4AEDC

Crystal structure of human enterovirus 71
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
242
structure length
242
Chain Sequence
b'GFPTEPKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRDGPWQSTMLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDTSHILQTASIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
molecule tags Virus
publication title Crystal Structure of Human Enterovirus 71.
pubmed doi rcsb
total genus 40
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4aedC00
1PVC3 1RUF3 1NCRC 2VQ0A 1ND3C 1R093 5FMOS 2X5IC 1NCQC 4CEYB 1RUI2 5L7OA 4CDXA 5K0UB 1AR83 1NOVA 1QJZA 3VBHB 4NWVA 3ZFEA 1E57A 1AR92 5A33B 1VBB2 2RR13 1HRV3 1MQTA 2DF7A 4YVWA 3J8F2 1PGW1 1X33A 2HWE1 1K5MB 1C8M2 1HQNA 2WZR2 1K5MA 1COV1 1CD3G 1ND2B 3VBHC 1NY71 4RS5A 4RFT0 1HRI3 5BNOA 1R091 1MEC2 1PGL2 1Z7S2 1EAH1 1RHI1 1AR81 2HWB1 1OPOA 3S6PA 1ND2C 1QJY1 3VBSB 1HXS2 1PIV2 4CDWA 3VBOA 1EV12 5DDJ3 2HWF3 2RS53 5C4WC 2WS93 1BMV1 2R043 1VB4A 1EAH2 1QJU1 1QJX1 4RHV1 3JB4C 3ZFFB 2FZ1A 1NA1C 2FZ2A 1NG0A 3VBSC 1AR73 1VBD2 5BNPA 4Q4W3 4SBVA 5D8AB 3NAPA 4LLFA 5CFDC 2QQPA 1QQP1 5BNNC 4Z92B 5AC92 1POV0 1PO21 3NAPB 5C4WB 3DPRC 1HRV1 1RUC2 4NWWA 1AL0G 1RUH2 1OOPA 3TN92 3J8F1 1GFF2 1WCDJ 2RS13 2X5IB 1VBB1 4YVSA 2BFUS 2HWF1 1AYM3 1RUD3 1HX6A 1F2NA 2HWC3 5AC91 4GH4B 3NAPC 3JBG1 3JD72 4Q4W2 1AR72 1FOD3 5JZGA 4JGZC 4AEDC 4N53B 1TME3 1AR71 4Q4W1 3ZXAC 1VB2A 1EAH3 5FOJB 1VAKA 1RUG2 2WS92 2RM22 4CEYA 2HWF2 5L7OB 1EV13 5DDJ2 1AR62 1FMD3 1PIV3 1RUE1 3VDDB 3M8LA 5ACA3 2RS51 1ND2A 4N53C 4GMP1 5C8CB 1V9U2 1VRH1 1ZBE1 1RUG3 1PO22 4CDUB 1RVF2 1H8TA 1TME2 4YVWB 4CEWB 2PLV1 3VDDA 3VDDC 3ZFGC 1H8TC 2XBO1 1TME1 4RHV2 1RUD2 3LOBA 2WZR3 5A32A 1C8M3 1COV2 2BFUL 2RS12 1EV11 3HAGA 4N53A 2RR11 3J8F3 3CJIB 1VBE2 4YVWC 2WFF1 3TN93 1NA1B 1FPN3 1BBT1 1B35C 1MQTC 2RR12 1VBB3 2Y26A 1QJY2 1TMF1 2HWE3 3ZFFA 4FTSA 1D4M3 1AR91 3VBOB 1RUG1 1FOD1 1RUI3 4CDXC 1R092 1OOPB 5JZGC 2PLV3 2PLV2 1PVC2 1RUF2 1NY72 1RVF1 2R042 1M06G 1R083 1VBC2 1ASJ1 2HWE2 4GH4C 5GKAC 1QJY3 4RQPB 3VBUC 4WM8C 2ZAHA 4GB33 1OOPC 5JZGB 1VBE3 1NCRB 4AEDB 1BBT3 1ZBE3 4IV3B 2BPA2 5DDJ1 4CEYC 5CFDA 4RHV3 4PDWA 1VBD1 4IV1C 4IV1A 4RQPC 2XBO3 5CFCC 4PDWC 1CJDA 1RVF3 2ZTNA 5C4WA 1PO23 3VBRB 4YVSC 2R062 4CDWC 1BBT2 1FPN1 1OHFA 1SMVA 1HXS1 4WM8A 1POV1 4WM7C 4GH4A 1AR93 3ZFGB 2RS11 4CEWA 1AR63 1AR82 4BCUA 2RM23 1R082 2IZWA 5C9AC 4JGYC 4Y4YA 5BNOC 4RS5C 1NA1A 1HRI1 1R1A2 3VBFC 2HWC2 1PO13 1BMV2 1AYM2 1W39A 1ASJ3 3ZFFC 1D4M2 1B35A 5C9AB 1PGW2 1VBE1 1IHMA 1FPN2 4FTBA 1RUJ2 1NCQB 2RMU1 1RUH3 5J98B 3ZFEC 1COV3 4EJRA 4Q4V3 5BNNB 2X5IA 1QJX3 1QJU3 1A6CA 2R072 4Q4X3 4Q4Y3 4RR3B 3ZFGA 3VBUB 5ABJC 3VBHA 4IV3C 3CJIA 1K5MC 1PO11 1C8M1 1QQP3 2RS52 1X36A 1V9U3 1RMU2 2RS31 4GMP0 1POV3 5ACA2 4JGZB 1RUE2 4RR3C 3TN91 4IV1B 1RUJ1 1AL21 1FMD2 1RUC1 5CFCB 4PDWB 5ABJB 2RM21 2R041 3IDEA 1Z7S3 4Q4V1 2WWSA 5L7OC 1NCQA 3JBG3 2BBVA 4AEDA 4JGZA 2GH8A 3FBMA 1HRI2 1FOD2 2TBVA 3JD73 4N43B 4N43A 1TMF2 2WLPA 4QPGA 1DDLA 2BUKA 2WFF2 2RMU3 5BNOB 1RUH1 1RUE3 4FTEA 4CDQA 1VBA1 1RMU3 3DPRA 1RUC3 1H8TB 4GMP3 1QQP2 2RS32 1RUD1 1VRH3 5BNNA 5D8AC 5AC93 5CFDB 1MEC1 5BNPC 3CJIC 1VBD3 3VBSA 5ABJA 2GSYA 1B35B 2XPJA 2R071 3ZFEB 1BEV3 1C8NA 4Q4V2 1V9U1 1VRH2 3VBRA 2RS33 1PIV1 3VBOC 5J96B 4CDXB 1AL22 2MEV1 1RUJ3 1HXS3 2RMU2 2WFF3 4QPIA 2HWD3 1RMU1 1VBA3 5K0UC 1TMF3 1Z7S1 1ASJ2 1D4M1 1PO12 1VBC1 4CDUA 5C8CA 1AYN3 1ZBA3 3VBFA 1R1A3 1MEC3 4CDQB 1PVC1 1RUF1 3JD71 3JBG2 5LK7B 4JGYA 5C9AA 5C8CC 2WZR1 4CDUC 5D8AA 5A32B 2ZZQA 1R081 5K0UA 4CEWC 4QPIC 4CDQC 4WM7A 5FMOL 4FSJA 2MEV3 3JB8A 2MEV2 1HRV2 2R063 4N43C 3VBRC 1RUI1 1AYM1 2HWC1 1AUYA 4CDWB 4Q4X1 1R1A1 4Q4Y1 4YVSB 1F8VA 4QPIB 1ND3A 5CFCA 1NCRA 2XBO2 4RQPA 4Q4X2 4Q4Y2 2R073 5A33A 1BEV1 4QPGB 1QJX2 1QJU2 1MQTB 4WM7B 1AYN2 1ZBA2 1VBA2 2HWD2 5BNPB 1ZBE2 4Y5Z0 1RHI3 4GB31 1FMD1 2HWB3 1ND3B 4JGYB 4RR3A 4GB32 1RB8G 2HWD1 2HWB2 1AL23 3VBUA 5ACA1 1RHI2 4RS5B 4QPGC 2R061 1VBC3 1PGL1 1AYN1 1ZBA1 1AR61 3VBFB 3DPRB 1BEV2 4IV3A 2WS91 4WM8B
chains in the Genus database with same CATH superfamily
1ODMA 2YBKA 3NNLA 4ITCA 4NHMA 2D98A 2CY6A 2WT2A 3MLLA 3DXUA 2ZEZA 4XHBA 4EE2A 3BGAA 5KR7A 4I01A 1LOFA 1W0PA 4CDXA 5EHDA 1OKOA 3SISA 4KG8A 2XJQA 5AVPA 1I5PA 5KBFA 1QJZA 4HN0A 2NPIA 4NWVA 3VBHB 4GWMA 2Q8EA 4QQOA 4ZU7A 4LBQB 1LNSA 4NN0A 1WW4A 3A23A 1PMJX 2DWRA 3M4FA 5JIAA 1DFQA 4CUBA 1LEDA 1X33A 2W2IA 2DUQA 2XOMA 1K5MB 4BQ2A 4XBLA 1HQNA 1YQ2A 2WZR2 3AMPA 5FZ9A 4YGDA 1K5MA 1O5UA 1QNWA 1COV1 4LO5B 4MX3A 4S2HA 3T2PA 1Z78A 1IQAA 5T5JA 1NY71 4HK9A 4YZ4A 3N9PA 2EXIA 3ZSLA 5CA6A 1JU4A 2VCBA 2EIGA 3LEMA 3I8TA 3KM5A 4AEJA 5BNOA 4UWDA 4W65A 1R091 1VR3A 2UY9A 1ULFA 3S7EA 3WDTA 5A3MA 4O65A 1HQWA 1IPJA 1UU6A 2WO1A 1V6IA 1Z7S2 3WR0A 5FZIA 2H0VA 1JOPA 5EJ1B 3GGLA 4XE9A 4YW2A 4BK4A 1XE0A 2GP3A 2IVIB 4W50A 3TNPB 2EAAA 3ATGA 3O5SA 4ZU5A 1CESA 1ULEA 1QJY1 4LO7A 2EXHA 5GJ6A 4RN5A 3VBSB 2ZGUA 5K7PA 2WFPA 2D7FA 1TE1B 3ACFA 2D93A 1W0NA 1ENRA 1JYXA 2UU8A 2WS93 4PIYA 3VZLA 2QNKA 3QH7A 2R043 4D6SA 1BMV1 1EAH2 1QJU1 1LHOA 2LTNA 3ES4A 4AFAA 4RHV1 4YZ1A 2ZX2A 5HPOA 5JAXA 3ZXFA 4LBQD 2AH2A 4OCTA 5FPXA 1H9WA 2ARAA 3ACLA 1AR73 4DUXA 2VTFA 5K9YA 1RXGA 3MYXA 1W8OA 2ZCWA 5SV8A 3WLUA 4QM8A 1ZZ7A 4B3NA 2QQPA 1CONA 3B7MA 2HBUA 2IFWA 5D8AB 1QQP1 2XJPA 4FQ4A 1FT9A 4LBNA 3KS7A 5C4WB 4A42A 3AK0A 1W9SA 4JKKA 1X50A 4XJAA 1GQPA 4K1YA 1EUUA 3B9IA 4WVMA 4HK8A 1GWLA 2PHDA 1LECA 3WINE 1YRZA 3OOXA 1ZRRA 4IGQA 1U5IA 2OVUA 3FHAA 4Y20B 5J09A 1XSQA 1VBB1 1GYKA 1YFWA 5FKBA 3UK9A 5JOXA 1F4AA 2HWF1 4V2WA 3BALA 4GH4B 4MGTA 2WZPP 3JD72 3DL3A 1LTEA 4MVTA 5DZEA 1CAXA 4UAPA 2C5DA 2ZGNA 3HOBA 2WWJA 4GWJA 5F9TA 1OSGA 2P5BA 4JGZC 4UI9L 4URTA 2R1BA 1TME3 3T2QA 2MHFA 3FWEA 2JG9C 3ZXAC 3OEBA 4L11A 4YWAA 1JZ3A 1RUG2 4MGZE 2RM22 4LKEA 3HN3A 4CEYA 5DDJ2 3IBMA 5L7OB 2VVFA 3WQ7A 4HPKB 2ZGKA 1RUE1 4LHSA 4BWOA 3VDDB 2FDIA 2DBNA 2H0BA 3I97A 3WF2A 4E8DA 1ULPA 3FMGA 5L9RA 4FQZA 5ACA3 1MVEA 4QDQA 2HLEA 2VZOA 1DP0A 4LO8A 1V9U2 4QX1A 3ZN6B 3ZYGA 5F3CA 1UNBA 5FIXA 1N1VA 3PUAA 1UL9A 4I02A 4CDUB 3FFQA 3KZ4C 1V70A 1WKYA 1RVF2 1ULCA 3MUZ1 3B9CA 5T54A 1TME2 1RTVA 4CEWB 3ZIXA 2WRAA 2WNUC 2WNUA 3P3NA 2FBEA 2JIJA 1SLAA 2DYCA 2VH9A 2VMIA 2X09A 5A7WA 4XQ4A 2DTWA 1HB3A 4RHV2 3LOBA 1G86A 1OA2A 3VHNA 4A7YA 1COV2 3O0XA 4EV0A 3SLIA 1ZZBA 3MIEA 4N53A 1OD5A 4D3WA 2RR11 3CJIB 1OUXA 2E63A 3OG2A 4PLNA 2QQMA 2WFF1 3ORJA 1GOHA 1UX7A 1YYNA 3RJRA 3N35A 1LGBA 1MS5A 1MQTC 1BVP1 1VBB3 2Y26A 1QJY2 3ZSEA 3J4UH 4DXTA 2HWE3 2DVBA 4QDRA 3K4AA 1AR91 2J42A 1PZ9A 2YU2A 5FYUA 2VXRA 1VMJA 3KHBA 1I3HA 4QKFA 2NN8A 1SPPA 3V0BA 5LA1A 5I0RA 2PLV2 2E7AA 3GBWA 3N9LA 1W2UA 2JG8A 1UKGA 3A22A 2OA2A 1NY72 3ILNA 4HLTA 3ZMOA 2D44A 2YBSA 1JYTA 3OGGA 2D5FA 5EYYA 1UYXA 3URFA 1OH4A 1FYUA 4Q0QA 4LEJA 2J1RA 1W8ZA 1W99A 4NVPA 5J48A 3O1OA 1DGLA 2FCUA 1EUTA 2KA3A 4PCRA 3N7KA 2VULA 3VBUC 2NYYA 4GJYA 1O59A 3BTXA 4RGAA 2ZGOA 4WZCA 4AEDB 3OBTA 4XUPA 1SPPB 1AJOA 4D8MA 1DGWX 3J9SA 4OI2A 5FJHA 5CISA 3MFCA 3AB0A 2VGDA 3AFGA 2KD7A 2YPJA 2QQJA 4I30A 1VBD1 2QQNA 2A5ZA 1N1TA 4Y20A 1XXNA 4BOWA 5A6QA 1JODA 2PHRA 1VPHA 4ISQA 3ZX7A 2DUPA 1QOSA 1E5HA 4DRRA 2YV8A 4PDWC 3THDA 4JX0A 5DUVA 2VU9A 4O61A 4LKDA 4CVUA 5CG9A 1F5JA 1RVF3 1SFYA 2DVGA 2ZEXA 3MIHA 4GAZA 4BPZA 2WZ8A 5CEHA 2C0ZA 2C9KA 1YFUA 5H9QA 4YVSC 4QQ2A 4XYXA 2OPWA 5EV7A 4AVBA 1HB4A 4CDWC 3L2HA 1SMVA 3B69A 1HXS1 4L2NA 5CNAA 3T2TA 3VDAA 2UYBA 4G9SB 2VCAA 1GANA 5AFBA 1AR93 3ZFGB 4B1MA 4Y1UA 2RS11 4JKMA 3JQXA 4XAEA 2C1FA 5JXHA 4NHLA 4CEWA 4BCUA 3KGLA 4YM2A 4TLGA 4A7ZA 2VOTA 4LBMA 1RC6A 3VV1A 5EP9A 1A3KA 4AEMA 1W8HA 4JGYC 4GIQA 4Y4YA 1C1FA 3LKJA 4FP2A 5LWBA 3J7MA 3ELNA 4MO3M 1JHJA 3AMQA 2BV4A 1XPWA 2W1UA 3I2FA 1NA1A 2VUCA 2Q30A 3MFAA 4OHWA 2VQUA 5ANQA 1UAIA 1PHMA 5FXXA 3VB9A 1R1A2 4A6OA 4ZHNA 1ZRCA 3WX5A 1RITA 2HWC2 3EJKA 3ZYRA 4LHLA 1OLQA 4HETA 3AJYA 4EROA 1UZZA 4O9GA 4OUEA 2DCYA 1GQGA 3OCPA 2JDKA 1KITA 3WNXA 2BOJA 1ZREA 2DCKA 5C9AB 1FV3A 5A7WB 1XBFA 1UMHA 3P1IA 1RUJ2 3BN6A 3K75B 5ISLA 3C7EA 2RMU1 3LDRA 4GKXA 5EIYB 2I2SA 4XEZA 3KVAA 3ZFEC 3IPVB 4IEXA 1YUDA 3MPPG 2F4LA 3EHKA 3DYMA 1IS5A 4FP3A 3J7LA 5FYZA 1CX1A 2P3JA 4EJRA 4Q4V3 1W03A 5BNNB 5KXDA 2HYXA 2UY8A 4ZKTB 1QJU3 3ILFA 1A6CA 3NV1A 4P9XA 4K8RB 4Q4X3 2I07B 1MZ5A 3GM8A 5KHHA 1MS9A 3A4UA 3LZZA 1LHUA 2XGXA 1UZVA 5ABJC 4R52A 3W21A 3LGRA 4IV3C 5D1IA 3AP4A 2XH6A 1S0IA 5LBBA 4AI1A 4AHYA 1PO11 1QQP3 1SLCA 1X36A 1DLLA 1DHKB 2A3XA 1W6PB 4B4RA 4ES9A 2VUDA 4AFMA 4YW6A 3LIHA 1RUE2 2VXJA 3C7GA 4OVEA 4CYDA 4YNIA 1VRBA 2QTWB 4PQ9A 5CKQA 2K46A 3VUOA 3B93A 2R0HA 3OPWA 4FXKB 1OVPA 1BQPA 2KXLA 1US2A 5H9RA 1LOFC 3MV11 4KWLA 5L7OC 3W5MA 1ZRIA 1BLZA 4JGZA 4QX8A 3LDBA 1O91A 2CNAA 3MDPA 3CNAA 5ANNA 3AYDA 4Q27A 1MVQA 5GZFA 5LY2A 4J1WA 4Y1XA 3WDWA 2TEPA 4JZRA 1QXJA 4E4DX 1VMHA 4N43A 1ALYA 4E2SA 4XMAA 2WLPA 3E6BA 4Y24A 2VNGA 1ZRFA 1XNCA 1NLSA 1GU3A 5C71A 1VJ2A 5I0TA 3ZPOA 2VNOA 2RMU3 5LEKA 1RUE3 1Q3EA 3POEA 4Q2FA 3MZHA 4IEOA 1DZTA 1GOFA 4AVAA 4BLJA 4GWNA 5APAA 1CQ9A 5A7OA 3DPRA 4CCJA 1RUC3 4ES8A 1Y9QA 3MIDA 2EA7A 3N9QA 5FLJA 5JMOA 2B4KA 3UJQA 1BXHA 1RGSA 1S2KA 3SNMA 5AC93 3S57A 1G8WA 1LOBA 2GNBA 3IDCB 5EYXA 3RZZA 1MEC1 3QBQA 5BNPC 3GJAA 4JRLA 1HJFA 4BJ0A 5GZGA 3NNGA 1TVGA 1DQ6A 1QXRA 5A1AA 4M00A 2OQ7A 5I0SA 5T55A 2ZJCA 3HJRA 3M3OA 5E89A 2AC1A 1S4CA 3RWNA 1GP4A 3OSDA 4Q4V2 4YZ2A 1GBGA 5A6ZA 4QQPA 3VBRA 3UESA 2A6YA 2PMWB 3I3QA 4CCOA 2WC2A 4FOWA 4JRAA 3ZR5A 1AL22 4CDXB 3RSJA 2QQWA 5FMDA 1DIWA 4Y1YA 2WFF3 2RDRA 4XTMA 4QPIA 4HSLA 3WG2A 1W6NB 1APNA 4XABA 4CDUA 2ZEWA 2D5HA 3USUB 3VKOA 1R1A3 3PU8A 4XIKA 3AKRA 1JYNA 4LULA 3TAYA 5FZEA 4EWAA 2WQZC 1PVC1 1FXZA 2B8MA 3AMHA 1S0GA 1Y9MA 3BTAA 3ROUA 1AVBA 4LORA 3B02A 4A3XA 2ZHKA 1JYWA 1YXWA 4XUTA 5A3TA 2VVDA 2W5FA 5D8AA 3HNBM 3BOWA 4NHXA 4R8HA 3IDBB 2PELA 4FPFA 1GUIA 2VZTA 4EN7B 2IVJA 4PF1A 2Z69A 4CDQC 2QQIA 4Q29A 1JS9A 3WP4A 2PFWA 4O7XA 4LO4B 4QAWA 2MEV3 3JB8A 4ZPIA 2ERFA 1UY0A 1IS3A 5C33A 1YHFA 2H6CA 1O4YA 2XUMA 4XILA 5CZKA 1GSLA 2NZ9A 5C7GA 1KDMA 2VJXA 3C7OA 3OGVA 2VO5A 1PZ8A 4DQAA 3BPZA 3H3UA 4Q4Y1 4QPIB 1ND3A 4DO0A 1QGLA 3BB6A 4RQPA 2VOWA 3MGUA 3FL7A 2D6PA 3J26N 2PHUA 1H4GA 2QVSB 2YHJA 5I0DA 1ZBA2 3POSA 4E27A 3BTYA 5L9BA 3T4HB 1V6MA 5LASA 2DV9A 1XYNA 1VBA2 4Q1PA 2HWD2 4M3CA 5FXWA 1DBNA 4C0HA 1RHI3 2XJSA 1FMD1 1PMIA 2ZXQA 2BQPA 3BIEA 1GZWA 4JGYB 2UWBA 2VW2A 4RR3A 4TLFA 3R05A 5F7UA 2HWB2 1PK6A 1UY1A 1RHI2 1UN1A 3EYPA 1WMFA 4M0NA 4QPGC 1WCKA 2R061 1UX6A 3ON7A 3TEZA 5C5TA 1PGL1 3B94A 3SITA 4PQQA 1YWKA 2WQ8A 2A71A 1RUNA 1BEV2 1ZZ8A 2YY1A 3HEIA 5A3LA 4WM8B 4K6BA 1PVC3 3HIFA 2BEOA 1T2XA 1NCRC 1W2NA 5CAZA 1ND3C 3RZJA 4X8NA 3U4XA 2C9AA 2V4AA 3LF7A 3ZSKA 3NW4A 5CKNA 5CG8A 2VL4A 1NCQC 4CEYB 1RUI2 3I3DA 5A3UA 5L7OA 3KGZA 3V65A 2GN3A 3VKFC 3NWKA 4AK3A 5K0UB 4XPVA 4PT6A 1AR83 1OXCA 2GMPA 1E57A 5DAQA 1VALA 2W52A 1UY2A 3VKLA 5KC5A 4IEPA 5BNQA 4BYYA 5JDBA 5FXZA 1SLIA 4JQTA 3FN9A 4M3CF 2EXKA 2AGSA 3SCFA 3OB8A 5FK7A 2VQTA 4JC1A 1JXNA 4H3WA 3ZR6A 3KMHA 2C4XA 3MW4A 3X29B 1GZTA 4QU2A 5IVEA 3NVCA 2Z4FA 4LMFA 2D6KA 1XE7A 3SHRA 3RZHA 4BH9A 5FPUA 5C3OA 4URAA 4Y5TA 2J1EA 3HD8B 5F39A 4CU6A 1PGL2 5A7PA 3U11A 4AXOA 4BQ1A 2YB7A 3KT7A 5FPVA 3FX3A 1RHI1 2YMZA 4IW3A 4CP1A 4ZONA 1S0CA 4XF1A 4IE0A 2CAUA 1OPOA 5FPBA 4P02B 1ND2C 5IHRA 4QB2A 1ZA4A 3RGBA 4H55A 3PUHA 3POWA 1HXS2 5FP8A 3POIA 3THCA 2XQRA 5EQUA 3O0VA 4TSVA 2VNRA 3K3NA 4B7KA 2V73A 5DDJ3 1D0GA 4MHUA 2RS53 5DUXA 3MO4A 2ZGQA 2NM1A 5BXXA 1DCSA 4ZXKA 1DGRN 2XR4A 3N7LA 3ZXDA 3JB4C 4QHZA 4XUNA 5JOWA 1PZ7A 2R0FA 2D6LX 3GZTB 3AMMA 5TSWA 3PUQA 4XJWA 1NG0A 5IVVA 1MS0A 3ZKUA 1LOCA 5A1FA 2QQLA 3GF6A 1WBFA 3HVDA 3PVEA 4M3CB 3K51A 4Q4W3 4SBVA 5EPAA 3NAPA 5FP3A 4ZY9A 1HDKA 3RG0A 4AE2A 5FYIA 1POV0 1PO21 3NAPB 2YXSA 4LOSA 3PIGA 5LBEA 3SC7X 1AL0G 2B9VA 2J7MA 3EO6A 4YPJA 4XXAA 3AP5A 4Q26A 5IATA 3AX4A 4LKFA 4D6RA 1XU1A 1DZRA 3AC0A 3AVSA 4LT5A 2WNOA 4AYUA 1SBEA 2FMYA 3D4KA 5E8AA 4YM3A 3FJSA 3LEGA 1H6YA 1AYM3 4GALA 4RGGA 1HX6A 4Z2WA 5AC91 1FNZA 2YZ4A 1LKNA 4NROA 2YC0A 4CU8A 5JZGA 1UZYA 4XTPA 5KXCA 2EVXA 3RI9A 4FFIA 4N53B 4L9BA 2GZWA 4AEDC 5KXEA 5H9SA 2VZUA 3RMXA 1F9KA 2V4VA 1AR71 4BE3A 2XMLA 2Q8OA 3ZN4A 3WW4A 4BQ3A 5L73A 5FOJB 2YC2A 4AI9A 5IFPA 4S2GA 4HKOA 4NR1A 5T3NA 1AR62 2R16A 3HWJA 4HL0A 3RRDA 1CGPA 2B7YA 3LFIA 5FZ8A 3POJA 2YGMA 1BK0A 1Y43B 4AF9A 4IEWA 5CYYA 3ZDVA 3M8LA 2PQSA 4P9YA 2O8OA 2IXLA 5F6KA 2PAKA 3QACA 3Q8CA 2RS51 2WA3A 2VM9A 4GMP1 4BK5A 2VMGA 4UBGA 1VRH1 2W1SA 2YGLA 4OHYA 4QX0A 5FQ0B 1UKRA 5FZGA 1PO22 4Z82A 3WDUA 4L0PA 3PTRB 3M7AA 5J1XA 1AX2A 4J1XA 5HV0A 1H8TA 1N3OA 2LUWA 3K4ZA 5F1RA 3BU7A 2YU1A 1KQRA 2PLV1 3M2MA 3VD5A 1FV2A 1W6QA 5JLVA 3ZFGC 1ONAA 2ZZJA 3WNNA 3PMSA 1AXKA 3EBRA 1TME1 3PURA 4LBOA 4COZA 1RJ7A 1RUD2 3ZDSA 3BPSA 1C8M3 5L9VA 2BFUL 2PXJA 3POGA 4XBQA 2W9XA 5FYYA 3O14A 4K1ZA 2OIIA 2J1VA 5E88A 3TN93 3H50A 3BYWA 3AYCA 2P1BA 1BBT1 5C3PA 1B35C 2RR12 1BKZA 4COUA 4WVZA 4M3CE 5JXIA 2ZA9A 3ZFFA 3OYWA 2R32A 4UFKA 4LK6A 4PJYA 1C3HA 1JU3A 1UU5A 3VBOB 3SEPA 1V6LA 2JG9A 4LBLA 4CCLA 2O14A 3OD0A 2PAMA 2VTXA 1KFUL 3TYJA 2LALA 2VBDA 1OOPB 2AYHA 3I2IA 4E2GA 2XB6C 1LJ7A 1J59A 4PI2A 2ZX0A 4E4ZA 3ZIWA 5A3WA 2BRTA 1QF3A 1XB9A 5FZOA 2ZMLA 4BQYA 1H6XA 1GNHA 1YC61 3D8CA 4I3PA 4XCAA 3N4MA 1ASJ1 3Q8FA 3FFZA 2DFCA 1YQ6A 5EJ3A 1O4TA 4RQPB 4WM8C 3VHOA 4BQWA 4Z2AA 1UOGA 5CFCB 2ZX1A 1S0DA 4MXWB 1NCRB 5AFEA 3ZSJA 3NO8A 4JHTA 3E5XA 3UGGA 1ODNA 4TYSA 3VDCA 2BPA2 2GMMA 4W4ZA 4OHZA 5FCCA 5FP7A 4XXPA 2NMOA 5CFDA 3C8XA 3CL1A 4G3YC 1KS5A 2HBTA 2BBAA 3USSA 2WNVA 1DGRA 2X53S 2BERA 4QMAA 3OYWB 1MZEA 3OGJA 2YFZA 4YLZA 2ZS6B 5E6HA 3QCWA 3H7YA 5GLVA 4S2FA 1K12A 3TWIA 1JTZX 3D6EA 4NRPA 3INAA 4DXZA 3LIGA 3T0DA 2DU1A 1MPXA 4BHPA 4EN6B 4Q0VA 2BP6A 3TEXA 4I0WB 2XVGA 2XHKA 1I6XA 1WW6A 4P08A 1WMDA 3VBRB 3ZYJB 1BBT2 1REEA 2Y6LA 3RPQA 1W28A 5I8SA 2OS2A 4NOTA 2Q0AA 2ZMNA 4NIHA 3MW3A 5DN2A 4IDZA 4EN8B 3M3QA 3H1WA 5DZFA 2WL1A 1Y4WA 2WKKA 4QB1A 3VZJA 4CA9A 1W8FA 1AR63 3VN4A 2J1AA 3NKTA 2VMEA 4IGOA 1R082 4MADA 1QU0A 2IZWA 4QX2A 1W2OA 3LEIA 4UOJA 3FUQA 4EQVA 2O8QA 3LD8A 2BOIA 5IW0A 4LUKA 5FYCA 4YFZA 3NJYA 1OH3A 2PHLA 4KL1A 4XFAA 4DMIA 1ZYBA 2IUWA 4HKWA 5FO8B 4A4AA 4HPKA 1WA6X 3G7DA 4DIQA 4MH0E 3RI8A 1LOGA 3VBFC 2AREA 1AYM2 1UD1A 1ASJ3 2XJRA 1O6UA 1QDOA 2VOXA 1GR3A 1IGOA 3MEPA 4I0BA 4PLOA 4DEVA 4FPJA 5FWJA 3W5NA 4AWDA 3GJBA 2XUEA 2SBAA 1N1YA 3LEKA 1FPN2 3H42B 5FZCA 3ZYHA 3F95A 4AHXA 4XACA 3WW1A 4DY3A 5FK8A 5FY9A 3U07A 1HV0A 3UJOA 1W9TA 1OI6A 1REDA 5CB7A 1AJKA 3IPVA 1K42A 3I3BA 5FZ4A 3LA7A 4IE5A 4X6RB 2ET7A 1TNRA 1BYHA 5CBLA 5JR2A 3S5AA 1CPNA 2BZDA 3K3OA 1IS4A 1RINA 1WCQA 4Y5SA 1QOOA 2W46A 1PK6B 2GC2A 2XJTA 1N47A 1W90A 2JICA 5LEJA 4J25A 3AKSA 1A8DA 4CPBD 3CJIA 2E7TA 3K77A 5LBFA 1CAWB 1K5MC 2FMDA 3ECQA 5A6YA 1LEMA 4XJZA 2RS52 1IG0A 1V9U3 4A41A 4F7ZA 1RMU2 5C8WA 5DAWA 5FZ6A 2XHNA 4XW3A 1OF3A 3QOPA 5A6XA 4H7MA 1YIPA 2BWAA 5C3SA 5LW9A 1XSRA 3DYOA 4XJUA 1AL21 5FY0A 3ES1A 3RYPA 5ABJB 1JYIA 3H1YA 1HJGA 5FXVA 4WVWA 1KD7A 3IDEA 4XDPA 5GZCA 2A75A 5E1RA 2YYOA 3POFA 4Q4V1 3MF6A 4FAGA 3ZO0B 5EFUA 1M4WA 5FZDA 3SQOA 2NLRA 1FAYA 2C6SA 4GULA 2P34A 1Q56A 2QQOA 3WCRA 2GH8A 4BM8A 3FBMA 1GV9A 2JXAA 1H2LA 3E5QA 4IE7A 2TNFA 4QPWA 1GWKA 1PM7A 2D3RA 2Y6FA 1D7PM 3GBGA 3IB3A 2PHWA 3JD73 3TB0A 1UQXA 2GC1A 5FAXA 3ZYFA 1ZA7A 1IKQA 3DYPA 4KMQA 3VGIA 4Y1ZA 4NPMA 4CE8A 4WZFA 3BI3A 1YQ8A 4FVVA 3WHUA 4IERA 5JI7A 2Y6JA 4KBZA 2QBXA 4P00B 1XE8A 2VOVA 4HOOA 1SQ4A 4M4PA 5LA2A 5FR3A 4INDA 4KWJA 3I2DA 3NV3A 4P9IA 4BMEA 5BNOB 5BYNA 4YFWA 4UF0B 2CL2A 5LA0A 1LHNA 5FLHA 1RMU3 1ZM1A 1XU2A 2RVAA 2RS32 4GMP3 3ETQA 4PHZA 3RVHA 1VRH3 1JZ4A 5FMCA 2OXBA 5D8AC 1D4VB 1XYPA 3WVJA 2VD7A 3SH3A 3NKGA 1JUHA 3CJIC 4LR4A 1JN2P 4KWUA 3DKQA 3HQUA 3ZYPA 2B9UA 3KSCA 3VBSA 1IS6A 5ABJA 5HXMA 4CUGA 4B4PA 5FKCA 2J1SA 5LZ6A 1OKQA 4BIFA 2Y0IA 5IK7A 2NMNA 3BODA 1B35B 2EALA 2PHFA 3AMNA 2XPJA 1LU2A 2ZHMA 5FUNA 1C8NA 3DECA 1V9U1 2Y6GA 4FO9A 4AI8A 1CAUA 1WD3A 3OUHA 3RYKA 4E2QA 1PNGA 5CU1A 2WSVA 3OGSA 3U10A 3TEYA 4H2AA 4R9DA 4QDSA 1MS1A 2HWD3 3ZYBA 3N7MA 1HIXA 1SFPA 4WVVA 4IEVA 1PO12 5F2WA 3ZOIA 3WP5A 1VE0A 4AQTA 1MEC3 2VUJA 5FZ0A 4CXXA 1L7RA 1YQCA 3WXPA 2CYFA 3LWCA 1DYKA 3H9AA 4FPKA 1RUF1 2WR9A 3T3YA 1A34A 3JD71 4HN1A 1O3QA 4PF5A 3BUCA 5LATA 4JGYA 3UV9A 1BZWA 2OQ6A 5LA9A 3W9AA 2D6MA 3H7JA 4I09A 5FUPA 4Y33A 2G9FA 2ZZQA 5K0UA 5GLTA 3SEEA 3CIHA 4J6GA 1SEFA 1YLLA 1UIKA 4K40A 4Q0UA 2JEMA 2JDPA 4FI9A 2O1QA 2MEV2 1X82A 3GCWA 3USUA 2DURA 3HQRA 1HRV2 3MHZA 4R9AA 1O3TA 2W94A 2A6VA 5IAXA 3IIAA 1DQ4A 3E5UA 4OMCA 1RUI1 1LOEA 5FUIA 1AUYA 3ZVXA 4BXFA 4C1XA 2QDRA 1R1A1 4DB5A 2XKPA 3GHMA 4YVSB 1F8VA 3V64A 3G6JB 1I1EA 2D6OX 2A6ZA 3QLQA 4A7KA 5CFCA 2BU9A 3WW3A 3NJZA 4YW5A 4Q4Y2 1Z0HA 1QJX2 4CP9B 1MQTB 3WF4A 4FOQA 1JBCA 2CHHA 2EXJA 3POBA 5IVFA 5KWRA 3U4SA 2X10A 1B09A 2XDVA 1WCUA 3WF0A 4AZZA 4XETA 3P3PA 3AZXA 1ZBE2 3V56A 2IXIA 5FY1A 1OUSA 2CDPA 2E6VA 4OHVA 3POYA 4GB32 1RB8G 2HWD1 1E5IA 4KGQA 3VBUA 5ACA1 3GCXA 5JSOA 2GAUA 1X9PA 3HNYM 5B2GB 3KCYA 5DQ0A 2G9GA 1TEIA 4XJ9A 2JD4A 4YGBA 1AR61 3VBFB 3WDVA 2Y6HA 1W8TA 1MACA 4XQWA 3H3LA 4NAOA 2AR6A 1K45A 1RUF3 4ZS2A 4CZSA 2JG8C 4XHXA 2DUOA 4AFDA 4BQXA 5JVVA 4UT5A 3DGTA 4XJ8A 4GJZA 1W8NA 2F4PA 4JTOA 4K8FA 5KHKA 3VZMA 3WG3A 3N9OA 1GP5A 1TNFA 1UMZA 1HB2A 2ADDA 4L8QA 2VBBA 5JWPA 1NOVA 2HJIA 1LAJA 2JDZA 3ZFEA 2XQXA 3AZVA 1AR92 3UGFA 2FDJA 4KQ7A 5FBJA 2RR13 1HRV3 5FP9A 2X05A 3N3HA 1MQTA 2P3YA 2Z5WA 4DINB 1UYPA 1YQ5A 2VTXJ 1WBLA 1IOAA 4YVWA 3J8F2 1C28A 1PGW1 2ZGPA 3PLQA 4I0AA 4PIXA 2HWE1 3HN1A 4C8DA 1Y7BA 1C8M2 5JMCA 4GKYA 2G4IA 5FZBA 1DG6A 4MGYE 2R6QA 4R9BA 1DU3D 4LBJA 3PVOA 1OVSA 3VBHC 3HNMA 3IWZA 2VCCA 2JJ6A 4HXCA 4NO4A 4RFT0 4MXWA 5H9PA 2GNTA 3NMBA 2P3KA 3FC0A 4KU8A 1HRI3 3ZMNA 2A6XA 1EPWA 4MUVA 3GHNA 2FQPA 1OMIA 2R1DA 1MEC2 5EWSA 5JXGA 4FPEA 3PNAA 2RG4A 3QD6A 3WDYA 3ALQA 2RHPA 3ITQA 1AR81 1UYYA 2E9QA 4TWTA 3S6PA 3O1MA 2A3WA 3I4IA 1GLHA 1O8PA 3DCQA 2VMHA 4DXRA 1PIV2 4CDWA 1QNYA 2VC9A 4FPYA 2OKXA 4QKDA 1PMHX 2ATFA 4N7UA 2CGOA 5FYTA 1R1ZA 2IC1A 3TEWA 3GZAA 5C4WC 2QZ3A 3JZVA 1CIWA 5FPAA 1QJX1 1US3A 4AI3A 3WNLA 1S0EA 2CGNA 3D5OA 3ZFFB 3UETA 5FWEA 3UL2A 3NQHA 4Y26A 3VKNA 1LODA 3B00A 5FYBA 3VBSC 3KVBA 2DCJA 2WO3A 3OTFA 4CU9A 5J36A 2R7EB 1S2EA 2B46X 4ASKA 4LLFA 5CFDC 5I91A 5IVJA 2OZJA 1POQA 3WF3A 1SLBA 4PIZA 4FOYA 3K2OA 5IVBA 1UZ0A 1HRV1 3DPRC 5DAPA 5I0UA 4IE6A 1F5FA 1C4RA 2CSGA 1BCXA 1DYOA 1O7FA 2UWCA 3HT1A 1RUH2 4Q8LA 1HV1A 1OOPA 4JDMA 4U2AA 2EF6A 3R4UA 5IUQA 2A3YA 4MHRA 1WCDJ 5KXBA 2RS13 2X5IB 5C6CA 3GBFA 1JOJA 2AZ5A 2BFUS 3H1MA 3T08A 2E53A 4NRMA 1Q8SA 1F2NA 1H2NA 1V0AA 2HWC3 3KB5A 2AUYA 3JBG1 4Q4W2 3K4DA 1FOD3 4YZ5A 3LCPA 5BY5A 1WD4A 2ZAAA 1FNYA 5FMBA 4BZ4A 4WVMB 2GC3A 4MGKE 5FYHA 5A7SA 3CQOA 1CAVA 2W1QA 1F31A 3R4SA 2P37A 1KJLA 2WSUA 4OHXA 2BVBA 4Q4W1 4MYEA 3E97A 1YIFA 2W08A 3IM0A 4UW6A 4XFHA 1MR5A 3CKHA 4JVAA 2LRPA 2A1XA 3AYEA 1VAVA 3OD4A 5JUVA 2HWF2 1EV13 1PGSA 4S2DA 2E51A 5HCAA 2QZ2A 4H7LA 2OUJA 3W59A 2VVEA 3S7IA 3FLPA 4N53C 5C8CB 1TQ5A 1ZZCA 2A7AA 1AHSA 3MV01 4CXWA 1SBDA 1RUG3 5LK5A 1UMIA 3MPBA 3KF5A 5T5PA 1UW8A 5J7MA 1CZTA 3LPFA 3D3AA 4YVWB 4XVHA 2WNEA 1JZ5A 2A6WA 2PHXA 2VG9A 4YGEA 1DGWA 3VDDC 1LOAA 4LTAA 3MLKA 3FBYA 1H1AA 2XONA 1H8TC 2VZSA 4XFCA 3JU9A 1C5IA 3AZYA 4Q0PA 4MGQA 1OC1A 1OQ1A 1XC6A 4OMDA 1LCLA 1ULDA 1OQDA 5HCHA 4A3ZA 2WDBA 5DUWA 4GWIA 1NYWA 2RS12 3MI8A 1XNAA 4HVOA 1RUOA 3A0NA 4M01A 5M0TA 1VBE2 2FCVA 1ULOA 4HANA 5FZAA 1NA1B 2WABA 1FPN3 3CZUA 4NPLA 4UFJA 1AZDA 4XUQA 5HI0A 3BTZA 1ENQA 4NHKA 2WNVB 3HBZA 5FLIA 3H8RA 1ZZ6A 1D4M3 5FV3A 5IK5A 3APBA 1Q8PA 3PVBB 5FZHA 2BNMA 1FOD1 3Q8BA 3WNOA 1RUI3 3A7QA 2ES3A 3KV9A 1R092 4I3GA 2ZX3A 5DABA 5FZ7A 3UNPA 3KHCA 2D43A 5JZGC 2VQAA 2PLV3 3D0JA 2ZABA 4LHKA 5A7QA 4Z8BA 5JSRA 1KS4A 1PVC2 3FE5A 4PLMA 4UFLA 3CO2A 3PHMA 2VMFA 3OEAA 5DUUA 4META 2JDHA 1NXD1 2R042 3OY8A 1M06G 5IVYA 1R083 3U37A 4RA0A 3E1F1 1J1LA 2BJSA 2VMDA 3FHIB 4P5YA 4RL7A 3T0BA 2IXKA 1NT0A 1WLWA 2HWE2 4RGKA 5GKAC 3SMHA 1QJEA 1QJY3 5LRRA 2ZKNA 1EYBA 1W8WA 2W3JA 3LE0A 3WP3A 4DRVA 1OOPC 1VBE3 2JG8B 4OUMA 1BBT3 3ACGA 4IV3B 4W6YA 1GNYA 1ZZ9A 2W91A 4XURA 1UF2C 4CEYC 1JW6A 4COYA 5A3PA 3RZKA 4IGPA 2VY0A 3ZKYA 4RHV3 4TXWA 4JDOA 1DQ0A 3H8UA 2PQQA 5I8TA 3CBNA 1BK1A 3L2YA 2XVLA 3I2KA 3ZYIB 4HKLA 2VPVA 5T5LA 2K0GA 3DXTA 2DU0A 1L7LA 3IT8A 2NQYA 3ZM8A 2QJVA 5LRSA 4Y3OA 4F8AA 1OA3A 2Q1MA 3KQ4B 4OYUA 2W95A 5GALA 5DAXA 5C4WA 2IWGB 5A70A 1ACCA 1WUVA 4D6QA 3WOGA 1BHGA 4MXVA 3BKZA 2Y38A 3PUIA 1UCXA 2VMCA 1WLTA 1FPN1 1D0HA 1HKDA 1OHFA 3CHXA 4NIAA 1SACA 1CVNA 2XL9A 4YGCA 2FHRA 4K3UA 5C70A 2HKXA 3CF6E 2W39A 4KG0A 4CSWA 5GLUA 4WM7C 4GH4A 2WZEA 3JQWA 1OLRA 2OYZA 2ZKLA 4NRQA 5EZWA 4NHYA 4XDOA 4Y1VA 2P6CA 2RM23 1JH5A 4QPYA 1LESA 4OZOA 4IESA 4LE3A 2VZ3A 4QXBA 2Z79A 2A70A 5BNOC 3PDQA 4LHNA 2YFUA 4RS5C 1EY2A 1QIQA 3I59A 2LW8A 3O7OA 3V0AB 1HRI1 4ZXEA 1DQ1A 3RJ2X 2O0OA 3NNJA 5BPXA 1T6GC 4ONUA 1CAUB 1W2TA 4OULA 3LQCA 4YG6A 1W39A 2WJSA 5JR7B 2YBPA 4GQ7A 5FZFA 1LULA 5JIUA 1B35A 3JCIA 1AXZA 2AACA 4IQPA 4C90A 2BYVE 2VAUA 2CAVA 1W8UA 1VBE1 1ZRDA 1IHMA 1ENXA 4FFHA 4V2VA 4AQ6A 4IEQA 4GA9A 1U5XA 5F32A 3RS6A 1RUH3 5J98B 4XOGA 1STMA 4DOUA 4LNVA 3EB7A 3K48A 4BQ4A 1PVXA 4AGVA 2VECA 2KR2A 5T50A 4ZZ8A 2EIDA 4UW5A 1W9WA 1QJX3 3WP6A 2R072 4Q4Y3 3RWKX 2CTVA 4RR3B 4AEKA 4QKNA 3ZLIA 4AVCA 5IT6A 4IEYA 3VBUB 1QWRA 1G9AA 2JECA 4FPHA 3SCHA 4LITA 3VD9A 3VBHA 3OPTA 1XNDA 3C7FA 5FZMA 5J3UA 1GQHA 2Q5TA 5IWFA 1H9PA 2YDEA 3LAGA 3K46A 4YW4A 5L19A 2RS31 2EIEA 4JAAA 4JGZB 2CWSA 2LS6A 3ZSMA 1L7QA 4IETA 4IV1B 1XQNA 2D40A 1RUJ1 4LO6B 1FMD2 3I2JA 1VAMA 2ZGMA 3GYDA 3N36A 2W68A 2RM21 4PDWB 3OUIA 4V1PA 5CADA 5K4LA 3WY6A 3L9JT 2B39A 4OLLA 5JPMB 1VLNA 2BVVA 5FZ3A 1Z7S3 4LLOA 2RJ2A 3PVNA 4CUCA 2B45X 4OI1A 3MUY1 4Z1VA 1LR5A 3JBG3 4AVTA 5FQ0A 4YM1A 1CZVA 1HRI2 2XJVA 3IMMA 2OX0A 3TBDA 5KC6A 2VZRA 4QD2A 5F5QA 2DVDA 4HMZA 2TBVA 2GNMA 3OGRA 4KH9A 4Q1RA 3J7HA 4KNCA 3D82A 3H8OA 4UFIA 2LM3A 4K21A 3A0KA 1J3RA 3H3ZA 1TMF2 1W0OA 3ASIA 2JB4A 2BUKA 1UY4A 4CP9A 1JZ2A 3ENRA 1W9FA 1NE4A 2DFBA 2GH2A 4AGRA 5HXVA 1RUH1 3R6SA 2WO7A 3NV4A 2BTVC 1OFSA 1NQJA 4FTEA 3FLTA 1QEXA 1CAXB 2GN7A 3KQRA 3M1HA 5DG1A 3WSOA 3EQEA 3H0OA 1VBA1 2PA7A 3HMYA 3HT2A 4HONA 4PBOA 5A7NA 3SCGA 1H8TB 1J58A 3LSDA 1QQP2 4AVVA 1RUD1 1ZNPA 3MIBA 2WINB 3I3EA 3O1SA 2IXJA 3M70A 4FPLA 2OUHA 2I45A 4BQ5A 1UXZA 1YFXA 2V09A 2W47A 1CZSA 3RYRA 4CPBA 1VBD3 5FY5A 4D7TA 5FO9B 3RMYA 4QGMA 4EWEA 5IK4A 2F6BA 3IAPA 3OF1A 4FFFA 2GSYA 3DEMA 3M3EA 1JZ7A 5K8SA 3WD5A 3RNSA 1Q8OA 4BB3A 1WWYA 2QQVA 1VRH2 4MOAA 2RS33 4QXCA 1RJ8A 2Q1ZB 3BU0A 2PTMA 1HN0A 1PIV1 2GALA 5G05L 5FYMA 3VBOC 4NUBA 4YARA 5J96B 1W6QB 2VZ1A 1GP6A 1RUJ3 1HXS3 2K9ZA 4K20A 3KV6A 1WLDA 4NMIA 5JPNB 2XLGA 4KGGA 4M0HA 5FZLA 2JG9B 3LB9A 2RDQA 2JDMA 1RMU1 4D7YA 2ZACA 2RDSA 5GLZA 4XF4A 5K0UC 1U12A 1Z7S1 2X8KA 3I2HA 4EWDA 1D4M1 1JZ8A 1FI2A 1NKGA 4YM0A 1AYN3 1IPSA 2FCTA 3VBFA 2BW8A 1YCIA 1V6NA 3C2UA 4FPOB 5F37A 3S5QA 3E6DA 2ZHNA 1PX4A 3ABZA 5F8PA 4Q0SA 3NJVA 5LK7B 1UXXX 3AL5A 2ORZA 4EN0A 1MS8A 4YRDA 5F6LB 5JSPA 1W6OB 4NJ4A 5C9AA 4ARYA 2WZR1 2B42B 4XUOA 4CDUC 4XF9A 3PIJA 4EN9B 3PMEA 2IXCA 1R081 4OQ8A 3NL1A 4QPIC 1HN1A 2E32A 2ET1A 3LOIA 4MGSA 4WM7A 5FMOL 2Y6KA 3M3CA 1YEWA 4B7EA 3PTYA 1SCRA 3N9NA 3WG4A 3MBWA 4JHZA 2NP0A 4GZ9A 3AP6A 5B4XA 4DFSA 4P9WA 4IEZA 5IJRA 2YC4A 4N43C 1WMXA 4Y22B 4HFSA 5F3IA 2P4EA 1AYM1 1Q43A 2CV6A 1NUKA 1Y9GA 4CDWB 3VD7A 4LXLA 3RZGA 1SDWA 4KI5M 4RFRB 4Q4X1 4NIDA 5F5CA 2GC0A 2K2SA 4N90A 1D2SA 3VZKA 1NCRA 4FFGA 1H8VA 1YNAA 3EXUA 4CP0A 3F2ZA 3MIGA 4N8MA 4QPGB 2GDFA 4W8JA 4DS0A 3U14A 1SG3A 2PN5A 1ZX5A 3RZMA 4R4XA 1H1MA 4B1LA 4QX3A 4D7SA 4EZHA 1UU4A 1UIJA 2QKDA 3GDBA 1NQDA 5GZEA 3VL8A 5BNPB 2AEZA 3SKJE 4GB31 1F35A 1S1AA 4AL9A 4CCEA 2HWB3 1ND3B 4R9CA 4LBKA 2PAEA 4HZFA 4LQRA 1DQ2A 4KWKA 2E7QA 3C3VA 2BWCA 4RS5B 5IVCA 1UOJA 1DF0A 4L97A 1YJKA 1SLLA 5FYSA 3GALA 2JDAA 1AYN1 3BCWA 5FY4A 3O1TA 4DZGA 1O3SA 2D6NA 1Q8VA 4DPNA 1O5LA 2HEVF 4LOTA 1MS3A 1QY4A 5HCFA 5FREA 3VL9A 3ST7A 5IYYA 3THPA 2VQ0A 3MF9A 3P6BA 1R093 5FBZA 5FMOS 3KCXA 3O1VA 2X5IC 4N9IA 2CWMA 1I9RA 3ZXGA 2HH9A 1MZFA 4JV4A 2TUNA 4E4SA 2XKOA 1Q5OA 2P17A 2C26A 1GZ9A 5I93A 3H8XA 4QB6A 5A33B 1VBB2 2QCSB 2HEWF 3Q8AA 2D97A 3AM2A 5T52A 4ASMB 4AW7A 1KFXL 3NJXA 4B8EA 2DF7A 4X8PA 3JXSA 4UYBA 1G9DA 1BVVA 1K3IA 1HB1A 4FAHA 1ENSA 4UFMA 5FTTC 1W05A 3S0MA 2DDUA 1OA4A 2HEYF 3NNMA 4OI0A 4FT8A 1UYZA 4K7JA 5G04L 3BOPA 1DLCA 4CRQA 3CU7A 3I7DA 1XNBA 1CD3G 1ND2B 3AYAA 4P9LA 4QT6A 1NX9A 1X8MA 4RS5A 4G4FA 4P5HA 3WHTA 3ZXEA 5GZDA 1SDDB 3HR9A 2G1MA 1JYVA 3RZLA 1ST8A 1QHDA 5BV6A 3WNMA 5LBCA 4YYOA 1NLQA 1W6PA 1IZ3A 3T30A 1G7YA 3LA3A 2DVFA 2JE7A 3TRSB 4CP2A 1EAH1 5A1LA 3VZOA 4QQLA 3AVRA 3ZN5A 2HWB1 1CX4A 2D3PA 3DF0A 1XNTA 2OT7A 2P3IA 2ZHLA 1FATA 4COWA 5FZ1A 4XZUG 4XAAA 1PX3A 4LIUA 4QM9A 3RFRA 3VBOA 4AFBA 5LCWL 3IZOA 2RJKA 1EV12 4PBPA 1AX0A 2HWF3 3DKWA 5IFTA 3E6CC 1UY3A 1W3XA 2E33A 1VB4A 5FP4A 1WMEA 2EICA 2FDKA 4BU2A 3AZWA 4F83A 1R64A 2EAKA 1BJQA 1HW5A 2JE8A 3AP9A 4LPLA 2FZ1A 1J84A 4IXLA 5FYVA 3WNPA 1NA1C 4JQRA 4C91A 2FZ2A 1GZWB 2P6HA 1V6OA 4IEUA 2WNVC 3O1RA 2RJLA 1VBD2 3O1PA 2BNOA 4AI2A 1Y3TA 5BNPA 4XF0A 4XMIA 1CJPA 4RYDA 2XWBB 3C7HA 3WQ1A 5BNNC 4Z92B 5AC92 4QKBA 2JIGA 3NV2A 2WAAA 1P8JA 4YG3A 1C57A 5GM0A 3AL6A 3QH6A 1RUC2 5JOZA 3CLPA 4LE4A 4NWWA 5CKMA 4MLOA 4UXAA 2WO2A 4BLIA 5EJZB 3TN92 2JDYA 2ZGLA 1OQEA 3J8F1 4CCKA 1GFF2 2BDRA 2DBIA 2JKBA 5F2SA 2XL7A 4YSFA 3I49A 1OLME 3TOJA 2AEYA 1FX5A 1OBNA 4YVSA 3UKVA 3LSEA 3S30A 3DUIA 3Q9OA 4UBHA 4WV8A 1RUD3 2FDHA 1LRHA 3KF3A 1H4HA 2OPKA 3NAPC 2VNVA 1YFYA 2XVKA 1AR72 1QKQA 1UOBA 2ZEYA 1E5SA 4AI0A 4E8CA 4XF3A 4W6WA 3T4VA 1W9YA 2ZGTA 4AVSA 4ET7A 1YI7A 3I3MA 1W04A 2JDNA 4D0QA 4FPCA 4KU7A 1VB2A 1EAH3 1J3QA 1VAKA 1S55A 3ACHA 4QQHA 4Q8KA 5JCTA 2WS92 1KDKA 3FLRA 1WW5A 4FPGA 1LU1A 2JWPA 4ATEA 2BGCA 2QFEA 3WEZA 2RV9A 1FMD3 1PIV3 4A45A 3B01A 2Z2SB 4E4HA 2OW4A 1JHNA 2WAOA 2QE3A 4QHOA 3U0ZA 4QXKA 2LROA 2JKXA 4FXGB 5CVRA 1S0BA 1ND2A 1H2KA 4OUSA 2W0XA 3UYJA 5IK8A 1ZBE1 2I74A 2WYFA 3O12A 3AKQA 4YZ3A 3Q8EA 1XOYA 3WW2A 1G9BA 1WCSA 1IPKA 3T09A 5D21A 1RL3A 1IG3A 2WN3A 4LIVA 1KEXA 3VDDA 4R4ZA 1QH7A 2ZBJA 2XBO1 1A78A 3PL0A 1LGNA 5FPLA 1C5HA 2V5YA 3OBAA 1N3QA 5FDBA 1JMUB 1G9CA 2OZ6A 2YG0A 2Y64A 2WZR3 4XDQA 1CAWA 5A32A 2ZGRA 3W58A 5LB6A 2JD9A 3I59B 3ILRA 3V0AA 1EV11 2XG3A 1NE6A 3HAGA 4M4RA 3KD4A 5FJKA 3J8F3 4XIOA 1U5ZA 1H30A 1WLCA 3N9MA 3PJQA 4YVWC 4ARXA 4DNYA 4JDNA 5JXJA 1G9FA 4JCKA 4H14A 1TMF1 4FTSA 1H1IA 3I2OA 4JTNA 3B5LB 1UZWA 3FHQA 4CCNA 2IXHA 1RUG1 1X7NA 4SLIA 1UPSA 4COVA 4LA3A 3RQ0A 4CDXC 1WA4A 2Y33A 1DQ5A 2VR4A 5DXDA 2WT1A 3NNFA 4NE9A 2G19A 2ETEA 4C1WA 2ENRA 2XLFA 3B3QE 1RUF2 4HSJA 3KWVA 4AAXA 1CN1A 5E16A 3I54A 1RVF1 4ZU4A 3UKNA 4A6SA 3KCCA 1AX1A 1VBC2 2V5DA 3OY8B 1J1TA 4A2UA 4GH4C 4AAPA 1SHWB 1CWPA 5A80A 4NIGA 1GOGA 1NZCA 1YI9A 1GICA 2D3SA 1PK6C 4HG6B 2ZAHA 4GB33 3OBRA 4TN7A 3TNQA 5JOYA 5JZGB 1OT5A 4LK7A 2JE9A 1URXA 4CCDA 1S2BA 1ZBE3 1JI6A 5EXOA 3VHRA 1C1LA 5DDJ1 2EIBA 4XFBA 4ISRA 2W1WA 4Y22A 1RXFA 4QWNA 5LY1A 1AXYA 1QJFA 3HPNA 3MW2A 4PDWA 3VLBB 3ZXJA 3WF1A 2Y34A 1J83A 2XXZA 3CEWA 4IV1C 3KT1A 4IV1A 4RQPC 2XBO3 4NIIA 1Q8QA 1KGYA 2Q8CA 4K9SA 4B4QA 4F3JA 5CFCC 1QXPA 2GMEA 2PYTA 1K5JA 2G9ZA 5F3EA 3OPZA 1CJDA 2BGPA 5FOBB 2ARXA 2WIIB 2FDGA 2VZQA 3KV5A 2ZTNA 2FD8A 1PO23 1UO9A 3OBZA 4RD7A 3KV4A 1LHWA 2R062 2JDUA 3MICA 1N1SA 5DAVA 3UGHA 1HLCA 2WBKA 1SLTA 4WM8A 1POV1 2WQ4A 2WNUB 2WT0A 5D2AA 3N7JA 1KJRA 4YW7A 2QDNA 4AQSA 4HBNA 3T1MA 2CGPA 1NZIA 1HQLA 1AR82 4Y4RA 3IAQA 4L99A 1MZ6A 5DMYA 1O4ZA 1JUIA 1LENA 4BISA 1S0FA 3D0SA 3ZN6A 3OJBA 5C9AC 5GLWA 4XBNA 4CTEA 1W6NA 2ZPXA 2PHTA 4LA2A 2R49A 2VZVA 5KHJA 4LBQA 2F17A 4PI0A 2DVAA 2Q8DA 5I8YA 2QQUA 3FZ3A 3O0WA 1V6JA 1PO13 1TG7A 1J3PA 1BMV2 1N3PA 1OURA 3WG1A 1SFNA 2X29A 3FUOA 4AHZA 5FRAA 3O1UA 3ZFFC 1D4M2 4XC9A 1XRUA 4JKLA 1GNZA 3LDKA 1PGW2 1UPIA 5T5OA 4NPRA 4FTBA 3J7NA 4AR2A 1VIWB 4AOCA 1NCQB 2VCMA 2DTYA 3IN9A 4OZXA 4HVRA 5J37A 3VZNA 2ZOEB 4XZPA 3BVCA 4KBBA 4FBFA 2VW1A 3AKTA 2WLQA 3AXEA 2AENA 1VMFA 1COV3 1LGCA 4ORFA 3T1LA 3T0AA 3UKTA 3GZEA 3NSTA 3WV6A 3R4DB 4LJHA 2HYKA 2W92A 1GZCA 4P14A 5FY8A 2X5IA 3VDBA 1OLMA 4QGLA 4UFHA 3ZFGA 5HBAA 3CZJA 4IUGA 4L92A 2RE9A 4XCBA 3GZUC 1LB2A 3A21A 4OFGA 4CCMA 1RYYA 2CU5A 3ZXLA 1XYOA 1G6NA 2P2KA 3HQXA 3LFMA 2V72A 4EZ4A 2Q1FA 2VUAA 1V00A 1EP0A 2YROA 3DV8A 1QDCA 1YO8A 1RIRA 1C8M1 1X8EA 4DUWA 3WDXA 4DEQA 5F3GA 1UWWA 5C5UA 4MZUA 2Y60A 3AP7A 4GMP0 1POV3 5ACA2 5C3RA 4RR3C 2VW0A 3TN91 2L9LA 4LKSA 1MS4A 4HT1T 4MGIE 5FFOC 5JI9A 2YUEA 4UW3A 3T2OA 1RUC1 2ARCA 1V6KA 2H6BA 4XQDA 4AG4A 1PNFA 2R041 4YG0A 4FCAA 1XJAA 2JB8A 3U78A 3JUUA 2KM2A 2VBPA 3W20A 2ILMA 3KT4A 2WWSA 5AVAA 5B4NA 2J1TA 1NCQA 1UOFA 1X9TA 1QMJA 2UWAA 2BBVA 4AEDA 3RDIA 1E5RA 4P9JA 4XFIA 2DCZA 3M3IA 2IFRA 2GNDA 1O8SA 2ZMKA 3WQBA 4XFGA 3WNKA 1FOD2 1PM4A 1NXMA 2WWUA 3WZ1A 1WZXA 4N43B 4DUVA 5FPZA 2XWJB 4BMBA 4A44A 2WUHA 4YW3A 2JENA 4QPGA 4LUMA 4ASLA 1DDLA 4BIOA 3GNEA 4DXSA 1IKPA 2SLIA 3THTA 3U75A 1W3VA 2WFF2 1W2AX 1NLRA 1JOBA 2C24A 5ERLA 2MNGA 4AHWA 3SH4A 3V0BB 2FDFA 1W6MB 4CDQA 4BXSV 5HCBA 4QX5A 1O3RA 4BDVB 2BGOA 4B29A 4AQ2A 5BNNA 5IAVA 5CFDB 2R30A 3KLSA 4Z07A 4EYUA 2QUOA 2ORXA 3WUDA 2GU9A 2XLAA 4GXLA 1W06A 4MV2A 3WCSA 2Y8KA 4UF0A 5FO7B 1T6BX 2WN2A 5FY7A 4CXYA 3P5BA 1DYPA 1YJLA 1H2MA 3VD3A 2ARBA 1L3JA 2R071 1A8MA 1BEV3 1ULGA 1VP6A 3SH5A 3UT0A 3ZFEB 4E9KA 5A3NA 2VE1A 2MPFA 4D69A 1OF4A 3AZZA 4FOVA 4UW4A 2W87A 4IL7A 1F4HA 1WW7A 3EMRA 3MIFA 4CCCA 3AJZA 3VD4A 3PU3A 5KHGA 2XJUA 2E26A 2MEV1 1WGPA 4N9HA 4QXHA 2RMU2 2BNNA 1SZBA 3PUSA 1OFNA 3IDAA 2Q4SA 3LPGA 3ETPA 2E31A 1VBA3 1U0AA 2B5HA 1TMF3 1ASJ2 2DCTA 5F5AA 2ID4A 4MSVA 3WUCA 1QOTA 1VBC1 4ATFA 1QH6A 1KRIA 3AFKA 5C8CA 1ZBA3 4TTGA 3MLJA 1W6MA 4CDQB 2RDNA 2N7GA 2VOKA 2UURA 1TZOA 1CIYA 1SCSA 3VHPA 3CMGA 2WA4A 3SXWA 5DZGA 5L36A 2ZGSA 4QGNA 1REFA 1IQDC 3JBG2 4N7IA 1CPMA 3WQ0A 3CDZB 1OPMA 4CUAA 1AF9A 4AFCA 4ZS3A 5C8CC 4OI4A 5FZOB 4MG2A 1W6OA 4AGGA 5A32B 3R0RA 5A3OA 4D94A 2VZPA 3IIIA 3ZPYA 4CEWC 5FZKA 1JYCA 1CAVB 4FSJA 4NAMA 3ACIA 2CDOA 5F5IA 2JX9A 3IKWA 1GKBA 1D2QA 4C0BA 5DG2A 1H0BA 4IE4A 2R063 2Y0OA 1GWMA 1LHVA 1CR7A 4TZDA 5HV4A 2QQKA 3VBRC 3AXDA 4RSUA 5SV5A 4GD4A 1OD3A 4O9EA 2HWC1 2UYAA 2GP5A 2Z42A 3CJXA 3IMNA 4OQ9A 2XBO2 2ZX4A 4QX7A 4BA6A 4YW1A 2WYSA 3DN7A 4Q4X2 5A33A 2R073 5BUVA 1BEV1 1QJU2 1F15A 3I2GA 4P9GA 1EPZA 4WM7B 1AYN2 3ME2A 3AKPA 2A73B 1GMMA 1NAEA 3VKMA 3PJYA 4X6QB 1S0JA 1XNKA 4QU1A 4W6XA 1DZQA 4WBBA 3LA2A 4Q5OA 1KXGA 4Y5Z0 1I5ZA 3GXUA 3U1XA 5C3QA 4U36A 4CU7A 4XFFA 4I2OA 2ADEA 1AL23 3OUJA 4QHBA 3HBKA 3SKVA 4DY5A 5KHIA 1U5YA 4HVQA 1VBC3 1ZVFA 5DPNA 3BIWE 4ZZ5A 1ZBA1 3WT3A 3ZXKA 1SBFA 3DPRB 5CIRA 1JZ6A 4IV3A 2WS91 2J1UA 3NRUA 2YPDA 2J22A
chains in the Genus database with same CATH topology
4ITCA 4NHMA 2D98A 2CY6A 2WT2A 3MLLA 4XHBA 4I01A 1LOFA 1W0PA 4CDXA 3SISA 4KG8A 2XJQA 5AVPA 5KBFA 1QJZA 4HN0A 2NPIA 4NWVA 3VBHB 4GWMA 4QQOA 4ZU7A 4LBQB 4NN0A 1WW4A 2DWRA 3M4FA 5JIAA 1DFQA 1LEDA 1X33A 2DUQA 1K5MB 4XBLA 1HQNA 2WZR2 3AMPA 4YGDA 1K5MA 1O5UA 1QNWA 1COV1 4LO5B 4MX3A 4S2HA 1Z78A 1IQAA 5T5JA 1NY71 4HK9A 4YZ4A 2EXIA 3ZSLA 5CA6A 2EIGA 3I8TA 3KM5A 4AEJA 5BNOA 4W65A 1R091 1VR3A 2UY9A 1ULFA 3S7EA 3WDTA 5A3MA 1HQWA 1IPJA 1UU6A 1V6IA 1Z7S2 3WR0A 2H0VA 4XE9A 4YW2A 3TNPB 2EAAA 3ATGA 3O5SA 4ZU5A 1CESA 1ULEA 1QJY1 4LO7A 2EXHA 5GJ6A 3VBSB 2ZGUA 5K7PA 2WFPA 2D7FA 1TE1B 2D93A 1ENRA 2UU8A 2WS93 4PIYA 3VZLA 2QNKA 3QH7A 2R043 1BMV1 1EAH2 1QJU1 1LHOA 2LTNA 3ES4A 4AFAA 4RHV1 4YZ1A 2ZX2A 5JAXA 3ZXFA 4LBQD 2AH2A 5FPXA 1H9WA 3ACLA 1AR73 5K9YA 3MYXA 2ZCWA 5SV8A 3WLUA 4B3NA 4QM8A 1ZZ7A 2QQPA 1CONA 3B7MA 2IFWA 5D8AB 1QQP1 2XJPA 4FQ4A 1FT9A 4LBNA 3KS7A 5C4WB 3AK0A 1X50A 4XJAA 4K1YA 3B9IA 4WVMA 4HK8A 2PHDA 1LECA 3WINE 1YRZA 1ZRRA 1U5IA 2OVUA 4Y20B 5J09A 1VBB1 1GYKA 1YFWA 3UK9A 5JOXA 2HWF1 3BALA 4GH4B 2WZPP 3JD72 3DL3A 1LTEA 4MVTA 5DZEA 1CAXA 2C5DA 2ZGNA 5F9TA 1OSGA 4JGZC 4URTA 2R1BA 1TME3 2MHFA 3FWEA 2JG9C 3ZXAC 4L11A 1RUG2 4MGZE 2RM22 4CEYA 5L7OB 5DDJ2 3IBMA 2VVFA 3WQ7A 4HPKB 2ZGKA 1RUE1 4BWOA 3VDDB 2H0BA 3FMGA 4FQZA 5ACA3 1MVEA 4LO8A 1V9U2 3ZN6B 3ZYGA 1N1VA 1UL9A 4I02A 4CDUB 3FFQA 3KZ4C 1V70A 1RVF2 1ULCA 3B9CA 5T54A 1TME2 1RTVA 4CEWB 3ZIXA 3P3NA 2WNUC 2WNUA 2FBEA 1SLAA 2DYCA 2VH9A 2VMIA 4XQ4A 2DTWA 4RHV2 3LOBA 1G86A 1OA2A 3VHNA 4A7YA 1COV2 3O0XA 4EV0A 3SLIA 1ZZBA 3MIEA 4N53A 1OD5A 4D3WA 2RR11 3CJIB 2E63A 4PLNA 2WFF1 1YYNA 3RJRA 3N35A 1LGBA 1MS5A 1MQTC 1BVP1 1VBB3 2Y26A 1QJY2 3ZSEA 3J4UH 2HWE3 2DVBA 1AR91 1PZ9A 2VXRA 1I3HA 2NN8A 3V0BA 5I0RA 2PLV2 2E7AA 3GBWA 1W2UA 2JG8A 1UKGA 3ILNA 2OA2A 1NY72 4HLTA 3ZMOA 2D44A 3OGGA 2D5FA 5EYYA 3URFA 1FYUA 4Q0QA 4LEJA 4NVPA 5J48A 1DGLA 2KA3A 4PCRA 3VBUC 3N7KA 2VULA 2NYYA 4RGAA 2ZGOA 4WZCA 4AEDB 3OBTA 1AJOA 1DGWX 3J9SA 4OI2A 3MFCA 3AB0A 2VGDA 3AFGA 2YPJA 4I30A 1VBD1 2A5ZA 1N1TA 4Y20A 1XXNA 4BOWA 2PHRA 4ISQA 3ZX7A 2DUPA 1QOSA 4DRRA 3U4XA 2YV8A 4PDWC 5CG9A 5DUVA 2VU9A 1F5JA 1RVF3 1SFYA 2DVGA 3MIHA 4BPZA 2C0ZA 1YFUA 5H9QA 4YVSC 4QQ2A 4XYXA 4AVBA 5EV7A 4CDWC 3L2HA 1SMVA 3B69A 1HXS1 4L2NA 5CNAA 3T2TA 2UYBA 4G9SB 5AFBA 1GANA 1AR93 3ZFGB 4Y1UA 2RS11 3JQXA 2C1FA 4NHLA 4CEWA 4BCUA 3KGLA 4YM2A 4A7ZA 4LBMA 1RC6A 3VV1A 1A3KA 4AEMA 4JGYC 4GIQA 4Y4YA 1C1FA 3LKJA 4FP2A 3ELNA 3AMQA 1NA1A 4OHWA 2Q30A 3MFAA 1UAIA 1PHMA 1R1A2 1ZRCA 3WX5A 1RITA 2HWC2 3EJKA 3ZYRA 4LHLA 1OLQA 4HETA 3AJYA 4EROA 1UZZA 4O9GA 2DCYA 1GQGA 3OCPA 1KITA 3WNXA 1ZREA 2DCKA 5C9AB 1FV3A 1RUJ2 2RMU1 4GKXA 2I2SA 4XEZA 3ZFEC 3IPVB 4IEXA 1YUDA 3MPPG 3EHKA 4FP3A 1IS5A 2P3JA 4EJRA 4Q4V3 5KXDA 5BNNB 2UY8A 4ZKTB 1QJU3 3ILFA 1A6CA 3NV1A 4P9XA 4Q4X3 5KHHA 2I07B 1MZ5A 1MS9A 3A4UA 3LZZA 1LHUA 2XGXA 5ABJC 4R52A 3LGRA 4IV3C 5D1IA 3AP4A 2XH6A 1S0IA 4AI1A 4AHYA 1PO11 1QQP3 1SLCA 1X36A 1DLLA 1DHKB 2A3XA 1W6PB 4B4RA 4ES9A 4AFMA 1RUE2 4OVEA 4CYDA 4YNIA 4PQ9A 3VUOA 3B93A 2R0HA 4FXKB 1BQPA 2KXLA 5H9RA 1LOFC 5L7OC 4KWLA 4JGZA 1O91A 2CNAA 3MDPA 3CNAA 3AYDA 4Q27A 1MVQA 5GZFA 3WDWA 4J1WA 4Y1XA 2TEPA 1QXJA 4E4DX 4N43A 4E2SA 1ALYA 4XMAA 2WLPA 3E6BA 4Y24A 2VNGA 1ZRFA 1XNCA 1NLSA 1VJ2A 5I0TA 2VNOA 2RMU3 5LEKA 1RUE3 1Q3EA 4Q2FA 3MZHA 4IEOA 1DZTA 4AVAA 4BLJA 4GWNA 1CQ9A 3DPRA 1RUC3 4ES8A 1Y9QA 3MIDA 2EA7A 5FLJA 3UJQA 1BXHA 1RGSA 1S2KA 3SNMA 5AC93 1G8WA 1LOBA 2GNBA 3IDCB 5EYXA 3RZZA 1MEC1 3QBQA 5BNPC 4JRLA 5GZGA 1DQ6A 1QXRA 4M00A 5I0SA 5T55A 2ZJCA 3M3OA 5E89A 3RWNA 4Q4V2 4YZ2A 1GBGA 4QQPA 3VBRA 2A6YA 2WC2A 4FOWA 4JRAA 4CDXB 1AL22 3RSJA 1DIWA 4Y1YA 2WFF3 4XTMA 4QPIA 4HSLA 3WG2A 1W6NB 1APNA 4CDUA 2D5HA 3USUB 3VKOA 1R1A3 4XIKA 3AKRA 4LULA 4EWAA 2WQZC 1PVC1 1FXZA 2B8MA 3AMHA 1S0GA 3BTAA 3ROUA 1AVBA 4A3XA 3B02A 2ZHKA 1YXWA 2VVDA 5D8AA 3BOWA 4R8HA 3IDBB 2PELA 4FPFA 4EN7B 2Z69A 4CDQC 4Q29A 3WP4A 2PFWA 4LO4B 2MEV3 3JB8A 2ERFA 1IS3A 5C33A 1YHFA 2H6CA 1O4YA 2XUMA 4XILA 1GSLA 2NZ9A 1KDMA 1PZ8A 4DQAA 3BPZA 3H3UA 4Q4Y1 4QPIB 1ND3A 1QGLA 3BB6A 4RQPA 2VOWA 3MGUA 2D6PA 3J26N 2PHUA 1H4GA 2QVSB 2YHJA 1ZBA2 3POSA 1V6MA 2DV9A 1XYNA 1VBA2 4Q1PA 2HWD2 4M3CA 4C0HA 1DBNA 2XJSA 1RHI3 1FMD1 1PMIA 2BQPA 1GZWA 4JGYB 2UWBA 2VW2A 4RR3A 4TLFA 3R05A 2HWB2 1PK6A 1RHI2 1UN1A 1WMFA 4M0NA 4QPGC 1WCKA 2R061 1UX6A 1PGL1 3B94A 3SITA 1YWKA 2A71A 1RUNA 1BEV2 1ZZ8A 2YY1A 5A3LA 4WM8B 4K6BA 1PVC3 3HIFA 2BEOA 1NCRC 5CAZA 1ND3C 4X8NA 2C9AA 3ZSKA 3NW4A 5CG8A 1NCQC 4CEYB 1RUI2 5L7OA 3KGZA 3V65A 2GN3A 3VKFC 3NWKA 4AK3A 5K0UB 4XPVA 1AR83 2GMPA 1E57A 1VALA 2W52A 3VKLA 5KC5A 4IEPA 5BNQA 4BYYA 5JDBA 1SLIA 4M3CF 2EXKA 2AGSA 3SCFA 4JC1A 1JXNA 4H3WA 3KMHA 3MW4A 3X29B 4QU2A 3NVCA 2D6KA 1XE7A 3SHRA 4BH9A 3HD8B 1PGL2 3U11A 4AXOA 4BQ1A 3KT7A 3FX3A 1RHI1 2YMZA 4CP1A 1S0CA 4XF1A 2CAUA 1OPOA 1ND2C 1ZA4A 4H55A 3POWA 1HXS2 3O0VA 4TSVA 2VNRA 4B7KA 2V73A 5DDJ3 1D0GA 2RS53 5DUXA 2ZGQA 2NM1A 5BXXA 4ZXKA 1DGRN 3N7LA 3ZXDA 3JB4C 5JOWA 1PZ7A 2R0FA 2D6LX 3GZTB 3AMMA 5TSWA 4XJWA 1NG0A 1MS0A 1LOCA 4M3CB 3GF6A 1WBFA 4Q4W3 3PVEA 3RG0A 3K51A 4SBVA 4AE2A 3NAPA 1HDKA 1POV0 1PO21 3NAPB 2YXSA 1AL0G 3EO6A 4XXAA 3AP5A 4Q26A 3AX4A 1XU1A 1DZRA 4LT5A 4AYUA 1SBEA 2FMYA 3D4KA 5E8AA 4YM3A 3FJSA 1AYM3 4GALA 4RGGA 1HX6A 4Z2WA 5AC91 1FNZA 2YZ4A 1LKNA 2YC0A 5JZGA 5KXCA 1UZYA 4XTPA 2EVXA 3RI9A 4AEDC 4N53B 4L9BA 2GZWA 5KXEA 5H9SA 3RMXA 1F9KA 1AR71 4BE3A 2Q8OA 3ZN4A 3WW4A 5L73A 5FOJB 4S2GA 4HKOA 4NR1A 5T3NA 1AR62 2R16A 3HWJA 4HL0A 3RRDA 1CGPA 2B7YA 2YGMA 1Y43B 4AF9A 4IEWA 3M8LA 4P9YA 2O8OA 2IXLA 5F6KA 2PAKA 3QACA 2RS51 2WA3A 4GMP1 2VMGA 4UBGA 1VRH1 2YGLA 4OHYA 5FQ0B 1UKRA 1PO22 4Z82A 3WDUA 3M7AA 1AX2A 4J1XA 1H8TA 1N3OA 2LUWA 5F1RA 3BU7A 1KQRA 2PLV1 3M2MA 1FV2A 1W6QA 5JLVA 3ZFGC 1ONAA 2ZZJA 3PMSA 1AXKA 3EBRA 1TME1 4LBOA 4COZA 1RJ7A 1RUD2 3ZDSA 1C8M3 2BFUL 4XBQA 3O14A 4K1ZA 2OIIA 5E88A 3TN93 3H50A 3AYCA 1BBT1 1B35C 2RR12 1BKZA 4COUA 4WVZA 4M3CE 2ZA9A 3ZFFA 3OYWA 2R32A 4PJYA 1C3HA 1UU5A 3VBOB 1V6LA 2JG9A 4LBLA 3OD0A 2PAMA 1KFUL 3TYJA 2LALA 1OOPB 2AYHA 4E2GA 2XB6C 1LJ7A 1J59A 2ZX0A 4E4ZA 3ZIWA 1QF3A 2ZMLA 1GNHA 3D8CA 4I3PA 3N4MA 1ASJ1 3FFZA 2DFCA 5EJ3A 1O4TA 4RQPB 4WM8C 3VHOA 2ZX1A 1S0DA 4MXWB 1NCRB 5AFEA 3ZSJA 3NO8A 3E5XA 2BPA2 4TYSA 2GMMA 4OHZA 5FCCA 4XXPA 2NMOA 5CFDA 3CL1A 4G3YC 1KS5A 3USSA 2WNVA 1DGRA 2X53S 4QMAA 3OYWB 1MZEA 3OGJA 4YLZA 2ZS6B 3QCWA 3H7YA 5GLVA 4S2FA 3TWIA 1JTZX 3D6EA 3INAA 4DXZA 2DU1A 4BHPA 4EN6B 4Q0VA 4I0WB 2XVGA 2XHKA 1I6XA 1WW6A 3VBRB 1WMDA 3ZYJB 1BBT2 1REEA 3RPQA 5I8SA 4NOTA 2Q0AA 2ZMNA 3MW3A 4EN8B 3M3QA 3H1WA 5DZFA 2WL1A 2WKKA 3VZJA 3VN4A 1AR63 3NKTA 1R082 1QU0A 2IZWA 3FUQA 2O8QA 4YFZA 4LUKA 2PHLA 4KL1A 4XFAA 4DMIA 1ZYBA 4HKWA 4HPKA 3G7DA 4MH0E 3RI8A 1LOGA 3VBFC 2AREA 1AYM2 1UD1A 1ASJ3 2XJRA 1QDOA 2VOXA 1GR3A 1IGOA 3MEPA 4I0BA 4PLOA 4FPJA 4AWDA 2SBAA 1N1YA 1FPN2 4AHXA 3WW1A 4DY3A 3U07A 1HV0A 3UJOA 1OI6A 1REDA 5CB7A 1AJKA 3IPVA 3LA7A 4X6RB 2ET7A 1TNRA 1BYHA 5CBLA 1CPNA 1IS4A 1RINA 1QOOA 1PK6B 2GC2A 2XJTA 1N47A 2JICA 5LEJA 3AKSA 1A8DA 3CJIA 2E7TA 1CAWB 1K5MC 2FMDA 3ECQA 1LEMA 4XJZA 2RS52 1V9U3 4F7ZA 1RMU2 5C8WA 4XW3A 3QOPA 4H7MA 1YIPA 2BWAA 4XJUA 1AL21 3ES1A 3RYPA 5ABJB 1JYIA 3H1YA 4WVWA 1KD7A 3IDEA 5GZCA 2A75A 5E1RA 2YYOA 4Q4V1 3MF6A 4FAGA 3ZO0B 5EFUA 1M4WA 2NLRA 1FAYA 4GULA 3WCRA 1Q56A 2P34A 4BM8A 2GH8A 3FBMA 1GV9A 2JXAA 1H2LA 3E5QA 2TNFA 1PM7A 2D3RA 3GBGA 3JD73 2PHWA 3TB0A 2GC1A 5FAXA 1IKQA 3VGIA 4Y1ZA 4WZFA 4FVVA 3WHUA 4IERA 5JI7A 4E27A 1XE8A 2VOVA 1SQ4A 4INDA 4KWJA 3I2DA 3NV3A 4P9IA 4BMEA 5BNOB 5BYNA 4YFWA 2CL2A 1LHNA 5FLHA 1RMU3 1ZM1A 1XU2A 2RS32 4GMP3 3ETQA 1VRH3 3WVJA 5D8AC 1D4VB 1XYPA 3SH3A 3NKGA 1JUHA 3CJIC 4LR4A 1JN2P 3ZYPA 2B9UA 3KSCA 3VBSA 1IS6A 5ABJA 4B4PA 1OKQA 4BIFA 2Y0IA 5IK7A 2NMNA 3BODA 1B35B 2EALA 2PHFA 3AMNA 2XPJA 1LU2A 2ZHMA 1C8NA 1V9U1 4FO9A 4AI8A 1CAUA 1WD3A 3RYKA 4E2QA 1PNGA 5CU1A 2WSVA 3U10A 4R9DA 1MS1A 2HWD3 3N7MA 1HIXA 4WVVA 4IEVA 1PO12 3WP5A 4AQTA 1MEC3 2VUJA 3WXPA 2CYFA 3LWCA 1DYKA 3H9AA 4FPKA 1RUF1 3JD71 4HN1A 1O3QA 4PF5A 4JGYA 3UV9A 1BZWA 3W9AA 2D6MA 3H7JA 4I09A 2G9FA 2ZZQA 5K0UA 5GLTA 4J6GA 1SEFA 1YLLA 1UIKA 4K40A 4Q0UA 2JEMA 2O1QA 2MEV2 1X82A 3USUA 2DURA 1HRV2 4R9AA 1O3TA 2A6VA 3IIAA 1DQ4A 3E5UA 1RUI1 1LOEA 1AUYA 3ZVXA 4C1XA 2QDRA 1R1A1 4DB5A 2XKPA 3GHMA 4YVSB 1F8VA 3V64A 3G6JB 1I1EA 2D6OX 2A6ZA 3QLQA 4A7KA 5CFCA 3WW3A 3NJZA 4YW5A 4Q4Y2 1Z0HA 1QJX2 1MQTB 4FOQA 1JBCA 2EXJA 5KWRA 1B09A 4XETA 3P3PA 3AZXA 1ZBE2 3V56A 2IXIA 2E6VA 4OHVA 3POYA 4GB32 1RB8G 2HWD1 4KGQA 3VBUA 5ACA1 5JSOA 2GAUA 5B2GB 3KCYA 2G9GA 1TEIA 4XJ9A 2JD4A 4YGBA 1AR61 3VBFB 3WDVA 1MACA 4XQWA 2AR6A 1RUF3 4CZSA 2JG8C 4XHXA 2DUOA 4AFDA 5JVVA 4XJ8A 3DGTA 5KHKA 2F4PA 4JTOA 4K8FA 3VZMA 3WG3A 1UMZA 1TNFA 4L8QA 5JWPA 1NOVA 2HJIA 2JDZA 3ZFEA 3AZVA 1AR92 4KQ7A 2RR13 1HRV3 3N3HA 1MQTA 2Z5WA 4DINB 1WBLA 1IOAA 4YVWA 3J8F2 1C28A 1PGW1 2ZGPA 3PLQA 4I0AA 4PIXA 2HWE1 3HN1A 1Y7BA 1C8M2 5JMCA 4GKYA 2G4IA 1DG6A 4MGYE 2R6QA 4R9BA 1DU3D 4LBJA 3PVOA 3VBHC 3IWZA 2JJ6A 4NO4A 4RFT0 4MXWA 5H9PA 2GNTA 2P3KA 3FC0A 4KU8A 1HRI3 3ZMNA 2A6XA 1EPWA 4MUVA 3GHNA 2FQPA 1OMIA 2R1DA 1MEC2 5EWSA 4FPEA 3PNAA 3QD6A 3WDYA 3ALQA 2RHPA 1AR81 2E9QA 4TWTA 3S6PA 2A3WA 3I4IA 1GLHA 2VMHA 1PIV2 4CDWA 1QNYA 4FPYA 4N7UA 2ATFA 2CGOA 1R1ZA 2IC1A 3GZAA 5C4WC 2QZ3A 3JZVA 1CIWA 1QJX1 1S0EA 2CGNA 3D5OA 3ZFFB 3UL2A 4Y26A 3VKNA 1LODA 3B00A 3VBSC 2DCJA 3OTFA 5J36A 2B46X 5CFDC 4LLFA 5I91A 2OZJA 1SLBA 4PIZA 4FOYA 1HRV1 3DPRC 5I0UA 1F5FA 1C4RA 2UWCA 1BCXA 3HT1A 1O7FA 4U2AA 4AI3A 1RUH2 4Q8LA 1HV1A 1OOPA 4JDMA 2EF6A 3R4UA 5IUQA 2A3YA 1WCDJ 5KXBA 2RS13 2X5IB 5C6CA 3GBFA 1JOJA 2AZ5A 2BFUS 3H1MA 2E53A 1Q8SA 1F2NA 1H2NA 2HWC3 3KB5A 2AUYA 3JBG1 4Q4W2 1FOD3 5BY5A 3LCPA 1WD4A 2ZAAA 1FNYA 4BZ4A 4WVMB 2GC3A 4MGKE 1CAVA 1F31A 3R4SA 2P37A 1KJLA 2WSUA 4OHXA 2BVBA 4Q4W1 4MYEA 3E97A 1YIFA 2W08A 3IM0A 4UW6A 4XFHA 1MR5A 4JVAA 5T5LA 3AYEA 3OD4A 3TAYA 1VAVA 2HWF2 1EV13 1PGSA 4S2DA 2E51A 5HCAA 2QZ2A 4H7LA 2OUJA 3W59A 2VVEA 3S7IA 3FLPA 4N53C 5C8CB 1TQ5A 1ZZCA 2A7AA 1AHSA 1SBDA 1RUG3 5LK5A 3MPBA 5T5PA 1UW8A 5J7MA 4YVWB 2WNEA 2A6WA 2PHXA 2VG9A 4YGEA 1DGWA 3VDDC 1LOAA 4LTAA 3MLKA 3FBYA 1H1AA 1H8TC 4XFCA 3JU9A 1C5IA 3AZYA 4Q0PA 1OQ1A 1LCLA 1ULDA 1OQDA 5DUWA 1NYWA 2RS12 3MI8A 4HVOA 1RUOA 3A0NA 4M01A 1VBE2 4HANA 1NA1B 1FPN3 5HI0A 1AZDA 1ENQA 4NHKA 2WNVB 3HBZA 5FLIA 1ZZ6A 1D4M3 5IK5A 3APBA 1Q8PA 3PVBB 2BNMA 1FOD1 1RUI3 2ES3A 1R092 4I3GA 2ZX3A 2D43A 5JZGC 2VQAA 2PLV3 3D0JA 2ZABA 4LHKA 4Z8BA 5JSRA 1KS4A 1PVC2 3FE5A 4PLMA 3CO2A