3HT2A

Zink containing polyketide cyclase remf from streptomyces resistomycificus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
143
structure length
143
Chain Sequence
b'SMMKRVHRTDVKAEIVREPGAKETTHRKLIDTPDGADRFVLTEFEVSPNGSTPPHFHEWEHEIYVLEGSMGLVLPDQGRTEEVGPGEAIFIPRGEPHGFVTGPGQTCRFLVVAPCERPPVRNVFLSEDPYEYTQMPEYTSLLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RemF protein
publication title The polyketide cyclase RemF from Streptomyces resistomycificus contains an unusual octahedral zinc binding site
pubmed doi rcsb
source organism Streptomyces resistomycificus
molecule tags Lyase
total genus 29
structure length 143
sequence length 143
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ht2A00
4ZU5A 2XLGA 5C8WA 2BNNA 1X8MA 3EJKA 2UYAA 3SMHA 1X7NA 5K8SA 3ELNA 1YFUA 1U12A 2XKOA 2QJVA 3R6SA 1DGWA 1FT9A 2ET1A 3MDPA 4LTAA 3B02A 2QDRA 3OCPA 4HVOA 4PIZA 2GH2A 4HZFA 4XF9A 4HSJA 4PJYA 1J1LA 1YFYA 4AQ2A 3DN7A 2ET7A 3ACLA 2GU9A 3UKTA 4YRDA 3MYXA 1ZNPA 2BYVE 3KCCA 2DCTA 2N7GA 5CU1A 3PVBB 2CGPA 1UPIA 1EYBA 4IETA 4XF4A 3KGZA 2K9ZA 3LWCA 1QWRA 3D0SA 1NXMA 5I0RA 1ZZBA 1I5ZA 4ZU7A 4IEYA 2OPKA 2B9UA 5T3NA 4QGNA 1H1IA 3ETQA 4QM9A 1DGRA 3SHRA 5I8TA 4WVZA 5JR7B 3TNQA 4FAHA 2ETEA 1Y9QA 4Q29A 3HT1A 1TQ5A 4F8AA 3H7JA 5CVRA 3H8UA 2ZKLA 4EWEA 3IBMA 4P9GA 3PNAA 4LEJA 3NL1A 4HN0A 2BNMA 4KU7A 2B8MA 2VPVA 3GYDA 3E5UA 1CAVB 1RL3A 3USSA 3EBRA 1YWKA 4I0AA 4KL1A 4ORFA 4BHPA 1IPJA 1X82A 2O8QA 2IXIA 1V70A 2XLFA 1GQHA 2ZCWA 4MGKE 4JTOA 1EPZA 3SXWA 5KBFA 2D40A 4XFAA 4FAGA 1UIJA 1ZREA 4KWKA 1OD5A 4MH0E 1YLLA 1J3QA 3S7EA 3CLPA 3WW3A 4HLTA 2IC1A 5FCCA 2Y0OA 4H7LA 1DZTA 3RDIA 3L2HA 1GQGA 3E6CC 1L3JA 1WA4A 1RUOA 2XHKA 4XFFA 3E5QA 2FMYA 4Q0QA 3BALA 3U11A 3LAGA 4I02A 1FXZA 1ZZ8A 2P17A 1UIKA 1J58A 1UD1A 2CAVA 4MGYE 2VECA 4LUKA 4O9EA 1LB2A 3M70A 2XGXA 3CO2A 1DZRA 4X6RB 3BCWA 4XFHA 2BEOA 4XF0A 1O3TA 2UY8A 3MZHA 4L11A 3ZDSA 1CAXA 3KSCA 2H6BA 3E6DA 4Z82A 4XFGA 1YUDA 1ZZ7A 3I54A 4HN1A 4EROA 4KWJA 3JZVA 1CAWA 1OMIA 3LOIA 4I09A 1ZRFA 3U0ZA 4AVBA 2OYZA 1YFXA 4RD7A 3GBFA 2KXLA 3LA3A 3E6BA 3G7DA 4Z07A 2C0ZA 4IEVA 3H3ZA 3BU7A 2BNOA 1NZCA 5JAXA 1H1MA 2D5HA 2PAEA 4QX5A 2IXHA 4UBHA 4B29A 5JSRA 2QVSB 4ONUA 1PM7A 4QXKA 5BV6A 3UKNA 3LA7A 3H1WA 2GC0A 3C3VA 1OI6A 4QM8A 2VQAA 3E97A 2MPFA 1HW5A 3CL1A 1FI2A 4UBGA 2E9QA 4HBNA 4R52A 1QY4A 2WC2A 5FLHA 3ST7A 4E2GA 1CGPA 3OGJA 4XF3A 3DL3A 4CYDA 4XFIA 4PIYA 3BB6A 2OZJA 1ZX5A 4ZU4A 2MHFA 2IXKA 1WLTA 5I8SA 2OZ6A 3HIFA 3OD0A 4OFGA 1O3QA 2GC1A 2XL9A 4OLLA 5BXXA 3CJXA 4MV2A 1EP0A 1VR3A 2WFPA 1J3RA 3I59B 3U10A 4EWDA 4WBBA 1RC6A 2CV6A 3NSTA 5KHKA 4Q0VA 3QOPA 3NKTA 4YSFA 2XLAA 5LEJA 3FE5A 2IXLA 1CAXB 1NYWA 2MNGA 5FPZA 2O1QA 1J3PA 1O4TA 4X6QB 2Q0AA 1SQ4A 1CAWB 3CEWA 3CF6E 3RYKA 1VP6A 5HI0A 1JUHA 4FBFA 4YNIA 5CADA 5I0SA 4I0BA 1IPKA 3H9AA 3TNPB 2EVXA 4IESA 4IERA 5I8YA 1Q3EA 2FQPA 3D0JA 4IEXA 4JVAA 2B5HA 5J48A 1ZRCA 4QGMA 4GULA 3HT2A 4JTNA 1CAUB 3H3UA 3I59A 5KHJA 3MPBA 5I0TA 1LKNA 2HKXA 3UKVA 4MGIE 3S0MA 2F4PA 1ZZCA 3FX3A 5I0UA 5FQ0A 1XE8A 1UW8A 3I7DA 5BPXA 4JV4A 2EAAA 2D5FA 2BGCA 1J59A 3SCGA 1LRHA 4J1XA 1EY2A 4BIFA 4O9GA 4LULA 2CAUA 5FDBA 3RNSA 3IWZA 5LRRA 1QXJA 2QCSB 1ZZ9A 4AVAA 4LA3A 2H0VA 4HMZA 5LEKA 4I3PA 4IEOA 5KHGA 2PHDA 1RGSA 4LA2A 3SCHA 3RYPA 3DKWA 4K8FA 3HQXA 3OTFA 4QGLA 3ES1A 3S7IA 5JCTA 3IDCB 1SEFA 2ATFA 1CAUA 5F1RA 5I93A 3KMHA 4YYOA 3M3IA 4PIXA 3PLQA 4N9HA 1LR5A 2UY9A 4NVPA 3O14A 4XETA 2K0GA 5JSOA 4WZCA 2PAKA 1O5UA 1ZRRA 2Q4SA 4Q0UA 2PAMA 3E5XA 4D7TA 5FLIA 3WW4A 2GC2A 1G6NA 5EFUA 4A2UA 2QNKA 5AVPA 4MZUA 3ROUA 3EQEA 2V09A 4R8HA 3QACA 1NE6A 3FFQA 4I2OA 4XFBA 4MX3A 4J1WA 2D93A 5BUVA 4LLOA 2Z2SB 4META 5D1IA 2PYTA 5FLJA 1PMIA 3FWEA 2PFWA 3H50A 4MUVA 5EZWA 1YFWA 4IEUA 1O5LA 1VJ2A 2IXJA 4TLFA 4DINB 1ZVFA 1OFNA 1XRUA 2Q1ZB 4IEQA 3WW2A 3RPQA 3EO6A 4XFCA 1O7FA 1RTVA 4E2QA 2PHLA 4EWAA 1UCXA 5LRSA 4AVCA 1I6XA 3H1MA 4HVRA 4D7SA 2PTMA 3SCFA 2Z69A 1O3RA 4FT8A 3DV8A 4XF1A 4Q0SA 5FQ0B 5E1RA 3NW4A 2GC3A 3WW1A 4F7ZA 3KGLA 3BPZA 3ES4A 4LUMA 3LZZA 5KHHA 3D82A 4UXAA 3RZZA 3RYRA 3EHKA 4I01A 4IEZA 1XE7A 4YARA 3FHIB 2GZWA 3FJSA 2XL7A 5FPXA 5J7MA 5KHIA 1QXRA 1X8EA 3N4MA 2H6CA 2PA7A 2I45A 3H1YA 2Q30A 4XEZA 3VHRA 2HJIA 5J3UA 1Q43A 2UYBA 1RUNA 4KU8A 1SFNA 1CX4A 2PQQA 4L2NA 5BY5A 4AQ6A 5C6CA 1NE4A 1YHFA 4BYYA 4EV0A 2EA7A 1CAVA 2GAUA 1WGPA 3NJZA 3LA2A 2OA2A 3FZ3A 3IIAA 1ZZ6A 5JSPA 3NVCA 5I91A 1O3SA 2XKPA 5E16A 4N9IA 4IEPA 3IDBB 4HSLA 4QMAA 4AXOA 4MGZE 4BH9A 3OF1A 4HVQA 1Y3TA 1Q5OA 2IXCA 3H7YA 4Q0PA 4E2SA 1ZRDA 4KWLA 4IEWA
chains in the Genus database with same CATH superfamily
1AR72 1WCSA 2ZXQA 3IPVA 3N7MA 1V9U2 1AR83 2BNNA 1KDKA 1QJFA 4HK9A 4HK8A 3KLSA 1DP0A 1IZ3A 4HT1T 4CDUC 4DB5A 5K8SA 4JKLA 2BGOA 5JIUA 3AMMA 3DXUA 2Y33A 2DU0A 1GQPA 2ZGKA 4LORA 4AG4A 4DRRA 1G9CA 3MDPA 3GGLA 3ZO0B 1JYCA 4HVOA 1F8VA 4XUQA 2RM21 4HKLA 4HZFA 5FTTC 4N7IA 2BJSA 1VB2A 4DIQA 4CU7A 3VUOA 4HSJA 1LGNA 1Y7BA 4JCKA 1YFYA 5L9BA 2ET7A 3VBHC 4Y1VA 2ARBA 3OGVA 3T3YA 2A6ZA 4LR4A 1W28A 3MF9A 3ZYGA 1OLRA 1ZNPA 1K45A 1OPMA 1QQP2 2X8KA 5CEHA 4PLMA 5FJHA 5LBEA 1OOPA 4OQ9A 4FPKA 3PVBB 3NO8A 4NE9A 2WLPA 4BPZA 4AEKA 1EYBA 2MEV3 3K75B 2K9ZA 1QWRA 3D0SA 3ACFA 3LKJA 5I0RA 4GA9A 4B4QA 4IEYA 4KMQA 2XBO3 3WY6A 5C8CC 4QM9A 1QJZA 5K9YA 4WVZA 5JR7B 4M0NA 5IJRA 3VB9A 4FAHA 1YQCA 2RS53 1TQ5A 3HT1A 4F8AA 2ZS6B 5BNOB 4QX8A 3I2DA 4QB1A 4FP2A 2E7AA 3ILFA 1IG0A 4RYDA 1BQPA 4FTBA 4JZRA 1VBE3 4YZ2A 2W68A 5LZ6A 3N9MA 1P8JA 1DQ0A 1RMU2 5FOBB 3THPA 1EAH2 2W47A 3IIIA 5J96B 4KWUA 2A7AA 1CD3G 5FPBA 4XILA 4QDRA 3AFKA 4DRVA 4A6SA 2QQIA 1GWMA 1X33A 5H9SA 1EV13 2BWCA 2VCMA 3AB0A 4MGKE 5DZEA 2YDEA 2ZHKA 1EPZA 2XJQA 2Y6GA 5FZHA 3H42B 5KBFA 3I4IA 5DAWA 4E4HA 4FAGA 5EV7A 3BYWA 1OD5A 3GZUC 2E7TA 5A7OA 1J3QA 1SDWA 2LS6A 4CE8A 1UZZA 1PIV3 2C26A 3WUDA 3FC0A 2C9KA 3KF5A 3JU9A 1UU6A 4Y22A 1MVEA 3LEKA 2Y0OA 2FDGA 3NJYA 3IPVB 3WG4A 3M1HA 2AZ5A 5T5OA 2WQZC 1Q56A 2R6QA 1W99A 2BOJA 5EIYB 1J1TA 3KHBA 4DQAA 4AI8A 3Q8EA 4KI5M 1H6XA 4YGBA 1WA4A 2HWF2 3NJVA 3J7LA 4RA0A 4WM8B 3UL2A 3HQRA 5B4XA 1S0JA 3HD8B 1YQ8A 2WAAA 4A3ZA 3M7AA 1PVXA 1QGLA 3E5QA 4N43C 2B46X 1HLCA 4ET7A 1MS4A 1JMUB 1XBFA 1W8FA 2YXSA 5KC5A 1NOVA 3U11A 3LGRA 4BU2A 3SH4A 2XR4A 3POEA 4I02A 3ECQA 1OPOA 1UZVA 3B01A 1XSQA 2VZPA 4Q8KA 2ARCA 2R0FA 5FMOS 1RHI3 2UWBA 4ES8A 3HEIA 5L36A 2P17A 4YWAA 3DEMA 2HWD2 4JGYA 4AF9A 3T08A 2L9LA 1OOPB 1J58A 2DTWA 2JB8A 5KXEA 2FBEA 2WFF2 5FMDA 1BJQA 3CO2A 4BWOA 3SITA 1H8TA 3J26N 3S57A 1WBLA 2WT1A 4UFLA 3ZIWA 5FYVA 1AYM3 1DBNA 2JG9C 2HWB3 2JJ6A 4QQLA 2YROA 3LOBA 4GMP0 3V0BA 1QJX1 3KSCA 1JW6A 4UFKA 1RUI3 2B7YA 2H6BA 1IS4A 1UY3A 2RR13 1MEC2 2VL4A 3IMNA 2R073 2ZX1A 4Z82A 1TMF1 2W5FA 3LFIA 5DUVA 1ZZ7A 2DFCA 4HN1A 4BIOA 4KWJA 4EROA 4NHYA 1YCIA 2HEWF 3FLPA 3JZVA 1OMIA 3LOIA 4RHV1 3S5QA 1ZRFA 2ZGQA 4H7MA 1ND3C 4WM8C 4DXZA 1OLQA 2G9FA 1LECA 1HX6A 1RUG1 4HETA 4N53A 1PGL1 1GR3A 3GCXA 1F4HA 1VBB1 2WL1A 5EJ3A 2Z4FA 2I74A 2KXLA 2UWAA 4FXGB 3AZYA 3G7DA 1VBC2 4IEVA 5A3UA 1CX1A 2BNOA 1E5SA 3VDCA 5EQUA 1PO13 5JAXA 1R1A3 3DCQA 4Q1PA 3FL7A 1PX3A 5DPNA 4ZY9A 2JEMA 5HCHA 2PAEA 1O59A 4UBHA 4F3JA 4QPYA 4B29A 4FPLA 5F2WA 1N1SA 3V64A 4K6BA 1MS5A 2DBNA 4G9SB 1K12A 3O0XA 4M3CE 5FZ3A 3SEPA 3M4FA 2R16A 1UWWA 5J37A 4YW7A 3KT4A 3M2MA 2XPJA 4Y22B 1OH3A 2WSVA 1MS8A 4QT6A 5ACA3 3N36A 1L7LA 4RGKA 4AWDA 2FD8A 5FXVA 2P6CA 5T50A 1XE0A 2WRAA 5C5UA 2VW0A 2CGNA 3KF3A 4QKDA 5L9VA 2HEVF 4C8DA 5LY2A 1IQDC 4GAZA 3WP4A 1QH6A 1QY4A 4E2GA 2A6WA 4GB32 3BVCA 5FZ7A 4A7KA 1SLAA 1N3OA 2ZJCA 4JC1A 1G9DA 4Y1YA 3L2YA 1JZ4A 1OT5A 3JD72 4AL9A 5FZBA 4AVTA 1A78A 2XHNA 2IXKA 2VNGA 5GZGA 1BVVA 1VBA3 4Y5Z0 4AZZA 4CRQA 5I8SA 2B42B 1SCRA 2ZTNA 1O3QA 5BXXA 2BU9A 4XXPA 1UAIA 4JGYB 3ZM8A 2D43A 4YVSB 3C7EA 5D2AA 4MHRA 3A0NA 5JPNB 3U10A 1JOBA 1CN1A 4CDWA 5JI9A 1SZBA 4A6OA 1C8M2 1NA1C 2MEV1 3NSTA 3Q8AA 1OC1A 4YVWB 4PDWB 1GFF2 1REDA 3WR0A 5FZAA 3ZYPA 4HFSA 1LOGA 5DMYA 1RUD2 2WA4A 5FYHA 2UWCA 3D5OA 3V0BB 1RUH2 2HWE3 2O1QA 1J3PA 2YHJA 4RQPA 1BCXA 1VRH2 4UT5A 2RS51 5FZMA 5FK7A 4CPBA 1OF3A 4BLIA 4GMP3 3NV4A 4XW3A 2OX0A 3WDYA 2ZACA 2ZZQA 5IWFA 5IAXA 1DFQA 4N53B 4QQPA 4W6XA 5CADA 4Q4Y3 1VBE1 4GWIA 4XQ4A 2VVFA 1NXD1 2ARXA 4PCRA 3VDDA 5I0SA 3W5NA 2WSUA 1OLMA 4AFMA 5GALA 2P3JA 4BDVB 4B7EA 4IESA 4IERA 3VBOB 4M0HA 1MZEA 3D0JA 3ZYHA 3P1IA 4JVAA 4XTMA 2VAUA 2DF7A 5DAXA 4TXWA 3LIGA 1B35A 3FHQA 1XU2A 2B5HA 3SEEA 2DWRA 3SISA 3T09A 1ZRCA 3MIHA 3FUQA 3HT2A 4QX7A 3H3UA 4XJAA 2F6BA 4YVSC 1WW5A 1DLLA 2PMWB 1CONA 4L97A 1CVNA 3S0MA 1UMIA 1LOFC 3ACIA 1KD7A 2VM9A 1WKYA 3BIWE 5FUNA 5I0UA 4YVWC 5F6KA 3SKVA 4LK6A 1W3XA 3OEAA 4PDWC 2CL2A 1GUIA 2BGCA 4CEWA 1J59A 1TME2 3T2OA 4J1XA 1PO23 1EY2A 3ZDVA 4LKDA 1HQWA 3WDVA 2YFUA 3BTZA 3RSJA 1S2KA 1OD3A 4TWTA 2J1VA 1MS1A 5G04L 4DZGA 4B3NA 5HXMA 1H6YA 2QCSB 4JGZA 1ZA4A 5FYZA 3VBSA 5A7WB 4MG2A 2J7MA 2P34A 4NO4A 3H8OA 2KM2A 4AVAA 4CP0A 3WQBA 5FOJB 4QQHA 1GZCA 5FPLA 5EJZB 5LEKA 2KD7A 4HXCA 1HV0A 4NIIA 4I30A 5F7UA 4LBKA 3SCHA 5L9RA 4ARYA 3KV6A 3C2UA 4FOYA 3ES1A 2F17A 5FP4A 5FYYA 3VBOC 1C8NA 3ZR5A 4QQ2A 1A3KA 1RHI1 2HWF1 3R05A 5LATA 2UU8A 4EN0A 3A22A 2DU1A 4IGOA 3KMHA 2J1SA 4PIXA 1BXHA 4KBBA 4YZ3A 1AVBA 2BFUL 1NKGA 2GP3A 4CDWB 1BBT2 4M3CF 1XOYA 3NNLA 2ZHNA 3O14A 4NVPA 4QDSA 1C3HA 3L9JT 1IOAA 1H30A 2VUJA 4EE2A 4NAOA 4XJWA 4HOOA 1G7YA 2HWB1 1RUJ2 1LOCA 1L7RA 4IDZA 2Q4SA 1WLWA 5CB7A 4D6QA 5FY5A 4RQPB 1RUI1 2RR11 3T2PA 5EFUA 4CXYA 2WYFA 5AVPA 4MZUA 3ROUA 2RS33 2OIIA 3JB4C 2V09A 1AL23 1VPHA 1W3VA 2VZQA 3CNAA 1FAYA 2ZZJA 1VALA 3UK9A 2OKXA 3MIDA 5IK7A 5D1IA 1BK1A 1FNYA 2VW1A 1SG3A 3H8XA 3GNEA 3VDDB 1YQ6A 1RINA 4QPGC 5EZWA 1YFWA 4IEUA 1O5LA 2AREA 3KV4A 2IXJA 2VZOA 2FZ2A 2DVGA 2RJKA 2DCZA 4TLFA 4URTA 4DINB 1GZWA 4CUAA 1A6CA 3N9OA 4CXXA 4Q1RA 4CZSA 3I3DA 1MQTA 3EO6A 3RPQA 4AEDB 1O7FA 2Q8OA 2PHLA 3VZOA 4ARXA 1UCXA 4K21A 1R083 4NIGA 1WMEA 4AVCA 4P5YA 1Z7S3 4NIDA 1RUF3 5CYYA 3ZFFA 2DCYA 4B8EA 2Z69A 1ASJ2 1WMXA 2C6SA 2WWJA 3K4AA 5DUWA 5FZIA 2VH9A 2EAKA 3NV1A 4AE2A 5E1RA 4FOVA 4OCTA 2DUPA 2GC3A 1SFPA 3TN93 1X36A 1KJRA 3OPWA 4NWVA 3WW1A 3NNFA 1LHOA 3BPZA 4CEWB 1AX1A 4AHWA 4LUMA 2VMGA 5KHHA 5ACA1 3MBWA 1GZ9A 5IK5A 1F9KA 4AVVA 2YBKA 4AHXA 4A7YA 3J8F2 4CU8A 5FZOA 4QD2A 3AMHA 2ZX2A 4GD4A 1B09A 4Y4YA 4CDQC 4CCLA 4S2HA 3ZN4A 1UO9A 3MV01 3FHIB 4KH9A 4XPVA 3VBSB 4CEYC 4CXWA 5CKNA 5FPXA 1XB9A 1QXRA 3N4MA 3ZXDA 5CFCA 1NY72 3VHRA 3CQOA 1QOTA 1CJPA 4M4RA 2XUMA 1W9FA 4YM0A 5FZGA 5C9AA 1POV0 1RB8G 1YIPA 4P9WA 5J3UA 2VZTA 4P5HA 4CCDA 4O65A 4MGQA 1SLTA 4H55A 4E4SA 3AYAA 3F95A 4L2NA 5DAPA 1ND2B 1OKOA 1WA6X 2D6NA 2VZ3A 3PUAA 2WT2A 1EUTA 3T2TA 3WNPA 2CGOA 2Q5TA 5C3OA 2XB6C 2EXHA 4AEDC 2W3JA 3ITQA 1S0IA 2G19A 3GJAA 3KCXA 3AP9A 2GAUA 1K5MC 2D6OX 4CDXA 3PVOA 5GLVA 2DVFA 5JSPA 5I91A 1O3SA 4KBZA 1DDLA 1IS6A 1R092 2PHFA 5E16A 5A80A 1FPN3 1I3HA 1UU5A 3EYPA 2LM3A 5FZEA 4MADA 5CFDC 3HVDA 3H0OA 2ZEZA 4NRQA 3VKOA 4B7KA 1ODNA 4QMAA 4PHZA 4AXOA 4CEWC 2HWE1 1MS9A 2X5IA 2VOKA 3B00A 4BCUA 2VGDA 5DZFA 5J36A 1NCRC 1HXS3 2IXCA 3POYA 4GMP1 5CKMA 4ISRA 1D0HA 1IHMA 4CDUA 2NYYA 5L7OC 3ZYRA 4Q4Y1 5FXZA 3WDWA 5C8WA 2X05A 4IE0A 1REFA 1RUD1 4BLJA 3EJKA 5BNPC 2BFUS 3FHAA 4TZDA 1GZWB 5FZKA 2YBPA 1DGLA 1AUYA 1FT9A 4UW4A 4FPCA 4UAPA 1VAVA 2RS12 1COV2 1MQTB 1HN0A 3B02A 3OCPA 3IM0A 3P3PA 2GMMA 4QPWA 1ND2C 3UESA 4XF9A 3VBHA 5AVAA 4AFCA 5LASA 1A8DA 3AL5A 4PJYA 4FPJA 1AYN1 1UF2C 2VUCA 4YW1A 2VOXA 4AQ2A 4BXSV 3ZFFB 3HR9A 1CPMA 3ACLA 4OULA 2GU9A 3BOWA 4HKOA 3LE0A 1NCQB 4JKMA 4YRDA 5E89A 3UKTA 1GOGA 1WD4A 4AGVA 5SV8A 2PQSA 2BYVE 4Y1XA 1ULCA 3ZVXA 1O8SA 5CU1A 5F6LB 4D0QA 4LIUA 3V0AA 3IAPA 4ZS3A 4CUCA 2CGPA 1YI7A 2YU2A 1PO21 3B5LB 3ZN6A 2ZMNA 3KGZA 5C8CA 3BN6A 4UOJA 5FZOB 1RVF2 5L73A 5JXJA 4JRAA 5LK7B 5LWBA 1W2UA 2DDUA 5JVVA 4ZU7A 4R9BA 4EJRA 4K1ZA 4Z92B 2WO2A 2B9UA 5T3NA 4QGNA 1QH7A 5IATA 4QWNA 3TEYA 1H4GA 5FYMA 1Y9QA 4Q29A 5A70A 1F2NA 2WA3A 5JPMB 1V6NA 3ILRA 4AEJA 1JHNA 3H7JA 4GWJA 5C9AB 4GALA 3H8UA 1VAMA 3DYOA 3IBMA 5CG8A 5ANNA 4P9GA 1YC61 1LOAA 2XJTA 5CA6A 2Z79A 2OUJA 3X29B 4RFT0 2XONA 3PNAA 3LEMA 4ZPIA 3NL1A 4HN0A 3O1UA 5A7NA 2P4EA 4QX1A 1S2EA 1XNTA 4XUNA 2YC4A 1C1FA 1MQTC 1POV3 2HWC3 4ZXKA 3BODA 3KZ4C 1HB2A 5TSWA 1RL3A 2QQPA 3EBRA 4BQ4A 1QNYA 1IPJA 1X82A 4A44A 2YY1A 1AR91 3W5MA 3WP3A 3ZFFC 2O8QA 2J1UA 2ZGNA 1AJKA 2JDMA 1NCQC 1OQEA 1V70A 3RWKX 3TYJA 2XJRA 5JOWA 3JXSA 1PNGA 1AX2A 3P3NA 1ENRA 3SXWA 4OZOA 2PXJA 5FZ6A 2JECA 2D40A 2P5BA 2R062 2WDBA 2X5IB 4XFAA 3I3MA 3HN1A 4LKFA 4KWKA 2WS92 4MH0E 1Y9GA 3Q8BA 5GKAC 1SBFA 3WW3A 3E1F1 2RS31 5CKQA 1LU2A 2IC1A 1AL21 2JG8B 2LUWA 4JQRA 4NJ4A 4AGRA 4BXFA 5F9TA 4FPEA 1TMF3 4CDUB 3I2HA 2J22A 3K4DA 3DKQA 3ZXLA 2ZBJA 3N9NA 2QE3A 3JBG2 4RHV3 3RDIA 1XNBA 4Q4X2 3UT0A 1UOBA 2QQJA 4N43A 5FZLA 1SBEA 3WVJA 1NT0A 2NLRA 1SLIA 3A4UA 3KVBA 1W6NA 4GJYA 4OI2A 1RUOA 5C9AC 2VMHA 3GBWA 1GWKA 2Y6FA 1LTEA 1VBD2 2Y26A 4GKXA 5LBBA 3O7OA 3U4XA 2Q8CA 2JX9A 1W6MA 3VBHB 4LOSA 1PVC3 4QX3A 1R081 3BALA 3ZIXA 1QMJA 1LESA 4COZA 2QQNA 4Q4V2 5IW0A 1YQ2A 1RUF1 2O0OA 4FP3A 3CKHA 4AQTA 1UIKA 3ENRA 4JDNA 5FYUA 3RZLA 2JE7A 3DYPA 1ACCA 3OBRA 1Q8OA 4RR3C 1WW4A 2VNOA 5I8YA 2WQ8A 3FLTA 4LUKA 2JDHA 2OW4A 3M70A 3V0AB 4M00A 4X6RB 5CAZA 2JG9A 5FKCA 3ZN6B 3I3EA 3EB7A 2BEOA 4XFHA 4XYXA 5HCFA 2X5IC 1HRV2 1WCDJ 4O61A 3O1VA 3ZDSA 3VHNA 2JG8C 5A33B 1W2OA 3E6DA 1W0PA 5HV4A 1NAEA 1WW6A 2RDSA 3AVSA 3TEXA 2ZAAA 3O1TA 1ND3A 1YUDA 2SBAA 4WM8A 4S2GA 3ABZA 1UMZA 2EF6A 4I09A 5J09A 5FP9A 3G6JB 4FPFA 4GKYA 5A3LA 4AVBA 2OYZA 4YW2A 1AR73 2B4KA 5LA2A 1HB1A 5BYNA 3WP6A 4L9BA 4OZXA 3RZHA 4AR2A 1V9U3 4LBOA 4UW3A 4IUGA 1ZBE2 2C0ZA 2IWGB 1NY71 2RDRA 3VKFC 3VD5A 3ZYBA 1APNA 3O1OA 5F3EA 4AAXA 5GZCA 1A8MA 5HV0A 3BUCA 1MZ5A 5D8AC 1NLSA 1CJDA 2J42A 1H1MA 3OGGA 4CCKA 3MI8A 2D5HA 4JDOA 1W6QA 1W9SA 1FPN1 3I8TA 4QKNA 4TYSA 4UF0A 4CCOA 3GJBA 4PF5A 4XHXA 3LD8A 1KJLA 1RITA 1PM7A 3OB8A 1ST8A 5BV6A 3UKNA 2XVKA 5B2GB 4LO4B 4ITCA 1DZQA 3Q8CA 4LBQB 3RZJA 4GWMA 1S0GA 2C9AA 1QU0A 2VNVA 2ZGSA 3NWKA 5EJ1B 3USUB 3HQUA 3GCWA 1QQP3 3C3VA 2VCCA 1OI6A 1HXS1 1Y9MA 2XJSA 4QM8A 2XBO2 4XMAA 4DS0A 3E97A 3ZFEC 2MPFA 4DUXA 5JR2A 4IE5A 1LGCA 3CL1A 2ZMKA 4Z8BA 1FOD2 5C3QA 1UZ0A 2E9QA 4P9XA 4R52A 4N43B 5FLHA 5JOZA 2YG0A 3HJRA 1UY2A 1WW7A 1S55A 1W6NB 3WOGA 1AXKA 3O12A 4XF3A 3DL3A 3WF0A 4W6WA 1W6MB 4COWA 5FY0A 5FUPA 3PMSA 2AEZA 4MGSA 2WN2A 4LO7A 2RG4A 1REEA 1YO8A 2BQPA 4Q4W2 5FFOC 2XG3A 1HJGA 4QXHA 3IN9A 2VC9A 3KQ4B 2VMCA 2OZ6A 2GC1A 4IE7A 2PN5A 5A6YA 4M4PA 1QJY1 5IYYA 5GLWA 4A3XA 1QJU2 3VHOA 1WMFA 4Q26A 1H2NA 1EV12 1NA1A 4LE4A 1EP0A 2G1MA 1VR3A 2EALA 2WFPA 4QQOA 4XBLA 1RMU3 3PUQA 3R0RA 2JG9B 4QB2A 4EWDA 4CA9A 2OQ6A 5KHKA 4OI1A 5JDBA 1W04A 2A70A 3NKTA 1A34A 5LEJA 1PIV2 1W6OB 4Y20B 2BV4A 4IQPA 1NYWA 3HAGA 3K46A 5FPZA 2WN3A 1KRIA 4YLZA 2JD4A 1STMA 5FWJA 2VMDA 1O4YA 1ND3B 2Q0AA 2RDQA 1SQ4A 4IE4A 5J1XA 2PHTA 4FXKB 3RZKA 3IT8A 5ANQA 4XBNA 3RI8A 1UNBA 2YYOA 5HI0A 1IQAA 4MYEA 1QXPA 5C3RA 1UZYA 4C90A 2VO5A 4YNIA 4QPIB 4E4ZA 3LSEA 1IPKA 5AC92 1N3QA 1POV1 2IUWA 2HWC1 2WNUB 1DIWA 4PT6A 1Q3EA 1DQ1A 4EN7B 2VW2A 2HWF3 4B1MA 4XCBA 5HXVA 3N7KA 2NN8A 4W8JA 4YVSA 2ZMLA 4L8QA 5J48A 1GZTA 3BTAA 5IT6A 3JQXA 4GULA 1W6QB 1LOFA 1CAUB 3NRUA 4UF0B 5KHJA 1LHWA 1ULPA 4EN9B 3MUY1 1NLRA 1ZYBA 4CCEA 1XXNA 4XUOA 4YVWA 1T6BX 1XYNA 4PDWA 5FZ1A 4FPYA 1ZZCA 4Y3OA 1XE8A 1UW8A 1PK6A 4KGQA 3JUUA 2HWD3 1AYM2 1D4VB 3OBTA 2D5FA 3MPPG 4UFMA 5DAQA 3C7OA 5FWEA 1LRHA 2WFF3 5AFBA 5K7PA 1W06A 1ZBA2 2R042 4CP1A 5FZDA 4IL7A 4O9GA 1KEXA 5F5CA 2R072 3AMNA 3RNSA 4NPLA 1N1TA 5CG9A 3OGSA 4OYUA 4JRLA 5FBZA 2QFEA 3VLBB 5LRRA 1QXJA 1T2XA 5C5TA 2P6HA 3EXUA 2P37A 4LA3A 3VBUB 4A41A 2QQWA 4HMZA 2PLV2 4YM2A 3WF3A 4I3PA 2B39A 5FUIA 3PIJA 1MEC3 4UWDA 4XHBA 3VBOA 2JDKA 2WKKA 3NQHA 4QPIC 1RGSA 1PVC1 5FMCA 3RJ2X 3WDUA 3DKWA 4XOGA 4K8FA 5GLUA 3GBGA 3HQXA 3UGGA 4C91A 4D69A 4XBQA 4E8CA 4QGLA 4EZHA 1C4RA 2WNUC 4Q4X1 3S7IA 3IDCB 1JZ6A 3AYEA 1QIQA 3PJQA 3S30A 4K9SA 3N35A 4JHZA 1NA1B 4YYOA 1D2QA 4CCCA 4MGTA 1M06G 3AZVA 2PHRA 4N9HA 1YRZA 4G3YC 3VD3A 1VBC3 3NV3A 1DLCA 3W59A 5LCWL 3FN9A 4LJHA 2LALA 1Q8SA 2XWJB 3JCIA 3WSOA 1WD3A 3KHCA 2ZEYA 2K0GA 1RUE2 5JSOA 2A6YA 5M0TA 4JDMA 2ZAHA 5FAXA 4FTSA 2QZ2A 1K42A 4D7YA 2W95A 1KITA 1ZRRA 4Q0UA 4K1YA 2CHHA 1GBGA 4NIAA 4D7TA 2VXRA 1PGW2 3WW4A 2GC2A 3CZUA 4FFIA 1G6NA 3VDBA 1BMV2 3N3HA 1GANA 3U1XA 3ZSEA 2ID4A 5A7WA 4R8HA 3AP6A 1OUSA 1F5FA 3PURA 2C5DA 4QPGA 5FK8A 1OSGA 4Z2AA 1GYKA 5FLJA 3WNNA 2FMDA 1AR71 3VV1A 3VBUC 2D6LX 2JKXA 3H50A 4HKWA 1URXA 1XYPA 2E51A 3WF2A 3GF6A 4SLIA 1V9U1 4PBOA 5LK5A 5F32A 2DFBA 1UZWA 3V65A 1OFNA 1K3IA 1LNSA 1XRUA 3MV11 4GB33 5FR3A 4EYUA 4XXAA 3WINE 1HRI2 4D94A 5KXDA 1YJKA 1RTVA 4E2QA 4YZ1A 4UI9L 1FNZA 1I6XA 1HB3A 1ULGA 2K2SA 3H1MA 1W8UA 4CPBD 4D7SA 2W0XA 4PQ9A 1BHGA 1DHKB 1TNFA 4E9KA 1GNHA 2NMNA 3TB0A 3ZSJA 4FT8A 2AGSA 1PK6B 3NW4A 1QQP1 2GALA 5H9PA 4NAMA 3ZYJB 1LJ7A 2WZR2 3A7QA 2FCUA 3LZZA 4CDQA 2WZ8A 3D82A 1BVP1 4Y24A 4CEYA 5B4NA 1U0AA 4YM3A 3RQ0A 1AR62 4MLOA 2YFZA 5FP7A 2AC1A 4I01A 4LOTA 3MIBA 2TEPA 5A1AA 1OFSA 4YARA 1WUVA 5F39A 1JHJA 2P3KA 2XL7A 4L92A 3BTXA 1RUD3 1U5IA 2E31A 4LLFA 1IKQA 4WVVA 3WDTA 1VRH3 2EIBA 1XSRA 3OOXA 1Q43A 1VB4A 1HJFA 5ISLA 2QQLA 1H9PA 3OPZA 3D6EA 3MLKA 5T54A 3VZNA 4L99A 3J7NA 3U37A 4AEDA 2PQQA 3T0BA 4TTGA 1V00A 1NE4A 2RJLA 1AYN3 1K5MA 1C1LA 1W8TA 3LDBA 4FFHA 4YGDA 4BYYA 2VBDA 4AFBA 1AXZA 4CUBA 1RXFA 1CAVA 2ZGMA 4JKKA 1RMU1 5F2SA 1F4AA 1WGPA 2GNTA 1EAH1 2KR2A 3NJZA 2JDZA 2OA2A 3FZ3A 3MO4A 2JD9A 4Q4W1 5DDJ2 2VR4A 5K4LA 5CFDA 3AP7A 2W9XA 5BNNC 1W0NA 2XKPA 2DTYA 3I3BA 1PK6C 3NJXA 2WABA 5A3MA 2WO7A 5A3NA 1NCRA 3RZMA 1WLDA 3OF1A 3ZX7A 5IVBA 4HVQA 1WCUA 3VL8A 3RRDA 4UFIA 1Q8PA 5L7OA 2Y6HA 4QDQA 3I2OA 1FV3A 3ZMOA 3H7YA 4FFFA 4Q0PA 4QPGB 1ZRDA 2OPWA 4KWLA 5FYTA 2TNFA 5BNPA 1MZFA 2O14A 4XMIA 4ZU5A 1TME3 2YC0A 2XLGA 3SH5A 4FPHA 1X8MA 4FFGA 4BK5A 2IFRA 3UYJA 3SMHA 4D6RA 3C8XA 5IVVA 5LW9A 1XYOA 3ELNA 1YFUA 1U12A 4MO3M 1ND2A 4YG6A 2QJVA 3AX4A 3ACGA 4YW6A 4W50A 2ET1A 3ZKUA 5FV3A 4O7XA 2BGPA 3A21A 5EYYA 3OJBA 3SQOA 4ASKA 1LHUA 1W03A 4PIZA 2BZDA 4FPOB 4I0WB 3JQWA 1E57A 2VCBA 3ZOIA 1J1LA 1AR93 3K3OA 5FO8B 5JXHA 5A32B 4ZKTB 4NR1A 1ULOA 3BTYA 4Y33A 4GH4B 2CU5A 3D8CA 2FCVA 3HPNA 4IXLA 3O1PA 1D4M2 1ZRIA 3MYXA 1MACA 3PTRB 5LBCA 3KCCA 2YPDA 2HWD1 1CQ9A 4NHXA 5LA0A 1DQ5A 4KGGA 5IVJA 5A7SA 1XNKA 4CDQB 2WFF1 4CEYB 1JI6A 1UPIA 1SBDA 1W9TA 4XF4A 4C1XA 1AXYA 1OLME 1BBT3 2R0HA 1S0BA 2JDYA 4MVTA 1E5HA 1ZZBA 1HQNA 1I5ZA 3PU3A 3T1LA 1PMHX 1GSLA 4LNVA 1RUJ3 3ETQA 4XJZA 3U75A 5I8TA 2NPIA 5L19A 3NNMA 1X50A 1PM4A 1W6PB 2ZGOA 5H9QA 4CCNA 3KV9A 4K3UA 3K2OA 1MEC1 4URAA 2ZEXA 2BTVC 5JMCA 2JE8A 1C57A 1GLHA 1W9YA 4PQQA 4P9JA 1BLZA 1I1EA 2BNMA 2WQ4A 1K5MB 4N7UA 3ORJA 2VPVA 3PUIA 4V1PA 3MW4A 2RMU2 1LGBA 2FDFA 3AP5A 3GYDA 3PTYA 1NCQA 1CAVB 4HPKB 1YWKA 1VAKA 2LW8A 4I0AA 1VBC1 3AVRA 3M3CA 4KL1A 4R9CA 4BHPA 5CFDB 2JENA 3Q8FA 4NRPA 4GH4C 4XCAA 2D3PA 3DECA 1CESA 3POJA 1OXCA 4JTOA 2CNAA 4CVUA 1QF3A 2XVLA 3KM5A 5F5AA 4OI4A 4EN8B 1HIXA 1VMJA 3AKQA 4RS5C 4CP2A 5IHRA 2VE1A 3RMYA 1FMD2 1NCRB 4C1WA 3WP5A 1ZREA 4NN0A 3MIFA 4EQVA 3KWVA 1ASJ3 1IPSA 1SLLA 1UU4A 2RJ2A 2YGLA 2XQRA 3S7EA 1CIWA 4K8RB 5L7OB 4DY3A 1HKDA 1VLNA 4Y1UA 2BVVA 4ZONA 3RFRA 4H7LA 5BNPB 2ZEWA 3OUIA 4CP9B 2XH6A 4DUWA 1SHWB 1CWPA 3J8F3 1GQGA 3E6CC 3P5BA 5DUUA 1L3JA 3A0KA 3AZXA 1UXZA 3ZMNA 5F3GA 4L0PA 3KQRA 4P14A 5FP8A 2XHKA 1LCLA 4GB31 4XFFA 2RV9A 4AHZA 1EUUA 1V6JA 2VQ0A 4LIVA 2FMYA 2RM22 2VQTA 5JZGA 1E5RA 4CSWA 1NZIA 4Q0QA 3SKJE 3JD71 2OQ7A 4RL7A 2BVBA 3HMYA 3OD4A 1UKGA 2V4VA 3LAGA 1RUC2 4BE3A 5A1FA 3M3QA 5CNAA 1RYYA 5DN2A 1ZZ8A 2EICA 2Y0IA 4ZS2A 4RR3A 1UYZA 3ZPYA 1XJAA 5IUQA 3IMMA 3ON7A 3ZXEA 5EHDA 3WG3A 5JOYA 5GJ6A 2X29A 3NNGA 1JZ7A 3VZKA 3PUHA 4J25A 2QBXA 3AC0A 3NAPA 4Z2WA 1DG6A 2VECA 4OHZA 2XGXA 1DZRA 3BCWA 1MR5A 3OBZA 3O1MA 4BQ1A 3JB8A 1FYUA 3POBA 3OBAA 1BEV2 4COVA 2JG8A 1C8M1 2P1BA 1ZA7A 2UY8A 2J1RA 3MZHA 3AK0A 2WYSA 3T0AA 3J4UH 4BMBA 1R093 5C70A 4NPMA 4SBVA 3O0VA 2BWAA 1CAXA 4H3WA 1ALYA 5J98B 4DEVA 1RUH1 1ZM1A 4XFGA 2E53A 1IS5A 3I54A 1KFUL 1VRH1 2QUOA 3QD6A 3GZTB 4NRMA 2ERFA 3VBFC 1AR61 3KV5A 5FYBA 2VBBA 1YXWA 5HBAA 1DQ2A 3O0WA 5LBFA 4FVVA 3HNBM 2P3YA 4FTEA 3B69A 3GBFA 1DQ6A 4AGGA 1NUKA 1TG7A 1AJOA 3ZSMA 3K3NA 4UW5A 4Z07A 5D8AA 2OXBA 5FJKA 2FCTA 5LB6A 3MLLA 3C7FA 1QJY3 4B1LA 2E7QA 4W6YA 5FO7B 2V5YA 1TZOA 2YGMA 2A73B 1COV3 2WJSA 1CZTA 2D6PA 1TE1B 2X10A 1QEXA 4QX5A 2HYXA 4OVEA 1V6KA 5FREA 3OUHA 3OPTA 5JSRA 2QVSB 4ONUA 5C71A 2QTWB 3KT7A 2FDIA 1FV2A 3LA7A 1AX0A 1MZ6A 1H9WA 1C28A 4V2VA 3ZFEA 5JXGA 4HL0A 4RSUA 3H1WA 4B4RA 1G86A 2GC0A 1QDCA 3OSDA 3W9AA 3BI3A 5A33A 5DG2A 1Y4WA 3HBZA 3N9QA 2BOIA 3FLRA 1HW5A 4XUTA 4CUGA 2EIEA 1FI2A 1TME1 2BERA 4UBGA 3VZMA 3ZXAC 4A42A 4HBNA 1IG3A 4XAAA 2QQKA 1CGPA 5DQ0A 2P2KA 3OGJA 2VZVA 4IW3A 5HCAA 2DCJA 3RZGA 5E88A 2DVAA 4PIYA 1JH5A 2H0BA 3WDXA 5JZGB 4XQWA 2VQUA 1ZX5A 2XOMA 3WQ0A 4ZU4A 1UQXA 3BOPA 2MHFA 2E26A 2Y6LA 3HIFA 3OD0A 4FQ4A 4RR3B 4E8DA 2XL9A 4OLLA 5FIXA 2ZGUA 4AHYA 4CCJA 2CY6A 4DMIA 2NP0A 1SDDB 2JXAA 3POFA 3LF7A 2JDUA 2JDNA 1YNAA 2W52A 3NAPB 2OS2A 2HH9A 4MV2A 3ZXKA 5KC6A 2HEYF 3FBMA 3N7JA 5FYSA 1J3RA 2W2IA 3I59B 4YW4A 3RVHA 2Q1MA 4LBQA 1JZ5A 3POIA 1RC6A 2CV6A 4PLNA 3USUA 4Q0VA 1BBT1 1MS3A 2JB4A 4IV3C 2XLAA 3FE5A 4COUA 1XNCA 1OUXA 1QJX2 2IXLA 4FO9A 5F5IA 1CAXB 1RUJ1 1RXGA 3B3QE 1TMF2 2R063 1IKPA 1O4TA 2R30A 3WF4A 1DYKA 2X53S 2WS93 4KQ7A 3ZFGC 4LHKA 1CZSA 3CF6E 2WAOA 1VP6A 2GP5A 1RUG2 4TLGA 4XE9A 1PGL2 1JUIA 2V72A 3B9CA 3HWJA 1VBB2 3DUIA 2WZPP 2Y34A 4OHVA 2WWUA 3FBYA 3Q9OA 3KCYA 5LY1A 3ZSLA 5JZGC 3H9AA 3JBG3 5T5JA 3WF1A 1XPWA 4DXTA 4Q4X3 3LPFA 5KR7A 1QOSA 1YYNA 5D8AB 1AL0G 3K48A 4AFAA 2FQPA 1F5JA 3MLJA 3R4DB 2RE9A 2ZOEB 1XNAA 3MEPA 3OUJA 1VBD3 2HYKA 5AFEA 3M3OA 1JODA 3URFA 4LBLA 1V6LA 4QGMA 3FFZA 3MHZA 4ISQA 1RJ8A 1LOBA 3MPBA 2JDAA 5I0TA 1HDKA 4QX2A 2HKXA 3UGFA 3CJIC 3NAPC 3UKVA 2D6KA 3PVNA 2YC2A 4GIQA 2F4PA 2P3IA 1YIFA 4XIOA 3ZFEB 1ASJ1 1W6OA 4Y20A 5FQ0A 1F15A 3I7DA 5BPXA 1R64A 4JV4A 3WD5A 2W1UA 3ASIA 1JZ2A 3VDAA 4XC9A 3WNOA 1JZ3A 2E6VA 1QJEA 2VOTA 1AR82 1V6MA 3KB5A 4LULA 1RIRA 2QQVA 3AKSA 5FDBA 4LBMA 3U14A 4ZHNA 3J8F1 3IWZA 1HRV3 2JIJA 2R49A 3LPGA 3TEZA 4U36A 3AFGA 1CR7A 2ZHLA 4PLOA 4QPIA 1JBCA 1ZZ9A 2VUDA 4XJ9A 5JLVA 2CWMA 4ATFA 3ZXFA 1UY4A 1U5XA 5T52A 2HBTA 2WNUA 4IV1C 4Q2FA 4GZ9A 2G9GA 3ACHA 3MFAA 2D6MA 3OY8A 3KS7A 2V73A 1G9FA 4LA2A 5EWSA 2C24A 3RYPA 3WHTA 4C0BA 2GH8A 5A3TA 3OTFA 4IGPA 1W05A 2DURA 2PELA 4TN7A 4A7ZA 1AZDA 1SEFA 2ATFA 5JCTA 3FMGA 3AXEA 2G4IA 2WT0A 3VKMA 1CAUA 5SV5A 1FATA 3I2KA 4LKSA 2Z42A 1AF9A 2WNOA 3M3EA 2WINB 4OMCA 2MEV2 2WO1A 1ZBE3 4YG3A 5FY4A 3S6PA 2BPA2 1RUC1 2VZUA 4XETA 4COYA 4UW6A 4D3WA 4WZCA 2JICA 1YQ5A 1R1ZA 2VMEA 3AMQA 5T5PA 1R091 2V4AA 3ZYIB 1N47A 2ADEA 4Q5OA 3VKNA 4ASLA 5K0UB 1JYIA 2PAMA 3DXTA 2RS52 5FLIA 3AKPA 3RWNA 4XDQA 3H8RA 1SLBA 4JAAA 1J83A 3CDZB 4QKFA 1D7PM 5C3SA 1SPPA 3QACA 3FFQA 4MXWA 3DPRC 1DYPA 3QH7A 4XDOA 2WO3A 1BEV1 3VBUA 4LLOA 4META 4NHLA 1VBE2 2WNVC 1UYPA 2PYTA 4H2AA 4GXLA 1IGOA 2VTFA 1GMMA 4LMFA 5F5QA 1W8ZA 5IFPA 3FWEA 5C4WB 2PFWA 1FOD3 3HOBA 3O5SA 4YPJA 4LE3A 4PBPA 1H2LA 3KT1A 1VJ2A 3GXUA 3T4VA 5FYCA 4QU1A 3U4SA 3O1RA 1ZVFA 2GMPA 2XVGA 2Q1ZB 2WUHA 4IEQA 4K7JA 4XACA 4ASMB 5IK4A 1ULDA 4FOQA 3CZJA 5F3IA 5ABJB 2RS11 1UXXX 2W87A 1COV1 4BK4A 2A75A 5LRSA 2GNDA 5A3PA 1EAH3 1S0FA 2DBIA 3CIHA 4HVRA 4Q4W3 1DU3D 1LODA 3SCFA 2E32A 1UL9A 1O3RA 2OT7A 1KGYA 3WHUA 3DV8A 4ZZ5A 4P02B 4WV8A 5FQ0B 1Z78A 4AEMA 3VBRB 1JOPA 4LO5B 3QBQA 3WNLA 1KFXL 1QJU3 1WCQA 4IGQA 5FPVA 4F7ZA 1US3A 2ZGRA 3KGLA 3UGHA 3AMPA 5C3PA 2ZX3A 3VZLA 4OMDA 1NQJA 1I9RA 2IVIB 4UXAA 2K46A 5K0UC 3RZZA 4FPGA 5EYXA 3RYRA 3AYCA 4UFJA 4QX0A 5FPAA 4DXRA 5DZGA 5FP3A 2XXZA 1RVF1 5DAVA 4KG8A 1JYVA 1LHNA 3MGUA 2VJXA 3BU0A 5BNQA 1S2BA 5KHIA 5IVCA 4HANA 1ONAA 2H6CA 2FZ1A 2PA7A 3IDEA 3H1YA 1I5PA 4XEZA 3IKWA 4M3CA 1V6IA 2JKBA 3WLUA 4AFDA 1W2TA 3OY8B 4EN6B 4P08A 5C4WC 2ENRA 1EPWA 4ZZ8A 5ERLA 2ZKNA 1GV9A 1RUNA 3ZPOA 2EIDA 5BNOC 1RHI2 1O91A 2YV8A 3I97A 1JTZX 1CX4A 2QQMA 3VD9A 4UFHA 1AHSA 2B9VA 3DF0A 5FZCA 4AQ6A 5C6CA 4PI0A 1DQ4A 1H0BA 1OQDA 2J1EA 1NX9A 2WZEA 3F2ZA 5ABJC 5AC93 4AI9A 4EV0A 1BZWA 1UOGA 2HLEA 3UJQA 1VMHA 5BNNA 2ZGLA 2W46A 2R32A 3LA2A 3IIAA 2LRPA 3DGTA 4DUVA 2R1DA 4XJUA 2HWB2 5G05L 1U5YA 4GJZA 4YFZA 3BKZA 3EMRA 3ETPA 1HN1A 5IFTA 2ES3A 3VBRC 3GHMA 5EP9A 1JS9A 1RUI2 2RR12 4HSLA 4DNYA 1Z0HA 2OUHA 4MGZE 4IE6A 2R061 3ILNA 4KG0A 2PHWA 2XJPA 4EZ4A 5FKBA 4NIHA 1Q5OA 2WS91 5FXXA 3VKLA 1SPPB 3INAA 1N1VA 1S0CA 1KDMA 4MXWB 5HCBA 3WV6A 3R4UA 4E2SA 2CDPA 5JI7A 3W21A 4AYUA 2YU1A 1JN2P 4QKBA 4BQ3A 5FPUA 1ZBA3 2AYHA 1LHVA 2GNBA 2R043 5HPOA 1J84A 5A6QA 4LPLA 5IAVA 4DOUA 3JBG1 3MW2A 2UYAA 4WM7A 1X7NA 2W94A 4WVWA 2XKOA 1ULFA 3R6SA 4OHYA 1DGWA 1QOOA 2W1QA 4AI1A 1CIYA 4LTAA 1PO12 1R1A2 1VBD1 2QDRA 2NM1A 2PLV3 2W1WA 5H9RA 3CBNA 2GH2A 2VTXA 2A5ZA 3AXDA 4AVSA 5FO9B 2VY0A 1GU3A 3DN7A 3J9SA 4CCMA 2ARAA 4Q4V1 1JZ8A 2YUEA 3W20A 1HV1A 4ES9A 1UPSA 3C7HA 1UY1A 4XQDA 1YI9A 2DCTA 3OG2A 4LO6B 3LFMA 4J6GA 4U2AA 2N7GA 4BM8A 5ACA2 3K77A 2X09A 2Y6JA 3QH6A 5CZKA 1OOPC 4IETA 1U5ZA 3LWCA 5FY8A 3WNKA 5DXDA 4R9DA 2ZHMA 1NXMA 5FBJA 5GZDA 1OVPA 2Y38A 1WCKA 2XUEA 4X8NA 1HRV1 2OPKA 4TSVA 1RUE3 1WBFA 1H1IA 2A6XA 4FOWA 1DGRA 3MW3A 3BGAA 1UY0A 3QLQA 3SHRA 3PVEA 1C5HA 3TNQA 4LXLA 2ETEA 4AQSA 2AENA 1O8PA 5CISA 4M3CB 1F31A 2VBPA 1LULA 5A6XA 3AYDA 1NLQA 1VBA2 2BW8A 5CVRA 1O4ZA 5APAA 1KS5A 2XDVA 2ZKLA 4BISA 1AR81 1V0AA 2Q1FA 5FYIA 4EWEA 2QZ3A 4LEJA 2CDOA 3JD73 3ATGA 3TBDA 4KU7A 5EPAA 3WQ1A 1W2NA 4BQXA 5KXBA 2B8MA 4XZPA 3BIEA 1WZXA 2V5DA 4QHBA 4YZ5A 5A32A 3THCA 4GWNA 4FI9A 5GLTA 2WBKA 2ORXA 2Q8EA 1MS0A 1QNWA 3E5UA 4GH4A 4I3GA 3USSA 2QDNA 5BNNB 4ORFA 2C4XA 1ZBE1 2VZSA 1OURA 5CBLA 4D8MA 3I2JA 2IXIA 4RS5A 4DO0A 2FDJA 1HRI3 4DFSA 3MIEA 3IAQA 2GN3A 1GQHA 2XLFA 4ZXEA 2ZCWA 4OUEA 1S0DA 1QDOA 5FZFA 3WX5A 4Y5SA 2HWE2 1SFYA 4H14A 1C8M3 4HONA 1UIJA 5FXWA 4V2WA 5FY1A 2YMZA 1G9AA 1GOFA 1H8TB 1W39A 1PMJX 1YLLA 4QHZA 2A1XA 2W1SA 3CLPA 4HLTA 5LA9A 4MHUA 2PHXA 2DYCA 5FCCA 4BB3A 5F3CA 2VVEA 3T2QA 1RUH3 1OBNA 1W6PA 2A3XA 2EXJA 2XBO1 2WZR3 4Q4Y2 3WG2A 1GICA 1DZTA 2LROA 1DYOA 2ZABA 4OUMA 1X9TA 3AKRA 5T55A 1H8VA 1OF4A 1FOD1 1AR63 1Q8QA 3L2HA 4RGAA 3LIHA 4WM7B 4BQ5A 2XMLA 1GP6A 1S0EA 3PJYA 3VD7A 2WR9A 4YG0A 1W9WA 2DCKA 4Q8LA 4OQ8A 1POQA 4NPRA 1AYN2 1E5IA 1WMDA 4HPKA 4NOTA 3LEIA 3CHXA 1FXZA 2D3RA 1LAJA 3SH3A 1OVSA 4AW7A 2VZ1A 3T4HB 4AK3A 1UD1A 2CAVA 1KS4A 1QJU1 4MGYE 4XABA 1LB2A 4O9EA 1PO22 3GHNA 1EV11 4JGYC 1H4HA 3MIGA 1JU3A 3UJOA 2VVDA 3TEWA 2VMFA 4XF0A 1O3TA 1JYTA 5DDJ3 5CIRA 1GP5A 1VMFA 2DUOA 1UN1A 1H8TC 2J1AA 4L11A 3ME2A 5JMOA 4BOWA 1PIV1 3AJZA 4CP9A 4XVHA 3I3QA 3VBFA 1SACA 5A3OA 3OGRA 3UNPA 3IB3A 1D2SA 4DXSA 3GZAA 5IVFA 1CAWA 1D0GA 1G8WA 3PHMA 3WNXA 2QQUA 3AM2A 4WM7C 3RJRA 3U0ZA 1PNFA 5A1LA 4JQTA 1L7QA 2ZA9A 4N90A 1YFXA 4RD7A 1QKQA 5GM0A 4MOAA 2Y60A 3LA3A 3E6BA 3M8LA 3ZXJA 4YZ4A 4N53C 4NUBA 5AC91 3VHPA 4AI2A 1AR92 3HNMA 5FZ8A 1S4CA 3H3ZA 2Z5WA 3SNMA 3BU7A 4W4ZA 2VU9A 4QXCA 4RS5B 1NZCA 3OYWA 1HQLA 3ZN5A 1TVGA 3LSDA 4XIKA 3AZZA 4M01A 2IXHA 2NMOA 1LU1A 1PHMA 4QXKA 3GDBA 2R7EB 3TRSB 1VIWB 2RS32 2VCAA 1D4M3 1AL22 1W0OA 2TBVA 3PUSA 1XU1A 2AACA 2GN7A 1BYHA 1ENQA 1K5JA 1AYM1 2VQAA 1KXGA 3CMGA 4XJ8A 1SLCA 4YW5A 1WLCA 3UETA 3VL9A 3NKGA 3WEZA 2VULA 4XUPA 2BDRA 1ZBA1 2R041 2W39A 2KA3A 4XDPA 2FDKA 3R4SA 3K4ZA 2WC2A 3ST7A 1MPXA 2R071 1Q8VA 2EXIA 4NHMA 3T1MA 1W8HA 1OA4A 2YB7A 3KVAA 4XFIA 4CYDA 2Y8KA 1YJLA 3U78A 1NQDA 3NMBA 3BB6A 2OZJA 1R082 2PLV1 2CYFA 1Z7S2 3LDRA 5FY7A 2R1BA 1RUF2 4HG6B 3LDKA 3AL6A 4P9LA 4Z1VA 3IZOA 1WLTA 2I2SA 4OFGA 1M4WA 2AEYA 2XJVA 3TN92 3TWIA 3CJXA 4FSJA 1B35B 4E4DX 4QB6A 2DV9A 3PMEA 4NMIA 3PDQA 1PO11 1R1A1 2RMU3 4IV3A 4Q27A 4QU2A 3BPSA 4WBBA 4G4FA 1GP4A 5IK8A 1C5IA 1XQNA 4XURA 3QOPA 4S2DA 5FY9A 1UOJA 4W65A 5DG1A 4YSFA 4CDWC 1O6UA 3TAYA 2QKDA 2GMEA 3WNMA 1RUE1 3GZEA 3RMXA 1HB4A 4UYBA 2MNGA 2BP6A 3ZFGA 1ULEA 2VXJA 3VBFB 1FMD3 1SCSA 1GOHA 1PGW1 1VE0A 3LB9A 4X6QB 4ATEA 2CWSA 1BMV1 2VD7A 1CAWB 1S1AA 3CEWA 4RQPC 3RYKA 1BKZA 1JUHA 5IVEA 4FBFA 4F83A 4PI2A 4JGZB 2RHPA 1PZ7A 4QHOA 3W58A 4NWWA 1H1AA 4Y26A 1PGSA 2F4LA 4I0BA 4MXVA 2D3SA 3TNPB 2EVXA 2G9ZA 3T30A 3WQ7A 2C1FA 2D98A 3V56A 4BMEA 4BZ4A 3VDDC 2VMIA 1NG0A 2ZX4A 2HBUA 4IEXA 4Y5TA 1OA2A 1UOFA 3ZYFA 2NZ9A 3POWA 5FZ9A 1ENXA 1VBA1 3ZKYA 4R4ZA 3CJIA 3LCPA 1YEWA 1HRI1 2RM23 3OYWB 1FPN2 3VZJA 4E27A 4LT5A 4JTNA 3I59A 2EIGA 4CU9A 2IZWA 1B35C 1F35A 1LKNA 3THDA 5DABA 4MGIE 5JOXA 1RUC3 1VRBA 2Y6KA 3J7MA 4OHXA 3PIGA 1G9BA 3AKTA 3AJYA 4X8PA 2O8OA 3MFCA 2A71A 2BRTA 3FX3A 5FZ0A 2ZX0A 4AI3A 1FX5A 1GNZA 1HXS2 5LA1A 2LTNA 2EAAA 1OHFA 1UKRA 3N9LA 3SCGA 2YZ4A 1US2A 2WZR1 4BIFA 2D7FA 2CAUA 4YW3A 3C7GA 5A7QA 1BEV3 3D3AA 3N9PA 4LK7A 4Y1ZA 4WVMA 1PZ9A 2WIIB 2I07B 4IV1A 3WUCA 2A3YA 4XAEA 1QHDA 2GDFA 4DY5A 1UYXA 1OA3A 1PZ8A 2H0VA 1DGRN 2XWBB 2WNEA 4CU6A 1JYNA 4JGZC 3VBSC 3AP4A 4IEOA 1W8OA 5KHGA 2PHDA 5E6HA 2OVUA 1IS3A 4LKEA 3POGA 2GNMA 2EXKA 2VNRA 5IVYA 4BQ2A 2RS13 1QJY2 4R9AA 3WZ1A 2AUYA 3MF6A 2JIGA 5A7PA 3HN3A 5F1RA 4BQWA 5I93A 1JYWA 3QCWA 4JX0A 1JU4A 2NQYA 3M3IA 2TUNA 3PLQA 4IV3B 5JWPA 5KXCA 4A45A 4BA6A 1LR5A 1H2MA 2ADDA 1CZVA 1XC6A 2UY9A 2E63A 3ALQA 3TOJA 2Y64A 5DDJ1 4OUSA 3GM8A 3UV9A 4P00B 2W92A 3VGIA 2GSYA 2VOVA 1Y43B 2PAKA 1O5UA 3PL0A 4YM1A 4RGGA 5A3WA 3POSA 3A23A 1GKBA 3E5XA 1JOJA 3ZFGB 4QXBA 1JXNA 4OI0A 3DPRA 1WWYA 1RVF3 3RS6A 3ZXGA 4AOCA 3J7HA 2QNKA 4A2UA 3B9IA 4LBNA 3EQEA 2WNVA 3I2GA 5F8PA 1OKQA 1NE6A 2DVDA 4I2OA 2VUAA 4XFBA 4MX3A 4J1WA 2D93A 2PHUA 2AH2A 3THTA 3WXPA 1UYYA 5BUVA 2Z2SB 2VG9A 4GQ7A 3FUOA 4LO8A 4DPNA 4LBQD 1PMIA 4XZUG 5A6ZA 2HWC2 4MUVA 3OEBA 3NV2A 5CFCB 2W08A 1LEDA 1UX7A 5C7GA 2YBSA 3S5AA 1CPNA 4AI0A 4PF1A 5T5LA 3SC7X 2FDHA 2A6VA 4LHNA 2RDNA 3APBA 5EXOA 3CJIB 3WW2A 1TNRA 3WCSA 4XFCA 1UX6A 3I49A 2JWPA 4EWAA 3I2IA 2VTXJ 2VOWA 1ODMA 2JDPA 1PX4A 2ILMA 4K20A 2PTMA 4BQYA 4D6SA 2BUKA 3N7LA 4WZFA 4AAPA 1RJ7A 1W8NA 4Y4RA 4B4PA 3VN4A 4CDXB 4XF1A 4Q0SA 4LITA 3HBKA 1D4M1 3ZR6A 3GALA 4N8MA 3K51A 5K0UA 5FRAA 5FZ4A 1TEIA 2D97A 5DUXA 1MVQA 3MUZ1 3ES4A 2D44A 2RVAA 3IDAA 3ZSKA 4RHV2 1LEMA 2A3WA 4P9IA 2CSGA 1W90A 3B7MA 3EHKA 4IEZA 1XE7A 1XNDA 3H3LA 2FHRA 3LEGA 1N3PA 4WVMB 3I2FA 3FJSA 2GZWA 3PU8A 4YGCA 4IV1B 4KNCA 4LHLA 5J7MA 1JYXA 1QJX3 1ENSA 1X8EA 3RI9A 2DUQA 5C4WA 5JUVA 2I45A 2Q30A 4CTEA 3T0DA 1PVC2 2ORZA 3B93A 5BNOA 3O1SA 2ZGPA 3KD4A 5GZFA 2HJIA 4LHSA 2IFWA 2QQOA 4P9YA 3ZLIA 4LBJA 2UYBA 3D4KA 1OQ1A 1T6GC 4YFWA 5CFCC 2J1TA 4KU8A 5ABJA 1LOEA 1RUG3 1SFNA 4R4XA 3VD4A 5BY5A 2JE9A 2YPJA 2ZPXA 2WLQA 1VBB3 5JIAA 2WWSA 5E8AA 1YHFA 2B45X 2BBAA 2DVBA 3NNJA 4MSVA 4Q4V3 1KQRA 3B94A 2EA7A 2Q8DA 2RMU1 3SLIA 3DYMA 2UURA 1X9PA 4DEQA 4FCAA 3U07A 2SLIA 1BK0A 4JHTA 1Z7S1 2E33A 1GWLA 1N1YA 1ZZ6A 3VBRA 4INDA 2AR6A 3NVCA 5F37A 4C0HA 4YGEA 2CTVA 5C33A 5GZEA 4CDXC 5I0DA 3RG0A 4N9IA 4RN5A 4BJ0A 1H2KA 4IEPA 3IDBB 5GLZA 1W8WA 4K40A 4NROA 5FMBA 2ZGTA 3TN91 3WCRA 5D21A 3DPRB 1DCSA 1DGWX 1DF0A 3P6BA 4LQRA 4OHWA 3WT3A 4BH9A 1FMD1 1LENA 1GNYA 2XJUA 2XQXA 3AZWA 3LQCA 3MICA 1Y3TA 5JXIA 2WNVB 5C8CB 1SMVA 2IVJA 3HNYM 5FMOL 4QAWA 4S2FA 1V6OA 1OH4A 3CU7A 1UMHA 4FQZA 2VZRA 4RFRB 3WG1A 4A4AA 5KWRA 3RGBA 4XTPA 2BBVA 1W2AX 4NHKA 4IEWA 2W91A
chains in the Genus database with same CATH topology
1AR72 1WCSA 3IPVA 3N7MA 1V9U2 1AR83 2BNNA 1KDKA 4HK8A 4HK9A 3KLSA 1IZ3A 4HT1T 4CDUC 4DB5A 5K8SA 5JIUA 3AMMA 4AG4A 1G9CA 2DU0A 2ZGKA 4DRRA 3MDPA 3ZO0B 1JYCA 4HVOA 1F8VA 2RM21 4HKLA 4HZFA 5FTTC 4N7IA 3VUOA 1VB2A 4HSJA 1LGNA 1Y7BA 4JCKA 1YFYA 3VBHC 2ET7A 4Y1VA 2ARBA 2A6ZA 4LR4A 3MF9A 3ZYGA 1OLRA 1ZNPA 1OPMA 1QQP2 2X8KA 4PLMA 1OOPA 4FPKA 3PVBB 3NO8A 2WLPA 4BPZA 4AEKA 1EYBA 2MEV3 2K9ZA 1QWRA 3D0SA 3LKJA 5I0RA 4GA9A 4B4QA 4IEYA 2XBO3 3WY6A 5C8CC 4QM9A 1QJZA 5K9YA 4WVZA 5JR7B 4M0NA 4FAHA 2RS53 1TQ5A 3HT1A 4F8AA 2ZS6B 5BNOB 3I2DA 4FP2A 2E7AA 3ILFA 1BQPA 4FTBA 1VBE3 4YZ2A 2W68A 1DQ0A 1RMU2 5FOBB 3THPA 1EAH2 5J96B 2A7AA 1CD3G 4XILA 3AFKA 4DRVA 1X33A 5H9SA 1EV13 2BWCA 3AB0A 4MGKE 5DZEA 2YDEA 2ZHKA 1EPZA 2XJQA 5KBFA 3I4IA 4FAGA 5EV7A 1OD5A 3GZUC 2E7TA 1J3QA 1SDWA 1UZZA 1PIV3 3WUDA 3FC0A 3JU9A 1UU6A 4Y22A 1MVEA 2Y0OA 3IPVB 3WG4A 3M1HA 2AZ5A 5T5OA 2WQZC 1Q56A 2R6QA 1J1TA 4DQAA 4AI8A 4YGBA 1WA4A 2HWF2 4WM8B 4RA0A 3UL2A 1S0JA 3HD8B 3M7AA 1PVXA 1QGLA 3E5QA 4N43C 2B46X 1HLCA 1MS4A 2YXSA 5KC5A 1NOVA 3U11A 3LGRA 3SH4A 4I02A 3ECQA 1OPOA 3B01A 4Q8KA 2R0FA 5FMOS 1RHI3 2UWBA 4ES8A 5L36A 2P17A 4JGYA 2HWD2 4AF9A 1OOPB 1J58A 2DTWA 5KXEA 2FBEA 2WFF2 1BJQA 3CO2A 4BWOA 3SITA 1H8TA 3J26N 1WBLA 2WT1A 3ZIWA 1AYM3 1DBNA 2JG9C 2HWB3 2JJ6A 4QQLA 2YROA 3LOBA 4GMP0 3V0BA 1QJX1 3KSCA 1JW6A 1RUI3 2B7YA 2H6BA 1IS4A 2RR13 1MEC2 3IMNA 2R073 2ZX1A 4Z82A 1TMF1 5DUVA 1ZZ7A 2DFCA 4HN1A 4BIOA 4KWJA 4EROA 1YCIA 2HEWF 3FLPA 3JZVA 1OMIA 3LOIA 4RHV1 1ZRFA 2ZGQA 4H7MA 1ND3C 4WM8C 4DXZA 1OLQA 2G9FA 1LECA 1HX6A 1RUG1 4HETA 4N53A 1PGL1 1GR3A 5EJ3A 1VBB1 2WL1A 2I74A 2KXLA 2UWAA 4FXGB 3AZYA 3G7DA 1VBC2 4IEVA 2BNOA 1PO13 5JAXA 1R1A3 4Q1PA 2JEMA 2PAEA 4F3JA 4UBHA 4QPYA 4B29A 4FPLA 1N1SA 3V64A 4K6BA 1MS5A 4G9SB 3O0XA 4M3CE 3M4FA 2R16A 5J37A 3KT4A 3M2MA 2XPJA 4Y22B 4QT6A 2WSVA 1MS8A 5ACA3 3N36A 4AWDA 5T50A 2VW0A 2CGNA 2HEVF 3WP4A 1QH6A 1QY4A 4E2GA 2A6WA 4GB32 4A7KA 1SLAA 1N3OA 2ZJCA 4JC1A 1G9DA 4Y1YA 3L2YA 3JD72 4AVTA 1A78A 2IXKA 2VNGA 5GZGA 1BVVA 1VBA3 4CRQA 5I8SA 2B42B 1SCRA 2ZTNA 1O3QA 5BXXA 4XXPA 1UAIA 4JGYB 2D43A 4YVSB 3A0NA 5JPNB 3U10A 1CN1A 4CDWA 5JI9A 1C8M2 1NA1C 2MEV1 3NSTA 4YVWB 4PDWB 1GFF2 1REDA 3WR0A 3ZYPA 4HFSA 1LOGA 1RUD2 2WA4A 3V0BB 2UWCA 3D5OA 1RUH2 2HWE3 2O1QA 1J3PA 2YHJA 4RQPA 1BCXA 1VRH2 2RS51 4BLIA 4GMP3 3NV4A 4XW3A 3WDYA 2ZACA 2ZZQA 1DFQA 4N53B 4QQPA 4W6XA 5CADA 4Q4Y3 1VBE1 4XQ4A 2VVFA 1NXD1 2ARXA 4PCRA 3VDDA 5I0SA 2WSUA 4AFMA 5GALA 2P3JA 4B7EA 4IESA 4IERA 3VBOB 4M0HA 1MZEA 3D0JA 4JVAA 4XTMA 2DF7A 1B35A 1XU2A 2B5HA 3SISA 2DWRA 1ZRCA 3MIHA 3FUQA 3HT2A 3H3UA 4XJAA 2F6BA 4YVSC 1WW5A 1DLLA 1CONA 4L97A 1CVNA 3S0MA 1LOFC 1KD7A 5I0UA 3BIWE 4YVWC 5F6KA 4PDWC 2CL2A 2BGCA 4CEWA 1J59A 1TME2 4J1XA 1PO23 1EY2A 1HQWA 3WDVA 3RSJA 1S2KA 4TWTA 1MS1A 4DZGA 4B3NA 2QCSB 4JGZA 1ZA4A 3VBSA 2P34A 4NO4A 2KM2A 4AVAA 4CP0A 5FOJB 4QQHA 1GZCA 5LEKA 1HV0A 4I30A 4LBKA 3SCHA 3C2UA 4FOYA 3ES1A 3VBOC 1C8NA 4QQ2A 1A3KA 1RHI1 2HWF1 3R05A 2UU8A 4EN0A 2DU1A 3KMHA 4PIXA 1BXHA 4KBBA 4YZ3A 1AVBA 2BFUL 4CDWB 1BBT2 4M3CF 4NVPA 2ZHNA 3O14A 1C3HA 3L9JT 1IOAA 1H30A 2VUJA 4XJWA 1G7YA 2HWB1 1RUJ2 1LOCA 2Q4SA 1WLWA 5CB7A 4RQPB 1RUI1 2RR11 5EFUA 5AVPA 4MZUA 3ROUA 2RS33 2OIIA 3JB4C 2V09A 1AL23 3CNAA 1FAYA 2ZZJA 1VALA 3UK9A 3MIDA 5IK7A 5D1IA 1BK1A 1FNYA 2VW1A 3GNEA 3VDDB 1RINA 4QPGC 5EZWA 1YFWA 4IEUA 1O5LA 2AREA 2IXJA 2FZ2A 2DVGA 2RJKA 2DCZA 4TLFA 4URTA 4DINB 1GZWA 1A6CA 4Q1RA 4CZSA 3RPQA 1MQTA 3EO6A 4AEDB 1O7FA 2Q8OA 2PHLA 3VZOA 1UCXA 4K21A 1R083 1WMEA 4AVCA 1Z7S3 1RUF3 3ZFFA 2DCYA 4B8EA 2Z69A 1ASJ2 5DUWA 4AE2A 2VH9A 2EAKA 3NV1A 5E1RA 4FOVA 2DUPA 2GC3A 3TN93 1X36A 1KJRA 4NWVA 3WW1A 1LHOA 3BPZA 4CEWB 1AX1A 4AHWA 4LUMA 2VMGA 5KHHA 5ACA1 1GZ9A 5IK5A 1F9KA 4AVVA 4AHXA 4A7YA 3J8F2 4QD2A 3AMHA 2ZX2A 1B09A 4Y4YA 4CDQC 4CEYC 4S2HA 3ZN4A 4XPVA 3FHIB 4KH9A 3VBSB 5FPXA 1QXRA 3N4MA 3ZXDA 5CFCA 1NY72 3VHRA 1QOTA 1CJPA 2XUMA 4YM0A 5C9AA 1POV0 1RB8G 1YIPA 4P9WA 5J3UA 4P5HA 1SLTA 4H55A 4E4SA 3AYAA 4L2NA 1ND2B 2D6NA 2WT2A 3T2TA 2CGOA 2Q5TA 2XB6C 2EXHA 4AEDC 1S0IA 3KCXA 3AP9A 1K5MC 2D6OX 2GAUA 4CDXA 3PVOA 5GLVA 2DVFA 5JSPA 5I91A 1O3SA 1DDLA 1IS6A 1R092 2PHFA 5E16A 1FPN3 1I3HA 1UU5A 2LM3A 5CFDC 3H0OA 3VKOA 4B7KA 4QMAA 4AXOA 4CEWC 2HWE1 1MS9A 2X5IA 2VOKA 3B00A 4BCUA 2VGDA 5DZFA 5J36A 1NCRC 1HXS3 2IXCA 3POYA 4GMP1 4ISRA 1D0HA 1IHMA 4CDUA 2NYYA 5L7OC 3ZYRA 4Q4Y1 3WDWA 5C8WA 1REFA 1RUD1 4BLJA 3EJKA 5BNPC 2BFUS 4TZDA 1GZWB 1DGLA 1AUYA 1FT9A 4UW4A 4FPCA 1VAVA 2RS12 1COV2 1MQTB 3B02A 3OCPA 3IM0A 3P3PA 2GMMA 3VBHA 1ND2C 4XF9A 5AVAA 4AFCA 1A8DA 4PJYA 4FPJA 1AYN1 1UF2C 4YW1A 4AQ2A 2VOXA 3ZFFB 3HR9A 1CPMA 3ACLA 4OULA 2GU9A 3BOWA 4HKOA 4YRDA 1NCQB 5E89A 3UKTA 1WD4A 4AGVA 5SV8A 2BYVE 4Y1XA 1ULCA 3ZVXA 5CU1A 5F6LB 3V0AA 2CGPA 1YI7A 1PO21 3B5LB 3ZN6A 2ZMNA 3KGZA 5C8CA 5L73A 1RVF2 5LK7B 4JRAA 1W2UA 5JVVA 4ZU7A 4R9BA 4EJRA 4K1ZA 4Z92B 2B9UA 5T3NA 4QGNA 1QH7A 1H4GA 1Y9QA 4Q29A 1F2NA 2WA3A 5JPMB 1V6NA 3ILRA 4AEJA 1JHNA 3H7JA 5C9AB 4GALA 3H8UA 1VAMA 3IBMA 5CG8A 4P9GA 1LOAA 2XJTA 5CA6A 2Z79A 2OUJA 3X29B 4RFT0 3PNAA 3NL1A 4HN0A 4ZXKA 1C1FA 1MQTC 1POV3 2HWC3 3BODA 3KZ4C 5TSWA 1RL3A 2QQPA 3EBRA 1QNYA 1IPJA 1X82A 2YY1A 1AR91 3WP3A 3ZFFC 2O8QA 2ZGNA 1AJKA 1NCQC 1OQEA 1V70A 3TYJA 2XJRA 5JOWA 1PNGA 1AX2A 3P3NA 1ENRA 3SXWA 2JECA 2D40A 2R062 4XFAA 2X5IB 3HN1A 4KWKA 2WS92 4MH0E 5GKAC 1SBFA 3WW3A 2RS31 1LU2A 2IC1A 1AL21 2JG8B 2LUWA 4JQRA 4AGRA 5F9TA 4FPEA 1TMF3 4CDUB 3ZXLA 2ZBJA 2QE3A 3JBG2 4RHV3 3RDIA 1XNBA 4Q4X2 4N43A 1SBEA 3WVJA 2NLRA 1SLIA 3A4UA 4OI2A 1W6NA 1RUOA 5C9AC 2VMHA 3GBWA 3U4XA 1LTEA 1VBD2 2Y26A 4GKXA 3O7OA 2JX9A 1W6MA 3VBHB 1PVC3 1R081 3BALA 3ZIXA 1QMJA 1LESA 4COZA 4Q4V2 1RUF1 2O0OA 4FP3A 4AQTA 1UIKA 3ENRA 4JDNA 2JE7A 3OBRA 1Q8OA 4RR3C 1WW4A 2VNOA 3FLTA 4LUKA 2OW4A 3M70A 3V0AB 4M00A 4X6RB 5CAZA 2JG9A 3ZN6B 4XFHA 2BEOA 4XYXA 5HCFA 2X5IC 1HRV2 1WCDJ 3ZDSA 3VHNA 2JG8C 5A33B 3E6DA 1W0PA 1WW6A 2ZAAA 1ND3A 1YUDA 2SBAA 4WM8A 4S2GA 1UMZA 2EF6A 4I09A 5J09A 3G6JB 4FPFA 4GKYA 5A3LA 4AVBA 2OYZA 4YW2A 1AR73 5BYNA 3WP6A 4L9BA 4OZXA 1V9U3 4LBOA 4UW3A 1ZBE2 2C0ZA 2IWGB 1NY71 3VKFC 1APNA 5GZCA 1A8MA 1MZ5A 5D8AC 1NLSA 1CJDA 1H1MA 3OGGA 3MI8A 2D5HA 4JDOA 1W6QA 3I8TA 1FPN1 4TYSA 4PF5A 4XHXA 1KJLA 1RITA 1PM7A 5BV6A 3UKNA 2XVKA 5B2GB 4LO4B 4ITCA 1DZQA 4LBQB 4GWMA 1S0GA 2C9AA 1QU0A 2ZGSA 3NWKA 3USUB 1QQP3 3C3VA 1OI6A 1HXS1 2XJSA 4QM8A 2XBO2 4XMAA 4DS0A 3E97A 3ZFEC 2MPFA 1LGCA 3CL1A 2ZMKA 4Z8BA 1FOD2 2E9QA 4P9XA 4R52A 4N43B 5FLHA 5JOZA 3WOGA 1WW7A 1S55A 1W6NB 1AXKA 3O12A 4XF3A 3DL3A 4W6WA 1W6MB 4COWA 3PMSA 4LO7A 4Q4W2 1REEA 1YO8A 2BQPA 5FFOC 2XG3A 3IN9A 2OZ6A 2GC1A 2PN5A 1QJY1 5GLWA 4A3XA 1QJU2 3VHOA 1WMFA 4Q26A 1H2NA 1EV12 1NA1A 4LE4A 1EP0A 1VR3A 2EALA 2WFPA 4QQOA 4XBLA 1RMU3 3R0RA 2JG9B 4EWDA 5KHKA 4OI1A 5JDBA 2A70A 3NKTA 5LEJA 1PIV2 1W6OB 4Y20B 4IQPA 1NYWA 3HAGA 5FPZA 1KRIA 4YLZA 2JD4A 1O4YA 1ND3B 2Q0AA 1SQ4A 2PHTA 4FXKB 3IT8A 4XBNA 3RI8A 2YYOA 5HI0A 1IQAA 4MYEA 1QXPA 1UZYA 4C90A 4YNIA 4QPIB 4E4ZA 3LSEA 1IPKA 5AC92 1N3QA 1POV1 2HWC1 2WNUB 1DIWA 1Q3EA 1DQ1A 4EN7B 2VW2A 2HWF3 5HXVA 3N7KA 2NN8A 4YVSA 2ZMLA 4L8QA 5J48A 3BTAA 5IT6A 3JQXA 4GULA 1W6QB 1LOFA 1CAUB 5KHJA 1LHWA 4EN9B 1NLRA 1ZYBA 1XXNA 4YVWA 1XYNA 4PDWA 4FPYA 1ZZCA 1XE8A 1UW8A 1PK6A 4KGQA 3JUUA 2HWD3 1AYM2 1D4VB 3OBTA 2D5FA 3MPPG 5K7PA 5AFBA 1LRHA 2WFF3 1ZBA2 2R042 4CP1A 4IL7A 4O9GA 2R072 3AMNA 3RNSA 5CG9A 1N1TA 4JRLA 5FBZA 2QFEA 3VLBB 5LRRA 1QXJA 3EXUA 2P37A 4LA3A 3VBUB 4HMZA 2PLV2 4YM2A 4I3PA 2B39A 1MEC3 4XHBA 3VBOA 4QPIC 2WKKA 1RGSA 1PVC1 3RJ2X 3WDUA 3DKWA 4XOGA 4K8FA 5GLUA 3GBGA 3HQXA 4C91A 4D69A 4XBQA 4QGLA 1C4RA 2WNUC 4Q4X1 3S7IA 3IDCB 3AYEA 3PJQA 3S30A 4K9SA 3N35A 1NA1B 4YYOA 1D2QA 1M06G 3AZVA 2PHRA 4N9HA 1YRZA 4G3YC 1VBC3 3NV3A 3W59A 2LALA 1Q8SA 2XWJB 3JCIA 1WD3A 2K0GA 1RUE2 5JSOA 2A6YA 4FTSA 4JDMA 2ZAHA 5FAXA 2QZ2A 4D7YA 1KITA 1ZRRA 4Q0UA 4K1YA 1GBGA 4D7TA 2VXRA 1PGW2 3WW4A 2GC2A 1G6NA 1BMV2 3N3HA 1GANA 3ZSEA 4R8HA 3AP6A 1F5FA 2C5DA 4QPGA 1OSGA 1GYKA 5FLJA 2FMDA 1AR71 3VV1A 3VBUC 2D6LX 3H50A 4HKWA 1URXA 1XYPA 2E51A 3GF6A 4SLIA 1V9U1 4PBOA 5LK5A 2DFBA 3V65A 5HCAA 1OFNA 1XRUA 4GB33 4XXAA 3WINE 1HRI2 4D94A 5KXDA 1YJKA 1RTVA 4E2QA 4YZ1A 1FNZA 1I6XA 1ULGA 2K2SA 3H1MA 4D7SA 2W0XA 4PQ9A 1DHKB 1TNFA 4E9KA 1GNHA 2NMNA 3TB0A 3ZSJA 4FT8A 2AGSA 1PK6B 3NW4A 1QQP1 2GALA 5H9PA 3ZYJB 1LJ7A 2WZR2 3LZZA 4CDQA 3D82A 1BVP1 4Y24A 4CEYA 1U0AA 4YM3A 3RQ0A 1AR62 4MLOA 4I01A 3MIBA 2TEPA 1OFSA 4YARA 1WUVA 2P3KA 2XL7A 4L92A 1RUD3 1U5IA 4LLFA 1IKQA 4WVVA 3WDTA 1VRH3 1Q43A 1VB4A 3OPZA 1H9PA 3VZNA 3D6EA 3MLKA 5T54A 4L99A 4AEDA 2PQQA 1V00A 1NE4A 2RJLA 1AYN3 1K5MA 1C1LA 4YGDA 4BYYA 4AFBA 1AXZA 2ZGMA 1CAVA 1RMU1 1WGPA 2GNTA 1EAH1 3NJZA 2JDZA 2OA2A 3FZ3A 4Q4W1 5DDJ2 5CFDA 3AP7A 5BNNC 2XKPA 2DTYA 1PK6C 5A3MA 1NCRA 1WLDA 3OF1A 3ZX7A 4HVQA 3VL8A 3RRDA 1Q8PA 5L7OA 1FV3A 3ZMOA 3H7YA 4Q0PA 4QPGB 1ZRDA 4KWLA 2TNFA 5BNPA 1MZFA 4XMIA 4ZU5A 1TME3 2YC0A 2XLGA 3SH5A 4FPHA 1X8MA 2IFRA 3SMHA 1XYOA 3ELNA 1YFUA 1U12A 4YG6A 1ND2A 2QJVA 3AX4A 2ET1A 5EYYA 3OJBA 1LHUA 4PIZA 4FPOB 4I0WB 3JQWA 1E57A 1J1LA 1AR93 5FO8B 5A32B 4ZKTB 4NR1A 4GH4B 3D8CA 4IXLA 1D4M2 3MYXA 1MACA 3KCCA 2HWD1 1CQ9A 1DQ5A 4KGGA 1XNKA 4CDQB 2WFF1 4CEYB 1UPIA 1SBDA 4XF4A 4C1XA 1AXYA 1BBT3 2R0HA 1S0BA 4MVTA 1ZZBA 3T1LA 1HQNA 1I5ZA 1GSLA 4LNVA 1RUJ3 3ETQA 4XJZA 5I8TA 2NPIA 5L19A 1X50A 1W6PB 2ZGOA 5H9QA 4K3UA 1MEC1 2BTVC 5JMCA 1C57A 1GLHA 4P9JA 1I1EA 2BNMA 2WQ4A 1K5MB 4N7UA 2VPVA 4V1PA 3MW4A 2RMU2 1LGBA 3AP5A 3GYDA 3PTYA 1NCQA 1CAVB 4HPKB 1YWKA 1VAKA 4I0AA 4KL1A 1VBC1 4R9CA 3M3CA 4BHPA 5CFDB 2JENA 4GH4C 2D3PA 1CESA 4JTOA 2CNAA 1QF3A 2XVLA 3KM5A 4EN8B 4OI4A 1HIXA 3AKQA 4RS5C 4CP2A 3RMYA 1FMD2 1NCRB 4C1WA 3WP5A 1ZREA 4NN0A 3MIFA 1ASJ3 1SLLA 1UU4A 2YGLA 3S7EA 1CIWA 5L7OB 4DY3A 1HKDA 1VLNA 4Y1UA 2BVVA 5BNPB 4H7LA 2XH6A 3J8F3 1GQGA 3E6CC 5DUUA 1L3JA 3A0KA 3AZXA 3ZMNA 3KQRA 4P14A 2XHKA 1LCLA 4GB31 4XFFA 4AHZA 1V6JA 2VQ0A 2FMYA 2RM22 5JZGA 4Q0QA 3JD71 4RL7A 2BVBA 3HMYA 3OD4A 1UKGA 3LAGA 4BE3A 1RUC2 3M3QA 5CNAA 1ZZ8A 2Y0IA 4RR3A 3ZPYA 5IUQA 3ZXEA 3WG3A 5JOYA 5GJ6A 2X29A 3VZKA 3NAPA 4Z2WA 1DG6A 2VECA 4OHZA 2XGXA 1DZRA 3BCWA 1MR5A 4BQ1A 3JB8A 1FYUA 4COVA 1BEV2 2JG8A 1C8M1 2UY8A