3HT2A

Zink containing polyketide cyclase remf from streptomyces resistomycificus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
143
structure length
143
Chain Sequence
SMMKRVHRTDVKAEIVREPGAKETTHRKLIDTPDGADRFVLTEFEVSPNGSTPPHFHEWEHEIYVLEGSMGLVLPDQGRTEEVGPGEAIFIPRGEPHGFVTGPGQTCRFLVVAPCERPPVRNVFLSEDPYEYTQMPEYTSLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RemF protein
publication title The polyketide cyclase RemF from Streptomyces resistomycificus contains an unusual octahedral zinc binding site
pubmed doi rcsb
source organism Streptomyces resistomycificus
molecule tags Lyase
total genus 29
structure length 143
sequence length 143
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ht2A00
3NVCA 1QY4A 3SXWA 1UPIA 2HKXA 3CL1A 2IXLA 3FE5A 3U11A 4QGNA 3LA2A 3ES4A 4AXOA 3EO6A 3LAGA 4HN1A 3RYKA 5J3UA 5I0TA 5BXXA 4Q0VA 1DGWA 5KBFA 4MGKE 3JZVA 3R6SA 5BY5A 3H3ZA 2PHLA 5EFUA 4F7ZA 4D7TA 4I0AA 5KHGA 2WFPA 3KGZA 3I59A 4L11A 4Q29A 3D82A 1IPKA 3EQEA 5AVPA 3BU7A 2UY8A 4WBBA 1I6XA 1PM7A 1EP0A 5CVRA 2PQQA 2MNGA 1OFNA 2VQAA 2ZKLA 4JVAA 3IIAA 4UBGA 4F8AA 3HQXA 4MGIE 3D0SA 1CAUA 2CAUA 3H50A 1CAVA 1Q3EA 5J48A 2IXJA 3S0MA 4HZFA 4O9EA 1ZZBA 4E2QA 2ATFA 4RD7A 5I8YA 2IC1A 4HLTA 3FJSA 5LRRA 3OCPA 1RL3A 1VJ2A 5FPZA 4HBNA 1VR3A 2GC3A 4HN0A 3H1WA 5FDBA 3ES1A 1RC6A 1X8MA 4MV2A 5C6CA 3RNSA 1O3QA 4UBHA 2PAKA 4FT8A 3BALA 2Z69A 3DV8A 1XE7A 2OZJA 3TNQA 1Q5OA 2XLGA 1YUDA 3O14A 4HSJA 2D93A 2Z2SB 5KHIA 3NKTA 4AQ6A 1GQGA 2XLFA 1CAUB 1Y9QA 3EJKA 4OLLA 1CAVB 3ROUA 2BNMA 2PFWA 5I8SA 4XFAA 3FHIB 2P17A 3QOPA 1NYWA 4CYDA 2BNNA 2XGXA 2GC1A 2QCSB 3NJZA 3OTFA 1ZRFA 2N7GA 1EY2A 3KSCA 1DZTA 4IEQA 2VPVA 4MGYE 3LA7A 4YSFA 1RTVA 2MPFA 4IEZA 5E16A 1YWKA 2D5FA 3H3UA 5FQ0A 3OF1A 2CV6A 5JSPA 3BB6A 4Q0QA 3H1YA 2Q30A 4IEXA 3MPBA 2PAEA 3U0ZA 3NSTA 2F4PA 4XF1A 2IXHA 2C0ZA 3SHRA 1YFWA 1JUHA 3SCGA 1X82A 1UW8A 3ELNA 3VHRA 4TLFA 2QVSB 4I2OA 4DINB 3UKTA 2GU9A 1X8EA 3FX3A 2GH2A 4LEJA 4D7SA 3H7YA 3C3VA 4J1XA 3PVBB 4LUKA 4Q0PA 1G6NA 1YFUA 3NW4A 3H7JA 5FQ0B 4EROA 1I5ZA 4EWDA 5LEKA 5I91A 2EAAA 2V09A 2XHKA 4PIXA 1FT9A 1J59A 4KU8A 1Y3TA 1EPZA 2XLAA 4GULA 1ZZ7A 5JAXA 4HSLA 3E6CC 3SMHA 3RPQA 4ONUA 4LULA 1UIJA 5BV6A 5FPXA 1NE6A 5CU1A 1YLLA 3GBFA 1HW5A 1WGPA 1ZX5A 1TQ5A 2MHFA 1VP6A 5LRSA 1ZREA 1QXJA 1RUOA 4PJYA 4XF3A 3UKNA 5FLHA 5KHHA 3BCWA 5LEJA 1ZZ8A 1J3RA 4MGZE 1IPJA 1LR5A 2FMYA 1O5UA 3OD0A 4XFIA 3HT2A 1CX4A 5I0SA 4B29A 1UCXA 3LWCA 1ZNPA 2PYTA 2IXIA 5KHJA 4AQ2A 2OA2A 4XFHA 2K9ZA 2ETEA 4XF4A 4KWJA 1J58A 2IXCA 4WZCA 3ZDSA 2BGCA 1XRUA 2D5HA 3EHKA 1O4TA 4XETA 3ST7A 1OMIA 2H6BA 3WW1A 1CAXA 1QXRA 2KXLA 2D40A 1LB2A 5C8WA 3EBRA 2CGPA 5D1IA 4ZU4A 4EV0A 1ZZ6A 1NE4A 3LOIA 5CADA 4QX5A 3G7DA 3B02A 3FFQA 4ZU5A 3E6BA 4FAHA 2ET1A 4L2NA 5JCTA 5JSOA 3IBMA 3HT1A 4QM8A 3PNAA 4PIYA 1O3TA 4I0BA 1O7FA 2UYBA 3IWZA 2BNOA 1YFXA 3MDPA 2QNKA 4XFGA 2XKOA 3KGLA 4PIZA 4XFBA 4LA2A 4H7LA 4QMAA 4QGLA 2I45A 2B5HA 4JTNA 4P9GA 4YNIA 3RYRA 2Q1ZB 5JR7B 1J3PA 4LA3A 1CAXB 2E9QA 3WW4A 4IEWA 4JTOA 3UKVA 4LLOA 4J1WA 3S7EA 2OYZA 3DKWA 1O3RA 4KWLA 3TNPB 2O1QA 1YFYA 3LZZA 4IEPA 4ZU7A 5BUVA 1H1IA 1FXZA 5FLJA 1ZVFA 1RUNA 2GAUA 2UY9A 1NZCA 4EWEA 3E5UA 4MZUA 4OFGA 1UD1A 1SQ4A 4YYOA 4LUMA 2Q0AA 1LKNA 1O3SA 3BPZA 1WA4A 4QXKA 3WW3A 5I0RA 4IEYA 3H8UA 1OI6A 4HVRA 1H1MA 4BHPA 4E2SA 3QACA 3IDCB 2QDRA 2WC2A 2QJVA 2XL9A 3ACLA 4Z07A 4KL1A 3IDBB 3KCCA 3RDIA 3M70A 1V70A 4YRDA 4MUVA 4AVBA 1RGSA 4FAGA 1ZRCA 2H0VA 4EWAA 4MH0E 3D0JA 4O9GA 3DL3A 5I0UA 2GC0A 4KU7A 4R8HA 4FBFA 2VECA 4META 1J3QA 3MYXA 5BPXA 3RZZA 2PA7A 4XF9A 4I01A 2EA7A 1ZZ9A 2H6CA 1ZRRA 3S7IA 1QWRA 3E6DA 3M3IA 1UIKA 4XFCA 2B9UA 4Z82A 3GYDA 2PHDA 2PTMA 4JV4A 5I93A 5I8TA 1NXMA 4IETA 1X7NA 4Q0SA 2HJIA 3FWEA 2EVXA 1YHFA 1ZZCA 4IEUA 4IERA 1CAWB 4BIFA 3ETQA 2OPKA 2ZCWA 2FQPA 2B8MA 1DZRA 1PMIA 3CJXA 3I7DA 4Q0UA 3H1MA 5K8SA 1XE8A 3NL1A 1GQHA 2XL7A 4XF0A 3SCHA 4I02A 3U10A 2K0GA 3LA3A 4N9HA 5T3NA 1L3JA 5HI0A 3CEWA 2IXKA 3L2HA 4E2GA 5JSRA 3I59B 4LTAA 4BYYA 4AVCA 3OGJA 3PLQA 5FLIA 3CF6E 3N4MA 4HVQA 3KMHA 4YARA 1OD5A 2BYVE 3WW2A 2Y0OA 4QM9A 1LRHA 2CAVA 3I54A 3SCFA 1O5LA 2XKPA 1CGPA 4I09A 5J7MA 4K8FA 3E5XA 4XFFA 4XEZA 1EYBA 1U12A 5FCCA 3E5QA 1J1LA 1WLTA 1SEFA 2Q4SA 4N9IA 4NVPA 3HIFA 4QGMA 2O8QA 2ET7A 2GZWA 2BEOA 5E1RA 4ORFA 4IEVA 4UXAA 3USSA 1FI2A 5F1RA 4X6RB 4R52A 4X6QB 3CO2A 4HMZA 5EZWA 2OZ6A 2PAMA 3E97A 3DN7A 3H9AA 4I3PA 4MX3A 2GC2A 1Q43A 2DCTA 3RYPA 1DGRA 4WVZA 4A2UA 4BH9A 4IESA 2UYAA 4AVAA 1ZRDA 4IEOA 3FZ3A 3CLPA 5KHKA 4KWKA 3MZHA 1SFNA 4HVOA 1CAWA
chains in the Genus database with same CATH superfamily
2W1UA 1H30A 3CL1A 3N9NA 2IXLA 1TMF3 2CU5A 5E8AA 2J1AA 5FYCA 1A3KA 2ZGPA 1UY3A 3HD8B 1XNBA 3LA2A 1AXZA 4E4DX 4AXOA 2XJSA 3LAGA 1GP5A 3GM8A 3I97A 1YO8A 3RYKA 3POYA 2WLPA 3KS7A 4XJUA 5I0TA 3SQOA 2BWCA 5FR3A 5IK5A 3H8XA 5EYXA 1S0FA 1RYYA 2Y33A 3NAPB 5DUXA 5FY8A 1DCSA 2A7AA 2P3KA 1UNBA 3MHZA 1MPXA 2FDFA 1R091 4L92A 4EN7B 4MHUA 1OLQA 4HXCA 3MEPA 1QJY2 4I0AA 4LPLA 1TME3 3KGZA 4IE4A 4CDWA 5CA6A 1JYXA 2W1QA 2PHUA 2V4VA 3D82A 4GWJA 5DG1A 4A42A 3EQEA 5F37A 5FYVA 2FDKA 3KM5A 3K75B 3O12A 2FDHA 3KB5A 4RS5C 3WXPA 4GZ9A 1BVP1 2ID4A 2VZTA 5CVRA 1NAEA 4LMFA 1O91A 4Y1ZA 2ORXA 3FHQA 4UBGA 4KQ7A 5IYYA 4Q4X3 1VBC3 4MGIE 3H8RA 2CAUA 1FATA 1JYVA 5LCWL 3K51A 2YBPA 1CAVA 1WKYA 4CP2A 2WSVA 4ITCA 1W05A 1ZZBA 2ATFA 2HWD1 4Q1PA 5DAQA 4NMIA 2JDPA 2R0HA 5DAPA 2W39A 1EV13 3D5OA 1G9DA 1RUC1 4AZZA 5CYYA 4DRVA 3GZTB 4Y33A 5FPZA 2GC3A 5L36A 4GB31 3H1WA 1JU3A 3NAPC 2Q8EA 4IDZA 1SG3A 1W2OA 1RC6A 3PIJA 1HLCA 2WJSA 2YDEA 2DBIA 4MV2A 4QPGC 4QX8A 5C6CA 1CX1A 1Y7BA 4CDWB 1QJFA 2G9FA 2X8KA 3M3QA 5ACA2 2Z69A 2D6KA 4LHNA 2RHPA 4QDQA 5HXVA 2XWBB 3GCXA 1Q5OA 3TNQA 1PZ9A 5C3QA 2D6LX 1R093 1DP0A 2VMDA 2YU1A 4R9DA 4GD4A 2BW8A 5HBAA 3MV01 4Y24A 3F95A 5KHIA 2HEVF 3JBG1 2GNTA 3AXDA 2EICA 3NKTA 3NMBA 1XJAA 1OA3A 2R1DA 3CIHA 4MVTA 3O0WA 5L73A 4OLLA 4LO8A 4FOWA 2JDZA 1CAVB 4RFRB 2PFWA 1UZVA 5BNNB 3MF9A 4UAPA 5FYMA 5FZIA 3QOPA 3ABZA 4BQ5A 1WD3A 2DFBA 4LBQB 4CYDA 3RZGA 2Y26A 4XXPA 2R073 2XGXA 2O14A 1XU1A 1Z0HA 3NJZA 5F3EA 2YUEA 1TEIA 1KEXA 3A4UA 3OTFA 4D3WA 1ZRFA 3TEWA 1O6UA 3QBQA 3EYPA 5FBZA 5JMOA 2UU8A 1HB2A 2E7TA 4TTGA 3PUSA 4QB2A 1J84A 1AR61 2P3YA 4UFMA 5EYYA 3MLLA 2HWD3 4IEQA 4D0QA 5IVEA 2RDQA 1UOGA 5H9QA 5FOBB 2VPVA 3POEA 2ZX1A 1RUC3 5FO9B 4CDWC 4IE7A 3NNLA 3OGGA 4N43A 1MZEA 1A34A 5T5JA 2J7MA 3K4ZA 4GB33 1VBE3 5A6ZA 3OBRA 1XNKA 2GP5A 1GQPA 2IFWA 1LOCA 4FI9A 3IMNA 4IV3A 4E9KA 5FQ0A 5G05L 2W91A 2YC0A 3LEGA 1PK6A 2BOJA 3KZ4C 4M0HA 2XJRA 3R05A 5JSPA 3BB6A 3OY8A 4Q0QA 5FMBA 5C3SA 5FBJA 3S30A 1LAJA 4RGGA 5DN2A 3A7QA 1YQ6A 3AZVA 3MPBA 2VMCA 2VTFA 5I0DA 5BNNC 1IPSA 3NSTA 5EV7A 3GBWA 1SPPB 2B42B 3LFIA 1C1FA 2Q8DA 5BNOA 2RS11 3MI8A 2C0ZA 5C71A 1CJDA 1SCSA 4COZA 3WDUA 2WWJA 2G1MA 3VBFA 4P00B 1UZZA 1D0HA 3KVBA 1QQP3 4W65A 4FFHA 2DVAA 2GU9A 3IB3A 1H8TB 4PBOA 5SV8A 1SLTA 1ACCA 4CCJA 3H7YA 4AI8A 3C7EA 1RUE3 3LB9A 3ZO0B 2ARCA 4N43B 3ON7A 5T50A 1YFUA 3NW4A 4Y20B 1RMU2 1O4ZA 4OHYA 4LE3A 2RR11 2A3XA 3KQRA 4IV3B 5FQ0B 2Y60A 1PIV2 1W39A 1HRV3 1PK6B 1U5YA 3MO4A 4KGGA 2X53S 3U1XA 1F4HA 4CDUA 3OY8B 2BJSA 4EWDA 3BUCA 4ASMB 2EAAA 4FO9A 1L7LA 4LK7A 1ZBA3 2ZS6B 4OULA 3FL7A 2WYSA 1WW5A 1EPZA 2R062 5FZ8A 1LGNA 1ZZ7A 3W5MA 5KXBA 3BGAA 2GNBA 4OUEA 4NHXA 5BNOB 4XDQA 3C7GA 1FPN2 4K1YA 4MOAA 4QXBA 4LULA 1H9PA 3ZMNA 1XYOA 1NE6A 2O0OA 1U5IA 1YLLA 1EAH2 3HVDA 3WOGA 1NT0A 2MHFA 4GJYA 1QXJA 4KGQA 4LBNA 4XUPA 2HWB1 2VMIA 3R4SA 4ASKA 4BA6A 3PU3A 2A1XA 2VQTA 4NIGA 1CR7A 1ND3A 1QJX1 1QJU1 2RS13 4QPWA 2OVUA 1ZZ8A 4N43C 3VKLA 3UK9A 4HANA 2WS93 1GZWA 3O1TA 1MACA 1J83A 3KV9A 2ZGTA 3R4UA 3ZKUA 1IS6A 1S0IA 3ZPOA 1IPJA 2ZABA 1GWMA 4IV3C 5FY0A 3VZLA 4CDUB 1DGRN 1GANA 4XFIA 1PK6C 2WFF2 3PVEA 1NLSA 3RJRA 5I0SA 2QQJA 4B29A 1OD3A 1YIPA 3HN1A 4BJ0A 3U4SA 3T4HB 1RXGA 2AGSA 2VZUA 2Y6HA 4YM0A 5CBLA 3LKJA 2RR13 4CCCA 4XFHA 4TLGA 4NJ4A 1RJ7A 2ETEA 4XF4A 3VBOB 4LITA 4WZCA 3ZDSA 3ZN4A 1XRUA 4Q8LA 2GN3A 5BNOC 1NY71 2D5HA 3B7MA 4IE6A 3K4AA 1F8VA 2WT1A 2XONA 3GALA 3IKWA 3EHKA 3WQ1A 4MGTA 1V6IA 5FZOB 3ZR6A 2PLV2 3AYDA 2VOTA 3TBDA 1C8M2 3AX4A 2ZAAA 3MW4A 2VZSA 3FLTA 2FHRA 4XUTA 1FMD1 2C24A 5DUUA 4PQ9A 2ZGNA 1COV1 4Z2WA 3RZHA 3Q9OA 1YYNA 2VR4A 4Q4V2 3WZ1A 3KHCA 5D1IA 1JS9A 1NE4A 1GZWB 3LOIA 4B4QA 2XUEA 5K7PA 3AP9A 4ZU5A 2HWB3 4RL7A 3OPTA 1G8WA 4TSVA 4FAHA 4CDUC 1SFPA 1W9SA 3ZN6A 3VDCA 1QJU3 3W9AA 4L2NA 1OA2A 1UYPA 4MADA 5JCTA 1KS5A 2Z5WA 2AACA 3IBMA 3SEPA 2VW1A 1OVPA 2H0BA 4NO4A 3VZJA 3WG3A 3FMGA 4ASLA 1S0BA 3TWIA 4PIYA 2VNGA 4I0BA 5A3PA 1UY1A 3CNAA 2UYBA 3U78A 3BVCA 3M1HA 4LBJA 1YFXA 2NLRA 3USUB 4PIZA 3KGLA 4FPFA 4QQLA 4IGQA 2OKXA 4P5HA 3KLSA 3T09A 4Q4Y2 3RYRA 3V0BA 1UOJA 4Z2AA 1R64A 2WNEA 3WW4A 4K21A 4LKSA 1X36A 4IGOA 2OX0A 4LLOA 2J1RA 2YU2A 3S7EA 4A44A 3KV6A 1W9FA 2FZ1A 1MS5A 2OUJA 3TNPB 3WNNA 1YFYA 3POGA 2P5BA 1Q8QA 4IEPA 5BUVA 2BP6A 1HQNA 3ZN6B 1FMD3 2YZ4A 1RUNA 1D7PM 5AC93 2GAUA 3QH7A 3Q8EA 1NZCA 1HQLA 1JI6A 1A8MA 4MZUA 2HH9A 5FFOC 2CSGA 3TEXA 4EJRA 4OFGA 3JB8A 4W6YA 2ZZJA 1UD1A 1Y43B 3B01A 3NNGA 4QWNA 5A3OA 2R30A 1WMDA 1SQ4A 4YYOA 4GXLA 3VL8A 4KWUA 1HIXA 3BPZA 2VY0A 4AI9A 2WUHA 1CPNA 1PX4A 4O7XA 1OF4A 2VNOA 4OI0A 3E1F1 5FWEA 3OBZA 2LTNA 1HJGA 2VCMA 2LALA 4IEYA 1KRIA 3BIEA 3IDCB 1JODA 4P9LA 1HB4A 1SLLA 2QJVA 4BQWA 1HXS2 4EN8B 3FBMA 5FMOL 1G9BA 5DABA 5FIXA 4Z07A 2W2IA 4LO5B 1QKQA 2VUJA 1N3QA 4ES9A 4I0WB 2JKXA 4K6BA 3N3HA 3IZOA 5JLVA 3O1SA 1S0EA 2JICA 5FYHA 4YRDA 4MUVA 4AVBA 5A6XA 3I3DA 1AJKA 2H0VA 5C5UA 1W3VA 1KJRA 4UFLA 2DU0A 4XACA 4A45A 1Q56A 2YV8A 5I0UA 1GZCA 2EIDA 1LJ7A 3T4VA 1A78A 4IV1A 3AC0A 4DXSA 1J3QA 3MYXA 1QJY3 2WWUA 3VZMA 2QZ3A 4YGDA 3IDAA 5F6LB 2RS32 1LU2A 4ES8A 2P6HA 3WVJA 5J36A 3M3IA 2WNUA 3NNJA 2RS52 4XAEA 1IZ3A 1VRBA 3ACGA 4AFAA 3GYDA 4COUA 2PTMA 1R1A2 3ZYBA 1WMXA 5I93A 4IETA 4LKFA 1BVVA 4Q0SA 5FYUA 1DF0A 2A3WA 2HJIA 5FP8A 1AYN1 2WL1A 2YB7A 1MEC2 1GOHA 4IEUA 1SLIA 4HK9A 1Z78A 2RJKA 1LGBA 3MFAA 2B8MA 5FTTC 1PMIA 2D6OX 3AM2A 3VKOA 4COVA 5IATA 4Q0UA 3UESA 1ENRA 1D0GA 4DMIA 1OA4A 2Y6GA 3HN3A 3VHPA 5K8SA 2GNDA 3NL1A 1GQHA 1BYHA 4M00A 4CUGA 4MSVA 3SCHA 1HB1A 2PHFA 4GKXA 4KBZA 1SLBA 3MIGA 4IV1B 3LSDA 2X09A 4N9HA 5T3NA 5HI0A 3PHMA 1BMV1 1DQ1A 3QD6A 3L2HA 2IXKA 2WO1A 2XG3A 1H2NA 3N36A 3A23A 1BK1A 5ACA3 3IMMA 4PF5A 3T30A 2ZHNA 4INDA 5FLIA 2WNUB 2J1TA 4RR3A 3NJYA 5FMDA 4YVSA 2RG4A 4PLNA 3T2QA 4RHV2 4Y1VA 1W2TA 2RJLA 1KJLA 3GCWA 4FTEA 4ZKTB 1RITA 2BYVE 2Y0OA 3OOXA 3OD4A 4G4FA 3ZIWA 1O5LA 2D6NA 2KM2A 2XKPA 4UFKA 1UY0A 1ULDA 1R082 4NIIA 2E7QA 4ISRA 5FUNA 4K8FA 2W52A 4DIQA 2EAKA 3I3MA 4Y22A 5LA9A 4PI2A 2R042 3IPVA 4IUGA 2DURA 4XQWA 3WDTA 5LATA 4Y5TA 1AR81 2R0FA 3CQOA 3DEMA 3RJ2X 4CRQA 4D94A 5FV3A 5LK7B 3WHTA 3RZLA 5CKNA 4N9IA 1W6QA 1AZDA 3HIFA 4BOWA 4CVUA 1H9WA 2JDHA 3POWA 4XDOA 2XH6A 3SITA 2B46X 2BZDA 2VVFA 1H1AA 4IV1C 4ORFA 4AI0A 3USSA 4GH4A 4YW3A 4X6RB 1CESA 3Q8AA 1C28A 4DRRA 3GF6A 4P9YA 3RMYA 3HBKA 4KNCA 4ZHNA 1DYPA 1TNFA 5A7WB 2R061 5M0TA 3UJQA 2WNUC 3B9CA 3MUY1 5EZWA 3ZXJA 4YVSB 3K4DA 2BBVA 2YGLA 4AHXA 2PQSA 3DN7A 2XJVA 3H9AA 4I3PA 3WUCA 1BEV2 4CCLA 3NQHA 1FPN1 5LK5A 5FKCA 3S6PA 2DCTA 2IWGB 4NHLA 1EAH1 1DGRA 1VMFA 1OFSA 4XURA 4A2UA 5FPAA 2WBKA 4LHLA 1UU5A 2ADDA 3KQ4B 5F3GA 2YROA 2OQ6A 4Y22B 4B7KA 2WAOA 4CSWA 3I2JA 4EYUA 2B39A 3VZKA 5FZGA 4QKDA 4WVVA 2WINB 4CP9A 1MZFA 1SMVA 2DUOA 3QLQA 1F15A 5IVJA 1W6QB 1SCRA 4KWKA 4C1WA 1AR62 4UFJA 4CU9A 2TUNA 1EUTA 3RFRA 1UKRA 5GLWA 5FY1A 1VRH1 2K2SA 3NVCA 1QY4A 1JOPA 1OOPA 4XTPA 3B5LB 3SXWA 4GH4B 3VV1A 2YC2A 3ZFEA 2ZGLA 4FPKA 4BQ3A 3FE5A 4S2HA 5KR7A 3U75A 4FFFA 1RMU3 3U11A 2C6SA 3M3OA 4CDQA 2VXJA 4ZS3A 1Q8OA 5IHRA 5J3UA 4LT5A 4YVSC 1QOOA 1PIV3 4UF0A 2QBXA 5BXXA 1V9U2 1VPHA 2GMEA 4Q0VA 4GWIA 5FZEA 4MGKE 5JI7A 4ZXEA 3ZXDA 2VQ0A 5FP3A 1LOEA 1WW4A 5EQUA 5LASA 2VZ3A 1RHI3 2R063 1KDKA 3HNBM 2WFPA 3I59A 1C8M1 2WNOA 4Q29A 4J6GA 3TN92 5L7OA 2ES3A 3PMEA 3O1UA 1FPN3 4WBBA 4B7EA 1PM7A 4Q4V1 3TAYA 4CP9B 3IAQA 4LBOA 4CUAA 5ABJA 1HRI3 1M4WA 2X10A 1NA1A 4C1XA 2VQAA 2ZKLA 4JVAA 3IIAA 5K4LA 4A41A 4DS0A 2QQWA 3HQXA 4OQ9A 3D0SA 3NV4A 4YPJA 1OOPB 3KV4A 3LPGA 1XBFA 2JB4A 2Q1MA 4GH4C 1Q3EA 3I2FA 3ZFEB 5G04L 3CBNA 2I07B 3LGRA 5H9SA 4FVVA 5J37A 4AOCA 2F4LA 4C0HA 2GALA 3FJSA 1Q8PA 4QB1A 5FPBA 2UURA 5FP4A 3W58A 1JH5A 2WFF3 1VR3A 4CXWA 4HN0A 5DQ0A 4EZ4A 2WN2A 3T08A 1ASJ2 1LODA 4MXWB 2Q1FA 4Q4Y1 3ES1A 3VBRA 4URAA 1GOFA 5ISLA 2DVFA 2ZACA 1ND2A 5L7OB 2FD8A 2PAKA 2IVIB 4CP1A 2OZJA 4XVHA 1Y4WA 1DFQA 1SBFA 1B35A 3ZYGA 3ZXAC 1RB8G 5ABJB 1NA1B 2AEYA 2PLV3 2DVDA 1T6BX 1FOD2 1QJX2 1C8M3 1MQTA 1IS3A 1GQGA 3VLBB 2XLFA 5JOZA 3RZKA 1W6MA 1OOPC 5FKBA 2HYXA 1E5RA 2ZOEB 1QJEA 4MO3M 3RI9A 5I8SA 4CCOA 3ZFEC 3FHIB 2P17A 1NYWA 2VZ1A 2JKBA 2ZXQA 2BNNA 3RWNA 2Y64A 2QCSB 2Y0IA 3ZFGB 2R49A 4XZUG 3AK0A 3L2YA 4DXZA 3HQUA 4BLJA 3NV1A 3I2DA 2BWAA 2PHRA 4RFT0 3VBRB 4EN6B 1DQ4A 4XIKA 2V4AA 3MW3A 1D4M2 2VJXA 2A3YA 4MGYE 2PHTA 1ND2B 3MIBA 1HXS1 2ZJCA 2BFUL 1NY72 1WBLA 5L7OC 4C90A 1H6XA 2YGMA 3P3PA 1W2AX 4TZDA 5E89A 4LOTA 4BXSV 4YZ3A 1B35B 2D5FA 3H3UA 5DDJ2 5J09A 3OF1A 1ZM1A 1F9KA 5F39A 4Q4Y3 3N7MA 4LXLA 5ABJC 1W8ZA 1NA1C 3H1YA 1MQTB 1VB4A 3OPZA 4BXFA 5K0UB 5KXDA 3WY6A 3D6EA 5JIAA 1OKQA 4XC9A 4YG0A 2Q8CA 3HR9A 1H0BA 2CHHA 3V64A 4AI3A 3KT1A 1UF2C 4ZPIA 3U0ZA 1WCKA 2RS31 2EXHA 3N7LA 4XJZA 4ZY9A 1QDCA 4Z8BA 2AYHA 1LHWA 2IXHA 5F3IA 3SHRA 2LUWA 3UGGA 1DHKB 4CEYA 3MW2A 1X82A 2ZEYA 4OHVA 1Q8VA 3ELNA 1R1A1 3F2ZA 2JE7A 5FPLA 3GZUC 1C1LA 2QVSB 1NX9A 4BK4A 5DPNA 3SH5A 3BI3A 3LDBA 1JN2P 4FOYA 3R0RA 1X8EA 4XBQA 3VBRC 1MEC1 3ZYJB 4MGSA 5A3MA 1ND2C 3C3VA 4J1XA 4LUKA 1W99A 3BTYA 1QH7A 5IVFA 3B93A 5F5IA 1US2A 2YHJA 2NQYA 3WG2A 2E32A 4XE9A 1F5JA 3IIIA 4XZPA 4XPVA 2WABA 4LR4A 1B35C 3GJAA 3KWVA 5EP9A 2BOIA 1C57A 1MS9A 4DOUA 2XQRA 3WR0A 1LOGA 3GXUA 2ZZQA 2ZMNA 2J1EA 1HXS3 1MQTC 1W6NB 2BDRA 2XHKA 2D7FA 4K3UA 4KU8A 4PIXA 4YG3A 4KG8A 4P9IA 5FYYA 1WLWA 1WCSA 2ILMA 2XLAA 2VOWA 4GULA 3ZR5A 4HOOA 1ENXA 4FOQA 4HSLA 5FYIA 3WNLA 5J1XA 3E6CC 1PHMA 1UOFA 2KA3A 3BYWA 3C8XA 4B4PA 3H8OA 2CTVA 1S0DA 1OLRA 1K42A 1UIJA 3VZOA 4CEYB 1NCQA 5CU1A 1ZX5A 1TQ5A 3WT3A 2AENA 5LRSA 4RHV1 1ZREA 4DFSA 2QFEA 1RUH2 4CXXA 3DCQA 4GAZA 2QQNA 3ZSLA 1UO9A 4PJYA 4XF3A 1L7QA 2CWSA 2VBBA 3UKNA 4AFBA 4CZSA 5B4NA 5FLHA 5KHHA 5BNNA 3FUQA 5A33B 1MZ6A 1WZXA 2GSYA 3M3CA 3WCRA 2BPA2 1R081 1W9TA 2RS53 4LBQA 1G86A 3AYCA 2VTXA 4GIQA 4MGZE 2HWF3 2R041 5EJZB 4B4RA 2FDIA 1O5UA 3ZSMA 3QCWA 4Y26A 1S55A 3OBAA 1LOBA 2W1WA 2VCBA 3HT2A 1CX4A 3ZXKA 1MEC3 1UCXA 3LWCA 1FYUA 5IAXA 4XQDA 4YZ4A 1V6MA 4FCAA 2OPWA 4NR1A 1JOJA 1RUF1 2OA2A 3AKRA 3KF3A 1UQXA 1UMHA 1LU1A 5F6KA 3ZSEA 1JZ2A 2IXCA 2EIEA 4ARXA 1XNTA 2QUOA 5T55A 1Y9GA 1NCQB 3S57A 5ANQA 1Z7S1 4CEYC 4OVEA 4P9XA 5IFPA 3PUAA 3ST7A 4FFIA 4TYSA 4LBKA 1BEV1 1DU3D 1DYOA 3WW1A 1W90A 1QXRA 2O8OA 5JXIA 4BM8A 4F3JA 1LB2A 2HLEA 1NLRA 1H4HA 1OQ1A 1LHOA 1H2LA 1JW6A 4OYUA 2XPJA 1SPPA 2JD9A 3AJYA 3W21A 2G9ZA 4TWTA 5CADA 3ZYRA 3WP6A 4RHV3 4BLIA 1AYN2 3U4XA 2HWE1 1NCRA 3KHBA 1S0JA 1JYTA 3T2PA 3DUIA 2VZPA 2FCTA 4NIAA 2QQVA 5DZGA 1JMUB 2C9AA 2VUAA 1N1YA 4CCDA 1NOVA 3UL2A 1H8TA 1R083 2HEYF 3DYOA 1G9AA 3HT1A 1BJQA 2VBPA 3FBYA 4QM8A 5FP7A 2R043 2W1SA 1CD3G 3PNAA 4Y20A 1N1VA 2QDNA 4YW4A 3TEYA 5F5QA 3ZMOA 4A7KA 2BNOA 3MDPA 3T1LA 2CGOA 1NCQC 4YW7A 3VKFC 4M0NA 4EN9B 4QMAA 2I45A 2B5HA 3B00A 4P9GA 1V9U1 2Q1ZB 1GU3A 1JYCA 1LHNA 1PO11 2VAUA 4TN7A 5JR7B 1QHDA 5FK7A 1JOBA 3ACFA 5FYZA 4YW1A 3WDVA 4E4SA 4W4ZA 4JTOA 2YFUA 3D4KA 4A4AA 4KG0A 1O3RA 3TN91 1N1TA 1V6LA 4P9WA 4RQPA 1AYM2 3JBG3 3RRDA 4AVSA 1POV0 1I5PA 1BEV3 1NCRB 1E5HA 1OPMA 1XSQA 2QQUA 1XPWA 3LZZA 2Q8OA 3WF4A 2CYFA 2A5ZA 2WO2A 3AMMA 3J7HA 2P2KA 3K77A 1H1IA 1UXXX 5FLJA 1RUJ2 1JTZX 2VO5A 1ST8A 1BCXA 1KD7A 2B7YA 4YGEA 4Q1RA 1W8TA 4JGZA 1PNFA 4XBLA 1K5JA 4DXRA 1E57A 3C2UA 5LBBA 1AR82 2YBKA 4QX7A 3WG4A 2W0XA 2V72A 1LKNA 4H2AA 3U14A 4A6SA 4QD2A 2V73A 4QXKA 2RDRA 5FUPA 5I0RA 4HL0A 3SLIA 5J96B 1AR63 4PI0A 4AQSA 2E31A 1ZA4A 1H1MA 1W8OA 4BHPA 2WR9A 4E2SA 2XJQA 2VOKA 1POQA 3GNEA 4XIOA 2QQLA 5F2SA 5CAZA 3HMYA 1ASJ1 5J98B 1WW6A 4FQ4A 2XJUA 2V5DA 2Z79A 1US3A 1XQNA 2D98A 3RDIA 3VBOA 3I4IA 1V70A 4QDSA 2XQXA 3POBA 1RGSA 5FY9A 4RQPB 2CL2A 3CZJA 5T54A 4FAGA 1DLLA 5A1AA 4JC1A 2VH9A 4A3ZA 5LA0A 3W59A 1NCRC 3OUHA 3VKNA 2XWJB 4O9GA 3I2IA 5FZOA 3ZYIB 4V2WA 4LK6A 4AGRA 4KU7A 4QHZA 4R8HA 4FBFA 2Y38A 2OXBA 5A7PA 1H8TC 2J42A 4JGZB 1ALYA 1FOD1 5BPXA 3RZZA 3PVOA 4XF9A 3TN93 5DAWA 4N8MA 4QU2A 1ZZ9A 4AEMA 1ZRRA 4LKEA 1JBCA 3DKQA 4QXCA 3S7IA 3URFA 1VAKA 4XFCA 3AKQA 1HKDA 3WSOA 2PHDA 4IE0A 1NXMA 3GBGA 5H9RA 1VRH2 4FPEA 1YI9A 3Q8BA 1AXYA 2EALA 1GICA 4K1ZA 4IERA 1J1TA 1OF3A 4BIFA 4OMDA 2Z4FA 4AFDA 2FQPA 5F5CA 4YZ5A 4LHKA 1UXZA 2RMU2 1DZRA 1D4M1 4BMBA 1HN0A 1W6OA 2X29A 3HJRA 3N7JA 4FPGA 1BK0A 5FJHA 4RQPC 3KT7A 4RYDA 3USUA 3WD5A 3WCSA 1W8HA 4XF0A 3LQCA 3U10A 4YM2A 4NHMA 2F6BA 3DYPA 3LA3A 1ASJ3 5DDJ1 3SH4A 3VBSB 2NM1A 1BLZA 4R4XA 3TRSB 2VGDA 4AFMA 5F3CA 1RUD1 4JGZC 5JUVA 4AHZA 2G4IA 3MLKA 5JSRA 4BYYA 4NHYA 4NIHA 1NZIA 1S4CA 3CF6E 4KH9A 3AKTA 2I74A 1JYNA 1RXFA 1F31A 3N4MA 3O0VA 1C5HA 1W2UA 4CP0A 4NPLA 4DNYA 1OLME 4Q5OA 2A73B 5GLVA 2HBUA 4YARA 2P1BA 1FOD3 1QJX3 2LROA 2E33A 1FV3A 1C8NA 2J1VA 4M3CE 1MS0A 3J7LA 1UU6A 3L9JT 4PT6A 4I09A 3HWJA 5J7MA 5AVAA 4BQXA 3OYWA 5TSWA 3MIFA 3E5XA 1LOFA 4K8RB 2FMDA 3WF1A 1J1LA 3VBOC 1W6OB 3ZX7A 3PDQA 3J9SA 4QDRA 5IAVA 2ZA9A 4JDMA 3AKSA 3VN4A 4NVPA 2ET7A 5CKMA 2XVKA 2ZGUA 2YBSA 1GOGA 1UY4A 4JKMA 3IDEA 5A6YA 1NKGA 2SBAA 4UXAA 2XBO2 5FYSA 5FZ9A 1LEMA 2RDSA 1QOSA 5FY4A 3VBUA 3POIA 4FPJA 4EE2A 5F32A 3RSJA 1UPSA 3WQBA 2BFUS 5HCFA 4HMZA 1K12A 2JIJA 3Q8CA 5FY7A 2OZ6A 2ZHMA 2ZGKA 5DDJ3 3E97A 5LA1A 3EMRA 4MX3A 1GNYA 1S1AA 1Q43A 3IM0A 1COV3 3BN6A 3RYPA 4WVZA 4X8PA 4RN5A 1AL0G 3FC0A 4BH9A 4E4ZA 2YFZA 5FO8B 1RUH1 3OYWB 1AF9A 1AXKA 4E27A 4CE8A 3ENRA 4IEOA 2B9VA 4JQTA 1ZRDA 5D8AA 2VCAA 4CU8A 3RMXA 2ZBJA 3QH6A 5FZAA 5KHKA 3ZFFB 4NRMA 1POV1 4OI2A 1UY2A 2ZEXA 4QQOA 5AFEA 1YXWA 2WWSA 4QKFA 4HVOA 1SDWA 1MZ5A 4OMCA 3M4FA 2HKXA 4R9AA 1MS1A 2GP3A 3VBUB 5HV4A 2DDUA 1TZOA 1X9PA 5FZHA 4GKYA 1AX0A 1PVC2 1QDOA 2WLQA 4HN1A 2VNRA 3CMGA 5FXVA 1W28A 5JZGB 1DGWA 1DLCA 5KBFA 2BUKA 2ZHKA 3OGRA 1GV9A 4UFIA 3R6SA 3T3YA 3O5SA 3ZKYA 5BY5A 1CPMA 3VD9A 1REEA 5FY5A 4B8EA 1LCLA 2WIIB 4D7TA 2ZMKA 3OUIA 1JZ7A 5KHGA 2AH2A 2NYYA 1Y9MA 2WA3A 4E4HA 2Q5TA 3ZXFA 1PO21 1LOFC 1IPKA 1CIWA 2VUCA 3B94A 5D8AB 1RIRA 3TOJA 3BU7A 3ZN5A 2BRTA 4AGGA 1GZTA 4MYEA 1DGWX 1N1SA 2D3RA 1EP0A 4B1MA 1ULPA 2PQQA 3JD72 3ZFFC 1OFNA 5CKQA 1RUH3 4ET7A 1W3XA 4F8AA 4N53A 2ERFA 4QAWA 3H50A 5JXGA 1IG3A 4Q4X2 5DZEA 1LECA 2VXRA 2NMOA 4Y5Z0 3VBUC 5J48A 3AXEA 4CA9A 1GUIA 3S0MA 4OHZA 1UOBA 4RD7A 5FPUA 1VBA2 1JZ8A 3WF2A 1EV12 4YGBA 3GDBA 3J7NA 4HBNA 1ZBE1 1XNCA 2DYCA 3VGIA 1YCIA 4HPKB 2W47A 2OUHA 5FDBA 1LOAA 2PHWA 2DVBA 4BE3A 4PLOA 1G7YA 5EWSA 5GJ6A 4URTA 3RNSA 1O3QA 1KQRA 3VB9A 1RJ8A 4DQAA 4FT8A 3AYEA 3O0XA 4K40A 1MS3A 3LPFA 4QX1A 5A7WA 3BALA 4BK5A 3DV8A 5D8AC 2GMMA 2QQMA 3GGLA 1XXNA 4Q2FA 3WUDA 1URXA 1V6NA 4HONA 4NIDA 5FO7B 1AYM1 3DGTA 3JUUA 4HSJA 2D93A 4HKLA 2Z2SB 3LCPA 4N53B 4ZXKA 3ZXEA 1APNA 1Y9QA 3OEBA 1RUJ1 2VOXA 1HDKA 4NWWA 1T6GC 3ROUA 4IGPA 3V65A 4XFAA 1I9RA 3PUQA 1AVBA 2WZ8A 3AYAA 1AYN3 4UW3A 1H4GA 4A7ZA 1YQ8A 1CN1A 2LS6A 4IE5A 4PBPA 1UYYA 1QOTA 3OBTA 5IUQA 2E63A 5JOXA 1EY2A 1DZTA 1RUF2 2HEWF 4PQQA 5FXXA 4YLZA 5IFTA 4Y5SA 3RI8A 1K45A 3I2HA 1H6YA 1W2NA 3AB0A 4QKBA 1Z7S2 5HCBA 3ACIA 3WP3A 3ZXGA 4XJWA 5C8CB 5A3TA 4LHSA 3THPA 2CV6A 3THTA 2DFCA 5B2GB 1W0NA 2RV9A 4AEJA 2A6WA 4N53C 3RG0A 2BQPA 2Q30A 1BBT2 4Q4W2 4IEXA 4LO6B 4FPYA 3VD7A 4JHZA 4MXVA 3IAPA 1QXPA 1XU2A 2HWE2 1GMMA 4B1LA 4BDVB 5CG8A 2F4PA 1AYM3 4CCKA 3IN9A 2E51A 3H3LA 1YFWA 5T5LA 1JUHA 3SCGA 1ENQA 3G6JB 4AWDA 2W87A 2W46A 4DZGA 1RUJ3 1V6KA 2IUWA 3VHRA 4TLFA 5BYNA 3RQ0A 4DXTA 4I2OA 2VNVA 4AQTA 2AREA 2WYFA 1PNGA 2LM3A 4LEJA 3SKVA 2NP0A 3WF0A 1K5MA 1VALA 2VZRA 3VZNA 4AI1A 4D7SA 1AR83 4PLMA 1F35A 2DCYA 1A6CA 4WZFA 3SC7X 2KR2A 5HV0A 4Q0PA 2A6YA 2VVEA 4AGVA 2C9KA 4HKWA 4KBBA 2RMU1 3H7JA 2X5IA 4EROA 5C8CC 1PO12 1PZ8A 2OIIA 2XJTA 2ZEWA 3LIHA 1HRV2 3ZYFA 5I91A 2WNVB 3ZYPA 5A7SA 5GZGA 4XYXA 4MXWA 5LBEA 4UW5A 1VBB2 1RUI1 4AVVA 4U2AA 1XNDA 5JAXA 2JE9A 2EIBA 4ONUA 4XTMA 2YPDA 1EAH3 1N3OA 4S2GA 5FPXA 3T0DA 4FTSA 2TEPA 3GBFA 1WGPA 2YYOA 1YRZA 1VP6A 3O1RA 3AMQA 4M4RA 1ZYBA 5CISA 3DECA 1U5ZA 1HV0A 1ZA7A 3INAA 3I2OA 1K5MB 5C4WA 4RGKA 1VE0A 2HWC2 1YQCA 5FJKA 5LEJA 4R4ZA 3BPSA 5F2WA 1SLCA 2WQZC 1Q8SA 3ORJA 2JDAA 3JCIA 1WCQA 2X5IB 1XB9A 3ZFGA 1LR5A 1VRH3 2XOMA 5KWRA 1PMJX 4D6QA 3ZDVA 1A8DA 3OD0A 1OH4A 4YZ1A 3FFZA 2JDKA 4GQ7A 5APAA 3HNMA 3WP5A 1ZNPA 2JENA 2NPIA 2D43A 2IXIA 2DWRA 2VTXJ 2Y34A 4H7MA 4BPZA 4DY5A 5GZFA 2D3SA 4NUBA 2L9LA 3LEKA 4NPRA 4AEDA 4AQ2A 1KFUL 1OURA 2RMU3 2XBO1 4GWNA 2JX9A 2K9ZA 5FZ4A 4NN0A 1WCUA 3SKJE 3C7FA 3SEEA 4KWJA 2NZ9A 1J58A 4S2FA 3D3AA 1MVEA 3K48A 1LENA 1O4TA 1OQDA 1WMFA 4XETA 3ILRA 1OMIA 2H6BA 1T2XA 1DGLA 2UWAA 3MPPG 4GWMA 2QQKA 4XABA 5K0UA 1UX7A 2D40A 2DUPA 4FPLA 1E5SA 3JB4C 1YC61 3KD4A 3APBA 5C4WB 3WQ7A 3OG2A 5FOJB 1K5MC 3I2KA 4Q4V3 3UNPA 3OSDA 3GHMA 2Y6LA 2CGPA 2JDYA 4EV0A 1QEXA 4QX5A 3G7DA 3B02A 3FFQA 4QX2A 1S0GA 5FREA 3CHXA 3WX5A 5IK7A 1ODNA 1JZ3A 2X5IC 3E6BA 2VMGA 2WSUA 3ILFA 1OXCA 5CG9A 3ME2A 4R9BA 4XW3A 4QB6A 1WLCA 5A7NA 4BQ4A 1W8FA 1VBD1 1OUXA 5JSOA 4QQ2A 5JWPA 4U36A 1UZWA 2CWMA 4AEDB 4S2DA 3ACHA 4AR2A 4XQ4A 3WF3A 5JR2A 1OQEA 1O3TA 3AVSA 5C3RA 1O7FA 5IVCA 1O8PA 3GHNA 4YFWA 1ZRIA 3IWZA 2EF6A 5FUIA 2R16A 1TNRA 1PVC1 1GWKA 2QNKA 2VU9A 3A0NA 5FZMA 4RGAA 1OKOA 4LA2A 4WM8B 5D2AA 4QGLA 3CDZB 3MIEA 1OPOA 1RUD2 1V00A 4XJ8A 1GBGA 4YNIA 1UN1A 1W6NA 2E9QA 2PXJA 2XBO3 3FN9A 4IEWA 1JHJA 4MGQA 4Y1YA 3ATGA 1UL9A 4NAOA 3LEMA 5T5OA 1JYWA 2A6VA 4J1WA 2WZR2 2J1UA 5C4WC 4FPHA 4XMAA 3DKWA 4L97A 3UJOA 3ZXLA 1W8NA 1JYIA 3JU9A 4COWA 1TME1 4KWLA 2O1QA 3ZFGC 4DUWA 4ZU7A 4BZ4A 3UYJA 3ZOIA 1TVGA 4D6RA 5KXCA 2VVDA 4QU1A 1VMHA 2R32A 5LBCA 1LULA 3JD71 5IK8A 4WM7A 4UYBA 2W94A 1QJZA 4ZZ5A 1UMZA 2BBAA 1H8VA 4H55A 5A33A 4NRPA 5JPNB 4AEDC 4BWOA 4Q4X1 1REFA 1VBC1 5A3NA 4LUMA 1OC1A 2Q0AA 3ITQA 5FZ1A 4A6OA 2XVLA 3JQXA 1WA4A 5JIUA 5GM0A 2WZPP 3WW3A 1YEWA 4NROA 3C7HA 3K3OA 5EJ1B 1R1ZA 1VBA1 1VIWB 2GN7A 2JB8A 3TB0A 4MHRA 1JU4A 1EV11 2PN5A 3C7OA 1CWPA 1K3IA 2WC2A 3WDYA 3AP4A 5DXDA 2VL4A 5K0UC 5FZ0A 5FMOS 2ZGQA 4Q27A 1G9FA 1BQPA 3IDBB 1PVC3 4CU6A 4HK8A 2DV9A 4HFSA 2DUQA 2GDFA 1ULFA 1W9WA 5FAXA 1ZRCA 3VD3A 3N7KA 3N9MA 1WA6X 3D0JA 3MUZ1 2VC9A 3DL3A 1D2QA 2GC0A 2WT2A 3CU7A 2V5YA 5LZ6A 4WM7B 4META 2QE3A 2RS33 3AFGA 3ALQA 4QPGB 2CY6A 4NE9A 2PA7A 4I01A 4CCEA 1KS4A 5FK8A 2H6CA 5LW9A 1QWRA 3E6DA 1RUG2 1UIKA 1R1A3 2JIGA 4QX3A 5FZBA 1REDA 3POSA 3WDXA 5HCHA 1JXNA 4JV4A 5I8TA 3JD73 4QXHA 2IFRA 4HT1T 4WVMB 3FWEA 2EVXA 2R071 5EXOA 2A71A 1YHFA 3I2GA 1X9TA 4LOSA 4AW7A 4DY3A 5CEHA 3MFCA 1PGSA 1CAWB 1QMJA 1CZVA 2OPKA 3ETQA 4CPBD 3V56A 4Y4YA 3WINE 4UI9L 2OS2A 2WZEA 1VBA3 4P08A 5FZ7A 5LB6A 2Y6FA 1YQ5A 1DQ6A 1XE8A 3PUIA 3BTAA 2XL7A 1JUIA 4I02A 3BIWE 4PF1A 1VBE1 5L9RA 3WLUA 2LW8A 1XOYA 3OEAA 4K9SA 2C26A 4K20A 2W3JA 4K7JA 4PHZA 1L3JA 1PO22 4WM7C 5C33A 3DPRA 4E2GA 4KI5M 2BTVC 1BBT1 3NNMA 3K3NA 4Q4W1 5A1FA 1OUSA 1SBEA 1U0AA 3OGJA 2WRAA 4LJHA 2I2SA 1GFF2 4XAAA 4CXYA 2K46A 3RS6A 2RE9A 2VZOA 4HVQA 4IL7A 1UX6A 4IQPA 3H42B 4AF9A 5HXMA 1X50A 2IVJA 4H14A 1VB2A 1WMEA 2C4XA 3B9IA 1IKPA 1LRHA 2ZHLA 2CAVA 3N9QA 2JG9A 2D44A 2ZX0A 3N9PA 1O59A 3I49A 4NPMA 3S5AA 1CGPA 2Y6JA 4LLFA 5FRAA 4LIUA 4XFFA 2W08A 1QQP1 4AYUA 1U12A 4ZZ8A 2HYKA 4W8JA 3LIGA 5FCCA 3E5QA 5LY2A 4A3XA 1YI7A 5IWFA 4DUVA 1ZBE2 5A3LA 3NJXA 5EHDA 1DQ0A 5KXEA 3J7MA 4FQZA 1RUE1 2DTYA 3OUJA 2WA4A 2AEZA 4QPYA 5T5PA 4CUCA 4QGMA 4HG6B 1UYXA 3PVNA 3WNPA 2GZWA 5A1LA 1RUF3 4PDWA 1SLAA 1DQ5A 1GR3A 3PJYA 5E1RA 5GZDA 4IEVA 1N47A 1CZSA 1HRV1 1FI2A 2CGNA 1JZ5A 3DPRB 3LOBA 1UMIA 5GLUA 2ZGSA 1KITA 4R52A 2UWBA 4X6QB 5C9AA 2WQ8A 1VBB1 3CO2A 5JXHA 1Z7S3 1ZBA1 2W9XA 3WP4A 3T0BA 3J4UH 2XR4A 3GZAA 2A75A 2IZWA 2PAMA 3Q8FA 2E53A 4WVWA 4JCKA 5FWJA 4FOVA 1PGW2 3POFA 4XBNA 1UWWA 3HQRA 1UZYA 3D8CA 2JG9B 2RM22 1BBT3 5ERLA 5CFDA 4Q4W3 2JG8A 3RGBA 3WNKA 4LKDA 4YZ2A 2VW2A 5JMCA 2BERA 3KCYA 4BIOA 4X8NA 4FSJA 2QTWB 2HWE3 2WN3A 3P5BA 3PU8A 4AVAA 5SV5A 3VL9A 4EQVA 2HWC1 4QHOA 4OHWA 1DZQA 3HAGA 4QQPA 4GA9A 5L19A 1IQAA 2F17A 1AX2A 3CLPA 1C4RA 5FXZA 5T52A 5LWBA 3LDRA 3MZHA 3FLRA 2WS91 4E8DA 1C5IA 3WHUA 3AZZA 4PDWB 1KDMA 4I30A 4JKKA 1UPIA 2YMZA 2YXSA 4MLOA 2VD7A 2ZMLA 1W04A 1WLDA 3DPRC 3VD4A 5L9VA 5C9AB 4OZOA 1PVXA 4CCNA 1CZTA 4AFCA 4CU7A 3B69A 4QGNA 3PTYA 3ES4A 2BVVA 2VW0A 3EO6A 3MF6A 3VBHA 4AHWA 3HNYM 1V9U3 3SISA 3O1PA 1PO13 1OSGA 4NOTA 5FZDA 4WV8A 3S5QA 5CNAA 3JZVA 3FHAA 4ZS2A 2A70A 4Y4RA 3H3ZA 3OGSA 4G3YC 2VUDA 5DAVA 3VBSA 2PHLA 5FPVA 4E8CA 4R9CA 2JG9C 1VBB3 2JG8B 3M7AA 5EFUA 2XXZA 5FZKA 4F7ZA 4N90A 2DVGA 4L11A 1RHI2 2BGPA 2D97A 3FUOA 5LBFA 3AVRA 3DF0A 2XUMA 4AEKA 2VBDA 5AVPA 2JDNA 1GSLA 2UY8A 1YQ2A 5A32A 1I6XA 4JX0A 5FZ3A 5AFBA 3KF5A 1W06A 2NMNA 2XB6C 1NG0A 2MNGA 3AP5A 4Q8KA 3VBFB 1PGL1 3HEIA 4C91A 1HRI2 5JXJA 2RJ2A 4FXKB 2Y6KA 1IS4A 4PDWC 1AR72 3THCA 1CAUA 2JE8A 2HWC3 5EIYB 2DCKA 2IXJA 2ZGOA 4RA0A 4HZFA 4O9EA 4E2QA 5A6QA 5C9AC 5I8YA 1S2KA 2IC1A 1BKZA 4OI4A 4ARYA 1OH3A 2D6PA 1V0AA 4ZONA 1XSRA 4FP3A 3VBHB 1XNAA 4HLTA 3OGVA 4FTBA 5LRRA 3OCPA 3HPNA 4XCBA 1RL3A 5FZCA 1VJ2A 4BB3A 3AL6A 3GZEA 1W8UA 3RWKX 1E5IA 1RUI2 5LA2A 4UT5A 2VMEA 1XE0A 1GP6A 1X8MA 1RVF2 1XC6A 2JG8C 1CJPA 3AMHA 3P3NA 5CFDC 4H3WA 1I1EA 4UBHA 2MEV2 5A3WA 2E7AA 2JDUA 2C5DA 2RDNA 2WZR1 1XE7A 2VZQA 4L0PA 4LO7A 5A32B 5GLTA 1ULEA 5CIRA 2VE1A 1B09A 1QNYA 2W95A 4AAPA 4HKOA 2XLGA 5EJ3A 3PIGA 1YUDA 1ULOA 3O14A 1UU4A 3ETPA 3VBFC 5F7UA 3KT4A 4AQ6A 5L9BA 3WNOA 1CAUB 1IG0A 3EJKA 4JDOA 3HBZA 3SNMA 2ZAHA 4XHXA 2BNMA 1ND3B 4AAXA 4LNVA 3DXUA 1S0CA 2ZEZA 1W0OA 5AC91 1UZ0A 3KVAA 3NKGA 3VDAA 4CPBA 3J8F2 2GC1A 3VBHC 3VDBA 1STMA 2P37A 2VZVA 3ZFFA 1AR92 1ONAA 2XJPA 1GP4A 1AX1A 2G9GA 2N7GA 3M3EA 4P02B 3WNXA 4CCMA 1QH6A 3KSCA 4C0BA 5BNPA 3VBSC 1AJOA 1D4M3 4BQYA 2RVAA 5IJRA 3LA7A 1WCDJ 1DDLA 1HJFA 3PL0A 4YSFA 5F5AA 1DIWA 3MICA 1RTVA 3JQWA 4YW2A 4N7IA 2MPFA 4IEZA 2HBTA 3WNMA 5E16A 1YWKA 2FZ2A 3O1VA 5JZGA 2X05A 4P9JA 1TG7A 3KCXA 3OB8A 2LRPA 2QKDA 1BHGA 5A7OA 2W92A 1RUD3 4DEVA 4YM3A 1CONA 2VM9A 2CNAA 3AFKA 4W50A 4AVTA 4D69A 4UFHA 4DEQA 3UV9A 2WZR3 3AMPA 3N9OA 2PAEA 2R6QA 4CDXA 1ND3C 1KGYA 1AL22 1QJY1 2G19A 1F5FA 4XF1A 2OQ7A 4L99A 1RUG1 1XYPA 3AZWA 1UW8A 4Z1VA 5JDBA 4V1PA 1QF3A 1VBD2 1QU0A 3JXSA 4QT6A 3SH3A 4JHTA 4JGYA 4M4PA 2WO3A 5BNPB 5IVVA 4XMIA 4DINB 3UKTA 2P3IA 3FX3A 5FXWA 1IQDC 1U5XA 2GH2A 2OT7A 4J25A 3BKZA 5IK4A 4TXWA 1IKQA 3WDWA 3BOPA 1FV2A 4V2VA 3PVBB 1TMF2 2PMWB 2ZX4A 4BU2A 1BMV2 1G6NA 4O61A 4JDNA 3OJBA 1WWYA 5A3UA 2C1FA 3W20A 1I5ZA 2ARXA 3CJIA 2DF7A 5GKAC 4XUOA 5GALA 4LIVA 3TYJA 2VMHA 4HPKA 4P5YA 4DB5A 5LEKA 1SDDB 3MBWA 3WG1A 3V0BB 3O1MA 3NWKA 2V09A 1J59A 1FT9A 3MLJA 4ISQA 1Y3TA 3BOWA 1MVQA 4KMQA 1I3HA 1TME2 5FZLA 4CDXB 2J22A 2WDBA 5C5TA 1CVNA 2W68A 4UOJA 4JZRA 3SMHA 1XYNA 1NQJA 3RPQA 3AMNA 5BV6A 5ACA1 1VMJA 2Z42A 3BTZA 1HW5A 5CZKA 4QKNA 3ASIA 4SLIA 4JQRA 4N7UA 4PCRA 3J26N 4NWVA 4JGYB 1W03A 2WAAA 3I3EA 4P14A 4FFGA 4GMP0 4A7YA 1VBC2 5BNPC 1LHVA 5DG2A 3U07A 1RUOA 1HB3A 3I3QA 2VQUA 1YJLA 3BCWA 1OT5A 2CDPA 1RUG3 1POV3 3NO8A 3N35A 4JAAA 4FP2A 5HPOA 5GZEA 4OCTA 2BGOA 4LBLA 2JD4A 1J3RA 4OUSA 4XHBA 5FYTA 1W8WA 5IT6A 5FZFA 2FMYA 1HV1A 1SACA 3CJIB 3T0AA 2HWF2 4HETA 1LTEA 5JVVA 4AHYA 5JZGC 2QZ2A 4Z92B 3A0KA 2WQ4A 3A22A 4NRQA 1WW7A 4DUXA 3VDDA 4GALA 2PYTA 4OI1A 1GZ9A 3LE0A 1S2EA 4FPCA 2ZGRA 5KHJA 5C70A 2AZ5A 1QGLA 4CDXC 4YVWA 4UW6A 2QQOA 1HN1A 3ZPYA 1JZ4A 2BGCA 1DYKA 2VG9A 5C8CA 1P8JA 1FAYA 5LY1A 2XHNA 4AE2A 2EXKA 1R092 5JOWA 2ZTNA 2XVGA 3LFMA 2GH8A 1AUYA 4YGCA 3ZVXA 1PO23 3HOBA 1M06G 3UETA 1CAXA 1PGW1 3EB7A 2KXLA 4JGYC 2W5FA 2ADEA 3THDA 4YFZA 3X29B 5C8WA 2RM21 4C8DA 3N9LA 4NHKA 1CQ9A 4I3GA 3EBRA 1LESA 2R7EB 3WV6A 4DO0A 1UYZA 1ULCA 5A70A 2PHXA 3R4DB 4ZU4A 1ZZ6A 4UW4A 4Y1UA 5F9TA 1YNAA 2R072 1N3PA 2D6MA 2EXIA 3LD8A 3BU0A 2WT0A 3ZIXA 3CJIC 4D6SA 4M01A 4ATFA 5JOYA 3KV5A 2ET1A 1S2BA 1PM4A 3AKPA 2GNMA 1DG6A 1IGOA 3VDDB 4OZXA 2P34A 1JHNA 2VULA 3LDKA 2FBEA 2HWD2 1SFYA 1ENSA 3K46A 2KD7A 1RUC2 4YVWB 4YM1A 1QIQA 1SBDA 1ODMA 1ZBE3 3AP7A 4LE4A 1YIFA 2J1SA 1EUUA 1FNZA 4MG2A 5CFCA 4GB32 1VBE2 1VAMA 1PZ7A 4XFGA 2XKOA 4XFBA 4OHXA 1RMU1 2P6CA 4H7LA 4BCUA 2XDVA 5C3PA 2WNVA 4JTNA 5DMYA 5ANNA 1J3PA 1PIV1 1CAXB 2VCCA 4LA3A 3WQ0A 2JECA 4L9BA 3PTRB 5DUVA 1DQ2A 3UKVA 4XILA 3IT8A 2GMPA 4QX0A 1F2NA 2OYZA 4W6XA 2EIGA 1RHI1 1GWLA 4RR3B 1GLHA 3LSEA 4IW3A 4F83A 3VD5A 3JBG2 5EPAA 2JJ6A 3AZXA 2B4KA 3P6BA 1FXZA 4XDPA 5JPMB 1ZVFA 2RM23 3PMSA 2UY9A 3VDDC 1QQP2 2JDMA 4EWEA 2A6ZA 3E5UA 3P1IA 1HRI1 1RINA 1H2MA 5H9PA 3NV2A 1AR71 3UGHA 5A7QA 4GJZA 2CDOA 1F4AA 2Y8KA 2DCZA 1RUE2 1LEDA 4YVWC 5DAXA 5JI9A 4M3CF 1O3SA 1QNWA 3IPVB 3VKMA 4CUBA 5CFCB 4Q26A 3T1MA 3H8UA 1OI6A 3M8LA 4HVRA 1SHWB 2SLIA 2PELA 4XOGA 3QACA 1G9CA 3MIDA 2QDRA 3I8TA 4LBQD 2ZGMA 2WKKA 4AK3A 2WFF1 2XL9A 3ACLA 1ZBA2 4BISA 4W6WA 3VHNA 4XUNA 4KL1A 3RVHA 2VOVA 2OW4A 2P4EA 1RVF1 3KCCA 1MR5A 3M70A 3W5NA 1MS4A 1AHSA 1NQDA 2EXJA 1TE1B 3V0AA 2FCVA 3K2OA 2MEV1 4SBVA 3ILNA 4RR3C 2JXAA 3ECQA 3T2TA 4EWAA 4MH0E 2QQPA 3I3BA 2FDGA 1NUKA 2JEMA 2R1BA 5FYBA 1SZBA 1L7RA 1WUVA 2E6VA 3FLPA 1OHFA 2YY1A 2VECA 4D8MA 4OUMA 1VAVA 4XCAA 1IOAA 1ULGA 1NLQA 3VHOA 4COYA 1GYKA 2D3PA 2PLV1 2A6XA 2EA7A 3H0OA 2DCJA 4FXGB 1UAIA 3NNFA 3UGFA 2RS12 1KXGA 1OLMA 3ZLIA 3M2MA 4XJAA 2NN8A 4QPIA 4LBMA 2AR6A 2B9UA 3RZMA 2WS92 4Z82A 3T2OA 4M3CA 2WO7A 3LEIA 5CFCC 3CZUA 2FDJA 1HX6A 1X7NA 1FNYA 2BVBA 3J8F1 3GJBA 5CB7A 4BQ2A 5DUWA 1UKGA 2WNVC 1AR73 3LF7A 1ZZCA 1AR91 2JWPA 5K9YA 5DZFA 5E6HA 2VMFA 1PX3A 1W6PA 1DBNA 2E26A 2ZCWA 4GMP1 4IXLA 4RSUA 1GKBA 4CEWA 2BV4A 2RR12 3CJXA 3I7DA 3RZJA 3ZSKA 4CDQB 3V0AB 3H1MA 5IW0A 1MS8A 2XMLA 3POJA 4JRAA 4WM8A 4UF0B 4YWAA 5A80A 2B45X 2AC1A 2K0GA 3ZM8A 5BNQA 1RUI3 2ZX3A 4G9SB 4LORA 5GLZA 4OQ8A 1W9YA 2ORZA 2ARAA 1RVF3 4JRLA 1OVSA 4ATEA 5CFDB 1NXD1 4DPNA 3MGUA 3CEWA 4AG4A 1EPWA 5KC5A 2DTWA 2MEV3 2ZPXA 3I59B 4LTAA 3EXUA 1O4YA 4XXAA 5C3OA 4AVCA 1PMHX 5D21A 5IVYA 4CTEA 3AZYA 1D4VB 3PLQA 4QPIB 3A21A 4QQHA 4YW6A 5B4XA 1PGL2 4BQ1A 1AL21 5FZ6A 4D7YA 4M3CB 3ZYHA 2YG0A 1D2SA 2DBNA 2HWB2 4L8QA 3KMHA 1GNHA 1OD5A 3U37A 3AP6A 4XJ9A 4QM9A 3WW2A 2DU1A 1HQWA 3I54A 1GNZA 1QJU2 3ZSJA 3SCFA 5E88A 2YPJA 3WEZA 1LHUA 1W6PB 3TEZA 1FX5A 1IHMA 2FCUA 4XEZA 1EYBA 1V6OA 3DXTA 1C3HA 4Y3OA 4LO4B 4UWDA 4CEWB 1CIYA 4RS5A 5FP9A 1YJKA 1LGCA 1JZ6A 3J8F3 4CDQC 1TMF1 3MV11 4YG6A 1WLTA 1AR93 1OBNA 1SEFA 2Q4SA 2O8QA 1BZWA 4QHBA 4EN0A 2ARBA 1LNSA 4GMP3 2BEOA 1X33A 5F1RA 5HCAA 2ZKNA 3AJZA 4BMEA 2TBVA 2TNFA 2UWCA 4O65A 1V6JA 4B3NA 2QQIA 2YC4A 4QPIC 2ENRA 1WD4A 2AUYA 3PJQA 3VUOA 3NRUA 4FPOB 2P3JA 1KFXL 1WBFA 3UT0A 5GZCA 2GC2A 3NAPA 5C7GA 3MIHA 2ZX2A 3PURA 1FMD2 1BXHA 3CKHA 3O7OA 1COV2 4NAMA 5AC92 4XUQA 4QPGA 4AL9A 5F8PA 4IESA 1O8SA 2UYAA 1W6MB 4YW5A 3B3QE 3NJVA 3O1OA 1AL23 2BU9A 4CEWC 3BTXA 3AL5A 4LQRA 1IS5A 4RS5B 4EZHA 1W0PA 3OPWA 3FZ3A 3BODA 3DYMA 4Y1XA 5FMCA 1VBD3 3NV3A 5KC6A 2RS51 4WM8C 4WVMA 5IVBA 4AI2A 1H2KA 3PUHA 1VLNA 1SFNA 2HWF1 4JKLA 1CAWA
chains in the Genus database with same CATH topology
1H30A 3CL1A 2IXLA 1TMF3 5E8AA 1A3KA 2ZGPA 3HD8B 4E4DX 1XNBA 3LA2A 1AXZA 4AXOA 2XJSA 3LAGA 3RYKA 1YO8A 3POYA 2WLPA 3KS7A 4XJUA 5I0TA 5IK5A 2BWCA 5EYXA 1S0FA 3NAPB 5DUXA 2A7AA 2P3KA 1R091 4L92A 4EN7B 1OLQA 3MEPA 1QJY2 4I0AA 1TME3 3KGZA 4CDWA 5CA6A 2PHUA 3D82A 5DG1A 3EQEA 3KM5A 3O12A 3KB5A 4RS5C 3WXPA 1BVP1 5CVRA 1O91A 4Y1ZA 4UBGA 4KQ7A 4Q4X3 1VBC3 4MGIE 2CAUA 1FATA 3K51A 1CAVA 4CP2A 2WSVA 4ITCA 1ZZBA 2ATFA 2HWD1 4Q1PA 2R0HA 2W39A 1EV13 3D5OA 1RUC1 4DRVA 3GZTB 5FPZA 2GC3A 5L36A 4GB31 3H1WA 3NAPC 1RC6A 1HLCA 2WJSA 2YDEA 4MV2A 4QPGC 5C6CA 1Y7BA 4CDWB 2G9FA 2X8KA 3M3QA 5ACA2 2Z69A 2D6KA 4LHNA 2RHPA 5HXVA 2XWBB 3TNQA 1Q5OA 1PZ9A 2D6LX 1R093 4R9DA 2BW8A 5HBAA 4Y24A 5KHIA 2HEVF 3JBG1 2GNTA 3AXDA 3NKTA 1OA3A 2R1DA 4MVTA 3O0WA 5L73A 4OLLA 4LO8A 4FOWA 2JDZA 1CAVB 2PFWA 5BNNB 3MF9A 3QOPA 1WD3A 2DFBA 4LBQB 4CYDA 2Y26A 4XXPA 2R073 2XGXA 1XU1A 1Z0HA 3NJZA 2YUEA 1TEIA 3A4UA 3OTFA 4D3WA 1ZRFA 3QBQA 5FBZA 2UU8A 2E7TA 5EYYA 1AR61 2XPJA 3MLLA 2HWD3 4IEQA 5H9QA 5FOBB 2VPVA 2ZX1A 1RUC3 5FO9B 4CDWC 3OGGA 4N43A 1MZEA 5T5JA 4GB33 1VBE3 3OBRA 1XNKA 2IFWA 1LOCA 3IMNA 4IV3A 4E9KA 5FQ0A 2YC0A 1PK6A 3KZ4C 4M0HA 2XJRA 3R05A 5JSPA 3BB6A 3OY8A 4Q0QA 3S30A 4RGGA 3AZVA 3MPBA 5BNNC 3NSTA 5EV7A 3GBWA 2B42B 5BNOA 1C1FA 2RS11 3MI8A 2C0ZA 1CJDA 1SCSA 4COZA 3WDUA 3VBFA 1UZZA 1D0HA 1QQP3 4W65A 2DVAA 2GU9A 1H8TB 4PBOA 5SV8A 1SLTA 3H7YA 4AI8A 1RUE3 3LB9A 3ZO0B 4N43B 5T50A 1YFUA 3NW4A 4Y20B 1RMU2 1O4ZA 4OHYA 4LE3A 2RR11 2A3XA 3KQRA 4IV3B 5FQ0B 1PIV2 1W39A 1HRV3 1PK6B 1U5YA 4KGGA 4CDUA 2X53S 4EWDA 3OY8B 4ASMB 2EAAA 4FO9A 1ZBA3 2ZS6B 4OULA 1WW5A 1EPZA 2R062 1LGNA 1ZZ7A 5KXBA 2GNBA 5BNOB 4XDQA 1FPN2 4K1YA 4LULA 1H9PA 3ZMNA 1XYOA 1NE6A 2O0OA 1U5IA 1YLLA 1EAH2 3WOGA 2MHFA 1QXJA 4KGQA 4LBNA 2HWB1 2VMIA 3R4SA 4BA6A 1CR7A 1ND3A 1QJX1 1QJU1 2RS13 2OVUA 1ZZ8A 4N43C 3VKLA 3UK9A 4HANA 2WS93 1GZWA 1MACA 2ZGTA 3R4UA 1IS6A 1S0IA 1IPJA 2ZABA 4IV3C 3VZLA 4CDUB 1DGRN 1GANA 4XFIA 1PK6C 2WFF2 3PVEA 1NLSA 3RJRA 5I0SA 4B29A 1YIPA 3HN1A 2AGSA 4YM0A 5CBLA 3LKJA 2RR13 4XFHA 1RJ7A 2ETEA 4XF4A 3VBOB 3ZDSA 4WZCA 3ZN4A 1XRUA 4Q8LA 2GN3A 5BNOC 1NY71 2D5HA 3B7MA 1F8VA 2WT1A 3GALA 3IKWA 3WQ1A 3EHKA 1V6IA 2PLV2 3AYDA 3TBDA 1C8M2 3AX4A 2ZAAA 3MW4A 3FLTA 2FHRA 1FMD1 5DUUA 4PQ9A 2ZGNA 1COV1 4Z2WA 3Q9OA 1YYNA 4Q4V2 3WZ1A 5D1IA 1NE4A 1GZWB 3LOIA 4B4QA 5K7PA 3AP9A 4ZU5A 2HWB3 4RL7A 1G8WA 4TSVA 4FAHA 4CDUC 3ZN6A 1QJU3 3W9AA 4L2NA 1OA2A 5JCTA 1KS5A 2Z5WA 3IBMA 3VZJA 2VW1A 4NO4A 2H0BA 3WG3A 4ASLA 3FMGA 1S0BA 3TWIA 4PIYA 2VNGA 4I0BA 3CNAA 2UYBA 3M1HA 4LBJA 1YFXA 2NLRA 3USUB 4PIZA 3KGLA 4FPFA 4QQLA 4P5HA 3KLSA 4Q4Y2 3RYRA 3V0BA 2WNEA 3WW4A 4K21A 1X36A 4LLOA 3S7EA 2FZ1A 1MS5A 2OUJA 3TNPB 1YFYA 1Q8QA 4IEPA 5BUVA 1HQNA 3ZN6B 1FMD3 2YZ4A 1RUNA 5AC93 2GAUA 3QH7A 1NZCA 1HQLA 1A8MA 4MZUA 5FFOC 4EJRA 4OFGA 3JB8A 4W6YA 2ZZJA 1UD1A 1Y43B 3B01A 2R30A 1WMDA 1SQ4A 4YYOA 4GXLA 3VL8A 1HIXA 3BPZA 2VY0A 1CPNA 2VNOA 4OI0A 2LTNA 4IEYA 1KRIA 2LALA 3IDCB 4P9LA 1SLLA 2QJVA 1HXS2 4EN8B 3FBMA 5FMOL 1G9BA 4Z07A 4LO5B 1QKQA 2VUJA 1N3QA 4ES9A 4I0WB 4K6BA 3N3HA 5JLVA 1S0EA 2JICA 4YRDA 4MUVA 4AVBA 1AJKA 2H0VA 1KJRA 2DU0A 1Q56A 2YV8A 5I0UA 1GZCA 1LJ7A 1A78A 4IV1A 1J3QA 3MYXA 1QJY3 3VZMA 2QZ3A 4YGDA 5F6LB 2RS32 1LU2A 3WVJA 5J36A 3M3IA 2WNUA 2RS52 1IZ3A 4AFAA 3GYDA 4COUA 2PTMA 1R1A2 5I93A 4IETA 4Q0SA 1BVVA 1DF0A 2A3WA 2HJIA 1AYN1 2WL1A 1MEC2 4IEUA 1SLIA 4HK9A 1Z78A 2RJKA 1LGBA 3MFAA 2B8MA 5FTTC 1PMIA 2D6OX 3AM2A 3VKOA 4COVA 4Q0UA 1ENRA 1D0GA 4DMIA 1OA4A 5K8SA 3VHPA 2GNDA 3NL1A 1GQHA 1BYHA 4M00A 4MSVA 3SCHA 2PHFA 4GKXA 1SLBA 3MIGA 4IV1B 3LSDA 4N9HA 5T3NA 5HI0A 3PHMA 1DQ1A 3QD6A 3L2HA 2IXKA 2XG3A 1H2NA 3N36A 1BK1A 5ACA3 4PF5A 2ZHNA 4INDA 5FLIA 2WNUB 4RR3A 4YVSA 4PLNA 4RHV2 4Y1VA 2RJLA 1KJLA 4FTEA 4ZKTB 1RITA 2BYVE 2Y0OA 3OD4A 4G4FA 3ZIWA 1O5LA 2D6NA 2KM2A 2XKPA 1ULDA 1R082 2E7QA 4ISRA 4K8FA 2W52A 2EAKA 4Y22A 2R042 3IPVA 2DURA 4XQWA 3WDTA 1AR81 2R0FA 4D94A 3RJ2X 5LK7B 4CRQA 3WHTA 4N9IA 1W6QA 1AZDA 3HIFA 4BOWA 1H9WA 3POWA 2XH6A 3SITA 2B46X 2VVFA 4IV1C 1H1AA 4ORFA 4AI0A 3USSA 4GH4A 4YW3A 4X6RB 1CESA 1C28A 4DRRA 3GF6A 4P9YA 3RMYA 4KNCA 1DYPA 1TNFA 2R061 3UJQA 2WNUC 3B9CA 5EZWA 3ZXJA 4YVSB 2BBVA 2YGLA 4AHXA 4I3PA 3DN7A 2XJVA 3H9AA 3WUCA 1BEV2 1FPN1 5LK5A 3S6PA 2DCTA 2IWGB 4NHLA 1EAH1 1DGRA 1OFSA 4A2UA 4LHLA 1UU5A 2YROA 4Y22B 4B7KA 2B39A 3VZKA 4WVVA 2WINB 1MZFA 1SMVA 2DUOA 3QLQA 1W6QB 1SCRA 4KWKA 1AR62 2TUNA 1UKRA 5GLWA 1VRH1 2K2SA 3NVCA 1QY4A 4XTPA 1OOPA 3SXWA 3B5LB 3VV1A 4GH4B 3ZFEA 2ZGLA 4FPKA 3FE5A 4S2HA 1RMU3 3U11A 3M3OA 4CDQA 1Q8OA 5J3UA 4LT5A 4YVSC 1QOOA 1PIV3 5BXXA 1V9U2 2GMEA 4Q0VA 4MGKE 5JI7A 3ZXDA 2VQ0A 1LOEA 1WW4A 1RHI3 2R063 1KDKA 2WFPA 3I59A 1C8M1 5L7OA 4Q29A 4J6GA 3TN92 2ES3A 3PMEA 1FPN3 4WBBA 4B7EA 1PM7A 4Q4V1 3TAYA 4LBOA 5ABJA 1HRI3 1M4WA 1NA1A 4C1XA 2VQAA 2ZKLA 4JVAA 3IIAA 4DS0A 3HQXA 3D0SA 3NV4A 1OOPB 2Q1MA 4GH4C 1Q3EA 3ZFEB 2I07B 3LGRA 5H9SA 4FVVA 5J37A 4C0HA 2GALA 3FJSA 1Q8PA 2UURA 3W58A 1JH5A 2WFF3 1VR3A 4HN0A 1ASJ2 1LODA 4MXWB 4Q4Y1 3ES1A 3VBRA 2DVFA 2ZACA 1ND2A 5L7OB 2PAKA 4CP1A 2OZJA 1DFQA 1SBFA 1B35A 3ZYGA 3ZXAC 1RB8G 5ABJB 1NA1B 2PLV3 2DVDA 1FOD2 1QJX2 1C8M3 1MQTA 1IS3A 1GQGA 3VLBB 2XLFA 5JOZA 1W6MA 1OOPC 3RI9A 2ZOEB 5I8SA 3ZFEC 3FHIB 2P17A 1NYWA 2JKBA 2BNNA 3RWNA 2QCSB 2Y0IA 3ZFGB 2R49A 3AK0A 3L2YA 4DXZA 4BLJA 3NV1A 3I2DA 2BWAA 2PHRA 4RFT0 3VBRB 4EN6B 1DQ4A 4XIKA 3MW3A 1D4M2 2A3YA 4MGYE 2PHTA 1ND2B 3MIBA 1HXS1 2ZJCA 2BFUL 1NY72 1WBLA 5L7OC 4C90A 2YGMA 4TZDA 3P3PA 5E89A 4YZ3A 1B35B 2D5FA 3H3UA 5DDJ2 5J09A 3OF1A 1ZM1A 1F9KA 4Q4Y3 3N7MA 5ABJC 1NA1C 3H1YA 1MQTB 1VB4A 3OPZA 5K0UB 5KXDA 3WY6A 3D6EA 5JIAA 1OKQA 4YG0A 3HR9A 1H0BA 4AI3A 3V64A 3U0ZA 3KT1A 1UF2C 1WCKA 2RS31 2EXHA 3N7LA 4XJZA 1QDCA 4Z8BA 2AYHA 1LHWA 2IXHA 3SHRA 2LUWA 1DHKB 4CEYA 3MW2A 1X82A 4OHVA 1Q8VA 3ELNA 1R1A1 2JE7A 3GZUC 1C1LA 2QVSB 3SH5A 1JN2P 4FOYA 3R0RA 1X8EA 4XBQA 3VBRC 1MEC1 3ZYJB 5A3MA 1ND2C 3C3VA 4J1XA 4LUKA 1QH7A 3B93A 2YHJA 2NQYA 3WG2A 4XE9A 1F5JA 4XZPA 4XPVA 4LR4A 1B35C 1C57A 1MS9A 4DOUA 3WR0A 1LOGA 2ZZQA 2ZMNA 1HXS3 1MQTC 1W6NB 2XHKA 4K3UA 2D7FA 4PIXA 4KU8A 4YG3A 4KG8A 4P9IA 1WLWA 1WCSA 2ILMA 2XLAA 2VOWA 4GULA 1ENXA 4FOQA 4HSLA 3E6CC 1PHMA 2KA3A 4B4PA 2CTVA 1S0DA 1OLRA 1UIJA 3VZOA 4CEYB 1NCQA 5CU1A 1ZX5A 1TQ5A 3WT3A 2AENA 5LRSA 4RHV1 1ZREA 4DFSA 2QFEA 1RUH2 3ZSLA 4PJYA 4XF3A 3UKNA 2CWSA 4CZSA 4AFBA 5FLHA 5KHHA 5BNNA 3FUQA 5A33B 1MZ6A 2GSYA 3M3CA 3WCRA 2BPA2 1R081 2RS53 4LBQA 1G86A 3AYCA 4GIQA 4MGZE 2HWF3 2R041 4B4RA 1O5UA 3ZSMA 3QCWA 4Y26A 1S55A 1LOBA 3ZXKA 3HT2A 1CX4A 1MEC3 1UCXA 3LWCA 1FYUA 4XQDA 4YZ4A 1V6MA 4FCAA 4NR1A 1JOJA 1RUF1 2OA2A 3AKRA 1LU1A 5F6KA 3ZSEA 2IXCA 2QUOA 5T55A 1NCQB 1Z7S1 4CEYC 4OVEA 4P9XA 3ST7A 4TYSA 4LBKA 1BEV1 1DU3D 3WW1A 1QXRA 2O8OA 4BM8A 4F3JA 1LB2A 1NLRA 1H4HA 1OQ1A 1LHOA 1H2LA 1JW6A 3AJYA 4TWTA 5CADA 3ZYRA 3WP6A 4RHV3 4BLIA 1AYN2 3U4XA 2HWE1 1NCRA 1S0JA 3DUIA 5DZGA 2C9AA 2VUAA 1N1YA 1NOVA 3UL2A 1H8TA 1R083 2HEYF 1G9AA 3HT1A 1BJQA 3FBYA 4QM8A 2R043 1CD3G 3PNAA 4Y20A 1N1VA 2QDNA 4YW4A 5F5QA 3ZMOA 4A7KA 2BNOA 3MDPA 3T1LA 2CGOA 1NCQC 3VKFC 4EN9B 4M0NA 4QMAA 2I45A 2B5HA 3B00A 4P9GA 1V9U1 2Q1ZB 1JYCA 1LHNA 1PO11 5JR7B 1QHDA 4YW1A 3WDVA 4E4SA 4JTOA 3D4KA 4KG0A 1O3RA 3TN91 1N1TA 1V6LA 4P9WA 4RQPA 1AYM2 3JBG3 3RRDA 4AVSA 1POV0 1BEV3 1NCRB 2Q8OA 1OPMA 3LZZA 2CYFA 2A5ZA 3AMMA 2P2KA 1H1IA 5FLJA 1RUJ2 1JTZX 1BCXA 1KD7A 2B7YA 4YGEA 4Q1RA 4JGZA 1PNFA 4XBLA 1E57A 3C2UA 1AR82 3WG4A 2W0XA 1LKNA 4QD2A 2V73A 4QXKA 5I0RA 4HL0A 3SLIA 5J96B 1AR63 4AQSA 1ZA4A 1H1MA 4BHPA 4E2SA 2XJQA 2VOKA 3GNEA 4XIOA 5CAZA 3HMYA 1ASJ1 5J98B 1WW6A 4FQ4A 2XJUA 2Z79A 1XQNA 2D98A 3RDIA 3VBOA 3I4IA 1V70A 5T54A 1RGSA 4RQPB 2CL2A 4FAGA 1DLLA 4JC1A 2VH9A 3W59A 1NCRC 3VKNA 2XWJB 4O9GA 3ZYIB 4AGRA 4KU7A 4R8HA 4FBFA 2Y38A 4AI1A 1H8TC 4JGZB 5BPXA 1ALYA 1FOD1 3RZZA 3PVOA 4XF9A 3TN93 4QU2A 1ZZ9A 4AEMA 1ZRRA 3S7IA 1JBCA 3URFA 1VAKA 4XFCA 3AKQA 1HKDA 2PHDA 1NXMA 3GBGA 5H9RA 1VRH2 4FPEA 1YI9A 1AXYA 2EALA 1GICA 4K1ZA 4IERA 1J1TA 4BIFA 4AFDA 2FQPA 4YZ5A 4LHKA 2RMU2 1DZRA 1D4M1 4BMBA 1W6OA 2X29A 3N7JA 4FPGA 4RQPC 3KT7A 3USUA 3WD5A 3WCSA 4XF0A 3U10A 4YM2A 4NHMA 2F6BA 3LA3A 1ASJ3 5DDJ1 3SH4A 3VBSB 2NM1A 4R4XA 3TRSB 2VGDA 4AFMA 1RUD1 4JGZC 4AHZA 2G4IA 3MLKA 5JSRA 4BYYA 3CF6E 4KH9A 3AKTA 2I74A 1F31A 3N4MA 3O0VA 1C5HA 1W2UA 4CP0A 4DNYA 2A73B 5GLVA 4YARA 1FOD3 1QJX3 1FV3A 1C8NA 4M3CE 1MS0A 1UU6A 3L9JT 4I09A 3HWJA 5J7MA 5AVAA 3OYWA 5TSWA 3MIFA 3E5XA 1LOFA 2FMDA 1J1LA 3VBOC 1W6OB 3ZX7A 3J9SA 2ZA9A 4JDMA 3AKSA 3VN4A 4NVPA 2ET7A 2XVKA 2ZGUA 3IDEA 2SBAA 4UXAA 4C1WA 2XBO2 4ES8A 1LEMA 1QOSA 3VBUA 4FPJA 3RSJA 1UPSA 2BFUS 5HCFA 4HMZA 2OZ6A 2ZHMA 2ZGKA 5DDJ3 3E97A 4MX3A 1S1AA 1Q43A 3IM0A 1COV3 3RYPA 4WVZA 4X8PA 1AL0G 3FC0A 4BH9A 4E4ZA 5FO8B 1RUH1 3OYWB 1AF9A 1AXKA 4E27A 3ENRA 4IEOA 1ZRDA 5D8AA 3RMXA 2ZBJA 3QH6A 5KHKA 3ZFFB 1POV1 4OI2A 5AFEA 4QQOA 1YXWA 2WWSA 4HVOA 1SDWA 1MZ5A 3M4FA 2HKXA 4R9AA 1MS1A 3VBUB 4GKYA 1AX0A 1PVC2 1QDOA 2WLQA 4HN1A 2VNRA 5JZGB 1DGWA 5KBFA 2BUKA 2ZHKA 1GV9A 3R6SA 5BY5A 3O5SA 1CPMA 1REEA 4B8EA 1LCLA 2WIIB 4D7TA 2ZMKA 5KHGA 2AH2A 2NYYA 2WA3A 2Q5TA 3ZXFA 1PO21 1LOFC 1IPKA 1CIWA 3B94A 5D8AB 1RIRA 3TOJA 3BU7A 3ZN5A 4AGGA 4MYEA 1DGWX 1N1SA 2D3RA 1EP0A 2PQQA 3JD72 3ZFFC 1OFNA 1RUH3 4F8AA 4N53A 2ERFA 3H50A 4Q4X2 5DZEA 1LECA 2VXRA 2NMOA 4Y5Z0 3VBUC 5J48A 3AXEA 3S0MA 4OHZA 4RD7A 1VBA2 1EV12 4YGBA 4HBNA 3VGIA 1ZBE1 1XNCA 2DYCA 1YCIA 4HPKB 2OUHA 5FDBA 1LOAA 2PHWA 2DVBA 4BE3A 4PLOA 1G7YA 5EWSA 5GJ6A 4URTA 3RNSA 1O3QA 1KQRA 1RJ8A 4DQAA 4FT8A 3AYEA 3O0XA 4K40A 1MS3A 3BALA 3DV8A 5D8AC 2GMMA 1XXNA 4Q2FA 3WUDA 1URXA 1V6NA 5FO7B 1AYM1 3DGTA 3JUUA 4HSJA 2D93A 4HKLA 2Z2SB 3LCPA 4N53B 4ZXKA 3ZXEA 1APNA 1Y9QA 1RUJ1 2VOXA 1HDKA 4NWWA 1T6GC 3ROUA 3V65A 4XFAA 1I9RA 1AVBA 3AYAA 1AYN3 4UW3A 1H4GA 4A7ZA 1CN1A 4PBPA 5IUQA 1QOTA 3OBTA 2E63A 5JOXA 1EY2A 1DZTA 1RUF2 2HEWF 4YLZA 3RI8A 3AB0A 1Z7S2 5HCBA 3WP3A 3ZXGA 4XJWA 5C8CB 3THPA 2CV6A 3THTA 2DFCA 5B2GB 4AEJA 2A6WA 4N53C 3RG0A 2BQPA 2Q30A 1BBT2 4Q4W2 4IEXA 4LO6B 4FPYA 4MXVA 1QXPA 1XU2A 2HWE2 5CG8A 2F4PA 1AYM3 3IN9A 2E51A 1YFWA 5T5LA 1JUHA 3SCGA 1ENQA 3G6JB 4AWDA 4DZGA 1RUJ3 1V6KA 5BYNA 3VHRA 4TLFA 3RQ0A 4I2OA 4AQTA 2AREA 1PNGA 2LM3A