4AEDC

Crystal structure of human enterovirus 71
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
242
structure length
242
Chain Sequence
GFPTEPKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRDGPWQSTMLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDTSHILQTASIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Crystal Structure of Human Enterovirus 71.
pubmed doi rcsb
molecule tags Virus
total genus 40
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4aedC00
3JBG1 5JZGA 1AYM3 2RR12 2ZZQA 3ZFGB 5CFCA 1X36A 4QPGB 4N53A 4WM8C 4Q4V1 2GH8A 5L7OB 3NAPB 1PVC3 1TME2 5A32B 3HAGA 2RS53 1SMVA 2GSYA 4GMP1 3JD73 2R061 4NWVA 1M06G 1PVC2 1HRV3 1EV12 2RS52 1RUJ1 2RS11 3JD72 1QJX1 5D8AA 1HRV2 2IZWA 1FOD1 1HXS1 1POV3 5K0UB 4PDWA 2Y26A 4YVSB 4Q4Y3 2RR11 1RUF3 3CJIB 1RMU1 1C8M2 2MEV1 4Q4Y2 1K5MB 5JZGC 2HWB2 1ZBA1 5AC92 1H8TA 2HWD3 3VBOA 1TME1 5CFCC 5BNNA 2ZAHA 2HWE1 4QPIA 1VBD3 2BFUL 4Y5Z0 3FBMA 3VBSA 1BMV2 2HWD2 4RR3C 1EV11 2FZ2A 4CDXB 1RUE1 1MEC3 1VBD2 1NCQA 1HQNA 4RHV1 1FMD1 1R1A3 3VBFB 5BNOA 4N43B 1PO13 5D8AC 1MEC2 1AYN1 2WWSA 5C9AA 1PO12 4JGZA 2WLPA 4GMP0 2WZR2 1C8M1 2HWB1 1NY72 1VBA3 5AC91 2ZTNA 2DF7A 1AL23 3VBUB 2XBO3 4CDQB 2QQPA 4GB33 1VBA2 3ZFFA 3VBOC 3J8F1 4RQPA 5BNNC 3JBG3 2XBO2 4QPIC 4JGYA 4GB32 3VBRA 5J96B 4NWWA 5FOJB 1PIV1 1OOPB 4Q4V3 1RUI2 1ND3A 4IV1A 5C8CA 1RUG2 3S6PA 4GMP3 1CJDA 4Q4V2 4CEYA 5BNOC 1AR81 1RVF2 2R063 3ZFEB 4GH4A 2WZR1 1RUJ3 1NG0A 2RS13 1ND2C 3TN92 1QJX3 2RMU1 4CEWA 2R062 4JGZC 1FOD3 5C4WA 4RR3B 2RS12 1QJX2 1Z7S2 3DPRC 4AEDB 1FOD2 2RR13 5GKAC 1BEV1 4CDUA 1RMU3 1RUD2 3VBHA 1MQTC 2MEV3 1X33A 4IV3C 1RUI1 1ZBA3 1B35C 1RMU2 1QJU1 1RUG1 4WM7A 1TME3 2MEV2 1AL0G 2HWE3 1RVF1 5ABJC 5BNPA 1ND3C 1ZBA2 1VBE1 5C8CC 1EV13 1QJZA 3TN91 2HWE2 1RUE3 4YVWC 1EAH1 5FMOS 4CDWB 4GH4C 3M8LA 4RHV3 4SBVA 1FMD3 1W39A 1Z7S1 1RUE2 4CEWC 1AYN3 1A6CA 4RHV2 1FMD2 3VDDB 1NA1A 2R071 5C4WC 1AYN2 1RUD1 1NCRC 1ASJ3 1C8M3 1RUC3 2HWB3 4CDUC 5AC93 5CFDA 2X5IA 1ASJ2 3VBHC 1RUH2 1RUC2 1ND2B 4FTSA 1AR61 4WM7C 3J8F3 2WFF3 1D4M1 4N53C 1GFF2 3ZFGA 4QPGA 3IDEA 3DPRB 3J8F2 4RS5B 2WFF2 1PIV3 5L7OA 2BPA2 3NAPA 1PGL2 1PIV2 1PGW1 1AR83 1COV3 1MQTB 2HWC1 4IV3B 2WZR3 1B35B 1NA1C 5J98B 1AR82 2RMU3 4WM8B 1COV2 4PDWC 5ABJB 1ASJ1 4Z92B 5K0UA 1RUH1 1RUC1 2RMU2 2R043 1VB2A 1ZBE1 4YVSA 3JB8A 4YVWB 2X5IC 3CJIA 2R042 1BEV3 1H8TC 2WFF1 1K5MA 4FTEA 1RUI3 3ZFGC 1BEV2 3VBSC 4QPGC 1RB8G 1QJU3 1R082 1RUG3 5A33B 1PGL1 1NCRB 1OHFA 3NAPC 1RVF3 1VBE3 1QJU2 1NCQC 4CDXA 3TN93 5JZGB 1COV1 1EAH3 4FSJA 1TMF2 1VBE2 3ZXAC 5DDJ3 2RM23 3VBFA 4N43A 5CFCB 5C9AC 2BUKA 1AR92 1Z7S3 4N53B 1EAH2 3JB4C 5DDJ2 2RM22 5FMOL 5K0UC 2R073 2R041 4YVSC 1RUD3 3CJIC 2R072 4Q4X2 1NOVA 1F8VA 1VBC2 3ZFFC 1R081 5D8AB 4EJRA 2PLV1 3VBUA 2HWF2 4RQPC 4CDQA 4JGYC 3VBRC 1AR63 4Q4W1 4PDWB 1D4M3 1HRI3 5ACA2 1TMF1 4IV1C 1AR62 1OOPA 1D4M2 4CDXC 1HRI2 1BBT2 1V9U2 4CEYC 1AR91 1FPN2 5DDJ1 2RM21 3VBFC 1H8TB 3VBOB 1VRH1 3ZFEA 5BNNB 2HWC3 1RHI1 4QPIB 1OPOA 1VBB2 3VBSB 1CD3G 1PGW2 1AYM2 4Q4X1 1VBC1 2HWC2 2HWF1 4RR3A 1QQP1 1RUH3 1NCQB 1VB4A 5BNOB 1ZBE3 4AEDA 3VBUC 4CDQC 2XPJA 1R091 2RS31 5ACA1 4BCUA 5C9AB 1ZBE2 4JGZB 1IHMA 1HRI1 1AR71 1BBT1 1V9U1 1FPN1 5BNPC 1PO23 4RFT0 1OOPC 1QJY1 5A32A 1PO22 1F2NA 1VBB1 5LK7B 3ZFFB 4RQPB 1AYM1 3ZFEC 4CDWA 2FZ1A 1RUF2 4JGYB 3VBRB 1ND3B 1PVC1 4IV1B 3VDDA 5C8CB 4FTBA 2RS51 1HX6A 3JD71 4CEYB 5CFDC 4AEDC 1HRV1 4GH4B 1DDLA 1R083 4CEWB 2PLV3 1POV1 1R1A2 1ND2A 5C4WB 1C8NA 1PO21 2PLV2 2WS93 4Q4W3 4Q4Y1 5L7OC 1RUF1 1TMF3 3DPRA 4RS5A 2WS92 4Q4W2 4CDUB 3LOBA 2BFUS 4CDWC 1AR93 1E57A 3VBHB 1BMV1 2HWD1 4Y4YA 4WM7B 1AL22 1MQTA 1VRH3 4IV3A 1VBD1 1B35A 1RHI3 5BNPB 3VDDC 2TBVA 3JBG2 4WM8A 1VRH2 4Q4X3 5ABJA 1VBC3 1MEC1 1RHI2 2HWF3 1QQP3 2VQ0A 1R1A1 1PO11 4YVWA 1K5MC 1AUYA 1QQP2 1R093 4LLFA 2RS33 5ACA3 1NY71 1NA1B 2WS91 1V9U3 1WCDJ 1AR73 1BBT3 1HXS3 1R092 1RUJ2 1FPN3 2RS32 1VBA1 4RS5C 2BBVA 5A33A 1NCRA 1QJY3 5CFDB 1AL21 2X5IB 1AR72 1HXS2 1VAKA 2XBO1 4GB31 1POV0 1VBB3 4N43C 1QJY2
chains in the Genus database with same CATH superfamily
4TWTA 2VUJA 1KDKA 2WAAA 3O0WA 4HMZA 2AZ5A 2FCTA 1Q43A 3CU7A 4YZ4A 5CFCA 5E6HA 1Y3TA 2ZEYA 4M4RA 3UKTA 3N9NA 4W50A 2QZ2A 1IPKA 2YMZA 1CWPA 1JU3A 2PHUA 3MV01 1MS3A 4WVMB 1TME2 1DYKA 1Y43B 3HAGA 3IDAA 5H9SA 4DXSA 3SNMA 4Y22B 2D3SA 2XJVA 3JD73 5FY4A 5LA9A 2YGLA 3VKMA 4UW5A 3RZHA 1OC1A 1UYPA 4QGLA 3GZEA 2VPVA 5FZAA 5APAA 4NO4A 4OI1A 1YFXA 1EV12 3JQXA 2Y6KA 3MPBA 2AR6A 3HQXA 3S57A 1TEIA 2OQ7A 1N1VA 2DCYA 1AVBA 2CAVA 1CESA 3DF0A 4M3CE 3O5SA 4EWDA 2IZWA 2JD4A 3AMPA 1FOD1 4M3CA 4MADA 1HXS1 1S0BA 2C24A 4NIIA 1WWYA 1XOYA 2WZEA 1QOSA 2DVGA 3GXUA 5FYBA 5C3PA 4D69A 4BQ5A 1H9PA 4J25A 5DG1A 1SEFA 4AGVA 2Y26A 4L97A 1QGLA 1RTVA 1CVNA 1S55A 4V1PA 3ZXEA 4CVUA 1H1MA 2R7EB 2X8KA 1Y9MA 3N9OA 2MHFA 3WNXA 3W5NA 4EZHA 1S2EA 2EVXA 5F9TA 5A3LA 1C8M2 4Q4Y2 4Y1UA 5CIRA 5A6QA 1ZBA1 1WW7A 5A3OA 2V5DA 2NZ9A 5CFCC 5DXDA 3WQ1A 2VBPA 5JWPA 3M4FA 3Q8EA 4QPIA 4MGZE 5F2WA 4K21A 1H1IA 3C7GA 4RR3C 4M0HA 2DU1A 1XSQA 5FKBA 5C7GA 3KT4A 1O5UA 1IG0A 2D93A 4XMIA 2PHFA 3RNSA 1MEC3 2QQWA 2R0FA 4XC9A 3H8OA 5AVPA 4BWOA 2W5FA 2H6BA 4W4ZA 1R1A3 3I2IA 3WX5A 1J59A 1PO13 3ACHA 3OD0A 5FZLA 4CXYA 1C1LA 2K0GA 3FHAA 3NL1A 3OBZA 2F6BA 3LWCA 4COYA 5IWFA 4KL1A 1W6OA 5DAVA 2VTXJ 5FPBA 2QJVA 1LGBA 1JS9A 4QQOA 3FFQA 4D8MA 2NPIA 1CJPA 3QCWA 4A7KA 2D3PA 5JOZA 5AC91 4CCNA 2ZACA 3IM0A 2DCKA 2ZTNA 4XABA 1WBFA 1XNAA 3B3QE 4LJHA 4WV8A 3UGGA 4JHZA 4YW3A 2BRTA 2XBO3 4CDQB 4AFCA 5HXMA 3QOPA 3W59A 1CAWA 3ZFFA 3J8F1 3AXEA 2ZMKA 2WC2A 4CTEA 4QPIC 1IS5A 3KSCA 4NVPA 1ZA4A 1H30A 1OLQA 5FOJB 1BHGA 3I8TA 4ISQA 5FY0A 4CP9B 1VLNA 1C4RA 1IPSA 1ND3A 2CSGA 3K51A 1NQDA 4S2DA 4Q0QA 2XLGA 1US2A 1DCSA 1AJKA 4QPWA 1W6NB 2XL7A 3LFMA 3VD7A 3A21A 4Q4V2 4CEYA 5LZ6A 1AR81 1KDMA 1OD5A 2WT1A 4YG0A 4YZ2A 3ZFEB 3VGIA 3NV4A 4O65A 4TYSA 2CV6A 1GZ9A 2Q1FA 3EYPA 4XUNA 3WW1A 3BUCA 4EQVA 1MZFA 1RUJ3 4K7JA 1QNYA 3T2PA 5FP9A 1OMIA 1A8DA 2J22A 3FUOA 4D6SA 5EQUA 4CUGA 1GR3A 1UIKA 2X10A 4WZFA 2D6KA 1SPPB 3N7MA 1MVEA 3LEMA 3PURA 4RR3B 4QX3A 1QJX2 1Z7S2 3BOWA 3IPVB 3GBWA 5FWEA 5L36A 2JIJA 5L19A 1WW6A 3IT8A 1HN0A 2BGPA 3M7AA 2A7AA 3V0AB 1W0OA 2RR13 3LIGA 3UGFA 4AVCA 1HQLA 5LBEA 3N7JA 2VZUA 1G9BA 3PVNA 5ANQA 3LAGA 1J58A 4TTGA 5GLWA 5LBFA 2BNMA 1E5RA 1X33A 1RUI1 2O1QA 2QQOA 4HKWA 4BLIA 4Q0SA 3GDBA 4IEXA 2W87A 2GAUA 3BPZA 4XUQA 2ZXQA 5FY5A 1QJU1 1RUG1 4BH9A 4UW4A 4OZOA 1KFUL 4IE6A 3WG2A 3RSJA 1AL0G 2XONA 1GOFA 3HT2A 4XBQA 5BNPA 1ND3C 1ZRFA 4QXKA 4KGGA 2WN3A 4YVWC 1W9TA 1EAH1 5FMOS 5FIXA 5F6KA 4LO5B 4KU8A 4BXFA 1S2BA 3TEZA 3FUQA 2FDJA 2D6PA 4Z07A 4LO8A 3OJBA 3AM2A 4LBQD 1CAUA 4NROA 4EN8B 1LOGA 5SV8A 1A6CA 2BU9A 3LGRA 1FMD2 5LEKA 5FMCA 5T54A 5A7WB 4YGBA 3J7MA 2J1EA 1ZX5A 3C7OA 3N36A 2X53S 4QD2A 5FK8A 1ASJ3 3DECA 1Q8QA 1V6IA 3ZYPA 1EPWA 2XUMA 1W06A 4HETA 2HWB3 3ZDSA 4XTPA 5FOBB 5CFDA 2OUHA 4FCAA 2ARAA 2EF6A 4NN0A 2RJKA 2I45A 4CUAA 5KBFA 1O4ZA 3W9AA 4PIZA 3M3CA 5C71A 3APBA 3HWJA 2WFF3 1D4M1 3UETA 1OKQA 1GFF2 5FZIA 1GP5A 2VMHA 1PM7A 3PUHA 4RN5A 4LKDA 3ZFGA 4XHBA 3WNLA 5FYUA 4C1WA 4QPGA 2E7QA 5I0DA 4KMQA 2ZGUA 3O0VA 2Q1MA 2UWCA 2ZEZA 3KB5A 4O9GA 2WRAA 1KXGA 1PIV3 5FZGA 5L7OA 1W6MA 1LOEA 2B46X 1X9PA 1GNHA 1OH4A 5HCBA 1UYZA 2EICA 2GMEA 4CCKA 3GZTB 2VL4A 1MZEA 4AVVA 3K77A 4BQ2A 1PGL2 2HKXA 1MPXA 2CDPA 2VNOA 5A3MA 1COV3 3THCA 3B00A 5AVAA 4Q1RA 4C8DA 2WZR3 5IHRA 2BTVC 5FZOA 2ZGPA 4WM8B 1OFSA 1QY4A 2VOXA 4PDWC 4X8PA 5JOXA 2ORZA 5LA1A 3PMSA 1ASJ1 5EYXA 2NM1A 3OCPA 2CYFA 4D7SA 1HQWA 3HBZA 5FKCA 5LB6A 1YFUA 2WBKA 3AX4A 2RMU2 2R043 4DUWA 1VB2A 2GP3A 2OPWA 4YVWB 4AFBA 3AK0A 1G9DA 3URFA 2YDEA 2FDKA 1IOAA 5FZ4A 3RYKA 3LQCA 4RD7A 4XF3A 3T4HB 3I3QA 1AX1A 2WFF1 4FFFA 2VUDA 4NRMA 4P02B 3M70A 3ZFGC 1V00A 4DO0A 4XETA 1BEV2 3A22A 3VBSC 4QPGC 4A7ZA 1VR3A 1H2KA 4CPBD 3MLKA 3KLSA 4HSJA 3EJKA 5C5TA 4CCDA 2JB8A 1H9WA 3KHBA 4KQ7A 1RVF3 4F8AA 1ENRA 1VBE3 4OMDA 4CDXA 2PQQA 4Y3OA 2VVFA 4XZUG 4XJ8A 3AL5A 4YLZA 3T0BA 1VE0A 4Y1XA 3TN93 3ZN6A 1COV1 4HKOA 4ZKTB 5JZGB 2SBAA 2RM23 1NKGA 2VZPA 2ZX0A 4NPMA 2A6YA 4QHBA 1ULPA 3IAQA 3RI9A 4YARA 1DZQA 1XNBA 2DCZA 2HH9A 5FYSA 1CAVB 2GH2A 3JB4C 1HB2A 4IETA 2VXJA 3AVSA 4PCRA 4IE5A 3PVBB 2R041 3N35A 2XQRA 2AEZA 3ZKYA 3RRDA 4ES8A 4BE3A 3ZM8A 2R072 4LORA 4Q4X2 3WDUA 5DUWA 5E16A 4A3ZA 1F8VA 3WNKA 1ENSA 1BKZA 1UOFA 3AC0A 3CIHA 1SFYA 5A7NA 4UYBA 1QWRA 1XE8A 2ORXA 2VOWA 3N7LA 3CO2A 4I01A 4LEJA 4E2GA 1WMFA 2JG9C 5A6XA 1GUIA 1S1AA 4PDWB 2CGNA 4ISRA 5CVRA 1GNZA 4DXRA 1HRI3 3O14A 5J48A 5A3TA 3JUUA 3SH5A 4L9BA 4UFIA 4Y1YA 4F3JA 1GSLA 2HEVF 4IEZA 4E4DX 2LW8A 1OOPA 2G1MA 3WCSA 4CDXC 4AVSA 1GP4A 1YC61 4HZFA 3MO4A 1WLWA 2WINB 2ZEWA 3RJ2X 2RM21 2GZWA 3AKTA 1NXMA 1A8MA 3LA2A 3WDXA 3VBOB 1JHNA 2D3RA 3VDBA 5BNNB 4ZU4A 2VQUA 3T1MA 1CAXA 1VBB2 5K4LA 3ACIA 3VBSB 1CD3G 1WBLA 4G3YC 1PGW2 1A78A 4QKFA 4MVTA 4A41A 3WW4A 3POSA 4ZS2A 3CKHA 3B7MA 1APNA 5FZ6A 1RUH3 2QQIA 5FZ7A 3JXSA 1GKBA 1UZZA 4G4FA 2D40A 4FI9A 5BNOB 1I5ZA 1Q3EA 1ZBE3 3VHPA 5IVVA 4CUCA 2PHLA 5BYNA 2VQAA 2WWUA 3UL2A 2WUHA 3MPPG 4UW3A 2R49A 2JICA 2AACA 1PX4A 2D5FA 3VLBB 3I59A 3WNOA 3ZXLA 4AI1A 1HRI1 2YROA 1V9U1 2RHPA 4UF0B 5JIAA 3TRSB 1FPN1 4RGKA 4ZU7A 4I3GA 5I0RA 1POQA 4LLOA 1H8VA 4RFT0 1GP6A 1OOPC 2O0OA 2ZGKA 4AHXA 2DV9A 4Q2FA 3LA3A 3AYAA 5CKMA 3KVAA 5A32A 2QQNA 2ZMLA 5JMCA 2W1QA 4ONUA 2WQ8A 4MOAA 5CYYA 3LEKA 5FJHA 2CHHA 1HLCA 2TUNA 4CDWA 4Z2WA 1ENQA 4LBNA 5DQ0A 5DUUA 2IFRA 1JZ5A 3PU3A 2J1SA 2JG9B 3J9SA 4X6RB 5KXDA 3ME2A 3JZVA 3NMBA 4Q8LA 2V73A 2VZRA 2RJ2A 4XUOA 5AFEA 5AFBA 3VZMA 3ZXGA 3JQWA 1S0FA 2ID4A 2WABA 3OGVA 5JSRA 2TEPA 3I97A 1Q8OA 2P3KA 4UW6A 1UY3A 2W39A 1YYNA 2V4VA 3M2MA 5F2SA 4QXHA 2XJTA 3H50A 1F4HA 4ES9A 4FPHA 4HN1A 5FCCA 1S0GA 2OZJA 1PK6A 4GH4B 2PELA 1HV0A 2ZJCA 5CADA 1AHSA 1IS6A 3LEIA 3DN7A 1NE4A 1ZZ6A 2HEWF 5FZBA 5J09A 3BU0A 4BM8A 3HN3A 2BGCA 1L7LA 4OUEA 1H6YA 1W6QB 1R1A2 3HJRA 4CCMA 2FBEA 3WF1A 4JRAA 1H6XA 3O1VA 3E5XA 4Q4W3 3BTZA 2G9FA 1FI2A 2XKPA 5KC6A 4Q4Y1 1Z78A 2XH6A 4RS5A 1O6UA 4DXTA 4FPLA 1BQPA 5FDBA 4URTA 5EFUA 2DVBA 4MX3A 3HMYA 5EP9A 4LKEA 2BFUS 4D6QA 1XYNA 3FLRA 4CDWC 1AR93 2BWCA 2XWBB 3KZ4C 3MW4A 4AGRA 2YPDA 4ORFA 2WT0A 1HB3A 5FYVA 1VMFA 1DF0A 1UN1A 2NN8A 3CQOA 3WOGA 4DRRA 4Q0VA 5C70A 2XJRA 4HXCA 4WM7B 4IV3A 1MS1A 2GMPA 4S2GA 3RVHA 1JW6A 5F3GA 2BW8A 4FPOB 1UNBA 1B35A 1RHI3 2VNGA 3MUZ1 2MNGA 4QAWA 1VRH2 5KHGA 2G9ZA 4YYOA 5ABJA 2A70A 3I2KA 1VBC3 1YCIA 3EB7A 1RITA 4R9CA 3UYJA 3VHOA 4XUPA 4CU7A 1DQ4A 3JU9A 2X05A 4XXAA 4MXVA 4Z2AA 3I49A 3ZKUA 4P00B 1W9FA 3D4KA 1AJOA 4AI9A 4BQ4A 1REEA 4FO9A 3P3NA 1XRUA 3TWIA 1AUYA 1VMJA 3F2ZA 2LALA 4DXZA 3LPFA 1Y7BA 3LF7A 1YJKA 1DU3D 2QUOA 3AJZA 4H14A 1LR5A 1RUJ2 1WCDJ 2RDQA 3FLTA 3I54A 4QX8A 5A70A 1OPMA 2RS32 3AMMA 3KV9A 3KS7A 4RS5C 4XDPA 2BBVA 1YXWA 5A33A 3NV1A 1V6KA 3U78A 2X5IB 2J42A 3LSEA 4QQLA 3TB0A 1UY2A 2WNUB 1ST8A 1POV0 2XHKA 2ZMNA 1N1TA 4N43C 1GOHA 2Q4SA 2RR12 1G9AA 2WSUA 1RC6A 3PLQA 2WO2A 1K45A 5DUVA 3VD4A 3KF5A 3A23A 3AKSA 4W6XA 5FY7A 4N53A 5IK4A 4AR2A 4NRQA 1ZRIA 4Q4V1 4QT6A 3UKVA 4ASLA 3V0BB 3K3OA 4QDQA 2GH8A 2D44A 3QH7A 5A32B 2Y60A 2RS53 4QHZA 2WR9A 4GMP1 4J1WA 3MFAA 4AVTA 5A3PA 3CL1A 1BYHA 4NWVA 3I2OA 1PVC2 1HRV3 1V6JA 2V5YA 3U4XA 5JLVA 3SH3A 3BIWE 4NHYA 1GZCA 3WP6A 3WNNA 1QJX1 5D8AA 4D7TA 1W9SA 4GWNA 4AZZA 2RDRA 3AKQA 2ZGLA 3ZSEA 1QMJA 3B94A 3G6JB 2DCTA 4P9WA 4RA0A 1POV3 3WW3A 2ZBJA 3ELNA 1QEXA 3PUQA 1O91A 2B7YA 5FMDA 1F5JA 4FPGA 3AP6A 2IWGB 5H9RA 4FQ4A 4QB1A 4YVSB 1QXJA 5CKQA 3EMRA 1XU1A 2R32A 1DQ2A 2CWSA 3EQEA 2CDOA 4LO6B 1OXCA 2D6MA 2JDUA 2QVSB 2R6QA 2ZEXA 3HT1A 4R8HA 5CA6A 5IK8A 2WO7A 4NMIA 3ZYIB 5LEJA 2BV4A 3W21A 2HWB2 3DCQA 3PIJA 1H8TA 1SFNA 2HWD3 4QKBA 1X9TA 3WNPA 5C6CA 5JXHA 3VD3A 5LY1A 3H8RA 3HVDA 2GC0A 2B9VA 2OYZA 4IDZA 1XNCA 5EJ1B 1BMV2 4I0BA 3USSA 1YNAA 2O14A 4HG6B 4AHZA 2DBNA 4IEOA 3O1UA 4YSFA 1D0HA 1YI7A 4JQTA 1VBD2 1B09A 3OUHA 4KH9A 2OS2A 3CF6E 4Q29A 4OMCA 1YQ2A 1HQNA 2GU9A 2ZX2A 1C1FA 2PHXA 1FMD1 2P34A 3F95A 4K1ZA 3VBFB 2JDKA 4N43B 3DKWA 2VZVA 5D8AC 1RINA 3VKFC 5JCTA 5K7PA 3BB6A 5FYCA 2WWSA 4C1XA 4XBLA 3LSDA 1ZM1A 2CGOA 3HIFA 4QDRA 4FT8A 1F15A 2P6HA 3VUOA 1GU3A 3BYWA 2WLPA 4JGZA 4A4AA 1JOBA 3PVOA 3NJVA 2WZR2 2HLEA 2Y0IA 1AZDA 3NJZA 3X29B 2JDHA 4GJZA 3OG2A 3AMNA 5CNAA 2JD9A 1U5YA 4XACA 5FZEA 4BIOA 3I3MA 4D7YA 2GNBA 4C0HA 1VP6A 2DF7A 4X6QB 3R6SA 4IESA 3ZSLA 1VBA2 4BLJA 4OLLA 2WNEA 2F4LA 2WQ4A 2ADDA 2XHNA 4NUBA 4CA9A 3OSDA 2VQTA 4GB32 4XXPA 3OPZA 5J96B 3WY6A 4B3NA 2YV8A 1Y4WA 4AI2A 2QCSB 5F6LB 2EXHA 2YHJA 2VH9A 4FFGA 4AF9A 4AQ6A 3T2TA 2BNNA 1X7NA 5C8CA 2YBPA 3NNJA 1JOPA 3B02A 4QXBA 3S6PA 3RZLA 4OYUA 5A1LA 1OQDA 1UU6A 1CJDA 3AZYA 4GZ9A 1W04A 4LBQB 1OUSA 1RVF2 2IXHA 3D5OA 4IXLA 1UXXX 1RL3A 4JKMA 2D5HA 2YC0A 5FUNA 5GJ6A 5FYHA 1NG0A 5BNQA 4N8MA 1ND2C 3INAA 3TN92 2RMU1 3FLPA 1SLIA 2R062 3FC0A 4JGZC 1LHOA 5JPNB 2XR4A 1FOD3 1GWMA 2RS12 2O8QA 2WLQA 3GBFA 4A3XA 4QHOA 3B93A 5FZCA 3CZUA 2VUCA 3J7NA 4JDNA 3W20A 3PNAA 1J1TA 4LHKA 5FBZA 4H3WA 2GMMA 1BEV1 1JUHA 2ILMA 3E6BA 4KWKA 3JCIA 1NYWA 5FTTC 1DGWX 4CDUA 3GZUC 1JODA 3POJA 4RSUA 5EIYB 3A4UA 3O1MA 2YBKA 1SBEA 3VBHA 2IVJA 4ZZ5A 4NIHA 5IUQA 1IS3A 1ZBA3 4QQPA 3ZMOA 1RMU2 5FZ0A 1LCLA 2XWJB 2RV9A 2WQZC 4Z1VA 4LA2A 1XC6A 4YGEA 2MEV2 1CX1A 4LBOA 3T2QA 2NYYA 4BOWA 3U37A 3Q9OA 5C8CC 5GALA 1ULFA 1CIWA 3J7LA 2JECA 2DVAA 4RL7A 1UMZA 1XYOA 2EAAA 2JE7A 3GJBA 4L92A 4QX7A 5A3NA 4I30A 2HWE2 5EJ3A 4ATEA 5I0TA 2H6CA 2JG8A 2DFCA 2RJLA 3FMGA 3NV3A 4JQRA 2EIEA 1OF3A 3KV6A 2I2SA 3WXPA 3WP5A 1RUE2 1FNZA 1XJAA 1W0NA 4K3UA 2ZX3A 3K4ZA 1V6LA 1H4HA 4RHV2 3MLLA 1NA1A 2R071 4P5YA 1C3HA 2BBAA 2DUOA 4BJ0A 2QDNA 1AYN2 2WFPA 4ZY9A 3VKLA 1RUD1 1NCRC 1XBFA 3T09A 3ILRA 2WNVB 4LKSA 1RUC3 3H3LA 4NHXA 4CZSA 2KR2A 3MUY1 2EXKA 2Y38A 4CDUC 5AC93 4X8NA 1N47A 3NNLA 4IEUA 4XILA 4A45A 4FBFA 4IERA 1RUH2 3VBHC 4DPNA 1W3VA 4HSLA 4AAXA 1ND2B 1QDCA 3QD6A 5FO7B 4FTSA 3J8F3 4DQAA 1T6GC 1W8HA 1Y9GA 4EN9B 4OUMA 4KGQA 3OTFA 4MGSA 4B4RA 4BPZA 4JHTA 4Y20A 3IZOA 4OHWA 3ST7A 1UPSA 2VCMA 2C26A 4MXWA 1N1YA 1WMDA 4MV2A 3TNQA 2BPA2 3TEXA 2JX9A 3NAPA 5FP7A 1LOAA 3RGBA 2JDYA 4QKDA 2JG8C 1FT9A 3ZYGA 3ACFA 2PA7A 1W2TA 1PGW1 1G7YA 1AR83 2R16A 1RXGA 2VW1A 3ZYBA 2YU2A 4MO3M 4A44A 4D6RA 5B4XA 4JTNA 4CP2A 4UFLA 1NA1C 2GDFA 3HQUA 5IFTA 3NNFA 3USUB 1BLZA 2ZHKA 4YZ5A 3C7EA 4GWJA 2A6WA 2B45X 5K0UA 4XIKA 4BU2A 1RUC1 3RWNA 1UIJA 3OD4A 3LB9A 4HPKA 1MS8A 1OVPA 3R4DB 4QM8A 3RG0A 1WMEA 3MIEA 1ZRCA 3E97A 4SLIA 5F5CA 3NKTA 1A34A 1MZ5A 3A0NA 1LU2A 3OYWB 5FQ0B 3WDTA 3CJIA 4Q8KA 5B2GB 1J83A 1JU4A 4FOYA 3J4UH 1WD3A 1VJ2A 4PBPA 1CZTA 3VDCA 2VMFA 5CKNA 1K5MA 5B4NA 1OUXA 2IUWA 3O1RA 4LBKA 1RUI3 3N4MA 4DY5A 4FAHA 5DABA 2VBBA 2GALA 3I2GA 3KCCA 4FOVA 1QJU3 1RUG3 4FOWA 2XVLA 3MF6A 2VVEA 3C7FA 3P6BA 4ET7A 1NCRB 3PJQA 3NAPC 2QTWB 2E33A 2PMWB 2Z5WA 5EWSA 4AOCA 2FHRA 4AI0A 4KWJA 1I9RA 4AWDA 1T2XA 3MIGA 2JENA 3RI8A 2Y6FA 1WW4A 1EAH3 3WR0A 2Z42A 3POEA 3ZXAC 3IB3A 5DDJ3 2Q8DA 5C3QA 3ZXDA 1DLLA 5CFCB 2W47A 4LHLA 1AR92 4BHPA 1OFNA 4P5HA 3AP4A 4PQQA 5JOWA 1M06G 1DG6A 5FZMA 1PMJX 4N7UA 3FX3A 3WW2A 5IVCA 5K0UC 4JDMA 3O1PA 5F1RA 5A3UA 5J36A 2VULA 1AX0A 1S0IA 4B7KA 3DYOA 3MIBA 4BA6A 2A6ZA 4NPRA 3VDAA 1JYTA 2E9QA 4KBZA 5GZEA 3CJIC 4BZ4A 2EIDA 4HVQA 1VBC2 4GQ7A 1YQ8A 3ZFFC 1R081 2C0ZA 1XNDA 2W08A 3VBUA 2XLFA 5A6ZA 1JI6A 2VR4A 1ZZ8A 1H2NA 2XXZA 2E51A 4OVEA 2ENRA 4M3CB 4P08A 5JI9A 1NE6A 1MS5A 2VZOA 1F35A 5KR7A 4BQ1A 1D4M3 1ZZBA 2W94A 1UMIA 3VB9A 1JZ6A 1CX4A 1TMF1 2WA4A 4QMAA 4UT5A 5GLVA 5TSWA 1AR62 1TVGA 2X09A 3ZXKA 3N7KA 3NJYA 3GNEA 5JSOA 3LPGA 4CEYC 1EUUA 2VMIA 5FP4A 4CYDA 4YGDA 5FREA 5FY8A 4BISA 1JZ3A 2QQVA 5HBAA 5DDJ1 1YWKA 4XFFA 2ARBA 4YPJA 4B8EA 3D82A 2B42B 2XG3A 2OW4A 5KWRA 1VRH1 3FZ3A 2KA3A 3FE5A 3AYCA 3K48A 4J6GA 3FWEA 4YM3A 1XB9A 1YHFA 4QPIB 3MDPA 2YUEA 5FXZA 3MEPA 4IEVA 4P9GA 3U11A 3WF0A 3ZVXA 2HWC2 2HWF1 4W65A 5FZ9A 1LESA 5T5JA 4B1LA 4I02A 5IT6A 3KM5A 4AEDA 2VMDA 1MS4A 1YRZA 3IMNA 3VBUC 3VZKA 3VZNA 5HV0A 4AG4A 2DTWA 3NWKA 3T4VA 5JXGA 2J1AA 2RS31 5ACA1 2LS6A 1J3RA 1GZWA 1TNRA 1SCRA 3QACA 5F8PA 3ZPOA 4UXAA 2NQYA 1W6OB 1YLLA 2QNKA 1G9FA 1BBT1 3WHTA 4OHZA 2KM2A 1DBNA 1BK0A 1UCXA 3ASIA 4V2VA 4OHVA 5BNPC 4Q26A 1U5XA 1K42A 2I07B 1ONAA 2V4AA 4B1MA 2WL1A 3CBNA 1JXNA 2HYKA 4Q0PA 1ZYBA 4WVWA 3QBQA 4LE4A 1PO22 1NT0A 4Y26A 5LK7B 1W2OA 3ZFFB 1CAWB 2Z4FA 1ZREA 1KEXA 1AYM1 5FUIA 4BXSV 3RZMA 2FZ1A 4N9IA 5LA0A 1SQ4A 3C8XA 3I2HA 2OXBA 4XFIA 1D0GA 3O12A 5KC5A 4OI4A 4K20A 3OUIA 2D98A 3FHIB 4BQWA 3OY8A 4Y1VA 1SZBA 1E5SA 4N90A 1ND3B 1PVC1 3VDDA 4YGCA 4FTBA 1W9WA 4PI2A 3NVCA 2WYFA 4DOUA 1HX6A 3SH4A 4CEYB 5CFDC 4AEDC 4BMBA 2N7GA 3BCWA 5CZKA 3WG3A 3MICA 5FBJA 1UYXA 1D2QA 2WKKA 2VVDA 1JZ2A 2YC2A 4L0PA 1SLAA 2JEMA 3AZVA 3NNMA 5F7UA 1FYUA 3VV1A 5DMYA 1O3RA 1W8WA 5A6YA 3BVCA 3BTXA 3WZ1A 1C8NA 2PLV2 4DZGA 2VNRA 5GZGA 5IVBA 5L7OC 4D94A 5KHHA 1RUF1 3E5UA 4AE2A 3DPRA 3I2DA 2WS92 1W3XA 5L73A 3WF4A 3WLUA 5G05L 1DHKB 3RDIA 2P6CA 4ARXA 4R9BA 3N3HA 3GCXA 2YG0A 1BMV1 1KJLA 1KS4A 1DYPA 4O9EA 4Y4YA 3S30A 3POYA 1LOCA 1MQTA 2YC4A 5FYYA 4DS0A 1O5LA 4Y24A 5BUVA 1VBD1 4RGAA 1ULEA 5BNPB 4WVVA 3VDDC 1UKRA 2MPFA 4QU2A 4QWNA 1WLDA 4UFMA 1YQCA 2TBVA 2B4KA 4IEQA 4YZ3A 4DINB 4FP3A 4UBGA 4LO7A 1YQ5A 3CZJA 4GWIA 5A7QA 1SLBA 2AENA 3WUDA 2XJUA 3DEMA 2VQ0A 3AYEA 5GLZA 4ZPIA 2EIBA 4O7XA 2IC1A 4IEPA 3ZPYA 4Y1ZA 4EZ4A 3GJAA 1QQP2 1CAUB 3VL9A 3AYDA 2BDRA 4LLFA 3U4SA 4DEVA 4HKLA 1BK1A 3AXDA 3HR9A 4Q1PA 2JKBA 1VMHA 4MZUA 5LWBA 5IFPA 1V9U3 3ILNA 2W91A 1R092 2NMOA 1FPN3 1JZ7A 2YFUA 1VBA1 3ZSJA 1N3OA 2J1VA 3M3QA 4XAEA 3AP7A 4RFRB 1LHVA 3ZDVA 2VC9A 5BXXA 1AL21 1AR72 5CFDB 1HXS2 5BPXA 5GLUA 2E31A 4GB31 1LECA 3SXWA 1MZ6A 5F37A 4QB6A 2JE8A 1GZWB 1QJY2 4CU8A 4EN7B 3JBG1 5JR2A 3BU7A 2ZZQA 5EYYA 5C8WA 3BGAA 3RFRA 2QQLA 2V09A 4I09A 5F5IA 3ZFGB 4CP1A 5HCHA 2IXLA 5FZ1A 4P9LA 4QPGB 1PVXA 2QDRA 3D3AA 3SHRA 5HI0A 3AZZA 1RJ7A 3OBRA 3WP3A 4XJWA 3UV9A 5L7OB 3GZAA 1J84A 1W6MB 3D6EA 5HXVA 2Q8EA 1WMXA 2UWAA 3RYPA 4I0WB 1SMVA 2GSYA 4JAAA 2BVBA 4LT5A 2Y6GA 2R061 5JAXA 4INDA 1BCXA 3MIFA 4LBMA 3WP4A 3MGUA 3TYJA 5FRAA 2VAUA 2RS11 2BP6A 2CY6A 3RS6A 2AEYA 3JD72 3MI8A 4K40A 2TNFA 4UI9L 4UOJA 5FZOB 4RYDA 5C33A 3SCHA 3VL8A 2GNDA 4F7ZA 4Z8BA 4XAAA 3NQHA 4E8DA 5FLIA 4XFBA 3MBWA 4YM2A 3I3DA 1F9KA 4XQ4A 4DIQA 4AI3A 2JE9A 4GIQA 4Q4Y3 1H2LA 4RGGA 1XNKA 2IFWA 1DP0A 1IGOA 4A7YA 1SBFA 2HBTA 2G4IA 2E6VA 1RMU1 4LQRA 1ZZCA 4UAPA 3ZN5A 2A6XA 2ZGOA 4LK7A 2MEV1 4R9DA 4IGQA 5FYIA 3GM8A 4YFWA 4LHSA 3BKZA 5AC92 4B29A 3IDBB 3TEYA 1TME1 3O1TA 2ZKLA 2ZAHA 4AVAA 1D4VB 5C3OA 2VMCA 2HWE1 1ZRRA 3ZOIA 3MZHA 1XQNA 3K4DA 4V2WA 5F3EA 1EV11 4ATFA 2CNAA 4ARYA 4Q5OA 4JDOA 2GP5A 4AAPA 4CDXB 1RUE1 3RZGA 2EIGA 4B4QA 2JB4A 3ZN6B 4AGGA 4PF5A 1NCQA 3ZR5A 2H0BA 4RHV1 3MW2A 2E26A 3TBDA 3ZO0B 4DRVA 4M4PA 4HN0A 2R0HA 5T55A 3Q8AA 1MEC2 4MHRA 1AYN1 3NKGA 4XJAA 1OI6A 4PJYA 5FO8B 4ZHNA 4COVA 2XOMA 5IW0A 1FV3A 3DUIA 4PIYA 4FXKB 5C9AA 3O1OA 3UJOA 1PO12 1PZ9A 3KD4A 3Q8BA 3VHNA 4C91A 5I93A 2ET1A 4GMP0 3AZWA 1C8M1 2FMDA 5HCFA 2VZSA 4YW1A 3B01A 2OT7A 1NY72 4EYUA 3SITA 2PHRA 4LO4B 3FJSA 3D0JA 3VZJA 4EE2A 3KT7A 1X82A 5HCAA 2QQPA 5FXXA 4RQPA 1DZTA 4COZA 2XBO2 1IQDC 4YZ1A 4JGYA 1G6NA 1UZYA 3VBRA 1RIRA 4FQZA 2P2KA 3IIIA 4CCCA 2VGDA 1CZSA 1OOPB 4Q4V3 1RUI2 1DQ5A 3AFGA 5L9BA 4IV1A 2XGXA 4AEMA 1FXZA 1RUG2 4IE0A 1PK6C 1CZVA 4E4HA 5FY1A 4HLTA 3RZJA 2ZABA 4GMP3 3LZZA 4JTOA 1DGLA 2QQUA 3ORJA 3H1MA 5I8YA 3ROUA 3VZOA 3LOIA 5LA2A 1CAXB 1NLRA 4IUGA 4P14A 1Q8PA 2VM9A 5T52A 2VU9A 5H9PA 3VHRA 1QJX3 5FPVA 4CEWA 3DV8A 3RMXA 4NE9A 3WEZA 1CR7A 1UMHA 1GNYA 4OULA 3MHZA 2WIIB 1W8NA 4QM9A 3WF2A 4OI2A 4HK8A 5DAPA 5C4WA 4CU6A 3RPQA 1OQEA 1K5JA 4GD4A 4CSWA 2WWJA 1N3PA 1OF4A 4A6SA 2E53A 1M4WA 3T0AA 4FFIA 3J26N 1GWLA 3NJXA 4FPYA 1NX9A 3LA7A 3POFA 2NP0A 1QHDA 5LBCA 3OGGA 3AMQA 3OBAA 3I59B 3U10A 4NIGA 1VALA 4IV3C 4FPFA 5FXVA 4CCJA 4NHLA 1B35C 4LNVA 1MR5A 1Z0HA 3N9LA 3MW3A 1OD3A 4S2HA 5FZFA 3DL3A 5DUXA 1EPZA 5ABJC 2XVGA 2Q0AA 4L2NA 4AK3A 4XPVA 1D2SA 3FL7A 4FP2A 4XQDA 1X50A 3ACLA 3EHKA 4CDWB 5DPNA 4META 1FMD3 2ZCWA 1H2MA 1ODMA 1W39A 3POIA 1Z7S1 1W8FA 4CEWC 2GN3A 1W6PA 2UURA 3KCXA 3LIHA 5C4WC 2OX0A 1AX2A 1GBGA 3BTAA 2ETEA 2UYBA 3CLPA 3LDBA 3T2OA 4FPKA 3C3VA 1JUIA 3LDKA 4ASKA 1OBNA 1PK6B 2GNTA 3RWKX 1CPMA 1YO8A 3ZX7A 1V6MA 2P37A 2XL9A 3T1LA 1ASJ2 4WBBA 1UKGA 5KXCA 4NJ4A 1PMHX 1PZ8A 3VZLA 4MG2A 2ZGQA 2Y6HA 2VXRA 2XMLA 4LBLA 1WGPA 1AR61 3H3ZA 4N53C 1G9CA 4HONA 4XF4A 1KJRA 1IG3A 2ET7A 3IDEA 4RS5B 2WFF2 5I0SA 4K1YA 4NAMA 4P9IA 1YUDA 1OURA 2ZGNA 1S0EA 2WDBA 4WVMA 1KGYA 2VUAA 3ZYHA 2JDPA 4CXWA 4Y22A 2VD7A 4YW4A 2ZZJA 3MIDA 1PIV2 2GN7A 4XMAA 5JI7A 5A7OA 1JYWA 4PLOA 1HB4A 2ZGTA 3N9PA 2HWC1 1JN2P 4IV3B 5F5QA 3ZSKA 1UO9A 4CRQA 4EWAA 5FPZA 4URAA 5CU1A 1B35B 1WLCA 5DG2A 1PNGA 1NQJA 4XFGA 2RMU3 2LUWA 3NW4A 1COV2 5IYYA 5JDBA 2UY8A 5ABJB 4MGTA 2OQ6A 1VAVA 2XDVA 2ZHMA 3BODA 1QNWA 4Z92B 1X8EA 1GQHA 3HNYM 4AFDA 3MFCA 1SBDA 3PUSA 2A3YA 2VTXA 2XB6C 3OEBA 5FXWA 3BALA 3WT3A 4D3WA 2RG4A 3PDQA 4C90A 1S0DA 2QE3A 1DZRA 5ANNA 2R042 2VW2A 1BEV3 2A71A 5FLHA 1WW5A 2YPJA 4CCEA 1H8TC 1ULDA 2DVDA 3B9CA 1GYKA 4M0NA 4XBNA 3SC7X 4H2AA 4BB3A 1VAMA 3N9QA 4XDQA 3WQ0A 4COUA 4UFHA 1RB8G 1SLTA 4OI0A 3IN9A 4ZONA 1SG3A 2CL2A 1FX5A 2YBSA 5A33B 2DBIA 1PGL1 2E63A 2VY0A 1LOFA 2YFZA 2DDUA 4LBJA 3SCFA 2AGSA 1BJQA 3R4SA 4L11A 4XW3A 2VBDA 2C1FA 4GAZA 4ZXEA 1VPHA 3W5MA 1UF2C 5IJRA 2WYSA 3KVBA 4FSJA 1VBE2 1W99A 4KWLA 2DCJA 5F3IA 5HPOA 3POBA 4PIXA 1PX3A 5T5OA 4DEQA 4DUVA 5ISLA 3K3NA 4N53B 4QQHA 2W3JA 4YM0A 3V65A 2GC1A 2CTVA 2RDSA 4ZU5A 3S7IA 1WKYA 2B8MA 1K12A 1WA6X 2PAMA 2RM22 5FMOL 1U5ZA 2R073 2WA3A 4MH0E 5FP3A 3GGLA 1PZ7A 1UU5A 4AYUA 3I7DA 1AXKA 4YW5A 1RUD3 3ETPA 1GLHA 3IMMA 4FVVA 1HN1A 2R1DA 1RXFA 3UK9A 1TNFA 5D8AB 2AREA 2PLV1 4OQ9A 4AW7A 2WZ8A 1NLSA 1U5IA 1GQGA 4CDQA 2BQPA 2CAUA 2XQXA 5JR7B 2VJXA 3BPSA 3FBYA 1LTEA 1MS9A 1XE0A 1YI9A 5JXJA 2J1RA 3ATGA 3BTYA 3E1F1 2WJSA 5L9RA 2AC1A 5FPAA 1LOFC 3THPA 1W0PA 1URXA 2PTMA 3LKJA 4CP9A 1HJFA 2DUQA 3GF6A 1HRI2 3H3UA 1V9U2 5HV4A 1VIWB 1FPN2 1W28A 5D1IA 2WN2A 5CAZA 2OUJA 1W6NA 5FYMA 1H8TB 4BDVB 1EUTA 2BWAA 3U07A 3ZFEA 4HBNA 5FZHA 5IVEA 3S0MA 3PTRB 2PHWA 5IVJA 1YFWA 1SLCA 1OPOA 1LHWA 3BOPA 4HT1T 4LK6A 1CGPA 3U14A 4R4ZA 2P17A 2Y0OA 3M3OA 1MACA 3WVJA 5FR3A 4Q4X1 2AH2A 2JDMA 4IEYA 3RYRA 5LRSA 4OHXA 4DY3A 1LNSA 2ZKNA 4LPLA 5C3RA 1SPPA 5ERLA 4RR3A 1QQP1 1R1ZA 3IPVA 1UY4A 5EXOA 3ABZA 1YQ6A 1W8TA 3KV4A 4CCLA 3V0AA 2ZGMA 2W1WA 4CDQC 2XPJA 1NZIA 4IW3A 1R091 3PVEA 4IQPA 1ZBE2 2LROA 4CXXA 5GZFA 4JGZB 1IHMA 4NIDA 1AR71 4BMEA 1DYOA 3DYMA 3ZXFA 4MYEA 5EV7A 1OH3A 5FV3A 1RUNA 3DYPA 1JYIA 1QJY1 4O61A 3WF3A 2B5HA 1Q56A 2VCAA 5EPAA 4QGMA 2B9UA 5E8AA 4PBOA 5FP8A 3R0RA 2BOJA 1F2NA 1EY2A 1VBB1 1G86A 4QX5A 3U75A 1SFPA 2C9KA 2KXLA 1SDDB 3ZFEC 1OA3A 2HEYF 4HOOA 4OQ8A 5LK5A 4XE9A 1FV2A 3MIHA 3A7QA 1RGSA 2GNMA 2ZX1A 4A2UA 4YW6A 1KQRA 3OGSA 1WUVA 5C8CB 3WHUA 5A7WA 1UOGA 3JD71 5FYZA 1DFQA 2Y6JA 1UOJA 1IKQA 3KGLA 2K46A 1G8WA 1J3PA 1UQXA 5I91A 1LAJA 1DDLA 5I8SA 4LOSA 2WO3A 3HNMA 1R083 4ZZ8A 4KG0A 2W68A 4LHNA 2W52A 4PI0A 4YM1A 4YNIA 5J7MA 4FAGA 1I6XA 1QH7A 2YYOA 4A6OA 4OFGA 3V56A 1OVSA 2WSVA 4LULA 1WLTA 3OPTA 4AL9A 5FK7A 5IK5A 1TMF3 4AFAA 2J1TA 1UZVA 4Q4W2 4CDUB 1JZ8A 2A1XA 2JJ6A 3KGZA 4BQXA 4AHWA 1HKDA 4QX0A 1E57A 2L9LA 3VBHB 5FZKA 1LHUA 1R64A 1RYYA 4AQSA 3AKRA 4XFCA 2ZX4A 1BVVA 1VRH3 1KD7A 2ARXA 1SACA 4LR4A 1BXHA 2A75A 4QB2A 1PHMA 1JMUB 2BOIA 3C2UA 5FZ3A 4LA3A 4WM8A 3PTYA 1EP0A 1UL9A 2F17A 4U2AA 1X8MA 5DZFA 1JH5A 1MEC1 1RHI2 4HK9A 2JKXA 4QXCA 2HWF3 4QX2A 3M3EA 2OKXA 2JG8B 2CU5A 1R1A1 1MS0A 2QKDA 1PO11 3QH6A 2EAKA 1LHNA 4YVWA 4CP0A 1O8PA 3ETQA 1ULCA 1QJFA 2OA2A 2P4EA 1K5MC 2QQKA 4LMFA 3AP9A 2RS33 3LE0A 2Q30A 1NY71 2VW0A 1NA1B 5ACA3 2VNVA 4LXLA 2D6OX 3UKNA 4F83A 4EN0A 1WCKA 1BBT3 2IXJA 2K9ZA 5DN2A 1JYNA 1UD1A 3GCWA 2W0XA 1YFYA 3OOXA 1OT5A 2FQPA 5FLJA 5I0UA 5DAXA 3WNMA 1S0JA 2XBO1 2ZS6B 5LW9A 1C5HA 1C5IA 4XUTA 1BVP1 1W05A 2WZPP 3VKOA 1C28A 4H7MA 4BYYA 5JMOA 4XF9A 1H4GA 4YG3A 1AYM3 5JZGA 5JPMB 4PHZA 4KWUA 1F4AA 3TNPB 1KFXL 5D2AA 5A1FA 1IPJA 4AI8A 4QPYA 1X36A 4CE8A 4Y20B 1Q8VA 4WM8C 3E6CC 1A3KA 1CAVA 3O0XA 3FN9A 4MXWB 3K2OA 4BK4A 2JDNA 2YB7A 3NAPB 3TOJA 1PVC3 4MSVA 1S0CA 5EJZB 2ERFA 4KBBA 1PM4A 1ZA7A 1U12A 3OGRA 4LKFA 1ENXA 2IXCA 2W46A 1Y9QA 3FHQA 4Q27A 2XLAA 1OA4A 3C7HA 3GALA 3U0ZA 4AHYA 4AQ2A 3HEIA 2RS52 1CONA 1N3QA 1RUJ1 4DNYA 2VTFA 2FD8A 3H42B 5CG8A 2QBXA 1LEMA 3K4AA 4R9AA 4UFJA 2NLRA 4XTMA 4E2SA 5K8SA 3ACGA 1HRV2 1L7QA 2W92A 4Y5TA 2JIGA 4AVBA 4CUBA 3SEEA 1P8JA 5I8TA 5K0UB 3CMGA 3B69A 3AJYA 1MVQA 3P5BA 2GC3A 4HPKB 4PDWA 4QGNA 2OPKA 3CNAA 5CISA 3OGJA 5DAWA 2RR11 1TZOA 1RUF3 3ZLIA 2PHTA 3UNPA 3ON7A 3CJIB 3I2JA 3NRUA 3PUIA 5IATA 5JOYA 2K2SA 3AMHA 3AKPA 5JZGC 1HB1A 1TG7A 1K5MB 5G04L 2Y33A 4XJ9A 5LATA 3ZIXA 5M0TA 1OLRA 5KHIA 4XCBA 1QOOA 3IKWA 3S5QA 3VBOA 3S5AA 5BNNA 4NAOA 3H8XA 3ILFA 4QU1A 3KCYA 4GXLA 3OUJA 5FYTA 1HIXA 3LFIA 2AUYA 4IGOA 2PAKA 1VBD3 2BFUL 4PQ9A 4Y5Z0 3FBMA 3VBSA 4E2QA 2HWD2 2I74A 5FZDA 2FDHA 4BK5A 2FZ2A 5DZEA 3P1IA 3KQRA 4H55A 4ZS3A 4B4PA 4GWMA 1HDKA 1HV1A 3I2FA 2ZOEB 3T30A 3WQ7A 3ZSMA 5KHKA 5F39A 5LASA 4QQ2A 1XPWA 2EALA 4EN6B 2XUEA 4GKXA 5BNOA 4P9YA 4MLOA 1E5HA 4E27A 2D97A 1E5IA 3WINE 1QXRA 3R4UA 5A1AA 2A5ZA 2CGPA 4K6BA 1IQAA 1BZWA 3MYXA 4AEJA 5JUVA 1GICA 4UF0A 4WZCA 2YU1A 1V6NA 2Q8CA 2Y8KA 2ZHLA 2HWB1 4L99A 4IEWA 2PN5A 1VBA3 3KWVA 4LOTA 3ES1A 3WDVA 4E4SA 4HANA 5FWJA 2G19A 3T0DA 3THDA 3KQ4B 3VBUB 1AL23 3TAYA 1PNFA 1QDOA 3L2HA 4GB33 2JXAA 3DXUA 3VBOC 2UYAA 5BNNC 1KRIA 1I1EA 3JBG3 4YFZA 3ZXJA 4QX1A 5BV6A 3GHNA 2FDIA 2EA7A 3IBMA 2JG9A 2UWBA 1DIWA 1UZ0A 4NWWA 3AL6A 1TE1B 5JSPA 5IVFA 4A42A 4XYXA 5FO9B 1PIV1 2W2IA 4CU9A 3VD9A 3IDCB 3ZMNA 2VE1A 1JBCA 5FZ8A 3WDWA 5C5UA 4HVRA 5BNOC 4COWA 2R063 5DZGA 4YW2A 4GH4A 1Q8SA 3AFKA 3H1YA 4NRPA 2WZR1 4XIOA 4JKKA 2RDNA 4D0QA 5LY2A 3POWA 2RS13 5F5AA 1OQ1A 2F4PA 2A6VA 3AP5A 3QLQA 4LIUA 3CEWA 4BQ3A 4LTAA 4G9SB 4P9JA 4YRDA 1QOTA 5IAXA 1LENA 1W6QA 5KXBA 1REFA 4OHYA 3LEGA 1DGWA 3DPRC 2ATFA 3LCPA 4KNCA 3SKVA 4E4ZA 4FOQA 2PQSA 2UY9A 5LCWL 2VOVA 1ZZ7A 1REDA 2PFWA 1FOD2 4AEDB 2YXSA 2FDGA 2Y64A 5GKAC 1HJGA 2DU0A 3PL0A 4LITA 1QF3A 2OVUA 2LM3A 1RMU3 3RZKA 1J3QA 4HFSA 1RUD2 3NV2A 4MGYE 5EZWA 1MQTC 2EXJA 2MEV3 2VG9A 2AYHA 4LIVA 4FFHA 3WCRA 4EROA 1I3HA 4W6WA 3WG4A 3BN6A 3NNGA 4WM7A 1CPNA 1TME3 1LULA 2ARCA 2SLIA 4MHUA 2D6NA 2DYCA 4K9SA 4S2FA 2Q8OA 1JZ4A 3OB8A 5FAXA 3IAPA 2ES3A 1RVF1 2HWE3 2WO1A 1ZBA2 1VBE1 4AXOA 3G7DA 1NZCA 4JVAA 1WZXA 1EV13 5FY9A 1NXD1 2P1BA 3P3PA 4XZPA 1QJZA 5L9VA 3TN91 3THTA 1RUE3 5GLTA 1DGRN 4KU7A 4GH4C 4TXWA 1W8OA 3ZYRA 3L9JT 3M8LA 1OLME 4RHV3 3EBRA 4SBVA 1LJ7A 2NMNA 1OLMA 2C6SA 3UESA 2RVAA 1AYN3 2X29A 1WCQA 3OY8B 1DGRA 3V64A 2V72A 1F31A 2JDZA 4FXGB 3VD5A 5FJKA 3S7EA 3VDDB 1SCSA 4XVHA 5F32A 1GOGA 4GALA 1GANA 2C9AA 5FPLA 1JTZX 2VCCA 1NUKA 4BIFA 2OIIA 4LE3A 2XJSA 1C8M3 4PT6A 2DVFA 2FCVA 5SV5A 1QKQA 3HD8B 5JIUA 1RJ8A 3SKJE 5CG9A 2X5IA 3K46A 3HPNA 2O8OA 4XDOA 4AEKA 2UU8A 1RUC2 2WNUA 4JZRA 1D7PM 1W03A 3B9IA 1DQ6A 3OBTA 3SMHA 3KF3A 4FPJA 2PYTA 4Z82A 5T5LA 1QIQA 2DWRA 3Q8CA 4WM7C 5JXIA 1UZWA 2C5DA 3RZZA 4NHMA 2A3XA 3AVRA 5GM0A 3IIAA 2VECA 3RJRA 1ULGA 1O8SA 3VKNA 4XHXA 3WUCA 2Q1ZB 3DPRB 1I5PA 1H0BA 3J8F2 3V0BA 4LUKA 5K9YA 1TQ5A 4XCAA 4NHKA 2XJQA 1FAYA 2BZDA 3FFZA 2BEOA 1ZRDA 2KD7A 1F5FA 2Z79A 4IGPA 2ZA9A 1MQTB 1CN1A 4E8CA 3CJXA 4XJUA 1O3QA 1LKNA 1GQPA 1AF9A 3H9AA 4YG6A 5J98B 1AR82 5A3WA 5FUPA 1S2KA 3E5QA 3PIGA 3VN4A 1RUH1 4K8FA 5FMBA 2BNOA 4M00A 1ZBE1 2Z2SB 4I0AA 4KI5M 3JB8A 3KT1A 2R30A 2X5IC 1SLLA 4I3PA 2FMYA 4XOGA 4YVSA 4U36A 1YEWA 3PJYA 2WNUC 2GC2A 3GBGA 1AXYA 1QXPA 1XXNA 3I3BA 1UXZA 1ZZ9A 2WNOA 1YJLA 2YY1A 3HBKA 5IVYA 3CHXA 3H7YA 2BVVA 1O3TA 1LRHA 3M3IA 4XQWA 4W8JA 4YW7A 3N9MA 1SHWB 4FTEA 3ZYJB 4DB5A 1EYBA 3PMEA 5A7PA 3SEPA 1DLCA 1R082 3KMHA 3Q8FA 5BY5A 2C4XA 4KG8A 2FDFA 3BIEA 5T5PA 1AXZA 3SLIA 1PGSA 1OHFA 1OA2A 1W9YA 3I3EA 1UU4A 3HQRA 1QJU2 3KHCA 1NCQC 4BQYA 3OEAA 2D43A 1JYCA 3PU8A 1JHJA 1W90A 3T08A 3WSOA 1TMF2 1ACCA 2ZPXA 4OUSA 1XE7A 2A73B 3K75B 3EO6A 3VBFA 4N43A 4XJZA 3RMYA 1LGNA 1O7FA 1FATA 3UT0A 5C9AC 2BUKA 1Z7S3 2DFBA 1EAH2 1UPIA 1UYYA 3LDRA 4GA9A 5E1RA 5H9QA 2ZGRA 2E7TA 4M3CF 5DDJ2 3WV6A 2G9GA 5KHJA 3M1HA 2VZ1A 3HOBA 2HYXA 1W2UA 4XEZA 4R4XA 2P3JA 1US3A 1V0AA 1K3IA 4YVSC 1ALYA 4QDSA 1ULOA 2DURA 3MF9A 4NR1A 4P9XA 4TN7A 5FPUA 2XKOA 1LEDA 4QKNA 3WG1A 3T3YA 1IZ3A 1GMMA 1NOVA 4N7IA 2W9XA 4MGIE 4DFSA 5KXEA 3E6DA 2VMEA 4EJRA 2BGOA 4AQTA 5E89A 2HWF2 4RQPC 2HBUA 1L3JA 2D6LX 3DGTA 4WVZA 4XF1A 4PF1A 3NSTA 3AZXA 4JGYC 3VBRC 4EWEA 2P5BA 1AR63 4Q4W1 3R05A 2PXJA 3MV11 3HNBM 5C3SA 1LOBA 4EV0A 1KITA 2Y34A 1WCUA 5ACA2 4IV1C 1KS5A 3H1WA 3LD8A 4PLMA 4AFMA 1D4M2 2JDAA 3J7HA 1BBT2 1LODA 1NLQA 1AR91 1UX6A 1XSRA 2P3YA 2WT2A 3H7JA 4B7EA 2A3WA 1ODNA 2VOKA 4W6YA 3VBFC 4UFKA 1C57A 1XYPA 3GHMA 2QQJA 4LBQA 4TSVA 4I2OA 2FCUA 2IXIA 1JYVA 2HWC3 1ZVFA 1RHI1 2LRPA 4NIAA 2PHDA 3SQOA 4HVOA 1S4CA 4LUMA 3ZIWA 1AYM2 3RQ0A 1QU0A 3U1XA 1VBC1 1T6BX 1LGCA 5CB7A 4JC1A 4N9HA 4H7LA 5F3CA 1NCQB 4FPEA 1VB4A 4GKYA 3GYDA 1W2NA 3W58A 1WA4A 1DQ0A 4XURA 2QZ3A 3B5LB 4GJYA 1UX7A 4Y33A 1YIPA 5T50A 2ADEA 3H0OA 4TZDA 3WD5A 4BCUA 1W8UA 5C9AB 4Q0UA 1L7RA 2VMGA 4J1XA 3KV5A 4XFAA 2YZ4A 3DXTA 2RE9A 3UJQA 4XFHA 5J37A 1WD4A 5GZDA 1N1SA 1PO23 2Y6LA 4DMIA 1W8ZA 2XJPA 1W2AX 4UWDA 2H0VA 3D8CA 4ITCA 3NO8A 4NOTA 3PUAA 4L8QA 4NPLA 1U0AA 3L2YA 2BJSA 4IE4A 4RQPB 3A0KA 1RUF2 4UBHA 2D7FA 1O4YA 3TEWA 2IVIB 1JOJA 2B39A 4JGYB 3VBRB 5LRRA 3MLJA 4GULA 3ZR6A 4JV4A 2VOTA 4ASMB 5CBLA 2J1UA 4R52A 4JKLA 4HL0A 5JVVA 4IV1B 4IE7A 2RS51 3OPWA 1YIFA 5A7SA 3OF1A 4DUXA 2WNVA 1HRV1 3DKQA 4JRLA 3O7OA 3CDZB 2ZHNA 1UOBA 2IXKA 4E9KA 2J7MA 1H1AA 2EXIA 2LTNA 1OSGA 1WCSA 3ECQA 1XNTA 3IWZA 4CEWB 2PLV3 4ZXKA 2DUPA 5CEHA 4TLGA 3ALQA 5IAVA 4CPBA 1POV1 2Q5TA 1ND2A 1V70A 2R1BA 2VZ3A 4M01A 2WAOA 2E7AA 1PO21 2P3IA 5E88A 5C4WB 1O59A 2WS93 1CIYA 1CQ9A 4YWAA 4JX0A 5GZCA 4Y5SA 4Y4RA 2CWMA 3LOBA 2ZGSA 5FPXA 2PAEA 4TLFA 2OZ6A 2BERA 1IS4A 1UY1A 1J1LA 1IKPA 1GV9A 2HWD1 4MGQA 3I4IA 5J3UA 2QFEA 1AL22 1O3SA 2W95A 4PLNA 1V6OA 5A80A 2JWPA 1SDWA 4MGKE 1UWWA 2Z69A 3HN1A 2VO5A 2ZAAA 3JBG2 4Q4X3 3USUA 1Q5OA 5DAQA 1FNYA 1JYXA 3D0SA 1HW5A 2E32A 1UW8A 3PHMA 2WNVC 4K8RB 2HJIA 1QQP3 1GWKA 3SCGA 1UY0A 1QH6A 1LU1A 5FFOC 5D21A 1DQ1A 4OZXA 2QQMA 3OYWA 4IL7A 2VZTA 5FQ0A 1NAEA 2YGMA 5T3NA 1R093 1W6PB 2W1UA 3O1SA 2VCBA 3ZN4A 4XF0A 1STMA 2WS91 1UAIA 3POGA 2XVKA 5EHDA 3UGHA 3ITQA 2BYVE 4OCTA 1AR73 1HXS3 1XU2A 3H8UA 5J1XA 5LBBA 4CCOA 1GZTA 1ZNPA 3EXUA 1NCRA 1QJEA 3ES4A 4MUVA 1QJY3 5IK7A 3WQBA 1VAKA 3ENRA 3WDYA 1O4TA 4FPCA 4C0BA 2DTYA 1PMIA 2W1SA 4JCKA 3AB0A 3SISA 1VBB3 3BI3A 3ZYFA 1RUOA 1VRBA 1LB2A 2VZQA 1OKOA
chains in the Genus database with same CATH topology
4TWTA 2VUJA 1KDKA 3O0WA 4HMZA 2AZ5A 1Q43A 3CU7A 4YZ4A 5CFCA 1Y3TA 3UKTA 2QZ2A 1IPKA 2YMZA 2PHUA 1MS3A 4WVMB 1TME2 1DYKA 1Y43B 3HAGA 5H9SA 3SNMA 4Y22B 2D3SA 2XJVA 3JD73 2YGLA 3VKMA 4UW5A 4OI1A 4QGLA 1I1EA 2VPVA 1M06G 4NO4A 1YFXA 1EV12 3JQXA 3MPBA 2AR6A 3HQXA 1TEIA 1N1VA 2DCYA 1AVBA 2CAVA 1CESA 3DF0A 4M3CE 3O5SA 4EWDA 2IZWA 2JD4A 3AMPA 1FOD1 4M3CA 1HXS1 1S0BA 1QOSA 2DVGA 4D69A 1H9PA 5DG1A 1SEFA 4AGVA 2Y26A 4L97A 1QGLA 1RTVA 1CVNA 1S55A 4V1PA 3ZXEA 1H1MA 2X8KA 2MHFA 3WNXA 5F9TA 2EVXA 5A3LA 1C8M2 4Q4Y2 4Y1UA 5CIRA 1ZBA1 1WW7A 2NZ9A 5CFCC 5DXDA 3WQ1A 5JWPA 3M4FA 4QPIA 4MGZE 4K21A 1H1IA 4RR3C 4M0HA 2DU1A 3KT4A 1O5UA 2D93A 4XMIA 2PHFA 3RNSA 1MEC3 2R0FA 5AVPA 4BWOA 2H6BA 1R1A3 3WX5A 1J59A 1PO13 3OD0A 1C1LA 2K0GA 3NL1A 2F6BA 3LWCA 4COYA 4KL1A 1W6OA 2QJVA 1LGBA 4QQOA 3FFQA 2NPIA 1CJPA 3QCWA 4A7KA 2D3PA 5JOZA 5AC91 2ZACA 3IM0A 2DCKA 2ZTNA 1WBFA 4WV8A 3B3QE 4YW3A 2XBO3 4CDQB 4AFCA 3QOPA 3W59A 1CAWA 3ZFFA 3J8F1 3AXEA 2ZMKA 2WC2A 4CTEA 4QPIC 1IS5A 3KSCA 4NVPA 1ZA4A 1H30A 1OLQA 5FOJB 3I8TA 4ISQA 1VLNA 1C4RA 1ND3A 3K51A 1NQDA 4S2DA 4Q0QA 2XLGA 1AJKA 1W6NB 2XL7A 4Q4V2 1O3SA 4CEYA 1AR81 1KDMA 1OD5A 2WT1A 4YG0A 4YZ2A 3ZFEB 3VGIA 3NV4A 4TYSA 2CV6A 1GZ9A 3WW1A 1MZFA 1RUJ3 4K7JA 1QNYA 1OMIA 1A8DA 3FUOA 1GR3A 1UIKA 4WZFA 2D6KA 3N7MA 1MVEA 4RR3B 1QJX2 1Z7S2 3BOWA 3IPVB 3GBWA 5L36A 5L19A 1WW6A 3IT8A 3M7AA 2A7AA 3V0AB 1W0OA 2RR13 4AVCA 1HQLA 3N7JA 1G9BA 3PVNA 3LAGA 1J58A 5GLWA 2BNMA 1X33A 2O1QA 1RUI1 4BLIA 4HKWA 4Q0SA 4IEXA 2GAUA 3BPZA 1QJU1 1RUG1 4BH9A 4UW4A 1KFUL 3WG2A 3RSJA 1AL0G 3HT2A 4XBQA 5BNPA 1ND3C 1ZRFA 4QXKA 4KGGA 4YVWC 1EAH1 5FMOS 5F6KA 4LO5B 4KU8A 1S2BA 3FUQA 2D6PA 4Z07A 4LO8A 3OJBA 3AM2A 4LBQD 1CAUA 4EN8B 1LOGA 5SV8A 1A6CA 3LGRA 1FMD2 5LEKA 5T54A 4YGBA 3N36A 1ZX5A 4QD2A 2X53S 1ASJ3 1Q8QA 1V6IA 3ZYPA 1EPWA 2XUMA 4HETA 2HWB3 3ZDSA 4XTPA 5FOBB 5CFDA 2OUHA 4FCAA 2EF6A 4NN0A 2RJKA 2I45A 5KBFA 1O4ZA 3W9AA 4PIZA 3M3CA 3APBA 3HWJA 2WFF3 1D4M1 1OKQA 1GFF2 3ZFGA 2VMHA 1PM7A 4C1WA 4XHBA 4QPGA 2E7QA 2ZGUA 3O0VA 2Q1MA 2UWCA 4O9GA 3KB5A 1KXGA 1PIV3 5L7OA 1W6MA 1LOEA 2B46X 1GNHA 5HCBA 2GMEA 3GZTB 1MZEA 4AVVA 1PGL2 2HKXA 2VNOA 5A3MA 1COV3 3B00A 5AVAA 4Q1RA 2WZR3 2BTVC 2ZGPA 4WM8B 1OFSA 1QY4A 2VOXA 4PDWC 4X8PA 5JOXA 3PMSA 1ASJ1 5EYXA 2NM1A 3OCPA 2CYFA 4D7SA 1HQWA 3HBZA 1YFUA 3AX4A 2RMU2 2R043 1VB2A 4YVWB 4AFBA 3AK0A 1G9DA 3URFA 2YDEA 1IOAA 3RYKA 4RD7A 4XF3A 1AX1A 2WFF1 3M70A 3ZFGC 1V00A 4XETA 1BEV2 3VBSC 4QPGC 4A7ZA 1VR3A 1H2KA 3MLKA 3KLSA 4HSJA 3EJKA 1H9WA 4KQ7A 1RVF3 4F8AA 1ENRA 1VBE3 4CDXA 2PQQA 4YLZA 2VVFA 4XJ8A 3TN93 4Y1XA 3ZN6A 1COV1 4HKOA 4ZKTB 5JZGB 2SBAA 2RM23 4QHBA 2ZX0A 2A6YA 3RI9A 4YARA 1DZQA 1XNBA 2DCZA 1CAVB 2GH2A 3JB4C 4IETA 4PCRA 3PVBB 2R041 3N35A 3RRDA 4ES8A 4BE3A 2R072 4Q4X2 3WDUA 5DUWA 5E16A 1F8VA 1ENSA 1BKZA 1SFYA 1QWRA 1XE8A 2VOWA 3N7LA 3CO2A 4I01A 4LEJA 4E2GA 1WMFA 2JG9C 1S1AA 4PDWB 2CGNA 4ISRA 5CVRA 1GNZA 5J48A 1HRI3 3O14A 3JUUA 3SH5A 4L9BA 4Y1YA 4F3JA 1GSLA 2HEVF 4IEZA 4E4DX 1OOPA 3WCSA 4CDXC 4AVSA 4HZFA 1WLWA 2WINB 3RJ2X 2RM21 2GZWA 3AKTA 1NXMA 1A8MA 3LA2A 3WDXA 3VBOB 1JHNA 2D3RA 5BNNB 4ZU4A 3T1MA 1CAXA 1VBB2 3VBSB 1CD3G 1WBLA 4G3YC 1PGW2 1A78A 4MVTA 3WW4A 3POSA 3B7MA 1APNA 1RUH3 1GKBA 1UZZA 4G4FA 2D40A 5BNOB 1I5ZA 1Q3EA 1ZBE3 3VHPA 2PHLA 5BYNA 2VQAA 3UL2A 4UW3A 3MPPG 2R49A 2JICA 2D5FA 3VLBB 3ZXLA 3I59A 4AI1A 2YROA 1HRI1 1V9U1 2RHPA 5JIAA 3TRSB 1FPN1 5I0RA 4ZU7A 4I3GA 4LLOA 1H8VA 4RFT0 1OOPC 2O0OA 2ZGKA 4AHXA 2DV9A 4Q2FA 3LA3A 3AYAA 5A32A 2ZMLA 5JMCA 4ONUA 1HLCA 2TUNA 4CDWA 4Z2WA 1ENQA 4LBNA 5DUUA 2IFRA 2JG9B 3J9SA 4X6RB 5KXDA 3ME2A 3JZVA 4Q8LA 2V73A 5AFEA 5AFBA 3VZMA 3ZXGA 3JQWA 1S0FA 5JSRA 2TEPA 1Q8OA 2P3KA 4UW6A 2W39A 1YYNA 3M2MA 2XJTA 3H50A 4ES9A 4FPHA 4HN1A 5FCCA 1S0GA 2OZJA 1PK6A 4GH4B 2PELA 1HV0A 2ZJCA 5CADA 1AHSA 1IS6A 3DN7A 1NE4A 1ZZ6A 2HEWF 5J09A 4BM8A 2BGCA 1W6QB 1R1A2 2FBEA 4JRAA 3E5XA 4Q4W3 2G9FA 1FI2A 2XKPA 5KC6A 4Q4Y1 1Z78A 2XH6A 4RS5A 4FPLA 1BQPA 5FDBA 4URTA 5EFUA 2DVBA 4MX3A 3HMYA 2BFUS 1XYNA 3FLRA 4CDWC 1AR93 2BWCA 2XWBB 3KZ4C 3MW4A 4AGRA 4ORFA 2WT0A 4AQ6A 1DF0A 1UN1A 2NN8A 3WOGA 4DRRA 4Q0VA 2XJRA 4WM7B 4IV3A 1MS1A 2GMPA 4S2GA 1JW6A 2BW8A 4FPOB 1B35A 1RHI3 2VNGA 2MNGA 5KHGA 1VRH2 4YYOA 5ABJA 2A70A 1VBC3 1YCIA 4R9CA 1RITA 3VHOA 1DQ4A 3JU9A 4XXAA 4MXVA 3D4KA 1AJOA 1REEA 4FO9A 3P3NA 1XRUA 3TWIA 1AUYA 2LALA 4DXZA 1Y7BA 1YJKA 1DU3D 2QUOA 3AJZA 4H14A 1LR5A 1RUJ2 1WCDJ 3FLTA 3I54A 1OPMA 2RS32 3AMMA 3KS7A 4RS5C 2BBVA 1YXWA 5A33A 3NV1A 1V6KA 2X5IB 3LSEA 4QQLA 3TB0A 2WNUB 1POV0 2XHKA 2ZMNA 1N1TA 4N43C 2Q4SA 2RR12 1G9AA 2WSUA 1RC6A 3PLQA 5DUVA 3AKSA 4W6XA 4N53A 5IK4A 3V0BB 4ASLA 4Q4V1 3UKVA 4QT6A 2GH8A 2D44A 3QH7A 5A32B 2RS53 4GMP1 4J1WA 3MFAA 4AVTA 3CL1A 1BYHA 4NWVA 1PVC2 1HRV3 1V6JA 2V5YA 3U4XA 5JLVA 3SH3A 3BIWE 3WP6A 1GZCA 1QJX1 5D8AA 4D7TA 4GWNA 3AKQA 2ZGLA 3ZSEA 1QMJA 3B94A 3G6JB 2DCTA 4P9WA 4RA0A 1POV3 3WW3A 2ZBJA 3ELNA 1O91A 2B7YA 1F5JA 4FPGA 3AP6A 2IWGB 5H9RA 4FQ4A 4YVSB 1QXJA 1XU1A 2R32A 1DQ2A 2CWSA 3EQEA 4LO6B 2QVSB 2D6MA 3HT1A 5CA6A 2R6QA 4R8HA 5IK8A 3ZYIB 5LEJA 2HWB2 1H8TA 1SFNA 2HWD3 5C6CA 2GC0A 2OYZA 1XNCA 1BMV2 4I0BA 3USSA 1YNAA 4AHZA 4IEOA 4YSFA 1D0HA 1YI7A 1VBD2 1B09A 4KH9A 3CF6E 4Q29A 1HQNA 2GU9A 2ZX2A 1C1FA 2PHXA 1FMD1 2P34A 4K1ZA 3VBFB 5JCTA 4N43B 5K7PA 3DKWA 5D8AC 1RINA 3VKFC 3BB6A 4C1XA 2WWSA 4XBLA 3LSDA 1ZM1A 2CGOA 3HIFA 4FT8A 3VUOA 4JGZA 2WLPA 3PVOA 2WZR2 2Y0IA 1AZDA 3NJZA 3X29B 3AMNA 5CNAA 1U5YA 4BIOA 4D7YA 2GNBA 4C0HA 1VP6A 2DF7A 4X6QB 3R6SA 4IESA 3ZSLA 1VBA2 4BLJA 4OLLA 2WNEA 2WQ4A 4XXPA 4GB32 5J96B 3OPZA 3WY6A 4B3NA 2YV8A 4AI2A 2QCSB 5F6LB 2EXHA 2YHJA 2VH9A 4AF9A 3T2TA 2BNNA 1X7NA 5C8CA 3B02A 3S6PA 1OQDA 1UU6A 1CJDA 3AZYA 4LBQB 1RVF2 2IXHA 3D5OA 4IXLA 1RL3A 2D5HA 2YC0A 5GJ6A 1NG0A 5BNQA 1ND2C 3INAA 3TN92 2RMU1 3FLPA 1SLIA 2R062 3FC0A 4JGZC 1LHOA 5JPNB 1FOD3 2RS12 2O8QA 2WLQA 3GBFA 4A3XA 3B93A 4JDNA 3PNAA 1J1TA 4LHKA 5FBZA 4H3WA 2GMMA 1BEV1 1JUHA 2ILMA 3E6BA 4KWKA 3JCIA 1NYWA 5FTTC 1DGWX 4CDUA 3GZUC 4RSUA 3A4UA 1SBEA 3VBHA 5IUQA 1IS3A 1ZBA3 4QQPA 3ZMOA 1RMU2 1LCLA 2XWJB 2WQZC 4Z1VA 4LA2A 4YGEA 2MEV2 4LBOA 2NYYA 4BOWA 3Q9OA 5C8CC 5GALA 1ULFA 1CIWA 2JECA 2DVAA 4RL7A 1UMZA 1XYOA 2EAAA 2JE7A 4L92A 4I30A 2HWE2 5EJ3A 4ATEA 5I0TA 2H6CA 2JG8A 2DFCA 2RJLA 3FMGA 3NV3A 4JQRA 2I2SA 3WXPA 3WP5A 1RUE2 1FNZA 4K3UA 2ZX3A 1V6LA 1H4HA 4RHV2 3MLLA 1NA1A 2R071 1C3HA 2DUOA 2QDNA 1AYN2 2WFPA 3VKLA 1RUD1 1NCRC 3ILRA 2WNVB 1RUC3 4CZSA 2EXKA 2Y38A 4CDUC 5AC93 4X8NA 1N47A 4XILA 4IEUA 4FBFA 4IERA 1RUH2 3VBHC 4DPNA 4HSLA 1ND2B 1QDCA 3QD6A 5FO7B 4FTSA 3J8F3 4DQAA 1T6GC 4EN9B 4OUMA 4KGQA 3OTFA 4B4RA 4BPZA 4Y20A 4OHWA 3ST7A 1UPSA 4MXWA 1N1YA 1WMDA 4MV2A 3TNQA 2BPA2 2JX9A 3NAPA 1LOAA 2JG8C 1FT9A 3ZYGA 2PA7A 1PGW1 1G7YA 1AR83 2R16A 2VW1A 4JTNA 4CP2A 1NA1C 2GDFA 3USUB 2ZHKA 4YZ5A 2A6WA 2B45X 5K0UA 4XIKA 1RUC1 3RWNA 1UIJA 3OD4A 3LB9A 4HPKA 1MS8A 3RG0A 3R4DB 4QM8A 1ZRCA 1WMEA 3MIEA 3E97A 4SLIA 3NKTA 1MZ5A 3A0NA 1LU2A 3OYWB 5FQ0B 3WDTA 3CJIA 4Q8KA 5B2GB 4FOYA 3J4UH 1WD3A 1VJ2A 4PBPA 1K5MA 4LBKA 1RUI3 3N4MA 4DY5A 4FAHA 3KCCA 2GALA 4FOVA 1QJU3 1RUG3 4FOWA 2XVLA 3MF6A 2VVEA 1NCRB 3PJQA 3NAPC 2Z5WA 5EWSA 2FHRA 4AI0A 4KWJA 1I9RA 4AWDA 3MIGA 2JENA 3RI8A 1WW4A 1EAH3 3WR0A 2Z42A 3ZXAC 5DDJ3 3ZXDA 1DLLA 5CFCB 4LHLA 1AR92 4BHPA 1OFNA 4P5HA 3AP4A 5JOWA 1DG6A 4N7UA 3FX3A 3WW2A 5K0UC 4JDMA 5F1RA 5J36A 2VULA 1AX0A 1S0IA 4B7KA 4BA6A 3MIBA 2A6ZA 4NPRA 2E9QA 5GZEA 3CJIC 4BZ4A 4HVQA 1VBC2 4GQ7A 3ZFFC 1R081 2C0ZA 2W08A 1XNDA 3VBUA 2XLFA 1ZZ8A 1H2NA 2E51A 4OVEA 2ENRA 4M3CB 5JI9A 1NE6A 1MS5A 4BQ1A 1D4M3 1ZZBA 1CX4A 1TMF1 2WA4A 4QMAA 5GLVA 5TSWA 1AR62 3ZXKA 3N7KA 5JSOA 3GNEA 4CEYC 2VMIA 4CYDA 4YGDA 5FREA 5HBAA 5DDJ1 1YWKA 4XFFA 2ARBA 4B8EA 3D82A 2B42B 2XG3A 2OW4A 5KWRA 1VRH1 3FZ3A 2KA3A 3FE5A 3AYCA 3K48A 4J6GA 3FWEA 4YM3A 1YHFA 4QPIB 3MDPA 2YUEA 3MEPA 4IEVA 4P9GA 3U11A 3ZVXA 2HWC2 2HWF1 4W65A 1LESA 5T5JA 4I02A 5IT6A 3KM5A 4AEDA 3VZKA 1MS4A 1YRZA 3IMNA 3VBUC 3VZNA 4AG4A 2DTWA 3NWKA 2RS31 5ACA1 1J3RA 1GZWA 1TNRA 1SCRA 3QACA 4UXAA 2NQYA 1W6OB 1YLLA 2QNKA 1G9FA 1BBT1 3WHTA 4OHZA 2KM2A 1DBNA 1UCXA 3ASIA 5BNPC 4OHVA 4Q26A 1U5XA 2I07B 1ONAA 2WL1A 1JXNA 2HYKA 4Q0PA 1ZYBA 4WVWA 3QBQA 4LE4A 1PO22 4Y26A 5LK7B 1ZREA 3ZFFB 1CAWB 1AYM1 2FZ1A 4N9IA 1SQ4A 4XFIA 1D0GA 3O12A 5KC5A 4OI4A 4K20A 2D98A 3FHIB 3OY8A 4Y1VA 4N90A 1ND3B 1PVC1 3VDDA 4YGCA 4FTBA 3NVCA 4DOUA 1HX6A 3SH4A 4CEYB 5CFDC 4AEDC 4BMBA 2N7GA 3BCWA 3WG3A 3MICA 2WKKA 1D2QA 2VVDA 1SLAA 2JEMA 3AZVA 1FYUA 3VV1A 1O3RA 3WZ1A 1C8NA 2PLV2 4DZGA 2VNRA 5GZGA 5L7OC 4D94A 5KHHA 1RUF1 3E5UA 4AE2A 3DPRA 3I2DA 2WS92 5L73A 3WLUA 1DHKB 3RDIA 4R9BA 3N3HA 1BMV1 1KJLA 1KS4A 1DYPA 4O9EA 4Y4YA 3S30A 3POYA 1LOCA 1MQTA 4DS0A 1O5LA 4Y24A 5BUVA 1VBD1 4RGAA 1ULEA 5BNPB 4WVVA 3VDDC 1UKRA 2MPFA 4QU2A 1WLDA 2TBVA 4IEQA 4YZ3A 4DINB 4FP3A 4UBGA 4LO7A 1SLBA 2AENA 3WUDA 2XJUA 2VQ0A 3AYEA 5GLZA 2IC1A 4IEPA 3ZPYA 4Y1ZA 1QQP2 1CAUB 3VL9A 3AYDA 4LLFA 4HKLA 1BK1A 3AXDA 3HR9A 4Q1PA 2JKBA 4MZUA 1V9U3 3ILNA 1R092 2NMOA 1FPN3 1VBA1 3ZSJA 1N3OA 3M3QA 3AP7A 1LHVA 5CFDB 5BXXA 1AL21 1AR72 1HXS2 5BPXA 5GLUA 4GB31 1LECA 3SXWA 1MZ6A 1GZWB 1QJY2 4EN7B 3JBG1 3BU7A 2ZZQA 5EYYA 5C8WA 2V09A 4I09A 3ZFGB 4CP1A 2IXLA 4P9LA 4QPGB 1PVXA 2QDRA 5HI0A 3SHRA 3AZZA 1RJ7A 3OBRA 3WP3A 4XJWA 3UV9A 5L7OB 3GZAA 5HXVA 1W6MB 3D6EA 2UWAA 3RYPA 4I0WB 1SMVA 2GSYA 4JAAA 2BVBA 4LT5A 2R061 5JAXA 4INDA 1BCXA 3MIFA 4LBMA 3WP4A 3MGUA 3TYJA 5FRAA 2RS11 2CY6A 3RS6A 3JD72 4K40A 3MI8A 5C33A 2TNFA 3SCHA 3VL8A 2GNDA 4F7ZA 4Z8BA 5FLIA 4XFBA 4YM2A 1F9KA 4XQ4A 4AI3A 2JE9A 4GIQA 4Q4Y3 1H2LA 4RGGA 1XNKA 2IFWA 1IGOA 4A7YA 1SBFA 2G4IA 2E6VA 1RMU1 1ZZCA 3ZN5A 2A6XA 2ZGOA 2MEV1 4R9DA 4YFWA 5AC92 4B29A 3IDBB 1TME1 2ZKLA 2ZAHA 4AVAA 1D4VB 3MZHA 2HWE1 1ZRRA 1XQNA 1EV11 4ATFA 2CNAA 4JDOA 4CDXB 1RUE1 2EIGA 4B4QA 3ZN6B 4AGGA 4PF5A 1NCQA 2H0BA 4RHV1 3MW2A 3TBDA 4DRVA 3ZO0B 4HN0A 2R0HA 5T55A 1MEC2 4XJAA 1AYN1 3NKGA 1OI6A 4PJYA 5FO8B 4COVA 1FV3A 3DUIA 4PIYA 4FXKB 5C9AA 3UJOA 1PO12 1PZ9A 3KD4A 3VHNA 4C91A 5I93A 2ET1A 4GMP0 3AZWA 1C8M1 2FMDA 5HCFA 4YW1A 3B01A 1NY72 3SITA 2PHRA 4LO4B 3FJSA 3D0JA 3VZJA 3KT7A 1X82A 5HCAA 2QQPA 4RQPA 1DZTA 4COZA 2XBO2 4YZ1A 4JGYA 1G6NA 1UZYA 3VBRA 1RIRA 4FQZA 2P2KA 2VGDA 1OOPB 4Q4V3 1RUI2 1DQ5A 3AFGA 4IV1A 2XGXA 4AEMA 1FXZA 1RUG2 1PK6C 4HLTA 2ZABA 4GMP3 3LZZA 4JTOA 1DGLA 3H1MA 5I8YA 3ROUA 3VZOA 3LOIA 1CAXB 1NLRA 4P14A 5T52A 1Q8PA 2VU9A 5H9PA 3VHRA 1QJX3 4CEWA 3DV8A 3RMXA 1CR7A 4QM9A 4OULA 4EWAA 2WIIB 4OI2A 4HK8A 5C4WA 3RPQA 1OQEA 1N3PA 2E53A 1M4WA