3HT2A

Zink containing polyketide cyclase remf from streptomyces resistomycificus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
143
structure length
143
Chain Sequence
SMMKRVHRTDVKAEIVREPGAKETTHRKLIDTPDGADRFVLTEFEVSPNGSTPPHFHEWEHEIYVLEGSMGLVLPDQGRTEEVGPGEAIFIPRGEPHGFVTGPGQTCRFLVVAPCERPPVRNVFLSEDPYEYTQMPEYTSLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The polyketide cyclase RemF from Streptomyces resistomycificus contains an unusual octahedral zinc binding site
pubmed doi rcsb
source organism Streptomyces resistomycificus
molecule tags Lyase
molecule keywords RemF protein
total genus 29
structure length 143
sequence length 143
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ht2A00
1O3TA 2GC0A 2QVSB 2IXKA 1I6XA 3WW4A 3UKNA 1XE8A 1UIJA 3LWCA 2FQPA 2HKXA 2N7GA 3MZHA 2OZJA 4AVCA 3H9AA 2H6BA 3E6BA 4MV2A 2PA7A 3ACLA 3ST7A 5FPXA 4KL1A 4FT8A 1J3QA 1DGRA 2UY8A 1J1LA 4DINB 3N4MA 3GBFA 4MUVA 5CVRA 3HT2A 3NL1A 4F8AA 4HSLA 3LZZA 1UPIA 4QGNA 4ZU7A 3ETQA 4IEXA 1EP0A 1OD5A 2P17A 3NW4A 5C6CA 5JSOA 2CV6A 4L11A 3SCGA 3E5UA 2H6CA 2Q0AA 4KWJA 1LR5A 4XEZA 2PAMA 1WGPA 4MGKE 2GAUA 1YHFA 4LUKA 1H1IA 3BU7A 2VECA 2IXCA 4AQ6A 4YYOA 4QXKA 3HIFA 5KHKA 2D93A 2B5HA 4ONUA 1Q43A 3E97A 1SFNA 4X6QB 1ZZ7A 3KSCA 1L3JA 4YNIA 2BNMA 2QJVA 3U11A 3SXWA 4QMAA 4BHPA 4YARA 3B02A 3QOPA 4CYDA 3EJKA 1EYBA 5KHGA 1QXJA 5KHJA 2PQQA 3UKTA 4LTAA 3NKTA 1NYWA 1CAVB 2ZKLA 5I8YA 4I01A 5J48A 3H3ZA 5I0RA 4D7TA 3U0ZA 4HBNA 4UBGA 1X8EA 3JZVA 4BIFA 2QNKA 2Q30A 1SQ4A 1DGWA 2EVXA 1J59A 4GULA 3E6DA 3WW2A 1LB2A 1FXZA 4META 3VHRA 1ZZ9A 2EAAA 3CO2A 4HMZA 2K0GA 2MPFA 3EBRA 4Z82A 2F4PA 1RUOA 4XF0A 3U10A 4PIYA 4N9IA 4F7ZA 5J3UA 5I0TA 1QWRA 4IEVA 4NVPA 5EFUA 4HVQA 4JV4A 4LUMA 1X7NA 3LA3A 3E5XA 2MNGA 2GC1A 2QDRA 4FAHA 5BY5A 1ZZCA 1CAVA 5FPZA 2CGPA 4XFCA 4XFGA 4E2SA 3PVBB 5EZWA 3DN7A 3ES4A 1YWKA 1XE7A 3NVCA 4H7LA 4MGIE 3IWZA 2Q1ZB 2PAEA 4IERA 3TNPB 2PTMA 3FHIB 4QM8A 3USSA 4WBBA 5FLHA 1CAUB 4IEZA 2CAVA 1ZX5A 4MZUA 1YFUA 4IEQA 1JUHA 2UYAA 2I45A 1CX4A 1XRUA 5HI0A 4X6RB 3O14A 1UCXA 1Y3TA 3ES1A 3LAGA 1TQ5A 5BPXA 3BCWA 2MHFA 1DZRA 3BALA 3SCFA 4LEJA 3ROUA 1GQGA 2UY9A 1J3RA 1ZZ6A 3MPBA 5JSRA 4MX3A 3H1YA 3PLQA 1NE4A 4R52A 2UYBA 2GU9A 1U12A 3IDBB 5KHHA 2D5FA 2O1QA 5KBFA 1O4TA 4JTNA 3FJSA 1ZZBA 3RYPA 1CAWA 3OGJA 4XF3A 2VPVA 4O9EA 3OF1A 2IXLA 2GH2A 4EROA 3SMHA 1ZVFA 1VR3A 3H1WA 1NE6A 2ETEA 3PNAA 4I09A 4HN1A 5BXXA 4P9GA 2XLGA 3RDIA 4HVRA 4J1XA 2Q4SA 3I54A 1RC6A 1Y9QA 1DZTA 5FQ0A 1PMIA 4XFAA 1YLLA 4EWAA 1I5ZA 2B9UA 5FDBA 2XKPA 3CLPA 1OFNA 5AVPA 4LA2A 3H50A 4MGYE 1SEFA 4I02A 3IIAA 2PHDA 2E9QA 2BEOA 5CADA 3OD0A 1O7FA 3NJZA 4UXAA 4TLFA 2DCTA 2XKOA 4E2GA 1IPKA 1UIKA 2IXJA 3SCHA 3LA2A 3R6SA 4LA3A 3NSTA 5JR7B 4XF9A 5J7MA 4IEPA 4AVBA 3RYRA 3H1MA 5FQ0B 1PM7A 2C0ZA 1EY2A 3FWEA 3CF6E 4PIXA 4WZCA 5D1IA 3I59B 1YFWA 3FX3A 2KXLA 4ZU5A 4KWLA 3MDPA 2GZWA 5C8WA 1YUDA 3BPZA 1V70A 5CU1A 2GC3A 3RNSA 4A2UA 5JCTA 2GC2A 4HVOA 2WFPA 3G7DA 2OA2A 4QGMA 4EWDA 1IPJA 4I2OA 2H0VA 3KGZA 5FLIA 3QACA 3FZ3A 1O3RA 1LKNA 3LOIA 1HW5A 5BUVA 4J1WA 4XETA 1CAUA 2FMYA 2O8QA 2ET1A 4I0AA 4OLLA 4KWKA 5F1RA 4IEOA 4XFFA 3ELNA 4XF4A 2PFWA 3H3UA 5KHIA 4JTOA 4XFBA 1LRHA 1QY4A 1NXMA 2XLAA 4FAGA 1EPZA 4IEWA 1O3SA 5BV6A 4PJYA 2B8MA 3WW1A 1ZRCA 3E6CC 4KU7A 4XFHA 1VJ2A 1ZRFA 1O5UA 3M70A 4LLOA 4YRDA 4D7SA 1CAWB 2D5HA 4MGZE 2BYVE 3TNQA 1NZCA 4IEYA 1WLTA 4PIZA 4XFIA 2BGCA 2Z69A 4ZU4A 1O3QA 2XHKA 5FCCA 2IC1A 4JVAA 4WVZA 4BYYA 5JAXA 2XLFA 4EV0A 3KCCA 4K8FA 1X8MA 3DL3A 2VQAA 5FLJA 3IBMA 4IESA 5I0UA 4Q0PA 1ZRRA 5LRRA 2XL9A 4HLTA 1ZZ8A 4Q0VA 4FBFA 3I7DA 1X82A 4UBHA 3GYDA 3DKWA 4AVAA 3D0SA 1CGPA 4ORFA 1H1MA 4B29A 1J3PA 2CAUA 1RL3A 1UD1A 5I0SA 4XF1A 2V09A 3UKVA 2OYZA 4YSFA 3KGLA 5LEKA 4I0BA 3RPQA 3LA7A 3EQEA 1YFYA 5I8TA 5E1RA 3H8UA 1RUNA 1WA4A 3S7IA 4AQ2A 3D82A 4LULA 4I3PA 1CAXA 2HJIA 2IXHA 3CEWA 4HZFA 1YFXA 3E5QA 5I8SA 3H7YA 3S0MA 4IETA 2QCSB 3HQXA 3ZDSA 4HSJA 2PAKA 3OTFA 4QM9A 3SHRA 3I59A 2EA7A 2IXIA 1QXRA 1Q5OA 3RZZA 4QGLA 2Z2SB 4QX5A 3C3VA 3EHKA 2BNNA 4Q0SA 1FT9A 4BH9A 3H7JA 1RGSA 4IEUA 5LRSA 2XL7A 4Z07A 3KMHA 3DV8A 1ZNPA 1VP6A 5E16A 1CAXB 3EO6A 5JSPA 4Q0QA 2PHLA 3OCPA 3RYKA 4Q29A 5LEJA 1O5LA 4OFGA 4HN0A 2ATFA 4RD7A 4R8HA 2PYTA 2K9ZA 4Q0UA 3L2HA 3FFQA 1ZREA 3BB6A 1UW8A 3M3IA 4EWEA 5I91A 3IDCB 3HT1A 1Q3EA 2D40A 3WW3A 2Y0OA 4KU8A 2ZCWA 3FE5A 4MH0E 1RTVA 2WC2A 2OZ6A 4AXOA 1G6NA 1FI2A 3S7EA 3D0JA 1ZRDA 2XGXA 1GQHA 3MYXA 3CL1A 4N9HA 1OMIA 5T3NA 1OI6A 3CJXA 4E2QA 5K8SA 2BNOA 2OPKA 4O9GA 1J58A 4L2NA 5I93A 2ET7A
chains in the Genus database with same CATH superfamily
4UFJA 4UW5A 2VNOA 5FZ7A 4DIQA 1AHSA 1O3TA 4QQOA 5D8AC 3T4HB 1J83A 3B5LB 4XJ9A 3WW4A 3CNAA 2WA4A 3FLPA 1UIJA 2E32A 2Y6FA 4MGSA 4I2OA 1US2A 2HYKA 2K2SA 4YVWA 4A44A 5F37A 3A22A 4OI4A 1B09A 2JXAA 3ILFA 2HKXA 1D2SA 3R4SA 5E88A 1KDMA 1PVC3 4K1YA 4QHBA 1XNDA 2PLV2 3C8XA 2DVDA 3E6BA 4OUSA 5AFEA 3ZYJB 3MPPG 4BJ0A 2JDPA 4COZA 4QHOA 2AC1A 5C8CB 3ACLA 1YI7A 4H55A 1MS1A 4FT8A 2A7AA 2JDNA 4O61A 4A6SA 3GBFA 4HFSA 3VBRC 1ENSA 3GDBA 3UETA 5HV4A 1KS4A 1OUSA 1R1A3 2WT2A 5A7QA 3HT2A 1O4YA 1ULEA 1FOD3 2RM22 4EZ4A 3POGA 2GP5A 4KBBA 1XSQA 1OF4A 2W9XA 3AYEA 1DDLA 1S2BA 2A6WA 2CYFA 1FNZA 1OD5A 2P17A 2D6OX 2XB6C 2OX0A 4LIVA 5FJKA 3ZXEA 4ZKTB 2ZX2A 4JRLA 1LEDA 1AZDA 3SITA 3VBUC 2IVIB 4LO7A 4YG0A 1NZIA 4EE2A 4GALA 2PMWB 1QDCA 4DY5A 2B7YA 2WS91 1GP6A 4XEZA 5FY0A 2FBEA 4CTEA 2ZGLA 4MGKE 5IFTA 4WV8A 1YHFA 4LUKA 2D3PA 1GNZA 3OUHA 4BQWA 5KXCA 2C24A 2VC9A 4LK7A 1W2NA 4AQ6A 1S0BA 1W3XA 3M7AA 2ARXA 2YPJA 4UW3A 2GNBA 5GLUA 1L3JA 4IE4A 1VIWB 1W03A 2OVUA 2PHFA 2R32A 4TWTA 2WFF3 2QJVA 3NV3A 4JKLA 4EN8B 1R1A1 2ZGUA 3LEIA 1E57A 1RJ8A 4P9LA 1WW7A 2ORXA 4IDZA 5A7PA 2SLIA 4XXPA 3N7LA 3WDUA 2ZPXA 3IDEA 4QPWA 3RZGA 1QJU1 1QJX3 1QXJA 2O8OA 4LNVA 4Y3OA 2VZPA 3ZYPA 3L2YA 3NKGA 3UKTA 5LA1A 1Q56A 1Y9GA 4I01A 4PLOA 5CAZA 1AVBA 3M3OA 5J48A 3NNLA 2HWF1 3PJYA 4DQAA 2WAOA 4XJUA 5GJ6A 3U0ZA 4HBNA 4HK9A 4UBGA 2Y6JA 4QX2A 4AHXA 1SQ4A 2TBVA 3OGRA 5C33A 4AVVA 4HETA 5DXDA 1SZBA 1FXZA 1ULDA 1SDDB 1AX1A 2Z42A 2EAAA 1FX5A 1SFYA 2K0GA 1UOJA 3EBRA 4WVMB 1N1YA 1JTZX 1RVF3 5LK5A 1HKDA 4TLGA 2CWMA 3J8F1 4FOWA 3V56A 3A7QA 4PIYA 5J09A 3P5BA 2VCMA 4F7ZA 5L7OB 1PZ7A 3KHCA 3VKLA 4AK3A 1QNWA 3RRDA 3WQ1A 4HVQA 2BBVA 3HEIA 2TUNA 3HQRA 5DAQA 3ZR5A 4LUMA 5FUIA 1X7NA 5J37A 3FBYA 1ULPA 1W90A 3JQWA 4XZUG 2UURA 2XMLA 3N9NA 2MNGA 1ZZCA 1CZSA 3AJYA 2WSVA 5FY7A 4AW7A 4GH4B 1C5HA 2VVDA 1JYCA 1SACA 4XFGA 4E2SA 5IVVA 1NCRA 1JMUB 2XXZA 4Q5OA 5FXZA 3SEPA 4NN0A 4AE2A 1UX6A 1YWKA 3NVCA 4MGIE 1R64A 4LR4A 3MLLA 5LWBA 2P4EA 3K75B 2DCJA 1A78A 3LPFA 4JKMA 1H0BA 2F17A 3OBZA 4QM8A 3KT7A 2VOWA 4U36A 3O7OA 4IEZA 5EJ1B 1SBFA 2ZEXA 5AC92 2PHTA 4MZUA 1HQLA 3SEEA 2I45A 1EV13 4OHYA 3HD8B 1Y3TA 5HCBA 2XVLA 3JU9A 4AEDC 3LSDA 5EIYB 4A42A 1JZ4A 1Y7BA 3T1LA 3AL5A 4NAOA 1DZRA 5J98B 2DCKA 3BALA 2UWBA 2VVEA 4AI1A 4OYUA 4YW1A 1GQGA 3VKOA 3Q8CA 1J3RA 2IFWA 4JDMA 3M1HA 5JSRA 2RS52 2PLV1 5FP8A 3ZKYA 3BODA 4AGRA 1HRV3 1H6XA 2WIIB 5DDJ2 2VJXA 4Q4X3 5KC6A 3AXDA 1RVF2 2XJRA 1GWKA 2V5DA 3HMYA 3GALA 2GU9A 5D2AA 4RR3C 2WO3A 2O1QA 5CYYA 2ZGSA 4IE0A 2ZAAA 4XJ8A 4RR3A 4PLMA 5IATA 3FJSA 3NJVA 5FMCA 1UF2C 1RUD3 4HKLA 4XF3A 3UGHA 1GANA 2WBKA 1C8NA 2R1DA 3KQ4B 4CEYB 4MO3M 4XUQA 1CQ9A 2WLQA 3WHUA 2OT7A 1JHNA 2GH2A 3SMHA 2RMU1 3BIWE 3BTXA 1B35A 2VUDA 1ZBE3 4P9WA 3LDKA 4Y22B 1IS6A 3MF9A 3NJXA 4RHV2 4Q4V3 4I09A 4YGEA 5IYYA 2FMDA 4HN1A 1H8TC 1H8TB 1VBC1 2WNVC 2WNVB 1V9U1 1SLAA 2NZ9A 3NNJA 3OBRA 3PIJA 1VBE2 5LA2A 3I2HA 3RDIA 1SCSA 1SLIA 3A4UA 1VBD3 4TZDA 1SMVA 3VKFC 4BXFA 1HV0A 2ID4A 4JHZA 4BQ1A 3U07A 4HK8A 1UPSA 1BEV1 2Z5WA 1G86A 3LIHA 4FPFA 4G9SB 5DAWA 4F83A 2ZACA 2HWE3 3Q8FA 1V9U3 3PTYA 4PBOA 5C5TA 3WNXA 2XBO3 5JMCA 1RMU1 4ES9A 4EN7B 4CVUA 2O14A 2XR4A 3GZAA 3NAPA 3USUA 2ENRA 1C8M3 2JD9A 5FZ9A 2XG3A 1SEFA 1UZ0A 1UY1A 1A34A 4FTSA 1V6MA 4HANA 3OD0A 1FMD3 1DHKB 2WWJA 3FHQA 1MR5A 2AZ5A 3MIEA 1RYYA 4TLFA 2BVVA 4URTA 4XJWA 1UIKA 5FZOB 3WF1A 3ZYIB 2P3YA 2VG9A 4NOTA 2VTXA 5A3TA 1ZM1A 2GMEA 3LA2A 3TOJA 3DYMA 1RUH2 4LA3A 5A7WA 1U5ZA 4EJRA 4YM0A 1G9DA 5F5QA 4Q26A 1A8DA 1BBT3 3IT8A 5J7MA 4KG8A 3WG2A 3CZJA 3GNEA 1YJLA 2W1SA 1M4WA 1L7LA 2R042 4YFZA 1AR61 1KFXL 1ND2C 1EY2A 5JXHA 3I2FA 3ZO0B 1PK6B 2YU1A 3FWEA 5FY9A 4PIXA 4WZCA 1HX6A 1GP4A 3I59B 4YVSC 1YFWA 1XNTA 3VHOA 3JB4C 4CEWA 5FJHA 2KXLA 3T0BA 3MDPA 4XE9A 2WDBA 4AFMA 3VD9A 1QH7A 4RS5A 4B7EA 2DF7A 1D7PM 3ZN5A 1S0EA 2AR6A 2WWUA 5FYSA 3VBSB 2EXHA 3O12A 3RNSA 1RUJ2 3VZMA 5JCTA 2A3YA 3EB7A 3KHBA 5F2SA 3VBHC 4AG4A 1QOSA 2WFPA 2HWE2 2F4LA 5A70A 3O0WA 3RMXA 1IPJA 5A7WB 3VUOA 2D7FA 4W65A 1OQDA 1O8SA 2YGMA 3GBWA 4XDOA 4YVWC 5AVAA 3ALQA 3VDCA 4N7UA 5FLIA 4AZZA 3FZ3A 3WDXA 5CA6A 1EPWA 2JJ6A 4MYEA 1PK6C 1BZWA 2ARCA 4XXAA 4AEDA 1HW5A 4AL9A 1R1ZA 1PK6A 2XUMA 4J1WA 4AFCA 1Z0HA 2YYOA 2O8QA 2ET1A 2X09A 1URXA 4I0AA 1PGL2 4CDQB 3IM0A 2DFCA 1EAH2 4G4FA 1QXPA 3LQCA 4B4RA 4QKDA 4ARYA 1IG3A 1OPMA 5LASA 1JYTA 4Y4YA 2R7EB 4OZOA 1TEIA 3TBDA 2C5DA 4GKYA 1F4HA 5A7OA 3TEXA 1OOPB 1BK1A 1LHOA 4IQPA 3FL7A 3FFZA 1V6LA 4FAGA 4IEWA 3FLTA 5BV6A 3KF5A 1Z78A 5FY4A 1GU3A 3J7LA 4RGGA 2CU5A 4KWUA 3THTA 3WW1A 2VQUA 5J96B 3AMMA 1ZRCA 2ZOEB 2QZ2A 2Y34A 3HN3A 2OPWA 1JODA 3A0NA 4K1ZA 5A7NA 5EJZB 3I3DA 4PQ9A 3AK0A 1W8WA 2R041 1UKRA 1N3PA 2A5ZA 1GOGA 4YRDA 1IS5A 2RM21 2WSUA 3RMYA 5IVBA 3AYAA 4AI2A 1GNHA 1VMFA 1UYXA 4IEYA 1MS4A 4MGZE 5H9QA 3T09A 4PI0A 3ZYGA 5FIXA 3AJZA 3HPNA 1W6MB 2RVAA 4PIZA 1AR83 1DQ0A 2BBAA 2BGCA 2Z69A 3ETPA 3GF6A 1W2OA 2AREA 4IE7A 5FCCA 3NRUA 4JVAA 3MIHA 4IV1C 1LEMA 2HWB1 4GMP0 3ZX7A 1UAIA 5JOWA 4BU2A 4QX7A 2BERA 3FLRA 5FP4A 1BCXA 1JYXA 3M2MA 4IESA 5F6LB 2DVBA 3POJA 3ZM8A 4AFBA 1MS5A 1LAJA 1TNRA 3ILNA 4L97A 2IVJA 3JD73 2V73A 2FDHA 1ZRRA 2DUQA 1CZVA 4XIKA 1OURA 4N53A 5LRRA 3WX5A 3RSJA 1LGCA 2YBSA 5A3MA 1JZ2A 1RMU3 4Y1XA 4B3NA 1X82A 2FCVA 4UBHA 3I2OA 3VBSC 1ZRIA 3CJIB 3GYDA 4CDWC 3D0SA 4FPOB 4E8CA 3ZSKA 2Q8OA 1BLZA 2CAUA 1RUG2 3N7MA 3VD3A 1UD1A 1RUH1 4QPIB 4WM7C 1ENXA 5I0SA 1TMF2 1WCUA 3J7HA 2DVGA 3L9JT 2MEV1 4XF1A 1KXGA 1V6OA 2VE1A 4K20A 5FZFA 4QB2A 3BUCA 3ZSEA 1EV11 2OYZA 1XNAA 1POQA 4XMAA 1GZTA 5A3OA 4KI5M 1W05A 3LA7A 1SLLA 1YFYA 3V0BB 1DF0A 1QIQA 1NAEA 2Y33A 5K0UC 3O1PA 4QQLA 5FYIA 2D97A 2YFZA 2A73B 4N43B 3WDWA 1RUNA 2JDKA 5FZGA 3WP6A 2OQ7A 1CAXA 1PIV1 2HJIA 4I3PA 1RJ7A 3PMSA 1PNFA 5FY5A 1TE1B 4OMDA 4C0HA 4HPKA 2X5IC 4QPGC 3J4UH 4H2AA 4ASLA 5A32B 2HEVF 2W91A 3NJYA 2GN3A 3D5OA 4N53B 3ZDSA 3LCPA 5FYHA 2OW4A 3ZFEC 1W8OA 2JX9A 4JQTA 3N7KA 2PAKA 1H6YA 4YW3A 2WFF1 4DUWA 4YZ1A 4BLJA 1YQCA 1OA2A 3AMPA 1H9PA 4IE5A 4UF0A 3UJQA 4NPMA 1VB4A 2OQ6A 1AYN3 3RZZA 3MGUA 1W8ZA 1E5IA 4XUNA 3WF4A 2ZKNA 3GHNA 2BNNA 1W6OB 1W9TA 3THPA 1FT9A 2ZEZA 4EN9B 1ASJ3 3PVOA 4R4XA 2ZGMA 1HB4A 3V0BA 4Y5TA 2DWRA 1MZEA 3H7JA 3JD72 5EWSA 1VLNA 3OSDA 1J84A 2HWD1 3UYJA 2XL7A 5JMOA 3KMHA 1ZNPA 2VTFA 2YBKA 2WKKA 5LY2A 4C90A 5E16A 4IV3C 1JYNA 3EO6A 4Q0QA 4JZRA 1WMEA 3ZXKA 2WZR1 2WO2A 5DMYA 1IPSA 5CIRA 3LE0A 3PHMA 4NHYA 4JDNA 3QD6A 1KD7A 1RUI3 4CZSA 1TMF3 1O5LA 3ZFEA 2Y8KA 1YQ2A 2I74A 3I2KA 4RHV3 2W2IA 3U4XA 2GNDA 2ATFA 5FAXA 5FZ3A 2P1BA 4R8HA 2PYTA 2W46A 3VHNA 1BHGA 1TME1 4Q0UA 5IUQA 1SFPA 3L2HA 3U75A 4LBOA 4TYSA 1W28A 1IZ3A 4G3YC 5HXVA 4CCMA 3LSEA 4OHWA 4JHTA 4FPCA 5CFCA 1X9TA 4D6SA 5JIUA 1GFF2 3MIGA 1NCRC 1WA6X 1GMMA 1P8JA 3BN6A 3AP7A 2AH2A 1F15A 1X9PA 1JZ5A 1QMJA 2WWSA 4PF1A 1PIV2 2WN2A 1CIYA 5IVEA 2WC2A 4P08A 1LHVA 4D7YA 4CUCA 3I2DA 1U0AA 2VZUA 4K6BA 1YRZA 4LORA 4DEVA 3K46A 5FZIA 3S7EA 4RA0A 5BNPB 1GQHA 4BIOA 5C8CC 2EICA 5T3NA 2RS31 1OI6A 2VZQA 4FFGA 3ZFEB 3D8CA 4O9GA 3VZJA 1Z7S3 1VBA2 5FZ0A 5I93A 4ET7A 1D0HA 2E7AA 3LFIA 1K5MC 2I07B 2WLPA 3A21A 2GDFA 5L73A 5KXBA 5A6XA 3MIBA 1I6XA 2DU0A 3KVBA 3UKNA 3ZFFB 5AFBA 3DYOA 1FMD1 3I3QA 3Q9OA 4NPRA 1W6PB 2E6VA 4YG3A 5FTTC 4Z1VA 5C9AB 5IW0A 1GR3A 1W39A 1JOBA 4YFWA 1AR93 1PHMA 2N7GA 3IDAA 3MZHA 1W9FA 4QT6A 4AI8A 4AVCA 1JN2P 1NQJA 3VZKA 1UMIA 1W0OA 4FFIA 4MV2A 2PA7A 4QX0A 3VD4A 5D21A 5FZ1A 1WMFA 4V2VA 2D98A 3MV11 4YM2A 5BNOA 4AGVA 2UY8A 1JI6A 1T2XA 3SNMA 4DINB 5F3EA 2WRAA 1CD3G 1RUJ3 3HJRA 1SBDA 4JGYC 1RUG1 1AL22 3IMMA 4F8AA 5J36A 4HSLA 1T6GC 3LZZA 1OOPC 1RUI1 2CY6A 4MGQA 4UFHA 2YY1A 5FYBA 4IUGA 4F3JA 3VBOB 1LOBA 1DLLA 4LBKA 3OOXA 2CV6A 2RS51 3TEYA 1GLHA 4W6WA 2NP0A 2HEYF 4PDWC 5C9AA 4NJ4A 1ACCA 1LR5A 1XB9A 4Q4Y1 2EIEA 1BVVA 2WQ4A 4BXSV 5LK7B 3MW2A 1WGPA 2VZ3A 3WP4A 3ZN6B 4COVA 2G9GA 3B69A 1Z7S2 2GAUA 2LROA 4R9DA 1AUYA 1H1IA 4OZXA 3IAPA 2ZGKA 1FPN1 1NA1B 5FZ6A 5FZCA 4AOCA 2VXJA 1DIWA 2NQYA 4QXKA 5L19A 1SLCA 2B5HA 1Q43A 2VGDA 3P3PA 4ONUA 4UFLA 3E97A 1RHI1 1ZZ7A 3AKRA 3RGBA 4K40A 2EXJA 1UXZA 3P6BA 2OKXA 2VUCA 1VBC2 3U11A 1UU5A 3AKQA 4QMAA 1MQTC 2DCYA 3QOPA 4LKEA 4CYDA 1MEC3 1H4GA 5FZKA 3VBOA 3ECQA 5KHJA 4E4ZA 2QE3A 3VDAA 3WT3A 3O1VA 1JZ7A 3QBQA 1Q8PA 2PHWA 1F35A 2VUAA 4ZXEA 1NYWA 1TZOA 5BNNB 2ZAHA 3O5SA 2WZR3 5I8YA 4CP9A 2B4KA 2OUJA 5I0RA 1WWYA 4MADA 1LNSA 1W8FA 2EIDA 2HWE1 3VDDA 3ZSJA 4N7IA 2O0OA 4PDWB 4XBLA 3I49A 3TB0A 2W1WA 1J59A 5LBEA 1ND2A 1WD4A 4YZ4A 3WW2A 1ZZ9A 2LRPA 4HMZA 5F6KA 4LBQB 1WMXA 1RITA 2F4PA 4PF5A 2XH6A 3SKVA 3N9MA 4FFHA 4XF0A 5L36A 1N3QA 4YGDA 1COV3 4N9IA 4ARXA 1G9FA 3J7NA 4JCKA 1QH6A 5K0UB 1QWRA 3DF0A 3LEMA 1IQDC 4IEVA 2YXSA 3ZMNA 3SISA 1DQ4A 3LB9A 2D6MA 4AHZA 5HBAA 4JQRA 2YZ4A 5K4LA 2ADDA 1YI9A 2P3IA 3LA3A 4FQZA 1BYHA 1GQPA 2UWCA 4FAHA 3R4DB 5BY5A 1CX1A 5GZDA 1CAVA 4CDXB 2CGPA 1RUG3 4XFCA 1C4RA 1OF3A 1YNAA 3U37A 4FPYA 1JYIA 3KQRA 1HJFA 1UZZA 5LA0A 3KV9A 5EZWA 2E7TA 3DN7A 3I2IA 4OHXA 1XE7A 2WR9A 4Q4X1 1DQ1A 4HXCA 3ZFGB 1VBC3 3B7MA 4A6OA 3HNMA 2Q1ZB 2PAEA 4IERA 5H9PA 2WYFA 2DTWA 3GZEA 3USSA 5IHRA 4ISQA 5FLHA 2HWC1 1CAUB 4AAXA 3KV4A 2CAVA 3R0RA 3WXPA 4YZ5A 1ZX5A 3KD4A 4ITCA 4AFAA 3V0AA 1IKPA 4D94A 3K4AA 2PHRA 4AQTA 1YFUA 1QJY2 4IEQA 1JUHA 2UYAA 5M0TA 1QJEA 1XRUA 4DMIA 1DFQA 4FPHA 5F32A 3AP5A 1DZQA 2VTXJ 3O14A 3WQBA 4AHWA 2X29A 1W6QA 5CBLA 2HBTA 2VW1A 4AEMA 5FPVA 4GJYA 1HB2A 2R073 1HB3A 1T6BX 2ZMNA 1W8HA 3ZN4A 5LY1A 2ARAA 4FQ4A 1C1LA 2XVKA 2BDRA 4OVEA 4BB3A 2NPIA 1DGLA 1AYN2 4LLFA 4I0WB 4LT5A 4N8MA 4HKOA 5JOZA 5KHHA 4CE8A 4P14A 4C1WA 2YUEA 1COV2 4D69A 1ALYA 2VR4A 4L99A 3RYPA 3THCA 4NIDA 3OGJA 4CA9A 2WABA 5A3LA 5E89A 2E26A 4AF9A 4A3XA 1HRV1 5KXDA 3OGSA 2RS53 1ODNA 5CEHA 1MZ6A 5FZ8A 2R061 3LD8A 4AYUA 1JU4A 3KVAA 1NE6A 2ETEA 4ASMB 1N47A 5FOBB 4P9GA 2QQKA 2XLGA 5FYTA 3UJOA 1XJAA 4GWIA 4MOAA 4B1MA 1PO13 5FPBA 1D2QA 3AL6A 4XDPA 2YV8A 2Q4SA 5JDBA 2R071 1RC6A 1QOTA 3HBKA 1QF3A 4PI2A 5BYNA 3LKJA 4FI9A 3OBTA 4YPJA 3OUIA 1IS4A 5FQ0A 3MUY1 2VMCA 1YLLA 1SHWB 2DURA 4N90A 1WUVA 1I5ZA 4W6XA 2B9UA 5FDBA 5A3PA 1DQ2A 3AZZA 1A6CA 4UI9L 2JIGA 4X8PA 5AVPA 2IWGB 2W95A 2BUKA 3RZKA 3H50A 2PELA 3IIAA 2W52A 1LJ7A 2E9QA 2BEOA 2VBBA 5IVYA 2R1BA 4Q27A 3RS6A 2HWD2 1JYWA 1O7FA 5K7PA 5EP9A 4LBQD 2VM9A 4FTBA 1UO9A 4E2GA 2DDUA 2B45X 5FY8A 1CIWA 2GALA 4OHZA 1CN1A 4UW6A 3UESA 3SCHA 5J1XA 4Q8KA 5JOXA 5CFCC 5GZGA 3JUUA 4L92A 4E9KA 1VBB1 4LHNA 1LOFC 4XURA 1NG0A 5JR7B 1ZYBA 5DAPA 2W68A 4HPKB 3WNLA 5BNQA 4QQHA 1JOPA 3VV1A 4IEPA 3T2QA 1F5FA 5T5OA 3NO8A 1XOYA 3RYRA 1XYNA 4P9YA 1S0JA 1ENQA 1HN0A 2WS93 4C91A 4CCNA 4RQPC 1PGW2 3ATGA 3RZMA 3ZOIA 5C8WA 2GZWA 5A1FA 4UAPA 3PUAA 2XQXA 2ZGTA 3KCYA 3BPZA 1V6KA 4DS0A 3WCRA 1V70A 1RUC3 3QH7A 3N3HA 1AJKA 1QKQA 3WG3A 4W4ZA 5CFDB 2QQUA 4H3WA 3RVHA 2BTVC 2BOIA 2OA2A 3OYWB 3BTAA 4ISRA 2Y64A 4EWDA 3IIIA 1D4M2 4GH4A 3B9CA 1VRH2 4WVVA 2AYHA 5T50A 1NCRB 1NA1C 3QLQA 4YW5A 1AL23 4B4PA 3QACA 5C5UA 4AFDA 1IKQA 3Q8BA 1WBFA 2RHPA 2YBPA 1QJX2 2WNUB 3ZXDA 2JKXA 2G9ZA 3PVNA 4LHSA 4DY3A 2EALA 1GICA 5BUVA 3A23A 5A33B 4YLZA 1FV3A 1MVQA 2J1AA 4L9BA 2DVFA 5GZCA 5CG8A 1K5MB 4M3CE 4OLLA 4OQ8A 2V4AA 1VMJA 1XYPA 1RUJ1 4YZ2A 2WO1A 4IEOA 4YW6A 5CFCB 3H3UA 1STMA 1ULOA 1E5SA 1LRHA 3Q8EA 2X8KA 2PHXA 2XLAA 1EPZA 4JDOA 4MXVA 1XYOA 5FR3A 4WM7A 2JDMA 4MXWB 1EAH3 1NT0A 4XBQA 2JE7A 2WS92 2RS33 1V6IA 5F2WA 1VE0A 3AB0A 3E6CC 4H7MA 4K8RB 1VAVA 3ABZA 4NIIA 1L7QA 4P5YA 4XFHA 1QNYA 3M3CA 1ULCA 4BLIA 1W3VA 1BJQA 4CUBA 4Y20A 3FHAA 3LEGA 5BNPA 4M0HA 1HQWA 3M70A 3C7EA 4ZS2A 5GKAC 4JX0A 4LLOA 1POV3 3S5AA 1YQ8A 5FFOC 1C1FA 1NZCA 3NV2A 1PGW1 3ILRA 5C7GA 3U4SA 5CZKA 4KH9A 5DUVA 2CDPA 5C3OA 3POEA 1RHI3 2NMNA 5JWPA 3B93A 2IC1A 2JDAA 4WVZA 4XVHA 3GJAA 4C1XA 5FYVA 1NCQA 1D4M3 2JWPA 4TSVA 3ZFFA 3WD5A 4EV0A 1VRH3 4DOUA 4YM1A 1GOFA 1NCQC 3VZLA 3OGVA 1DBNA 1QQP3 3AVRA 1X8MA 3ZIXA 1IS3A 5C3RA 1GUIA 3WY6A 2F6BA 4N43C 1H2MA 1SPPA 4Q0PA 5JLVA 1AXYA 3VBFC 2JB8A 4QX1A 1PMHX 2BGOA 5FY1A 4CDUB 4HLTA 1I5PA 4RN5A 4FBFA 1OD3A 3OJBA 4HL0A 4KMQA 4LBJA 4AGGA 2E7QA 3B3QE 4XPVA 2A70A 3J8F3 3T1MA 1VRBA 4FFFA 1H1MA 1Z7S1 1MPXA 2AENA 5JZGB 5JZGC 1RL3A 4Q4W1 1IHMA 5GALA 1YIPA 4LITA 2V09A 4MHRA 3JBG2 1DQ6A 1E5RA 5A6QA 1AX2A 5GLWA 5FZBA 4I0BA 5FPAA 5I8TA 2A6ZA 3RZLA 1RUD2 1SLBA 5FZOA 2RS32 4M3CA 3C7GA 1W6NB 5E1RA 2OIIA 3ZFFC 3S7IA 4AQ2A 3AKTA 3D82A 2VMFA 3T3YA 4DB5A 2RDNA 2RR13 3WQ0A 2MEV3 3CEWA 3WUCA 1ZBE2 3K77A 3PVEA 4W50A 1AR71 2FDKA 1LODA 1YFXA 1W8UA 1XNKA 1PVC1 4M00A 4UFMA 4YZ3A 5I8SA 4RL7A 3T2PA 5FMOS 1VAKA 3WP3A 3HQXA 3PTRB 1VBE3 1OKOA 5FZHA 2LUWA 2JG8A 3GM8A 5DG1A 1EAH1 3I59A 2EA7A 1HQNA 2RR11 1Q5OA 2BQPA 1VALA 2J1SA 3DPRA 4CUGA 2XWJB 5B2GB 3M3EA 4K3UA 1UQXA 3WUDA 1V6JA 5CKNA 1OSGA 1OA3A 3GHMA 2X10A 1WCKA 1GSLA 1V0AA 3VL9A 4ASKA 4BK4A 4V1PA 2CWSA 2R16A 4NMIA 3IMNA 5T54A 2JG9C 4LPLA 4M3CB 5F3GA 4NE9A 3DV8A 2G1MA 5G04L 5BNNA 5IK5A 2ZGRA 4OI0A 1RIRA 4GMP3 1NX9A 5FMDA 3AP4A 2PHLA 4FXGB 3T08A 2KM2A 4B4QA 3UGGA 4RQPA 2I2SA 1Y43B 3MI8A 5JXIA 1QJX1 3KCXA 1D0GA 2HWF2 3M8LA 1XC6A 5DDJ1 3OY8A 2VXRA 1LCLA 2QQJA 2QFEA 1H1AA 4LBQA 5CKMA 4BQ2A 2WZ8A 4S2DA 1PO12 4CDQA 4Q4W2 3FFQA 2GNTA 1UW8A 2R043 3LEKA 4FOVA 3FC0A 3M3IA 4S2GA 4EWEA 1SLTA 5HCAA 2XJPA 4RHV1 1HN1A 3MO4A 5LB6A 4JGZB 2JG9B 4YVWB 4GH4C 4CXWA 2C9AA 1JH5A 2ZCWA 3JXSA 5ABJC 4A41A 4CP0A 2VCAA 4MH0E 1AR91 2RJKA 1RUF1 5HPOA 2KD7A 5FXVA 3PDQA 3C7OA 5DQ0A 4AXOA 3CU7A 3LOBA 2BWAA 2XGXA 4GQ7A 3CL1A 5FBZA 5T55A 5FXWA 1ULFA 2YDEA 4Z92B 1UNBA 1JXNA 1IQAA 3POBA 4NHMA 4IGPA 1RXFA 4DO0A 3TN93 1J58A 1W2UA 4NUBA 4QXBA 3ACFA 5GLVA 4XHXA 4SLIA 1PVXA 1XE0A 1WD3A 2ET7A 1YCIA 4LIUA 3M3QA 4QX8A 4CDQC 2D3RA 3AFKA 4XC9A 4XUTA 2IXKA 5T5LA 1PZ9A 3BPSA 2JIJA 1PM4A 3E1F1 3HBZA 1PZ8A 5A80A 2BPA2 3LWCA 3PURA 2FQPA 5C70A 4QU1A 4FPLA 4BE3A 2OZJA 5TSWA 1H2NA 4CXXA 2HWF3 1W0PA 3PUSA 1LU1A 1OQEA 4ZONA 4O65A 5A3UA 3ST7A 2DVAA 4EZHA 5IAXA 4CU7A 5IJRA 5FPXA 1AR62 1OFSA 1J3QA 4UOJA 2XVGA 3N4MA 4XACA 3TYJA 2UWAA 1QEXA 2XJSA 1HDKA 1RUC2 2UU8A 4L0PA 1C5IA 1HV1A 3SLIA 4CUAA 2J1RA 1PMJX 1OC1A 3AP9A 4AVTA 3R05A 1PO11 4MUVA 1NLSA 1QJU3 1S2EA 4CU9A 1BMV2 1A3KA 3NL1A 3POYA 4ATEA 1SDWA 4KGQA 1UPIA 1Y4WA 3EYPA 2VMIA 2YU2A 4FVVA 2VUJA 4GAZA 4ZU7A 4OUMA 3BYWA 4DUVA 3ON7A 5C6CA 3I97A 5FYUA 3RQ0A 4PHZA 4TXWA 4L11A 3SCGA 4HKWA 3RJRA 4RGKA 4ZZ8A 3E5UA 2H6CA 1Q8SA 4RGAA 1AX0A 2Q0AA 3N9PA 2OUHA 2XHNA 3F2ZA 4KWJA 1DYOA 4PCRA 4OMCA 4U2AA 3RI9A 3POWA 3SQOA 4CCCA 5FOJB 4ZZ5A 4XYXA 4IW3A 1VPHA 2P5BA 4LHLA 4NPLA 4XTMA 4RFRB 5C8CA 2VNRA 1DGWX 2EXKA 4AR2A 3VDBA 1QJZA 1F9KA 2WUHA 2J1EA 3ZMOA 4Y1VA 4XCAA 5IAVA 4ZY9A 5GZFA 1SFNA 1S0IA 1WW5A 3WG4A 5KXEA 1PGL1 1ZA4A 3T2TA 3WNPA 2J1UA 1CESA 3P1IA 4MLOA 5F7UA 1L7RA 2XJQA 3O1SA 4GB31 1RMU2 3BI3A 4FOYA 3WG1A 4EN6B 3O1OA 3ZSMA 5H9SA 1O91A 3EJKA 5KHGA 4RS5C 2FZ2A 4LE3A 4YM3A 5FWEA 4LTAA 4E4SA 3W59A 1CPNA 1DGRN 3QCWA 4DUXA 3S57A 4D7TA 4AI3A 2AACA 3T30A 2PHUA 1X8EA 1RUE2 2R062 3JZVA 1NQDA 1QHDA 1ZBA3 5HCHA 1R093 1DGWA 1QJU2 1MEC2 4GULA 3E6DA 5EQUA 2Z4FA 3RG0A 2W1UA 3CO2A 4NIHA 3WF0A 3V65A 3N35A 2H0BA 2VQ0A 3AKPA 1R083 3RZJA 3CBNA 4CCOA 4AI9A 3BU0A 2ZHNA 3U10A 2VZOA 5I0TA 4FP2A 2BV4A 4NVPA 3VBHB 4BDVB 2BFUL 5EFUA 3WNOA 3ME2A 5C3QA 5A6YA 1ODMA 2VVFA 4CDXC 1TNFA 1OXCA 4XOGA 5FO9B 3MLKA 1YQ6A 2ZHKA 3J8F2 3W9AA 2QDRA 5EHDA 5FPZA 2X05A 3KS7A 3ACIA 4O7XA 3BOPA 3JCIA 4QB6A 3UT0A 1ASJ1 3AYCA 3ES4A 5CKQA 4CDUC 3AKSA 4H7LA 4LJHA 5L7OC 3IWZA 3UGFA 2QKDA 4IXLA 4NIGA 5ACA2 2DU1A 2FHRA 3FHIB 2IZWA 5A33A 3P3NA 2D6KA 4DXRA 1TME2 2RE9A 1K5MA 1Y9MA 1QGLA 3NV1A 2RR12 2WT1A 3C2UA 4OHVA 3H0OA 5ANQA 2VBPA 4LK6A 5FZLA 1JZ6A 4QHZA 4DXTA 4X6RB 4BWOA 2DBIA 3VDDC 1UCXA 5LEKA 3JQXA 2Q5TA 3ES1A 3WQ7A 5KC5A 1H2KA 1TQ5A 1TMF1 1W6PA 2A6YA 2BZDA 2GNMA 2JKBA 3BCWA 4H14A 5BPXA 2LTNA 2LW8A 2VNVA 5JVVA 1WW4A 5LCWL 5JUVA 5IK7A 4AWDA 1DQ5A 3SCFA 4LEJA 1G9AA 3GXUA 4WM7B 3HOBA 1ZZ6A 4BZ4A 3PLQA 2QQPA 3VBRA 1WKYA 1RUE1 2W3JA 2NN8A 4I3GA 4WZFA 5FKCA 1W9WA 4CRQA 1U12A 5LBCA 2Q8EA 2D5FA 2HYXA 2VD7A 3VZNA 4BQYA 4GWMA 5BNOB 3JD71 1HJGA 1O4TA 3K3NA 5JPMB 5KBFA 4QQPA 5CNAA 1UOFA 4QKFA 3C7HA 4RFT0 3HNYM 1JW6A 4EROA 1UYZA 5JI7A 4Q8LA 3LIGA 3APBA 3RWNA 1VR3A 4NHLA 3I3EA 5F5IA 4DXSA 5SV8A 3H1WA 1NCQB 2QQMA 1AR72 4XIOA 2BP6A 2DCZA 2LALA 3JBG1 4HONA 4HVRA 4J1XA 4KQ7A 4NHXA 5L9BA 2A3XA 4QAWA 1LOEA 3I54A 2P6HA 3ZN6A 2BVBA 4Q4W3 2V5YA 5T5JA 2R6QA 4SBVA 5ANNA 4YW7A 3J26N 1ND3C 1UYYA 1PMIA 2SBAA 3ITQA 2W47A 5CISA 3WF2A 4EWAA 1YQ5A 3I8TA 2AEYA 2XKPA 3B9IA 3CLPA 3GJBA 2QQWA 4LKDA 4RR3B 1H8VA 1DP0A 4XAEA 2RV9A 2EIBA 2TEPA 1U5IA 5B4NA 1K42A 4I02A 2PHDA 3POFA 4QXCA 5L9VA 3CJIC 2A6XA 5FMOL 1OVSA 3NJZA 3WCSA 3ZYFA 2QDNA 4UXAA 3TWIA 3Q8AA 3T2OA 2DV9A 4Y22A 3WDYA 1IPKA 3VBSA 1IOAA 1US3A 1KQRA 1NLRA 3MBWA 4Q2FA 5LBFA 3VZOA 3DEMA 4BQ5A 3B00A 2WAAA 3MUZ1 5FO7B 1KJRA 1YIFA 3R6SA 1W8TA 3FMGA 3NSTA 3TN92 2R49A 4HT1T 3DGTA 3MFAA 2OS2A 4QPYA 1NKGA 1K3IA 2ZS6B 3DYPA 4FO9A 3WSOA 5IK8A 4DFSA 1TVGA 1JS9A 5JI9A 1MEC1 3EMRA 4BMBA 5DZGA 3CF6E 2WNUC 2A75A 4AAPA 3FX3A 4CP2A 4FPJA 4ZU5A 1E5HA 1LENA 4KWLA 1PNGA 3USUB 2PN5A 3DPRB 3GGLA 4EQVA 1YUDA 2ORZA 4NWWA 5BNPC 2RDSA 5F5CA 1LOAA 5L9RA 2ERFA 5DUUA 1KEXA 1S0CA 2GC3A 3HVDA 2GC2A 3BTYA 4CCJA 4WM8A 3G7DA 3D3AA 4QGMA 2VMGA 4KGGA 2C9KA 4V2WA 3RJ2X 5C3SA 2AGSA 2G19A 2QQLA 1ZA7A 2H0VA 4JGZC 4K7JA 2VAUA 2V4VA 4RQPB 1LKNA 1O3RA 1RINA 4K21A 1OHFA 4QKNA 5A3NA 4BISA 3DUIA 2WZR2 3LDRA 4IV1A 4KG0A 4LOTA 4XETA 5FP9A 3VLBB 1CAUA 2FDFA 2FMYA 3BTZA 1OLMA 5LATA 1JBCA 4MSVA 4Q4Y2 3H8OA 4PBPA 4E4HA 3V0AB 3I3MA 1LOFA 4KWKA 2BW8A 5BNNC 1HXS2 4A45A 4XFFA 2QUOA 4XF4A 2QBXA 2A6VA 5IWFA 4GWNA 4K9SA 1D4M1 1NXMA 3INAA 4GA9A 1O3SA 4PT6A 3ZPOA 2B42B 3OUJA 4PJYA 2ZABA 1QJFA 2B8MA 3HAGA 1MZ5A 4L8QA 3WOGA 2ZGOA 5FP7A 4KU7A 5DAXA 1UY0A 1DCSA 2HLEA 1VJ2A 2VZ1A 4OCTA 2RM23 1ZRFA 2XOMA 5HCFA 1O5UA 3UV9A 3H3LA 2VY0A 4Y24A 2CSGA 3W20A 2CGNA 4ZS3A 1CAWB 2ZA9A 4D7SA 1XXNA 1YJKA 4FOQA 3AMHA 3IPVA 3PUIA 2Y6HA 3VD5A 3W58A 1UOGA 1WLTA 2Q1FA 3DXTA 4QPIA 4XFIA 3WDVA 1F8VA 1F4AA 1RUC1 2CNAA 4QDRA 4ZU4A 1O3QA 1PO23 3O1UA 4A3ZA 3ORJA 1BEV3 5JAXA 2JG8C 4K8FA 3H8XA 3NV4A 1OOPA 3CQOA 1R092 1BK0A 1VBB2 4XABA 4YW2A 3VBOC 5EYXA 3W5MA 3IBMA 1A8MA 1APNA 1RXGA 2RDQA 3OBAA 3RWKX 3WHTA 1QJY3 5I0UA 4AQSA 2RJ2A 5A32A 1UZYA 1R082 4DXZA 2XL9A 3O0VA 1ZZ8A 2ZZJA 4Q0VA 4W8JA 3S30A 1O4ZA 3I7DA 4DRRA 1UMHA 1LHUA 1W9YA 3MW3A 1COV1 2ZX3A 2YB7A 4QDQA 3WEZA 1W2AX 3AZVA 3HNBM 2P2KA 5FREA 4AVAA 4ORFA 3WNMA 4QXHA 5F39A 1KGYA 1XNBA 1OQ1A 1J3PA 2VULA 3LGRA 1KDKA 3POIA 4XJAA 1KFUL 5C4WA 2P6CA 2FCUA 1IG0A 2FDJA 3UKVA 2W92A 5LA9A 3ZKUA 2W5FA 1W9SA 3KGLA 1CPMA 1JZ3A 4GB32 2Y0IA 2D44A 1DLCA 3GZTB 1V00A 4XCBA 1OLME 1W0NA 3ZXAC 3HWJA 1WA4A 2VW0A 1CWPA 3H42B 4LULA 3VKNA 1WLCA 3ZLIA 2VZSA 2IXHA 5D8AB 2VOTA 4LXLA 3SC7X 1TME3 3E5QA 4IL7A 2JICA 3H7YA 2Q8DA 5A1AA 3S0MA 2YPDA 2BFUS 2QCSB 1CJDA 1XSRA 5DZEA 1DYPA 3PU8A 3CMGA 4Y5Z0 3CJIA 4QM9A 3SHRA 4CEYC 2WZPP 4DEQA 3ZYBA 2XQRA 3SH4A 5FBJA 2AEZA 1WZXA 2IUWA 5HXMA 1LHNA 3U1XA 5C4WB 1VBB3 2Z2SB 3T4VA 3EHKA 3DKQA 3R4UA 4LBLA 4A7YA 2B9VA 5I0DA 2D43A 4QDSA 1KRIA 4LQRA 3CHXA 3QH6A 4OQ9A 2HWB3 1CR7A 2VCCA 3C7FA 4INDA 5CFDA 2VH9A 1GV9A 2WZEA 4N43A 1QOOA 2JECA 1VP6A 4OULA 2HWD3 1CAXB 5JSPA 3TAYA 5D8AA 1XNCA 3VL8A 3N9OA 1RUF3 3K51A 4XQWA 1MS3A 1S0GA 4COWA 3I4IA 4D0QA 1Q8QA 3RYKA 4Q29A 5LEJA 1AYM1 4LKFA 1PO21 1UN1A 1WLWA 2XUEA 2ZMLA 5JIAA 3ACGA 2C26A 1ENRA 2ZMKA 3K4ZA 4Y33A 3KT4A 4ZPIA 2JENA 1OLRA 4BQ3A 3KV5A 4RD7A 3ZPYA 1HLCA 1N1TA 3RZHA 2YMZA 4GB33 2RS13 5ACA1 5AC91 3IAQA 1ZREA 1NOVA 3ENRA 3W21A 1W6OA 3IDCB 3VBHA 1OA4A 5FK7A 2DTYA 4XZPA 2RG4A 3I3BA 5DDJ3 3VHPA 3WW3A 4YG6A 1C3HA 4KU8A 4FSJA 1JYVA 1YXWA 5FKBA 3S5QA 3PIGA 2GH8A 1G8WA 3POSA 2WO7A 2DFBA 1RTVA 4MXWA 4QU2A 2NLRA 3VN4A 2OZ6A 1N3OA 2PXJA 3KWVA 3N9QA 3H8RA 2BJSA 1Q8VA 1G6NA 3T0DA 1FI2A 3D0JA 4ES8A 1QQP1 2ARBA 2YHJA 3HN1A 3MYXA 1UL9A 4N9HA 5DUWA 2G9FA 4UYBA 2CGOA 4WVWA 2CHHA 2G4IA 4GIQA 4CXYA 3CJXA 4FPKA 4HG6B 4M0NA 2E31A 1ZBA1 4Q4V2 2OPKA 3KB5A 4Z8BA 3SKJE 3VBFA 1LOCA 1OUXA 1WCDJ 2BOJA 3CIHA 3VB9A 2PLV3 2J7MA 2X5IB 1GP5A 1XU2A 4QPGB 4Y1YA 3ZXFA 2GC0A 2DYCA 1MACA 2D6LX 3KF3A 1HRI1 2QQIA 2QVSB 5FO8B 5GLZA 2P3JA 4GXLA 5K9YA 3PUHA 1XE8A 1VMHA 1KS5A 2HBUA 3BKZA 5FYZA 1QJY1 3ZSLA 3KZ4C 3N36A 2XBO2 5FPUA 3VBUA 1SPPB 3H9AA 2KA3A 2H6BA 4ATFA 1F5JA 1FOD2 1QDOA 2C4XA 3WLUA 3OD4A 1C8M2 4XILA 3ZVXA 2VBDA 5IK4A 3K48A 3VBRB 5G05L 3I2JA 4UWDA 1FMD2 3ACHA 3MV01 4KL1A 2RS12 2YC0A 1CZTA 4J6GA 1DGRA 1W04A 1J1LA 4IV3A 1WCQA 2WA3A 5DN2A 1GWMA 5JZGA 2BU9A 1JU3A 1HIXA 2W94A 4LO4B 4UT5A 3VBFB 3UNPA 2ZX4A 5CVRA 2XDVA 2WT0A 4IGOA 1B35B 3O1MA 4QGNA 3IZOA 4YVSB 3ETQA 4IEXA 1F2NA 5FZEA 1HRI3 2DUOA 3AP6A 1EP0A 1S0FA 3NW4A 2VZRA 4AVSA 5JR2A 1H8TA 5JSOA 1HXS1 3PMEA 5ISLA 2Y6LA 2QQOA 1AL21 5DZFA 4CP9B 3U78A 1RHI2 4PQQA 3VBUB 3WVJA 5KR7A 1WCSA 2WFF2 2GMMA 3AZWA 5FUNA 2PAMA 1UZVA 4Q4Y3 5F8PA 4B1LA 2NMOA 2J1TA 3AVSA 4MG2A 1QQP2 2Q1MA 1HXS3 2VECA 3BU7A 1VRH1 1W06A 2IXCA 3PUQA 4Q1PA 4DZGA 1BMV1 4UFKA 4YYOA 3HIFA 5KHKA 2D93A 2P3KA 4IV3B 1XPWA 2ZEWA 4X6QB 3KSCA 4YNIA 2QZ3A 2BNMA 2XJVA 4A4AA 3D4KA 1GNYA 5K0UA 1SCRA 1FAYA 2JEMA 1MS9A 3AXEA 2ZZQA 3SXWA 4BHPA 4CPBD 2A1XA 1U5XA 5BNOC 4YARA 5T5PA 2JDUA 3B02A 4CCDA 1D4VB 4M01A 1MQTA 4LBMA 2WYSA 4LO5B 1CVNA 4P5HA 4XJZA 1EYBA 1JUIA 3MICA 3N9LA 3OPWA 5FYYA 2FDGA 2PQQA 3DPRC 1ND3A 3WINE 2ZEYA 4QD2A 1W8NA 3NKTA 5FUPA 1C28A 1EUTA 1REFA 1CAVB 2AUYA 1BQPA 2VOXA 3IB3A 2ZKLA 4CDXA 3TEZA 3JBG3 1UY2A 3H3ZA 1G9BA 4IE6A 4N53C 2JE9A 4LMFA 3X29B 4BIFA 2QNKA 2Q30A 2EVXA 1PO22 2V72A 4FTEA 3G6JB 1LB2A 1NA1A 5JXGA 1BEV2 1GZ9A 4META 3SH5A 3VHRA 4YWAA 5LW9A 2MEV2 2R0FA 1BXHA 2MPFA 2ZXQA 4GD4A 4LO8A 2DUPA 1UYPA 3O0XA 4Z82A 1RUOA 5FRAA 4XBNA 4NRMA 5J3UA 1CONA 4EYUA 1GWLA 1UX7A 1RUE3 1UWWA 2P34A 1ULGA 1W6QB 2D6NA 2R063 4YGCA 3AZXA 4M4RA 4JV4A 4JGZA 4LBNA 3NMBA 5FV3A 1OVPA 1XBFA 5IT6A 2BGPA 4DNYA 4JGYA 2TNFA 3E5XA 1LGBA 4WM8B 4WM8C 2GC1A 4A7KA 4CSWA 1RB8G 2ZGNA 5AC93 4CEWC 1UY3A 2LM3A 4M3CF 3PVBB 1AR82 1VBD1 2WJSA 3MIFA 3K4DA 1EV12 4NRQA 2FDIA 3O1RA 1GZWB 3D6EA 4GZ9A 3UL2A 4PDWA 2HH9A 3MHZA 3KLSA 1QU0A 5C9AC 1O8PA 3CDZB 4AEDB 1ND2B 5DABA 3TNPB 1AF9A 2PTMA 4J25A 4P02B 4WBBA 4QB1A 2W1QA 5F3IA 3OB8A 2XBO1 4GMP1 1CX4A 4GJZA 4Q4X2 5HI0A 4FP3A 2E33A 3WR0A 4PLNA 1XQNA 1W99A 2GMPA 1GKBA 2K46A 4BPZA 3LAGA 2RMU2 3ZIWA 4QX3A 3NNMA 4ZXKA 1LECA 2BRTA 2RS11 2MHFA 2W39A 5DG2A 5CB7A 5ACA3 2WINB 3OEAA 2ILMA 3TRSB 4CPBA 2FCTA 2VU9A 4E4DX 3ROUA 5IVFA 2UY9A 4BA6A 3MPBA 2VCBA 4R9AA 4MX3A 1C57A 3FN9A 3ZYHA 3H1YA 1HB1A 2XJTA 4LE4A 5EPAA 5CG9A 1NE4A 1WW6A 1AYM3 4R52A 1OH4A 2UYBA 1UOBA 2VMEA 5JXJA 2XPJA 3IDBB 1GZWA 1LU2A 2YGLA 5EJ3A 2E51A 4JC1A 4XTPA 1R081 4JTNA 1ZZBA 5FZMA 3U14A 1BVP1 1CAWA 1YO8A 2EIGA 5DPNA 3RFRA 2VPVA 1LOGA 1AL0G 1W6MA 3MEPA 4O9EA 3OF1A 4W6YA 5FXXA 2IXLA 5APAA 1I1EA 1S55A 1FATA 1OT5A 2ZX1A 2VOKA 4GWJA 3VGIA 1ZVFA 1NLQA 2YFUA 3V64A 2VNGA 3PNAA 5BXXA 1I9RA 2C1FA 3T0AA 3GCXA 3THDA 3AMNA 4YGBA 4TTGA 3BVCA 5DAVA 1ST8A 4LHKA 5C3PA 1YYNA 1WLDA 1Y9QA 1DU3D 4CP1A 2JDHA 2GP3A 3TEWA 1DZTA 3ZYRA 5E6HA 4Y1UA 2ZGQA 2VO5A 2C6SA 2VOVA 3LDBA 4CEWB 2JB4A 4XFAA 3SH3A 2P37A 1I3HA 4XDQA 1AR73 3KT1A 2JDYA 4BK5A 4EN0A 4NROA 4XQ4A 2Z79A 1OFNA 3AC0A 4LA2A 4NHKA 5F9TA 4P9IA 1PGSA 2RMU3 4MGYE 4AEKA 5C4WC 3AM2A 5CADA 1O59A 3F95A 4MVTA 1AR63 1MVEA 1S0DA 2DCTA 2XKOA 3PL0A 3NNFA 1AXKA 1S4CA 5A1LA 2IXJA 2ZHMA 4CCLA 1LGNA 5FWJA 4OUEA 4ZHNA 3A0KA 1AYM2 4AI0A 1WMDA 1G9CA 1UZWA 2VZVA 4JAAA 4C8DA 4XF9A 2ZJCA 5FZAA 4AEJA 4AVBA 3OPTA 3WF3A 1GZCA 3H1MA 5FQ0B 4E27A 1IGOA 1UU4A 4XUOA 2C0ZA 1PM7A 3CKHA 3OGGA 3ZFGC 4COYA 3RI8A 5D1IA 1PVC2 3B01A 5FYCA 1FNYA 3IN9A 4UF0B 1PX4A 3I2GA 4WVMA 1M06G 2WN3A 1OLQA 3HR9A 4XMIA 4MGTA 1XU1A 5L7OA 1PIV3 3CZUA 1F31A 1X33A 3J7MA 2EAKA 2Y38A 1FV2A 3WZ1A 3GBGA 3W5NA 4E8DA 4P9XA 3ZXLA 2E53A 2WNOA 5CU1A 4CDWB 5GLTA 3ZR6A 4HOOA 2ZX0A 1UY4A 4A2UA 4R4ZA 1J1TA 1R1A2 4HVOA 1LTEA 1GYKA 1FYUA 3J9SA 3ZDVA 3GZUC 3KM5A 3K2OA 4GKXA 2XWBB 1POV1 1VBA3 4JKKA 5ABJA 2DBNA 3KGZA 4OI2A 1REEA 4NR1A 4Y20B 5SV5A 2IFRA 5B4XA 4D8MA 3AYDA 4NO4A 3LOIA 3WP5A 1V6NA 2XONA 4BQ4A 1HRI2 4QKBA 3K3OA 2YG0A 3OG2A 2ZBJA 2EXIA 1VBA1 2ADEA 4BOWA 4LO6B 1S2KA 1FPN3 1ZBA2 1OBNA 4LKSA 5DUXA 4CCEA 5FYMA 1WBLA 3FBMA 3IKWA 5ERLA 5F1RA 3ELNA 1NY72 2PFWA 2WQZC 5KHIA 2FD8A 5E8AA 2CL2A 4JTOA 2ES3A 2VZTA 2Y6GA 4XFBA 4CDWA 1QY4A 3AX4A 1LESA 1K5JA 2B46X 3KV6A 5F5AA 5C71A 3O1TA 3LFMA 4XUPA 5FPLA 4BQXA 3OYWA 5IVJA 1YEWA 4FPEA 3ZXGA 3BIEA 1GOHA 2J22A 5ABJB 1X36A 4LOSA 3WDTA 3MLJA 2ZHLA 2ZGPA 4QWNA 5FP3A 2WNUA 1FOD1 1O6UA 4DPNA 5A6ZA 3DXUA 4X8NA 1MZFA 2OXBA 4P00B 2D5HA 1PX3A 2BYVE 2NYYA 3TNQA 1K45A 2CTVA 5FZDA 4D6QA 2RJLA 4CEYA 4I30A 3OPZA 2X5IA 4QPGA 3MIDA 1H30A 2L9LA 1H2LA 2A3WA 4R9CA 5FZ4A 4IGQA 5A3WA 3S6PA 4DRVA 2XHKA 4Y1ZA 3MFCA 4BYYA 4FXKB 3PU3A 4BCUA 3N7JA 2XLFA 1KITA 3GCWA 3NWKA 5GZEA 1X50A 3KCCA 2WNVA 4XQDA 5H9RA 5LBBA 5T52A 3WV6A 4P9JA 4M4PA 4RSUA 3DL3A 2VQAA 4RYDA 5FLJA 4Y5SA 1SBEA 1B35C 1NUKA 1POV0 1S1AA 3PJQA 2Y6KA 3LPGA 4FPGA 4NIAA 4Q4V1 4KBZA 3ZXJA 1UXXX 2A71A 1G7YA 1W2TA 4NWVA 4Z2WA 5CFDC 4BM8A 1FPN2 5KWRA 3DKWA 1CGPA 4FCAA 4B29A 2BWCA 2D6PA 2HWC2 3NAPC 1RVF1 3NAPB 4S2HA 2QQVA 4XAAA 4CU6A 2X53S 2YC2A 3AZYA 1JZ8A 2JE8A 3EXUA 2VL4A 4JRAA 5LZ6A 4R9BA 1TG7A 4YSFA 5FMBA 4YVSA 2HEWF 3RPQA 3JB8A 3EQEA 3URFA 2RDRA 4Y26A 5JPNB 3H8UA 3NQHA 1LULA 2Q8CA 1C8M1 1AYN1 3VD7A 4CCKA 4YW4A 2W0XA 1UMZA 5EV7A 4HZFA 4S2FA 4NAMA 5EXOA 2FZ1A 1AJOA 5HV0A 2YROA 1VBE1 4IETA 2QTWB 3OEBA 1ASJ2 1RUD1 1H9WA 4UFIA 3VKMA 4CDUA 1REDA 4HSJA 2EF6A 2LS6A 5EYYA 3OTFA 3OY8B 3WNNA 2W87A 4C0BA 2D3SA 2Y26A 2IXIA 1CJPA 1QXRA 1JHJA 1ZBE1 1BBT1 1HRV2 1EUUA 2WL1A 4XHBA 2VQTA 4QGLA 5A7SA 4COUA 4RS5B 5F3CA 4QX5A 3C3VA 3ASIA 3BOWA 4Q0SA 2VMDA 2VMHA 4MHUA 1MQTB 1OH3A 2JG9A 5JOYA 2PQSA 1UKGA 4TN7A 1RUI2 3DECA 1RGSA 3FUQA 3FUOA 4IEUA 4BH9A 5LRSA 1W6NA 4Z07A 1ND3B 3NNGA 1AXZA 5FK8A 4Y4RA 1H4HA 1GBGA 1JOJA 3B94A 3HQUA 4CU8A 3OCPA 4Z2AA 3BGAA 4QQ2A 1K12A 4B7KA 4URAA 4Q1RA 2HWC3 1OPOA 1Q8OA 3VDDB 4AHYA 2B39A 2JDZA 1U5YA 2YC4A 2J42A 2GN7A 2JD4A 2HWB2 1VAMA 2JG8B 1SG3A 1KJLA 1MS0A 1AR81 1NXD1 1VBD2 2KR2A 2R30A 4HN0A 4IV1B 4OFGA 3MF6A 4KNCA 4D6RA 2R072 4OI1A 2NM1A 3AFGA 1ONAA 2K9ZA 2QQNA 4UW4A 1RUF2 3BB6A 4BMEA 2J1VA 2CDOA 4NRPA 1V9U2 3M4FA 1R091 4B8EA 5I91A 3HT1A 1Q3EA 2E63A 1DYKA 2D40A 2W08A 1NY71 1DG6A 2VW2A 2XJUA 1BKZA 4QPIC 2Y0OA 4JGYB 2ZTNA 2Y60A 5IFPA 1VB2A 3FE5A 4D3WA 3WNKA 3MW4A 3DCQA 4XW3A 5IVCA 1MS8A 1N1VA 1ZRDA 2R0HA 2GSYA 3LF7A 1LHWA 1OKQA 2WQ8A 4A7ZA 3ZFGA 1OMIA 1N1SA 4E2QA 1RUH3 3UK9A 5K8SA 2BNOA 1AR92 3AMQA 1UU6A 3IPVB 5GM0A 4L2NA 2WNEA 1YC61 1BBT2 3TN91
chains in the Genus database with same CATH topology
4UW5A 2VNOA 1AHSA 1O3TA 4QQOA 5D8AC 4XJ9A 3B5LB 3WW4A 3CNAA 2WA4A 3FLPA 1UIJA 2HYKA 2K2SA 4YVWA 4OI4A 1B09A 2JXAA 3ILFA 2HKXA 1D2SA 3R4SA 5E88A 1KDMA 1PVC3 4K1YA 4QHBA 1XNDA 2PLV2 2DVDA 3E6BA 4OUSA 5AFEA 3ZYJB 3MPPG 5C8CB 4COZA 3ACLA 1YI7A 4H55A 1MS1A 4FT8A 2A7AA 3GBFA 4HFSA 3VBRC 1ENSA 1KS4A 1R1A3 2WT2A 3HT2A 1O4YA 1ULEA 1FOD3 2RM22 4KBBA 1DDLA 3AYEA 1S2BA 2A6WA 2CYFA 1FNZA 1OD5A 2P17A 2D6OX 2XB6C 3ZXEA 4ZKTB 2ZX2A 4JRLA 1LEDA 1AZDA 3SITA 3VBUC 4LO7A 4YG0A 4GALA 1QDCA 4DY5A 2B7YA 2WS91 4XEZA 2FBEA 4CTEA 2ZGLA 4MGKE 4WV8A 1YHFA 4LUKA 2D3PA 1GNZA 5KXCA 4AQ6A 1S0BA 3M7AA 2ARXA 2YPJA 4UW3A 2GNBA 5GLUA 1L3JA 1VIWB 2OVUA 2PHFA 2R32A 4EN8B 4TWTA 2WFF3 2QJVA 3NV3A 1R1A1 2ZGUA 1E57A 1RJ8A 4P9LA 1WW7A 3WDUA 2SLIA 4XXPA 3N7LA 2ZPXA 3IDEA 1QJU1 1QJX3 1QXJA 2O8OA 4LNVA 3ZYPA 3L2YA 3NKGA 3UKTA 1Q56A 4I01A 4PLOA 5CAZA 1AVBA 3M3OA 5J48A 2HWF1 3PJYA 4DQAA 4XJUA 5GJ6A 3U0ZA 4HBNA 4HK9A 4UBGA 4AHXA 1SQ4A 2TBVA 5C33A 4AVVA 4HETA 5DXDA 1ULDA 1FXZA 1AX1A 2Z42A 2EAAA 1FX5A 1SFYA 2K0GA 3EBRA 4WVMB 1N1YA 1JTZX 1RVF3 5LK5A 1HKDA 2CWMA 3J8F1 4FOWA 3V56A 4PIYA 5J09A 5L7OB 4F7ZA 1PZ7A 3VKLA 4AK3A 1QNWA 3RRDA 3WQ1A 4HVQA 2BBVA 2TUNA 4LUMA 1X7NA 5J37A 3FBYA 3JQWA 2UURA 2MNGA 1ZZCA 3AJYA 4AW7A 2WSVA 4GH4B 1C5HA 2VVDA 1JYCA 1SACA 4XFGA 4E2SA 1NCRA 4NN0A 4AE2A 1UX6A 1YWKA 3NVCA 4MGIE 4LR4A 3MLLA 2DCJA 1A78A 4QM8A 1H0BA 3KT7A 2VOWA 4U36A 3O7OA 4IEZA 1SBFA 5AC92 2PHTA 4MZUA 1HQLA 2I45A 1EV13 4OHYA 3HD8B 1Y3TA 5HCBA 2XVLA 3JU9A 4AEDC 3LSDA 1Y7BA 3T1LA 1DZRA 5J98B 2DCKA 3BALA 2UWBA 2VVEA 4AI1A 4YW1A 1GQGA 3VKOA 1J3RA 2IFWA 4JDMA 3M1HA 5JSRA 2RS52 2PLV1 3BODA 4AGRA 1HRV3 5DDJ2 2WIIB 4Q4X3 5KC6A 3AXDA 1RVF2 2XJRA 3HMYA 3GALA 2GU9A 4RR3C 2O1QA 2ZGSA 2ZAAA 4XJ8A 4RR3A 4PLMA 3FJSA 1UF2C 1RUD3 4HKLA 4XF3A 1GANA 1C8NA 2R1DA 4CEYB 1CQ9A 2WLQA 3WHUA 1JHNA 2GH2A 3SMHA 2RMU1 3BIWE 1B35A 1ZBE3 4P9WA 4Y22B 1IS6A 3MF9A 4RHV2 4YGEA 4Q4V3 4I09A 2FMDA 4HN1A 1H8TC 1H8TB 1VBC1 2WNVC 2WNVB 1V9U1 1SLAA 2NZ9A 3OBRA 3RDIA 1VBE2 1SCSA 1SLIA 3A4UA 1VBD3 4TZDA 1SMVA 3VKFC 1HV0A 4BQ1A 3U07A 4HK8A 1UPSA 1BEV1 2Z5WA 1G86A 4FPFA 4G9SB 4F83A 2ZACA 2HWE3 1V9U3 3PTYA 4PBOA 5JMCA 3WNXA 2XBO3 1RMU1 4ES9A 4EN7B 3GZAA 3NAPA 3USUA 2ENRA 1C8M3 2XG3A 1SEFA 4FTSA 1V6MA 4HANA 3OD0A 1FMD3 1DHKB 1MR5A 2AZ5A 3MIEA 4TLFA 2BVVA 4URTA 4XJWA 1UIKA 3ZYIB 2VG9A 4NOTA 1ZM1A 2GMEA 3LA2A 3TOJA 1RUH2 4LA3A 1U5ZA 4EJRA 4YM0A 1G9DA 5F5QA 4Q26A 1A8DA 1BBT3 3IT8A 5J7MA 4KG8A 3WG2A 3GNEA 1YJLA 1M4WA 2R042 4YFZA 1AR61 1KFXL 1ND2C 1EY2A 3ZO0B 1PK6B 3FWEA 4PIXA 4WZCA 1HX6A 4CEWA 3I59B 4YVSC 1YFWA 3VHOA 3JB4C 2KXLA 3MDPA 4XE9A 4AFMA 1QH7A 4RS5A 4B7EA 2DF7A 3ZN5A 1S0EA 2AR6A 3VBSB 2EXHA 3O12A 3RNSA 1RUJ2 3VZMA 5JCTA 2A3YA 3VBHC 4AG4A 1QOSA 2WFPA 2HWE2 3O0WA 3RMXA 1IPJA 3VUOA 4I2OA 2D7FA 4W65A 1OQDA 3GBWA 2YGMA 5AVAA 4YVWC 3ALQA 4N7UA 5FLIA 3FZ3A 3WDXA 5CA6A 1EPWA 2JJ6A 4MYEA 1PK6C 1BZWA 4XXAA 4AEDA 1HW5A 1R1ZA 1PK6A 2XUMA 4J1WA 4AFCA 1Z0HA 2YYOA 2O8QA 2ET1A 1URXA 4I0AA 1PGL2 4CDQB 3IM0A 2DFCA 1EAH2 4G4FA 1QXPA 4B4RA 1OPMA 4Y4YA 1TEIA 3TBDA 2C5DA 4GKYA 1OOPB 1BK1A 1LHOA 4IQPA 3FFZA 1V6LA 4FAGA 4IEWA 3FLTA 5BV6A 1Z78A 4RGGA 3THTA 3WW1A 5J96B 3AMMA 1ZRCA 2ZOEB 2QZ2A 3A0NA 4K1ZA 4PQ9A 3AK0A 2R041 1UKRA 1N3PA 2A5ZA 4YRDA 1IS5A 2RM21 2WSUA 3RMYA 3AYAA 1GNHA 4MGZE 3ZYGA 4IEYA 1MS4A 5H9QA 3AJZA 1W6MB 4PIZA 1AR83 1DQ0A 2BGCA 2Z69A 3GF6A 2AREA 5FCCA 4JVAA 3MIHA 4IV1C 1LEMA 2HWB1 4GMP0 3ZX7A 1UAIA 5JOWA 3FLRA 1BCXA 3M2MA 4IESA 5F6LB 2DVBA 4AFBA 1MS5A 1TNRA 3ILNA 4L97A 3JD73 2V73A 1ZRRA 2DUQA 4XIKA 5LRRA 4N53A 3WX5A 3RSJA 1LGCA 5A3MA 1RMU3 4Y1XA 4B3NA 1X82A 4UBHA 3VBSC 3CJIB 3GYDA 4CDWC 3D0SA 4FPOB 3ZSKA 2Q8OA 2CAUA 1RUG2 3N7MA 1UD1A 1RUH1 4QPIB 4WM7C 1ENXA 5I0SA 1TMF2 2DVGA 3L9JT 2MEV1 4XF1A 1KXGA 1V6OA 4K20A 3ZSEA 1EV11 2OYZA 4XMAA 4AI2A 3V0BB 5LEKA 3LA7A 1SLLA 1YFYA 1DF0A 5K0UC 4QQLA 2D97A 2A73B 4N43B 3WDWA 1RUNA 3WP6A 4I3PA 1CAXA 1PIV1 2HJIA 1RJ7A 3PMSA 1PNFA 1TE1B 4C0HA 4HPKA 2X5IC 4QPGC 3J4UH 4ASLA 5A32B 2HEVF 2GN3A 3D5OA 4N53B 3ZDSA 3LCPA 3ZFEC 2OW4A 2JX9A 3N7KA 2PAKA 4YW3A 2WFF1 4YZ1A 4BLJA 1OA2A 3AMPA 1H9PA 3UJQA 1VB4A 1AYN3 3RZZA 3MGUA 2ZKNA 3GHNA 2BNNA 1W6OB 3THPA 1FT9A 4EN9B 1ASJ3 3PVOA 4R4XA 2ZGMA 3V0BA 2DWRA 1MZEA 3H7JA 3JD72 5EWSA 1VLNA 2HWD1 2XL7A 3KMHA 1ZNPA 2WKKA 4C90A 5E16A 4IV3C 3EO6A 4Q0QA 1WMEA 3ZXKA 2WZR1 5CIRA 3PHMA 4JDNA 3QD6A 1KD7A 1RUI3 4CZSA 1TMF3 1O5LA 3ZFEA 4RHV3 2I74A 3U4XA 2GNDA 2ATFA 5FAXA 4R8HA 2PYTA 3VHNA 1TME1 5IUQA 4Q0UA 3L2HA 4LBOA 4TYSA 1IZ3A 4G3YC 5HXVA 3LSEA 4OHWA 4FPCA 5CFCA 5JIUA 1GFF2 3MIGA 1NCRC 3AP7A 2AH2A 1QMJA 2WWSA 1PIV2 2WC2A 1LHVA 4D7YA 3I2DA 1U0AA 4K6BA 1YRZA 3S7EA 4RA0A 5BNPB 1GQHA 4BIOA 5C8CC 5T3NA 2RS31 1OI6A 3ZFEB 3D8CA 4O9GA 3VZJA 1Z7S3 1VBA2 5I93A 1D0HA 2E7AA 1K5MC 2I07B 2WLPA 5L73A 2GDFA 5KXBA 3MIBA 1I6XA 2DU0A 3UKNA 3ZFFB 5AFBA 1FMD1 3Q9OA 4NPRA 1W6PB 2E6VA 4YG3A 5FTTC 4Z1VA 5C9AB 1GR3A 1W39A 4YFWA 1AR93 1PHMA 2N7GA 3MZHA 4QT6A 4AI8A 4AVCA 1JN2P 1NQJA 3VZKA 1W0OA 4MV2A 2PA7A 1WMFA 2D98A 4YM2A 5BNOA 4AGVA 2UY8A 4DINB 3SNMA 1CD3G 1RUJ3 1SBDA 4JGYC 1RUG1 1AL22 4F8AA 5J36A 4HSLA 1T6GC 3LZZA 1OOPC 1RUI1 2CY6A 2YY1A 4F3JA 3VBOB 1LOBA 1DLLA 4LBKA 2CV6A 2RS51 1GLHA 4W6WA 2NP0A 2HEYF 4PDWC 5C9AA 1LR5A 4Q4Y1 5LK7B 1BVVA 2WQ4A 3MW2A 1WGPA 3WP4A 3ZN6B 4COVA 2G9GA 3B69A 1Z7S2 2GAUA 4R9DA 1AUYA 1H1IA 4OZXA 2ZGKA 1FPN1 1NA1B 1DIWA 2NQYA 4QXKA 5L19A 1SLCA 2B5HA 1Q43A 2VGDA 3P3PA 4ONUA 3E97A 1RHI1 1ZZ7A 3AKRA 4K40A 2EXJA 1VBC2 3U11A 1UU5A 3AKQA 4QMAA 1MQTC 2DCYA 3QOPA 4CYDA 1MEC3 1H4GA 3VBOA 3ECQA 5KHJA 4E4ZA 2QE3A 3WT3A 3QBQA 1Q8PA 2PHWA 2VUAA 1NYWA 5BNNB 2ZAHA 3O5SA 2WZR3 5I8YA 2OUJA 5I0RA 2HWE1 3VDDA 3ZSJA 4N7IA 2O0OA 4PDWB 4XBLA 3TB0A 1J59A 1ND2A 1WD4A 4YZ4A 3WW2A 1ZZ9A 4HMZA 5F6KA 4LBQB 1RITA 2F4PA 4PF5A 2XH6A 5L36A 4XF0A 1N3QA 4YGDA 1COV3 4N9IA 5K0UB 1G9FA 4JCKA 1QH6A 1QWRA 3DF0A 4IEVA 2YXSA 3ZMNA 3SISA 1DQ4A 3LB9A 2D6MA 4AHZA 5HBAA 4JQRA 2YZ4A 1YI9A 2P3IA 3LA3A 4FQZA 1BYHA 2UWCA 4FAHA 3R4DB 5BY5A 5GZDA 1CAVA 4CDXB 2CGPA 1RUG3 4XFCA 1C4RA 1YNAA 1JYIA 4FPYA 3KQRA 1UZZA 5EZWA 2E7TA 3DN7A 4OHXA 1XE7A 4Q4X1 1DQ1A 3ZFGB 1VBC3 3B7MA 2Q1ZB 2PAEA 4IERA 5H9PA 2DTWA 3USSA 4ISQA 5FLHA 2HWC1 1CAUB 3R0RA 2CAVA 4YZ5A 3WXPA 1ZX5A 3KD4A 4ITCA 4AFAA 3V0AA 1IKPA 4D94A 2PHRA 4AQTA 1YFUA 1QJY2 4IEQA 1JUHA 2UYAA 1XRUA 4DMIA 1DFQA 4FPHA 3AP5A 1DZQA 3O14A 4AHWA 2X29A 1W6QA 5CBLA 2VW1A 4AEMA 2R073 2ZMNA 3ZN4A 4FQ4A 1C1LA 2XVKA 4OVEA 2NPIA 1DGLA 1AYN2 4LLFA 4I0WB 4LT5A 4HKOA 5JOZA 5KHHA 4P14A 4C1WA 2YUEA 1COV2 4D69A 1ALYA 4L99A 3RYPA 3OGJA 5A3LA 5E89A 4AF9A 4A3XA 1HRV1 5KXDA 2RS53 1MZ6A 2R061 4AYUA 1NE6A 2ETEA 4ASMB 1N47A 5FOBB 4P9GA 2XLGA 3UJOA 1PO13 1D2QA 2YV8A 2Q4SA 5JDBA 2R071 1RC6A 1QOTA 1QF3A 5BYNA 3LKJA 3OBTA 1IS4A 5FQ0A 1YLLA 2DURA 4N90A 1WUVA 1I5ZA 4W6XA 2B9UA 5FDBA 1DQ2A 3AZZA 1A6CA 4X8PA 5AVPA 2IWGB 2BUKA 3H50A 2PELA 3IIAA 2W52A 1LJ7A 2E9QA 2BEOA 2R1BA 4Q27A 3RS6A 2HWD2 1O7FA 5K7PA 4LBQD 4FTBA 4E2GA 2B45X 1CIWA 2GALA 4OHZA 1CN1A 4UW6A 3SCHA 4Q8KA 5JOXA 5CFCC 5GZGA 3JUUA 4L92A 4E9KA 1VBB1 4LHNA 1LOFC 1NG0A 5JR7B 1ZYBA 2W68A 4HPKB 5BNQA 4QQHA 3VV1A 4IEPA 1F5FA 5T5OA 3NO8A 3RYRA 1XYNA 4P9YA 1S0JA 1ENQA 4C91A 2WS93 4RQPC 1PGW2 3ATGA 5C8WA 2GZWA 2ZGTA 3KCYA 3BPZA 1V6KA 4DS0A 3WCRA 1V70A 1RUC3 3QH7A 3N3HA 1AJKA 1QKQA 3WG3A 5CFDB 4H3WA 2BTVC 2OA2A 3OYWB 3BTAA 4ISRA 4EWDA 1D4M2 4GH4A 3B9CA 1VRH2 4WVVA 2AYHA 5T50A 1NCRB 1NA1C 3QLQA 4YW5A 1AL23 4B4PA 3QACA 4AFDA 1IKQA 1WBFA 2RHPA 3ZXDA 1QJX2 2WNUB 4DY3A 3PVNA 2EALA 1GICA 5BUVA 5A33B 4YLZA 1FV3A 1MVQA 4L9BA 2DVFA 5GZCA 5CG8A 1K5MB 4M3CE 4OLLA 1XYPA 1RUJ1 4YZ2A 4IEOA 5CFCB 3H3UA 1LRHA 2X8KA 2PHXA 2XLAA 1EPZA 4JDOA 4MXVA 1XYOA 4WM7A 4MXWB 1EAH3 4XBQA 2JE7A 2WS92 2RS33 1V6IA 3AB0A 3E6CC 4H7MA 1VAVA 4BLIA 4XFHA 1QNYA 3M3CA 1ULCA 1BJQA 4Y20A 5BNPA 4M0HA 1HQWA 3M70A 5GKAC 4LLOA 1POV3 5FFOC 1C1FA 1NZCA 3NV2A 1PGW1 3ILRA 4KH9A 5DUVA 1RHI3 2NMNA 5JWPA 3B93A 2IC1A 4WVZA 4C1XA 4EV0A 1NCQA 1D4M3 4TSVA 3ZFFA 3WD5A 1VRH3 4DOUA 4YM1A 3VZLA 1NCQC 1DBNA 1QQP3 1X8MA 3ZIXA 1IS3A 3WY6A 2F6BA 4N43C 1H2MA 4Q0PA 1AXYA 3VBFC 4CDUB 4HLTA 4FBFA 3OJBA 4HL0A 4LBJA 4AGGA 2E7QA 3B3QE 4XPVA 2A70A 3J8F3 3T1MA 1H1MA 1Z7S1 2AENA 5JZGB 5JZGC 1RL3A 4Q4W1 1IHMA 5GALA 1YIPA 2V09A 3JBG2 1DQ6A 1AX2A 5GLWA 4I0BA 5I8TA 2A6ZA 1RUD2 1SLBA 2RS32 4M3CA 1W6NB 5E1RA 2OIIA 3ZFFC 3S7IA 4AQ2A 3AKTA 3D82A 4DB5A 2RR13 3WQ0A 2MEV3 3CEWA 3WUCA 1ZBE2 3PVEA 1AR71 1LODA 1YFXA 1XNKA 4M00A 1PVC1 4YZ3A 5I8SA 3WP3A 4RL7A 5FMOS 1VAKA 3HQXA 1VBE3 2LUWA 2JG8A 5DG1A 1EAH1 3I59A 2EA7A 1HQNA 2RR11 1Q5OA 2BQPA 1VALA 3DPRA 2XWJB 5B2GB 3M3EA 4K3UA 3WUDA 1V6JA 1OSGA 1OA3A 3GHMA 1WCKA 1GSLA 3VL9A 4V1PA 2CWSA 2R16A 3IMNA 5T54A 2JG9C 4M3CB 3DV8A 5BNNA 5IK5A 2ZGRA 4OI0A 1RIRA 4GMP3 3AP4A 2PHLA 4FXGB 2KM2A 4B4QA 4RQPA 2I2SA 1Y43B 3MI8A 1QJX1 3KCXA 1D0GA 2HWF2 3M8LA 5DDJ1 3OY8A 2VXRA 1LCLA 2QFEA 1H1AA 4LBQA 4S2DA 1PO12 4CDQA 4Q4W2 3FFQA 2GNTA 1UW8A 2R043 4S2GA 4FOVA 3FC0A 3M3IA 4EWEA 1SLTA 5HCAA 2XJPA 4RHV1 4JGZB 2JG9B 4YVWB 4GH4C 2C9AA 1JH5A 2ZCWA 5ABJC 4CP0A 4MH0E 1AR91 2RJKA 1RUF1 4AXOA 3CU7A 3LOBA 2BWAA 2XGXA 4GQ7A 3CL1A 5FBZA 5T55A 1ULFA 2YDEA 4Z92B 1JXNA 1IQAA 4NHMA 3TN93 1J58A 1W2UA 5GLVA 4XHXA 4SLIA 1PVXA 1WD3A 2ET7A 1YCIA 3M3QA 4CDQC 2D3RA 3AFKA 5T5LA 2IXKA 1PZ9A 3HBZA 1PZ8A 2BPA2 3LWCA 2FQPA 4FPLA 4BE3A 2OZJA 5TSWA 1H2NA 2HWF3 1W0PA 1LU1A 1OQEA 3ST7A 2DVAA 5FPXA 1AR62 1OFSA 1J3QA 2XVGA 3N4MA 3TYJA 2UWAA 2XJSA 1HDKA 1RUC2 2UU8A 1C5IA 1HV1A 3SLIA 3AP9A 4AVTA 3R05A 1PO11 4MUVA 1NLSA 1QJU3 1BMV2 1A3KA 3NL1A 3POYA 4ATEA 1SDWA 4KGQA 1UPIA 4FVVA 2VMIA 2VUJA 4ZU7A 4OUMA 5C6CA 3RQ0A 4L11A 3SCGA 4HKWA 3RJRA 3E5UA 2H6CA 1Q8SA 4RGAA 1AX0A 2Q0AA 5JLVA 2OUHA 4KWJA 4PCRA 4U2AA 3RI9A 3POWA 5FOJB 4XYXA 4LHLA 4XTMA 5C8CA 2VNRA 1DGWX 2EXKA 1QJZA 1F9KA 3ZMOA 4Y1VA 5GZFA 1SFNA 1S0IA 1WW5A 3WG4A 5KXEA 1PGL1 1ZA4A 3T2TA 1CESA 4MLOA 2XJQA 4GB31 1RMU2 4FOYA 3WG1A 4EN6B 3ZSMA 5H9SA 1O91A 3EJKA 5KHGA 4RS5C 2FZ2A 4LE3A 4YM3A 4LTAA 4E4SA 3W59A 1CPNA 1DGRN 3QCWA 4D7TA 4AI3A 2PHUA 1X8EA 1RUE2 2R062 3JZVA 1NQDA 1QHDA 1ZBA3 1R093 1DGWA 1QJU2 1MEC2 4GULA 3E6DA 3RG0A 3CO2A 3V65A 3N35A 2H0BA 2VQ0A 3AKPA 1R083 2ZHNA 3U10A 5I0TA 4FP2A 4NVPA 3VBHB<