4NRPA

Crystal structure of human alkbh5 in complex with n-oxalylglycine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
219
structure length
211
Chain Sequence
QQLQKEEEARKVKSGIRQMRLFSQDECAKIEARIDEVVSRAEKGLYNEHTVDRAPLRNKYFFGEGYTGPGQERLYPPGDVDEIPEWVHQLVIQKLVEHRVIPEGFVNSAVINDYQPGGCIVSHVDPIHIFERPIVSVSFFSDSALCFGCKFQFKPIRVSEPVLSLPVRRGSVTVLSGYAADEITHCIRPQDIKERRAVIILRKTRLDAPRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA demethylase ALKBH5
publication title Crystal structures of the human RNA demethylase Alkbh5 reveal basis for substrate recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 56
structure length 211
sequence length 219
ec nomenclature ec 1.14.11.53: mRNA N(6)-methyladenine demethylase.
pdb deposition date 2013-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 4nrpA00
4QKBA 4OCTA 3RZKA 3BTXA 3H8XA 4ZHNA 3O1MA 3S57A 3LFMA 4CXXA 3BKZA 3T4VA 3BIEA 3I3MA 3RZMA 4MGTA 5F8PA 4ZS3A 3BTZA 3RZGA 3I2OA 3O1RA 2FD8A 4IE6A 4CXWA 4IE5A 3KHCA 2IUWA 3BTYA 4NIGA 3BU0A 4CXYA 4JHTA 4NROA 4NIHA 4IE4A 3O1SA 4IE0A 4NIIA 3O1PA 4NIDA 4QKDA 4MG2A 2FDIA 4NPMA 2FDFA 3RZHA 4NPLA 4NJ4A 3T4HB 4ZS2A 3RZJA 3H8OA 4NRQA 4NRMA 4QKFA 3I49A 3BI3A 4RFRB 3O1VA 4IDZA 4NRPA 3H8RA 3S5AA 4O7XA 4O61A 3BUCA 2FDKA 3KHBA 3RZLA 4QKNA 2FDGA 4IE7A 4QHOA 2FDHA 3I3QA 5DABA 3T3YA 3O1UA 3O1OA 3O1TA 2FDJA
chains in the Genus database with same CATH superfamily
4Y33A 2I07B 3CMGA 4BQXA 1QQP1 2VD7A 1ZZ9A 5CKNA 2WZPP 3BPZA 1ASJ2 1LRHA 4ZZ5A 3OPZA 1UQXA 2W08A 4AHWA 3GM8A 1FYUA 4H3WA 1RUG2 4GA9A 1UZVA 1WLWA 3E6CC 1RUF2 1OA3A 5KHHA 5CFDA 4URAA 3C7HA 4XBNA 2QQNA 2QE3A 2VL4A 3NWKA 4FOWA 4XDPA 1HDKA 1VMFA 1DG6A 3MGUA 4CDXA 5FAXA 4LBNA 4UI9L 4CDQB 1I6XA 2WRAA 2A3YA 2ET7A 2XVKA 4C1WA 2W1UA 2NMOA 1J3QA 2E9QA 1JZ2A 1VBB3 1ZNPA 2ET1A 3ORJA 3ST7A 1LOBA 2VECA 3I2OA 4OMCA 2PYTA 2VZTA 1JODA 1J3PA 1UF2C 5A33A 1C8M3 3KV6A 1TME3 1IQAA 2Q8OA 4P9GA 4NIGA 4R8HA 4MUVA 5FZ8A 3H3ZA 4PIXA 4CDQC 2EIBA 2UURA 5E1RA 1SMVA 1UOGA 1OLME 1XYPA 4CE8A 4G3YC 2ZOEB 2BGPA 4CYDA 1VAMA 4LPLA 3B93A 1LAJA 4KH9A 4DZGA 4Q4Y3 5HCHA 3NV1A 4YW2A 2DUOA 4AFBA 3ACLA 3IDEA 3WR0A 5K0UA 3NNMA 4Q1RA 4HL0A 1QXPA 1CIWA 2D98A 4LO6B 3WNMA 4B1LA 5AC93 1G9AA 4LK6A 3VL9A 3ZFEB 1Q8OA 1XE8A 1SLTA 1YO8A 2NN8A 2PXJA 2ZGSA 2HWF1 4LHNA 3WXPA 4LKEA 4COYA 3IIAA 3HD8B 1YJLA 4AQSA 4YG0A 2WR9A 1DGWX 2ARBA 1BMV2 1X50A 2E31A 4WVWA 3VBFA 4DS0A 1NE4A 4NPLA 1ACCA 1O8SA 1FV3A 5GALA 4H7LA 3ZYBA 2A3XA 3SCHA 5A32B 5C8WA 1H8TA 4IV1B 4KBZA 2C24A 5L36A 1S0GA 2W46A 1L3JA 1WCUA 2GSYA 1GZWB 2WS91 3POWA 3VLBB 5IAVA 5C9AB 5ABJA 1JZ5A 1AYN1 2VXRA 5LATA 2IXHA 1ZVFA 3HVDA 3WQ1A 1PGW1 2KXLA 2YUEA 3M7AA 3ZR5A 2W94A 1V00A 3SH3A 2IXCA 4N9IA 4M4PA 3VD4A 2R042 4J25A 3RJ2X 4BXSV 4YG3A 4BWOA 3RNSA 5FTTC 3KHBA 3WNPA 1XC6A 4IV1C 1V0AA 2WL1A 4YLZA 4YVWB 5KHKA 3W5MA 5JZGB 4BQ4A 2WUHA 1YIFA 5D8AB 5C9AC 2R071 3JXSA 4ARYA 3PURA 2AENA 2F4LA 2KR2A 2VUDA 3AP4A 3HT1A 2PA7A 1CVNA 4P9WA 4AW7A 4FPOB 1RUJ2 1DFQA 3D82A 4LHSA 4Y5SA 3JB4C 5A3LA 3GZUC 4FTBA 3LDKA 1O6UA 1SLIA 2B42B 1R1A2 2ZGNA 2OUHA 5FP7A 1NZCA 3MF9A 4YVWC 5EYXA 2BERA 1XXNA 2WSUA 5C3PA 4LXLA 5D8AC 3KCXA 4W6WA 1TEIA 4QXKA 4Q4X3 2RS31 4A6SA 1L7QA 5LA2A 1J3RA 1NX9A 2ARXA 4OVEA 1JI6A 2HWE2 2RMU3 1DU3D 2HJIA 1Y9QA 3HT2A 3IAQA 3WP6A 1OKOA 1WBFA 3AVSA 5C6CA 3I59A 3VHPA 2JDHA 1DDLA 1RUI3 4M0NA 3FX3A 2RVAA 2P3IA 1AX0A 5DZGA 1CJDA 4DXTA 1NXD1 2B45X 3OYWA 4UBGA 5FPXA 1OMIA 3WDWA 4KQ7A 1XNKA 2RJ2A 2BEOA 4QGLA 2ZGKA 4W4ZA 2V4VA 1YFWA 3D0JA 4CCCA 4QPIA 2MEV3 4CCLA 4ITCA 1NAEA 2D6OX 4OHWA 5FXZA 3B5LB 3O1RA 4HSJA 5F37A 5JI9A 3B7MA 5BUVA 5J3UA 1C3HA 1GYKA 1GOHA 1COV3 5K7PA 2VZ3A 1W04A 2XJTA 2X5IB 3AMNA 3LA2A 4KGQA 3WDXA 5LWBA 1NCQA 4SBVA 5FOBB 1FXZA 4DPNA 1QJX3 1BVP1 4QB2A 2ZA9A 4LR4A 5GLTA 3AP7A 4HZFA 4V2WA 3VZOA 1W90A 1I1EA 1H6XA 4QGMA 4WVVA 2CSGA 5F32A 4KG8A 2VMHA 1PVXA 1FV2A 1UMHA 2Y0IA 4FOYA 2VZRA 4HFSA 4WM7C 1SZBA 5F5IA 3PUQA 3Q8FA 1UMIA 1CZTA 2X5IC 4CP1A 4YW1A 4CSWA 3LDBA 1R093 1RIRA 2VNVA 4C1XA 5J09A 4ASKA 1OVPA 2JDZA 1OT5A 3ABZA 2RV9A 4NHLA 5LZ6A 1JBCA 5JSOA 1YWKA 3AX4A 2A6ZA 4A3ZA 1QDOA 1O7FA 1GQPA 1JW6A 5FZHA 4HK8A 2D43A 5H9PA 3H7JA 4GMP1 4IEVA 2Y6GA 4JKMA 4XQDA 4FP3A 4C0HA 4I01A 2ZBJA 3JQWA 1LECA 2GNTA 3I2DA 4X6RB 4KBBA 5A3MA 5ACA3 2QQJA 1ULGA 3WT3A 3OPTA 5BPXA 3SCFA 1SACA 3KZ4C 3ZN6B 4YZ2A 2TEPA 4CP2A 1CAXB 3M2MA 4XDQA 5CB7A 4BQWA 4CP9B 3H8RA 1RUH1 2B9UA 3H0OA 5FREA 3O14A 3UK9A 1LU2A 4GB32 1X36A 2E7AA 4XJZA 3I7DA 3SEEA 3WCRA 2OPWA 3POBA 2FDKA 4QM8A 3LGRA 4TYSA 3USUB 5FRAA 4A2UA 5FUNA 3CNAA 1W2UA 5HXVA 1VBC2 4QKNA 2C9KA 3J8F1 5FXXA 5FJKA 2GNMA 2B4KA 3QBQA 4UAPA 1MQTA 2WABA 4OULA 2P17A 3G6JB 4IL7A 2AR6A 5K4LA 4XQ4A 2XL7A 2ZX4A 1KS4A 2XLAA 3D6EA 5FJHA 2LALA 3ME2A 2JG8A 2QQIA 2VR4A 3O1UA 3O1OA 2XPJA 5LB6A 1I5PA 3AXEA 2WZR2 1HXS2 5FP8A 3V0AB 1Y43B 3LOBA 2R1DA 3GBFA 4UOJA 3MW3A 3U1XA 4NWWA 4XMAA 2F4PA 5DZFA 1OLRA 3PHMA 4QKBA 3UV9A 3NV3A 1PK6B 2JDKA 3EXUA 1D0HA 4YARA 4JVAA 5EFUA 1BZWA 3J9SA 1JOBA 1MS9A 1VBD1 4JTNA 1V6LA 4N53B 4C8DA 4WZFA 3K48A 2ORXA 2SLIA 1RUE1 4GMP0 1PGL2 4B7EA 1IS5A 1FI2A 1CONA 4IUGA 4XZPA 1XRUA 3PL0A 1G9FA 3T4VA 2W92A 3DKQA 1H9WA 1CIYA 5C7GA 2WS92 1QIQA 1RUC3 3OBAA 2W3JA 2WNUA 4Z2AA 1N47A 1WD3A 1XYNA 1PGW2 1AR83 1PK6C 1RHI3 2DBIA 2ZHMA 3AK0A 2WT0A 3M1HA 5FMOS 2E63A 4BDVB 3EMRA 4V2VA 2WQZC 1V6NA 5FUIA 3OGVA 4FI9A 4HETA 4J1WA 3KV4A 2R16A 2FD8A 3RWNA 4AEDA 1EAH3 5K8SA 2N7GA 1LOFC 2FCTA 3SXWA 1MS4A 1QU0A 1US2A 2XJUA 1S4CA 3E97A 4RL7A 4UFIA 4MV2A 1H2LA 3FC0A 3CKHA 4YM0A 4HVOA 5FY0A 4HT1T 1NA1A 5FPLA 4FP2A 4EN9B 1IKPA 4EJRA 3M3QA 3PVNA 5F5CA 4CRQA 5JSPA 1STMA 2XH6A 1G7YA 5KBFA 4J6GA 3APBA 3OUIA 5IVVA 4ISRA 1GMMA 1DBNA 5A3UA 1WCSA 5C8CC 2V09A 1MZ5A 2KD7A 4AGGA 2VZ1A 2RS12 2QQKA 4LMFA 1ODNA 2K0GA 4MGKE 3E5QA 3D8CA 5FK8A 2JENA 3OGRA 5BY5A 2A6WA 2D6KA 1WW7A 2F6BA 2RS32 1ENXA 2DCKA 5AVAA 2VZPA 2JKBA 3VN4A 4P08A 1IKQA 3H8UA 3U10A 4PJYA 4BISA 5CBLA 2HWC3 4Y5Z0 1EV11 3KWVA 3VDDB 1F31A 3R4DB 4BLJA 3AYAA 2WFF3 3WSOA 2RR13 2ZZJA 2CL2A 3ZLIA 4ZPIA 2VW0A 4CUBA 2WYFA 3LDRA 1CAWB 4AVSA 4EWAA 4RFRB 1UKGA 1ZBE1 1PIV2 4YG6A 2W1SA 5FLHA 1ZM1A 1CAUB 1UXXX 4KWKA 5FY4A 1LHUA 3E6BA 3DV8A 5IK8A 1XU1A 4QX3A 4AVAA 2PMWB 4MLOA 3VBHB 5C33A 3ETQA 4LA2A 5IUQA 1N3QA 5I0DA 2D40A 2MPFA 2VOVA 3PU8A 5CYYA 3MIDA 2HBUA 4RD7A 1XU2A 3M3EA 4Q4V2 3UJQA 2FZ1A 3ZXEA 4CU7A 4ASMB 4DXZA 1LHNA 2WWJA 4NIAA 1VBE1 2ENRA 4K1YA 3UKVA 4CDUB 5BNNB 3R0RA 2OS2A 1S2KA 2ZGLA 2D3RA 4RR3B 1DYOA 5K0UC 1UZZA 3VBHC 4FPYA 4YNIA 1H0BA 5EXOA 1KD7A 1DQ6A 1EYBA 1BLZA 1YI9A 5J36A 1HQLA 1LODA 2BYVE 2ETEA 1JS9A 4HPKB 4BPZA 4P02B 4Q0VA 2BWAA 4HLTA 2EXHA 4FOVA 3SHRA 2ARAA 2WAAA 4IW3A 4ZXEA 4CDUC 5BNNC 3DN7A 5FQ0B 4Y1UA 1QXRA 1RUD2 4JRAA 4S2DA 3S57A 5FZAA 1GU3A 3ZIWA 3ZFFB 3RI9A 2XG3A 2P5BA 3O7OA 2ZGTA 2VMEA 2DTWA 4E4SA 4JCKA 3ZR6A 5A6XA 1S2BA 1N3OA 4QX8A 3WF0A 4D69A 5KC6A 5FZBA 1OPOA 1RUH2 4FFGA 5DMYA 2YPJA 3NRUA 5EZWA 5I0RA 1N1VA 1YQ8A 3MPBA 1PGL1 3PTRB 1PVC2 1RMU3 4ZS3A 1YC61 1CAVB 1NLRA 2RM21 1Y3TA 4J1XA 4NUBA 1RITA 1W99A 4M00A 1W2AX 3J8F2 3NV4A 4EN7B 3KHCA 3HOBA 4P9JA 5E6HA 1W8TA 2NP0A 3EQEA 3VZKA 2QJVA 4IERA 5B4NA 4FPEA 3RMYA 3WVJA 2OZ6A 4XJWA 3FMGA 2C26A 3VHNA 5JOZA 2ATFA 2R062 2WQ4A 4JHTA 2Q8EA 5L9RA 3WEZA 3WQ0A 1X7NA 3I2JA 4NROA 2FQPA 1PM4A 2P1BA 3ACHA 3NVCA 1YQCA 1YYNA 2HEWF 3VBSB 3W21A 4DUVA 2VOKA 5CFCA 1HQNA 1JU3A 1W8WA 1NCRA 1ZZ8A 2BQPA 3F2ZA 3ITQA 2G9FA 3PMSA 3WG4A 1LEDA 4IEYA 3POFA 1XOYA 5L9VA 1UL9A 4GJYA 4DUXA 4QB6A 2ZGPA 3W59A 2QKDA 4A6OA 1HW5A 2W68A 3FN9A 4Q0SA 4TSVA 4NPMA 4RYDA 1D4VB 4D6SA 5JMCA 4FPFA 3B9CA 2Z42A 3J7MA 2WNVA 1LENA 3FWEA 1FOD1 4HXCA 1OH3A 4XDOA 4Y5TA 5D2AA 5IWFA 3DXUA 4XC9A 4LE4A 4RQPA 3KM5A 4QQHA 4JGYB 1MACA 2XBO1 2XVLA 1O4YA 1WUVA 4R52A 1F5JA 1O5LA 1TMF2 3RJRA 3SKJE 3CDZB 1N3PA 1LU1A 2FHRA 1YCIA 4N9HA 2ZPXA 4XUTA 5FLJA 2PHXA 2F17A 1SFYA 3ILNA 3AZVA 1LHWA 4WVZA 1JZ6A 4EWDA 3AJZA 4IEUA 3IMMA 2QZ2A 4AWDA 4Z2WA 5FBZA 4E2GA 2VQUA 2CDPA 5LBBA 2BBVA 3FZ3A 4XQWA 2BP6A 1D2QA 1IG3A 3GJBA 4M3CE 3CEWA 3CIHA 4JGYC 1QJU1 2VG9A 2VCAA 3BTXA 1KFXL 3NL1A 2DV9A 4RFT0 1ND3A 3MI8A 5AVPA 1ASJ1 4N7UA 2GMMA 4O65A 2ZHLA 4QPGC 2Z69A 5C70A 5J7MA 3AB0A 1M4WA 5KWRA 5SV5A 5DABA 1RUG1 3U75A 3RI8A 4TTGA 1PMJX 4AFMA 3GHMA 5CG8A 3I54A 4MXWA 4PF1A 1AL23 4AHXA 5FYHA 2J1UA 3AYDA 4ZKTB 1JZ4A 2DCYA 5G05L 1PO23 1GP5A 3HNMA 3VHRA 3KQ4B 1W9SA 1W8ZA 3V65A 5JCTA 2P6CA 1BVVA 2XJPA 3ZN5A 1BYHA 3AKSA 2H0VA 3H42B 5LA9A 4JRLA 4PI2A 1RVF2 3VKMA 4WBBA 1GNZA 3WF3A 4TN7A 1IHMA 1QH6A 4UFHA 2UY8A 3U4SA 1BQPA 4LKDA 3LB9A 1QY4A 4CVUA 2ZCWA 2A7AA 4MGIE 3LSDA 4TWTA 5FK7A 1PO13 1UY1A 1XNBA 3OBRA 4JC1A 2DVGA 5JLVA 3VV1A 4H7MA 1QJY2 4MXVA 3G7DA 3IMNA 3WHTA 5KR7A 1PHMA 5T5JA 3N7KA 2R49A 1F9KA 4PHZA 5J96B 1UPIA 4JDNA 1ULFA 4FPGA 1W6QB 4Q4W3 1VBE2 4R9AA 3SLIA 1WA6X 3IAPA 4HVRA 1VB2A 4X8NA 1HIXA 4YZ5A 2AGSA 3NV2A 1LGNA 2AH2A 1XPWA 4LULA 5CAZA 3T09A 3WP3A 4CXYA 2XJRA 5FZKA 3HPNA 4K20A 4B4QA 3MV11 2D6PA 2RS53 1LHVA 3VBUA 3ZPYA 2XKPA 2P4EA 3RSJA 2V5YA 4PT6A 5LBEA 1S0IA 2Y60A 4E27A 4NIHA 4DFSA 2CDOA 4FFFA 2A75A 1SHWB 2JE8A 4RHV3 1W8OA 4HKOA 1V6IA 1W6MB 2YPDA 3VD5A 2G1MA 1HJFA 4OQ9A 3OEAA 4QPYA 4EZ4A 5KXDA 1YQ6A 2R1BA 2WFPA 3T30A 5L73A 1CZVA 4DINB 3OGJA 1V9U3 3TYJA 5JXJA 1KQRA 4XMIA 2MNGA 2HEYF 3RZHA 2E7QA 2HEVF 3LQCA 2E6VA 1XNCA 3GXUA 1WKYA 4XYXA 4ZS2A 3VBOB 2GN3A 2IC1A 4LBQA 2OXBA 1VE0A 4K8RB 2VAUA 1ZRIA 3M4FA 4QXCA 4UWDA 2WA3A 5C9AA 1S0FA 3RYPA 2P37A 2VMIA 5A80A 2RM22 2Q0AA 3AFGA 2P3JA 5GLWA 2DYCA 3A0KA 3KB5A 2BNMA 4YW6A 4FVVA 5K9YA 1D4M1 4NWVA 5A7NA 1RUJ1 1AX2A 4XZUG 3N9OA 3L2YA 5BYNA 3LE0A 3IPVB 2I74A 3VBOC 3AJYA 1X9PA 4AEMA 5A7WA 3LWCA 1XBFA 2LROA 4K7JA 2FDGA 1LTEA 5APAA 5A7SA 2C9AA 1QOSA 1V6KA 1SLCA 5B4XA 1DCSA 1GSLA 3ALQA 1CX1A 3VZJA 3K3NA 4OLLA 3JD73 1Y7BA 4Y1ZA 3IT8A 2HWE1 1B35B 2GC1A 4MOAA 3R6SA 4IV3A 4C0BA 2WAOA 3VHOA 2WT1A 4AQ2A 2BGOA 4L92A 1APNA 1MPXA 3JBG1 2BPA2 2YC2A 4XEZA 4CEWB 1UY4A 4FPJA 1HRV1 2BVVA 1FOD2 1YEWA 5I8YA 1JHJA 2E32A 3BB6A 4D7TA 5FOJB 3IB3A 2XBO2 2PLV3 2Y6LA 3LFMA 4D3WA 1A34A 1B35C 3B69A 3MF6A 4YYOA 3T2QA 2OW4A 1EPWA 1BBT1 4CDWB 1R081 5FZ4A 1UX7A 2PHTA 3AKTA 1Q5OA 2GP3A 2DCTA 5D21A 1ZBA2 4Y22A 3TRSB 3B00A 3IWZA 1Z7S2 3MDPA 5FDBA 3ES4A 5JXGA 4WM7A 2Q1MA 3ZX7A 1Z78A 2VNOA 3FLRA 4AYUA 1QJU2 4IE6A 1AR63 3OY8A 3OB8A 4PIZA 3VD3A 5DAQA 3FLPA 1S1AA 1WZXA 4CDWC 4R9BA 1GZ9A 1K5MB 1SPPB 1W0NA 2DU1A 4MGYE 3CF6E 3GGLA 3UJOA 1KDMA 2J1TA 2YZ4A 3GZAA 3LEKA 4HSLA 4UXAA 3BU0A 1AR91 4HK9A 1S0EA 5A3PA 3S7EA 5F5QA 3Q8CA 2RDNA 3PLQA 1EPZA 4IETA 1RUF3 2CWSA 3E5UA 2YGLA 5EJZB 3UKNA 3WY6A 2NQYA 1HN0A 4B3NA 5IFTA 4H14A 4PLMA 3MZHA 1KFUL 3TN91 1K5MC 5FZLA 5JOXA 4NMIA 3AXDA 5DUWA 4XUNA 4DUWA 5JDBA 4Y20B 2Y34A 4B4PA 2JG9B 1SCRA 5FMCA 1VRH1 1ZRCA 5L19A 2OKXA 1W3XA 4P5HA 4GB31 1MEC3 2BW8A 4OI2A 5ACA1 2XGXA 5BNPA 1H6YA 1VB4A 4NJ4A 4YGEA 3GNEA 1ZREA 1IS6A 4JV4A 1AHSA 4W65A 1H2NA 1AXYA 1VBC1 2B8MA 2ZMKA 4BM8A 4CTEA 1JZ7A 1DGRN 3MIEA 4XTMA 4COUA 1XE7A 1C8M2 1WW4A 1WCKA 4FQZA 4FQ4A 1TME2 1W8HA 2ZMNA 1NT0A 4IDZA 3URFA 2JG9C 4M4RA 3QACA 3LPFA 5CG9A 1K12A 1OFNA 2OQ7A 3LA7A 4I3PA 2IXJA 3EO6A 3N7MA 4YZ3A 2WZR1 1HXS1 2GZWA 3RRDA 4LORA 4Z82A 2RDRA 3K51A 4WVMB 1TE1B 5FXVA 1HB4A 4BMBA 1OOPB 3LF7A 3ON7A 1A6CA 3HIFA 3IKWA 4UFLA 3W9AA 3AKRA 2VW1A 3HWJA 3IIIA 4OFGA 5E88A 3H3UA 3QH7A 4QHOA 4JGZA 3K75B 3PUHA 3ZKUA 3DEMA 2P3YA 5LA0A 3BU7A 1NOVA 5DQ0A 4ZU4A 4YZ1A 5AC92 1W2OA 2C5DA 1VRBA 2CWMA 1UOBA 3LFIA 3OTFA 3CLPA 3PUIA 4OHVA 1OSGA 3I3BA 5C3QA 4IEQA 2CTVA 4LIUA 5JOWA 3ZFEC 1OOPC 1PMIA 2FDJA 3AL6A 4GALA 3D5OA 2DDUA 1BJQA 1AJKA 2AEYA 5FYBA 1QEXA 2XL9A 3TWIA 1V6MA 3UYJA 1IS4A 3IDCB 5FZ7A 3O1MA 5I93A 1K42A 4KG0A 4GULA 1LOFA 4NE9A 2DUQA 3ZYHA 5CU1A 1ULOA 2HWD1 3RMXA 1BEV3 3POSA 4QX5A 4MSVA 4XHXA 4BJ0A 2R043 4N43A 2XQXA 4RGGA 1CESA 2FCVA 1U5YA 5DAWA 4BK5A 3AFKA 1F15A 5F2SA 5F3GA 1POV3 2QQOA 3PUSA 1DHKB 2ZX2A 2WN2A 4LBLA 4XAAA 4S2GA 1D4M2 1SFNA 1V6JA 4MYEA 2PHUA 4ASLA 2IWGB 5FWEA 1TZOA 4XF0A 4AVVA 5C8CA 4R9CA 1RUOA 3ZDVA 3FE5A 4CUAA 2BVBA 5A3OA 1K5JA 2ZEYA 2WYSA 2Y33A 1LEMA 3T08A 2XLFA 4QU1A 3EHKA 2RS11 5JZGC 2WO7A 2G9ZA 4XCAA 5F6KA 1UOFA 5CIRA 5IVEA 2WN3A 1Q43A 3BALA 1R1A3 1DF0A 1CR7A 4AEJA 4COZA 3HBKA 3JZVA 3GBGA 2JJ6A 4Q0UA 4L2NA 4XFCA 4ISQA 1A8MA 5JR2A 5FYUA 3WF1A 4GXLA 2CAUA 2QDRA 3MLKA 3WOGA 1KRIA 3JBG2 1PNFA 4NO4A 1WGPA 3ZXLA 2JKXA 3WP4A 1YI7A 1E5RA 1HRV2 2WT2A 4Q5OA 5EYYA 5FZOA 3RVHA 2DURA 4I09A 1W6OB 1RINA 2PN5A 4IEOA 1PIV1 4A44A 4CCKA 1QOOA 1AZDA 1NY71 1SLBA 4INDA 3OOXA 5FMDA 4IXLA 4BLIA 1WMXA 4UYBA 4YWAA 1RUI2 3NNLA 4AQ6A 4EWEA 4QPWA 1ONAA 5ISLA 1HRI3 4QQ2A 1GICA 1BBT2 5C4WA 1R082 3MW4A 3U07A 1AYM1 1UN1A 1DZQA 4KWJA 3ZYRA 2YBSA 4QDRA 4Z92B 5A3NA 5EJ3A 2CAVA 4M3CF 2MEV2 4Q4V1 4OHZA 5JR7B 3T1MA 3VB9A 2VQAA 3ZM8A 4XJUA 1DQ2A 1COV2 2J7MA 1RXGA 2E53A 2ZTNA 3O1VA 1OPMA 3WNXA 3ZN4A 4DB5A 3WDUA 2ZKNA 1UCXA 4I0WB 2QDNA 4HKLA 1DQ5A 3B3QE 3O0VA 2VVEA 2JB8A 1LGCA 3OUJA 4YM1A 1QQP3 5T5PA 1AR92 2JDNA 4PBOA 1SLLA 4LLFA 3TEYA 4XUOA 2ZACA 2OZJA 3RYRA 3GZEA 5CFDB 2E51A 2FBEA 2VJXA 4AVTA 2J1SA 2XHNA 2TUNA 1RUD1 2FZ2A 1R092 4ARXA 1KGYA 1UXZA 4PQ9A 4CDXB 3AVRA 4HN0A 4QM9A 3TN92 1GLHA 1U5XA 4XF9A 4BQ5A 4EV0A 1PZ9A 3ZXGA 5JSRA 1W6PA 1VRH2 3KF3A 3A0NA 5A1FA 2D6LX 1X8MA 1KXGA 2VUJA 3ZMOA 4AE2A 2I45A 5ACA2 1CJPA 1PVC1 5CFDC 1PZ7A 2WNEA 3WUDA 4ZHNA 4U36A 4FT8A 4ZY9A 1CN1A 5A33B 5JI7A 4UF0A 2D93A 2DCJA 4CDXC 4XAEA 3AYEA 1OURA 4DXSA 4XXPA 2XJSA 3LIGA 3ZXJA 3ZFGA 5LK5A 4MGTA 1XYOA 2Q1ZB 2VOWA 4RA0A 5JUVA 4BQ2A 4A7KA 1CZSA 2VVDA 1G86A 2AUYA 2TNFA 3C8XA 2R061 4Z07A 1LOGA 3IZOA 2FCUA 4LT5A 1FPN1 5FYSA 1PMHX 3ZDSA 3LEGA 3Q8BA 4BIOA 4EN8B 5K0UB 1XJAA 5KC5A 1FAYA 3E6DA 4CEYA 4XF4A 5GZDA 4P14A 3ZXDA 3J4UH 2ILMA 1GZTA 5FZ6A 1L7LA 2IUWA 2PQQA 5JAXA 3WLUA 3RFRA 2HWF3 4DY5A 4OZXA 2GC3A 1LESA 4LTAA 3VBFB 4FPLA 4CCNA 3PIGA 2UWCA 3O0WA 4N8MA 4JKKA 4CUGA 3ZSJA 1H8TB 5FY9A 2Q5TA 2YROA 1W9TA 2B7YA 2ZAHA 2EVXA 3H9AA 4LBQD 4PF5A 4R9DA 5E89A 5FPBA 2J1RA 3ZIXA 1C57A 2Y26A 4OHXA 5FZ0A 4D7SA 5KXBA 3NAPA 2WS93 2QFEA 4LK7A 4Z8BA 5ABJB 1TMF1 2BWCA 4HG6B 4N53C 4NVPA 3VGIA 4Y1VA 5L7OA 1OUXA 1AYN3 2H6CA 3E1F1 4DXRA 5A70A 3N9LA 1VIWB 4XJ8A 3O1PA 1Q8QA 3HEIA 2HWD2 3VKOA 1QJEA 3C7OA 5FO8B 1C1FA 1VBA1 2WO3A 1UYPA 4NAMA 1H8TC 5C5UA 1OBNA 1JYNA 1GOFA 1SCSA 3EYPA 4QX0A 4I2OA 3CHXA 5ABJC 1DGWA 2YHJA 2R073 4QPGA 2JE9A 3WDYA 2ADDA 3I2KA 5IVBA 1C8NA 2K9ZA 1YFXA 4ZU7A 4GIQA 1JU4A 2G9GA 4OMDA 5FMOL 1TQ5A 1UY0A 3S5AA 4Y1YA 4ZZ8A 1O3TA 2HWB1 1QH7A 2NYYA 4OUEA 3ZSKA 2QZ3A 1FMD1 2ZXQA 5FKBA 2R6QA 4KGGA 3W5NA 5T54A 3MIBA 3H3LA 1MR5A 5F9TA 4EZHA 1C4RA 5LRRA 2RS33 1RVF1 4OHYA 2VUAA 4L11A 4GH4A 1HB2A 5CZKA 4LUMA 3T1LA 4FFHA 3VBRA 3I59B 4Y3OA 1Y4WA 3CBNA 1OXCA 5LW9A 4LO7A 1WCQA 3A7QA 5LASA 2NMNA 4Y24A 3OYWB 4Y4YA 3AKQA 5FBJA 5GLUA 3VL8A 4BOWA 1NY72 3BOPA 1UX6A 1Z0HA 2HWC2 2ORZA 3KV5A 4JAAA 5F39A 5F5AA 1O91A 4XXAA 2OT7A 3OPWA 5JXHA 1IGOA 2QCSB 4LO5B 4QPIB 2CHHA 4QQLA 5FO9B 2WFF2 1QJY1 2IFWA 1W3VA 4UFMA 1UU6A 1ENRA 1AYM2 3VDDC 1VPHA 1ODMA 2VZVA 1W05A 2W0XA 3BODA 3AKPA 4GKXA 2VH9A 2NPIA 3VZNA 2Z2SB 2W87A 4MHUA 4XTPA 4AVCA 1MZFA 1RC6A 2A6XA 5A6YA 4LQRA 4KI5M 1A78A 3RYKA 1W0OA 3IBMA 1A3KA 3V0BA 1AF9A 4BQ3A 3S30A 3H1YA 4QPIC 1SEFA 2QQPA 2LUWA 4M3CA 4WM8A 5T5LA 3C7GA 4QMAA 3ROUA 1IQDC 1DQ0A 2Y6KA 2XWJB 2QQVA 5FZCA 1GKBA 3BPSA 4I30A 1AR71 1J1LA 1LR5A 4FPKA 3HBZA 1VMHA 3GZTB 3W20A 3GF6A 1GANA 3D3AA 4F3JA 1F4HA 3DPRA 2FDFA 3N35A 4BB3A 4M01A 1FNYA 2Q1FA 5H9QA 4QXBA 3M70A 3LAGA 1W2NA 2EIGA 4RR3C 5EP9A 1HV1A 2OUJA 5BNOA 1K3IA 4GMP3 2B46X 4TXWA 1RJ8A 1ND2A 4MGSA 1Q56A 1XNTA 1ZZBA 1W6NA 3N7LA 2D6MA 3AMHA 4A41A 4FAGA 3S7IA 1QKQA 3NW4A 1GZCA 1UAIA 1TG7A 3MV01 3POGA 3UGFA 3WDVA 4QX2A 3GALA 2EXKA 3POJA 4RS5A 3SCGA 2GH2A 3ZFFC 1W9WA 4QHBA 1E5IA 1RUH3 2KA3A 2VNRA 4MG2A 4IESA 1W8UA 3J7NA 4I3GA 3WUCA 5DN2A 4AI2A 4ES9A 1X33A 1FNZA 3ZSLA 1MS3A 1W8NA 2AC1A 2R0HA 2VM9A 2VY0A 4D8MA 4DO0A 1LOCA 1RMU2 2YG0A 2PTMA 4Y26A 1QDCA 2YXSA 3K3OA 1WLDA 3J8F3 1MQTB 4META 5F3IA 3ZYJB 5C5TA 4XABA 1E57A 1FPN2 2WIIB 4W6XA 3VKNA 3ZMNA 1CX4A 2JG8B 1UY2A 2J1EA 3M3CA 1YLLA 1G6NA 4XF1A 2JB4A 4H2AA 4LOTA 2VMDA 1SBDA 2A5ZA 1I9RA 4PQQA 4HONA 2EA7A 2VXJA 4I0BA 5I0UA 3NMBA 1W28A 3USSA 4O7XA 2VUCA 2VNGA 5LCWL 3OJBA 4TLGA 5IVYA 5CISA 1PGSA 5FYTA 2BZDA 2W91A 1AVBA 5IW0A 4K9SA 1VBD3 3JU9A 4ZU5A 4YGBA 5IYYA 1RUE3 2YU2A 3LZZA 1JZ8A 4IQPA 4R4ZA 1G8WA 2JG8C 4NPRA 3VBSC 1VR3A 2IVIB 3E5XA 5BV6A 1RJ7A 3KT1A 1ZRDA 2WNUB 2ZHNA 1F2NA 1YXWA 5IK7A 1N1TA 2WQ8A 3S6PA 2B9VA 3TNPB 2GNDA 1ZZCA 2W9XA 4LBMA 4L99A 3T2OA 4AI8A 4RSUA 4EROA 3CJIA 4GWIA 1ZBA1 1VBA2 3A22A 4AEDB 5FZEA 1Z7S1 2LW8A 2GAUA 3ZXKA 1WW6A 2XLGA 3Q8EA 5DZEA 2QQLA 5I0TA 2V5DA 5A6ZA 4HMZA 3JCIA 2YYOA 3TEZA 2WNUC 4A7YA 1U5ZA 2HYXA 2QQUA 2XUEA 3GHNA 1NQDA 1NA1B 2VTXJ 4KL1A 4NHKA 4L9BA 2CYFA 3I3MA 5T55A 1OQEA 2Y6HA 2XVGA 1QF3A 3I2HA 4HKWA 4S2FA 5FO7B 2EIEA 1GBGA 2HWB2 4GJZA 4QX1A 5CKMA 2J1VA 3FFQA 2HBTA 4XILA 4FCAA 1S0JA 3TEXA 1K45A 2IXKA 1FMD2 3ES1A 3HAGA 3ZYFA 1RUNA 2VBPA 4IE5A 4D6RA 3PMEA 3KLSA 1X9TA 4GWNA 4X6QB 5A7QA 2C1FA 3CU7A 4B7KA 4LUKA 4PLNA 2UY9A 1TVGA 1DGRA 2B5HA 2Z79A 1H1IA 2JE7A 3NNFA 4QGNA 4EQVA 5DAPA 5CA6A 2A6VA 1E5SA 2D3SA 1PO22 5I0SA 4PIYA 1YNAA 1EV13 1WD4A 2VQ0A 3H50A 4CDQA 4XFHA 3N9NA 1JH5A 1MS8A 2DU0A 3K4ZA 5F2WA 3WQBA 4AVBA 1RGSA 1VBB1 3ETPA 3MUY1 2DTYA 4XVHA 2BNNA 3S0MA 1ZBE3 4AG4A 3DXTA 4W8JA 3THPA 2W39A 1OHFA 3O1SA 4ZONA 1C8M1 3KT4A 4XFAA 4R4XA 4NIDA 2PHRA 1TME1 2K2SA 2YV8A 4BXFA 5FWJA 3Q9OA 5GZGA 2BU9A 4AGVA 3I3EA 2DFCA 4OZOA 5DXDA 4YVSB 5LA1A 4XF3A 2RDSA 4Q4Y1 1UYZA 1VBE3 3H8OA 4I02A 4RN5A 2XR4A 4NRQA 1UMZA 3BI3A 4PLOA 1VP6A 1AR72 4Q4W2 2JDMA 3GCWA 3U37A 3ZXAC 1BK1A 5AC91 1GV9A 2FMDA 2WBKA 1H4GA 2OYZA 2ADEA 2OPKA 3CZJA 2YDEA 4L8QA 1KS5A 3WHUA 3SITA 4YVSC 3NO8A 3ZFEA 4P9YA 3SH4A 1GQHA 2WZEA 2QNKA 2XONA 4YW7A 1F8VA 1JMUB 2RS52 2NZ9A 2LTNA 4JTOA 2PAMA 4LKSA 5C3SA 5FYMA 5I8TA 2QTWB 3J7LA 3FUOA 1C5IA 5FZ3A 2A6YA 5DDJ1 3O5SA 3UKTA 4AEKA 1LB2A 4OUMA 2DUPA 2FDHA 3KT7A 5A32A 4IV1A 3AP9A 2ZGQA 4MVTA 5GZFA 2YC0A 3BVCA 2WLPA 2YGMA 3D4KA 1GZWA 4QAWA 5ANQA 1V70A 5EJ1B 1JZ3A 2I2SA 4DY3A 5J98B 1I3HA 4PCRA 3RG0A 4K3UA 3HQUA 1XE0A 5DG2A 2CU5A 2Y8KA 3RZKA 4BH9A 5FZGA 1XB9A 1MZ6A 4XFFA 5E8AA 1UU4A 1W06A 5FKCA 2EXJA 2RM23 3L9JT 3OD0A 4JHZA 4LHLA 5HCBA 4B4RA 4BHPA 4C90A 3BOWA 4YVWA 3RWKX 2WSVA 4HN1A 5JZGA 4O9GA 2PFWA 5D8AA 4NHMA 1POV1 4KU8A 1GP6A 1DZTA 4B1MA 1QNWA 1UW8A 4AAPA 4DOUA 2EF6A 2JXAA 5T3NA 2AZ5A 2VCBA 5A1AA 4A3XA 3C7FA 3MUZ1 2GN7A 1UOJA 4QWNA 4NN0A 5F8PA 1DQ1A 1ENQA 5CFCB 3ACIA 4YFZA 5IVCA 2VMCA 1NCRB 1FT9A 2YFUA 4XJAA 4Q2FA 4CA9A 4YW5A 4OI0A 3KMHA 4CXWA 2Z4FA 3JD72 4Q4X1 4UW6A 3LIHA 3VZMA 1NZIA 4F7ZA 2BGCA 2RMU1 2A70A 2JD9A 3WNKA 4YFWA 5ERLA 3MLJA 5DAVA 2WNVB 4CCJA 1O8PA 3KGZA 1RUI1 3VD9A 3TAYA 1FOD3 2PHLA 4RQPB 1SBFA 4E2QA 4G4FA 4Q8KA 3ZSEA 2XBO3 2CGNA 3HQRA 5C71A 5F1RA 1UD1A 4BQYA 2MEV1 4CEWC 4MZUA 1YRZA 2XOMA 4CCEA 2JECA 4K6BA 5HI0A 2PLV2 2ZGRA 3AZXA 1JYCA 4Q0QA 2IZWA 1COV1 3DGTA 2OA2A 3QCWA 4FPHA 1MVQA 2WNVC 4Q8LA 2X5IA 5FY1A 1CWPA 2P34A 1QJX1 3WG3A 2LS6A 2D7FA 2YC4A 3HNBM 3CZUA 2GNBA 4P9XA 1IG0A 4NHYA 2ID4A 1POV0 1QXJA 3LOIA 3HJRA 1PZ8A 1QJU3 4P9IA 3BCWA 1ND3B 5HPOA 1ASJ3 2ZX0A 3AZYA 1O4TA 1OD5A 1AR62 1UKRA 1UYXA 3EJKA 1RUG3 2Z5WA 5DUXA 1O3QA 1H2KA 4MXWB 1R091 2WDBA 4NRPA 2KM2A 2VOXA 4IGQA 1W9YA 2GP5A 5EPAA 3WF4A 4N90A 1SBEA 3POIA 1ND3C 2R30A 2H6BA 2PAEA 1HLCA 3NNJA 2D97A 3RZLA 1H1AA 2BV4A 4AK3A 4MGQA 4AHZA 2CY6A 4PDWB 1VAKA 1GR3A 1DYKA 1YUDA 1J84A 1H8VA 3KVAA 1VBB2 2JD4A 1REFA 1VLNA 3ZN6A 5F7UA 3MPPG 4DRVA 4E8DA 3T2TA 5C3OA 1CAXA 2OIIA 2VBBA 4Q26A 3GCXA 4IEWA 4CP9A 5J48A 2EAAA 1MEC2 5HCFA 2PHFA 2BBAA 2ZKLA 4LIVA 3TNQA 2XWBB 5BNQA 4AF9A 4OI4A 1YQ2A 5LK7B 2O8OA 2DCZA 4PDWC 3H8XA 3J7HA 2WZ8A 3H1MA 3MFAA 4AAXA 3USUA 1FATA 2YFZA 3B94A 4Q0PA 4Q4Y2 4BYYA 4TZDA 3RS6A 2ZABA 1AX1A 3AZWA 5LBCA 4CXXA 3KQRA 2AEZA 3RZZA 4L0PA 2Q8CA 3ZKYA 4BK4A 1ALYA 1LNSA 1RYYA 1RTVA 4IGPA 3B9IA 4ET7A 1GWMA 4LO4B 1YFUA 3FJSA 5FXWA 3VBUB 3V0AA 1WW5A 1URXA 3UGGA 2GH8A 3KS7A 3NSTA 1WCDJ 1PK6A 2J1AA 1SQ4A 1UZYA 3K4AA 1JOPA 4NOTA 1XSRA 4QX7A 4N53A 4MHRA 5DDJ2 1JYWA 2OX0A 1Q8VA 3ECQA 4FBFA 4QQOA 1OQ1A 5JOYA 2Q30A 1RUC1 3D0SA 1JYIA 4GKYA 1HB3A 3VBUC 5DUUA 1DYPA 5JPNB 1AR81 1RHI1 3PU3A 4LBQB 5F6LB 3ZXFA 1H4HA 3FL7A 3HN3A 4LO8A 3BTAA 4OYUA 3ZYPA 2GDFA 2P2KA 2UU8A 1OVSA 2DVDA 1W03A 5I8SA 1T6BX 5IHRA 3A23A 4XURA 1EAH1 2BDRA 4YGCA 3SQOA 1BEV2 1GOGA 4UT5A 4YPJA 1QHDA 3PUAA 1D4M3 5KXCA 1H2MA 1RUJ3 2O8QA 1QWRA 3ASIA 3WDTA 4D7YA 4DIQA 2AREA 4AFDA 3AC0A 4F8AA 3K46A 5A7WB 4D94A 1YHFA 3AZZA 3QLQA 5E16A 4NR1A 2BJSA 2Y6JA 3HN1A 3T4HB 3GBWA 5FY5A 2C0ZA 2D5FA 4IEXA 5FMBA 4QKFA 3I49A 3WD5A 2G19A 3MLLA 4GZ9A 2W1QA 1J58A 1AUYA 1XNDA 4E4ZA 1G9DA 2HWE3 3OBTA 2VZQA 1MZEA 2JDYA 4IV3B 1H30A 4Q4X2 3LEIA 2VZSA 3H7YA 3SH5A 2DBNA 2RMU2 3RPQA 4JX0A 1NLSA 2C4XA 4O61A 3VDCA 5FR3A 3JBG3 2HWC1 1QGLA 2W5FA 3OBZA 5A6QA 5FYVA 3BUCA 1HRV3 2WKKA 4P9LA 1O4ZA 3VDDA 3WNNA 2WFF1 2PHWA 2RR11 4H55A 1OC1A 3RQ0A 5F3CA 2AACA 2BFUS 1MS5A 2ZS6B 3I3QA 1JTZX 2ZEWA 1HJGA 3FHIB 1CAWA 4IV3C 4XBQA 4XIOA 5IATA 3T3YA 3UNPA 1BBT3 1R083 3ZSMA 1CAUA 4Z1VA 2XQRA 4JKLA 1UNBA 3DF0A 2SBAA 4BA6A 1HRI2 1O3RA 4Y22B 1OD3A 3VBHA 5F3EA 1N1SA 3DYOA 1QJX2 4WM7B 3O0XA 1ULCA 2VOTA 3IDAA 4QDQA 3SEPA 1BHGA 3LKJA 3OY8B 2YBPA 3N9MA 4LOSA 2X29A 4YW3A 5IJRA 4CCDA 3T0DA 1T6GC 3NKGA 4HBNA 2A3WA 4CDUA 3PVBB 1BCXA 2O0OA 1KEXA 3ILRA 1F35A 3K77A 5BNNA 3WX5A 3OEBA 2E33A 5ANNA 3BIEA 4XACA 2P6HA 2UWAA 3A21A 4Q1PA 3DYPA 4RR3A 3CQOA 3DUIA 2YU1A 1MVEA 5L9BA 2BFUL 1AR93 3RZMA 1NE6A 1QOTA 4V1PA 3PJYA 4GQ7A 1F5FA 2DVBA 2D3PA 5JIUA 2R7EB 1GWKA 1KITA 1QQP2 4G9SB 4L97A 5FYCA 4Q27A 4HPKA 3JB8A 5FYIA 3WG2A 5CEHA 2B39A 2O1QA 3KGLA 1J1TA 1ZYBA 5FQ0A 4MO3M 3TN93 1ZA7A 4EE2A 4UW5A 1W2TA 4DRRA 1US3A 1D7PM 2ZAAA 2XHKA 1H9PA 3ZFFA 3BTYA 5IFPA 2VTFA 1JUIA 2X10A 1I5ZA 1OF4A 1VRH3 1ZZ7A 3WW2A 3GJAA 2Y0OA 3U11A 4GB33 3VDBA 4QDSA 1G9CA 5BNPB 2GMEA 1O5UA 3S5QA 1D2SA 1IOAA 2RDQA 1X8EA 3QD6A 3HMYA 5GLVA 4LEJA 1RMU1 2CV6A 5GKAC 1VBC3 1S55A 2VTXA 3PIJA 4D0QA 3MW2A 1CAVA 2CNAA 3EBRA 3CO2A 1DP0A 3Q8AA 4AOCA 4BU2A 3U78A 5JPMB 4K40A 4NIIA 1GNHA 2YMZA 3P5BA 3WNOA 2VGDA 1DZRA 4KMQA 3P6BA 4OUSA 2FDIA 5BNPC 5LEKA 1EUTA 1HXS3 2OQ6A 2WZR3 4AFCA 3ZOIA 5H9SA 2Q8DA 3PVEA 1C28A 3MIGA 1MS1A 4NAOA 5J1XA 3WW1A 4CU9A 5CNAA 1OI6A 2VCCA 4YSFA 4JGZB 3V56A 1RL3A 4O9EA 2QBXA 4U2AA 1JHNA 1SFPA 3I3DA 4NRMA 2RG4A 3R4UA 5FYYA 2RHPA 3VBSA 5FPVA 5GZCA 1C5HA 2BUKA 3AMQA 2VZUA 3DECA 3R05A 4URTA 1U0AA 5DDJ3 4COWA 1M06G 1CPNA 1NKGA 1UIKA 5FY8A 3U4XA 2HWF2 4GD4A 4EYUA 4CPBA 1LHOA 5LY2A 1QNYA 2TBVA 3WQ7A 1XSQA 2JIJA 4D6QA 3NNGA 1RUC2 4XIKA 5CVRA 4ES8A 4GWJA 4JGZC 3VBFC 5LRSA 4YGDA 3ATGA 4XUQA 1ZRFA 1AR82 1RHI2 2ZGMA 5BXXA 5T52A 5T50A 1E5HA 4JGYA 4XOGA 4FAHA 2HWD3 3POYA 4N43B 1AYN2 1POQA 3BGAA 2XJVA 5GJ6A 4EN0A 1EAH2 1DQ4A 4UFKA 3AMMA 4CU6A 4XUPA 1JOJA 1NUKA 3O1TA 4UW3A 2G4IA 5C8CB 1ZZ6A 2ZEXA 2JIGA 3QH6A 3H1WA 4OCTA 4DMIA 5FP9A 1WMEA 3J26N 4RGKA 3X29B 3P3PA 2VO5A 5CKQA 1BXHA 4AGRA 2JEMA 1ULPA 5FY7A 2R072 3U0ZA 3ENRA 4N7IA 4BMEA 3B01A 4N43C 2RS13 1HB1A 2HLEA 3F95A 3NQHA 2QVSB 3FHAA 1VALA 4DQAA 2E7TA 5FUPA 1PX3A 2DVFA 1LOEA 2IVJA 4JZRA 3THTA 4IGOA 3IM0A 4DEQA 1WMFA 3THCA 1AL21 4HVQA 5A3WA 5FFOC 4XFIA 4FTEA 3MYXA 1PO21 2EIDA 1QJFA 3IDBB 3NJZA 5LBFA 2GC2A 1R1ZA 3A4UA 2WWUA 4AI0A 5FCCA 4FSJA 3SISA 2QUOA 3AL5A 1VAVA 5FZOB 1JYXA 3DKWA 1N1YA 1KJRA 1LULA 3UT0A 2WINB 2W1WA 4S2HA 2W2IA 1IZ3A 1PIV3 2RR12 1IPJA 3KCYA 4MX3A 3UESA 4AI1A 2NLRA 5GLZA 2P3KA 4A7ZA 5C4WB 4XETA 2W52A 1CQ9A 1OQDA 1LCLA 1NCQB 3I4IA 4XBLA 1JYTA 2ZX1A 1AYM3 1PO11 5FP4A 1X82A 4JQRA 1S0BA 3VD7A 2JDUA 1AXZA 3WF2A 4Q4V3 2D44A 1UO9A 4OQ8A 4YZ4A 5FP3A 3JQXA 1DIWA 4MH0E 4PI0A 3VZLA 3PNAA 4JDOA 2DVAA 3N9QA 5HV4A 4QD2A 3OGSA 2A73B 2IXLA 2ZZQA 4Q4W1 2CGOA 5C4WC 1W6QA 4NHXA 1P8JA 3MICA 4QKDA 3PDQA 1NCQC 1W0PA 1A8DA 2L9LA 5B2GB 5HCAA 1CPMA 4YVSA 1YFYA 5A1LA 4FXGB 4IEPA 4W6YA 3WV6A 2BTVC 2LM3A 1FX5A 3SC7X 4YRDA 3M3IA 1Q8SA 3NJYA 3GYDA 1XQNA 4CCOA 4F83A 2DF7A 2EICA 2RS51 3FLTA 1Y9GA 3CJXA 4YW4A 1VMJA 5HXMA 5JMOA 1O3SA 1RUD3 4FFIA 1R64A 5FZ1A 1TNFA 2AYHA 3L2HA 4RHV1 1ENSA 1SLAA 2GALA 4BE3A 4Y1XA 4COVA 3ZO0B 5SV8A 1W6MA 3PJQA 1W6PB 5EHDA 4CZSA 4DEVA 4EN6B 1V9U1 1UZWA 1EP0A 2C6SA 2GC0A 1AJOA 4WZCA 1WWYA 2BNOA 2DWRA 5JIAA 5EV7A 4BZ4A 1EY2A 1PVC3 5FPUA 2GU9A 2RE9A 1GP4A 4LBOA 4LBKA 4IE7A 4LJHA 4UF0B 3VBOA 4LA3A 5KHGA 4KWLA 4WV8A 1AL0G 2RJKA 4AHYA 1ULEA 2VQTA 1OA2A 3LPGA 4UFJA 1CGPA 3ZFGB 1U12A 1UZ0A 3N7JA 1DLLA 3KV9A 3NKTA 4LE3A 2BOIA 2EXIA 3SMHA 2GMPA 1RXFA 4AI9A 4FO9A 2W95A 1G9BA 1UY3A 2MHFA 2ARCA 2HH9A 2UYBA 3AP5A 4P5YA 1T2XA 3V64A 3ZVXA 2R063 4SLIA 1JXNA 4ZXKA 4CUCA 5LY1A 2JDPA 4I0AA 1OH4A 1FPN3 4GAZA 3IPVA 4CEYB 1OKQA 3OG2A 3T2PA 3K2OA 2A1XA 4B29A 4DNYA 3AYCA 5EQUA 1MQTC 2Y6FA 4BIFA 3ZFGC 1JYVA 4AFAA 1HQWA 5FZIA 3POEA 3NJXA 3JD71 2JICA 3FHQA 1Q3EA 2QQWA 2VC9A 1AXKA 2PQSA 2WA4A 3TB0A 1B35A 2WC2A 3HNYM 5GM0A 1MS0A 3T0BA 3UETA 4XFBA 2VMFA 3ELNA 5FV3A 3W58A 3QOPA 2VVFA 5TSWA 1O59A 1QMJA 4ATEA 3N36A 4BQ1A 1VBD2 4CEYC 2ZEZA 3BN6A 3UL2A 3U14A 3NAPB 5KHIA 3RZGA 1DGLA 1RUE2 2FMYA 3KVBA 5FZMA 4CEWA 5L7OB 1TMF3 4K21A 3PTYA 4XHBA 5AFEA 2PLV1 2VE1A 1NLQA 3P1IA 4XE9A 3LSEA 5DG1A 1NXMA 2H0BA 1DLCA 2PELA 3RDIA 4LKFA 5LEJA 3R4SA 1HV0A 3AMPA 3MBWA 1ZRRA 4CDWA 1VBA3 3TEWA 5FPZA 1HN1A 3MIHA 2XMLA 5DAXA 1D0GA 3INAA 2ZHKA 3N3HA 3NAPC 1LJ7A 3AP6A 4QPGB 4GWMA 5L7OC 3PVOA 5KHJA 4AEDC 4IE4A 2ZMLA 4IE0A 1AR61 2XKOA 3N4MA 3N9PA 3MFCA 2HWB3 3OD4A 1UYYA 1K5MA 1SPPA 1WBLA 1NA1C 2HYKA 2ZJCA 1BK0A 5FZDA 3WP5A 4CU8A 4UBHA 4QB1A 3VKLA 1FMD3 5HV0A 1AL22 3AM2A 2DFBA 3MO4A 3M8LA 2Q4SA 4QXHA 3OUHA 4E4HA 5IVJA 2VMGA 1PM7A 1RUF1 3LEMA 4RGAA 2ZGUA 1RVF3 3IN9A 4GH4B 1S0CA 3FBYA 3ZYIB 3VBRB 4P00B 4A42A 4TLFA 1XNAA 2J42A 5FYZA 5C3RA 4LHKA 2A71A 5IT6A 4A4AA 4AQTA 1H1MA 4FTSA 2VW2A 2R32A 4KWUA 3BYWA 4LITA 1KJLA 5AFBA 4MGZE 4XCBA 4QHZA 1GNYA 1OLQA 3I2GA 4Y20A 5GZEA 1UPSA 1EV12 2JG9A 3WCSA 2X8KA 3C7EA 5JWPA 1MEC1 1YIPA 3KCCA 1QJY3 1ULDA 2K46A 5G04L 4JQTA 4PDWA 3DL3A 1RB8G 2V4AA 4GH4C 3THDA 1BKZA 1PO12 3SKVA 1WLCA 3VBRC 4Y4RA 1ZBE2 4UW4A 3ZPOA 4FOQA 1S0DA 5A7PA 3MHZA 2D5HA 2R0FA 3MEPA 3C2UA 1HX6A 2Y64A 3OF1A 4AZZA 2EAKA 3V0BB 3I8TA 1W39A 4BCUA 1TNRA 3I2IA 3LD8A 5IK4A 1UIJA 3KF5A 1UU5A 2O14A 4KU7A 4MADA 4B8EA 4M3CB 4WM8B 3JUUA 1SDDB 2ZX3A 1CD3G 1B09A 2BOJA 3O12A 1OF3A 2VPVA 4M0HA 1JN2P 1NYWA 1AR73 4WVMA 1U5IA 5D1IA 4K8FA 2YY1A 1OOPA 3DPRB 5JVVA 4AXOA 1IS3A 4LLOA 2QQMA 5IVFA 1ZA4A 2W47A 4PBPA 5J37A 2WO1A 1GQGA 4XPVA 4C91A 4XFGA 5A3TA 5HBAA 2RJLA 3I2FA 3NJVA 1KDKA 3WZ1A 4ORFA 5EWSA 3BKZA 3WG1A 2LRPA 3OGGA 4RHV2 5BNOB 1SG3A 1BMV1 4WM8C 1ND2B 3DCQA 4JDMA 3ACFA 4LBJA 3WINE 5T5OA 2CGPA 1W6NB 3M3OA 1REDA 1REEA 2E26A 2JX9A 3DPRC 3OSDA 1ZX5A 3LCPA 3TOJA 1W9FA 1GUIA 1YJKA 1V9U2 1PX4A 3BTZA 3MIFA 2BRTA 2VCMA 4FXKB 4X8PA 3EB7A 4RS5B 3SNMA 2V72A 4E4DX 1IPKA 1LGBA 4W50A 5DPNA 1L7RA 5CADA 4E9KA 5BNOC 3B02A 3WW3A 1BEV1 5JXIA 1OA4A 1ND2C 2XDVA 2R041 4QT6A 3WW4A 1V6OA 1WMDA 3I97A 3FFZA 3ILFA 3VUOA 3BIWE 1F4AA 3HR9A 2WJSA 3C3VA 1IPSA 2WNOA 5FZ9A 5M0TA 3T0AA 4E2SA 4QQPA 2WLQA 4RS5C 2VULA 1S2EA 2D6NA 2X09A 1GWLA 2XJQA 3HQXA 4ATFA 2VZOA 1OLMA 1J83A 4AL9A 2Y38A 2XXZA 1OFSA 2IFRA 1EUUA 4CPBD 5FLIA 4A45A 2VU9A 1QJZA 2JWPA 1R1A1 2YB7A 2WWSA 3VKFC 3ACGA 5DUVA 1ST8A 2IXIA 1GFF2 1LKNA 2OVUA 5EIYB 1NG0A 2PHDA 3RZJA 4E8CA 1Q8PA 5FZFA 1OUSA 5CFCC 2VBDA 2X53S 4HANA 4LNVA 2YBKA 1NCRC 3UGHA 1WA4A 1JUHA 4AI3A 1LOAA 2JDAA 3RGBA 5FPAA 3CL1A 2PAKA 5IAXA 3FBMA 3P3NA 4KNCA 3LA3A 5H9RA 1W6OA 2EALA 4ONUA 3WNLA 1HKDA 4IEZA 4YM3A 2X05A 1J59A 3CJIB 1HRI1 4QU2A 1C1LA 3OCPA 3ZYGA 3DYMA 4K1ZA 3K4DA 1ZBA3 2J22A 3GDBA 4HOOA 2XB6C 1Z7S3 2XUMA 4FPCA 3KSCA 4Q29A 1UWWA 2NM1A 2ES3A 4RQPC 5FIXA 2UWBA 5KXEA 2WO2A 4XW3A 1PNGA 1NQJA 5A7OA 4XJ9A 1W8FA 3KD4A 4AR2A 1SDWA 4YM2A 2ZGOA 5IK5A 1YQ5A 1WLTA 1Y9MA 2ERFA 2HKXA 3FUQA 4OI1A 3CJIC 4CP0A 3TBDA 5I91A 3VDAA 2V73A 1VJ2A 2UYAA 4CCMA
chains in the Genus database with same CATH topology
4QKBA 4OCTA 3RZKA 3BTXA 3H8XA 4ZHNA 3O1MA 3S57A 3LFMA 4CXXA 3BKZA 3T4VA 3BIEA 3I3MA 3RZMA 4MGTA 5F8PA 4ZS3A 3BTZA 3RZGA 3I2OA 3O1RA 2FD8A 4IE6A 4CXWA 4IE5A 3KHCA 2IUWA 3BTYA 4NIGA 3BU0A 4CXYA 4JHTA 4NROA 4NIHA 4IE4A 3O1SA 4IE0A 4NIIA 3O1PA 4NIDA 4QKDA 4MG2A 2FDIA 4NPMA 2FDFA 3RZHA 4NPLA 4NJ4A 3T4HB 4ZS2A 3RZJA 3H8OA 4NRQA 4NRMA 4QKFA 3I49A 3BI3A 4RFRB 3O1VA 4IDZA 4NRPA 3H8RA 3S5AA 4O7XA 4O61A 3BUCA 2FDKA 3KHBA 3RZLA 4QKNA 2FDGA 4IE7A 4QHOA 2FDHA 3I3QA 5DABA 3T3YA 3O1UA 3O1OA 3O1TA 2FDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QKB A;  4OCT A;  3RZK A;  3BTX A;  3H8X A;  4ZHN A;  3O1M A;  3S57 A;  3LFM A;  4CXX A;  3BKZ A;  3T4V A;  3BIE A;  3I3M A;  3RZM A;  4MGT A;  5F8P A;  4ZS3 A;  3BTZ A;  3RZG A;  3I2O A;  3O1R A;  2FD8 A;  4IE6 A;  4CXW A;  4IE5 A;  3KHC A;  2IUW A;  3BTY A;  4NIG A;  3BU0 A;  4CXY A;  4JHT A;  4NRO A;  4NIH A;  4IE4 A;  3O1S A;  4IE0 A;  4NII A;  3O1P A;  4NID A;  4QKD A;  4MG2 A;  2FDI A;  4NPM A;  2FDF A;  3RZH A;  4NPL A;  4NJ4 A;  3T4H B;  4ZS2 A;  3RZJ A;  3H8O A;  4NRQ A;  4NRM A;  4QKF A;  3I49 A;  3BI3 A;  4RFR B;  3O1V A;  4IDZ A;  4NRP A;  3H8R A;  3S5A A;  4O7X A;  4O61 A;  3BUC A;  2FDK A;  3KHB A;  3RZL A;  4QKN A;  2FDG A;  4IE7 A;  4QHO A;  2FDH A;  3I3Q A;  5DAB A;  3T3Y A;  3O1U A;  3O1O A;  3O1T A;  2FDJ A; 
#chains in the Genus database with same CATH topology
 4Y33 A;  2I07 B;  3CMG A;  4BQX A;  1QQP 1;  2VD7 A;  1ZZ9 A;  5CKN A;  2WZP P;  3BPZ A;  1ASJ 2;  1LRH A;  4ZZ5 A;  3OPZ A;  1UQX A;  2W08 A;  4AHW A;  3GM8 A;  1FYU A;  4H3W A;  1RUG 2;  4GA9 A;  1UZV A;  1WLW A;  3E6C C;  1RUF 2;  1OA3 A;  5KHH A;  5CFD A;  4URA A;  3C7H A;  4XBN A;  2QQN A;  2QE3 A;  2VL4 A;  3NWK A;  4FOW A;  4XDP A;  1HDK A;  1VMF A;  1DG6 A;  3MGU A;  4CDX A;  5FAX A;  4LBN A;  4UI9 L;  4CDQ B;  1I6X A;  2WRA A;  2A3Y A;  2ET7 A;  2XVK A;  4C1W A;  2W1U A;  2NMO A;  1J3Q A;  2E9Q A;  1JZ2 A;  1VBB 3;  1ZNP A;  2ET1 A;  3ORJ A;  3ST7 A;  1LOB A;  2VEC A;  3I2O A;  4OMC A;  2PYT A;  2VZT A;  1JOD A;  1J3P A;  1UF2 C;  5A33 A;  1C8M 3;  3KV6 A;  1TME 3;  1IQA A;  2Q8O A;  4P9G A;  4NIG A;  4R8H A;  4MUV A;  5FZ8 A;  3H3Z A;  4PIX A;  4CDQ C;  2EIB A;  2UUR A;  5E1R A;  1SMV A;  1UOG A;  1OLM E;  1XYP A;  4CE8 A;  4G3Y C;  2ZOE B;  2BGP A;  4CYD A;  1VAM A;  4LPL A;  3B93 A;  1LAJ A;  4KH9 A;  4DZG A;  4Q4Y 3;  5HCH A;  3NV1 A;  4YW2 A;  2DUO A;  4AFB A;  3ACL A;  3IDE A;  3WR0 A;  5K0U A;  3NNM A;  4Q1R A;  4HL0 A;  1QXP A;  1CIW A;  2D98 A;  4LO6 B;  3WNM A;  4B1L A;  5AC9 3;  1G9A A;  4LK6 A;  3VL9 A;  3ZFE B;  1Q8O A;  1XE8 A;  1SLT A;  1YO8 A;  2NN8 A;  2PXJ A;  2ZGS A;  2HWF 1;  4LHN A;  3WXP A;  4LKE A;  4COY A;  3IIA A;  3HD8 B;  1YJL A;  4AQS A;  4YG0 A;  2WR9 A;  1DGW X;  2ARB A;  1BMV 2;  1X50 A;  2E31 A;  4WVW A;  3VBF A;  4DS0 A;  1NE4 A;  4NPL A;  1ACC A;  1O8S A;  1FV3 A;  5GAL A;  4H7L A;  3ZYB A;  2A3X A;  3SCH A;  5A32 B;  5C8W A;  1H8T A;  4IV1 B;  4KBZ A;  2C24 A;  5L36 A;  1S0G A;  2W46 A;  1L3J A;  1WCU A;  2GSY A;  1GZW B;  2WS9 1;  3POW A;  3VLB B;  5IAV A;  5C9A B;  5ABJ A;  1JZ5 A;  1AYN 1;  2VXR A;  5LAT A;  2IXH A;  1ZVF A;  3HVD A;  3WQ1 A;  1PGW 1;  2KXL A;  2YUE A;  3M7A A;  3ZR5 A;  2W94 A;  1V00 A;  3SH3 A;  2IXC A;  4N9I A;  4M4P A;  3VD4 A;  2R04 2;  4J25 A;  3RJ2 X;  4BXS V;  4YG3 A;  4BWO A;  3RNS A;  5FTT C;  3KHB A;  3WNP A;  1XC6 A;  4IV1 C;  1V0A A;  2WL1 A;  4YLZ A;  4YVW B;  5KHK A;  3W5M A;  5JZG B;  4BQ4 A;  2WUH A;  1YIF A;  5D8A B;  5C9A C;  2R07 1;  3JXS A;  4ARY A;  3PUR A;  2AEN A;  2F4L A;  2KR2 A;  2VUD A;  3AP4 A;  3HT1 A;  2PA7 A;  1CVN A;  4P9W A;  4AW7 A;  4FPO B;  1RUJ 2;  1DFQ A;  3D82 A;  4LHS A;  4Y5S A;  3JB4 C;  5A3L A;  3GZU C;  4FTB A;  3LDK A;  1O6U A;  1SLI A;  2B42 B;  1R1A 2;  2ZGN A;  2OUH A;  5FP7 A;  1NZC A;  3MF9 A;  4YVW C;  5EYX A;  2BER A;  1XXN A;  2WSU A;  5C3P A;  4LXL A;  5D8A C;  3KCX A;  4W6W A;  1TEI A;  4QXK A;  4Q4X 3;  2RS3 1;  4A6S A;  1L7Q A;  5LA2 A;  1J3R A;  1NX9 A;  2ARX A;  4OVE A;  1JI6 A;  2HWE 2;  2RMU 3;  1DU3 D;  2HJI A;  1Y9Q A;  3HT2 A;  3IAQ A;  3WP6 A;  1OKO A;  1WBF A;  3AVS A;  5C6C A;  3I59 A;  3VHP A;  2JDH A;  1DDL A;  1RUI 3;  4M0N A;  3FX3 A;  2RVA A;  2P3I A;  1AX0 A;  5DZG A;  1CJD A;  4DXT A;  1NXD 1;  2B45 X;  3OYW A;  4UBG A;  5FPX A;  1OMI A;  3WDW A;  4KQ7 A;  1XNK A;  2RJ2 A;  2BEO A;  4QGL A;  2ZGK A;  4W4Z A;  2V4V A;  1YFW A;  3D0J A;  4CCC A;  4QPI A;  2MEV 3;  4CCL A;  4ITC A;  1NAE A;  2D6O X;  4OHW A;  5FXZ A;  3B5L B;  3O1R A;  4HSJ A;  5F37 A;  5JI9 A;  3B7M A;  5BUV A;  5J3U A;  1C3H A;  1GYK A;  1GOH A;  1COV 3;  5K7P A;  2VZ3 A;  1W04 A;  2XJT A;  2X5I B;  3AMN A;  3LA2 A;  4KGQ A;  3WDX A;  5LWB A;  1NCQ A;  4SBV A;  5FOB B;  1FXZ A;  4DPN A;  1QJX 3;  1BVP 1;  4QB2 A;  2ZA9 A;  4LR4 A;  5GLT A;  3AP7 A;  4HZF A;  4V2W A;  3VZO A;  1W90 A;  1I1E A;  1H6X A;  4QGM A;  4WVV A;  2CSG A;  5F32 A;  4KG8 A;  2VMH A;  1PVX A;  1FV2 A;  1UMH A;  2Y0I A;  4FOY A;  2VZR A;  4HFS A;  4WM7 C;  1SZB A;  5F5I A;  3PUQ A;  3Q8F A;  1UMI A;  1CZT A;  2X5I C;  4CP1 A;  4YW1 A;  4CSW A;  3LDB A;  1R09 3;  1RIR A;  2VNV A;  4C1X A;  5J09 A;  4ASK A;  1OVP A;  2JDZ A;  1OT5 A;  3ABZ A;  2RV9 A;  4NHL A;  5LZ6 A;  1JBC A;  5JSO A;  1YWK A;  3AX4 A;  2A6Z A;  4A3Z A;  1QDO A;  1O7F A;  1GQP A;  1JW6 A;  5FZH A;  4HK8 A;  2D43 A;  5H9P A;  3H7J A;  4GMP 1;  4IEV A;  2Y6G A;  4JKM A;  4XQD A;  4FP3 A;  4C0H A;  4I01 A;  2ZBJ A;  3JQW A;  1LEC A;  2GNT A;  3I2D A;  4X6R B;  4KBB A;  5A3M A;  5ACA 3;  2QQJ A;  1ULG A;  3WT3 A;  3OPT A;  5BPX A;  3SCF A;  1SAC A;  3KZ4 C;  3ZN6 B;  4YZ2 A;  2TEP A;  4CP2 A;  1CAX B;  3M2M A;  4XDQ A;  5CB7 A;  4BQW A;  4CP9 B;  3H8R A;  1RUH 1;  2B9U A;  3H0O A;  5FRE A;  3O14 A;  3UK9 A;  1LU2 A;  4GB3 2;  1X36 A;  2E7A A;  4XJZ A;  3I7D A;  3SEE A;  3WCR A;  2OPW A;  3POB A;  2FDK A;  4QM8 A;  3LGR A;  4TYS A;  3USU B;  5FRA A;  4A2U A;  5FUN A;  3CNA A;  1W2U A;  5HXV A;  1VBC 2;  4QKN A;  2C9K A;  3J8F 1;  5FXX A;  5FJK A;  2GNM A;  2B4K A;  3QBQ A;  4UAP A;  1MQT A;  2WAB A;  4OUL A;  2P17 A;  3G6J B;  4IL7 A;  2AR6 A;  5K4L A;  4XQ4 A;  2XL7 A;  2ZX4 A;  1KS4 A;  2XLA A;  3D6E A;  5FJH A;  2LAL A;  3ME2 A;  2JG8 A;  2QQI A;  2VR4 A;  3O1U A;  3O1O A;  2XPJ A;  5LB6 A;  1I5P A;  3AXE A;  2WZR 2;  1HXS 2;  5FP8 A;  3V0A B;  1Y43 B;  3LOB A;  2R1D A;  3GBF A;  4UOJ A;  3MW3 A;  3U1X A;  4NWW A;  4XMA A;  2F4P A;  5DZF A;  1OLR A;  3PHM A;  4QKB A;  3UV9 A;  3NV3 A;  1PK6 B;  2JDK A;  3EXU A;  1D0H A;  4YAR A;  4JVA A;  5EFU A;  1BZW A;  3J9S A;  1JOB A;  1MS9 A;  1VBD 1;  4JTN A;  1V6L A;  4N53 B;  4C8D A;  4WZF A;  3K48 A;  2ORX A;  2SLI A;  1RUE 1;  4GMP 0;  1PGL 2;  4B7E A;  1IS5 A;  1FI2 A;  1CON A;  4IUG A;  4XZP A;  1XRU A;  3PL0 A;  1G9F A;  3T4V A;  2W92 A;  3DKQ A;  1H9W A;  1CIY A;  5C7G A;  2WS9 2;  1QIQ A;  1RUC 3;  3OBA A;  2W3J A;  2WNU A;  4Z2A A;  1N47 A;  1WD3 A;  1XYN A;  1PGW 2;  1AR8 3;  1PK6 C;  1RHI 3;  2DBI A;  2ZHM A;  3AK0 A;  2WT0 A;  3M1H A;  5FMO S;  2E63 A;  4BDV B;  3EMR A;  4V2V A;  2WQZ C;  1V6N A;  5FUI A;  3OGV A;  4FI9 A;  4HET A;  4J1W A;  3KV4 A;  2R16 A;  2FD8 A;  3RWN A;  4AED A;  1EAH 3;  5K8S A;  2N7G A;  1LOF C;  2FCT A;  3SXW A;  1MS4 A;  1QU0 A;  1US2 A;  2XJU A;  1S4C A;  3E97 A;  4RL7 A;  4UFI A;  4MV2 A;  1H2L A;  3FC0 A;  3CKH A;  4YM0 A;  4HVO A;  5FY0 A;  4HT1 T;  1NA1 A;  5FPL A;  4FP2 A;  4EN9 B;  1IKP A;  4EJR A;  3M3Q A;  3PVN A;  5F5C A;  4CRQ A;  5JSP A;  1STM A;  2XH6 A;  1G7Y A;  5KBF A;  4J6G A;  3APB A;  3OUI A;  5IVV A;  4ISR A;  1GMM A;  1DBN A;  5A3U A;  1WCS A;  5C8C C;  2V09 A;  1MZ5 A;  2KD7 A;  4AGG A;  2VZ1 A;  2RS1 2;  2QQK A;  4LMF A;  1ODN A;  2K0G A;  4MGK E;  3E5Q A;  3D8C A;  5FK8 A;  2JEN A;  3OGR A;  5BY5 A;  2A6W A;  2D6K A;  1WW7 A;  2F6B A;  2RS3 2;  1ENX A;  2DCK A;  5AVA A;  2VZP A;  2JKB A;  3VN4 A;  4P08 A;  1IKQ A;  3H8U A;  3U10 A;  4PJY A;  4BIS A;  5CBL A;  2HWC 3;  4Y5Z 0;  1EV1 1;  3KWV A;  3VDD B;  1F31 A;  3R4D B;  4BLJ A;  3AYA A;  2WFF 3;  3WSO A;  2RR1 3;  2ZZJ A;  2CL2 A;  3ZLI A;  4ZPI A;  2VW0 A;  4CUB A;  2WYF A;  3LDR A;  1CAW B;  4AVS A;  4EWA A;  4RFR B;  1UKG A;  1ZBE 1;  1PIV 2;  4YG6 A;  2W1S A;  5FLH A;  1ZM1 A;  1CAU B;  1UXX X;  4KWK A;  5FY4 A;  1LHU A;  3E6B A;  3DV8 A;  5IK8 A;  1XU1 A;  4QX3 A;  4AVA A;  2PMW B;  4MLO A;  3VBH B;  5C33 A;  3ETQ A;  4LA2 A;  5IUQ A;  1N3Q A;  5I0D A;  2D40 A;  2MPF A;  2VOV A;  3PU8 A;  5CYY A;  3MID A;  2HBU A;  4RD7 A;  1XU2 A;  3M3E A;  4Q4V 2;  3UJQ A;  2FZ1 A;  3ZXE A;  4CU7 A;  4ASM B;  4DXZ A;  1LHN A;  2WWJ A;  4NIA A;  1VBE 1;  2ENR A;  4K1Y A;  3UKV A;  4CDU B;  5BNN B;  3R0R A;  2OS2 A;  1S2K A;  2ZGL A;  2D3R A;  4RR3 B;  1DYO A;  5K0U C;  1UZZ A;  3VBH C;  4FPY A;  4YNI A;  1H0B A;  5EXO A;  1KD7 A;  1DQ6 A;  1EYB A;  1BLZ A;  1YI9 A;  5J36 A;  1HQL A;  1LOD A;  2BYV E;  2ETE A;  1JS9 A;  4HPK B;  4BPZ A;  4P02 B;  4Q0V A;  2BWA A;  4HLT A;  2EXH A;  4FOV A;  3SHR A;  2ARA A;  2WAA A;  4IW3 A;  4ZXE A;  4CDU C;  5BNN C;  3DN7 A;  5FQ0 B;  4Y1U A;  1QXR A;  1RUD 2;  4JRA A;  4S2D A;  3S57 A;  5FZA A;  1GU3 A;  3ZIW A;  3ZFF B;  3RI9 A;  2XG3 A;  2P5B A;  3O7O A;  2ZGT A;  2VME A;  2DTW A;  4E4S A;  4JCK A;  3ZR6 A;  5A6X A;  1S2B A;  1N3O A;  4QX8 A;  3WF0 A;  4D69 A;  5KC6 A;  5FZB A;  1OPO A;  1RUH 2;  4FFG A;  5DMY A;  2YPJ A;  3NRU A;  5EZW A;  5I0R A;  1N1V A;  1YQ8 A;  3MPB A;  1PGL 1;  3PTR B;  1PVC 2;  1RMU 3;  4ZS3 A;  1YC6 1;  1CAV B;  1NLR A;  2RM2 1;  1Y3T A;  4J1X A;  4NUB A;  1RIT A;  1W99 A;  4M00 A;  1W2A X;  3J8F 2;  3NV4 A;  4EN7 B;  3KHC A;  3HOB A;  4P9J A;  5E6H A;  1W8T A;  2NP0 A;  3EQE A;  3VZK A;  2QJV A;  4IER A;  5B4N A;  4FPE A;  3RMY A;  3WVJ A;  2OZ6 A;  4XJW A;  3FMG A;  2C26 A;  3VHN A;  5JOZ A;  2ATF A;  2R06 2;  2WQ4 A;  4JHT A;  2Q8E A;  5L9R A;  3WEZ A;  3WQ0 A;  1X7N A;  3I2J A;  4NRO A;  2FQP A;  1PM4 A;  2P1B A;  3ACH A;  3NVC A;  1YQC A;  1YYN A;  2HEW F;  3VBS B;  3W21 A;  4DUV A;  2VOK A;  5CFC A;  1HQN A;  1JU3 A;  1W8W A;  1NCR A;  1ZZ8 A;  2BQP A;  3F2Z A;  3ITQ A;  2G9F A;  3PMS A;  3WG4 A;  1LED A;  4IEY A;  3POF A;  1XOY A;  5L9V A;  1UL9 A;  4GJY A;  4DUX A;  4QB6 A;  2ZGP A;  3W59 A;  2QKD A;  4A6O A;  1HW5 A;  2W68 A;  3FN9 A;  4Q0S A;  4TSV A;  4NPM A;  4RYD A;  1D4V B;  4D6S A;  5JMC A;  4FPF A;  3B9C A;  2Z42 A;  3J7M A;  2WNV A;  1LEN A;  3FWE A;  1FOD 1;  4HXC A;  1OH3 A;  4XDO A;  4Y5T A;  5D2A A;  5IWF A;  3DXU A;  4XC9 A;  4LE4 A;  4RQP A;  3KM5 A;  4QQH A;  4JGY B;  1MAC A;  2XBO 1;  2XVL A;  1O4Y A;  1WUV A;  4R52 A;  1F5J A;  1O5L A;  1TMF 2;  3RJR A;  3SKJ E;  3CDZ B;  1N3P A;  1LU1 A;  2FHR A;  1YCI A;  4N9H A;  2ZPX A;  4XUT A;  5FLJ A;  2PHX A;  2F17 A;  1SFY A;  3ILN A;  3AZV A;  1LHW A;  4WVZ A;  1JZ6 A;  4EWD A;  3AJZ A;  4IEU A;  3IMM A;  2QZ2 A;  4AWD A;  4Z2W A;  5FBZ A;  4E2G A;  2VQU A;  2CDP A;  5LBB A;  2BBV A;  3FZ3 A;  4XQW A;  2BP6 A;  1D2Q A;  1IG3 A;  3GJB A;  4M3C E;  3CEW A;  3CIH A;  4JGY C;  1QJU 1;  2VG9 A;  2VCA A;  3BTX A;  1KFX L;  3NL1 A;  2DV9 A;  4RFT 0;  1ND3 A;  3MI8 A;  5AVP A;  1ASJ 1;  4N7U A;  2GMM A;  4O65 A;  2ZHL A;  4QPG C;  2Z69 A;  5C70 A;  5J7M A;  3AB0 A;  1M4W A;  5KWR A;  5SV5 A;  5DAB A;  1RUG 1;  3U75 A;  3RI8 A;  4TTG A;  1PMJ X;  4AFM A;  3GHM A;  5CG8 A;  3I54 A;  4MXW A;  4PF1 A;  1AL2 3;  4AHX A;  5FYH A;  2J1U A;  3AYD A;  4ZKT B;  1JZ4 A;  2DCY A;  5G05 L;  1PO2 3;  1GP5 A;  3HNM A;  3VHR A;  3KQ4 B;  1W9S A;  1W8Z A;  3V65 A;  5JCT A;  2P6C A;  1BVV A;  2XJP A;  3ZN5 A;  1BYH A;  3AKS A;  2H0V A;  3H42 B;  5LA9 A;  4JRL A;  4PI2 A;  1RVF 2;  3VKM A;  4WBB A;  1GNZ A;  3WF3 A;  4TN7 A;  1IHM A;  1QH6 A;  4UFH A;  2UY8 A;  3U4S A;  1BQP A;  4LKD A;  3LB9 A;  1QY4 A;  4CVU A;  2ZCW A;  2A7A A;  4MGI E;  3LSD A;  4TWT A;  5FK7 A;  1PO1 3;  1UY1 A;  1XNB A;  3OBR A;  4JC1 A;  2DVG A;  5JLV A;  3VV1 A;  4H7M A;  1QJY 2;  4MXV A;  3G7D A;  3IMN A;  3WHT A;  5KR7 A;  1PHM A;  5T5J A;  3N7K A;  2R49 A;  1F9K A;  4PHZ A;  5J96 B;  1UPI A;  4JDN A;  1ULF A;  4FPG A;  1W6Q B;  4Q4W 3;  1VBE 2;  4R9A A;  3SLI A;  1WA6 X;  3IAP A;  4HVR A;  1VB2 A;  4X8N A;  1HIX A;  4YZ5 A;  2AGS A;  3NV2 A;  1LGN A;  2AH2 A;  1XPW A;  4LUL A;  5CAZ A;  3T09 A;  3WP3 A;  4CXY A;  2XJR A;  5FZK A;  3HPN A;  4K20 A;  4B4Q A;  3MV1 1;  2D6P A;  2RS5 3;  1LHV A;  3VBU A;  3ZPY A;  2XKP A;  2P4E A;  3RSJ A;  2V5Y A;  4PT6 A;  5LBE A;  1S0I A;  2Y60 A;  4E27 A;  4NIH A;  4DFS A;  2CDO A;  4FFF A;  2A75 A;  1SHW B;  2JE8 A;  4RHV 3;  1W8O A;  4HKO A;  1V6I A;  1W6M B;  2YPD A;  3VD5 A;  2G1M A;  1HJF A;  4OQ9 A;  3OEA A;  4QPY A;  4EZ4 A;  5KXD A;  1YQ6 A;  2R1B A;  2WFP A;  3T30 A;  5L73 A;  1CZV A;  4DIN B;  3OGJ A;  1V9U 3;  3TYJ A;  5JXJ A;  1KQR A;  4XMI A;  2MNG A;  2HEY F;  3RZH A;  2E7Q A;  2HEV F;  3LQC A;  2E6V A;  1XNC A;  3GXU A;  1WKY A;  4XYX A;  4ZS2 A;  3VBO B;  2GN3 A;  2IC1 A;  4LBQ A;  2OXB A;  1VE0 A;  4K8R B;  2VAU A;  1ZRI A;  3M4F A;  4QXC A;  4UWD A;  2WA3 A;  5C9A A;  1S0F A;  3RYP A;  2P37 A;  2VMI A;  5A80 A;  2RM2 2;  2Q0A A;  3AFG A;  2P3J A;  5GLW A;  2DYC A;  3A0K A;  3KB5 A;  2BNM A;  4YW6 A;  4FVV A;  5K9Y A;  1D4M 1;  4NWV A;  5A7N A;  1RUJ 1;  1AX2 A;  4XZU G;  3N9O A;  3L2Y A;  5BYN A;  3LE0 A;  3IPV B;  2I74 A;  3VBO C;  3AJY A;  1X9P A;  4AEM A;  5A7W A;  3LWC A;  1XBF A;  2LRO A;  4K7J A;  2FDG A;  1LTE A;  5APA A;  5A7S A;  2C9A A;  1QOS A;  1V6K A;  1SLC A;  5B4X A;  1DCS A;  1GSL A;  3ALQ A;  1CX1 A;  3VZJ A;  3K3N A;  4OLL A;  3JD7 3;  1Y7B A;  4Y1Z A;  3IT8 A;  2HWE 1;  1B35 B;  2GC1 A;  4MOA A;  3R6S A;  4IV3 A;  4C0B A;  2WAO A;  3VHO A;  2WT1 A;  4AQ2 A;  2BGO A;  4L92 A;  1APN A;  1MPX A;  3JBG 1;  2BPA 2;  2YC2 A;  4XEZ A;  4CEW B;  1UY4 A;  4FPJ A;  1HRV 1;  2BVV A;  1FOD 2;  1YEW A;  5I8Y A;  1JHJ A;  2E32 A;  3BB6 A;  4D7T A;  5FOJ B;  3IB3 A;  2XBO 2;  2PLV 3;  2Y6L A;  3LFM A;  4D3W A;  1A34 A;  1B35 C;  3B69 A;  3MF6 A;  4YYO A;  3T2Q A;  2OW4 A;  1EPW A;  1BBT 1;  4CDW B;  1R08 1;  5FZ4 A;  1UX7 A;  2PHT A;  3AKT A;  1Q5O A;  2GP3 A;  2DCT A;  5D21 A;  1ZBA 2;  4Y22 A;  3TRS B;  3B00 A;  3IWZ A;  1Z7S 2;  3MDP A;  5FDB A;  3ES4 A;  5JXG A;  4WM7 A;  2Q1M A;  3ZX7 A;  1Z78 A;  2VNO A;  3FLR A;  4AYU A;  1QJU 2;  4IE6 A;  1AR6 3;  3OY8 A;  3OB8 A;  4PIZ A;  3VD3 A;  5DAQ A;  3FLP A;  1S1A A;  1WZX A;  4CDW C;  4R9B A;  1GZ9 A;  1K5M B;  1SPP B;  1W0N A;  2DU1 A;  4MGY E;  3CF6 E;  3GGL A;  3UJO A;  1KDM A;  2J1T A;  2YZ4 A;  3GZA A;  3LEK A;  4HSL A;  4UXA A;  3BU0 A;  1AR9 1;  4HK9 A;  1S0E A;  5A3P A;  3S7E A;  5F5Q A;  3Q8C A;  2RDN A;  3PLQ A;  1EPZ A;  4IET A;  1RUF 3;  2CWS A;  3E5U A;  2YGL A;  5EJZ B;  3UKN A;  3WY6 A;  2NQY A;  1HN0 A;  4B3N A;  5IFT A;  4H14 A;  4PLM A;  3MZH A;  1KFU L;  3TN9 1;  1K5M C;  5FZL A;  5JOX A;  4NMI A;  3AXD A;  5DUW A;  4XUN A;  4DUW A;  5JDB A;  4Y20 B;  2Y34 A;  4B4P A;  2JG9 B;  1SCR A;  5FMC A;  1VRH 1;  1ZRC A;  5L19 A;  2OKX A;  1W3X A;  4P5H A;  4GB3 1;  1MEC 3;  2BW8 A;  4OI2 A;  5ACA 1;  2XGX A;  5BNP A;  1H6Y A;  1VB4 A;  4NJ4 A;  4YGE A;  3GNE A;  1ZRE A;  1IS6 A;  4JV4 A;  1AHS A;  4W65 A;  1H2N A;  1AXY A;  1VBC 1;  2B8M A;  2ZMK A;  4BM8 A;  4CTE A;  1JZ7 A;  1DGR N;  3MIE A;  4XTM A;  4COU A;  1XE7 A;  1C8M 2;  1WW4 A;  1WCK A;  4FQZ A;  4FQ4 A;  1TME 2;  1W8H A;  2ZMN A;  1NT0 A;  4IDZ A;  3URF A;  2JG9 C;  4M4R A;  3QAC A;  3LPF A;  5CG9 A;  1K12 A;  1OFN A;  2OQ7 A;  3LA7 A;  4I3P A;  2IXJ A;  3EO6 A;  3N7M A;  4YZ3 A;  2WZR 1;  1HXS 1;  2GZW A;  3RRD A;  4LOR A;  4Z82 A;  2RDR A;  3K51 A;  4WVM B;  1TE1 B;  5FXV A;  1HB4 A;  4BMB A;  1OOP B;  3LF7 A;  3ON7 A;  1A6C A;  3HIF A;  3IKW A;  4UFL A;  3W9A A;  3AKR A;  2VW1 A;  3HWJ A;  3III A;  4OFG A;  5E88 A;  3H3U A;  3QH7 A;  4QHO A;  4JGZ A;  3K75 B;  3PUH A;  3ZKU A;  3DEM A;  2P3Y A;  5LA0 A;  3BU7 A;  1NOV A;  5DQ0 A;  4ZU4 A;  4YZ1 A;  5AC9 2;  1W2O A;  2C5D A;  1VRB A;  2CWM A;  1UOB A;  3LFI A;  3OTF A;  3CLP A;  3PUI A;  4OHV A;  1OSG A;  3I3B A;  5C3Q A;  4IEQ A;  2CTV A;  4LIU A;  5JOW A;  3ZFE C;  1OOP C;  1PMI A;  2FDJ A;  3AL6 A;  4GAL A;  3D5O A;  2DDU A;  1BJQ A;  1AJK A;  2AEY A;  5FYB A;  1QEX A;  2XL9 A;  3TWI A;  1V6M A;  3UYJ A;  1IS4 A;  3IDC B;  5FZ7 A;  3O1M A;  5I93 A;  1K42 A;  4KG0 A;  4GUL A;  1LOF A;  4NE9 A;  2DUQ A;  3ZYH A;  5CU1 A;  1ULO A;  2HWD 1;  3RMX A;  1BEV 3;  3POS A;  4QX5 A;  4MSV A;  4XHX A;  4BJ0 A;  2R04 3;  4N43 A;  2XQX A;  4RGG A;  1CES A;  2FCV A;  1U5Y A;  5DAW A;  4BK5 A;  3AFK A;  1F15 A;  5F2S A;  5F3G A;  1POV 3;  2QQO A;  3PUS A;  1DHK B;  2ZX2 A;  2WN2 A;  4LBL A;  4XAA A;  4S2G A;  1D4M 2;  1SFN A;  1V6J A;  4MYE A;  2PHU A;  4ASL A;  2IWG B;  5FWE A;  1TZO A;  4XF0 A;  4AVV A;  5C8C A;  4R9C A;  1RUO A;  3ZDV A;  3FE5 A;  4CUA A;  2BVB A;  5A3O A;  1K5J A;  2ZEY A;  2WYS A;  2Y33 A;  1LEM A;  3T08 A;  2XLF A;  4QU1 A;  3EHK A;  2RS1 1;  5JZG C;  2WO7 A;  2G9Z A;  4XCA A;  5F6K A;  1UOF A;  5CIR A;  5IVE A;  2WN3 A;  1Q43 A;  3BAL A;  1R1A 3;  1DF0 A;  1CR7 A;  4AEJ A;  4COZ A;  3HBK A;  3JZV A;  3GBG A;  2JJ6 A;  4Q0U A;  4L2N A;  4XFC A;  4ISQ A;  1A8M A;  5JR2 A;  5FYU A;  3WF1 A;  4GXL A;  2CAU A;  2QDR A;  3MLK A;  3WOG A;  1KRI A;  3JBG 2;  1PNF A;  4NO4 A;  1WGP A;  3ZXL A;  2JKX A;  3WP4 A;  1YI7 A;  1E5R A;  1HRV 2;  2WT2 A;  4Q5O A;  5EYY A;  5FZO A;  3RVH A;  2DUR A;  4I09 A;  1W6O B;  1RIN A;  2PN5 A;  4IEO A;  1PIV 1;  4A44 A;  4CCK A;  1QOO A;  1AZD A;  1NY7 1;  1SLB A;  4IND A;  3OOX A;  5FMD A;  4IXL A;  4BLI A;  1WMX A;  4UYB A;  4YWA A;  1RUI 2;  3NNL A;  4AQ6 A;  4EWE A;  4QPW A;  1ONA A;  5ISL A;  1HRI 3;  4QQ2 A;  1GIC A;  1BBT 2;  5C4W A;  1R08 2;  3MW4 A;  3U07 A;  1AYM 1;  1UN1 A;  1DZQ A;  4KWJ A;  3ZYR A;  2YBS A;  4QDR A;  4Z92 B;  5A3N A;  5EJ3 A;  2CAV A;  4M3C F;  2MEV 2;  4Q4V 1;  4OHZ A;  5JR7 B;  3T1M A;  3VB9 A;  2VQA A;  3ZM8 A;  4XJU A;  1DQ2 A;  1COV 2;  2J7M A;  1RXG A;  2E53 A;  2ZTN A;  3O1V A;  1OPM A;  3WNX A;  3ZN4 A;  4DB5 A;  3WDU A;  2ZKN A;  1UCX A;  4I0W B;  2QDN A;  4HKL A;  1DQ5 A;  3B3Q E;  3O0V A;  2VVE A;  2JB8 A;  1LGC A;  3OUJ A;  4YM1 A;  1QQP 3;  5T5P A;  1AR9 2;  2JDN A;  4PBO A;  1SLL A;  4LLF A;  3TEY A;  4XUO A;  2ZAC A;  2OZJ A;  3RYR A;  3GZE A;  5CFD B;  2E51 A;  2FBE A;  2VJX A;  4AVT A;  2J1S A;  2XHN A;  2TUN A;  1RUD 1;  2FZ2 A;  1R09 2;  4ARX A;  1KGY A;  1UXZ A;  4PQ9 A;  4CDX B;  3AVR A;  4HN0 A;  4QM9 A;  3TN9 2;  1GLH A;  1U5X A;  4XF9 A;  4BQ5 A;  4EV0 A;  1PZ9 A;  3ZXG A;  5JSR A;  1W6P A;  1VRH 2;  3KF3 A;  3A0N A;  5A1F A;  2D6L X;  1X8M A;  1KXG A;  2VUJ A;  3ZMO A;  4AE2 A;  2I45 A;  5ACA 2;  1CJP A;  1PVC 1;  5CFD C;  1PZ7 A;  2WNE A;  3WUD A;  4ZHN A;  4U36 A;  4FT8 A;  4ZY9 A;  1CN1 A;  5A33 B;  5JI7 A;  4UF0 A;  2D93 A;  2DCJ A;  4CDX C;  4XAE A;  3AYE A;  1OUR A;  4DXS A;  4XXP A;  2XJS A;  3LIG A;  3ZXJ A;  3ZFG A;  5LK5 A;  4MGT A;  1XYO A;  2Q1Z B;  2VOW A;  4RA0 A;  5JUV A;  4BQ2 A;  4A7K A;  1CZS A;  2VVD A;  1G86 A;  2AUY A;  2TNF A;  3C8X A;  2R06 1;  4Z07 A;  1LOG A;  3IZO A;  2FCU A;  4LT5 A;  1FPN 1;  5FYS A;  1PMH X;  3ZDS A;  3LEG A;  3Q8B A;  4BIO A;  4EN8 B;  5K0U B;  1XJA A;  5KC5 A;  1FAY A;  3E6D A;  4CEY A;  4XF4 A;  5GZD A;  4P14 A;  3ZXD A;  3J4U H;  2ILM A;  1GZT A;  5FZ6 A;  1L7L A;  2IUW A;  2PQQ A;  5JAX A;  3WLU A;  3RFR A;  2HWF 3;  4DY5 A;  4OZX A;  2GC3 A;  1LES A;  4LTA A;  3VBF B;  4FPL A;  4CCN A;  3PIG A;  2UWC A;  3O0W A;  4N8M A;  4JKK A;  4CUG A;  3ZSJ A;  1H8T B;  5FY9 A;  2Q5T A;  2YRO A;  1W9T A;  2B7Y A;  2ZAH A;  2EVX A;  3H9A A;  4LBQ D;  4PF5 A;  4R9D A;  5E89 A;  5FPB A;  2J1R A;  3ZIX A;  1C57 A;  2Y26 A;  4OHX A;  5FZ0 A;  4D7S A;  5KXB A;  3NAP A;  2WS9 3;  2QFE A;  4LK7 A;  4Z8B A;  5ABJ B;  1TMF 1;  2BWC A;  4HG6 B;  4N53 C;  4NVP A;  3VGI A;  4Y1V A;  5L7O A;  1OUX A;  1AYN 3;  2H6C A;  3E1F 1;  4DXR A;  5A70 A;  3N9L A;  1VIW B;  4XJ8 A;  3O1P A;  1Q8Q A;  3HEI A;  2HWD 2;  3VKO A;  1QJE A;  3C7O A;  5FO8 B;  1C1F A;  1VBA 1;  2WO3 A;  1UYP A;  4NAM A;  1H8T C;  5C5U A;  1OBN A;  1JYN A;  1GOF A;  1SCS A;  3EYP A;  4QX0 A;  4I2O A;  3CHX A;  5ABJ C;  1DGW A;  2YHJ A;  2R07 3;  4QPG A;  2JE9 A;  3WDY A;  2ADD A;  3I2K A;  5IVB A;  1C8N A;  2K9Z A;  1YFX A;  4ZU7 A;  4GIQ A;  1JU4 A;  2G9G A;  4OMD A;  5FMO L;  1TQ5 A;  1UY0 A;  3S5A A;  4Y1Y A;  4ZZ8 A;  1O3T A;  2HWB 1;  1QH7 A;  2NYY A;  4OUE A;  3ZSK A;  2QZ3 A;  1FMD 1;  2ZXQ A;  5FKB A;  2R6Q A;  4KGG A;  3W5N A;  5T54 A;  3MIB A;  3H3L A;  1MR5 A;  5F9T A;  4EZH A;  1C4R A;  5LRR A;  2RS3 3;  1RVF 1;  4OHY A;  2VUA A;  4L11 A;  4GH4 A;  1HB2 A;  5CZK A;  4LUM A;  3T1L A;  4FFH A;  3VBR A;  3I59 B;  4Y3O A;  1Y4W A;  3CBN A;  1OXC A;  5LW9 A;  4LO7 A;  1WCQ A;  3A7Q A;  5LAS A;  2NMN A;  4Y24 A;  3OYW B;  4Y4Y A;  3AKQ A;  5FBJ A;  5GLU A;  3VL8 A;  4BOW A;  1NY7 2;  3BOP A;  1UX6 A;  1Z0H A;  2HWC 2;  2ORZ A;  3KV5 A;  4JAA A;  5F39 A;  5F5A A;  1O91 A;  4XXA A;  2OT7 A;  3OPW A;  5JXH A;  1IGO A;  2QCS B;  4LO5 B;  4QPI B;  2CHH A;  4QQL A;  5FO9 B;  2WFF 2;  1QJY 1;  2IFW A;  1W3V A;  4UFM A;  1UU6 A;  1ENR A;  1AYM 2;  3VDD C;  1VPH A;  1ODM A;  2VZV A;  1W05 A;  2W0X A;  3BOD A;  3AKP A;  4GKX A;  2VH9 A;  2NPI A;  3VZN A;  2Z2S B;  2W87 A;  4MHU A;  4XTP A;  4AVC A;  1MZF A;  1RC6 A;  2A6X A;  5A6Y A;  4LQR A;  4KI5 M;  1A78 A;  3RYK A;  1W0O A;  3IBM A;  1A3K A;  3V0B A;  1AF9 A;  4BQ3 A;  3S30 A;  3H1Y A;  4QPI C;  1SEF A;  2QQP A;  2LUW A;  4M3C A;  4WM8 A;  5T5L A;  3C7G A;  4QMA A;  3ROU A;  1IQD C;  1DQ0 A;  2Y6K A;  2XWJ B;  2QQV A;  5FZC A;  1GKB A;  3BPS A;  4I30 A;  1AR7 1;  1J1L A;  1LR5 A;  4FPK A;  3HBZ A;  1VMH A;  3GZT B;  3W20 A;  3GF6 A;  1GAN A;  3D3A A;  4F3J A;  1F4H A;  3DPR A;  2FDF A;  3N35 A;  4BB3 A;  4M01 A;  1FNY A;  2Q1F A;  5H9Q A;  4QXB A;  3M70 A;  3LAG A;  1W2N A;  2EIG A;  4RR3 C;  5EP9 A;  1HV1 A;  2OUJ A;  5BNO A;  1K3I A;  4GMP 3;  2B46 X;  4TXW A;  1RJ8 A;  1ND2 A;  4MGS A;  1Q56 A;  1XNT A;  1ZZB A;  1W6N A;  3N7L A;  2D6M A;  3AMH A;  4A41 A;  4FAG A;  3S7I A;  1QKQ A;  3NW4 A;  1GZC A;  1UAI A;  1TG7 A;  3MV0 1;  3POG A;  3UGF A;  3WDV A;  4QX2 A;  3GAL A;  2EXK A;  3POJ A;  4RS5 A;  3SCG A;  2GH2 A;  3ZFF C;  1W9W A;  4QHB A;  1E5I A;  1RUH 3;  2KA3 A;  2VNR A;  4MG2 A;  4IES A;  1W8U A;  3J7N A;  4I3G A;  3WUC A;  5DN2 A;  4AI2 A;  4ES9 A;  1X33 A;  1FNZ A;  3ZSL A;  1MS3 A;  1W8N A;  2AC1 A;  2R0H A;  2VM9 A;  2VY0 A;  4D8M A;  4DO0 A;  1LOC A;  1RMU 2;  2YG0 A;  2PTM A;  4Y26 A;  1QDC A;  2YXS A;  3K3O A;  1WLD A;  3J8F 3;  1MQT B;  4MET A;  5F3I A;  3ZYJ B;  5C5T A;  4XAB A;  1E57 A;  1FPN 2;  2WII B;  4W6X A;  3VKN A;  3ZMN A;  1CX4 A;  2JG8 B;  1UY2 A;  2J1E A;  3M3C A;  1YLL A;  1G6N A;  4XF1 A;  2JB4 A;  4H2A A;  4LOT A;  2VMD A;  1SBD A;  2A5Z A;  1I9R A;  4PQQ A;  4HON A;  2EA7 A;  2VXJ A;  4I0B A;  5I0U A;  3NMB A;  1W28 A;  3USS A;  4O7X A;  2VUC A;  2VNG A;  5LCW L;  3OJB A;  4TLG A;  5IVY A;  5CIS A;  1PGS A;  5FYT A;  2BZD A;  2W91 A;  1AVB A;  5IW0 A;  4K9S A;  1VBD 3;  3JU9 A;  4ZU5 A;  4YGB A;  5IYY A;  1RUE 3;  2YU2 A;  3LZZ A;  1JZ8 A;  4IQP A;  4R4Z A;  1G8W A;  2JG8 C;  4NPR A;  3VBS C;  1VR3 A;  2IVI B;  3E5X A;  5BV6 A;  1RJ7 A;  3KT1 A;  1ZRD A;  2WNU B;  2ZHN A;  1F2N A;  1YXW A;  5IK7 A;  1N1T A;  2WQ8 A;  3S6P A;  2B9V A;  3TNP B;  2GND A;  1ZZC A;  2W9X A;  4LBM A;  4L99 A;  3T2O A;  4AI8 A;  4RSU A;  4ERO A;  3CJI A;  4GWI A;  1ZBA 1;  1VBA 2;  3A22 A;  4AED B;  5FZE A;  1Z7S 1;  2LW8 A;  2GAU A;  3ZXK A;  1WW6 A;  2XLG A;  3Q8E A;  5DZE A;  2QQL A;  5I0T A;  2V5D A;  5A6Z A;  4HMZ A;  3JCI A;  2YYO A;  3TEZ A;  2WNU C;  4A7Y A;  1U5Z A;  2HYX A;  2QQU A;  2XUE A;  3GHN A;  1NQD A;  1NA1 B;  2VTX J;  4KL1 A;  4NHK A;  4L9B A;  2CYF A;  3I3M A;  5T55 A;  1OQE A;  2Y6H A;  2XVG A;  1QF3 A;  3I2H A;  4HKW A;  4S2F A;  5FO7 B;  2EIE A;  1GBG A;  2HWB 2;  4GJZ A;  4QX1 A;  5CKM A;  2J1V A;  3FFQ A;  2HBT A;  4XIL A;  4FCA A;  1S0J A;  3TEX A;  1K45 A;  2IXK A;  1FMD 2;  3ES1 A;  3HAG A;  3ZYF A;  1RUN A;  2VBP A;  4IE5 A;  4D6R A;  3PME A;  3KLS A;  1X9T A;  4GWN A;  4X6Q B;  5A7Q A;  2C1F A;  3CU7 A;  4B7K A;  4LUK A;  4PLN A;  2UY9 A;  1TVG A;  1DGR A;  2B5H A;  2Z79 A;  1H1I A;  2JE7 A;  3NNF A;  4QGN A;  4EQV A;  5DAP A;  5CA6 A;  2A6V A;  1E5S A;  2D3S A;  1PO2 2;  5I0S A;  4PIY A;  1YNA A;  1EV1 3;  1WD4 A;  2VQ0 A;  3H50 A;  4CDQ A;  4XFH A;  3N9N A;  1JH5 A;  1MS8 A;  2DU0 A;  3K4Z A;  5F2W A;  3WQB A;  4AVB A;  1RGS A;  1VBB 1;  3ETP A;  3MUY 1;  2DTY A;  4XVH A;  2BNN A;  3S0M A;  1ZBE 3;  4AG4 A;  3DXT A;  4W8J A;  3THP A;  2W39 A;  1OHF A;  3O1S A;  4ZON A;  1C8M 1;  3KT4 A;  4XFA A;  4R4X A;  4NID A;  2PHR A;  1TME 1;  2K2S A;  2YV8 A;  4BXF A;  5FWJ A;  3Q9O A;  5GZG A;  2BU9 A;  4AGV A;  3I3E A;  2DFC A;  4OZO A;  5DXD A;  4YVS B;  5LA1 A;  4XF3 A;  2RDS A;  4Q4Y 1;  1UYZ A;  1VBE 3;  3H8O A;  4I02 A;  4RN5 A;  2XR4 A;  4NRQ A;  1UMZ A;  3BI3 A;  4PLO A;  1VP6 A;  1AR7 2;  4Q4W 2;  2JDM A;  3GCW A;  3U37 A;  3ZXA C;  1BK1 A;  5AC9 1;  1GV9 A;  2FMD A;  2WBK A;  1H4G A;  2OYZ A;  2ADE A;  2OPK A;  3CZJ A;  2YDE A;  4L8Q A;  1KS5 A;  3WHU A;  3SIT A;  4YVS C;  3NO8 A;  3ZFE A;  4P9Y A;  3SH4 A;  1GQH A;  2WZE A;  2QNK A;  2XON A;  4YW7 A;  1F8V A;  1JMU B;  2RS5 2;  2NZ9 A;  2LTN A;  4JTO A;  2PAM A;  4LKS A;  5C3S A;  5FYM A;  5I8T A;  2QTW B;  3J7L A;  3FUO A;  1C5I A;  5FZ3 A;  2A6Y A;  5DDJ 1;  3O5S A;  3UKT A;  4AEK A;  1LB2 A;  4OUM A;  2DUP A;  2FDH A;  3KT7 A;  5A32 A;  4IV1 A;  3AP9 A;  2ZGQ A;  4MVT A;  5GZF A;  2YC0 A;  3BVC A;  2WLP A;  2YGM A;  3D4K A;  1GZW A;  4QAW A;  5ANQ A;  1V70 A;  5EJ1 B;  1JZ3 A;  2I2S A;  4DY3 A;  5J98 B;  1I3H A;  4PCR A;  3RG0 A;  4K3U A;  3HQU A;  1XE0 A;  5DG2 A;  2CU5 A;  2Y8K A;  3RZK A;  4BH9 A;  5FZG A;  1XB9 A;  1MZ6 A;  4XFF A;  5E8A A;  1UU4 A;  1W06 A;  5FKC A;  2EXJ A;  2RM2 3;  3L9J T;  3OD0 A;  4JHZ A;  4LHL A;  5HCB A;  4B4R A;  4BHP A;  4C90 A;  3BOW A;  4YVW A;  3RWK X;  2WSV A;  4HN1 A;  5JZG A;  4O9G A;  2PFW A;  5D8A A;  4NHM A;  1POV 1;  4KU8 A;  1GP6 A;  1DZT A;  4B1M A;  1QNW A;  1UW8 A;  4AAP A;  4DOU A;  2EF6 A;  2JXA A;  5T3N A;  2AZ5 A;  2VCB A;  5A1A A;  4A3X A;  3C7F A;  3MUZ 1;  2GN7 A;  1UOJ A;  4QWN A;  4NN0 A;  5F8P A;  1DQ1 A;  1ENQ A;  5CFC B;  3ACI A;  4YFZ A;  5IVC A;  2VMC A;  1NCR B;  1FT9 A;  2YFU A;  4XJA A;  4Q2F A;  4CA9 A;  4YW5 A;  4OI0 A;  3KMH A;  4CXW A;  2Z4F A;  3JD7 2;  4Q4X 1;  4UW6 A;  3LIH A;  3VZM A;  1NZI A;  4F7Z A;  2BGC A;  2RMU 1;  2A70 A;  2JD9 A;  3WNK A;  4YFW A;  5ERL A;  3MLJ A;  5DAV A;  2WNV B;  4CCJ A;  1O8P A;  3KGZ A;  1RUI 1;  3VD9 A;  3TAY A;  1FOD 3;  2PHL A;  4RQP B;  1SBF A;  4E2Q A;  4G4F A;  4Q8K A;  3ZSE A;  2XBO 3;  2CGN A;  3HQR A;  5C71 A;  5F1R A;  1UD1 A;  4BQY A;  2MEV 1;  4CEW C;  4MZU A;  1YRZ A;  2XOM A;  4CCE A;  2JEC A;  4K6B A;  5HI0 A;  2PLV 2;  2ZGR A;  3AZX A;  1JYC A;  4Q0Q A;  2IZW A;  1COV 1;  3DGT A;  2OA2 A;  3QCW A;  4FPH A;  1MVQ A;  2WNV C;  4Q8L A;  2X5I A;  5FY1 A;  1CWP A;  2P34 A;  1QJX 1;  3WG3 A;  2LS6 A;  2D7F A;  2YC4 A;  3HNB M;  3CZU A;  2GNB A;  4P9X A;  1IG0 A;  4NHY A;  2ID4 A;  1POV 0;  1QXJ A;  3LOI A;  3HJR A;  1PZ8 A;  1QJU 3;  4P9I A;  3BCW A;  1ND3 B;  5HPO A;  1ASJ 3;  2ZX0 A;  3AZY A;  1O4T A;  1OD5 A;  1AR6 2;  1UKR A;  1UYX A;  3EJK A;  1RUG 3;  2Z5W A;  5DUX A;  1O3Q A;  1H2K A;  4MXW B;  1R09 1;  2WDB A;  4NRP A;  2KM2 A;  2VOX A;  4IGQ A;  1W9Y A;  2GP5 A;  5EPA A;  3WF4 A;  4N90 A;  1SBE A;  3POI A;  1ND3 C;  2R30 A;  2H6B A;  2PAE A;  1HLC A;  3NNJ A;  2D97 A;  3RZL A;  1H1A A;  2BV4 A;  4AK3 A;  4MGQ A;  4AHZ A;  2CY6 A;  4PDW B;  1VAK A;  1GR3 A;  1DYK A;  1YUD A;  1J84 A;  1H8V A;  3KVA A;  1VBB 2;  2JD4 A;  1REF A;  1VLN A;  3ZN6 A;  5F7U A;  3MPP G;  4DRV A;  4E8D A;  3T2T A;  5C3O A;  1CAX A;  2OII A;  2VBB A;  4Q26 A;  3GCX A;  4IEW A;  4CP9 A;  5J48 A;  2EAA A;  1MEC 2;  5HCF A;  2PHF A;  2BBA A;  2ZKL A;  4LIV A;  3TNQ A;  2XWB B;  5BNQ A;  4AF9 A;  4OI4 A;  1YQ2 A;  5LK7 B;  2O8O A;  2DCZ A;  4PDW C;  3H8X A;  3J7H A;  2WZ8 A;  3H1M A;  3MFA A;  4AAX A;  3USU A;  1FAT A;  2YFZ A;  3B94 A;  4Q0P A;  4Q4Y 2;  4BYY A;  4TZD A;  3RS6 A;  2ZAB A;  1AX1 A;  3AZW A;  5LBC A;  4CXX A;  3KQR A;  2AEZ A;  3RZZ A;  4L0P A;  2Q8C A;  3ZKY A;  4BK4 A;  1ALY A;  1LNS A;  1RYY A;  1RTV A;  4IGP A;  3B9I A;  4ET7 A;  1GWM A;  4LO4 B;  1YFU A;  3FJS A;  5FXW A;  3VBU B;  3V0A A;  1WW5 A;  1URX A;  3UGG A;  2GH8 A;  3KS7 A;  3NST A;  1WCD J;  1PK6 A;  2J1A A;  1SQ4 A;  1UZY A;  3K4A A;  1JOP A;  4NOT A;  1XSR A;  4QX7 A;  4N53 A;  4MHR A;  5DDJ 2;  1JYW A;  2OX0 A;  1Q8V A;  3ECQ A;  4FBF A;  4QQO A;  1OQ1 A;  5JOY A;  2Q30 A;  1RUC 1;  3D0S A;  1JYI A;  4GKY A;  1HB3 A;  3VBU C;  5DUU A;  1DYP A;  5JPN B;  1AR8 1;  1RHI 1;  3PU3 A;  4LBQ B;  5F6L B;  3ZXF A;  1H4H A;  3FL7 A;  3HN3 A;  4LO8 A;  3BTA A;  4OYU A;  3ZYP A;  2GDF A;  2P2K A;  2UU8 A;  1OVS A;  2DVD A;  1W03 A;  5I8S A;  1T6B X;  5IHR A;  3A23 A;  4XUR A;  1EAH 1;  2BDR A;  4YGC A;  3SQO A;  1BEV 2;  1GOG A;  4UT5 A;  4YPJ A;  1QHD A;  3PUA A;  1D4M 3;  5KXC A;  1H2M A;  1RUJ 3;  2O8Q A;  1QWR A;  3ASI A;  3WDT A;  4D7Y A;  4DIQ A;  2ARE A;  4AFD A;  3AC0 A;  4F8A A;  3K46 A;  5A7W B;  4D94 A;  1YHF A;  3AZZ A;  3QLQ A;  5E16 A;  4NR1 A;  2BJS A;  2Y6J A;  3HN1 A;  3T4H B;  3GBW A;  5FY5 A;  2C0Z A;  2D5F A;  4IEX A;  5FMB A;  4QKF A;  3I49 A;  3WD5 A;  2G19 A;  3MLL A;  4GZ9 A;  2W1Q A;  1J58 A;  1AUY A;  1XND A;  4E4Z A;  1G9D A;  2HWE 3;  3OBT A;  2VZQ A;  1MZE A;  2JDY A;  4IV3 B;  1H30 A;  4Q4X 2;  3LEI A;  2VZS A;  3H7Y A;  3SH5 A;  2DBN A;  2RMU 2;  3RPQ A;  4JX0 A;  1NLS A;  2C4X A;  4O61 A;  3VDC A;  5FR3 A;  3JBG 3;  2HWC 1;  1QGL A;  2W5F A;  3OBZ A;  5A6Q A;  5FYV A;  3BUC A;  1HRV 3;  2WKK A;  4P9L A;  1O4Z A;  3VDD A;  3WNN A;  2WFF 1;  2PHW A;  2RR1 1;  4H55 A;  1OC1 A;  3RQ0 A;  5F3C A;  2AAC A;  2BFU S;  1MS5 A;  2ZS6 B;  3I3Q A;  1JTZ X;  2ZEW A;  1HJG A;  3FHI B;  1CAW A;  4IV3 C;  4XBQ A;  4XIO A;  5IAT A;  3T3Y A;  3UNP A;  1BBT 3;  1R08 3;  3ZSM A;  1CAU A;  4Z1V A;  2XQR A;  4JKL A;  1UNB A;  3DF0 A;  2SBA A;  4BA6 A;  1HRI 2;  1O3R A;  4Y22 B;  1OD3 A;  3VBH A;  5F3E A;  1N1S A;  3DYO A;  1QJX 2;  4WM7 B;  3O0X A;  1ULC A;  2VOT A;  3IDA A;  4QDQ A;  3SEP A;  1BHG A;  3LKJ A;  3OY8 B;  2YBP A;  3N9M A;  4LOS A;  2X29 A;  4YW3 A;  5IJR A;  4CCD A;  3T0D A;  1T6G C;  3NKG A;  4HBN A;  2A3W A;  4CDU A;  3PVB B;  1BCX A;  2O0O A;  1KEX A;  3ILR A;  1F35 A;  3K77 A;  5BNN A;  3WX5 A;  3OEB A;  2E33 A;  5ANN A;  3BIE A;  4XAC A;  2P6H A;  2UWA A;  3A21 A;  4Q1P A;  3DYP A;  4RR3 A;  3CQO A;  3DUI A;  2YU1 A;  1MVE A;  5L9B A;  2BFU L;  1AR9 3;  3RZM A;  1NE6 A;  1QOT A;  4V1P A;  3PJY A;  4GQ7 A;  1F5F A;  2DVB A;  2D3P A;  5JIU A;  2R7E B;  1GWK A;  1KIT A;  1QQP 2;  4G9S B;  4L97 A;  5FYC A;  4Q27 A;  4HPK A;  3JB8 A;  5FYI A;  3WG2 A;  5CEH A;  2B39 A;  2O1Q A;  3KGL A;  1J1T A;  1ZYB A;  5FQ0 A;  4MO3 M;  3TN9 3;  1ZA7 A;  4EE2 A;  4UW5 A;  1W2T A;  4DRR A;  1US3 A;  1D7P M;  2ZAA A;  2XHK A;  1H9P A;  3ZFF A;  3BTY A;  5IFP A;  2VTF A;  1JUI A;  2X10 A;  1I5Z A;  1OF4 A;  1VRH 3;  1ZZ7 A;  3WW2 A;  3GJA A;  2Y0O A;  3U11 A;  4GB3 3;  3VDB A;  4QDS A;  1G9C A;  5BNP B;  2GME A;  1O5U A;  3S5Q A;  1D2S A;  1IOA A;  2RDQ A;  1X8E A;  3QD6 A;  3HMY A;  5GLV A;  4LEJ A;  1RMU 1;  2CV6 A;  5GKA C;  1VBC 3;  1S55 A;  2VTX A;  3PIJ A;  4D0Q A;  3MW2 A;  1CAV A;  2CNA A;  3EBR A;  3CO2 A;  1DP0 A;  3Q8A A;  4AOC A;  4BU2 A;  3U78 A;  5JPM B;  4K40 A;  4NII A;  1GNH A;  2YMZ A;  3P5B A;  3WNO A;  2VGD A;  1DZR A;  4KMQ A;  3P6B A;  4OUS A;  2FDI A;  5BNP C;  5LEK A;  1EUT A;  1HXS 3;  2OQ6 A;  2WZR 3;  4AFC A;  3ZOI A;  5H9S A;  2Q8D A;  3PVE A;  1C28 A;  3MIG A;  1MS1 A;  4NAO A;  5J1X A;  3WW1 A;  4CU9 A;  5CNA A;  1OI6 A;  2VCC A;  4YSF A;  4JGZ B;  3V56 A;  1RL3 A;  4O9E A;  2QBX A;  4U2A A;  1JHN A;  1SFP A;  3I3D A;  4NRM A;  2RG4 A;  3R4U A;  5FYY A;  2RHP A;  3VBS A;  5FPV A;  5GZC A;  1C5H A;  2BUK A;  3AMQ A;  2VZU A;  3DEC A;  3R05 A;  4URT A;  1U0A A;  5DDJ 3;  4COW A;  1M06 G;  1CPN A;  1NKG A;  1UIK A;  5FY8 A;  3U4X A;  2HWF 2;  4GD4 A;  4EYU A;  4CPB A;  1LHO A;  5LY2 A;  1QNY A;  2TBV A;  3WQ7 A;  1XSQ A;  2JIJ A;  4D6Q A;  3NNG A;  1RUC 2;  4XIK A;  5CVR A;  4ES8 A;  4GWJ A;  4JGZ C;  3VBF C;  5LRS A;  4YGD A;  3ATG A;  4XUQ A;  1ZRF A;  1AR8 2;  1RHI 2;  2ZGM A;  5BXX A;  5T52 A;  5T50 A;  1E5H A;  4JGY A;  4XOG A;  4FAH A;  2HWD 3;  3POY A;  4N43 B;  1AYN 2;  1POQ A;  3BGA A;  2XJV A;  5GJ6 A;  4EN0 A;  1EAH 2;  1DQ4 A;  4UFK A;  3AMM A;  4CU6 A;  4XUP A;  1JOJ A;  1NUK A;  3O1T A;  4UW3 A;  2G4I A;  5C8C B;  1ZZ6 A;  2ZEX A;  2JIG A;  3QH6 A;  3H1W A;  4OCT A;  4DMI A;  5FP9 A;  1WME A;  3J26 N;  4RGK A;  3X29 B;  3P3P A;  2VO5 A;  5CKQ A;  1BXH A;  4AGR A;  2JEM A;  1ULP A;  5FY7 A;  2R07 2;  3U0Z A;  3ENR A;  4N7I A;  4BME A;  3B01 A;  4N43 C;  2RS1 3;  1HB1 A;  2HLE A;  3F95 A;  3NQH A;  2QVS B;  3FHA A;  1VAL A;  4DQA A;  2E7T A;  5FUP A;  1PX3 A;  2DVF A;  1LOE A;  2IVJ A;  4JZR A;  3THT A;  4IGO A;  3IM0 A;  4DEQ A;  1WMF A;  3THC A;  1AL2 1;  4HVQ A;  5A3W A;  5FFO C;  4XFI A;  4FTE A;  3MYX A;  1PO2 1;  2EID A;  1QJF A;  3IDB B;  3NJZ A;  5LBF A;  2GC2 A;  1R1Z A;  3A4U A;  2WWU A;  4AI0 A;  5FCC A;  4FSJ A;  3SIS A;  2QUO A;  3AL5 A;  1VAV A;  5FZO B;  1JYX A;  3DKW A;  1N1Y A;  1KJR A;  1LUL A;  3UT0 A;  2WIN B;  2W1W A;  4S2H A;  2W2I A;  1IZ3 A;  1PIV 3;  2RR1 2;  1IPJ A;  3KCY A;  4MX3 A;  3UES A;  4AI1 A;  2NLR A;  5GLZ A;  2P3K A;  4A7Z A;  5C4W B;  4XET A;  2W52 A;  1CQ9 A;  1OQD A;  1LCL A;  1NCQ B;  3I4I A;  4XBL A;  1JYT A;  2ZX1 A;  1AYM 3;  1PO1 1;  5FP4 A;  1X82 A;  4JQR A;  1S0B A;  3VD7 A;  2JDU A;  1AXZ A;  3WF2 A;  4Q4V 3;  2D44 A;  1UO9 A;  4OQ8 A;  4YZ4 A;  5FP3 A;  3JQX A;  1DIW A;  4MH0 E;  4PI0 A;  3VZL A;  3PNA A;  4JDO A;  2DVA A;  3N9Q A;  5HV4 A;  4QD2 A;  3OGS A;  2A73 B;  2IXL A;  2ZZQ A;  4Q4W 1;  2CGO A;  5C4W C;  1W6Q A;  4NHX A;  1P8J A;  3MIC A;  4QKD A;  3PDQ A;  1NCQ C;  1W0P A;  1A8D A;  2L9L A;  5B2G B;  5HCA A;  1CPM A;  4YVS A;  1YFY A;  5A1L A;  4FXG B;  4IEP A;  4W6Y A;  3WV6 A;  2BTV C;  2LM3 A;  1FX5 A;  3SC7 X;  4YRD A;  3M3I A;  1Q8S A;  3NJY A;  3GYD A;  1XQN A;  4CCO A;  4F83 A;  2DF7 A;  2EIC A;  2RS5 1;  3FLT A;  1Y9G A;  3CJX A;  4YW4 A;  1VMJ A;  5HXM A;  5JMO A;  1O3S A;  1RUD 3;  4FFI A;  1R64 A;  5FZ1 A;  1TNF A;  2AYH A;  3L2H A;  4RHV 1;  1ENS A;  1SLA A;  2GAL A;  4BE3 A;  4Y1X A;  4COV A;  3ZO0 B;  5SV8 A;  1W6M A;  3PJQ A;  1W6P B;  5EHD A;  4CZS A;  4DEV A;  4EN6 B;  1V9U 1;  1UZW A;  1EP0 A;  2C6S A;  2GC0 A;  1AJO A;  4WZC A;  1WWY A;  2BNO A;  2DWR A;  5JIA A;  5EV7 A;  4BZ4 A;  1EY2 A;  1PVC 3;  5FPU A;  2GU9 A;  2RE9 A;  1GP4 A;  4LBO A;  4LBK A;  4IE7 A;  4LJH A;  4UF0 B;  3VBO A;  4LA3 A;  5KHG A;  4KWL A;  4WV8 A;  1AL0 G;  2RJK A;  4AHY A;  1ULE A;  2VQT A;  1OA2 A;  3LPG A;  4UFJ A;  1CGP A;  3ZFG B;  1U12 A;  1UZ0 A;  3N7J A;  1DLL A;  3KV9 A;  3NKT A;  4LE3 A;  2BOI A;  2EXI A;  3SMH A;  2GMP A;  1RXF A;  4AI9 A;  4FO9 A;  2W95 A;  1G9B A;  1UY3 A;  2MHF A;  2ARC A;  2HH9 A;  2UYB A;  3AP5 A;  4P5Y A;  1T2X A;  3V64 A;  3ZVX A;  2R06 3;  4SLI A;  1JXN A;  4ZXK A;  4CUC A;  5LY1 A;  2JDP A;  4I0A A;  1OH4 A;  1FPN 3;  4GAZ A;  3IPV A;  4CEY B;  1OKQ A;  3OG2 A;  3T2P A;  3K2O A;  2A1X A;  4B29 A;  4DNY A;  3AYC A;  5EQU A;  1MQT C;  2Y6F A;  4BIF A;  3ZFG C;  1JYV A;  4AFA A;  1HQW A;  5FZI A;  3POE A;  3NJX A;  3JD7 1;  2JIC A;  3FHQ A;  1Q3E A;  2QQW A;  2VC9 A;  1AXK A;  2PQS A;  2WA4 A;  3TB0 A;  1B35 A;  2WC2 A;  3HNY M;  5GM0 A;  1MS0 A;  3T0B A;  3UET A;  4XFB A;  2VMF A;  3ELN A;  5FV3 A;  3W58 A;  3QOP A;  2VVF A;  5TSW A;  1O59 A;  1QMJ A;  4ATE A;  3N36 A;  4BQ1 A;  1VBD 2;  4CEY C;  2ZEZ A;  3BN6 A;  3UL2 A;  3U14 A;  3NAP B;  5KHI A;  3RZG A;  1DGL A;  1RUE 2;  2FMY A;  3KVB A;  5FZM A;  4CEW A;  5L7O B;  1TMF 3;  4K21 A;  3PTY A;  4XHB A;  5AFE A;  2PLV 1;  2VE1 A;  1NLQ A;  3P1I A;  4XE9 A;  3LSE A;  5DG1 A;  1NXM A;  2H0B A;  1DLC A;  2PEL A;  3RDI A;  4LKF A;  5LEJ A;  3R4S A;  1HV0 A;  3AMP A;  3MBW A;  1ZRR A;  4CDW A;  1VBA 3;  3TEW A;  5FPZ A;  1HN1 A;  3MIH A;  2XML A;  5DAX A;  1D0G A;  3INA A;  2ZHK A;  3N3H A;  3NAP C;  1LJ7 A;  3AP6 A;  4QPG B;  4GWM A;  5L7O C;  3PVO A;  5KHJ A;  4AED C;  4IE4 A;  2ZML A;  4IE0 A;  1AR6 1;  2XKO A;  3N4M A;  3N9P A;  3MFC A;  2HWB 3;  3OD4 A;  1UYY A;  1K5M A;  1SPP A;  1WBL A;  1NA1 C;  2HYK A;  2ZJC A;  1BK0 A;  5FZD A;  3WP5 A;  4CU8 A;  4UBH A;  4QB1 A;  3VKL A;  1FMD 3;  5HV0 A;  1AL2 2;  3AM2 A;  2DFB A;  3MO4 A;  3M8L A;  2Q4S A;  4QXH A;  3OUH A;  4E4H A;  5IVJ A;  2VMG A;  1PM7 A;  1RUF 1;  3LEM A;  4RGA A;  2ZGU A;  1RVF 3;  3IN9 A;  4GH4 B;  1S0C A;  3FBY A;  3ZYI B;  3VBR B;  4P00 B;  4A42 A;  4TLF A;  1XNA A;  2J42 A;  5FYZ A;  5C3R A;  4LHK A;  2A71 A;  5IT6 A;  4A4A A;  4AQT A;  1H1M A;  4FTS A;  2VW2 A;  2R32 A;  4KWU A;  3BYW A;  4LIT A;  1KJL A;  5AFB A;  4MGZ E;  4XCB A;  4QHZ A;  1GNY A;  1OLQ A;  3I2G A;  4Y20 A;  5GZE A;  1UPS A;  1EV1 2;  2JG9 A;  3WCS A;  2X8K A;  3C7E A;  5JWP A;  1MEC 1;  1YIP A;  3KCC A;  1QJY 3;  1ULD A;  2K46 A;  5G04 L;  4JQT A;  4PDW A;  3DL3 A;  1RB8 G;  2V4A A;  4GH4 C;  3THD A;  1BKZ A;  1PO1 2;  3SKV A;  1WLC A;  3VBR C;  4Y4R A;  1ZBE 2;  4UW4 A;  3ZPO A;  4FOQ A;  1S0D A;  5A7P A;  3MHZ A;  2D5H A;  2R0F A;  3MEP A;  3C2U A;  1HX6 A;  2Y64 A;  3OF1 A;  4AZZ A;  2EAK A;  3V0B B;  3I8T A;  1W39 A;  4BCU A;  1TNR A;  3I2I A;  3LD8 A;  5IK4 A;  1UIJ A;  3KF5 A;  1UU5 A;  2O14 A;  4KU7 A;  4MAD A;  4B8E A;  4M3C B;  4WM8 B;  3JUU A;  1SDD B;  2ZX3 A;  1CD3 G;  1B09 A;  2BOJ A;  3O12 A;  1OF3 A;  2VPV A;  4M0H A;  1JN2 P;  1NYW A;  1AR7 3;  4WVM A;  1U5I A;  5D1I A;  4K8F A;  2YY1 A;  1OOP A;  3DPR B;  5JVV A;  4AXO A;  1IS3 A;  4LLO A;  2QQM A;  5IVF A;  1ZA4 A;  2W47 A;  4PBP A;  5J37 A;  2WO1 A;  1GQG A;  4XPV A;  4C91 A;  4XFG A;  5A3T A;  5HBA A;  2RJL A;  3I2F A;  3NJV A;  1KDK A;  3WZ1 A;  4ORF A;  5EWS A;  3BKZ A;  3WG1 A;  2LRP A;  3OGG A;  4RHV 2;  5BNO B;  1SG3 A;  1BMV 1;  4WM8 C;  1ND2 B;  3DCQ A;  4JDM A;  3ACF A;  4LBJ A;  3WIN E;  5T5O A;  2CGP A;  1W6N B;  3M3O A;  1RED A;  1REE A;  2E26 A;  2JX9 A;  3DPR C;  3OSD A;  1ZX5 A;  3LCP A;  3TOJ A;  1W9F A;  1GUI A;  1YJK A;  1V9U 2;  1PX4 A;  3BTZ A;  3MIF A;  2BRT A;  2VCM A;  4FXK B;  4X8P A;  3EB7 A;  4RS5 B;  3SNM A;  2V72 A;  4E4D X;  1IPK A;  1LGB A;  4W50 A;  5DPN A;  1L7R A;  5CAD A;  4E9K A;  5BNO C;  3B02 A;  3WW3 A;  1BEV 1;  5JXI A;  1OA4 A;  1ND2 C;  2XDV A;  2R04 1;  4QT6 A;  3WW4 A;  1V6O A;  1WMD A;  3I97 A;  3FFZ A;  3ILF A;  3VUO A;  3BIW E;  1F4A A;  3HR9 A;  2WJS A;  3C3V A;  1IPS A;  2WNO A;  5FZ9 A;  5M0T A;  3T0A A;  4E2S A;  4QQP A;  2WLQ A;  4RS5 C;  2VUL A;  1S2E A;  2D6N A;  2X09 A;  1GWL A;  2XJQ A;  3HQX A;  4ATF A;  2VZO A;  1OLM A;  1J83 A;  4AL9 A;  2Y38 A;  2XXZ A;  1OFS A;  2IFR A;  1EUU A;  4CPB D;  5FLI A;  4A45 A;  2VU9 A;  1QJZ A;  2JWP A;  1R1A 1;  2YB7 A;  2WWS A;  3VKF C;  3ACG A;  5DUV A;  1ST8 A;  2IXI A;  1GFF 2;  1LKN A;  2OVU A;  5EIY B;  1NG0 A;  2PHD A;  3RZJ A;  4E8C A;  1Q8P A;  5FZF A;  1OUS A;  5CFC C;  2VBD A;  2X53 S;  4HAN A;  4LNV A;  2YBK A;  1NCR C;  3UGH A;  1WA4 A;  1JUH A;  4AI3 A;  1LOA A;  2JDA A;  3RGB A;  5FPA A;  3CL1 A;  2PAK A;  5IAX A;  3FBM A;  3P3N A;  4KNC A;  3LA3 A;  5H9R A;  1W6O A;  2EAL A;  4ONU A;  3WNL A;  1HKD A;  4IEZ A;  4YM3 A;  2X05 A;  1J59 A;  3CJI B;  1HRI 1;  4QU2 A;  1C1L A;  3OCP A;  3ZYG A;  3DYM A;  4K1Z A;  3K4D A;  1ZBA 3;  2J22 A;  3GDB A;  4HOO A;  2XB6 C;  1Z7S 3;  2XUM A;  4FPC A;  3KSC A;  4Q29 A;  1UWW A;  2NM1 A;  2ES3 A;  4RQP C;  5FIX A;  2UWB A;  5KXE A;  2WO2 A;  4XW3 A;  1PNG A;  1NQJ A;  5A7O A;  4XJ9 A;  1W8F A;  3KD4 A;  4AR2 A;  1SDW A;  4YM2 A;  2ZGO A;  5IK5 A;  1YQ5 A;  1WLT A;  1Y9M A;  2ERF A;  2HKX A;  3FUQ A;  4OI1 A;  3CJI C;  4CP0 A;  3TBD A;  5I91 A;  3VDA A;  2V73 A;  1VJ2 A;  2UYA A;  4CCM A; 
#chains in the Genus database with same CATH homology
 4QKB A;  4OCT A;  3RZK A;  3BTX A;  3H8X A;  4ZHN A;  3O1M A;  3S57 A;  3LFM A;  4CXX A;  3BKZ A;  3T4V A;  3BIE A;  3I3M A;  3RZM A;  4MGT A;  5F8P A;  4ZS3 A;  3BTZ A;  3RZG A;  3I2O A;  3O1R A;  2FD8 A;  4IE6 A;  4CXW A;  4IE5 A;  3KHC A;  2IUW A;  3BTY A;  4NIG A;  3BU0 A;  4CXY A;  4JHT A;  4NRO A;  4NIH A;  4IE4 A;  3O1S A;  4IE0 A;  4NII A;  3O1P A;  4NID A;  4QKD A;  4MG2 A;  2FDI A;  4NPM A;  2FDF A;  3RZH A;  4NPL A;  4NJ4 A;  3T4H B;  4ZS2 A;  3RZJ A;  3H8O A;  4NRQ A;  4NRM A;  4QKF A;  3I49 A;  3BI3 A;  4RFR B;  3O1V A;  4IDZ A;  4NRP A;  3H8R A;  3S5A A;  4O7X A;  4O61 A;  3BUC A;  2FDK A;  3KHB A;  3RZL A;  4QKN A;  2FDG A;  4IE7 A;  4QHO A;  2FDH A;  3I3Q A;  5DAB A;  3T3Y A;  3O1U A;  3O1O A;  3O1T A;  2FDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...