4I3PA

1.96 angstrom x-ray crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase bound with 3-aminosalicylic acid from cupriavidus metallidurans
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
174
structure length
174
Chain Sequence
MLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFFYQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQLKSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxioreductase/substrate
molecule keywords 3-hydroxyanthranilate 3,4-dioxygenase
publication title 1.96 angstrom x-ray crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase bound with 3-aminosalicylic acid from cupraavidus metallidurans
rcsb
source organism Cupriavidus metallidurans
total genus 39
structure length 174
sequence length 174
ec nomenclature ec 1.13.11.6: 3-hydroxyanthranilate 3,4-dioxygenase.
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06052 3-HAO 3-hydroxyanthranilic acid dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4i3pA01
4NVPA 1NXMA 2GU9A 5I8YA 4ZU4A 4YARA 2DCTA 1O5LA 5J3UA 3FE5A 3OD0A 1CAXB 2GC0A 3MDPA 1EY2A 2K9ZA 4KU8A 4LUKA 4XF3A 4XFAA 1GQGA 4Q0SA 3E6DA 5FLJA 1VJ2A 4QGNA 1XE7A 4YRDA 3WW3A 4BHPA 3UKVA 4JVAA 3G7DA 4PIXA 3USSA 3HIFA 4BYYA 3RNSA 4IESA 1OI6A 3OGJA 1RL3A 1LB2A 1O3SA 3CEWA 4XEZA 1DZTA 1HW5A 3IDCB 1QY4A 4UXAA 1YHFA 3LZZA 4L2NA 4Q0UA 2E9QA 3H9AA 3D82A 1RC6A 2OZJA 4B29A 2GZWA 2PQQA 5E16A 4YSFA 2BGCA 2MNGA 1O3RA 3KSCA 5FLHA 3I7DA 2B9UA 3H1MA 4JTNA 2IXJA 4IEVA 2PFWA 1Y9QA 3GBFA 2D40A 1SEFA 2IXKA 3CLPA 3H7YA 3LWCA 3M3IA 1FI2A 5LRRA 3E5XA 1NYWA 1ZZCA 4N9IA 1LKNA 4KWKA 3DL3A 4LULA 3CO2A 1YUDA 4F8AA 3FX3A 3RYPA 3FZ3A 2PTMA 4E2SA 3EO6A 3FHIB 3D0JA 2GH2A 4XFCA 4IEZA 5JSRA 3LA2A 3E6CC 3UKTA 5KHIA 2C0ZA 4MGIE 4AVCA 4EV0A 3RPQA 2UYAA 4I0AA 1Q5OA 3S7IA 3SMHA 1QWRA 1VP6A 1ZZBA 1QXRA 3HT1A 4CYDA 2HKXA 4I2OA 2GC3A 4KWJA 3R6SA 1YFYA 4L11A 1Q3EA 4J1WA 5FDBA 4XFIA 1UCXA 3KMHA 2QVSB 4E2GA 1EYBA 1G6NA 2UYBA 4I09A 2D93A 1CX4A 4AVAA 1TQ5A 4HVQA 1GQHA 4XFFA 1OFNA 4I02A 1ZREA 4QM8A 1YFUA 1RTVA 3ROUA 1U12A 4HSLA 3VHRA 1CAVB 4HZFA 4META 1X8EA 4KU7A 5C6CA 3EBRA 3H50A 5J7MA 2ET7A 1J59A 4N9HA 4HVOA 4KWLA 4EWDA 5KHJA 1CAWB 5KHGA 4AQ6A 4I0BA 1YFXA 4HVRA 2WC2A 1UD1A 3ZDSA 5EFUA 3KGLA 3FJSA 3WW4A 4IEYA 3PLQA 3BCWA 1YWKA 1DGWA 4Q0PA 5I0TA 2GC2A 4XFBA 1ZRCA 2ZKLA 4PIZA 4FT8A 3MZHA 4XF4A 1WGPA 4Z07A 5JR7B 2OYZA 3JZVA 1V70A 3QOPA 1CAUB 2GAUA 2XHKA 4Z82A 5KHKA 4R8HA 5I0RA 2Z69A 5AVPA 2UY9A 5I93A 1O3TA 2ETEA 5F1RA 4MGYE 4YYOA 2QCSB 2ET1A 3D0SA 4AXOA 2B8MA 1I6XA 2PA7A 1ZRDA 1XRUA 5CVRA 1O5UA 2HJIA 3IBMA 2IXCA 3H7JA 5K8SA 3FFQA 4IEQA 3HQXA 1WA4A 4O9EA 2D5FA 2ATFA 1O7FA 1YFWA 3LAGA 3I59A 5LEKA 1SQ4A 4MX3A 3ES4A 5CADA 4X6QB 1O3QA 3BB6A 4OFGA 1J3QA 1DGRA 1VR3A 2PHLA 3IDBB 4IEPA 1FT9A 3UKNA 5FCCA 3H8UA 2Q1ZB 5JSOA 2ZCWA 5EZWA 5KHHA 2MHFA 3L2HA 3H3UA 3E5UA 4Q29A 3CL1A 2OA2A 2V09A 3O14A 4J1XA 4LA3A 2IXLA 2CAVA 5CU1A 1RUOA 5BUVA 3GYDA 3WW1A 3B02A 4HMZA 2B5HA 4I3PA 1ZZ6A 3WW2A 1I5ZA 2IXHA 3FWEA 3EJKA 5I8SA 4AVBA 4AQ2A 4XFGA 3OTFA 5LEJA 2H6BA 5LRSA 1ZZ8A 4FAGA 2CV6A 1FXZA 2BNNA 3LA7A 3KCCA 3TNQA 1Q43A 3LA3A 4LTAA 5BPXA 3RYRA 5JCTA 4XF0A 1NE6A 5FQ0B 4IEOA 4QGMA 1CAXA 3HT2A 4UBHA 1CAWA 2BNMA 4DINB 4FAHA 5FPXA 2IXIA 5I8TA 2EA7A 3NKTA 3MPBA 1UIJA 2XL9A 4MH0E 5J48A 1QXJA 2EVXA 1H1MA 4WVZA 2KXLA 5C8WA 4Q0VA 3E6BA 4OLLA 4HN0A 1OD5A 1IPJA 3SXWA 4XETA 1LR5A 1XE8A 4XF1A 5FPZA 5BV6A 3S0MA 1J3PA 4Q0QA 4XF9A 1SFNA 5HI0A 4YNIA 2Q0AA 1PMIA 3OCPA 3CJXA 3U11A 2Q30A 1H1IA 2CGPA 2OPKA 1X82A 1EP0A 4R52A 5T3NA 4MUVA 4PIYA 3SCGA 3N4MA 2BEOA 4IERA 5FLIA 1ZZ7A 3CF6E 3NL1A 4WBBA 3NW4A 4XFHA 4TLFA 2H0VA 1ZRFA 5BY5A 1J58A 3DN7A 1CGPA 3NVCA 4MZUA 1OMIA 1EPZA 1RGSA 5JAXA 2F4PA 2IC1A 2VECA 5I0SA 2FQPA 3MYXA 2PYTA 4ORFA 5KBFA 2QNKA 4LA2A 4E2QA 2PAEA 1RUNA 3H3ZA 4WZCA 3DV8A 5JSPA 4QM9A 1DZRA 4MV2A 3IIAA 1ZZ9A 5I91A 1WLTA 3E97A 1ZVFA 3NSTA 5FQ0A 2N7GA 3QACA 4UBGA 4HN1A 3DKWA 4O9GA 3ELNA 4D7SA 2UY8A 3SCHA 1ZX5A 2BYVE 4FBFA 1UIKA 5I0UA 2PAMA 5BXXA 3BU7A 4GULA 3ES1A 2K0GA 2P17A 3EQEA 3I54A 4QMAA 1IPKA 3RZZA 2GC1A 3M70A 3SCFA 3C3VA 4KL1A 4QX5A 4IETA 5E1RA 3H1YA 1ZNPA 3E5QA 2O1QA 4HSJA 1L3JA 3LOIA 2OZ6A 2H6CA 4HBNA 2Y0OA 2QDRA 3KGZA 3ACLA 3S7EA 2XLGA 4BIFA 3EHKA 1CAVA 4HLTA 1PM7A 3BALA 2CAUA 3RDIA 1LRHA 2XKOA 3U10A 3IWZA 3U0ZA 2Z2SB 2EAAA 4JV4A 4LUMA 4ONUA 4P9GA 4A2UA 4ZU7A 3BPZA 3RYKA 2PAKA 4QGLA 4MGKE 4I01A 1J3RA 3SHRA 4EWAA 4H7LA 5D1IA 4ZU5A 4IEXA 3ST7A 4QXKA 1ZRRA 3PNAA 3TNPB 3NJZA 1YLLA 3OF1A 4D7TA 1CAUA 2VPVA 1JUHA 2PHDA 3I59B 2XLFA 1UPIA 2I45A 4IEUA 3PVBB 4BH9A 4K8FA 4LEJA 2FMYA 4RD7A 4EROA 1J1LA 2XLAA 4JTOA 2XL7A 2XKPA 1Y3TA 4EWEA 2O8QA 2MPFA 2Q4SA 4PJYA 1NZCA 4IEWA 2BNOA 3ETQA 1X8MA 4LLOA 2QJVA 4X6RB 4MGZE 2XGXA 1NE4A 1O4TA 2D5HA 4F7ZA 2VQAA 3H1WA 1X7NA 1UW8A 2WFPA
chains in the Genus database with same CATH superfamily
2ZHMA 1MR5A 4EE2A 4GH4C 4ZU4A 1MS4A 1LOGA 3U07A 3WDYA 4CEYB 1O5LA 1QXPA 4HXCA 3RZMA 3FE5A 3JCIA 4E4SA 5KR7A 4Z2WA 2RS12 1IG3A 1SDDB 1W05A 4NWVA 2YV8A 4YW1A 2XVLA 1DIWA 2C4XA 1POQA 1L7RA 5A7QA 2JIGA 4MHRA 4AOCA 5K0UA 4WM8B 2P3IA 2GALA 2R0FA 4Q0SA 5EV7A 1AR61 2MEV2 1AVBA 5FMCA 3WOGA 1ULGA 1ZBA2 1WCKA 2LRPA 3UKVA 4JVAA 3G7DA 5LA9A 5C9AC 2ZGQA 2EXJA 1SFPA 3HIFA 1YQ6A 3LEKA 3BU0A 2OQ7A 1W6PB 1MS5A 2K2SA 3KQRA 1RL3A 2Z4FA 3D8CA 2ZEWA 5FBZA 1EV13 2PN5A 5GZGA 5J96B 5DDJ1 1O3SA 2VMGA 5JPNB 3IDCB 3WF3A 1EAH3 3KQ4B 1TVGA 3KF5A 5GLZA 4CPBD 4CSWA 1CJPA 3TEYA 1JOJA 1QJX1 3HQUA 1PIV2 1YJLA 4J6GA 4YW5A 2WZEA 2VUJA 4AVSA 4CDXB 3OPWA 2JWPA 4JKLA 1VLNA 2YC4A 4Q0UA 1QOOA 2C9KA 3NAPB 3D82A 5FZAA 4CDQA 2DTWA 2VXRA 3VBRA 1W8HA 3T2TA 2GZWA 4QWNA 1JOBA 3APBA 4YVWB 1RUJ2 2XVGA 4XUPA 1UPSA 2WBKA 1ENRA 4BZ4A 1W06A 1FV3A 1LOEA 3PU3A 4RA0A 3NQHA 3NV3A 3AMHA 1IQAA 1WMEA 4Y1VA 2B9UA 3GBWA 2IXJA 2RS11 4QX1A 4K6BA 2P2KA 1ZBE2 4HKLA 3ITQA 3CKHA 3I3EA 3GBFA 2D40A 1AYM3 1VBB2 3LFMA 1GLHA 2RM23 5CBLA 1X33A 3AZVA 2MEV1 3H7YA 4R9BA 2AACA 2XJQA 1FI2A 2A6WA 4IV1C 2FBEA 3E5XA 4CCLA 5C5TA 5JXHA 1AJKA 1U0AA 1ZZCA 3RS6A 3RZKA 1UYYA 4N9IA 3WNXA 2HWC1 1TE1B 3VD4A 3GZEA 5HPOA 2G9FA 4NIGA 2P3YA 3DL3A 1DQ2A 2XR4A 4LHKA 4F3JA 2VU9A 1R64A 4F8AA 3VBUC 3C7OA 3MIGA 1PIV1 2XJVA 1OKQA 4NHMA 1IS5A 3WNNA 2E7TA 4DQAA 4AGGA 4AL9A 2GH2A 1VB4A 2ENRA 2FDFA 1SFYA 4XTPA 2DUQA 1W6MB 4IEZA 5JSRA 2P6CA 4CPBA 1UN1A 4B1MA 3JD73 3E6CC 1UY1A 2HEYF 4XXPA 5KHIA 2C0ZA 4CEYA 1SCRA 1RUJ1 1W3VA 4I0AA 1O91A 3S7IA 3ZYPA 1JZ4A 4LO4B 1NY72 3LEIA 1YC61 2HKXA 4WM8A 3ZSKA 5IHRA 2PHUA 1YRZA 1YJKA 3MFAA 1PO22 1AL22 1H9WA 1ZBE1 1MQTC 4Y33A 2Y26A 4ASMB 2ILMA 1WW5A 3THTA 1VBB1 5EYYA 1YIFA 2RS53 1OA2A 3ZM8A 2JJ6A 5HV4A 1YCIA 2ZGTA 1ZYBA 3WY6A 3D3AA 2WNUC 3T0AA 3O1TA 4QDRA 4BMEA 2LALA 2W92A 3POJA 4HVQA 2GN3A 2Y6JA 4RYDA 3JU9A 1ASJ2 2EXKA 2B39A 3ZDVA 1OLME 4QM8A 1YFUA 2HWE3 5A1AA 3BUCA 1LGCA 3NAPA 2JG9C 3WD5A 4AAXA 4HZFA 4NROA 2QQMA 1REEA 3ZXGA 4OHZA 5JZGC 1HQWA 3WCSA 1COV3 4NIDA 1J59A 4YVWA 1SACA 2CDPA 3VBFA 1DQ6A 5FZ3A 1R1A2 2LW8A 4D94A 3KT7A 4KWLA 4DXSA 1ACCA 2A3XA 4K8RB 3B94A 1CAWB 4OI4A 5KHJA 3AVRA 2AEZA 5GKAC 4HVRA 1XYOA 2DVDA 5L73A 3MEPA 1F5JA 3POGA 4BK4A 1EUUA 2W39A 3AZYA 1QH7A 1Z7S1 4IEYA 1DGWA 4C0HA 3AXDA 1NAEA 4QHBA 5ANQA 3S57A 1RUH2 1ZRCA 2J1UA 3BPSA 1AL21 1AJOA 5BNOB 3JQWA 5E8AA 5FYUA 2ZX3A 1GBGA 3MZHA 2ZGRA 2PXJA 2W46A 3U14A 4Y5SA 1ZA4A 3IDAA 1PZ9A 1GOGA 2OW4A 3JZVA 2EXHA 3SHRA 3PUSA 3QOPA 4CEWA 5H9SA 2A73B 1RINA 3KVAA 5AVPA 1L7QA 2VOTA 1FATA 1O3TA 4A6OA 3VLBB 2WYSA 1C1FA 4MGTA 1ASJ1 1NA1A 4Y4RA 3M1HA 4AEDA 5LB6A 1WZXA 1W2OA 3I97A 1SZBA 3T1MA 5BYNA 4IGPA 1W6MA 5CG8A 5FV3A 3SKJE 1Q8QA 3KD4A 3PUAA 1R093 4CUCA 1ODNA 1GSLA 4IEQA 3HQXA 3PURA 3SITA 2E31A 1R1A1 2ATFA 1O7FA 3LAGA 2C6SA 2A5ZA 3VL8A 1CD3G 5K9YA 3KHCA 3BB6A 5FZKA 1DGRA 1VR3A 1SPPB 2JB4A 1EAH2 3M3QA 3PJQA 3ZVXA 5FZ0A 1O59A 4JKKA 1LENA 5E89A 3T3YA 4C8DA 5JI7A 4CRQA 5E6HA 5KXBA 4EN8B 1MS3A 2NPIA 5FY5A 5JSOA 1RUH1 4OUSA 3DUIA 2MHFA 2WN2A 3H3UA 2A71A 3E5UA 2OA2A 1BVP1 3I2FA 3J7NA 2V09A 4Y5TA 4CXYA 1UY4A 3O14A 4LA3A 3J4UH 4PF1A 2CAVA 3H3LA 2VMIA 2DCJA 2D3RA 3WW1A 2G1MA 2JDHA 3NKGA 1WUVA 1I5ZA 2IXHA 3FWEA 3EJKA 3MUZ1 3IMMA 1S0FA 2VNOA 2ZGNA 4LKEA 4XFGA 4ZONA 4AQ2A 2H6BA 4DFSA 5JOYA 2Z42A 5LEJA 5DMYA 4RR3B 1SLTA 2CV6A 1FXZA 3LCPA 4N43C 4NOTA 3LA7A 3I3MA 1KFUL 3I2HA 4ZHNA 1Q43A 3LA3A 4CU7A 2RM22 1VB2A 5FYBA 1W8WA 1IQDC 2A75A 4H7MA 3WQ1A 3K77A 5JCTA 1JYIA 2BRTA 1OH4A 1S0JA 3ATGA 3VBHA 2ZMLA 3POYA 4IEOA 1HQNA 1CAXA 2Y6GA 4YG6A 4WZFA 5IUQA 5L36A 1CAWA 1DLLA 5FZBA 2W5FA 4A7YA 3FMGA 1GOFA 2ZGPA 1JYWA 1ND2A 2QQKA 4QQ2A 4XBNA 2WZ8A 5F39A 3VKNA 1JZ6A 1EV11 5JOZA 1R1ZA 1EAH1 5I8TA 1WW7A 3V0BA 4UF0A 3VHNA 3WDWA 4LBLA 5J48A 4LBQB 1SLAA 3ZSLA 4ZY9A 1H1MA 3O1RA 1KRIA 2FZ2A 2BGOA 1E5HA 1XNBA 3T09A 5C33A 3AMPA 2RVAA 3E6BA 3JD72 1JMUB 1JTZX 3RG0A 3TOJA 5C71A 1BLZA 1NXD1 1IPJA 4DB5A 3DYMA 3FBYA 1AX0A 1Q8VA 3WEZA 4NAOA 3WX5A 4TSVA 2K46A 5F32A 1DGWX 1YI7A 2WT2A 1C57A 1OUXA 2G4IA 4QPGB 2YGLA 3PVOA 3AMMA 2YXSA 4M00A 4LPLA 2WQZC 3HBZA 1H2KA 1SFNA 2B42B 4V1PA 1AYM1 4DUVA 3WV6A 3ZO0B 2RM21 2RS52 5FUNA 3M3CA 5FJKA 2DVGA 4XACA 1RIRA 2YROA 4IW3A 3VZNA 4A4AA 4XJAA 5CFCA 3AFKA 1DQ1A 1RUD3 3U11A 3VDAA 1H1IA 3N9MA 4LXLA 5FYIA 4CCEA 3A0NA 5FZGA 3USUB 1JUIA 1SPPA 3K4DA 1WCSA 5FPUA 5KC6A 3N4MA 3NL1A 4BISA 3LDBA 2HWE2 3ZFEA 4XFHA 3ZYRA 4TLFA 2H0VA 3WP3A 1J84A 5KXEA 1R083 4JC1A 1CGPA 3NVCA 2VOKA 5FY9A 2JEMA 4UFHA 2HYKA 3BI3A 4WM7C 2R16A 3T0BA 1COV2 2A3WA 2JDYA 3BOWA 1SHWB 2EALA 2VECA 4K21A 2CHHA 3JD71 1LCLA 4CDUB 5I0SA 4LO7A 1VMFA 2CSGA 4ARXA 4GZ9A 5DAWA 1YQ5A 3OSDA 5A6XA 4XJWA 5KBFA 3AMNA 2QNKA 4YGDA 5A3NA 1QF3A 2JD9A 4KH9A 2DUPA 2JICA 4OMDA 1M4WA 1RUNA 4P00B 4PQ9A 1K5MA 5A33B 2YDEA 3UNPA 1UY2A 1DZRA 2NMNA 3D4KA 3ZX7A 2RE9A 1HQLA 5I91A 1V6MA 1OKOA 4LOTA 5LBEA 2FCUA 5F6LB 4XQDA 2A3YA 3A4UA 3AYAA 1HB3A 5IWFA 3WNKA 4PDWC 1JI6A 2RS51 1ZA7A 3QACA 1WMXA 1W8FA 2ZA9A 4HN1A 2P6HA 3SH4A 3DKWA 3B69A 4TYSA 3IPVB 5DPNA 4XQWA 1YO8A 3RVHA 5FOBB 5C4WC 1ZX5A 1RVF3 3AYEA 3BIEA 2RDNA 1UIKA 5FZ8A 2D6LX 3OY8A 4ISRA 2D44A 2GNDA 1BZWA 1IGOA 2CY6A 4LBQA 2P17A 2VMHA 4QXBA 4UFMA 4RFRB 2HWE1 2PELA 4YW7A 4NPRA 2ZGLA 1KDMA 2VZPA 4ZXEA 4QXHA 5C8CB 1AL0G 1OA3A 5FMOS 3SCFA 4JHZA 1MZ6A 1QU0A 3MV11 1W8ZA 2EIBA 1KEXA 1MS9A 1CZSA 4L97A 1COV1 1UL9A 3E5QA 4FPYA 3GGLA 4HSJA 2R1DA 3VB9A 2OZ6A 4QDQA 2H6CA 4AVVA 4LHSA 1W6OB 4YZ2A 2AENA 1AF9A 2QDRA 3N9LA 4XVHA 2W94A 2XLGA 2KM2A 1VBC3 1CAVA 3JB4C 4AF9A 3WF0A 4OVEA 4RQPC 5IW0A 3A7QA 4QPGA 4B4RA 2R7EB 4AGRA 3QCWA 4YW6A 3UETA 5JMOA 2CAUA 1DQ5A 3F2ZA 1LRHA 1NCQB 2XKOA 4N90A 3U10A 5EIYB 1N1TA 2X53S 3IIIA 3GF6A 5FZOB 3CDZB 3WUCA 4AI2A 3BPZA 5JDBA 4XAEA 1EUTA 1OOPC 3W5NA 1HB2A 3KHBA 3B00A 4UW4A 2R1BA 4GH4B 4LLFA 2DDUA 3EB7A 3FFZA 5CFDC 1UOFA 1BXHA 4RFT0 1NX9A 4ZU5A 2ADDA 3WZ1A 4L0PA 4NRQA 3WT3A 1OHFA 4QXKA 2BVBA 1UU5A 2BV4A 1YXWA 2ZZJA 4HT1T 4K9SA 4QHOA 1H30A 3NJZA 3OF1A 5IATA 3TEWA 4D7TA 1W9YA 3SISA 2J1VA 5FWJA 5EWSA 1N3OA 2PHDA 4CDUA 5C9AB 1R091 2A6ZA 1UPIA 4NR1A 2I45A 2VXJA 4ES8A 4GWJA 3WQ7A 4BH9A 4CTEA 4LEJA 1PX4A 2FMYA 2VTXJ 5JIUA 4RD7A 2ZTNA 1JZ7A 2FDIA 3ZYIB 2AREA 2XJTA 4GB32 4JZRA 4JTOA 5A33A 1F2NA 1RXFA 2XHNA 2XKPA 5T5JA 3ZKUA 1C3HA 3U4SA 3C2UA 2DVBA 3V0AB 2MPFA 3PUQA 5DAQA 3KCYA 3WP5A 1F31A 1X8MA 4QX3A 2VTXA 5HBAA 5GZDA 2WFF3 5CA6A 4YZ3A 3DPRA 1NE4A 2WSVA 2VZUA 5CNAA 2J1SA 1OSGA 2VQAA 3H1WA 1X7NA 3ZN4A 4XBQA 4MXVA 4K40A 4FCAA 4QKDA 2HWF2 2GU9A 3LF7A 4JGZC 1KJRA 1PM4A 3AL6A 1RUF3 5J3UA 3OD0A 4XHXA 5FYSA 1DLCA 1HIXA 1HDKA 2GC0A 3GZAA 4QPYA 3MW4A 3MIHA 4BLJA 4FPEA 5ANNA 3O0XA 2VVDA 2VW1A 2K9ZA 1RUD2 4IV1B 1W6OA 4XFAA 1XYPA 4MHUA 1GQGA 4Y5Z0 3E6DA 5FLJA 5A6YA 1JYNA 1DF0A 1LEMA 3KVBA 4MXWA 5K4LA 4K7JA 4PIXA 4ZS3A 4M0NA 3T2QA 3VBUB 3V56A 4JQTA 5FY4A 3RNSA 3CU7A 5CYYA 2F17A 5FYZA 2WNVA 3S5QA 1G9BA 2C1FA 1R082 3CEWA 2J1TA 5K7PA 4XEZA 2EIEA 1HW5A 1GQPA 1REFA 2Q8DA 2AR6A 3VBSA 1KITA 1BQPA 4LIUA 4L2NA 2RJ2A 4LK6A 1S0EA 1Y9GA 1UYPA 3V64A 1D7PM 4B29A 4LBOA 1UYZA 1HRV3 1SBEA 1XYNA 4M0HA 4IGOA 5E16A 4YSFA 4A7ZA 1S2KA 1OF4A 2XJPA 2ZABA 5L7OA 1MQTB 3ETPA 5FFOC 2XVKA 5F5QA 1TNFA 3H1MA 1JH5A 1FYUA 5C9AA 1UOBA 2V4VA 1IS4A 1O4ZA 1PNFA 4XILA 3RZJA 4M3CA 3OUHA 2B7YA 2JECA 3N7JA 3HMYA 2WNUB 4DIQA 1IPSA 1RUD1 3GHMA 1W8OA 2OXBA 1SEFA 1AR93 2W87A 2ZKNA 1WMDA 4Q1PA 5C3OA 3RMYA 2IXKA 3IT8A 4EQVA 5LCWL 3ASIA 5FZFA 2ZGUA 5HCBA 1E5RA 1UKRA 1ULFA 1BEV3 5CKNA 4NE9A 4JGYA 4BB3A 2ZAHA 4HETA 3B9CA 1PMJX 4DRRA 2WA3A 2BP6A 1YQ8A 4KMQA 2Y0IA 3ZYGA 5FZ1A 1R081 2XG3A 4CDWB 3P6BA 3O0WA 3OBAA 1BJQA 1LOFC 3CO2A 5FY0A 3Q8CA 5JZGB 4LOSA 3RYPA 3ZFFC 1XPWA 2PTMA 2QZ3A 3PHMA 3BTYA 1UO9A 1BHGA 3SH3A 3D0JA 1LGNA 4TN7A 4XFCA 4HPKB 3FC0A 2TEPA 1H2NA 3NMBA 4V2WA 1VBC2 4AVTA 3CJIA 4FFHA 2WJSA 1GOHA 3LA2A 2VZTA 3OBZA 1GZWB 5FY1A 4LORA 4EV0A 3S5AA 2UYAA 3AYDA 4LO5B 1NUKA 1GFF2 2IVJA 2R0HA 1U5YA 5T55A 4ASLA 5JLVA 1F8VA 4QX8A 1QXRA 1OLRA 2VOXA 1YEWA 3HT1A 4IE6A 3U37A 1F4AA 2RG4A 1HRI3 2JIJA 3DXUA 5FYMA 3OG2A 3R6SA 4FPJA 1YFYA 1K5JA 4L11A 4YLZA 5A7WB 2WQ8A 3MLLA 5KC5A 4J1WA 1DFQA 1K45A 1A3KA 4DY3A 3GJBA 1RVF1 3KMHA 4YM1A 2QVSB 4K1YA 3NWKA 3A21A 1EYBA 3VBUA 2Z5WA 2UYBA 1LODA 2D93A 4UW6A 1Q8OA 2C5DA 4OMCA 2OUHA 1GQHA 2J7MA 3K2OA 4P9IA 4XFFA 3ZN5A 1OFNA 2NZ9A 4I02A 3W58A 2VMFA 4UAPA 5IVJA 2L9LA 4A3XA 1LNSA 4INDA 2P1BA 1RTVA 3ROUA 3VHRA 4HSLA 4CCKA 4U2AA 4QKNA 5BNNC 5D2AA 1E57A 4META 1RUC3 4N8MA 5F3GA 4AFCA 4COUA 1APNA 4NUBA 3N9QA 3WHTA 4KU7A 4OULA 3EBRA 5C6CA 5J7MA 4KBBA 4PBPA 1UXZA 2DVAA 1VBC1 4IV3A 3RZLA 3N35A 2ZHLA 3PMSA 3AP7A 1W28A 2ZS6B 4HVOA 2OIIA 2VM9A 3HEIA 1LHNA 4IDZA 3VZJA 5EYXA 5LBCA 3UT0A 4YZ4A 2W9XA 4AQ6A 1YFXA 4XUNA 2FCTA 2VUAA 4OI0A 2VE1A 2R6QA 2WC2A 3ZDSA 1VAMA 3M3OA 2BERA 3FJSA 1E5SA 2WNUA 3BCWA 4FOQA 5I0TA 4QKBA 3T1LA 3I2DA 5F3CA 5A32B 2WFF2 3DYOA 4XFBA 3EMRA 1FPN3 3MW3A 2VBBA 3K48A 4PIZA 3CQOA 5FRAA 1REDA 4XHBA 4FT8A 2DV9A 1W9SA 1XSQA 3GCWA 4W8JA 3SH5A 2HLEA 2HWC2 2G9ZA 2D98A 4L92A 4LK7A 4PLOA 4YM3A 2P5BA 1QJEA 2A6XA 3PUHA 4DXRA 3M3EA 1CAUB 2GAUA 2YUEA 3B01A 2I2SA 3POFA 5FP3A 4L99A 5I0RA 2Z69A 2X5IC 4N43B 1RUF2 4BQ5A 2ETEA 4CDWA 5D21A 4O61A 1LULA 2QCSB 1ST8A 2XDVA 5A3MA 3SEPA 1XRUA 5CVRA 3LSDA 4HPKA 2HJIA 3ZFGC 1H9PA 3IBMA 1N3PA 3AYCA 3ZYBA 4XJ9A 5K8SA 1DGRN 2DCZA 1X50A 4MGQA 1ENSA 4EYUA 1GZWA 2TBVA 4QX0A 3M7AA 1RUOA 3VHPA 4FTEA 1OUSA 2D3SA 4B7KA 4V2VA 5LEKA 1SQ4A 1WD3A 5JOXA 1O3QA 1DGLA 4OFGA 4P9JA 2BWCA 3HNMA 4H2AA 4IEPA 4IUGA 1ND3A 2VQTA 3UKNA 1RJ7A 4BM8A 1UZZA 2QKDA 4Y22B 5B2GB 2R062 4LBJA 1GP4A 1UYXA 2WS93 4M3CE 4WVMB 5A3PA 2YYOA 3LFIA 2WFF1 2ZCWA 2QTWB 5D8AA 3VDDA 2QQVA 5J1XA 1JU3A 4Q29A 1HRV2 2WWSA 2C26A 4BXFA 2E26A 1TMF3 2JXAA 1UY0A 4GMP0 1WLWA 4RS5A 5LBBA 3D5OA 1F5FA 3B02A 3ME2A 1DYKA 1W0PA 2BVVA 1RUF1 1UF2C 3FLRA 5I8SA 3AL5A 1VMJA 3IB3A 1WWYA 3IAQA 4AVBA 1H2MA 4EN9B 3LIGA 1ZZ8A 5FUIA 3VBOA 2YB7A 4IE4A 3ABZA 4RSUA 4Q4V3 3WDVA 2BNNA 4FQ4A 2ZHNA 4UW3A 4XCBA 1W2NA 4OZXA 1GP5A 4FPFA 1AR92 2DYCA 3LD8A 3POWA 2CNAA 5BPXA 4LMFA 1VAKA 4ZZ8A 3PIGA 3ZKYA 4CUGA 3HT2A 3ILFA 1LOAA 1WW4A 2BNMA 4QPIC 2VY0A 2A70A 3MGUA 4UT5A 1Z7S2 4AE2A 2IVIB 5TSWA 1OA4A 4N7IA 4FAHA 3PVEA 2XPJA 4OYUA 4WM7B 1AHSA 1B35C 2UWBA 3NKTA 4FI9A 1VAVA 1JN2P 5LATA 1UIJA 2XL9A 2R061 4UW5A 5FXXA 1K12A 1QXJA 3N3HA 4AW7A 5A3TA 5EP9A 3DKQA 4BQ1A 4CUAA 1OBNA 1W6PA 4HANA 4Q0VA 1EPWA 4FFGA 1HRV1 5IT6A 4IE5A 4OZOA 5FO9B 2FDJA 2W68A 1GANA 2Q5TA 1LR5A 4CDXA 3AVSA 2DFCA 2HBTA 4OUEA 4P9XA 2Y34A 2J22A 3WXPA 5FPZA 5JXJA 2DCKA 4PDWB 1K3IA 1YI9A 4L8QA 1HN0A 2QQIA 3VKOA 1HRI2 5A6QA 1F35A 2HWD3 4QD2A 1V6IA 4COVA 3S0MA 1DHKB 4Q0QA 4LKFA 2JDNA 2XUEA 1FX5A 1QQP3 4W6YA 5C4WB 2WYFA 3NRUA 4I3GA 4UI9L 3WQ0A 5K0UC 5HCHA 1AR91 3MV01 3VV1A 4A3ZA 2PHRA 3O1MA 3MHZA 2QQPA 2JD4A 5CZKA 1D2QA 4YG0A 5T52A 5FO8B 3FUOA 2Z79A 1BEV1 3IZOA 3MIBA 3VD5A 2CGPA 4DNYA 2QZ2A 1ULEA 5T3NA 3AP5A 1L7LA 3VKLA 2ZAAA 2BEOA 5FLIA 4J25A 2R49A 5FPLA 4CZSA 3CF6E 3WSOA 4WVMA 4WBBA 1OF3A 1SLLA 1C4RA 5A3WA 3ILNA 5T5OA 5I0DA 3DN7A 4AYUA 1RUC2 3U1XA 2A1XA 2RDSA 4M01A 4MZUA 1TG7A 1RGSA 4BQWA 1HJGA 5JAXA 2F4PA 4BDVB 3LE0A 4CDQC 5ACA3 4RQPB 4BE3A 4OHWA 4YGBA 4FQZA 5SV5A 4FXGB 3QH7A 4Y4YA 4L9BA 2P4EA 1BVVA 4ORFA 3I2KA 1DG6A 5CAZA 3WNOA 2JDAA 3WG1A 3ZOIA 3DYPA 2WZPP 2VOVA 1OOPB 3N9NA 4ISQA 2X05A 2JG8C 1UNBA 4MV2A 1WCUA 1HRI1 4UFLA 4ZKTB 4A42A 1GYKA 1PVXA 2WABA 2WO3A 1W6NB 3E97A 5CFDB 1Q8PA 3U4XA 2VNVA 1ZVFA 3NSTA 4Q4X3 1CIWA 1LECA 2YGMA 4BLIA 4DPNA 3P5BA 4C1XA 3EYPA 2QFEA 2P3JA 1EV12 4O9GA 5LK7B 3ELNA 4NRPA 2BDRA 2UY8A 4BPZA 4FBFA 4B4QA 1SG3A 1WLDA 4QU1A 2R30A 4EN7B 5CEHA 1J1TA 5I0UA 2FDHA 4AEMA 4GD4A 5BXXA 3ZYJB 4HOOA 2K0GA 2UURA 3I54A 4QMAA 3WQBA 3O1OA 1IPKA 4QHZA 2W1QA 1DBNA 1CPNA 5JI9A 1CX1A 1RUC1 4GJYA 3UK9A 1UOJA 5JIAA 3C3VA 1O8SA 1W8UA 5FK8A 2OS2A 5E1RA 1F4HA 1NZIA 4YZ5A 3N9OA 3H1YA 1ZNPA 2O1QA 2AGSA 4NIAA 1L3JA 3FLPA 4HBNA 1FNYA 1M06G 3HNYM 2V4AA 3ACLA 2XBO3 1CQ9A 2JDMA 5IAXA 1IKQA 2XQXA 1DU3D 2VQUA 4HLTA 2YZ4A 4AQSA 5EHDA 1AYM2 3RDIA 4W6WA 1HB4A 2VCAA 3ZSMA 1DZQA 3C7EA 3U0ZA 2ARCA 2Z2SB 1FPN1 3LPGA 5LWBA 5IK7A 5F2SA 1LEDA 4G9SB 2DU0A 1CWPA 3I4IA 3ACHA 1J3RA 5FUPA 3BOPA 3O5SA 1OQEA 1ULDA 5DG2A 4H7LA 5D1IA 2ES3A 2KD7A 4IEXA 4COWA 5BNOA 3VZLA 1ZRRA 5A80A 2NYYA 1A8DA 2E33A 5FO7B 4YW2A 2BZDA 1VRBA 1YLLA 3TYJA 3MICA 1VBA3 1OURA 3J8F3 1PZ7A 3K3OA 3VD3A 4JAAA 1CN1A 1SDWA 4DY5A 2VPVA 3KV4A 4BK5A 5A1FA 4Q2FA 3I59B 3KT1A 4FP2A 1F15A 4AFAA 3WINE 4I30A 3MIEA 1OQDA 1P8JA 2IUWA 1LAJA 4YVWC 3VBFC 2Y6LA 4BMBA 1KGYA 1N3QA 1S0CA 1LTEA 1CPMA 2WINB 3KV6A 4H3WA 1QHDA 3OGRA 3EXUA 2VUDA 2XL7A 2VW2A 4ES9A 5IFPA 3FHAA 1MZFA 2P37A 3ZMNA 2RDQA 2WS91 3TN93 3TEZA 1NZCA 2ZHKA 4M4PA 4RGGA 4LBQD 5CG9A 2O14A 5FJHA 3UL2A 4XMIA 4LJHA 4XUOA 4QB2A 1JYVA 5LK5A 3ZN6B 1BBT3 1TMF1 2WLQA 4MGZE 2XGXA 4GKYA 3AZZA 3S6PA 2B45X 2BW8A 1ENQA 1O4TA 2QDNA 3WLUA 4E8DA 3K75B 4ET7A 4CEWC 4TWTA 5JOWA 1UW8A 3RI8A 2UWCA 1LHVA 2EICA 2VZ1A 2A6YA 5HV0A 2UWAA 2XXZA 4FP3A 1NA1C 4NVPA 4LBKA 4CVUA 4GMP3 1Z78A 2HWD2 4YARA 4AEDC 4Q4V1 1GNYA 1QQP2 2OVUA 3ZXKA 4OQ8A 1KJLA 5DZGA 3Q8BA 4WV8A 2WO7A 4EROA 4DUXA 1SLIA 5DQ0A 1QJZA 3TB0A 1UZVA 4KU8A 4XF3A 2DF7A 2YHJA 4IE7A 4XDOA 2WWJA 5F7UA 5DUUA 3ACIA 2J1AA 5CKQA 1XE7A 4S2HA 1RHI3 2Y64A 2VQ0A 4RR3A 3WW3A 3RMXA 4R9AA 4AG4A 4Y1XA 1GKBA 4FOVA 3USSA 1MEC3 2O0OA 2EAKA 3HJRA 4K3UA 1Z0HA 2ZX1A 4QT6A 3ZFFB 1OI6A 1RJ8A 5F8PA 4A7KA 1LB2A 4EZHA 3FL7A 2JENA 4CCJA 1QY4A 3JXSA 3THCA 2HYXA 2J1EA 3N7LA 4NHKA 1PK6C 1YHFA 5ACA2 2YU2A 1IS6A 3LZZA 4AHYA 3HOBA 3TRSB 5A7NA 1OFSA 4P14A 4COYA 1PGSA 4JDNA 2E9QA 1UY3A 3H9AA 5F5IA 1RC6A 1VBE3 4RN5A 1JW6A 5GLWA 1PGW2 2OZJA 2WNEA 1V0AA 1OVPA 1BMV2 3JBG3 1STMA 5IFTA 2MNGA 4KG0A 5J09A 4BIOA 1O3RA 2HWD1 3CHXA 3KSCA 1R092 4MO3M 2WN3A 3LIHA 4UYBA 5FLHA 3I7DA 2VMDA 3RJ2X 3BKZA 4JTNA 1YNAA 1QQP1 4Z1VA 4Q4X2 3WNLA 4BOWA 4IEVA 1H6YA 2PFWA 3R4UA 1Y9QA 3RJRA 4P5HA 3VBHC 2DU1A 1G9CA 5EQUA 4AI1A 4E8CA 2C9AA 5FPBA 1NLRA 1PO13 3M3IA 2FMDA 3LB9A 3LWCA 5C3SA 1D4VB 1RUG3 4LO8A 1ND2C 2ZXQA 1W3XA 4O7XA 4OHXA 2VVFA 5LRRA 5FZ4A 4DO0A 4YM0A 1NYWA 5B4XA 3ZXEA 5JMCA 5GALA 4FSJA 2D6MA 1LKNA 5DUXA 4LR4A 1RUI3 5H9QA 1HV1A 3AC0A 4KWKA 3VUOA 4LULA 1W9WA 3USUA 3J7HA 1LJ7A 3ACFA 3LDRA 1ALYA 4XXAA 2WQ4A 5ACA1 1U5IA 2I74A 3FHIB 3JUUA 4ZPIA 1FAYA 5J36A 1S1AA 1DCSA 2WSUA 4ITCA 2XBO2 2G19A 4YM2A 4P9YA 3LSEA 2NQYA 4HK9A 4CCOA 4N53C 1PGW1 1DDLA 1HN1A 3WF2A 4MGIE 1AXKA 3Q9OA 3TAYA 1BMV1 4LNVA 3B3QE 2BFUL 2QQOA 4NIHA 1FOD3 2BQPA 1X9PA 4QB1A 1Q5OA 1DQ4A 4UOJA 3SMHA 1QWRA 2WT0A 3A22A 1VP6A 1GNHA 3ZXLA 4Q4X1 1G9DA 1AXYA 2WA4A 2ARXA 3KM5A 1GWKA 2R32A 4KWJA 5FY7A 4AHZA 4FPHA 5CFCC 2ZMNA 2A6VA 2X5IB 5FDBA 4XFIA 1SCSA 1UCXA 1LOFA 2WZR3 1DQ0A 2Y6KA 2D43A 4MADA 2JE7A 1G6NA 4URAA 4CP9B 2PHTA 3PUIA 1CX4A 4AVAA 2WL1A 1QDOA 1JU4A 2FZ1A 4NHXA 3ZFEC 2LM3A 1VBA2 3ZFGB 3J8F2 3NV2A 1S4CA 3ALQA 4A41A 3MUY1 5FYHA 3IPVA 2HEVF 2WO1A 1ZREA 2DBIA 2JDKA 1KQRA 3P3NA 3POSA 4OI2A 3WVJA 4LBNA 2CYFA 4Z2AA 4Q4Y3 5FK7A 3J26N 1CIYA 4IE0A 4XW3A 4NJ4A 1A6CA 2VZVA 1ULOA 1X8EA 4XAAA 1QEXA 2DCYA 2XBO1 2R043 4MVTA 3MIFA 2ET7A 1OPOA 1YIPA 4N9HA 1BKZA 1W6QB 4FTBA 3AKPA 1XNDA 4A6SA 5A3OA 5C8CA 1JXNA 4EWDA 3CZUA 3NNMA 4BQ2A 4KWUA 1K5MC 5KHGA 1C28A 3TN92 5IK4A 5FZ9A 1XU1A 1UD1A 2QE3A 2ID4A 1ZBA3 5EFUA 3GDBA 2VCBA 4Q8LA 3WW4A 1POV0 1N1SA 5T50A 1O8PA 1JYXA 2GC2A 3IDEA 4IL7A 3POBA 4R4ZA 1GP6A 3VZKA 4F83A 5FZDA 1CZVA 4ZXKA 1NCQA 2GP5A 2KR2A 2V73A 4JRAA 4XF4A 1UKGA 1WGPA 4Z07A 2V5YA 2PMWB 1WKYA 4Z82A 3HQRA 4CP1A 5FZOA 1UWWA 2CDOA 2AEYA 3HNBM 3GCXA 3N9PA 4MGYE 3O1UA 3OEAA 5FZMA 1VBA1 3J8F1 4AEJA 3K4ZA 4XE9A 4GH4A 1XC6A 4CP2A 1I6XA 4AWDA 1T2XA 3FLTA 1UMHA 1V6KA 4QPIB 5AFEA 2IXCA 3H7JA 5FYYA 3O1SA 1ULPA 5FMDA 4LT5A 3ZMOA 2W1SA 4O9EA 1MEC2 3NO8A 2LUWA 3NNGA 4R4XA 2D5FA 1UQXA 2RS33 3UJOA 1YFWA 1TZOA 4AHXA 2ZJCA 5CADA 4X6QB 1QMJA 1XU2A 3ZLIA 1J3QA 4SBVA 3TN91 3T4VA 1FMD3 3IDBB 1W8NA 2QQJA 1UOGA 4AK3A 1ENXA 1D4M3 3NV1A 3ZXFA 5F3IA 5FCCA 1RVF2 1D0GA 3H8UA 4XOGA 2ZGKA 5M0TA 1BBT1 4GKXA 4QX7A 5IVBA 1CONA 5IK8A 2EIDA 5KHHA 2VO5A 1VBE2 2X09A 3L2HA 4XPVA 1W99A 3V0AA 3CL1A 4Z8BA 4IGQA 1PHMA 4OQ9A 2CU5A 3ZIWA 2JG9B 4J1XA 2IXLA 4QPWA 3H8OA 4XUTA 5BUVA 4N7UA 4Q27A 4GMP1 4HMZA 1WD4A 1ZZ6A 2XQRA 5K0UB 2ZGSA 1UU6A 3HAGA 4URTA 4Y24A 4HKWA 5BNQA 3OTFA 5FXWA 3GNEA 1KFXL 2JB8A 1W0OA 3Q8AA 4EJRA 3VZOA 3BGAA 1I1EA 1GU3A 2AYHA 3CBNA 3TNQA 2ARBA 2YG0A 3AP4A 1C5HA 3OUJA 4CA9A 2PHWA 2YY1A 1GZTA 1PO12 3DECA 1GWLA 4QQOA 5C5UA 1AYN3 3NNJA 1RUG2 1RHI1 3PIJA 3TWIA 3WG3A 4XCAA 1NE6A 4YW3A 5FQ0B 4YFZA 4QGMA 4DZGA 4P5YA 3RZHA 3SLIA 4UBHA 5IJRA 1MEC1 2JKXA 1PO23 1C8M3 4Q26A 3VD7A 4AAPA 2GMPA 2GH8A 1RUI2 4IV1A 5LZ6A 1CESA 3DF0A 3GALA 4K1ZA 4PQQA 5FPXA 1RYYA 2VJXA 3BTXA 2IXIA 1HV0A 5A6ZA 2CWSA 5LY2A 3VL9A 4CDQB 3B9IA 4QB6A 1IZ3A 1MACA 2XUMA 1F9KA 4XC9A 3OUIA 2KXLA 2DWRA 3DPRC 2VZSA 4OI1A 1ODMA 2W52A 1VBE1 3GJAA 1A78A 4YGEA 1S2BA 1OD5A 1IKPA 5DZEA 2BOJA 1HB1A 1JHJA 2RJLA 2E53A 3VZMA 3JBG1 2JG8B 3K51A 2VTFA 3IM0A 2GMEA 1FOD2 1H4HA 5EXOA 3VGIA 4DOUA 5DAPA 4XF1A 5JPMB 1JZ5A 2AC1A 3BN6A 3WNPA 2YBPA 1KDKA 1OC1A 4LIVA 4Y26A 4BCUA 4NN0A 5FP9A 4XABA 4NPLA 1BK0A 1J3PA 4HK8A 1W90A 4XURA 3ZXAC 2EXIA 2ZX2A 1C1LA 4YNIA 1VMHA 3G6JB 2Q0AA 1PO11 2VMEA 2WZR2 1MQTA 3AM2A 1DYOA 5BNPC 1RUG1 5L19A 3OCPA 3CJXA 1TME3 4YZ1A 5ABJC 4RGKA 4NMIA 4S2GA 5FMBA 4NIIA 3H42B 3POEA 1X82A 3LOBA 1EP0A 4R52A 1BK1A 4NRMA 4MUVA 2JDPA 4PIYA 3W59A 3KS7A 1GMMA 2XWBB 1H1AA 1AX2A 2WNVC 1ZZ7A 1RUI1 4TZDA 5FREA 1UX7A 3NW4A 5FPVA 2OKXA 3VBSC 5ERLA 2HH9A 4Q4Y2 1MPXA 4G3YC 2W2IA 2YMZA 3WUDA 5IVFA 2CGNA 3PDQA 4ZZ5A 1J58A 1RMU3 4GQ7A 1QNWA 2WT1A 3ZSJA 1OMIA 2JG9A 2R042 2ZEZA 4Y1UA 2IC1A 1PGL2 4YFWA 2NMOA 1J83A 4A44A 1HJFA 3MYXA 5FZLA 1OH3A 3ORJA 4XJZA 3GBGA 2XH6A 2RMU3 3M8LA 5JZGA 2E7AA 4D0QA 1W9TA 1FOD1 5L7OC 5H9PA 1WBLA 4LA2A 4E2QA 2HWB3 4KGGA 4HFSA 3ZR5A 1AR83 5IYYA 3H3ZA 2ZMKA 3DV8A 5JSPA 1W2UA 3OGVA 4NAMA 4QM9A 3IIAA 1XNTA 4AFMA 3P3PA 3T2PA 1A34A 3ZXDA 1B09A 1XNAA 4RGAA 2ZBJA 1WLTA 4DEVA 2EIGA 4YVSC 4DEQA 3AK0A 5FQ0A 2N7GA 4IXLA 4XTMA 5G04L 1N1VA 2WZR1 1Q8SA 2VNRA 3HWJA 4BJ0A 1I3HA 1RXGA 2JDUA 4EN0A 5IVYA 3SCHA 4JGYC 1CZTA 2QQNA 5FPAA 1T6GC 1VRH3 5FTTC 4OCTA 4BQ4A 2ERFA 4LKSA 1YQ2A 3WCRA 5A7WA 3BU7A 4BU2A 5AVAA 4GULA 2LROA 3ES1A 1X9TA 3ZIXA 4CCCA 3T2OA 1US3A 5FOJB 4YW4A 3J9SA 5FZ6A 1G9AA 2G9GA 4Q4Y1 3RZZA 2VG9A 4S2DA 2GC1A 3UYJA 3VBFB 5HXMA 3M70A 1HLCA 1US2A 5A7SA 2GP3A 3ILRA 2FD8A 4IETA 3WP6A 2ORXA 1TNRA 2Q8OA 2R041 1I9RA 3CJIC 4FFFA 2JG8A 1PGL1 3AKRA 3W5MA 2RS32 3O1PA 1S55A 1H8TC 5A1LA 1VPHA 4Q5OA 4BIFA 4GALA 2W1UA 3I8TA 5FXVA 5GJ6A 4CCMA 2ADEA 3RZGA 2VH9A 2ZOEB 1AZDA 1FMD2 1SMVA 3OJBA 1ZBA1 1C8NA 4JDMA 1D4M2 3B5LB 5T5LA 3B93A 2OT7A 1G8WA 2ZGOA 1V6OA 5FWEA 4UFJA 1Y7BA 4CEWB 4JV4A 4FPKA 4P9GA 1BEV2 3MF6A 2YU1A 1U5ZA 1XQNA 1POV3 4QGLA 2NN8A 1NA1B 5FXZA 4I01A 3THPA 4AEDB 1UU4A 1OVSA 3HBKA 4W4ZA 2D6NA 5A32A 5FZEA 1H6XA 5L9RA 3LEMA 4BA6A 4CU8A 3ZR6A 3OBRA 3TNPB 3PMEA 1GICA 3PL0A 4E4ZA 1C5IA 1NCRC 3RWNA 1LHUA 2D6OX 5AC93 3D6EA 1CAUA 3OD4A 4UFIA 1AYN2 3LKJA 1JUHA 2B46X 1QKQA 1N47A 3KF3A 4NO4A 4N43A 2ZEXA 4CXXA 4CU6A 4LHLA 3PVBB 1H4GA 4IV3C 1MVEA 5FKBA 4MOAA 2RS31 1C8M2 5DAXA 3T4HB 1AUYA 2C24A 2YPJA 1J1LA 2XLAA 3HN3A 3N7MA 4HONA 2OX0A 1WCDJ 4W6XA 4ZS2A 2Q8EA 4EN6B 1W9FA 4AGVA 3R0RA 1IG0A 1FMD1 4EWEA 1PK6B 5DUWA 3QH6A 3J7MA 4DXZA 4FFIA 2AZ5A 4PI2A 1D4M1 2Q4SA 4SLIA 4MYEA 4XDPA 4PJYA 1W03A 5C3QA 1UZWA 2ARAA 2Y33A 1JS9A 2BNOA 3AP6A 3ETQA 2ZX4A 4LLOA 2DVFA 3SC7X 4HG6B 3HD8B 5E88A 5AFBA 4H55A 3RWKX 4FPCA 4OUMA 4CXWA 4D69A 5JXIA 2YC0A 4PCRA 2D5HA 4XBLA 4F7ZA 4Y22A 4E9KA 2D6KA 1VIWB 2WFPA 2Y8KA 4CDWC 5GZEA 2UU8A 2BPA2 1NXMA 1U5XA 5I8YA 1QJU3 2DCTA 2JE8A 3VD9A 4BWOA 3VBHB 5LBFA 3ECQA 2XJSA 3JB8A 1CAXB 4HL0A 3CZJA 3NJYA 1UX6A 4K20A 2XMLA 3MDPA 1BYHA 1LU2A 3VBRC 1CJDA 1VBD3 1ND2B 1AYN1 2SBAA 4CCDA 2VD7A 1EY2A 3KT4A 1TME2 2PHFA 1NY71 4LUKA 3SNMA 3WNMA 1JBCA 3KWVA 1VJ2A 2SLIA 2Y6HA 4QGNA 4YRDA 4BHPA 1XNKA 4XDQA 2IZWA 1PO21 3V0BB 4UF0B 4Z92B 1C8M1 2OUJA 2J42A 2XWJB 4IQPA 2NP0A 2IFRA 2VZ3A 1AR73 1FPN2 3VDCA 4BYYA 3KLSA 4IESA 4CE8A 3INAA 1ND3C 3OGJA 5A3UA 4KQ7A 1RMU2 2BBVA 4Q1RA 1DZTA 2XJUA 4UXAA 1OPMA 4B7EA 5D8AC 3VDDC 3PJYA 1W8TA 2R073 3K4AA 4N53B 4CUBA 1JZ3A 5LA1A 2W91A 4ATEA 5FZ7A 3O7OA 2LS6A 2Y6FA 4QKFA 4WM7A 1QNYA 2RMU2 5GLTA 3RQ0A 4RS5C 4EZ4A 2WIIB 1GUIA 1LGBA 1H0BA 5GZCA 3NNLA 5C3RA 2HWB2 2PQQA 1V9U3 5IVVA 1AR82 3C7GA 4PLMA 1LU1A 3AJZA 3NJVA 2BGCA 2WUHA 2FCVA 5F5AA 4B4PA 1XNCA 5CFCB 3VBOC 4U36A 4QQPA 2X10A 1WW6A 3URFA 1UXXX 5DZFA 4GAZA 4M3CF 2E32A 3KZ4C 3K3NA 4LE3A 3I3BA 1H2LA 4CEYC 1TME1 2RV9A 4FPOB 3UJQA 2PHXA 4PDWA 3N36A 3V65A 5F5CA 2BTVC 4PF5A 1VRH2 3CLPA 3ZFEB 2WAAA 5HCAA 3NNFA 5IVCA 4R9CA 1PK6A 4WM8C 2WS92 4NHLA 2W08A 4Q4W3 1QJFA 4QQLA 4TLGA 5C4WA 1MS1A 5LA2A 5J98B 2E6VA 2D6PA 5A7PA 3AZWA 3PU8A 3MLJA 1W2TA 1RMU1 2GSYA 4P9WA 1OLQA 1TMF2 5IVEA 1YUDA 2VUCA 4AZZA 4W65A 3FX3A 3BVCA 3FZ3A 4JGZB 3GHNA 4E2SA 4GIQA 2W95A 3EO6A 5EPAA 1N1YA 4AI9A 5L9BA 1Q56A 4JX0A 5B4NA 1UZYA 4E4DX 1K5MB 5IK5A 2RMU1 5EJZB 5DN2A 3TEXA 4CDXC 2VW0A 2VULA 4PBOA 3UKTA 1PVC3 1D2SA 4Q4V2 3T30A 1JYCA 2HWB1 4OHVA 3ENRA 1AR81 3NAPC 3QD6A 1GWMA 4A45A 4AVCA 3RPQA 3AP9A 3VHOA 1Y9MA 4RQPA 1NLSA 2QQWA 3GZUC 3AMQA 5CB7A 3W21A 1ZZBA 1RUE3 2NLRA 4XIKA 3W9AA 4CYDA 4OHYA 4GB33 2BOIA 5DXDA 4I2OA 2GC3A 4RL7A 1WBFA 1V6NA 1QIQA 2JKBA 3OY8B 3R4SA 3MI8A 4FXKB 4GJZA 4NPMA 3LQCA 1Q3EA 1OOPA 2FDKA 5LY1A 4Y3OA 5FP8A 1VALA 4B8EA 1VRH1 1WMFA 4AI8A 2E63A 3C7FA 4E2GA 4D6QA 3I49A 1S2EA 2VMCA 4I09A 1W6NA 5CFDA 3WDTA 1Y43B 1TQ5A 2GNMA 2OQ6A 4H14A 1JHNA 5AC92 3WG4A 1V6LA 4N53A 4CU9A 2DFBA 1PX3A 2RHPA 4E27A 1FNZA 1SBDA 3OB8A 1U12A 2PLV3 3OEBA 1PMHX 1CAVB 2HEWF 2W1WA 4D8MA 5KXDA 2HWF3 4O65A 3FHQA 2WR9A 3DXTA 4GWIA 1HX6A 4MSVA 1NG0A 3N7KA 4MG2A 5DG1A 1PNGA 3SEEA 1HKDA 2YFZA 3H50A 4AFBA 4BXSV 4DMIA 4XZPA 4FOWA 3T0DA 1MZ5A 1AX1A 4LE4A 3UGGA 2H0BA 4Q8KA 1ONAA 2VAUA 3PTYA 3WDUA 3ZPYA 5ISLA 1XSRA 2GNTA 3OGGA 2YFUA 5JVVA 4I0BA 4B3NA 4I0WB 1X36A 1OXCA 1IS3A 2WDBA 4MLOA 4AI3A 5C7GA 3KGLA 3T08A 3PLQA 4Q0PA 1YWKA 3U78A 4DUWA 1RB8G 1POV1 2ZKLA 4D7YA 2W0XA 4UFKA 3H8XA 2ZX0A 2VCMA 1S0BA 3BTZA 1MS8A 2X8KA 3RRDA 3HPNA 4FO9A 4QDSA 1UMZA 1T6BX 1HXS3 2D97A 5CIRA 2OYZA 4PT6A 5JR7B 3UGFA 4MGSA 1V70A 2RDRA 4PLNA 3OGSA 2XHKA 3AKSA 5KHKA 4R8HA 1QJU2 2UY9A 4C0BA 5I93A 1JZ8A 1G9FA 3HN1A 5F1RA 3CMGA 2WLPA 4YYOA 5LA0A 2OPWA 3LPFA 1G86A 1IHMA 2ET1A 5AC91 3D0SA 4JGZA 1VBD2 4AXOA 2B8MA 2VZRA 2VVEA 2W47A 5F2WA 2PA7A 1ZRDA 1O5UA 2ZZQA 3O1VA 5FAXA 1D0HA 3WG2A 5EJ1B 2ZPXA 4JQRA 2VZQA 5FZHA 3OOXA 5FMOL 4NHYA 3FFQA 3UESA 1KS5A 2KA3A 1WA4A 4C90A 1AR72 3AKTA 3A0KA 2F4LA 3LEGA 1UZ0A 2RR13 4YWAA 1XB9A 4LO6B 3I59A 3KCXA 4X8NA 4E4HA 4GA9A 3ES4A 4MX3A 3ZYHA 3C8XA 1GR3A 2FHRA 2GMMA 1DYPA 2X29A 2PHLA 3DPRB 2JE9A 3L2YA 1FT9A 3IMNA 2BGPA 3WDXA 2R072 1JYTA 1LHOA 1WLCA 2Y38A 1TEIA 2F6BA 1ZM1A 1QJY3 2Q1ZB 5EJ3A 2YBSA 3THDA 1YQCA 2HBUA 5EZWA 3ZSEA 4BQXA 4RHV3 3M2MA 2J1RA 1S0IA 5FYTA 3SQOA 3CNAA 3AB0A 1V9U2 1A8MA 2WKKA 3BODA 3BYWA 5CU1A 1LESA 3UV9A 1VE0A 4ASKA 5BNOC 3GYDA 2WWUA 5BNNB 2VBDA 3S30A 4G4FA 1QJU1 2B5HA 1XE0A 2VZOA 2BU9A 2XJRA 2Q1MA 3KB5A 4I3PA 5FZIA 3WW2A 1XOYA 2TNFA 4XJ8A 5F6KA 3ZN6A 5LW9A 3VDBA 5LRSA 5BNPB 4MXWB 1VBD1 4FAGA 5FZCA 1ZRIA 4GWNA 5GZFA 3KV5A 2GN7A 1GV9A 3MW2A 5ABJB 5HXVA 3KCCA 4QQHA 1FV2A 5A70A 4XZUG 1IOAA 4LTAA 3U75A 5SV8A 5APAA 3RYRA 2Q1FA 4XF0A 1UMIA 4COZA 2WNVB 1CR7A 3AXEA 4JHTA 1AR63 1QGLA 4Q4W2 1NQJA 3OYWB 2YBKA 3TBDA 3ZXJA 4B1LA 1AR71 2ZEYA 3VBSB 1S0GA 2LTNA 4DINB 4KG8A 3AJYA 3AX4A 3JQXA 3UGHA 3AKQA 3WP4A 5FYVA 3VKFC 2EA7A 2VC9A 2YPDA 1GNZA 2R071 2VGDA 3MPBA 4MH0E 5DDJ3 4YG3A 1V00A 5JXGA 2EVXA 3J7LA 4WVZA 3VKMA 3LGRA 3L9JT 3MIDA 4QXCA 1QJX3 3ZFFA 2D3PA 4FVVA 3WR0A 5C8WA 5L7OB 3MBWA 4OLLA 2V5DA 4HN0A 1SBFA 2O8OA 1PVC2 2YC2A 3AFGA 4XYXA 4FOYA 4JDOA 1V9U1 1WCQA 2RJKA 1MS0A 3SXWA 3IKWA 4M3CB 4XETA 3RFRA 2BFUS 4LHNA 4Y1YA 1OQ1A 1XE8A 2VOWA 2P34A 1QOSA 4P02B 1MZEA 4YVSB 1RUE2 3WHUA 3POIA 3C7HA 3FBMA 4Y20B 3LDKA 4BQYA 3PVNA 2AUYA 5BV6A 5FBJA 2XB6C 1QH6A 4FPLA 4C91A 1KD7A 2XOMA 4XF9A 3H8RA 2RS13 5HI0A 3SKVA 2QQUA 2QBXA 4JGYB 4PI0A 4XUQA 3R4DB 4RR3C 1PMIA 1LHWA 3ACGA 1O4YA 3O12A 2Q30A 5GLVA 2OPKA 2MEV3 4Q4W1 1MVQA 1JODA 3GM8A 2WNOA 1QDCA 3X29B 4TXWA 3SCGA 4IERA 2PQSA 2V72A 3Q8FA 3MF9A 2BUKA 1BBT2 3FN9A 1W2AX 3OBTA 1LOCA 3PTRB 3I2OA 5FR3A 2HWC3 2Q8CA 2PLV2 1KS4A 3CJIB 1ZRFA 3W20A 5BY5A 3ON7A 3DEMA 2VBPA 3HVDA 5FP4A 1H8TB 5GLUA 1I5PA 5JR2A 5H9RA 4ATFA 1EPZA 5J37A 4NWWA 1PIV3 4XIOA 2CGOA 1BCXA 2ZACA 5BNNA 5CKMA 4AFDA 2FQPA 4AQTA 1URXA 2DTYA 2B9VA 1PVC1 3OPTA 2FDGA 1LOBA 2PYTA 3MO4A 2CL2A 3M4FA 2WRAA 5DUVA 5BNPA 4CP0A 1JOPA 2PAEA 4KNCA 3A23A 3DCQA 2I07B 1RUE1 1QOTA 4WZCA 1RUJ3 4WVWA 5ABJA 2Y60A 1YYNA 4GB31 1RHI2 2WO2A 1ZZ9A 5T54A 3H0OA 2IFWA 3F95A 4JKMA 5A7OA 5IAVA 1NQDA 2VCCA 1B35B 1HXS2 4UBGA 1ZBE3 4QPGC 2BBAA 3OYWA 2NM1A 1PZ8A 1VBB3 4LQRA 4D7SA 1OT5A 2R063 1GZ9A 2BYVE 2A7AA 2AH2A 1NCRB 3O0VA 3OPZA 4XJUA 4D6RA 5GM0A 3IAPA 3MLKA 2PAMA 1H8VA 1E5IA 4M4RA 3DGTA 3I2IA 3K46A 1DP0A 2CWMA 2X5IA 2DUOA 3EQEA 4KI5M 4AR2A 3I3QA 3E1F1 2PLV1 1SLBA 3R05A 4IV3B 4KBZA 1WA6X 4CP9A 1XBFA 2HWF1 3GZTB 2IWGB 1W39A 3JBG2 4KL1A 1SLCA 4QX5A 5HCFA 1O6UA 3ZFGA 4DRVA 3WF4A 4CCNA 3LOIA 4AEKA 3QLQA 2RR12 2Y0OA 3NJXA 3KGZA 4XQ4A 4LITA 3RI9A 3S7EA 4KGQA 3EHKA 4YVSA 1ULCA 4S2FA 4DS0A 1NOVA 4LBMA 4CDUC 4Y20A 2BJSA 1PM7A 3BALA 5LASA 5KWRA 1QJY2 4HKOA 2CTVA 1W6QA 3BTAA 3IWZA 1GZCA 5F3EA 5CISA 2GNBA 4RHV2 2EAAA 4LUMA 1Z7S3 4ONUA 5DAVA 4A2UA 4C1WA 4ZU7A 1JZ2A 4P9LA 3RYKA 2PAKA 4D3WA 5G05L 2ORZA 1NT0A 1HXS1 1AL23 2E7QA 3IN9A 4JRLA 3GXUA 4MGKE 5FKCA 2QQLA 5F9TA 4QX2A 4P08A 4WVVA 1XJAA 1AXZA 4GWMA 2GDFA 3B7MA 1RITA 2ZGMA 3MPPG 4UWDA 1G7YA 3FUQA 5FY8A 4AI0A 4EWAA 2DBNA 4FTSA 3Q8EA 2VL4A 1CVNA 3QBQA 4W50A 3ST7A 2XONA 3VBRB 3P1IA 3PNAA 3VN4A 5FIXA 3AZXA 1NLQA 3WF1A 2JDZA 1H8TA 1ASJ3 3I2JA 2W3JA 3ZYFA 2JX9A 1V6JA 3MFCA 4X8PA 2P3KA 1XXNA 4R9DA 1OD3A 4AHWA 1KXGA 2XLFA 2D7FA 4BQ3A 4IEUA 1AR62 3RSJA 5KXCA 3CIHA 2VNGA 4JCKA 4K8FA 3BIWE 5DABA 5T5PA 1ND3B 5FP7A 2RR11 5C8CC 2DURA 2E51A 2QUOA 2VR4A 4FPGA 3KV9A 3I3DA 3HR9A 4D6SA 5C3PA 4DXTA 4QPIA 4ARYA 1R1A3 1Y3TA 4GXLA 1Y4WA 5D8AB 2O8QA 5FYCA 3VDDB 1NKGA 3I2GA 4LKDA 3NV4A 5DDJ2 4XMAA 5L9VA 5JUVA 1QJY1 1W0NA 1OLMA 1B35A 1W04A 5A3LA 4IEWA 4QAWA 1QJX2 4RHV1 4RS5B 4YPJA 5F37A 2WAOA 3ZPOA 5C70A 1UAIA 2QJVA 2TUNA 4X6RB 4TTGA 1NCQC 4QU2A 1RUH3 3RGBA 4Y1ZA 1NCRA 4YGCA 5JWPA 1S0DA 3VBOB 2B4KA 4PHZA 2EF6A 1K42A 2BWAA
chains in the Genus database with same CATH topology
2ZHMA 1MR5A 4GH4C 4ZU4A 1MS4A 1LOGA 3U07A 3WDYA 4CEYB 1O5LA 1QXPA 3FE5A 3JCIA 4E4SA 4Z2WA 2RS12 4NWVA 4YW1A 2YV8A 2XVLA 1DIWA 5K0UA 4WM8B 2P3IA 2GALA 2R0FA 4Q0SA 5EV7A 1AR61 2MEV2 1AVBA 3WOGA 1ULGA 1ZBA2 1WCKA 3UKVA 4JVAA 3G7DA 5C9AC 2ZGQA 2EXJA 3HIFA 1W6PB 1MS5A 2K2SA 3KQRA 1RL3A 3D8CA 5FBZA 5J96B 5GZGA 1EV13 2PN5A 1O3SA 5DDJ1 2VMGA 5JPNB 3IDCB 1EAH3 5GLZA 1CJPA 1JOJA 1QJX1 4J6GA 1PIV2 1YJLA 4YW5A 4AVSA 2VUJA 4CDXB 1VLNA 4Q0UA 1QOOA 3NAPB 3D82A 4CDQA 2DTWA 2VXRA 3VBRA 3T2TA 2GZWA 3APBA 4YVWB 1RUJ2 2XVGA 1UPSA 4BZ4A 1ENRA 1FV3A 1LOEA 4RA0A 3NV3A 3AMHA 1IQAA 1WMEA 4Y1VA 2B9UA 3GBWA 2IXJA 2RS11 4K6BA 2P2KA 1ZBE2 4HKLA 3GBFA 2D40A 1AYM3 1VBB2 1GLHA 2RM23 5CBLA 1X33A 3AZVA 2MEV1 3H7YA 4R9BA 2XJQA 1FI2A 2A6WA 4IV1C 2FBEA 3E5XA 1AJKA 1U0AA 1ZZCA 3RS6A 4N9IA 3WNXA 2HWC1 1TE1B 2G9FA 3DL3A 1DQ2A 4LHKA 4F3JA 2VU9A 4F8AA 3VBUC 3MIGA 1PIV1 2XJVA 1OKQA 4NHMA 1IS5A 4DQAA 2E7TA 4AGGA 2GH2A 1VB4A 2ENRA 1SFYA 4XTPA 2DUQA 1W6MB 4IEZA 5JSRA 1UN1A 3JD73 3E6CC 2HEYF 4XXPA 5KHIA 2C0ZA 4CEYA 1SCRA 1RUJ1 4I0AA 1O91A 3S7IA 3ZYPA 4LO4B 1NY72 2HKXA 4WM8A 3ZSKA 2PHUA 1YRZA 1YJKA 3MFAA 1PO22 1AL22 1H9WA 1ZBE1 1MQTC 2Y26A 4ASMB 2ILMA 1WW5A 3THTA 1VBB1 5EYYA 1YIFA 2RS53 1OA2A 2JJ6A 1YCIA 2ZGTA 1ZYBA 3WY6A 2WNUC 4BMEA 2LALA 4HVQA 2GN3A 3JU9A 1ASJ2 2EXKA 2B39A 4QM8A 1YFUA 2HWE3 1LGCA 3NAPA 2JG9C 3WD5A 4HZFA 1REEA 3ZXGA 4OHZA 5JZGC 1HQWA 3WCSA 1COV3 1J59A 4YVWA 1SACA 4D94A 3VBFA 1DQ6A 1R1A2 3KT7A 4KWLA 5KHJA 2A3XA 3B94A 1CAWB 4OI4A 5GKAC 4HVRA 1XYOA 2DVDA 5L73A 3MEPA 1F5JA 2W39A 3AZYA 1QH7A 1Z7S1 4IEYA 1DGWA 4C0HA 3AXDA 4QHBA 1RUH2 1ZRCA 1AL21 1AJOA 5BNOB 3JQWA 5E8AA 2ZX3A 1GBGA 3MZHA 2ZGRA 1ZA4A 1PZ9A 2OW4A 3JZVA 2EXHA 3QOPA 4CEWA 5H9SA 2A73B 1RINA 5AVPA 1FATA 1O3TA 3VLBB 1C1FA 1ASJ1 1NA1A 3M1HA 4AEDA 3T1MA 5BYNA 5CG8A 1W6MA 1Q8QA 3KD4A 1R093 1GSLA 4IEQA 3HQXA 3SITA 1R1A1 2ATFA 1O7FA 3LAGA 2A5ZA 3VL8A 1CD3G 5K9YA 3BB6A 1DGRA 1VR3A 3PJQA 1EAH2 3M3QA 3ZVXA 1LENA 5E89A 5JI7A 5KXBA 4EN8B 1MS3A 2NPIA 5JSOA 1RUH1 4OUSA 3DUIA 2MHFA 3H3UA 2A71A 3E5UA 2OA2A 1BVP1 2V09A 3O14A 4LA3A 3J4UH 2CAVA 2VMIA 2DCJA 2D3RA 3WW1A 3NKGA 1WUVA 1I5ZA 2IXHA 3FWEA 3EJKA 4AE2A 1S0FA 2VNOA 2ZGNA 4AQ2A 4XFGA 4DFSA 5LEJA 2H6BA 5JOYA 2Z42A 4RR3B 1SLTA 2CV6A 1FXZA 3LCPA 4N43C 4NOTA 3LA7A 1KFUL 1Q43A 3LA3A 2RM22 1VB2A 2A75A 4H7MA 3WQ1A 5JCTA 1JYIA 1S0JA 3ATGA 3VBHA 2ZMLA 3POYA 4IEOA 1HQNA 1CAXA 4YG6A 5IUQA 4WZFA 5L36A 1CAWA 1DLLA 4A7YA 3FMGA 2ZGPA 1ND2A 4QQ2A 4XBNA 3VKNA 1EV11 5JOZA 1R1ZA 1EAH1 5I8TA 1WW7A 3V0BA 3VHNA 3WDWA 4LBLA 5J48A 4LBQB 1SLAA 3ZSLA 1H1MA 1KRIA 2FZ2A 1XNBA 5C33A 3AMPA 3TOJA 3E6BA 3JD72 1JTZX 3RG0A 1NXD1 1IPJA 4DB5A 3FBYA 1AX0A 1Q8VA 3WX5A 4TSVA 1DGWX 1YI7A 2WT2A 1C57A 2G4IA 4QPGB 2YGLA 3PVOA 3AMMA 2YXSA 4M00A 2WQZC 3HBZA 1H2KA 1SFNA 2B42B 4V1PA 1AYM1 3WV6A 3ZO0B 2RM21 2RS52 3M3CA 3VZNA 2DVGA 1RIRA 2YROA 5CFCA 4XJAA 3AFKA 1DQ1A 1RUD3 3U11A 1H1IA 3A0NA 3USUB 1JUIA 1WCSA 5KC6A 3N4MA 3NL1A 2HWE2 3ZFEA 4XFHA 3ZYRA 4TLFA 2H0VA 3WP3A 5KXEA 1R083 4JC1A 1CGPA 3NVCA 2VOKA 2JEMA 2HYKA 4WM7C 2R16A 1COV2 2A3WA 3BOWA 5FOJB 2VECA 2EALA 4CDUB 4K21A 5I0SA 3JD71 1LCLA 4LO7A 4XJWA 5KBFA 3AMNA 2QNKA 4YGDA 1QF3A 4KH9A 2DUPA 2JICA 1RUNA 1M4WA 4PQ9A 1K5MA 5A33B 2YDEA 1DZRA 2NMNA 3D4KA 3ZX7A 2RE9A 1HQLA 5I91A 1V6MA 5F6LB 4XQDA 2A3YA 3A4UA 3AYAA 4PDWC 2RS51 3QACA 2ZA9A 4HN1A 3SH4A 3DKWA 3B69A 4TYSA 3IPVB 4XQWA 1YO8A 5FOBB 5C4WC 1ZX5A 1RVF3 3AYEA 1UIKA 2D6LX 3OY8A 4ISRA 2D44A 2GNDA 1BZWA 1IGOA 2CY6A 4LBQA 2P17A 2VMHA 2HWE1 2PELA 4NPRA 2ZGLA 1KDMA 5C8CB 1AL0G 1OA3A 5FMOS 3SCFA 1MZ6A 1QU0A 1MS9A 4L97A 1COV1 1UL9A 3E5QA 4FPYA 4HSJA 2R1DA 2OZ6A 2H6CA 4AVVA 1W6OB 4YZ2A 2AENA 1AF9A 2QDRA 2XLGA 2KM2A 1VBC3 1CAVA 3JB4C 4AF9A 4OVEA 4RQPC 4B4RA 4QPGA 4AGRA 3QCWA 2CAUA 1DQ5A 1LRHA 1NCQB 2XKOA 4N90A 3U10A 1N1TA 2X53S 3GF6A 5JDBA 3WUCA 4AI2A 3BPZA 1OOPC 3B00A 4UW4A 2R1BA 4GH4B 4LLFA 3FFZA 5CFDC 1BXHA 4RFT0 4ZU5A 3WZ1A 3WT3A 1OHFA 4QXKA 2BVBA 1UU5A 2ZZJA 1YXWA 4HT1T 4K9SA 1H30A 3NJZA 3OF1A 4D7TA 3SISA 5EWSA 1N3OA 2PHDA 4CDUA 5C9AB 1R091 2A6ZA 1UPIA 4NR1A 2I45A 4ES8A 3WQ7A 4BH9A 4CTEA 4LEJA 2FMYA 5JIUA 4RD7A 2ZTNA 3ZYIB 2AREA 2XJTA 4GB32 4JTOA 5A33A 1F2NA 2XKPA 5T5JA 1C3HA 3C2UA 2DVBA 3V0AB 2MPFA 3KCYA 3WP5A 1F31A 1X8MA 5HBAA 5GZDA 2WFF3 5CA6A 4YZ3A 3DPRA 1NE4A 2WSVA 5CNAA 1OSGA 2VQAA 3H1WA 1X7NA 3ZN4A 4XBQA 4MXVA 4K40A 4FCAA 2HWF2 2GU9A 4JGZC 1KJRA 1RUF3 5J3UA 3OD0A 4XHXA 1HIXA 1HDKA 2GC0A 3GZAA 4QPYA 3MW4A 3MIHA 4BLJA 4FPEA 3O0XA 2VVDA 2VW1A 2K9ZA 1RUD2 4IV1B 1W6OA 4XFAA 1XYPA 1GQGA 4Y5Z0 3E6DA 5FLJA 1DF0A 1LEMA 4MXWA 4K7JA 4PIXA 4M0NA 3VBUB 3V56A 3RNSA 3CU7A 2WNVA 1G9BA 2C1FA 1R082 3CEWA 5K7PA 4XEZA 1HW5A 1REFA 2AR6A 3VBSA 1KITA 1BQPA 4L2NA 1S0EA 3V64A 4B29A 4LBOA 1HRV3 1SBEA 1XYNA 4M0HA 5E16A 4YSFA 4A7ZA 1S2KA 2XJPA 2ZABA 5L7OA 1MQTB 5FFOC 2XVKA 5F5QA 1TNFA 3H1MA 1JH5A 1FYUA 5C9AA 1IS4A 1O4ZA 1PNFA 4XILA 4M3CA 2B7YA 2JECA 3N7JA 3HMYA 2WNUB 1RUD1 3GHMA 1SEFA 1AR93 2ZKNA 1WMDA 4Q1PA 3RMYA 2IXKA 3IT8A 3ASIA 5HCBA 2ZGUA 1UKRA 1ULFA 1BEV3 4JGYA 2ZAHA 4HETA 3B9CA 4DRRA 2WA3A 3ZYGA 2Y0IA 1R081 2XG3A 4CDWB 3O0WA 1BJQA 1LOFC 3CO2A 5JZGB 3RYPA 3ZFFC 2PTMA 2QZ3A 3PHMA 3SH3A 3D0JA 1LGNA 4XFCA 4HPKB 3FC0A 2TEPA 1H2NA 1VBC2 4AVTA 3CJIA 2WJSA 3LA2A 1GZWB 4EV0A 2UYAA 3AYDA 4LO5B 1GFF2 2R0HA 1U5YA 5T55A 4ASLA 5JLVA 1F8VA 1QXRA 1OLRA 2VOXA 3HT1A 1HRI3 3R6SA 4FPJA 1YFYA 4L11A 4YLZA 3MLLA 5KC5A 4J1WA 1DFQA 1A3KA 4DY3A 1RVF1 3KMHA 4YM1A 2QVSB 4K1YA 3NWKA 3VBUA 1EYBA 2Z5WA 2UYBA 1LODA 2D93A 4UW6A 1Q8OA 2C5DA 2OUHA 1GQHA 3ZN5A 4P9IA 4XFFA 1OFNA 2NZ9A 4I02A 3W58A 4A3XA 4INDA 1RTVA 3ROUA 3VHRA 4HSLA 4U2AA 5BNNC 1E57A 4META 1RUC3 4AFCA 4COUA 1APNA 3WHTA 4KU7A 4OULA 3EBRA 5C6CA 5J7MA 4KBBA 4PBPA 2DVAA 1VBC1 4IV3A 3N35A 2ZHLA 3PMSA 3AP7A 2ZS6B 4HVOA 2OIIA 1LHNA 3VZJA 5EYXA 4YZ4A 4AQ6A 4OI0A 1YFXA 2VUAA 2WC2A 2R6QA 3ZDSA 1VAMA 3M3OA 3FJSA 2WNUA 3BCWA 4FOQA 5I0TA 3T1LA 3I2DA 5A32B 2WFF2 4XFBA 1FPN3 3MW3A 3K48A 4PIZA 5FRAA 1REDA 4XHBA 4FT8A 2DV9A 3SH5A 2HWC2 2D98A 4L92A 4PLOA 4YM3A 2A6XA 3M3EA 1CAUB 2GAUA 2YUEA 3B01A 2I2SA 4L99A 5I0RA 2Z69A 2X5IC 4N43B 1RUF2 2ETEA 4CDWA 1LULA 2QCSB 5A3MA 1XRUA 5CVRA 3LSDA 4HPKA 2HJIA 3ZFGC 1H9PA 3IBMA 1N3PA 3AYCA 4XJ9A 5K8SA 1DGRN 2DCZA 1X50A 1ENSA 1GZWA 2TBVA 3M7AA 3VHPA 4FTEA 2D3SA 4B7KA 5LEKA 1SQ4A 1WD3A 5JOXA 1O3QA 1DGLA 4OFGA 4P9JA 2BWCA 4IEPA 1ND3A 3UKNA 1RJ7A 4BM8A 1UZZA 2QKDA 4Y22B 5B2GB 2R062 4LBJA 4M3CE 4WVMB 2WS93 2YYOA 2WFF1 2ZCWA 5D8AA 3VDDA 4Q29A 1HRV2 2WWSA 1TMF3 2JXAA 4GMP0 1WLWA 4RS5A 3D5OA 1F5FA 3B02A 3ME2A 1DYKA 1W0PA 2BVVA 1RUF1 1UF2C 3FLRA 5I8SA 4AVBA 4EN9B 1H2MA 1ZZ8A 3VBOA 4RSUA 4Q4V3 3WDVA 2BNNA 4FQ4A 2ZHNA 4UW3A 4OZXA 4FPFA 1AR92 2DYCA 3POWA 2CNAA 5BPXA 1VAKA 3HT2A 3ILFA 1LOAA 1WW4A 2BNMA 4QPIC 2VY0A 2A70A 3MGUA 1Z7S2 5TSWA 1OA4A 4N7IA 4FAHA 3PVEA 2XPJA 4WM7B 1AHSA 1B35C 2UWBA 3NKTA 1VAVA 1JN2P 1UIJA 2XL9A 2R061 4UW5A 1QXJA 3N3HA 4AW7A 4BQ1A 1W6PA 4HANA 4Q0VA 1EPWA 1HRV1 5IT6A 5FO9B 2W68A 1GANA 2Q5TA 1LR5A 4CDXA 2DFCA 4P9XA 3WXPA 5FPZA 2DCKA 4PDWB 1YI9A 4L8QA 3VKOA 1HRI2 2HWD3 4QD2A 1V6IA 4COVA 3S0MA 1DHKB 4Q0QA 1FX5A 1QQP3 4W6YA 5C4WB 5K0UC 4I3GA 3WQ0A 1AR91 3VV1A 2PHRA 2QQPA 2JD4A 1D2QA 4YG0A 5T52A 5FO8B 3FUOA 2Z79A 1BEV1 3MIBA 2CGPA 4DNYA 2QZ2A 1ULEA 5T3NA 3AP5A 3VKLA 2ZAAA 2BEOA 5FLIA 2R49A 4CZSA 3CF6E 4WVMA 4WBBA 1SLLA 1C4RA 3ILNA 5T5OA 3DN7A 4AYUA 1RUC2 4M01A 4MZUA 1RGSA 5JAXA 2F4PA 5ACA3 4CDQC 4RQPB 4BE3A 4OHWA 4YGBA 4FQZA 5SV5A 4FXGB 3QH7A 4Y4YA 4L9BA 1BVVA 4ORFA 1DG6A 5CAZA 3WG1A 2WZPP 2VOVA 1OOPB 4ISQA 2JG8C 4MV2A 1HRI1 4ZKTB 1GYKA 1PVXA 1W6NB 3E97A 5CFDB 1Q8PA 3U4XA 4Q4X3 1ZVFA 3NSTA 1CIWA 1LECA 2YGMA 4BLIA 4DPNA 4C1XA 2QFEA 2P3JA 1EV12 4O9GA 5LK7B 3ELNA 2UY8A 4BPZA 4FBFA 4B4QA 1WLDA 2R30A 4EN7B 1J1TA 5I0UA 4AEMA 5BXXA 3ZYJB 2K0GA 2UURA 3I54A 4QMAA 1IPKA 1DBNA 1CPNA 5JI9A 1RUC1 3UK9A 5JIAA 3C3VA 5E1RA 4YZ5A 3H1YA 1ZNPA 2O1QA 2AGSA 1L3JA 3FLPA 4HBNA 1FNYA 1M06G 3ACLA 2XBO3 1CQ9A 1IKQA 1DU3D 4HLTA 2YZ4A 4AQSA 1AYM2 3RDIA 4W6WA 3ZSMA 1DZQA 3U0ZA 2Z2SB 1FPN1 5IK7A 1LEDA 4G9SB 2DU0A 3I4IA 1J3RA 3BOPA 3O5SA 1OQEA 1ULDA 5DG2A 4H7LA 5D1IA 2ES3A 4IEXA 4COWA 5BNOA 3VZLA 1ZRRA 2NYYA 1A8DA 5FO7B 4YW2A 1YLLA 3TYJA 3MICA 1VBA3 3J8F3 1PZ7A 4JAAA 1CN1A 1SDWA 4DY5A 2VPVA 4Q2FA 3I59B 3KT1A 4FP2A 4AFAA 3WINE 4I30A 3MIEA 1OQDA 4YVWC 3VBFC 4BMBA 1N3QA 1S0CA 1LTEA 1CPMA 2WINB 4H3WA 1QHDA 3EXUA 2XL7A 2VW2A 4ES9A 1MZFA 2P37A 3ZMNA 2WS91 3TN93 1NZCA 2ZHKA 4RGGA 4LBQD 3UL2A 4XMIA 5LK5A 3ZN6B 1BBT3 1TMF1 2WLQA 4MGZE 2XGXA 4GKYA 3AZZA 3S6PA 2B45X 2BW8A 1ENQA 1O4TA 2QDNA 3WLUA 4CEWC 5JOWA 4TWTA 1UW8A 3RI8A 2UWCA 1LHVA 2A6YA 2UWAA 4FP3A 1NA1C 4NVPA 4LBKA 4GMP3 1Z78A 2HWD2 4YARA 4AEDC 4Q4V1 1QQP2 2OVUA 3ZXKA 1KJLA 5DZGA 4WV8A 1SLIA 1QJZA 3TB0A 4KU8A 4XF3A 2DF7A 2YHJA 5DUUA 1XE7A 4S2HA 1RHI3 3WW3A 2VQ0A 4RR3A 3RMXA 4R9AA 4AG4A 4Y1XA 1GKBA 4FOVA 3USSA 1MEC3 2O0OA 2EAKA 4K3UA 1Z0HA 2ZX1A 4QT6A 3ZFFB 1OI6A 1RJ8A 4A7KA 1LB2A 2JENA 1QY4A 3N7LA 4NHKA 1PK6C 1YHFA 5ACA2 1IS6A 3LZZA 4AHYA 3TRSB 4COYA 1OFSA 4P14A 1PGSA 4JDNA 2E9QA 3H9AA 1RC6A 1VBE3 1JW6A 5GLWA 1PGW2 2OZJA 2WNEA 1BMV2 3JBG3 2MNGA 4KG0A 5J09A 4BIOA 1O3RA 2HWD1 3KSCA 1R092 3RJ2X 5FLHA 3I7DA 4JTNA 1YNAA 1QQP1 4Z1VA 4Q4X2 4BOWA 4IEVA 2PFWA 3R4UA 1Y9QA 3RJRA 4P5HA 3VBHC 2DU1A 1G9CA 4AI1A 2C9AA 1NLRA 1PO13 3M3IA 2FMDA 3LB9A 3LWCA 1D4VB 1RUG3 4LO8A 1ND2C 4OHXA 2VVFA 5LRRA 4YM0A 1NYWA 3ZXEA 5JMCA 5GALA 4FSJA 2D6MA 1LKNA 5DUXA 4LR4A 1RUI3 5H9QA 1HV1A 4KWKA 3VUOA 4LULA 3USUA 1LJ7A 1ALYA 4XXAA 2WQ4A 5ACA1 1U5IA 2I74A 3FHIB 3JUUA 1FAYA 5J36A 1S1AA 2WSUA 4ITCA 2XBO2 4YM2A 4P9YA 3LSEA 2NQYA 4HK9A 4N53C 1PGW1 1DDLA 4MGIE 1AXKA 3Q9OA 3TAYA 1BMV1 4LNVA 3B3QE 2BFUL 1FOD3 2BQPA 1Q5OA 1DQ4A 3SMHA 1QWRA 2WT0A 1VP6A 1GNHA 3ZXLA 4Q4X1 1G9DA 1AXYA 2WA4A 2ARXA 3KM5A 2R32A 4KWJA 4AHZA 4FPHA 5CFCC 2ZMNA 2A6VA 2X5IB 5FDBA 4XFIA 1SCSA 1UCXA 2WZR3 1LOFA 1DQ0A 2D43A 2JE7A 1G6NA 2PHTA 1CX4A 4AVAA 2WL1A 1QDOA 2FZ1A 3ZFEC 2LM3A 1VBA2 3ZFGB 3J8F2 3NV2A 3ALQA 3IPVA 2HEVF 1ZREA 3P3NA 1KQRA 4OI2A 3POSA 3WVJA 4LBNA 2CYFA 4Q4Y3 3J26N 4XW3A 1A6CA 1X8EA 2DCYA 2XBO1 2R043 4MVTA 3MIFA 2ET7A 1OPOA 1YIPA 4N9HA 1BKZA 1W6QB 4FTBA 3AKPA 1XNDA 5C8CA 1JXNA 4EWDA 1K5MC 5KHGA 1C28A 3TN92