1J59A

Catabolite gene activator protein (cap)/dna complex + adenosine-3',5'-cyclic-monophosphate
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
199
structure length
199
Chain Sequence
PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the CAP-DNA complex at 2.5 angstroms resolution: a complete picture of the protein-DNA interface.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords 5'-D(*GP*CP*GP*AP*AP*AP*AP*GP*TP*GP*TP*GP*AP*C)-3'
total genus 53
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1j59A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1j59A01
1YW9A 5HDKA 2ISYA 1GXQA 1DPRA 4HAMA 5HS7A 2ETHA 4MEXF 4G9YA 1FZPB 5DEQA 1Y9QA 3I5UA 4DNCA 1LQ1A 1RUNA 3DP7A 4G6QA 2ELHA 3MZYA 4PDKA 4I7HA 1R7JA 4XFBA 4RGXA 2UYAA 4O5VA 1EV7A 4PIYA 5E18F 4U7DA 3ELKA 4MQ9F 4ZZDA 3OV8A 1FYLA 3HHGA 4MGRA 5FFZA 1O3SA 3SCFA 3H9AA 2QQBA 2FF4A 5CVIA 3ZPLA 1W5TA 4OFGA 1LNWA 2D2WA 2CQKA 4YSFA 1ZARA 3IKVA 1J0RA 5LHIA 3RKXA 3GUDA 4YIIA 4I2OA 1B59A 1OR7A 2YSRA 4MH0E 3OOPA 1UHMA 1IUYA 3ECOA 1BI0A 4LLLA 4LLGF 5I0TA 3ZP5A 5ICCA 3PNAA 1O3TA 2IT0A 1R00A 1HW2A 2J5OA 2CO5A 5BPXA 2ADUA 4Z07A 2JPBA 1CAXA 3RZZA 4E70A 2PFWA 1XDSA 3LA7A 4EJTA 4KICA 3IDCB 2UYBA 2FEZA 4EM1A 2DK8A 2VOPA 5JAXA 3HT1A 1KGSA 4BQAA 3TO9A 2G7UA 1USSA 3BCWA 4YRDA 1HKTA 2C6YA 4CDGA 4KMUX 1USTA 2EK5A 2A6EF 3LAJA 2MBFA 5D8LB 4IF4A 4LG0B 3FM3A 1Z1DA 3ML6A 4XFHA 1ZNPA 3DEUA 1SAXA 3WE2A 3K1MA 3GFLA 3WE3A 1JHHA 5D5VB 3MEXA 2Q0AA 3U10A 3CUQC 5AONA 1R58A 4AIHA 2H6CA 3E5QA 3WTXC 2QCSB 2DW4A 4WX9A 2BYVE 2VBZA 1KU2A 1FSEA 1ON2A 1ZZ7A 4LK0F 1O5LA 3CLPA 4CYDA 2F5EA 5BS6A 4A12A 1BN5A 3IBMA 2OZJA 1ZN2A 2EFQA 1MZBA 4HV5A 3SQNA 1XE7A 3WG9A 2IXLA 2Z3YA 2K4JA 3HRTA 4CHUA 1PM7A 3I64A 3I0TA 3JSOA 4PGHA 3T8RA 5DD4A 2CFXA 2PN6A 4Q29A 2VOOA 1IXCA 2TDXA 1J5YA 2HZTA 4XRFA 4RGSA 5L3FA 1W7PB 1XB4A 4EWDA 1SFNA 2BBYA 2Z69A 3UKNA 2VT2A 5CVJA 1BIBA 2EFOA 4M74A 2IA0A 3FMSA 1NXMA 1Z6RA 1VP6A 2OAZA 4XEZA 2MHFA 4ESFA 4WWCA 2B5HA 2PAMA 1D5VA 3BPVA 1YQAA 4A5MA 2FBIA 3JAMZ 2NS0A 1S6LA 2OPKA 2ZNYA 1QBJA 3M8FA 2EA4A 2ZKZA 3H50A 5C6CA 5E1WA 3FHIB 5KHJA 3GW2A 3M7GA 3EUHA 5J8FA 1DDNA 4D7TA 5FQ0B 3GBFA 2CG4A 3BU7A 4IXAA 3VODA 4F8AA 1EH8A 1MDMA 3HTSB 3P7NA 4MNUA 3L9FA 1ZGJA 5AIPA 3LA3A 4QGNA 4AVCA 1SD4A 2ZJ2A 4JK1X 4HF2A 1KQ8A 2Q1ZB 4XF0A 2O1QA 3LOIA 4EWEA 1DGRA 2Y0OA 4RGUA 4YNIA 1IZ1A 4OLLA 3EYYA 5I0SA 1P4AA 1Y3TA 2A3SA 5ILUA 2VC0A 3KP2A 2NYXA 1H9TA 4J1XA 5DD8A 4RB1A 3FMRA 4QXKA 2ZMEB 4YFNF 1F4KA 4WVZA 4BAYA 2FU4A 4M72A 5FQ0A 4KA4A 4META 4P9UA 2M1BA 1P4WA 3D0JA 1J7KA 4A0YA 2UWMA 3Q9VA 4KT5C 2FMYA 3DPTA 1G3WA 3F23A 5J3UA 1NYWA 4ORFA 4M9ZA 1S29A 1A04A 2Z5UA 4I01A 1ZRRA 3PQJA 4BIFA 2GXBA 4MZUA 1BC8C 3I58A 4IHSA 5F6FA 4R1HA 1J3PA 2EA7A 1QY4A 4OIRF 5DUIA 2P7VB 2STWA 2RN7A 5BY5A 1HQCA 2EFPA 1GQGA 1Q1HA 4UVAA 4ZH4F 1KYZA 4Q0UA 4U88A 4IEQA 2K86A 5D5XB 5CADA 4IPAA 3TOAA 1U12A 5FO5A 1XGNA 1PP7U 2WV0A 4UBGA 3G73A 3FZVA 3KLNA 1R1TA 1WKMA 4X6QB 5E20A 2W24A 2OYZA 2R3SA 2B9UA 1WWXA 3SFZA 4Y15A 4Q0SA 2LF8A 5E8IA 3HT2A 1J3QA 4IEXA 2EA2A 4WF2A 4HLYA 1PMIA 4Z82A 4KMFA 1ZG1A 5BV6A 1DP7P 4ZYEA 2PFBA 2LNBA 5HDGA 2DI3A 4OIOF 1ZRCA 3P9IA 1NE4A 3H7YA 3ZMDA 2GH2A 4EM2A 1Z05A 5KHGA 2O8XA 5BUVA 4LB5A 1X7NA 4BHPA 4XLPF 4AVBA 2ETEA 1NZCA 3O14A 4I0AA 3ZMVA 3BROA 1F9NA 2XLGA 3WGIA 5EFUA 3IWZA 3T8TA 2DAOA 3OF1A 4G94A 4AIKA 3MZHA 4FX4A 3F3XA 4KWKA 2OQGA 2E1CA 5ILSA 4ZYHA 2PHDA 1RGSA 3SHRA 5E16A 3RKWA 1O5UA 4Q0PA 2IXIA 2XIGA 4XETA 4CICA 1F1ZA 4R52A 2YR2A 3CL1A 5JR7B 1T98A 3ZDSA 4HQEA 1ZZ6A 3TDUC 4L9VA 1IN4A 3V4GA 4EGYA 2P4WA 2GAUA 2JPCA 1L3JA 1P92A 4HDVA 5JSOA 2A5YB 3TKYA 4L0ZB 4XF4A 1YLFA 1K78A 4BYYA 3GX4X 5BOXA 3R60A 3ZMSA 4TV7A 2KXLA 4KU7A 4A6EA 2XROA 1BJAA 3S7EA 1FNNA 2UZKA 2O61A 3W6KB 1Q43A 1BOAA 4YFXF 4UHTA 4XF9A 1CX4A 4WXDA 2GZWA 2QVSB 4FBFA 1FX7A 2X4HA 3C1DA 3G3ZA 3WU0A 2DPUA 1W7PD 2FA5A 2RDPA 3BWGA 1EP0A 1U5TA 1OYWA 1K6OA 1TW2A 2XVCA 3WU1B 1WSUA 2PYTA 3M70A 5D6FA 1J2XA 4YIFA 4S05A 4L0YB 3CEWA 1YO5C 4EGZA 2UXNA 3TO7A 4AXOA 1DPUA 2ESNA 5DV5A 4D0PA 3FM5A 1XSXA 1O4TA 2DBBA 1ULYA 3SZPA 3MQ0A 4HOBA 3QP6A 3FWEA 4N0BA 1X8MA 1VJ2A 3WTVC 4PJYA 1KU9A 4K2EA 2EWNA 3E5XA 5DUKA 1CAVB 4ZU5A 1WA4A 4ZU7A 2IJLA 2WFPA 3BPZA 4GO1A 3Q9SA 4OOIA 3P9CA 2ET7A 4LB6B 3TQNA 4UBHA 4RS8A 1RC6A 4M9XA 1QQIA 2QQ9A 3RDIA 1ZRFA 1HW1A 1SFEA 2FXAA 2HGCA 4U7BA 1T2KA 3FF5A 3BJ6A 5AVPA 4ETSA 4MEYF 5ICEA 1RIOH 3EHKA 2MH2A 2ESHA 4HQMA 2XHKA 4JTOA 3KP6A 2HQRA 1JE8A 3TO6A 3UKTA 3L09A 4FAHA 2AXLA 4Q0VA 1Q3EA 4EJUA 2VE9A 4YARA 1XCVA 4DQ2A 5F64A 2QNKA 2DK5A 3IDBB 1ZAOA 1WLTA 5FCCA 4Q4ZF 2RVCA 2ZXJA 3WODF 2QUFA 1OMIA 3DN7A 2ZMEA 3S2WA 4FT8A 3K1PA 2Q8KA 2XKOA 5FB2A 2VE8A 2CSOA 4GCVA 4BHCA 3VOEA 1ZG5A 2W57A 4LA3A 2XGXA 3E6BA 1BIAA 5I0RA 1B1BA 2XV4S 3RI4A 5L3EA 3L7WA 1YFXA 1OD5A 4HW0A 5JI6A 1ZZBA 4P9FA 3T5XA 2VECA 2VPVA 1TQ5A 2XL7A 2WTEA 2ZCWA 4ENJA 4G8XA 3RJPA 3FE5A 2COMA 3CTAA 3N97A 5KBFA 2QJVA 3NEUA 3H3UA 1HXDA 2V6CA 4HX7A 5HS8A 2W85A 1XN7A 3LSTA 4O9GA 4OIPF 3ECHA 2ET1A 1TLHB 2M30A 1U8RA 4HN1A 4OMYA 3RNSA 3KSCA 3OGJA 4E2GA 4IESA 5K1YA 3V7RA 3U1DA 2G7HA 1FP2A 1OYIA 2K7LA 2ZO4A 3KETA 5LEJA 3SHFA 1X8EA 3I59A 1ZRDA 3NJZA 4M9SA 5BPIA 1XD7A 1GVJA 1WQ2A 2PEXA 1J1LA 3K0LA 5J7MA 1B4AA 4O3MA 2KRFA 1ZVFA 3CJXA 4CXFA 3HOTA 1R23A 3H8UA 2MD5A 2V79A 3HRMA 4Y17A 3HOSA 4IEZA 2HTSA 4A0XA 2HTJA 2DO7A 5DDGA 1I1GA 1FI2A 2V09A 2QVOA 3C7JA 1QXRA 4Q0QA 2HYFA 3FXQA 5K8SA 1SEFA 2HR3A 3I59B 1I5ZA 3S7IA 2F5FA 3BP8A 3GFMA 5FLXZ 4ON0A 5D5WB 1GXPA 2M45A 2KIUA 2O0YA 5L3CA 5AIQA 1C0WA 2B0LA 4ZU4A 1OPCA 2L4AA 5I8TA 2B8MA 2Y75A 2A69F 1X82A 4XFAA 4EQQA 2W84A 3ES1A 1DZRA 3KEOA 4EWAA 2L3DA 5J8CA 1VR3A 4BHBA 1LEBA 2V1XA 4I09A 1ZYRF 1Z91A 3SXWA 5ED4A 2D5HA 1EH6A 3KP7A 5CVRA 2DCTA 3F72A 3NW4A 4R8HA 5FPZA 1FBSA 3JSPA 2FE3A 4N9HA 3ST7A 5E1XA 3KGZA 5ICGA 3GO5A 2GA1A 3KZZA 3CUQA 4GYIA 1S8NA 5KHKA 2KIMA 4GGGA 4EMSA 3GWZA 2FBHA 2YX4A 3ZN0A 5A2QZ 1HSTA 4WBBA 1XGOA 1SFXA 3BJAA 4HVQA 5D1IA 2RQPA 4RGRA 3QOPA 4KDPA 4KWJA 5K5QA 3LAPA 2HDCA 3F6VA 5HVQC 3L00A 3W6JB 4LUKA 2IW5A 3MPBA 2OU2A 1I27A 5D6EA 4IETA 5JFRA 3NVCA 4QMAA 2E9QA 1O3RA 1CAXB 1FOKA 2VXZA 2VODA 4P55A 1F5TA 2L54A 1HKQA 3C3WA 5E1ZB 1R22A 5HLHA 4O9EA 1E17A 1EYBA 1AOYA 5KHIA 4I0BA 5JR3A 1BI3A 3H1MA 1D8JA 1FY7A 2Z99A 4HYEA 4HV6A 3WTYC 1IRFA 4LG0A 4YG2F 1O57A 4Z2YA 1L3LA 3LQRA 3MDPA 4F7ZA 2NAZA 3QRFF 2FOKA 1TW3A 2J5PA 3JTGA 1TTYA 1G3YA 2RKHA 3LFKA 2PA7A 3DF8A 2VBXA 3DXJF 4GYGA 3I7DA 3QU6A 5H6QA 2QM3A 3ES4A 1SMYF 3ETQA 2LDUA 3WGGA 4HVOA 3U0ZA 2FBKA 4XFCA 2Q4SA 3H1YA 3H7JA 1U2WA 2HJIA 4EVIA 4A0ZA 1IAWA 2LF7A 4FAGA 1XSVA 5KK1A 4IRHA 1LR5A 1XDUA 3CDHA 2BE5F 4O6JA 2ISZA 3R4KA 1DZTA 3OD0A 1XE8A 3H1WA 5JSRA 1G3SA 3RTRA 5JSPA 1JXSA 4XBFA 2OA2A 1SD7A 2P17A 2O8QA 4IEWA 2JRTA 4KIFA 4UV8A 4Q47A 2KKOA 1OYYA 3ISPA 2H0VA 2HKXA 3HUGA 1GQHA 3SZTA 2RC4A 1EH7A 3GEZA 3G7DA 4CO8A 1KU7A 3TNQA 1B6AA 3TNPB 3J80K 5L3BA 1ZH5A 4HLXA 3RKYA 2P5KA 2BGCA 5D4RA 3VB2A 4UUVA 3U11A 4I02A 2BNMA 1B9MA 4LUMA 1LJ9A 1IW7F 2D5FA 3KGLA 3CUOA 3MYXA 5FGMA 1PDNC 5I93A 3JZVA 2K9ZA 3VHRA 2OZ6A 3O3KA 1RZ4A 2D45A 4MTDA 2VC1A 3V7CA 2OD5A 5HLGA 4LEJA 1MJAA 1S7OA 2QENA 3TOBA 1SD6A 5LHHA 4LMYA 3EQLF 1P4XA 2UY9A 1UB9A 1QZZA 2L01A 2CW0F 2DQLA 3HIFA 3WTWC 1UPIA 1NHAA 3ZMTA 4D7SA 4Y13A 3T0YA 2P6SA 2VT3A 3F8BA 1YTYA 1RL3A 2ZFWA 1MDMB 4I98B 4U0YA 1DUXC 4RB2C 3FZ3A 2HFHA 3LZZA 1UW8A 3QP5A 2GC1A 3H3ZA 1J9IA 2PHLA 3R0AA 1IN6A 3S0MA 3HSFA 3R61A 3C3VA 3F8FA 2IP2A 4A5NA 1FYKA 1AWCA 3HSEA 3FX3A 4AWXB 2XASA 3CO6C 3GZ6A 3M3IA 5E8GA 5C8WA 3ZN1A 5FD5A 5BXXA 3GYDA 1V3FA 2EFNA 3CO2A 3ABUA 4JQFA 2F4PA 5FLIA 3P9KA 5T3NA 2IVMA 3RYKA 2RV8A 1ON1A 1FT9A 5KHHA 4P96A 5JCTA 4HZFA 1YLLA 4X6RB 3QPHA 4XFGA 4XFIA 2MC3A 2UY8A 1YS7A 4HVRA 4IRIA 5ERIA 1YFUA 4XFFA 2EVXA 3WW3A 3V8LA 1Z6TA 1K7AA 3M1EA 4U0VA 2PQQA 2MLKA 3E3VA 1KA8A 3NRVA 1HBXG 2FQPA 1CAWB 5H6RA 5HS9A 2V1UA 6PAXA 3D5LA 5I8SA 4EJWA 4XSZF 4MHGA 3IRQA 3C18A 1O7LA 4RAZA 3F6OA 3BOQA 2VN2A 3LWCA 1S7AA 1RTVA 5F1RA 1FP1D 4RB0A 4FX0A 1H0MA 2HKOA 4BXUA 2QBYA 1ZGAA 3FHZA 5L3DA 3LWFA 4LD5A 5LBQA 1MGTA 2KJCA 1Z9CA 1LVAA 4JV4A 5HDNA 3QPTA 2QQAA 1IXSB 3BDDA 4M73A 3WTZA 4Q5SF 1MJ9A 2N7GA 4QLCU 1H1IA 5DCMB 4NVPA 3OTFA 2QYOA 3DKWA 4PGGA 2NNNA 3ABTA 1G3TA 4QGLA 5K5OA 1YFYA 4HSLA 4L18B 3HSRA 2GC2A 2KIFA 3DL3A 3B02A 2LSOA 2PI0A 1OFNA 2P8TA 4NHJA 2P5LC 1W5SA 1XGSA 3DFGA 4QGMA 4L9JA 2RNJA 1T39A 1KU3A 1QPMA 2MH9A 4S04A 2XUBA 4BH9A 1XRUA 1FWZA 2HEOA 5I91A 2Q0OA 1SFUA 2HOEA 3SCGA 3REOA 1LDKB 3EDPA 3QAHA 4G6DA 1MJBA 4HF0A 3FFQA 2DQRA 1OI6A 3EQEA 4LK1F 4U0WA 5E1RA 4GULA 4UVBA 2NNYA 1YHFA 3NKTA 1SMTA 4UXAA 3M8EA 2CYYA 1TNSA 4HSJA 1R5HA 4QX5A 2DLLA 2MPFA 2PLYA 4MGKE 1PP8F 2G9WA 5KVRA 2JZYA 3FJSA 1EPZA 2DFIA 2RGVA 1XSDA 4YYOA 1W7PA 3ERED 3JW4A 3R6SA 3QACA 3E97A 2XAJA 1JUHA 2ZBKA 3SCHA 1KQ0A 4H7LA 4ENNA 3BJOA 2D1HA 2PBIA 1UCRA 1U5TB 4ASNA 3F22A 4KYWA 5LRRA 2ZKLA 1BBYA 1RI7A 3ZQ7A 2OBPA 4OINF 2F2EA 3I54A 5LGNA 4QWQA 1NE6A 4PIXA 2VBWA 4A2UA 1R5GA 1QO0D 3GFJA 4EROA 1UHWA 2A68F 5EZWA 1UFMA 4L9NA 3KZYA 2CAVA 3EJKA 2VBYA 4WXCA 3KMHA 5CU1A 1PUEE 5IT9Z 3I4PA 2HWVA 3ACLA 3CJNA 3BB6A 1X3UA 1XMAA 2DTRA 2K4BA 1TQMA 3T1BA 1QXJA 2K27A 3HRUA 1FXZA 4HMZA 1D8KA 2E7XA 2MA3A 2WWYA 2MNGA 2K0GA 3K1NA 2R7DA 4L9TA 4A6DA 2GA2A 1MD0A 3J7AO 5LGTA 5TRDA 1REPC 1YWKA 1FBUA 2GXGA 4AIJA 2YU3A 2PMUA 4YFKF 1DGWA 1LKNA 4IRGA 4AQ6A 3EBRA 2K02A 4PZJA 3O2PE 5JVTA 2JSCA 5CVUA 2IRFG 2QDRA 3CO7C 1I1SA 2DPDA 3KCCA 4L5IA 1J58A 3RYRA 1CAUA 1TQIA 2L4MA 5FLHA 4IERA 4WK8F 2Z9OA 3IC7A 3OCPA 2H27A 4KL1A 3WTUC 1UCXA 3HHHA 1HSJA 3V8JA 5J6XA 4ZYGA 2CV6A 1ZLKA 2PAEA 2Y48A 1K79A 4LJZF 2IXJA 4TLFA 4KFCA 2O03A 1Q5OA 3NSTA 3VEPA 4QM9A 3K69A 1IF1A 1ZLJA 3DQVC 1VTNC 5D4SA 5DYMA 1BC7C 4MTEA 1V4RA 4XLNF 5IT9K 4HN0A 2YX7A 4H0EA 5E17F 2CAUA 4WCGA 3EETA 4G7OF 4UXNA 5BPDA 2EV5A 1ZREA 2PJPA 3ELNA 3B73A 1V70A 1CAUB 4HLTA 3BALA 1YYVA 3L2HA 3PLQA 4ESJA 4ENMA 4N9IA 5LEKA 2HQNA 2QWWA 1YFWA 2GC3A 1D3YA 5HI0A 2O3FA 2R7FA 2FNAA 3WTSC 2AS5F 5HLIA 3H92A 1MKMA 1T0FA 1KQ9A 1Z7UA 2EJRA 1HW5A 5LRSA 1IXRC 2GC0A 2JTVA 3MAJA 5BQTA 2BNOA 3ULQB 3ZMUA 3IRRA 2V9VA 2C0ZA 2P6TA 3LQQA 1LDJA 1R1UA 4WZCA 3KP4A 4IHTA 3GZ5A 1T38A 4ESBA 2DU9A 2P7CB 4KWLA 1ZG3A 3HTUA 1H1MA 4LFUA 4LULA 4ZZLA 5LGUA 1TBXA 3FMQA 2X0LA 5EEGA 1U78A 3E6CC 1YW8A 3NL1A 5J48A 3CLOA 1FC3A 4G7HF 3QU3A 3E6MA 2PAKA 4RD7A 3M9AA 2IXHA 4JVAA 1ZX5A 1ONVA 4ONUA 4IEVA 1G4DA 3WW1A 2E1NA 2XAFA 4P5OA 5FFXA 4OIQF 4AVPA 1ZZ9A 3NQOA 5I8YA 2OQRA 1YW7A 2JT1A 4ZYDA 4LLNA 2I45A 2P5VA 1GHCA 3TGNA 2Z2SB 4IEUA 2F5CA 1ODDA 2D40A 4KIBA 4BNCA 3F21A 3MWMA 2A61A 1ZZ8A 2PQ8A 3HYIA 4M71A 2ZNZA 1QWRA 4HDUA 1STZA 4L2NA 2YPRA 2Q2EA 3WGHA 2XKPA 4M6YA 1IN8A 2H94A 4JTNA 4HX4A 4LGWA 1FPQA 1O7FA 4J1WA 3ROUA 1YFHA 4IVNA 3KFWX 1R1VA 4JBAA 1S3JA 1OKRA 3GF2A 5EEHA 5ICFA 1CF7B 5D8KB 1XCBA 3U2RA 3FXRA 4CGZA 3FXUA 3K9TA 4MGZE 4LLOA 3PFIA 3COAC 2GIVA 4XF1A 2PMHA 3UKVA 2Z33A 3R0JA 3PQKA 3K2ZA 4B29A 2QLZA 4UV9A 2H09A 5ILVA 3F8MA 5A2QK 2UXXA 2XRNA 1B9NA 5FLJA 1YG2A 5FD6A 3WTTC 1QNTA 3CF6E 3USSA 3DPLC 4IEOA 4M6XA 4MV2A 4KIGA 1BI1A 3E5UA 3RYPA 3GVAA 3V8KA 3IKTA 3KE2A 5CLSA 3L2CA 3D0SA 2FMLA 1CAWA 1YUDA 3EO6A 2LKPA 2M5WA 4HA8A 1WRJA 3ZMZA 1ZZCA 3E6DA 2ATFA 5HOOA 4ENKA 4KN7X 1CAVA 3HQXA 4QM8A 4P9GA 2GQQA 4Q48A 3RPUA 1FLIA 2XLAA 4GXOA 1U3EM 2IXKA 1XGMA 2IPQX 2IA2A 3KP5A 2HYGD 4MQVA 3RPQA 5H20A 4KUMA 3KEQA 2BV6A 3WW4A 1CF7A 4MGIE 4KNYA 3GLXA 2EFWA 5IT3A 1UD1A 1K78B 1LB2A 1W4MA 5CVVA 3F8NA 3D82A 3U9GA 2GWRA 2XAGA 1JGSA 1Y0UA 2EB7A 5I0UA 2QZ8A 4L11A 5DCMA 3TDZC 4UNOA 1FBQA 3MCZA 5FLXK 2E7WA 3DV8A 3GFIA 3Q5FA 3KP3A 2ACJA 4MX3A 4B09A 1U5TC 2XAQA 5LHGA 4WXHA 4NB5A 1XMKA 5BMZA 4AD9A 1IPKA 3V7SA 3BPXA 4LA2A 4EJOA 2D93A 1QGPA 3BY6A 4IJAA 1IRGA 3WW2A 1RUOA 3IHUA 3KLOA 5L3GA 4MGYE 1FYMA 2PTMA 4MUVA 1G6NA 4IEYA 1J3RA 2EV0A 3GXOA 2Y0MA 5D5UB 2L02A 1U6GA 2OA4A 2HS5A 4FHTA 1QZYA 2XAHA 4UVCA 1O3QA 1P2FA 5CYVA 1CGPA 2CWEA 4XSXF 2XL9A 2O6GE 1KYWA 3I53A 3EYIA 3GYHX 3JAMK 1ZHFA 1HKSA 1R36A 1SD5A 2EAAA 3IIAA 3N4MA 3VFZA 2A07F 4NQWA 4DINB 4HX8A 1T6SA 3SMHA 1J59A 4AQ2A 3J80Z 1BI2A 4E2SA 2BNNA 4RB3C 3LAGA 2H6BA 2EV6A 1IPJA 4RAYA 4LTAA 1JHFA 3J81Z 2OZUA 2GU9A 3LA2A 4HBLA 2KJBA 4CZZA 1LDDA 3BZ6A 4KN4X 1WI9A 2M8EA 4G7ZF 1LRHA 3J81K 2QBYB 3JTHA 3MFKA 2XLFA 4KU8A 1P6RA 2Q30A 1BM9A 2NRAC 2DT5A 1YIOA 2FSWA 4HBNA 1J75A 2D1VA 5JHUA 3O6BB 4L5JA 3HRSA 3IWFA 1YS6A 5FDBA 1WGPA 4R79A 2F5DA 1H9GA 4AVAA 3F8CA 3RIRA 4XF3A 4PIZA 2MLGA 2FQ3A 2BEOA 1IN7A 2A6HF 4OU0A 4EM0B 5DCFA 1TNTA 2IA1A 2FNPA 2W25A 2V1DA 4EV0A 1EY2A 3AAFA 2WC2A 3IL2A 4K8FA 3I71A 1E2XA 1SQ4A 4IEPA 5TJJA 4B8XA 1IN5A 1RNLA 2FRHA 4OMZA 2IXCA 2M87A 5CJ9A 4I3PA 1FSHA 2VQAA 4E2QA 3SXYA 5K5RA 2STTA 2VONA 5FPXA 1TQPA 5LLQA 1L0OC 2IC1A 3PVBB 3CUQB 1UIKA 1LEAA 2PG4A 4HF1A 4EJVA 1UIJA 4PCQA 1I6XA 2CGPA
chains in the Genus database with same CATH superfamily
1QMJA 2HOSA 1YW9A 3KVAA 5HDKA 4EYUA 4AR2A 3I55I 1RUE2 2BVMA 3A0NA 4GMP3 2GMEA 1E3PA 3SEPA 5DEQA 4DNCA 1LQ1A 3DP7A 3K48A 2ELHA 1ZELA 2DCZA 2ZZQA 1FYLA 3H9AA 3MIFA 2FF4A 4GXLA 4F52A 1FOXA 2HQ5A 2IBDA 5FZIA 2CQKA 3ZLIA 4YSFA 3RKXA 3GUDA 4LLFA 3K4AA 4YIIA 2YSRA 3CJQB 3ASIA 3VYUB 4LLGF 4NO4A 2LG4A 2BQPA 3RS6A 2QBXA 3HJEA 2JG9C 4R9DA 1R00A 1MZ5A 3VBUB 3A23A 5BPXA 1YJLA 2JEMA 2JPBA 1H8TC 3CCEI 1XDSA 4XQWA 4IOAF 2HOAA 4AHWA 2R063 4XOGA 1WMEA 1U0AA 4PT6A 1F5JA 1OQDA 2LUWA 4YZ5A 3TO9A 3GCXA 2G7UA 3BTYA 1USSA 1W8OA 4CPBA 1USTA 1YE9A 2MBFA 4AG4A 4C0BA 3FM3A 4XFHA 3CZUA 4G6TB 3WE2A 1OLRA 1JHHA 5D5VB 3MEXA 4YM3A 5AONA 3NWTA 2QCSB 2PHWA 4WX9A 2NMNA 3W3CA 1MS4A 4BB3A 1W0UA 1FSEA 4LBLA 1ZZ7A 4QPOA 3S32A 5EJZB 1IZ3A 2F5EA 4RS5A 1HRV3 4UWDA 4A12A 1FTTA 4HV5A 1MZBA 2DMPA 1AR82 3AMQA 3RCOA 1GMMA 1U9NA 2Z3YA 2R073 3ACHA 3T2PA 3HRTA 4E4SA 1PM7A 5HNFA 2VOKA 3J7AY 1PO21 3RZOJ 3J8F2 1YI7A 3I64A 1A5JA 3I0TA 4CDUA 3JSOA 2Y9YA 5DD4A 2CFXA 1VBC2 1XOYA 1J5YA 1T2XA 5L3FA 2J7MA 2BBYA 2QQVA 4NE9A 3B3QE 2VT2A 2EFOA 2OQ6A 3HOZJ 4LO5B 2JG9B 5FY0A 1G9AA 1EV13 3WNMA 4PUSA 3ATGA 2AREA 1ACIA 1PVXA 2B5HA 3M07A 2Z42A 4PCRA 3BPVA 4S2HA 3LKJA 5A32B 4A5MA 4INDA 2FBIA 1TME3 2Y33A 2NS0A 2MG4A 4Y1VA 2ZNYA 2I5UA 1O4XA 1LFPA 3W58A 4IDZA 3HOBA 5FIXA 4UFLA 5J1RA 3S14J 3M7GA 3EUHA 1BR1A 1WBFA 4XMAA 3GBFA 3BU7A 4IXAA 2PMZN 1GU3A 3HTSB 4EE2A 3S57A 4MNUA 4FPHA 4NHYA 2ZJ2A 1IS3A 3MBWA 2Q1ZB 4XF0A 2O1QA 1OURA 3D4KA 5CBLA 1VQ9I 2YROA 1P4AA 1Y3TA 1PUFA 5L7OB 4IV3A 4E9KA 1H8VA 4RB1A 4GQ7A 2FCUA 2DA6A 1IGOA 1SLAA 5L19A 2LLKA 4P9UA 3VN4A 1Z0XA 5LB6A 5FZFA 4J25A 5JHFA 2FMYA 1LPQA 3JCIA 2J1UA 4ORFA 1K5MC 4I01A 1RYYA 4KH9A 3VBFA 3E1SA 4IHSA 1VALA 2E53A 1RITA 2M34A 4R1HA 2P7VB 3JRBA 2CU7A 1HQCA 2XSDC 1AR72 4JP0A 4RHV2 1Q1HA 3G1MA 4JKMA 3HMYA 4MFDA 4DXZA 2HDDA 1NLQA 1V6NA 4AI9A 3A4UA 4JX0A 3HB9A 1ULGA 1DLLA 1CZVA 1PO22 5D5XB 2CYFA 4IPAA 3TOAA 2A6ZA 1PP7U 2HWB3 3OBZA 1W9TA 4XE9A 2W00A 1LGNA 5C3PA 3WD5A 1R1TA 1UZWA 2CSGA 1XG1A 4CZSA 1MQTB 2KISA 5E20A 1TWHJ 1D0HA 3HBLA 1K45A 2DT6A 3K4CA 2VIXA 2EIEA 4IEXA 1R082 4H14A 2EA2A 1PMIA 1ZG1A 4ZY9A 2GXAA 2LNBA 3LD8A 1Z78A 5GPAA 3MFAA 2XJUA 1N1TA 3H5RA 4EM2A 2ZEWA 2O8XA 1AYN3 4BHPA 4XLPF 2ZAHA 1GWLA 2QDNA 3DF0A 2ZXQA 2ETEA 3ZN6B 4CSWA 3ABKH 1W9SA 3ZYJB 3TEWA 3T8TA 2DAOA 1Z67A 2LC2A 4G94A 4AIKA 5T52A 4RMNA 4FX4A 4XOPA 3AKQA 1S2BA 3PL0A 2E1CA 1RGSA 3SHRA 3RKWA 4AVTA 5HNHA 3M3CA 3ZN4A 1XTAA 3J7YJ 3MKLA 4NIHA 1TT5B 2NS8A 2FCVA 5LWBA 3KYCB 2WNOA 4HQEA 3TDUC 4L9VA 2OPWA 3PJQA 3V4GA 2L9LA 1LVKA 3MZ8A 2K85A 1MS9A 2JPCA 1P92A 2B63J 4C8DA 1DLCA 1ZA7A 1RUD1 3MV11 1WH7A 3ZMSA 2A71A 2GP5A 2XROA 1BJAA 1XSRA 3W6KB 1EAH3 2LY1A 1LAJA 2R7TA 1A8DA 4WXDA 2DA5A 3FL7A 4GKYA 4FBFA 4XBNA 2XMLA 2X4HA 2LW8A 3G3ZA 4IE7A 4J6GA 2ECCA 4JQTA 2EQRA 2RDPA 1WZXA 2AXTC 3CKHA 3WU1B 3H0OA 4ZONA 3AFKA 3M70A 5D6FA 3TO7A 1DCSA 2ESNA 5DV5A 5DAVA 2NYYA 1QKQA 2XH6A 3TN91 3VBFC 4HT1T 3NV3A 2O5RA 3NAPC 3BQYA 1VJ2A 3CZ6A 5GTHC 1DG6A 4K2EA 4UF0B 2KPMA 3E5XA 4CDQA 1QU0A 1SANA 5IVEA 2WFPA 3BPZA 3BOPA 4GO1A 4OOIA 3P9CA 2R7EB 4UBHA 3WNOA 3DPRA 3VKFC 2RR13 2NVXJ 2HWD3 1QQIA 2PX9A 1ND3A 1Z21A 5A3LA 5F0FA 4U7BA 2RMU3 3D5OA 4DW6A 3NJXA 4ZTJA 3LSMA 2RDNA 5IY5H 1BKZA 3EHKA 2ESHA 4HQMA 4D7MA 4GB32 4E8CA 1UOBA 4CCJA 4E7JA 1SG3A 3ABLH 3P5JA 1S0BA 5HV0A 1CD3G 2AXLA 5A3OA 1RR8C 4Q0VA 1QJZA 1UMQA 4DFSA 2JIJA 4DO0A 2DU0A 1GKBA 1JZ6A 4MHUA 3F0CA 4YM2A 3NV4A 2DK5A 4AM3A 4GH4B 1ZAOA 4Q4ZF 1ASJ2 2BY1A 3H42B 5CZKA 1OMIA 2ZMEA 2W52A 3ON7A 3GTKJ 3LIGA 3CIHA 3VOEA 1SAUA 2AQEA 1XNKA 3OYLA 4WZFA 3RI4A 2JDYA 3FMGA 5L3EA 5IPAA 1POV0 2MGQA 1MR5A 3ZXLA 1MIJA 1VMFA 4PHZA 3WOGA 4HW0A 4JDMA 2CL2A 1ZZBA 4P9FA 1EUTA 2OJED 5CIRA 5L7OA 2WTEA 5F3GA 4G8XA 1ND2C 5J36A 5KNLA 3A0KA 1HV0A 3NEUA 3H3UA 1HXDA 5FPBA 5HS8A 2E71A 1UG0A 1XN7A 3LSTA 4O9GA 4OIPF 3ECHA 4H55A 1Z7S2 4RM3A 3RNSA 4MFEA 2VY0A 3OGJA 1A34A 4E2GA 3N3HA 4CRQA 4TN7A 2VOWA 4P5HA 3URFA 1SVMA 1FP2A 1OYIA 2ZO4A 1VBA1 1IGNA 5LEJA 3SHFA 3I59A 5BPIA 5IHRA 1XD7A 3AB0A 4O3MA 1W1WE 1ZVFA 3L2WA 2RS13 3HOTA 4IO9F 3NKGA 4X8PA 1MMNA 1S0GA 1UZZA 3TAYA 4Y17A 2PLV2 3RG0A 1AYM1 3H8OA 4AEDC 2PMZA 1I1GA 2JG9A 3Q8FA 1QXRA 1T0FC 1LHVA 2HYFA 4O65A 3I9V2 5CFDA 3K4MA 3U1XA 1CWPA 3S7IA 1JS9A 4ES9A 1O8PA 5FLXZ 5D5WB 4Y26A 2KIUA 3CCSI 1YHQI 4GRIA 1C0WA 2B0LA 4K20A 1TME2 4ZU4A 2JWTA 1OPCA 1YJ9I 3P3NA 1UELB 5I8TA 1D4M2 1AR61 2VPRA 2IAIA 2VUDA 2E19A 2W84A 4Q4Y2 1URXA 2ZJQF 2XVLA 1BJQA 3KEOA 1K4TA 5CKMA 4BHBA 4XN3A 5LA0A 2V1XA 4I09A 3I4IA 5DABA 2D5HA 3C7GA 1EH6A 2ZPXA 3KP7A 2DCTA 3FBIB 3TEDA 3T30A 3SH3A 5IOYA 4R8HA 3OUJA 3FKJA 4U87A 4AE2A 1GNZA 5JOYA 1P9QC 3C7OA 2WAAA 2FE3A 4DRRA 3POJA 1R1A2 1PUFB 4XN0A 4ISQA 1I39A 5FJHA 2RMU2 5ICGA 4PJJA 1W39A 1ZYBA 4E7IA 3KZZA 4IHVA 3CUQA 4GYIA 2R042 3ZN0A 2A6WA 1SFXA 4HVQA 5C71A 5D1IA 2RQPA 2ZX1A 3THTA 4URAA 3QOPA 4D5FA 3LAPA 5FZMA 3SH5A 1IUFA 5JI9A 5HVQC 4CP2A 3L00A 3W6JB 4J00A 1I1EA 5LCWL 2IW5A 4BKXA 3D1NI 1V0AA 2WRAA 2NQYA 4Y3OA 3VBUC 4QMAA 1B72B 2W5FA 1VZ0A 4AGRA 4RBOA 4YZ4A 1CAXB 4OWRB 4E7HA 2BFUL 1RVF1 3KCYA 4X1EA 5E1ZB 2O14A 1EYBA 5JVVA 3O1RA 4Y7NJ 3IKWA 1QRYA 5KHIA 3MICA 5DDJ3 5L7OC 1S4CA 5BNPB 4RQPA 2IFWA 3H1MA 5FYBA 2Z99A 4YVSB 3B5LB 4N43B 3TRSB 4CDQB 3FLTA 5FYCA 3Q0UA 3C7HA 5FY1A 1IRFA 2LALA 2CWSA 2BW3A 1H89C 1O57A 3BZKA 3I3DA 5J40A 4Q4X1 3QRFF 1TTYA 3DF8A 1HC8A 3NNJA 2YYOA 3I7DA 1KJRA 2WQ8A 2DVFA 3QU6A 5H6QA 1S7EA 4D69A 1ALYA 1F8VA 3LIHA 2XONA 3V0AB 3QLQA 3JBG3 2Q4SA 1HV1A 4YM1A 1GANA 2WQ4A 2HWC1 4FTSA 2B7YA 2JECA 3VUOA 3AXDA 5DAXA 1V5FA 2XJVA 2LF7A 4XDQA 4FAGA 1W6OB 4AHZA 1ZR2A 1LR5A 1XDUA 2BE5F 1LGCA 1VBE1 4GMP0 3GJAA 4RFRB 4Z2AA 1RHI3 3OD0A 5GLVA 2IVIB 1VBD1 2DU1A 2JENA 3H1WA 3S1NJ 5ISLA 1IS6A 5JSPA 1R4NB 3J8F1 4FFFA 4XBFA 1S0IA 2OA2A 4WM8B 1SD7A 5F5CA 2JRTA 4CUBA 1RUF1 3FFZA 1R1A3 1OYYA 2H0VA 3ILNA 3M3EA 1AR81 1LCLA 3CJRB 3ZOIA 2WO7A 3HUGA 4XUPA 2LKSA 5FZ0A 2HH9A 3A01B 1MBHA 5EGOA 2YS9A 1VBB3 2OT7A 3TNQA 4YW4A 3POWA 5IP7J 2DOFA 2QKMB 3I3MA 2BGCA 4CDXC 5D4RA 5J09A 3U11A 1CPNA 2FDIA 2HBTA 2W7NA 5T5LA 1OUSA 4PFOA 1KJLA 3JRFA 3WF2A 2CMPA 2K46A 1IW7F 1YIFA 1JOJA 2VZTA 4XQDA 5I93A 2OZ6A 1RZ4A 4S2DA 3L2YA 3OMYA 1W6QB 4A3ZA 5FP4A 1TWGJ 1NQDA 4XL9A 2RAEA 3K7AJ 4Q4V2 4LMFA 4KJZA 3TOBA 1W04A 5LHHA 5C3OA 3JREA 3QCWA 5JVGF 5LW9A 1OUXA 2D6MA 2L01A 2E1MC 3MLLA 4DBQA 1UPIA 2HXOA 2EAKA 3L1PA 2AUYA 4EN6B 1NHAA 1GUIA 3RZMA 3KF5A 1WH5A 4N7IA 5FPVA 4AAXA 4BJ5C 1QVTA 4JGYA 3BR0A 4D6RA 3FZ3A 2HFHA 1CESA 1IDZA 1I3QJ 5J1YA 1DU6A 1Q8OA 2HWB1 1OISA 1AL0G 3WINE 5C4WB 1FYKA 2IP2A 1AWCA 2EF6A 3AP5A 2CQQA 2JVGA 3LSRA 2XASA 2VZSA 4BE2A 3CJIA 4D8MA 3N9MA 5C8WA 2V72A 5BXXA 3OYKA 3VBRA 4BLJA 3CO2A 4XMYA 1WHUA 3P9KA 2VVFA 2A5ZA 5T3NA 1PYVA 3IM0A 3PUBA 5KHHA 5LBBA 4OUSA 4X6RB 3QPHA 4XFGA 2X05A 1RUE1 2DUPA 4QHZA 5GJ6A 2Y6HA 1YS7A 5JLWA 4HVRA 4IRIA 5CFDC 1GSLA 5ERIA 1MSFC 3IUOA 4QPIB 2EVXA 1X1AA 2DFHA 4IL6C 4B8EA 3CJTB 3V8LA 1Z6TA 1T6BX 5F0CA 4F3QA 5EF6A 2BY2A 4KG8A 1HBXG 3T09A 2NPIA 4QSHA 5HS9A 4TYSA 6PAXA 2CTVA 3C18A 4RAZA 3F6OA 3AJYA 3BOQA 4A93J 2DYSH 1BXHA 2F4OB 4CE8A 3LWCA 1RTVA 1N78A 5F1RA 1FP1D 1EA3A 4BA6A 5A33A 5L3DA 2NVTJ 4LD5A 1FOYA 1Z9CA 1LVAA 5HDNA 2WABA 1TE1B 1BW5A 5CG8A 1IXSB 1NCRA 3LL7A 1DP0A 3VD7A 1P8JA 4RR3C 2N7GA 5IYBJ 3OTFA 4DB5A 3DKWA 4PGGA 3ZCOA 1G3TA 2M9HA 4CCNA 4B1RA 2LR8A 4QDRA 2A1XA 1YNAA 1QIQA 4LBQA 5F6LB 4DQAA 2ICWG 3VBUA 1HRI1 3ORJA 1XNCA 1LKXA 2RS12 4C2MJ 1XRUA 1UXZA 2CUEA 2ZGKA 2ZJPF 3REOA 1YIJI 1IOAA 4G6DA 1OFSA 4HF0A 1WCDJ 3FFQA 4NHMA 1UQXA 1G7YA 3EQEA 1MBFA 1JZ7A 1WW4A 3WF4A 2K3FA 4UVBA 3MKWB 4OAZA 3K3NA 3H9GA 5B66C 5F5QA 5HLTA 2QZ2A 3M8EA 2NP0A 1G9CA 4F3JA 2CYYA 4HSJA 1GR3A 1R5HA 2RR11 2HWD1 2DLLA 1VF9A 5DZGA 4B4PA 1UY2A 5KVRA 1U0JA 3FJSA 2C5DA 1BK0A 2JA5J 1WMFA 3V0BA 5IVVA 1RUH1 4YYOA 1LOFA 2XPWA 1Q8PA 3JRDA 3ERED 3R6SA 1P7IA 1OR7C 2XAJA 1JUHA 2ZBKA 1KQ0A 4ENNA 3W6VA 2VCMA 1DQ1A 1UCRA 3EB7A 1U5TB 4UFIA 4DRVA 1QXPA 4LR4A 4JCKA 4YFWA 3RMXA 5LZ6A 3OYEA 4JAAA 2DA4A 1UHWA 2A68F 2RQQA 1QEXA 2GMMA 2CAVA 4WXCA 1LHWA 1ENRA 1LGBA 3I3EA 1Z7LA 1Y1VJ 3I4PA 1ETOA 5J4VA 1VRH2 1XMAA 5DUUA 1W6QA 1LFUP 1TQMA 1QXJA 2ID6A 1OKOA 4HMZA 3HRUA 2MA3A 4KGGA 2VASA 2R7DA 5FY4A 2Q8DA 4A6DA 1MD0A 2WZEA 3J7AO 5FOBB 3OL4A 3O1VA 3LSJA 3GZEA 4KISA 1DGWA 2YU3A 4OULA 2EXKA 1LKNA 4AF9A 1G9FA 3EBRA 4AYBA 2VZOA 2Q1MA 4XKBA 2K02A 5CKNA 4CEYA 4CCKA 1IG0A 1O59A 5LY2A 2JSCA 3BUCA 2IRFG 2QQIA 5BNPA 2VE1A 1YYNA 2QDRA 3CO7C 2PHTA 3MLJA 4QX7A 1QJX2 1CAUA 4WK8F 3PO3J 3WTUC 1CPMA 3VYRB 1HSJA 5DZEA 1ZLKA 2XWBB 2IXJA 2W1OA 3USUA 1F35A 1N3OA 1Q5OA 3VEPA 4ARXA 1JYIA 1S0JA 3LF7A 1XS9A 3G1OA 4KT6A 4XNFA 4M3CB 2M0MA 4XLNF 5IT9K 2FDJA 4GMP1 2YU2A 3QQAA 5E17F 3ONQA 2CAUA 1FV3A 3LFIA 2EXJA 1RUC1 3L2HA 5FKBA 3PLQA 4ESJA 3PNTA 4QTRA 4MHRA 4YW1A 3AZYA 1JUSA 2HQNA 1CJPA 5M5YJ 2GC3A 1D3YA 1C8M1 1PO11 4HPKB 2R5YB 2E2JJ 4JX5A 3WTSC 5HLIA 1MKMA 5JPMB 2GC0A 2JTVA 4CU7A 2D5VA 3MW3A 4QPWA 1W90A 3IRRA 1GYKA 2K2SA 4A3EJ 2V9VA 3P3PA 3CMGA 2A6VA 2ZBJA 3KP4A 5GP9A 1V5EA 1SDDB 2PHFA 2G4IA 2VPLA 1ZG3A 3S93A 4ZZ8A 3W20A 4UFKA 3GM8A 4LFUA 3KYLA 4ZZLA 2VH9A 2UURA 5F2SA 2X0LA 5IWFA 1U78A 3E6CC 1BEV1 3E6MA 3H0GJ 3PSIA 2PAKA 4RD7A 4XKVA 4Y20A 4A3CJ 4ONUA 3BZCA 4IEVA 4QPIC 1G4DA 4AEKA 4IE4A 2QQLA 4P5OA 1Q1VA 3ZN6A 4IE0A 1F4AA 1UYZA 4RL7A 4M6VA 3JRAA 3I3QA 5I8YA 1R1ZA 2OQRA 4QX8A 1VBC3 2NVUB 4DBRA 1VBB2 1QOTA 4KIBA 2VULA 3DCFA 3MWMA 2WT2A 3M1HA 2O0OA 2ZX0A 2VVEA 2VB6A 1ENXA 4Q4W3 4M71A 1U5YA 2X53S 1G86A 1QWRA 3POFA 2XPUA 5JUVA 2RR12 4HDUA 1STZA 4LKSA 1DHKB 3ZMOA 2R7VA 5FZ7A 5EHDA 1DQ2A 4F83A 2H94A 4JTNA 3OGRA 4HX4A 2UWCA 1TP4A 1YFHA 5F3EA 4IVNA 2HQAA 2OUHA 1ONAA 5HPOA 1R1VA 1CF7B 4CCOA 3E7LA 1XCBA 4LLOA 3PFIA 4XF1A 1JJ8C 4TSVA 3UKVA 2H1KA 1GP6A 1IG3A 2YHJA 4FPOB 4QHOA 3FN9A 5GAGJ 3DBHB 1V6IA 2WWSA 1ENQA 3ZQQA 2QLZA 1ZR4A 3ZQGA 1JZ8A 5GADJ 1OPMA 3OY8B 1RKWA 3O1OA 2JVHA 2BPA2 4NIDA 1HRI2 5T5OA 5A7OA 4XUTA 5FLJA 4DIQA 1BLZA 5FD6A 4XTMA 5FKMA 4IEOA 4M6XA 4MV2A 2VQHA 1K83J 3GVAA 2WINB 2OUMA 5CLSA 2YC4A 5IYCJ 5FXXA 3HKZA 2Q1FA 4AFDA 1YUDA 3EO6A 5DM7F 3IPVB 3VZOA 2LKPA 1KS4A 5GZFA 1DDLA 1ZZCA 5GM0A 1GUUA 4KWUA 1MMGA 2GIZA 2WZPP 3A0HC 2WT1A 1FLIA 4XC9A 1U3EM 5EG0B 2WFF3 3HPGA 2XVKA 4KUMA 3BCBA 2RS51 4MGIE 2CW7A 5FLVA 4BOWA 5CVVA 3U9GA 2XG3A 4H7MA 4BCUA 3I2HA 2QZ8A 5A7NA 3TDZC 4UNOA 4CDWA 4JRLA 3JUUA 4WM8C 2QFEA 1WD4A 1JYXA 5FLXK 2E7WA 3DV8A 3Q5FA 3DU5A 1LODA 4BEHB 1W8HA 1BMV1 1XMKA 2VZUA 4N90A 3J4UH 2ZABA 5JPNB 4EJOA 2D93A 3I3BA 1BW6A 1POV3 2X6YA 1IRGA 2I8DA 3WW2A 3IHUA 2GLOA 3KLOA 5L3GA 3OB8A 4CDXB 2RM21 3OEBA 4FQZA 1G6NA 5C4XJ 1REFA 3IAS2 3QH7A 1T56A 2K3PA 4FTBA 5EIYB 4AHXA 1QZYA 2XAHA 3S1RJ 4UVCA 1GZWB 4L99A 2CWEA 4XSXF 2XL9A 2O6GE 1XU1A 3QOEA 5LA2A 4CUAA 1VI0A 5EZGA 3FHQA 3GYHX 1ZHFA 5C7GA 4ZYAA 1WPKA 2JD9A 5H9RA 1VIWB 3LPFA 2R49A 3VFZA 3C8XA 3N9NA 2VW1A 4CA0A 4NQWA 1C1LA 4DINB 5A3WA 1T6SA 3SMHA 2W2IA 4E2SA 2BNNA 4LPLA 3LSKA 3VPRA 2EV6A 4XXAA 4RAYA 4CCMA 2OZUA 4IGPA 2GU9A 3LA2A 1R5ID 2KJBA 4CZZA 3BZ6A 1JKPC 2R16A 1AYN1 5FOJB 4G12A 2OS2A 1FIAA 2QSGX 2HBUA 3CMEI 4HBNA 1OOPB 5JHUA 5F1JA 2XJRA 2LKXA 1QJU3 3KYDB 1WGPA 3U78A 2VZVA 1R091 3RIRA 2MLGA 1O6UA 5AFBA 1UYPA 1YI9A 2A73B 2EIKH 2DJIA 1DQ4A 1TNTA 2IA1A 2B9VA 3QYFA 4WVMA 3BYWA 2Y6JA 3SH4A 2ARBA 2V1DA 5KAIC 2VLAA 1W3XA 2DOEA 1ODNA 2WC2A 3IL2A 3I71A 4BE3A 1VQ6I 3IH2A 2RS31 5AFEA 4V1PA 2CJJA 3D5SC 1IN5A 1H8TA 4OMZA 3AKZA 1RUF2 3JD73 2WV1A 1CR7A 1AX0A 3SXYA 5K5RA 2QQJA 5G04L 5C3QA 1TQPA 3F2ZA 1H6YA 3UETA 2IC1A 2GN7A 4DOUA 5D8AB 3CUQB 1UIKA 4PCQA 2WY7Q 2JICA 2P3YA 1ZBA3 1I6XA 2P81A 1GXQA 4B1MA 1POQA 4BLIA 4AEJA 3RQ0A 4MEXF 4FTHA 3I5UA 3B6AA 4BY1J 1X3ZB 1XC5A 3KM5A 3DBRB 4XMIA 5FYTA 3MZYA 5EPAA 4PDKA 4RGXA 2UYAA 3CF2A 1NCQB 4PIYA 2VBBA 4MQ9F 3OV8A 4MGRA 2Q8CA 3M4OJ 5HXMA 1QQP1 3ZPLA 2VTXJ 2HOTA 1W5TA 3MF9A 4QKBA 1J0RA 5AVAA 2QE3A 1HDKA 1OR7A 2GSYA 2F5VA 3CCYA 1R9TJ 1YIPA 5I0TA 3ZP5A 3HWJA 1ULPA 5DUXA 2LTPA 3HJRA 5ICCA 1APLC 3RQ4A 5LK7B 2CO5A 3QWLA 2X5IB 3TEYA 4R4XA 3UGFA 4Z07A 4BK4A 2ZGLA 4OQ9A 2PFWA 3LA7A 3CBNA 4XRMA 3IDCB 1NUKA 2UYBA 2VOPA 4YRDA 4URTA 1HKTA 4N43C 2A6EF 1JBCA 1OKQA 3FLRA 5D8LB 4IF4A 1MMAA 3HEIA 1A78A 1BL0A 4NR1A 3DEUA 3VBHC 1AL21 3GFLA 3WE3A 2Q0AA 1ZM1A 3U10A 3CUQC 1UPSA 4AIHA 3E5QA 1RR7A 4FQ4A 5JXIA 4YZ3A 4XM3A 2BYVE 4DY5A 1X9TA 2ECBA 2IS1A 5KC5A 4JGZA 1UG2A 4AI0A 3K4ZA 2TRTA 4XDOA 3CLPA 4CYDA 1HB3A 4MVTA 3RWNA 2XDVA 5FO9B 3ILFA 2EFQA 3WG9A 2P37A 1PO12 1NCQC 4CHUA 3GXUA 2P3KA 2E1OA 1MZFA 4AQTA 2WSVA 3B7MA 3T8RA 2XGCA 2PN6A 5LA1A 1D4M1 2VOOA 3H9JA 4CCEA 4HPQA 3DCQA 1TME1 2TDXA 3POSA 4RGSA 1D0ZA 2JKBA 3FLPA 5CVJA 1BIBA 1JYWA 3K70C 3CNAA 2EZHA 2IA0A 1NXMA 1DGWY 1G59A 3AMMA 2MHFA 1A6IA 2OIIA 4ESFA 4WWCA 5EV7A 2PAMA 2DTZA 1OFCX 2DMUA 2B39A 4AI3A 1L7LA 2EA4A 5K0UB 3KV9A 3H50A 1HOMA 3WG4A 5E1WA 3VYTB 3FHIB 4XACA 5KHJA 2WAQN 3GW2A 5J8FA 1E5SA 4AVZA 4D7TA 2CG4A 2HI3A 1LECA 2UWBA 3OYJA 4F8AA 1EH8A 2Y0SA 3L9FA 2Z16A 3P1IA 4KQ7A 3LA3A 4COVA 1SD4A 4JK1X 5F04A 4LBMA 2Z5WA 2R7SA 3LOIA 4EWEA 3CESA 5C8CB 2ENRA 1DGRA 1W8FA 1AZDA 4ABZA 4OLLA 3U4SA 2BY0A 1WLDA 3QYEA 5FP7A 2CGOA 2VC0A 5LBEA 1MS0A 2PHRA 1H9TA 1XXNA 4QXKA 5JLVA 1SBEA 3G6EI 1F4KA 4BAYA 4M72A 4KA4A 4TWTA 1DBNA 1P4WA 1F2NA 1MZEA 3H3VK 3IMMA 1S5LC 1N1SA 3Q9VA 3RFRA 5HV4A 5J3UA 3ZYPA 1NYWA 4M9ZA 4LHKA 1A04A 3G1LA 3VWBA 4DUVA 1ZRRA 4RGGA 3PQJA 1Y4WA 3WDWA 4UOJA 5F6FA 1J3PA 2I74A 3UGGA 4NJ4A 3IN9A 2PHXA 4LHNA 5DMYA 4IV3B 2M7BA 1W6NB 3QBQA 1LOGA 4UUSA 4C3IJ 2O7OA 4UVAA 4ZH4F 3FXLA 2DURA 1BHGA 1KYZA 1MW7A 4F55A 4U88A 1NT0A 4FP3A 3ZMNA 1YCIA 1U12A 5FO5A 1XGNA 2A5WA 3KHBA 4YGEA 4LOTA 5C33A 2ZGSA 3G73A 3VZJA 1NG7A 3HOUJ 3ZXAC 4XAEA 1F31A 3VBFB 2R3SA 2RHPA 1S0DA 4CTEA 3SFZA 4PLOA 2FZ1A 1V5GA 4DYQA 2VZRA 4PDWB 1XNAA 3QPSA 4WF2A 4KMFA 4QIWN 5BV6A 1DP7P 2FHRA 3H7YA 3FXKA 1Z05A 1UNBA 5M5WJ 5AC91 2XGDA 5A33B 5BUVA 2D6LX 3B9IA 1AXYA 3HKZN 2OKXA 2ID3A 1QJX3 2DF7A 3OG2A 4MADA 1H2NA 1NZCA 3ZMVA 3BROA 3WGIA 5EFUA 3IWZA 5K7ZA 3OF1A 5FZ3A 3MZHA 3ZFGC 2KRHA 3TN92 5ILSA 5DUVA 3KZIC 3KCXA 4CCDA 4R9CA 5E16A 1MS1A 4COYA 1COV1 3PIPF 2IXIA 4XETA 1P7JA 5IFPA 3RZLA 1AR92 5JR7B 2YV8A 3HN3A 3WP4A 1JI6A 2XGEA 1UMIA 2ARAA 1VBE3 2GAUA 1L3JA 3LNQA 4HDVA 3PUQA 1VAMA 2A5YB 3TKYA 1H6XA 4L0ZB 3IDEA 4XF4A 1RUI2 1K78A 2VUJA 3GX4X 4B7KA 4PF5A 3ACFA 2VQTA 3S7EA 5M5XJ 5M3MJ 2LY2A 2X29A 3IDAA 1FIPA 4UHTA 3UNPA 3C1DA 2ZGNA 3U14A 1W7PD 5A80A 2VD7A 3KIOA 3AZZA 1OYWA 1TNRA 4Q5OA 2XVCA 2C9AA 2BBVA 4YIFA 1J2XA 2DA7A 1U5ZA 4L0YB 3CEWA 4AXOA 1DPUA 5IVYA 1RRJA 4D0PA 3FM5A 4MGSA 4TLGA 2W1QA 2W95A 2LM3A 4QKDA 5CA6A 3U1KA 5CYYA 4BWOA 3FWEA 1PIV3 4N0BA 2YUSA 3OYNA 1FATA 3N05A 3WTVC 4QPGB 3OPTA 4PJYA 3WP5A 2HEVF 3WG3A 4XORA 1E57A 2EWNA 1I50J 1W36C 2WBKA 5DUKA 1CAVB 4P9LA 2FOWA 1WA4A 4ZU7A 4GFBA 1W6MB 4D6SA 5IFTA 4NBQA 3HOXJ 3HPNA 3KLSA 3B01A 5FFOC 4RS8A 3PTYA 4FOYA 2D43A 2XUMA 4D7NA 4X6AJ 3LEMA 4QQ2A 4AEDB 5FZEA 3RDIA 3OYHA 1MNDA 1ZRFA 3GTQJ 2P3JA 2VOVA 3NNMA 1T2KA 1OLQA 2BWCA 4AZZA 2R4GA 2ZMKA 1GOFA 5L9RA 4JTOA 1WCMJ 1HQNA 3MMYB 2ME6A 4AAPA 1WJCA 3NNGA 1QVUA 2HWB2 2R30A 1KGYA 4F91B 3WU2C 4E7LA 4C1XA 1UOGA 2VL8A 3AL0C 3S3OA 1UAAA 1JOBA 2BXYA 4OHWA 3IDBB 3FBNB 1WLTA 2ZXJA 3QH6A 2QUFA 2ZX4A 1ND3B 2LFBA 3RVHA 2XKOA 5E3LA 3FDYA 2CSOA 1Z0HA 5J1XA 3OS1A 4FFIA 3QPLA 1ZG5A 3WY6A 4LA3A 1BIAA 3OGSA 2XV4S 5L9VA 2HYJA 1VRH3 2X51A 4Y22B 4N53C 4YFZA 1YFXA 2ARCA 5DUWA 4BGDA 1Y6IA 1H0BA 3POGA 3HNBM 3IAM2 1TQ5A 2ZCWA 4ENJA 3FE5A 3BU0A 3BGAA 1JT6A 3CTAA 3N97A 1VBA3 1ND2B 1W6PB 4O7XA 4A3XA 2XOMA 2WDBA 4HX7A 3K70D 2W85A 5C9AC 3AFHA 2D3SA 4HG6B 1IKPA 3GJBA 1Z3XA 4Y33A 3LGRA 5HODA 1SLBA 1E0EA 5K1YA 3H0DA 3V7RA 1SC7A 2K7LA 4EZHA 1W8WA 3RPUD 1M4WA 5A1FA 1JYVA 3ZYIB 5J7MA 1B4AA 2OXBA 2KRFA 5A7QA 1ULCA 1KRIA 2V79A 4C2UA 4CDQC 3HRMA 3ILRA 3I56I 4P9XA 1VQ4I 3HOSA 2HTSA 2EIDA 1FI2A 4V2FA 1K4SA 2V09A 1XYOA 2QVOA 2G9GA 4YG0A 2JD4A 2K40A 3MW2A 5FRNA 4Q2FA 4Y1YA 5K8SA 3JRIA 4CH7A 3BODA 5T54A 1I5ZA 2A70A 3N36A 2F5FA 5IAVA 2G1MA 4GA9A 1DU0A 4HNTA 4OHVA 2M45A 2GNDA 1MBJA 2J1EA 2YPDA 3FUQA 1NY72 5DPNA 3HL2A 3CC7I 3ZIWA 5GLZA 3DPRC 3ES1A 2A6YA 4M3CA 1RUG1 4AGGA 3MPPG 4EWAA 2L3DA 5J8CA 4E7ZA 2DA3A 5KAFC 1ZYRF 1Z91A 4NPMA 5FR3A 4F93B 1H4GA 1PZ9A 5CVRA 3F72A 1ZRIA 5EDNA 2BGOA 3NW4A 4DZPA 2V7FA 4N9HA 2VCAA 5FTTC 4N4OB 1S2KA 3SZGA 4XABA 2D6OX 3ZKUA 1S8NA 5KHKA 3LCPA 3TEZA 3HC7A 1XGOA 1DQ0A 3BJAA 4RGRA 3VD3A 2JJ7A 2WNEA 4CCCA 4A7KA 2HWE3 3WDUA 4KWJA 2J22A 1ZGWA 5K5QA 1JJ6C 4CU6A 5JZGA 4P1WA 3G2BA 5D6EA 2SBAA 4IETA 2GALA 4Y5Z0 1WW5A 1BYHA 1D1CA 1F43A 4NOTA 3J7MA 1FOKA 2XQRA 2YBSA 4Q4X3 2R7UA 2X6WA 2UWAA 4JKLA 5J47A 5ACA3 3GBGA 4HV6A 2K9QA 4M00A 3WTYC 4UY8I 3AX4A 5EGOB 4LG0A 4YG2F 3AP9A 2XAUA 2E33A 3POIA 3ABZA 3MDPA 2NAZA 2J5PA 3JTGA 2RKHA 3BTIA 2OV7A 4MLOA 2QM3A 3VZKA 5IUQA 4BDYA 1FMD3 5FZCA 4H3WA 3ZR6A 2LDUA 5GTIC 3DEMA 1QZEA 2FBKA 1GZCA 3DKXA 2Y8KA 3H7JA 3S16J 4B44A 2K9LA 1U2WA 4BEHA 1KQRA 2FUG2 1PVC1 3WNNA 4IRHA 1QU3A 3CDHA 5JZGC 2ZZJA 1S9HA 1BOBA 1YEWA 5M3FJ 3VKMA 1DZTA 1V9U1 1JYNA 3SJMA 2R1BA 3RTRA 1JXSA 2P17A 2HU9A 1LUJB 5CEHA 2KKOA 1BBT2 2P0WA 1UU5A 4XUNA 3TBDA 2WLQA 3VDBA 1PZ7A 1GQHA 2W68A 3OOUA 5DM6F 2CU5A 2RC4A 3HN1A 3BIEA 2GOXB 4CO8A 1KU7A 3TNPB 5FLMJ 3ZXDA 1ZH5A 1JOPA 4CA9A 5FYSA 2JA7J 4UUVA 5J4YA 2CWMA 1B9MA 4LUMA 1LJ9A 1XBFA 4XDPA 2MEV2 4N4NB 3JZVA 3K4DA 3VHRA 3O3KA 3TMOA 4RGKA 1QJY3 3L2VA 5JOWA 4ARYA 1SEUA 2GN3A 2SLIA 4H2AA 1FAYA 1MJAA 3OSGA 1SD6A 2VZ3A 5DG2A 3EQLF 2UY9A 1XNDA 3PVEA 4A6SA 3OIQA 1W8UA 2VZPA 4RN5A 2CW0F 3CCLI 4QX2A 1COV2 2DQLA 3HIFA 5F6KA 1X58A 3VBOA 3HGGA 3CMMA 3QODA 1C5HA 2BJSA 4I30A 4GJYA 2ZFWA 2QQWA 5FP9A 4XYXA 1DUXC 1QHDA 1UW8A 3V64A 4QPGA 3WNXA 1M06G 3H3ZA 2PHLA 3BIWE 3HSFA 3R61A 3GTMJ 3AYAA 3PDQA 3OOXA 4XBQA 3FX3A 3CO6C 5JIUA 1T08B 1UY0A 1YRNB 1YX5A 1WMDA 5FKCA 4JQFA 5CKQA 2M3AA 2IVMA 1JKRC 3RYKA 1W0TA 1WI3A 3VL9A 4NHKA 4P96A 5JCTA 3DTKA 2JE9A 4CXWA 1CX1A 2UY8A 3KWVA 1YFUA 4XFFA 3TYJA 1HRI3 1IV8A 4XOTA 3VDDA 1VQ5I 1K7AA 5A7WA 3WDXA 2BHZA 2WNUC 1FOD1 3M1EA 2D98A 2PQQA 2YC2A 2MLKA 3GGLA 3IH3A 1FX5A 4WM7A 4HSRA 3H8RA 3DTIA 1CAWB 1UU4A 1E5IA 1QDOA 4FOWA 1N75A 4EJWA 5A1AA 4XSZF 4XJAA 4LG3A 2Y6LA 4FE4A 1O7LA 1LOBA 3OYGA 2W94A 1W03A 2WZ8A 2XR4A 1MZ6A 2JUGA 5T5JA 4FETA 1H0MA 3OS2A 1ZGAA 1OH3A 3LWFA 2KJCA 4JV4A 5BNNB 1LESA 3CJIB 5FV3A 2ZHLA 3O0VA 3BDDA 4M73A 3O12A 4DXRA 1RUD2 5A7SA 1F5FA 4HXCA 1MJ9A 5C5UA 2CUJA 4D7YA 5DCMB 1AKHA 2ORZA 5IAXA 3JCUC 2QYOA 3F9KA 5GAEJ 2NNNA 4MOAA 4XTPA 4HEA2 4AK3A 3ZQIA 2GC2A 2MC4A 3B02A 4BBRJ 4XLEA 1NK2P 2P8TA 2XPJA 2VMDA 3VBOC 1UKRA 4DZJA 1XGSA 2VQUA 2IGNA 1HXS2 1QPMA 2WAFA 1FWZA 2HEOA 5I91A 2Q0OA 3RZGA 2RE9A 3BI3A 3SCGA 3Q8EA 1FOWA 3EDPA 1W9FA 1ULDA 1WW6A 5A3MA 3OYIA 2DQRA 1W2AX 5LBCA 3MF6A 4LK1F 1OPOA 5E1RA 2XUEA 1UHSA 3POYA 4OHYA 3ECQA 2X1CA 4RM2A 2ZGPA 3AFGA 2WNVB 4QX5A 3O8GA 2F48A 1EV11 2MPFA 2XXZA 4MGKE 1PP8F 2G9WA 4LJHA 1LENA 2DFIA 4UW3A 1DYPA 3AP6A 2XB5A 4DZGA 2VZQA 5TSWA 1SFYA 1W9WA 4K1ZA 2VNVA 1YX3A 5T5PA 5BNNC 3BJOA 2IS4A 4ASLA 2D1HA 3GMEA 5LRRA 1YJNI 4AVSA 2ZKLA 1BBYA 3M7AA 3ZQ7A 2OBPA 1NY71 1US2A 2QKLB 2F2EA 3ZRGA 3I54A 5FRAA 4NPLA 4QWQA 1NE6A 1ACCA 2VBWA 5FXWA 1R5GA 3GFJA 2A6XA 5EZWA 2KZVA 4DS0A 3KZYA 2A05A 4JX6A 3GHNA 3OBTA 5FJ8J 4E8DA 3O0WA 4ZKTB 3HXLA 4E6KG 3ACLA 2VUCA 1AHDP 4QB1A 4P9WA 2K4BA 1V6KA 2DCYA 1HDDC 1YJKA 4Q1RA 4LO6B 2VJJA 2WLPA 4Y1UA 2K0GA 3K1NA 2EZKA 1N3QA 4CP9A 5LGTA 3LSGA 1HXS1 1YWKA 1DP3A 2JDZA 4NAOA 3WNLA 4YFKF 2PMUA 1SHWB 1HJGA 3I2JA 1PGL1 5C4JJ 4AQ6A 5FMBA 4DEVA 1OLME 2VTXA 1B8IA 5JLXA 4BMEA 1NAEA 3HZJA 4A3JJ 3KCCA 1J58A 3RYRA 5FLHA 4IERA 2TCTA 1CN1A 3IC7A 1SLIA 3JD71 3OCPA 3ENRA 1X33A 5GZDA 1GWMA 1UMHA 4A41A 3ZXJA 3WQ0A 3BTCA 3HHHA 4ZYGA 2PAEA 4TLFA 4QM9A 3FKIJ 4IXLA 4AYBN 1VTNC 4AVVA 5D4SA 3HOYJ 5F5IA 1BC7C 1X36A 4LBOA 1VQ8I 4H0EA 4WCGA 2V9KA 1JZ3A 5BPDA 1ZREA 2ZXHA 4H4KC 1CAUB 4HLTA 1VBC1 1T33A 4BQYA 2DYCA 1RUI3 2QEXI 5FPLA 4IE6A 2R1DA 3FBYA 1KD7A 2JDUA 4OCTA 5HI0A 2FNAA 4QWNA 5E3OA 3OEAA 5LRSA 3MAJA 1O4ZA 3ULQB 4CP1A 3VDDB 1Y1WJ 1GT0C 3PUFA 3DLAA 1LDJA 4PK4A 4WZCA 1US3A 2P7CB 4KWLA 2J1RA 1H1MA 2MEV3 4D0QA 4A69C 1K5MA 4LKDA 5KCMA 5IJRA 1TBXA 2EIMH 3W5NA 4RQPB 1YC61 1DIWA 3NL1A 4NNJA 5J48A 3QU3A 4YVSA 1JKQC 1YQ5A 2RJLA 4KBZA 5F7UA 1RVF3 4EZ4A 4I3GA 4II2A 3FXJA 3WW1A 4MYEA 2E1NA 4RAFA 1AL23 2DWRA 4L5EA 2VAUA 2WYFA 1VLNA 4OIQF 2VW0A 2EZIA 1T8IA 4IHWA 4NIGA 2YMZA 2VCCA 4IV1B 3VD4A 4LLNA 2P5VA 4P00B 1EUUA 3P5BA 3TGNA 2E5NA 2QUOA 1VAKA 4WVVA 4BXFA 5J3LA 1ODDA 2D40A 5IK8A 3LSHA 2R7WA 1OCPA 3F21A 5ACA1 3Q0WA 3JB4C 2QQKA 2IVJA 4FVVA 3PIJA 4XJ9A 2ZNZA 4ZDLA 1S1AA 1VPHA 4QB2A 2NM1A 5FRMA 2XKPA 4CU9A 2IS2A 3JBG1 1RKTA 1A35A 4LGWA 1O7FA 2UUZA 3SDBA 4EQVA 3VBHB 4AI2A 1AXZA 1D4M3 2RS53 4OI1A 1PNGA 3KFWX 4JBAA 1S3JA 3GF2A 1MS3A 3OL3A 4M3BA 5EEHA 4COUA 1NZIA 2WSUA 3FXUA 4A3MJ 4MGZE 1WJ5A 5DS9A 4PDWA 2GIVA 4BJTA 4XQ4A 2PMHA 3EPZA 2E7TA 3VSKA 2Z33A 3AG4H 3SKJE 1LULA 4XW3A 2H09A 3EYPA 3MFCA 3F8MA 3SEZA 2P2KA 3N9PA 5A2QK 1BBT1 2XRNA 1BMV2 1B9NA 4ZJZA 1YG2A 1QNTA 3CF6E 2O8KA 3USSA 4KIGA 4LHSA 3E5UA 4COZA 3RYPA 3V8KA 3IKTA 2XJQA 3L2CA 4HKOA 4FI9A 1NLRA 4CDXA 4QHBA 2L7KA 1CAWA 1TZLA 2M5WA 1WRJA 3ZMZA 2QQNA 2JB8A 1MEC1 4XONA 1CAVA 2ZMNA 3HQXA 3PUHA 2BRTA 4P9GA 4Q48A 5AC92 2AHQA 2Y2ZA 4PSXA 3FXOA 1MVEA 1GFF2 4MQVA 3RPQA 5H20A 4CP9B 2HLEA 5A3PA 4KNYA 2L9SA 3S6PA 5IT3A 1FPN3 2OVUA 5FYVA 3N7KA 3D82A 1LB2A 4GD4A 2DFEA 5I0UA 1SZBA 1S0CA 5DCMA 5DN2A 4FOVA 1QJY2 1LE8A 1LJ7A 3CCRI 4GKXA 3GFIA 3BG7A 4ZS3A 3KP3A 3MD2A 5C70A 5BMZA 3FBMA 4AD9A 3V7SA 1VQLI 1QGPA 3HOWJ 3L2RA 3BY6A 2JA6J 3N9OA 4Y1XA 5BNOA 2YBPA 5JXGA 2DTYA 1D7PM 4MGYE 4MUVA 4LBKA 4IEYA 1GZ9A 1HIXA 3M4FA 4ATEA 2OA4A 4J19A 3ZSEA 1P2FA 5CYVA 3ABMH 3I53A 3B9CA 3JAMK 1AR73 4OAYA 1SD5A 3IIAA 3BT9A 3AG1H 2A07F 3AL0B 2YU9J 1SVOA 1FTZA 4BU2A 2HVRA 2BTVC 4V19K 1ND2A 1W6PA 5B5EC 4GH4C 1OF4A 4BJ6C 1H9PA 3K2OA 4NN0A 1HDPA 1IPJA 3KX2A 1ZA4A 1JHFA 1AJKA 2P6HA 3T08A 3J81Z 1KS5A 2AO9A 1W8TA 3LDBA 3KS7A 3FHAA 2XWJB 2XVGA 1LDDA 2WT0A 2DMQA 2C24A 1HQLA 1DYOA 4G7ZF 1OA4A 1BR4A 5EJ3A 2QBYB 5JIAA 3JTHA 2XLFA 1P6RA 3DYMA 2NRAC 2VZ1A 1OCZH 2I10A 3W5MA 2M4KA 3AG2H 2D1VA 4IQPA 3O6BB 3HRSA 4HKLA 1Y9GA 4LO4B 5JOZA 4OYUA 1G9DA 1W5CC 2W92A 2ELKA 2FQ3A 2RS33 3GZAA 3VZMA 3LSDA 4BPZA 5DCFA 2ZEZA 1IDYA 1QJU2 2W25A 2BV4A 5FKNA 3AAFA 4K8FA 5C4WA 4L92A 2CUFA 3KV4A 4YG6A 1SQ4A 1IS4A 4IEPA 5FWEA 1S2EA 4DGWB 2FRHA 2NOGA 2VOTA 2YY1A 2DCKA 1C8M2 2WNUB 4A3BJ 1PX4A 3VB9A 4EN7B 5JDBA 3HDDA 3ZN5A 2VONA 3CCUI 4HKWA 3ZFGB 1X1CA 1LNSA 2WA3A 5ABJC 1BK1A 3NWSA 3BTXA 4YW7A 3ZFEC 1B8IB 4TTGA 1V6OA 3J9SA 4HAMA 5HS7A 1I9RA 3KV5A 3K75B 2KA3A 4PLNA 4RFT0 2EIJH 4W50A 4G9YA 1FZPB 3LQCA 1Y9QA 4EJRA 4RLQA 2BVBA 4IV1A 1RJ8A 4I7HA 1NCRC 4XFBA 5CB7A 1EV7A 5E18F 3HM5A 4U7DA 3H8XA 4ZZDA 3HHGA 5FFZA 2XHNA 1O3SA 2QQBA 5IW0A 5CVIA 1QOSA 2WL1A 4C3JJ 4OFGA 3KPHA 1LNWA 1AJOA 3OYMA 1ZARA 3WUCA 3IKVA 1WZ2A 3OYBA 5LHIA 4XPVA 4Q4Y3 3OOPA 2X09A 3ECOA 1R64A 3PHMA 1BI0A 4LLLA 4QX3A 2IZWA 4NDLA 3T4HB 4CXXA 5B1BH 3J26N 3PNAA 3OUHA 1HW2A 4M3DA 5FZ6A 2ADUA 4GWJA 1L7RA 1A6QA 2DDUA 5IK4A 4PFPA 4JC1A 2L0KA 4E70A 4EJTA 1FNZA 2M0CA 4KICA 5IYYA 1YOVB 1F9KA 2N8GA 5JAXA 3HT1A 1KGSA 4BQAA 2C6YA 4KMUX 2EK5A 3NMBA 4A3LJ 4M3EA 1VBD3 4LG0B 1BZWA 2KL4A 4W4ZA 2VKEA 1Z1DA 3O1TA 3ML6A 1DQ6A 2A3YA 3K1MA 3KEYA 1XNBA 3MV01 2MW8A 2VBPA 2H6CA 4NRPA 1I6HJ 2F4MB 2VBZA 4LKFA 4K8RB 2R6QA 3ZXFA 2CV0A 3M1CA 4LK0F 4OZOA 4N8MA 1K5MB 1ST8A 1O5LA 3OGVA 2LMDA 2D97A 2BY3A 4BMBA 5BS6A 2KDOA 2JUCA 2V6EA 3IBMA 1ZN2A 2LD5A 2X1DA 3SQNA 4BBSJ 2IXLA 1UF2C 3L2QA 2NVQJ 1OQYA 3PUIA 3JRGA 3S2DJ 5JZGB 4DUXA 2AEZA 1XC6A 1PGSA 4PGHA 3I8TA 4Q29A 1IXCA 4BZ4A 4ZXKA 3AMNA 4RYDA 4XRFA 1W7PB 3CHXA 2VXDA 2Z69A 1ND3C 3UKNA 2GH8A 4FPJA 1Z3YA 4C90A 3I4NJ 1AU7A 2JDPA 4M74A 2VXRA 4Q8KA 3FMSA 4JX4A 1VP6A 5EJCA 2CGNA 3J7LA 4LT5A 5EYXA 1ZBE1 1RMU3 1UL9A 4N53B 3JAMZ 2BUKA 1S6LA 2YGLA 3M8FA 5C6CA 1LEMA 2QQPA 4N7UA 1OCTC 2KMUA 5EQUA 5FQ0B 2L9NA 3TP3A 3MUZ1 1WWYA 4XZUG 4M01A 5FKOA 2WN3A 5CNAA 5CPRB 1MDMA 4U36A 4AQSA 4CEYC 4ASMB 4HNVA 3DPUA 4QGNA 4B47A 4AVCA 3WG1A 4DXSA 5FO7B 1AR91 3FK6A 4PI2A 2B9SA 2FDKA 4M0HA 4QKFA 3NO8A 3SNMA 5DXDA 5E6HA 1SMVA 4RGUA 3WG2A 1IZ1A 2R5ZA 3EYYA 4S2GA 5I0SA 3JXSA 3POEA 3LB9A 1WJDA 2A3SA 3LFMA 1MVQA 2BZTA 3KP2A 4J1XA 5DD8A 1SDWA 3FMRA 2ZMEB 3NV1A 4WVZA 3T1LA 3O1MA 3OBAA 2M1BA 2CUZA 3S3NA 5B2GB 3D0JA 1DGRM 5C9AA 3WZ1A 4KT5C 3DPTA 1G3WA 3F23A 3WF0A 2ZSHB 1WGXA 2CDPA 2VNOA 5E8AA 1XPXA 5KHDA 1DGRN 2GXBA 4MZUA 4Y4YA 3I58A 2E26A 2V73A 2F6CA 4OIRF 5DUIA 1X4OA 2Y31A 2STWA 4MIMA 1XU2A 2EFPA 1GQGA 3IB3A 3ZSJA 3GLLA 3U21A 2TUNA 4Z1VA 1RUJ1 3UT0A 5FZ4A 4C3HJ 2E7AA 1RUD3 3AL6A 2K86A 1ENSA 5CADA 4CP0A 4D5CA 1CIWA 3PMEA 2OCCH 5A7WB 4QPYA 2O9LA 3KLNA 1WKMA 4XQFA 3VBSC 2W24A 2OYZA 5AC93 2B9UA 4Y15A 3VD5A 4XZPA 3HT2A 1TWAJ 1J3QA 3M8LA 2WA0A 1XB9A 2GOMA 2EXIA 2M4GA 5ABJA 2ZXWH 5JWPA 4AFBA 2Q8EA 4FISA 4OIOF 3H9QA 1ZRCA 4AWDA 3P9IA 1BJZA 1NE4A 2WWJA 2Y60A 5LD2C 2GH2A 1XMXA 5KHGA 1YQ2A 3TN93 1X7NA 4QX0A 4AVBA 3INAA 5K4LA 4D9JA 2ZMEC 2YZ4A 2Q5TA 3SYTA 3O14A 3P6BA 2XLGA 3UK9A 1WA6X 1UZVA 1LOCA 2ZGTA 3B00A 3T1MA 3F3XA 5FY5A 4LE3A 4IUGA 2NZ9A 4ET7A 4Q0PA 2XIGA 1QA6A 4CICA 1L7QA 1UZ0A 1BBT3 3RI9A 1AX2A 3CL1A 1ODMA 3RJ2X 3THDA 3MVPA 5EG0A 5HBAA 1W6MA 4MXWB 4IV3C 1IN4A 2GNBA 4EGYA 2P4WA 2LY9A 2BGPA 1LTEA 2VCBA 1GLHA 5FZLA 2PMWB 2RG4A 4WM7C 4A42A 1YLFA 2WZR2 5HCHA 2EIBA 1GV5A 4C1WA 5BOXA 3T0BA 3R60A 4KU7A 4A6EA 2WFF1 3I4MJ 2IXSA 2R7OA 1UXXX 1NA1C 1FNNA 3PVOA 3UV9A 1Q43A 1BOAA 1DGLA 2GP3A 3BCAA 1CX4A 4XF9A 1UZCA 2HNHA 1XJAA 1PGW1 2MD0A 5HCFA 3WU0A 2DPUA 3CQZJ 4B3NA 4FPCA 5KR7A 1K6OA 3ZYRA 4JDOA 2R92J 1WSUA 2PYTA 5JMCA 1YO5C 4XLFA 1SBDA 4FCYA 1WCQA 1XSXA 1HB1A 2L9RA 4AEDA 2DBBA 1ULYA 1FYUA 3SZPA 4G3YC 4QQPA 4HOBA 2XBO1 5DQ0A 3RSJA 1O8SA 1IC8A 4YW3A 4GWMA 2XRLA 3ZFGA 2RDSA 1BA5A 1YXWA 3VZLA 3OS0A 4BQXA 4RR3A 3A02A 4DMIA 4E27A 3S3MA 1H30A 3U07A 4XICA 4ZU5A 4IE5A 3DGTA 3Q9SA 1JU4A 1VMJA 2BW3B 5ANNA 4LB6B 3AXEA 1QJU1 2FDFA 2PQSA 1OD3A 3Q9OA 1KFUL 3OSDA 2Y0IA 3VD9A 1K61A 3LFUA 3UL2A 5H9QA 2TEPA 4ZTFA 1HW1A 5F8PA 1SVLA 2W82A 1SFEA 3RQIA 1X9PA 3FF5A 5FXZA 5AVPA 5FYUA 4CDWC 4YELA 1NA1A 1ETVA 4MEYF 5ICEA 3CP8A 1RIOH 4XLAA 3AC0A 1VQKI 3BTLA 3KP6A 2HQRA 3HUGB 3TL4X 3TO6A 5GAHJ 3UKTA 1AHSA 1GQPA 1Q3EA 2VE9A 2NLRA 1HCRA 4YARA 1XCVA 4DQ2A 1Y8QB 3WEZA 5F37A 2LTNA 2QNKA 3MI8A 4K40A 4M4PA 3UNGC 1QHGA 2RVCA 3B93A 2H8WA 1RHI2 3Q3SA 1N1VA 5T50A 5IVFA 1RUC2 5KXDA 3PUSA 1K6YA 4FT8A 3GTLJ 3K1PA 2Q8KA 4M0NA 3H1CA 2K9MA 2LBFB 3AYEA 5H9SA 2EICA 4Y24A 2X5IC 4CEWA 1PGW2 2QQMA 1WUVA 2WJSA 2W39A 2P5BA 3VGIA 4DNYA 2VECA 3PJRA 4XJWA 2VPVA 1IV6A 2KD7A 2XL7A 2R041 4YGDA 1I3AA 3GTJJ 4EATA 3FK7A 5FJKA 2WZR1 5KBFA 2QJVA 2OUJA 3NJYA 3H36A 1LHOA 3GHMA 2ET1A 1PK6A 1J84A 3ZR8X 1JUPA 5C9AB 1U8RA 4OMYA 4HG2A 3KSCA 2R072 1AVBA 4IESA 5LA9A 3GTOJ 3MIGA 4XJ8A 4UW6A 2G7HA 1TEIA 3HAGA 3DKYA 2X10A 3TW7A 4M9SA 4BIOA 3A1YA 3K4NA 2PEXA 3IH4A 1AR62 3TBIA 1DZQA 2JJ6A 2VVDA 3I2FA 3AYDA 3VKOA 4MG2A 2HZDA 2ORXA 3CJXA 1Y56A 3GNEA 1R23A 2MD5A 3ACIA 4JGYB 1UY3A 5E88A 5CAZA 4IEZA 4A0XA 1Q8VA 2JE8A 2DO7A 2BVLA 2JSPA 1JODA 2FMDA 4Q0QA 3LEGA 2VMCA 5DG1A 3FXQA 5FKKA 5DDJ1 1RUG3 1SEFA 3MGUA 4LORA 1KFXL 3DXTA 3GFMA 1R092 4BXSV 3WNKA 4ON0A 5FZ9A 1GXPA 5L3CA 2O0YA 2NVYJ 1RMU2 4IL7A 3JRHA 2B8MA 2A69F 4BXXJ 1DZRA 3MUY1 3MLKA 1VR3A 3C7FA 2VMGA 1LOAA 3AM2A 3SXWA 2X1EA 3HQRA 1D5YA 4MGTA 4GALA 3VBHA 2JRMA 3A2KA 3JSPA 1RUH2 5FWJA 1UJ8A 3ST7A 3KGZA 4KBBA 2HYKA 3ZSKA 3VV1A 5B1AH 2BP6A 5C5TA 4FO9A 4JZRA 2GA1A 2PELA 1ETXA 3A21A 3S8PA 1UMZA 2IWGB 4HNUA 2YX4A 1POGA 5DAPA 5A2QZ 3MW4A 1QDCA 1HSTA 1H1AA 4R9BA 3IP4B 2NXNB 5CFCC 4KDPA 3WXPA 2HWF3 1VNDA 1IO2A 2P6CA 4L9BA 3AKTA 4JGYC 4QDQA 3M2MA 2WS93 2X5IA 1NTCA 2E9QA 4W6YA 1X3WB 1NCQA 2VXZA 3PNVA 1F5TA 4G9SB 1HKQA 2H1LA 3C3WA 1R22A 1ENHA 5HLHA 3C7EA 1AOYA 2D3RA 3MHZA 5JR3A 3BVCA 4HYEA 2ZJCA 3THCA 5BYNA 4RA2A 5K0UA 1U5XA 4Z2YA 3PTRB 1L3LA 4F7ZA 5GZEA 3LFKA 2PA7A 3O8HA 2RS52 4GYGA 4UB6C 2EPFA 3KV6A 4JGZC 3ES4A 5G05L 1SMYF 2VTFA 4PLMA 4OUEA 3ETQA 2CQNA 3VDDC 3VL8A 4HVOA 4UT5A 4XFCA 5EWSA 3H1YA 3OUIA 2E2HJ 3AK0A 2ZX3A 4B1LA 2CW8A 3FC0A 3PFYA 1SLLA 4A0ZA 3HGYA 2VJ5A 2G9ZA 4OHXA 5KK1A 4KI5M 1N1YA 4QB6A 2ID4A 4ISRA 3C2GA 4YGBA 5F08A 1JTYA 2W48A 2EALA 4QAWA 1V9U2 3KVBA 1CIYA 3ZQCA 1XE8A 5JSRA 3ZXKA 4K21A 3OY9A 4ZDOA 4IEWA 2X8KA 1H8AC 1CQTA 4ZXEA 5KC6A 3D3AA 2F17A 3SZTA 2BZDA 3GEZA 1EH7A 2XSJC 1TT0A 1B6AA 2LREA 5L3BA