5FZ8A

Crystal structure of the catalytic domain of human jarid1b in complex with malate
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
463
structure length
453
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with Malate
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
total genus 143
structure length 453
sequence length 463
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fz8A01
4D6RA 5FZBA 4D6QA 4C8DA 4GAZA 2OS2A 2XMLA 5FP8A 3LDBA 3U78A 4EYUA 4TN7A 5IW0A 3N9OA 4UF0B 3N9MA 4V2VA 5A7OA 2W2IA 3AVRA 5FYHA 5FYBA 5A7QA 4CCLA 4E4HA 5A3NA 5LW9A 4QX8A 5FZOB 5FYMA 3KV9A 2GP5A 1VRBA 5FZ6A 3UYJA 5FUNA 4QXBA 3PUQA 5A7PA 3PURA 5FY9A 4CCNA 4Y4RA 3PU3A 5FZCA 4LXLA 5FZ8A 5IVFA 4EZHA 4CCKA 5FYZA 3N9LA 4XDOA 5F2SA 5IWFA 5FY8A 5LWBA 5A3PA 4IGQA 4ASKA 5FZLA 4BISA 5IVCA 5F3CA 2YBKA 5FZMA 4LITA 5IVVA 3LD8A 4QX7A 4BXFA 3PU8A 5K4LA 5A1LA 3DXTA 3U4SA 5F37A 5FWJA 5LY2A 4DIQA 4XDPA 5FXWA 5FZFA 4CCOA 3NJYA 5FZOA 4CSWA 5A7NA 5FYCA 3KV5A 3K2OA 5FXVA 4NUBA 5LY1A 4CCMA 3ZPOA 3DXUA 2Q8DA 5ISLA 5FWEA 5FY0A 5FYYA 3RVHA 3AL5A 5ANQA 2GP3A 5FZDA 2Q8EA 2WWUA 5FPBA 3K3OA 5FY7A 3PDQA 4V2WA 4BU2A 5FYVA 4HOOA 5FZEA 5KR7A 2YPDA 3PUSA 4CCJA 3KV4A 4HONA 2XXZA 5FZIA 5F5AA 4DO0A 5FZ9A 4QXCA 5FZ0A 5FUPA 4Y3OA 5FZ4A 4GD4A 5F2WA 5FPUA 5FPVA 5FV3A 2Q8CA 5FZKA 3PTRB 2YBSA 4AI9A 5FP3A 5A3TA 4AAPA 5F3GA 5FZ7A 4QWNA 3K3NA 5A7WB 3KVBA 5F5IA 5FJHA 5A1FA 4QU1A 5F39A 5FP9A 5FPLA 4URAA 5FP4A 5FXZA 3OPTA 2YBPA 4EZ4A 2OQ7A 5FZHA 3PUAA 5FZGA 2XDVA 3N9NA 5FYSA 4QXHA 5FJKA 4LIVA 2OX0A 3OPWA 5FZ1A 4UF0A 5A7SA 5A80A 5IVEA 5FYTA 5F3IA 5FY1A 2OT7A 3KVAA 5F5CA 2WWJA 2OQ6A 5FBJA 2XUEA 5FP7A 2YU2A 2VD7A 3N9QA 5FY4A 4LIUA 5FZAA 4GJYA 4CUGA 2YU1A 5IVBA 3KV6A 5E6HA 5F3EA 4D6SA 3N9PA 2PXJA 5F32A 3AL6A 5FZ3A 5FYIA 5FYUA 5CEHA 5A3WA 3AVSA 5IVYA 5FY5A 4Y33A 5IVJA 2P5BA 4GJZA 3ZLIA 5A7WA 5FXXA 4IGPA 5FPAA 4IGOA
chains in the Genus database with same CATH superfamily
1O5UA 4DEVA 1IPSA 2WAAA 4FPYA 3LB9A 3WINE 2AACA 1RTVA 1V6MA 5BY5A 2E9QA 2CAUA 5FP8A 3WF4A 3U78A 1ZBA1 1KDKA 1OPOA 2NQYA 2EF6A 1X9TA 2D6KA 1I9RA 4XUOA 1GZCA 1XRUA 1HRV1 2GC0A 3U0ZA 1WA6X 4A6SA 3WW2A 2BYVE 2PHFA 2WFF1 1BVP1 1F15A 3OYWB 4M0NA 1W9WA 3LA2A 3VBSC 1LKNA 1A78A 4XEZA 5AC93 1KXGA 3HQRA 3IDBB 4B1LA 2HYKA 3INAA 2O8OA 1GQGA 3RMYA 2W95A 4I2OA 3H8UA 4GXLA 2W1WA 4XBLA 2QFEA 2WO1A 1MQTC 3ES4A 2VUJA 5M0TA 3DF0A 3FHIB 2ZS6B 3AC0A 4H14A 4W8JA 4YVWA 2CNAA 4EROA 5AFBA 5I0UA 4F7ZA 1PIV1 4YM3A 4AI1A 1JYXA 1GSLA 3CO2A 2WNVB 4URTA 1SZBA 3WV6A 4NN0A 4WM8C 1R083 4RHV3 5KXEA 3WHUA 1QHDA 3I7DA 5H9SA 5K4LA 4DRRA 2B9UA 5LY2A 4ZU7A 5LEKA 3KSCA 1YNAA 5T5PA 4W6WA 3K46A 4CU9A 1QJZA 2RDRA 3VKLA 1W2OA 3IPVB 4AEDB 4WBBA 2RR13 5C4WA 1W03A 1BBT2 3AXEA 5LK5A 4UW3A 4R9AA 4X6RB 5ANQA 1RUJ1 3CJXA 1DQ5A 3RI8A 2B46X 2PHTA 2ZGTA 1QNWA 5KC6A 3GXUA 1YWKA 4I0WB 1GR3A 3G6JB 4QPGC 4K6BA 4MV2A 1W2UA 1XYOA 3S7EA 2X5IC 2JE9A 4G9SB 4BOWA 3HIFA 1AUYA 1G9DA 5A3TA 2CV6A 4OZOA 1C5IA 1UOBA 1HX6A 4IEPA 4JQTA 3S5AA 4AFMA 1XE8A 4JKMA 4ZY9A 5CB7A 5F39A 5CFDC 5FP9A 1NCQC 3NVCA 1G9CA 3H1YA 3QD6A 4XAAA 1WD4A 2QQUA 4EZ4A 5FZHA 4YZ1A 4AR2A 1VBD3 4AFCA 3POFA 1ZA7A 4EN8B 1DLCA 2EXIA 1K3IA 3HQUA 4Z8BA 3I59A 1QJY1 1VBE1 4NHKA 5CU1A 2RE9A 3AZVA 1UF2C 2DVGA 1H30A 3C7OA 3IBMA 2EAAA 2XONA 1FV3A 2BV4A 1D4M2 2WWJA 4LLOA 2W87A 4PF1A 4RQPB 1QQP1 4BM8A 2VOKA 5JXGA 5FZAA 1W6QB 4CDUA 3HAGA 4JDOA 1J59A 5IVBA 2Z42A 3VKFC 4GIQA 1PGL1 3KHBA 3VDDB 1QF3A 2WNUC 3VBRC 5DDJ2 3LPFA 4LBLA 3ZSMA 2VCBA 2RDSA 3LOBA 2QQWA 2WINB 2A3YA 2QNKA 4N43B 3U11A 1AR62 3PJYA 4IV3C 4NIDA 2GH2A 3MV11 5FZBA 4XBNA 1IGOA 1K12A 2J1RA 1C1LA 5GZDA 1ZRRA 1GICA 4JGZA 1NCRC 3PIGA 2L9LA 2XB6C 3HN3A 3O1PA 1FMD3 4UWDA 1A3KA 5IK5A 5HXVA 3J4UH 4XCBA 5T52A 3RMXA 4AHYA 5CFCB 3MICA 2EALA 1JOJA 1OH4A 1S0IA 2W46A 1PHMA 3UYJA 1TMF3 1QKQA 2JDZA 3AKRA 4X8NA 1ULFA 3CIHA 1BCXA 1COV2 4A2UA 4HSLA 2DWRA 5IVFA 4WVZA 3CEWA 1H8TA 1W90A 2D3SA 2XHNA 3WP6A 2PAKA 1S2EA 3NNMA 4FI9A 2YV8A 4DOUA 4GMP0 3PUIA 1ND3C 3UNPA 3MO4A 3OB8A 4BISA 5J7MA 5F3CA 2R32A 2XUMA 1VP6A 3FWEA 3WUCA 5A1LA 1LESA 3MIGA 1VMJA 5I0TA 2GNTA 2UURA 2VNOA 4L99A 2BVVA 2IXIA 3FUOA 2E63A 1OOPC 1SBDA 4GMP1 3WNLA 3KV5A 3BVCA 1VPHA 4PIXA 4CCMA 1DQ1A 5CKMA 1UZZA 3K77A 1EAH2 2PQSA 2VMHA 3MUZ1 1VR3A 3POYA 4PQ9A 3A23A 5LRRA 1IQDC 5FWEA 4CA9A 1ENXA 5D8AB 2GP3A 1DZQA 2WO3A 3BODA 2R30A 3UV9A 1EV13 4RS5A 5KR7A 5FDBA 3TRSB 4DXRA 1FAYA 3O0XA 1GWKA 4DZGA 2V4VA 2R073 3V0BA 1X33A 1XPWA 2VQ0A 4YWAA 2VW2A 1IG3A 2OKXA 1RJ8A 4EN6B 3WDUA 4E27A 5A33A 4XXAA 5T50A 1ZBA2 1VBD2 2ZACA 4AI9A 4ISRA 1CONA 1GZTA 5FZ7A 1FPN1 2DU1A 3VBHA 1A6CA 1MS0A 1RC6A 2UY8A 1XJAA 4IE5A 5FJHA 4BYYA 4D8MA 5A1FA 4CDUC 5A1AA 1DZTA 1PNFA 1OC1A 4BHPA 1PZ9A 4XXPA 1GP4A 5FO7B 1ZYBA 1JU3A 2DFCA 2NYYA 3C7EA 4BE3A 5F7UA 1E57A 1SFYA 1Y43B 3AB0A 1JYWA 2GC1A 1JYNA 5JXHA 2AYHA 1GZWA 4Q1PA 4WVMB 1TME1 1IHMA 5FBJA 2CGNA 3B5LB 4RHV2 5FP7A 5JZGC 3RJ2X 2E31A 2WNEA 5CIRA 4Q1RA 2ADDA 4AQTA 1LOEA 3N9PA 3OUHA 1XE0A 2CDOA 2Y6LA 3WX5A 4M3CF 4XF4A 4N43C 3S57A 1H1IA 2R041 2BUKA 4GULA 4AVBA 1QJX2 5FPAA 5F8PA 3TEYA 5HBAA 1M06G 1OXCA 3ZYIB 1W2AX 4D6QA 4YSFA 2PYTA 1HLCA 2P4EA 5CKNA 1FOD1 3EO6A 5BNOA 2XMLA 4YM1A 5C5TA 4CZSA 4EYUA 2IXCA 2RS31 2HH9A 1UZVA 4FFHA 3ZFFA 4OHZA 3FHQA 1RUF2 2XKPA 3CJIC 3M2MA 3DKQA 1YXWA 1GWLA 4QQOA 4RFRB 3WNXA 4QX8A 3BB6A 4LE4A 3MF9A 4XFFA 2YDEA 1XNBA 4GKYA 4NPLA 4UFKA 3VKMA 1VMFA 1RUF1 1HN0A 4KU7A 4QHOA 5J36A 1R081 2IXJA 3PNAA 4IEXA 4WM7C 4Y5Z0 2ZAHA 1IKQA 3JQWA 3ACIA 3T4VA 2CTVA 3T2PA 2ADEA 1JH5A 2BOIA 2BBAA 3UETA 4ZS3A 5FZCA 4DINB 2W1SA 2A5ZA 4QMAA 4FT8A 5I91A 3NV1A 3KQ4B 2JDHA 3D8CA 3LQCA 5F2SA 5GZGA 4D94A 3MZHA 5IWFA 3THCA 4CRQA 1W0PA 5JAXA 2DCJA 4YVSA 4XACA 2J42A 3CKHA 1GMMA 3I49A 3RFRA 1CGPA 4XILA 2VZ3A 1G6NA 1IOAA 1AR73 4QAWA 4XTPA 1YJLA 3V0AB 2XKOA 3ILNA 2JJ6A 4I0AA 1VE0A 5FZFA 2B7YA 2DUPA 3NJYA 1UMZA 1UMHA 1U5IA 4MGQA 5GM0A 4PJYA 5E88A 2BFUL 3OY8A 4FOYA 3ZPOA 2UYBA 3ZR6A 2P3IA 3IAPA 5IK8A 5FY0A 4CDXB 4PBPA 1FT9A 3WP3A 1Q43A 2HWF3 2WJSA 3AL5A 3OEBA 4FO9A 4FPKA 3GDBA 4PBOA 1ZRIA 1O7FA 3K3OA 3KWVA 4Q0VA 4Y1VA 1VJ2A 2ATFA 2WNUA 3PDQA 3VBRA 4BLIA 4GWIA 2WYFA 2A73B 1DGWA 4K8FA 5CKQA 2R1BA 3R05A 1GFF2 1VBC3 1HJFA 3ME2A 4COWA 5BNPC 1D0HA 1UN1A 2R0FA 3RPQA 1NXMA 3ZYFA 4DO0A 4Y3OA 5F2WA 1E5IA 5FMCA 4DUWA 2ZHNA 3TEZA 2MPFA 4R4ZA 2WFF2 2D3RA 4LORA 5J3UA 1QXPA 2AENA 3AZZA 3T2TA 2NM1A 2VU9A 4YW4A 1RVF1 2PLV3 2A75A 5F5IA 4CDWB 3M3IA 1J3QA 1J1TA 2RR12 3SQOA 2VZTA 4P9JA 2G9ZA 5FTTC 2DUOA 2C5DA 5LK7B 2O0OA 1C8M1 4ZS2A 1ND2C 3O1VA 4MG2A 3V0BB 3HPNA 1KDMA 2NN8A 4UF0A 4HPKA 3ZN6B 3ZVXA 4CEYB 5F9TA 5IVEA 1R64A 1W6MA 4PI0A 2FHRA 4OHXA 4QPIC 3ZXJA 1RUH1 2WAOA 1PO21 3MEPA 3SLIA 2JD4A 4NWVA 3L2YA 3U14A 4S2GA 2OPWA 2Y34A 4FPJA 3LEKA 1HKDA 3T4HB 4AEDC 5I0DA 2VZPA 5HCAA 1WCSA 3AKTA 3ZLIA 2QQPA 4TSVA 4Q4V2 2A6WA 2VQTA 4Q4W1 3WF1A 2O8QA 1JUIA 5EZWA 2EAKA 3SH3A 1CD3G 2ZGQA 4LQRA 3D3AA 1S0GA 4XAEA 2QTWB 4H3WA 1IS6A 2FCUA 3C7FA 3RG0A 1UZYA 1OI6A 3JBG3 1QDCA 2VBBA 3VBUC 3N7MA 4ZONA 3CNAA 4JV4A 2VR4A 3LSEA 1QOSA 5JMCA 2ZZQA 1SLLA 4J6GA 4QX0A 5FYHA 1JOPA 5A3NA 2WT1A 2FCTA 2J1VA 2LS6A 2DCZA 4IW3A 3B3QE 3GZAA 3WW3A 2VZRA 3SKJE 3AYCA 5C3QA 3LEIA 3QOPA 3KCCA 2PTMA 2DVDA 3PUQA 2VCMA 5FY9A 2QKDA 1TQ5A 1RUG3 1S2BA 1TNRA 4LBQA 1TMF2 2X29A 1QXJA 1BJQA 5G04L 3AMPA 1RIRA 4DXZA 1W2NA 1AXYA 5LA2A 4Q4X2 2PHDA 3MPBA 1OUXA 3SITA 4AWDA 3ZFGC 1DGLA 2HEVF 2OZ6A 2PLV2 1GOHA 1PX4A 5EJ1B 1K45A 1K5JA 2XJVA 4MXWB 3AJZA 3OGVA 3MW3A 4RR3C 4HN0A 5DUUA 3WF3A 4E9KA 2R16A 1NA1C 1XNCA 4OFGA 1Y4WA 3DKWA 4CSWA 3WNNA 3VL8A 4FPOB 2D97A 3I3BA 4QT6A 2G4IA 3U1XA 3VBSA 3U4XA 2Y8KA 4JRAA 2Q8DA 5FO9B 2WA4A 1W9TA 1NY71 2P6CA 1XQNA 2WDBA 3CQOA 1BVVA 4QX5A 4RHV1 1WLDA 4OMCA 2ZKNA 5KHHA 3TN92 3KM5A 5FPBA 4QX1A 1ASJ2 4NPMA 4I02A 3OYWA 4IV1B 1DQ6A 5FY7A 3DUIA 1U5YA 4V2WA 4ORFA 1NCRB 2ET7A 4RA0A 2RJLA 4M3CE 3IAQA 5ABJC 2WS91 4QHBA 1LRHA 5BNPB 2ORZA 3VDDA 2OUHA 3W20A 4I09A 2BQPA 1UIKA 4LUKA 1R1A3 4PLNA 5DZFA 4O9EA 2JG9A 5FUPA 4FPCA 1UOGA 2WNVA 2VE1A 3AP4A 3MLJA 4QQLA 4XJZA 5FZKA 5KHKA 5L7OB 3AMQA 2QE3A 3TAYA 3O7OA 2WABA 3C7HA 1W6OB 2VC9A 4YVWB 2JICA 4QWNA 4D7YA 4IE4A 3KVBA 1Y9GA 3ZFFC 5DAVA 3RYRA 3POIA 3ZKYA 1RMU3 4BQWA 4HK9A 3GF6A 5K9YA 2XJTA 3HR9A 2C9AA 2VBDA 2YHJA 4YW2A 5E89A 4JGZB 1UWWA 3OY8B 1W6PB 1X50A 2JIGA 2RG4A 1EPWA 1OUSA 5BNNB 4AGGA 1RUC3 2NZ9A 3WVJA 5C8WA 1MS8A 2W68A 3D82A 4FP2A 4XFBA 5DUVA 5A7SA 1CWPA 4LR4A 5F5CA 2OQ6A 1BXHA 2RS52 1QOTA 3ALQA 4LKEA 1QJY3 2XUEA 2XVKA 3RZGA 1JZ3A 2LROA 4HK8A 3LA3A 1XXNA 2ORXA 1CAVA 1WMXA 2IZWA 3BOPA 3HOBA 5E6HA 5F3EA 4OHYA 1PO12 2W52A 5CG9A 3M3QA 3ZOIA 4UBGA 5FMOS 3QH7A 1VBA3 3SCHA 4Z92B 4ZHNA 3UJQA 1QQP3 1DBNA 1RUH2 1PZ8A 1REDA 4XUTA 3BKZA 3KT4A 5IYYA 4D6RA 3ZXAC 5D1IA 4LNVA 5BNNA 2CAVA 3A0NA 1AL23 3VV1A 3KQRA 3ZYRA 4FQ4A 4AEKA 2W0XA 1O91A 4TN7A 3N4MA 3WOGA 2W5FA 2BWCA 3BPSA 3WG4A 2EA7A 4Z07A 1AJKA 3W5MA 5A7OA 4XVHA 4HVOA 3APBA 4OMDA 1S55A 2GN3A 4QM9A 1L3JA 1JZ6A 4C0BA 2GNBA 1OF3A 1REEA 2JG9B 4GZ9A 5DPNA 5KHJA 2W92A 2XHKA 3KF5A 2FQPA 4OUEA 1O59A 5DZGA 4CEWB 2YROA 1BEV2 1UX6A 3KGLA 3WW1A 3PU3A 4CCNA 3RYKA 2IUWA 1WMEA 4KMQA 4XDOA 1YQ6A 2DDUA 4IE0A 1FYUA 1TVGA 1KS5A 1RL3A 3GGLA 4FAGA 2RHPA 2W1UA 4JGYB 1H9WA 1S0BA 5EJ3A 4FVVA 1PMIA 4JRLA 3WUDA 5JZGB 2HWF1 4O7XA 1V9U1 1MEC1 3DXTA 4MGIE 4Q2FA 5FPXA 3VBHC 3AYEA 3KZ4C 1OQDA 2PAMA 2DURA 3I2FA 2HWE3 3K2OA 4FXGB 1RUOA 3FLRA 1RXFA 4IQPA 1SLCA 2DCYA 3M7AA 4Q26A 4J1WA 3JBG2 2Q8EA 1C8M2 2XQXA 3WW4A 2I07B 3MI8A 3WNOA 3SCGA 2P6HA 2YPDA 4LEJA 4DQAA 4HN1A 2JB4A 3P1IA 4IEQA 3J9SA 3A7QA 1EAH3 2F4PA 2JIJA 1AL0G 1ZA4A 2QQKA 2PA7A 3AP7A 4AVSA 2FMYA 5FZ4A 1HRV2 3VLBB 1MVQA 1W05A 1QJU1 4AI8A 4CU6A 5EQUA 3RSJA 4XFGA 2VTXJ 1EV11 4XDQA 3HEIA 2OUJA 1QJU3 1V70A 3N7LA 1OMIA 4PLOA 4UAPA 5FPLA 1LR5A 5FP4A 4FSJA 1OPMA 1IS5A 2D6PA 4COYA 3TYJA 2VZQA 2XDVA 5LCWL 3ZXKA 1G7YA 1UY3A 3PVNA 1UMIA 4TYSA 1GWMA 1L7LA 4FTSA 3T09A 1R1ZA 1OURA 1VAMA 2EXKA 2MEV3 2RJKA 4D69A 3WDWA 3CZUA 1JXNA 1C1FA 1S0JA 3K4AA 5DDJ1 2J22A 3ZSKA 4R52A 2MHFA 2V5DA 3AMNA 2ETEA 5JIUA 3ZDSA 4A7KA 1OLME 1PM4A 5EJZB 4D6SA 1HB3A 5IFTA 5F32A 3BTZA 3NJXA 3RZHA 3OGRA 1WUVA 2Y6FA 1QQP2 1QNYA 1LULA 4HT1T 4BK5A 2NMNA 1HQNA 4HMZA 3GNEA 1NQDA 1CR7A 4CDQC 5KXBA 2Y60A 1AX2A 1W6OA 5JUVA 4H7LA 1H1MA 3WQ7A 5AC91 2K46A 3B94A 3KB5A 4GAZA 2G19A 2HEYF 4N7UA 4NHYA 2HWF2 1HRI1 2HWD3 4YZ2A 3CMGA 4UF0B 1RUG1 2RMU3 2JDAA 1W6NA 2HWD1 4I0BA 1G9BA 2JDKA 2HJIA 4RSUA 3NNJA 4M3CB 3H42B 4GWMA 4S2DA 2RM23 4UW6A 1Q8QA 2RV9A 5DAQA 1SG3A 4OVEA 2ENRA 1FPN2 2WA3A 2D3PA 2SBAA 2VZVA 3AX4A 4IE6A 4A7ZA 1MPXA 5FUNA 4QXBA 1J83A 1ULOA 2VL4A 2RS33 2R062 2VCCA 4Q0PA 5CFCA 3R4DB 1RVF2 4XUQA 1JYVA 2ZEWA 1RUF3 2JEMA 4TTGA 4E4SA 4HBNA 3DYPA 4P00B 1PIV3 4N43A 4O9GA 3S7IA 1GQPA 4MXWA 4MGYE 2OYZA 5A6YA 3H8RA 2VMIA 4LO7A 3NAPC 3I54A 4Y1ZA 4X6QB 3N7KA 3DPRB 2BJSA 3AFKA 3T3YA 2E33A 3SHRA 1R093 4AGVA 1H2MA 3PU8A 4Q4W2 2JE8A 4Y5SA 3NKGA 3ABZA 4Q4V1 2HWC2 1LGNA 4XDPA 4QDSA 2PHLA 4XETA 4YGEA 2D5HA 2XJUA 1US3A 1X36A 1XYNA 2G9GA 1NLRA 2LUWA 5FYCA 4CP9B 2DFBA 5FLIA 3HVDA 1JBCA 1RYYA 3ES1A 4MXVA 2C1FA 2ZEYA 2ZX0A 2CGPA 1ND2A 2C24A 2GNDA 3VBOA 2KD7A 3V64A 3LIGA 4H7MA 3LAGA 3U10A 2CY6A 2IVIB 3VZKA 4DS0A 5AVAA 3TBDA 2HEWF 4XF1A 4FCAA 4HOOA 4A45A 2Q5TA 5JSOA 3B7MA 4DUXA 2CGOA 1JN2P 4IV3B 4P9XA 5F5AA 3H3ZA 1WWYA 2BVBA 4XHXA 4B4PA 4MUVA 3VD5A 1RUC1 1OF4A 3MHZA 2WLQA 4YFWA 1D7PM 2VJXA 3BCWA 3B93A 4HVQA 2QVSB 3BTAA 1UPSA 4COZA 1YHFA 2IC1A 4W4ZA 3H8OA 5ERLA 5JXIA 1CQ9A 1CAVB 4W6XA 5JPNB 4UFMA 5BV6A 4C8DA 1NX9A 1BK1A 4ZXEA 3OSDA 1AX1A 5FYSA 3OGGA 2VUCA 4HKLA 4CPBD 1RUNA 2EIDA 1WZXA 3IT8A 3CF6E 4KBBA 1AR93 1N1VA 4JHTA 4Q8LA 2TUNA 4ZU5A 3MFCA 4L0PA 3S30A 3ACGA 3I3DA 3RZJA 3WNKA 2YU1A 1JODA 2WWSA 4LE3A 4R9DA 4K9SA 1PO23 2VCAA 3AL6A 5LBFA 4BQ1A 1PIV2 1RB8G 4AHZA 3H1WA 5IVYA 2BFUS 4HKOA 3LZZA 1BEV3 4QX2A 1FI2A 3ETPA 3FFZA 5FXXA 3RRDA 1UZ0A 3K75B 3VD4A 2BNMA 2JDMA 2RM22 1I5ZA 3H0OA 1H2LA 5A3PA 4AVVA 3KF3A 5C3SA 1TME2 2LW8A 1K42A 1CAWB 4YZ3A 1KQRA 2WBKA 4GB33 3PVOA 2VZSA 5D8AC 3VZNA 4QD2A 5A70A 1OVSA 3AVRA 3ZXDA 4CCLA 4YG6A 4AOCA 2PMWB 1LOFA 2Q4SA 4BJ0A 3E1F1 1LENA 4IV3A 1IPJA 4JKKA 2C4XA 5FZ6A 3W5NA 4YM2A 4M01A 2VMFA 3I2KA 3J8F1 1BMV1 3CDZB 5C6CA 1HJGA 2C6SA 4JGZC 4MSVA 1H8TB 1YLLA 2VO5A 1V0AA 2P3KA 3MUY1 5HCFA 1AXZA 1QJU2 2H0BA 1VB2A 1ST8A 4NAMA 4QB2A 4CP1A 2ES3A 1QWRA 2Q1MA 2WS92 3MFAA 2XBO3 1AR82 3N9LA 5ABJA 5C33A 5GLWA 4RQPA 2W3JA 1KJLA 1PGW1 1S2KA 1ND3B 2P34A 4PI2A 1Q8SA 2ZGMA 4BMEA 2XBO1 4GH4B 4D0QA 2WSVA 2NP0A 3SH5A 2FDJA 4FPHA 1H4GA 1VIWB 2RS53 2Z5WA 4I3PA 2PFWA 1Y7BA 5C3OA 2BNOA 1WKYA 5L9VA 1CJPA 4ES8A 3WG1A 4C91A 2E7TA 1YI7A 2JE7A 2ZABA 1EAH1 2ARAA 3H8XA 2D40A 3ZYJB 2R071 4B29A 5KBFA 4KWLA 4EWAA 1BLZA 1CX1A 5FYYA 1UIJA 1ZRFA 4S2HA 3HNYM 2X5IB 3UKVA 3AYDA 5GLZA 4XF9A 4EE2A 3VD9A 1VLNA 1IKPA 4AFAA 1ULPA 3BN6A 2VOWA 4MGSA 1Q56A 2WZR3 4DRVA 2XXZA 4QGMA 1O4TA 4CEYA 2GDFA 3T30A 4LHKA 4CP0A 5BNQA 1NCQB 2WZR1 4QXCA 2UU8A 5FZ0A 5FMDA 1S0FA 5FPVA 2ZBJA 3VBFB 1RUJ3 5CISA 1OBNA 1PVC3 1ENSA 4EJRA 5CVRA 1SPPB 2C9KA 3KS7A 4SLIA 2VQAA 1ZZ9A 5FUIA 1D4M3 2JDUA 3CJIB 4YZ4A 2YC2A 2BEOA 2ARXA 4BQ2A 2DVFA 2XVGA 2Y6GA 3GJAA 3LGRA 1H2NA 4HFSA 1UYZA 1X7NA 3NJVA 5FRAA 4ES9A 5BUVA 2OPKA 1AF9A 1NKGA 1AJOA 2OIIA 1DFQA 1RHI2 1DG6A 2R043 5T5JA 4NE9A 4IDZA 1MZFA 1W3VA 2Y33A 1ZZ8A 2ZJCA 3JB4C 1RUD3 1YQ8A 3WG2A 5LA0A 4Q4Y3 1W8TA 1GANA 4PF5A 3OBAA 4HETA 5FPZA 4U2AA 2VG9A 2W94A 2XJSA 3H1MA 1UY0A 2VOXA 3J7LA 5ANNA 5CFDA 3VUOA 2BDRA 5IVJA 3DV8A 2ID4A 5FAXA 3WNMA 3S0MA 1PK6A 1CJDA 1ZBE3 2BGCA 1FX5A 1ULEA 2FDFA 2PHUA 2ZCWA 2A3XA 3BYWA 5IT6A 1PO13 2RDQA 1WMFA 3Q8CA 2CDPA 4LBNA 2QZ2A 3PMSA 1AYN2 1S1AA 3WDYA 4IEWA 1ZBE2 1SHWB 1ENQA 2LALA 2Q8OA 1MVEA 3AZXA 3JU9A 4DEQA 3SMHA 1IPKA 5HXMA 3P3NA 3RWNA 4B8EA 3VKOA 4CTEA 4HL0A 4E2GA 4KGGA 4L9BA 1M4WA 3ITQA 2W2IA 3VBUA 4AQ2A 3BUCA 1HXS1 4E4HA 4CUCA 5KHGA 1AL22 3D6EA 1G8WA 5GZFA 2GZWA 3C2UA 1PMHX 2D6LX 3KV9A 1SBEA 3VB9A 1HIXA 2VOVA 2ZOEB 2PELA 5A7PA 5L36A 1POV0 1R082 2JDNA 3AMMA 3O12A 1NZIA 3VBOB 1WLWA 2ET1A 4DUVA 4Q4V3 4JC1A 4N9IA 5EP9A 3ZR5A 1IS4A 4AEMA 3JB8A 3FHAA 4DNYA 4OI4A 5FZ8A 2ZHKA 1ND3A 3LEGA 3OGJA 5FYZA 1NE6A 3OJBA 5L19A 4HVRA 3J7MA 2ZX2A 4BQ3A 3ZYPA 5F1RA 2XPJA 4DXSA 1SBFA 1XNKA 5JWPA 3WD5A 3IDEA 1H6XA 2X09A 3O1OA 3ZO0B 4H55A 3I2DA 2ZX3A 4Y26A 5C70A 3O0WA 3ELNA 5A7NA 1RUE1 4RGKA 4YYOA 1PGL2 5FXVA 2D6MA 5JSPA 2VZ1A 3AZWA 4RR3A 3USSA 5JSRA 1UU5A 2DYCA 4PIYA 2WZR2 1XU2A 5ISLA 1V00A 1NA1A 1AR92 2HWE1 3AZYA 1AYM1 3LIHA 4BH9A 1G9FA 1LGBA 4FPFA 3O1SA 3PTYA 3HJRA 4XFCA 4E8CA 1D2SA 2J1EA 5C8CA 5A32A 3FBYA 1QIQA 3E5QA 1LHNA 4JAAA 4HONA 3OEAA 3VBFA 3GCWA 5BYNA 2PQQA 4L8QA 1N1YA 2DTYA 3RDIA 1DYOA 2Y6KA 5E1RA 5GLVA 4B7EA 1PZ7A 1SDWA 4DY3A 4UOJA 5FP3A 2P3YA 3AKQA 2IFRA 2W08A 2QQNA 4CDQA 3RNSA 3O1RA 1DGWX 5A7WB 3WY6A 1RUH3 2DVAA 2WNVC 2BBVA 2JKXA 1YFYA 5A6XA 1JYTA 1ZX5A 2RS12 2ZTNA 4N53C 1SQ4A 2AEZA 1AR83 5FLJA 2VW1A 4AI3A 1RITA 2TEPA 5CNAA 4N9HA 4P9GA 4NWWA 3WCRA 2QQVA 5C9AC 3I3MA 1NOVA 3HT2A 1LAJA 1VBC2 3MLKA 4CU7A 2YG0A 3MBWA 3NJZA 4LIUA 1STMA 5T5LA 4HKWA 1C57A 1O8SA 1OOPB 2HWC3 4JZRA 3WG3A 1J1LA 1WGPA 2EIBA 1H8VA 3E6BA 4WVWA 4OI1A 1RUG2 4WM8A 3UGHA 1OT5A 1VBB3 2EXJA 3OUIA 3NNGA 3H50A 5BNOC 4QPIA 2G9FA 1YIFA 5I0SA 2QQOA 4P08A 1PMJX 1O4YA 2R49A 2UWCA 3CJIA 5E16A 3VDBA 4YW5A 4PHZA 3JZVA 5IW0A 3N9OA 1W8HA 5C71A 2J1AA 4JKLA 5LBEA 3N9MA 3DGTA 4IL7A 5JDBA 2LRPA 3DL3A 2CWSA 1DP0A 4YVSB 2D7FA 1APNA 1WMDA 4N8MA 1C28A 3LSDA 2ZGLA 2KR2A 2GP5A 4Z2WA 1CIWA 1O3RA 1S0DA 4QPGA 4YZ5A 1EUUA 1RXGA 1N3QA 1GNYA 3AM2A 5KXCA 1HQWA 2CU5A 4QQHA 5D21A 1PGW2 4SBVA 3WDTA 5BPXA 1T6GC 3Q8BA 4KWJA 2RS11 4Q0SA 4G3YC 2ZGSA 1EYBA 2G1MA 2IWGB 2YYOA 1YFXA 1C8NA 3ZN5A 5I93A 1LU1A 5CYYA 5K0UB 1Q5OA 3M8LA 1KD7A 4NAOA 1QJEA 4NROA 1HB4A 3I2IA 5F37A 1QJFA 4P02B 1XOYA 3PHMA 4JTOA 5IATA 1MZ6A 4A3ZA 2ZGKA 2VVEA 4I01A 3SEPA 1F2NA 2BP6A 4K3UA 1WW4A 3T2OA 1VBA2 2MEV2 1K5MC 1NY72 3NV3A 3RVHA 3HQXA 2R042 2XJPA 5CFCC 3MW4A 5K0UA 2JENA 2JX9A 3I59B 2WS93 3PUHA 5DABA 3SKVA 1ZVFA 2ZHLA 1ODMA 5FKCA 3J26N 5JIAA 4OQ9A 3W59A 2E51A 4OYUA 4CCJA 1B35C 1LEMA 1RMU1 3WF2A 1OFSA 2F17A 1PK6C 3JD73 3VZJA 1HW5A 2JB8A 1YYNA 1SFPA 3HNMA 1LHUA 4AHWA 1H6YA 1REFA 4MHRA 1URXA 5JR7B 3CZJA 3JCIA 4LA2A 3VHNA 2EXHA 1XBFA 2NPIA 1MS1A 2DV9A 3ZIWA 1JU4A 3K3NA 4WZCA 3ZSLA 5T54A 1KJRA 5EFUA 3QBQA 3WDXA 1RUD1 4ARYA 2PHRA 2WIIB 3FX3A 2DVBA 1DQ0A 4MYEA 5J09A 2E32A 4OHVA 5JOYA 1VBE3 1CPMA 1JW6A 2HKXA 4QXHA 1NXD1 1UYXA 1NQJA 2B4KA 2JG9C 1LOCA 3AJYA 5A6ZA 1VBD1 5A80A 1MZEA 4LT5A 4FFFA 2OT7A 4GWNA 4LMFA 4KWUA 2E7AA 5GKAC 3QH6A 1GKBA 3S5QA 2VZUA 4WZFA 4CP9A 4P14A 1AL21 4EN9B 2WZPP 1RUJ2 2VVDA 5DAPA 4MVTA 4JX0A 4NO4A 5FYIA 2ZGPA 4A41A 1IS3A 1IG0A 2D44A 4TWTA 1OHFA 4RS5B 5KXDA 2FDGA 4LKDA 5KHIA 5IJRA 1SLIA 5ACA1 1KRIA 4EN0A 1COV3 1RUI1 4TLFA 1ONAA 4IGOA 4NRMA 4CP2A 4K7JA 1W9FA 4BMBA 5FMOL 4A7YA 5JPMB 1F9KA 3OCPA 1LHVA 2WUHA 3B9IA 3FL7A 1UAIA 1W8ZA 2OXBA 1XNAA 3GBGA 5C7GA 1PX3A 3I3QA 4XFAA 3P3PA 3USUB 3MF6A 4BIFA 3OBTA 4XZPA 4BIOA 2JXAA 5C8CC 4LO6B 1U0AA 5CAZA 2YGMA 1LOGA 1F4HA 1BBT3 4YW3A 1V6LA 4CEWC 1E5SA 1ULDA 3P6BA 3POGA 1YFUA 1V9U3 2B42B 3UGFA 1POV3 2BPA2 1LNSA 3PLQA 4CDWA 2W1QA 4XJ9A 1ND2B 4CCKA 3F95A 4G4FA 3TNPB 2VUDA 1POV1 4CXYA 4BB3A 3MIHA 5FY8A 4CEYC 4LTAA 2Y26A 5C5UA 5LWBA 4QPIB 3UESA 2AR6A 5J37A 4COUA 3IDCB 3J8F3 3RYPA 1O3QA 3LD8A 4UI9L 1AYM3 4NR1A 3VHOA 1CN1A 4QKFA 1GBGA 4A3XA 5EWSA 4J25A 5JCTA 4YW7A 2WNOA 1XE7A 3V56A 2A7AA 2VULA 1W8NA 3AP5A 3SC7X 3HNBM 1JHNA 4CUBA 5I8YA 3KHCA 4NUBA 2VMEA 3DXUA 4MADA 2W39A 3BGAA 2Q1ZB 3HMYA 1OQ1A 2H0VA 4YW6A 3K4DA 3ON7A 4AQ6A 1LHOA 2JDYA 4ISQA 4IXLA 2IFWA 1UOJA 2QJVA 2ARBA 5L7OC 3T2QA 1DYPA 3I3EA 5FZEA 3ZSJA 5FOBB 3IKWA 4X8PA 3PJQA 5L73A 1PK6B 1RMU2 4L11A 4AI0A 2R1DA 1W99A 4LJHA 1LOBA 3DYOA 3UJOA 5FO8B 5HV0A 5FOJB 1JYCA 1ZREA 1FPN3 2E53A 2GMPA 3IDAA 1WBFA 3I2HA 1UY2A 4FP3A 4XJAA 1GOGA 1VBE2 5FIXA 2D43A 4BXSV 3F2ZA 3TNQA 1R1A2 2H6BA 5FBZA 4XF3A 4XC9A 5HPOA 1VBB2 4UFHA 1J58A 4ITCA 5LBBA 1DQ2A 1UL9A 1ZZ7A 2RDNA 2DBIA 1F5FA 3KCYA 4J1XA 4LHSA 4Z82A 1UO9A 3WHTA 3ST7A 3ZFEB 2HWC1 5JR2A 1GUIA 3NO8A 4QU2A 2VM9A 1WCKA 2DCTA 4PIZA 2AZ5A 1OOPA 4UFIA 2FCVA 3BTXA 5ACA2 4KG8A 4UFJA 1S0CA 4WM7A 3J8F2 3PIJA 5T55A 2MNGA 1CZSA 3RQ0A 2RJ2A 1X8MA 2IXKA 5T3NA 3VD3A 2VD7A 2O14A 4B3NA 4XUNA 5LATA 1J84A 2V5YA 4ZU4A 1HDKA 4RS5C 1PNGA 3MIEA 3OTFA 4UW4A 5LEJA 3RZMA 1HRV3 3GALA 1LEDA 1CVNA 1DF0A 3GZUC 4DMIA 3RWKX 2AH2A 3E5XA 4Q4X3 2BU9A 3HN1A 2ZGNA 1SPPA 4GB32 2YUEA 3LWCA 2B9VA 2VQUA 4IV1C 1ZBE1 4HSJA 4YM0A 2A3WA 3OGSA 1SDDB 3PVBB 2RVAA 4NJ4A 2Y64A 3X29B 4OQ8A 1NYWA 2VVFA 4CDWC 1QXRA 2WN2A 1VBA1 5GALA 4KL1A 3LEMA 4M0HA 4KU8A 5FYBA 1OD3A 3GBFA 1US2A 1GOFA 5C8CB 1LJ7A 1PO22 1HXS3 1PO11 5D8AA 1Z0HA 4K20A 3HT1A 4LBQD 2NLRA 3ZYGA 2WLPA 2X8KA 3B69A 1LOFC 3PURA 1OLQA 2W9XA 2DTWA 4D7TA 1CESA 4N53B 1IQAA 3M4FA 4Y4RA 3AMHA 4LLFA 3S6PA 3WP4A 4L92A 1G9AA 4IEOA 3ZX7A 5CG8A 3OD0A 1RUE2 3HBKA 1W9SA 1R091 1SLBA 2RR11 4XUPA 3BOWA 3M3CA 3WQ0A 1VAKA 2BNNA 3H7YA 2IXHA 2XOMA 4RQPC 1GP6A 1GU3A 4CXXA 4JHZA 3LDKA 1MS5A 3QACA 1ZZBA 2BERA 3FJSA 1U5ZA 2I45A 2UYAA 3NL1A 4CU8A 1VRH1 3UKTA 4AL9A 4AE2A 4EWEA 1BMV2 2BGOA 1LOAA 5A3MA 5FQ0A 1Q8VA 2Z69A 3BTYA 2J7MA 5DZEA 3D5OA 4XBQA 4L2NA 4BCUA 3SISA 1P8JA 2YY1A 1LTEA 4CYDA 5TSWA 4DFSA 4MHUA 5C4WC 5I8TA 4NOTA 3UGGA 4FFIA 3IMNA 1NG0A 4FPGA 1Q3EA 2EIGA 4YFZA 4ASLA 5EIYB 1Y3TA 2GSYA 2ZMLA 5JLVA 2D5FA 1CIYA 2KM2A 3JXSA 4K8RB 1T6BX 4MLOA 3SXWA 2QBXA 1C5HA 1NLSA 4HANA 4HXCA 2FDHA 5F3GA 2R7EB 5D2AA 3MYXA 4OUMA 4BWOA 1ZRCA 1TG7A 2QQMA 3M3OA 2VBPA 3N7JA 1YUDA 5FK8A 2OVUA 1QJY2 2FDKA 3K4ZA 3OPTA 2WZEA 2WZ8A 4AVCA 5FJKA 1L7RA 1X9PA 4CCDA 4LIVA 3GJBA 4LULA 4Q27A 1NCQA 2Q30A 4FPEA 3POSA 1C8M3 1Q8OA 1AR81 1UXXX 1YQCA 3IN9A 4IE7A 4JGYC 5F3IA 5FYTA 4CEWA 4FOVA 4GA9A 4YNIA 1MZ5A 1PM7A 3FLTA 2LTNA 1WD3A 4E8DA 1GV9A 1Z7S3 2BW8A 2XWBB 4XIKA 4WVMA 4MGTA 1UD1A 2LM3A 1ZZ6A 5APAA 1MS9A 4NHLA 4XCAA 5H9PA 2HBUA 4KBZA 1BEV1 5A3UA 1UQXA 5CEHA 2X10A 3D0JA 3U37A 1HV1A 1TE1B 3BU7A 1T2XA 3USUA 3W58A 3LDRA 3N3HA 3TEXA 1DIWA 1I5PA 1GQHA 3CHXA 3GHNA 4Y1YA 3VZLA 2DCKA 1AZDA 1WW6A 3NSTA 1ODNA 4I30A 1XNTA 1VBB1 4P9WA 4BZ4A 1W04A 3C8XA 5KC5A 4CCEA 1B35B 4XMIA 1JZ4A 5A33B 2ZAAA 2QQJA 4ZXKA 4LKSA 3RZLA 5JVVA 4LBOA 1AYM2 3LF7A 2VTXA 4YRDA 1MS4A 1KFXL 4V2VA 2HWE2 5C9AA 2QCSB 4XZUG 5A7QA 4P9LA 1O6UA 1EY2A 4YGCA 2VXRA 2JECA 3U07A 4CCCA 3VBSB 2WFF3 1QY4A 2CYFA 2YPJA 4FTEA 4COVA 5DN2A 5L9BA 5CBLA 4YG0A 4MOAA 4W6YA 5DQ0A 4TXWA 4PQQA 1ENRA 4IEUA 3H7JA 4FOQA 4LA3A 5GLTA 4LXLA 2P2KA 4XQ4A 5L9RA 1ASJ3 1B35A 4FFGA 2A70A 5A3LA 1H4HA 4E2SA 4GMP3 3OUJA 3MIDA 2WT2A 4IEYA 3WDVA 3VN4A 2GMMA 2RS51 4GH4C 3P5BA 1YCIA 1Z78A 2CL2A 4IGQA 2WR9A 2W91A 5A32B 4AG4A 4WVVA 5DUWA 1LECA 5FLHA 1L7QA 1QGLA 3ATGA 4PDWA 4UW5A 4YARA 1UPIA 2RS13 5FZOA 3FUQA 2QUOA 3DPRC 2DF7A 2FD8A 3HWJA 3V65A 2R061 2PHWA 1UYPA 1CAUA 2YZ4A 5E8AA 1AR63 4B4QA 5LB6A 4C1WA 3GYDA 5C4WB 3NNFA 4QQPA 2XJRA 4EV0A 3UK9A 1CAWA 4NIHA 4GQ7A 3NMBA 1W8FA 4Z1VA 2A6VA 2OA2A 2D93A 1RUD2 2FZ2A 4M4RA 5LZ6A 2FDIA 1CZTA 3FBMA 3MIBA 1H0BA 1MR5A 5FPUA 1UYYA 2HWB1 1HXS2 1OSGA 3IWZA 5K7PA 4AAPA 4Y22A 2BGPA 1CAUB 1UXZA 1LCLA 4AW7A 4CXWA 3R0RA 3WR0A 1ZRDA 4Q0QA 3O5SA 2VNGA 4LBJA 4LHNA 4WM8B 4MZUA 1OQEA 5DUXA 2PAEA 1AYN1 3W21A 3JD71 1DLLA 2D6NA 2OQ7A 3VHRA 3IB3A 4NIGA 4QB1A 3CU7A 4XIOA 2WN3A 4O61A 5GLUA 1K5MA 1YC61 3OPWA 5DG2A 3VBHB 1VMHA 3O0VA 3Q9OA 1Q8PA 5EYXA 2XQRA 1WW7A 4Q4Y1 2XG3A 5FY1A 2ZEXA 4AGRA 1E5RA 4CDUB 3Q8EA 1N3PA 4Q4X1 3K51A 1NE4A 2BWAA 4LK7A 4O65A 3EYPA 3N9QA 2HBTA 1JOBA 4JCKA 4C0HA 4Z2AA 4KG0A 4ZZ5A 4LPLA 4ONUA 3EB7A 4NRQA 2ZZJA 3NV2A 3POWA 2K0GA 5FYUA 1JHJA 5A3WA 3I97A 1JZ5A 1NZCA 5FY5A 2WQ8A 2ZA9A 1JMUB 3KLSA 4LOTA 3NQHA 1KITA 5A7WA 1PVXA 4IGPA 2YMZA 3BALA 3E5UA 4LKFA 1UY1A 1SFNA 4YGBA 3UKNA 1HRI2 3ORJA 4RGAA 3U75A 1AHSA 2X53S 5CADA 4S2FA 1HB2A 1X8EA 2EIEA 3WCSA 5GJ6A 4JQRA 5IK7A 2W47A 3E6DA 3BIEA 2QDRA 2P17A 2J1SA 3GHMA 3OBZA 5F6LB 2KA3A 2A6XA 4K1YA 3A4UA 4XABA 1H8TC 1UCXA 2R0HA 3RS6A 4AQSA 5A6QA 2D98A 5LW9A 1A34A 1EP0A 3SCFA 4GH4A 3IIIA 3I2JA 4Q5OA 3RJRA 3AYAA 1GP5A 1SLTA 1XC6A 2DU0A 2XL7A 3GZTB 2YC0A 4KGQA 1HQLA 3DYMA 5A3OA 2BTVC 4AYUA 1C4RA 2YB7A 4Y22B 1W6MB 3D4KA 4GB31 4XJ8A 3VDCA 5HI0A 1O3SA 2OZJA 1F8VA 5L7OA 1XSQA 4PDWC 3WNPA 2WC2A 4ET7A 3WLUA 1DYKA 2GAUA 2VNRA 3IPVA 4MH0E 4OCTA 3HD8B 1NAEA 4QM8A 5J98B 3B01A 1MEC2 4YGDA 3MGUA 3ZKUA 4QGNA 1NT0A 2WQZC 4A6OA 1DQ4A 1WCDJ 2YBKA 4A4AA 1ULCA 4LOSA 4BXFA 1IZ3A 4XQDA 1E5HA 1RHI3 4OUSA 3U4SA 4Y1XA 5FWJA 1YFWA 3NKTA 1JI6A 2JDPA 5BNNC 1MS3A 2PN5A 3LA7A 1RHI1 4R4XA 3RI9A 1QDOA 4RYDA 1NLQA 4FQZA 4C90A 3IM0A 1OLMA 3CL1A 1QH7A 1RGSA 4INDA 1FNYA 1QEXA 2K2SA 4A44A 2RS32 3ZIXA 2XWJB 4QKNA 1RJ7A 4AHXA 3VKNA 1FNZA 2ERFA 2O1QA 3NWKA 4LO4B 5SV5A 5J48A 2YXSA 3B02A 5FZDA 3TOJA 5JXJA 2WFPA 1OKOA 2TNFA 3TN91 5C9AB 1Y9MA 1JZ7A 4Y1UA 2XR4A 3ACFA 3TN93 2VY0A 3KV4A 1HB1A 2RMU2 3LPGA 4LBMA 4XW3A 3VDAA 4FAHA 1GZ9A 5GZEA 1GLHA 1W6QA 4XOGA 4BQYA 2F6BA 1LHWA 1UNBA 2WSUA 3NRUA 1WA4A 3THPA 1OFNA 2ZPXA 2Q8CA 4QXKA 4QPWA 4F83A 1DHKB 3IZOA 4CDXA 1JZ8A 4XF0A 5SV8A 2X05A 3NAPB 5JI7A 3ILRA 4XURA 1VALA 4TLGA 4QU1A 1Z7S1 4RN5A 5DXDA 3RGBA 4ARXA 4DY5A 4W50A 3BU0A 2YBPA 1O4ZA 3VBFC 5HCHA 3MW2A 3N9NA 1W2TA 3DCQA 5JMOA 3R4UA 4K40A 3QLQA 4CUAA 4NPRA 3I2OA 3ZYHA 1UX7A 1PVC1 5F5QA 2XJQA 5C3PA 5I0RA 2UY9A 1CPNA 4Q29A 1HV0A 1HN1A 5CFDB 3KVAA 1V6JA 4QGLA 4Q4W3 5IAXA 1J3PA 2MEV1 1F4AA 1CZVA 2CSGA 2WKKA 3JUUA 5FY4A 1V6KA 1W06A 1BQPA 4C1XA 4RGGA 3H3UA 2WT0A 4P5YA 3KCXA 3POBA 4N53A 4QB6A 1ZBA3 3NAPA 4RFT0 5FZ3A 1W3XA 1NA1B 2H6CA 3AVSA 1LU2A 1W39A 3Q8FA 3VBUB 4BK4A 2CWMA 2VOTA 1FMD2 3ASIA 1SCRA 1N1SA 3FFQA 1ZM1A 1XB9A 2VXJA 4HPKB 3ZN6A 5H9RA 5DMYA 1AX0A 2ZMKA 3ROUA 2EICA 1D0GA 2OS2A 1EV12 3C7GA 4B4RA 5FQ0B 2Q1FA 4I3GA 2GU9A 1DU3D 2F4LA 2Z4FA 3ECQA 3WT3A 3T0DA 5EV7A 1UKRA 3ZMOA 3THDA 2JG8B 4XE9A 5EYYA 3VBOC 3G7DA 1RUC2 1ASJ1 3E97A 3LE0A 1QU0A 5FZOB 2C0ZA 5FYMA 3N35A 4BLJA 4AAXA 2P1BA 2Y6JA 1W6PA 2RM21 2XH6A 3AK0A 4RD7A 4HG6B 1QOOA 2VTFA 4META 3NV4A 4WM7B 3TB0A 2WRAA 3CBNA 1UZWA 3ZPYA 1WCQA 3RZKA 3FLPA 2QZ3A 4XTMA 4BQ5A 5GZCA 3FZ3A 1LODA 3GZEA 1OA4A 4K21A 3VD7A 1H2KA 1SMVA 5LA1A 3KGZA 1W28A 2VGDA 5FZMA 5IVVA 4LITA 4N90A 1V9U2 4QX7A 3OD4A 5JI9A 3FC0A 4LO8A 3IMMA 2FZ1A 1W6NB 1W0NA 4R8HA 3EJKA 5FXWA 3KD4A 4OI2A 1G86A 4TZDA 2BRTA 4XPVA 4LBQB 5IUQA 2Y0IA 3V0AA 2GC3A 3ZFGB 1H9PA 1RINA 2GH8A 4IEZA 4XQWA 2P3JA 4BDVB 1H1AA 3ZSEA 3LKJA 3WZ1A 2BOJA 3POEA 5HV4A 3DN7A 3I4IA 1WLCA 4CDXC 2HWB3 2WWUA 2YGLA 5FCCA 1EPZA 1FXZA 1O8PA 4NMIA 3I8TA 1MQTA 1LGCA 3FE5A 5B4NA 2NMOA 3MDPA 2IVJA 2Z2SB 4YVWC 3KT7A 4Q8KA 4Q4Y2 4JTNA 2WYSA 3KMHA 4UFLA 4NIAA 1R092 2R6QA 4NIIA 3PVEA 1ZZCA 4GD4A 5FR3A 2V72A 4R9BA 5FV3A 5HCBA 3T1LA 1I1EA 4AI2A 3O1MA 2V09A 3EBRA 1XNDA 2BZDA 4M4PA 1POQA 5ABJB 1TZOA 4NVPA 5JOWA 3EXUA 4KQ7A 2IXLA 1AR72 3B9CA 5C3RA 3EHKA 5LA9A 2C26A 3T1MA 2N7GA 4DPNA 1O5LA 1JZ2A 3MPPG 4BPZA 4CPBA 1RVF3 2PLV1 2E6VA 4QKDA 4KI5M 4AF9A 2FMDA 3OF1A 4XYXA 4YPJA 3M3EA 1NCRA 1BK0A 4AEDA 3UL2A 2GNMA 2E26A 4UBHA 4BA6A 3WXPA 5FZ1A 5JZGA 1WLTA 3ZFFB 4KH9A 2OW4A 2Q0AA 4W65A 2A6YA 4UYBA 4YG3A 4K1ZA 3J7HA 1BZWA 1A8MA 1F31A 4KNCA 1AR91 3TWIA 2UWAA 4GJYA 3A22A 3ACHA 1VRH2 5J96B 2X5IA 2YFUA 4E4DX 2AC1A 1COV1 1RUI3 3T0AA 5DG1A 1FMD1 4Y33A 1PGSA 2GMEA 4GJZA 1JTZX 1X82A 1YIPA 1W8OA 4UT5A 3WQBA 3ZDVA 4XMAA 4U36A 1ACCA 4ATEA 1BKZA 3VGIA 1UW8A 2KXLA 4Y24A 2JD9A 3C3VA 3D0SA 1U12A 3M70A 3LDBA 1BBT1 3ETQA 4RL7A 3ZM8A 4IV1A 2HLEA 2JG8C 3GBWA 3H9AA 4KWKA 3JBG1 3WEZA 4CVUA 4LBKA 4FXKB 1DGRA 4NHMA 5F6KA 2HWD2 2XLGA 3K48A 5BXXA 2ZGOA 3GM8A 3AP6A 3WSOA 1KS4A 5LRSA 5IAVA 1AVBA 3VL9A 3T08A 5IHRA 1SEFA 1VRBA 2HWB2 4EQVA 1KFUL 1TEIA 1MACA 1W0OA 2AEYA 2VH9A 4AVTA 3JQXA 3RZZA 1U5XA 3BI3A 4Y4YA 3LFMA 4LO5B 4GKXA 4D3WA 4H2AA 1DZRA 4QPYA 2WO2A 4YVSC 1CX4A 2VNVA 4FOWA 3SNMA 1W8UA 3I2GA 5IFPA 2VAUA 2GN7A 2ZGUA 1FV2A 1N3OA 1OVPA 2B8MA 3VZMA 5AVPA 5FZLA 4ASKA 5KWRA 3ZXEA 5DAWA 5CA6A 5JOZA 4EN7B 4NRPA 1ALYA 5JOXA 1VB4A 2JWPA 4EWDA 2Z79A 4MX3A 4AK3A 2XGXA 4CCOA 3ILFA 4BQXA 3VDDC 3FN9A 4QDQA 5G05L 5K0UC 5CZKA 1D2QA 5FREA 4XJWA 4XJUA 2R063 2HYXA 2ZX1A 5T5OA 5FMBA 1BHGA 1S4CA 4BU2A 5FYVA 3NNLA 3PUSA 2EVXA 3OPZA 3L9JT 4D7SA 4FPLA 5AFEA 5FZIA 2ZKLA 1TNFA 1UY4A 2DUQA 1AR61 2QDNA 3LCPA 3DEMA 4MO3M 3ZN4A 4ASMB 4AVAA 1ZNPA 5AC92 3PTRB 2YBSA 1KGYA 2JKBA 1XU1A 1R1A1 1GNHA 1V6NA 3OBRA 4FTBA 3AFGA 2ZGRA 4P9YA 1XSRA 1YI9A 2Y38A 4URAA 3DPRA 3JD72 5FXZA 4P5HA 4PDWB 1F5JA 1SCSA 1VAVA 4XFHA 3ZMNA 3PUAA 5FZGA 1D4M1 2I74A 2QQLA 2ARCA 3M1HA 4RR3B 1Y9QA 3UT0A 1DDLA 1AYN3 3OG2A 1Z7S2 4GWJA 3ZFEA 4AFDA 2XL9A 4XFIA 4GALA 1N47A 1A8DA 4DB5A 2B39A 2P37A 3LOIA 2YU2A 1BYHA 4CUGA 2PHXA 4ZZ8A 3AKPA 4AEJA 4JGYA 2VMDA 1S0EA 4A42A 3NW4A 3B00A 1DCSA 2GC2A 3H3LA 3PL0A 1C3HA 1HRI3 4MGZE 3E6CC 3FMGA 3A0KA 1EUTA 3ACLA 2WL1A 2RMU1 1J3RA 3J7NA 1WW5A 3MLLA 1F35A 4IESA 3O1TA 1JS9A 1LB2A 4OULA 3WF0A 5DAXA 1O3TA 1FOD3 3AP9A 1OKQA 3EMRA 3WP5A 4LUMA 2TBVA 5K8SA 2XBO2 2ZXQA 1YEWA 2VW0A 1OH3A 1OD5A 1FOD2 4F3JA 1FATA 4ZPIA 1V6IA 3SEEA 3AKSA 3WQ1A 4Y20B 1QH6A 1JYIA 4CDQB 3QCWA 1NUKA 1WCUA 5ACA3 2E7QA 1YO8A 4LK6A 1UU6A 4QKBA 1GZWB 3ZYBA 4FBFA 4B1MA 2J1TA 1SLAA 1YRZA 3HBZA 3PMEA 4V1PA 1PVC2 2VECA 2A6ZA 1XYPA 4IUGA 2J1UA 1JUHA 1UOFA 4AZZA 4OLLA 3GCXA 3MV01 4Y20A 2Y0OA 3CLPA 1D4VB 2A1XA 1MQTB 4EZHA 3ZFGA 2B45X 5I8SA 2QQIA 2VMGA 3BIWE 5FFOC 1OA3A 4MGKE 5BNPA 3A21A 3ZXFA 4JDNA 2R072 1YJKA 4N7IA 2YC4A 2XVLA 2A71A 1AR71 3AXDA 4Y5TA 4YW1A 1TMF1 1I3HA 4ATFA 5IVCA 3POJA 4B7KA 4ZKTB 5BNOB 1RUI2 1RUE3 3ENRA 1VRH3 3KT1A 1WBLA 5B4XA 4PLMA 4DIQA 5LBCA 1KEXA 1MEC3 3O14A 2XLFA 3MIFA 4IETA 4UXAA 1B09A 1VBC1 2VZOA 4JDMA 3N36A 4M00A 3DECA 4P9IA 5FK7A 4QHZA 3VHPA 3ZXLA 3BPZA 5LY1A 1SACA 2DBNA 2AGSA 4IEVA 2I2SA 4QX3A 1AXKA 4OHWA 4R9CA 4HLTA 2WQ4A 1V6OA 2SLIA 2YFZA 1OLRA 4QDRA 4L97A 3TEWA 1DGRN 1W8WA 4HZFA 1YQ5A 4F8AA 4YLZA 3O1UA 2ILMA 3IIAA 1I6XA 4JVAA 2K9ZA 3R6SA 3THTA 4QPGB 2CHHA 4WV8A 5J1XA 5FZ9A 4AXOA 3R4SA 2D6OX 3T0BA 1CAXA 1UKGA 2AUYA 2ZX4A 1QMJA 1YQ2A 4LHLA 5EHDA 3ZFEC 3URFA 2VUAA 4M3CA 1QJX3 2JG8A 5EXOA 3LFIA 2WO7A 2AREA 5FKBA 1QJX1 2VMCA 1N1TA 4QQ2A 2GALA 2V73A 3Q8AA 3EQEA 3SH4A 1UU4A 2B5HA 2Y6HA 2VPVA 1OA2A 4AFBA 2OX0A 2ZEZA 4PCRA 5H9QA 1GYKA 5B2GB 2ZMNA 4OI0A 1GNZA 4Q0UA 1W9YA 4NHXA 4XHBA 5IK4A 2XLAA 2V4AA 3L2HA 1CAXB 1K5MB 3OOXA 1ULGA 5LASA 3W9AA 3KV6A 4E4ZA 2PXJA 4E2QA 3ZXGA 4IERA 5EPAA 4PT6A 4BQ4A 2WNUB 3VBRB 2UWBA 3VZOA 2P5BA 4CE8A 1TME3 4DXTA 5DDJ3 2FBEA 2ZHMA 4OZXA
chains in the Genus database with same CATH topology
4D6RA 5FZBA 4D6QA 4C8DA 4GAZA 2OS2A 2XMLA 5FP8A 3LDBA 3U78A 4EYUA 4TN7A 5IW0A 3N9OA 4UF0B 3N9MA 4V2VA 5A7OA 2W2IA 3AVRA 5FYHA 5FYBA 5A7QA 4CCLA 4E4HA 5A3NA 5LW9A 4QX8A 5FZOB 5FYMA 3KV9A 2GP5A 1VRBA 5FZ6A 3UYJA 5FUNA 4QXBA 3PUQA 5A7PA 3PURA 5FY9A 4CCNA 4Y4RA 3PU3A 5FZCA 4LXLA 5FZ8A 5IVFA 4EZHA 4CCKA 5FYZA 3N9LA 4XDOA 5F2SA 5IWFA 5FY8A 5LWBA 5A3PA 4IGQA 4ASKA 5FZLA 4BISA 5IVCA 5F3CA 2YBKA 5FZMA 4LITA 5IVVA 3LD8A 4QX7A 4BXFA 3PU8A 5K4LA 5A1LA 3DXTA 3U4SA 5F37A 5FWJA 5LY2A 4DIQA 4XDPA 5FXWA 5FZFA 4CCOA 3NJYA 5FZOA 4CSWA 5A7NA 5FYCA 3KV5A 3K2OA 5FXVA 4NUBA 5LY1A 4CCMA 3ZPOA 3DXUA 2Q8DA 5ISLA 5FWEA 5FY0A 5FYYA 3RVHA 3AL5A 5ANQA 2GP3A 5FZDA 2Q8EA 2WWUA 5FPBA 3K3OA 5FY7A 3PDQA 4V2WA 4BU2A 5FYVA 4HOOA 5FZEA 5KR7A 2YPDA 3PUSA 4CCJA 3KV4A 4HONA 2XXZA 5FZIA 5F5AA 4DO0A 5FZ9A 4QXCA 5FZ0A 5FUPA 4Y3OA 5FZ4A 4GD4A 5F2WA 5FPUA 5FPVA 5FV3A 2Q8CA 5FZKA 3PTRB 2YBSA 4AI9A 5FP3A 5A3TA 4AAPA 5F3GA 5FZ7A 4QWNA 3K3NA 5A7WB 3KVBA 5F5IA 5FJHA 5A1FA 4QU1A 5F39A 5FP9A 5FPLA 4URAA 5FP4A 5FXZA 3OPTA 2YBPA 4EZ4A 2OQ7A 5FZHA 3PUAA 5FZGA 2XDVA 3N9NA 5FYSA 4QXHA 5FJKA 4LIVA 2OX0A 3OPWA 5FZ1A 4UF0A 5A7SA 5A80A 5IVEA 5FYTA 5F3IA 5FY1A 2OT7A 3KVAA 5F5CA 2WWJA 2OQ6A 5FBJA 2XUEA 5FP7A 2YU2A 2VD7A 3N9QA 5FY4A 4LIUA 5FZAA 4GJYA 4CUGA 2YU1A 5IVBA 3KV6A 5E6HA 5F3EA 4D6SA 3N9PA 2PXJA 5F32A 3AL6A 5FZ3A 5FYIA 5FYUA 5CEHA 5A3WA 3AVSA 5IVYA 5FY5A 4Y33A 5IVJA 2P5BA 4GJZA 3ZLIA 5A7WA 5FXXA 4IGPA 5FPAA 4IGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D6R A;  5FZB A;  4D6Q A;  4C8D A;  4GAZ A;  2OS2 A;  2XML A;  5FP8 A;  3LDB A;  3U78 A;  4EYU A;  4TN7 A;  5IW0 A;  3N9O A;  4UF0 B;  3N9M A;  4V2V A;  5A7O A;  2W2I A;  3AVR A;  5FYH A;  5FYB A;  5A7Q A;  4CCL A;  4E4H A;  5A3N A;  5LW9 A;  4QX8 A;  5FZO B;  5FYM A;  3KV9 A;  2GP5 A;  1VRB A;  5FZ6 A;  3UYJ A;  5FUN A;  4QXB A;  3PUQ A;  5A7P A;  3PUR A;  5FY9 A;  4CCN A;  4Y4R A;  3PU3 A;  5FZC A;  4LXL A;  5FZ8 A;  5IVF A;  4EZH A;  4CCK A;  5FYZ A;  3N9L A;  4XDO A;  5F2S A;  5IWF A;  5FY8 A;  5LWB A;  5A3P A;  4IGQ A;  4ASK A;  5FZL A;  4BIS A;  5IVC A;  5F3C A;  2YBK A;  5FZM A;  4LIT A;  5IVV A;  3LD8 A;  4QX7 A;  4BXF A;  3PU8 A;  5K4L A;  5A1L A;  3DXT A;  3U4S A;  5F37 A;  5FWJ A;  5LY2 A;  4DIQ A;  4XDP A;  5FXW A;  5FZF A;  4CCO A;  3NJY A;  5FZO A;  4CSW A;  5A7N A;  5FYC A;  3KV5 A;  3K2O A;  5FXV A;  4NUB A;  5LY1 A;  4CCM A;  3ZPO A;  3DXU A;  2Q8D A;  5ISL A;  5FWE A;  5FY0 A;  5FYY A;  3RVH A;  3AL5 A;  5ANQ A;  2GP3 A;  5FZD A;  2Q8E A;  2WWU A;  5FPB A;  3K3O A;  5FY7 A;  3PDQ A;  4V2W A;  4BU2 A;  5FYV A;  4HOO A;  5FZE A;  5KR7 A;  2YPD A;  3PUS A;  4CCJ A;  3KV4 A;  4HON A;  2XXZ A;  5FZI A;  5F5A A;  4DO0 A;  5FZ9 A;  4QXC A;  5FZ0 A;  5FUP A;  4Y3O A;  5FZ4 A;  4GD4 A;  5F2W A;  5FPU A;  5FPV A;  5FV3 A;  2Q8C A;  5FZK A;  3PTR B;  2YBS A;  4AI9 A;  5FP3 A;  5A3T A;  4AAP A;  5F3G A;  5FZ7 A;  4QWN A;  3K3N A;  5A7W B;  3KVB A;  5F5I A;  5FJH A;  5A1F A;  4QU1 A;  5F39 A;  5FP9 A;  5FPL A;  4URA A;  5FP4 A;  5FXZ A;  3OPT A;  2YBP A;  4EZ4 A;  2OQ7 A;  5FZH A;  3PUA A;  5FZG A;  2XDV A;  3N9N A;  5FYS A;  4QXH A;  5FJK A;  4LIV A;  2OX0 A;  3OPW A;  5FZ1 A;  4UF0 A;  5A7S A;  5A80 A;  5IVE A;  5FYT A;  5F3I A;  5FY1 A;  2OT7 A;  3KVA A;  5F5C A;  2WWJ A;  2OQ6 A;  5FBJ A;  2XUE A;  5FP7 A;  2YU2 A;  2VD7 A;  3N9Q A;  5FY4 A;  4LIU A;  5FZA A;  4GJY A;  4CUG A;  2YU1 A;  5IVB A;  3KV6 A;  5E6H A;  5F3E A;  4D6S A;  3N9P A;  2PXJ A;  5F32 A;  3AL6 A;  5FZ3 A;  5FYI A;  5FYU A;  5CEH A;  5A3W A;  3AVS A;  5IVY A;  5FY5 A;  4Y33 A;  5IVJ A;  2P5B A;  4GJZ A;  3ZLI A;  5A7W A;  5FXX A;  4IGP A;  5FPA A;  4IGO A; 
#chains in the Genus database with same CATH topology
 1O5U A;  4DEV A;  1IPS A;  2WAA A;  4FPY A;  3LB9 A;  3WIN E;  2AAC A;  1RTV A;  1V6M A;  5BY5 A;  2E9Q A;  2CAU A;  5FP8 A;  3WF4 A;  3U78 A;  1ZBA 1;  1KDK A;  1OPO A;  2NQY A;  2EF6 A;  1X9T A;  2D6K A;  1I9R A;  4XUO A;  1GZC A;  1XRU A;  1HRV 1;  2GC0 A;  3U0Z A;  1WA6 X;  4A6S A;  3WW2 A;  2BYV E;  2PHF A;  2WFF 1;  1BVP 1;  1F15 A;  3OYW B;  4M0N A;  1W9W A;  3LA2 A;  3VBS C;  1LKN A;  1A78 A;  4XEZ A;  5AC9 3;  1KXG A;  3HQR A;  3IDB B;  4B1L A;  2HYK A;  3INA A;  2O8O A;  1GQG A;  3RMY A;  2W95 A;  4I2O A;  3H8U A;  4GXL A;  2W1W A;  4XBL A;  2QFE A;  2WO1 A;  1MQT C;  3ES4 A;  2VUJ A;  5M0T A;  3DF0 A;  3FHI B;  2ZS6 B;  3AC0 A;  4H14 A;  4W8J A;  4YVW A;  2CNA A;  4ERO A;  5AFB A;  5I0U A;  4F7Z A;  1PIV 1;  4YM3 A;  4AI1 A;  1JYX A;  1GSL A;  3CO2 A;  2WNV B;  4URT A;  1SZB A;  3WV6 A;  4NN0 A;  4WM8 C;  1R08 3;  4RHV 3;  5KXE A;  3WHU A;  1QHD A;  3I7D A;  5H9S A;  5K4L A;  4DRR A;  2B9U A;  5LY2 A;  4ZU7 A;  5LEK A;  3KSC A;  1YNA A;  5T5P A;  4W6W A;  3K46 A;  4CU9 A;  1QJZ A;  2RDR A;  3VKL A;  1W2O A;  3IPV B;  4AED B;  4WBB A;  2RR1 3;  5C4W A;  1W03 A;  1BBT 2;  3AXE A;  5LK5 A;  4UW3 A;  4R9A A;  4X6R B;  5ANQ A;  1RUJ 1;  3CJX A;  1DQ5 A;  3RI8 A;  2B46 X;  2PHT A;  2ZGT A;  1QNW A;  5KC6 A;  3GXU A;  1YWK A;  4I0W B;  1GR3 A;  3G6J B;  4QPG C;  4K6B A;  4MV2 A;  1W2U A;  1XYO A;  3S7E A;  2X5I C;  2JE9 A;  4G9S B;  4BOW A;  3HIF A;  1AUY A;  1G9D A;  5A3T A;  2CV6 A;  4OZO A;  1C5I A;  1UOB A;  1HX6 A;  4IEP A;  4JQT A;  3S5A A;  4AFM A;  1XE8 A;  4JKM A;  4ZY9 A;  5CB7 A;  5F39 A;  5CFD C;  5FP9 A;  1NCQ C;  3NVC A;  1G9C A;  3H1Y A;  3QD6 A;  4XAA A;  1WD4 A;  2QQU A;  4EZ4 A;  5FZH A;  4YZ1 A;  4AR2 A;  1VBD 3;  4AFC A;  3POF A;  1ZA7 A;  4EN8 B;  1DLC A;  2EXI A;  1K3I A;  3HQU A;  4Z8B A;  3I59 A;  1QJY 1;  1VBE 1;  4NHK A;  5CU1 A;  2RE9 A;  3AZV A;  1UF2 C;  2DVG A;  1H30 A;  3C7O A;  3IBM A;  2EAA A;  2XON A;  1FV3 A;  2BV4 A;  1D4M 2;  2WWJ A;  4LLO A;  2W87 A;  4PF1 A;  4RQP B;  1QQP 1;  4BM8 A;  2VOK A;  5JXG A;  5FZA A;  1W6Q B;  4CDU A;  3HAG A;  4JDO A;  1J59 A;  5IVB A;  2Z42 A;  3VKF C;  4GIQ A;  1PGL 1;  3KHB A;  3VDD B;  1QF3 A;  2WNU C;  3VBR C;  5DDJ 2;  3LPF A;  4LBL A;  3ZSM A;  2VCB A;  2RDS A;  3LOB A;  2QQW A;  2WIN B;  2A3Y A;  2QNK A;  4N43 B;  3U11 A;  1AR6 2;  3PJY A;  4IV3 C;  4NID A;  2GH2 A;  3MV1 1;  5FZB A;  4XBN A;  1IGO A;  1K12 A;  2J1R A;  1C1L A;  5GZD A;  1ZRR A;  1GIC A;  4JGZ A;  1NCR C;  3PIG A;  2L9L A;  2XB6 C;  3HN3 A;  3O1P A;  1FMD 3;  4UWD A;  1A3K A;  5IK5 A;  5HXV A;  3J4U H;  4XCB A;  5T52 A;  3RMX A;  4AHY A;  5CFC B;  3MIC A;  2EAL A;  1JOJ A;  1OH4 A;  1S0I A;  2W46 A;  1PHM A;  3UYJ A;  1TMF 3;  1QKQ A;  2JDZ A;  3AKR A;  4X8N A;  1ULF A;  3CIH A;  1BCX A;  1COV 2;  4A2U A;  4HSL A;  2DWR A;  5IVF A;  4WVZ A;  3CEW A;  1H8T A;  1W90 A;  2D3S A;  2XHN A;  3WP6 A;  2PAK A;  1S2E A;  3NNM A;  4FI9 A;  2YV8 A;  4DOU A;  4GMP 0;  3PUI A;  1ND3 C;  3UNP A;  3MO4 A;  3OB8 A;  4BIS A;  5J7M A;  5F3C A;  2R32 A;  2XUM A;  1VP6 A;  3FWE A;  3WUC A;  5A1L A;  1LES A;  3MIG A;  1VMJ A;  5I0T A;  2GNT A;  2UUR A;  2VNO A;  4L99 A;  2BVV A;  2IXI A;  3FUO A;  2E63 A;  1OOP C;  1SBD A;  4GMP 1;  3WNL A;  3KV5 A;  3BVC A;  1VPH A;  4PIX A;  4CCM A;  1DQ1 A;  5CKM A;  1UZZ A;  3K77 A;  1EAH 2;  2PQS A;  2VMH A;  3MUZ 1;  1VR3 A;  3POY A;  4PQ9 A;  3A23 A;  5LRR A;  1IQD C;  5FWE A;  4CA9 A;  1ENX A;  5D8A B;  2GP3 A;  1DZQ A;  2WO3 A;  3BOD A;  2R30 A;  3UV9 A;  1EV1 3;  4RS5 A;  5KR7 A;  5FDB A;  3TRS B;  4DXR A;  1FAY A;  3O0X A;  1GWK A;  4DZG A;  2V4V A;  2R07 3;  3V0B A;  1X33 A;  1XPW A;  2VQ0 A;  4YWA A;  2VW2 A;  1IG3 A;  2OKX A;  1RJ8 A;  4EN6 B;  3WDU A;  4E27 A;  5A33 A;  4XXA A;  5T50 A;  1ZBA 2;  1VBD 2;  2ZAC A;  4AI9 A;  4ISR A;  1CON A;  1GZT A;  5FZ7 A;  1FPN 1;  2DU1 A;  3VBH A;  1A6C A;  1MS0 A;  1RC6 A;  2UY8 A;  1XJA A;  4IE5 A;  5FJH A;  4BYY A;  4D8M A;  5A1F A;  4CDU C;  5A1A A;  1DZT A;  1PNF A;  1OC1 A;  4BHP A;  1PZ9 A;  4XXP A;  1GP4 A;  5FO7 B;  1ZYB A;  1JU3 A;  2DFC A;  2NYY A;  3C7E A;  4BE3 A;  5F7U A;  1E57 A;  1SFY A;  1Y43 B;  3AB0 A;  1JYW A;  2GC1 A;  1JYN A;  5JXH A;  2AYH A;  1GZW A;  4Q1P A;  4WVM B;  1TME 1;  1IHM A;  5FBJ A;  2CGN A;  3B5L B;  4RHV 2;  5FP7 A;  5JZG C;  3RJ2 X;  2E31 A;  2WNE A;  5CIR A;  4Q1R A;  2ADD A;  4AQT A;  1LOE A;  3N9P A;  3OUH A;  1XE0 A;  2CDO A;  2Y6L A;  3WX5 A;  4M3C F;  4XF4 A;  4N43 C;  3S57 A;  1H1I A;  2R04 1;  2BUK A;  4GUL A;  4AVB A;  1QJX 2;  5FPA A;  5F8P A;  3TEY A;  5HBA A;  1M06 G;  1OXC A;  3ZYI B;  1W2A X;  4D6Q A;  4YSF A;  2PYT A;  1HLC A;  2P4E A;  5CKN A;  1FOD 1;  3EO6 A;  5BNO A;  2XML A;  4YM1 A;  5C5T A;  4CZS A;  4EYU A;  2IXC A;  2RS3 1;  2HH9 A;  1UZV A;  4FFH A;  3ZFF A;  4OHZ A;  3FHQ A;  1RUF 2;  2XKP A;  3CJI C;  3M2M A;  3DKQ A;  1YXW A;  1GWL A;  4QQO A;  4RFR B;  3WNX A;  4QX8 A;  3BB6 A;  4LE4 A;  3MF9 A;  4XFF A;  2YDE A;  1XNB A;  4GKY A;  4NPL A;  4UFK A;  3VKM A;  1VMF A;  1RUF 1;  1HN0 A;  4KU7 A;  4QHO A;  5J36 A;  1R08 1;  2IXJ A;  3PNA A;  4IEX A;  4WM7 C;  4Y5Z 0;  2ZAH A;  1IKQ A;  3JQW A;  3ACI A;  3T4V A;  2CTV A;  3T2P A;  2ADE A;  1JH5 A;  2BOI A;  2BBA A;  3UET A;  4ZS3 A;  5FZC A;  4DIN B;  2W1S A;  2A5Z A;  4QMA A;  4FT8 A;  5I91 A;  3NV1 A;  3KQ4 B;  2JDH A;  3D8C A;  3LQC A;  5F2S A;  5GZG A;  4D94 A;  3MZH A;  5IWF A;  3THC A;  4CRQ A;  1W0P A;  5JAX A;  2DCJ A;  4YVS A;  4XAC A;  2J42 A;  3CKH A;  1GMM A;  3I49 A;  3RFR A;  1CGP A;  4XIL A;  2VZ3 A;  1G6N A;  1IOA A;  1AR7 3;  4QAW A;  4XTP A;  1YJL A;  3V0A B;  2XKO A;  3ILN A;  2JJ6 A;  4I0A A;  1VE0 A;  5FZF A;  2B7Y A;  2DUP A;  3NJY A;  1UMZ A;  1UMH A;  1U5I A;  4MGQ A;  5GM0 A;  4PJY A;  5E88 A;  2BFU L;  3OY8 A;  4FOY A;  3ZPO A;  2UYB A;  3ZR6 A;  2P3I A;  3IAP A;  5IK8 A;  5FY0 A;  4CDX B;  4PBP A;  1FT9 A;  3WP3 A;  1Q43 A;  2HWF 3;  2WJS A;  3AL5 A;  3OEB A;  4FO9 A;  4FPK A;  3GDB A;  4PBO A;  1ZRI A;  1O7F A;  3K3O A;  3KWV A;  4Q0V A;  4Y1V A;  1VJ2 A;  2ATF A;  2WNU A;  3PDQ A;  3VBR A;  4BLI A;  4GWI A;  2WYF A;  2A73 B;  1DGW A;  4K8F A;  5CKQ A;  2R1B A;  3R05 A;  1GFF 2;  1VBC 3;  1HJF A;  3ME2 A;  4COW A;  5BNP C;  1D0H A;  1UN1 A;  2R0F A;  3RPQ A;  1NXM A;  3ZYF A;  4DO0 A;  4Y3O A;  5F2W A;  1E5I A;  5FMC A;  4DUW A;  2ZHN A;  3TEZ A;  2MPF A;  4R4Z A;  2WFF 2;  2D3R A;  4LOR A;  5J3U A;  1QXP A;  2AEN A;  3AZZ A;  3T2T A;  2NM1 A;  2VU9 A;  4YW4 A;  1RVF 1;  2PLV 3;  2A75 A;  5F5I A;  4CDW B;  3M3I A;  1J3Q A;  1J1T A;  2RR1 2;  3SQO A;  2VZT A;  4P9J A;  2G9Z A;  5FTT C;  2DUO A;  2C5D A;  5LK7 B;  2O0O A;  1C8M 1;  4ZS2 A;  1ND2 C;  3O1V A;  4MG2 A;  3V0B B;  3HPN A;  1KDM A;  2NN8 A;  4UF0 A;  4HPK A;  3ZN6 B;  3ZVX A;  4CEY B;  5F9T A;  5IVE A;  1R64 A;  1W6M A;  4PI0 A;  2FHR A;  4OHX A;  4QPI C;  3ZXJ A;  1RUH 1;  2WAO A;  1PO2 1;  3MEP A;  3SLI A;  2JD4 A;  4NWV A;  3L2Y A;  3U14 A;  4S2G A;  2OPW A;  2Y34 A;  4FPJ A;  3LEK A;  1HKD A;  3T4H B;  4AED C;  5I0D A;  2VZP A;  5HCA A;  1WCS A;  3AKT A;  3ZLI A;  2QQP A;  4TSV A;  4Q4V 2;  2A6W A;  2VQT A;  4Q4W 1;  3WF1 A;  2O8Q A;  1JUI A;  5EZW A;  2EAK A;  3SH3 A;  1CD3 G;  2ZGQ A;  4LQR A;  3D3A A;  1S0G A;  4XAE A;  2QTW B;  4H3W A;  1IS6 A;  2FCU A;  3C7F A;  3RG0 A;  1UZY A;  1OI6 A;  3JBG 3;  1QDC A;  2VBB A;  3VBU C;  3N7M A;  4ZON A;  3CNA A;  4JV4 A;  2VR4 A;  3LSE A;  1QOS A;  5JMC A;  2ZZQ A;  1SLL A;  4J6G A;  4QX0 A;  5FYH A;  1JOP A;  5A3N A;  2WT1 A;  2FCT A;  2J1V A;  2LS6 A;  2DCZ A;  4IW3 A;  3B3Q E;  3GZA A;  3WW3 A;  2VZR A;  3SKJ E;  3AYC A;  5C3Q A;  3LEI A;  3QOP A;  3KCC A;  2PTM A;  2DVD A;  3PUQ A;  2VCM A;  5FY9 A;  2QKD A;  1TQ5 A;  1RUG 3;  1S2B A;  1TNR A;  4LBQ A;  1TMF 2;  2X29 A;  1QXJ A;  1BJQ A;  5G04 L;  3AMP A;  1RIR A;  4DXZ A;  1W2N A;  1AXY A;  5LA2 A;  4Q4X 2;  2PHD A;  3MPB A;  1OUX A;  3SIT A;  4AWD A;  3ZFG C;  1DGL A;  2HEV F;  2OZ6 A;  2PLV 2;  1GOH A;  1PX4 A;  5EJ1 B;  1K45 A;  1K5J A;  2XJV A;  4MXW B;  3AJZ A;  3OGV A;  3MW3 A;  4RR3 C;  4HN0 A;  5DUU A;  3WF3 A;  4E9K A;  2R16 A;  1NA1 C;  1XNC A;  4OFG A;  1Y4W A;  3DKW A;  4CSW A;  3WNN A;  3VL8 A;  4FPO B;  2D97 A;  3I3B A;  4QT6 A;  2G4I A;  3U1X A;  3VBS A;  3U4X A;  2Y8K A;  4JRA A;  2Q8D A;  5FO9 B;  2WA4 A;  1W9T A;  1NY7 1;  2P6C A;  1XQN A;  2WDB A;  3CQO A;  1BVV A;  4QX5 A;  4RHV 1;  1WLD A;  4OMC A;  2ZKN A;  5KHH A;  3TN9 2;  3KM5 A;  5FPB A;  4QX1 A;  1ASJ 2;  4NPM A;  4I02 A;  3OYW A;  4IV1 B;  1DQ6 A;  5FY7 A;  3DUI A;  1U5Y A;  4V2W A;  4ORF A;  1NCR B;  2ET7 A;  4RA0 A;  2RJL A;  4M3C E;  3IAQ A;  5ABJ C;  2WS9 1;  4QHB A;  1LRH A;  5BNP B;  2ORZ A;  3VDD A;  2OUH A;  3W20 A;  4I09 A;  2BQP A;  1UIK A;  4LUK A;  1R1A 3;  4PLN A;  5DZF A;  4O9E A;  2JG9 A;  5FUP A;  4FPC A;  1UOG A;  2WNV A;  2VE1 A;  3AP4 A;  3MLJ A;  4QQL A;  4XJZ A;  5FZK A;  5KHK A;  5L7O B;  3AMQ A;  2QE3 A;  3TAY A;  3O7O A;  2WAB A;  3C7H A;  1W6O B;  2VC9 A;  4YVW B;  2JIC A;  4QWN A;  4D7Y A;  4IE4 A;  3KVB A;  1Y9G A;  3ZFF C;  5DAV A;  3RYR A;  3POI A;  3ZKY A;  1RMU 3;  4BQW A;  4HK9 A;  3GF6 A;  5K9Y A;  2XJT A;  3HR9 A;  2C9A A;  2VBD A;  2YHJ A;  4YW2 A;  5E89 A;  4JGZ B;  1UWW A;  3OY8 B;  1W6P B;  1X50 A;  2JIG A;  2RG4 A;  1EPW A;  1OUS A;  5BNN B;  4AGG A;  1RUC 3;  2NZ9 A;  3WVJ A;  5C8W A;  1MS8 A;  2W68 A;  3D82 A;  4FP2 A;  4XFB A;  5DUV A;  5A7S A;  1CWP A;  4LR4 A;  5F5C A;  2OQ6 A;  1BXH A;  2RS5 2;  1QOT A;  3ALQ A;  4LKE A;  1QJY 3;  2XUE A;  2XVK A;  3RZG A;  1JZ3 A;  2LRO A;  4HK8 A;  3LA3 A;  1XXN A;  2ORX A;  1CAV A;  1WMX A;  2IZW A;  3BOP A;  3HOB A;  5E6H A;  5F3E A;  4OHY A;  1PO1 2;  2W52 A;  5CG9 A;  3M3Q A;  3ZOI A;  4UBG A;  5FMO S;  3QH7 A;  1VBA 3;  3SCH A;  4Z92 B;  4ZHN A;  3UJQ A;  1QQP 3;  1DBN A;  1RUH 2;  1PZ8 A;  1RED A;  4XUT A;  3BKZ A;  3KT4 A;  5IYY A;  4D6R A;  3ZXA C;  5D1I A;  4LNV A;  5BNN A;  2CAV A;  3A0N A;  1AL2 3;  3VV1 A;  3KQR A;  3ZYR A;  4FQ4 A;  4AEK A;  2W0X A;  1O91 A;  4TN7 A;  3N4M A;  3WOG A;  2W5F A;  2BWC A;  3BPS A;  3WG4 A;  2EA7 A;  4Z07 A;  1AJK A;  3W5M A;  5A7O A;  4XVH A;  4HVO A;  3APB A;  4OMD A;  1S55 A;  2GN3 A;  4QM9 A;  1L3J A;  1JZ6 A;  4C0B A;  2GNB A;  1OF3 A;  1REE A;  2JG9 B;  4GZ9 A;  5DPN A;  5KHJ A;  2W92 A;  2XHK A;  3KF5 A;  2FQP A;  4OUE A;  1O59 A;  5DZG A;  4CEW B;  2YRO A;  1BEV 2;  1UX6 A;  3KGL A;  3WW1 A;  3PU3 A;  4CCN A;  3RYK A;  2IUW A;  1WME A;  4KMQ A;  4XDO A;  1YQ6 A;  2DDU A;  4IE0 A;  1FYU A;  1TVG A;  1KS5 A;  1RL3 A;  3GGL A;  4FAG A;  2RHP A;  2W1U A;  4JGY B;  1H9W A;  1S0B A;  5EJ3 A;  4FVV A;  1PMI A;  4JRL A;  3WUD A;  5JZG B;  2HWF 1;  4O7X A;  1V9U 1;  1MEC 1;  3DXT A;  4MGI E;  4Q2F A;  5FPX A;  3VBH C;  3AYE A;  3KZ4 C;  1OQD A;  2PAM A;  2DUR A;  3I2F A;  2HWE 3;  3K2O A;  4FXG B;  1RUO A;  3FLR A;  1RXF A;  4IQP A;  1SLC A;  2DCY A;  3M7A A;  4Q26 A;  4J1W A;  3JBG 2;  2Q8E A;  1C8M 2;  2XQX A;  3WW4 A;  2I07 B;  3MI8 A;  3WNO A;  3SCG A;  2P6H A;  2YPD A;  4LEJ A;  4DQA A;  4HN1 A;  2JB4 A;  3P1I A;  4IEQ A;  3J9S A;  3A7Q A;  1EAH 3;  2F4P A;  2JIJ A;  1AL0 G;  1ZA4 A;  2QQK A;  2PA7 A;  3AP7 A;  4AVS A;  2FMY A;  5FZ4 A;  1HRV 2;  3VLB B;  1MVQ A;  1W05 A;  1QJU 1;  4AI8 A;  4CU6 A;  5EQU A;  3RSJ A;  4XFG A;  2VTX J;  1EV1 1;  4XDQ A;  3HEI A;  2OUJ A;  1QJU 3;  1V70 A;  3N7L A;  1OMI A;  4PLO A;  4UAP A;  5FPL A;  1LR5 A;  5FP4 A;  4FSJ A;  1OPM A;  1IS5 A;  2D6P A;  4COY A;  3TYJ A;  2VZQ A;  2XDV A;  5LCW L;  3ZXK A;  1G7Y A;  1UY3 A;  3PVN A;  1UMI A;  4TYS A;  1GWM A;  1L7L A;  4FTS A;  3T09 A;  1R1Z A;  1OUR A;  1VAM A;  2EXK A;  2MEV 3;  2RJK A;  4D69 A;  3WDW A;  3CZU A;  1JXN A;  1C1F A;  1S0J A;  3K4A A;  5DDJ 1;  2J22 A;  3ZSK A;  4R52 A;  2MHF A;  2V5D A;  3AMN A;  2ETE A;  5JIU A;  3ZDS A;  4A7K A;  1OLM E;  1PM4 A;  5EJZ B;  4D6S A;  1HB3 A;  5IFT A;  5F32 A;  3BTZ A;  3NJX A;  3RZH A;  3OGR A;  1WUV A;  2Y6F A;  1QQP 2;  1QNY A;  1LUL A;  4HT1 T;  4BK5 A;  2NMN A;  1HQN A;  4HMZ A;  3GNE A;  1NQD A;  1CR7 A;  4CDQ C;  5KXB A;  2Y60 A;  1AX2 A;  1W6O A;  5JUV A;  4H7L A;  1H1M A;  3WQ7 A;  5AC9 1;  2K46 A;  3B94 A;  3KB5 A;  4GAZ A;  2G19 A;  2HEY F;  4N7U A;  4NHY A;  2HWF 2;  1HRI 1;  2HWD 3;  4YZ2 A;  3CMG A;  4UF0 B;  1RUG 1;  2RMU 3;  2JDA A;  1W6N A;  2HWD 1;  4I0B A;  1G9B A;  2JDK A;  2HJI A;  4RSU A;  3NNJ A;  4M3C B;  3H42 B;  4GWM A;  4S2D A;  2RM2 3;  4UW6 A;  1Q8Q A;  2RV9 A;  5DAQ A;  1SG3 A;  4OVE A;  2ENR A;  1FPN 2;  2WA3 A;  2D3P A;  2SBA A;  2VZV A;  3AX4 A;  4IE6 A;  4A7Z A;  1MPX A;  5FUN A;  4QXB A;  1J83 A;  1ULO A;  2VL4 A;  2RS3 3;  2R06 2;  2VCC A;  4Q0P A;  5CFC A;  3R4D B;  1RVF 2;  4XUQ A;  1JYV A;  2ZEW A;  1RUF 3;  2JEM A;  4TTG A;  4E4S A;  4HBN A;  3DYP A;  4P00 B;  1PIV 3;  4N43 A;  4O9G A;  3S7I A;  1GQP A;  4MXW A;  4MGY E;  2OYZ A;  5A6Y A;  3H8R A;  2VMI A;  4LO7 A;  3NAP C;  3I54 A;  4Y1Z A;  4X6Q B;  3N7K A;  3DPR B;  2BJS A;  3AFK A;  3T3Y A;  2E33 A;  3SHR A;  1R09 3;  4AGV A;  1H2M A;  3PU8 A;  4Q4W 2;  2JE8 A;  4Y5S A;  3NKG A;  3ABZ A;  4Q4V 1;  2HWC 2;  1LGN A;  4XDP A;  4QDS A;  2PHL A;  4XET A;  4YGE A;  2D5H A;  2XJU A;  1US3 A;  1X36 A;  1XYN A;  2G9G A;  1NLR A;  2LUW A;  5FYC A;  4CP9 B;  2DFB A;  5FLI A;  3HVD A;  1JBC A;  1RYY A;  3ES1 A;  4MXV A;  2C1F A;  2ZEY A;  2ZX0 A;  2CGP A;  1ND2 A;  2C24 A;  2GND A;  3VBO A;  2KD7 A;  3V64 A;  3LIG A;  4H7M A;  3LAG A;  3U10 A;  2CY6 A;  2IVI B;  3VZK A;  4DS0 A;  5AVA A;  3TBD A;  2HEW F;  4XF1 A;  4FCA A;  4HOO A;  4A45 A;  2Q5T A;  5JSO A;  3B7M A;  4DUX A;  2CGO A;  1JN2 P;  4IV3 B;  4P9X A;  5F5A A;  3H3Z A;  1WWY A;  2BVB A;  4XHX A;  4B4P A;  4MUV A;  3VD5 A;  1RUC 1;  1OF4 A;  3MHZ A;  2WLQ A;  4YFW A;  1D7P M;  2VJX A;  3BCW A;  3B93 A;  4HVQ A;  2QVS B;  3BTA A;  1UPS A;  4COZ A;  1YHF A;  2IC1 A;  4W4Z A;  3H8O A;  5ERL A;  5JXI A;  1CQ9 A;  1CAV B;  4W6X A;  5JPN B;  4UFM A;  5BV6 A;  4C8D A;  1NX9 A;  1BK1 A;  4ZXE A;  3OSD A;  1AX1 A;  5FYS A;  3OGG A;  2VUC A;  4HKL A;  4CPB D;  1RUN A;  2EID A;  1WZX A;  3IT8 A;  3CF6 E;  4KBB A;  1AR9 3;  1N1V A;  4JHT A;  4Q8L A;  2TUN A;  4ZU5 A;  3MFC A;  4L0P A;  3S30 A;  3ACG A;  3I3D A;  3RZJ A;  3WNK A;  2YU1 A;  1JOD A;  2WWS A;  4LE3 A;  4R9D A;  4K9S A;  1PO2 3;  2VCA A;  3AL6 A;  5LBF A;  4BQ1 A;  1PIV 2;  1RB8 G;  4AHZ A;  3H1W A;  5IVY A;  2BFU S;  4HKO A;  3LZZ A;  1BEV 3;  4QX2 A;  1FI2 A;  3ETP A;  3FFZ A;  5FXX A;  3RRD A;  1UZ0 A;  3K75 B;  3VD4 A;  2BNM A;  2JDM A;  2RM2 2;  1I5Z A;  3H0O A;  1H2L A;  5A3P A;  4AVV A;  3KF3 A;  5C3S A;  1TME 2;  2LW8 A;  1K42 A;  1CAW B;  4YZ3 A;  1KQR A;  2WBK A;  4GB3 3;  3PVO A;  2VZS A;  5D8A C;  3VZN A;  4QD2 A;  5A70 A;  1OVS A;  3AVR A;  3ZXD A;  4CCL A;  4YG6 A;  4AOC A;  2PMW B;  1LOF A;  2Q4S A;  4BJ0 A;  3E1F 1;  1LEN A;  4IV3 A;  1IPJ A;  4JKK A;  2C4X A;  5FZ6 A;  3W5N A;  4YM2 A;  4M01 A;  2VMF A;  3I2K A;  3J8F 1;  1BMV 1;  3CDZ B;  5C6C A;  1HJG A;  2C6S A;  4JGZ C;  4MSV A;  1H8T B;  1YLL A;  2VO5 A;  1V0A A;  2P3K A;  3MUY 1;  5HCF A;  1AXZ A;  1QJU 2;  2H0B A;  1VB2 A;  1ST8 A;  4NAM A;  4QB2 A;  4CP1 A;  2ES3 A;  1QWR A;  2Q1M A;  2WS9 2;  3MFA A;  2XBO 3;  1AR8 2;  3N9L A;  5ABJ A;  5C33 A;  5GLW A;  4RQP A;  2W3J A;  1KJL A;  1PGW 1;  1S2K A;  1ND3 B;  2P34 A;  4PI2 A;  1Q8S A;  2ZGM A;  4BME A;  2XBO 1;  4GH4 B;  4D0Q A;  2WSV A;  2NP0 A;  3SH5 A;  2FDJ A;  4FPH A;  1H4G A;  1VIW B;  2RS5 3;  2Z5W A;  4I3P A;  2PFW A;  1Y7B A;  5C3O A;  2BNO A;  1WKY A;  5L9V A;  1CJP A;  4ES8 A;  3WG1 A;  4C91 A;  2E7T A;  1YI7 A;  2JE7 A;  2ZAB A;  1EAH 1;  2ARA A;  3H8X A;  2D40 A;  3ZYJ B;  2R07 1;  4B29 A;  5KBF A;  4KWL A;  4EWA A;  1BLZ A;  1CX1 A;  5FYY A;  1UIJ A;  1ZRF A;  4S2H A;  3HNY M;  2X5I B;  3UKV A;  3AYD A;  5GLZ A;  4XF9 A;  4EE2 A;  3VD9 A;  1VLN A;  1IKP A;  4AFA A;  1ULP A;  3BN6 A;  2VOW A;  4MGS A;  1Q56 A;  2WZR 3;  4DRV A;  2XXZ A;  4QGM A;  1O4T A;  4CEY A;  2GDF A;  3T30 A;  4LHK A;  4CP0 A;  5BNQ A;  1NCQ B;  2WZR 1;  4QXC A;  2UU8 A;  5FZ0 A;  5FMD A;  1S0F A;  5FPV A;  2ZBJ A;  3VBF B;  1RUJ 3;  5CIS A;  1OBN A;  1PVC 3;  1ENS A;  4EJR A;  5CVR A;  1SPP B;  2C9K A;  3KS7 A;  4SLI A;  2VQA A;  1ZZ9 A;  5FUI A;  1D4M 3;  2JDU A;  3CJI B;  4YZ4 A;  2YC2 A;  2BEO A;  2ARX A;  4BQ2 A;  2DVF A;  2XVG A;  2Y6G A;  3GJA A;  3LGR A;  1H2N A;  4HFS A;  1UYZ A;  1X7N A;  3NJV A;  5FRA A;  4ES9 A;  5BUV A;  2OPK A;  1AF9 A;  1NKG A;  1AJO A;  2OII A;  1DFQ A;  1RHI 2;  1DG6 A;  2R04 3;  5T5J A;  4NE9 A;  4IDZ A;  1MZF A;  1W3V A;  2Y33 A;  1ZZ8 A;  2ZJC A;  3JB4 C;  1RUD 3;  1YQ8 A;  3WG2 A;  5LA0 A;  4Q4Y 3;  1W8T A;  1GAN A;  4PF5 A;  3OBA A;  4HET A;  5FPZ A;  4U2A A;  2VG9 A;  2W94 A;  2XJS A;  3H1M A;  1UY0 A;  2VOX A;  3J7L A;  5ANN A;  5CFD A;  3VUO A;  2BDR A;  5IVJ A;  3DV8 A;  2ID4 A;  5FAX A;  3WNM A;  3S0M A;  1PK6 A;  1CJD A;  1ZBE 3;  2BGC A;  1FX5 A;  1ULE A;  2FDF A;  2PHU A;  2ZCW A;  2A3X A;  3BYW A;  5IT6 A;  1PO1 3;  2RDQ A;  1WMF A;  3Q8C A;  2CDP A;  4LBN A;  2QZ2 A;  3PMS A;  1AYN 2;  1S1A A;  3WDY A;  4IEW A;  1ZBE 2;  1SHW B;  1ENQ A;  2LAL A;  2Q8O A;  1MVE A;  3AZX A;  3JU9 A;  4DEQ A;  3SMH A;  1IPK A;  5HXM A;  3P3N A;  3RWN A;  4B8E A;  3VKO A;  4CTE A;  4HL0 A;  4E2G A;  4KGG A;  4L9B A;  1M4W A;  3ITQ A;  2W2I A;  3VBU A;  4AQ2 A;  3BUC A;  1HXS 1;  4E4H A;  4CUC A;  5KHG A;  1AL2 2;  3D6E A;  1G8W A;  5GZF A;  2GZW A;  3C2U A;  1PMH X;  2D6L X;  3KV9 A;  1SBE A;  3VB9 A;  1HIX A;  2VOV A;  2ZOE B;  2PEL A;  5A7P A;  5L36 A;  1POV 0;  1R08 2;  2JDN A;  3AMM A;  3O12 A;  1NZI A;  3VBO B;  1WLW A;  2ET1 A;  4DUV A;  4Q4V 3;  4JC1 A;  4N9I A;  5EP9 A;  3ZR5 A;  1IS4 A;  4AEM A;  3JB8 A;  3FHA A;  4DNY A;  4OI4 A;  5FZ8 A;  2ZHK A;  1ND3 A;  3LEG A;  3OGJ A;  5FYZ A;  1NE6 A;  3OJB A;  5L19 A;  4HVR A;  3J7M A;  2ZX2 A;  4BQ3 A;  3ZYP A;  5F1R A;  2XPJ A;  4DXS A;  1SBF A;  1XNK A;  5JWP A;  3WD5 A;  3IDE A;  1H6X A;  2X09 A;  3O1O A;  3ZO0 B;  4H55 A;  3I2D A;  2ZX3 A;  4Y26 A;  5C70 A;  3O0W A;  3ELN A;  5A7N A;  1RUE 1;  4RGK A;  4YYO A;  1PGL 2;  5FXV A;  2D6M A;  5JSP A;  2VZ1 A;  3AZW A;  4RR3 A;  3USS A;  5JSR A;  1UU5 A;  2DYC A;  4PIY A;  2WZR 2;  1XU2 A;  5ISL A;  1V00 A;  1NA1 A;  1AR9 2;  2HWE 1;  3AZY A;  1AYM 1;  3LIH A;  4BH9 A;  1G9F A;  1LGB A;  4FPF A;  3O1S A;  3PTY A;  3HJR A;  4XFC A;  4E8C A;  1D2S A;  2J1E A;  5C8C A;  5A32 A;  3FBY A;  1QIQ A;  3E5Q A;  1LHN A;  4JAA A;  4HON A;  3OEA A;  3VBF A;  3GCW A;  5BYN A;  2PQQ A;  4L8Q A;  1N1Y A;  2DTY A;  3RDI A;  1DYO A;  2Y6K A;  5E1R A;  5GLV A;  4B7E A;  1PZ7 A;  1SDW A;  4DY3 A;  4UOJ A;  5FP3 A;  2P3Y A;  3AKQ A;  2IFR A;  2W08 A;  2QQN A;  4CDQ A;  3RNS A;  3O1R A;  1DGW X;  5A7W B;  3WY6 A;  1RUH 3;  2DVA A;  2WNV C;  2BBV A;  2JKX A;  1YFY A;  5A6X A;  1JYT A;  1ZX5 A;  2RS1 2;  2ZTN A;  4N53 C;  1SQ4 A;  2AEZ A;  1AR8 3;  5FLJ A;  2VW1 A;  4AI3 A;  1RIT A;  2TEP A;  5CNA A;  4N9H A;  4P9G A;  4NWW A;  3WCR A;  2QQV A;  5C9A C;  3I3M A;  1NOV A;  3HT2 A;  1LAJ A;  1VBC 2;  3MLK A;  4CU7 A;  2YG0 A;  3MBW A;  3NJZ A;  4LIU A;  1STM A;  5T5L A;  4HKW A;  1C57 A;  1O8S A;  1OOP B;  2HWC 3;  4JZR A;  3WG3 A;  1J1L A;  1WGP A;  2EIB A;  1H8V A;  3E6B A;  4WVW A;  4OI1 A;  1RUG 2;  4WM8 A;  3UGH A;  1OT5 A;  1VBB 3;  2EXJ A;  3OUI A;  3NNG A;  3H50 A;  5BNO C;  4QPI A;  2G9F A;  1YIF A;  5I0S A;  2QQO A;  4P08 A;  1PMJ X;  1O4Y A;  2R49 A;  2UWC A;  3CJI A;  5E16 A;  3VDB A;  4YW5 A;  4PHZ A;  3JZV A;  5IW0 A;  3N9O A;  1W8H A;  5C71 A;  2J1A A;  4JKL A;  5LBE A;  3N9M A;  3DGT A;  4IL7 A;  5JDB A;  2LRP A;  3DL3 A;  2CWS A;  1DP0 A;  4YVS B;  2D7F A;  1APN A;  1WMD A;  4N8M A;  1C28 A;  3LSD A;  2ZGL A;  2KR2 A;  2GP5 A;  4Z2W A;  1CIW A;  1O3R A;  1S0D A;  4QPG A;  4YZ5 A;  1EUU A;  1RXG A;  1N3Q A;  1GNY A;  3AM2 A;  5KXC A;  1HQW A;  2CU5 A;  4QQH A;  5D21 A;  1PGW 2;  4SBV A;  3WDT A;  5BPX A;  1T6G C;  3Q8B A;  4KWJ A;  2RS1 1;  4Q0S A;  4G3Y C;  2ZGS A;  1EYB A;  2G1M A;  2IWG B;  2YYO A;  1YFX A;  1C8N A;  3ZN5 A;  5I93 A;  1LU1 A;  5CYY A;  5K0U B;  1Q5O A;  3M8L A;  1KD7 A;  4NAO A;  1QJE A;  4NRO A;  1HB4 A;  3I2I A;  5F37 A;  1QJF A;  4P02 B;  1XOY A;  3PHM A;  4JTO A;  5IAT A;  1MZ6 A;  4A3Z A;  2ZGK A;  2VVE A;  4I01 A;  3SEP A;  1F2N A;  2BP6 A;  4K3U A;  1WW4 A;  3T2O A;  1VBA 2;  2MEV 2;  1K5M C;  1NY7 2;  3NV3 A;  3RVH A;  3HQX A;  2R04 2;  2XJP A;  5CFC C;  3MW4 A;  5K0U A;  2JEN A;  2JX9 A;  3I59 B;  2WS9 3;  3PUH A;  5DAB A;  3SKV A;  1ZVF A;  2ZHL A;  1ODM A;  5FKC A;  3J26 N;  5JIA A;  4OQ9 A;  3W59 A;  2E51 A;  4OYU A;  4CCJ A;  1B35 C;  1LEM A;  1RMU 1;  3WF2 A;  1OFS A;  2F17 A;  1PK6 C;  3JD7 3;  3VZJ A;  1HW5 A;  2JB8 A;  1YYN A;  1SFP A;  3HNM A;  1LHU A;  4AHW A;  1H6Y A;  1REF A;  4MHR A;  1URX A;  5JR7 B;  3CZJ A;  3JCI A;  4LA2 A;  3VHN A;  2EXH A;  1XBF A;  2NPI A;  1MS1 A;  2DV9 A;  3ZIW A;  1JU4 A;  3K3N A;  4WZC A;  3ZSL A;  5T54 A;  1KJR A;  5EFU A;  3QBQ A;  3WDX A;  1RUD 1;  4ARY A;  2PHR A;  2WII B;  3FX3 A;  2DVB A;  1DQ0 A;  4MYE A;  5J09 A;  2E32 A;  4OHV A;  5JOY A;  1VBE 3;  1CPM A;  1JW6 A;  2HKX A;  4QXH A;  1NXD 1;  1UYX A;  1NQJ A;  2B4K A;  2JG9 C;  1LOC A;  3AJY A;  5A6Z A;  1VBD 1;  5A80 A;  1MZE A;  4LT5 A;  4FFF A;  2OT7 A;  4GWN A;  4LMF A;  4KWU A;  2E7A A;  5GKA C;  3QH6 A;  1GKB A;  3S5Q A;  2VZU A;  4WZF A;  4CP9 A;  4P14 A;  1AL2 1;  4EN9 B;  2WZP P;  1RUJ 2;  2VVD A;  5DAP A;  4MVT A;  4JX0 A;  4NO4 A;  5FYI A;  2ZGP A;  4A41 A;  1IS3 A;  1IG0 A;  2D44 A;  4TWT A;  1OHF A;  4RS5 B;  5KXD A;  2FDG A;  4LKD A;  5KHI A;  5IJR A;  1SLI A;  5ACA 1;  1KRI A;  4EN0 A;  1COV 3;  1RUI 1;  4TLF A;  1ONA A;  4IGO A;  4NRM A;  4CP2 A;  4K7J A;  1W9F A;  4BMB A;  5FMO L;  4A7Y A;  5JPM B;  1F9K A;  3OCP A;  1LHV A;  2WUH A;  3B9I A;  3FL7 A;  1UAI A;  1W8Z A;  2OXB A;  1XNA A;  3GBG A;  5C7G A;  1PX3 A;  3I3Q A;  4XFA A;  3P3P A;  3USU B;  3MF6 A;  4BIF A;  3OBT A;  4XZP A;  4BIO A;  2JXA A;  5C8C C;  4LO6 B;  1U0A A;  5CAZ A;  2YGM A;  1LOG A;  1F4H A;  1BBT 3;  4YW3 A;  1V6L A;  4CEW C;  1E5S A;  1ULD A;  3P6B A;  3POG A;  1YFU A;  1V9U 3;  2B42 B;  3UGF A;  1POV 3;  2BPA 2;  1LNS A;  3PLQ A;  4CDW A;  2W1Q A;  4XJ9 A;  1ND2 B;  4CCK A;  3F95 A;  4G4F A;  3TNP B;  2VUD A;  1POV 1;  4CXY A;  4BB3 A;  3MIH A;  5FY8 A;  4CEY C;  4LTA A;  2Y26 A;  5C5U A;  5LWB A;  4QPI B;  3UES A;  2AR6 A;  5J37 A;  4COU A;  3IDC B;  3J8F 3;  3RYP A;  1O3Q A;  3LD8 A;  4UI9 L;  1AYM 3;  4NR1 A;  3VHO A;  1CN1 A;  4QKF A;  1GBG A;  4A3X A;  5EWS A;  4J25 A;  5JCT A;  4YW7 A;  2WNO A;  1XE7 A;  3V56 A;  2A7A A;  2VUL A;  1W8N A;  3AP5 A;  3SC7 X;  3HNB M;  1JHN A;  4CUB A;  5I8Y A;  3KHC A;  4NUB A;  2VME A;  3DXU A;  4MAD A;  2W39 A;  3BGA A;  2Q1Z B;  3HMY A;  1OQ1 A;  2H0V A;  4YW6 A;  3K4D A;  3ON7 A;  4AQ6 A;  1LHO A;  2JDY A;  4ISQ A;  4IXL A;  2IFW A;  1UOJ A;  2QJV A;  2ARB A;  5L7O C;  3T2Q A;  1DYP A;  3I3E A;  5FZE A;  3ZSJ A;  5FOB B;  3IKW A;  4X8P A;  3PJQ A;  5L73 A;  1PK6 B;  1RMU 2;  4L11 A;  4AI0 A;  2R1D A;  1W99 A;  4LJH A;  1LOB A;  3DYO A;  3UJO A;  5FO8 B;  5HV0 A;  5FOJ B;  1JYC A;  1ZRE A;  1FPN 3;  2E53 A;  2GMP A;  3IDA A;  1WBF A;  3I2H A;  1UY2 A;  4FP3 A;  4XJA A;  1GOG A;  1VBE 2;  5FIX A;  2D43 A;  4BXS V;  3F2Z A;  3TNQ A;  1R1A 2;  2H6B A;  5FBZ A;  4XF3 A;  4XC9 A;  5HPO A;  1VBB 2;  4UFH A;  1J58 A;  4ITC A;  5LBB A;  1DQ2 A;  1UL9 A;  1ZZ7 A;  2RDN A;  2DBI A;  1F5F A;  3KCY A;  4J1X A;  4LHS A;  4Z82 A;  1UO9 A;  3WHT A;  3ST7 A;  3ZFE B;  2HWC 1;  5JR2 A;  1GUI A;  3NO8 A;  4QU2 A;  2VM9 A;  1WCK A;  2DCT A;  4PIZ A;  2AZ5 A;  1OOP A;  4UFI A;  2FCV A;  3BTX A;  5ACA 2;  4KG8 A;  4UFJ A;  1S0C A;  4WM7 A;  3J8F 2;  3PIJ A;  5T55 A;  2MNG A;  1CZS A;  3RQ0 A;  2RJ2 A;  1X8M A;  2IXK A;  5T3N A;  3VD3 A;  2VD7 A;  2O14 A;  4B3N A;  4XUN A;  5LAT A;  1J84 A;  2V5Y A;  4ZU4 A;  1HDK A;  4RS5 C;  1PNG A;  3MIE A;  3OTF A;  4UW4 A;  5LEJ A;  3RZM A;  1HRV 3;  3GAL A;  1LED A;  1CVN A;  1DF0 A;  3GZU C;  4DMI A;  3RWK X;  2AH2 A;  3E5X A;  4Q4X 3;  2BU9 A;  3HN1 A;  2ZGN A;  1SPP A;  4GB3 2;  2YUE A;  3LWC A;  2B9V A;  2VQU A;  4IV1 C;  1ZBE 1;  4HSJ A;  4YM0 A;  2A3W A;  3OGS A;  1SDD B;  3PVB B;  2RVA A;  4NJ4 A;  2Y64 A;  3X29 B;  4OQ8 A;  1NYW A;  2VVF A;  4CDW C;  1QXR A;  2WN2 A;  1VBA 1;  5GAL A;  4KL1 A;  3LEM A;  4M0H A;  4KU8 A;  5FYB A;  1OD3 A;  3GBF A;  1US2 A;  1GOF A;  5C8C B;  1LJ7 A;  1PO2 2;  1HXS 3;  1PO1 1;  5D8A A;  1Z0H A;  4K20 A;  3HT1 A;  4LBQ D;  2NLR A;  3ZYG A;  2WLP A;  2X8K A;  3B69 A;  1LOF C;  3PUR A;  1OLQ A;  2W9X A;  2DTW A;  4D7T A;  1CES A;  4N53 B;  1IQA A;  3M4F A;  4Y4R A;  3AMH A;  4LLF A;  3S6P A;  3WP4 A;  4L92 A;  1G9A A;  4IEO A;  3ZX7 A;  5CG8 A;  3OD0 A;  1RUE 2;  3HBK A;  1W9S A;  1R09 1;  1SLB A;  2RR1 1;  4XUP A;  3BOW A;  3M3C A;  3WQ0 A;  1VAK A;  2BNN A;  3H7Y A;  2IXH A;  2XOM A;  4RQP C;  1GP6 A;  1GU3 A;  4CXX A;  4JHZ A;  3LDK A;  1MS5 A;  3QAC A;  1ZZB A;  2BER A;  3FJS A;  1U5Z A;  2I45 A;  2UYA A;  3NL1 A;  4CU8 A;  1VRH 1;  3UKT A;  4AL9 A;  4AE2 A;  4EWE A;  1BMV 2;  2BGO A;  1LOA A;  5A3M A;  5FQ0 A;  1Q8V A;  2Z69 A;  3BTY A;  2J7M A;  5DZE A;  3D5O A;  4XBQ A;  4L2N A;  4BCU A;  3SIS A;  1P8J A;  2YY1 A;  1LTE A;  4CYD A;  5TSW A;  4DFS A;  4MHU A;  5C4W C;  5I8T A;  4NOT A;  3UGG A;  4FFI A;  3IMN A;  1NG0 A;  4FPG A;  1Q3E A;  2EIG A;  4YFZ A;  4ASL A;  5EIY B;  1Y3T A;  2GSY A;  2ZML A;  5JLV A;  2D5F A;  1CIY A;  2KM2 A;  3JXS A;  4K8R B;  1T6B X;  4MLO A;  3SXW A;  2QBX A;  1C5H A;  1NLS A;  4HAN A;  4HXC A;  2FDH A;  5F3G A;  2R7E B;  5D2A A;  3MYX A;  4OUM A;  4BWO A;  1ZRC A;  1TG7 A;  2QQM A;  3M3O A;  2VBP A;  3N7J A;  1YUD A;  5FK8 A;  2OVU A;  1QJY 2;  2FDK A;  3K4Z A;  3OPT A;  2WZE A;  2WZ8 A;  4AVC A;  5FJK A;  1L7R A;  1X9P A;  4CCD A;  4LIV A;  3GJB A;  4LUL A;  4Q27 A;  1NCQ A;  2Q30 A;  4FPE A;  3POS A;  1C8M 3;  1Q8O A;  1AR8 1;  1UXX X;  1YQC A;  3IN9 A;  4IE7 A;  4JGY C;  5F3I A;  5FYT A;  4CEW A;  4FOV A;  4GA9 A;  4YNI A;  1MZ5 A;  1PM7 A;  3FLT A;  2LTN A;  1WD3 A;  4E8D A;  1GV9 A;  1Z7S 3;  2BW8 A;  2XWB B;  4XIK A;  4WVM A;  4MGT A;  1UD1 A;  2LM3 A;  1ZZ6 A;  5APA A;  1MS9 A;  4NHL A;  4XCA A;  5H9P A;  2HBU A;  4KBZ A;  1BEV 1;  5A3U A;  1UQX A;  5CEH A;  2X10 A;  3D0J A;  3U37 A;  1HV1 A;  1TE1 B;  3BU7 A;  1T2X A;  3USU A;  3W58 A;  3LDR A;  3N3H A;  3TEX A;  1DIW A;  1I5P A;  1GQH A;  3CHX A;  3GHN A;  4Y1Y A;  3VZL A;  2DCK A;  1AZD A;  1WW6 A;  3NST A;  1ODN A;  4I30 A;  1XNT A;  1VBB 1;  4P9W A;  4BZ4 A;  1W04 A;  3C8X A;  5KC5 A;  4CCE A;  1B35 B;  4XMI A;  1JZ4 A;  5A33 B;  2ZAA A;  2QQJ A;  4ZXK A;  4LKS A;  3RZL A;  5JVV A;  4LBO A;  1AYM 2;  3LF7 A;  2VTX A;  4YRD A;  1MS4 A;  1KFX L;  4V2V A;  2HWE 2;  5C9A A;  2QCS B;  4XZU G;  5A7Q A;  4P9L A;  1O6U A;  1EY2 A;  4YGC A;  2VXR A;  2JEC A;  3U07 A;  4CCC A;  3VBS B;  2WFF 3;  1QY4 A;  2CYF A;  2YPJ A;  4FTE A;  4COV A;  5DN2 A;  5L9B A;  5CBL A;  4YG0 A;  4MOA A;  4W6Y A;  5DQ0 A;  4TXW A;  4PQQ A;  1ENR A;  4IEU A;  3H7J A;  4FOQ A;  4LA3 A;  5GLT A;  4LXL A;  2P2K A;  4XQ4 A;  5L9R A;  1ASJ 3;  1B35 A;  4FFG A;  2A70 A;  5A3L A;  1H4H A;  4E2S A;  4GMP 3;  3OUJ A;  3MID A;  2WT2 A;  4IEY A;  3WDV A;  3VN4 A;  2GMM A;  2RS5 1;  4GH4 C;  3P5B A;  1YCI A;  1Z78 A;  2CL2 A;  4IGQ A;  2WR9 A;  2W91 A;  5A32 B;  4AG4 A;  4WVV A;  5DUW A;  1LEC A;  5FLH A;  1L7Q A;  1QGL A;  3ATG A;  4PDW A;  4UW5 A;  4YAR A;  1UPI A;  2RS1 3;  5FZO A;  3FUQ A;  2QUO A;  3DPR C;  2DF7 A;  2FD8 A;  3HWJ A;  3V65 A;  2R06 1;  2PHW A;  1UYP A;  1CAU A;  2YZ4 A;  5E8A A;  1AR6 3;  4B4Q A;  5LB6 A;  4C1W A;  3GYD A;  5C4W B;  3NNF A;  4QQP A;  2XJR A;  4EV0 A;  3UK9 A;  1CAW A;  4NIH A;  4GQ7 A;  3NMB A;  1W8F A;  4Z1V A;  2A6V A;  2OA2 A;  2D93 A;  1RUD 2;  2FZ2 A;  4M4R A;  5LZ6 A;  2FDI A;  1CZT A;  3FBM A;  3MIB A;  1H0B A;  1MR5 A;  5FPU A;  1UYY A;  2HWB 1;  1HXS 2;  1OSG A;  3IWZ A;  5K7P A;  4AAP A;  4Y22 A;  2BGP A;  1CAU B;  1UXZ A;  1LCL A;  4AW7 A;  4CXW A;  3R0R A;  3WR0 A;  1ZRD A;  4Q0Q A;  3O5S A;  2VNG A;  4LBJ A;  4LHN A;  4WM8 B;  4MZU A;  1OQE A;  5DUX A;  2PAE A;  1AYN 1;  3W21 A;  3JD7 1;  1DLL A;  2D6N A;  2OQ7 A;  3VHR A;  3IB3 A;  4NIG A;  4QB1 A;  3CU7 A;  4XIO A;  2WN3 A;  4O61 A;  5GLU A;  1K5M A;  1YC6 1;  3OPW A;  5DG2 A;  3VBH B;  1VMH A;  3O0V A;  3Q9O A;  1Q8P A;  5EYX A;  2XQR A;  1WW7 A;  4Q4Y 1;  2XG3 A;  5FY1 A;  2ZEX A;  4AGR A;  1E5R A;  4CDU B;  3Q8E A;  1N3P A;  4Q4X 1;  3K51 A;  1NE4 A;  2BWA A;  4LK7 A;  4O65 A;  3EYP A;  3N9Q A;  2HBT A;  1JOB A;  4JCK A;  4C0H A;  4Z2A A;  4KG0 A;  4ZZ5 A;  4LPL A;  4ONU A;  3EB7 A;  4NRQ A;  2ZZJ A;  3NV2 A;  3POW A;  2K0G A;  5FYU A;  1JHJ A;  5A3W A;  3I97 A;  1JZ5 A;  1NZC A;  5FY5 A;  2WQ8 A;  2ZA9 A;  1JMU B;  3KLS A;  4LOT A;  3NQH A;  1KIT A;  5A7W A;  1PVX A;  4IGP A;  2YMZ A;  3BAL A;  3E5U A;  4LKF A;  1UY1 A;  1SFN A;  4YGB A;  3UKN A;  1HRI 2;  3ORJ A;  4RGA A;  3U75 A;  1AHS A;  2X53 S;  5CAD A;  4S2F A;  1HB2 A;  1X8E A;  2EIE A;  3WCS A;  5GJ6 A;  4JQR A;  5IK7 A;  2W47 A;  3E6D A;  3BIE A;  2QDR A;  2P17 A;  2J1S A;  3GHM A;  3OBZ A;  5F6L B;  2KA3 A;  2A6X A;  4K1Y A;  3A4U A;  4XAB A;  1H8T C;  1UCX A;  2R0H A;  3RS6 A;  4AQS A;  5A6Q A;  2D98 A;  5LW9 A;  1A34 A;  1EP0 A;  3SCF A;  4GH4 A;  3III A;  3I2J A;  4Q5O A;  3RJR A;  3AYA A;  1GP5 A;  1SLT A;  1XC6 A;  2DU0 A;  2XL7 A;  3GZT B;  2YC0 A;  4KGQ A;  1HQL A;  3DYM A;  5A3O A;  2BTV C;  4AYU A;  1C4R A;  2YB7 A;  4Y22 B;  1W6M B;  3D4K A;  4GB3 1;  4XJ8 A;  3VDC A;  5HI0 A;  1O3S A;  2OZJ A;  1F8V A;  5L7O A;  1XSQ A;  4PDW C;  3WNP A;  2WC2 A;  4ET7 A;  3WLU A;  1DYK A;  2GAU A;  2VNR A;  3IPV A;  4MH0 E;  4OCT A;  3HD8 B;  1NAE A;  4QM8 A;  5J98 B;  3B01 A;  1MEC 2;  4YGD A;  3MGU A;  3ZKU A;  4QGN A;  1NT0 A;  2WQZ C;  4A6O A;  1DQ4 A;  1WCD J;  2YBK A;  4A4A A;  1ULC A;  4LOS A;  4BXF A;  1IZ3 A;  4XQD A;  1E5H A;  1RHI 3;  4OUS A;  3U4S A;  4Y1X A;  5FWJ A;  1YFW A;  3NKT A;  1JI6 A;  2JDP A;  5BNN C;  1MS3 A;  2PN5 A;  3LA7 A;  1RHI 1;  4R4X A;  3RI9 A;  1QDO A;  4RYD A;  1NLQ A;  4FQZ A;  4C90 A;  3IM0 A;  1OLM A;  3CL1 A;  1QH7 A;  1RGS A;  4IND A;  1FNY A;  1QEX A;  2K2S A;  4A44 A;  2RS3 2;  3ZIX A;  2XWJ B;  4QKN A;  1RJ7 A;  4AHX A;  3VKN A;  1FNZ A;  2ERF A;  2O1Q A;  3NWK A;  4LO4 B;  5SV5 A;  5J48 A;  2YXS A;  3B02 A;  5FZD A;  3TOJ A;  5JXJ A;  2WFP A;  1OKO A;  2TNF A;  3TN9 1;  5C9A B;  1Y9M A;  1JZ7 A;  4Y1U A;  2XR4 A;  3ACF A;  3TN9 3;  2VY0 A;  3KV4 A;  1HB1 A;  2RMU 2;  3LPG A;  4LBM A;  4XW3 A;  3VDA A;  4FAH A;  1GZ9 A;  5GZE A;  1GLH A;  1W6Q A;  4XOG A;  4BQY A;  2F6B A;  1LHW A;  1UNB A;  2WSU A;  3NRU A;  1WA4 A;  3THP A;  1OFN A;  2ZPX A;  2Q8C A;  4QXK A;  4QPW A;  4F83 A;  1DHK B;  3IZO A;  4CDX A;  1JZ8 A;  4XF0 A;  5SV8 A;  2X05 A;  3NAP B;  5JI7 A;  3ILR A;  4XUR A;  1VAL A;  4TLG A;  4QU1 A;  1Z7S 1;  4RN5 A;  5DXD A;  3RGB A;  4ARX A;  4DY5 A;  4W50 A;  3BU0 A;  2YBP A;  1O4Z A;  3VBF C;  5HCH A;  3MW2 A;  3N9N A;  1W2T A;  3DCQ A;  5JMO A;  3R4U A;  4K40 A;  3QLQ A;  4CUA A;  4NPR A;  3I2O A;  3ZYH A;  1UX7 A;  1PVC 1;  5F5Q A;  2XJQ A;  5C3P A;  5I0R A;  2UY9 A;  1CPN A;  4Q29 A;  1HV0 A;  1HN1 A;  5CFD B;  3KVA A;  1V6J A;  4QGL A;  4Q4W 3;  5IAX A;  1J3P A;  2MEV 1;  1F4A A;  1CZV A;  2CSG A;  2WKK A;  3JUU A;  5FY4 A;  1V6K A;  1W06 A;  1BQP A;  4C1X A;  4RGG A;  3H3U A;  2WT0 A;  4P5Y A;  3KCX A;  3POB A;  4N53 A;  4QB6 A;  1ZBA 3;  3NAP A;  4RFT 0;  5FZ3 A;  1W3X A;  1NA1 B;  2H6C A;  3AVS A;  1LU2 A;  1W39 A;  3Q8F A;  3VBU B;  4BK4 A;  2CWM A;  2VOT A;  1FMD 2;  3ASI A;  1SCR A;  1N1S A;  3FFQ A;  1ZM1 A;  1XB9 A;  2VXJ A;  4HPK B;  3ZN6 A;  5H9R A;  5DMY A;  1AX0 A;  2ZMK A;  3ROU A;  2EIC A;  1D0G A;  2OS2 A;  1EV1 2;  3C7G A;  4B4R A;  5FQ0 B;  2Q1F A;  4I3G A;  2GU9 A;  1DU3 D;  2F4L A;  2Z4F A;  3ECQ A;  3WT3 A;  3T0D A;  5EV7 A;  1UKR A;  3ZMO A;  3THD A;  2JG8 B;  4XE9 A;  5EYY A;  3VBO C;  3G7D A;  1RUC 2;  1ASJ 1;  3E97 A;  3LE0 A;  1QU0 A;  5FZO B;  2C0Z A;  5FYM A;  3N35 A;  4BLJ A;  4AAX A;  2P1B A;  2Y6J A;  1W6P A;  2RM2 1;  2XH6 A;  3AK0 A;  4RD7 A;  4HG6 B;  1QOO A;  2VTF A;  4MET A;  3NV4 A;  4WM7 B;  3TB0 A;  2WRA A;  3CBN A;  1UZW A;  3ZPY A;  1WCQ A;  3RZK A;  3FLP A;  2QZ3 A;  4XTM A;  4BQ5 A;  5GZC A;  3FZ3 A;  1LOD A;  3GZE A;  1OA4 A;  4K21 A;  3VD7 A;  1H2K A;  1SMV A;  5LA1 A;  3KGZ A;  1W28 A;  2VGD A;  5FZM A;  5IVV A;  4LIT A;  4N90 A;  1V9U 2;  4QX7 A;  3OD4 A;  5JI9 A;  3FC0 A;  4LO8 A;  3IMM A;  2FZ1 A;  1W6N B;  1W0N A;  4R8H A;  3EJK A;  5FXW A;  3KD4 A;  4OI2 A;  1G86 A;  4TZD A;  2BRT A;  4XPV A;  4LBQ B;  5IUQ A;  2Y0I A;  3V0A A;  2GC3 A;  3ZFG B;  1H9P A;  1RIN A;  2GH8 A;  4IEZ A;  4XQW A;  2P3J A;  4BDV B;  1H1A A;  3ZSE A;  3LKJ A;  3WZ1 A;  2BOJ A;  3POE A;  5HV4 A;  3DN7 A;  3I4I A;  1WLC A;  4CDX C;  2HWB 3;  2WWU A;  2YGL A;  5FCC A;  1EPZ A;  1FXZ A;  1O8P A;  4NMI A;  3I8T A;  1MQT A;  1LGC A;  3FE5 A;  5B4N A;  2NMO A;  3MDP A;  2IVJ A;  2Z2S B;  4YVW C;  3KT7 A;  4Q8K A;  4Q4Y 2;  4JTN A;  2WYS A;  3KMH A;  4UFL A;  4NIA A;  1R09 2;  2R6Q A;  4NII A;  3PVE A;  1ZZC A;  4GD4 A;  5FR3 A;  2V72 A;  4R9B A;  5FV3 A;  5HCB A;  3T1L A;  1I1E A;  4AI2 A;  3O1M A;  2V09 A;  3EBR A;  1XND A;  2BZD A;  4M4P A;  1POQ A;  5ABJ B;  1TZO A;  4NVP A;  5JOW A;  3EXU A;  4KQ7 A;  2IXL A;  1AR7 2;  3B9C A;  5C3R A;  3EHK A;  5LA9 A;  2C26 A;  3T1M A;  2N7G A;  4DPN A;  1O5L A;  1JZ2 A;  3MPP G;  4BPZ A;  4CPB A;  1RVF 3;  2PLV 1;  2E6V A;  4QKD A;  4KI5 M;  4AF9 A;  2FMD A;  3OF1 A;  4XYX A;  4YPJ A;  3M3E A;  1NCR A;  1BK0 A;  4AED A;  3UL2 A;  2GNM A;  2E26 A;  4UBH A;  4BA6 A;  3WXP A;  5FZ1 A;  5JZG A;  1WLT A;  3ZFF B;  4KH9 A;  2OW4 A;  2Q0A A;  4W65 A;  2A6Y A;  4UYB A;  4YG3 A;  4K1Z A;  3J7H A;  1BZW A;  1A8M A;  1F31 A;  4KNC A;  1AR9 1;  3TWI A;  2UWA A;  4GJY A;  3A22 A;  3ACH A;  1VRH 2;  5J96 B;  2X5I A;  2YFU A;  4E4D X;  2AC1 A;  1COV 1;  1RUI 3;  3T0A A;  5DG1 A;  1FMD 1;  4Y33 A;  1PGS A;  2GME A;  4GJZ A;  1JTZ X;  1X82 A;  1YIP A;  1W8O A;  4UT5 A;  3WQB A;  3ZDV A;  4XMA A;  4U36 A;  1ACC A;  4ATE A;  1BKZ A;  3VGI A;  1UW8 A;  2KXL A;  4Y24 A;  2JD9 A;  3C3V A;  3D0S A;  1U12 A;  3M70 A;  3LDB A;  1BBT 1;  3ETQ A;  4RL7 A;  3ZM8 A;  4IV1 A;  2HLE A;  2JG8 C;  3GBW A;  3H9A A;  4KWK A;  3JBG 1;  3WEZ A;  4CVU A;  4LBK A;  4FXK B;  1DGR A;  4NHM A;  5F6K A;  2HWD 2;  2XLG A;  3K48 A;  5BXX A;  2ZGO A;  3GM8 A;  3AP6 A;  3WSO A;  1KS4 A;  5LRS A;  5IAV A;  1AVB A;  3VL9 A;  3T08 A;  5IHR A;  1SEF A;  1VRB A;  2HWB 2;  4EQV A;  1KFU L;  1TEI A;  1MAC A;  1W0O A;  2AEY A;  2VH9 A;  4AVT A;  3JQX A;  3RZZ A;  1U5X A;  3BI3 A;  4Y4Y A;  3LFM A;  4LO5 B;  4GKX A;  4D3W A;  4H2A A;  1DZR A;  4QPY A;  2WO2 A;  4YVS C;  1CX4 A;  2VNV A;  4FOW A;  3SNM A;  1W8U A;  3I2G A;  5IFP A;  2VAU A;  2GN7 A;  2ZGU A;  1FV2 A;  1N3O A;  1OVP A;  2B8M A;  3VZM A;  5AVP A;  5FZL A;  4ASK A;  5KWR A;  3ZXE A;  5DAW A;  5CA6 A;  5JOZ A;  4EN7 B;  4NRP A;  1ALY A;  5JOX A;  1VB4 A;  2JWP A;  4EWD A;  2Z79 A;  4MX3 A;  4AK3 A;  2XGX A;  4CCO A;  3ILF A;  4BQX A;  3VDD C;  3FN9 A;  4QDQ A;  5G05 L;  5K0U C;  5CZK A;  1D2Q A;  5FRE A;  4XJW A;  4XJU A;  2R06 3;  2HYX A;  2ZX1 A;  5T5O A;  5FMB A;  1BHG A;  1S4C A;  4BU2 A;  5FYV A;  3NNL A;  3PUS A;  2EVX A;  3OPZ A;  3L9J T;  4D7S A;  4FPL A;  5AFE A;  5FZI A;  2ZKL A;  1TNF A;  1UY4 A;  2DUQ A;  1AR6 1;  2QDN A;  3LCP A;  3DEM A;  4MO3 M;  3ZN4 A;  4ASM B;  4AVA A;  1ZNP A;  5AC9 2;  3PTR B;  2YBS A;  1KGY A;  2JKB A;  1XU1 A;  1R1A 1;  1GNH A;  1V6N A;  3OBR A;  4FTB A;  3AFG A;  2ZGR A;  4P9Y A;  1XSR A;  1YI9 A;  2Y38 A;  4URA A;  3DPR A;  3JD7 2;  5FXZ A;  4P5H A;  4PDW B;  1F5J A;  1SCS A;  1VAV A;  4XFH A;  3ZMN A;  3PUA A;  5FZG A;  1D4M 1;  2I74 A;  2QQL A;  2ARC A;  3M1H A;  4RR3 B;  1Y9Q A;  3UT0 A;  1DDL A;  1AYN 3;  3OG2 A;  1Z7S 2;  4GWJ A;  3ZFE A;  4AFD A;  2XL9 A;  4XFI A;  4GAL A;  1N47 A;  1A8D A;  4DB5 A;  2B39 A;  2P37 A;  3LOI A;  2YU2 A;  1BYH A;  4CUG A;  2PHX A;  4ZZ8 A;  3AKP A;  4AEJ A;  4JGY A;  2VMD A;  1S0E A;  4A42 A;  3NW4 A;  3B00 A;  1DCS A;  2GC2 A;  3H3L A;  3PL0 A;  1C3H A;  1HRI 3;  4MGZ E;  3E6C C;  3FMG A;  3A0K A;  1EUT A;  3ACL A;  2WL1 A;  2RMU 1;  1J3R A;  3J7N A;  1WW5 A;  3MLL A;  1F35 A;  4IES A;  3O1T A;  1JS9 A;  1LB2 A;  4OUL A;  3WF0 A;  5DAX A;  1O3T A;  1FOD 3;  3AP9 A;  1OKQ A;  3EMR A;  3WP5 A;  4LUM A;  2TBV A;  5K8S A;  2XBO 2;  2ZXQ A;  1YEW A;  2VW0 A;  1OH3 A;  1OD5 A;  1FOD 2;  4F3J A;  1FAT A;  4ZPI A;  1V6I A;  3SEE A;  3AKS A;  3WQ1 A;  4Y20 B;  1QH6 A;  1JYI A;  4CDQ B;  3QCW A;  1NUK A;  1WCU A;  5ACA 3;  2E7Q A;  1YO8 A;  4LK6 A;  1UU6 A;  4QKB A;  1GZW B;  3ZYB A;  4FBF A;  4B1M A;  2J1T A;  1SLA A;  1YRZ A;  3HBZ A;  3PME A;  4V1P A;  1PVC 2;  2VEC A;  2A6Z A;  1XYP A;  4IUG A;  2J1U A;  1JUH A;  1UOF A;  4AZZ A;  4OLL A;  3GCX A;  3MV0 1;  4Y20 A;  2Y0O A;  3CLP A;  1D4V B;  2A1X A;  1MQT B;  4EZH A;  3ZFG A;  2B45 X;  5I8S A;  2QQI A;  2VMG A;  3BIW E;  5FFO C;  1OA3 A;  4MGK E;  5BNP A;  3A21 A;  3ZXF A;  4JDN A;  2R07 2;  1YJK A;  4N7I A;  2YC4 A;  2XVL A;  2A71 A;  1AR7 1;  3AXD A;  4Y5T A;  4YW1 A;  1TMF 1;  1I3H A;  4ATF A;  5IVC A;  3POJ A;  4B7K A;  4ZKT B;  5BNO B;  1RUI 2;  1RUE 3;  3ENR A;  1VRH 3;  3KT1 A;  1WBL A;  5B4X A;  4PLM A;  4DIQ A;  5LBC A;  1KEX A;  1MEC 3;  3O14 A;  2XLF A;  3MIF A;  4IET A;  4UXA A;  1B09 A;  1VBC 1;  2VZO A;  4JDM A;  3N36 A;  4M00 A;  3DEC A;  4P9I A;  5FK7 A;  4QHZ A;  3VHP A;  3ZXL A;  3BPZ A;  5LY1 A;  1SAC A;  2DBN A;  2AGS A;  4IEV A;  2I2S A;  4QX3 A;  1AXK A;  4OHW A;  4R9C A;  4HLT A;  2WQ4 A;  1V6O A;  2SLI A;  2YFZ A;  1OLR A;  4QDR A;  4L97 A;  3TEW A;  1DGR N;  1W8W A;  4HZF A;  1YQ5 A;  4F8A A;  4YLZ A;  3O1U A;  2ILM A;  3IIA A;  1I6X A;  4JVA A;  2K9Z A;  3R6S A;  3THT A;  4QPG B;  2CHH A;  4WV8 A;  5J1X A;  5FZ9 A;  4AXO A;  3R4S A;  2D6O X;  3T0B A;  1CAX A;  1UKG A;  2AUY A;  2ZX4 A;  1QMJ A;  1YQ2 A;  4LHL A;  5EHD A;  3ZFE C;  3URF A;  2VUA A;  4M3C A;  1QJX 3;  2JG8 A;  5EXO A;  3LFI A;  2WO7 A;  2ARE A;  5FKB A;  1QJX 1;  2VMC A;  1N1T A;  4QQ2 A;  2GAL A;  2V73 A;  3Q8A A;  3EQE A;  3SH4 A;  1UU4 A;  2B5H A;  2Y6H A;  2VPV A;  1OA2 A;  4AFB A;  2OX0 A;  2ZEZ A;  4PCR A;  5H9Q A;  1GYK A;  5B2G B;  2ZMN A;  4OI0 A;  1GNZ A;  4Q0U A;  1W9Y A;  4NHX A;  4XHB A;  5IK4 A;  2XLA A;  2V4A A;  3L2H A;  1CAX B;  1K5M B;  3OOX A;  1ULG A;  5LAS A;  3W9A A;  3KV6 A;  4E4Z A;  2PXJ A;  4E2Q A;  3ZXG A;  4IER A;  5EPA A;  4PT6 A;  4BQ4 A;  2WNU B;  3VBR B;  2UWB A;  3VZO A;  2P5B A;  4CE8 A;  1TME 3;  4DXT A;  5DDJ 3;  2FBE A;  2ZHM A;  4OZX A; 
#chains in the Genus database with same CATH homology
 4D6R A;  5FZB A;  4D6Q A;  4C8D A;  4GAZ A;  2OS2 A;  2XML A;  5FP8 A;  3LDB A;  3U78 A;  4EYU A;  4TN7 A;  5IW0 A;  3N9O A;  4UF0 B;  3N9M A;  4V2V A;  5A7O A;  2W2I A;  3AVR A;  5FYH A;  5FYB A;  5A7Q A;  4CCL A;  4E4H A;  5A3N A;  5LW9 A;  4QX8 A;  5FZO B;  5FYM A;  3KV9 A;  2GP5 A;  1VRB A;  5FZ6 A;  3UYJ A;  5FUN A;  4QXB A;  3PUQ A;  5A7P A;  3PUR A;  5FY9 A;  4CCN A;  4Y4R A;  3PU3 A;  5FZC A;  4LXL A;  5FZ8 A;  5IVF A;  4EZH A;  4CCK A;  5FYZ A;  3N9L A;  4XDO A;  5F2S A;  5IWF A;  5FY8 A;  5LWB A;  5A3P A;  4IGQ A;  4ASK A;  5FZL A;  4BIS A;  5IVC A;  5F3C A;  2YBK A;  5FZM A;  4LIT A;  5IVV A;  3LD8 A;  4QX7 A;  4BXF A;  3PU8 A;  5K4L A;  5A1L A;  3DXT A;  3U4S A;  5F37 A;  5FWJ A;  5LY2 A;  4DIQ A;  4XDP A;  5FXW A;  5FZF A;  4CCO A;  3NJY A;  5FZO A;  4CSW A;  5A7N A;  5FYC A;  3KV5 A;  3K2O A;  5FXV A;  4NUB A;  5LY1 A;  4CCM A;  3ZPO A;  3DXU A;  2Q8D A;  5ISL A;  5FWE A;  5FY0 A;  5FYY A;  3RVH A;  3AL5 A;  5ANQ A;  2GP3 A;  5FZD A;  2Q8E A;  2WWU A;  5FPB A;  3K3O A;  5FY7 A;  3PDQ A;  4V2W A;  4BU2 A;  5FYV A;  4HOO A;  5FZE A;  5KR7 A;  2YPD A;  3PUS A;  4CCJ A;  3KV4 A;  4HON A;  2XXZ A;  5FZI A;  5F5A A;  4DO0 A;  5FZ9 A;  4QXC A;  5FZ0 A;  5FUP A;  4Y3O A;  5FZ4 A;  4GD4 A;  5F2W A;  5FPU A;  5FPV A;  5FV3 A;  2Q8C A;  5FZK A;  3PTR B;  2YBS A;  4AI9 A;  5FP3 A;  5A3T A;  4AAP A;  5F3G A;  5FZ7 A;  4QWN A;  3K3N A;  5A7W B;  3KVB A;  5F5I A;  5FJH A;  5A1F A;  4QU1 A;  5F39 A;  5FP9 A;  5FPL A;  4URA A;  5FP4 A;  5FXZ A;  3OPT A;  2YBP A;  4EZ4 A;  2OQ7 A;  5FZH A;  3PUA A;  5FZG A;  2XDV A;  3N9N A;  5FYS A;  4QXH A;  5FJK A;  4LIV A;  2OX0 A;  3OPW A;  5FZ1 A;  4UF0 A;  5A7S A;  5A80 A;  5IVE A;  5FYT A;  5F3I A;  5FY1 A;  2OT7 A;  3KVA A;  5F5C A;  2WWJ A;  2OQ6 A;  5FBJ A;  2XUE A;  5FP7 A;  2YU2 A;  2VD7 A;  3N9Q A;  5FY4 A;  4LIU A;  5FZA A;  4GJY A;  4CUG A;  2YU1 A;  5IVB A;  3KV6 A;  5E6H A;  5F3E A;  4D6S A;  3N9P A;  2PXJ A;  5F32 A;  3AL6 A;  5FZ3 A;  5FYI A;  5FYU A;  5CEH A;  5A3W A;  3AVS A;  5IVY A;  5FY5 A;  4Y33 A;  5IVJ A;  2P5B A;  4GJZ A;  3ZLI A;  5A7W A;  5FXX A;  4IGP A;  5FPA A;  4IGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...