1J59A

Catabolite gene activator protein (cap)/dna complex + adenosine-3',5'-cyclic-monophosphate
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
199
structure length
199
Chain Sequence
b'PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*AP*AP*AP*GP*TP*GP*TP*GP*AP*C)-3'
publication title Structure of the CAP-DNA complex at 2.5 angstroms resolution: a complete picture of the protein-DNA interface.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
total genus 53
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1j59A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1j59A01
1YUDA 2CAUA 2Q8KA 3BY6A 1U2WA 3SCFA 4KIBA 3WODF 1LEAA 4UBHA 3KP5A 5BXXA 3RDIA 2GU9A 1RUOA 2V9VA 3V7RA 3ZMSA 2XAGA 1HSTA 3P9CA 4IEPA 1IN6A 3FMRA 1B1BA 2XGXA 2GA2A 3I59A 3BJAA 3Q9VA 2Q0OA 1J3QA 3E5UA 2IT0A 3T5XA 3IRRA 2FQPA 4BIFA 1YS7A 3NJZA 3H1WA 3HRUA 5E8GA 3U10A 1WGPA 3OF1A 3HTUA 4CGZA 4XFFA 3RJPA 2E7XA 2IPQX 4UVCA 1J5YA 1ZZ9A 1RZ4A 2VECA 2KKOA 2VT3A 3BPZA 3BWGA 2XUBA 1S8NA 2CSOA 2GC2A 2J5PA 1QQIA 2BBYA 4XSZF 5FLJA 2JRTA 3COAC 4LK1F 5HDGA 4RGXA 3SCGA 4IRIA 4XLPF 2EFQA 2JPBA 2P17A 2HWVA 3M1EA 3WU1B 1CF7A 2HKXA 1QZZA 4BH9A 1TQPA 3WGIA 1UHMA 2QQBA 4PZJA 4A0XA 3SCHA 3VODA 1Q43A 4AIKA 1HW5A 3HQXA 3U11A 1NE6A 4KMUX 3GX4X 5BPXA 4KIFA 1F5TA 3RKWA 3F8MA 4NB5A 4KA4A 4L9TA 3NEUA 4HVRA 5FPXA 3ML6A 5D4SA 3E97A 1ZGAA 2RC4A 5BPDA 2D1HA 4QWQA 4X6QB 3V8JA 3KP4A 5KK1A 1X3UA 1FNNA 4HLXA 1O5UA 5DCFA 2E7WA 4ESBA 4UXAA 4I3PA 2XV4S 3R6SA 1P4WA 2QJVA 4XFIA 2CAVA 4N9HA 4IXAA 4I0BA 4MUVA 1H9GA 4FX0A 1ZG3A 2C6YA 1YFXA 3R61A 2PI0A 2OZUA 4ETSA 1TQIA 1I6XA 2NNNA 2UYBA 3T1BA 2LKPA 2EA7A 2MH2A 3KZYA 2A3SA 1SEFA 2O8XA 2QBYB 3RNSA 1LDKB 4CICA 4M9SA 1I1GA 5D5XB 4LLNA 4E2QA 2F5EA 3IHUA 5A2QK 1V3FA 4BHBA 2RN7A 4KT5C 5ILVA 5I0RA 5EEGA 1XCBA 4M9XA 4G7HF 3AAFA 3F8FA 4M6XA 1QWRA 2FBKA 4J1WA 4F8AA 1XMKA 3TO7A 4UBGA 4P55A 1IRGA 1LNWA 3C7JA 2V1UA 4HX8A 2V09A 3PVBB 4EGYA 3TO6A 1P6RA 3F8CA 3MFKA 1NE4A 4I2OA 5IT3A 1R22A 1XRUA 3FM3A 5D1IA 4META 2GWRA 5KHJA 2EAAA 4BHPA 5IT9K 3HOSA 1G4DA 1G3SA 1BI1A 3DKWA 5D8LB 2Y75A 1WLTA 2KIUA 2D93A 4O5VA 2D5HA 4N9IA 4RS8A 3PNAA 2XROA 4GO1A 3QACA 1IAWA 3OD0A 4YRDA 4YG2F 2VE9A 3LA2A 4DNCA 2ZKLA 4OOIA 5CVUA 3S2WA 1OMIA 2PA7A 2D45A 3G3ZA 1FT9A 1W7PD 3DEUA 4OIRF 5K5OA 3OTFA 5ICCA 1EYBA 2F2EA 1T2KA 3BOQA 1FYMA 2Q0AA 4HOBA 3VEPA 1SFNA 4M6YA 2EFNA 2Q2EA 4UHTA 4ESFA 2PAKA 1B6AA 3K1NA 3GZ5A 2EA2A 4HSJA 2CG4A 5EEHA 4BNCA 3T8TA 2IA0A 1F4KA 2EWNA 2QCSB 3QU6A 4HYEA 3MPBA 4JTOA 2XLAA 2UWMA 5LGUA 2VBWA 2ZFWA 1ULYA 3MWMA 4G6DA 3TNPB 4ZZDA 4HX7A 2OQRA 2E9QA 4G8XA 4QGNA 4IEUA 1D3YA 1W5SA 1PUEE 1H1IA 6PAXA 1O5LA 2MBFA 2QZ8A 1J2XA 3EQEA 3H1YA 3KMHA 4IEOA 1MD0A 3CO2A 5ILUA 4G94A 4D7TA 1O3TA 4LK0F 1BC8C 2CW0F 4ZYHA 2FXAA 1NYWA 5I8TA 3M8FA 1VP6A 3DPLC 2KXLA 3I4PA 1CAVB 2UXNA 5KBFA 1EP0A 2IXIA 1Z1DA 5BV6A 2W25A 1H1MA 2KJCA 1CAUB 3O3KA 4IEYA 1DPRA 1FX7A 4HN0A 1G6NA 1GXQA 5LGTA 2ZCWA 5J8CA 3ULQB 4IHSA 2FMLA 1EV7A 3L00A 3JTGA 3JW4A 3IRQA 4IPAA 3ZQ7A 4ENMA 3FM5A 2VC1A 4OLLA 2YPRA 1V4RA 2HQRA 3TOBA 2EV6A 3MEXA 4IF4A 4IJAA 1T98A 3JAMK 3CF6E 3HOTA 1KYZA 2XLFA 4XETA 5BY5A 4U0VA 4PIZA 1T39A 1IRFA 2IXJA 5HDNA 1U6GA 1UIKA 5BS6A 3WE3A 1UCXA 4QX5A 3IDCB 4IESA 4FAHA 2QQAA 1BI3A 5I91A 2JPCA 1Z05A 1ZN2A 2DQRA 2ESNA 2R7FA 1SD7A 3KEOA 1LB2A 2MHFA 2F5CA 1OYYA 2HYGD 3TKYA 2HOEA 1G3TA 3H7YA 1B4AA 5K5RA 3M7GA 3J81K 3R0JA 1CAWB 1MKMA 1DUXC 1JUHA 2D40A 1S7AA 1TBXA 2FNAA 1IW7F 4B09A 1U78A 1BI2A 1R5GA 4KN4X 3WTSC 3P7NA 2UZKA 3KEQA 4LD5A 1UPIA 4WVZA 1O7LA 2B8MA 3MYXA 5CYVA 2I45A 2IXLA 4YFKF 3CEWA 3P9KA 2ET1A 1J59A 2XAFA 2GAUA 4ENKA 3J80Z 1FBUA 2D2WA 4O9EA 4S04A 5DUIA 3K1PA 2EV0A 4PGHA 3F8NA 4HN1A 1ZG1A 5CVIA 2GA1A 1EY2A 2HS5A 1SD4A 3TDZC 2MLGA 2UYAA 4MH0E 3B02A 3HUGA 1ZGJA 1R00A 5HS9A 1R1VA 1P4XA 3WTYC 4XFGA 5EFUA 3SMHA 3I5UA 4D7SA 1UFMA 4YSFA 1YIOA 3MCZA 3HSFA 4U7DA 4XF0A 3V4GA 2DU9A 5I0UA 2YX7A 2O0YA 2PQ8A 5D5UB 1HSJA 2ZKZA 4I7HA 1TLHB 2XAHA 1OYWA 2XAQA 1WQ2A 2ZMEA 3L7WA 3GFLA 1FP1D 1E17A 4QM8A 3HYIA 2OBPA 3DV8A 4B29A 4MZUA 1YFWA 1FSHA 2H27A 2VPVA 2BV6A 4H0EA 2F4PA 5JAXA 4Z07A 4AQ2A 4Q0QA 4M71A 2LNBA 3W6JB 2IA1A 1IN8A 1SAXA 4WWCA 2PN6A 3TGNA 2VC0A 2GZWA 3QPHA 2DTRA 5JSPA 3WG9A 2IC1A 3V8LA 3KLOA 3KLNA 3ABTA 4UV9A 4EGZA 5CU1A 3U0ZA 2FU4A 1ZRCA 1YHFA 2KIFA 1G3YA 5E17F 2ADUA 5BOXA 4XEZA 3ELKA 3K0LA 2XL7A 4L5IA 5AIPA 2Q1ZB 3I59B 2Y0MA 3SFZA 4AIJA 4ENNA 5CJ9A 2P6SA 1L3JA 1ZZBA 2M8EA 4UVAA 1XGOA 4LJZF 3M8EA 3V7CA 1NXMA 1YW8A 2FOKA 2F5FA 3CJNA 3EQLF 2RNJA 3SZTA 4D0PA 2JT1A 2NS0A 1FP2A 3FMQA 3BROA 4YIFA 5DCMA 5HDKA 2DW4A 1ZG5A 3C3WA 3M3IA 3WTTC 2L3DA 1HKTA 1YLFA 5KHHA 2D5FA 3T0YA 1U5TA 4HMZA 1BN5A 3LOIA 2P7CB 2Y0OA 3ZMDA 2CV6A 3O6BB 1XE8A 2YU3A 1YFYA 1ZNPA 1ZX5A 2OZJA 3H8UA 5F1RA 5I93A 4CHUA 2JZYA 2DI3A 5FB2A 5JR7B 2R7DA 3HRSA 3F21A 4KWKA 2O3FA 1XB4A 3CJXA 3H1MA 3E6DA 4OIQF 4LLOA 2HEOA 2H0VA 1ZAOA 1D8JA 1CF7B 5T3NA 4HV6A 3ECHA 1R1UA 4RGRA 5LHIA 2BNOA 4WXCA 4EVIA 1GQGA 2LF8A 1LKNA 4HBNA 1OR7A 1KU7A 4IEZA 3F6OA 5JCTA 2J5OA 4ASNA 4AVPA 3QPTA 3OCPA 3EHKA 4P9GA 4G7OF 1LEBA 4ZYGA 1DP7P 2VN2A 2BYVE 5D4RA 3ELNA 3NKTA 4JVAA 2FEZA 1L0OC 3QP6A 4NHJA 4R8HA 2CO5A 2WC2A 2IXHA 4WZCA 1O3RA 4BQAA 3UKVA 3FF5A 3FXRA 4HA8A 3LSTA 4HAMA 4WF2A 4HVQA 3LFKA 4ZYDA 3JSPA 5DUKA 4XSXF 1SD5A 1IN7A 1FBQA 4EM2A 2BEOA 4E2GA 4LG0A 2ELHA 3LA7A 3EJKA 4IRGA 1R36A 3DF8A 3GBFA 2A69F 1WI9A 4LUKA 1NZCA 5C8WA 1UW8A 3DPTA 2DO7A 5HLIA 3FHIB 1UIJA 1U5TC 2P7VB 3ISPA 3JSOA 5C6CA 3TOAA 2ISZA 2LSOA 3WTZA 4M72A 4IVNA 2HTJA 4XFHA 1HBXG 3ZN0A 5HS8A 5FGMA 4FT8A 4HVOA 2Z5UA 1B59A 2FE3A 2OD5A 1RL3A 2P6TA 3PQKA 3CLPA 5FQ0A 3HSRA 2HR3A 4L18B 5DYMA 5FD6A 3WTWC 5CVVA 3SHRA 2E1CA 2AS5F 4KIGA 1DPUA 4EROA 4LTAA 4HF2A 3S0MA 5AONA 1BM9A 1D5VA 3LAJA 4MTEA 4Q47A 3M9AA 4CYDA 3NL1A 1GXPA 4EMSA 3M70A 1Y9QA 2K9ZA 3ZMTA 1TNSA 4RGUA 3KP7A 1F9NA 3HRTA 1QNTA 2GC0A 4AD9A 4MGYE 4CO8A 4EM0B 1QY4A 3DP7A 3GW2A 1XD7A 2DPDA 2QLZA 2QVOA 4EQQA 3GZ6A 2ZNZA 4U88A 5E1XA 3K1MA 1HKSA 4AXOA 3FE5A 2H09A 4FX4A 4B8XA 2GIVA 2ISYA 3FWEA 4Q0PA 4PCQA 3ERED 3ROUA 1ZRDA 4BYYA 2EJRA 3BALA 2PFBA 4A0YA 2DAOA 3C1DA 3BCWA 3E6BA 4Z82A 2UY9A 2QM3A 1BJAA 1MDMA 4U7BA 1GQHA 3EO6A 4XFAA 4IEVA 3KGZA 3I7DA 3LAPA 4BHCA 4KDPA 3GVAA 3C3VA 3ZMVA 1ZRRA 1DGWA 2JSCA 5FLXZ 3R60A 1ON1A 3U9GA 3LWCA 4RB3C 3RKXA 5BPIA 1ODDA 5LHGA 1JHFA 1R1TA 2DCTA 1ZARA 5E20A 5LEJA 2MA3A 4L2NA 4DQ2A 1OPCA 2B0LA 4RB1A 2C0ZA 1LQ1A 3LAGA 3HHGA 5L3BA 4WK8F 2CGPA 3DXJF 3LQRA 4DINB 4UNOA 2E1NA 3SXYA 3Q9SA 2YR2A 3HHHA 4LMYA 5ICFA 5LLQA 4QGMA 2TDXA 2MC3A 3H92A 4J1XA 5JVTA 2ZNYA 4EJWA 2FNPA 1TQMA 4HQEA 4HLTA 4EM1A 2W85A 2ZO4A 1XSXA 2NNYA 3ZPLA 5CLSA 5KHIA 2P5VA 1KA8A 2BGCA 1YLLA 3FJSA 1JGSA 2R3SA 4Z2YA 2K86A 1W7PA 2O8QA 4L0ZB 3JTHA 1Q3EA 2A61A 4FAGA 1U12A 5L3DA 4L11A 3EDPA 1OKRA 4KNYA 1ZH5A 2EA4A 5IT9Z 3JZVA 4RB0A 4KWJA 3LQQA 1QXRA 1ZLKA 4X6RB 4I0AA 2X4HA 1O4TA 1SMYF 3RI4A 1TTYA 4KU7A 1IN5A 2O03A 1K78A 4M73A 1ZHFA 4QMAA 4Q0VA 2A68F 3WTUC 3L9FA 3MZHA 3FZ3A 5I0TA 2PTMA 5D6FA 1ZLJA 4ZU5A 5FDBA 3CUQB 4AWXB 1B9MA 1Z7UA 1FSEA 2V79A 5JSRA 4P9UA 1WSUA 2LF7A 1DGRA 3J80K 3FMSA 4ONUA 1Z9CA 3LA3A 1BC7C 4BXUA 5ERIA 2HTSA 2FF4A 5DD4A 1ZZ6A 3ES1A 2EV5A 3TO9A 1CAXB 3CTAA 4A0ZA 5F64A 1R5HA 3I71A 1V70A 3EETA 5DV5A 4EJTA 3GF2A 3EUHA 2ETHA 4MGKE 3RPUA 2YX4A 1RIOH 5BUVA 1BOAA 5ILSA 4HDUA 1CAUA 2HKOA 1SFEA 3RYRA 4EJUA 1MJ9A 3ACLA 5HLHA 3MAJA 3I54A 2W84A 3TDUC 4RB2C 2G7UA 2RVCA 4HLYA 2ZXJA 1J9IA 4YFNF 4GULA 5H6QA 2STWA 2M1BA 4A2UA 1RNLA 3HSEA 1YO5C 4OIOF 5LHHA 1HW1A 1TNTA 3SXWA 3SQNA 4FHTA 2HGCA 1LDJA 1FC3A 1RGSA 2XIGA 1XDSA 5DD8A 4XLNF 1P4AA 1X82A 4L9VA 1U3EM 2ACJA 1IXCA 3GFIA 3U1DA 3OGJA 2ZMEB 3DN7A 3BDDA 5JFRA 4Y17A 1T38A 1Q1HA 5EZWA 1Z6TA 1QZYA 1B9NA 4H7LA 4OMYA 2GC1A 2G9WA 5H6RA 1OFNA 3KFWX 2OU2A 4UVBA 1G3WA 5DEQA 3WGGA 3LZZA 1FYLA 1P92A 1CAWA 2EFOA 2GXGA 4EWDA 4UUVA 5FFZA 1EH6A 1YYVA 2BNMA 4A12A 1QXJA 1MJBA 3S7IA 4MEXF 2A6HF 2CQKA 4XFBA 2ESHA 2STTA 1YG2A 1SMTA 4A5MA 4O9GA 3RYKA 2CWEA 4LB6B 3FFQA 1XDUA 2VT2A 5D5WB 1C0WA 2W57A 5JHUA 4XFCA 2XVCA 4F7ZA 4LB5A 1AOYA 3IBMA 1YW9A 2OA2A 1P2FA 2K7LA 4MGIE 3F3XA 3GLXA 1KQ9A 3P9IA 4UXNA 1E2XA 3E5QA 3WW3A 2DK8A 5BQTA 4KFCA 2WFPA 3HRMA 4OU0A 1VTNC 3USSA 1HKQA 4QLCU 3BZ6A 1ONVA 4LFUA 4MEYF 2PJPA 1S6LA 4AQ6A 3VHRA 3K69A 1LJ9A 1HQCA 2OZ6A 3TQNA 2ETEA 2K0GA 4ZU4A 3GXOA 4G7ZF 1UCRA 1IXSB 4WCGA 1U5TB 3FZVA 3NVCA 1VJ2A 4IEWA 4A6DA 4JTNA 3F22A 4Y13A 1J58A 1Q5OA 5K1YA 1KGSA 2QQ9A 1W5TA 2MLKA 2PYTA 1SD6A 1J3PA 3KZZA 1J1LA 4K8FA 4AIHA 3J7AO 1FOKA 4N0BA 5D6EA 1JHHA 3WGHA 2EK5A 2XASA 4EJVA 2HFHA 3ZMZA 4HV5A 3N4MA 2M30A 3WU0A 1BIAA 5AIQA 3QAHA 1WKMA 1REPC 4L0YB 5FLIA 2H6BA 4LUMA 2PFWA 4JQFA 2XRNA 4EJOA 4GYGA 3VOEA 2VQAA 5L3CA 5HS7A 3DFGA 1J7KA 3BB6A 4RGSA 2CFXA 1R7JA 3KCCA 4Q5SF 3ZMUA 3KETA 3OOPA 1PMIA 2QWWA 4XF3A 5FD5A 4HF0A 2Z99A 5LGNA 4KUMA 2MNGA 3I64A 1ZVFA 1USTA 2VONA 2IXKA 1GHCA 2PAMA 1YW7A 4WX9A 3KP2A 5L3EA 2HYFA 5ICGA 2DK5A 4HF1A 4IEXA 5E16A 3RTRA 4LA2A 4AVCA 3SZPA 2VBZA 2IXCA 4LG0B 2DBBA 3F23A 4KL1A 4R52A 3TNQA 1XMAA 3ECOA 2CYYA 2EFPA 5TRDA 1J75A 3CL1A 3IWFA 2LDUA 2PG4A 3BJ6A 4RD7A 1LDDA 3L2CA 5E8IA 2HJIA 2OYZA 1ZREA 3IKTA 2EFWA 4Q0UA 2PMUA 4P5OA 1BIBA 3RKYA 1IPJA 1F1ZA 1FLIA 2VODA 1OI6A 5KVRA 3GYDA 1TW2A 5FQ0B 1EPZA 1RUNA 4MHGA 2H94A 2DQLA 5I0SA 3HTSB 3VB2A 4PGGA 1S3JA 1J0RA 5FFXA 2COMA 3H50A 2DT5A 2PEXA 2KIMA 1EH7A 4KYWA 3NW4A 4R1HA 1BI0A 4CXFA 5FO5A 5JI6A 4K2EA 3LWFA 4QXKA 1KQ8A 1A04A 2K27A 3IL2A 5K5QA 4I02A 4KN7X 2EVXA 3MDPA 5I8YA 3GFMA 2PHLA 1WA4A 1MGTA 3F8BA 4LULA 1PM7A 2L4AA 3DL3A 1UB9A 4HX4A 1LR5A 1UHWA 2QDRA 3QRFF 3H7JA 3K2ZA 5FLXK 2IP2A 5E1RA 2OQGA 3WW1A 4LGWA 1MDMB 4PIYA 1IUYA 2XKPA 2IW5A 2G7HA 1ZYRF 1AWCA 4XF4A 2F5DA 4LLGF 4KICA 3BP8A 2DLLA 2FMYA 2L02A 2Q30A 2VOPA 4MNUA 4WBBA 2NYXA 1RC6A 4RAYA 2W24A 2P5KA 3MQ0A 1STZA 5LEKA 2XLGA 4I01A 2VBXA 3R4KA 3O14A 3BPXA 3H3ZA 1QPMA 4MQ9F 1O7FA 3KE2A 2MH9A 5FCCA 4EWAA 4XF9A 1R58A 2QBYA 4PDKA 1YFHA 1ZZCA 4E2SA 1FWZA 3D0SA 1ZRFA 2PBIA 1MZBA 1X7NA 4YYOA 2RQPA 4XRFA 5J8FA 1MJAA 3GFJA 2V6CA 4HZFA 2VXZA 1KQ0A 1U8RA 3WE2A 1JXSA 4M9ZA 3CLOA 2QYOA 2WTEA 2RGVA 1JE8A 3E6MA 4E70A 3OV8A 3S7EA 3EBRA 3E3VA 4Y15A 4RAZA 1XGSA 4R79A 1YWKA 1DZTA 1KU3A 4JV4A 1W7PB 3IIAA 2A6EF 2K02A 5A2QZ 2H6CA 2PAEA 1H0MA 1S7OA 2MD5A 3ZN1A 2PQQA 4XF1A 2MPFA 2PLYA 1OD5A 3D82A 1IPKA 4EV0A 1H9TA 5CADA 3DQVC 3WW2A 4HQMA 2IRFG 1K78B 5CVRA 2HZTA 1LRHA 2A07F 1J3RA 4BAYA 1S29A 4ZYEA 3HT1A 4U0WA 4JK1X 4L9JA 3PLQA 2JTVA 3QP5A 4UV8A 1OYIA 1DZRA 2K4JA 1EH8A 5HOOA 1KYWA 2UY8A 3CUOA 2IVMA 4HDVA 1LVAA 1O57A 4L5JA 2O1QA 4AVBA 1FZPB 4P96A 5KHGA 2Z2SB 1L3LA 2ZJ2A 1BBYA 3HT2A 1IN4A 2QVSB 3NQOA 4CDGA 3D5LA 5HLGA 4CZZA 2VBYA 1CX4A 4YARA 2PMHA 3RPQA 1IXRC 1IZ1A 4KWLA 2FQ3A 2FA5A 1I27A 2DFIA 1R23A 2DPUA 4WXDA 4TV7A 3KP3A 4Q0SA 4HBLA 3CDHA 4G9YA 4Q48A 3RIRA 5JR3A 3IKVA 1O3QA 1KU9A 2IA2A 4PIXA 5AVPA 5LRRA 3QOPA 4IEQA 2NRAC 1TW3A 2X0LA 3L2HA 2PHDA 3G73A 4A6EA 4NQWA 3CO6C 4Q29A 2VE8A 1TQ5A 1X8MA 2P4WA 3NRVA 4ORFA 2Z69A 2Z9OA 3B73A 4ENJA 4MGZE 1XSVA 1QBJA 2N7GA 2P8TA 1USSA 3GEZA 1PP8F 5BMZA 4GYIA 3CO7C 3WW4A 2GXBA 4YNIA 4I09A 2XL9A 3WTVC 4YIIA 4FBFA 5E1WA 4QM9A 5E1ZB 1Y0UA 1X8EA 2L01A 4S05A 3EYIA 3E5XA 4LLLA 1CAVA 3ZP5A 2K4BA 3ZDSA 1XGMA 5I8SA 1FYKA 3FX3A 3SHFA 5J3UA 1XE7A 4PJYA 4ZU7A 2Q4SA 4MV2A 5HI0A 3E6CC 2BE5F 2QENA 2BNNA 3UKTA 2XKOA 4HW0A 5FPZA 2B9UA 3CUQA 3ABUA 1ZZ7A 1WWXA 4GXOA 4G6QA 1CGPA 5CVJA 2D1VA 1XCVA 4MGRA 2V1XA 4M74A 1XSDA 1KU2A 2Z3YA 3PQJA 5JSOA 5ED4A 3C18A 5K8SA 2ZBKA 3FHZA 3QU3A 4ZZLA 3KP6A 1K7AA 4I98B 3IC7A 3BU7A 4L9NA 1FY7A 2M45A 4HSLA 4U0YA 1CAXA 1XGNA 2KJBA 2GH2A 3G7DA 1SQ4A 2FBIA 2OA4A 3GO5A 2XHKA 2YSRA 1ON2A 3IWZA 4P9FA 4A5NA 2QNKA 1YTYA 1IF1A 3U2RA 5J7MA 1WRJA 3F6VA 2WWYA 3Q5FA 1RTVA 2WV0A 4KU8A 2HDCA 3WTXC 3N97A 4IRHA 4TLFA 2O6GE 3FXQA 3JAMZ 5KHKA 2ET7A 3H3UA 1SFUA 1NHAA 2M5WA 1Z6RA 3F72A 3FXUA 1O3SA 4ON0A 4JBAA 2RDPA 2UXXA 2GC3A 3BJOA 3H9AA 4OINF 2RKHA 1I5ZA 2FSWA 1YS6A 1PDNC 2VOOA 2QUFA 3RZZA 4GGGA 3V8KA 1QO0D 4EWEA 4ZH4F 5F6FA 4GCVA 4Q4ZF 1FBSA 2V1DA 5ICEA 3GYHX 2HQNA 3J81Z 3I0TA 5J6XA 4WXHA 1YFUA 1FXZA 3VFZA 1PP7U 5J48A 2A5YB 4LA3A 4MTDA 4LEJA 4QGLA 1UD1A 1VR3A 1RI7A 2FBHA 4KMFA 3ST7A 4MQVA 2EB7A 2AXLA 2M87A 1HW2A 4NVPA 5D5VB 1ZZ8A 3KGLA 1D8KA 2GQQA 1Y3TA 3NSTA 1T0FA 3CUQC 2O61A 5LRSA 1XN7A 3T8RA 3R0AA 3K9TA 3O2PE 3I58A 2Z33A 4OMZA 2XAJA 5FLHA 4AVAA 3REOA 3W6KB 3HIFA 2RV8A 5D8KB 2Y48A 5TJJA 2P5LC 5DDGA 5DCMB 1FPQA 1K6OA 1K79A 3GUDA 3I53A 1W4MA 3L09A 3PFIA 2L54A 3ES4A 1Z91A 2IJLA 4IHTA 1FI2A 3IDBB 2NAZA 2ATFA 3GWZA 5LBQA 3RYPA 2KRFA 1SFXA 2FRHA 1I1SA 1GVJA 4ESJA 3BPVA 3UKNA 4MX3A 3MZYA 4O3MA 3KSCA 4YFXF 1DDNA 2L4MA 2B5HA 3EYYA 3ETQA 4OIPF 3V7SA 5HVQC 5E18F 4XBFA 1T6SA 5L3GA 4IETA 2OAZA 1YQAA 2OPKA 4OFGA 5H20A 1HXDA 4IERA 3D0JA 5L3FA 1QGPA 4O6JA
chains in the Genus database with same CATH superfamily
1YUDA 2Q8KA 4JKLA 4FVVA 5FKOA 4C3IJ 4KIBA 4B4PA 1ZR4A 4UBHA 3KP5A 2V6EA 2VOXA 1WMFA 3S6PA 2OUHA 3V7RA 2XAGA 5J1YA 3TEYA 4EQVA 2AQEA 1LOFC 1TZOA 1IN6A 3FMRA 3FKJA 4CPBA 3OBZA 1V55H 1KFXL 3I59A 5IVJA 3N9PA 3KIOA 1WJDA 1J3QA 3FXJA 1D0GA 1XG1A 3B9CA 2IT0A 1MQTA 3B5LB 4N43A 3AYAA 3AX4A 1YS7A 3NJZA 1GP4A 1O91A 4H4KC 1OOPC 3OSGA 4DPNA 2ZMKA 1H8TB 2WS92 1JHJA 3RJPA 1KDKA 1VQMI 1DG6A 3C7FA 3SITA 4UFIA 2VECA 4JRAA 1WI3A 2VT3A 2W3JA 1S8NA 4A42A 4D6RA 5J47A 4JX5A 3ZSKA 4C1WA 2J5PA 4LBLA 2JRTA 4LK1F 5HDGA 3SCGA 4IRIA 1ZELA 2E7AA 1UKGA 2BGPA 2AH2A 2FCUA 1H9PA 4HPQA 1AHSA 1RUI2 1QZZA 3VKOA 1TQPA 1VBD2 1HV0A 1UHMA 4BLIA 5A32B 5IK4A 3SCHA 3T0AA 2A5ZA 4K20A 1ETVA 4IV1B 1UZCA 1HW5A 4AIKA 1QQP1 1D1BA 5D21A 3GX4X 5FWJA 5GTIC 4WM8B 3KVAA 3HKZA 5BPXA 2RS51 3RKWA 2NS8A 1PUFA 4NB5A 4HVRA 4PI2A 4SBVA 5CAZA 3BQZA 2DT6A 3E97A 1ZGAA 2LOOA 2RC4A 2VC9A 4HL0A 3CZUA 3V8JA 3POSA 1PGW1 2E7WA 1BK1A 5DUVA 2XV4S 2VKVA 2DMNA 1XPXA 2CAVA 3AZZA 3DPRC 1H9GA 1ZG3A 2KD7A 1YFXA 4XONA 5FY0A 4DBQA 2ECCA 2LREA 3AVSA 2MH2A 5GZGA 2VTXA 3CC2I 1MS8A 4P9YA 3UK9A 4CICA 1S0IA 3VBOA 4PLMA 2TCTA 2QCOA 1NZIA 4KT5C 5FRAA 1NKGA 3G6EI 2L9SA 1LHOA 5F39A 3WNKA 2OQ7A 3AAFA 3F8FA 5IOZA 5JI7A 1K5JA 4CXYA 3ABLH 2CDPA 4WM7B 1VBC3 1LNWA 2ZXQA 3V64A 3C7JA 2BW8A 3PVBB 1H1AA 5A7PA 3F8CA 4JGYA 4I2OA 5IT3A 1GYKA 3FM3A 4CCEA 4QAWA 1IKQA 1RUE3 5KHJA 4AHZA 4BHPA 3H42B 4CEYA 2ZAHA 2BFUS 4XN0A 2VVEA 2Y75A 4XKCA 2KIUA 1HLVA 4XDOA 4KBZA 3PNVA 2TUNA 2VE9A 2K9QA 2DCKA 1W3VA 2R7UA 5CVUA 4UFKA 3GHMA 1REFA 4U36A 4PFOA 1OMIA 2HWF3 2XF7A 3AMMA 1EYBA 2WWUA 4GJYA 1MEC2 5FKBA 2XDVA 4QWNA 4XHXA 3MKWB 2EFNA 1VBA2 3R4UA 4ESFA 4HKOA 5IVFA 1B6AA 1IQDC 3GM8A 2HWC2 1QOTA 2CG4A 4B3XA 1FMD2 3T8TA 2ZMLA 5A1LA 2XLAA 5LGUA 5CKNA 2VUDA 1TZLA 1W2NA 3MWMA 1K4TA 2XGCA 4G6DA 5IW0A 4HX7A 3L1PA 1D3YA 1AYM1 1PUEE 1QEXA 5L73A 6PAXA 1O5LA 1VE0A 5J1UA 1SBEA 4IEOA 3FLPA 4FQZA 4LK0F 1VBE3 2VBBA 2CW0F 1U0AA 3IH3A 1W0OA 2FXAA 2NOGA 3RMYA 3WDWA 3KZ4C 3VDAA 3M8FA 3DPLC 4CYCB 1CAVB 2UXNA 1Z1DA 1GFF2 4QPIC 5CFDB 3ACHA 4NJ4A 1O8PA 4BXXJ 5IK5A 5DZFA 4ZXKA 2K46A 5J8CA 3CDIA 4EATA 4IHSA 2W46A 4JHZA 1EV7A 4G9SB 3L00A 2A73B 2D6PA 3KHCA 1W99A 3IRQA 4IPAA 2Y31A 4ENMA 4Y1XA 4XMAA 4BOWA 4GJZA 1V4RA 4P9WA 1J1TA 4Y26A 4IJAA 2JB8A 1IDZA 3O1TA 2XLFA 4XETA 3UETA 3GJBA 2Q1FA 5CFCC 1GV5A 4ZZ5A 2IXJA 4CCKA 1U6GA 1NCQC 2DJIA 1UIKA 5BS6A 5J36A 5JXGA 4B3AA 4FAHA 2Y0SN 2XPJA 3TOJA 2FX0A 5I91A 3ZR5A 1FATA 2JPCA 4OUSA 2E5ZA 1LB2A 1NOVA 3K46A 3TKYA 1UG2A 3VBUC 3K4DA 3C7EA 1B4AA 5K5RA 4NNJA 1OKQA 3R0JA 3J7YJ 1OCCH 1DUXC 2COBA 4B4QA 4O7XA 4KN4X 2ORZA 3RZOJ 4OWRB 4LD5A 1UPIA 1A6CA 2ZEYA 3AP7A 3MYXA 4XUTA 4LKFA 1HQLA 2DU1A 1L7QA 1YIPA 1IUFA 3FISA 2I45A 3M1HA 3P9KA 4B4CA 2JXAA 1J59A 3WD5A 2Y30A 4LBJA 1N25A 1JT6A 5GTHC 4LO7A 4HN1A 2XJTA 5CVIA 1EY2A 4L0PA 2Z1DA 4GXLA 3IUOA 1H4GA 4I30A 3TDZC 2UYAA 3B02A 4AGVA 3W21A 1ZGJA 3DKYA 5HS9A 1D0XA 3I3LA 5FLVA 1P4XA 1W2OA 5EFUA 4M3DA 2PHXA 1LUJB 3AG2H 1ENHA 4Q8LA 2RS33 1YO8A 4A69C 4XJAA 4YSFA 1YIOA 1OOPB 3MCZA 3CCRI 1UMZA 1RUJ2 4UOJA 3ZLIA 1SBFA 1W9SA 1T8IA 2PQ8A 5D5UB 1HSJA 1OHFA 2A6YA 4IE5A 3UYJA 4YVSA 3WDUA 2LR8A 5FREA 1JYXA 3NMBA 1WQ2A 2R7TA 2ZMEA 2D7FA 2EILH 2IGKA 1G2HA 4B29A 4A41A 2VPVA 3AKTA 4UFMA 2F4PA 3BIWE 2HLEA 2FOWA 5JAXA 3LPGA 2ZX0A 3K3NA 1KD7A 2CDOA 4M71A 2VW2A 2DA7A 4XKWA 3GCWA 3LDBA 3THPA 2VZUA 4XYXA 3TGNA 1BQPA 2DTRA 2UWAA 5LK7B 3LFIA 4CRQA 4C30A 3KLNA 4EGZA 1YQ8A 4YZ4A 2E2HJ 5E17F 4XR6A 1SG3A 1QOSA 3Q0WA 1HQWA 2XL7A 2O9LA 2Y0MA 1IS4A 4AIJA 3MUZ1 4OMDA 2P6SA 2A3YA 4ZDLA 1W28A 1HB3A 1XGOA 4XLFA 3O1RA 2M9HA 3EQLF 2RNJA 1PZ9A 4BIOA 3SZTA 3ASOH 2NMOA 4CDWA 2X53S 1LHWA 1MNEA 3C3WA 1JJ6C 1RXFA 4CDUA 2DBNA 1YLFA 2EXJA 5JIUA 1U5TA 4HMZA 4D94A 1JZ2A 3NWKA 3SISA 3CZJA 2QQUA 1FIAA 2XONA 2Y0OA 1IV8A 1RJ8A 4G6TB 2YU3A 1W6NA 5DG2A 5JWPA 2R7DA 3HRSA 1V5FA 4KWKA 4YW2A 1MS1A 3CJXA 3JRCA 3DU6A 2WN2A 1CPMA 4OIQF 5F0HA 2Y6LA 3SC7X 5L7OC 4NIGA 1TG7A 1C8M1 2LRDA 1R1UA 4RGRA 3U21A 4OZXA 4RS5A 4HBNA 5JCTA 2J5OA 4ASNA 2WWSA 2BHYA 3KWVA 4ZYGA 1W6MA 2VN2A 3ELNA 3NKTA 2WNEA 2WLQA 1S9HA 2FEZA 2IS2A 3MF6A 3CQZJ 3HQRA 2L9VA 3SFIA 1AXZA 1R092 2R7SA 2VJXA 3FXRA 4LHNA 5JLWA 4C2UA 2G9ZA 2BOLA 4ZYDA 4OI0A 2OPTA 4XSXF 1SD5A 4MOAA 1IN7A 3ABMH 4IX7A 1S1AA 4V2FA 3NWTA 2ELHA 3FXKA 2EXKA 2HXOA 3DF8A 3GBFA 1XNAA 4LUKA 5FUIA 2P7VB 5C6CA 3TOAA 2ISZA 2GH8A 5EJCA 4FOQA 3NNGA 2RDNA 2ADEA 3K4AA 4IVNA 4XFHA 1HBXG 4XURA 4FT8A 4HVOA 1MEC1 3O1PA 3PQKA 2EIDA 2R49A 2BHZA 3HSRA 2ZHKA 1GV9A 2IXSA 2HR3A 2QKMB 5DYMA 1VBA1 3C7GA 4PI0A 1UAAA 1ASJ3 3A2KA 3S0MA 4YELA 1VIWB 3D5SC 5K0UC 1BL0A 1D5VA 1X3WB 3IAS2 3M9AA 3M70A 3CC7I 3AVRA 2FMDA 2LBFA 3ZOIA 1T6BX 2GC0A 4QPIB 4MGYE 2LP0A 4EM0B 3OGRA 3FLTA 4AI0A 3GW2A 2DPDA 3D5OA 2GOXB 2OCEA 2X48A 2QVOA 2J1EA 3C2UA 2ZNZA 4QQHA 3NRUA 4LORA 4FOWA 2AEZA 2H09A 1MMDA 4B8XA 4ES8A 2NVUB 2QQVA 4OHWA 2ID3A 3CJQB 3ZXFA 2D43A 4KWUA 4A0YA 2DYRH 4W6WA 4Q8KA 1C3HA 2TRTA 2QM3A 4NPLA 2BBAA 1MBEA 1OPOA 5CFCB 4QKFA 5KR7A 4XFAA 4GH4B 1E5HA 3LAPA 2EALA 4QX2A 1LODA 2QSHX 2GXAA 4QHBA 2GALA 3MFAA 5H9SA 3U9GA 3LWCA 2VZQA 3I3QA 1ODDA 2DCTA 1UU4A 5KXDA 5LEJA 3VBUB 3BUCA 1OPCA 2B0LA 2C0ZA 3HHGA 3X29B 3A1YA 2DT7B 5IATA 3KYCB 4M3CA 2DA4A 4LQRA 3I8TA 2P37A 4XQDA 5K7HA 3LKJA 3K4LA 5ICFA 4LMYA 2X5IC 4M4RA 3VDBA 2HDDA 2TDXA 2MC3A 1QPIA 2VIXA 1HXS3 5A33B 1D1CA 4M3FA 4CXXA 1JYNA 4LBQD 3LDRA 4W97A 4DXTA 3FLRA 2BOIA 4HLTA 4L8QA 2ZO4A 1X33A 1XSXA 4CA0A 3TN92 3DXUA 2NNYA 4K6BA 2BGCA 4K40A 3DBHB 3ZQFA 4CSWA 4D8MA 1OFSA 4N7UA 1DU6A 3A23A 1AL23 4OHVA 4BKXA 2J1RA 1JTZX 1Q3EA 2A61A 1AF9A 4FAGA 2E35A 2DA3A 1OKRA 3N9MA 4RB0A 4X6RB 3B00A 4I0AA 4E4DX 3WF4A 1FAYA 1LE8A 4CDQB 1TTYA 4AGRA 4KU7A 1I9RA 4M73A 3JBG2 4QMAA 1PVC3 4RL7A 2ZTNA 3WF3A 5I0TA 5LA0A 1UZWA 4OUMA 1ZLJA 3J26N 3KQ4B 1B9MA 3M1CA 2EZKA 3GLLA 3QQAA 5T55A 1KS5A 1G59A 2QSFX 5FPUA 4IOAF 2B9VA 3FMSA 1DGWY 3EMRA 1HDKA 3LA3A 2GBYA 4CDXA 4URTA 1X50A 1ZZ6A 3ES1A 3TO9A 2RE9A 1ZBA2 1LENA 3OS1A 2E63A 2QKDA 1JODA 1V70A 4EJTA 3GF2A 3H8OA 3Q0VA 2V4AA 4MGKE 3MV01 1D4VB 3MKYB 1RIOH 1S72I 4FOYA 2WY7Q 3VD4A 5JLVA 3RYRA 1FJLA 4LBOA 2VMDA 3SQOA 4QQOA 1YRNA 5HLHA 3OEAA 2W84A 4MGTA 1RPWA 2HU9A 2ZXJA 3PJYA 1S2EA 4YFNF 2IZWA 5GJ6A 4OHYA 3RGBA 2STWA 2NVXJ 2VZPA 5IAVA 4A2UA 1QJY3 1RNLA 4P00B 1MMAA 1BBT1 2R5ZA 4OIOF 3KV6A 1TME3 1B8IA 5A6YA 1LDJA 1RGSA 4BBSJ 3MD2A 1Y6IA 4PJ0C 1MMNA 1UMIA 2DVAA 5BNPC 1U3EM 1IXCA 3GFIA 1AVBA 2YG0A 4NHMA 1FOD3 4B1LA 3JQXA 4M3EA 4BQYA 5JFRA 5F3EA 1Q1HA 1ULOA 1NXD1 1E0EA 3V0BB 3NAUA 5ABJC 4Q4W1 1MBHA 1OCZH 5H9RA 3CLQA 2G9WA 2Y8KA 2QEXI 1BOBA 1RMU2 3WGGA 2WYSA 2OVUA 3LZZA 5L7OB 4AVZA 1OLME 1MSEC 5FKKA 4EWDA 2VMCA 3NAPC 3AL0B 2W91A 4GB31 2WQZC 2WNVA 1JZ8A 3MN2A 4S0HB 4A12A 4YW7A 5A7WB 2WQ4A 4Y33A 5D8AA 1Y43B 4XABA 2ESHA 2E1MC 2KPMA 3EUHC 5FZFA 2NXNB 1SMVA 2BP6A 4Q4X2 4CUCA 4DRVA 2BOJA 4PLNA 1XDUA 1OFCX 1C0WA 3PU3A 5FYYA 2FCVA 4E6KG 4XFCA 2W9XA 1RR8C 1AOYA 3AMPA 3BOPA 5AC93 4BEHB 3P9IA 4QB2A 1E2XA 3E5QA 1A31A 5LK5A 2DK8A 5BQTA 2V9PA 3HC7A 3HRMA 4OU0A 5LA2A 1VTNC 3USSA 1HKQA 4LFUA 1S6LA 3VHRA 1HQCA 5K7ZA 2KZVA 4G7ZF 4BQ4A 4D7MA 2BZTA 1IXSB 3GNEA 1ACIA 2JJ7A 1NQJA 2R062 3VBHA 4JTNA 1Y9MA 3F22A 4Y13A 2VZVA 3WDTA 2YB7A 2CSGA 1ND2C 4BJTA 1COV1 2QQ9A 2MLKA 5F0CA 4YVWC 2PYTA 1DQ2A 2BVBA 4DEQA 2KIQA 2W87A 5SV5A 3J7AO 1FOKA 3PUQA 3K2OA 2WUHA 3VZNA 3WGHA 2N8GA 2HFHA 2CL2A 1YYNA 5CB7A 3N4MA 5K0UB 3PNYA 2M30A 1Y9GA 1ZTRA 5AIQA 1WKMA 4BUPA 1REPC 2IVJA 4L0YB 5FLIA 2VVFA 4JQFA 4BQXA 5J1RA 1TL8A 4BQ3A 3K4NA 4EJOA 1CJPA 3J7ZI 3IZOA 2VQAA 3DFGA 4NHXA 1XBFA 2X6XA 3ZMUA 1PMIA 1DHKB 1WHUA 5C8CC 2E53A 2Z99A 3DTIA 3WNMA 1O4ZA 4PHZA 2IXKA 2PAMA 4GMP3 1WGXA 1YW7A 2YUEA 4MSVA 3UNGC 4LKDA 4JRLA 2CQXA 3K4CA 5L3EA 3FXLA 4XIKA 2CUZA 2WR9A 4XJUA 3SZPA 5GKAC 2DBBA 2MEV1 1XB9A 2XQRA 1KXGA 2LDUA 4FTSA 3F2ZA 4M4PA 3ECQA 1LEMA 1XSRA 3NV1A 5E8IA 5A3PA 3ZYFA 3ASNH 4AFCA 1F2NA 4RR3A 4GWMA 1G9FA 3VB9A 2WZPP 2WWJA 2KISA 1JS9A 4Y5SA 3KCYA 1D4M3 4NUBA 4AYBA 5GAGJ 3H0DA 3ZPOA 5KVRA 3GYDA 4RLQA 5FQ0B 4FFGA 2W1SA 1EPZA 3AKRA 2HYKA 2H94A 5I0SA 3SYTA 3ZXLA 4PGGA 3UNPA 5LBCA 3K2AA 3G6JB 4H7MA 3B94A 5FFXA 1H8TA 1ETQA 2X5IB 2ADDA 2VCCA 2COMA 4LR4A 2KIMA 1EH7A 4KYWA 4CXFA 4NMIA 1IO2A 5FO5A 3G1MA 2XC7A 3LWFA 1A04A 2K27A 3SEEA 4JQRA 3B6CA 1N1VA 3PURA 4L99A 3IL2A 4CP0A 3CJIB 5LBFA 3I2GA 3E1SA 3N9OA 2R30A 4BCUA 4DMIA 1JZ7A 1W2AX 1SCSA 2B46X 4QQ2A 4AHWA 1H89C 1JUPA 1FOYA 5KNLA 2J1AA 3VN4A 1RETA 3VDDC 1W8ZA 1EA3A 5F6LB 4LOCA 1MDMB 3I2FA 4PIYA 3S30A 1OJLA 1ZYRF 2VQGA 1UN1A 1F8VA 3DYMA 3BZKA 3QOEA 1RUC1 3OWTA 2XB6C 3QH7A 2W48A 1WVRA 2Q30A 4MNUA 4Z8BA 2Y6GA 1RXGA 1V6JA 4RAYA 1STMA 3JBG1 1Z21A 2AUYA 3NV3A 1QMJA 2DCJA 4XMIA 4AHYA 3KE2A 4N4NB 2Q2EB 1VBB3 4PDKA 2DDUA 1U9NA 5J3LA 1ZZCA 1RUG2 3D0SA 2YU2A 2L9LA 1KZHA 5FZGA 3SH4A 3OSFA 5DAXA 1WJEA 1R4MB 1JXSA 3WE2A 1ZBA1 2WTEA 2KFDA 2PJRB 1MZ5A 2R4GA 4E70A 4AFBA 3E3VA 1KU3A 2A6EF 2K02A 3HR9A 3ZN1A 2MPFA 2PLYA 3OUIA 3T2PA 1Y0NA 1VRH2 3N9QA 2W7NA 5CADA 3DQVC 2RJKA 3VD9A 3VLBB 2IRFG 1LECA 2A5WA 5BNPB 1J3RA 5FKLA 2XAUA 3HT1A 4L9JA 2ARAA 3QP5A 2Y60A 2VULA 2BTVC 5HOOA 1KYWA 1OURA 2KDOA 4GKYA 5ABJB 2VJ5A 4PDWB 1LVAA 1FZPB 1AHDP 1BJZA 2A1XA 3ITQA 5EXOA 1RRJA 2ZJ2A 2BZDA 2OS2A 2E2JJ 5FMOS 3NQOA 4UW3A 3AMHA 3ACGA 5T5OA 4CDGA 4KGQA 1XNDA 3VKLA 3WCSA 1S0CA 2KP6A 1K5MB 2W1UA 4E7LA 4C1XA 2FA5A 5JXJA 3TP3A 4WXDA 4Y1ZA 3HOVJ 5FXWA 1H88C 3CDHA 4Q48A 3IKVA 1O3QA 4EZHA 3GXUA 1QJU1 4P5HA 2E1MB 1WMDA 3KVBA 2NVYJ 1HJFA 2KDZA 4EN9B 3QOPA 4Y1UA 2QF7A 1VQOI 2XJPA 2LMDA 2PHDA 3G73A 1MS3A 1WCUA 5CNAA 3A21A 1JW6A 1RUD1 4ORFA 3I2DA 2Z9OA 3B73A 2KRHA 1XSVA 2DMTA 2VLAA 2ZSIB 3IT8A 5BMZA 2I10A 1PIV3 4YIIA 2WA4A 3WCRA 4Q4X1 2P6CA 5E1WA 1X8EA 1Y0UA 1HRI2 4BE3A 5LA9A 1F4HA 2D5VA 2CUFA 4LLLA 1CAVA 2X1DA 3GDBA 1Q8SA 3ZDSA 2AENA 1DYKA 4B7EA 1XGMA 1S2BA 2R93J 4X0GA 3SHFA 1HRV2 5J3UA 3UV9A 5JXIA 5HI0A 3UKTA 3WUCA 1SAUA 3TMOA 3GTQJ 2WO1A 4IGQA 5FPZA 3ABUA 1WWXA 4IZZA 1CX1A 1CGPA 2CY6A 1W39A 1QH7A 2HXIA 2V1XA 1YHQI 2OPWA 1R1A1 2JG9C 5FZOB 3H8RA 3QU3A 4P08A 2H8WA 3DCFA 5TGTA 4ZZLA 4LHSA 1AJKA 4I98B 1V9U3 1H2LA 2VZOA 3BU7A 2M45A 2WKKA 1CAXA 5GALA 1TWHJ 3GMEA 3RZMA 2AO9A 2GH2A 2Z79A 5KAIC 5K9YA 4BE0A 2YSRA 4A5NA 1IF1A 3BTCA 3J8F1 4Y20B 5LBEA 3O0WA 5APAA 2HDWA 3MKZA 3KHBA 2V7FA 4RM2A 1HDDC 5JVGF 2WV0A 2DYCA 2IEKA 2O6GE 3FXQA 1IHMA 4QPGC 2VTFA 2Y6JA 1FMD3 4FPCA 1NHAA 1VQNI 2VNOA 3F72A 3FXUA 1O3SA 3ZKUA 4N7IA 1GWLA 2JA5J 5FZLA 3W58A 2JDUA 1GNHA 5F2WA 1SZBA 2FSWA 2VB6A 4CUGA 4RBOA 1YS6A 4FQGA 2VOOA 1QO0D 3BCBA 4EWEA 4IE6A 4UF0B 4Q4ZF 4AUXA 2HQNA 2ZB9A 3I0TA 1LOFA 4MTDA 1E3PA 4QGLA 1UD1A 2IVIB 1VR3A 1RI7A 1HOMA 4MQVA 1VALA 4QPQA 1D8KA 1Y3TA 5GLWA 3ZMNA 4AW7A 2VW0A 5FLMJ 2VI6A 1YIFA 3N3HA 2V73A 2WB1N 4YZ1A 3K9TA 3LMMA 2DN0A 2Z33A 4OMZA 4RGGA 3REOA 1SLCA 3HIFA 1OOPA 2P5LC 5DCMB 1VQ7I 2ZX4A 1MS4A 5AFEA 2YDEA 1UPSA 3DUIA 1WMXA 1I5PA 5LATA 1F5FA 2ATFA 3T3YA 5L9VA 4PSXA 4NIHA 3BR3A 3VZKA 1XOYA 3UKNA 5ACA1 3MZYA 1TEIA 4O3MA 1DDNA 2M2EA 1DQ1A 1APNA 2R7ZJ 4OIPF 4B1MA 5A6XA 4XBFA 1W8WA 5GZDA 4MIMA 1SC7A 1HXDA 3D0JA 2M8GX 4O6JA 2IWGB 3WNPA 3SCFA 1U8BA 3WODF 1LEAA 3VDDB 4AFDA 3NARA 1DP0A 1TNFA 3RDIA 1JN2P 1RUOA 4BQOA 2V9VA 2Q5TA 5GPAA 3ZMSA 4IHYA 4D6SA 3HPNA 3ZIXA 4AVVA 3HDDA 2M7AA 2ELKA 2J1VA 2LS6A 1AYN3 3KYDB 3BJAA 2Q0OA 2ZMEC 3JCIA 1V6KA 2LH9A 3E5UA 3T4HB 3IAQA 1POQA 1VLNA 4IHXA 1VBC2 3DPRA 3H1WA 2WBMA 5K4LA 1E5IA 4B8EA 4LKEA 1CZTA 5E8GA 2W92A 3SNMA 5BNOB 1WGPA 2ZGNA 2XR4A 1VQKI 4DXRA 1DP3A 1N3PA 1ZZ9A 1GWKA 2WNUB 4LO8A 5LFAA 2R32A 1C1LA 4C0BA 4D6QA 3BWGA 4DIQA 5HV0A 2GC2A 1LOBA 3JRAA 2ZGLA 1QQIA 2PHFA 3SKVA 5IK7A 3COAC 2GSYA 3WG4A 1BCXA 4XUQA 4RGXA 3DWLE 3CD6I 1HDPA 2EFQA 3A01A 1APLC 5ISLA 3UESA 2HWF2 3M1EA 1KONA 5FPVA 1W6PB 3WU1B 1RUG1 1PGL1 2HKXA 2GLOA 3WGIA 4A0XA 4OQ8A 5DAVA 2VCBA 3BKZA 3HQXA 3U11A 2R073 4CZSA 4KMUX 3TEDA 4ABZA 1F5TA 5C3RA 4BQWA 2E26A 1BMV1 4XTMA 3ML6A 3PNTA 1RHI1 5BPDA 3SDGA 4QWQA 3A4CA 4OCTA 3KP4A 4ZKTB 2BV4A 5C9AB 4HLXA 5DCFA 1VQ6I 5LY2A 3R6SA 1KGYA 1SDWA 4XFIA 1MH3A 3UR3C 1FEXA 4QDQA 4N9HA 4GD4A 4I0BA 1IZ3A 4MUVA 3AXDA 4DUXA 2E19A 1JU3A 1VBE2 1RJ7A 2OZUA 2WRAA 2ZGKA 4BLJA 1I6XA 2UV1A 2LK2A 2UYBA 2D6MA 3A0NA 1V6MA 2PX9A 4ZTFA 2DUQA 2EA7A 4ZDPA 2QZ3A 2PMZA 5FKCA 1Y8QB 2EAKA 3LSRA 1ZBE1 1JKRC 3O5SA 1AR93 5IUQA 5HNFA 4RGKA 2DMPA 5I0RA 4MFEA 5EEGA 3PVEA 3PUIA 4M9XA 1JOPA 4G7HF 1SACA 2HWE3 4B4RA 3MIDA 1KJLA 2FBKA 1YEWA 4DYQA 4NC6A 3TO7A 4P55A 2B63J 2Q8EA 4ZY9A 4HXCA 4HX8A 4F83A 4LKSA 3S5QA 1CR7A 1GKBA 1R22A 3LSDA 4A3IJ 2DXIA 5CEHA 5HCBA 4QTRA 4QPIA 5IT9K 1G4DA 5JZGC 1QHHD 3DKWA 3SH5A 1WLTA 3LFMA 3PNAA 2JG8C 4JX0A 2JA2A 2C26A 1HRI1 3LL7A 2JG9B 3WDVA 3S2WA 4YW6A 2PA7A 3RMXA 1FT9A 1W7PD 1IV6A 3WNLA 4DRRA 3DEUA 3OTFA 1HRV1 1LGBA 5FO7B 5ICCA 4XOPA 5CA6A 3WG7H 2BJSA 2LY1A 3AG4H 1SLAA 1U5IA 2ZHLA 5CFCA 5FZ3A 4HETA 4MADA 1SFNA 5HXMA 3WQ7A 4XLCA 3V0AB 3LIHA 1NCQA 2G19A 3H8XA 1ETYA 2EA2A 3ZQLA 4HSJA 2ZGSA 2IA0A 1Y1WJ 4HYEA 4JTOA 1I3AA 5LA1A 2CHHA 2ILMA 5H9QA 5IYDJ 1S4CA 3MKLA 1ULYA 3VBUA 4XKVA 1FTTA 3TNPB 4ZZDA 2E9QA 4G8XA 2G1MA 2LLKA 1H1IA 2DF7A 4ZZ8A 2RS32 3CO2A 5ILUA 3PM1A 1O3TA 1W2UA 1BC8C 2X6OA 3GZEA 2SLIA 4L97A 5I8TA 3H35A 1QDOA 2DFCA 2FDKA 2KXLA 5EGOB 2Q8CA 1WJFA 4BXFA 4CEWC 2KJCA 2LM3A 5KAFC 4IW3A 1SLIA 1DPRA 1X3ZB 2CFOA 1NCRC 1G6NA 4AQTA 2LYCA 3I2OA 5LGTA 5GADJ 2E33A 1UL9A 3ULQB 1AL0G 2EPFA 3JTGA 3KT1A 3ZQ7A 2VOTA 4AAPA 2VC1A 4OLLA 2FZ1A 2GNBA 3ZSEA 1NLQA 2QSGX 5FMBA 4IF4A 1T98A 3CF6E 1KYZA 2KL4A 5BY5A 4U0VA 4PIZA 5FYZA 2XF5A 2OJED 1OCTC 2SBAA 3WE3A 5DN2A 4AEJA 3IDCB 4IESA 4AEDC 5FXXA 2GDFA 1BI3A 4DS0A 1QQP3 1ZN2A 2DQRA 3I4NJ 2ESNA 5HNHA 2NPIA 3KEOA 5DUUA 2F5CA 3FMGA 4XZPA 2RS53 3NWSA 3H7YA 3OUJA 3M7GA 4NDLA 1CAWB 1MKMA 1VQ5I 4HG2A 3JB8A 3MVPA 2OUMA 3T08A 5E8AA 1TBXA 4B09A 1IW7F 4G12A 4RSUA 2P4EA 3P7NA 1CQ9A 4A3FJ 1W36D 2BUKA 1BR2A 3HL2A 1O7LA 2B8MA 1I6HJ 3LOBA 2IXLA 4YFKF 1EF4A 3CEWA 3OYCA 4ENKA 3J80Z 1FBUA 2HWD1 1EAH3 4S04A 5DUIA 2W2IA 2EV0A 3I97A 2MSYA 4IV3C 1ZG1A 4DO0A 1UOFA 2HS5A 1X58A 3ZN5A 1A34A 1MMGA 2MLGA 2JVGA 2VXDA 4FTHA 4DFSA 1R00A 2A6TA 5FY7A 1R1VA 4PF5A 3O7OA 3WTYC 3SMHA 3TP0A 4Q1PA 3K4KA 2WN3A 4D7SA 3B6AA 4QT6A 5KCMA 3HOYJ 2ZX3A 4DYRA 4QU2A 4U7DA 4NBQA 1Z78A 3V4GA 5FWEA 2YX7A 5A3UA 4I7HA 4K7JA 3VYSB 3Q8BA 2XAQA 4Y3OA 4A44A 1UG0A 2F4MB 1VBC1 3GFLA 5FXVA 3S1MJ 1Z7S3 2OBPA 1YFWA 3HQUA 4HPKA 4BZ4A 2XVLA 3QCWA 3W20A 2BV6A 1RUE1 5IFTA 2CJJA 5L7OA 1XQNA 4FPOB 2CWMA 5C3QA 3QPHA 5C44J 2W00A 5EQUA 5A7WA 3V8LA 3NJYA 4JP0A 2W52A 5CU1A 5HBAA 3U0ZA 1SLTA 2KIFA 1G3YA 2UU8A 2V4VA 2BY1A 5E89A 3SEZA 4XEZA 3ELKA 3PUBA 1FNYA 2BW3B 2HWF1 5AIPA 2Q1ZB 4NHLA 2K3FA 3SFZA 4ENNA 5CJ9A 3JR9A 1L3JA 5FOBB 5FRMA 1ZZBA 2M8EA 3S1RJ 4S2HA 3HB9A 1YW8A 4RAGA 1ASJ2 2JA6J 1JT0A 4D5FA 5EPAA 1WA6X 2KT0A 3DEWA 5HDKA 3W6VA 1ZG5A 1HKTA 3UGFA 4BQ2A 2D5FA 1BN5A 1OSGA 4SLIA 4UB8C 2A3WA 3M8LA 2WZ8A 2P3IA 1LFPA 1WH7A 3R0RA 1ZX5A 2XJRA 3ZQGA 1W6QB 4CP1A 5BNNB 2BQPA 2JZYA 2DI3A 5FB2A 4W65A 3JXSA 2O3FA 1XB4A 1C1FA 5CPRB 4QU1A 2FDGA 5G05L 1ZAOA 5F5CA 3ZQIA 1D8JA 4HV6A 5K0UA 1D0YA 3ECHA 3S3OA 1UY2A 1BXHA 3H1CA 2WJSA 2OTLI 5LHIA 2BNOA 4A45A 4EVIA 1JYCA 1URXA 1AKHB 1ULEA 3Q3SA 3B69A 4IEZA 3F6OA 4NWWA 1WJBA 1K6YA 5ANQA 2JDNA 5JZGB 1Z0XA 1B72B 3AL5A 2BYVE 4JVAA 3VHOA 4ZS2A 1LPQA 5FUNA 4XOGA 2WC2A 2XJSA 3UKVA 1PMJX 2XQXA 4UUSB 4HFSA 3FF5A 5BNGA 1OCPA 4HEA2 1BHGA 1PGSA 4HVQA 4BWOA 5DUKA 3BTJA 3AP6A 1FBQA 2BEOA 2Y6HA 2HPIA 1A8DA 4Q4V1 3LA7A 3EJKA 1HXS2 4IRGA 1R36A 1CIWA 1HC8A 3OIPA 1WI9A 1ST8A 2RMU3 3DPTA 3DPUA 2DO7A 3HZJA 3FHIB 3M8JA 3O1MA 3ISPA 2LSOA 4BE2A 5GZEA 3VZOA 1OLRA 4KJZA 3WTZA 2X09A 2Z5WA 1RB8G 1ND3C 5FRNA 3AB0A 2Z5UA 2FE3A 4X6AJ 2GM4A 1AL22 4OI2A 2QQNA 3UT0A 5F37A 2P6TA 2VJ4A 3LEMA 5FQ0A 1BYHA 3OL4A 4P9LA 5FP9A 5FD6A 3WTWC 1UY0A 4HF2A 2X5IA 1BM9A 1UZ0A 1N1YA 2FDHA 2AGSA 1PVC2 3NL1A 4LIVA 2Z4FA 1OR7C 1Y9QA 3ZN6B 3OIQA 4CEWB 4RGUA 2JD9A 4IUGA 4AD9A 2FJ1A 3ZXDA 4RHV2 2RS31 1NCRB 2QLZA 1I39A 2GNTA 3K1MA 2IAIA 5GPCA 3WEZA 3H5NA 2L9NA 4FX4A 5L9BA 1Z7LA 3BTIA 2ISYA 4QXBA 3FWEA 1OA3A 2L9RA 4PCQA 3CCQI 2BPA2 3HGGA 5TSWA 3G1OA 1ZRDA 2EJRA 2PFBA 2W94A 2DAOA 3C1DA 3SJMA 4ARYA 2JDMA 4Z82A 4X8PA 3J7NA 5FYBA 1MDMA 4U7BA 1YOVB 5DS9A 4IEVA 3PFYA 3WT3A 3I7DA 1F4AA 1BJQA 3KYLA 5FYIA 1ENRA 5FZ1A 3ZMVA 3PL0A 1MNDA 1DGWA 2JSCA 2KMUA 5FLXZ 1ON1A 3RKXA 5BPIA 5JXHA 3ZXEA 1JHFA 1R1TA 5JPMB 1LFUP 5E20A 3AYEA 4L2NA 1V00A 4XLHA 3LAGA 1LQ1A 1LOCA 5L3BA 3K4BA 1FPN2 3LQRA 3LQCA 4YWAA 3BR0A 1WCKA 2J1SA 3HHHA 1TME2 1GP5A 4IOCF 4QGMA 2VMFA 2TEPA 1BW5A 1OLMA 3DLLF 4J1XA 4C2MJ 3CBNA 4EJWA 3CKHA 2V72A 5DXDA 1FOD2 3HGYA 4IV1C 5EYXA 5M5WJ 4EM1A 4WM8C 3AXEA 4QHOA 4NQWB 4Y52J 4YM1A 2VH9A 2CGOA 1N78A 2VKEA 2HZDA 1KS4A 2PJRA 1YLLA 4XN3A 5A3MA 1JGSA 1UOBA 2XUMA 1G86A 4Z2YA 1ZA7A 1XE0A 5CBLA 4HKLA 3KZIC 4L11A 3EDPA 1ZH5A 4KWJA 3LQQA 1QXRA 2EICA 5A3OA 3TW6A 4II3A 3POFA 2W82A 5FZMA 3RI4A 1WZ2A 4AC0A 5DZEA 5T54A 1ZHFA 5BNPA 4EEFG 3OY9A 2P0WA 2OC6A 4M3BA 3MZHA 1C8M3 4AU7A 2PTMA 3FK6A 4ZU5A 2XWBB 1T33A 3AKPA 1YI2I 3CUQB 1TWAJ 4MXWB 5ABJA 4BISA 1EUTA 4W4ZA 5FYCA 4XRSA 1Z7UA 5JSRA 2ZACA 2B39A 1S0FA 3TRSB 4AYBN 4NN0A 3LSGA 4H2AA 3AZWA 2LF7A 4IE7A 3J80K 3ESWB 5AC92 2YUSA 3CMGA 3VWBA 3K6GA 4IQ4A 3PSFA 2HTSA 5DD4A 3CCLI 4BE1A 3NAPA 4QXCA 2XVGA 2EV5A 2JICA 3IIIA 4X1EA 4WM7C 2X6WA 5K7FA 3A4UA 3PL8A 2HVQA 4QKDA 1LTEA 2R5YB 2WV1A 3U1XA 1US3A 3EUHA 2ETHA 4CA9A 3RPUA 2XB5A 3MIEA 5BUVA 2NS7A 5ILSA 1CAUA 2EF6A 3BOWA 1V6IA 2R7EB 4UY8I 5GAEJ 1MJ9A 2VE1A 2I74A 2RM21 3TDUC 3HUGB 3DYPA 4FSJA 1WLDA 2G7UA 4YW1A 2RVCA 4HLYA 1J9IA 2W68A 1VZ0A 1MS0A 3ZGKA 4P9XA 5FY4A 5H6QA 4AZZA 4FETA 1PM4A 2XSJC 2CS3A 3HSEA 1YO5C 2B4KA 1X1PA 5LHHA 1TNTA 3SXWA 4B7KA 1POV1 3TBDA 5IP7J 4V2VA 4FISA 1X82A 1PHMA 3BGAA 2ACJA 3U1DA 2V4JC 3DN7A 3BDDA 3I4IA 1IPSA 1ASJ1 3L2QA 4Y17A 4NPMA 5EIYB 4NRQA 1EV12 1ND2A 4QKBA 3A7QA 1Z6TA 4XRSG 3JD71 1B9NA 1JI6A 4YVWA 1QHDA 4OMYA 4QHZA 4BACA 2GC1A 1OFNA 1Y1VJ 2OU2A 4UVBA 3AMNA 1G3WA 1MBKA 5FZOA 1XX5A 2WADA 3FFZA 3PIPF 1YX3A 4IKFA 1Y7BA 5IYBJ 1EH6A 2BNMA 3POJA 2ID6A 4FI9A 1QXJA 1MJBA 1JMUB 3QYEA 2VJJA 5GZFA 1GP6A 4Y20A 2A6HF 1VMFA 1K42A 3ZFGC 4O9GA 3GTLJ 3OOUA 3JRHA 4LB6B 1CIYA 4P9IA 4QXHA 4QIWN 3URFA 3FFQA 5GLTA 5CFDC 3IM0A 1D4M2 5D5WB 3CF2A 5C8CA 2VCMA 4PQ9A 1AR71 3CCEI 1E3OC 2HYXA 2XVCA 3EPZA 4F7ZA 2OA2A 4MGIE 3PU8A 1KQ9A 1OPMA 4UXNA 4XW3A 2VUCA 3BG3A 3T2OA 3WW3A 4FPLA 2OT7A 1NX9A 3O8HA 2WFPA 4YZ5A 1LOGA 3HXLA 4UF0A 4QLCU 3BZ6A 3MIHA 5C3EJ 2E71A 4MEYF 4AQ6A 2D44A 3K69A 1RUF1 2ETEA 4ZU4A 4YPJA 1HB1A 3RJ2X 3GXOA 1PMHX 4II2A 5B3SH 5A3NA 2A75A 3H3LA 3LPFA 1JTXA 1XS9A 4A6DA 5A3TA 1ND3B 4CPBD 3OIOA 4E7JA 1MQTB 4PCRA 1W6OA 4N43B 4DGWB 3POBA 1JGGA 1SD6A 4BK5A 5FV3A 4FP3A 3CMMA 1HXS1 1ERDA 1IS6A 4OZOA 3ALQA 2DMUA 2EK5A 2XASA 4IE0A 5C4JJ 1UU6A 3NV4A 4R9AA 2YU1A 3S14J 1D7PM 1ORKA 4XM3A 2R1DA 3N7LA 2PFWA 3R4DB 4P9JA 5GP9A 1C8NA 5C3PA 4OI1A 4QX8A 4K1YA 2D3RA 2TBVA 4AI1A 3OUHA 5L3CA 4A7ZA 1EPWA 5HLTA 3S1NJ 2M0MA 4XK4A 2CFXA 4Q5SF 3OOPA 1YC61 2QWWA 4HF0A 2D3SA 4CU6A 5LGNA 2K5CA 4KUMA 3I64A 1PVC1 3OY8A 1LHNA 3GHNA 2VONA 5FIXA 2A7AA 1JOJA 5DAQA 1SHWB 4WX9A 1NLSA 3GJAA 2R043 4XQWA 3VDDA 4AVCA 3C8XA 1VBB2 3WDYA 3ZYBA 4LG0B 3NJVA 1DQ5A 4LBMA 3TNQA 2EFPA 1J75A 1PUFB 5FY1A 1JYVA 2HOSA 4OI4A 1MSFC 1ZREA 3IKTA 3OGVA 2BBVA 2WAEA 3RKYA 1GT0C 1OI6A 2DFBA 2K40A 1H30A 4PK4A 1TW2A 4DEVA 3KPHA 2VZ1A 2W1WA 2DQLA 3MZ8A 1J0RA 1OT5A 3ZSJA 1AXYA 4PBPA 2WYFA 3VYRB 3UKGA 2JMWA 3UJOA 2IGNA 1QNWA 3WHUA 3FK7A 4RQPC 2A05A 4QXKA 4CCDA 5F2SA 2IS1A 1QJY1 4IDZA 4PJLA 5K5QA 4I02A 1AR63 4KN7X 5CZKA 1TME1 2ZGPA 3MDPA 3GFMA 1GANA 2ORXA 3VZMA 1WA4A 1OF3A 4MVTA 3BT9A 3DL3A 1A6QA 4WV8A 4HX4A 1LR5A 3N05A 1C5IA 3USUB 1UHWA 5HCAA 4YZ2A 2ZGUA 3H7JA 1I3HA 5FLXK 2XSDC 2IP2A 5E1RA 4LK7A 3RSNA 2OQGA 4YIRX 2VMEA 1ETXA 1TWCJ 1RVF3 3HOBA 1CESA 3ON7A 2CGNA 3SZGA 2JEMA 4GB33 2IW5A 1JZ6A 1C28A 1AWCA 1TT0A 4XF4A 2V5YA 4DQAA 5J40A 4GFBA 4COUA 2Z16A 2NYXA 1RC6A 1HN1A 4NRMA 1STZA 4EE2A 4BB3A 2XLGA 4I01A 2VBXA 4LNVA 3O14A 1PIV2 3WP3A 1IOAA 3DECA 2HBUA 2MH9A 2JECA 1R58A 1YQ2A 3I4MJ 5DDJ1 4AF9A 2HEYF 5AC91 1TMF3 2PBIA 4INDA 1MZBA 1X7NA 4YYOA 3VYUB 3GFJA 3CJRB 1GNZA 2VXZA 5HXVA 1OISA 1JZ4A 2XF6A 2QA4I 4IQJA 3BR2A 4WVMA 1XGSA 1DZTA 5D2AA 5J4VA 2PQSA 4JV4A 1V9U2 4JC1A 5A2QZ 2PAEA 1H0MA 1COV3 2PHUA 2MD5A 4XF1A 2HI3A 1J09A 4L92A 3D82A 4EV0A 1H9TA 1U5ZA 3HJRA 5CVRA 2HZTA 4URAA 4YEJA 4BAYA 1S29A 1D5YA 3O12A 1UQXA 2ZC2A 4PJMA 2JTVA 3TEZA 4X8NA 3ABKH 4UV8A 5C3SA 3HN3A 2K4JA 1WW5A 3S15J 3OS0A 3PMEA 5L19A 1O8SA 4BPZA 4P96A 4KG0A 5KHGA 1NAEA 1BBYA 3FUOA 3HT2A 2AXTC 1E57A 1W3XA 2JG9A 1IN4A 4TXWA 2A71A 1QGLA 4K3UA 4CZZA 2VBYA 2F4OB 4LO5B 1K4SA 4BQNA 3I49A 2A6WA 4CCLA 5EJ1B 4MYEA 4LITA 2P6HA 5IP6A 2VUMJ 3C7HA 1R23A 1YIJI 4TV7A 4Q0SA 4XC9A 3ZIWA 4HBLA 3V0AA 5JR3A 2DJNA 3OPWA 4GMP1 3ZFGB 4JYKA 4XAEA 3DKQA 3QD6A 4MGQA 2WFF3 2MEV3 1TW3A 4QPGA 4WVWA 3VZJA 1A3KA 3IDEA 3CO6C 4BGDA 4Q29A 2VE8A 1X8MA 4F3QA 3KF3A 2P4WA 1PK6C 1ONAA 4JGZC 4MGZE 4JCKA 1BW6A 3V56A 1UZYA 3L9JT 2P8TA 3GEZA 3CO7C 3WW4A 4YNIA 2B42B 4FBFA 2F4LA 5E1ZB 5A6ZA 1D4M1 4DNYA 2L01A 2L5QA 3E5XA 3GTPJ 3ZP5A 3LGRA 2E60A 2DDBA 4PJYA 1CPNA 2Q4SA 4MV2A 2PLV1 4GH4C 3ZDVA 2VKDA 3X2QH 2HWB3 1LGNA 2Q8OA 4GXOA 3UGHA 2H1KA 1XCVA 4MGRA 3FIWA 4M74A 3U4XA 1H8AC 3W5MA 1J84A 1KU2A 2Z3YA 5JSOA 5JHFA 3CCVI 5M3FJ 2ZJPF 2ZBKA 3HEFA 4N90A 4Y24A 3KP6A 4UUTA 3T2QA 4GWNA 1UZVA 4GIQA 2CQQA 1XGNA 2PMZN 3DLAA 4AHXA 3GO5A 5FFOC 1UNBA 3OBTA 4MGSA 3APBA 3U2RA 4Q4Y3 1MZEA 2BDRA 2MW8A 2L7KA 2EIEA 1AYN2 3Q5FA 3OYGA 3INAA 3ZR6A 4M3CE 4BA6A 1A6IA 1S55A 4IRHA 2WO3A 3JAMZ 2CUJA 5KHKA 3G71I 1SFUA 4DYCA 4ON0A 2RDPA 2RJLA 3ILNA 4A7KA 2B9SA 2UXXA 1AJOA 3BJOA 2R92J 4MLOA 2X8KA 2RKHA 1I5ZA 5A3LA 4CCJA 2ZGMA 3V8KA 1UZZA 2VL4A 4ZH4F 5F6FA 4GCVA 3MFCA 3GYHX 1FOWA 3J81Z 4CDQC 5F5AA 1FXZA 1PP7U 2VKHA 3LE0A 4KT6A 3LD8A 3ST7A 3QH6A 2EB7A 2AXLA 4UYBA 1ETKA 2EZHA 5D5VB 1ZZ8A 3Q9OA 3I3DA 4FOVA 2ZJCA 3FBYA 1MACA 3FHAA 2R7QA 3R0AA 4BU2A 3OPTA 1GLHA 3WP4A 3O2PE 3I58A 2X9DA 2WS91 1MNMC 3W6KB 1H8VA 1DLCA 2HQAA 5C33A 5D8KB 1GUUA 4CDWB 1YE9A 3CJTB 4E8CA 3HPHA 3T0DA 1FPQA 3A02A 1K6OA 3I53A 3S93A 3ZXAC 2LW8A 2R072 3NNJA 1XPWA 1W4MA 4AFMA 1W0NA 3O1UA 4IHTA 4MXVA 2RQQA 4RQPB 4UT5A 3ZO0B 2HOAA 2VTXJ 2RG4A 2Q8DA 4OUEA 4QSHA 5LBQA 3GTJJ 1W6NB 1Z77A 3O0VA 3NNFA 3BPVA 2CW7A 1W06A 2GMEA 4XDQA 4MX3A 1RUI1 4YFXF 4OHXA 4XPVA 1WJ5A 3HEIA 3EYYA 2RNGA 3BLYA 1SPPB 3POWA 4QKNA 5T5JA 1VBD1 5HVQC 4IETA 2OAZA 5H20A 2LALA 2E32A 1JXNA 5EG0A 1OH4A 3VBFC 3GZNB 2CAUA 3BY6A 1R49A 2JA8J 5BXXA 1EKEA 4DW6A 3VL8A 1HSTA 3O1SA 3P9CA 4GDFA 3RZJA 1AR92 1FNZA 2QUOA 3GTOJ 2LG4A 2VBPA 4D5CA 1B1BA 3AYDA 1OCOH 2BW3A 1JKOC 4IGOA 1MS5A 2HWE2 1RKWA 4XE9A 3PUHA 1QXPA 1QJU3 5A70A 5FZBA 1T0FC 4ZS3A 3IRRA 3T09A 3WINE 4BIFA 3D5RC 1DGRN 2KA3A 1N1SA 2LKXA 3HRUA 5FP8A 1GOGA 1MBGA 3I3EA 1LGCA 3M3EA 2O8OA 2X10A 1RUD3 3HTUA 4CGZA 2WZR3 5EF6A 3EXUA 3VBRC 2E7XA 1XC5A 2IPQX 4UVCA 3AL0C 1J5YA 4ISRA 2JWPA 3BPZA 1R9TJ 2XUBA 1F43A 2ZX1A 3Q8CA 4OYUA 2OX0A 4AGGA 5B4XA 3UJQA 2CRGA 3GZTB 1OXCA 2EIGA 4EN7B 1W6QA 2EZLA 3ZN4A 2BBYA 1PIV1 1V6OA 1QH6A 5F7UA 1MH4A 1XTAA 3DU5A 1WPKA 4XLPF 3ZYGA 2P17A 2HWVA 2YU9J 4BH9A 4Q5OA 2VASA 1WW4A 1LOEA 4PZJA 1AKHA 1R1A3 4TLGA 4C3HJ 4KQ7A 1UHSA 1NE6A 1WWYA 2VNRA 1SVMA 3U78A 5GLUA 2JENA 3K77A 5JZGA 1B72A 1NA1C 1GZTA 4L9TA 5HCFA 5C3OA 5D4SA 2D1HA 1V9U1 2EIBA 4M00A 2JSPA 1O5UA 3N36A 4J25A 3J8F3 2JG8A 4ESBA 1VMHA 4UUSA 3TW7A 4I3PA 1W0TA 5IVCA 3ZR8X 1VQ4I 4IXAA 4FX0A 1DQ6A 4KG8A 2PI0A 1VB2A 4ETSA 4LJHA 3LSEA 3N7KA 1HJGA 2ERFA 1T2XA 2HWC1 1FMD1 5JDBA 2A3SA 1SEFA 2O8XA 1E5SA 2WAQN 1LDKB 1Q1VA 5F8PA 3KX2A 4M9SA 1AA7A 4Q1RA 2Y6FA 3VKMA 5D5XB 4LLNA 4K21A 5A2QK 3IHUA 1V3FA 2FUG2 2DCYA 3JRGA 2Y6KA 1MIJA 4IEJA 1QWRA 1PK6B 4J1WA 4BMBA 1JKQC 4F8AA 4M3CB 4JGZB 1XMKA 4UBGA 1KRIA 5B66C 1LFBA 1IRGA 1W9TA 3U1KA 2XPWA 3BCAA 4A7YA 2FQ4A 1P6RA 1FX5A 3BTAA 3FHQA 1NE4A 5D1IA 3ZN6A 1PO13 4CEWA 4META 1YXWA 1HA8A 3HOSA 2CV2A 4F55A 3G2BA 1G3SA 4MHRA 1BI1A 5HODA 1NCRA 1QQP2 5D8LB 3OJBA 2D93A 3IPVB 4OULA 4O5VA 1KJRA 3DXTA 4N9IA 2RS52 1POV0 2XROA 4GO1A 3QACA 2Y0IA 2X1EA 1G9AA 3OD0A 1RC9A 1ZGWA 4CP9B 2XHNA 4OOIA 4E7ZA 3OGGA 4HNVA 4XJZA 1JZ5A 3E7LA 2RS13 4G3YC 1PGW2 2YS9A 5ACA3 2D45A 3G3ZA 1LE8B 1WBLA 3WP5A 5K5OA 3MW3A 3AFGA 2K9SA 1T2KA 2KZGA 1QKQA 3BOQA 1FYMA 1L7RA 2H0BA 4LBQB 3CCYA 1UMQA 1YJWI 3VEPA 1EAH2 2LY2A 4M6YA 2DCEA 2JN6A 2QTWB 1V5GA 2EIJH 3K1NA 3GZ5A 4AEDA 5EEHA 4BNCA 2QCSB 3QU6A 2AR6A 3ASIA 1ZYBA 3MPBA 2UWMA 2VBWA 2ZFWA 1SANA 5IT6A 2FD5A 1TVGA 4R9DA 4AQSA 1WLWA 3R4SA 1M1EB 1Y39A 3CJIC 4IEUA 4A3XA 2QZ8A 3EQEA 3KMHA 4G94A 1AYN1 3KF5A 5LCWL 3PMSA 5FKMA 2ZA9A 5JOWA 5JI9A 4XVHA 4ZDOA 3OD4A 5KBFA 1EP0A 2IXIA 5BV6A 3HJEA 4IV3A 1A5JA 3DEMA 1Z7S2 4YGBA 1K12A 1FX7A 2NMNA 4MO3M 1GXQA 1LAJA 4RHV3 2AC1A 2FMLA 2BWCA 3ZXGA 1RUJ1 2GP5A 1QJX3 2W5FA 4XAAA 2R5ZB 3S2HJ 4DOZA 3RKQA 2HQRA 3Q0UA 1B8IB 3JAMK 2BXZA 2L0KA 3MUY1 5KXEA 3BR5A 3JRFA 1MVQA 5HDNA 3S2DJ 4QX5A 4QB6A 2K2SA 2R0FA 3W59A 1T56A 4CU7A 3I9V2 1UX7A 1Z05A 2VZ3A 4A3DJ 4MFDA 5CKQA 2HOEA 3J81K 2JK3A 4PBOA 1DDLA 1RHI3 4E4HA 3QYBA 2D40A 2FNAA 1B35C 1U78A 3WTSC 4JZRA 2WNVB 2UZKA 3VBFB 3KEQA 1RIRA 3RZGA 1FPN3 5CYVA 4QDRA 5D8AB 3M4OJ 1REEA 2V9KA 3V65A 3LB9A 2YBKA 2GAUA 4XORA 2IUWA 3MO4A 2MFZA 2R5YA 1FV2A 2D2WA 2DVDA 2L7ZA 3KT7A 3CHXA 1SFKA 4P02B 4ZYAA 3K1PA 4PGHA 3F8NA 5B1BH 3HOUJ 1CZSA 4TTGA 4ZPIA 3SLIA 2GA1A 1SD4A 2VNVA 3WUDA 1VI0A 3HUGA 4I0WB 3MBWA 4PDWC 1BR1A 2C5DA 2WT2A 2R0HA 2UUZA 3I5UA 1AR91 1UFMA 2YXSA 2XG3A 4XKBA 1X2MA 1UF2C 3OSDA 3VBRB 1K5MC 1YQ5A 3GCXA 5I0UA 4RA0A 2O0YA 1SDDB 2ZKZA 1TLHB 2XAHA 1OYWA 2X29A 3L7WA 3VV1A 1A8MA 4H55A 4P5YA 3ZXSA 4C90A 2GN3A 1FP1D 1E17A 3HYIA 1PO23 3I3MA 1OC1A 5FMDA 2PHTA 1XU2A 2W1QA 2DYSH 4H0EA 4QX0A 3DYOA 3ZM8A 4Z07A 4AQ2A 4F92B 4Q0QA 4Y7NJ 4NIAA 3W6JB 2IA1A 2HOTA 1TWFJ 1A78A 1BR4A 2BY0A 2AREA 2VC0A 2GZWA 1JYTA 5JSPA 3WG9A 1GDTA 3J7MA 2ZXIA 2RMU2 4UV9A 1NG0A 3WF2A 3HVDA 2FU4A 1YHFA 2OXBA 1QF3A 1NA1B 4Z1VA 3NNLA 1R091 2ADUA 5BOXA 4FPFA 3ZYRA 4W1UA 3OYHA 1K61A 1H2KA 1PZ7A 5FZCA 1AZDA 2CU5A 2YY1A 4AEKA 4TYSA 5CKMA 2QQLA 5EYYA 1VQ9I 1HB2A 3MW4A 4LJZF 1DU0A 3M8EA 3C7OA 4NR1A 3V7CA 1NXMA 2F5FA 3CJNA 3R05A 4OMCA 4P1WA 2DUOA 4D0PA 2DVFA 3AYCA 3CQOA 1FP2A 4TWTA 4I99C 3KCXA 3CDLA 3WTTC 2WO2A 3OYKA 3MLLA 3WX5A 5KHHA 3T0YA 2BFUL 1UJ8A 1JUMA 3KV5A 4K9SA 3DEEA 4RR3B 3ZMDA 2CV6A 3ILRA 3O6BB 4XJ8A 1XE8A 1ND3A 5F1JA 2QGUA 1YFYA 1XU1A 3N35A 3BTZA 2OZJA 3K70D 3H8UA 5F1RA 2JVHA 4CHUA 5I93A 2DOAA 2C4XA 4TZDA 2DWRA 1EV13 5A7QA 2DTWA 5JMOA 3E6DA 4LLOA 1WD3A 2HEOA 3CIHA 1CF7B 2L7MP 3OMYA 4BY1J 4Y22A 2WAAA 4XQ4A 5KHDA 4Z2AA 3LEGA 2WIIB 2LF8A 4CU8A 1LKNA 1OR7A 4KISA 3CMEI 4AVPA 5ERLA 4R4ZA 3OCPA 1EJ9A 3EHKA 5FYTA 1PX4A 4P9GA 4G7OF 1PZ8A 3OYDA 4A93J 5D4RA 1X9TA 2X85A 3QP6A 4NHJA 4S2FA 2CO5A 2XH6A 3W2AA 2IXHA 3RS6A 4NO4A 1O3RA 4BQAA 1DBNA 4HA8A 4C2TA 2Z42A 3POGA 4C91A 1R4NB 3LSTA 4HAMA 1CZVA 1H6XA 1P7IA 3GTKJ 2QQWA 1ALYA 2DOFA 3JSPA 2E7TA 1NG6A 1L7LA 4EM2A 4E2GA 1R1ZA 3HNYM 4LG0A 1HLCA 3AKSA 5CQEA 1CD3G 1YQ6A 2F4IA 5C8WA 2CUEA 2ZMNA 3VD7A 3JSOA 2XPUA 3FL7A 3I2IA 3J7HA 3CU7A 2HTJA 5HS8A 5FGMA 2HWD3 3RZLA 1UAIA 4H14A 1Q8QA 3MICA 1QJFA 2LUWA 2OD5A 3GTGJ 4YRVA 5A1FA 4GMP0 3WQ0A 3GF6A 1EAH1 4JDNA 4NIIA 4KGGA 2VMHA 4L18B 4ZC3A 2E1CA 4LOTA 2OKXA 2FDJA 1D2QA 3QPLA 3AP9A 4EROA 4LTAA 3AG3H 2VJIA 5AONA 1GOHA 3LAJA 4MTEA 4Q47A 2GN7A 2ZGOA 4CYDA 5A32A 1N3OA 3HMYA 1GXPA 5GLZA 1C8M2 3TN91 2E2IJ 4IV1A 3KP7A 4KBBA 3CP2A 3AL6A 4WM8A 2XPVA 1QY4A 3DP7A 1XD7A 1RUH3 2J22A 3L2YA 5FK7A 3GZ6A 2RR13 4U88A 1XXNA 5FYUA 3CP8A 4D1QA 5FZ9A 4ZJZA 4Y5Z0 5DTDA 3B01A 4YGDA 3THTA 2VQUA 5DZGA 2JX9A 3ZFFC 4DUVA 3K4JA 5IK8A 3P5JA 3ROUA 3U75A 3USUA 4OVEA 1Z7S1 4R9BA 5HCHA 5L9RA 3E6BA 2J42A 2UY9A 1AU7A 5BNOC 1ETOA 3ABZA 4A3GJ 4Q27A 9ANTA 3EO6A 3KGZA 4FPJA 1C4RA 2ZXWH 3IDAA 5FJHA 2WNUC 3GVAA 5DMYA 3C3VA 4JAAA 1YI9A 1ZRRA 4Y1VA 4XCAA 2WABA 3R60A 1DQUA 1F9KA 2WB1A 5DAPA 2MA3A 2VGDA 4DQ2A 4RB1A 3EB7A 1QA6A 5FZ8A 1WJCA 5FTTC 1B35B 1PX3A 4V19K 4WM7A 2E1NA 1OQYA 4E9KA 1NK3P 4K8RB 2JB4A 3BZCA 1NY72 1DQ4A 3H92A 2BVMA 2ZNYA 4AYUA 1NT0A 1LVKA 4RLFA 5JOXA 5E3MA 2XOMA 2W85A 2KHMA 1GU3A 2YMZA 5CLSA 5KHIA 2P5VA 3ERMA 1KA8A 1OA4A 4A3KJ 1DIWA 1IQAA 3N7JA 3CNAA 2XUEA 5M5YJ 1R083 5EV7A 2VU9A 5ANNA 3FJSA 2JE8A 1Q8OA 5C9AC 2R3SA 4EYUA 5IAXA 3AG1H 1QZEA 2O8QA 3JTHA 5FPLA 1WBFA 1U12A 4FPKA 3BVCA 5B5EC 4KNYA 5IT9Z 2EA4A 3HPGA 3CCUI