5FLHA

Free state of ni-quercetinase
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
190
structure length
190
Chain Sequence
IEYATRHRARSFIPPEPGKPYFIEKGLGDRAHLFGDLITIYAGGEQTENTFNFFTCEGPKGEVIPAHSHADTYEVFYITQGAVRLFVEDLEGEQHEKLLTPGDFGFVPKNCVHAYRMERHHSQVVGVAAGPGGTFERFFESLGTPAEELGLPVRPFVPEPEKFRTVPEQYDVRFRPDHQWHTGSIEGRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords QUERCETINASE QUED
publication title Quercetin 2,4-Dioxygenase Activates Dioxygen in a Side-on O2 -Ni Complex.
pubmed doi rcsb
source organism Streptomyces sp. fla
molecule tags Oxidoreductase
total genus 46
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5flhA00
5E1RA 1XRUA 4UBHA 5JSOA 1X8MA 3LAGA 5I0RA 5KHIA 5CU1A 1YLLA 1Q3EA 3RPQA 4E2QA 2K9ZA 1WA4A 4MZUA 1H1IA 3USSA 3LA3A 2XGXA 3WW4A 4FAHA 1ZRCA 1O4TA 4UBGA 1RL3A 3OTFA 2GC0A 4EV0A 1X82A 5T3NA 4B29A 4IEXA 1J3QA 3MPBA 4IERA 1Q43A 3E97A 3RYKA 4K8FA 4Q0PA 3M70A 4MV2A 2VPVA 5FLIA 2P17A 1FXZA 5LRRA 4XETA 3H7JA 4HLTA 1EPZA 5C8WA 5HI0A 1VR3A 3B02A 2XHKA 3HQXA 4I2OA 4QGLA 3SXWA 4YRDA 2PFWA 2Q1ZB 5I0SA 2BYVE 2KXLA 5LEKA 4YYOA 3BPZA 1UIKA 1LR5A 1LB2A 3PNAA 1ZVFA 4A2UA 2XL9A 3LOIA 1DZTA 3DV8A 4ZU7A 3KSCA 4IEUA 1NE4A 2PHLA 4IEPA 3E6BA 3BB6A 2QDRA 1IPKA 2BEOA 2ET7A 4HVOA 5K8SA 4E2SA 5CVRA 4BIFA 4KWJA 4HVRA 5I91A 4XF4A 3RNSA 2EVXA 5EFUA 4AQ2A 1YFUA 2GAUA 3L2HA 1OMIA 2ZKLA 4CYDA 5FCCA 1DGWA 3SCHA 2QCSB 5E16A 1LKNA 3UKVA 2OZ6A 3BCWA 5EZWA 2N7GA 1CAXA 3U0ZA 3CF6E 3IDCB 1J3RA 4LA2A 2PAKA 4ORFA 3CEWA 5KHHA 2OPKA 3FJSA 4WBBA 4MX3A 3D82A 3S0MA 1RTVA 3I54A 4I02A 3FZ3A 3M3IA 1CAVA 2V09A 4AVAA 3C3VA 4XFGA 1UD1A 1WLTA 2D93A 4J1WA 1ZZ8A 3HIFA 1VP6A 3ROUA 1CAUA 1HW5A 2BGCA 3KGZA 4JTNA 4XF1A 3CJXA 4QM9A 4WVZA 3SHRA 3HT1A 4AVBA 2B8MA 4ZU4A 3EJKA 5J3UA 1NXMA 1EY2A 4Z82A 3KCCA 1PM7A 3OCPA 2UY9A 1UIJA 2CGPA 4GULA 1RGSA 2VECA 2PQQA 3LA2A 4FT8A 4YARA 4AVCA 1ZZBA 5KHJA 4N9HA 1CAWA 4HZFA 1GQHA 4L2NA 4OLLA 3RDIA 5KHGA 3EQEA 4I3PA 5I93A 5JSRA 2UYAA 2WFPA 3H1WA 3MZHA 3H1YA 1ZZ7A 5FLJA 2IXIA 3N4MA 4QMAA 5BY5A 3WW3A 2PTMA 2D40A 2Y0OA 4I0BA 4PJYA 4QX5A 3GBFA 4KL1A 1J3PA 3ES4A 3ETQA 2H6BA 2MPFA 2GC3A 3NJZA 3DL3A 2Q0AA 3BALA 4QGNA 3U11A 1H1MA 4XFIA 2WC2A 3PLQA 4IEOA 4XF0A 5J48A 2Q30A 5F1RA 4LTAA 1O3RA 1CX4A 1XE8A 3VHRA 2GZWA 3ST7A 2MHFA 4X6RB 5FDBA 3ZDSA 1NZCA 2QJVA 3E6DA 3O14A 2QNKA 3H50A 3JZVA 1FT9A 1X8EA 4XFAA 1QWRA 3D0JA 5KBFA 2PAEA 4KU7A 1ZRDA 1O5UA 4PIYA 4KWLA 4JV4A 5BV6A 3D0SA 3KMHA 3RYPA 1JUHA 4EWEA 4D7SA 2E9QA 4E2GA 4XEZA 2C0ZA 3S7EA 5C6CA 2FMYA 1UW8A 4XFFA 2OZJA 4YNIA 3NSTA 1J59A 3MYXA 4Q0QA 4NVPA 4O9GA 4MGKE 1IPJA 2HKXA 3E6CC 5FPXA 3ACLA 3H9AA 3TNQA 2OYZA 4HVQA 5JR7B 4R52A 1NE6A 1GQGA 2Z69A 5J7MA 2IXJA 5FQ0A 3H7YA 4XFCA 1CAXB 2MNGA 3G7DA 3DN7A 2GU9A 1YFXA 4HN0A 2XL7A 4EWAA 4H7LA 3MDPA 1SFNA 3H1MA 1SQ4A 1ZRFA 5JCTA 3FFQA 1DGRA 4HN1A 3FHIB 3FX3A 4D7TA 3U10A 2DCTA 2B9UA 1CAVB 4LUKA 3BU7A 3CL1A 5CADA 1CAUB 4IESA 1Y9QA 3KGLA 4PIZA 4XF9A 2ET1A 3E5QA 4LLOA 1YWKA 3HT2A 4HSLA 4IEVA 4XF3A 4BH9A 3OGJA 5I0UA 1J1LA 3LZZA 1QXJA 3FE5A 2XKPA 2PYTA 4P9GA 3H3UA 1G6NA 4WZCA 2EA7A 2XLAA 4EWDA 3SCFA 2IC1A 1CAWB 4AQ6A 4F7ZA 4N9IA 5I0TA 3NKTA 4YSFA 2GH2A 4R8HA 4MH0E 4Q0VA 2O1QA 1TQ5A 4I01A 2PA7A 3OD0A 4HBNA 1ZZ6A 1VJ2A 4FBFA 1OFNA 2H0VA 4BHPA 4O9EA 4XFHA 3GYDA 2BNNA 4LA3A 4F8AA 4LUMA 2O8QA 3CO2A 2QVSB 1XE7A 2BNMA 2GC1A 4I0AA 4X6QB 3SMHA 1UPIA 4ZU5A 3UKNA 3EBRA 3NVCA 4ONUA 4TLFA 4LEJA 4Z07A 1J58A 1O5LA 3FWEA 4QGMA 2F4PA 4MGYE 4QXKA 5BXXA 4QM8A 4KWKA 4META 2XKOA 1SEFA 2D5FA 1YFYA 1ZRRA 2D5HA 2UYBA 5D1IA 2VQAA 2PHDA 3R6SA 5BUVA 4XFBA 2HJIA 1I6XA 4HSJA 3LA7A 2IXKA 2Q4SA 3SCGA 2BNOA 3IWZA 3I59A 3NW4A 2ETEA 1O7FA 4KU8A 1OD5A 1ZX5A 5I8TA 1YHFA 1Y3TA 3I7DA 3RYRA 3I59B 3UKTA 1ZZ9A 5LRSA 4Q29A 1U12A 3WW2A 2B5HA 1O3SA 3CLPA 3QACA 4L11A 1QY4A 3H3ZA 4IEYA 5JSPA 1PMIA 4IEZA 3ES1A 4MGZE 3E5XA 1OI6A 3S7IA 4PIXA 5AVPA 3OF1A 1DZRA 3ELNA 3IBMA 4LULA 1O3TA 5FPZA 3EO6A 4OFGA 1EP0A 4AXOA 1O3QA 2CV6A 3E5UA 5FQ0B 2IXLA 3QOPA 2IXHA 1RC6A 4BYYA 1ZNPA 2CAUA 2FQPA 2XLGA 1YFWA 5I8SA 3PVBB 1FI2A 4IEWA 4J1XA 4Q0SA 3WW1A 5JAXA 4FAGA 4MGIE 3DKWA 5KHKA 5FLHA 2Z2SB 4JVAA 2ATFA 1RUOA 3IIAA 4RD7A 1ZZCA 4UXAA 3RZZA 1CGPA 3EHKA 1QXRA 2H6CA 1YUDA 2I45A 1RUNA 2ZCWA 4HMZA 5LEJA 1I5ZA 1X7NA 4IETA 1NYWA 2XLFA 1Q5OA 2UY8A 5I8YA 2K0GA 1UCXA 4MUVA 1ZREA 2CAVA 2PAMA 4JTOA 1LRHA 2IXCA 1V70A 4IEQA 3LWCA 2EAAA 3NL1A 2GC2A 4I09A 1WGPA 1EYBA 5BPXA 2OA2A 3TNPB 3H8UA 1L3JA 4EROA 4DINB 3IDBB 4Q0UA
chains in the Genus database with same CATH superfamily
4ES8A 3O1VA 3OPWA 4NRQA 4OUEA 1GP6A 1VE0A 4UBHA 1VBE3 3AJYA 2RMU2 3LAGA 1WD4A 4QPGC 1RUI1 5ACA2 2W1SA 3TN91 2B45X 4Y5SA 4K8RB 3KT1A 3OGRA 4MXWA 1RUE3 4QU1A 4HT1T 5EYYA 3V64A 1DF0A 4MZUA 3USSA 1HDKA 1ULGA 2XJSA 4PHZA 1HJFA 2P3YA 4FFIA 4FAHA 2VNVA 4CP1A 4UBGA 1KS4A 5FK8A 4COVA 4Y22B 2HEYF 4EV0A 3DYOA 3DF0A 1AZDA 2YC4A 3AP9A 1J3QA 1QKQA 1GZWA 1Q43A 1BXHA 3MIDA 3MPBA 5FFOC 5CG8A 2YU1A 4K8FA 2HLEA 5LA1A 4Q0PA 3M70A 1ULPA 5FUNA 3AM2A 5H9RA 1NCRC 5JXHA 5FP9A 2VZUA 4KG8A 1DG6A 2VQUA 1DDLA 2TUNA 2WZPP 1RUC1 2ZTNA 1U5IA 2UWBA 3VDDC 2MEV2 3MFAA 3RZHA 1EPZA 4FPGA 4JRAA 3CQOA 5HI0A 3VDBA 4FTEA 2GP3A 1PK6A 2NQYA 5A3OA 3KZ4C 2B9VA 3OOXA 1X9PA 3O7OA 1ASJ1 3POFA 3MIFA 3VD7A 1AXYA 2R073 2CSGA 2BRTA 4YRDA 2ZEXA 1LGCA 3BTAA 3A0KA 5FBJA 1BJQA 2KXLA 5IK4A 5IUQA 4AF9A 3NMBA 4YYOA 3LEIA 1LR5A 1ULFA 5J96B 5D8AA 2QQPA 4LBOA 1NX9A 1ZVFA 3ZSKA 4A2UA 2RS12 4AI1A 1DZTA 2WNOA 2XQXA 4NUBA 2PHUA 3O1MA 1NE4A 3K2OA 3SEEA 1GU3A 2KM2A 1UZ0A 2VZQA 5GALA 3H8XA 2WSVA 4Q26A 5KR7A 1CX1A 1UY3A 1DCSA 3E6BA 4LE3A 3FFZA 4QX0A 5E88A 1DQ0A 4IGOA 3VL9A 5IT6A 4AVVA 1AR61 3ZFFC 1HN1A 3OGGA 3HR9A 5FXXA 2F17A 4XXPA 1XSQA 5IK7A 5AC91 1RUG2 1QOOA 4KNCA 3SH3A 3O0WA 2JECA 4BIFA 2FDJA 5I91A 1VAVA 3ZMNA 2GMPA 3I3QA 2P6CA 2QQKA 3K3NA 1CIWA 3A4UA 4SBVA 2ZEWA 4QPGA 3MIGA 5F5CA 1DBNA 2CGOA 4CEYC 1E5IA 3IB3A 4CYDA 2PHXA 1W3XA 3PDQA 4QKNA 5FCCA 1DGWA 5FBZA 3ZXGA 3ZYGA 2EAKA 1QOTA 2RJ2A 3GDBA 1WWYA 2QCSB 1Z0HA 2AEYA 1XE0A 1LKNA 2HWC1 3VGIA 1OHFA 5JOXA 4W6YA 3N7MA 4QD2A 4XCBA 3THDA 3J7HA 3WV6A 4L97A 1GWMA 5FZ4A 4E8DA 1AR83 2X5IB 4AEDC 3WQBA 1L7QA 1V6IA 1D7PM 1QQP2 4Q27A 2QZ2A 5FV3A 1MPXA 1NCRA 4D3WA 3I3EA 4LPLA 5DUUA 4YM3A 1AYM2 3VDDA 4I30A 5T5OA 2OPKA 3UNPA 1K42A 4WM7B 2ARXA 3S0MA 1RTVA 3I54A 4WV8A 4AVAA 2V09A 3ZXDA 3LDKA 1BMV1 3C3VA 4XFGA 1ZYBA 5E89A 1UD1A 1K5MC 2D93A 2Q8DA 4QXHA 4GB31 1CAUA 3ROUA 4QDQA 3UGHA 3EMRA 1WCUA 2R49A 5LASA 4JTNA 2E32A 3B9IA 3HAGA 4QM9A 4XJAA 3J4UH 3TB0A 2NN8A 5D21A 4AQTA 3RZMA 1W6MB 2B8MA 4NIDA 5JVVA 3S30A 4AFAA 5J3UA 3T09A 5K9YA 4QU2A 4QXBA 3KCCA 1LOEA 3MO4A 4RS5B 1C8M3 3VV1A 1IGOA 3UESA 1O8SA 1G8WA 2CGPA 4CU6A 3CZUA 3SH4A 4GULA 3AYAA 3VKMA 3ZFFA 2VECA 3N7LA 3UETA 5H9PA 3ZN6A 4Q8KA 3RVHA 4FT8A 2JEMA 4YARA 4XYXA 1W8UA 1UO9A 2IVJA 1H4GA 1F35A 5FZ1A 1WMXA 3BPSA 3I8TA 3T1MA 2HWB2 4OLLA 5KHGA 1GLHA 4LKFA 2DCZA 4RFT0 4DXSA 4QKFA 1F31A 2B39A 2JE7A 4I3PA 3N9NA 4CEYA 2DU0A 1W3VA 1VBA2 5L73A 1DP0A 1R082 2DU1A 3H3LA 1PGW2 2BUKA 3ORJA 4YM2A 1RMU2 4BQ4A 2YGLA 3ZR6A 1HXS2 2WFPA 1DYPA 1RUF2 4JDOA 5IFPA 3GZTB 2QTWB 2BGPA 5FLJA 4FOWA 1JS9A 2Y38A 4IV3C 2P4EA 1S0JA 3KVAA 4LIVA 3AP4A 1H9WA 3HBZA 4QMAA 4NOTA 3ZOIA 4AEDA 4BQ1A 4CUBA 5LBCA 4QX7A 3UT0A 1SLBA 3HBKA 4I0BA 3N7JA 3RI9A 3OY8A 1D4M2 5DG2A 1C8NA 1O4ZA 4FOVA 4Q4W2 2A73B 3WP3A 3VHPA 1NOVA 1OURA 5FMCA 1HQNA 2H6BA 1GOFA 2BVVA 3GNEA 2ZHMA 2WFF3 3DL3A 1F8VA 1CZVA 1K5MA 1YC61 2RJKA 2ZZJA 3IM0A 4XTMA 5FP8A 4AE2A 1N3PA 1S2EA 1YEWA 4XFIA 5ERLA 4AAPA 2VVFA 1MS5A 2WC2A 2ZGUA 1CPMA 2EALA 1ODNA 3Q8FA 3U37A 2Q30A 1EUUA 1U5ZA 3CDZB 4QPIB 4LTAA 3ZVXA 1O3RA 1CX4A 2R041 4XDQA 1XE8A 2EICA 4YW5A 2GZWA 5DPNA 4QQOA 1RUJ1 4FPHA 5FDBA 4CSWA 5C3PA 3E6DA 2QJVA 2QNKA 5T5JA 2R7EB 4NPLA 4Q4V1 2P34A 3WDTA 2X8KA 4XFAA 2CDOA 3FL7A 5DUWA 3D0JA 5A3PA 3ZSEA 4KU7A 1W06A 1FOD1 5JLVA 3JXSA 4Q5OA 5IVFA 1NUKA 2VZTA 1PO13 5CKMA 3ZFEB 5L36A 2Z4FA 1OQEA 2DVBA 4YVSC 1H8TC 1QH6A 1PMHX 2AR6A 2ARBA 4EWEA 3D8CA 4D7SA 1FMD3 3AYEA 4XEZA 3WX5A 2RM22 2RS33 1JHJA 1F15A 3HNMA 3MFCA 2HBUA 1IZ3A 1WLDA 2OZJA 2R0FA 1VBC2 3LSEA 2DUQA 4XMAA 3AX4A 3U4XA 1REFA 4Q0QA 3F2ZA 5LK5A 1XYOA 4HANA 3WNKA 2D44A 4IV3A 4QKBA 1IS3A 2X09A 1LU2A 1XJAA 2HEWF 4KGGA 4Q2FA 5GM0A 3M7AA 4CXWA 1F2NA 2CYFA 5DG1A 5F3GA 5FPXA 3O5SA 3ACLA 3J8F1 4Q4X1 2Z5WA 2DBIA 4HVQA 4J25A 4QT6A 5LBEA 4RHV1 5G04L 2LS6A 2QQJA 3EYPA 2W1WA 3PL0A 1VPHA 2IXJA 3KCYA 3PVNA 2LALA 5CKNA 4Z92B 2R063 4PF1A 2WT0A 4QXCA 2DF7A 4BQYA 4WVWA 2C24A 2LRPA 1POV3 1Q8VA 2XL7A 3KS7A 2WS91 3PUSA 5A33B 1HN0A 3POGA 5DDJ1 3S5AA 2RS52 1VBB1 1DGRA 3A0NA 3FHIB 4HN1A 2OS2A 3FX3A 1ONAA 1OXCA 4D7TA 2DCTA 1CAVB 1H9PA 2XQRA 1OKOA 3MUZ1 1OVSA 4GJYA 4AEKA 1SBFA 5LB6A 2Y6FA 3RJ2X 1CONA 3ZO0B 5L9BA 1V6JA 4IESA 1Y9QA 3KD4A 4PIZA 1LEDA 3SEPA 2ZS6B 3E5QA 2W3JA 4LLFA 5J36A 1GOHA 5JI7A 2WO3A 1QJU1 4XF3A 4BH9A 1NQJA 2ZGPA 1UAIA 3OGJA 5FPVA 3RRDA 4N90A 1J1LA 3VD9A 4OI0A 2K2SA 2PHTA 4MLOA 5FRAA 5A7WA 1QXJA 4FPEA 1QDOA 4YVSA 1DGWX 2YG0A 3FE5A 4DXRA 1H8TA 3I49A 4P9GA 2VZ3A 3TN92 4U2AA 1G6NA 3PMEA 3M2MA 4WZCA 5FKCA 3AP5A 4EWDA 3T4HB 3JQXA 4WVVA 1VRH3 2QBXA 3WHTA 1OPOA 2VOKA 2YB7A 2IC1A 3L9JT 4JDNA 1CAWB 4AQ6A 3HEIA 1R64A 3W59A 4N9IA 1TME3 5I0TA 3WDUA 4F7ZA 1PNGA 4CCOA 4MH0E 3BUCA 1GP4A 4EN8B 1XNBA 1YIFA 5HCBA 5CZKA 2JDNA 1RUC2 4DB5A 1JYWA 4NJ4A 1XB9A 2JD9A 4W8JA 4P08A 1GICA 1W0OA 1Y4WA 4MHRA 1CN1A 5FUPA 2J1VA 2H0VA 4BHPA 4LT5A 1ASJ2 3MV01 3GYDA 4QB1A 1XNAA 2F4LA 3BTYA 2OX0A 2VOVA 2JXAA 3AJZA 4FOYA 5JIAA 3WSOA 2CHHA 1JMUB 3IKWA 2DFCA 1XE7A 1RUD1 4Y22A 2BNMA 4IW3A 3EB7A 2OQ6A 4UFMA 3SMHA 4ZU5A 4BK4A 2XVLA 2X5IC 3OGSA 4TLFA 4P9JA 4P00B 3P1IA 4BZ4A 4DUXA 2WNEA 1J58A 1H1AA 4HXCA 1O5LA 4N53B 4CTEA 4UWDA 5G05L 4XBLA 4QGMA 2XB6C 1BVVA 1UYZA 2F4PA 5EHDA 5GLWA 2WNUB 1JH5A 4WM7C 4AFCA 1AR62 5FKBA 2QKDA 1C1LA 4V1PA 4ATEA 4P9IA 4ZZ5A 5IJRA 4META 4HK9A 5AC92 1UY0A 1BBT1 3J26N 3MIHA 5E8AA 2WYFA 1UYYA 2G9FA 1LECA 4CA9A 3SLIA 4DXZA 3HN1A 4AR2A 1UWWA 3T2OA 3R6SA 1GZCA 2JB8A 3E1F1 3ZN4A 2A71A 4XFBA 1U5YA 1QNYA 4Z2AA 3UGFA 2A3YA 1JZ5A 1UPSA 2IZWA 2Q4SA 3U14A 4GAZA 1PIV3 4ATFA 2BNOA 2HWC2 4DY3A 2GN7A 4RR3B 4N43B 2E6VA 1RUI3 2WO1A 3KHBA 2ETEA 1O7FA 4P02B 5LA2A 1J84A 4IE0A 4QWNA 4QX2A 2QQOA 4DS0A 1OUXA 2XUMA 4YG6A 1CGPA 1QJX3 1H6XA 4PLOA 1U12A 4XC9A 4A3XA 1CIYA 3T0AA 4JCKA 3QACA 1URXA 1E57A 3D3AA 2RDNA 1QY4A 2R16A 4L11A 5A33A 4JKLA 3MF9A 2BGOA 1MVQA 4W6XA 3B7MA 5JSPA 2VXRA 3CMGA 4IEZA 3ES1A 1DQ1A 3GJBA 1UN1A 1BMV2 3S7IA 1DU3D 4PDWB 4YGEA 5M0TA 1W9WA 5AVPA 5FZDA 1HX6A 2ZX2A 3OBAA 3QLQA 4NO4A 3AMHA 4BB3A 4GB32 1QIQA 1DZRA 3T08A 4A3ZA 4HKLA 3O1PA 5FPZA 3EO6A 1FNZA 4OFGA 3HN3A 1O3QA 2AUYA 2CV6A 2R1DA 2GNMA 3GCWA 2ZEYA 4R4ZA 3HQUA 4BQWA 2X5IA 5BNNB 5AFEA 1I1EA 4ZKTB 5B4NA 4CCCA 1RC6A 4IDZA 2JDHA 3VKNA 1CD3G 3M3CA 1QDCA 1MR5A 2XH6A 1PVC1 1UU4A 3ECQA 3PVBB 3IIIA 3MBWA 4J1XA 1Y43B 4WM7A 1LGBA 5EQUA 5K0UC 4S2FA 1JOBA 5A1FA 3J9SA 3B5LB 2YV8A 3I3BA 3WINE 3LB9A 2WZR1 3VZNA 1UOGA 2ATFA 2EIDA 1ACCA 1RUOA 1GR3A 1WW7A 1ZZCA 5FREA 1X9TA 1QQP1 1AL23 2H6CA 1RVF3 3AXEA 3MV11 4QPIC 1W6MA 4MGQA 5CAZA 1BK1A 2RDRA 1LOGA 2PLV3 1C5IA 1AX2A 4NR1A 4YGBA 3WHUA 5LEJA 3BI3A 1JOJA 1YI9A 3K77A 4QQHA 1X7NA 3LEKA 3INAA 5BYNA 4GMP0 4XUQA 5A80A 5EWSA 4CP0A 1OPMA 2K0GA 1UCXA 2CWSA 2PAMA 3PUHA 5A3TA 5HXVA 5DABA 2V72A 5FY9A 1V70A 4IEQA 3O0XA 4XUOA 4A7YA 3ZFEC 3LWCA 1ULEA 4QQPA 1WGPA 3C8XA 2FDFA 2NZ9A 3SQOA 2KR2A 2OA2A 3TNPB 3H8UA 5KWRA 2JG8B 3MEPA 4NAOA 3HNBM 5FJHA 1A8DA 1G9DA 2A75A 5KXCA 3M3EA 3POSA 5E1RA 1XRUA 5EJ1B 3VDAA 4CP9B 1QJY1 3UJOA 5JOWA 4NN0A 2R042 4RQPB 1YXWA 2Y33A 3HD8B 1WLWA 4Y5TA 2YPJA 4C91A 2V4VA 1Q3EA 1RUJ2 3RPQA 4E2QA 2YXSA 1W8TA 2K9ZA 3VBHB 1H1IA 1ZBA3 4UAPA 5FJKA 4CDQB 1XPWA 3M3QA 3WW4A 4Q4V2 4P5HA 1SACA 4XW3A 2GC0A 2VZSA 5T3NA 5DQ0A 2BOJA 5GZGA 5K0UA 1QJFA 1FOD2 4LK6A 3ZN5A 2YUEA 1LOBA 3NNJA 5LW9A 1O8PA 5FLIA 4E4ZA 4LHSA 2W08A 4XUTA 4PI0A 1YQ5A 3H7JA 2XVKA 3L2YA 4QPIA 5T50A 1POQA 3AMPA 1RHI1 1WCDJ 3N35A 3B02A 4CCMA 3POEA 3HQXA 4I2OA 2XONA 4G3YC 4QGLA 3SXWA 4AI2A 1CJPA 2PFWA 4NWVA 4K9SA 5A7QA 1VAKA 1E5SA 3NJYA 2ADEA 1SBEA 1Y9GA 2BYVE 5IFTA 4LO5B 4DRRA 3I2HA 4W65A 4YVWB 3JB4C 4Q8LA 2R6QA 3MF6A 4LO8A 1H30A 2WO7A 3WNXA 3WNPA 2ZX0A 3J8F2 4QPYA 4ZU7A 4L8QA 3KSCA 4IEUA 3ZFGB 1G9FA 3ZFEA 1F5JA 4DUWA 4RHV2 4IEPA 5IAXA 2ZAAA 1TNRA 2GMMA 3TRSB 4KH9A 4ZPIA 5FIXA 3VZMA 1TMF1 2WA3A 5JXGA 1IPKA 1R093 3MUY1 2BBVA 3ZYRA 4HVOA 1KD7A 4R9AA 1OLMA 1W05A 2UWAA 5CVRA 1ZBE3 2WS92 3ZYJB 2VVEA 2ZMLA 1NCQB 4UOJA 5DDJ2 2Q8CA 1VBB2 5EFUA 3ZSJA 2OXBA 5A7PA 2HWE3 2YZ4A 3L2HA 2E7QA 3FBMA 4Y5Z0 2ZKLA 1AYN3 4XVHA 1UOBA 2WWJA 3WLUA 4W50A 1TNFA 1COV3 3THCA 2WT1A 3MIEA 1NXD1 4OQ9A 4P14A 1QJU2 2J42A 3VBSB 4V2WA 4M3CE 4WVMB 3WF4A 3U0ZA 3LIHA 4PCRA 3ZXEA 4E8CA 4XIOA 2YYOA 1HV0A 1STMA 2WQ4A 5KHHA 3WXPA 3WY6A 3BOPA 3FJSA 4HETA 4WBBA 4MX3A 1LJ7A 4CRQA 3O1UA 3FZ3A 3M3IA 4LBMA 5LBFA 1CAVA 3AZZA 4D7YA 4G9SB 1WLTA 4OVEA 3RS6A 2QZ3A 1DHKB 1VP6A 4N53C 1BEV1 4XF1A 3VD4A 5DAXA 1UXXX 4XIKA 4AVBA 3HT1A 3APBA 3CHXA 5HV4A 3VHNA 4ZU4A 4X8PA 2DTWA 3EJKA 4FPJA 3M8LA 4GZ9A 4S2GA 3SNMA 4YZ1A 1NXMA 4Z2WA 2XPJA 3NJVA 1EY2A 4FPLA 3T4VA 1G7YA 3AYDA 1BLZA 1H2KA 1PGSA 2OW4A 1GZ9A 1D2SA 4ET7A 2WZ8A 2R0HA 2ZMKA 3BGAA 3LA2A 4H55A 2VTFA 4Q4X3 1W8WA 3PUQA 5FZ6A 3JUUA 2Y34A 4LHLA 5D2AA 4BMBA 4RR3C 4XQ4A 2Y6HA 1CAWA 1RUD2 3PVEA 4L2NA 4N43C 3RDIA 1EPWA 1SLTA 5ISLA 5ABJB 5C5TA 3CBNA 1WCKA 2RR13 3KVBA 1P8JA 1H2NA 4UF0B 1W2TA 1UY2A 4R9CA 4XZPA 4EN6B 4TTGA 1LTEA 5EJZB 2HWD3 3W58A 1RUH3 3WP4A 1U5XA 4RL7A 3C2UA 5FYSA 3SC7X 4NIHA 4BCUA 3LPGA 5FYTA 5LA9A 3Q9OA 5B4XA 2ILMA 4E9KA 3LE0A 3AP7A 2CY6A 1NKGA 2VBBA 1XBFA 2QQLA 2Z42A 4PDWC 3V65A 5CA6A 1BBT2 3O1TA 3FC0A 3WW3A 3WF1A 4AHWA 2PTMA 2D40A 4BXSV 5KC5A 1AR73 2JDKA 1R1A1 3RMXA 1REDA 3NV1A 4XPVA 3URFA 1N1VA 4D94A 2RHPA 5FPLA 4KL1A 4BQ3A 3D5OA 5JUVA 2FD8A 2JE8A 1K45A 2YC0A 4XZUG 4ZZ8A 5GZEA 3NNMA 5BNNC 3Q8EA 3NJZA 2QE3A 2VCAA 4FP3A 2LTNA 4QGNA 1VBD3 1H1MA 4N53A 1DFQA 5JI9A 1UKRA 2Q5TA 2IUWA 4A41A 4IV1B 4XAEA 1E5HA 5F1RA 4Y33A 2V4AA 3ZSLA 4H3WA 5C8CB 3I2OA 4AI8A 2VZOA 3LGRA 2VNGA 3IN9A 3N9QA 4X6RB 1AJKA 3ALQA 1GUIA 3ZDSA 2TEPA 5KXEA 1V9U1 5A6XA 3H50A 5A1AA 1LNSA 1MEC3 2JDMA 2W46A 1FT9A 4AEMA 5LY2A 5CB7A 4C1XA 3FUOA 3ZXAC 2D6PA 5KBFA 4Q4Y1 4QX8A 5I0DA 1SFPA 1ZRDA 2AH2A 1YQ2A 1RXGA 4PIYA 3R4DB 4KWLA 4JV4A 3W5NA 2DURA 4RR3A 4N43A 4S2DA 2WNVB 1TG7A 2ZEZA 4CPBA 2QQMA 2JKBA 5C3OA 4MG2A 1HRI1 4LBKA 5HPOA 3PTYA 4E2GA 2C0ZA 3S7EA 4LIUA 1UW8A 2DVFA 4PT6A 1Q8QA 3F95A 1HRV1 2VE1A 3W5MA 5JPMB 1JHNA 4YNIA 3NSTA 4AI0A 1Z7S2 3VUOA 3MYXA 1PVC2 4NVPA 1OC1A 4YZ2A 5FY5A 3C7FA 5A1LA 3PURA 4L92A 2C4XA 5FP3A 4ASLA 1W8OA 2EIEA 2HKXA 5FZFA 3E6CC 2RMU3 2XJTA 2P2KA 4PDWA 1W6NB 3Q8AA 2WZR2 3K75B 2JG8C 4LKEA 5DUVA 4B4PA 4AI3A 5ACA3 5KXDA 1W28A 1GSLA 3H9AA 3TNQA 2OYZA 1FPN1 5FYUA 5FXWA 4ZXKA 4DZGA 4P9LA 3T2TA 2QDNA 1HB2A 4FP2A 5FYCA 1XNCA 3N9OA 4BLJA 1W6QB 4RQPC 1AR91 2XWJB 4HPKB 3H7YA 2BJSA 3DEMA 4I3GA 5BNNA 1CAXB 3VZJA 4BMEA 5LCWL 4BLIA 2F6BA 1ENXA 2WBKA 4BU2A 2MNGA 2XBO1 3VBHC 5EPAA 5F6LB 2ZX1A 2PMWB 1KJRA 3ON7A 4TSVA 5EYXA 3WG4A 4EWAA 3POBA 4H7LA 4OHYA 3MDPA 3ASIA 4A45A 5JCTA 1YQ6A 1Y9MA 2W52A 1F5FA 2UWCA 5J98B 5DMYA 4YWAA 2SBAA 1CESA 2XOMA 2MEV3 4TN7A 2B9UA 3CJIB 2YFZA 4BE3A 4LO4B 4CU7A 5CADA 3PMSA 5CBLA 1GP5A 1VRBA 2ZGSA 4LHKA 4XBQA 4P9XA 4CU9A 4XF9A 1V6KA 4RFRB 1JZ2A 5T52A 4FOQA 1PGL1 3DYMA 3HT2A 5CEHA 4NAMA 1XXNA 2AGSA 1DLLA 4CDWB 2RS13 3V56A 1ZM1A 2FCVA 5FZAA 1QJY2 2AC1A 4CDUB 4A4AA 2VNRA 1W6PB 4GXLA 1QXPA 2EA7A 3I2GA 3QBQA 5JZGB 2XLAA 4IQPA 1QJZA 2BZDA 1S0IA 1N1SA 1X50A 4FO9A 5FY0A 3ZFGC 4BDVB 2J1SA 1PO21 4QX1A 1RUG3 1ENQA 2BV4A 2DVAA 4A42A 1LODA 1JW6A 3NKTA 4JQTA 3R4UA 5ANQA 4YSFA 4CCNA 3LD8A 4EN9B 2G9GA 2GH2A 4R8HA 3N9MA 4CE8A 2JE9A 2JG8A 2XXZA 4KWUA 4XACA 1JUIA 2PA7A 1B09A 4HBNA 3FLRA 1I3HA 1EAH1 4OI2A 4YZ4A 1VAMA 1YCIA 4CP9A 1NCQC 4CXXA 2VM9A 1RHI2 2ZX3A 1GKBA 3DXUA 4GIQA 4RQPA 4CCEA 2ZGKA 3JD71 5EJ3A 1JOPA 3O12A 3GBWA 4FI9A 3U07A 2OIIA 3K51A 3JBG1 2DVGA 1YJKA 3K48A 4IXLA 1DQ2A 1PX4A 1S0BA 3VBHA 1XSRA 5FOBB 3I3MA 1W9YA 4LUMA 1QQP3 3IPVB 2GNBA 4OZXA 4FCAA 1DYKA 2EXIA 2GC1A 3QD6A 2Q8EA 4M0NA 1AYM3 4YW3A 2WO2A 3VBSC 1W2AX 3NWKA 3ACFA 3NVCA 4ONUA 4DMIA 4KI5M 2QQUA 3B94A 1LGNA 3IMNA 3N9LA 5A3WA 1S1AA 4A6SA 4Z07A 1VB2A 2HWF1 4IE6A 4MXVA 4C1WA 3FWEA 2XJUA 1TMF2 4TWTA 2J1UA 5BXXA 3IMMA 4QM8A 2A6WA 5FO7B 1MZ6A 4EZ4A 5IAVA 1SEFA 2HYKA 2VZRA 1YFYA 1OUSA 1ZRRA 5A3LA 2EIGA 1LOCA 2UYBA 4IE7A 4ASKA 2VQAA 2D3SA 2PHDA 3GHMA 3LDBA 1REEA 2D6NA 1VMHA 2OUJA 1S0DA 2HJIA 3T2PA 1I6XA 4R9BA 2WL1A 4HSJA 3LA7A 4B7KA 3KCXA 4K7JA 2IXKA 3AL6A 4AGVA 5K7PA 4L99A 2P3JA 3ZFGA 1MS3A 4YLZA 3LOBA 5A3MA 4XQDA 4LBLA 1J1TA 3I59A 2W94A 1W9TA 4KU8A 4C0BA 3H8OA 1ZX5A 5HCHA 2D6MA 2HWB3 3B3QE 1QJEA 4JC1A 4NPRA 3S57A 3IT8A 3U75A 5ANNA 2VOXA 1LENA 3I7DA 1WZXA 2WZEA 1ZZ9A 2JDUA 1DQ4A 1VBA3 4YW1A 1R083 2A6ZA 4OHVA 2B5HA 4NE9A 5LZ6A 3BIWE 1RMU3 1O3SA 5F6KA 2BBAA 1HXS3 4W6WA 4XUPA 4COWA 3FMGA 4QX3A 1NCQA 2WQZC 3H3ZA 4EQVA 1EV11 1RUF3 1O59A 1XC6A 1G9AA 5ABJC 1PMIA 4CUCA 4F3JA 4XQWA 3VKLA 2XJRA 2JICA 5F5IA 3I4IA 3WP5A 5CFCB 1NG0A 1OI6A 2VG9A 3AKQA 4QB2A 2BQPA 2BTVC 1B35B 1KFXL 1O3TA 3ELNA 1BEV2 2DDUA 2HEVF 3KT7A 1D4M3 1UL9A 1W04A 5F39A 4DY5A 4Q4W3 5FZKA 1PHMA 4H2AA 4WVMA 3VBSA 4YG3A 1LESA 2B42B 4JAAA 3GF6A 1C28A 3POWA 2YROA 4GKYA 5SV8A 2CAUA 4YFZA 1CWPA 2VMIA 2XLGA 1H6YA 1G9BA 1FI2A 1SDWA 2AACA 2QUOA 3CIHA 4UT5A 1BQPA 5KHKA 4Y24A 5FLHA 4DUVA 3DECA 3RFRA 1SFYA 4CPBD 3AKSA 4AOCA 2QFEA 1GWKA 2A6XA 4RYDA 3ZYHA 3KF5A 5A6YA 1VBE1 4ES9A 3ZXFA 1GV9A 2D43A 3WQ0A 1OF4A 4IV1C 1OVPA 2RE9A 5A7SA 1O6UA 3ZR5A 4W4ZA 4Y4RA 1RUE1 2YHJA 1OLQA 5C8CC 4YGDA 2LROA 2I45A 5JOYA 2J7MA 4XURA 3WF2A 4JGYB 5T5LA 1WA6X 4BJ0A 5DZGA 2CL2A 5BNQA 4Y1YA 1NYWA 2FZ1A 1Q5OA 3LDRA 2UY8A 1AXZA 3KV6A 4B7EA 5AVAA 5E6HA 4JTOA 1LRHA 2Y64A 2RM23 4AWDA 2ZJCA 1RJ8A 1J83A 3FLPA 4O7XA 1S4CA 3RG0A 1R1A2 4UYBA 2EAAA 2XJQA 3KV4A 2D7FA 1VBC3 2WNVC 3PJYA 4QDSA 4AVSA 5K4LA 1UMHA 1HJGA 5ABJA 3NNLA 5BPXA 1QH7A 4RSUA 2GSYA 4GMP1 3O0VA 4LQRA 3ILNA 1K5JA 3IDBB 2R071 4UF0A 2ZA9A 3BN6A 2VY0A 3Q8BA 5JSOA 3VN4A 1OA2A 1X8MA 2L9LA 3OBRA 5KHIA 2JX9A 4OHZA 5CU1A 1WMFA 5JOZA 1YLLA 4KG0A 4UFKA 4YG0A 1V9U2 4NHXA 1Y7BA 1C57A 3LA3A 5TSWA 1ZRCA 1XOYA 2BDRA 1X82A 4N7UA 4B29A 1JU4A 2UURA 4Q4Y2 3KHCA 2B7YA 2RS53 3E97A 1UMZA 3ZM8A 3GZUC 5FZGA 2O8OA 2FCUA 3POJA 4MV2A 4JKKA 2ADDA 2VPVA 4Q1PA 4ZY9A 2VUDA 2ERFA 5C33A 3VL8A 2VC9A 1HRI2 2FDHA 4MSVA 2ORZA 4IV1A 3RWKX 2PHRA 5C8WA 1RB8G 3ZKYA 4AAXA 1UU5A 1VR3A 3WVJA 5A3NA 5C8CA 3TEWA 2WWSA 2XHKA 1HRV2 1BCXA 2DV9A 4XABA 3CJIC 3PUIA 2Q1ZB 3DUIA 3U4SA 2KA3A 1LHUA 1GNHA 5LK7B 3AZYA 3KWVA 4HONA 4WM8B 1VIWB 4LKSA 5I0SA 1OOPB 4XBNA 5EP9A 3SISA 4RS5C 3RZLA 1AR81 1UIKA 1VB4A 3Q8CA 3WF0A 4KMQA 1HB4A 4NHMA 3TN93 1S2BA 3LOIA 3AB0A 1FPN2 3WEZA 3BTXA 4CDWC 4TZDA 5JIUA 1F4AA 1M06G 3I2KA 3LEGA 5FY1A 2PHLA 1E5RA 1CPNA 2WNVA 5IWFA 2VCBA 1AR92 2WAOA 2P3IA 4CDUC 3IDAA 2VVDA 2BEOA 2XJPA 4LKDA 3ZYIB 2EXHA 1M4WA 2DCJA 2J22A 2XBO2 4NWWA 3NV4A 5FY4A 4E2SA 5K8SA 2EF6A 5GLZA 5AFBA 2GH8A 3WUCA 1WCQA 2H0BA 4KWJA 2YY1A 1RITA 4UFIA 1RUC3 2EVXA 4HKOA 4JZRA 4RN5A 3VZLA 2FBEA 4IUGA 1GOGA 3ENRA 2W68A 3OBTA 1W9SA 3UK9A 2NM1A 2W9XA 4XJ8A 3VBRB 1W6NA 4QHBA 5C9AB 1ASJ3 1C8M1 1W8FA 4A7ZA 1YO8A 5IVJA 4YW6A 4KBBA 5E16A 3WDYA 2BWAA 4FXGB 1LHNA 2WJSA 3BYWA 3UKVA 3BKZA 2OZ6A 1W6QA 4NRPA 5FZ8A 3T30A 1PGL2 2WSUA 3BCWA 4HPKA 1ST8A 1HLCA 2VJXA 1Z7S1 1CAXA 4CCJA 3TEZA 4H7MA 3UGGA 5FZ7A 4CUAA 5FMDA 4YW7A 2C26A 1JZ7A 1J3RA 2I07B 3R4SA 2PAKA 2CTVA 3ZXJA 1GMMA 5BNOB 5LBBA 3D82A 1YIPA 3PIGA 2SLIA 1AR63 5JWPA 3A21A 1GWLA 1G9CA 1Q8OA 2J1AA 3CJIA 1WMDA 2BP6A 5AC93 1PO22 3OSDA 3ZKUA 1ZZ8A 3D4KA 3HIFA 3QH7A 1GNYA 4C0HA 3KGZA 2Q8OA 3CJXA 3J7NA 4RS5A 1OD3A 4K1ZA 2ZHNA 4XJUA 1HRV3 5EXOA 4RA0A 3MPPG 4Z82A 5FZLA 2J1RA 1PM7A 5DXDA 4CDWA 4KGQA 4UFLA 1EAH2 4AL9A 3NKGA 1JZ6A 1UIJA 3C7GA 2WRAA 3ZLIA 3ZIWA 2HWC3 4M3CB 4GH4B 4CDUA 1RGSA 1W6PA 1WCSA 1TE1B 3JD72 1SZBA 2DFBA 3DPRB 2PQQA 3HPNA 2RDQA 4HG6B 3JBG2 2WFF1 5FZEA 2GN3A 2E26A 1GBGA 5FYIA 4B1MA 1RIRA 3MW4A 1ZZBA 3AK0A 4EE2A 4BQ2A 5KHJA 1RXFA 4KQ7A 4MHUA 2Y26A 3ACHA 2CNAA 3ZN6B 3GZAA 4BA6A 5C3SA 2BU9A 1CVNA 2ZGNA 3U1XA 5JPNB 3EQEA 3BIEA 4COUA 3P6BA 3A7QA 1ULDA 4AFDA 5I93A 2NMOA 1QNWA 4UW3A 4Z1VA 5C3QA 2A7AA 2W1UA 2V5YA 3NAPB 2HWF2 2P5BA 2VMDA 2EXJA 4YM0A 3MZHA 4FQ4A 4XE9A 4QHZA 3H1YA 4COZA 4GB33 3W21A 3W20A 2VXJA 4EYUA 4D0QA 3VKFC 4XJZA 4G4FA 3NJXA 5CFCC 3NNFA 2R32A 3LSDA 4AG4A 2AEZA 1PO11 4XTPA 1FX5A 2JDAA 4GWNA 1B35C 4BK5A 4QX5A 5LWBA 1D4VB 3GBFA 3OPZA 3IPVA 3WG2A 5F8PA 1FMD1 2ZHLA 1RYYA 3ES4A 3HQRA 4OMDA 5FYHA 3RI8A 5FOJB 2FCTA 2RS31 2CWMA 4LBNA 4LE4A 4YZ5A 1JYXA 2QQNA 3TEYA 2Q0AA 3BALA 4AZZA 1HIXA 4INDA 2JJ6A 1ND2B 3PLQA 4FFFA 4IEOA 1DGRN 5IYYA 3GALA 4HOOA 3NNGA 5J48A 1ND3B 3PIJA 4QB6A 5A70A 1JU3A 5F2SA 1UNBA 3VHRA 1SDDB 2ZGRA 2WAAA 1C1FA 2ZPXA 3PU8A 4ISQA 5CIRA 3O14A 3SKJE 4JX0A 1HQLA 2ZHKA 3JZVA 4FPCA 3T2QA 1EV12 5CKQA 4BPZA 4OCTA 3CZJA 1X8EA 2JDYA 2W39A 1QWRA 4K21A 4AVTA 5JR2A 5IK8A 2R061 3KT4A 5FR3A 3OBZA 2D6KA 3MIBA 1AVBA 4URAA 1O5UA 5FZMA 1SPPB 5BV6A 4SLIA 4J6GA 1POV1 4JGYC 4ITCA 2E9QA 1IPSA 2DWRA 3M3OA 3WDWA 2ZKNA 3ILRA 4LJHA 3ZSMA 5JDBA 3X29B 4QKDA 4FPFA 1KEXA 5FZ3A 2ZGQA 3ZX7A 5FMOS 2E53A 5C7GA 3GCXA 3MLJA 5DAWA 5JSRA 5JMCA 3AFGA 4O9GA 4DOUA 4K20A 2OQ7A 4MGKE 3RJRA 2VW2A 2FDIA 2VQ0A 1X36A 5H9SA 5CFCA 3BVCA 2R043 5FZ0A 4MOAA 3N3HA 1WBLA 4OZOA 4GD4A 1B35A 1RUJ3 1ENSA 1VBE2 3ZIXA 3OUIA 1JYCA 4GJZA 3JCIA 1QEXA 2B4KA 4UW5A 1OFSA 1NE6A 1NY71 4Q4V3 3WG1A 2Z69A 3I2FA 4N8MA 5J7MA 1RUE2 2ZBJA 1VRH1 4LBQB 5KC6A 1A34A 3POYA 4LITA 4PF5A 1UY1A 1C4RA 1FOD3 2GU9A 4DEQA 4E4DX 2FDKA 4LO7A 2VO5A 1JI6A 1TME1 3FUQA 4PBOA 3TEXA 3H1MA 1SQ4A 2YFUA 1N1TA 1W0NA 1AF9A 3FFQA 5T5PA 4CZSA 3U10A 3B93A 2WNUC 1IQDC 1T6GC 1W2NA 3IAPA 3CL1A 3P3NA 3MGUA 2RDSA 2W47A 3LEMA 1WUVA 3KGLA 4NHKA 5CYYA 4M4PA 2BERA 4XHBA 2WQ8A 4HFSA 4AHXA 3NV3A 4IEVA 1PZ9A 2R072 5I0UA 5BNPB 3AKRA 3K4ZA 2ZACA 2D6OX 2J1TA 3LZZA 3J8F3 4JGYA 1A8MA 1UQXA 1KFUL 2E51A 2XKPA 1SLLA 4MO3M 3O1OA 2ID4A 4M3CF 1S55A 4WM8C 3RGBA 4RHV3 3V0BB 4B3NA 1OOPC 3WT3A 2RJLA 5HXMA 1ENRA 4YW4A 1TVGA 2PELA 1CZSA 5GZFA 3SCFA 1ZA7A 3EXUA 4CCLA 1SCSA 3ZYFA 2D3RA 4RGAA 4DNYA 2HH9A 4JKMA 3K3OA 2WS93 1JN2P 1YYNA 2E31A 1MVEA 2BOIA 4NHYA 4P9YA 1D2QA 2VMGA 3OG2A 5DDJ3 1VBB3 1DQ5A 3TOJA 3VBUB 5IVVA 2LUWA 2O1QA 5HBAA 3KV5A 5A7NA 4NROA 1YNAA 3OGVA 4I01A 5FZ9A 1ZZ6A 1AHSA 5FZBA 1WD3A 3HNYM 2XHNA 3NQHA 1OA3A 1I5PA 3JB8A 3PJQA 2VR4A 5FY8A 4FBFA 4YPJA 3T0DA 4QAWA 4O9EA 4NMIA 2G4IA 4BIOA 2BNNA 1QJU3 3VBRC 1PIV1 4BM8A 3ZMOA 4P5YA 5C9AC 4LA3A 3SKVA 1HQWA 2A3XA 1YQ8A 2QVSB 4AHYA 2P37A 4K40A 1AR82 4K3UA 5DZFA 4X6QB 1MS8A 1BVP1 3A23A 3VBFB 1QJX1 1UMIA 4B1LA 5GZCA 3KB5A 4XCAA 2WNUA 5IVCA 1V6LA 3LFIA 1POV0 2D3PA 4JRLA 3ATGA 1IS6A 2VH9A 1NT0A 1K3IA 5BNOC 3KM5A 2XUEA 4QXKA 2WYSA 2JWPA 3RMYA 3LFMA 4KWKA 4E27A 2XKOA 1KDMA 3ZPYA 3RZKA 4HKWA 2DUPA 3AVSA 4BWOA 3WCRA 1S2KA 4AGRA 2AYHA 2OKXA 5GZDA 3J7MA 5D1IA 1KXGA 1OF3A 1MS9A 4LK7A 1LOAA 3LCPA 4WM8A 5BUVA 1L7LA 3P3PA 5JXJA 1OOPA 4GMP3 3QH6A 3OEBA 4LBJA 5FK7A 4JGZB 2WLPA 4D6SA 2VW0A 1HB1A 1C8M2 2WN2A 1JODA 3SCGA 3IWZA 4AHZA 4F83A 1YRZA 3NW4A 1S0FA 5C5UA 3HOBA 4GH4C 1RUD3 1YHFA 1UF2C 3DYPA 1Y3TA 2W91A 3DPRC 5DUXA 3UKTA 1OBNA 3MHZA 2RVAA 4XUNA 3WW2A 1LULA 2WLQA 3C7OA 3NV2A 1NQDA 1AL21 1RVF1 3MICA 5SV5A 5FZIA 3V0AB 4QQ2A 1QOSA 5F2WA 1K12A 3USUB 2PLV1 3E5XA 5FMBA 3VBRA 5C9AA 2D6LX 1DQ6A 1VALA 2P3KA 2A70A 3VBOB 3NAPC 5F5QA 1LCLA 1BBT3 3FBYA 3IBMA 2TNFA 1IS5A 2A6VA 4AXOA 5FY7A 4CDQC 3E5UA 5FQ0B 4IE5A 4BISA 2IXLA 3P5BA 3R05A 2BPA2 3QOPA 5J37A 2LM3A 1ZNPA 1OLRA 2FQPA 3LIGA 1UU6A 4MVTA 3SITA 4CXYA 4JDMA 4DIQA 4IGPA 1OQDA 1BZWA 4IEWA 4HL0A 1UZZA 5BNOA 2W0XA 5L9VA 4Q0SA 3WW1A 4FAGA 1N3OA 4MGIE 1KQRA 2WFF2 3AMNA 1WLCA 3ZPOA 2Z2SB 1MS0A 1NAEA 2VTXJ 1Q8SA 4BXFA 4DO0A 1KJLA 5FPAA 3B9CA 1RJ7A 1ND2C 2G1MA 1YJLA 1Q8PA 1FNYA 3EHKA 1QXRA 3PU3A 4LHNA 4LNVA 1A78A 4DEVA 1ND3C 2AREA 5B2GB 1MZ5A 2DVDA 1YUDA 4M01A 4ZS3A 5FP4A 5HCFA 4PQQA 1F4HA 2WA4A 2ZCWA 1ZBA1 1SBDA 2ARAA 2PHFA 2K46A 3AFKA 4HMZA 3VD5A 4OUMA 4AFBA 1V6OA 4YVWC 1UYPA 4I0WB 1I5ZA 2VU9A 5F5AA 4M3CA 2W5FA 4GH4A 1WKYA 2P1BA 2C9KA 2VBDA 3DPRA 1ZREA 4MUVA 1IG0A 2EXKA 1PO12 1C5HA 2A3WA 2VUAA 3DGTA 5FYBA 4Y20B 1LEMA 5A6ZA 4A7KA 2BVBA 5LY1A 3NL1A 1EUTA 1FMD2 2Y60A 1Z7S3 4XJWA 5CG9A 1PVC3 2R1BA 1EYBA 2RS32 3GZEA 4ZONA 1V6MA 3WNNA 4N7IA 2Y0IA 1L3JA 4GQ7A 4EROA 3UV9A 5F3EA 4DINB 5FO9B 3NAPA 4Q0UA 1JYIA 1XNKA 1AX1A 2WZR3 2Z79A 3WCSA 3O1SA 1V00A 4AGGA 5A32B 4QQLA 1S0CA 2ZZQA 1CR7A 1D0GA 1HKDA 5FZCA 4CDQA 2B46X 5I0RA 3VLBB 3OUJA 1MZFA 3OEAA 2CDPA 4FXKB 4OMCA 5FZOB 4MGTA 1KDKA 3OPTA 5HV0A 1WA4A 2Q1FA 1KRIA 2XGXA 3M1HA 2GDFA 2JDPA 5L7OB 3WQ7A 1O4TA 1T2XA 3THTA 1RL3A 3OTFA 2JDZA 4FPOB 4PLNA 1AX0A 1R091 5GLUA 2YGMA 2R062 4IEXA 4IERA 1LAJA 3RYKA 2UU8A 5F3IA 5IK5A 5CNAA 1ZBE1 3WD5A 1JYVA 1DYOA 1DGLA 4FFGA 3RQ0A 3W9AA 2C1FA 2Y6GA 5CFDB 2P17A 3HVDA 5K0UB 1ND2A 1FXZA 5LRRA 5C4WB 4XETA 2X53S 4Y1ZA 4IL7A 2HWE1 4HLTA 3MW2A 5FP7A 1ND3A 1KS5A 1YI7A 2WUHA 1N1YA 1AYN1 4UW4A 4V2VA 3GXUA 2OUHA 3SH5A 2G19A 1OKQA 1HB3A 1XNDA 3CU7A 4FPKA 4YVWA 4ZS2A 1COV1 2PHWA 5FAXA 4DRVA 5LEKA 3K46A 1QJY3 3WNLA 2JD4A 3BPZA 5KXBA 1A3KA 1LB2A 2C9AA 3GGLA 3PNAA 1G86A 2XL9A 3DV8A 5BNPC 4Q1RA 3KQRA 1SPPA 4FTBA 4CP2A 2BFUS 2HBTA 4QDRA 4CEWB 4O65A 2VCMA 1NY72 4LOSA 3H42B 1H0BA 5F7UA 4YGCA 5APAA 1CJDA 2VZVA 3LQCA 3BB6A 3POIA 3DXTA 4S2HA 1LU1A 2QDRA 2RG4A 4XXAA 4D6RA 1VRH2 4NRMA 5FXZA 4AEJA 2ET7A 3FLTA 3BTZA 2VBPA 3FN9A 1W90A 1TME2 4FSJA 2Q1MA 3ETPA 4HVRA 5DZEA 1WW4A 4ARXA 5JMOA 4XF4A 3RNSA 3DCQA 2Y6KA 3G6JB 2GP5A 4AQ2A 3WOGA 4OULA 1BK0A 1YFUA 2XWBB 2GAUA 1LHVA 4FFHA 2YBKA 1OMIA 1RHI3 2R30A 3VBUC 3OD4A 1SLAA 3A22A 5JXIA 1JBCA 1W99A 2AZ5A 2OVUA 2WDBA 4XDOA 5FYZA 3SCHA 2NYYA 3TYJA 2ZABA 3MW3A 4O61A 5FZHA 2JG9B 1UOFA 2VOWA 1W2OA 1SG3A 3WDVA 4CDXB 5EZWA 2N7GA 4OQ8A 4LBQA 3PHMA 3OJBA 3CF6E 3IDCB 1FYUA 2O0OA 1W39A 3WUDA 1JXNA 2VAUA 4LA2A 4XAAA 4Y26A 1IQAA 1GQPA 4BQXA 5IVBA 4ORFA 3CEWA 3ACGA 4NHLA 2C6SA 1IS4A 3KF3A 1JYNA 2G9ZA 2RR11 2VMHA 1TMF3 1NA1B 3I2DA 4I02A 3VBFC 2NLRA 1D0HA 2DCYA 4UI9L 4YM1A 3ZXKA 1W8HA 2HWD1 1RUH1 2HYXA 2W1QA 4J1WA 4L9BA 1AUYA 3HWJA 1W6OB 1HW5A 3OB8A 2BGCA 5T54A 4WVZA 3SHRA 1NLRA 4CU8A 5FMOL 1MQTB 3RZGA 3BODA 4NIAA 2A5ZA 2V5DA 3D6EA 5BNPA 1US3A 5IVEA 1AR71 3OCPA 4R9DA 3PUAA 4UFHA 2O14A 1W9FA 2UY9A 3WF3A 2VUCA 3LPFA 1AJOA 4GWMA 3CNAA 3VB9A 3VHOA 3K4DA 3V0BA 5FPUA 1JZ3A 1FV3A 1XU2A 4RGGA 2V73A 1BYHA 4ARYA 1PIV2 3C7HA 2NPIA 3B69A 4JGZC 4B4QA 4AVCA 1OH3A 2J1EA 1RUI2 1VBD1 3OYWB 2P6HA 3WQ1A 4IGQA 2XMLA 4N9HA 4HZFA 1GQHA 3VD3A 1OH4A 2WKKA 4D69A 5DAPA 2FDGA 3B01A 1HV1A 1BHGA 3H0OA 1JZ8A 1NLSA 1QJX2 2E7TA 4LO6B 2IFWA 1O91A 1UX6A 5FYMA 2QQWA 2JENA 3VBUA 1FV2A 2EIBA 3IAQA 4XHXA 3UL2A 2UYAA 4OI4A 2IVIB 4E4HA 1SHWB 3H1WA 1MEC1 4B8EA 5GLTA 1ZZ7A 2IXIA 5A6QA 1BEV3 3FHQA 3TWIA 3N4MA 1OSGA 3T3YA 2X29A 4MXWB 2PQSA 4AK3A 2JB4A 5BY5A 3GJAA 3VBOC 4YFWA 1H2LA 5C71A 2Y0OA 4ZXEA 4PJYA 2CU5A 1H2MA 2RV9A 5EV7A 5DAVA 1RINA 2X05A 4B4RA 1J3PA 2WINB 1S0GA 5FXVA 3ETQA 3RWNA 4KBZA 1GZWB 2MPFA 3IDEA 3VBFA 2WABA 2KD7A 2GC3A 1WW5A 5J1XA 1I9RA 1WW6A 4LR4A 3CKHA 3U11A 1WMEA 1OLME 3BOWA 3PTRB 4M4RA 4E4SA 4URTA 4XF0A 1PVXA 4XDPA 4D6QA 2FHRA 2RMU1 1PK6B 2W87A 5ACA1 1KGYA 1UX7A 1FATA 1XU1A 4OUSA 3ST7A 2MHFA 4BQ5A 4JHZA 1PX3A 1NZCA 4H14A 2A1XA 5FUIA 1KITA 3C7EA 4IE4A 1AL22 1RVF2 2YC2A 1VMJA 2DTYA 1U0AA 3T1LA 4GA9A 4COYA 1PM4A 2PLV2 3AZXA 3LF7A 2VULA 5D8AB 5FYYA 1UZYA 1W2UA 2W2IA 2PAEA 2PN5A 1C3HA 1AXKA 1UXZA 3AVRA 4JGZA 5F3CA 2ZGMA 3D0SA 4FVVA 3KMHA 5JZGC 3RYPA 5FWJA 3I2IA 1JUHA 3ACIA 4PLMA 2IWGB 1R1A3 3R0RA 2E7AA 2NMNA 2MEV1 2VZ1A 1ULOA 5C6CA 2FMYA 2OT7A 1OQ1A 3GBGA 3VZKA 2CGNA 4XFFA 3QCWA 1UYXA 1DLCA 2XR4A 1J59A 4CVUA 5IVYA 5IATA 1R1ZA 4DPNA 4QPGB 4X8NA 3V0AA 1IPJA 1US2A 4LOTA 3USUA 1ALYA 1Q56A 3AZWA 1BKZA 1QMJA 2RS11 3VBOA 1IKPA 1MZEA 4LORA 5FPBA 5JR7B 1V9U3 1XYNA 4XILA 4XMIA 3WNMA 2VGDA 4R52A 2JIGA 4Z8BA 1VLNA 1GQGA 1W03A 4XJ9A 5FQ0A 3RSJA 4XFCA 1FAYA 4Y1UA 1QF3A 1WBFA 1ZBA2 4Q4Y3 2ARCA 2C5DA 4QHOA 1JYTA 2ZGLA 3DN7A 3G7DA 1NCRB 1YFXA 3ILFA 4HN0A 4R4XA 1RUG1 3AMQA 1UZVA 2ENRA 5L7OC 4TYSA 1SFNA 3VDDB 1ZRFA 1Z78A 3OUHA 2VMFA 2OPWA 1UY4A 1HRI3 4DFSA 2VCCA 2D98A 2FMDA 4LMFA 4LUKA 3BU7A 3AKPA 3I97A 5CFDC 1CAUB 2VMEA 5C4WC 3MI8A 4XOGA 1W0PA 1L7RA 2ET1A 4LLOA 3S6PA 1X33A 1YWKA 4HSLA 1PMJX 4EN0A 2GALA 2WWUA 4UFJA 2VD7A 1GNZA 2ES3A 3BU0A 5FWEA 4CCDA 5JZGA 1FPN3 2PYTA 2I2SA 1NZIA 1AYM1 4AW7A 3WZ1A 3H3UA 2IFRA 4AYUA 3ZFFB 2VMCA 1AR93 3LKJA 4EZHA 1LHOA 3KQ4B 3U78A 1MS1A 3AC0A 5GJ6A 1PZ7A 5LATA 3AMMA 2XBO3 3THPA 4Y20A 4CEWC 3AL5A 4RGKA 4JQRA 1R092 4LBQD 5FYVA 1SLIA 4EN7B 1MS4A 1V6NA 4PBPA 3IZOA 4L0PA 4CEYB 5CISA 4BOWA 4CCKA 4Q0VA 1ZBE2 1TQ5A 2DCKA 3OD0A 5F37A 1UOJA 3ZDVA 3TBDA 2VW1A 3JU9A 2Y6LA 5LA0A 2HWE2 5A32A 1VJ2A 4FPYA 4OHXA 2DYCA 5IW0A 1AYN2 1TZOA 1OFNA 1XNTA 4TLGA 2A6YA 5FZOA 4AEDB 4XFHA 2JKXA 3UYJA 5FO8B 1GZTA 3UJQA 4F8AA 5GKAC 1COV2 2O8QA 1MACA 3OY8B 3CO2A 5L7OA 2AENA 1ULCA 3I2JA 5H9QA 2WIIB 2ZGOA 2HWB1 4NPMA 2WT2A 2JG9C 4PQ9A 1OA4A 1VMFA 4I0AA 4TXWA 4UW6A 5A7OA 3NRUA 1UPIA 3MLLA 4M00A 4MADA 3ZYPA 3UKNA 5DAQA 4CDXC 5EIYB 1OT5A 2TBVA 3EBRA 1VBA1 2YMZA 3AYCA 1R081 4K6BA 1PGW1 5T55A 1RMU1 1K5MB 4YZ3A 4LEJA 1HXS1 4GKXA 5FTTC 3NO8A 5CFDA 3WNOA 2XVGA 4WZFA 3M4FA 1RUF1 5C4WA 1PO23 4M0HA 4OHWA 1CQ9A 1ZRIA 4MGYE 3S5QA 2BWCA 1NA1C 5F9TA 2YU2A 2VZPA 2GNDA 2D5FA 4P9WA 3ZXLA 2D5HA 3KV9A 5C70A 2YDEA 2FZ2A 4DXTA 1D4M1 1EAH3 4Q4W1 2VL4A 1SMVA 1APNA 3ITQA 2NP0A 2XJVA 4AI9A 2D97A 1MQTC 3JD73 3WP6A 3VDCA 2E33A 1IKQA 1IOAA 3N36A 3JBG3 4CEWA 1SCRA 3JQWA 1LOFC 1DZQA 2DUOA 1QU0A 4FTSA 1OD5A 5I8TA 5HCAA 3PVOA 1ODMA 4Q4X2 2ZGTA 1T6BX 4A6OA 3B00A 2PXJA 4ASMB 2VNOA 4HK8A 3I59B 1NLQA 4OI1A 3RYRA 5LRSA 2ORXA 3GHNA 4Q29A 3VKOA 3O1RA 3TAYA 3CLPA 3T0BA 4FQZA 3ABZA 4Y1XA 2HWF3 3N9PA 5GLVA 1ZA4A 4IEYA 4IV3B 2RR12 1CZTA 4PI2A 4MGZE 1XQNA 2YBSA 3KLSA 3I3DA 2ZXQA 3MLKA 4PIXA 2HWD2 1RUH2 4YW2A 3OF1A 3WDXA 4ISRA 4GWJA 3FHAA 4MYEA 1H8VA 4LULA 5J09A 2E63A 3N7KA 4AQSA 4C8DA 4EJRA 1PNFA 2JG9A 1GANA 3ZYBA 1EP0A 2X10A 4CDXA 1F9KA 1AL0G 1GFF2 1TEIA 2RM21 1H4HA 1LHWA 2YPDA 1AR72 5C3RA 2IXHA 4Y3OA 1A6CA 4A44A 4BYYA 2ZAHA 2I74A 4LXLA 1VBC1 3HMYA 2Y8KA 4Y4YA 1YFWA 2W95A 1PZ8A 2QQIA 3AP6A 5I8SA 5L9RA 4DQAA 5JAXA 5L19A 1NA1A 3DKWA 2VOTA 2BFUL 5A3UA 2Y6JA 1O4YA 1VBD2 2W92A 4JVAA 4ZHNA 1UZWA 1GYKA 1W6OA 3IIAA 4RD7A 5IHRA 4UXAA 3RZZA 2VQTA 3HJRA 1N47A 2XDVA 1EV13 1MQTA 1PK6C 1YQCA 1IG3A 5DN2A 5F32A 1IHMA 1RUNA 1DIWA 3J7LA 1MEC2 5A7WB 4MGSA 1LOFA 1W8NA 4YVSB 1H8TB 4OYUA 3K4AA 3DKQA 4IETA 4K1YA 3WG3A 2GMEA 2VTXA 2XLFA 4AFMA 3AKTA 2DBNA 2RS51 2ZX4A 3AXDA 4NIGA 1UKGA 5I8YA 5D8AC 2CAVA 4GALA 4GWIA 1SLCA 1W8ZA 3RZJA 4JHTA 1JTZX 2BW8A 2IXCA 2ZMNA 1XYPA 3OYWA 4QPWA 2GNTA 2WR9A 1JZ4A 1V0AA 4Y1VA 3AZVA 1QHDA 2GC2A 2QQVA 2YBPA 3ME2A 4CUGA 4I09A 4U36A 4C90A 4NIIA 1N3QA 3VZOA 2VUJA 2LW8A 1QGLA 1S0EA 2XG3A 2ZOEB 3H8RA 3GM8A 4D8MA 3WR0A 2WN3A 2JIJA
chains in the Genus database with same CATH topology
4ES8A 4UBHA 1VBE3 3AJYA 2RMU2 3LAGA 1WD4A 4QPGC 1RUI1 5ACA2 3TN91 2B45X 3KT1A 4MXWA 5EYYA 1RUE3 3V64A 4HT1T 1DF0A 4MZUA 3USSA 1HDKA 1ULGA 2XJSA 4FAHA 4CP1A 4UBGA 1KS4A 4COVA 4Y22B 2HEYF 4EV0A 3DF0A 1AZDA 3AP9A 5CG8A 1J3QA 1QKQA 1GZWA 1Q43A 1BXHA 3MIDA 3MPBA 5FFOC 4K8FA 4Q0PA 3M70A 3AM2A 5H9RA 1NCRC 4KG8A 1DG6A 1DDLA 2TUNA 2WZPP 1RUC1 2ZTNA 1U5IA 2UWBA 3VDDC 2MEV2 3MFAA 1EPZA 4FPGA 4JRAA 5HI0A 4FTEA 1PK6A 2NQYA 3KZ4C 3O7OA 1ASJ1 3MIFA 1AXYA 2R073 4YRDA 1LGCA 3BTAA 3A0KA 1BJQA 2KXLA 5IK4A 5IUQA 4AF9A 4YYOA 1LR5A 1ULFA 5J96B 5D8AA 2QQPA 4LBOA 1ZVFA 3ZSKA 4A2UA 2RS12 4AI1A 1DZTA 2PHUA 1NE4A 2KM2A 5GALA 2WSVA 4Q26A 3E6BA 4LE3A 5E88A 2NP0A 3FFZA 5IT6A 1DQ0A 3VL9A 4AVVA 1AR61 3ZFFC 3OGGA 3HR9A 4XXPA 5IK7A 5AC91 1RUG2 1QOOA 4KNCA 3SH3A 3O0WA 2JECA 4BIFA 5I91A 1VAVA 3ZMNA 2GMPA 5A33B 4SBVA 1CIWA 3A4UA 4QPGA 3MIGA 1DBNA 2CGOA 4CEYC 4CYDA 2PHXA 5FBZA 5FCCA 3ZXGA 3ZYGA 1DGWA 2EAKA 1QOTA 2QCSB 1Z0HA 2HWC1 3VGIA 1LKNA 1OHFA 5JOXA 4W6YA 3N7MA 4QD2A 3WV6A 4L97A 1AR83 2X5IB 4AEDC 1V6IA 1QQP2 4Q27A 2QZ2A 1NCRA 4D3WA 5DUUA 4YM3A 1AYM2 3VDDA 4I30A 5T5OA 2OPKA 4WM7B 2ARXA 3S0MA 1RTVA 3I54A 4WV8A 4AVAA 2V09A 3ZXDA 1BMV1 3C3VA 4XFGA 1ZYBA 5E89A 1UD1A 1K5MC 2D93A 4GB31 1CAUA 3ROUA 2R49A 4JTNA 3B9IA 3HAGA 4QM9A 4XJAA 3J4UH 3TB0A 2NN8A 4AQTA 1W6MB 2B8MA 5JVVA 3S30A 4AFAA 5J3UA 5K9YA 4QU2A 3KCCA 1LOEA 4RS5B 1C8M3 3VV1A 1IGOA 1G8WA 2CGPA 3SH4A 4GULA 3AYAA 3VKMA 3ZFFA 2VECA 3N7LA 5H9PA 3ZN6A 4Q8KA 4FT8A 2JEMA 4YARA 4XYXA 1H4GA 3I8TA 3T1MA 2HWB2 4OLLA 5KHGA 1GLHA 2DCZA 4RFT0 1F31A 2B39A 2JE7A 4I3PA 4CEYA 2DU0A 5L73A 1VBA2 5JSRA 1R082 2DU1A 1PGW2 2BUKA 4YM2A 1RMU2 2YGLA 1HXS2 2WFPA 1DYPA 1RUF2 4JDOA 3GZTB 5FLJA 4FOWA 2Y38A 4IV3C 1S0JA 3AP4A 1H9WA 3HBZA 4QMAA 4NOTA 4AEDA 4BQ1A 1SLBA 4I0BA 3N7JA 3RI9A 3OY8A 1D4M2 5DG2A 1C8NA 1O4ZA 4FOVA 4Q4W2 2A73B 3WP3A 3VHPA 1NOVA 1HQNA 2H6BA 2BVVA 3GNEA 2ZHMA 2WFF3 3DL3A 1F8VA 1K5MA 2RJKA 2ZZJA 3IM0A 4XTMA 4AE2A 1N3PA 4XFIA 2VVFA 1MS5A 2WC2A 2ZGUA 1CPMA 2EALA 3ZVXA 2Q30A 1U5ZA 4QPIB 4LTAA 1O3RA 1CX4A 2R041 4XDQA 1XE8A 4YW5A 2GZWA 4QQOA 1RUJ1 4FPHA 5FDBA 3E6DA 2QJVA 2QNKA 5T5JA 4Q4V1 2P34A 3WDTA 2X8KA 4XFAA 5DUWA 3D0JA 3ZSEA 4KU7A 1FOD1 5JLVA 1PO13 3ZFEB 5L36A 1OQEA 2DVBA 4YVSC 1H8TC 1QH6A 2AR6A 2ARBA 4EWEA 3D8CA 4D7SA 1FMD3 3AYEA 4XEZA 3WX5A 2RM22 2RS33 3MFCA 1IZ3A 1WLDA 2OZJA 2R0FA 1VBC2 3LSEA 2DUQA 4XMAA 3AX4A 3U4XA 1REFA 4Q0QA 5LK5A 1XYOA 4HANA 2D44A 4IV3A 1IS3A 1LU2A 2HEWF 4KGGA 4Q2FA 5GM0A 3M7AA 1F2NA 2CYFA 5DG1A 5FPXA 3O5SA 3ACLA 3J8F1 4Q4X1 2Z5WA 4HVQA 4QT6A 4RHV1 2IXJA 3KCYA 3PVNA 2LALA 4Z92B 2R063 2WT0A 2DF7A 4WVWA 2XL7A 1POV3 1Q8VA 3KS7A 2WS91 5DDJ1 2RS52 1VBB1 1DGRA 3A0NA 3FHIB 4HN1A 3FX3A 1ONAA 4D7TA 2DCTA 1CAVB 1H9PA 4AEKA 1SBFA 3RJ2X 1CONA 3ZO0B 1V6JA 4IESA 1Y9QA 3KD4A 4PIZA 1LEDA 2ZS6B 3E5QA 4LLFA 5J36A 5JI7A 1QJU1 4XF3A 4BH9A 1NQJA 2ZGPA 1UAIA 3OGJA 3RRDA 4N90A 1J1LA 4OI0A 2K2SA 2PHTA 4MLOA 5FRAA 1QXJA 4FPEA 1QDOA 4YVSA 1DGWX 3FE5A 1H8TA 4P9GA 3TN92 4U2AA 1G6NA 3PMEA 3M2MA 4WZCA 3AP5A 4EWDA 3JQXA 4WVVA 1VRH3 3WHTA 1OPOA 2VOKA 2IC1A 3L9JT 4JDNA 1CAWB 4AQ6A 4F7ZA 3W59A 4N9IA 1TME3 5I0TA 3WDUA 1PNGA 4MH0E 4EN8B 1XNBA 1YIFA 5HCBA 1RUC2 4DB5A 1GICA 1W0OA 1CN1A 2H0VA 4BHPA 4LT5A 1ASJ2 3GYDA 2VOVA 3AJZA 2JXAA 4FOYA 5JIAA 3IKWA 2DFCA 1XE7A 1RUD1 4Y22A 2BNMA 3SMHA 4ZU5A 2XVLA 2X5IC 4TLFA 4P9JA 4BZ4A 2WNEA 1J58A 1H1AA 4N53B 1O5LA 4CTEA 4XBLA 4QGMA 2XB6C 1BVVA 2F4PA 5GLWA 4AFCA 1AR62 2WNUB 1JH5A 4WM7C 2QKDA 1C1LA 4V1PA 4ATEA 4P9IA 4META 4HK9A 5AC92 1BBT1 3J26N 3MIHA 5E8AA 2G9FA 1LECA 3SLIA 4DXZA 3HN1A 3R6SA 1GZCA 3ZN4A 2A71A 4XFBA 1U5YA 1QNYA 2A3YA 1UPSA 2IZWA 2Q4SA 1PIV3 4ATFA 2BNOA 2HWC2 4DY3A 2GN7A 4RR3B 4N43B 2E6VA 1RUI3 2ETEA 1O7FA 4DS0A 2XUMA 4YG6A 1QJX3 4PLOA 1U12A 4A3XA 4JCKA 3QACA 1URXA 1E57A 4L11A 1QY4A 2R16A 5A33A 3MF9A 4W6XA 1MVQA 5JSPA 3B7MA 2VXRA 4IEZA 3ES1A 1DQ1A 1UN1A 1BMV2 3S7IA 1DU3D 4PDWB 4YGEA 5AVPA 1HX6A 2ZX2A 3QLQA 4NO4A 3AMHA 4GB32 1DZRA 4HKLA 5FPZA 3EO6A 1FNZA 4OFGA 1O3QA 2AUYA 2CV6A 2R1DA 2GNMA 4R4ZA 5BNNB 2X5IA 5AFEA 1I1EA 4ZKTB 1RC6A 3VKNA 1CD3G 3M3CA 1QDCA 1MR5A 2XH6A 1PVC1 1UU4A 3ECQA 3PVBB 4J1XA 1Y43B 4WM7A 1LGBA 5K0UC 4S2FA 3J9SA 3B5LB 2YV8A 3WINE 3LB9A 2WZR1 3VZNA 2ATFA 1RUOA 1GR3A 1WW7A 1ZZCA 5FREA 1QQP1 1AL23 1RVF3 2H6CA 3AXEA 4QPIC 1W6MA 5CAZA 1BK1A 1LOGA 2PLV3 1C5IA 1AX2A 4NR1A 4YGBA 3WHUA 5LEJA 1JOJA 1YI9A 4QQHA 1X7NA 5BYNA 3INAA 4GMP0 5EWSA 4CP0A 1OPMA 2K0GA 1UCXA 2CWSA 2PAMA 5HXVA 1V70A 4IEQA 3O0XA 4A7YA 3ZFEC 3LWCA 1ULEA 4QQPA 1WGPA 2NZ9A 2OA2A 3TNPB 3H8UA 5KWRA 2JG8B 3MEPA 1G9DA 1A8DA 2A75A 5KXCA 3M3EA 3POSA 5E1RA 1XRUA 5JOWA 1QJY1 3UJOA 4NN0A 2R042 4RQPB 1YXWA 3HD8B 1WLWA 2YPJA 4C91A 1Q3EA 1RUJ2 3RPQA 4E2QA 2YXSA 2K9ZA 3VBHB 1H1IA 1ZBA3 4CDQB 3M3QA 3WW4A 4Q4V2 4P5HA 1SACA 4XW3A 2GC0A 5T3NA 5GZGA 5K0UA 1FOD2 3ZN5A 2YUEA 1LOBA 5FLIA 4E4ZA 2W08A 3H7JA 2XVKA 3L2YA 4QPIA 5T50A 3AMPA 1RHI1 1WCDJ 3N35A 3B02A 3HQXA 4I2OA 4G3YC 4AI2A 4QGLA 3SXWA 1CJPA 2PFWA 4NWVA 4K9SA 1VAKA 1SBEA 2BYVE 4LO5B 4DRRA 4W65A 4YVWB 3JB4C 4Q8LA 2R6QA 3MF6A 4LO8A 1H30A 3WNXA 2ZX0A 3J8F2 4QPYA 4ZU7A 4L8QA 3KSCA 4IEUA 3ZFGB 1G9FA 3ZFEA 1F5JA 4RHV2 4IEPA 2ZAAA 1TNRA 2GMMA 3TRSB 4KH9A 3VZMA 1TMF1 2WA3A 2BBVA 1IPKA 1R093 3ZYRA 4HVOA 1KD7A 4R9AA 2UWAA 5CVRA 1ZBE3 2WS92 3ZYJB 2VVEA 2ZMLA 1NCQB 5DDJ2 1VBB2 5EFUA 3ZSJA 2HWE3 2YZ4A 3L2HA 2E7QA 3FBMA 4Y5Z0 2ZKLA 1AYN3 3WLUA 1TNFA 1COV3 2WT1A 3MIEA 1NXD1 4P14A 1QJU2 3VBSB 4M3CE 4WVMB 3U0ZA 4PCRA 3ZXEA 4XIOA 2YYOA 1HV0A 2WQ4A 5KHHA 3WXPA 3WY6A 3BOPA 3FJSA 4HETA 4WBBA 4MX3A 1LJ7A 4CRQA 3FZ3A 3M3IA 4LBMA 1CAVA 3AZZA 4D7YA 4G9SB 1WLTA 4OVEA 3RS6A 2QZ3A 1DHKB 1VP6A 4N53C 1BEV1 4XF1A 4XIKA 4AVBA 3HT1A 3APBA 3VHNA 4ZU4A 4X8PA 2DTWA 3EJKA 4FPJA 3M8LA 3SNMA 4S2GA 4YZ1A 1NXMA 4Z2WA 2XPJA 1EY2A 4FPLA 1G7YA 3AYDA 1H2KA 1PGSA 2OW4A 1GZ9A 1D2SA 3LA2A 2R0HA 2ZMKA 4H55A 4Q4X3 3JUUA 4LHLA 4BMBA 4RR3C 4XQ4A 4N43C 1CAWA 1RUD2 3PVEA 4L2NA 3RDIA 1EPWA 1SLTA 5ABJB 1WCKA 2RR13 1H2NA 4EN6B 4R9CA 4XZPA 1LTEA 2HWD3 3W58A 1RUH3 3WP4A 1U5XA 4RL7A 3C2UA 4BCUA 3Q9OA 2ILMA 4E9KA 3AP7A 2CY6A 3V65A 2Z42A 5IK5A 5CA6A 4PDWC 1BBT2 3FC0A 3WW3A 4AHWA 2PTMA 2D40A 5KC5A 1AR73 1R1A1 3RMXA 1REDA 3NV1A 4XPVA 3URFA 1N1VA 4D94A 2RHPA 4KL1A 3D5OA 2YC0A 5GZEA 5BNNC 3NJZA 2QE3A 4FP3A 2LTNA 4QGNA 1VBD3 1H1MA 4N53A 1DFQA 5JI9A 1UKRA 2Q5TA 4IV1B 5F1RA 3ZSLA 4H3WA 5C8CB 4AI8A 3LGRA 2VNGA 3IN9A 4X6RB 1AJKA 3ALQA 3ZDSA 2TEPA 5KXEA 1V9U1 3H50A 1MEC3 1FT9A 4AEMA 5CB7A 4C1XA 3FUOA 3ZXAC 2D6PA 5KBFA 4Q4Y1 1ZRDA 2AH2A 4PIYA 3R4DB 4KWLA 4JV4A 2DURA 4RR3A 4N43A 4S2DA 2WNVB 2JKBA 1HRI1 4LBKA 3PTYA 4E2GA 2C0ZA 3S7EA 1UW8A 2DVFA 1Q8QA 1HRV1 5JPMB 1JHNA 4YNIA 3NSTA 4AI0A 1Z7S2 3VUOA 3MYXA 1PVC2 4NVPA 4YZ2A 4L92A 4ASLA 2HKXA 3E6CC 2RMU3 2XJTA 2P2KA 4PDWA 1W6NB 5ACA3 2WZR2 5DUVA 2JG8C 5KXDA 4B4PA 4AI3A 1GSLA 3H9AA 3TNQA 2OYZA 1FPN1 4ZXKA 4DZGA 4P9LA 3T2TA 2QDNA 4FP2A 1XNCA 4BLJA 1W6QB 4RQPC 1AR91 2XWJB 4HPKB 3H7YA 4I3GA 5BNNA 1CAXB 3VZJA 4BMEA 4BLIA 2F6BA 1ENXA 2MNGA 2XBO1 3VBHC 5F6LB 2ZX1A 4TSVA 1KJRA 5EYXA 3WG4A 4EWAA 4H7LA 4OHYA 3MDPA 3ASIA 5JCTA 2W52A 1F5FA 2UWCA 5J98B 2SBAA 1CESA 2MEV3 2B9UA 3CJIB 4BE3A 4LO4B 5CADA 3PMSA 5CBLA 2ZGSA 4LHKA 4XBQA 4P9XA 4XF9A 1V6KA 5T52A 4FOQA 1PGL1 3HT2A 1XXNA 2AGSA 1DLLA 4CDWB 2RS13 3V56A 1ZM1A 1QJY2 4CDUB 2VNRA 1W6PB 4GXLA 1QXPA 2EA7A 3QBQA 5JZGB 2XLAA 4IQPA 1QJZA 1S0IA 1N1SA 1X50A 4FO9A 3ZFGC 1PO21 1RUG3 1ENQA 2DVAA 1LODA 1JW6A 3NKTA 3R4UA 4YSFA 4EN9B 2G9GA 2GH2A 4R8HA 2JE9A 2JG8A 1JUIA 2PA7A 1B09A 4HBNA 3FLRA 1I3HA 1EAH1 4OI2A 4YZ4A 1VAMA 1YCIA 1NCQC 2ZX3A 1RHI2 4RQPA 1GKBA 4GIQA 2ZGKA 3JD71 5EJ3A 3O12A 3U07A 3GBWA 2OIIA 3K51A 3JBG1 2DVGA 1YJKA 3K48A 4IXLA 1DQ2A 1S0BA 3VBHA 5FOBB 4LUMA 1QQP3 3IPVB 2GNBA 4OZXA 4FCAA 1DYKA 2EXIA 2GC1A 3QD6A 4M0NA 1AYM3 4YW3A 3VBSC 3NWKA 3NVCA 4ONUA 4DMIA 3B94A 1LGNA 3IMNA 1S1AA 4Z07A 1VB2A 2HWF1 4MXVA 4C1WA 3FWEA 2XJUA 1TMF2 4TWTA 5BXXA 4QM8A 2A6WA 5FO7B 1MZ6A 1SEFA 2HYKA 1YFYA 1ZRRA 5A3LA 2EIGA 1LOCA 2UYBA 2VQAA 2D3SA 2PHDA 3GHMA 1REEA 2D6NA 2OUJA 1S0DA 2HJIA 1I6XA 4R9BA 2WL1A 4HSJA 3LA7A 4B7KA 3KCXA 4K7JA 2IXKA 4AGVA 5K7PA 4L99A 2P3JA 3ZFGA 1MS3A 4YLZA 3LOBA 5A3MA 4XQDA 4LBLA 1J1TA 3I59A 4KU8A 4C0BA 1ZX5A 2D6MA 2HWB3 3B3QE 4JC1A 4NPRA 3IT8A 2VOXA 1LENA 3I7DA 1ZZ9A 1DQ4A 1VBA3 4YW1A 1R083 2A6ZA 4OHVA 2B5HA 1O3SA 3BIWE 1RMU3 5F6KA 1HXS3 4W6WA 4COWA 3FMGA 1NCQA 2WQZC 3H3ZA 1EV11 1RUF3 1G9AA 5ABJC 1PMIA 4F3JA 4XQWA 3VKLA 2XJRA 2JICA 3WP5A 3I4IA 5CFCB 1NG0A 1OI6A 2VG9A 3AKQA 2BQPA 2BTVC 1B35B 1KFXL 1O3TA 3ELNA 1BEV2 2HEVF 3KT7A 1D4M3 1UL9A 4DY5A 4Q4W3 3VBSA 1PHMA 4WVMA 4YG3A 1LESA 2B42B 4JAAA 3GF6A 1C28A 3POWA 2YROA 4GKYA 5SV8A 2CAUA 4YFZA 2VMIA 2XLGA 1G9BA 1FI2A 1SDWA 2QUOA 1BQPA 5KHKA 4Y24A 5FLHA 1SFYA 3AKSA 2QFEA 2A6XA 1VBE1 4ES9A 3ZXFA 1GV9A 2D43A 3WQ0A 4IV1C 2RE9A 1RUE1 2YHJA 1OLQA 5C8CC 4YGDA 2I45A 5JOYA 4JGYB 5T5LA 5DZGA 2CL2A 5BNQA 4Y1YA 1NYWA 2FZ1A 1Q5OA 2UY8A 1AXZA 4B7EA 5AVAA 4JTOA 1LRHA 2RM23 4AWDA 2ZJCA 1RJ8A 3FLPA 3RG0A 1R1A2 2EAAA 2XJQA 2D7FA 1VBC3 2WNVC 3PJYA 4AVSA 5ABJA 5BPXA 1QH7A 4RSUA 2GSYA 4GMP1 3O0VA 3ILNA 3IDBB 2R071 2ZA9A 2VY0A 5JSOA 3VN4A 1OA2A 1X8MA 3OBRA 5KHIA 2JX9A 4OHZA 5CU1A 1WMFA 5JOZA 1YLLA 4KG0A 4YG0A 1V9U2 1Y7BA 1C57A 3LA3A 5TSWA 1ZRCA 1X82A 4N7UA 4B29A 2UURA 4Q4Y2 2B7YA 2RS53 3E97A 1UMZA 3GZUC 2O8OA 4MV2A 2VPVA 4Q1PA 2ERFA 5C33A 3VL8A 1HRI2 4MSVA 4IV1A 2PHRA 5C8WA 1RB8G 1UU5A 1VR3A 3WVJA 5C8CA 2WWSA 2XHKA 1HRV2 1BCXA 2DV9A 3CJIC 2Q1ZB 3DUIA 5LK7B 2KA3A 1LHUA 1GNHA 3AZYA 4WM8B 1VIWB 5I0SA 1OOPB 4XBNA 3SISA 4RS5C 1AR81 1UIKA 1VB4A 4NHMA 3TN93 1S2BA 3LOIA 3AB0A 1FPN2 4CDWC 4TZDA 5JIUA 1M06G 2PHLA 1CPNA 2WNVA 1AR92 4CDUC 2P3IA 3ZYIB 2VVDA 2BEOA 2XJPA 2EXHA 1M4WA 2DCJA 2XBO2 4NWWA 4E2SA 3NV4A 5K8SA 2EF6A 5GLZA 5AFBA 2GH8A 3WUCA 2H0BA 4KWJA 2YY1A 1RITA 1RUC3 2EVXA 4HKOA 3VZLA 2FBEA 3UK9A 3ENRA 2W68A 3OBTA 2NM1A 4XJ8A 3VBRB 1W6NA 4QHBA 5C9AB 1ASJ3 1C8M1 4A7ZA 1YO8A 4KBBA 5E16A 3WDYA 2BWAA 4FXGB 1LHNA 2WJSA 3UKVA 2OZ6A 1W6QA 1PGL2 2WSUA 3BCWA 4HPKA 1HLCA 1Z7S1 1CAXA 4H7MA 1J3RA 2I07B 3R4SA 2PAKA 2CTVA 3ZXJA 5BNOB 3D82A 1YIPA 2SLIA 1AR63 5JWPA 1G9CA 1Q8OA 3CJIA 1WMDA 5AC93 1PO22 1ZZ8A 3D4KA 3HIFA 3QH7A 4C0HA 3KGZA 2Q8OA