1J59A

Catabolite gene activator protein (cap)/dna complex + adenosine-3',5'-cyclic-monophosphate
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
199
structure length
199
Chain Sequence
PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*AP*AP*AP*GP*TP*GP*TP*GP*AP*C)-3'
publication title Structure of the CAP-DNA complex at 2.5 angstroms resolution: a complete picture of the protein-DNA interface.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
total genus 53
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1j59A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1j59A01
1FBSA 5BMZA 3QAHA 2K27A 3RKWA 4IETA 4BIFA 5BUVA 5DCFA 3E5QA 2IJLA 2IT0A 3QPHA 3D0JA 4HQEA 4HW0A 2EFOA 2PLYA 1HSJA 3ETQA 3D5LA 5T3NA 5D6FA 4O9GA 1D8JA 4KIBA 1IN4A 3F8CA 5K5QA 5F64A 2G9WA 2OD5A 3GF2A 1VJ2A 1OYIA 4M74A 4QGNA 1RZ4A 3RYPA 2P6TA 1XGMA 3ZMTA 1PP8F 2ZJ2A 5HDNA 1SFXA 1ON1A 4KMUX 4HQMA 1FPQA 4META 2IXIA 5BXXA 1K7AA 1ZREA 1I1SA 3IL2A 1Z6TA 4Q0VA 3NKTA 3SQNA 5HLIA 3O14A 2DW4A 2ZCWA 1ZAOA 2A3SA 3FHZA 2O8QA 4GGGA 2KIMA 2K0GA 2EJRA 3L09A 3QU6A 4RB2C 1KU3A 2F5EA 3TOAA 3ZMDA 2A6HF 1LVAA 4XLPF 2JRTA 5CVVA 4KUMA 4MNUA 3RIRA 1ONVA 5ILVA 2RV8A 1ZZCA 3MPBA 1B9NA 1IZ1A 4IJAA 2WTEA 3DPLC 4A0XA 2Z2SB 4L9JA 3ML6A 1KYZA 1ZZ6A 4IEYA 4BH9A 3IRQA 4LTAA 1X82A 2VECA 3N97A 4BHBA 2QZ8A 5E18F 4LA2A 2F4PA 3E97A 3MZYA 5I91A 3V7CA 4HLYA 1U78A 2X4HA 4ZU7A 1R58A 4HV6A 4PIZA 1G3WA 3ZN0A 1U8RA 5HVQC 5A2QK 1IPKA 4J1WA 3OF1A 1TW2A 4ZU4A 1T38A 4J1XA 5D5UB 5IT3A 3F6OA 3O2PE 4JV4A 3REOA 1ZGAA 3OD0A 1VR3A 4Q0SA 3KLOA 4EJVA 3S7IA 5DV5A 1H0MA 4IEUA 1U5TC 1ODDA 2VOOA 4ASNA 5LLQA 3LAJA 3GLXA 4O9EA 4IPAA 1Q5OA 3C7JA 5J3UA 1BI0A 1ZZ8A 4KL1A 5ICCA 4TV7A 5I8TA 3LQRA 4OU0A 1V4RA 3T8TA 3DQVC 4LG0A 1SAXA 4NB5A 1UCRA 5IT9Z 5I8SA 3U0ZA 2PMUA 5AVPA 1R1UA 5CJ9A 1A04A 3FMQA 2DCTA 2V09A 3TNQA 1H1MA 1BIAA 1ZHFA 3SFZA 4IRGA 5FCCA 4MGZE 5LHHA 4L11A 2Y0OA 4HYEA 4I7HA 3TKYA 4M73A 4OOIA 1I27A 4Y15A 3JAMZ 3H7YA 3ISPA 4HAMA 1H1IA 3FHIB 2XGXA 3ACLA 4M6XA 3TOBA 1MJ9A 1ZZBA 2ESHA 2NRAC 1YW7A 3DF8A 3WTSC 1TNSA 2RNJA 2QENA 2HYFA 2E7WA 2QJVA 4WXDA 1ZZ7A 2J5PA 3IRRA 2OU2A 3J7AO 5HLGA 2IXHA 3KGLA 5BPXA 3SZTA 2V79A 1P92A 3DKWA 3IHUA 3NW4A 3KE2A 2QLZA 4HX8A 3M8FA 2EFWA 3BPZA 3BPVA 3KP2A 2A07F 1YFXA 2MC3A 1F5TA 1Q43A 3V8LA 4HSJA 1BJAA 1B1BA 4G9YA 3RI4A 2OAZA 3V8KA 3GFLA 5L3FA 4XSZF 5KK1A 3JSPA 4ZZLA 2YSRA 2CAUA 2IXJA 3DFGA 2FNPA 3TO9A 2XKOA 3MFKA 2QM3A 3T1BA 3MAJA 3P7NA 4LK1F 2CG4A 1YLLA 1XN7A 2FEZA 4HVOA 1OPCA 3I64A 1FNNA 1T0FA 2HTJA 2F5CA 1XSXA 1PM7A 5LEJA 3BY6A 4EMSA 1MZBA 2OYZA 5C8WA 2XLAA 2OZ6A 3NL1A 5L3EA 2MH9A 3B02A 2GXGA 1BBYA 3E5UA 4ZZDA 1BOAA 1DZRA 3LA2A 1Z6RA 1QBJA 3WW1A 4F8AA 1CAVA 2IXLA 5HDGA 1R23A 3ST7A 4OIPF 2A5YB 5E8IA 2HFHA 2DPUA 4YFNF 1WQ2A 4LB6B 5E20A 1FP1D 4HV5A 2XKPA 4HF2A 2Z69A 5HS8A 2D93A 2CO5A 2DO7A 2CSOA 2V9VA 3WU0A 3I5UA 2O03A 5BPIA 3H3ZA 1V70A 1J3PA 5E8GA 2K02A 4UBHA 4ENJA 4OLLA 2XL7A 2GA1A 3R0AA 2ZXJA 3AAFA 4AVBA 4O5VA 2DK5A 1QNTA 4ON0A 3RZZA 1CF7B 1Y3TA 3HRSA 3VEPA 1XMAA 1LR5A 4ZYGA 4OIRF 3T0YA 2VBXA 2UY8A 3GFIA 4RB3C 4WCGA 2GU9A 5JR3A 4HVRA 3ZN1A 3BZ6A 4MUVA 3F8MA 1AWCA 1PP7U 1GQGA 4WX9A 1YFWA 3K0LA 4U0VA 3TNPB 4FX4A 3I71A 4LG0B 3KFWX 5FB2A 1YUDA 2COMA 2W84A 1RGSA 1S29A 3WW3A 3EYYA 1FZPB 4N9HA 1NHAA 2E7XA 4P5OA 5HS7A 1EH6A 2GWRA 1CAXA 1T39A 1EP0A 3ECHA 1NXMA 2FU4A 1ZRDA 3CF6E 2IPQX 1F1ZA 1UB9A 2JPCA 1GQHA 4PGGA 2ZO4A 2VBWA 1CAUA 1SD7A 3ZMSA 3KP5A 1YTYA 2PFWA 3TDUC 4RAYA 1SD6A 5LGUA 2EA4A 1DGWA 3HT1A 5D6EA 5AIPA 1RNLA 2W25A 2DQLA 1FX7A 3UKTA 3FXRA 2ISYA 5D4SA 1QO0D 2PQQA 4KT5C 1U12A 4QGMA 4LULA 4IVNA 3HOTA 2ZKLA 3VOEA 2K86A 2IC1A 2L01A 3K69A 1FSHA 3U9GA 3WTUC 2EK5A 5FQ0B 4XF1A 3IKTA 1IF1A 1YS7A 5H6RA 2IXCA 4JBAA 4E2SA 4I3PA 3BU7A 4YNIA 3G3ZA 4RAZA 2UXXA 4ENMA 4RGSA 3E6MA 3KETA 3WW2A 2PAEA 1XGNA 2HKXA 5LGTA 2LSOA 2NYXA 2MNGA 2H94A 2DPDA 1BI1A 1ZLKA 4XFHA 1ZRRA 4WXHA 3HRUA 1HKTA 2BE5F 2B0LA 3KZYA 1D3YA 3M8EA 1TQMA 1HBXG 1Y9QA 3G73A 1QZZA 2D40A 1WA4A 1U3EM 1SMTA 3FM3A 3BP8A 1AOYA 4L5IA 3CDHA 3HSRA 4CGZA 2PQ8A 4MX3A 1G3TA 4U0WA 3H8UA 5K1YA 1WI9A 4OFGA 3SXYA 4YFXF 1ON2A 3QPTA 1QY4A 5J7MA 4AQ6A 5FPZA 2QWWA 1OD5A 5ICFA 1UFMA 2ZFWA 4Y17A 1GHCA 4RD7A 1O3TA 4IEPA 4HVQA 2PI0A 1J3QA 3HYIA 3KP4A 3L00A 3LQQA 1XE7A 3RYRA 4MQ9F 1CAVB 2Y48A 3CUQB 4JQFA 1MD0A 4XFCA 5IT9K 2IP2A 4ZU5A 3C3WA 2GC2A 1LEAA 2QCSB 3IDCB 4HA8A 4X6RB 1ZRFA 2C6YA 2LF7A 5E1WA 1PDNC 1O3RA 4MHGA 4L18B 2A6EF 4IEZA 4RGRA 3ZMZA 1UPIA 3TO6A 2YX7A 1IXCA 3JAMK 1UHMA 1XGOA 5LBQA 4PDKA 3L7WA 3COAC 2IXKA 2Z3YA 4YARA 3FE5A 4EQQA 1FYKA 2IRFG 3S0MA 4EJUA 2IW5A 1CGPA 3LA7A 3KMHA 5F1RA 1YS6A 2BNNA 2XAFA 1Z1DA 1KQ8A 3GFJA 2FF4A 5ICEA 4L5JA 3DL3A 4ZYHA 2O0YA 5JR7B 2H09A 1SQ4A 2GC1A 3S2WA 4IRIA 2VBYA 5CU1A 3SXWA 3FXUA 3M1EA 2WV0A 2D5FA 3U2RA 1JHHA 1XRUA 3F8FA 1BC8C 3NVCA 4CDGA 5KHHA 3TQNA 4XFGA 5FD5A 4RB1A 1V3FA 4HLXA 4R8HA 3R60A 2VONA 4KWKA 1YIOA 3BDDA 6PAXA 2RKHA 2VT2A 3BCWA 1KU9A 3GWZA 4HN1A 5H20A 1FOKA 4IRHA 3GVAA 5FLXZ 2OBPA 3VHRA 1O7LA 1KU7A 1CAXB 3ELNA 5LGNA 3IBMA 3DPTA 1T98A 2CQKA 1TQIA 1XGSA 4LLLA 1CAWA 2FE3A 4WVZA 1CAUB 3CL1A 2EA2A 2UXNA 2E1CA 2TDXA 2P5LC 4P9UA 4LLGF 1USTA 4CXFA 5AONA 2QBYB 3LWCA 5F6FA 4PJYA 4B8XA 2O61A 4KIFA 1QQIA 2A69F 1YFUA 2CAVA 1OMIA 4UNOA 3L2HA 3HT2A 1GVJA 4LA3A 3B73A 4XF0A 2BBYA 3E6CC 3HRTA 4QMAA 2FXAA 1RTVA 2G7UA 4FBFA 1JE8A 1CF7A 2KXLA 2PTMA 3ZMUA 4LB5A 2EAAA 5J8CA 2DQRA 1RIOH 5DDGA 5LRSA 4UVBA 1YFHA 1R00A 1FI2A 1XMKA 3K1PA 1FP2A 3UKNA 3WU1B 4IESA 4CO8A 1RC6A 4EJWA 2EVXA 5JSPA 1B59A 3FM5A 3M70A 4YIFA 5HOOA 2UZKA 4M9SA 3MEXA 4YSFA 4MTDA 4MH0E 4L0YB 2A68F 4F7ZA 4MQVA 4GYGA 4HBLA 5D4RA 3CLOA 5BOXA 2IA1A 3GXOA 2M30A 2NNYA 2L54A 1XDUA 3PLQA 1LJ9A 3HRMA 4CICA 3CUQC 3M9AA 3ABTA 3WW4A 4XETA 2KJBA 1FYMA 2HQNA 2MPFA 4ONUA 5KHGA 4DNCA 5LRRA 2QVSB 3ZQ7A 3MYXA 1K78A 4QX5A 1OFNA 2YU3A 2PJPA 4QLCU 4EWAA 2K4JA 1FBQA 2ZNZA 5E1XA 1WLTA 3D82A 5K8SA 3WGGA 2DBBA 3BOQA 3MQ0A 2EFPA 4LLNA 1KQ0A 2D2WA 2V6CA 3CJNA 1K79A 3E6BA 2Q0OA 3KGZA 3BALA 3SCFA 1I5ZA 1YG2A 2I45A 4AXOA 5E16A 1KYWA 3CEWA 1B9MA 1KU2A 1XSVA 4JVAA 3QP5A 3JZVA 3HQXA 3I0TA 1ZRCA 5CADA 4UXAA 3GUDA 2ACJA 4P55A 1NYWA 3SHFA 1UIJA 1O7FA 5FQ0A 1ZN2A 5FLJA 1IN7A 2RN7A 2KKOA 4KMFA 3J80Z 4XFBA 3IWFA 1SFNA 2O1QA 2M45A 2OA4A 2QYOA 1G6NA 1R22A 2PBIA 4L0ZB 3MDPA 2FQ3A 3F3XA 2GQQA 2ETEA 2IVMA 5E1ZB 1FYLA 2J5OA 4PIYA 2BGCA 4AIHA 2D1HA 4R1HA 3I53A 5J6XA 3Q5FA 1IRGA 4JTNA 4IF4A 2B9UA 1R5GA 4UHTA 2HQRA 3R4KA 5CVJA 2RQPA 2UYBA 3VODA 3FX3A 3OTFA 3HSEA 3IKVA 4E70A 4OMZA 3GYHX 4Y13A 1S6LA 1EV7A 1WRJA 2GC0A 1HW1A 1X7NA 4Z07A 1L0OC 1G4DA 5CLSA 4I0AA 3BWGA 4NQWA 1SMYF 1FBUA 2W85A 2VC1A 2HS5A 4ZH4F 5KVRA 1SEFA 2W24A 3RKXA 1J59A 1XB4A 1Q1HA 3KEQA 4MTEA 2PAMA 4AVPA 4WZCA 5BV6A 4A6DA 4YG2F 1WWXA 1TTYA 2P17A 1S7OA 1CAWB 1DUXC 1LB2A 3CUQA 5FD6A 1ZVFA 3KLNA 4B29A 1XD7A 2BEOA 5EEHA 4ETSA 4M9XA 5L3BA 4KU7A 4QWQA 4WBBA 3JTGA 4D7TA 2ET7A 4XBFA 1XCBA 4XRFA 1R36A 4OMYA 3ES4A 4I2OA 3NRVA 4GXOA 4ENKA 1EY2A 1F4KA 4G6DA 2X0LA 5J48A 4PGHA 3OGJA 3OOPA 5ILSA 3FJSA 4HMZA 3LAPA 3H3UA 4U88A 1DP7P 4LUKA 4N9IA 4UV9A 2MHFA 2P7VB 2M8EA 3U10A 1TQPA 3BJ6A 4KA4A 3O6BB 4HN0A 4JK1X 3R6SA 5I8YA 4S04A 4ORFA 1IN8A 2XASA 4FAHA 4XFIA 1YQAA 1DPUA 4IEVA 4E2GA 3V7SA 3KEOA 3BB6A 1PUEE 1XSDA 2MLKA 4KWJA 2KRFA 4QM9A 4HZFA 1G3YA 3SHRA 4WK8F 5FGMA 1BI2A 5JFRA 5FLIA 5L3DA 2MH2A 2NNNA 5D8KB 1QWRA 3DN7A 1P4AA 2STTA 2UY9A 2ADUA 1R1VA 2CYYA 3JTHA 2OA2A 3P9CA 2PAKA 4BNCA 1BIBA 4A2UA 1K78B 1U2WA 2Y0MA 3T8RA 4L9NA 3SCHA 5JVTA 3GZ5A 3IIAA 4KNYA 1GXQA 1TW3A 1FSEA 2LDUA 4EROA 3RNSA 4XFFA 5KBFA 4P9GA 2EV6A 1RUOA 1EH7A 5FFZA 4YFKF 3BPXA 3KP3A 2QBYA 4IHSA 5E17F 1JXSA 2E1NA 5FLXK 2P5VA 1IAWA 3ZDSA 4KN4X 3GBFA 1Z05A 2EA7A 2L3DA 4Q48A 1HKQA 3JSOA 4HX4A 2GIVA 1I1GA 4HBNA 2DAOA 3TDZC 4P9FA 1IXRC 5JHUA 5AIQA 1LDKB 2YPRA 3P9IA 3NJZA 4YRDA 2BNOA 4DQ2A 1LEBA 2XIGA 2FBIA 4QGLA 2VC0A 4Q0PA 3E3VA 3K9TA 1HW2A 1IXSB 2AS5F 4ESBA 4NVPA 1STZA 3FFQA 1BM9A 3EBRA 2UYAA 4UUVA 1ZNPA 3PFIA 4I02A 5H6QA 1RUNA 3IWZA 3I58A 4L2NA 4UVCA 3SMHA 1P6RA 4MZUA 1O5UA 3PNAA 2Z33A 2MLGA 2P6SA 3HHHA 1WSUA 4XSXF 5DUKA 1H9GA 3E6DA 3ZP5A 3ULQB 1TQ5A 3RYKA 1HSTA 4G7ZF 2ISZA 3EUHA 3FF5A 3LAGA 3I59B 4G6QA 2CFXA 1J1LA 3FWEA 4ZYDA 5I0UA 2OZJA 3RPUA 4O6JA 3H1WA 2R7FA 1L3JA 2FMLA 1PMIA 3WG9A 2N7GA 4XFAA 1LNWA 3GW2A 4PZJA 1BC7C 4NHJA 2DLLA 2V1UA 1RI7A 4KWLA 1UIKA 4IEXA 1YLFA 5EEGA 1OR7A 4XF9A 1VP6A 4BHPA 1HQCA 4WWCA 2QDRA 1LRHA 1QPMA 3K1NA 1UW8A 3O3KA 3LOIA 2VOPA 4XEZA 5BS6A 2PYTA 3UKVA 3HTSB 4DINB 2EV5A 4YIIA 4UV8A 2P7CB 1FC3A 3USSA 4IXAA 4Z2YA 4HX7A 3C1DA 3BJOA 2L02A 4A5NA 1UCXA 3K2ZA 3HUGA 4MV2A 4KICA 4AIJA 2RC4A 1BN5A 2MD5A 4K8FA 4H0EA 3IDBB 4MGIE 1G3SA 4Q0QA 5LHIA 4IHTA 3EHKA 3CLPA 3WODF 3F8BA 3J80K 3VFZA 4CZZA 4MEYF 4MEXF 3V8JA 3KZZA 3NQOA 1X8EA 4BXUA 3C3VA 1UD1A 2BV6A 3M3IA 1FY7A 3SCGA 2M5WA 1MJAA 3I4PA 3P9KA 3WE3A 2HEOA 3FZVA 5E1RA 4Z82A 4AIKA 4E2QA 2FNAA 2PHDA 2PG4A 2Q1ZB 4ESFA 5DCMA 4A0ZA 2ELHA 3QU3A 4GO1A 3GO5A 3FXQA 4EWEA 5LHGA 2VQAA 2FA5A 3V4GA 3TGNA 3H92A 4ZYEA 1R5HA 5TRDA 5FDBA 2VODA 4HDVA 4G8XA 1YHFA 4D7SA 2XROA 3GX4X 3T5XA 3EQEA 4IEWA 4IEOA 1IRFA 5JCTA 5HS9A 1O3QA 3NSTA 5DD4A 2EFQA 4OINF 5JSRA 5HDKA 4R79A 4LUMA 2C0ZA 4H7LA 4MGYE 4X6QB 3DP7A 5FFXA 3F23A 2STWA 2DT5A 2UWMA 1Z9CA 3PVBB 4JTOA 2E9QA 3OV8A 3WTYC 1C0WA 4LMYA 4U0YA 2Q30A 3Q9VA 3LZZA 1XE8A 4AVCA 1RL3A 1TLHB 2PMHA 3WTTC 3KCCA 5EFUA 2XRNA 5I0TA 1TBXA 3GYDA 4HF0A 5D1IA 3J81K 3QRFF 1EH8A 3NEUA 4A6EA 2XLFA 4U7DA 2R3SA 3EETA 2HZTA 1B6AA 3PQKA 5K5OA 1IPJA 4BYYA 2RVCA 1ZG1A 1ZH5A 2L4MA 2ZKZA 2FRHA 1QXJA 4GCVA 1USSA 3W6KB 5K5RA 3C18A 2KJCA 4EVIA 3Q9SA 3HHGA 2QQAA 4I01A 4UVAA 3W6JB 1T6SA 2VT3A 2QQBA 3CO7C 1HXDA 4FT8A 4KFCA 1LDDA 4EM2A 5TJJA 4QM8A 4P96A 3LWFA 2VN2A 2HJIA 4ESJA 1JGSA 2FBHA 1W7PD 4ENNA 2JSCA 4EM0B 2FSWA 2Z5UA 3F6VA 1J0RA 3R0JA 1U6GA 3R61A 2V1DA 1YW8A 3GZ6A 1VTNC 2KIUA 1YO5C 4MGRA 2CW0F 4EWDA 1TNTA 2OQRA 3ERED 3H9AA 3MZHA 3F22A 4HF1A 5CVIA 3WTXC 4Q0UA 1J58A 4HOBA 3U1DA 3QACA 3HOSA 4LEJA 4HSLA 1DDNA 1IN5A 2GC3A 3D0SA 5CVUA 1ULYA 2A61A 3VB2A 2RDPA 3RTRA 3F8NA 2XAQA 1OYWA 3DV8A 1D8KA 1ZGJA 4XF3A 2LNBA 2CV6A 4Q47A 3ZPLA 2Q4SA 1J75A 4CHUA 2GXBA 3JW4A 1NE4A 4U7BA 3F21A 3HTUA 4L9VA 2ZMEA 4KDPA 2R7DA 2QVOA 1D5VA 1P2FA 2D1VA 2EFNA 4IERA 2ESNA 3CJXA 3K1MA 4M9ZA 1HW5A 4AVAA 4XLNF 2P4WA 3WE2A 4KU8A 1XDSA 2O3FA 2Q8KA 3V7RA 4LJZF 5C6CA 1W7PA 4YYOA 2F5FA 2HDCA 4BAYA 3RDIA 2DI3A 2PA7A 1J7KA 5KHJA 3MWMA 5I0RA 3LSTA 1Q3EA 4FX0A 4A0YA 5JAXA 1EYBA 1ZZ9A 4O3MA 1ZG3A 5KHIA 1UHWA 2MA3A 1LKNA 2CGPA 4HDUA 1O5LA 5L3CA 4EJOA 5BY5A 1Y0UA 1OKRA 4EV0A 1Z7UA 3KSCA 2LKPA 2Q2EA 4S05A 1MKMA 1MDMA 2IA2A 1JHFA 2XAGA 2M1BA 2HGCA 2VPVA 1SFUA 2AXLA 2FOKA 5DCMB 4MGKE 1L3LA 3I59A 1ZX5A 4AWXB 2JPBA 2Y75A 4M6YA 2IA0A 3M7GA 5CVRA 1KQ9A 1OYYA 2QUFA 5D5XB 4LD5A 2QQ9A 5I0SA 2GA2A 2NAZA 3EQLF 3GFMA 3PQJA 1O4TA 4LGWA 1P4WA 1U5TA 4Q4ZF 2K7LA 3QOPA 2HKOA 5DUIA 2G7HA 5FLHA 4HLTA 5ERIA 1MGTA 3DEUA 3J81Z 4LLOA 1KGSA 2L4AA 2FQPA 4AQ2A 1ZYRF 2W57A 2H6CA 1NZCA 2HR3A 2ETHA 2XLGA 2DFIA 4A12A 2KIFA 1EPZA 2JT1A 1FXZA 5A2QZ 2V1XA 4R52A 5KHKA 3RKYA 2F5DA 3CO2A 2HTSA 1ZG5A 3WTZA 3LFKA 4IEQA 4AD9A 1IW7F 4GYIA 5J8FA 1R7JA 3EDPA 2B8MA 4XF4A 2Z99A 5ICGA 5DD8A 2FBKA 1W4MA 1S3JA 2GAUA 4QXKA 4EJTA 1W5TA 4LFUA 1CX4A 3WGIA 3L2CA 1SFEA 1DGRA 2XAHA 1QXRA 2PFBA 2WFPA 2YR2A 5D5WB 1BI3A 2YX4A 2WWYA 3WTVC 2D5HA 4B09A 4GULA 1O3SA 5CYVA 4KYWA 2M87A 3FMSA 3TO7A 3G7DA 2EV0A 2HOEA 3H1YA 5JI6A 1K6OA 3EO6A 4OIQF 4UXNA 5BQTA 1ZARA 3IC7A 3RJPA 4G94A 5FO5A 4N0BA 2XHKA 3ECOA 4K2EA 4L9TA 3EJKA 4LK0F 3U11A 4CYDA 3KP6A 3F72A 3N4MA 3CO6C 3WGHA 2RGVA 1J2XA 1QGPA 4PCQA 3QP6A 2FMYA 3HIFA 4UBGA 3ABUA 2XL9A 4Q29A 5BPDA 1FWZA 2JTVA 4I09A 1QZYA 1FT9A 3GEZA 1SD4A 3ROUA 4TLFA 2ZMEB 1NE6A 1F9NA 4BQAA 4KN7X 1YW9A 2DU9A 2P5KA 1H9TA 3OCPA 2QNKA 3HSFA 1E17A 4M72A 1HKSA 2D45A 3S7EA 4EM1A 1KA8A 3WTWC 2ZNYA 2B5HA 3ELKA 1E2XA 5I93A 2JZYA 1W7PB 2OQGA 1DZTA 1OI6A 5FPXA 2BYVE 1W5SA 2VBZA 2ATFA 2HWVA 3I7DA 1GXPA 4Q5SF 1X3UA 1YYVA 1S7AA 1R1TA 1P4XA 1XCVA 5DYMA 3MCZA 1REPC 2O8XA 4WXCA 3KP7A 1ZLJA 4RGUA 4BHCA 2XAJA 2ET1A 4EGYA 3H1MA 2WC2A 2OPKA 2EB7A 3FMRA 2H0VA 2H6BA 5ED4A 5D8LB 3I54A 1B4AA 4RB0A 1YFYA 1S8NA 2DTRA 2DK8A 2PEXA 1JUHA 4PIXA 4EGZA 1MDMB 2CWEA 2LF8A 1YWKA 5DEQA 3RPQA 5ILUA 3ES1A 5EZWA 4D0PA 2H27A 1IN6A 1LDJA 1IUYA 2Z9OA 1T2KA 2VE9A 2OZUA 2BNMA 1J9IA 3CTAA 5JSOA 2F2EA 1SD5A 3SZPA 4RGXA 1Z91A 3ZMVA 3H7JA 4G7HF 1FLIA 3EYIA 3BJAA 3CUOA 4WF2A 2ZBKA 1J3RA 1U5TB 2GH2A 4I0BA 5HLHA 3E5XA 1LQ1A 1X8MA 1J5YA 2K4BA 2HYGD 4OIOF 2VXZA 3FZ3A 1WGPA 2PHLA 2NS0A 2XUBA 4KIGA 2O6GE 3LA3A 4I98B 2K9ZA 2Q0AA 4FAGA 3DXJF 3H50A 2XVCA 1MJBA 2XV4S 2P8TA 2GZWA 5LEKA 5HI0A 3BROA 2EWNA 3L9FA 1O57A 4A5MA 2VE8A 5D5VB 1I6XA 2PN6A 1WKMA 4G7OF 4M71A 5L3GA 2MBFA 1DPRA 4FHTA 4RS8A
chains in the Genus database with same CATH superfamily
5CFDC 3ZXFA 1U0JA 2NYYA 5JMOA 3I2DA 1KQRA 2LRDA 1DYPA 2K27A 4IETA 5ERLA 1X3ZB 2RR12 1VBA3 3QPHA 5IVVA 1CN1A 2XMLA 2W92A 2VVEA 2QSHX 3M3QA 3LOCA 3D5LA 3OIOA 1ONAA 2BW3B 4AFBA 3K77A 4KIBA 2G9WA 3PIPF 2J22A 3WF1A 1RZ4A 1Z3XA 2B46X 2P6TA 2VMGA 1M4WA 3AMNA 1SFXA 2XDVA 5BXXA 2YFUA 3CD6I 4QPIC 1I1EA 3FBYA 3IL2A 2DVFA 2E5ZA 3NKTA 3O14A 1JUMA 4AR2A 1ZAOA 1ENXA 4JQRA 2ZMEC 2W95A 3AP4A 2WFF2 3UETA 4B4PA 3L09A 1VRBA 2JRTA 2OVUA 4KUMA 4E7ZA 1S5LC 2X6OA 2G9ZA 5ILVA 2RV8A 2YBKA 2L7MP 1POV3 3UV9A 5IHRA 1E5HA 3N9MA 1XYNA 5FMOS 3THTA 2JD9A 2QQKA 4BM8A 3ML6A 1SC7A 4BH9A 2ZABA 1UYYA 4LTAA 4OHYA 1X82A 1X4PA 1X4OA 2JE8A 5E18F 1MR5A 1OURA 2MGQA 4IGOA 3E97A 5K4LA 4ZU7A 2MG4A 1R58A 1EA3A 3OPZA 4Q27A 3DEEA 3ZN0A 1C8M3 5C3RA 4XIKA 1TW2A 4LHSA 2R063 3VBHA 5D5UB 2JA5J 3VUOA 4OHZA 3OD0A 3RVHA 2JG8C 2OXBA 3JBG1 4Q0SA 2B39A 2BVLA 2P3IA 2XSJC 2Z5WA 1ND2B 3VBRA 1NQDA 4PBOA 5CG8A 1X19A 4IEUA 1U5TC 2WAEA 3RMXA 3DLAA 4ASNA 1QJX2 2RHPA 5DQ0A 4O9EA 1RUG1 3C7JA 4CDQA 5J3UA 4I3GA 3N9PA 2CTVA 5ICCA 3DTIA 5A32B 1V4RA 1WJCA 3DQVC 2V4VA 4RS5B 5C3PA 1ODNA 4DW6A 5F39A 4UOJA 3AMPA 2ZMKA 4CZSA 5CJ9A 4ARXA 2V09A 1UY4A 3CMYA 1H1MA 1Z0XA 3J7MA 5FIXA 5E88A 1ND3C 5LHHA 5LBCA 2ELJA 3CC2I 2RJLA 4I7HA 4BGDA 4XUQA 3TKYA 4OOIA 4R4XA 1EF4A 3JAMZ 2X1EA 2PJRA 3LOBA 3H7YA 3ISPA 3FHIB 2XGXA 5JVGF 1ZELA 4M6XA 3DTKA 3TOBA 3UT0A 1MJ9A 3A01A 2OTLI 2ESHA 3PHMA 3KHCA 1V55H 1VZ0A 3WDYA 1AF9A 3KV9A 5LCWL 2QJVA 4BZ4A 4WXDA 1QNWA 1N1VA 4XONA 2OU2A 2W9XA 1SHWB 5BPXA 2V79A 3DKWA 3S3MA 3IHUA 5B66C 3NW4A 2CL2A 3BPZA 4BQWA 1WCQA 4XLHA 2JA8J 2Z42A 1E57A 1YFXA 1IG3A 3BR0A 2LG4A 1Q43A 2VZOA 1BJAA 3M8JA 1HKDA 4OCTA 3SKVA 4M4RA 4ZZLA 1OQYA 3BTLA 4Y4YA 2CGNA 2HWF2 1PX4A 4GIQA 3UGHA 3QBQA 3JB4C 3NARA 4GMP1 2FEZA 3ZGKA 2YBPA 1RVF2 4Q4V3 1BMV1 1UZCA 4W97A 1XSXA 2R7EB 3V42A 1OCZH 1PMJX 4MO7A 2VPRA 2JXAA 2JWPA 4HXCA 3T1MA 3J7NA 1XG1A 4PLOA 4B4QA 5C33A 1WJDA 4ZZDA 1BOAA 1DZRA 1EAH1 4F8AA 5FY0A 2WB1A 1R23A 5C9AA 3ST7A 1LJ7A 5E79C 2DODA 1R71A 1WQ2A 2BWCA 1LPQA 3K75B 4DMIA 2OQ6A 2D93A 2CU5A 3I5UA 1YHQI 2XPJA 4L5EA 1G86A 1W6OA 1N1TA 3THPA 1ND2C 1MBJA 2HWD1 3LSJA 3H0GJ 5FO7B 2K02A 2XL7A 1OCCH 3AYCA 3R0AA 5ABJA 1XE0A 4ON0A 2WSVA 4JGYA 1OF4A 4CP9A 2EIEA 2VM9A 5CQGA 1QJY2 2JX9A 4RS5C 1FOWA 3VBRB 1D0GA 2UY8A 1FTTA 2K5CA 4YFWA 2UWBA 3A4CA 1B8IA 3CBNA 1JTZX 1UYPA 1XXNA 3F8MA 3ZDVA 4CDQB 1WJ5A 1SLCA 4AUXA 1VAMA 1RHI3 3B9CA 1DQ6A 5EDNA 1AYM2 4WX9A 2BVMA 3TOJA 4U0VA 2VCBA 3C8XA 4F92B 1YUDA 3SZGA 3WW3A 4N9HA 1NHAA 1WZ2A 1IQDC 1VAVA 2WAQN 2PHWA 1SLBA 1ZRDA 1UB9A 2JPCA 4HG6B 4LITA 2CRGA 2VBWA 4G4FA 3ZMSA 5GLUA 2NPIA 5LGUA 2PX9A 2PJRB 4BQ3A 2W25A 4QPQA 3VYUB 3A01B 1NH3A 2CHHA 4MGQA 1SEUA 4AGGA 5FOBB 2IC1A 3VD4A 1MMSA 5EP9A 1DZQA 3OPWA 2FQ4A 4CEWA 2WS91 3RPUD 3IKTA 3I9V2 2IXCA 1H2KA 4JBAA 2Q8DA 2RS52 4YNIA 4RAZA 2UXXA 4Y1VA 2HNHA 4GB33 2CQQA 3WW2A 5LGTA 2LSOA 2N8GA 2MNGA 2NVQJ 3IAQA 1BI1A 2FHRA 3SEPA 4WXHA 1BBT1 1US3A 2BE5F 1SACA 2CU7A 1JXNA 5FP7A 3M8EA 4LHLA 2RNGA 1QZZA 2YMZA 1LKXA 2D40A 1KONA 2R4GA 3NJYA 1RETA 2LBFA 4V2FA 4L5IA 3GTKJ 5LY2A 1G3TA 2CNAA 3H8UA 2EXIA 5IYYA 1ON2A 4B4CA 4DBRA 3BG7A 3QPTA 4XDPA 3NNJA 4C2UA 2QWWA 3AKPA 2E51A 4DOZA 1VRH2 1UFMA 1GHCA 3A0HC 4WVVA 1RR7A 5GTIC 4DIQA 4IEPA 4M3CA 1J3QA 4M00A 5T54A 4DB5A 4XDQA 2Y48A 5JWPA 5C9AB 4JQFA 1MD0A 3AC0A 1D4M1 1JJ8C 2QCSB 4MYEA 1F43A 4X6RB 3SISA 3K4BA 2ZEWA 3T0DA 4YVWA 4KGGA 3I49A 5DM6F 3AFKA 4L18B 1W6OB 2F4MB 2R30A 3VBRC 4KG0A 5FP9A 3BTAA 2NOGA 3P1IA 2RS11 5B4NA 3GF6A 4QD2A 4Y3OA 1UHMA 5LBQA 3COAC 4P5YA 4JGYB 4CDQC 4CP9B 5JLXA 2GBYA 3FE5A 3JD73 1FYKA 4LIVA 5FP8A 1MEC2 4B1RA 5F3IA 2IW5A 1LE8A 1M1EB 1JYCA 4AFAA 1YS6A 4AK3A 2BNNA 2XAFA 2FF4A 2AC1A 3MIEA 2CSGA 5T50A 3DECA 3OIQA 2O0YA 1B8IB 1SQ4A 4BIOA 3S2WA 3SXWA 3FXUA 2D6PA 4COUA 1BC8C 3O1TA 2HDDA 4CDGA 1TVGA 1UG0A 3MW3A 5KHHA 3ZFFA 5FD5A 4RB1A 4GMP0 4BQ4A 4HLXA 2EXKA 4IOAF 4QKBA 2FD8A 1FJLA 6PAXA 4XN0A 1MNMC 3ZIWA 2BV4A 2VT2A 1CQTA 2R7SA 2R7RA 2VGDA 2IFRA 3ZSJA 1FOKA 3AG2H 4QXHA 4D5FA 3WCSA 1O7LA 5B4XA 1YJLA 3A22A 1T98A 1CD3G 2A3YA 1Y0NA 5DXDA 1TQIA 3OSDA 4EJRA 1YIFA 1MBGA 1CAWA 1F36A 2E1CA 4P9UA 4FFHA 4NRPA 1PX3A 2XB5A 1HJGA 3L9JT 3MKLA 4BEHA 1CESA 2XGEA 1SLIA 1OMIA 2C1FA 1GVJA 4LBNA 2R49A 2R071 3RJRA 4XF0A 1U5XA 2VUCA 4ZS2A 2W91A 4CEWB 2FXAA 3WNPA 3PNTA 1RTVA 2EAKA 4LB5A 2CH0A 3GTJJ 4YM1A 2VKDA 2E36A 1O6UA 2LP0A 2VQGA 2B9VA 1FP2A 3ZYJB 3WU1B 3OYWA 2D3PA 1RC6A 1G9BA 2CDPA 3K4KA 3N9QA 4D3WA 4QX3A 4OWRB 4YSFA 1GWLA 3S14J 4NAMA 1PK6A 2LBFB 2QA4I 1XYPA 1YI7A 3GXOA 3CF2A 2P5BA 3VL8A 3M9AA 3WW4A 5C9AC 3NV3A 2KJBA 2BBAA 2MPFA 2BDRA 2H8RA 2FDFA 4UFLA 1WD4A 2RS33 4BE2A 5IOYA 1UNBA 1LTEA 3O1SA 3HOBA 4XICA 2YU3A 3C7EA 5FYZA 3ZKUA 1QDOA 4EWAA 1REDA 2RMU3 3W21A 2DBBA 4U36A 4M3CB 4N7UA 4AAPA 1YCIA 4LLNA 2D2WA 4TZDA 4XUPA 3BALA 3DPUA 2DJIA 3W3CA 4AXOA 2FCVA 1B9MA 1AR93 4JGYC 4ITCA 3VZNA 5F7UA 3NNGA 2XQXA 2W3JA 4L92A 1QQP1 2LTNA 3JZVA 3FK7A 3FUOA 2LVSA 2FZ1A 3HQXA 4AIDA 1W05A 4UXAA 1WH7A 1DCSA 2WJSA 4P55A 5A7WA 3VDXA 3SHFA 1UIJA 2ZA9A 1BQPA 2YXSA 2MD0A 3RZGA 3J80Z 2VW1A 4UF0A 1QVUA 4XFBA 2R043 5EJZB 3J7YJ 1G6NA 4NHKA 5FROA 2FQ3A 4XDOA 2DA2A 1RINA 1LE8B 5IFTA 1JZ4A 4ZJZA 2LMDA 1R093 2J5OA 4PIYA 3OIPA 2J1SA 4AIHA 5J6XA 5A33A 4MO3M 4JTNA 4IF4A 2B9UA 3ABZA 3GZUC 5CVJA 1JODA 1UF2C 1VBD1 3FX3A 4DGWB 1U9OA 2QKLB 4Y13A 3ZFFB 1K5JA 4K40A 4D94A 2EZHA 1GWKA 1GZ9A 4Z07A 5E3MA 1L0OC 2Y6HA 5FBZA 2IGKA 5EHDA 3WHCA 1ZM1A 2VC1A 2HS5A 5FMCA 2W24A 1J59A 4XCBA 2RM21 4R9CA 4MTEA 4RHV3 2DOFA 4AVPA 4Z2AA 2KA3A 1QJY1 5FY4A 1RUJ2 2VMHA 5BNNA 1IRZA 4KI5M 5FY1A 1CAWB 1DUXC 3VBFA 4CEWC 3W58A 1JHJA 4LG3A 3RWKX 3D3AA 2OIIA 3H8OA 2QE3A 1PIV1 4B29A 1KEXA 5L3BA 3AMQA 4D7TA 4BEHB 1MBFA 1BKZA 4XRFA 1CJPA 1VBA2 4I2OA 4GXOA 1EY2A 1F4KA 4XN3A 3OGJA 4CP0A 3OOPA 1RC9A 2Z4FA 2SBAA 4I6ZA 4F3JA 2CWSA 3H3UA 4D0QA 1A36A 1AX2A 3BKZA 4LUKA 4N9IA 3M7AA 4XBNA 2ME0A 1TQPA 4HRIA 3S15J 3ZLIA 3HDDA 4P1WA 3R6SA 2A3WA 2WIIB 2MEV3 1KXGA 4COZA 3OYWB 2GNTA 2XWBB 3ZM8A 4FAHA 4KBBA 3WF4A 4XKVA 1K6YA 3D1NI 4IEVA 4JKMA 2DFFA 4R4ZA 2MLKA 3TEYA 4D6SA 4P9XA 2JENA 3VBUA 3MMYB 1QPIA 1UL9A 1PK6B 4V2GA 2L7KA 1ETQA 3BC8A 4XJUA 4AHWA 2DBNA 3PNYA 3PURA 3WG4A 4OHXA 3OYHA 5EF6A 4NWWA 5L73A 1RUE3 1IJWC 1VQKI 3UNGC 4A2UA 3T8RA 3SCHA 4IEJA 5I0DA 4K21A 1P7JA 4M3DA 5KBFA 4P9GA 2KL4A 2EV6A 1EH7A 5FFZA 2YU1A 2ZC2A 5M5XJ 3BPXA 3POWA 3C2BA 3KP3A 2QBYA 3H9GA 5FAXA 1MMGA 4LOTA 2PQSA 1IG7A 4NIGA 3K4MA 4YEJA 2KDZA 1Z7S3 1APNA 1MMAA 1C8M2 1Y9GA 4QKNA 1XNTA 3X2QH 4XAEA 2R062 2RQQA 5A7WB 2GIVA 1I1GA 1KJRA 1W6QA 3AZWA 3TDZC 3CU7A 1IXRC 2XF6A 1QRYA 3W9AA 3P9IA 1VRH1 2RVAA 4UF0B 1PVC1 3GDBA 5M3MJ 4ES8A 2DTZA 5DZFA 3CLQA 2BNOA 1LEBA 5EGOB 5F5CA 3OYIA 1F15A 3WSOA 1ULCA 3ZFFC 1G2HA 3E3VA 1HW2A 4A3GJ 4CVUA 4NVPA 5F2SA 1OFSA 3WNMA 2R1BA 1ZBA2 5FP3A 5A33B 3AKTA 1JZ3A 1VQPI 2JJ6A 4AI8A 4RAGA 2EXHA 3CCRI 3HBZA 3PUIA 4MZUA 1O5UA 2Y6FA 3PNAA 3WNOA 2P6SA 1WSUA 1BJQA 3GHMA 1H9GA 4ZTFA 5BNGA 3GZEA 3O0XA 1N25A 2CFXA 1J1LA 4YM3A 4DNYA 5FKCA 2FDHA 1ULEA 1UOBA 3K51A 5BNNB 2FMLA 3RKQA 3BQYA 1PMIA 4IHWA 1H4HA 5DG2A 3VBFB 5F8PA 1ST8A 4HG2A 4NHJA 2DLLA 1DYOA 2A6VA 1WJEA 2FCTA 1UIKA 1D4VB 4FPOB 4YW2A 3S5QA 3JRIA 4BHPA 3H8XA 2W68A 4SBVA 1NG6A 3CP2A 1LRHA 1TWAJ 2HQAA 1JT6A 1SBEA 1UW8A 5JXIA 3LOIA 4RHV1 4DINB 2PLV1 5CA6A 5DDJ3 4U87A 2D6OX 2J1EA 4A6SA 2VUJA 1PK6C 2ARCA 4GZ9A 2V7FA 4FO9A 3H42B 5LFAA 4AFMA 1BN5A 1V00A 3ZYGA 3B5LB 1NUKA 4H0EA 1BW5A 3TEWA 1HLVA 3V65A 5GAGJ 1BZWA 3VBUB 4COYA 3F8BA 3VFZA 4CZZA 4MEYF 1KFXL 1J09A 4MEXF 3LMMA 2VQTA 4Q4V2 3NQOA 4BXUA 1UD1A 2BV6A 4H3WA 3QCWA 3WE3A 1N3PA 2HEOA 4E2QA 2FNAA 1QU0A 2PG4A 3WXPA 3HG9A 3MLKA 5EPAA 3KIOA 5F08A 4Y5SA 5DUWA 5GZEA 1QDCA 5LHGA 2VQAA 2A73B 2ZKNA 2FA5A 2WAAA 1R5HA 4RM2A 2DVGA 5C4WA 4FPJA 4RN5A 4R9DA 1YHFA 4D7SA 4PK4A 2G4IA 2ZXQA 2EIJH 1JHNA 3TN93 4AYBN 3O5SA 4OINF 3L2VA 1PGL2 2YG0A 4MGYE 4YM0A 4AHYA 4ZHNA 3DP7A 5FFXA 4I0WB 4E7HA 1SCSA 1C8NA 3VV1A 3PVBB 4XL9A 2E9QA 1Y7BA 4OMCA 2VXRA 4FQ4A 1L7QA 4U0YA 4S2FA 3GTGJ 3WTTC 3AP6A 4OI2A 1W6QB 2JEMA 4YPJA 3K4JA 2XRNA 1TBXA 1NXD1 4DXZA 3KCXA 3ZYPA 2DUPA 4IOCF 2Y64A 4XHBA 3BN6A 3OY8A 4A6EA 4U7DA 4AVTA 2F4IA 1Z3YA 5APAA 1RHI2 5HPOA 1USSA 4XJ9A 2D6LX 4EVIA 3CDIA 2KD7A 4I01A 1GOFA 1W8NA 3TEXA 2HBTA 5BNNC 1OT5A 2LK2A 3VBFC 1WGXA 1DU3D 4XBLA 4P96A 3S1QJ 1S0BA 4CZCA 4YRVA 1W7PD 1JOJA 4EM0B 2JVHA 2FSWA 5J98B 1J0RA 2XONA 5LBBA 2BY1A 2V1DA 1RKWA 3PSIA 5F0HA 4MGRA 2E31A 4EWDA 2OQRA 2GP3A 3T4VA 2JMWA 3U1DA 1DDNA 5JI7A 1ULYA 3VB2A 2ADEA 1AR73 2PMWB 2RDPA 1H2MA 1VI0A 1W6NB 1BEV3 3MIFA 1ZGJA 1UX6A 4BQOA 2LNBA 4Q47A 3ZPLA 2NMNA 4FPCA 1G59A 3JW4A 1BL0A 2J1VA 1SLLA 4LBQD 3F21A 2Q1MA 3HTUA 4GB32 1D5VA 1P2FA 2D1VA 4IERA 3CJXA 4IDZA 1S0GA 3VBUC 4B1LA 3GGLA 4NDLA 1SDDB 3OL3A 1VAKA 1W0NA 4IKFA 2ZXWH 3T2TA 1Q1VA 3H3LA 3MWMA 3POGA 4LO8A 3ZFEB 5I0RA 3AL5A 1W90A 1V6NA 4A0YA 1EYBA 1LFUP 1ZZ9A 1ZG3A 1UHWA 1XOYA 2MA3A 3HPGA 3K6GA 1OISA 1RUF3 4QXCA 4HDUA 4NPRA 5L9BA 1W0TA 4EV0A 3ME2A 4S05A 1MKMA 1IG0A 5CEHA 1NZIA 4X8PA 3KWVA 2IXSA 3ZSLA 3KV5A 4MGKE 4ZY9A 3OL4A 1L3LA 2AYHA 1ZX5A 3IV5A 1SZBA 3VDAA 3WDWA 3BI3A 2O9LA 4A3KJ 1MS1A 9ANTA 2L7FP 1TE1B 1AA7A 3CJRB 2QUFA 5D5XB 3QODA 4P02B 2JK3A 4A42A 5C4WB 3QWLA 4KNCA 5M3FJ 2QSGX 1O4TA 3PQJA 3DCQA 1BYHA 3ACGA 1PYVA 2HKOA 5T5JA 3VD3A 1YXWA 3LFMA 1OPMA 5FLHA 5ERIA 1K83J 2W08A 3AB0A 2FQPA 3TBIA 2H6CA 5GZCA 2HR3A 2V9PA 4NIIA 3BPSA 4Y22A 3G1MA 3PUFA 5FO9B 2JT1A 2R7VA 3JD72 2BOLA 4QQOA 3U1KA 5IVYA 3O8GA 1GVDA 5B1BH 2EXJA 1SPPA 3LFKA 5LW9A 4CXXA 2EZIA 3OY8B 3FISA 1IW7F 4AD9A 3EDPA 2O8KA 4B8EA 1MQTA 4PI2A 3GBGA 5DD8A 3DEWA 4XLFA 4M3CE 2AR6A 4EJTA 3IMMA 3S6PA 4YGCA 4N8MA 3ASNH 1OVSA 1SFEA 2XAHA 4DZPA 2PFBA 5LK7B 2DFBA 2YPJA 3WQ7A 3WTVC 1OOPA 1XSRA 3NJXA 2W47A 3AKZA 3UGGA 2D5HA 1W9WA 2M87A 3TO7A 3G7DA 2HEVF 2E35A 1JOBA 2DFEA 1YQ8A 4C3JJ 2HOEA 3M3CA 1C1LA 4BJ0A 1X50A 4BQ2A 2DCYA 2WNVA 2Y0SA 5FZ9A 4N0BA 2JUCA 4NRQA 1ZBA1 4L9TA 5M5WJ 3HWJA 1EV13 3N4MA 2A6YA 4QPWA 2BXZA 3RZKA 5L7OA 3WGHA 1J2XA 2L9VA 1DYKA 1MPXA 3IIIA 3ABUA 1SCRA 4BMEA 2W7NA 1QZYA 3ZFEC 2Y9YA 2RREA 2VL8A 1CX1A 5HLTA 1F9NA 4A6OA 4KN7X 2P5KA 4UB6C 3OCPA 3HSFA 1Q8SA 5AVAA 5A70A 5GLZA 2D45A 3S7EA 1FMD3 3WTWC 3NV1A 1RIRA 4DXSA 2B5HA 1OF3A 5JZGA 4QU2A 5I93A 1AR81 1ZK8A 1MMDA 1ULGA 3QD6A 3ZSEA 1H6XA 3ZXLA 4A3IJ 2IBDA 3I7DA 1LVKA 4Q5SF 4QB6A 1R1TA 1W8UA 2RV9A 1SVLA 5DYMA 2VMEA 2K9SA 3GTPJ 2WC2A 4EATA 2H6BA 5C4WC 4JOMA 1S8NA 3T2PA 2C5DA 2WQ4A 2HEYF 1JUHA 1NY71 2D3SA 4HONA 5CKQA 4C0HA 3BQZA 2CWEA 1YWKA 5ILUA 3RPQA 3HOZJ 2X9DA 2RMU2 2H27A 1WMEA 2L9NA 3WX5A 5C5UA 4EQVA 5JSOA 2F2EA 1A8MA 3W5NA 3BG9A 4FETA 1S2EA 4FOQA 4BK4A 1AR92 1KITA 1US2A 1VIWB 4QTRA 3ERMA 4B7EA 1IDYA 3CUOA 3A03A 1J3RA 3ABLH 1HXS3 4QPGA 1W2TA 1X8MA 2Y0IA 1YJKA 3CJIA 3HQRA 3VKFC 2PHRA 3RZOJ 2O6GE 1RUH3 4I98B 5FKMA 5ANQA 4OQ9A 5C3OA 2VZVA 2HWE2 3AG4H 3I4NJ 2GZWA 1E5RA 3L9FA 4Y22B 1VQ7I 4ZZ5A 1IS5A 5D5VB 1JKQC 5A1LA 2PN6A 1VBE3 2LW8A 1SPPB 2DA4A 4CCMA 4B3AA 2LM3A 2R6QA 4YW1A 3O0WA 2A05A 4OI1A 1H6YA 4BACA 1MQTB 4BIFA 5DCFA 4M3CF 3E5QA 5F9TA 4FPEA 2Y8KA 3WHUA 3NNMA 4HW0A 4COWA 1F2NA 1PGL1 5D6FA 2BRTA 3S1MJ 1D8JA 4FTBA 5K5QA 2VG9A 5F64A 3GZNB 2OD5A 3GF2A 1Y6IA 1LNSA 4CYCA 4E7IA 2ZSHB 1XGMA 3D8CA 3ZMTA 1PP8F 1HRV1 4IGQA 3GTQJ 1TWGJ 3OEAA 4KMUX 1W5CC 4JCKA 2IXIA 1TWFJ 4A4AA 3BTJA 1ZREA 1DIWA 1MSFC 1WLWA 1W36D 1X9PA 1Z6TA 4A7ZA 1WCDJ 5HLIA 3ZYRA 4CU9A 2DW4A 1GUIA 1W6MA 3OYAA 3K70C 5BNOA 3IM0A 2COBA 2V72A 3R4SA 4GGGA 2Q1FA 2EJRA 4RB2C 1OXCA 2AENA 1KU3A 1YRZA 5J1XA 1WW7A 2A6HF 3B3QE 3PIJA 3O1RA 4XLPF 4ZXEA 1WMFA 3CP8A 4MNUA 3RIRA 2Z79A 2IEKA 3RSJA 1B9NA 4IJAA 5J1UA 1ETOA 2HBUA 2F4LA 1T08B 5GZFA 1Q56A 4SLIA 3LSPA 1ZZ6A 3HOYJ 2MEV2 5DAXA 1WCUA 5L19A 2FZ2A 4LA2A 3SH3A 2WQZC 4XNFA 3V7CA 4W65A 4OQ8A 2JDZA 1N3QA 1ZR4A 1G8WA 2NM1A 4HV6A 4PIZA 1T38A 2KFDA 5A7QA 4A45A 3SNMA 3O2PE 4JV4A 3REOA 1ZGAA 1RUI3 1Y1WJ 3CQOA 3KLOA 3GHNA 3PIGA 4ANJA 3S7IA 2XH6A 1ODDA 1W04A 5FZ7A 3K48A 1QJU1 5LLQA 2ZJPF 1JKPC 3LAJA 3CDLA 2DVBA 1Q5OA 5FJKA 3QYEA 1ZZ8A 2MC4A 2NVYJ 4AI3A 4NPLA 5LB6A 3IMNA 3T8TA 1SAXA 2P0WA 2ZGTA 3KF5A 5I8SA 1UCRA 1JGGA 2XHNA 2X6XA 4QPGB 2VTXJ 1ZBE3 3CJIB 2DVDA 5FCCA 4J6GA 5CKMA 1UU4A 2JDAA 1W2NA 2Y0OA 4GJZA 5FMDA 4A7KA 1DGWY 3S2HJ 4M73A 1MQTC 4Y15A 5TISC 3GZAA 4HNVA 1Z0HA 3ACLA 5CQEA 5DG1A 1D5YA 3JQXA 2WZ8A 4RLQA 2NXNB 1YW7A 5FYVA 1QGLA 4TXWA 1TNSA 2AREA 4JZRA 5JLWA 3QH6A 1OOPC 2VB6A 3J7AO 2IXHA 2I07B 3KGLA 3SZTA 3ZQLA 4II3A 2W1UA 3CDZB 3J7HA 4Q4Y3 4HX8A 4NIAA 3LSKA 3IAM2 1URXA 1WI3A 1VPHA 2A07F 1JJ6C 2MC3A 1VBE1 2OC6A 3GTLJ 3V8LA 2ZGQA 4HSJA 1ULDA 1LHWA 1WZXA 4G9YA 3EYPA 4QX1A 4AHXA 3V8KA 2LRPA 5EYRA 3I2KA 4CYCB 3M8LA 5KK1A 1U5IA 2YSRA 5FK8A 2Q8EA 3J4UH 3KPHA 3DFGA 2FNPA 3TO9A 1MZ6A 2DFCA 4W1UA 2QM3A 3T1BA 3I8TA 3MAJA 1A3KA 2CG4A 2GXAA 2K9NA 4AFDA 2VZPA 3LDKA 3PSFA 4E6KG 5BNOB 2WZR3 1KRIA 3I64A 3I56I 2F5CA 4GKYA 2QGUA 2HH9A 2WO2A 2XJVA 2NN8A 2OTJI 1MZ5A 1OUXA 2XLAA 1W1WE 5L3EA 1BBYA 4YIRX 2VULA 1T8IA 1Z6RA 5DDJ2 5FRAA 2NP0A 4EYUA 4OIPF 3NRUA 4A69C 1PMHX 4YFNF 5E20A 3OYCA 1PO21 4E9KA 2CO5A 2CSOA 2DO7A 1V5EA 2O5RA 1FPN3 5FXZA 2O03A 1MS3A 1U9NA 1V70A 1I3QJ 5FZEA 1X58A 1OH3A 1DQ2A 3I2GA 4Q1RA 5IYCJ 4NHMA 2GA1A 1UELB 3PO3J 4EEFG 4ZYAA 4O5VA 2DK5A 5FR3A 2F17A 2ICWG 3RZZA 1Y3TA 1HDPA 1IKQA 2QQJA 4LR4A 3HRSA 2E1MB 2M7AA 2JA7J 5CPRB 2G9FA 4ZYGA 2ZS6B 1C57A 4OIRF 3FXJA 2VBXA 3T0YA 2WO1A 2CQNA 2A70A 3WINE 4TTGA 1BLZA 4XJAA 3CHXA 3UK9A 3I2JA 3HGYA 5FY9A 4QPGC 4F3QA 4DUXA 2XVKA 3CJIC 1PZ9A 2IS1A 1AXKA 3C2UA 1MS5A 1GQGA 5C3QA 5GAHJ 3R4DB 5GADJ 3TN92 4FX4A 3WNNA 1TMF1 2BY2A 4DPNA 2R16A 3KV4A 2W84A 1RGSA 1S29A 2LLKA 3DU5A 3A7QA 1FZPB 2XSDC 2VCAA 5BNPB 1T39A 2V9KA 2LROA 2VOTA 4HL0A 3FHQA 1F1ZA 1I50J 2R7XA 3GBWA 4PGGA 4LK7A 1CAUA 2EH3A 1SD7A 4I99C 2X5IB 4AVSA 2PFWA 2YUSA 3K4LA 3HT1A 3HMYA 3MW2A 2RG4A 5AIPA 4FQZA 3SC7X 1RNLA 2DQLA 2QQUA 5JR2A 2CV1A 1PHMA 4KT5C 2WY7Q 4A7YA 1SLAA 3HOTA 1DQ1A 1UX7A 2E19A 2L01A 1Y9MA 2OX0A 2EK5A 4AVZA 2JSPA 5A3WA 3CCEI 3T3YA 4ENMA 3MEPA 1XGNA 2KIQA 3N35A 2HWE1 1T95A 1ZLKA 1UN1A 4XLAA 3HRUA 2DMPA 5BNOC 2B0LA 4AE2A 3KZYA 1D3YA 3L1PA 3VL9A 1YI9A 1TQMA 1HBXG 1Y9QA 1WA4A 1NK2P 4Q1PA 2JDYA 1SMTA 1VBB3 4IHYA 3JQWA 3M3OA 4CGZA 2BJSA 3I97A 5K1YA 1AR72 1HRI1 1UQXA 1XC6A 3ZR8X 3DTEA 1ETVA 4XRMA 1P7IA 1CIYA 4IGPA 5TSWA 1GNZA 2TRTA 1O3TA 1AR63 2VLAA 1X36A 2PI0A 4CUBA 3GXUA 1JH5A 2ZGRA 3L00A 3KYCB 3LQQA 3RYRA 3CUQB 3KF3A 4XFCA 4JRLA 4F83A 4NC7A 3C3WA 5C3SA 2JG9A 4HA8A 4AG4A 1AXZA 4J25A 2E1MC 2LF7A 2E7TA 4QB2A 1RR8C 1JUPA 5E1WA 3U37A 1RUC2 1O3RA 2YFZA 5H9QA 1FMVA 1UG2A 4IEZA 1JYXA 4N53A 3ZMZA 1G9CA 3O1VA 1RUF2 4AZZA 3TWIA 3MLJA 3S5AA 2B63J 2IXKA 2Y9ZA 1YQ6A 2Z3YA 1MBEA 4C1XA 2IRFG 4ZDPA 1RMU1 1CGPA 1VE0A 3LA7A 1V0AA 4XJZA 1JUSA 3HC7A 2JICA 4GKXA 2ID3A 1GBGA 1IRXA 5JR7B 2H09A 4KBZA 5CYYA 3CCJI 2GC1A 3WDVA 1S0EA 2JN6A 4IRIA 5BNPC 5CU1A 4PF5A 2XBO2 2R5YA 5H9PA 2Z16A 2WV0A 2GP5A 4E7LA 3TQNA 4BJ5C 4Z2WA 2LD5A 3BDDA 4E7KA 1UXZA 1KU9A 4HN1A 3HPHA 3OYNA 5H20A 4AU7A 3I4IA 4BXFA 1YI2I 2R32A 5ACA3 1OLMA 4WM7A 3MUY1 3TRSB 3DPTA 2WA4A 4L8QA 3AFGA 1WCSA 3WDTA 1XGSA 5FUNA 2FE3A 2VD7A 4WVZA 1CAUB 1V9U3 2UXNA 1TG7A 1RPWA 2TDXA 3RG0A 5FUPA 4EN0A 3S1RJ 1W99A 2CQ7A 2GMMA 1X1BA 1QU3A 3CMGA 4B8XA 2XF5A 1W2OA 3WDUA 3WNXA 4XKCA 3HT2A 5F3CA 4LA3A 3B73A 2BBYA 3E6CC 1CZVA 1JU4A 3BR2A 3HRTA 2RJKA 1V6LA 4Q4X3 4ASMB 4QMAA 3MV01 4CU6A 3LE0A 3K7AJ 4UW5A 1GYKA 3K2AA 4FBFA 1CF7A 5F3GA 1M06G 2QTWB 1OQDA 3K4ZA 2EZLA 4PDWA 1R00A 3UKNA 4CO8A 3CKHA 2AEZA 3FM5A 2E7AA 4YIFA 3NV2A 1VMFA 2P6HA 2ZGMA 3NKGA 1X2NA 4X6AJ 1IS3A 1DFQA 1FX5A 4F7ZA 4MQVA 1F35A 4IE0A 1RUD1 4B7KA 1NKGA 1FMWA 2A7AA 2NNYA 2L54A 2D3RA 1XDUA 2FDIA 2NVTJ 3CUQC 1EV12 4XETA 5GZGA 1MW7A 4DNCA 4QQHA 3DPRA 3SH5A 3SJMA 2QVSB 3J26N 3ZQ7A 1K78A 1OC1A 1YNAA 4BKXA 2K4JA 1L7RA 1R5ID 4DUVA 2BGOA 1FBQA 2ZNZA 1WLTA 5K8SA 3WGGA 4PFPA 3H5RA 1LFPA 1K79A 3WF3A 2Q0OA 3KGZA 4ASLA 4B1MA 3A0NA 1FMD2 3VWBA 5JUVA 3PUHA 4P00B 2OS2A 3VZOA 2JG9B 1WW5A 1MNDA 1ZKGA 2VTFA 5F0FA 4JVAA 4YVSA 3H8RA 2NQYA 1ZRCA 4YZ2A 4CE8A 2ZZQA 2ACJA 1NYWA 4N53B 5FQ0A 4BE3A 1IO2A 1FOYA 1IN7A 1CJDA 3KEYA 3U21A 2ZGPA 2M45A 2QYOA 4PI0A 3BR5A 2WQ8A 3B93A 2PBIA 3VDDB 3KT4A 2GQQA 2ETEA 5LA2A 5A7SA 2IVMA 1AUYA 3TW7A 2K3PA 3L2WA 4HANA 2HEWF 4AEDA 4R1HA 3Q5FA 4RGKA 3AKSA 1MS8A 1R5GA 4UHTA 1S1AA 2W1QA 1R1A3 3S32A 4ES9A 2HQRA 1K5MA 2R5YB 1ULOA 3RS6A 3OTFA 1HXS2 3HSEA 4XLEA 3GYHX 1S6LA 1JI8A 4FPHA 1X7NA 2DYRH 3QPSA 3N36A 3EUKL 3GTOJ 1MVQA 1RUH2 3FXOA 3BWGA 2W85A 4MIMA 3OOXA 1LULA 4WM7B 5JOYA 1Q1HA 3KYLA 2HWB3 2KP6A 5BV6A 2WLPA 3Q8BA 5ANNA 1W9FA 4MLOA 1WWXA 1TTYA 3MKZA 1MSEC 1J1TA 2XVLA 1GZTA 2BQPA 4BPZA 1S7OA 5GLTA 4V1PA 4XOGA 3LDBA 1LB2A 1XYOA 3A21A 2HI3A 2EIKH 5GKAC 1XD7A 4M9XA 4P5HA 1SBFA 4XILA 2R0QC 1ITYA 1C1FA 2GMPA 3ES4A 2WAFA 4IE5A 1Z77A 3NRVA 4OMDA 4ENKA 4DZJA 5IVCA 5J48A 3LSGA 4URTA 4HMZA 3LAPA 1LGNA 2YU9J 4N43A 1FAYA 5IP7J 1AU7A 4K1ZA 2P7VB 1A78A 3HNYM 2LKXA 2AO9A 3R05A 4YGBA 3BJ6A 1IZ3A 5IW0A 3AFHA 5I8YA 5GPAA 4PDWB 1AL22 4XE9A 1PGW1 2C9KA 4ORFA 3PMSA 1QOTA 4K20A 4M3GA 2L0KA 4XFIA 4FE7A 2VE1A 1DPUA 3ZXSA 3KEOA 1V6JA 2KRFA 3KQ4B 3POJA 1G3YA 3SHRA 2MFZA 5FGMA 5FZAA 4AYUA 2MH2A 3C7FA 5D8KB 3DN7A 2AHQA 2STTA 2VW0A 4JRAA 3N05A 2ADUA 1R1VA 1WH5A 2L5QA 1C4RA 4PF1A 1X1CA 4Z8BA 2EIBA 2JG9C 1OVPA 2VVDA 4GWMA 3FXMA 5A3OA 2PAKA 4J01A 4Y1ZA 2D5VA 3ILNA 1K78B 1U2WA 1NA1A 2M7BA 4L9NA 3GZ5A 5K7HA 3IIAA 2NZ9A 4UUSA 4ZONA 2LDUA 4K1YA 4PJJA 3AXEA 3RNSA 4XFFA 4N53C 4JC1A 4DFSA 2L7ZA 4AI1A 5FYYA 4YFKF 5D21A 4OVEA 5F0CA 4YM2A 5H9RA 2P5VA 3ZDSA 3VDDC 4KN4X 2D98A 3GBFA 2BVVA 2WBKA 1FOD1 4HKLA 1Z05A 2ZAAA 2D97A 1HKQA 3JSOA 3IAPA 1ZRIA 3BVCA 2JE9A 3JBG3 3LF7A 3ON7A 3POSA 1RUI2 5E89A 1HQNA 4XPVA 1VBC1 4GWNA 4YRDA 2BTVC 2WZPP 4DQ2A 1RUG3 1HV0A 4C2TA 1N1YA 2BZDA 1OLTA 2KMUA 4BQNA 2WUHA 2X53S 5A6ZA 1R081 4AEDB 3HAGA 4UUVA 4XRSA 5JOZA 4WM7C 1K5MB 1RUC1 4DOUA 2VBBA 4CRQA 4Z6YA 2Z33A 2VMIA 3HHHA 4XSXF 2WBMA 3WVJA 5DUKA 3GNEA 1TQ5A 5C44J 4R9BA 3EUHA 3G1OA 3I59B 4PT6A 2JD4A 1TME1 4G6QA 1BVVA 3DYMA 2VZRA 1Y1VJ 4Y52J 2OZJA 5IOZA 4UUTA 3OS2A 3QLQA 2VKEA 3WG9A 4XFAA 2EIDA 1LNWA 3GW2A 1BR4A 4A3LJ 4PZJA 2ELKA 2V1UA 2TCTA 4CEYB 3R4UA 4IEXA 4UFIA 5EEGA 1OR7A 4UFKA 2G1MA 2XBO1 1HQCA 4LPLA 4WWCA 2GDFA 4PDWC 5JIUA 1A6CA 3AYEA 4BL0B 3O3KA 1R9TJ 3OBZA 4BBSJ 4B4RA 2VOPA 3IB3A 5BS6A 4XEZA 1IC8A 2P34A 4XR6A 4Y1UA 4NHYA 5EYXA 1D2QA 2W82A 4F91B 3JR9A 4IXAA 1TT0A 4ABZA 1F5JA 4HX7A 3VBOB 3P3NA 2L02A 3K2ZA 4DXTA 3HJEA 2WL1A 2IWGB 4KICA 5A7NA 1UZ0A 1QJEA 1SFOJ 3DYPA 3FLRA 3IDBB 1SBDA 4KGQA 3ZYIB 3BCBA 4GMP3 1G3SA 5LHIA 4IHTA 3EHKA 3DUIA 3BTYA 3TBDA 3KZZA 2CGOA 3C3VA 4W50A 2WZR2 5F32A 3SCGA 2X29A 1MJAA 3FZVA 4Z82A 4BU2A 1O4XA 5FYIA 4COVA 5FZMA 3ASIA 4ESFA 5A6XA 4OZXA 5J36A 4ISQA 3QU3A 1EAH3 1GDTA 1NTCA 3WEZA 4JHTA 4EWEA 2WNEA 3KM5A 3POEA 1NA1B 3T0AA 3H92A 1BR2A 5TRDA 1S72I 4Y33A 2FDGA 4OZOA 4UUSB 3BTXA 3GX4X 3T5XA 4HKWA 3K4DA 5FPUA 1FPN2 3ZQQA 1VF9A 1UY1A 3NSTA 1V5FA 2HWD3 5JSRA 1LENA 3VB9A 2ZBJA 4FXKB 4X6QB 3J8F1 3B69A 2H1KA 1Z9CA 1XQNA 2UUZA 2YBSA 2Q30A 3Q9VA 1H2LA 3LZZA 1VB4A 4AVCA 5GM0A 1TLHB 2ZGSA 4CUGA 4AEDC 2JB4A 3VD7A 4LHNA 5I0TA 1UPSA 3GYDA 3WUDA 5HXMA 3O0VA 5LBFA 5HCBA 3WOGA 1K5MC 1NCRA 2LY2A 3NWKA 3VPRA 1B6AA 3PQKA 3H9JA 5K5OA 3PTRB 1BA5A 4BYYA 1OCPA 1FOXA 1F4HA 2L4MA 1AXYA 4S2HA 2GM4A 4XKBA 3PTYA 1QJFA 4GCVA 3RZDJ 3V56A 2WWSA 3Q9SA 2QQAA 2XQRA 4BJTA 2YY1A 1MBHA 1T6SA 1JYVA 2VT3A 4YZ4A 2M0CA 2X51A 1HXDA 1YITI 4NWVA 1H8VA 2A6XA 4FVVA 4ZC3A 5K0UA 2OV7A 4QM8A 3FLTA 3L2QA 5FOJB 2NMOA 3UJOA 4ESJA 1JGSA 4ENNA 3IDEA 2JSCA 2Z5UA 4CEYC 3R0JA 1ASJ1 2V73A 3LDRA 2A6TA 3GZ6A 3U4XA 2KIUA 3HZJA 5EIYB 2I74A 2HVSA 3ERED 3F22A 1WCMJ 4IO9F 1O8PA 5CVIA 4Q0UA 4AOCA 5IP6A 3SITA 2BVBA 5TGTA 3V0BA 3APBA 4DEQA 2GC3A 3D0SA 2VZ1A 3WNKA 3CCUI 2G9GA 3F8NA 2DXIA 4UW4A 3VBOC 2WS93 2ZHMA 2XAQA 1OYWA 3DV8A 5FPAA 4WZFA 4RQPA 1ZA4A 5KAIC 2XJRA 2K85A 5KR7A 2AH2A 4CHUA 1VQ9I 5K9YA 1NE4A 3O1MA 2JDHA 1LGBA 2E34A 4FTEA 2YS9A 1OUSA 4AQSA 1XS9A 1HW5A 5AC91 3QH7A 1BBT3 2P4WA 3WE2A 1O4YA 5E3NA 4XIOA 2RAEA 4IQPA 1MS0A 4LJZF 1W7PA 3KD4A 4YYOA 3VDBA 3O1OA 1V6KA 5GTHC 3FBNB 2ZZJA 3OYGA 3IKWA 1VBB2 4QHOA 1Q3EA 4QPOA 4PCRA 3P6BA 1W03A 3POYA 5FFOC 4O3MA 3ZN4A 4H55A 5KHIA 1GWMA 2LH9A 4AQTA 1NA1C 3ZOIA 4E4HA 1S0CA 3HEFA 1Y0UA 1HB3A 3S1NJ 2PXJA 2LKPA 2Q2EA 2W1WA 1MDMA 2ZHLA 3VSKA 1AR62 5HV4A 1SFUA 2AXLA 2FOKA 3ILFA 3D5RC 4AWXB 4IV3A 2LUWA 4LBQA 5LY1A 5FYCA 3W20A 5JIAA 4Q5OA 2Y75A 4M6YA 1D4M3 5CVRA 3OG2A 1AL21 4OUMA 2GALA 4LD5A 3DKXA 3I2FA 1JYTA 2F6BA 3C2GA 4RA2A 3WLUA 4Q4ZF 2K7LA 3QOPA 5DUIA 5EV7A 4JP0A 4DBQA 2G7HA 4QPYA 4XQFA 1KGSA 1HV1A 2OUHA 2RS13 5CFCA 3RGBA 5F6LB 5C4JJ 1NZCA 2P2KA 3NWTA 2XLGA 2DFIA 3OWTA 1UY2A 2Y38A 3SFIA 4R52A 3MFAA 5J37A 3VKLA 3RKYA 1YQ5A 1NCQA 3OYKA 4OULA 2J1RA 4QT6A 2F5DA 2G19A 4NPMA 2YDEA 2QZ2A 2P81A 1PM4A 4PJNA 3CCSI 4IEQA 1GLHA 1NCRB 4GYIA 2VQUA 3IH4A 1CQ9A 4RDUA 3EUHC 2FBKA 3LSRA 4ZZ8A 1S3JA 5HCAA 2J1AA 4O7XA 3VBHB 1TP4A 1DGRA 1QXRA 5FJ8J 2YR2A 1YC61 5D5WB 3EXUA 2EPFA 4Q2FA 1BI3A 1FIPA 2YX4A 2YC2A 5ACA2 5K0UB 1JZ7A 3RRDA 1X2MA 4B09A 2C24A 1AYN1 5CYVA 3S30A 3FMSA 1JOPA 1V9U2 1GLNA 5IVJA 1OR7C 4PQQA 4XZPA 2EV0A 3H1YA 3THDA 2WWUA 5A3PA 3DYOA 4M0NA 5BQTA 3FFZA 4AWDA 3RZLA 3V0BB 1ZARA 3IC7A 2QQOA 4G94A 5FKLA 2XHKA 3EJKA 3U11A 2R073 3BTCA 4PJ0C 3KP6A 4Q4X2 1NX9A 1QGPA 5C8CA 2FMYA 3PVOA 4UBGA 2JWTA 2XJSA 2XL9A 4CA0A 4I09A 1A5JA 1KD7A 1SD4A 2DCKA 1BXHA 5F5QA 4BE1A 1GICA 2WNUA 4FSJA 2YHJA 1YW9A 3WDXA 4YZ1A 2QNKA 2IS2A 2HXOA 1LHVA 4XM3A 2B9SA 2PELA 4QDSA 2HWC2 5H2FC 3ELKA 1OA3A 2W52A 3PJQA 2I2SA 4N4OB 2JZYA 1W7PB 2OQGA 1W8HA 4H2AA 4TWTA 2VKHA 4CCKA 4I76A 2VBZA 3IPVA 2F6CA 2YGLA 4CA9A 5A3NA 1GXPA 4LKEA 1X3UA 1YYVA 1S7AA 2WT2A 3MCZA 5FBJA 4K9SA 5JPNB 4RGUA 2CW8A 1LFBA 1VNDA 2R7QA 4EGYA 2EILH 5ED4A 2O7OA 4AM3A 5KXDA 3I54A 1YFYA 4BWOA 3LSDA 2DK8A 3GCXA 2Q2EB 4PIXA 1MDMB 1XSQA 5DEQA 3ES1A 2XRLA 4D0PA 2NS7A 3ZCOA 2ZTNA 2UV1A 4IV3B 4BOWA 4Y7NJ 4LBQB 2BNMA 1JZ8A 1J9IA 3CTAA 2IVJA 1Z91A 3H7JA 3KX2A 4P9WA 2E63A 1FV2A 1GP4A 1QQP3 2DU0A 4WF2A 5A1FA 1JUIA 4JDNA 4KQ7A 2RR11 1GZWA 2DJNA 1OCTC 1J5YA 3HNMA 2HYGD 4OIOF 1GSLA 2DMUA 2C9AA 1B35A 1WGPA 3O12A 2PHLA 4GWJA 1W3XA 3MKYB 5CFCB 4KIGA 2K9ZA 2Q0AA 3LA3A 1NCRC 1BCXA 2XWJB 2XVCA 5LEKA 2Y6KA 3OEBA 5HI0A 2C6SA 3UKGA 1O57A 1VQ6I 3BIEA 3GJAA 2VE8A 3UGFA 1TT5B 1I6XA 3VBHC 4QX8A 5LK5A 1JT0A 3H3VK 2VVFA 4S2DA 1IOAA 1PO12 4FI9A 2PHXA 3N7KA 4QX2A 4FHTA 3RFRA 3HVDA 4RS8A 2VQ0A 1FBSA 5BMZA 1BJZA 4TN7A 3TB0A 3QAHA 3EMRA 5K0UC 1R1A2 5BUVA 2WFF1 5ABJB 2YC0A 1VBD3 2W2IA 2X6WA 1KFUL 3ETQA 5T3NA 4O9GA 3F8CA 5FZ4A 1VJ2A 4ASKA 2RM23 4W6WA 4M74A 1HB4A 4N7IA 4QGNA 2HWB2 5FPVA 3RYPA 2DOAA 4LOCA 1QJY3 2XB0X 4YFZA 1D1BA 2ZJ2A 5HDNA 4HQMA 1TNFA 4META 1K7AA 2ID6A 1A8DA 3MUZ1 1I1SA 1PUFA 2E2HJ 1PIV3 4E27A 1GNYA 2DT7B 4GFBA 5FZBA 2BOIA 2KIMA 3MIBA 2K0GA 3T09A 3S17J 3ZMDA 3ZVXA 3OYLA 1SVOA 1YE9A 5FXVA 3VKOA 2ZGLA 3J7ZI 4HSRA 5FZIA 5C8CB 3NNLA 2Y31A 2P3YA 4RMNA 4FOYA 4L9JA 3VDCA 1QJX1 3KV6A 4XUOA 5GLWA 1H88C 2ZEXA 1AZDA 4IEYA 3IRQA 3CCLI 4FXGB 1QH7A 4MFDA 4BHBA 2WN3A 2QZ8A 2V4AA 3NAPA 4CCDA 2LKSA 5I91A 1BR1A 1U78A 2X4HA 1IPSA 4RAFA 2L9SA 1KDMA 2M34A 4BUPA 3IPVB 1SAUA 1G3WA 1U8RA 5A2QK 4J1WA 4ZPIA 3OF1A 4ZU4A 2D43A 4IV3C 1COV2 4NOTA 1X3WB 3F6OA 1ENSA 1IS6A 3WF0A 4MXVA 3Q8CA 3AKQA 5CFDA 2RDRA 4EJVA 3ZXKA 1H0MA 2VOOA 2WNOA 2GN3A 2DTWA 5IUQA 4IPAA 5FPBA 2KLOA 4KL1A 5CFCC 4TV7A 1HB1A 3OYFA 5I8TA 3HJRA 4FFGA 3LQRA 4JQTA 4XKWA 1YYNA 4LG0A 4NO4A 4P9YA 4NB5A 3RZJA 4AI9A 3U0ZA 2IGOA 5AVPA 5LZ6A 4GA9A 1R1UA 3FMQA 1NCQC 1BIAA 1ZHFA 3OGRA 4IRGA 1CWPA 1ULPA 1B35B 1FEXA 3OY9A 1Y39A 3JBG2 4L11A 3LL7A 1VRH3 3M1CA 1PVC3 1I27A 1KGYA 2GOMA 5T5PA 5E3LA 5ABJC 2Q5TA 3SEQA 2R7ZJ 1H1IA 4P14A 5HNHA 5JOXA 4FOVA 2HWF1 1GV5A 4O65A 2QFEA 4DZGA 3HOUJ 1ZZBA 4LKDA 5K7FA 1EUTA 2NRAC 4YVWB 2M3AA 3WCRA 1D1CA 3WTSC 1LESA 4AGVA 1LU2A 1AVBA 2HYFA 2E7WA 3UYJA 1GP6A 1RVF1 3IRRA 1Z78A 1JZ5A 1UOFA 1HN1A 1P92A 3KE2A 2QLZA 1R64A 3M8FA 2EFWA 2E7QA 3ALQA 2D44A 3KP2A 4WM8A 3U4SA 1F5TA 2XB6C 2A5WA 1LHUA 1UZYA 4FP2A 4K8RB 3RI4A 4L97A 3GFLA 4EN6B 5K7PA 1T56A 4Q4W2 5L3FA 1CVNA 2AQFA 2IXJA 1W9TA 3F9KA 1NLQA 2L2OA 4FTSA 4LK1F 2JG8A 2QQNA 5C8CC 1PJRA 5L9VA 1PUFB 4NC8A 1XN7A 1E3PA 1F4AA 1OPCA 2VNRA 3U78A 2K9QA 4IQ4A 1FNNA 2HTJA 2WNUC 3VZJA 3ENRA 3D5OA 2GNMA 1LHNA 4EMSA 1MZBA 3L2RA 1GOHA 2OZ6A 2PLV3 4YGDA 3ZQCA 5EZGA 3LA2A 1QBJA 4QDRA 2XJPA 5HDGA 1DG6A 2EALA 1G9AA 3G1LA 2A5YB 2X1DA 4P9JA 3OUIA 2HFHA 5A3LA 5BYNA 4LB6B 1FP1D 4HV5A 2XKPA 4HF2A 5IATA 1V6MA 3DKYA 4K3UA 3UJQA 2Z69A 3MW4A 2V9VA 3WU0A 1JYIA 3NAPB 4GWIA 1AYM1 1AL0G 3T0BA 3MKWB 3SLIA 4LMFA 4UBHA 4ENJA 4OLLA 3SEEA 3KYDB 3AAFA 1U5ZA 1BMV2 2MYSA 2CW7A 4FCYA 1QF3A 4CUCA 3TP3A 3THCA 2LALA 1XMAA 1LODA 1LR5A 1SDWA 1EAH2 3RMYA 3GFIA 4JDMA 3HBKA 4C3HJ 4IHVA 3H0OA 1G9FA 5DZGA 3HD8B 2EIMH 4WCGA 2GU9A 4HVRA 3N7LA 4JAAA 4PLMA 3ZN1A 3BZ6A 3WG3A 1ULFA 4NUBA 4MUVA 1AJKA 2QQMA 4A3MJ 1FNZA 1B35C 1PP7U 2ZAHA 3IT8A 3C7GA 4GQ7A 3ZXJA 2PHUA 3J7AY 1OD3A 4YZ5A 1YFWA 3K0LA 2HWD2 3KS7A 4LG0B 3PL0A 4XVHA 3KFWX 5FB2A 5FK7A 2COMA 1JYWA 1ZYBA 3EYYA 2V26A 3MBWA 2RS51 2E7XA 5HS7A 4RR3A 1EH6A 2GWRA 1EP0A 2VCMA 4D7YA 1NXMA 2FU4A 4YVWC 1GQHA 4UFMA 2ZO4A 1AX1A 1XNKA 3KP5A 1SD6A 3CZ6A 4LO7A 5IJRA 1WA6X 2DCJA 2VASA 1W8WA 3UKTA 2ISYA 1QO0D 1HN0A 3HKZA 4NN0A 4IVNA 2ZKLA 3VOEA 2K86A 2M8GX 1VMJA 1W0PA 4BLIA 1QJZA 1FSHA 3U9GA 3BOWA 3WTUC 4XF1A 2VJ4A 4JX4A 1IF1A 5DAVA 1R4NB 4PLNA 3W2AA 2WB1N 4BDVB 1KS4A 3BU7A 3G3ZA 1JZ6A 1ZGWA 3E6MA 4JKLA 5FWJA 3KETA 2E60A 2PAEA 3VGIA 2HKXA 4WM8B 1QOSA 1IQAA 4XFHA 2K40A 1HKTA 1I39A 1R1ZA 1DGLA 5F3EA 3K46A 4ATFA 1JW6A 5H9SA 3BR3A 1E3HA 1KS5A 3GCWA 3G73A 4BMBA 1U3EM 2E2IJ 1PO11 3FM3A 1AOYA 1W8FA 1MBKA 3L2YA 4MX3A 2PQ8A 5FZ3A 4U0WA 4FCAA 4RS5A 2YB7A 1WI9A 2FOWA 4OFGA 3SXYA 3R0RA 1W6PA 2WS92 3NMBA 3VN4A 2R0HA 4AQ6A 1LOBA 1OD5A 5ICFA 5EXOA 4Y17A 5HV0A 2WA0A 4C2MJ 2BOJA 3NAPC 1MEC1 1VQ8I 4JX0A 3DKQA 1X9TA 4LLFA 1UMQA 4LJHA 4LBKA 4C9YA 3KP4A 2W4SA 2UU8A 1BBT2 4N90A 5IT9K 4ZU5A 2GC2A 2PN5A 1LEAA 1W36C 3IDCB 4EE2A 3OYMA 4W8JA 1ZRFA 2BY3A 2OJED 4MHGA 3ZO0B 4KH9A 3FLPA 3HBLA 1YJNI 4RGRA 1SFPA 1UPIA 3WHBA 3OBAA 3TO6A 1NLRA 1IXCA 2VQHA 3MN2A 3DBHB 4PDKA 3L7WA 2KRHA 1I9RA 4YARA 4EQQA 3S0MA 4CPBD 2IGNA 2VUAA 4HK9A 4IQJA 4K7JA 1G9DA 2D6MA 3KMHA 1WLCA 2H8WA 1KQ8A 3GFJA 3CCYA 4L5JA 2XGDA 3DL3A 3WUCA 1D4M2 1XNAA 2VBYA 2W0XA 3KZIC 3M1EA 4I30A 2MSYA 1H0BA 2QBXA 4KITB 3NVCA 4XFGA 2P3JA 2BP6A 1YIOA 1UO9A 4LO6B 2RS12 2RKHA 4ZDLA 2JB8A 3BCWA 1QH6A 3GWZA 4BA6A 4IRHA 2R1DA 1COV1 4RR3B 3J9SA 5LGNA 3IBMA 3TAYA 3AMMA 3POFA 4LLLA 2VNVA 3D6EA 3ZQFA 3JREA 2VUMJ 4F93B 1ZQ3P 2PHTA 5GALA 2P5LC 1OHFA 1OLQA 1UZVA 2BPA2 4LLGF 1USTA 4CXFA 2QBYB 3LWCA 5F6FA 4P9IA 3LCPA 1YJWI 4KIFA 1QQIA 3WP5A 2A69F 2CAVA 1IV8A 4E4ZA 4WM8C 3L2HA 4IE6A 4ATEA 2V4JC 2NLRA 3LD8A 1POGA 4D6RA 2QQPA 1CPMA 5FZLA 3ZSMA 2G7UA 1JE8A 2JE7A 3RQ4A 3ZMUA 1XU1A 3K2OA 5J8CA 2V1NA 2LFBA 4RSUA 2HVQA 5DPNA 1YFHA 3S16J 1XMKA 3K1PA 4M3FA 4EJWA 2JECA 2ZX1A 4X0GA 1E5SA 5JSPA 1B59A 3M70A 2DCEA 2UZKA 3MEXA 4URAA 4MTDA 4BXSV 1UAIA 4MH0E 3SH4A 4XQ4A 3T2OA 1HLCA 4GRIA 4FPFA 3CLOA 2WINB 1ZBA3 5F37A 1DP3A 1H8AC 2R072 3PLQA 3JRBA 3HRMA 1HX6A 4Q8LA 3OUHA 4CICA 2A3XA 1W2UA 5KXBA 3CJTB 3CJQB 2IFWA 1W6PB 1FYMA 2E6VA 5FYUA 4ONUA 1GMMA 3UESA 1FNYA 5LRRA 4QB1A 1MACA 3RJ2X 4IE7A 5DM7F 4QX5A 1OFNA 2ID4A 4PJLA 2PJPA 1Z7LA 2JDUA 3LNQA 2WDBA 5IK5A 5T55A 3RZHA 2CUEA 1KQ0A 2V6CA 1GOGA 4UAPA 4DJAA 3DLLF 1SFKA 2OPTA 2YPDA 5IK8A 2MW8A 4EN8B 4IX7A 5F5IA 2LREA 4Q4W1 3IZOA 1KU2A 1AR83 3QYFA 1G7YA 3BZCA 2VY0A 5EJ3A 4KT6A 2GSYA 3GUDA 4C8DA 1O7FA 5HCFA 2SLIA 1UYXA 2KKOA 4KMFA 3IWFA 2R5ZA 1SFNA 2O1QA 2OA4A 3I3EA 1R22A 3ZPYA 1RUJ1 3N9LA 2HPMA 2P1BA 5DTDA 5E1ZB 1YIPA 3S93A 3UR3C 2O0OA 2D1HA 3HOWJ 4XABA 4AEJA 1IRGA 5D8AA 4RR3C 5FY5A 1F31A 5JXGA 1QQP2 3ZMNA 3R4KA 1VBA1 3KVBA 3IKVA 2X6YA 4OMZA 1MVEA 1ERDA 1EV7A 1WRJA 1HIXA 2GC0A 5HCHA 2M0MA 1Y8RB 3WP6A 3Q0WA 2VH9A 5CLSA 3WF2A 4I0AA 1S0FA 2JIJA 1FBUA 5KVRA 1SEFA 3RKXA 4ITVA 4NBQA 2J42A 1NOVA 2VO5A 3KEQA 2FCUA 2GNDA 2PAMA 1MNEA 4RA0A 4YG2F 2XJQA 2P17A 2IGMA 3CMEI 2ADDA 2VNGA 3AMHA 3BR1A 1D0XA 2BXYA 5FD6A 2R7OA 2ZJQF 2DUOA 2BEOA 3S57A 4CH7A 4KU7A 4WBBA 2P6CA 2ET7A 4XBFA 1XCBA 5IYBJ 3OR1C 4OMYA 1TWHJ 1VBD2 5JMCA 2TBVA 1H30A 3LGRA 4G6DA 4AFCA 2X0LA 1Y56A 1FYUA 1K12A 3D4KA 1JI6A 3FJSA 3VHNA 4GAZA 1OSGA 2A75A 3TYJA 1POV1 4QQ2A 4UV9A