3HT2A

Zink containing polyketide cyclase remf from streptomyces resistomycificus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
143
structure length
143
Chain Sequence
SMMKRVHRTDVKAEIVREPGAKETTHRKLIDTPDGADRFVLTEFEVSPNGSTPPHFHEWEHEIYVLEGSMGLVLPDQGRTEEVGPGEAIFIPRGEPHGFVTGPGQTCRFLVVAPCERPPVRNVFLSEDPYEYTQMPEYTSLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The polyketide cyclase RemF from Streptomyces resistomycificus contains an unusual octahedral zinc binding site
pubmed doi rcsb
source organism Streptomyces resistomycificus
molecule tags Lyase
molecule keywords RemF protein
total genus 29
structure length 143
sequence length 143
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ht2A00
4IETA 4MV2A 3GBFA 1VJ2A 4N9HA 4EWEA 4LTAA 1YFYA 4XFAA 4ZU5A 1WGPA 5I0SA 4XETA 5CU1A 2UY8A 3E6DA 3C3VA 1CAWB 2PYTA 3LA7A 3D0JA 5CADA 4META 5LEKA 3M3IA 4MUVA 1CGPA 4HZFA 4JTOA 3OTFA 1DZTA 3WW2A 5T3NA 2ATFA 1XE8A 4XF1A 3H3UA 3NL1A 1L3JA 4XFIA 5JSPA 1YFUA 4N9IA 1J58A 2P17A 2PHLA 2D5HA 3SHRA 1XE7A 4AQ6A 2PAMA 1V70A 2EVXA 4IESA 3H1YA 5JSOA 2E9QA 3SXWA 1J1LA 4I3PA 1FI2A 1O5UA 4ZU4A 2WFPA 3QACA 1X8EA 2O1QA 2ET7A 4AQ2A 1LB2A 2ETEA 1J59A 3MPBA 1ZRRA 4AVBA 4I2OA 4MH0E 3D0SA 1LKNA 3EQEA 2XLAA 4J1XA 3S7IA 3FHIB 1YWKA 2PA7A 4I01A 3H1MA 1J3RA 1O5LA 3RNSA 4I02A 5LRSA 1O3RA 5FPXA 2Z69A 1Q43A 1FT9A 4IEWA 4AVAA 3IDCB 1QWRA 4F8AA 4HVOA 3WW4A 3D82A 2PTMA 1ZZ6A 2F4PA 4XF4A 1J3PA 1OD5A 2BGCA 2UYBA 4L2NA 1EPZA 4I0AA 3BB6A 4LUKA 3LA2A 4HN1A 1LRHA 4GULA 2XL9A 3FE5A 2N7GA 4MGYE 2QJVA 5KHIA 4FBFA 1UD1A 4QM8A 3L2HA 3GYDA 3PVBB 4YSFA 3ROUA 3UKVA 4QGNA 1ZZ7A 1H1IA 4YYOA 2GAUA 2Z2SB 2ET1A 4X6QB 1YLLA 3KMHA 4HN0A 2BNMA 4IERA 4R8HA 2OYZA 3LWCA 2K0GA 4FT8A 2XLGA 2GC1A 5CVRA 4EV0A 4FAHA 3FX3A 1ZZ8A 4PIZA 4E2SA 3ELNA 1VR3A 4IEZA 4LA3A 2BEOA 3CL1A 5FQ0A 5J3UA 1I6XA 3FWEA 4IEOA 5JR7B 1NZCA 4HVQA 4PJYA 4IEUA 4HSJA 1DGWA 4XFGA 4O9EA 4QM9A 3U11A 3RYPA 4NVPA 3VHRA 4XEZA 1YFWA 2PHDA 5I93A 3M70A 4YRDA 1RGSA 1ZRDA 4XF9A 3KSCA 3H3ZA 1FXZA 1ZREA 5I8YA 5I0RA 4IEXA 3KGZA 4YARA 3CEWA 4E2QA 1PM7A 2B8MA 4QGLA 5I8TA 5LEJA 2B9UA 2QNKA 4XFCA 5BXXA 4I09A 4KU7A 3E6CC 1EYBA 2IXCA 3SCFA 1IPKA 1X7NA 4ORFA 5FQ0B 1H1MA 4HMZA 2HKXA 4BHPA 4UXAA 4I0BA 5BV6A 4LUMA 1NE6A 4WBBA 2CAVA 2O8QA 2PAEA 2D93A 5BPXA 1QXRA 4EWDA 2V09A 5BY5A 5LRRA 4EROA 3H7JA 4BH9A 1UPIA 2IXIA 4BYYA 3PNAA 4Q0UA 4XFFA 3OCPA 4Q0SA 3EO6A 1IPJA 3H1WA 5I8SA 3RYRA 4H7LA 3WW1A 4F7ZA 2XHKA 3RDIA 3FFQA 2XGXA 3IIAA 1OMIA 3LA3A 4O9GA 1ZZ9A 3ST7A 1RC6A 2IXLA 4QXKA 1Y3TA 2IC1A 4IEPA 3LOIA 4KWKA 3S7EA 2XLFA 1NE4A 3E97A 5I0TA 4HBNA 2VQAA 3JZVA 5FLIA 5JSRA 3S0MA 3E5XA 4KL1A 4DINB 4K8FA 4B29A 3WW3A 4BIFA 4E2GA 3E5QA 4LLOA 4XF0A 1U12A 3DKWA 3G7DA 1QXJA 4PIYA 3KGLA 1VP6A 1I5ZA 2H6CA 3TNPB 1HW5A 1YFXA 1SEFA 1TQ5A 3HT1A 1ZX5A 3UKNA 1WA4A 5I91A 1RTVA 2QCSB 5JAXA 3NW4A 5JCTA 1CAVB 3ZDSA 5K8SA 1RUNA 4R52A 2QDRA 2QVSB 4LULA 3IDBB 1O3SA 3NVCA 3BALA 4XF3A 1UIKA 2GC2A 3UKTA 4D7SA 4QGMA 1LR5A 3CF6E 3DN7A 3O14A 2Q4SA 4Q29A 3OGJA 4IEYA 2GC3A 4HVRA 1ZNPA 2GZWA 1UCXA 1ZVFA 2MNGA 3OF1A 2ZKLA 2IXJA 3NSTA 1UW8A 3ACLA 3E5UA 5KBFA 2KXLA 2UYAA 2OZ6A 4A2UA 1OI6A 4Z07A 3FJSA 4UBGA 3H9AA 1CAUB 1UIJA 4MGIE 1OFNA 4LEJA 4XFBA 2GC0A 1J3QA 1Q5OA 2UY9A 2XL7A 4MZUA 4Q0PA 1CAXB 1ZZCA 2MPFA 2BNOA 5KHKA 4OLLA 2C0ZA 3SCHA 1NYWA 4QX5A 2FMYA 3BPZA 5FDBA 4OFGA 3CO2A 3N4MA 1CAVA 3DL3A 1YUDA 2VECA 1ZZBA 4P9GA 1SQ4A 1X82A 3EBRA 3DV8A 2D40A 3FZ3A 2WC2A 1NXMA 4L11A 1Q3EA 3CLPA 5EFUA 3MYXA 3EHKA 4WVZA 2XKOA 1O7FA 2D5FA 1WLTA 2IXKA 4ONUA 2B5HA 4KWLA 1G6NA 4MX3A 4J1WA 5E1RA 1ZRFA 1O3QA 4UBHA 1YHFA 2CGPA 3E6BA 3I7DA 1CAXA 3RPQA 3MZHA 3USSA 5C8WA 1X8MA 3TNQA 3QOPA 3U0ZA 3ETQA 3H8UA 2H0VA 5FCCA 2GU9A 3I54A 5KHJA 5FPZA 5J48A 3H50A 1EP0A 2DCTA 2Q30A 1CAUA 3KCCA 4XFHA 3NJZA 3LAGA 2OZJA 4HSLA 1RUOA 1XRUA 4ZU7A 1O4TA 3MDPA 3ES4A 2CV6A 2ZCWA 4QMAA 5BUVA 5AVPA 1JUHA 5I0UA 2EAAA 2H6BA 4IEQA 2PAKA 2IXHA 1DZRA 2I45A 3R6SA 2FQPA 1ZRCA 4KU8A 1RL3A 5KHHA 2HJIA 2BNNA 2PQQA 3SCGA 3ES1A 1O3TA 4Q0VA 3PLQA 5FLJA 4IEVA 5F1RA 1Y9QA 3CJXA 4FAGA 1CX4A 2Y0OA 3I59A 4PIXA 1GQHA 4MGKE 1CAWA 2EA7A 4Q0QA 5C6CA 4Z82A 4YNIA 2CAUA 2PFWA 4AXOA 5J7MA 5EZWA 3HQXA 2BYVE 4EWAA 4WZCA 5KHGA 2VPVA 4RD7A 5D1IA 2XKPA 3EJKA 2GH2A 4JTNA 4TLFA 5FLHA 3NKTA 3OD0A 1GQGA 4JV4A 3U10A 3H7YA 2MHFA 1DGRA 3BCWA 3RYKA 2OPKA 4MGZE 4KWJA 4X6RB 3SMHA 1PMIA 5HI0A 4D7TA 2K9ZA 2OA2A 2Q1ZB 1SFNA 1QY4A 4LA2A 1EY2A 5E16A 3IWZA 3HT2A 4AVCA 3LZZA 3I59B 4HLTA 3RZZA 3B02A 2Q0AA 3HIFA 3IBMA 3BU7A 4JVAA 4CYDA
chains in the Genus database with same CATH superfamily
1AX0A 1AJKA 1YNAA 3PU3A 4IETA 5HPOA 4FPCA 2P3JA 1FOD1 2YU2A 5DAVA 2Y64A 4IL7A 3LDKA 3POGA 4W6XA 3J8F1 4CCCA 4LT5A 5A32A 1F35A 1PX4A 2OKXA 4B7KA 3MW2A 3I2OA 4F83A 4A4AA 4AYUA 5J09A 1EV11 4RQPC 4XETA 4JGZA 3WVJA 3I3DA 5G05L 5F7UA 1OA2A 1RUE1 5SV8A 1WCQA 1S0GA 3E6DA 5BNPB 2DVAA 5H9QA 4QPIA 3OBAA 4FPGA 3C3VA 2PYTA 2R041 2VBPA 4ZS3A 4META 4RHV1 3VBRC 4Q5OA 1HKDA 2VOKA 1G7YA 4MUVA 1W39A 4XZPA 4ARYA 5F6KA 1HRI3 1CGPA 1BEV2 4XUNA 1QH7A 1ULCA 2D6NA 4JTOA 2RR13 1UOJA 1UKGA 3RZMA 4JGZC 1E5HA 4LBQA 1RUD2 3NNLA 3ZPOA 1AL23 1VBA3 2ATFA 2I07B 1XE8A 4PLNA 2VNVA 4RQPB 5A3UA 4C0BA 3F95A 4N9IA 4ZXKA 5A3MA 4UI9L 1WBLA 1DYOA 5CFCB 3T1LA 5LBEA 3CBNA 3MFCA 5LBCA 2WNUA 1OPMA 2DUOA 2QBXA 1EV13 5FZ7A 1GV9A 4LIUA 2QE3A 2ZEXA 2A7AA 2QZ2A 3M3OA 3WG4A 2D6OX 5IVEA 4D7YA 1O5UA 3BIEA 1W8WA 1X8EA 1RUI1 1XU1A 3TN92 4RHV3 4QWNA 4AVBA 3VBSB 4PI0A 4MH0E 4TTGA 4AEDB 2WO7A 5F3CA 1LHUA 2XVKA 3OGGA 5CBLA 5CFDB 2ZPXA 2ZX0A 3J7NA 3OY8B 4GB33 2ZEYA 5D2AA 4IE5A 2D3SA 5CISA 2PA7A 1W6QA 5CA6A 2ZBJA 1DGRN 3IDAA 3H1MA 1DQ2A 1J3RA 2HWF3 2XJPA 4QU1A 1VBC2 2CU5A 4M4RA 1K5MB 5AFBA 4I02A 4Y4RA 5LRSA 1OLMA 3AKTA 1UQXA 1OHFA 1FT9A 3AP5A 3GCXA 5FP8A 4WM8C 1QWRA 2K2SA 3VZNA 4QB6A 1RINA 4BOWA 2W46A 3OEAA 4QDSA 4QX0A 5FZ9A 1R1A3 2PHUA 2J1TA 2PTMA 4PBOA 1WMXA 3AYDA 5AVAA 1LODA 1I9RA 3TOJA 2BGCA 1W06A 4AEDC 3B69A 5L9RA 5H9PA 4I0AA 3EB7A 5CFDC 3OUHA 2UWCA 2VVDA 3JUUA 4HFSA 4NHXA 2B4KA 1QOSA 3URFA 4CU9A 4TN7A 3CU7A 1P8JA 3THTA 4FTEA 2JDYA 3B7MA 2ZGOA 5K0UB 2N7GA 1EV12 4YG3A 5K7PA 4GB31 4XMIA 4KQ7A 1UD1A 4OUSA 2FCTA 3GYDA 4QM8A 5KHIA 1PGW2 3PVBB 2Q8DA 1N1YA 4M01A 1GZ9A 2FCUA 4ISRA 3ROUA 1JZ7A 3IZOA 1AR62 2KD7A 5GLZA 4AEDA 4BK5A 3BODA 4QGNA 1ODMA 1Z7S1 1ZZ7A 4YYOA 4QPYA 2HWD3 1HN1A 5CFDA 2DVBA 1H8TB 3FLPA 3MF9A 3M7AA 5FZBA 3A0NA 1YLLA 2JDUA 5CYYA 3H3LA 2YU1A 2D6MA 1ENQA 2VCBA 2O8OA 1Z0HA 3ZXJA 4FT8A 5DZGA 3WP3A 4ZXEA 1HRV2 1BXHA 4R9BA 3ELNA 4E2SA 1VR3A 5FOBB 4LA3A 4AWDA 1JN2P 1QJY1 1UL9A 3H8OA 1PO12 4RR3C 2K46A 2CGNA 3FWEA 3WLUA 2X5IB 5HCAA 1S0EA 4Z1VA 1JU3A 1EPWA 1UY4A 3IKWA 4JGYB 3ZOIA 4XBQA 1BEV3 3A0KA 3VDDC 5DMYA 4C1WA 4DRVA 2ZJCA 1R082 2A73B 2BOJA 2VJXA 2WNVB 4NVPA 4XEZA 1Q8PA 3RGBA 5I93A 2AGSA 3M70A 2VQ0A 4YRDA 3LSEA 5FP9A 4XJZA 4CVUA 1Z7S3 5CNAA 4WZFA 3GZUC 4CA9A 4AFCA 1VBE2 2VNGA 2AREA 1RUJ2 3H3ZA 2HWB3 4XIOA 4Y26A 4NRMA 3FMGA 5EIYB 4A41A 5I0RA 3GHNA 4LKEA 1QJZA 3AZWA 5EYYA 5C8CA 3AP7A 1FNZA 4LBJA 4OHVA 1OLQA 2B8MA 4AHWA 3A21A 4EE2A 1H8TA 4LMFA 5I8TA 2C24A 1YIPA 4RGKA 2HBTA 4XFCA 3VZJA 1KQRA 4I09A 1CJPA 1G8WA 4QPIC 4KU7A 5LASA 4Z92B 1ENSA 2AUYA 3NJYA 3S6PA 4CDXB 1AXKA 1UMIA 4AG4A 2VOVA 3VDDB 1CX1A 2YGMA 5HV0A 1X7NA 3D3AA 4FFHA 5DAPA 2XVGA 4AVVA 4EN9B 2A3XA 3RZGA 3T4VA 3TEZA 2HKXA 1YJKA 1SPPB 5GJ6A 1HV0A 1JYVA 4NPLA 1W6MA 3GJBA 2FDHA 4H2AA 4J25A 4LXLA 2JD4A 3OOXA 3PIGA 1PVC3 1ULPA 2QQKA 1YC61 2ZA9A 3GBWA 4YWAA 4A6OA 1IHMA 1G9AA 2D93A 3WHTA 3T09A 1C1FA 4JDOA 5FZCA 2I74A 5BY5A 4EROA 3RG0A 4CCKA 1RMU3 4UAPA 5FZEA 1UPIA 2PLV3 4LNVA 3POYA 4GMP0 4XILA 4BYYA 2BJSA 1RHI2 4GMP3 4XFFA 5T5OA 3PJQA 4Q4W2 3OCPA 1V9U1 4ASLA 4GWMA 1QNWA 1GQPA 4XBNA 3I2HA 4YW1A 5HCFA 1NLRA 3EO6A 1IPJA 4JQRA 1OH4A 4Y5Z0 5I8SA 4E4ZA 3RYRA 2DFCA 1DU3D 2Q8OA 4ZZ5A 2WWUA 3MBWA 3V0BA 1YQ2A 1A3KA 2JIGA 4BJ0A 1K3IA 2R061 3OUJA 3UGGA 1ZRIA 1RC6A 4CP9B 4M00A 4CE8A 2NZ9A 4IW3A 2HWE1 2IC1A 4QB2A 1ASJ1 1TZOA 3S7EA 2ZGMA 2DURA 3KV9A 3HAGA 3RZLA 2A6WA 2WA4A 1V6LA 5IK7A 4K6BA 3OEBA 1HN0A 2D3PA 1UZVA 2ZZQA 2P34A 4KL1A 1JUIA 1LJ7A 1W2TA 4LKSA 3VZMA 3U07A 2AYHA 2B9VA 2QQUA 4ZZ8A 4XHXA 4OQ9A 1YXWA 4LK6A 3E5QA 2RR11 4XJWA 1IG0A 1V9U3 3WOGA 3V0AB 3PTRB 1T2XA 3VD7A 4XJ8A 1SACA 5CFCC 1GANA 4JKLA 4PDWB 2DCZA 3DKWA 3FLRA 1UWWA 2WSUA 3WG3A 1PO13 2BDRA 5C70A 3KS7A 1IPSA 1VP6A 3HMYA 2JECA 1DGWX 1Q8OA 4RGGA 4Q8KA 5JZGA 1W05A 3NNJA 1S0CA 1VE0A 3AMPA 3HT1A 1ND2B 3VBFA 1ASJ3 3VHPA 3MIGA 4QKDA 3UKNA 1WA4A 1NQJA 3M8LA 5FY8A 1W8UA 2QCSB 2DTWA 4NIDA 5KR7A 4LBLA 4LOTA 1WCKA 1ZBA3 1RUNA 3ZFGA 2ZX4A 2QDRA 2X09A 2DFBA 5EYXA 5FZKA 4L92A 5FPBA 4IV3A 1NQDA 1W2UA 3MIDA 2VGDA 3NWKA 2D97A 1VB4A 1RUE2 5JZGC 5IK8A 2C5DA 3MLKA 2Y33A 2P2KA 3MICA 3VL8A 4D7SA 4YZ1A 4QGMA 4XUOA 1LR5A 1UY1A 5JOXA 3VHOA 4IEYA 4E9KA 3I2KA 1ZNPA 2VW1A 2ZHLA 2UURA 3VHNA 3K77A 4GAZA 1ZVFA 1ND2C 2ZHNA 4DEQA 2MNGA 2RS53 1L7QA 3ZXKA 3L2YA 4PDWA 2JJ6A 1SDDB 4WVMA 2GDFA 2RVAA 4P9WA 2HLEA 4YLZA 1PGL2 3VD5A 3M2MA 1JOJA 1VAVA 3A23A 5SV5A 5AC92 5JZGB 3CJIA 4NPRA 4QPGB 5IVJA 1KJLA 4DOUA 4LEJA 3K2OA 1J3QA 4OULA 3WP5A 2XL7A 3PU8A 3TB0A 5M0TA 3OBRA 1MQTB 2PLV2 3BIWE 3RFRA 2BQPA 3WF0A 1H8TC 1RHI3 4CDWB 4CU6A 4XTPA 2EF6A 2W2IA 3C2UA 3NV1A 4UOJA 3W9AA 3TBDA 1CONA 3ZN6B 1D4M2 1ZZCA 5F39A 3J8F3 1ZBA2 2UWBA 4ARXA 1D7PM 4AE2A 1YI7A 1HQNA 2GNDA 2HYKA 3LDBA 3VBUA 2VBDA 2VAUA 3BPZA 1XNDA 4GIQA 4JQTA 1CAVA 3DL3A 4B7EA 1KDMA 1ZZBA 1VLNA 4P9GA 1Q8VA 4BU2A 1C8M1 2D40A 3AMMA 2G9FA 2VUCA 1NXMA 2WC2A 5T55A 3W21A 5K9YA 1Q3EA 1D4M1 1ZBE3 1V6IA 4LO4B 1F4HA 2PQSA 2VNRA 4Q4Y3 3GNEA 1C5HA 4HK8A 1WW7A 2B5HA 4LBMA 4KWLA 4DO0A 4MX3A 4J1WA 1F9KA 5E1RA 5GZCA 3J26N 3TWIA 1ZRFA 1S0JA 3WSOA 5FBZA 5AC93 1CAXA 3RPQA 1K5JA 5J96B 1GU3A 2V73A 2W95A 4A3ZA 5DAWA 1X8MA 3SH5A 3QOPA 5A3OA 4AK3A 4KWUA 1XYPA 5T52A 1S0BA 3I54A 1JS9A 4O7XA 5KHJA 3LB9A 4I30A 1EP0A 4QB1A 1SLCA 2DCTA 3ZR5A 3VKOA 1LHVA 4P9XA 4P9YA 1AR61 1TME1 1JH5A 1LOBA 2R0HA 4HSLA 1I1EA 5ACA1 2ID4A 5C9AA 2PMWB 1O4TA 3DCQA 1APNA 1HX6A 3MIHA 3MDPA 4XQDA 2J1AA 1NAEA 4PCRA 1L7RA 2GALA 4GH4A 5EV7A 1PX3A 4Y4YA 5JLVA 5AVPA 1JUHA 5I0UA 4CZSA 2YXSA 1RUC2 3ORJA 1FMD1 1YQ8A 2IXHA 2PAKA 4ZY9A 3MW3A 3KQRA 1DZRA 2GNMA 3HBZA 1KFUL 3N9PA 3ZSKA 2CSGA 2HWF1 2I45A 2YFZA 4GKYA 1LGCA 4XJ9A 5IVFA 4EYUA 2VO5A 3RSJA 1ZRCA 4KU8A 4IV1A 1RL3A 2WT1A 2WZEA 3C7OA 2D6LX 5IVYA 5FZOB 2A6VA 4CUGA 4AFBA 1JHNA 1LENA 2WS91 4RSUA 5F5IA 5F8PA 4IUGA 3SLIA 4K8RB 3VZOA 2WNEA 1Y9QA 5F1RA 1A78A 1J1TA 4RGAA 3VKLA 2QKDA 1RITA 1NZIA 1NCRA 1AR63 2YFUA 3WY6A 1TMF3 4Z82A 5J7MA 1S2BA 4AI8A 3DYPA 3FN9A 1W8HA 2GN3A 3WNXA 4EWAA 4MSVA 5D21A 5DQ0A 1ULOA 3AYEA 4V2WA 1LU2A 2RJLA 3ZYRA 5EJ1B 1BVVA 2VVFA 3ZYIB 1CIYA 2Q1FA 1O8SA 1YO8A 1JI6A 1CPNA 2JX9A 4M0NA 5FLHA 3WNMA 3OD0A 1TNRA 4XQWA 5FXVA 2OQ6A 2WR9A 3H7YA 4Y22B 5FTTC 3RYKA 1G9DA 3AXEA 3JQWA 2P4EA 2WINB 1OOPC 4QX3A 3N9LA 2ZHKA 1MVEA 1PMIA 2WQ8A 1DZQA 2HWD1 3DGTA 5JPNB 2XJVA 4NE9A 2VOWA 4HT1T 2K9ZA 2W1WA 3Q8AA 3WQBA 3ZYBA 1QY4A 1GMMA 4LA2A 4AEMA 3VDBA 2EALA 1S0IA 5JOYA 1NY71 2Y6HA 1U0AA 2GMMA 1ND3A 2RDNA 1R083 1AL0G 1DYKA 2VC9A 3J7MA 3GM8A 4XABA 4ZPIA 2VMIA 5FZAA 1UY0A 4E4DX 2Q0AA 4EJRA 3LOBA 3I8TA 1M06G 5LCWL 1AUYA 4CEWA 4FSJA 3PURA 1O59A 3B9CA 1J84A 3HVDA 3W20A 1AR91 4CPBA 2HWB2 2ARAA 5LY2A 4KMQA 4MV2A 1HXS1 1NCRB 1BZWA 1GP5A 4M4PA 5EJZB 4L9BA 1H9PA 1H6YA 5FMOS 4FOWA 1YFYA 1BEV1 2DWRA 2A1XA 1C8M2 1QMJA 1QQP1 4LHNA 3MGUA 4P00B 3DPRA 1K5MA 5FZDA 4OUMA 1XSQA 4HKLA 2VG9A 4FP2A 1F31A 3IIIA 1XE0A 2ZGQA 1IQAA 2VQUA 4A6SA 4AFDA 2BFUL 4LO6B 1G9FA 2DCJA 5GALA 1S2KA 1CAWB 5ISLA 1ZBA1 1ENXA 1RUD3 3JQXA 4M3CB 1C5IA 1VALA 3VBUC 1PM4A 3M3IA 3UGHA 1FOD2 2WA3A 1QQP2 2DCYA 1WUVA 5A3WA 3ZFEC 2BFUS 4HZFA 3OTFA 3ZYGA 4O61A 2WL1A 3ZFEB 3ZMOA 2NQYA 1KITA 5T3NA 3T30A 3KF5A 3ZMNA 1SBFA 2B7YA 3QH6A 3H3UA 3NL1A 1D2SA 2XWBB 4OHYA 5JSPA 4K3UA 1AX2A 2RS51 3MW4A 2Z4FA 5A3PA 2P17A 1WD4A 3RI9A 2WZR2 1GNZA 4CPBD 5FK8A 1US3A 1XE7A 5APAA 1UX6A 1UZWA 2EVXA 3PHMA 1HLCA 4RA0A 5JSOA 2OX0A 3D5OA 3SXWA 1J1LA 3ZVXA 3TEYA 3GALA 2R043 4I3PA 4XAAA 4ZU4A 3T0AA 2IVIB 2WFPA 3ASIA 2ET7A 5IJRA 3HNBM 2WKKA 2BTVC 5A7OA 4DUXA 1LGNA 4LOSA 4A45A 4JDNA 4B3NA 2ZMKA 3LPGA 3WNKA 3WF2A 1GZWA 5J1XA 4NWVA 1PZ7A 3UK9A 2XLAA 4L8QA 3KWVA 2YPDA 4IGOA 3WNNA 4FPKA 1TMF2 1YQ5A 4K21A 1U5ZA 2R6QA 4RHV2 4LORA 4DQAA 5KXEA 3PL0A 4W8JA 3ENRA 3FFZA 5E8AA 2VZVA 1X50A 1VMHA 4YW7A 1JZ5A 1DQ6A 2CWMA 2RHPA 2W0XA 1W2NA 4P9LA 2AENA 2KA3A 4BLJA 4HVOA 5IHRA 3D82A 5FYSA 2P6HA 4N43B 3WP4A 1YEWA 5DG2A 1WCDJ 1OD5A 2UYBA 4BQ3A 5LW9A 1QH6A 3ACGA 1EPZA 1PHMA 3F2ZA 2XMLA 4GKXA 4JX0A 3THDA 1LOAA 1OF3A 3BB6A 1JYNA 2DYCA 4XXPA 2OT7A 4HN1A 2AR6A 3HEIA 3OJBA 4GULA 1PO21 3ZFFB 4NJ4A 2WJSA 4MGYE 3NV2A 4UFHA 1W90A 3HQUA 3KV5A 5FZ4A 2QJVA 1B35A 5DZEA 4YVSC 3L2HA 3OD4A 4D3WA 4ZS2A 3NJXA 4ISQA 2ZAHA 4M3CF 4CDQA 2ZACA 3HWJA 4R4XA 1SLLA 4LHSA 4CCMA 5CG8A 1PVXA 2D44A 4B1LA 5JOWA 1NKGA 2H0BA 5FJHA 2Z2SB 2ET1A 1JTZX 1IKPA 2CDOA 1SMVA 4TLGA 3VBOC 3LFIA 2BUKA 3POJA 4BCUA 4IERA 2OYZA 4D69A 2JEMA 2SLIA 3LWCA 4CUCA 4NIHA 1RUF1 5L9BA 1JZ3A 4O65A 2NMOA 2XLGA 1AYM1 1U5YA 3NV3A 3FX3A 1ZZ8A 5FYIA 4MYEA 3WCRA 5A7WB 3WNOA 4P14A 5DZFA 2BEOA 4K1ZA 1F15A 2XUMA 3CL1A 5LA1A 4N43A 1ND3C 1R091 5FQ0A 1WMDA 1JHJA 1PO23 4DPNA 1NZCA 1W8FA 4Y1VA 1UZZA 1RUI2 5FZHA 1JW6A 3AKPA 3CMGA 5GLTA 5FYUA 4RN5A 2OUJA 4TZDA 1GP4A 4LKDA 2VMDA 3U11A 4N90A 1GOHA 1YFWA 2PHDA 2A5ZA 3NNMA 2JDAA 1RGSA 4AI2A 4XF9A 1CVNA 5FXXA 2QQPA 4YPJA 4INDA 1IS4A 4DNYA 4QQLA 3K46A 1UX7A 2ADEA 5F5QA 1WW4A 3LGRA 3OSDA 4NHLA 4Q27A 3N7MA 1ZREA 4CTEA 1E5SA 1H0BA 4IEXA 3WNPA 4PBPA 3CEWA 4E2QA 1N3PA 2WO3A 2QFEA 5A33A 3WUDA 1TMF1 5A6YA 5IAXA 2WBKA 5KC5A 2Z79A 4QX1A 3O1TA 4Z2AA 2QNKA 3HN3A 3N9MA 3M4FA 1TEIA 3DKQA 3E6CC 1EYBA 3P5BA 2QQOA 3FUOA 2IXCA 2P37A 3A4UA 2ADDA 2WDBA 2ZZJA 3KCYA 3IMNA 1OQ1A 3OBZA 4OVEA 4ORFA 4PT6A 4A7ZA 3NJVA 1RHI1 1QOOA 2FBEA 1RVF1 4NIIA 3THPA 4BHPA 5A7WA 4UXAA 4I0BA 3P6BA 5FZ6A 5IK4A 4FTSA 5FR3A 2AC1A 1ZBE2 2JDNA 4QQPA 5FYMA 1RJ7A 3MEPA 4XW3A 4WBBA 5LK7B 4WVWA 4COYA 4U36A 4JZRA 4XJAA 5FOJB 5CG9A 2BVBA 5JIAA 5GZGA 4YM1A 1O4ZA 2EXHA 3CHXA 3IN9A 1ND2A 5FY0A 3VBFB 4BH9A 5CFCA 2IXIA 1R081 2LALA 2VM9A 3PNAA 2WNUB 2DU0A 1W6NA 3ZXFA 1HQLA 4C91A 2ZABA 4QPWA 1VPHA 5IUQA 1DYPA 3VBHC 4Y20A 1RUG1 1AR93 2VU9A 2YBSA 1RMU2 1JXNA 3PIJA 5BNOC 2ENRA 4AQSA 3KVBA 5A33B 4H7LA 4IGPA 3FFQA 5FMOL 3S57A 2XQXA 4NHYA 1QJY2 1PVC1 4TXWA 1K12A 3LA3A 5IK5A 4UYBA 1W2AX 5FYTA 4Q1PA 1OF4A 3M3CA 5ABJB 3HR9A 3K51A 4NUBA 3LOIA 4KWKA 4U2AA 2DDUA 3KCXA 2XLFA 2VZUA 3WXPA 2JDZA 4YVWA 3JCIA 5DAXA 1NE4A 5B4NA 5LA0A 3H42B 1RMU1 5I0TA 2YGLA 2PLV1 3K4AA 5FLIA 4LE3A 4FPLA 4GMP1 3E5XA 4K9SA 1TME3 2XUEA 5BNOB 4CDUB 2DUPA 5F37A 4N53B 3POIA 2VZRA 3WW3A 4BIFA 4LE4A 3GCWA 2VMFA 1X36A 4XHBA 2YHJA 3Q8BA 5ANQA 4XXAA 5IYYA 2O14A 1SG3A 1RUG3 2GMEA 2P6CA 4Q4X2 4LIVA 4XUTA 3K3OA 3DXUA 4OUEA 3PVNA 5EXOA 1ODNA 1FMD3 3WEZA 2JG9A 2R16A 1YYNA 4NROA 5A1LA 4IE6A 2A6ZA 1T6GC 3LEIA 3TAYA 2E51A 1I5ZA 2E32A 2H6CA 5LBBA 3T4HB 3AKQA 4OHZA 2XPJA 2E31A 3BTYA 2G19A 2TNFA 2X8KA 2KR2A 4QX2A 1ZX5A 3DYMA 2XJQA 3NQHA 5EQUA 2J1VA 2VD7A 2LROA 2WS93 1MACA 4LPLA 2ZMNA 1OT5A 1GNHA 5DXDA 2WFF1 5BNNB 5JAXA 3VKMA 4BQ2A 3WG1A 1CAVB 2R49A 4XPVA 4CCDA 4DIQA 2YY1A 3HPNA 3VBOA 2PXJA 4XMAA 3O1SA 2D3RA 1AXYA 1RXGA 1VAKA 1ZM1A 2YC0A 3AX4A 3UL2A 1PGL1 2ZGTA 2EIBA 5GLWA 3AL5A 4XF3A 3UKTA 1RUF2 1OA3A 3O14A 4G3YC 3KQ4B 5FZ8A 1I5PA 2BGPA 3ZKUA 5HV4A 5HXMA 1C3HA 4CCNA 3B3QE 2Z42A 2ILMA 4Q2FA 3VDAA 2XJTA 4XTMA 5FJKA 2VUAA 3AJYA 1TME2 2UWAA 4H14A 2X53S 4HK9A 5F6LB 3ZKYA 2V4AA 4XZUG 3AZZA 1UOFA 3NSTA 4D0QA 5JXGA 3IAPA 2JKBA 2OUHA 1VB2A 2KXLA 1B35C 2ZGPA 1XU2A 2UYAA 3GZEA 1OI6A 4UT5A 1H4GA 1JYTA 4Z07A 1TG7A 3WNLA 3MIBA 1H4HA 2RS52 1FMD2 1LESA 3UJQA 4YVSB 1XNBA 1BBT1 1OFNA 3OYWA 3AZYA 3GZTB 2XONA 1Q5OA 2FZ2A 1PK6B 4GA9A 3ME2A 5C8CB 3NNGA 3N9OA 4XUPA 4XDQA 2WSVA 3GDBA 4Z2WA 1MS1A 3ECQA 1W04A 3POWA 3OGSA 1US2A 3JU9A 4YW5A 1RB8G 4UF0B 4YGCA 1W8OA 2MPFA 3AFGA 4LKFA 5FMBA 3USUB 2WO2A 5FPLA 2YMZA 1OUXA 5JWPA 1WA6X 3P3NA 1UU6A 1AR71 2J42A 1NYWA 2VR4A 2FMYA 4FOVA 1NUKA 1VRBA 1RUH3 2R0FA 2ZXQA 4OMDA 5D8AC 1S0FA 3CO2A 4CUBA 1YJLA 3N4MA 1RUF3 1W0OA 1TVGA 5IWFA 4MGSA 1C28A 3ZM8A 5LB6A 1KS5A 2Y6JA 3B9IA 2OIIA 5DN2A 5FP4A 4MHUA 1UN1A 4RS5A 2D5FA 2HWC2 4AF9A 4ASKA 1H2KA 2FZ1A 4OI4A 5JOZA 1GICA 2LM3A 5A3LA 1DBNA 4YZ3A 4JC1A 4IE4A 4OHWA 2JE9A 1NCQB 2R042 3QH7A 3MLJA 3IDEA 4YZ2A 1O3QA 2Q8CA 1HJGA 1V6MA 1CJDA 1N1SA 1POV1 3FL7A 3RS6A 4P02B 3T2TA 4FPHA 1PK6A 3KT1A 1UYYA 5D8AB 3JB8A 1KJRA 3ETQA 3E1F1 3H8UA 1SBDA 3I2IA 5FCCA 2GU9A 4RS5C 1CAUA 2YC4A 3JD72 2BOIA 3KCCA 3LDRA 3NJZA 3EMRA 4FXGB 4UF0A 4XFHA 5DUUA 4GD4A 1HXS2 2OZJA 4JKKA 4P08A 3GF6A 2E26A 3HBKA 4Q4Y1 4AVTA 2JKXA 2WS92 5LATA 2CWSA 3ES4A 3AFKA 5IATA 3FHQA 3VD3A 2YZ4A 5HBAA 2JENA 4QMAA 3SEEA 1R64A 2CTVA 2RE9A 1FNYA 1RVF3 5T54A 1LCLA 5I0DA 3ETPA 1POV0 2HYXA 4FO9A 1POV3 3OB8A 4IE7A 2XBO2 4FPEA 2W87A 1BJQA 2LS6A 4IV3C 2ARBA 1MS8A 5L73A 3VBHA 1VBD3 3ZSEA 2GNBA 4S2HA 2Y6KA 2BNNA 1UU4A 3DPRB 3A22A 3AZVA 1CPMA 4L99A 2ZX2A 3IPVB 5FP3A 4LR4A 5GZEA 3SCGA 1OUSA 5FLJA 4S2FA 3L9JT 3B00A 3CJXA 4FAGA 2KM2A 1CX4A 2Y0OA 3FLTA 5ACA3 5LBFA 2F4LA 2QQIA 3I59A 4BXFA 3LFMA 4GB32 2R30A 2JB8A 1CAWA 4KNCA 4MGKE 1PGW1 4RYDA 4NO4A 2CAUA 4YNIA 4COWA 4DRRA 2BYVE 2HWF2 4WZCA 4AVSA 5D1IA 3U4SA 5FZGA 1HJFA 3QCWA 1SCRA 3EJKA 3WDYA 1AR72 1K5MC 4Y5SA 3VBRB 5CKQA 4UWDA 2GH2A 3I97A 2DU1A 5FAXA 3RWNA 4NAMA 1GQGA 3FC0A 1SHWB 3U10A 5J37A 4NRPA 1ZYBA 3R4UA 2OPKA 3HN1A 4JGZB 4X6RB 1XYOA 1O8PA 2R1DA 5C4WC 3I4IA 5F9TA 2B46X 4D7TA 2VULA 2NP0A 3LE0A 3OUIA 4ZHNA 2TUNA 4H3WA 1W8NA 5FYHA 3PDQA 3SEPA 5CZKA 1DQ4A 3BTXA 4XYXA 4OHXA 4CP2A 4HLTA 1AYM3 1GWKA 3EYPA 3RZZA 5IVVA 2ZGSA 3AMHA 3IBMA 1COV3 1N3QA 4IE0A 2VOXA 1QU0A 1XOYA 2C4XA 2JG8C 2PN5A 2WT0A 2VXRA 4RL7A 4DFSA 4CEYB 2P3IA 2CDPA 1R093 3I2DA 5T5LA 1OH3A 4XJUA 4XCBA 1VJ2A 4EWEA 1CD3G 1UOBA 1T6BX 2RMU1 3NAPB 4LTAA 1F8VA 1I3HA 4TWTA 4XFAA 1OSGA 2A3WA 3Q8FA 1WGPA 3APBA 3ILRA 3W5NA 5I0SA 5FO7B 3ZYJB 1RYYA 1Y7BA 3VD4A 5FKCA 4CDQC 2WFF3 2Y6FA 1ENRA 1V6KA 5GZDA 1RJ8A 4CP0A 2WAAA 1OA4A 3LA7A 2W91A 1REFA 3D0JA 1YRZA 4HPKA 4NHMA 5FYCA 3WQ0A 3ZYPA 4BK4A 5LEKA 3O1MA 4PF1A 1FYUA 3B94A 4XACA 1JMUB 2X29A 4WM8B 3V64A 4DY3A 3U4XA 1XNTA 1GP6A 3EXUA 1HXS3 1R1ZA 1ULDA 3ZSLA 2G4IA 1CESA 3WW2A 3VB9A 4JKMA 2WWSA 5A6QA 4QQOA 4QDQA 3JD71 1EAH2 1B35B 1QQP3 2RMU3 1PMJX 1NT0A 4XFIA 2QQLA 4DUVA 2E6VA 3ILFA 3AB0A 1W6OB 1J58A 5IVCA 3RQ0A 5C9AC 2IVJA 4CDQB 3Q9OA 3POFA 4E8CA 4LBQD 4IQPA 3SHRA 1PZ8A 1UXZA 2PAMA 4Q4X1 5C5UA 4AHZA 1NG0A 3N9QA 3BGAA 4IESA 1E5IA 3H1YA 1JOPA 2J1SA 1PK6C 3I3QA 1RUD1 1W8ZA 1FI2A 1UKRA 3BI3A 4FI9A 2A6YA 3CKHA 3KV4A 4P5HA 4QPIB 2O1QA 4AQ2A 3SKJE 1LB2A 3MI8A 1BMV1 2DBIA 5F5AA 3R4SA 4EN7B 3MPBA 2HWD2 4QXHA 3HD8B 4MXWA 1ZRRA 2BERA 3IM0A 1QDCA 5IVBA 1FPN1 2AEZA 4CU7A 1W0PA 1XBFA 3EQEA 4J1XA 2CYFA 3O0WA 4LHKA 3S7IA 3FHIB 1YWKA 1CN1A 2E7AA 4I01A 2B45X 2GN7A 2ZGUA 4Y1YA 1O5LA 3RNSA 3KVAA 3JXSA 3M3QA 2EIDA 1AR73 2RM21 1QJU2 2F17A 5FPXA 2Z69A 3LEMA 3NKGA 4AVAA 1RXFA 4CXXA 2EXIA 4D8MA 4JGYC 1FPN2 2ZTNA 2J22A 1NA1A 5KC6A 1WLCA 3AK0A 3WX5A 3WW4A 5DG1A 2HEVF 4W4ZA 3Q8EA 2QDNA 1V6OA 2F4PA 2WNVC 1VBA2 1IOAA 1J3PA 1W6OA 3IAQA 3N7LA 4J6GA 4V1PA 3C7HA 1NCQC 3BVCA 4M3CE 5C7GA 5A7PA 1PZ9A 4LUKA 5A7SA 3M1HA 4QKFA 3LA2A 2VBBA 2YROA 3MV01 2WYSA 1A34A 2W47A 3PTYA 4OZOA 2XL9A 4WM7C 3U37A 5L19A 3FE5A 2DVFA 1QNYA 4PLMA 5FY7A 1YQCA 4A42A 2JE7A 1AYM2 3T2OA 1GZCA 4Y24A 4FBFA 1X9TA 2W1SA 3ZFGC 5A70A 1XJAA 1O6UA 3POBA 1H9WA 2PHTA 5KXCA 4Q1RA 1UZ0A 1KRIA 3PVEA 2CY6A 3UKVA 3KHCA 2VUJA 2W5FA 1H1IA 1IS6A 1ZA7A 3W5MA 2EAKA 2EIEA 2GAUA 1O4YA 2E53A 5FZ1A 1JYWA 4FVVA 4G9SB 4FFIA 4I0WB 2HH9A 2BNMA 3O0XA 2VZTA 4JCKA 4Y22A 2GNTA 2RS31 3KM5A 1NLQA 1LULA 5CVRA 2GC1A 4AHYA 4D6SA 2FDIA 4PIZA 4YVWC 4IEZA 4CDXA 3C7EA 1W6NB 3GZAA 4N8MA 5F3EA 4CUAA 4DXTA 4E4HA 5FZFA 3VZLA 3H8RA 1JOBA 1ZA4A 4YG0A 5JR7B 1YI9A 2OS2A 4IEOA 4E8DA 4HVQA 2J1EA 2VW2A 4PJYA 3B01A 3CJIC 1R1A2 4HSJA 1W6MB 1OLME 2W39A 3O0VA 2JDMA 1SLTA 4XFGA 4O9EA 4QM9A 4L0PA 1BLZA 1G86A 4NIAA 3RYPA 4QD2A 2RDSA 4S2GA 3ZXDA 2FDKA 3ZXAC 1OBNA 1ZRDA 5C3OA 3QBQA 4B8EA 3KB5A 2WZ8A 5ABJA 1FAYA 1GUIA 1EAH3 2VMHA 3J9SA 3OGVA 4MXVA 1FXZA 2VTXJ 3AVRA 2XQRA 4Y1XA 4YVWB 1JYXA 2RDQA 1Q56A 3PJYA 2PHXA 1PM7A 1QKQA 1VMFA 4QGLA 2RJ2A 1BBT3 2B9UA 5LEJA 2XB6C 1AXZA 2FMDA 2ZGNA 1NX9A 5C4WA 4CDUA 1G9CA 1POQA 3T2PA 4B4PA 1H2LA 4DB5A 1HDKA 4CRQA 1IPKA 2XVLA 5A7QA 4XE9A 3VBSC 1LOGA 2PHWA 2PHFA 3N7JA 4HMZA 4BZ4A 2WNOA 4FCAA 2BU9A 2NMNA 1GWLA 2GMPA 2Y60A 4K20A 4YM3A 4CP9A 1XC6A 1X9PA 5BV6A 4FFGA 3ATGA 4HETA 1JZ6A 2WO1A 4HOOA 2PAEA 2W94A 2YUEA 2PELA 1V0AA 1Y9GA 5CKNA 1QXRA 2WQ4A 1OVSA 5FPAA 2V09A 3BOPA 5LRRA 1RUH1 3PVOA 4Y5TA 3O7OA 2BWAA 1S0DA 2C9AA 3J7LA 4IXLA 4YGDA 5K8SA 3O1OA 3FHAA 3LEGA 1LAJA 2EICA 1UU5A 4Q0UA 1COV1 1JYCA 2WZR3 5L7OB 3GHMA 1U5IA 4Q0SA 4K1YA 1QGLA 3T3YA 4LHLA 5JPMB 3JB4C 3RJ2X 5A1AA 1Z7S2 2EXJA 1JYIA 1REEA 1UXXX 4AGGA 3I3MA 5H9SA 3WW1A 4CXYA 4FPYA 3RDIA 4JRAA 5K0UC 3JBG1 1SPPA 3IIAA 3ST7A 3W58A 1ZZ9A 2IWGB 3MIFA 1LU1A 1SLAA 2IXLA 4AI0A 5KXBA 1KS4A 2XOMA 3MF6A 4IEPA 4BB3A 1YIFA 1JBCA 5FRAA 1QJX3 1UF2C 2G1MA 3E97A 1RVF2 2VQAA 2VE1A 4BXSV 5L7OC 4R9DA 3AMQA 4Y3OA 2RM22 2FDFA 1NLSA 4DINB 4K8FA 3RI8A 4B29A 4IV1C 2XBO3 4YFZA 5C33A 1LOCA 3NMBA 4H55A 5GM0A 4C90A 5FZ0A 4E2GA 5GLUA 1PVC2 1XSRA 3H8XA 1W9SA 2WZR1 4GJZA 1GZTA 3O5SA 5BNQA 1H2MA 2P5BA 1PIV1 2RS13 4QPGC 4XF0A 4RR3B 1U12A 1Y9MA 4YW3A 2SBAA 3G7DA 4PIYA 4HKOA 4QAWA 1Q8QA 3ZIXA 3V0BB 3WCSA 4WM7A 5A7NA 1REDA 2X5IC 1QHDA 2WN3A 1X33A 3A7QA 3ZIWA 3WZ1A 3TNPB 1MQTC 3KHBA 1YFXA 1XB9A 1F2NA 1RUG2 4JRLA 4Q4X3 4Q4V3 4C1XA 1H1AA 1BK0A 3LKJA 1V00A 1VBD1 2ES3A 4QXBA 3DYOA 5LK5A 4QXCA 5I91A 1K45A 5IAVA 1RTVA 4YM2A 3NW4A 4AI9A 4UFMA 2ZKNA 2VOTA 3NV4A 4PHZA 3ZDSA 4R52A 2DVGA 1VBE3 4LBKA 1OLRA 4W6YA 1HB4A 2ZAAA 3DUIA 4ET7A 3BALA 2ZX1A 1MQTA 3C8XA 5JXHA 2BV4A 5FYYA 1SCSA 1EUTA 4AEKA 2DCKA 1WW6A 3CF6E 3DN7A 2YPJA 3PUIA 3ZN6A 4COVA 3OGJA 2QQMA 2D98A 3S5AA 1D4VB 5FXZA 5FO9B 1LOFC 4AAPA 3QLQA 2RM23 4CEWC 2QQWA 3KD4A 3OF1A 4Y33A 1IKQA 4FOQA 4CU8A 2ZKLA 1A8MA 2IXJA 2WUHA 1N3OA 3ACLA 2V4VA 5KBFA 2VZ1A 5F5CA 3PUQA 5FY1A 1WLDA 4WM7B 3PUSA 1QJEA 1KGYA 3IMMA 2VY0A 1CAUB 1UIJA 2JWPA 4PDWC 1KFXL 3MUY1 4GWJA 3ZFGB 2IZWA 1TNFA 4TYSA 4XFBA 3FBMA 2GC0A 2UY9A 4Q4V2 5A6ZA 3WF1A 1MZFA 4AI1A 1KEXA 4CCOA 5JI9A 1JU4A 2WFF2 5DAQA 4Q0PA 4LLFA 3DECA 4Q8LA 5JR2A 2O0OA 4HONA 3ZR6A 4D6RA 1RUH2 1GNYA 1CAXB 1SZBA 4B4QA 5FZMA 2YDEA 3BOWA 3MUZ1 4XQ4A 4URTA 5KHKA 5EJ3A 4MGQA 4MGTA 2D6KA 4OLLA 1G9BA 5EP9A 3CDZB 3ZO0B 5CKMA 1SLIA 2L9LA 3SCHA 2Q1MA 4WVMB 4FFFA 5F3IA 2ORXA 5T5PA 1XNKA 2VECA 5T5JA 3ZN4A 3AZXA 3G6JB 5FZLA 1SQ4A 1X82A 1UYZA 3IPVA 2D43A 3O1RA 1GOFA 1QJX2 1DHKB 1W99A 1DFQA 3WDWA 5LY1A 3CJIB 2WN2A 3CLPA 3MYXA 2LW8A 3EHKA 4WVZA 5JVVA 4RQPA 1O7FA 3LEKA 1WLTA 4ONUA 1IGOA 2W92A 1MZ5A 2HWE2 4LJHA 4AHXA 5B4XA 1ULEA 1LGBA 2YV8A 5IFPA 3PMEA 3AKRA 1MEC2 4UBHA 3C7FA 3ZYFA 1MR5A 1YHFA 4BQ1A 3E6BA 3I7DA 3JD73 3WF4A 1WCUA 5FK7A 1VRH3 5HCHA 3MZHA 1LEMA 5C8WA 1CWPA 5FZOA 1SFYA 5FBJA 4AEJA 4GXLA 3ABZA 3I2JA 5FPZA 5J48A 3H50A 1XQNA 3VBUB 2XR4A 5T50A 3WR0A 3MO4A 2OVUA 4AFAA 2MEV1 1BCXA 4LBNA 4QHBA 5IW0A 1A8DA 3OY8A 2VMEA 1OOPB 2BVVA 2JG9C 3N35A 4W65A 1RUOA 4FP3A 1CIWA 1XRUA 5C3SA 1ASJ2 3LCPA 4NOTA 2VVEA 1CZVA 5FREA 4QKNA 1UOGA 4Z8BA 4AW7A 2ZCWA 5BUVA 2EAAA 3MPPG 2BWCA 2H6BA 2ZGRA 2R1BA 3GJAA 2YB7A 5AFEA 1HRV1 5E88A 4M0HA 4AZZA 2JXAA 5JDBA 2A75A 3R6SA 2XJSA 4NWWA 5ACA2 1UO9A 1VRH1 2FQPA 3PMSA 1QIQA 5KHHA 3NNFA 5JXIA 4AOCA 3VKNA 4BQXA 1NCRC 3AJZA 3LIHA 4Q4Y2 2XJRA 2JG9B 3IB3A 5IFTA 3ES1A 2J1UA 4GJYA 3PLQA 4Q0VA 2JG8A 4W6WA 4IEVA 5LA2A 1KXGA 5E89A 3WT3A 4CXWA 1CZTA 5K0UA 2ORZA 5EWSA 1DQ0A 1IZ3A 1GQHA 4PIXA 4MOAA 4GALA 4AXOA 5GLVA 4EZ4A 2E7TA 5EZWA 2NN8A 5J98B 4PLOA 5KHGA 2VH9A 1RUJ1 4RD7A 5BNNA 4LO8A 2XKPA 5FKBA 3ZXEA 1Y4WA 4BPZA 1MVQA 3CQOA 4JHZA 4JTNA 1C1LA 4AAXA 3KT7A 2XJUA 1QF3A 3NKTA 4TLFA 4UFIA 5F2SA 1SDWA 4JV4A 4XUQA 1GKBA 2HWC1 5A3TA 2FDGA 3SH3A 2B39A 3WG2A 4CDWC 4MGZE 3WDTA 1IS3A 1AR82 4P9JA 3VL9A 4KWJA 2BRTA 3SMHA 4HKWA 2Y6GA 1QJX1 5HI0A 2V5DA 5FXWA 4IV1B 3WDVA 1UMZA 4YG6A 1RIRA 2RDRA 4N7IA 4XCAA 1PNFA 2R7EB 2OA2A 2Q1ZB 2ZGLA 1DG6A 4QDRA 1EY2A 2P1BA 4E27A 3BN6A 1DQ5A 4QQ2A 5E16A 1VMJA 1W9YA 1WWYA 3IWZA 2RS33 4PQQA 1SLBA 2VTXA 3S30A 3V65A 2X5IA 3LZZA 5FUIA 1N1TA 5C3PA 2QQJA 3B02A 4JGYA 3HIFA 5FY5A 3VGIA 3SITA 4QX8A 4CYDA 3AKSA 2VCMA 3ZFEA 4MXWB 1GYKA 1B09A 1RUJ3 1PIV3 2RS11 4GZ9A 4Y1ZA 4S2DA 2P3KA 3GBFA 4N9HA 5L9VA 1AL21 2GH8A 1AZDA 1COV2 1H8VA 3O1VA 5G04L 4ZU5A 2BBVA 1F4AA 3DXTA 4W50A 1WLWA 5CU1A 5A1FA 2UY8A 1H30A 2Y34A 3IT8A 5FPUA 1AX1A 1EAH1 1W9WA 2VZOA 5FYVA 1WKYA 3USUA 2FCVA 3KV6A 2GP5A 3VDDA 2OW4A 5CADA 3J7HA 5FZ3A 2EXKA 1ND3B 3ILNA 4LO5B 1LHOA 1V6NA 3SISA 3T0BA 3N9NA 1MPXA 4CEWB 4OMCA 4XOGA 5JMOA 3OG2A 4RFT0 3U78A 5FZIA 4DUWA 1DZTA 4CCJA 5ERLA 1W28A 1LECA 1OKQA 3ZLIA 4BIOA 1BMV2 4GWIA 2LTNA 4XF1A 2LUWA 1NA1C 2W08A 4KGGA 4COZA 1HRI2 4F3JA 1L3JA 4E4SA 1YFUA 4BDVB 2IUWA 4Y1UA 3ZFFC 4D6QA 2PHLA 2D6PA 4X8NA 5DUVA 1E5RA 2D5HA 1RUC3 3NO8A 4QHZA 4BWOA 1NCQA 2C26A 2ZEZA 4AQ6A 1FV3A 4CCEA 1OURA 2EIGA 1V70A 3R05A 2TEPA 2X10A 2E9QA 1IG3A 2R071 4K40A 1UYXA 2JIJA 2VUDA 3QACA 2JE8A 2CNAA 4BA6A 3ZYHA 2ETEA 3I2GA 1J59A 3ALQA 2G9ZA 4M3CA 4FQ4A 3RZJA 4OI0A 1EUUA 2ZEWA 3W59A 3ZFFA 3D0SA 4I2OA 1LKNA 1JZ8A 1OPOA 5A6XA 3R0RA 3T1MA 4ZONA 3O1PA 3CIHA 1DP0A 5A3NA 1C57A 1GLHA 1OXCA 3LPFA 3AP4A 1W8TA 3SC7X 2A6XA 3JBG3 3AYAA 4XDPA 4AFMA 4DXZA 1MZ6A 4MG2A 3BU0A 4I3GA 1O3RA 2R32A 1GOGA 1Q43A 2WT2A 4IEWA 1XPWA 3IDCB 3CZUA 4WVVA 1SFPA 3TN91 4F8AA 4B1MA 2DTYA 3OBTA 4R9AA 1MS4A 2CGOA 1IQDC 1ZZ6A 3V0AA 4XF4A 4L2NA 4DXRA 3VBHB 3UJOA 4FXKB 1QJU3 4G4FA 2OXBA 5DDJ1 5B2GB 5LA9A 5BYNA 2NM1A 2VNOA 1FPN3 4LITA 5LWBA 2V5YA 4BM8A 4LBQB 1JODA 1LRHA 1QJY3 4UFJA 4KG0A 1VAMA 2RS32 4LBOA 4BLIA 4MO3M 1GZWB 2D7FA 3RJRA 4KBBA 2QTWB 1E57A 3OPWA 3UT0A 4YGEA 5H9RA 2Z5WA 3AL6A 3T08A 3TRSB 5TSWA 2VCAA 3SH4A 4YSFA 1F5FA 1N47A 3ZXGA 2ARCA 3V56A 2VMGA 1MS9A 2E33A 4YW6A 5DDJ2 2WIIB 3VBRA 2LRPA 2XG3A 2HEYF 2Y26A 4X6QB 2GP3A 5JXJA 4NPMA 3HQRA 3MV11 2VZ3A 3KMHA 4HN0A 4JAAA 4R8HA 4URAA 5C71A 1UZYA 1GBGA 1HB2A 1IS5A 2HWB1 2K0GA 1W3XA 3OPTA 4L97A 1H2NA 1J83A 5FUPA 3RMXA 5C3QA 2WABA 3VZKA 3VBSA 4AL9A 4EV0A 3RRDA 4FAHA 2DF7A 2VZQA 3ACHA 3VN4A 1VBE1 1F5JA 3JBG2 4FPJA 3HOBA 3VBFC 1LHNA 3WF3A 4WV8A 1MS3A 1W6QB 2Y6LA 4XAEA 5FY9A 5L7OA 3VUOA 4ITCA 5DPNA 1I6XA 5J3UA 2WNUC 1W9FA 4IEUA 2I2SA 3RZHA 5JI7A 1HRV3 1FOD3 4KI5M 1DF0A 1DGWA 2BBAA 2NPIA 3BYWA 1DQ1A 2VXJA 4XURA 3KT4A 4N43C 4DMIA 2TBVA 3VHRA 4TSVA 3I3EA 1C8NA 1AR92 3O12A 3P1IA 3B93A 4QPGA 3KSCA 4HL0A 3NAPA 3T2QA 3ZX7A 1R092 2GSYA 3HNMA 5FO8B 2BPA2 4UFLA 3I3BA 5I8YA 2CL2A 3KGZA 4YARA 5DUWA 1UYPA 4BMBA 4KBZA 1DGLA 1HRI1 4BQ5A 1QXPA 1VIWB 1BQPA 5BXXA 4C8DA 1HQWA 5HCBA 1VBB1 2QQNA 2Y8KA 3SKVA 3N36A 4ZKTB 1PGSA 1Z78A 4Q26A 4OI2A 1Q8SA 5F32A 3SCFA 3VLBB 5FQ0B 5FY4A 1H1MA 4WM8A 4N53C 5FUNA 2C9KA 2YYOA 1BBT2 1PMHX 4QKBA 2PHRA 2VQTA 2X05A 2DVDA 3OPZA 1Y43B 2BZDA 4LUMA 2R063 4PF5A 1NE6A 2CAVA 2O8QA 4P9IA 2JB4A 4QQHA 1UNBA 2RV9A 1SBEA 1WD3A 2HWE3 2RR12 2QUOA 2ZGKA 2ZMLA 1WCSA 5BPXA 4EWDA 3S5QA 1W6PB 3SNMA 4FPOB 1LOFA 1PO22 3H7JA 1ONAA 1RUI3 5BNOA 4B4RA 2C1FA 4N53A 2RMU2 4V2VA 1OVPA 1OC1A 4AQTA 1PNGA 2WLQA 1WMFA 3N3HA 3SQOA 2OQ7A 4YFWA 4EQVA 1WZXA 1GWMA 3AM2A 2R072 3H1WA 2YBPA 1AVBA 5F3GA 1C4RA 1DLCA 1GFF2 4YZ4A 1UAIA 1YQ6A 2XDVA 5F2WA 1DLLA 2JDKA 2XHKA 3RWKX 4F7ZA 2XGXA 2WNVA 4DEVA 1XYNA 3POEA 2Q8EA 1HIXA 4O9GA 1OMIA 5GZFA 1LEDA 1PO11 4OYUA 3B5LB 4QXKA 3FUQA 1Y3TA 1D0HA 3FBYA 3M3EA 2W3JA 1UY3A 2XHNA 3AXDA 3GBGA 4JHTA 4ASMB 2A3YA 4EN0A 4EZHA 3ZDVA 1R1A1 1XXNA 4QT6A 4HBNA 2BGOA 3JZVA 4A7KA 3I49A 1LNSA 1N1VA 4GH4B 5JSRA 1QDOA 3WP6A 4KH9A 2MEV3 1L7LA 3VBOB 3S0MA 5FYBA 3WD5A 1AR81 4R9CA 1NXD1 2WAOA 3GXUA 4DZGA 1AYN1 1NA1B 2XWJB 3ZN5A 2VMCA 1OD3A 5L36A 2R062 1W6PA 4OI1A 4AGRA 3THCA 5DUXA 4Y20B 4LLOA 1BVP1 1W3VA 4FQZA 3AMNA 3TYJA 3AP6A 3U1XA 1QXJA 3LQCA 2A70A 3KZ4C 4BQ4A 3KGLA 4NAOA 2QZ3A 4FPFA 1V9U2 4GWNA 5HXVA 3WHUA 5C8CC 1BK1A 2JICA 1HW5A 3Q8CA 4LQRA 4X8PA 1SEFA 4GH4C 2FDJA 1OKOA 1TQ5A 2RS12 4MHRA 2AZ5A 4MVTA 3ZSJA 2WZPP 3BKZA 1ULFA 3BTAA 5DABA 3WDXA 3C7GA 1FATA 5LZ6A 2R073 5FFOC 3RVHA 2WQZC 4LK7A 5ANNA 1AHSA 4YVSA 1ALYA 1W0NA 2FHRA 2XBO1 4MLOA 2CHHA 2G9GA 2YC2A 4AGVA 2Q5TA 2QVSB 1W2OA 3MIEA 5IT6A 4LULA 1AR83 3IDBB 3K75B 4D94A 2Y0IA 1W9TA 3LD8A 3TEXA 3NVCA 4AI3A 1O3SA 4UW5A 4EN8B 3LSDA 2IFWA 2W1UA 1UIKA 2GC2A 4UW4A 1V6JA 5ABJC 5JUVA 1GSLA 1MZEA 3DF0A 5FMCA 5CAZA 1OQDA 2HEWF 1VBD2 2Q4SA 1BKZA 4P5YA 4Q29A 2GC3A 1HB3A 4HVRA 3T0DA 2GZWA 2RJKA 2UU8A 1UCXA 2JDPA 4QX7A 1S2EA 2MEV2 2DUQA 4Q4V1 4YGBA 5FYZA 4NR1A 2VL4A 3N7KA 2HWC3 4COUA 1DCSA 4UFKA 5FP7A 1MS5A 3X29B 4CDUC 4YW4A 1UW8A 4XVHA 3VKFC 3MHZA 1PIV2 2WWJA 3E5UA 4IGQA 2B42B 2NLRA 2ERFA 3MLLA 4A2UA 2OZ6A 4JDMA 3AVSA 3GGLA 4XIKA 5KWRA 4FTBA 4HANA 3FJSA 4UBGA 3H9AA 3O1UA 1DDLA 4R4ZA 1MEC1 3ACFA 4MGIE 1WBFA 1C8M3 3I2FA 4UW3A 2VW0A 4ATEA 4PQ9A 4RS5B 5JMCA 1OOPA 5CB7A 3BUCA 4OZXA 1D4M3 1ZBE1 1URXA 2WRAA 1XNCA 2NYYA 3MFAA 1QOTA 3UNPA 1DIWA 3BPSA 3UV9A 2F6BA 2DV9A 2WYFA 4MZUA 2ZHMA 3ON7A 3UETA 3WINE 3WV6A 1HV1A 4FOYA 1O91A 2FD8A 3ZPYA 3J4UH 3DEMA 4KG8A 5C4WB 2Y38A 5D8AA 2BNOA 2W52A 4KGQA 4BE3A 4BQWA 2BW8A 5BNNC 1VBB2 1NOVA 2AEYA 5AC91 1LHWA 2C0ZA 1ACCA 4XC9A 3QD6A 4QX5A 1AF9A 3K48A 2W1QA 2VTFA 3KF3A 1M4WA 5FPVA 5FDBA 4OFGA 4MADA 5EPAA 1YUDA 3J8F2 5C5TA 3EBRA 2JG8B 3DV8A 3FZ3A 2HBUA 2C6SA 1CR7A 3PUAA 4IV3B 4L11A 4NMIA 4NHKA 5EHDA 5EFUA 1MEC3 3DPRC 1A6CA 2XKOA 3OYWB 4OCTA 2XH6A 2IXKA 1VRH2 4BQYA 2E7QA 3NAPC 5CIRA 4ES8A 3AP9A 3UESA 4YZ5A 1G6NA 1MS0A 5E6HA 3ITQA 3LF7A 1ULGA 2JD9A 5FWJA 1AJOA 5FMDA 1JZ4A 5GKAC 1JZ2A 2CGPA 1NY72 1UPSA 1LOEA 1YCIA 1HB1A 1BHGA 1QJFA 3TNQA 2AH2A 4Q4W3 3USSA 3VV1A 4H7MA 4IDZA 2W68A 3U0ZA 1RUC1 2QQVA 1OFSA 2H0VA 4A7YA 3VD9A 3D6EA 2VCCA 5JCTA 2VZPA 3HJRA 2Q30A 3LIGA 4CCLA 4SBVA 3LAGA 2OPWA 5CEHA 5K4LA 1AL22 4ZU7A 4N7UA 4SLIA 3UYJA 3ZXLA 4ATFA 3AC0A 1FX5A 1VBB3 1VBC1 2CV6A 1KD7A 1H6XA 2RG4A 1S1AA 1STMA 2IFRA 5KXDA 3BTZA 4NIGA 4EN6B 4CDWA 4HG6B 4C0HA 4K7JA 3INAA 4IEQA 3RZKA 2JDHA 4QHOA 2J7MA 3ZSMA 4DXSA 1WMEA 1AYN2 1UMHA 3U14A 1U5XA 4LO7A 5A80A 4CEYC 3OGRA 4YW2A 1LTEA 4HXCA 4A44A 2J1RA 1UY2A 1CZSA 4RR3A 2HJIA 4Q4W1 4DS0A 2XXZA 4BMEA 3WDUA 3TN93 5FIXA 2WLPA 1ST8A 2PQQA 3KLSA 3CZJA 1O3TA 4NN0A 4YM0A 2AACA 3WQ7A 2V72A 2ZOEB 1OQEA 1D2QA 3TEWA 4BISA 1FV2A 4XBLA 1QJU1 2EA7A 4Q0QA 5C6CA 5DDJ3 2PFWA 3HQXA 4NRQA 4XDOA 4AR2A 4CEYA 5A32B 3K3NA 5FV3A 2BP6A 2VPVA 1VBC3 5J36A 4GQ7A 2ARXA 3D8CA 2ZS6B 1CQ9A 5JIUA 1S55A 3U75A 3HNYM 1W03A 1K42A 4UW6A 5BNPA 2P3YA 1WW5A 1GR3A 3CNAA 2W9XA 2MHFA 1DGRA 3BCWA 4CDXC 4CP1A 3WQ1A 3R4DB 4DY5A 3D4KA 3H0OA 3WUCA 4RFRB 1RUE3 3AYCA 3UGFA 2VZSA 3P3PA 1TE1B 2ZX3A 1SFNA 2E63A 1BYHA 3NRUA 3PUHA 3RMYA 4HPKB 3VDCA 1XNAA 5C9AB 2DBNA 1S4CA 2YBKA 1QEXA 3ACIA 3HT2A 3K4ZA 4AVCA 5C3RA 1AYN3 3I59B 4A3XA 5BNPC 1KDKA 3POSA 4QU2A 5FWEA 2A71A 2YG0A 1D0GA 3BU7A 4JVAA 4ES9A 1VBA1 4OQ8A 4CSWA 3K4DA 4PI2A
chains in the Genus database with same CATH topology
1AX0A 1AJKA 1YNAA 4IETA 4FPCA 2P3JA 1FOD1 4IL7A 4W6XA 3J8F1 4LT5A 5A32A 4B7KA 3MW2A 4F83A 4AYUA 5J09A 1EV11 4RQPC 4XETA 4JGZA 3WVJA 1OA2A 1RUE1 5SV8A 1S0GA 3E6DA 5BNPB 2DVAA 5H9QA 4QPIA 4FPGA 3C3VA 2PYTA 2R041 4META 4RHV1 3VBRC 1HKDA 2VOKA 1G7YA 4MUVA 1W39A 4XZPA 5F6KA 1HRI3 1CGPA 1BEV2 1QH7A 1ULCA 2D6NA 4JTOA 2RR13 1UKGA 4JGZC 4LBQA 1RUD2 1AL23 1VBA3 2ATFA 2I07B 1XE8A 4PLNA 4RQPB 4C0BA 4N9IA 4ZXKA 5A3MA 1WBLA 5CFCB 3T1LA 3MFCA 2WNUA 1OPMA 2DUOA 1EV13 1GV9A 2QE3A 2A7AA 2QZ2A 3M3OA 3WG4A 2D6OX 4D7YA 1O5UA 1X8EA 1RUI1 1XU1A 3TN92 4RHV3 4AVBA 3VBSB 4MH0E 4AEDB 1LHUA 2XVKA 3OGGA 5CBLA 5CFDB 2ZPXA 2ZX0A 3OY8B 4GB33 2D3SA 2PA7A 1W6QA 5CA6A 2ZBJA 1DGRN 3H1MA 1DQ2A 1J3RA 2HWF3 2XJPA 1VBC2 1K5MB 5AFBA 4I02A 5LRSA 3AKTA 1OHFA 1FT9A 3AP5A 4WM8C 1QWRA 2K2SA 3VZNA 1RINA 4BOWA 1R1A3 2PHUA 2PTMA 4PBOA 3AYDA 5AVAA 1LODA 1I9RA 3TOJA 2BGCA 4AEDC 3B69A 5H9PA 4I0AA 5CFDC 2UWCA 2VVDA 3JUUA 4HFSA 3URFA 1QOSA 3CU7A 3THTA 4FTEA 3B7MA 2ZGOA 5K0UB 2N7GA 1EV12 4YG3A 5K7PA 4GB31 4XMIA 4KQ7A 1UD1A 4OUSA 4QM8A 3GYDA 5KHIA 1PGW2 3PVBB 1N1YA 4M01A 1GZ9A 4ISRA 3ROUA 1AR62 5GLZA 4AEDA 3BODA 4QGNA 1ZZ7A 1Z7S1 5CFDA 4YYOA 4QPYA 2HWD3 2DVBA 1H8TB 3FLPA 3MF9A 3M7AA 3A0NA 1YLLA 2D6MA 1ENQA 2O8OA 1Z0HA 3ZXJA 4FT8A 5DZGA 3WP3A 1HRV2 1BXHA 4R9BA 3ELNA 4E2SA 1VR3A 5FOBB 4LA3A 4AWDA 1JN2P 1QJY1 1UL9A 1PO12 4RR3C 2CGNA 3FWEA 3WLUA 2X5IB 5HCAA 1S0EA 4Z1VA 1EPWA 3IKWA 4JGYB 4XBQA 1BEV3 3A0KA 3VDDC 4C1WA 4DRVA 2ZJCA 1R082 2A73B 2WNVB 4NVPA 4XEZA 1Q8PA 5I93A 2AGSA 3M70A 2VQ0A 4YRDA 3LSEA 4XJZA 1Z7S3 5CNAA 4WZFA 3GZUC 4AFCA 1VBE2 2VNGA 2AREA 1RUJ2 3H3ZA 2HWB3 4XIOA 4Y26A 3FMGA 5I0RA 3GHNA 1QJZA 3AZWA 5EYYA 5C8CA 3AP7A 1FNZA 4LBJA 4OHVA 1OLQA 2B8MA 4AHWA 1H8TA 5I8TA 1YIPA 4XFCA 3VZJA 4Z92B 1KQRA 4I09A 1CJPA 1G8WA 4QPIC 4KU7A 1ENSA 2AUYA 3S6PA 4CDXB 1AXKA 4AG4A 2VOVA 3VDDB 2YGMA 1X7NA 2XVGA 4AVVA 4EN9B 2A3XA 2HKXA 1YJKA 5GJ6A 1HV0A 1W6MA 2JD4A 1PVC3 2ZA9A 3GBWA 1IHMA 1G9AA 2D93A 3WHTA 1C1FA 4JDOA 2I74A 5BY5A 4EROA 3RG0A 1RMU3 1UPIA 2PLV3 4LNVA 3POYA 4GMP0 4XILA 4BYYA 1RHI2 4GMP3 4XFFA 5T5OA 3PJQA 4Q4W2 3OCPA 1V9U1 4ASLA 4GWMA 1QNWA 4XBNA 4YW1A 5HCFA 1NLRA 3EO6A 1IPJA 4JQRA 4E4ZA 4Y5Z0 5I8SA 3RYRA 2DFCA 1DU3D 2Q8OA 3V0BA 1A3KA 2R061 1RC6A 4M00A 2NZ9A 2HWE1 2IC1A 1ASJ1 3S7EA 2ZGMA 2DURA 3HAGA 2A6WA 2WA4A 1V6LA 5IK7A 4K6BA 2D3PA 2ZZQA 2P34A 4KL1A 1JUIA 1LJ7A 3U07A 2AYHA 4XHXA 1YXWA 3E5QA 2RR11 4XJWA 1V9U3 3WOGA 3V0AB 4XJ8A 1SACA 5CFCC 1GANA 4PDWB 2DCZA 3DKWA 3FLRA 2WSUA 3WG3A 1PO13 3KS7A 1VP6A 3HMYA 2JECA 1DGWX 1Q8OA 4RGGA 4Q8KA 5JZGA 1S0CA 3AMPA 3HT1A 1ND2B 3VBFA 1ASJ3 3VHPA 3MIGA 3UKNA 1WA4A 1NQJA 3M8LA 2QCSB 2DTWA 4LBLA 1WCKA 1ZBA3 1RUNA 3ZFGA 2ZX4A 2QDRA 5EYXA 2DFBA 4L92A 4IV3A 1NQDA 1W2UA 3MIDA 2VGDA 3NWKA 2D97A 1VB4A 1RUE2 5JZGC 5IK8A 2C5DA 3MLKA 3VL8A 2P2KA 3MICA 4D7SA 4YZ1A 4QGMA 1LR5A 5JOXA 3VHOA 4IEYA 4E9KA 1ZNPA 2VW1A 2ZHLA 2UURA 3VHNA 1ZVFA 1ND2C 2ZHNA 2MNGA 2RS53 3ZXKA 3L2YA 4PDWA 2JJ6A 4WVMA 2GDFA 4P9WA 4YLZA 1PGL2 3M2MA 1JOJA 1VAVA 5SV5A 5AC92 5JZGB 3CJIA 4NPRA 4QPGB 1KJLA 4DOUA 4LEJA 1J3QA 4OULA 3WP5A 2XL7A 3TB0A 3OBRA 1MQTB 2PLV2 3BIWE 2BQPA 1H8TC 1RHI3 4CDWB 4XTPA 2EF6A 3NV1A 3C2UA 3W9AA 3TBDA 1CONA 3ZN6B 1D4M2 1ZZCA 3J8F3 1ZBA2 2UWBA 4AE2A 1YI7A 1HQNA 2GNDA 2HYKA 3VBUA 3BPZA 1XNDA 4GIQA 1CAVA 3DL3A 4B7EA 1KDMA 1ZZBA 1VLNA 4P9GA 1Q8VA 1C8M1 3AMMA 2D40A 2G9FA 2WC2A 1NXMA 5T55A 5K9YA 1Q3EA 1D4M1 1ZBE3 1V6IA 4LO4B 2VNRA 4Q4Y3 3GNEA 1C5HA 4HK8A 1WW7A 2B5HA 4LBMA 4KWLA 4MX3A 4J1WA 1F9KA 5E1RA 5GZCA 3J26N 3TWIA 1ZRFA 1S0JA 5FBZA 5AC93 1CAXA 3RPQA 5J96B 2V73A 1X8MA 3SH5A 3QOPA 4AK3A 1XYPA 5T52A 1S0BA 3I54A 5KHJA 3LB9A 4I30A 1EP0A 1SLCA 2DCTA 3VKOA 1LHVA 4P9XA 4P9YA 1AR61 1TME1 1JH5A 1LOBA 2R0HA 4HSLA 1I1EA 5ACA1 5C9AA 1O4TA 1APNA 1HX6A 3MIHA 3MDPA 4XQDA 4PCRA 5EV7A 2GALA 4GH4A 5JLVA 4Y4YA 5AVPA 1JUHA 5I0UA 4CZSA 2YXSA 1RUC2 1FMD1 2PAKA 2IXHA 3MW3A 3KQRA 1DZRA 2GNMA 3HBZA 1KFUL 3ZSKA 2HWF1 2I45A 4GKYA 1LGCA 4XJ9A 3RSJA 1ZRCA 4KU8A 4IV1A 1RL3A 2WT1A 2D6LX 2A6VA 4AFBA 1JHNA 1LENA 2WS91 4RSUA 3SLIA 3VZOA 2WNEA 1Y9QA 5F1RA 1A78A 1J1TA 4RGAA 3VKLA 2QKDA 1RITA 1NCRA 1AR63 3WY6A 1TMF3 4Z82A 5J7MA 1S2BA 4AI8A 2GN3A 3WNXA 4EWAA 4MSVA 3AYEA 1LU2A 2RJLA 3ZYRA 3ZYIB 1BVVA 2VVFA 1YO8A 1CPNA 2JX9A 4M0NA 5FLHA 3OD0A 1TNRA 4XQWA 3H7YA 3RYKA 4Y22B 5FTTC 1G9DA 3AXEA 3JQWA 2WINB 1OOPC 3DGTA 2ZHKA 1MVEA 1PMIA 1DZQA 2HWD1 5JPNB 2XJVA 2VOWA 4HT1T 2K9ZA 1QY4A 4LA2A 4AEMA 2EALA 1S0IA 5JOYA 1NY71 1U0AA 2GMMA 1ND3A 1R083 1AL0G 1DYKA 4E4DX 2VMIA 3LOBA 4EJRA 2Q0AA 3I8TA 1M06G 1AUYA 4CEWA 4FSJA 3B9CA 1AR91 2HWB2 4MV2A 1HXS1 1NCRB 1BZWA 4L9BA 1H9PA 5FMOS 4FOWA 1YFYA 1BEV1 2DWRA 1C8M2 1QMJA 1QQP1 4LHNA 3MGUA 3DPRA 1K5MA 4OUMA 4HKLA 2VG9A 4FP2A 1F31A 2ZGQA 1IQAA 4AFDA 2BFUL 4LO6B 1G9FA 2DCJA 5GALA 1S2KA 1CAWB 1ZBA1 1ENXA 1RUD3 3JQXA 4M3CB 1C5IA 1VALA 3VBUC 3M3IA 1FOD2 2WA3A 1QQP2 2DCYA 1WUVA 2BFUS 4HZFA 3OTFA 3ZYGA 2WL1A 3ZFEB 3ZMOA 2NQYA 1KITA 5T3NA 3ZMNA 1SBFA 2B7YA 3QH6A 3H3UA 3NL1A 1D2SA 2XWBB 4OHYA 5JSPA 4K3UA 1AX2A 2RS51 3MW4A 2P17A 1WD4A 3RI9A 2WZR2 1GNZA 1XE7A 1UX6A 2EVXA 3PHMA 1HLCA 4RA0A 5JSOA 3SXWA 3D5OA 1J1LA 3ZVXA 3GALA 2R043 4I3PA 4ZU4A 2WFPA 3ASIA 2ET7A 2WKKA 2BTVC 1LGNA 4JDNA 4B3NA 2ZMKA 1GZWA 4NWVA 1PZ7A 3UK9A 2XLAA 4L8QA 4FPKA 1TMF2 4K21A 1U5ZA 2R6QA 4RHV2 4DQAA 5KXEA 3ENRA 3FFZA 5E8AA 1X50A 1DQ6A 2CWMA 2RHPA 2W0XA 4P9LA 2AENA 2KA3A 4BLJA 4HVOA 3D82A 4N43B 3WP4A 5DG2A 1WCDJ 1OD5A 2UYBA 1QH6A 1EPZA 1PHMA 4GKXA 1LOAA 3BB6A 2DYCA 4XXPA 4HN1A 2AR6A 3OJBA 4GULA 1PO21 3ZFFB 2WJSA 4MGYE 3NV2A 2QJVA 1B35A 5DZEA 4YVSC 3L2HA 3OD4A 4D3WA 4ISQA 2ZAHA 4M3CF 4CDQA 2ZACA 3HWJA 4R4XA 1SLLA 5CG8A 1PVXA 2D44A 5JOWA 2H0BA 2Z2SB 2ET1A 1JTZX 1IKPA 3VBOC 1SMVA 2BUKA 4BCUA 4IERA 2OYZA 4D69A 2SLIA 2JEMA 3LWCA 1RUF1 2NMOA 2XLGA 1AYM1 1U5YA 3NV3A 3FX3A 1ZZ8A 3WCRA 4MYEA 4P14A 5DZFA 2BEOA 4K1ZA 2XUMA 3CL1A 4N43A 1ND3C 1R091 5FQ0A 1WMDA 1PO23 4DPNA 1NZCA 4Y1VA 1UZZA 1RUI2 1JW6A 3AKPA 5GLTA 2OUJA 4TZDA 3U11A 4N90A 1YFWA 2PHDA 2A5ZA 1RGSA 4AI2A 4XF9A 1CVNA 2QQPA 4INDA 1IS4A 4DNYA 4QQLA 5F5QA 1WW4A 3LGRA 4NHLA 4Q27A 3N7MA 1ZREA 4CTEA 1H0BA 4IEXA 4PBPA 3CEWA 4E2QA 1N3PA 2QFEA 5A33A 3WUDA 1TMF1 5KC5A 2Z79A 2QNKA 3M4FA 1TEIA 3E6CC 1EYBA 3FUOA 2IXCA 2P37A 3A4UA 2ZZJA 3KCYA 3IMNA 1OQ1A 4OVEA 4ORFA 4A7ZA 1RHI1 1QOOA 2FBEA 1RVF1 3THPA 4BHPA 4UXAA 4I0BA 5IK4A 4FTSA 1ZBE2 4QQPA 1RJ7A 3MEPA 4XW3A 4WBBA 5LK7B 4WVWA 4COYA 4U36A 4XJAA 5FOJB 5CG9A 2BVBA 5JIAA 5GZGA 4YM1A 1O4ZA 2EXHA 3IN9A 1ND2A 3VBFB 4BH9A 5CFCA 2IXIA 1R081 2LALA 3PNAA 2WNUB 2DU0A 1W6NA 3ZXFA 1HQLA 4C91A 2ZABA 5IUQA 1DYPA 3VBHC 4Y20A 1RUG1 1AR93 2VU9A 5BNOC 1RMU2 1JXNA 2ENRA 4AQSA 5A33B 4H7LA 3FFQA 5FMOL 1QJY2 1PVC1 5IK5A 3LA3A 4Q1PA 5ABJB 3M3CA 3HR9A 3K51A 4U2AA 3LOIA 4KWKA 3WXPA 3KCXA 2XLFA 2JDZA 4YVWA 3JCIA 1NE4A 1RMU1 5I0TA 2YGLA 2PLV1 5FLIA 4LE3A 4FPLA 4GMP1 3E5XA 4K9SA 1TME3 5BNOB 4CDUB 2DUPA 4N53B 3WW3A 4BIFA 4LE4A 1X36A 4XHBA 2YHJA 4XXAA 1RUG3 2GMEA 4Q4X2 3PVNA 5EXOA 1FMD3 2JG9A 2R16A 1YYNA 2A6ZA 1T6GC 3TAYA 2E51A 1I5ZA 2H6CA 3AKQA 4OHZA 2XPJA 2TNFA 2X8KA 1ZX5A 2XJQA 2WS93 1MACA 2ZMNA 1GNHA 5DXDA 2WFF1 5BNNB 5JAXA 3VKMA 3WG1A 1CAVB 2R49A 4XPVA 2YY1A 3VBOA 4XMAA 2D3RA 1AXYA 3AX4A 1VAKA 1ZM1A 2YC0A 1PGL1 2ZGTA 5GLWA 4XF3A 3UKTA 1RUF2 1OA3A 3O14A 4G3YC 1C3HA 3B3QE 2Z42A 2ILMA 4Q2FA 2XJTA 4XTMA 2VUAA 3AJYA 1TME2 2UWAA 4H14A 2X53S 4HK9A 5F6LB 3AZZA 3NSTA 2JKBA 2OUHA 1VB2A 2KXLA 1B35C 2ZGPA 1XU2A 2UYAA 1OI6A 1H4GA 4Z07A 3MIBA 1H4HA 2RS52 1FMD2 1LESA 3UJQA 4YVSB 1XNBA 1BBT1 1OFNA 3OYWA 3AZYA 3GZTB 1Q5OA 2FZ2A 1PK6B 4GA9A 3ME2A 5C8CB 4XDQA 2WSVA 4Z2WA 1MS1A 3ECQA 3POWA 3JU9A 4YW5A 1RB8G 4YGCA 2MPFA 3AFGA 3USUB 5JWPA 2YMZA 3P3NA 1UU6A 1AR71 1NYWA 2FMYA 4FOVA 5D8AC 1RUH3 2R0FA 1S0FA 3CO2A 3N4MA 1YJLA 1RUF3 1W0OA 1C28A 1KS5A 3B9IA 2OIIA 1UN1A 4RS5A 2D5FA 2HWC2 4AF9A 1H2KA 2FZ1A 4OI4A 5JOZA 1GICA 2LM3A 5A3LA 1DBNA 4YZ3A 4JC1A 4OHWA 2JE9A 1NCQB 2R042 3QH7A 3MLJA 3IDEA 4YZ2A 1O3QA 1V6MA 1CJDA 1N1SA 1POV1 3RS6A 3T2TA 4FPHA 1PK6A 3KT1A 5D8AB 3JB8A 1KJRA 3ETQA 3H8UA 1SBDA 5FCCA 2GU9A 4RS5C 1CAUA 3JD72 3KCCA 4FXGB 3NJZA 4XFHA 5DUUA 1HXS2 2OZJA 3GF6A 4Q4Y1 4AVTA 2WS92 2CWSA 3ES4A 3AFKA 5HBAA 2YZ4A 2JENA 4QMAA 2CTVA 2RE9A 1FNYA 1RVF3 5T54A 1LCLA 1POV0 4FO9A 1POV3 2XBO2 4FPEA 1BJQA 4IV3C 2ARBA 1MS8A 5L73A 3VBHA 1VBD3 3ZSEA 2GNBA 4S2HA 2BNNA 1UU4A 3DPRB 3AZVA 4L99A 1CPMA 3SCGA 2ZX2A 3IPVB 5GZEA 4LR4A 5FLJA 4S2FA 3L9JT 3B00A 3CJXA 4FAGA 2KM2A 1CX4A 2Y0OA 3FLTA 5ACA3 3I59A 4GB32 2R30A 4KNCA 1CAWA 4MGKE 4COWA 1PGW1 4NO4A 2CAUA 4YNIA 4DRRA 2BYVE 2HWF2 4WZCA 4AVSA 5D1IA 3QCWA 1SCRA 3EJKA 3WDYA 1AR72 1K5MC 3VBRB 2GH2A 2DU1A 5FAXA 3RWNA 1GQGA 3FC0A 3U10A 5J37A 1ZYBA 3R4UA 2OPKA 3HN1A 4JGZB 4X6RB 1XYOA 2R1DA 5C4WC 3I4IA 5F9TA 2B46X 4D7TA 2VULA 2NP0A 2TUNA 4H3WA 1DQ4A 4XYXA 4OHXA 4CP2A 4HLTA 1AYM3 3RZZA 2ZGSA 3AMHA 3IBMA 1COV3 1N3QA 2VOXA 1QU0A 2WT0A 2JG8C 2PN5A 4RL7A 2VXRA 4DFSA 4CEYB 2P3IA 1R093 3I2DA 5T5LA 4XJUA 1VJ2A 4EWEA 1CD3G 2RMU1 3NAPB 4LTAA 1F8VA 1I3HA 4TWTA 4XFAA 1OSGA 2A3WA 1WGPA 3APBA 3ILRA 5I0SA 5FO7B 3ZYJB 1Y7BA 4CDQC 2WFF3 5GZDA 1ENRA 1V6KA 1RJ8A 4CP0A 1OA4A 3LA7A 3WQ0A 1REFA 3D0JA 1YRZA 4HPKA 4NHMA 3ZYPA 5LEKA 1FYUA 3B94A 2X29A 4WM8B 3V64A 4DY3A 3U4XA 3EXUA 1HXS3 1R1ZA 1ULDA 3ZSLA 2G4IA 1CESA 3WW2A 2WWSA 4QQOA 3JD71 1EAH2 1B35B 1QQP3 2RMU3 4XFIA 2E6VA 3ILFA 3AB0A 1W6OB 1J58A 3RQ0A 5C9AC 4CDQB 3Q9OA 4LBQD 4IQPA 3SHRA 1PZ8A 2PAMA 4Q4X1 4AHZA 1NG0A 4IESA 3H1YA 1PK6C 1RUD1 1FI2A 1UKRA 2A6YA 4P5HA 4QPIB 2O1QA 4AQ2A 1LB2A 3MI8A 1BMV1 3R4SA 4EN7B 3MPBA 2HWD2 3HD8B 4MXWA 1ZRRA 3IM0A 1QDCA 1FPN1 1W0PA 3EQEA 4J1XA 2CYFA 3O0WA 4LHKA 3S7IA 3FHIB 1YWKA 1CN1A 2E7AA 4I01A 2B45X 2GN7A 2ZGUA 4Y1YA 1O5LA 3RNSA 3M3QA 2RM21 1AR73 1QJU2 5FPXA 2Z69A 3NKGA 4AVAA 2EXIA 4JGYC 1FPN2 2ZTNA 1NA1A 5KC6A 1WLCA 3AK0A 3WX5A 3WW4A 5DG1A 2HEVF 2QDNA 1V6OA 2F4PA 2WNVC 1VBA2 1IOAA 1J3PA 1W6OA 4J6GA 3N7LA 4V1PA 1NCQC 4M3CE 1PZ9A 4LUKA 3M1HA 3LA2A 2YROA 3PTYA 2XL9A 4WM7C 5L19A 3FE5A 2DVFA 1QNYA 4PLMA 2JE7A 1AYM2 1GZCA 4Y24A 4FBFA 3ZFGC 1H9WA 2PHTA 5KXCA 4Q1RA 1KRIA 3PVEA 2CY6A 3UKVA 2VUJA 1H1IA 1IS6A 2EAKA 2GAUA 1O4YA 2E53A 4FVVA 4G9SB 4I0WB 2BNMA 3O0XA 4JCKA 4Y22A 2GNTA 2RS31 3KM5A<