3HT2A

Zink containing polyketide cyclase remf from streptomyces resistomycificus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
143
structure length
143
Chain Sequence
SMMKRVHRTDVKAEIVREPGAKETTHRKLIDTPDGADRFVLTEFEVSPNGSTPPHFHEWEHEIYVLEGSMGLVLPDQGRTEEVGPGEAIFIPRGEPHGFVTGPGQTCRFLVVAPCERPPVRNVFLSEDPYEYTQMPEYTSLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords RemF protein
publication title The polyketide cyclase RemF from Streptomyces resistomycificus contains an unusual octahedral zinc binding site
pubmed doi rcsb
source organism Streptomyces resistomycificus
total genus 29
structure length 143
sequence length 143
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ht2A00
2MNGA 1OFNA 1H1MA 4HMZA 1DZRA 4PIZA 1O5UA 4XFHA 3ST7A 5FDBA 5FPXA 5HI0A 4MGZE 4ORFA 2HKXA 1UW8A 4HSJA 2QDRA 5KHKA 4AVBA 3H1YA 3TNQA 3DN7A 2IXHA 1O3QA 1YFXA 2VPVA 4META 3VHRA 2ZKLA 1I5ZA 4PJYA 3SCGA 4YRDA 5FQ0A 1CAXB 2ET7A 2IXIA 4LEJA 4H7LA 2QCSB 2PAMA 2H0VA 1UIKA 2Q0AA 3NVCA 1Q3EA 1ZRFA 4Q29A 2Z2SB 4MX3A 4FAHA 1X7NA 4PIXA 2GC1A 3SMHA 1O3TA 3EQEA 1U12A 1QY4A 1VP6A 3GYDA 2PQQA 1NZCA 4IETA 3CF6E 3EHKA 4NVPA 3H9AA 4LA2A 3H1MA 4IEQA 4I0AA 1ZZ7A 4XFFA 4HVRA 1FT9A 1Y3TA 1X8EA 2D5HA 2D5FA 3E6DA 2GH2A 3NKTA 3MZHA 3ACLA 1ZZ9A 1O5LA 4GULA 3BU7A 4QGLA 3RYPA 1X8MA 5I0UA 3R6SA 4UBHA 2EVXA 3EJKA 2E9QA 2OPKA 4XF9A 4HBNA 1CAVA 3H3UA 5BPXA 2DCTA 3S7EA 3TNPB 5JCTA 3FJSA 1X82A 4X6QB 3DV8A 1O7FA 3FE5A 3D0SA 3I7DA 4LULA 4KU7A 1YUDA 2WFPA 4XFAA 4HVOA 4J1XA 5BXXA 2O1QA 2WC2A 2UYBA 1JUHA 4QM8A 3E5QA 3MPBA 3H50A 4LA3A 5I91A 4N9IA 5FLHA 5AVPA 4Q0SA 2VECA 3KGLA 4ONUA 4XFGA 3LA3A 1H1IA 4QGNA 5LRSA 2GU9A 4XF1A 4I09A 1PMIA 4R52A 5J48A 5CU1A 2KXLA 3IDCB 4AXOA 4HN1A 5FQ0B 3GBFA 1GQHA 2BNOA 3EO6A 4JTOA 5BY5A 2GC3A 1UIJA 2ZCWA 2QJVA 3FHIB 2UY9A 1GQGA 4BIFA 5I8YA 4ZU7A 4XF4A 2D93A 1OI6A 1WA4A 4XETA 1DGWA 1Q5OA 5C8WA 1G6NA 2MPFA 2OZ6A 5F1RA 2CGPA 3MYXA 3IDBB 4MZUA 3S0MA 4AVCA 2BNNA 2I45A 3BB6A 3NJZA 3FX3A 4YARA 4IEOA 4L2NA 1V70A 2FQPA 4HLTA 3WW1A 4Z82A 2B9UA 1Y9QA 4PIYA 1CAWA 3PNAA 2OYZA 4Z07A 4YSFA 5CVRA 1J3PA 5I8TA 1ZREA 2XKOA 3LAGA 3N4MA 3NSTA 1J3RA 3FFQA 1ZZ8A 1NYWA 1L3JA 5E1RA 4IEPA 4IESA 3DL3A 2O8QA 2GC2A 3ETQA 4QXKA 3RNSA 1SEFA 3ROUA 5LEJA 2D40A 4QGMA 4WBBA 4FAGA 3LA2A 1FI2A 4MGYE 4Q0UA 4FT8A 4OFGA 2XGXA 4I2OA 3WW3A 4AQ2A 5LRRA 3OGJA 1Q43A 1YWKA 5J3UA 3E97A 2PFWA 3QACA 2ET1A 5CADA 2Q30A 1UCXA 2EA7A 4IEYA 1NXMA 4IERA 2IXCA 4E2GA 2PAEA 1CAUB 4IEVA 5KHJA 3H3ZA 1J59A 4EV0A 4BH9A 2PAKA 2Q1ZB 5I0RA 4HVQA 5JSRA 2UY8A 5KBFA 4UXAA 5I8SA 4IEUA 4MGIE 4DINB 5KHHA 3MDPA 3NL1A 4UBGA 1O4TA 3G7DA 1IPKA 1RUOA 4Q0VA 1I6XA 2CAUA 2Q4SA 3RZZA 4KWKA 2BYVE 3E6BA 4O9EA 3RYKA 2HJIA 4LTAA 4XEZA 4F8AA 1EP0A 3BCWA 5EZWA 5JSPA 3U10A 2XL9A 1XE8A 1HW5A 1YFWA 1RL3A 4EWEA 1CAXA 1VJ2A 1DGRA 1IPJA 1ZNPA 4XF3A 2V09A 1ZRRA 1YFUA 2XHKA 4HZFA 1CAWB 3H1WA 5E16A 3H7YA 4KU8A 3SXWA 3UKNA 5FLJA 4D7TA 2XLGA 2EAAA 3O14A 3D82A 3FWEA 4P9GA 2K0GA 1J58A 2B5HA 3HIFA 3LA7A 4CYDA 2PHLA 3WW2A 1TQ5A 3SCHA 3UKTA 5KHGA 4R8HA 3WW4A 3HQXA 5FPZA 3LWCA 2BNMA 1CX4A 3S7IA 4Q0PA 5JAXA 3LOIA 4KWLA 4OLLA 4TLFA 2B8MA 4WVZA 5I0SA 4I02A 1EY2A 1RGSA 3CO2A 3FZ3A 2FMYA 2PYTA 4O9GA 3NW4A 1VR3A 3KGZA 4K8FA 4F7ZA 3BALA 2XLFA 3LZZA 2QNKA 4JV4A 2N7GA 1YHFA 3IIAA 5BV6A 4IEWA 1XE7A 1CAVB 4KWJA 2CAVA 4EWDA 3I59A 4EWAA 1RUNA 2MHFA 4LUMA 3OTFA 1NE4A 1ZZBA 4MV2A 4XF0A 2IC1A 1QXRA 2PTMA 1ZRCA 4XFBA 3ZDSA 1WLTA 4BHPA 5I93A 2C0ZA 2K9ZA 3U11A 3USSA 2ATFA 1OD5A 2P17A 5I0TA 2UYAA 2OZJA 2XL7A 4WZCA 1RTVA 3QOPA 3IBMA 1QXJA 1SFNA 2BGCA 1RC6A 4MH0E 2XLAA 3ES1A 5JSOA 2H6BA 1FXZA 3OCPA 3C3VA 4IEXA 1XRUA 3HT2A 4JVAA 4KL1A 4JTNA 4EROA 3CL1A 2GC0A 3IWZA 3E5XA 4BYYA 3ES4A 1LR5A 1ZZCA 4YYOA 4XFCA 3H8UA 3EBRA 5J7MA 1O3SA 1WGPA 1SQ4A 1ZVFA 2PHDA 2GAUA 1PM7A 3UKVA 4I0BA 5FLIA 5JR7B 4L11A 1QWRA 4A2UA 5BUVA 1EPZA 5D1IA 3CEWA 1LB2A 4E2QA 3M3IA 4QM9A 1LRHA 4ZU5A 2ETEA 2XKPA 3KMHA 5FCCA 2IXLA 1YLLA 5C6CA 2CV6A 3OF1A 3JZVA 4D7SA 1EYBA 3B02A 4E2SA 2QVSB 1O3RA 1NE6A 4LUKA 3I59B 3RPQA 2OA2A 5K8SA 3U0ZA 1ZRDA 2GZWA 3D0JA 2Y0OA 2Z69A 3PLQA 5EFUA 4B29A 5KHIA 1UD1A 3KSCA 4X6RB 3BPZA 2H6CA 3PVBB 1ZX5A 4I3PA 4FBFA 1J3QA 4MUVA 3H7JA 1YFYA 2F4PA 3DKWA 3I54A 1CAUA 3E5UA 4IEZA 4QMAA 3CLPA 4HSLA 2PA7A 4J1WA 5LEKA 1LKNA 3ELNA 3E6CC 3SCFA 2IXJA 3RDIA 3OD0A 4N9HA 3RYRA 1UPIA 4QX5A 1CGPA 2BEOA 3SHRA 4ZU4A 1ZZ6A 4AQ6A 4XFIA 4YNIA 4Q0QA 4RD7A 3HT1A 4I01A 1OMIA 3M70A 4MGKE 2IXKA 2VQAA 5T3NA 4AVAA 3L2HA 4HN0A 3CJXA 4LLOA 3KCCA 1J1LA 1DZTA
chains in the Genus database with same CATH superfamily
3LQCA 1OFNA 4FQ4A 5BYNA 4HMZA 4PIZA 3ST7A 3C7FA 1O5UA 4LO4B 1ULPA 1OF3A 2I74A 2RJLA 1OLRA 2XMLA 3SEPA 2ZHKA 4FPYA 4QQLA 4JCKA 1BK1A 2VZ3A 2XOMA 2X5IC 4QDSA 3HJRA 3OUJA 3BIEA 1DQ2A 1LJ7A 1UMZA 3SC7X 3VHRA 3MIDA 3WVJA 3OGSA 5F7UA 3ZVXA 1I5ZA 1LHNA 1ODNA 4L92A 3OGVA 2LROA 5FZCA 5LA2A 3ZYJB 4AZZA 3SH3A 3TB0A 5CKNA 4QPGA 1CAXB 1IQAA 1PNGA 2E51A 2QCSB 5IVYA 2H0VA 1UNBA 3D5OA 1UIKA 3I2DA 1OXCA 2Z4FA 2PXJA 1LENA 3NVCA 2ADDA 3WOGA 4CDUB 1JHJA 4RHV2 2Z2SB 1XNBA 4MX3A 4RFT0 5AC91 3ZXEA 2NM1A 3AK0A 4O65A 2J1RA 5CG9A 2GC1A 3SMHA 1EAH3 2QQUA 4DUXA 1O3TA 2A6YA 3GYDA 4IV1C 2NMOA 2PQQA 4AGRA 5EJZB 1UYXA 2WYSA 1LU2A 4PBPA 1ASJ2 4IETA 3ILRA 4XIOA 3ZN5A 3EHKA 3POYA 1IKPA 5FP9A 3M3CA 3H9AA 4JKLA 5LB6A 2VNOA 1D0HA 1ONAA 2HWF2 3H1MA 2WFF3 4I0AA 4IEQA 4JGYB 4NUBA 1ZZ7A 4UFLA 3NJXA 3LEGA 4QHBA 1NAEA 3AYDA 4HXCA 3E6DA 1V9U3 1ZZ9A 2WO1A 1DG6A 2WT0A 1GSLA 3OB8A 3R6SA 2ZGLA 2EVXA 2RJKA 2E9QA 2OPKA 1AL23 4XF9A 1GP6A 4JHTA 5F37A 4HBNA 1WUVA 2LRPA 3MUY1 2DCTA 3S7EA 3U4XA 3MEPA 4NO4A 1WCSA 1CQ9A 2PLV1 4GB33 2ORXA 5K0UA 3MHZA 1PVXA 3BODA 3FJSA 4LOSA 4LKEA 2XBO3 2ZZJA 3AKRA 4QX2A 2JG9A 3VDDA 1QQP3 1NCRB 1V6LA 3GZAA 2RS11 5AC92 3HNMA 2JKXA 5J09A 1H2LA 3T4VA 4J1XA 2ZGUA 1TG7A 1VMFA 2VCMA 2W0XA 4PBOA 4CCMA 3WF3A 2DUQA 2CWSA 2UYBA 4QM8A 4RS5A 5CFDA 5JMOA 1PK6C 2GSYA 3WP5A 4W6YA 2ZKNA 4LXLA 1JU4A 3AP6A 3VBRC 2Q8EA 1VALA 2QQKA 2CGOA 3VB9A 3OBZA 3ZN6B 1HRI1 5DAWA 2XQXA 4JGZA 5IJRA 1SG3A 3VBFB 1AX2A 1WW5A 3KGLA 4COZA 1AR83 4XABA 1JOBA 3RI8A 1Y43B 3GBWA 4BQWA 4DUVA 4WVMB 4MADA 5JOXA 1MS4A 1Q8QA 4A7KA 1NQDA 1C5IA 2VZSA 4I09A 4R52A 4R9CA 4LT5A 1FNZA 2B9VA 4P5YA 4UW5A 1OKQA 4BQ4A 4N43B 1NA1A 4E4ZA 2WNUC 3WNMA 1UKGA 4JGZC 1VLNA 1REFA 1GZWB 4KBBA 2P3JA 4QPGB 4XQWA 4Y1YA 2BNOA 3EO6A 2A1XA 4CDXA 4XAAA 4EYUA 2VCCA 2DVDA 2B45X 2ZGRA 3FHIB 1LULA 1UWWA 2UY9A 3TN91 1W6OA 4WM7A 2RVAA 1VBD3 2AEYA 4M3CF 4YVSB 4EE2A 1R64A 3OOXA 5FZOB 3KV5A 2DVFA 3I3QA 1H6YA 1NA1C 4LHNA 4M0NA 2XPJA 2HWE3 1DIWA 4LORA 5JXHA 3VUOA 1Q5OA 3AKSA 4UI9L 5JZGA 3J7MA 1GWMA 2IUWA 2W68A 1DF0A 4P9LA 5IW0A 5A6YA 5F1RA 5FPAA 1NKGA 3ILFA 1HRI2 4WM7C 1X9PA 2ZEYA 4A44A 1WWYA 2BNNA 2G1MA 3V65A 4AFMA 4YARA 2DDUA 5FZ3A 1V70A 3GNEA 3I2KA 1C5HA 4CP0A 1H9WA 1W2NA 3RJRA 2VBPA 4QKNA 2B9UA 2B4KA 3HN1A 1PO21 2VVEA 1H0BA 3PJYA 4JRAA 4OHVA 5AFBA 2NZ9A 5IVJA 4XE9A 4JZRA 2P6CA 4P9XA 3ZFFB 2VUJA 3T3YA 2J1UA 1DLCA 1LU1A 4WVVA 1IPSA 5FY4A 3V0BA 3KCXA 4N7IA 2R7EB 3HQUA 3VZOA 1NCQB 4K8RB 2V4VA 4XUPA 4AEJA 1PZ8A 2GP3A 3EXUA 3LAGA 5K0UB 2D7FA 1E5RA 2R041 3W58A 1UO9A 2D3RA 2R063 3BYWA 3NMBA 1NYWA 2FCVA 1G8WA 1UXZA 4H7MA 4IEPA 3POWA 2GC2A 5CFCB 1JZ6A 4QXKA 3JB4C 3POEA 4JQTA 1KJRA 1JZ3A 3ROUA 5LEJA 1AJKA 3POFA 3FUQA 4NIIA 4CUBA 1GNYA 1UU5A 4XPVA 5FP7A 3TEWA 3DXTA 4CCCA 1JODA 2WWUA 4OFGA 1VAMA 4PF1A 1HB2A 1S2BA 5H9PA 2VZTA 4UF0B 5FMDA 5FY0A 2WN3A 4I2OA 2BZDA 5LRRA 3BTAA 3PUSA 3OGJA 5JOWA 1ND3A 5J3UA 3VKNA 3FN9A 1HJGA 1QDOA 1UCXA 4K3UA 1G7YA 4PQ9A 1JI6A 5F32A 2GNBA 2ZABA 4N53B 3B3QE 1OLME 1PO22 4A7YA 4IEVA 4BQ5A 5T50A 2O8OA 3DYPA 1OOPB 2YPDA 2E63A 3D4KA 5F3GA 5T5LA 5FMOL 3VKMA 3AKQA 1T2XA 2G9FA 3MF9A 2QQOA 4ATEA 3IZOA 1QIQA 4KI5M 1ND3C 4UFIA 5JXIA 5GALA 2R042 5CKQA 5KBFA 3WDXA 5I8SA 4A45A 4X8PA 3VHOA 2YPJA 4CRQA 4QT6A 5FWJA 3B9CA 2GH8A 1LHOA 2QUOA 5KHHA 5LY1A 1ZBA1 2VCAA 3KS7A 4DXSA 1DLLA 1O4TA 1N3PA 1IPKA 2PHWA 4MG2A 5FPBA 3GGLA 2CAUA 4FFFA 2E26A 2Q4SA 3EYPA 3DKQA 3KM5A 4G3YC 4DFSA 3E6BA 5HBAA 5JZGB 3UYJA 3O0VA 4LTAA 4CCNA 4F8AA 4G4FA 4BLIA 2E31A 3USUA 3JXSA 2ARBA 1QJU1 4QDRA 4YW7A 3U10A 5IT6A 3O1RA 3UJQA 1YFWA 2JIGA 2W3JA 4E9KA 2WZR1 1QOOA 2WUHA 3UV9A 3WF4A 1AHSA 2EXIA 3WD5A 1STMA 3PUAA 2JE9A 2P3KA 3QCWA 3ZSKA 4AFCA 1DGRA 1VRH3 2LUWA 4XF3A 1FOD1 2W46A 4LO6B 4PLOA 4TXWA 1H1AA 4CEYC 3ABZA 3H7YA 4KU8A 3VZJA 1ZA4A 3W9AA 2VULA 2X05A 3MO4A 5FZKA 2D6PA 2Y6GA 2VH9A 3D82A 3FWEA 1AYM3 3AYCA 3OUIA 4IL7A 2XXZA 2W95A 3I2FA 1J58A 4DPNA 2A6WA 2B5HA 4ZZ5A 4ZKTB 5FZ9A 1IHMA 5G05L 1DYPA 4NWWA 1ZBE2 3SNMA 1ZBA2 5L9RA 3WW2A 3ZXDA 3I3DA 4TSVA 3UKTA 2RS53 2YG0A 3C7HA 3ZO0B 3HMYA 1WCKA 1RHI3 4N90A 1W99A 4UW6A 3HQXA 3O1UA 3KB5A 3LWCA 5GKAC 3O12A 2AH2A 1POV0 1H4GA 5A7SA 2FDFA 4Q0PA 1O59A 2JIJA 1YI9A 1HN1A 4IGQA 1OH4A 3I2IA 3DPRB 1QJU2 1TVGA 3I97A 5ANNA 5C3SA 1XU1A 1W9YA 3PIGA 1XPWA 4ZS3A 2WZR2 3CQOA 4FPEA 2QDNA 1TMF1 1L7RA 2FMYA 3HAGA 4DRRA 5FZEA 3KZ4C 4O9GA 1FOD2 1SLCA 4IUGA 1VR3A 2B7YA 2YBKA 5CEHA 2BU9A 4Q8LA 2ZJCA 4LJHA 3RJ2X 4BCUA 3I4IA 5FZ4A 1HXS1 4M3CA 5A6QA 3VBUB 1JBCA 1JYCA 4JV4A 2XJRA 4NHLA 3WDTA 2VMGA 3AMPA 3VKLA 1XE7A 1RUF3 4KWJA 3VKOA 1JXNA 1RUC1 1YXWA 3I59A 4UT5A 1WCQA 2G4IA 1OF4A 5IHRA 2RR11 3L2YA 1LOGA 3OY8A 1PVC3 3MI8A 5L7OB 2W5FA 1PGSA 4HKWA 4KQ7A 3T30A 1BQPA 3VGIA 5DZEA 3WSOA 3H8OA 2FDKA 2E7TA 2PTMA 1C8M2 4YG3A 4XFBA 4MSVA 3PUHA 3DGTA 1RYYA 4BHPA 1LHWA 3U11A 1M4WA 2JG8B 4LPLA 2W91A 2NN8A 1IS3A 3LFIA 4L99A 4D7YA 1OD5A 1QJY1 2A5ZA 1CIYA 4W6WA 2Q8CA 5ISLA 2XL7A 1RTVA 5FUPA 4P9IA 3IBMA 4YM3A 3ZXJA 2FD8A 1TMF2 1XNDA 2ZOEB 1ASJ3 3FLRA 4AYUA 4CEWB 3VZNA 2BUKA 2HWC2 1GWLA 4K9SA 3I3BA 4YM0A 2VW2A 1Y9GA 2VUAA 2W1QA 3ES1A 2E53A 1F8VA 2HWF3 1ENQA 3FMGA 4ITCA 3AVRA 3AJZA 3IM0A 1AR91 3POGA 3WF0A 1W9WA 4B1MA 5A1AA 4YW6A 5HCFA 3WT3A 2IFWA 4FPCA 1AXZA 1ZZCA 2GMPA 1RUC2 4LBLA 5FJHA 3W59A 4UFKA 3WY6A 4Y20B 2RR12 1MS5A 5IFTA 5J7MA 1UMIA 2JD9A 1QNYA 2ARXA 3BPSA 1I5PA 1VRBA 4FPOB 4OMCA 1R091 2ARAA 2ZGQA 4Q4Y1 4LHKA 1F4HA 5JR7B 3FUOA 2DBIA 2VZVA 1QWRA 2WT1A 5BUVA 3EB7A 2FCUA 1OPOA 5D1IA 4GKXA 4YPJA 4B7KA 5CYYA 1UY2A 4A6SA 2PHFA 1VBB1 1V6JA 3PU3A 1PHMA 2YU2A 2QQMA 5AC93 1QJY2 2Y6KA 3ZYGA 1TNFA 2ZMKA 5EJ3A 4QM9A 2J42A 4Y26A 4ZU5A 1OVPA 4XCBA 4YVWA 2VL4A 2A6VA 3DUIA 4U2AA 5FZ8A 1NLSA 1GV9A 4BQXA 1GP4A 5T55A 4ISRA 1W6MB 5F3EA 2YGMA 1XE0A 3WNKA 2JB8A 2CNAA 5C6CA 3OF1A 4NRMA 4YW1A 4KGGA 1YYNA 1FV3A 2YFUA 4AHXA 2BVBA 1B35C 1AR92 1FYUA 2EIEA 1SHWB 3B02A 3HN3A 3M3QA 4FQZA 4LBQA 4YVWC 4E2SA 2RMU3 3ON7A 2QVSB 3WQ0A 5DN2A 1RVF1 2JX9A 4PDWB 2VZUA 3I59B 5E8AA 3GHMA 1U5IA 3ZYHA 1SPPA 1YJKA 5EFUA 4B29A 3PLQA 4GWJA 1JN2P 1R092 4QQOA 3IT8A 4Q4Y2 4D6RA 4X6RB 2VNRA 2WA3A 3RSJA 3H8XA 4XJWA 3AL6A 5C9AA 5B4NA 4W65A 4UFHA 1VBB2 3QBQA 3QLQA 1QU0A 4MHUA 3FLTA 4XUNA 2W1SA 2Q1FA 5KWRA 3H7JA 1JZ7A 4GH4B 2JICA 1OD3A 4A7ZA 2PA7A 3ZFEC 4GKYA 1LKNA 5LEKA 2IXJA 4B1LA 1QJX1 4RR3B 5E6HA 2VC9A 3RYRA 4OYUA 3NJVA 1CGPA 1RUI1 1ZZ6A 1CN1A 5A6XA 4P9YA 1V6NA 1XYNA 2GDFA 4Y4RA 3JQWA 3RMYA 2BERA 1U5ZA 3CNAA 5JI7A 4FPHA 1RVF2 3VBOB 5JOZA 1CIWA 1OQDA 3QD6A 3L2HA 4WM8B 2RM21 4A42A 4LLOA 1QEXA 1N3OA 4HPKB 1RXGA 2OIIA 4QPIA 2Q8DA 3ZKUA 4YZ5A 3UNPA 4B4QA 1LECA 5FP3A 4XUQA 5C8CA 4FTSA 2YMZA 2CSGA 5FDBA 1MEC1 3S30A 5FPXA 1DGRN 4FTBA 5FXWA 4MGZE 3LFMA 2PMWB 3J4UH 1RUJ1 3JBG2 3LCPA 1H8TC 3I2JA 4XBLA 3ALQA 3UGHA 1UL9A 1UZVA 1OUXA 1QJX2 2R0FA 2DBNA 1T6BX 2AC1A 2FBEA 2NPIA 4CVUA 2VPVA 4META 2VUDA 2ZKLA 2VD7A 4WZFA 3FBYA 2P5BA 2E33A 3I49A 1RUI2 3NAPA 5D21A 2ET7A 2IXIA 2HWB1 3K46A 4A4AA 2W08A 4H7LA 5A3PA 1UU6A 4AK3A 1Q56A 3C7GA 1DQ0A 4PI0A 3ZXKA 1JZ8A 2VNGA 4Y5Z0 2WDBA 4Q29A 3O1TA 5IVBA 2FZ2A 1KRIA 2WO7A 1TME1 4FAHA 3K48A 2DURA 2R32A 3OBAA 2JECA 4LE4A 5FXXA 3CBNA 1AL0G 1O4ZA 1GNZA 2D97A 2RM22 3LIHA 1U12A 4S2HA 4XDQA 3NWKA 4ASKA 4F3JA 5FFOC 1UU4A 1NZCA 3KF3A 4EN7B 2VTXA 2QQPA 1QNWA 5JWPA 5D8AC 4LA2A 4OMDA 3UT0A 2VMDA 1G86A 4BE3A 1MEC2 5EQUA 2BTVC 2A3XA 5FY7A 5BNPA 1FT9A 1Y3TA 2D5HA 2D5FA 2GH2A 2W52A 1W2UA 1YNAA 4GZ9A 1O5LA 4CDQA 1RUJ2 5FZMA 3DEMA 4DIQA 4QGLA 2D44A 4XHXA 5I0UA 3RYPA 2DVBA 5IK8A 5C4WA 5DMYA 4LE3A 5BNNA 4TWTA 2HLEA 1MS3A 1ODMA 3ZMNA 2W1WA 3M1HA 5A1LA 5C5UA 2HBUA 5FYUA 1JZ5A 5T52A 1YI7A 5JCTA 4MGSA 2HWB2 3G6JB 4LIVA 2VMCA 3AB0A 3KQ4B 3PVNA 4O7XA 3ZSMA 4CDQC 1X82A 3NO8A 3ZYPA 4K1YA 3P5BA 3POSA 1SLLA 3DV8A 5T5JA 4URAA 4AI2A 1O7FA 5C4WC 3X29B 5FZDA 4QKFA 3VBHB 4KU7A 1TME2 5BNNC 5HXMA 5FMOS 1K5MC 4XUOA 3ZFGA 4YZ4A 1W9TA 1GNHA 3MUZ1 5A3WA 5BXXA 2CHHA 1OA2A 1RJ8A 2O1QA 4LLFA 1QJZA 1UY1A 1W2TA 3I8TA 3OPTA 4CPBA 3O1PA 1JUHA 2WNVA 1SBFA 4COWA 4AW7A 4E4DX 1RITA 3M3EA 2P4EA 3H50A 4AOCA 4ZY9A 2XB6C 4LA3A 1ND2B 4JQRA 5C8CB 1AR61 1EUUA 1QKQA 4N9IA 5FLHA 4Q26A 4OZXA 1W3VA 1ZBE3 1ZBA3 4CDWB 1ENXA 1F9KA 5IVEA 4ONUA 1YQCA 1HQLA 3V56A 3RZGA 3GBGA 3THDA 1BKZA 2ES3A 4XF1A 2Z79A 3K4DA 5J96B 4Z92B 3IDCB 3KT4A 5A6ZA 2QQLA 3N9LA 1RUE1 1W6NB 4DQAA 1D2SA 5KXDA 1GQHA 4JTOA 1VE0A 2WZR3 3FLPA 2P3YA 4ZXEA 5HCBA 3LEMA 1UZWA 4V2VA 4GWIA 4CDUC 4R4ZA 1R083 3PUQA 1W6QB 1FOD3 3ZYIB 1RUH3 4MVTA 5FOBB 3ZLIA 3B00A 3AXEA 4FFGA 3HNYM 2KD7A 2DFBA 4MXWB 1VIWB 2XVLA 4XF4A 5APAA 3UK9A 2D6LX 3PL0A 4LKSA 3UJOA 2ZX4A 5EV7A 1WLWA 2D93A 1XC6A 5A3UA 2JDMA 1GICA 2YXSA 2Q8OA 1DGWA 3CU7A 3KQRA 5C8WA 1G6NA 4Y3OA 1KS4A 3GJAA 3ZXFA 1FMD3 2MPFA 4K1ZA 4UW4A 2OKXA 2FCTA 1V00A 2CYFA 4QB2A 3PMSA 4JGYC 3MYXA 3OSDA 3WCSA 4AGGA 3AL5A 1AR62 3T0DA 4MZUA 3S0MA 4AVCA 1RJ7A 4FP2A 2I45A 3KT7A 3U75A 3WNNA 3EMRA 1G9DA 3AJYA 4RGAA 1TNRA 2FQPA 1C8M3 2ZZQA 4PIYA 3O1SA 3APBA 3PNAA 3JQXA 3S5AA 4BWOA 4XQ4A 4SBVA 3KV4A 3CMGA 2FMDA 1KD7A 1TE1B 2HH9A 4DS0A 5I8TA 4K40A 1WMDA 4YG0A 3NSTA 1TMF3 4IV1A 5LA0A 1HX6A 5KR7A 2HWC3 1ULEA 1NCRC 2FDGA 2NYYA 2EIDA 1L3JA 2Y6JA 4NHYA 2XJPA 4DO0A 5CAZA 3DL3A 2O8QA 2AACA 1AXYA 3JD71 4LKFA 3WNXA 3ETQA 3PUIA 4LBJA 1JW6A 3RNSA 5A7OA 1BJQA 4A3XA 3A0KA 1CWPA 3FL7A 1VAVA 5A80A 3THTA 1RUC3 3LA2A 5FUIA 1UAIA 1IS4A 1XOYA 1LGCA 4XILA 3ITQA 1X50A 5IVFA 2RR13 2XH6A 4FT8A 4KG0A 2XGXA 4XJUA 2ZACA 3CJIB 5ACA1 2EXJA 4W6XA 2VZQA 5FJKA 4W8JA 4LK7A 3SH5A 4URTA 4D3WA 5FBZA 1YWKA 1MQTB 3E97A 2ET1A 4YWAA 5CADA 2Q30A 2V73A 2RDRA 3OYWA 2BWAA 2EA7A 1NXMA 2VR4A 4IEYA 2IXCA 1QMJA 3W5NA 2PAEA 2DYCA 3S57A 5BNOB 2VG9A 2W47A 1QJY3 4XHBA 4EV0A 4N43C 4QX0A 2WWSA 1JH5A 4DEQA 5HV0A 5FZAA 2JJ6A 4A3ZA 2Q1ZB 3RZMA 1F15A 3I2OA 4HVQA 3T0BA 4N7UA 3RRDA 3HBZA 5JSRA 3KLSA 4TTGA 1MACA 5A7NA 2D3SA 1HB4A 1PNFA 3LSDA 4UXAA 3VD3A 4E8DA 4GD4A 1K42A 1PK6A 4MXVA 4YVSC 1MS8A 4P08A 5A33B 3VBRA 2OUHA 3JD72 5GLVA 3NL1A 2BOJA 3THCA 3FHAA 3VZMA 3CHXA 5F5QA 4Y5TA 3L9JT 1HV1A 1E5HA 2VQUA 1GFF2 1US2A 2BYVE 1YO8A 2VNVA 3RYKA 4B3NA 4XEZA 1E5SA 1W0OA 1NZIA 2X5IB 2VOKA 3AZVA 4LMFA 5FP8A 5FPLA 2RE9A 5JXGA 4XBQA 4NIAA 3W21A 3ME2A 1XE8A 1HW5A 2WAAA 2WZ8A 1RL3A 4EWEA 1UOBA 3NRUA 3O1VA 4Q4Y3 5C3OA 3WDUA 2WNUA 4C0HA 4IGPA 1OVSA 1VJ2A 2OX0A 5FZ6A 1BVP1 4IV3A 1ZRRA 2L9LA 4BXFA 3WLUA 1C3HA 5DDJ1 4HK9A 1AYN1 2HEVF 3ZFFC 2ZS6B 2AENA 2B46X 2JDUA 2JDKA 4QX8A 3SXWA 3UKNA 1JYXA 2ZMLA 1D0GA 2GNMA 1NCQC 3H3LA 4QDQA 5FAXA 4EN6B 2EAAA 3O14A 2Y8KA 4HETA 4HKOA 1CZVA 2BGOA 4P9GA 1MR5A 2Y6LA 2PLV2 2K0GA 5DQ0A 3AVSA 4QX1A 1N1VA 1J1TA 4EN9B 3DYMA 1Q8SA 1YIPA 4IV3C 3THPA 1JU3A 1VB4A 4CYDA 4YFWA 3M2MA 3O0WA 2C4XA 4P02B 2VW0A 5G04L 2E6VA 1TQ5A 3OBTA 2RS12 3IDEA 4FVVA 2QQVA 1FPN1 2R6QA 2A75A 4LHSA 3WW4A 4CA9A 5LCWL 1VBE1 4L0PA 4UFMA 1UZ0A 1V0AA 1W8ZA 1YC61 2XVGA 3LPGA 1RVF3 1WMEA 3U07A 1LESA 3OPWA 3TAYA 4OLLA 1IG0A 4OI4A 1LGBA 5FXZA 4TLFA 1LOBA 1HLCA 4JKKA 4I02A 1H9PA 1EY2A 1U5YA 3JUUA 4XQDA 1RGSA 2W9XA 3CO2A 4COYA 4GMP3 4AL9A 1UKRA 2F4LA 4RSUA 3RG0A 2VOXA 1S0JA 5JVVA 3VD9A 2OXBA 5LK5A 1VBC3 4K8FA 5DDJ2 4F7ZA 1OOPC 2PN5A 2XLFA 2A70A 2QNKA 5FR3A 1AF9A 2RS31 1YHFA 3N9MA 2QE3A 3JBG3 2UWBA 4ZZ8A 1XB9A 2CAVA 4EWAA 1O8SA 1XU2A 1QJX3 1RUNA 2MHFA 1Q8VA 1UYPA 4L9BA 4TLGA 5IWFA 1RINA 3HWJA 1PK6B 2C6SA 4XF0A 1RUI3 4AEKA 2VO5A 4FP3A 5FYCA 5J1XA 2H0BA 2JG9B 3VDDB 3VL8A 1QXRA 2BRTA 3TN92 1FX5A 3DCQA 2VVDA 1FPN2 1ZRCA 1R1ZA 5FZ1A 3WR0A 1VBE2 4K20A 1D4M1 4NHXA 2RV9A 4KBZA 5FP4A 1YQ8A 5FO8B 5I93A 2BPA2 3USSA 5FZ0A 3VDCA 1W3XA 5LY2A 1W06A 2W2IA 1MS0A 2P17A 3AX4A 5CFDB 4NAMA 4RS5B 3VZKA 4NIGA 2DV9A 3QOPA 3WG1A 5F6LB 5C70A 3OGRA 1F5JA 2BBAA 1A3KA 1GR3A 3KD4A 4OUMA 1RC6A 2WNUB 3R05A 4MH0E 2XLAA 4JGZB 5FOJB 2ORZA 4M4RA 1MEC3 4IEXA 1XRUA 4FOQA 4JVAA 1DYKA 2DTWA 2VMIA 4HG6B 3I2GA 5C5TA 2RS32 2VZ1A 3CL1A 1REDA 1RUJ3 3IWZA 4FXGB 5I0DA 4D6QA 4YYOA 1AX1A 2B42B 1NA1B 3GXUA 4HANA 4CUCA 5DUUA 1NUKA 1UPSA 1RB8G 3WUDA 3SKJE 2JEMA 4CDXB 5GZGA 3CZUA 5IAVA 1COV1 5L9VA 5ERLA 4I0BA 4MYEA 4AI0A 5FLIA 3BI3A 2PHTA 3U37A 1LNSA 4A2UA 2YC2A 1W6OB 3CKHA 4WM7B 1D4M2 1EPZA 4C90A 2R1BA 4E2QA 5LK7B 3T2TA 1TME3 2E7AA 3IN9A 3P3PA 2G9GA 2ARCA 4CEYA 2ETEA 3URFA 2VU9A 2LM3A 5EHDA 5FYTA 2VBBA 5F5IA 5EP9A 4M4PA 3BKZA 2YROA 2XVKA 3WG4A 1TEIA 2XJTA 3VBUC 3WINE 5FYBA 1JOJA 2YZ4A 1PX4A 1EYBA 1RUG1 1WCDJ 5FREA 2WZPP 5A3OA 2XUMA 4OUSA 3D6EA 1REEA 3AMHA 1O3RA 3LDKA 1KDKA 3SH4A 3V0BB 1JTZX 2R16A 2VM9A 4QU1A 3DECA 2OA2A 1KJLA 1BK0A 4Z2WA 4Z2AA 1ZRDA 1W8UA 1MZEA 3D0JA 4OVEA 3WHUA 2X10A 3KCYA 2C24A 1COV2 5KHIA 1UD1A 2GN7A 3AFGA 3BPZA 5TSWA 1S0CA 2VOWA 3PVBB 4NIHA 1MPXA 1ZX5A 5JXJA 2GP5A 3GJBA 3DF0A 4FBFA 4XYXA 3B9IA 5E88A 3N9PA 1WD3A 1XSQA 1SLBA 3LD8A 1CAUA 2BQPA 2CWMA 4QAWA 4XCAA 3CLPA 1EV11 1XYPA 5CZKA 1MVQA 1POV1 3ELNA 3E6CC 3WEZA 1H2NA 4CEWC 1UXXX 2OT7A 3KVAA 5GZFA 4XUTA 4ASLA 3WP4A 5JDBA 2BEOA 2GN3A 2ZX2A 3SHRA 1ND3B 1AR63 3U1XA 5HCHA 4AQ6A 1GMMA 2DVAA 2WSUA 1KS5A 3B69A 4Q0QA 4XFIA 1RUG2 4IDZA 4RD7A 4XZUG 2RDQA 4MGKE 3TOJA 4AVVA 1OKOA 1ST8A 4OHXA 2IXKA 2VQAA 4PLMA 4YG6A 2VXJA 2WLQA 2JE8A 2UU8A 5GJ6A 5GLTA 4DY5A 5FZLA 4NRPA 1QOTA 3BTZA 4UWDA 1S4CA 4AFBA 4BJ0A 2VQ0A 2Y64A 3HPNA 3MFAA 3P6BA 5DZGA 3VLBB 4ET7A 1QJEA 1LHUA 1SCRA 2LS6A 4MLOA 4IE0A 2MNGA 3BOPA 1H1MA 3K77A 1DZRA 3A21A 3MLKA 5C3QA 2DFCA 1G9BA 4CP9A 3FHQA 3GDBA 3Q8CA 4K6BA 1RMU1 5FZHA 5HI0A 1ULGA 3OPZA 2HKXA 1H4HA 4RHV3 1Z7S1 1EV12 3I3EA 3V64A 1UW8A 1WMFA 2QDRA 4HSJA 4IQPA 3H1YA 4AVBA 3TNQA 2J1VA 5IVCA 3DN7A 3NV2A 5K4LA 1ZM1A 4QXBA 5IFPA 3USUB 4QQ2A 1UOGA 1W0NA 2CY6A 1O3QA 5JIUA 4Q4W1 1VPHA 5HXVA 2JDYA 4PJYA 3IIIA 3SCGA 2ZA9A 3POJA 4X8NA 1N1SA 4YRDA 5FQ0A 3MW4A 5AVAA 5F5AA 1DGLA 2WQ8A 1GZ9A 4HKLA 4LEJA 1WW6A 4SLIA 2PAMA 4FOWA 2WFF1 1HXS2 2Q0AA 2QQIA 1LHVA 3ACIA 4Y1VA 2KM2A 5FPVA 5J98B 3VHPA 1Q3EA 2UWAA 2XWBB 1V9U1 4XMIA 3PDQA 4PDWC 3NKGA 5FV3A 2R30A 1KXGA 1LEDA 2JDHA 1OA4A 3K51A 1LOCA 2JENA 1AL21 1UMHA 1QY4A 3OJBA 1VP6A 4A41A 1MS1A 1IZ3A 3CF6E 4FPFA 2EIBA 2J1EA 3TWIA 2UWCA 2XJVA 3OBRA 3POBA 4D6SA 4KWUA 1CZSA 5JI9A 4CU9A 3AYEA 1YCIA 4K21A 4CUGA 4I3GA 4XFFA 3ZSEA 1RMU2 2A6XA 2XQRA 4GH4C 3N7LA 2WBKA 1X8EA 3MZHA 3S6PA 1WLDA 4RQPA 3ACLA 4YZ2A 1Z7S2 4GULA 4LBMA 4ZXKA 1AR71 4QPWA 4PT6A 4UBHA 1B35A 4RR3C 3SQOA 4OHWA 4Q4W2 1CAVA 3H3UA 3NNGA 2AYHA 1HRV1 2OUJA 4BU2A 3O1OA 1W9SA 2P3IA 4CCOA 2K46A 4RQPC 4XDOA 3GCXA 3OD4A 4IGOA 4QB1A 3WG2A 1D7PM 2WINB 3N35A 4X6QB 3VZLA 1LGNA 2P37A 2XWJB 4M3CB 1UOJA 1V9U2 3D0SA 3I7DA 4XURA 5FZGA 4MHRA 5B4XA 1NQJA 1YUDA 1OLMA 4AQTA 2AEZA 5IK5A 4XFAA 3MF6A 3BN6A 3O5SA 4BM8A 4GJZA 4LBQD 5EPAA 4JRLA 1LAJA 1U0AA 2WC2A 3POIA 1HJFA 4RGGA 1V6KA 3OY8B 4LBNA 4AQSA 1DP0A 1W0PA 3RI9A 3VBSC 1JYIA 3PIJA 5SV8A 2Y60A 2PLV3 3ZFEA 4AVTA 2WNOA 5ANQA 1N1YA 2VTXJ 5SV5A 5I91A 1YJLA 5EXOA 4JKMA 4ES8A 3IAPA 5AVPA 1J83A 1AVBA 1NY71 2AUYA 2VZOA 2ZPXA 4JX0A 2VECA 4XOGA 3ASIA 1IG3A 2MEV1 2RS13 4LR4A 1AR72 1VBD1 3LA3A 4ZPIA 1H1IA 5DAPA 5FZBA 4AHYA 5A32A 1JYNA 5IAXA 1V6OA 2R071 3U14A 4QGNA 4UW3A 3LGRA 5DPNA 3UETA 4D8MA 1JZ4A 4AVSA 3ACFA 3TBDA 2W87A 5J48A 3A4UA 1WKYA 2CGNA 5CU1A 3ZPYA 3MW3A 1K5JA 1HRV2 4AXOA 3OEAA 2DCKA 1GOGA 2Y6FA 4OUEA 4IXLA 1S1AA 5FQ0B 4QU2A 1SDDB 3KT1A 2RDNA 2P2KA 3M4FA 5BY5A 2GC3A 2ZCWA 1HRI3 1S0BA 2WZEA 4AE2A 4O61A 5FY9A 1CR7A 2HBTA 2X29A 4G9SB 5IATA 5KXEA 4EN0A 1GQGA 2ZHNA 4BIFA 4Q1PA 4LQRA 3T4HB 5DDJ3 3HR9A 4XACA 1H2MA 2DCZA 5T54A 4Y4YA 1YQ2A 2TEPA 2VVFA 2HWD1 2V72A 2C9KA 3AP5A 3AP7A 2OZ6A 4DY3A 5A3NA 3AZYA 3A22A 1H8TA 1W6PA 2CGPA 3VV1A 1PMHX 4RN5A 1KQRA 1W8FA 3IDBB 3MW2A 1NY72 1BBT1 3WP6A 1H2KA 2O0OA 3B94A 2VQTA 3NJZA 5FTTC 1NXD1 3FX3A 2MEV2 3TN93 2QQJA 1VBD2 2ZGSA 4C1WA 1DYOA 4HLTA 1YRZA 2R072 1VBE3 1OBNA 3N3HA 5L19A 1PM4A 4NIDA 4L8QA 1CAWA 1W8WA 3WQBA 1LCLA 4YVWB 4BISA 2FHRA 4IE4A 2ZEWA 1W90A 2OYZA 5DG2A 3V0AA 4Z07A 4YSFA 4E4SA 3BIWE 1ZREA 2BP6A 1WBLA 2ZGMA 5FK8A 3N4MA 4FSJA 1O8PA 2VXRA 5FZIA 2ZBJA 4Q4V1 4P5HA 3VBHC 4LBQB 1Y7BA 4NAOA 4UAPA 5H9SA 4HOOA 1SLTA 5LA1A 2VZPA 5D8AA 1XNCA 1GQPA 5F5CA 3ZN4A 1PO23 2HWD2 2WA4A 1SEFA 4J6GA 2D40A 3ENRA 4AG4A 4WBBA 4FAGA 2YDEA 1SPPB 4DXRA 3N9OA 1O91A 1FI2A 4JHZA 4AEDC 4XJAA 4R9AA 4PQQA 2XJUA 1UYYA 2R043 1BBT2 3WW3A 5C9AB 4ARXA 1OFSA 1Q43A 3H8RA 2PFWA 4BMEA 2WNEA 4GXLA 5H9RA 1D4M3 4LIUA 3RVHA 4AGVA 5DABA 3H3ZA 5KHJA 1J59A 2Q1MA 3PJQA 1XNKA 4IE7A 5LW9A 4KMQA 3WCRA 4AHZA 1K5MA 4BH9A 4B8EA 2PELA 5I0RA 4LHLA 1BEV1 4BA6A 3F2ZA 3PHMA 1SFYA 2J1SA 2UY8A 2Y34A 4Q4V2 3WV6A 1Z0HA 4BQ2A 2ZEZA 5ABJC 4I30A 5GLZA 4MGIE 5JIAA 4YGBA 4GWMA 4YW2A 3NNMA 3ZR6A 1LOFA 5EWSA 1DFQA 5EYXA 4KNCA 3G7DA 3LSEA 2BWCA 3BGAA 1H30A 5JUVA 3R4DB 2JDPA 5JSPA 2FDIA 2WKKA 3RZLA 4E27A 2BJSA 1AYM1 4TZDA 4DUWA 4Y1ZA 4FXKB 1NLRA 2VTFA 2XL9A 4NR1A 4QPIB 1COV3 4D69A 1SBDA 1LOFC 4YZ3A 3O7OA 1DQ1A 4LKDA 5A3MA 1CAXA 4CE8A 2VJXA 1ZNPA 5IYYA 3VN4A 3ZSJA 2RS51 2XHKA 4H2AA 2CDPA 1CAWB 1QJFA 3H1WA 5GM0A 3VDAA 3Q8EA 5E16A 4CDUA 4NWVA 1HQNA 3GM8A 3GF6A 4D7TA 3ZYRA 1NX9A 3V0AB 4YW5A 2Z5WA 1BEV2 4BQYA 3IDAA 1VBA1 1H6XA 5EJ1B 1QJU3 4YM2A 4PHZA 3T2OA 3NAPB 1C28A 3HIFA 1VB2A 5JPMB 5FUNA 3LA7A 2QZ3A 4Z8BA 2VBDA 2A73B 1JYTA 4JGYA 3K3NA 4OI0A 1LOEA 3H42B 3LKJA 4CUAA 1RUG3 4R8HA 3K4AA 2BDRA 4PLNA 5CBLA 3ATGA 2I2SA 1TZOA 5FPZA 1AX0A 2CL2A 1GZTA 1URXA 1CX4A 4NMIA 1RUD1 1L7QA 1YEWA 3LOIA 1RUF1 4QQPA 1ACCA 2JWPA 1WBFA 2WL1A 1LODA 2Y38A 2YFZA 1BCXA 3OGGA 2ZTNA 2J1AA 1S0GA 4LBOA 1PVC1 1SLIA 1X36A 1MQTC 3LEIA 3FZ3A 5DAXA 2PYTA 2HEWF 2YHJA 3HBKA 4FPJA 2RHPA 5BNPB 2RS52 3A7QA 3QH7A 1YQ6A 4NPRA 3KGZA 4QXHA 1FNYA 5BNOC 4CDQB 2DVGA 3ZMOA 3BALA 1U5XA 3WQ7A 1NCRA 3LZZA 5C4WB 1GU3A 1W8HA 5BNNB 2N7GA 1Q8PA 5FO9B 1RXFA 2ILMA 5IK4A 2OVUA 1WW7A 2DCJA 1POV3 3CIHA 3MIGA 1ULFA 1VBA2 1JZ2A 3VBOC 1F35A 1RUE2 4DRVA 5FZ7A 1B09A 1QHDA 4LUMA 1HDKA 1NE4A 1DQ5A 3ZX7A 2GMEA 3VD7A 1ZZBA 2RJ2A 2CU5A 4MV2A 2IC1A 3BUCA 1M06G 5DG1A 2YYOA 3ZN6A 1LTEA 1GUIA 3MBWA 5CB7A 1BHGA 2FDJA 2HWF1 3MLJA 3T2QA 1HXS3 2BVVA 3VBFA 2P1BA 3A0NA 3ZDSA 3ZFGB 1A34A 2V5YA 2K9ZA 3R4SA 3CDZB 1RUD2 4HONA 4WVMA 1RUF2 1KFXL 4P00B 3K2OA 3NNLA 2IVJA 5I0TA 5LBEA 2WNVB 4WZCA 2WO2A 4NRQA 3U78A 3RZHA 1PVC2 2TNFA 5FRAA 2ERFA 4N43A 3WDYA 2PHRA 1O6UA 4QKBA 1GZWA 1OC1A 4WVWA 1Z78A 3T0AA 2JDAA 3VBFC 3C7EA 3GCWA 4Q5OA 3WNLA 4S2GA 4Q2FA 3KF5A 1IS5A 2IZWA 4FOVA 5JSOA 5F2SA 1FXZA 1XJAA 3IPVA 3OCPA 5K7PA 3C3VA 4QPYA 2QTWB 2W92A 3HT2A 1RMU3 4UOJA 2EF6A 2LW8A 1OHFA 5A3TA 4YVSA 1Z7S3 3J7NA 4KGQA 3ACGA 2ZGKA 4PI2A 5FZOA 2BBVA 4AI1A 2PHUA 1UQXA 2TUNA 4M00A 1R1A1 2EICA 4R9DA 2DWRA 4XFCA 3H8UA 4QPGC 1GLHA 4LO8A 1H8VA 3EBRA 4Q4W3 2RG4A 3UL2A 5LZ6A 1PO11 1W8NA 1ZVFA 1NT0A 4GAZA 4COVA 4CU8A 1OLQA 4QWNA 4W50A 5GLUA 3RGBA 2XHNA 3T1MA 5IVVA 4S2DA 4AEMA 5FKBA 3AFKA 2SLIA 1OQ1A 1LB2A 1DBNA 5HPOA 1AR93 3U4SA 2RMU1 2VZRA 1UY4A 2Z42A 3J8F1 1LRHA 1JHNA 4XJ9A 3KWVA 2VOTA 3GZUC 1G9CA 1JOPA 2XKPA 3ZFFA 5JOYA 4AHWA 3KMHA 5FCCA 3J7LA 1PZ7A 4KG8A 2XJSA 1NCQA 5ACA2 1PGL1 2NLRA 1YLLA 2ID4A 3WP3A 3WHTA 1R093 5GLWA 3SLIA 3IKWA 2JD4A 4AWDA 4XJZA 2FZ1A 1WD4A 2A3WA 3JU9A 1F31A 1SZBA 4D7SA 1VBB3 2DCYA 2VMHA 3AM2A 1AR73 1QXPA 5K9YA 5FBJA 1CVNA 1JS9A 2BFUL 2J22A 5CFCA 1I1EA 4BIOA 1R1A2 1C8NA 1NOVA 3J7HA 1S2EA 4HT1T 3RPQA 5K0UC 5K8SA 1PO12 3AP4A 2GZWA 4CZSA 2VMEA 2WRAA 2Y0OA 1HRV3 2ZGTA 2JG9C 3AYAA 3N7JA 4IV1B 2VMFA 3KSCA 3VDDC 1G9FA 4EJRA 5L73A 2ZX3A 3IB3A 1UOFA 1A6CA 2H6CA 3QH6A 4UF0A 2CDOA 2NQYA 1GOFA 3KV9A 4OCTA 2EAKA 5FYVA 4YZ1A 5CFCC 1J3QA 4CCJA 3WNPA 4Q1RA 2VUCA 3LOBA 2RMU2 1XBFA 4M3CE 5FMCA 4Y24A 5CFDC 1YFYA 2F4PA 3J8F2 4N53A 4RS5C 4Y1UA 3I54A 4CU6A 3E5UA 1IS6A 4HL0A 1OOPA 4MGQA 1OURA 3SCFA 3KV6A 3OD0A 1DCSA 3OG2A 2J1TA 4C91A 1GYKA 4N9HA 5A7WA 1PGL2 1UPIA 2G9ZA 2EXHA 1UF2C 5D2AA 2YB7A 3P3NA 3IPVB 4OI2A 3VKFC 4N53C 3OYWB 3T2PA 4F83A 4TYSA 2WSVA 3HT1A 3MV11 2MEV3 1OMIA 3M70A 4I01A 1AYN2 4EZ4A 4Y5SA 1JYWA 1C1FA 2R073 3J9SA 4NROA 2GNDA 5T3NA 2WS91 4KH9A 1CPMA 1HQWA 1PIV1 4HN0A 4CDXC 2NMNA 3KCCA 3MIEA 1J1LA 2YBPA 1S0DA 4RFRB 1KDMA 1V6MA 3VBRB 4PCRA 4XFHA 2J7MA 1UZYA 4BDVB 3WZ1A 5F2WA 3R4UA 5C7GA 5JZGC 4V1PA 2QFEA 1PGW1 4ORFA 1CZTA 3AXDA 3VD5A 2HWD3 5KHKA 4CCEA 4CCDA 1ALYA 2IXHA 4M01A 4QD2A 2RM23 4FCAA 5BNQA 1YFXA 5L9BA 3HOBA 3ZXAC 2A3YA 1F2NA 2Y26A 1WCUA 4B7EA 1CD3G 1BBT3 2W1UA 3R0RA 4IW3A 4IV3B 4DXZA 4XAEA 3BVCA 1ULOA 1ZRFA 4MGTA 1MZ5A 1X7NA 2QBXA 5L36A 2WS92 4XZPA 5F3CA 3UESA 4PIXA 1PIV2 2DUPA 4CXYA 3EQEA 2BW8A 2X09A 3D3AA 3J26N 4BMBA 1Q8OA 3HEIA 1E57A 3MIFA 4P9JA 4XBNA 4YM1A 3DPRA 4IE6A 4BXSV 1CESA 1KEXA 4NVPA 4NE9A 4Q4V3 3BTYA 5JMCA 2HWB3 1ZRIA 3VDBA 1HB1A 2AZ5A 1O4YA 4D94A 3LEKA 4HVRA 5DAQA 3MFCA 2XONA 3NKTA 1PGW2 1WZXA 4R4XA 4B4RA 1JYVA 2F17A 3BU7A 1X8MA 3VBUA 4Q4X1 1CJPA 3DPRC 4ISQA 2JDZA 3EJKA 4QKDA 5A7PA 5J37A 3ZPOA 4QHOA 2X53S 1SACA 1IGOA 3HVDA 5A7WB 5HCAA 5BPXA 3TNPB 2WLPA 4K7JA 3ZYFA 2RDSA 4DXTA 4LO5B 1VMJA 2PHXA 2YC0A 4YGCA 2A71A 4GWNA 5L7OA 4CXWA 1MVEA 1BZWA 5EYYA 1J84A 1ULDA 4XVHA 4H3WA 2C26A 4ZONA 1GOHA 1ZBE1 1F5FA 3FE5A 4BZ4A 3IAQA 1EUTA 2YGLA 4LULA 1W8OA 1XNAA 2LTNA 4EN8B 3GALA 2WFPA 1QF3A 4HVOA 4ATFA 2JG8A 4WV8A 4E4HA 5C3RA 3ZYBA 3ZR5A 5L7OC 1OA3A 2HEYF 1PZ9A 2C1FA 3BTXA 2SBAA 4U36A 4BQ1A 3E5QA 3AKPA 1BEV3 4UFJA 3MPBA 1DQ6A 4LNVA 3N7MA 4YLZA 2W39A 3A23A 1A8DA 4CEWA 3WDVA 3P1IA 4JC1A 2PQSA 1R081 2ZXQA 3NNJA 1ENSA 1XYOA 2JG8C 3JCIA 1RUH1 2VW1A 3PVOA 4Q0SA 4XFGA 3MIHA 4Q4X2 1UYZA 4E8CA 3PURA 1PMJX 5LRSA 1DZQA 2GU9A 1PMIA 4MOAA 1MZ6A 1HV0A 3ZM8A 2KXLA 3MIBA 2NP0A 1FMD1 4HN1A 1A8MA 4J25A 1EPWA 5A3LA 2OW4A 4Y20A 2C5DA 3GBFA 5F6KA 2WWJA 2BOIA 1UIJA 1UX6A 4QXCA 2QJVA 5FY5A 1QH7A 3E1F1 4FPLA 1QOSA 3TRSB 4MO3M 4JDMA 4AAXA 4OZOA 5I8YA 2AGSA 4ZU7A 4JAAA 1I9RA 1C8M1 4DNYA 3RZJA 5CNAA 2GALA 1T6GC 1OI6A 1QH6A 1WA4A 4XETA 1N47A 3UGFA 1UN1A 3RS6A 2JB4A 3K75B 1Y9MA 1AUYA 4BK4A 3AMQA 4COUA 1VBA3 2DU0A 2IVIB 3OEBA 1RUE3 5JLVA 2WN2A 3MLLA 2HYKA 5CKMA 1W6MA 2HWC1 1R082 2D6MA 1D2QA 3C2UA 3BB6A 1RUH2 5A70A 5KXCA 4V2WA 2WQ4A 4IEOA 3INAA 1W05A 4L2NA 3LIGA 3TEYA 4YGDA 2UURA 1W9FA 4Z82A 3WW1A 1S0EA 1DDLA 2ZMNA 1RIRA 1Y9QA 4ASMB 4CCLA 2D6NA 3PU8A 4RL7A 2GMMA 1RUD3 3JB8A 4CEYB 5FYYA 1EAH1 2ZAHA 2R49A 1FMD2 1G9AA 5F39A 4NPMA 4PDWA 3B5LB 5CVRA 5FY8A 4YGEA 1J3PA 5GZDA 1FV2A 1HN0A 2WABA 2XKOA 5B2GB 3LDRA 1J3RA 3FFQA 4YFZA 2Y33A 4Y33A 4DEVA 2FDHA 1BVVA 1ZZ8A 2ENRA 1GWKA 4FFHA 5E1RA 4AF9A 1WA6X 4IESA 4S2FA 2JXAA 1C1LA 1VAKA 4YW3A 4EQVA 2OQ7A 1UY0A 2Q5TA 1HB3A 5LWBA 4GH4A 1V6IA 1N3QA 4QGMA 4H14A 4ZS2A 2VOVA 2WR9A 2QQWA 4QHZA 5KC6A 4GALA 2VE1A 1HKDA 4M0HA 4MGYE 4N8MA 4Q0UA 1AXKA 4RR3A 4GB31 5FZFA 3PVEA 4GIQA 2P34A 4BQ3A 4AQ2A 2XBO1 2WIIB 3ZKYA 2DTYA 1GKBA 3QACA 2E32A 3H0OA 3PTYA 3ZIXA 4AFDA 1QQP1 2QQNA 3KVBA 3JD73 3Q8AA 4IERA 5JPNB 3HNBM 1MS9A 5DZFA 4E2GA 1CAUB 5IK7A 2KR2A 1EAH2 3C8XA 3VBOA 1JMUB 2K2SA 5LBFA 3M3OA 2R1DA 1DU3D 2PAKA 1OSGA 4GJYA 4Q8KA 3I3MA 4WM8A 5FIXA 3RWKX 3LPFA 4HPKA 4BB3A 2ZX0A 3WDWA 3UGGA 4XXPA 5ACA3 5FYZA 3K3OA 2WFF2 2WYFA 4IEUA 1SCSA 3VBSA 3NV1A 4D0QA 3AZXA 4DINB 2HYXA 2WQZC 3MDPA 2I07B 1I3HA 4UBGA 1AR81 1Y4WA 1W04A 2D43A 2WO3A 4Q0VA 3PMEA 1RUOA 1I6XA 4I0WB 1DQ4A 3AKTA 2ZAAA 2ZEXA 4JDNA 4WM8C 5GZEA 4KWKA 3RZZA 1AL22 4O9EA 4XW3A 4CXXA 4DMIA 1R1A3 3DYOA 2HJIA 1EP0A 3B7MA 3BCWA 5EZWA 4XIKA 3HD8B 1OT5A 1BYHA 1POQA 2DU1A 4P9WA 1PO13 4LITA 4GB32 3KHCA 2LALA 2EXKA 2OS2A 2XG3A 2O14A 2XBO2 4GQ7A 5J36A 1SFPA 4CP9B 1QQP2 3B01A 3NNFA 1IPJA 1D4VB 1ENRA 4AI9A 2V09A 1YQ5A 1IQDC 1YFUA 3AMMA 1SBEA 2D98A 3NJYA 4HZFA 3NQHA 4UYBA 4XTMA 2D6KA 4ARYA 4A6OA 3J8F3 5FLJA 4AFAA 2HWE1 1OH3A 2XLGA 3RQ0A 5C71A 1XQNA 2C9AA 2Y6HA 5C33A 1WLCA 4GMP0 2A7AA 1HIXA 3TEZA 5FK7A 3ZSLA 4GMP1 4HFSA 2B39A 2PHLA 1DGWX 2JE7A 2YY1A 5DAVA 2QZ2A 4AI8A 4OHYA 2VCBA 3N7KA 2BFUS 3SCHA 5KHGA 1AR82 2E7QA 1VBC1 1DHKB 5FYMA 1JUIA 1AYN3 4PF5A 3TYJA 3MICA 2BNMA 3S7IA 1X33A 3WXPA 5JAXA 3JBG1 5FPUA 4KWLA 1X9TA 5DUXA 3FBMA 4FI9A 2ZHLA 2B8MA 3MV01 4Q27A 4WVZA 2EIGA 4INDA 5C9AC 1SDWA 5I0SA 1OQEA 4AR2A 1XNTA 3LF7A 1W39A 4LO7A 4C0BA 3SITA 1S0FA 3SKVA 2R061 2VGDA 3NW4A 4RGKA 4B4PA 1KFUL 5FYSA 4ES9A 4RQPB 1S0IA 5C3PA 1FPN3 2EALA 3OUHA 4BOWA 2D3PA 1GANA 2DUOA 3C7OA 3F95A 3GZEA 4FTEA 3M8LA 2XUEA 3K4ZA 3VBHA 5FYIA 3ZDVA 4Z1VA 1B35B 2HWE2 4CSWA 5LBBA 1IKQA 1WW4A 3IIAA 5BV6A 4IEWA 4XTPA 1XXNA 3WX5A 4EZHA 1CAVB 4NPLA 1K12A 4FPGA 3AMNA 2W94A 4EWDA 4OQ9A 3OTFA 4C1XA 4TN7A 5DUVA 4XJ8A 3VBSB 3ZIWA 5CG8A 5FMBA 5IUQA 1ND2A 1CPNA 3ZOIA 4AEDA 3RWNA 4BK5A 1CJDA 1VBC2 1KITA 2WAOA 4FOYA 4NOTA 3AZWA 5CIRA 3O1MA 1OUSA 1C57A 1S55A 1WLTA 2YU1A 5FY1A 1ZA7A 2C0ZA 3FC0A 4CDWA 1FATA 1S2KA 5T5PA 2ATFA 2QKDA 2RS33 3RFRA 5KC5A 2ZGNA 5F9TA 2WS93 5H9QA 4BPZA 3Q8BA 2UYAA 2OZJA 1PIV3 2ZX1A 3ACHA 4QPIC 2DF7A 2AR6A 4DZGA 2XR4A 4OI1A 1ND2C 3ZFEB 5C8CC 3D8CA 5FWEA 1QXJA 5FYHA 3ZXGA 5AFEA 1W6NA 1SFNA 1UX7A 2BGCA 3I2HA 3TEXA 1ZYBA 3PTRB 4Y22A 3M7AA 2R062 3WG3A 5E89A 4CDWC 2YUEA 4QX7A 3ETPA 1K45A 2H6BA 5F3IA 4BLJA 1W6QA 5A32B 5ABJA 3VHNA 3RMXA 4MXWA 1PX3A 4JTNA 4KL1A 4RYDA 4EROA 1W03A 4LK6A 2GC0A 4BYYA 3E5XA 1UY3A 3GZTB 5F8PA 3WQ1A 3ES4A 4CP2A 1LR5A 3NV4A 3LE0A 1US3A 2D6OX 4P14A 4QX3A 3N36A 4GA9A 4XMAA 4CU7A 2F6BA 3NAPC 4XXAA 5HV4A 3LB9A 1O3SA 1WGPA 1SQ4A 4OULA 1FAYA 2PHDA 1BXHA 2GAUA 1PM7A 4ZHNA 1CX1A 3UKVA 1OPMA 3ZXLA 1VMHA 1KGYA 4H55A 5FXVA 1YIFA 2CTVA 4L11A 2BV4A 1BMV1 5LBCA 1L7LA 4RA0A 4CTEA 1VRH1 1IOAA 3CEWA 2G19A 3MPPG 5GZCA 1P8JA 2VAUA 4LBKA 5A1FA 2X8KA 3M3IA 2WT2A 4YW4A 3SEEA 1SMVA 4CP1A 2BGPA 3S5QA 3MGUA 4QB6A 3FFZA 3ORJA 4DOUA 2VY0A 3RZKA 1H8TB 3T09A 1W6PB 2ZHMA 4HK8A 2WJSA 2A6ZA 5LASA 2JDNA 5JR2A 1F4AA 3T1LA 2IXLA 5BNPC 5M0TA 3WF1A 3WUCA 3HQRA 4CPBD 1WMXA 1NG0A 2CV6A 1UZZA 3AZZA 3B93A 3BOWA 3IMNA 1APNA 1BLZA 3KHBA 1CONA 4JDOA 3JZVA 5T5OA 3AC0A 2P6HA 3T08A 5DXDA 1MZFA 3SISA 1RHI1 4NJ4A 2ZGPA 4Q4X3 3LDBA 2XJQA 1NE6A 4LUKA 2V4AA 5DUWA 2AREA 4OQ8A 2V5DA 1W2OA 2YV8A 3ILNA 1K3IA 5CA6A 4NHMA 2TBVA 3U0ZA 5EIYB 1LEMA 2Z69A 4CCKA 4IE5A 3Q9OA 4FFIA 3BU0A 3IMMA 2JKBA 2YC4A 4NHKA 1N1TA 4AEDB 1BMV2 3CJIA 3VL9A 1VRH2 3W20A 3ZFGC 3O0XA 3GHNA 4I3PA 4XDPA 5D8AB 2IFRA 2OQ6A 1MQTA 1W8TA 4L97A 2KA3A 3N9QA 3VD4A 1GZCA 3ECQA 4QQHA 5LATA 4OHZA 4MUVA 4AAPA 1W2AX 3N9NA 4XC9A 1QDCA 2WNVC 3DKWA 3AP9A 4IEZA 4QMAA 5BNOA 4HSLA 4J1WA 5FKCA 2R0HA 1AYM2 4Y1XA 2YBSA 5LA9A 3CJIC 3RDIA 4C8DA 1AZDA 1A78A 3DXUA 3CZJA 4QX5A 4Y22B 5CISA 1AJOA 5A7QA 3W5MA 4ZU4A 2ADEA 4FPKA 1E5IA 3Q8FA 1W28A 4YNIA 5ABJB 5A33A 1RHI2 2OPWA 1XSRA 1NLQA 5FO7B 4DB5A 2GNTA 4RHV1 4AVAA 1GBGA 2IWGB 1EV13 1SLAA 1C4RA 1K5MB 1ULCA 2XDVA 2ZGOA 3NV3A 4LOTA 4NN0A 1GP5A 3CJXA 5KXBA 2X5IA 1QGLA 4W4ZA 4R9BA 1DZTA 3WF2A 3WNOA 4AI3A 2Y0IA 1LOAA 4FO9A 1ASJ1
chains in the Genus database with same CATH topology
1OFNA 4FQ4A 5BYNA 4HMZA 4PIZA 3ST7A 1O5UA 4LO4B 2I74A 2RJLA 1OLRA 2ZHKA 4FPYA 4QQLA 4JCKA 1BK1A 2X5IC 1DQ2A 1LJ7A 1UMZA 3VHRA 3MIDA 3WVJA 3ZVXA 1I5ZA 1LHNA 4L92A 3ZYJB 3SH3A 3TB0A 4QPGA 1CAXB 1IQAA 1PNGA 2E51A 2QCSB 2H0VA 3D5OA 1UIKA 3I2DA 1LENA 3NVCA 4CDUB 3WOGA 4RHV2 2Z2SB 1XNBA 4MX3A 4RFT0 5AC91 3ZXEA 2NM1A 3AK0A 5CG9A 2GC1A 3SMHA 1EAH3 1O3TA 2A6YA 3GYDA 4IV1C 2NMOA 2PQQA 4AGRA 1LU2A 4PBPA 1ASJ2 4IETA 3ILRA 4XIOA 3ZN5A 3EHKA 3POYA 1IKPA 3M3CA 3H9AA 2VNOA 1D0HA 1ONAA 2HWF2 3H1MA 2WFF3 4I0AA 4IEQA 4JGYB 1ZZ7A 4QHBA 3AYDA 3E6DA 1V9U3 1ZZ9A 1DG6A 2WT0A 1GSLA 3R6SA 2ZGLA 2EVXA 2RJKA 2E9QA 2OPKA 1AL23 4XF9A 4HBNA 1WUVA 2DCTA 3S7EA 3U4XA 3MEPA 4NO4A 1WCSA 1CQ9A 2PLV1 4GB33 5K0UA 1PVXA 3BODA 3FJSA 2XBO3 2ZZJA 3AKRA 2JG9A 3VDDA 1QQP3 1NCRB 1V6LA 3GZAA 2RS11 5AC92 5J09A 1H2LA 4J1XA 2ZGUA 2W0XA 4PBOA 2DUQA 2CWSA 2UYBA 4QM8A 4RS5A 5CFDA 1PK6C 2GSYA 3WP5A 4W6YA 2ZKNA 3AP6A 3VBRC 1VALA 2CGOA 3ZN6B 1HRI1 4JGZA 3VBFB 1AX2A 1WW5A 3KGLA 4COZA 1AR83 3RI8A 1Y43B 3GBWA 4WVMB 5JOXA 1MS4A 1Q8QA 4A7KA 1NQDA 1C5IA 4I09A 4R9CA 4R52A 4LT5A 1FNZA 4UW5A 1OKQA 4N43B 1NA1A 4E4ZA 2WNUC 1UKGA 4JGZC 1VLNA 1REFA 1GZWB 4KBBA 2P3JA 4QPGB 4XQWA 4Y1YA 2BNOA 3EO6A 4CDXA 2DVDA 2B45X 2ZGRA 3FHIB 1LULA 2UY9A 3TN91 1W6OA 4WM7A 1VBD3 4M3CF 4YVSB 2DVFA 1NA1C 4LHNA 4M0NA 2XPJA 2HWE3 1DIWA 3VUOA 1Q5OA 3AKSA 5JZGA 2W68A 1DF0A 4P9LA 5F1RA 3ILFA 1HRI2 4WM7C 2BNNA 3V65A 4AFMA 4YARA 1V70A 3GNEA 4CP0A 1C5HA 1H9WA 3RJRA 2B9UA 3HN1A 1PO21 2VVEA 1H0BA 3PJYA 4JRAA 4OHVA 5AFBA 2NZ9A 4XE9A 3ZFFB 4P9XA 2VUJA 1LU1A 4WVVA 3V0BA 3KCXA 4N7IA 3VZOA 1NCQB 4AEJA 1PZ8A 5K0UB 3EXUA 3LAGA 2D7FA 2R041 3W58A 2D3RA 2R063 1NYWA 1G8WA 4H7MA 4IEPA 3POWA 2GC2A 5CFCB 4QXKA 3JB4C 1KJRA 3ROUA 5LEJA 1AJKA 3FUQA 4XPVA 1UU5A 4OFGA 1VAMA 5H9PA 1S2BA 4I2OA 5LRRA 3BTAA 3OGJA 5JOWA 1ND3A 5J3UA 3VKNA 1QDOA 1UCXA 4K3UA 1G7YA 4PQ9A 2GNBA 2ZABA 4N53B 3B3QE 1PO22 4A7YA 4IEVA 5T50A 2O8OA 1OOPB 2E63A 3D4KA 5T5LA 5FMOL 3VKMA 3AKQA 2G9FA 3MF9A 4ATEA 1ND3C 5GALA 2R042 5KBFA 3WDXA 5I8SA 4X8PA 3VHOA 2YPJA 4CRQA 4QT6A 3B9CA 2GH8A 1LHOA 2QUOA 5KHHA 1ZBA1 3KS7A 1DLLA 1O4TA 1N3PA 1IPKA 2PHWA 2CAUA 2Q4SA 3KM5A 4G3YC 4DFSA 3E6BA 5HBAA 5JZGB 3O0VA 4LTAA 4F8AA 4G4FA 4BLIA 3USUA 2ARBA 1QJU1 3U10A 5IT6A 3UJQA 1YFWA 4E9KA 2WZR1 1QOOA 3UV9A 1AHSA 2EXIA 3WD5A 2JE9A 2P3KA 3QCWA 3ZSKA 4AFCA 1DGRA 1VRH3 2LUWA 4XF3A 1FOD1 4LO6B 4PLOA 1H1AA 4CEYC 3H7YA 4KU8A 3VZJA 1ZA4A 3W9AA 2VULA 2D6PA 2VH9A 3D82A 3FWEA 1AYM3 3AYCA 4IL7A 1J58A 4DPNA 2A6WA 2B5HA 4ZKTB 1IHMA 1DYPA 4NWWA 1ZBE2 3SNMA 1ZBA2 3WW2A 3ZXDA 4TSVA 3UKTA 2RS53 3ZO0B 3HMYA 1WCKA 1RHI3 4N90A 4UW6A 3HQXA 3KB5A 3LWCA 5GKAC 3O12A 2AH2A 1POV0 1H4GA 4Q0PA 1YI9A 3DPRB 1QJU2 1XU1A 2WZR2 4FPEA 2QDNA 1TMF1 2FMYA 3HAGA 4DRRA 3KZ4C 4O9GA 1FOD2 1SLCA 1VR3A 2B7YA 4Q8LA 2ZJCA 3RJ2X 4BCUA 3I4IA 1HXS1 4M3CA 3VBUB 1JBCA 1JYCA 4JV4A 2XJRA 4NHLA 3WDTA 2VMGA 3AMPA 3VKLA 1XE7A 1RUF3 4KWJA 3VKOA 1JXNA 1RUC1 1YXWA 3I59A 2G4IA 2RR11 3L2YA 1LOGA 3OY8A 1PVC3 3MI8A 5L7OB 1PGSA 4HKWA 4KQ7A 1BQPA 3VGIA 5DZEA 2E7TA 2PTMA 1C8M2 4YG3A 4XFBA 4MSVA 3DGTA 4BHPA 1LHWA 3U11A 1M4WA 2JG8B 2NN8A 1IS3A 4L99A 4D7YA 1OD5A 1QJY1 2A5ZA 4W6WA 2XL7A 1RTVA 4P9IA 3IBMA 4YM3A 3ZXJA 1TMF2 1XNDA 2ZOEB 1ASJ3 3FLRA 4AYUA 4CEWB 3VZNA 2BUKA 2HWC2 4K9SA 4YM0A 2VW2A 2VUAA 3ES1A 2E53A 1F8VA 2HWF3 1ENQA 3FMGA 4ITCA 3IM0A 3AJZA 1AR91 3WT3A 5HCFA 2IFWA 4FPCA 1AXZA 1ZZCA 2GMPA 1RUC2 4LBLA 3W59A 3WY6A 4Y20B 2RR12 1MS5A 5J7MA 1QNYA 2ARXA 4FPOB 1R091 2ZGQA 4Q4Y1 4LHKA 5JR7B 3FUOA 1QWRA 2WT1A 5BUVA 1OPOA 5D1IA 4GKXA 4B7KA 2PHFA 1VBB1 1V6JA 1PHMA 5AC93 1QJY2 3ZYGA 1TNFA 2ZMKA 5EJ3A 4QM9A 4Y26A 4ZU5A 4YVWA 4U2AA 2A6VA 3DUIA 1NLSA 1GV9A 5T55A 4ISRA 1W6MB 2YGMA 5C6CA 2CNAA 3OF1A 4YW1A 4KGGA 1YYNA 1FV3A 4AHXA 2BVBA 1B35C 1AR92 1FYUA 4LBQA 3ZYRA 3B02A 4YVWC 3M3QA 4FQZA 4E2SA 2RMU3 2QVSB 3WQ0A 1RVF1 2JX9A 4PDWB 5E8AA 3I59B 3GHMA 1U5IA 1YJKA 5EFUA 4B29A 3PLQA 4QQOA 1JN2P 1R092 3IT8A 4Q4Y2 4X6RB 2VNRA 2WA3A 3RSJA 4XJWA 5C9AA 4W65A 1VBB2 3QBQA 3QLQA 1QU0A 3FLTA 5KWRA 3H7JA 4GH4B 2JICA 4A7ZA 2PA7A 3ZFEC 4GKYA 1LKNA 5LEKA 2IXJA 1QJX1 4RR3B 3RYRA 1CGPA 1RUI1 1ZZ6A 1CN1A 4P9YA 1V6NA 1XYNA 2GDFA 3JQWA 3RMYA 1U5ZA 3CNAA 5JI7A 4FPHA 1RVF2 3VBOB 5JOZA 1CIWA 1OQDA 3QD6A 3L2HA 4WM8B 2RM21 4LLOA 1N3OA 4HPKB 2OIIA 4QPIA 4YZ5A 4B4QA 1LECA 5C8CA 4FTSA 2YMZA 5FDBA 1MEC1 3S30A 5FPXA 1DGRN 4FTBA 4MGZE 3J4UH 1RUJ1 3JBG2 3LCPA 1H8TC 4XBLA 3ALQA 1UL9A 1QJX2 2R0FA 2FBEA 2NPIA 2VPVA 4META 2ZKLA 4WZFA 3FBYA 1RUI2 3NAPA 2ET7A 2IXIA 2HWB1 2W08A 4H7LA 1UU6A 4AK3A 1Q56A 3ZXKA 1DQ0A 2VNGA 4Y5Z0 4Q29A 2FZ2A 1KRIA 1TME1 4FAHA 3K48A 2DURA 2R32A 2JECA 4LE4A 1AL0G 1O4ZA 1GNZA 2D97A 2RM22 4XDQA 1U12A 4S2HA 3NWKA 4F3JA 5FFOC 1UU4A 1NZCA 4EN7B 2QQPA 1QNWA 5JWPA 5D8AC 4LA2A 1G86A 4BE3A 1MEC2 2BTVC 2A3XA 5BNPA 1FT9A 1Y3TA 2D5HA 2D5FA 2GH2A 2W52A 1W2UA 1YNAA 1O5LA 4CDQA 1RUJ2 4QGLA 2D44A 4XHXA 5I0UA 3RYPA 2DVBA 5IK8A 5C4WA 4LE3A 5BNNA 4TWTA 1MS3A 3ZMNA 3M1HA 5T52A 1YI7A 5JCTA 2HWB2 3G6JB 3AB0A 3PVNA 3ZSMA 4CDQC 1X82A 3NO8A 3ZYPA 4K1YA 3POSA 1SLLA 3DV8A 5T5JA 4AI2A 1O7FA 5C4WC 3X29B 5BNNC 3VBHB 4KU7A 1TME2 5FMOS 1K5MC 3ZFGA 4YZ4A 1GNHA 5BXXA 1OA2A 1RJ8A 2O1QA 4LLFA 1QJZA 3I8TA 1JUHA 2WNVA 1SBFA 4COWA 4AW7A 4E4DX 1RITA 3M3EA 3H50A 2XB6C 4LA3A 1ND2B 4JQRA 5C8CB 1AR61 1QKQA 4N9IA 5FLHA 4Q26A 4OZXA 1ZBE3 1ZBA3 4CDWB 1ENXA 1F9KA 4ONUA 1HQLA 3V56A 3GBGA 1BKZA 2ES3A 4XF1A 2Z79A 5J96B 4Z92B 3IDCB 3KT4A 1RUE1 1W6NB 4DQAA 1D2SA 5KXDA 1GQHA 4JTOA 2WZR3 3FLPA 5HCBA 4CDUC 4R4ZA 1R083 1W6QB 1FOD3 3ZYIB 1RUH3 4MVTA 5FOBB 3B00A 3AXEA 4MXWB 2DFBA 1VIWB 2XVLA 4XF4A 3UK9A 2D6LX 3UJOA 2ZX4A 5EV7A 1WLWA 2D93A 2Q8OA 1GICA 2YXSA 1DGWA 3CU7A 3KQRA 5C8WA 1G6NA 1KS4A 3ZXFA 1FMD3 2MPFA 4K1ZA 4UW4A 1V00A 2CYFA 3PMSA 4JGYC 3MYXA 3WCSA 4AGGA 1AR62 4MZUA 3S0MA 4AVCA 1RJ7A 4FP2A 2I45A 3KT7A 1G9DA 3AJYA 4RGAA 1TNRA 2FQPA 1C8M3 2ZZQA 4PIYA 3APBA 3PNAA 3JQXA 4BWOA 4XQ4A 4SBVA 2FMDA 1KD7A 1TE1B 4DS0A 5I8TA 4K40A 1WMDA 4YG0A 3NSTA 1TMF3 4IV1A 1HX6A 2HWC3 1ULEA 1NCRC 2NYYA 1L3JA 2XJPA 5CAZA 3DL3A 2O8QA 3JD71 1AXYA 3WNXA 3ETQA 4LBJA 1JW6A 3RNSA 1BJQA 4A3XA 3A0KA 1VAVA 3THTA 1RUC3 3LA2A 1UAIA 1IS4A 1LGCA 4XILA 1X50A 2RR13 2XH6A 4FT8A 4KG0A 2XGXA 4XJUA 2ZACA 3CJIB 5ACA1 2EXJA 4W6XA 3SH5A 4URTA 4D3WA 5FBZA 1YWKA 1MQTB 3E97A 2ET1A 5CADA 2Q30A 2V73A 3OYWA 2BWAA 2EA7A 1NXMA 4IEYA 2IXCA 1QMJA 2PAEA 2DYCA 5BNOB 2VG9A 1QJY3 4XHBA 4EV0A 4N43C 2WWSA 1JH5A 2JJ6A 2Q1ZB 4HVQA 4N7UA 3RRDA 3HBZA 5JSRA 3KLSA 1MACA 2D3SA 3LSDA 1PNFA 4UXAA 1PK6A 4MXVA 4YVSC 1MS8A 5A33B 3VBRA 2OUHA 3JD72 5GLVA 3NL1A 3VZMA 5F5QA 3L9JT 1HV1A 1GFF2 2BYVE 1YO8A 3RYKA 4B3NA 4XEZA 1W0OA 2X5IB 3AZVA 2VOKA 2RE9A 4XBQA 3ME2A 1XE8A 1HW5A 1RL3A 4EWEA 4Q4Y3 3WDUA 2WNUA 4C0HA 1VJ2A 1BVP1 4IV3A 1ZRRA 3WLUA 1C3HA 5DDJ1 4HK9A 1AYN1 2HEVF 3ZFFC 2ZS6B 2AENA 2B46X 3SXWA 3UKNA 2ZMLA 1D0GA 2GNMA 1NCQC 5FAXA 4EN6B 2EAAA 3O14A 4HETA 4HKOA 4P9GA 1MR5A 2PLV2 2K0GA 1N1VA 1J1TA 4EN9B 4IV3C 1Q8SA 1YIPA 3THPA 1VB4A 4CYDA 4YFWA 3M2MA 3O0WA 2VW0A 2E6VA 1TQ5A 3OBTA 2RS12 3IDEA 4FVVA 1FPN1 2R6QA 2A75A 3WW4A 1VBE1 2XVGA 1RVF3 1WMEA 3U07A 1LESA 3TAYA 4OLLA 4OI4A 1LGBA 4TLFA 1LOBA 1HLCA 4I02A 1H9PA 1EY2A 1U5YA 3JUUA 4XQDA 1RGSA 3CO2A 4COYA 4GMP3 1UKRA 4RSUA 3RG0A 2VOXA 1S0JA 5JVVA 5LK5A 1VBC3 4K8FA 5DDJ2 4F7ZA 1OOPC 2PN5A 2XLFA 2A70A 2QNKA 1AF9A 2RS31 1YHFA 2QE3A 3JBG3 2UWBA 2CAVA 4EWAA 1XU2A 1RUNA 1QJX3 2MHFA 1Q8VA 4L9BA 1RINA 3HWJA 1PK6B 4XF0A 4AEKA 1RUI3 4FP3A 2H0BA 2JG9B 3VDDB 3VL8A 1QXRA 3TN92 1FX5A 2VVDA 1FPN2 1ZRCA 1R1ZA 3WR0A 1VBE2 4K20A 1D4M1 2BPA2 5FO8B 5I93A 3USSA 1MS0A 2P17A 3AX4A 5CFDB 4RS5B 3VZKA 2DV9A 3QOPA 3WG1A 5F6LB 1F5JA 1A3KA 1GR3A 3KD4A 4OUMA 1RC6A 2WNUB 3R05A 4MH0E 2XLAA 4JGZB 5FOJB 1MEC3 4IEXA 1XRUA 4FOQA 4JVAA 1DYKA 2DTWA 2VMIA 2RS32 3CL1A 1REDA 1RUJ3 3IWZA 4FXGB 4YYOA 1AX1A 2B42B 1NA1B 4HANA 1RB8G 5DUUA 1UPSA 3WUDA 2JEMA 4CDXB 5GZGA 1COV1 4I0BA 4MYEA 4AI0A 5FLIA 2PHTA 4A2UA 1W6OB 4WM7B 1D4M2 1EPZA 4C90A 2R1BA 4E2QA 5LK7B 3T2TA 1TME3 2E7AA 3IN9A 3P3PA 2G9GA 4CEYA 2ETEA 3URFA 2VU9A 2LM3A 2YROA 2XVKA 3WG4A 1TEIA 2XJTA 3VBUC 3WINE 1JOJA 2YZ4A 1EYBA 1RUG1 1WCDJ 5FREA 2WZPP 2XUMA 4OUSA 3D6EA 1REEA 3AMHA 1O3RA 1KDKA 3SH4A 3V0BB 1JTZX 2R16A 2OA2A 1KJLA 4Z2WA 1ZRDA 1MZEA 3D0JA 4OVEA 3WHUA 3KCYA 1COV2 5KHIA 1UD1A 2GN7A 3AFGA 3BPZA 5TSWA 1S0CA 2VOWA 3PVBB 1ZX5A 3DF0A 4FBFA 4XYXA 3B9IA 5E88A 1WD3A 1SLBA 1CAUA 2BQPA 2CWMA 3CLPA 1EV11 1XYPA 1MVQA 1POV1 3ELNA 3E6CC 1H2NA 4CEWC 5GZFA 4ASLA 3WP4A 5JDBA 2BEOA 2GN3A 2ZX2A 3SHRA 1ND3B 1AR63 4AQ6A 2DVAA 2WSUA 1KS5A 3B69A 4Q0QA 4XFIA 1RUG2 4RD7A 3TOJA 4MGKE 4AVVA 4OHXA 2IXKA 2VQAA 4PLMA 4YG6A 2WLQA 5GJ6A 2UU8A 4DY5A 5GLTA 1QOTA 4AFBA 2VQ0A 3MFAA 5DZGA 3VLBB 1SCRA 1LHUA 4MLOA 2MNGA 3BOPA 1H1MA 3MLKA 1DZRA 2DFCA 1G9BA 4K6BA 1RMU1 5HI0A 1ULGA 3OPZA 2HKXA 1H4HA 4RHV3 1Z7S1 1EV12 3V64A 1UW8A 1WMFA 2QDRA 4HSJA 4IQPA 3H1YA 4AVBA 3TNQA 3DN7A 3NV2A 1ZM1A 3USUB 4QQ2A 2CY6A 1O3QA 5JIUA 4Q4W1 5HXVA 4PJYA 3SCGA 2ZA9A 4X8NA 1N1SA 4YRDA 5FQ0A 3MW4A 5AVAA 1DGLA 4HKLA 1GZ9A 4SLIA 4LEJA 1WW6A 2PAMA 4FOWA 2WFF1 1HXS2 2Q0AA 4Y1VA 1LHVA 5J98B 2KM2A 3VHPA 1Q3EA 2UWAA 2XWBB 1V9U1 4XMIA 4PDWC 3NKGA 2R30A 1KXGA 1LEDA 1OA4A 3K51A 1LOCA 2JENA 1AL21 1QY4A 3OJBA 1VP6A 1MS1A 1IZ3A 3CF6E 4FPFA 3TWIA 2UWCA 2XJVA 3OBRA 5JI9A 3AYEA 1YCIA 4K21A 4I3GA 4XFFA 3ZSEA 1RMU2 2A6XA 4GH4C 3N7LA 3MZHA 1X8EA 3S6PA 1WLDA 4RQPA 3ACLA 4YZ2A 1Z7S2 4GULA 4LBMA 4ZXKA 1AR71 4UBHA 1B35A 4RR3C 4OHWA 4Q4W2 1CAVA 3H3UA 2AYHA 1HRV1 2OUJA 2P3IA 4RQPC 3OD4A 3WG2A 2WINB 3N35A 4X6QB 3VZLA 1LGNA 2P37A 2XWJB 4M3CB 3VBOC 1V9U2 3D0SA 3I7DA 4AEMA 4AQTA 1NQJA 1YUDA 5IK5A 4XFAA 3MF6A 3O5SA 4BM8A 4LBQD 4JRLA 1U0AA 2WC2A 4RGGA 1V6KA 3OY8B 4LBNA 4AQSA 3RI9A 1W0PA 3VBSC 1JYIA 5SV8A 2PLV3 3ZFEA 4AVTA 1N1YA 5SV5A 5I91A 1YJLA 5EXOA 4ES8A 5AVPA 1NY71 1AVBA 2AUYA 2ZPXA 2VECA 4XOGA 3ASIA 2MEV1 2RS13 4LR4A 1AR72 1VBD1 3LA3A 4AHYA 1H1IA 5A32A 1V6OA 2R071 4QGNA 4UW3A 3LGRA 4AVSA 3TBDA 5J48A 3A4UA 2CGNA 5CU1A 3ZPYA 3MW3A 4AXOA 1HRV2 2DCKA 4IXLA 1S1AA 5FQ0B 4QU2A 3KT1A 2P2KA 3M4FA 5BY5A 2GC3A 2ZCWA 1HRI3 1S0BA 4AE2A 1CR7A 2X29A 4G9SB 5KXEA 4EN0A 1GQGA 2ZHNA 4BIFA 4Q1PA 5DDJ3 3HR9A 1H2MA 2DCZA 5T54A 4Y4YA 2TEPA