4AEDC

Crystal structure of human enterovirus 71
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
242
structure length
242
Chain Sequence
GFPTEPKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRDGPWQSTMLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDTSHILQTASIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords VP1
publication title Crystal Structure of Human Enterovirus 71.
pubmed doi rcsb
total genus 40
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4aedC00
4JGYB 4CEWB 4QPGA 2HWE1 1AR82 2GH8A 1VRH2 1AYM2 1C8NA 5BNPA 2RS32 4RHV3 2RR13 2WS92 1PO12 2WZR1 4GMP3 4Q4W1 3VBSB 1BBT3 2HWD3 3TN92 5ABJB 3JB8A 1ZBA1 1RUE3 1NCQC 1ASJ2 1VBC3 2R063 1ZBE2 1RVF2 4PDWC 1RUI1 1QJU3 1RUF1 1SMVA 4RR3C 1B35C 1V9U1 4JGZC 4WM8C 1ND2A 5AC91 5CFCB 1HRI3 1RUD3 4YVWC 1Z7S3 2BBVA 3J8F2 1PVC2 1VBD3 4CDQC 2WFF2 5BNOC 4QPIC 1NA1B 3VBOB 1EV12 2HWB1 5J98B 3DPRC 3ZFFA 5CFDC 1AYN2 4QPGB 4Z92B 2RR12 5C9AA 2MEV1 1MQTC 1BBT2 1OPOA 5BNPB 1RUC1 1K5MA 1R093 1RUE2 3NAPA 1RUG3 2HWC1 2R062 1FOD1 1C8M2 3VBRC 1R081 1QJU2 5FMOS 2RMU1 4WM7B 2XBO3 2BFUL 1HRI2 5FOJB 1RUD2 1W39A 1Z7S2 2RS53 1GFF2 5ACA3 1VBA1 1VBD2 1TMF3 1QJX1 3CJIA 4NWVA 4IV3A 4Y5Z0 2X5IC 5ABJC 2R043 1AR61 1EAH3 4IV1A 2FZ1A 1POV1 4CDUC 1VBE3 1HRV1 5K0UA 3ZFFB 2WZR3 3VBHA 1RMU3 5C9AB 4RS5C 1AR83 1HXS1 3VBUA 3VDDA 1VRH3 1AYM3 2ZZQA 2PLV1 2WWSA 1RUG2 2WS93 1PO13 1K5MB 2BUKA 5CFCC 4SBVA 4GH4A 5DDJ2 4FTSA 3JD72 1COV1 2WLPA 4Y4YA 2RS12 4CDWC 5D8AA 1V9U3 1CJDA 5C4WA 2XBO2 3ZFGB 1NA1C 1AL22 2R073 3VBFC 5ACA2 2RM21 1BEV1 1TMF2 1MEC2 1PGL1 4N53A 2TBVA 2R042 5A32A 1HQNA 4IV3B 1POV0 3J8F3 2FZ2A 1EAH2 5BNNC 1PVC3 2HWE2 4GB31 1NCRA 1VBE2 2HWF1 4IV1B 1FPN1 2WZR2 1RMU2 1OOPA 5K0UB 1EV13 1ZBA2 3VBHB 1AYN3 5JZGA 1BMV2 3VBUB 3VDDB 4CEYC 1R1A1 4WM7C 1PIV3 1VB2A 1RUJ1 1H8TC 1QJY1 1R083 1D4M3 1RUI2 1RUF2 1V9U2 3ZFEA 1RHI3 3HAGA 1C8M3 1ND3B 2R072 1QQP1 4YVSB 1AR93 4Q4X1 1PO21 1WCDJ 2ZTNA 4CDXA 1IHMA 4N53B 4RQPA 1AUYA 2RS31 2HWB2 4NWWA 3TN91 1NCRB 1HRV3 4AEDC 1ASJ1 1HX6A 4Q4Y3 5L7OC 1OOPB 1ZBE1 3LOBA 1TME3 5C8CC 1PIV2 1VBB1 5J96B 3ZFGC 1NCQA 5JZGB 1FMD1 4RFT0 1R082 1D4M2 3JB4C 2RMU2 4PDWA 3JBG3 4RR3A 5DDJ3 1B35A 1RHI2 4JGZA 4WM8A 3JD73 3ZFEB 1A6CA 2RS13 1AR92 2BFUS 2WFF1 4N43C 1AR73 1NG0A 1VBA2 4YVWA 4JGYC 1ND2B 4CDXB 4CEWC 4CDQA 1AL23 5BNOA 1AR62 1NY72 4QPIA 2RR11 4RHV1 4EJRA 4GMP1 1MEC3 1BBT1 2HWD1 4RQPB 3VBSC 1HRV2 1RUH1 3DPRA 5CFDA 1FPN3 1RUE1 2HWE3 1MQTA 4Q4Y2 1VBC1 2R061 1PGW1 3IDEA 1TME2 1QJU1 4Q4W3 1ND3C 5LK7B 1M06G 4YVSC 1NCQB 1ZBA3 3VBRA 3JBG2 3NAPB 1RUD1 4PDWB 1CD3G 1QJZA 1RUI3 1RUF3 1QQP3 2ZAHA 4WM8B 1AR72 2RM22 1BEV2 4Q4V1 5AC93 3S6PA 4YVWB 4GMP0 3VBOC 1DDLA 2X5IA 5A33A 4QPGC 5ABJA 4FTBA 4BCUA 5BNOB 4FTEA 2HWF2 3CJIB 5BNPC 1FPN2 1R091 4CDUA 3DPRB 1RUG1 5CFDB 2HWB3 4RS5A 1MQTB 2MEV3 4Q4W2 5CFCA 1RUC3 2XBO1 3ZXAC 2HWC3 1FOD3 3VBRB 4CDWA 1ND2C 2RS51 4GH4B 5ACA1 2RMU3 1TMF1 1QQP2 1NA1A 4Q4X2 1PO22 3VBFA 5D8AB 5AC92 2R041 1EAH1 5C4WB 2VQ0A 1VBE1 1VBA3 1QJX3 5BNNA 2X5IB 1RMU1 3ZFFC 5A33B 1AR81 1VRH1 1NOVA 5C9AC 1AYM1 1RUH3 2QQPA 1AR63 1BMV1 5A32B 2WS91 1PO11 4CDUB 1K5MC 1POV3 4FSJA 3NAPC 2MEV2 1VBB2 4RS5B 1FMD2 4CEYA 4WM7A 1HXS3 1RUC2 5GKAC 1X33A 1RB8G 2PLV3 1H8TA 1RVF1 2HWC2 1FOD2 2R071 1COV3 4CDWB 4Q4V3 3J8F1 3CJIC 4IV3C 3VBFB 1PVC1 1AL0G 2RM23 4RHV2 1BEV3 4IV1C 1QJX2 2HWD2 1EV11 1RUH2 5BNNB 5K0UC 1AYN1 2Y26A 3VBHC 4GB33 1PIV1 4LLFA 3VBUC 1VBC2 3VDDC 4AEDA 2HWF3 1PGW2 5L7OA 1D4M1 4GH4C 5C8CA 1HXS2 1VB4A 3ZFGA 5FMOL 2PLV2 1RHI1 4CEYB 1C8M1 1VAKA 5D8AC 1R1A3 1H8TB 1RUJ3 1AR91 5C4WC 1QJY3 1COV2 1E57A 1HRI1 2IZWA 1Z7S1 4Q4V2 4N43A 4RR3B 1B35B 4N53C 1NY71 1VBD1 4JGZB 4JGYA 4Q4X3 1PO23 3M8LA 4CEWA 1PGL2 1NCRC 4Q4Y1 1R092 3VBSA 4CDQB 4GB32 1TME1 2RS33 1OOPC 1X36A 4QPIB 3TN93 5JZGC 3FBMA 4AEDB 2BPA2 1OHFA 1ASJ3 5L7OB 3JBG1 1ND3A 5DDJ1 5C8CB 1ZBE3 2GSYA 1R1A2 1RVF3 4YVSA 1F2NA 1VBB3 3JD71 1RUJ2 2RS11 1FMD3 3ZFEC 1F8VA 1QJY2 2RS52 1AR71 2DF7A 1AL21 4CDXC 2XPJA 1MEC1 4N43B 2WFF3 4RQPC 3VBOA
chains in the Genus database with same CATH superfamily
1J3RA 1FI2A 1H1AA 3D3AA 3HQXA 2B5HA 4UFKA 4QPGA 2HWE1 1WGPA 1W9SA 1UYZA 1AYM2 3PVBB 3WNKA 4Q1RA 1ZA4A 5I0DA 5BNPA 2RS32 3EB7A 3T2TA 2WS92 1PO12 4D0QA 1QWRA 2WN2A 4Q4W1 3PUQA 2J1EA 3ZPOA 2HWD3 2ZGUA 3GXUA 5CKMA 3TN92 3JB8A 5F5QA 4XF9A 1UZYA 1ZZBA 3B9CA 4K6BA 3ZXLA 2XVKA 1RUE3 5FQ0A 4WV8A 1ASJ2 2IVJA 3DKQA 1WW7A 1CJPA 3WW2A 2C9KA 2R063 1YRZA 3POSA 4OYUA 4OVEA 1UD1A 4P08A 4MXWA 2VY0A 4OHXA 1S0IA 3OBRA 1QU0A 1QH7A 4D7TA 4Y3OA 1DYOA 3RI8A 4A42A 3QD6A 1KDKA 2EA7A 3EYPA 2DVGA 5AC91 5CFCB 5IFPA 3FL7A 4RGGA 5FXXA 3AXEA 2JKBA 3K77A 1XOYA 3R4SA 4YVWC 2BBVA 3J8F2 4K3UA 2Y6JA 4XF3A 4ZU5A 5HV0A 4IEYA 1DYPA 1JYXA 5FPZA 5LB6A 2DVFA 4U2AA 1OH3A 3ZXJA 5DPNA 5K4LA 4EN0A 4TWTA 1UMHA 1NA1B 4XVHA 2NMOA 2QQVA 4XURA 3U4XA 4OUSA 2XJRA 3GNEA 3J7NA 1EV12 1V0AA 4KWJA 3NRUA 2VZSA 2Z2SB 3C3VA 3Q8BA 4OZOA 2VCBA 3RYPA 3TAYA 5C9AA 2G19A 1HW5A 2MEV1 2E7TA 2YV8A 4L9BA 3SEEA 3RWNA 1MQTC 1BBT2 1ULEA 5KHJA 4B4PA 2WIIB 1XRUA 1W6QA 3K51A 4UXAA 5EQUA 5IVBA 1YJLA 3MIEA 3JXSA 3NAPA 2V4VA 4G9SB 4NRPA 3UL2A 4E2SA 2H0BA 5CBLA 4YGBA 5I93A 2MPFA 4LKDA 4UT5A 2VM9A 4UFLA 4I30A 1FATA 1C8M2 2IFRA 4GQ7A 5FMOS 4DPNA 3KT4A 4OQ9A 4AE2A 1JZ2A 1NKGA 3SNMA 5FY0A 4DUWA 3B69A 3MLKA 2GNDA 2BWAA 4IGOA 5A1AA 2XBO3 3K48A 3WCSA 5FOJB 2ZEYA 3NW4A 5F7UA 1GR3A 3GGLA 2ZKLA 2QJVA 2DCYA 1SQ4A 2DWRA 2GZWA 4N7IA 1VBA1 1VBD2 1GQPA 1QJX1 2RVAA 3CJIA 4IV3A 1OA4A 4Y5Z0 1DFQA 2X5IC 2WYSA 4IDZA 1OA2A 3LPGA 1WBLA 4CCDA 3BU0A 1EAH3 4IV1A 4I3GA 5F5AA 1AX0A 1VBE3 2CV6A 1VR3A 4AL9A 1BXHA 3VHOA 1GWKA 1RMU3 1GOFA 1OLQA 4FP2A 4LOSA 1QNWA 3PJQA 3ZKUA 4Q8LA 1W8WA 3ZYBA 3FHQA 4BU2A 4XXAA 5CFCC 4GH4A 5CADA 3CKHA 5DDJ2 5FIXA 1WW6A 1V6LA 2CAUA 4CCNA 2P3IA 1COV1 3LEMA 2E6VA 3W5NA 2DUOA 1KJRA 3B02A 4Y4YA 3SC7X 4GWIA 4QMAA 2PN5A 2FDFA 4E4HA 1XE0A 1GOHA 3O1MA 1NA1C 4YG3A 1VJ2A 3VBFC 3MIDA 3Q8EA 4A4AA 4AYUA 1TZOA 2XUMA 1Q56A 1TMF2 1LB2A 1HJFA 1TNFA 5A3MA 5HCAA 5IYYA 1MZEA 4E4SA 3KGZA 4CCEA 5FWJA 4E4DX 5A32A 2WQZC 1H4HA 5C3SA 2GH2A 5ISLA 1W6OB 2A3YA 1NYWA 2HWE2 3PU8A 4H2AA 1O5UA 1KJLA 3DXTA 2VCMA 1A34A 3HIFA 3UETA 1G9BA 1FPN1 1ZZ9A 1BYHA 4XAEA 3NNGA 1CAUB 1E5IA 1NE6A 4COYA 4XJZA 1OOPA 5K0UB 1EY2A 4LOTA 4ARXA 4FXKB 3GZAA 1AYN3 2OW4A 3TB0A 1JZ7A 3QH6A 3H0OA 3VBUB 3VDDB 3VL8A 5FBZA 4CEYC 3IT8A 2QZ3A 3PHMA 2ZX3A 1V6OA 4MO3M 3WUDA 5I0UA 1CZSA 2Z42A 3O14A 1OI6A 4LHLA 1J59A 4E27A 2Z5WA 5CB7A 1DYKA 3ZFEA 2PHFA 5C71A 1RHI3 3S30A 4AK3A 2JECA 3K3OA 3I7DA 4R52A 5FUIA 2CGOA 3H3ZA 3MICA 4E2QA 1H6YA 1PO21 5IK4A 4QXKA 2XJPA 2ZHLA 2W3JA 3K2OA 2Y64A 4QKFA 4XTPA 1SACA 2RJ2A 5A7WA 2ZHKA 2F17A 5E16A 3RZHA 1UF2C 1W05A 2A6XA 4Y1YA 5GLZA 3OPZA 2D3RA 4UBGA 1AUYA 3N7MA 1EPZA 5B4XA 1W2OA 3JUUA 2BW8A 5L9VA 1C57A 5I91A 3WG4A 1A78A 2YYOA 1IZ3A 5IK8A 4GKXA 3GDBA 1Y43B 5J96B 1NX9A 2D44A 1IS4A 1JU3A 2EAKA 2P37A 2Q8DA 5JXHA 1FMD1 2AGSA 3B00A 4WVVA 1MVQA 3JB4C 3NSTA 4BDVB 3ZLIA 2JD9A 2I07B 2E7QA 2VMCA 4M3CF 4NAOA 1X7NA 4KBBA 4UF0A 5DAWA 3WNOA 2JXAA 5FO8B 4AI1A 4CPBD 1T6GC 4QQHA 3JD73 2PA7A 3C8XA 1A6CA 4QDQA 2FMYA 4XJWA 4I3PA 4MG2A 3HNBM 4N43C 2X8KA 4V2WA 5JDBA 1AR73 1NG0A 1AZDA 1SEFA 1SDDB 1VBA2 2OXBA 3MIBA 4ISQA 4YVWA 3SCHA 4CCOA 1GWMA 3ZDSA 4JGYC 1OPMA 4ORFA 1O8PA 4OHWA 3U1XA 4CDXB 1AL23 2VMEA 1WBFA 2QDNA 1XU2A 3E6BA 2N7GA 3NNMA 3DXUA 3MUY1 2YXSA 3AP4A 3ZN6B 1MEC3 1RGSA 4EJRA 3V0BA 2JDUA 4DS0A 3SCGA 1OSGA 3M3IA 2VR4A 1BVP1 3BIWE 1GKBA 5SV8A 1MQTA 1KFUL 2Y6KA 4Q4Y2 1PNFA 3D8CA 4E9KA 4XF4A 4I2OA 3GF6A 1TME2 1J84A 1UN1A 2QZ2A 3AZYA 4KI5M 2JICA 4BMBA 1W9WA 1MS8A 5LK7B 2JIGA 5FY9A 4NIDA 3AYCA 3THTA 5FZGA 3I59B 3T09A 3NQHA 1M06G 5C70A 2OIIA 4IGQA 3NNJA 1ZBA3 1SLAA 3J26N 2BQPA 3JBG2 1JUIA 1RUD1 3HOBA 4PDWB 1LOFC 1LENA 4LKEA 1LEMA 1BLZA 4XEZA 3P3NA 1RUI3 3KB5A 1RUF3 1UCXA 5DZFA 4XPVA 2ZAHA 1YIPA 1DBNA 3VN4A 2YB7A 1HQLA 5DABA 1GP6A 1MZFA 4AVSA 4GMP0 2B9UA 4B8EA 3VBOC 4D6RA 2X09A 5DAQA 4UBHA 2X5IA 4CCJA 2O14A 1JH5A 1YYNA 4LBQB 4IE7A 2VH9A 3ZYFA 2Y38A 2OUJA 3AMPA 4KGGA 5EV7A 1NLRA 1JOPA 1FPN2 1W3VA 2D5FA 1W8OA 1YJKA 2WNEA 4H3WA 2JDNA 2HBUA 5CFDB 2W46A 4YZ1A 1BK1A 1F5JA 1E5SA 2VC9A 4NUBA 1PMHX 5FZ0A 3KV4A 2L9LA 3WP6A 3POWA 2VOXA 5C3QA 5EWSA 4J1XA 2J1TA 2ZKNA 3Q8AA 5CFCA 5DUXA 1MR5A 1G9CA 1AJKA 4B4RA 3N7JA 1RC6A 3VGIA 3LSEA 1SFPA 2HWC3 1KEXA 3X29B 4A3ZA 4QKBA 4A2UA 2J1UA 1LNSA 3K4AA 1UL9A 4FPYA 1DZQA 5EYYA 4ISRA 5ACA1 5DUVA 1HIXA 2RMU3 2RV9A 5BNQA 4LHKA 5K9YA 1NA1A 1X50A 3MF6A 1PO22 3BTZA 2QCSB 3VBFA 5D8AB 1H0BA 2R041 5FPUA 5FR3A 4RA0A 5CZKA 4L0PA 4YLZA 4MGQA 4P9IA 4JQTA 1UYYA 2JB4A 2WO1A 1G9FA 4YG0A 3USUB 3B5LB 2WNOA 5FFOC 2X10A 2W92A 1D2SA 1PK6C 2QFEA 3LDKA 4AR2A 3ZFFC 5A33B 2VUAA 3ETQA 3N9LA 1UY3A 1RINA 3HQRA 2CAVA 1OD5A 2QQPA 1ULDA 2DFCA 3IMMA 4YFZA 3S5AA 1W6MA 4M0HA 3N9MA 2ZHNA 1K5MC 4XFIA 1NLQA 4FSJA 1RL3A 2A3XA 2R16A 4LR4A 3WY6A 4F7ZA 5FY1A 1SFYA 5I8YA 1SLIA 1FMD2 4CEYA 1LOCA 3HQUA 1DQ1A 1MACA 2E63A 3WQ1A 5GKAC 3I2OA 5KHKA 2GMPA 3CF6E 1HB2A 2PLV3 1RVF1 2Y6GA 3WSOA 3MI8A 4CPBA 1APNA 1FOD2 2FDHA 4JVAA 3CHXA 3OGSA 5DG1A 2XOMA 3LFIA 4M01A 2WT0A 2Q4SA 2GP3A 5A6QA 1JOJA 5LBCA 5LWBA 3NJVA 1LCLA 3GBWA 5K8SA 3VKLA 2FDIA 5CKNA 3POFA 3LEGA 2W1SA 3PMEA 1LGCA 1WD3A 1PVC1 2EXKA 1XNCA 3JCIA 4BQWA 3U0ZA 3KCCA 1JW6A 1AL0G 4RGKA 4LIUA 5I0TA 3ZPYA 5GZEA 2YPDA 2RM23 3N35A 4QX5A 3NV4A 3ST7A 3MDPA 4Q0QA 4DFSA 3JQWA 4A41A 1CGPA 3WEZA 2P3JA 3QLQA 2NLRA 1I9RA 4BQYA 4INDA 3S5QA 1SLBA 1PM7A 3TEXA 2E53A 1PIV1 3OBTA 4E8CA 3CU7A 4LQRA 4LPLA 3K46A 3MW3A 4DIQA 3PUIA 4FPEA 2DBNA 4TLGA 4YFWA 1D4M1 1UO9A 2OKXA 4EN8B 5J48A 1FV3A 5CG8A 3POGA 5EHDA 1OUXA 1VB4A 5IJRA 4PF1A 2ZZJA 3OF1A 4EQVA 1J1TA 4JDNA 3SXWA 1VAKA 1VE0A 3FFQA 1R1A3 5D8AC 3SCFA 2XVGA 2ZABA 3LGRA 4J1WA 4FFIA 4YGCA 4R8HA 1Q8OA 2HJIA 1KD7A 4YW4A 1QJY3 2WQ8A 2ZPXA 4NJ4A 2QQJA 2EAAA 1CAWA 2WFPA 3A0NA 3MV01 5CNAA 4A6OA 4LA3A 3V0AA 4XUOA 1Z7S1 4N43A 1KQRA 4RR3B 2WINB 5AVAA 2DDUA 4XFCA 2HEWF 1N1YA 5JSRA 3N36A 4JGZB 4JGYA 4LBQD 2WDBA 1XSRA 1IG0A 2ID4A 1CAUA 2IXJA 4KGQA 2YFUA 3VZLA 2WQ4A 3P3PA 1IS5A 3VKNA 1NCRC 4AHYA 1PGL2 2Q0AA 1U5IA 4B1LA 3KHCA 2WNVB 3B01A 3NV2A 5FREA 1DGLA 4LO6B 4G4FA 4XYXA 4MGIE 4XJUA 4CDQB 3OEAA 4ZPIA 2RS33 3OYWB 4I01A 4U36A 2A71A 3WP5A 4QHBA 3OBAA 3THPA 4OHZA 2Q8CA 3TN93 4LO8A 5JZGC 4CP9B 2E51A 3N4MA 3WNPA 4AEDB 2W9XA 3HJRA 3DYPA 4OLLA 4QX7A 4AOCA 1JYVA 1OHFA 1ASJ3 2QNKA 2W91A 3I8TA 5L7OB 1O4YA 2F6BA 3MIFA 5C8CB 1S0JA 4L92A 2XLGA 3RZGA 1WCUA 4OHYA 3LB9A 4XZPA 1HB3A 4YSFA 2W2IA 5FZDA 2DTYA 1RUJ2 5FZ4A 1A8MA 4K9SA 2XJQA 1W6PB 4K1ZA 3PU3A 3SKJE 2AZ5A 4Y24A 1LOFA 5FJKA 2RE9A 2ZGSA 2DF7A 1KRIA 1SBDA 1FV2A 3VHRA 4EZ4A 2CSGA 2XKOA 2XPJA 2RHPA 2VZUA 3NMBA 4P5YA 4KBZA 4DEVA 1OXCA 3VBOA 4JTNA 4NHXA 4OMDA 4GIQA 4MHUA 5IAXA 4CEWB 1CPMA 1Q8VA 1QXRA 5E88A 2GH8A 4M0NA 4Y1ZA 1JYNA 5FMDA 5F3EA 2BERA 2PHDA 1OQ1A 1PMIA 1S0DA 4RHV3 4Q26A 3VD7A 2WZR1 1W3XA 3VBSB 1BBT3 1Q8SA 2VZTA 4AHWA 4GJYA 4ATFA 1YO8A 3OOXA 4KU7A 1NCQC 5APAA 4NOTA 4BE3A 2ZMKA 4PLNA 2WA4A 4JRLA 4YGDA 1V70A 2XB6C 3T0AA 1JYIA 1HDKA 1ZBE2 2DU0A 1RVF2 2TNFA 4TYSA 2VG9A 3WG2A 2A75A 1SMVA 2FMDA 2VNVA 2VAUA 4RR3C 3WR0A 3WV6A 1XNDA 4JGZC 5JXIA 4D3WA 4MH0E 1CAVB 1H9WA 2R30A 1XJAA 4KNCA 3OD4A 1JZ5A 3LAGA 5LEJA 4HXCA 5FYCA 2O1QA 1PVC2 1C5HA 2VD7A 1VBD3 2WAOA 3ACHA 4QGLA 3ES4A 3TNPB 5FPVA 4CDQC 5C3OA 4JTOA 3ZSMA 2WNUC 1WKYA 3VD4A 4XBNA 5BNOC 1OMIA 2KD7A 2WUHA 2WN3A 3BU7A 2EALA 5FZMA 2HWB1 1PK6A 1Q8QA 2ZOEB 3DPRC 5J98B 3ZFFA 4GALA 1TE1B 1ULCA 2AENA 3F2ZA 1KFXL 2RR12 3RG0A 3VUOA 3INAA 2KA3A 4FPHA 1K5JA 1CVNA 4XJ8A 5FO9B 3AKPA 5EP9A 5HV4A 3I3DA 4H7MA 1GZWA 2QBXA 1X9TA 1RUC1 4HKLA 1K5MA 1R093 2JG8B 5DZGA 5F5CA 4XE9A 3T08A 5LRSA 2QQUA 4FPFA 1ENQA 4MSVA 4GWJA 4IEQA 2ZX1A 3RMYA 2FCTA 3MIHA 4QGMA 2JG9C 1WLTA 1WCQA 4O65A 3VBRC 3RZMA 1R081 1QJU2 1BJQA 1QXPA 2F4PA 1NQJA 3PVNA 2AUYA 3RDIA 5LA0A 1YIFA 2JX9A 4LJHA 2W47A 1OBNA 1Z7S2 2VTXJ 1UQXA 3AZXA 4LBQA 3L2HA 1WLCA 1W2AX 3NO8A 1TMF3 1XNAA 1OH4A 4NWVA 5FBJA 2RDSA 2FDKA 1MS9A 5FZBA 3BYWA 1AR61 3LEIA 3MPBA 2JDMA 5J3UA 1O8SA 3EQEA 2HKXA 3FUOA 2FZ1A 1POV1 5T54A 4YW3A 5FZ3A 2YU2A 4M3CB 1UOGA 4CDUC 1HRV1 3B3QE 1ENRA 1IG3A 4QGNA 1TQ5A 1QJEA 2Z4FA 3FMGA 2HYXA 5FZFA 1AR83 1HXS1 4NRQA 1V6IA 1VRH3 2XVLA 2ZZQA 2WWSA 4KQ7A 3WDUA 5IVVA 1QXJA 1RUG2 1VAMA 2DV9A 5LRRA 3UGGA 2BUKA 1OF4A 3VZMA 4LO4B 1IKPA 1NZCA 3OY8B 3AP7A 2BNOA 3NVCA 2YROA 3H8OA 5HCHA 2VVEA 3CZJA 4TSVA 5D8AA 3U75A 4K8RB 3H50A 4Q0SA 2DTWA 2XGXA 3ENRA 2PHTA 1O3SA 1VMJA 1O5LA 1X8EA 2YBPA 3USUA 1XB9A 1C5IA 2FQPA 3URFA 1GYKA 1ODNA 4W4ZA 4IEUA 2NYYA 1SFNA 4PLMA 4D7YA 4DEQA 1BEV1 4CU6A 4ONUA 3BUCA 1C28A 4WBBA 4KWUA 5JI7A 1H4GA 1I3HA 2KR2A 3PTYA 1G9DA 2GDFA 3WW3A 4NIIA 4Y20A 2C0ZA 2TEPA 5BNNC 3I2JA 4GB31 4R9CA 3LWCA 5GLTA 1NCRA 1VAVA 2IXCA 4BLIA 2HWF1 4CA9A 4K21A 2QDRA 5FY8A 1XPWA 3IZOA 4OI1A 5A3TA 2WZR2 1CR7A 2PQSA 2VQAA 3LPFA 1RJ8A 2XONA 5FZ9A 3M1HA 1VLNA 5FKCA 4SLIA 1DCSA 3VBHB 1W03A 5JZGA 1BMV2 2DCKA 4ATEA 4LK6A 1HLCA 2AYHA 4A7ZA 3LEKA 1JN2P 3JU9A 3K75B 1UU4A 3OB8A 1SHWB 1GMMA 2G9FA 3MFAA 1O3RA 1YI7A 1XXNA 4XIKA 5ERLA 1ZZCA 2K46A 4ITCA 5FP3A 1ND3B 4COWA 4IERA 2R072 3PVEA 1QQP1 3I2GA 1KS4A 1YQ8A 4BQ3A 4Q4X1 4XUTA 3AP6A 3ZXGA 3ZSLA 2O8OA 3C7GA 3WQBA 2WABA 2E33A 3KWVA 1IHMA 1NZIA 3OTFA 3WP3A 4ASLA 1UZ0A 4QU2A 2W1UA 5T50A 4D94A 3O1TA 2ZCWA 4N53B 4XACA 1LECA 3S0MA 5LY1A 1O3TA 2HWB2 5DN2A 2OZ6A 1U12A 2QQLA 4NWWA 4WVMA 3U78A 4CUCA 5F9TA 5I8SA 4K1YA 1ZNPA 5KXCA 1UZZA 3W59A 2JDAA 3AMQA 1YFYA 5GM0A 4Q0UA 3S7IA 4C1WA 3E5XA 1LHWA 4AXOA 1JZ4A 2ARAA 4Q4Y3 1W04A 5KHIA 3O1UA 5E1RA 3FUQA 1JTZX 1TME3 2DUPA 4L99A 5JCTA 4W6YA 1LGNA 1NCQA 1SDWA 4G3YC 2EXIA 3F95A 1OQDA 4HETA 3UESA 3VHNA 4RFT0 2A3WA 4NROA 1R082 3E6DA 3ZYRA 4QDSA 4IEWA 3T4VA 3DUIA 3U14A 5HXVA 3U4SA 5JOZA 5AFEA 3JBG3 2A6ZA 4RR3A 4XMIA 3BKZA 2C24A 1IPJA 2RJKA 4Y5SA 4JGZA 4GWMA 1UU5A 3I2HA 2RS13 4FPKA 1AR92 4X6QB 5FXWA 4B3NA 2WFF1 2RG4A 5T3NA 4MV2A 1US2A 2CDOA 2GNMA 3WDWA 4IXLA 3LIGA 1ND2B 2CWMA 4CDQA 4BIFA 2WNUA 3V56A 4J25A 5BNOA 3AP5A 3DGTA 1NY72 3PIGA 3KLSA 3WNLA 5A6XA 1AR62 2GP5A 1LHNA 3ZXEA 5LEKA 2OQ7A 2HWD1 4RQPB 4FQ4A 4NO4A 5A7SA 4D6QA 1EPWA 1HRV2 1RUH1 2WSVA 1ULGA 3DPRA 1FPN3 1Y9GA 4UI9L 1RUE1 2G1MA 3MW2A 3PDQA 5HPOA 5A7OA 4LHNA 1YI9A 1SZBA 3WVJA 2R061 1H2NA 1S4CA 1PGW1 5JMCA 4XZUG 1K3IA 1YQCA 1YQ5A 4AFDA 1W6PA 5B4NA 4QPYA 1GOGA 1ND3C 1OLME 3V64A 4CDWA 4P9JA 1EUUA 2DYCA 5ANNA 1YEWA 2D7FA 2JG9A 4ARYA 1JU4A 4LKSA 3VBRA 4QAWA 5T52A 2XQXA 5JOXA 5KXDA 3FX3A 4M4RA 3VDCA 1BK0A 4DOUA 1U5YA 1S2KA 4DUXA 1UXZA 1DZRA 1OQEA 4O9GA 4WM8B 1OFNA 5JAXA 1XC6A 3IKWA 1BEV2 2J1VA 4YM0A 4DUVA 1GQGA 1LULA 3UT0A 2NMNA 5LK5A 1DDLA 5EIYB 1H8VA 2D98A 2QQOA 4Y26A 4FTBA 4Q0PA 4K40A 3CEWA 4BCUA 4TTGA 2B42B 2DVDA 2ETEA 2HWF2 1D0GA 1TEIA 2XJSA 3AVRA 4QD2A 4CDUA 1FNZA 3HD8B 3IB3A 3ZYGA 4AGRA 4DY3A 4C1XA 4M3CE 4XILA 1LOGA 4FOYA 1MZ6A 4MHRA 1JHJA 1W8TA 4Q4W2 2HEVF 4B4QA 3G6JB 1WCSA 2ZEZA 4QXHA 5FO7B 1H30A 1T6BX 4X6RB 2IXHA 3AKQA 2XH6A 4L8QA 4NAMA 5AFBA 1CAXB 3I2FA 2XBO1 5A7PA 5JXGA 3DCQA 2E7AA 3FZ3A 5TSWA 4L2NA 3ZXAC 1FOD3 3CIHA 3BN6A 2VU9A 5CVRA 4AI2A 3LIHA 1ND2C 3EXUA 4Y33A 4QX3A 3THCA 4QX8A 3GCXA 1A8DA 1MZ5A 1LOEA 1QQP2 1S2EA 1W99A 1X82A 2A6YA 4Q4X2 3VDBA 1HJGA 1W9FA 4Z8BA 1S0GA 5AC92 4BQXA 3HNMA 4ET7A 4OUMA 1EAH1 3BALA 3AJYA 2YZ4A 3E1F1 3WOGA 2VQ0A 1VBE1 1SBFA 3VD5A 1YFXA 4OHVA 5BNNA 1RMU1 4FPJA 2ZXQA 1OLMA 4PQQA 5A7NA 1MS3A 3WQ7A 3N9OA 4UW4A 3VKOA 3ALQA 1FXZA 3K4ZA 3LFMA 1OFSA 4ZU7A 4EN7B 1DGRA 5I0SA 3HVDA 2MEV2 4RS5B 2K2SA 2W1WA 3FHIB 1SLCA 2BEOA 3PNAA 2LALA 3RVHA 1REDA 4Y1XA 4YM2A 3RPQA 3T30A 1CZTA 2D3SA 1UY4A 1RB8G 3S7EA 5A1LA 2EIBA 2BGCA 4Q0VA 4QX2A 1L7RA 2F4LA 5JWPA 2JDKA 3T0DA 3D6EA 3UYJA 5L9BA 1REEA 2ZX0A 1LU2A 3D82A 2XXZA 2D3PA 1G6NA 1WMXA 2ZBJA 4CDWB 1GZCA 4XTMA 1PM4A 2DCJA 1OUSA 2ZS6B 4PT6A 5D21A 3H8XA 2BNNA 4LUMA 3ZXKA 4BXSV 4HVRA 2LUWA 2H6CA 2VOKA 2BWCA 4FCAA 4HONA 2JJ6A 2VW2A 4M3CA 3BVCA 4CCKA 1UNBA 1F9KA 4NPMA 5FY4A 3EBRA 4BH9A 2Q30A 1QJX2 2J42A 2JDPA 2YDEA 3FFZA 2Y60A 1TG7A 2HWD2 3GYDA 4OFGA 2A1XA 2GC3A 3TRSB 2JE8A 1RUH2 4MXVA 5K0UC 1AYN1 2ZGKA 4K7JA 1WA4A 1W6NA 2ZEWA 1UIKA 2VZPA 3OY8A 1BQPA 1S0EA 2OT7A 2K0GA 3VBUC 3VDDC 2O0OA 1PGW2 2UWBA 4AAXA 1DP0A 1JOBA 2IXLA 3KMHA 4KG8A 2AACA 5FYHA 1GANA 3H1MA 3KZ4C 4J6GA 2FDGA 4BYYA 3M70A 5DQ0A 2DVAA 1RHI1 1IPSA 2YBSA 3O7OA 2ARXA 1YFWA 4OCTA 4URAA 2NN8A 1H8TB 2GMEA 4IL7A 1RUJ3 1S0BA 3PURA 1HV0A 1C1FA 1COV2 1R1ZA 2ZEXA 3WQ0A 2OYZA 4CXXA 3RQ0A 5HI0A 3VHPA 3WP4A 1HRI1 2WR9A 3KF3A 4Y22B 5C8WA 3AKSA 4FOWA 5IVCA 1PZ7A 3IAPA 4CRQA 1IS6A 1L3JA 5KXEA 1QIQA 2V72A 2ZGQA 4Q8KA 5FMCA 4AI3A 5JSOA 1H1IA 2WAAA 3KT1A 3M8LA 5D1IA 2Y8KA 5EJZB 3WDYA 1W9YA 4IEOA 1LHVA 2UYAA 4MUVA 1W0PA 1JI6A 3RFRA 3BPSA 2DVBA 1LHUA 1QJFA 2QQIA 2RDNA 2SBAA 4N8MA 3POJA 4GWNA 4XF1A 3CBNA 2RJLA 3HMYA 4V1PA 3J4UH 4AGVA 1J3PA 1WD4A 4TZDA 4OI0A 4QPIB 4Z82A 4BQ5A 4HSJA 1BKZA 1PVXA 5L9RA 5JXJA 5BYNA 1DGWA 3BTYA 5M0TA 5C33A 2IXIA 2VBBA 2VMDA 1QOSA 4I02A 4Z07A 3VLBB 2UY8A 1ND3A 4DZGA 5BV6A 3BCWA 1J58A 3MEPA 2WO3A 2GALA 1ZBE3 2VZVA 1RVF3 3O1VA 4AGGA 1VBB3 3JD71 3QCWA 3AC0A 5A6ZA 3MGUA 4JHTA 5FZ7A 3IPVB 4EWAA 1AR71 3DEMA 2JDYA 3IMNA 4BMEA 1CZVA 4QM8A 4QU1A 4NHMA 4W65A 1AL21 2ZGTA 4CDXC 3DL3A 3NV1A 2EIDA 1MEC1 2A6WA 1DHKB 3POYA 4XCBA 5A1FA 5FYVA 3OPWA 4EWEA 2ZGMA 2ADEA 3E5QA 3M3CA 5CU1A 1ULPA 2IFWA 1PZ9A 4LBOA 2J7MA 4GD4A 4AZZA 4XFFA 3KCYA 3ZM8A 4FFFA 2GC2A 5FZ6A 1C8NA 1SLTA 2RR13 3HNYM 3OEBA 4GMP3 4TN7A 5JPMB 1HV1A 3IIAA 1H2MA 3I3BA 5ABJB 5I8TA 4CCCA 2LW8A 1ZBA1 1STMA 5T5LA 4NIAA 2B9VA 5C6CA 4ZZ5A 1WMFA 4UW5A 1VBC3 2BOIA 3M3OA 4HL0A 3KF5A 1KXGA 4Y5TA 1Q5OA 3RZLA 1CWPA 3NWKA 4PDWC 1GNZA 4IE6A 1RUI1 1QJU3 1RUF1 1UY2A 2GN3A 4W6WA 5F8PA 1WZXA 1V9U1 1VMFA 1GLHA 2GNTA 2P1BA 3EHKA 5FZKA 3O1OA 5A3PA 1ND2A 3ASIA 3LKJA 3ZN5A 1XE7A 4FI9A 5F39A 3TBDA 4HPKB 3O1SA 3SH4A 4LBJA 3ECQA 4NVPA 5HCFA 1Z7S3 1QF3A 1MS4A 5FP7A 1BVVA 3OJBA 1QOTA 2HBTA 1W90A 3IN9A 1W2TA 4AVCA 3ABZA 1IQAA 4Q29A 3WDVA 4QPIC 1OURA 1EP0A 1RXFA 4ZONA 4AFCA 3WT3A 4I0WB 4C0BA 4JC1A 3R6SA 5FZOB 3N9NA 4IUGA 5CFDC 1AYN2 4QPGB 4Z92B 5KXBA 3MF9A 3KS7A 5BPXA 3VL9A 1G8WA 3PUAA 2VQUA 1QKQA 1WCKA 4V2VA 1QOOA 1YFUA 3B7MA 4P9GA 5FZ8A 2XQRA 4Q27A 3VZKA 1G7YA 5BNPB 1RUNA 3MUZ1 3WG1A 1GUIA 1W8UA 4MGTA 4AAPA 1RUG3 3MO4A 3WD5A 2HWC1 5FYSA 3GZEA 5FYTA 3WLUA 2W5FA 4LO5B 5IHRA 1UU6A 2VBDA 2RMU1 3C7FA 2AREA 2UYBA 2ZHMA 3CZUA 4MXWB 1UKRA 2OVUA 2WZ8A 2VMGA 2ES3A 4X8NA 1HRI2 5FXVA 2FCVA 4C0HA 1RUD2 1D2QA 3OGJA 2RS53 1JXNA 3BOPA 2CU5A 3I97A 1ULFA 2JE7A 2D40A 4A6SA 3JZVA 4JHZA 2Y34A 5FTTC 1W6OA 1MS0A 5ABJC 3CJXA 1H2KA 3FLRA 1DZTA 2XWBB 4EV0A 2LRPA 2X29A 4W8JA 5J36A 1HN0A 2C1FA 2R6QA 4N9HA 1AXZA 1FT9A 2VZOA 5K0UA 4ZZ8A 3SMHA 3CLPA 1NAEA 2WZR3 3FBYA 5C9AB 1U0AA 3VBUA 1CAXA 5FJHA 3VDDA 1AYM3 2D5HA 2V5DA 2R49A 2PLV1 4Y4RA 1DIWA 1W6QB 1ULOA 1PO13 2VNOA 2WS93 4KH9A 4QWNA 4S2HA 4X8PA 5IWFA 4XHBA 4FTSA 3TOJA 3KSCA 2QVSB 3JD72 4C91A 2VZRA 2WLPA 1GP5A 1DF0A 5T5PA 1MS5A 3RI9A 4HKWA 4LE4A 1LU1A 2LROA 3O1PA 3ZFGB 4JKKA 3KV5A 1LTEA 3A21A 4UOJA 3RJ2X 1K45A 4NR1A 1AL22 2R073 1MPXA 5LBEA 4A7YA 4NHLA 5ACA2 2VUJA 2PTMA 2RM21 3C7OA 4L11A 2VW0A 3RRDA 1DQ6A 5DUWA 1MEC2 4RYDA 4LIVA 3I2IA 5IVYA 1GBGA 2TBVA 2VBPA 3Q8FA 4LKFA 4RL7A 2R042 4IV3B 3USSA 1POV0 4WZFA 3J8F3 2FZ2A 3BTAA 3FJSA 2GN7A 2IXKA 3H3LA 2VQTA 4ZHNA 5CA6A 2YUEA 3WCRA 4P02B 4XFGA 5FLJA 4IV1B 4CUAA 1QEXA 1YQ6A 4CSWA 1AXKA 1HQWA 2DUQA 1SCSA 4HK9A 4IEVA 2DBIA 2K9ZA 3NNFA 4O61A 4QDRA 5CYYA 2VOTA 3OG2A 3D5OA 1EV13 4RSUA 5EJ3A 2PQQA 5KHHA 4QB1A 3VV1A 3VKFC 1ZBA2 1PX4A 4XQ4A 1O6UA 4PHZA 1R1A1 3WDXA 3BGAA 4XHXA 2LM3A 2W39A 1I5PA 3PLQA 4PLOA 5E8AA 2PFWA 5LW9A 3OD0A 4CZSA 1QJY1 1RIRA 4MGYE 1R083 1RUI2 1RUF2 4HSLA 3I4IA 3B93A 5FK8A 1V9U2 2YU1A 1VIWB 3PMSA 3TEWA 1GNHA 4XOGA 3I49A 2VVFA 5EXOA 1C8M3 3BODA 4LO7A 1ZZ7A 2DURA 5GZCA 3O5SA 4MX3A 5FZIA 4YVSB 5FUPA 3WDTA 2XR4A 3SQOA 1AR93 1ZREA 1WCDJ 4PIYA 1QGLA 4AI9A 4CDXA 1Y9MA 3M4FA 3IAQA 1YLLA 1PHMA 3SLIA 2E9QA 3ZN6A 3RJRA 2WNVC 4COVA 1W28A 4RGAA 4R9AA 4DXRA 2RS31 1S1AA 3VKMA 3FN9A 2ZGNA 2YGMA 3OUHA 1W2UA 2NPIA 4Q5OA 3TN91 3GJBA 1UYXA 2AEZA 1HRV3 3KQ4B 1HB1A 5IW0A 2VULA 4AEDC 1ASJ1 5LATA 2CHHA 2C6SA 5A7QA 5L7OC 2JENA 1N1TA 3MIGA 1OOPB 2Z79A 1XNTA 3KM5A 1CIYA 4DINB 5C8CC 1PIV2 2Y33A 3I59A 1WW4A 3ZFGC 1E5HA 1V6NA 3KV6A 2XJVA 3T4HB 2VOVA 4WZCA 4JCKA 1D4M2 5FZLA 4Y22A 2RMU2 4PDWA 4BQ1A 1LKNA 1E5RA 4BOWA 3KHBA 2P34A 3I3EA 1UIJA 5DDJ3 1CPNA 3NKGA 3EO6A 2VMIA 3ZSJA 2JEMA 3ZFEB 4CUGA 3H7JA 2VZ1A 1ZX5A 5EFUA 3UJOA 5JLVA 4XFHA 5CIRA 4CVUA 4XJAA 1F5FA 2YBKA 2BU9A 3KVBA 3SH5A 5T5OA 4LXLA 1UOJA 3ATGA 3C7HA 3RYRA 4AI8A 4CEWC 1CQ9A 1UZWA 1WUVA 2EIEA 4PCRA 4S2FA 5A7WB 4AVBA 5A80A 3ZYIB 4EYUA 4QPIA 4RHV1 2XL7A 2YY1A 4XBLA 4AQ2A 4QQPA 1BBT1 2UY9A 2Q8EA 1PX3A 3VBSC 1IGOA 2BOJA 3PTRB 4LORA 5IAVA 3UJQA 4DB5A 5CFDA 3FLPA 1UX7A 3LQCA 5F2SA 2ZGLA 2HWE3 1DLCA 1YUDA 2X53S 4UAPA 2ATFA 4URTA 4UYBA 1UMZA 3ZMNA 5JIUA 1Y9QA 4GA9A 4LLOA 5FRAA 4Q4W3 2NZ9A 3SH3A 1J1LA 4ZXEA 4YVSC 1JS9A 4XETA 1SLLA 3THDA 1XSQA 2JWPA 4JDOA 4K20A 5E89A 1OKOA 2CNAA 1KS5A 5FYYA 3HN1A 3VD9A 1AXYA 4A7KA 1OT5A 3RS6A 1QMJA 4UF0B 5C5UA 3O0VA 5FWEA 5JI9A 2JIJA 1QQP3 2YC2A 3P1IA 3ACFA 2J1RA 3GHMA 2RM22 2BVBA 4N9IA 2PHWA 3R0RA 1ODMA 3GZTB 1QDOA 3P6BA 4Q4V1 5AC93 1C4RA 4XUPA 4YVWB 4YYOA 1QHDA 2XKPA 1RUOA 5GALA 1DQ0A 1W2NA 5A33A 4AFAA 2WC2A 5CAZA 2LTNA 5ABJA 4JKLA 5IT6A 1SPPB 1EYBA 3POIA 4GZ9A 3MW4A 3U37A 3KV9A 4AQSA 1R091 1JZ8A 3V0BB 3OCPA 4HMZA 2JG8C 4BIOA 1QNYA 4NPRA 5FY5A 2EIGA 2CWSA 1MQTB 2MEV3 3OUIA 5DZEA 4DQAA 4FXGB 1VPHA 3HT1A 2BYVE 1JYWA 1UX6A 4I09A 4XDOA 1SG3A 4HBNA 4DRRA 3A0KA 2KM2A 2OUHA 5GLVA 3C7EA 4BK4A 3E5UA 4JRAA 4YZ5A 5K7PA 2QQNA 4LA2A 4E8DA 4HN0A 4HANA 2A70A 2D6LX 1TMF1 4PI2A 2V73A 1I6XA 4CP2A 1I1EA 4AQTA 5FYMA 1T2XA 3KT7A 1ALYA 3H7YA 4FQZA 5A3LA 5FZOA 5FPXA 2WLQA 5C4WB 3NNLA 3ACGA 3HEIA 3G7DA 5F6KA 4DXSA 5A3WA 4PI0A 3BPZA 1VBA3 1UKGA 2FD8A 1QJX3 1UOBA 2X5IB 3WX5A 1AR81 5F37A 3W5MA 4LEJA 1VRH1 5A70A 1RUH3 3P5BA 2W0XA 3LA3A 5LBFA 5FZ1A 3IDAA 3ZOIA 1HKDA 3J9SA 3TYJA 1JYTA 5HCBA 1YQ2A 3FWEA 3W58A 1FX5A 2C9AA 2GC1A 2YC4A 4HG6B 3AMHA 5L36A 1IQDC 1XNBA 2A7AA 2BRTA 3AL6A 5FYUA 2PAEA 4ZY9A 5H9QA 1S0CA 2QQKA 3J7HA 2Q1MA 4M00A 1RUC2 5T55A 2CTVA 1ACCA 2ERFA 4TLFA 1X33A 5KC5A 1OD3A 5T5JA 2QKDA 4OI2A 1YNAA 2D6PA 4COZA 1W8ZA 1LRHA 4QXBA 4DNYA 1JODA 2JDZA 4W50A 2CGPA 1XYPA 3Q8CA 1COV3 4LT5A 2XJTA 5GZDA 4PIXA 3UV9A 2E26A 4FP3A 2WRAA 1MS1A 2VOWA 4XQWA 4D6SA 4FPGA 4H14A 3VBFB 4IEPA 2WWJA 3NJXA 3AYDA 1IOAA 2DFBA 1RJ7A 1ZVFA 3I54A 4AVVA 1C3HA 3FC0A 2WBKA 4RHV2 2WNVA 3NJZA 3MLJA 3SISA 5B2GB 4YW6A 3MV11 1NQDA 2EICA 2PXJA 3OYWA 1MVEA 5GJ6A 2H6BA 3O0XA 3VBHC 3UNPA 4LTAA 4AG4A 4CP9A 4GAZA 4AEDA 1REFA 5IVJA 3SITA 5FYZA 5FXZA 2BV4A 1W6MB 5IUQA 3C2UA 3LDRA 5FLHA 2XLFA 5L7OA 1YXWA 2UWCA 4FVVA 5C8CA 1HXS2 3ZFGA 3SHRA 4XMAA 3QH7A 4YM1A 2LS6A 2PAMA 2XHNA 4CEYB 3L2YA 3W9AA 4YW7A 5CEHA 1UAIA 1KITA 3EJKA 4QQLA 4BQ4A 2EXHA 3U07A 5C4WC 2G9GA 3H1YA 2ARCA 3IDBB 5H9RA 4TXWA 2VZQA 2YC0A 4JX0A 1E57A 4YM3A 2IZWA 2G9ZA 4I0AA 2Q5TA 3ACLA 2PELA 4Q4V2 4XJ9A 1DGWX 1UWWA 1B35B 4N53C 3AVSA 4IQPA 3WHUA 1GICA 3UGFA 1PO23 4CEWA 4HN1A 4BK5A 2ZAAA 5FDBA 4UFMA 4ZS2A 4HVQA 4BLJA 1N3PA 2B46X 3AYAA 4Q4Y1 1R092 1SBEA 1OKQA 3M3EA 2J22A 5LA9A 3VBSA 5A3UA 4GB32 1TME1 3BIEA 2VECA 4P5HA 1PMJX 2G4IA 1X36A 2W52A 2ZMLA 3UKVA 2VUDA 3PVOA 4ASMB 2EXJA 3KGLA 5HXMA 4O9EA 1ZRFA 3IIIA 1XQNA 5JR2A 5L19A 5C5TA 1O91A 1NUKA 2UURA 2AR6A 4HLTA 4JDMA 4P14A 2WZPP 2I45A 4FO9A 4MADA 1JZ6A 3JBG1 5A3OA 3KQRA 3OUJA 1B09A 2GSYA 4YVSA 5BY5A 1DQ4A 1F2NA 1ZRIA 2WZEA 3AYEA 3RZZA 1C1LA 3RYKA 2RS11 4E2GA 1FMD3 5LY2A 2X05A 4IEXA 1CAVA 3DN7A 3WNXA 4AF9A 1D4VB 1F8VA 2P5BA 4LBNA 5F32A 1DGRN 5IATA 4XUQA 2XUEA 3AK0A 3AZWA 1CAWB 4MYEA 4Z1VA 3N7LA 4NN0A 3V0AB 2WWUA 4N43B 1ST8A 2JE9A 3GHNA 3O12A 5A6YA 1G86A 5DAPA 4RQPC 5H9SA 3D0SA 2Y0IA 3Q9OA 4JGYB 2YG0A 3I2DA 5JIAA 2ZGRA 5LCWL 4AHXA 1Z0HA 3EMRA 2ZX4A 1AR82 2BGOA 4YARA 3L9JT 1VRH2 3N3HA 2BJSA 2OPWA 4BJ0A 3AKRA 1RITA 5J09A 4D8MA 2JG8A 3GBFA 2BVVA 2D6NA 1WLWA 3IWZA 3NKTA 2PHLA 3U10A 3DV8A 2V5YA 2VMFA 1ZM1A 1NLSA 3OGRA 4YGEA 5EJ1B 3A4UA 4XUNA 4BB3A 1PGSA 4LNVA 4C90A 4UFJA 1ZRDA 1XYNA 3MYXA 5IVFA 1ENXA 1L7QA 4HOOA 3WHTA 4BM8A 1B35C 1LHOA 5BXXA 1O4TA 2VMHA 4IGPA 4WM8C 1D0HA 5F3GA 3RNSA 4JQRA 2XL9A 2GNBA 1HRI3 3J7MA 1RUD3 2VJXA 4R9DA 3PL0A 3AFKA 4P9XA 2IC1A 2R7EB 4HT1T 2WFF2 1W06A 2DCZA 3R4DB 2OZJA 1XE8A 2WT2A 3ZDVA 3OBZA 4UFIA 3RMXA 2CL2A 3ZR5A 4YW5A 4FPOB 3VBOB 3WF2A 4LMFA 1UOFA 3D0JA 4IESA 2ZJCA 3MZHA 2XJUA 3VB9A 1V6JA 2NP0A 3MBWA 4JZRA 1OPOA 2B45X 2DCTA 2WJSA 3ITQA 5JSPA 1LODA 1DQ5A 3VDAA 1RUE2 5KBFA 4I0BA 2VCCA 4LUKA 1U5XA 4BPZA 5F2WA 5H9PA 3OGGA 2R062 4AEKA 1AF9A 1FOD1 4Q1PA 1JHNA 3H8UA 2YFZA 5JPNB 1GP4A 1W8NA 3WF1A 5CKQA 5HBAA 2JD4A 2BBAA 3AM2A 4A3XA 3GJAA 4LITA 1KDMA 3GALA 3OSDA 4WM7B 3WF4A 3ZIWA 5GLUA 2BFUL 3A23A 3AKTA 3CNAA 1W39A 4A45A 3AP9A 1WMDA 3A22A 1SPPA 1GFF2 5ACA3 5CG9A 4FPCA 4DY5A 3POEA 2TUNA 5FZAA 1GU3A 1WWYA 2C4XA 3WUCA 2VTXA 3OGVA 3T1LA 1ENSA 2R043 3H1WA 1P8JA 3QBQA 5IK7A 3M7AA 3POBA 2A6VA 3IDCB 5DG2A 4S2DA 3LOIA 3VZJA 3ME2A 4DO0A 2QQWA 1PK6B 3ZFFB 2BNMA 1NXD1 1UXXX 2UWAA 3VBHA 2IVIB 3HN3A 3QACA 4RS5C 5LA2A 1N3QA 2VW1A 3WNNA 1F4HA 3JQXA 1CX1A 3AL5A 3IBMA 2QTWB 3LSDA 5IVEA 4QXCA 2MHFA 1GZWB 1HB4A 1G9AA 1VALA 1K5MB 3LDBA 2VVDA 4SBVA 2W87A 4UWDA 1UPSA 2PHRA 4Y1UA 3AMNA 1F4AA 4GULA 1GV9A 4LBLA 1Z78A 1VP6A 2RS12 4CDWC 4AHZA 3ZYHA 1EUTA 4LBKA 3AJZA 5DUUA 1V9U3 2VL4A 4DMIA 4FBFA 1CJDA 4FFGA 1H6XA 2XBO2 5C4WA 5JOYA 2R0FA 1GQHA 5L73A 3LD8A 4B7KA 1LOBA 1TNRA 3ACIA 3K4DA 3W21A 3WXPA 1CX4A 1QH6A 3WINE 1WA6X 1QY4A 2R0HA 4MGZE 4NPLA 4N53A 1PGL1 4JKMA 2Q1FA 4AVAA 3VD3A 2FBEA 1HQNA 3H8RA 1OVPA 3ZXFA 1EAH2 2AC1A 4YPJA 5BUVA 3WF0A 1PVC3 1ZA7A 4N90A 4PF5A 1VBE2 4OULA 5E6HA 1IPKA 3WF3A 2RDQA 3N7KA 1RMU2 2QQMA 2YHJA 3ES1A 4KG0A 5LBBA 1H1MA 4BWOA 4OUEA 4GKYA 4ZU4A 1OA3A 3ILNA 4OMCA 1JBCA 2XDVA 4WM7C 1PIV3 3KCXA 5FYBA 4NHKA 1VB2A 2VNRA 4D69A 5KWRA 1RUJ1 2BTVC 3AZZA 1H8TC 4HK8A 5EYXA 3E97A 4GJZA 4QX1A 3AMMA 3RGBA 4AEMA 1D4M3 1FNYA 4RD7A 2OS2A 5D2AA 3WNMA 2GMMA 5DXDA 2WA3A 5AVPA 1US3A 4F8AA 1I5ZA 1DLLA 2ILMA 1Q8PA 1CN1A 2OX0A 2ZMNA 3GZUC 1M4WA 3HAGA 4IETA 3T1MA 4MLOA 3LF7A 1O7FA 3T2PA 1UY0A 1UY1A 4QPWA 3RZKA 2H0VA 2ZGOA 3I3MA 2ZTNA 5FPBA 2OA2A 1JZ3A 4EN6B 5JMOA 3HT2A 1RYYA 1UYPA 3DYOA 3IM0A 1LEDA 3MHZA 5F3IA 5FYIA 3WW1A 2R1BA 4RQPA 4CP0A 4CTEA 4ZKTB 4HFSA 4Y20B 2W08A 2XHKA 1DU3D 5JR7B 1NCRB 4YZ2A 2CGNA 3TEYA 3AXDA 1QDCA 2JB8A 3B9IA 4UW3A 4CE8A 2VCAA 4QT6A 4LHSA 4RFRB 3CDZB 2QUOA 1HX6A 2VUCA 4MZUA 2VTFA 5G05L 5LA1A 1ZBE1 4XW3A 1XBFA 2PHXA 4P00B 1N1SA 3HR9A 1VBB1 4L97A 3LOBA 3ILRA 1JYCA 5JZGB 2ZACA 4YG6A 3HWJA 5GZFA 3W20A 1SCRA 4PJYA 3RSJA 3AX4A 1CIWA 2NQYA 3ZYJB 4KU8A 4MGKE 1UW8A 1YWKA 5FQ0B 1DG6A 4FOVA 4NMIA 4R9BA 1B35A 1RHI2 2Y0OA 2WO2A 1TVGA 3LA7A 4WM8A 4OI4A 4PIZA 2OPKA 3KVAA 3M2MA 2ZA9A 4KWLA 4WVZA 2BFUS 3WZ1A 1ZZ8A 3FHAA 3MPPG 2V09A 4IE4A 1IKQA 2EVXA 2GAUA 3NL1A 4PQ9A 3S57A 1NT0A 3R4UA 4P9LA 2P6CA 4XC9A 4P9YA 3NV3A 5JOWA 1J83A 4LE3A 3DYMA 2RR11 3BOWA 4GMP1 4Y1VA 4META 2IUWA 2FHRA 1URXA 1W0NA 2RDRA 2C26A 3J7LA 5ANQA 4XBQA 2A73B 2VGDA 4W6XA 4XIOA 3D4KA 4WVMB 4FAGA 4OQ8A 3O1RA 3UKNA 1PZ8A 2VPVA 4IEZA 2AEYA 4HKOA 3A7QA 1NXMA 3T3YA 1VBC1 3ZYPA 2DU1A 2ORXA 2P3YA 3H42B 3IDEA 4M4PA 1F15A 3AZVA 3CQOA 4QB6A 4XAAA 4Z2AA 5I0RA 1QJU1 4EE2A 4CCLA 1ZZ6A 2BGPA 2D93A 1S55A 2E31A 3FE5A 5C3RA 2ET7A 2CYFA 2W94A 1CESA 1NCQB 4CU7A 4AW7A 4FFHA 4KWKA 3N9QA 4CU9A 4H55A 4D7SA 4CXYA 1YC61 3NAPB 3QOPA 5IFTA 3DF0A 4XDPA 5DAVA 3ZSEA 3O0WA 4EZHA 1CD3G 2WYFA 1X9PA 1WW5A 1QJZA 1ZYBA 4XXPA 4XFBA 3PUSA 3ZKYA 1ONAA 1W9TA 4R4ZA 2B39A 2ET1A 2W95A 1AR72 2NM1A 1CONA 1WLDA 2VXJA 3S6PA 1V6KA 2XWJB 2AH2A 1Y3TA 2Y6LA 2ADDA 4HZFA 3I2KA 3ORJA 4ZS3A 5CISA 4QPGC 1XNKA 4WVWA 2WNUB 3SKVA 1AX2A 5BNOB 4FTEA 1Q43A 3GM8A 4AVTA 3CJIB 5BNPC 1OLRA 1FAYA 1XU1A 3RZJA 3BI3A 3DPRB 1RUG1 4PBOA 5J1XA 1D7PM 2HWB3 2EF6A 2SLIA 3GCWA 4B29A 4BXFA 1NE4A 5KHGA 4RS5A 4YRDA 5FZHA 4FOQA 2C5DA 5FLIA 2VNGA 3ON7A 2WKKA 1AVBA 1AJOA 1IS3A 1RTVA 1RUC3 2P6HA 3E6CC 2HLEA 3HBKA 3WG3A 4UW6A 5FK7A 2JG9B 3ZSKA 2ZGPA 3VBRB 2D6KA 1U5ZA 2PMWB 1A3KA 2JDHA 3ILFA 5F6LB 3SEPA 4YW2A 2RS51 4GH4B 3T0BA 3ZMOA 4CUBA 2YMZA 5KR7A 4BZ4A 4AWDA 3ELNA 1XYOA 2GC0A 3ZO0B 3DKWA 2B8MA 2OQ6A 4YZ3A 4ZXKA 3ZVXA 4MOAA 1F31A 1O4ZA 5FAXA 1POQA 4K8FA 4MGSA 1YCIA 5C7GA 2VXRA 2I2SA 3ETPA 4ES9A 1F35A 4O7XA 4FAHA 4NIGA 4DXZA 1BHGA 1Y7BA 3HPNA 5KC6A 3VZNA 4R4XA 5F5IA 3WW4A 4CXWA 4XABA 2MNGA 5C9AC 1NOVA 1AYM1 1GZ9A 4QHOA 2B4KA 2WT1A 1OC1A 3LCPA 5F3CA 1AR63 4QKNA 3ZN4A 1BMV1 1GSLA 2IWGB 2R1DA 2WS91 1PO11 4JV4A 2Y6HA 5FP4A 2XG3A 5A32B 4CDUB 5A3NA 1S2BA 1L7LA 4QHZA 4YW1A 1POV3 4DXTA 3NAPC 3GBGA 4XDQA 4EROA 2P4EA 3H3UA 3TWIA 4AI0A 1VBB2 2D43A 3AB0A 1ZRCA 2WSUA 4WM7A 1HXS3 2PAKA 2I74A 3FLTA 4E4ZA 4QX0A 5FP9A 1DQ2A 1H8TA 1V00A 4QB2A 4IE0A 3OPTA 5FMBA 2HWC2 4LBMA 5FP8A 5GLWA 1N47A 4CP1A 2R071 3TEZA 2Q1ZB 1W8FA 3NJYA 4BQ2A 4AQ6A 4YZ4A 1O59A 2W1QA 3LZZA 2KXLA 4S2GA 3BTXA 4LK7A 1GZTA 1PNGA 5GZGA 2JKXA 2Y6FA 3LE0A 4IE5A 4UFHA 4QKDA 3U11A 4BHPA 4ES8A 4F3JA 2HH9A 4Q4V3 4QM9A 3J8F1 1N1VA 3CJIC 4NE9A 1HN1A 1VMHA 3CL1A 2XLAA 3R05A 4IV3C 5FCCA 2E32A 2Z69A 3VZOA 2ENRA 1R64A 2D97A 5FKBA 2CDPA 5FY7A 3KD4A 3UK9A 2R32A 1BEV3 3DECA 4IV1C 1J3QA 2VE1A 2VZ3A 3K3NA 4RN5A 1JMUB 4XF0A 4YWAA 3ZX7A 2PYTA 1EV11 4N7UA 4COUA 1W0OA 1JUHA 3BB6A 5BNNB 5LZ6A 1K42A 2Y26A 3ZR6A 1LOAA 2WO7A 1V6MA 2A5ZA 4GB33 2D6OX 2HYKA 2P3KA 1VBC2 3I3QA 4LLFA 5J7MA 2HWF3 2HEYF 2WL1A 1O3QA 1W8HA 1OF3A 1AX1A 2XMLA 4GH4C 3UGHA 1X8MA 5FV3A 2BDRA 1UMIA 3MLLA 4CYDA 3CO2A 5LASA 3APBA 5FMOL 2PLV2 1C8M1 5JUVA 2O8QA 3IPVA 4LULA 4GXLA 4IW3A 4XCAA 1AR91 1BZWA 5JVVA 1LGBA 2FCUA 3HBZA 5C3PA 5DMYA 4A44A 2P17A 1LAJA 2ARBA 1K12A 4B7EA 2Q8OA 4EWDA 2ZX2A 3UKTA 4AEJA 2UU8A 5FZCA 1OVSA 2J1AA 4BISA 4BA6A 2BZDA 3B94A 3T2QA 1NY71 1VBD1 5J37A 5IK5A 2V4AA 1H9PA 3M3QA 2W68A 1AHSA 2QE3A 1RXGA 4Q4X3 3ZXDA 1BCXA 1UZVA 3RWKX 3PUHA 1GNYA 4AFBA 1H2LA 3PIJA 5FPLA 4H7LA 4JAAA 1UPIA 2FDJA 1LESA 4EN9B 4AFMA 4CCMA 4XQDA 4NIHA 1S0FA 3H9AA 4YNIA 1N3OA 2PHUA 1OOPC 5G04L 2YPJA 4XFAA 1Y4WA 4NRMA 2YGLA 3TNQA 1W6NB 2J1SA 4DRVA 2D6MA 3ZIXA 2BP6A 4HVOA 3FBMA 4FPLA 5EZWA 3T2OA 2BPA2 4P9WA 3MFCA 5FUNA 4PBPA 5F1RA 4NHYA 5DAXA 4CU8A 5FZEA 5DDJ1 4F83A 4KL1A 4C8DA 1R1A2 2GU9A 3AFGA 4QQOA 5SV5A 3ZFEC 1QJY2 4OZXA 2RS52 4MVTA 4KMQA 2P2KA 4HPKA 1LJ7A 3LA2A 4Z2WA 2CY6A 2VO5A 3CMGA 5EPAA 4ASKA 1GWLA 4QQ2A 5FOBB 1ZRRA 2ORZA 3ROUA 1KGYA 1LR5A 1FYUA 1Q3EA 4Q2FA 3V65A 2B7YA 4B1MA 4FT8A 2WFF3 1WMEA 3N9PA 5FPAA 1VRBA 1YHFA 3PJYA
chains in the Genus database with same CATH topology
1J3RA 1FI2A 1H1AA 3HQXA 2B5HA 4QPGA 2HWE1 1WGPA 1AYM2 3PVBB 4Q1RA 1ZA4A 5BNPA 2RS32 3T2TA 2WS92 1PO12 1QWRA 4Q4W1 2HWD3 2ZGUA 3TN92 3JB8A 5F5QA 4XF9A 1UZYA 1ZZBA 3B9CA 4K6BA 3ZXLA 2XVKA 1RUE3 5FQ0A 4WV8A 1ASJ2 1WW7A 1CJPA 3WW2A 2R063 1YRZA 3POSA 4OVEA 1UD1A 4MXWA 2VY0A 4OHXA 1S0IA 3OBRA 1QU0A 1QH7A 4D7TA 3RI8A 3QD6A 1KDKA 2EA7A 2DVGA 5AC91 5CFCB 4RGGA 3AXEA 2JKBA 3R4SA 4YVWC 2BBVA 3J8F2 4K3UA 4XF3A 4ZU5A 4IEYA 1DYPA 5FPZA 2DVFA 4U2AA 3ZXJA 4EN0A 4TWTA 1NA1B 2NMOA 3U4XA 4OUSA 2XJRA 3GNEA 1EV12 4KWJA 3RYPA 2Z2SB 3TAYA 3C3VA 5C9AA 1HW5A 2MEV1 2E7TA 2YV8A 4L9BA 3RWNA 1MQTC 1BBT2 1ULEA 5KHJA 4B4PA 2WIIB 1XRUA 1W6QA 3K51A 4UXAA 1YJLA 3MIEA 3NAPA 4G9SB 3UL2A 4E2SA 5CBLA 2H0BA 4YGBA 5I93A 2MPFA 4I30A 1FATA 1C8M2 2IFRA 4GQ7A 5FMOS 4DPNA 3KT4A 4AE2A 3SNMA 3B69A 3MLKA 2GNDA 2BWAA 2XBO3 3K48A 3WCSA 5FOJB 3NW4A 1GR3A 2ZKLA 2QJVA 2DCYA 1SQ4A 2DWRA 2GZWA 4N7IA 1VBA1 1VBD2 1QJX1 3CJIA 4Y5Z0 4IV3A 1OA4A 1DFQA 2X5IC 1OA2A 1WBLA 1EAH3 4IV1A 4I3GA 1AX0A 1VBE3 2CV6A 1VR3A 1BXHA 3VHOA 1RMU3 1OLQA 4FP2A 1QNWA 3PJQA 4Q8LA 4XXAA 5CFCC 4GH4A 5CADA 5DDJ2 1WW6A 1V6LA 2CAUA 2P3IA 1COV1 2E6VA 2DUOA 1KJRA 3B02A 4Y4YA 4QMAA 2PN5A 1NA1C 4YG3A 1VJ2A 3VBFC 3MIDA 4AYUA 2XUMA 1Q56A 1TMF2 1LB2A 1TNFA 5A3MA 5HCAA 1MZEA 4E4SA 3KGZA 4E4DX 5A32A 2WQZC 1H4HA 2GH2A 1W6OB 2A3YA 1NYWA 2HWE2 1O5UA 1KJLA 3HIFA 1G9BA 1FPN1 1ZZ9A 1BYHA 4COYA 1CAUB 1NE6A 4XJZA 1OOPA 5K0UB 1EY2A 4FXKB 3GZAA 1AYN3 2OW4A 3TB0A 3QH6A 3H0OA 3VBUB 3VDDB 3VL8A 5FBZA 4CEYC 3IT8A 2QZ3A 3PHMA 2ZX3A 1V6OA 3WUDA 5I0UA 2Z42A 3O14A 1OI6A 4LHLA 1J59A 4E27A 2Z5WA 5CB7A 1DYKA 3ZFEA 2PHFA 1RHI3 3S30A 4AK3A 2JECA 3I7DA 4R52A 2CGOA 3H3ZA 3MICA 4E2QA 1PO21 5IK4A 4QXKA 2XJPA 2ZHLA 4XTPA 1SACA 2ZHKA 5E16A 1UF2C 4Y1YA 2A6XA 5GLZA 3OPZA 2D3RA 4UBGA 1AUYA 3N7MA 1EPZA 3JUUA 2BW8A 1C57A 5I91A 3WG4A 1A78A 2YYOA 1IZ3A 5IK8A 4GKXA 1Y43B 5J96B 2D44A 1IS4A 2P37A 2EAKA 1FMD1 2AGSA 3B00A 4WVVA 1MVQA 3JB4C 3NSTA 2I07B 2E7QA 4M3CF 1X7NA 4KBBA 2JXAA 5FO8B 4AI1A 1T6GC 4QQHA 3JD73 2PA7A 1A6CA 4XJWA 2FMYA 4I3PA 4N43C 2X8KA 5JDBA 1AR73 1NG0A 1AZDA 1SEFA 1VBA2 3MIBA 4ISQA 4YVWA 3SCHA 3ZDSA 4JGYC 1OPMA 4ORFA 4OHWA 4CDXB 1AL23 1WBFA 2QDNA 1XU2A 3E6BA 2N7GA 3ZN6B 4EJRA 2YXSA 3AP4A 1MEC3 1RGSA 3V0BA 4DS0A 3SCGA 1OSGA 3M3IA 1BVP1 3BIWE 1GKBA 5SV8A 1MQTA 1KFUL 4Q4Y2 1PNFA 3D8CA 4E9KA 4XF4A 4I2OA 3GF6A 1TME2 1UN1A 3AZYA 2QZ2A 2JICA 4BMBA 1MS8A 5LK7B 3AYCA 3THTA 3I59B 1M06G 2OIIA 1ZBA3 1SLAA 3J26N 2BQPA 3JBG2 1JUIA 1RUD1 4PDWB 1LOFC 1LENA 1LEMA 4XEZA 3P3NA 1RUI3 3KB5A 1RUF3 1UCXA 5DZFA 4XPVA 2ZAHA 1YIPA 1DBNA 3VN4A 1HQLA 1MZFA 4AVSA 4GMP0 2B9UA 4B8EA 3VBOC 4UBHA 2X5IA 1JH5A 1YYNA 4LBQB 2VH9A 2Y38A 2OUJA 3AMPA 4KGGA 5EV7A 1NLRA 1FPN2 2D5FA 2WNEA 1YJKA 4H3WA 5CFDB 4YZ1A 1BK1A 1F5JA 3WP6A 3POWA 2VOXA 5EWSA 4J1XA 2ZKNA 5CFCA 5DUXA 1MR5A 1G9CA 1AJKA 4B4RA 3N7JA 1RC6A 3VGIA 3LSEA 2HWC3 3X29B 4A2UA 1UL9A 4FPYA 1DZQA 5EYYA 4ISRA 5ACA1 5DUVA 1HIXA 2RMU3 5BNQA 4LHKA 5K9YA 1NA1A 1X50A 3MF6A 1PO22 2QCSB 3VBFA 5D8AB 1H0BA 2R041 4RA0A 4YLZA 4P9IA 1G9FA 4YG0A 3USUB 3B5LB 5FFOC 1D2SA 1PK6C 2QFEA 3ZFFC 5A33B 2VUAA 3ETQA 1RINA 2CAVA 1OD5A 2QQPA 1ULDA 2DFCA 4YFZA 1W6MA 4M0HA 2ZHNA 1K5MC 4XFIA 4FSJA 1RL3A 2A3XA 2R16A 4LR4A 3WY6A 4F7ZA 1SFYA 5I8YA 1SLIA 1FMD2 4CEYA 1LOCA 1DQ1A 1MACA 2E63A 3WQ1A 5GKAC 5KHKA 2GMPA 3CF6E 2PLV3 1RVF1 3MI8A 1APNA 1FOD2 4JVAA 5DG1A 4M01A 2WT0A 2Q4SA 1JOJA 1LCLA 3GBWA 5K8SA 3VKLA 3PMEA 1LGCA 1WD3A 1PVC1 2EXKA 1XNCA 3JCIA 3U0ZA 3KCCA 1JW6A 1AL0G 5I0TA 3ZPYA 5GZEA 2RM23 3N35A 4QX5A 3NV4A 3ST7A 3MDPA 4Q0QA 4DFSA 3JQWA 1CGPA 2P3JA 3QLQA 2NLRA 1I9RA 4INDA 1SLBA 1PM7A 2E53A 1PIV1 3OBTA 3CU7A 3MW3A 4FPEA 4YFWA 1D4M1 5J48A 4EN8B 1FV3A 5CG8A 1VB4A 2ZZJA 3OF1A 1J1TA 4JDNA 3SXWA 1VAKA 3FFQA 1R1A3 5D8AC 3SCFA 2XVGA 2ZABA 3LGRA 4J1WA 4YGCA 4R8HA 1Q8OA 2HJIA 1KD7A 4YW4A 1QJY3 2ZPXA 2EAAA 1CAWA 2WFPA 3A0NA 5CNAA 4LA3A 3V0AA 1Z7S1 4N43A 1KQRA 4RR3B 2WINB 5AVAA 4XFCA 2HEWF 1N1YA 5JSRA 3N36A 4JGZB 4JGYA 4LBQD 2IXJA 1CAUA 4KGQA 3VZLA 2WQ4A 3P3PA 1IS5A 3VKNA 1NCRC 4AHYA 1PGL2 2Q0AA 1U5IA 2WNVB 3B01A 3NV2A 5FREA 1DGLA 4LO6B 4G4FA 4XYXA 4MGIE 4XJUA 4CDQB 2RS33 3OYWB 4I01A 4U36A 2A71A 3WP5A 4QHBA 3THPA 4OHZA 3TN93 3N4MA 4LO8A 5JZGC 2E51A 4AEDB 4OLLA 1OHFA 1ASJ3 2QNKA 3I8TA 5L7OB 1O4YA 2F6BA 3MIFA 5C8CB 1S0JA 4L92A 2XLGA 4OHYA 3LB9A 4XZPA 4YSFA 2DTYA 1RUJ2 1A8MA 4K9SA 2XJQA 1W6PB 4K1ZA 2AZ5A 4Y24A 1LOFA 2RE9A 2ZGSA 2DF7A 1KRIA 1SBDA 1FV2A 3VHRA 2XKOA 2XPJA 2RHPA 3VBOA 4JTNA 4GIQA 4CEWB 1CPMA 1Q8VA 1QXRA 5E88A 2GH8A 4M0NA 4Y1ZA 2PHDA 1OQ1A 1PMIA 1S0DA 4RHV3 4Q26A 2WZR1 3VBSB 1BBT3 1Q8SA 4AHWA 4ATFA 1YO8A 4KU7A 1NCQC 4NOTA 4BE3A 2ZMKA 4PLNA 2WA4A 4JRLA 4YGDA 1V70A 2XB6C 1JYIA 1HDKA 1ZBE2 2DU0A 1RVF2 2TNFA 4TYSA 2VG9A 3WG2A 2A75A 1SMVA 2FMDA 4RR3C 3WR0A 3WV6A 1XNDA 4JGZC 4D3WA 4MH0E 1CAVB 1H9WA 2R30A 4KNCA 3OD4A 3LAGA 5LEJA 2O1QA 1PVC2 1C5HA 4QGLA 1VBD3 3TNPB 3VKOA 3ES4A 4CDQC 4JTOA 3ZSMA 2WNUC 4XBNA 5BNOC 1OMIA 3BU7A 2EALA 2HWB1 1PK6A 1Q8QA 2ZOEB 3DPRC 5J98B 3ZFFA 4GALA 1TE1B 1ULCA 2AENA 1KFXL 2RR12 3RG0A 3VUOA 3INAA 2KA3A 4FPHA 4XJ8A 1CVNA 5FO9B 3AKPA 4H7MA 1GZWA 4HKLA 5DZGA 1RUC1 1K5MA 1R093 2JG8B 4XE9A 5LRSA 4FPFA 1ENQA 4MSVA 4IEQA 2ZX1A 3RMYA 3MIHA 4QGMA 2JG9C 1WLTA 3VBRC 1R081 1QJU2 1BJQA 1QXPA 2F4PA 1NQJA 3PVNA 2AUYA 3RDIA 1YIFA 2JX9A 1Z7S2 3AZXA 4LBQA 3L2HA 1WLCA 3NO8A 1TMF3 4NWVA 1MS9A 1AR61 3MPBA 5J3UA 3EQEA 2HKXA 3FUOA 2FZ1A 1POV1 5T54A 4YW3A 4CDUC 4M3CB 1HRV1 3B3QE 1ENRA 4QGNA 1TQ5A 3FMGA 1AR83 1HXS1 1V6IA 1VRH3 2XVLA 2ZZQA 2WWSA 4KQ7A 3WDUA 1QXJA 1RUG2 1VAMA 2DV9A 5LRRA 3VZMA 2BUKA 4LO4B 1IKPA 1NZCA 3OY8B 3AP7A 2BNOA 3NVCA 2YROA 2VVEA 4TSVA 5D8AA 3H50A 4Q0SA 2DTWA 2XGXA 3ENRA 2PHTA 1O3SA 1O5LA 1X8EA 3USUA 2FQPA 1C5IA 3URFA 1GYKA 4IEUA 2NYYA 1SFNA 4PLMA 4D7YA 1BEV1 4ONUA 1C28A 5JI7A 1H4GA 1I3HA 3PTYA 1G9DA 2GDFA 3WW3A 4Y20A 2C0ZA 2TEPA 5BNNC 4GB31 4R9CA 3LWCA 5GLTA 1NCRA 1VAVA 2IXCA 4BLIA 2HWF1 4K21A 2QDRA 4OI1A 2WZR2 1CR7A 2VQAA 1RJ8A 3M1HA 1VLNA 4SLIA 3VBHB 5JZGA 1BMV2 2DCKA 4ATEA 1HLCA 2AYHA 4A7ZA 1JN2P 3JU9A 1UU4A 2G9FA 3MFAA 1O3RA 1YI7A 1XXNA 4XIKA 1ZZCA 4ITCA 1ND3B 4COWA 4IERA 2R072 3PVEA 1QQP1 1KS4A 4Q4X1 3AP6A 3ZXGA 3ZSLA 2O8OA 1IHMA 3OTFA 3WP3A 4ASLA 4QU2A 5T50A 4D94A 2ZCWA 4N53B 1LECA 3S0MA 1O3TA 2HWB2 2OZ6A 1U12A 4WVMA 4NWWA 5F9TA 5I8SA 4K1YA 1ZNPA 5KXCA 1UZZA 3W59A 3AMQA 4C1WA 1YFYA 5GM0A 4Q0UA 3S7IA 3E5XA 1LHWA 4AXOA 4Q4Y3 5KHIA 5E1RA 3FUQA 1JTZX 1TME3 2DUPA 4L99A 5JCTA 4W6YA 1LGNA 1NCQA 1SDWA 4G3YC 2EXIA 4HETA 1OQDA 3VHNA 4RFT0 2A3WA 3ZYRA 1R082 3E6DA 4IEWA 3DUIA 5HXVA 5JOZA 5AFEA 3JBG3 2A6ZA 4RR3A 4XMIA 2RJKA 1IPJA 4JGZA 4GWMA 1UU5A 2RS13 4FPKA 1AR92 4X6QB 4B3NA 2WFF1 5T3NA 4MV2A 2GNMA 3WDWA 4IXLA 1ND2B 2CWMA 4CDQA 4BIFA 2WNUA 3V56A 5BNOA 3AP5A 3DGTA 1NY72 1AR62 3KLSA 3ZXEA 1LHNA 5LEKA 2HWD1 4RQPB 4FQ4A 4NO4A 1EPWA 1HRV2 1RUH1 2WSVA 1ULGA 3DPRA 1FPN3 1RUE1 3MW2A 4LHNA 1YI9A 3WVJA 2R061 1H2NA 1PGW1 5JMCA 4AFDA 1W6PA 4QPYA 1ND3C 3V64A 4P9JA 2DYCA 2D7FA 2JG9A 3VBRA 5T52A 5JOXA 5KXDA 3FX3A 4DOUA 1U5YA 1S2KA 1DZRA 1OQEA 4O9GA 4WM8B 1OFNA 5JAXA 3IKWA 1BEV2 4YM0A 1GQGA 1LULA 2NMNA 5LK5A 1DDLA 1H8VA 2D98A 4Y26A 4FTBA 4Q0PA 4K40A 3CEWA 4BCUA 2B42B 2DVDA 2ETEA 2HWF2 1D0GA 1TEIA 2XJSA 4QD2A 4CDUA 1FNZA 3HD8B 3ZYGA 4AGRA 4DY3A 4C1XA 4M3CE 4XILA 1LOGA 4FOYA 1MZ6A 4Q4W2 2HEVF 4B4QA 3G6JB 1WCSA 5FO7B 1H30A 4X6RB 2IXHA 3AKQA 2XH6A 4L8QA 5AFBA 1CAXB 2XBO1 2E7AA 3FZ3A 5TSWA 4L2NA 3ZXAC 1FOD3 5CVRA 2VU9A 4AI2A 1ND2C 3EXUA 1A8DA 1MZ5A 1LOEA 1QQP2 1X82A 2A6YA 4Q4X2 4Z8BA 1S0GA 5AC92 4OUMA 1EAH1 3BALA 3AJYA 2YZ4A 3WOGA 2VQ0A 1VBE1 1SBFA 1YFXA 4OHVA 5BNNA 1RMU1 4FPJA 1MS3A 3WQ7A 4UW4A 3ALQA 1FXZA 1OFSA 4ZU7A 4EN7B 1DGRA 5I0SA 2MEV2 4RS5B 2K2SA 3FHIB 1SLCA 2BEOA 3PNAA 2LALA 1REDA 4Y1XA 4YM2A 3RPQA 2D3SA 1RB8G 3S7EA 4Q0VA 2BGCA 5JWPA 3D6EA 1REEA 2ZX0A 1LU2A 3D82A 2D3PA 1G6NA 2ZBJA 4CDWB 1GZCA 4XTMA 2DCJA 2ZS6B 2BNNA 4LUMA 3ZXKA 4HVRA 2LUWA 2H6CA 2VOKA 2BWCA 4FCAA 2JJ6A 2VW2A 4M3CA 1F9KA 3EBRA 4BH9A 2Q30A 1QJX2 2YDEA 3FFZA 4OFGA 3GYDA 2HWD2 2GC3A 3TRSB 1RUH2 4MXVA 5K0UC 1AYN1 2ZGKA 4K7JA 1WA4A 1W6NA 1UIKA 3OY8A 1BQPA 1S0EA 3VBUC 2K0GA 3VDDC 2O0OA 1PGW2 2UWBA 2IXLA 3KMHA 4KG8A 1GANA 3H1MA 3KZ4C 4J6GA 4BYYA 3M70A 2DVAA 1RHI1 3O7OA 2ARXA 1YFWA 2NN8A 1H8TB 2GMEA 4IL7A 1RUJ3 1S0BA 1HV0A 1C1FA 1COV2 1R1ZA 3WQ0A 2OYZA 3RQ0A 5HI0A 3VHPA 3WP4A 1HRI1 4Y22B 5C8WA 3AKSA 4FOWA 1PZ7A 4CRQA 1IS6A 1L3JA 5KXEA 2ZGQA 4Q8KA 4AI3A 5JSOA 1H1IA 3KT1A 3M8LA 5D1IA 3WDYA 4MUVA 4IEOA 1LHVA 2UYAA 1W0PA 2DVBA 1LHUA 2SBAA 4GWNA 4XF1A 4V1PA 2RJLA 3HMYA 4AGVA 3J4UH 1J3PA 1WD4A 4TZDA 4OI0A 4QPIB 4Z82A 4HSJA 1BKZA 1PVXA 5BYNA 1DGWA 5C33A 2IXIA 4I02A 4Z07A 1QOSA 3VLBB 4DZGA 2UY8A 1ND3A 5BV6A 3BCWA 1J58A 3MEPA 2GALA 1ZBE3 1RVF3 4AGGA 1VBB3 3JD71 3QCWA 3MGUA 3IPVB 4EWAA 1AR71 3IMNA 4BMEA 4QM8A 4NHMA 4W65A 1AL21 2ZGTA 4CDXC 3DL3A 3NV1A 1MEC1 2A6WA 1DHKB 3POYA 4EWEA 2ZGMA 3E5QA 3M3CA 5CU1A 2IFWA 1PZ9A 4LBOA 4XFFA 3KCYA 2GC2A 1C8NA 1SLTA 2RR13 4GMP3 5JPMB 1HV1A 3IIAA 1H2MA 5ABJB 5I8TA 1ZBA1 5C6CA 5T5LA 1WMFA 4UW5A 1VBC3 4HL0A 3M3OA 1KXGA 1Q5OA 3NWKA 4PDWC 1GNZA 1RUI1 1QJU3 1RUF1 4W6WA 2GN3A 1V9U1 2GNTA 1GLHA 3EHKA 1ND2A 3ASIA 3LKJA 3ZN5A 1XE7A 3TBDA 4HPKB 3SH4A 4LBJA 3ECQA 4NVPA 5HCFA 1Z7S3 1QF3A 1MS4A 1BVVA 3OJBA 1QOTA 3IN9A 4AVCA 1IQAA 4Q29A 3WDVA 4QPIC 1EP0A 4AFCA 3WT3A 4I0WB 4C0BA 4JC1A 3R6SA 5CFDC 1AYN2 4QPGB 4Z92B 5KXBA 3MF9A 3KS7A 5BPXA 3VL9A 1G8WA 1QKQA 1WCKA 1QOOA 1YFUA 3B7MA 4P9GA 3VZKA 5BNPB 4Q27A 1G7YA 1RUNA 3WG1A 1RUG3 3WD5A 2HWC1 3WLUA 4LO5B 1UU6A 2RMU1 2AREA 2UYBA 2ZHMA 4MXWB 1UKRA 2OVUA 2VMGA 2ES3A 4X8NA 1HRI2 4C0HA 1RUD2 1D2QA 3OGJA 2RS53 1JXNA 3BOPA 1ULFA 2JE7A 2D40A 3JZVA 5FTTC 1W6OA 1MS0A 5ABJC 3CJXA 1H2KA 3FLRA 1DZTA 2XWBB 4EV0A 2X29A 5J36A 2C1FA 2R6QA 4N9HA 1AXZA 1FT9A 5K0UA 3SMHA 3CLPA 2WZR3 3FBYA 5C9AB 1U0AA 3VBUA 1CAXA 3VDDA 1AYM3 2D5HA 2R49A 2PLV1 2VNOA 1DIWA 1W6QB 1PO13 2WS93 4S2HA 4KH9A 4X8PA 4XHBA 4FTSA 3TOJA 3KSCA 2QVSB 3JD72 4C91A 2WLPA 1DF0A 5T5PA 1MS5A 3RI9A 4HKWA 4LE4A 1LU1A 3ZFGB 1LTEA 3RJ2X 4NR1A 1AL22 2R073 4A7YA 4NHLA 5ACA2 2VUJA 2PTMA 2RM21 4L11A 2VW0A 3RRDA 1DQ6A 5DUWA 1MEC2 1GBGA 2TBVA 4RL7A 2R042 4IV3B 3USSA 1POV0 4WZFA 3J8F3 2FZ2A 3BTAA 3FJSA 2GN7A 2IXKA 5CA6A 2YUEA 3WCRA 4XFGA 5FLJA 4IV1B 1AXKA 1HQWA 2DUQA 1SCSA 4HK9A 4IEVA 2K9ZA 4RSUA 3D5OA 1EV13 5EJ3A 2PQQA 5KHHA 3VV1A 3VKFC 1ZBA2 4XQ4A 3WDXA 1R1A1 4XHXA 2LM3A 2W39A 3PLQA 4PLOA 5E8AA 2PFWA 3OD0A 4CZSA 1QJY1 1RIRA 4MGYE 1R083 1RUI2 1RUF2 4HSLA 3I4IA 3B93A 1V9U2 1VIWB