5FZ8A

Crystal structure of the catalytic domain of human jarid1b in complex with malate
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
463
structure length
453
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with Malate
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
total genus 143
structure length 453
sequence length 463
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fz8A01
3OPWA 2Q8CA 3KVAA 5FY9A 3N9QA 4D6RA 2OT7A 3KV6A 3AVRA 4GD4A 4LITA 2Q8DA 4AI9A 4CUGA 4GJYA 5A3PA 4LIVA 4QXBA 3KV5A 3LDBA 4IGPA 3AL6A 2VD7A 5F5AA 2YU1A 5F3EA 2XMLA 5ANQA 5FP8A 5A80A 3U4SA 5FXWA 4QXCA 5FZEA 2GP3A 3KVBA 4DIQA 4UF0A 4CCLA 4EZHA 4GJZA 5FZIA 4CCJA 5FYSA 4D6QA 4Y33A 5IVYA 5FV3A 4BXFA 5FZKA 5FY5A 3N9OA 2XXZA 5FPUA 5A1FA 5ISLA 5A3NA 3PU3A 2OX0A 3PUQA 5FZLA 5FZCA 3AVSA 5F2SA 5F5CA 5FP7A 5FY7A 4HONA 4EZ4A 5FPVA 5FXZA 5A7SA 3DXTA 5FZHA 5CEHA 2YU2A 5FZ1A 1VRBA 5FYHA 3PUAA 5FYIA 5F37A 3KV4A 3KV9A 3RVHA 2W2IA 5FYYA 5A3WA 3K2OA 5F2WA 5FUPA 5FZ6A 5FZ0A 5FP9A 3K3OA 5LY2A 5LY1A 3PTRB 4CCMA 5FYVA 5A3TA 3AL5A 3PDQA 5IVFA 4V2WA 5FZ7A 3N9MA 3N9PA 5FZ3A 5FWEA 5FPLA 5FYZA 3OPTA 3NJYA 5FYTA 2GP5A 5FZGA 4E4HA 5FXVA 5FZFA 2XUEA 5FP3A 3PUSA 5F3GA 5FYCA 4BU2A 5FY1A 4Y3OA 5IWFA 5FBJA 5FYMA 5A7PA 3ZLIA 2XDVA 4QX8A 5F32A 5IVBA 5FZ8A 4CCKA 5FZMA 5IVJA 2OS2A 3PURA 2YPDA 5A7NA 5FZBA 5F5IA 5A7QA 5FJHA 4QX7A 4QXHA 5FP4A 2WWUA 5FUNA 3U78A 4LXLA 4EYUA 5IVCA 2YBSA 2Q8EA 4DO0A 2YBKA 4NUBA 4C8DA 3UYJA 3ZPOA 2YBPA 4IGQA 5FZOA 4ASKA 4GAZA 3PU8A 4Y4RA 5FY0A 5A7WB 5IVEA 5LWBA 3LD8A 4QWNA 5KR7A 5FZ9A 5IVVA 5FZ4A 5A7OA 4CCNA 4D6SA 5FWJA 4XDOA 2OQ6A 5FZAA 5FZDA 3N9NA 3K3NA 2WWJA 5IW0A 5F39A 5A1LA 5K4LA 5FY8A 4BISA 4URAA 4LIUA 5E6HA 5FPBA 4IGOA 5FY4A 5A7WA 4XDPA 4V2VA 4HOOA 5FZOB 3N9LA 3DXUA 5FYBA 4UF0B 2P5BA 5FPAA 2OQ7A 5FXXA 4CSWA 2PXJA 4TN7A 5FYUA 4QU1A 4AAPA 4CCOA 5LW9A 5FJKA 5F3CA 5F3IA
chains in the Genus database with same CATH superfamily
1JUIA 4AOCA 4PHZA 3OUJA 3VBUC 5HXMA 2IVIB 1OD3A 3ILRA 4XILA 4ES9A 4GD4A 4MGIE 1YC61 1FOD1 4Q8KA 4I02A 1JYTA 3OBTA 1A3KA 1U12A 1CIYA 3TEXA 3AL6A 3WW4A 4M3CE 5GLTA 2BFUL 2QCSB 2PHRA 3MIBA 1QJX1 1A8MA 2HBTA 5J37A 4X6RB 3LFMA 4L11A 4LBMA 4ZXEA 5DZEA 2AGSA 3B93A 5CG9A 1AR72 1FMD1 5JVVA 1YCIA 3I97A 2RR13 1ZVFA 3J7LA 4GMP3 1XXNA 4FT8A 3TOJA 1RIRA 4FOWA 3WG4A 2AEYA 1SBFA 2JDAA 5A1FA 2K9ZA 4QQ2A 1NUKA 3KZ4C 4QGNA 5FZCA 5IFTA 2ZJCA 4Q4X1 2EXHA 4YPJA 4GB32 3AZWA 2IXHA 3HNMA 4E2SA 2HWD3 4ZPIA 4RFT0 1YFYA 4CZSA 1GP5A 2BBAA 2ZMNA 4DFSA 4RN5A 1H1IA 5J09A 2BRTA 2ZGUA 3B00A 1ZZBA 1MPXA 5FYHA 2WQZC 4BMBA 2ZHMA 4X8PA 1WMDA 5JXIA 4F8AA 4RL7A 4BB3A 2GZWA 2VULA 4CDUB 4A7YA 1JS9A 4IE4A 3ZN6B 5A3OA 1YQCA 5HV4A 1KJLA 4BJ0A 2ZTNA 1LHWA 1QJY2 1UZVA 5FZ7A 5JUVA 4P5YA 1N1SA 2NLRA 4YVSA 3H0OA 2L9LA 1HKDA 3AMHA 3VDDA 1XJAA 4XUNA 2NM1A 5BXXA 3GZAA 3PUSA 5JPNB 4LBNA 5FY1A 3FHQA 2ES3A 3WDWA 5FYMA 4FFGA 3VD4A 5FUIA 2GMEA 3UNPA 2QFEA 4FP3A 4JGZB 1TQ5A 3I7DA 2YY1A 2R32A 4LO7A 5J1XA 5IK8A 2MHFA 4Z1VA 4OHVA 5I0SA 1X50A 5A7NA 1RUD2 3E5UA 4Q0QA 2VUAA 5FZBA 4BLIA 1LGBA 1IG3A 4MXWB 5FJHA 5I8YA 2V09A 3N3HA 2YROA 5FP4A 5L9BA 4Q1RA 5KHJA 4LR4A 4QX1A 4YGBA 1RJ8A 1DIWA 4FXKB 2RJ2A 4FPOB 1O4YA 3MLLA 3GF6A 3DPRC 4JKKA 1NCQA 2WS92 5C33A 4I30A 5AFEA 4D6SA 1JXNA 3HIFA 2E7QA 1M06G 4OI2A 4C90A 3S5QA 2WWJA 3QH7A 4FTBA 1OPOA 3H8OA 3T2PA 3MIEA 5CIRA 2Y0OA 3I59B 3DV8A 1JZ5A 4PDWA 4IGOA 4IV1A 5E1RA 4B7EA 5FPXA 3EXUA 2YC4A 4N9IA 4P9WA 4QU2A 3WNMA 2ZX1A 5FYBA 4UF0B 2VTXJ 2Z42A 2QQNA 3ZYFA 3USUB 1UWWA 1F9KA 4DUXA 2HWF1 3TYJA 4YARA 1O6UA 5FYUA 1UOBA 4AAPA 3SHRA 3D8CA 3UGFA 4E8CA 4Y22A 1W3XA 1WUVA 1VE0A 4UW5A 4CEYA 4NE9A 4R8HA 4H55A 4YZ4A 4YM0A 3SXWA 3WF1A 3POBA 5LK5A 1RUH3 1HV0A 1NCRB 1QXPA 4F3JA 4Z2AA 5GZCA 4JGYB 3AKRA 3TN91 5I0TA 3CBNA 3ZKUA 1RUF3 2C1FA 3AMNA 1A6CA 1W0NA 3EMRA 1PMJX 1HDKA 4QPIC 4XUQA 2QDNA 5F3EA 4DMIA 2C0ZA 4NWWA 4R9BA 3DYMA 4M3CF 3JQXA 1GP6A 5D1IA 4BIFA 4CCEA 3JCIA 5CYYA 1VBB3 1QHDA 4HXCA 4DIQA 5F1RA 5EYXA 1JYWA 1DCSA 3H7YA 4Y1UA 3KM5A 2J1VA 3O1SA 2A6YA 5FZKA 4XIKA 1VBE3 1EP0A 2OA2A 1WCSA 3JXSA 1HIXA 3FC0A 2HH9A 3CJIB 5LK7B 1YI9A 4X8NA 2O8OA 3MIDA 3RZHA 4FTEA 2W91A 2PHLA 3C7GA 1Y9GA 5D8AA 4NIHA 2VQTA 2EIDA 2R6QA 5EJZB 4MSVA 5EJ1B 4U2AA 1K45A 3BVCA 3E6BA 1K5MB 5F37A 1WLCA 5GLVA 3ZX7A 3S7EA 4CDQA 1DU3D 2VUCA 3T4HB 1QU0A 1PIV3 3CJXA 3RZKA 2I45A 2HWB1 5H9QA 4XAEA 5B4XA 3D5OA 2WNVC 3RJ2X 4S2GA 3SKJE 2HWD2 1W6MA 1S0DA 3RMYA 2ZHKA 2QQWA 2D43A 1HRI3 2FHRA 5CKQA 5FWEA 1WBFA 2GDFA 3C7OA 2ZGSA 4E4HA 1VMJA 2A3YA 2P37A 2Y6GA 2QQOA 1U5YA 3AP4A 2RVAA 4UFJA 3WCSA 1QDCA 2VMEA 1AR61 1P8JA 3P3PA 2RV9A 2ZGRA 5A32B 1MZ6A 1SFPA 1DGRA 5KXBA 3T0DA 3TEZA 3NQHA 3HR9A 3M3CA 4QT6A 1F35A 1US2A 1SBEA 4MGSA 5BNNA 3FZ3A 3LKJA 1RJ7A 4LULA 4MO3M 2R1DA 5E88A 5KHHA 4WZCA 3USUA 4P5HA 1ZREA 3HQXA 5BNOA 1PGL1 5JIUA 1XC6A 2YBPA 2DV9A 3POEA 4QDSA 1Q8QA 1H8TC 2ZAHA 5IVEA 5LWBA 1QJX2 2ZGPA 5JOXA 1ST8A 2VG9A 4HSLA 4JQTA 4Y1VA 3WOGA 1CAUB 2VC9A 1J1LA 3F95A 4KBZA 1QQP1 5AC91 3H1MA 4O65A 4BQ4A 4OI0A 1FPN2 4G9SB 1H8VA 3LFIA 2WO3A 3B9IA 3M8LA 1Q5OA 1VBD2 3J26N 5A6QA 1ZX5A 3MW3A 4B8EA 1BLZA 4JDNA 4I2OA 2BYVE 2WFF1 1UYPA 2CAVA 2JX9A 3I59A 1CAWA 4AVSA 2DFBA 2A7AA 5HPOA 2JG9B 1FMD3 4QGMA 5K7PA 5JPMB 4B4QA 3BTAA 3IIIA 4BA6A 1CGPA 2WN2A 4N43C 3Q8CA 5FTTC 4AAXA 4BDVB 5KXCA 1EUTA 4XW3A 4OVEA 4NHMA 1SZBA 1XBFA 4WBBA 1ULDA 4L92A 1H8TA 1QJY3 2PLV2 4AEJA 5L73A 2B7YA 4KNCA 4I0AA 2HWD1 3KVAA 1UMZA 3MW2A 5FMCA 3OD4A 4PBOA 1NZCA 4QQLA 4M0NA 2VNVA 3D6EA 1F31A 3OYWA 1ZRCA 5FFOC 2QZ3A 4YM2A 4RQPB 1JZ6A 1MZEA 3BYWA 4IGPA 4I0WB 3UT0A 1V9U2 1LODA 4AZZA 4K20A 1W2TA 2W9XA 3N7KA 5F5AA 1HB2A 3ZYGA 1RUC3 1H8TB 2NZ9A 4Y1ZA 5LBCA 4FO9A 2IVJA 4N43A 1W9WA 1UY3A 5L7OC 1GNZA 1E57A 5BY5A 2PHUA 4LUKA 3ATGA 1W0OA 2BWAA 2GMMA 3NL1A 4JHTA 2QKDA 5GZFA 4Y33A 4K8RB 5FKBA 2GALA 2H6BA 5FBZA 2VCBA 5A3NA 3PU3A 2FCVA 4YM1A 3THDA 3S30A 3W9AA 3AVSA 1GNHA 3OTFA 4Y5TA 4CVUA 1WMXA 1XYPA 1OH3A 1UZWA 3JBG1 3QACA 4CDUA 1UXXX 2ENRA 1W9YA 5C8CB 2PELA 2NQYA 2ZMLA 5L7OA 4AQSA 1FXZA 3PVEA 4N7UA 5LY1A 1IZ3A 5FLJA 2MEV3 4JRAA 2E6VA 1TE1B 1NX9A 1Q8SA 2KR2A 4C1WA 3J7MA 4E27A 2Z69A 5BNNB 1PM4A 4LKFA 1AX2A 2P6CA 1OPMA 1VAKA 3AFGA 4IDZA 4J1XA 4PLNA 1X9PA 3NJYA 3NV2A 3ZYBA 1I1EA 3KCXA 2BU9A 2WO1A 1W6OB 2WR9A 3HQUA 1V6JA 5HCFA 2Q1MA 5F3GA 5FYCA 1O3RA 4Q4V1 3GJAA 5EZWA 1QWRA 5JI9A 4Q4Y2 1QJFA 3OG2A 3ZLIA 3AX4A 1UX7A 4QB1A 4XEZA 1ENXA 2O0OA 5T5LA 1AVBA 2A6ZA 2DCKA 2G9ZA 4CU6A 3FLRA 4LLOA 4Q29A 3T30A 1ULOA 4CRQA 4LKDA 1S2BA 4RA0A 5F5IA 2ORXA 3VBSA 1QEXA 5DN2A 1LHUA 2RG4A 3U78A 5HV0A 2AC1A 2MPFA 4JRLA 1PGW2 4BE3A 4XZUG 4A44A 1DGWA 3LSEA 2SLIA 2VBDA 4HK9A 4ZZ8A 4Y4RA 3VDDC 1Y9QA 3C8XA 1W8OA 5EQUA 5CFDA 3ZIXA 3AKPA 4NROA 2CDOA 2OIIA 1VP6A 4Q0UA 2BPA2 2Y64A 5E16A 4WVWA 5JWPA 5DZGA 1AYN1 1JHJA 2PHWA 1RUD1 3S57A 2B9UA 2XWJB 2YGMA 3RWKX 5A1LA 2CU5A 4LK7A 1KJRA 1QH6A 4URAA 1AR91 3TNPB 1OOPB 1VBB1 3J7NA 1C4RA 3KQRA 4KWLA 2YV8A 2HWC3 2E32A 2VUJA 1UYZA 4K3UA 5C3SA 2QTWB 1ULFA 1J84A 2GC2A 4CP2A 1VBE1 3ETPA 2VOKA 4UT5A 4EN0A 5CG8A 2Z4FA 4LOSA 4EN8B 4I0BA 1F15A 2ZACA 1HJFA 2WO2A 4LOTA 3T2TA 3ZYIB 3OCPA 1KDMA 3CIHA 1EV12 4BK5A 3W5NA 3LGRA 1KS5A 4JGYA 3OF1A 2WT1A 3AP5A 1FPN1 4DXSA 3V56A 4B4PA 2VZOA 3THPA 4DEVA 2IFWA 2A70A 1C8M1 1OKOA 1W9SA 1G6NA 1RVF3 2VD7A 4LQRA 4O61A 3UJQA 2CWSA 4HETA 4AI3A 5CFCB 3M3EA 4P9GA 4QAWA 1J3PA 3B69A 3I3QA 2ILMA 3GHMA 4BLJA 1DQ0A 3LQCA 1WMFA 4YZ1A 1G86A 3LEIA 4UF0A 2JKXA 3VZOA 1S0IA 2BGCA 3ZM8A 4META 1CONA 5H9RA 2R0HA 3FBYA 3IIAA 1KXGA 1NOVA 3AZVA 5SV8A 4QPGA 2B42B 4RGKA 3PUQA 3LB9A 1PNFA 4UAPA 2ZS6B 3HWJA 3U37A 5F2SA 1IS3A 1X8MA 3ENRA 4AFBA 1BJQA 1OD5A 1VBA1 4LHLA 4MZUA 4P9YA 3TRSB 4BK4A 2F4PA 1ND2C 2J1TA 3ES4A 5DABA 4BWOA 1D2SA 5FYIA 5J98B 5JOYA 1OVPA 4CP9B 4K1ZA 5KHGA 1JYCA 2FD8A 2DTYA 2AACA 2HBUA 2XLGA 5LY2A 3T2OA 5EIYB 2AUYA 3MDPA 4FPCA 4P02B 3DPRA 4XJWA 2F4LA 1NCQC 4RS5A 3ZR6A 2VZPA 3KQ4B 1UL9A 2OPKA 1U5XA 4OMCA 4P9XA 1G8WA 3GZTB 1DGWX 4QPGC 5AC93 5JSOA 4D8MA 1SFNA 2GP5A 4OQ9A 1ZM1A 3QOPA 2JIGA 3VZMA 2FZ2A 1SLTA 4K6BA 5IWFA 3ASIA 4RGAA 2I2SA 5A7PA 1JOPA 2VAUA 3NAPC 2CAUA 4CDXA 5AFBA 3AB0A 1BZWA 4L97A 2A3XA 1CZTA 4CU7A 4LORA 1V0AA 2AR6A 3NNJA 4M4PA 3R6SA 5J7MA 1V70A 4IEYA 4QX7A 1DGRN 3FN9A 5IK5A 5LB6A 1RUI1 2P1BA 4YW2A 5FUNA 4ZKTB 1Q8OA 4PI2A 1WBLA 4AW7A 2Z2SB 2XVGA 2RR12 2ORZA 1T6BX 3P1IA 2ZEWA 2GNBA 1V6LA 5FZ4A 4NVPA 4BQWA 1JZ7A 4XC9A 1LOEA 1G9FA 2ZAAA 3I3DA 4AVBA 4HPKA 4CP0A 3ZMOA 5FZAA 2VVEA 4NOTA 4BMEA 2VR4A 1W2AX 2ZGOA 5F39A 4QKNA 4E2QA 1EV11 1DYKA 1KDKA 5KHIA 1OC1A 5A7WA 5GZDA 1PGSA 1DBNA 3LDRA 5FZOB 1IHMA 2W39A 2ZGLA 3FX3A 1DQ2A 1TVGA 2P5BA 2PFWA 1A34A 1U5ZA 1QNWA 4KWUA 3I2KA 2WT2A 1I3HA 3ZO0B 4QDQA 4XF9A 4Y5Z0 1VMFA 1CAVB 3AVRA 4LITA 1ASJ3 2KM2A 1PHMA 2Q8DA 4IERA 3M2MA 1V6IA 2JE8A 1VRH1 4XF0A 4CUGA 2Y26A 1UKRA 2W1QA 3QH6A 5FKCA 1ONAA 1WMEA 5KBFA 4AEKA 2HKXA 3NV1A 3UKVA 5JCTA 5FP8A 4CU8A 3ACIA 1J1TA 2P3KA 3ST7A 2EAAA 1R083 1GWKA 2CV6A 4QXKA 3TBDA 4DXRA 3MPBA 4KG8A 3Q9OA 5GLZA 4A45A 5CA6A 5CAZA 2GP3A 2V73A 1JTZX 3MYXA 1GQPA 1Z7S1 4MADA 3MPPG 4CCJA 5GJ6A 4CYDA 2W3JA 5J96B 1OA3A 4CE8A 2BWCA 3HT2A 1MS8A 3NSTA 4UBGA 4YW1A 3H8UA 4KG0A 5F5CA 4IE5A 5FP7A 2UURA 3K48A 4RD7A 5JXGA 5LBEA 2DBIA 2VXRA 3BN6A 4K40A 4LBQD 5J48A 3K46A 3UJOA 1C5IA 4AF9A 2CY6A 2RS32 1CJPA 3NAPB 5CEHA 1H4HA 4KBBA 3E6CC 2DVBA 3WP6A 1WZXA 2FMDA 1ZA7A 4YW7A 3AP7A 4AHYA 2BVBA 4ZONA 5FZ0A 2BGOA 5IJRA 1S0GA 3LWCA 4XZPA 3CU7A 2WZ8A 3AZZA 5FYVA 3T0AA 3AYCA 3PDQA 4V2WA 1YNAA 1DP0A 2ZGNA 3HOBA 2JE7A 4Y26A 2ZEZA 2ERFA 3C7FA 1WWYA 3I8TA 5IT6A 1NE6A 1CZSA 5ACA1 2CSGA 1Y9MA 4XF3A 5FMDA 4LTAA 1CR7A 4JKMA 1ND3B 4YVWB 1S0JA 4R9DA 3G6JB 4BU2A 2JXAA 1PNGA 2B8MA 4AHZA 4BQXA 4IETA 2ZABA 5G04L 3JUUA 1BEV1 3WT3A 3R0RA 1M4WA 2RHPA 3MO4A 1RUJ1 2J7MA 4CXYA 3VBRC 4AFMA 5A7QA 4MGKE 4HN0A 1SQ4A 1QIQA 5CFCC 4WM7C 3OGSA 5CISA 1RUI2 1GZCA 3VBUA 3UYJA 1W6OA 2SBAA 1CAVA 3PVBB 3I54A 3JZVA 2D3PA 1POV3 1UOJA 4JAAA 1XYNA 3E1F1 4XQWA 4F83A 4YFZA 3IMMA 1AXKA 1H0BA 3VV1A 1VBE2 1GZTA 2YGLA 1W8NA 2HWB2 4DUVA 5HI0A 2GC3A 5FO8B 3R4SA 1O59A 2BUKA 5L9RA 2DUOA 1RVF1 3ELNA 3VBFC 1MZ5A 5FAXA 1FOD2 2QQKA 3FBMA 2A5ZA 5F6LB 3IN9A 2WYSA 5C8CA 2VBBA 3O5SA 4W65A 1H2LA 1OUSA 3EBRA 4HN1A 1PIV2 4OUSA 4QX0A 3WW1A 1YIFA 4NHXA 1RXFA 3ZXJA 5FIXA 4P9IA 2VPVA 2X5IA 4Q1PA 2DVGA 3O1RA 3I2HA 4XXPA 3VBHB 2OPWA 4ZHNA 5M0TA 1QF3A 3S0MA 2Y6HA 3A23A 5F3IA 4BOWA 4FXGB 1JI6A 4CDUC 2V4AA 3AC0A 4YFWA 1UOGA 5BNOC 3MV01 4NO4A 1POV0 3D0JA 1S0BA 1C5HA 4AI9A 5C3QA 1G7YA 3T3YA 1OOPC 1FI2A 1UYXA 2EF6A 4LIVA 5A3PA 3I2OA 2A75A 2BERA 3ZPYA 3J8F2 1UY1A 3VKNA 4JCKA 2HEWF 3BTXA 4FPYA 1ENSA 3CZJA 4IEUA 2YUEA 2W1WA 4TLGA 2AYHA 2PHTA 3AYAA 2XMLA 2QJVA 3NRUA 3HNBM 2D93A 4OULA 4YGEA 1BBT3 1BK0A 2FDKA 4AGVA 4QXCA 1TME2 2D6KA 2RJLA 3MIHA 4OCTA 4EWDA 1GOFA 1EY2A 2AREA 3CLPA 3BPZA 2WRAA 3POSA 3NWKA 1APNA 1RHI1 5LBFA 1DZTA 3N9OA 1YHFA 1YEWA 4DY5A 3OGRA 3JD72 5LA9A 2P34A 1YFWA 1AXYA 2G9GA 2OX0A 4QHBA 1X7NA 1DZQA 1YFUA 3DPRB 1WLDA 3HJRA 3N7MA 4COZA 2JICA 3OBZA 3DECA 3M70A 1GLHA 1DHKB 1LOFA 4FI9A 4PT6A 3SNMA 2NYYA 2OUHA 5LA1A 2YU2A 4IEZA 1LHVA 2CGPA 2ZPXA 5A3WA 3WP3A 4N8MA 2Z79A 4K1YA 1RHI2 1TEIA 5DUXA 3ZDVA 4DQAA 4LKSA 2FCUA 4H14A 4UI9L 1PX3A 3UL2A 2RDNA 4NN0A 3WCRA 2JG8C 2WC2A 2TNFA 4AE2A 3J9SA 2LUWA 2HJIA 1WA4A 2ZGMA 3NV3A 4QPYA 5IYYA 3T4VA 2CL2A 3ZXEA 3BI3A 2NMOA 1LOFC 3FL7A 4COVA 3CEWA 1FNYA 4TZDA 4XUOA 2YFUA 4LHSA 3AMMA 4CEWA 5F9TA 1GSLA 3IDBB 1DF0A 2QNKA 1VB2A 3MF6A 5A32A 1O3TA 1XU2A 2A1XA 2NPIA 4HVRA 1OLQA 3QLQA 4CU9A 1RUC2 5JSPA 4HKOA 4LO6B 1IPJA 4M01A 4XHBA 4XXAA 4MGTA 4XYXA 4CEYC 4EYUA 5LCWL 1NA1A 3TB0A 3VBOC 3WF4A 1O5LA 1O8SA 2VNRA 4C8DA 4YZ2A 1JHNA 1GZWA 1ZBA1 4CDWA 1WCUA 1RUH2 1EAH1 4ES8A 1JZ8A 4BQ5A 3ZFEA 1VRH3 1UYYA 2B5HA 2ZCWA 5LBBA 1JN2P 1O3QA 4YLZA 2WIIB 3GGLA 1PVXA 4IEOA 2K46A 1BVP1 3E6DA 3K3NA 1J3QA 1V00A 1UZ0A 1IS4A 4K8FA 1R081 1SLBA 4CDQB 2CTVA 4XE9A 2J1EA 3EJKA 3WV6A 2XJTA 1UIJA 1AF9A 2JWPA 1XE7A 3L9JT 1Z7S3 5BYNA 2CDPA 1QJEA 5EXOA 3BOWA 1V6OA 3GBFA 2JIJA 1RC6A 4AVAA 2UY9A 5CFDB 4GH4C 1OXCA 2GSYA 1GR3A 4ORFA 2A3WA 1QXRA 1VAMA 2BDRA 3IMNA 1W03A 3PTYA 2WSUA 1LJ7A 1BEV2 2W94A 4O7XA 2CGNA 2D7FA 3AJYA 3VL9A 4Q4Y3 1H9WA 2C4XA 2YFZA 3MFCA 4FFHA 3KGZA 4J6GA 1BBT2 4ITCA 5ACA2 1GWLA 3N7JA 4YZ3A 3RFRA 2XWBB 3C2UA 4MVTA 5K8SA 3C3VA 1S2EA 1W6QB 1O3SA 3G7DA 1IOAA 1JBCA 3H3UA 4ZU7A 4CEYB 3UV9A 4LKEA 4S2DA 4CP1A 4QHOA 1UF2C 1MQTB 3U10A 1YYNA 5JLVA 1ODNA 2W68A 4YVSC 4WM8B 1YXWA 1IPKA 1RMU2 5CVRA 3BIWE 1JYIA 1CX4A 4HONA 1Z0HA 3F2ZA 3O7OA 4FPHA 2VMFA 1VBB2 3MFAA 3VL8A 1RUJ3 3WG2A 4ET7A 5L7OB 1HRI2 3WXPA 3U75A 1Y7BA 4RR3B 1FOD3 4IV1B 4UYBA 2D5HA 3WHUA 4JC1A 3KB5A 4JKLA 1H2NA 2VW0A 3JD73 2Q8OA 1CN1A 4D0QA 2HWC2 2BBVA 3GM8A 2IFRA 4CCMA 1O8PA 1QJX3 4SBVA 3NJVA 3AL5A 4QQHA 4BQYA 4QM8A 2D3RA 2PQQA 3DKWA 5FZ3A 4AI2A 3B3QE 2G19A 1ZNPA 5D21A 2WFF2 5DXDA 4MGZE 2LM3A 5A70A 2E63A 5T54A 4WV8A 4GMP1 2JKBA 1UQXA 3RGBA 1HRV2 3MHZA 4HLTA 2AH2A 5JSRA 1PVC2 4N43B 4XIOA 1K5MC 5FO7B 1Q3EA 2VO5A 4FOVA 3ZOIA 2VJXA 5B4NA 2X29A 5GLWA 4FPGA 1MVQA 2EAKA 4JGZA 2R30A 2VECA 1COV3 3OGVA 2Y6JA 4N53C 3RS6A 2QQIA 3FUOA 5IVCA 1XQNA 3Q8EA 1LENA 3BU7A 2Q8EA 1VBD3 3NKTA 5D2AA 4QX3A 5JZGC 3AZYA 3OGGA 1W9TA 5HXVA 1JZ3A 1VBC3 3CKHA 2EIEA 1SDWA 4CPBA 3HN3A 1AR62 5A7OA 4HANA 4FP2A 4CCCA 3J4UH 4AVTA 4XDOA 3SC7X 3BTZA 2OQ6A 3ZN6A 3K4AA 3FUQA 5A33A 5JR7B 4BPZA 2X10A 4QX5A 3WQBA 1BBT1 4GWIA 5KWRA 1R1A3 3KT1A 2OVUA 3JBG2 1RUE1 1K3IA 3NVCA 2ID4A 3ZIWA 4XHXA 2I74A 3N4MA 1RHI3 2VL4A 1NA1B 4CDXC 5FPAA 3GZEA 2EXJA 3VBHC 4S2HA 1VLNA 5I8TA 2GAUA 1UY2A 2Q0AA 3VD3A 4GXLA 4XCBA 3WNKA 5F3CA 2ZHLA 1JUHA 1U5IA 2IC1A 5FY9A 5GZGA 3RWNA 4XTMA 2PLV3 2PQSA 4JHZA 1LNSA 2VU9A 5FOBB 4OHZA 3VBFA 3VBFB 1UZYA 3GXUA 1JZ2A 5KXDA 1K42A 3NJZA 3VKMA 5D8AC 2VGDA 3MF9A 3NO8A 3OSDA 1V9U1 1E5SA 1QKQA 1NLQA 3DL3A 3GBGA 4GKYA 5EJ3A 2LRPA 2X05A 4QD2A 4NHLA 5A80A 2QZ2A 3GDBA 1OT5A 1W8HA 4XUTA 2EIGA 1N1VA 5HCBA 3KVBA 1C57A 1AX1A 5C9AA 2WNUC 1BKZA 1W6NB 1PZ8A 1ZRRA 4BXFA 1OFNA 5AVAA 4JX0A 5H9PA 3WEZA 1AXZA 4AFDA 1Y4WA 1UOFA 1ZRDA 1PO22 4FAGA 1AJOA 1IKPA 3IAQA 1W2UA 1REDA 2RMU1 2WLQA 3NNLA 4QMAA 4XJAA 5IAXA 1D4VB 1GOHA 1UCXA 2XJRA 3OPZA 5CFCA 4QPIB 3CDZB 2A6VA 3RI8A 1ACCA 1HW5A 1EYBA 4P9JA 5FYYA 3K2OA 2QQMA 2XLAA 3M1HA 4Q0VA 5FUPA 4MGYE 5GLUA 2XVKA 3AKTA 2WNUA 2OW4A 4FQ4A 4GQ7A 2VZRA 3BUCA 3ETQA 3N9MA 3B02A 5GZEA 1MVEA 2HYXA 2R16A 1CWPA 1KGYA 1N1TA 1EPZA 2F6BA 3DYPA 1HRV1 3H50A 4IE7A 5FRAA 2W95A 4MV2A 4RYDA 5KHKA 3J7HA 3WDYA 3PURA 4UFMA 1UO9A 1STMA 1MEC1 3KS7A 3OB8A 1LRHA 3P3NA 1L7QA 1U0AA 2IXJA 3GNEA 2O1QA 4UFLA 4AI0A 1XNTA 1YJLA 2D6NA 1WW7A 2WWUA 3WZ1A 2WZR2 2YBKA 4RR3C 3VKOA 1PIV1 4OZXA 4AHXA 4ONUA 2DFCA 3H3LA 3BGAA 4HMZA 3SH5A 5HBAA 3RG0A 1ULCA 2WZEA 3SITA 1HRI1 4W6XA 1IPSA 5CKMA 3T1MA 5JOZA 3VD7A 3VN4A 1RVF2 4CUBA 1W8WA 3WF2A 4AEMA 5EV7A 1AYN2 3PIGA 1JYVA 3ZYRA 3DCQA 3UGHA 1US3A 3SCGA 2VW2A 4E8DA 1MQTA 4LJHA 4PDWB 1VR3A 2D6MA 3DGTA 3VHPA 3VDAA 4XDPA 2ZGQA 1YLLA 4HOOA 4BZ4A 2WS93 3E97A 1AR63 1EAH2 4IUGA 2OQ7A 2V5DA 4XTPA 5I8SA 3O0XA 1IS6A 3GALA 4CCOA 4LNVA 2NMNA 4KU7A 5LW9A 3U11A 1DFQA 5JMCA 3DKQA 4B7KA 1AYM3 2D6PA 2DVDA 5EPAA 5CB7A 2Q8CA 3RZZA 2X53S 5CADA 1UU6A 3KV6A 2WINB 1LCLA 1GNYA 5IK4A 4N90A 5CZKA 4YZ5A 1GU3A 1MQTC 4XF4A 4IE0A 3BKZA 1F5FA 2DUPA 3HN1A 1QQP3 1UNBA 4YW6A 3ROUA 4X6QB 1MS0A 2C9AA 1CPMA 2JG8A 2YPJA 4QKBA 2FMYA 2R042 3HEIA 1I9RA 4YG6A 5EYYA 3FFQA 5ABJA 3HBKA 4CA9A 3VDDB 1Q56A 4GZ9A 4EZHA 1W6PA 4ASMB 3FE5A 4AL9A 4YM3A 1AR92 3T1LA 1DZRA 4C0BA 3Q8FA 4XFAA 4ATEA 4A6SA 4XBLA 4A2UA 3WNXA 3LSDA 2FDFA 2X09A 3D82A 2D6OX 1YWKA 1ZA4A 2PTMA 4O9GA 1W99A 2VY0A 3VBOA 2Y38A 1ZZ9A 3KV4A 1PVC1 1RUG3 3ZSEA 4DB5A 1VBD1 1Z7S2 4YSFA 2O14A 5L9VA 2VM9A 3KWVA 1QY4A 1BXHA 1QOSA 2BNOA 3IB3A 2W87A 3POIA 1VBC1 1J83A 2RM23 5F5QA 1CVNA 4TTGA 2Q30A 3O12A 1PO13 3PUIA 4A4AA 2JENA 1XNBA 4XOGA 4P9LA 4R52A 3RJRA 4OLLA 3SH3A 3PMEA 1WGPA 4LHKA 4CEWB 4TXWA 1QDOA 1UAIA 1NT0A 4QHZA 1LHNA 4BM8A 3I2DA 2RDRA 2XQXA 4Q4W3 2VMHA 1RUE3 3M3QA 3CMGA 3RPQA 4BHPA 2XL9A 2ZX2A 1KRIA 1LOCA 1OLRA 5FZ8A 3BIEA 2WSVA 2CWMA 3ZXDA 1W90A 1S0CA 3W20A 5C4WB 5LRRA 3SLIA 3HMYA 2Q1ZB 4ARXA 2VOVA 4HT1T 4GH4A 2OKXA 5KXEA 4FFIA 3PVOA 1D4M3 3AMPA 1DLCA 2XHKA 3L2HA 4PIYA 1QOOA 1MS4A 1C8NA 3H42B 3ZPOA 2MNGA 4LE4A 5IUQA 4BCUA 2PLV1 4UXAA 4WM8C 1AJKA 2H6CA 4AFCA 1LULA 4QQOA 5FY0A 3H8RA 5FR3A 2FDJA 1C1FA 1RGSA 4A3XA 1RMU3 4RHV1 4CCNA 5IAVA 4D7YA 4BIOA 5I91A 2YC2A 2NN8A 5DQ0A 2WA3A 1WCKA 3MGUA 4HPKB 4A6OA 3OJBA 1YQ6A 1XPWA 5FY8A 3LCPA 4L99A 4PQ9A 4Q4V3 5A3MA 1QJU1 2WKKA 5E6HA 1E5RA 1QGLA 1WD4A 5A3LA 4DS0A 1LESA 1UXZA 3N9LA 4N9HA 4XBNA 3WINE 3WUCA 2ZEXA 2LALA 3AKQA 3WP4A 4CEWC 5LEJA 3GHNA 3O1OA 4C1XA 1N3QA 1RB8G 1GV9A 1QOTA 3MW4A 4IV3B 5LASA 5FXXA 5FK8A 4PIZA 3T09A 3MBWA 3EYPA 2JDKA 4FVVA 4GWMA 4QU1A 5FREA 3SH4A 3T08A 1SLIA 4D69A 1CAXA 4AEDA 1D0GA 1J59A 2DCYA 2ZZJA 3OPWA 3KCCA 4XDQA 2WYFA 4D7SA 1W2OA 2D6LX 2J1SA 3A0KA 5T50A 2RMU3 1OQ1A 3LOIA 3BODA 5ABJB 2GH2A 2FCTA 1YRZA 1RINA 1YO8A 4ARYA 3WUDA 3ZXAC 2N7GA 4GWJA 4MOAA 3I4IA 1LOAA 4B1LA 1NLSA 1PK6B 2CNAA 4D7TA 1ND2A 3K77A 1RUD3 4MGQA 1D0HA 2G9FA 3EHKA 3AYEA 5J36A 4Y20A 3RZGA 4FAHA 3V0BB 2QQPA 4HSJA 2FDHA 2OZ6A 1AR93 1UMIA 1OLME 2WLPA 3GZUC 4DRVA 2HWC1 4RS5C 1O4ZA 3KF3A 1Z78A 4GJZA 5F8PA 5FZIA 3ZN5A 3POWA 3ITQA 1Q8VA 2IXCA 3KSCA 3OBRA 4TLFA 5FPUA 1GWMA 5A6YA 3I2IA 5F6KA 3WDXA 5ISLA 4V1PA 4AGGA 4LA2A 2XLFA 3O0WA 3AZXA 1R082 1ZBE1 3T2QA 3TEYA 3W21A 1GZ9A 3SISA 1OSGA 2ARXA 2ZKLA 1H30A 4EZ4A 4BQ3A 1YIPA 5ERLA 1IQDC 1MEC3 3FMGA 1DQ1A 4DY3A 2R073 2FDGA 4LBQB 3M7AA 2XOMA 4EN9B 1VRBA 4W50A 4L0PA 4EN7B 2OZJA 1NZIA 3E5QA 4GALA 2Y6KA 3K75B 5FP9A 3RNSA 3PNAA 1C8M3 2WWSA 2XB6C 3A7QA 2PAEA 3B01A 2R7EB 1VBC2 2RDQA 4NAMA 1HQWA 3ILNA 5T5OA 2YG0A 3N9PA 4EWEA 1OF4A 3WDUA 2ET7A 3IBMA 3ORJA 2E26A 2KXLA 4OQ8A 5IFPA 5FZFA 4PBPA 4FSJA 1XNDA 4K9SA 4IEXA 1VJ2A 1Y3TA 4XFHA 5GM0A 3VKLA 2VCAA 2XDVA 1B35A 1MS3A 1ND3A 4QX8A 3WDTA 4EROA 4CCKA 2PMWB 5IVJA 2XONA 3S5AA 1VBA3 1O4TA 5FDBA 3WLUA 1URXA 2ADEA 4OYUA 4WM7B 2WNEA 3N35A 2C9KA 1WW6A 1EUUA 1AUYA 2HWF2 4M3CA 4XJ9A 2OXBA 5FK7A 5T3NA 4UFKA 2TUNA 3HT1A 4W6WA 2GH8A 2QUOA 2E9QA 2V4VA 2VOTA 4WVZA 3SCFA 5K9YA 4EQVA 1SPPB 1CAXB 1SBDA 4AEDB 3V0AB 1XU1A 2R49A 2VTXA 5KR7A 1AX0A 4C91A 1R092 1UU5A 2XJPA 3WW2A 3M3IA 3AFKA 4IV3A 2FDIA 3OBAA 2YXSA 1X33A 4LBKA 1H1AA 2D40A 2K2SA 2XBO1 4M4RA 4Q26A 2GN3A 2Y34A 2PN5A 5K4LA 4KGQA 3THTA 4LIUA 5FPBA 4CTEA 4MLOA 4V2VA 4ATFA 3FHAA 3HVDA 4A7KA 5K0UB 3WDVA 2RR11 1YQ8A 3WNNA 5DUWA 3QBQA 2PYTA 4HVQA 3RYKA 4PI0A 4QX2A 4CSWA 2BJSA 2RM22 3D0SA 2JDMA 4O9EA 4DEQA 4N53A 4Q4X3 4B1MA 4XFFA 2Z5WA 1HB3A 2XR4A 3VZNA 4NIDA 2E7AA 3T0BA 3PJQA 3N9QA 4D6RA 5A1AA 2O8QA 2EVXA 4N7IA 2WBKA 4K21A 4LBOA 1PVC3 2DYCA 1IQAA 3NW4A 4MHRA 4IEVA 5BNPB 1XRUA 5DAPA 4JZRA 1X82A 1G9BA 2WT0A 5I0UA 2DF7A 1CPNA 5ANQA 4IW3A 1EV13 3AP9A 2I07B 1C1LA 1J3RA 5FXWA 4BXSV 2VUDA 2WNOA 5FZEA 3BCWA 5C8CC 3ACHA 3KHCA 4U36A 1W9FA 1NG0A 5L19A 4D3WA 4NHKA 4NIAA 4Z92B 1SFYA 1WCDJ 2BOIA 3VBOB 2F17A 3LE0A 3W5MA 4Q5OA 4KH9A 1PX4A 3GJBA 1ZBA2 2XJUA 4Q4W1 1T2XA 5E8AA 5FZLA 3VZKA 3JB4C 2QVSB 3ALQA 4CUCA 4AI1A 5BNQA 2DDUA 2D3SA 3WSOA 4L9BA 2EICA 3OD0A 4QQPA 3WQ1A 2C5DA 4XJ8A 3IM0A 3UKTA 1SPPA 4S2FA 3KGLA 1UU4A 1HQLA 2WAOA 4H2AA 5A33B 3MZHA 4Y4YA 3MLJA 3VBRA 3ZFEC 1VRH2 5JAXA 4BQ2A 3VB9A 1SDDB 4WM7A 1LEMA 4CPBD 3WF0A 1FV2A 5C3PA 1F4HA 4HK8A 4H7MA 2AENA 1AR82 2JG8B 4FPEA 4HBNA 1RXGA 3OPTA 2VVDA 1VALA 1HB4A 3RQ0A 4B4RA 1IGOA 3D4KA 1E5IA 3O1PA 1BMV2 4FTSA 3IDCB 2YYOA 5CFDC 5DUUA 2QQLA 4RQPA 1LHOA 1QJU3 1WKYA 4DINB 2VNOA 3OGJA 3CZUA 2B45X 3PL0A 1S2KA 4Y3OA 1OKQA 5FMBA 4ZXKA 1TMF3 1LB2A 1RITA 2DBNA 3IWZA 5FZMA 1Q8PA 1XSQA 2VNGA 2ZKNA 3IKWA 2K0GA 2WZPP 3ZMNA 2HWF3 2DVAA 2VXJA 4CXXA 2UY8A 2V72A 4OFGA 3AMQA 4M00A 3DEMA 4XMAA 1ZRIA 3IPVA 3U4XA 4BYYA 1XB9A 4DO0A 2QE3A 4NUBA 3NJXA 2X5IC 1QH7A 4TYSA 3AK0A 1ENQA 5APAA 5C5UA 1R093 1RTVA 3RSJA 1RUH1 4GAZA 3PU8A 1BK1A 2CYFA 5FQ0B 3E5XA 3VKFC 4YVWC 4I09A 3TWIA 2WABA 5C70A 3ME2A 3K4DA 5LA2A 1AL0G 1RUF1 4LA3A 4LPLA 5ACA3 5AC92 1I6XA 3OUHA 5IW0A 4K7JA 2VCCA 4Y24A 4QPGB 2JDPA 4XACA 2WL1A 4HL0A 4JTOA 3UESA 4BQ1A 3KT7A 2BTVC 4I3PA 3I2JA 5JMOA 1BEV3 2VZTA 3ON7A 4YYOA 3O1MA 4MG2A 3ZXGA 5CBLA 4IE6A 1OA2A 1ZZCA 2VZQA 2VZUA 4WM8A 3ZDSA 4Y20B 4XQ4A 4DXZA 4E2GA 1ND2B 4MH0E 3BTYA 2BVVA 1C28A 2VQUA 2JECA 2R071 1POV1 2D98A 1N3OA 2HWE1 4DRRA 1N47A 1XNKA 4GJYA 1DQ6A 4I3GA 4MYEA 5JI7A 3JQWA 4IQPA 3SEPA 1SMVA 1RUE2 3KV5A 3MUZ1 5IHRA 1JU4A 4NRQA 4PDWC 3M3OA 3U14A 4OMDA 4TSVA 2OYZA 2MEV2 3LIGA 2VVFA 1CZVA 2KD7A 1NAEA 2R063 4FOYA 4XFGA 2VOWA 4COUA 3THCA 4FPJA 1W6MB 2WN3A 2Y33A 4E4SA 1UPSA 4WVMB 1S0EA 4XQDA 1H2KA 3O0VA 3KHBA 4DUWA 3POYA 1CX1A 2UYAA 3RYPA 5FLIA 3A22A 1JMUB 1OA4A 3FHIB 4FQZA 1N1YA 2XXZA 3WD5A 1UPIA 1RYYA 1K5MA 1SLLA 1YQ2A 2XJVA 2VMGA 5T52A 5C4WC 1CQ9A 1GANA 1E5HA 1UMHA 1MACA 5AVPA 3VLBB 1ALYA 2ADDA 3ACLA 2TEPA 4KWKA 5D8AB 5FMOS 5BNPC 1DLLA 5EFUA 4IEQA 5T55A 2EA7A 3H3ZA 5A7SA 3HAGA 3FFZA 2A71A 1SHWB 1DQ5A 1SCRA 5JOWA 1W8ZA 1DG6A 5C7GA 1KFUL 4QPIA 1ZRFA 2GN7A 4HVOA 1V6NA 1W6NA 2P3JA 4OZOA 5T5PA 1TG7A 1GUIA 2DWRA 2JB4A 5E89A 3ZXFA 3KLSA 5A3TA 3MIGA 3TAYA 2JE9A 4Q2FA 1W28A 2ZEYA 1NA1C 2TBVA 5EWSA 2P3YA 1GICA 4UW3A 4W6YA 5C4WA 2PHDA 4WVVA 1OBNA 2VMCA 4I01A 4R4XA 5FZGA 5ABJC 3ZYJB 2XBO3 4LLFA 2DUQA 4G4FA 1AR83 2XJQA 2ZX0A 5C5TA 1R1A2 2WFF3 1OQEA 1NCRA 1KITA 4QKFA 4B3NA 3SQOA 2DVFA 1K12A 3POJA 3IZOA 4KGGA 4E4ZA 1SACA 4JTNA 3I49A 2AZ5A 2V5YA 5DG2A 2QQUA 2LROA 4SLIA 4Y22B 2LS6A 1LGCA 4HKLA 4Y1YA 5FO9B 3ZYHA 4XFIA 4NRMA 3GCWA 3ZR5A 1QJY1 2JDYA 1UY0A 2YBSA 4ISRA 2RS12 2EALA 5I93A 1H1MA 1BQPA 1TNFA 4GA9A 1HJGA 1PZ7A 3WR0A 1OMIA 4QWNA 1SEFA 5IVVA 1F2NA 5LA0A 5J3UA 4INDA 4R9CA 1GQHA 1PM7A 3WF3A 3PLQA 3EO6A 1MS5A 1B35C 5FZDA 4Y1XA 3W58A 1MEC2 1B09A 2R072 1RUC1 4NWVA 1NCQB 4M0HA 5BNNC 3ILFA 5C9AC 2W0XA 4QB6A 1W2NA 1W6PB 1FYUA 4ZU4A 5F7UA 4DNYA 4YG3A 1DYPA 2BFUS 4E4DX 4XBQA 2XJSA 3ZXLA 4XAAA 4JGZC 2PXJA 2RS51 3POGA 2VOXA 3Q8AA 4MXWA 3U07A 4FPFA 1G9DA 5DPNA 5SV5A 5JIAA 4NPMA 4Q27A 1JOJA 3JBG3 4ISQA 1FT9A 2HEYF 2JD4A 2Y8KA 2YHJA 3U0ZA 4WVMA 2C6SA 4UOJA 2FZ1A 2JD9A 3OYWB 1MS9A 1L3JA 4NRPA 1TMF2 5TSWA 4AQ6A 2HEVF 2WQ8A 2B39A 5A3UA 1NYWA 2MEV1 1NXD1 3CHXA 4OHYA 4XF1A 4AGRA 5DAWA 1JODA 4NHYA 1TNRA 1XNCA 4BH9A 3H7JA 2R0FA 4AHWA 4Z07A 4Q0PA 1N3PA 3I3BA 2EXKA 1CAWB 2BW8A 5FV3A 3RZMA 5JXJA 4AQ2A 4JQRA 2JDNA 3VBHA 1ZZ8A 4JDMA 1TMF1 2VCMA 2X5IB 2GMPA 1GQGA 2P6HA 4C0HA 2FBEA 1PMIA 2IWGB 2XKPA 4UW6A 1CAUA 2WUHA 3HNYM 5FZHA 4A42A 1LECA 3WW3A 1BMV1 1Q43A 2VH9A 2ZX4A 3FLPA 5H9SA 5FZ1A 1PO23 3ZFFB 3PUAA 3ZFFA 4B29A 5KC6A 4GULA 2CHHA 2J1RA 3KV9A 4Q4Y1 4RR3A 3V65A 4ASLA 1YFXA 3D3AA 1YQ5A 1UZZA 2WO7A 1OH4A 4Z2WA 5BNOB 1R091 2ZZQA 3PTRB 3B94A 4XURA 1NQJA 4QM9A 4E9KA 2VBPA 2JB8A 3VDBA 1GMMA 5FQ0A 4IV3C 5KC5A 4DZGA 5FPLA 2VZSA 3GCXA 5IK7A 3C7EA 5FYTA 1AYN3 1TME3 5B2GB 3B9CA 3I2FA 1CD3G 4UBHA 2RMU2 1W6QA 2ATFA 4GMP0 5FP3A 3O1VA 4MX3A 2J22A 3EB7A 3IPVB 4AK3A 3QCWA 1OFSA 2XBO2 3URFA 4OHWA 4LO4B 3WHTA 4RHV2 1W06A 1W8FA 3J8F3 1OLMA 3LAGA 3WNLA 1QMJA 3OEBA 4CXWA 2UU8A 1KS4A 2JDHA 4XVHA 4FPKA 4EJRA 2YPDA 1W05A 4KQ7A 3AP6A 4QXHA 1DGLA 2WNUB 3DUIA 2YDEA 2ARBA 1OQDA 2OUJA 3JD71 5JR2A 2HYKA 4EE2A 2HLEA 1R64A 1RUNA 4IGQA 1V6MA 3A21A 1XOYA 4XPVA 3PHMA 2HWE3 3LA7A 3LD8A 1FPN3 1I5ZA 3RRDA 5FZ9A 1SG3A 3VBRB 2R061 2WZR3 3OOXA 1W39A 2W46A 1H4GA 2D97A 3CJIA 1POQA 3O1UA 3PUHA 5IATA 4DXTA 2QBXA 2GC1A 3VHRA 3ZFEB 4Y5SA 5LRSA 1MZFA 2P3IA 3H9AA 3MEPA 3OEAA 2XPJA 1OHFA 2JJ6A 2VMIA 1GZWB 1ASJ2 4CDWB 5C9AB 1ZBE2 2E31A 1WLWA 3BB6A 3MI8A 3WP5A 2YZ4A 4KWJA 4UWDA 1COV1 3I2GA 4J25A 1MS1A 1XSRA 3INAA 1HB1A 3H1YA 3JB8A 3PVNA 1REFA 1XE0A 1V6KA 2R043 3UK9A 2OT7A 1AL21 1W8TA 1JYNA 2X8KA 2R1BA 1F4AA 4LO8A 3CJIC 1BYHA 1VAVA 3WQ7A 2IXIA 2BNMA 1L7LA 2JG9C 1UX6A 5DDJ2 4FFFA 4IESA 2QDRA 4A41A 2YU1A 1VBA2 4LT5A 2E33A 1FAYA 1QQP2 4AR2A 3OY8A 3N36A 3LDKA 1R1A1 4HFSA 4PF5A 5A6ZA 1DYOA 2Y0IA 4XETA 1Y43B 4URTA 3FJSA 4OUMA 4LHNA 2JDZA 5FYSA 1AR81 5IVYA 4RQPC 3ZVXA 4QKDA 1OUXA 4AXOA 4N53B 4LBJA 5FY5A 5DG1A 2DCZA 2WJSA 4CCDA 1PGW1 3CL1A 5JDBA 2UWAA 2XH6A 2J42A 2DU1A 3UETA 3A4UA 4XMIA 3IT8A 1KQRA 4XFCA 1ENRA 3WQ0A 3OUIA 5FXZA 1WCQA 2BQPA 3DXTA 3H1WA 3ECQA 5K0UA 4GIQA 1NXMA 1PO12 2ARCA 1F5JA 5HCHA 1RUI3 4GWNA 4L8QA 3MUY1 3AJZA 4PLMA 5DAQA 3RVHA 1NE4A 2W2IA 4AYUA 2W1SA 5F2WA 5FZ6A 3MIFA 2B4KA 1V9U3 1LR5A 1QXJA 1XYOA 4Q4W2 1RUG2 2LW8A 4YNIA 3UKNA 2PHXA 3BOPA 3HD8B 1GKBA 4HZFA 2Y6LA 4UFIA 4CDWC 3BALA 1IG0A 4WZFA 2RS11 1OVSA 4XJUA 1CESA 1QNYA 1JYXA 1EPWA 2QQVA 4AVVA 4DPNA 5EP9A 3WG3A 1UIKA 1VPHA 1NLRA 2AEZA 4QGLA 2Y60A 3WY6A 3B5LB 3PJYA 3SCHA 5I0DA 3SEEA 4NR1A 5F32A 4NPLA 2RS31 2BZDA 4IEWA 4GB33 1DQ4A 2GNDA 1D4M2 1LTEA 1NKGA 4QPWA 1JH5A 2Q5TA 4YVSB 2IUWA 5BPXA 1B35B 3ZKYA 1HV1A 2RS53 1WLTA 4JVAA 5FCCA 2DTWA 4A3ZA 2W5FA 1AL22 4EN6B 1GOGA 1NY71 2HWE2 3NMBA 4LXLA 4P00B 4YRDA 1AR73 1HN1A 4YWAA 1ASJ1 2J1AA 4LE3A 2VZ3A 4Q8LA 2Y6FA 1S4CA 1UD1A 4YGDA 1T6GC 3USSA 4RS5B 4RGGA 1FX5A 4H7LA 1W04A 5DMYA 4AQTA 2ZBJA 4RSUA 1W0PA 1IS5A 1GYKA 1XNAA 3DN7A 4LBLA 3RDIA 2A6WA 2WNVB 3AXEA 1WW5A 2VZ1A 1HRV3 4KMQA 5FY4A 3QD6A 2J1UA 4LBQA 4PCRA 4PLOA 4OI1A 5C3RA 1PK6C 1VB4A 3KT4A 4LEJA 3I3MA 4Q4V2 3VGIA 3O1TA 2ZOEB 2E51A 4XFBA 5I0RA 2W1UA 2C26A 3WVJA 1R1ZA 1HN0A 4XUPA 3L2YA 1PMHX 5DZFA 5BV6A 2NP0A 3HQRA 1ZYBA 5FJKA 5FMOL 3VBSC 1X9TA 3LEGA 3M4FA 4XCAA 3VDCA 2D44A 3K4ZA 4FCAA 1KEXA 1UN1A 2DCJA 2IXKA 3VBUB 4XABA 2G1MA 1PO21 4CDQC 2P17A 3TN92 2ZXQA 2ZX3A 3V0BA 1H2MA 1W8UA 4YVWA 3KF5A 5A6XA 3MV11 5DAXA 4OI4A 4LO5B 4F7ZA 5JZGB 3NNGA 1PK6A 2YB7A 3P6BA 1L7RA 1COV2 1RUOA 3GYDA 5DDJ3 1UKGA 3GBWA 3WX5A 2ETEA 1C3HA 1ZZ6A 1OURA 1S0FA 1W3VA 3FLTA 3NNMA 2WS91 1TME1 4IV1C 3LOBA 1HXS1 4CCLA 3ZXKA 2ZHNA 1XE8A 3R4UA 4KL1A 5FLHA 3NAPA 1PGL2 1WA6X 3SKVA 2ZGKA 2UYBA 4TWTA 3J8F1 3MICA 2RE9A 1REEA 1H9PA 1AYM1 2DU0A 1JOBA 4IEPA 4NMIA 4OUEA 2GC0A 5CNAA 3VHNA 5C71A 4HG6B 3NNFA 5LZ6A 4YW4A 3LEMA 2QQJA 2DCTA 4JDOA 3RZJA 4QB2A 1C8M2 2EXIA 2C24A 4COWA 2Q1FA 3ZN4A 3TEWA 5C3OA 4NJ4A 1LAJA 1D2QA 1RUF2 1OI6A 1UW8A 1YI7A 3P5BA 3B7MA 5FPZA 4R4ZA 1A8DA 1ODMA 4LUMA 3ZSMA 3WG1A 4QDRA 4ZS3A 5BUVA 1ULPA 3VZJA 4EWAA 4ZZ5A 1O91A 2IZWA 3ZSLA 5FYZA 1LKNA 4Z82A 5JZGA 2WZR1 1SCSA 3RZLA 4UW4A 1HQNA 1SLAA 3LF7A 3POFA 3CF6E 2W08A 1GP4A 3VBSB 2VW1A 2XQRA 3WNPA 4GH4B 2RDSA 3ZFFC 4JV4A 3KD4A 2P4EA 5BNPA 2XHNA 2XL7A 3HBZA 1JU3A 1LU2A 3LEKA 4G3YC 1UY4A 2B46X 4Q4X2 4NIIA 3BU0A 2VTFA 2WFPA 5GKAC 1X36A 3N7LA 3TNQA 1LOGA 3LIHA 4NPRA 1RUG1 3AKSA 4FBFA 4ZY9A 2R041 3LPFA 5FZOA 1AL23 2WQ4A 4AVCA 1ULEA 2BV4A 5A7WB 2WNVA 3KMHA 4AEDC 2RM21 3RMXA 1HXS2 4YW3A 1PO11 3AM2A 4ZU5A 1S55A 3FWEA 3U1XA 1RUJ2 3RYRA 2PHFA 1HLCA 3W59A 1KD7A 1AHSA 4YW5A 2W52A 4HKWA 5LEKA 4D94A 1BCXA 1NCRC 3LA3A 5CU1A 2VE1A 3VHOA 3LZZA 3DXUA 1KFXL 5JXHA 4UFHA 4AWDA 3LA2A 1NY72 4NAOA 2IXLA 1VMHA 4RFRB 1X8EA 1WW4A 2D5FA 3ZFGB 2KA3A 1WD3A 2XKOA 3V0AA 1D4M1 2LTNA 2UWCA 4YGCA 2VQAA 2BGPA 4M3CB 3H8XA 3VZLA 2ET1A 2XVLA 3I3EA 4QXBA 4ZS2A 1RMU1 2E7TA 3LDBA 4PIXA 4RHV3 3CO2A 3RI9A 3NV4A 4AFAA 3ABZA 1BVVA 3DF0A 3ZYPA 2XG3A 2WA4A 2W92A 4CDXB 1JW6A 1K5JA 3ZFGA 1ULGA 4LK6A 2RS52 3U4SA 3ES1A 2B9VA 3VD5A 5G05L 2FQPA 2PAKA 3BPSA 1O7FA 2BNNA 2RS13 1TZOA 3HPNA 1HX6A 4R9AA 3ZSJA 4D6QA 1LU1A 2JEMA 3CQOA 1FV3A 1H6XA 2UWBA 3PMSA 1CJDA 3APBA 2G4IA 4A7ZA 1LOBA 2H0BA 2BEOA 5FY7A 2RS33 3S6PA 1F8VA 2YC0A 5GALA 4GB31 3LPGA 5FPVA 4AI8A 1AYM2 2JG9A 4CP9A 2VZVA 3ACGA 2ARAA 2ZGTA 4LMFA 1ND3C 2CGOA 2ZMKA 4FOQA 3NKGA 3ZFGC 3TN93 4PQQA 4GKXA 4AG4A 1ZBA3 1AR71 1FMD2 3EQEA 1EAH3 2H0VA 3K3OA 5FOJB 4FPLA 2PAMA 4YG0A 3CNAA 3OY8B 5C6CA 2A6XA 5C8WA 5IVFA 3IDEA 1CIWA 5ANNA 1BHGA 4Z8BA 3UGGA 4J1WA 1QJU2 3WNOA 2P2KA 4IL7A 5FXVA 2E53A 4EV0A 3O14A 2GU9A 1FATA 2XUEA 3IDAA 1O5UA 1NQDA 5K0UC 4PF1A 2BOJA 4P14A 3MLKA 5FBJA 5IVBA 2EIBA 5T5JA 1A78A 1J58A 1GFF2 3A0NA 3AXDA 1ZBE3 2XGXA 2A73B 2WDBA 4KI5M 2YMZA 2OS2A 1G9CA 4MUVA 1H6YA 4H3WA 4MXVA 4XJZA 4DOUA 1QJZA 2DURA 2XUMA 2GNMA 1G9AA 3JU9A 1LEDA 4NIGA 3AYDA 1DDLA 5LATA 2WAAA 3X29B 2Q4SA 2RJKA 3C7HA 1LGNA 1AZDA 2BP6A 2JDUA 4CUAA 4Q0SA 4JGYC 4OHXA 4ASKA 3V64A 2HWB3 1OOPA 1JZ4A 3ACFA 3Q8BA 5DAVA 4IXLA 4MHUA 1PZ9A 1YUDA 3R4DB 5FWJA 3K51A 5EHDA 2ZA9A 2R062 5HCAA 1GBGA 2VMDA 1OF3A 1I5PA 1SLCA 3N9NA 4L2NA 4P08A 1ZZ7A 1RL3A 1MR5A 3SMHA 4BISA 4W4ZA 1VIWB 1YJKA 1FNZA 2W47A 5DDJ1 3KCYA 2VQ0A 3ZSKA 4KU8A 1HXS3 4W8JA 2PA7A 3IAPA 3PIJA 3VUOA 1IKQA 1D7PM 5DUVA 3S7IA 5CKNA 3VD9A 4TN7A 4PJYA 3R05A 5L36A 2GNTA 4COYA 3DYOA 1S1AA
chains in the Genus database with same CATH topology
3OPWA 2Q8CA 3KVAA 5FY9A 3N9QA 4D6RA 2OT7A 3KV6A 3AVRA 4GD4A 4LITA 2Q8DA 4AI9A 4CUGA 4GJYA 5A3PA 4LIVA 4QXBA 3KV5A 3LDBA 4IGPA 3AL6A 2VD7A 5F5AA 2YU1A 5F3EA 2XMLA 5ANQA 5FP8A 5A80A 3U4SA 5FXWA 4QXCA 5FZEA 2GP3A 3KVBA 4DIQA 4UF0A 4CCLA 4EZHA 4GJZA 5FZIA 4CCJA 5FYSA 4D6QA 4Y33A 5IVYA 5FV3A 4BXFA 5FZKA 5FY5A 3N9OA 2XXZA 5FPUA 5A1FA 5ISLA 5A3NA 3PU3A 2OX0A 3PUQA 5FZLA 5FZCA 3AVSA 5F2SA 5F5CA 5FP7A 5FY7A 4HONA 4EZ4A 5FPVA 5FXZA 5A7SA 3DXTA 5FZHA 5CEHA 2YU2A 5FZ1A 1VRBA 5FYHA 3PUAA 5FYIA 5F37A 3KV4A 3KV9A 3RVHA 2W2IA 5FYYA 5A3WA 3K2OA 5F2WA 5FUPA 5FZ6A 5FZ0A 5FP9A 3K3OA 5LY2A 5LY1A 3PTRB 4CCMA 5FYVA 5A3TA 3AL5A 3PDQA 5IVFA 4V2WA 5FZ7A 3N9MA 3N9PA 5FZ3A 5FWEA 5FPLA 5FYZA 3OPTA 3NJYA 5FYTA 2GP5A 5FZGA 4E4HA 5FXVA 5FZFA 2XUEA 5FP3A 3PUSA 5F3GA 5FYCA 4BU2A 5FY1A 4Y3OA 5IWFA 5FBJA 5FYMA 5A7PA 3ZLIA 2XDVA 4QX8A 5F32A 5IVBA 5FZ8A 4CCKA 5FZMA 5IVJA 2OS2A 3PURA 2YPDA 5A7NA 5FZBA 5F5IA 5A7QA 5FJHA 4QX7A 4QXHA 5FP4A 2WWUA 5FUNA 3U78A 4LXLA 4EYUA 5IVCA 2YBSA 2Q8EA 4DO0A 2YBKA 4NUBA 4C8DA 3UYJA 3ZPOA 2YBPA 4IGQA 5FZOA 4ASKA 4GAZA 3PU8A 4Y4RA 5FY0A 5A7WB 5IVEA 5LWBA 3LD8A 4QWNA 5KR7A 5FZ9A 5IVVA 5FZ4A 5A7OA 4CCNA 4D6SA 5FWJA 4XDOA 2OQ6A 5FZAA 5FZDA 3N9NA 3K3NA 2WWJA 5IW0A 5F39A 5A1LA 5K4LA 5FY8A 4BISA 4URAA 4LIUA 5E6HA 5FPBA 4IGOA 5FY4A 5A7WA 4XDPA 4V2VA 4HOOA 5FZOB 3N9LA 3DXUA 5FYBA 4UF0B 2P5BA 5FPAA 2OQ7A 5FXXA 4CSWA 2PXJA 4TN7A 5FYUA 4QU1A 4AAPA 4CCOA 5LW9A 5FJKA 5F3CA 5F3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OPW A;  2Q8C A;  3KVA A;  5FY9 A;  3N9Q A;  4D6R A;  2OT7 A;  3KV6 A;  3AVR A;  4GD4 A;  4LIT A;  2Q8D A;  4AI9 A;  4CUG A;  4GJY A;  5A3P A;  4LIV A;  4QXB A;  3KV5 A;  3LDB A;  4IGP A;  3AL6 A;  2VD7 A;  5F5A A;  2YU1 A;  5F3E A;  2XML A;  5ANQ A;  5FP8 A;  5A80 A;  3U4S A;  5FXW A;  4QXC A;  5FZE A;  2GP3 A;  3KVB A;  4DIQ A;  4UF0 A;  4CCL A;  4EZH A;  4GJZ A;  5FZI A;  4CCJ A;  5FYS A;  4D6Q A;  4Y33 A;  5IVY A;  5FV3 A;  4BXF A;  5FZK A;  5FY5 A;  3N9O A;  2XXZ A;  5FPU A;  5A1F A;  5ISL A;  5A3N A;  3PU3 A;  2OX0 A;  3PUQ A;  5FZL A;  5FZC A;  3AVS A;  5F2S A;  5F5C A;  5FP7 A;  5FY7 A;  4HON A;  4EZ4 A;  5FPV A;  5FXZ A;  5A7S A;  3DXT A;  5FZH A;  5CEH A;  2YU2 A;  5FZ1 A;  1VRB A;  5FYH A;  3PUA A;  5FYI A;  5F37 A;  3KV4 A;  3KV9 A;  3RVH A;  2W2I A;  5FYY A;  5A3W A;  3K2O A;  5F2W A;  5FUP A;  5FZ6 A;  5FZ0 A;  5FP9 A;  3K3O A;  5LY2 A;  5LY1 A;  3PTR B;  4CCM A;  5FYV A;  5A3T A;  3AL5 A;  3PDQ A;  5IVF A;  4V2W A;  5FZ7 A;  3N9M A;  3N9P A;  5FZ3 A;  5FWE A;  5FPL A;  5FYZ A;  3OPT A;  3NJY A;  5FYT A;  2GP5 A;  5FZG A;  4E4H A;  5FXV A;  5FZF A;  2XUE A;  5FP3 A;  3PUS A;  5F3G A;  5FYC A;  4BU2 A;  5FY1 A;  4Y3O A;  5IWF A;  5FBJ A;  5FYM A;  5A7P A;  3ZLI A;  2XDV A;  4QX8 A;  5F32 A;  5IVB A;  5FZ8 A;  4CCK A;  5FZM A;  5IVJ A;  2OS2 A;  3PUR A;  2YPD A;  5A7N A;  5FZB A;  5F5I A;  5A7Q A;  5FJH A;  4QX7 A;  4QXH A;  5FP4 A;  2WWU A;  5FUN A;  3U78 A;  4LXL A;  4EYU A;  5IVC A;  2YBS A;  2Q8E A;  4DO0 A;  2YBK A;  4NUB A;  4C8D A;  3UYJ A;  3ZPO A;  2YBP A;  4IGQ A;  5FZO A;  4ASK A;  4GAZ A;  3PU8 A;  4Y4R A;  5FY0 A;  5A7W B;  5IVE A;  5LWB A;  3LD8 A;  4QWN A;  5KR7 A;  5FZ9 A;  5IVV A;  5FZ4 A;  5A7O A;  4CCN A;  4D6S A;  5FWJ A;  4XDO A;  2OQ6 A;  5FZA A;  5FZD A;  3N9N A;  3K3N A;  2WWJ A;  5IW0 A;  5F39 A;  5A1L A;  5K4L A;  5FY8 A;  4BIS A;  4URA A;  4LIU A;  5E6H A;  5FPB A;  4IGO A;  5FY4 A;  5A7W A;  4XDP A;  4V2V A;  4HOO A;  5FZO B;  3N9L A;  3DXU A;  5FYB A;  4UF0 B;  2P5B A;  5FPA A;  2OQ7 A;  5FXX A;  4CSW A;  2PXJ A;  4TN7 A;  5FYU A;  4QU1 A;  4AAP A;  4CCO A;  5LW9 A;  5FJK A;  5F3C A;  5F3I A; 
#chains in the Genus database with same CATH topology
 1JUI A;  4AOC A;  4PHZ A;  3OUJ A;  3VBU C;  5HXM A;  2IVI B;  1OD3 A;  3ILR A;  4XIL A;  4ES9 A;  4GD4 A;  4MGI E;  1YC6 1;  1FOD 1;  4Q8K A;  4I02 A;  1JYT A;  3OBT A;  1A3K A;  1U12 A;  1CIY A;  3TEX A;  3AL6 A;  3WW4 A;  4M3C E;  5GLT A;  2BFU L;  2QCS B;  2PHR A;  3MIB A;  1QJX 1;  1A8M A;  2HBT A;  5J37 A;  4X6R B;  3LFM A;  4L11 A;  4LBM A;  4ZXE A;  5DZE A;  2AGS A;  3B93 A;  5CG9 A;  1AR7 2;  1FMD 1;  5JVV A;  1YCI A;  3I97 A;  2RR1 3;  1ZVF A;  3J7L A;  4GMP 3;  1XXN A;  4FT8 A;  3TOJ A;  1RIR A;  4FOW A;  3WG4 A;  2AEY A;  1SBF A;  2JDA A;  5A1F A;  2K9Z A;  4QQ2 A;  1NUK A;  3KZ4 C;  4QGN A;  5FZC A;  5IFT A;  2ZJC A;  4Q4X 1;  2EXH A;  4YPJ A;  4GB3 2;  3AZW A;  2IXH A;  3HNM A;  4E2S A;  2HWD 3;  4ZPI A;  4RFT 0;  1YFY A;  4CZS A;  1GP5 A;  2BBA A;  2ZMN A;  4DFS A;  4RN5 A;  1H1I A;  5J09 A;  2BRT A;  2ZGU A;  3B00 A;  1ZZB A;  1MPX A;  5FYH A;  2WQZ C;  4BMB A;  2ZHM A;  4X8P A;  1WMD A;  5JXI A;  4F8A A;  4RL7 A;  4BB3 A;  2GZW A;  2VUL A;  4CDU B;  4A7Y A;  1JS9 A;  4IE4 A;  3ZN6 B;  5A3O A;  1YQC A;  5HV4 A;  1KJL A;  4BJ0 A;  2ZTN A;  1LHW A;  1QJY 2;  1UZV A;  5FZ7 A;  5JUV A;  4P5Y A;  1N1S A;  2NLR A;  4YVS A;  3H0O A;  2L9L A;  1HKD A;  3AMH A;  3VDD A;  1XJA A;  4XUN A;  2NM1 A;  5BXX A;  3GZA A;  3PUS A;  5JPN B;  4LBN A;  5FY1 A;  3FHQ A;  2ES3 A;  3WDW A;  5FYM A;  4FFG A;  3VD4 A;  5FUI A;  2GME A;  3UNP A;  2QFE A;  4FP3 A;  4JGZ B;  1TQ5 A;  3I7D A;  2YY1 A;  2R32 A;  4LO7 A;  5J1X A;  5IK8 A;  2MHF A;  4Z1V A;  4OHV A;  5I0S A;  1X50 A;  5A7N A;  1RUD 2;  3E5U A;  4Q0Q A;  2VUA A;  5FZB A;  4BLI A;  1LGB A;  1IG3 A;  4MXW B;  5FJH A;  5I8Y A;  2V09 A;  3N3H A;  2YRO A;  5FP4 A;  5L9B A;  4Q1R A;  5KHJ A;  4LR4 A;  4QX1 A;  4YGB A;  1RJ8 A;  1DIW A;  4FXK B;  2RJ2 A;  4FPO B;  1O4Y A;  3MLL A;  3GF6 A;  3DPR C;  4JKK A;  1NCQ A;  2WS9 2;  5C33 A;  4I30 A;  5AFE A;  4D6S A;  1JXN A;  3HIF A;  2E7Q A;  1M06 G;  4OI2 A;  4C90 A;  3S5Q A;  2WWJ A;  3QH7 A;  4FTB A;  1OPO A;  3H8O A;  3T2P A;  3MIE A;  5CIR A;  2Y0O A;  3I59 B;  3DV8 A;  1JZ5 A;  4PDW A;  4IGO A;  4IV1 A;  5E1R A;  4B7E A;  5FPX A;  3EXU A;  2YC4 A;  4N9I A;  4P9W A;  4QU2 A;  3WNM A;  2ZX1 A;  5FYB A;  4UF0 B;  2VTX J;  2Z42 A;  2QQN A;  3ZYF A;  3USU B;  1UWW A;  1F9K A;  4DUX A;  2HWF 1;  3TYJ A;  4YAR A;  1O6U A;  5FYU A;  1UOB A;  4AAP A;  3SHR A;  3D8C A;  3UGF A;  4E8C A;  4Y22 A;  1W3X A;  1WUV A;  1VE0 A;  4UW5 A;  4CEY A;  4NE9 A;  4R8H A;  4H55 A;  4YZ4 A;  4YM0 A;  3SXW A;  3WF1 A;  3POB A;  5LK5 A;  1RUH 3;  1HV0 A;  1NCR B;  1QXP A;  4F3J A;  4Z2A A;  5GZC A;  4JGY B;  3AKR A;  3TN9 1;  5I0T A;  3CBN A;  3ZKU A;  1RUF 3;  2C1F A;  3AMN A;  1A6C A;  1W0N A;  3EMR A;  1PMJ X;  1HDK A;  4QPI C;  4XUQ A;  2QDN A;  5F3E A;  4DMI A;  2C0Z A;  4NWW A;  4R9B A;  3DYM A;  4M3C F;  3JQX A;  1GP6 A;  5D1I A;  4BIF A;  4CCE A;  3JCI A;  5CYY A;  1VBB 3;  1QHD A;  4HXC A;  4DIQ A;  5F1R A;  5EYX A;  1JYW A;  1DCS A;  3H7Y A;  4Y1U A;  3KM5 A;  2J1V A;  3O1S A;  2A6Y A;  5FZK A;  4XIK A;  1VBE 3;  1EP0 A;  2OA2 A;  1WCS A;  3JXS A;  1HIX A;  3FC0 A;  2HH9 A;  3CJI B;  5LK7 B;  1YI9 A;  4X8N A;  2O8O A;  3MID A;  3RZH A;  4FTE A;  2W91 A;  2PHL A;  3C7G A;  1Y9G A;  5D8A A;  4NIH A;  2VQT A;  2EID A;  2R6Q A;  5EJZ B;  4MSV A;  5EJ1 B;  4U2A A;  1K45 A;  3BVC A;  3E6B A;  1K5M B;  5F37 A;  1WLC A;  5GLV A;  3ZX7 A;  3S7E A;  4CDQ A;  1DU3 D;  2VUC A;  3T4H B;  1QU0 A;  1PIV 3;  3CJX A;  3RZK A;  2I45 A;  2HWB 1;  5H9Q A;  4XAE A;  5B4X A;  3D5O A;  2WNV C;  3RJ2 X;  4S2G A;  3SKJ E;  2HWD 2;  1W6M A;  1S0D A;  3RMY A;  2ZHK A;  2QQW A;  2D43 A;  1HRI 3;  2FHR A;  5CKQ A;  5FWE A;  1WBF A;  2GDF A;  3C7O A;  2ZGS A;  4E4H A;  1VMJ A;  2A3Y A;  2P37 A;  2Y6G A;  2QQO A;  1U5Y A;  3AP4 A;  2RVA A;  4UFJ A;  3WCS A;  1QDC A;  2VME A;  1AR6 1;  1P8J A;  3P3P A;  2RV9 A;  2ZGR A;  5A32 B;  1MZ6 A;  1SFP A;  1DGR A;  5KXB A;  3T0D A;  3TEZ A;  3NQH A;  3HR9 A;  3M3C A;  4QT6 A;  1F35 A;  1US2 A;  1SBE A;  4MGS A;  5BNN A;  3FZ3 A;  3LKJ A;  1RJ7 A;  4LUL A;  4MO3 M;  2R1D A;  5E88 A;  5KHH A;  4WZC A;  3USU A;  4P5H A;  1ZRE A;  3HQX A;  5BNO A;  1PGL 1;  5JIU A;  1XC6 A;  2YBP A;  2DV9 A;  3POE A;  4QDS A;  1Q8Q A;  1H8T C;  2ZAH A;  5IVE A;  5LWB A;  1QJX 2;  2ZGP A;  5JOX A;  1ST8 A;  2VG9 A;  4HSL A;  4JQT A;  4Y1V A;  3WOG A;  1CAU B;  2VC9 A;  1J1L A;  3F95 A;  4KBZ A;  1QQP 1;  5AC9 1;  3H1M A;  4O65 A;  4BQ4 A;  4OI0 A;  1FPN 2;  4G9S B;  1H8V A;  3LFI A;  2WO3 A;  3B9I A;  3M8L A;  1Q5O A;  1VBD 2;  3J26 N;  5A6Q A;  1ZX5 A;  3MW3 A;  4B8E A;  1BLZ A;  4JDN A;  4I2O A;  2BYV E;  2WFF 1;  1UYP A;  2CAV A;  2JX9 A;  3I59 A;  1CAW A;  4AVS A;  2DFB A;  2A7A A;  5HPO A;  2JG9 B;  1FMD 3;  4QGM A;  5K7P A;  5JPM B;  4B4Q A;  3BTA A;  3III A;  4BA6 A;  1CGP A;  2WN2 A;  4N43 C;  3Q8C A;  5FTT C;  4AAX A;  4BDV B;  5KXC A;  1EUT A;  4XW3 A;  4OVE A;  4NHM A;  1SZB A;  1XBF A;  4WBB A;  1ULD A;  4L92 A;  1H8T A;  1QJY 3;  2PLV 2;  4AEJ A;  5L73 A;  2B7Y A;  4KNC A;  4I0A A;  2HWD 1;  3KVA A;  1UMZ A;  3MW2 A;  5FMC A;  3OD4 A;  4PBO A;  1NZC A;  4QQL A;  4M0N A;  2VNV A;  3D6E A;  1F31 A;  3OYW A;  1ZRC A;  5FFO C;  2QZ3 A;  4YM2 A;  4RQP B;  1JZ6 A;  1MZE A;  3BYW A;  4IGP A;  4I0W B;  3UT0 A;  1V9U 2;  1LOD A;  4AZZ A;  4K20 A;  1W2T A;  2W9X A;  3N7K A;  5F5A A;  1HB2 A;  3ZYG A;  1RUC 3;  1H8T B;  2NZ9 A;  4Y1Z A;  5LBC A;  4FO9 A;  2IVJ A;  4N43 A;  1W9W A;  1UY3 A;  5L7O C;  1GNZ A;  1E57 A;  5BY5 A;  2PHU A;  4LUK A;  3ATG A;  1W0O A;  2BWA A;  2GMM A;  3NL1 A;  4JHT A;  2QKD A;  5GZF A;  4Y33 A;  4K8R B;  5FKB A;  2GAL A;  2H6B A;  5FBZ A;  2VCB A;  5A3N A;  3PU3 A;  2FCV A;  4YM1 A;  3THD A;  3S30 A;  3W9A A;  3AVS A;  1GNH A;  3OTF A;  4Y5T A;  4CVU A;  1WMX A;  1XYP A;  1OH3 A;  1UZW A;  3JBG 1;  3QAC A;  4CDU A;  1UXX X;  2ENR A;  1W9Y A;  5C8C B;  2PEL A;  2NQY A;  2ZML A;  5L7O A;  4AQS A;  1FXZ A;  3PVE A;  4N7U A;  5LY1 A;  1IZ3 A;  5FLJ A;  2MEV 3;  4JRA A;  2E6V A;  1TE1 B;  1NX9 A;  1Q8S A;  2KR2 A;  4C1W A;  3J7M A;  4E27 A;  2Z69 A;  5BNN B;  1PM4 A;  4LKF A;  1AX2 A;  2P6C A;  1OPM A;  1VAK A;  3AFG A;  4IDZ A;  4J1X A;  4PLN A;  1X9P A;  3NJY A;  3NV2 A;  3ZYB A;  1I1E A;  3KCX A;  2BU9 A;  2WO1 A;  1W6O B;  2WR9 A;  3HQU A;  1V6J A;  5HCF A;  2Q1M A;  5F3G A;  5FYC A;  1O3R A;  4Q4V 1;  3GJA A;  5EZW A;  1QWR A;  5JI9 A;  4Q4Y 2;  1QJF A;  3OG2 A;  3ZLI A;  3AX4 A;  1UX7 A;  4QB1 A;  4XEZ A;  1ENX A;  2O0O A;  5T5L A;  1AVB A;  2A6Z A;  2DCK A;  2G9Z A;  4CU6 A;  3FLR A;  4LLO A;  4Q29 A;  3T30 A;  1ULO A;  4CRQ A;  4LKD A;  1S2B A;  4RA0 A;  5F5I A;  2ORX A;  3VBS A;  1QEX A;  5DN2 A;  1LHU A;  2RG4 A;  3U78 A;  5HV0 A;  2AC1 A;  2MPF A;  4JRL A;  1PGW 2;  4BE3 A;  4XZU G;  4A44 A;  1DGW A;  3LSE A;  2SLI A;  2VBD A;  4HK9 A;  4ZZ8 A;  4Y4R A;  3VDD C;  1Y9Q A;  3C8X A;  1W8O A;  5EQU A;  5CFD A;  3ZIX A;  3AKP A;  4NRO A;  2CDO A;  2OII A;  1VP6 A;  4Q0U A;  2BPA 2;  2Y64 A;  5E16 A;  4WVW A;  5JWP A;  5DZG A;  1AYN 1;  1JHJ A;  2PHW A;  1RUD 1;  3S57 A;  2B9U A;  2XWJ B;  2YGM A;  3RWK X;  5A1L A;  2CU5 A;  4LK7 A;  1KJR A;  1QH6 A;  4URA A;  1AR9 1;  3TNP B;  1OOP B;  1VBB 1;  3J7N A;  1C4R A;  3KQR A;  4KWL A;  2YV8 A;  2HWC 3;  2E32 A;  2VUJ A;  1UYZ A;  4K3U A;  5C3S A;  2QTW B;  1ULF A;  1J84 A;  2GC2 A;  4CP2 A;  1VBE 1;  3ETP A;  2VOK A;  4UT5 A;  4EN0 A;  5CG8 A;  2Z4F A;  4LOS A;  4EN8 B;  4I0B A;  1F15 A;  2ZAC A;  1HJF A;  2WO2 A;  4LOT A;  3T2T A;  3ZYI B;  3OCP A;  1KDM A;  3CIH A;  1EV1 2;  4BK5 A;  3W5N A;  3LGR A;  1KS5 A;  4JGY A;  3OF1 A;  2WT1 A;  3AP5 A;  1FPN 1;  4DXS A;  3V56 A;  4B4P A;  2VZO A;  3THP A;  4DEV A;  2IFW A;  2A70 A;  1C8M 1;  1OKO A;  1W9S A;  1G6N A;  1RVF 3;  2VD7 A;  4LQR A;  4O61 A;  3UJQ A;  2CWS A;  4HET A;  4AI3 A;  5CFC B;  3M3E A;  4P9G A;  4QAW A;  1J3P A;  3B69 A;  3I3Q A;  2ILM A;  3GHM A;  4BLJ A;  1DQ0 A;  3LQC A;  1WMF A;  4YZ1 A;  1G86 A;  3LEI A;  4UF0 A;  2JKX A;  3VZO A;  1S0I A;  2BGC A;  3ZM8 A;  4MET A;  1CON A;  5H9R A;  2R0H A;  3FBY A;  3IIA A;  1KXG A;  1NOV A;  3AZV A;  5SV8 A;  4QPG A;  2B42 B;  4RGK A;  3PUQ A;  3LB9 A;  1PNF A;  4UAP A;  2ZS6 B;  3HWJ A;  3U37 A;  5F2S A;  1IS3 A;  1X8M A;  3ENR A;  4AFB A;  1BJQ A;  1OD5 A;  1VBA 1;  4LHL A;  4MZU A;  4P9Y A;  3TRS B;  4BK4 A;  2F4P A;  1ND2 C;  2J1T A;  3ES4 A;  5DAB A;  4BWO A;  1D2S A;  5FYI A;  5J98 B;  5JOY A;  1OVP A;  4CP9 B;  4K1Z A;  5KHG A;  1JYC A;  2FD8 A;  2DTY A;  2AAC A;  2HBU A;  2XLG A;  5LY2 A;  3T2O A;  5EIY B;  2AUY A;  3MDP A;  4FPC A;  4P02 B;  3DPR A;  4XJW A;  2F4L A;  1NCQ C;  4RS5 A;  3ZR6 A;  2VZP A;  3KQ4 B;  1UL9 A;  2OPK A;  1U5X A;  4OMC A;  4P9X A;  1G8W A;  3GZT B;  1DGW X;  4QPG C;  5AC9 3;  5JSO A;  4D8M A;  1SFN A;  2GP5 A;  4OQ9 A;  1ZM1 A;  3QOP A;  2JIG A;  3VZM A;  2FZ2 A;  1SLT A;  4K6B A;  5IWF A;  3ASI A;  4RGA A;  2I2S A;  5A7P A;  1JOP A;  2VAU A;  3NAP C;  2CAU A;  4CDX A;  5AFB A;  3AB0 A;  1BZW A;  4L97 A;  2A3X A;  1CZT A;  4CU7 A;  4LOR A;  1V0A A;  2AR6 A;  3NNJ A;  4M4P A;  3R6S A;  5J7M A;  1V70 A;  4IEY A;  4QX7 A;  1DGR N;  3FN9 A;  5IK5 A;  5LB6 A;  1RUI 1;  2P1B A;  4YW2 A;  5FUN A;  4ZKT B;  1Q8O A;  4PI2 A;  1WBL A;  4AW7 A;  2Z2S B;  2XVG A;  2RR1 2;  2ORZ A;  1T6B X;  3P1I A;  2ZEW A;  2GNB A;  1V6L A;  5FZ4 A;  4NVP A;  4BQW A;  1JZ7 A;  4XC9 A;  1LOE A;  1G9F A;  2ZAA A;  3I3D A;  4AVB A;  4HPK A;  4CP0 A;  3ZMO A;  5FZA A;  2VVE A;  4NOT A;  4BME A;  2VR4 A;  1W2A X;  2ZGO A;  5F39 A;  4QKN A;  4E2Q A;  1EV1 1;  1DYK A;  1KDK A;  5KHI A;  1OC1 A;  5A7W A;  5GZD A;  1PGS A;  1DBN A;  3LDR A;  5FZO B;  1IHM A;  2W39 A;  2ZGL A;  3FX3 A;  1DQ2 A;  1TVG A;  2P5B A;  2PFW A;  1A34 A;  1U5Z A;  1QNW A;  4KWU A;  3I2K A;  2WT2 A;  1I3H A;  3ZO0 B;  4QDQ A;  4XF9 A;  4Y5Z 0;  1VMF A;  1CAV B;  3AVR A;  4LIT A;  1ASJ 3;  2KM2 A;  1PHM A;  2Q8D A;  4IER A;  3M2M A;  1V6I A;  2JE8 A;  1VRH 1;  4XF0 A;  4CUG A;  2Y26 A;  1UKR A;  2W1Q A;  3QH6 A;  5FKC A;  1ONA A;  1WME A;  5KBF A;  4AEK A;  2HKX A;  3NV1 A;  3UKV A;  5JCT A;  5FP8 A;  4CU8 A;  3ACI A;  1J1T A;  2P3K A;  3ST7 A;  2EAA A;  1R08 3;  1GWK A;  2CV6 A;  4QXK A;  3TBD A;  4DXR A;  3MPB A;  4KG8 A;  3Q9O A;  5GLZ A;  4A45 A;  5CA6 A;  5CAZ A;  2GP3 A;  2V73 A;  1JTZ X;  3MYX A;  1GQP A;  1Z7S 1;  4MAD A;  3MPP G;  4CCJ A;  5GJ6 A;  4CYD A;  2W3J A;  5J96 B;  1OA3 A;  4CE8 A;  2BWC A;  3HT2 A;  1MS8 A;  3NST A;  4UBG A;  4YW1 A;  3H8U A;  4KG0 A;  5F5C A;  4IE5 A;  5FP7 A;  2UUR A;  3K48 A;  4RD7 A;  5JXG A;  5LBE A;  2DBI A;  2VXR A;  3BN6 A;  4K40 A;  4LBQ D;  5J48 A;  3K46 A;  3UJO A;  1C5I A;  4AF9 A;  2CY6 A;  2RS3 2;  1CJP A;  3NAP B;  5CEH A;  1H4H A;  4KBB A;  3E6C C;  2DVB A;  3WP6 A;  1WZX A;  2FMD A;  1ZA7 A;  4YW7 A;  3AP7 A;  4AHY A;  2BVB A;  4ZON A;  5FZ0 A;  2BGO A;  5IJR A;  1S0G A;  3LWC A;  4XZP A;  3CU7 A;  2WZ8 A;  3AZZ A;  5FYV A;  3T0A A;  3AYC A;  3PDQ A;  4V2W A;  1YNA A;  1DP0 A;  2ZGN A;  3HOB A;  2JE7 A;  4Y26 A;  2ZEZ A;  2ERF A;  3C7F A;  1WWY A;  3I8T A;  5IT6 A;  1NE6 A;  1CZS A;  5ACA 1;  2CSG A;  1Y9M A;  4XF3 A;  5FMD A;  4LTA A;  1CR7 A;  4JKM A;  1ND3 B;  4YVW B;  1S0J A;  4R9D A;  3G6J B;  4BU2 A;  2JXA A;  1PNG A;  2B8M A;  4AHZ A;  4BQX A;  4IET A;  2ZAB A;  5G04 L;  3JUU A;  1BEV 1;  3WT3 A;  3R0R A;  1M4W A;  2RHP A;  3MO4 A;  1RUJ 1;  2J7M A;  4CXY A;  3VBR C;  4AFM A;  5A7Q A;  4MGK E;  4HN0 A;  1SQ4 A;  1QIQ A;  5CFC C;  4WM7 C;  3OGS A;  5CIS A;  1RUI 2;  1GZC A;  3VBU A;  3UYJ A;  1W6O A;  2SBA A;  1CAV A;  3PVB B;  3I54 A;  3JZV A;  2D3P A;  1POV 3;  1UOJ A;  4JAA A;  1XYN A;  3E1F 1;  4XQW A;  4F83 A;  4YFZ A;  3IMM A;  1AXK A;  1H0B A;  3VV1 A;  1VBE 2;  1GZT A;  2YGL A;  1W8N A;  2HWB 2;  4DUV A;  5HI0 A;  2GC3 A;  5FO8 B;  3R4S A;  1O59 A;  2BUK A;  5L9R A;  2DUO A;  1RVF 1;  3ELN A;  3VBF C;  1MZ5 A;  5FAX A;  1FOD 2;  2QQK A;  3FBM A;  2A5Z A;  5F6L B;  3IN9 A;  2WYS A;  5C8C A;  2VBB A;  3O5S A;  4W65 A;  1H2L A;  1OUS A;  3EBR A;  4HN1 A;  1PIV 2;  4OUS A;  4QX0 A;  3WW1 A;  1YIF A;  4NHX A;  1RXF A;  3ZXJ A;  5FIX A;  4P9I A;  2VPV A;  2X5I A;  4Q1P A;  2DVG A;  3O1R A;  3I2H A;  4XXP A;  3VBH B;  2OPW A;  4ZHN A;  5M0T A;  1QF3 A;  3S0M A;  2Y6H A;  3A23 A;  5F3I A;  4BOW A;  4FXG B;  1JI6 A;  4CDU C;  2V4A A;  3AC0 A;  4YFW A;  1UOG A;  5BNO C;  3MV0 1;  4NO4 A;  1POV 0;  3D0J A;  1S0B A;  1C5H A;  4AI9 A;  5C3Q A;  1G7Y A;  3T3Y A;  1OOP C;  1FI2 A;  1UYX A;  2EF6 A;  4LIV A;  5A3P A;  3I2O A;  2A75 A;  2BER A;  3ZPY A;  3J8F 2;  1UY1 A;  3VKN A;  4JCK A;  2HEW F;  3BTX A;  4FPY A;  1ENS A;  3CZJ A;  4IEU A;  2YUE A;  2W1W A;  4TLG A;  2AYH A;  2PHT A;  3AYA A;  2XML A;  2QJV A;  3NRU A;  3HNB M;  2D93 A;  4OUL A;  4YGE A;  1BBT 3;  1BK0 A;  2FDK A;  4AGV A;  4QXC A;  1TME 2;  2D6K A;  2RJL A;  3MIH A;  4OCT A;  4EWD A;  1GOF A;  1EY2 A;  2ARE A;  3CLP A;  3BPZ A;  2WRA A;  3POS A;  3NWK A;  1APN A;  1RHI 1;  5LBF A;  1DZT A;  3N9O A;  1YHF A;  1YEW A;  4DY5 A;  3OGR A;  3JD7 2;  5LA9 A;  2P34 A;  1YFW A;  1AXY A;  2G9G A;  2OX0 A;  4QHB A;  1X7N A;  1DZQ A;  1YFU A;  3DPR B;  1WLD A;  3HJR A;  3N7M A;  4COZ A;  2JIC A;  3OBZ A;  3DEC A;  3M70 A;  1GLH A;  1DHK B;  1LOF A;  4FI9 A;  4PT6 A;  3SNM A;  2NYY A;  2OUH A;  5LA1 A;  2YU2 A;  4IEZ A;  1LHV A;  2CGP A;  2ZPX A;  5A3W A;  3WP3 A;  4N8M A;  2Z79 A;  4K1Y A;  1RHI 2;  1TEI A;  5DUX A;  3ZDV A;  4DQA A;  4LKS A;  2FCU A;  4H14 A;  4UI9 L;  1PX3 A;  3UL2 A;  2RDN A;  4NN0 A;  3WCR A;  2JG8 C;  2WC2 A;  2TNF A;  4AE2 A;  3J9S A;  2LUW A;  2HJI A;  1WA4 A;  2ZGM A;  3NV3 A;  4QPY A;  5IYY A;  3T4V A;  2CL2 A;  3ZXE A;  3BI3 A;  2NMO A;  1LOF C;  3FL7 A;  4COV A;  3CEW A;  1FNY A;  4TZD A;  4XUO A;  2YFU A;  4LHS A;  3AMM A;  4CEW A;  5F9T A;  1GSL A;  3IDB B;  1DF0 A;  2QNK A;  1VB2 A;  3MF6 A;  5A32 A;  1O3T A;  1XU2 A;  2A1X A;  2NPI A;  4HVR A;  1OLQ A;  3QLQ A;  4CU9 A;  1RUC 2;  5JSP A;  4HKO A;  4LO6 B;  1IPJ A;  4M01 A;  4XHB A;  4XXA A;  4MGT A;  4XYX A;  4CEY C;  4EYU A;  5LCW L;  1NA1 A;  3TB0 A;  3VBO C;  3WF4 A;  1O5L A;  1O8S A;  2VNR A;  4C8D A;  4YZ2 A;  1JHN A;  1GZW A;  1ZBA 1;  4CDW A;  1WCU A;  1RUH 2;  1EAH 1;  4ES8 A;  1JZ8 A;  4BQ5 A;  3ZFE A;  1VRH 3;  1UYY A;  2B5H A;  2ZCW A;  5LBB A;  1JN2 P;  1O3Q A;  4YLZ A;  2WII B;  3GGL A;  1PVX A;  4IEO A;  2K46 A;  1BVP 1;  3E6D A;  3K3N A;  1J3Q A;  1V00 A;  1UZ0 A;  1IS4 A;  4K8F A;  1R08 1;  1SLB A;  4CDQ B;  2CTV A;  4XE9 A;  2J1E A;  3EJK A;  3WV6 A;  2XJT A;  1UIJ A;  1AF9 A;  2JWP A;  1XE7 A;  3L9J T;  1Z7S 3;  5BYN A;  2CDP A;  1QJE A;  5EXO A;  3BOW A;  1V6O A;  3GBF A;  2JIJ A;  1RC6 A;  4AVA A;  2UY9 A;  5CFD B;  4GH4 C;  1OXC A;  2GSY A;  1GR3 A;  4ORF A;  2A3W A;  1QXR A;  1VAM A;  2BDR A;  3IMN A;  1W03 A;  3PTY A;  2WSU A;  1LJ7 A;  1BEV 2;  2W94 A;  4O7X A;  2CGN A;  2D7F A;  3AJY A;  3VL9 A;  4Q4Y 3;  1H9W A;  2C4X A;  2YFZ A;  3MFC A;  4FFH A;  3KGZ A;  4J6G A;  1BBT 2;  4ITC A;  5ACA 2;  1GWL A;  3N7J A;  4YZ3 A;  3RFR A;  2XWB B;  3C2U A;  4MVT A;  5K8S A;  3C3V A;  1S2E A;  1W6Q B;  1O3S A;  3G7D A;  1IOA A;  1JBC A;  3H3U A;  4ZU7 A;  4CEY B;  3UV9 A;  4LKE A;  4S2D A;  4CP1 A;  4QHO A;  1UF2 C;  1MQT B;  3U10 A;  1YYN A;  5JLV A;  1ODN A;  2W68 A;  4YVS C;  4WM8 B;  1YXW A;  1IPK A;  1RMU 2;  5CVR A;  3BIW E;  1JYI A;  1CX4 A;  4HON A;  1Z0H A;  3F2Z A;  3O7O A;  4FPH A;  2VMF A;  1VBB 2;  3MFA A;  3VL8 A;  1RUJ 3;  3WG2 A;  4ET7 A;  5L7O B;  1HRI 2;  3WXP A;  3U75 A;  1Y7B A;  4RR3 B;  1FOD 3;  4IV1 B;  4UYB A;  2D5H A;  3WHU A;  4JC1 A;  3KB5 A;  4JKL A;  1H2N A;  2VW0 A;  3JD7 3;  2Q8O A;  1CN1 A;  4D0Q A;  2HWC 2;  2BBV A;  3GM8 A;  2IFR A;  4CCM A;  1O8P A;  1QJX 3;  4SBV A;  3NJV A;  3AL5 A;  4QQH A;  4BQY A;  4QM8 A;  2D3R A;  2PQQ A;  3DKW A;  5FZ3 A;  4AI2 A;  3B3Q E;  2G19 A;  1ZNP A;  5D21 A;  2WFF 2;  5DXD A;  4MGZ E;  2LM3 A;  5A70 A;  2E63 A;  5T54 A;  4WV8 A;  4GMP 1;  2JKB A;  1UQX A;  3RGB A;  1HRV 2;  3MHZ A;  4HLT A;  2AH2 A;  5JSR A;  1PVC 2;  4N43 B;  4XIO A;  1K5M C;  5FO7 B;  1Q3E A;  2VO5 A;  4FOV A;  3ZOI A;  2VJX A;  5B4N A;  2X29 A;  5GLW A;  4FPG A;  1MVQ A;  2EAK A;  4JGZ A;  2R30 A;  2VEC A;  1COV 3;  3OGV A;  2Y6J A;  4N53 C;  3RS6 A;  2QQI A;  3FUO A;  5IVC A;  1XQN A;  3Q8E A;  1LEN A;  3BU7 A;  2Q8E A;  1VBD 3;  3NKT A;  5D2A A;  4QX3 A;  5JZG C;  3AZY A;  3OGG A;  1W9T A;  5HXV A;  1JZ3 A;  1VBC 3;  3CKH A;  2EIE A;  1SDW A;  4CPB A;  3HN3 A;  1AR6 2;  5A7O A;  4HAN A;  4FP2 A;  4CCC A;  3J4U H;  4AVT A;  4XDO A;  3SC7 X;  3BTZ A;  2OQ6 A;  3ZN6 A;  3K4A A;  3FUQ A;  5A33 A;  5JR7 B;  4BPZ A;  2X10 A;  4QX5 A;  3WQB A;  1BBT 1;  4GWI A;  5KWR A;  1R1A 3;  3KT1 A;  2OVU A;  3JBG 2;  1RUE 1;  1K3I A;  3NVC A;  2ID4 A;  3ZIW A;  4XHX A;  2I74 A;  3N4M A;  1RHI 3;  2VL4 A;  1NA1 B;  4CDX C;  5FPA A;  3GZE A;  2EXJ A;  3VBH C;  4S2H A;  1VLN A;  5I8T A;  2GAU A;  1UY2 A;  2Q0A A;  3VD3 A;  4GXL A;  4XCB A;  3WNK A;  5F3C A;  2ZHL A;  1JUH A;  1U5I A;  2IC1 A;  5FY9 A;  5GZG A;  3RWN A;  4XTM A;  2PLV 3;  2PQS A;  4JHZ A;  1LNS A;  2VU9 A;  5FOB B;  4OHZ A;  3VBF A;  3VBF B;  1UZY A;  3GXU A;  1JZ2 A;  5KXD A;  1K42 A;  3NJZ A;  3VKM A;  5D8A C;  2VGD A;  3MF9 A;  3NO8 A;  3OSD A;  1V9U 1;  1E5S A;  1QKQ A;  1NLQ A;  3DL3 A;  3GBG A;  4GKY A;  5EJ3 A;  2LRP A;  2X05 A;  4QD2 A;  4NHL A;  5A80 A;  2QZ2 A;  3GDB A;  1OT5 A;  1W8H A;  4XUT A;  2EIG A;  1N1V A;  5HCB A;  3KVB A;  1C57 A;  1AX1 A;  5C9A A;  2WNU C;  1BKZ A;  1W6N B;  1PZ8 A;  1ZRR A;  4BXF A;  1OFN A;  5AVA A;  4JX0 A;  5H9P A;  3WEZ A;  1AXZ A;  4AFD A;  1Y4W A;  1UOF A;  1ZRD A;  1PO2 2;  4FAG A;  1AJO A;  1IKP A;  3IAQ A;  1W2U A;  1RED A;  2RMU 1;  2WLQ A;  3NNL A;  4QMA A;  4XJA A;  5IAX A;  1D4V B;  1GOH A;  1UCX A;  2XJR A;  3OPZ A;  5CFC A;  4QPI B;  3CDZ B;  2A6V A;  3RI8 A;  1ACC A;  1HW5 A;  1EYB A;  4P9J A;  5FYY A;  3K2O A;  2QQM A;  2XLA A;  3M1H A;  4Q0V A;  5FUP A;  4MGY E;  5GLU A;  2XVK A;  3AKT A;  2WNU A;  2OW4 A;  4FQ4 A;  4GQ7 A;  2VZR A;  3BUC A;  3ETQ A;  3N9M A;  3B02 A;  5GZE A;  1MVE A;  2HYX A;  2R16 A;  1CWP A;  1KGY A;  1N1T A;  1EPZ A;  2F6B A;  3DYP A;  1HRV 1;  3H50 A;  4IE7 A;  5FRA A;  2W95 A;  4MV2 A;  4RYD A;  5KHK A;  3J7H A;  3WDY A;  3PUR A;  4UFM A;  1UO9 A;  1STM A;  1MEC 1;  3KS7 A;  3OB8 A;  1LRH A;  3P3N A;  1L7Q A;  1U0A A;  2IXJ A;  3GNE A;  2O1Q A;  4UFL A;  4AI0 A;  1XNT A;  1YJL A;  2D6N A;  1WW7 A;  2WWU A;  3WZ1 A;  2WZR 2;  2YBK A;  4RR3 C;  3VKO A;  1PIV 1;  4OZX A;  4AHX A;  4ONU A;  2DFC A;  3H3L A;  3BGA A;  4HMZ A;  3SH5 A;  5HBA A;  3RG0 A;  1ULC A;  2WZE A;  3SIT A;  1HRI 1;  4W6X A;  1IPS A;  5CKM A;  3T1M A;  5JOZ A;  3VD7 A;  3VN4 A;  1RVF 2;  4CUB A;  1W8W A;  3WF2 A;  4AEM A;  5EV7 A;  1AYN 2;  3PIG A;  1JYV A;  3ZYR A;  3DCQ A;  3UGH A;  1US3 A;  3SCG A;  2VW2 A;  4E8D A;  1MQT A;  4LJH A;  4PDW B;  1VR3 A;  2D6M A;  3DGT A;  3VHP A;  3VDA A;  4XDP A;  2ZGQ A;  1YLL A;  4HOO A;  4BZ4 A;  2WS9 3;  3E97 A;  1AR6 3;  1EAH 2;  4IUG A;  2OQ7 A;  2V5D A;  4XTP A;  5I8S A;  3O0X A;  1IS6 A;  3GAL A;  4CCO A;  4LNV A;  2NMN A;  4KU7 A;  5LW9 A;  3U11 A;  1DFQ A;  5JMC A;  3DKQ A;  4B7K A;  1AYM 3;  2D6P A;  2DVD A;  5EPA A;  5CB7 A;  2Q8C A;  3RZZ A;  2X53 S;  5CAD A;  1UU6 A;  3KV6 A;  2WIN B;  1LCL A;  1GNY A;  5IK4 A;  4N90 A;  5CZK A;  4YZ5 A;  1GU3 A;  1MQT C;  4XF4 A;  4IE0 A;  3BKZ A;  1F5F A;  2DUP A;  3HN1 A;  1QQP 3;  1UNB A;  4YW6 A;  3ROU A;  4X6Q B;  1MS0 A;  2C9A A;  1CPM A;  2JG8 A;  2YPJ A;  4QKB A;  2FMY A;  2R04 2;  3HEI A;  1I9R A;  4YG6 A;  5EYY A;  3FFQ A;  5ABJ A;  3HBK A;  4CA9 A;  3VDD B;  1Q56 A;  4GZ9 A;  4EZH A;  1W6P A;  4ASM B;  3FE5 A;  4AL9 A;  4YM3 A;  1AR9 2;  3T1L A;  1DZR A;  4C0B A;  3Q8F A;  4XFA A;  4ATE A;  4A6S A;  4XBL A;  4A2U A;  3WNX A;  3LSD A;  2FDF A;  2X09 A;  3D82 A;  2D6O X;  1YWK A;  1ZA4 A;  2PTM A;  4O9G A;  1W99 A;  2VY0 A;  3VBO A;  2Y38 A;  1ZZ9 A;  3KV4 A;  1PVC 1;  1RUG 3;  3ZSE A;  4DB5 A;  1VBD 1;  1Z7S 2;  4YSF A;  2O14 A;  5L9V A;  2VM9 A;  3KWV A;  1QY4 A;  1BXH A;  1QOS A;  2BNO A;  3IB3 A;  2W87 A;  3POI A;  1VBC 1;  1J83 A;  2RM2 3;  5F5Q A;  1CVN A;  4TTG A;  2Q30 A;  3O12 A;  1PO1 3;  3PUI A;  4A4A A;  2JEN A;  1XNB A;  4XOG A;  4P9L A;  4R52 A;  3RJR A;  4OLL A;  3SH3 A;  3PME A;  1WGP A;  4LHK A;  4CEW B;  4TXW A;  1QDO A;  1UAI A;  1NT0 A;  4QHZ A;  1LHN A;  4BM8 A;  3I2D A;  2RDR A;  2XQX A;  4Q4W 3;  2VMH A;  1RUE 3;  3M3Q A;  3CMG A;  3RPQ A;  4BHP A;  2XL9 A;  2ZX2 A;  1KRI A;  1LOC A;  1OLR A;  5FZ8 A;  3BIE A;  2WSV A;  2CWM A;  3ZXD A;  1W90 A;  1S0C A;  3W20 A;  5C4W B;  5LRR A;  3SLI A;  3HMY A;  2Q1Z B;  4ARX A;  2VOV A;  4HT1 T;  4GH4 A;  2OKX A;  5KXE A;  4FFI A;  3PVO A;  1D4M 3;  3AMP A;  1DLC A;  2XHK A;  3L2H A;  4PIY A;  1QOO A;  1MS4 A;  1C8N A;  3H42 B;  3ZPO A;  2MNG A;  4LE4 A;  5IUQ A;  4BCU A;  2PLV 1;  4UXA A;  4WM8 C;  1AJK A;  2H6C A;  4AFC A;  1LUL A;  4QQO A;  5FY0 A;  3H8R A;  5FR3 A;  2FDJ A;  1C1F A;  1RGS A;  4A3X A;  1RMU 3;  4RHV 1;  4CCN A;  5IAV A;  4D7Y A;  4BIO A;  5I91 A;  2YC2 A;  2NN8 A;  5DQ0 A;  2WA3 A;  1WCK A;  3MGU A;  4HPK B;  4A6O A;  3OJB A;  1YQ6 A;  1XPW A;  5FY8 A;  3LCP A;  4L99 A;  4PQ9 A;  4Q4V 3;  5A3M A;  1QJU 1;  2WKK A;  5E6H A;  1E5R A;  1QGL A;  1WD4 A;  5A3L A;  4DS0 A;  1LES A;  1UXZ A;  3N9L A;  4N9H A;  4XBN A;  3WIN E;  3WUC A;  2ZEX A;  2LAL A;  3AKQ A;  3WP4 A;  4CEW C;  5LEJ A;  3GHN A;  3O1O A;  4C1X A;  1N3Q A;  1RB8 G;  1GV9 A;  1QOT A;  3MW4 A;  4IV3 B;  5LAS A;  5FXX A;  5FK8 A;  4PIZ A;  3T09 A;  3MBW A;  3EYP A;  2JDK A;  4FVV A;  4GWM A;  4QU1 A;  5FRE A;  3SH4 A;  3T08 A;  1SLI A;  4D69 A;  1CAX A;  4AED A;  1D0G A;  1J59 A;  2DCY A;  2ZZJ A;  3OPW A;  3KCC A;  4XDQ A;  2WYF A;  4D7S A;  1W2O A;  2D6L X;  2J1S A;  3A0K A;  5T50 A;  2RMU 3;  1OQ1 A;  3LOI A;  3BOD A;  5ABJ B;  2GH2 A;  2FCT A;  1YRZ A;  1RIN A;  1YO8 A;  4ARY A;  3WUD A;  3ZXA C;  2N7G A;  4GWJ A;  4MOA A;  3I4I A;  1LOA A;  4B1L A;  1NLS A;  1PK6 B;  2CNA A;  4D7T A;  1ND2 A;  3K77 A;  1RUD 3;  4MGQ A;  1D0H A;  2G9F A;  3EHK A;  3AYE A;  5J36 A;  4Y20 A;  3RZG A;  4FAH A;  3V0B B;  2QQP A;  4HSJ A;  2FDH A;  2OZ6 A;  1AR9 3;  1UMI A;  1OLM E;  2WLP A;  3GZU C;  4DRV A;  2HWC 1;  4RS5 C;  1O4Z A;  3KF3 A;  1Z78 A;  4GJZ A;  5F8P A;  5FZI A;  3ZN5 A;  3POW A;  3ITQ A;  1Q8V A;  2IXC A;  3KSC A;  3OBR A;  4TLF A;  5FPU A;  1GWM A;  5A6Y A;  3I2I A;  5F6K A;  3WDX A;  5ISL A;  4V1P A;  4AGG A;  4LA2 A;  2XLF A;  3O0W A;  3AZX A;  1R08 2;  1ZBE 1;  3T2Q A;  3TEY A;  3W21 A;  1GZ9 A;  3SIS A;  1OSG A;  2ARX A;  2ZKL A;  1H30 A;  4EZ4 A;  4BQ3 A;  1YIP A;  5ERL A;  1IQD C;  1MEC 3;  3FMG A;  1DQ1 A;  4DY3 A;  2R07 3;  2FDG A;  4LBQ B;  3M7A A;  2XOM A;  4EN9 B;  1VRB A;  4W50 A;  4L0P A;  4EN7 B;  2OZJ A;  1NZI A;  3E5Q A;  4GAL A;  2Y6K A;  3K75 B;  5FP9 A;  3RNS A;  3PNA A;  1C8M 3;  2WWS A;  2XB6 C;  3A7Q A;  2PAE A;  3B01 A;  2R7E B;  1VBC 2;  2RDQ A;  4NAM A;  1HQW A;  3ILN A;  5T5O A;  2YG0 A;  3N9P A;  4EWE A;  1OF4 A;  3WDU A;  2ET7 A;  3IBM A;  3ORJ A;  2E26 A;  2KXL A;  4OQ8 A;  5IFP A;  5FZF A;  4PBP A;  4FSJ A;  1XND A;  4K9S A;  4IEX A;  1VJ2 A;  1Y3T A;  4XFH A;  5GM0 A;  3VKL A;  2VCA A;  2XDV A;  1B35 A;  1MS3 A;  1ND3 A;  4QX8 A;  3WDT A;  4ERO A;  4CCK A;  2PMW B;  5IVJ A;  2XON A;  3S5A A;  1VBA 3;  1O4T A;  5FDB A;  3WLU A;  1URX A;  2ADE A;  4OYU A;  4WM7 B;  2WNE A;  3N35 A;  2C9K A;  1WW6 A;  1EUU A;  1AUY A;  2HWF 2;  4M3C A;  4XJ9 A;  2OXB A;  5FK7 A;  5T3N A;  4UFK A;  2TUN A;  3HT1 A;  4W6W A;  2GH8 A;  2QUO A;  2E9Q A;  2V4V A;  2VOT A;  4WVZ A;  3SCF A;  5K9Y A;  4EQV A;  1SPP B;  1CAX B;  1SBD A;  4AED B;  3V0A B;  1XU1 A;  2R49 A;  2VTX A;  5KR7 A;  1AX0 A;  4C91 A;  1R09 2;  1UU5 A;  2XJP A;  3WW2 A;  3M3I A;  3AFK A;  4IV3 A;  2FDI A;  3OBA A;  2YXS A;  1X33 A;  4LBK A;  1H1A A;  2D40 A;  2K2S A;  2XBO 1;  4M4R A;  4Q26 A;  2GN3 A;  2Y34 A;  2PN5 A;  5K4L A;  4KGQ A;  3THT A;  4LIU A;  5FPB A;  4CTE A;  4MLO A;  4V2V A;  4ATF A;  3FHA A;  3HVD A;  4A7K A;  5K0U B;  3WDV A;  2RR1 1;  1YQ8 A;  3WNN A;  5DUW A;  3QBQ A;  2PYT A;  4HVQ A;  3RYK A;  4PI0 A;  4QX2 A;  4CSW A;  2BJS A;  2RM2 2;  3D0S A;  2JDM A;  4O9E A;  4DEQ A;  4N53 A;  4Q4X 3;  4B1M A;  4XFF A;  2Z5W A;  1HB3 A;  2XR4 A;  3VZN A;  4NID A;  2E7A A;  3T0B A;  3PJQ A;  3N9Q A;  4D6R A;  5A1A A;  2O8Q A;  2EVX A;  4N7I A;  2WBK A;  4K21 A;  4LBO A;  1PVC 3;  2DYC A;  1IQA A;  3NW4 A;  4MHR A;  4IEV A;  5BNP B;  1XRU A;  5DAP A;  4JZR A;  1X82 A;  1G9B A;  2WT0 A;  5I0U A;  2DF7 A;  1CPN A;  5ANQ A;  4IW3 A;  1EV1 3;  3AP9 A;  2I07 B;  1C1L A;  1J3R A;  5FXW A;  4BXS V;  2VUD A;  2WNO A;  5FZE A;  3BCW A;  5C8C C;  3ACH A;  3KHC A;  4U36 A;  1W9F A;  1NG0 A;  5L19 A;  4D3W A;  4NHK A;  4NIA A;  4Z92 B;  1SFY A;  1WCD J;  2BOI A;  3VBO B;  2F17 A;  3LE0 A;  3W5M A;  4Q5O A;  4KH9 A;  1PX4 A;  3GJB A;  1ZBA 2;  2XJU A;  4Q4W 1;  1T2X A;  5E8A A;  5FZL A;  3VZK A;  3JB4 C;  2QVS B;  3ALQ A;  4CUC A;  4AI1 A;  5BNQ A;  2DDU A;  2D3S A;  3WSO A;  4L9B A;  2EIC A;  3OD0 A;  4QQP A;  3WQ1 A;  2C5D A;  4XJ8 A;  3IM0 A;  3UKT A;  1SPP A;  4S2F A;  3KGL A;  1UU4 A;  1HQL A;  2WAO A;  4H2A A;  5A33 B;  3MZH A;  4Y4Y A;  3MLJ A;  3VBR A;  3ZFE C;  1VRH 2;  5JAX A;  4BQ2 A;  3VB9 A;  1SDD B;  4WM7 A;  1LEM A;  4CPB D;  3WF0 A;  1FV2 A;  5C3P A;  1F4H A;  4HK8 A;  4H7M A;  2AEN A;  1AR8 2;  2JG8 B;  4FPE A;  4HBN A;  1RXG A;  3OPT A;  2VVD A;  1VAL A;  1HB4 A;  3RQ0 A;  4B4R A;  1IGO A;  3D4K A;  1E5I A;  3O1P A;  1BMV 2;  4FTS A;  3IDC B;  2YYO A;  5CFD C;  5DUU A;  2QQL A;  4RQP A;  1LHO A;  1QJU 3;  1WKY A;  4DIN B;  2VNO A;  3OGJ A;  3CZU A;  2B45 X;  3PL0 A;  1S2K A;  4Y3O A;  1OKQ A;  5FMB A;  4ZXK A;  1TMF 3;  1LB2 A;  1RIT A;  2DBN A;  3IWZ A;  5FZM A;  1Q8P A;  1XSQ A;  2VNG A;  2ZKN A;  3IKW A;  2K0G A;  2WZP P;  3ZMN A;  2HWF 3;  2DVA A;  2VXJ A;  4CXX A;  2UY8 A;  2V72 A;  4OFG A;  3AMQ A;  4M00 A;  3DEM A;  4XMA A;  1ZRI A;  3IPV A;  3U4X A;  4BYY A;  1XB9 A;  4DO0 A;  2QE3 A;  4NUB A;  3NJX A;  2X5I C;  1QH7 A;  4TYS A;  3AK0 A;  1ENQ A;  5APA A;  5C5U A;  1R09 3;  1RTV A;  3RSJ A;  1RUH 1;  4GAZ A;  3PU8 A;  1BK1 A;  2CYF A;  5FQ0 B;  3E5X A;  3VKF C;  4YVW C;  4I09 A;  3TWI A;  2WAB A;  5C70 A;  3ME2 A;  3K4D A;  5LA2 A;  1AL0 G;  1RUF 1;  4LA3 A;  4LPL A;  5ACA 3;  5AC9 2;  1I6X A;  3OUH A;  5IW0 A;  4K7J A;  2VCC A;  4Y24 A;  4QPG B;  2JDP A;  4XAC A;  2WL1 A;  4HL0 A;  4JTO A;  3UES A;  4BQ1 A;  3KT7 A;  2BTV C;  4I3P A;  3I2J A;  5JMO A;  1BEV 3;  2VZT A;  3ON7 A;  4YYO A;  3O1M A;  4MG2 A;  3ZXG A;  5CBL A;  4IE6 A;  1OA2 A;  1ZZC A;  2VZQ A;  2VZU A;  4WM8 A;  3ZDS A;  4Y20 B;  4XQ4 A;  4DXZ A;  4E2G A;  1ND2 B;  4MH0 E;  3BTY A;  2BVV A;  1C28 A;  2VQU A;  2JEC A;  2R07 1;  1POV 1;  2D98 A;  1N3O A;  2HWE 1;  4DRR A;  1N47 A;  1XNK A;  4GJY A;  1DQ6 A;  4I3G A;  4MYE A;  5JI7 A;  3JQW A;  4IQP A;  3SEP A;  1SMV A;  1RUE 2;  3KV5 A;  3MUZ 1;  5IHR A;  1JU4 A;  4NRQ A;  4PDW C;  3M3O A;  3U14 A;  4OMD A;  4TSV A;  2OYZ A;  2MEV 2;  3LIG A;  2VVF A;  1CZV A;  2KD7 A;  1NAE A;  2R06 3;  4FOY A;  4XFG A;  2VOW A;  4COU A;  3THC A;  4FPJ A;  1W6M B;  2WN3 A;  2Y33 A;  4E4S A;  1UPS A;  4WVM B;  1S0E A;  4XQD A;  1H2K A;  3O0V A;  3KHB A;  4DUW A;  3POY A;  1CX1 A;  2UYA A;  3RYP A;  5FLI A;  3A22 A;  1JMU B;  1OA4 A;  3FHI B;  4FQZ A;  1N1Y A;  2XXZ A;  3WD5 A;  1UPI A;  1RYY A;  1K5M A;  1SLL A;  1YQ2 A;  2XJV A;  2VMG A;  5T52 A;  5C4W C;  1CQ9 A;  1GAN A;  1E5H A;  1UMH A;  1MAC A;  5AVP A;  3VLB B;  1ALY A;  2ADD A;  3ACL A;  2TEP A;  4KWK A;  5D8A B;  5FMO S;  5BNP C;  1DLL A;  5EFU A;  4IEQ A;  5T55 A;  2EA7 A;  3H3Z A;  5A7S A;  3HAG A;  3FFZ A;  2A71 A;  1SHW B;  1DQ5 A;  1SCR A;  5JOW A;  1W8Z A;  1DG6 A;  5C7G A;  1KFU L;  4QPI A;  1ZRF A;  2GN7 A;  4HVO A;  1V6N A;  1W6N A;  2P3J A;  4OZO A;  5T5P A;  1TG7 A;  1GUI A;  2DWR A;  2JB4 A;  5E89 A;  3ZXF A;  3KLS A;  5A3T A;  3MIG A;  3TAY A;  2JE9 A;  4Q2F A;  1W28 A;  2ZEY A;  1NA1 C;  2TBV A;  5EWS A;  2P3Y A;  1GIC A;  4UW3 A;  4W6Y A;  5C4W A;  2PHD A;  4WVV A;  1OBN A;  2VMC A;  4I01 A;  4R4X A;  5FZG A;  5ABJ C;  3ZYJ B;  2XBO 3;  4LLF A;  2DUQ A;  4G4F A;  1AR8 3;  2XJQ A;  2ZX0 A;  5C5T A;  1R1A 2;  2WFF 3;  1OQE A;  1NCR A;  1KIT A;  4QKF A;  4B3N A;  3SQO A;  2DVF A;  1K12 A;  3POJ A;  3IZO A;  4KGG A;  4E4Z A;  1SAC A;  4JTN A;  3I49 A;  2AZ5 A;  2V5Y A;  5DG2 A;  2QQU A;  2LRO A;  4SLI A;  4Y22 B;  2LS6 A;  1LGC A;  4HKL A;  4Y1Y A;  5FO9 B;  3ZYH A;  4XFI A;  4NRM A;  3GCW A;  3ZR5 A;  1QJY 1;  2JDY A;  1UY0 A;  2YBS A;  4ISR A;  2RS1 2;  2EAL A;  5I93 A;  1H1M A;  1BQP A;  1TNF A;  4GA9 A;  1HJG A;  1PZ7 A;  3WR0 A;  1OMI A;  4QWN A;  1SEF A;  5IVV A;  1F2N A;  5LA0 A;  5J3U A;  4IND A;  4R9C A;  1GQH A;  1PM7 A;  3WF3 A;  3PLQ A;  3EO6 A;  1MS5 A;  1B35 C;  5FZD A;  4Y1X A;  3W58 A;  1MEC 2;  1B09 A;  2R07 2;  1RUC 1;  4NWV A;  1NCQ B;  4M0H A;  5BNN C;  3ILF A;  5C9A C;  2W0X A;  4QB6 A;  1W2N A;  1W6P B;  1FYU A;  4ZU4 A;  5F7U A;  4DNY A;  4YG3 A;  1DYP A;  2BFU S;  4E4D X;  4XBQ A;  2XJS A;  3ZXL A;  4XAA A;  4JGZ C;  2PXJ A;  2RS5 1;  3POG A;  2VOX A;  3Q8A A;  4MXW A;  3U07 A;  4FPF A;  1G9D A;  5DPN A;  5SV5 A;  5JIA A;  4NPM A;  4Q27 A;  1JOJ A;  3JBG 3;  4ISQ A;  1FT9 A;  2HEY F;  2JD4 A;  2Y8K A;  2YHJ A;  3U0Z A;  4WVM A;  2C6S A;  4UOJ A;  2FZ1 A;  2JD9 A;  3OYW B;  1MS9 A;  1L3J A;  4NRP A;  1TMF 2;  5TSW A;  4AQ6 A;  2HEV F;  2WQ8 A;  2B39 A;  5A3U A;  1NYW A;  2MEV 1;  1NXD 1;  3CHX A;  4OHY A;  4XF1 A;  4AGR A;  5DAW A;  1JOD A;  4NHY A;  1TNR A;  1XNC A;  4BH9 A;  3H7J A;  2R0F A;  4AHW A;  4Z07 A;  4Q0P A;  1N3P A;  3I3B A;  2EXK A;  1CAW B;  2BW8 A;  5FV3 A;  3RZM A;  5JXJ A;  4AQ2 A;  4JQR A;  2JDN A;  3VBH A;  1ZZ8 A;  4JDM A;  1TMF 1;  2VCM A;  2X5I B;  2GMP A;  1GQG A;  2P6H A;  4C0H A;  2FBE A;  1PMI A;  2IWG B;  2XKP A;  4UW6 A;  1CAU A;  2WUH A;  3HNY M;  5FZH A;  4A42 A;  1LEC A;  3WW3 A;  1BMV 1;  1Q43 A;  2VH9 A;  2ZX4 A;  3FLP A;  5H9S A;  5FZ1 A;  1PO2 3;  3ZFF B;  3PUA A;  3ZFF A;  4B29 A;  5KC6 A;  4GUL A;  2CHH A;  2J1R A;  3KV9 A;  4Q4Y 1;  4RR3 A;  3V65 A;  4ASL A;  1YFX A;  3D3A A;  1YQ5 A;  1UZZ A;  2WO7 A;  1OH4 A;  4Z2W A;  5BNO B;  1R09 1;  2ZZQ A;  3PTR B;  3B94 A;  4XUR A;  1NQJ A;  4QM9 A;  4E9K A;  2VBP A;  2JB8 A;  3VDB A;  1GMM A;  5FQ0 A;  4IV3 C;  5KC5 A;  4DZG A;  5FPL A;  2VZS A;  3GCX A;  5IK7 A;  3C7E A;  5FYT A;  1AYN 3;  1TME 3;  5B2G B;  3B9C A;  3I2F A;  1CD3 G;  4UBH A;  2RMU 2;  1W6Q A;  2ATF A;  4GMP 0;  5FP3 A;  3O1V A;  4MX3 A;  2J22 A;  3EB7 A;  3IPV B;  4AK3 A;  3QCW A;  1OFS A;  2XBO 2;  3URF A;  4OHW A;  4LO4 B;  3WHT A;  4RHV 2;  1W06 A;  1W8F A;  3J8F 3;  1OLM A;  3LAG A;  3WNL A;  1QMJ A;  3OEB A;  4CXW A;  2UU8 A;  1KS4 A;  2JDH A;  4XVH A;  4FPK A;  4EJR A;  2YPD A;  1W05 A;  4KQ7 A;  3AP6 A;  4QXH A;  1DGL A;  2WNU B;  3DUI A;  2YDE A;  2ARB A;  1OQD A;  2OUJ A;  3JD7 1;  5JR2 A;  2HYK A;  4EE2 A;  2HLE A;  1R64 A;  1RUN A;  4IGQ A;  1V6M A;  3A21 A;  1XOY A;  4XPV A;  3PHM A;  2HWE 3;  3LA7 A;  3LD8 A;  1FPN 3;  1I5Z A;  3RRD A;  5FZ9 A;  1SG3 A;  3VBR B;  2R06 1;  2WZR 3;  3OOX A;  1W39 A;  2W46 A;  1H4G A;  2D97 A;  3CJI A;  1POQ A;  3O1U A;  3PUH A;  5IAT A;  4DXT A;  2QBX A;  2GC1 A;  3VHR A;  3ZFE B;  4Y5S A;  5LRS A;  1MZF A;  2P3I A;  3H9A A;  3MEP A;  3OEA A;  2XPJ A;  1OHF A;  2JJ6 A;  2VMI A;  1GZW B;  1ASJ 2;  4CDW B;  5C9A B;  1ZBE 2;  2E31 A;  1WLW A;  3BB6 A;  3MI8 A;  3WP5 A;  2YZ4 A;  4KWJ A;  4UWD A;  1COV 1;  3I2G A;  4J25 A;  1MS1 A;  1XSR A;  3INA A;  1HB1 A;  3H1Y A;  3JB8 A;  3PVN A;  1REF A;  1XE0 A;  1V6K A;  2R04 3;  3UK9 A;  2OT7 A;  1AL2 1;  1W8T A;  1JYN A;  2X8K A;  2R1B A;  1F4A A;  4LO8 A;  3CJI C;  1BYH A;  1VAV A;  3WQ7 A;  2IXI A;  2BNM A;  1L7L A;  2JG9 C;  1UX6 A;  5DDJ 2;  4FFF A;  4IES A;  2QDR A;  4A41 A;  2YU1 A;  1VBA 2;  4LT5 A;  2E33 A;  1FAY A;  1QQP 2;  4AR2 A;  3OY8 A;  3N36 A;  3LDK A;  1R1A 1;  4HFS A;  4PF5 A;  5A6Z A;  1DYO A;  2Y0I A;  4XET A;  1Y43 B;  4URT A;  3FJS A;  4OUM A;  4LHN A;  2JDZ A;  5FYS A;  1AR8 1;  5IVY A;  4RQP C;  3ZVX A;  4QKD A;  1OUX A;  4AXO A;  4N53 B;  4LBJ A;  5FY5 A;  5DG1 A;  2DCZ A;  2WJS A;  4CCD A;  1PGW 1;  3CL1 A;  5JDB A;  2UWA A;  2XH6 A;  2J42 A;  2DU1 A;  3UET A;  3A4U A;  4XMI A;  3IT8 A;  1KQR A;  4XFC A;  1ENR A;  3WQ0 A;  3OUI A;  5FXZ A;  1WCQ A;  2BQP A;  3DXT A;  3H1W A;  3ECQ A;  5K0U A;  4GIQ A;  1NXM A;  1PO1 2;  2ARC A;  1F5J A;  5HCH A;  1RUI 3;  4GWN A;  4L8Q A;  3MUY 1;  3AJZ A;  4PLM A;  5DAQ A;  3RVH A;  1NE4 A;  2W2I A;  4AYU A;  2W1S A;  5F2W A;  5FZ6 A;  3MIF A;  2B4K A;  1V9U 3;  1LR5 A;  1QXJ A;  1XYO A;  4Q4W 2;  1RUG 2;  2LW8 A;  4YNI A;  3UKN A;  2PHX A;  3BOP A;  3HD8 B;  1GKB A;  4HZF A;  2Y6L A;  4UFI A;  4CDW C;  3BAL A;  1IG0 A;  4WZF A;  2RS1 1;  1OVS A;  4XJU A;  1CES A;  1QNY A;  1JYX A;  1EPW A;  2QQV A;  4AVV A;  4DPN A;  5EP9 A;  3WG3 A;  1UIK A;  1VPH A;  1NLR A;  2AEZ A;  4QGL A;  2Y60 A;  3WY6 A;  3B5L B;  3PJY A;  3SCH A;  5I0D A;  3SEE A;  4NR1 A;  5F32 A;  4NPL A;  2RS3 1;  2BZD A;  4IEW A;  4GB3 3;  1DQ4 A;  2GND A;  1D4M 2;  1LTE A;  1NKG A;  4QPW A;  1JH5 A;  2Q5T A;  4YVS B;  2IUW A;  5BPX A;  1B35 B;  3ZKY A;  1HV1 A;  2RS5 3;  1WLT A;  4JVA A;  5FCC A;  2DTW A;  4A3Z A;  2W5F A;  1AL2 2;  4EN6 B;  1GOG A;  1NY7 1;  2HWE 2;  3NMB A;  4LXL A;  4P00 B;  4YRD A;  1AR7 3;  1HN1 A;  4YWA A;  1ASJ 1;  2J1A A;  4LE3 A;  2VZ3 A;  4Q8L A;  2Y6F A;  1S4C A;  1UD1 A;  4YGD A;  1T6G C;  3USS A;  4RS5 B;  4RGG A;  1FX5 A;  4H7L A;  1W04 A;  5DMY A;  4AQT A;  2ZBJ A;  4RSU A;  1W0P A;  1IS5 A;  1GYK A;  1XNA A;  3DN7 A;  4LBL A;  3RDI A;  2A6W A;  2WNV B;  3AXE A;  1WW5 A;  2VZ1 A;  1HRV 3;  4KMQ A;  5FY4 A;  3QD6 A;  2J1U A;  4LBQ A;  4PCR A;  4PLO A;  4OI1 A;  5C3R A;  1PK6 C;  1VB4 A;  3KT4 A;  4LEJ A;  3I3M A;  4Q4V 2;  3VGI A;  3O1T A;  2ZOE B;  2E51 A;  4XFB A;  5I0R A;  2W1U A;  2C26 A;  3WVJ A;  1R1Z A;  1HN0 A;  4XUP A;  3L2Y A;  1PMH X;  5DZF A;  5BV6 A;  2NP0 A;  3HQR A;  1ZYB A;  5FJK A;  5FMO L;  3VBS C;  1X9T A;  3LEG A;  3M4F A;  4XCA A;  3VDC A;  2D44 A;  3K4Z A;  4FCA A;  1KEX A;  1UN1 A;  2DCJ A;  2IXK A;  3VBU B;  4XAB A;  2G1M A;  1PO2 1;  4CDQ C;  2P17 A;  3TN9 2;  2ZXQ A;  2ZX3 A;  3V0B A;  1H2M A;  1W8U A;  4YVW A;  3KF5 A;  5A6X A;  3MV1 1;  5DAX A;  4OI4 A;  4LO5 B;  4F7Z A;  5JZG B;  3NNG A;  1PK6 A;  2YB7 A;  3P6B A;  1L7R A;  1COV 2;  1RUO A;  3GYD A;  5DDJ 3;  1UKG A;  3GBW A;  3WX5 A;  2ETE A;  1C3H A;  1ZZ6 A;  1OUR A;  1S0F A;  1W3V A;  3FLT A;  3NNM A;  2WS9 1;  1TME 1;  4IV1 C;  3LOB A;  1HXS 1;  4CCL A;  3ZXK A;  2ZHN A;  1XE8 A;  3R4U A;  4KL1 A;  5FLH A;  3NAP A;  1PGL 2;  1WA6 X;  3SKV A;  2ZGK A;  2UYB A;  4TWT A;  3J8F 1;  3MIC A;  2RE9 A;  1REE A;  1H9P A;  1AYM 1;  2DU0 A;  1JOB A;  4IEP A;  4NMI A;  4OUE A;  2GC0 A;  5CNA A;  3VHN A;  5C71 A;  4HG6 B;  3NNF A;  5LZ6 A;  4YW4 A;  3LEM A;  2QQJ A;  2DCT A;  4JDO A;  3RZJ A;  4QB2 A;  1C8M 2;  2EXI A;  2C24 A;  4COW A;  2Q1F A;  3ZN4 A;  3TEW A;  5C3O A;  4NJ4 A;  1LAJ A;  1D2Q A;  1RUF 2;  1OI6 A;  1UW8 A;  1YI7 A;  3P5B A;  3B7M A;  5FPZ A;  4R4Z A;  1A8D A;  1ODM A;  4LUM A;  3ZSM A;  3WG1 A;  4QDR A;  4ZS3 A;  5BUV A;  1ULP A;  3VZJ A;  4EWA A;  4ZZ5 A;  1O91 A;  2IZW A;  3ZSL A;  5FYZ A;  1LKN A;  4Z82 A;  5JZG A;  2WZR 1;  1SCS A;  3RZL A;  4UW4 A;  1HQN A;  1SLA A;  3LF7 A;  3POF A;  3CF6 E;  2W08 A;  1GP4 A;  3VBS B;  2VW1 A;  2XQR A;  3WNP A;  4GH4 B;  2RDS A;  3ZFF C;  4JV4 A;  3KD4 A;  2P4E A;  5BNP A;  2XHN A;  2XL7 A;  3HBZ A;  1JU3 A;  1LU2 A;  3LEK A;  4G3Y C;  1UY4 A;  2B46 X;  4Q4X 2;  4NII A;  3BU0 A;  2VTF A;  2WFP A;  5GKA C;  1X36 A;  3N7L A;  3TNQ A;  1LOG A;  3LIH A;  4NPR A;  1RUG 1;  3AKS A;  4FBF A;  4ZY9 A;  2R04 1;  3LPF A;  5FZO A;  1AL2 3;  2WQ4 A;  4AVC A;  1ULE A;  2BV4 A;  5A7W B;  2WNV A;  3KMH A;  4AED C;  2RM2 1;  3RMX A;  1HXS 2;  4YW3 A;  1PO1 1;  3AM2 A;  4ZU5 A;  1S55 A;  3FWE A;  3U1X A;  1RUJ 2;  3RYR A;  2PHF A;  1HLC A;  3W59 A;  1KD7 A;  1AHS A;  4YW5 A;  2W52 A;  4HKW A;  5LEK A;  4D94 A;  1BCX A;  1NCR C;  3LA3 A;  5CU1 A;  2VE1 A;  3VHO A;  3LZZ A;  3DXU A;  1KFX L;  5JXH A;  4UFH A;  4AWD A;  3LA2 A;  1NY7 2;  4NAO A;  2IXL A;  1VMH A;  4RFR B;  1X8E A;  1WW4 A;  2D5F A;  3ZFG B;  2KA3 A;  1WD3 A;  2XKO A;  3V0A A;  1D4M 1;  2LTN A;  2UWC A;  4YGC A;  2VQA A;  2BGP A;  4M3C B;  3H8X A;  3VZL A;  2ET1 A;  2XVL A;  3I3E A;  4QXB A;  4ZS2 A;  1RMU 1;  2E7T A;  3LDB A;  4PIX A;  4RHV 3;  3CO2 A;  3RI9 A;  3NV4 A;  4AFA A;  3ABZ A;  1BVV A;  3DF0 A;  3ZYP A;  2XG3 A;  2WA4 A;  2W92 A;  4CDX B;  1JW6 A;  1K5J A;  3ZFG A;  1ULG A;  4LK6 A;  2RS5 2;  3U4S A;  3ES1 A;  2B9V A;  3VD5 A;  5G05 L;  2FQP A;  2PAK A;  3BPS A;  1O7F A;  2BNN A;  2RS1 3;  1TZO A;  3HPN A;  1HX6 A;  4R9A A;  3ZSJ A;  4D6Q A;  1LU1 A;  2JEM A;  3CQO A;  1FV3 A;  1H6X A;  2UWB A;  3PMS A;  1CJD A;  3APB A;  2G4I A;  4A7Z A;  1LOB A;  2H0B A;  2BEO A;  5FY7 A;  2RS3 3;  3S6P A;  1F8V A;  2YC0 A;  5GAL A;  4GB3 1;  3LPG A;  5FPV A;  4AI8 A;  1AYM 2;  2JG9 A;  4CP9 A;  2VZV A;  3ACG A;  2ARA A;  2ZGT A;  4LMF A;  1ND3 C;  2CGO A;  2ZMK A;  4FOQ A;  3NKG A;  3ZFG C;  3TN9 3;  4PQQ A;  4GKX A;  4AG4 A;  1ZBA 3;  1AR7 1;  1FMD 2;  3EQE A;  1EAH 3;  2H0V A;  3K3O A;  5FOJ B;  4FPL A;  2PAM A;  4YG0 A;  3CNA A;  3OY8 B;  5C6C A;  2A6X A;  5C8W A;  5IVF A;  3IDE A;  1CIW A;  5ANN A;  1BHG A;  4Z8B A;  3UGG A;  4J1W A;  1QJU 2;  3WNO A;  2P2K A;  4IL7 A;  5FXV A;  2E53 A;  4EV0 A;  3O14 A;  2GU9 A;  1FAT A;  2XUE A;  3IDA A;  1O5U A;  1NQD A;  5K0U C;  4PF1 A;  2BOJ A;  4P14 A;  3MLK A;  5FBJ A;  5IVB A;  2EIB A;  5T5J A;  1A78 A;  1J58 A;  1GFF 2;  3A0N A;  3AXD A;  1ZBE 3;  2XGX A;  2A73 B;  2WDB A;  4KI5 M;  2YMZ A;  2OS2 A;  1G9C A;  4MUV A;  1H6Y A;  4H3W A;  4MXV A;  4XJZ A;  4DOU A;  1QJZ A;  2DUR A;  2XUM A;  2GNM A;  1G9A A;  3JU9 A;  1LED A;  4NIG A;  3AYD A;  1DDL A;  5LAT A;  2WAA A;  3X29 B;  2Q4S A;  2RJK A;  3C7H A;  1LGN A;  1AZD A;  2BP6 A;  2JDU A;  4CUA A;  4Q0S A;  4JGY C;  4OHX A;  4ASK A;  3V64 A;  2HWB 3;  1OOP A;  1JZ4 A;  3ACF A;  3Q8B A;  5DAV A;  4IXL A;  4MHU A;  1PZ9 A;  1YUD A;  3R4D B;  5FWJ A;  3K51 A;  5EHD A;  2ZA9 A;  2R06 2;  5HCA A;  1GBG A;  2VMD A;  1OF3 A;  1I5P A;  1SLC A;  3N9N A;  4L2N A;  4P08 A;  1ZZ7 A;  1RL3 A;  1MR5 A;  3SMH A;  4BIS A;  4W4Z A;  1VIW B;  1YJK A;  1FNZ A;  2W47 A;  5DDJ 1;  3KCY A;  2VQ0 A;  3ZSK A;  4KU8 A;  1HXS 3;  4W8J A;  2PA7 A;  3IAP A;  3PIJ A;  3VUO A;  1IKQ A;  1D7P M;  5DUV A;  3S7I A;  5CKN A;  3VD9 A;  4TN7 A;  4PJY A;  3R05 A;  5L36 A;  2GNT A;  4COY A;  3DYO A;  1S1A A; 
#chains in the Genus database with same CATH homology
 3OPW A;  2Q8C A;  3KVA A;  5FY9 A;  3N9Q A;  4D6R A;  2OT7 A;  3KV6 A;  3AVR A;  4GD4 A;  4LIT A;  2Q8D A;  4AI9 A;  4CUG A;  4GJY A;  5A3P A;  4LIV A;  4QXB A;  3KV5 A;  3LDB A;  4IGP A;  3AL6 A;  2VD7 A;  5F5A A;  2YU1 A;  5F3E A;  2XML A;  5ANQ A;  5FP8 A;  5A80 A;  3U4S A;  5FXW A;  4QXC A;  5FZE A;  2GP3 A;  3KVB A;  4DIQ A;  4UF0 A;  4CCL A;  4EZH A;  4GJZ A;  5FZI A;  4CCJ A;  5FYS A;  4D6Q A;  4Y33 A;  5IVY A;  5FV3 A;  4BXF A;  5FZK A;  5FY5 A;  3N9O A;  2XXZ A;  5FPU A;  5A1F A;  5ISL A;  5A3N A;  3PU3 A;  2OX0 A;  3PUQ A;  5FZL A;  5FZC A;  3AVS A;  5F2S A;  5F5C A;  5FP7 A;  5FY7 A;  4HON A;  4EZ4 A;  5FPV A;  5FXZ A;  5A7S A;  3DXT A;  5FZH A;  5CEH A;  2YU2 A;  5FZ1 A;  1VRB A;  5FYH A;  3PUA A;  5FYI A;  5F37 A;  3KV4 A;  3KV9 A;  3RVH A;  2W2I A;  5FYY A;  5A3W A;  3K2O A;  5F2W A;  5FUP A;  5FZ6 A;  5FZ0 A;  5FP9 A;  3K3O A;  5LY2 A;  5LY1 A;  3PTR B;  4CCM A;  5FYV A;  5A3T A;  3AL5 A;  3PDQ A;  5IVF A;  4V2W A;  5FZ7 A;  3N9M A;  3N9P A;  5FZ3 A;  5FWE A;  5FPL A;  5FYZ A;  3OPT A;  3NJY A;  5FYT A;  2GP5 A;  5FZG A;  4E4H A;  5FXV A;  5FZF A;  2XUE A;  5FP3 A;  3PUS A;  5F3G A;  5FYC A;  4BU2 A;  5FY1 A;  4Y3O A;  5IWF A;  5FBJ A;  5FYM A;  5A7P A;  3ZLI A;  2XDV A;  4QX8 A;  5F32 A;  5IVB A;  5FZ8 A;  4CCK A;  5FZM A;  5IVJ A;  2OS2 A;  3PUR A;  2YPD A;  5A7N A;  5FZB A;  5F5I A;  5A7Q A;  5FJH A;  4QX7 A;  4QXH A;  5FP4 A;  2WWU A;  5FUN A;  3U78 A;  4LXL A;  4EYU A;  5IVC A;  2YBS A;  2Q8E A;  4DO0 A;  2YBK A;  4NUB A;  4C8D A;  3UYJ A;  3ZPO A;  2YBP A;  4IGQ A;  5FZO A;  4ASK A;  4GAZ A;  3PU8 A;  4Y4R A;  5FY0 A;  5A7W B;  5IVE A;  5LWB A;  3LD8 A;  4QWN A;  5KR7 A;  5FZ9 A;  5IVV A;  5FZ4 A;  5A7O A;  4CCN A;  4D6S A;  5FWJ A;  4XDO A;  2OQ6 A;  5FZA A;  5FZD A;  3N9N A;  3K3N A;  2WWJ A;  5IW0 A;  5F39 A;  5A1L A;  5K4L A;  5FY8 A;  4BIS A;  4URA A;  4LIU A;  5E6H A;  5FPB A;  4IGO A;  5FY4 A;  5A7W A;  4XDP A;  4V2V A;  4HOO A;  5FZO B;  3N9L A;  3DXU A;  5FYB A;  4UF0 B;  2P5B A;  5FPA A;  2OQ7 A;  5FXX A;  4CSW A;  2PXJ A;  4TN7 A;  5FYU A;  4QU1 A;  4AAP A;  4CCO A;  5LW9 A;  5FJK A;  5F3C A;  5F3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...