1J59A

Catabolite gene activator protein (cap)/dna complex + adenosine-3',5'-cyclic-monophosphate
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
199
structure length
199
Chain Sequence
PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation/dna
molecule keywords 5'-D(*GP*CP*GP*AP*AP*AP*AP*GP*TP*GP*TP*GP*AP*C)-3'
publication title Structure of the CAP-DNA complex at 2.5 angstroms resolution: a complete picture of the protein-DNA interface.
pubmed doi rcsb
source organism Escherichia coli
total genus 53
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1j59A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1j59A01
3RDIA 2IW5A 1P4XA 1R22A 3E6BA 2HEOA 5FGMA 2PHDA 4I2OA 4BXUA 4KYWA 5CADA 3HTUA 1UFMA 3SHRA 1JHHA 4EV0A 2P5LC 2JTVA 1MJAA 4LD5A 2B0LA 3CLOA 4EM2A 2WTEA 1RZ4A 4YFXF 5LHIA 4GCVA 4E2QA 1KYZA 4UV9A 3BB6A 2BYVE 3NKTA 2IA1A 2P6TA 5DCMA 1TQ5A 3SCFA 2ZO4A 3BALA 3HTSB 2MC3A 4ENJA 4GO1A 2FXAA 1FOKA 3GFJA 4PIXA 3WU0A 2OBPA 1NZCA 4F8AA 1LEBA 4MGRA 3GFLA 1XSDA 4G8XA 4B8XA 5FDBA 3SZTA 5BY5A 2F5FA 2FOKA 3FXRA 4UV8A 4B09A 3E5UA 1QZZA 5HI0A 5HOOA 2FA5A 3KZZA 3F21A 4NVPA 3CF6E 3TKYA 3ECOA 4HLTA 1UD1A 1CAVA 3GBFA 3ELNA 1I1SA 4AVPA 1C0WA 2P7CB 3TDZC 3LSTA 4ENKA 2NRAC 1O5LA 1R23A 3FX3A 1NE4A 1Q1HA 3UKTA 4P9UA 4Z2YA 1F5TA 3K69A 2KXLA 5FPXA 5LLQA 5LGTA 3IRRA 2PMUA 4XETA 2RKHA 3J81K 5E17F 1SFNA 4ZU4A 2YX4A 2HOEA 3GLXA 1PM7A 2K9ZA 1QNTA 5JR3A 3GFIA 2X4HA 1LRHA 4U0YA 4R79A 2B8MA 2EA4A 1VTNC 6PAXA 2Q1ZB 5EFUA 3MZYA 1FLIA 1LKNA 4IRHA 5I8YA 4E70A 2VOPA 4WX9A 3VOEA 2FBHA 2Z9OA 4L5IA 1SFXA 5JR7B 3ZQ7A 3OGJA 4GYGA 1UCRA 3KP6A 1J7KA 1IF1A 3RI4A 2Y48A 1IN8A 4ZYGA 4U7BA 4CHUA 3RKXA 1TNSA 3FM5A 3F8MA 1FBUA 5I0TA 5TRDA 4M74A 3F72A 2HDCA 5K5OA 3SFZA 3VEPA 1TQIA 1YUDA 5K5RA 2VBZA 1R1VA 3CEWA 1T0FA 1FPQA 4UVCA 1ZNPA 2VT3A 2Y75A 1DP7P 5E8GA 4R52A 3E97A 4MGZE 4FX4A 3PQJA 3I53A 3AAFA 2FMYA 1O7FA 3ELKA 4G6QA 4ZU7A 2DW4A 3IRQA 3SXWA 1Z1DA 2Z5UA 2H6BA 3I64A 1MDMA 3NVCA 2LSOA 4NQWA 3WGHA 2PI0A 2PAEA 4LG0A 4QGLA 4NHJA 2MA3A 3FMQA 3GEZA 1HBXG 2PEXA 5BPIA 2ET1A 2DO7A 1ULYA 5CU1A 2IT0A 1IN5A 4O6JA 3RYPA 4EVIA 3DKWA 2PQ8A 4EWAA 3RPQA 3SHFA 1DGWA 4E2SA 3KFWX 2HTJA 3KP7A 4L5JA 2PN6A 1ZH5A 2FBKA 4PIYA 1R36A 1UPIA 5JHUA 3WGIA 4YRDA 3ROUA 2GC1A 4EROA 3KP2A 3BCWA 4RGRA 2PTMA 4HA8A 2FU4A 2F2EA 1BM9A 4M9XA 5HVQC 2GXBA 2JPCA 2DPDA 1UCXA 4ORFA 4Q48A 3WW2A 5AIPA 1KU2A 1AOYA 2GZWA 1GXQA 4MGKE 5FD6A 3H3UA 2EFWA 3M3IA 4MEYF 1WRJA 3FMSA 1KQ9A 1X7NA 5E8IA 1YFXA 1LDDA 3CLPA 4LLLA 2DQLA 1ZLKA 1MJBA 1J3RA 3IC7A 1Z9CA 1KU9A 1REPC 5D5UB 3D82A 2ZKLA 2Q2EA 3HQXA 2UXXA 4IF4A 2FNAA 4KFCA 5TJJA 2PJPA 1QXJA 3ZMVA 5FCCA 2VBYA 4JTOA 5HS9A 2GXGA 4ENMA 2VECA 1XGSA 5HS8A 3EJKA 1GXPA 5H20A 2BBYA 4M71A 3FXUA 4XBFA 1I1GA 1J9IA 5KVRA 3E5QA 3RIRA 4Y15A 3WTZA 2PA7A 4EQQA 3ZPLA 3T8TA 4Q4ZF 1EH6A 3EHKA 1OI6A 3WTYC 1PUEE 2QVSB 3M1EA 3ZMSA 2QBYB 4RAZA 4LLGF 2FQPA 4M9SA 1YO5C 1W5TA 3O14A 2G7HA 1OYIA 5AVPA 2ELHA 3F8CA 3LWCA 4O3MA 2QQBA 3NL1A 3LFKA 5D1IA 1G3WA 3LAGA 4IEUA 2ZMEB 4RS8A 2A6EF 3BROA 2WV0A 2CAUA 2A07F 1FC3A 2JZYA 2DU9A 4J1XA 1YFWA 3K2ZA 1U2WA 1ZZCA 1SMTA 1R58A 4MQVA 5FB2A 1CAWB 4KIBA 5LHHA 4HN1A 3KP4A 3UKNA 3TQNA 4HVRA 1Z6TA 4IXAA 1ZN2A 1K79A 2O8QA 1XN7A 5I8SA 4TLFA 4Y13A 4OMYA 3EYYA 1YFUA 4META 4FBFA 1R1UA 3J7AO 3EO6A 1Q5OA 2EWNA 5JVTA 1YW7A 5DV5A 3ZN0A 4XFGA 5K1YA 2W84A 3I59A 2EFNA 2QJVA 2Z99A 3MPBA 1H9GA 1J3QA 1H1MA 1UHWA 2A6HF 3IWZA 1FYMA 3WTWC 5I8TA 3TOAA 2R7DA 2O1QA 4IJAA 3ECHA 2C0ZA 3PVBB 2XKOA 4KWKA 2KIMA 2A3SA 4KN4X 2PHLA 1PMIA 1EV7A 4HOBA 3ES1A 4FHTA 1G6NA 2IPQX 3M7GA 1J58A 1OPCA 4IRGA 2VPVA 1WI9A 5DUIA 1SMYF 1RUNA 5K5QA 4L9TA 4RB0A 1KA8A 2EFPA 4HF0A 1YHFA 3CDHA 2P5KA 4IEWA 2PG4A 2E7XA 2X0LA 5CVUA 3HHGA 1DDNA 4WBBA 1YLFA 3IDCB 2OZUA 2ISYA 3JAMK 1ZVFA 1FI2A 4OIOF 4MNUA 4F7ZA 3QPTA 2ESHA 4PJYA 2CG4A 4TV7A 4YFNF 1FP2A 2PFBA 1R7JA 3F6OA 4P5OA 4AIHA 2CSOA 3E6DA 3IKVA 2B9UA 2ACJA 5E1ZB 3IWFA 4L9NA 4PGGA 3V8LA 5I93A 1YS7A 1T39A 4O9EA 2RV8A 5J8CA 3KSCA 3H8UA 2D2WA 4LB5A 4IPAA 3BY6A 3LA7A 1HKQA 3GVAA 5HLHA 1XDSA 2ZMEA 2IA0A 1W7PB 2KJBA 5BS6A 3LAPA 1SEFA 5E20A 3RNSA 1IPJA 1D8KA 1ZRRA 3QRFF 2BGCA 3NRVA 3I58A 2BNNA 5C6CA 5J6XA 3U10A 2XRNA 1FT9A 1QY4A 1BI0A 2P7VB 5KK1A 3KCCA 4U7DA 1T6SA 4RD7A 4ASNA 1FNNA 5A2QK 4UNOA 4EJTA 1BN5A 3B02A 1XSXA 4JQFA 5JI6A 2CFXA 1H9TA 1QWRA 4QGNA 3IBMA 3L2HA 3WGGA 1LDJA 3ZN1A 2RGVA 3L09A 2OZJA 3T5XA 1X8MA 1IPKA 1GQGA 2K0GA 4X6RB 4P9FA 5KHKA 4RGXA 2MNGA 3H7JA 1B9MA 4A5NA 5IT9K 2G7UA 3FZ3A 1EY2A 1NYWA 2HS5A 2A5YB 4RB1A 3QACA 3HIFA 4HW0A 4HQEA 4KL1A 1UIJA 4U88A 1Z91A 3LQRA 5BPDA 1B6AA 4UVAA 2ADUA 1TQMA 3WE2A 1BI1A 1I27A 3J80Z 2V09A 2RDPA 1ZZ7A 2R7FA 1O3SA 1H0MA 3RKYA 4EM0B 3KGLA 2IXLA 2BE5F 4CYDA 2ET7A 2EVXA 4QLCU 1ZG5A 1S7OA 3JSPA 1ZLJA 3V8KA 5ILVA 3JTGA 3HRMA 1RI7A 1FYLA 1CAUB 1RC6A 2A61A 2HQRA 4YFKF 3EBRA 3DPLC 3BDDA 4CGZA 4M6YA 4CZZA 3EDPA 4OIPF 1FSHA 4PDKA 3RJPA 5J8FA 5IT3A 4PIZA 2UXNA 5BV6A 5FO5A 1TNTA 1EH8A 2PBIA 3H1MA 1Y0UA 3FE5A 2XIGA 3KE2A 4I3PA 3GF2A 3F8BA 3K0LA 4G7OF 1TTYA 5FLXK 5LGNA 4IEVA 3OCPA 2Y0OA 2IXCA 1DGRA 4PCQA 5KHGA 3WTXC 2ZJ2A 3TNQA 1HW1A 2LDUA 3ISPA 4BYYA 1YYVA 4JK1X 1ZG1A 1IXRC 2COMA 1O3QA 2BNMA 4LUKA 3QP6A 4Y17A 4Z07A 2DLLA 1V4RA 1FZPB 1O4TA 4XEZA 4S05A 2N7GA 4MGYE 2AS5F 5CLSA 1MKMA 1EP0A 1FWZA 3T0YA 1K78B 4LK0F 2LKPA 2MPFA 2XL7A 4IEZA 2UZKA 2ZBKA 3W6JB 1FYKA 3NEUA 3GXOA 1XRUA 1B9NA 3COAC 1QQIA 2KIUA 3WE3A 4Z82A 4Q29A 4QX5A 5KHJA 3F8NA 4BHCA 4Q5SF 2XLGA 4I7HA 2WC2A 2EFOA 1LR5A 4KNYA 1X82A 4KU8A 3HRTA 2VN2A 1W4MA 2MBFA 2FBIA 4U0VA 4A0XA 2QUFA 3ACLA 4HDVA 4ESJA 4Q47A 3TO7A 5KHHA 2VOOA 3GZ6A 5E1WA 4HLYA 1EYBA 3CUQC 5BOXA 2L3DA 3C18A 3LZZA 4R1HA 1BIAA 4HX8A 2E9QA 3USSA 3LA2A 4EM1A 1SAXA 3GFMA 2W85A 4OLLA 5KHIA 4KIGA 1BOAA 5LEKA 2C6YA 3H7YA 1LJ9A 5J48A 4UHTA 4KMFA 4HF2A 5C8WA 1SD7A 5I0SA 4XF4A 3F23A 4Q0SA 1JE8A 3S7EA 2XHKA 1IUYA 2HJIA 1ZX5A 1P4WA 5AONA 4I0BA 1VP6A 3R4KA 4A5MA 3WTUC 2NNYA 4K8FA 5L3GA 2D45A 4MH0E 4IEPA 3FWEA 1BJAA 4CDGA 3U0ZA 2HYGD 2GWRA 2IXKA 3G7DA 1HSJA 3LOIA 2XGXA 2QWWA 4MQ9F 1UB9A 1RL3A 5D5VB 3RYRA 3HRSA 2KJCA 2IXHA 2VC1A 3OF1A 2IXIA 2XKPA 2RNJA 3CO6C 2E1NA 3JSOA 3I5UA 5LRSA 5J3UA 2MLKA 2WFPA 1FY7A 1J2XA 4FAHA 1HKSA 4P9GA 4ZU5A 1YQAA 2V9VA 4GGGA 3E3VA 4XF0A 1FXZA 3BJOA 4LA2A 3RYKA 1XE7A 4KMUX 5T3NA 1O5UA 4LUMA 3HRUA 5LGUA 4U0WA 3JAMZ 2R3SA 5ICEA 3IDBB 3ULQB 4WXDA 5CVIA 5JSPA 5CVRA 4X6QB 4AD9A 3ZP5A 2XAFA 3S0MA 2EJRA 3LA3A 2RN7A 3H50A 4AQ2A 1ZRDA 2VE9A 5D8KB 1CF7B 5E1XA 1CGPA 3PLQA 3R6SA 3W6KB 2D1HA 5DD4A 3SCGA 3DQVC 3M8FA 1P2FA 3V7RA 1V3FA 2HKOA 4OIQF 3D5LA 1EPZA 4XRFA 3BJ6A 2VODA 3BWGA 3I71A 1MJ9A 1U5TC 2EA7A 5EZWA 3CO2A 3T1BA 3S2WA 2D5HA 3O2PE 4G94A 3QOPA 1T38A 1E2XA 2OYZA 3H3ZA 3T8RA 1XB4A 2VBXA 3TO9A 2DBBA 1SFUA 2J5PA 3GUDA 4E2GA 4Q0QA 2QNKA 4G7HF 4KU7A 1STZA 2NS0A 4HN0A 3CUQB 1ON1A 3RPUA 2DI3A 1F9NA 5FLIA 3WW1A 2QM3A 1UIKA 3I54A 3L2CA 1JHFA 1XGOA 2M1BA 2HFHA 4IVNA 4XFBA 1YWKA 1X8EA 1R5GA 1OD5A 1XCBA 2IVMA 4EJWA 1A04A 3SMHA 1ZAOA 3B73A 4KA4A 4RGUA 3V8JA 2CO5A 2HKXA 1SD5A 3KP3A 3QPHA 2F5DA 3H9AA 2Q0OA 1GQHA 3KLOA 4MZUA 3K1MA 2NYXA 4IEQA 2GAUA 2YX7A 3MWMA 2VC0A 3MYXA 2O0YA 4D7TA 4L0YB 1KQ8A 2W24A 3HSFA 3FHIB 3ABUA 2BV6A 2FEZA 4KICA 1WGPA 5L3EA 2CAVA 5ILUA 1ON2A 2M30A 4GULA 3WTTC 2VONA 2RQPA 4P55A 5CVVA 3G73A 2NNNA 3DL3A 5AIQA 1R1TA 4XF9A 4A12A 3BPXA 3BZ6A 4G7ZF 1WLTA 3FF5A 3N4MA 3MEXA 1ZREA 3F6VA 2UY8A 4OU0A 3REOA 2FE3A 4IETA 3RTRA 1NHAA 1Z6RA 3U9GA 2Q30A 3TGNA 2JPBA 3E6MA 4I01A 2EFQA 2XAHA 4MTEA 5J7MA 3CJNA 2K4BA 4WXCA 1Z05A 3QU6A 3F8FA 4JTNA 3FMRA 1WQ2A 2ZNZA 1YS6A 3DXJF 2O03A 3HHHA 3WODF 1ZYRF 4KWJA 2M5WA 2E1CA 4A2UA 4S04A 4N9HA 4HSJA 3SQNA 1XE8A 2UYBA 3KP5A 3DF8A 1WSUA 3DEUA 4HX7A 4QXKA 4ZZDA 2HR3A 2P17A 4LLOA 2DK8A 4O5VA 4MX3A 2FSWA 1QXRA 3JW4A 2FQ3A 2HQNA 1U5TB 1W7PD 2AXLA 1BC8C 4H7LA 1FBQA 3E6CC 2O8XA 5HDGA 3J81Z 2P4WA 4M73A 1IXCA 4LEJA 5D4SA 3FXQA 5E18F 1Y9QA 1IN7A 2BEOA 2VE8A 1FSEA 2XAQA 1QZYA 2OPKA 2QENA 4WCGA 4EGYA 2K27A 3CUQA 2QBYA 3MFKA 4FX0A 1IXSB 3JZVA 4D0PA 1DZTA 3V4GA 5F1RA 1IRGA 1YW8A 2V1DA 4EWEA 3WTVC 2L01A 2P8TA 4HYEA 1CAVB 2MLGA 2Z3YA 4LK1F 1SQ4A 2STWA 4LULA 3M70A 4EGZA 2LNBA 4XSXF 3CUOA 5L3CA 1OMIA 5LRRA 4FT8A 1IN6A 2HYFA 5CJ9A 4HF1A 3VB2A 3NJZA 2CWEA 2K7LA 2L54A 1CAWA 1PP7U 2F5CA 2OZ6A 2NAZA 5D5XB 4DNCA 4XFIA 2H94A 3HT2A 2GA2A 1YFHA 1RTVA 3BU7A 4LB6B 1G4DA 4OOIA 1WKMA 3BPZA 3DPTA 3R0JA 4IRIA 2XV4S 3OD0A 4RGSA 4QM9A 4JVAA 3HSRA 5F6FA 1Z7UA 4EWDA 1DZRA 1W5SA 3DV8A 2H09A 4H0EA 5ICFA 1BC7C 1J0RA 4IERA 3SXYA 4BH9A 2UY9A 4J1WA 3FZVA 1TBXA 4YIFA 1OFNA 4P96A 5ICCA 4I98B 1F1ZA 3P9IA 2DCTA 3ABTA 5BXXA 4ZYDA 1B1BA 4I0AA 1TQPA 1SD6A 2RVCA 4A6EA 1RGSA 1L3LA 5DD8A 3I4PA 5LEJA 1YG2A 4A0ZA 2D1VA 5E16A 1XMKA 5EEGA 5KBFA 2IXJA 1SFEA 2XUBA 3CL1A 4HBLA 2D5FA 4ESBA 4KWLA 4HVQA 1QGPA 5HLGA 3BOQA 5DEQA 4L2NA 2GQQA 1O57A 2EK5A 4OIRF 4XLNF 4HSLA 4HV5A 1MDMB 3GX4X 5HDKA 3IKTA 1XCVA 4YNIA 1U5TA 4LG0B 2FRHA 1DPUA 3TOBA 1HSTA 2VBWA 3EETA 4KIFA 3GO5A 1O3TA 4WXHA 3OTFA 1NXMA 3L00A 5D5WB 1J75A 4B29A 5FQ0B 3KMHA 1FBSA 4DINB 1OYWA 3TO6A 1TW2A 2CGPA 1BI2A 2ISZA 3ES4A 4L9VA 1KYWA 5H6QA 2G9WA 4YARA 3EQLF 2ZXJA 2BNOA 2D93A 1WA4A 2PAMA 1G3SA 2GC0A 3C7JA 4GYIA 1LVAA 1K6OA 2O6GE 2ZFWA 4ZYHA 4CXFA 4XLPF 3TNPB 1W7PA 1CX4A 5DDGA 2QCSB 3E5XA 4Q0VA 1D3YA 1JGSA 2O61A 1V70A 4NB5A 2EA2A 4KT5C 4WK8F 1KGSA 5BQTA 4ON0A 5CYVA 4ZH4F 2OU2A 4JBAA 1XGMA 2GC2A 3K9TA 3O3KA 3Q5FA 1X3UA 3NSTA 4RB2C 1R00A 2YSRA 1J3PA 4MUVA 1P6RA 4ZYEA 4A6DA 1J5YA 2PLYA 2ZKZA 3I0TA 4DQ2A 3MDPA 2HTSA 3C3WA 4HDUA 3H1WA 5D4RA 4N0BA 1S6LA 3ZMZA 3M9AA 4KN7X 1TLHB 5CVJA 2H6CA 1I5ZA 1O7LA 2W57A 3FHZA 2YU3A 4IESA 3EUHA 3KEQA 2M87A 3GW2A 3PNAA 1DPRA 3WU1B 1BBYA 4R8HA 1U6GA 3R61A 2CW0F 3ML6A 2W25A 3RKWA 3MCZA 4QM8A 4MV2A 3LWFA 2IJLA 2WWYA 3MQ0A 2CQKA 3GWZA 4ETSA 1CAUA 1L0OC 4LJZF 1F4KA 2V1XA 2XROA 1U8RA 4YSFA 4XFFA 2JRTA 5D6EA 2XVCA 2F4PA 2DPUA 1FX7A 2K4JA 2E7WA 1RIOH 3ZDSA 4XFHA 2CYYA 3IL2A 2QYOA 1LDKB 4CICA 2MH2A 1S3JA 2KIFA 5JSOA 4UXAA 4ENNA 4EMSA 5D6FA 3GYHX 3WTSC 3TDUC 1E17A 1ZZBA 4AXOA 1D5VA 3M8EA 1KU3A 1VR3A 4IHSA 4LGWA 4Q0PA 5FQ0A 1U3EM 1K7AA 3C3VA 2Z2SB 1PDNC 5I0RA 2IP2A 5DUKA 3J80K 3DFGA 4YG2F 2ZCWA 2XLAA 1JXSA 2FNPA 2P6SA 4L11A 2EV5A 2D40A 2GC3A 2KKOA 1S7AA 1TW3A 2DFIA 3EYIA 2L02A 1GHCA 4UVBA 2H0VA 1MZBA 4A0YA 1ZGAA 5HDNA 4CO8A 3MAJA 3ZMTA 4MEXF 1Q3EA 3Q9SA 2L4MA 4IEXA 2HWVA 2Y0MA 4UUVA 4EJVA 1AWCA 3I59B 5LBQA 4Q0UA 4BHBA 2JSCA 1Y3TA 3VODA 4WWCA 1HXDA 2VXZA 2PFWA 4UBHA 4WZCA 3P9KA 4HVOA 1RUOA 2Z33A 4KUMA 4LMYA 1K78A 2OQRA 3D0SA 2Z69A 4GXOA 5K8SA 2VQAA 3CJXA 4BIFA 4QMAA 1LNWA 3F3XA 4OINF 2XAGA 1BIBA 2UWMA 3LQQA 1J59A 4EJUA 2DT5A 2M8EA 5HS7A 4HLXA 4G6DA 1MD0A 3QAHA 2ATFA 2GU9A 1KQ0A 1XGNA 4AWXB 3FM3A 4D7SA 1CAXB 2DTRA 3BJAA 1XD7A 3U2RA 1USTA 2L4AA 3HUGA 1YIOA 4QGMA 5BPXA 2YPRA 2Q4SA 4JV4A 4G9YA 2F5EA 4LFUA 1SD4A 4AIJA 1UW8A 4XF1A 1PP8F 2FMLA 4BHPA 3GYDA 2EAAA 2EV0A 4HZFA 3U1DA 2ETEA 3WW4A 5A2QZ 3P7NA 4K2EA 1ZZ8A 2EV6A 4MHGA 4HX4A 5BMZA 1D8JA 3F22A 2QQ9A 3HYIA 3PFIA 1LEAA 4HMZA 2YR2A 1UHMA 1U78A 4EJOA 1RNLA 1KU7A 1HKTA 2MH9A 2QQAA 3SCHA 3UKVA 4BNCA 2PYTA 5I0UA 5IT9Z 3H92A 3IHUA 3ST7A 3MZHA 1OR7A 1ZZ6A 4YYOA 3C1DA 4ONUA 1XMAA 4O9GA 1WWXA 1H1IA 3QU3A 3NW4A 2A68F 3DN7A 5ICGA 3IIAA 1Q43A 4AQ6A 2OD5A 2PAKA 5FFZA 2IA2A 3HSEA 3FJSA 1J1LA 5ERIA 2RC4A 2P5VA 1YFYA 2V1UA 2J5OA 3OOPA 3H1YA 1OYYA 3Q9VA 5FLJA 1ZZ9A 1P4AA 3P9CA 3KGZA 4XFCA 2IC1A 2KRFA 4M72A 4OMZA 5JAXA 3ERED 4N9IA 2ETHA 1IN4A 3RZZA 1VJ2A 2H27A 2XL9A 2FF4A 4OFGA 3N97A 1ZRFA 5BUVA 3KLNA 1OKRA 4L18B 4M9ZA 1BI3A 4ZZLA 5LHGA 1ODDA 5FD5A 2MD5A 3NQOA 2OQGA 3HT1A 2HZTA 2EB7A 3SZPA 5JSRA 3HOTA 1NE6A 4LLNA 2K02A 2ZNYA 3L7WA 1XDUA 5FFXA 4UXNA 2V6CA 1IW7F 2DQRA 1CF7A 5L3BA 3V7CA 5FLXZ 5I91A 4UBGA 1YTYA 2PMHA 4BAYA 1LB2A 1I6XA 5H6RA 4RB3C 2OAZA 3VFZA 4IEOA 1T2KA 5FLHA 5EEHA 2IRFG 1U12A 1CAXA 5FPZA 4ESFA 3V7SA 4M6XA 1ZRCA 1USSA 3JTHA 4KDPA 2LF8A 2I45A 3O6BB 5DCMB 5L3DA 1S8NA 1R5HA 5JFRA 1YLLA 2HGCA 3K1PA 2GH2A 2M45A 2VT2A 3G3ZA 5ED4A 5D8LB 1DUXC 3BPVA 2CV6A 3L9FA 3WW3A 1GVJA 4AVCA 4XSZF 1S29A 4HQMA 1QO0D 3LAJA 2MHFA 3KEOA 2TDXA 2LF7A 4I02A 4I09A 1HQCA 2UYAA 3KZYA 4WVZA 3QP5A 3D0JA 2QVOA 2DAOA 2QZ8A 1G3TA 2OA2A 3KETA 3I7DA 2OA4A 4HV6A 4AIKA 3BP8A 4HAMA 2O3FA 2XASA 4QWQA 4IHTA 3CTAA 4AVBA 5F64A 1HW2A 1JUHA 3S7IA 2ESNA 3ZMDA 5ILSA 1ZG3A 1ZARA 2GIVA 3FFQA 2B5HA 3GZ5A 3R0AA 4FAGA 2Q0AA 2A69F 3ZMUA 3U11A 5JCTA 1IZ1A 4AVAA 2PQQA 1QPMA 2Q8KA 4HBNA 3K1NA 1ONVA 1XSVA 2XLFA 1YW9A 5E1RA 2K86A 1O3RA 2STTA 1LQ1A 1B4AA 4MTDA 2XAJA 5L3FA 4PGHA 4XFAA 4LA3A 2GA1A 2QDRA 3OV8A 3HOSA 5DCFA 3DP7A 3PQKA 2V79A 2JT1A 1ZGJA 3R60A 4LTAA 4WF2A 1MGTA 1IAWA 1G3YA 2QLZA 4RAYA 3WG9A 1L3JA 5HLIA 1ZHFA 4IEYA 1P92A 3VHRA 4MGIE 4PZJA 5DYMA 1T98A 3ETQA 1FP1D 1HW5A 1IRFA 2DK5A 4BQAA 1QBJA 4L0ZB 4XF3A 1EH7A 3CO7C 4YIIA 4L9JA 3EQEA 1B59A
chains in the Genus database with same CATH superfamily
3RDIA 1WCUA 1R22A 3E6BA 2HEOA 2HXIA 4LNVA 4GMP3 2FDFA 2BBVA 2C26A 2P5LC 1OVPA 4XIDA 4BQ1A 4Y7NJ 4A44A 2XB6C 1DYOA 4L8QA 3CLOA 4QPGB 2DCJA 1T6BX 4YFXF 3I2DA 4GCVA 3N9MA 4UV9A 4XNFA 2BHYA 2IA1A 4Q4Y1 2HYXA 3TMOA 4GO1A 3FUOA 2FXAA 1YJNI 2XG3A 4AUXA 4PIXA 1GU3A 1MR5A 1H4GA 1WCDJ 2OBPA 2M8GX 1LEBA 4MGRA 2ZZJA 3AB0A 1JT0A 1ERDA 1REDA 2JDPA 4ZJZA 5G05L 4B8XA 2M2EA 1UMZA 4B09A 3FXRA 2IGOA 3WU2C 3E5UA 1R6RA 5C33A 2VZ1A 5HOOA 2QQJA 5BNOC 3KZZA 3CF6E 4HLTA 3GBFA 3G2BA 1I1SA 4AEDB 3TDZC 1PGSA 5KXBA 1QXPA 3W58A 4KQ7A 3THDA 4XTPA 1O5LA 3FLTA 2OQ7A 1F5TA 3K69A 2G4IA 4COVA 3IRRA 3MKYB 5C3QA 2VZPA 1MACA 5E17F 1SFNA 4ZU4A 5HBAA 2K9ZA 5EJCA 2VMHA 3N35A 4BKXA 1LRHA 1CWPA 1LFBA 4NIGA 3OYEA 1VTNC 4RYDA 1C8M3 2BRTA 1XBFA 3CC4I 4RN5A 1NH3A 4DXRA 4YGDA 1US3A 2ZX1A 4RS5A 2FQ4A 3Q0UA 1OPOA 3A0KA 3GZTB 3PJQA 4GWIA 3NV3A 4CU8A 1J7KA 1OLME 3JRIA 5DTDA 4LHKA 3RI4A 2Y48A 4ZYGA 5K0UB 1S0IA 4U7BA 1IDYA 2Q1MA 3LQCA 1MQTB 1FBUA 4MVTA 4HG6B 3PUHA 3N05A 1VQMI 5CNAA 5K5OA 3SFZA 3DGTA 3VEPA 1TQIA 3AVSA 4CCEA 1QJX2 4IV3C 3PUQA 5A3UA 1RUI1 5FXXA 2VT3A 4NRQA 1S2EA 3SQOA 2KDOA 3PQJA 3I53A 1LGBA 4BXSV 2P6HA 4FTEA 3IRQA 1Z1DA 2RJLA 1MDMA 2LSOA 1QJFA 4QGLA 2MA3A 3FMQA 1HBXG 5BPIA 4YM1A 3IIIA 1ULYA 2IT0A 4CP0A 3O1TA 4FPOB 4QX8A 1B35A 3RYPA 2QF7A 1PO11 3OWTA 4EWAA 1WKYA 2GNTA 3DCFA 3SHFA 3KFWX 4FFGA 1UPIA 5JHUA 3WGIA 2XSJC 1W28A 4CP2A 2E33A 2YFUA 3BCWA 3QLQA 2PTMA 4HA8A 3I3DA 2GXBA 3MFAA 3SKVA 4IHYA 1ULOA 3WW2A 4CVUA 4Y4RA 4FE4A 4JHTA 2YU1A 2YBPA 2ZAAA 1KU2A 2GZWA 1GXQA 5FD6A 5EZGA 3H3UA 3M3IA 3FMSA 1UAAA 3K4NA 1WCQA 4E8CA 3RZMA 2V4AA 2IAIA 4LLLA 1ZLKA 4XN3A 1N25A 4XZUG 1W8OA 1D5YA 5FZEA 5FR3A 1YX3A 1R091 1UHSA 4IV1C 5FZAA 4D7MA 5CZKA 3PUFA 4KFCA 2PJPA 4QQOA 1QXJA 5FCCA 1XYOA 4LE4A 3HQUA 2X6YA 2VECA 2GMMA 1HDPA 1WI3A 2VI6A 1VQNI 3DKQA 4B4RA 5APAA 3FXUA 1QA6A 2TCTA 4XBFA 5IY5H 1I1GA 2J22A 1J9IA 2L9NA 4I76A 4Y15A 1OLRA 4LBNA 2JN6A 1FMWA 3ZPLA 3O1MA 2LROA 4XUTA 1PUEE 3M1EA 3BTAA 3ZFFC 4LK6A 4LLGF 4AVSA 4M9SA 1YO5C 1W5TA 2G7HA 5AVPA 2ELHA 2FDJA 3U4XA 5GALA 1OQDA 1HB4A 4LOSA 4LO6B 1ZYBA 3LFKA 1G3WA 3I56I 3LAGA 3OL4A 4RS8A 1RHI1 1OHFA 3BROA 2WDBA 3OS1A 4AEJA 1SDWA 4ZS3A 1FC3A 1BW5A 4J1XA 4QX1A 1ZR2A 3POFA 5FP3A 2JSPA 1WD3A 5D8AA 1LGNA 4MQVA 2VU9A 3CDZB 2B7YA 4LK7A 3K4DA 1QQP1 5DMYA 2CJJA 3VZNA 2EIEA 4HVRA 1RVF1 2ZACA 1AYN1 1XN7A 5I8SA 3T2PA 1EV13 4OMYA 1C1LA 4N43B 1YFUA 2BJSA 1ZGWA 4RHV1 2C6SA 3EO6A 5BNPC 3V42A 1LE8A 1Q5OA 3M3OA 5JVTA 2VUDA 3VKMA 5K1YA 2W84A 4CZCA 3NJYA 4E4SA 4HL0A 3MPBA 2BW3B 1H9GA 1U0AA 2EXJA 4BJTA 1QVUA 3IWZA 2E71A 2ZBJA 2ZXHA 4IJAA 3AL0B 4CUBA 2KIMA 1GUIA 1FOYA 2A3SA 1N77A 2BQPA 2ZGKA 4KN4X 2XBO1 1WW6A 1EV7A 4HOBA 4Y22A 4FHTA 1G6NA 5FY9A 1S0DA 3PUBA 1J58A 3PNYA 1WI9A 3ZFGB 3ACGA 5A7PA 1UZWA 5K5QA 1BLZA 2A3WA 5IYDJ 4L9TA 4HF0A 3IMNA 1YHFA 4L5EA 4V19K 2EXIA 2DA6A 3QWLA 2GXAA 3C7FA 4AFDA 2A6XA 4GD4A 3BTJA 1VMFA 1GWMA 1GOFA 2A7AA 3BTLA 2Y38A 3WG1A 2OZUA 1ZVFA 1XQNA 1JOJA 4MNUA 4RLFA 3NNJA 5IVFA 3SJMA 4H4KC 1KEXA 4QWNA 2W00A 4YFNF 3V65A 2ZMKA 2CSOA 3BLYA 1V9U3 1XNCA 2B9UA 1NKGA 3AYDA 5E1ZB 4CDXA 4PGGA 2Z16A 2YXSA 1AXYA 3KSCA 3H8UA 3BY6A 3LA7A 3MZ8A 5HLHA 3DKXA 5AC92 1TNFA 1CZTA 2OW4A 2ZMEA 5FZ9A 4LO4B 1W7PB 2WN2A 3IKWA 4Y4YA 2X6XA 2JK3A 4YW7A 4JAAA 1D8KA 1EJ9A 3ZX7A 2E6VA 2OQ6A 4FPJA 1OISA 1LESA 5T54A 3ZR6A 1KXGA 3PSFA 1BI0A 2P7VB 1JTZX 1JXNA 4XIOA 1U9NA 3KCCA 4DOUA 1E0EA 3FXJA 1XSXA 4AYBN 4IGOA 5JI6A 5JXGA 1EV12 1H9TA 1QWRA 4QGNA 2FDKA 1C3HA 1BMV1 1GQGA 2K0GA 4H3WA 2IUWA 4B4CA 4IKFA 4RGXA 3ZSLA 4Q4Y3 5FZDA 4A5NA 5IT9K 5LCWL 1MZ5A 2W39A 4KGGA 4EJRA 2Y33A 4YZ3A 3A01B 1S2KA 3AG2H 5IFPA 1Z91A 4UVAA 2ELJA 1BBT2 4X6AJ 3BQYA 2RDPA 2R7FA 1EAH1 2XR4A 1W8TA 1OCTC 3HKZA 3QQAA 1ETQA 3T0DA 2Y6LA 4CYDA 4URTA 1S7OA 4TSVA 3KF5A 3V8KA 5H9SA 1ETXA 1YRNB 3HRMA 3A0NA 3OY8B 1RC6A 2R32A 5FKCA 2A61A 4AOCA 4Q8KA 3EBRA 4JQRA 5DM6F 1WCMJ 4PDKA 5J8FA 2LH9A 1GDTA 2HWD1 4BDYA 1QH6A 2R1DA 1TNTA 5C8CA 2PBIA 3X29B 3FE5A 2L7MP 3PURA 3KE2A 4I3PA 3G1LA 2ZJPF 4CSWA 1S5LC 3GF2A 3F8BA 3OYDA 2GNDA 5K7FA 3OCPA 4CEYC 1DGRA 1U5IA 3WTXC 2DMUA 1LTEA 4UYBA 2JD4A 2MW8A 5LK7B 1O3QA 1UOFA 2BNMA 4P9JA 3QP6A 2VZQA 5FO8B 2PMZA 2X53S 1V4RA 2E7QA 1YITI 1Y9MA 3IPVA 1O4TA 3HVDA 1LUJB 1DQ2A 2BY1A 1RUI3 4MGYE 5CLSA 4LBJA 3WDWA 4ZDOA 2LKPA 2MPFA 4IEZA 3THCA 3NEUA 3ZQHA 3U1XA 1XRUA 2BVMA 2WAQA 1B9NA 3E7LA 2R7TA 1YCIA 5TSWA 2OIIA 3SH4A 3ZGKA 4P5HA 4X8NA 2DVDA 4Y1UA 5KHJA 4R4ZA 1WJBA 1SCSA 1JOBA 3TN92 3OYBA 2G1MA 3MEPA 2WKKA 2WC2A 1AR81 4Q4Y2 2NS7A 2CMPA 1VZ0A 2E35A 2KZVA 5LBCA 2MBFA 1PO13 1ZQ3P 4DUXA 1H2NA 4U0VA 4A0XA 1CIWA 4NRMA 4N7IA 4EYUA 4Q47A 4BGDA 1J84A 3JB4C 4YM2A 2ID3A 1EYBA 2L3DA 1QDOA 4IQPA 4E4DX 5G04L 1BIAA 3M1CA 5DZGA 1OUXA 3AKPA 5KHIA 1LJ9A 5EYRA 1X3WB 5M3MJ 2NMNA 4JDNA 4HF2A 4FPLA 1N3QA 1LHNA 2EIGA 3C2GA 3OPTA 4YWAA 2CRGA 1W06A 5GZFA 1DU6A 1NXD1 5LK5A 3O1OA 2A70A 4I0BA 4QPGA 4A5MA 2Z79A 4BB3A 4MH0E 5J37A 3MLLA 3UL2A 3T2TA 1LU1A 3OYHA 4CDGA 3IZOA 3UV9A 1HSJA 2PJRB 1UB9A 3AG1H 2WQ4A 2M0CA 3KYDB 3O1SA 1EKEA 2X29A 3WUDA 1OA2A 1R093 2IXIA 2RNJA 1X9TA 1RINA 2XGDA 3W3CA 4HKLA 3TW7A 2G9FA 2WFPA 3ZFEC 4FAHA 3EMRA 4ZU5A 1WBFA 2AYHA 1US2A 5T50A 2ES3A 3RYKA 2PELA 4HNUA 5T3NA 1UKRA 4LUMA 4LT5A 3HRUA 1N1SA 4DXSA 5LGUA 3G1OA 4L0PA 3W2AA 4GKYA 2A3YA 4OZOA 1VIWB 3I8TA 1HKDA 5CVIA 4M01A 1LFUP 1RUI2 3K4ZA 1JT6A 2XAFA 2JG9C 2AZ5A 5F2WA 2VZ3A 3H50A 4EN6B 3L2UA 1GSLA 2VOVA 3WNNA 1LKXA 3PLQA 3AFHA 1R1A1 1F15A 2D1HA 1TZLA 2HDWA 1Z67A 1RHI3 5GKAC 3VUOA 4OIQF 4LOCA 1AHDP 3C2BA 1NCQC 3BJ6A 3WQ7A 3I71A 4RMNA 1MJ9A 2EA7A 2XHNA 3CO2A 5K0UA 2PMWB 3HWJA 1ZBA1 5JOXA 3T1BA 5GPCA 1UY0A 1MQTA 2QKLB 4G94A 3MPPG 2OYZA 1NLRA 3U78A 4DY3A 1RVF3 1PK6B 4XICA 1AYN3 5JLWA 2KRHA 1X19A 5F04A 1IJWC 4RHV3 1JZ4A 4ISRA 2K9LA 3CUQB 3OSFA 4JOMA 4QTRA 5F1JA 3WQ1A 3FBNB 4UY8I 3AJYA 4BXXJ 1Z7S1 3LF7A 4CP1A 2WFF2 1YWKA 1X8EA 2FHRA 2F48A 1NLQA 4G6TB 1A04A 3TYJA 2MFZA 2BTVC 1ZAOA 1STMA 2XBO3 3UGHA 1HX6A 4M00A 2G19A 1BZWA 1GQHA 3KLOA 4MZUA 4A42A 4NHYA 3VBSB 3SEPA 1HQNA 1OCZH 3MYXA 2L5QA 4D7TA 4LO5B 3ZOIA 3FHIB 3D5RC 3CF2A 1QIQA 3CCEI 3PIGA 4P55A 3BVCA 5C5TA 4Q4W1 2CQXA 1FMD2 4EN7B 5ISLA 4RFRB 4E7LA 5E8AA 3DLAA 3BZ6A 2RS11 2QBXA 2FDIA 3KB5A 2FE3A 4IETA 4RGAA 4XQWA 3U9GA 5K7HA 3TGNA 3E6MA 2XAHA 1RUD1 4BE2A 4YEJA 1R4MB 1IQDC 2DTWA 1M4WA 4MIMA 2QQVA 4M3FA 3NWSA 4JTNA 3K10A 3MIHA 1WQ2A 1BJZA 1SVLA 3WODF 2O03A 5A3NA 2E26A 4A2UA 4HSJA 3M2MA 1TWGJ 1K4TA 4JGYA 5FKKA 1WSUA 1GANA 3KD4A 4HX7A 4QXKA 5C3RA 4ZZDA 1AR62 4IGPA 2HR3A 1UOGA 2D44A 2VW2A 4LLOA 2YDEA 2HVRA 5JI9A 1FBQA 1BVVA 1QQP2 3OYWB 1UPSA 4NIIA 2VZTA 2EQRA 4BMBA 1IXCA 2B7EA 3O7OA 4XL9A 5E18F 3AZVA 1QZYA 4OI0A 2HBTA 4EE2A 4ZONA 4RHV2 3ZPYA 4EGYA 5A3TA 4PFOA 4D0PA 4WM7B 1MS5A 1YW8A 1C4RA 3RSNA 3WTVC 2W92A 3LFMA 1D0GA 3NAPC 2Y0SN 1UX6A 3ORJA 4KITB 3VYUB 3N9QA 4HYEA 1UN1A 2C1FA 4FPEA 4H55A 1JH5A 5AFBA 2Y6KA 3GJAA 4LULA 4EGZA 4Z92B 4DZGA 3RGBA 1EAH3 5CJ9A 3EYPA 4OI1A 2L54A 4DO0A 3FXOA 4DNCA 4XFIA 2JECA 2DFEA 1YFHA 1CJPA 1GZ9A 1RTVA 4LBMA 1X3ZB 3HOVJ 1H2KA 3PTRB 2HVQA 4N43A 3V64A 4OOIA 4MGQA 4AVTA 4M3CF 3OD0A 3OSGA 3RMYA 1MMDA 2HWD3 4ZY9A 1ODMA 2BW3A 1ALYA 4PJLA 3SXYA 3ZQCA 1YNAA 3PIPF 1TBXA 3S5AA 3FHAA 3ZYRA 3P9IA 4JKKA 4ASKA 2OV7A 3ABTA 4ZYDA 1B1BA 2Y26A 4GMP0 1ND3C 3I4PA 3ZQFA 3OPZA 3ZXJA 2XXZA 3ZFGA 5JPMB 4Q4X1 5EEGA 4RQPC 4Y26A 5KBFA 5DDJ2 5J96B 4DB5A 1SFEA 2HWF1 1NG6A 2BVLA 2D5FA 2VVDA 1WBLA 5L73A 1OR7C 2R16A 2YMZA 4D8MA 1YQ8A 2GQQA 1O57A 3WF4A 1A78A 2DMPA 1X58A 2QQNA 4HSLA 1JS9A 1Z3XA 4NQWB 2AEYA 4LG0B 3PU8A 2FRHA 1VQ4I 1QOSA 1DPUA 1YJLA 3S5QA 3ZIXA 1FV3A 1QEXA 3TOBA 1HSTA 2VBWA 3EETA 3OTFA 1H8TB 4QU2A 1L7LA 3JU9A 4D5FA 3TO6A 1BMV2 4DYRA 1FOD1 3ES4A 2X1CA 2AUYA 4FPYA 2VVFA 2J1TA 3DCQA 2CQQA 3AKSA 2XF6A 1AR83 2Y8KA 1GWLA 1UYZA 3ZRGA 2PHXA 3AVRA 4QIWN 3P5JA 4AGGA 3HAGA 3SDBA 1DHKB 2D93A 1W9SA 4FETA 2GC0A 1K6OA 3LIHA 3V0AB 1I6HJ 2ZFWA 4XLPF 3UJQA 4CXWA 1W7PA 2JRMA 2VIXA 1A3KA 2ZGQA 1HDKA 1EAH2 2DUPA 5LATA 3OGVA 4OMCA 5A6XA 2FZ1A 2CW8A 3CMGA 3S1MJ 3Q3SA 2WO2A 3S3MA 2W2IA 3GCMA 1IG7A 2WA3A 2Q8CA 2GC2A 4C2UA 5F39A 1H6XA 3B5LB 2W68A 4RB2C 1GNHA 5B1AH 1R00A 4MUVA 5KNLA 4FVVA 4V2WA 5FZBA 1J5YA 1DGRM 2PLYA 3DXTA 1W0NA 5DUXA 2XJSA 2HWD2 4EZ4A 2GM4A 1S6LA 1TLHB 3A01A 1B8IB 3KVAA 1S0JA 1I5ZA 2W57A 2A05A 3EUHA 1VQPI 2RM21 5FZCA 3UK9A 3K4JA 1BBYA 4A69C 2A71A 1U6GA 4G4FA 4YW1A 2W25A 3F9KA 1A8MA 3OY8A 2CQKA 3GWZA 2CS3A 4ETSA 3RWNA 3CJRB 4OQ8A 3DKYA 5JZGC 2XROA 4Q2FA 2JRTA 2F5VA 2XVCA 1Q8SA 5IK4A 3TEYA 3IL2A 1LDKB 5CKTA 4QB2A 4UXAA 4ENNA 4D6RA 2ECCA 5D6FA 3OEBA 3TDUC 1E17A 2WO7A 4BMEA 1R1A3 3P6BA 1ZZBA 2CL2A 2VJIA 4Z8BA 2V5YA 2YG0A 3BU0A 4BBRJ 1LU2A 5HNFA 4IXLA 3J80K 4S2GA 3ZQIA 4YG2F 5F7UA 1XMXA 3ZKUA 4MFEA 3PUIA 2EV5A 4XMAA 2KKOA 4XUOA 2BUKA 3SYTA 1ZBA3 1GHCA 3S2HJ 4YM3A 4UVBA 5KXDA 4QAWA 2WZR2 2E2JJ 1Q3EA 3DLLF 1JGGA 2E1MB 1VQ8I 5F5QA 5LBQA 3S15J 4Q0UA 3VODA 1Z7LA 2LVSA 3W9AA 3OBTA 3AP6A 4JX4A 3WD5A 3P9KA 2OQRA 4LBQD 3D0SA 1JN2P 3CJXA 4QMAA 1Z7S3 2XF5A 4OINF 4K9SA 2C24A 4N4OB 1BIBA 5F0CA 5FYSA 1RR7A 4IOCF 4R9BA 2DT5A 2M8EA 5HS7A 4HLXA 4G6DA 2X6WA 2GU9A 5IOZA 4W1UA 4S0HB 5SV8A 1U5YA 3INAA 2UURA 1USTA 2L4AA 4QX0A 4NR1A 3VKLA 2ZEYA 4Y5TA 2J7MA 2RS31 4G9YA 2JG8B 1R4NB 4Z6YA 1YI7A 4AIJA 1UW8A 3AMQA 3UETA 5SV5A 4RFT0 1VQ6I 3A03A 3P7NA 3RI9A 2WR9A 2EV6A 4Q4W3 1X1BA 2HPIA 2FD8A 2EIDA 1I50J 1AKHB 3AP7A 3NARA 3SISA 1HLCA 2VR4A 3PFIA 2VBPA 4W6WA 2YR2A 5E3OA 1UHMA 3CCJI 2RS13 1N3OA 3DYOA 4IV3B 1U78A 4XLAA 3DBLB 3A1YA 5FYIA 4BNCA 5J4VA 4DS0A 5IT9Z 4B7KA 1RUD3 4YYOA 2DVAA 1XMAA 1A8DA 3NRUA 4DRVA 2R6QA 1YOVB 2A68F 3MMYB 5ICGA 2PJRA 2BHZA 3IIAA 1P8JA 3V56A 1RESA 2WQ8A 4AQ6A 1Y4WA 2F6BA 1H1AA 2XPUA 1I5PA 5EJ1B 1PMJX 3KHBA 4M4PA 2Y64A 2P5VA 2V1UA 1Y8QB 1WJCA 3BR0A 3WG7H 4S2HA 3ZN4A 5FLJA 3GTQJ 2W4SA 3KGZA 2IC1A 3JR9A 1ZBA2 4MHRA 3GTGJ 4N9IA 1Z78A 1IN4A 3QPLA 2CSGA 1D4VB 1VJ2A 1OF4A 5A32B 2FF4A 4NE9A 3ZSMA 1E5HA 3N97A 3TL4X 1JHJA 4W65A 3CCYA 1OKRA 1I3QJ 1BI3A 2BU9A 2MD5A 2HZTA 4COWA 2CUEA 4RGGA 1JZ3A 5FFXA 2CDOA 1LHVA 3VPRA 1Z7S2 2JB8A 4U36A 4UBGA 5DZFA 1JZ2A 2Y2ZA 1JUIA 4W50A 2E63A 5H6RA 4RB3C 5IK5A 1T2KA 5FLHA 3A4CA 4GAZA 5FPZA 2GLOA 1NA1C 5CBLA 3JTHA 2LF8A 5C9AB 3PJYA 3JRGA 4BQNA 5L3DA 2SLIA 1L7RA 4NIAA 2RR11 1PK6A 1R5HA 4YFZA 2QGUA 4DMIA 2BBAA 4A41A 4CCCA 2VT2A 5D8LB 5FP7A 1UX7A 4JX0A 1IC8A 5LA2A 4XQDA 2VZOA 1UY4A 3CLQA 3MUY1 2UWBA 4PLMA 3VLBB 4I02A 4I09A 3PVOA 2RS12 4WVZA 4D9JA 3QP5A 1UAIA 3D0JA 1GMMA 4AEDC 2CFOA 2DCYA 3TP3A 2OA4A 3ZFFB 3BP8A 2O3FA 3FLPA 1RUD2 3MW3A 1KRIA 5M0TA 5J40A 4M0NA 1ZG3A 3WDUA 5GLUA 4Q4X3 3SEEA 3R0AA 4FAGA 1ETOA 3ZMUA 2XPWA 1SANA 4CCLA 3U11A 1S1AA 3OS0A 2HWF3 5IHRA 5CB7A 3ZYGA 3BTCA 1VLNA 2KR2A 1PVXA 2E7TA 1ONVA 5CAZA 4HONA 5E1RA 3BTZA 1B4AA 2K2SA 4C9YA 4UFLA 1UY1A 2WZEA 3HJEA 4Z2WA 3U21A 3LD8A 1F43A 2EAKA 3KHCA 1ULPA 2VNOA 2GA1A 3NJVA 3OV8A 4XRSG 3AZXA 4LTAA 2BY2A 4WF2A 1FAYA 1XNKA 1MGTA 2QLZA 3WG9A 5HLIA 4V2FA 3ZMNA 5GLZA 1P92A 5FZMA 4MGIE 1T98A 2DCZA 1FOD3 1URXA 3L2RA 4BQAA 3AX4A 3IH2A 1F4HA 3TEWA 2TRTA 5HV4A 5FGMA 2KISA 4BXUA 4FTBA 5DG1A 3OEAA 2W1UA 4BWOA 3SHRA 3MHZA 4I3GA 4EV0A 1LFPA 3PSIA 2ZZQA 4DBQA 1IKQA 1OVSA 4LD5A 4PFPA 4PSWA 4EM2A 1RZ4A 1WMXA 4BQXA 3GXUA 4XTMA 5LHIA 1I39A 1KYZA 3OYWA 3WZ1A 5K9YA 3HD8B 4P5YA 2N8GA 2P6TA 5DCMA 4M3DA 2ZO4A 1RUH1 2V7FA 1K42A 4ENJA 1OBNA 3L1PA 3A4UA 4MLOA 2OKXA 3QCWA 4WM7A 2WAAA 3GFLA 3ZQGA 4G8XA 1CJDA 3SZTA 1HQLA 2F5FA 1X4OA 3KT4A 4A4AA 4MO7A 1BHGA 4LJHA 5FYVA 2FA5A 4OAYA 2R92J 3FHNA 3ELNA 3HN1A 4ENKA 5FZHA 1GVDA 1RYYA 5IVBA 2NRAC 1R23A 1XC5A 2L2OA 3FX3A 1NE4A 2RM23 3UKTA 4P9UA 5E88A 1HN0A 3H5AA 4YZ4A 5LGTA 2CW7A 2PMUA 2BVVA 3VL8A 2IEKA 2RKHA 3TEXA 3ZIWA 3WP5A 1PIV1 4AR2A 2YX4A 1KFXL 4E7IA 5F3IA 2HWF2 4NWVA 4C30A 3IH3A 1E5IA 3THPA 3O12A 4U0YA 3TAYA 2TNFA 3L2QA 2Q1ZB 1W6MB 1XPXA 5DG2A 3VBOA 1RKWA 2FBHA 2P3YA 3A22A 2DOEA 5JR7B 2YPJA 3KVBA 4GYGA 2IS4A 2LYCA 1HXS1 2IVJA 4PF5A 3VYRB 3HPNA 1AXZA 2YBSA 4B47A 4Y5SA 2VTXJ 1OOPC 1KS5A 3F8MA 2X51A 3HNYM 4CDQA 4FXGB 3K46A 2HDCA 3UJOA 4XJ8A 1WZXA 2VBZA 3KQ4B 1FPQA 5IATA 4UVCA 5M3FJ 1DP7P 5E8GA 4R52A 1VMJA 1HDDC 3GBGA 4MGZE 3FLRA 2OPTA 3VBHB 1SLAA 2VY0A 4G6QA 5IT6A 2O14A 1IZ3A 3WNLA 3I64A 3NVCA 4QQPA 4NQWA 2PI0A 5JVGF 3K2AA 4LG0A 2ZAHA 2RDRA 2F6CA 4PI2A 4MXWB 5C3EJ 1JTYA 5CU1A 2ZMLA 1OSGA 3AZWA 1OQ1A 5L9RA 1H8TA 1IN5A 3VHPA 5EG0B 4NHMA 1VQLI 3PVNA 3H9GA 1W8NA 4E2SA 3KP7A 1QJY1 1ZH5A 1R36A 2ZXWH 3I97A 2DA4A 3K4KA 2X5IA 4LHSA 4Q4V1 4YRDA 3ROUA 1D0ZA 3KYLA 4PI0A 1BM9A 3V0AA 2JPCA 2DPDA 1UCXA 4ORFA 4DZJA 2RMU2 3Q8CA 4CEYB 4PHZA 3MV11 4RDUA 3WLUA 2JMWA 2ZJRF 3HEIA 5A7NA 2HXOA 2VJXA 4MEYF 1COV1 3CHXA 1WRJA 1KQ9A 1X7NA 1YFXA 3MKZA 1LDDA 4A3GJ 1HJGA 5JMCA 2DTYA 1HIXA 1S0EA 1WVRA 1MJBA 2PLV1 1GV9A 4XBQA 1Z9CA 5D5UB 3D82A 1DLCA 1QU3A 1RUG2 3S1NJ 2UXXA 4BDZA 1H30A 1ZA7A 5DQ0A 4JTOA 2WJSA 5HS9A 1W39A 5HLTA 1MMSA 3H5RA 2EIKH 1XGSA 3W2VA 3SITA 1B8IA 4BDVB 5GZGA 1J09A 2MGQA 5FKMA 4AHZA 4M71A 2HWC1 3Q8BA 2YY1A 3AKZA 3OYAA 5KVRA 1OXCA 4AE2A 1UY3A 2LLKA 3VL9A 4XJUA 3T8TA 3EHKA 4K3UA 4S2DA 2Y0SA 2WO3A 4GJZA 3M3EA 3VBFA 3USUB 1CONA 2QBYB 4G9SB 4NIHA 1PGL2 3D5SC 1XTAA 3O14A 1OYIA 2DA3A 1DLLA 1GP4A 3VD5A 3RZGA 2QQBA 1W5CC 3NL1A 5JHFA 5D1IA 2VNVA 1QU0A 1VBC1 5F0FA 2OUHA 3OG2A 2WV0A 2AR6A 2ENRA 2JZYA 2SBAA 2DU9A 4QX7A 1VQOI 3MD2A 2KPMA 4M3CB 3K2ZA 1E5RA 1U2WA 2JA8J 1ZZCA 4BA6A 1SMTA 2ELKA 1R58A 1CAWB 4KIBA 1IS3A 3HDDA 3TQNA 4P02B 1Z6TA 4PT6A 4B1LA 3CCRI 1K79A 5FMBA 3OGGA 4L97A 3WINE 1JI6A 1T33A 3J7AO 3A0HC 2Q1FA 1UL9A 1JYTA 2RR13 2RS32 3NV2A 3ZN0A 5FLVA 4XFGA 1GBGA 3ZFEB 2FBEA 2WNUB 5BNOA 5CFCC 5EP9A 1J3QA 4JCKA 1H1MA 5DZEA 1XNTA 2JA7J 3KLSA 2HOSA 1D7PM 4P9YA 1FYMA 3WTWC 3T1MA 2O1QA 1ENRA 3PVBB 2XKOA 2VVEA 1QHHD 1JHNA 1S0CA 2PHLA 3OYLA 1W36C 3M7GA 4AU7A 2Y6JA 4QHOA 2VPVA 1C5IA 2L9LA 2VTFA 2JG9B 1SMYF 3DU6A 2DA1A 4IQ4A 4BQQA 4RB0A 2BZDA 2BPA2 4B8EA 4CYCB 2M7BA 2W91A 3K4MA 4IEWA 2PG4A 2K9SA 2AREA 1JW6A 1A5JA 2KQRA 3RS6A 2YGMA 3JAMK 3KQRA 1NCQB 5A7OA 2ECBA 3VD4A 4OIOF 1FNZA 2Z4FA 1G59A 5DM7F 1POQA 4TV7A 3CDLA 1GFF2 2NZ9A 3BR1A 1AKHA 4P5OA 1UQXA 4AIHA 4EN9B 3IKVA 4IV3A 3IWFA 3V8LA 4LIUA 3FFZA 4O9EA 4EN8B 1OLQA 5J8CA 1A31A 1RXGA 2D2WA 4IPAA 4XKCA 2ZKNA 1HKQA 4XMYA 1X1PA 1XDSA 3K70C 5FMOL 2IGMA 2HOTA 4HOOA 3RNSA 2CWSA 1G7YA 2YC2A 3QRFF 2BGCA 3WVJA 1HRV2 5J6XA 3HOWJ 2GSYA 4WVMB 3LSHA 3HOYJ 5KK1A 5KHDA 4HETA 4QHBA 1T6SA 3NJXA 1FNNA 5LZ6A 4FTHA 1ASJ1 3B02A 3T08A 1S72I 4XPVA 2CFXA 4AL9A 3L2HA 4XMIA 3WGGA 1NAEA 3ZN1A 5C7GA 3L09A 2XGCA 2ZJCA 1X8MA 2X10A 3WNMA 4P9FA 5ABJC 3ZXGA 4RLQA 3CP8A 4YM0A 1RUH3 3H7JA 1B9MA 2VQTA 2G7UA 3FZ3A 3HPGA 1NYWA 4ARXA 3DPUA 4RB1A 4A3CJ 1ZBE2 2DF7A 4HW0A 4HQEA 1MMAA 2R7OA 1W04A 3LQRA 4PDWC 1B6AA 4BE0A 3W2WA 3NNMA 1TQMA 1O8PA 3WE2A 2LRDA 1X1CA 1BI1A 2DMQA 1I27A 3J80Z 1UXXX 1O3SA 1H0MA 4XDQA 3U4SA 4A3XA 3GNEA 3GZNB 5L19A 2R7WA 2LFBA 2IXLA 4CU9A 5DN2A 4QX2A 4QLCU 1ZG5A 5ILVA 1RI7A 1YXWA 5FP4A 1FYLA 1CAUB 2JDMA 5LBBA 4U87A 4GB32 2LG4A 4TN7A 4MGSA 4IV1A 4YFKF 3DPLC 4CGZA 5EGOB 4M6YA 1VAKA 1PIV3 4ZDPA 4Y3OA 1FSHA 4XIKA 5CG8A 5IT3A 1K3IA 2UXNA 4BY7J 4GRIA 3GMEA 1E3OC 5JXHA 1XSQA 3IN9A 2VQLA 1LECA 5E3NA 2R1BA 2VO5A 5A1AA 2EZLA 3K0LA 2QQPA 1TTYA 4XUNA 5IW0A 2QQIA 5FLXK 1HXS3 2CQ7A 2IXCA 2CU7A 2E34A 3S93A 4YPJA 3S1RJ 3ZFFA 1S4CA 3ISPA 1YYVA 2WSUA 2DA2A 3V0BB 2DLLA 2LBFB 3NAPB 1FPN1 5IOYA 2M7AA 4S05A 1W0UA 5L36A 3ILNA 1NK3P 2E2IJ 1K78B 4LK0F 2ZBKA 1MBJA 3W6JB 3GXOA 1WLWA 2ICWG 5C5UA 1SLTA 3MUZ1 3LSKA 1QQIA 3WE3A 2ZEXA 2VUAA 4Q29A 2VXRA 1C28A 4OI2A 1XX5A 5J3LA 1W2TA 1WWYA 1TEIA 3ZXDA 4A3LJ 2JJ7A 4Q5SF 1AX2A 4I7HA 4J01A 1GR3A 1LR5A 4KNYA 5BNPA 2ZHMA 4GWMA 1RUH2 1W4MA 4BS9A 2AQFA 5A1FA 1D1CA 1MMGA 4ES9A 1YI9A 3ACLA 1Y43B 5B2GB 1CESA 1QJY3 3BTXA 4ESJA 5E1WA 2EZKA 1JI8A 1W9FA 3PNVA 2MD0A 3CUQC 5BOXA 3C18A 4Q4V3 3LZZA 4R1HA 2E9QA 3USSA 5I0DA 3LSIA 2W85A 5IVVA 1T2XA 3M8JA 5J48A 3LSDA 5GM0A 5C8WA 3DUIA 1ND3B 1IKPA 4GALA 1CVNA 1RR8C 5FOJB 4FP3A 2XHKA 2XQRA 4UW3A 1IUYA 2HJIA 1V55H 4RQPB 4BPZA 4IGQA 4ZTFA 2NNYA 3ZYIB 1COV3 3W5NA 1Y7BA 2KDZA 2XJPA 1DCSA 3U0ZA 2HYGD 4FQZA 3VBSC 3LOIA 4MQ9F 5HXMA 4BZ4A 4FE7A 1XOYA 5D5VB 2PLV3 3RYRA 2KJCA 4D6SA 2JE7A 1K5JA 1HQWA 2Y6GA 3OF1A 5DPNA 4JC1A 1V6NA 3JSOA 2Y6HA 5ANQA 3KWVA 1BEV2 2VM9A 3PO2J 2ZGOA 1GNYA 2WZ8A 2NXNB 2V9VA 4AI1A 3E3VA 4YG3A 1XE7A 2TUNA 1W9TA 4KMUX 2ZEWA 2O7OA 2HWC3 4FSJA 2IGKA 4U0WA 3IDBB 2OTJI 4BE3A 4JYKA 4FPGA 2WV1A 2NVUB 3W21A 5JSPA 1XSRA 2B9SA 4AD9A 1K4SA 5DUWA 2AC1A 2VE9A 4DRRA 5F0HA 1FYUA 3PVEA 1JKRC 3GTLJ 4AQTA 2XJQA 2LOOA 2D98A 1ULDA 1GKBA 4G3YC 3DQVC 1XE0A 2XVLA 4GJYA 3M8FA 1VBC3 2ZMNA 1P2FA 2EZHA 3QYBA 3JRBA 2ZX2A 4XABA 4W6XA 3S14J 2VCMA 3KV4A 3GZEA 5F5AA 1UZYA 5EZWA 2R061 4IE0A 1W6PB 2J42A 2D5HA 2AEZA 3T8RA 2VBXA 4CDUB 2J5PA 2JENA 1RUF1 4Q0QA 3LDRA 2QNKA 4G7HF 2LALA 4Q4V2 4LBQB 2QTWB 4HN0A 3RPUA 5FZ3A 2DI3A 1TP4A 3VBHA 1IGNA 3WW1A 2WZPP 5FY7A 2QM3A 2P5BA 3VSLA 2Q5TA 2CGNA 2F4MB 2M1BA 4K6BA 4FOYA 2HFHA 1T95A 1L7QA 2E51A 3QD6A 3P3PA 1R5GA 3O5SA 3ALQA 2ZXQA 3CF5F 5JZGB 3B73A 4KA4A 3S32A 3V8JA 2CO5A 3KP3A 1GV5A 3QPHA 5EG0A 1SHWB 2VKVA 2Q0OA 3K1MA 4HG2A 1TWFJ 1UMHA 2L9VA 3I49A 1UMQA 3ZSKA 2V72A 3T0AA 2PXJA 4L0YB 4UUSB 2IWGB 1N1TA 2Y9ZA 1AX1A 4RM2A 1AR72 4INDA 4L99A 1WGPA 5C3SA 2M30A 5B5EC 2NP0A 2VONA 3MW4A 4DEQA 5FY8A 1H88C 1DGWY 3S6PA 4CU6A 1R1TA 4CEYA 2D6OX 4A12A 2E1OA 1WLTA 3N4MA 3CDIA 1ZREA 3F6VA 2UY8A 5IWFA 3REOA 3RTRA 1NHAA 3M4OJ 2JPBA 4I01A 3BR5A 4NBQA 4MTEA 2OCEA 1PZ9A 1U0JA 1VBB1 3JBG2 1VBE1 1O6UA 5AC91 5L7OB 2JDAA 1VBA1 4WM8C 1HRI1 2R071 2V5DA 2VMEA 4B3NA 3RQ0A 3A02A 3MO4A 1X33A 1YS6A 5IJRA 1SFOJ 1GOHA 3WCRA 4KWJA 5EHDA 4S04A 5FP9A 3SQNA 1XE8A 4OVEA 3KP5A 3QYFA 2HWB2 1ENSA 2R5ZB 3KV6A 1CPMA 2P17A 1REEA 2XF7A 4XE9A 3JW4A 4I0WB 4XW3A 1U5TB 1BC8C 5C4XJ 3Q8EA 1X50A 4E7HA 2O8XA 5DAWA 2K3FA 2P4WA 2DMNA 4M73A 2D6LX 1JKOC 2WYSA 4AAPA 3K7AJ 5D4SA 1ASJ3 3ZXLA 2BEOA 4XKBA 2OPKA 1Y56A 3ZPOA 2VMGA 4D69A 1TME1 2DVBA 2XJRA 2K27A 4NIDA 2QBYA 3MFKA 4BLJA 1W2OA 3V4GA 4EWEA 3BYWA 2L01A 1T6GC 2R30A 1UU5A 1BBT1 2P8TA 4LG3A 2F4OB 1GICA 1GP6A 2MLGA 2Z3YA 1SQ4A 2HPMA 3H9QA 1CIYA 3ZM8A 5L3CA 4M3CA 5LRRA 3EUAA 4WVVA 3S1QJ 3H1CA 2WIIB 3NJZA 2CWEA 2K7LA 2VCCA 4JDMA 1CAWA 5A80A 3ILFA 5T52A 4LBLA 1YYNA 1BA5A 4LITA 2H94A 4X0GA 2WT2A 1Y1VJ 5JVVA 1WKMA 2XAUA 1R71A 1PYVA 3DPTA 3KIOA 2XV4S 5GADJ 3G1MA 3R4DB 3VBUB 1UY2A 5F6FA 2E7AA 3ZFEA 2WNUA 3K4BA 4N90A 2HQAA 4Y1ZA 3H8OA 3T09A 1WMFA 3RZJA 3ZXAC 1J0RA 3LEKA 2UY9A 4YIFA 1OFNA 2VULA 4P96A 1W3VA 4XXAA 1F1ZA 1AZDA 5JMOA 1RMU2 4I0AA 1SD6A 3B93A 5FP8A 4D0QA 2A3XA 3ZQLA 2JG9A 4RR3C 4XOPA 4KG8A 2GDFA 3R4SA 1XC6A 2W95A 3J26N 2XUBA 5LY1A 1OFCX 3CL1A 4FQGA 4HVQA 4Q8LA 1QGPA 1N1VA 1FPN3 3TBIA 2JIJA 4HSTA 3HB9A 2QSHX 3BZKA 3FMGA 4XLNF 1BVP1 2R7VA 1NCQA 4HV5A 1LULA 1XCVA 4YNIA 4NPLA 3BOWA 1WH5A 2H8WA 5FO7B 2KRCA 1QZEA 3TN91 4KIFA 1NA1B 3GO5A 4C3JJ 1NZIA 5F08A 2GIZA 4YZ5A 1ASJ2 1J75A 5C4WB 3KMHA 1FBSA 1VALA 4DINB 5FV3A 1OYWA 4IHVA 2JD9A 3J7AY 1TW2A 2CGPA 4L9VA 1KYWA 1MZ6A 2XVGA 4BACA 2VXJA 1OC1A 2EBIA 2ZXJA 3E1SA 2BNOA 1YRZA 1G3SA 4PJNA 1N47A 2JICA 2E1MC 1W6QB 5C44J 4PCRA 4ZYHA 3VZJA 1CX4A 1D0XA 3HNMA 3MICA 4LXLA 5FYYA 3OD4A 2HI3A 4Q0VA 1D3YA 1W0OA 2BFUL 1NCRB 2O61A 4GH4C 3BOPA 4OHXA 4NB5A 4K1YA 3S16J 2CGOA 2J1UA 4XRSA 1KGSA 3S2DJ 3VKNA 1LOAA 4ON0A 5CYVA 5T5JA 2Z42A 4JDOA 5FXWA 3CCQI 1XGMA 2KIQA 3WP4A 1OA3A 3B94A 3Q5FA 3MIBA 3J8F2 1X3UA 3ZR5A 2IGNA 2Q2EB 1BQPA 4A6DA 4ZYEA 3HUGB 4ASLA 2ERFA 4DQ2A 1AL21 3MDPA 4O65A 5FLMJ 2HTSA 3C3WA 4CDWB 5D4RA 2JG8C 4KBBA 1RUC2 2GOXB 4KN7X 2VCBA 5FZOB 2C9AA 2CV1A 5CVJA 1UZVA 3CCSI 3LE0A 4IQJA 1V0AA 2YU3A 2VH9A 4JGZB 2YC0A 3KEQA 3GW2A 4D6QA 2X6OA 5A33B 5FYBA 1H6YA 1TNRA 3WU1B 3ABMH 4YW5A 4R8HA 3R61A 1WJEA 2C5DA 2F17A 1IO2A 3OR1C 3RKWA 4QM8A 5LA1A 3MN2A 2UU8A 4BISA 3LWFA 3U14A 2IJLA 3MQ0A 3WNPA 1CAUA 3NWTA 1F4KA 2V1XA 1FPN2 1WJ5A 4XFFA 5D6EA 3RZLA 2K4JA 2BP6A 2L7KA 5JWPA 5EYXA 2QYOA 1J1TA 3R0RA 2IFRA 3U07A 4CICA 3BCAA 2DFHA 1S3JA 4K40A 2NVTJ 4CCNA 1QHGA 1XNBA 2Y69H 1UU6A 1D5VA 3M8EA 3H0OA 3CZJA 1KU3A 1T8IA 4IHSA 4LGWA 5FQ0A 1U3EM 1K7AA 2O0OA 3EB7A 1PDNC 5I0RA 5DUKA 2Z1DA 1S2BA 2ZCWA 5JUVA 2XLAA 1JXSA 2R063 2D40A 1DU0A 1S7AA 5B3SH 2O8OA 4UAPA 1GZWB 1H2LA 4CO8A 3V0BA 3MAJA 3ZMTA 3Q9SA 1ND2B 4XDPA 2LBFA 3NAPA 4TYSA 1RUF3 4UUVA 1N3PA 2NPIA 1AWCA 3I59B 2VUCA 3I2JA 2XWBB 3DTIA 5C3OA 2BW8A 2PFWA 2WFF1 4UBHA 1W8HA 1O59A 1VB4A 4XRMA 1UXZA 4HVOA 1RUOA 4KUMA 1K78A 1SDDB 1SLLA 3MW2A 4GXOA 2O5RA 1JYWA 2JVGA 1J59A 4N4NB 3AZYA 5BNNB 2QKDA 3N3HA 1KQ0A 2BXZA 3FM3A 2GH8A 3LSEA 1PO22 3ZR8X 4F92B 2DTRA 3BJAA 1XD7A 3U2RA 4BQYA 4XILA 5C9AC 2I10A 4ZHNA 4QGMA 1JUSA 2V73A 2Q4SA 1WLCA 3VZLA 5FY5A 3I3MA 4EN0A 2HWE2 1KJLA 2PHFA 1FMD1 2D6MA 2FMLA 4XJ9A 4BHPA 1W8FA 2EAAA 2DBIA 1OOPB 3WG2A 5C70A 4K2EA 3ZCOA 1LOFA 4MHGA 3Q0WA 5EJ3A 3HYIA 1ND3A 1OLMA 2LUWA 1LEAA 4C2TA 4CA0A 5B1BH 1RNLA 1HKTA 5D2AA 4RQPA 2MH9A 3UKVA 3MBWA 1KDKA 2PYTA 3A21A 2ADDA 4DW6A 1PX3A 3J7ZI 1OR7A 1WUVA 3FXKA 3C1DA 4ONUA 4O9GA 1VBB3 1VBE3 5AC93 1N1YA 4UW6A 4NMIA 1HRI3 2R073 2JKBA 5HV0A 1AR61 1V5GA 2OD5A 3VZOA 3AL5A 2PAKA 1JODA 3DEMA 3MGUA 5DXDA 4B4QA 3OYKA 4LE3A 1S0GA 3IP4B 4N7UA 3OOPA 3H1YA 4X8PA 1P4AA 2ARAA 3ZOBA 2VE1A 2R062 2QSFX 3HOUJ 2VOKA 2ZGNA 1IG0A 1CZVA 3RZZA 1QMJA 4MG2A 3KLNA 1RUF2 3I9V2 4W97A 3OBAA 4BJ6C 4F93B 1TME3 4ZZLA 3FN9A 4C1WA 5LHGA 3CJIB 1ODDA 5FD5A 3NQOA 3ZLIA 1T0FC 2OQGA 3O8GA 1G2HA 1K5MB 1AHSA 3I2OA 1NE6A 2K02A 2ZNYA 2ZEZA 2V6CA 4Q1PA 5L3BA 5FLXZ 1BBT3 3BG9A 5I91A 4FFFA 3KCYA 4QKFA 3VKFC 4AI2A 4B4PA 1YTYA 3CCLI 5DAVA 2ADEA 5KWRA 2PMHA 4YW2A 3CQZJ 2P0WA 4HSRA 1YJ9I 1I6XA 4DYQA 2QE3A 4IEOA 5EEHA 2IRFG 2FMDA 1CAXA 3VZMA 5GPAA 1TT0A 4ESFA 1W6PA 5LY2A 3GJBA 4RBOA 4M6XA 4NC7A 2F4IA 2XGEA 1DBNA 2AH2A 3AC0A 4NHKA 1YLLA 1A36A 4CDUA 4II3A 4PF1A 5HXVA 5ED4A 5FYZA 4QU1A 4UF0B 3PMEA 3NNLA 1GVJA 2RS52 4AVCA 2RG4A 2OVUA 3GHMA 1YQ6A 4PLOA 3B3QE 3KEOA 2TDXA 2LF7A 1BYHA 1APNA 2JDKA 1HQCA 1BR2A 2UYAA 3D8CA 1HV0A 2QVOA 4OUEA 2XB0X 2LW8A 2RJ2A 1WJAA 4HV6A 4AIKA 4BXFA 1GLHA 2JQ7A 1UWWA 1O4XA 5JZGA 4IHTA 3CTAA 5DDJ1 4AVBA 3LEGA 3DYPA 1JUHA 2XMLA 2W5FA 1VBB2 4H7MA 2ZSHB 1SACA 1VBE2 1VBA2 1X36A 1HRI2 2R072 2B5HA 4CRQA 5JR2A 2A69F 1K61A 3CP2A 5IAXA 3SEQA 5JCTA 2B39A 4AVAA 2EZIA 2PQQA 4UUSA 4J25A 2VASA 2IVIB 2K86A 1O3RA 3OMYA 1WW5A 2GP3A 1BOBA 4MTDA 2XAJA 1JKPC 4RS5B 3BTYA 2TEPA 3N7KA 4PGHA 2QQLA 2DUQA 1B72B 3L2VA 4K20A 5CKMA 1NTCA 1YE9A 2BGPA 4LA3A 2QDRA 1U8BA 1SCRA 4EQVA 2P2KA 5AVAA 3PQKA 2V9PA 2V79A 4RA2A 4QPWA 4C8DA 3R60A 3TN93 5A3WA 3FISA 2K40A 1G3YA 4RAYA 1L3JA 4TXWA 1PVC2 1ZHFA 4IEYA 4E7SA 2W0XA 1TME2 3VHRA 1QDCA 1OLTA 5HNHA 5CFCB 3SDGA 1V6OA 1IRFA 2DK5A 1QBJA 3ON7A 4PQQA 4B44A 1RIRA 4D1QA 4JP0A 3CZ6A 5CA6A 3EQEA 2IW5A 1P4XA 3N9LA 3VBHC 4YGBA 2Y30A 2HYJA 1LEMA 4I2OA 1FEXA 1D2SA 4KYWA 5CADA 3HTUA 5GAGJ 1UFMA 3C2HA 2R5ZA 1KDMA 2QQ8A 1OKQA 4BM8A 4JRLA 3MKLA 1YX5A 3THTA 2WTEA 2LC2A 2MSYA 1SAUA 4E2QA 4HANA 1FOWA 3NKTA 3UYJA 5EIYB 2UUZA 1B35B 3BALA 4YVWC 3HTSB 2GP5A 2MC3A 2EXHA 1FOKA 2QZ3A 3WDTA 2DFCA 4OHYA 4A3FJ 5J09A 3K2OA 2NVXJ 1ACIA 1AL23 2FOKA 4XLEA 1QZZA 5HI0A 4NHLA 1YIJI 3UGGA 2E60A 4NVPA 3ECOA 4AC0A 5EXOA 1LODA 4AVPA 3LSTA 2FDGA 2P1BA 3RJRA 2KXLA 5FYMA 4ANJA 3QPSA 1UG2A 4N53B 3HBKA 4XJZA 3DU5A 2G9ZA 1U5XA 3U75A 2HOEA 3GLXA 1PM7A 3B6CA 1QNTA 3LFUA 4QQ2A 2B8MA 4R79A 3FBYA 5LW9A 1WGXA 2EA4A 5F32A 5K7PA 4LBKA 3MZYA 4XACA 1FLIA 2RAEA 1FIAA 4UFHA 2D3RA 2P4EA 4WX9A 3IMMA 3VOEA 1W8UA 2LP0A 2Z9OA 3P5BA 3POJA 3OGJA 1UCRA 2DA7A 2WINB 4W6YA 2QQMA 2V26A 1F4AA 3N9OA 1IN8A 1HCRA 5ABJB 5FY4A 4QB1A 4CHUA 3RKXA 2ORZA 4XR6A 3S3OA 5TRDA 1BK1A 1LJ7A 4M74A 2WZR1 2BXYA 3F72A 3AP4A 1JZ7A 4LO8A 4P1WA 3GTKJ 3R05A 2DU1A 1YUDA 1R1VA 1SFKA 1JUPA 3B69A 2GNBA 3W20A 1ZNPA 2Y75A 4JRAA 4PDWB 2AENA 3E97A 3AK0A 4FX4A 3HKZN 3D1NI 1SBFA 4C0BA 1DU3D 1WPKA 2FMYA 4IW3A 1O7FA 3ELKA 5LA9A 1ULFA 3B9CA 4XDOA 2P34A 4ZU7A 3SXWA 3CCUI 2H6BA 1ITYA 2WFF3 3VGIA 5IVJA 3WGHA 2H1LA 2PAEA 2I2SA 1P7IA 2A6YA 2PEXA 2DBNA 4E7ZA 1NA1A 2KL4A 2DOFA 4OHZA 2PQ8A 4HEA2 2DDAA 2P3JA 3RPQA 2HTJA 2Q8EA 4L5JA 2PN6A 5FPUA 1DZQA 5IPAA 1AL22 2O9LA 3QH7A 2GC1A 4EROA 2AXTC 3HZJA 3W59A 3SZGA 2DT6A 3DBHB 1ENXA 3G71I 1K12A 2WNUC 4XJWA 4CEWC 1MS0A 1DQ1A 1VI0A 2H8RA 1FMD3 3MIGA 4AEDA 4GKXA 3K51A 2PMZN 1NCRA 4AEMA 3HQRA 4MGKE 2DN0A 4BJ5C 2VPLA 2ARCA 2EFWA 5E79C 2VMIA 3KPHA 3O1RA 3KM5A 4Y22B 4KWUA 5E8IA 1DQ0A 3CLPA 5CIRA 3BIEA 3OOUA 3JXSA 1J3RA 1MS3A 3IC7A 1REPC 1DQ4A 2YZ4A 2Q2EA 2X85A 5K7ZA 1ONAA 4BBSJ 2YV8A 4IF4A 4KG0A 2DOAA 2W52A 2XUMA 3ZMVA 2VBYA 1ZM1A 3ZSEA 1POGA 3WUCA 1AR63 3FL7A 5IVCA 4UFKA 3CNAA 1WA6X 3I4NJ 1GXPA 2W94A 2VZSA 1F31A 4JGZA 2BBYA 4XQFA 3M7AA 2W1WA 2R7QA 1QQP3 4BQ4A 5A33A 3AKTA 3E5QA 5HCFA 1HB1A 4WVWA 1SBDA 4MFDA 4FTSA 3PIJA 1E3PA 1LHUA 1OI6A 4HT1T 3WTYC 3D3AA 4FPHA 5F6LB 2QVSB 2M4GA 5GP9A 1BW6A 2R7XA 2G9GA 2FQPA 3CC7I 4RM3A 1Q8VA 3OYCA 1IUFA 1M06G 2WB1N 2MEV1 2VJ4A 3LWCA 5H2FC 1RUJ2 2K9NA 3PM1A 3HJRA 1UOBA 2DJNA 2ZMEB 4IEUA 4ATEA 2A6EF 1R64A 3POYA 2CAUA 2A07F 5FYUA 5CEHA 2QCOA 4AIDA 5FMDA 3RZHA 2VB6A 5FRAA 1AR91 1F36A 4A3IJ 5FB2A 9ANTA 5LHHA 2VMCA 4Y24A 1LNSA 2DMTA 1TWCJ 1ZN2A 1G9FA 4JX5A 5JOWA 2WNVC 2EXKA 4JHZA 3EYYA 4META 3K3NA 3OUHA 4NO4A 4AGVA 1GZWA 2EWNA 1YW7A 1QJU2 1WW7A 5DV5A 1ND2A 4XQ4A 3BR3A 4YGCA 4XOTA 3I59A 2QJVA 5A3MA 4OYUA 5KC5A 1AVBA 1UHWA 4HNTA 2A6HF 3TOAA 2R7DA 1OFSA 2C0ZA 4KWKA 4LOTA 1MW7A 1W1WE 4AQSA 2CY6A 1PMIA 1CPNA 4D3WA 2IPQX 5A7SA 4FP2A 1MH4A 5DUIA 2WT0A 1FNYA 2XJVA 3LOBA 1RUNA 1KA8A 5DDJ3 3LFIA 3TEDA 4M3GA 2P5KA 2R7ZJ 3JRFA 2WRAA 4A6OA 2X0LA 3O1PA 3HHGA 3BQZA 2WBMA 1DDNA 2GALA 4YRVA 4IHXA 4BE1A 3IDCB 3OIQA 5A6QA 4DY5A 5C4JJ 3S8PA 5LD2C 1FI2A 1PZ7A 4URAA 4QHZA 2YC4A 4F7ZA 3QPTA 1ST8A 2ESHA 4PJYA 4O7XA 3PO3J 1OOPA 2DYRH 2QQWA 3J7NA 4GA9A 3IB3A 2BY0A 3E6DA 5CYYA 4ABZA 2ACJA 2VBBA 5I93A 3ONQA 4M0HA 3AZZA 4ZZ5A 3QOEA 2X9DA 4OZXA 2RV8A 3A2KA 1V6LA 4GWNA 4XLFA 3GVAA 5BNGA 2XB5A 1SVMA 2KJBA 5BS6A 4DXZA 1PM4A 1SEFA 2VZVA 3CKHA 3CIHA 1IPJA 5CKQA 2H0BA 3NRVA 3I58A 3GHNA 2BNNA 4DEVA 5C6CA 3U10A 2XRNA 4B1RA 1FT9A 2GMPA 3WQ0A 1AJKA 4U7DA 2QDNA 4RD7A 4Z2AA 4ASNA 1WH7A 3I2FA 5A2QK 4EJTA 2FCTA 4NN0A 3G4SI 2WL1A 4IX7A 2RGVA 2OZJA 2VL8A 3T5XA 5FZ4A 2VW1A 5T5OA 1W0PA 4KT6A 5IYYA 5KHKA 1WFXA 3WDYA 3O0XA 2P37A 4YVSC 3MFCA 1EY2A 2J1SA 4MYEA 2HS5A 3CJIA 1V00A 3E0JB 1MNDA 4CA9A 4M4RA 1K5MA 1R081 4U88A 3K4CA 4AF9A 5BPDA 4UWDA 1GT0C 2ADUA 1X2MA 1LOFC 2V09A 5HODA 3QODA 1UZZA 1F8VA 2CUFA 3WF0A 2WWJA 2BE5F 4H14A 3UNPA 3HL2A 2ET7A 2W1SA 5A7WB 4WM8B 1IV8A 1QJZA 1ZLJA 2Y0IA 5J47A 2HLEA 2VW0A 2FUG2 1C8NA 2HQRA 1F35A 1LOGA 2VKDA 5F3CA 3BDDA 3W6VA 3M3CA 5HCHA 3RJPA 2W48A 1MNMC 1FV2A 2PHRA 4YZ1A 1K6YA 5BV6A 5FZFA 1C5HA 4XUQA 5FO5A 5J36A 4OQ9A 4UF0A 3QYEA 1EH8A 3H1MA 4QB6A 2XIGA 1QH7A 2NMOA 2DU0A 2ZFUA 5LGNA 4IEVA 4IHWA 1OKOA 2ZS6B 1XJAA 3TNQA 1HW1A 1GUUA 4PJ0C 4CCJA 3MKWB 2BY3A 2QA4I 2XPVA 4JK1X 1ZG1A 2COMA 3H5NA 4Z07A 2WZR3 4C3HJ 3CMEI 1FZPB 5FWJA 4P9LA 5H9PA 2LY1A 3JREA 3ABZA 2NLRA 4K1ZA 5LA0A 2AS5F 1D0YA 3T0YA 1KD7A 1QHDA 2XL7A 3I2GA 1FYKA 2ZTNA 3COAC 2WLPA 2C9KA 1G9BA 4Z82A 5CFDC 4YW6A 4QX5A 3HM5A 2VNGA 1B72A 4CXXA 1I3AA 1CR7A 4NUBA 3F8NA 1ETYA 4E4HA 2LTPA 2XLGA 5FYHA 1X82A 1H8AC 4UB8C 4F3QA 4KU8A 2ZGLA 1TE1B 3JRDA 1GP5A 1IHMA 1W2AX 5EWSA 3RVHA 2V9KA 4CDUC 3FHQA 5CFCA 4HDVA 3CCVI 3MF9A 5KHHA 2VOOA 3GZ6A 4HLYA 5K4LA 2FD5A 1VRBA 2Q8DA 2RMU1 3N7MA 1E5SA 4DPNA 4EM1A 3BN6A 1SAXA 1BOAA 3HGYA 5LEKA 2VG9A 3RWKX 4UHTA 4KMFA 4ASMB 1SD7A 4NPRA 1X9PA 4XF4A 3F23A 1DQ6A 3S7EA 4RR3B 2YU9J 2WY8Q 5FZGA 1MS8A 3AG3H 1ZX5A 1YRNA 1NX9A 1P4WA 5AONA 1OCOH 3WTUC 4FCYA 5L3GA 2D45A 1BR4A 2ZGMA 2L0KA 5T5PA 2K9MA 1W9WA 4IEPA 4OMDA 1RUG1 3FWEA 3OIOA 1BJAA 2GWRA 2IXKA 2QWWA 4OAZA 3SNMA 4L92A 2VMDA 4K7JA 2IXHA 3HRSA 1VAVA 4XJAA 2VC1A 1Q8QA 2X48A 2XKPA 2ZHLA 3CO6C 2E1NA 3I5UA 4BIOA 5BYNA 3JRCA 3TWIA 5J3UA 1ZELA 2NYYA 4CP9B 3LPGA 1D1BA 4QSHA 2I07B 1FY7A 1W8ZA 1YQAA 3D4KA 4XF0A 3BJOA 2J1EA 1ZTRA 4NNJA 4S2FA 1DFQA 2VQ0A 1O5UA 3J7YJ 2DFBA 1FTTA 2KM2A 3T4HB 2R3SA 3LOCA 1LCLA 2EF6A 1PGL1 4J6GA 5FRNA 4ZTJA 2K46A 4N53A 4V1PA 2R0FA 5CVRA 4A7ZA 3ZP5A 5L7OC 3S0MA 3LA3A 2D97A 3WNKA 4AQ2A 3P3NA 5F5CA 5CQGA 1C8M2 1YJKA 4GH4B 4XZPA 2Y31A 5E1XA 3R6SA 2MEV3 3APBA 5DD4A 4JGYB 3GDBA 1UOJA 3V7RA 1V3FA 3D5LA 1X1AA 4COUA 2VODA 3BWGA 4A3BJ 1U5TC 1AR93 5EZHA 1I3HA 3I3EA 5ABJA 5EPAA 3S2WA 3O2PE 3LEIA 1K83J 1WMEA 4KBZA 3TO9A 2DBBA 1SFUA 3GUDA 5A3LA