5FLHA

Free state of ni-quercetinase
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
190
structure length
190
Chain Sequence
IEYATRHRARSFIPPEPGKPYFIEKGLGDRAHLFGDLITIYAGGEQTENTFNFFTCEGPKGEVIPAHSHADTYEVFYITQGAVRLFVEDLEGEQHEKLLTPGDFGFVPKNCVHAYRMERHHSQVVGVAAGPGGTFERFFESLGTPAEELGLPVRPFVPEPEKFRTVPEQYDVRFRPDHQWHTGSIEGRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords QUERCETINASE QUED
publication title Quercetin 2,4-Dioxygenase Activates Dioxygen in a Side-on O2 -Ni Complex.
pubmed doi rcsb
source organism Streptomyces sp. fla
total genus 46
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5flhA00
4E2QA 1X82A 4LTAA 4IEPA 3IBMA 1CAVA 2Y0OA 1ZZBA 3LZZA 4YRDA 5KHGA 3FZ3A 4R8HA 1V70A 3NW4A 1QWRA 5FLIA 1DZRA 1CGPA 2Q30A 4IEYA 5J48A 4LA3A 5BV6A 4F7ZA 5KHHA 2QVSB 1CAVB 4J1WA 4J1XA 4QXKA 3I59A 3D0JA 2D5FA 2IXHA 4X6RB 2UY9A 2OYZA 4NVPA 3CO2A 3DL3A 3SMHA 3HT2A 3I59B 4GULA 4IEZA 1HW5A 3H1WA 1QXJA 1Q3EA 4MUVA 4XF0A 1YFWA 4DINB 3E6CC 1ZRCA 2PTMA 4AXOA 3JZVA 4XETA 3H7YA 2K0GA 3TNQA 2O8QA 4EWAA 4L2NA 1LRHA 2VECA 3GYDA 5BPXA 2GZWA 1YWKA 3ACLA 4MV2A 3RPQA 3SCFA 4EV0A 2PYTA 3RYKA 3OTFA 3O14A 1NXMA 4A2UA 3KSCA 3EJKA 4OFGA 4AVCA 1H1IA 4O9GA 3HT1A 1SQ4A 4JVAA 1ZZCA 4EWDA 3SCHA 2CGPA 2XLFA 4HSLA 2HJIA 1NE6A 4Q0PA 4QMAA 4H7LA 2XLGA 4QM8A 1VJ2A 2EAAA 4I01A 4ONUA 1NYWA 4CYDA 3BU7A 2GC1A 1O3TA 2Q0AA 3ES4A 5I0RA 3DV8A 3CEWA 1OFNA 2XHKA 5FCCA 2H6BA 1CX4A 4IEVA 2ZKLA 2UY8A 5LEKA 2BGCA 4YYOA 4XFGA 2GC0A 1WA4A 3E5UA 3GBFA 3PLQA 2MHFA 1J1LA 4Q0SA 3SXWA 4FAHA 2PA7A 5I8TA 2IXCA 1RL3A 2OPKA 3E5QA 3EO6A 3M70A 3H3UA 3DKWA 3NVCA 3KGZA 3FE5A 2ZCWA 2ET1A 2N7GA 3IDCB 4Q0QA 1O7FA 2XGXA 5KHIA 3UKNA 4L11A 2PFWA 2ETEA 3MDPA 1H1MA 1WGPA 3H3ZA 4LUMA 3SCGA 3ELNA 2D5HA 1RTVA 4QGMA 4F8AA 2PAEA 4LEJA 3H50A 1IPJA 4ZU7A 2H6CA 1I5ZA 3H7JA 1XE7A 4MGKE 4EWEA 3FJSA 1XE8A 1L3JA 3LAGA 3OGJA 1YLLA 3LA2A 3S7IA 3U10A 1EYBA 4HZFA 4FBFA 1EP0A 2D40A 1OI6A 3I54A 5LEJA 3RZZA 3FFQA 1YFUA 5CADA 2D93A 3RYRA 4BH9A 5BY5A 1LR5A 3FWEA 2WFPA 1O3RA 2VQAA 4QGNA 3U11A 4XFBA 3H1MA 4R52A 2VPVA 2OZ6A 3UKVA 4N9IA 5JSOA 4P9GA 3H9AA 2V09A 4FT8A 1LB2A 4I09A 4AQ2A 4HN1A 4BHPA 5I0TA 4YARA 5FDBA 1ZRRA 2MNGA 5BUVA 4UXAA 2XL9A 1ZRDA 2Z69A 4UBHA 4XF4A 1NZCA 1X8EA 4KU8A 3SHRA 4KWJA 3G7DA 3LWCA 1LKNA 2E9QA 2OA2A 3E97A 4IEWA 2H0VA 2GC2A 3CL1A 5FLHA 3E6DA 2CAVA 2HKXA 1CAUA 4LA2A 4AVAA 4I3PA 1RUNA 4XEZA 3NJZA 4Q29A 4HBNA 2GH2A 4MX3A 4ZU5A 1UIKA 1CAUB 3WW1A 3D82A 2ATFA 2BEOA 1U12A 3FHIB 2Q4SA 5KHJA 4PJYA 1UIJA 4AQ6A 3E5XA 1Q43A 4QGLA 3QOPA 4IESA 1ZREA 2IC1A 4IETA 2DCTA 3E6BA 5HI0A 3D0SA 3BCWA 3PVBB 1PM7A 4HVOA 1XRUA 1NE4A 2XKOA 1QXRA 4XFCA 1VP6A 4IEOA 3VHRA 2IXJA 4WZCA 2Z2SB 5JSRA 1YFYA 4MGYE 4KWKA 4IEUA 2BNMA 2UYBA 4YSFA 1O5LA 4KU7A 2CAUA 2ET7A 3OF1A 1RUOA 2IXKA 3ETQA 3OCPA 3CLPA 4QM9A 4RD7A 3QACA 5I8SA 4IEQA 3BPZA 2K9ZA 4XFAA 1QY4A 5AVPA 3U0ZA 2UYAA 4HVRA 3ZDSA 3BB6A 3C3VA 3CJXA 4MH0E 4WVZA 1CAWA 1O4TA 1ZNPA 1YFXA 2GU9A 1GQGA 5D1IA 5C8WA 3ES1A 3DN7A 1Q5OA 3S0MA 2F4PA 1CAWB 3IIAA 5JAXA 2P17A 1EPZA 3MZHA 1O3QA 1WLTA 3USSA 4Z07A 2I45A 2PQQA 4XF1A 4XFFA 1ZZ6A 4IERA 5F1RA 3WW3A 2QDRA 4D7TA 3HIFA 1OD5A 2B8MA 2KXLA 3M3IA 5KHKA 4XFIA 3EBRA 1ZVFA 1GQHA 1Y3TA 3KGLA 4E2SA 1PMIA 1YUDA 3BALA 1VR3A 2CV6A 3CF6E 4WBBA 2QNKA 3FX3A 3NL1A 3HQXA 3S7EA 4O9EA 2MPFA 1DZTA 4HSJA 4FAGA 2QJVA 4PIXA 3RNSA 1G6NA 4XFHA 1OMIA 1ZZ8A 2PAMA 3LOIA 3NKTA 5I91A 2BNOA 5FLJA 4Z82A 4YNIA 1SEFA 1J3PA 1X8MA 2Q1ZB 3ROUA 3R6SA 3UKTA 4X6QB 5KBFA 2FMYA 3KCCA 3NSTA 1FI2A 4META 3RYPA 4K8FA 5BXXA 1DGRA 4TLFA 5EFUA 4I0AA 4I2OA 2PHDA 3N4MA 2B5HA 4XF3A 4QX5A 4HN0A 4OLLA 4PIYA 2IXIA 4I0BA 1J3QA 2BYVE 4LULA 1SFNA 4MGZE 1UW8A 4AVBA 1TQ5A 3I7DA 4KL1A 1JUHA 1UD1A 4EROA 2EA7A 2B9UA 2IXLA 5T3NA 2XKPA 4JTNA 2C0ZA 4ZU4A 5C6CA 1FXZA 5CU1A 4BYYA 3OD0A 5CVRA 2GAUA 3LA7A 4XF9A 4JTOA 2XLAA 3IWZA 3MPBA 5FPZA 2WC2A 3ST7A 3H8UA 4LLOA 5LRRA 4MZUA 5J3UA 2O1QA 5K8SA 2GC3A 4LUKA 5E16A 2QCSB 1O5UA 4JV4A 5I0UA 5J7MA 1EY2A 1FT9A 4IEXA 3WW4A 1RC6A 3IDBB 2OZJA 4ORFA 5I8YA 5EZWA 4PIZA 2EVXA 4B29A 2BNNA 5FQ0A 5I0SA 1RGSA 4HVQA 1ZZ9A 3PNAA 4MGIE 4E2GA 5I93A 1O3SA 2PHLA 3RDIA 3WW2A 4D7SA 1YHFA 5FQ0B 2XL7A 4Q0VA 2FQPA 4BIFA 5JSPA 1IPKA 5LRSA 1J59A 1UCXA 3B02A 5E1RA 3TNPB 1DGWA 5JCTA 3MYXA 3H1YA 3LA3A 4UBGA 4N9HA 1ZX5A 1Y9QA 4HMZA 3EHKA 3KMHA 1ZRFA 1ZZ7A 4HLTA 1I6XA 1CAXA 1UPIA 3EQEA 4Q0UA 3L2HA 5JR7B 1X7NA 4KWLA 1J58A 2PAKA 5FPXA 1J3RA 4I02A 1CAXB
chains in the Genus database with same CATH superfamily
4A41A 4UFKA 3KV5A 4QKFA 1AX2A 2CWSA 1JW6A 2L9LA 1UWWA 1W6OB 1VMFA 2Y6FA 3LZZA 4QXCA 1DF0A 3VD3A 3PU8A 2WO1A 1W99A 2DWRA 3OBRA 4R8HA 3UGGA 3VZMA 1V70A 3VBHB 4CU9A 2BPA2 3AKRA 4LO7A 4IV1A 1RHI1 2XUEA 1CGPA 4GB33 3MW3A 4IEYA 1DFQA 4QU1A 3AL6A 3OUIA 5ERLA 2VL4A 3VDDC 3N35A 2QQUA 5FYUA 1DQ0A 1NY72 2D5FA 4IQPA 1D0GA 1W0NA 2JDAA 5FZHA 3PU3A 2I2SA 4LE3A 4NVPA 3CO2A 4Q4X2 1KFXL 3RVHA 1V9U3 4CEWB 3EYPA 3NMBA 1CESA 3FBYA 1IQAA 1OQ1A 1FPN2 4KI5M 3SMHA 3GF6A 3WP4A 3ZN4A 3I59B 5B4NA 2ZS6B 3H1WA 3E6CC 2Q8OA 3T4VA 1YFWA 3HN3A 2ARBA 4KMQA 5FYYA 2E6VA 2RHPA 2WSUA 4BQ1A 3JZVA 1N3QA 1I1EA 1HJFA 1XYPA 2E32A 1MZ5A 4Q4Y2 5FJHA 4B4PA 5A3PA 4EWAA 1HB2A 2ZX3A 1LRHA 1QQP1 2VECA 2W1WA 2WNUC 5T5PA 4MV2A 2YPDA 3ZYBA 2RJLA 1V6NA 3BPSA 1ENXA 3TBDA 1JOBA 4E9KA 4IE4A 4CTEA 2ARCA 2QQKA 3IM0A 1H1AA 3OTFA 3LKJA 5FXZA 3O14A 4JDMA 3KSCA 4UFMA 3HT1A 5F32A 5FOBB 5FKBA 1MS0A 2ADEA 2WT2A 2GNMA 4YVWA 3RZLA 1VRBA 1PVC3 2QQOA 4HKWA 1Z7S3 1AX1A 3I3EA 3U78A 4RSUA 5D8AC 3IAQA 3HMYA 4QQ2A 1FATA 4Q0PA 2HYKA 4E8CA 1EAH3 4QMAA 2R061 2OPWA 2HH9A 3ZXJA 2R32A 2XLGA 4Y1XA 5F2WA 2Y33A 2EAAA 4C90A 5KXBA 5CIRA 2RS31 1Z78A 2J1AA 1QQP2 3R05A 4KQ7A 4ONUA 4BQXA 3WINE 2W1QA 1HN1A 1LOAA 1Q8PA 3GZUC 3POGA 2RS53 4QPIC 1W3VA 2XHNA 3NV1A 4Y20B 1E5RA 3M2MA 1PK6A 2O8OA 3DV8A 3VKNA 1OFSA 2VM9A 3CDZB 3NNFA 3WUDA 2YU1A 1RJ8A 4A7ZA 2DCKA 4QD2A 3NJYA 3CMGA 1C4RA 3B00A 5A6XA 1W6NB 2EXIA 4GAZA 3I4IA 4ZY9A 2GC0A 4YZ3A 1WMXA 4PBPA 1AXYA 4Q8KA 4EYUA 1AR73 4A3XA 2A3XA 1LJ7A 2VNRA 3HAGA 1MZ6A 1RL3A 2R062 4K21A 2OPKA 2XVKA 3V0AA 4GA9A 3E5QA 5IWFA 2Y64A 1X9PA 2JDZA 1JN2P 4ARYA 3NVCA 1VBE3 2Y6HA 4XJWA 3O5SA 3TWIA 4NR1A 1DG6A 1DQ2A 1OUXA 1RITA 3PIJA 2GP5A 2N7GA 2WRAA 4IV3B 3VKOA 2VNVA 1AR81 5JIAA 4S2FA 4CP2A 3V64A 3T4HB 3POYA 5JR2A 2E31A 1W6PA 4S2HA 4Y1YA 3UKNA 1LOGA 4L11A 5HXVA 4AEKA 1SCRA 4MADA 4CUGA 4XCBA 4WV8A 3ZYHA 1KS4A 1GWMA 2BFUS 4ZZ5A 3KCYA 2DV9A 1WGPA 3BKZA 3H3ZA 2KA3A 4IV1C 4YW6A 4B3NA 3SCGA 3VZLA 3LPGA 4GB31 2D5HA 4XQ4A 4NAOA 3TRSB 1CIYA 1RXGA 1H9PA 3H50A 5FYBA 5LW9A 3KT7A 4ASLA 3V0BA 1GNYA 4ZU7A 4M00A 1M4WA 3EB7A 2H6CA 3C7EA 3A23A 4XUOA 1JYNA 4IE7A 1Q8QA 3WDUA 3FJSA 1L3JA 3OGJA 3NKGA 1PIV1 2YB7A 5FREA 1G9DA 3B94A 4HZFA 5A1FA 3ZYIB 5FRAA 5L7OB 2QZ3A 2D40A 4NE9A 4Y3OA 4NIHA 1GBGA 1B35B 3GCWA 1AR82 4Y22A 5T5JA 4CDQA 5CADA 2D93A 1QOTA 2OQ7A 5E6HA 3SEEA 4JKKA 3RYRA 2DCZA 3UNPA 2JG8A 4BH9A 4E4ZA 3Q8CA 1LR5A 2JENA 3FWEA 4FFGA 2VQAA 2P6HA 2G19A 4LBQA 3RJRA 3O0VA 1SZBA 3AMNA 4GB32 1PZ7A 4Q1PA 2P2KA 5J37A 1MR5A 3UKVA 4N9IA 5A6YA 2UWBA 4CDUB 3ZM8A 3L9JT 4P9YA 2XVGA 2BZDA 2HLEA 4YVWC 3KHCA 1YI9A 2W68A 1LB2A 3I2HA 1W28A 4AQ2A 4BHPA 3NQHA 3N7KA 4UT5A 1A3KA 2A6WA 1MS3A 1Z7S1 4YARA 3AMMA 4FTBA 5A7PA 4KH9A 3JCIA 5EPAA 4AOCA 5DZGA 3J8F3 1OLRA 2YXSA 3DXTA 3T0DA 1BBT3 3DPRA 4NAMA 3N9LA 4WVMA 2IUWA 5F3IA 4DXTA 3FHQA 2GNTA 1X8EA 2ENRA 3WDYA 4CP1A 4IE5A 5KC6A 1G86A 3AXEA 1KGYA 2H0VA 1COV3 3CZJA 2GC2A 3CL1A 4XTMA 4EN7B 5JOXA 3JBG1 3D6EA 4UW3A 2RS51 2A70A 1VB2A 1VE0A 3AX4A 1PK6C 4XEZA 4Q29A 2GDFA 4LHNA 3AK0A 2DVAA 2VZPA 2QTWB 4MX3A 5GLVA 3SKVA 3K77A 4UI9L 3WQ1A 1KRIA 1VIWB 2QDNA 2RS11 1CAUB 2DVBA 4TWTA 4MGQA 2ATFA 2BEOA 2SBAA 1PVC2 3FHIB 4AW7A 1U5XA 1DLCA 2CDPA 5GZFA 1Z7S2 5A3TA 1KDMA 4AQ6A 5FXWA 1DYKA 5FO7B 1IPSA 2VNGA 1Q43A 1MS8A 4QGLA 5CB7A 4IESA 1EAH2 3OGRA 2JDYA 3KZ4C 4WM8B 2WFF1 3O0WA 4OMCA 2VW1A 4LK7A 1ENQA 1ST8A 2IC1A 3SLIA 3WVJA 2DCTA 3E6BA 1VBE1 5A1AA 3BTXA 5C8CB 1V6MA 4A4AA 4DO0A 1NCRB 2BV4A 3PVBB 1XE0A 1OF3A 5EYYA 3JBG2 4G4FA 2TNFA 3C7FA 2RS52 1MS9A 1OVSA 2XKOA 3A22A 4AGGA 1C28A 1U5YA 4IEOA 3VBSB 2IXJA 1KQRA 2ZHLA 4YM1A 1YFYA 4BXFA 3LB9A 5DDJ3 3N9QA 5G05L 2UYBA 3OYWB 4LBOA 2C6SA 1O5LA 2OXBA 3NV4A 3JQWA 3MGUA 1JTZX 2WNVA 3W58A 5GJ6A 1OA2A 2ET7A 1UOBA 4IGOA 3HPNA 2HWE3 3KF5A 3ETQA 3OCPA 1W0OA 3APBA 4QM9A 4RD7A 3K4ZA 1UF2C 1XSRA 2CSGA 3MIEA 3NO8A 3VBOB 2A71A 3PVNA 1AR72 1KITA 3AMQA 3HBZA 3JUUA 3LFIA 4FQ4A 1YCIA 4R9DA 1GUIA 3VZKA 1UOGA 2UYAA 5IJRA 3GALA 2WFF2 4HVRA 3VLBB 1IS6A 2TBVA 2W87A 2ARAA 5TSWA 2YROA 4YFWA 3HBKA 1VBE2 4IXLA 3OSDA 4ZHNA 1CQ9A 5A3MA 1LECA 3WF3A 1PX3A 1WW7A 3O12A 5D21A 5FJKA 1R1A3 2GU9A 4CDQC 4ITCA 3N9PA 3MO4A 1XPWA 5C8WA 4FCAA 4FPJA 3ES1A 1AX0A 1OXCA 2DURA 2JE8A 3DGTA 3ZFEB 3AC0A 4XXPA 3MZHA 2ZKNA 1O3QA 1WLTA 2XJUA 3USSA 4A6SA 4A42A 3POEA 5J98B 2HWD1 3MW4A 3IB3A 1G7YA 1HRI1 2VQTA 2QDRA 4JDOA 4JCKA 4OI4A 3WOGA 4Z1VA 1WLCA 4D7TA 3CZUA 1JUIA 3QCWA 4UOJA 4FPOB 3WF1A 2JX9A 1ALYA 4F3JA 4NJ4A 4B4RA 4BM8A 1GQHA 2JECA 2XJSA 3KGLA 4NIAA 1VR3A 2CV6A 2ZACA 2XXZA 1W8HA 1W9TA 1XNBA 3HQUA 3NL1A 2WT0A 4OQ8A 3DPRC 4ATFA 4FTEA 1KD7A 4LIVA 1DGWX 4X8PA 4FAGA 2QJVA 1XU2A 4FPLA 4GD4A 3WNMA 5ACA3 4QKNA 4J6GA 3VDBA 3DKQA 3VUOA 1UOJA 1UX7A 3AYCA 4GH4B 1AL23 1H2LA 4LE4A 2PAMA 2V4AA 2OQ6A 4MXWB 1YQ2A 2EALA 1W8TA 1HB3A 1C8M3 3GNEA 3LOIA 4W6XA 3JQXA 2EXJA 2ZGQA 2BNOA 2VCCA 4YFZA 3WDVA 4TSVA 1ODMA 1HRI2 3AKPA 1REEA 4E4HA 2DVDA 3DEMA 3MLLA 1D0HA 3R6SA 4TXWA 5FPBA 3ROUA 1RUI3 2RG4A 3E1F1 3KCCA 2Q8CA 4M0HA 3I49A 2GH8A 3KD4A 4TLFA 2QQVA 1IOAA 2PHFA 5FPLA 4QQPA 4I2OA 1NA1B 3K4DA 5A70A 2BTVC 1HIXA 1EV13 2DBNA 2E33A 3J8F2 5JZGA 2AUYA 2RM23 1BBT2 4ASKA 5L9VA 1MQTB 5HV0A 4QX8A 4LKDA 4O7XA 2WZEA 4UFIA 3LDBA 5KXEA 4JGZB 2EICA 2WA3A 5F3CA 1COV2 1DZQA 4M01A 1BLZA 3MLJA 3CJIA 4NUBA 4YG3A 2EA7A 1UKGA 4QPWA 4BMEA 2FCUA 4AGRA 5T3NA 5FY4A 4UFLA 4OUMA 1W6QA 5FYMA 1S0IA 5C6CA 2YG0A 1Q8VA 1F31A 2LW8A 4XMIA 5FWEA 3WQ7A 5IYYA 5F5CA 1R64A 2WNVC 3LPFA 5GALA 1WZXA 3THDA 4NIIA 2D44A 3WX5A 4FTSA 2HWE1 4FSJA 2Y6JA 3MPBA 5C3RA 4QB1A 2WC2A 1FNYA 3B93A 4S2DA 4H7MA 5FYTA 4LLOA 4BK5A 4MZUA 3X29B 1U0AA 5J3UA 2GC3A 1IQDC 2NN8A 4QHOA 4EN9B 1SHWB 3D4KA 4J25A 5I0UA 1H2MA 4GALA 3THCA 1EY2A 2BWAA 1RUC3 2OW4A 1F4AA 3IDBB 5LK5A 3M8LA 2V73A 1QH7A 3MICA 2W52A 1R1A1 2EVXA 2Y6LA 4YGCA 1LNSA 5FQ0A 1XSQA 4E8DA 4IDZA 2UURA 5DUWA 3OPWA 4HVQA 2AH2A 1DQ6A 3P3PA 4E2GA 3PHMA 4Z2AA 4FPCA 1L7QA 3WP6A 5JXHA 2EIDA 4P14A 2PHLA 5DDJ2 3RDIA 2PHXA 1ENSA 4DXRA 1AYM3 4YW4A 1MS4A 4Q0VA 5JSPA 3QBQA 1IPKA 3SEPA 1NQDA 3PUQA 4PF5A 4PHZA 5BNOB 2HWE2 4KGGA 3MUY1 1J59A 2GN3A 2YMZA 4P00B 5M0TA 2VVDA 3B02A 4FO9A 3ZYFA 1MPXA 2BVVA 5FZDA 3TNPB 4D6RA 3V56A 3GZAA 5KC5A 1DLLA 2JJ6A 3CBNA 1W8FA 4N9HA 1SLTA 4HMZA 5KXDA 1LHNA 3OPTA 3LEIA 2DF7A 1HQWA 2W91A 2W94A 1W90A 4HFSA 4CRQA 1UYZA 1W8ZA 1C5IA 1I6XA 4NHLA 4XBQA 3S6PA 4AVTA 2A3YA 3FBMA 1R1A2 1UPIA 5LY2A 2QQJA 5LBFA 2JEMA 3PUHA 1SACA 1DDLA 1OC1A 1X7NA 1BHGA 3THPA 3O1UA 3MIGA 1SPPB 1LGCA 1AL21 2W9XA 5FZ0A 2WLPA 2ARXA 2VY0A 1OLME 1CAXB 2VUCA 4E2QA 4N43B 3OY8A 3N9NA 1FAYA 4LTAA 1YC61 2ZGUA 4S2GA 4IEPA 2FDKA 1CAVA 2Y0OA 1E5IA 3M3QA 5KHGA 3FL7A 3FZ3A 4TLGA 3WY6A 1AJKA 2Q30A 2JG9A 5SV8A 5BV6A 3TOJA 5KHHA 5HCFA 4BQYA 1VBB3 4J1WA 5JOWA 2HWC1 1SLAA 3K2OA 4BLIA 5JZGC 1VBA1 1EV11 2UY9A 2RM21 1PZ9A 1VBC3 2VMDA 4RHV1 2AC1A 3FLPA 2Z5WA 3B01A 3MI8A 5ABJC 3OBZA 3HT2A 4XYXA 1UYPA 2IVJA 1QXJA 1Q3EA 2JG8B 2VBDA 4QPYA 4XF0A 1RHI3 3NAPB 4XJAA 3UT0A 2PTMA 1ZRCA 3ZKUA 1AL22 5F6KA 2E7QA 3H7YA 2J1UA 2X09A 1SFYA 4IE6A 4R9AA 4Y1UA 3CJIC 2JB8A 3ZFGB 1C8M2 4BQWA 1R093 1RIRA 3GYDA 1O4ZA 4EQVA 2VGDA 2W39A 1XU1A 1ZM1A 2VH9A 1JI6A 3T1LA 1RUI2 1IS4A 3SCFA 1AL0G 1GNZA 1AZDA 4M3CA 3GBGA 5A33A 1SLBA 1DGLA 1UAIA 4LIUA 3WNXA 1SCSA 4AVCA 4O9GA 5JMCA 2ZX2A 2CGOA 2Y0IA 1WCSA 2DFBA 1ULPA 2G1MA 1EV12 1PO21 2XPJA 1QQP3 2RM22 3KLSA 4JVAA 1K5MB 1W9SA 1ZZCA 4EWDA 4BXSV 3T0AA 3SCHA 2XB6C 2XLFA 4XQWA 1NE6A 2XH6A 5T54A 2WNOA 1GKBA 3BUCA 1C1LA 3USUA 1POV0 4YW2A 4ES8A 4P02B 3AP9A 1JXNA 1V6JA 5FPAA 4AG4A 4V2VA 4K8RB 3MIHA 2WAOA 3RWKX 4P9JA 4C91A 1YI7A 5A3OA 4CYDA 5EXOA 1ZBA1 3ZSJA 4N53A 2WT1A 5FZ4A 2D6OX 5A7WA 1SBDA 1UYXA 5CFCC 3ZXAC 1WBLA 4DY5A 2E53A 4AHZA 1AYM1 1H6YA 4C1XA 4GMP3 3PJQA 5H9SA 3PURA 2CWMA 1VB4A 3ZFFA 2JKXA 1GFF2 3GBWA 1DGRN 4PQ9A 5FZOA 5GM0A 4AR2A 2PMWB 1PO22 2RS33 1GANA 3KS7A 4BIOA 3WCRA 1QHDA 2FCTA 3UESA 3GBFA 3KV6A 1LGNA 3M7AA 4JZRA 2JDKA 1EUUA 4Q0SA 3SXWA 1DBNA 1UZWA 3JXSA 1RUC2 4AAPA 3FLTA 3OUJA 3RZHA 2J1VA 1NQJA 2RMU3 4UWDA 2ZMNA 1UY3A 3M70A 2VZSA 4D7YA 2TEPA 3JD71 1R1ZA 4HONA 4KNCA 1RVF1 3FE5A 3O0XA 4QPGA 5FZ8A 3BI3A 1AJOA 3PJYA 1W0PA 4RQPA 1QXPA 4WZFA 1O7FA 3POFA 2DUOA 1HX6A 2O14A 3KVBA 5A7QA 5F7UA 1WMFA 1KJRA 5KHIA 4YM3A 1PMHX 3AZXA 2WNVB 5LATA 3BTZA 1AYM2 2G9ZA 2PHTA 1F15A 2PFWA 2JB4A 1IZ3A 2VQ0A 4XDOA 4YVSA 4DMIA 4DS0A 2GALA 2VO5A 4QX7A 4NHXA 3ME2A 2Q5TA 4XQDA 3ZIXA 2IFWA 4FI9A 1CWPA 2JG9C 3PL0A 1HB1A 2X5IB 4PCRA 3VBFB 4JGYA 4F8AA 1HXS3 2D6LX 2PAEA 1ODNA 4LEJA 4LPLA 2YU2A 4PDWA 1OOPB 1UQXA 2DUQA 2ZEZA 3MIFA 1OPOA 1Y7BA 2VE1A 4DRRA 4NRPA 1IPJA 3P1IA 2IWGB 4YG6A 2PXJA 4QQLA 1VBC1 1XE7A 1POV1 4MGKE 4RGAA 3HJRA 3LAGA 1YLLA 2KR2A 1O4YA 4JQRA 2V5YA 4GIQA 1HQLA 3WG3A 1ND2B 3WQ0A 1RVF2 1YYNA 4KG8A 5FZKA 3WDTA 2W47A 4YZ1A 3VBRB 3FFQA 5C9AA 5CG8A 2WKKA 4DPNA 4DRVA 2IVIB 3B5LB 4LXLA 5CEHA 1FV3A 1OH4A 5DXDA 5F2SA 3OGSA 4GZ9A 5IW0A 4OI2A 5DQ0A 3WHUA 1S2EA 2QUOA 2X53S 4XJUA 1R091 1DQ1A 2ZTNA 5F9TA 3O1PA 2WINB 2CU5A 4BE3A 4D94A 1E57A 3PUAA 4W6WA 2PLV1 2BGPA 5IVCA 1PIV3 1Y9MA 2A6XA 5GZDA 1PO13 1PVXA 1GZ9A 1RMU3 2C24A 3H1MA 3HD8B 3AZZA 3ZN6B 4BDVB 2VPVA 1H30A 5EWSA 2VC9A 4TYSA 1NG0A 1VBB2 2QQIA 1F2NA 2V09A 3FFZA 4LHSA 1OQDA 2Y38A 5A32A 5I0DA 3MUZ1 4RS5A 1VBC2 1NCQA 4ZS2A 5I0TA 5GLUA 1ZRRA 1XB9A 4Y33A 5BUVA 5EP9A 4UXAA 1RHI2 2WWUA 1DU3D 1POQA 1JU4A 4UBHA 3W5MA 1ZRDA 1H0BA 3MLKA 1GWKA 2R073 4B7EA 2YC4A 1W2OA 4Y26A 1Q8OA 3LWCA 5HCBA 5FYHA 1LKNA 1R092 1PGW1 3E97A 4HK9A 4QWNA 4OHYA 4N53C 4B4QA 2PLV2 4EZ4A 3E6DA 2HKXA 3RZMA 5C3PA 3T09A 1H9WA 4AVAA 5FZLA 2XWJB 4I3PA 3NJZA 2ZGRA 4AEDB 2GH2A 4JRAA 4GMP1 3LF7A 3BODA 5LA9A 2WIIB 3RI8A 3ZFFC 4DZGA 4ISQA 3W5NA 3IPVA 3DXUA 5A3WA 3AKQA 3DYPA 4BB3A 4HXCA 2QZ2A 1U12A 2YDEA 2Q4SA 3ACHA 1ZBE1 3O7OA 3UJOA 4Z92B 1ZRIA 3ZX7A 1GSLA 1BKZA 1QU0A 2GMPA 3JBG3 4PJYA 1ULOA 3ZXGA 5BYNA 5L9RA 1WCUA 3E5XA 3ZXDA 3ITQA 4CCLA 4MGTA 3NNLA 3S5QA 3CHXA 3ZVXA 2RMU1 2D3PA 2RS13 1YJKA 2PN5A 1WMEA 4QPGC 2KD7A 3I2JA 1ND3A 3WNOA 3D0SA 5HI0A 4CCKA 3VD9A 4CCEA 4RQPC 4P9XA 1NLQA 2NPIA 2BP6A 2ZGMA 1G9FA 2HBTA 4XFCA 1DHKB 1TVGA 1VP6A 3HOBA 3INAA 4Y5TA 3VHRA 4LBJA 1N1VA 2QE3A 4YVSC 4MGYE 1MS5A 2VVEA 1PNFA 1IS3A 2WFF3 2ZJCA 4CXXA 3WG2A 4YSFA 1H8TB 3VBUB 3NV3A 4CDXA 3MW2A 4XVHA 1RB8G 1SLCA 3AYDA 3JU9A 5A1LA 3I3BA 4AK3A 2RS32 4BU2A 3OF1A 2IXKA 1AHSA 5FZFA 4CDWB 4JGYC 1SLLA 4COYA 1H4GA 3QACA 1HXS1 4PDWC 4IEQA 2OIIA 5I8SA 3VV1A 1H8VA 4XFAA 4WM7A 5LA1A 1IGOA 1PMJX 3U0ZA 1JZ8A 2KM2A 4LBLA 4NROA 4DQAA 3AM2A 4HKLA 5EHDA 2LTNA 4L97A 1CJPA 3BB6A 1JU3A 2RMU2 3J7LA 3CJXA 2A6VA 2E63A 4MH0E 3D5OA 2ID4A 2NZ9A 1CAWA 4L99A 4RYDA 1LULA 5C3OA 3A0NA 2QQPA 1ZNPA 4QDRA 5C9AC 5DABA 4YW7A 4RR3B 2BRTA 3AB0A 4BJ0A 1VRH1 2ORXA 2ZAAA 1QMJA 5DZFA 1Q5OA 2CL2A 3MBWA 4L92A 3IIAA 4YG0A 4PF1A 5JAXA 2ZMKA 5FKCA 5A3LA 4FFHA 1HN0A 2R30A 4K1YA 4O61A 2PELA 3SISA 1BEV1 1K45A 5FZ6A 1PO11 1GWLA 1RMU1 1RYYA 2VMFA 5FBJA 4AFMA 2RJKA 4K6BA 3K46A 4X8NA 1D7PM 3CQOA 1HXS2 4XUPA 4AYUA 1M06G 4LJHA 2B8MA 1QF3A 4CP9A 4CEYB 1ASJ3 4YW5A 1H2KA 4V1PA 4QB2A 2JICA 4BZ4A 3B7MA 4RS5C 5FUIA 3RQ0A 1JYIA 4V2WA 4BCUA 3BALA 1NCQC 3CF6E 4SLIA 3AL5A 3R4SA 4QT6A 2QNKA 5C4WA 2WO7A 3FX3A 4CUAA 1CR7A 3ZN5A 2XJVA 3GCXA 2HWD3 3HQXA 3NNJA 3BIWE 2ZEYA 4ZXEA 1K12A 1HRI3 1UU6A 3TN93 1LOCA 3DCQA 1JH5A 3ACIA 2G9GA 1DYOA 1VRH2 3N9MA 4XDQA 5JUVA 2R071 3EMRA 1XJAA 2LRPA 1W9FA 2RE9A 3IIIA 1BYHA 3VL9A 3VL8A 1UZZA 3S30A 4D0QA 4AE2A 2QQWA 4BPZA 4E4SA 1VAKA 4MLOA 4W4ZA 3H8XA 1US3A 4QHZA 4QQOA 1BEV2 1PIV2 1YJLA 3JB4C 5FP3A 5FLJA 1PO12 1RMU2 4Z82A 1SEFA 4XTPA 3HEIA 5JVVA 4NPRA 2UWAA 4X6QB 1UNBA 4BOWA 1G9BA 4PLMA 5FK8A 4XUNA 4YM2A 2XMLA 3RYPA 5CFDC 2HYXA 3KVAA 4OI1A 3ILFA 2OUJA 1C1FA 5JI7A 4ZKTB 5K0UC 2VBBA 2P5BA 2JDHA 1C3HA 3RZKA 4ZXKA 2IXIA 5FZBA 5CZKA 4CXWA 2XJTA 2P4EA 2R072 2BYVE 3FMGA 2ZPXA 3VDDB 4DXZA 3FUOA 3MEPA 1ND3C 2CY6A 1OH3A 2ZHNA 2BBVA 2R6QA 4MGZE 2XBO1 4NHYA 4OI0A 4BK4A 1D2QA 2JDUA 1OHFA 2FDJA 4UF0A 4AVBA 3IN9A 4KL1A 3RG0A 2EIGA 2PQSA 4MGSA 4Q26A 1JUHA 3IMNA 4EROA 2VZOA 5LBBA 3WD5A 5H9RA 4LO6B 3HN1A 2ADDA 3ZXEA 4JTNA 1GV9A 1SLIA 1XBFA 3DUIA 2C0ZA 5BNPA 1OPMA 4CDXC 5CU1A 2I07B 3AZVA 3GHMA 3LEGA 4Y4YA 2ZGPA 5IFPA 2GAUA 4DB5A 5K9YA 4FPYA 2R041 3LA7A 1I5PA 4JTOA 4K9SA 4XF9A 2WNUB 1F4HA 4Q4V1 3VD4A 4WM7C 1AR63 5LRRA 5C71A 5T55A 3KCXA 1YQ6A 3WUCA 5K8SA 2UWCA 2BBAA 2W95A 2WL1A 2ZA9A 3KV9A 1IKQA 4D69A 5BNNA 5J7MA 4QXBA 2RS12 5FK7A 3W21A 1D4VB 1US2A 2XBO2 4M3CE 4CE8A 4PIZA 3N3HA 1TE1B 2GMMA 2W0XA 4QQHA 5D8AB 1YQ5A 4QXHA 5G04L 1RGSA 2YBSA 4FXGB 1ZZ9A 4DEVA 5I93A 3PDQA 4G9SB 4CU8A 2BVBA 1O3SA 3SH4A 3K48A 3B9CA 3WW2A 5FPVA 1OT5A 3U4XA 2XL7A 5FUPA 2Q1FA 2R042 5LRSA 4XILA 4QX1A 4BQ3A 2WR9A 4QPIB 4AZZA 1ZA7A 1DGWA 3ZO0B 1ASJ1 1RJ7A 4URTA 4IUGA 1N1YA 2LALA 5C4WC 1Y9QA 5L73A 4AEJA 5IT6A 4JHZA 1QJU1 4N7IA 4CCDA 2ILMA 5A7SA 3KMHA 4YM0A 4MSVA 1GQPA 2XJPA 1VAMA 3LDKA 1ZRFA 3UYJA 2P3JA 4HPKB 3TN91 3ZSMA 4QX2A 4UAPA 5DAXA 3F95A 5JR7B 4NN0A 1XOYA 1W6OA 5DG2A 2TUNA 1GZWB 2WN2A 3LDRA 1QJX1 1QDOA 4I02A 5F5AA 2XJRA 1VBD1 1JZ5A 1GNHA 3TYJA 2VZUA 1JYTA 3GZEA 1GMMA 4YRDA 1X9TA 5FFOC 3WP3A 2IFRA 2FMDA 2WSVA 2YGLA 3U37A 4A7KA 3NW4A 1QWRA 3BIEA 5FLIA 1DZRA 1ASJ2 2YPJA 4YW3A 4CEWA 2ZAHA 5J48A 1JZ7A 3HR9A 4DFSA 4F7ZA 1JYCA 3I59A 3N36A 1QJU2 2ZX0A 3MIDA 3D0JA 3KT4A 5J09A 4CVUA 2HWD2 2JKBA 4IV1B 3ZMOA 1LU1A 1RUE3 5FV3A 3DL3A 3TN92 5IVVA 5FTTC 5FO9B 1VALA 1UOFA 3C7HA 4P9LA 2VZTA 1KXGA 4IEZA 1HW5A 2B9VA 2BDRA 2VW0A 1R081 1S0JA 4LHLA 1PNGA 3HVDA 4AXOA 4ZPIA 1CIWA 4XETA 2K0GA 3ACFA 2HWC3 1VBD2 4OULA 1OLQA 4BQ2A 1VBA3 3IAPA 5FXVA 5BPXA 2GZWA 1YWKA 4RHV3 2YFZA 5BNPC 3UK9A 4Y4RA 4W50A 5ABJA 1PGL1 3M3EA 2R1DA 5FZMA 2V4VA 1JBCA 1GP4A 4XHBA 5FZ3A 3H8RA 4XUTA 1S4CA 2X05A 4A7YA 3LIHA 1H1IA 3NNGA 1SQ4A 1AR61 4HANA 4AFDA 3MIBA 4XCAA 1BK1A 1W8OA 1UXXX 2QKDA 4CCNA 2Z79A 5BNNC 1KEXA 2VTXA 4YGDA 4A45A 2E7TA 4LK6A 4SBVA 4HSLA 2HJIA 2XWBB 3I8TA 4A44A 5CAZA 3SH5A 2WAAA 5JIUA 4YVWB 2XQXA 2A6ZA 5GZEA 4CCCA 2A7AA 2HEYF 4MHRA 4QM8A 5CYYA 1HRV1 2EF6A 4DUWA 1IG0A 2XR4A 3MPPG 3QH6A 1QKQA 2YC2A 3CNAA 4Y20A 5E88A 1PO23 3IZOA 2DU0A 5APAA 2P37A 1NYWA 4MXVA 4AI3A 1ACCA 4ISRA 1O3TA 3ZXKA 4C1WA 1KDKA 4N7UA 5HV4A 1LHWA 1W6NA 5C3SA 5I0RA 1CONA 2BOIA 3KT1A 3CEWA 2ZGNA 3OG2A 2GN7A 4ET7A 3THTA 3AXDA 1VMHA 5FCCA 2WDBA 5FXXA 5FP8A 3T0BA 1RUH3 4IEVA 1AR62 2ZBJA 4C0HA 1AYN3 3R4DB 1H4HA 2ZKLA 1JHJA 1PK6B 2UY8A 3GHNA 2BGCA 4YYOA 5LEKA 1UMZA 2CGNA 4XFGA 1WA4A 1MVQA 3AZYA 1APNA 3PLQA 1ZBA3 2YZ4A 1PGSA 3BOPA 4HG6B 3POJA 4Y1ZA 3P3NA 2FZ1A 4FAHA 5CKQA 3VN4A 4LO4B 3WR0A 1CX1A 5CFCA 5CKMA 2AEYA 4AFAA 3POWA 4IV3A 5K4LA 5FY0A 1AR91 3T1MA 2JIJA 1A78A 2ZGTA 3H3UA 5JWPA 3DKWA 2K2SA 1LESA 3KGZA 4AHXA 5LZ6A 3UJQA 3VGIA 2ZCWA 1HB4A 4FP3A 2ET1A 3PMEA 4AI9A 5FZCA 4AEMA 4AVSA 3IDCB 4CCMA 4Q0QA 4OUSA 3ZXFA 1V6KA 2LUWA 3V0AB 3VBHC 3ILRA 2XGXA 4NO4A 2DFCA 1JS9A 3VKMA 5DAPA 4JQTA 3WNKA 4H14A 1NZIA 3F2ZA 2P6CA 2NYYA 3MDPA 2VOVA 4CPBA 1H1MA 4YPJA 3JD73 2BERA 1RVF3 4CEWC 5HCAA 2ZGLA 1W6PB 2D6NA 1DP0A 2RVAA 4QGMA 3WG4A 1D2SA 2XG3A 2YUEA 5J96B 3C7OA 4EN8B 1V00A 4ES9A 1KJLA 3ZIWA 5F6LB 3ZYGA 3AVRA 4XMAA 1B35A 1I5ZA 2JE7A 3H7JA 2C1FA 3VKFC 1RUE1 5FZ1A 3ZSKA 4EWEA 3ZYRA 3G6JB 1XE8A 3RFRA 3GM8A 3J7HA 3LGRA 1NXD1 4COWA 4FBFA 1EP0A 3I54A 1OI6A 2CYFA 2VUJA 4FPFA 4R4XA 3RZZA 5C5TA 2AACA 3V0BB 1QNWA 2HWF3 2QQNA 3LCPA 3T2TA 5L36A 3MV11 4NRMA 4I3GA 5DAVA 4OVEA 4WVWA 4DIQA 4NRQA 2FHRA 5BY5A 3OEBA 3LOBA 5DUVA 2R1BA 3I2FA 2J1EA 2WFPA 4LBNA 1O3RA 1POV3 1O6UA 4Y22B 1JYWA 1HKDA 4CDQB 2DCYA 1T6BX 1JYXA 1V6OA 3U11A 4XFBA 4UFHA 1OURA 4NHMA 3QLQA 2P3YA 3PVOA 4D6SA 2OZ6A 4K40A 3BTAA 5JSOA 4LHKA 4FXKB 2YBKA 4OQ9A 4EN0A 3O1OA 1S0FA 1W9WA 4LBQB 4KGQA 4I09A 4NPMA 2ZHMA 1RUD1 4HN1A 1XNTA 5JOZA 1BCXA 1RUE2 1FYUA 1YQCA 4OUEA 5EQUA 2PLV3 5FDBA 2P3IA 3C8XA 3WSOA 3AKTA 5IFTA 5EJ3A 2XJQA 5F3GA 2MNGA 1W9YA 4FFFA 5FZGA 3ZLIA 1NX9A 2XL9A 3ATGA 3OPZA 3VD7A 4HKOA 4XF4A 2NP0A 2AR6A 2HWB1 5LA0A 5FYSA 3CU7A 4QU2A 2HWC2 1W3XA 3G7DA 4KWJA 3A0KA 4AAXA 2E9QA 1VBA2 2OA2A 3DPRB 3BYWA 1CD3G 3AYEA 4WVMB 3K3NA 5FLHA 4RHV2 2WZR1 2CAVA 1JOPA 4FQZA 1CAUA 5E89A 5FYCA 5AVAA 3ORJA 3ZDVA 2WUHA 4HBNA 3U4SA 2ZHKA 1NT0A 3UGFA 3KM5A 1E5HA 2JE9A 3DYOA 4RGGA 3T3YA 3WF0A 1J83A 5C3QA 5IK8A 1RUH1 3WW1A 1F35A 2VOTA 4NIDA 1QNYA 1AYN1 4WM8A 4XABA 2VTXJ 3ALQA 2J1TA 3ZSEA 3ECQA 2GSYA 4LKSA 4Y5Z0 1UIJA 3M4FA 4DNYA 1FOD1 5C8CA 1O8SA 5T5OA 2ORZA 1NCRA 2YFUA 5EJZB 4IV3C 1Q56A 2HWB2 5H9QA 3SH3A 3ASIA 3WLUA 3HNMA 1C8NA 3V65A 1DQ4A 1YIFA 5FR3A 1WCKA 2ZEXA 3VBSA 2WO3A 2ZGKA 5FZIA 2OVUA 3BCWA 1ULEA 5L19A 4AHWA 1ZBE3 2I74A 3OYWA 4XJ8A 4HVOA 1XRUA 1S1AA 2V72A 1NE4A 3POSA 3EXUA 1QXRA 4AI1A 4Q4W1 5E8AA 2Z2SB 3RZJA 2RV9A 4DXSA 5JSRA 2VOKA 3Q8EA 1RUF3 3KQRA 5F39A 3VBOA 4AQTA 4CU7A 1LAJA 1RUH2 3KHBA 1AYN2 4YLZA 3SKJE 1RUOA 2W5FA 3M3CA 4YZ5A 5IAVA 3CLPA 4PQQA 1ZBA2 5FUNA 3VB9A 3RWNA 5L7OC 1HV0A 1TMF1 1BXHA 1UU4A 1FOD2 2WABA 5AVPA 1K3IA 3C7GA 3AYAA 2GNBA 4RGKA 1HJGA 1B35C 1W05A 3AKSA 1XC6A 1SDDB 3ZDSA 1G8WA 3LE0A 4L9BA 1I9RA 3FN9A 4UW5A 4OMDA 5FPUA 1QEXA 1NOVA 3ZFEA 5FBZA 1OKOA 2JDPA 1TZOA 2BGOA 2HWF1 1E5SA 4EN6B 1GQGA 2EAKA 2FCVA 5D1IA 1HV1A 2VOXA 3S0MA 1AF9A 1WD4A 2VZVA 2F4PA 2G9FA 4COVA 1NAEA 5FZ7A 1N1TA 1QIQA 3WT3A 1UY1A 4JX0A 4CDUC 5FIXA 4Z07A 3WNLA 2PQQA 3N4MA 3JD72 4BWOA 1ZZ6A 2VCMA 2CDOA 3AMPA 4JKLA 4LR4A 2W1SA 4FPHA 4Q4X1 3WW3A 1JYVA 4BLJA 3TEZA 2AGSA 5H9PA 2W08A 2ZZJA 5A7NA 5LWBA 1OD5A 1VRH3 2RDQA 2KXLA 3LD8A 3M3IA 4QX3A 4OHZA 4XFIA 3EBRA 1ZVFA 5KHKA 3RGBA 3RMYA 4E2SA 4Q4Y1 3ZR6A 3TB0A 4CSWA 2D3SA 4K3UA 4COUA 2Q1MA 1U5IA 1BEV3 2VUAA 4CPBD 4GH4A 2ZX1A 4O9EA 4IL7A 2JDNA 2MPFA 1DZTA 2E26A 2HWF2 3N7MA 4MXWA 4LORA 5JDBA 2D43A 3OBTA 1Z0HA 3KV4A 4H2AA 4KBBA 4I0WB 5FWJA 3RSJA 1O91A 2VMIA 1WLDA 3H3LA 4JHTA 5BNQA 4XAAA 2VXJA 1XYNA 1LHUA 4QAWA 3KF3A 2VZRA 3WQBA 2X10A 4OHWA 5I91A 3HWJA 1JZ6A 1MACA 4YNIA 3WV6A 1WBFA 1J3PA 1GP6A 2Q1ZB 1G9AA 2VZQA 2BU9A 3UKTA 4BA6A 1NA1A 2B39A 5KBFA 4YZ2A 1GLHA 2Q8DA 3NSTA 1F5FA 3GXUA 4META 5DN2A 3O1MA 1VAVA 1O59A 5BXXA 1DGRA 1MQTA 2NM1A 2VOWA 2DVGA 4WM8C 5EFUA 3ZYJB 2CHHA 1OA4A 4BQ5A 4EZHA 2EXKA 4I0AA 1QJFA 4LT5A 2C4XA 3KQ4B 3S5AA 2DTWA 4RN5A 2VVFA 2PHDA 2VCBA 5C8CC 2WLQA 2WNEA 4XF3A 5DPNA 4OCTA 1NCRC 2A5ZA 4QX5A 2WYSA 1DIWA 4JGZA 5FAXA 1T2XA 3L2YA 4KG0A 4CA9A 4OHVA 4PI0A 1J3QA 3I2GA 3VBSC 3SNMA 3W9AA 1UPSA 1IS5A 1QGLA 2ZZQA 5F37A 1VPHA 2NLRA 5EIYB 5JZGB 4XHXA 1UW8A 4W8JA 1TEIA 5CFDA 1KS5A 5HBAA 1GU3A 2AZ5A 5IVBA 1QH6A 2Y6KA 1UD1A 4OZOA 2V5DA 5ABJB 2B9UA 4P5HA 2DDUA 1GOHA 2BUKA 2IXLA 5K0UA 2XKPA 3I3QA 4KWUA 5GKAC 1RUF1 1UMHA 3VBOC 3ZMNA 3URFA 1FXZA 3PUIA 4K7JA 5GLTA 4BYYA 3CJIB 4RL7A 2LM3A 1A8DA 4WVVA 5CVRA 1F9KA 1MVEA 1RXFA 4H55A 4GWJA 2XBO3 1PGW2 5DAWA 5AC93 3IWZA 1W06A 1W6QB 3FC0A 3UV9A 2MEV3 3MFCA 3VZJA 2ES3A 5GLWA 4JDNA 5FP9A 2O1QA 4AI8A 2B7YA 4P08A 4LUKA 5A6QA 3SITA 5E16A 4JV4A 4HETA 2EIEA 1N3PA 4IEXA 3ZFEC 1OF4A 3ON7A 1LOEA 3J7MA 1RC6A 4FP2A 3WW4A 1JZ4A 1D4M3 2BWCA 4ORFA 2R043 1ZBE2 1L7LA 4ATEA 5EZWA 4JC1A 4B29A 4Q4V3 2VR4A 4AFCA 3VHNA 3AP4A 2WA4A 4FOQA 2QQMA 1LEDA 4HOOA 3RMXA 1OLMA 3Q9OA 5BNOA 1N1SA 2A75A 1PM4A 4MGIE 3ACGA 3VKLA 1RUF2 3DF0A 3Q8AA 2LROA 1GR3A 1CN1A 2JD4A 5FQ0B 1XYOA 2ZMLA 2FQPA 3CKHA 1NLRA 3ETPA 4FPKA 2IZWA 1BMV1 1UCXA 2ZGOA 5E1RA 5JOYA 2OS2A 5LASA 1REDA 5CFCB 3MYXA 5KXCA 3LA3A 2VAUA 1OD3A 1PX4A 4XIOA 1ZX5A 1UYYA 1BJQA 2VW2A 3NJXA 1QJZA 3EHKA 1VMJA 3HNBM 3HQRA 3OOXA 3VHPA 4A6OA 4GH4C 4B7KA 1SPPA 4HLTA 1Y4WA 2VNOA 2J7MA 1REFA 1CAXA 1WWYA 5FYVA 1W6MA 3EQEA 4Q0UA 1QOOA 1RUJ3 1YEWA 3L2HA 4N43A 4XUQA 4P9WA 4KWLA 1FV2A 1NUKA 2GP3A 1C57A 1J58A 2PAKA 1FMD3 3VDCA 5F8PA 2X29A 1MZFA 3AFKA 2C9AA 5FMBA 4CXYA 3PIGA 3WG1A 3NRUA 1QJU3 2VMEA 1W2AX 1X82A 2VUDA 4MOAA 4CU6A 3ZR5A 1OUSA 1V9U1 4URAA 3IBMA 1NA1C 2A1XA 1ZZBA 2NMNA 3M3OA 1IKPA 3AP6A 3P6BA 5LB6A 5IAXA 1NKGA 1BMV2 1ZA4A 1HDKA 2G4IA 5CKNA 1MQTC 3OY8B 1V0AA 3RI9A 4LA3A 2XUMA 2QVSB 1CAVB 3AMHA 4QXKA 4J1XA 3I3MA 1QJX3 4LNVA 1VBD3 2IXHA 5FY9A 3NAPA 2W2IA 5FY5A 1GP5A 3ILNA 4JGZC 4X6RB 1L7RA 2OYZA 5ANQA 1LEMA 2JG9B 4KBZA 3RJ2X 4BQ4A 2VJXA 3J26N 4MHUA 3ZFGA 1EPWA 3UL2A 4UYBA 2CNAA 2WQZC 3LSEA 4GULA 4DINB 2VMHA 1CZSA 4MUVA 4COZA 3LEKA 5JPNB 2VQUA 1QOSA 1WMDA 2HEVF 4LBKA 1LHVA 1LHOA 3TNQA 1TG7A 2O8QA 3NV2A 4L2NA 2HEWF 4L8QA 3SQOA 2RDRA 3ZSLA 1PVC1 3A4UA 1V9U2 2W46A 1CPMA 3ACLA 1JMUB 1LOFA 3RPQA 2EXHA 4EV0A 5FMOL 1JHNA 2PYTA 3GJBA 5FP4A 1EAH1 1R083 1CJDA 3RYKA 1BVP1 1K5MA 1NXMA 1WCDJ 3QD6A 4XE9A 5LBCA 5AC91 4Y1VA 4A2UA 3EJKA 4OFGA 5IVYA 2LS6A 4Y24A 2MEV1 1P8JA 3I3DA 4AWDA 2VMCA 3BOWA 1H2NA 4HL0A 4D8MA 4Z8BA 2BJSA 4IW3A 2FZ2A 1PHMA 4M3CB 5A33B 1JOJA 4K1ZA 4LO5B 3NNMA 2VG9A 4QDQA 4YZ4A 2CGPA 5CA6A 4ZZ8A 5JXGA 2ZABA 3PUSA 1A6CA 5FYZA 4FPGA 2ERFA 1WCQA 1OBNA 1D4M1 2FBEA 4H7LA 3VHOA 1LCLA 1UY4A 1VJ2A 3FUQA 2VU9A 4FPEA 4F83A 4I01A 5BNOC 3U1XA 1QDCA 4P9IA 3USUB 5F5IA 2WS93 3VZOA 3BU7A 1AXKA 2GC1A 2Q0AA 3ES4A 3RS6A 3D3AA 1DCSA 1AR71 4NIGA 1K5JA 2ZEWA 1ONAA 2Z4FA 1OFNA 1F8VA 1CZTA 2XHKA 4DUVA 1S0GA 2DYCA 5AC92 1LGBA 2H6BA 1XNKA 1CX4A 4N53B 3ZYPA 2MEV2 2CTVA 1HRV3 5A7WB 2VZ3A 4DEQA 4G3YC 4AQSA 1CPNA 1SBEA 4LBMA 4M4PA 3OB8A 1WKYA 3U75A 3T30A 5LBEA 3E5UA 5IVFA 2F6BA 1GICA 2MHFA 1J1LA 2B4KA 3POIA 2AEZA 4DOUA 4ZS3A 4XAEA 3ZFFB 5AFEA 1FX5A 4BMBA 1YNAA 2PA7A 5FZOB 5I8TA 2IXCA 4ASMB 1GOGA 1D4M2 1GYKA 3PMSA 1VLNA 3S57A 3EO6A 5JMOA 2BQPA 3MFAA 4QX0A 4CZSA 4N43C 4Q4V2 5JLVA 1RUJ1 3WEZA 2E7AA 1WW4A 3ENRA 1YO8A 3POBA 2A3WA 4GWMA 5A3UA 2QBXA 1FMD1 2C9KA 3J7NA 1BZWA 1KFUL 3CIHA 3IKWA 5HCHA 4MVTA 3GGLA 5FY1A 3KB5A 3N9OA 4NHKA 1W8WA 4MYEA 4XPVA 5F5QA 3ZOIA 1XXNA 4QHBA 2X5IA 4QPGB 5DAQA 3VBFA 4YGBA 1LODA 5IVJA 4Q27A 2FD8A 1OOPA 2ETEA 1AR93 4RQPB 4Q5OA 3SC7X 3LIGA 2WQ8A 4PLOA 3W59A 1AUYA 2DBIA 4LUMA 3T08A 4AI2A 4DY3A 3ELNA 4PLNA 1GZTA 1RTVA 5IATA 3MV01 2WBKA 4XJZA 4YVSB 4AI0A 5JXJA 1ND2A 2JG8C 4Q2FA 3VBHA 2DUPA 4XBNA 3NAPC 3K4AA 2FDIA 3VBRA 3H8OA 1QJEA 3T2QA 3WCSA 4RFRB 3B3QE 1A8MA 4HK8A 5IUQA 4LOSA 5B2GB 3ZFGC 2VCAA 2HBUA 4JGYB 3LA2A 3MF6A 4PDWB 3S7IA 1EYBA 1SFPA 1RUJ2 1X33A 3U10A 2WO2A 2P34A 4FOVA 3VZNA 5HXMA 5LY1A 5LEJA 1XQNA 1CVNA 1TNRA 1FMD2 1YFUA 3A21A 3IDAA 3OEAA 4B1LA 2JDMA 4XDPA 4O65A 4Q8LA 1DYPA 4D3WA 5FO8B 4LO8A 5GLZA 4QKBA 2VTFA 3ZN6A 5IHRA 1UZ0A 5C9AB 2WN3A 2C26A 1LOFC 1MEC3 1UU5A 5T50A 3J8F1 4QGNA 1BBT1 4R52A 1K5MC 1HLCA 3LSDA 1O8PA 3ZXLA 4Q1RA 4P9GA 1WW5A 3H9AA 4LQRA 4QB6A 1OKQA 1T6GC 1QJX2 3MHZA 4FT8A 2D98A 4JKMA 1UL9A 3I2OA 2K46A 2J1SA 2YY1A 4GWNA 4NWWA 1COV1 4B8EA 5JXIA 3TEWA 2A73B 2YHJA 3OUHA 4OYUA 3TEXA 2ZX4A 2ZXQA 5T5LA 1U5ZA 3UGHA 3OGVA 4LKFA 3ZPYA 2WZ8A 3WDWA 1BVVA 4R9BA 4AHYA 4XIKA 5A32B 2Z69A 3KWVA 2DVFA 2WWJA 3B9IA 4RS5B 4Z2WA 1UZVA 1NZCA 1NCQB 1PZ8A 1YIPA 4B1MA 2BOJA 4AF9A 2XDVA 1WD3A 4R9CA 1MS1A 4KU8A 3SHRA 1SMVA 2XVLA 3UETA 4AEDA 5IK7A 2VBPA 1DQ5A 3P5BA 4IEWA 1RUD3 2WS91 3IDEA 4FFIA 4GKYA 3AZWA 4INDA 4XZUG 4N90A 2JWPA 4LKEA 5A7OA 4NWVA 4LA2A 1WW6A 5A80A 1YXWA 3WNPA 4GJYA 4LBQD 1RUNA 3WF2A 5DZEA 5KR7A 2C5DA 1R082 1ENRA 4TN7A 2F4LA 2AYHA 2VXRA 1Y43B 2HWB3 3FHAA 4ZU5A 5AFBA 2Y8KA 4JAAA 3K51A 3OGGA 1UIKA 1W8NA 5A6ZA 1LENA 3I97A 1TME3 4M0NA 3D82A 3ZKYA 3BVCA 1IG3A 3AP5A 3WP5A 3N7JA 5C7GA 1URXA 5KHJA 1UN1A 2WZR3 4AVVA 2VD7A 1S0BA 1I3HA 4BISA 4IGPA 3IPVB 4MO3M 2RDSA 4QKDA 5D2AA 5KWRA 4GWIA 1PGL2 3QOPA 1OSGA 4CUBA 5CFDB 2PHWA 1GZCA 1UMIA 1Y9GA 2YV8A 5DDJ1 1ZREA 2J22A 3K3OA 1GOFA 2R16A 4IETA 2VULA 1AVBA 1S0EA 2E51A 5C70A 5K0UB 4FVVA 1W8UA 4OZXA 1UY2A 2WS92 4N8MA 4W65A 1PM7A 1H8TA 3VBUA 1OQEA 4ARXA 1ULFA 3OJBA 2D3RA 2RR13 4L0PA 3QH7A 1FOD3 5IVEA 3PTRB 2X5IC 1ND3B 4WZCA 3VBFC 4C0BA 4CDWA 5JPMB 1OOPC 3AJZA 4IEUA 2BNMA 4KWKA 3ABZA 5FZAA 2R7EB 4NOTA 5IK4A 4IGQA 4KU7A 1HRV2 1MZEA 2D6KA 3R4UA 2CAUA 2X8KA 3DECA 5LA2A 1A34A 5FZEA 3WNNA 1C5HA 4XW3A 3BPZA 1ND2C 4XURA 2K9ZA 4W6YA 3BU0A 1QY4A 2H0BA 3WDXA 1JODA 4CDXB 3VBRC 1JZ3A 3MF9A 4TZDA 3J9SA 4Q4W3 3NJVA 4U2AA 5C5UA 4RA0A 4RR3A 2Y60A 2P1BA 1AXZA 3C3VA 1RUG3 4PI2A 2Y26A 2W1UA 4WM7B 4WVZA 3GDBA 4OHXA 4ZONA 3O1RA 1EUTA 1O4TA 2BW8A 2GMEA 5EV7A 4XC9A 2FDGA 2D6PA 2PHRA 2QQLA 1YFXA 1W39A 3H42B 5K7PA 5FYIA 1TMF3 4QDSA 3D8CA 3DN7A 5L7OA 2WQ4A 3PTYA 3Q8FA 1UZYA 1CAWB 1UX6A 1WUVA 2JXAA 5FY8A 2P17A 3U14A 5FZ9A 3WXPA 5FMOS 1EPZA 5FY7A 3O1VA 4GKXA 1QJY3 4RFT0 1AR92 1MEC1 2ZOEB 2I45A 3IT8A 3H0OA 4CEYA 4XF1A 4XFFA 4C8DA 4IERA 1N3OA 4CUCA 3R0RA 5F1RA 3O1TA 5L9BA 2W3JA 1S55A 3TEYA 1S0DA 5ANNA 1J84A 3M1HA 3HIFA 2Y34A 5ACA1 5CG9A 3GJAA 5DUXA 3W20A 1ULDA 2JIGA 1Y3TA 4YW1A 2J1RA 1PMIA 1YUDA 4A3ZA 4LOTA 4WBBA 2W92A 4M3CF 1W6MB 1C8M1 5J36A 2YC0A 4CDUA 4CP9B 1SBFA 3S7EA 2WJSA 5CNAA 1LU2A 4Q4X3 3FLRA 3LFMA 4HSJA 1RUI1 1STMA 2YGMA 4P5YA 2Q8EA 1FPN3 2D7FA 3PVEA 5C4WB 4NMIA 4Y5SA 5GZGA 4PIXA 3BTYA 2FDFA 3RNSA 4AEDC 1G6NA 4FOWA 2WZPP 4XFHA 1X36A 1OMIA 1BK0A 3OBAA 2R49A 4Q4Y3 3AJYA 4PT6A 1ZZ8A 1MEC2 3NKTA 3VD5A 1UKRA 4AL9A 3WHTA 2RJ2A 1F5JA 2EIBA 2OX0A 2P3KA 1HQNA 1W2NA 1UY0A 2O0OA 4XXAA 5T52A 1X8MA 4DUXA 2DCJA 4YWAA 2UU8A 4XBLA 4XACA 2FMYA 3RRDA 5ACA2 1FI2A 3LEMA 2B46X 4EJRA 1TME1 3WF4A 2WYFA 4K8FA 2BFUL 2F17A 2A6YA 2WWSA 2J42A 2XOMA 3VDDA 4EE2A 2B5HA 5LK7B 3DYMA 4HN0A 4OLLA 4PIYA 4I0BA 3RZGA 3NWKA 1Q8SA 2OUHA 2PHUA 4U36A 5SV5A 5C33A 1S2BA 3T2PA 1W2TA 3O1SA 1W04A 4E4DX 4CCOA 1BQPA 4LULA 2DTYA 1V6LA 1B09A 1SFNA 3B69A 5CBLA 1XNCA 4AFBA 1RUD2 3ZPOA 1S0CA 1TQ5A 3I7DA 4LLFA 3T2OA 1H8TC 4GQ7A 3VBUC 4UFJA 4CCJA 5EYXA 5FP7A 5IK5A 1YRZA 1LOBA 2YBPA 4UW6A 2RR11 4LITA 3A7QA 4IE0A 4CDWC 3I2DA 1XNAA 3HNYM 5HPOA 2NQYA 1OVPA 2WNUA 1YQ8A 4UF0B 5FMDA 1ULGA 4YGEA 4ZU4A 1IHMA 3I2KA 5A3NA 2AREA 3LQCA 1RUC1 1TME2 2ZGSA 3OD0A 4K20A 1V6IA 5DMYA 3BN6A 2FDHA 2RDNA 2D6MA 2XLAA 3AVSA 1TNFA 5FPZA 1N47A 1NLSA 3AFGA 2WZR2 3ST7A 1FNZA 5BNPB 3H8UA 3WZ1A 2GNDA 4I30A 1WLWA 4XZPA 3JB8A 4RR3C 2B42B 2QCSB 1O5UA 1RINA 1RUG1 2XQRA 4UW4A 2OKXA 2QFEA 5D8AA 4CP0A 4D6QA 2JD9A 1FT9A 3Q8BA 1LTEA 1UO9A 2R063 4JRLA 2OZJA 5I8YA 1SDWA 2VMGA 1J1TA 1ZYBA 3C2UA 3K75B 5DG1A 5BNNB 1ULCA 2BNNA 4XOGA 5I0SA 2RR12 4H3WA 3BGAA 3PNAA 5B4XA 1H6XA 3TAYA 1JZ2A 4GXLA 1SG3A 1QJY1 4QPIA 5DUUA 3U07A 4CEYC 4D7SA 1YHFA 1K42A 2B45X 3IMMA 5LCWL 4FOYA 2D97A 3GZTB 4BIFA 3AP7A 1WA6X 1XNDA 4GJZA 4R4ZA 1CZVA 2XONA 4HT1T 2AENA 5JCTA 1W2UA 5CISA 3H1YA 2Y6GA 4UBGA 3OD4A 4HPKA 2SLIA 4Q4W2 5FMCA 3J4UH 5FOJB 4NPLA 4PBOA 1S2KA 1RUG2 2VZ1A 4XJ9A 1NY71 4MG2A 5F3EA 5ISLA 2R0FA 2NMOA 2OT7A 1ZZ7A 1OA3A 5EJ1B 3N7LA 4LMFA 1GZWA 5JI9A 2Z42A 4AGVA 1FPN1 1UXZA 4E27A 4TTGA 1G9CA 3VDAA 4GMP0 5J1XA 1TMF2 1X50A 2R0HA 2YYOA 5FPXA 1W03A 1AR83 1J3RA 3I2IA 1VBB1 1QJY2 4M4RA 2DU1A 5GZCA
chains in the Genus database with same CATH topology
1AX2A 2CWSA 1JW6A 1W6OB 3LZZA 1DF0A 3VZMA 2DWRA 3OBRA 4R8HA 1V70A 3VBHB 2BPA2 3AKRA 4LO7A 4IV1A 1RHI1 1CGPA 4GB33 3MW3A 4IEYA 1DFQA 3VDDC 3N35A 1DQ0A 1NY72 2D5FA 4IQPA 1D0GA 4LE3A 2I2SA 4NVPA 3CO2A 4Q4X2 1KFXL 4CEWB 1V9U3 1CESA 3FBYA 1IQAA 1OQ1A 1FPN2 3SMHA 3WP4A 3GF6A 3ZN4A 3I59B 2ZS6B 3H1WA 3E6CC 2Q8OA 1YFWA 2ARBA 2E6VA 2RHPA 2WSUA 4BQ1A 3JZVA 1N3QA 1I1EA 1XYPA 4Q4Y2 1MZ5A 4B4PA 4EWAA 2ZX3A 1LRHA 1QQP1 2VECA 2WNUC 5T5PA 4MV2A 2RJLA 1V6NA 1ENXA 3TBDA 4E9KA 4CTEA 3IM0A 1H1AA 3OTFA 3LKJA 3O14A 4JDMA 3KSCA 3HT1A 5FOBB 1MS0A 2WT2A 2GNMA 4YVWA 1PVC3 4HKWA 1Z7S3 1AX1A 4RSUA 5D8AC 3HMYA 4QQ2A 1FATA 4Q0PA 2HYKA 1EAH3 4QMAA 2R061 3ZXJA 2R32A 2XLGA 4Y1XA 2EAAA 4C90A 5KXBA 5CIRA 2RS31 1Z78A 1QQP2 3R05A 4KQ7A 4ONUA 3WINE 1LOAA 1Q8PA 3GZUC 4QPIC 2RS53 3NV1A 4Y20B 3M2MA 1PK6A 2O8OA 3DV8A 3VKNA 1OFSA 3WUDA 1RJ8A 4A7ZA 2DCKA 4QD2A 1C4RA 3B00A 1W6NB 2EXIA 3I4IA 2GC0A 4YZ3A 4PBPA 1AXYA 4Q8KA 1AR73 4A3XA 2A3XA 1LJ7A 2VNRA 3HAGA 1MZ6A 1RL3A 2R062 4K21A 2OPKA 2XVKA 3V0AA 4GA9A 3E5QA 2JDZA 1JN2P 3NVCA 1VBE3 4XJWA 3O5SA 3TWIA 4NR1A 1DG6A 1DQ2A 1RITA 2N7GA 4IV3B 3VKOA 1AR81 5JIAA 4S2FA 4CP2A 3V64A 3POYA 3UKNA 1W6PA 4S2HA 4Y1YA 1LOGA 4L11A 5HXVA 4AEKA 1SCRA 4WV8A 1KS4A 2BFUS 3KCYA 2DV9A 1WGPA 3H3ZA 2KA3A 4IV1C 4B3NA 3SCGA 3VZLA 4GB31 2D5HA 4XQ4A 3TRSB 1H9PA 3H50A 3KT7A 4ASLA 3V0BA 4ZU7A 4M00A 1M4WA 2H6CA 1Q8QA 3WDUA 3FJSA 1L3JA 3OGJA 3NKGA 1PIV1 5FREA 1G9DA 3B94A 4HZFA 3ZYIB 5FRAA 5L7OB 2QZ3A 2D40A 1GBGA 1B35B 1AR82 4Y22A 5T5JA 4CDQA 5CADA 2D93A 1QOTA 3RYRA 2DCZA 2JG8A 4BH9A 4E4ZA 1LR5A 2JENA 3FWEA 2VQAA 4LBQA 3RJRA 3O0VA 3AMNA 4GB32 1PZ7A 4Q1PA 2P2KA 5J37A 1MR5A 3UKVA 4N9IA 2UWBA 4CDUB 3L9JT 4P9YA 2XVGA 4YVWC 1YI9A 2W68A 1LB2A 4AQ2A 4BHPA 3N7KA 1A3KA 2A6WA 1MS3A 1Z7S1 4YARA 3AMMA 4FTBA 4KH9A 3JCIA 5DZGA 3J8F3 1OLRA 2YXSA 1BBT3 3DPRA 4WVMA 2GNTA 1X8EA 2ENRA 3WDYA 4CP1A 5KC6A 1G86A 3AXEA 2H0VA 1COV3 5JOXA 2GC2A 3CL1A 4XTMA 4EN7B 3JBG1 3D6EA 4UW3A 2RS51 2A70A 1VB2A 3AX4A 1PK6C 4XEZA 4Q29A 2GDFA 4LHNA 3AK0A 2DVAA 4MX3A 3WQ1A 5GLVA 1KRIA 1VIWB 2QDNA 2RS11 1CAUB 2DVBA 4TWTA 2ATFA 2BEOA 2SBAA 1PVC2 3FHIB 4AW7A 1U5XA 5GZFA 1Z7S2 1KDMA 4AQ6A 1DYKA 5FO7B 2VNGA 1Q43A 1MS8A 4QGLA 5CB7A 4IESA 1EAH2 4WM8B 3KZ4C 2WFF1 3O0WA 2VW1A 1ENQA 2IC1A 3SLIA 3WVJA 2DCTA 3E6BA 1VBE1 5C8CB 1V6MA 1NCRB 3PVBB 5EYYA 3JBG2 4G4FA 2TNFA 2RS52 1MS9A 2XKOA 4AGGA 1C28A 1U5YA 4IEOA 3VBSB 2IXJA 1KQRA 2ZHLA 4YM1A 1YFYA 3LB9A 5DDJ3 2UYBA 3OYWB 4LBOA 1O5LA 3NV4A 3JQWA 3MGUA 1JTZX 2WNVA 3W58A 5GJ6A 1OA2A 2ET7A 2HWE3 3ETQA 3OCPA 1W0OA 3APBA 4QM9A 4RD7A 1UF2C 3MIEA 3VBOB 3NO8A 2A71A 3PVNA 1AR72 1KITA 3AMQA 3HBZA 3JUUA 4FQ4A 1YCIA 4R9DA 3VZKA 2UYAA 3GALA 2WFF2 4HVRA 3VLBB 1IS6A 2TBVA 5TSWA 2YROA 4YFWA 1VBE2 4IXLA 1CQ9A 5A3MA 1LECA 1WW7A 3O12A 4CDQC 1R1A3 2GU9A 4ITCA 5C8WA 4FCAA 4FPJA 3ES1A 1AX0A 2DURA 3DGTA 3ZFEB 4XXPA 3MZHA 2ZKNA 1O3QA 1WLTA 2XJUA 3USSA 5J98B 2HWD1 3MW4A 4JDOA 1G7YA 1HRI1 4OI4A 2QDRA 3WOGA 4JCKA 4Z1VA 1WLCA 4D7TA 1JUIA 3QCWA 4FPOB 2JX9A 1ALYA 4F3JA 4B4RA 4BM8A 1GQHA 2JECA 2XJSA 3KGLA 1VR3A 2CV6A 2ZACA 1XNBA 3NL1A 2WT0A 3DPRC 4ATFA 4FTEA 1KD7A 1DGWX 4X8PA 4FAGA 2QJVA 1XU2A 4FPLA 5ACA3 4J6GA 3VUOA 3AYCA 4GH4B 1AL23 1H2LA 4LE4A 2PAMA 4MXWB 2EALA 3GNEA 3LOIA 1C8M3 4W6XA 3JQXA 2EXJA 2ZGQA 2BNOA 4YFZA 3WDVA 4TSVA 1HRI2 3AKPA 1REEA 2DVDA 3ROUA 3MLLA 1D0HA 3R6SA 1RUI3 3KCCA 4M0HA 2GH8A 3KD4A 4TLFA 1IOAA 2PHFA 4I2OA 4QQPA 1NA1B 2BTVC 1HIXA 1EV13 3J8F2 3N4MA 5JZGA 2AUYA 2RM23 1BBT2 1MQTB 5KXEA 4JGZB 2WA3A 1COV2 1DZQA 4M01A 3MLJA 3CJIA 4YG3A 2EA7A 1UKGA 4BMEA 4AGRA 5T3NA 4OUMA 1W6QA 1S0IA 5C6CA 1Q8VA 1F31A 4XMIA 3WQ7A 2WNVC 5GALA 2D44A 3WX5A 4FTSA 2HWE1 4FSJA 3MPBA 2WC2A 1FNYA 3B93A 4S2DA 4H7MA 4LLOA 4MZUA 3X29B 1U0AA 5J3UA 2GC3A 2NN8A 4EN9B 3D4KA 5I0UA 1H2MA 4GALA 1EY2A 2BWAA 1RUC3 2OW4A 3IDBB 5LK5A 3M8LA 2V73A 1QH7A 3MICA 2W52A 1R1A1 2EVXA 4YGCA 5FQ0A 2UURA 5DUWA 4HVQA 2AH2A 1DQ6A 3P3PA 4E2GA 3PHMA 4FPCA 3WP6A 4P14A 2PHLA 5DDJ2 3RDIA 2PHXA 1ENSA 1AYM3 4YW4A 1MS4A 4Q0VA 5JSPA 3QBQA 1IPKA 5BNOB 1NQDA 4PF5A 2HWE2 4KGGA 1J59A 2GN3A 2YMZA 2VVDA 3B02A 4FO9A 2BVVA 3TNPB 3V56A 3GZAA 5KC5A 1DLLA 2JJ6A 4N9HA 1SLTA 4HMZA 5KXDA 1LHNA 2DF7A 1HQWA 4HFSA 4CRQA 1C5IA 1I6XA 4NHLA 4XBQA 3S6PA 4AVTA 2A3YA 3FBMA 1R1A2 1UPIA 2JEMA 1SACA 1DDLA 1X7NA 3THPA 3MIGA 1LGCA 1AL21 2WLPA 2ARXA 2VY0A 1CAXB 4E2QA 4N43B 3OY8A 4LTAA 1FAYA 2ZGUA 4S2GA 4IEPA 1CAVA 2Y0OA 3M3QA 5KHGA 3FZ3A 3WY6A 1AJKA 2Q30A 2JG9A 5SV8A 5BV6A 3TOJA 5KHHA 5HCFA 1VBB3 4J1WA 5JOWA 2HWC1 1SLAA 4BLIA 5JZGC 1VBA1 1EV11 2UY9A 2RM21 1PZ9A 1VBC3 4RHV1 3FLPA 2Z5WA 3B01A 3MI8A 5ABJC 3HT2A 4XYXA 2JG8B 1QXJA 1Q3EA 4QPYA 4XF0A 4XJAA 1RHI3 3NAPB 1ZRCA 2PTMA 1AL22 5F6KA 2E7QA 3H7YA 3ZFGB 4Y1UA 1SFYA 4R9AA 3CJIC 1C8M2 1R093 1RIRA 3GYDA 1O4ZA 2VGDA 2W39A 1XU1A 1ZM1A 2VH9A 3T1LA 1RUI2 1IS4A 3SCFA 1AL0G 1GNZA 1AZDA 4M3CA 3GBGA 5A33A 1SLBA 1DGLA 1UAIA 3WNXA 1SCSA 4AVCA 4O9GA 5JMCA 2ZX2A 2CGOA 2Y0IA 1WCSA 2DFBA 1EV12 1PO21 2XPJA 1QQP3 2RM22 3KLSA 4JVAA 1K5MB 1ZZCA 4EWDA 3SCHA 2XB6C 2XLFA 4XQWA 1NE6A 2XH6A 5T54A 1GKBA 1C1LA 3USUA 1POV0 4YW2A 4ES8A 3AP9A 1JXNA 1V6JA 4AG4A 3MIHA 4P9JA 4C91A 1YI7A 4CYDA 5EXOA 1ZBA1 3ZSJA 4N53A 2WT1A 2D6OX 1SBDA 5CFCC 3ZXAC 1WBLA 4DY5A 2E53A 4AHZA 1AYM1 4C1XA 4GMP3 3PJQA 5H9SA 2CWMA 1VB4A 3ZFFA 1GFF2 3GBWA 1DGRN 4PQ9A 5GM0A 3KS7A 1PO22 2RS33 1GANA 4BIOA 3WCRA 1QHDA 3GBFA 1LGNA 3M7AA 4Q0SA 3SXWA 1DBNA 1RUC2 3FLTA 1NQJA 2RMU3 2ZMNA 3M70A 4D7YA 2TEPA 3JD71 1R1ZA 4KNCA 1RVF1 3FE5A 3O0XA 4QPGA 1AJOA 3PJYA 1W0PA 4RQPA 1QXPA 4WZFA 1O7FA 2DUOA 1HX6A 1WMFA 1KJRA 5KHIA 4YM3A 3AZXA 2WNVB 1AYM2 2PHTA 2PFWA 2VQ0A 1IZ3A 4YVSA 4DS0A 4DMIA 2GALA 3ME2A 2Q5TA 4XQDA 3ZIXA 2IFWA 2JG9C 2X5IB 4PCRA 3VBFB 4JGYA 4F8AA 1HXS3 2D6LX 2PAEA 4LEJA 4PDWA 1OOPB 2DUQA 3MIFA 1OPOA 1Y7BA 4DRRA 1IPJA 2IWGB 4YG6A 4QQLA 1VBC1 1XE7A 1POV1 4MGKE 4RGAA 3LAGA 1YLLA 4JQRA 1O4YA 2V5YA 4GIQA 1HQLA 3WG3A 1ND2B 3WQ0A 1RVF2 1YYNA 4KG8A 3WDTA 4YZ1A 3VBRB 3FFQA 5C9AA 5CG8A 2WKKA 4DPNA 4DRVA 3B5LB 1FV3A 5DXDA 4OI2A 3WHUA 2QUOA 2X53S 4XJUA 1R091 1DQ1A 2ZTNA 5F9TA 2WINB 4BE3A 4D94A 1E57A 4W6WA 2PLV1 1PIV3 2A6XA 5GZDA 1PO13 1PVXA 1GZ9A 1RMU3 3H1MA 3HD8B 3AZZA 3ZN6B 2VPVA 1H30A 5EWSA 4TYSA 1NG0A 1VBB2 1F2NA 2V09A 3FFZA 1OQDA 2Y38A 5A32A 4RS5A 1VBC2 1NCQA 5I0TA 5GLUA 1ZRRA 5BUVA 4UXAA 1RHI2 1DU3D 1ZRDA 4UBHA 1H0BA 3MLKA 2R073 4B7EA 4Y26A 1Q8OA 3LWCA 5HCBA 1LKNA 1R092 1PGW1 3E97A 4HK9A 4OHYA 4N53C 4B4QA 2PLV2 3E6DA 2HKXA 1H9WA 4AVAA 2XWJB 4I3PA 3NJZA 2ZGRA 4AEDB 2GH2A 4JRAA 4GMP1 3BODA 2WIIB 3RI8A 3ZFFC 4DZGA 4ISQA 3IPVA 3AKQA 2QZ2A 1U12A 2YDEA 2Q4SA 3O7OA 1ZBE1 3UJOA 4Z92B 3ZX7A 1GSLA 1BKZA 1QU0A 2GMPA 3JBG3 4PJYA 3ZXGA 5BYNA 3ZXDA 3E5XA 3ZVXA 2RMU1 2D3PA 2RS13 1YJKA 2PN5A 1WMEA 4QPGC 5HI0A 1ND3A 3D0SA 4RQPC 4P9XA 2NPIA 2ZGMA 1G9FA 4XFCA 1DHKB 1VP6A 3VHRA 3INAA 4LBJA 1N1VA 2QE3A 4YVSC 4MGYE 1MS5A 2VVEA 1PNFA 1IS3A 2WFF3 2ZJCA 3WG2A 4YSFA 1H8TB 3VBUB 3NV3A 4CDXA 3MW2A 1RB8G 1SLCA 3AYDA 3JU9A 4AK3A 2RS32 3OF1A 2IXKA 1AHSA 4CDWB 4JGYC 1SLLA 4COYA 1H4GA 3QACA 1HXS1 4PDWC 4IEQA 2OIIA 5I8SA 3VV1A 1H8VA 4XFAA 4WM7A 1IGOA 3U0ZA 2KM2A 4LBLA 4DQAA 3AM2A 4HKLA 2LTNA 4L97A 1CJPA 3BB6A 2RMU2 3CJXA 2A6VA 2E63A 4MH0E 3D5OA 4L99A 2NZ9A 1CAWA 1LULA 2QQPA 3A0NA 1ZNPA 5C9AC 4RR3B 3AB0A 1VRH1 2ZAAA 1QMJA 5DZFA 1Q5OA 2CL2A 4L92A 3IIAA 4YG0A 5JAXA 2ZMKA 5A3LA 2R30A 4K1YA 2PELA 3SISA 1BEV1 1PO11 1RMU1 4AFMA 2RJKA 4K6BA 4X8NA 4AYUA 1HXS2 1M06G 2B8MA 1QF3A 4CEYB 1ASJ3 4YW5A 1H2KA 4V1PA 4BZ4A 2JICA 1JYIA 3B7MA 4RS5C 3RQ0A 4BCUA 3BALA 1NCQC 3CF6E 4SLIA 3R4SA 4QT6A 5C4WA 2QNKA 3FX3A 1CR7A 3ZN5A 2XJVA 2HWD3 3HQXA 3BIWE 1HRI3 1UU6A 3TN93 1LOCA 1JH5A 2G9GA 1VRH2 4XDQA 2R071 2RE9A 3VL9A 1BYHA 3VL8A 1UZZA 3S30A 4AE2A 4BPZA 4E4SA 1VAKA 4MLOA 4QQOA 1BEV2 1PIV2 1YJLA 3JB4C 5FLJA 1PO12 1RMU2 4Z82A 1SEFA 4XTPA 5JVVA 4NPRA 2UWAA 4X6QB 4BOWA 1G9BA 4PLMA 4YM2A 3RYPA 5CFDC 4OI1A 3ILFA 2OUJA 1C1FA 5JI7A 4ZKTB 5K0UC 1C3HA 4ZXKA 2IXIA 2XJTA 2R072 2BYVE 3FMGA 2ZPXA 3VDDB 4DXZA 3FUOA 3MEPA 1ND3C 2CY6A 2ZHNA 2BBVA 2R6QA 4MGZE 2XBO1 4OI0A 1D2QA 1OHFA 4AVBA 3IN9A 4KL1A 3RG0A 2EIGA 4Q26A 1JUHA 3IMNA 4EROA 3WD5A 5H9RA 4LO6B 3HN1A 3ZXEA 4JTNA 1GV9A 1SLIA 3DUIA 2C0ZA 5BNPA 1OPMA 4CDXC 5CU1A 2I07B 3AZVA 3GHMA 4Y4YA 2ZGPA 2GAUA 4DB5A 5K9YA 4FPYA 2R041 3LA7A 4K9SA 4JTOA 4XF9A 2WNUB 4Q4V1 4WM7C 1AR63 5LRRA 5T55A 3KCXA 3WUCA 5K8SA 2UWCA 2ZA9A 2WL1A 4D69A 1IKQA 5BNNA 5J7MA 2RS12 1D4VB 2XBO2 4M3CE 4PIZA 3N3HA 1TE1B 2GMMA 2W0XA 4QQHA 5D8AB 1RGSA 4FXGB 1ZZ9A 5I93A 4G9SB 2BVBA 1O3SA 3SH4A 3K48A 3B9CA 3WW2A 3U4XA 2XL7A 2R042 5LRSA 4XILA 4QPIB 1DGWA 3ZO0B 1ASJ1 1RJ7A 4URTA 1N1YA 2LALA 5C4WC 1Y9QA 5L73A 4AEJA 5IT6A 1QJU1 4N7IA 2ILMA 3KMHA 4YM0A 4MSVA 2XJPA 1ZRFA 1VAMA 2P3JA 4HPKB 3TN91 3ZSMA 5JR7B 4NN0A 1W6OA 5DG2A 2TUNA 1GZWB 1QJX1 1QDOA 4I02A 2XJRA 1VBD1 1GNHA 3TYJA 4YRDA 5FFOC 3WP3A 4A7KA 2IFRA 2FMDA 2WSVA 2YGLA 3NW4A 1QWRA 5FLIA 1DZRA 1ASJ2 2YPJA 4YW3A 4CEWA 2ZAHA 5J48A 3HR9A 4DFSA 4F7ZA 1JYCA 3I59A 3N36A 1QJU2 2ZX0A 3MIDA 3D0JA 3KT4A 5J09A 2HWD2 2JKBA 4IV1B 3ZMOA 1LU1A 1RUE3 3DL3A 3TN92 5FTTC 5FO9B 1VALA 4P9LA 1KXGA 4IEZA 1HW5A 2VW0A 1R081 1S0JA 4LHLA 1PNGA 4AXOA 1CIWA 4XETA 2K0GA 2HWC3 1VBD2 4OULA 1OLQA 1VBA3 5BPXA 2GZWA 1YWKA 4RHV3 5BNPC 3UK9A 5ABJA 1PGL1 3M3EA 2R1DA 1JBCA 4XHBA 4A7YA 1H1IA 1SQ4A 1AR61 4HANA 4AFDA 3MIBA 1BK1A 2QKDA 2Z79A 5BNNC 4YGDA 2E7TA 4SBVA 4HSLA 2HJIA 2XWBB 3I8TA 5CAZA 3SH5A 5JIUA 4YVWB 2A6ZA 5GZEA 2A7AA 2HEYF 4QM8A 1HRV1 2EF6A 4Y20A 3MPPG 3QH6A 1QKQA 5E88A 3CNAA 1PO23 2DU0A 2P37A 1NYWA 4MXVA 4AI3A 1O3TA 4ISRA 3ZXKA 4C1WA 1KDKA 4N7UA 1LHWA 1W6NA 5I0RA 1CONA 3KT1A 3CEWA 2ZGNA 2GN7A 3THTA 3AXDA 5FCCA 1RUH3 4IEVA 1AR62 2ZBJA 4C0HA 1AYN3 3R4DB 1H4HA 2ZKLA 1PK6B 2UY8A 3GHNA 2BGCA 4YYOA 5LEKA 1UMZA 2CGNA 4XFGA 1WA4A 1MVQA 3AZYA 1APNA 3PLQA 1ZBA3 2YZ4A 1PGSA 3BOPA 4Y1ZA 3P3NA 2FZ1A 4FAHA 3VN4A 4LO4B 3WR0A 5CFCA 4AFAA 3POWA 4IV3A 1AR91 3T1MA 1A78A 2ZGTA 3H3UA 5JWPA 3DKWA 2K2SA 1LESA 3KGZA 4AHXA 3UJQA 3VGIA 2ZCWA 4FP3A 2ET1A 3PMEA 4AEMA 4AVSA 3IDCB 4Q0QA 4OUSA 3ZXFA 1V6KA 2LUWA 3V0AB 3VBHC 3ILRA 2XGXA 4NO4A 2DFCA 3VKMA 4H14A 2NYYA 3MDPA 2VOVA 1H1MA 3JD73 1RVF3 4CEWC 5HCAA 2ZGLA 1W6PB 2D6NA 4QGMA 3WG4A 1D2SA 2XG3