NNL A;  1YQ8 A;  4IW3 A;  1L7L A;  3H1W A;  4CU6 A;  2V5Y A;  1WA4 A;  3VZO A;  5FPU A;  2DCK A;  3KQR A;  4AI3 A;  1F35 A;  1YUD A;  3CJI A;  3CJX A;  4LOT A;  1H1A A;  4QT6 A;  2GN3 A;  4UW3 A;  3O1T A;  2YZ4 A;  2JIC A;  4I3G A;  5T5L A;  4CP1 A;  1FXZ A;  4UWD A;  5I0R A;  4Y4R A;  3ON7 A;  5IK5 A;  1U5X A;  3KT7 A;  2DVA A;  1HN0 A;  2NM1 A;  4S2H A;  5T54 A;  5BNP C;  3ELN A;  2RMU 2;  5EYX A;  3J7M A;  5LK7 B;  1KDM A;  1GP5 A;  2BFU L;  2BPA 2;  1UL9 A;  4UW5 A;  2W46 A;  4OI4 A;  4Y22 B;  1O6U A;  3RMY A;  3ZIX A;  1D2S A;  2K0G A;  2JG8 B;  3K2O A;  5FLI A;  1PNG A;  4DUW A;  5A7W A;  1R1A 2;  1RUJ 2;  2JWP A;  5JXI A;  1UW8 A;  2CYF A;  2AGS A;  1YYN A;  3BTY A;  2W1U A;  4AF9 A;  2VO5 A;  1B35 A;  2ARX A;  1CZS A;  3KF5 A;  2CSG A;  3ZXK A;  2WO3 A;  1K45 A;  1T6G C;  1VJ2 A;  4JGY C;  5DAB A;  3LSE A;  3S5A A;  5FYM A;  1AJO A;  1QHD A;  1IZ3 A;  1OUR A;  1QXJ A;  4PCR A;  1X8M A;  4ZU7 A;  3PVB B;  1QWR A;  5DAV A;  1SLB A;  3K4A A;  3VN4 A;  5HCB A;  3WLU A;  5T5J A;  4CCL A;  2JG9 B;  4URT A;  3J26 N;  1NE6 A;  4QAW A;  5FUN A;  2VG9 A;  4AXO A;  1F31 A;  2CGN A;  4BK4 A;  1W0N A;  2R49 A;  4PJY A;  5FMO L;  5GAL A;  1IS4 A;  2JB4 A;  1C5I A;  4MLO A;  4YVS B;  3AYD A;  4AED C;  1QXR A;  4WZC A;  2ZGK A;  1AR6 1;  1WCK A;  4FPH A;  2VOX A;  1XB9 A;  1UYY A;  1YFX A;  1QJX 1;  5LA9 A;  4UFL A;  1T6B X;  1FV2 A;  2PQS A;  4EN9 B;  5KC6 A;  2WZR 3;  1H2L A;  4HON A;  4OZX A;  1O4Z A;  3IT8 A;  4XMI A;  4UXA A;  2QJV A;  3VBR A;  1H9W A;  3D0S A;  1NCR A;  4K40 A;  3VHN A;  2PAM A;  2JEC A;  4Y1X A;  4BHP A;  1VRH 1;  2A3X A;  1NX9 A;  4GD4 A;  2FMY A;  1VMJ A;  2C9A A;  5C3S A;  4D6S A;  2ZMN A;  4EJR A;  4WM7 B;  1YQ6 A;  3PMS A;  2WS9 1;  1ZBA 3;  1S0G A;  1LHN A;  1GP6 A;  3D4K A;  1O5U A;  1ULD A;  2Y60 A;  4R8H A;  5FDB A;  3AJZ A;  3BTA A;  2Q5T A;  5D21 A;  2CNA A;  2ERF A;  3ZO0 B;  5T5O A;  1HRI 3;  1XRU A;  2WNV A;  4LA2 A;  5D2A A;  2YYO A;  2X5I A;  2WR9 A;  4I3P A;  5A7Q A;  2EAK A;  3G6J B;  5C33 A;  4XFC A;  5DDJ 1;  5C4W A;  1ZRF A;  1GZC A;  4HN1 A;  3T4V A;  5FY0 A;  4ZZ8 A;  4JAA A;  4XAE A;  3EO6 A;  5A3P A;  4L97 A;  1V0A A;  2DF7 A;  2E7A A;  3NQH A;  3MF6 A;  3KQ4 B;  4UFK A;  1N47 A;  1RVF 2;  4PQQ A;  2KXL A;  3ROU A;  3GZU C;  3I2D A;  2ET1 A;  4QKN A;  1VBC 3;  2AEZ A;  5CA6 A;  3MLL A;  2J1T A;  3EYP A;  2WZR 2;  4NHY A;  1IS6 A;  1C1F A;  2ZEX A;  4AFA A;  4CDU A;  3LDB A;  4MGQ A;  1XND A;  1W6M B;  2BWA A;  2W91 A;  4Q4V 1;  2XJP A;  1C8N A;  2HYK A;  2F4P A;  3RI9 A;  2BDR A;  1PZ9 A;  1QY4 A;  2B4K A;  4FBF A;  2VMC A;  2PMW B;  1LOC A;  4NPR A;  1UWW A;  4P08 A;  2D7F A;  2YDE A;  1ZA7 A;  2BBA A;  5C3O A;  3OD0 A;  5CFC A;  4M3C E;  1VIW B;  3HBZ A;  3PIJ A;  4NJ4 A;  4LOR A;  4XYX A;  5IK8 A;  2IXL A;  4WM8 C;  3CF6 E;  5J37 A;  3T3Y A;  5D1I A;  4L11 A;  3A7Q A;  3HNB M;  4ARX A;  5F9T A;  3I2H A;  2C6S A;  1PIV 2;  1GYK A;  3APB A;  5SV8 A;  3H0O A;  1H6X A;  5HCF A;  2ZGP A;  3OBZ A;  2CV6 A;  1QMJ A;  1QOO A;  4JHZ A;  3AL5 A;  4LHS A;  5CFD B;  5ISL A;  2P3I A;  1MS1 A;  4AWD A;  2PHF A;  2Q30 A;  4JQT A;  5I0D A;  1OVS A;  3AKS A;  4HET A;  4O9G A;  4D8M A;  2EIE A;  3WSO A;  4O65 A;  3UET A;  3FN9 A;  2BRT A;  3CJI C;  1UYX A;  4EE2 A;  4DXT A;  2KA3 A;  1O59 A;  1VAL A;  1N1Y A;  4XMA A;  3B02 A;  1X8E A;  1N1S A;  4K7J A;  5C3Q A;  1XE7 A;  4Q4X 3;  1FT9 A;  1PX3 A;  4AW7 A;  2R7E B;  3J7H A;  3ME2 A;  1W06 A;  4HBN A;  4QGM A;  5JZG A;  3V0B A;  1PK6 A;  3H8O A;  4LO6 B;  1VBA 1;  2JE9 A;  1CAW B;  4YZ3 A;  1POV 3;  2A73 B;  4EN8 B;  3AP6 A;  4G3Y C;  4F8A A;  4XDQ A;  3CU7 A;  1QOT A;  2Y34 A;  3ACL A;  3Q9O A;  2VEC A;  3FJS A;  5BNO A;  3AX4 A;  2XGX A;  4XZU G;  1B35 C;  1IPJ A;  1U12 A;  2PHX A;  5FYV A;  4AHX A;  1FOD 2;  1KEX A;  1W9T A;  2W5F A;  5LCW L;  1ZZ8 A;  4UFI A;  3DYM A;  4DIQ A;  5ABJ A;  3O14 A;  2RS1 1;  1NQD A;  1AR8 2;  4BQY A;  2VU9 A;  4OYU A;  2RM2 2;  2VCC A;  5EV7 A;  1WLT A;  4A3Z A;  3FHA A;  2W1Q A;  4N43 A;  2DCJ A;  1TEI A;  3BTZ A;  5JAX A;  5A3T A;  2Y64 A;  1Y3T A;  3ILR A;  5FP3 A;  4N53 A;  4DY5 A;  1A78 A;  3Q8C A;  1AR6 2;  3RVH A;  1HRV 1;  1KJR A;  1UXZ A;  3VL8 A;  5FZM A;  5F5I A;  3R0R A;  2OQ6 A;  4P9X A;  5H9Q A;  3D8C A;  4NOT A;  4YWA A;  4FP2 A;  1Q8Q A;  5E89 A;  4EWD A;  4KBZ A;  5FRA A;  4GB3 2;  1SLA A;  2GNT A;  4LEJ A;  4NHK A;  3FX3 A;  2V5D A;  1WBL A;  4BQX A;  3NJV A;  1VRH 2;  1UZZ A;  2RS5 3;  3IKW A;  4PDW B;  4AE2 A;  4XUT A;  2YC2 A;  4YG3 A;  4X8P A;  3I2G A;  3UKN A;  1D4M 1;  3MIB A;  5FY4 A;  3VBR C;  1JOP A;  4Q0P A;  1R09 1;  3OUI A;  4XJ9 A;  1LOF A;  1R08 1;  1NCR C;  3CEW A;  2WS9 2;  4KQ7 A;  4B1L A;  5FQ0 B;  5FP7 A;  5C3P A;  2DFB A;  2ZGM A;  4Y24 A;  1QEX A;  4MXW B;  4PQ9 A;  3BOW A;  4KBB A;  2OVU A;  3C2U A;  3W58 A;  3KV4 A;  4FOQ A;  4QDR A;  3OY8 A;  2XLG A;  3F95 A;  2WWJ A;  2P37 A;  3GZA A;  3WW2 A;  2Q0A A;  4V1P A;  5DDJ 2;  4XFI A;  5F7U A;  4QQO A;  5FZ4 A;  5K4L A;  2WFP A;  4DPN A;  2GMM A;  3PUA A;  5E16 A;  3NNG A;  3VGI A;  4RD7 A;  1JHJ A;  2X5I C;  3KF3 A;  4KWU A;  1H30 A;  1YC6 1;  2WZE A;  2ZGR A;  4LBQ A;  2JB8 A;  5C4W C;  2VCB A;  4FAG A;  2VTX A;  1NA1 A;  3C7O A;  3J8F 3;  4I02 A;  1UIK A;  5LBF A;  4LPL A;  3S7E A;  3V0A B;  3NV4 A;  1LHU A;  1QJU 1;  2DCT A;  3SKJ E;  1UZV A;  4FTS A;  2W95 A;  5A1F A;  3NW4 A;  4DXZ A;  3ACG A;  4LNV A;  4G9S B;  1J59 A;  2JG8 A;  1QU0 A;  2J7M A;  1LCL A;  3N9L A;  3PVO A;  5FYY A;  3R4U A;  1HB3 A;  2UYB A;  1V00 A;  3Q8F A;  2QDN A;  5LY1 A;  1GFF 2;  4XFA A;  2YHJ A;  5F3G A;  3ZYG A;  1GOH A;  1Q8P A;  4XDP A;  4W4Z A;  4NWV A;  2YMZ A;  1H8T A;  4QMA A;  3MW2 A;  1WW7 A;  3HD8 B;  5CKQ A;  1GWK A;  2FCT A;  1W03 A;  5FUI A;  4D7Y A;  4RN5 A;  2HWD 3;  3IDB B;  1X36 A;  2QQM A;  3NNM A;  1JW6 A;  2C24 A;  1X33 A;  2E33 A;  2AR6 A;  2B39 A;  4Q27 A;  5CFC C;  3I7D A;  4AI9 A;  1COV 1;  2Z42 A;  4C1X A;  2ES3 A;  4OUM A;  5AFE A;  5EZW A;  1GAN A;  2XJV A;  5CU1 A;  5JOZ A;  2Q8O A;  3JBG 1;  2ZJC A;  4YVS A;  3QOP A;  5T52 A;  4PIZ A;  2A5Z A;  1RUI 3;  3JD7 3;  3VV1 A;  4XAC A;  2VNR A;  3VBF B;  3WF0 A;  4RHV 1;  5FP4 A;  4A41 A;  3ECQ A;  4DS0 A;  3PUQ A;  1W8Z A;  4COW A;  1AYN 2;  1GWM A;  4J25 A;  2VQA A;  1NYW A;  1SZB A;  2DUO A;  1VBA 2;  3E6D A;  4Z8B A;  5FP9 A;  4ZU4 A;  5KWR A;  1GV9 A;  1AR7 3;  3I49 A;  1M4W A;  3RWK X;  1B09 A;  1AXZ A;  1OUS A;  1VAK A;  1RED A;  2W3J A;  4IE5 A;  5ERL A;  2MEV 1;  1JS9 A;  3E6B A;  1C57 A;  5JZG C;  1RTV A;  1SPP A;  3ZXL A;  1PK6 C;  1V6N A;  4WM7 A;  4XCB A;  3WDT A;  2B42 B;  3KV9 A;  5DZF A;  3T2O A;  1XQN A;  5KR7 A;  1W8O A;  1LEN A;  1DGR N;  1F4H A;  2VZ1 A;  3OEB A;  2R06 3;  3SXW A;  1ZRR A;  4NUB A;  3IPV B;  2VMF A;  4XUQ A;  4TN7 A;  3LDR A;  1OSG A;  1F15 A;  1Q8O A;  2JE7 A;  5BNO C;  1WMF A;  1K42 A;  1W8N A;  1RUF 2;  4Y5T A;  2R07 1;  4K9S A;  3TOJ A;  4CSW A;  5CG8 A;  3HEI A;  5FJK A;  5ABJ C;  2JD4 A;  3VHP A;  1UY1 A;  3PHM A;  1MS5 A;  4CU9 A;  2J1A A;  3VKL A;  1OT5 A;  1OVP A;  1JI6 A;  1CZV A;  3VKO A;  2PFW A;  2JDN A;  4OMD A;  4N43 C;  1BHG A;  4NHX A;  1YIP A;  2IVI B;  1U5Z A;  3WDW A;  4EYU A;  1SBE A;  4FOV A;  3MIE A;  3ES4 A;  3KS7 A;  1QJY 2;  4N53 C;  4KWK A;  4CVU A;  2QKD A;  3H1M A;  1DZR A;  1TME 1;  1KGY A;  1UKG A;  2BVV A;  2VOT A;  3WZ1 A;  4RGK A;  3L2H A;  3PUS A;  1G7Y A;  4ERO A;  4HVR A;  5IVB A;  1AYM 2;  2HWE 1;  5L7O B;  4A45 A;  1AR9 3;  2D6P A;  1ZZB A;  1D4M 2;  2VBB A;  4LBK A;  1SCR A;  3DPR A;  3AMM A;  2PA7 A;  1VB2 A;  4FPJ A;  4XTM A;  4YZ1 A;  3CHX A;  2XKO A;  3E5X A;  3LDK A;  1ENQ A;  5F32 A;  3UV9 A;  3VBO B;  1AR7 2;  4W6Y A;  2DUQ A;  5FZ8 A;  2YBP A;  5FZ0 A;  5F3C A;  3THD A;  2WFF 2;  4QKB A;  1OD5 A;  2JDZ A;  3WNK A;  3BUC A;  3MW3 A;  1MR5 A;  2XLF A;  4X6Q B;  4YYO A;  4UI9 L;  1XU1 A;  5FMD A;  3VHR A;  3U0Z A;  1RJ8 A;  2VXR A;  1LOF C;  2RG4 A;  1KXG A;  4PLM A;  1GZW B;  2Y6L A;  2D6M A;  3GZE A;  4PF5 A;  1X82 A;  4Q5O A;  3DV8 A;  4COV A;  5C5U A;  2W52 A;  5CB7 A;  3NJZ A;  1SLT A;  1S4C A;  2QBX A;  2R04 3;  1XU2 A;  2IFW A;  1Z78 A;  4CXY A;  1POV 0;  5I8T A;  1ZRI A;  3RYR A;  4HPK A;  1RGS A;  5J3U A;  3NV1 A;  1W28 A;  2R1B A;  3WP4 A;  4BXF A;  4JDM A;  2IUW A;  3POJ A;  1EAH 3;  4QX0 A;  2ZHN A;  3H8X A;  2HWC 1;  3WW1 A;  2EAA A;  1MS9 A;  4HT1 T;  3ASI A;  5ACA 2;  2BOI A;  3SCH A;  5DAW A;  1W05 A;  3LF7 A;  3NNF A;  5FYU A;  3S6P A;  5BPX A;  5T3N A;  5L9V A;  2QZ3 A;  5E88 A;  1KRI A;  3IMN A;  4Q26 A;  1AR9 2;  3C8X A;  5AC9 1;  2BOJ A;  1CAU B;  1UOG A;  2JG8 C;  2VQT A;  3HR9 A;  3KCC A;  4HKO A;  3M2M A;  2QQN A;  5FWE A;  5KHH A;  4AHY A;  4TTG A;  3H8U A;  1GKB A;  2D5F A;  1SDD B;  4OI2 A;  3DYP A;  4OHV A;  1RUC 1;  2PHU A;  5FBZ A;  1OH4 A;  3N7K A;  3W59 A;  5BNN A;  1CQ9 A;  3K4Z A;  3K4D A;  1PO2 3;  4RGG A;  3VL9 A;  4YGE A;  5DAX A;  1H9P A;  2D93 A;  3ZOI A;  2WAA A;  5FUP A;  2SLI A;  2O8O A;  3BIW E;  1CAV B;  4KNC A;  1XNC A;  4Q4W 3;  2FHR A;  3ZN5 A;  3JBG 2;  2X53 S;  5A7N A;  3WHU A;  2DTW A;  1NCQ B;  4QPI B;  3FBY A;  2A75 A;  1YJL A;  3LA2 A;  4A44 A;  4EZH A;  4YFZ A;  3G7D A;  3III A;  3ZFF B;  1K5M B;  2J1E A;  1A6C A;  2WKK A;  4RHV 2;  4YW5 A;  3RMX A;  2HWF 3;  2J42 A;  4AGG A;  1HJF A;  2JDY A;  4RA0 A;  3ZFE A;  4YVS C;  4RSU A;  4Y1Z A;  1BBT 1;  4LO8 A;  1UY2 A;  1ZNP A;  2WDB A;  2WII B;  5K7P A;  2VZT A;  4Q4Y 1;  2RR1 2;  5FK7 A;  4ARY A;  5K9Y A;  3IM0 A;  4PDW A;  3J7L A;  3T2Q A;  4BE3 A;  2YU1 A;  4Q1P A;  5A6X A;  3DN7 A;  4TWT A;  4CCM A;  3DEC A;  1V6L A;  1FMD 3;  3LEI A;  2YFU A;  1ZBE 3;  2RJ2 A;  3R05 A;  1LJ7 A;  4Y1U A;  4CP9 B;  3B01 A;  1SG3 A;  3TEZ A;  2JKB A;  2XBO 1;  1AX2 A;  3AMH A;  2ZAC A;  4YG6 A;  1ZRC A;  1QH7 A;  1VBB 3;  2UYA A;  3H7Y A;  4LA3 A;  5H9R A;  5IAX A;  1VRB A;  1JYT A;  1Y9Q A;  3RQ0 A;  1C8M 3;  3PIG A;  5FPL A;  4B4Q A;  3WF4 A;  2OUJ A;  2R07 2;  4WM7 C;  5JPM B;  1BVP 1;  2NZ9 A;  2AEN A;  2W0X A;  2GC0 A;  4O7X A;  5FMB A;  3OEA A;  1YWK A;  4IES A;  2D6N A;  2QQV A;  3H1Y A;  3WXP A;  3DCQ A;  5IFT A;  3WDU A;  3ACI A;  5CAD A;  2F17 A;  4HK8 A;  4WV8 A;  3QH7 A;  3O1P A;  3SNM A;  5A80 A;  1QOS A;  2QNK A;  1UXX X;  3ABZ A;  3MFA A;  1ASJ 1;  1PVC 2;  1JUI A;  1US3 A;  2VTF A;  2YC0 A;  3I3Q A;  1HDK A;  5HXV A;  1W6O B;  3B69 A;  4ATE A;  5FO8 B;  1EYB A;  1WW6 A;  1PM7 A;  1RYY A;  3OSD A;  3V0A A;  3POW A;  5IK7 A;  2QZ2 A;  2HWE 2;  4GMP 0;  4XJZ A;  3HQR A;  4JCK A;  1AVB A;  3PTY A;  2P34 A;  4EN6 B;  5A6Y A;  3KVA A;  4GJZ A;  2YPD A;  1VLN A;  1CIW A;  4YAR A; 
#chains in the Genus database with same CATH homology
 4QB6 A;  2VO5 A;  1CZS A;  2X10 A;  2WO3 A;  1K45 A;  2EIB A;  2VZ3 A;  3CZJ A;  2QQO A;  1W9S A;  2XHN A;  3CKH A;  2J1R A;  2VZV A;  3K4A A;  4LKS A;  2WQ8 A;  1JZ7 A;  4QAW A;  2V72 A;  4BK4 A;  1W0N A;  2J1V A;  3HPN A;  1XC6 A;  4DUV A;  3SEE A;  1GMM A;  1UYY A;  1NT0 A;  1O8P A;  2PQS A;  1MPX A;  2HLE A;  3HNY M;  1I5P A;  2BGO A;  2E31 A;  5C71 A;  3IB3 A;  1PMH X;  3WNL A;  3C7E A;  2VR4 A;  3I2J A;  1NX9 A;  3HOB A;  2WO1 A;  2VZP A;  2B9V A;  4GWI A;  4XVH A;  4JKK A;  1UY4 A;  2DDU A;  2W1S A;  1GQP A;  4IUG A;  5A1A A;  1J83 A;  2CDP A;  1CIY A;  3ETP A;  3C7F A;  4A4A A;  4XUO A;  4RYD A;  4MO3 M;  4TXW A;  5C70 A;  1UX7 A;  4PT6 A;  3VDB A;  2ZEZ A;  4ZZ8 A;  2VZU A;  1O8S A;  2JE8 A;  3OGS A;  4A42 A;  3NQH A;  2C26 A;  1JZ8 A;  2YC4 A;  2VME A;  3KQ4 B;  3HNM A;  4UAP A;  3ACH A;  1JU4 A;  2W1W A;  4PQQ A;  4KMQ A;  1J84 A;  3A21 A;  2J1T A;  3EYP A;  3VDC A;  2ZEX A;  4MGQ A;  5EJZ B;  5EIY B;  2RV9 A;  2W91 A;  3A22 A;  4D0Q A;  2ZEY A;  2B4K A;  2VMC A;  3T2P A;  4DXS A;  3VDA A;  1UWW A;  4P08 A;  2WNO A;  2BBA A;  2WN3 A;  1PX4 A;  2JDA A;  5HPO A;  2BGP A;  3NJX A;  4LOR A;  5G04 L;  1IQD C;  4DUX A;  4MAD A;  4ARX A;  2VZQ A;  3A7Q A;  3HNB M;  3HN3 A;  3I2H A;  4JX0 A;  4LQR A;  4CUB A;  1GU3 A;  3POF A;  1H6X A;  2W87 A;  4LHS A;  2VL4 A;  4JHZ A;  1XPW A;  5LA0 A;  5I0D A;  4D8M A;  2EIE A;  3WSO A;  3UET A;  3FN9 A;  1UYX A;  5G05 L;  4DXT A;  5JXG A;  1O59 A;  5EJ1 B;  1XNT A;  1DLC A;  3DYO A;  3WNO A;  3MV0 1;  1PX3 A;  2R7E B;  3J7H A;  5IHR A;  2WUH A;  3WQB A;  4DEV A;  5DQ0 A;  4JKM A;  2VZO A;  3FL7 A;  4BJ0 A;  3BGA A;  5DN2 A;  3OBA A;  1JZ4 A;  1ULP A;  3I2F A;  4AAX A;  1JZ5 A;  4XZU G;  3I3B A;  3UES A;  4E8C A;  2VZR A;  1KEX A;  1W9T A;  2W5F A;  5LCW L;  4XUP A;  3P6B A;  3DYM A;  1JZ3 A;  1NKG A;  3WNN A;  3W5M A;  2KD7 A;  4OYU A;  2E26 A;  2VCC A;  4A3Z A;  1UMH A;  2VQU A;  3FHA A;  2W1Q A;  4CU7 A;  2DCJ A;  4LOS A;  4LMF A;  2QQJ A;  2Y64 A;  2W94 A;  3MUZ 1;  2WO2 A;  1TVG A;  1UXZ A;  4MGS A;  4QPW A;  4QX2 A;  4P5Y A;  2VJX A;  4OMC A;  3OGV A;  5B4X A;  2V5D A;  2Y6K A;  3BN6 A;  3IAP A;  3NJV A;  2Y6G A;  4XUT A;  2YC2 A;  1GUI A;  1UY3 A;  3I2G A;  2E32 A;  4Z2A A;  4QDQ A;  3WEZ A;  2L9L A;  2Y8K A;  3WF3 A;  1CZT A;  4M4R A;  2CDO A;  4OZO A;  3E1F 1;  4QDS A;  4QDR A;  3PUI A;  5F7U A;  4XUR A;  3I3E A;  2Y6H A;  5JMO A;  2EID A;  4ZY9 A;  3OG2 A;  3MBW A;  1DYO A;  3NNG A;  1OD3 A;  3OB8 A;  1JHJ A;  4KWU A;  2WZE A;  2VCB A;  3C7O A;  2J1U A;  4LPL A;  5LA2 A;  3SKJ E;  2W95 A;  3VD5 A;  4E8D A;  3POE A;  3ACG A;  5HXM A;  3CMG A;  5CIS A;  2J7M A;  4UOJ A;  4YPJ A;  2VZS A;  1GOH A;  4W4Z A;  4PF1 A;  5CKQ A;  5FUI A;  5C7G A;  4RN5 A;  2QQM A;  2W47 A;  1F4A A;  2E33 A;  3K46 A;  4QB2 A;  1SFP A;  1JU3 A;  3MV1 1;  3VD3 A;  1GOG A;  1R64 A;  2JKX A;  5DMY A;  2ORX A;  3LEG A;  1LNS A;  2HYX A;  1NZI A;  2ORZ A;  2WZ8 A;  4L0P A;  3WF0 A;  4QX1 A;  4BDV B;  4GWJ A;  4A41 A;  3ECQ A;  2ZXQ A;  2X09 A;  1WCQ A;  3I2K A;  5IJR A;  1SZB A;  3MUY 1;  4P00 B;  2W3J A;  5JR2 A;  3OGR A;  2C9K A;  2ZEW A;  1SPP A;  3VD9 A;  3T2O A;  5DPN A;  3CDZ B;  3K77 A;  1W8O A;  3OEB A;  1F4H A;  2VZ1 A;  3IDA A;  5JUV A;  3NRU A;  1OF4 A;  2XQX A;  2VMF A;  4XUQ A;  3T08 A;  3A23 A;  1K42 A;  1W8N A;  2J1S A;  3VD7 A;  3HEI A;  3GXU A;  1UY1 A;  4CU9 A;  2J1A A;  1K3I A;  3T0B A;  1OT5 A;  3VD4 A;  4AG4 A;  1JI6 A;  1CZV A;  3GDB A;  4ZXE A;  5IYY A;  3MO4 A;  4OMD A;  1BHG A;  1HN1 A;  3HJR A;  3POB A;  1W9W A;  1SHW B;  4CVU A;  2LS6 A;  1EUT A;  3I97 A;  3D3A A;  1KGY A;  2LW8 A;  2VOT A;  3I3D A;  2WAO A;  4HG6 B;  3POI A;  1UYZ A;  3W5N A;  2WYS A;  4A45 A;  1GNY A;  1CX1 A;  2XON A;  3T09 A;  3LPG A;  4OUE A;  1UY0 A;  3THD A;  1W99 A;  3WNK A;  4ZZ5 A;  2EIC A;  2W92 A;  2OKX A;  4UI9 L;  1JZ2 A;  1JYW A;  5CKN A;  5CYY A;  1TG7 A;  3ACF A;  4KI5 M;  2Y6L A;  3ZM8 A;  1XNA A;  3P1I A;  3CZU A;  3CQO A;  3GM8 A;  1NUK A;  2QBX A;  1OF3 A;  4BK5 A;  3JXS A;  2YFZ A;  5LA1 A;  2V4V A;  5IFP A;  3POJ A;  4QX0 A;  5CKM A;  3LQC A;  3LEK A;  2WAB A;  2QQK A;  1UZ0 A;  4GZ9 A;  1YQ2 A;  1DP0 A;  1L7R A;  2VC9 A;  2WN2 A;  3GGL A;  1SPP B;  3WF1 A;  3LPF A;  2J22 A;  3SKV A;  4CUA A;  3WNM A;  3C8X A;  3FHQ A;  5JXH A;  2VQT A;  1JYX A;  3T0D A;  2QQN A;  5J1X A;  4TTG A;  3LE0 A;  1SDD B;  3DYP A;  1OH4 A;  1P8J A;  2ID4 A;  3THC A;  1GOF A;  3K4Z A;  3K4D A;  4ET7 A;  2WAA A;  3K75 B;  2Y6J A;  2QQI A;  4QB1 A;  1PMJ X;  1ULO A;  1NAE A;  1US2 A;  2W9X A;  4A44 A;  1JYN A;  4BXS V;  1UMI A;  2C4X A;  3III A;  2YB7 A;  2J1E A;  1D7P M;  3IAQ A;  3PUH A;  2WBK A;  2JD9 A;  3I2I A;  4QX3 A;  2RVA A;  2YG0 A;  2BZD A;  4P02 B;  3AC0 A;  4CU8 A;  3POG A;  2X05 A;  1L7Q A;  1UY2 A;  2WDB A;  4M4P A;  3C7G A;  3DEM A;  3WF2 A;  2VZT A;  3T0A A;  1WKY A;  4ARY A;  5CZK A;  2VM9 A;  3T2Q A;  2XOM A;  3SEP A;  1JZ6 A;  4W50 A;  4DEQ A;  3F2Z A;  3DEC A;  3LEI A;  5B4N A;  2YFU A;  2RJ2 A;  1SG3 A;  2BER A;  3UNP A;  4FI9 A;  5JXJ A;  2VCA A;  1EUU A;  4XUN A;  4CUC A;  4MOA A;  3WF4 A;  4CU6 A;  4JKL A;  2DCK A;  3OEA A;  4W8J A;  3C7H A;  4A6O A;  5IFT A;  4LOT A;  1K12 A;  4DXR A;  3ACI A;  1T2X A;  2Z4F A;  1JYV A;  1H6Y A;  1UXX X;  3U37 A;  3ABZ A;  3WNP A;  1US3 A;  2VTF A;  3CIH A;  2W46 A;  2VMD A;  3EB7 A;  1RYY A;  4DUW A;  2QQL A;  5JXI A;  2W1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...