1J59A

Catabolite gene activator protein (cap)/dna complex + adenosine-3',5'-cyclic-monophosphate
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
199
structure length
199
Chain Sequence
PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*AP*AP*AP*GP*TP*GP*TP*GP*AP*C)-3'
publication title Structure of the CAP-DNA complex at 2.5 angstroms resolution: a complete picture of the protein-DNA interface.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
total genus 53
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1j59A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1j59A01
4EGZA 1LVAA 2DQLA 1J7KA 1Q5OA 2R7FA 2DTRA 2IXKA 2WV0A 4OINF 3R0AA 4BXUA 2V9VA 3CUQA 4MUVA 4PIXA 1IXCA 3BCWA 4Q0QA 1H0MA 1BIBA 2OQRA 4FX4A 2HEOA 2PQQA 2XGXA 1U5TC 4GYIA 1R7JA 3O3KA 2HYFA 1DGRA 3NQOA 3HT1A 2Z3YA 2VBYA 3CLOA 3IKVA 1YS7A 4OU0A 4LMYA 4QM8A 4WF2A 4XFAA 1MKMA 1QNTA 5FDBA 1U78A 1QPMA 4LULA 3HRTA 3SZPA 2DPUA 2VODA 1IRFA 4MGZE 3H1WA 1REPC 4HQEA 1U8RA 4CZZA 1UB9A 1NYWA 5ERIA 3R6SA 3HIFA 3L2HA 3VB2A 4RB3C 1R1VA 1J3QA 3WW1A 5IT9K 1E17A 5HDNA 3PQJA 5HDKA 4MEYF 2A61A 2MNGA 2IA1A 3KP4A 2BV6A 1OI6A 1FNNA 2CW0F 2J5OA 2IXHA 4XFFA 3RKXA 2E1NA 4FT8A 4QMAA 4ZYGA 1QGPA 1QXRA 3EO6A 1YFXA 5K5QA 1QO0D 1ODDA 1XN7A 2HTSA 3LAPA 2J5PA 2HGCA 5KBFA 3JAMK 4AIKA 1EH8A 4XF4A 4EWDA 3F8BA 3O6BB 2MPFA 2VN2A 3QP6A 2D1VA 3ABUA 3ZMUA 3WGGA 2FBHA 5DCMA 5F6FA 3O2PE 3I59B 2HFHA 2V79A 4HA8A 2STTA 2OAZA 2VT3A 1OMIA 4I2OA 3LAJA 1FI2A 3KP2A 5ICGA 3EDPA 5H20A 3H7YA 3GX4X 3CTAA 1OPCA 5ILSA 3H3UA 5J7MA 2MH9A 4HF1A 2XRNA 1UW8A 3PNAA 1Q43A 2HWVA 4L9NA 3QPHA 3RPUA 2N7GA 3F6VA 2RV8A 2HR3A 2ADUA 4IERA 4KL1A 1FBSA 2LF7A 1OFNA 3U1DA 3WTVC 1B59A 4OOIA 1XDUA 2PAKA 3IDBB 4QGLA 4L0YB 2EV6A 1J5YA 4RAYA 4ZU5A 4KT5C 4OIPF 1CAWB 4HBLA 3UKNA 3HYIA 2QLZA 3SQNA 1ZRDA 2KIUA 1H9GA 2IC1A 2DQRA 2GIVA 4ENKA 1YW8A 2AXLA 1ZZ6A 4LA2A 3FJSA 4ESFA 4ZU7A 4P55A 1CAVB 5L3BA 5HS7A 2OU2A 2P6SA 3MPBA 5E1WA 4HV5A 3F72A 3VFZA 2QBYA 3LA3A 3V8KA 4WVZA 4I98B 4LB5A 2RGVA 5I0SA 5I0TA 3IDCB 1S8NA 4XEZA 2G7UA 3E3VA 2CAUA 2EB7A 1MZBA 2KIMA 1HKSA 4YIIA 2PAEA 2VBZA 1HBXG 2YX7A 1XGMA 4WXHA 3S0MA 4TV7A 4KN7X 2GAUA 4PGGA 3LWCA 4MQ9F 1FSEA 4A5NA 4YIFA 2Q2EA 3WW4A 3RPQA 4NHJA 4P9FA 4MEXF 4KFCA 2A6HF 2X0LA 2XIGA 1Q3EA 4LA3A 5I91A 3Q5FA 1KQ0A 3J80Z 3RKWA 5LHIA 1F4KA 1H9TA 3BPZA 4G6DA 3T5XA 3V4GA 3U0ZA 4A6DA 4ZYEA 3IIAA 4N9IA 1BC8C 1G6NA 2OD5A 1DGWA 2ETEA 4EV0A 4KIGA 1J3PA 3Q9SA 1B1BA 2ZXJA 1HKQA 2JSCA 3B73A 5DUIA 3CJNA 3W6KB 3T0YA 2PJPA 1S7AA 2OBPA 3HSFA 4MGKE 3QPTA 3KEQA 2ZO4A 4IESA 1FY7A 2PYTA 5K8SA 4CO8A 4LGWA 3IBMA 5L3DA 4OIRF 3OF1A 1YW7A 1IUYA 5CVIA 1I5ZA 4YSFA 3JSOA 5D6FA 1LDJA 1O5LA 2VPVA 2JPBA 5FQ0A 2VECA 3HTSB 2G9WA 2KJBA 4O9GA 4QGNA 3F6OA 3QU3A 2Q0AA 4RB0A 1OYYA 2VT2A 3OD0A 2FQPA 5BS6A 3M9AA 3FXRA 2QNKA 1FP1D 2JZYA 3WW2A 1W4MA 3I4PA 1K7AA 2YU3A 2M5WA 4PZJA 2EA2A 3BJ6A 3RYPA 2BNMA 1H1IA 5E18F 4R8HA 4RGSA 2O03A 1BC7C 1YIOA 2XAFA 2RVCA 1R5GA 1MD0A 5K1YA 3DV8A 4XFGA 3T1BA 2BNNA 5CYVA 2V6CA 2LDUA 3N97A 2Z5UA 1SMTA 5D5UB 1R00A 4ZYHA 1Q1HA 3C3VA 4L9TA 2FQ3A 2F5EA 2UWMA 4WX9A 3FMQA 2JRTA 2IPQX 2FU4A 4O9EA 5FLIA 3GVAA 2RDPA 3KE2A 3DL3A 2EFOA 2MD5A 1FBUA 3B02A 1AWCA 2EJRA 3NRVA 1XSDA 1TLHB 1T38A 2JPCA 2K02A 2ZNZA 3RTRA 1SD4A 4KICA 2WWYA 3UKVA 4F8AA 2HQNA 1LKNA 1VJ2A 1ZX5A 2PHLA 5LEJA 4HBNA 5JFRA 1O57A 4KU8A 4GCVA 3TDUC 4MGYE 4BHCA 2GC1A 2W57A 1GQHA 3SHFA 3HRUA 2PG4A 1O3TA 4BAYA 1KQ8A 2PFWA 1RZ4A 3J81K 4O5VA 1P4AA 2LNBA 1D8JA 2HJIA 4ZYDA 3L9FA 1FYLA 1U5TA 1QZYA 2QUFA 4IRGA 1NE6A 2IVMA 4P96A 3EHKA 4JBAA 3U2RA 4N9HA 2DPDA 1FP2A 1R23A 4X6RB 1J9IA 3TGNA 5D4RA 2IXIA 3FXUA 5ICFA 3SZTA 4EJWA 2FSWA 1S3JA 1IPKA 1S7OA 3QAHA 2VE8A 3T8TA 4S04A 1J1LA 2KXLA 3HQXA 3GO5A 3GYHX 3LZZA 4CYDA 5JSPA 4AVPA 2UXXA 3HOTA 1IRGA 2CV6A 1DPRA 2CGPA 3JZVA 1U2WA 2F5CA 3JW4A 2XKOA 4KMUX 1A04A 2TDXA 1SFEA 3DPTA 1E2XA 1J0RA 1YFHA 4IEQA 3OCPA 1F9NA 4EVIA 1X82A 2LSOA 2ELHA 3MWMA 3FM5A 3LWFA 3S2WA 1GHCA 3ERED 4UV8A 3MCZA 2W84A 5DCFA 1VR3A 3ULQB 4UXAA 3WGIA 2VBWA 5E8IA 1I1SA 4BH9A 1NXMA 2PLYA 4I7HA 5I93A 4JTNA 1KU7A 2O1QA 4IEVA 1XRUA 3FX3A 5JI6A 5KHIA 1ZN2A 2VOOA 2ET1A 1GVJA 1LEBA 3SCGA 2KRFA 2IP2A 3WE2A 2IXLA 2L4AA 4RGXA 2Q4SA 1Y9QA 1ZG3A 4EWAA 2L4MA 2BNOA 1KYZA 1YLFA 3D0JA 1QXJA 2L02A 3D5LA 5HVQC 1P4WA 4HZFA 3ISPA 4ENNA 1LNWA 1RL3A 3G7DA 3LA2A 3LSTA 2MA3A 4D7TA 3DPLC 3KP3A 5FD5A 3KP5A 2NRAC 1XMAA 3R60A 2UY8A 3KGLA 4QWQA 4DQ2A 1PP8F 2EWNA 3I54A 1ZHFA 5E1ZB 1WSUA 3BWGA 2OZJA 4RB2C 3NL1A 5FPXA 2ZJ2A 1X7NA 3ECHA 3L7WA 5JSRA 4UBHA 1CAXA 3C18A 2M45A 5JHUA 5CVUA 3JTGA 1Z9CA 2K4JA 3NEUA 2PMHA 5E1RA 2YPRA 2NNYA 4RGRA 1QWRA 4JK1X 2CQKA 4I0AA 3GYDA 2Y75A 4BQAA 2QVSB 2D40A 2D45A 3KLOA 3U11A 1RTVA 2EA4A 4JV4A 1USSA 4H0EA 3F3XA 1T39A 1BI3A 1ZARA 3EQLF 4LFUA 1F5TA 4LK1F 3EETA 1UFMA 5E20A 4EROA 5LEKA 2XHKA 5H6RA 3FHZA 3RYKA 2RNJA 1TW2A 3FXQA 2V1DA 3IWFA 4ZZLA 4EM1A 2PBIA 3L2CA 1O3SA 5J48A 2GC2A 4HSLA 2GA1A 4IEPA 1ZZBA 4HW0A 2FF4A 1GQGA 2WTEA 2Z9OA 2W24A 2LKPA 4CHUA 2XROA 5T3NA 1CAWA 4IJAA 4L5JA 1DUXC 1KU9A 1YFUA 4XFBA 4KWKA 2RN7A 3WG9A 4XFIA 1IAWA 3RNSA 3FZ3A 2B0LA 1ZRRA 3WTXC 3RKYA 1T6SA 1JXSA 1NE4A 3E5UA 3VOEA 3HHGA 2VBXA 4UVCA 5HS9A 1DP7P 3HOSA 3M3IA 1U3EM 4I02A 1SMYF 3NVCA 4Q48A 1ZZ7A 1JGSA 5LRRA 4MV2A 2P7CB 4RGUA 2K9ZA 1Z6TA 2P4WA 1UCRA 3KCCA 1X8MA 3EQEA 3GFLA 4E2SA 4CXFA 3MZYA 5I8TA 1HQCA 5E17F 1U6GA 1J2XA 4UVBA 5DYMA 2PEXA 1QBJA 1F1ZA 1IN7A 2ETHA 1SQ4A 4U7DA 2ZFWA 2XLGA 1P2FA 1XCBA 2PTMA 1LDKB 2Q30A 2C0ZA 3E5QA 2DCTA 2OA4A 1OR7A 5FB2A 5J6XA 4Z07A 4PDKA 4YG2F 4P9UA 1T0FA 3K1NA 5BPDA 2EVXA 4O3MA 5HS8A 1PUEE 2E7XA 5AIPA 4UUVA 4G7OF 3ZMTA 4IEWA 2IXJA 3ZMSA 3LA7A 3H92A 1JE8A 1VTNC 3CUOA 5LRSA 1YFWA 5JVTA 5JR7B 4D7SA 2K4BA 3GF2A 3ZMZA 3WE3A 5DDGA 4AVAA 4LLGF 4YARA 1WA4A 5AVPA 3ROUA 1EP0A 3EYYA 3GWZA 3QP5A 4UHTA 2XAHA 1D8KA 2H6BA 4UXNA 4IHSA 4Z2YA 2DU9A 1DZRA 4HX4A 4AQ2A 2UZKA 4YFNF 3CUQB 2M8EA 4XF0A 3V8JA 2A5YB 4G94A 1V3FA 5HLGA 4KUMA 4R79A 4XSXF 2FRHA 2MLKA 4HMZA 5KHJA 1TQ5A 3V7SA 2ZMEB 3KMHA 3QU6A 5CVVA 4AWXB 1IW7F 1L3LA 4XSZF 3KZZA 1YW9A 3BROA 4KMFA 4ZU4A 1FYMA 4YFKF 4Q29A 5FLXZ 2D5FA 4WZCA 1KU3A 2PN6A 1ZREA 3EJKA 2ZNYA 2EFNA 2D2WA 2W25A 4CICA 2A3SA 3H50A 1HXDA 1CF7B 2L3DA 3R4KA 1XCVA 4U0YA 1P6RA 2RC4A 2ISYA 4ONUA 1YQAA 4HV6A 4EM0B 4PGHA 2A69F 2ACJA 3QRFF 3BY6A 3SXWA 3D0SA 2CG4A 2XL9A 2P17A 1FSHA 4HDUA 3CJXA 4HDVA 3ZN0A 3LQQA 4WBBA 3UKTA 5A2QZ 5EFUA 1ULYA 2XV4S 1T2KA 1B9MA 2HQRA 2IW5A 2DAOA 5ICEA 3F22A 5L3GA 3BZ6A 1UIKA 2OQGA 5KHGA 3ZMVA 4BYYA 4FX0A 4HLTA 3DKWA 2P5KA 3IHUA 3H1YA 1TQMA 5ILVA 2DW4A 3FM3A 2FBKA 2FMYA 1WQ2A 4JQFA 1BJAA 3NSTA 3F8CA 4JVAA 2BGCA 2HTJA 5DCMB 3J80K 1FXZA 4YRDA 2XAJA 4Q0UA 3MFKA 4XFHA 5BPIA 4HX8A 4KN4X 4MQVA 3ML6A 2YSRA 3IC7A 3BJOA 3K9TA 4AQ6A 1FLIA 3K2ZA 3ZN1A 4KYWA 3OOPA 4EWEA 4A2UA 4M74A 3TO6A 5LGUA 1W7PD 4KWLA 1BIAA 1J75A 1HW2A 3KSCA 2DI3A 3H8UA 1B4AA 1TTYA 2YX4A 4QX5A 4AIHA 5D5VB 5L3FA 5C8WA 2F5DA 4Y17A 3TO7A 3WTWC 4PIYA 1JHHA 1ZLJA 3HRSA 4BHPA 1XB4A 2GWRA 5BQTA 4MTEA 5HI0A 2NYXA 2P5LC 1G3YA 2VQAA 1XSXA 4I0BA 3GZ6A 2FMLA 6PAXA 2QQBA 2O8QA 2V1UA 2M1BA 3FWEA 3CDHA 2OZUA 1IN4A 3MZHA 3M7GA 5BUVA 3E6CC 1LQ1A 2PQ8A 1AOYA 3ELKA 1HW5A 3QOPA 2BE5F 2K27A 1LDDA 2QBYB 2D1HA 1Z05A 1V4RA 3DN7A 3E6MA 2OYZA 1FPQA 2IA0A 1SEFA 4JTOA 3RYRA 1S29A 1FOKA 3SCFA 2ET7A 1R58A 4Q47A 2Y48A 1EYBA 1SD7A 1MDMB 2HDCA 5I0RA 1O4TA 3LFKA 5BMZA 5FCCA 3ST7A 4HVQA 5E16A 2XAGA 5LLQA 2UYBA 2STWA 2EK5A 4HAMA 2R3SA 3WGHA 2PA7A 1RC6A 1OD5A 4K2EA 2QJVA 2V09A 4HYEA 2P8TA 4MH0E 1ZYRF 3BB6A 1ONVA 1G3WA 1RI7A 2JTVA 1ON2A 4MHGA 4HSJA 2BBYA 2KIFA 3CLPA 3K1PA 5LGNA 1CAUA 3O14A 4XBFA 3H3ZA 4UBGA 2XVCA 5J8FA 1UPIA 1EY2A 4N0BA 3EBRA 1OYWA 3GXOA 3PFIA 4O6JA 1O5UA 3U10A 1IXRC 3BPVA 1DPUA 4PJYA 1W5SA 2WC2A 2E9QA 1IPJA 4NVPA 1TNTA 1IF1A 5JSOA 1FT9A 2QVOA 3TOBA 4LB6B 4H7LA 3M70A 3FZVA 4UVAA 3DF8A 5TRDA 1ZLKA 2HZTA 3WTTC 2A6EF 2H6CA 5D1IA 1R5HA 1PP7U 4FAHA 1O3RA 1JUHA 2L54A 1XD7A 1WI9A 3HSRA 4M73A 3IWZA 3I58A 5H6QA 1HKTA 2B9UA 4IEOA 4HVOA 1K78B 1I27A 3FMRA 2GH2A 2UYAA 5D8KB 5K5RA 4HF0A 3BOQA 1RUNA 2Q0OA 3M1EA 1ZGAA 2PAMA 4R52A 3K0LA 3PVBB 4GYGA 5FPZA 2P7VB 1TQPA 5FLJA 4XETA 3WODF 4G7HF 3S7EA 2RQPA 3KEOA 3R61A 3SMHA 3R0JA 1YHFA 4RAZA 4LLOA 1OYIA 2CYYA 3MQ0A 1C0WA 2X4HA 1SFUA 3WU0A 1LB2A 2CFXA 2ZBKA 4M71A 1WRJA 4A5MA 1KYWA 3F8FA 3OV8A 1KU2A 1TNSA 2O6GE 1R22A 1R1UA 2C6YA 1YUDA 3BDDA 1XGNA 1EH7A 3GZ5A 4E2GA 3HUGA 4EJUA 1G4DA 2DK8A 2PI0A 1BI0A 1W5TA 2A68F 3H1MA 2XKPA 5FFXA 1R36A 5CADA 5I8SA 1ZZ8A 3USSA 4G7ZF 4OMYA 1Z6RA 1FWZA 4BNCA 2EV5A 4F7ZA 5KVRA 1MJBA 2IT0A 3V8LA 1HW1A 2H94A 2M30A 1QY4A 4L0ZB 5FO5A 3KP6A 1U12A 1RNLA 3FF5A 5FLHA 5F1RA 2B5HA 4Y15A 2BYVE 4GXOA 2MH2A 2EFPA 2GA2A 1U5TB 2P5VA 5FD6A 2Z33A 1LJ9A 3U9GA 4J1WA 4YNIA 1TQIA 1ZGJA 3I59A 3CEWA 1LR5A 5KHKA 1WWXA 2Z69A 4Q0PA 3L09A 4ZZDA 3E5XA 1QQIA 4Q5SF 2EFQA 4A0YA 4MNUA 1DDNA 3RIRA 3FFQA 3I64A 2COMA 1XGOA 3AAFA 4GO1A 4Z82A 5DV5A 4QXKA 1SD5A 2AS5F 1W7PB 2FEZA 2EFWA 3G73A 5D6EA 2FNPA 5I8YA 3F8MA 3KZYA 4MGRA 2H09A 1MJ9A 2QM3A 3WTZA 1D3YA 5BOXA 3WU1B 5BV6A 1X8EA 2XLFA 4QLCU 5L3CA 4U0VA 2H0VA 1DZTA 3IL2A 2HS5A 1IN8A 1B9NA 3K1MA 1Y0UA 4L9JA 4KIFA 3OTFA 3VHRA 3I0TA 1EH6A 2ZMEA 2PMUA 3T8RA 3JSPA 4LD5A 5AIQA 1UIJA 2O8XA 5IT9Z 2R7DA 1CAVA 2DK5A 1YFYA 2ATFA 1BN5A 1BBYA 3BU7A 4IRIA 2RKHA 3KGZA 3TQNA 2XLAA 5HLHA 2IXCA 3NKTA 1CF7A 2MC3A 3HSEA 2VOPA 4LLNA 3SXYA 4G8XA 5DEQA 2K0GA 2NAZA 3P9IA 2MLGA 2PHDA 4IXAA 1KA8A 1NHAA 1YYVA 3DFGA 1P4XA 1G3SA 3JAMZ 2XASA 3P9CA 4S05A 5HDGA 5BPXA 4GGGA 1YWKA 2GC3A 5CU1A 3ZQ7A 3GFIA 2MHFA 3BJAA 1FZPB 4ASNA 4IEXA 2D93A 2XUBA 1ZZCA 2GZWA 3S7IA 1P92A 2QQAA 4EJVA 1EV7A 1Y3TA 1WKMA 3COAC 4KDPA 4P5OA 1ZZ9A 1R1TA 3J7AO 3ES1A 4LG0B 4DNCA 2W85A 3JTHA 3RJPA 1X3UA 3REOA 4DINB 1CAXB 1FYKA 2O3FA 1YO5C 1YLLA 4HF2A 1QZZA 5E1XA 3M8EA 1SAXA 3IRRA 2PFBA 3ABTA 3SCHA 3EYIA 4ESBA 3DQVC 4L2NA 4J1XA 3PLQA 3GFJA 4LUMA 2GXGA 2QENA 1ZRFA 3NW4A 3MYXA 4XFCA 4AXOA 3PQKA 4OIOF 5D4SA 4XF1A 1H1MA 2OZ6A 5ED4A 1O7LA 4ESJA 3ACLA 5J3UA 4ZH4F 1J58A 3OGJA 4X6QB 4CGZA 4XF9A 3W6JB 3HRMA 4IHTA 4IETA 1B6AA 1XGSA 4MX3A 2F4PA 2GQQA 3P9KA 2ISZA 2DFIA 4EMSA 5JAXA 4Q4ZF 3C7JA 3ZDSA 3NJZA 1PDNC 4YFXF 4FAGA 1RUOA 4I09A 4IPAA 2HYGD 5EEHA 4L11A 1XSVA 4AD9A 4PCQA 2OPKA 5FLXK 3D82A 2KJCA 4IEZA 4HN1A 2HKOA 4CDGA 4XLPF 1VP6A 3FE5A 1XE7A 4HLXA 4HOBA 3P7NA 3C1DA 3CUQC 2O61A 1STZA 4Q0VA 3I53A 1J59A 2CSOA 2Y0OA 1RIOH 4QGMA 1MDMA 4MTDA 2QWWA 4ORFA 1L0OC 4WXDA 4P9GA 4IEYA 5IT3A 5C6CA 4HX7A 3E97A 2BEOA 4HLYA 1XDSA 4U88A 4IRHA 2GXBA 5A2QK 5AONA 4EJOA 4LUKA 1UHMA 4Q0SA 3ZPLA 4UNOA 3BP8A 1HSJA 5ILUA 2ZCWA 3CO6C 4B29A 2ESNA 4U7BA 3GBFA 1FBQA 3HT2A 4NQWA 4RD7A 5EEGA 4XF3A 3N4MA 1JHFA 1CGPA 4UV9A 4PIZA 1GXPA 3M8FA 4FBFA 3F23A 4AVCA 4M72A 2FE3A 2VONA 3SHRA 1USTA 4AIJA 5EZWA 2XAQA 5FFZA 5D5XB 4XRFA 4D0PA 5D5WB 4MZUA 3H7JA 4HQMA 4I01A 3GEZA 2E7WA 5ICCA 4KU7A 2DO7A 4I3PA 3GUDA 4OLLA 3ZMDA 4YYOA 4EM2A 1J3RA 4E70A 3CO2A 5F64A 5BXXA 2EV0A 3DEUA 2IA2A 4AVBA 3Q9VA 3I7DA 5JR3A 3DXJF 2K7LA 4B8XA 5JCTA 1K78A 3GFMA 4WK8F 3TO9A 4B09A 5FGMA 5KK1A 2YR2A 2FXAA 4LJZF 4MGIE 2FOKA 4KIBA 1IXSB 4META 1ZAOA 1OKRA 3EUHA 4ENMA 2V1XA 1MGTA 1NZCA 4BHBA 2OA2A 3SFZA 1BI1A 4WXCA 3MAJA 5DUKA 1PM7A 3MEXA 4ON0A 3ETQA 3GW2A 3H9AA 5BY5A 4KA4A 5LHGA 4EJTA 1K6OA 3I71A 1MJAA 1WLTA 1SFXA 4Y13A 5CVJA 4GULA 2QZ8A 1LEAA 1BOAA 4TLFA 3WW3A 2GU9A 1YTYA 1UHWA 2FNAA 4BIFA 2DT5A 4E2QA 2I45A 3TOAA 5I0UA 2VC0A 1TW3A 2NNNA 3GLXA 2DBBA 2K86A 2NS0A 3RDIA 3IRQA 1UD1A 3C3WA 1XMKA 5TJJA 3K69A 4XLNF 4A0ZA 3BALA 3LAGA 4HN0A 2EAAA 2Q1ZB 3J81Z 3WTSC 1BI2A 3VODA 1FC3A 3ELNA 4WWCA 2QQ9A 4L9VA 2Y0MA 4A6EA 3HHHA 2QCSB 1BM9A 1I6XA 4M9XA 2LF8A 2B8MA 1SD6A 1Z1DA 1RGSA 3KP7A 5LHHA 1Z91A 1KGSA 4IF4A 5HOOA 1EPZA 3KFWX 2UY9A 5E8GA 4L5IA 5CJ9A 4KWJA 3QACA 5D8LB 1T98A 2M87A 2ZKZA 5CLSA 3L00A 3V7CA 1Z7UA 2F5FA 4EQQA 2DLLA 2Z99A 3ES4A 2UXNA 3KLNA 3VEPA 4A12A 1O3QA 1IN6A 1ZRCA 5FQ0B 2ZKLA 4M9ZA 4IEUA 2E1CA 3LQRA 3RZZA 1ZNPA 1ZG5A 2L01A 4G9YA 1LRHA 3ZP5A 1O7FA 1D5VA 5LGTA 3G3ZA 1W7PA 1K79A 2ESHA 2CO5A 3TDZC 4NB5A 3V7RA 5K5OA 3LOIA 4LTAA 3TNPB 2QYOA 4LK0F 1ON1A 3TNQA 3CO7C 4L18B 2FBIA 2O0YA 1IN5A 3TKYA 3WTYC 2Z2SB 2HOEA 4G6QA 3BPXA 4LLLA 3FHIB 4KNYA 3WTUC 4M6XA 5KHHA 3E6DA 3DP7A 4QM9A 1ZVFA 4OFGA 4K8FA 5J8CA 2H27A 2HKXA 5DD4A 1PMIA 3E6BA 1SFNA 1FX7A 1GXQA 2VC1A 4EGYA 4OMZA 2Q8KA 2WFPA 1IZ1A 3FMSA 2GC0A 3F8NA 4IVNA 1ZG1A 2JT1A 4ENJA 2D5HA 1I1GA 1YG2A 4FHTA 4WCGA 2QDRA 5L3EA 2P6TA 1L3JA 1WGPA 4A0XA 4RB1A 3MDPA 4RS8A 4M9SA 3CF6E 4M6YA 1CAUB 3IKTA 4LEJA 3KETA 4OIQF 1YS6A 5DD8A 4ETSA 5HLIA 1ZH5A 1G3TA 1UCXA 2MBFA 5CVRA 2F2EA 2CWEA 2FA5A 2IRFG 1HSTA 1TBXA 2XL7A 2G7HA 1XE8A 1V70A 3RI4A 3ECOA 4U0WA 4LG0A 2VXZA 3I5UA 4R1HA 3F21A 2CAVA 2KKOA 2IJLA 5LBQA 2VE9A 1KQ9A 1CX4A 4HVRA 2A07F 3CL1A 1S6LA 3HTUA 2EA7A
chains in the Genus database with same CATH superfamily
4N53B 4LO7A 5FOJB 2CGOA 1EV12 1ULEA 3HJEA 4XLHA 3VBFA 3R0AA 5DG2A 4BXUA 2ZSHB 2V9VA 4PIXA 4Q0QA 4BA6A 1H0MA 5F0HA 2HEOA 1MS1A 2PQQA 1HB3A 2LVSA 3O3KA 4OHXA 1SLTA 4P02B 4FTBA 3NQOA 2Z3YA 2VBYA 2QQ8A 3IKVA 1YS7A 4XCAA 4QM8A 5JUVA 3WF2A 4QQLA 2WINB 5FDBA 4LULA 2A75A 4CPBD 2VODA 2XBO2 2PLV1 4MGZE 1H8TA 2WAEA 2YUSA 4BQXA 3WP5A 3IDAA 1FPN1 1NYWA 1DQ1A 3HUGB 3VB2A 1J3QA 4F3JA 3BR5A 2ZGTA 1JW6A 1E17A 4IQPA 4PK4A 1W0PA 2VE1A 3CESA 3PQJA 1CVNA 4N53C 2ZGSA 3LEGA 4MEYF 1FX5A 3NV4A 1MS3A 1DQ5A 1QJU2 2DYSH 4KISA 2JEMA 1OI6A 1KDKA 1X1CA 4CA9A 2E19A 2LTNA 1K5JA 4PJJA 4ZZ5A 4QMAA 1H2LA 3BTAA 3EO6A 5FY5A 1RR7A 5AVAA 1XN7A 3VBHB 2HTSA 4DO0A 3BC8A 2DYRH 4YM1A 1W9YA 5HNHA 4XQ4A 1X3ZB 3FISA 1MNDA 1K4TA 4X8NA 2MPFA 5C3SA 2VC9A 1SFYA 2VN2A 2D1VA 3WGGA 1QJFA 5DCMA 2OW4A 1RUC2 2STTA 1I39A 2HFHA 2JA5J 1MQTA 2VZ1A 2XJSA 4AGRA 1QKQA 3R4SA 4X8PA 3BYWA 3LAJA 4Z6YA 5H20A 1DGRM 4XJWA 1E5SA 4K40A 3CTAA 4BQ5A 4HF1A 1G9AA 5CPRB 4BM8A 4FPGA 3QPHA 3TP3A 1CONA 2RV8A 2VBPA 2ADUA 1S4CA 4IERA 1G9DA 2WY7Q 1FBSA 1QXPA 2LF7A 1OFNA 3U1DA 1B59A 2PX9A 1HRI1 3WDVA 1LOFC 3IDBB 2R073 3VSLA 1EAH3 4CU8A 1JZ4A 4L0YB 4MGQA 3AKQA 4ZU5A 4OIPF 2XPWA 3LDBA 4ZTFA 1Y4WA 3HYIA 2Z5WA 2QLZA 3SQNA 2W2IA 4NPMA 3NJVA 2GP3A 4KBBA 1ZRDA 2BGPA 4RQPC 2JA2A 1NG0A 4ENKA 5KC5A 4GH4B 2AXLA 1ZZ6A 3FJSA 3U1XA 4ZU7A 4LOTA 2VULA 2P6SA 2DFCA 2BTVC 1D5YA 5A1LA 3U14A 1Y8QB 4HV5A 2QBYA 3LA3A 5L19A 4A42A 3HD8B 2WZEA 4XEZA 2G7UA 3E3VA 1OPOA 2YFUA 4IV1A 4WZFA 5K9YA 1S0FA 2PAEA 2VBZA 2YX7A 3AZWA 1ST8A 4A7YA 4KN7X 1R082 2Q2EA 4LKSA 3ZYFA 3ERMA 4NHJA 4MEXF 5F39A 3Q0VA 1D1CA 3IDEA 4YGDA 3O1RA 2A6HF 2XIGA 5I91A 4M0HA 2OPTA 3J8F3 1F4KA 3NNJA 4B4CA 3LNQA 4YZ1A 3PMEA 4G6DA 3T5XA 3V4GA 2VOVA 1VAKA 4GH4C 1OCRH 3O7OA 4AFCA 3WX5A 2WFF3 4RGGA 4IL6C 2OD5A 2V4VA 2ETEA 3O1TA 2NLRA 1HJGA 1NXD1 2R1BA 2M0MA 4KIGA 2GH8A 2Q1FA 5JDBA 2OV7A 5DUIA 4E7HA 3W6KB 3X29B 2PJPA 1AYM2 1HRV2 5L7OB 4BGDA 4Y1UA 1FY7A 3K4DA 4RS5B 3IBMA 3RI8A 2NZ9A 2E5NA 5JXHA 2J1RA 3O1SA 1LDJA 1SLLA 2JENA 1PGL2 2COBA 3RJ2X 4E7KA 1PYVA 1V6LA 3WQ1A 1S0JA 5EJZB 4QPYA 4A3JJ 2Q0AA 1YRNA 4RB0A 5JVGF 2EBIA 2VT2A 3OD0A 5BS6A 2ID3A 2J1EA 2JZYA 3K4MA 3LPGA 4PZJA 2EA2A 4GJZA 5FZAA 1VBE1 3T0AA 2MEV1 1H1IA 3L2RA 1RUI3 5JVVA 2EZIA 2RVCA 1TZLA 4DXTA 2A71A 3A23A 2VCMA 3T1BA 3L2WA 1B35A 2WS91 3WNPA 4FP3A 2OTJI 1OISA 5D5UB 1R00A 4ZYHA 2EIGA 2FQ3A 2F5EA 2RMU1 4IE6A 4WX9A 3FMQA 5FLIA 1SPPB 3GVAA 2RDPA 3KE2A 3DL3A 5DQ0A 2BU9A 1I1EA 2JJ7A 1FBUA 2WB1A 3WP6A 3C7EA 4UFKA 2WA4A 4AEDB 4GXLA 2VZSA 4R9CA 5IT6A 3CMMA 4F8AA 1VJ2A 4D9JA 1ZX5A 2W7NA 1F4AA 4K7JA 2UWBA 4HBNA 4LBNA 1N77A 2C6SA 4HFSA 2TBVA 4BHCA 4LO5B 4RHV1 2VBBA 1FAYA 3P1IA 3SHFA 3DKXA 2PG4A 4OQ9A 1JOBA 4GMP1 4BAYA 1LECA 3K70C 3TBDA 4NC6A 5FWJA 5FUNA 2W82A 3IH3A 2WABA 4B3XA 3J81K 2OQ6A 3O8GA 4GWMA 2HJIA 2Q8DA 2QUFA 1NE6A 1D0HA 2IVMA 4CXXA 5LCWL 5GTHC 1KFUL 2FDKA 3WDXA 3HDDA 1FMD1 2ID4A 2DPDA 4Z2AA 1RC9A 3HOBA 3DYMA 1TMF3 3FXUA 1A36A 3VYUB 3HG9A 4EJWA 4CCCA 5FUPA 3J9SA 3VBSB 5J1YA 5ACA2 2VE8A 4A7ZA 1XYOA 2YPJA 1ZQ3P 3NWKA 2UXXA 2CQNA 3LOBA 2E1MC 4A3FJ 4Q4Y2 3K4CA 1DPRA 4N53A 3JZVA 5B4NA 1U2WA 5DDJ2 1O4ZA 4KMUX 1A04A 1F5JA 4FPFA 3DPTA 1JYXA 1JKPC 1WLWA 5FJHA 3T4HB 2R93J 3CQZJ 2B45X 1X4PA 3AZZA 3FM5A 3LWFA 1GHCA 3OYKA 4UV8A 2ME6A 4LO6B 1JYVA 1OC1A 2K46A 2WBMA 5E8IA 3AKPA 5I93A 1DYOA 2YYOA 3Q8FA 1KU7A 2HVQA 1XRUA 3FX3A 5JI6A 3L1PA 5LFAA 4XR6A 2VOOA 2ET1A 4XABA 3VPRA 2DJNA 4J00A 2EZLA 3WE2A 2Q4SA 3VLBB 5BNPB 1Y9QA 4EWAA 2Q8EA 4CDUB 4PFOA 3NO8A 2XRLA 4DFSA 3D0JA 1QXJA 4HZFA 1LFBA 2JN6A 4XK4A 1BHGA 4XPVA 3DPLC 4DOUA 3UGHA 5FD5A 3KP5A 2NRAC 3R60A 2G1MA 2UY8A 1DGWX 1QVTA 4IV3C 4QWQA 1LOFA 1JTXA 2EWNA 4Q1RA 4Y1YA 1DGLA 3BWGA 3J26N 5FPXA 1B72B 5JSRA 1W39A 3VDCA 4U36A 4ZPIA 2EH3A 5DUVA 5JHUA 1JN2P 2R6QA 4RQPA 4Y26A 2DCKA 2PMHA 5E1RA 2YPRA 4RGRA 1QWRA 2BY0A 5BNPC 1WKYA 5EP9A 3K75B 2D40A 1TWAJ 3U11A 1RTVA 4XAEA 2EA4A 1ULPA 1USSA 4QPIC 4UFHA 2KL4A 1BI3A 4RM3A 1F5TA 3AP6A 1HB2A 3AMMA 1GZCA 2JDHA 4I76A 1D7PM 2XHKA 5H6RA 3FHZA 4KMQA 4II2A 1JS9A 3RYKA 2RNJA 1TW2A 2RR11 3N9PA 5HLTA 4FXGB 1ENSA 2HWF1 1LFUP 2DBNA 3KPHA 4EM1A 3L2CA 2VOKA 1O3SA 5J48A 1N47A 3N9LA 1VBB3 1ZZBA 1BOBA 4FQGA 3M1CA 3OR2C 2WTEA 3GNEA 3CQOA 1K5MC 2JB8A 2NP0A 2XROA 3PUQA 4L5JA 2QSGX 1DUXC 4QXHA 1MS4A 2KT0A 3FHNA 3B3QE 1HXS3 3CCRI 5FYMA 2VTXJ 1H89C 1ZRRA 4INDA 4GH4A 2A3XA 3GMEA 4NJ4A 1RKWA 4C0HA 1HJFA 4CEWB 3FLPA 1SMYF 1SCSA 4Q48A 1ZZ7A 2LP0A 3ACHA 2K9ZA 5JPMB 2GP5A 1ZBE2 3D3AA 1GNHA 3A1YA 2VO5A 4OCTA 2L9NA 4BWOA 2DCEA 3MZYA 1QDCA 5I8TA 1VBA1 3OYDA 5E17F 3INAA 5DYMA 3VKFC 1PK6C 2SLIA 1Z3XA 1QBJA 1F1ZA 1GV9A 1KGYA 4CYCB 4QHZA 3ZQGA 1SQ4A 4U7DA 2ZFWA 2XLGA 3WDTA 1X1DA 1YJNI 1XCBA 1XNBA 5FZEA 3POFA 3PHMA 1LDKB 1VQ6I 2Q30A 3E5QA 5HCFA 2CFOA 5FB2A 5J6XA 2PLV2 3VWBA 1S2KA 3HR9A 2D6OX 4O3MA 1MEC1 2GXAA 1FPN2 5FO8B 5K7FA 3HOZJ 4G7OF 4AGVA 3ZMTA 1MMSA 4X1EA 1OJLA 3NNFA 5SV8A 1QJX1 3CUOA 3IPVB 1YFWA 5JR7B 2K4BA 3ZMZA 3WDUA 3U07A 1CZSA 2NVTJ 4U87A 4M3DA 1EP0A 3EYYA 3QP5A 4M3CF 2P3IA 4Z2YA 5F8PA 4AFBA 5C3PA 5J3LA 4AQ2A 2UZKA 3FLTA 1WD3A 1OCPA 3CUQB 1LCLA 1Q8SA 3AYDA 1V3FA 4KUMA 2VNGA 4DPNA 4TSVA 2FRHA 2JQ7A 1OVPA 1TQ5A 3CU7A 1L3LA 1IW7F 4XSZF 2VNRA 2VTFA 3KZZA 3DCQA 1EJ9A 1H2KA 5IFTA 4CE8A 4XDOA 5DM7F 2BGOA 2ZNYA 4CICA 5FXZA 3ZFFB 2XH6A 1KS4A 3H50A 1HXDA 3AKZA 2B46X 3JQXA 3OY8B 1XU2A 1CF7B 3GALA 3VBUC 1XCVA 1GDTA 4PGHA 2A69F 3G2BA 2E2HJ 4ITVA 4JYKA 3BY6A 4P00B 3D0SA 4UF0B 2CG4A 2P17A 1MVEA 4HDUA 2K85A 2DT7B 1WI3A 3MFCA 5KXBA 2V9KA 1HRI2 2EAKA 1B8IA 3TMOA 1ULYA 1GNYA 3PVEA 3Q9OA 1B9MA 2QQLA 4KJZA 1S72I 5ICEA 1UIKA 5A33B 4AEDA 4FX0A 1U8BA 1TWGJ 4CP9A 5HXVA 1UF2C 2R7UA 2C1FA 4TLGA 5GZEA 4LIVA 3QPSA 4OUSA 1TME3 2CJJA 2P81A 1PHMA 1WQ2A 4MXWB 4JQFA 1BJAA 2ZGKA 1S0CA 3MICA 2XAJA 5HCBA 1JYWA 1ASJ1 4XFHA 3MFKA 4R9BA 5FKOA 1LHUA 1RUE1 1G9FA 2P0WA 3ZIWA 3IC7A 3BJOA 5L73A 1X3WB 4YLZA 1FLIA 3GZAA 5A1AA 3K2ZA 5FKLA 2O8KA 4M74A 3TO6A 2GNMA 2A70A 4KWLA 4NIAA 3OGSA 1TTYA 2WY8Q 2YX4A 2LREA 2O14A 5D5VB 2VQLA 4N8MA 5C8WA 1ND2B 2Y60A 2C4XA 4DRVA 4DS0A 1W90A 3DLLF 2GWRA 4BQWA 3AYEA 2NYXA 6PAXA 1RUG1 2O8QA 2V1UA 3FWEA 3I2JA 3CDHA 3ZIXA 4PJ0C 4A3KJ 4JQTA 2ZX3A 4Y1XA 2QDNA 5BUVA 1LQ1A 3ELKA 4BDYA 2K27A 4GRIA 1LDDA 1UOJA 4QKDA 1V4RA 1AJOA 2AQFA 2IA0A 4IV3A 4LBLA 2VM9A 1S0BA 4HPKB 5DZFA 2WNUC 2MC4A 2A6YA 3K2AA 4P1WA 3MLLA 1EYBA 2HDCA 1BQPA 1NCQC 4CRQA 5DUUA 3PIPF 3AP4A 2XAGA 5EZGA 2UYBA 2STWA 2EK5A 1IPSA 2R3SA 1M06G 2ZJCA 5BNPA 2PA7A 1OD5A 4XTMA 4RM2A 1OLQA 3QYFA 3AMQA 1QEXA 5LBBA 1VBE2 4DBRA 3LB9A 2MEV2 4AEKA 4QPIA 2LG4A 1ZYRF 1ONVA 3J7ZI 3ZM8A 4D6SA 3PNTA 1G3WA 1OLME 4R9DA 1RI7A 2JTVA 4MHGA 3FKJA 4NRQA 3CJIB 3DWLE 1SLCA 3K4NA 1CAUA 3PM1A 4RLFA 4UBGA 5J8FA 2WS92 4RDUA 4UYBA 1W0TA 3VZNA 1P8JA 4O6JA 4PJYA 1EV13 2E9QA 1IPJA 1OURA 1TNTA 4MXVA 3KV6A 2W87A 2RMU2 5JSOA 2C24A 3I97A 3SDBA 4UVAA 1K5MA 5CAZA 5F6LB 4WM8C 4QB2A 3ZQLA 3AFGA 2L54A 3HSRA 3IWZA 2E1OA 4HKWA 1EKEA 1HKTA 1FOWA 2B9UA 1W06A 3OUIA 3S57A 3FMRA 2GH2A 2XBO3 5KAIC 3BOQA 1RUNA 3SKJE 1COV1 4M3GA 2YC4A 5EJCA 2PAMA 4RHV2 1PX3A 4A3GJ 2WSVA 5F5IA 4UUTA 1RESA 2I07B 2P7VB 4ZJZA 5FPAA 5FZ6A 1TQPA 3WF3A 4XQDA 5LATA 3POIA 2RQPA 1C28A 1QJU3 4IE4A 1LU2A 4LLOA 5A3MA 1VZ0A 2QF7A 1R5ID 2CFXA 1FMD2 3IM0A 3OJBA 1WRJA 3MVPA 3VGIA 4AWDA 2KRCA 4N43B 5FYIA 1CR7A 1R22A 3PUBA 2C6YA 3MEPA 2DCYA 2K40A 2VL8A 3GZ5A 4E2GA 4Y24A 1G4DA 2R7TA 2R0QC 2DK8A 4IOAF 2WZ8A 2BWAA 5A3TA 5SV5A 5G05L 1RUC3 1R36A 5JZGB 3C2BA 3E7LA 2Y69H 4CH7A 3CDIA 1SEUA 3USSA 4ASMB 4JCKA 1Z6RA 1PMJX 2CQQA 2WZPP 2EV5A 4HK9A 5K7HA 5EPAA 2M8GX 2FHRA 4PF5A 3KHBA 2PHWA 4XBNA 3LQCA 4AFMA 2GNDA 5F1RA 5B5EC 4CYCA 2MH2A 2GA2A 2MD0A 5A6YA 1WJDA 3ILFA 4U2AA 2D6NA 1HDPA 3RPUD 4J1WA 4CDXB 3CCMI 3S8PA 5M3MJ 1LR5A 4LHKA 2DMTA 1A31A 4K1YA 3HBKA 4HL0A 4CSWA 4Q5SF 1GICA 3VKOA 1DDNA 3RIRA 1AZDA 2COMA 3X2QH 1DQ4A 3VBUA 2NS8A 3IPVA 4QXKA 1OQ1A 2AS5F 3KZYA 3GHMA 5FXXA 4MOAA 1T33A 3EMRA 3JRFA 2CW7A 5A7NA 5BV6A 4UW3A 4CU6A 2NMOA 2DDUA 3ACFA 1OCCH 1R091 1GOFA 2HOTA 3MLKA 4PF1A 1HB4A 2E6VA 2ZGPA 1ZA7A 5FY4A 2CW8A 1R083 1WJCA 3BIWE 1W6NB 1AHDP 4CDXC 2W91A 2VUCA 3K77A 2IGNA 2R7DA 5FY7A 4YM2A 3FDYA 1CAVA 4DUWA 1HQWA 1BN5A 2ARAA 4JKLA 2DOEA 4JX6A 3OY8A 4XQFA 1CF7A 2EZKA 3HSEA 2LFBA 3GZNB 4LLNA 2CQXA 5DEQA 4FOQA 4YPJA 4KITB 2K0GA 5LA2A 5F3GA 4BU2A 2HWE1 2RR12 2XGEA 3B94A 4PT6A 5DAXA 1CPNA 2HWF2 1G3SA 4AU7A 1AYM3 3ITQA 1UX7A 3JAMZ 4FQ4A 1M1EB 1HRV3 4SBVA 4C1XA 5HDGA 3ZFEB 3GFIA 2MHFA 4A6OA 4QXCA 3BTYA 1L7LA 3BJAA 1FZPB 2P1BA 1ZZCA 1W8UA 2GZWA 5JPNB 1P92A 3AXEA 3EPZA 4FTHA 1EV7A 4XJ9A 4KDPA 3H5AA 2XQRA 4IL7A 1ZZ9A 2XVKA 1RJ7A 4LG0B 4E4HA 1GR3A 2K3PA 3REOA 5GLVA 2ZOEB 5LBCA 1AVBA 2O3FA 2DVDA 2ZGOA 1QZZA 4AQSA 2DOFA 2PFBA 4AM3A 2FBEA 3Q3SA 3EYIA 3NV2A 4KNCA 1GZTA 3HL2A 1D2QA 2RDNA 4J1XA 4LUMA 4EN8B 3NW4A 1AKHA 5DPNA 1D2SA 4QKNA 4OIOF 1MMNA 4XF1A 1H1MA 1VBA2 4M01A 1BA5A 4ZKTB 2WNUA 4ZH4F 1K4SA 3OGJA 1NCQA 2XGDA 3W6JB 3HN3A 5FIXA 3I9V2 1XE0A 2EILH 1B6AA 1AR81 5FWEA 3P9KA 2DT6A 1XS9A 1RINA 5JAXA 3J7LA 3ZOIA 4Q4ZF 4PJMA 1MEC2 3JBG1 4YFXF 1VQ8I 4MFEA 2PN5A 4RA0A 4I09A 4IPAA 2ZJQF 2HYGD 1QJX2 5FO7B 1F5FA 1XSVA 1VBC1 2XGCA 2KHMA 3W3CA 2MYSA 4GJYA 4CPBA 2BVBA 3CKHA 2XOMA 3FE5A 4HLXA 3P7NA 1VF9A 3SC7X 5EG0A 1SC7A 1BYHA 4HPKA 5T5PA 4Y20B 3I53A 3RQ0A 1G8XA 4LLFA 4RMNA 4WM8A 2QWWA 3A0KA 1SLAA 4P9GA 4IEYA 5IT3A 3T09A 4HX7A 4PLNA 3N3HA 2RJ2A 3CJRB 2KISA 2GIZA 5C70A 2HEVF 4YG3A 3GBWA 3J7YJ 3KZIC 1UHMA 2O5RA 1H2MA 5ACA3 1VQ5I 4UNOA 1HSJA 3CO6C 3WP4A 4A41A 3T08A 1AYN1 2HWC1 3GBFA 5DXDA 4WV8A 4RD7A 4XF3A 1H0BA 3N4MA 1JHFA 2VQGA 3BTLA 1UZVA 4Q4Y3 1ZBA1 2ZGLA 4AVCA 5DDJ3 3WP3A 3CMAI 3M2MA 2AHQA 2ZHLA 1LEMA 3NNLA 1WWYA 5FFZA 5D5XB 2GLOA 2JUGA 4MZUA 4LQRA 2E7WA 5ICCA 3PUIA 4KU7A 5FMBA 4E7SA 2Y33A 1KEXA 3WHUA 4YYOA 3BR3A 4EM2A 1J3RA 5FK8A 2P4EA 5F64A 2VMHA 2ZC2A 4AVBA 1QJY2 2X29A 1EUTA 2L9VA 5C4XJ 2WJSA 4RFT0 1SBDA 2Z1DA 2GDFA 4CU9A 2W52A 4QPOA 4C3IJ 3GFMA 3OYGA 1WLDA 2ZX1A 4N90A 2VZRA 1NZIA 3L2VA 2CV1A 2FOKA 3AJYA 3VD3A 1YXWA 4MO3M 3AP7A 1W36D 1ASJ2 2EXKA 1KJRA 4BHBA 1MVQA 1RUE2 3A03A 1NK2P 1MS9A 1RUH1 3POEA 4B44A 1A8MA 4RAFA 3W9AA 1BEV1 1FATA 4LOCA 3B69A 3OR1C 4ON0A 4KA4A 1MJAA 1C1LA 3P3PA 4DIQA 1SFXA 4Y13A 2VW0A 5C4JJ 5EYXA 4LNVA 2ZEXA 1S2BA 3HJRA 2GU9A 2LTPA 4A3XA 4HG2A 3OBRA 1PZ7A 2NNNA 2FCVA 3R4UA 2OQ7A 3ZGKA 4NHYA 4K21A 3OBAA 4XMAA 1RUG2 4BY1J 2DA7A 4JX0A 3LAGA 4HN0A 5GLUA 2ZZJA 1X1AA 1TE1B 2QQ9A 1I3HA 2D6PA 5F32A 4A6EA 1HB1A 3HHHA 1V9U1 2B8MA 4XN0A 4BLJA 2IVIB 1UPSA 2PHXA 1RGSA 1IO2A 1Z91A 4UUSB 1KDMA 2ES3A 3FXLA 3KFWX 2YC0A 2UY9A 2A05A 2OF7A 4BQOA 3I3DA 2VASA 3EB7A 1JUPA 5D8LB 3QACA 5FXVA 1VAVA 1T98A 2M9HA 3L00A 3MI8A 3BU0A 4FCYA 3L2YA 4CDXA 4BQ4A 1Y8RB 5BNNB 1OUSA 4XE9A 4XCBA 3ES4A 2UXNA 3VEPA 5H9SA 4IHVA 4D7MA 1BW5A 3VBRB 1JI6A 2ZKLA 3KV9A 1ODMA 4XZUG 5A70A 2NMNA 1UYXA 3PMSA 1J09A 4QXBA 1SACA 2L01A 1LRHA 3ZP5A 2E53A 1W04A 4IGPA 3JRAA 3TDZC 2WSUA 2RNGA 4DYCA 3OYIA 3PNVA 5FROA 4FE4A 3TNPB 1YQ6A 2G19A 4LK0F 1ON1A 5DS9A 3TNQA 3CO7C 4L18B 4DGWB 3QOEA 2FBIA 3AL0B 1ZBE3 1AX2A 1AX1A 2Z2SB 2ZEYA 3N9NA 4XILA 3I2FA 1F43A 2XMLA 5EXOA 4DQAA 1AL21 3G4SI 4M6XA 5KHHA 3E6DA 4PI2A 5L9RA 1W6NA 4QM9A 2JDMA 3OPWA 3AMNA 2DDBA 3E6BA 2VC1A 2R92J 4XNFA 4NDLA 1KFXL 2AZ5A 4YIRX 4CZCA 3I56I 3LFUA 2PLV3 4W1UA 2W39A 3F8NA 4MG2A 1A6QA 2JT1A 4ENJA 1IQDC 1FPN3 4QX0A 3PSIA 1H2NA 4XKVA 4YM3A 2FZ1A 2LKSA 2VXRA 3DEWA 1LGCA 5L3EA 2W92A 1GKBA 1WLCA 1L3JA 1SMVA 1BZWA 4YGCA 3THTA 2GNBA 3MDPA 3VUOA 3K4ZA 2IXSA 3AL0C 4XDQA 2NVQJ 3H35A 3KETA 2L5QA 1CD3G 5FRAA 2X10A 1YS6A 4Q8LA 4PCRA 5DD8A 1ZH5A 4QB6A 3OIPA 1GOHA 2MBFA 2JDNA 4C3JJ 1AR71 2IRFG 2YBSA 2BFUS 1JKOC 1V70A 4FISA 5JOZA 4LG0A 4PDWB 2CAVA 4C1WA 2WLPA 5EV7A 2IJLA 5M3FJ 2VE9A 1KQ9A 3S14J 3ONQA 4HVRA 1AUYA 1ETYA 2A07F 3GTLJ 1OH4A 3O0XA 2QFEA 1S6LA 2DA6A 2BBVA 2EA7A 2X6WA 1JT0A 1LVAA 2IGKA 1TP4A 2R7FA 2DTRA 4ZXEA 4FI9A 1VIWB 4HKLA 4MUVA 3GF6A 4I6ZA 3F2ZA 2OQRA 3DF0A 4IGOA 1WW4A 4Q4V1 4XW3A 2XGXA 1U5TC 3G71I 1R7JA 4ARYA 3OUHA 2KRHA 1XNDA 1BK1A 5F3EA 1HRI3 4OU0A 3NJYA 3DLAA 4WF2A 1MSFC 1QNTA 1H6XA 5HCHA 1U78A 2OTLI 3BQZA 3FXJA 3HRTA 1W8ZA 2DPUA 3IAS2 1IRFA 5FZ9A 2ZS6B 2EIMH 2X1EA 5GAEJ 1J1TA 2JIGA 4TYSA 1OKQA 3BODA 5IP7J 3VHPA 3JRDA 1HC8A 3AVSA 5FRMA 2GNTA 2AQEA 3DECA 3MFAA 2DA1A 5HDNA 5LD2C 1G59A 2HPIA 4AQTA 3DEMA 2M7BA 2A61A 1LOEA 3IAM2 5FYHA 5EQUA 2MNGA 4RGAA 4Y20A 1FNNA 2NM1A 5FPBA 1R092 4BQYA 4UFMA 4PQQA 4LBKA 1QXRA 2V5YA 4BUPA 1LKXA 1QO0D 2OKXA 4CUCA 3ZXSA 3O12A 4F83A 3JAMK 3OY9A 4AIKA 3PNYA 4QKFA 2Y6GA 3HOXJ 4EWDA 2RVAA 4BLIA 1CJPA 2FCTA 3QP6A 1YI7A 2DTYA 4BB3A 1WMDA 4C8DA 1MS0A 3D6EA 3OG2A 5A3OA 2JA8J 5FYUA 1FI2A 3AG4H 4OWRB 3H7YA 3GX4X 1OPCA 5ILSA 1W1WE 1S1AA 2BOJA 5FZOB 4XN3A 2HWE2 2FCUA 3V64A 3NV1A 4XRSA 3WUDA 1GSLA 4F91B 1PNGA 2BQPA 2Y6LA 5FP9A 1Z3YA 3LEKA 1XDUA 3IH2A 2PAKA 2FX0A 1MZ6A 1H8AC 3JD71 2A73B 3HNYM 2DVBA 4RAYA 4HBLA 1GT0C 3M7AA 2VCAA 3ABMH 3WDYA 2AXTC 1VQMI 1ENHA 1H9GA 2KA3A 4BQ3A 4FSJA 3BCBA 3A2KA 1YW8A 3WUCA 2LR8A 5FMOS 5HS7A 2OU2A 1VBE3 3MIFA 2MEV3 5J37A 5FO9B 3TRSB 2CUJA 1MR5A 3VKNA 3V8KA 4DY5A 3BTZA 4I98B 1JH5A 2RGVA 3PUFA 3H8OA 1S8NA 1XBFA 3DTIA 1XSQA 3R4DB 2EB7A 2WS93 1RXFA 1VAMA 2CUEA 2VPLA 1RKTA 2ILMA 1HBXG 4WXHA 1N78A 3IZOA 3S0MA 1MBKA 4TV7A 2OT7A 3HOUJ 5C8CC 4A5NA 1WH5A 4YIFA 4CCNA 2RMU3 3WW4A 1PZ9A 1AL0G 3HC7A 3OUJA 5FKNA 1JUIA 1AR82 3Q5FA 5ERLA 4H7MA 3RKWA 5LHIA 1QOOA 4XJAA 3BCAA 3S3MA 1RUJ1 5A7PA 4LBMA 1LENA 3JBG2 4A6DA 4OZXA 3ZQQA 3QCWA 1JI8A 3OMYA 3H1CA 1VBC2 4ZY9A 3RZDJ 1DYKA 1CN1A 1J3PA 3Q9SA 1B1BA 4RHV3 1HKQA 2JSCA 3CJNA 4JOMA 3NNMA 3T1MA 3HSFA 4YVSC 4BJ6C 4GMP3 4UUSA 3MF9A 4P08A 4COYA 2B7YA 4CO8A 2LBFA 5L3DA 1YW7A 1E5IA 5CVIA 3ZXAC 1I5ZA 4YSFA 3AMHA 3JSOA 2A7AA 5D6FA 2RS32 1SCRA 2AYHA 4FPOB 5C71A 1FMD3 5JWPA 2FJ1A 1Y1VJ 2UV1A 3G1OA 2VPVA 2WUHA 1LE8B 4F92B 2JE8A 2VECA 3HTSB 5E79C 1OYYA 2VKVA 4BOWA 3S2DJ 1JHJA 1FP1D 2XWJB 4NC8A 3U21A 2YGMA 2ENRA 1DQ6A 1CIYA 1AYN2 2BNMA 3POJA 3GBGA 3KF3A 2QGUA 1IOAA 2Z16A 3ORJA 2QQVA 5IYBJ 3HZJA 5EYYA 2XAFA 1HCRA 3DV8A 4LOSA 2EZHA 3OEBA 1KQRA 1SMTA 1GP4A 3C3VA 3LIGA 4L9TA 2CU7A 2OIIA 1XTAA 3DPRB 2QCOA 3B02A 1LJ7A 1AWCA 1BLZA 1YHQI 1WCQA 3NRVA 4AI3A 3ZXDA 1XSDA 1TLHB 2JPCA 1W0NA 3HNMA 2ECBA 4M3CE 3RTRA 2YS9A 2WWYA 1LKNA 2BJSA 4Q4X1 1O57A 1UWWA 4PHZA 1NK3P 2KFDA 2E51A 4CDWC 5CFCB 2ADDA 3ILNA 1POV1 4NQWB 1W6PB 4K8RB 2EPFA 1KQ8A 2JDZA 1ZM1A 1NA1C 1XNTA 4O5VA 1P4AA 2LNBA 3JB8A 4ZYDA 3L9FA 1U5TA 5GLZA 2DFBA 4RAGA 4A7KA 3T2PA 2BXZA 3U2RA 2YPDA 3HKZN 1J9IA 4NUBA 4KBZA 5IVBA 5L36A 4XAAA 5FUIA 2KZVA 2QSFX 1GMMA 1S3JA 1S7OA 3QAHA 3T8TA 1DU6A 4S04A 1J1LA 3HQXA 5J09A 5GKAC 4DBQA 4AVPA 3OS1A 2CL2A 4V2VA 1WCUA 4QPQA 2JDKA 5GLWA 1IS6A 3V0AB 1V9U2 5E8AA 5CFCC 5CA6A 4AFAA 1XQNA 2OCEA 3CZ6A 2QZ3A 1YFHA 3MIGA 4LBQB 1H4HA 3BTXA 1BMV1 1X82A 3WQBA 2ELHA 4OI1A 4OAYA 1F9KA 2RR13 3MWMA 3S2WA 3ERED 1PUFB 2HWF3 2W84A 3CCEI 4MIMA 4W65A 4QQPA 1I1SA 4BH9A 4JTNA 4IEVA 1DYPA 2WO1A 1U0JA 4AHXA 3RQ4A 1C1FA 2WA0A 3AK0A 4DB5A 1ZN2A 3G1MA 3SCGA 1LEBA 1O4YA 3GGLA 1GU3A 2L4AA 4RGXA 1VQLI 1RUF1 3CLQA 3KCXA 4Y1ZA 1W6MB 5A6QA 4UT5A 4C0BA 3D5LA 4BQQA 4AYBN 1LNWA 1IC8A 3G7DA 4LORA 3FMGA 1SLIA 2R7SA 3LSTA 1BK0A 1C4RA 2L7KA 3CZJA 4H55A 3LF7A 5LA1A 1JHNA 2J1UA 2HBUA 2YG0A 3MIBA 1PP8F 2R061 4AK3A 1K45A 1VBA3 1AL22 1IKQA 4Y4YA 2OZJA 5IVJA 2HVSA 2AC1A 1CESA 4ET7A 3MKYB 4TXWA 4NR1A 1G9CA 1MNMC 1CAXA 3C18A 1Z9CA 2K4JA 3NEUA 1DQUA 4JK1X 4KI5M 5LY2A 2CQKA 3GYDA 2Y75A 4OMDA 3HGYA 5AFBA 4YG6A 2Y26A 2D45A 1YIPA 3I55I 1MEC3 1X1PA 2VLAA 4H0EA 5CB7A 4YRVA 1APNA 2ZGNA 4LK1F 5FZOA 2IS2A 2AEYA 1GLHA 4GIQA 1QJX3 5LEKA 1WH7A 3DU5A 3IWFA 2V1NA 1OQDA 5IVEA 3F0CA 5FYSA 2ZAAA 2PBIA 2VPRA 2W1OA 1DP0A 4C2MJ 4HSLA 5C8CA 1CZTA 4IEPA 4UAPA 2Z42A 2Z9OA 2HDWA 5DZGA 4J19A 4CHUA 1AR72 2GN7A 2Y6JA 1KU9A 4XFBA 4KWKA 2RN7A 5FZ4A 4YW2A 1HLCA 2ARBA 2P3KA 4XOTA 5H9QA 3TEXA 5FRNA 1W99A 1NE4A 5DMYA 4BJTA 4GKXA 2ZX4A 1DP7P 3HOSA 3M3IA 3H0DA 4DUXA 4I02A 5FZ7A 1LHVA 1JGSA 4QPWA 5LRRA 5IVCA 4MV2A 2E7TA 3VZKA 3GTOJ 3VZMA 2P4WA 2VJ4A 1UCRA 4YVSA 3EQEA 5CIRA 2F4LA 2PJRB 4EYUA 3VSKA 4E2SA 3MMYB 1MZEA 4CXFA 1UN1A 4Q4V2 4R9AA 4E6KG 1J2XA 3RZMA 5D8AC 4ZS3A 2EIBA 3HBZA 1IN7A 3CBNA 1W36C 4EN7B 3JRCA 4OHWA 4IHXA 1QJY3 3VBOC 4AYUA 2VGDA 5F0FA 3K1NA 5BPDA 1VE0A 2EVXA 1DZQA 2Q5TA 5HS8A 4KGQA 1IZ3A 4JX4A 5AIPA 3WHBA 5EGOA 4IEWA 1B09A 1YITI 4ATEA 1RPWA 5CKTA 4GKYA 5LRSA 2D5VA 4D7SA 4SLIA 3GF2A 2IAIA 1ACIA 1AXKA 1MBFA 5DDGA 1ASJ3 4YARA 5AVPA 1RUE3 2BY3A 3K4BA 2XAHA 2H6BA 4UXNA 5C5TA 4GQ7A 2DU9A 4JP0A 1JJ6C 1DZRA 4HX4A 3KZ4C 2PHTA 3M8LA 3VBFB 4QPGB 4LBQD 3V8JA 2W1WA 2G0EA 5HBAA 5HLGA 2B63J 2MLKA 2AACA 3GJBA 3WG4A 1S0DA 3RKQA 3DYPA 3BI3A 2A1XA 5IOZA 3PVOA 4IE5A 4XURA 3T4VA 2EFNA 2D2WA 3CMYA 5M5WJ 4BQ2A 1H8TB 4AI2A 2ZHKA 2W94A 1TNRA 1RUG3 2L3DA 3WNOA 1FMWA 4CDWA 2ZSIB 5J4YA 1P6RA 2ISYA 1FEXA 1YQAA 2XR4A 4HV6A 4ISRA 5F2SA 3QRFF 3IKWA 1KS5A 2RS12 2E34A 1K12A 3HQUA 4A3EJ 5IPAA 2XL9A 1AR62 4QPGC 3UESA 3JD72 2TEPA 5A2QZ 3DPRA 1OH3A 5EFUA 2XV4S 4NIIA 3HPHA 3V0BA 2HQRA 3RMYA 2DAOA 5K7PA 3IV5A 2IS4A 4FPCA 2JECA 4I99C 3SEPA 5KHGA 3NARA 4HLTA 4EATA 2P5KA 3IP4B 4B1MA 2DW4A 3ZO0B 3UK9A 3R05A 1JT6A 2RV9A 3AYCA 3HPNA 1Z67A 1I50J 3KB5A 3HKZA 5DCMB 1FXZA 5CFCA 1VMFA 1W6PA 3C7GA 2IGOA 4KN4X 4MQVA 4M4RA 4HK8A 3AP9A 3ML6A 5DAQA 1ODNA 3BTIA 1AX0A 3S5QA 3ZN1A 3K2OA 3WQ0A 4G3YC 1OKOA 4ZTJA 4Q1PA 4A44A 2VL4A 1W7PD 2R7WA 3VD4A 1BIAA 1J75A 2TRTA 1OF4A 3UKGA 2DI3A 3H8UA 5A7OA 4QX5A 2XDVA 4AIHA 4CCJA 1X58A 2VKEA 5L3FA 1VNDA 1E3HA 4Y17A 4URAA 4Y22B 4PIYA 3DKYA 1RUJ2 4WM7B 3MW3A 3HRSA 1XB4A 1W05A 3KEYA 4Y5SA 2P5LC 1G3YA 3ZXLA 1XSXA 4I0BA 2FQ4A 2FMLA 2HYXA 3UNGC 3VHOA 2QQBA 3H9GA 2JB4A 1IKPA 3AYAA 1V5FA 3AZXA 3M7GA 5HV4A 2ARXA 2VCBA 1Q56A 5JHFA 4B43A 5FP4A 2QBYB 1F2NA 1A6IA 1SDDB 1IJWC 3N7LA 2V6EA 1FPQA 3ZQFA 3H5NA 1X19A 1FOKA 4NRPA 2OUHA 3B9IA 3ZPYA 4AYBA 5FZ3A 1YJ9I 5H9PA 2YROA 4XZPA 1SD7A 4JX5A 2DBIA 2DMQA 3LFKA 5FCCA 3O0VA 2Q2EB 5E16A 3SLIA 2WAAA 5B2GB 1ZELA 1J84A 4WM7C 1RC6A 1VQOI 1HQLA 1JXNA 2L7ZA 2JDYA 4K2EA 3K4KA 4MH0E 4XRSG 2CWSA 1EF4A 5IYYA 1H9PA 2WAOA 2EXJA 4PLMA 3K1PA 5LGNA 4QT6A 1GWLA 3H3ZA 2X6XA 3TP0A 2XVCA 2PELA 3VZLA 3EBRA 3H3LA 3PFIA 1O5UA 1GLNA 2TNFA 3U10A 1IXRC 3BPVA 5KC6A 1DFQA 5FY9A 3DTKA 4II3A 5GPCA 3SYTA 1OD3A 2WLQA 3TEWA 4AG4A 4LB6B 2EICA 1R1ZA 2J22A 3DF8A 3WTTC 3VYSB 2BW3B 2A6EF 2H6CA 5D1IA 4BQ1A 2ZMKA 1PP7U 4FAHA 3WNMA 1XD7A 1WI9A 4EEFG 3ME2A 5H6QA 2VW2A 3RZOJ 3OIOA 5IP9J 1I27A 3N35A 4Y5Z0 4PJLA 1U5IA 4MGTA 1YRNB 2Q0OA 3N36A 4Q4X2 2A6XA 4YZ3A 4D69A 5GLTA 2VQHA 5JXGA 2ZMNA 3BTJA 2L9SA 3ZXEA 1GVDA 4RFRB 1NQDA 3WODF 3BR2A 4G7HF 3KEOA 3R61A 2ZGQA 3SMHA 5E3LA 4YW7A 4QX8A 5FV3A 3MV01 1D0YA 1QHDA 1C0WA 5D8AA 3RZHA 1W3XA 4NN0A 2VJJA 1R093 2J1TA 1MIJA 2L7FP 1HN0A 4H2AA 2XF5A 2ME0A 1PM4A 2AENA 2F6CA 1DG6A 4CCLA 2FD5A 3VBOA 2Y8KA 1S5LC 2CU5A 1SVLA 4GWJA 3C7OA 1QHHD 5GZGA 3VL9A 4TN7A 2KPMA 1BI0A 2E63A 1W5TA 2YHJA 1F15A 2H1KA 5FZ1A 5I8SA 4YZ5A 3EUHC 5JOYA 4OMYA 2DUPA 4D3WA 1I5PA 4OHZA 1MJBA 1BMV2 1HW1A 2PJRA 3PUAA 2M30A 4GB31 2HWE3 2W68A 1BR2A 5FO5A 1J83A 3KYCB 2AGSA 3LSDA 4YW4A 4J25A 3FF5A 4IGQA 5FZGA 2M34A 2BYVE 4GXOA 2ZTNA 4N4NB 1JZ8A 2EFPA 5C4WC 3S1QJ 2E71A 2JWPA 5FR3A 4YNIA 2BVLA 1SAUA 3I59A 5J1RA 1WWXA 2WNVB 4Q0PA 3FK7A 3DPUA 4HSRA 1YQ5A 1RUF2 2FD8A 2ZXWH 5C3QA 5IFPA 3FFQA 2LH9A 3MW2A 3MIHA 4Z82A 1MW7A 5DV5A 1XB9A 1T6BX 2QSHX 2LUWA 2VUAA 2EFWA 2K9SA 2FNPA 4HNUA 5I8YA 3F8MA 4MGRA 2H09A 1H4GA 3WTZA 3VD9A 1XG1A 2XJQA 1ETKA 5L3CA 4QPGA 4W6YA 2H0VA 3OBZA 1DZTA 2R062 4JGYB 3B93A 1Y1WJ 3IL2A 2M3AA 2HS5A 4A6SA 1IN8A 1B9NA 3ZDVA 1Y0UA 4GALA 1AHSA 4YFWA 3A0BC 4L9JA 1BL0A 3OTFA 2GALA 3T8RA 2VUJA 3NRUA 4LD5A 1UIJA 1W8WA 3LSJA 4BISA 1PO21 5IT9Z 1AR83 2WNVC 2WYSA 2XLAA 2IXCA 3JBG3 1S55A 1HN1A 5HXMA 2VOPA 5CFDC 3FXKA 1ZRIA 2DMPA 4G8XA 3ABZA 4DRRA 3P9IA 2MLGA 2P34A 1VBC3 1QZEA 1WZ2A 4IXAA 1YYVA 4NE9A 2DU1A 1IG7A 4FOWA 3PURA 2R30A 1VQNI 2MSYA 1POV0 4JGYC 2DFFA 3WG1A 4FFIA 1G9BA 4GGGA 2ZXIA 3DBHB 4LXLA 1D0GA 3NWTA 4IEXA 3POGA 2R7VA 3L2QA 2XONA 2RS33 4EJVA 1Y3TA 3COAC 4IDZA 3J7AO 1IG0A 2W85A 3JTHA 1X3UA 3VYRB 3ZQIA 2LK2A 4RQPB 2V26A 4EJRA 2BHZA 1C3HA 2X5IB 1BJZA 2VJIA 1SAXA 1AYN3 2KQRA 1LPQA 4XOPA 1X9PA 4E4SA 1OOPC 1C8NA 1YE9A 3PLQA 3GFJA 2GXGA 2QENA 1ZRFA 3MYXA 2AH2A 2WQ4A 4OI4A 2Q8CA 1MS5A 2YB7A 2OZ6A 5CQEA 1O7LA 5EJ1B 2ZACA 4AIDA 1N3PA 3BG6A 3ACLA 1V6IA 2X1CA 1DQ0A 4X6QB 1U0AA 4JKKA 2HPMA 2GQQA 4Y22A 4CTEA 1O91A 4WM7A 2ISZA 2DFIA 4EMSA 3UYJA 4QX1A 3WD5A 5EWSA 3TEYA 2FZ2A 2DJIA 1BVVA 2CDOA 2X5IC 2R32A 5FY8A 2EIJH 4PCQA 2OPKA 3D5OA 3ASNH 4CCKA 1G86A 3V42A 1VQKI 2I74A 5DAWA 1WJ5A 4YW3A 1UY1A 3C1DA 5FZMA 4Q0VA 5KCMA 1SVOA 1GZ9A 1GP5A 3MKWB 2AREA 4QGMA 4LO8A 4R4ZA 3AM2A 3BR1A 5CG8A 2ID6A 3ZQHA 3DCFA 3S1MJ 1O4XA 4WVMA 2DVFA 4IRHA 2ZAHA 5A2QK 2DODA 5AONA 2VY0A 2P37A 3ZPLA 3UGFA 3Q0UA 4UW6A 4LHNA 3SH4A 2ZCWA 1SFOJ 4B29A 4U7BA 1FBQA 1OLTA 1PX4A 3BG9A 1NTCA 3M8FA 1ZR4A 4BK5A 2F48A 3F23A 2H8WA 2FE3A 3TN92 2VONA 4IXLA 3SHRA 1USTA 5FKKA 1V9U3 2R042 3RJRA 2C9AA 3BKZA 3AJZA 3OGGA 3FIWA 2X53S 3H7JA 3GEZA 5JLWA 1UYPA 4I30A 5K7ZA 2BW3A 4OLLA 1QGLA 3AG1H 4M6VA 1MMAA 1GOGA 3ZMDA 3I2KA 2RG4A 1OLRA 4BJ5C 3DXTA 3DEUA 4P9IA 4QAWA 2IA2A 1QDOA 3A0HC 4FASD 3DXJF 3FFZA 3W58A 2JVGA 4AF9A 4WK8F 2VH9A 5E6HA 3TO9A 2R0FA 5KK1A 1HV0A 2YR2A 2W3JA 4MGIE 3P6BA 4QDSA 4KIBA 1O8SA 4XJUA 3WR0A 1ZAOA 1JKQC 3UJOA 1WMFA 3EYPA 3EUHA 1MGTA 4BBRJ 2UWAA 1IGOA 4QWNA 3IT8A 2DN0A 3O1PA 3RVHA 1DP3A 1V0AA 5CKNA 2Y31A 3MAJA 5DUKA 3MIEA 3H9AA 5BY5A 5LHGA 3I71A 3B01A 1WLTA 1E5HA 2H8RA 2VKDA 2YY1A 5C4WA 4TLFA 3WW3A 1YTYA 1W0OA 2QQUA 3WF0A 3TEZA 1AL23 3K10A 1MPXA 4BIFA 5F7UA 2DOAA 1B8IB 2I45A 3TOAA 5I0UA 1N25A 2VC0A 1TW3A 1TC3C 4OULA 3GLXA 1D0ZA 4M0NA 2P5BA 3PJRA 5EYRA 3K69A 1TEIA 4FTSA 4A0ZA 2F17A 2CUFA 3BALA 4CP9B 4O65A 1AF9A 1OUXA 3WTSC 1BI2A 1N1VA 3VODA 1UZ0A 3AFHA 2VQCA 3NWSA 2Y0MA 5FYBA 5A1FA 2E1MB 2LF8A 2EXIA 3KM5A 5IK8A 5LHHA 4NIHA 1A6CA 5I0DA 5FZKA 5CJ9A 1BBT1 1I3QJ 3F95A 4KWJA 5CLSA 3SJMA 5BNOB 4V2FA 2DLLA 2Z99A 1AR73 5JIAA 2WNVA 3KLNA 1O3QA 1ZRCA 5FQ0B 1JZ5A 1MH4A 1TNFA 2E1CA 3LQRA 3DXUA 1PZ8A 1PVEA 2QEXI 4FXKB 4AAPA 1DLCA 1CQ9A 4G9YA 5KWRA 3JR9A 3CC2I 5CFDA 5ANNA 3WHTA 4KT6A 3G3ZA 4JKMA 1FOD1 1HV1A 3BR6A 3I2GA 1XNCA 3CF2A 4NB5A 3V7RA 2JMWA 2W1QA 3RWNA 3ZN4A 2WT1A 2XAUA 2J7MA 3S32A 1TWHJ 4JGYA 2PMZN 3BPXA 1WJBA 5EHDA 3A7QA 1JBCA 4GFBA 4Q4V3 4IV3B 5BNOC 1CQTA 3QLQA 2H27A 1S9HA 1PIV1 2HKXA 3HBLA 3ZR8X 1RHI1 3BUCA 2YV8A 4DEQA 4OMZA 2OUMA 1ETWA 5TISC 1NH3A 3H3VK 2D5HA 3ZYJB 4J6GA 1YG2A 3BG7A 2D7FA 4WCGA 1EV11 2QDRA 4XTPA 1OOPA 4QPIB 3RZKA 1NAEA 1OPMA 2QKMB 2BW8A 1OFCX 4RB1A 4P14A 3KV5A 3I2OA 4M9SA 3CF6E 5CISA 1CAUB 3H42B 4KQ7A 5A80A 1OBNA 1R1A1 3OYMA 3K3OA 5HLIA 5CG9A 5J1UA 3MV11 1WJAA 5CVRA 5LA0A 2ZX2A 1TBXA 2XL7A 5J4VA 1K5MB 1P7IA 3CDLA 1JZ6A 5EZHA 3ECOA 4PLOA 3I5UA 3H8XA 2KKOA 5LBQA 1C8M2 4L9BA 1CX4A 2X5IA 1IV8A 1YO8A 3D8CA 3HTUA 2HGCA 4Q29A 4V19K 2DQLA 1J7KA 1Q5OA 3BVCA 1QJU1 4MFDA 2VZQA 4GB32 1LAJA 4MADA 1WGXA 2VZTA 3OEAA 1IXCA 4QQ2A 1NKGA 1QJEA 3LIHA 1BIBA 2RS13 4BK4A 5L9VA 1OQEA 2YBPA 4XLAA 3POSA 1DGRA 3MBWA 1AR63 5IWFA 3CLOA 3P5BA 3ZSLA 3Q8EA 3JD73 1PK6B 2DMUA 4LMYA 3WLUA 5IVFA 1MKMA 2QA4I 4LBOA 3OL4A 1QPMA 3I4MJ 1RUC1 1R64A 3H1WA 4HONA 5IK4A 4HQEA 5F3IA 3OS0A 1U8RA 1UB9A 1RR8C 5ERIA 3R6SA 3HIFA 4QB1A 3L2HA 4BXFA 3OGVA 5IT9K 1W2UA 4XDPA 2Y34A 5HDKA 3JU9A 2C5DA 3ZQCA 2D97A 5FP3A 2HQ5A 4HG6B 1W8FA 3VD7A 3VB9A 2IA1A 1STMA 4XYXA 4DZPA 3KP4A 4FPEA 5J98B 4BMBA 2R4GA 2J5OA 3PIGA 1LVKA 4XFFA 3RKXA 4XUTA 4FT8A 4ZYGA 1RXGA 1YFXA 5K5QA 2K9QA 1ODDA 5FFOC 3OYJA 4XKWA 1C57A 1PO22 5KBFA 1EH8A 4QU1A 4XF4A 2G9FA 4ABZA 1UYZA 3F8BA 3O6BB 4BEHA 3ZMUA 4HA8A 1RUJ3 3QWLA 3BOPA 2VT3A 1GFF2 1OMIA 1I9RA 3RMXA 3MUY1 5ICGA 3S3NA 1VALA 3CZUA 3KVBA 2WN2A 3H3UA 5J7MA 1AU7A 4DXRA 3U1KA 1UW8A 1Q43A 3VBUB 2HWVA 4L9NA 2N7GA 3MGUA 1AA7A 4KL1A 3JQWA 3H0OA 1WPKA 4FO9A 1ULFA 2ELKA 4OOIA 1UMQA 2B42B 2XF7A 2BZDA 4QGLA 2IZWA 1HLVA 3J7NA 1J5YA 3GTPJ 3GM8A 1CAWB 3UKNA 1F31A 5FXWA 1VPHA 4FP2A 4OMCA 4BMEA 3UV9A 2DQRA 3V65A 3QH7A 4LA2A 2G9GA 4ESFA 4XHBA 1CAVB 5FJKA 2VTXA 2WZR1 1IRXA 2TCTA 3MKZA 3RSJA 1RYYA 3MPBA 2CWMA 4BZ4A 2RDRA 4LB5A 4CU7A 2K9LA 3ZRGA 4P5YA 3KS7A 4MHRA 3D5SC 3JCUC 1MZBA 2QZ2A 2WRAA 2KIMA 2GN3A 1A35A 9ANTA 5GADJ 3MW4A 2DA4A 5KR7A 3MD2A 1XGMA 3PJQA 3I2HA 1PGL1 3B7MA 4P9FA 1V5EA 4KFCA 2L0KA 1WA6X 2X0LA 1HKDA 4LA3A 4KG0A 3ACIA 4Q4W1 1H9TA 2NYYA 3BPZA 2GMMA 5HV0A 2D44A 3GTQJ 3U0ZA 5FTTC 1OA2A 1QQP1 3BGAA 1BC8C 1G6NA 3ZVXA 1A34A 5AC91 4LIUA 4Q4X3 3ALQA 3AFKA 1K3IA 4EV0A 2X05A 3WHCA 1LOGA 3KHCA 2ZXJA 3B73A 1S7AA 2OBPA 3QPTA 2LOOA 3KEQA 2ZO4A 5T5JA 3NAPC 3VV1A 2FOWA 5K8SA 3LEMA 1QVUA 4LGWA 5CKQA 4PSXA 1PVXA 2CDPA 1AKHB 1IUYA 1NG7A 5BNOA 4OI2A 1D4VB 1OXCA 1UU5A 1O5LA 5GALA 3VD5A 2WNUB 2JPBA 5FQ0A 5A7QA 2KJBA 2KMUA 1NCQB 1OR7C 1IS3A 4JZRA 3M9AA 2VZVA 3FXRA 2QNKA 2RE9A 2PMZA 3WW2A 4M4PA 4CDQB 1W4MA 3I4PA 1K7AA 2YU3A 2M5WA 4DOZA 2JJ6A 5J40A 3RYPA 1LOBA 5E18F 2O03A 4YZ4A 1Q1VA 2K5CA 1BC7C 4EZ4A 2D3SA 1R5GA 1MD0A 3A01A 3CC4I 4XFGA 2BNNA 5CYVA 2V6CA 4F3QA 4Z8BA 2LDUA 2HNHA 3N97A 3KLSA 3FL7A 5ABJB 3IUOA 4OAZA 1Q1HA 2GOXB 4ES8A 4AEJA 1BKZA 3KQ4B 2JRTA 4O9EA 4MLOA 5EG0B 2EFOA 1SVMA 3LMMA 2RHPA 3C2UA 4WM8B 1S0IA 2MFZA 2X51A 3FKIJ 3ZXKA 5GZCA 1T38A 4HT1T 1SD4A 4CDQC 3LE0A 3GZEA 2HQNA 4Q4Y1 2PHLA 1RUF3 5CNAA 1WZXA 1REEA 5B1BH 3TDUC 1GQHA 3HRUA 3AVRA 1R4MB 1GANA 2YU1A 5ABJC 1CX1A 2DA5A 4OYUA 4IRGA 1IS5A 3EHKA 4JBAA 2A5ZA 3WNKA 4N9HA 4S2HA 2R063 1FP2A 4PJNA 3TGNA 5D4RA 4XHXA 2VIXA 1A5JA 5ICFA 3SZTA 1FV3A 4DXZA 3I4NJ 1VMHA 3P5JA 2HI3A 2LY1A 3OOXA 3QH6A 1N1TA 3CMGA 3LZZA 2L2OA 3ZXFA 3HOTA 1IRGA 2XXZA 1JOJA 1HX6A 2CV6A 2VMIA 2F5CA 2XKOA 3M07A 2WKKA 2TDXA 2VQ0A 5A32A 2WADA 2ZEWA 2QE3A 5B66C 4IEQA 1KXGA 1F9NA 4EVIA 2VNOA 3EUKL 4OI0A 1QRYA 4IO9F 4BE1A 3MCZA 4DZJA 4FOVA 2SBAA 2VXJA 5DCFA 4UXAA 1BBT2 5GM0A 2VBWA 4LG3A 5K0UC 1XOYA 2UUZA 1XNAA 1NXMA 1G8WA 4FFGA 4X6AJ 1OA3A 1PK6A 3CCQI 2D43A 2O1QA 4XKCA 1U5ZA 1JUSA 2JD4A 3WCSA 5JXIA 5J96B 2CNAA 2BERA 2DVAA 5CKMA 1NQJA 4B47A 2IP2A 2IXLA 1UZYA 4Y33A 5KNLA 2L4MA 2XG3A 4FETA 2BNOA 1QNWA 5FZFA 1YEWA 5ISLA 1PVC1 4RSUA 5C7GA 1FOD2 5HVQC 5H9RA 1W0UA 1RL3A 4LO4B 1F35A 1BW6A 3CJTB 2MA3A 3UETA 4D7TA 4L8QA 2ZA9A 2JG9B 1BJQA 4B48A 1L7RA 2IEKA 5DABA 1ZHFA 5E1ZB 4RB2C 4W50A 2R5ZA 2LS6A 1PIV2 2HH9A 1R6RA 4UBHA 1RHI2 2M45A 5CVUA 3JTGA 3GJAA 1MBGA 2VNVA 2NNYA 4B1LA 4BQAA 4XORA 4BCUA 3T2QA 4FPKA 4RR3B 4XJ8A 1ENRA 3F3XA 1T39A 4BDVB 1W28A 1ZARA 3EQLF 1JU4A 4LFUA 2XSJC 5M5XJ 3BPSA 1KRIA 4OHVA 4XM3A 1UFMA 1ZBE1 3PUHA 1DQ2A 3USUB 4DW6A 4XC9A 3EUAA 3FXQA 2CV0A 3TW6A 2V1DA 2X1DA 4NROA 2JG9C 3ZN5A 4ZZLA 1R1A2 5D2AA 2LRPA 4HW0A 4DZGA 2FF4A 2NVYJ 5GP9A 3WNNA 1GQGA 1VB2A 4D6QA 2W24A 5T3NA 3ZYBA 3BG3A 1CAWA 4IJAA 1YFUA 3JRBA 4ZDPA 4C2UA 4AL9A 3WG9A 1VI0A 3FZ3A 3JRGA 3WTXC 4QHBA 1NCRB 3RKYA 1AR91 1W03A 3E5UA 4MO7A 5C9AC 3DGTA 3VOEA 3CCSI 4RR3C 4G9SB 3K48A 5IUQA 5HS9A 4Q2FA 5IW0A 2W0XA 4LKEA 4EZHA 3GCMA 2I8DA 4E9KA 5FZBA 2DF7A 4CP0A 2P7CB 4RGUA 1Z6TA 3S1NJ 3LSRA 3KCCA 3OGRA 5DUWA 3TN93 3NAPA 3L2UA 1K83J 4QQOA 3GFLA 2R043 3KT7A 1U6GA 4NBQA 2VD7A 1YJKA 2ICWG 2XB6C 4XJZA 3J7MA 1RRJA 3W21A 2OS2A 1P2FA 2PTMA 3QD6A 2C0ZA 3VHNA 3ZSKA 2OA4A 1OR7A 1YX5A 4PDKA 2M2EA 4YG2F 3I3EA 1NCRC 2VB6A 5FYZA 4P9LA 4UUVA 1SLBA 4C2TA 1W6QB 3B9CA 2IXJA 3LA7A 3H92A 1VTNC 2MG4A 1QH6A 3CC7I 3ABKH 2P3JA 3J4UH 5GJ6A 3WE3A 1YJLA 4AVAA 4LLGF 2F6BA 3ROUA 1CZVA 1D8KA 1R4NB 3FXOA 2WL1A 3OIQA 4FPYA 1QU3A 3ZKUA 1H1AA 1IGNA 3QBQA 3UT0A 3VBHC 1DCSA 4XF0A 2A5YB 4CCDA 5FZLA 1QU0A 3O0WA 2XUEA 3T0BA 4XSXF 4HMZA 1YNAA 2I5UA 2VMCA 5KHJA 2CS3A 3PTRB 3KMHA 5BYNA 3QU6A 5CVVA 3ILRA 5FLMJ 3EXUA 1FYMA 4CDQA 5FLXZ 4E7LA 2D5FA 4WZCA 1KU3A 3MPPG 3PIJA 2PN6A 4HETA 5T54A 4LE4A 2W25A 4H14A 2A3SA 4XIOA 3ASOH 4CCOA 3POBA 2K3FA 4IE0A 1FIAA 1QNYA 2RC4A 4ONUA 5A7SA 2K9NA 1NG6A 2LLKA 4M00A 5IYDJ 2VZUA 1LODA 5ABJA 5F9TA 1UKGA 4IE7A 5C5UA 4IQ4A 2L7MP 1S7EA 4QIWN 3K46A 1RUD1 1XC6A 2FDJA 3LQQA 4WBBA 3O5SA 1UMZA 2Y0IA 3U78A 1UJ8A 2IW5A 5DAPA 1JYNA 3F22A 2ZXHA 3BZ6A 1WBFA 5J1XA 2DA3A 3ZMVA 4IQJA 4KWUA 2QQWA 1Y9MA 3IHUA 1TQMA 4UFIA 3ZSJA 5ILVA 4ATFA 5FYCA 3HWJA 5JOXA 2UURA 5FZIA 3WZ1A 4E4ZA 2WZR2 3NSTA 4JVAA 2BGCA 1PO11 2HTJA 2R1DA 2UWCA 4ARXA 2XHNA 5BPIA 1YI9A 4HX8A 1DDLA 3ZN6A 2YSRA 4G12A 4PBPA 3K9TA 3OD4A 2R7EB 2Y6FA 4AQ6A 2D6MA 2XB0X 4D0QA 2AEZA 3SZGA 2NVUB 4KYWA