4NRPA

Crystal structure of human alkbh5 in complex with n-oxalylglycine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
219
structure length
211
Chain Sequence
QQLQKEEEARKVKSGIRQMRLFSQDECAKIEARIDEVVSRAEKGLYNEHTVDRAPLRNKYFFGEGYTGPGQERLYPPGDVDEIPEWVHQLVIQKLVEHRVIPEGFVNSAVINDYQPGGCIVSHVDPIHIFERPIVSVSFFSDSALCFGCKFQFKPIRVSEPVLSLPVRRGSVTVLSGYAADEITHCIRPQDIKERRAVIILRKTRLDAPRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords RNA demethylase ALKBH5
publication title Crystal structures of the human RNA demethylase Alkbh5 reveal basis for substrate recognition
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 211
sequence length 219
ec nomenclature ec 1.14.11.53: mRNA N(6)-methyladenine demethylase.
pdb deposition date 2013-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 4nrpA00
3BU0A 2FDKA 4NRQA 4NPMA 4QKFA 3BI3A 4JHTA 4NROA 3RZLA 3RZHA 4NIHA 4NIDA 4NRPA 3RZGA 4NIGA 4CXWA 2FDGA 3I3QA 3I2OA 3RZMA 4RFRB 4OCTA 4NJ4A 5F8PA 3KHBA 3LFMA 3O1SA 2FDHA 4NPLA 3BKZA 4QKNA 4ZHNA 4IE5A 3S57A 4QKBA 3T4VA 3O1UA 3KHCA 4O7XA 3S5AA 4MG2A 4CXYA 4O61A 2IUWA 3T4HB 4ZS2A 3BTZA 5DABA 4NRMA 3BTXA 2FD8A 3O1OA 3BIEA 4IE6A 4IDZA 4NIIA 2FDIA 3O1RA 3RZJA 3BTYA 2FDFA 4QHOA 3H8XA 4CXXA 3O1PA 2FDJA 4IE4A 3T3YA 3H8OA 4IE0A 3I49A 3O1MA 3O1VA 3BUCA 4ZS3A 3O1TA 4IE7A 4QKDA 3RZKA 3H8RA 3I3MA 4MGTA
chains in the Genus database with same CATH superfamily
5FOJB 1QDOA 5T5OA 1HJGA 1GQHA 3MICA 4Q8LA 1AL23 1XXNA 3TNQA 5D21A 4BQ4A 1PX4A 3POJA 4QWNA 4W6WA 1VRH2 4U36A 1KFXL 3URFA 4HK8A 5DAWA 4BLIA 1JYNA 4LJHA 4UFIA 1PK6C 2A1XA 4CZSA 5BNOB 3WP5A 1X33A 1HIXA 2ZJCA 4AEMA 1NCRA 3ZXDA 3OGSA 1FV3A 1PVC1 1ASJ3 2E6VA 2JICA 4W6XA 4LBQD 3K4ZA 4NUBA 2HWF1 1U5ZA 2EXJA 4GKXA 4J1XA 4M4RA 2GALA 4QPGA 5CG9A 4MV2A 5J37A 1QJX2 4UFKA 1WLWA 3AL6A 1UY0A 5FMOS 2WO3A 4IV3A 1URXA 2JJ6A 3C7EA 4RQPB 5BPXA 3UESA 2I74A 4QHZA 1ZBE3 2A7AA 4HKLA 4ZXKA 3ZXJA 4ATFA 2VVFA 1CAWA 1VBE3 3I59B 4AAPA 4LHKA 3O0VA 4XCAA 5T54A 1OFNA 2PHTA 3PTYA 2E51A 4AFAA 2B45X 2CWSA 3N7JA 2CSGA 3HJRA 1UCXA 2C0ZA 4K8RB 4EN9B 3MUZ1 3MLJA 2JE9A 3NVCA 4WM8C 4QXKA 3S7EA 3ZYPA 3DPRA 2WQ4A 5FYSA 3FE5A 1CJPA 3FN9A 1UN1A 1W8TA 1TEIA 3INAA 4LHLA 3NV2A 2Z42A 3K3OA 2QVSB 4XF0A 4N7IA 4CEWB 3AXDA 1X9TA 5FXXA 4Q26A 1JOJA 5FZDA 5A7WA 4DUWA 1UMHA 1M4WA 3I3EA 1GR3A 4Z2AA 2RDNA 5FYUA 3KCXA 4AQSA 4QB1A 3BU7A 2GU9A 4JQRA 4UI9L 2FBEA 4GJYA 2XBO3 4QQ2A 2JDMA 3BTXA 1VBA3 1AF9A 1QJY3 3AZYA 1H2MA 4YW4A 2ZGUA 3W20A 2PFWA 2VZ3A 2WNVC 2DCYA 4IDZA 2D93A 3NAPC 2FDIA 2RS11 4X8NA 3T08A 4AGRA 1FOD2 3C2UA 1MZ6A 3OPZA 1AHSA 2GP3A 3AJZA 4JKKA 4XAAA 1AX1A 3ZMNA 1E5IA 4KU7A 1DGLA 5G04L 3ZLIA 4Y22B 1WCQA 1TMF1 2HWB3 3H7JA 2W1UA 1UWWA 2VQUA 3POFA 3UK9A 2Y6LA 3D0SA 3N9OA 2HYKA 4C0HA 2WNOA 2JKXA 4XCBA 2RMU3 4MGKE 5EFUA 1F8VA 2YXSA 1W8ZA 4IE4A 3SNMA 1W2AX 1OBNA 1X9PA 3ACIA 1J59A 4EWEA 2AZ5A 4FXKB 3APBA 2ZMNA 4IE0A 1I6XA 1BBT3 2NMOA 2Y6FA 3D82A 1DFQA 2Q1ZB 3K77A 2HWD2 2OXBA 1O5UA 1Z7S2 4AI8A 1EUUA 1HXS2 1WUVA 2XKPA 1N3QA 1ZRRA 2OIIA 1B35B 3UGFA 3VZLA 1LKNA 2ZABA 1AXKA 3HD8B 2XXZA 1PNGA 2W9XA 4GAZA 1QJZA 4LQRA 5IW0A 1J1LA 3S7IA 4HMZA 4CP9B 2RS32 3ACGA 3T2PA 2DV9A 2OA2A 1VAVA 1U5YA 1H4HA 2WYFA 5CFDC 3WQ1A 3IKWA 2WNUB 4M0NA 1REEA 4Q0PA 2YGMA 4WVVA 3K46A 5C3OA 3O14A 4RS5B 3VZMA 2RS52 3R05A 1FATA 3ZYFA 2ZPXA 4DOUA 2G9ZA 3D5OA 3VL9A 2BGOA 4K40A 2JG8A 1SFPA 3JXSA 4BB3A 1MEC1 2VZRA 3E5XA 4AI2A 2QQLA 4RGGA 1WMFA 2XVGA 2NP0A 3EO6A 1HQLA 1YRZA 3DXTA 3OUIA 5EWSA 5FYBA 2JIJA 1MS8A 2NMNA 4RR3C 1W6NA 3J7LA 2VXJA 3I54A 1GWKA 1HRV3 5A3TA 2QQNA 2VG9A 3WUCA 4YLZA 5BYNA 2ET1A 3V56A 4KG8A 3ZN5A 3KHBA 3AP7A 3S5AA 4CCOA 1QOOA 3HVDA 4YFZA 1VMFA 3GYDA 2CGPA 4HN0A 1B09A 3SITA 5KXEA 1JW6A 3B7MA 3RDIA 4LA3A 4CDQA 1IZ3A 1WD3A 1YQCA 1ND2A 5C4WC 5LCWL 4ZHNA 4EWAA 5H9QA 3W21A 1C1FA 3SEEA 5A70A 4CPBA 5BNOC 3DKQA 3FHQA 4QT6A 1HLCA 2MEV1 1JS9A 3J7NA 3ZVXA 1Q3EA 4HETA 1AX2A 3HT2A 2J1AA 3WY6A 2EIDA 2V72A 2XPJA 4HFSA 3OBZA 4Q0VA 3WOGA 1KEXA 1RUF3 5L9BA 1Y3TA 4H2AA 4A3ZA 1I1EA 1LHUA 2BEOA 3WW3A 1YYNA 2K46A 4IEVA 5EYXA 3ZXKA 5FOBB 5SV5A 3H3LA 4EN0A 1TME2 1CX1A 2DTYA 2ZGSA 2FMDA 5ABJC 5CFCA 2WZR2 2BQPA 3DGTA 3GBGA 3H8UA 4NIIA 2D44A 3RI9A 1XNTA 1AYM2 4DEVA 3ZSEA 5IK7A 3JQWA 1ZRIA 4JQTA 2WZEA 4WM7B 5BUVA 3V64A 4I3PA 1HQWA 1K12A 1OT5A 3SHRA 2X8KA 3W5NA 1ZRCA 2W46A 2C6SA 2Q4SA 5H9PA 1A78A 3ME2A 1KGYA 2PYTA 1AR72 3VBHC 1NXD1 1DYKA 1RUI3 4FP2A 4COVA 2ENRA 2DVAA 1UY3A 2BPA2 1CAVB 4AQ6A 5CG8A 2R061 1IS3A 4FPOB 4JKLA 4XYXA 3WDWA 4A7KA 4Q4V3 2JG9A 2DTWA 2R041 4CEWC 4UFHA 2E26A 2WS93 2OZ6A 4DY5A 3KV6A 4TTGA 3LDKA 3I4IA 3WCSA 2OUJA 3K4DA 5F6LB 3NJXA 5A3WA 3AL5A 3QACA 4N43C 2Z79A 4GWIA 4TYSA 3WQBA 4CCEA 2E7TA 3HN1A 3P1IA 1H2KA 2HYXA 5EP9A 4GXLA 3FLPA 1OLQA 3K3NA 3ZFEC 5C8CC 5IUQA 2WIIB 2JD9A 2A73B 4PF1A 4Q4Y1 3RYKA 3UKVA 1JU4A 2LALA 2PLV2 2XWBB 3PU8A 4MGSA 4XF9A 4DPNA 1O3SA 1LEMA 4GJZA 1J58A 3N9PA 1OH4A 4GH4C 1XYNA 5FMBA 1MS1A 1BK0A 1SLBA 2BWCA 4H3WA 5KHGA 4ZZ5A 2XHKA 2AH2A 4AL9A 1O59A 4NR1A 2BJSA 2C9KA 3E6BA 1Y9MA 2RR12 1WKYA 4O9GA 5LK5A 2VCMA 5H9SA 5F3EA 4LO4B 4LKDA 1ULCA 5DAPA 3CL1A 4P5YA 1ZRFA 1UD1A 1QH6A 1CAXA 3HMYA 4NWVA 2YC0A 1CWPA 3ZYGA 3SXWA 2LS6A 3AX4A 2C26A 4MGIE 2WNEA 5HXMA 4BJ0A 4CDWB 1RUJ1 1UZYA 1AR93 1O4ZA 4UFLA 1A8DA 2EALA 4NE9A 4B3NA 3VHOA 4CXWA 3IWZA 3POIA 5C9AA 5FWJA 2ETEA 1KQRA 3VBSB 4OI0A 4XFHA 2V73A 3LEGA 1LOAA 4GA9A 2ARBA 4JGYA 4EROA 1K5JA 1YFUA 4BLJA 5L9RA 1S0CA 5JLVA 2J1EA 4AFDA 4P9IA 5FP3A 3LFMA 1NQJA 1W9YA 2AR6A 4MGZE 4BQ3A 1FPN2 3T0AA 4NWWA 2VZTA 1OFSA 1CAUB 5A7OA 2J7MA 3LDBA 3PVBB 4LUKA 1D4M2 1KS4A 1RUE3 3D4KA 4JV4A 4QKBA 3FC0A 4E4SA 2YBSA 2B9UA 4YM2A 1W03A 3OEAA 3AP6A 2DURA 1NE6A 2JE7A 5I8SA 4FTBA 2VOXA 3LSDA 1SLCA 1TNRA 4UYBA 3OSDA 1LEDA 2QUOA 3Q8CA 1RVF1 5DABA 3M70A 1XNCA 4EQVA 4JDNA 1G7YA 1XOYA 1OMIA 2WR9A 3ZSMA 4LE3A 1XU1A 2WZR1 1JZ7A 5DUVA 1EYBA 2H6CA 4LO7A 5LRRA 4CDUB 1AYM1 4CTEA 1SLLA 1W6PB 1SEFA 1RIRA 1HJFA 1SBEA 2GN3A 1UPIA 2K0GA 1TNFA 4BH9A 5FY9A 2CWMA 3DYOA 1QJFA 1RINA 2W1SA 2BFUL 1QH7A 4PIZA 2PMWB 2BOIA 1GZWB 1SLTA 2CDOA 4IEWA 4RHV2 4NHXA 5I0SA 4YGDA 5HPOA 3NV4A 1DZTA 3C7GA 2GMEA 3RI8A 2ZGKA 4Q8KA 3S0MA 5FYCA 5FY7A 1MZFA 3ZPOA 3KVBA 2FQPA 1AR61 2ZHLA 4RQPA 2VJXA 2A70A 2P6HA 4QX0A 3ZN4A 1PZ8A 3WF1A 2XHNA 3CDZB 5APAA 4L8QA 1X7NA 5GLVA 3AXEA 3VHRA 4O65A 4QPYA 2RVAA 5C3SA 2DU0A 2EIGA 2VH9A 4QGMA 3KGZA 5J09A 5IVVA 4PBOA 2WYSA 3PDQA 4IL7A 3RJRA 1F35A 1QKQA 5FYVA 3VBRB 1ZZCA 5L36A 3OBAA 2ILMA 3SISA 4IEXA 1Q8OA 1RHI1 2BVVA 3MYXA 2VNOA 4Q0UA 2PN5A 1E57A 3VKOA 1UW8A 1UO9A 1ASJ2 4BPZA 1Q43A 2LRPA 1A6CA 2DU1A 1COV3 2V4AA 2W39A 3TRSB 2W68A 2V5YA 1FX5A 4Y5Z0 3ACFA 1KXGA 1ZM1A 2A3YA 1H9WA 2Y64A 4FFIA 4FPJA 1RUNA 3ZXGA 3WP3A 1ZVFA 4YPJA 4BWOA 1LHNA 2BGCA 2K2SA 1ZBE2 3DUIA 3NRUA 4JVAA 4D7SA 1EV11 2OYZA 5HCAA 3E1F1 4MSVA 5EJ1B 4PDWC 1WZXA 1NKGA 1VBE2 3VBOB 4I01A 1JU3A 2RM23 2WSVA 3GJBA 4Y1YA 5GALA 4XQDA 4QPWA 5FZ7A 1FI2A 1UX6A 4AW7A 2VOVA 3J8F2 3VD4A 1O8SA 1OQDA 4KQ7A 1PGW2 4Y22A 5FYYA 3RZMA 3OB8A 3AMPA 5E16A 2WSUA 5CKQA 4XAEA 4KMQA 2XJPA 1KDKA 1W99A 2JDYA 2VM9A 2YBKA 5CNAA 1MQTA 3N36A 4OUEA 5I8YA 4XEZA 1FPN1 1CQ9A 3O1SA 2VQTA 3BODA 1AR83 3PVEA 1OF4A 2P37A 4TSVA 4P9LA 2R073 2HWE1 4UF0B 4F83A 4BMEA 4UW5A 5CYYA 4K6BA 3U0ZA 2FCUA 4Y20A 3EB7A 3SKJE 3AC0A 4CVUA 5FUIA 4D0QA 1BK1A 3DN7A 3LAGA 1UPSA 4XETA 1DQ0A 1UZZA 2XBO2 3ZR6A 4LLOA 5DAVA 5JDBA 1VBA2 1QJY2 4MG2A 3R6SA 4QPIC 3WNNA 5T3NA 3HPNA 4BQ1A 1B35A 1WLCA 2Q30A 4XDQA 3WCRA 1XSQA 2J1SA 2OPKA 3T4HB 2NN8A 3HQUA 1SZBA 5EJ3A 1RUC1 3ZSJA 5JOWA 1BEV3 2XONA 2Q5TA 2WT2A 2FD8A 1LGCA 4CP9A 2VW1A 4CDXB 1R093 5FZMA 2HWB2 3O0WA 4D6SA 3UV9A 4YZ1A 5C70A 1PVXA 3NWKA 3VBSC 4AFMA 3RZZA 3CJIB 1Y9GA 3LQCA 5GZEA 3SH4A 3T1MA 3FX3A 2WNUA 1DCSA 1UOJA 2RMU2 3E97A 3NNJA 4P02B 3ZFFA 4FPFA 5M0TA 2VGDA 1VJ2A 5FJKA 3ASIA 2GZWA 4AGGA 5JXJA 2G9FA 4B1LA 2VMFA 2E63A 2TBVA 1BBT2 4AHWA 2PHLA 5GZFA 4Z1VA 2WUHA 2W0XA 4XFAA 1SDDB 1ODMA 4XJ8A 3THCA 3LOIA 4H7MA 4AGVA 2B39A 3OEBA 4LKFA 2JX9A 1S0GA 2DWRA 4QB2A 5A1FA 5E1RA 1IG0A 4FPCA 4MXVA 5KWRA 1UU6A 3ZFGC 2VZVA 2P3YA 3AYDA 1EP0A 4M4PA 2X5IA 3CF6E 1AJKA 4LT5A 2XQRA 4LBJA 3O1VA 1SMVA 2JXAA 2DCJA 5IATA 1OF3A 1POV1 4D94A 2BBAA 3VD9A 4AVVA 1CIYA 2EF6A 4QKDA 1N1YA 3MFCA 4IV1A 3UNPA 3HOBA 3VDAA 1TG7A 3B00A 3AMHA 2YGLA 3JZVA 4ZONA 3RZKA 4YRDA 5KHHA 4CDUC 3VKNA 3SC7X 3SCFA 1GP6A 1JHNA 4IGOA 3CKHA 4QGNA 1PK6B 3ZR5A 4FFGA 5LBEA 5FREA 4MH0E 1QNWA 5CIRA 1V9U2 1RJ8A 2ARCA 2PHFA 1WMXA 5FMOL 3WF4A 1P8JA 2R30A 3OGRA 1ZZ6A 4FPEA 3T30A 5J48A 1XNAA 3I2JA 4JGZC 2YU1A 4XF4A 1JZ4A 2ZKLA 1LR5A 1ULEA 4JHTA 3LCPA 3MFAA 5FIXA 1HV0A 1VIWB 3CO2A 3FLRA 4UAPA 4XMIA 1WWYA 4NIHA 1US3A 4WZCA 2XDVA 3KWVA 3Q8BA 1NCQC 2A71A 1JBCA 1UZVA 3MIBA 4K1ZA 1PIV1 4ET7A 3J8F1 2B7YA 3I2GA 5FPLA 4YVSA 4CU8A 4DB5A 5F3CA 3AKSA 5LEKA 3PVNA 2ET7A 1CN1A 1HRI3 4PQ9A 1LAJA 1QJU3 5JIAA 3KQ4B 2X05A 2VC9A 4WM8B 2VULA 4AK3A 1SQ4A 2HWC3 4COWA 1CAVA 2ADDA 1NCRC 3PMEA 1FV2A 1ZA4A 1GKBA 4NVPA 4XUOA 1RUD1 4ZZ8A 4XDPA 1RUF2 5EHDA 3IIAA 4QKNA 3AYAA 5FYMA 4YWAA 3RG0A 1VAKA 1G9DA 1WBFA 4Q4W1 4FOWA 4AI1A 1Q5OA 1CPNA 5FBJA 1QOSA 3G7DA 3TNPB 1L7RA 5DQ0A 2JEMA 2PHXA 1NA1C 2QJVA 4IV3C 4FFFA 3W9AA 5FZLA 4NHMA 3N4MA 1XNDA 3PUSA 3TOJA 4CU9A 1SLIA 2WNVB 1CR7A 4GB33 1GOHA 1MS0A 4KBBA 3VBOC 3ETPA 4Q5OA 2JDZA 4YG0A 3UT0A 2NZ9A 2W87A 4F7ZA 5DDJ2 2Y60A 1YIPA 3ZN6B 3ZYHA 1AL0G 1YLLA 1H2LA 2ZEYA 1RUI2 5AFEA 1MVQA 3ZO0B 4BQXA 4DUXA 3RVHA 4K8FA 5D1IA 1PGSA 5L73A 1UXZA 4E4HA 4FI9A 1HN1A 1N1SA 4Q4V2 4Z82A 2O14A 2YU2A 2W94A 2WS92 2YYOA 2ZHKA 4OZOA 4M01A 4A7ZA 1H1IA 1MS3A 4XXPA 5FLJA 5LK7B 4AHXA 5JZGC 4OULA 1OURA 4DXRA 2FDJA 1YHFA 2GNBA 1LOFA 3O7OA 3FHIB 4QX7A 3VD7A 1H1AA 1OQEA 4LBQB 3EJKA 3ITQA 3TAYA 1PZ9A 3AK0A 4I3GA 5C3PA 2ZHMA 3ABZA 3E5QA 3FUQA 5A3PA 2Q1MA 4FP3A 4YW3A 1J83A 4BXFA 3NO8A 3KZ4C 1M06G 3JD73 3GHMA 4QX8A 3O1TA 1VBC3 1XPWA 3T0BA 2LUWA 2ZZJA 2ZA9A 1QWRA 2WINB 1R1A1 4FO9A 4XUTA 1XB9A 1R083 4CCJA 5K7PA 1FMD1 1XRUA 4CPBD 3UJQA 3TN93 1NY72 1C8M1 1GWLA 5CFDB 1LESA 3P3NA 5FDBA 2WFF1 4WV8A 4PIXA 1V9U1 1MZEA 2FDKA 4BQ5A 1EAH1 1Y9QA 4XIKA 2R1DA 4PJYA 2ZX4A 4QX5A 1YFWA 1QQP3 4XFGA 1HKDA 1UL9A 1ZZBA 1BQPA 3IIIA 4IETA 4IUGA 1OC1A 4PBPA 4W6YA 5JSPA 3MV01 4UOJA 1UYPA 3Q9OA 2J1TA 4HT1T 1AR92 1ZZ7A 3SH3A 3GDBA 2VMCA 4LE4A 1YUDA 1W8HA 1YQ2A 1DHKB 2CDPA 3NNGA 1WA4A 1QDCA 3AP4A 2OW4A 3KCYA 4RR3B 1XQNA 2XGXA 5LY2A 4NIDA 3MIHA 1LHOA 1WLTA 1YIFA 1W6MB 3USUB 2WLQA 3ECQA 1W6PA 1S0DA 1AYN1 1KD7A 4YG6A 3KF5A 2UU8A 3RWKX 2B8MA 5DN2A 1GZWA 3OYWB 3NNLA 4NJ4A 1I9RA 3PUAA 1OD5A 1PZ7A 5C4WB 1HW5A 1TQ5A 2EA7A 1OLME 3B9CA 3PLQA 3GXUA 4RSUA 5A1LA 2WKKA 1H6XA 4AYUA 2WQ8A 5FLHA 2NYYA 2BVBA 3KGLA 4OI4A 4XPVA 5ACA1 1PHMA 5B4XA 1OA4A 1W3XA 4ATEA 4F8AA 3LF7A 2VCAA 1XU2A 2CGOA 2TEPA 4L9BA 1BCXA 4RL7A 5SV8A 1AZDA 3AZVA 2D3PA 2PQSA 4OQ9A 3CZUA 3ROUA 2D43A 4GMP3 3ZM8A 4CU7A 5JXHA 2W92A 2Y8KA 3PL0A 5ABJB 4N90A 1BMV1 2QZ2A 3R4UA 1JUHA 4FT8A 2YPDA 5ISLA 5DDJ1 3VKLA 3OG2A 1W8OA 1X8EA 4NHKA 4E2SA 4Q29A 3JB8A 3G6JB 4ZU4A 1E5RA 1FNYA 3WF2A 3N7MA 4NIAA 3VBHB 3WNKA 2EAAA 4IEPA 4R4XA 4CDQC 3VZNA 1O3RA 4Q4V1 1VB2A 1H8VA 3M3CA 1IS4A 2ZEZA 4B8EA 2A6YA 1BVVA 3P5BA 1ND3B 4XE9A 2AEZA 1S0JA 4OFGA 2D5HA 3U10A 3GZEA 4PCRA 5FBZA 4HZFA 4UFMA 5A33B 1JYCA 5K4LA 3X29B 5L7OA 3IAPA 4N43B 4MADA 3UJOA 4MLOA 2DUPA 3OJBA 1UU4A 3HNYM 2O0OA 3ZFEB 4CP1A 5C8CB 1VALA 1OUXA 1QY4A 2ZGOA 5KBFA 4H7LA 2VVDA 2MHFA 1COV2 5FP9A 4GH4B 1ZBA3 2E7AA 1NZIA 1PO11 1RC6A 2ZAAA 3W59A 4FTSA 2YZ4A 4ZPIA 5FZGA 4UF0A 3OY8B 3KT4A 3NMBA 3H3ZA 3BU0A 1KITA 5LBBA 4OYUA 2VOWA 3OGVA 3WX5A 4YZ4A 5AC93 5IT6A 1OI6A 2OPWA 1S55A 2PHRA 4META 2DVFA 3DEMA 3O5SA 4N53C 5HV0A 1VLNA 3A0NA 1LOCA 1YI7A 2W1WA 5K0UC 1VAMA 2HKXA 1OHFA 3M8LA 2E31A 3IB3A 2DFBA 3WDVA 4YW1A 5FY0A 2W47A 2XH6A 1PO23 2AUYA 4XW3A 1W8NA 5B2GB 1NX9A 4RGKA 1LB2A 1OOPA 1OXCA 3MGUA 3VBFA 1W9TA 3NL1A 5IVBA 1HV1A 3V0AB 1ULDA 2FDGA 1C8NA 4KU8A 3NKGA 1AR82 2RE9A 3ZIXA 1ENQA 1VRH1 1O8PA 2UWCA 2R072 3BPSA 4ZKTB 3BCWA 2XL7A 1FXZA 5FAXA 3SCHA 1UZ0A 5KC5A 1VBB3 2WA3A 3RS6A 4Q27A 1OVPA 4NPLA 3ZDVA 4CCDA 1T2XA 1JOPA 2WFPA 1QJX1 1F5JA 2JWPA 1S0FA 2QKDA 4S2FA 4I2OA 4D7YA 1BEV2 1DLLA 1RUH3 4O7XA 4YSFA 3WF0A 4NN0A 2XQXA 2IFRA 4ITCA 4JAAA 4OI2A 4URAA 5JWPA 1OPMA 4A45A 1DGRN 4LKEA 3ZXEA 1QIQA 3ZDSA 1BLZA 2VXRA 4OQ8A 5IVCA 1W05A 4YVWA 4CEYB 1RUG3 5DAQA 5BNNA 3TEYA 3ENRA 4AAXA 4GZ9A 3WW4A 3UYJA 3V0BA 1K5MA 1W04A 2P34A 4UW6A 4Z92B 1DYPA 5FK8A 3T2TA 1SPPB 1W3VA 3H42B 1V6OA 2VAUA 3IDEA 1D4VB 5IJRA 4LTAA 4FPHA 3BGAA 5C3QA 1U5IA 3A21A 3KM5A 1C1LA 4GWNA 4XUPA 2Z5WA 1PGL2 2Y26A 4FPYA 4HPKA 3H50A 3JBG3 1Q8SA 1MACA 4BOWA 3LOBA 3H1YA 2YC2A 2VTXA 4B7EA 2QQWA 4TWTA 3KS7A 2W95A 4AEDC 4ES9A 3U11A 5JIUA 3VZOA 2GNDA 3KB5A 1H8TC 2VE1A 3U07A 2LW8A 4XQ4A 4XOGA 4MXWB 1O7FA 5A6ZA 5FUPA 1YI9A 4HVOA 5D2AA 4WM8A 2I07B 1FOD1 2ZX3A 4V2VA 5C5UA 5JSOA 4P9WA 3LEKA 1VB4A 2Y6HA 5LBFA 4M3CA 5F7UA 3WUDA 2XOMA 1SLAA 4IERA 1Q56A 1MVEA 1GZCA 1PVC3 1ULPA 3MO4A 2HWF3 3BALA 3HWJA 1L3JA 1HDKA 3B01A 3M2MA 4KH9A 2C1FA 5D8AC 5EXOA 3ZMOA 3V65A 5CZKA 3MI8A 5FKCA 4XJ9A 4E4DX 2JDNA 5FZEA 1ND3C 3RNSA 5HI0A 4M3CF 2Z69A 1GOFA 4FAGA 3FZ3A 3L9JT 1LOGA 5AVPA 5J96B 4PDWB 5IVJA 3UETA 3VUOA 2WNVA 2DCTA 5FP4A 3T2QA 3NAPA 2HWD1 3WEZA 2RDQA 1GANA 1Z7S1 2PA7A 3IPVB 3LKJA 1HXS1 4Q2FA 4XFCA 4JRLA 1HRI2 2BNMA 4FOQA 5JPMB 5CVRA 1E5SA 4BMBA 3QBQA 2HWC2 3H7YA 1JODA 5T5LA 4B4PA 3GZUC 2D6OX 1GNHA 2RS31 2YC4A 1PX3A 4WZFA 5F5QA 4BXSV 4LOTA 3VZJA 3ZXFA 2DUOA 4FPKA 1SCRA 1ZNPA 4LITA 5A32A 2BGPA 2YBPA 2UY9A 3HIFA 1C5HA 4DRVA 5IK5A 2A3XA 4AZZA 1ZZ8A 4D6QA 1DZQA 1OH3A 2QDNA 2RS51 2YB7A 1SFNA 2W52A 4I02A 4QPIB 4Y1VA 3UKNA 2R7EB 2BWAA 4Q4X3 3J7MA 3PIGA 2CTVA 2WT0A 2LM3A 2XUMA 4EN7B 2OT7A 2FCTA 3PUIA 5DUWA 3AYCA 1W39A 3C7OA 3O12A 1GNZA 2RS13 5EZWA 2VO5A 4CCNA 2EXHA 1FAYA 3S5QA 4QB6A 4AOCA 4J6GA 2QQIA 3U75A 4FQZA 1WCDJ 1TMF3 2PHWA 2YV8A 4XVHA 3KV4A 4NRMA 2LTNA 4BM8A 2CL2A 4PLNA 1MQTC 1IKQA 4A41A 5FO9B 3SCGA 1LNSA 5EYYA 2BBVA 1SBDA 1SBFA 2ZXQA 5FXVA 5JOYA 1JZ5A 3GF6A 4L97A 5IAVA 4QXBA 4LNVA 3VBUB 5F3GA 3DYMA 2VUAA 4XHBA 1FYUA 2JB4A 4GWJA 3AKQA 2OVUA 5GZCA 2HEVF 4KWLA 3RRDA 2ZKNA 3ZFGB 3GBWA 5KHIA 3BN6A 3IDAA 3JU9A 2IWGB 3A7QA 3JD72 3GZAA 2JKBA 3LDRA 1VBC2 2EVXA 5FXZA 4ARYA 3ZPYA 2YPJA 2Y34A 1W6MA 2C4XA 2W3JA 3USUA 1K45A 4OI1A 3RPQA 5EJZB 4FSJA 1QNYA 1R082 4LEJA 3DL3A 3WF3A 1TME1 5F39A 3VD5A 3TN92 3ZKYA 2TUNA 3I49A 2AYHA 1V6LA 3DXUA 4HG6B 5H9RA 4UT5A 1OQ1A 2F4LA 3BTAA 2WBKA 3OYWA 4OHXA 3N9MA 5HXVA 5FK7A 2WZPP 4CEYC 4YW6A 1OLRA 1WD4A 4E2GA 3ZYJB 1N47A 2J1VA 3VDDC 3ZFFC 4CSWA 5BNOA 4Y5SA 4PLOA 1QQP2 4MHRA 4CCLA 1V6JA 5FFOC 1AR71 1O91A 4HANA 4HSLA 1GP4A 3KT1A 4NO4A 4JGZB 4N7UA 3GNEA 1RITA 1PM4A 2D6MA 3IT8A 3N9NA 4YFWA 3C8XA 1JZ6A 1W06A 2ZGQA 5BNPC 2Z4FA 1MEC3 1ACCA 4LBOA 1GSLA 4MVTA 3BPZA 1OSGA 4U2AA 4CYDA 1YC61 4IGPA 5FV3A 2O8OA 2X5IC 2ERFA 1NAEA 2KXLA 5ABJA 2P4EA 4M00A 1NCQB 2XLGA 4R9CA 5CU1A 4EN6B 1H30A 1IPJA 5FTTC 1TZOA 2VMIA 3I59A 2B9VA 2ZX2A 2QQKA 2VZSA 1EY2A 3AMNA 2KA3A 1AL22 2XJQA 3E5UA 1POQA 2UYBA 1W8FA 2EICA 4Y5TA 1YXWA 3F95A 3CQOA 1BZWA 2BP6A 4QM9A 4RYDA 3RYPA 4LBNA 3UL2A 4WVMB 5FQ0B 5IWFA 3BIWE 2PLV1 1NXMA 4ZU5A 4ASKA 1K42A 4P00B 1UMIA 4UFJA 2E9QA 3GALA 3I3QA 2X10A 3POEA 5JOXA 4OHZA 5CAZA 1NCRB 1RL3A 5F9TA 1W2NA 4RFRB 5JI7A 5J36A 4OVEA 4QPGB 4CEWA 4DO0A 5LA1A 2MEV3 4XC9A 5FZKA 4QHBA 4F3JA 2OUHA 2Y6JA 2RR11 1RXGA 4YW5A 4I0BA 5A33A 5J3UA 3VDBA 2YY1A 2VCCA 4PHZA 5KXBA 1JYXA 4P5HA 5GZGA 4X8PA 4IV3B 1NA1B 1JZ8A 2GNMA 4I30A 4FOVA 3FFQA 3WNOA 3T4VA 4DXSA 5GJ6A 2VZQA 1LU1A 3AKTA 1S2KA 2DBIA 2ES3A 3LFIA 1JUIA 1PMIA 3CHXA 1PNFA 4NHLA 2IUWA 4YVSC 4KBZA 3FFZA 4X6QB 4S2GA 1D7PM 2RJ2A 4JRAA 4WVWA 4MZUA 4MGYE 5A6QA 1CONA 4JHZA 4UW3A 2R6QA 4HOOA 3BIEA 3GZTB 1RJ7A 4ASMB 4D3WA 2XMLA 2X09A 4W4ZA 1H2NA 2VQAA 4K7JA 2R063 1OPOA 1W6OB 5JZGB 4G9SB 1D4M1 2R043 2WO7A 4LORA 3N7KA 3WP6A 3LIHA 1T6BX 5JR2A 2Y0OA 3AKPA 4GIQA 1AXYA 2DCKA 1K3IA 4QDQA 3MDPA 1W90A 2ZGRA 2PQQA 3MHZA 3WD5A 3FLTA 3RWNA 4E2QA 4CXXA 3FL7A 4Y1XA 4YW7A 2HJIA 4A42A 2VL4A 4XQWA 5A3OA 3VLBB 4LO5B 3H8OA 4FPLA 4Q4Y3 4ASLA 4BE3A 4I0WB 4LHSA 1UMZA 5KHJA 3O1MA 1W2OA 1YNAA 3S30A 3ZYIB 3TEZA 2BZDA 3PTRB 3OBRA 5G05L 1HX6A 3I8TA 2E7QA 1UKRA 2VD7A 3NKTA 3C7HA 3OBTA 4QMAA 4ZU7A 3HEIA 4YARA 2BUKA 1C5IA 1PMHX 4LIUA 4RS5A 4RHV1 2X53S 2AREA 2VECA 4MGTA 5I0UA 3POGA 4Q0SA 5F6KA 1MS5A 2A5ZA 3ZSKA 2XG3A 1UYXA 2HBUA 3VBUC 2A6VA 3A0KA 2CAVA 2DFCA 4A3XA 2XB6C 3H0OA 4BCUA 2KD7A 1RUJ3 4HL0A 1SACA 2BNOA 1PO22 5GLWA 1Q8QA 1Z78A 5ANNA 4CA9A 3N3HA 2MNGA 1F2NA 2ZS6B 4QX3A 1IPKA 2ZGLA 4NROA 4L2NA 1ST8A 1W0PA 1W6QB 3KF3A 1AL21 1S4CA 1WGPA 3HQRA 3H9AA 3MV11 4XTPA 1YJKA 3WG1A 2E53A 5DUXA 3FUOA 2UY8A 5F5CA 1SPPA 5FP8A 2DCZA 3WNPA 5A3UA 4NIGA 2YHJA 2P5BA 4AR2A 3K2OA 4OHVA 4EV0A 4C1XA 1DQ2A 1OUSA 1ASJ1 1VBB2 4XBLA 2Q8DA 2UWAA 1WMEA 3AKRA 1BHGA 3IBMA 5FXWA 4DEQA 2Y38A 3W58A 2VW2A 3I7DA 2K9ZA 1RUH2 2VNVA 1UOBA 3AFGA 4L99A 2GN7A 3HAGA 5T5PA 4PF5A 4KI5M 4Y33A 1BJQA 1ZBE1 1RVF3 2VW0A 4A6SA 1JXNA 3ZYBA 4BU2A 4DXTA 1VBE1 2QQVA 2G19A 3B9IA 1HRV2 1XNBA 2WZR3 3EYPA 2D97A 1G9CA 3NV3A 4G4FA 5JAXA 4IEOA 5CA6A 1AYM3 5FPBA 4ONUA 3B93A 4JX0A 4WM7A 1JHJA 5LA2A 1O6UA 2ADEA 1PGW1 2XWJB 2Y6GA 3BYWA 3GBFA 5A6YA 1G9AA 5BNQA 1QF3A 3AVRA 1T6GC 2I2SA 4CDQB 2EXIA 2VBPA 4BK4A 4COZA 1O3QA 2VVEA 4XHXA 5FY1A 3M3QA 1IS5A 4PI2A 3O1RA 3JBG2 2VNGA 5LB6A 4QPGC 1Q8PA 2D6LX 3N9LA 4IEUA 4CUBA 3UKTA 2IFWA 2ZZQA 2NM1A 1AR63 1D0HA 3D8CA 4CUCA 2XBO1 1VBA1 1QJY1 2VTXJ 4QHOA 4RA0A 3IPVA 1JMUB 3U14A 4UW4A 2GSYA 3USSA 4DMIA 4R9BA 3CEWA 2PAEA 2BNNA 5CFCB 2O1QA 3Q8FA 5GM0A 4DINB 1R64A 3LB9A 3KT7A 1F5FA 1MR5A 3AYEA 4OMCA 3RGBA 2ZEXA 1V6NA 3MLKA 2N7GA 1RHI3 2L9LA 2HWB1 2R16A 3H1MA 3HR9A 4DQAA 1IG3A 1H4GA 4DFSA 1PVC2 5T50A 1G9FA 4BQYA 1F9KA 5L19A 4GWMA 3B3QE 2HWF2 3IN9A 3ZXLA 4BYYA 1LJ7A 2RMU1 5FUNA 3RSJA 2VUJA 4OZXA 4K21A 1BKZA 4H14A 4MHUA 1NLQA 3DPRC 3ZIWA 1UQXA 4CCMA 3THPA 3B02A 3OGJA 3OGGA 4GMP0 3KCCA 2JDHA 4K1YA 4DXZA 3H8RA 5C71A 4R9DA 4QPIA 5JI9A 3I3MA 2YMZA 1J3QA 1BBT1 3MBWA 3PHMA 4N53B 5E8AA 4LIVA 3U1XA 1EV13 3RFRA 4CDWA 5K0UB 5DXDA 5FZCA 5EIYB 1W9WA 1GU3A 1RMU3 4JZRA 2Y0IA 5LATA 4B1MA 2RDSA 3ORJA 2OS2A 3NNFA 3VBSA 4GKYA 3KSCA 5FZ0A 3S6PA 2GP5A 3FBYA 5HCBA 3AMMA 3J9SA 4Z8BA 1V70A 3BVCA 1N3PA 1UY4A 1J3RA 4BQ2A 4LOSA 4A7YA 2Q8EA 1FPN3 4TLFA 3DECA 4XJUA 1CAUA 1UYZA 2Q1FA 2VZOA 2WRAA 5ANQA 2WQZC 3P6BA 3N7LA 4BIFA 2CHHA 3I2OA 2HWE3 1MS4A 2IXHA 2ZGTA 3NJVA 1SCSA 4Q4X2 3ZFGA 5JPNB 4PLMA 1GZ9A 2DF7A 3ZYRA 1XC6A 5FZOB 2XJVA 4C91A 2EXKA 1CX4A 2B4KA 3OD4A 4MUVA 4C1WA 4XZPA 5JSRA 2RS12 2RJKA 3MIFA 3OUHA 3TYJA 4IESA 1RUC3 4L11A 1XYOA 2W1QA 2DDUA 2CAUA 3MEPA 3NSTA 1HRV1 5JMOA 2ZGPA 1LECA 2G4IA 1XNKA 1U0AA 3LGRA 1LHVA 2EIBA 1TMF2 3POYA 4O9EA 2AENA 4CDUA 5C33A 1DGRA 3SQOA 1OOPC 1EUTA 3I3BA 3NJZA 3VBFC 4O61A 1LTEA 1REDA 5FLIA 3OOXA 4FQ4A 4OMDA 2GH8A 3MW4A 1BYHA 2RV9A 3NW4A 4YG3A 1RUE2 3I2HA 2ZOEB 4UBHA 4FVVA 3VHNA 3CJXA 1QGLA 1S0EA 2XKOA 2TNFA 3LA2A 1D0GA 2V09A 4J25A 5LASA 1RUF1 3RZJA 5IYYA 3ILRA 3WT3A 2P1BA 2JG8C 1NCQA 3SH5A 4AEJA 2VZ1A 5GLUA 2OQ6A 3POSA 3CBNA 2KM2A 4AEDB 5GLZA 4CCCA 5L9VA 3H8XA 2V5DA 4LMFA 1POV3 1V00A 1H8TB 3AB0A 4A2UA 5FPVA 4DIQA 5A7SA 3OD0A 1KFUL 2ID4A 4YVWC 4CP0A 3VBRA 4WVMA 3T3YA 4A4AA 4CUAA 5BNNC 5FQ0A 2MPFA 3EBRA 2ORZA 1K5MC 4FBFA 1SDWA 3WG4A 1QU0A 1YJLA 1NYWA 4YGEA 2WLPA 1HB4A 1RUI1 5LEJA 5FZIA 1DP0A 3LD8A 4TLGA 4UXAA 4BDVB 5TSWA 3TBDA 1RTVA 2C5DA 2CY6A 3FJSA 1ND2C 2WN2A 5D8AB 3KMHA 3VDCA 1BXHA 1MEC2 1UZWA 2IVIB 1LGBA 1LODA 1MZ5A 2D40A 2WS91 2CU5A 4C90A 4NAMA 2CNAA 1NA1A 4YGBA 3KVAA 1G9BA 2JENA 3LEMA 1DDLA 3K48A 4S2HA 4XMAA 3WDXA 2FHRA 5JVVA 4GD4A 3OPTA 3ACLA 4V2WA 2SBAA 4FPGA 2IVJA 2XLAA 3VBOA 3FBMA 1YCIA 1ZYBA 4QKFA 1PM7A 2IZWA 2RDRA 3T2OA 3GGLA 2XLFA 4XBQA 1PIV3 4Y4YA 2F17A 3QH7A 3J8F3 1W0OA 5DG1A 2DUQA 3BI3A 1WW7A 4YGCA 5CFCC 1S1AA 3EXUA 2IXLA 4R9AA 3AZWA 2KR2A 3O1PA 4FTEA 1NE4A 4CE8A 3KQRA 4XF3A 1FT9A 1US2A 1W0NA 4CUGA 1GNYA 1UOGA 2R32A 3F2ZA 2QZ3A 2Y6KA 4AEKA 1NY71 2MEV2 3PUQA 4GQ7A 1W6OA 3MPBA 5JZGA 5GLTA 5B4NA 4PI0A 2UURA 1RUD3 4YZ3A 4OUMA 3OF1A 4Q4X1 1DQ5A 4KGGA 5DUUA 1ONAA 1ZX5A 4Q4W3 3IDCB 4Y3OA 5F3IA 4XF1A 2ARAA 2JG9C 3GM8A 3LA7A 4DZGA 3LE0A 1VBD3 4Y1ZA 3HQXA 3WP4A 2QBXA 1GBGA 4XUQA 2O8QA 2RHPA 5IFPA 1NG0A 4AI9A 1AR91 4AXOA 5LA0A 5FYIA 2RM22 5CKMA 4CP2A 2J22A 3I2KA 2FDHA 2OX0A 2YFZA 2I45A 3THTA 4XURA 3T09A 5IVYA 2FZ2A 2IXJA 1BVP1 3EHKA 3IMMA 3J7HA 2WWUA 1KS5A 2ZGMA 3N35A 1N3OA 3VZKA 2BRTA 4CDXA 5J1XA 5JXIA 3KHCA 4BHPA 2CYFA 3CJIA 3E6DA 4HLTA 4XXAA 4Z2WA 1UKGA 5DPNA 1MQTB 3LIGA 2GC0A 4AFCA 5I93A 4K20A 1R1ZA 3K51A 2R062 2D3SA 2CGNA 2BV4A 4AQTA 1RUE1 2R042 1W9FA 4LPLA 4OHYA 4I0AA 4Y20B 1JI6A 1CVNA 2WJSA 4E9KA 1VRBA 3TEWA 3E6CC 3B94A 1YO8A 5GZDA 2GNTA 4B4RA 5FPZA 3R4SA 4KGQA 4D6RA 3MF6A 2AGSA 1ULOA 4ISQA 4AVSA 2G9GA 2NPIA 3VV1A 5T52A 5C6CA 1WMDA 3WDTA 4BQWA 1DGWX 4Q4Y2 1IQAA 4S2DA 1W6QA 2GMMA 3K4AA 2HLEA 3PVOA 4COUA 1R092 3FWEA 2JDKA 1ZREA 1C3HA 5C9AC 3MIEA 4AFBA 1R1A3 4QX2A 4R4ZA 1FMD3 1WCKA 1GLHA 4JGYC 1QXJA 2JDAA 4KWJA 1C8M3 2GDFA 3VDDB 1GWMA 1PK6A 4N9HA 3ZFFB 4W8JA 4KWKA 2WWSA 4IXLA 2ORXA 2WFF3 3LPFA 5I91A 1V9U3 4Q0QA 1UYYA 1EAH3 2GC1A 4AI0A 3QH6A 5HCFA 1IHMA 2H0VA 5I0RA 4QGLA 4UWDA 1W8UA 5LA9A 2VUDA 4YZ5A 4IEZA 2WABA 3OPWA 2ARXA 3T1LA 4AVTA 5BNPB 5C7GA 3TWIA 1RUJ2 4Q1PA 4LK6A 4W50A 2X5IB 2UWBA 4KNCA 4N8MA 4BISA 1GZTA 5LW9A 1QJEA 3A4UA 3M3IA 5F32A 2DBNA 2JDPA 2XJUA 5FPAA 1VE0A 4DUVA 4KG0A 4LBMA 4DNYA 2PHDA 4CCKA 1JTZX 1J1TA 1F4AA 2XVLA 4LO6B 3A23A 4NOTA 3WW2A 1FNZA 1GICA 4IV1B 1A34A 3CLPA 2JB8A 1YQ6A 3WR0A 1AYN3 1CZVA 3R0RA 2PXJA 2QFEA 1XYPA 1QOTA 2R1BA 2XJSA 4DS0A 5FPXA 3RZLA 1TVGA 4ISRA 1COV1 1XE0A 1ZA7A 1ODNA 4CRQA 1ENXA 1WW6A 5DMYA 1JYVA 3WQ0A 5FMCA 2VOTA 3B69A 4LO8A 4NAOA 1HN0A 1N1VA 5ACA3 4BZ4A 3CNAA 1RVF2 3NNMA 2DVDA 1VR3A 3PU3A 1GUIA 4R52A 4V1PA 1WBLA 3D0JA 5CB7A 2VMDA 2VZUA 4HVRA 4RQPC 5E6HA 5K9YA 3CZJA 2RM21 1LU2A 5CADA 2A75A 5F2SA 4I09A 3ST7A 3MW2A 1LULA 5A6XA 2P6CA 5FZ4A 1UU5A 2A6XA 3MIGA 1ENRA 4YVSB 2WL1A 5FYHA 2HBTA 1UY2A 3ATGA 5DDJ3 1QJU2 4MOAA 5FO7B 3ZN6A 1RUOA 1W9SA 2QDRA 1IPSA 3ES4A 4H55A 4CXYA 5FY8A 4C0BA 5FY5A 3AJYA 4MO3M 5A3LA 5HCHA 4JDMA 1AR81 2HH9A 4A6OA 1LOBA 4FXGB 5IVFA 2R071 3HNBM 3BTZA 4HK9A 3VD3A 4TZDA 1EPZA 4N53A 3C3VA 3I2FA 3WSOA 3WZ1A 3ZOIA 1AR62 3WG3A 1XJAA 4QU2A 5KHKA 1C4RA 3WDUA 3WHTA 1D2SA 4LBQA 5K0UA 3R4DB 1ZZ9A 2XUEA 2ZACA 2ZMLA 3L2YA 4GB32 4AQ2A 4SLIA 1BEV1 1UIKA 1STMA 2D98A 1YEWA 3HBZA 4Y4RA 5E88A 5FZ6A 2RG4A 3BOPA 1OA2A 1R091 1RHI2 4EE2A 3BB6A 3RQ0A 1G86A 2YG0A 2EAKA 3OTFA 1X82A 2J1UA 2QQJA 1KDMA 2ZMKA 3VKFC 2RJLA 1WCSA 4DY3A 1PO13 5CFDA 4XZUG 5F1RA 1UIJA 5C8WA 1DZRA 4L92A 3POWA 4E8DA 2BW8A 1UXXX 1YWKA 3LPGA 3AZZA 2D3RA 3EQEA 1F15A 2WN3A 2VR4A 4JTNA 3ZSLA 2D6NA 1X8MA 1EV12 3U4SA 1U5XA 4QD2A 5DZGA 3WHUA 3WXPA 2ZEWA 3DV8A 4QDRA 5FZOA 3VHPA 3C7FA 3WW1A 5AFBA 5CEHA 2BERA 2VMHA 1U12A 2EIEA 3IMNA 1RMU2 4FFHA 1PGL1 3DKWA 2PTMA 1DGWA 4KWUA 3N9QA 1OD3A 5FO8B 4URTA 1B35C 4LK7A 4DRRA 4RR3A 4YYOA 1NLSA 1CIWA 1XE7A 2W5FA 2GH2A 4N9IA 2A6WA 5EPAA 3VKMA 1JYWA 1VMJA 2W08A 3SKVA 1UX7A 3AZXA 2BTVC 1DQ4A 1YQ5A 4M0HA 1OVSA 1ZRDA 1W28A 1VRH3 4HXCA 4K3UA 3RMXA 4XUNA 2D6KA 2HWE2 1O3TA 2IXKA 2WNUC 4W65A 3J26N 3WG2A 5C4WA 5FZ9A 2H6BA 1A3KA 2JECA 2J1RA 3QLQA 4RS5C 5FZAA 2ZAHA 5ERLA 4NRPA 3FMGA 4OHWA 4BK5A 3RZGA 1ULGA 1Y43B 3LEIA 2F4PA 1TE1B 1NT0A 4NPRA 3PURA 3ZX7A 5C5TA 2WC2A 4RFT0 1GQGA 1CGPA 3ON7A 1GV9A 1QJX3 1G6NA 3OUJA 4JCKA 4B4QA 1DQ6A 1RUC2 3DCQA 3PJYA 4IGQA 4OCTA 5CBLA 1C28A 3SEPA 4AEDA 3BOWA 4AHYA 4IW3A 1LGNA 2P3KA 5F8PA 5FY4A 1H8TA 4YM0A 2CV6A 1QMJA 1HB3A 1XSRA 4PQQA 2VBDA 2FCVA 1JOBA 4BIOA 3HBKA 4LBKA 5J7MA 1A8MA 2GC2A 4TN7A 3PUHA 1OA3A 4E8CA 3IM0A 3A22A 1HRI1 1I5ZA 2VMEA 5F5IA 4IE5A 1QJU1 4AVBA 3O1UA 4IV1C 5DG2A 1VPHA 2DVBA 3QOPA 4XFIA 2Q8CA 4AWDA 2HWC1 5FKBA 1AJOA 2NQYA 4AVCA 3VBHA 5D8AA 5FMDA 2QQOA 3HT1A 2VCBA 2VU9A 4ZS2A 4XJAA 3KLSA 2BU9A 5CISA 4MX3A 1ND3A 1HB2A 4UBGA 1KRIA 5K8SA 5BY5A 4IE6A 2R0HA 5LWBA 1CZSA 2P3JA 4QM8A 4D69A 4YW2A 1NLRA 4D8MA 2ZBJA 2A3WA 1F31A 4N43A 4PIYA 1H0BA 3DYPA 2P2KA 4P9GA 2HEWF 3M3OA 4GB31 2FDFA 4XABA 4QU1A 1WCUA 4MGQA 1IOAA 1D2QA 4QXHA 5FZ1A 3ZFEA 5C8CA 1JZ3A 1CAWB 1W8WA 3AMQA 3IDBB 3M3EA 1CD3G 1W2TA 1OKQA 4WM7C 1FOD3 4X6RB 1IGOA 2ZCWA 4FCAA 4QDSA 4GH4A 1I5PA 4XDOA 5A7PA 1SFYA 4OUSA 3LWCA 3SMHA 5FZHA 5FR3A 2H0BA 3NJYA 4AVAA 3M1HA 1GYKA 1JH5A 3OY8A 2GC3A 3M4FA 5DZEA 4XTMA 3DPRB 3WQ7A 5KXDA 3ALQA 1LHWA 5A3MA 1CESA 3ZKUA 1LENA 5FZFA 4QQOA 3MLLA 2P17A 1LCLA 3MW3A 5A7WB 3RYRA 2D6PA 3T0DA 1GMMA 3PJQA 4IE7A 3WINE 3WV6A 4R8HA 1RMU1 3WDYA 5L7OB 5I8TA 2A6ZA 3VN4A 4QAWA 5JCTA 1PIV2 2X29A 4Q1RA 2HWD3 2LROA 5FP7A 1Z7S3 5J98B 2NLRA 1HXS3 3ELNA 3JD71 3QCWA 1VBC1 3RJ2X 1ENSA 3OCPA 2R49A 2QTWB 1S0IA 3P3PA 1R081 2QQPA 1G8WA 3TN91 3V0AA 1ZBA2 3MPPG 4XIOA 4HSJA 1ALYA 4EJRA 1OLMA 2WAAA 1S2EA 3U37A 1GOGA 1V0AA 4XJZA 2RS33 1V6MA 5CKNA 1H6YA 1RUD2 4FAHA 1HQNA 1MPXA 2Z2SB 1REFA 4M3CE 2R0FA 5AC92 1CZTA 2FZ1A 1QQP1 4Q4W2 3GJAA 1H1MA 5FWEA 4P08A 1O4TA 1VBD2 4E27A 2BYVE 2ZTNA 2RS53 4NHYA 1GP5A 4EYUA 2XJRA 4EN8B 1WW5A 4BA6A 1LOFC 4ES8A 4CDWC 1SHWB 5IAXA 5I0TA 3UGHA 2QQMA 3I3DA 2V4VA 4K9SA 2OZJA 3CU7A 4YNIA 4IQPA 2D5FA 5JR7B 5HBAA 3UGGA 3MIDA 4QX1A 4CEYA 5A3NA 1OOPB 2B42B 5FZBA 3VBFB 3WLUA 1RB8G 3BKZA 3VDDA 1AVBA 2B5HA 3S57A 5AVAA 2WZ8A 2PELA 3KD4A 4HONA 4WBBA 4AE2A 2G1MA 5FYTA 1PMJX 4GULA 2D7FA 5IHRA 2FMYA 2VOKA 1NOVA 1EPWA 2QCSB 1YFXA 2VPVA 2YUEA 3ES1A 4P14A 4A44A 1O5LA 2DVGA 3D6EA 4ORFA 2YROA 3K75B 2IC1A 1JYIA 2WAOA 4QQLA 3GHNA 3H1WA 1KJLA 2OQ7A 1GQPA 3ILFA 5BNPA 5FJHA 4COYA 3H3UA 5FRAA 4D7TA 1DYOA 3WVJA 1QXRA 3O1OA 2JG8B 4LR4A 2HEYF 4WVZA 5F37A 3WNXA 3LA3A 4AI3A 2ZX0A 3AFKA 4GMP1 4HKOA 1WA6X 1R1A2 4SBVA 4KL1A 3I97A 4LKSA 3Q8AA 4MXWA 1FMD2 1TME3 1W6NB 4YVWB 1RUG2 1X50A 1C8M2 5BNNB 4ARXA 3PNAA 3JUUA 3V0BB 5BXXA 1K5MB 2ZX1A 2XVKA 1W2UA 2JE8A 2WFF2 3AP9A 5FCCA 1IS6A 5IFTA 1UOFA 2J42A 4C8DA 1EAH2 4TXWA 4LBLA 2GMPA 1RYYA 5A7QA 5LBCA 4LXLA 3W5MA 1KJRA 3O0XA 2Y33A 3KV5A 3CMGA 3JB4C 1OKOA 1AR73 3J4UH 1DBNA 1ND2B 3DF0A 2C9AA 5FZ8A 1LOEA 1AXZA 3RMYA 5IK8A 4EZ4A 4ZS3A 4JKMA 3AM2A 2W2IA 4JC1A 4HPKB 5JXGA 2ZHNA 5FPUA 2BFUS 4INDA 1QEXA 1Y4WA 5FZ3A 1C57A 3VL8A 1L7LA 4PDWA 5DZFA 2VZPA 3MF9A 5E89A 2F6BA 5KR7A 5LZ6A 1DU3D 1J84A 1UNBA 4Y1UA 3LZZA 1L7QA 3Q8EA 2YDEA 1AYN2 3LSEA 3TEXA 2BOJA 4HBNA 2Q8OA 3PMSA 2P3IA 1Q8VA 2SLIA 4NRQA 3VBRC 1QHDA 2DYCA 2IXCA 4NPMA 2ZGNA 2VTFA 3FHAA 2VNRA 4JTOA 4AF9A 1HB1A 1ZBA1 5T55A 3KV9A 5GKAC 2PLV3 4AHZA 4M3CB 1DIWA 1RGSA 3GCWA 2Q0AA 4Y26A 3TB0A 2E33A 3MUY1 4P9XA 2AEYA 3VB9A 5AC91 4XJWA 5ACA2 3RZHA 1NQDA 1IQDC 1WW4A 3ILNA 4LA2A 5A1AA 4YM3A 1JN2P 1POV0 4PT6A 3POBA 1VBD1 3I2DA 4ZY9A 5BV6A 1MS9A 2RR13 4GALA 4OLLA 3I2IA 1S0BA 1VP6A 2JG9B 3U78A 1QXPA 2VBBA 4RD7A 4CU6A 1RXFA 1V6IA 4XFFA 2VUCA 2XL9A 1S2BA 2PAMA 5LRSA 2ATFA 3NAPB 5JUVA 2JDUA 5LY1A 4RGAA 1BMV2 5L7OC 2BDRA 3ETQA 3THDA 4HVQA 2JIGA 5C3RA 1CJDA 1LRHA 1O4YA 3AVSA 4LLFA 3CIHA 4IEQA 1PO21 4YZ2A 1Y7BA 3EMRA 4LUMA 1JYTA 5EQUA 3NQHA 4LHNA 1J3PA 2QQUA 2WO1A 2XR4A 5IK4A 3AP5A 1DQ1A 4Y24A 3HNMA 2WA4A 2WDBA 1DF0A 5A80A 2JD4A 4FOYA 1XE8A 5JMCA 3B5LB 1NZCA 1IKPA 5FYZA 1I3HA 3VGIA 1AX0A 2UYAA 4LULA 2VQ0A 1WLDA 4QQHA 2QE3A 5A32B 1H9PA 2IXIA 1UF2C 3M7AA 4IEYA 4XFBA 3HN3A 4XBNA 3IAQA 1VBB1 4B29A 5EV7A 2WWJA 3VBUA 1D4M3 1V6KA 2C24A 3NV1A 2WT1A 5JOZA 4QQPA 4P9JA 1CAXB 1CPMA 4RN5A 1RUH1 3ZXAC 5A7NA 1VMHA 1X36A 3ACHA 2AC1A 4G3YC 1XBFA 4HN1A 4E4ZA 5I0DA 4J1WA 1Z0HA 4EWDA 2VY0A 3L2HA 1UY1A 2AACA 3BTYA 4CDXC 1DLCA 5IVEA 5C9AB 3U4XA 1RUG1 2E32A 2PHUA 3WNMA 1PO12 4ZXEA 2B46X 5DAXA 5KC6A 3CJIC 3SLIA 4JGYB 3D3AA 4HKWA 4JDOA 2OKXA 3JQXA 1N1TA 2GAUA 3WNLA 1GFF2 4YM1A 5HV4A 2QNKA 1JZ2A 4XACA 1NUKA 3IZOA 2WO2A 4XILA 1YFYA 1E5HA 4AG4A 4JGZA 1DG6A 1ULFA 2YFUA 4RHV3 1YQ8A 3PIJA 4EZHA 3BUCA 5T5JA 4NMIA 4B7KA 2VMGA 3MZHA 3JCIA 3JBG1 3QD6A 1SG3A 2XJTA 1UAIA 4MYEA 4Z07A 1AUYA 2PAKA 1F4HA 1APNA 2W91A 4L0PA 3GCXA 5F5AA 5F2WA 4QXCA 5KXCA 4P9YA
chains in the Genus database with same CATH topology
3BU0A 2FDKA 4NRQA 4NPMA 4QKFA 3BI3A 4JHTA 4NROA 3RZLA 3RZHA 4NIHA 4NIDA 4NRPA 3RZGA 4NIGA 4CXWA 2FDGA 3I3QA 3I2OA 3RZMA 4RFRB 4OCTA 4NJ4A 5F8PA 3KHBA 3LFMA 3O1SA 2FDHA 4NPLA 3BKZA 4QKNA 4ZHNA 4IE5A 3S57A 4QKBA 3T4VA 3O1UA 3KHCA 4O7XA 3S5AA 4MG2A 4CXYA 4O61A 2IUWA 3T4HB 4ZS2A 3BTZA 5DABA 4NRMA 3BTXA 2FD8A 3O1OA 3BIEA 4IE6A 4IDZA 4NIIA 2FDIA 3O1RA 3RZJA 3BTYA 2FDFA 4QHOA 3H8XA 4CXXA 3O1PA 2FDJA 4IE4A 3T3YA 3H8OA 4IE0A 3I49A 3O1MA 3O1VA 3BUCA 4ZS3A 3O1TA 4IE7A 4QKDA 3RZKA 3H8RA 3I3MA 4MGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BU0 A;  2FDK A;  4NRQ A;  4NPM A;  4QKF A;  3BI3 A;  4JHT A;  4NRO A;  3RZL A;  3RZH A;  4NIH A;  4NID A;  4NRP A;  3RZG A;  4NIG A;  4CXW A;  2FDG A;  3I3Q A;  3I2O A;  3RZM A;  4RFR B;  4OCT A;  4NJ4 A;  5F8P A;  3KHB A;  3LFM A;  3O1S A;  2FDH A;  4NPL A;  3BKZ A;  4QKN A;  4ZHN A;  4IE5 A;  3S57 A;  4QKB A;  3T4V A;  3O1U A;  3KHC A;  4O7X A;  3S5A A;  4MG2 A;  4CXY A;  4O61 A;  2IUW A;  3T4H B;  4ZS2 A;  3BTZ A;  5DAB A;  4NRM A;  3BTX A;  2FD8 A;  3O1O A;  3BIE A;  4IE6 A;  4IDZ A;  4NII A;  2FDI A;  3O1R A;  3RZJ A;  3BTY A;  2FDF A;  4QHO A;  3H8X A;  4CXX A;  3O1P A;  2FDJ A;  4IE4 A;  3T3Y A;  3H8O A;  4IE0 A;  3I49 A;  3O1M A;  3O1V A;  3BUC A;  4ZS3 A;  3O1T A;  4IE7 A;  4QKD A;  3RZK A;  3H8R A;  3I3M A;  4MGT A; 
#chains in the Genus database with same CATH topology
 5FOJ B;  1QDO A;  5T5O A;  1HJG A;  1GQH A;  3MIC A;  4Q8L A;  1AL2 3;  1XXN A;  3TNQ A;  5D21 A;  4BQ4 A;  1PX4 A;  3POJ A;  4QWN A;  4W6W A;  1VRH 2;  4U36 A;  1KFX L;  3URF A;  4HK8 A;  5DAW A;  4BLI A;  1JYN A;  4LJH A;  4UFI A;  1PK6 C;  2A1X A;  4CZS A;  5BNO B;  3WP5 A;  1X33 A;  1HIX A;  2ZJC A;  4AEM A;  1NCR A;  3ZXD A;  3OGS A;  1FV3 A;  1PVC 1;  1ASJ 3;  2E6V A;  2JIC A;  4W6X A;  4LBQ D;  3K4Z A;  4NUB A;  2HWF 1;  1U5Z A;  2EXJ A;  4GKX A;  4J1X A;  4M4R A;  2GAL A;  4QPG A;  5CG9 A;  4MV2 A;  5J37 A;  1QJX 2;  4UFK A;  1WLW A;  3AL6 A;  1UY0 A;  5FMO S;  2WO3 A;  4IV3 A;  1URX A;  2JJ6 A;  3C7E A;  4RQP B;  5BPX A;  3UES A;  2I74 A;  4QHZ A;  1ZBE 3;  2A7A A;  4HKL A;  4ZXK A;  3ZXJ A;  4ATF A;  2VVF A;  1CAW A;  1VBE 3;  3I59 B;  4AAP A;  4LHK A;  3O0V A;  4XCA A;  5T54 A;  1OFN A;  2PHT A;  3PTY A;  2E51 A;  4AFA A;  2B45 X;  2CWS A;  3N7J A;  2CSG A;  3HJR A;  1UCX A;  2C0Z A;  4K8R B;  4EN9 B;  3MUZ 1;  3MLJ A;  2JE9 A;  3NVC A;  4WM8 C;  4QXK A;  3S7E A;  3ZYP A;  3DPR A;  2WQ4 A;  5FYS A;  3FE5 A;  1CJP A;  3FN9 A;  1UN1 A;  1W8T A;  1TEI A;  3INA A;  4LHL A;  3NV2 A;  2Z42 A;  3K3O A;  2QVS B;  4XF0 A;  4N7I A;  4CEW B;  3AXD A;  1X9T A;  5FXX A;  4Q26 A;  1JOJ A;  5FZD A;  5A7W A;  4DUW A;  1UMH A;  1M4W A;  3I3E A;  1GR3 A;  4Z2A A;  2RDN A;  5FYU A;  3KCX A;  4AQS A;  4QB1 A;  3BU7 A;  2GU9 A;  4JQR A;  4UI9 L;  2FBE A;  4GJY A;  2XBO 3;  4QQ2 A;  2JDM A;  3BTX A;  1VBA 3;  1AF9 A;  1QJY 3;  3AZY A;  1H2M A;  4YW4 A;  2ZGU A;  3W20 A;  2PFW A;  2VZ3 A;  2WNV C;  2DCY A;  4IDZ A;  2D93 A;  3NAP C;  2FDI A;  2RS1 1;  4X8N A;  3T08 A;  4AGR A;  1FOD 2;  3C2U A;  1MZ6 A;  3OPZ A;  1AHS A;  2GP3 A;  3AJZ A;  4JKK A;  4XAA A;  1AX1 A;  3ZMN A;  1E5I A;  4KU7 A;  1DGL A;  5G04 L;  3ZLI A;  4Y22 B;  1WCQ A;  1TMF 1;  2HWB 3;  3H7J A;  2W1U A;  1UWW A;  2VQU A;  3POF A;  3UK9 A;  2Y6L A;  3D0S A;  3N9O A;  2HYK A;  4C0H A;  2WNO A;  2JKX A;  4XCB A;  2RMU 3;  4MGK E;  5EFU A;  1F8V A;  2YXS A;  1W8Z A;  4IE4 A;  3SNM A;  1W2A X;  1OBN A;  1X9P A;  3ACI A;  1J59 A;  4EWE A;  2AZ5 A;  4FXK B;  3APB A;  2ZMN A;  4IE0 A;  1I6X A;  1BBT 3;  2NMO A;  2Y6F A;  3D82 A;  1DFQ A;  2Q1Z B;  3K77 A;  2HWD 2;  2OXB A;  1O5U A;  1Z7S 2;  4AI8 A;  1EUU A;  1HXS 2;  1WUV A;  2XKP A;  1N3Q A;  1ZRR A;  2OII A;  1B35 B;  3UGF A;  3VZL A;  1LKN A;  2ZAB A;  1AXK A;  3HD8 B;  2XXZ A;  1PNG A;  2W9X A;  4GAZ A;  1QJZ A;  4LQR A;  5IW0 A;  1J1L A;  3S7I A;  4HMZ A;  4CP9 B;  2RS3 2;  3ACG A;  3T2P A;  2DV9 A;  2OA2 A;  1VAV A;  1U5Y A;  1H4H A;  2WYF A;  5CFD C;  3WQ1 A;  3IKW A;  2WNU B;  4M0N A;  1REE A;  4Q0P A;  2YGM A;  4WVV A;  3K46 A;  5C3O A;  3O14 A;  4RS5 B;  3VZM A;  2RS5 2;  3R05 A;  1FAT A;  3ZYF A;  2ZPX A;  4DOU A;  2G9Z A;  3D5O A;  3VL9 A;  2BGO A;  4K40 A;  2JG8 A;  1SFP A;  3JXS A;  4BB3 A;  1MEC 1;  2VZR A;  3E5X A;  4AI2 A;  2QQL A;  4RGG A;  1WMF A;  2XVG A;  2NP0 A;  3EO6 A;  1HQL A;  1YRZ A;  3DXT A;  3OUI A;  5EWS A;  5FYB A;  2JIJ A;  1MS8 A;  2NMN A;  4RR3 C;  1W6N A;  3J7L A;  2VXJ A;  3I54 A;  1GWK A;  1HRV 3;  5A3T A;  2QQN A;  2VG9 A;  3WUC A;  4YLZ A;  5BYN A;  2ET1 A;  3V56 A;  4KG8 A;  3ZN5 A;  3KHB A;  3AP7 A;  3S5A A;  4CCO A;  1QOO A;  3HVD A;  4YFZ A;  1VMF A;  3GYD A;  2CGP A;  4HN0 A;  1B09 A;  3SIT A;  5KXE A;  1JW6 A;  3B7M A;  3RDI A;  4LA3 A;  4CDQ A;  1IZ3 A;  1WD3 A;  1YQC A;  1ND2 A;  5C4W C;  5LCW L;  4ZHN A;  4EWA A;  5H9Q A;  3W21 A;  1C1F A;  3SEE A;  5A70 A;  4CPB A;  5BNO C;  3DKQ A;  3FHQ A;  4QT6 A;  1HLC A;  2MEV 1;  1JS9 A;  3J7N A;  3ZVX A;  1Q3E A;  4HET A;  1AX2 A;  3HT2 A;  2J1A A;  3WY6 A;  2EID A;  2V72 A;  2XPJ A;  4HFS A;  3OBZ A;  4Q0V A;  3WOG A;  1KEX A;  1RUF 3;  5L9B A;  1Y3T A;  4H2A A;  4A3Z A;  1I1E A;  1LHU A;  2BEO A;  3WW3 A;  1YYN A;  2K46 A;  4IEV A;  5EYX A;  3ZXK A;  5FOB B;  5SV5 A;  3H3L A;  4EN0 A;  1TME 2;  1CX1 A;  2DTY A;  2ZGS A;  2FMD A;  5ABJ C;  5CFC A;  2WZR 2;  2BQP A;  3DGT A;  3GBG A;  3H8U A;  4NII A;  2D44 A;  3RI9 A;  1XNT A;  1AYM 2;  4DEV A;  3ZSE A;  5IK7 A;  3JQW A;  1ZRI A;  4JQT A;  2WZE A;  4WM7 B;  5BUV A;  3V64 A;  4I3P A;  1HQW A;  1K12 A;  1OT5 A;  3SHR A;  2X8K A;  3W5N A;  1ZRC A;  2W46 A;  2C6S A;  2Q4S A;  5H9P A;  1A78 A;  3ME2 A;  1KGY A;  2PYT A;  1AR7 2;  3VBH C;  1NXD 1;  1DYK A;  1RUI 3;  4FP2 A;  4COV A;  2ENR A;  2DVA A;  1UY3 A;  2BPA 2;  1CAV B;  4AQ6 A;  5CG8 A;  2R06 1;  1IS3 A;  4FPO B;  4JKL A;  4XYX A;  3WDW A;  4A7K A;  4Q4V 3;  2JG9 A;  2DTW A;  2R04 1;  4CEW C;  4UFH A;  2E26 A;  2WS9 3;  2OZ6 A;  4DY5 A;  3KV6 A;  4TTG A;  3LDK A;  3I4I A;  3WCS A;  2OUJ A;  3K4D A;  5F6L B;  3NJX A;  5A3W A;  3AL5 A;  3QAC A;  4N43 C;  2Z79 A;  4GWI A;  4TYS A;  3WQB A;  4CCE A;  2E7T A;  3HN1 A;  3P1I A;  1H2K A;  2HYX A;  5EP9 A;  4GXL A;  3FLP A;  1OLQ A;  3K3N A;  3ZFE C;  5C8C C;  5IUQ A;  2WII B;  2JD9 A;  2A73 B;  4PF1 A;  4Q4Y 1;  3RYK A;  3UKV A;  1JU4 A;  2LAL A;  2PLV 2;  2XWB B;  3PU8 A;  4MGS A;  4XF9 A;  4DPN A;  1O3S A;  1LEM A;  4GJZ A;  1J58 A;  3N9P A;  1OH4 A;  4GH4 C;  1XYN A;  5FMB A;  1MS1 A;  1BK0 A;  1SLB A;  2BWC A;  4H3W A;  5KHG A;  4ZZ5 A;  2XHK A;  2AH2 A;  4AL9 A;  1O59 A;  4NR1 A;  2BJS A;  2C9K A;  3E6B A;  1Y9M A;  2RR1 2;  1WKY A;  4O9G A;  5LK5 A;  2VCM A;  5H9S A;  5F3E A;  4LO4 B;  4LKD A;  1ULC A;  5DAP A;  3CL1 A;  4P5Y A;  1ZRF A;  1UD1 A;  1QH6 A;  1CAX A;  3HMY A;  4NWV A;  2YC0 A;  1CWP A;  3ZYG A;  3SXW A;  2LS6 A;  3AX4 A;  2C26 A;  4MGI E;  2WNE A;  5HXM A;  4BJ0 A;  4CDW B;  1RUJ 1;  1UZY A;  1AR9 3;  1O4Z A;  4UFL A;  1A8D A;  2EAL A;  4NE9 A;  4B3N A;  3VHO A;  4CXW A;  3IWZ A;  3POI A;  5C9A A;  5FWJ A;  2ETE A;  1KQR A;  3VBS B;  4OI0 A;  4XFH A;  2V73 A;  3LEG A;  1LOA A;  4GA9 A;  2ARB A;  4JGY A;  4ERO A;  1K5J A;  1YFU A;  4BLJ A;  5L9R A;  1S0C A;  5JLV A;  2J1E A;  4AFD A;  4P9I A;  5FP3 A;  3LFM A;  1NQJ A;  1W9Y A;  2AR6 A;  4MGZ E;  4BQ3 A;  1FPN 2;  3T0A A;  4NWW A;  2VZT A;  1OFS A;  1CAU B;  5A7O A;  2J7M A;  3LDB A;  3PVB B;  4LUK A;  1D4M 2;  1KS4 A;  1RUE 3;  3D4K A;  4JV4 A;  4QKB A;  3FC0 A;  4E4S A;  2YBS A;  2B9U A;  4YM2 A;  1W03 A;  3OEA A;  3AP6 A;  2DUR A;  1NE6 A;  2JE7 A;  5I8S A;  4FTB A;  2VOX A;  3LSD A;  1SLC A;  1TNR A;  4UYB A;  3OSD A;  1LED A;  2QUO A;  3Q8C A;  1RVF 1;  5DAB A;  3M70 A;  1XNC A;  4EQV A;  4JDN A;  1G7Y A;  1XOY A;  1OMI A;  2WR9 A;  3ZSM A;  4LE3 A;  1XU1 A;  2WZR 1;  1JZ7 A;  5DUV A;  1EYB A;  2H6C A;  4LO7 A;  5LRR A;  4CDU B;  1AYM 1;  4CTE A;  1SLL A;  1W6P B;  1SEF A;  1RIR A;  1HJF A;  1SBE A;  2GN3 A;  1UPI A;  2K0G A;  1TNF A;  4BH9 A;  5FY9 A;  2CWM A;  3DYO A;  1QJF A;  1RIN A;  2W1S A;  2BFU L;  1QH7 A;  4PIZ A;  2PMW B;  2BOI A;  1GZW B;  1SLT A;  2CDO A;  4IEW A;  4RHV 2;  4NHX A;  5I0S A;  4YGD A;  5HPO A;  3NV4 A;  1DZT A;  3C7G A;  2GME A;  3RI8 A;  2ZGK A;  4Q8K A;  3S0M A;  5FYC A;  5FY7 A;  1MZF A;  3ZPO A;  3KVB A;  2FQP A;  1AR6 1;  2ZHL A;  4RQP A;  2VJX A;  2A70 A;  2P6H A;  4QX0 A;  3ZN4 A;  1PZ8 A;  3WF1 A;  2XHN A;  3CDZ B;  5APA A;  4L8Q A;  1X7N A;  5GLV A;  3AXE A;  3VHR A;  4O65 A;  4QPY A;  2RVA A;  5C3S A;  2DU0 A;  2EIG A;  2VH9 A;  4QGM A;  3KGZ A;  5J09 A;  5IVV A;  4PBO A;  2WYS A;  3PDQ A;  4IL7 A;  3RJR A;  1F35 A;  1QKQ A;  5FYV A;  3VBR B;  1ZZC A;  5L36 A;  3OBA A;  2ILM A;  3SIS A;  4IEX A;  1Q8O A;  1RHI 1;  2BVV A;  3MYX A;  2VNO A;  4Q0U A;  2PN5 A;  1E57 A;  3VKO A;  1UW8 A;  1UO9 A;  1ASJ 2;  4BPZ A;  1Q43 A;  2LRP A;  1A6C A;  2DU1 A;  1COV 3;  2V4A A;  2W39 A;  3TRS B;  2W68 A;  2V5Y A;  1FX5 A;  4Y5Z 0;  3ACF A;  1KXG A;  1ZM1 A;  2A3Y A;  1H9W A;  2Y64 A;  4FFI A;  4FPJ A;  1RUN A;  3ZXG A;  3WP3 A;  1ZVF A;  4YPJ A;  4BWO A;  1LHN A;  2BGC A;  2K2S A;  1ZBE 2;  3DUI A;  3NRU A;  4JVA A;  4D7S A;  1EV1 1;  2OYZ A;  5HCA A;  3E1F 1;  4MSV A;  5EJ1 B;  4PDW C;  1WZX A;  1NKG A;  1VBE 2;  3VBO B;  4I01 A;  1JU3 A;  2RM2 3;  2WSV A;  3GJB A;  4Y1Y A;  5GAL A;  4XQD A;  4QPW A;  5FZ7 A;  1FI2 A;  1UX6 A;  4AW7 A;  2VOV A;  3J8F 2;  3VD4 A;  1O8S A;  1OQD A;  4KQ7 A;  1PGW 2;  4Y22 A;  5FYY A;  3RZM A;  3OB8 A;  3AMP A;  5E16 A;  2WSU A;  5CKQ A;  4XAE A;  4KMQ A;  2XJP A;  1KDK A;  1W99 A;  2JDY A;  2VM9 A;  2YBK A;  5CNA A;  1MQT A;  3N36 A;  4OUE A;  5I8Y A;  4XEZ A;  1FPN 1;  1CQ9 A;  3O1S A;  2VQT A;  3BOD A;  1AR8 3;  3PVE A;  1OF4 A;  2P37 A;  4TSV A;  4P9L A;  2R07 3;  2HWE 1;  4UF0 B;  4F83 A;  4BME A;  4UW5 A;  5CYY A;  4K6B A;  3U0Z A;  2FCU A;  4Y20 A;  3EB7 A;  3SKJ E;  3AC0 A;  4CVU A;  5FUI A;  4D0Q A;  1BK1 A;  3DN7 A;  3LAG A;  1UPS A;  4XET A;  1DQ0 A;  1UZZ A;  2XBO 2;  3ZR6 A;  4LLO A;  5DAV A;  5JDB A;  1VBA 2;  1QJY 2;  4MG2 A;  3R6S A;  4QPI C;  3WNN A;  5T3N A;  3HPN A;  4BQ1 A;  1B35 A;  1WLC A;  2Q30 A;  4XDQ A;  3WCR A;  1XSQ A;  2J1S A;  2OPK A;  3T4H B;  2NN8 A;  3HQU A;  1SZB A;  5EJ3 A;  1RUC 1;  3ZSJ A;  5JOW A;  1BEV 3;  2XON A;  2Q5T A;  2WT2 A;  2FD8 A;  1LGC A;  4CP9 A;  2VW1 A;  4CDX B;  1R09 3;  5FZM A;  2HWB 2;  3O0W A;  4D6S A;  3UV9 A;  4YZ1 A;  5C70 A;  1PVX A;  3NWK A;  3VBS C;  4AFM A;  3RZZ A;  3CJI B;  1Y9G A;  3LQC A;  5GZE A;  3SH4 A;  3T1M A;  3FX3 A;  2WNU A;  1DCS A;  1UOJ A;  2RMU 2;  3E97 A;  3NNJ A;  4P02 B;  3ZFF A;  4FPF A;  5M0T A;  2VGD A;  1VJ2 A;  5FJK A;  3ASI A;  2GZW A;  4AGG A;  5JXJ A;  2G9F A;  4B1L A;  2VMF A;  2E63 A;  2TBV A;  1BBT 2;  4AHW A;  2PHL A;  5GZF A;  4Z1V A;  2WUH A;  2W0X A;  4XFA A;  1SDD B;  1ODM A;  4XJ8 A;  3THC A;  3LOI A;  4H7M A;  4AGV A;  2B39 A;  3OEB A;  4LKF A;  2JX9 A;  1S0G A;  2DWR A;  4QB2 A;  5A1F A;  5E1R A;  1IG0 A;  4FPC A;  4MXV A;  5KWR A;  1UU6 A;  3ZFG C;  2VZV A;  2P3Y A;  3AYD A;  1EP0 A;  4M4P A;  2X5I A;  3CF6 E;  1AJK A;  4LT5 A;  2XQR A;  4LBJ A;  3O1V A;  1SMV A;  2JXA A;  2DCJ A;  5IAT A;  1OF3 A;  1POV 1;  4D94 A;  2BBA A;  3VD9 A;  4AVV A;  1CIY A;  2EF6 A;  4QKD A;  1N1Y A;  3MFC A;  4IV1 A;  3UNP A;  3HOB A;  3VDA A;  1TG7 A;  3B00 A;  3AMH A;  2YGL A;  3JZV A;  4ZON A;  3RZK A;  4YRD A;  5KHH A;  4CDU C;  3VKN A;  3SC7 X;  3SCF A;  1GP6 A;  1JHN A;  4IGO A;  3CKH A;  4QGN A;  1PK6 B;  3ZR5 A;  4FFG A;  5LBE A;  5FRE A;  4MH0 E;  1QNW A;  5CIR A;  1V9U 2;  1RJ8 A;  2ARC A;  2PHF A;  1WMX A;  5FMO L;  3WF4 A;  1P8J A;  2R30 A;  3OGR A;  1ZZ6 A;  4FPE A;  3T30 A;  5J48 A;  1XNA A;  3I2J A;  4JGZ C;  2YU1 A;  4XF4 A;  1JZ4 A;  2ZKL A;  1LR5 A;  1ULE A;  4JHT A;  3LCP A;  3MFA A;  5FIX A;  1HV0 A;  1VIW B;  3CO2 A;  3FLR A;  4UAP A;  4XMI A;  1WWY A;  4NIH A;  1US3 A;  4WZC A;  2XDV A;  3KWV A;  3Q8B A;  1NCQ C;  2A71 A;  1JBC A;  1UZV A;  3MIB A;  4K1Z A;  1PIV 1;  4ET7 A;  3J8F 1;  2B7Y A;  3I2G A;  5FPL A;  4YVS A;  4CU8 A;  4DB5 A;  5F3C A;  3AKS A;  5LEK A;  3PVN A;  2ET7 A;  1CN1 A;  1HRI 3;  4PQ9 A;  1LAJ A;  1QJU 3;  5JIA A;  3KQ4 B;  2X05 A;  2VC9 A;  4WM8 B;  2VUL A;  4AK3 A;  1SQ4 A;  2HWC 3;  4COW A;  1CAV A;  2ADD A;  1NCR C;  3PME A;  1FV2 A;  1ZA4 A;  1GKB A;  4NVP A;  4XUO A;  1RUD 1;  4ZZ8 A;  4XDP A;  1RUF 2;  5EHD A;  3IIA A;  4QKN A;  3AYA A;  5FYM A;  4YWA A;  3RG0 A;  1VAK A;  1G9D A;  1WBF A;  4Q4W 1;  4FOW A;  4AI1 A;  1Q5O A;  1CPN A;  5FBJ A;  1QOS A;  3G7D A;  3TNP B;  1L7R A;  5DQ0 A;  2JEM A;  2PHX A;  1NA1 C;  2QJV A;  4IV3 C;  4FFF A;  3W9A A;  5FZL A;  4NHM A;  3N4M A;  1XND A;  3PUS A;  3TOJ A;  4CU9 A;  1SLI A;  2WNV B;  1CR7 A;  4GB3 3;  1GOH A;  1MS0 A;  4KBB A;  3VBO C;  3ETP A;  4Q5O A;  2JDZ A;  4YG0 A;  3UT0 A;  2NZ9 A;  2W87 A;  4F7Z A;  5DDJ 2;  2Y60 A;  1YIP A;  3ZN6 B;  3ZYH A;  1AL0 G;  1YLL A;  1H2L A;  2ZEY A;  1RUI 2;  5AFE A;  1MVQ A;  3ZO0 B;  4BQX A;  4DUX A;  3RVH A;  4K8F A;  5D1I A;  1PGS A;  5L73 A;  1UXZ A;  4E4H A;  4FI9 A;  1HN1 A;  1N1S A;  4Q4V 2;  4Z82 A;  2O14 A;  2YU2 A;  2W94 A;  2WS9 2;  2YYO A;  2ZHK A;  4OZO A;  4M01 A;  4A7Z A;  1H1I A;  1MS3 A;  4XXP A;  5FLJ A;  5LK7 B;  4AHX A;  5JZG C;  4OUL A;  1OUR A;  4DXR A;  2FDJ A;  1YHF A;  2GNB A;  1LOF A;  3O7O A;  3FHI B;  4QX7 A;  3VD7 A;  1H1A A;  1OQE A;  4LBQ B;  3EJK A;  3ITQ A;  3TAY A;  1PZ9 A;  3AK0 A;  4I3G A;  5C3P A;  2ZHM A;  3ABZ A;  3E5Q A;  3FUQ A;  5A3P A;  2Q1M A;  4FP3 A;  4YW3 A;  1J83 A;  4BXF A;  3NO8 A;  3KZ4 C;  1M06 G;  3JD7 3;  3GHM A;  4QX8 A;  3O1T A;  1VBC 3;  1XPW A;  3T0B A;  2LUW A;  2ZZJ A;  2ZA9 A;  1QWR A;  2WIN B;  1R1A 1;  4FO9 A;  4XUT A;  1XB9 A;  1R08 3;  4CCJ A;  5K7P A;  1FMD 1;  1XRU A;  4CPB D;  3UJQ A;  3TN9 3;  1NY7 2;  1C8M 1;  1GWL A;  5CFD B;  1LES A;  3P3N A;  5FDB A;  2WFF 1;  4WV8 A;  4PIX A;  1V9U 1;  1MZE A;  2FDK A;  4BQ5 A;  1EAH 1;  1Y9Q A;  4XIK A;  2R1D A;  4PJY A;  2ZX4 A;  4QX5 A;  1YFW A;  1QQP 3;  4XFG A;  1HKD A;  1UL9 A;  1ZZB A;  1BQP A;  3III A;  4IET A;  4IUG A;  1OC1 A;  4PBP A;  4W6Y A;  5JSP A;  3MV0 1;  4UOJ A;  1UYP A;  3Q9O A;  2J1T A;  4HT1 T;  1AR9 2;  1ZZ7 A;  3SH3 A;  3GDB A;  2VMC A;  4LE4 A;  1YUD A;  1W8H A;  1YQ2 A;  1DHK B;  2CDP A;  3NNG A;  1WA4 A;  1QDC A;  3AP4 A;  2OW4 A;  3KCY A;  4RR3 B;  1XQN A;  2XGX A;  5LY2 A;  4NID A;  3MIH A;  1LHO A;  1WLT A;  1YIF A;  1W6M B;  3USU B;  2WLQ A;  3ECQ A;  1W6P A;  1S0D A;  1AYN 1;  1KD7 A;  4YG6 A;  3KF5 A;  2UU8 A;  3RWK X;  2B8M A;  5DN2 A;  1GZW A;  3OYW B;  3NNL A;  4NJ4 A;  1I9R A;  3PUA A;  1OD5 A;  1PZ7 A;  5C4W B;  1HW5 A;  1TQ5 A;  2EA7 A;  1OLM E;  3B9C A;  3PLQ A;  3GXU A;  4RSU A;  5A1L A;  2WKK A;  1H6X A;  4AYU A;  2WQ8 A;  5FLH A;  2NYY A;  2BVB A;  3KGL A;  4OI4 A;  4XPV A;  5ACA 1;  1PHM A;  5B4X A;  1OA4 A;  1W3X A;  4ATE A;  4F8A A;  3LF7 A;  2VCA A;  1XU2 A;  2CGO A;  2TEP A;  4L9B A;  1BCX A;  4RL7 A;  5SV8 A;  1AZD A;  3AZV A;  2D3P A;  2PQS A;  4OQ9 A;  3CZU A;  3ROU A;  2D43 A;  4GMP 3;  3ZM8 A;  4CU7 A;  5JXH A;  2W92 A;  2Y8K A;  3PL0 A;  5ABJ B;  4N90 A;  1BMV 1;  2QZ2 A;  3R4U A;  1JUH A;  4FT8 A;  2YPD A;  5ISL A;  5DDJ 1;  3VKL A;  3OG2 A;  1W8O A;  1X8E A;  4NHK A;  4E2S A;  4Q29 A;  3JB8 A;  3G6J B;  4ZU4 A;  1E5R A;  1FNY A;  3WF2 A;  3N7M A;  4NIA A;  3VBH B;  3WNK A;  2EAA A;  4IEP A;  4R4X A;  4CDQ C;  3VZN A;  1O3R A;  4Q4V 1;  1VB2 A;  1H8V A;  3M3C A;  1IS4 A;  2ZEZ A;  4B8E A;  2A6Y A;  1BVV A;  3P5B A;  1ND3 B;  4XE9 A;  2AEZ A;  1S0J A;  4OFG A;  2D5H A;  3U10 A;  3GZE A;  4PCR A;  5FBZ A;  4HZF A;  4UFM A;  5A33 B;  1JYC A;  5K4L A;  3X29 B;  5L7O A;  3IAP A;  4N43 B;  4MAD A;  3UJO A;  4MLO A;  2DUP A;  3OJB A;  1UU4 A;  3HNY M;  2O0O A;  3ZFE B;  4CP1 A;  5C8C B;  1VAL A;  1OUX A;  1QY4 A;  2ZGO A;  5KBF A;  4H7L A;  2VVD A;  2MHF A;  1COV 2;  5FP9 A;  4GH4 B;  1ZBA 3;  2E7A A;  1NZI A;  1PO1 1;  1RC6 A;  2ZAA A;  3W59 A;  4FTS A;  2YZ4 A;  4ZPI A;  5FZG A;  4UF0 A;  3OY8 B;  3KT4 A;  3NMB A;  3H3Z A;  3BU0 A;  1KIT A;  5LBB A;  4OYU A;  2VOW A;  3OGV A;  3WX5 A;  4YZ4 A;  5AC9 3;  5IT6 A;  1OI6 A;  2OPW A;  1S55 A;  2PHR A;  4MET A;  2DVF A;  3DEM A;  3O5S A;  4N53 C;  5HV0 A;  1VLN A;  3A0N A;  1LOC A;  1YI7 A;  2W1W A;  5K0U C;  1VAM A;  2HKX A;  1OHF A;  3M8L A;  2E31 A;  3IB3 A;  2DFB A;  3WDV A;  4YW1 A;  5FY0 A;  2W47 A;  2XH6 A;  1PO2 3;  2AUY A;  4XW3 A;  1W8N A;  5B2G B;  1NX9 A;  4RGK A;  1LB2 A;  1OOP A;  1OXC A;  3MGU A;  3VBF A;  1W9T A;  3NL1 A;  5IVB A;  1HV1 A;  3V0A B;  1ULD A;  2FDG A;  1C8N A;  4KU8 A;  3NKG A;  1AR8 2;  2RE9 A;  3ZIX A;  1ENQ A;  1VRH 1;  1O8P A;  2UWC A;  2R07 2;  3BPS A;  4ZKT B;  3BCW A;  2XL7 A;  1FXZ A;  5FAX A;  3SCH A;  1UZ0 A;  5KC5 A;  1VBB 3;  2WA3 A;  3RS6 A;  4Q27 A;  1OVP A;  4NPL A;  3ZDV A;  4CCD A;  1T2X A;  1JOP A;  2WFP A;  1QJX 1;  1F5J A;  2JWP A;  1S0F A;  2QKD A;  4S2F A;  4I2O A;  4D7Y A;  1BEV 2;  1DLL A;  1RUH 3;  4O7X A;  4YSF A;  3WF0 A;  4NN0 A;  2XQX A;  2IFR A;  4ITC A;  4JAA A;  4OI2 A;  4URA A;  5JWP A;  1OPM A;  4A45 A;  1DGR N;  4LKE A;  3ZXE A;  1QIQ A;  3ZDS A;  1BLZ A;  2VXR A;  4OQ8 A;  5IVC A;  1W05 A;  4YVW A;  4CEY B;  1RUG 3;  5DAQ A;  5BNN A;  3TEY A;  3ENR A;  4AAX A;  4GZ9 A;  3WW4 A;  3UYJ A;  3V0B A;  1K5M A;  1W04 A;  2P34 A;  4UW6 A;  4Z92 B;  1DYP A;  5FK8 A;  3T2T A;  1SPP B;  1W3V A;  3H42 B;  1V6O A;  2VAU A;  3IDE A;  1D4V B;  5IJR A;  4LTA A;  4FPH A;  3BGA A;  5C3Q A;  1U5I A;  3A21 A;  3KM5 A;  1C1L A;  4GWN A;  4XUP A;  2Z5W A;  1PGL 2;  2Y26 A;  4FPY A;  4HPK A;  3H50 A;  3JBG 3;  1Q8S A;  1MAC A;  4BOW A;  3LOB A;  3H1Y A;  2YC2 A;  2VTX A;  4B7E A;  2QQW A;  4TWT A;  3KS7 A;  2W95 A;  4AED C;  4ES9 A;  3U11 A;  5JIU A;  3VZO A;  2GND A;  3KB5 A;  1H8T C;  2VE1 A;  3U07 A;  2LW8 A;  4XQ4 A;  4XOG A;  4MXW B;  1O7F A;  5A6Z A;  5FUP A;  1YI9 A;  4HVO A;  5D2A A;  4WM8 A;  2I07 B;  1FOD 1;  2ZX3 A;  4V2V A;  5C5U A;  5JSO A;  4P9W A;  3LEK A;  1VB4 A;  2Y6H A;  5LBF A;  4M3C A;  5F7U A;  3WUD A;  2XOM A;  1SLA A;  4IER A;  1Q56 A;  1MVE A;  1GZC A;  1PVC 3;  1ULP A;  3MO4 A;  2HWF 3;  3BAL A;  3HWJ A;  1L3J A;  1HDK A;  3B01 A;  3M2M A;  4KH9 A;  2C1F A;  5D8A C;  5EXO A;  3ZMO A;  3V65 A;  5CZK A;  3MI8 A;  5FKC A;  4XJ9 A;  4E4D X;  2JDN A;  5FZE A;  1ND3 C;  3RNS A;  5HI0 A;  4M3C F;  2Z69 A;  1GOF A;  4FAG A;  3FZ3 A;  3L9J T;  1LOG A;  5AVP A;  5J96 B;  4PDW B;  5IVJ A;  3UET A;  3VUO A;  2WNV A;  2DCT A;  5FP4 A;  3T2Q A;  3NAP A;  2HWD 1;  3WEZ A;  2RDQ A;  1GAN A;  1Z7S 1;  2PA7 A;  3IPV B;  3LKJ A;  1HXS 1;  4Q2F A;  4XFC A;  4JRL A;  1HRI 2;  2BNM A;  4FOQ A;  5JPM B;  5CVR A;  1E5S A;  4BMB A;  3QBQ A;  2HWC 2;  3H7Y A;  1JOD A;  5T5L A;  4B4P A;  3GZU C;  2D6O X;  1GNH A;  2RS3 1;  2YC4 A;  1PX3 A;  4WZF A;  5F5Q A;  4BXS V;  4LOT A;  3VZJ A;  3ZXF A;  2DUO A;  4FPK A;  1SCR A;  1ZNP A;  4LIT A;  5A32 A;  2BGP A;  2YBP A;  2UY9 A;  3HIF A;  1C5H A;  4DRV A;  5IK5 A;  2A3X A;  4AZZ A;  1ZZ8 A;  4D6Q A;  1DZQ A;  1OH3 A;  2QDN A;  2RS5 1;  2YB7 A;  1SFN A;  2W52 A;  4I02 A;  4QPI B;  4Y1V A;  3UKN A;  2R7E B;  2BWA A;  4Q4X 3;  3J7M A;  3PIG A;  2CTV A;  2WT0 A;  2LM3 A;  2XUM A;  4EN7 B;  2OT7 A;  2FCT A;  3PUI A;  5DUW A;  3AYC A;  1W39 A;  3C7O A;  3O12 A;  1GNZ A;  2RS1 3;  5EZW A;  2VO5 A;  4CCN A;  2EXH A;  1FAY A;  3S5Q A;  4QB6 A;  4AOC A;  4J6G A;  2QQI A;  3U75 A;  4FQZ A;  1WCD J;  1TMF 3;  2PHW A;  2YV8 A;  4XVH A;  3KV4 A;  4NRM A;  2LTN A;  4BM8 A;  2CL2 A;  4PLN A;  1MQT C;  1IKQ A;  4A41 A;  5FO9 B;  3SCG A;  1LNS A;  5EYY A;  2BBV A;  1SBD A;  1SBF A;  2ZXQ A;  5FXV A;  5JOY A;  1JZ5 A;  3GF6 A;  4L97 A;  5IAV A;  4QXB A;  4LNV A;  3VBU B;  5F3G A;  3DYM A;  2VUA A;  4XHB A;  1FYU A;  2JB4 A;  4GWJ A;  3AKQ A;  2OVU A;  5GZC A;  2HEV F;  4KWL A;  3RRD A;  2ZKN A;  3ZFG B;  3GBW A;  5KHI A;  3BN6 A;  3IDA A;  3JU9 A;  2IWG B;  3A7Q A;  3JD7 2;  3GZA A;  2JKB A;  3LDR A;  1VBC 2;  2EVX A;  5FXZ A;  4ARY A;  3ZPY A;  2YPJ A;  2Y34 A;  1W6M A;  2C4X A;  2W3J A;  3USU A;  1K45 A;  4OI1 A;  3RPQ A;  5EJZ B;  4FSJ A;  1QNY A;  1R08 2;  4LEJ A;  3DL3 A;  3WF3 A;  1TME 1;  5F39 A;  3VD5 A;  3TN9 2;  3ZKY A;  2TUN A;  3I49 A;  2AYH A;  1V6L A;  3DXU A;  4HG6 B;  5H9R A;  4UT5 A;  1OQ1 A;  2F4L A;  3BTA A;  2WBK A;  3OYW A;  4OHX A;  3N9M A;  5HXV A;  5FK7 A;  2WZP P;  4CEY C;  4YW6 A;  1OLR A;  1WD4 A;  4E2G A;  3ZYJ B;  1N47 A;  2J1V A;  3VDD C;  3ZFF C;  4CSW A;  5BNO A;  4Y5S A;  4PLO A;  1QQP 2;  4MHR A;  4CCL A;  1V6J A;  5FFO C;  1AR7 1;  1O91 A;  4HAN A;  4HSL A;  1GP4 A;  3KT1 A;  4NO4 A;  4JGZ B;  4N7U A;  3GNE A;  1RIT A;  1PM4 A;  2D6M A;  3IT8 A;  3N9N A;  4YFW A;  3C8X A;  1JZ6 A;  1W06 A;  2ZGQ A;  5BNP C;  2Z4F A;  1MEC 3;  1ACC A;  4LBO A;  1GSL A;  4MVT A;  3BPZ A;  1OSG A;  4U2A A;  4CYD A;  1YC6 1;  4IGP A;  5FV3 A;  2O8O A;  2X5I C;  2ERF A;  1NAE A;  2KXL A;  5ABJ A;  2P4E A;  4M00 A;  1NCQ B;  2XLG A;  4R9C A;  5CU1 A;  4EN6 B;  1H30 A;  1IPJ A;  5FTT C;  1TZO A;  2VMI A;  3I59 A;  2B9V A;  2ZX2 A;  2QQK A;  2VZS A;  1EY2 A;  3AMN A;  2KA3 A;  1AL2 2;  2XJQ A;  3E5U A;  1POQ A;  2UYB A;  1W8F A;  2EIC A;  4Y5T A;  1YXW A;  3F95 A;  3CQO A;  1BZW A;  2BP6 A;  4QM9 A;  4RYD A;  3RYP A;  4LBN A;  3UL2 A;  4WVM B;  5FQ0 B;  5IWF A;  3BIW E;  2PLV 1;  1NXM A;  4ZU5 A;  4ASK A;  1K42 A;  4P00 B;  1UMI A;  4UFJ A;  2E9Q A;  3GAL A;  3I3Q A;  2X10 A;  3POE A;  5JOX A;  4OHZ A;  5CAZ A;  1NCR B;  1RL3 A;  5F9T A;  1W2N A;  4RFR B;  5JI7 A;  5J36 A;  4OVE A;  4QPG B;  4CEW A;  4DO0 A;  5LA1 A;  2MEV 3;  4XC9 A;  5FZK A;  4QHB A;  4F3J A;  2OUH A;  2Y6J A;  2RR1 1;  1RXG A;  4YW5 A;  4I0B A;  5A33 A;  5J3U A;  3VDB A;  2YY1 A;  2VCC A;  4PHZ A;  5KXB A;  1JYX A;  4P5H A;  5GZG A;  4X8P A;  4IV3 B;  1NA1 B;  1JZ8 A;  2GNM A;  4I30 A;  4FOV A;  3FFQ A;  3WNO A;  3T4V A;  4DXS A;  5GJ6 A;  2VZQ A;  1LU1 A;  3AKT A;  1S2K A;  2DBI A;  2ES3 A;  3LFI A;  1JUI A;  1PMI A;  3CHX A;  1PNF A;  4NHL A;  2IUW A;  4YVS C;  4KBZ A;  3FFZ A;  4X6Q B;  4S2G A;  1D7P M;  2RJ2 A;  4JRA A;  4WVW A;  4MZU A;  4MGY E;  5A6Q A;  1CON A;  4JHZ A;  4UW3 A;  2R6Q A;  4HOO A;  3BIE A;  3GZT B;  1RJ7 A;  4ASM B;  4D3W A;  2XML A;  2X09 A;  4W4Z A;  1H2N A;  2VQA A;  4K7J A;  2R06 3;  1OPO A;  1W6O B;  5JZG B;  4G9S B;  1D4M 1;  2R04 3;  2WO7 A;  4LOR A;  3N7K A;  3WP6 A;  3LIH A;  1T6B X;  5JR2 A;  2Y0O A;  3AKP A;  4GIQ A;  1AXY A;  2DCK A;  1K3I A;  4QDQ A;  3MDP A;  1W90 A;  2ZGR A;  2PQQ A;  3MHZ A;  3WD5 A;  3FLT A;  3RWN A;  4E2Q A;  4CXX A;  3FL7 A;  4Y1X A;  4YW7 A;  2HJI A;  4A42 A;  2VL4 A;  4XQW A;  5A3O A;  3VLB B;  4LO5 B;  3H8O A;  4FPL A;  4Q4Y 3;  4ASL A;  4BE3 A;  4I0W B;  4LHS A;  1UMZ A;  5KHJ A;  3O1M A;  1W2O A;  1YNA A;  3S30 A;  3ZYI B;  3TEZ A;  2BZD A;  3PTR B;  3OBR A;  5G05 L;  1HX6 A;  3I8T A;  2E7Q A;  1UKR A;  2VD7 A;  3NKT A;  3C7H A;  3OBT A;  4QMA A;  4ZU7 A;  3HEI A;  4YAR A;  2BUK A;  1C5I A;  1PMH X;  4LIU A;  4RS5 A;  4RHV 1;  2X53 S;  2ARE A;  2VEC A;  4MGT A;  5I0U A;  3POG A;  4Q0S A;  5F6K A;  1MS5 A;  2A5Z A;  3ZSK A;  2XG3 A;  1UYX A;  2HBU A;  3VBU C;  2A6V A;  3A0K A;  2CAV A;  2DFC A;  4A3X A;  2XB6 C;  3H0O A;  4BCU A;  2KD7 A;  1RUJ 3;  4HL0 A;  1SAC A;  2BNO A;  1PO2 2;  5GLW A;  1Q8Q A;  1Z78 A;  5ANN A;  4CA9 A;  3N3H A;  2MNG A;  1F2N A;  2ZS6 B;  4QX3 A;  1IPK A;  2ZGL A;  4NRO A;  4L2N A;  1ST8 A;  1W0P A;  1W6Q B;  3KF3 A;  1AL2 1;  1S4C A;  1WGP A;  3HQR A;  3H9A A;  3MV1 1;  4XTP A;  1YJK A;  3WG1 A;  2E53 A;  5DUX A;  3FUO A;  2UY8 A;  5F5C A;  1SPP A;  5FP8 A;  2DCZ A;  3WNP A;  5A3U A;  4NIG A;  2YHJ A;  2P5B A;  4AR2 A;  3K2O A;  4OHV A;  4EV0 A;  4C1X A;  1DQ2 A;  1OUS A;  1ASJ 1;  1VBB 2;  4XBL A;  2Q8D A;  2UWA A;  1WME A;  3AKR A;  1BHG A;  3IBM A;  5FXW A;  4DEQ A;  2Y38 A;  3W58 A;  2VW2 A;  3I7D A;  2K9Z A;  1RUH 2;  2VNV A;  1UOB A;  3AFG A;  4L99 A;  2GN7 A;  3HAG A;  5T5P A;  4PF5 A;  4KI5 M;  4Y33 A;  1BJQ A;  1ZBE 1;  1RVF 3;  2VW0 A;  4A6S A;  1JXN A;  3ZYB A;  4BU2 A;  4DXT A;  1VBE 1;  2QQV A;  2G19 A;  3B9I A;  1HRV 2;  1XNB A;  2WZR 3;  3EYP A;  2D97 A;  1G9C A;  3NV3 A;  4G4F A;  5JAX A;  4IEO A;  5CA6 A;  1AYM 3;  5FPB A;  4ONU A;  3B93 A;  4JX0 A;  4WM7 A;  1JHJ A;  5LA2 A;  1O6U A;  2ADE A;  1PGW 1;  2XWJ B;  2Y6G A;  3BYW A;  3GBF A;  5A6Y A;  1G9A A;  5BNQ A;  1QF3 A;  3AVR A;  1T6G C;  2I2S A;  4CDQ B;  2EXI A;  2VBP A;  4BK4 A;  4COZ A;  1O3Q A;  2VVE A;  4XHX A;  5FY1 A;  3M3Q A;  1IS5 A;  4PI2 A;  3O1R A;  3JBG 2;  2VNG A;  5LB6 A;  4QPG C;  1Q8P A;  2D6L X;  3N9L A;  4IEU A;  4CUB A;  3UKT A;  2IFW A;  2ZZQ A;  2NM1 A;  1AR6 3;  1D0H A;  3D8C A;  4CUC A;  2XBO 1;  1VBA 1;  1QJY 1;  2VTX J;  4QHO A;  4RA0 A;  3IPV A;  1JMU B;  3U14 A;  4UW4 A;  2GSY A;  3USS A;  4DMI A;  4R9B A;  3CEW A;  2PAE A;  2BNN A;  5CFC B;  2O1Q A;  3Q8F A;  5GM0 A;  4DIN B;  1R64 A;  3LB9 A;  3KT7 A;  1F5F A;  1MR5 A;  3AYE A;  4OMC A;  3RGB A;  2ZEX A;  1V6N A;  3MLK A;  2N7G A;  1RHI 3;  2L9L A;  2HWB 1;  2R16 A;  3H1M A;  3HR9 A;  4DQA A;  1IG3 A;  1H4G A;  4DFS A;  1PVC 2;  5T50 A;  1G9F A;  4BQY A;  1F9K A;  5L19 A;  4GWM A;  3B3Q E;  2HWF 2;  3IN9 A;  3ZXL A;  4BYY A;  1LJ7 A;  2RMU 1;  5FUN A;  3RSJ A;  2VUJ A;  4OZX A;  4K21 A;  1BKZ A;  4H14 A;  4MHU A;  1NLQ A;  3DPR C;  3ZIW A;  1UQX A;  4CCM A;  3THP A;  3B02 A;  3OGJ A;  3OGG A;  4GMP 0;  3KCC A;  2JDH A;  4K1Y A;  4DXZ A;  3H8R A;  5C71 A;  4R9D A;  4QPI A;  5JI9 A;  3I3M A;  2YMZ A;  1J3Q A;  1BBT 1;  3MBW A;  3PHM A;  4N53 B;  5E8A A;  4LIV A;  3U1X A;  1EV1 3;  3RFR A;  4CDW A;  5K0U B;  5DXD A;  5FZC A;  5EIY B;  1W9W A;  1GU3 A;  1RMU 3;  4JZR A;  2Y0I A;  5LAT A;  4B1M A;  2RDS A;  3ORJ A;  2OS2 A;  3NNF A;  3VBS A;  4GKY A;  3KSC A;  5FZ0 A;  3S6P A;  2GP5 A;  3FBY A;  5HCB A;  3AMM A;  3J9S A;  4Z8B A;  1V70 A;  3BVC A;  1N3P A;  1UY4 A;  1J3R A;  4BQ2 A;  4LOS A;  4A7Y A;  2Q8E A;  1FPN 3;  4TLF A;  3DEC A;  4XJU A;  1CAU A;  1UYZ A;  2Q1F A;  2VZO A;  2WRA A;  5ANQ A;  2WQZ C;  3P6B A;  3N7L A;  4BIF A;  2CHH A;  3I2O A;  2HWE 3;  1MS4 A;  2IXH A;  2ZGT A;  3NJV A;  1SCS A;  4Q4X 2;  3ZFG A;  5JPN B;  4PLM A;  1GZ9 A;  2DF7 A;  3ZYR A;  1XC6 A;  5FZO B;  2XJV A;  4C91 A;  2EXK A;  1CX4 A;  2B4K A;  3OD4 A;  4MUV A;  4C1W A;  4XZP A;  5JSR A;  2RS1 2;  2RJK A;  3MIF A;  3OUH A;  3TYJ A;  4IES A;  1RUC 3;  4L11 A;  1XYO A;  2W1Q A;  2DDU A;  2CAU A;  3MEP A;  3NST A;  1HRV 1;  5JMO A;  2ZGP A;  1LEC A;  2G4I A;  1XNK A;  1U0A A;  3LGR A;  1LHV A;  2EIB A;  1TMF 2;  3POY A;  4O9E A;  2AEN A;  4CDU A;  5C33 A;  1DGR A;  3SQO A;  1OOP C;  1EUT A;  3I3B A;  3NJZ A;  3VBF C;  4O61 A;  1LTE A;  1RED A;  5FLI A;  3OOX A;  4FQ4 A;  4OMD A;  2GH8 A;  3MW4 A;  1BYH A;  2RV9 A;  3NW4 A;  4YG3 A;  1RUE 2;  3I2H A;  2ZOE B;  4UBH A;  4FVV A;  3VHN A;  3CJX A;  1QGL A;  1S0E A;  2XKO A;  2TNF A;  3LA2 A;  1D0G A;  2V09 A;  4J25 A;  5LAS A;  1RUF 1;  3RZJ A;  5IYY A;  3ILR A;  3WT3 A;  2P1B A;  2JG8 C;  1NCQ A;  3SH5 A;  4AEJ A;  2VZ1 A;  5GLU A;  2OQ6 A;  3POS A;  3CBN A;  2KM2 A;  4AED B;  5GLZ A;  4CCC A;  5L9V A;  3H8X A;  2V5D A;  4LMF A;  1POV 3;  1V00 A;  1H8T B;  3AB0 A;  4A2U A;  5FPV A;  4DIQ A;  5A7S A;  3OD0 A;  1KFU L;  2ID4 A;  4YVW C;  4CP0 A;  3VBR A;  4WVM A;  3T3Y A;  4A4A A;  4CUA A;  5BNN C;  5FQ0 A;  2MPF A;  3EBR A;  2ORZ A;  1K5M C;  4FBF A;  1SDW A;  3WG4 A;  1QU0 A;  1YJL A;  1NYW A;  4YGE A;  2WLP A;  1HB4 A;  1RUI 1;  5LEJ A;  5FZI A;  1DP0 A;  3LD8 A;  4TLG A;  4UXA A;  4BDV B;  5TSW A;  3TBD A;  1RTV A;  2C5D A;  2CY6 A;  3FJS A;  1ND2 C;  2WN2 A;  5D8A B;  3KMH A;  3VDC A;  1BXH A;  1MEC 2;  1UZW A;  2IVI B;  1LGB A;  1LOD A;  1MZ5 A;  2D40 A;  2WS9 1;  2CU5 A;  4C90 A;  4NAM A;  2CNA A;  1NA1 A;  4YGB A;  3KVA A;  1G9B A;  2JEN A;  3LEM A;  1DDL A;  3K48 A;  4S2H A;  4XMA A;  3WDX A;  2FHR A;  5JVV A;  4GD4 A;  3OPT A;  3ACL A;  4V2W A;  2SBA A;  4FPG A;  2IVJ A;  2XLA A;  3VBO A;  3FBM A;  1YCI A;  1ZYB A;  4QKF A;  1PM7 A;  2IZW A;  2RDR A;  3T2O A;  3GGL A;  2XLF A;  4XBQ A;  1PIV 3;  4Y4Y A;  2F17 A;  3QH7 A;  3J8F 3;  1W0O A;  5DG1 A;  2DUQ A;  3BI3 A;  1WW7 A;  4YGC A;  5CFC C;  1S1A A;  3EXU A;  2IXL A;  4R9A A;  3AZW A;  2KR2 A;  3O1P A;  4FTE A;  1NE4 A;  4CE8 A;  3KQR A;  4XF3 A;  1FT9 A;  1US2 A;  1W0N A;  4CUG A;  1GNY A;  1UOG A;  2R32 A;  3F2Z A;  2QZ3 A;  2Y6K A;  4AEK A;  1NY7 1;  2MEV 2;  3PUQ A;  4GQ7 A;  1W6O A;  3MPB A;  5JZG A;  5GLT A;  5B4N A;  4PI0 A;  2UUR A;  1RUD 3;  4YZ3 A;  4OUM A;  3OF1 A;  4Q4X 1;  1DQ5 A;  4KGG A;  5DUU A;  1ONA A;  1ZX5 A;  4Q4W 3;  3IDC B;  4Y3O A;  5F3I A;  4XF1 A;  2ARA A;  2JG9 C;  3GM8 A;  3LA7 A;  4DZG A;  3LE0 A;  1VBD 3;  4Y1Z A;  3HQX A;  3WP4 A;  2QBX A;  1GBG A;  4XUQ A;  2O8Q A;  2RHP A;  5IFP A;  1NG0 A;  4AI9 A;  1AR9 1;  4AXO A;  5LA0 A;  5FYI A;  2RM2 2;  5CKM A;  4CP2 A;  2J22 A;  3I2K A;  2FDH A;  2OX0 A;  2YFZ A;  2I45 A;  3THT A;  4XUR A;  3T09 A;  5IVY A;  2FZ2 A;  2IXJ A;  1BVP 1;  3EHK A;  3IMM A;  3J7H A;  2WWU A;  1KS5 A;  2ZGM A;  3N35 A;  1N3O A;  3VZK A;  2BRT A;  4CDX A;  5J1X A;  5JXI A;  3KHC A;  4BHP A;  2CYF A;  3CJI A;  3E6D A;  4HLT A;  4XXA A;  4Z2W A;  1UKG A;  5DPN A;  1MQT B;  3LIG A;  2GC0 A;  4AFC A;  5I93 A;  4K20 A;  1R1Z A;  3K51 A;  2R06 2;  2D3S A;  2CGN A;  2BV4 A;  4AQT A;  1RUE 1;  2R04 2;  1W9F A;  4LPL A;  4OHY A;  4I0A A;  4Y20 B;  1JI6 A;  1CVN A;  2WJS A;  4E9K A;  1VRB A;  3TEW A;  3E6C C;  3B94 A;  1YO8 A;  5GZD A;  2GNT A;  4B4R A;  5FPZ A;  3R4S A;  4KGQ A;  4D6R A;  3MF6 A;  2AGS A;  1ULO A;  4ISQ A;  4AVS A;  2G9G A;  2NPI A;  3VV1 A;  5T52 A;  5C6C A;  1WMD A;  3WDT A;  4BQW A;  1DGW X;  4Q4Y 2;  1IQA A;  4S2D A;  1W6Q A;  2GMM A;  3K4A A;  2HLE A;  3PVO A;  4COU A;  1R09 2;  3FWE A;  2JDK A;  1ZRE A;  1C3H A;  5C9A C;  3MIE A;  4AFB A;  1R1A 3;  4QX2 A;  4R4Z A;  1FMD 3;  1WCK A;  1GLH A;  4JGY C;  1QXJ A;  2JDA A;  4KWJ A;  1C8M 3;  2GDF A;  3VDD B;  1GWM A;  1PK6 A;  4N9H A;  3ZFF B;  4W8J A;  4KWK A;  2WWS A;  4IXL A;  2ORX A;  2WFF 3;  3LPF A;  5I91 A;  1V9U 3;  4Q0Q A;  1UYY A;  1EAH 3;  2GC1 A;  4AI0 A;  3QH6 A;  5HCF A;  1IHM A;  2H0V A;  5I0R A;  4QGL A;  4UWD A;  1W8U A;  5LA9 A;  2VUD A;  4YZ5 A;  4IEZ A;  2WAB A;  3OPW A;  2ARX A;  3T1L A;  4AVT A;  5BNP B;  5C7G A;  3TWI A;  1RUJ 2;  4Q1P A;  4LK6 A;  4W50 A;  2X5I B;  2UWB A;  4KNC A;  4N8M A;  4BIS A;  1GZT A;  5LW9 A;  1QJE A;  3A4U A;  3M3I A;  5F32 A;  2DBN A;  2JDP A;  2XJU A;  5FPA A;  1VE0 A;  4DUV A;  4KG0 A;  4LBM A;  4DNY A;  2PHD A;  4CCK A;  1JTZ X;  1J1T A;  1F4A A;  2XVL A;  4LO6 B;  3A23 A;  4NOT A;  3WW2 A;  1FNZ A;  1GIC A;  4IV1 B;  1A34 A;  3CLP A;  2JB8 A;  1YQ6 A;  3WR0 A;  1AYN 3;  1CZV A;  3R0R A;  2PXJ A;  2QFE A;  1XYP A;  1QOT A;  2R1B A;  2XJS A;  4DS0 A;  5FPX A;  3RZL A;  1TVG A;  4ISR A;  1COV 1;  1XE0 A;  1ZA7 A;  1ODN A;  4CRQ A;  1ENX A;  1WW6 A;  5DMY A;  1JYV A;  3WQ0 A;  5FMC A;  2VOT A;  3B69 A;  4LO8 A;  4NAO A;  1HN0 A;  1N1V A;  5ACA 3;  4BZ4 A;  3CNA A;  1RVF 2;  3NNM A;  2DVD A;  1VR3 A;  3PU3 A;  1GUI A;  4R52 A;  4V1P A;  1WBL A;  3D0J A;  5CB7 A;  2VMD A;  2VZU A;  4HVR A;  4RQP C;  5E6H A;  5K9Y A;  3CZJ A;  2RM2 1;  1LU2 A;  5CAD A;  2A75 A;  5F2S A;  4I09 A;  3ST7 A;  3MW2 A;  1LUL A;  5A6X A;  2P6C A;  5FZ4 A;  1UU5 A;  2A6X A;  3MIG A;  1ENR A;  4YVS B;  2WL1 A;  5FYH A;  2HBT A;  1UY2 A;  3ATG A;  5DDJ 3;  1QJU 2;  4MOA A;  5FO7 B;  3ZN6 A;  1RUO A;  1W9S A;  2QDR A;  1IPS A;  3ES4 A;  4H55 A;  4CXY A;  5FY8 A;  4C0B A;  5FY5 A;  3AJY A;  4MO3 M;  5A3L A;  5HCH A;  4JDM A;  1AR8 1;  2HH9 A;  4A6O A;  1LOB A;  4FXG B;  5IVF A;  2R07 1;  3HNB M;  3BTZ A;  4HK9 A;  3VD3 A;  4TZD A;  1EPZ A;  4N53 A;  3C3V A;  3I2F A;  3WSO A;  3WZ1 A;  3ZOI A;  1AR6 2;  3WG3 A;  1XJA A;  4QU2 A;  5KHK A;  1C4R A;  3WDU A;  3WHT A;  1D2S A;  4LBQ A;  5K0U A;  3R4D B;  1ZZ9 A;  2XUE A;  2ZAC A;  2ZML A;  3L2Y A;  4GB3 2;  4AQ2 A;  4SLI A;  1BEV 1;  1UIK A;  1STM A;  2D98 A;  1YEW A;  3HBZ A;  4Y4R A;  5E88 A;  5FZ6 A;  2RG4 A;  3BOP A;  1OA2 A;  1R09 1;  1RHI 2;  4EE2 A;  3BB6 A;  3RQ0 A;  1G86 A;  2YG0 A;  2EAK A;  3OTF A;  1X82 A;  2J1U A;  2QQJ A;  1KDM A;  2ZMK A;  3VKF C;  2RJL A;  1WCS A;  4DY3 A;  1PO1 3;  5CFD A;  4XZU G;  5F1R A;  1UIJ A;  5C8W A;  1DZR A;  4L92 A;  3POW A;  4E8D A;  2BW8 A;  1UXX X;  1YWK A;  3LPG A;  3AZZ A;  2D3R A;  3EQE A;  1F15 A;  2WN3 A;  2VR4 A;  4JTN A;  3ZSL A;  2D6N A;  1X8M A;  1EV1 2;  3U4S A;  1U5X A;  4QD2 A;  5DZG A;  3WHU A;  3WXP A;  2ZEW A;  3DV8 A;  4QDR A;  5FZO A;  3VHP A;  3C7F A;  3WW1 A;  5AFB A;  5CEH A;  2BER A;  2VMH A;  1U12 A;  2EIE A;  3IMN A;  1RMU 2;  4FFH A;  1PGL 1;  3DKW A;  2PTM A;  1DGW A;  4KWU A;  3N9Q A;  1OD3 A;  5FO8 B;  4URT A;  1B35 C;  4LK7 A;  4DRR A;  4RR3 A;  4YYO A;  1NLS A;  1CIW A;  1XE7 A;  2W5F A;  2GH2 A;  4N9I A;  2A6W A;  5EPA A;  3VKM A;  1JYW A;  1VMJ A;  2W08 A;  3SKV A;  1UX7 A;  3AZX A;  2BTV C;  1DQ4 A;  1YQ5 A;  4M0H A;  1OVS A;  1ZRD A;  1W28 A;  1VRH 3;  4HXC A;  4K3U A;  3RMX A;  4XUN A;  2D6K A;  2HWE 2;  1O3T A;  2IXK A;  2WNU C;  4W65 A;  3J26 N;  3WG2 A;  5C4W A;  5FZ9 A;  2H6B A;  1A3K A;  2JEC A;  2J1R A;  3QLQ A;  4RS5 C;  5FZA A;  2ZAH A;  5ERL A;  4NRP A;  3FMG A;  4OHW A;  4BK5 A;  3RZG A;  1ULG A;  1Y43 B;  3LEI A;  2F4P A;  1TE1 B;  1NT0 A;  4NPR A;  3PUR A;  3ZX7 A;  5C5T A;  2WC2 A;  4RFT 0;  1GQG A;  1CGP A;  3ON7 A;  1GV9 A;  1QJX 3;  1G6N A;  3OUJ A;  4JCK A;  4B4Q A;  1DQ6 A;  1RUC 2;  3DCQ A;  3PJY A;  4IGQ A;  4OCT A;  5CBL A;  1C28 A;  3SEP A;  4AED A;  3BOW A;  4AHY A;  4IW3 A;  1LGN A;  2P3K A;  5F8P A;  5FY4 A;  1H8T A;  4YM0 A;  2CV6 A;  1QMJ A;  1HB3 A;  1XSR A;  4PQQ A;  2VBD A;  2FCV A;  1JOB A;  4BIO A;  3HBK A;  4LBK A;  5J7M A;  1A8M A;  2GC2 A;  4TN7 A;  3PUH A;  1OA3 A;  4E8C A;  3IM0 A;  3A22 A;  1HRI 1;  1I5Z A;  2VME A;  5F5I A;  4IE5 A;  1QJU 1;  4AVB A;  3O1U A;  4IV1 C;  5DG2 A;  1VPH A;  2DVB A;  3QOP A;  4XFI A;  2Q8C A;  4AWD A;  2HWC 1;  5FKB A;  1AJO A;  2NQY A;  4AVC A;  3VBH A;  5D8A A;  5FMD A;  2QQO A;  3HT1 A;  2VCB A;  2VU9 A;  4ZS2 A;  4XJA A;  3KLS A;  2BU9 A;  5CIS A;  4MX3 A;  1ND3 A;  1HB2 A;  4UBG A;  1KRI A;  5K8S A;  5BY5 A;  4IE6 A;  2R0H A;  5LWB A;  1CZS A;  2P3J A;  4QM8 A;  4D69 A;  4YW2 A;  1NLR A;  4D8M A;  2ZBJ A;  2A3W A;  1F31 A;  4N43 A;  4PIY A;  1H0B A;  3DYP A;  2P2K A;  4P9G A;  2HEW F;  3M3O A;  4GB3 1;  2FDF A;  4XAB A;  4QU1 A;  1WCU A;  4MGQ A;  1IOA A;  1D2Q A;  4QXH A;  5FZ1 A;  3ZFE A;  5C8C A;  1JZ3 A;  1CAW B;  1W8W A;  3AMQ A;  3IDB B;  3M3E A;  1CD3 G;  1W2T A;  1OKQ A;  4WM7 C;  1FOD 3;  4X6R B;  1IGO A;  2ZCW A;  4FCA A;  4QDS A;  4GH4 A;  1I5P A;  4XDO A;  5A7P A;  1SFY A;  4OUS A;  3LWC A;  3SMH A;  5FZH A;  5FR3 A;  2H0B A;  3NJY A;  4AVA A;  3M1H A;  1GYK A;  1JH5 A;  3OY8 A;  2GC3 A;  3M4F A;  5DZE A;  4XTM A;  3DPR B;  3WQ7 A;  5KXD A;  3ALQ A;  1LHW A;  5A3M A;  1CES A;  3ZKU A;  1LEN A;  5FZF A;  4QQO A;  3MLL A;  2P17 A;  1LCL A;  3MW3 A;  5A7W B;  3RYR A;  2D6P A;  3T0D A;  1GMM A;  3PJQ A;  4IE7 A;  3WIN E;  3WV6 A;  4R8H A;  1RMU 1;  3WDY A;  5L7O B;  5I8T A;  2A6Z A;  3VN4 A;  4QAW A;  5JCT A;  1PIV 2;  2X29 A;  4Q1R A;  2HWD 3;  2LRO A;  5FP7 A;  1Z7S 3;  5J98 B;  2NLR A;  1HXS 3;  3ELN A;  3JD7 1;  3QCW A;  1VBC 1;  3RJ2 X;  1ENS A;  3OCP A;  2R49 A;  2QTW B;  1S0I A;  3P3P A;  1R08 1;  2QQP A;  1G8W A;  3TN9 1;  3V0A A;  1ZBA 2;  3MPP G;  4XIO A;  4HSJ A;  1ALY A;  4EJR A;  1OLM A;  2WAA A;  1S2E A;  3U37 A;  1GOG A;  1V0A A;  4XJZ A;  2RS3 3;  1V6M A;  5CKN A;  1H6Y A;  1RUD 2;  4FAH A;  1HQN A;  1MPX A;  2Z2S B;  1REF A;  4M3C E;  2R0F A;  5AC9 2;  1CZT A;  2FZ1 A;  1QQP 1;  4Q4W 2;  3GJA A;  1H1M A;  5FWE A;  4P08 A;  1O4T A;  1VBD 2;  4E27 A;  2BYV E;  2ZTN A;  2RS5 3;  4NHY A;  1GP5 A;  4EYU A;  2XJR A;  4EN8 B;  1WW5 A;  4BA6 A;  1LOF C;  4ES8 A;  4CDW C;  1SHW B;  5IAX A;  5I0T A;  3UGH A;  2QQM A;  3I3D A;  2V4V A;  4K9S A;  2OZJ A;  3CU7 A;  4YNI A;  4IQP A;  2D5F A;  5JR7 B;  5HBA A;  3UGG A;  3MID A;  4QX1 A;  4CEY A;  5A3N A;  1OOP B;  2B42 B;  5FZB A;  3VBF B;  3WLU A;  1RB8 G;  3BKZ A;  3VDD A;  1AVB A;  2B5H A;  3S57 A;  5AVA A;  2WZ8 A;  2PEL A;  3KD4 A;  4HON A;  4WBB A;  4AE2 A;  2G1M A;  5FYT A;  1PMJ X;  4GUL A;  2D7F A;  5IHR A;  2FMY A;  2VOK A;  1NOV A;  1EPW A;  2QCS B;  1YFX A;  2VPV A;  2YUE A;  3ES1 A;  4P14 A;  4A44 A;  1O5L A;  2DVG A;  3D6E A;  4ORF A;  2YRO A;  3K75 B;  2IC1 A;  1JYI A;  2WAO A;  4QQL A;  3GHN A;  3H1W A;  1KJL A;  2OQ7 A;  1GQP A;  3ILF A;  5BNP A;  5FJH A;  4COY A;  3H3U A;  5FRA A;  4D7T A;  1DYO A;  3WVJ A;  1QXR A;  3O1O A;  2JG8 B;  4LR4 A;  2HEY F;  4WVZ A;  5F37 A;  3WNX A;  3LA3 A;  4AI3 A;  2ZX0 A;  3AFK A;  4GMP 1;  4HKO A;  1WA6 X;  1R1A 2;  4SBV A;  4KL1 A;  3I97 A;  4LKS A;  3Q8A A;  4MXW A;  1FMD 2;  1TME 3;  1W6N B;  4YVW B;  1RUG 2;  1X50 A;  1C8M 2;  5BNN B;  4ARX A;  3PNA A;  3JUU A;  3V0B B;  5BXX A;  1K5M B;  2ZX1 A;  2XVK A;  1W2U A;  2JE8 A;  2WFF 2;  3AP9 A;  5FCC A;  1IS6 A;  5IFT A;  1UOF A;  2J42 A;  4C8D A;  1EAH 2;  4TXW A;  4LBL A;  2GMP A;  1RYY A;  5A7Q A;  5LBC A;  4LXL A;  3W5M A;  1KJR A;  3O0X A;  2Y33 A;  3KV5 A;  3CMG A;  3JB4 C;  1OKO A;  1AR7 3;  3J4U H;  1DBN A;  1ND2 B;  3DF0 A;  2C9A A;  5FZ8 A;  1LOE A;  1AXZ A;  3RMY A;  5IK8 A;  4EZ4 A;  4ZS3 A;  4JKM A;  3AM2 A;  2W2I A;  4JC1 A;  4HPK B;  5JXG A;  2ZHN A;  5FPU A;  2BFU S;  4IND A;  1QEX A;  1Y4W A;  5FZ3 A;  1C57 A;  3VL8 A;  1L7L A;  4PDW A;  5DZF A;  2VZP A;  3MF9 A;  5E89 A;  2F6B A;  5KR7 A;  5LZ6 A;  1DU3 D;  1J84 A;  1UNB A;  4Y1U A;  3LZZ A;  1L7Q A;  3Q8E A;  2YDE A;  1AYN 2;  3LSE A;  3TEX A;  2BOJ A;  4HBN A;  2Q8O A;  3PMS A;  2P3I A;  1Q8V A;  2SLI A;  4NRQ A;  3VBR C;  1QHD A;  2DYC A;  2IXC A;  4NPM A;  2ZGN A;  2VTF A;  3FHA A;  2VNR A;  4JTO A;  4AF9 A;  1HB1 A;  1ZBA 1;  5T55 A;  3KV9 A;  5GKA C;  2PLV 3;  4AHZ A;  4M3C B;  1DIW A;  1RGS A;  3GCW A;  2Q0A A;  4Y26 A;  3TB0 A;  2E33 A;  3MUY 1;  4P9X A;  2AEY A;  3VB9 A;  5AC9 1;  4XJW A;  5ACA 2;  3RZH A;  1NQD A;  1IQD C;  1WW4 A;  3ILN A;  4LA2 A;  5A1A A;  4YM3 A;  1JN2 P;  1POV 0;  4PT6 A;  3POB A;  1VBD 1;  3I2D A;  4ZY9 A;  5BV6 A;  1MS9 A;  2RR1 3;  4GAL A;  4OLL A;  3I2I A;  1S0B A;  1VP6 A;  2JG9 B;  3U78 A;  1QXP A;  2VBB A;  4RD7 A;  4CU6 A;  1RXF A;  1V6I A;  4XFF A;  2VUC A;  2XL9 A;  1S2B A;  2PAM A;  5LRS A;  2ATF A;  3NAP B;  5JUV A;  2JDU A;  5LY1 A;  4RGA A;  1BMV 2;  5L7O C;  2BDR A;  3ETQ A;  3THD A;  4HVQ A;  2JIG A;  5C3R A;  1CJD A;  1LRH A;  1O4Y A;  3AVS A;  4LLF A;  3CIH A;  4IEQ A;  1PO2 1;  4YZ2 A;  1Y7B A;  3EMR A;  4LUM A;  1JYT A;  5EQU A;  3NQH A;  4LHN A;  1J3P A;  2QQU A;  2WO1 A;  2XR4 A;  5IK4 A;  3AP5 A;  1DQ1 A;  4Y24 A;  3HNM A;  2WA4 A;  2WDB A;  1DF0 A;  5A80 A;  2JD4 A;  4FOY A;  1XE8 A;  5JMC A;  3B5L B;  1NZC A;  1IKP A;  5FYZ A;  1I3H A;  3VGI A;  1AX0 A;  2UYA A;  4LUL A;  2VQ0 A;  1WLD A;  4QQH A;  2QE3 A;  5A32 B;  1H9P A;  2IXI A;  1UF2 C;  3M7A A;  4IEY A;  4XFB A;  3HN3 A;  4XBN A;  3IAQ A;  1VBB 1;  4B29 A;  5EV7 A;  2WWJ A;  3VBU A;  1D4M 3;  1V6K A;  2C24 A;  3NV1 A;  2WT1 A;  5JOZ A;  4QQP A;  4P9J A;  1CAX B;  1CPM A;  4RN5 A;  1RUH 1;  3ZXA C;  5A7N A;  1VMH A;  1X36 A;  3ACH A;  2AC1 A;  4G3Y C;  1XBF A;  4HN1 A;  4E4Z A;  5I0D A;  4J1W A;  1Z0H A;  4EWD A;  2VY0 A;  3L2H A;  1UY1 A;  2AAC A;  3BTY A;  4CDX C;  1DLC A;  5IVE A;  5C9A B;  3U4X A;  1RUG 1;  2E32 A;  2PHU A;  3WNM A;  1PO1 2;  4ZXE A;  2B46 X;  5DAX A;  5KC6 A;  3CJI C;  3SLI A;  4JGY B;  3D3A A;  4HKW A;  4JDO A;  2OKX A;  3JQX A;  1N1T A;  2GAU A;  3WNL A;  1GFF 2;  4YM1 A;  5HV4 A;  2QNK A;  1JZ2 A;  4XAC A;  1NUK A;  3IZO A;  2WO2 A;  4XIL A;  1YFY A;  1E5H A;  4AG4 A;  4JGZ A;  1DG6 A;  1ULF A;  2YFU A;  4RHV 3;  1YQ8 A;  3PIJ A;  4EZH A;  3BUC A;  5T5J A;  4NMI A;  4B7K A;  2VMG A;  3MZH A;  3JCI A;  3JBG 1;  3QD6 A;  1SG3 A;  2XJT A;  1UAI A;  4MYE A;  4Z07 A;  1AUY A;  2PAK A;  1F4H A;  1APN A;  2W91 A;  4L0P A;  3GCX A;  5F5A A;  5F2W A;  4QXC A;  5KXC A;  4P9Y A; 
#chains in the Genus database with same CATH homology
 3BU0 A;  2FDK A;  4NRQ A;  4NPM A;  4QKF A;  3BI3 A;  4JHT A;  4NRO A;  3RZL A;  3RZH A;  4NIH A;  4NID A;  4NRP A;  3RZG A;  4NIG A;  4CXW A;  2FDG A;  3I3Q A;  3I2O A;  3RZM A;  4RFR B;  4OCT A;  4NJ4 A;  5F8P A;  3KHB A;  3LFM A;  3O1S A;  2FDH A;  4NPL A;  3BKZ A;  4QKN A;  4ZHN A;  4IE5 A;  3S57 A;  4QKB A;  3T4V A;  3O1U A;  3KHC A;  4O7X A;  3S5A A;  4MG2 A;  4CXY A;  4O61 A;  2IUW A;  3T4H B;  4ZS2 A;  3BTZ A;  5DAB A;  4NRM A;  3BTX A;  2FD8 A;  3O1O A;  3BIE A;  4IE6 A;  4IDZ A;  4NII A;  2FDI A;  3O1R A;  3RZJ A;  3BTY A;  2FDF A;  4QHO A;  3H8X A;  4CXX A;  3O1P A;  2FDJ A;  4IE4 A;  3T3Y A;  3H8O A;  4IE0 A;  3I49 A;  3O1M A;  3O1V A;  3BUC A;  4ZS3 A;  3O1T A;  4IE7 A;  4QKD A;  3RZK A;  3H8R A;  3I3M A;  4MGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...