1J59A

Catabolite gene activator protein (cap)/dna complex + adenosine-3',5'-cyclic-monophosphate
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
199
structure length
199
Chain Sequence
PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the CAP-DNA complex at 2.5 angstroms resolution: a complete picture of the protein-DNA interface.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords 5'-D(*GP*CP*GP*AP*AP*AP*AP*GP*TP*GP*TP*GP*AP*C)-3'
total genus 53
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1j59A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1j59A01
4P9GA 3KEQA 5H6QA 3HQXA 4ZU7A 2YU3A 1OKRA 1YFXA 3J81Z 2IXKA 2QQ9A 3NSTA 4XF1A 2RQPA 5I0TA 2UY9A 2PMHA 2QNKA 4XETA 1AWCA 3SHRA 5E17F 4Y13A 3OV8A 2Y0OA 2EFWA 1YLFA 2FEZA 3CL1A 3SCFA 3H7JA 2MPFA 5JAXA 3CJNA 5EZWA 2EV6A 2O03A 3KP5A 5FLHA 4ENJA 3LWCA 4EWDA 1UPIA 2P17A 3MZHA 1FP1D 1O3TA 1IW7F 2TDXA 1DZRA 3F3XA 3M1EA 3WTVC 5LGTA 2EFPA 1FYKA 4WBBA 1R1TA 2JPBA 4UHTA 4QXKA 3M3IA 5C6CA 3R61A 4UUVA 5BUVA 2ADUA 1B9NA 2QCSB 2VECA 4AIJA 1LKNA 2UXNA 3EYYA 4OIPF 4HSJA 1EH6A 4HAMA 4CDGA 2DFIA 1USTA 1TBXA 3MDPA 1IPJA 3CDHA 1YHFA 1SAXA 2RVCA 1BJAA 4LG0B 5K1YA 2FF4A 1TNTA 5BPXA 5E1RA 1LDKB 1IN4A 1DUXC 3IBMA 4LULA 1ZRCA 1HBXG 4I7HA 4ZYHA 4Q0PA 4QM8A 1Y9QA 2OZUA 4KWLA 3GZ5A 1HW1A 2HOEA 1FT9A 3QRFF 4XEZA 1JXSA 2DO7A 2PQQA 2W25A 1J5YA 4G9YA 1IF1A 5K5QA 1G6NA 3QOPA 2C6YA 1E17A 4LGWA 2I45A 1BI3A 3SZPA 4D7TA 1LNWA 1YQAA 5FLXZ 4R52A 3MPBA 3DF8A 1U12A 1QZZA 1TTYA 2EJRA 4U0WA 4M74A 3CUOA 5F6FA 4IJAA 4LJZF 3E6CC 4MV2A 4L9VA 4P96A 5LGUA 4A5NA 2DPDA 5JSPA 3E6BA 1XSDA 1E2XA 1W5TA 3OCPA 3D82A 2VODA 1T0FA 3MCZA 3WTXC 4L9JA 2K02A 2LNBA 3BB6A 1BC7C 5H20A 3HTSB 3KCCA 4YSFA 4XFGA 1IN5A 2VBYA 2MA3A 2PG4A 5HLHA 1YW8A 4ZYDA 2F2EA 1OYYA 4XFHA 3L00A 1FBSA 2QYOA 3E5XA 1DGRA 2UYBA 2MC3A 4FX4A 4LK1F 4EJWA 4XF4A 4ZU4A 2Y48A 3R6SA 4KYWA 2P7VB 3K2ZA 1IN7A 1JHHA 4EJTA 3V7CA 1K78A 3FMQA 3HTUA 4EGZA 1RL3A 4UV8A 1F9NA 4QWQA 3QAHA 1CAUA 2H09A 3F8MA 2YX7A 4BHBA 4LFUA 1I1GA 2A6HF 5LHGA 2FU4A 1ZG1A 5J3UA 1Y3TA 2C0ZA 4WF2A 1XSVA 1QXRA 2K9ZA 4WZCA 3I5UA 4IXAA 5CJ9A 1J3QA 1ZAOA 4IHTA 4IEWA 2W85A 3D0JA 1BC8C 5KHGA 1PP8F 3BJOA 1O3QA 4XFIA 4PIYA 2FMLA 1XMAA 3WTSC 4RB1A 3LQQA 2UXXA 2BNNA 3IKVA 1J3RA 1V70A 3ECOA 4HSLA 4ZU5A 2IA2A 4S04A 1UFMA 4GCVA 1RNLA 4PCQA 4KUMA 1V4RA 4WXHA 2ZBKA 1ZLJA 2DPUA 3NW4A 2M1BA 1R5HA 5HLIA 3U0ZA 4GYIA 2MLKA 3MYXA 1R5GA 1D8KA 1B59A 1WWXA 1UB9A 1QO0D 3N4MA 2FRHA 2NAZA 1LQ1A 2RV8A 2D1HA 3SHFA 4JQFA 3WGHA 2GZWA 3HT1A 3ZDSA 4S05A 4HF1A 2V1UA 4BIFA 4IVNA 2BE5F 4OFGA 2HTSA 3OTFA 4LLGF 4M72A 4NHJA 1G3WA 2IXCA 3E5QA 2PAEA 4I0BA 4P5OA 2QJVA 3ERED 1LRHA 4G6DA 2HKXA 3RDIA 1I1SA 1KYZA 2E1NA 2ETEA 3ZN1A 1J1LA 4B09A 4EMSA 5I8YA 1MJ9A 1CF7B 4PIXA 2UY8A 1FBQA 2QLZA 1OYIA 2H27A 2JSCA 4B29A 4L5JA 4IEQA 4EGYA 2EAAA 1U8RA 3KSCA 2GXGA 1BI1A 1ZHFA 5KHHA 2YPRA 5CVJA 4ZYEA 1HSJA 2BNOA 1STZA 1FXZA 1UW8A 5FQ0B 2BEOA 2Z3YA 5FQ0A 1FY7A 4DINB 3I64A 4IF4A 4RGXA 2RDPA 4I09A 4PJYA 2W24A 5FD5A 2WV0A 3BALA 2FBKA 4KN7X 3FF5A 1UHMA 1B4AA 1TW3A 5D6EA 2OA2A 1HSTA 1QQIA 3GFLA 1W7PD 4HV5A 2BNMA 2MLGA 3EQEA 3UKNA 4HOBA 3K69A 2OBPA 3EUHA 1P4WA 4P55A 4HA8A 3VHRA 2GIVA 4CYDA 3SFZA 3T1BA 4HVOA 4G7HF 2RNJA 4X6RB 2M87A 1ZH5A 5CU1A 1USSA 3RTRA 2FNPA 3DFGA 4O3MA 2DW4A 4HBNA 4IEVA 2VOPA 3ZMSA 1FYMA 2VPVA 5E16A 3RPUA 4YIFA 4R1HA 2D45A 2FQ3A 2CO5A 4IEOA 1ZZCA 2DK8A 1XDSA 3FFQA 4IEUA 1TQIA 1TW2A 1CF7A 2KRFA 1J59A 1YWKA 2Q0AA 4META 4RGSA 4HN0A 5HI0A 4OOIA 1J9IA 1ONVA 1LDJA 3PNAA 1W7PA 4M9XA 5L3GA 5BS6A 3CEWA 3HHGA 4XLNF 2DI3A 2L4MA 3DN7A 2A69F 4G94A 1FOKA 4K8FA 3IIAA 4HW0A 1G4DA 2Y75A 3RJPA 1XE7A 2JT1A 2VQAA 1R00A 2OYZA 2DLLA 2B5HA 2OU2A 4PGHA 5CVIA 5ILVA 3E5UA 3KLOA 1K7AA 1U6GA 2GWRA 1UIJA 3J80K 4UVCA 5E1XA 4FAGA 4I02A 2XRNA 4A12A 4PZJA 5H6RA 5KHKA 1ZNPA 5ILSA 5KBFA 5L3FA 4UBGA 3J80Z 2Z69A 2JTVA 2EFNA 3K0LA 2PYTA 5FB2A 4K2EA 5IT9K 1I6XA 3C1DA 3L9FA 4XRFA 5C8WA 4UXAA 2B8MA 4FT8A 1WSUA 4LD5A 2QBYA 4OLLA 2VBWA 3V8JA 2A3SA 5BV6A 3J7AO 3C3VA 4ESFA 4ZZLA 3LAJA 2HFHA 3LZZA 5HOOA 3I0TA 1YFYA 3IRRA 1YFWA 1MDMB 4AVBA 1FNNA 4IPAA 3FZ3A 3BY6A 1KA8A 4L9NA 1TQ5A 1G3TA 2EK5A 4JTOA 3O6BB 4ON0A 1IRGA 1B6AA 5KHJA 2D40A 4WXCA 5EEGA 4WVZA 4RAZA 3TKYA 2ET1A 1SFUA 2X4HA 2PI0A 1JGSA 5D4RA 5A2QZ 2O8QA 2GU9A 2KJCA 3RKXA 3ZMZA 3RYRA 3H9AA 2UZKA 3C3WA 1O4TA 3IC7A 1REPC 1S6LA 2F5FA 1J3PA 2K4BA 2DAOA 4L0YB 2GC3A 3NKTA 4XF0A 2BBYA 2VBZA 2DQLA 3R4KA 1PDNC 3FZVA 1FP2A 3G3ZA 1CAVA 3WGGA 5I0SA 5BOXA 3CF6E 1FBUA 4YFXF 4L5IA 2OD5A 5DCFA 3E97A 1TNSA 1IAWA 4Z07A 4ZZDA 3C7JA 5D8LB 3GZ6A 1BN5A 5FCCA 1JHFA 2QQBA 4XF9A 2LDUA 4WCGA 3SXYA 1H9TA 4WK8F 3KP4A 4RB3C 2ZMEB 2E7XA 2W57A 2L01A 4U7DA 2VE9A 1C0WA 2HJIA 1K79A 4KN4X 3CO2A 4KWJA 2PHDA 2O61A 3SZTA 4GULA 3ES1A 4KIBA 3BJAA 4KIGA 1DZTA 3T8RA 1F1ZA 5F64A 1J7KA 3F23A 3GVAA 4P9FA 4BNCA 1RUNA 2F5DA 5L3CA 3VOEA 1WQ2A 3IWZA 4N9HA 4I2OA 3BPVA 4A5MA 2Q0OA 3LFKA 3DL3A 3M70A 4GGGA 3J81K 4TV7A 4OMYA 2PEXA 2Q1ZB 3MFKA 4AIHA 3I4PA 5ICCA 4B8XA 5TRDA 3L09A 4XFAA 3TNPB 4O5VA 4XFFA 2DT5A 1RIOH 5LGNA 1H1IA 4G7OF 1YW9A 3REOA 3K1PA 2GAUA 4D7SA 3ZMDA 4F7ZA 4JTNA 3D0SA 1Z1DA 1ZGJA 2XAFA 4L18B 4BHPA 1XDUA 3WTYC 4JBAA 3MQ0A 5CYVA 3ROUA 2MHFA 4E2QA 5ERIA 4DQ2A 3S7EA 4Q48A 3CUQB 1XCVA 4Q5SF 5JVTA 2PLYA 2Y0MA 2ZFWA 3EBRA 2UWMA 2XV4S 3I53A 1LVAA 2QVSB 1T2KA 2HS5A 2FBHA 1MD0A 5JSOA 4DNCA 4QGMA 3EYIA 2PQ8A 4MTEA 2GC1A 2LF7A 3I7DA 2NNNA 4KU7A 1ZG5A 1XMKA 2Z99A 2OQRA 3U10A 2H0VA 5EFUA 5I0RA 4WWCA 1QPMA 4GYGA 1UD1A 3T5XA 4HQEA 3KP7A 3FXQA 3RYKA 4IETA 2DBBA 1ODDA 5E8GA 3QU6A 1CAXA 2A68F 2VC0A 4X6QB 1LDDA 1RC6A 2ZCWA 4EM0B 2KKOA 3ST7A 4KMUX 2VT3A 5LEJA 3RKWA 2X0LA 5DDGA 5HDKA 1ZRDA 2B9UA 4I0AA 1ZG3A 1ZZ7A 1P2FA 2B0LA 3M9AA 1HKQA 2MH2A 2CAVA 2EA2A 3O2PE 2Q30A 4YYOA 1D3YA 1SEFA 1CGPA 4XBFA 3W6JB 4MGIE 4ASNA 2V1XA 1IRFA 4KU8A 2LF8A 2ETHA 3P7NA 3EETA 3I54A 3S0MA 5DEQA 4M9SA 4KA4A 2RC4A 4E2SA 2PFBA 1XD7A 4RB0A 1R58A 2GA1A 4LLLA 2NYXA 2IXIA 3M7GA 3TO7A 5AIQA 5LBQA 4AXOA 5ED4A 2Q8KA 4BQAA 3DEUA 5DV5A 2GC2A 4HLTA 5D1IA 2RN7A 2LKPA 3GX4X 1LEAA 2HDCA 3NJZA 2WFPA 1O3SA 4LLNA 2DCTA 3L2HA 3JW4A 4MEXF 2E1CA 3OGJA 4MQVA 2XLGA 1YTYA 1KU3A 3GEZA 1FLIA 1PUEE 1U2WA 2EFOA 1CAXB 1XCBA 2P5LC 3FXRA 1ZZBA 1O7LA 4HF0A 1BI0A 5KHIA 3K1MA 4Y15A 1K6OA 4Q0VA 2V6CA 1T38A 2FXAA 2COMA 5DUKA 1QGPA 3HYIA 2QUFA 2D93A 1P6RA 4HLXA 4QGNA 3WW2A 1H9GA 3DKWA 4A0ZA 1XGOA 1X7NA 1X8MA 5FLJA 3FJSA 4HVRA 2XAQA 2D1VA 3LA3A 1HKTA 4M71A 2KIUA 2IT0A 1S7AA 4RGRA 4H7LA 3NQOA 5I8SA 4FBFA 1NZCA 4Z2YA 1EH7A 3GXOA 1NHAA 1YLLA 4HVQA 1DP7P 2MD5A 1W5SA 1R36A 2XL9A 2VE8A 2ZO4A 2IA1A 1J58A 2CW0F 4KIFA 1WI9A 4YG2F 2EWNA 3FM5A 3BJ6A 1F5TA 3EO6A 5JI6A 4A0XA 3JZVA 3TOAA 1ZZ8A 2FQPA 3NEUA 2XAHA 3ZP5A 3WODF 5FD6A 5FDBA 1R23A 3U1DA 3RZZA 2G9WA 1FWZA 5CLSA 3M8FA 3TGNA 2CV6A 5FPXA 2KJBA 3WGIA 4KNYA 2HYFA 3GYDA 3LSTA 1WRJA 2HEOA 4HQMA 4BXUA 3BOQA 2HR3A 2K4JA 4WXDA 4OINF 3FE5A 1U5TA 2EV0A 4PIZA 4LMYA 4ZH4F 3EQLF 3ETQA 1R22A 4IEXA 4IEYA 2W84A 1GQHA 2NRAC 2XKOA 5CVUA 4QLCU 5JR7B 3BROA 3CUQA 1GXQA 2F5EA 3JAMZ 3DPTA 2G7UA 4KWKA 2IC1A 3PLQA 4Q47A 5CADA 3RYPA 3H7YA 4ESBA 3WW1A 5E18F 2MBFA 2VONA 5E1ZB 2GA2A 4KL1A 2V1DA 4EM1A 4J1XA 3S2WA 3RNSA 4AWXB 1W4MA 2QZ8A 2CFXA 1NE6A 1L0OC 5ICGA 2IPQX 5DUIA 1MKMA 1O7FA 4Q0QA 2IJLA 4XSXF 5FLIA 3O14A 3QU3A 1D5VA 2K27A 3NVCA 3V8KA 3F21A 3WU0A 1PMIA 3SCGA 1SFXA 2ZMEA 2E7WA 2NNYA 3WTUC 2VBXA 4I3PA 1L3LA 1SD6A 1GXPA 2IA0A 2EV5A 1KU9A 3GFIA 1U3EM 2PJPA 1Q43A 2O0YA 4AVCA 3O3KA 3KLNA 4YNIA 4L11A 4FX0A 1QXJA 5HDNA 2J5PA 2CSOA 4EM2A 4LB5A 3D5LA 3P9KA 2FE3A 4R8HA 3EJKA 2XASA 3K1NA 1JE8A 5FFXA 3GYHX 4OIRF 3CTAA 2CGPA 4ONUA 2BV6A 1HKSA 1J0RA 3HRSA 4AIKA 4MTDA 2KIFA 2WWYA 4Q0UA 2O3FA 2JZYA 5J6XA 1XRUA 4G8XA 3TDUC 3U11A 1ZARA 4RD7A 3CO7C 1SQ4A 1G3SA 3LA2A 3ZMTA 2A07F 4XFBA 1ZVFA 3CLOA 3HIFA 2PN6A 4JK1X 1Q1HA 2JPCA 2EVXA 4G7ZF 1FX7A 1CAWB 2K86A 1ZZ9A 4QMAA 2JRTA 1BBYA 1Z9CA 1IUYA 3DV8A 4A6EA 1OI6A 2ATFA 3SXWA 2M45A 4MQ9F 1VTNC 1Z05A 2AXLA 2BYVE 2J5OA 3VB2A 1O57A 3LWFA 3N97A 4L2NA 4YRDA 1CAVB 1WA4A 1GQGA 5D4SA 4Z82A 1SD4A 3DP7A 3P9CA 2F4PA 1RUOA 2V79A 2QVOA 1R1UA 1T6SA 1KQ0A 3GWZA 2FBIA 5HS7A 3RIRA 4HYEA 3Q5FA 3GLXA 1P4XA 2R7FA 3KP2A 2IP2A 3WW3A 1KQ8A 2EFQA 3MZYA 3H1WA 4EROA 3V8LA 3G7DA 3CO6C 4HX7A 2OAZA 1QWRA 3OOPA 2WTEA 1B1BA 4OIQF 5T3NA 5F1RA 2Z2SB 1H1MA 5I91A 1FSHA 4JVAA 2H6CA 3KP6A 4BAYA 2XAJA 3PQJA 4M6XA 5D6FA 3GF2A 3PVBB 3E3VA 3BCWA 4U0YA 3IKTA 1S29A 3IL2A 3LAPA 3ZN0A 1ZX5A 2Z5UA 4I01A 1MDMA 3U9GA 1OYWA 3F22A 4LA2A 1KGSA 3R0AA 2F5CA 3P9IA 4CICA 4GXOA 1J75A 1YYVA 4FAHA 2GXBA 5LHIA 4IEPA 1OMIA 1YW7A 2ESNA 3KE2A 5LHHA 1SD5A 4BYYA 1OPCA 1Z91A 5J48A 3GW2A 3LQRA 3T8TA 3RI4A 3ABUA 1EPZA 1Q5OA 3C18A 2XGXA 1LB2A 1T39A 2ZNZA 3KETA 2OQGA 4ETSA 3G73A 1YG2A 4GO1A 2EA7A 3ABTA 4J1WA 2VC1A 2PAKA 1KYWA 1KU2A 3QP6A 1JUHA 4M6YA 2IRFG 1IZ1A 4PGGA 3M8EA 3CUQC 3JSOA 4IERA 3TO6A 1G3YA 3QACA 1O5UA 1IXRC 4O9GA 5I93A 3H1MA 1RZ4A 1XGSA 4LLOA 2HQRA 2P6SA 3E6MA 1RTVA 1VP6A 5HS8A 1O3RA 1GVJA 1P4AA 2ZKLA 4IRHA 5BQTA 4EJOA 1U78A 2K7LA 2M5WA 1FZPB 3PQKA 4YIIA 5HVQC 5DYMA 1Z6TA 4A0YA 2O6GE 1YS7A 3NRVA 4N0BA 4M73A 1IXSB 3FMRA 3JSPA 2R7DA 3VFZA 5DD4A 5JFRA 5HLGA 3AAFA 3VEPA 3KGLA 2R3SA 1YUDA 2D2WA 3NL1A 1HXDA 3HRTA 5HS9A 4UVAA 1R7JA 2XKPA 2XLAA 4N9IA 5LLQA 3BPZA 3F8CA 2MH9A 3OF1A 5JCTA 2CWEA 3ES4A 4E2GA 2XVCA 3DPLC 5LEKA 2EB7A 3F8NA 1U5TC 2O1QA 5DD8A 3IRQA 1OFNA 4U88A 2XLFA 1EV7A 4ESJA 4LG0A 4HMZA 3T0YA 2RKHA 2XROA 4QX5A 2MNGA 2CYYA 4UV9A 1K78B 4PDKA 3WTTC 1L3JA 3HSRA 1WLTA 3HSEA 4HDUA 2DTRA 5K5RA 1FI2A 2RGVA 3F8FA 4HF2A 3FHIB 2P5KA 4HV6A 5D5XB 1BOAA 4MHGA 1ZRFA 5D8KB 2VN2A 3HRUA 2P4WA 1NXMA 3ZQ7A 2IXLA 3IDBB 2G7HA 2PFWA 3F6VA 3COAC 5A2QK 2A5YB 2QM3A 2P8TA 3JTGA 4KDPA 5LRRA 1BIBA 1Z7UA 1EY2A 5K5OA 3HT2A 5E20A 2YX4A 5J8CA 1HQCA 5E8IA 3H1YA 2H94A 2ZJ2A 3KZYA 1SFNA 2ELHA 1KU7A 4UXNA 1TQMA 5ICFA 4EWAA 2L3DA 3FX3A 4HLYA 4NB5A 2XIGA 5KK1A 2AS5F 2HZTA 2D5HA 3KGZA 3DQVC 4O6JA 4UBHA 1VR3A 2PTMA 3RKYA 3ELNA 1DGWA 2QENA 1XB4A 3MAJA 5I0UA 2GC0A 3F72A 4IHSA 1MGTA 1T98A 3MEXA 1SMYF 2DU9A 1ZLKA 3BDDA 3ULQB 1UCXA 2KXLA 5CVVA 1S3JA 3JTHA 5IT3A 3WU1B 4Q29A 2KIMA 4A2UA 3BZ6A 5E1WA 3W6KB 1RI7A 4ORFA 1MZBA 3ZMVA 4AQ6A 3S7IA 2IXHA 4EJUA 5EEHA 4P9UA 5JSRA 3QP5A 1YIOA 3CLPA 2UYAA 3TQNA 5JHUA 3SQNA 4BHCA 2K0GA 1D8JA 3UKVA 3RPQA 4LUKA 3HHHA 4YFKF 1P92A 1UCRA 2L4AA 1Y0UA 2XL7A 1YFHA 1BIAA 4CXFA 5JR3A 3TDZC 3LOIA 4CZZA 1QBJA 5FLXK 2Z33A 2FOKA 4M9ZA 1XGNA 3Q9SA 2OZ6A 3V7RA 1TLHB 2Q2EA 4HDVA 1V3FA 1Z6RA 2ZNYA 3HOSA 1GHCA 1XGMA 5BPIA 1OD5A 1IN8A 4LEJA 3WG9A 3WE3A 3ACLA 3FM3A 3KP3A 2P7CB 2Z9OA 4IESA 2HGCA 1ZZ6A 2PMUA 3PFIA 1Q3EA 4E70A 3USSA 1U5TB 1BM9A 1LEBA 1EH8A 2H6BA 3KEOA 3V7SA 4KMFA 4MGYE 2NS0A 4ENNA 1CAWA 4R79A 1QZYA 2EA4A 4RS8A 4WX9A 4MEYF 3ZMUA 2HYGD 3SMHA 3F6OA 2FA5A 3TNQA 2HTJA 1YS6A 2DQRA 3WE2A 4H0EA 1FPQA 4LK0F 1W7PB 3HOTA 2CQKA 4U0VA 4ENMA 3B02A 2QDRA 4RGUA 1PP7U 4G6QA 3I58A 3OD0A 4RAYA 3GO5A 2E9QA 1EYBA 2STWA 1RGSA 2CG4A 4CO8A 2HQNA 4CHUA 1YFUA 2FNAA 1MJAA 2WC2A 2ESHA 3GUDA 2CAUA 1DPRA 3WW4A 1BI2A 4MX3A 5CVRA 2VXZA 3E6DA 1PM7A 2XAGA 2A6EF 1VJ2A 4OMZA 6PAXA 2OA4A 3DXJF 1NE4A 1ON2A 4KT5C 2M8EA 5I8TA 5FO5A 4FHTA 3BPXA 2N7GA 5AIPA 4EWEA 5D5VB 2HKOA 2QBYB 2D5FA 1QY4A 1WKMA 4IRIA 2V09A 2P6TA 1AOYA 1B9MA 2Q4SA 1UHWA 1MJBA 5D5UB 1DDNA 4MGZE 2IXJA 3SCHA 4O9EA 3IDCB 1FYLA 3UKTA 2PAMA 3F8BA 4HX8A 3V4GA 5AONA 1CAUB 3KMHA 1I5ZA 4D0PA 4EJVA 4IEZA 5IT9Z 5K8SA 4ZYGA 4OU0A 1YO5C 2OZJA 2QWWA 4A6DA 3LA7A 1H0MA 2HWVA 2PHLA 1KQ9A 5BMZA 4HBLA 4RB2C 4MNUA 2VT2A 2ZXJA 3GFJA 4MGRA 3JAMK 1EP0A 5HDGA 3I59B 1SD7A 2O8XA 2M30A 2ISZA 4F8AA 5KVRA 3I71A 4AVAA 4L0ZB 1HW2A 2BGCA 3FHZA 1DPUA 1SFEA 3BP8A 5TJJA 2A61A 4HN1A 2ACJA 3FXUA 1FC3A 1NYWA 4CGZA 1CX4A 5BY5A 5D5WB 3L2CA 4OIOF 1FSEA 1ULYA 1X3UA 2ET7A 4LUMA 4EVIA 4LB6B 4HZFA 3IWFA 4UNOA 3QPHA 4XLPF 4Y17A 1IN6A 3H8UA 1O5LA 4LTAA 3GFMA 5AVPA 3H3UA 3H3ZA 3ML6A 1IPKA 3EDPA 4QM9A 5J7MA 4NQWA 2GH2A 1ZREA 4AQ2A 3LAGA 1QNTA 2ISYA 3ELKA 2PA7A 3H50A 3KFWX 3U2RA 3TOBA 4MUVA 3R0JA 4KICA 5L3BA 3HRMA 5BPDA 1TQPA 3K9TA 3WTWC 1UIKA 2YR2A 1ZYRF 2VOOA 1ZN2A 3ZPLA 4EV0A 5BXXA 2QQAA 3FWEA 4XSZF 1IXCA 3IHUA 1X8EA 4MZUA 3ECHA 3FMSA 5DCMB 4XFCA 5DCMA 1J2XA 2XHKA 5J8FA 3VODA 1S7OA 1HW5A 5FPZA 4AVPA 1ZGAA 3HSFA 3CJXA 4L9TA 4NVPA 3QPTA 2IW5A 3MWMA 1LR5A 4MGKE 1I27A 2STTA 1R1VA 4UVBA 1OR7A 4IRGA 3GBFA 4BH9A 3WTZA 2OPKA 5FGMA 3L7WA 4KFCA 2DK5A 2L02A 1S8NA 4ENKA 1XN7A 5L3EA 3Q9VA 3HUGA 4I98B 4LA3A 1A04A 2GQQA 2LSOA 5ICEA 3I59A 4AD9A 4HX4A 3EHKA 3BWGA 4YFNF 3BU7A 4JV4A 1X82A 3H92A 2ZKZA 4MH0E 2L54A 2PBIA 5ILUA 4EQQA 2FMYA 1LJ9A 4YARA 4U7BA 4Q4ZF 3ISPA 1XSXA 5FFZA 3TO9A 1WGPA 1ZRRA 2XUBA 2P5VA 3R60A 5LRSA 3KZZA 1ON1A 2V9VA 1SMTA 5L3DA 1XE8A 2FSWA 2YSRA 4XF3A 4QGLA 2IVMA 4Q0SA 3B73A 4TLFA 1F4KA
chains in the Genus database with same CATH superfamily
1TEIA 4Z92B 4ZU7A 2R30A 3LPGA 3JRGA 1MEC1 1WA6X 4IQ4A 2QTWB 3M8JA 3J81Z 2R7QA 2IXKA 4RL7A 2QQ9A 2RQPA 1EV13 4N43B 3O0XA 3SHRA 1W04A 5E17F 1GOGA 1YITI 1REEA 1TWAJ 3LNQA 2CNAA 3CL1A 3SCFA 2Y31A 1SLCA 4Q4W3 5JAXA 4FQGA 2PLV3 5L7OA 1SLBA 5FZBA 1SG3A 5FLHA 1IGNA 2EIKH 3LWCA 1Z7S3 1JI6A 4AIDA 1QKQA 1MVQA 1Z3XA 1IW7F 4RMNA 1RUH3 1ZYBA 2XBO1 1YYNA 3RCOA 1YNAA 3WP6A 1CX1A 2EFPA 4AE2A 2JPBA 4QXKA 2W46A 2V5DA 4XE9A 1LKXA 3GMEA 5JIUA 5KC6A 3GZEA 3ZKUA 1AR83 2RDQA 2UXNA 3EYYA 2VQUA 2RJKA 4P9IA 4HSJA 3DPUA 1RUJ1 3D4KA 5CBLA 1VZ0A 1YHFA 4YVSC 2BVMA 3OGSA 5B5EC 4Q4V3 1TNTA 2W2IA 5E1RA 2DOEA 3VD9A 2HQAA 2JSPA 1DUXC 3V0BA 4I7HA 2NVTJ 4ZYHA 2OJED 1ND2B 1V6OA 5C8CA 5A7PA 2HOEA 1A6CA 1LHVA 2RREA 4HSTA 2CDOA 2LROA 2F6CA 2DU1A 1DU6A 1AKHA 1IF1A 2VZSA 5K5QA 2C6YA 3IP4B 1BI3A 4D7TA 3KLSA 4DYRA 2WNVC 4R52A 3A01B 4U0WA 2DT7B 1JUPA 2NVUB 5F6FA 4ATEA 4MV2A 5LGUA 3KHBA 2GMEA 5FYCA 5DUUA 2ZEXA 1O8SA 1S2BA 5IK4A 2ZXQA 2JIJA 4DUVA 3D82A 1UG2A 2WAFA 3ZXLA 3BYWA 1X19A 2LNBA 4JGYC 4YSFA 4XFGA 1BR4A 2BXZA 3ZQGA 2MA3A 3OS1A 2EIMH 4ZYDA 1APNA 2KQRA 3L00A 2HDWA 1FBSA 4QHOA 2UYBA 3AYDA 2MC3A 1S72I 4KYWA 3G4SI 3AZVA 4EJTA 3V7CA 1FV3A 2JWPA 1K78A 3FMQA 2GNMA 1WJFA 3KZ4C 4UV8A 2L0KA 3CC4I 3BOPA 3AG3H 3QAHA 4GKXA 1QJZA 2VW1A 2ECCA 2KRHA 4DNYA 3MUY1 2VZOA 5J3UA 2HOTA 5BNOB 1RHI2 2ENRA 2VQHA 4IE5A 2IS1A 1J3QA 3GTLJ 3D0JA 3NNLA 1BC8C 4M3FA 4XUPA 5CFDB 4G3YC 5LWBA 3BTLA 1NH3A 4XJ9A 3R4SA 3HOBA 3ZSMA 2FMLA 3W5MA 3W59A 2UXXA 5FO9B 3IKVA 1GWMA 3SITA 1JU3A 4S04A 1UFMA 1QQP3 3AFGA 3OYMA 3GJAA 4WXHA 3POEA 5JXHA 3A4UA 3ZXGA 4U87A 3NW4A 2RS31 1R5HA 5HLIA 1CPNA 4N7IA 1Z78A 3U0ZA 3MW2A 4KWUA 1VAMA 5BNPA 1GLHA 2E7QA 1WWXA 1POGA 3VZMA 1UB9A 1QO0D 3N4MA 3JREA 2R063 2ZZJA 5KNLA 2JEMA 1TMF3 2VBBA 3WGHA 2BRTA 2VZVA 3HT1A 1BXHA 2VJXA 3ZDSA 2E19A 1VBC1 2A6WA 1HX6A 4BIFA 2OS2A 3J8F3 3THTA 1JU4A 4NR1A 4WZFA 2JUCA 5JXJA 4M72A 1OFCX 4NHJA 5FZOB 1QH7A 4NIHA 2IXCA 2PAEA 3E5QA 2FCTA 4F3JA 3ERED 1LOAA 1PO12 1H8AC 2HKXA 1OCCH 2X6OA 1T56A 2E1NA 3PVNA 2HWF1 3K2OA 4XR6A 1J1LA 2IBDA 5GLTA 4B09A 2WAOA 1AL21 3MO4A 3UKGA 2WN2A 5TGTA 4WM8A 3BVCA 5F0HA 2VMIA 3OOUA 1U5XA 1WVRA 1WCUA 4LQRA 5KHHA 2YPRA 4P00B 3WEZA 4C30A 4LBOA 4ZXKA 1UW8A 5FQ0B 3BN6A 3GTJJ 1STMA 3N05A 1LOBA 3ABLH 5A6ZA 1AL22 2FBKA 1M06G 2CGOA 3KWVA 3FF5A 3NWTA 5T52A 5FRMA 2OA2A 2DVGA 5LA0A 2L7ZA 4X0GA 2BNMA 1BLZA 4A3FJ 3M7AA 5DAWA 1Z0XA 3HN1A 4IL7A 5JPNB 4HA8A 1RUG3 3M3EA 2JA2A 3T1MA 2HWB1 3TEWA 4CYDA 1ULFA 4HVOA 4AFAA 1USSA 5GLVA 1ULDA 4NPMA 1HDDC 5CB7A 3K4BA 4XNFA 2DU0A 3W2AA 4R1HA 1HC8A 2VG9A 4IEOA 2CV1A 3S16J 1XDSA 4IEUA 3CJTB 1RJ7A 1CF7A 2VMHA 1JT6A 2BOJA 1V6NA 3PHMA 5D8AA 3IH3A 1XNDA 1ZRIA 4J6GA 5F8PA 4RGSA 4RM3A 2W95A 4PLMA 4OOIA 1PK6B 4BS9A 2BPA2 5HLTA 2ES3A 4AEDA 3OBAA 2JB4A 1W0UA 2NS8A 2L4MA 4LBNA 3VDAA 4K8FA 2E1OA 3PUSA 4HW0A 4BM8A 2Y75A 3CBNA 3VD7A 2Y30A 3RJPA 2VL4A 2EXHA 1FJLA 2OYZA 3W2VA 1AR82 5FWJA 1K7AA 3DUIA 5C9AC 4UVCA 5E1XA 4I02A 4A12A 5H6RA 5KBFA 1VQMI 5CKNA 5IP6A 3ZIXA 2EFNA 1QHGA 3INAA 3K0LA 1AR91 1DCSA 1O59A 4K2EA 2PYTA 4DXSA 2I10A 2ZJQF 3HQRA 2B8MA 4URTA 4ES8A 1IS6A 2VBWA 1XJAA 1XNCA 2I5UA 2A3SA 5BV6A 3FHNA 5EHDA 4YVSB 2UUZA 3AJZA 3WG1A 2PHTA 3LAJA 4LO5B 3LZZA 5IP7J 4BQ2A 2R043 3GBWA 3OL3A 3PVEA 1YFYA 4AVBA 3IM0A 1HOMA 2RS51 1TQ5A 1KA8A 2ORZA 2GP3A 2NMNA 4JTOA 3O6BB 1ENSA 2QQJA 4WXCA 2VCCA 3LSJA 2ZJCA 4WVZA 3VL8A 2D5VA 2VOXA 3POWA 4XCAA 4XIKA 1US3A 4KG0A 5FYIA 2X4HA 4OZOA 3WHBA 4Y20A 2B42B 3M8LA 3K3OA 1VALA 2C5DA 2WA4A 1EKEA 3MKWB 2LD5A 1FMVA 1J3PA 3BTAA 4COUA 2K4BA 2G19A 1PK6A 2RQQA 2GC3A 5FZLA 4RHV2 2BBYA 3R4KA 1T2XA 2YXSA 4GD4A 3RQ0A 3D5RC 3WGGA 5I0SA 2XB5A 5BOXA 1OH3A 5GZFA 3CCRI 2FMDA 1PK6C 4L5IA 4UB8C 5GLUA 3CCSI 1TME2 4YZ2A 3E97A 4GH4B 5D8LB 3C7HA 3N9MA 1BN5A 2TCTA 4BDZA 5F04A 2YG0A 5JOZA 4IV3A 1ULGA 1AYM3 4JHTA 2E7XA 4AAPA 3CMYA 2W57A 3VD5A 1XPWA 2VOWA 1HB1A 2R6QA 3HOUJ 2HJIA 5GZCA 3T1LA 2E2JJ 4KN4X 1RVF1 2BW8A 2Q8CA 2ZAAA 3ES1A 3T8RA 2WN3A 1SDDB 1PX3A 1WMEA 4XMIA 5CEHA 3GVAA 4QPGC 4X8PA 4LBJA 1NQJA 4G9SB 1ZELA 1HRI1 1L7RA 4BE3A 2WFF3 1WFXA 3IDEA 2ZFUA 3PL8A 4TV7A 2YBSA 4XLAA 1QGLA 1V54H 2VOTA 2GNTA 3MFKA 1UAIA 4IGQA 4B8XA 4E7JA 4XFAA 3TRSB 4XFFA 1RIOH 4G7OF 1YW9A 1XSQA 2GAUA 5EYRA 3BTYA 2JA5J 4CU7A 1WCDJ 2XAFA 4L18B 1LFPA 1D2QA 2R49A 5A3MA 1XDUA 1PVC1 4JX5A 1W0OA 3P1IA 2ZOEB 3VL9A 1JTZX 3UYJA 2BV4A 1K3IA 2ZGLA 4OI0A 5ERIA 5FPUA 3CUQB 3ZQHA 4Q5SF 1G9BA 3NNJA 2Y2ZA 5JVTA 4KG8A 1WD3A 3SEZA 2XV4S 4ITVA 1FYUA 1MD0A 1GYKA 2YB7A 1W36C 1QQP2 5H9SA 2NNNA 2LVSA 4DW6A 5JVVA 2WNVA 5F5CA 4YM1A 3CCYA 3VZNA 2CJJA 1W8WA 2H0VA 1ZBA1 2Y6GA 4WWCA 4GYGA 1B35C 4A3JJ 4PI0A 4A69C 4HQEA 4FOQA 3RYKA 1UX6A 4IETA 2LFBA 1FTTA 1QJX3 1ODDA 2VBPA 3USUB 4X6QB 1S2KA 2ZGTA 2ZCWA 3ZFGC 2KKOA 3H9QA 2IGKA 3O0WA 4TSVA 5DDGA 2EXKA 5APAA 5HDKA 3J7HA 2B9VA 2QQPA 2E5NA 1UU4A 4ARYA 2CAVA 2EA2A 1SEFA 2DCKA 4BK5A 1OCTC 4QX7A 1ZTRA 3P7NA 1EUUA 3EETA 4BU2A 3I54A 1T8IA 1QU0A 5DEQA 1XPXA 4KA4A 2DVDA 1NA1A 1XD7A 1KS5A 4L97A 4RB0A 1B35A 4RSUA 1QMJA 1GP5A 3M7GA 1PNFA 5LBQA 2FZ2A 4AXOA 2HBTA 2WV1A 5A3WA 2RMU1 2FDHA 5IVFA 4BUPA 2RN7A 1LEAA 2HDCA 4HFSA 1H1AA 5JZGA 4JRAA 2TUNA 4Y7NJ 5GKAC 3OYKA 2FCVA 3ZYRA 1JYXA 5GADJ 4EN9B 4MEXF 4DUWA 5EP9A 4MQVA 1YTYA 1N1SA 1FLIA 4QKDA 3BG5A 1XCBA 3JD73 1TL8A 1LAJA 3IAM2 3C7EA 5IVBA 1YIJI 2WWJA 3K1MA 5DAPA 4NROA 2COMA 4N90A 4JGZC 1JYTA 1WCSA 1W9SA 2JG9C 3O8GA 1H9GA 3TP3A 1X7NA 3BR6A 2WS93 5FLJA 3HZJA 5FPBA 3AMPA 1UAAA 2XAQA 2IT0A 1S7AA 4X1EA 2LS6A 3QYEA 1DFQA 4Z2YA 3GXOA 5IAVA 1YLLA 5CIRA 1DP7P 4AEDB 2XBO3 1R36A 1Z3YA 3ILNA 4DYQA 1QQP1 1X4OA 2YROA 3L1PA 1E3OC 4CA0A 4GB33 2EWNA 3FM5A 1Q8PA 3BJ6A 1UF2C 4NIIA 3S1NJ 3JZVA 2BUKA 3H3LA 1V6LA 4Y1XA 2ZS6B 4CDUC 5FDBA 1R23A 3SH5A 4YM3A 4N53B 4OCTA 5CLSA 4AHWA 2LBFA 2CV6A 3POYA 1KJRA 4AW7A 2SBAA 2WB1A 4OINF 1U5TA 3VDCA 2OVUA 1P7JA 1L7QA 4G6TB 3PUIA 4GA9A 3IAQA 5C3QA 2CW7A 4Z1VA 3APBA 4CYCB 3BROA 3KV9A 3CUQA 2WAEA 5DM7F 5CISA 2G7UA 5F9TA 3RS6A 1MH3A 3PLQA 1K4TA 4Q47A 2X09A 1V5FA 3RYPA 2ZXIA 4JGYA 4ESBA 2WAQN 5CPRB 2XJPA 4QX0A 1GNHA 4AI3A 5E18F 2MBFA 3ACHA 2A73B 4OUEA 4EM1A 4MHUA 1COV1 3BIEA 3S2WA 4AGRA 3O8HA 4PK4A 2CFXA 1F5JA 1GSLA 5A7QA 2W52A 3NQHA 1CZVA 1LOFC 5FLIA 3O14A 3W9AA 1PUFA 5EJCA 1AR62 3JRFA 5A32A 4AI1A 3AMMA 3F21A 4JGYB 1SFXA 1QU3A 4Y52J 1VFCA 1DQ6A 3G1LA 1PYVA 1IQDC 4B3AA 4AZZA 1KU9A 2DYRH 3CCVI 3GF6A 5L36A 4K6BA 1Y7BA 4XQFA 4ZY9A 2ICWG 3TEDA 5HDNA 4EM2A 3AYCA 3D5LA 3P9KA 5A3PA 2FE3A 2WABA 2ELKA 3K4LA 3DKXA 2F6BA 4BK4A 1UPSA 1LHUA 1LU2A 2AENA 4BCUA 5EGOB 4OIRF 1O4XA 1H88C 2VKDA 4HL0A 2WWSA 1J0RA 4LOSA 4OI2A 2KIFA 1XRUA 2TBVA 2QFEA 3ZMNA 1GV5A 3JRDA 3CO7C 2HNHA 1DU0A 1SQ4A 1VAVA 1NY72 1Y8RB 1YX3A 4BE1A 2HWC2 1FX7A 1CAWB 2K86A 2JRTA 4IV1A 2XHNA 1BBYA 2XGEA 2EILH 3FFZA 4A6EA 1O6UA 4QPWA 1S4CA 4S2DA 2M45A 2WQ8A 1VB2A 4XQ4A 2YZ4A 1Z05A 2BYVE 4FO9A 1C5IA 2V1NA 4UFKA 1VLNA 1OA2A 1GQGA 3H1CA 3MN2A 4CUAA 3DEMA 2CW8A 4II3A 3DKYA 2R5YA 2WO1A 5F3GA 5C3EJ 2QVOA 1PIV3 4NHLA 3NAUA 3GWZA 1G9FA 2X6XA 3THPA 1P4XA 2R7FA 4YGEA 5J1XA 5FLVA 3HAGA 5ACA1 2BWCA 1QWRA 3HWJA 3OOPA 4JP0A 3B5LB 5I91A 1RUE1 1UZZA 4JVAA 5CKQA 1JXNA 1DGLA 5CG8A 3PQJA 1RMU1 3JQXA 4XJUA 3T3YA 2XUMA 3GF2A 3E3VA 3S32A 3P3PA 1S0GA 3W58A 3ZN0A 1JKPC 5LBCA 1Q1VA 1VQPI 4RHV1 1MDMA 3BR5A 1KGSA 2HWE1 4E4SA 3R0AA 1NCRB 1NCQC 2GXBA 4IEPA 1OMIA 1W2NA 1SCRA 4LBQB 4XJWA 1RR8C 3LQRA 3H0GJ 3CJIB 3JXSA 2WLQA 3C18A 3D1NI 2ZNZA 3LSIA 3L2QA 1R49A 4P9WA 4PSWA 3U4XA 1YG2A 2NZ9A 4GO1A 2X9DA 3ABTA 2PAKA 3G6EI 1BVP1 3QP6A 4V2GA 1IS3A 4M6YA 1JUHA 4PGGA 4FFGA 2LALA 1VBA3 5J96B 2YPDA 3CUQC 3KZIC 3NJXA 2JX9A 1O5UA 3B01A 1IXRC 1FMD3 1IGOA 2WUHA 2RS13 1V6MA 2D6NA 3WNOA 5J47A 2HQRA 2P6SA 5FYHA 4ASKA 1RUI1 4CDXA 3U1KA 1YRNB 3O7OA 4A7KA 4O65A 4IRHA 3QH6A 1R092 2K7LA 1SVMA 3PQKA 4G12A 5DYMA 1W2TA 2O6GE 2P37A 4M73A 3JSPA 2R7DA 4RFRB 3VEPA 1SLIA 2VULA 3KGLA 4XXPA 2R3SA 2AREA 2D2WA 4FPYA 3IV5A 5HS9A 4Z2WA 4N9IA 5LLQA 3K10A 3GTGJ 2Y33A 4UUTA 1NT0A 4E2GA 3DPLC 4MO7A 5IOZA 5LEKA 3AKZA 2NLRA 5DD8A 2DCYA 1X58A 2ZGPA 4XJZA 4U88A 1PZ9A 4LMFA 1A34A 5J36A 1A35A 2YY1A 4CEYB 1X1BA 1U5ZA 4UV9A 5E89A 1KGYA 4FOVA 5JMOA 5JXIA 2RM22 3J8F1 5FY1A 2EINH 2P3JA 3HSEA 3EUKL 3ATGA 5K5RA 5T54A 2RDNA 3RJ2X 2IVJA 2X29A 3ORJA 4QHBA 3CJIA 4Q8KA 1HRI3 4I30A 5D5XB 1W0NA 3PURA 4XW3A 3WF2A 4MHGA 2EIDA 5ERLA 2VN2A 2PMWB 3BTJA 4A4AA 3TWIA 2A5YB 4XZPA 5A3OA 1HKDA 3MF9A 2W92A 4HPKA 4C2UA 1MVEA 3B69A 1QH6A 4BBSJ 5J8CA 3MZ8A 1W28A 3L2RA 2JE9A 3PSIA 2HWF2 5BNNC 3FX3A 2BFUL 4HG2A 1PNGA 2AS5F 1C8M1 1DYOA 3KGZA 1VR3A 2BJSA 5JI9A 1Y56A 1HQNA 4A3IJ 2DA1A 3LPFA 3TP0A 2KXLA 2JDYA 2HYKA 2G9GA 3WU1B 1U5IA 4Q29A 4XTMA 4BXSV 3CCUI 2KIMA 1SLLA 1CJDA 2PQSA 3BZ6A 4XMYA 4BQWA 5E1WA 5C7GA 1RI7A 2Z4FA 1MZBA 4JGZB 1VQ6I 2VCMA 5JSRA 3QP5A 5JWPA 2O5RA 3LEIA 2C9AA 3SQNA 2F5VA 4XIDA 3EXUA 3VBHA 4QXHA 3HHHA 1Z77A 4YFKF 2W48A 4I3GA 2TRTA 2L4AA 4D7NA 2KDZA 3X2QH 2HVRA 3K7AJ 4C0HA 1G8WA 4CXFA 3S93A 2DT6A 4QX8A 1QOTA 4CZZA 5EXOA 3MKLA 3WV6A 2MD0A 2MEV1 1N3OA 1H0BA 1UOBA 4NRPA 4HDVA 1V3FA 4SLIA 1VBB3 3R4DB 3B9IA 3E0JB 1IN8A 3GTPJ 4LEJA 3PL0A 2WYSA 4AVSA 1JODA 3WHUA 3I3EA 2Q8OA 3ACLA 1OCZH 2RG4A 3GGLA 4LITA 5FKBA 4E70A 1YIFA 2VUJA 1U5TB 2OC6A 4NOTA 1LEBA 2H6BA 4QX3A 3KEOA 3V7SA 2L9VA 4KMFA 1IRXA 2ZGOA 3EUHC 1S7EA 3IAS2 3I3DA 3ZMUA 5FZFA 2HYGD 1B72B 3SMHA 2W4SA 5C71A 2Y64A 5K4LA 1UL9A 5IW0A 1R9TJ 4LK0F 2KMUA 3G2BA 2CQKA 1S0JA 3E7LA 2CTVA 3H5AA 3WXPA 5LA2A 4CPBA 1PP7U 3RFRA 4A6SA 4RAYA 2L9NA 3NWSA 2E9QA 4QXBA 3I97A 1RGSA 5DG1A 1E3PA 2CG4A 1LPQA 1DGWY 3BTIA 4CHUA 1DPRA 3WW4A 1BI2A 5CVRA 3K70D 4Y26A 2RV9A 1VJ2A 3BG9A 2PJRA 1NE4A 4A45A 2M8EA 2VCBA 1UYPA 2JECA 1LOEA 1WMFA 1D4VB 5FMCA 5AIPA 5GP9A 2JMWA 3MVPA 1QY4A 3BR1A 4IRIA 1DQ2A 2O0OA 2P6TA 3GCXA 1B9MA 2J1VA 1MJBA 3U78A 4XBQA 2R16A 4MGZE 2IXJA 3CQOA 3N7MA 2QE3A 4HX8A 1CAUB 3KMHA 3VBFC 2RDRA 1IG0A 2V7FA 2R0HA 2OZJA 4PFOA 1H0MA 3PDQA 1FPN1 5FAXA 2VT2A 4KGGA 2HBUA 1XYPA 1I3QJ 4E8DA 5DTDA 1PO11 1NQDA 3WHTA 2M7AA 3I71A 5HCBA 3POBA 3KPHA 4TWTA 1DPUA 2PXJA 1DGRM 4AGVA 5M5WJ 3FXUA 1AYM2 4K1ZA 1SFKA 5H2FC 4PHZA 4YGBA 4OIOF 3WCSA 1FSEA 5F5QA 1Y39A 2HWB2 1W6QB 4EVIA 1W06A 4Y17A 4QQLA 5FZKA 3IN9A 3H8UA 1O5LA 5HV4A 4XLHA 5JXGA 4CP9B 5B66C 5J7MA 2ME6A 5ANNA 5BNPB 4UT5A 4JX4A 1QNTA 3H50A 3KFWX 3HPHA 4R9BA 4NC6A 1SC7A 1AXZA 2VPLA 5BPDA 1IPSA 1MBEA 1UIKA 2R7ZJ 5B3SH 4C3JJ 4L8QA 3ZPLA 4AI9A 3UK9A 2QQAA 1LJ7A 4JOMA 5EIYB 3ECHA 3FMSA 5DCMB 3LSHA 2IFWA 2FOWA 3T4VA 4PSXA 2R5ZB 1S7OA 1HW5A 4AVPA 1ZGAA 4ZZ8A 2ZGKA 3DBRB 4K9SA 2DUOA 2IW5A 5J3LA 1YRNA 3MWMA 4UVBA 1TE1B 1OR7A 1SAUA 2HEWF 3WP3A 4KFCA 2VI6A 4RR3A 5FLMJ 4GJYA 1FOYA 3KB5A 3LOCA 4DEVA 2AO9A 3VBRB 3HUGA 4D94A 4W4ZA 1A04A 2LSOA 1ITYA 3ASIA 4C1WA 4PLOA 3BWGA 3BU7A 4XAEA 3WF0A 2BWAA 1X82A 2P5BA 4HNUA 1FPN3 5CFCB 5KWRA 2DA4A 1LOCA 4AVZA 4L0PA 2OUHA 4EQQA 2EBIA 4Q4ZF 5E3LA 1XSXA 1WGPA 1W9YA 4B1RA 1E5RA 1HV0A 1GICA 3OMYA 2DF7A 4CEYA 1AR73 2SLIA 1W0PA 3KZZA 3KYDB 5LW9A 5C4JJ 2YSRA 3OIQA 1HIXA 5E79C 2XH6A 2VNVA 4QGLA 2IVMA 3B73A 1F4KA 3I55I 4P9GA 3KEQA 5H6QA 1ZBA2 2VIXA 1YFXA 4D5FA 1CVNA 3WNMA 1ZA4A 4QDRA 4WM7C 3OGVA 4XF1A 5C4WB 4JKLA 5I0TA 5B4XA 4TN7A 2Y6LA 2PMHA 2QNKA 4XETA 1AWCA 2WQ4A 1B09A 3HEFA 4Y13A 1BK1A 1UNBA 2FEZA 2X5IC 1RUC3 1MS5A 3TEYA 1UOGA 4MGSA 5B1AH 4AR2A 5EJ1B 5FY7A 3M3OA 1AF9A 3VKMA 4DUXA 4FTEA 1SBFA 4PJNA 3CZUA 1DZRA 5FZ3A 2X1DA 2KISA 2OPWA 3F3XA 3M1EA 5LGTA 1G86A 1QNWA 2XF6A 3C2HA 2IGOA 3OYHA 3BC8A 2DJIA 5G04L 3G1MA 4PJ0C 1Q8SA 4B1MA 5C6CA 1MS3A 3T2OA 1W1WE 4UUVA 2ADUA 2Q8DA 5CYYA 1HN0A 5FXZA 1LKNA 5EZHA 2R7EB 2BOIA 3O1UA 3IH4A 1TG7A 5FYBA 1AX0A 4CDGA 4UB6C 4XTPA 2DFIA 2W00A 1IPJA 4PDWB 4AOCA 3RZJA 5K1YA 2L7FP 1DQUA 3CJRB 2RM21 2J42A 1GU3A 4IE4A 3L2VA 1IN4A 3HMYA 5DAVA 3K46A 2CQXA 4LULA 4N43A 3NARA 5F1JA 3LSEA 3HBZA 3K70C 4P9XA 2OZUA 4MVTA 3GZ5A 2D3RA 1NCQB 3FXJA 1K83J 1B72A 3PNYA 4PF5A 4XEZA 3WNLA 2CL2A 2PQQA 1K12A 2X48A 4XKVA 3H8XA 3ZXKA 2OTLI 4LGWA 3WQ0A 5E6HA 5FZMA 3SZPA 4B47A 3U4SA 1LNWA 4XOPA 1YQAA 3UJOA 3IH2A 3IIIA 3GTOJ 3QYBA 2XDVA 3KQRA 2EJRA 4M74A 2DCJA 4IJAA 4LJZF 3E6CC 5TSWA 1BEV3 4L9VA 4P96A 3CC7I 2CQ7A 2JG9B 2QUOA 2WWUA 1I3AA 1KZHA 1U5YA 1W5TA 1E0EA 5FYTA 2VODA 1T0FA 1CIYA 1HF0A 4EQVA 1BC7C 2NM1A 5T5PA 5H20A 3HTSB 1GFF2 2H8RA 3BGAA 1ACIA 2KR2A 4UFHA 1C8M3 2R5ZA 2PG4A 3PNVA 4EN6B 3OYLA 4XMAA 3BZCA 2K46A 2ZMLA 3E5XA 2VXDA 4ZU4A 2Y48A 2P7VB 3K2ZA 1IN7A 3ASNH 2NS7A 2C26A 3ZR8X 2JDPA 3JRBA 3UGHA 4AEJA 1X1CA 3OYFA 2ME0A 1CAUA 4P9YA 2H09A 4YG3A 4YW5A 1WUVA 1RUF1 3S3NA 3ZN6A 5LHGA 4GH4C 2H8WA 3VSLA 1ZG1A 4LIVA 4KQ7A 1Y3TA 3SEQA 4IXAA 5CG9A 2VMDA 4DBRA 5CJ9A 4LE3A 4IEWA 2EF6A 2XJRA 3N9OA 4I0WB 2Z1DA 3OYDA 3HOZJ 2D98A 3VDBA 2LRDA 4XFIA 2IUWA 2HWC1 5BYNA 1UMIA 1XMAA 2A6YA 4FPFA 2VUDA 1V00A 2X05A 1YX5A 1N47A 1RUG1 1V70A 4ZU5A 1U0AA 1W6QA 3WT3A 1SFPA 1QHHD 4GCVA 3DEEA 4PCQA 2DPUA 4QPGA 1VMHA 5FZ1A 5D21A 1MMDA 2WAQA 3T4HB 4K7JA 1R5GA 2CU5A 2JG9A 1B59A 1MS1A 2YUEA 4YFWA 2XUEA 4QPIC 5E3OA 3OPTA 2NAZA 2RV8A 2D1HA 3SHFA 4PLNA 5JDBA 1MQTA 2V1UA 4QX2A 1HXS2 2WRAA 3HDDA 3SKJE 3SYTA 3AZZA 5FRAA 1AX1A 2NOJB 4OWRB 2QBXA 3ZXEA 2RS11 2HLEA 4I99C 2HVQA 2X6YA 2ETEA 1OCRH 1X50A 2V72A 1MJ9A 3J7LA 3OPZA 4BJTA 3IMNA 2WNUA 4UW6A 3LE0A 5E88A 1FBQA 2H27A 1WMXA 3DTKA 1K61A 4PJJA 4IEQA 3U14A 4EGYA 2WS91 1BW6A 2GXGA 2ZX3A 2C9KA 2YC0A 2ZMKA 2E2IJ 4ZYEA 4NC7A 1QJY1 3NWKA 2BEOA 1X3WB 2Z3YA 4J01A 5FQ0A 4DINB 2W0XA 3CCEI 4IF4A 4XKCA 2RDPA 4I09A 5LY1A 2WV0A 3BALA 3MFCA 3W3CA 4AFBA 1UZCA 4KN7X 1W8ZA 2RS52 1UHMA 3ONQA 5JIAA 3RG0A 4GALA 5D6EA 3TYJA 1HSTA 1QQIA 4C90A 5K7FA 2X8KA 2MLGA 4QSHA 2RHPA 1ALYA 3EQEA 3CKHA 4HOBA 3ZSJA 2VXJA 1UMZA 3AZXA 3EUHA 1P4WA 4MOAA 3B00A 4MYEA 3JU9A 1WJ5A 1KDMA 5CU1A 2WFF2 4C1XA 2P0WA 2FNPA 4HBNA 1NXD1 2VOPA 4JZRA 3WNXA 5LBFA 2VZPA 5E16A 3VZLA 3QQAA 3AZYA 1OISA 2Y0SN 1BK0A 2VQGA 1D7PM 4CH7A 4NJ4A 1OOPC 3Q3SA 1HRV2 4P5HA 3M4OJ 2HDDA 1HXS1 3OYEA 1BW5A 1JBCA 4YGDA 1H2NA 1Y4WA 5HI0A 3VSKA 4U36A 1R71A 1J9IA 2VW0A 3QPSA 3CD6I 1RRJA 3ZRGA 2XWJB 3W6VA 1NOVA 1MZ5A 5BS6A 1BMV2 3MIFA 3HHGA 4XLNF 2D44A 2DURA 1YE9A 2ZX1A 3KCXA 4G94A 4NHMA 1LU1A 1G4DA 1CN1A 4GWNA 2BVBA 3H8RA 1XE7A 1KDKA 4NWWA 5LFAA 4OVEA 3K48A 1ACCA 4YELA 1R00A 1UOFA 4PGHA 5CVIA 2VJIA 2F17A 4Y4YA 3J80K 3NMBA 2M7BA 2XRNA 2VKHA 4PZJA 4PF1A 1OQ1A 1TMF1 1ZNPA 2BHZA 5L3FA 1WCMJ 4UBGA 2Z69A 4XL9A 2R7VA 5FZ0A 5J98B 2NXNB 4WM7A 3NAPA 4FT8A 1WSUA 3CDZB 3I2KA 1COV2 4MO3M 3V8JA 3H0DA 5IFPA 5FWEA 3J7AO 3C3VA 2ZGQA 3VYTB 4ESFA 3K51A 3BQYA 2EZHA 1MZ6A 3I2IA 2HFHA 1XG1A 1UY2A 3I0TA 1B8IA 3IRRA 1DLCA 2X85A 3HPGA 4RA2A 1W8TA 3FZ3A 3V56A 4ON0A 3ZFFA 5KHJA 1HDPA 4PDWA 1Q56A 1QJY2 3CDLA 3VHNA 1SFUA 1ONAA 1HQWA 4CDXB 5F5AA 3GM8A 1JGSA 3SQOA 4V2WA 2KJCA 3ZMZA 4DMIA 2AUYA 3WLUA 5C33A 1YJ9I 1IZ3A 3H9AA 2UZKA 2FDIA 1S6LA 2F5FA 5CKMA 4FCYA 1XX5A 1SLTA 2M8GX 3DCQA 3QOEA 4KJZA 3G3ZA 2ZMEC 4GMP3 5M0TA 3CF6E 5IVEA 3RZKA 2VVEA 2OD5A 5DCFA 1BZWA 3MUZ1 2QQMA 2XQRA 1L7LA 4ZZDA 4GH4A 4N7UA 2P3YA 2DJNA 2CDPA 1MBFA 2JKBA 4HG6B 1WW7A 2LDUA 2R1BA 3LOBA 3SXYA 2JIGA 3Q8AA 3JD72 4WK8F 4NWVA 1QJU3 1J84A 3AYAA 2A6ZA 1VRH2 4U7DA 2VE9A 2GH8A 1C0WA 4LO4B 4FVVA 2PHDA 3M1HA 1UOJA 2NMOA 1NG7A 1J7KA 2D43A 3LDKA 4DZGA 2WB1N 4AEDC 4BNCA 1MSEC 5A33B 1JN2P 4N43C 1WQ2A 2Q0OA 5D8AC 3EMRA 4AYBN 3MKZA 2KFDA 5J1RA 5J40A 3HC7A 4OMYA 5JUVA 3OY8A 1PVXA 1UU5A 2OQ7A 4AIHA 3UETA 3B6AA 1XNBA 1YI2I 2QQWA 4Q27A 3TNPB 4AEKA 5LGNA 2LKXA 1IDYA 2MGQA 4D7SA 1RHI1 3PIOF 4ZDLA 3MPPG 3VZKA 4U2AA 3KT7A 1WLCA 4LHNA 4DY3A 2MHFA 4E2QA 3UGGA 3F0CA 1PMHX 4XN3A 1A3KA 3OL4A 4YM2A 4Q48A 2PLYA 1IV8A 3MFAA 2Y0MA 2HXOA 2ZFWA 1UKGA 4LBQA 3EBRA 3LL7A 1VBC3 1LVAA 2QVSB 2HS5A 2ZKNA 4BQYA 2EZLA 4DNCA 2HPMA 4QGMA 2PQ8A 3SH3A 2W3JA 2LF7A 2GMPA 1X1PA 3VPRA 5LZ6A 5D8AB 2VPRA 1XMKA 1AXKA 4DEQA 4HONA 4BEHA 3U10A 4UFJA 3J7MA 5C3PA 1H8VA 5EFUA 5I0RA 1QPMA 3T5XA 4A3EJ 3GBGA 3KP7A 2LK2A 2CUFA 3FXOA 3JRCA 1XS9A 2AQFA 1DU3D 3QU6A 1CAXA 4B4CA 1P9QC 1X4PA 2IFRA 3PM1A 1HXS3 3U21A 3ST7A 5LEJA 2VT3A 4YFZA 2AQEA 1GV9A 3TN93 1VRBA 4MG2A 3FC0A 3PIGA 3S1RJ 1UXXX 1ZG3A 3O0VA 1ETYA 5LY2A 3M9AA 2MYSA 1ETKA 4K1YA 4BMEA 4A3CJ 1WHUA 3O2PE 4CZCA 2Q30A 4YYOA 1YRZA 1CGPA 3W6JB 3UT0A 3HOVJ 1IRFA 4KU8A 5ANQA 1Z0HA 2GOMA 4E9KA 4NPRA 3GTQJ 3VBUA 3POJA 4WM8B 4HNTA 3MF6A 3BR2A 3WDUA 5CFDC 3ZN5A 2RC4A 4HPKB 4Y5Z0 2VQCA 1R58A 1OVSA 4LLLA 2XF7A 5EQUA 3WP5A 2NYXA 1BYHA 4TLGA 2NVYJ 4CDQA 2VJ4A 3WNPA 2W1QA 3TO7A 3CF5F 4BQAA 1S0IA 2ZEWA 3CCJI 2JQ7A 3D8CA 3WZ1A 2K2SA 3JRHA 3GX4X 1H30A 2WFPA 2IZWA 1O3SA 2DCTA 4YVWB 3KCYA 3JB4C 4XBLA 5A6YA 3PUQA 5ABJA 3WDVA 4E4HA 2EIEA 3DYMA 3Q8FA 1Y1VJ 2D6MA 2WO3A 1O7LA 5KC5A 2YMZA 3VBHC 1BI0A 2V73A 4Y15A 1K6OA 4NMIA 4NE9A 2FXAA 5DUKA 4IOCF 2BVVA 4HLXA 2G9ZA 1RESA 1XGOA 5FYVA 5K7HA 3FXMA 1JOPA 1X8MA 1T08B 4HVRA 3LA3A 1DG6A 3O5SA 5ABJB 1HKTA 4M71A 4RGRA 1PUFB 3VKLA 5I8SA 1VBD1 1NZCA 1PO13 4LPLA 4B8EA 5FP3A 1KD7A 2RS32 2B63J 4ABZA 3RI8A 5FZIA 4IV3C 3KYLA 1MQTC 2XL9A 2IA1A 1J58A 4UF0A 2JDAA 2A3WA 4XQWA 4N4NB 4LBQD 5FZGA 1GNYA 4KIFA 2WA3A 5FZCA 4CDWB 5JI6A 4FPCA 3WF4A 2M9HA 1WCKA 3WODF 3LEKA 1A31A 3RZZA 1UZ0A 3M8FA 4N53A 2KJBA 3WGIA 2HEOA 3BOQA 3V0AB 2HR3A 4XLEA 3FE5A 3RVHA 3V0BB 2JWTA 4ZH4F 1R22A 1XNKA 1JUIA 2W84A 2P34A 2XKOA 1COV3 4QLCU 2E31A 2ZB9A 5LBBA 5GAGJ 2F5EA 3OBRA 3DPTA 4FPJA 2JA8J 4M6VA 1AR71 2VNRA 4YLZA 4A44A 1H4HA 5CADA 1LOGA 3H7YA 4C3IJ 3FIWA 3WW1A 1D0ZA 1RMU3 2M0CA 1LESA 3FBNB 2V1DA 5LASA 4N53C 4YW1A 2QZ8A 4W1UA 2E63A 4YG6A 1W6MA 1D4M3 2PHWA 1L0OC 1D0XA 4FOWA 3OUIA 2WDBA 3OYJA 2V9PA 4CCOA 2DCEA 2K27A 5A3LA 3ZIWA 1AR63 1JYVA 3ZM8A 1OJLA 2NNYA 3WTUC 4MADA 1DDLA 2VBXA 1XB9A 1L3LA 2BBVA 3PO3J 3GDBA 4EJRA 3MW4A 5DAXA 5C3OA 2DVBA 4V1PA 1RPWA 2O0YA 4B7EA 4AVCA 4CCDA 4NIDA 4L11A 4IE7A 4MFDA 2CQNA 1QXJA 4CDQC 4CEWB 3R4UA 1EUTA 4LB5A 3EJKA 2HWC3 5DUXA 2NQYA 5FFXA 1OPOA 3S2HJ 5HNFA 5L7OC 2J1EA 3HRSA 4MTDA 1GMMA 2R1DA 4PJMA 1HQLA 2JZYA 2WNOA 2Q8EA 3RWNA 4G8XA 2WZEA 3U11A 1ZARA 3S8PA 4QPIB 1FNYA 5LB6A 1POQA 2QDNA 1G3SA 3ZMTA 2A07F 2P3KA 1AL0G 1PO22 5A33A 3S6PA 1JKOC 1EAH1 1ZVFA 3AKPA 3CLOA 1HJGA 4BXFA 2PN6A 4JK1X 2JPCA 1M4WA 1LGBA 4BQQA 3A03A 1Z7S1 2EZIA 2E5ZA 1X1AA 3I8TA 2DFHA 5FYMA 1IUYA 3HXLA 3DV8A 2ZAHA 3HGYA 3H5RA 2DOFA 1VTNC 1GT0C 3LIHA 1RITA 3LSDA 2O9LA 4DO0A 3PU8A 3LWFA 3N97A 4L2NA 3ZXJA 3JB8A 2LOOA 5A3UA 1WA4A 2YFZA 5D4SA 4Z82A 2VC9A 5JZGC 2HWF3 5EDNA 3OYBA 2FUG2 1D1CA 2QCOA 1QA6A 2BZDA 1MNDA 1TZLA 3AXDA 2E7TA 2V79A 1AR81 1R1UA 1NG0A 1VBC2 2FBIA 5HS7A 3Q5FA 3K4NA 2KPMA 4IZZA 2WNUC 2K85A 2IP2A 1HLVA 1X3ZB 3WW3A 5GAHJ 2DA2A 3FMGA 2NVQJ 4NBQA 3G7DA 4FPKA 3A2KA 4OIQF 5F1RA 3K4MA 4WM8C 1E5IA 4M0HA 1D5YA 4M6XA 5F27A 3BCBA 3PVBB 3BCWA 3IKTA 1RB8G 1ENXA 1ZX5A 1T6BX 2Z5UA 1TWCJ 2QKMB 2JB8A 2F5CA 3P9IA 4LBMA 4CICA 4GXOA 4N8MA 1W2OA 3OBZA 1YYVA 3Q0VA 1HV1A 1QHDA 3KE2A 2Y0IA 3GW2A 1F15A 3POGA 2AHQA 2LTPA 1OLTA 2VQ0A 3T8TA 3ABUA 1EPZA 1Q5OA 5FP9A 2XGXA 1FOD2 1T39A 4BY1J 3ZO0B 4ET7A 4A7YA 4ZC3A 3I2JA 1Q8QA 1WLDA 4OHVA 4YM0A 5F7UA 1SCSA 2QQLA 3M8EA 3CLQA 1PJRA 1QZEA 1RUD2 1WJBA 1CR7A 1W99A 3THCA 1N75A 4HRIA 1REDA 3GALA 2DMTA 3BU0A 3FK7A 4NHXA 1X9TA 5I93A 2LR8A 1BEV1 4IDZA 3GTMJ 1RZ4A 3GHMA 4Y24A 3AMHA 3AG1H 2LUWA 5HS8A 3LSKA 1GVJA 2V4AA 5JLWA 1K5MC 3BG6A 5BQTA 1U78A 2M5WA 4EJOA 1OR7C 4FOYA 2M34A 2VL8A 1R093 1Z6TA 2JA7J 3FMRA 1ODNA 5FYSA 1UYZA 3KV4A 4LKFA 3ZYFA 2ZX2A 2VB6A 3AM2A 2V4JC 1HXDA 2WSUA 2VAUA 1YQCA 3USUA 2RS33 1HB3A 3F8CA 3AKQA 2XVCA 1T95A 5C5TA 2EB7A 1U5TC 4BDVB 3UNPA 4QXCA 3IRQA 2O8KA 2XLFA 1EV7A 4ESJA 3T0YA 1WMDA 2RKHA 2XROA 1YJWI 5H9QA 2DMQA 4CDWA 2VOKA 4WVWA 1K78B 5A7NA 1X9PA 2R042 5C8CC 2LH9A 4LXLA 1WLTA 2YS9A 2DTRA 1KITA 5IATA 4HF2A 3CDIA 5F3EA 2W9XA 2XB0X 3MICA 2R062 1BOAA 1ZRFA 1QIQA 3V0AA 1QDOA 2BXYA 3HRUA 2CYFA 2ZJPF 3MKYB 1AJOA 4DBQA 1NXMA 4BISA 1F5FA 4JHZA 3IDBB 3P5JA 2FD8A 5ACA2 5C4WC 1IV6A 1LULA 5FO8B 1AU7A 1BIBA 1TT5B 4AFDA 1UZYA 1H9PA 1VBB1 3M07A 2RAEA 1F4AA 1D1AA 2LBFB 4XICA 1KU7A 5ICFA 2L3DA 4PQQA 2VD7A 4NB5A 4JGZA 3Q0UA 2J1SA 2W82A 3K4ZA 1W5CC 1YOVB 2D5HA 2E1MB 2PTMA 1YCIA 3E1F1 5JLXA 5LD2C 2WA0A 4XK4A 1AHSA 3ELNA 4XRSG 4GMP1 1DGWA 2A75A 4RM2A 1VQNI 2RS53 3S5AA 2CV2A 3BR0A 2QENA 3MAJA 2OKXA 3F72A 1MGTA 1T98A 3NJYA 1SMYF 1XNTA 4SBVA 2XB6C 2YUSA 3KIOA 5IT3A 4LLFA 4JKMA 3DU6A 3B9CA 1R1ZA 5IVJA 4Y33A 3ZSKA 3BG7A 1SPPB 1VBB2 4ORFA 5A6QA 1MEC2 3S7IA 2IXHA 4EJUA 5E8AA 3HOWJ 4FP2A 1RUJ2 2BBAA 4A93J 1FOD1 4FTSA 5FKNA 5FY0A 3KV5A 2KT0A 4BHCA 2K0GA 3UKVA 4EN7B 3ZFEC 1UCRA 1W36D 5BNOA 1Y0UA 2XL7A 1YFHA 1BIAA 2EXJA 2XXZA 1UY4A 5FLXK 4AUXA 2PHUA 2Z33A 2FOKA 4BXXJ 3UL2A 1XGNA 4NRMA 4RQPC 3POIA 4EN8B 1Z6RA 2JVHA 1G2HA 1RUH2 3HOSA 1GHCA 3ZQLA 4M3CA 1QNYA 1V9U1 4GFBA 4H7MA 2KZVA 2HPIA 3WE3A 1DGWX 3KP3A 2P7CB 4RQPA 2Z9OA 4PQ9A 2HGCA 3KHCA 2OW4A 4OHWA 2PMUA 1Q3EA 4BLJA 5A3NA 2LY1A 1EH8A 4QT6A 4BMBA 3URFA 2VMCA 2ZGUA 1DLLA 2NS0A 4ENNA 2LYCA 4UUSB 2CU7A 1W6PA 1QZYA 4RS8A 2WYFA 4DIQA 1VQLI 2FA5A 4CDUB 3AVRA 3TMOA 4CE8A 2L7KA 4H0EA 1BVVA 3Q8CA 4CDQB 1W7PB 3QBQA 4RN5A 4U0VA 1IDZA 4ENMA 2QDRA 4RGUA 4Q4V2 5IYCJ 5FUPA 3I58A 5J4VA 1DQ0A 4FPOB 2BY1A 2LM3A 3T0DA 2X51A 2WKKA 3ALQA 1F2NA 1JGGA 4CO8A 4UFMA 4OQ9A 5EEAA 4QQPA 2ESHA 2C24A 3ZXAC 2BOLA 1RUE3 4QWNA 2D7FA 1PM7A 2KZGA 2F4MB 3KVAA 2YGLA 1UHSA 1ON2A 2QQVA 3WNKA 4Q1PA 2XVLA 5IK8A 3BPXA 3NV2A 2N7GA 5DPNA 3HKZA 3OS0A 2D5FA 1ETXA 1WKMA 2HYJA 1AYN3 2Q4SA 1UHWA 2QEXI 1DDNA 2VXRA 1S0FA 1FYLA 1OQYA 2PAMA 3F8BA 3V4GA 1I5ZA 4IEZA 5IT9Z 1VBA1 4AEMA 2CY6A 2EICA 2VY0A 4OU0A 1YO5C 3LA7A 1MS4A 3GCMA 1TZOA 5BMZA 2Z79A 4MGRA 2E34A 5HDGA 2WNUB 3I59B 1G7YA 4H14A 1SD7A 2M30A 4MXVA 1UMHA 2Y0SA 1D0HA 5KVRA 4UAPA 5IP9J 3FHZA 3BP8A 3LEGA 4XAAA 2HU9A 2ACJA 4UW4A 1N1TA 1GQPA 1OUSA 2YU2A 3OR1C 2KLOA 2G4IA 2VGDA 1X3UA 4Y4RA 5F5IA 4HZFA 4B43A 3ABMH 3GFMA 1ZM1A 3H3UA 1OPMA 1V0AA 2IVIB 5IY5H 4A3KJ 2WY8Q 1EF4A 1IPKA 1RHI3 4CP9A 4RLFA 3JD71 4MIMA 4NQWA 2GH2A 1AR93 1ZREA 4AQ2A 3A22A 1VBE3 3DCFA 4ITCA 3O1MA 4D69A 4MUVA 4AF9A 4KICA 5L3BA 2E2HJ 1LGCA 4E4DX 1URXA 1TQPA 3WTWC 4B4PA 4RDUA 2Z42A 2G1MA 1C8M2 2HEVF 1BJQA 3SEPA 1ZN2A 4CUBA 1RUI3 4AG4A 1Y43B 4XSZF 1CIWA 4NDLA 4NHKA 3WP4A 3L9JT 3RRDA 4MZUA 4Q4W2 1NLQA 2WZPP 4XPVA 1J2XA 3BTXA 2DVAA 5B4NA 1NK2P 4CXXA 3CJXA 4L9TA 3QPTA 1QJU1 2JG8A 4MGKE 1R1VA 2OPKA 4XQDA 3L7WA 3A02A 2Y6HA 4IL6C 2BY3A 4CCNA 1XN7A 1QVTA 5FY5A 2R7OA 5FKCA 4NO4A 3RZMA 1F36A 1MS9A 4LA3A 3MGUA 2GQQA 4KBBA 3I59A 3OGGA 4IQPA 1OF3A 2GDFA 5FKLA 1NA1C 3VDDC 2ZKZA 1FIAA 4UY8I 4XDOA 4YARA 4U7BA 3ISPA 3TO9A 2DN0A 4CCJA 2P5VA 3MLJA 3R60A 2XMLA 4LK7A 1AX2A 3C7OA 2VUCA 2LREA 1AYM1 4JDMA 1ON1A 5L3DA 1XE8A 5IFTA 4UFIA 3OY8B 1TT0A 1IHMA 2P1BA 3W2WA 1N77A 2GM4A 4L9BA 5CFCC 3TN92 5IVYA 1OA4A 2RMU3 1NCQA 1VMJA 1OKRA 3JR9A 4XDQA 1JJ8C 3NSTA 4YVSA 1UKRA 4O7XA 2HI3A 4V2FA 1YHQI 2UY9A 3BTCA 3OV8A 4XURA 2Y0OA 2EFWA 2BQPA 5FZ6A 5L9RA 3H7JA 4WV8A 2MPFA 2VU9A 5IHRA 3CJNA 5EZWA 1RVF2 5FZOA 2O03A 3KP5A 4ENJA 4Q4X2 4B3NA 2HOAA 3JCUC 2XQXA 1UPIA 2P17A 3MZHA 1FP1D 3VN4A 4QHZA 3MBWA 1UG0A 5IYYA 3WTVC 4F55A 1OOPB 3NRUA 1BOBA 5EPAA 4JQRA 3DTIA 3R61A 4AWDA 1Y9GA 1E57A 1B9NA 3ZFEB 2VECA 1R5ID 2L9SA 3IZOA 2JRMA 4OIPF 4P08A 1S0BA 5FK7A 4AVTA 1EH6A 4HAMA 1KFXL 3PUBA 4GJZA 1S2EA 3OYCA 3HBLA 1TBXA 3JBG3 3MDPA 5GTHC 3CDHA 1WWYA 5LK5A 3IPVB 4LG0B 3M3CA 2CWMA 5BPXA 3F2ZA 4M0NA 3SZGA 2W5FA 2IAIA 3IBMA 4HKWA 4Q0PA 2VZTA 1Y9QA 4KWLA 2E26A 5IYDJ 1RYYA 4D6QA 4DOUA 4YZ4A 1HW1A 5FXWA 1FT9A 3QRFF 2ZX0A 2WZ8A 5DAQA 3RWKX 2DO7A 3WDWA 1J5YA 4G9YA 1DP0A 1H6YA 3EUAA 3QOPA 2I45A 1LE8A 3VYRB 1U12A 1QZZA 1W03A 2VMFA 4XKWA 1YEWA 2PMZA 3RGBA 2QSGX 5FMDA 4IGPA 4A5NA 1RKWA 2DPDA 3VHPA 4Y1YA 4K3UA 1XSDA 3HJEA 1HLCA 2I2SA 1HCRA 1RUE2 2HVSA 3MCZA 4ZTJA 4OUMA 4L9JA 3OYWB 1I3HA 2K02A 2A7AA 4GWJA 2CMPA 2MFZA 3KCCA 2VBYA 5IPAA 1PGW2 2IS4A 5HLHA 4V19K 2F2EA 1QOSA 1OYYA 1N78A 2QYOA 3FN9A 4FX4A 2RR11 5F2WA 4LK1F 4XF4A 5HXMA 4XUQA 2W91A 1DYKA 1JHHA 3NO8A 3HTUA 4EGZA 2LKSA 1QRYA 1W6NA 5A7WA 3HGGA 1LUJB 3F8MA 1TC3C 1IS4A 4HKLA 1NLRA 2BP6A 4NNJA 4C2TA 3GTKJ 4Q4X1 1R1A2 4AI0A 1OC1A 5BNPC 4HXCA 2C0ZA 1QDCA 1XSVA 2K9ZA 4RGGA 4XJAA 4K40A 5KXEA 3UESA 1JT0A 2BFUS 1ZAOA 4IHTA 3DXUA 2W85A 2Y9YA 1UWWA 3MD2A 3BJOA 1O3QA 1NUKA 2D6PA 4FSJA 1W39A 2ZEZA 5H9RA 1J3RA 4XILA 4HSLA 1H8TB 5EJZB 3PO2J 4WVMB 2L2OA 1RNLA 1JZ4A 3VBSB 2ZBKA 1ZLJA 2RS12 1R081 2BZTA 4GYIA 1MNMC 3MYXA 1D8KA 2JICA 4F3QA 4CDWC 3CNAA 3MEPA 1RUJ3 4AYUA 1LQ1A 4GWIA 2BY2A 4JQFA 4QU2A 2GZWA 5JOWA 4S05A 4HF1A 1RUC1 5T5JA 2BE5F 4FASD 2FZ1A 4LLGF 1CQTA 1S0CA 2VZUA 4I0BA 2QJVA 4BWOA 2Y26A 4LOTA 2ZA9A 5ABJC 3RDIA 1I1SA 1KYZA 1IC8A 5FREA 4EMSA 1LFBA 4QPQA 4P14A 1SDWA 4PIXA 2UY8A 3S14J 4OAZA 2QLZA 1V6JA 2JSCA 3ECQA 4B29A 1IOAA 2W1WA 2PELA 5L9VA 2EAAA 3KSCA 1EPWA 1BI1A 1ZHFA 2Q2EB 3GLLA 4P9LA 4ZTFA 3CF2A 3M3YJ 2BNOA 3DPRB 1FXZA 3I2OA 1N25A 4PJYA 1WJDA 3QWLA 3H8OA 4QB1A 2W1SA 4QPGB 3AG4H 2CV0A 1TW3A 4IHVA 1ORKA 1W9TA 1DZQA 2K3PA 3GFLA 4OMCA 3S3MA 2ZGMA 3PSFA 1W7PD 4HV5A 2DMUA 1MH4A 1FTZA 2VR4A 4P55A 3HM5A 4MXWB 1Y0NA 3F95A 3KV6A 2WLPA 4G7HF 5C8CB 4QU1A 1ZH5A 3RMXA 3WQ7A 3VYSB 2D6KA 1W0TA 2AC1A 4O3MA 2DW4A 3H35A 4IEVA 3ZYHA 4A3XA 4TTGA 4XHBA 1PIV2 3PTRB 3L2UA 2VPVA 3AZWA 3AL0B 3V65A 2P81A 3WUCA 2FQ3A 4NQWB 2CO5A 5SV8A 1SHWB 2IS6A 5F3CA 2J1RA 1ZZCA 2DK8A 4QQOA 2XJUA 3PFYA 1TW2A 1VMFA 3VUOA 1J59A 1ASJ3 4QQHA 2WZR2 3K4JA 3H42B 2Q0AA 4CCKA 5IOYA 4META 1AYN2 2H1LA 3OSGA 1A6QA 1ONVA 3PNAA 4IHXA 1W7PA 4XLCA 4M9XA 3C7GA 1Q8OA 2P6CA 2W7NA 4DY5A 3AL6A 2DI3A 2HEYF 3DN7A 3NAPB 2A69F 1FOKA 4CUCA 1Z7LA 2IWGB 4AHXA 4YG0A 3DPRC 1CZSA 5GLZA 2JT1A 2VQAA 2QZ2A 2KA3A 2ZHKA 2OX0A 2OU2A 3VZOA 1U6GA 1UIJA 2E53A 4FPEA 2R0QC 4J19A 3CMGA 4FAGA 5KHKA 1SFOJ 2VTXA 5ILSA 3AKTA 2XJQA 3HJRA 1JTYA 2RR12 3A0HC 2JK3A 5FB2A 3L9FA 3C1DA 1F9KA 5C8WA 2BY0A 3LGRA 4CU9A 4UXAA 3J7ZI 3S5QA 1T6GC 4ZDPA 4ZZLA 1XYOA 2XOMA 4XORA 2UWCA 3MV11 5HOOA 2ADDA 3WUDA 1YFWA 1X2NA 1MDMB 4A3LJ 1VBE2 1FNNA 4IPAA 2DUQA 5LCWL 4ZS3A 4L9NA 3VKNA 3OIOA 1G3TA 2EK5A 1IRGA 1B6AA 4ZPIA 3S1QJ 3JBG2 5EEGA 3KM5A 4RAZA 3TKYA 4YPJA 1DQ1A 3IMMA 4GXLA 3ZDVA 3CJQB 2DYCA 2KP6A 2ZSHB 2A3YA 5D4RA 5A2QZ 1ODMA 1POV1 4P9JA 2O8QA 4AHYA 1J09A 3RKXA 2YC4A 2FJ1A 3T2TA 1QOOA 4FETA 3IC7A 1REPC 1LNSA 2TNFA 2DAOA 3NKTA 3FLTA 1AR92 5FZAA 4UW3A 4BE2A 3AP6A 1CAVA 4QKBA 5IWFA 2WT2A 1FBUA 4YFXF 4YIRX 5ACA3 2DTZA 4M3DA 4CP2A 1OHFA 4KGQA 3LSGA 1IAWA 3C7JA 3BTZA 5FZEA 1ENHA 3GZ6A 5FCCA 1JHFA 2CH0A 2QQBA 4XF9A 3O1SA 1H9TA 4Q4Y3 4DYCA 4UWDA 3N3HA 3SH4A 3UR3C 2ID3A 3N9QA 4PBPA 1LGNA 3ZYIB 2V26A 1Y9MA 3CO2A 1TP4A 2O61A 4XUTA 3M2MA 1OLME 1R4MB 1QJX2 4KIBA 3BJAA 1DZTA 5IK7A 4E7LA 1F1ZA 1OH4A 2XWBB 4UI9L 5FZHA 1B35B 1W2UA 5L19A 1WGXA 4RLQA 3J9SA 2F5DA 2J7MA 5GZEA 5L3CA 3VOEA 4N9HA 4I2OA 1Y8QB 5JHFA 5C3RA 3DL3A 3AMNA 3M70A 2OXBA 1XOYA 4OQ8A 3A21A 2PEXA 4IQJA 3L09A 1UY1A 2VUAA 3REOA 1OLMA 3K1PA 3ZMDA 2M0MA 3CZ6A 1KRIA 1RVF3 1Z1DA 2AEYA 1ZGJA 3CQZJ 1Z21A 3S2DJ 2COBA 3AFKA 4C0BA 4IHYA 4DXRA 4JCKA 5J4YA 2P6HA 4LR4A 4DQ2A 4Q4Y1 3S7EA 4WVVA 3ZSLA 2KHMA 5GPCA 2ZC2A 2UWMA 5JI7A 1YO8A 1IJWC 1KXGA 1R4NB 4INDA 1PHMA 3EYIA 2CFOA 4MTEA 1O4YA 2GC1A 3I7DA 5C9AA 4GB31 1BL0A 3RPUD 1ZG5A 3QPLA 3BKZA 3FBMA 2BGOA 4XBNA 1NLSA 1TWFJ 5JR2A 5J1YA 2X5IA 1MPXA 4QDQA 3OUJA 1PVEA 1IO2A 3FISA 1AA7A 1GNZA 3TEXA 3RQIA 4ANJA 2HYXA 1BA5A 2DBBA 5E8GA 2A68F 3ETPA 3FKIJ 1LDDA 1G8XA 1JMUB 2MEV3 2R073 5C3SA 1I39A 4KMUX 3WF3A 3RKWA 2VTFA 3I3MA 1ZRDA 2B9UA 2Y6KA 4I0AA 2VQLA 4M01A 3IKWA 4M4RA 1GBGA 1P2FA 1GZWA 2B0LA 2OUMA 1OOPA 2R32A 1R64A 1ULCA 3GJBA 1YIPA 3O1PA 4PI2A 4MGIE 4ASNA 2V1XA 3PIPF 2LF8A 3K4CA 3HPNA 2R071 3ZFEA 4M9SA 2K9MA 3KT1A 2ARBA 2PLV1 4E2SA 2WADA 1YJLA 2HXIA 4I76A 1ZA7A 3OYGA 1OXCA 3LCPA 3AL5A 2GA1A 4XXAA 5DN2A 1ETOA 1JOJA 4JRLA 1GUUA 5HCFA 2IXIA 1VRH1 4DZJA 5F6KA 4RR3C 3WHCA 5ED4A 3DEUA 1WH7A 2GC2A 1MW7A 5D1IA 5FY9A 3VBUC 2LKPA 5M3MJ 3NJZA 5F32A 4ISRA 3SLIA 3JW4A 2E1CA 3OGJA 1ASJ2 2XLGA 1OLRA 3GEZA 1PUEE 2EFOA 1CAXB 1R1A1 2P5LC 1GDTA 5A1LA 5TISC 4MFEA 1ZZBA 2A6VA 2IEKA 4LKDA 3NJVA 5KHIA 2MW8A 1JTXA 5FYZA 3T09A 2V6CA 1MZFA 1XC6A 3HR9A 2XPWA 1QGPA 5DUVA 2QUFA 2D93A 1JZ7A 3DKWA 4A0ZA 5IYBJ 3LEMA 3FJSA 4XHXA 2UU8A 2D1VA 4GQ7A 2HQ5A 4QKNA 5FOJB 1MMAA 1DP3A 4H4KC 1YQ5A 4H7LA 3NQOA 4M3GA 1C1LA 4IV3B 1AZDA 1JI8A 2WO7A 3VBOB 4Q26A 3W20A 1EH7A 2PJRB 1N3PA 1FOWA 1NHAA 2MD5A 1C1FA 1H4GA 2WNEA 1W5SA 5CA6A 1RXGA 2ZO4A 4BQ5A 2HWD2 3RSNA 1RUH1 5HXVA 3PVOA 2IGNA 2W87A 1VAKA 3TAYA 2CW0F 1WI9A 4FP3A 4CZSA 1JZ3A 1APLC 2A71A 2YPJA 3TOAA 4W8JA 3GHNA