1J59A

Catabolite gene activator protein (cap)/dna complex + adenosine-3',5'-cyclic-monophosphate
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
199
structure length
199
Chain Sequence
PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the CAP-DNA complex at 2.5 angstroms resolution: a complete picture of the protein-DNA interface.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords 5'-D(*GP*CP*GP*AP*AP*AP*AP*GP*TP*GP*TP*GP*AP*C)-3'
total genus 53
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1j59A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1j59A01
3F6VA 2QWWA 3U9GA 1EPZA 2A68F 1XSXA 5BMZA 2ESNA 2OBPA 2FQ3A 3F23A 4BXUA 3K2ZA 2IXHA 4FBFA 4L5IA 1W7PD 1XMKA 3M1EA 2MH9A 3G73A 4LA2A 1ZZ6A 3I59A 3DPLC 5BV6A 5I8TA 3G3ZA 5DCMA 4PDKA 2IA2A 3T0YA 3P7NA 2XL7A 1K6OA 3ES4A 4FAGA 2OAZA 3WTYC 1Q43A 2B5HA 2IXIA 5J8CA 4YYOA 2VT3A 5DV5A 1U5TA 4BH9A 4MEYF 5FDBA 5HS9A 1IW7F 1MDMA 1WQ2A 4KIFA 4MGKE 3HUGA 1FPQA 1KGSA 2QQ9A 5EEHA 2EFWA 5D5VB 4UUVA 2VQAA 1BI3A 3V4GA 4EM1A 1V70A 1R58A 1QQIA 5JAXA 3TOBA 4QGNA 4ZH4F 3EUHA 4LB6B 2XLGA 1H0MA 4XF1A 2ET7A 2BYVE 4YFXF 3HTSB 3GFJA 4WK8F 4KU7A 2V6CA 1D3YA 1U5TB 2RDPA 1O57A 1U2WA 2JPCA 3LQQA 1T38A 1O5LA 2Z3YA 2QM3A 3KP3A 4A0ZA 4O9GA 4O3MA 3M8EA 4GGGA 5AIPA 3HSEA 4GO1A 4CICA 1YLFA 5DD4A 2WTEA 3COAC 3H1WA 4HMZA 1S7AA 5ICEA 3CEWA 2VN2A 3RNSA 3S7EA 1I5ZA 2HS5A 5J48A 3M3IA 1IXSB 3ML6A 3Q9VA 1XGMA 3HOTA 4IEYA 3GZ5A 4GYIA 2MHFA 3E6MA 1AOYA 3LA7A 3H92A 1WLTA 5LEJA 5JVTA 2IVMA 4I98B 2VC1A 1YLLA 2DO7A 1RUOA 4G7ZF 4M6XA 5I0TA 3GZ6A 4Q4ZF 4Q0UA 3F3XA 1K79A 4GULA 3MWMA 1JGSA 4ESFA 1OI6A 2B8MA 2XROA 4O6JA 1G6NA 3JTHA 4NHJA 3IBMA 1KA8A 4HW0A 4KU8A 4WXHA 2H94A 3DXJF 3LQRA 4MGYE 1X82A 2X0LA 5KHGA 4I02A 4AQ6A 5IT3A 1ZRRA 1SD5A 2GAUA 5C6CA 3CUQA 1CF7A 3I53A 4KN4X 2TDXA 3GYHX 3CJNA 1KU3A 2QJVA 2D5HA 4Q29A 4XFFA 1D8JA 3NSTA 2OA4A 2MLKA 3R0JA 5KHIA 5CVIA 2Z33A 5H20A 5IT9K 3LWCA 1P4AA 3I71A 2ESHA 2O8QA 2CG4A 2H6CA 2ZMEB 1VJ2A 4ZU5A 3VOEA 1QGPA 2IRFG 3KSCA 4ON0A 1O7LA 4JV4A 1KYWA 4IPAA 1K78A 5CYVA 1OFNA 2XKOA 1QWRA 3MZYA 3EQEA 3NL1A 3KCCA 4YG2F 2OA2A 3WU0A 2PYTA 1T98A 2PN6A 4XFIA 3WE2A 4XSZF 2IPQX 1FXZA 1Z7UA 3DN7A 5J3UA 1LQ1A 3M70A 4FT8A 3BJ6A 2I45A 4OFGA 1EY2A 2M8EA 4WX9A 2C0ZA 4OMZA 2QBYA 2GH2A 2LKPA 3KP6A 3H3UA 4RGXA 3MQ0A 2WFPA 2D1VA 2AXLA 5DDGA 4KYWA 2D5FA 5JCTA 1VTNC 1UCRA 4GCVA 4TV7A 1NXMA 3GUDA 4AWXB 1ZZ9A 1XGSA 3LAJA 5EEGA 4M74A 2ETEA 2GA1A 3BOQA 3V7CA 5LGUA 1I1SA 4KFCA 2RGVA 1RZ4A 5ILUA 2GWRA 2IP2A 3TQNA 2M1BA 4RGRA 2O1QA 1B9NA 4IEWA 3JW4A 5J8FA 1U12A 2O61A 4IRHA 3DFGA 4HN1A 3ABUA 3CUQC 2VBZA 5CVRA 4UHTA 3WODF 2FRHA 3IIAA 4XLPF 4LLOA 3NEUA 3PNAA 4FAHA 5DCMB 2HEOA 3KP7A 4U0YA 3RDIA 3BWGA 4NVPA 1ZRCA 2QNKA 4KA4A 1Z05A 3OF1A 3T5XA 1Z6TA 4QWQA 5JR3A 3J7AO 1O5UA 1ZZ8A 3KZYA 4E2QA 5H6QA 3BP8A 1ZH5A 4META 4E2SA 4G7HF 3KEOA 2STWA 2Q0AA 3HHHA 2D40A 3H50A 2K27A 1UHMA 1ZLJA 3GO5A 1HKSA 3CLPA 3RZZA 3WTUC 3M8FA 3FZ3A 1W7PA 1OR7A 2VC0A 3K9TA 4XETA 1ZZ7A 1DUXC 1FP1D 1CX4A 2YX4A 3GX4X 3SHRA 2IT0A 1YO5C 1CAXB 2ISZA 5A2QK 2FE3A 4YIIA 4OU0A 4EWEA 3GFLA 4MGIE 5KBFA 4M73A 4ONUA 2CWEA 3L09A 3OOPA 2L3DA 3KP4A 4Q0QA 3QACA 2NYXA 4HVOA 4KMUX 4IF4A 5FLXK 4ZYEA 4AXOA 1J3RA 4WWCA 2PBIA 4OIRF 2RQPA 5I8YA 3ZMSA 1LRHA 2EV6A 5ILVA 2IXLA 4IEVA 5BPDA 4E2GA 1E2XA 3FM3A 1YFWA 4G94A 5LRSA 5BS6A 3BPVA 4QX5A 5BY5A 3N4MA 3PQJA 4IESA 4U7DA 2JZYA 3D5LA 1J5YA 2GC1A 1GXPA 1FWZA 2A6HF 1IXCA 2UXXA 1DP7P 1F4KA 3M7GA 4FX4A 2K0GA 1ZZBA 4HSJA 3ACLA 1P2FA 3ABTA 1J58A 3ISPA 2CSOA 2DI3A 4G6QA 1I6XA 4JBAA 1FY7A 4IVNA 4E70A 1UHWA 4EROA 4MHGA 3O6BB 3U1DA 4YRDA 1ONVA 4HLXA 4HSLA 3F8CA 1ZG1A 3TO6A 1G3YA 1VR3A 2QUFA 1DGRA 4M9ZA 1UCXA 2F4PA 2N7GA 3RYKA 5CVUA 2FSWA 2P4WA 1XGNA 3E97A 1P6RA 2K7LA 1J7KA 4ETSA 3GF2A 3PFIA 3KLNA 2KIMA 3V8LA 2X4HA 4IRGA 1WI9A 1OYIA 5K5QA 3IKTA 1ZHFA 3CJXA 1B4AA 1U78A 1EV7A 4BAYA 5EZWA 4U0VA 2L02A 1F1ZA 2H27A 4EQQA 1Z6RA 3HOSA 3BCWA 4X6RB 3JAMK 1JXSA 3T8TA 2PFBA 2Q4SA 3I4PA 4UBHA 4LK0F 3JAMZ 3BJAA 2WWYA 2D1HA 2HOEA 3FXRA 4A0XA 1T6SA 2D93A 2MA3A 5K5OA 2PLYA 2GQQA 4IERA 1ZG3A 2XLAA 2P6TA 3ZMZA 1J75A 4J1WA 2DK8A 1FC3A 4YFKF 3RYPA 4HF2A 4S05A 1NE4A 1TQMA 3F8MA 1QNTA 2EWNA 5T3NA 4XFGA 3TNPB 1MD0A 1Z9CA 1J59A 1TQ5A 4I09A 5FPZA 2LF8A 4LD5A 1BI1A 1R1UA 3KFWX 3I0TA 4L5JA 1BIAA 1UW8A 5KVRA 3FFQA 2R7DA 5DYMA 3KETA 1QY4A 3FXQA 4MZUA 2BV6A 2HKOA 2FNPA 5DUKA 1TNTA 2K4BA 2JTVA 2FEZA 3QPHA 2FBKA 2PTMA 3DL3A 3VEPA 2DPUA 4ZU4A 1A04A 4EM2A 2CYYA 3WW3A 1R1TA 2ATFA 1J3PA 2IC1A 3DV8A 3QOPA 4HVRA 3N97A 2DTRA 4P9FA 4LLGF 2QQBA 2JRTA 1P92A 4HV6A 5JHUA 1BJAA 2ZO4A 4LG0A 1O7FA 4MNUA 1CAUB 2FA5A 3C7JA 3QP5A 3PLQA 3KGZA 3CDHA 2ZXJA 3HTUA 4EMSA 3RKWA 1DZTA 3HHGA 2HTJA 3ZMUA 5I0SA 4BHBA 5FLIA 4ASNA 1RI7A 4UVBA 2OQGA 2QBYB 3Q9SA 4MEXF 5K8SA 2PHLA 2BNOA 2UY8A 2W85A 4AIHA 3FMQA 2IJLA 5E8IA 1ZAOA 4JQFA 1PP7U 1R23A 1WRJA 4LEJA 2KRFA 4PIZA 1KU2A 5CU1A 4UBGA 3TKYA 3MAJA 3ZDSA 1XB4A 4YARA 4UV8A 1YHFA 5KK1A 3S7IA 1SMTA 5ED4A 3F22A 2NNYA 1XE8A 4UVAA 3JTGA 4RAYA 3P9IA 2D45A 1UIKA 5JSPA 4P96A 5F6FA 2G7HA 5K1YA 1ZREA 1TNSA 5FCCA 1LDDA 1Y0UA 1ZLKA 2EVXA 3KZZA 1YQAA 1QBJA 3UKVA 5BQTA 3WE3A 3V8KA 4UVCA 2P5KA 2EA4A 4KUMA 2FNAA 2GC3A 2FF4A 1W5TA 5AIQA 2CV6A 1ZGAA 2BNMA 2IXJA 4R1HA 5ILSA 1L3LA 2Q8KA 2M30A 2XLFA 5LHHA 1Y9QA 4LJZF 3D0JA 4MH0E 1FI2A 5FD6A 1YW7A 5D8KB 5L3CA 3DQVC 4BHPA 3KP5A 2XHKA 3EDPA 1T0FA 3L9FA 1B9MA 4HF1A 3BDDA 2V09A 4LLNA 2VBYA 3V7SA 4KL1A 1RC6A 2GXBA 3KGLA 2W25A 4JVAA 3PVBB 4CO8A 4M9XA 2VOOA 2K02A 4L0YB 4L18B 3FJSA 1B6AA 2ZCWA 3CLOA 5HDGA 3VODA 2XAFA 4AVAA 4BQAA 1XDSA 1T2KA 1LJ9A 1HKQA 4ZYHA 1RGSA 1J3QA 1T39A 3ECOA 2J5PA 3FMRA 4XF3A 3HRTA 3GW2A 5HS8A 3TGNA 5D1IA 4H7LA 3CTAA 3KE2A 1BOAA 2EFNA 3CO7C 5FGMA 4AIJA 1ZZCA 2W57A 2VPVA 1XSDA 3H7YA 3E5UA 5HLHA 4EGYA 1E17A 4EM0B 3HT2A 5E18F 3ZQ7A 4A0YA 1XN7A 2F5EA 4EJUA 1SD4A 4A5NA 1FYMA 1ON2A 4HX8A 1BBYA 5TRDA 4OIOF 1JHFA 2MBFA 2H6BA 2RN7A 5I0UA 3SCGA 1TQIA 1IPJA 5CVJA 3G7DA 4MTDA 2HFHA 2XAGA 3EBRA 3U0ZA 4I0AA 3E6DA 2H09A 2CAUA 1Q3EA 2LF7A 4PIXA 2ACJA 1GXQA 1OYWA 2Z5UA 3RJPA 4MGZE 1B1BA 2DK5A 3WG9A 4LK1F 5H6RA 3NW4A 5HLGA 5BPIA 4XFAA 3QU6A 4IEQA 1I27A 2HGCA 5FD5A 4PGHA 1O4TA 2NAZA 3D82A 1KQ9A 3ZMVA 1LEAA 5D6EA 1J9IA 1O3QA 1S3JA 4L11A 1DPUA 2J5OA 4P5OA 5ICGA 3SXYA 2F5FA 1LR5A 4CDGA 3E3VA 3DPTA 3S0MA 1R5HA 2P5VA 3SFZA 1OD5A 5EFUA 4B29A 3LAGA 3H1YA 3ZMDA 4Y15A 1CAVB 4WCGA 1FBQA 3RIRA 4HLYA 2IW5A 5LLQA 3T1BA 2RV8A 1H1MA 3IWZA 1ZARA 2K86A 2CAVA 4S04A 2CO5A 4LG0B 1YS6A 3L7WA 2A3SA 3I58A 2O8XA 2HQNA 4MQ9F 1CAUA 3FZVA 3IHUA 1BI0A 3MEXA 3CF6E 1ULYA 5I0RA 2MH2A 4CXFA 4HBNA 2HWVA 2PAKA 1W7PB 1R36A 5DCFA 4I01A 1FBUA 2IA0A 3F8BA 2K9ZA 1S7OA 2PQ8A 1HW2A 1FYKA 4HX7A 5CLSA 1FX7A 4HOBA 1BC8C 2EAAA 3PQKA 1YW8A 3O3KA 2R3SA 2UYAA 1HQCA 1TBXA 1CAVA 4ORFA 2XAQA 3K1PA 1J1LA 4P9GA 5D5XB 2ZMEA 2DQRA 1YFHA 4QXKA 2DT5A 2VECA 2ET1A 3HSFA 1FT9A 1O3RA 1PUEE 1Y3TA 2DLLA 3WW1A 5ICCA 2HDCA 4RD7A 1SMYF 5JSOA 4IEZA 3WTWC 5J6XA 3ZMTA 3QRFF 1SFEA 2OZUA 4ESJA 1DPRA 1ZG5A 2PAEA 4LUMA 3U11A 3WTVC 3TDZC 1GHCA 1PMIA 3ECHA 2GC2A 5E8GA 3FX3A 5KHKA 1SFUA 1PM7A 4N9HA 3RPQA 3LAPA 2EFQA 3BROA 4M9SA 2O3FA 1TLHB 4XLNF 2ETHA 5BXXA 3I5UA 1ZNPA 3CL1A 2QCSB 1ZYRF 1G3SA 1J2XA 4MX3A 1ODDA 1YYVA 2M5WA 3IWFA 3OV8A 2VONA 1MJAA 1KU9A 1R5GA 2PJPA 4I7HA 4DINB 3F8NA 2BE5F 4P9UA 4XFHA 1QZYA 3MDPA 1DDNA 1SAXA 2PEXA 2BGCA 3U10A 4TLFA 1S8NA 2KJBA 3I54A 2FXAA 3SZPA 2Q30A 4ENKA 4QGLA 1VP6A 4R52A 1YS7A 3H1MA 2IXCA 2QENA 4KNYA 5BOXA 3HQXA 1YUDA 4AD9A 1EH7A 1LDJA 4FX0A 5C8WA 4UXNA 2VE9A 1HXDA 2V1UA 4I0BA 4CGZA 3K1NA 1IF1A 4HVQA 2A69F 3FM5A 4EGZA 4ENJA 4AQ2A 4RAZA 3RYRA 1IN8A 3GEZA 1CGPA 3MCZA 2ZBKA 5DD8A 2GA2A 3EETA 4A6EA 2F5CA 1BIBA 1D5VA 5LHIA 2DPDA 2ZJ2A 3SHFA 5LRRA 5FPXA 2FMYA 1ZVFA 2M45A 1CAXA 4G8XA 2CQKA 4WXDA 3B02A 3UKNA 5IT9Z 3FHZA 4LA3A 5CVVA 3BPXA 1FBSA 5D5UB 2C6YA 1S6LA 4ENMA 1YFUA 1S29A 1GVJA 4L9JA 4RB0A 1FSHA 2EFPA 1IN7A 1KQ8A 2Q0OA 2F5DA 3MPBA 5D4SA 5CADA 3WTTC 2PG4A 2Y0MA 1XRUA 2IXKA 4Z82A 4HDVA 4EJTA 4YSFA 1XDUA 3EYYA 3ELNA 2Z69A 3K1MA 3SXWA 2LNBA 1K7AA 5LHGA 3VB2A 4Q47A 3J81Z 5HS7A 3RI4A 4Q0SA 4ZU7A 4Q48A 4LFUA 3IDCB 1ZGJA 4IHSA 1WWXA 1KU7A 2ZKZA 1EH6A 2P7CB 1XCVA 2QVSB 4GXOA 4UNOA 1HW5A 3GFMA 2MC3A 2UWMA 2YR2A 5AVPA 1IN5A 1RIOH 3LA2A 4IEOA 1HW1A 2D2WA 1F9NA 2E9QA 5LEKA 2XGXA 1USSA 3RPUA 1O3TA 3LSTA 3DF8A 2ZNYA 2B0LA 2HR3A 5LGTA 1IAWA 2Y48A 3DKWA 3J81K 1SFXA 1V3FA 1PDNC 4G9YA 1LB2A 2DW4A 1P4WA 1JHHA 3HRSA 3NKTA 4JK1X 2YPRA 4OIQF 4H0EA 2BBYA 4AVCA 1QPMA 4KIGA 4XF4A 3EQLF 1MZBA 5HDNA 2Z9OA 1IXRC 3BJOA 3EO6A 1RNLA 2DAOA 4YFNF 4XFBA 4HQMA 1EP0A 3CO2A 5D6FA 1OYYA 1HKTA 1YTYA 1G3TA 1WSUA 1RUNA 4R79A 2HYGD 4LMYA 1R00A 2A61A 2Z99A 2LSOA 4Z2YA 2VBWA 2PI0A 5DEQA 3EJKA 1UD1A 4HDUA 1IPKA 3WW4A 1XMAA 4XF9A 4D7SA 4YIFA 3ULQB 4D0PA 4XFCA 1X3UA 4PIYA 4O5VA 3USSA 2AS5F 4I3PA 3ZN0A 3I59B 1Z1DA 1FNNA 2R7FA 2K4JA 5BPXA 5E1RA 5FLJA 1SD7A 3KLOA 4LLLA 3RKXA 2Z2SB 2PA7A 2BEOA 1SFNA 1RL3A 1XE7A 5FO5A 4A5MA 4XF0A 2OQRA 2CGPA 3TO7A 4L2NA 1MJBA 2P17A 1R22A 4KN7X 2OPKA 4IETA 4U0WA 2VODA 2XL9A 3NQOA 2COMA 4DQ2A 2E1CA 1NZCA 4F7ZA 1MDMB 2KKOA 3ROUA 1X7NA 4WXCA 3E5QA 5TJJA 1ZRFA 1UB9A 2M87A 2DFIA 4I2OA 2EJRA 4GYGA 4HV5A 3HIFA 1JUHA 2EFOA 3H9AA 4HA8A 4A2UA 5L3EA 3I7DA 3IKVA 1I1GA 1KYZA 3QAHA 3SQNA 1ZX5A 3AAFA 3K69A 1LVAA 2OYZA 3P9KA 2ZNZA 2GIVA 2Y75A 3F8FA 2W24A 2Y0OA 1EYBA 3LWFA 5CJ9A 1X8MA 4ENNA 3NRVA 4HQEA 4WVZA 3H3ZA 2ISYA 3IC7A 3R60A 4XRFA 4L0ZB 1UIJA 4KWJA 5DUIA 2L4AA 4MQVA 3WTXC 4QGMA 1YG2A 1QO0D 5ERIA 4Q0PA 1H9TA 4ZYGA 2DBBA 4M71A 2OU2A 1IUYA 2YU3A 4IRIA 3P9CA 4RGSA 1FYLA 1TW2A 4OINF 5I8SA 1YFXA 3GVAA 3HYIA 1WA4A 1K78B 4XSXF 4L9VA 4HF0A 2B9UA 1R1VA 2OZJA 4UXAA 3E6CC 4BYYA 3OCPA 1DGWA 1XGOA 3EYIA 1R7JA 1NHAA 2STTA 4OLLA 4UV9A 1LKNA 1CF7B 1FLIA 1KQ0A 2QVOA 1SQ4A 3HSRA 2G9WA 3FWEA 1GQGA 3BZ6A 4RB3C 1TQPA 1MJ9A 4EWAA 1IN6A 4MV2A 3J80K 1FOKA 3B73A 3TOAA 2RC4A 3V7RA 2P7VB 2FOKA 1IRFA 1W5SA 4IJAA 5HVQC 5LBQA 2Q1ZB 2FMLA 3VFZA 5HOOA 1MGTA 2V79A 3OTFA 1JE8A 2O03A 3WTSC 4Q0VA 5A2QZ 2PHDA 1STZA 4B09A 5I93A 3GFIA 4KIBA 3S2WA 3JSPA 4QMAA 2QQAA 3U2RA 1PP8F 2YX7A 2V9VA 5HLIA 1BM9A 2P5LC 1CAWB 4NQWA 4U88A 4KWKA 2JT1A 1J0RA 4M6YA 2O0YA 1ZN2A 3F6OA 2VE8A 4IEPA 4WZCA 1NE6A 2V1DA 3HRUA 3Q5FA 5D4RA 3R0AA 3FMSA 4OOIA 3C18A 3BB6A 5FFZA 5F1RA 4XBFA 2XUBA 2KXLA 1BN5A 3ZP5A 3CUQB 1OMIA 2P6SA 4FHTA 3QPTA 4G7OF 4LTAA 5L3FA 4PZJA 5KHJA 4CZZA 2F2EA 4KICA 1YIOA 3FF5A 1NYWA 1TTYA 5I91A 4CYDA 3F72A 3GLXA 2HZTA 4PJYA 2HKXA 2KIFA 2E7WA 5E1ZB 2EA2A 3C1DA 4A6DA 1U3EM 4WF2A 3O14A 4LULA 4U7BA 2IA1A 2JSCA 3IL2A 1W4MA 5HI0A 2GZWA 1IRGA 4OIPF 1LNWA 3W6KB 4HYEA 2A6EF 6PAXA 2OZ6A 1ON1A 2FU4A 2HTSA 2EA7A 2CFXA 2QZ8A 4MTEA 3W6JB 4AIKA 4Y13A 2ZKLA 5BUVA 3R6SA 4ESBA 2WV0A 2PAMA 3M9AA 1H9GA 2NS0A 5JI6A 3L2CA 2PFWA 4RB2C 3L00A 2ADUA 3MFKA 1LEBA 3IRRA 1WKMA 2EK5A 3KEQA 4Z07A 1AWCA 4JTNA 3C3WA 5E16A 4Y17A 1HBXG 1QXJA 1B59A 3HRMA 2GXGA 3KP2A 4PGGA 3D0SA 3WGHA 3K0LA 3R61A 4HAMA 4ZZLA 2PMHA 4QM8A 1YWKA 1QZZA 4PCQA 4X6QB 5E1WA 1BC7C 1L0OC 3SZTA 3JSOA 3LA3A 4EJVA 4LUKA 3ES1A 3UKTA 2UYBA 1MKMA 3F21A 2W84A 5E1XA 3GWZA 2G7UA 1U8RA 4HBLA 3WU1B 3TO9A 4JTOA 1UPIA 3E5XA 4RS8A 3MZHA 2GU9A 1FP2A 4HX4A 4HLTA 5E17F 3IRQA 1IN4A 2EV5A 3CO6C 3VHRA 2Q2EA 3ELKA 3DEUA 2BNNA 4K8FA 3LZZA 1WGPA 1V4RA 2E7XA 4LB5A 4BNCA 3KMHA 3FE5A 5HDKA 4O9EA 5E20A 2ELHA 2DCTA 1P4XA 1IZ1A 3HT1A 4EVIA 2YSRA 2V1XA 3QP6A 5KHHA 4KWLA 2NRAC 2MNGA 1Z91A 3E6BA 1C0WA 4QM9A 4IEUA 2XAHA 2QYOA 5K5RA 1D8KA 1Q1HA 5L3GA 3GYDA 4RB1A 1LDKB 1U6GA 4EJOA 2XKPA 5F64A 1Q5OA 4M72A 2E1NA 1TW3A 2XRNA 5JFRA 4L9NA 1SEFA 2FQPA 2UXNA 1O3SA 3BU7A 3TNQA 4BIFA 3REOA 1BI2A 4J1XA 2KIUA 1FSEA 2ZFWA 2QLZA 3V8JA 3WGIA 4NB5A 3SCFA 4XEZA 2XAJA 2QDRA 2L4MA 2UZKA 1G4DA 3MYXA 2EB7A 5L3DA 3WGGA 3FHIB 1F5TA 2HJIA 5FQ0A 2DQLA 1DZRA 2RVCA 5D8LB 3RKYA 4AVBA 5D5WB 3BPZA 4G6DA 2MLGA 4L9TA 2HQRA 2O6GE 1UFMA 2LDUA 3ZN1A 1CAWA 1YFYA 2KJCA 4MUVA 3T8RA 3BALA 1USTA 4HN0A 4IHTA 1XCBA 2WC2A 4Q5SF 4HZFA 1L3JA 3OGJA 4N9IA 3SMHA 2XVCA 3I64A 2VBXA 4AVPA 3J80Z 3TDUC 2GC0A 5FB2A 2MPFA 2P8TA 2RNJA 2UY9A 4D7TA 2XV4S 4KT5C 2A07F 1GQHA 2XIGA 4ZYDA 5FLHA 3SCHA 2CW0F 3WTZA 2JPBA 4KMFA 5L3BA 1RTVA 3IDBB 5FQ0B 2VOPA 3GBFA 2OD5A 3EHKA 4KDPA 1SD6A 5FLXZ 4YNIA 4B8XA 1REPC 4BHCA 1YW9A 1XSVA 3C3VA 4QLCU 2A5YB 2FBHA 4P55A 2DU9A 3FXUA 3ST7A 3CUOA 1HSJA 4IEXA 2MD5A 2FBIA 2RKHA 2HYFA 1OPCA 3NVCA 1G3WA 5J7MA 5ICFA 3H8UA 2EV0A 3ETQA 1XD7A 4N0BA 4EJWA 4EV0A 4ZZDA 2PQQA 1FZPB 3WW2A 1U5TC 3LOIA 1QXRA 2VXZA 4RGUA 3OD0A 3O2PE 2PMUA 3L2HA 4MGRA 3JZVA 4F8AA 2H0VA 3NJZA 2L54A 1EH8A 5JR7B 4A12A 3QU3A 5LGNA 2L01A 3RTRA 4WBBA 1HSTA 3BY6A 3GXOA 4K2EA 4CHUA 1H1IA 1X8EA 3DP7A 2VT2A 2XASA 5JSRA 3LFKA 5FFXA 4R8HA 4OMYA 2NNNA 1ZRDA 3ERED 4DNCA 3ZPLA 3R4KA 1OKRA 4LGWA 5AONA 4EWDA 4IXAA 3H7JA
chains in the Genus database with same CATH superfamily
2JB8A 1W39A 4QDSA 3ZIWA 4CEYA 1JH5A 5BMZA 4YM1A 4BXUA 3D6EA 4DPNA 2VOKA 3AFGA 5A3NA 1ZYBA 5E3LA 3K48A 1XMKA 1DQ4A 1LOBA 3BGAA 2MH9A 5ACA1 5DCMA 4E7KA 2IA2A 2BW8A 2LM3A 3T0YA 3UGHA 3P7NA 1LODA 1P9QC 4FAGA 1WLWA 3WTYC 1FPN1 3WNKA 2B5HA 2IXIA 3B94A 1JOPA 1JS9A 5DV5A 4YYOA 4BH9A 4WVWA 1K5MC 5FDBA 1XS9A 1X50A 3PURA 1UY2A 3VZKA 3FUQA 3RG0A 1KGSA 2HZDA 1QJX1 1WI3A 4RQPC 5FPLA 4HSRA 1J83A 1QQIA 2W08A 1Z78A 1JUIA 5DQ0A 3ZKUA 3CZ6A 4LB6B 1HX6A 3OL3A 4PSWA 1YI7A 4K6BA 1RETA 1KEXA 4Y22B 2VASA 2R7SA 1OQ1A 5FKOA 1PZ7A 5GPCA 3FDYA 1U2WA 2JPCA 2B7YA 4ABZA 1O5LA 2JVGA 3DBHB 3PFYA 5AIPA 1V6MA 4S2FA 4CICA 3HXLA 5CPRB 3COAC 4AFDA 2LS6A 1S7AA 4W1UA 1H2NA 3OJBA 1R4NB 3RNSA 3ENRA 1H1AA 1I5ZA 1S7EA 2P5BA 4XIKA 1JGGA 1JHJA 1GZ9A 4GDFA 1QVTA 3M3IA 3NWKA 2HVQA 3VB9A 1XGMA 2GSYA 4G9SB 3F95A 2DA2A 2FHRA 5CKQA 1W8TA 2DOEA 3F2ZA 2VC1A 3QPSA 1MBJA 1NCRC 1DYPA 1OI6A 3HGGA 4O6JA 1G6NA 4Y1ZA 1ODNA 4NHJA 3SJMA 4AI0A 2CQ7A 3K4CA 3IBMA 3UESA 3VD4A 2K9LA 4QX2A 1MVQA 4HW0A 4CCCA 3K2OA 3VYTB 4I02A 2LALA 1W6MB 5BNQA 1KONA 1R5ID 3GF6A 3W5MA 3M07A 1JU3A 1CF7A 4PSXA 4AI3A 3CJNA 2D5HA 2ZGUA 2QBXA 4E7LA 3NSTA 5KHIA 2IAIA 1FTTA 5A6ZA 4DEVA 2VGDA 3FBYA 1FV2A 1Z67A 2PLV3 5IT9K 2J1RA 1DP3A 3I71A 2O8QA 4DXSA 2CG4A 4AI8A 3OIQA 4ON0A 4WVMB 4NNJA 5FY9A 3ZSEA 4RM3A 3MKLA 1R64A 5DM7F 2OA2A 4YG2F 2XB6C 3WU0A 1UQXA 2PHWA 3CJRB 1FXZA 1Z7UA 4XZPA 5FJ8J 2ZX0A 4R9BA 4QPOA 5TSWA 3I2OA 3NRUA 1RMU2 2YY1A 2C0ZA 3T0BA 2QBYA 4E7HA 2ZGOA 4PJNA 4RGXA 3MQ0A 2DDUA 1RITA 2JDYA 4KYWA 5DDGA 1UCRA 2VD7A 1E57A 4MGSA 2M7AA 3BODA 1ZZ9A 1NUKA 5C7GA 1NG6A 2I74A 2GA1A 3BOQA 3V7CA 4TYSA 5FZKA 5FZGA 3PU8A 3G1LA 2FD8A 5HNHA 5ILUA 5DMYA 2IP2A 2M1BA 2O1QA 4AGRA 4IEWA 1A6CA 3WNXA 5J8FA 1U12A 2O61A 4MXWB 1FOD2 4IRHA 4HN1A 1PGL1 1W1WE 3ABUA 5F04A 3ZFEC 4AYUA 2AYHA 3WODF 1OA4A 5A32B 2DMUA 3QPLA 2FRHA 4JYKA 2R7UA 4LLOA 4FCAA 4FAHA 1PYVA 4YZ2A 1X33A 4KA4A 5CQEA 4Q4Y1 3T5XA 2X53S 3Q3SA 5JR3A 4EN9B 3J7AO 4K1YA 1SBEA 5C3QA 1IG3A 1AR72 5C3RA 5H6QA 4ZHNA 4META 2BDRA 2PHRA 2Q0AA 2VBPA 2K27A 4PJLA 5FZLA 3VWBA 3LSPA 2BBAA 1NQDA 2E6VA 3RZZA 5LASA 4YW3A 5A3WA 2VMEA 1TME2 1ZBE3 1W7PA 2LTNA 4BK4A 1ZZ7A 1FP1D 1EAH2 3GX4X 2ZMEC 3PUQA 3ILNA 3PIOF 2X85A 2IT0A 5A2QK 2IEKA 4YIIA 5ACA3 2D97A 5IP6A 2KR2A 1VQLI 4EWEA 4A4AA 5E79C 2FCVA 1DCSA 2CWEA 4RHV1 3KP4A 4Q0QA 1BJZA 1WW4A 5JVGF 3OEBA 4IF4A 1GLHA 4JGYC 4NHYA 4XKBA 3CLQA 1J3RA 3O1UA 2BW3A 5FREA 4WWCA 4NHLA 4EN6B 3NNFA 2WQ4A 4IEVA 4MSVA 4JQTA 5BPDA 1RKWA 4CDWA 1E2XA 4RGGA 1OA3A 2G1MA 2ZXQA 3MUY1 3PTRB 3AMNA 5GZFA 3O1PA 3WP3A 1ALYA 3ECQA 4U7DA 3FN9A 2ZEWA 1C5IA 3S32A 4FTEA 1J5YA 1WJFA 4M3EA 2A6HF 1IXCA 2UXXA 4FOWA 1F4KA 3M7GA 1AX0A 4H14A 2K0GA 2VJ4A 1E3HA 1ZZBA 3ACLA 2DYRH 1RUG1 1J58A 3FISA 1XU1A 3HAGA 2J1VA 4YRDA 2E36A 5LFAA 4LBQB 2N8GA 4DFSA 2W47A 3TO6A 4XMYA 2ZMNA 5T5PA 4I6ZA 1Q8SA 4DGWB 4OUSA 2FSWA 5F8PA 3MV11 1BR1A 4AEMA 2X6OA 4XILA 1QMJA 1WI9A 3HB9A 2GDFA 3J9SA 1B4AA 4GQ7A 1BBT2 4G6TB 2FCUA 3JRAA 4N43A 1F1ZA 5FWJA 4EQQA 5FZ7A 5E6HA 1G8XA 2H8WA 4X6RB 2ZXIA 5GLVA 4V2FA 1JXSA 5FTTC 2Q4SA 3I4PA 1TMF3 4YG3A 4LK0F 3BJAA 2D6LX 4MXWA 3U37A 1T6SA 3UKGA 3OYWB 3CCVI 2YPDA 1JZ3A 5GTHC 1DGRN 4V19K 2OS2A 1QJFA 3RJ2X 4GB32 1POV1 3OBZA 2DK8A 2R061 4HF2A 4XIOA 5FPAA 3A02A 3ESWB 1H8VA 4ZDOA 1Z9CA 1XYOA 2CQXA 1VBC2 5A33B 4WM7B 4QKDA 2LF8A 3FL7A 4YGEA 1CIWA 2WYSA 1U8BA 3KFWX 5CEHA 1SZBA 2Y26A 1AL22 3FFQA 1PUFA 1OLTA 3PTYA 4K9SA 5A1LA 3SEZA 3PVNA 2DCJA 3A4UA 3S14J 4RHV2 2JTVA 1IDZA 1UY4A 1OCOH 1OQYA 1PMHX 4LBMA 1I50J 3VEPA 2WT2A 1K3IA 2IC1A 1PIV3 3DWLE 3QOPA 2DXIA 5EJ1B 4HVRA 4RS5A 4UFJA 3V0AB 1TWHJ 5A32A 4HRIA 4LK6A 2ELKA 2WQ8A 5GM0A 1GT0C 1P92A 4HV6A 1REDA 3VBFA 2JUCA 3DCQA 5J4VA 1I3QJ 2HOAA 4LG0A 4CU6A 1JN2P 2DBNA 3PLQA 2OKXA 2MG4A 2L7ZA 1DZTA 4FPYA 1W8ZA 4A3JJ 2HTJA 4HK9A 2UWAA 3WQ7A 3JRGA 4YW6A 3IV5A 3CCEI 4ARXA 2QBYB 5IVYA 5K8SA 3BTAA 4UB8C 3LIHA 2OX0A 3QD6A 3MO4A 2RV9A 5H9RA 2BNOA 5L7OB 3K4NA 4YW7A 3FMQA 5J3LA 1COV3 2A3WA 1VBB3 1PP7U 2EIEA 2CUFA 2ZX3A 4LEJA 2KRFA 4QHZA 3FKIJ 4GFBA 3ZYBA 3MAJA 4Y20B 3KYLA 2WQZC 3K3OA 3OPZA 2WWUA 3BR5A 2HWF2 3OIOA 1UAIA 4WVVA 1YC61 5KK1A 2KZVA 5ED4A 2BXZA 2AEZA 2M0CA 1PVC1 1RINA 4RGAA 1TNSA 1LDDA 1Y0UA 1ZLKA 2EVXA 1WCMJ 3UKVA 2BRTA 3ZR6A 2GOMA 3V8KA 1NT0A 2EA4A 2X5IC 3VBSB 2GC3A 1V9U2 4C3HJ 4DRRA 5FZ1A 4X0GA 2IXJA 5FBZA 1Y9QA 3D0JA 1YW7A 5JZGB 4AK3A 4XUQA 4XTPA 3R05A 3IUOA 2XHKA 4C2TA 1B9MA 3MIDA 4HF1A 3V0BA 3T2TA 3V7SA 2GXBA 3KGLA 2W25A 5A6XA 2BOIA 2A3XA 4FQGA 3C2GA 1SVMA 2K02A 1AL21 2R6QA 4AU7A 4L18B 1EAH3 2HWE2 2HEVF 4XLAA 1FMVA 3DLLF 3VD7A 1B6AA 3CLOA 1VALA 3L2YA 3ZSMA 2JA6J 1ULCA 1W99A 5BNOC 3JRDA 1T39A 2J5PA 2EIDA 2D6NA 3PIJA 1X3WB 2K9MA 4F91B 3HOWJ 2NZ9A 1VRBA 3GW2A 1HA8A 2LK2A 4COYA 2GNTA 4AVZA 5CFDA 3MKZA 2WNVB 4XPVA 2VPVA 2XJQA 3H7YA 2QQKA 4ANJA 4GA9A 1E17A 4EGYA 3NO8A 3HT2A 1MMNA 5LB6A 1NLQA 4A0YA 4EJUA 3GZNB 1SD4A 4CVUA 1UMQA 1WJ5A 1JYIA 1EV12 5BNPC 3Q8FA 3AP7A 3USUB 3B00A 2RN7A 1IQAA 3SCGA 1UZZA 5CFDC 4EATA 4XJAA 2VTFA 5A3UA 4A6OA 2H09A 2VW1A 4BJ5C 4IV1A 2B4KA 2JDUA 4XN3A 1LE8B 2J1AA 2Z5UA 2EBIA 3HUGB 5IFTA 3NW4A 1XNCA 2X05A 4FXKB 4W4ZA 3ZVXA 4D7MA 2ARCA 2RDNA 1SFKA 1I27A 4Q4V2 1O4TA 1IGNA 1KQ9A 2JG8A 2WR9A 2NMNA 5FZHA 3J7YJ 1TP4A 1W9TA 2ZMKA 1OR7C 3O0VA 2KISA 4RL7A 1GYKA 5LK5A 2F5FA 1RB8G 4BY1J 2WABA 3PL0A 5F2SA 2ZJPF 3S0MA 1CESA 4XXPA 4JKKA 4Y15A 3C7FA 4NRQA 1CAVB 2XUEA 3RIRA 5C71A 5IYYA 1HQLA 2GM4A 3K51A 1HRI2 3IWZA 2CAVA 3Q9OA 4Y3OA 2A3SA 3I58A 1JU4A 3FZVA 3MEXA 2WNEA 4LMFA 3W21A 1ULYA 5I0RA 4B1LA 2HWVA 4CDWC 2V4VA 3LPFA 2XF5A 5LZ6A 1TG7A 1LENA 2VO5A 2K9ZA 2K2SA 1H88C 1TZOA 1B09A 1HW2A 4HX7A 1BC8C 1YW8A 3O3KA 3Q8CA 1HQCA 2W39A 1CAVA 4A44A 3K1PA 1J1LA 5FP9A 4X8PA 3FHAA 1H8TA 2GNMA 4BKXA 4AVVA 1OH3A 3ZSKA 1ASJ1 3SEQA 1Y3TA 5F5IA 1SBDA 3USUA 3H8XA 4PI2A 2MD0A 4RD7A 1W6NA 2R041 4ESJA 3S2HJ 1JZ8A 1S2BA 2PAEA 1F31A 4HEA2 4DBQA 1VMHA 3PU3A 1SFUA 3A0KA 3RPQA 2BV4A 3R4DB 4GH4A 1COV1 4XLNF 4YGBA 2YFZA 5BXXA 4Y1UA 1GV5A 4JKMA 3CL1A 3JBG1 4IW3A 1VQNI 4NAMA 3POBA 3INAA 1K12A 3OV8A 3FFZA 1MJAA 1A36A 2WSVA 5APAA 3BU0A 4HKLA 3SKJE 4I7HA 4XQDA 3J7HA 3V64A 3VHPA 3GTPJ 3OB8A 3BTJA 2IBDA 2KIQA 2BE5F 2P81A 4LKEA 5DG1A 4SBVA 4P9UA 5GAHJ 3NV4A 4JP0A 3ZYPA 3MDPA 1W0UA 4YZ3A 1SAXA 5FKNA 2PEXA 1X58A 1S8NA 3N35A 5FZOB 4QPYA 3NJXA 5FY5A 2BW3B 4E4SA 2Q30A 3NMBA 4ENKA 3OS2A 3THCA 5FP8A 4R52A 1HRV3 4KNYA 4I76A 3T0AA 3C2HA 2HWB2 1LDJA 1AU7A 4V2GA 2VE9A 2V5DA 4PFOA 3CJIC 1Q8OA 3U75A 3K1NA 3ASOH 4Y5SA 3OSFA 4DXTA 4QB2A 5LBFA 2WJSA 1CZTA 2K85A 1CGPA 2VQ0A 3GZEA 2KMUA 4A6EA 3AYDA 1WJEA 4O61A 2ZTNA 5LHIA 1ENHA 3SHFA 4TXWA 1UOBA 3WNOA 4UW6A 2FMYA 1ND2B 2R5YB 4QIWN 4WXDA 5EGOA 2Z5WA 3UKNA 4CCMA 3BG7A 2V26A 5CVVA 2C6YA 3H42B 3PJYA 2FUG2 1Q1VA 4NPLA 2EFPA 3POWA 1JW6A 2W87A 2Q0OA 2DYSH 5T5JA 3ZXDA 2R5ZA 5FPBA 2DYCA 4GRIA 2NPIA 1JZ6A 4YSFA 1XDUA 5F37A 2VQUA 2DMPA 3MLJA 3KYCB 3N9QA 1K83J 2Z69A 1TT0A 4XL9A 4MG2A 1K7AA 2LMDA 3M7AA 2W1UA 4EYUA 5K4LA 5F2WA 4LFUA 4BOWA 4AVSA 3Q8EA 1WWXA 1HJGA 2ZKZA 1PMJX 2FDFA 2P7CB 1EUTA 1NX9A 4UNOA 2UWMA 2VNGA 5AVPA 2PMZA 3F0CA 2DTYA 4QQ2A 3LA2A 1OBNA 4F93B 3O1RA 4IEOA 2PHFA 3CIHA 2HYXA 2OTLI 2D2WA 4DYQA 1F9NA 2QQNA 1UJ8A 2DA7A 2GH8A 3DYPA 2BQPA 3VZLA 4Q4V1 4Y26A 1WH7A 2IZWA 3J81K 2W2IA 1V3FA 2BUKA 1PDNC 1VPHA 1LB2A 5K9YA 1ENXA 5H9PA 4BQ1A 1XOYA 2YPRA 1PUFB 3DKXA 1TE1B 2X6XA 2W7NA 2CQNA 1MW7A 4JGYA 2JVHA 3BJOA 4UW5A 1WD3A 2FZ2A 5HBAA 1RNLA 4HQMA 1EP0A 2MEV1 5HV4A 3BCBA 4R79A 4JX4A 3WF1A 3UL2A 3VV1A 2A61A 5GZGA 4AM3A 4DEQA 4U2AA 1YJKA 1XMAA 3QYEA 1SG3A 2ZZJA 3ULQB 4Z92B 1X3UA 3ZFGC 4DRVA 4PIYA 1A3KA 5E88A 3VDCA 4I3PA 3K6GA 3WUDA 3LSGA 1Y1VJ 4NRPA 2K4JA 5BPXA 3LEIA 1MS8A 1SD7A 4ZXKA 3RKXA 1DIWA 2PA7A 1QIQA 2VZPA 4Q4V3 4YVWA 3OG2A 1W2TA 2RR11 2V5YA 2WN2A 1EUUA 3LFIA 2QQIA 2OQRA 2CGPA 4L2NA 1MJBA 3KT4A 3ZXJA 2WLQA 4KGQA 3G4SI 2P17A 4Q8LA 1V6NA 1R22A 2OPKA 4IETA 4NROA 3NARA 2M2EA 3DPUA 1RUF3 1YEWA 5D8AC 4BWOA 3W5NA 3ROUA 1X7NA 1OLMA 4MFDA 4WXCA 4PT6A 5TJJA 4EQVA 3N05A 3LFUA 2DFIA 2ILMA 4IGPA 4I2OA 1KJLA 1WJCA 4GYGA 4HV5A 3HIFA 4BM8A 3AK0A 4URAA 1UMIA 1BBT1 1COV2 2X6YA 1AR91 2Y6FA 3P9KA 4XXAA 3ZDVA 3VDAA 5B1AH 2Y75A 5F39A 1C5HA 4RHV3 2W24A 3HOYJ 2W5FA 3WDYA 2WZ8A 1FATA 4UI9L 3C7GA 4UUTA 3IH3A 4WVZA 1WPKA 2FQ4A 3LIGA 3LB9A 5FZFA 2EXJA 2YDEA 2ISYA 1PX3A 5CIRA 2O7OA 5M3FJ 3L2QA 1AJKA 2R7XA 3WG4A 4L0ZB 4KWJA 1PK6C 1X1DA 4QGMA 1YG2A 4YLZA 4ET7A 3OYGA 3DXTA 2TEPA 1VQMI 2JJ6A 4BDZA 1AR73 3K4AA 2K9SA 2HYJA 4IRIA 2R073 4RGSA 4E7ZA 3CZUA 3ACGA 5I8SA 2ZGRA 1FOD1 1WA4A 4ITVA 2YB7A 2E1MC 1K78B 5JR2A 2ZGPA 4GAZA 2B9UA 1R1VA 3FXMA 2VQTA 3C2BA 1VBB2 3E6CC 2NVYJ 3FLTA 2D3SA 2STTA 4OLLA 5JXGA 1GANA 3LSKA 4AOCA 5HPOA 2VCCA 2Y9YA 3V7RA 2FOKA 4IZZA 5EQUA 5LBQA 2Q1ZB 2CUEA 5HOOA 1MGTA 2V79A 4EEFG 3ZX7A 1WJAA 4AC0A 3LSRA 4Q0VA 4M3CF 5A2QZ 4F83A 1W2AX 1STZA 5B66C 5BNNB 2DOFA 2WT0A 4B44A 3RJRA 3JSPA 4B3NA 5JVVA 4CU7A 1QU0A 2P5LC 4U88A 1J0RA 2JSPA 5F0HA 2O0YA 1TVGA 1JOBA 2ZKNA 4FE4A 3F6OA 3LCPA 1RHI3 4UF0A 3AP5A 5K7FA 3CQZJ 4XDPA 5KHDA 2ZPXA 3TRSB 3TEYA 3Q5FA 3R0AA 3MW4A 2V4AA 2JDKA 5F1RA 2VZRA 1CJDA 1HXS3 3HWJA 1XMXA 2XUBA 1WBLA 2KXLA 3K75B 2Y60A 1OMIA 5FYMA 2C6SA 2DVFA 5L3FA 4NJ4A 3MI8A 2E19A 4CZZA 2ZGTA 2RAEA 4KICA 1YIOA 1TTYA 4DYCA 4CYDA 1AYN1 4W6XA 3RZKA 1MMSA 4LO7A 4B43A 4FOVA 2Q1MA 1SDWA 5E1ZB 2EA2A 3O14A 4LULA 3K7AJ 5E3OA 2JSCA 5K7ZA 5HI0A 3A22A 1YJLA 1LNWA 3OYLA 2VUJA 2A6EF 2NVQJ 3PM1A 1ON1A 2FU4A 2HTSA 3WSOA 2R7VA 4MTEA 5BUVA 4Y13A 1IQDC 1O8SA 2PAMA 3M9AA 2X1DA 5EEAA 4FO9A 2ZHKA 5IP9J 3L2CA 4M00A 5GJ6A 4EN7B 4RB2C 3I56I 2LBFA 1VAKA 3T2QA 4CUGA 2ADUA 4Y1VA 4NOTA 2ZXWH 3IRRA 1DU6A 5IK8A 4JTNA 3C3WA 1RHI2 1JTYA 2D6OX 4JGYB 4Y17A 4QKBA 1B59A 2HXOA 5FMCA 3MN2A 5A3LA 3K0LA 4AEDB 1RUE3 4ZZLA 2PMHA 2VUMJ 1DZQA 3A2KA 1YWKA 3U78A 3KF5A 4C2UA 3MKWB 5E1WA 1AR62 4XW3A 1ZKGA 1N47A 2D6KA 2R7EB 4QT6A 4LUKA 2RR13 1NCRA 2UYBA 2NVXJ 1Y43B 4IE6A 4LPLA 3MUZ1 3F21A 5E1XA 1KGYA 2RDSA 2G7UA 5JXJA 2D3PA 4TLGA 1JYNA 1PO12 1OOPC 2X48A 2ZHMA 2FX0A 1UPIA 4G3YC 3CP2A 4HLTA 3FUOA 2LR8A 2GU9A 5DABA 1RUC2 3IRQA 1IN4A 2EV5A 3H9GA 4N43B 2BNNA 5FMOS 1WGPA 1GR3A 1V4RA 1UAAA 4BQXA 1BEV3 2W3JA 3LD8A 4O9EA 2YROA 3AP6A 1X4PA 3HT1A 4KQ7A 2V1XA 4SLIA 1ZA4A 4K8RB 3QP6A 2VZSA 2IS4A 3JREA 3H8RA 1C4RA 2MNGA 3ORJA 5A7OA 2WA3A 2WAOA 2XAHA 4XLHA 5K5RA 4V2VA 4QPWA 1X2MA 2VZVA 4AHYA 3MVPA 1C8M3 1ACCA 2UU8A 5BNGA 2E31A 1YQ5A 1TW3A 3OYBA 1XTAA 1SEFA 2FQPA 3ITQA 1O3SA 3VLBB 1JJ6C 1DYKA 1AR81 5IAVA 3TEWA 2QLZA 3SCFA 4NB5A 4CDUC 1LOCA 4IUGA 2L4MA 1G4DA 4D5CA 4Q4W1 3C7EA 4CP9A 1BEV1 1YYNA 3WG3A 5FQ0A 3RKYA 2OJED 3ZFFA 3BPZA 1I39A 4WM7C 3PNYA 5B3SH 4AFBA 5GLTA 4L9TA 1YHQI 4Q4X3 2O6GE 4Q26A 1UFMA 3NV2A 2VTXJ 4MUVA 2D5VA 4HN0A 5F5CA 2VOXA 4YVSB 5KCMA 3GZAA 1S0CA 3OGJA 2R1DA 2FMDA 2VBXA 3CESA 3GALA 1GBGA 4BQOA 2GC0A 4ZS2A 2RNJA 1VQ9I 2UY9A 4K21A 2WY7Q 2AQEA 3D5SC 1OCZH 2XSJC 4J19A 3PSIA 1K5MB 5FLHA 2P3YA 3WTZA 5A7PA 3IMMA 4C3JJ 5L3BA 3HOVJ 2ME0A 3AFKA 5FQ0B 4DY5A 4BJTA 3GBFA 2CU7A 5DN2A 4KDPA 4M6VA 1P8JA 5JPMB 5A7WB 4B8XA 5AFEA 2HWB3 5EG0A 1SLBA 2FBHA 3HJRA 4P55A 4M0NA 2BOLA 3FXUA 3ST7A 1WUVA 2MD5A 2RKHA 3OWTA 1QXPA 5ICFA 2EALA 1XD7A 5EGOB 2BBVA 1P7JA 3POIA 3TAYA 3IDEA 5FK8A 2ZMLA 3O2PE 3L2HA 5E89A 4F8AA 2VXRA 3M3OA 2OCEA 3FC0A 2AHQA 5F5AA 1UG0A 2VLAA 3RTRA 3NV1A 3GXOA 4K2EA 1QEXA 1NKGA 4XUPA 1VBD1 3BR3A 2EIMH 4E8CA 1GNYA 2VJJA 1KZHA 1KDMA 1AYN3 4LBOA 3R4KA 1OKRA 4LGWA 5AONA 3CCJI 1W90A 3F6VA 4XDQA 4BISA 3VBOB 2VC9A 1NG7A 2A68F 2ESNA 4AQSA 2OBPA 3F23A 3K2ZA 2IXHA 2BWAA 2RJ2A 4MADA 3M1EA 4LA2A 1NCRB 3AVSA 4PDKA 4UW3A 5J98B 1K6OA 1MZ5A 1UELB 2B9VA 3AKSA 4JDMA 2QE3A 4CE8A 1Q43A 3CJTB 5KXEA 1MNDA 5J8CA 3IZOA 3WF3A 2VT3A 4IGOA 4MEYF 2GNDA 1Q8PA 5HS9A 3GTJJ 1IW7F 4BQ4A 1MDMA 3OS0A 3NNJA 2Q8CA 2QQ9A 5EEHA 1KJRA 2EFWA 4N90A 5D5VB 4UUVA 1VRH1 4IQJA 4AZZA 2QTWB 3ZN6B 3ZKYA 5JAXA 4XM3A 2WO1A 4ZH4F 3KM5A 3EUHA 1ITYA 3WLUA 3I2HA 1UZWA 3IKWA 4GH4C 4XF1A 3OYKA 2ET7A 5GKAC 5EDNA 2WBMA 1QA6A 1X9PA 4YFXF 2ENRA 1QHGA 5LA9A 3LQQA 4ZS3A 1T38A 5A7SA 3CP8A 4OHWA 2ZBJA 3J7NA 3M8EA 4O3MA 2VMDA 4GO1A 1HRV2 2E2HJ 1OT5A 3VBHC 3H0DA 2D7FA 4EZ4A 3ZQHA 2HS5A 1ETXA 3VZJA 1MS5A 3VHOA 3T4HB 3ML6A 2IGNA 5FKMA 3AG4H 3HOTA 5EG0B 4GYIA 3LOBA 2MHFA 2QF7A 3THDA 1U9NA 1ZA7A 2DMQA 1AOYA 1WLTA 5IVBA 5JVTA 3ACHA 4UOJA 5DPNA 4I98B 1YLLA 2RS11 4M6XA 3S3NA 4Q4ZF 2QKMB 2XG3A 3MWMA 1JGSA 1YJNI 3TYJA 2B8MA 2X6WA 2Y30A 2VXDA 3JTHA 1H2LA 1PNFA 2H94A 2JK3A 1X82A 3VYSB 2X0LA 5KHGA 4D5FA 1UOGA 3LDKA 4L97A 3OOUA 5IT3A 1ZR4A 4G4FA 4LBQD 2KZGA 2GAUA 1JHNA 3CUQA 4XZUG 5B4NA 5C6CA 3I53A 2QZ2A 1KU3A 4KISA 4XFFA 1UZCA 2OA4A 2MLKA 2PXJA 5FZ8A 4OHYA 2EZHA 2D6PA 2EIGA 2ESHA 1CN1A 4IE7A 2DODA 2H6CA 2ZMEB 2SLIA 4QD2A 4ZTFA 3K70D 5JI7A 1QGPA 5F5QA 1O7LA 3GM8A 1XG1A 2CL2A 3ACIA 3SFIA 5FZ4A 3WY6A 4XOPA 2JG9B 2DFBA 4IPAA 5CYVA 4ZDPA 2XKOA 3WX5A 1QWRA 4Y24A 3MZYA 3NL1A 4B3AA 3KCCA 1RVF1 5IYDJ 2L9NA 5EF6A 2JDPA 4XSZF 2J1UA 2Q8DA 3FHNA 4Q4Y3 3OBTA 1LQ1A 3M70A 1H6YA 4B1RA 4FCYA 4BPZA 3KPHA 2M8EA 2DDBA 3K4KA 1UY0A 5IY5H 3CDZB 3TBDA 5LCWL 1WCDJ 1MR5A 1B72A 1I1EA 3H3UA 5JI9A 5FO8B 2D1VA 3O1SA 2J1TA 4GCVA 1F35A 3GUDA 5KAFC 4NPRA 2IS1A 2E7AA 3OR1C 4AFMA 5EEGA 3AZZA 3ZFFC 3M2MA 5FY7A 4COVA 1LPQA 1YQ8A 3G6JB 3VBFB 2JN6A 5FRAA 2VJ5A 2H1LA 2VPLA 5FO9B 2JUGA 1ZR2A 1DLCA 1IHMA 4PLOA 2VBZA 5CVRA 4NIGA 2FDJA 3N9NA 4AGVA 3IIAA 4BJ6C 4XLPF 5DCMB 4U0YA 3RDIA 1VFCA 3BWGA 3R4UA 2R16A 3OF1A 2L0KA 1Z6TA 4EJRA 3T2OA 1O5UA 1R081 4N53B 1CQTA 3AKRA 4IL6C 2R93J 3BP8A 1ZH5A 2Q2EB 2VR4A 5FWEA 2ZAAA 5TGTA 3HHHA 2D40A 1UHMA 1ZLJA 1HLVA 1HKSA 4LIVA 3CLPA 2DA1A 2NYYA 1NG0A 1UX6A 2VC0A 3JCIA 1BW6A 2WL1A 1BZWA 1R9TJ 3HDDA 2VB6A 2VY0A 5M5WJ 4BQNA 5C4XJ 3RZMA 3OOXA 1ENQA 5GZCA 5KBFA 4WM8A 1VB4A 2F6CA 5C9AB 2F17A 3RQIA 4ZYEA 1U5IA 3HOBA 3GDBA 1R092 4AXOA 2M7BA 3FMGA 3D8CA 5K7PA 1VQPI 5KAIC 2IXLA 1HB2A 4E2GA 3FM3A 1Q56A 4IQPA 4ASKA 1ASJ2 4BQWA 3JXSA 4QSHA 1A34A 2K9QA 2VI6A 4XCAA 5FRMA 1H9PA 2IWGB 1G7YA 3ZSJA 2JDZA 5IPAA 3D5LA 3I3BA 2GC1A 1GXPA 1FWZA 1TME3 1ZBE2 1GNZA 3AG3H 5JPNB 4FX4A 4FPLA 1UU6A 1Z7S2 1P2FA 2QKLB 2EIKH 4XDOA 2WS91 1FY7A 4IVNA 1UHWA 2XGCA 4EROA 2ZX4A 3O6BB 4OQ8A 5C8CA 1ONVA 3F8CA 3H3VK 1ZG1A 1AYN2 3QODA 2ZABA 2HWE1 4AAXA 4FQ4A 3S3OA 2F4PA 2P4WA 2WLPA 2KT0A 4NN0A 3E97A 2WNVA 5E8AA 2K7LA 4ETSA 5FK7A 4QX3A 2NOGA 4IRGA 3IKTA 1W03A 2CWMA 3BG3A 1URXA 3SYTA 1OUSA 5EZWA 4U0VA 5DS9A 3NJVA 3NAPB 1Z6RA 5LA2A 1G9BA 2JG9A 5ABJB 4A45A 4F52A 3JAMZ 2CY6A 2VZ3A 2P37A 3WP4A 4CCDA 3BT9A 3FXRA 1RHI1 4OZOA 1WGXA 3WNNA 2MA3A 2PLYA 1F5FA 4IERA 1MNMC 2XLAA 2P6TA 3K4BA 3LDRA 1QNTA 1T08B 1W8HA 5T3NA 4XFGA 3TNPB 1MD0A 4DW6A 4UB6C 4QX7A 1MZEA 5JUVA 4BCUA 2FD5A 1Y9MA 4LD5A 1AYM3 1BIAA 3PNVA 3WVJA 1RJ8A 1KS4A 1YRNB 4KGGA 5FJHA 4MZUA 2QKDA 2FNPA 2VXJA 4OQ9A 3KF3A 5DUKA 4HOOA 2VOTA 2I8DA 1K4SA 1W0OA 2PTMA 3DL3A 1N1YA 3IPVB 4J01A 4ZU4A 2CYYA 2XWJB 2VZUA 4M0HA 1RVF3 5SV5A 1PIV2 2JECA 1MMAA 1W8FA 4WVMA 2DTRA 4P9FA 2QQBA 3AZWA 2A6TA 3DU6A 5CFCC 4PLNA 5JHUA 2ZO4A 2X8KA 5C9AA 2VUCA 2LG4A 1MBFA 5A1AA 2ZGKA 3IAM2 2EH3A 4AI2A 3HTUA 1U0JA 3HHGA 4V1PA 2R49A 4NO4A 4CDQC 2J7MA 5I0SA 4MYEA 4ASNA 1NA1A 1V5FA 2OQGA 3Q9SA 2ZACA 4BXFA 1V5GA 1RUJ1 2PHLA 4DY3A 1LEMA 1VLNA 3OYNA 4AIHA 5E8IA 1O91A 4FTHA 5FY4A 1YNAA 5L9BA 1W0PA 4PIZA 2RM22 5CU1A 5GLZA 4OUMA 1SLTA 3ZDSA 1V6LA 4YARA 3TN93 3MICA 3VKMA 3WDXA 1N75A 4CU8A 3JTGA 1IS5A 4PQ9A 4QAWA 3P9IA 2AUYA 1C1LA 4CCOA 3SH4A 1OPMA 4RLFA 1YIJI 4CZCA 5C4WA 3TEDA 3WE3A 4ZJZA 5FP7A 1C8NA 2P5KA 2GN7A 2XF7A 1BVVA 4KUMA 1IKQA 3IM0A 2CV6A 2BNMA 2Q8KA 2C4XA 2XLFA 1G2HA 3N7LA 4FPKA 1KS5A 4MH0E 5FD6A 2BHZA 4DUWA 3QOEA 4S2DA 2V7FA 3WHBA 3NAPA 1R091 2YC4A 1MIJA 1MQTB 3EDPA 4KL1A 1RC6A 4AI9A 4DYRA 1QJU1 5H2FC 3HMYA 4CO8A 4M9XA 4A3KJ 1PGW1 3BOPA 2VOOA 4L0YB 2VMGA 2BY2A 2ORZA 1WKYA 5FZDA 3VODA 4P02B 4YVSA 1JKQC 4ATFA 3PUBA 1HKQA 3ZYHA 4W97A 3EB7A 3FMRA 3FBMA 2C9AA 4JDOA 3KZ4C 3HRTA 2JICA 3DEWA 1FMD3 4ISRA 4Q4W3 3BPSA 3CMAI 4FFFA 4CDWB 2EFNA 3CO7C 1IS4A 2E5NA 4LG3A 4AIJA 9ANTA 2W57A 2Z1DA 4NDLA 1BYHA 4RQPB 2GMMA 1D4M2 2DDAA 2RS33 3AZXA 3E5UA 1F8VA 1LHNA 3ASNH 2CS3A 4NBQA 1DF0A 4A5NA 1S0FA 4HX8A 3CZJA 3BTLA 5TRDA 4IGQA 1JHFA 2MBFA 2O0OA 2QUOA 3ALQA 5I0UA 4JRLA 3EUAA 5IK4A 4MTDA 2K46A 2PHUA 4Z2AA 3BN6A 2NP0A 2CAUA 1Q3EA 4CP2A 1JKOC 1GZWA 2DCEA 3MFCA 2X09A 1Z0XA 1GXQA 1OYWA 3RJPA 2BY0A 5A3TA 3BTYA 4ZTJA 2DK5A 3KT7A 4O65A 3VDXA 4ES8A 5HLGA 1JTXA 4IEQA 4X8NA 1VE0A 1MBKA 1W3VA 5IJRA 1LEDA 2F6BA 1J9IA 5B2GB 4OULA 1W0TA 2WNUA 2XJPA 1G86A 2J5OA 4P5OA 5T50A 3SXYA 4CDGA 3E3VA 2ID6A 4PDWA 1R5HA 4Y22A 3SFZA 3CMEI 1POV3 1Z21A 3LAGA 3DU5A 1UO9A 1FBQA 3CCRI 4A3EJ 2B46X 3LOCA 3OSGA 3I3DA 1WZXA 3AYEA 3O1MA 4IQ4A 3DUIA 3T1BA 5FZAA 1WMDA 2RV8A 3M1CA 1H1MA 2OT7A 4AEDC 3LGRA 1LFUP 1R1A2 3H9QA 1YS6A 3L7WA 1WVRA 2HQNA 2O8KA 5FLVA 4A3GJ 1CAUA 3K77A 1BI0A 4KWUA 1TT5B 1XNTA 2JG8B 1GOGA 3FXOA 2Y8KA 3GTKJ 4HBNA 1W36C 4CRQA 4IHVA 3N7KA 2LBFB 1R36A 2CTVA 3BZCA 3VBUA 4TTGA 2IUWA 1W9SA 4UFIA 1VBD3 3D4KA 1S7OA 1WMXA 3RKQA 2PQ8A 1UL9A 1JYTA 4ASLA 1FYKA 1BJQA 2YBSA 3J8F3 3OYMA 1W8NA 3WT3A 4Z1VA 4ORFA 1G9FA 2ZMEA 2K3PA 1C1FA 2ZGSA 2LRPA 2RS12 5HCFA 1FT9A 1O3RA 1PUEE 2DMTA 3ATGA 3WW1A 1OA2A 2ECBA 4XQWA 5JSOA 1JT0A 3ONQA 2DUOA 5J6XA 1F4AA 2OZUA 1DPRA 1ZG5A 3UJQA 5F32A 1GHCA 2R4GA 4Y7NJ 2GC2A 3QWLA 1H89C 1RUJ3 4QX0A 3H5RA 1QJX3 1PM7A 2EFQA 3BROA 2ETHA 1AVBA 5CKTA 2CGOA 1ZNPA 1VQ5I 1N3QA 4FPFA 3I97A 3IWFA 3FK6A 1C57A 1HQNA 2WYFA 2PJPA 3WNMA 3U4XA 4B3XA 1GWKA 2CU5A 3K2AA 3HL2A 3F8NA 3WEZA 3UV9A 1SACA 4B48A 1WHUA 4CDUB 2F4IA 2BGCA 2KJBA 3I54A 3ZXEA 4UUSB 4QGLA 4DUXA 2RM23 1VP6A 2WWSA 3PMSA 1AYM1 3GHNA 2V1UA 4CGZA 5I0DA 3H0OA 4HVQA 3H1CA 2A69F 3FM5A 5J1XA 3SEPA 4EGZA 4ENJA 1LULA 4CP1A 5C3PA 3GEZA 2E2IJ 2QQOA 3UGFA 3MCZA 5DD8A 1PM4A 3EETA 3HPHA 3GTLJ 2DPDA 5JOYA 4NIHA 1ZVFA 2M45A 1G8WA 3VDDA 1LOEA 4CPBD 2R32A 2CQKA 2ZS6B 3RS6A 1IOAA 2RE9A 4DOUA 4PDWB 4AF9A 4CXXA 4DZPA 4UW4A 3MEPA 2GLOA 2CDOA 4XIDA 4M3CE 3KHCA 3FHZA 3S2DJ 1N1VA 3AYCA 2JA8J 1UN1A 4ENMA 4Z2WA 1S29A 1GVJA 4RB0A 2JKXA 5L9RA 2DOAA 2W1OA 2E35A 1GOFA 3MPBA 5CADA 2ZSHB 4IOCF 2PG4A 1GZCA 3VBRA 2W68A 3OSDA 4CXYA 4CDXA 4EJTA 2BZDA 5C5UA 4BBRJ 2V72A 3EUHC 4TZDA 2P1BA 1SLIA 5JIUA 1K61A 1EV11 4FPOB 2DTWA 4BK5A 1IS6A 3MW3A 3MW2A 3A4CA 3VB2A 3J81Z 5EIYB 5HXVA 1HC8A 2PQSA 2P3KA 5KR7A 3I2JA 1XPXA 1KU7A 1QJY2 1EH6A 4DJAA 5FYSA 1XCVA 2DUPA 4A3IJ 4BXXJ 3DXUA 2WAFA 3LSJA 1RIOH 2CSGA 4LBKA 5ANNA 3W20A 5LW9A 5KC6A 2E9QA 2XGXA 5CFCA 4I3GA 2Y38A 3DF8A 3TEZA 2X10A 2Y48A 3POEA 4RR3B 3HRSA 4A3MJ 4H0EA 2BBYA 4AVCA 3EQLF 1GUIA 2VKVA 2Z9OA 4P5HA 2HWD3 2DAOA 4YFNF 4XFBA 1OYYA 1ZGWA 1WSUA 1RUNA 2VKDA 2Z99A 4AW7A 2VBWA 1MMGA 3KT1A 5DEQA 3EJKA 1UD1A 1QOTA 4J6GA 3DF0A 4LKFA 1FV3A 5L19A 2YGLA 4XF9A 4BDYA 3LSMA 4YIFA 1ACIA 2L7MP 1S4CA 1POGA 1MS4A 5IOYA 3B9CA 4O5VA 3USSA 2MFZA 4CZSA 3DPRC 3KLSA 2E60A 3I59B 1Z1DA 1FNNA 5E1RA 5FLJA 3KLOA 3W6VA 2BEOA 1RL3A 5C70A 2I10A 5K0UA 5B1BH 2QQJA 4BJ0A 3TO7A 4OCTA 1GV9A 4OI1A 2V1NA 5JXIA 4XR6A 3T2PA 1TNFA 1OQDA 4F7ZA 2DURA 3OY8B 2E7TA 3BIWE 4KBZA 1A5JA 4NHMA 3PDQA 3T30A 1ZRFA 1UB9A 1FTZA 2M87A 2JDNA 2EFOA 4A2UA 5L3EA 1KYZA 4XUNA 3UNPA 1VBD2 4ZC3A 3AAFA 2TRTA 4LHNA 1CQ9A 5GTIC 3B6CA 3N36A 4C3IJ 5FY1A 1DGWY 3V65A 3LWFA 5CJ9A 3DEEA 4D9JA 3E1SA 2ES3A 4ENNA 3NRVA 4BLIA 2WT1A 3LE0A 4WV8A 4AQTA 2XB0X 3R60A 1V54H 2RVAA 5IVJA 1UIJA 3N3HA 3UR3C 3WTXC 1WCSA 2VVFA 4G12A 1XE0A 2AREA 1L7QA 4ZYGA 2LLKA 3AMQA 2OU2A 1IUYA 2YU3A 4RGKA 3JD73 1YFXA 2XOMA 1X19A 2VNVA 4HF0A 2OPTA 1JYXA 4UXAA 3LFMA 4FXGB 4GWIA 1T95A 1FYUA 2OQ7A 1R7JA 2ID3A 3UNGC 1LKNA 1TWFJ 3EYPA 3TN92 2AEYA 4HK8A 2QVOA 1SQ4A 1UKGA 2G9WA 1GQGA 3VSKA 4QQLA 1TQPA 3EUKL 3HBLA 3VBSC 1PGSA 4QHBA 4EWAA 4E7JA 1IN6A 4MV2A 1RKTA 3N7MA 3B73A 1ND3A 1IRFA 1D1BA 4IJAA 4S2HA 1Y8QB 4FPEA 1JE8A 1JKRC 4RQPA 1AHDP 2WINB 4DZJA 3KCXA 4B09A 3THTA 5I93A 4W6YA 2Y0SN 3VKOA 2QQAA 1ASJ3 1IC8A 2XBO2 1PP8F 2V9VA 1B35C 1OJLA 4KWKA 2JT1A 3N9MA 5CKMA 4C2MJ 4IEPA 3ZCOA 1QDCA 3I8TA 3ZLIA 4LE3A 2VTXA 2V1DA 2E33A 1LE8A 1GLNA 4OOIA 2ZB9A 3BB6A 3BZKA 1YXWA 2HQAA 4Q1PA 4BB3A 1RUD2 2BVVA 4FHTA 3QPTA 1DGRM 3LEGA 2XVGA 2NVUB 2HDWA 4Q27A 2WNVC 2QA4I 2F2EA 1AXKA 2BOJA 1QJY1 3FF5A 5I91A 2M0MA 5LY1A 3GLXA 2HZTA 4PJYA 5IK5A 2R7TA 3HN3A 1RYYA 4A6DA 1U3EM 3ZQFA 4NMIA 1IRGA 3JD72 2CFXA 5A6YA 4LBLA 2YU1A 2QZ8A 5GPAA 3H36A 2ZKLA 3R6SA 3FLPA 4ESBA 2F48A 5M3MJ 1ULDA 1OQEA 5KC5A 2ZJQF 4HANA 1ERDA 2NS0A 3HOUJ 1FPN3 2PFWA 4MGTA 2JRMA 3RPUD 2EZIA 3MFKA 5FYTA 1LEBA 4YFZA 3BYWA 3KEQA 4Z07A 4LO8A 1AWCA 1HBXG 2G19A 2KQRA 3HRMA 1JOJA 2GXGA 4QB6A 1JJ8C 3VBUB 4PGGA 2R1BA 4L5EA 1AR82 4UFLA 1QZZA 2VBBA 1GWLA 1OOPA 2E63A 1MQTA 3A23A 1ETKA 3JSOA 3ZQGA 3PO2J 3M3EA 1O6UA 1KRIA 1MKMA 2KL4A 2GN3A 5F3EA 3WXPA 1GZTA 3GWZA 1BK0A 1U8RA 4HBLA 5A70A 1SC7A 1V9U3 4FISA 3V56A 2TNFA 1PO13 3E5XA 4RS8A 3MZHA 1SANA 1CPNA 2XC7A 1G59A 3CC4I 2XSDC 2QCOA 4CYCB 1EA3A 4K8FA 2Y6KA 4BNCA 3FE5A 1QH6A 4DBRA 5HDKA 3P1IA 2QGUA 3AKQA 2ELHA 1H30A 2DCTA 2ADEA 3A0NA 1R49A 1WW7A 5M5XJ 5J4YA 1IG7A 2Z16A 5KHHA 4KWLA 2NRAC 5M5YJ 1UKRA 1Z91A 3E6BA 4NQWB 2VCMA 4PQQA 1QDOA 3T3YA 1GKBA 2DVGA 3GYDA 1MH4A 4DMIA 1D7PM 4XAAA 4A3CJ 3S5QA 3MZ8A 5IYCJ 1STMA 4L9NA 2KRCA 5FZEA 1HQWA 4FFIA 3HBKA 4D6RA 3L2RA 4C0HA 3I2FA 4BIFA 2VNRA 2WFF1 3DLAA 4I0WB 3V8JA 4XEZA 2XAJA 2QDRA 3A21A 5L3DA 1KFUL 5FAXA 2VZTA 3BUCA 2RVCA 5CZKA 1UZYA 2Y9ZA 1O4XA 3OYDA 3BIEA 4RN5A 3DGTA 3QYFA 4FPGA 3T8RA 1LHOA 4Q4X2 2HNHA 1USTA 3BALA 1XSRA 1XCBA 4Q5SF 3JB8A 4PLMA 2VQGA 4N9IA 3CMGA 4D7YA 4AVPA 3J80Z 2QQWA 1R71A 5FB2A 2DUQA 1LJ7A 2D44A 2D3RA 4AHWA 1VAVA 2XV4S 1YJ9I 4RFRB 4DB5A 1J09A 1RUI1 3WCSA 3SCHA 1FOYA 3ZIXA 2KDZA 2JPBA 3RMXA 4N7UA 3M4FA 5JMOA 1RTVA 4FQZA 2XBO1 4Z6YA 3PL8A 1AR83 5CA6A 2OD5A 1LHWA 1EKEA 3ABZA 1TL8A 3AP4A 2OUMA 4AUXA 2GALA 3I3MA 4BHCA 5GLWA 2WN3A 1OCPA 1H2MA 1XSVA 3D3AA 2TCTA 5DUUA 4YM0A 4CDQB 3CUOA 2HVRA 2A05A 1OPCA 5DDJ2 3NVCA 1G3WA 2W91A 4C8DA 3WV6A 3RMYA 3GCWA 1W36D 2EV0A 3ETQA 2CW8A 3JRIA 4HG6B 4HXCA 4N0BA 1VMFA 3WF0A 2A73B 4ZZDA 1FZPB 3AC0A 4FPJA 3I49A 2OW4A 1W2NA 4MGRA 4FP2A 1WJBA 2W46A 4OI4A 3ZN4A 1UMZA 5EP9A 2KHMA 2X1CA 3WNLA 2B9SA 2E71A 1YOVB 1OF3A 5LGNA 2HOTA 3VBRB 3OPWA 1ENSA 4WM7A 2R7RA 3DP7A 1UX7A 3S8PA 2VT2A 4D69A 4ZKTB 5FFXA 5JOXA 2YU2A 3O8GA 2YC2A 1N25A 4DNCA 3HM5A 4EWDA 4Y5Z0 1ND3C 2XVLA 4JC1A 4D0QA 2QWWA 3U9GA 1EPZA 1S0EA 2ID4A 3MIBA 1XSXA 2CH0A 1AR63 3OR2C 2FQ3A 3C8XA 4QKFA 4DS0A 2FBEA 5FO7B 4FBFA 2FDKA 4L5IA 3G73A 2Y33A 5BV6A 3POGA 3DPLC 5I8TA 3G3ZA 2WBKA 5EYRA 4Y20A 1ULGA 3ES4A 2JKBA 2OAZA 4JGZB 3L2WA 2RREA 3GTGJ 4QPGA 5F1JA 1K5MA 3L1PA 2Y0SA 4YIRX 2IVIB 3A01A 1X1BA 2J42A 4ISQA 4KIFA 4MGKE 3HUGA 1JZ4A 1YCIA 4NWVA 3IH2A 3WUCA 1GNHA 4PBPA 1HDKA 4LKDA 4XE9A 2IS2A 4AAPA 4TN7A 2VQAA 1KFXL 3LSHA 4QXBA 4UT5A 4EM1A 1V70A 4IX7A 1R1A3 1US3A 3LKJA 3CCMI 1E5HA 3TOBA 4QGNA 5F3GA 3I3EA 1VQOI 2XLGA 4LOCA 1LKXA 1AR61 1MBGA 1YI9A 3QH7A 3BTIA 3HTSB 1WCUA 3H9JA 4KU7A 1NH3A 2V6CA 4P9JA 4ATEA 1SMVA 2BFUS 2RDPA 1O57A 1VQ4I 4P14A 1DQUA 5JZGC 3BR0A 3WOGA 3KP3A 1UHSA 1AZDA 1OC1A 2RJLA 4QPIC 4QKNA 2PELA 1F9KA 5DD4A 2A6WA 3H1WA 4HMZA 5HCBA 1Z77A 5ICEA 1HXS1 2VN2A 2JA2A 4RYDA 3S7EA 2VVDA 1REFA 1WA6X 2BXYA 5J48A 3OGGA 1ETQA 4FP3A 4RDUA 3WD5A 3ZFFB 5D8AB 3N9LA 3GZ5A 5JLXA 2CV1A 3A03A 3NQHA 5BNOB 3E6MA 4XURA 2D6MA 4JAAA 3H92A 4A7KA 5LEJA 3ABKH 2HEWF 4L8QA 4GMP0 1JYVA 2DCYA 4G7ZF 3LL7A 4Q0UA 1YQCA 5ACA2 1K79A 4GULA 4ESFA 4ZY9A 2XROA 4XRSA 1GMMA 4AGGA 1KA8A 4XUOA 5K7HA 4MGYE 1H6XA 1OCCH 4AQ6A 2W48A 1HXS2 3SH5A 3AL5A 2GOXB 4B8EA 3W9AA 4BQ5A 1HV1A 2TDXA 2QJVA 3A01B 1MSFC 1OFSA 3UETA 3BG5A 2LFBA 4Q29A 3K4DA 1PK6B 3R0JA 4Q4W2 1MS9A 2Z33A 1B8IB 5HNFA 3E1F1 1VRH2 5CFDB 5H20A 3LWCA 2RG4A 1P4AA 3RZGA 1XC6A 5EJ3A 3OYEA 4ZU5A 1VJ2A 2XJVA 3VOEA 4CA0A 3F9KA 4JV4A 1C3HA 4DUVA 3VBHA 2JQ7A 3FXKA 2JG8C 5FPUA 1LFBA 1JUSA 2PN6A 3O1VA 3WE2A 4C1WA 3HN1A 4BY7J 2YS9A 2IPQX 1EAH1 3DN7A 5J3UA 4YGCA 1D0HA 3BTCA 1YRNA 4HKOA 2I45A 4IE0A 1A78A 5FZ3A 5FXZA 2CJJA 2RS53 2LKPA 3KP6A 2AXLA 1MPXA 4TV7A 1V6KA 1NXMA 3CMMA 4AWXB 1N1TA 1S1AA 1XGSA 3LAJA 2ETEA 5C44J 3MMYB 4CUBA 4YEJA 1WW5A 3T4VA 1I1SA 2WADA 4KFCA 5DDJ1 1RZ4A 5FXXA 2GWRA 3TQNA 4BEHA 4RGRA 2HYKA 4LORA 1JXNA 3HGYA 4YELA 3DFGA 3CUQC 2VMIA 4UHTA 5A3PA 2K5CA 1TC3C 1I9RA 2P6CA 1U9OA 3A1YA 1W6QA 3PNAA 2YZ4A 3KP7A 1JI6A 2LP0A 4NVPA 1ZRCA 5J37A 1W8OA 4NUBA 4QWQA 3IIIA 4MIMA 3N9OA 3KS7A 4Q1RA 2PX9A 1MEC1 1ZM1A 3KZYA 4F3QA 2PJRB 1VIWB 4E2SA 2WZEA 4PI0A 3DKYA 4IV3C 5A6QA 4G7HF 2STWA 1YIFA 2G9GA 4EN0A 3GO5A 4C9YA 1HDDC 3U07A 4YG0A 3BQYA 3FZ3A 1OR7A 3K9TA 3Q0VA 4NC8A 1DUXC 1TWAJ 1Y56A 3G6EI 3SHRA 1YO5C 3VDDB 2ISZA 2FE3A 2OXBA 3ZOBA 2GMEA 3HNMA 3ZN5A 3GFLA 1Y8RB 1UG2A 4BBSJ 5GLUA 4JX0A 3L09A 4CCLA 3OOPA 2W1WA 5A7QA 2L3DA 5T54A 3V0AA 1QJU3 3QACA 1C8M2 4KMUX 1O4YA 5FXVA 4ES9A 1LHVA 3WG2A 2PBIA 3AX4A 2RQPA 4BS9A 2EV6A 5ILVA 5FZOA 4CDXB 1YFWA 2W9XA 1VRH3 2A6ZA 5LRSA 2J22A 4GB31 3TMOA 1XBFA 3JBG2 3V0BB 1JODA 3N4MA 3PQJA 2ZHNA 4WM8C 1VAMA 1RPWA 1FPN2 3CCLI 2PMZN 4INDA 4JDNA 1K45A 3QLQA 1DP7P 3CJIB 2H0BA 2H1KA 1XSQA 1W6OA 5JXHA 1QZEA 3ISPA 2CSOA 1ZK8A 3SEEA 4JBAA 5CFCB 4HNTA 2E34A 1BK1A 5IUQA 1A6QA 3JD71 2NN8A 2R063 4HSLA 1VBE3 3BR2A 3H3LA 2M3AA 2XJRA 3ZFGA 1VR3A 1PZ9A 2QUFA 1VQ6I 2DU1A 5CVUA 1SPPB 4M3GA 1XGNA 2KD7A 1P6RA 2ZX2A 3AKPA 2TUNA 1J7KA 2KIMA 2NXNB 1QNWA 4URTA 2X4HA 4LHLA 1OYIA 5K5QA 1ZHFA 2WO2A 4AL9A 5B4XA 4B7KA 3WHTA 2P3JA 2XXZA 1EV7A 4BAYA 1SAUA 2L02A 2XWBB 1LOFA 5JWPA 4OI0A 3HOSA 3BCWA 4CP9B 4B4PA 4RR3C 3T8TA 2PFBA 3NKGA 4UBHA 3JUUA 1BKZA 2D1HA 3RCOA 1N77A 3KQRA 1GDTA 2D93A 4A3XA 3HEIA 1YX5A 4NC6A 3AJYA 1ZG3A 1D2QA 1Z7S3 2HBTA 1LGCA 4J1WA 1FC3A 3HQRA 1NE4A 1TQMA 2F4LA 2EWNA 5FKKA 5EJCA 1RUH2 4CH7A 1TQ5A 2Z4FA 4I09A 4O7XA 2W94A 2VMFA 1IDYA 1BI1A 3RSJA 1MS0A 1GFF2 1W0NA 1RXFA 5KVRA 1H4HA 2R7DA 5DYMA 3FXQA 1ETOA 2BV6A 2A1XA 3CD6I 1TNTA 2K4BA 2A75A 2DVBA 3W59A 1OLRA 3K4MA 3QPHA 2FBKA 4AYBA 1UU4A 4DZGA 3ME2A 3J7MA 4D6SA 1R1TA 2ATFA 1J3PA 4BE2A 1UXZA 1T2XA 1FJLA 4QDRA 1N3PA 3ZPYA 4LKSA 1GVDA 2GP3A 5FIXA 1HN1A 1BJAA 1UPSA 4MNUA 4XJWA 4CTEA 5F27A 1CAUB 2JE9A 3C7JA 3CDHA 5BYNA 2ZXJA 2E51A 3RKWA 2Z79A 3P5BA 3ZMUA 1ZTRA 4ITCA 3GCMA 1BOBA 2G9FA 4UVBA 3LPGA 3J7LA 1DG6A 5ERLA 4N7IA 1A6IA 2WFF2 2X9DA 4NC7A 4MEXF 1RUC1 2WV1A 2SBAA 3GZTB 1IV6A 1O59A 3PJRA 5FKLA 2EXKA 3SKVA 4JQFA 1UXXX 3ZYJB 3MHZA 4HSTA 1KU2A 4UBGA 1PIV1 2RS13 3TKYA 4KI5M 4CCNA 4H4KC 1S2EA 2WZR1 3OUHA 1NLRA 1AF9A 1LOFC 1XB4A 3DECA 4CP0A 1YHFA 1IUFA 2VE1A 3S7IA 3C7HA 2AZ5A 1SMTA 3F22A 2F4OB 5DZFA 2ZZQA 2P4EA 1XE8A 4UVAA 3NNMA 3P3NA 2ZAHA 2VMCA 2D45A 2VULA 5JSPA 5K1YA 3FKJA 3GTMJ 3VD9A 1SBFA 4LK7A 1YQAA 2R30A 3ZXGA 4QPGB 5BQTA 4UVCA 3TL4X 3T09A 2FNAA 1Q8QA 2FF4A 3C2UA 3Q0UA 4M4PA 5AIQA 3MD2A 1CIYA 4R1HA 1L3LA 3VUOA 3H5AA 5GAEJ 2JB4A 3KV4A 4LHSA 2M30A 4AI1A 5LHHA 4LJZF 1FI2A 2FZ1A 5FV3A 1RUI2 1RXGA 5L3CA 3KP5A 2AR6A 1T0FA 2P2KA 4XACA 4OWRB 2VBYA 5FZIA 2DMNA 4GKYA 3PVBB 3GBWA 1S9HA 5F08A 2OTJI 3OY9A 1LU1A 4LLFA 2LROA 3FJSA 2ZJRF 5KXDA 3GNEA 3PIGA 2KFDA 2ZCWA 3LQCA 3K4ZA 1IG0A 2L9RA 3TBIA 4AVAA 5AC92 4BQAA 1XDSA 1T2KA 3PVOA 4FPCA 4XOTA 3I2DA 4DXZA 5LWBA 1W3XA 3R4SA 3AXDA 4OZXA 4P08A 1XU2A 2W82A 4GZ9A 5HS8A 3ZXAC 4Y1YA 4H7LA 1PO23 3KE2A 2VW0A 1LAJA 1OVSA 3M3YJ 2ECCA 3VDBA 1XSDA 1K5JA 4CCKA 2HPIA 5HLHA 1HIXA 4EM0B 2A5ZA 1YJWI 5E18F 5F3CA 4P1WA 2YMZA 3I3QA 2F5EA 2NOJB 5JOZA 1ON2A 3DTIA 1JZ5A 4OIOF 2VL4A 4XKCA 2XAUA 4QX8A 4LHKA 1IPJA 3G7DA 2HFHA 3DKQA 1GICA 4I0AA 3CDLA 4XJUA 2GP5A 2LF7A 5BNNC 3LSIA 4PIXA 5IYBJ 3G71I 2ACJA 1DQ6A 4YRVA 2NS7A 1B1BA 2UUZA 3WG9A 4LK1F 1B8IA 2ZEZA 3DCFA 3LSEA 4XFAA 3OEAA 4PCRA 5FD5A 4PGHA 1OKOA 3D82A 1VBA3 3ZMVA 1Q8VA 5D6EA 1O3QA 1S3JA 1NK2P 5CKNA 2RS31 2UWCA 5EHDA 4BMEA 3HNBM 1YX3A 5ICGA 3D5OA 4M3CB 1LR5A 5FPVA 5JIAA 3HOXJ 4KITB 4XICA 4XRMA 5BNNA 3CC2I 1OD5A 1TMF2 3MPPG 5IATA 4GXLA 3W2VA 1QQP2 3KEYA 3TWIA 3CCQI 3PSFA 4WCGA 2VQLA 2AGSA 1KD7A 3DTEA 5LLQA 5FYHA 1X1PA 2YPJA 2HH9A 3AKZA 4FOQA 4S04A 1QU3A 2DVDA 5T5OA 3ETPA 1R082 3CU7A 4MQ9F 3IHUA 1U0AA 3NWSA 3NAUA 4XNFA 2MH2A 2QQ8A 1W7PB 2OIIA 2EINH 4I01A 1FBUA 2XPJA 3K3NA 4II3A 2IA0A 4MHUA 1LU2A 2XPVA 3ERMA 1VBA1 2XQRA 5DG2A 4FSJA 1NCQC 2EAAA 3PQKA 5FRNA 4BQ2A 1QOOA 2XAQA 4P9GA 2DFEA 2DQRA 4KH9A 1YFHA 1CWPA 2DT5A 5FUIA 2VECA 4NIAA 2ET1A 3AM2A 2EICA 2PLV2 2DLLA 2ZSIB 1VBE1 5ICCA 2XVKA 4YVWB 1SMYF 2JX9A 3WTWC 3UJOA 1X1AA 4ZDLA 4KG8A 4GWMA 3OL4A 3TDZC 1PMIA 3KV9A 3FX3A 5KHKA 1BCXA 5H9QA 4M9SA 1RRJA