4AEDC

Crystal structure of human enterovirus 71
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
242
structure length
242
Chain Sequence
b'GFPTEPKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRDGPWQSTMLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDTSHILQTASIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Crystal Structure of Human Enterovirus 71.
pubmed doi rcsb
molecule tags Virus
total genus 40
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4aedC00
1B35A 2BFUS 4RQPA 1AYN1 1COV2 1AR82 1AYM1 1PGL1 1QJX2 2RM21 1Z7S3 4N43B 3J8F3 4JGZB 2WS92 1AR63 1HX6A 4N53A 4Q4Y3 4GH4C 1HRV2 2XBO1 1PVC3 1MQTC 4WM7B 4FTEA 1PO23 2R042 2PLV1 5D8AC 1PIV2 1RVF3 4WM8A 2R062 1ZBE2 2TBVA 4IV3A 4PDWB 5JZGC 2Y26A 4RR3A 1RUF1 2X5IA 3DPRA 3TN91 5K0UB 2FZ2A 1RMU2 4CDXA 1NY72 1AYN2 4QPIA 5BNNA 1POV3 3VBFB 1TME3 5CFDA 1M06G 1RUH1 5C9AB 1V9U3 1ASJ3 1VRH1 1VBB3 1NCQC 4AEDC 1C8NA 1X36A 1R091 4RHV3 5CFCA 4JGYA 1VBC3 1MEC3 3VBUC 4Y4YA 5ABJB 1QQP1 4Q4W3 4CEYA 2XBO2 3S6PA 1RUC1 1RHI3 3M8LA 1WCDJ 1VBA2 3JD73 1TMF1 1AR92 1RUE3 4Q4X2 2BFUL 1VBD3 1D4M3 4QPGC 3VBRB 2HWD1 3VBSC 4YVWC 1W39A 3ZFGB 5FOJB 4CEWC 3IDEA 1FPN3 1ND3A 1Z7S1 1COV1 1AR81 3VBHC 4RS5C 1CD3G 4CDUA 1NCQB 4Q4Y1 1RUJ3 1R082 1RUI2 1NCRB 1OOPB 2RS13 1RUH2 4Q4V2 5DDJ2 1VAKA 3ZFFB 1VRH2 4CDWB 5BNOB 5BNPB 2VQ0A 4N43C 2MEV3 5C8CB 1FMD3 1HRV1 1ZBA3 3VDDB 1RUD3 1BEV3 2HWC3 2HWB3 5A33A 1AL23 1C8M3 1B35B 1AUYA 1EV13 1PIV1 1HRI1 3CJIA 4YVWB 4FTSA 1SMVA 2BBVA 4CEWB 1ND2A 1FOD3 1R1A1 4PDWC 1RMU1 1H8TA 2HWF3 5FMOS 1NY71 3JBG3 1Z7S2 1BBT1 1HXS1 3ZFEA 5K0UC 1AR62 1RUG3 4Q4Y2 1QJY3 2ZTNA 5GKAC 2R073 3VBFC 2RS53 5J96B 2RS33 5C9AC 1PVC2 4IV1B 1AR73 1PO22 1OPOA 1OHFA 3JD71 2DF7A 4RR3B 2RMU3 3NAPA 5ABJC 3DPRB 1RVF2 4QPGA 3VBOC 4CDXB 1VBA1 4CDQC 4QPIB 3VBSA 5AC91 1AR91 4YVSC 1HRI2 4Q4X1 1QJX3 1NOVA 4Z92B 4GMP1 5CFCB 3VBRC 1PGW2 1R1A2 1K5MC 1TME2 5L7OB 4CEYB 3ZFGC 1VB2A 1V9U2 4GB33 5C4WC 1BBT2 1ASJ2 4JGZA 1VBB2 4BCUA 1HXS2 1R081 2HWE3 1RUI1 2WZR3 4Q4V1 4RHV2 5DDJ1 1VBC2 2GH8A 1MEC2 5ACA3 1NCRC 1OOPC 4GMP0 2RR13 2R063 2ZZQA 4WM7A 1ZBE3 3ZFFC 1RB8G 1C8M1 4CDWC 1RHI2 5BNOC 5BNPC 1NA1C 3VBOB 4CDQB 1EV11 5C8CC 1PO13 1VBE3 3JB4C 3JD72 3VDDC 4YVSB 4FTBA 1ND3B 1RUE2 2GSYA 5A32A 1VBD2 4RFT0 3LOBA 5AC92 1D4M2 1B35C 1AYM3 2IZWA 5FMOL 2RM23 1X33A 1FPN2 1K5MB 1EAH3 2WFF3 5C4WB 1RUG1 1RUJ2 4N53C 3J8F1 2RS12 2R071 4NWWA 1F8VA 4GH4A 1AR61 2XBO3 5A33B 2MEV2 1FMD2 1MQTA 1AR71 1NA1B 1PVC1 1QJU3 1RUD2 2PLV3 1BEV2 2WLPA 3CJIB 2HWB2 1AL22 1C8M2 1PO21 5D8AA 4WM8C 1E57A 1ND2B 1EV12 4IV1C 1RVF1 1H8TB 4RQPB 1RUF3 3TN93 5JZGA 4RR3C 2WWSA 3DPRC 3ZFEB 4CDXC 4QPIC 5BNNC 1FOD2 3ZFGA 3JBG2 1VRH3 4N53B 1POV1 1PGW1 1BMV2 1R093 1TME1 1RUG2 1NCQA 1CJDA 1V9U1 4AEDA 1QJY2 5CFCC 3J8F2 1ASJ1 4JGYC 1VBB1 1NCRA 1OOPA 1QQP3 2R072 2RS52 5ACA1 2RS32 4RHV1 3VBUA 3NAPB 3ZFFA 5L7OC 3ZXAC 4CEYC 5BNOA 1RUC3 1VBC1 1MEC1 4LLFA 4Q4W1 1AR72 4WM8B 1TMF3 1VB4A 1PO11 1RHI1 4IV3B 2RMU2 1NG0A 2HWD3 2X5IB 1IHMA 1RUE1 1VBD1 1D4M1 5BNNB 4YVWA 1COV3 1AR83 4EJRA 1EAH1 1ND3C 4CEWA 5CFDB 2WFF1 3VBHA 1FPN1 4CDUC 4SBVA 4RS5A 2WS93 3FBMA 4GB32 4JGYB 4NWVA 1RUJ1 2HWE2 2RS11 2WZR2 1HRV3 4N43A 5ACA2 1QJU1 3JB8A 2MEV1 2FZ1A 2BPA2 1FMD1 2RR12 5A32B 1ZBA1 2R043 1RUD1 4IV1A 1BEV1 1PIV3 4Q4W2 1HRI3 2ZAHA 2HWC1 2HWB1 1AL21 1PO12 1GFF2 1VBE2 3CJIC 1AYM2 1PGL2 1R1A3 1A6CA 1RMU3 1ND2C 1AYN3 4GH4B 2RM22 1H8TC 4CDUB 1BBT3 4PDWA 4RQPC 4FSJA 1HXS3 1EAH2 1FOD1 2WFF2 2HWF1 1MQTB 3ZFEC 3JBG1 5K0UA 1BMV1 5L7OA 3VBFA 1QJY1 5D8AB 5C9AA 2RS51 2RS31 2PLV2 1QJU2 5JZGB 1VBA3 1ZBA2 3NAPC 2QQPA 5LK7B 5AC93 5ABJA 1AR93 1DDLA 3VBOA 2RMU1 4CDQA 2HWC2 4Q4X3 1F2NA 1AL0G 4YVSA 1RUF2 3TN92 4GMP3 4IV3C 1QJX1 4AEDB 3HAGA 2X5IC 2WS91 3VBRA 3VBUB 1K5MA 1R083 1RUI3 4Q4V3 1R092 1RUH3 4JGZC 5DDJ3 5C4WA 2HWF2 5CFDC 4GB31 1QQP2 1QJZA 2HWE1 2WZR1 1HQNA 1RUC2 4WM7C 2R041 2RR11 4CDWA 4QPGB 5BNPA 1NA1A 5J98B 2R061 1TMF2 1ZBE1 3VBSB 5C8CA 3VDDA 4Y5Z0 2HWD2 1POV0 1VBE1 2BUKA 3VBHB 4RS5B 2XPJA
chains in the Genus database with same CATH superfamily
2P5BA 1VMJA 2PHXA 5H9RA 3VUOA 5A3NA 5C5TA 2DURA 1AZDA 2VVEA 2W2IA 2ZACA 3AP6A 1COV2 4NUBA 4COUA 2ORZA 4XCBA 4BU2A 5A3LA 1QJX2 3PDQA 3MV11 3LEKA 4OCTA 4ES8A 5FZ7A 4AGRA 1O4TA 3PMSA 3BOPA 1AR63 2NLRA 4HPKB 2V72A 1UZVA 4N53A 4Q4Y3 5K7PA 1CAVB 4GH4C 1HJFA 3B5LB 4Q0VA 1URXA 1LU1A 1Y43B 2ARAA 5FPAA 4AVBA 1CZSA 1Q3EA 1PVC3 2E26A 3BPZA 1SG3A 5BNQA 5IWFA 1YQ6A 4MYEA 4HG6B 5FYHA 1KRIA 2PQQA 1N3OA 4A7YA 4BLIA 4B3NA 5H9SA 2EALA 4E8CA 2PLV1 1YWKA 3PVEA 1RVF3 4WM8A 1SCSA 2XJRA 2XJTA 1GQHA 4B8EA 2VBBA 5L36A 1Y7BA 1QXJA 2C9AA 5A7PA 4C1WA 3OG2A 1GKBA 5FTTC 4NIHA 4OHWA 1OVSA 3WX5A 4RR3A 5CIRA 2DVFA 1U12A 3IAQA 2ES3A 5GLTA 3AZVA 3CHXA 4W65A 4RL7A 2IUWA 2GH2A 3M2MA 1VR3A 4GA9A 4LIVA 2FD8A 1UQXA 4IGQA 1JOBA 5HXMA 4LQRA 5CFDA 1UX6A 1M06G 2FCUA 1W99A 4L9BA 4QM8A 3MIDA 1ULCA 3EMRA 3WVJA 1V9U3 2YDEA 1VRH1 2W92A 1S2KA 3BALA 2JDKA 3E6BA 3IAPA 3OOXA 1TE1B 5FZFA 2X05A 2VOWA 4Y20B 5J37A 2Y0OA 1VBC3 2PFWA 2WDBA 2ZX4A 3QH6A 4GKXA 3VDCA 4AVSA 1DQ5A 1DZTA 4GWNA 2A73B 4Y4YA 1YO8A 3JQWA 3SKJE 1YFXA 4KGQA 1P8JA 2GP5A 2LM3A 2IFRA 2V4VA 1XU2A 3R4UA 1RUC1 5FO9B 3GZAA 4MH0E 1W8WA 3SXWA 5KHGA 1XXNA 4HK9A 1L3JA 4OHYA 3ELNA 1VBA2 4HL0A 1PNGA 1TMF1 4KU7A 1AR92 2L9LA 5FREA 3ZMNA 4Y5SA 1UKGA 3IPVA 4QAWA 4AK3A 1FV3A 3PJYA 1RL3A 4C0HA 4FOVA 2VW2A 1D4M3 5D1IA 4MG2A 1UYZA 2HWD1 1H2KA 1YXWA 3N7LA 2BV4A 2HEWF 3R05A 3DUIA 1W8OA 1REDA 3IDEA 4JHTA 5BV6A 4EN7B 1Z7S1 3VBHC 1AR81 1F5FA 1OF4A 4G4FA 2E7TA 5C5UA 2P17A 4RS5C 3ZYIB 1NCQB 2ZHMA 3H9AA 4QD2A 3ZX7A 3WNOA 4XVHA 4DY5A 1MZFA 2RS13 2DUQA 3SHRA 3V56A 1W8TA 4M3CA 2DDUA 4WVVA 3ZFFB 1VRH2 2XL7A 1H2NA 5FZ8A 4CDWB 1UZZA 2Q8OA 4EZ4A 5F5QA 4BIOA 4NRPA 1U5XA 3VKLA 5KHKA 1FMD3 3KS7A 2ZGQA 2WO1A 4LHSA 4OQ8A 1RYYA 1ZBA3 2WNVA 3FMGA 3KGLA 5F8PA 1RUD3 2WAOA 3D82A 4FFHA 5AFBA 3O5SA 3QD6A 2HWC3 4DZGA 2OQ7A 2QNKA 5IAVA 4YM3A 4D3WA 5F3IA 2O14A 1H9PA 4LO8A 5DAXA 3ABZA 3T09A 4LA3A 1FX5A 2D43A 2YBKA 2CYFA 4PI2A 3IZOA 4XILA 4YVWB 3WDUA 4PIYA 1ULEA 4AGVA 3BIWE 4QGLA 1YI9A 1YLLA 2PHTA 4BH9A 2PHDA 2E9QA 1VLNA 5SV8A 4AFDA 4KWKA 3ZLIA 3Q8CA 4P9XA 5FZHA 1HKDA 5CYYA 1FOD3 2F17A 4U36A 5HI0A 1RC6A 3D4KA 1NY71 3H1YA 1JHJA 4XQ4A 2AACA 5CKQA 1W8NA 3VHOA 1Z7S2 3ZXGA 5ACA1 1BBT1 2ADDA 2JDPA 3N9NA 3RZZA 5FPUA 3RI8A 4B4QA 1QOTA 4AI1A 1UZ0A 2HLEA 5I0UA 2C4XA 2AENA 2H0VA 3VBFC 3RWNA 4F8AA 1Q5OA 2PHUA 4LULA 1LENA 2E53A 1YNAA 2Y6GA 3N7MA 3ON7A 4XETA 3WINE 3DECA 1W6PA 4YGEA 3LOIA 4IV1B 5F3EA 5FZ9A 1AR73 4LBOA 4XJ9A 3GCWA 3NRUA 5FYBA 5C7GA 2UWCA 1PO22 5GJ6A 1S0JA 2JECA 3GDBA 1OPOA 2CGOA 2DF7A 3KLSA 1YQ5A 4CDXB 1NT0A 1US3A 4FFGA 2YYOA 3LFIA 4MSVA 3U14A 5CKMA 1AF9A 5A70A 2B8MA 3MW2A 1QJX3 3WF3A 2HH9A 2NMOA 2WT0A 2K9ZA 1SDWA 2QQJA 1LRHA 1MVQA 3RYPA 1WW7A 1XE7A 3OGRA 1S2BA 3U4XA 3WG4A 5CFCB 2VTXA 2OS2A 1PGW2 5AVPA 3MUZ1 4NRQA 5LA2A 2LALA 3IKWA 4A6OA 1K5MC 3Q8FA 4CU8A 1UZWA 1GZTA 5LA1A 4CEYB 3QOPA 2R7EB 3NWKA 1DF0A 1VB2A 3HBZA 4MO3M 3ZFGC 1BBT2 1J59A 1VBB2 1GZ9A 3KVAA 3DKQA 1RUI1 2WZR3 1IS5A 4HPKA 3RGBA 3W5MA 1ZRRA 2GMPA 5JSOA 1BK1A 1L7LA 1XRUA 2C1FA 2WNOA 3IDCB 5ACA3 2HBUA 3WNLA 4DIQA 1O8PA 1LULA 3WHUA 1XNCA 1C5IA 2ZZQA 1GBGA 5BNOC 1UXZA 5ISLA 1F9KA 2GAUA 4QX8A 1EV11 1UOGA 1W2AX 4NE9A 5AFEA 1YI7A 4UYBA 3HMYA 3JB4C 4NN0A 3WP3A 4AEKA 2PTMA 4LT5A 2PN5A 2NQYA 2GSYA 3AB0A 5DABA 2B45X 4UBGA 5FP4A 4RFT0 4HKWA 4BQYA 3R6SA 1UY2A 2WWUA 3GZTB 1B35C 2NM1A 4FPJA 4E4SA 4EWDA 2FMDA 5HCAA 3CL1A 4AQ6A 2YFZA 3FWEA 1V6JA 4PBOA 5FMOL 1RXFA 2XONA 1X33A 2J1UA 1WCSA 1FPN2 1EAH3 4DUWA 1H8VA 4JVAA 3B9CA 4BHPA 3D5OA 3WQBA 3ZDVA 3ES4A 4MVTA 1RUG1 4I09A 1G9FA 4AVTA 2VUAA 3GNEA 1F8VA 1LHUA 4MADA 4M3CF 3RSJA 3FZ3A 3VGIA 1JYVA 1G9BA 5EJ3A 4P9GA 3VZNA 4OI2A 1SLLA 4D69A 3VLBB 4Y5TA 4YFWA 1NA1B 2PLV3 4IEPA 2IXLA 3P3PA 4EZHA 4PF5A 4KWLA 1V6KA 3PUIA 3NV1A 5D8AA 1OA4A 3H8RA 3O1RA 2HEVF 2B42B 2NYYA 1Q8VA 2BNMA 2XVGA 1ND2B 3JQXA 1EV12 3LZZA 4GXLA 2VMHA 4QXCA 4QXKA 3T0BA 1I5ZA 2VMCA 2C26A 3LIGA 4QDSA 1ZRIA 3Q8BA 4LHKA 4W4ZA 3THPA 5IVEA 1N47A 1YJKA 5FRAA 3DPRC 2VZTA 1KFXL 2WAAA 5EP9A 2OW4A 2VC9A 3C7EA 3HN3A 4Q8KA 4Y24A 1YQ2A 3I7DA 1KDMA 4FT8A 3JBG2 4R9DA 1VRH3 5LW9A 1EYBA 1POV1 4F83A 1GR3A 5H9PA 2P6CA 1F4AA 1TME1 2QQVA 4P00B 2E7AA 2GNBA 3NVCA 1RUG2 1SLBA 5FZBA 1NCQA 2J1VA 4CUBA 3NNMA 1W2UA 4A7ZA 4R9AA 5FCCA 4DRVA 4UXAA 4XBLA 2JG8C 3J7NA 5FY0A 5FZMA 2RS32 3ZPOA 3VBUA 3NAPB 3ZFFA 3ZXAC 1RUC3 4PCRA 1J1LA 5DMYA 1KFUL 1MEC1 4N7UA 3HT1A 3GZEA 1N3PA 3PU8A 4GJYA 4S2GA 4Y22A 3U78A 1I6XA 2E51A 1XNAA 4K1YA 1TMF3 3RWKX 4K20A 1RHI1 2ET1A 4H7LA 2ARBA 2AH2A 4YM0A 2PQSA 1CESA 1FI2A 1NG0A 4K1ZA 5E88A 2HWD3 4NOTA 3WUDA 4MGKE 4OUSA 1SFYA 1WCUA 3HNYM 2X5IB 1CPMA 2BNNA 5LEKA 3ALQA 2BWAA 5LZ6A 1VBD1 5IK5A 5IUQA 3KB5A 2ZAAA 4YVWA 5BNNB 1AR83 1GOHA 1S2EA 1XQNA 4EJRA 1ND3C 3K4DA 3H42B 3OJBA 1OQ1A 4TXWA 5LWBA 1K42A 4XQDA 3SH3A 2OT7A 2AR6A 5LY2A 4CDUC 1UL9A 4YRDA 4AFBA 3AJYA 3O14A 2W91A 4AVCA 3KT4A 1H6YA 2A3XA 2A75A 2KA3A 5L9RA 1K5JA 1WLWA 2DBNA 5FZEA 1RUJ1 3ZSJA 4HSLA 5LBFA 2HWE2 4A2UA 3WF1A 3I2KA 4BQXA 5C6CA 1BVVA 1J58A 3IN9A 1UW8A 5JVVA 4AEJA 3DYMA 2JG9B 4A45A 1GWLA 5LBEA 1QJU1 1IGOA 2MEV1 5GLUA 2QQLA 2JDNA 1I1EA 2AEZA 3NL1A 3A23A 3DL3A 2A3YA 3DGTA 3O12A 1DLLA 2X8KA 1IQDC 2W68A 4IV1A 4QHZA 5SV5A 3ZOIA 2ZAHA 4HBNA 2RDQA 4NVPA 1TG7A 1W3VA 1YFUA 3SH4A 3WF4A 3E97A 1JODA 4CXXA 2GMMA 4Z1VA 5FK7A 3CJIC 3Q8EA 1T6GC 5A1LA 2IXHA 4YGCA 1G9CA 1IKQA 4W8JA 4DMIA 1X50A 3TWIA 1AYN3 1L7RA 3VDAA 4GH4B 2RM22 1OLMA 1KXGA 1BBT3 2PAMA 4RQPC 5FP7A 4YZ2A 4QM9A 4MGSA 3H8OA 2JD9A 2RJ2A 1QJEA 1UY3A 3CU7A 4XC9A 1YQ8A 3MF9A 1C3HA 5K0UA 4BIFA 3FHQA 3WD5A 4CP9A 1LAJA 2DCZA 4K8FA 4UW6A 3W59A 2NMNA 3ZM8A 4HK8A 1YQCA 4QX2A 4YFZA 4E4ZA 1I5PA 2FQPA 4HMZA 3AP4A 3HJRA 5C9AA 5FXWA 5HV0A 2XKPA 2CV6A 5IAXA 2EIBA 1EPWA 1V6LA 1QJU2 5EJZB 3KCXA 1LHOA 5IVYA 5FO7B 1W2TA 5KXDA 4A41A 5IHRA 3RJ2X 1LOBA 5JLVA 3LFMA 3PVBB 5ABJA 3AMQA 2RMU1 4KNCA 5FK8A 2P4EA 2WKKA 4LBQB 2LRPA 3ZKYA 4D6RA 4Y1YA 1AL0G 2E6VA 3UJOA 5F6KA 3WF0A 3S30A 4WVWA 5LA0A 4FTEA 2D6OX 1S55A 4AQ2A 1HB3A 3VB9A 1QNYA 4ATEA 3HAGA 1NQDA 5DZGA 2RHPA 4E2SA 5DAQA 1HB1A 4EE2A 1DCSA 2OUJA 2ZGRA 3FUOA 4QKDA 5EFUA 4OUEA 4O61A 1RUI3 4HLTA 1R092 1RUH3 1MZEA 1ST8A 2FCTA 1SLIA 3CKHA 4B1MA 3BODA 4GB31 5LB6A 2GNMA 4JKKA 2VQAA 3VZMA 3OYWA 3UKVA 1HQNA 4QKFA 4AL9A 4KI5M 2P1BA 1AJKA 1F15A 3QBQA 1HDKA 1EPZA 4HN0A 1JXNA 4OLLA 1E5IA 3MZHA 2YMZA 4MHUA 1OC1A 2RR11 1ULGA 4J1WA 5BNPA 1NA1A 1ZBE1 3K4ZA 1QXRA 2ZHLA 1SQ4A 5C8CA 3SKVA 1LGNA 3HQUA 1ZX5A 2W5FA 1XJAA 2RJLA 3FLTA 3N7JA 3BYWA 4HETA 3VBHB 1JZ6A 3LQCA 5F5CA 3K3OA 1WMEA 1ZVFA 4R9BA 4RS5B 2BFUS 4Y3OA 5F7UA 2B4KA 1JZ8A 2ZA9A 4FAHA 1PGL1 3N9QA 3OEBA 4IE5A 4IUGA 4MGQA 4XF4A 4FPLA 4YW1A 3J4UH 2W3JA 4CXYA 3O1PA 1VRBA 1UMHA 2YXSA 2JKXA 2G1MA 1RITA 4WV8A 3DXUA 4TLFA 1HX6A 3S57A 1MACA 2R0HA 1PM7A 2QUOA 3WDVA 4JDNA 1AX1A 1UAIA 2Z5WA 3FX3A 1C4RA 1HRV2 1LOFC 3ZYFA 5EV7A 4YPJA 1V0AA 3I2FA 5JWPA 5EWSA 5FY1A 3ZSMA 2XJQA 5C3OA 4HVOA 5IFPA 1JU4A 1Y4WA 4XW3A 2DVDA 1H4HA 1DHKB 5KBFA 4AW7A 1JZ4A 2BGCA 1RXGA 1ZBE2 4IW3A 1XNDA 1W9SA 2TBVA 3ZR6A 4QXHA 4QGMA 1KD7A 4LITA 3C2UA 3G6JB 1W9FA 3WP6A 3B94A 3K46A 3JU9A 2X5IA 3TN91 1RMU2 3M1HA 5EIYB 5DZEA 4QPIA 2YC4A 1POV3 2VU9A 3POSA 5BNNA 1U5YA 2C24A 5DZFA 3VBFB 1CX1A 3C7OA 4XF9A 3PVNA 4L97A 1TME3 2PELA 5GLWA 3SC7X 3RDIA 5FKCA 3ILNA 4PT6A 2QQIA 2N7GA 1OBNA 3MHZA 4P5HA 4AEDC 1C8NA 5IYYA 4LKDA 4RFRB 3ILRA 3AYCA 2JDYA 2H6CA 2EXKA 3LIHA 1MEC3 1DYPA 2G4IA 5FY8A 1OUSA 4NIDA 4PQ9A 5LATA 3FN9A 1F35A 3ILFA 3OUJA 4ONUA 4YNIA 3RRDA 2JG9A 1BQPA 3OY8B 1RHI3 3NV2A 3OB8A 3EHKA 5HXVA 3SNMA 3KD4A 5FLHA 2X29A 3WG1A 3VKOA 1YJLA 5JPMB 4OMDA 4Y26A 2EAKA 3OTFA 1OSGA 3BGAA 3GHMA 2VZQA 3MO4A 4R9CA 3USUA 3JD73 1CN1A 4CRQA 3WW2A 2QE3A 5KXBA 4Q4X2 1LESA 1VBD3 4XUQA 3B7MA 3N9PA 2IXCA 2VR4A 4QQOA 4Z8BA 2P3JA 3BVCA 5IVFA 1L7QA 1LECA 4ES9A 3VBSC 1LHVA 1W39A 3ZFGB 3SITA 4KG8A 5FOJB 4NO4A 2CGPA 4BQ3A 4EN0A 1COV1 2VAUA 3DN7A 3THCA 3OUIA 4LO6B 2R32A 1KJRA 1NQJA 1W04A 2D5FA 2ZMKA 3L9JT 1BK0A 1RUJ3 1JZ2A 1LJ7A 4Q4V2 3ZSKA 4CP2A 5DDJ2 3K2OA 3PTRB 1GICA 1OI6A 2CDOA 2OIIA 3LKJA 5IVVA 4FPFA 4B4PA 4E9KA 3MGUA 1IPSA 5BNOB 1QH7A 4N43C 3OPZA 4QHOA 2MEV3 3UNPA 5E8AA 4Z2WA 1ZA7A 2W87A 5FZCA 2OPWA 2D3SA 2DV9A 3IM0A 2DTYA 2I45A 4CSWA 2ZJCA 1O4ZA 4L99A 2Q1FA 4RN5A 3KV6A 5EYXA 4GQ7A 4UW3A 3POYA 4IXLA 3THTA 1C8M3 1B35B 5F9TA 2JB4A 1AUYA 2VNRA 1QDCA 1ODMA 4ZXEA 4HSJA 4MOAA 2VY0A 2ZGLA 1HRI1 5FMBA 4AHWA 2YU2A 3APBA 3UK9A 2V5YA 3T0AA 1XBFA 4ORFA 3SCGA 1JOJA 1XE0A 3VZJA 4CEWB 2PAEA 1AX2A 4JX0A 1J3RA 4CZSA 2GNTA 1HB2A 1PK6C 2W0XA 2Y8KA 4PDWC 1H8TA 2BVVA 2JIJA 1W0OA 5JMCA 3NKGA 2XWBB 3KM5A 3QACA 2VG9A 3PIJA 3ZFEA 4LXLA 4A3XA 2NP0A 4GKYA 4PLMA 4UW5A 2FDGA 5GKAC 2R073 1KEXA 4YW5A 4ZU5A 5FP3A 5T3NA 3ZIXA 2JDAA 5FUNA 1OUXA 5C70A 4YM2A 3H50A 4AYUA 3F2ZA 2W95A 4QHBA 1IG3A 3WP4A 1MZ6A 5HPOA 1W9YA 4XFHA 1UYPA 4IERA 3OGVA 1A8DA 3KV5A 4MV2A 1GSLA 4IL7A 4M0NA 2RMU3 1XSQA 3T1LA 4A6SA 3EXUA 2XQXA 2XHNA 3DPRB 2WNEA 2Y6JA 3VBOC 1VBA1 4CDQC 3AMMA 5FP9A 1OFNA 1AR91 4YG0A 3VKNA 1H1IA 1HRI2 1GOFA 4URAA 4HVQA 3VD9A 1OD3A 2GN7A 3HOBA 5FZIA 2YC0A 1ULDA 5FV3A 4CP1A 4F7ZA 3C3VA 5E6HA 3LPGA 2B7YA 3ETQA 4AI2A 2Y33A 4CCEA 4Z92B 4GMP1 1J3PA 1MR5A 4NHMA 2BGPA 2YBSA 3AYAA 5FZLA 1W6OB 1JUIA 2DBIA 2VULA 4N7IA 3VBRC 1TNRA 2FMYA 2ZGNA 2JG8B 2VH9A 2ZHKA 3E5XA 2XVLA 4LTAA 3WQ0A 4OI1A 3U10A 1Q43A 4GB33 2O8OA 1ASJ2 3OD0A 3I2GA 4QKNA 5FPZA 4ZZ5A 1SPPA 1X8EA 4LBQD 4NR1A 4URTA 4RHV2 5JXJA 1DQ4A 2NN8A 2E63A 4IE7A 1UWWA 2J7MA 4RGKA 5F39A 4OVEA 3D6EA 3ACGA 1NCRC 4GMP0 2RR13 2VVFA 1ALYA 5LCWL 1UPSA 1RB8G 1ZBE3 2OA2A 4FPGA 3KT7A 3GYDA 4BXFA 2WO7A 1RTVA 4RYDA 4XPVA 4IQPA 3T0DA 1C5HA 1CIYA 1PO13 2ARCA 2P3IA 3B93A 1WBFA 3VDDC 4X6QB 3LEIA 3IMNA 3PL0A 4YVSB 1ND3B 1NKGA 4FPYA 5I0TA 1RUE2 3K4AA 5HBAA 3WOGA 4DQAA 3R4DB 1ENXA 3UESA 1ZRCA 1NUKA 4W6XA 4Q0QA 4HXCA 3WZ1A 2J42A 4Z2AA 1CVNA 1JYTA 1GNHA 2IZWA 2CTVA 2ZKNA 2RVAA 1QF3A 3FLPA 3L2HA 1H30A 4X8PA 4YW7A 4OYUA 2WYFA 1W2OA 5C4WB 2QBXA 3MIHA 1STMA 1UYXA 2NPIA 4EWEA 2DUOA 2JD4A 1A3KA 4N53C 1WA4A 3WLUA 4NWWA 1LB2A 3OUHA 5GM0A 4XURA 4NIAA 4XBNA 1JYIA 5A33B 2BOIA 3GF6A 2BZDA 2IVJA 1D2QA 5E1RA 1W9WA 5FYZA 2EIGA 4C8DA 3V0AA 3B01A 1O3SA 1Y3TA 5AVAA 4CUGA 1MQTA 2ADEA 5IK7A 1MS0A 3MF6A 4D0QA 5JOXA 5LBBA 4CCOA 4AAXA 3GZUC 1BEV2 4META 3VL9A 1O8SA 3AP9A 1HV0A 3CJIB 2HWB2 1AL22 5CEHA 1QY4A 2TNFA 3OY8A 1PO21 4WM8C 3T4VA 3I3MA 2WABA 3UGHA 2VMIA 4CUCA 4RQPB 3A0NA 3H7JA 1KDKA 3TN93 4AXOA 5JZGA 4RR3C 3PU3A 2JE8A 3ITQA 3SMHA 1DLCA 4LUKA 1JZ5A 5EJ1B 5A7SA 5JI7A 1O7FA 2O1QA 2RDNA 3VZKA 2BP6A 3WF2A 1UIKA 4QX7A 4I02A 1CX4A 2EICA 2ZGOA 4JQTA 5T55A 3ZFGA 1UMZA 4CU7A 5J7MA 1PMIA 1DYOA 2R16A 3MDPA 3POGA 3M3OA 4V2VA 5JI9A 4XDOA 1PGW1 2GALA 1D2SA 4OHVA 1RJ8A 3A4UA 1JYWA 4DOUA 3K77A 5F37A 3SISA 3WNKA 1QJY2 4CYDA 1VBB1 2VECA 4MXWB 2RS52 1CAXB 3V0BB 3IDBB 5FIXA 2D6PA 2R30A 2VE1A 4H55A 5BNOA 2BWCA 2Q8DA 2ZS6B 1LHNA 4LLFA 4AE2A 5JXHA 4P9IA 5FZ3A 1ZNPA 4IEUA 2GDFA 4PJYA 4QT6A 4ZZ8A 1EY2A 4QGNA 3OGJA 1XPWA 1GZWB 2VPVA 1BZWA 4KGGA 4FQ4A 4LKFA 4CCKA 2DU0A 4QB6A 5C71A 1OURA 3H8XA 3C7HA 4XJUA 5JSRA 1COV3 3U0ZA 4MLOA 1IKPA 4ISQA 2WN2A 3K75B 4J1XA 1MS4A 3KHBA 4CEWA 1Q8QA 2WFF1 4U2AA 3LF7A 5A3MA 3WXPA 1FPN1 3AX4A 4SBVA 2QZ2A 1ZZCA 3HQXA 3FFZA 4C90A 3ZN6B 1JYCA 4LBLA 2XB6C 1GNZA 3FBMA 4JGYB 3UJQA 3W9AA 2WC2A 1WMFA 4EV0A 4BK4A 3RS6A 3MW4A 1W0NA 2D5HA 3N9OA 3D8CA 2E32A 5JUVA 2WNUC 2ZBJA 5ANNA 3POFA 2FZ1A 2VUJA 1CAVA 5DG2A 2CSGA 5FPXA 2Q5TA 4HOOA 2HYKA 4B7KA 5GLZA 1N1TA 4XF3A 3KWVA 2BDRA 2YZ4A 1HRI3 1A78A 4S2DA 3VD5A 5KXEA 1VBE2 3RVHA 1LKNA 3KT1A 2V73A 1GQGA 3OPTA 4RGGA 1GYKA 2E33A 3S5AA 4P5YA 4ISRA 5B4NA 4LPLA 3POIA 2W1WA 4YW6A 4CDQA 3PUQA 3ES1A 1AYM2 2WUHA 2Z79A 3B69A 1DGRN 4JV4A 3RJRA 2WQZC 1CWPA 1X9TA 5J3UA 3DF0A 2Y64A 1GU3A 2BERA 4FSJA 2R0FA 1HQWA 4NIIA 3RZLA 2LROA 3QCWA 3WG2A 2WFF2 4DXRA 1W6OA 3MBWA 2VZRA 2IVIB 3MYXA 3H0OA 3GCXA 3JBG1 2JG8A 3AFGA 3AKSA 4YZ4A 5FDBA 1AXYA 4ET7A 2EIDA 3SEPA 1UYYA 3ACFA 5FZAA 3IB3A 5HCHA 2A6WA 2E7QA 2PHRA 2WINB 4ZU4A 1GOGA 2RS31 2VJXA 3WDTA 5HV4A 5CG9A 1LOCA 4Y20A 3O0WA 3X29B 4OZOA 1XYNA 1UU5A 1VBA3 2Z42A 2LW8A 4KG0A 4XJWA 5IW0A 3RNSA 4B1LA 2QQPA 3LA7A 2FDHA 2A7AA 4WZFA 1AR93 2P3YA 1PZ7A 3UV9A 1DDLA 2ENRA 4UFMA 4XXPA 2G19A 5A7OA 2EIEA 4R4ZA 4YVSA 2VO5A 5C3RA 2Q8EA 3WNMA 1RUF2 2EVXA 3KMHA 2W47A 4GMP3 1VJ2A 1GMMA 4IV3C 2OPKA 3HVDA 3RI9A 2CWSA 3GHNA 5D21A 5KHHA 5BXXA 1XNKA 4FPKA 5FZDA 4AEDB 1HW5A 4INDA 1TVGA 3SH5A 3HWJA 2WS91 2G9GA 4YG6A 1IZ3A 1ENQA 1UY4A 4BWOA 1RUNA 3KCCA 1JYXA 2WBKA 4R8HA 5GZFA 1O3QA 1NYWA 5C4WA 4AI9A 3ZN5A 3KZ4C 4PHZA 2VOXA 3O1OA 5C3SA 1SLTA 2GMEA 1QQP2 2XKOA 2ZGTA 3R4SA 4LUMA 2HWE1 1EUUA 4XBQA 3AP7A 1OMIA 3EJKA 2YC2A 3KVBA 2R041 3MICA 1V00A 3OCPA 5IJRA 4AEMA 5FZ0A 3A21A 1DQ0A 3FLRA 4JDMA 4CDWA 4Q8LA 2R061 3POEA 2VVDA 2QQNA 3VBSB 4JCKA 5LRRA 3PMEA 4TTGA 5DG1A 1G7YA 1W6NB 4QB2A 1LTEA 1DZQA 4MZUA 1ZYBA 4Y5Z0 2CHHA 1POV0 5CZKA 5FXVA 2BOJA 4XTMA 2VTXJ 1XC6A 2R1BA 3MV01 4Q29A 4RQPA 4AQTA 3ORJA 2J1TA 4QU1A 1S0BA 1G8WA 2UY9A 4IGPA 5HCFA 4D7SA 5CAZA 3ZR5A 2OUHA 2RE9A 5I0SA 1ULPA 2PHWA 1ZRFA 2RM21 1Z7S3 4N43B 3MPBA 2DVGA 2HKXA 4JGZB 2WQ8A 3LGRA 2WS92 3O1UA 4P08A 3NO8A 4LMFA 4NMIA 4YARA 3TEYA 2DWRA 2Q4SA 2ZGMA 1WWYA 3H8UA 3ZXDA 4LBNA 4DO0A 5F2WA 4NPMA 2XBO1 1VP6A 3N35A 5KC5A 1C28A 1YIFA 2XOMA 4WM7B 5DN2A 1N1SA 2QKDA 1WMXA 4MXWA 4QPWA 1CAXA 3V0BA 3ZYJB 2A6ZA 3AMNA 2ZHNA 5FYUA 1PO23 3GJAA 1UD1A 1W6QB 1WUVA 2R042 1PGSA 4LHNA 5D8AC 2Q8CA 1PIV2 4ZXKA 1JOPA 3RZJA 1S0IA 5CVRA 2R062 4GWIA 1PK6B 3ZXJA 4PDWB 1IPJA 2F6BA 1B09A 1GZWA 2IC1A 3HNBM 5IFTA 2Y26A 4UW4A 2ZX0A 2FZ2A 3U75A 4NHLA 2V5DA 2Q1MA 2E31A 4Y33A 4CDXA 3MIFA 1ZZ7A 2EXHA 4A3ZA 4Q5OA 2Q0AA 4GALA 1UPIA 4DS0A 2AREA 3ACIA 5A3PA 1E5HA 1OFSA 4J25A 4M3CE 1BJQA 2FDJA 4YW4A 3AZZA 5A1AA 4V2WA 2VOTA 4BMBA 2D6KA 2ZX2A 3ZKUA 4Y1ZA 1VBB3 2LTNA 1NCQC 3FE5A 1SLAA 2YY1A 1R091 2VXRA 4HANA 5CFCA 1SBFA 1YHFA 4JGYA 1LR5A 4Z07A 3VBUC 2OXBA 5JAXA 3C7FA 5CBLA 3BI3A 4XIOA 3WUCA 4CEYA 4YWAA 2XBO2 3PURA 3S6PA 4AQSA 2P2KA 3M8LA 1WCDJ 4Y1UA 3HQRA 4AVAA 2VCBA 1XB9A 2VCAA 4F3JA 2XG3A 1F31A 2ARXA 4AI0A 1J83A 1XNTA 4WZCA 2BJSA 4XMIA 5JOZA 1LOEA 3W21A 4YSFA 3VBRB 4QPGC 4JTNA 4CCDA 4HVRA 2QQOA 2TEPA 3AFKA 5A7WB 3AL6A 4YVWC 3SCFA 4B4RA 3OSDA 2C9KA 3TRSB 3WV6A 3BCWA 2JENA 4LHLA 1ZREA 2A6VA 1FPN3 3CBNA 1FNYA 3E1F1 5KR7A 2Y6LA 4AR2A 4RGAA 2ZMNA 2YBPA 1TNFA 3E5UA 4MGZE 4Q1PA 4EN8B 3NW4A 4IEOA 4XFCA 4Q4Y1 2F4LA 1R082 3S7EA 1TEIA 4XF0A 1LOFA 4KH9A 1NCRB 1W8FA 5A3OA 1A8MA 1W90A 1ZZBA 1VAKA 4XFAA 2AGSA 4QQHA 4COWA 2GC3A 3IT8A 4XABA 5J1XA 4BXSV 1NXD1 2V4AA 2C0ZA 1D4VB 2GC1A 4H14A 3S5QA 1HRV1 3LDRA 4R4XA 2J22A 3FL7A 1AVBA 3VDDB 3EO6A 1C1FA 4PI0A 2A71A 4WBBA 4XACA 1GWMA 1S0DA 2FDIA 3ATGA 2EF6A 1H6XA 2BQPA 4YZ1A 5FY9A 4JQRA 4ARXA 1R64A 2J1SA 4QX5A 4QU2A 3WW3A 5CU1A 1EV13 3W5NA 2D7FA 4R52A 3VZOA 4YZ5A 2DCYA 3NNFA 1PMHX 2X09A 1SMVA 2WO2A 5BY5A 1V6NA 2TUNA 2BBVA 1MS3A 1SDDB 2C5DA 2GU9A 4XAEA 4K40A 5F6LB 3O1MA 1ND2A 2YG0A 1R1A1 5DUWA 1RMU1 1V6MA 1GP5A 2VQUA 1Y9GA 5FMOS 3JBG3 3I2DA 3LE0A 1GNYA 1HXS1 4EYUA 1D7PM 5A3TA 4G3YC 1J3QA 4P9WA 5K0UC 1AR62 1OQEA 1RUG3 4D6QA 4Q4Y2 2VMGA 4FP3A 1UF2C 4HONA 2GN3A 4JKLA 5FPVA 2Y6HA 4FAGA 2KXLA 3TEXA 3CMGA 4AHXA 2RS33 5J96B 4C1XA 4LE3A 5C9AC 1TZOA 1PVC2 4A4AA 1HIXA 4MX3A 5FPLA 4JKMA 1OA3A 5FAXA 1JYNA 5FMCA 3HIFA 3DXTA 4OQ9A 3S7IA 2WZ8A 2HYXA 3A0KA 4KBZA 4RR3B 4AOCA 5A6QA 1WGPA 1W2NA 3DCQA 3NAPA 2UYBA 5ABJC 5IVBA 1RVF2 2A1XA 2BNOA 2ZZJA 3WEZA 1Q56A 5FWEA 3VBSA 4DXZA 3RQ0A 3UKNA 5FWJA 4M00A 3HBKA 4DEVA 1WLTA 3B00A 1QDOA 3WP5A 4Q4X1 2W39A 4W6YA 3MIBA 5EZWA 4XF1A 5C3PA 3AKPA 1NLRA 3CDZB 4OUMA 1SZBA 5I8SA 2OQ6A 1OKQA 2YPDA 4PQQA 2ZX1A 1WKYA 4BOWA 3I2OA 3P1IA 5A3UA 2X10A 3WCSA 1ZA4A 3HPNA 3GGLA 1R1A2 1HLCA 4CCJA 3BPSA 1H1AA 3KGZA 2OX0A 1F4HA 2XGXA 1O6UA 1V9U2 3EQEA 1GWKA 3KF5A 4L0PA 4UFHA 3RG0A 4JGZA 3VKFC 3ZVXA 1HXS2 1U5ZA 3J7HA 4E8DA 2YGMA 2HWE3 4FP2A 4QDQA 4Q4V1 3UYJA 1OVPA 4P9LA 4MGYE 5DDJ1 4DUXA 4V1PA 3N36A 1VBC2 3I4IA 3R0RA 4QB1A 2WRAA 1IS6A 1MS8A 4LNVA 1OOPC 1MS9A 2PA7A 2H0BA 4Q27A 3IPVB 3ZO0B 5KHIA 2VM9A 2R063 4TWTA 2DTWA 4WM7A 2WYSA 3OEAA 5A32A 1BXHA 5BNPC 1NA1C 2QQWA 2KM2A 5C8CC 1CPNA 4NJ4A 2B46X 3FC0A 2CY6A 2YV8A 5A80A 4PIXA 4LK6A 3V64A 2ETEA 4CTEA 1SEFA 2EXIA 4J6GA 1D4M2 1DBNA 2VZVA 4FPCA 5T5PA 1SBEA 2XJVA 1WLDA 4O9GA 1BLZA 2RM23 1LNSA 4QDRA 3NQHA 4LKSA 5FJKA 4MGTA 4BJ0A 1K5MB 5LBCA 4AGGA 4HKOA 3I3BA 1PMJX 2D97A 1G9DA 4LO7A 5EHDA 1LEDA 1UNBA 3LEGA 3I3EA 2WNUB 2G9ZA 3CJXA 2J1AA 3J8F1 4LEJA 2RS12 3I2JA 3AJZA 4DINB 2ZX3A 2XBO3 4GH4A 5J36A 3J9SA 5T50A 5FZ4A 1HQLA 1RIRA 3AXDA 3LB9A 2D6MA 5T5OA 5DUVA 1FMD2 1W9TA 3WNPA 3DYOA 5T54A 1AR71 4I0WB 4AHYA 2ZMLA 4NHKA 1RUD2 1OXCA 1QJU3 4PLOA 1QEXA 3SEEA 2AUYA 3T4HB 3ZSEA 5C3QA 2PMWB 5DPNA 3INAA 4FVVA 5A6ZA 3TBDA 5JXGA 3CZJA 3M70A 2W1UA 3MFAA 1CAUB 1VAVA 1JMUB 3WSOA 2VUCA 5E89A 1LCLA 4UFKA 2D93A 2PHLA 1FV2A 5BUVA 5KWRA 1FNZA 4KL1A 4X6RB 4UFLA 3T2QA 5D2AA 3AVRA 4N90A 1XYPA 4QPIC 4QQPA 5A7WA 5BNNC 4XUNA 4LBQA 1O91A 3ZYPA 1FOD2 1YC61 3OPWA 5A3WA 3UGGA 4Y4RA 5A6YA 1W3XA 3BOWA 4KWUA 1CJPA 3WNNA 1O5LA 1BMV2 3POWA 1R093 1H2LA 1CONA 3U07A 1XYOA 4P02B 1QNWA 2XLAA 1CJDA 2YUEA 2EXJA 4ITCA 4PBPA 3J8F2 1ASJ1 2XDVA 4HFSA 1NCRA 5FPBA 4COZA 5GLVA 4OFGA 1U0AA 1X7NA 1ZM1A 2SBAA 3AVSA 3DEMA 4RHV1 4AWDA 4E4DX 3SCHA 5L7OC 4JC1A 5I0RA 4XHXA 2ZEZA 4BPZA 3HEIA 3NV4A 1ZRDA 2JG9C 5DUUA 1DIWA 4Q4W1 1AR72 4QX0A 2R1DA 5FBJA 5FZKA 3T30A 5C33A 4UWDA 3IMMA 3H3LA 4CCNA 1OLRA 4A7KA 4IV3B 4LIUA 1GP4A 3HD8B 1Q8SA 2BEOA 4XAAA 3ZPYA 3H3ZA 3GALA 3NNLA 5L19A 3ZYGA 4FCAA 5I93A 4ZS2A 3SLIA 3LPFA 2Y34A 4KU8A 4K8RB 1OPMA 4XFIA 1REFA 1OLME 1IHMA 1RUE1 2MPFA 2JE9A 3OBAA 4M4RA 1FATA 1O4YA 4JTOA 3VD3A 3ENRA 1MPXA 1SACA 3GJBA 5CB7A 3CO2A 2G9FA 2GZWA 1UY0A 5FYSA 1EAH1 3IBMA 4XE9A 4YW2A 2RJKA 1UZYA 3VBHA 4FPHA 4M01A 2JXAA 2JDMA 5APAA 4RS5A 3WDXA 4DPNA 1WW4A 3LSDA 4QX1A 1GP6A 4QQ2A 3LCPA 4YG3A 5FBZA 4LOTA 5FFOC 3U4SA 4O7XA 4CE8A 4XHBA 3AKTA 2AC1A 2WZR2 4BZ4A 1HRV3 1NX9A 3H1MA 1Z0HA 1PNFA 3N9LA 1YRZA 2Z2SB 4FQZA 4XZPA 5K4LA 4CUAA 2WFPA 2IWGB 4EWAA 5ACA2 4B7EA 1ZZ6A 5BPXA 5L9VA 5CA6A 2BRTA 2BPA2 2P3KA 5C8WA 3AZYA 4S2HA 5A32B 3WR0A 4GJZA 4DB5A 1BEV1 4Q4W2 3GBWA 3JXSA 5IATA 4JHZA 3TEZA 2HWB1 1AL21 1GFF2 3A22A 3K48A 2FBEA 4DRRA 3WCRA 1DQ1A 1JS9A 4K7JA 2ZGPA 4UBHA 4OHZA 4NPLA 4YGBA 4Q1RA 1QOOA 3MPPG 2XQRA 1R1A3 5GZDA 5A7NA 1HV1A 1RMU3 2ZABA 5DXDA 5BYNA 2WR9A 4E2GA 3ZN4A 1H8TC 1M4WA 4CDUB 1IS4A 2XJPA 3HT2A 4LBJA 1HXS3 1EAH2 5E16A 1CZVA 2P6HA 1GZCA 5EQUA 3I59B 1FAYA 2HWF1 5IT6A 1ENSA 1UO9A 2RDRA 2BTVC 4GULA 5FZGA 3ZFEC 2R6QA 1A34A 3M3EA 3MIGA 5HCBA 1CQ9A 1GQPA 1SFPA 4QMAA 4IEYA 4RA0A 3VV1A 5JDBA 1KS5A 3T3YA 1DGLA 3CQOA 1JI6A 4ZKTB 4AI3A 3VBFA 1QJY1 5D8AB 3TNPB 4CXWA 2W9XA 4Q0PA 4XUTA 2RS51 3H1WA 4A44A 3N9MA 1HN0A 2Q1ZB 3U1XA 3TYJA 1IQAA 2JWPA 5I0DA 5FYVA 2PLV2 3CLPA 3BUCA 4JAAA 4BQ5A 1DU3D 3AXEA 5F32A 3T08A 2QQKA 3IDAA 3RZMA 3MI8A 2PAKA 2VMEA 2YFUA 4Q4X3 2B5HA 2ZGSA 3NKTA 2DCTA 1AJOA 1OT5A 3AYEA 3VD4A 2LS6A 1VALA 4EQVA 1H4GA 2ZEWA 3T1MA 5EXOA 4TZDA 4YW3A 1AXKA 1WD4A 2QJVA 2QQUA 1UN1A 3FBYA 2Q30A 4IETA 1RUOA 2XL9A 3BN6A 4XJAA 5KXCA 3ACLA 4BM8A 2XMLA 3PHMA 2WZEA 1TQ5A 1T6BX 3LA2A 4Y1VA 1K5MA 2VZOA 3DV8A 1DGWA 4UFIA 5FY4A 3VBUB 3O1SA 4TSVA 2JX9A 2EA7A 4C0BA 4Q4V3 4PLNA 5DDJ3 2HWF2 5FYYA 5FZ1A 1OD5A 3NNJA 5FYTA 5F2SA 3ZXFA 5CFDC 4Y22B 5CG8A 2VZ3A 2BVBA 2WNUA 3RMXA 1T2XA 3MW3A 2DFCA 3KV9A 1W8UA 4COYA 1W0PA 3TB0A 1LU2A 1QJZA 2RV9A 3KCYA 4FPOB 3WQ7A 1DYKA 3AKRA 1ENRA 1LHWA 3O1TA 1KITA 1RUC2 1VAMA 2QVSB 2XHKA 2A70A 4AHZA 2XLGA 3DKWA 4XXAA 1D0GA 3ZXLA 1WBLA 4JRLA 4QPGB 2CAVA 5J98B 1QMJA 3FFQA 1BHGA 1SLCA 1TMF2 4BB3A 2ILMA 3POBA 4H7MA 2D6NA 4NROA 3SQOA 4CA9A 5JOYA 2OVUA 1QXPA 4P14A 3THDA 1BCXA 5H9QA 2HWD2 2JEMA 2WA3A 1VBE1 3WG3A 1AX0A 3S0MA 3I97A 3LSEA 1LODA 2DCJA 3PUAA 4BDVB 2VD7A 1CAUA 1B35A 3IIIA 3JZVA 5FZOB 4I0BA 2XPJA 3KV4A 3B02A 1AYN1 4AVVA 3LA3A 2ET7A 1DFQA 1AR82 1LOGA 4PF1A 4E4HA 1AYM1 1KGYA 3MFCA 4UFJA 5GZCA 4WVMB 2P37A 3VHNA 3D3AA 4DFSA 5FOBB 4FFFA 1OH4A 1QGLA 3J8F3 2VZPA 4LOSA 4I3PA 4NHYA 5F5AA 3VZLA 2YB7A 4UF0B 1CGPA 3NJYA 4RSUA 2CL2A 1NAEA 4QWNA 3WY6A 2FCVA 1WCQA 4D7TA 1LOAA 1MQTC 4B29A 4COVA 2VXJA 4DXSA 2D3RA 2JDHA 1BVP1 2ERFA 3BU7A 1ULOA 5T5LA 1HN1A 3N3HA 1V6IA 4LK7A 5ERLA 5A6XA 4Q0UA 5TSWA 1U5IA 1BYHA 2WNVC 1UMIA 2J1EA 3NMBA 2BW8A 1S0FA 4NAMA 4ZPIA 5G04L 3U37A 1YCIA 4NHXA 1OH3A 4LO5B 3D0SA 2D6LX 2QFEA 3C7GA 3AKQA 3AYDA 4MXVA 3NJVA 3J7LA 4IV3A 4XDPA 3E6CC 5I8TA 2DVAA 5L73A 5J48A 2GNDA 5JZGC 2WWJA 4XFGA 4BE3A 2WIIB 1Y9MA 4K6BA 4QKBA 2VW0A 1CIWA 1RUF1 2QQMA 3DPRA 2CNAA 4OMCA 2YHJA 2ZGUA 4XUOA 2X53S 1WW6A 4WVZA 4CP9B 5K0UB 1K12A 4BQWA 1NY72 1AYN2 5K9YA 3EB7A 4GWMA 4BMEA 2VW1A 1OLQA 2XXZA 2MNGA 2JICA 3VDBA 1MS5A 1W6MB 2O8QA 1RUH1 5C9AB 1E5SA 1O5UA 1ASJ3 5LK5A 2A6YA 2Y6FA 3AMHA 3WNXA 4A42A 5KC6A 1X36A 2A6XA 4RHV3 5DAVA 2GP3A 5FJHA 1NLQA 3I3QA 1QJFA 2OYZA 1O59A 4M0HA 5LA9A 3MLJA 3RPQA 5JCTA 2B39A 1APNA 1REEA 1QQP1 3OBRA 4Q4W3 4DNYA 5LASA 5ABJB 4BQ1A 4KMQA 3LD8A 3OBZA 3T2OA 4MHRA 4HN1A 2AEYA 3AK0A 1PZ9A 2XUEA 2VCMA 3NNGA 2D3PA 4K9SA 5J09A 2ZXQA 2DUPA 3IWZA 5K8SA 4EN9B 3RZHA 2CWMA 5FKBA 1RUE3 2VZUA 1MS1A 2BFUL 3VN4A 4ZU7A 4IE4A 3P3NA 3KF3A 3OBTA 2W46A 4P9YA 3B9IA 4ZHNA 2P34A 3AP5A 4YYOA 5FUPA 3ECQA 4TYSA 3MIEA 4CEWC 1ND3A 4XUPA 1ACCA 4RD7A 2XR4A 3H3UA 4BISA 3GBFA 3OYWB 4W6WA 1CD3G 2XLFA 4CDUA 4BK5A 3NJZA 3RZGA 4KQ7A 1LEMA 3GXUA 1RUI2 1OOPB 1RUH2 3I59A 4DEQA 1E5RA 1N3QA 1GUIA 2OZJA 4ARYA 1UOBA 1FT9A 3BTZA 5BNPB 2VQ0A 1CAWB 3BU0A 3TEWA 5C8CB 3HR9A 3UGFA 2MHFA 4XZUG 5FYCA 3E6DA 5A7QA 2WSVA 1JW6A 4L92A 4OI4A 5CNAA 5CISA 4ASKA 4NIGA 1BEV3 2XJSA 2OKXA 2W1QA 1S1AA 5B2GB 5JOWA 2HWB3 5A33A 1AL23 3PLQA 5IK4A 2KR2A 1DG6A 2VZSA 3NSTA 4ZONA 4CVUA 4FFIA 2Y60A 2RDSA 1PIV1 1CR7A 1YYNA 1YUDA 1WA6X 4I0AA 2ZOEB 2XH6A 4D7YA 2WJSA 4AFAA 2UU8A 3CJIA 3AZWA 1Q8OA 5GZGA 4CCMA 5F3CA 4FTSA 1N1VA 3BIEA 1GLHA 2NZ9A 3PIGA 3WT3A 5FQ0B 4ZS3A 4D6SA 3WHTA 1JH5A 1G6NA 1G86A 2UYAA 4EN6B 1H2MA 1W8ZA 1ZZ9A 2ZPXA 3GBGA 2HWF3 1S0CA 4OI0A 3BTXA 2OZ6A 1F5JA 2A5ZA 5EYYA 3K51A 1WZXA 4KBBA 4UI9L 4IGOA 4CP0A 1MZ5A 3VHRA 1YIPA 3I3DA 1JHNA 2K0GA 4IE0A 1SCRA 3AZXA 3J7MA 2WL1A 4KWJA 1NZCA 1QJY3 4AAPA 3UL2A 4XMAA 2ZTNA 3OD4A 5JR7B 3I49A 2RS53 4CU9A 4LBMA 3M3CA 3DYPA 4CPBA 4LKEA 3RMYA 1YEWA 5T52A 2VMDA 1KQRA 2VMFA 2Y6KA 4QQLA 3LWCA 4E2QA 2BGOA 2D40A 4BLJA 4I3GA 4LBKA 4XJ8A 3KSCA 3GM8A 2CU5A 2JKBA 2FDKA 1OHFA 1PHMA 3JD71 2JE7A 1KS4A 4BQ4A 1PZ8A 4X8NA 2D98A 2VBDA 1SHWB 4QPGA 2C6SA 1ODNA 2WA4A 3ZYBA 5FY5A 4QPIB 2IFWA 5AC91 4IE6A 3MLLA 5DQ0A 2QZ3A 3LDBA 4YVSC 1D0HA 4O65A 5LY1A 2ZCWA 1NOVA 1UCXA 1AHSA 1N1YA 4Y1XA 5FZOA 4FOQA 2K46A 2WN3A 3QLQA 2VNOA 1W05A 3LDKA 4PIZA 4WVMA 1AXZA 1TME2 2BU9A 3CNAA 5L7OB 3RFRA 4IEWA 5C4WC 5FR3A 3IIAA 4BCUA 3W58A 1R081 5ANQA 2F4PA 4UT5A 4XYXA 3AL5A 4UF0A 2AYHA 1C57A 1S0EA 4FI9A 1UU4A 1PX3A 2GH8A 1MEC2 1V70A 4HT1T 5FXZA 3USUB 3QH7A 3ZN6A 2R49A 3ETPA 4OULA 1JN2P 4XJZA 5DAWA 3ZFFC 3MUY1 1DQ6A 1C8M1 4CDWC 1RHI2 4YZ3A 4CCCA 3K3NA 4XEZA 2W52A 2YPJA 4GZ9A 2FHRA 3VBOB 4YLZA 4CDQB 2W1SA 4E27A 3M7AA 1VMHA 1PX4A 3E5QA 1VBE3 4FTBA 3JD72 3ROUA 4IESA 4CPBD 4L2NA 2QDNA 1VBD2 3O0VA 1O3RA 2B9UA 5AC92 1EP0A 1H1MA 3LOBA 1AYM3 5EPAA 5JXIA 4G9SB 1OA2A 4LA2A 3POJA 4MUVA 2W08A 3UT0A 2O0OA 4XQWA 2DU1A 5KHJA 2YU1A 1XNBA 4MGIE 1SBDA 1WD3A 2A3WA 2WFF3 3OGGA 2GC0A 2I2SA 4NAOA 4QX3A 5B4XA 3WW1A 2DFBA 1C1LA 2Y38A 1RUJ2 4AZZA 3AC0A 2WO3A 1W6MA 2R071 3FHAA 4LLOA 1AR61 3J26N 4IEZA 1FXZA 5F5IA 3BKZA 2VQTA 3O7OA 4XFFA 2WLQA 3PUSA 2WZPP 1QOSA 3M3IA 4Q0SA 2FDFA 2MEV2 5F1RA 5FYMA 1UY1A 3O0XA 1WCKA 3NJXA 3P6BA 4K21A 1IOAA 1I9RA 4LE4A 4QPYA 4BYYA 5DUXA 5I8YA 1PVC1 4JDOA 1DZRA 2WSUA 1H9WA 2WLPA 2XJUA 3HNMA 5GALA 5FLJA 3ZXEA 1C8M2 5FUIA 1W8HA 4H2AA 1E57A 4DY3A 4EROA 5LEJA 3F95A 2PYTA 3ACHA 1W03A 2W94A 3FUQA 1VPHA 4IV1C 4Q26A 1RVF1 3AMPA 1H8TB 1RUF3 5I91A 4H3WA 1X82A 2UWAA 1NZIA 1JU3A 1MVEA 2BYVE 2WWSA 2Z69A 5DAPA 3ZFEB 1SFNA 2Z4FA 4FXGB 3UETA 2CAUA 5FZ6A 3T2TA 2QTWB 4CDXC 2DYCA 4D94A 3O1VA 3KHCA 5FP8A 3JUUA 4TN7A 1OF3A 4XOGA 2DCKA 3OF1A 5FLIA 1DQ2A 1S0GA 3ZYRA 1FYUA 4N53B 4XIKA 5F3GA 2VCCA 4FOYA 3TAYA 2I74A 1ONAA 2XVKA 1OKOA 3G7DA 4GIQA 1JUHA 4IEVA 1V9U1 4AEDA 3N4MA 1QH6A 4LORA 2QCSB 4BQ2A 4JGYC 5CFCC 1OOPA 2R072 1QQP3 3EBRA 1Z78A 3URFA 1XE8A 4ZY9A 4CEYC 1VBC1 1CAWA 2VNGA 1NXMA 2V09A 1QWRA 1Y9QA 1NLSA 4WM8B 4NPRA 1IS3A 3EYPA 4BA6A 1VB4A 4GWJA 1PO11 4JZRA 1ULFA 3I2IA 2RMU2 1GV9A 3ZIWA 2VOVA 3VHPA 1K45A 1J84A 1EUTA 4OHXA 3WDWA 3CF6E 2GC2A 4ASMB 1PVXA 3HN1A 3N7KA 4IEQA 4XFBA 2J1RA 5LRSA 2D44A 4S2FA 3ZMOA 1D4M1 3W20A 1WW5A 1UOFA 4HKLA 2QDRA 3BTAA 1W6NA 1DGRA 5GZEA 1SPPB 5CFDB 5FQ0A 2UY8A 3B3QE 4M4PA 2JDUA 4I30A 4AFMA 4AF9A 4D8MA 2WS93 1QU0A 3TOJA 1PM4A 3I54A 4LR4A 5JIUA 1KJLA 4GB32 4NWVA 5G05L 4N9HA 1HJGA 3UKTA 3M3QA 4W50A 2RS11 1H0BA 2SLIA 1J1TA 2HEYF 2JJ6A 4N43A 3ST7A 4C91A 4Q2FA 3PUHA 4AI8A 4GD4A 1UX7A 1VMFA 4N8MA 3JB8A 4SLIA 3PVOA 3Q8AA 1UXXX 4L11A 4ATFA 1YFWA 1FMD1 2RR12 1K3IA 3H7YA 3TNQA 1ZBA1 5FY7A 4IEXA 4XCAA 5JMOA 2R043 1RUD1 3RZKA 1PIV3 1UU6A 4XTPA 2HWC1 5L9BA 3WDYA 3ZSLA 1PO12 3P5BA 1RJ7A 3U11A 1W28A 3OGSA 1ZZ8A 2UURA 4YM1A 1W6QA 2VZ1A 1W06A 3V65A 1PGL2 1A6CA 3BB6A 3CEWA 1ND2C 4LO4B 3MLKA 3ZXKA 4UOJA 1PK6A 4PDWA 3NV3A 4FOWA 2CGNA 2IXJA 4QXBA 5M0TA 3CZUA 3I8TA 1QIQA 2ZKLA 1DGWX 2YGLA 2Y0IA 3FJSA 1FOD1 1OQDA 3ZDSA 3V0AB 3ME2A 4CU6A 3KQ4B 1IG0A 2DVBA 1MQTB 3AM2A 4M3CB 3VKMA 1GANA 2WQ4A 3A7QA 2HBTA 3ZYHA 2IXKA 1BMV1 3WQ1A 5L7OA 4OZXA 2PHFA 2IXIA 1G9AA 2WNVB 2WT1A 4HZFA 4LJHA 5FMDA 2XWJB 2VOKA 1RGSA 1JZ3A 1VE0A 2JB8A 2ORXA 2VBPA 1DP0A 1JTZX 1R1ZA 2JDZA 2KD7A 4JRAA 3WW4A 4GAZA 5FXXA 3CIHA 5CKNA 1IPKA 1UOJA 5IK8A 2EAAA 1YFYA 3MEPA 5JZGB 1ZBA2 2RG4A 2VUDA 2PXJA 2BBAA 2XUMA 2ZEYA 3NAPC 4I01A 2UWBA 5AC93 4YGDA 2VL4A 5CADA 5LK7B 3C8XA 4L8QA 2LUWA 5JR2A 3VBOA 3I2HA 1NE4A 1RINA 2HWC2 2YROA 2ZGKA 3Q9OA 1F2NA 3KQRA 5T5JA 3VL8A 2H6BA 4XDQA 2VTFA 1UIJA 2ID4A 2I07B 3TN92 2WT2A 3T2PA 1V6OA 1VIWB 1QHDA 5JPNB 2VGDA 3PTYA 1QJX1 4TLGA 1NE6A 1US2A 2AZ5A 3LEMA 4K3UA 3USSA 4O9EA 2X5IC 3VBRA 1HB4A 1O3TA 4DUVA 4FBFA 4AG4A 1Q8PA 3L2YA 1R083 4UAPA 5JIAA 5FYIA 3M4FA 4JGZC 3RYKA 1JBCA 1QKQA 1X9PA 2CDPA 3VD7A 2ATFA 5JSPA 4NRMA 1W6PB 1UKRA 2WZR1 2B9VA 4P9JA 1BKZA 3FHIB 1X8MA 2VNVA 2ZEXA 4IDZA 4CCLA 4FO9A 4FXKB 1POQA 4WM7C 1LGBA 3RYRA 5FO8B 4I2OA 3PNAA 1WLCA 4AFCA 1S4CA 2HJIA 1WMDA 3JCIA 4ASLA 5A1FA 3BTYA 1I3HA 1XSRA 1XOYA 3PJQA 3LAGA 5IVCA 4N9IA 4Z82A 3D0JA 1CZTA 3VDDA 4DXTA 1LGCA 3ASIA 1JZ7A 2K2SA 5IVJA 1XU1A 2BUKA 2JIGA 4FPEA
chains in the Genus database with same CATH topology
5H9RA 2PHXA 3VUOA 2DURA 1AZDA 2VVEA 2ZACA 3AP6A 4COUA 1COV2 5A3LA 1QJX2 4ES8A 4AGRA 1O4TA 3PMSA 3BOPA 1AR63 2NLRA 4HPKB 4N53A 4Q4Y3 5K7PA 1CAVB 4GH4C 4Q0VA 3B5LB 1URXA 1LU1A 1Y43B 4AVBA 1Q3EA 1PVC3 3BPZA 5BNQA 4MYEA 1KRIA 2PQQA 1N3OA 4A7YA 4BLIA 4B3NA 5H9SA 2EALA 2PLV1 1YWKA 3PVEA 1RVF3 4WM8A 1SCSA 2XJRA 2XJTA 1GQHA 4B8EA 5L36A 1Y7BA 1QXJA 2C9AA 4C1WA 1GKBA 5FTTC 4OHWA 3WX5A 4RR3A 5CIRA 2DVFA 1U12A 5GLTA 2ES3A 3AZVA 4W65A 4RL7A 2GH2A 3M2MA 1VR3A 4GA9A 5CFDA 1UX6A 1M06G 4L9BA 4QM8A 3MIDA 1ULCA 3WVJA 1V9U3 2YDEA 1VRH1 1S2KA 3BALA 3E6BA 1TE1B 2VOWA 4Y20B 5J37A 2Y0OA 1VBC3 2PFWA 2ZX4A 4GKXA 3QH6A 4CP2A 4AVSA 1DQ5A 1DZTA 4GWNA 2A73B 4Y4YA 1YO8A 3JQWA 1YFXA 4KGQA 2LM3A 2IFRA 3R4UA 1XU2A 5FO9B 1RUC1 3GZAA 4MH0E 3SXWA 5KHGA 1XXNA 4HK9A 1L3JA 4OHYA 3ELNA 1VBA2 4HL0A 1PNGA 1TMF1 4KU7A 1AR92 5FREA 3ZMNA 1UKGA 3IPVA 4AK3A 1FV3A 3PJYA 1RL3A 4C0HA 4FOVA 2VW2A 1D4M3 5D1IA 2HWD1 1H2KA 1YXWA 3N7LA 2HEWF 3R05A 3DUIA 5BV6A 1REDA 3IDEA 4EN7B 1Z7S1 3VBHC 1AR81 1F5FA 4G4FA 2E7TA 2P17A 4RS5C 3ZYIB 1NCQB 2ZHMA 3H9AA 4QD2A 3ZX7A 4DY5A 1MZFA 2RS13 2DUQA 3SHRA 3V56A 4M3CA 4WVVA 3ZFFB 1VRH2 2XL7A 1H2NA 4CDWB 1UZZA 2Q8OA 5F5QA 4BIOA 3VKLA 1U5XA 5KHKA 1FMD3 3KS7A 2ZGQA 1ZBA3 2WNVA 3KGLA 3FMGA 1RUD3 3D82A 5AFBA 3O5SA 3QD6A 2HWC3 4DZGA 2QNKA 4YM3A 4D3WA 1H9PA 4LO8A 4LA3A 1FX5A 2D43A 2CYFA 4XILA 4YVWB 3WDUA 4PIYA 1ULEA 4AGVA 3BIWE 4QGLA 1YI9A 1YLLA 2PHTA 4BH9A 2PHDA 2E9QA 1VLNA 5SV8A 4AFDA 4KWKA 4P9XA 1HKDA 1FOD3 4U36A 5HI0A 1RC6A 3D4KA 1NY71 3H1YA 4XQ4A 3VHOA 3ZXGA 1Z7S2 1BBT1 3RZZA 3RI8A 4B4QA 1QOTA 4AI1A 5I0UA 2AENA 2H0VA 3VBFC 3RWNA 4F8AA 1Q5OA 2PHUA 4LULA 1LENA 2E53A 1YNAA 3N7MA 4XETA 3WINE 1W6PA 4YGEA 3LOIA 4IV1B 1AR73 4LBOA 4XJ9A 2UWCA 1PO22 5GJ6A 1S0JA 2JECA 1OPOA 2CGOA 2DF7A 3KLSA 4CDXB 2YYOA 4MSVA 1AF9A 2B8MA 3MW2A 1QJX3 2NMOA 2WT0A 2K9ZA 1SDWA 3U4XA 1LRHA 1MVQA 3RYPA 1WW7A 1XE7A 1S2BA 3WG4A 5CFCB 1PGW2 5AVPA 2LALA 3IKWA 1K5MC 4CEYB 3QOPA 3ZFGC 3NWKA 1DF0A 1VB2A 3HBZA 1J59A 1BBT2 1VBB2 1GZ9A 1RUI1 2WZR3 1IS5A 4HPKA 1ZRRA 2GMPA 5JSOA 1BK1A 1XRUA 2C1FA 3IDCB 5ACA3 1LULA 3WHUA 1XNCA 1C5IA 2ZZQA 1GBGA 5BNOC 1F9KA 2GAUA 1EV11 5AFEA 1YI7A 3HMYA 3JB4C 4NN0A 3WP3A 4AEKA 2PTMA 4LT5A 2PN5A 2NQYA 2GSYA 3AB0A 5A32A 2B45X 4UBGA 4RFT0 4HKWA 3R6SA 4E4SA 3GZTB 1B35C 2NM1A 4FPJA 4EWDA 5HCAA 2FMDA 3CL1A 4AQ6A 3FWEA 1V6JA 4PBOA 5FMOL 1X33A 1WCSA 1FPN2 1EAH3 1H8VA 4JVAA 3B9CA 4BHPA 3D5OA 3ES4A 4MVTA 1RUG1 4I09A 1G9FA 4AVTA 2VUAA 3GNEA 1F8VA 1LHUA 3RSJA 4M3CF 3FZ3A 3VGIA 1G9BA 5EJ3A 4P9GA 3VZNA 4OI2A 1SLLA 4D69A 3VLBB 4YFWA 1NA1B 2PLV3 4IEPA 2IXLA 3P3PA 4PF5A 4KWLA 1V6KA 3NV1A 5D8AA 1OA4A 2HEVF 2B42B 2NYYA 1Q8VA 2BNMA 2XVGA 1ND2B 3JQXA 1EV12 3LZZA 4GXLA 2VMHA 4QXKA 1I5ZA 4LHKA 3THPA 1N47A 1YJKA 5FRAA 3DPRC 1KFXL 2OW4A 4Q8KA 4Y24A 3I7DA 1KDMA 4FT8A 3JBG2 4R9DA 1VRH3 1EYBA 1POV1 4F83A 1GR3A 5H9PA 1TME1 2E7AA 2GNBA 3NVCA 1RUG2 1SLBA 1NCQA 1W2UA 4A7ZA 4R9AA 5FCCA 4DRVA 4UXAA 4XBLA 2JG8C 2RS32 3VBUA 3NAPB 3ZFFA 3ZXAC 1RUC3 4PCRA 1J1LA 1KFUL 1MEC1 4N7UA 3HT1A 1N3PA 4Y22A 4S2GA 1I6XA 2E51A 4K1YA 1TMF3 4K20A 1RHI1 2ET1A 4H7LA 2ARBA 2AH2A 4YM0A 1CESA 1FI2A 1NG0A 4K1ZA 5E88A 2HWD3 4NOTA 3WUDA 4MGKE 4OUSA 1SFYA 2X5IB 1CPMA 2BNNA 5LEKA 3ALQA 2BWAA 1VBD1 5IK5A 5IUQA 3KB5A 2ZAAA 4YVWA 5BNNB 1AR83 1XQNA 4EJRA 1ND3C 3OJBA 1OQ1A 4XQDA 3SH3A 2AR6A 4CDUC 1UL9A 4YRDA 4AFBA 3AJYA 3O14A 4AVCA 3KT4A 2A3XA 2A75A 2KA3A 3ZSJA 1WLWA 1RUJ1 4HSLA 2HWE2 4A2UA 5C6CA 1BVVA 1J58A 3IN9A 1UW8A 5JVVA 4AEJA 2JG9B 1QJU1 1IGOA 2MEV1 5GLUA 1I1EA 3NL1A 3DL3A 2A3YA 3DGTA 3O12A 1DLLA 2X8KA 2W68A 4IV1A 5SV5A 2ZAHA 4HBNA 4NVPA 1YFUA 3SH4A 3E97A 2GMMA 4Z1VA 3CJIC 1T6GC 2IXHA 4YGCA 1G9CA 1IKQA 4DMIA 1X50A 3TWIA 1AYN3 4GH4B 2RM22 1KXGA 1BBT3 2PAMA 4RQPC 4YZ2A 4QM9A 3CU7A 3MF9A 1C3HA 5K0UA 4BIFA 3WD5A 2DCZA 4K8FA 4UW6A 3W59A 2NMNA 4HK8A 4YFZA 4E4ZA 4HMZA 2FQPA 3AP4A 5C9AA 2XKPA 2CV6A 1EPWA 1V6LA 1QJU2 3KCXA 1LHOA 5FO7B 5KXDA 3RJ2X 1LOBA 5JLVA 3PVBB 5ABJA 3AMQA 2RMU1 4KNCA 2WKKA 4LBQB 4Y1YA 1AL0G 2E6VA 3UJOA 5F6KA 3S30A 4WVWA 2D6OX 1S55A 4AQ2A 1QNYA 4ATEA 3HAGA 1NQDA 5DZGA 2RHPA 4E2SA 2OUJA 3FUOA 2ZGRA 5EFUA 1RUI3 4HLTA 1R092 1RUH3 1MZEA 1SLIA 3BODA 4GB31 2GNMA 2VQAA 3VZMA 3OYWA 3UKVA 1HQNA 3QBQA 1AJKA 1HDKA 1EPZA 4HN0A 1JXNA 4OLLA 3MZHA 2YMZA 2RR11 1ULGA 4J1WA 5BNPA 1NA1A 1ZBE1 1QXRA 2ZHLA 1SQ4A 5C8CA 1LGNA 1ZX5A 2RJLA 3FLTA 3N7JA 4HETA 3VBHB 1WMEA 1ZVFA 4R9BA 4RS5B 2BFUS 2ZA9A 4FAHA 1PGL1 4XF4A 4YW1A 4FPLA 3J4UH 2YXSA 1RITA 4WV8A 4TLFA 1HX6A 1MACA 2R0HA 1PM7A 2QUOA 3WDVA 4JDNA 1AX1A 1UAIA 2Z5WA 3FX3A 1C4RA 1HRV2 1LOFC 5EV7A 5JWPA 5EWSA 3ZSMA 2XJQA 4HVOA 4XW3A 2DVDA 1H4HA 1DHKB 5KBFA 4AW7A 2BGCA 1ZBE2 1XNDA 2TBVA 4QGMA 1KD7A 3C2UA 3G6JB 3WP6A 3B94A 3JU9A 2X5IA 3TN91 1RMU2 3M1HA 5DZEA 4QPIA 5BNNA 1POV3 2VU9A 3POSA 1U5YA 5DZFA 3VBFB 4XF9A 3PVNA 4L97A 1TME3 2PELA 5GLWA 3RDIA 3ILNA 2N7GA 4P5HA 4AEDC 1C8NA 3ILRA 3AYCA 2H6CA 2EXKA 1MEC3 1DYPA 2G4IA 4PQ9A 3ILFA 4YNIA 3RRDA 4ONUA 2JG9A 1BQPA 3OY8B 1RHI3 3NV2A 3EHKA 5HXVA 3SNMA 3KD4A 5FLHA 2X29A 3WG1A 3VKOA 1YJLA 5JPMB 4Y26A 2EAKA 3OTFA 1OSGA 3GHMA 4R9CA 3USUA 4CRQA 3JD73 1CN1A 3WW2A 2QE3A 5KXBA 4Q4X2 1LESA 1VBD3 3B7MA 2IXCA 4QQOA 4Z8BA 2P3JA 1LECA 4ES9A 3VBSC 1LHVA 1W39A 3ZFGB 3SITA 4KG8A 5FOJB 4NO4A 2CGPA 4EN0A 1COV1 3DN7A 4LO6B 2R32A 1KJRA 1NQJA 2D5FA 2ZMKA 3L9JT 1RUJ3 1LJ7A 4Q4V2 3ZSKA 5DDJ2 1GICA 1OI6A 2OIIA 3LKJA 4FPFA 4B4PA 4E9KA 3MGUA 5BNOB 1QH7A 4N43C 3OPZA 2MEV3 5E8AA 4Z2WA 2D3SA 2DV9A 3IM0A 2DTYA 2I45A 2ZJCA 1O4ZA 4L99A 5EYXA 4GQ7A 4UW3A 3POYA 4IXLA 3THTA 1C8M3 1B35B 5F9TA 1AUYA 2VNRA 1QDCA 4HSJA 2VY0A 2ZGLA 1HRI1 4AHWA 3APBA 3UK9A 2V5YA 4ORFA 3SCGA 1JOJA 3VZJA 4CEWB 2PAEA 1AX2A 1J3RA 4CZSA 2GNTA 1PK6C 2W0XA 4PDWC 1H8TA 2BVVA 1W0OA 5JMCA 3NKGA 2XWBB 3KM5A 3QACA 2VG9A 3ZFEA 2NP0A 4A3XA 4GKYA 4PLMA 4UW5A 5GKAC 2R073 4YW5A 4ZU5A 3ZIXA 5T3NA 4YM2A 3H50A 4AYUA 4QHBA 3WP4A 1MZ6A 4XFHA 4IERA 1A8DA 4MV2A 1GSLA 4IL7A 4M0NA 2RMU3 3T1LA 3EXUA 3DPRB 2WNEA 3VBOC 1VBA1 4CDQC 3AMMA 1OFNA 1AR91 4YG0A 3VKNA 1H1IA 1HRI2 2GN7A 2YC0A 1ULDA 4CP1A 4F7ZA 3C3VA 2B7YA 3ETQA 4AI2A 4Z92B 4GMP1 1J3PA 1MR5A 4NHMA 3AYAA 1W6OB 1JUIA 2VULA 4N7IA 3VBRC 1TNRA 2FMYA 2ZGNA 2JG8B 2VH9A 2ZHKA 3E5XA 2XVLA 4LTAA 3WQ0A 4OI1A 3U10A 1Q43A 4GB33 2O8OA 1ASJ2 3OD0A 5FPZA 1X8EA 4LBQD 4NR1A 4URTA 4RHV2 1DQ4A 2NN8A 2E63A 4OVEA 3D6EA 1NCRC 4GMP0 2RR13 2VVFA 1ALYA 1UPSA 1RB8G 1ZBE3 2OA2A 4FPGA 3KT7A 3GYDA 1RTVA 4XPVA 4IQPA 1C5HA 1PO13 3B93A 2P3IA 1WBFA 3VDDC 4X6QB 4YVSB 3IMNA 1ND3B 4FPYA 5I0TA 1RUE2 5HBAA 3WOGA 4DQAA 3R4DB 1ENXA 1ZRCA 4W6XA 4Q0QA 3WZ1A 1CVNA 1GNHA 2IZWA 2CTVA 2ZKNA 1QF3A 3FLPA 3L2HA 1H30A 4X8PA 5C4WB 3MIHA 2NPIA 4EWEA 2DUOA 2JD4A 1A3KA 4N53C 1WA4A 3WLUA 4NWWA 1LB2A 5GM0A 4XBNA 1JYIA 5A33B 3GF6A 5E1RA 1D2QA 2EIGA 3V0AA 3B01A 1O3SA 1Y3TA 5AVAA 1MQTA 5IK7A 1MS0A 3MF6A 5JOXA 3GZUC 1BEV2 4META 3VL9A 3AP9A 1HV0A 3CJIB 2HWB2 1AL22 1QY4A 2TNFA 3OY8A 1PO21 4WM8C 2VMIA 4RQPB 3A0NA 3H7JA 1KDKA 3TN93 4AXOA 5JZGA 4RR3C 3SMHA 4LUKA 5JI7A 1O7FA 2O1QA 3VZKA 1UIKA 4I02A 1CX4A 5T55A 2ZGOA 3ZFGA 1UMZA 5J7MA 1PMIA 2R16A 3MDPA 5JI9A 3M3OA 1PGW1 2GALA 1D2SA 4OHVA 1RJ8A 3A4UA 4DOUA 3SISA 1QJY2 4CYDA 1VBB1 2VECA 4MXWB 2RS52 1CAXB 3V0BB 3IDBB 2D6PA 2R30A 4H55A 5BNOA 2BWCA 2ZS6B 1LHNA 4LLFA 4AE2A 4P9IA 1ZNPA 4IEUA 2GDFA 4PJYA 4QT6A 1EY2A 4QGNA 3OGJA 1GZWB 2VPVA 1BZWA 4KGGA 4FQ4A 2DU0A 4XJUA 5JSRA 1COV3 3U0ZA 4MLOA 1IKPA 4ISQA 4J1XA 1MS4A 4CEWA 1Q8QA 2WFF1 4U2AA 5A3MA 3WXPA 1FPN1 3AX4A 4SBVA 2QZ2A 1ZZCA 3HQXA 3FFZA 4C90A 3ZN6B 1JYCA 4LBLA 2XB6C 1GNZA 3FBMA 4JGYB 3UJQA 3W9AA 2WC2A 1WMFA 4EV0A 3RS6A 3MW4A 2D5HA 3D8CA 2WNUC 2ZBJA 2FZ1A 2VUJA 1CAVA 5DG2A 5FPXA 2Q5TA 4B7KA 2HYKA 5GLZA 1N1TA 4XF3A 2YZ4A 1HRI3 1A78A 4S2DA 1VBE2 1LKNA 3KT1A 2V73A 1GQGA 4RGGA 1GYKA 4ISRA 3ES1A 1AYM2 2Z79A 3B69A 1DGRN 4JV4A 3RJRA 2WQZC 5J3UA 3DF0A 4FSJA 2R0FA 1HQWA 3QCWA 3WG2A 2WFF2 1W6OA 3MYXA 3H0OA 3JBG1 2JG8A 3AFGA 3AKSA 4YZ4A 5FDBA 1AXYA 2A6WA 2E7QA 2PHRA 2WINB 4ZU4A 2RS31 3WDTA 5CG9A 1LOCA 4Y20A 3O0WA 3X29B 1XYNA 1UU5A 1VBA3 2Z42A 4XJWA 4KG0A 3RNSA 2QQPA 3LA7A 2A7AA 4WZFA 1AR93 1DDLA 1PZ7A 3UV9A 2ENRA 4XXPA 4R4ZA 4YVSA 1RUF2 2EVXA 3KMHA 4GMP3 1VJ2A 4IV3C 2OPKA 3RI9A 2CWSA 3GHNA 5KHHA 5BXXA 1XNKA 4FPKA 4AEDB 1HW5A 4INDA 3SH5A 3HWJA 2WS91 2G9GA 4YG6A 1IZ3A 1ENQA 1RUNA 4BWOA 3KCCA 5GZFA 4R8HA 1O3QA 1NYWA 5C4WA 3ZN5A 3KZ4C 2VOXA 1SLTA 2GMEA 1QQP2 2XKOA 2ZGTA 3R4SA 4LUMA 2HWE1 4XBQA 3AP7A 1OMIA 3EJKA 3MICA 2R041 3OCPA 1V00A 4AEMA 1DQ0A 3FLRA 4JDMA 4CDWA 4Q8LA 2R061 2VVDA 3VBSB 4JCKA 5LRRA 3PMEA 5DG1A 1G7YA 1W6NB 1LTEA 1DZQA 4MZUA 1ZYBA 4Y5Z0 1POV0 4XTMA 2R1BA 4Q29A 4AQTA 4RQPA 1S0BA 1G8WA 2UY9A 5HCFA 4D7SA 5CAZA 2OUHA 2RE9A 5I0SA 2PHWA 1ZRFA 2RM21 1Z7S3 4N43B 3MPBA 2DVGA 2HKXA 4JGZB 3LGRA 2WS92 3NO8A 4YARA 2DWRA 2Q4SA 2ZGMA 3H8UA 3ZXDA 4LBNA 2XBO1 1VP6A 3N35A 5KC5A 1C28A 1YIFA 4WM7B 1N1SA 2QKDA 4MXWA 3V0BA 1CAXA 3ZYJB 2A6ZA 3AMNA 2ZHNA 1PO23 1UD1A 1W6QB 1WUVA 2R042 1PGSA 4LHNA 5D8AC 1PIV2 4ZXKA 1S0IA 5CVRA 2R062 1PK6B 3ZXJA 4PDWB 1IPJA 2F6BA 1B09A 1GZWA 2IC1A 2Y26A 4UW4A 2ZX0A 2FZ2A 4NHLA 4CDXA 2Q1MA 3MIFA 1ZZ7A 2EXHA 2Q0AA 4GALA 1UPIA 4DS0A 2AREA 1OFSA 4M3CE 1BJQA 4YW4A 3AZZA 4BMBA 2D6KA 2ZX2A 4Y1ZA 1VBB3 2LTNA 1NCQC 3FE5A 1SLAA 2YY1A 1R091 2VXRA 4HANA 5CFCA 1SBFA 1YHFA 4JGYA 1LR5A 4Z07A 3VBUC 5JAXA 5CBLA 4XIOA 3WUCA 4CEYA 2XBO2 3S6PA 4AQSA 2P2KA 3M8LA 1WCDJ 4Y1UA 4AVAA 4F3JA 2XG3A 1F31A 2ARXA 4AI0A 4WZCA 5JOZA 4XMIA 1LOEA 4YSFA 3VBRB 4QPGC 4JTNA 4HVRA 3AFKA 2TEPA 3SCFA 4B4RA 4YVWC 3TRSB 3WV6A 3BCWA 2JENA 4LHLA 1ZREA 2A6VA 1FPN3 1FNYA 4RGAA 2ZMNA 3E5UA 1TNFA 4MGZE 4Q1PA 4EN8B 3NW4A 4IEOA 4XFCA 4Q4Y1 1R082 3S7EA 1TEIA 4XF0A 1LOFA 4KH9A 1NCRB 1A8MA 1ZZBA 1VAKA 4XFAA 2AGSA 4QQHA 4COWA 2GC3A 3IT8A 1NXD1 2C0ZA 1D4VB 2GC1A 4H14A 1HRV1 4R4XA 1AVBA 3VDDB 3EO6A 1C1FA 2A71A 4WBBA 1S0DA 3ATGA 2EF6A 2BQPA 4YZ1A 4JQRA 3WW3A 4QX5A 4QU2A 5CU1A 1EV13 2D7FA 4R52A 3VZOA 4YZ5A 2DCYA 1SMVA 5BY5A 1V6NA 2TUNA 2BBVA 1MS3A 2C5DA 2GU9A 5F6LB 4K40A 1ND2A 1R1A1 5DUWA 1RMU1 1V6MA 5FMOS 3JBG3 3I2DA 1HXS1 5K0UC 4G3YC 1J3QA 4P9WA 1AR62 1OQEA 1RUG3 4Q4Y2 2VMGA 4FP3A 1UF2C 2GN3A 4FAGA 2KXLA 4AHXA 5J96B 2RS33 4C1XA 4LE3A 5C9AC 1PVC2 1HIXA 4MX3A 1OA3A 5FAXA 3HIFA 3S7IA 3A0KA 4RR3B 1WGPA 3NAPA 5ABJC 2UYBA 1RVF2 2BNOA 2ZZJA 1Q56A 3VBSA 4DXZA 3RQ0A 3UKNA 4M00A 1WLTA 3B00A 1QDOA 3WP5A 4Q4X1 2W39A 4W6YA 3MIBA 5EZWA 4XF1A 3AKPA 1NLRA 5I8SA 4OUMA 1OKQA 4BOWA 2ZX1A 3WCSA 1ZA4A 1R1A2 1HLCA 1H1AA 3KGZA 2XGXA 3EQEA 1V9U2 3VKFC 3ZVXA 3RG0A 4JGZA 1HXS2 1U5ZA