4I3PA

1.96 angstrom x-ray crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase bound with 3-aminosalicylic acid from cupriavidus metallidurans
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
174
structure length
174
Chain Sequence
MLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFFYQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQLKSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-hydroxyanthranilate 3,4-dioxygenase
publication title 1.96 angstrom x-ray crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase bound with 3-aminosalicylic acid from cupraavidus metallidurans
rcsb
source organism Cupriavidus metallidurans
molecule tags Oxioreductase/substrate
total genus 39
structure length 174
sequence length 174
ec nomenclature ec 1.13.11.6: 3-hydroxyanthranilate 3,4-dioxygenase.
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06052 3-HAO 3-hydroxyanthranilic acid dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i3pA01
3WW4A 1XRUA 2FMYA 1UIJA 1UIKA 1X8EA 2XL7A 3IIAA 5KHGA 2GC0A 3FFQA 3PNAA 2IXIA 1Q3EA 4DINB 1ZRDA 2FQPA 1YLLA 2UYBA 4MGYE 3ETQA 4LUMA 2PQQA 3FX3A 3S0MA 4I2OA 5KHJA 1J3PA 2PAEA 3NW4A 3BALA 3UKNA 4QMAA 5I93A 3NKTA 4UBHA 1SQ4A 3CL1A 3HT1A 2XLGA 3FWEA 1RUOA 3KMHA 1QXJA 4X6QB 4HSJA 5BXXA 1CAWA 1G6NA 5C6CA 3GBFA 1Q43A 4BIFA 4O9GA 4MUVA 4TLFA 5FQ0A 2H6BA 1DGRA 3E6BA 1J3QA 4IEOA 5JSRA 2IXCA 4HVOA 1X82A 2DCTA 4R52A 3NJZA 2ETEA 3GYDA 3KGLA 5I8YA 1EYBA 1DZRA 5KHHA 1O7FA 5FPZA 3E5QA 3SCHA 2IXKA 2PA7A 3H9AA 3NVCA 5J3UA 4LUKA 4Z82A 4Q0UA 3EHKA 4Q0PA 2Y0OA 2O8QA 3ACLA 3B02A 2PAKA 3CO2A 5LRSA 4IEPA 4EWAA 4HBNA 5K8SA 2OA2A 3CLPA 5JAXA 1ZZ8A 3CEWA 1UPIA 4HN0A 5KHIA 3LA3A 1YUDA 5AVPA 5KHKA 1ZRRA 3O14A 1J59A 2IC1A 4BYYA 4JTOA 4LULA 4XFAA 5JSPA 3EJKA 3USSA 5JSOA 5FQ0B 1SFNA 3VHRA 1ZX5A 3QOPA 4AQ6A 2UY9A 3H1WA 4YYOA 1V70A 4KU8A 3WW3A 1H1MA 1NYWA 1WA4A 2D93A 1I6XA 1NE4A 3OD0A 2GH2A 4YARA 5FDBA 2C0ZA 2XLFA 4NVPA 5T3NA 1XE7A 1ZZ6A 4IEZA 4E2SA 2ET7A 4XF0A 2BYVE 3LA2A 4XF3A 3CF6E 4QM9A 4IEYA 2WC2A 2WFPA 1RC6A 3RPQA 3M3IA 1VJ2A 1DGWA 3H50A 4B29A 3LA7A 1IPJA 3TNPB 2XKOA 3H8UA 5I8SA 3MYXA 1O3QA 3LAGA 4HVQA 3DKWA 3QACA 4OLLA 1ZZ7A 2OYZA 2PFWA 3RDIA 4EWEA 1J1LA 2XL9A 4JVAA 2XGXA 3ES4A 4I02A 4P9GA 4BH9A 5BPXA 3S7EA 4QM8A 2KXLA 3N4MA 3M70A 3DN7A 4FAHA 4E2GA 3LZZA 3SHRA 1DZTA 4KL1A 1VR3A 4K8FA 3S7IA 1Q5OA 3FHIB 4Q0SA 5D1IA 2GC3A 4Z07A 2BGCA 5CU1A 1U12A 3MDPA 5I0UA 4AXOA 3U0ZA 1OD5A 1IPKA 4XFCA 2GC2A 4QX5A 3ELNA 1X7NA 3ES1A 3I54A 4J1WA 1J3RA 4LA2A 1GQHA 2MPFA 2IXLA 3C3VA 4LTAA 2D40A 1CAUA 5FPXA 3IBMA 1O5LA 3RYKA 4KWLA 4XFBA 1RUNA 3I59B 2K0GA 3NL1A 2MNGA 4MX3A 2PTMA 4YNIA 2B5HA 1WLTA 3RYPA 3E6CC 4LEJA 4KU7A 1WGPA 4ORFA 3SCGA 4UBGA 5I8TA 4MGIE 4Q29A 4IEQA 1HW5A 4LLOA 1RL3A 2QNKA 3LWCA 4XEZA 4EWDA 1YFYA 5CADA 3H1MA 2E9QA 3EQEA 4JV4A 4META 3LOIA 1O5UA 2IXJA 1O4TA 4A2UA 4WVZA 4ONUA 4Q0QA 1YFXA 5JCTA 1LRHA 4QGMA 3BU7A 3UKTA 2BEOA 1L3JA 4MGKE 1CAUB 1ZNPA 1TQ5A 3KSCA 4AVAA 1CAWB 4FBFA 1CAXA 5FLHA 3OGJA 4I09A 4AVBA 3IDCB 4PIZA 4XFHA 4N9HA 5JR7B 4XF4A 2EAAA 4O9EA 5J7MA 1ZZ9A 3FJSA 4QGNA 3WW1A 1X8MA 1O3RA 3HQXA 4H7LA 1Y9QA 2H0VA 1XE8A 5E16A 4FAGA 2Z2SB 4L11A 3OTFA 4ZU5A 3EO6A 5FLJA 1NZCA 4UXAA 1ZREA 3KGZA 1J58A 1YFUA 2VPVA 3D0JA 3IWZA 5C8WA 1UCXA 2B8MA 2O1QA 2Q30A 2BNOA 4XFIA 1CX4A 1CAXB 5I91A 2GZWA 4IEUA 3FE5A 4PIXA 4D7TA 4IERA 4XF9A 5I0SA 1LR5A 4HLTA 2I45A 2PAMA 3E97A 4MV2A 3U10A 3DV8A 1FI2A 4AQ2A 4MZUA 3IDBB 3TNQA 2D5HA 2B9UA 2Z69A 3SMHA 3ZDSA 2VECA 2CV6A 2HKXA 3R6SA 3SCFA 2Q0AA 2GU9A 1RGSA 4PIYA 4AVCA 4XETA 1FT9A 1EPZA 5KBFA 4IEVA 2OPKA 4ZU7A 2ZKLA 1YFWA 4YRDA 3H1YA 5BV6A 3MPBA 2ET1A 4X6RB 2CAVA 1VP6A 1QY4A 4QGLA 4RD7A 1EP0A 3BCWA 1ZZCA 3E5UA 5BUVA 3E6DA 3I7DA 5I0RA 3SXWA 1PMIA 2OZJA 2UY8A 3HT2A 1NE6A 1SEFA 3ROUA 2PHDA 2EA7A 1LKNA 1YWKA 5CVRA 3HIFA 3D0SA 4J1XA 2V09A 5F1RA 2Q1ZB 4MGZE 3BB6A 4HMZA 3H7YA 2XLAA 4EROA 5EFUA 1Y3TA 2XKPA 2Q4SA 1ZZBA 4I3PA 4IESA 3PLQA 1GQGA 3L2HA 4IEXA 4HVRA 2CAUA 1ZRCA 2K9ZA 2GAUA 4YSFA 4HSLA 4KWKA 5FLIA 1O3SA 2ATFA 4WZCA 1ZVFA 2D5FA 1CGPA 4Q0VA 4FT8A 2CGPA 5LRRA 1NXMA 5E1RA 1PM7A 3WW2A 4OFGA 1CAVA 5I0TA 1QXRA 2PYTA 3FZ3A 2XHKA 4E2QA 3EBRA 2IXHA 2ZCWA 5FCCA 2H6CA 1OFNA 3MZHA 2HJIA 4R8HA 2PHLA 1RTVA 2QDRA 3RYRA 4CYDA 3D82A 2QCSB 5LEKA 3UKVA 3OF1A 4D7SA 1LB2A 4XF1A 4ZU4A 2N7GA 3CJXA 4WBBA 3H3UA 2OZ6A 2MHFA 3ST7A 1O3TA 4I0AA 1YHFA 1OMIA 4QXKA 1EY2A 1UD1A 3OCPA 4XFGA 4I01A 4LA3A 2EVXA 1JUHA 4HZFA 4PJYA 2P17A 1I5ZA 5HI0A 3DL3A 3PVBB 5LEJA 1CAVB 3NSTA 3E5XA 5J48A 3RNSA 4N9IA 4IEWA 3KCCA 2QVSB 4F7ZA 4MH0E 4L2NA 4F8AA 2F4PA 3H7JA 1FXZA 4KWJA 2BNMA 4XFFA 4HN1A 5BY5A 1QWRA 2GC1A 5EZWA 3BPZA 2QJVA 3G7DA 4BHPA 3U11A 1UW8A 3JZVA 1H1IA 2BNNA 4I0BA 4GULA 3RZZA 3I59A 2UYAA 4EV0A 4IETA 3H3ZA 1OI6A 2VQAA 4JTNA 1ZRFA
chains in the Genus database with same CATH superfamily
1RIRA 3CJIA 3T4HB 1UIJA 2VMGA 3IIAA 2GC0A 1VBE3 3PUQA 5F5CA 3GHMA 4FP3A 4GXLA 5A6QA 2IXIA 2P3KA 4DINB 1IGOA 4WM7B 5FBZA 1Q8VA 5G05L 2WNVC 5FXZA 4EN6B 2HLEA 2F6BA 3USUA 5A1AA 2A6XA 2D44A 4CDQA 3OPTA 4IV3C 2GMMA 4RGGA 5G04L 2Q8CA 3ETQA 2YB7A 3WCRA 1JU4A 2PQQA 1GBGA 3IIIA 2ARXA 4Q4X2 5FYIA 1AR62 2R16A 1J3PA 2PAEA 3NW4A 4NIGA 2BBVA 1KITA 3DPRC 1OURA 2BTVC 4PDWC 4WM7C 2WNUB 5DQ0A 4SLIA 1QJY1 4BCUA 5CAZA 4UBHA 1X9PA 3WR0A 1O91A 2RS33 5B4NA 3FWEA 1A8MA 1GSLA 1QU0A 1WCKA 3ME2A 5EQUA 3ZKUA 1LOAA 5FRAA 3KMHA 3IMNA 3ZMOA 5KXCA 3VKNA 1UWWA 3WD5A 3ZLIA 5A3PA 4HSJA 1RUD1 5FUNA 1LODA 1OVPA 5BXXA 1VBB3 1G9BA 4CCCA 3DGTA 5E88A 3NKGA 1C5IA 1LNSA 5C6CA 1H2NA 4OUMA 4EN8B 4CEWC 2XOMA 1B09A 3P3PA 3T09A 1VALA 4RR3B 4BIFA 1RXGA 1TME1 1POV0 1DGRA 2D3RA 2H6BA 2Z79A 3IPVB 5FIXA 3ZFEB 4AFCA 3E6BA 4CA9A 3CJIB 2IXCA 4HVOA 3VKMA 3BUCA 2G19A 2RHPA 1GZWB 2VD7A 4AQTA 1M06G 4GD4A 1AR82 2WZR2 3NJZA 4W50A 4BK4A 4Z92B 1LESA 2FDGA 1DZRA 5FUIA 4RR3C 3USUB 1OA2A 3ZIXA 2MEV3 2J1UA 2EXJA 2DUPA 5FPZA 4AFBA 3SCHA 3HN1A 5LA0A 1A3KA 2XJVA 4PF5A 3CJIC 2CY6A 3T3YA 4H14A 3B02A 4JZRA 5E89A 1U5IA 3CO2A 4JX0A 3I97A 3IDEA 4IEPA 3T1MA 3UETA 4EWAA 4OHYA 3J9SA 3FLTA 2GNMA 2JENA 3KT7A 1UU5A 4XTMA 4CDQC 4W6YA 1KGYA 5FPLA 3KB5A 2RDNA 2V4AA 1UPIA 3CEWA 4HN0A 2VNOA 4NMIA 4XE9A 4AW7A 1PO12 4RSUA 1O4ZA 1PX3A 1J59A 4XILA 1ZA7A 2X10A 4YVWC 4D6RA 4JTOA 3AZZA 4LULA 1NKGA 2ZTNA 2G9FA 3EJKA 2JXAA 4PLOA 5J1XA 1SLIA 2ZGQA 1B35B 3OJBA 5JSOA 3ALQA 1BEV3 2NM1A 4M0NA 3QOPA 1BCXA 5JIUA 1SBEA 1V70A 3CNAA 1AYN3 3UT0A 1JI6A 3WNOA 5F3IA 2B9VA 5HBAA 3VBFB 1W2UA 1DBNA 3GBWA 5F8PA 3B9CA 3TB0A 5GZDA 3BOPA 3AKTA 2RR11 2VUAA 3FLRA 1H6XA 2VAUA 4E2SA 2ET7A 3GJBA 3MV11 5GZCA 1W0PA 3LB9A 1QKQA 4RGKA 1UAIA 1RUJ1 5FAXA 3OY8A 1JYIA 4QDSA 2SBAA 1V9U1 3A0KA 2WFPA 3RPQA 1H8VA 3M3IA 4FQ4A 1DHKB 4XABA 5GZFA 3H50A 4E4HA 4GAZA 1RUI1 5E8AA 1YI9A 2XVLA 3TEWA 3MLLA 3RQ0A 2DWRA 5JZGA 4XCBA 1VRH1 2BVVA 3UL2A 3H8UA 1QJY2 2C6SA 2VCCA 3KF3A 3MYXA 2ORXA 4AE2A 1VB4A 1MQTC 3QACA 1UY4A 3U75A 5H9PA 4AF9A 4D6SA 3CU7A 5AC93 2PFWA 3MGUA 3WNLA 3TN92 1UYPA 4FFGA 4JVAA 4ASLA 4CXYA 5KC5A 2JE7A 4D0QA 4NHXA 4BQWA 3W5NA 4BH9A 4UT5A 4Y3OA 5FXWA 2PMWB 4QU2A 2KXLA 2CTVA 5HXVA 1W6OA 1UPSA 3KM5A 1RUE2 4R4XA 2RM23 3HQRA 3N9NA 1JUIA 2KA3A 5FYBA 4AHXA 4UYBA 2QQJA 3W21A 2HWB3 1XNKA 4D3WA 2EIGA 4W65A 1Q5OA 2ZEZA 2BUKA 2VZRA 2ZEXA 3QH6A 4QKDA 5LBBA 1IPSA 3FMGA 4LHLA 2DCJA 2DBNA 1CN1A 3OY8B 4RHV2 4FCAA 4C8DA 1G9AA 1OD5A 3PURA 1W2NA 5FY1A 4YW4A 4IV1A 4DQAA 4OHVA 4IE6A 1GQPA 3ES1A 1ULOA 4M4PA 1OXCA 3OUHA 4CU7A 3BTZA 4CTEA 1J3RA 4JKLA 1RMU3 3AJZA 1AUYA 1GQHA 2W2IA 2IXLA 5JZGB 5K0UA 5JXIA 1UY3A 3NV3A 5FOBB 1R081 1OUSA 4B8EA 4UFJA 3WHTA 1GMMA 3I3EA 1JZ5A 1US2A 3AFKA 3OUJA 4K7JA 2ES3A 4XFBA 4DXRA 1U5ZA 5FZKA 4B7KA 3A23A 5JXGA 4CPBD 3AMHA 1WLTA 3RYPA 5FZ8A 1OQDA 5JZGC 1R093 4COZA 2ZS6B 4UBGA 2ZGLA 1W6OB 4MGIE 2EALA 5FO8B 4QDRA 2YY1A 1LGNA 3N7LA 4NHLA 2DUOA 4EWDA 1YFYA 3N9QA 4QX7A 4YFWA 3RMYA 4CUGA 3ON7A 2VULA 4META 3EQEA 3LOIA 2RS32 3ZN6A 2NN8A 1F4HA 1WD3A 1SG3A 1VAMA 3AKPA 2LUWA 3PUSA 1HRV1 4Y5TA 1JMUB 1O4TA 2JIGA 4EZHA 5IT6A 4FXKB 4A2UA 2RR12 4FPCA 5A3LA 1OLQA 1VBB2 2IVJA 2OT7A 2Y8KA 4ONUA 5A33A 4CU9A 1VPHA 4LBMA 4NHYA 4KWUA 1RXFA 2ZGMA 4Z8BA 4TXWA 1K45A 1RUJ2 3BU7A 1ODNA 2OQ7A 2BEOA 4FFIA 3I4IA 5T54A 4AFAA 1L3JA 1V9U2 2RM21 2XDVA 4MGKE 5LY2A 5K0UB 2ADDA 3HOBA 3KSCA 1CAWB 4NHKA 5LZ6A 4LITA 4TN7A 4XPVA 3DXTA 2FDHA 2VXRA 1W8NA 2HWB1 4I09A 5CBLA 3IDCB 4IV1C 4KG0A 1HB3A 4WM8A 2C5DA 1EUTA 4N9HA 1S0CA 5JR7B 1VMFA 5C9AA 2UWAA 3DECA 1OF4A 5K0UC 1KRIA 1RJ8A 1CIWA 2VTFA 2YPJA 4H3WA 1OUXA 3QLQA 3AZVA 2VMCA 1O3RA 1MS9A 3HQXA 4YG0A 5FP8A 4C90A 4OCTA 5FTTC 3U14A 1SHWB 1Y9QA 3V0AB 5LBFA 5IVJA 2EIBA 5E16A 3AX4A 3GXUA 4OHWA 1OKQA 2YGLA 3OTFA 2PELA 1CPMA 1YNAA 1NZCA 2JDPA 1LOFA 1AYM3 1FYUA 4K40A 5FWEA 2VR4A 4AI8A 3DEMA 3FLPA 4FPOB 1FAYA 4P00B 2FCTA 2XQRA 3AP5A 4JAAA 1OC1A 4NRMA 3MW4A 2KD7A 5ACA3 2WUHA 4FI9A 2RMU3 1MZ6A 2Z5WA 1GANA 3AYDA 3PL0A 2B8MA 1MR5A 1XNTA 4YW1A 2BNOA 1TG7A 1WMFA 2QDNA 4KI5M 1LOGA 4LOTA 4HG6B 4CPBA 1W39A 3T0BA 4IGQA 2DCKA 1AYN2 2JX9A 3GBGA 1CR7A 1YQ6A 2P34A 4IEUA 4YFZA 3FE5A 1LHVA 4ZS2A 4ZXEA 5L9BA 4IERA 3ZPOA 1WLCA 2DV9A 3O1MA 1JZ3A 1LR5A 4LHNA 3RJ2X 3VV1A 2PAMA 1RUG3 2JDAA 4Q5OA 5FZFA 2ILMA 2WT2A 1FI2A 2XHNA 1W6QA 3LD8A 4LBNA 4MZUA 3N36A 4OUEA 1CZSA 4ARXA 4XIKA 2B9UA 2Y6KA 2Z69A 5FWJA 2WFF1 3ZDSA 3N7MA 4WM8C 4AAPA 2VECA 2VNRA 5C9AC 2HKXA 2XJUA 3SCFA 3WF0A 4LKFA 3ZSKA 2GU9A 2VUCA 3OEBA 4ES9A 1LGCA 1RGSA 5FYSA 2GP5A 3ZYJB 4PIYA 1SPPA 4XETA 5FZGA 3ZO0B 4XUPA 1H2KA 2DVDA 5JMOA 3N3HA 1J1TA 5FJKA 3V64A 5AC92 4PQQA 4CCOA 2Q1FA 4KNCA 4NAOA 4C1XA 4AWDA 1VP6A 2L9LA 1FNYA 1LOFC 3VHNA 1AXZA 3MFCA 4QGLA 5F3GA 1GNZA 1ZZCA 1S4CA 2HWC1 3PIGA 4M3CB 2XQXA 3AZWA 3E6DA 1GLHA 4PLNA 5HV0A 5K4LA 3SXWA 3VBOB 2ZMLA 2W1QA 3FHAA 3IZOA 2LROA 1AYM1 2RM22 2VH9A 1LKNA 3VBHA 3AYAA 4QQ2A 3S5AA 1O59A 1GNHA 4XJ9A 2HWB2 1W6QB 3BOWA 3BB6A 3VBUA 3H7YA 2RMU1 5JWPA 5JUVA 3B69A 5EFUA 2ZEWA 3CIHA 2W91A 1DGRN 1ZRIA 4N8MA 4GB31 1QF3A 4TLGA 4DUXA 4H55A 4MYEA 1H8TA 2EXHA 2Q5TA 2ENRA 5IATA 2W1SA 4I3PA 4IESA 3MI8A 2YFZA 4FSJA 1DYOA 4BISA 1N3OA 2GMEA 2GAUA 2K9ZA 4HPKA 4CDXA 1ZBE3 4NIDA 3O0VA 1APNA 3U78A 3ZXGA 5FYTA 5IVCA 4WZCA 1ZVFA 5FO9B 4MGTA 3ZN4A 4M4RA 4N90A 4FOWA 1C57A 2C26A 1PGSA 5J37A 2GNTA 3NJXA 2VBBA 5E1RA 1PM7A 1LGBA 3WW2A 4CU6A 4OFGA 3ZYRA 1IS5A 1PHMA 4CUBA 5EHDA 3CZJA 3JU9A 4OI2A 5IYYA 3K2OA 1V6NA 4HFSA 1LHNA 4V2WA 4YLZA 3RFRA 4URTA 1JYNA 2TUNA 4AVVA 2HJIA 3VBHB 3T1LA 2PHLA 2W94A 3N9OA 2RDQA 2VVFA 3ACIA 3KWVA 3T0DA 2WR9A 3VBUB 3W58A 2HBUA 1LB2A 2G9ZA 5D2AA 1C4RA 1VBA1 1H8TB 2RV9A 3MHZA 1AR73 3EB7A 2UURA 3H3UA 2OZ6A 2MHFA 2UU8A 4MSVA 1QOSA 2VUDA 1KJRA 1Z0HA 2AENA 5A6XA 4XDPA 4D69A 1UX6A 4GH4A 3AMQA 1YHFA 4A3XA 4CDXB 2XBO3 3VBUC 1EY2A 3IKWA 1UD1A 4D7YA 5DAWA 1FX5A 4I01A 3F95A 2EVXA 3K77A 5BNPA 1H8TC 4XACA 2BOIA 2E7AA 1NLSA 1ND2B 1VRBA 1LOBA 1GP4A 3LEMA 4PJYA 2ARCA 1V6KA 5F39A 5A7PA 3SH5A 5JXJA 3TEYA 2C9AA 3UGHA 1PVC3 3EMRA 3K3NA 5T5LA 5HI0A 2VQUA 5FY8A 5LEJA 3NSTA 5FO7B 1XYOA 3OSDA 5IW0A 2JDKA 5FR3A 5A7NA 3HBKA 3MIGA 4LO4B 3RNSA 1NA1A 1QQP1 2R49A 4UFMA 4F7ZA 3J8F3 4QKBA 1NX9A 2K2SA 1W6NA 3GZUC 2WWUA 3H7JA 1ZBE1 1FXZA 2HWC2 2XWBB 4KWJA 4AEMA 2BNMA 2JE9A 4ITCA 4I3GA 2VG9A 4HN1A 2QZ2A 3INAA 5E6HA 1AX2A 4CUAA 5A3OA 2ZA9A 4PCRA 3HR9A 1AYM2 4XXAA 2QJVA 3WP4A 5JOYA 1C8NA 4HOOA 2GALA 3KD4A 5FZEA 3JZVA 3U11A 4P08A 5C4WC 1PX4A 5ACA2 2WT1A 4LO8A 4QPIA 4RQPA 2RMU2 3RZZA 1POV1 3I59A 3CZUA 4JTNA 4GH4B 4A6OA 1VE0A 4AHWA 3WW4A 2ZGRA 3VGIA 2R061 1VBC3 5F3EA 4R9DA 1UIKA 2HEVF 1X8EA 2XL7A 5KHGA 3FFQA 1IHMA 2JEMA 1BBT3 2XMLA 1ZRDA 2WYFA 1WCDJ 2X5IA 3RVHA 2VE1A 5FZAA 3OB8A 1QJZA 4X8PA 1OBNA 1K12A 4YPJA 1W8UA 4Q8LA 5DMYA 1RUC3 5F2WA 1RUG2 3FX3A 3SISA 1SMVA 4K1ZA 2LS6A 4I2OA 2ZEYA 5BNPC 5KHJA 2D97A 4Q4W3 3BALA 3LPGA 3ABZA 4QMAA 3RS6A 3WNMA 1DU3D 3ZKYA 3HAGA 5L7OB 1VIWB 1W6NB 1SQ4A 1V0AA 1ALYA 2DTYA 1UYYA 2YC0A 2EXKA 3AM2A 5KXEA 1RUOA 2YG0A 1QXJA 1MPXA 4IDZA 1HV1A 5IK5A 1ZA4A 2A70A 1KQRA 2P6HA 4KBZA 4W4ZA 1NA1C 5DDJ1 5FZLA 3T2OA 2A7AA 4QPIB 2XB6C 1E5RA 1TMF1 4W6XA 4TLFA 3Q9OA 3AMNA 2JICA 3LF7A 4UFIA 5FQ0A 4C0BA 3LFMA 2I2SA 1JYXA 3WNKA 2R071 4IEOA 3J8F1 4FOYA 1X82A 1SBFA 4AHYA 4R52A 1C8M1 1O8SA 3MO4A 3TAYA 5C3OA 3PU3A 2VMEA 3GYDA 3KGLA 4W8JA 4ARYA 4Q4V1 4QPIC 4RQPC 1LAJA 4IE4A 1IS3A 3U4XA 5L36A 2BDRA 5FZHA 4NN0A 4QU1A 1BLZA 3E5QA 2VOWA 4HL0A 1OQ1A 1YRZA 3NJYA 3THCA 2PA7A 2VTXJ 4LUKA 4EZ4A 2YMZA 2VCBA 3EHKA 3ACFA 2Y0OA 2O8QA 4Y1VA 4FVVA 1UMZA 5CIRA 1ASJ3 2VMFA 5KWRA 5LRSA 2X5IC 3J7NA 3LDKA 5IVEA 4BOWA 2JG9A 3PMEA 4OMDA 2YC2A 4Y20A 3CLPA 5D8AA 4A7KA 3VD4A 1VBC1 1AL0G 3VDBA 2YXSA 5HXMA 1QQP2 3I2JA 1G8WA 1BBT1 4YG3A 5LK7B 3LA3A 1IKQA 1S55A 1UZ0A 1ZBE2 3ZSEA 5CISA 4GIQA 1YYNA 4BYYA 1SLLA 4XFAA 5JSPA 4EN0A 1K5JA 1XYNA 4Q2FA 4D8MA 1AR81 2WZR1 5A70A 3EXUA 1UOGA 4XVHA 3JB8A 5FQ0B 5F6KA 1W05A 1BVP1 4IV3A 3D4KA 1ZX5A 3ZSLA 4AQ6A 1OFSA 2K46A 4Q4W1 3OUIA 4KU8A 3WW3A 3ZM8A 1IG3A 2HWF3 4KGQA 5H9SA 1WA4A 3Q8FA 3VZKA 3POBA 1WMXA 2FZ1A 3OD4A 5HCFA 1RVF3 1UL9A 3E1F1 1QJU1 3M3QA 4TTGA 2JG8B 3OD0A 2Q8DA 2GH2A 5D21A 1F4AA 1W9SA 5IVYA 4R9BA 5FDBA 1XE7A 2W08A 3SEEA 3I3DA 2BYVE 2ORZA 3PUAA 3LA2A 4BXFA 1AJKA 3CF6E 4ZONA 1RUF1 3UGFA 1HJFA 4JDNA 4IEYA 5FREA 1GOFA 5B2GB 1PO11 5FZ7A 4ATEA 2GN7A 4AVSA 4Y20B 5D8AB 1AR72 3VLBB 4HK8A 2VC9A 3FBMA 4O61A 3WG3A 2Y64A 1DZQA 1SLAA 1LULA 1EUUA 1JYWA 3C7OA 5I8SA 4IL7A 1MACA 4XYXA 2WAAA 3DKWA 4F83A 2FDKA 3QBQA 1W6MA 1ZZ7A 2BQPA 1PZ8A 2WNVB 4HKLA 2JG9C 2OYZA 4AZZA 3RDIA 3AVRA 1YQ2A 3ORJA 2XL9A 1NQDA 5FZ9A 2VZOA 3ES4A 4IV3B 2CGNA 2VZSA 4G4FA 1PO23 4H2AA 4A44A 1W3XA 5DDJ2 1UY1A 3S7EA 3VHOA 4QQPA 2VQTA 2W39A 5J98B 2VM9A 5EWSA 4AI3A 1SFPA 1LHOA 1TMF2 4PDWB 2E33A 3C8XA 3DPRB 3ASIA 3N9MA 2VNVA 3ZX7A 2YYOA 3KV9A 2BWCA 3MLKA 4CUCA 2R072 2WBKA 2W1WA 2VVDA 3J8F2 5IK4A 1JYVA 1J84A 4KL1A 3VN4A 1C8M2 3S7IA 4QXCA 3NV4A 2IUWA 2DCZA 2VNGA 4HONA 5D1IA 4Q4V2 2BGCA 1HRI3 3MDPA 4YVWA 4OI4A 3ZMNA 2PHXA 5C70A 2BERA 4CEWB 1IPKA 3HMYA 4QB1A 4HANA 2VXJA 4K8RB 5FZBA 1MS5A 3NV2A 3I54A 2YU2A 1R1ZA 2HWF1 3MIBA 3TBDA 3TN91 1RVF1 4LTAA 1HQWA 1XSQA 1C28A 5FY4A 5FPXA 4KGGA 3SITA 5LBEA 2VL4A 4BMBA 5M0TA 4FFFA 1O5LA 1VBC2 4L92A 1W6MB 4TZDA 2D6OX 1RUE1 2W68A 4QQHA 1BBT2 2P3YA 1CWPA 1BQPA 4AGGA 2PTMA 1DQ0A 2GP3A 3BN6A 2ZGOA 3I2FA 2P37A 4KMQA 5EIYB 2P3IA 3AXDA 4GWIA 4IE7A 1UN1A 5FYCA 4LEJA 4KU7A 3SCGA 3AVSA 1V6MA 1RUC2 4P9XA 4RGAA 4IEQA 2JECA 5FP4A 2QNKA 3N9PA 3IB3A 4MO3M 1UZWA 5DUVA 1DP0A 4NE9A 4RHV1 4CDQB 4Q4W2 4QKNA 1ZM1A 2D6PA 3H1MA 3VKFC 1EAH3 1ACCA 1K5MA 3ILRA 4DEVA 2JJ6A 2ZAAA 4UFLA 2FDIA 3TRSB 1HXS3 1KFUL 2O14A 1O5UA 5I0DA 1DQ1A 4CRQA 2ZACA 4P9YA 1QJU2 4GALA 4K6BA 2IXJA 1PVXA 4B1MA 4BIOA 4YVWB 1MQTA 1N47A 4XJZA 3CBNA 3HNBM 4N7IA 2D3SA 3T4VA 4WVZA 4Q0QA 1YFXA 1US3A 2BWAA 2DF7A 4DOUA 5JCTA 1ULGA 3GDBA 2HEYF 1VBE1 3ACGA 1RUF2 4JGZA 3UKTA 4UW4A 1Z7S3 2JDYA 2A73B 4QX3A 5FK8A 3ETPA 4XBNA 2GSYA 2BPA2 1TQ5A 3H8XA 1AL23 4XQWA 2ZABA 1CAXA 2WIIB 3Q8AA 4JGYC 3ZXAC 2WAOA 1W2OA 2BU9A 2TBVA 1Q8SA 3O1SA 2G4IA 2P1BA 3SKJE 2ZGTA 2OIIA 1HRI1 2LALA 5J7MA 3X29B 3WEZA 1E5SA 1DQ4A 2PN5A 4FP2A 3WW1A 3ZXFA 4CU8A 2Z4FA 5F7UA 4E8CA 2RS31 1G9CA 1STMA 1WMDA 3AXEA 1FV3A 4EE2A 2A6ZA 3OBTA 1ASJ2 1NZIA 2WT0A 1K5MB 3JBG3 1VBB1 3MIEA 4ZU5A 3ZYPA 1PK6A 4UXAA 2XJSA 2A75A 1ZREA 4K21A 1D2QA 3B00A 2FHRA 2JIJA 4BMEA 1WKYA 3RRDA 5JLVA 5DXDA 1MQTB 2E63A 2OS2A 2EICA 4NRPA 1GKBA 2WO1A 4JKKA 4COYA 2W87A 5JR2A 1C1LA 4ZZ8A 3V0BA 1JZ6A 1K5MC 3FHQA 3MF9A 3Q8CA 1XYPA 4JGZB 4XTPA 2QQUA 2AC1A 1C3HA 3CQOA 5C71A 3O1VA 3IM0A 3MIDA 4ZPIA 1CX4A 1RHI3 2WA4A 2MEV1 1CAXB 5ANNA 5KXDA 3RSJA 5I91A 2WZEA 5ABJA 1EAH1 2ZHNA 2HWF2 4GZ9A 3GHNA 3P6BA 5EV7A 3AL6A 2ZGNA 1RVF2 3WX5A 1KEXA 1FPN3 4JGZC 2E6VA 3ZYIB 3ZPYA 3D6EA 1H1AA 1FMD3 2ERFA 3KZ4C 3U10A 2W5FA 2VOKA 2VQ0A 4CP0A 4AFDA 4GWNA 3N7KA 3IDBB 3U07A 3DUIA 1W9YA 2D43A 3GCXA 2D5HA 2OPWA 3BGAA 4OI0A 3GNEA 3SMHA 4COWA 4HETA 2FDJA 5GM0A 1RINA 1BZWA 3OGSA 4Y1UA 5T52A 2CV6A 3S30A 1Y9MA 3R6SA 1DDLA 2J42A 4E4DX 4BLIA 1GYKA 4OQ8A 4NPMA 3DYPA 5A32A 3RZKA 3ZXJA 1O3SA 1FT9A 2WO2A 1BEV1 4LK7A 2OUHA 2ZPXA 1EPWA 1CESA 1YFWA 1ZYBA 4UAPA 4YRDA 1AYN1 2WA3A 3MW3A 4U2AA 4YZ3A 5A7WA 3MPBA 4XUTA 3S6PA 2VVEA 4YVSA 5DZFA 2CAVA 1PK6C 1OF3A 1AXYA 5F37A 3OBAA 4JKMA 5IUQA 3E5UA 1WLDA 3C7GA 5ABJB 3VDAA 4MADA 3I7DA 4XZPA 5I0RA 1N1SA 1VBE2 2I07B 4XUQA 2OZJA 3VB9A 4JRLA 5FPAA 3HT2A 1SEFA 3R0RA 2PXJA 3MFAA 3ROUA 3O1UA 2PHDA 4Q26A 3EYPA 1N1TA 4J1XA 3WF2A 4W6WA 5FOJB 5F1RA 2Q1ZB 2YUEA 2RS13 1W8WA 2CDOA 4Y4RA 2ZGUA 3HEIA 5DAXA 1A78A 4EROA 3AC0A 5EJZB 3WDXA 5ABJC 4CCJA 4NAMA 5IAXA 2YU1A 1ULFA 4QX0A 1HRI2 4MOAA 4QHBA 2E7QA 3VDDA 2VOVA 4L99A 1MZ5A 1PNGA 1NCQA 5EYXA 2QQLA 1GQGA 4IEXA 5A3WA 1JOPA 3KV4A 1LHUA 4HVRA 1S2BA 3AKQA 3GJAA 4XXPA 5AC91 2DVFA 5A32B 1WCQA 1KJLA 3D5OA 4BXSV 5F2SA 4YSFA 4HSLA 4KWKA 1FPN1 4IV1B 3AFGA 2JWPA 2IFWA 3HBZA 3T30A 5SV8A 2IFRA 2CSGA 3WDWA 4Q0VA 5FFOC 5A7WB 4BA6A 3M8LA 1DQ2A 1JW6A 1W6PA 4YVSB 5A7SA 1YI7A 4YZ5A 4KBBA 5A1FA 1NAEA 2ZXQA 3N35A 4B4RA 1OD3A 5CG9A 1CAVA 5FPBA 1QXRA 2VU9A 1ZBA3 1UKRA 3PU8A 2YROA 5FCCA 3O1RA 2ID4A 4QHOA 5J96B 4I30A 1QDOA 2A1XA 1QMJA 1PNFA 3OPZA 4Y1ZA 1OFNA 1X50A 1VBD3 2D6MA 5T55A 1GWMA 2QUOA 4LBOA 2MEV2 4YVSC 4BLJA 5C3RA 1EAH2 4RS5A 2QDRA 1N1VA 3WF3A 2QCSB 4BM8A 3UKVA 1UYZA 3OF1A 2OKXA 2RVAA 4CXWA 1JN2P 4BJ0A 1CIYA 2WRAA 3H8RA 1RMU1 4XF1A 4AEDA 1OA4A 1WD4A 2ZZQA 4FFHA 1GU3A 1JHNA 3VDDB 4N53A 1XC6A 1AR93 4LHKA 1XU2A 1JHJA 1KFXL 2A5ZA 1ND3A 3LFIA 3ZN6B 2DBIA 4K3UA 3OBRA 1MEC3 4I0AA 4UWDA 5LK5A 2VZ3A 1Z7S2 1E5HA 1WW5A 3OCPA 4P5HA 4PF1A 4WVWA 5FPUA 5A33B 1R091 4R9CA 3VDDC 1CX1A 2RS11 3LQCA 1NCQC 2JKBA 2DVGA 2YBKA 2P17A 4HZFA 1W8TA 5FKBA 1W6PB 1K3IA 2SLIA 3S5QA 3WQ7A 1BEV2 3KCYA 4JC1A 4JQRA 3J26N 4LNVA 1CAVB 5H9RA 2VCMA 3AB0A 1CPNA 5GLZA 3MPPG 3CMGA 3E5XA 4UF0A 2PHFA 3HJRA 4WM8B 3ZXDA 5JI7A 4QB2A 4CEYA 5C9AB 3LEIA 4MH0E 5A6ZA 1DQ5A 4XQ4A 2BOJA 4LIVA 3D8CA 1QJFA 2OXBA 3I2KA 1LU1A 3WG4A 3KF5A 1W90A 3JBG2 4RS5B 2QQVA 4F3JA 5C3QA 3DYMA 1PZ9A 1LENA 4I0WB 1SDWA 4XUNA 1TZOA 2NPIA 4A7ZA 1O8PA 4FOQA 2QQKA 4XC9A 5ANQA 4BHPA 3AZXA 2Y26A 5A7QA 1F2NA 5DAQA 4N53B 1HDKA 2DVAA 2J22A 4BQ3A 2XUMA 4YZ2A 1UNBA 5JDBA 4QPYA 1DIWA 1ND3B 4WVVA 2YC4A 2A71A 1OI6A 2E32A 4RS5C 5C3PA 2OQ6A 4HKWA 1XBFA 4BZ4A 3TEXA 1DF0A 2DVBA 4LE4A 2W95A 1HX6A 1OKOA 1MZEA 4B4QA 1HKDA 1L7QA 4AEDC 2JD9A 2Q8EA 4B3NA 1Q3EA 5IK8A 4AK3A 3PVNA 4N53C 4IGPA 1Q8PA 2FQPA 1UMHA 3WG2A 1A8DA 1ND3C 3POWA 5FP3A 5GLVA 4MXVA 5C5UA 1FPN2 1DYPA 1SLCA 4MGYE 5FYMA 3UJOA 3VL9A 4BE3A 4IQPA 4LUMA 3SEPA 2UWCA 2DFBA 4UF0B 4FPKA 5EJ3A 4UOJA 4UW6A 3UJQA 4CEYB 1MEC1 1U0AA 1DLCA 3SNMA 4BQYA 4HKOA 3HT1A 3CL1A 1PMJX 3AKSA 2DFCA 5ACA1 5DG1A 4DXTA 1I1EA 1OA3A 2VOXA 1Q56A 2BJSA 4XOGA 4YM3A 1E57A 1MS3A 2AACA 4ASMB 1Z78A 2YGMA 1XE0A 3LSDA 2XPJA 2IWGB 1G6NA 3P1IA 3B5LB 3WY6A 4CEYC 4KQ7A 1HN0A 5IVVA 3B7MA 3HPNA 4BQ1A 1N3QA 1Q43A 2HYKA 2V5DA 5BNQA 2XWJB 1JZ4A 1S0JA 5LY1A 1FOD3 1SPPB 1RMU2 2HWE3 4NJ4A 1WCUA 1J3QA 1GZCA 3P3NA 1H30A 4AAXA 5EPAA 5FZOA 4X8NA 1RUG1 5APAA 2RG4A 4RL7A 5F5AA 5I8YA 5DUWA 2BZDA 4AHZA 2V5YA 5KHHA 1O7FA 1S0FA 5H9QA 4HT1T 2CDPA 1NY71 1Y9GA 2IXKA 3WQBA 5J3UA 1R092 3WDUA 2B7YA 3RI9A 4Q0UA 5HCBA 2RS12 1R1A3 2D3PA 1BKZA 2QQOA 4Q0PA 4DEQA 4M3CF 3ZFFA 2PAKA 4EYUA 3ZXEA 1BXHA 5C4WA 3VUOA 1UOBA 1VMJA 3MIFA 4DFSA 5K8SA 2G9GA 4IE0A 4Y4YA 5GKAC 5JAXA 3VD3A 3I3MA 1QNWA 4JHZA 4CDWA 1F15A 3NNJA 3AL5A 5GLTA 3THDA 2VW0A 4MVTA 5KHIA 5AVPA 4NR1A 1ENQA 5KHKA 3GM8A 2YZ4A 3O14A 5CFDA 4HK9A 2IC1A 3CKHA 4DXZA 5J36A 5DZGA 1SCRA 3ZDVA 3USSA 4CCDA 4RA0A 3KQRA 4DUVA 1ST8A 1D2SA 1SFNA 4HPKB 5F32A 3VHRA 5FV3A 3MUY1 4YYOA 2D6LX 3B93A 5FZOB 1UQXA 4PI2A 2R043 1J83A 2CWMA 1W06A 2CYFA 1ZBA2 1I6XA 4NHMA 1REDA 3RWKX 2R6QA 4AFMA 3WHUA 4FOVA 1M4WA 1F35A 1OOPC 2WWSA 2HWD3 1WZXA 4XJAA 1VBD2 4XJWA 2C0ZA 4LBQD 4AEKA 1O4YA 4NVPA 1MS8A 4K9SA 4YW6A 4XF0A 5LA9A 3K4ZA 4J6GA 1GFF2 4NIHA 5IWFA 3LEGA 4NWVA 4SBVA 4Q1RA 2EF6A 4XHXA 4Z2WA 2ARAA 2GDFA 4QM9A 5DUUA 5A3UA 4ISRA 4JDMA 5C4WB 1X33A 2WC2A 1RC6A 4QB6A 3K4DA 3K4AA 3CDZB 1GZ9A 2LRPA 5TSWA 1DGWA 1ULDA 3WINE 4B29A 3OBZA 3W59A 4AQSA 1C5HA 3CHXA 3LA7A 4DS0A 4Z1VA 3BI3A 1IPJA 3TNPB 4WZFA 4AVTA 3WQ1A 2R32A 4CP2A 5CA6A 4EQVA 1MEC2 2JDMA 2B42B 1O3QA 5FYZA 3LAGA 3ZFFC 4DRVA 1IG0A 4HVQA 4Q1PA 1D4M3 3O12A 4FXGB 4XQDA 3KCXA 4OLLA 3VKOA 3KHBA 4CP1A 5IVBA 2EAKA 2WS93 4EWEA 1J1LA 3P5BA 5KXBA 1V6LA 1A6CA 3WNPA 1GUIA 4CDWC 3DXUA 4I02A 5C8CC 5BPXA 4MXWA 2FCUA 4Y22A 4QM8A 4YGDA 4ZKTB 1AR63 4Q4X3 5BNPB 2VY0A 3N4MA 4INDA 3VDCA 5CFDC 3M70A 3AKRA 2W9XA 4ISQA 4M00A 3RG0A 4G9SB 4E2GA 2F17A 1F8VA 1UOJA 3MV01 4AOCA 4XMAA 2WYSA 3GZTB 1DGLA 3BU0A 1DZTA 1VR3A 2NQYA 3NNLA 5CKNA 1AR71 4Y26A 2GC3A 4P9LA 4Z07A 4ZXKA 1NA1B 1YO8A 5I0UA 4AXOA 1QDCA 1W03A 3OOXA 1GP6A 4XFCA 2XBO1 1NY72 3ELNA 3KT4A 4Q27A 1DQ6A 2EIEA 5CEHA 1X7NA 1UZZA 4IUGA 4LA2A 2IVIB 3J7LA 2MPFA 3C3VA 1FV2A 3ZFGC 1I9RA 3V56A 1PZ7A 3RJRA 1KDMA 1YIFA 2BP6A 2CHHA 2VMDA 1PVC1 3IBMA 3QCWA 3RYKA 1H4HA 3I2GA 1LEMA 1SBDA 4RQPB 4UW3A 2XVGA 4ZZ5A 3I59B 5FZ4A 2BFUS 3NL1A 4MX3A 3UK9A 2XJRA 4DPNA 3K51A 3LIGA 5A80A 1WA6X 3HQUA 4YM1A 1XNDA 4E27A 3MF6A 3E6CC 4RYDA 1WGPA 1S0BA 4LBQA 4ORFA 1SACA 2P2KA 2X05A 5HV4A 3IMMA 1RL3A 2X5IB 5A1LA 1WBLA 3QH7A 4A7YA 4XEZA 2B46X 3BVCA 3MLJA 5CADA 2VTXA 2ZBJA 1N3PA 3GALA 5JIAA 4JV4A 1GZTA 5GJ6A 4XJUA 2FZ2A 1QOTA 1D4M1 4YZ4A 1UX7A 4NUBA 2NLRA 2WS91 1JYCA 3KQ4B 4AR2A 4BDVB 2JKXA 2Y0IA 3ENRA 1UF2C 1FATA 3O7OA 5C33A 1JOBA 1W8HA 4GWJA 1V6IA 4AVAA 2HWE2 5BNOA 1BMV1 1LU2A 4FBFA 1PGW1 1RITA 3T08A 3AYCA 2WABA 2ZGKA 4ASKA 3OGJA 2DUQA 4B4PA 2ZAHA 4YGEA 3ZXKA 4AVBA 1RUC1 4C0HA 2ZX4A 1LTEA 4PIZA 4QD2A 3NO8A 4CCEA 2AEYA 4HXCA 1UZYA 4XF4A 3LSEA 3WZ1A 2F4LA 2EAAA 3ZXLA 5CFCA 1IS6A 2AUYA 3ZR5A 1ZZ9A 5DUXA 4XDQA 1H4GA 1QJX3 2J1RA 1X8MA 2JDUA 5FP9A 1S0GA 4XCAA 5FY0A 1H6YA 1V00A 1R1A2 5FXXA 3POJA 1CJPA 3HNMA 2V73A 5CKMA 2H0VA 1XE8A 2BV4A 3FUOA 5AFEA 2D7FA 3DKQA 2P3JA 3A21A 1UMIA 4OUSA 4FPHA 4MLOA 3VZLA 4YZ1A 4PI0A 2CNAA 4DUWA 3ZVXA 3KGZA 5C5TA 2YV8A 1QEXA 2KM2A 4DRRA 2ZHLA 2QKDA 2JG9B 5FZ1A 3UV9A 1JXNA 3IWZA 4QWNA 1S1AA 3F2ZA 1OLRA 3K75B 1RUD3 2O1QA 4S2FA 4AGVA 1C1FA 2Q30A 3AP4A 3H8OA 1Y43B 4Y24A 2Q8OA 2XBO2 5FZCA 5FKCA 2DCYA 1CD3G 2GZWA 1R64A 5EXOA 5GALA 4OHZA 4E4ZA 2LM3A 1SFYA 2RJLA 1TME3 3BPSA 4NROA 4D7TA 1QH6A 2XH6A 5A3TA 3GF6A 4XF9A 3PDQA 1UKGA 1NCRA 1AX0A 3B9IA 2I45A 5CFCB 1XXNA 2HWD2 1PVC2 1ASJ1 1KDKA 4GKXA 3E97A 2WINB 5LA2A 3ZN5A 1YCIA 2VZTA 1LEDA 2WQZC 3DV8A 1RYYA 4BQ4A 5BNOC 2YDEA 4LK6A 1SDDB 2A3WA 4BWOA 1K42A 2AYHA 3DYOA 3WVJA 4JCKA 2PHUA 1AF9A 4XJ8A 4XURA 3OYWA 4YM0A 4QDQA 1AJOA 1DGWX 1IOAA 1OQEA 2VZVA 5CNAA 5CFCC 3RZLA 3WP3A 5JOXA 1LECA 3BYWA 3ZFEA 1OLMA 2ZGPA 1CJDA 4JGYA 3SQOA 1EPZA 5KBFA 4AG4A 3ILNA 2Y33A 4IEVA 4C1WA 2OPKA 1GZWA 4ZU7A 2BRTA 2ZKLA 4N7UA 2R30A 1D4M2 3H1YA 3OGRA 4YWAA 1D0HA 4CZSA 1HQNA 5BV6A 4LPLA 1QJX1 5CZKA 2WS92 2LW8A 2ET1A 2P5BA 4FPJA 4EJRA 2RDSA 3LKJA 1L7LA 1QY4A 3KVBA 1Y7BA 1TE1B 2BGOA 4RD7A 3VD7A 1EP0A 2DU1A 4CDUA 5BUVA 4XAAA 1EV13 3WQ0A 2WJSA 2EIDA 2WLPA 3WDYA 3ZOIA 2V72A 1TNFA 1NE6A 2VBPA 3WNXA 3A0NA 1NCRB 5BNNA 3HVDA 3THTA 4CP9A 1BMV2 3HIFA 1PGW2 1DYKA 4QAWA 4MGZE 3VBRA 4HMZA 3GCWA 3N7JA 2JDZA 2VGDA 5FUPA 2W92A 2DU0A 2BFUL 2RR13 1XNCA 3OYWB 1I3HA 2Q4SA 4UFKA 1ZZBA 1NCRC 3NNFA 2WNUC 3N9LA 4XUOA 3PLQA 4XBQA 4FQZA 3L2HA 1RUJ3 2CAUA 4BU2A 1B35A 1ULCA 2D98A 1V9U3 4FPGA 1OPMA 1VLNA 4JGYB 1U5YA 2GN3A 4LO6B 1CQ9A 4OHXA 4AL9A 1PO21 4MGQA 1RUI3 2ZMKA 2ZX2A 2W46A 2WZ8A 5FLIA 4XBLA 1W8FA 2ATFA 1BHGA 3POGA 5C8CA 5JI9A 2D5FA 3DCQA 4K1YA 1CGPA 1VRH3 3VBFA 1MS0A 2CGPA 5LW9A 1V6JA 1NOVA 3IN9A 2HEWF 3WF4A 1GWLA 3T2QA 4Q4Y3 3ZFEC 3WLUA 1T6BX 4PBOA 4CDUB 3RZGA 2PYTA 3FZ3A 2XHKA 5FZ3A 4E2QA 3C7FA 2IXHA 4M0HA 3JXSA 1QGLA 2TNFA 1AX1A 3H0OA 4A6SA 2BW8A 4IXLA 1GV9A 3J7HA 1KD7A 4LKSA 1RUH3 4JHTA 2FBEA 5BNNB 1YEWA 3PUHA 4CP9B 1GICA 4S2GA 5IK7A 5FYUA 4WVMA 4Y33A 1QHDA 2X09A 3MW2A 5FY5A 3VBRB 3H42B 5LEKA 1QH7A 2VMHA 4CDUC 4D7SA 5J09A 5A3MA 4LXLA 2AGSA 2N7GA 4R9AA 1NQJA 4OVEA 1V6OA 2B39A 1XU1A 3CJXA 3IAQA 5BNNC 1VAKA 1W2TA 1X36A 1EV11 1F5JA 4LBKA 3OGGA 1O3TA 1UY0A 4BB3A 3VBRC 3RZJA 2E26A 3FN9A 4KG8A 3IAPA 4QXKA 3APBA 1G7YA 1UXZA 1GOGA 1JZ2A 4XFGA 2OVUA 2NYYA 4PQ9A 2QBXA 5C8CB 2QQPA 1OHFA 1Y4WA 3POEA 4QPGA 4DZGA 2O8OA 1R083 4OQ9A 4D6QA 5FMOS 1B35C 2ZHMA 4QX8A 1BK0A 3DL3A 3PVBB 2WL1A 4IGOA 2Y60A 1REFA 1GR3A 3AYEA 3M3OA 3NWKA 1QJX2 3I2DA 3HN3A 1HXS1 4K20A 5DABA 3VZNA 4AI1A 4FPLA 4IEWA 4M01A 4PHZA 2QVSB 3WUDA 1ULEA 1W0OA 2A6YA 4L2NA 4ZS3A 3VBFC 4BK5A 4CSWA 1W99A 4NIIA 1ENSA 3BTXA 2XONA 3ECQA 3ITQA 4WVMB 3SH4A 1A34A 2YPDA 1QWRA 2C24A 5FY7A 2W3JA 5EZWA 1SLTA 3RGBA 2VZ1A 1Z7S1 4LOSA 2E7TA 1AHSA 3AMPA 1JH5A 3ATGA 1AL21 2BNNA 3MIHA 4Q4Y1 3BTAA 4Y1XA 3VZJA 3C7EA 3VD9A 2NP0A 4FTSA 1HRV3 3A4UA 3JCIA 4QHZA 1PK6B 2X8KA 5ERLA 5K9YA 3H3ZA 2GNBA 1RUD2 1ZRFA 3PVOA 4FPEA 1W9WA 2FCVA 2QZ3A 5FXVA 1G9DA 1XRUA 2FMYA 1LHWA 3I2IA 1RUH1 2BBAA 2CGOA 3LDRA 3Q8BA 4P9WA 2P4EA 3THPA 3PNAA 3V0BB 3B3QE 4NWWA 1WUVA 2WKKA 1TME2 3JD73 4QPGB 3NJVA 1YLLA 3AZYA 2QFEA 2NMNA 2UYBA 1PO22 3D3AA 3UESA 2XR4A 1IQAA 4MHRA 4P9IA 2ZHKA 1H0BA 4TYSA 2G1MA 2J7MA 4UI9L 3ZIWA 3JBG1 3S0MA 2YFUA 2J1VA 4NO4A 5DN2A 4DMIA 4G3YC 4Y5SA 4GA9A 4QX2A 1URXA 4OZXA 3GZAA 3UKNA 5I93A 3NKTA 4YM2A 4QPGC 2WZPP 3L2YA 2XLGA 5LCWL 3VBSA 1IKPA 2PHRA 3PTYA 1YIPA 3JQWA 3OGVA 4OI1A 1HV0A 4QQLA 4X6QB 4GMP3 3ZR6A 5B4XA 4MG2A 3OPWA 1CAWA 1CONA 2WQ4A 4MHUA 4KH9A 5JMCA 2A3YA 1T6GC 1RHI1 4QX1A 3GBFA 4RFRB 2RJKA 4LHSA 4EN7B 2Y6GA 4O9GA 4MUVA 4DY3A 5HCHA 1ODMA 3OG2A 2W47A 3JB4C 4LBLA 1UOFA 5LA1A 1YC61 1HJGA 3VZMA 3ZSMA 5JSRA 2DCTA 1NUKA 3IT8A 2PQSA 3M3EA 1FMD1 2ETEA 1YJLA 1EV12 3KV5A 1D0GA 4FTBA 1EYBA 3KT1A 4NPRA 4GJYA 5FY9A 3I49A 1KXGA 4TSVA 3WP6A 3V0AA 2C1FA 5JOZA 1MZFA 2LTNA 1QJEA 3BTYA 3W5MA 2EXIA 3H9AA 3NVCA 4ZY9A 4A4AA 1SZBA 2ZKNA 4Z82A 1BJQA 4J25A 2WNOA 4DO0A 1GOHA 3ACLA 2Y6HA 3SKVA 4YW7A 5EYYA 3T0AA 2HH9A 2DURA 2VMIA 3NQHA 4HBNA 3VD5A 3C2UA 2OA2A 5LWBA 3AJYA 3VBSB 1ZZ8A 3ZYBA 1ULPA 1NXD1 1HXS2 5GZEA 2WFF3 1WW7A 1N1YA 1YUDA 3JD71 4FPFA 1ZRRA 1W04A 1H9PA 2IZWA 4LE3A 4ZHNA 1NCQB 1RUI2 2RS53 4LT5A 4COVA 5IHRA 2W1UA 3FC0A 4R4ZA 1JZ7A 3TOJA 3G6JB 4FO9A 1W0NA 2CWSA 2Y6FA 3VBSC 1VRH2 3K3OA 4A42A 4OMCA 4NRQA 4LR4A 1U5XA 2J1EA 2UY9A 2VOTA 3H1WA 5T5PA 2XJTA 1AL22 4NOTA 2WWJA 4Q4Y2 4CCNA 1H1MA 1NYWA 4P14A 3R4DB 2D93A 2QQWA 3WG1A 3LOBA 3L9JT 2OX0A 2WLQA 3FUQA 5FMBA 4V1PA 1SLBA 1NE4A 3V65A 3K46A 3POSA 4YARA 1NT0A 2HWC3 3LIHA 4GMP1 1UU4A 5FMCA 1RUH2 2XLFA 5T3NA 1KS5A 1ZZ6A 4IEZA 2Y38A 5IFPA 3O0XA 4AI9A 5BYNA 3IDAA 4XF3A 3TWIA 4V2VA 1IZ3A 1VMHA 4CVUA 1PIV3 3DF0A 1QNYA 1OLME 2R7EB 2O0OA 1VJ2A 5FMOL 3BKZA 1HQLA 1LOCA 2WNEA 2B45X 3A22A 4QXBA 5IVFA 4GB33 5F5QA 1ENRA 3FBYA 2XKOA 5FZDA 3KV6A 3Q8EA 1TVGA 1VB2A 3LDBA 4AEDB 1XNBA 1P8JA 2ZJCA 4M3CA 2PHTA 3RZMA 4AGRA 4IW3A 5FPVA 2A6VA 2E53A 3W9AA 3BODA 4TWTA 3ZYHA 3VBOA 1ZBA1 1LJ7A 2XGXA 5DAPA 4AYUA 4Y1YA 4RN5A 2W0XA 1R082 1YQCA 4P9GA 4L9BA 5T5JA 1CZTA 1VBD1 4OZOA 5T50A 4CCKA 1RHI2 1I5PA 2B4KA 3WUCA 1BYHA 3WP5A 1REEA 1WLWA 3S57A 1S2EA 3DN7A 4FAHA 1QXPA 3LZZA 1L7RA 3I8TA 5JVVA 5LASA 3U4SA 5A6YA 4RFT0 4URAA 3SHRA 1DLLA 1JODA 4K8FA 2VBDA 4N43A 3C7HA 1FMD2 2VJXA 4O65A 4DB5A 3FHIB 2DYCA 4Q0SA 2RS51 5LB6A 1AR91 5CU1A 3O1TA 4CCMA 1U12A 3U0ZA 2GH8A 2X29A 1OPOA 5DG2A 3HWJA 3MUZ1 5L9VA 4C91A 2CL2A 2GC2A 4QX5A 1GWKA 1JU3A 2ADEA 5HPOA 2AEZA 1LOEA 2H0BA 3POYA 4J1WA 3AP9A 3POIA 4BQ2A 1HRV2 1VBA3 1AVBA 1KS4A 1MS4A 5FYVA 2PLV3 1S0EA 2D40A 1CAUA 2JE8A 3R05A 4LKEA 1F9KA 2JB4A 3POFA 4U36A 1JTZX 2NZ9A 1UY2A 4KWLA 4JQTA 1IQDC 2W52A 3O1OA 1OOPA 2BGPA 1XOYA 3FL7A 2K0GA 1RUNA 2QQMA 1S0IA 2MNGA 4IE5A 4YNIA 2B5HA 3JD72 2WN2A 4A41A 2ARBA 3I2OA 3M3CA 2AR6A 1H2MA 1PIV1 4O7XA 2XUEA 3AMMA 5F3CA 5HCAA 5I8TA 1JYTA 5FZ6A 1WW4A 4Q29A 4OULA 1HW5A 4LLOA 2GMPA 3NV1A 2JDNA 5FP7A 4L0PA 3LWCA 1NLRA 1YXWA 3VBOC 1COV3 2XVKA 4XDOA 5K7PA 4N43B 2WO3A 2E9QA 3WT3A 4DNYA 2R0FA 1W9TA 1QQP3 4AI2A 2NMOA 1ONAA 1XJAA 3H3LA 4Y5Z0 1CVNA 2VZQA 1E5IA 2Y34A 5FK7A 1YQ5A 4E8DA 1XNAA 3RI8A 1GP5A 2JD4A 3WDTA 2RJ2A 4YW3A 1D4VB 2CU5A 1POQA 3M7AA 4L8QA 1LRHA 3KHCA 4QGMA 2XXZA 5L19A 3NAPA 4N43C 1ND2A 3AK0A 4YGBA 3UNPA 2ZOEB 2GNDA 1CAUB 1ZNPA 4PBPA 1PGL1 4ET7A 3GZEA 4S2DA 3LGRA 1POV3 5FLHA 3WXPA 2Q1MA 1OOPB 4XMIA 5LBCA 3M2MA 2YBSA 3KVAA 5EP9A 2R063 2X53S 4XFHA 4XHBA 4O9EA 1HB1A 4EN9B 3RMXA 3FJSA 3PTRB 4QGNA 1XB9A 4LBJA 4UFHA 2DDUA 3UYJA 5C7GA 3LPFA 3LCPA 1HN1A 2RDRA 1DFQA 5F5IA 3GGLA 2JB8A 4H7LA 4S2HA 5DPNA 4LLFA 3O1PA 2WQ8A 5ISLA 4FAGA 2PLV1 2Z2SB 1FNZA 4L11A 4OYUA 4GJZA 3VBHC 3EO6A 1QOOA 3I3QA 5FLJA 3WF1A 3WSOA 2VO5A 4YGCA 3PUIA 3T2TA 3ZFGA 2TEPA 2WN3A 3ZFFB 1J58A 4COUA 1YFUA 1FOD1 1UYXA 2WFF2 4CE8A 2VPVA 2Y6LA 1W9FA 2HWE1 2ZGSA 4WV8A 1HB2A 3D0JA 4QPWA 5C8WA 2ZZJA 3U37A 2AZ5A 1AXKA 2RS52 1UCXA 2I74A 1AR92 4CDWB 3NMBA 1JZ8A 3NAPB 4DXSA 1W8OA 5GLUA 4GKYA 5DDJ3 1HIXA 1WMEA 4BQXA 2A3XA 2VUJA 4XFIA 1H2LA 3ZSJA 5CFDB 2R1BA 1AZDA 3PIJA 3WV6A 4CDXC 5JPNB 5JPMB 1COV1 1TMF3 2J1TA 2E31A 4JRAA 4PIXA 2ZX0A 5DAVA 1R1A1 1OVSA 2R073 5I0SA 5FZMA 4HLTA 3NAPC 1ND2C 4QQOA 1WW6A 5L7OA 1C8M3 2Y6JA 4LKDA 5L9RA 3VKLA 4MV2A 5KC6A 2C4XA 3TYJA 2ZX3A 4Q4V3 4AQ2A 3J4UH 3MICA 3O0WA 4B7EA 4CCLA 2JDHA 3TNQA 3B01A 5FZIA 4PT6A 2Z42A 1OSGA 1PIV2 1YJKA 4GMP0 2YHJA 2Q0AA 5EJ1B 2VCAA 1SCSA 3ZFGB 2HYXA 1XQNA 4AVCA 4GB32 4ES8A 3BIWE 1NLQA 2QE3A 4E9KA 1S2KA 3WDVA 3ZYGA 5JOWA 1UU6A 1X9TA 3W20A 3JUUA 2QQNA 4L97A 3PJQA 4NIAA 1BK1A 2R041 1YQ8A 3NRUA 4YG6A 2D6KA 1VAVA 4X6RB 3QD6A 5JXHA 5SV5A 5CG8A 1WBFA 4AI0A 2FDFA 1F5FA 1W8ZA 2HWD1 4GH4C 3BCWA 3TEZA 1AR83 2J1AA 2WZR3 4XW3A 5FMDA 1LCLA 1UXXX 2XG3A 3JQXA 5CYYA 3J7MA 4LORA 1PMIA 3WOGA 2UY8A 3PJYA 1G9FA 3A7QA 5FYYA 5GLWA 2EA7A 5IAVA 2BVBA 1YWKA 3MEPA 1XSRA 3PHMA 5CVRA 3VHPA 1PGL2 4CXXA 3D0SA 4MXWB 2XJPA 2V09A 1Q8OA 4Y22B 2PHWA 1QJU3 2WSUA 5F9TA 2XLAA 3K48A 2OUJA 4H7MA 1MVQA 3NNMA 4LIUA 1Y3TA 3T2PA 1RB8G 1MVEA 1W28A 3KS7A 4ATFA 2C9KA 2WDBA 5AFBA 2XKPA 4Z2AA 1RJ7A 4A3ZA 5A3NA 1XPWA 5L7OC 1WCSA 2KR2A 1RUF3 4P02B 5AVAA 4DIQA 4AEJA 4Q8KA 2VW1A 4YW2A 1PO13 1ZRCA 2XJQA 1DCSA 4A45A 1VBA2 1OH4A 1O6UA 3R4UA 2PLV2 4P9JA 4XZUG 1HB4A 1OH3A 3I3BA 3ZYFA 5T5OA 1WWYA 1AR61 4Q4X1 5FBJA 3BIEA 2FD8A 1OT5A 4FT8A 2JG8A 2R0HA 1FOD2 5IJRA 5LRRA 1NXMA 3URFA 2VZPA 3O5SA 1H9WA 3VL8A 3SC7X 4LQRA 4XAEA 5I0TA 2RE9A 3AP6A 4QT6A 4UW5A 3SH3A 5F6LB 3EBRA 1TEIA 2ZCWA 4E4SA 1S0DA 3PMSA 2H6CA 4LJHA 3MZHA 1CZVA 2VW2A 4MGSA 4R8HA 2YBPA 3VZOA 1UO9A 3NNGA 1COV2 4FPYA 4PLMA 1BVVA 1G86A 4LBQB 1RTVA 1W2AX 3LE0A 2R1DA 3M1HA 2AH2A 1D7PM 3D82A 3RYRA 4LO5B 3U1XA 1MS1A 4CYDA 3M4FA 1UZVA 4GWMA 1HLCA 4ZU4A 2V4VA 3WCSA 2QTWB 4WBBA 2WNVA 1JOJA 1W3VA 4LO7A 3RWNA 3ST7A 2QQIA 4M3CE 4D94A 2DTWA 1QJY3 1OMIA 3PVEA 5FJHA 5A7OA 2J1SA 5L73A 3B94A 4LMFA 4LA3A 5FZ0A 5IFTA 3ACHA 1JUHA 4PDWA 3DPRA 3SLIA 4WM7A 3TN93 4XIOA 2AREA 5GZGA 3OEAA 5DZEA 4DY5A 1I5ZA 2R062 5CB7A 4BQ5A 2HBTA 5BNOB 2WSVA 5KR7A 1PMHX 3LEKA 1RUE3 1Q8QA 2OW4A 2ZMNA 2P6CA 4FTEA 3RZHA 5J48A 3ILFA 2R042 3AP7A 4N9IA 2D6NA 5C3SA 1T2XA 3KCCA 4F8AA 2WNUA 4CEWA 2F4PA 2WO7A 3KLSA 1DG6A 3FFZA 4GQ7A 2JG8C 4QKFA 4YW5A 5FYHA 4B1LA 1TNRA 4XFFA 3HNYM 2E51A 3HD8B 4QXHA 5BY5A 1F31A 1JS9A 2VZUA 4BPZA 5LATA 4RHV3 2GC1A 3R4SA 3UGGA 1IS4A 3BPZA 1NG0A 1PM4A 3G7DA 4JDOA 4P5YA 1ENXA 1JBCA 1UW8A 2FMDA 3WNNA 1H1IA 3I2HA 4I0BA 2UWBA 5CKQA 4GULA 4RR3A 2UYAA 4EV0A 2ZX1A 4IETA 4NPLA 1GNYA 5D8AC 2VQAA 3IPVA 1QIQA 2A6WA 3MBWA
chains in the Genus database with same CATH topology
1RIRA 3CJIA 1UIJA 2VMGA 3IIAA 2GC0A 1VBE3 3GHMA 4FP3A 4GXLA 2IXIA 2P3KA 4DINB 1IGOA 4WM7B 5FBZA 1Q8VA 2WNVC 4EN6B 3USUA 2F6BA 2A6XA 2D44A 4CDQA 4IV3C 2GMMA 4RGGA 3WCRA 3ETQA 2PQQA 1GBGA 2ARXA 4Q4X2 1AR62 2R16A 1J3PA 2PAEA 3NW4A 2BBVA 1KITA 3DPRC 4PDWC 2BTVC 4WM7C 5CAZA 2WNUB 4SLIA 1QJY1 4BCUA 4UBHA 1O91A 2RS33 3FWEA 1A8MA 1GSLA 1QU0A 1WCKA 3ME2A 3ZMOA 5KXCA 1LOAA 5FRAA 3KMHA 3IMNA 3VKNA 3WD5A 1G9BA 4HSJA 1RUD1 1LODA 5BXXA 1VBB3 3DGTA 5E88A 3NKGA 1C5IA 5C6CA 1H2NA 4OUMA 4EN8B 4CEWC 1B09A 3P3PA 1VALA 4RR3B 4BIFA 1TME1 1POV0 1DGRA 2D3RA 2H6BA 2Z79A 3IPVB 3ZFEB 4AFCA 3E6BA 3CJIB 2IXCA 4HVOA 3VKMA 2RHPA 1GZWB 4AQTA 1M06G 1AR82 2WZR2 3NJZA 4Z92B 1LESA 1DZRA 4RR3C 3USUB 1OA2A 3ZIXA 2MEV3 2EXJA 2DUPA 5FPZA 4AFBA 3SCHA 3HN1A 1A3KA 2XJVA 4PF5A 3CJIC 2CY6A 4H14A 3B02A 5E89A 1U5IA 3CO2A 3IDEA 4IEPA 3T1MA 4OHYA 4EWAA 3J9SA 3FLTA 2GNMA 2JENA 3KT7A 1UU5A 4XTMA 4CDQC 4W6YA 3KB5A 3CEWA 1UPIA 4HN0A 2VNOA 4XE9A 4AW7A 1PO12 4RSUA 1O4ZA 1J59A 4XILA 4YVWC 4JTOA 3AZZA 4LULA 2ZTNA 2G9FA 3EJKA 2JXAA 4PLOA 1SLIA 2ZGQA 1B35B 3OJBA 5JSOA 3ALQA 1BEV3 2NM1A 4M0NA 3QOPA 1BCXA 5JIUA 1SBEA 1V70A 3CNAA 1AYN3 5HBAA 3VBFB 1W2UA 1DBNA 3GBWA 3B9CA 3TB0A 5GZDA 3BOPA 3AKTA 2RR11 2VUAA 3FLRA 4E2SA 2ET7A 5GZCA 1W0PA 3LB9A 1QKQA 1UAIA 1RUJ1 5FAXA 3OY8A 1JYIA 2SBAA 1V9U1 3A0KA 2WFPA 3RPQA 1H8VA 3M3IA 4FQ4A 1DHKB 5GZFA 3H50A 1RUI1 5E8AA 1YI9A 2XVLA 3MLLA 3RQ0A 2DWRA 5JZGA 1VRH1 2BVVA 3UL2A 3H8UA 1QJY2 3MYXA 4AE2A 1VB4A 1MQTC 3QACA 4AF9A 5H9PA 5AC93 3CU7A 2PFWA 3MGUA 3TN92 4JVAA 4ASLA 5KC5A 2JE7A 4BH9A 4QU2A 2KXLA 2CTVA 5HXVA 1W6OA 1UPSA 3KM5A 1RUE2 4R4XA 2RM23 1JUIA 2KA3A 4AHXA 2HWB3 1XNKA 4D3WA 2EIGA 4W65A 1Q5OA 2BUKA 3QH6A 4LHLA 3FMGA 2DCJA 3OY8B 1CN1A 4RHV2 4FCAA 1G9AA 1OD5A 4YW4A 4IV1A 4DQAA 4OHVA 3ES1A 4CTEA 1J3RA 1RMU3 3AJZA 1AUYA 1GQHA 5JZGB 2IXLA 5K0UA 3NV3A 5FOBB 1R081 4B8EA 3WHTA 4K7JA 3AFKA 2ES3A 4XFBA 1U5ZA 4B7KA 3AMHA 1WLTA 3RYPA 1OQDA 5JZGC 1R093 4COZA 2ZS6B 4UBGA 2ZGLA 1W6OB 4MGIE 2EALA 5FO8B 2YY1A 1LGNA 3N7LA 4NHLA 2DUOA 4EWDA 1YFYA 4YFWA 3RMYA 2VULA 4META 3EQEA 3LOIA 2RS32 3ZN6A 2NN8A 1WD3A 1VAMA 3AKPA 2LUWA 1HRV1 1O4TA 5IT6A 4FXKB 4A2UA 2RR12 4FPCA 5A3LA 1OLQA 1VBB2 5A33A 4ONUA 4LBMA 2ZGMA 4Z8BA 1RUJ2 3BU7A 2BEOA 3I4IA 5T54A 4AFAA 1L3JA 1V9U2 2RM21 4MGKE 5K0UB 3KSCA 1CAWB 4NHKA 4XPVA 2VXRA 2HWB1 4I09A 5CBLA 3IDCB 4IV1C 4KG0A 4WM8A 2C5DA 4N9HA 1S0CA 5JR7B 5C9AA 2UWAA 5K0UC 1KRIA 1RJ8A 1CIWA 2YPJA 4H3WA 3QLQA 3AZVA 1O3RA 1MS9A 3HQXA 4YG0A 4C90A 5FTTC 1Y9QA 3V0AB 5E16A 3AX4A 4OHWA 1OKQA 2YGLA 3OTFA 2PELA 1CPMA 1YNAA 1NZCA 1LOFA 1AYM3 1FYUA 4K40A 4AI8A 3FLPA 4FPOB 1FAYA 3AP5A 4JAAA 3MW4A 5ACA3 2RMU3 1MZ6A 2Z5WA 1GANA 3AYDA 2B8MA 1MR5A 4YW1A 2BNOA 1WMFA 2QDNA 1LOGA 1W39A 2DCKA 1AYN2 2JX9A 3GBGA 1CR7A 2P34A 4IEUA 4YFZA 3FE5A 1LHVA 4IERA 1WLCA 2DV9A 1LR5A 4LHNA 3RJ2X 3VV1A 2PAMA 1RUG3 2ILMA 2WT2A 1FI2A 1W6QA 4LBNA 4MZUA 3N36A 4XIKA 2B9UA 2Z69A 2WFF1 3ZDSA 3N7MA 4WM8C 2VECA 2VNRA 5C9AC 2HKXA 2XJUA 3SCFA 3ZSKA 2GU9A 4ES9A 1LGCA 1RGSA 3ZYJB 4PIYA 4XETA 3ZO0B 1H2KA 2DVDA 3N3HA 1J1TA 3V64A 5AC92 4KNCA 4C1XA 4AWDA 1VP6A 1FNYA 1LOFC 3VHNA 1AXZA 3MFCA 4QGLA 1GNZA 1ZZCA 2HWC1 4M3CB 3AZWA 3E6DA 1GLHA 4PLNA 3SXWA 3VBOB 2ZMLA 1AYM1 2RM22 2VH9A 1LKNA 3VBHA 3AYAA 4QQ2A 1GNHA 4XJ9A 2HWB2 1W6QB 3BOWA 3BB6A 3VBUA 3H7YA 2RMU1 5JWPA 3B69A 5EFUA 1DGRN 4GB31 1QF3A 4H55A 4MYEA 1H8TA 2EXHA 2Q5TA 2ENRA 4I3PA 4IESA 3MI8A 4FSJA 1N3OA 2K9ZA 2GAUA 2GMEA 4HPKA 4CDXA 1ZBE3 3O0VA 1APNA 3ZXGA 4WZCA 1ZVFA 5FO9B 3ZN4A 4N90A 4FOWA 1C57A 1PGSA 5J37A 2GNTA 5E1RA 1PM7A 1LGBA 3WW2A 4OFGA 3ZYRA 1IS5A 1PHMA 3JU9A 4OI2A 1V6NA 4HFSA 1LHNA 4YLZA 4URTA 2TUNA 4AVVA 2HJIA 3VBHB 3T1LA 2PHLA 2VVFA 3VBUB 3W58A 1LB2A 1C4RA 1VBA1 1H8TB 1AR73 2UURA 3H3UA 2OZ6A 2MHFA 2UU8A 4MSVA 1QOSA 1KJRA 1Z0HA 2AENA 4D69A 1UX6A 4GH4A 3AMQA 1YHFA 4A3XA 4CDXB 2XBO3 3VBUC 1EY2A 3IKWA 1UD1A 4D7YA 1FX5A 4I01A 2EVXA 5BNPA 1H8TC 2E7AA 1NLSA 1ND2B 1LOBA 4PJYA 1V6KA 3SH5A 2C9AA 1PVC3 5T5LA 5HI0A 5LEJA 3NSTA 5FO7B 1XYOA 3MIGA 4LO4B 3RNSA 1NA1A 1QQP1 2R49A 4F7ZA 3J8F3 2K2SA 1W6NA 3GZUC 3H7JA 1ZBE1 1FXZA 2HWC2 2XWBB 4KWJA 4AEMA 2BNMA 2JE9A 4ITCA 4I3GA 2VG9A 4HN1A 2QZ2A 3INAA 1AX2A 2ZA9A 4PCRA 3HR9A 1AYM2 4XXAA 2QJVA 3WP4A 5JOYA 1C8NA 2GALA 3KD4A 3U11A 3JZVA 5C4WC 5ACA2 2WT1A 4LO8A 4QPIA 4RQPA 2RMU2 3RZZA 1POV1 3I59A 4JTNA 4GH4B 4AHWA 3WW4A 2ZGRA 3VGIA 2R061 1VBC3 4R9DA 1UIKA 2HEVF 1X8EA 2XL7A 5KHGA 3FFQA 1IHMA 2JEMA 1BBT3 1ZRDA 1WCDJ 2X5IA 1QJZA 4X8PA 4Q8LA 1RUC3 1RUG2 3FX3A 3SISA 1SMVA 4K1ZA 4I2OA 5BNPC 5KHJA 2D97A 4Q4W3 3BALA 4QMAA 3RS6A 1DU3D 3HAGA 5L7OB 1VIWB 1W6NB 1SQ4A 1ALYA 2DTYA 2YC0A 5KXEA 2EXKA 3AM2A 1RUOA 1QXJA 1HV1A 5IK5A 1ZA4A 2A70A 1KQRA 5DDJ1 1NA1C 2A7AA 4QPIB 2XB6C 1TMF1 4W6XA 4TLFA 3Q9OA 3AMNA 2JICA 5FQ0A 4C0BA 2I2SA 2R071 4IEOA 3J8F1 4FOYA 1X82A 1SBFA 4AHYA 4R52A 1C8M1 3TAYA 3GYDA 3KGLA 4Q4V1 4QPIC 4RQPC 1IS3A 3U4XA 5L36A 4NN0A 3E5QA 2VOWA 4HL0A 1OQ1A 1YRZA 2PA7A 4LUKA 2YMZA 3EHKA 2Y0OA 2O8QA 4Y1VA 4FVVA 1UMZA 5CIRA 1ASJ3 5KWRA 5LRSA 2X5IC 4BOWA 2JG9A 3PMEA 4Y20A 4A7KA 3CLPA 5D8AA 1VBC1 1AL0G 2YXSA 1QQP2 4YG3A 1G8WA 1BBT1 5LK7B 3LA3A 1IKQA 1S55A 1ZBE2 3ZSEA 4GIQA 1YYNA 4BYYA 1SLLA 4XFAA 5JSPA 4EN0A 1XYNA 4Q2FA 1AR81 2WZR1 3EXUA 3JB8A 5FQ0B 5F6KA 1BVP1 4IV3A 3D4KA 1ZX5A 3ZSLA 4AQ6A 1OFSA 4Q4W1 4KU8A 3WW3A 2HWF3 4KGQA 5H9SA 1WA4A 3VZKA 2FZ1A 3OD4A 5HCFA 1RVF3 1UL9A 1QJU1 3M3QA 2JG8B 3OD0A 2GH2A 4R9BA 5FDBA 1XE7A 2W08A 2BYVE 3LA2A 1AJKA 3CF6E 1RUF1 4JDNA 4IEYA 5FREA 5B2GB 1PO11 4ATEA 2GN7A 4AVSA 4Y20B 5D8AB 1AR72 3VLBB 4HK8A 3FBMA 3WG3A 1DZQA 1SLAA 1LULA 5I8SA 4IL7A 1MACA 4XYXA 3DKWA 4F83A 3QBQA 1W6MA 1ZZ7A 2BQPA 1PZ8A 2WNVB 4HKLA 2JG9C 2OYZA 4DZGA 3RDIA 2XL9A 1NQDA 3ES4A 4IV3B 2CGNA 4G4FA 1PO23 5DDJ2 3S7EA 3VHOA 4QQPA 2W39A 5J98B 5EWSA 1LHOA 1TMF2 4PDWB 3DPRB 3ASIA 3ZX7A 2YYOA 2BWCA 3MLKA 2R072 2VVDA 3J8F2 5IK4A 4KL1A 3VN4A 1C8M2 3S7IA 3NV4A 2DCZA 2VNGA 5D1IA 4Q4V2 2BGCA 1HRI3 3MDPA 4YVWA 4OI4A 3ZMNA 2PHXA 4CEWB 1IPKA 3HMYA 4HANA 1MS5A 3NV2A 3I54A 1R1ZA 2HWF1 3MIBA 3TBDA 3TN91 1RVF1 4LTAA 1HQWA 1C28A 5FPXA 4KGGA 3SITA 4BMBA 1O5LA 1VBC2 4L92A 1W6MB 4TZDA 2D6OX 1RUE1 2W68A 4QQHA 1BBT2 1BQPA 4AGGA 2PTMA 1DQ0A 2ZGOA 2P37A 2P3IA 3AXDA 1UN1A 4LEJA 4KU7A 3SCGA 1V6MA 1RUC2 4P9XA 4RGAA 4IEQA 2JECA 2QNKA 5DUVA 4RHV1 3VUOA 4CDQB 4Q4W2 1ZM1A 2D6PA 3H1MA 3VKFC 1EAH3 1K5MA 3ILRA 2JJ6A 2ZAAA 3TRSB 1HXS3 1KFUL 1O5UA 1DQ1A 4CRQA 2ZACA 4P9YA 1QJU2 4GALA 4K6BA 2IXJA 1PVXA 4BIOA 4YVWB 1MQTA 1N47A 4XJZA 4N7IA 2D3SA 4WVZA 4Q0QA 1YFXA 2BWAA 2DF7A 4DOUA 5JCTA 1ULGA 2HEYF 1VBE1 1RUF2 4JGZA 3UKTA 4UW4A 1Z7S3 2A73B 4XBNA 2GSYA 2BPA2 1TQ5A 1AL23 4XQWA 2ZABA 1CAXA 2WIIB 4JGYC 3ZXAC 2TBVA 1Q8SA 2G4IA 2ZGTA 2OIIA 1HRI1 2LALA 5J7MA 3X29B 1DQ4A 2PN5A 4FP2A 3WW1A 3ZXFA 2RS31 1G9CA 1WMDA 3AXEA 1FV3A 2A6ZA 3OBTA 1ASJ2 2WT0A 1K5MB 3JBG3 1VBB1 3MIEA 4ZU5A 3ZYPA 1PK6A 4UXAA 2XJSA 2A75A 1ZREA 4K21A 1D2QA 3B00A 2FHRA 4BMEA 5JLVA 5DXDA 1MQTB 2E63A 1GKBA 4COYA 1C1LA 3V0BA 1K5MC 3MF9A 4XTPA 1XYPA 4JGZB 1C3HA 3IM0A 3MIDA 1CX4A 1RHI3 2WA4A 2MEV1 1CAXB 5KXDA 3RSJA 5I91A 5ABJA 1EAH1 2ZHNA 2HWF2 3GHNA 5EV7A 2ZGNA 1RVF2 3WX5A 1FPN3 4JGZC 2E6VA 3ZYIB 3ZPYA 3D6EA 1H1AA 1FMD3 2ERFA 3KZ4C 3U10A 4CP0A 2VOKA 2VQ0A 4AFDA 4GWNA 3N7KA 3IDBB 3U07A 3DUIA 2D43A 4OI0A 2D5HA 3GNEA 3SMHA 4COWA 4HETA 5GM0A 5T52A 1RINA 1BZWA 4Y1UA 3S30A 2CV6A 3R6SA 1DDLA 4E4DX 4BLIA 1GYKA 5A32A 3ZXJA 1FT9A 1BEV1 2OUHA 2ZPXA 1EPWA 1CESA 1YFWA 1ZYBA 4YRDA 1AYN1 2WA3A 3MW3A 4U2AA 4YZ3A 3MPBA 3S6PA 2VVEA 4YVSA 5DZFA 2CAVA 1PK6C 1AXYA 5IUQA 3E5UA 1WLDA 5ABJB 3I7DA 4XZPA 5I0RA 1N1SA 1VBE2 2I07B 2OZJA 4JRLA 3HT2A 1SEFA 3R0RA 3MFAA 3ROUA 2PHDA 4Q26A 1N1TA 4J1XA 4W6WA 5FOJB 5F1RA 2Q1ZB 2YUEA 2RS13 2ZGUA 1A78A 4EROA 5ABJC 3WDXA 1ULFA 1HRI2 4QHBA 2E7QA 3VDDA 2VOVA 4L99A 1MZ5A 1PNGA 1NCQA 5EYXA 1GQGA 4IEXA 4HVRA 1LHUA 1S2BA 3AKQA 4XXPA 5AC91 2DVFA 5A32B 1KJLA 3D5OA 4YSFA 4HSLA 4KWKA 1FPN1 4IV1B 3AFGA 2IFWA 3HBZA 5SV8A 2IFRA 3WDWA 4Q0VA 5FFOC 4BA6A 3M8LA 1DQ2A 1JW6A 1W6PA 4YVSB 4YZ5A 1YI7A 4KBBA 3N35A 4B4RA 5CG9A 1CAVA 1QXRA 2VU9A 1ZBA3 1UKRA 2YROA 5FCCA 5J96B 4I30A 1QDOA 3OPZA 1QMJA 1PNFA 5T55A 4Y1ZA 1OFNA 1X50A 1VBD3 2D6MA 2QUOA 4LBOA 2MEV2 4YVSC 4BLJA 1EAH2 4RS5A 2QDRA 1N1VA 2QCSB 4BM8A 3UKVA 3OF1A 1JN2P 1RMU1 4XF1A 4AEDA 1OA4A 1WD4A 2ZZQA 1JHNA 3VDDB 4N53A 1AR93 4LHKA 1XU2A 1KFXL 2A5ZA 1ND3A 3ZN6B 4K3UA 3OBRA 1MEC3 4I0AA 5LK5A 1Z7S2 1WW5A 3OCPA 4P5HA 4WVWA 5A33B 1R091 4R9CA 3VDDC 2RS11 1NCQC 2JKBA 2DVGA 4HZFA 2P17A 1W6PB 2SLIA 3WQ7A 1BEV2 3KCYA 4JC1A 4JQRA 3J26N 4LNVA 1CAVB 5H9RA 3AB0A 1CPNA 5GLZA 3MPPG 3E5XA 2PHFA 4WM8B 3ZXDA 5JI7A 4CEYA 5C9AB 4MH0E 1DQ5A 4XQ4A 3D8CA 1LU1A 3WG4A 3JBG2 4RS5B 4F3JA 1PZ9A 1LENA 4I0WB 1SDWA 2NPIA 4A7ZA 4FOQA 4BHPA 3AZXA 2Y26A 1F2NA 4N53B 1HDKA 2DVAA 4YZ2A 5JDBA 2XUMA 4QPYA 1DIWA 1ND3B 4WVVA 2A71A 1OI6A 4RS5C 4HKWA 4BZ4A 1DF0A 2DVBA 4LE4A 1HX6A 1MZEA 4B4QA 1HKDA 4AEDC 4B3NA 1Q3EA 5IK8A 4AK3A 3PVNA 4N53C 1Q8PA 2FQPA 3WG2A 1A8DA 1ND3C 3POWA 5GLVA 4MXVA 1FPN2 1DYPA 1SLCA 4MGYE 3UJOA 3VL9A 4BE3A 4IQPA 4LUMA 2UWCA 2DFBA 4FPKA 5EJ3A 4UW6A 3UJQA 4CEYB 1MEC1 1U0AA 3SNMA 4HKOA 3HT1A 3CL1A 3AKSA 2DFCA 5ACA1 5DG1A 1I1EA 1OA3A 2VOXA 1Q56A 4XOGA 4YM3A 1E57A 1MS3A 4ASMB 1Z78A 2YGMA 2XPJA 3LSDA 2IWGB 1G6NA 3WY6A 3B5LB 4CEYC 4KQ7A 3B7MA 4BQ1A 1N3QA 1Q43A 2HYKA 5BNQA 2XWJB 1S0JA 1FOD3 1RMU2 2HWE3 1J3QA 1GZCA 3P3NA 1H30A 4X8NA 1RUG1 4RL7A 5I8YA 5DUWA 4AHZA 2V5YA 5KHHA 1O7FA 1S0FA 5H9QA 4HT1T 1NY71 2IXKA 5J3UA 1R092 3WDUA 2B7YA 3RI9A 4Q0UA 5HCBA 2RS12 1R1A3 2D3PA 1BKZA 4Q0PA 4M3CF 3ZFFA 2PAKA 3ZXEA 1BXHA 5C4WA 4DFSA 3MIFA 5K8SA 2G9GA 4Y4YA 5GKAC 5JAXA 1QNWA 4CDWA 5GLTA 2VW0A 4MVTA 5KHIA 5AVPA 4NR1A 1ENQA 5KHKA 2YZ4A 3O14A 5CFDA 4HK9A 2IC1A 4DXZA 5J36A 5DZGA 1SCRA 3USSA 4RA0A 3KQRA 1D2SA 1SFNA 4HPKB 3VHRA 4YYOA 2D6LX 3B93A 2R043 2CWMA 2CYFA 1ZBA2 1I6XA 4NHMA 1REDA 4AFMA 2R6QA 3WHUA 4FOVA 1M4WA 1OOPC 2WWSA 2HWD3 4XJAA 1VBD2 4XJWA 2C0ZA 4LBQD 4AEKA 1O4YA 4NVPA 1MS8A 4K9SA 4XF0A 4J6GA 1GFF2 4XHXA 4NWVA 4SBVA 4Q1RA 2EF6A 4Z2WA 4QM9A 2GDFA 5DUUA 4ISRA 4JDMA 5C4WB 1X33A 2WC2A 1RC6A 1GZ9A 5TSWA 1DGWA 1ULDA 3WINE 4B29A 3W59A 4AQSA 1C5HA 3LA7A 4DS0A 4Z1VA 1IPJA 3TNPB 4WZFA 4AVTA 3WQ1A 2R32A 4CP2A 5CA6A