5FLHA

Free state of ni-quercetinase
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
190
structure length
190
Chain Sequence
IEYATRHRARSFIPPEPGKPYFIEKGLGDRAHLFGDLITIYAGGEQTENTFNFFTCEGPKGEVIPAHSHADTYEVFYITQGAVRLFVEDLEGEQHEKLLTPGDFGFVPKNCVHAYRMERHHSQVVGVAAGPGGTFERFFESLGTPAEELGLPVRPFVPEPEKFRTVPEQYDVRFRPDHQWHTGSIEGRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords QUERCETINASE QUED
publication title Quercetin 2,4-Dioxygenase Activates Dioxygen in a Side-on O2 -Ni Complex.
pubmed doi rcsb
source organism Streptomyces sp. fla
molecule tags Oxidoreductase
total genus 46
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5flhA00
3E97A 4I0AA 3RPQA 3FJSA 1RC6A 4MV2A 3H1YA 4I3PA 3QACA 1ZZ6A 4PJYA 5JCTA 2BYVE 2PHDA 1CAVB 1FT9A 1I6XA 3BCWA 4YARA 1O3SA 4META 5FQ0B 2QNKA 3WW2A 3GYDA 4XFIA 5T3NA 4IERA 3OCPA 4XF0A 3I7DA 2KXLA 3CF6E 2K0GA 4UXAA 2IC1A 3RNSA 3MYXA 1G6NA 4ORFA 3DV8A 4IEOA 3LAGA 4QXKA 5FLIA 3WW3A 5HI0A 4O9GA 4XFHA 2P17A 3LA2A 1CGPA 2XKOA 4MGZE 3H1MA 5KHIA 1V70A 1DGWA 1DZRA 2FQPA 4FBFA 2C0ZA 3FX3A 4WBBA 3HT1A 1ZZ7A 4FAGA 4I02A 4LTAA 2UY8A 4QGNA 1J59A 1RUOA 4WVZA 3NKTA 2GC2A 4HVRA 4YNIA 1ZRDA 2QCSB 4IEXA 1JUHA 2F4PA 4MGYE 4XF4A 3IDBB 1ZZ9A 2HJIA 4IEPA 4IEQA 4MH0E 3UKTA 4K8FA 3OTFA 1NE4A 2IXLA 2QVSB 3BPZA 2BNMA 2IXHA 4D7SA 4QGMA 4XETA 1H1IA 4QM8A 2B5HA 1FXZA 1HW5A 3FE5A 4XFFA 2BNOA 1I5ZA 2QJVA 1VP6A 1LB2A 3GBFA 2N7GA 3CO2A 4D7TA 2MNGA 4KU7A 3FHIB 1Y3TA 3MPBA 4NVPA 1OI6A 1YFWA 3NVCA 4ZU5A 4XFAA 3I59A 3KSCA 1QXRA 1XE8A 1YFUA 2Q1ZB 2K9ZA 3HQXA 4PIZA 4UBGA 3UKNA 4MX3A 3MDPA 5E16A 5I0UA 3RDIA 4MGIE 1X7NA 2D40A 3FFQA 1X8MA 3TNPB 4YRDA 3NJZA 2PA7A 3ACLA 3KCCA 3SXWA 3LWCA 2PYTA 4AXOA 2ZCWA 1L3JA 4IETA 2GAUA 4AVAA 1Q5OA 3CEWA 4YSFA 3PLQA 2XLGA 5I0SA 2OZJA 5CADA 2IXCA 1RGSA 4HZFA 1ZRRA 3DN7A 4JVAA 2CGPA 5KHHA 1UIJA 1FI2A 1XRUA 3CLPA 1RL3A 4IEWA 3KMHA 4QM9A 4IEVA 4MZUA 4HN0A 5K8SA 3H7JA 4JTOA 1ZZCA 3ROUA 1O3RA 3M70A 2GH2A 3H8UA 3QOPA 3FWEA 1EYBA 5J3UA 4HVQA 3RYKA 1UPIA 1GQGA 1NZCA 4H7LA 4LUMA 4WZCA 1UIKA 3H3UA 4IEUA 1RTVA 1O7FA 1XE7A 4EWDA 1YHFA 3KGLA 5EFUA 1YWKA 4JTNA 4HVOA 4AVCA 4HN1A 2VECA 4Q29A 4FAHA 3U10A 2DCTA 3E6CC 2OYZA 2ET1A 4EROA 2ET7A 3ES1A 4AQ2A 5I0RA 5EZWA 2VPVA 1ZZBA 5BXXA 5I93A 3BB6A 2Q0AA 4HSLA 1OD5A 3IBMA 2XKPA 1J3QA 3ZDSA 5D1IA 2E9QA 2PTMA 3PVBB 4IESA 5CU1A 4RD7A 5AVPA 1J3PA 4EV0A 4TLFA 4X6QB 4F7ZA 1EY2A 1CAXA 4Z82A 3N4MA 4ONUA 1UCXA 3MZHA 4N9HA 4HLTA 4LLOA 2PAKA 1ZNPA 4HBNA 4HMZA 1J58A 4JV4A 5FPXA 2ETEA 5F1RA 4KWJA 4XF3A 4AQ6A 1NYWA 3RYRA 2UY9A 4XF9A 3FZ3A 1CAWB 5KHJA 3LA3A 1YFXA 1QWRA 4AVBA 1NE6A 1SFNA 3C3VA 4E2SA 2Q4SA 3PNAA 1O3TA 2H6CA 1VR3A 3H3ZA 5BV6A 5J48A 1WLTA 5FLJA 1Q43A 4Q0QA 1VJ2A 2I45A 4ZU4A 3OD0A 1YLLA 1CAUA 3U0ZA 3HIFA 2BEOA 3SCFA 4BHPA 5E1RA 4OLLA 2GZWA 3CJXA 3S0MA 4J1WA 4IEZA 2Q30A 2IXIA 3UKVA 2BGCA 4QX5A 4BH9A 3EO6A 3EBRA 3WW1A 3NSTA 4XFGA 5I8YA 2PHLA 3DL3A 5J7MA 3OF1A 3NW4A 4XFCA 4F8AA 1OFNA 3I54A 2FMYA 1GQHA 4OFGA 2CAUA 3D0JA 5LRRA 4LA2A 4LEJA 1PMIA 4EWEA 4KWLA 4YYOA 2PQQA 2XL7A 1X8EA 1J3RA 1U12A 2MPFA 5KHGA 5I0TA 2OZ6A 2XLAA 3E5UA 5BPXA 3RZZA 1Y9QA 3I59B 5FCCA 3ST7A 1ZREA 1PM7A 1CAVA 4R52A 1WA4A 5FQ0A 4X6RB 3IWZA 3ELNA 2CV6A 2O1QA 2B9UA 3H9AA 2H0VA 2XHKA 1RUNA 3H7YA 2PAMA 4Q0SA 2UYAA 3VHRA 3BALA 1YUDA 5KBFA 1ZX5A 1EPZA 3H1WA 3IDCB 4QMAA 3EJKA 2H6BA 4L11A 4O9EA 3SHRA 3L2HA 2D5FA 4PIYA 4MGKE 3O14A 2CAVA 5FPZA 3KGZA 2ZKLA 4PIXA 1O3QA 3E6DA 1IPKA 4EWAA 2XLFA 3RYPA 2OPKA 4Z07A 1ZZ8A 3HT2A 1DGRA 2ATFA 4L2NA 3SCHA 3CL1A 3USSA 4I01A 3BU7A 5I91A 2EAAA 1LKNA 2HKXA 3EQEA 5KHKA 5CVRA 3M3IA 3TNQA 3G7DA 3DKWA 5LRSA 1WGPA 5JR7B 3E6BA 1LR5A 4Q0PA 2GU9A 3B02A 1J1LA 3S7IA 2MHFA 2BNNA 1UW8A 2EA7A 3JZVA 4KU8A 3S7EA 4I09A 1EP0A 4LUKA 1CAWA 2V09A 3D0SA 4P9GA 2XGXA 3LOIA 1LRHA 2Z2SB 5JAXA 1ZVFA 3SCGA 1SEFA 1ZRCA 5C8WA 1SQ4A 4KL1A 1UD1A 5C6CA 3D82A 4B29A 3E5XA 4Q0UA 3SMHA 4BIFA 2B8MA 2GC3A 3OGJA 4GULA 3ES4A 1NXMA 4KWKA 4Q0VA 1TQ5A 4XF1A 4BYYA 4LA3A 3ETQA 2D93A 2GC1A 1YFYA 5LEJA 5FLHA 4ZU7A 1CAXB 3WW4A 4FT8A 2WC2A 2GC0A 3LZZA 2IXKA 4J1XA 5JSPA 4I0BA 1X82A 2WFPA 2EVXA 1QY4A 3NL1A 2IXJA 2O8QA 5JSRA 4A2UA 1OMIA 3R6SA 4UBHA 1O5LA 4XEZA 5I8SA 2QDRA 1QXJA 5FDBA 4E2GA 4LULA 5BUVA 1CX4A 2PAEA 1O4TA 1H1MA 2Y0OA 3U11A 3E5QA 2UYBA 1O5UA 1Q3EA 4N9IA 1IPJA 4DINB 4R8HA 1CAUB 2PFWA 5I8TA 5JSOA 1ZRFA 1DZTA 2Z69A 2VQAA 4E2QA 4CYDA 2XL9A 4IEYA 4HSJA 4I2OA 3IIAA 3LA7A 3H50A 5BY5A 4XFBA 2D5HA 4MUVA 3EHKA 5LEKA 2OA2A 4QGLA
chains in the Genus database with same CATH superfamily
3E97A 2ORXA 1PMJX 2G9ZA 4HK9A 1U0AA 1BBT1 2JG8C 2CWSA 4I0AA 3FJSA 4MV2A 4IV3A 2V5YA 4AHZA 5FY5A 2EIGA 2XBO2 2RJKA 3VBOB 4EN7B 2BYVE 3K2OA 3OD4A 4AI8A 1CAVB 2G19A 1WCUA 5ABJA 1CWPA 1AR93 1QJX1 3LDKA 5KXBA 4S2DA 2AEYA 1LHWA 1VBB2 3ZN6A 4META 4QT6A 2UURA 4CCOA 3AFGA 4U2AA 3J7MA 4K9SA 4CCJA 5CBLA 2KXLA 2K0GA 2VGDA 3AMNA 1T6GC 2D43A 5IW0A 1G6NA 1H8TB 1QOOA 1F2NA 4LBNA 3LAGA 5HXVA 1QJU2 1POV3 5HI0A 1AR81 3PUQA 4YVSC 5D8AA 3U1XA 4MXVA 1CGPA 2VTFA 4H55A 3ME2A 2FDIA 4NIAA 1FNYA 1GP5A 3AZZA 5GZDA 4KNCA 2A5ZA 4ARXA 3T0AA 3J9SA 2J1EA 1DZRA 1XYOA 2DWRA 5A7OA 2RM23 1A8MA 4JHTA 4NIHA 2AC1A 1QDCA 4OULA 4XMIA 1MS5A 1Z78A 4Y1UA 2DCJA 1ZZ7A 1SCRA 4XBNA 5JZGA 3AP7A 1BLZA 1V9U3 3BOPA 5IATA 1W04A 4LTAA 4NN0A 4BQYA 4A41A 4YG6A 1RUF2 1PGSA 4WVZA 1IKQA 1ZM1A 1LODA 5FP7A 3FL7A 1RUG3 4RS5B 3ZR6A 3WD5A 3QD6A 1FMD2 4QQPA 4QQHA 1BK0A 4RFRB 3URFA 4W6XA 2ZGKA 1UXXX 3AC0A 2PN5A 2ZS6B 4EZHA 2R1DA 2JWPA 4FTSA 1KFXL 4IEQA 2WNOA 2C4XA 2YPDA 4K8FA 3ZIXA 3K51A 1ZBE2 4BMBA 2DURA 5IK5A 5FMOS 3AL6A 2E7QA 4QGMA 5FMBA 5FZ8A 2WA4A 4QM8A 5C70A 2R7EB 3RZKA 1RUC3 3WNLA 4PBOA 4UYBA 2UWAA 2VD7A 1UL9A 2HLEA 4OI4A 3UJQA 1ZBA1 2BNOA 3QLQA 1LGNA 3ECQA 3HWJA 1W6QA 1W6OB 1QJY2 4UI9L 5A7WA 2UWBA 1RUD3 4HPKA 5F3GA 2TEPA 3MICA 3A22A 1RHI1 3CO2A 1W2UA 2XONA 2CTVA 4G4FA 4Y4YA 1JYTA 2VAUA 5GLWA 1DYOA 3T0DA 2Q8CA 5ANQA 1J84A 3AYAA 5CB7A 4CDXB 2YY1A 4ZU5A 2O14A 2PLV1 3KSCA 2JDNA 3SQOA 4CTEA 4YZ2A 4OVEA 4CRQA 5A3LA 1MVQA 1ENRA 4NMIA 1SMVA 2RMU2 1QNYA 3WG1A 4EYUA 4XQWA 2V4AA 3VBRA 3JUUA 2JDYA 4KMQA 5FMDA 2HYKA 3MDPA 1VB2A 5F7UA 4DUVA 1XOYA 2D40A 4NE9A 4GA9A 5EHDA 4XUOA 3JD73 4DNYA 4OI2A 1QJZA 1SCSA 4YM1A 4JGYA 5ACA2 2PA7A 2WINB 1XNBA 4NIIA 4D7YA 4E8DA 1D4M1 1PZ7A 2JG8A 3A0KA 3P3NA 4MLOA 3AZXA 2RS33 1NCRB 1CESA 1HRV2 4RGGA 3WCSA 4IETA 4XUNA 3J7HA 4AVAA 5C7GA 2FZ2A 3CEWA 4BISA 2E6VA 1LHOA 3QCWA 5DZEA 1D0HA 5DDJ3 5GLUA 4DS0A 1CQ9A 1OVSA 3PURA 2JIJA 4L0PA 5DG1A 3TN93 2ARCA 2OZJA 3AYDA 2BOJA 5CKNA 3VBUA 1W8OA 4IE4A 1ZRRA 2Y6LA 2L9LA 3I3EA 3OGSA 3ZXAC 1RUJ1 1AR72 3TEYA 3ACFA 1TEIA 1OA2A 4IGOA 1HQLA 5KHHA 1JZ7A 1V6OA 3HR9A 4QKNA 4YVSA 3ZFFC 2OUHA 1RL3A 3ZYPA 4NHMA 4YZ1A 2WSVA 2W91A 1W2NA 4QM9A 5JMCA 4MZUA 4QD2A 5FYUA 1O6UA 2LS6A 4ISQA 1VB4A 4CXYA 1ULCA 3ROUA 4R9CA 3ZKUA 1REDA 1MEC3 2ERFA 3HNMA 4PLNA 1CN1A 2GH2A 3H8UA 2WT1A 3WF4A 5JDBA 1PO12 2O8OA 1NXD1 1NZCA 4H7LA 4LUMA 4QU2A 1LEDA 4WZCA 5A3OA 2XPJA 1IZ3A 2Q1MA 3AP9A 1DF0A 3H3UA 4NHLA 5FZOA 1XE7A 4W6WA 4LE4A 4OHYA 4FVVA 4FTEA 1Z7S1 3C8XA 3MIFA 2RS51 1FOD3 4HVOA 5C3QA 3TEWA 2WAAA 4JKLA 1AYM1 1RUE3 1ZYBA 3PMSA 4MOAA 4BM8A 5JXJA 3U10A 2GN7A 2PXJA 3W20A 2CWMA 3KT4A 4IV3B 1XSQA 4UW5A 1YEWA 5FO8B 1ASJ3 5ABJB 4AQ2A 5I0RA 2VPVA 2Q0AA 2QFEA 3VHOA 3ZN6B 4AFMA 2Y26A 1V6IA 2J1UA 4N7IA 3PVBB 3HQRA 4IESA 3HVDA 5AVPA 3RS6A 3K75B 4CU9A 1PVC2 2Y6GA 5LBBA 1H4HA 4NHXA 4Y1VA 1ULGA 3FMGA 1EY2A 1CAXA 2YB7A 2IFRA 4LK7A 2WS92 4Z82A 4ONUA 5D8AB 2VCCA 1GNZA 1GV9A 2ZGSA 4N9HA 3MGUA 4QPIA 2ZGNA 1I5PA 2YMZA 3HAGA 1UPSA 4FPLA 2A1XA 2YV8A 1F15A 1ZNPA 3MHZA 5JPNB 2NMNA 3SC7X 1EV13 1H0BA 3B69A 3DCQA 2B39A 5LCWL 4COZA 5BNNC 1RINA 3BODA 2KR2A 4XURA 1NYWA 3RYRA 2ZGRA 2ZGLA 4BK4A 5JZGB 2F6BA 1AYN2 2BVBA 1AX0A 5KHJA 2RVAA 5FOJB 3LA3A 5E8AA 5K9YA 3T09A 5FP9A 3C3VA 5IFTA 1WCQA 2H6CA 2XJQA 4GJZA 4Q0QA 1QU0A 3IMMA 1K5MB 3WP5A 1WKYA 1OBNA 2EXKA 5F32A 5JMOA 1YIFA 5F5AA 5FKBA 4DY5A 5E6HA 5DG2A 4BHPA 5E1RA 1COV2 1TZOA 1CX1A 4TN7A 1K42A 1MQTC 4OLLA 4C0HA 3BN6A 1VAKA 3S0MA 3BTZA 2HWB2 2IXIA 4Q27A 5FZ1A 4YW3A 3EO6A 3PMEA 1S0GA 1KEXA 4YWAA 1WD4A 1FV2A 3N7MA 3I4IA 3C2UA 1SFYA 2DBIA 1OFNA 3ZFFA 3I54A 1W6QB 3KV5A 1GQHA 1V6KA 4OFGA 1OH3A 1W8UA 4Q4W3 5LRRA 5A7WB 4A6SA 3LFMA 4HPKB 4EWEA 3I3QA 3AVRA 2PMWB 3DF0A 1AL22 4YYOA 2PQQA 2VQTA 2XL7A 3LEKA 4COYA 1HRI1 3LDBA 1URXA 1X8EA 4XTPA 4PLOA 1OT5A 1XNCA 2ID4A 3POGA 4JAAA 3WNMA 3BUCA 5KHGA 5I0TA 3SLIA 3N36A 4AEJA 3G6JB 5DUVA 2VQUA 2CY6A 5BYNA 1QEXA 4AAXA 4XUPA 1ZREA 4QX1A 2HBTA 3T3YA 5FY4A 3VBRB 1KXGA 4BA6A 4QX7A 2P3JA 3SISA 4M3CE 3MO4A 3IWZA 3ZM8A 1VBE3 3TYJA 4AEKA 1UY4A 2YYOA 2ZGMA 1IG0A 2XVGA 2B9UA 2QQLA 2WLQA 2XMLA 2ZX2A 3H9AA 2R062 5BNPC 1W8TA 2R073 4AG4A 4JGYB 3ZFEC 1RUNA 2IZWA 1W8NA 3FLRA 4YGCA 3VHRA 3BALA 5KBFA 4Q4V2 2YC4A 1ZX5A 4N7UA 1QF3A 2ZABA 4GALA 3IDCB 3IPVB 4V2WA 5DAXA 1G9DA 1LOBA 4L99A 4LXLA 2RR12 5F3IA 3T4VA 4L11A 1YIPA 2BERA 4AGVA 4ES9A 2JDHA 1TMF1 1NLQA 2VR4A 4CP1A 5K0UC 3NNFA 4WVVA 4DEVA 1PGL2 2AENA 1I1EA 3BU0A 3WQ7A 3VBUB 4E4HA 3AFKA 1QQP1 2VZPA 2OPKA 3Q8AA 1HB2A 2OIIA 5LA9A 4Z07A 1E5SA 4YVSB 5FRAA 5H9QA 3OYWA 1CVNA 1WA6X 4IE5A 5A6YA 4L2NA 3CL1A 4RN5A 5JOXA 2W39A 4E8CA 5I91A 4M0HA 2WBKA 5F5IA 3O1MA 5IFPA 1OOPC 5DAQA 3MUZ1 4CEYC 3CQOA 2XBO3 1FX5A 3M3IA 5FXVA 1S2EA 3I2HA 3G7DA 2RE9A 3W5MA 5BNNA 1VBB3 4K20A 3M4FA 5CA6A 1LHUA 4IDZA 1NG0A 2BP6A 1FNZA 2DTWA 1LHVA 1UN1A 3E6BA 4Y1XA 1EPWA 1C8M3 4F83A 3WXPA 5GALA 4TXWA 5H9PA 4XJAA 5FZ0A 5FZOB 1J1LA 4HL0A 2MHFA 4ZY9A 1BXHA 1QJU3 1DDLA 1CPMA 3IN9A 1CAWA 5KXCA 2V09A 5FBJA 3ACHA 2BBAA 2FHRA 4INDA 4AWDA 1AVBA 4FP2A 2HEYF 2Z2SB 3TBDA 5JAXA 4QHOA 2HWC2 1AR91 4LKEA 1W3XA 3MIGA 3TWIA 2BFUS 1MQTA 2OQ7A 5IUQA 5A1FA 1SQ4A 5JXGA 1UD1A 4LO5B 4Q26A 3D82A 4QHBA 1U5IA 3E5XA 4XXPA 3RMXA 4BIFA 4I30A 2B8MA 4M01A 1UMIA 5JI9A 4Q4Y2 1DBNA 4YM2A 1RUF3 4XF1A 2XQRA 3ZPOA 4BYYA 4PI2A 4DO0A 1POV1 5FYCA 1RUH2 3SH3A 2FBEA 1VE0A 5JIAA 5H9RA 4A6OA 5LEJA 5FLHA 4XDOA 1CAXB 3WHTA 1ZA4A 4TSVA 4FOYA 4QPIB 2VZOA 4EN8B 3CZJA 1H6XA 2GC0A 2RM21 3DPRC 3EXUA 3N3HA 4OZOA 4QB6A 4COWA 4E27A 5DMYA 5FO7B 5FUNA 1UY2A 1E57A 2BFUL 3IT8A 2HWD2 5A32A 1V9U1 3JQXA 4CA9A 1L7RA 1BVVA 5FZFA 3S6PA 1US2A 3O5SA 1XNDA 3MLLA 4XACA 2HEWF 3OEAA 1S0IA 1O5LA 5J96B 1WLDA 4NPMA 1R093 5I8SA 3RZMA 2Q8DA 4GH4A 4BU2A 5EJ3A 2JJ6A 4IGQA 4Q5OA 1J83A 1H2NA 1IS5A 2NP0A 2PAEA 1C5HA 1VRH2 2Q8EA 4QWNA 2WL1A 1ONAA 2WSUA 3LIHA 3P3PA 2OX0A 3ILRA 3LSDA 4GAZA 4AFCA 2JG9C 2GH8A 3KLSA 4Y1YA 4P9LA 4LO8A 5IVEA 4R8HA 1JYXA 2ZAHA 3A7QA 3I2FA 2WLPA 3HBZA 5C3SA 2QQOA 2O0OA 2ZGQA 2VE1A 5K0UA 5HXMA 2XJVA 5FY1A 3OGRA 4WZFA 3S57A 1LOFC 3AK0A 4Q8LA 3I2IA 1YQ2A 4BLJA 1PO22 4YFWA 1SDWA 5AC93 1Y7BA 2WAOA 4CUAA 2JXAA 4PCRA 3H8RA 3ZFFB 3VBFC 3B01A 3LA7A 4N53C 5ACA3 2PHWA 3BIEA 2QTWB 3OOXA 4MUVA 3EHKA 4YGEA 5LEKA 1CR7A 3T4HB 2WIIB 3GDBA 1OOPA 4CEYA 2VM9A 4CU7A 3NMBA 4B7EA 2DVBA 2WO3A 2K46A 5IVBA 3DKQA 1BVP1 3RPQA 4P9YA 1W2AX 4RHV2 5EQUA 3H1YA 4I3PA 5C3OA 4Q4X2 5CG8A 3HJRA 4PJYA 5JCTA 1WMDA 1FT9A 3ZSEA 1DQ6A 2NZ9A 3ZXFA 2YFZA 1LOAA 4YG0A 3JD71 3BCWA 4QX3A 3SH5A 1CJDA 4IE6A 4YARA 1AR73 2QNKA 3WW2A 1O3SA 2VOWA 3P5BA 4XFIA 2ZA9A 5T3NA 4B4PA 1YQ5A 3UGHA 4J25A 4CCKA 4UXAA 2RS31 4Q1RA 1SDDB 1W0OA 4TWTA 1V00A 3JB4C 3KVAA 4XJ8A 2P37A 3KQ4B 1JYNA 3JBG2 4QXKA 1UNBA 3A0NA 5FLIA 4AOCA 5FZ4A 3OGGA 3VD3A 5C8CB 3FBYA 1WW6A 4XFHA 4NIGA 2P17A 5FZDA 4L92A 5DDJ1 4C8DA 1X36A 2E7AA 2PHXA 3TN91 4LO7A 5IK4A 1MS0A 2R042 2CDPA 1MZ5A 2ZEZA 4MGZE 3H1MA 4LIUA 4BB3A 1PO13 5KHIA 1NQDA 1DYKA 4XC9A 3O1UA 4X8PA 2FQPA 2GSYA 1BEV1 2VULA 3MIDA 2VL4A 4JRAA 4UFIA 1RJ8A 1TNRA 2VG9A 4HANA 1SLIA 4UT5A 4I02A 4XHXA 5DUUA 3WF3A 1AUYA 1UU5A 4RQPC 2PHFA 1LTEA 4JCKA 3NKTA 4ZXEA 5FP8A 3OYWB 3WNXA 3WF1A 5LY1A 1LENA 2W68A 1JMUB 1NCQC 1SLLA 3I49A 4XMAA 1ZRDA 2QCSB 4CPBD 3DPRA 4DPNA 3VD4A 1LOGA 3KT7A 2VZ1A 4XF4A 1PNGA 4DQAA 1BYHA 2ORZA 2ZGOA 2HJIA 2QKDA 3AXEA 4K1ZA 5EWSA 4P9WA 4PLMA 4Q2FA 2IXLA 2VZ3A 3GBGA 3BPZA 3KV4A 3VDDC 3PTYA 1ULDA 4XETA 4UWDA 4CDQC 2ZZQA 1YXWA 2B5HA 1PVC3 1FOD1 3OUJA 3FE5A 4MGTA 1RVF3 3GJBA 3J4UH 1RUE1 3WVJA 4CZSA 4EJRA 4LBQA 4AI0A 3F95A 3O1SA 2QJVA 2WS93 2ZX0A 2JG9A 4LMFA 1MVEA 5FPBA 1LB2A 1BBT2 2GMEA 4RYDA 2N7GA 2FCTA 2VY0A 3C7HA 2RHPA 1OXCA 2FD8A 4LHLA 3FHIB 1Y3TA 4DRRA 3R4UA 1HJFA 1MZEA 5J36A 3QH7A 5FJHA 1MQTB 2DTYA 4YFZA 2RDRA 4M4PA 5GZCA 4FPOB 1W6PB 1XE8A 2JDAA 1V6LA 5CZKA 1YFUA 3TEZA 1LOFA 1SBFA 1GWLA 1UAIA 2K9ZA 2NLRA 4P9XA 4YGBA 4UBGA 4PIZA 2VMHA 3RWNA 3UKNA 4MX3A 4CCCA 2JIGA 3VBFA 4CUCA 4N53A 4UW3A 2GDFA 4MGIE 2D3SA 2QBXA 1PM4A 2A71A 3OBRA 3N9OA 3VZMA 1EUUA 3FUQA 3KV6A 4LOTA 4AFAA 4YRDA 1GZWA 2A6XA 4P02B 4K21A 5C9AC 3SXWA 1EV11 3FUOA 5SV5A 2SBAA 2WNEA 3OG2A 1COV3 1XU2A 4JC1A 4QQOA 1HIXA 2GAUA 5FZ6A 5A32B 3CDZB 1UZZA 1H9PA 1O8PA 1OLME 1HN1A 2HWB3 2EIDA 3NAPC 4BXSV 4XBLA 3S5AA 2Z79A 4EQVA 2WO7A 2WNVC 2XLGA 1AZDA 5F2SA 1OUXA 5HCFA 3WG4A 3ZDVA 1A3KA 3OJBA 4FP3A 2YBSA 4GH4B 4N43C 3KHBA 1G86A 3NV2A 2KD7A 3IDAA 3V56A 2VCAA 5LATA 2R49A 4QDQA 5EJZB 4DXTA 5K7PA 3U75A 1XRUA 1HKDA 2PHRA 3T2QA 2UWCA 1JN2P 4DIQA 1WCSA 1ZRIA 2J1TA 2RDSA 2R0FA 4V2VA 1UQXA 1ZZCA 3LD8A 4P14A 2A6ZA 4MYEA 3M70A 5IAXA 2JDZA 2DDUA 5T55A 2TUNA 3NJYA 1H30A 4ARYA 4FSJA 1S0DA 2MEV2 3QOPA 2EIBA 2QQIA 2VVDA 2WYFA 2CHHA 1EYBA 4GD4A 3PTRB 4IE7A 4HVQA 4Q4W1 1UPIA 1GQGA 2Y34A 5J3UA 2DCZA 2VNRA 3MF6A 4NHYA 4RQPA 4QKDA 2R063 4UFMA 1RHI2 1YHFA 3RRDA 3KGLA 4ZPIA 1YWKA 2DCKA 1A8DA 3NV1A 5FP3A 5FYZA 3B94A 3T2TA 4JTNA 5JPMB 1OOPB 4XIOA 1HXS2 2AH2A 4AVCA 3L9JT 1HV0A 2PLV2 3U07A 2RR13 4FPHA 3ZPYA 2WZR3 1U5ZA 2VC9A 5C3RA 3ZLIA 2YU1A 5FYVA 3JB8A 1CZSA 4A7YA 3EYPA 1E5IA 2I74A 4XDPA 2WUHA 1VBE1 2ET7A 3VBSC 3VDDA 2J22A 5LB6A 3ES1A 4CDQA 2Y8KA 3N7KA 1W9YA 3RJ2X 1ALYA 4FPEA 1H2MA 5F6KA 1NA1C 2R071 2W0XA 3JU9A 1LGCA 2J7MA 1QXPA 3IBMA 2FDJA 4NPRA 5ERLA 2X5IC 2PTMA 2WFF3 2D97A 1AR61 2AEZA 4RD7A 5FXXA 1BZWA 3WV6A 3LPFA 1GKBA 2PHTA 4TLFA 3KVBA 2CNAA 4X6QB 4Y33A 4F7ZA 1V6MA 5IVVA 2FMDA 1UCXA 2I2SA 3MUY1 2WWUA 5JI7A 3WT3A 4FOWA 1WD3A 3MZHA 4URTA 3VKFC 5JXHA 1BHGA 1NUKA 1STMA 3KZ4C 3LEMA 4FXKB 4HLTA 4LLOA 2PAKA 1UWWA 1OA4A 3KV9A 4HBNA 4HMZA 2XB6C 3J8F3 1AXZA 1J58A 5K4LA 4JV4A 4WM8A 4GXLA 4XHBA 4X8NA 3AL5A 3M1HA 4AI1A 3GHMA 1RUJ2 3LGRA 4M3CA 3AKSA 3WSOA 4BOWA 2WO1A 1N1TA 2UY9A 3NV4A 4XF9A 4H7MA 5IT6A 1W6MA 3VUOA 4W4ZA 5LA1A 1LGBA 2WNUC 1QKQA 2VBBA 1IQAA 1CPNA 5LASA 1Q8QA 3NO8A 5C9AA 3V0BA 1QWRA 3ZSKA 4NAOA 4M0NA 4AVBA 4LO4B 3POJA 2Q4SA 1POQA 4E2SA 5L19A 5A7SA 2DF7A 3H3ZA 1KD7A 3IZOA 3OPZA 1VBB1 1Q43A 2XOMA 1VJ2A 2D3RA 2I45A 4JKKA 3OD0A 1CIYA 1YLLA 2FDFA 3WHUA 1GFF2 4A4AA 5A3WA 3ETPA 1RXFA 4LE3A 4RGKA 1VBC2 5FMOL 4ASKA 1C8M1 1PIV2 1VBD1 1HQWA 3HIFA 3FN9A 4JKMA 4NHKA 3OUHA 2XJPA 4N8MA 4ZZ5A 2WNVA 3ZSMA 3THPA 4B1MA 2GZWA 1UF2C 2J1VA 4AI3A 2Y33A 1QJU1 4IEZA 2Q30A 2Y6HA 2QQWA 1O3QA 4IE0A 3TAYA 1SBEA 1RUH3 2IFWA 4N43A 1C57A 1WBLA 3R0RA 4QX5A 3V0AA 5HV4A 1Z7S2 1N1YA 4XFGA 2YZ4A 2PHLA 3WNOA 4SBVA 4XE9A 5FZGA 1AYM2 2FCVA 4ZKTB 1YO8A 4GB33 2CAUA 1F9KA 1ULEA 1WLWA 2JG9B 3MPPG 1PMIA 4LA2A 4LEJA 2X05A 4AQSA 5HBAA 1IS6A 1RMU3 3PU3A 4P9JA 4A45A 3QH6A 4OZXA 4YM3A 2ZX4A 1UMZA 1PGW2 2HWD3 1H4GA 1TE1B 2OZ6A 3IIIA 5LBCA 2HWE2 1LCLA 3RZZA 1RUF1 4AEDC 4XAAA 3SNMA 4JGZC 3SKJE 1CJPA 3N7JA 4LQRA 5DPNA 2LROA 1PM7A 4BCUA 2P1BA 2XWBB 4AAPA 4S2HA 4R52A 4LO6B 1KS4A 4KBBA 4FTBA 1WA4A 4YW7A 3ITQA 3VBFB 1JYWA 3OY8A 1UYXA 2XWJB 4NJ4A 2LRPA 2CV6A 4L8QA 4QHZA 4XCBA 2O1QA 4KG8A 4OMDA 2PQSA 2H0VA 4A3XA 2YPJA 1GZWB 1JU3A 3H7YA 1GP6A 1K45A 1MZFA 3HEIA 2XDVA 1R1A1 4Y5Z0 1QDOA 2UYAA 5FTTC 2Y60A 1JZ6A 3DXUA 2BBVA 1DU3D 3PHMA 3H1WA 3VKOA 3LIGA 2VNVA 4QMAA 3WLUA 5JOWA 1R091 4LBLA 1K12A 4XJ9A 1JBCA 1FATA 2JE8A 2KM2A 1XNTA 2V72A 2Y38A 3H0OA 4LBOA 3SHRA 4EZ4A 1NA1A 4LLFA 1PO23 1JZ3A 3WF2A 2CAVA 4PIXA 2P6CA 2QQKA 2X53S 2X5IA 4YLZA 4CCEA 1IPKA 3WP3A 4HT1T 3RG0A 4FFGA 1OLRA 3DGTA 3UNPA 4QPYA 3AYEA 4JQTA 2XJSA 1AX2A 2BUKA 1M06G 2AREA 2VMFA 5GLTA 4XJZA 1VAVA 5FZBA 4URAA 2W47A 1UOFA 1UXZA 4JDOA 2BWAA 3I3MA 1DGRA 1WMXA 1LU1A 1Y43B 2P3YA 4RR3C 5F5QA 5HPOA 3I2KA 3USSA 3BU7A 3P6BA 4OHVA 3HMYA 4HKWA 2AR6A 4LITA 4RHV3 1LKNA 3DYPA 5HV0A 3WDWA 4Q4X3 5AVAA 3WCRA 1JHNA 5CVRA 3TNQA 5A1LA 4CEWC 5CYYA 3ABZA 1XBFA 2JKXA 2WZEA 1TNFA 3ATGA 5AC91 3DKWA 4KBZA 1WGPA 5JR7B 3HPNA 2XUMA 3GXUA 4K40A 4WVMA 4XQ4A 4YZ4A 2EXJA 2F4LA 2WNUA 3C7GA 4RQPB 5IK7A 3N9LA 4AL9A 2XJRA 4DB5A 3S7IA 1HRI2 1UW8A 2CGOA 2YUEA 1WCDJ 3JBG3 3JZVA 4E4DX 1D2SA 4YZ5A 1VAMA 1F5JA 2LUWA 2ILMA 2SLIA 5L73A 1OF4A 3D0SA 2WWSA 1W2OA 1NT0A 1D7PM 3I2DA 1LRHA 2D6OX 4OCTA 4D8MA 4AZZA 3U4XA 3BI3A 4E4SA 3LKJA 1S0CA 1SEFA 1UOJA 3M3OA 1BMV2 4KI5M 2ZGTA 3NJVA 3PJYA 2WR9A 3VDDB 3THDA 4DY3A 2VW1A 1MACA 5FBZA 4CVUA 5C6CA 4Y3OA 2G9FA 2QQMA 4CDQB 4Z8BA 4OQ8A 1G9AA 1YQCA 1LU2A 2GC3A 3A23A 1G8WA 4DUXA 4BMEA 5IVYA 1GOGA 3ES4A 4DXZA 3MW2A 2C26A 4Q0VA 1IQDC 3I2GA 5FY9A 3UYJA 4B3NA 2LM3A 3NNMA 5T50A 4OQ9A 4DOUA 1EAH2 3ETQA 2B42B 2D93A 2P6HA 5B4NA 5FZLA 1YFYA 4XAEA 4CP9A 3THTA 1IOAA 5LA2A 3B5LB 3RZGA 4ZU7A 5FK8A 3ZYFA 4FT8A 4ITCA 3I2JA 1C5IA 1PO11 1S1AA 1GNHA 1W8FA 1X9PA 4HETA 3VKLA 1R64A 3CJIC 4AEDA 1L7LA 3LZZA 3QBQA 4J1XA 5JSPA 1TMF2 4JGZA 1FPN3 1LEMA 2RS12 1DLCA 4QB2A 1S0JA 3AJZA 4WM8B 2EVXA 5EIYB 4YVWC 1YCIA 1APNA 4GWIA 4S2GA 3D8CA 3GZAA 2IXJA 1O4YA 1QQP2 2O8QA 3KWVA 3WX5A 5FY0A 1GU3A 1OMIA 4M3CB 4NUBA 4UBHA 4XPVA 5KR7A 1C28A 3KD4A 4XEZA 2WZPP 4OMCA 1W6MB 4B1LA 2QDRA 3USUA 5F37A 1QXJA 3CZUA 5FDBA 3PIGA 4AF9A 1CX4A 5BNOC 3NQHA 5C9AB 1H1MA 4LJHA 3AP6A 2CL2A 4CCDA 2Y0OA 1AF9A 1H2KA 4AQTA 2VXJA 1GYKA 1A78A 2VCBA 4NR1A 3U11A 1XU1A 5C5UA 2UYBA 1WMEA 1VBA2 2QQPA 5A70A 3ZMNA 1PX3A 4N9IA 5JUVA 5FZAA 1CD3G 2C6SA 4XBQA 3MBWA 3VN4A 1PVC1 4LOSA 3R4SA 2WNVB 4LKFA 1RVF1 4LHKA 2HWF1 5FZIA 3EB7A 4CDUC 3BTYA 1ZRFA 1R081 5JXIA 2Z69A 4FPJA 4N43B 2WS91 5GLVA 3UESA 2VZTA 5FPUA 4JX0A 2DBNA 1REEA 3AB0A 2WQ8A 4O65A 1YYNA 3O12A 4I2OA 3X29B 3UK9A 4BQ3A 3MW4A 2ZHKA 2DCYA 2JG8B 5CAZA 3H50A 4CCMA 2W08A 4LBJA 4RR3A 3U4SA 5GZFA 1NLSA 3UV9A 5DQ0A 1LOCA 2Y6KA 3VB9A 2NM1A 4QGLA 5FY8A 4CEWA 1LJ7A 3V65A 3JCIA 3H8XA 1RYYA 1LAJA 2W92A 1RC6A 2YXSA 4L97A 3NNLA 5FXZA 2AZ5A 3UJOA 3QACA 5FYSA 3PUIA 4D3WA 1OKQA 5BNQA 1GSLA 2C24A 1I6XA 2WZ8A 1KS5A 3OGVA 4FPKA 1W8WA 1JW6A 2BGPA 3VHPA 3OY8B 3GYDA 4XVHA 4AI2A 3OCPA 2W46A 4C0BA 4XF0A 3I7DA 2W1QA 3CF6E 2NYYA 5FIXA 2DVAA 2IC1A 3MYXA 3WG2A 2A75A 3DV8A 1COV1 3LEGA 2VBDA 5IVFA 1N1VA 1KDKA 2YDEA 2HWB1 3WW3A 2JDUA 5F2WA 4ET7A 4O9GA 1SPPA 1PNFA 2QE3A 3LA2A 5IAVA 1WWYA 5JOZA 2MEV3 2VUCA 3MIHA 4A3ZA 1W90A 3OPTA 5DAVA 1Q8OA 1WW4A 5DABA 1DGWA 3ZN4A 1NA1B 2BPA2 5A3NA 4I3GA 4D0QA 1NKGA 2C1FA 3FX3A 2X5IB 3WF0A 4WBBA 1PK6C 1UZWA 1UOBA 4FAGA 1W28A 5T52A 1OURA 5KWRA 4BQXA 3T1MA 4BZ4A 3RVHA 1E5RA 2UY8A 4QGNA 1K5JA 1OC1A 3FFZA 1RUOA 3D3AA 3MW3A 1HXS3 1OQ1A 1KDMA 2ZOEB 4GZ9A 4WV8A 1GUIA 1GOHA 1TME2 2E53A 1DLLA 2XQXA 2R0HA 2JENA 3WP6A 1JUHA 3K4DA 2W94A 4TTGA 5LZ6A 1OLMA 1MS8A 3H42B 2Y6JA 4YVWA 3ZVXA 3B00A 4IL7A 4RS5C 1VMJA 3O0WA 3RZJA 4IEPA 4MH0E 4CUBA 3UKTA 2WA3A 2R061 1JYVA 2JE9A 3VHNA 4RFT0 3R05A 1NY71 1NE4A 4BLIA 2XVKA 2QVSB 2BNMA 5M0TA 4WVMB 1FMD3 3W5NA 1H1IA 2WNUB 1ENQA 4GKXA 5EV7A 4DXRA 4AHXA 1W0NA 2VZRA 1S55A 1POV0 1FXZA 1HW5A 4PDWC 5BNOA 4TZDA 4XFFA 2XJTA 2RR11 5L9BA 2A3YA 4J6GA 2WN2A 4ASLA 2WZR1 3CMGA 3WEZA 1NAEA 2AYHA 3D4KA 3FHAA 1VP6A 1DYPA 1KJLA 1JOJA 3IAQA 1YI9A 3PL0A 2Y6FA 2D6KA 3GBFA 2ZPXA 1ZBE3 5TSWA 2JECA 1MS1A 3VDBA 4KU7A 4AYUA 3J7LA 5GLZA 2H0BA 4AHYA 1IGOA 3I2OA 1OI6A 2R1BA 5FYYA 1YFWA 2YGMA 1DCSA 1RUG1 3JD72 3NVCA 2Z5WA 3I59A 3NJXA 1QXRA 1VPHA 4CDUA 2WFF1 3N7LA 2Q1ZB 3WDXA 1QJY3 1V0AA 1W2TA 4GIQA 4XUQA 5A3TA 5BNPA 3APBA 3HQXA 3ZFEA 2E26A 2VZVA 5FZMA 4CDXC 2QUOA 2VMDA 4MXWA 5E16A 1UKRA 1IPSA 3DYOA 2JD9A 2VMIA 3FFQA 4D6SA 3N9PA 1K3IA 1X8MA 3LEIA 2EALA 3JXSA 4CU8A 3TNPB 1UY1A 1XQNA 3ZN5A 5DDJ2 3J8F1 3KCCA 3TN92 4C1XA 1RUC1 2BWCA 4YM0A 2RMU3 5G04L 1VBC3 3AYCA 4Y5TA 2PYTA 4YW5A 1ZA7A 1PIV3 2BGOA 4AEDB 3ZYRA 4JGZB 5FYMA 3RZLA 4YW4A 2P5BA 1SLAA 4Q8KA 1BEV2 2OKXA 4BQ1A 1BK1A 2GP3A 2D7FA 4P9IA 3PIJA 1RUD1 2W1SA 4HKLA 2G1MA 4YSFA 1YQ8A 3BYWA 3KHCA 1L7QA 3ZYIB 3KT1A 1F31A 1HJGA 4FPGA 2IXCA 2E7TA 1UX6A 3USUB 4IV1C 4M3CF 3MV11 3DN7A 1WZXA 3SH4A 2BQPA 3WDYA 2CGPA 3AKPA 1HRV3 3H3LA 1FI2A 3ZXEA 5DUWA 4JZRA 3CLPA 1LOEA 2HWE3 2VBPA 4IEVA 2WT0A 5FKCA 1SZBA 2IVJA 4HN0A 4ATEA 3H7JA 1GZCA 3GM8A 5F9TA 5C71A 4Y5SA 1RUH1 3WNKA 4R9BA 2CSGA 4OHWA 4FI9A 3AKTA 2VVFA 3TEXA 4XQDA 3ZR5A 1FOD2 3GBWA 4PQQA 1PK6A 4GB31 2ZMNA 3Q8CA 2CU5A 2B7YA 1NOVA 2NN8A 2CDOA 4P5HA 4UFKA 3LB9A 1RUI2 3Q8BA 1RMU1 4IEUA 1RTVA 1O7FA 4QX2A 2V73A 4EWDA 4PHZA 2VUJA 4RR3B 1REFA 5EFUA 4COVA 3GJAA 2OW4A 5A33A 3VBHC 2HBUA 1OSGA 3N9NA 3O1TA 2J42A 4Q29A 3KS7A 1H9WA 1W9SA 3K46A 3O0VA 4FAHA 3I3BA 4RS5A 2DCTA 1Q56A 1ACCA 5FXWA 2ET1A 3F2ZA 3AKQA 4MGSA 2E63A 2I07B 4EROA 5GM0A 4K1YA 3ZOIA 4Z92B 4H2AA 4JQRA 4OYUA 1ZZBA 3U37A 3C7OA 4QPWA 5I93A 1HB1A 4PDWA 3AVSA 3W21A 1OD5A 3KF3A 2DUPA 1H1AA 2GMPA 1MEC1 1SHWB 3V64A 4Y4RA 1C1FA 1US3A 1XPWA 2OVUA 2A3WA 4GWNA 5CU1A 1ULPA 3GHNA 3VKMA 1S0EA 1HV1A 4DRVA 2YBKA 3ALQA 3IAPA 2XR4A 3M3EA 1QOTA 5FPAA 2C9KA 2DVDA 4MGQA 1GMMA 4CCNA 1SPPB 1DQ2A 2DFBA 1OPOA 2ZMLA 3C7FA 1G7YA 2LTNA 3HBKA 2W1UA 5BNNB 1YC61 1QJEA 1DFQA 1PO21 3BVCA 3JQWA 2V5DA 2XH6A 3A21A 1CIWA 1MS9A 4FOQA 5EPAA 1W39A 1ST8A 5F1RA 5T5OA 4WVWA 3BPSA 4OI0A 2ZKNA 4XF3A 2GNMA 5CG9A 4AQ6A 2W95A 2P3KA 5L9RA 3BTXA 1DG6A 1CAWB 3SKVA 4LBMA 1UZVA 2DUQA 3O0XA 4RHV1 1ASJ1 1ND3C 2R6QA 4Q4X1 5AFBA 1NE6A 5A7QA 1SFNA 3AMQA 1I9RA 1LULA 3PUSA 4EN9B 1QJX2 3PNAA 3WQ1A 1O3TA 5IHRA 1VR3A 2VNOA 4NOTA 5BV6A 5J48A 1GWMA 1SLTA 1UZ0A 4CP2A 3VD9A 1UMHA 5ANNA 3UGFA 1AYN3 3WQBA 5CFCC 5E89A 4YVWB 3S5QA 3IMNA 4Q4W2 4UF0A 3SCFA 4ZS2A 3ZXGA 4HOOA 1VMFA 1C1LA 1OFSA 2VUDA 3CJXA 3JBG1 1CZTA 4YPJA 2VUAA 4J1WA 1AR82 1OQDA 2B46X 2RDQA 1K5MC 1QHDA 2YROA 3LSEA 3M8LA 3MV01 4IV1A 1V6NA 1EAH3 3UKVA 4BH9A 3WW1A 3EBRA 5A1AA 1SG3A 1AX1A 2QZ2A 1DIWA 3DL3A 4UW6A 3OF1A 4IXLA 4P5YA 4F8AA 2X29A 3I3DA 3FLTA 5D2AA 4KG0A 1G9BA 1UY3A 1UYYA 1N47A 3M2MA 5JWPA 4CDWC 2VMCA 3PVOA 1GZTA 4KWLA 4EE2A 3ON7A 1DGLA 1J3RA 2D6PA 2RS13 1VBE2 1U12A 2MPFA 2XLAA 5BPXA 2R30A 3M7AA 1G9FA 3ZYJB 1QQP3 3J26N 1Y9QA 5C3PA 3I59B 4CDUB 5FUIA 4A7ZA 4MG2A 1S2BA 5CFDC 4YGDA 1W3VA 4LHNA 1QIQA 5BNPB 1AR62 3ZFEB 2VXRA 1AHSA 1AL23 1N1SA 4QXBA 3AXDA 2IWGB 3FHQA 4MXWB 5FQ0A 3D5OA 3ELNA 4XOGA 3DECA 3RWKX 4MHRA 2EAKA 1VMHA 1X33A 3LPGA 3OUIA 4Y1ZA 4E9KA 4NIDA 2XHKA 3VBHA 4AFDA 1FPN1 2QQJA 4ES8A 1O8SA 1VBA3 2PAMA 3WOGA 4CPBA 4IUGA 5K0UB 1Y4WA 1JHJA 3AP5A 2XJUA 1ZBA2 2ZEXA 3EJKA 1HB4A 2H6BA 3NKGA 4O9EA 5DZGA 3L2HA 2D5FA 1W0PA 1JOPA 2ZJCA 3IDEA 5FP4A 4MGKE 2V4VA 1W99A 5FPZA 3MF9A 4JHZA 2ARBA 1DZQA 4R4XA 4AVTA 3LE0A 4D69A 1JTZX 1NCQA 3MIBA 3POSA 4Q4V3 3WNNA 5KXEA 4EWAA 1GOFA 2VOXA 3ZYHA 3RYPA 4CEYB 3LCPA 4LHSA 1KFUL 3VL8A 5FV3A 1ZZ8A 5FMCA 3T2PA 4BJ0A 3MLJA 2K2SA 2BV4A 3HT2A 3K77A 5L7OC 1LECA 5FZ7A 2ZHLA 3VBUC 2ZHNA 2ARXA 1C8M2 4I01A 1VBD2 2EAAA 3ACIA 4WM7C 1VLNA 1VALA 2ZX1A 1GP4A 1ODNA 4HKOA 4QX8A 3TB0A 4AGGA 2HKXA 1MZ6A 3EQEA 5KHKA 3VD7A 4K3UA 2NQYA 1PHMA 4G9SB 3VV1A 4BE3A 1HQNA 2X10A 2WN3A 5F3EA 1PK6B 3T2OA 4NWVA 2A6VA 4LNVA 1D4M2 4K8RB 4Q0PA 2Q1FA 1GLHA 4BQ4A 1HB3A 4ZS3A 1ND3A 4LKDA 4Y20A 1HN0A 1P8JA 2F17A 3S7EA 1SFPA 5A33B 1EP0A 4ZHNA 1OA3A 5IVCA 1JS9A 2XGXA 2W5FA 3LOIA 2GMMA 2VW0A 5CFCA 2BRTA 2AGSA 4FO9A 1Q8VA 4QQ2A 3AKRA 1ZRCA 3AX4A 1PVXA 5B4XA 4GMP3 3OBAA 5C8WA 2ZGPA 3T1LA 4KL1A 2FDGA 4QPGC 1K5MA 3OPWA 4UFHA 4B29A 1QJFA 3SMHA 3HNBM 4PDWB 3FC0A 4QQLA 2XBO1 1OPMA 2OPWA 3RI8A 4ISRA 3HOBA 1UO9A 2HWC3 3KM5A 1R1A2 2KA3A 1QMJA 3DPRB 1TME3 3B3QE 2GC1A 4O61A 4YG3A 1JXNA 4IQPA 5F39A 2DU1A 3EMRA 4CDWA 3B7MA 5FYHA 5A3UA 5LA0A 1KGYA 2DVGA 2MEV1 2JKBA 5KC6A 1YNAA 5F8PA 3NAPA 1G9CA 3M3QA 3NNJA 5ISLA 4LBKA 4QKFA 3BIWE 1R092 2DVFA 4BQ5A 4Q4Y3 3ACGA 3AZWA 1DP0A 2ZAAA 2IXKA 2OS2A 3VZKA 3W58A 1F8VA 1X82A 5KC5A 3MEPA 4YW2A 5J37A 5CFDA 1JZ2A 2YC2A 4MSVA 1PZ8A 4UFLA 5H9SA 1OVPA 2RS52 4QPIC 4LBQB 3R6SA 5LK7B 1HXS1 3RZHA 1E5HA 4KH9A 4XCAA 3WR0A 2G4IA 4LKSA 1W06A 5F5CA 2WJSA 5APAA 2Q8OA 4BXFA 4AE2A 1X50A 1LHNA 3CBNA 2ENRA 4E2GA 5C4WC 1DGWX 1DQ4A 2XXZA 3ZFGC 4F3JA 3IM0A 4NRMA 2ARAA 1D0GA 3CHXA 3SITA 1DQ0A 4QX0A 2VNGA 3DYMA 1U5XA 4CXXA 4MVTA 5AC92 1O5UA 1Q3EA 2GNDA 1IPJA 1FMD1 1FAYA 4DINB 4UF0B 2PFWA 2D98A 4AR2A 5I8TA 4JRLA 1W9TA 4LORA 4N53B 1GWKA 1VRH3 2DU0A 4UOJA 5LBFA 4XJWA 1KRIA 3IPVA 4E2QA 4IV1B 2C9AA 3MIEA 5LWBA 4U36A 2CGNA 4W50A 4CUGA 1JI6A 4DZGA 1UU4A 2Q5TA 3K4AA 4HSJA 2YU2A 1ZBE1 4FFHA 2YFUA 2TNFA 1S4CA 3IIAA 5A7PA 1H6YA 1MR5A 5L7OA 2D6LX 4BWOA 5AFEA 5B2GB 5BY5A 3T0BA 5CKMA 4WM7A 5DN2A 3CIHA 1OHFA 3VBSA 4CSWA 2QQUA 5L36A 2JDKA 2QQVA 2OA2A 1BJQA 1BEV3 2WABA 4CCLA 1QJY1 3LFIA 3RI9A 4LT5A 2ADEA 3ZXLA 1W9FA 1T2XA 1ZZ6A 2VMEA 5FPVA 2PHDA 2R32A 2B45X 1DHKB 3POWA 1LESA 1DGRN 3N9QA 4N90A 4FOVA 1YQ6A 4W8JA 5E88A 3WZ1A 4ASMB 2W3JA 5FYBA 3VZLA 5FQ0B 1XYNA 1HDKA 2WDBA 1MS4A 3W59A 3ZXKA 3PVEA 4AVVA 4IERA 2E31A 4MADA 5A6QA 3TRSB 4XILA 5J98B 2G9GA 2RMU1 1VBC1 3RNSA 1PIV1 2NPIA 3VBHB 4ORFA 4IEOA 1XJAA 2GNBA 2OUJA 3I97A 2Y0IA 2W2IA 3PUAA 2YGLA 3AZYA 4OUEA 1O4ZA 4O7XA 5ACA1 4ZXKA 2EXIA 2BTVC 5D21A 4QPGA 1WCKA 2ZACA 2XKOA 3CKHA 3ZYBA 2RJLA 3POEA 1V70A 4HG6B 1XNKA 2EICA 5C8CC 3ZXDA 1HRV1 1RUI3 4QDRA 1W9WA 4FXGB 4FBFA 1KITA 2C0ZA 1FYUA 2VMGA 3K3OA 3HT1A 1NCQB 1UYZA 1PGW1 4FPYA 4QXCA 1QNWA 3BTAA 2HWE1 4AVSA 2A3XA 2R043 1UZYA 1SLBA 4B4RA 1RJ7A 3ILFA 4KGGA 3N4MA 2GC2A 3N35A 4HVRA 4H3WA 4YNIA 1AR71 4W6YA 4GWJA 4XZUG 2VZSA 1BKZA 3MFCA 3M3CA 2WKKA 4BK5A 4IEXA 2F4PA 5DUXA 3ENRA 4MGYE 1RVF2 4M00A 3IDBB 2HWF2 4PT6A 1IG3A 1ZZ9A 2P2KA 5DXDA 1R082 4CU6A 2VO5A 3AMPA 3MI8A 5CISA 4DFSA 3AZVA 1XC6A 2JEMA 2E51A 4BQ2A 3OTFA 4NWWA 5DAWA 4IW3A 2IXHA 1C4RA 4D7SA 3H8OA 4YW6A 3UETA 2PHUA 2TBVA 3BGAA 5C4WA 1ND3B 4Y20B 5FYIA 1B35C 1JU4A 2LW8A 2VZQA 3ZFGA 5A7NA 4XXAA 2WT2A 2D44A 2DV9A 5C5TA 4KGQA 1I5ZA 3CNAA 2VQ0A 5T5JA 4FQZA 2W52A 5FWJA 2R16A 5A6XA 5FZHA 2FDHA 4D7TA 5CFCB 2MNGA 4QDSA 1F4AA 5CKQA 3VD5A 3MPBA 4NVPA 5F6LB 1D4VB 2JD4A 3LQCA 3WDUA 3ZKYA 3LF7A 4XFAA 4Y24A 1ND2C 1NX9A 1EUTA 2RJ2A 1GQPA 1PX4A 3OBZA 1W03A 1BBT3 3V0BB 2P4EA 3IKWA 4S2FA 1WBFA 5FREA 3D6EA 5I0UA 3RDIA 5IYYA 3OBTA 4P00B 4K7JA 1XB9A 1X7NA 5HCHA 2ZZJA 4CDWB 3GF6A 5J09A 1QJX3 2RDNA 3ILNA 3NV3A 5KXDA 4ZZ8A 2RG4A 3WNPA 3NAPB 5GZEA 1R1ZA 1XNAA 3NJZA 2A7AA 4C90A 1B09A 3ACLA 4M4RA 1PZ9A 4UFJA 3MLKA 3HD8B 3LWCA 4DXSA 2FDKA 2A73B 4FPFA 2HYXA 1WMFA 5IWFA 3ZYGA 2ZCWA 1L3JA 4AXOA 4E4ZA 3V0AB 4L9BA 5CFDB 5FZCA 1Q5OA 4XABA 1AR83 1A6CA 4W65A 1H8VA 3PLQA 1JYIA 4AHWA 3UT0A 4B8EA 3I8TA 2A6WA 5I0SA 1M4WA 5FZEA 5EJ1B 5EP9A 5FAXA 5CADA 3VZNA 1QGLA 1AR92 1RGSA 3GALA 1AJOA 1ENXA 4HZFA 4R9AA 4TYSA 4Y22A 5A3PA 1JZ5A 4JVAA 3L2YA 1BMV1 4GWMA 1W05A 3K4ZA 1RITA 1AYN1 1UIJA 1C8NA 2ZBJA 2VOTA 5FY7A 1A34A 1V6JA 2VOKA 5JOYA 3THCA 4IEWA 2ZEYA 3KMHA 3ZSLA 4GH4C 4ZONA 2NMOA 3R4DB 5J1XA 4YZ3A 1Q8PA 5K8SA 1NY72 3PU8A 4JTOA 1RIRA 1XSRA 1O3RA 3HN3A 1EAH1 1IS4A 1KQRA 1N3OA 2VVEA 1AR63 3ZIWA 4A42A 5C8CA 3T30A 4YW1A 2JB4A 1OKOA 3VDCA 3FWEA 4QXHA 4A44A 1SBDA 3RYKA 2EIEA 3VBOC 3ASIA 2DUOA 1UU6A 2WZR2 1HLCA 4JDMA 5T5LA 1UIKA 2RM22 3ORJA 3WINE 4PQ9A 2Z4FA 3Q8EA 3KF5A 5A3MA 2RS11 5L7OB 4R9DA 4NO4A 3A4UA 3ZSJA 1V9U2 3POYA 4Y26A 2B9VA 3O1RA 4TLGA 4FQ4A 1LNSA 4WM7B 3VBSB 3WUCA 1H8TC 1GANA 1RUG2 2VECA 4HN1A 2ZMKA 1ZBA3 4CP0A 1AJKA 3AJYA 2B4KA 2WFF2 1OF3A 2RV9A 4NRQA 2W87A 3E6CC 1AL21 2AACA 4QU1A 5SV8A 2OYZA 2XVLA 4AK3A 4Z2WA 3VKNA 5CIRA 4D6RA 1RHI3 2W9XA 1JH5A 4QKBA 3INAA 2YBPA 3N9MA 4D6QA 2DYCA 5JIUA 4QAWA 3VDAA 2C5DA 1GR3A 2J1SA 3KB5A 1YJLA 3GZTB 3O7OA 5EZWA 5BXXA 3BB6A 4HSLA 5JLVA 3PVNA 1B35A 1VBA1 2XKPA 1J3QA 2PLV3 3RQ0A 3ZDSA 1GBGA 5D1IA 2E9QA 2VH9A 2JE7A 3VGIA 3J8F2 4Z2AA 3CJIA 1RUC2 1J3PA 2GALA 2QDNA 1XXNA 4EV0A 5GZGA 4MO3M 5CEHA 4KQ7A 1VBD3 5T5PA 3Q8FA 4EN0A 1ULOA 3GNEA 1OLQA 2ZHMA 3NRUA 4Z1VA 5LY2A 2PELA 1NZIA 1RUD2 2GN3A 5JR2A 1SACA 4B4QA 4AGRA 1Z0HA 2VCMA 1OH4A 1ND2A 1MS3A 2ADDA 4QPGB 1WUVA 5FOBB 4Q4V1 2WQZC 5A80A 2VJXA 5FPXA 1D4M3 2ETEA 1NLRA 5FUPA 3POBA 4KWJA 4JDNA 1WW7A 1XE0A 2FCUA 2A6YA 3OB8A 3FZ3A 2BVVA 1W6PA 4B7KA 4SLIA 1QH7A 3BOWA 4QB1A 5EYYA 5LW9A 3IB3A 1YFXA 1WW5A 4AI9A 5IK8A 1PGL1 1PMHX 2J1RA 4HXCA 4OUMA 4LPLA 2D3PA 2FZ1A 2X09A 5GJ6A 3WQ0A 5HCAA 4KWUA 3P1IA 5IVJA 1IHMA 3AMMA 1JYCA 1WLTA 2WQ4A 1RUJ3 3AP4A 4FPCA 4ZU4A 1QH6A 2XG3A 3DXTA 3ZXJA 2E33A 5LBEA 1CAUA 3GZEA 4GB32 3U0ZA 2BEOA 2BJSA 2RS32 4COUA 3WY6A 1ODMA 1JZ4A 3VLBB 5F3CA 2EF6A 1RMU2 2JICA 1TG7A 5FPLA 2W1WA 4DUWA 4D94A 5T54A 1Q8SA 4CP9B 1R1A3 2J1AA 2BGCA 2JB8A 4XIKA 5C4WB 2HEVF 3NSTA 5I8YA 5FZ3A 3ZFGB 3K3NA 1ULFA 5J7MA 5IJRA 3NW4A 4BQWA 2YG0A 4XFCA 4OHXA 4AW7A 2FMYA 1N3QA 3RMYA 1S0BA 3D0JA 4H14A 4OHZA 5C33A 1W6NA 4GMP1 3ZMOA 3POFA 3S30A 5FZKA 1RB8G 1WLCA 2LALA 1AXKA 1H2LA 3U14A 3HNYM 4GMP0 3E5UA 1Z7S3 3SEPA 4C91A 5I0DA 3RJRA 4HK8A 2GNTA 2RS53 1NCRC 4IGPA 5FCCA 3ST7A 2HWC1 4C1WA 1AYM3 3VBOA 1MEC2 1CAVA 1TME1 4HONA 2UU8A 3W9AA 2E32A 4CXWA 1SLCA 1IS3A 1I3HA 2ZTNA 4X6RB 4RSUA 1RXGA 4Q4Y1 3LOBA 4LBQD 1H8TA 3T08A 4BDVB 2WWJA 5EXOA 3WUDA 1W8HA 4Q0SA 2A70A 1YUDA 3GGLA 3RGBA 5FFOC 3VL9A 1EPZA 4BPZA 2Z42A 2X8KA 3MFAA 1IKPA 1RUE2 3KCXA 2ZEWA 4R4ZA 4FCAA 5A6ZA 1X9TA 4P08A 1VRBA 1BQPA 4GJYA 4GKYA 4PIYA 4AFBA 1UX7A 3O14A 3KGZA 5FJKA 3ZX7A 2ZKLA 1ASJ2 1YRZA 2HWD1 4PF5A 3E6DA 4PBPA 4PI0A 5FO9B 4Y22B 5LK5A 2XLFA 2EXHA 4RL7A 1JOBA 2GP5A 1C3HA 3KQRA 1UY0A 1O59A 4Q1PA 1NQJA 1ENSA 1UOGA 4XJUA 3J7NA 1Y9GA 4GQ7A 4PF1A 2ZGUA 2WO2A 4CEWB 4LR4A 4V1PA 2ATFA 3GCXA 3DUIA 4I0WB 1DQ5A 1O91A 3SCHA 3VZOA 3WG3A 3LDRA 4BIOA 1VRH1 4CE8A 1J1TA 2WYSA 4K6BA 5FR3A 3O1OA 5EYXA 1GICA 2QQNA 3PUHA 1GZ9A 4IV3C 3GCWA 4LIVA 4EN6B 3B9CA 2D6MA 4UAPA 5LRSA 1CONA 1F4HA 1EV12 1LR5A 4AEMA 5ABJC 2JDMA 1JODA 2GU9A 5JVVA 1J59A 5G05L 3B02A 3B9IA 2BDRA 2P34A 5DZFA 2BNNA 2EA7A 4KU8A 3RSJA 4I09A 2OQ6A 4LUKA 1W6OA 2VOVA 2JX9A 4P9GA 3O1PA 4HFSA 2OXBA 1DQ1A 1OQEA 2VTXJ 3SEEA 3U78A 3WDVA 1ZVFA 3SCGA 4OI1A 2QZ3A 5D8AC 3WDTA 4XDQA 2OT7A 3UL2A 4CDXA 3C7EA 4UW4A 1HRI3 1W8ZA 2XUEA 2YC0A 3AM2A 2ZXQA 4XYXA 4FFFA 4Q0UA 5FWEA 2YHJA 1MPXA 3CU7A 3OGJA 3KCYA 3O1VA 4GULA 1B35B 1XYPA 4KWKA 1NXMA 1TQ5A 1FPN2 2DFCA 1QOSA 1YI7A 3CJIB 5JZGC 4LA3A 2AUYA 3FLPA 2BU9A 5DAPA 4XTMA 1FV3A 4NRPA 2IVIB 2VZUA 3HQUA 4RGAA 1UYPA 3WW4A 2HWF3 2JDPA 4XZPA 5GKAC 2VU9A 1R083 1BCXA 4NPLA 2BZDA 1RUI1 2WC2A 1ND2B 1NCRA 4I0BA 1TVGA 4XW3A 2WFPA 2Y64A 4MHUA 5CNAA 1QY4A 1S0FA 3NL1A 5BNOB 1KJRA 2XHNA 5JSRA 3B93A 4A2UA 1YJKA 2R041 1U5YA 3PDQA 3TOJA 3ZO0B 1N3PA 3UGGA 2ES3A 3WP4A 2WRAA 4OUSA 3HN1A 3GZUC 4NAMA 2BOIA 1VIWB 4WM8C 1OUSA 4LULA 5BUVA 1D2QA 3RFRA 1TMF3 5FYTA 1O4TA 3BKZA 3POIA 1CZVA 4XUTA 1HX6A 1OD3A 3OSDA 4A7KA 5HCBA 2R072 1F35A 1AL0G 3E5QA 4DMIA 5L9VA 2D6NA 4G3YC 1T6BX 4DEQA 1GNYA 3PJQA 1CAUB 2P3IA 5FLJA 1JZ8A 4LK6A 2ZX3A 4ATFA 3Q9OA 3E1F1 3DEMA 1JUIA 5JSOA 1DZTA 2VQAA 4FFIA 4RA0A 2BW8A 2IUWA 4CYDA 2XL9A 4NROA 4IEYA 1F5FA 3NNGA 3VBRC 1Y9MA 3AMHA 3FBMA 3VZJA 5FZ9A 1UKGA 2CYFA 3NWKA 4XFBA 2D5HA 1W6NB 3K48A 2HH9A 2VTXA 2VW2A 1AXYA 4JGYC 3OEBA 5FK7A 1S2KA
chains in the Genus database with same CATH topology
3E97A 4HK9A 1U0AA 1BBT1 2JG8C 2CWSA 4I0AA 3FJSA 4MV2A 4IV3A 2V5YA 4AHZA 2EIGA 2XBO2 2RJKA 3VBOB 4EN7B 2BYVE 3OD4A 4AI8A 1CAVB 5ABJA 1AR93 1QJX1 5KXBA 4S2DA 1LHWA 1VBB2 3ZN6A 4META 4QT6A 2UURA 3AFGA 4U2AA 4K9SA 5CBLA 2KXLA 2K0GA 2VGDA 3AMNA 1T6GC 2D43A 1G6NA 1H8TB 1QOOA 1F2NA 4LBNA 3LAGA 5HXVA 1QJU2 1POV3 5HI0A 1AR81 4YVSC 5D8AA 4MXVA 1CGPA 4H55A 3ME2A 1FNYA 5GZDA 3AZZA 4KNCA 2A5ZA 3J9SA 1DZRA 1XYOA 2DWRA 2RM23 1A8MA 4OULA 1QDCA 4XMIA 1MS5A 1Z78A 4Y1UA 1ZZ7A 2DCJA 1SCRA 4XBNA 5JZGA 3AP7A 1V9U3 3BOPA 4LTAA 4NN0A 1J59A 4YG6A 1RUF2 1PGSA 4WVZA 1IKQA 1ZM1A 1LODA 1RUG3 4RS5B 3WD5A 3QD6A 1FMD2 4QQPA 4QQHA 3URFA 4W6XA 2ZGKA 2PN5A 2ZS6B 2R1DA 4FTSA 1KFXL 4IEQA 4K8FA 3ZIXA 3K51A 1ZBE2 4BMBA 2DURA 5IK5A 5FMOS 2E7QA 4QGMA 2WA4A 4QM8A 1RUC3 4PBOA 2UWAA 1UL9A 4OI4A 3UJQA 1ZBA1 2BNOA 3QLQA 1LGNA 3ECQA 3HWJA 1W6QA 1W6OB 1QJY2 2UWBA 1RUD3 4HPKA 2TEPA 3MICA 1RHI1 3CO2A 1W2UA 2CTVA 4G4FA 4Y4YA 5GLWA 4CDXB 3AYAA 5CB7A 2YY1A 4ZU5A 2PLV1 3KSCA 4CTEA 4YZ2A 4OVEA 4CRQA 5A3LA 1MVQA 1ENRA 3WG1A 1SMVA 2RMU2 1QNYA 4XQWA 3VBRA 3JUUA 2HYKA 3MDPA 1VB2A 2D40A 4GA9A 3JD73 4DNYA 4OI2A 1QJZA 1SCSA 4YM1A 4JGYA 5ACA2 2PA7A 2WINB 1XNBA 4D7YA 1D4M1 1PZ7A 2JG8A 3A0KA 3P3NA 4MLOA 3AZXA 2RS33 1NCRB 1CESA 1HRV2 4RGGA 3WCSA 4IETA 4AVAA 2FZ2A 3CEWA 2E6VA 1LHOA 3QCWA 5DZEA 1D0HA 5DDJ3 5GLUA 4DS0A 1CQ9A 5DG1A 3TN93 2OZJA 3AYDA 3VBUA 1ZRRA 3ZXAC 1RUJ1 1AR72 1TEIA 1OA2A 5KHHA 1HQLA 1V6OA 3HR9A 4YVSA 3ZFFC 2OUHA 1RL3A 3ZYPA 4NHMA 4YZ1A 2WSVA 4QM9A 5JMCA 4MZUA 4QD2A 4ISQA 1VB4A 1ULCA 3ROUA 4R9CA 1REDA 1MEC3 2ERFA 4PLNA 1CN1A 2GH2A 3H8UA 2WT1A 5JDBA 1PO12 2O8OA 1NXD1 1NZCA 4H7LA 4LUMA 4QU2A 1LEDA 4WZCA 2XPJA 1IZ3A 2Q1MA 3AP9A 1DF0A 3H3UA 4NHLA 1XE7A 4W6WA 4LE4A 4OHYA 4FVVA 4FTEA 1Z7S1 3MIFA 2RS51 1FOD3 4HVOA 1AYM1 1RUE3 1ZYBA 3PMSA 4BM8A 3U10A 2GN7A 2CWMA 3KT4A 4IV3B 4UW5A 5FO8B 1ASJ3 5ABJB 4AQ2A 5I0RA 2VPVA 2Q0AA 2QFEA 3VHOA 3ZN6B 4AFMA 2Y26A 1V6IA 4N7IA 3PVBB 4IESA 3RS6A 5AVPA 1PVC2 1H4HA 4Y1VA 1ULGA 3FMGA 1EY2A 1CAXA 2IFRA 4Z82A 2WS92 5D8AB 4ONUA 1GNZA 1GV9A 2ZGSA 4N9HA 3MGUA 4QPIA 2ZGNA 2YMZA 3HAGA 1UPSA 4FPLA 2YV8A 1ZNPA 5JPNB 2NMNA 1EV13 1H0BA 3B69A 2B39A 4COZA 5BNNC 1RINA 3BODA 1NYWA 3RYRA 2ZGRA 2ZGLA 5JZGB 2F6BA 1AYN2 2BVBA 1AX0A 5KHJA 5FOJB 3LA3A 5E8AA 5K9YA 3C3VA 2H6CA 2XJQA 4Q0QA 1QU0A 3WP5A 1K5MB 2EXKA 1YIFA 4DY5A 5DG2A 4BHPA 5E1RA 1COV2 1MQTC 4OLLA 4C0HA 1VAKA 3S0MA 2HWB2 2IXIA 4Q27A 4YW3A 3EO6A 3PMEA 1S0GA 1WD4A 1FV2A 3N7MA 3I4IA 3C2UA 1SFYA 1OFNA 3ZFFA 3I54A 1W6QB 1GQHA 1V6KA 4OFGA 4Q4W3 5LRRA 4HPKB 4EWEA 3DF0A 4COYA 1AL22 4YYOA 2PQQA 2XL7A 1HRI1 1URXA 1X8EA 4XTPA 4PLOA 1XNCA 4JAAA 5KHGA 5I0TA 3SLIA 3N36A 4AEJA 3G6JB 5DUVA 2CY6A 5BYNA 1ZREA 3VBRB 1KXGA 4BA6A 2P3JA 3SISA 4M3CE 3IWZA 1VBE3 3TYJA 4AEKA 2YYOA 2ZGMA 2XVGA 2B9UA 2WLQA 3H9AA 2ZX2A 1RUNA 2R062 5BNPC 2R073 4AG4A 4JGYB 3ZFEC 2IZWA 3FLRA 4YGCA 3VHRA 3BALA 5KBFA 4Q4V2 1ZX5A 4N7UA 1QF3A 2ZABA 4GALA 3IDCB 3IPVB 1G9DA 1LOBA 4L99A 2RR12 4L11A 1YIPA 4AGVA 4ES9A 1TMF1 4CP1A 5K0UC 4WVVA 1PGL2 2AENA 1I1EA 3WQ7A 3VBUB 3AFKA 1QQP1 2OPKA 2OIIA 4Z07A 4YVSB 5FRAA 5H9QA 3OYWA 1CVNA 4L2NA 3CL1A 5JOXA 2W39A 5I91A 4M0HA 1OOPC 4CEYC 2XBO3 1FX5A 3M3IA 3G7DA 2RE9A 5BNNA 1VBB3 4K20A 3M4FA 5CA6A 1LHUA 1NG0A 1FNZA 2DTWA 1LHVA 1UN1A 3E6BA 4Y1XA 1EPWA 1C8M3 4F83A 3WXPA 5GALA 5H9PA 4XJAA 1J1LA 4HL0A 2MHFA 1BXHA 1QJU3 1DDLA 1CPMA 3IN9A 1CAWA 5KXCA 2V09A 4AWDA 2FHRA 4INDA 1AVBA 4FP2A 2HEYF 2Z2SB 3TBDA 5JAXA 2HWC2 1AR91 3MIGA 3TWIA 2BFUS 1MQTA 5IUQA 1SQ4A 1UD1A 4LO5B 4Q26A 3D82A 4QHBA 1U5IA 3E5XA 4XXPA 3RMXA 4BIFA 4I30A 2B8MA 4M01A 5JI9A 4Q4Y2 1DBNA 4YM2A 1RUF3 4XF1A 4BYYA 1POV1 1RUH2 3SH3A 2FBEA 5JIAA 5H9RA 5LEJA 5FLHA 1CAXB 3WHTA 1ZA4A 4TSVA 4FOYA 4QPIB 4EN8B 2GC0A 2RM21 3DPRC 3EXUA 3N3HA 4COWA 4E27A 5FO7B 1E57A 2BFUL 3IT8A 2HWD2 5A32A 1V9U1 3JQXA 1BVVA 3S6PA 3O5SA 1XNDA 3MLLA 2HEWF 1S0IA 1O5LA 5J96B 1WLDA 1R093 5I8SA 4GH4A 5EJ3A 2JJ6A 1H2NA 1IS5A 2NP0A 2PAEA 1C5HA 1VRH2 2WL1A 1ONAA 2WSUA 3P3PA 3ILRA 3LSDA 4AFCA 2JG9C 2GH8A 3KLSA 4Y1YA 4P9LA 4LO8A 4R8HA 2ZAHA 2WLPA 3HBZA 2O0OA 2ZGQA 5K0UA 2XJVA 4WZFA 1LOFC 3AK0A 4Q8LA 4BLJA 1PO22 4YFWA 1SDWA 5AC93 1Y7BA 2JXAA 4PCRA 3ZFFB 3VBFC 3B01A 3LA7A 4N53C 5ACA3 2PHWA 4MUVA 3EHKA 4YGEA 5LEKA 1CR7A 2WIIB 1OOPA 4CEYA 4B7EA 2DVBA 1BVP1 3RPQA 4P9YA 4RHV2 3H1YA 4I3PA 4Q4X2 5CG8A 4PJYA 5JCTA 1WMDA 1FT9A 3ZSEA 1DQ6A 2NZ9A 3ZXFA 1LOAA 4YG0A 3JD71 3BCWA 3SH5A 1CJDA 4YARA 1O3SA 1AR73 2QNKA 3WW2A 2VOWA 4XFIA 2ZA9A 5T3NA 4B4PA 4UXAA 2RS31 4Q1RA 1W0OA 4TWTA 1V00A 3JB4C 4XJ8A 2P37A 3JBG2 4QXKA 3A0NA 5FLIA 3OGGA 5C8CB 3FBYA 1WW6A 4XFHA 2P17A 4L92A 5DDJ1 1X36A 2E7AA 2PHXA 3TN91 4LO7A 5IK4A 1MS0A 2R042 1MZ5A 4MGZE 3H1MA 5KHIA 1PO13 1NQDA 1DYKA 4X8PA 2FQPA 2GSYA 1BEV1 2VULA 3MIDA 4JRAA 1RJ8A 1TNRA 2VG9A 4HANA 1SLIA 4I02A 4XHXA 5DUUA 1AUYA 1UU5A 4RQPC 2PHFA 1LTEA 4JCKA 3NKTA 3WNXA 3OYWB 1LENA 2W68A 1NCQC 1SLLA 4XMAA 1ZRDA 2QCSB 3DPRA 4DPNA 1LOGA 3KT7A 4XF4A 1PNGA 4DQAA 1BYHA 2ZGOA 2HJIA 2QKDA 3AXEA 4K1ZA 5EWSA 4P9WA 4PLMA 4Q2FA 2IXLA 3GBGA 3BPZA 3VDDC 3PTYA 1ULDA 4XETA 4CDQC 2ZZQA 1YXWA 2B5HA 1PVC3 1FOD1 3FE5A 1RVF3 3J4UH 1RUE1 3WVJA 4CZSA 4EJRA 4LBQA 4AI0A 2QJVA 2WS93 2ZX0A 2JG9A 1LB2A 1MVEA 1BBT2 2GMEA 2N7GA 2VY0A 2RHPA 4LHLA 3FHIB 1Y3TA 4DRRA 3R4UA 1MZEA 5J36A 3QH7A 4YFZA 1MQTB 2DTYA 5GZCA 4FPOB 1W6PB 1XE8A 1V6LA 1YFUA 1LOFA 1SBFA 1UAIA 2K9ZA 2NLRA 4P9XA 4YGBA 4UBGA 4PIZA 2VMHA 3RWNA 3UKNA 4MX3A 3VBFA 4N53A 4UW3A 2GDFA 4MGIE 2D3SA 2A71A 3OBRA 3VZMA 3FUQA 4AFAA 4YRDA 1GZWA 2A6XA 4K21A 5C9AC 3SXWA 1EV11 3FUOA 5SV5A 2SBAA 2WNEA 1COV3 1XU2A 4JC1A 4QQOA 1HIXA 2GAUA 5A32B 1UZZA 1H9PA 2HWB3 3NAPC 4XBLA 2Z79A 3WG4A 2WNVC 2XLGA 1AZDA 5HCFA 1A3KA 3OJBA 4FP3A 4GH4B 4N43C 1G86A 3NV2A 3V56A 2R49A 5K7PA 1XRUA 1HKDA 2PHRA 2UWCA 1JN2P 1WCSA 2R0FA 1ZZCA 4P14A 2A6ZA 4MYEA 3M70A 2JDZA 5T55A 2TUNA 4FSJA 1H30A 1S0DA 2MEV2 3QOPA 2VVDA 1EYBA 5J3UA 4HVQA 4Q4W1 1UPIA 1GQGA 2DCZA 2VNRA 3MF6A 4RQPA 2R063 1RHI2 1YHFA 3RRDA 3KGLA 1YWKA 2DCKA 1A8DA 3NV1A 3B94A 3T2TA 4JTNA 5JPMB 1OOPB 4XIOA 1HXS2 2AH2A 4AVCA 3L9JT 1HV0A 2PLV2 3U07A 2RR13 4FPHA 3ZPYA 2WZR3 1U5ZA 4A7YA 3JB8A 2I74A 1VBE1 2ET7A 3VBSC 3VDDA 3ES1A 4CDQA 3RJ2X 3N7KA 1ALYA 4FPEA 1H2MA 5F6KA 1NA1C 2R071 2W0XA 3JU9A 1LGCA 4NPRA 1QXPA 3IBMA 2X5IC 2PTMA 2WFF3 2D97A 1AR61 4RD7A 1BZWA 3WV6A 1GKBA 2PHTA 4TLFA 2CNAA 4X6QB 4F7ZA 1V6MA 2FMDA 1UCXA 2I2SA 5JI7A 3WT3A 3MZHA 4FOWA 1WD3A 4URTA 3VKFC 3KZ4C 4HLTA 4FXKB 4LLOA 2PAKA 1OA4A 4HBNA 4HMZA 2XB6C 3J8F3 1AXZA 1J58A 4JV4A 4WM8A 4GXLA 4XHBA 4X8NA 3M1HA 4AI1A 3GHMA 1RUJ2 3LGRA 4M3CA 3AKSA 4BOWA 1N1TA 2UY9A 3NV4A 4XF9A 4H7MA 5IT6A 1W6MA 3VUOA 1LGBA 2WNUC 1QKQA 1IQAA 1CPNA 1Q8QA 3NO8A 5C9AA 3V0BA 1QWRA 3ZSKA 4AVBA 4M0NA 4LO4B 4E2SA 2Q4SA 5L19A 2DF7A 3H3ZA 1KD7A 3OPZA 5FLJA 1Q43A 1VBB1 1VJ2A 2D3RA 2I45A 3OD0A 1YLLA 3WHUA 1GFF2 4LE3A 1VBC2 5FMOL 1C8M1 1PIV2 1VBD1 1HQWA 3HIFA 4NHKA 2XJPA 2WNVA 3ZSMA 3THPA 2GZWA 1UF2C 4AI3A 1QJU1 4IEZA 2Q30A 3TAYA 1SBEA 1RUH3 2IFWA 4N43A 1C57A 1WBLA 3R0RA 4QX5A 3V0AA 1Z7S2 1N1YA 4XFGA 2YZ4A 2PHLA 4SBVA 4XE9A 1AYM2 4ZKTB 1YO8A 4GB33 1F9KA 1ULEA 2CAUA 1WLWA 2JG9B 3MPPG 1PMIA 4LA2A 4LEJA 3RMYA 4AQSA 5HBAA 1IS6A 1RMU3 4YM3A 4P9JA 3QH6A 4OZXA 2ZX4A 1UMZA 1PGW2 2HWD3 1H4GA 1TE1B 2OZ6A 3RZZA 2HWE2 1LCLA 1RUF1 4AEDC 3SNMA 4JGZC 1CJPA 3N7JA 1PM7A 4BCUA 2XWBB 4S2HA 4R52A 4LO6B 1KS4A 4KBBA 4FTBA 1WA4A 3VBFB 3OY8A 2XWJB 2CV6A 4L8QA 2O1QA 4KG8A 2H0VA 4A3XA 2YPJA 1GZWB 3H7YA 4Y5Z0 1MZFA 5FTTC 1R1A1 1QDOA 2UYAA 2BBVA 1DU3D 3PHMA 3H1WA 3VKOA 3WLUA 4QMAA 5JOWA 1R091 4LBLA 4XJ9A 3WDYA 1JBCA 1FATA 2Y38A 2KM2A 4LBOA 3SHRA 3H0OA 1NA1A 4LLFA 1PO23 2CAVA 4PIXA 4YLZA 2X53S 2X5IA 1IPKA 3WP3A 4HT1T 3RG0A 1OLRA 3DGTA 4QPYA 3AYEA 1M06G 2XJSA 1AX2A 2BUKA 2AREA 5GLTA 4XJZA 1VAVA 4JDOA 2BWAA 1DGRA 1Y43B 1LU1A 4RR3C 5F5QA 3USSA 3BU7A 4OHVA 3HMYA 4HKWA 2AR6A 4RHV3 1LKNA 3WDWA 4Q4X3 5AVAA 3WCRA 1JHNA 5CVRA 3TNQA 4CEWC 5AC91 3ATGA 1TNFA 3DKWA 1WGPA 5JR7B 2XUMA 4K40A 4WVMA 4YZ4A 4XQ4A 2EXJA 2WNUA 4RQPB 5IK7A 2XJRA 4DB5A 3S7IA 1HRI2 1UW8A 2CGOA 2YUEA 1WCDJ 3JBG3 3JZVA 4E4DX 1D2SA 4YZ5A 1VAMA 1F5JA 2LUWA 2ILMA 2SLIA 5L73A 3D0SA 2WWSA 3I2DA 1LRHA 2D6OX 3U4XA 4E4SA 3LKJA 1S0CA 1SEFA 3M3OA 1BMV2 2ZGTA 3PJYA 3VDDB 4DY3A 2VW1A 1MACA 5FBZA 5C6CA 2G9FA 4CDQB 4Z8BA 1G9AA 2GC3A 1LU2A 1G8WA 4BMEA 3ES4A 4DXZA 3MW2A 4Q0VA 4B3NA 2LM3A 5T50A 4DOUA 1EAH2 3ETQA 2B42B 2D93A 1YFYA 3THTA 1IOAA 3B5LB 4ZU7A 4FT8A 4ITCA 1C5IA 1PO11 1S1AA 1GNHA 4HETA 3VKLA 3CJIC 4AEDA 3LZZA 3QBQA 4J1XA 5JSPA 1TMF2 4JGZA 1FPN3 1LEMA 2RS12 1S0JA 3AJZA 4WM8B 2EVXA 4YVWC 1YCIA 1APNA 4S2GA 3D8CA 3GZAA 2IXJA 1O4YA 1QQP2 2O8QA 3WX5A 1OMIA 4M3CB 4UBHA 4XPVA 1C28A 3KD4A 4XEZA 2WZPP 1W6MB 2QDRA 3USUA 1QXJA 5FDBA 4AF9A 1CX4A 5BNOC 5C9AB 1H1MA 3AP6A 2CL2A 2Y0OA 1AF9A 1H2KA 4AQTA 1GYKA 1A78A 4NR1A 3U11A 1XU1A 2UYBA 1WMEA 1VBA2 2QQPA 3ZMNA 4N9IA 1CD3G 4XBQA 3VN4A 1PVC1 3R4SA 2WNVB 1RVF1 4LHKA 2HWF1 4CDUC 1ZRFA 1R081 2Z69A 4FPJA 4N43B 2WS91 5GLVA 1REEA 3AB0A 1YYNA 3O12A 4I2OA 3X29B 3UK9A 3MW4A 2ZHKA 2DCYA 2JG8B 5CAZA 3H50A 2W08A 4LBJA 4RR3A 5GZFA 1NLSA 3UV9A 1LOCA 2NM1A 4QGLA 4CEWA 1LJ7A 3V65A 3JCIA 1RC6A 2YXSA 4L97A 2AZ5A 3UJOA 3QACA 4D3WA 1OKQA 5BNQA 1GSLA 1I6XA 1KS5A 4FPKA 3VHPA 1JW6A 3OY8B 3GYDA 4AI2A 3OCPA 4C0BA 4XF0A 3I7DA 3CF6E 2NYYA 2DVAA 2IC1A 3MYXA 3WG2A 2A75A 3DV8A 1COV1 1N1VA 1KDKA 2YDEA 2HWB1 3WW3A 4O9GA 1PNFA 2QE3A 3LA2A 5JOZA 2MEV3 3MIHA 1Q8OA 1WW4A 1DGWA 3ZN4A 1NA1B 2BPA2 4I3GA 2C1FA 3FX3A 2X5IB 4WBBA 1PK6C 4FAGA 5T52A 5KWRA 4BZ4A 3T1MA 2UY8A 4QGNA 3FFZA 1RUOA 3MW3A 1HXS3 1OQ1A 1KDMA 2ZOEB 4WV8A 1TME2 2E53A 1DLLA 2R0HA 2JENA 3WP6A 1JUHA 1MS8A 4YVWA 3ZVXA 3B00A 4IL7A 4RS5C 3O0WA 4IEPA 4MH0E 3UKTA 2WA3A 2R061 2JE9A 3VHNA 4RFT0 3R05A 1NY71 1NE4A 4BLIA 2XVKA 2QVSB 2BNMA 4WVMB 1FMD3 1H1IA 2WNUB 1ENQA 4GKXA 5EV7A 4AHXA 1S55A 1POV0 1FXZA 1HW5A 4PDWC 5BNOA 4TZDA 4XFFA 2XJTA 2RR11 4ASLA 2A3YA 4J6GA 2WZR1 2AYHA 3D4KA 1VP6A 1DYPA 1KJLA 1JOJA 1YI9A 2D6KA 3GBFA 2ZPXA 1ZBE3 5TSWA 2JECA 1MS1A 4KU7A 4AYUA 5GLZA 2H0BA 4AHYA 1IGOA 1OI6A 2R1BA 1YFWA 2YGMA 1RUG1 3JD72 3NVCA 2Z5WA 3I59A 4CDUA 1QXRA 2WFF1 3N7LA 2Q1ZB 3WDXA 1QJY3 4GIQA 5BNPA 3APBA 3HQXA 3ZFEA 4CDXC 2QUOA 4MXWA 5E16A 1UKRA 2VMIA