2QQKA

Neuropilin-2 a1a2b1b2 domains in complex with a semaphorin-blocking fab
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
568
structure length
541
Chain Sequence
PCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVYAPEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSMLYIKFTSDQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDLYDWLDIWDGIPHVGPLIGKYCGTKTPSELRSSTGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEWSPSAARLVSSRSGWFPRIPQAQPGEEWLQVDLGTPKTVKGVIIQGARARAFVRKFKVSYSLNGKDWEYIQDPRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural studies of neuropilin/antibody complexes provide insights into semaphorin and VEGF binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Neuropilin-2
total genus 122
structure length 541
sequence length 568
ec nomenclature
pdb deposition date 2007-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00431 CUB CUB domain
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2qqkA03
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2qqkA04
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 2qqkA02
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 2qqkA01
2VCCA 4CUBA 2W1QA 3AC0A 1CX1A 3CZJA 2YC2A 5DPNA 2W9XA 1UYZA 3W5NA 3THCA 3POEA 3K4DA 2QQJA 1O59A 5IJRA 3IAPA 4XUQA 4MGSA 3HEIA 3CQOA 2VM9A 2DCJA 4A41A 4A45A 2Y6JA 3ACHA 4ARYA 3HJRA 2QQOA 3T08A 1GU3A 3OB8A 4AAXA 1UXZA 2WBKA 4KWUA 3GDBA 2W87A 5C7GA 3T0AA 3C7HA 5JXJA 3GXUA 3WF4A 1UWWA 5LCWL 1PX3A 4JKLA 2J1AA 2J1TA 3U37A 1L7QA 1DYOA 1XNTA 1JZ7A 1OH4A 4MO3M 1WCQA 1JYNA 3MV11 2E26A 3E1F1 4PT6A 5C70A 3VD3A 5G05L 1JYVA 4JX0A 2RVAA 3NJVA 4JHZA 1OT5A 4P5YA 2ORZA 2VTFA 2W3JA 4P02B 2LW8A 3K77A 1JU3A 1GOHA 2VMFA 4OZOA 4XUPA 1JU4A 1XC6A 2J1SA 3POBA 2ID4A 2VZSA 1I5PA 2JE8A 4A6OA 2W91A 1J83A 1K45A 2QQKA 4P00B 1SHWB 4L0PA 1JZ2A 1EUUA 1GUIA 2WO2A 2BERA 4A4AA 3P6BA 2V72A 3HNMA 4QB6A 4LPLA 4XVHA 3SEEA 4BDVB 4QAWA 1UYXA 2WNOA 4ZZ8A 3HNBM 4CU9A 2VZRA 2Y6KA 2WQ8A 4PF1A 4LKSA 2BBAA 1W8NA 4LQRA 3K4AA 1SZBA 3WF3A 3OGSA 2VR4A 4KMQA 3FL7A 1GNYA 3UETA 1CZVA 1H6YA 3C7OA 4CU8A 4ZY9A 3GM8A 2LS6A 2QQNA 3JXSA 2YB7A 4RN5A 4DXSA 1JI6A 5JMOA 3WF1A 2BGPA 5JR2A 3DYPA 2E33A 4RYDA 4XUNA 1PMJX 4A42A 4QDSA 1ULPA 5B4XA 4YPJA 3IAQA 2C26A 4CU6A 1R64A 1GQPA 2WN2A 3I2KA 3HOBA 2RV9A 4A44A 2VL4A 2ZXQA 3POFA 2WO3A 3MO4A 4QX0A 4DXTA 3ABZA 4QX2A 2ORXA 3ZM8A 2E31A 4Z2AA 2B9VA 4LHSA 4UI9L 2Y6HA 3I2IA 4UAPA 5JXHA 3ACIA 1NUKA 1GOGA 5EJ1B 1KGYA 3A7QA 2W5FA 1UY3A 1GMMA 3KQ4B 4QB1A 5EIYB 2VQUA 1UY1A 2Y64A 2ZEWA 1OD3A 5CISA 2W95A 2XQXA 4QB2A 3UNPA 3IDAA 4GWIA 2XONA 3A23A 1K42A 2YC4A 1W9WA 4M4RA 3BN6A 3I2JA 3OEAA 2VZUA 2V4VA 1NZIA 3WF0A 3LPFA 2XHNA 4CVUA 2EICA 4DEQA 3I2FA 1UY0A 3HPNA 3NRUA 2VOTA 2X09A 5HXMA 2VC9A 1JZ4A 2VMDA 5JXGA 2RJ2A 3SEPA 3ETPA 4P08A 2C9KA 3IB3A 3WNOA 2L9LA 3MUZ1 3WNKA 5JXIA 3C8XA 1UMHA 3LE0A 3CKHA 2VZOA 1RYYA 3T0BA 2E32A 4DEVA 3DECA 1TVGA 4MOAA 2J1EA 2ZEXA 3LEIA 1JZ5A 1SPPA 1UY4A 3CMGA 1JZ3A 2CDOA 1LNSA 2WAOA 3VD7A 3FN9A 5C71A 1W9SA 3PUHA 5CKQA 5HPOA 1JZ8A 1PX4A 2X05A 5IFTA 4CU7A 1F4HA 1F4AA 5IYYA 2Y8KA 3CIHA 3I3DA 1DP0A 4XURA 1IQDC 1BHGA 3POJA 2VZVA 1P8JA 3T0DA 3EB7A 4ET7A 3ECQA 1DLCA 2WAAA 2WDBA 1W99A 2W1UA 3A21A 4CUCA 4E8DA 3I2GA 4ZZ5A 5B4NA 3WSOA 2W92A 2WYSA 3K75B 4TTGA 2PQSA 4E8CA 2Z4FA 3UESA 3OGVA 5J1XA 1T2XA 1W8OA 3MV01 2C4XA 3A22A 2XOMA 2B4KA 1UY2A 3NNGA 3WEZA 4OYUA 3WQBA 1OF4A 4W4ZA 3DEMA 1JHJA 3W5MA 5DQ0A 5LA0A 4UOJA 4W8JA 2J7MA 3THDA 1UMIA 3OGRA 2VJXA 3HN3A 1SPPB 2W1SA 1UX7A 2EIEA 3LEGA 2WUHA 3I2HA 1CIYA 1CZTA 1W9TA 3ACGA 3IIIA 3T09A 1US3A 3VD9A 1XNAA 1NT0A 3DYOA 4LOSA 2W94A 4OMCA 4FI9A 3GGLA 4BK4A 2WABA 4XUOA 5LA1A 4DUWA 1O8SA 1XPWA 2VCBA 3K4ZA 1SDDB 2JD9A 2VMCA 4M4PA 4PQQA 3T2OA 5DN2A 2BGOA 3I3BA 2YG0A 2VCAA 4AG4A 2ZEZA 5CZKA 5I0DA 2YFZA 1JYWA 3SKJE 4GZ9A 5FUIA 1US2A 4JKMA 1D7PM 2W46A 4QDQA 2QQMA 2QQLA 3OEBA 1OF3A 1PMHX 3VDAA 4ZXEA 5CKMA 2JKXA 3D3AA 3NQHA 1K3IA 3VDBA 4XZUG 3FHQA 4W50A 4DUXA 5LA2A 3NJXA 2Y6GA 2QBXA 2WZEA 2VZ3A 3I97A 1KEXA 3WF2A 4XUTA 3CDZB 1TG7A 4OUEA 1UYYA 2WO1A 2Y6LA 2VZ1A 3OBAA 1O8PA 5G04L 1SFPA 3FHAA 4BK5A 4A3ZA 3VD5A 1SG3A 3K46A 3PUIA 5JUVA 2EIDA 3I3EA 1NAEA 3CZUA 2VO5A 2CDPA 1EUTA 4JKKA 3WNPA 1NKGA 4D8MA 2J1VA 4DUVA 4CUAA 4BXSV 2DCKA 1GOFA 2HYXA 3WNNA 1H6XA 2EIBA 3VD4A 5F7UA 5DMYA 3T2QA 3F2ZA 2WZ8A 4ARXA 3T2PA 1JYXA 1L7RA 4OMDA 4GWJA 2V5DA 2JDAA 2X10A 4HG6B 2WN3A 2VZQA 3POGA 3C7EA 2R7EB 2HLEA 2OKXA 2YFUA 2J1UA 5IHRA 4QX3A 2DDUA 1JZ6A 4MGQA 4LORA 4QX1A 3HNYM 1W0NA 4BJ0A 5CYYA 1ULOA 4TXWA 1UXXX 4KI5M 3SKVA 4DXRA 2QQIA 1HN1A 2W1WA 2VMEA 3J7HA 4LMFA 1NX9A 3VDCA 3OG2A 2J1RA 1UZ0A 5EJZB 4D0QA 4QDRA 3LEKA 1YQ2A 5A1AA 4QPWA 3MUY1 3WNMA 3BGAA 3EYPA 1WKYA 3POIA 2VZPA 3LQCA 2W47A 3ACFA 3MBWA 2KD7A 5IFPA 4MADA 1CZSA 2ZEYA 4IUGA 3C7GA 3DYMA 1K12A 4LOTA 5CKNA 2VZTA 3C7FA 3P1IA 3LPGA 3WNLA 2VQTA 2J22A 1MPXA 1J84A 2BZDA
chains in the Genus database with same CATH superfamily
2UURA 1H2NA 2VCCA 2D43A 5FY7A 5KHIA 1X50A 2W1QA 3SMHA 3CZJA 2AENA 3OBRA 1HRI2 2YC2A 5DPNA 5SV5A 3SHRA 5FZIA 2BVBA 5HXVA 3SQOA 1AR62 4FTEA 4JGZA 2YDEA 1X33A 4XQWA 1ZZ7A 5T54A 3CQOA 4CCCA 3PL0A 1VALA 2DCJA 4UFHA 4A41A 4BLJA 1O3RA 2QFEA 5APAA 3ZMOA 4XTMA 1ZBA1 1VB2A 2RS31 3ACHA 4S2HA 2Z79A 3B7MA 4Z07A 4ARYA 1KITA 2QQOA 1ZA7A 4Q8LA 5FLHA 3WP3A 2VUAA 4QQHA 4YRDA 3I2OA 3T08A 1W9YA 2ZMLA 5EV7A 1QNWA 1CX4A 3FLPA 4XFHA 1EPWA 4QHZA 2WO7A 3WX5A 1QF3A 3NNFA 3GDBA 3PU3A 4CSWA 1AXYA 2VQ0A 1AR82 5HI0A 5J7MA 5J98B 2WZR3 2WFF3 3GBWA 4GH4B 4NHXA 3WCRA 4CCOA 1HB3A 3T0AA 3IDBB 3U78A 3C7HA 5CG8A 1O5LA 4JKLA 4AI8A 2NZ9A 2VOXA 1MVEA 1XNTA 1K5MB 3B9IA 4MO3M 4MGTA 1IG0A 3KWVA 3AVSA 3SH5A 1WCQA 1QXPA 1O3SA 4A6SA 1SLAA 4HK8A 1M4WA 4QXBA 4PT6A 1PO12 4CA9A 5C70A 1O3QA 4UF0B 3ES4A 3RS6A 5A3TA 2XL7A 4IDZA 2VTFA 3KLSA 4P02B 2A3XA 4HKLA 1UIKA 1YO8A 5ERLA 4AYUA 3SISA 1YQ6A 4A7ZA 4CCJA 5J3UA 4HSLA 1A78A 4BLIA 1HJFA 3N7MA 4HVRA 2O0OA 1ZVFA 3M3OA 2CSGA 4LK7A 1XC6A 2WWSA 2ID4A 1I5PA 4MHRA 5F5IA 4RS5C 1W8HA 2JJ6A 3AL6A 3Q8AA 4NWWA 2V4AA 1JZ2A 4UF0A 1GUIA 1LOFA 4DXZA 2D5HA 3LKJA 2VQAA 2BERA 2DURA 4QQ2A 3VZNA 3ZKYA 4AI2A 1W6OA 3GBFA 4K1YA 3HNMA 4KG8A 1RUC2 2C5DA 1HB4A 4LPLA 5JI9A 4AI3A 1W8UA 2P5BA 4XQ4A 2RM22 3VKOA 4LBOA 4ATFA 2WNOA 3TN92 4BDVB 4BWOA 2R0HA 4Z8BA 4CU9A 1GNZA 1RMU2 1SLTA 1WGPA 5FZOA 2Y6KA 4EWDA 4NIGA 2JG8A 3UGGA 2GH2A 1W8NA 1SZBA 3FFQA 3OGSA 4ISQA 3WUDA 3HWJA 1IZ3A 3USUB 4N43A 1CZVA 4AWDA 3B01A 1H6YA 1YYNA 1WMXA 2WSVA 3GM8A 3HQRA 2YB7A 1JI6A 2BQPA 4V2WA 5DABA 3ASIA 4GMP1 3Q8FA 3Q8CA 4LKDA 2WSUA 1RB8G 2ZPXA 3W21A 4FPJA 4EE2A 5GJ6A 1WD4A 2HEWF 3S7IA 4A42A 4BPZA 1R1ZA 2D6KA 3N3HA 3RRDA 1K5JA 5DUUA 1DDLA 3DF0A 3ZOIA 1C8M3 1Q56A 2ILMA 3KZ4C 2ARXA 2KA3A 5K4LA 2RS32 2WNUC 2Z69A 1ZBA2 3H1MA 4CXYA 1AYM1 5DDJ3 3BVCA 1DF0A 4DY5A 5LK7B 1JBCA 4CPBA 1Y9QA 2WO3A 4DXTA 2R071 3N9MA 4QM9A 1NCQC 2R061 4Q0PA 2O8OA 1I6XA 4XQDA 3ABZA 3NL1A 4QX2A 4JRAA 4XBNA 2E31A 2OPKA 4CP9B 3VV1A 1W6MA 4HT1T 3B94A 2GC3A 4UI9L 1YHFA 5KXEA 1X7NA 4RR3C 4WM8A 3VKNA 1SLCA 1VBE1 1ZYBA 4QQLA 3BTXA 1IPSA 1F9KA 4QGLA 3H3LA 3MIDA 3AMHA 1SACA 5CVRA 2ZX1A 5LATA 2CL2A 3WR0A 2JWPA 2PQQA 3JZVA 1IGOA 2HWB1 3N35A 1CJDA 4A3XA 2RR12 3L2YA 4WV8A 3MICA 5A33A 2PELA 2YHJA 4XDQA 1N3OA 1OLMA 2VQUA 5FZKA 2ZEWA 3ORJA 4KU7A 3HMYA 4RGKA 5AC92 3U4XA 5EHDA 3WHTA 2ZS6B 1RUOA 3IDAA 1AYN2 1LOGA 2XONA 1XNCA 1K42A 3PVEA 4IV3A 3VZJA 4LNVA 1TQ5A 4JC1A 1WBLA 2F17A 3ZFEA 2WL1A 4RSUA 3A4UA 4M4RA 1HRI3 1FMD1 5E6HA 2VZUA 3BUCA 4R8HA 5LASA 5FY9A 2XHNA 3WG3A 2OUJA 4CVUA 2X8KA 5FLJA 3I2FA 4FFHA 4DEQA 4TYSA 2VGDA 2DTYA 3VBFA 1DGRA 3JB8A 4DPNA 1CAXA 1QMJA 1XE0A 5KXCA 2VOTA 3AM2A 5HXMA 2VU9A 3LIHA 2VMDA 3JQWA 1KXGA 1VRBA 1RUJ3 2WNEA 2BV4A 5BNNB 1XU2A 2EXKA 4LR4A 4OVEA 4P08A 2DWRA 4FO9A 3GZAA 2L9LA 5FXVA 1UMHA 4I09A 2W2IA 5F39A 1TME3 5A6QA 4G4FA 3PVNA 4K8FA 5H9PA 3VDDA 3B5LB 2EXHA 5C6CA 1GV9A 1OXCA 1IPKA 3TNQA 1RYYA 3PTYA 4RFT0 5ISLA 3ZSMA 3P3NA 3AP4A 4XILA 3WOGA 1YC61 4CDWA 4FOVA 4N53B 3UV9A 5K8SA 2GSYA 4XJUA 2HWD3 2CDOA 2CGPA 4AR2A 1LNSA 5HV0A 5C71A 3RI9A 1ULFA 1W9SA 3PUHA 5CKQA 4BQ1A 2MEV1 3SCHA 1WCDJ 1B09A 1OPMA 4IEXA 4N9HA 1W0PA 1D0HA 1F4HA 2A75A 1F4AA 2JG9C 2RM23 3DXUA 2W52A 4ASLA 5IYYA 1RUD1 4NIHA 1NLRA 3CIHA 3LDRA 4OULA 1YQ8A 1MZEA 2JE7A 3N9QA 2PHTA 1F5FA 2XL9A 4HN0A 4XURA 3O1RA 4HFSA 3R05A 3O1OA 1P8JA 2J42A 4RS5A 2RS52 3GCXA 4I01A 4XF3A 3ECQA 4HOOA 1DLCA 3D8CA 5LBEA 3AXEA 4EV0A 1WW5A 2W1UA 1H1IA 4COUA 2CGOA 5BNOA 2OIIA 4E2GA 4IW3A 1BEV1 4D69A 1XYNA 2ZGQA 1DGWX 4ZZ5A 4W6YA 3MPBA 3WSOA 4PF5A 3KB5A 3VHOA 3GZEA 2HWF2 3BIWE 4Y1XA 2P6CA 1HN0A 4AF9A 2PQSA 2FZ1A 5FP9A 1V6IA 4AQSA 5F2SA 4ASKA 2BPA2 1UIJA 1VBB2 4Q5OA 5M0TA 3OJBA 5JOYA 3T3YA 5J1XA 1T2XA 3MV01 1FOD3 1W9FA 5IVBA 5FY1A 3J26N 4PLMA 3J7MA 4UW4A 1SFYA 4XCAA 5BNPC 4NPRA 3WQBA 3VZMA 2VW1A 1MS3A 5GLWA 4NMIA 1LCLA 4Z1VA 3W5MA 4KU8A 2QQWA 2R041 5A3PA 3WUCA 4META 2J7MA 1ALYA 2BVVA 5GZFA 3AMNA 4UFKA 4Q4V1 2DCYA 5A7WA 3THDA 4H7MA 1OOPB 1G9BA 3ZDSA 1WD3A 2W1SA 1DQ6A 3HR9A 2A6WA 1MS8A 1UX7A 1POV3 3MLJA 3JB4C 5FYUA 4IV3B 1H2MA 2WUHA 2OUHA 3L9JT 1AR93 2VMIA 4IEQA 3VBHC 3N9OA 1HRI1 1COV3 3UYJA 5F3IA 3T30A 5F3EA 5FIXA 4FI9A 2FMYA 3GGLA 4KQ7A 4R4ZA 2WABA 1Y9GA 3LAGA 5FYZA 4XUOA 4AZZA 1E5HA 4BK4A 1O8SA 4K7JA 4RR3A 1XPWA 1VPHA 1G9AA 1SDDB 2O1QA 4NVPA 2GC1A 4HN1A 2BFUL 5T5LA 5C3SA 5IK5A 3DV8A 5DN2A 2VBDA 1DYPA 2Q1MA 4S2FA 5AC91 2VOWA 2FDFA 4GAZA 3CLPA 2RS33 3IZOA 4KH9A 4AFMA 2FDGA 4IE4A 4NE9A 1JODA 1OUXA 4IXLA 5CZKA 4XBLA 5FZOB 1Q5OA 2YFZA 1TME1 5K9YA 4LT5A 2XJSA 2BOJA 5FZHA 1WMEA 1NXMA 4QDQA 4ORFA 5A7SA 4Q4V3 3ZSKA 2QQLA 3OEBA 1OF3A 1XQNA 2WNUB 4X8NA 3LSDA 3VDAA 4B29A 1EPZA 3B93A 3MIFA 2Y33A 3KF3A 3RDIA 5KWRA 1OQDA 2BWAA 5IVVA 4N8MA 2WC2A 1VE0A 3Q9OA 4LBMA 4MGIE 3RYPA 5C8WA 2Z2SB 1POQA 3GJBA 5LA2A 1C8M1 1BKZA 4CEWB 5BNNC 3HVDA 2IXIA 4UXAA 1BMV2 1F8VA 5DAQA 4X6RB 4YNIA 5LZ6A 3O0WA 2OQ7A 3CDZB 4ZU5A 4OUEA 4BZ4A 3B69A 5DUVA 4DFSA 4U2AA 4BMEA 2R073 3KV4A 2WNUA 5LEJA 1O8PA 5GLTA 1HDKA 3CJIC 4QPGB 1H8TA 2WRAA 2A1XA 2XBO1 3VD5A 1G6NA 4E2QA 4JTNA 4M00A 1FX5A 4AEDA 2BNMA 2ZCWA 1V9U1 1MQTC 1OHFA 3EQEA 2ZHLA 3K46A 3NNMA 4Q26A 4XZPA 5ABJB 5GZCA 1BXHA 3KSCA 4YGBA 1AX2A 1I3HA 1KQRA 1LHOA 1NQJA 1NAEA 3CZUA 1UPIA 3MZHA 2PHUA 3AB0A 1KFXL 1RUF3 2CDPA 2XG3A 3POSA 4FPCA 2AUYA 1CD3G 1V6JA 1O5UA 4D8MA 2J1VA 1C1LA 4CCMA 2ARAA 3BPZA 1W6NA 5A7NA 5FLIA 4CUAA 2YZ4A 2ZGSA 3DUIA 1PHMA 1RUC1 3MPPG 2P4EA 3ACLA 2QQVA 4PIZA 2Z42A 1ZZ6A 3DKWA 3ZXDA 3BODA 1GZWB 5F32A 1VBB3 4YZ4A 3AKPA 4QU1A 5F8PA 4AEMA 5F7UA 2OXBA 4PLOA 3T2QA 4AQTA 4LKFA 1CAVB 2XBO2 4QXKA 5HV4A 2V5YA 4OFGA 1OSGA 3T2PA 2NLRA 1VB4A 1XYOA 2V5DA 1LOCA 2ENRA 3HQUA 1J59A 3PNAA 4BH9A 3MYXA 3FX3A 3N9LA 3IDCB 1ZA4A 1C8M2 1PZ8A 1JZ6A 3N36A 4AW7A 4IEYA 4C8DA 1YI9A 2DV9A 1GZWA 1C5IA 4CEYA 4BQXA 4Q4Y2 3KV5A 2WYFA 2WZPP 1ULOA 4X8PA 4MHUA 2W0XA 5FXZA 5FP3A 1UKRA 1ZZCA 2JDNA 1RINA 1HN1A 4M0NA 2W1WA 4RHV2 4D7TA 2D6OX 4NRMA 1ZREA 4LEJA 1UYPA 3I7DA 1NX9A 1JTZX 4GALA 1V6LA 3OG2A 1XXNA 4YW3A 3V56A 1QJX1 4IE0A 1LAJA 4YVWC 1PIV1 5EJZB 2FCVA 4D0QA 5CFDC 4LBQD 1VAVA 3BGAA 3LD8A 4AEJA 3POIA 4DS0A 3CHXA 1KJLA 1RMU3 3LB9A 5FY5A 3VL9A 1J1LA 1MEC1 1D0GA 2DU0A 4NRQA 4MADA 2XH6A 1CZSA 2AZ5A 4XETA 4GB31 5FZ7A 1BLZA 4IESA 5FYCA 1WWYA 2ZHKA 1UW8A 1V6OA 4CCLA 5L36A 1ZRDA 2VZTA 4AQ6A 3C7FA 4AE2A 2C9AA 3OY8A 1ZBE2 4XF0A 3BCWA 3ZFFA 1ND2B 2VQTA 3THTA 4JDNA 5FUPA 3J8F2 3GZUC 4JVAA 2RDRA 2BZDA 4HPKA 4XXPA 4Y1UA 4PJYA 2EVXA 5F2WA 2GN7A 2XVKA 1TMF2 5FV3A 5I8SA 3RPQA 4CUBA 4AGGA 2W9XA 3IPVB 3MEPA 4H55A 4D6RA 3THCA 3JUUA 5FZ9A 3POEA 4DXRA 5I0SA 1DQ4A 2QQJA 3K4DA 1O59A 4URTA 1OA3A 2QTWB 1RUH1 2PYTA 3BYWA 4XUQA 3A0KA 3OOXA 3HEIA 3EBRA 5HCFA 1D4VB 2UWCA 3ALQA 4A45A 1PVC1 4GKXA 4CZSA 5CFCA 1DFQA 3PMEA 2VXJA 4A7KA 3HJRA 5KHKA 1NYWA 2OT7A 2A5ZA 1V00A 2Y0OA 3V64A 2P3JA 4IE6A 3T1MA 5FR3A 4RFRB 4AAXA 4Y1ZA 4CDUB 3WP6A 5F37A 1VBE3 4SLIA 2GMEA 3NKTA 1RMU1 2I2SA 4Y26A 4Y5Z0 4B1MA 4AVCA 4NIAA 3DPRB 5CU1A 5CB7A 1CIWA 1WMDA 1YEWA 3ZYFA 1LKNA 4DNYA 2PAMA 1CAWB 2FDIA 2OZJA 1MZFA 3ES1A 5LCWL 1RUNA 3O0XA 1UQXA 3NKGA 2GP3A 4CP0A 4AVVA 3D0JA 2J1TA 3U37A 4L9BA 1L7QA 1NCQA 4Y20B 3HT2A 3VZKA 3KS7A 2F4LA 4K8RB 3I4IA 4IQPA 1JYNA 3UGHA 3MV11 2B9UA 4NO4A 1W3VA 2RMU2 3O1TA 3E1F1 5JI7A 1LR5A 4Z92B 5JDBA 4S2GA 1JXNA 2WJSA 4CDWB 4LA3A 4GMP3 4E9KA 3NV3A 4W6WA 1JYVA 1DCSA 4CYDA 2GH8A 3BALA 4WVMB 2ORZA 1H8TB 1SCRA 1RUE3 3UKTA 3K77A 1JU3A 4Q27A 5E8AA 5A3UA 4OZOA 1X82A 2FCTA 4I3PA 1LGCA 1WA4A 4HK9A 2WQZC 2QZ2A 1DQ2A 3AKQA 5A3LA 1LULA 1PZ7A 1N1VA 4M3CE 2ERFA 2JE8A 2VZSA 4I30A 3AK0A 4UBHA 1J83A 1L7LA 2BFUS 3RQ0A 3PDQA 1U5ZA 5KXDA 4QX5A 3I8TA 2EA7A 1MACA 4P9WA 1EUUA 1FT9A 1G86A 2VH9A 4GWNA 4EZHA 4RQPA 2JDZA 2WO2A 3OPTA 5C4WB 3V0BA 2DCTA 3ZFGB 2XPJA 3BIEA 2W39A 2EAAA 5F1RA 5IK4A 4LK6A 4HKOA 4QB6A 5LA9A 2KXLA 1MEC2 4XVHA 1C3HA 2YGMA 3TBDA 4ZZ8A 3HNBM 3PVBB 5IUQA 4WM7C 3M3QA 4GWMA 3U07A 3AMQA 1W8WA 2WQ8A 2JICA 3AXDA 2ZGOA 3J8F3 4FOYA 1IG3A 4H2AA 2HWD1 1QJX2 1NCRA 3K4AA 2RDSA 2VR4A 2Y38A 2VW2A 4KMQA 3UT0A 4CCEA 2DU1A 2XQRA 5DZFA 2JG8B 2K2SA 5FJHA 1YUDA 4KG0A 4RHV1 5C3OA 1MS9A 1QJY2 4R9AA 1WZXA 4E2SA 2GC0A 4ZY9A 2UY9A 1UN1A 1PK6B 3WW2A 3C3VA 1NY72 2D6NA 3WF1A 1VBA2 5FMOS 5JSPA 2E33A 4JZRA 4D94A 4BIOA 4Q29A 4XUNA 3TEYA 4Q4X3 4B1LA 3AKSA 4KWKA 4NRPA 5B4XA 3IAQA 3JU9A 3GF6A 2WN2A 4OUSA 1POV0 2VECA 4HZFA 2RV9A 1OOPA 1PZ9A 4YZ5A 3ZN4A 4AGRA 3I59B 1VBA1 2XLGA 1PK6A 1QKQA 2VVDA 2BBVA 2ZXQA 4QX0A 1ULEA 2P6HA 5I8YA 3LIGA 4Q4Y1 1AR72 1HX6A 3AFGA 1GZTA 2B45X 4QPIC 4WVZA 4CEYB 3NW4A 2H0VA 5TSWA 5IT6A 2PHDA 3LFMA 2Y6HA 4R9CA 5D8AA 5ANQA 5F5AA 2BU9A 2EAKA 2YC0A 4YW6A 5A3NA 1REEA 3RZKA 4GH4C 1VBD2 3AJZA 1FV3A 3MDPA 1GP4A 1GOGA 5EJ1B 5FJKA 5BV6A 3ZIXA 3NMBA 2YBPA 3ZO0B 2NYYA 1H1MA 1D4M2 4CDQC 4WZCA 1Y4WA 1X8MA 3E5UA 3OGGA 4QD2A 4CEYC 1D4M3 4C1XA 1UY1A 1W39A 1UOGA 2Y64A 3S5QA 4QXCA 4HPKB 5A6XA 4BMBA 3EJKA 3RZMA 3UNPA 1AJKA 1QJEA 5EJ3A 1IKQA 2FCUA 5IVEA 3WG4A 5DZGA 2SLIA 3WDXA 3RZJA 5EYXA 2HJIA 3RZHA 1W9WA 1MS1A 3FZ3A 3WVJA 3I2JA 1U5YA 3QBQA 4UFMA 1NZIA 2HWC3 4YYOA 4MX3A 2CTVA 4XAEA 4LBKA 1UL9A 4KBZA 1XOYA 4XXAA 3GALA 5LBBA 3ZXGA 3VUOA 5FZDA 3QH6A 4BYYA 5I8TA 1MS5A 1PO22 1M06G 1JYCA 5DDJ1 3I49A 3LFIA 2G4IA 4UW5A 2XGXA 3HPNA 4Y22B 2GNTA 5C9AB 1RUI2 4N7IA 4RGAA 2IXKA 2XLAA 4OHZA 3VBFB 2VC9A 4C0BA 1JZ4A 2D5FA 4M3CF 3SEPA 5DG1A 4TWTA 2HEYF 5JZGC 3RG0A 3IB3A 1QJX3 4TSVA 3PHMA 2DVGA 1KJRA 4IEVA 1WCKA 3LE0A 4YARA 1SQ4A 1E5RA 1EAH2 3TAYA 2WNVA 2RG4A 3CU7A 4XF1A 5GLZA 1MZ5A 4QPGA 1W6PA 2WWUA 1QJU1 3T0BA 2E32A 3MW4A 4P9XA 1FOD1 2PHRA 4GB33 2HWE3 1JHNA 2J1EA 4LBQA 2VOKA 3LOBA 4BHPA 1GICA 5KHHA 1EV12 5FYHA 2IXHA 4AHWA 1S0IA 4BOWA 1ODMA 3ZXLA 4AI0A 4I0BA 2WAOA 3SH3A 2FBEA 1OBNA 1QXRA 5L19A 4Y1VA 5HPOA 3ZYRA 1JZ8A 1D4M1 1Q8VA 5E88A 3SCFA 1ONAA 3UK9A 2P17A 5CFCC 4YW5A 1OLQA 1FNYA 1SBDA 4M3CB 3ZX7A 4CU7A 2RDQA 3IKWA 2Q5TA 1FMD3 1H8VA 1U5IA 3EHKA 3I3DA 4WBBA 5FKBA 3C2UA 1KDKA 1DP0A 5FZCA 1LESA 1RUE2 1IQDC 1BHGA 1TME2 5IVYA 2P3IA 1OLRA 1RUH2 5JIUA 1FPN1 1R091 2VZVA 4ET7A 5GKAC 4XOGA 3ZFGC 1DHKB 4X6QB 5E1RA 2W08A 1AVBA 2PMWB 4EROA 1TMF1 4COWA 1AYN3 3I2GA 2EXJA 5F5QA 5CEHA 5LWBA 4PDWC 3H42B 4NIDA 2FDKA 4GMP0 4LO6B 3TEZA 1ZRFA 1COV2 3K75B 4L8QA 3OSDA 1AR92 3D4KA 3BU0A 2YXSA 2Z4FA 1N3PA 1VBC2 4JDMA 3J7LA 3UESA 1LU2A 2CYFA 4BCUA 5J96B 2DBIA 3VHRA 1UY2A 3WEZA 2PTMA 5EWSA 2Q8CA 3WW4A 1C28A 1BBT2 1E57A 2VUCA 4LXLA 1Z7S3 2D93A 3LGRA 2WZR1 5HCHA 4Y3OA 3V65A 5FXXA 1V70A 3ST7A 1LODA 1VAKA 4W8JA 4DB5A 3KV6A 2WT0A 1AHSA 1SPPB 4ZHNA 3N9PA 2QJVA 5BNOB 3ZYPA 2EIEA 1WLCA 5AFBA 4XFCA 5FK8A 3V0AB 2LTNA 2VG9A 4FFIA 4PDWA 4QT6A 1XJAA 1XSQA 1CIYA 1LENA 1W9TA 3ACGA 5CADA 5I0RA 1N1TA 4OI4A 1RUE1 1Y43B 3INAA 3WW1A 2QQPA 2W94A 3UJQA 4QPIB 3DGTA 5I0TA 3SC7X 1TMF3 2AGSA 1ENQA 4DUWA 2TBVA 3L2HA 3GJAA 4QKNA 4M4PA 4PQQA 5DAWA 3ZPOA 3JCIA 4NAOA 1CAUB 3VBRA 1DYKA 4Q1RA 2IUWA 2AEZA 2YG0A 5FO8B 1NE6A 2VCAA 1GWKA 4GJZA 1PIV3 3I3QA 2YYOA 1S2EA 5I0DA 1PGL1 1ENXA 3JBG1 5A80A 4ES8A 5FAXA 2CNAA 4GZ9A 1JUIA 1US2A 3A0NA 4RHV3 3IM0A 2ET1A 2HWE2 1LEDA 4K40A 4PLNA 1B35B 2YPDA 4XFAA 4XJWA 4COVA 2FZ2A 3IIAA 2G9FA 2QQMA 4B7KA 1DU3D 4EZ4A 1SFNA 5FZBA 2R043 4MXVA 1RUC3 2WS91 3ZN6B 5F3CA 1PGW1 3LF7A 4ZXKA 1WBFA 5A7QA 1HXS2 2N7GA 2ZGUA 4UWDA 1KD7A 5A6YA 3D3AA 1C8NA 3VHPA 2DUPA 2IC1A 3TOJA 3USSA 3TEWA 1Y3TA 1UKGA 2JEMA 4JGYB 4W50A 5DG2A 5BXXA 4UFIA 5D8AC 4S2DA 5FZ6A 3WDVA 4DOUA 2Y6GA 1KFUL 1N1YA 5L7OC 2HWC2 2QBXA 2VOVA 1RUG1 3QCWA 2VZ3A 5J48A 3WF2A 5L73A 5FYIA 4BE3A 4TLGA 1SBFA 1UYYA 4Q4W3 3LDKA 1O3TA 2HEVF 4FP2A 4Q4Y3 2H6CA 4O65A 3P3PA 1ULCA 1W2OA 3OGJA 1S1AA 2PLV1 3MLLA 3PLQA 1UU4A 3TRSB 2BNOA 3AZYA 1AYM3 1KDMA 4OHWA 2BRTA 2A70A 1ZX5A 4Y22A 4KGQA 3WQ0A 5C9AA 2JB8A 4QXHA 2EIDA 2YY1A 3VL8A 1EYBA 1VRH1 3OPZA 5FYTA 4CE8A 2BOIA 2VO5A 4CDUC 4E4DX 1VBD3 5FK7A 4BIFA 2HWB2 4FOWA 1AX0A 2ZMKA 4N9IA 5DZEA 2Q30A 3HD8B 1EUTA 2KR2A 4TN7A 1NKGA 2XUMA 2GN3A 4OQ9A 2VBPA 1F31A 5JPNB 4OCTA 3OUJA 4YWAA 4BXSV 2HYXA 5IW0A 1H6XA 1O4ZA 2IFWA 4FFGA 4FPKA 3IT8A 2DBNA 2C1FA 1AR71 3U11A 5FQ0A 3PMSA 1HRV3 2WS93 3PUSA 5F5CA 1OKQA 5DMYA 3M2MA 2A6ZA 2WZ8A 4DRRA 4KGGA 3O12A 1HKDA 2G9GA 4W65A 4F8AA 4UW6A 4BQYA 2FD8A 1SMVA 4V2VA 5DUWA 3PIGA 1JYXA 2C24A 1L7RA 2YBSA 4OMDA 5FTTC 2F6BA 5ABJA 5KR7A 2X10A 3NWKA 2VZQA 1RVF3 1SBEA 1UPSA 1PM7A 2IVJA 4P9JA 2HLEA 5F6LB 4LULA 1A6CA 4XABA 3LOIA 2ZAHA 1BK0A 2DDUA 4MGQA 4LORA 1VIWB 1WMFA 4LIVA 3HNYM 1GSLA 4QX1A 1W0NA 5HCBA 1QOTA 1RUH3 4OHXA 4LO5B 1UO9A 4AFBA 1N1SA 4LTAA 2RDNA 1AR63 3M8LA 3HN1A 2BDRA 3BOWA 3KVAA 4NJ4A 1IKPA 1W6NB 2QQIA 2Q1ZB 4Q4V2 3USUA 2A6XA 3RWKX 3WT3A 4CDXC 1H0BA 1LB2A 1QJU3 1HIXA 3FMGA 4BISA 1OURA 5FUNA 1ZBA3 3J7HA 4I3GA 2E7QA 4LMFA 1Z0HA 1S0FA 2J1RA 4LE4A 4KNCA 1BVP1 1UZ0A 1S4CA 4AVAA 1CAVA 3PU8A 1YQ2A 5A1AA 1NY71 2YU1A 1QQP1 1WKYA 3EYPA 1XB9A 2VZPA 3APBA 4XEZA 3ROUA 2R1DA 3IN9A 1EY2A 2PHLA 1HV1A 1DGWA 4YZ1A 2QQUA 3JBG3 5FWEA 2NPIA 4WM8C 4R4XA 5CG9A 1C5HA 1RUJ2 2SBAA 4LOTA 1ZRCA 1ZBE3 4QX7A 5A3MA 4LO4B 1AL23 4WZFA 4BXFA 5CKNA 1HRV1 2E6VA 1F15A 3LPGA 4MGKE 4QKDA 3H9AA 4RQPC 3WNLA 4K20A 5T55A 1H2KA 2J22A 4MYEA 1I5ZA 1FV2A 1OA4A 3OY8B 4XJAA 3SNMA 3OCPA 4Q0SA 4AI9A 3O1SA 1J84A 1UZZA 4DIQA 4XMAA 4IV1B 3AC0A 1CX1A 2XB6C 2XXZA 4PCRA 3TN93 4N53C 5JR7B 1C4RA 3H1WA 1UYZA 3MF6A 5JOXA 1NA1B 3DCQA 4OLLA 2PXJA 2X5IB 1V9U2 2G1MA 2JIGA 5FZ3A 3BTZA 1I9RA 5FP7A 1RUI3 4NR1A 1Q8QA 1ENSA 1J3PA 2ZKLA 5FPZA 4AVSA 4L2NA 3DN7A 5AC93 1DBNA 3ITQA 2Y6JA 3G6JB 1BEV3 3NAPB 1CPNA 2XUEA 4YFWA 4Z82A 4LBJA 5LB6A 3IBMA 4B4PA 4CDWC 2UYBA 5FZLA 1ND3B 1GU3A 1F5JA 2X53S 3OB8A 4Y5SA 5T52A 1F35A 4NPMA 3IWZA 4U36A 4O7XA 2RS51 2AYHA 2ZJCA 5JVVA 2VNOA 2WBKA 3CEWA 2XJQA 4ONUA 1E5SA 4FQ4A 2A6YA 5BNOC 4ZS2A 2W87A 1UU5A 4XDPA 3BOPA 2VBBA 3GXUA 3VDDC 1UWWA 3RZGA 2JDYA 3AZVA 3PUQA 1J1TA 5F9TA 4XHBA 4QWNA 3KT4A 1Z78A 2K0GA 4LKEA 2UU8A 3JD71 1JZ7A 2G19A 2YMZA 5A33B 1OH4A 2WFPA 2ZX2A 5JAXA 3KCYA 1W06A 4K6BA 1BBT1 4SBVA 1DQ1A 5IVCA 4RL7A 3VBOA 3H1YA 2WIIB 2XWJB 4H7LA 3VD3A 1JOBA 1XNBA 2QKDA 2NQYA 2RVAA 4XFGA 1OT5A 4P5YA 2Q8EA 4AQ2A 3CNAA 1TE1B 4JV4A 4R9BA 3VBSA 3VZLA 4F83A 4HONA 2LUWA 2PHWA 3ZFFB 1ND2A 5IVJA 3N7LA 4IGPA 3VBUC 4A2UA 4QQPA 1GOHA 4CDQA 2JECA 4XUPA 5C9AC 4M01A 1UZVA 3U4SA 1JU4A 4NAMA 4OI2A 1AR91 4L92A 4MG2A 3OPWA 4KWLA 3POBA 1Q3EA 4CDUA 1B35C 4C1WA 1QH6A 3WP4A 2ARBA 3BU7A 3ZN5A 3IMMA 1CAUA 2D6PA 4IV1C 2DUQA 2D7FA 2QQKA 1SHWB 2WKKA 2X5IC 2R16A 1G9DA 4D6QA 4YM2A 1RXGA 1JOJA 4A4AA 3P6BA 2V72A 4RA0A 4INDA 1LRHA 1W2UA 2DVDA 3MGUA 3RI8A 1H9WA 4QKBA 3WV6A 4IE7A 5ANNA 3SEEA 4AAPA 4FVVA 1IS5A 4YM3A 2RJLA 1UYXA 5FQ0B 1QJFA 3W59A 4M0HA 3WD5A 4AEDB 2GNMA 3NAPC 1AUYA 1VBB1 2QUOA 2VTXA 2ADEA 4PF1A 3KHBA 1UAIA 4LQRA 4A7YA 1NOVA 4K21A 3WF3A 2R042 4CCKA 1W0OA 3FLRA 1GNYA 1QWRA 1KRIA 1OKOA 2I74A 5EP9A 2BNNA 4IEWA 4CU8A 2QQNA 5FZ4A 2JDMA 4JGYA 1ZZBA 2AC1A 2WNVB 3O14A 2IXJA 5C8CA 5JMOA 1GWMA 1HQLA 2ZX0A 4E4SA 2V73A 1ODNA 2BTVC 3AKRA 3HT1A 5JR2A 2XJTA 1R082 1NCQB 1PMJX 3U1XA 3WCSA 4AXOA 1W04A 5FFOC 4QDSA 4UFJA 1ULPA 3KD4A 4J6GA 1W6QB 2VNGA 3WG2A 3RZZA 2CAUA 4H14A 4IV1A 3ZFGA 1HB2A 1VRH2 1R64A 2HKXA 3GNEA 3MIEA 3NNJA 4QPYA 5A7OA 4XHXA 4BU2A 4EN7B 4XCBA 3HOBA 3WW3A 1YLLA 4EYUA 4A44A 2R0FA 2VL4A 3WDTA 1WCUA 2I07B 1U5XA 1YI7A 1GP6A 1XSRA 1DLLA 3KT7A 5EZWA 3POFA 5SV8A 2A3YA 3H3UA 5CFDA 2QDRA 1RUI1 1YCIA 1YFXA 2GP5A 5LBCA 1DZQA 4EN0A 3I3MA 4ASMB 4QM8A 4DO0A 3MIGA 4Z2AA 2B9VA 2CV6A 5FP4A 4URAA 3I2IA 1CR7A 1TZOA 1W6QA 1NG0A 4NIIA 1Q8OA 2E7TA 5FBJA 3BPSA 2PAEA 3ACIA 3V0BB 3ZYGA 1TNRA 2A73B 1KGYA 3A7QA 1DQ0A 2W5FA 4IGQA 5FKCA 1UY3A 3U10A 5A1FA 4OHYA 1PNFA 1Z7S1 4CP2A 2C0ZA 1K5MA 3KQ4B 4GQ7A 4QB1A 4CPBD 1RUF2 4AEDC 2R49A 4L11A 5JZGB 3ILRA 1OD3A 2WS92 4EN9B 2W95A 3VB9A 2XQXA 2Y6FA 4XW3A 4FAGA 5CISA 2B8MA 1JS9A 2QZ3A 1FAYA 1DZTA 2XJUA 5D21A 4COYA 3ENRA 4W6XA 5ACA3 4QGMA 1LJ7A 1LEMA 2PAKA 4B3NA 1Q43A 2P34A 5FZ0A 3I54A 5BUVA 3BN6A 3OEAA 3KHCA 2V4VA 5IK8A 3WF0A 4XPVA 1RUD3 3LPFA 1LTEA 2EICA 2D6LX 2ZX3A 3H0OA 4OZXA 5E89A 1FMD2 1JOPA 1S0JA 5CIRA 1WW4A 2K46A 5KC6A 3HBKA 4LHLA 5FYBA 3RWNA 3WLUA 5FWJA 1UX6A 4Z2WA 5FY0A 2XJRA 3NRUA 1AYN1 4UYBA 5JXGA 2GC2A 2DVFA 3ZXAC 1NA1A 1URXA 3RMYA 1KS4A 3ETPA 2JXAA 2ZA9A 2C9KA 3H50A 4JQRA 1Q8PA 2E51A 3MUZ1 1SLBA 3C8XA 4JGZC 4LJHA 2DTWA 3CJIA 4FBFA 3CKHA 4LA2A 1HLCA 2IZWA 3POWA 1BQPA 2ZX4A 4ZU7A 3KGZA 1OFSA 4YG6A 2Y60A 3DECA 1TVGA 2VMGA 3DL3A 2ZEXA 4CEWA 1JZ5A 1YXWA 1W6PB 2YGLA 3ILNA 4QHOA 4BQWA 1O4TA 4CTEA 5C3PA 2E9QA 1RL3A 3U14A 1UY4A 3KGLA 2DF7A 4XMIA 1GNHA 4K3UA 2PN5A 4QX8A 3P5BA 4E4HA 3BI3A 2IVIB 2RR11 3VBSC 1HXS3 2VVFA 2XLFA 4MV2A 5FYVA 1PMIA 5IFTA 2GAUA 3POYA 3ZFFC 1ZM1A 1NXD1 2CWSA 2Y8KA 2EIGA 4BQ3A 4WVWA 1GP5A 2GNDA 5ACA1 1PNGA 3THPA 3URFA 3S57A 1S2KA 2CY6A 4HKWA 1RVF2 4L97A 3D0SA 1G7YA 1YNAA 3T0DA 2MHFA 1WW6A 1PO23 1QDOA 3TYJA 3CBNA 2R30A 1J58A 3ZIWA 3VKLA 3VBOC 2QVSB 4CUCA 4Y33A 4E8DA 4IE5A 2NP0A 5ABJC 3AP5A 2R1BA 3ZFEB 2Q1FA 1PVC3 2JB4A 4I02A 4NHKA 4Y5TA 5T3NA 3WG1A 5B4NA 4WVVA 4MVTA 4YW1A 2WYSA 1OMIA 1H30A 1MZ6A 4FPGA 4OHVA 4WVMA 3VBUA 4TTGA 4BQ2A 3M4FA 4HVQA 5F3GA 2ATFA 4JTOA 4TZDA 1AR61 4QHBA 5FYSA 3BB6A 3OGVA 3IPVA 3VHNA 4N43C 2LROA 2XOMA 1GLHA 4FOQA 3VGIA 2RS11 1QOOA 1YIPA 1OUSA 1O7FA 2VNVA 1QOSA 1S0EA 1OF4A 1QDCA 4MH0E 1HXS1 3JQXA 4M3CA 4YLZA 2KM2A 4W4ZA 2OW4A 4NHLA 1JHJA 2ZGTA 1W2NA 3AX4A 1ZZ9A 1W90A 1APNA 4O9EA 4YVWB 1W6MB 3RZLA 2CWMA 4ZS3A 5L9RA 2VCMA 4EQVA 1QGLA 1UMIA 5J37A 2ZGRA 4YZ3A 4MUVA 5K0UC 2RM21 3VBSB 2I45A 3TNPB 1T6BX 2UWBA 3T1LA 2TUNA 3DPRC 4XE9A 2B5HA 1LECA 4XAAA 3E6DA 3LEGA 4DY3A 3R4SA 3I2HA 3S5AA 1MVQA 4V1PA 2H6BA 1J3QA 1W6OB 4COZA 3VD9A 2FMDA 4P9GA 3WDYA 1H1AA 3NO8A 1LHVA 4MXWA 4YM1A 5FCCA 1OQEA 3X29B 3BKZA 1VBA3 3J4UH 1IS6A 3N4MA 2ZABA 2JG8C 2YU2A 1RIRA 3N7KA 5BNNA 1OVPA 4AFAA 2WQ4A 4XIOA 1C57A 1DIWA 2ZKNA 2BEOA 3AL5A 4YGCA 1BEV2 5BY5A 3RNSA 3RJ2X 4MGZE 5LEKA 1QXJA 3AVRA 3S6PA 1KS5A 4PI2A 3T2OA 1BVVA 1Y7BA 4JGYC 5FMDA 5A3OA 2BGOA 3CJXA 3MFCA 3ZPYA 3I3BA 1VLNA 2D6MA 4JDOA 2RS13 3VBHB 5IAXA 2ZEZA 2WNVC 4ZPIA 5IWFA 3VBRB 2JIJA 3AP6A 1AXZA 3ZYHA 4MZUA 2WR9A 2EXIA 3FC0A 2CHHA 1LGNA 2NMOA 3SKJE 3J8F1 4F3JA 1JYWA 5FUIA 3O1VA 4AI1A 4JKMA 1D7PM 2OS2A 2MEV2 2D97A 4Y24A 2WLPA 1H9PA 3PUAA 3AKTA 5FY4A 1HQWA 1PMHX 2BYVE 5CKMA 4GB32 1WA6X 3PVOA 3VDBA 4XZUG 3WY6A 1ULGA 3IDEA 3SCGA 4FPOB 4DUXA 4BQ5A 1EV13 1EAH3 5IK7A 3RYKA 3NJXA 1H2LA 2ZGKA 2LRPA 5DXDA 1GQGA 2P1BA 1NA1C 1CESA 4XDOA 1OA2A 1S55A 1KEXA 2LALA 2JX9A 2YROA 4XF9A 1NCRB 3D5OA 3MW2A 2G9ZA 1TG7A 1CQ9A 2DCZA 2Z5WA 4IV3C 4XUTA 5ACA2 3OBAA 4D7YA 1COV1 3HQXA 2VE1A 5G04L 1PGSA 1OOPC 3FHAA 3ZYIB 4AHZA 4A3ZA 3ZKUA 4JQTA 3TWIA 3UKNA 1PVXA 1SG3A 1V6KA 1N47A 5FYMA 3R6SA 1A8MA 1IPJA 3BTYA 1NLQA 3TEXA 3U75A 4CEWC 4QPIA 1X9PA 5I0UA 3WHUA 1CVNA 3PUIA 3B9CA 2DFCA 2IXCA 3I3EA 1QNYA 1YFYA 2VD7A 4CXWA 1NCRC 3H3ZA 3J9SA 4HL0A 1B35A 3KVBA 4P9LA 4GA9A 1GZ9A 3NV2A 1CONA 5C3RA 2X5IA 5GALA 3WNPA 2ZGLA 4DUVA 1YJLA 1VBC3 4FAHA 3GBGA 4IEPA 2GALA 1JYTA 2DCKA 1PO13 3I59A 2HYKA 3VBFC 1QEXA 3AP9A 2HWB3 1UMZA 2ADDA 4DZGA 2EIBA 4KL1A 3VD4A 1W05A 3NV1A 4FPYA 1EV11 1VMHA 2Q8DA 1FPN3 1R093 1UZYA 4D3WA 3ZFEC 1AZDA 1ASJ3 1GBGA 1VBE2 2D3SA 4GWJA 4N7UA 3T4VA 2JDAA 4HG6B 1AR83 2ZACA 1EAH1 1UOFA 3VN4A 3ZR5A 2IXLA 2YFUA 2J1UA 5FZEA 5KHGA 1MQTA 3OYWA 2E63A 5C5UA 2R062 1RUG2 1UOJA 2HWC1 4P9IA 3ETQA 4YFZA 1R1A2 5JIAA 5C8CB 2PLV2 1BYHA 2GDFA 3LA7A 5CYYA 2D40A 3AYAA 4TXWA 1AYM2 1UXXX 1YFUA 3QLQA 1GFF2 4KI5M 1XNKA 4K1ZA 3CJIB 1RUF1 5KC5A 4ES9A 2P2KA 4G3YC 3MLKA 2VUDA 5CAZA 2ES3A 2VAUA 3JD72 2OA2A 4CCDA 1SCSA 4Q4W2 4MLOA 1ZZ8A 1WLTA 1OC1A 3LEKA 2RS53 5FXWA 2XJVA 4QPWA 3AFKA 5FMBA 3VKFC 2D3PA 3BTAA 1H4GA 4NHMA 2W47A 3ACFA 3ILFA 3MBWA 2KD7A 5FRAA 3ELNA 2E53A 5A3WA 4AVTA 2IWGB 2NMNA 5IFPA 2BW8A 2P37A 1CN1A 3MIHA 1GANA 1JUHA 3C7GA 3DYMA 1K12A 1G9CA 4XFIA 4LITA 5GZGA 4QMAA 4AEKA 3FJSA 4R52A 1LOFC 1R1A3 5FP8A 5EQUA 4D6SA 4N90A 5FY8A 3JBG2 4K9SA 3E97A 3AZXA 3S7EA 5JOZA 1U12A 3KQRA 1PGL2 1XU1A 2RJKA 2AR6A 1ASJ1 3FWEA 4NROA 3SITA 3W9AA 4YVSC 5JCTA 5FOJB 3CF6E 1W28A 5KXBA 2JD4A 1RUG3 4YG0A 3R4DB 1ZRRA 3G7DA 5JZGA 3W5NA 2XDVA 1R081 4LHNA 2HBTA 5IJRA 4FTSA 3IAPA 4MGSA 2XJPA 2VM9A 3FFZA 1JN2P 4OI1A 2DUOA 2WINB 1GR3A 4ATEA 1RHI1 4HVOA 3V0AA 1YQCA 3KM5A 1HJGA 5C8CC 1RJ8A 3RSJA 2XBO3 3LZZA 3PIJA 4R9DA 4FSJA 5CBLA 3AZWA 2XKPA 2WZR2 4LIUA 2FDJA 4DMIA 4EN8B 2R32A 1UXZA 4AVBA 1VMJA 1FNZA 2OVUA 3OBZA 1LOBA 3ZR6A 1CPMA 3OD0A 4P9YA 1ND3A 3TB0A 1QQP3 1VMFA 3OBTA 3O0VA 4KWUA 1AXKA 2VXRA 5FZMA 1NZCA 2ZGMA 3VBHA 5C7GA 4EWAA 4IERA 1LU1A 5JXJA 3AP7A 3WF4A 1TNFA 2RMU3 1ZBE1 2JDHA 1PX3A 4XFBA 2CAVA 2J1AA 5FREA 1VBC1 1DYOA 1S0CA 3AMPA 1DQ5A 3ME2A 2GU9A 3E6BA 5B2GB 3AYCA 1REFA 2E26A 3M1HA 1DGLA 3WXPA 1FI2A 4DQAA 3HBZA 5G05L 3CO2A 4Q4X1 1O6UA 3NJVA 4JHZA 4JX0A 5LW9A 3H8RA 4UBGA 1D2SA 2W3JA 1MS0A 1G9FA 5IAVA 2LW8A 1RVF1 3ZVXA 3UJOA 2VMFA 4ISRA 1CWPA 3LCPA 1RC6A 3FBMA 3RJRA 3KCXA 4ZONA 4PBPA 3OYWB 2J1SA 2B42B 3QD6A 4DRVA 1EP0A 3K48A 1RHI2 2XVGA 4A6OA 2BGCA 2ET7A 2W91A 1OVSA 1K45A 1VRH3 2ZTNA 2CU5A 4RGGA 5FYYA 3WNXA 2DVAA 1XNDA 2ZMNA 4L0PA 4P5HA 4P00B 4YGEA 2OYZA 5EXOA 2QE3A 3U0ZA 3D82A 2VW0A 4LHKA 3ZDVA 3D6EA 4C0HA 1H4HA 2OZ6A 3UGFA 1X36A 2K9ZA 5A70A 5CFDB 4Q1PA 4ZKTB 3LA2A 4QAWA 3NNLA 1REDA 1WLDA 2IFRA 2VZRA 3I2DA 3K51A 1XE8A 4UW3A 2OQ6A 3VBUB 1QJU2 4LKSA 4N43B 2BBAA 4YSFA 5AVAA 1OPOA 4BA6A 1XE7A 3FL7A 4JCKA 5E16A 3MFAA 3UETA 2NM1A 4IEZA 5C4WC 5CNAA 4Q0UA 3C7OA 2QNKA 1QY4A 2LS6A 3JXSA 3KT1A 4LO8A 5GM0A 4B4QA 1AL21 4RN5A 4C91A 4DXSA 1IS4A 5LRRA 4OQ8A 2BGPA 4Y1YA 4LLOA 1ULDA 1W3XA 3DYPA 4MSVA 2Q0AA 4RYDA 5FPVA 1R1A1 5D1IA 2VPVA 2JDUA 1PO21 4NWVA 3ZYBA 4YPJA 2C26A 3EMRA 3RVHA 4CU6A 1Y9MA 2ZGNA 2ZZQA 1GQPA 4I2OA 2VY0A 2E7AA 1RXFA 1VP6A 3FUQA 3I2KA 4L99A 5LY2A 5J36A 3M7AA 4IEUA 1D2QA 1DG6A 2PLV3 5AVPA 4FPEA 5H9QA 4C90A 2P3YA 1BJQA 1HRV2 1GWLA 1AJOA 4AFDA 3AJYA 2AH2A 3MO4A 5FZ8A 3B00A 3M3CA 5C33A 3OF1A 1RUJ1 2ORXA 4J25A 3ZM8A 3S30A 3LA3A 2RE9A 4Y4YA 4LHSA 1IHMA 3E5QA 4KWJA 4PIXA 3H7JA 4UAPA 5DUXA 2MPFA 1QQP2 4XACA 4YGDA 5L9BA 5JXHA 2HWE1 3MI8A 2PFWA 3ATGA 4JAAA 4OUMA 4QU2A 5H9RA 1NUKA 3HAGA 2YUEA 2WFF2 4DINB 3LDBA 4YG3A 1UZWA 1N3QA 1JH5A 1BZWA 3VBRC 3VDDB 5EYYA 2Q8OA 4HMZA 5H9SA 1GMMA 4H3WA 4IL7A 5C3QA 4FXKB 2D98A 4Y20A 4AK3A 4IEOA 4D7SA 5EIYB 5HBAA 2YBKA 2A6VA 4LUKA 3R0RA 3RYRA 4E27A 5IVFA 2RHPA 1STMA 3ZSJA 4QB2A 4JHTA 4N53A 3WP5A 4GWIA 2WT2A 3ZMNA 2FHRA 1HV0A 4GJYA 3A23A 1L3JA 1AR73 4PI0A 5K0UA 3MIBA 1BBT3 1VJ2A 4BM8A 2YC4A 2JKBA 4HANA 3DXTA 1RGSA 2VULA 5LY1A 3WDWA 2D3RA 2Y34A 4YM0A 3NSTA 4YW4A 1QJZA 2B39A 1ZRIA 1PK6C 2ZHNA 3UL2A 1O91A 4TLFA 1LHWA 3M70A 4B4RA 3QH7A 5CA6A 1GQHA 1A3KA 3E6CC 4FPHA 2CGNA 1RJ7A 1G8WA 4G9SB 1AL0G 1QU0A 1UY0A 3MF9A 4EJRA 3PURA 2X09A 5GLUA 2R072 3UKVA 3DKQA 5EFUA 2OPWA 4XF4A 2RJ2A 4RQPB 2ZOEB 4GH4A 4PQ9A 3ZN6A 1WW7A 3WNOA 2FDHA 3WNKA 5JXIA 3LSEA 3GHNA 1S0DA 2XVLA 3FBYA 1NLSA 1V9U3 1QHDA 3B02A 3FE5A 2UWAA 5FZ1A 3ZXJA 2JG9B 2WFF1 5JOWA 2ARCA 2BP6A 2HH9A 4XYXA 2VZOA 4AFCA 2AEYA 2HWD2 2AREA 2VNRA 2XHKA 3FLTA 3KCCA 4IGOA 4DEVA 4E4ZA 4MOAA 4YZ2A 4Q4X2 3LEIA 1SPPA 5KHJA 3NAPA 3JD73 4Q2FA 4RD7A 1SDWA 2WLQA 3CMGA 1MEC3 1RITA 1JZ3A 2V09A 4HSJA 3W58A 5FMCA 5FPXA 3VD7A 4FFFA 3FN9A 1MS4A 1VAMA 1ZNPA 2ZBJA 3AYDA 4HLTA 1ST8A 4CDXA 3Q8BA 1PX4A 2VUJA 3J7NA 4FP3A 5A7PA 2X05A 5JSOA 1GYKA 3O1UA 1X9TA 2O14A 2UY8A 4XFFA 4XTPA 2ZGPA 5FPAA 4CP1A 2WA3A 1YQ5A 3WQ7A 5L9VA 4CP9A 3TN91 2TEPA 4YVSA 3POJA 4FCAA 3EB7A 1WCSA 3FHIB 1W8ZA 3AZZA 5A7WB 4NUBA 4BQ4A 2WAAA 2WDBA 1W99A 4LO7A 3A21A 1UD1A 1S0BA 1FPN2 1R092 2VVEA 4FXGB 1RHI3 5FZAA 1OQ1A 3K3OA 4UFLA 5EPAA 4AOCA 1C1FA 2Q4SA 2EALA 3HIFA 4HXCA 2W92A 4QPGC 4CRQA 5JSRA 3O1MA 5FO9B 2H0BA 1ENRA 5JPMB 3AYEA 1MQTB 4E8CA 1BK1A 4RR3B 4GULA 1YRZA 4GD4A 2DVBA 4JRLA 5LK5A 2PA7A 1HB1A 1SLLA 1W8OA 2C4XA 3A22A 4Q0QA 3RGBA 1S2BA 2RMU1 2A7AA 2B4KA 3OD4A 2X29A 2PHXA 3NNGA 1PO11 3H8UA 4OYUA 4XJ9A 4KBBA 2A3WA 1I1EA 5A32B 1H8TC 2JE9A 1DZRA 1V6MA 5A6ZA 5FZFA 5BNQA 1ACCA 3DEMA 5L7OB 2RR13 5DQ0A 5I91A 2BUKA 2XWBB 5LA0A 4UOJA 2JDPA 4XJ8A 1UCXA 3OGRA 5J09A 2VJXA 3HN3A 2VTXJ 3OUHA 1OI6A 2W68A 1FXZA 3SXWA 5LRSA 5C4WA 3IMNA 4PBOA 5DDJ2 3ZLIA 1XBFA 4J1XA 3T09A 1CZTA 3IIIA 4AHYA 1US3A 1NT0A 1CJPA 1XNAA 3DYOA 3K3NA 4Q4W1 5FOBB 4LOSA 2HWF3 3KF5A 2JENA 4LUMA 3ZXEA 1LOEA 1PVC2 5FO7B 4I0AA 2ZHMA 3O5SA 4OMCA 5GLVA 4CXXA 4HBNA 1FYUA 1UF2C 4Q8KA 5KBFA 2F4PA 5LA1A 5HCAA 1R083 2GMPA 4FT8A 2VCBA 3E5XA 3K4ZA 3GYDA 1T6GC 3NV4A 2GZWA 2JD9A 3AMMA 2BWCA 4XIKA 5BPXA 5T5OA 3T4HB 3ZSLA 3NJZA 2VMCA 4Q0VA 1LGBA 2WA4A 4NN0A 3S0MA 4PHZA 4AG4A 1SLIA 1QIQA 3H8XA 4LBQB 4YVWA 1GZCA 2WT1A 3PTRB 2XR4A 5K7PA 1FATA 4Y4RA 5FPUA 2YV8A 2MNGA 3EXUA 1W8FA 4WM7A 1AF9A 1WUVA 4HETA 3ZSEA 4RS5B 1VBD1 3GZTB 1IS3A 2W46A 3H7YA 3M3EA 1DGRN 4B8EA 4J1WA 3T2TA 1LOAA 2C6SA 3PJQA 1ND3C 2YPJA 2XKOA 5T5PA 3FUOA 1PM4A 2AACA 3QOPA 1A34A 4ZXEA 3VKMA 1CGPA 3MW3A 1ND2C 1J3RA 4NPLA 4QQOA 2JKXA 3NQHA 1CAXB 5T50A 1K3IA 3WZ1A 5FBZA 4NOTA 3FHQA 1PIV2 3Q8EA 2A71A 2ZZJA 2WZEA 4FQZA 3I97A 3EO6A 1TEIA 4IETA 2ZAAA 4QGNA 1JW6A 2FQPA 1ASJ2 4YVSB 4MGYE 4XBQA 4LE3A 5FPBA 2WO1A 5BNPA 1YFWA 2VZ1A 2Y6LA 2HWF1 1W8TA 2UYAA 4FPFA 1SFPA 2Y0IA 1S0GA 1NQDA 5FDBA 4BK5A 5DAXA 1SEFA 4QKFA 1W03A 3MHZA 5F6KA 1UOBA 4MXWB 2DYCA 5FPLA 2B46X 3CL1A 3VLBB 1UU6A 1HW5A 3QACA 3O7OA 2HBUA 1QJY1 5JUVA 3M3IA 3ZXKA 1XRUA 5JMCA 4LBNA 2GNBA 5IATA 2R063 1V0AA 3LWCA 4LBLA 1GKBA 3R4UA 4UT5A 1Z7S2 2XMLA 1FOD2 2P3KA 3B3QE 4B7EA 1Q8SA 1RUD2 5D2AA 4ZU4A 1E5IA 1QH7A 4JKKA 3ZYJB 5BNPB 4WM8B 3F95A 2VMHA 4GIQA 4XC9A 4CUGA 4CCNA 2JG9A 3ON7A 1GOFA 1YJKA 1YIFA 3WNNA 1K5MC 3ZXFA 4AHXA 3KMHA 2D44A 3K2OA 1OLME 5A32A 3GCWA 1MR5A 1XYPA 5L7OA 5K0UB 1W2AX 3F2ZA 4P14A 4ARXA 5GZDA 3W20A 1NE4A 3GHMA 1W2TA 3NJYA 2PHFA 1HQNA 3SH4A 1LHUA 1WLWA 4PDWB 2WWJA 1YWKA 4LLFA 5GZEA 4EN6B 4CDXB 1JMUB 3RFRA 3VBOB 5DAVA 2WN3A 3POGA 1IQAA 4EWEA 3C7EA 2R7EB 4F7ZA 1OH3A 2OKXA 1LHNA 1AX1A 1V6NA 2LM3A 3LEMA 4PIYA 2B7YA 4QX3A 3WINE 5IHRA 1O4YA 3PJYA 4O61A 5D8AB 2QDNA 4FTBA 1BMV1 4AL9A 4OI0A 1X8EA 5JWPA 5T5JA 4BJ0A 4YW2A 1OD5A 1AL22 1BCXA 1QJY3 3N9NA 4NHYA 5C5TA 1JYIA 3SKVA 1VR3A 1UNBA 3VZOA 2QCSB 5LBFA 4AGVA 1PGW2 3N7JA 3WDUA 1RTVA 2ETEA 2VMEA 4GXLA 3H8OA 3WQ1A 1IOAA 5FZGA 5CFCB 3VDCA 3OTFA 1U0AA 5I93A 2NN8A 2OX0A 3OUIA 4ITCA 4QDRA 3MUY1 3WNMA 2Y26A 2GMMA 1F2NA 3KV9A 3LQCA 2EF6A 2JDKA 2BJSA 5DAPA 1A8DA 4BB3A 2ZEYA 5FMOL 4WM7B 2R6QA 2O8QA 4I0WB 4IUGA 4JGZB 4O9GA 5JLVA 4XJZA 3DPRA 4FPLA 5AFEA 4GKYA 4CDQB 5A1LA 1POV1 3P1IA 3RMXA 3NVCA 1CAWA 3SLIA 5BYNA 3O1PA 1OFNA 4YW7A 2TNFA 2DFBA 2MEV3 1MPXA 1AR81 2RS12
chains in the Genus database with same CATH topology
2VCCA 4CUBA 2W1QA 3AC0A 1CX1A 3CZJA 2YC2A 5DPNA 2W9XA 1UYZA 3W5NA 3THCA 3POEA 3K4DA 2QQJA 1O59A 5IJRA 3IAPA 4XUQA 4MGSA 3HEIA 3CQOA 2VM9A 2DCJA 4A41A 4A45A 2Y6JA 3ACHA 4ARYA 3HJRA 2QQOA 3T08A 1GU3A 3OB8A 4AAXA 1UXZA 2WBKA 4KWUA 3GDBA 2W87A 5C7GA 3T0AA 3C7HA 5JXJA 3GXUA 3WF4A 1UWWA 5LCWL 1PX3A 4JKLA 2J1AA 2J1TA 3U37A 1L7QA 1DYOA 1XNTA 1JZ7A 1OH4A 4MO3M 1WCQA 1JYNA 3MV11 2E26A 3E1F1 4PT6A 5C70A 3VD3A 5G05L 1JYVA 4JX0A 2RVAA 3NJVA 4JHZA 1OT5A 4P5YA 2ORZA 2VTFA 2W3JA 4P02B 2LW8A 3K77A 1JU3A 1GOHA 2VMFA 4OZOA 4XUPA 1JU4A 1XC6A 2J1SA 3POBA 2ID4A 2VZSA 1I5PA 2JE8A 4A6OA 2W91A 1J83A 1K45A 2QQKA 4P00B 1SHWB 4L0PA 1JZ2A 1EUUA 1GUIA 2WO2A 2BERA 4A4AA 3P6BA 2V72A 3HNMA 4QB6A 4LPLA 4XVHA 3SEEA 4BDVB 4QAWA 1UYXA 2WNOA 4ZZ8A 3HNBM 4CU9A 2VZRA 2Y6KA 2WQ8A 4PF1A 4LKSA 2BBAA 1W8NA 4LQRA 3K4AA 1SZBA 3WF3A 3OGSA 2VR4A 4KMQA 3FL7A 1GNYA 3UETA 1CZVA 1H6YA 3C7OA 4CU8A 4ZY9A 3GM8A 2LS6A 2QQNA 3JXSA 2YB7A 4RN5A 4DXSA 1JI6A 5JMOA 3WF1A 2BGPA 5JR2A 3DYPA 2E33A 4RYDA 4XUNA 1PMJX 4A42A 4QDSA 1ULPA 5B4XA 4YPJA 3IAQA 2C26A 4CU6A 1R64A 1GQPA 2WN2A 3I2KA 3HOBA 2RV9A 4A44A 2VL4A 2ZXQA 3POFA 2WO3A 3MO4A 4QX0A 4DXTA 3ABZA 4QX2A 2ORXA 3ZM8A 2E31A 4Z2AA 2B9VA 4LHSA 4UI9L 2Y6HA 3I2IA 4UAPA 5JXHA 3ACIA 1NUKA 1GOGA 5EJ1B 1KGYA 3A7QA 2W5FA 1UY3A 1GMMA 3KQ4B 4QB1A 5EIYB 2VQUA 1UY1A 2Y64A 2ZEWA 1OD3A 5CISA 2W95A 2XQXA 4QB2A 3UNPA 3IDAA 4GWIA 2XONA 3A23A 1K42A 2YC4A 1W9WA 4M4RA 3BN6A 3I2JA 3OEAA 2VZUA 2V4VA 1NZIA 3WF0A 3LPFA 2XHNA 4CVUA 2EICA 4DEQA 3I2FA 1UY0A 3HPNA 3NRUA 2VOTA 2X09A 5HXMA 2VC9A 1JZ4A 2VMDA 5JXGA 2RJ2A 3SEPA 3ETPA 4P08A 2C9KA 3IB3A 3WNOA 2L9LA 3MUZ1 3WNKA 5JXIA 3C8XA 1UMHA 3LE0A 3CKHA 2VZOA 1RYYA 3T0BA 2E32A 4DEVA 3DECA 1TVGA 4MOAA 2J1EA 2ZEXA 3LEIA 1JZ5A 1SPPA 1UY4A 3CMGA 1JZ3A 2CDOA 1LNSA 2WAOA 3VD7A 3FN9A 5C71A 1W9SA 3PUHA 5CKQA 5HPOA 1JZ8A 1PX4A 2X05A 5IFTA 4CU7A 1F4HA 1F4AA 5IYYA 2Y8KA 3CIHA 3I3DA 1DP0A 4XURA 1IQDC 1BHGA 3POJA 2VZVA 1P8JA 3T0DA 3EB7A 4ET7A 3ECQA 1DLCA 2WAAA 2WDBA 1W99A 2W1UA 3A21A 4CUCA 4E8DA 3I2GA 4ZZ5A 5B4NA 3WSOA 2W92A 2WYSA 3K75B 4TTGA 2PQSA 4E8CA 2Z4FA 3UESA 3OGVA 5J1XA 1T2XA 1W8OA 3MV01 2C4XA 3A22A 2XOMA 2B4KA 1UY2A 3NNGA 3WEZA 4OYUA 3WQBA 1OF4A 4W4ZA 3DEMA 1JHJA 3W5MA 5DQ0A 5LA0A 4UOJA 4W8JA 2J7MA 3THDA 1UMIA 3OGRA 2VJXA 3HN3A 1SPPB 2W1SA 1UX7A 2EIEA 3LEGA 2WUHA 3I2HA 1CIYA 1CZTA 1W9TA 3ACGA 3IIIA 3T09A 1US3A 3VD9A 1XNAA 1NT0A 3DYOA 4LOSA 2W94A 4OMCA 4FI9A 3GGLA 4BK4A 2WABA 4XUOA 5LA1A 4DUWA 1O8SA 1XPWA 2VCBA 3K4ZA 1SDDB 2JD9A 2VMCA 4M4PA 4PQQA 3T2OA 5DN2A 2BGOA 3I3BA 2YG0A 2VCAA 4AG4A 2ZEZA 5CZKA 5I0DA 2YFZA 1JYWA 3SKJE 4GZ9A 5FUIA 1US2A 4JKMA 1D7PM 2W46A 4QDQA 2QQMA 2QQLA 3OEBA 1OF3A 1PMHX 3VDAA 4ZXEA 5CKMA 2JKXA 3D3AA 3NQHA 1K3IA 3VDBA 4XZUG 3FHQA 4W50A 4DUXA 5LA2A 3NJXA 2Y6GA 2QBXA 2WZEA 2VZ3A 3I97A 1KEXA 3WF2A 4XUTA 3CDZB 1TG7A 4OUEA 1UYYA 2WO1A 2Y6LA 2VZ1A 3OBAA 1O8PA 5G04L 1SFPA 3FHAA 4BK5A 4A3ZA 3VD5A 1SG3A 3K46A 3PUIA 5JUVA 2EIDA 3I3EA 1NAEA 3CZUA 2VO5A 2CDPA 1EUTA 4JKKA 3WNPA 1NKGA 4D8MA 2J1VA 4DUVA 4CUAA 4BXSV 2DCKA 1GOFA 2HYXA 3WNNA 1H6XA 2EIBA 3VD4A 5F7UA 5DMYA 3T2QA 3F2ZA 2WZ8A 4ARXA 3T2PA 1JYXA 1L7RA 4OMDA 4GWJA 2V5DA 2JDAA 2X10A 4HG6B 2WN3A 2VZQA 3POGA 3C7EA 2R7EB 2HLEA 2OKXA 2YFUA 2J1UA 5IHRA 4QX3A 2DDUA 1JZ6A 4MGQA 4LORA 4QX1A 3HNYM 1W0NA 4BJ0A 5CYYA 1ULOA 4TXWA 1UXXX 4KI5M 3SKVA 4DXRA 2QQIA 1HN1A 2W1WA 2VMEA 3J7HA 4LMFA 1NX9A 3VDCA 3OG2A 2J1RA 1UZ0A 5EJZB 4D0QA 4QDRA 3LEKA 1YQ2A 5A1AA 4QPWA 3MUY1 3WNMA 3BGAA 3EYPA 1WKYA 3POIA 2VZPA 3LQCA 2W47A 3ACFA 3MBWA 2KD7A 5IFPA 4MADA 1CZSA 2ZEYA 4IUGA 3C7GA 3DYMA 1K12A 4LOTA 5CKNA 2VZTA 3C7FA 3P1IA 3LPGA 3WNLA 2VQTA 2J22A 1MPXA 1J84A 2BZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VCC A;  4CUB A;  2W1Q A;  3AC0 A;  1CX1 A;  3CZJ A;  2YC2 A;  5DPN A;  2W9X A;  1UYZ A;  3W5N A;  3THC A;  3POE A;  3K4D A;  2QQJ A;  1O59 A;  5IJR A;  3IAP A;  4XUQ A;  4MGS A;  3HEI A;  3CQO A;  2VM9 A;  2DCJ A;  4A41 A;  4A45 A;  2Y6J A;  3ACH A;  4ARY A;  3HJR A;  2QQO A;  3T08 A;  1GU3 A;  3OB8 A;  4AAX A;  1UXZ A;  2WBK A;  4KWU A;  3GDB A;  2W87 A;  5C7G A;  3T0A A;  3C7H A;  5JXJ A;  3GXU A;  3WF4 A;  1UWW A;  5LCW L;  1PX3 A;  4JKL A;  2J1A A;  2J1T A;  3U37 A;  1L7Q A;  1DYO A;  1XNT A;  1JZ7 A;  1OH4 A;  4MO3 M;  1WCQ A;  1JYN A;  3MV1 1;  2E26 A;  3E1F 1;  4PT6 A;  5C70 A;  3VD3 A;  5G05 L;  1JYV A;  4JX0 A;  2RVA A;  3NJV A;  4JHZ A;  1OT5 A;  4P5Y A;  2ORZ A;  2VTF A;  2W3J A;  4P02 B;  2LW8 A;  3K77 A;  1JU3 A;  1GOH A;  2VMF A;  4OZO A;  4XUP A;  1JU4 A;  1XC6 A;  2J1S A;  3POB A;  2ID4 A;  2VZS A;  1I5P A;  2JE8 A;  4A6O A;  2W91 A;  1J83 A;  1K45 A;  2QQK A;  4P00 B;  1SHW B;  4L0P A;  1JZ2 A;  1EUU A;  1GUI A;  2WO2 A;  2BER A;  4A4A A;  3P6B A;  2V72 A;  3HNM A;  4QB6 A;  4LPL A;  4XVH A;  3SEE A;  4BDV B;  4QAW A;  1UYX A;  2WNO A;  4ZZ8 A;  3HNB M;  4CU9 A;  2VZR A;  2Y6K A;  2WQ8 A;  4PF1 A;  4LKS A;  2BBA A;  1W8N A;  4LQR A;  3K4A A;  1SZB A;  3WF3 A;  3OGS A;  2VR4 A;  4KMQ A;  3FL7 A;  1GNY A;  3UET A;  1CZV A;  1H6Y A;  3C7O A;  4CU8 A;  4ZY9 A;  3GM8 A;  2LS6 A;  2QQN A;  3JXS A;  2YB7 A;  4RN5 A;  4DXS A;  1JI6 A;  5JMO A;  3WF1 A;  2BGP A;  5JR2 A;  3DYP A;  2E33 A;  4RYD A;  4XUN A;  1PMJ X;  4A42 A;  4QDS A;  1ULP A;  5B4X A;  4YPJ A;  3IAQ A;  2C26 A;  4CU6 A;  1R64 A;  1GQP A;  2WN2 A;  3I2K A;  3HOB A;  2RV9 A;  4A44 A;  2VL4 A;  2ZXQ A;  3POF A;  2WO3 A;  3MO4 A;  4QX0 A;  4DXT A;  3ABZ A;  4QX2 A;  2ORX A;  3ZM8 A;  2E31 A;  4Z2A A;  2B9V A;  4LHS A;  4UI9 L;  2Y6H A;  3I2I A;  4UAP A;  5JXH A;  3ACI A;  1NUK A;  1GOG A;  5EJ1 B;  1KGY A;  3A7Q A;  2W5F A;  1UY3 A;  1GMM A;  3KQ4 B;  4QB1 A;  5EIY B;  2VQU A;  1UY1 A;  2Y64 A;  2ZEW A;  1OD3 A;  5CIS A;  2W95 A;  2XQX A;  4QB2 A;  3UNP A;  3IDA A;  4GWI A;  2XON A;  3A23 A;  1K42 A;  2YC4 A;  1W9W A;  4M4R A;  3BN6 A;  3I2J A;  3OEA A;  2VZU A;  2V4V A;  1NZI A;  3WF0 A;  3LPF A;  2XHN A;  4CVU A;  2EIC A;  4DEQ A;  3I2F A;  1UY0 A;  3HPN A;  3NRU A;  2VOT A;  2X09 A;  5HXM A;  2VC9 A;  1JZ4 A;  2VMD A;  5JXG A;  2RJ2 A;  3SEP A;  3ETP A;  4P08 A;  2C9K A;  3IB3 A;  3WNO A;  2L9L A;  3MUZ 1;  3WNK A;  5JXI A;  3C8X A;  1UMH A;  3LE0 A;  3CKH A;  2VZO A;  1RYY A;  3T0B A;  2E32 A;  4DEV A;  3DEC A;  1TVG A;  4MOA A;  2J1E A;  2ZEX A;  3LEI A;  1JZ5 A;  1SPP A;  1UY4 A;  3CMG A;  1JZ3 A;  2CDO A;  1LNS A;  2WAO A;  3VD7 A;  3FN9 A;  5C71 A;  1W9S A;  3PUH A;  5CKQ A;  5HPO A;  1JZ8 A;  1PX4 A;  2X05 A;  5IFT A;  4CU7 A;  1F4H A;  1F4A A;  5IYY A;  2Y8K A;  3CIH A;  3I3D A;  1DP0 A;  4XUR A;  1IQD C;  1BHG A;  3POJ A;  2VZV A;  1P8J A;  3T0D A;  3EB7 A;  4ET7 A;  3ECQ A;  1DLC A;  2WAA A;  2WDB A;  1W99 A;  2W1U A;  3A21 A;  4CUC A;  4E8D A;  3I2G A;  4ZZ5 A;  5B4N A;  3WSO A;  2W92 A;  2WYS A;  3K75 B;  4TTG A;  2PQS A;  4E8C A;  2Z4F A;  3UES A;  3OGV A;  5J1X A;  1T2X A;  1W8O A;  3MV0 1;  2C4X A;  3A22 A;  2XOM A;  2B4K A;  1UY2 A;  3NNG A;  3WEZ A;  4OYU A;  3WQB A;  1OF4 A;  4W4Z A;  3DEM A;  1JHJ A;  3W5M A;  5DQ0 A;  5LA0 A;  4UOJ A;  4W8J A;  2J7M A;  3THD A;  1UMI A;  3OGR A;  2VJX A;  3HN3 A;  1SPP B;  2W1S A;  1UX7 A;  2EIE A;  3LEG A;  2WUH A;  3I2H A;  1CIY A;  1CZT A;  1W9T A;  3ACG A;  3III A;  3T09 A;  1US3 A;  3VD9 A;  1XNA A;  1NT0 A;  3DYO A;  4LOS A;  2W94 A;  4OMC A;  4FI9 A;  3GGL A;  4BK4 A;  2WAB A;  4XUO A;  5LA1 A;  4DUW A;  1O8S A;  1XPW A;  2VCB A;  3K4Z A;  1SDD B;  2JD9 A;  2VMC A;  4M4P A;  4PQQ A;  3T2O A;  5DN2 A;  2BGO A;  3I3B A;  2YG0 A;  2VCA A;  4AG4 A;  2ZEZ A;  5CZK A;  5I0D A;  2YFZ A;  1JYW A;  3SKJ E;  4GZ9 A;  5FUI A;  1US2 A;  4JKM A;  1D7P M;  2W46 A;  4QDQ A;  2QQM A;  2QQL A;  3OEB A;  1OF3 A;  1PMH X;  3VDA A;  4ZXE A;  5CKM A;  2JKX A;  3D3A A;  3NQH A;  1K3I A;  3VDB A;  4XZU G;  3FHQ A;  4W50 A;  4DUX A;  5LA2 A;  3NJX A;  2Y6G A;  2QBX A;  2WZE A;  2VZ3 A;  3I97 A;  1KEX A;  3WF2 A;  4XUT A;  3CDZ B;  1TG7 A;  4OUE A;  1UYY A;  2WO1 A;  2Y6L A;  2VZ1 A;  3OBA A;  1O8P A;  5G04 L;  1SFP A;  3FHA A;  4BK5 A;  4A3Z A;  3VD5 A;  1SG3 A;  3K46 A;  3PUI A;  5JUV A;  2EID A;  3I3E A;  1NAE A;  3CZU A;  2VO5 A;  2CDP A;  1EUT A;  4JKK A;  3WNP A;  1NKG A;  4D8M A;  2J1V A;  4DUV A;  4CUA A;  4BXS V;  2DCK A;  1GOF A;  2HYX A;  3WNN A;  1H6X A;  2EIB A;  3VD4 A;  5F7U A;  5DMY A;  3T2Q A;  3F2Z A;  2WZ8 A;  4ARX A;  3T2P A;  1JYX A;  1L7R A;  4OMD A;  4GWJ A;  2V5D A;  2JDA A;  2X10 A;  4HG6 B;  2WN3 A;  2VZQ A;  3POG A;  3C7E A;  2R7E B;  2HLE A;  2OKX A;  2YFU A;  2J1U A;  5IHR A;  4QX3 A;  2DDU A;  1JZ6 A;  4MGQ A;  4LOR A;  4QX1 A;  3HNY M;  1W0N A;  4BJ0 A;  5CYY A;  1ULO A;  4TXW A;  1UXX X;  4KI5 M;  3SKV A;  4DXR A;  2QQI A;  1HN1 A;  2W1W A;  2VME A;  3J7H A;  4LMF A;  1NX9 A;  3VDC A;  3OG2 A;  2J1R A;  1UZ0 A;  5EJZ B;  4D0Q A;  4QDR A;  3LEK A;  1YQ2 A;  5A1A A;  4QPW A;  3MUY 1;  3WNM A;  3BGA A;  3EYP A;  1WKY A;  3POI A;  2VZP A;  3LQC A;  2W47 A;  3ACF A;  3MBW A;  2KD7 A;  5IFP A;  4MAD A;  1CZS A;  2ZEY A;  4IUG A;  3C7G A;  3DYM A;  1K12 A;  4LOT A;  5CKN A;  2VZT A;  3C7F A;  3P1I A;  3LPG A;  3WNL A;  2VQT A;  2J22 A;  1MPX A;  1J84 A;  2BZD A; 
#chains in the Genus database with same CATH topology
 2UUR A;  1H2N A;  2VCC A;  2D43 A;  5FY7 A;  5KHI A;  1X50 A;  2W1Q A;  3SMH A;  3CZJ A;  2AEN A;  3OBR A;  1HRI 2;  2YC2 A;  5DPN A;  5SV5 A;  3SHR A;  5FZI A;  2BVB A;  5HXV A;  3SQO A;  1AR6 2;  4FTE A;  4JGZ A;  2YDE A;  1X33 A;  4XQW A;  1ZZ7 A;  5T54 A;  3CQO A;  4CCC A;  3PL0 A;  1VAL A;  2DCJ A;  4UFH A;  4A41 A;  4BLJ A;  1O3R A;  2QFE A;  5APA A;  3ZMO A;  4XTM A;  1ZBA 1;  1VB2 A;  2RS3 1;  3ACH A;  4S2H A;  2Z79 A;  3B7M A;  4Z07 A;  4ARY A;  1KIT A;  2QQO A;  1ZA7 A;  4Q8L A;  5FLH A;  3WP3 A;  2VUA A;  4QQH A;  4YRD A;  3I2O A;  3T08 A;  1W9Y A;  2ZML A;  5EV7 A;  1QNW A;  1CX4 A;  3FLP A;  4XFH A;  1EPW A;  4QHZ A;  2WO7 A;  3WX5 A;  1QF3 A;  3NNF A;  3GDB A;  3PU3 A;  4CSW A;  1AXY A;  2VQ0 A;  1AR8 2;  5HI0 A;  5J7M A;  5J98 B;  2WZR 3;  2WFF 3;  3GBW A;  4GH4 B;  4NHX A;  3WCR A;  4CCO A;  1HB3 A;  3T0A A;  3IDB B;  3U78 A;  3C7H A;  5CG8 A;  1O5L A;  4JKL A;  4AI8 A;  2NZ9 A;  2VOX A;  1MVE A;  1XNT A;  1K5M B;  3B9I A;  4MO3 M;  4MGT A;  1IG0 A;  3KWV A;  3AVS A;  3SH5 A;  1WCQ A;  1QXP A;  1O3S A;  4A6S A;  1SLA A;  4HK8 A;  1M4W A;  4QXB A;  4PT6 A;  1PO1 2;  4CA9 A;  5C70 A;  1O3Q A;  4UF0 B;  3ES4 A;  3RS6 A;  5A3T A;  2XL7 A;  4IDZ A;  2VTF A;  3KLS A;  4P02 B;  2A3X A;  4HKL A;  1UIK A;  1YO8 A;  5ERL A;  4AYU A;  3SIS A;  1YQ6 A;  4A7Z A;  4CCJ A;  5J3U A;  4HSL A;  1A78 A;  4BLI A;  1HJF A;  3N7M A;  4HVR A;  2O0O A;  1ZVF A;  3M3O A;  2CSG A;  4LK7 A;  1XC6 A;  2WWS A;  2ID4 A;  1I5P A;  4MHR A;  5F5I A;  4RS5 C;  1W8H A;  2JJ6 A;  3AL6 A;  3Q8A A;  4NWW A;  2V4A A;  1JZ2 A;  4UF0 A;  1GUI A;  1LOF A;  4DXZ A;  2D5H A;  3LKJ A;  2VQA A;  2BER A;  2DUR A;  4QQ2 A;  3VZN A;  3ZKY A;  4AI2 A;  1W6O A;  3GBF A;  4K1Y A;  3HNM A;  4KG8 A;  1RUC 2;  2C5D A;  1HB4 A;  4LPL A;  5JI9 A;  4AI3 A;  1W8U A;  2P5B A;  4XQ4 A;  2RM2 2;  3VKO A;  4LBO A;  4ATF A;  2WNO A;  3TN9 2;  4BDV B;  4BWO A;  2R0H A;  4Z8B A;  4CU9 A;  1GNZ A;  1RMU 2;  1SLT A;  1WGP A;  5FZO A;  2Y6K A;  4EWD A;  4NIG A;  2JG8 A;  3UGG A;  2GH2 A;  1W8N A;  1SZB A;  3FFQ A;  3OGS A;  4ISQ A;  3WUD A;  3HWJ A;  1IZ3 A;  3USU B;  4N43 A;  1CZV A;  4AWD A;  3B01 A;  1H6Y A;  1YYN A;  1WMX A;  2WSV A;  3GM8 A;  3HQR A;  2YB7 A;  1JI6 A;  2BQP A;  4V2W A;  5DAB A;  3ASI A;  4GMP 1;  3Q8F A;  3Q8C A;  4LKD A;  2WSU A;  1RB8 G;  2ZPX A;  3W21 A;  4FPJ A;  4EE2 A;  5GJ6 A;  1WD4 A;  2HEW F;  3S7I A;  4A42 A;  4BPZ A;  1R1Z A;  2D6K A;  3N3H A;  3RRD A;  1K5J A;  5DUU A;  1DDL A;  3DF0 A;  3ZOI A;  1C8M 3;  1Q56 A;  2ILM A;  3KZ4 C;  2ARX A;  2KA3 A;  5K4L A;  2RS3 2;  2WNU C;  2Z69 A;  1ZBA 2;  3H1M A;  4CXY A;  1AYM 1;  5DDJ 3;  3BVC A;  1DF0 A;  4DY5 A;  5LK7 B;  1JBC A;  4CPB A;  1Y9Q A;  2WO3 A;  4DXT A;  2R07 1;  3N9M A;  4QM9 A;  1NCQ C;  2R06 1;  4Q0P A;  2O8O A;  1I6X A;  4XQD A;  3ABZ A;  3NL1 A;  4QX2 A;  4JRA A;  4XBN A;  2E31 A;  2OPK A;  4CP9 B;  3VV1 A;  1W6M A;  4HT1 T;  3B94 A;  2GC3 A;  4UI9 L;  1YHF A;  5KXE A;  1X7N A;  4RR3 C;  4WM8 A;  3VKN A;  1SLC A;  1VBE 1;  1ZYB A;  4QQL A;  3BTX A;  1IPS A;  1F9K A;  4QGL A;  3H3L A;  3MID A;  3AMH A;  1SAC A;  5CVR A;  2ZX1 A;  5LAT A;  2CL2 A;  3WR0 A;  2JWP A;  2PQQ A;  3JZV A;  1IGO A;  2HWB 1;  3N35 A;  1CJD A;  4A3X A;  2RR1 2;  3L2Y A;  4WV8 A;  3MIC A;  5A33 A;  2PEL A;  2YHJ A;  4XDQ A;  1N3O A;  1OLM A;  2VQU A;  5FZK A;  2ZEW A;  3ORJ A;  4KU7 A;  3HMY A;  4RGK A;  5AC9 2;  3U4X A;  5EHD A;  3WHT A;  2ZS6 B;  1RUO A;  3IDA A;  1AYN 2;  1LOG A;  2XON A;  1XNC A;  1K42 A;  3PVE A;  4IV3 A;  3VZJ A;  4LNV A;  1TQ5 A;  4JC1 A;  1WBL A;  2F17 A;  3ZFE A;  2WL1 A;  4RSU A;  3A4U A;  4M4R A;  1HRI 3;  1FMD 1;  5E6H A;  2VZU A;  3BUC A;  4R8H A;  5LAS A;  5FY9 A;  2XHN A;  3WG3 A;  2OUJ A;  4CVU A;  2X8K A;  5FLJ A;  3I2F A;  4FFH A;  4DEQ A;  4TYS A;  2VGD A;  2DTY A;  3VBF A;  1DGR A;  3JB8 A;  4DPN A;  1CAX A;  1QMJ A;  1XE0 A;  5KXC A;  2VOT A;  3AM2 A;  5HXM A;  2VU9 A;  3LIH A;  2VMD A;  3JQW A;  1KXG A;  1VRB A;  1RUJ 3;  2WNE A;  2BV4 A;  5BNN B;  1XU2 A;  2EXK A;  4LR4 A;  4OVE A;  4P08 A;  2DWR A;  4FO9 A;  3GZA A;  2L9L A;  5FXV A;  1UMH A;  4I09 A;  2W2I A;  5F39 A;  1TME 3;  5A6Q A;  4G4F A;  3PVN A;  4K8F A;  5H9P A;  3VDD A;  3B5L B;  2EXH A;  5C6C A;  1GV9 A;  1OXC A;  1IPK A;  3TNQ A;  1RYY A;  3PTY A;  4RFT 0;  5ISL A;  3ZSM A;  3P3N A;  3AP4 A;  4XIL A;  3WOG A;  1YC6 1;  4CDW A;  4FOV A;  4N53 B;  3UV9 A;  5K8S A;  2GSY A;  4XJU A;  2HWD 3;  2CDO A;  2CGP A;  4AR2 A;  1LNS A;  5HV0 A;  5C71 A;  3RI9 A;  1ULF A;  1W9S A;  3PUH A;  5CKQ A;  4BQ1 A;  2MEV 1;  3SCH A;  1WCD J;  1B09 A;  1OPM A;  4IEX A;  4N9H A;  1W0P A;  1D0H A;  1F4H A;  2A75 A;  1F4A A;  2JG9 C;  2RM2 3;  3DXU A;  2W52 A;  4ASL A;  5IYY A;  1RUD 1;  4NIH A;  1NLR A;  3CIH A;  3LDR A;  4OUL A;  1YQ8 A;  1MZE A;  2JE7 A;  3N9Q A;  2PHT A;  1F5F A;  2XL9 A;  4HN0 A;  4XUR A;  3O1R A;  4HFS A;  3R05 A;  3O1O A;  1P8J A;  2J42 A;  4RS5 A;  2RS5 2;  3GCX A;  4I01 A;  4XF3 A;  3ECQ A;  4HOO A;  1DLC A;  3D8C A;  5LBE A;  3AXE A;  4EV0 A;  1WW5 A;  2W1U A;  1H1I A;  4COU A;  2CGO A;  5BNO A;  2OII A;  4E2G A;  4IW3 A;  1BEV 1;  4D69 A;  1XYN A;  2ZGQ A;  1DGW X;  4ZZ5 A;  4W6Y A;  3MPB A;  3WSO A;  4PF5 A;  3KB5 A;  3VHO A;  3GZE A;  2HWF 2;  3BIW E;  4Y1X A;  2P6C A;  1HN0 A;  4AF9 A;  2PQS A;  2FZ1 A;  5FP9 A;  1V6I A;  4AQS A;  5F2S A;  4ASK A;  2BPA 2;  1UIJ A;  1VBB 2;  4Q5O A;  5M0T A;  3OJB A;  5JOY A;  3T3Y A;  5J1X A;  1T2X A;  3MV0 1;  1FOD 3;  1W9F A;  5IVB A;  5FY1 A;  3J26 N;  4PLM A;  3J7M A;  4UW4 A;  1SFY A;  4XCA A;  5BNP C;  4NPR A;  3WQB A;  3VZM A;  2VW1 A;  1MS3 A;  5GLW A;  4NMI A;  1LCL A;  4Z1V A;  3W5M A;  4KU8 A;  2QQW A;  2R04 1;  5A3P A;  3WUC A;  4MET A;  2J7M A;  1ALY A;  2BVV A;  5GZF A;  3AMN A;  4UFK A;  4Q4V 1;  2DCY A;  5A7W A;  3THD A;  4H7M A;  1OOP B;  1G9B A;  3ZDS A;  1WD3 A;  2W1S A;  1DQ6 A;  3HR9 A;  2A6W A;  1MS8 A;  1UX7 A;  1POV 3;  3MLJ A;  3JB4 C;  5FYU A;  4IV3 B;  1H2M A;  2WUH A;  2OUH A;  3L9J T;  1AR9 3;  2VMI A;  4IEQ A;  3VBH C;  3N9O A;  1HRI 1;  1COV 3;  3UYJ A;  5F3I A;  3T30 A;  5F3E A;  5FIX A;  4FI9 A;  2FMY A;  3GGL A;  4KQ7 A;  4R4Z A;  2WAB A;  1Y9G A;  3LAG A;  5FYZ A;  4XUO A;  4AZZ A;  1E5H A;  4BK4 A;  1O8S A;  4K7J A;  4RR3 A;  1XPW A;  1VPH A;  1G9A A;  1SDD B;  2O1Q A;  4NVP A;  2GC1 A;  4HN1 A;  2BFU L;  5T5L A;  5C3S A;  5IK5 A;  3DV8 A;  5DN2 A;  2VBD A;  1DYP A;  2Q1M A;  4S2F A;  5AC9 1;  2VOW A;  2FDF A;  4GAZ A;  3CLP A;  2RS3 3;  3IZO A;  4KH9 A;  4AFM A;  2FDG A;  4IE4 A;  4NE9 A;  1JOD A;  1OUX A;  4IXL A;  5CZK A;  4XBL A;  5FZO B;  1Q5O A;  2YFZ A;  1TME 1;  5K9Y A;  4LT5 A;  2XJS A;  2BOJ A;  5FZH A;  1WME A;  1NXM A;  4QDQ A;  4ORF A;  5A7S A;  4Q4V 3;  3ZSK A;  2QQL A;  3OEB A;  1OF3 A;  1XQN A;  2WNU B;  4X8N A;  3LSD A;  3VDA A;  4B29 A;  1EPZ A;  3B93 A;  3MIF A;  2Y33 A;  3KF3 A;  3RDI A;  5KWR A;  1OQD A;  2BWA A;  5IVV A;  4N8M A;  2WC2 A;  1VE0 A;  3Q9O A;  4LBM A;  4MGI E;  3RYP A;  5C8W A;  2Z2S B;  1POQ A;  3GJB A;  5LA2 A;  1C8M 1;  1BKZ A;  4CEW B;  5BNN C;  3HVD A;  2IXI A;  4UXA A;  1BMV 2;  1F8V A;  5DAQ A;  4X6R B;  4YNI A;  5LZ6 A;  3O0W A;  2OQ7 A;  3CDZ B;  4ZU5 A;  4OUE A;  4BZ4 A;  3B69 A;  5DUV A;  4DFS A;  4U2A A;  4BME A;  2R07 3;  3KV4 A;  2WNU A;  5LEJ A;  1O8P A;  5GLT A;  1HDK A;  3CJI C;  4QPG B;  1H8T A;  2WRA A;  2A1X A;  2XBO 1;  3VD5 A;  1G6N A;  4E2Q A;  4JTN A;  4M00 A;  1FX5 A;  4AED A;  2BNM A;  2ZCW A;  1V9U 1;  1MQT C;  1OHF A;  3EQE A;  2ZHL A;  3K46 A;  3NNM A;  4Q26 A;  4XZP A;  5ABJ B;  5GZC A;  1BXH A;  3KSC A;  4YGB A;  1AX2 A;  1I3H A;  1KQR A;  1LHO A;  1NQJ A;  1NAE A;  3CZU A;  1UPI A;  3MZH A;  2PHU A;  3AB0 A;  1KFX L;  1RUF 3;  2CDP A;  2XG3 A;  3POS A;  4FPC A;  2AUY A;  1CD3 G;  1V6J A;  1O5U A;  4D8M A;  2J1V A;  1C1L A;  4CCM A;  2ARA A;  3BPZ A;  1W6N A;  5A7N A;  5FLI A;  4CUA A;  2YZ4 A;  2ZGS A;  3DUI A;  1PHM A;  1RUC 1;  3MPP G;  2P4E A;  3ACL A;  2QQV A;  4PIZ A;  2Z42 A;  1ZZ6 A;  3DKW A;  3ZXD A;  3BOD A;  1GZW B;  5F32 A;  1VBB 3;  4YZ4 A;  3AKP A;  4QU1 A;  5F8P A;  4AEM A;  5F7U A;  2OXB A;  4PLO A;  3T2Q A;  4AQT A;  4LKF A;  1CAV B;  2XBO 2;  4QXK A;  5HV4 A;  2V5Y A;  4OFG A;  1OSG A;  3T2P A;  2NLR A;  1VB4 A;  1XYO A;  2V5D A;  1LOC A;  2ENR A;  3HQU A;  1J59 A;  3PNA A;  4BH9 A;  3MYX A;  3FX3 A;  3N9L A;  3IDC B;  1ZA4 A;  1C8M 2;  1PZ8 A;  1JZ6 A;  3N36 A;  4AW7 A;  4IEY A;  4C8D A;  1YI9 A;  2DV9 A;  1GZW A;  1C5I A;  4CEY A;  4BQX A;  4Q4Y 2;  3KV5 A;  2WYF A;  2WZP P;  1ULO A;  4X8P A;  4MHU A;  2W0X A;  5FXZ A;  5FP3 A;  1UKR A;  1ZZC A;  2JDN A;  1RIN A;  1HN1 A;  4M0N A;  2W1W A;  4RHV 2;  4D7T A;  2D6O X;  4NRM A;  1ZRE A;  4LEJ A;  1UYP A;  3I7D A;  1NX9 A;  1JTZ X;  4GAL A;  1V6L A;  3OG2 A;  1XXN A;  4YW3 A;  3V56 A;  1QJX 1;  4IE0 A;  1LAJ A;  4YVW C;  1PIV 1;  5EJZ B;  2FCV A;  4D0Q A;  5CFD C;  4LBQ D;  1VAV A;  3BGA A;  3LD8 A;  4AEJ A;  3POI A;  4DS0 A;  3CHX A;  1KJL A;  1RMU 3;  3LB9 A;  5FY5 A;  3VL9 A;  1J1L A;  1MEC 1;  1D0G A;  2DU0 A;  4NRQ A;  4MAD A;  2XH6 A;  1CZS A;  2AZ5 A;  4XET A;  4GB3 1;  5FZ7 A;  1BLZ A;  4IES A;  5FYC A;  1WWY A;  2ZHK A;  1UW8 A;  1V6O A;  4CCL A;  5L36 A;  1ZRD A;  2VZT A;  4AQ6 A;  3C7F A;  4AE2 A;  2C9A A;  3OY8 A;  1ZBE 2;  4XF0 A;  3BCW A;  3ZFF A;  1ND2 B;  2VQT A;  3THT A;  4JDN A;  5FUP A;  3J8F 2;  3GZU C;  4JVA A;  2RDR A;  2BZD A;  4HPK A;  4XXP A;  4Y1U A;  4PJY A;  2EVX A;  5F2W A;  2GN7 A;  2XVK A;  1TMF 2;  5FV3 A;  5I8S A;  3RPQ A;  4CUB A;  4AGG A;  2W9X A;  3IPV B;  3MEP A;  4H55 A;  4D6R A;  3THC A;  3JUU A;  5FZ9 A;  3POE A;  4DXR A;  5I0S A;  1DQ4 A;  2QQJ A;  3K4D A;  1O59 A;  4URT A;  1OA3 A;  2QTW B;  1RUH 1;  2PYT A;  3BYW A;  4XUQ A;  3A0K A;  3OOX A;  3HEI A;  3EBR A;  5HCF A;  1D4V B;  2UWC A;  3ALQ A;  4A45 A;  1PVC 1;  4GKX A;  4CZS A;  5CFC A;  1DFQ A;  3PME A;  2VXJ A;  4A7K A;  3HJR A;  5KHK A;  1NYW A;  2OT7 A;  2A5Z A;  1V00 A;  2Y0O A;  3V64 A;  2P3J A;  4IE6 A;  3T1M A;  5FR3 A;  4RFR B;  4AAX A;  4Y1Z A;  4CDU B;  3WP6 A;  5F37 A;  1VBE 3;  4SLI A;  2GME A;  3NKT A;  1RMU 1;  2I2S A;  4Y26 A;  4Y5Z 0;  4B1M A;  4AVC A;  4NIA A;  3DPR B;  5CU1 A;  5CB7 A;  1CIW A;  1WMD A;  1YEW A;  3ZYF A;  1LKN A;  4DNY A;  2PAM A;  1CAW B;  2FDI A;  2OZJ A;  1MZF A;  3ES1 A;  5LCW L;  1RUN A;  3O0X A;  1UQX A;  3NKG A;  2GP3 A;  4CP0 A;  4AVV A;  3D0J A;  2J1T A;  3U37 A;  4L9B A;  1L7Q A;  1NCQ A;  4Y20 B;  3HT2 A;  3VZK A;  3KS7 A;  2F4L A;  4K8R B;  3I4I A;  4IQP A;  1JYN A;  3UGH A;  3MV1 1;  2B9U A;  4NO4 A;  1W3V A;  2RMU 2;  3O1T A;  3E1F 1;  5JI7 A;  1LR5 A;  4Z92 B;  5JDB A;  4S2G A;  1JXN A;  2WJS A;  4CDW B;  4LA3 A;  4GMP 3;  4E9K A;  3NV3 A;  4W6W A;  1JYV A;  1DCS A;  4CYD A;  2GH8 A;  3BAL A;  4WVM B;  2ORZ A;  1H8T B;  1SCR A;  1RUE 3;  3UKT A;  3K77 A;  1JU3 A;  4Q27 A;  5E8A A;  5A3U A;  4OZO A;  1X82 A;  2FCT A;  4I3P A;  1LGC A;  1WA4 A;  4HK9 A;  2WQZ C;  2QZ2 A;  1DQ2 A;  3AKQ A;  5A3L A;  1LUL A;  1PZ7 A;  1N1V A;  4M3C E;  2ERF A;  2JE8 A;  2VZS A;  4I30 A;  3AK0 A;  4UBH A;  1J83 A;  1L7L A;  2BFU S;  3RQ0 A;  3PDQ A;  1U5Z A;  5KXD A;  4QX5 A;  3I8T A;  2EA7 A;  1MAC A;  4P9W A;  1EUU A;  1FT9 A;  1G86 A;  2VH9 A;  4GWN A;  4EZH A;  4RQP A;  2JDZ A;  2WO2 A;  3OPT A;  5C4W B;  3V0B A;  2DCT A;  3ZFG B;  2XPJ A;  3BIE A;  2W39 A;  2EAA A;  5F1R A;  5IK4 A;  4LK6 A;  4HKO A;  4QB6 A;  5LA9 A;  2KXL A;  1MEC 2;  4XVH A;  1C3H A;  2YGM A;  3TBD A;  4ZZ8 A;  3HNB M;  3PVB B;  5IUQ A;  4WM7 C;  3M3Q A;  4GWM A;  3U07 A;  3AMQ A;  1W8W A;  2WQ8 A;  2JIC A;  3AXD A;  2ZGO A;  3J8F 3;  4FOY A;  1IG3 A;  4H2A A;  2HWD 1;  1QJX 2;  1NCR A;  3K4A A;  2RDS A;  2VR4 A;  2Y38 A;  2VW2 A;  4KMQ A;  3UT0 A;  4CCE A;  2DU1 A;  2XQR A;  5DZF A;  2JG8 B;  2K2S A;  5FJH A;  1YUD A;  4KG0 A;  4RHV 1;  5C3O A;  1MS9 A;  1QJY 2;  4R9A A;  1WZX A;  4E2S A;  2GC0 A;  4ZY9 A;  2UY9 A;  1UN1 A;  1PK6 B;  3WW2 A;  3C3V A;  1NY7 2;  2D6N A;  3WF1 A;  1VBA 2;  5FMO S;  5JSP A;  2E33 A;  4JZR A;  4D94 A;  4BIO A;  4Q29 A;  4XUN A;  3TEY A;  4Q4X 3;  4B1L A;  3AKS A;  4KWK A;  4NRP A;  5B4X A;  3IAQ A;  3JU9 A;  3GF6 A;  2WN2 A;  4OUS A;  1POV 0;  2VEC A;  4HZF A;  2RV9 A;  1OOP A;  1PZ9 A;  4YZ5 A;  3ZN4 A;  4AGR A;  3I59 B;  1VBA 1;  2XLG A;  1PK6 A;  1QKQ A;  2VVD A;  2BBV A;  2ZXQ A;  4QX0 A;  1ULE A;  2P6H A;  5I8Y A;  3LIG A;  4Q4Y 1;  1AR7 2;  1HX6 A;  3AFG A;  1GZT A;  2B45 X;  4QPI C;  4WVZ A;  4CEY B;  3NW4 A;  2H0V A;  5TSW A;  5IT6 A;  2PHD A;  3LFM A;  2Y6H A;  4R9C A;  5D8A A;  5ANQ A;  5F5A A;  2BU9 A;  2EAK A;  2YC0 A;  4YW6 A;  5A3N A;  1REE A;  3RZK A;  4GH4 C;  1VBD 2;  3AJZ A;  1FV3 A;  3MDP A;  1GP4 A;  1GOG A;  5EJ1 B;  5FJK A;  5BV6 A;  3ZIX A;  3NMB A;  2YBP A;  3ZO0 B;  2NYY A;  1H1M A;  1D4M 2;  4CDQ C;  4WZC A;  1Y4W A;  1X8M A;  3E5U A;  3OGG A;  4QD2 A;  4CEY C;  1D4M 3;  4C1X A;  1UY1 A;  1W39 A;  1UOG A;  2Y64 A;  3S5Q A;  4QXC A;  4HPK B;  5A6X A;  4BMB A;  3EJK A;  3RZM A;  3UNP A;  1AJK A;  1QJE A;  5EJ3 A;  1IKQ A;  2FCU A;  5IVE A;  3WG4 A;  5DZG A;  2SLI A;  3WDX A;  3RZJ A;  5EYX A;  2HJI A;  3RZH A;  1W9W A;  1MS1 A;  3FZ3 A;  3WVJ A;  3I2J A;  1U5Y A;  3QBQ A;  4UFM A;  1NZI A;  2HWC 3;  4YYO A;  4MX3 A;  2CTV A;  4XAE A;  4LBK A;  1UL9 A;  4KBZ A;  1XOY A;  4XXA A;  3GAL A;  5LBB A;  3ZXG A;  3VUO A;  5FZD A;  3QH6 A;  4BYY A;  5I8T A;  1MS5 A;  1PO2 2;  1M06 G;  1JYC A;  5DDJ 1;  3I49 A;  3LFI A;  2G4I A;  4UW5 A;  2XGX A;  3HPN A;  4Y22 B;  2GNT A;  5C9A B;  1RUI 2;  4N7I A;  4RGA A;  2IXK A;  2XLA A;  4OHZ A;  3VBF B;  2VC9 A;  4C0B A;  1JZ4 A;  2D5F A;  4M3C F;  3SEP A;  5DG1 A;  4TWT A;  2HEY F;  5JZG C;  3RG0 A;  3IB3 A;  1QJX 3;  4TSV A;  3PHM A;  2DVG A;  1KJR A;  4IEV A;  1WCK A;  3LE0 A;  4YAR A;  1SQ4 A;  1E5R A;  1EAH 2;  3TAY A;  2WNV A;  2RG4 A;  3CU7 A;  4XF1 A;  5GLZ A;  1MZ5 A;  4QPG A;  1W6P A;  2WWU A;  1QJU 1;  3T0B A;  2E32 A;  3MW4 A;  4P9X A;  1FOD 1;  2PHR A;  4GB3 3;  2HWE 3;  1JHN A;  2J1E A;  4LBQ A;  2VOK A;  3LOB A;  4BHP A;  1GIC A;  5KHH A;  1EV1 2;  5FYH A;  2IXH A;  4AHW A;  1S0I A;  4BOW A;  1ODM A;  3ZXL A;  4AI0 A;  4I0B A;  2WAO A;  3SH3 A;  2FBE A;  1OBN A;  1QXR A;  5L19 A;  4Y1V A;  5HPO A;  3ZYR A;  1JZ8 A;  1D4M 1;  1Q8V A;  5E88 A;  3SCF A;  1ONA A;  3UK9 A;  2P17 A;  5CFC C;  4YW5 A;  1OLQ A;  1FNY A;  1SBD A;  4M3C B;  3ZX7 A;  4CU7 A;  2RDQ A;  3IKW A;  2Q5T A;  1FMD 3;  1H8V A;  1U5I A;  3EHK A;  3I3D A;  4WBB A;  5FKB A;  3C2U A;  1KDK A;  1DP0 A;  5FZC A;  1LES A;  1RUE 2;  1IQD C;  1BHG A;  1TME 2;  5IVY A;  2P3I A;  1OLR A;  1RUH 2;  5JIU A;  1FPN 1;  1R09 1;  2VZV A;  4ET7 A;  5GKA C;  4XOG A;  3ZFG C;  1DHK B;  4X6Q B;  5E1R A;  2W08 A;  1AVB A;  2PMW B;  4ERO A;  1TMF 1;  4COW A;  1AYN 3;  3I2G A;  2EXJ A;  5F5Q A;  5CEH A;  5LWB A;  4PDW C;  3H42 B;  4NID A;  2FDK A;  4GMP 0;  4LO6 B;  3TEZ A;  1ZRF A;  1COV 2;  3K75 B;  4L8Q A;  3OSD A;  1AR9 2;  3D4K A;  3BU0 A;  2YXS A;  2Z4F A;  1N3P A;  1VBC 2;  4JDM A;  3J7L A;  3UES A;  1LU2 A;  2CYF A;  4BCU A;  5J96 B;  2DBI A;  3VHR A;  1UY2 A;  3WEZ A;  2PTM A;  5EWS A;  2Q8C A;  3WW4 A;  1C28 A;  1BBT 2;  1E57 A;  2VUC A;  4LXL A;  1Z7S 3;  2D93 A;  3LGR A;  2WZR 1;  5HCH A;  4Y3O A;  3V65 A;  5FXX A;  1V70 A;  3ST7 A;  1LOD A;  1VAK A;  4W8J A;  4DB5 A;  3KV6 A;  2WT0 A;  1AHS A;  1SPP B;  4ZHN A;  3N9P A;  2QJV A;  5BNO B;  3ZYP A;  2EIE A;  1WLC A;  5AFB A;  4XFC A;  5FK8 A;  3V0A B;  2LTN A;  2VG9 A;  4FFI A;  4PDW A;  4QT6 A;  1XJA A;  1XSQ A;  1CIY A;  1LEN A;  1W9T A;  3ACG A;  5CAD A;  5I0R A;  1N1T A;  4OI4 A;  1RUE 1;  1Y43 B;  3INA A;  3WW1 A;  2QQP A;  2W94 A;  3UJQ A;  4QPI B;  3DGT A;  5I0T A;  3SC7 X;  1TMF 3;  2AGS A;  1ENQ A;  4DUW A;  2TBV A;  3L2H A;  3GJA A;  4QKN A;  4M4P A;  4PQQ A;  5DAW A;  3ZPO A;  3JCI A;  4NAO A;  1CAU B;  3VBR A;  1DYK A;  4Q1R A;  2IUW A;  2AEZ A;  2YG0 A;  5FO8 B;  1NE6 A;  2VCA A;  1GWK A;  4GJZ A;  1PIV 3;  3I3Q A;  2YYO A;  1S2E A;  5I0D A;  1PGL 1;  1ENX A;  3JBG 1;  5A80 A;  4ES8 A;  5FAX A;  2CNA A;  4GZ9 A;  1JUI A;  1US2 A;  3A0N A;  4RHV 3;  3IM0 A;  2ET1 A;  2HWE 2;  1LED A;  4K40 A;  4PLN A;  1B35 B;  2YPD A;  4XFA A;  4XJW A;  4COV A;  2FZ2 A;  3IIA A;  2G9F A;  2QQM A;  4B7K A;  1DU3 D;  4EZ4 A;  1SFN A;  5FZB A;  2R04 3;  4MXV A;  1RUC 3;  2WS9 1;  3ZN6 B;  5F3C A;  1PGW 1;  3LF7 A;  4ZXK A;  1WBF A;  5A7Q A;  1HXS 2;  2N7G A;  2ZGU A;  4UWD A;  1KD7 A;  5A6Y A;  3D3A A;  1C8N A;  3VHP A;  2DUP A;  2IC1 A;  3TOJ A;  3USS A;  3TEW A;  1Y3T A;  1UKG A;  2JEM A;  4JGY B;  4W50 A;  5DG2 A;  5BXX A;  4UFI A;  5D8A C;  4S2D A;  5FZ6 A;  3WDV A;  4DOU A;  2Y6G A;  1KFU L;  1N1Y A;  5L7O C;  2HWC 2;  2QBX A;  2VOV A;  1RUG 1;  3QCW A;  2VZ3 A;  5J48 A;  3WF2 A;  5L73 A;  5FYI A;  4BE3 A;  4TLG A;  1SBF A;  1UYY A;  4Q4W 3;  3LDK A;  1O3T A;  2HEV F;  4FP2 A;  4Q4Y 3;  2H6C A;  4O65 A;  3P3P A;  1ULC A;  1W2O A;  3OGJ A;  1S1A A;  2PLV 1;  3MLL A;  3PLQ A;  1UU4 A;  3TRS B;  2BNO A;  3AZY A;  1AYM 3;  1KDM A;  4OHW A;  2BRT A;  2A70 A;  1ZX5 A;  4Y22 A;  4KGQ A;  3WQ0 A;  5C9A A;  2JB8 A;  4QXH A;  2EID A;  2YY1 A;  3VL8 A;  1EYB A;  1VRH 1;  3OPZ A;  5FYT A;  4CE8 A;  2BOI A;  2VO5 A;  4CDU C;  4E4D X;  1VBD 3;  5FK7 A;  4BIF A;  2HWB 2;  4FOW A;  1AX0 A;  2ZMK A;  4N9I A;  5DZE A;  2Q30 A;  3HD8 B;  1EUT A;  2KR2 A;  4TN7 A;  1NKG A;  2XUM A;  2GN3 A;  4OQ9 A;  2VBP A;  1F31 A;  5JPN B;  4OCT A;  3OUJ A;  4YWA A;  4BXS V;  2HYX A;  5IW0 A;  1H6X A;  1O4Z A;  2IFW A;  4FFG A;  4FPK A;  3IT8 A;  2DBN A;  2C1F A;  1AR7 1;  3U11 A;  5FQ0 A;  3PMS A;  1HRV 3;  2WS9 3;  3PUS A;  5F5C A;  1OKQ A;  5DMY A;  3M2M A;  2A6Z A;  2WZ8 A;  4DRR A;  4KGG A;  3O12 A;  1HKD A;  2G9G A;  4W65 A;  4F8A A;  4UW6 A;  4BQY A;  2FD8 A;  1SMV A;  4V2V A;  5DUW A;  3PIG A;  1JYX A;  2C24 A;  1L7R A;  2YBS A;  4OMD A;  5FTT C;  2F6B A;  5ABJ A;  5KR7 A;  2X10 A;  3NWK A;  2VZQ A;  1RVF 3;  1SBE A;  1UPS A;  1PM7 A;  2IVJ A;  4P9J A;  2HLE A;  5F6L B;  4LUL A;  1A6C A;  4XAB A;  3LOI A;  2ZAH A;  1BK0 A;  2DDU A;  4MGQ A;  4LOR A;  1VIW B;  1WMF A;  4LIV A;  3HNY M;  1GSL A;  4QX1 A;  1W0N A;  5HCB A;  1QOT A;  1RUH 3;  4OHX A;  4LO5 B;  1UO9 A;  4AFB A;  1N1S A;  4LTA A;  2RDN A;  1AR6 3;  3M8L A;  3HN1 A;  2BDR A;  3BOW A;  3KVA A;  4NJ4 A;  1IKP A;  1W6N B;  2QQI A;  2Q1Z B;  4Q4V 2;  3USU A;  2A6X A;  3RWK X;  3WT3 A;  4CDX C;  1H0B A;  1LB2 A;  1QJU 3;  1HIX A;  3FMG A;  4BIS A;  1OUR A;  5FUN A;  1ZBA 3;  3J7H A;  4I3G A;  2E7Q A;  4LMF A;  1Z0H A;  1S0F A;  2J1R A;  4LE4 A;  4KNC A;  1BVP 1;  1UZ0 A;  1S4C A;  4AVA A;  1CAV A;  3PU8 A;  1YQ2 A;  5A1A A;  1NY7 1;  2YU1 A;  1QQP 1;  1WKY A;  3EYP A;  1XB9 A;  2VZP A;  3APB A;  4XEZ A;  3ROU A;  2R1D A;  3IN9 A;  1EY2 A;  2PHL A;  1HV1 A;  1DGW A;  4YZ1 A;  2QQU A;  3JBG 3;  5FWE A;  2NPI A;  4WM8 C;  4R4X A;  5CG9 A;  1C5H A;  1RUJ 2;  2SBA A;  4LOT A;  1ZRC A;  1ZBE 3;  4QX7 A;  5A3M A;  4LO4 B;  1AL2 3;  4WZF A;  4BXF A;  5CKN A;  1HRV 1;  2E6V A;  1F15 A;  3LPG A;  4MGK E;  4QKD A;  3H9A A;  4RQP C;  3WNL A;  4K20 A;  5T55 A;  1H2K A;  2J22 A;  4MYE A;  1I5Z A;  1FV2 A;  1OA4 A;  3OY8 B;  4XJA A;  3SNM A;  3OCP A;  4Q0S A;  4AI9 A;  3O1S A;  1J84 A;  1UZZ A;  4DIQ A;  4XMA A;  4IV1 B;  3AC0 A;  1CX1 A;  2XB6 C;  2XXZ A;  4PCR A;  3TN9 3;  4N53 C;  5JR7 B;  1C4R A;  3H1W A;  1UYZ A;  3MF6 A;  5JOX A;  1NA1 B;  3DCQ A;  4OLL A;  2PXJ A;  2X5I B;  1V9U 2;  2G1M A;  2JIG A;  5FZ3 A;  3BTZ A;  1I9R A;  5FP7 A;  1RUI 3;  4NR1 A;  1Q8Q A;  1ENS A;  1J3P A;  2ZKL A;  5FPZ A;  4AVS A;  4L2N A;  3DN7 A;  5AC9 3;  1DBN A;  3ITQ A;  2Y6J A;  3G6J B;  1BEV 3;  3NAP B;  1CPN A;  2XUE A;  4YFW A;  4Z82 A;  4LBJ A;  5LB6 A;  3IBM A;  4B4P A;  4CDW C;  2UYB A;  5FZL A;  1ND3 B;  1GU3 A;  1F5J A;  2X53 S;  3OB8 A;  4Y5S A;  5T52 A;  1F35 A;  4NPM A;  3IWZ A;  4U36 A;  4O7X A;  2RS5 1;  2AYH A;  2ZJC A;  5JVV A;  2VNO A;  2WBK A;  3CEW A;  2XJQ A;  4ONU A;  1E5S A;  4FQ4 A;  2A6Y A;  5BNO C;  4ZS2 A;  2W87 A;  1UU5 A;  4XDP A;  3BOP A;  2VBB A;  3GXU A;  3VDD C;  1UWW A;  3RZG A;  2JDY A;  3AZV A;  3PUQ A;  1J1T A;  5F9T A;  4XHB A;  4QWN A;  3KT4 A;  1Z78 A;  2K0G A;  4LKE A;  2UU8 A;  3JD7 1;  1JZ7 A;  2G19 A;  2YMZ A;  5A33 B;  1OH4 A;  2WFP A;  2ZX2 A;  5JAX A;  3KCY A;  1W06 A;  4K6B A;  1BBT 1;  4SBV A;  1DQ1 A;  5IVC A;  4RL7 A;  3VBO A;  3H1Y A;  2WII B;  2XWJ B;  4H7L A;  3VD3 A;  1JOB A;  1XNB A;  2QKD A;  2NQY A;  2RVA A;  4XFG A;  1OT5 A;  4P5Y A;  2Q8E A;  4AQ2 A;  3CNA A;  1TE1 B;  4JV4 A;  4R9B A;  3VBS A;  3VZL A;  4F83 A;  4HON A;  2LUW A;  2PHW A;  3ZFF B;  1ND2 A;  5IVJ A;  3N7L A;  4IGP A;  3VBU C;  4A2U A;  4QQP A;  1GOH A;  4CDQ A;  2JEC A;  4XUP A;  5C9A C;  4M01 A;  1UZV A;  3U4S A;  1JU4 A;  4NAM A;  4OI2 A;  1AR9 1;  4L92 A;  4MG2 A;  3OPW A;  4KWL A;  3POB A;  1Q3E A;  4CDU A;  1B35 C;  4C1W A;  1QH6 A;  3WP4 A;  2ARB A;  3BU7 A;  3ZN5 A;  3IMM A;  1CAU A;  2D6P A;  4IV1 C;  2DUQ A;  2D7F A;  2QQK A;  1SHW B;  2WKK A;  2X5I C;  2R16 A;  1G9D A;  4D6Q A;  4YM2 A;  1RXG A;  1JOJ A;  4A4A A;  3P6B A;  2V72 A;  4RA0 A;  4IND A;  1LRH A;  1W2U A;  2DVD A;  3MGU A;  3RI8 A;  1H9W A;  4QKB A;  3WV6 A;  4IE7 A;  5ANN A;  3SEE A;  4AAP A;  4FVV A;  1IS5 A;  4YM3 A;  2RJL A;  1UYX A;  5FQ0 B;  1QJF A;  3W59 A;  4M0H A;  3WD5 A;  4AED B;  2GNM A;  3NAP C;  1AUY A;  1VBB 1;  2QUO A;  2VTX A;  2ADE A;  4PF1 A;  3KHB A;  1UAI A;  4LQR A;  4A7Y A;  1NOV A;  4K21 A;  3WF3 A;  2R04 2;  4CCK A;  1W0O A;  3FLR A;  1GNY A;  1QWR A;  1KRI A;  1OKO A;  2I74 A;  5EP9 A;  2BNN A;  4IEW A;  4CU8 A;  2QQN A;  5FZ4 A;  2JDM A;  4JGY A;  1ZZB A;  2AC1 A;  2WNV B;  3O14 A;  2IXJ A;  5C8C A;  5JMO A;  1GWM A;  1HQL A;  2ZX0 A;  4E4S A;  2V73 A;  1ODN A;  2BTV C;  3AKR A;  3HT1 A;  5JR2 A;  2XJT A;  1R08 2;  1NCQ B;  1PMJ X;  3U1X A;  3WCS A;  4AXO A;  1W04 A;  5FFO C;  4QDS A;  4UFJ A;  1ULP A;  3KD4 A;  4J6G A;  1W6Q B;  2VNG A;  3WG2 A;  3RZZ A;  2CAU A;  4H14 A;  4IV1 A;  3ZFG A;  1HB2 A;  1VRH 2;  1R64 A;  2HKX A;  3GNE A;  3MIE A;  3NNJ A;  4QPY A;  5A7O A;  4XHX A;  4BU2 A;  4EN7 B;  4XCB A;  3HOB A;  3WW3 A;  1YLL A;  4EYU A;  4A44 A;  2R0F A;  2VL4 A;  3WDT A;  1WCU A;  2I07 B;  1U5X A;  1YI7 A;  1GP6 A;  1XSR A;  1DLL A;  3KT7 A;  5EZW A;  3POF A;  5SV8 A;  2A3Y A;  3H3U A;  5CFD A;  2QDR A;  1RUI 1;  1YCI A;  1YFX A;  2GP5 A;  5LBC A;  1DZQ A;  4EN0 A;  3I3M A;  4ASM B;  4QM8 A;  4DO0 A;  3MIG A;  4Z2A A;  2B9V A;  2CV6 A;  5FP4 A;  4URA A;  3I2I A;  1CR7 A;  1TZO A;  1W6Q A;  1NG0 A;  4NII A;  1Q8O A;  2E7T A;  5FBJ A;  3BPS A;  2PAE A;  3ACI A;  3V0B B;  3ZYG A;  1TNR A;  2A73 B;  1KGY A;  3A7Q A;  1DQ0 A;  2W5F A;  4IGQ A;  5FKC A;  1UY3 A;  3U10 A;  5A1F A;  4OHY A;  1PNF A;  1Z7S 1;  4CP2 A;  2C0Z A;  1K5M A;  3KQ4 B;  4GQ7 A;  4QB1 A;  4CPB D;  1RUF 2;  4AED C;  2R49 A;  4L11 A;  5JZG B;  3ILR A;  1OD3 A;  2WS9 2;  4EN9 B;  2W95 A;  3VB9 A;  2XQX A;  2Y6F A;  4XW3 A;  4FAG A;  5CIS A;  2B8M A;  1JS9 A;  2QZ3 A;  1FAY A;  1DZT A;  2XJU A;  5D21 A;  4COY A;  3ENR A;  4W6X A;  5ACA 3;  4QGM A;  1LJ7 A;  1LEM A;  2PAK A;  4B3N A;  1Q43 A;  2P34 A;  5FZ0 A;  3I54 A;  5BUV A;  3BN6 A;  3OEA A;  3KHC A;  2V4V A;  5IK8 A;  3WF0 A;  4XPV A;  1RUD 3;  3LPF A;  1LTE A;  2EIC A;  2D6L X;  2ZX3 A;  3H0O A;  4OZX A;  5E89 A;  1FMD 2;  1JOP A;  1S0J A;  5CIR A;  1WW4 A;  2K46 A;  5KC6 A;  3HBK A;  4LHL A;  5FYB A;  3RWN A;  3WLU A;  5FWJ A;  1UX6 A;  4Z2W A;  5FY0 A;  2XJR A;  3NRU A;  1AYN 1;  4UYB A;  5JXG A;  2GC2 A;  2DVF A;  3ZXA C;  1NA1 A;  1URX A;  3RMY A;  1KS4 A;  3ETP A;  2JXA A;  2ZA9 A;  2C9K A;  3H50 A;  4JQR A;  1Q8P A;  2E51 A;  3MUZ 1;  1SLB A;  3C8X A;  4JGZ C;  4LJH A;  2DTW A;  3CJI A;  4FBF A;  3CKH A;  4LA2 A;  1HLC A;  2IZW A;  3POW A;  1BQP A;  2ZX4 A;  4ZU7 A;  3KGZ A;  1OFS A;  4YG6 A;  2Y60 A;  3DEC A;  1TVG A;  2VMG A;  3DL3 A;  2ZEX A;  4CEW A;  1JZ5 A;  1YXW A;  1W6P B;  2YGL A;  3ILN A;  4QHO A;  4BQW A;  1O4T A;  4CTE A;  5C3P A;  2E9Q A;  1RL3 A;  3U14 A;  1UY4 A;  3KGL A;  2DF7 A;  4XMI A;  1GNH A;  4K3U A;  2PN5 A;  4QX8 A;  3P5B A;  4E4H A;  3BI3 A;  2IVI B;  2RR1 1;  3VBS C;  1HXS 3;  2VVF A;  2XLF A;  4MV2 A;  5FYV A;  1PMI A;  5IFT A;  2GAU A;  3POY A;  3ZFF C;  1ZM1 A;  1NXD 1;  2CWS A;  2Y8K A;  2EIG A;  4BQ3 A;  4WVW A;  1GP5 A;  2GND A;  5ACA 1;  1PNG A;  3THP A;  3URF A;  3S57 A;  1S2K A;  2CY6 A;  4HKW A;  1RVF 2;  4L97 A;  3D0S A;  1G7Y A;  1YNA A;  3T0D A;  2MHF A;  1WW6 A;  1PO2 3;  1QDO A;  3TYJ A;  3CBN A;  2R30 A;  1J58 A;  3ZIW A;  3VKL A;  3VBO C;  2QVS B;  4CUC A;  4Y33 A;  4E8D A;  4IE5 A;  2NP0 A;  5ABJ C;  3AP5 A;  2R1B A;  3ZFE B;  2Q1F A;  1PVC 3;  2JB4 A;  4I02 A;  4NHK A;  4Y5T A;  5T3N A;  3WG1 A;  5B4N A;  4WVV A;  4MVT A;  4YW1 A;  2WYS A;  1OMI A;  1H30 A;  1MZ6 A;  4FPG A;  4OHV A;  4WVM A;  3VBU A;  4TTG A;  4BQ2 A;  3M4F A;  4HVQ A;  5F3G A;  2ATF A;  4JTO A;  4TZD A;  1AR6 1;  4QHB A;  5FYS A;  3BB6 A;  3OGV A;  3IPV A;  3VHN A;  4N43 C;  2LRO A;  2XOM A;  1GLH A;  4FOQ A;  3VGI A;  2RS1 1;  1QOO A;  1YIP A;  1OUS A;  1O7F A;  2VNV A;  1QOS A;  1S0E A;  1OF4 A;  1QDC A;  4MH0 E;  1HXS 1;  3JQX A;  4M3C A;  4YLZ A;  2KM2 A;  4W4Z A;  2OW4 A;  4NHL A;  1JHJ A;  2ZGT A;  1W2N A;  3AX4 A;  1ZZ9 A;  1W90 A;  1APN A;  4O9E A;  4YVW B;  1W6M B;  3RZL A;  2CWM A;  4ZS3 A;  5L9R A;  2VCM A;  4EQV A;  1QGL A;  1UMI A;  5J37 A;  2ZGR A;  4YZ3 A;  4MUV A;  5K0U C;  2RM2 1;  3VBS B;  2I45 A;  3TNP B;  1T6B X;  2UWB A;  3T1L A;  2TUN A;  3DPR C;  4XE9 A;  2B5H A;  1LEC A;  4XAA A;  3E6D A;  3LEG A;  4DY3 A;  3R4S A;  3I2H A;  3S5A A;  1MVQ A;  4V1P A;  2H6B A;  1J3Q A;  1W6O B;  4COZ A;  3VD9 A;  2FMD A;  4P9G A;  3WDY A;  1H1A A;  3NO8 A;  1LHV A;  4MXW A;  4YM1 A;  5FCC A;  1OQE A;  3X29 B;  3BKZ A;  1VBA 3;  3J4U H;  1IS6 A;  3N4M A;  2ZAB A;  2JG8 C;  2YU2 A;  1RIR A;  3N7K A;  5BNN A;  1OVP A;  4AFA A;  2WQ4 A;  4XIO A;  1C57 A;  1DIW A;  2ZKN A;  2BEO A;  3AL5 A;  4YGC A;  1BEV 2;  5BY5 A;  3RNS A;  3RJ2 X;  4MGZ E;  5LEK A;  1QXJ A;  3AVR A;  3S6P A;  1KS5 A;  4PI2 A;  3T2O A;  1BVV A;  1Y7B A;  4JGY C;  5FMD A;  5A3O A;  2BGO A;  3CJX A;  3MFC A;  3ZPY A;  3I3B A;  1VLN A;  2D6M A;  4JDO A;  2RS1 3;  3VBH B;  5IAX A;  2ZEZ A;  2WNV C;  4ZPI A;  5IWF A;  3VBR B;  2JIJ A;  3AP6 A;  1AXZ A;  3ZYH A;  4MZU A;  2WR9 A;  2EXI A;  3FC0 A;  2CHH A;  1LGN A;  2NMO A;  3SKJ E;  3J8F 1;  4F3J A;  1JYW A;  5FUI A;  3O1V A;  4AI1 A;  4JKM A;  1D7P M;  2OS2 A;  2MEV 2;  2D97 A;  4Y24 A;  2WLP A;  1H9P A;  3PUA A;  3AKT A;  5FY4 A;  1HQW A;  1PMH X;  2BYV E;  5CKM A;  4GB3 2;  1WA6 X;  3PVO A;  3VDB A;  4XZU G;  3WY6 A;  1ULG A;  3IDE A;  3SCG A;  4FPO B;  4DUX A;  4BQ5 A;  1EV1 3;  1EAH 3;  5IK7 A;  3RYK A;  3NJX A;  1H2L A;  2ZGK A;  2LRP A;  5DXD A;  1GQG A;  2P1B A;  1NA1 C;  1CES A;  4XDO A;  1OA2 A;  1S55 A;  1KEX A;  2LAL A;  2JX9 A;  2YRO A;  4XF9 A;  1NCR B;  3D5O A;  3MW2 A;  2G9Z A;  1TG7 A;  1CQ9 A;  2DCZ A;  2Z5W A;  4IV3 C;  4XUT A;  5ACA 2;  3OBA A;  4D7Y A;  1COV 1;  3HQX A;  2VE1 A;  5G04 L;  1PGS A;  1OOP C;  3FHA A;  3ZYI B;  4AHZ A;  4A3Z A;  3ZKU A;  4JQT A;  3TWI A;  3UKN A;  1PVX A;  1SG3 A;  1V6K A;  1N47 A;  5FYM A;  3R6S A;  1A8M A;  1IPJ A;  3BTY A;  1NLQ A;  3TEX A;  3U75 A;  4CEW C;  4QPI A;  1X9P A;  5I0U A;  3WHU A;  1CVN A;  3PUI A;  3B9C A;  2DFC A;  2IXC A;  3I3E A;  1QNY A;  1YFY A;  2VD7 A;  4CXW A;  1NCR C;  3H3Z A;  3J9S A;  4HL0 A;  1B35 A;  3KVB A;  4P9L A;  4GA9 A;  1GZ9 A;  3NV2 A;  1CON A;  5C3R A;  2X5I A;  5GAL A;  3WNP A;  2ZGL A;  4DUV A;  1YJL A;  1VBC 3;  4FAH A;  3GBG A;  4IEP A;  2GAL A;  1JYT A;  2DCK A;  1PO1 3;  3I59 A;  2HYK A;  3VBF C;  1QEX A;  3AP9 A;  2HWB 3;  1UMZ A;  2ADD A;  4DZG A;  2EIB A;  4KL1 A;  3VD4 A;  1W05 A;  3NV1 A;  4FPY A;  1EV1 1;  1VMH A;  2Q8D A;  1FPN 3;  1R09 3;  1UZY A;  4D3W A;  3ZFE C;  1AZD A;  1ASJ 3;  1GBG A;  1VBE 2;  2D3S A;  4GWJ A;  4N7U A;  3T4V A;  2JDA A;  4HG6 B;  1AR8 3;  2ZAC A;  1EAH 1;  1UOF A;  3VN4 A;  3ZR5 A;  2IXL A;  2YFU A;  2J1U A;  5FZE A;  5KHG A;  1MQT A;  3OYW A;  2E63 A;  5C5U A;  2R06 2;  1RUG 2;  1UOJ A;  2HWC 1;  4P9I A;  3ETQ A;  4YFZ A;  1R1A 2;  5JIA A;  5C8C B;  2PLV 2;  1BYH A;  2GDF A;  3LA7 A;  5CYY A;  2D40 A;  3AYA A;  4TXW A;  1AYM 2;  1UXX X;  1YFU A;  3QLQ A;  1GFF 2;  4KI5 M;  1XNK A;  4K1Z A;  3CJI B;  1RUF 1;  5KC5 A;  4ES9 A;  2P2K A;  4G3Y C;  3MLK A;  2VUD A;  5CAZ A;  2ES3 A;  2VAU A;  3JD7 2;  2OA2 A;  4CCD A;  1SCS A;  4Q4W 2;  4MLO A;  1ZZ8 A;  1WLT A;  1OC1 A;  3LEK A;  2RS5 3;  5FXW A;  2XJV A;  4QPW A;  3AFK A;  5FMB A;  3VKF C;  2D3P A;  3BTA A;  1H4G A;  4NHM A;  2W47 A;  3ACF A;  3ILF A;  3MBW A;  2KD7 A;  5FRA A;  3ELN A;  2E53 A;  5A3W A;  4AVT A;  2IWG B;  2NMN A;  5IFP A;  2BW8 A;  2P37 A;  1CN1 A;  3MIH A;  1GAN A;  1JUH A;  3C7G A;  3DYM A;  1K12 A;  1G9C A;  4XFI A;  4LIT A;  5GZG A;  4QMA A;  4AEK A;  3FJS A;  4R52 A;  1LOF C;  1R1A 3;  5FP8 A;  5EQU A;  4D6S A;  4N90 A;  5FY8 A;  3JBG 2;  4K9S A;  3E97 A;  3AZX A;  3S7E A;  5JOZ A;  1U12 A;  3KQR A;  1PGL 2;  1XU1 A;  2RJK A;  2AR6 A;  1ASJ 1;  3FWE A;  4NRO A;  3SIT A;  3W9A A;  4YVS C;  5JCT A;  5FOJ B;  3CF6 E;  1W28 A;  5KXB A;  2JD4 A;  1RUG 3;  4YG0 A;  3R4D B;  1ZRR A;  3G7D A;  5JZG A;  3W5N A;  2XDV A;  1R08 1;  4LHN A;  2HBT A;  5IJR A;  4FTS A;  3IAP A;  4MGS A;  2XJP A;  2VM9 A;  3FFZ A;  1JN2 P;  4OI1 A;  2DUO A;  2WIN B;  1GR3 A;  4ATE A;  1RHI 1;  4HVO A;  3V0A A;  1YQC A;  3KM5 A;  1HJG A;  5C8C C;  1RJ8 A;  3RSJ A;  2XBO 3;  3LZZ A;  3PIJ A;  4R9D A;  4FSJ A;  5CBL A;  3AZW A;  2XKP A;  2WZR 2;  4LIU A;  2FDJ A;  4DMI A;  4EN8 B;  2R32 A;  1UXZ A;  4AVB A;  1VMJ A;  1FNZ A;  2OVU A;  3OBZ A;  1LOB A;  3ZR6 A;  1CPM A;  3OD0 A;  4P9Y A;  1ND3 A;  3TB0 A;  1QQP 3;  1VMF A;  3OBT A;  3O0V A;  4KWU A;  1AXK A;  2VXR A;  5FZM A;  1NZC A;  2ZGM A;  3VBH A;  5C7G A;  4EWA A;  4IER A;  1LU1 A;  5JXJ A;  3AP7 A;  3WF4 A;  1TNF A;  2RMU 3;  1ZBE 1;  2JDH A;  1PX3 A;  4XFB A;  2CAV A;  2J1A A;  5FRE A;  1VBC 1;  1DYO A;  1S0C A;  3AMP A;  1DQ5 A;  3ME2 A;  2GU9 A;  3E6B A;  5B2G B;  3AYC A;  1REF A;  2E26 A;  3M1H A;  1DGL A;  3WXP A;  1FI2 A;  4DQA A;  3HBZ A;  5G05 L;  3CO2 A;  4Q4X 1;  1O6U A;  3NJV A;  4JHZ A;  4JX0 A;  5LW9 A;  3H8R A;  4UBG A;  1D2S A;  2W3J A;  1MS0 A;  1G9F A;  5IAV A;  2LW8 A;  1RVF 1;  3ZVX A;  3UJO A;  2VMF A;  4ISR A;  1CWP A;  3LCP A;  1RC6 A;  3FBM A;  3RJR A;  3KCX A;  4ZON A;  4PBP A;  3OYW B;  2J1S A;  2B42 B;  3QD6 A;  4DRV A;  1EP0 A;  3K48 A;  1RHI 2;  2XVG A;  4A6O A;  2BGC A;  2ET7 A;  2W91 A;  1OVS A;  1K45 A;  1VRH 3;  2ZTN A;  2CU5 A;  4RGG A;  5FYY A;  3WNX A;  2DVA A;  1XND A;  2ZMN A;  4L0P A;  4P5H A;  4P00 B;  4YGE A;  2OYZ A;  5EXO A;  2QE3 A;  3U0Z A;  3D82 A;  2VW0 A;  4LHK A;  3ZDV A;  3D6E A;  4C0H A;  1H4H A;  2OZ6 A;  3UGF A;  1X36 A;  2K9Z A;  5A70 A;  5CFD B;  4Q1P A;  4ZKT B;  3LA2 A;  4QAW A;  3NNL A;  1RED A;  1WLD A;  2IFR A;  2VZR A;  3I2D A;  3K51 A;  1XE8 A;  4UW3 A;  2OQ6 A;  3VBU B;  1QJU 2;  4LKS A;  4N43 B;  2BBA A;  4YSF A;  5AVA A;  1OPO A;  4BA6 A;  1XE7 A;  3FL7 A;  4JCK A;  5E16 A;  3MFA A;  3UET A;  2NM1 A;  4IEZ A;  5C4W C;  5CNA A;  4Q0U A;  3C7O A;  2QNK A;  1QY4 A;  2LS6 A;  3JXS A;  3KT1 A;  4LO8 A;  5GM0 A;  4B4Q A;  1AL2 1;  4RN5 A;  4C91 A;  4DXS A;  1IS4 A;  5LRR A;  4OQ8 A;  2BGP A;  4Y1Y A;  4LLO A;  1ULD A;  1W3X A;  3DYP A;  4MSV A;  2Q0A A;  4RYD A;  5FPV A;  1R1A 1;  5D1I A;  2VPV A;  2JDU A;  1PO2 1;  4NWV A;  3ZYB A;  4YPJ A;  2C26 A;  3EMR A;  3RVH A;  4CU6 A;  1Y9M A;  2ZGN A;  2ZZQ A;  1GQP A;  4I2O A;  2VY0 A;  2E7A A;  1RXF A;  1VP6 A;  3FUQ A;  3I2K A;  4L99 A;  5LY2 A;  5J36 A;  3M7A A;  4IEU A;  1D2Q A;  1DG6 A;  2PLV 3;  5AVP A;  4FPE A;  5H9Q A;  4C90 A;  2P3Y A;  1BJQ A;  1HRV 2;  1GWL A;  1AJO A;  4AFD A;  3AJY A;  2AH2 A;  3MO4 A;  5FZ8 A;  3B00 A;  3M3C A;  5C33 A;  3OF1 A;  1RUJ 1;  2ORX A;  4J25 A;  3ZM8 A;  3S30 A;  3LA3 A;  2RE9 A;  4Y4Y A;  4LHS A;  1IHM A;  3E5Q A;  4KWJ A;  4PIX A;  3H7J A;  4UAP A;  5DUX A;  2MPF A;  1QQP 2;  4XAC A;  4YGD A;  5L9B A;  5JXH A;  2HWE 1;  3MI8 A;  2PFW A;  3ATG A;  4JAA A;  4OUM A;  4QU2 A;  5H9R A;  1NUK A;  3HAG A;  2YUE A;  2WFF 2;  4DIN B;  3LDB A;  4YG3 A;  1UZW A;  1N3Q A;  1JH5 A;  1BZW A;  3VBR C;  3VDD B;  5EYY A;  2Q8O A;  4HMZ A;  5H9S A;  1GMM A;  4H3W A;  4IL7 A;  5C3Q A;  4FXK B;  2D98 A;  4Y20 A;  4AK3 A;  4IEO A;  4D7S A;  5EIY B;  5HBA A;  2YBK A;  2A6V A;  4LUK A;  3R0R A;  3RYR A;  4E27 A;  5IVF A;  2RHP A;  1STM A;  3ZSJ A;  4QB2 A;  4JHT A;  4N53 A;  3WP5 A;  4GWI A;  2WT2 A;  3ZMN A;  2FHR A;  1HV0 A;  4GJY A;  3A23 A;  1L3J A;  1AR7 3;  4PI0 A;  5K0U A;  3MIB A;  1BBT 3;  1VJ2 A;  4BM8 A;  2YC4 A;  2JKB A;  4HAN A;  3DXT A;  1RGS A;  2VUL A;  5LY1 A;  3WDW A;  2D3R A;  2Y34 A;  4YM0 A;  3NST A;  4YW4 A;  1QJZ A;  2B39 A;  1ZRI A;  1PK6 C;  2ZHN A;  3UL2 A;  1O91 A;  4TLF A;  1LHW A;  3M70 A;  4B4R A;  3QH7 A;  5CA6 A;  1GQH A;  1A3K A;  3E6C C;  4FPH A;  2CGN A;  1RJ7 A;  1G8W A;  4G9S B;  1AL0 G;  1QU0 A;  1UY0 A;  3MF9 A;  4EJR A;  3PUR A;  2X09 A;  5GLU A;  2R07 2;  3UKV A;  3DKQ A;  5EFU A;  2OPW A;  4XF4 A;  2RJ2 A;  4RQP B;  2ZOE B;  4GH4 A;  4PQ9 A;  3ZN6 A;  1WW7 A;  3WNO A;  2FDH A;  3WNK A;  5JXI A;  3LSE A;  3GHN A;  1S0D A;  2XVL A;  3FBY A;  1NLS A;  1V9U 3;  1QHD A;  3B02 A;  3FE5 A;  2UWA A;  5FZ1 A;  3ZXJ A;  2JG9 B;  2WFF 1;  5JOW A;  2ARC A;  2BP6 A;  2HH9 A;  4XYX A;  2VZO A;  4AFC A;  2AEY A;  2HWD 2;  2ARE A;  2VNR A;  2XHK A;  3FLT A;  3KCC A;  4IGO A;  4DEV A;  4E4Z A;  4MOA A;  4YZ2 A;  4Q4X 2;  3LEI A;  1SPP A;  5KHJ A;  3NAP A;  3JD7 3;  4Q2F A;  4RD7 A;  1SDW A;  2WLQ A;  3CMG A;  1MEC 3;  1RIT A;  1JZ3 A;  2V09 A;  4HSJ A;  3W58 A;  5FMC A;  5FPX A;  3VD7 A;  4FFF A;  3FN9 A;  1MS4 A;  1VAM A;  1ZNP A;  2ZBJ A;  3AYD A;  4HLT A;  1ST8 A;  4CDX A;  3Q8B A;  1PX4 A;  2VUJ A;  3J7N A;  4FP3 A;  5A7P A;  2X05 A;  5JSO A;  1GYK A;  3O1U A;  1X9T A;  2O14 A;  2UY8 A;  4XFF A;  4XTP A;  2ZGP A;  5FPA A;  4CP1 A;  2WA3 A;  1YQ5 A;  3WQ7 A;  5L9V A;  4CP9 A;  3TN9 1;  2TEP A;  4YVS A;  3POJ A;  4FCA A;  3EB7 A;  1WCS A;  3FHI B;  1W8Z A;  3AZZ A;  5A7W B;  4NUB A;  4BQ4 A;  2WAA A;  2WDB A;  1W99 A;  4LO7 A;  3A21 A;  1UD1 A;  1S0B A;  1FPN 2;  1R09 2;  2VVE A;  4FXG B;  1RHI 3;  5FZA A;  1OQ1 A;  3K3O A;  4UFL A;  5EPA A;  4AOC A;  1C1F A;  2Q4S A;  2EAL A;  3HIF A;  4HXC A;  2W92 A;  4QPG C;  4CRQ A;  5JSR A;  3O1M A;  5FO9 B;  2H0B A;  1ENR A;  5JPM B;  3AYE A;  1MQT B;  4E8C A;  1BK1 A;  4RR3 B;  4GUL A;  1YRZ A;  4GD4 A;  2DVB A;  4JRL A;  5LK5 A;  2PA7 A;  1HB1 A;  1SLL A;  1W8O A;  2C4X A;  3A22 A;  4Q0Q A;  3RGB A;  1S2B A;  2RMU 1;  2A7A A;  2B4K A;  3OD4 A;  2X29 A;  2PHX A;  3NNG A;  1PO1 1;  3H8U A;  4OYU A;  4XJ9 A;  4KBB A;  2A3W A;  1I1E A;  5A32 B;  1H8T C;  2JE9 A;  1DZR A;  1V6M A;  5A6Z A;  5FZF A;  5BNQ A;  1ACC A;  3DEM A;  5L7O B;  2RR1 3;  5DQ0 A;  5I91 A;  2BUK A;  2XWB B;  5LA0 A;  4UOJ A;  2JDP A;  4XJ8 A;  1UCX A;  3OGR A;  5J09 A;  2VJX A;  3HN3 A;  2VTX J;  3OUH A;  1OI6 A;  2W68 A;  1FXZ A;  3SXW A;  5LRS A;  5C4W A;  3IMN A;  4PBO A;  5DDJ 2;  3ZLI A;  1XBF A;  4J1X A;  3T09 A;  1CZT A;  3III A;  4AHY A;  1US3 A;  1NT0 A;  1CJP A;  1XNA A;  3DYO A;  3K3N A;  4Q4W 1;  5FOB B;  4LOS A;  2HWF 3;  3KF5 A;  2JEN A;  4LUM A;  3ZXE A;  1LOE A;  1PVC 2;  5FO7 B;  4I0A A;  2ZHM A;  3O5S A;  4OMC A;  5GLV A;  4CXX A;  4HBN A;  1FYU A;  1UF2 C;  4Q8K A;  5KBF A;  2F4P A;  5LA1 A;  5HCA A;  1R08 3;  2GMP A;  4FT8 A;  2VCB A;  3E5X A;  3K4Z A;  3GYD A;  1T6G C;  3NV4 A;  2GZW A;  2JD9 A;  3AMM A;  2BWC A;  4XIK A;  5BPX A;  5T5O A;  3T4H B;  3ZSL A;  3NJZ A;  2VMC A;  4Q0V A;  1LGB A;  2WA4 A;  4NN0 A;  3S0M A;  4PHZ A;  4AG4 A;  1SLI A;  1QIQ A;  3H8X A;  4LBQ B;  4YVW A;  1GZC A;  2WT1 A;  3PTR B;  2XR4 A;  5K7P A;  1FAT A;  4Y4R A;  5FPU A;  2YV8 A;  2MNG A;  3EXU A;  1W8F A;  4WM7 A;  1AF9 A;  1WUV A;  4HET A;  3ZSE A;  4RS5 B;  1VBD 1;  3GZT B;  1IS3 A;  2W46 A;  3H7Y A;  3M3E A;  1DGR N;  4B8E A;  4J1W A;  3T2T A;  1LOA A;  2C6S A;  3PJQ A;  1ND3 C;  2YPJ A;  2XKO A;  5T5P A;  3FUO A;  1PM4 A;  2AAC A;  3QOP A;  1A34 A;  4ZXE A;  3VKM A;  1CGP A;  3MW3 A;  1ND2 C;  1J3R A;  4NPL A;  4QQO A;  2JKX A;  3NQH A;  1CAX B;  5T50 A;  1K3I A;  3WZ1 A;  5FBZ A;  4NOT A;  3FHQ A;  1PIV 2;  3Q8E A;  2A71 A;  2ZZJ A;  2WZE A;  4FQZ A;  3I97 A;  3EO6 A;  1TEI A;  4IET A;  2ZAA A;  4QGN A;  1JW6 A;  2FQP A;  1ASJ 2;  4YVS B;  4MGY E;  4XBQ A;  4LE3 A;  5FPB A;  2WO1 A;  5BNP A;  1YFW A;  2VZ1 A;  2Y6L A;  2HWF 1;  1W8T A;  2UYA A;  4FPF A;  1SFP A;  2Y0I A;  1S0G A;  1NQD A;  5FDB A;  4BK5 A;  5DAX A;  1SEF A;  4QKF A;  1W03 A;  3MHZ A;  5F6K A;  1UOB A;  4MXW B;  2DYC A;  5FPL A;  2B46 X;  3CL1 A;  3VLB B;  1UU6 A;  1HW5 A;  3QAC A;  3O7O A;  2HBU A;  1QJY 1;  5JUV A;  3M3I A;  3ZXK A;  1XRU A;  5JMC A;  4LBN A;  2GNB A;  5IAT A;  2R06 3;  1V0A A;  3LWC A;  4LBL A;  1GKB A;  3R4U A;  4UT5 A;  1Z7S 2;  2XML A;  1FOD 2;  2P3K A;  3B3Q E;  4B7E A;  1Q8S A;  1RUD 2;  5D2A A;  4ZU4 A;  1E5I A;  1QH7 A;  4JKK A;  3ZYJ B;  5BNP B;  4WM8 B;  3F95 A;  2VMH A;  4GIQ A;  4XC9 A;  4CUG A;  4CCN A;  2JG9 A;  3ON7 A;  1GOF A;  1YJK A;  1YIF A;  3WNN A;  1K5M C;  3ZXF A;  4AHX A;  3KMH A;  2D44 A;  3K2O A;  1OLM E;  5A32 A;  3GCW A;  1MR5 A;  1XYP A;  5L7O A;  5K0U B;  1W2A X;  3F2Z A;  4P14 A;  4ARX A;  5GZD A;  3W20 A;  1NE4 A;  3GHM A;  1W2T A;  3NJY A;  2PHF A;  1HQN A;  3SH4 A;  1LHU A;  1WLW A;  4PDW B;  2WWJ A;  1YWK A;  4LLF A;  5GZE A;  4EN6 B;  4CDX B;  1JMU B;  3RFR A;  3VBO B;  5DAV A;  2WN3 A;  3POG A;  1IQA A;  4EWE A;  3C7E A;  2R7E B;  4F7Z A;  1OH3 A;  2OKX A;  1LHN A;  1AX1 A;  1V6N A;  2LM3 A;  3LEM A;  4PIY A;  2B7Y A;  4QX3 A;  3WIN E;  5IHR A;  1O4Y A;  3PJY A;  4O61 A;  5D8A B;  2QDN A;  4FTB A;  1BMV 1;  4AL9 A;  4OI0 A;  1X8E A;  5JWP A;  5T5J A;  4BJ0 A;  4YW2 A;  1OD5 A;  1AL2 2;  1BCX A;  1QJY 3;  3N9N A;  4NHY A;  5C5T A;  1JYI A;  3SKV A;  1VR3 A;  1UNB A;  3VZO A;  2QCS B;  5LBF A;  4AGV A;  1PGW 2;  3N7J A;  3WDU A;  1RTV A;  2ETE A;  2VME A;  4GXL A;  3H8O A;  3WQ1 A;  1IOA A;  5FZG A;  5CFC B;  3VDC A;  3OTF A;  1U0A A;  5I93 A;  2NN8 A;  2OX0 A;  3OUI A;  4ITC A;  4QDR A;  3MUY 1;  3WNM A;  2Y26 A;  2GMM A;  1F2N A;  3KV9 A;  3LQC A;  2EF6 A;  2JDK A;  2BJS A;  5DAP A;  1A8D A;  4BB3 A;  2ZEY A;  5FMO L;  4WM7 B;  2R6Q A;  2O8Q A;  4I0W B;  4IUG A;  4JGZ B;  4O9G A;  5JLV A;  4XJZ A;  3DPR A;  4FPL A;  5AFE A;  4GKY A;  4CDQ B;  5A1L A;  1POV 1;  3P1I A;  3RMX A;  3NVC A;  1CAW A;  3SLI A;  5BYN A;  3O1P A;  1OFN A;  4YW7 A;  2TNF A;  2DFB A;  2MEV 3;  1MPX A;  1AR8 1;  2RS1 2; 
#chains in the Genus database with same CATH homology
 2VCC A;  4CUB A;  2W1Q A;  3AC0 A;  1CX1 A;  3CZJ A;  2YC2 A;  5DPN A;  2W9X A;  1UYZ A;  3W5N A;  3THC A;  3POE A;  3K4D A;  2QQJ A;  1O59 A;  5IJR A;  3IAP A;  4XUQ A;  4MGS A;  3HEI A;  3CQO A;  2VM9 A;  2DCJ A;  4A41 A;  4A45 A;  2Y6J A;  3ACH A;  4ARY A;  3HJR A;  2QQO A;  3T08 A;  1GU3 A;  3OB8 A;  4AAX A;  1UXZ A;  2WBK A;  4KWU A;  3GDB A;  2W87 A;  5C7G A;  3T0A A;  3C7H A;  5JXJ A;  3GXU A;  3WF4 A;  1UWW A;  5LCW L;  1PX3 A;  4JKL A;  2J1A A;  2J1T A;  3U37 A;  1L7Q A;  1DYO A;  1XNT A;  1JZ7 A;  1OH4 A;  4MO3 M;  1WCQ A;  1JYN A;  3MV1 1;  2E26 A;  3E1F 1;  4PT6 A;  5C70 A;  3VD3 A;  5G05 L;  1JYV A;  4JX0 A;  2RVA A;  3NJV A;  4JHZ A;  1OT5 A;  4P5Y A;  2ORZ A;  2VTF A;  2W3J A;  4P02 B;  2LW8 A;  3K77 A;  1JU3 A;  1GOH A;  2VMF A;  4OZO A;  4XUP A;  1JU4 A;  1XC6 A;  2J1S A;  3POB A;  2ID4 A;  2VZS A;  1I5P A;  2JE8 A;  4A6O A;  2W91 A;  1J83 A;  1K45 A;  2QQK A;  4P00 B;  1SHW B;  4L0P A;  1JZ2 A;  1EUU A;  1GUI A;  2WO2 A;  2BER A;  4A4A A;  3P6B A;  2V72 A;  3HNM A;  4QB6 A;  4LPL A;  4XVH A;  3SEE A;  4BDV B;  4QAW A;  1UYX A;  2WNO A;  4ZZ8 A;  3HNB M;  4CU9 A;  2VZR A;  2Y6K A;  2WQ8 A;  4PF1 A;  4LKS A;  2BBA A;  1W8N A;  4LQR A;  3K4A A;  1SZB A;  3WF3 A;  3OGS A;  2VR4 A;  4KMQ A;  3FL7 A;  1GNY A;  3UET A;  1CZV A;  1H6Y A;  3C7O A;  4CU8 A;  4ZY9 A;  3GM8 A;  2LS6 A;  2QQN A;  3JXS A;  2YB7 A;  4RN5 A;  4DXS A;  1JI6 A;  5JMO A;  3WF1 A;  2BGP A;  5JR2 A;  3DYP A;  2E33 A;  4RYD A;  4XUN A;  1PMJ X;  4A42 A;  4QDS A;  1ULP A;  5B4X A;  4YPJ A;  3IAQ A;  2C26 A;  4CU6 A;  1R64 A;  1GQP A;  2WN2 A;  3I2K A;  3HOB A;  2RV9 A;  4A44 A;  2VL4 A;  2ZXQ A;  3POF A;  2WO3 A;  3MO4 A;  4QX0 A;  4DXT A;  3ABZ A;  4QX2 A;  2ORX A;  3ZM8 A;  2E31 A;  4Z2A A;  2B9V A;  4LHS A;  4UI9 L;  2Y6H A;  3I2I A;  4UAP A;  5JXH A;  3ACI A;  1NUK A;  1GOG A;  5EJ1 B;  1KGY A;  3A7Q A;  2W5F A;  1UY3 A;  1GMM A;  3KQ4 B;  4QB1 A;  5EIY B;  2VQU A;  1UY1 A;  2Y64 A;  2ZEW A;  1OD3 A;  5CIS A;  2W95 A;  2XQX A;  4QB2 A;  3UNP A;  3IDA A;  4GWI A;  2XON A;  3A23 A;  1K42 A;  2YC4 A;  1W9W A;  4M4R A;  3BN6 A;  3I2J A;  3OEA A;  2VZU A;  2V4V A;  1NZI A;  3WF0 A;  3LPF A;  2XHN A;  4CVU A;  2EIC A;  4DEQ A;  3I2F A;  1UY0 A;  3HPN A;  3NRU A;  2VOT A;  2X09 A;  5HXM A;  2VC9 A;  1JZ4 A;  2VMD A;  5JXG A;  2RJ2 A;  3SEP A;  3ETP A;  4P08 A;  2C9K A;  3IB3 A;  3WNO A;  2L9L A;  3MUZ 1;  3WNK A;  5JXI A;  3C8X A;  1UMH A;  3LE0 A;  3CKH A;  2VZO A;  1RYY A;  3T0B A;  2E32 A;  4DEV A;  3DEC A;  1TVG A;  4MOA A;  2J1E A;  2ZEX A;  3LEI A;  1JZ5 A;  1SPP A;  1UY4 A;  3CMG A;  1JZ3 A;  2CDO A;  1LNS A;  2WAO A;  3VD7 A;  3FN9 A;  5C71 A;  1W9S A;  3PUH A;  5CKQ A;  5HPO A;  1JZ8 A;  1PX4 A;  2X05 A;  5IFT A;  4CU7 A;  1F4H A;  1F4A A;  5IYY A;  2Y8K A;  3CIH A;  3I3D A;  1DP0 A;  4XUR A;  1IQD C;  1BHG A;  3POJ A;  2VZV A;  1P8J A;  3T0D A;  3EB7 A;  4ET7 A;  3ECQ A;  1DLC A;  2WAA A;  2WDB A;  1W99 A;  2W1U A;  3A21 A;  4CUC A;  4E8D A;  3I2G A;  4ZZ5 A;  5B4N A;  3WSO A;  2W92 A;  2WYS A;  3K75 B;  4TTG A;  2PQS A;  4E8C A;  2Z4F A;  3UES A;  3OGV A;  5J1X A;  1T2X A;  1W8O A;  3MV0 1;  2C4X A;  3A22 A;  2XOM A;  2B4K A;  1UY2 A;  3NNG A;  3WEZ A;  4OYU A;  3WQB A;  1OF4 A;  4W4Z A;  3DEM A;  1JHJ A;  3W5M A;  5DQ0 A;  5LA0 A;  4UOJ A;  4W8J A;  2J7M A;  3THD A;  1UMI A;  3OGR A;  2VJX A;  3HN3 A;  1SPP B;  2W1S A;  1UX7 A;  2EIE A;  3LEG A;  2WUH A;  3I2H A;  1CIY A;  1CZT A;  1W9T A;  3ACG A;  3III A;  3T09 A;  1US3 A;  3VD9 A;  1XNA A;  1NT0 A;  3DYO A;  4LOS A;  2W94 A;  4OMC A;  4FI9 A;  3GGL A;  4BK4 A;  2WAB A;  4XUO A;  5LA1 A;  4DUW A;  1O8S A;  1XPW A;  2VCB A;  3K4Z A;  1SDD B;  2JD9 A;  2VMC A;  4M4P A;  4PQQ A;  3T2O A;  5DN2 A;  2BGO A;  3I3B A;  2YG0 A;  2VCA A;  4AG4 A;  2ZEZ A;  5CZK A;  5I0D A;  2YFZ A;  1JYW A;  3SKJ E;  4GZ9 A;  5FUI A;  1US2 A;  4JKM A;  1D7P M;  2W46 A;  4QDQ A;  2QQM A;  2QQL A;  3OEB A;  1OF3 A;  1PMH X;  3VDA A;  4ZXE A;  5CKM A;  2JKX A;  3D3A A;  3NQH A;  1K3I A;  3VDB A;  4XZU G;  3FHQ A;  4W50 A;  4DUX A;  5LA2 A;  3NJX A;  2Y6G A;  2QBX A;  2WZE A;  2VZ3 A;  3I97 A;  1KEX A;  3WF2 A;  4XUT A;  3CDZ B;  1TG7 A;  4OUE A;  1UYY A;  2WO1 A;  2Y6L A;  2VZ1 A;  3OBA A;  1O8P A;  5G04 L;  1SFP A;  3FHA A;  4BK5 A;  4A3Z A;  3VD5 A;  1SG3 A;  3K46 A;  3PUI A;  5JUV A;  2EID A;  3I3E A;  1NAE A;  3CZU A;  2VO5 A;  2CDP A;  1EUT A;  4JKK A;  3WNP A;  1NKG A;  4D8M A;  2J1V A;  4DUV A;  4CUA A;  4BXS V;  2DCK A;  1GOF A;  2HYX A;  3WNN A;  1H6X A;  2EIB A;  3VD4 A;  5F7U A;  5DMY A;  3T2Q A;  3F2Z A;  2WZ8 A;  4ARX A;  3T2P A;  1JYX A;  1L7R A;  4OMD A;  4GWJ A;  2V5D A;  2JDA A;  2X10 A;  4HG6 B;  2WN3 A;  2VZQ A;  3POG A;  3C7E A;  2R7E B;  2HLE A;  2OKX A;  2YFU A;  2J1U A;  5IHR A;  4QX3 A;  2DDU A;  1JZ6 A;  4MGQ A;  4LOR A;  4QX1 A;  3HNY M;  1W0N A;  4BJ0 A;  5CYY A;  1ULO A;  4TXW A;  1UXX X;  4KI5 M;  3SKV A;  4DXR A;  2QQI A;  1HN1 A;  2W1W A;  2VME A;  3J7H A;  4LMF A;  1NX9 A;  3VDC A;  3OG2 A;  2J1R A;  1UZ0 A;  5EJZ B;  4D0Q A;  4QDR A;  3LEK A;  1YQ2 A;  5A1A A;  4QPW A;  3MUY 1;  3WNM A;  3BGA A;  3EYP A;  1WKY A;  3POI A;  2VZP A;  3LQC A;  2W47 A;  3ACF A;  3MBW A;  2KD7 A;  5IFP A;  4MAD A;  1CZS A;  2ZEY A;  4IUG A;  3C7G A;  3DYM A;  1K12 A;  4LOT A;  5CKN A;  2VZT A;  3C7F A;  3P1I A;  3LPG A;  3WNL A;  2VQT A;  2J22 A;  1MPX A;  1J84 A;  2BZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...