3IIIA

1.95 angstrom crystal structure of coce/nond family hydrolase (sacol2612) from staphylococcus aureus
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
558
structure length
556
Chain Sequence
QHLLGNPKLTVTHVNEVKAGINHIVVDSVQYGNQEMIMEKDGTVEMRDGEKLYINIFRPNKDGKFPVVMSADTYGKDNKPKNMGALWPTLGTIPTSSFTPEESPDPGFWVPNDYVVVKVALRGSDKSKGVLSPWSKREAEDYYEVIEWAANQSWSNGNIGTNGVSYLAVTQWWVASLNPPHLKAMIPWEGLNDMYREVAFHGGIPDTGFYRFWTQGIFARWTDNPNIEDLIQAQQEHPLFDDFWKQRQVPLSQIKTPLLTCASWSTQGLHNRGSFEGFKQAASEEKWLYVHGRKEWESYYARENLERQKSFFDFYLKEENNDWKDTPHVIYEVRDQFYKGEFKSASAFPLPNAEYTPLYLNAENHTLNHAKISSAHVAQYDSEDKQQDVSFKYTFDKDTELVGNMNLKLWVSTKDSDDMDLFAGIKKLDRRGNEVNFPDFNHIENGQVATGWLRVSHRELDQEKSSIAQPWHKHETELKLSQDEIVPVEIELLPSGTLFKQGETLEVVVKGSEIVIGNSTPGMKTRYEHEETVNKGMHMIYTGGKYDSQLIIPIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title 1.95 Angstrom Crystal Structure of CocE/NonD family hydrolase (SACOL2612) from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus col
molecule tags Hydrolase
molecule keywords CocE/NonD family hydrolase
total genus 189
structure length 556
sequence length 558
ec nomenclature
pdb deposition date 2009-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02129 Peptidase_S15 X-Pro dipeptidyl-peptidase (S15 family)
A PF08530 PepX_C X-Pro dipeptidyl-peptidase C-terminal non-catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3020.20 Mainly Alpha Orthogonal Bundle alpha-amino acid ester hydrolase ( Helical cap domain) alpha-amino acid ester hydrolase ( Helical cap domain) 3iiiA02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3iiiA03
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iiiA01
4D9JA 1KU6A 3MVEA 1AUOA 5JD5A 4FLMA 4BVLA 5IKXA 2J7MA 3BN6A 3WIOA 3BF7A 5CH8A 2XUFA 3AUKA 3WL5A 1JT2A 4JX0A 1U2EA 4QDOA 5JIBA 4PO3X 2RHWA 1OH4A 1Y7HA 2V5DA 3D7RA 4UHDA 4UBIA 1EB9A 3G0GA 3OEAA 2E31A 2WYSA 2VA9A 2XMSA 2OCLA 3IVMA 4FHZA 2VMDA 3VD5A 3G0CA 4MWSA 3DYOA 4RE6A 2BBAA 1W52X 2B20A 1YA4A 2GBGA 3L1HA 2OGTA 1TIBA 3WA7A 1JU4A 3QH4A 4EY8A 1MT3A 2VZTA 5JZBA 2PU7A 3C87A 4HXFB 3WI7A 4B0OA 3IAQA 1BEEA 3W05A 1UY0A 2C5FA 4QNNA 3BIWA 4LXIA 4ARBA 3PI6A 3H2HA 1UKAA 4EUSA 3FYUA 1J06A 1E89A 5E4YA 1VA4A 1F8UA 3M83A 2QXUA 5C7YA 2XLBA 1ISPA 1MNQA 2EDCA 1JYNA 4E8DA 5LLSA 5ALHA 2V98A 4M0EA 4Y2VA 5ALXA 1WPRA 2VZPA 2JBWA 2H7YA 5AI9A 5ALVA 5FUIA 2ZEYA 2WIGA 3WL6A 1ZD2P 3NWOA 5BOVA 2CDOA 3LP5A 1O8PA 2WIFA 3NGMA 1L7QA 1XZFA 4QDRA 1XZLA 3EBLA 3DS8A 2WQ8A 2G4LA 4QZVA 1EDDA 1MX5A 2JGEA 4EY7A 2OKXA 5EIAA 4M4PA 4DXRA 5JR2A 2W3JA 1JHJA 2HU5A 1CUBA 3A2NA 1J07A 1RWQA 5A7GA 1I6WA 2DSNA 4CCWA 3TGLA 1S8OA 2IIVA 4FBLA 1CZVA 4EY4A 4CU6A 3C8DA 1LPMA 4K6HA 1JZ4A 1CQZA 4C4XA 1YAHA 1X2BA 3CDZB 4K6KA 1OF3A 3CQOA 4OD0A 2H9YA 1XRMA 2EEPA 1D7PM 1EUUA 3CZUA 1H2ZA 4HRYA 2PSDA 2LW8A 3OG9A 2J1SA 4DLNA 5HKBA 2DHEA 2WJ4A 1JZ5A 2C7BA 1BCSA 4J0KA 5LZ7A 3U0VA 3OPMA 2C5GA 4F60A 3VJLA 4KAJA 2FX5A 2VM9A 3IUQA 4YK7A 4BDVB 3UUFA 4E15A 2XQGA 4C4YA 3HPNA 4H7JA 2PSEA 2C26A 5HFAA 3UNPA 1XNTA 1HLGA 2OAEA 2J1TA 2DCJA 4ETWA 1GQPA 1LPNA 2ZYSA 5CRIA 4BK5A 4FWBA 4CUCA 2K2QB 1G42A 1VE7A 1NU8A 3FN9A 3VD9A 5AKXA 3I2KA 3HI4A 4G8DA 2XUPA 1CUDA 3WYDA 3VD7A 3F2ZA 1G4HA 4X85A 1B6GA 3UMJA 3IUNA 3FAKA 1XQVA 4DMCA 1VXRA 5ISMA 4LKOA 3WNNA 1UFOA 1CV2A 5LCWL 1WPXA 1CUCA 4U2FA 4QLOA 4UHCA 3AIMA 3FBWA 2PVSA 3G0BA 5JUVA 2PSFA 1XLWA 3DYIA 1K6EA 3LCRA 4J0IA 1QE3A 4AB1A 4QPWA 4Y2RA 1XZAA 5KBYA 3AINA 3MGAA 4JUIA 1ZI8A 1QFSA 2RHTA 4L0CA 4E46A 2ZJ6A 4W1SA 4BC1A 5IH7A 3STUA 2WG0A 2WUDA 2HU8A 1H2XA 2V72A 4Y7DA 2RVAA 3C43A 4QDTA 3AC0A 5J1XA 5EHXA 3LS2A 4GWIA 1QTIA 5ALIA 1SG3A 1K45A 3X3HA 3I3DA 5ALTA 3I2JA 5AICA 5ALDA 2Y6KA 3WWCA 3DL7A 1F4AA 2XQXA 2AJCA 4QDZA 2OCKA 5T4BA 3EF3A 4H35A 1DT3A 3CCCA 3MV01 4Q34A 5JD6A 4BJ0A 2Z8XA 4DUWA 4GWJA 1NKGA 4G9EA 4KE9A 2WTMA 4TXWA 4GECA 4B0PA 4A5SA 1LLFA 4ZXEA 2Z3WA 1FFCA 2HA6A 1CR6A 1ZI9A 5AI0A 5AOCA 2W6CX 3DOIA 3WMRA 2W1SA 4Y2TA 2PBLA 3B12A 2BCEA 2UZ0A 3DLTA 5I7UA 2Y6LA 1OILA 2HA0A 1HBJA 5AKGA 1H2YA 2X5XA 4JHZA 1MX1A 4B9AA 1PX3A 3S2ZA 3W5MA 3GGLA 2VO5A 3MV11 5FP0A 1A8SA 1XZGA 3VD4A 3I2FA 3C6BA 4P02B 2XUHA 4L72A 2EIDA 2W91A 3IIIA 1KEZA 3T0BA 2W1UA 1MX9A 3VJKA 2DQZA 2XMQA 2ZJ7A 2J1AA 3EYPA 4A4AA 1SC9A 3ZLVA 4OPMA 1US2A 3NRUA 5ALRA 3CN7A 1GQRA 3QVMA 1TCAA 3I3EA 4G4IA 4ZWNA 1USWA 5LKRA 3R3ZA 5ALWA 2XUKA 2DHDA 1EVEA 1QJ4A 1R9NA 1XZDA 2VEOA 3G7NA 2WAAA 2XONA 5JATA 2VC9A 4OB6A 1JZ3A 1WKYA 2WO2A 1P0IA 3MBWA 5ALMA 2QRUA 1CUGA 1KEXA 2XUJA 2QQNA 5DN2A 4OMCA 5LYYA 3HYSA 1BU8A 2HIHA 4PT6A 2QUAA 4EZIA 3H0CA 5AM1A 2VMFA 1QIJA 3ZWQA 5JD4A 2OPHA 4B82A 1TK3A 3S8YA 4BDTA 4OZOA 3AIKA 4BE9A 3I97A 4FOLA 5E4JA 1YS1X 3E1F1 4U2EA 5C71A 1OT5A 3QPCA 5AOBA 2WLSA 3A70A 3K75B 3ZLUA 3FLAA 5EJZB 1QFMA 5D6OA 3ETPA 4C6HA 1VOTA 3STXA 3WF2A 4RNCA 5A7HA 4P92A 4H7IA 2VZRA 5DTIA 1QIMA 4AQDA 3HNMA 4EBBA 3DYVA 3HABA 4MO3M 4OB7A 5T4EA 3D4LA 3I6ZA 2KD7A 1E8DA 1CUSA 2ONCA 4LKSA 4P93A 4GW3A 1UWWA 5H3HA 2WHPB 2VTFA 2PSJA 2PSHA 4RPCA 4X71A 4QB2A 5ALPA 3LQCA 3VVLA 1I5PA 4IH4A 3IURA 4UFNA 1XZEA 1JMKC 1CRLA 2CJPA 4KEAA 1QIHA 1XZIA 4M0FA 3WYNA 3LEIA 1NU6A 1DWOA 3ED1A 3WLAA 2X76A 1JJBA 3BGAA 1GUIA 5AI8A 5K3AA 1LBSA 1QTRA 2WZ8A 5LA0A 2XMDA 3D2BA 3FWHA 3K2IA 1ZI6A 2OAGA 4P08A 5AK5A 5EFZA 1XZMA 2QOEA 1GPLA 2QQLA 3CIHA 4CG1A 3WK9A 4H77A 2WHRA 5JYCA 4FFWA 3ANSA 3PE6A 4B85A 4QWWA 3WWOA 1W76A 1BN6A 2W95A 1JYVA 1R64A 4PF1A 3H17A 3ZLTA 1CUJA 4UUQA 3GUUA 4IH9A 1X2EA 2BKLA 2XUGA 1QIFA 4C87A 5ALSA 3GA7A 4P5YA 3WKBA 2DCMA 4A3ZA 4E14A 2DQYA 3DEAA 3I1YA 2VAVA 2D5LA 4DNPA 3H04A 1WB4A 1DQYA 4FDMA 1RYYA 4NZZA 1CUAA 1QO7A 4PV7A 2DHCA 4ZRDA 3NUZA 5LA1A 4FLEA 4GLBA 4UBOA 3LIPA 2E33A 2W22A 1CQWA 4X93A 2O2IA 2X8BA 3EB7A 3WNKA 5K3DA 2W92A 3WEZA 3OC0A 2XUOA 3MUY1 4HRXA 5HF9A 1MO2A 2WO3A 1W1IA 4AO7A 3KWJA 4MYSA 1P0MA 1HL7A 1CPYA 3KXPA 3H1AA 1XQYA 1CUHA 3WK8A 4BVJA 1H23A 4HXEB 1KGYA 4CUBA 4ARXA 4IH1A 3HZOA 3R3UA 4MOAA 3JXSA 4EB0A 2XLCA 1L7AA 4FLFA 3D5EA 3GXUA 5HF6A 4ROTA 5CT8A 4LHSA 5K5EA 2LS6A 4MYDA 1UKCA 4OU5A 4YPVA 5C81A 3OG2A 2CKMA 5A71A 3DCNA 4CU9A 1CUEA 3V9AA 4JYMA 1QOZA 3I2GA 1LNSA 5J3JA 4BCDA 5EJ1B 4GI1A 1R3DA 4G8BA 4I4CA 2B61A 2VZSA 2V97A 4UBKA 2GBCA 3BE8A 2W47A 2J4CA 3W2TA 4N8SA 1YASA 4CU7A 2QM0A 5CYYA 5C70A 2O2GA 4CIAA 4QDQA 1JJFA 2XUIA 5AM2A 3LEGA 1UK6A 2Z5GA 4LHEA 2JIDA 4C4ZA 3THDA 1YQ2A 2CBGA 2J3QA 2WIKA 2RONA 4TGLA 1SCIA 1HN1A 4DIUA 5LP1A 1TRHA 5JALA 3CN9A 5IYYA 1Q0ZA 4AO8A 4ARYA 4XWGA 3HC7A 2YB7A 5JADA 4GZ9A 4QB6A 5FRDA 5LKAA 4B83A 4AZ3A 1XKTA 2WO1A 5AM3A 5HK9A 4UFOA 4DUXA 2QQKA 2Y6GA 1VZ3A 4XJVA 5FDFA 4H0CA 3QMMA 5HF8A 3G02A 3F96A 2W5FA 3OTQA 4J0GA 4QAWA 5ALYA 5ALJA 4E8CA 3DD5A 5JANA 4H7FA 4PQQA 3HNYM 5DQ0A 3WL7A 3D0KA 3DKKA 2JD9A 1SCKA 5ALZA 3OEBA 3QYJA 4A16A 3STWA 2H1IA 1AX9A 2OLEA 2HRQA 3BIXA 3F9CA 5YASA 1WOMA 5JXHA 2PPLA 2Z8ZA 5ALQA 3IB3A 1CX1A 1ZJ5A 4UHHA 1T2NA 3D3NA 4UHEA 2WAOA 2B4KA 3LPGA 4PSDA 4M0MA 2AJ8A 1HPLA 1YR2A 3WL8A 4UBJA 2WKWA 1ORWA 4NS4A 1EUTA 4O08A 1EHYA 3HOBA 1GGVA 1XQXA 5C8XA 4K5QA 4Y2QA 1WB5A 2YFZA 4FTWA 4HS9A 2VZQA 4WCVA 2QQJA 3FHQA 4QDSA 4N8DA 2ES4A 4BDSA 1LPBB 1JZ6A 4G5XA 1LGYA 1Q83A 3FYTA 2D0DA 1A7UA 4EY5A 5K3EA 5AK6A 3OGRA 3R41A 3V1NA 5A2GA 3HSSA 2QVBA 2GBFA 4XVCA 3WK5A 4B81A 1BE0A 2HLEA 3LIIA 5AIAA 3AZQA 4OYLA 1XLVA 3HACA 2YH2A 1XC6A 4I3FA 5DPNA 2X05A 5B4NA 4JEIA 4D0QA 1O6GA 5AJHA 4OUKX 3DECA 3TJMA 3AJAA 3T09A 5CURA 2VJDA 2WUHA 4BAZA 5A6VA 3SEPA 1UMHA 3WJ2A 1CUXA 1H22A 1BN7A 1R88A 3A6ZA 5KREA 1GZ7A 5K3FA 1US3A 1ZIXA 3FVRA 3GM8A 1BCRA 4BC0A 3VXKA 1EK2A 1UY1A 3G9XA 3I1IA 3WA6A 3T2PA 5AK3A 5ALOA 1QONA 4INZA 4AMYA 4HXGA 2EIEA 3M3DA 2R7EB 3STTA 5LZ8A 2W1QA 1ZIYA 3TEJA 2OG1A 3I2IA 4QB1A 5HZGA 1A8QA 4FBMA 4Q05A 4Y2PA 2VMEA 4BRSA 2W94A 4X6UA 5FPQA 4WFKA 4QDXA 2QMQA 2J22A 4LYDA 5AP9A 2BJHA 4UAPA 5EIHA 2ECFA 3ZV7A 1ZD4A 3HJUA 1W9TA 3FLBA 5SYMA 3WWEA 2JEZA 4N5IX 4GXNA 4WDRA 1WCYA 3STVA 1MNAA 2WZEA 4B6GA 1EK1A 1YS2X 2WSLA 2XQJA 2OGSA 1W8OA 3GELA 4W8JA 1A8UA 4BXSV 2VQUA 2VZVA 2WG1A 3KD2A 1MN6A 4DXSA 1LZKA 3H1BA 3VVMA 3EIOA 2VL4A 2HFKA 4W1PA 3OM8A 4TVKA 1R1DA 2WABA 1Q84A 3D2AA 2HYXA 1UY2A 3C6YA 2DDUA 3BF8A 1GOGA 2R11A 5T4HA 2JDAA 3T0DA 1XRQA 1TCCA 2BGNA 1CEXA 4A41A 3P2MA 3VDBA 5AKLA 5DLPA 5CT5A 1BROA 2E3JA 2ZXQA 1ZICA 5SYNA 1CUWA 3QMVA 5A1AA 4H7HA 5ALLA 1K12A 1QIDA 2JEYA 3WF4A 1W6RA 2WHPA 4QDUA 4X97A 1IQDC 1GKLA 1W8NA 6YASA 3FNBA 4KACA 5AKZA 5FOQA 1J1IA 2WBKA 1N5MA 1LZLA 5EHNA 1JZ7A 3FOBA 4K6GA 4BBZA 3T2QA 2JKXA 5ALGA 4ITVA 3VISA 4BP9A 1D07A 5AK4A 1CUZA 2R8BA 2XDWA 2BUAA 5LZ9A 1PJAA 2G5TA 3K4AA 2WG2A 2RJ2A 4DXTA 1CUVA 2GYUA 4K2AA 1DINA 4L9AA 4QA9A 1DT5A 3WKCA 1GMMA 4ARAA 2BFNA 2ZYRA 2BGOA 1CLEA 2JGFA 2AJDA 5AHXA 2HL6A 5JMOA 3B3QA 3O4IA 4BTLA 1DX4A 3D3AA 1UZAA 1BHGA 4TTGA 2WFLB 3H18A 4GHWA 4LPLA 4MWTA 4H7KA 5JZSA 2VQTA 3MO4A 1E8MA 5I8PA 2QZPA 3H2GA 3WF3A 2ORXA 3PDCA 2G63A 2VZ3A 3HEIA 4UBLA 5DWDA 1SFRA 4HTAA 1UOPA 3PF9A 3A23A 1ODTC 1ODCA 3DYPA 3O9VA 5EHQA 2ORZA 2W1WA 2VJCA 3CXUA 1DYOA 1A88A 2AJLI 2HDWA 2VAXA 5EIEA 1BEZA 3IDAA 4XUPA 1XZHA 3N0TA 3VD3A 4CG2A 2Y6HA 4QX0A 3F97A 3WWDA 4DSAA 3OGVA 3T0AA 2XMRA 3C6ZA 2IX9A 2HFJA 4CFSA 1J83A 4G8CA 3WKEA 1PV1A 1GKKA 1ZOIA 4LQRA 3LE0A 4J03A 4KRYA 3OGSA 2RAUA 5D3ZA 1K63A 3U37A 1CUIA 2C4XA 5EIYB 4J3JA 3V1KA 1CIYA 3V1LA 4ZV9A 1GOHA 4DEVA 3BJMA 3O9MA 4HVTA 4XX1A 4QX2A 1GNYA 2ROQA 4N8EA 4U2GA 1C7IA 3HLKA 5KWJA 3IULA 4JYPA 5DMYA 3FVTA 4BATA 5DTJA 3Q8WA 3C7EA 3JW8A 3PUHA 1JKMA 3WNMA 3OB8A 2CUTA 4GEGA 4DUVA 2VSQA 4RGYA 3QITA 4F21A 3QPAA 5AI6A 4OU4A 4BCBA 3MUZ1 1Z68A 3HRHA 2GBIA 3RKSA 3SKVA 2WUEA 3O4GA 2DR0A 5AI5A 1JZ8A 1AQLA 1XLUA 1TVGA 1HQDA 4CI9A 2WJ6A 2HADA 5JAOA 1W75A 3K4ZA 4WFIA 3G8YA 1THGA 3THCA 3BL8A 3H2IA 1MU0A 4PNZA 5F7UA 2QXTA 1VZ2A 5AKHA 3EQ9A 4X95A 2XHNA 1IZ7A 4UFPA 4W9RA 7YASA 1OXMA 1N5RA 1GT6A 1GQSA 2IITA 3WK4A 1EXWA 2EIBA 2OQVA 1UYYA 4BRZA 2C0PA 3ZM8A 2RIPA 4JKLA 4GDMA 4XIIA 4ZXFA 3I28A 4UHBA 1AMNA 2XOMA 5FPPA 1P0PA 5E4TA 4ZZ5A 4UOJA 5I9IA 4FNMA 3FCYA 1YAJA 2XUQA 1FFDA 3WZLA 5IVIA 3YASA 4P9NA 3T2OA 4W63A 1H6XA 3OURA 3WKAA 5ALFA 3FYUB 3KSRA 4CVUA 1VE6A 2VR4A 2VJXA 1C4XA 5HQ3B 1ZGCA 3TRDA 5KWIA 2WU3A 3WZMA 2QR5A 2VCBA 2GYWA 3K77A 1GPNA 3IA2A 4J0JA 4BE4A 3A22A 5LZ4A 4OB8A 4KJXA 3N2ZB 1KU0A 1SOMA 1CVLA 5CBKA 4M4RA 4TPKA 1P8JA 2VCAA 5AO9A 5I0DA 3M81A 4L3WA 4BYMA 2OXEA 3KWFA 4NVRA 2Y2UA 4B7ZA 5DNUA 5AOAA 3U1TA 4BVKA 4F0JA 5G05L 1M33A 3ACHA 1F0PA 3E0XA 2C9KA 1QIIA 1SHWB 1PMHX 3PICA 2VMCA 3AZOA 4Y2SA 1JMYA 4Q3OA 1U8EA 2PU5A 3DL4A 5A62A 4AN1A 1XKLA 2C58A 4FMPA 5AH0A 5FV4A 3ESDA 2XMBA 1LPAB 4DM7A 2ZSIA 4WDQA 2NW6A 3D59A 4JNCA 4I19A 2HU7A 1OCEA 4C88A 5HKAA 3GZJA 4HAIA 3VDCA 1TCBA 4WFJA 3V48A 2VCCA 4MEAA 1UK8A 4PSUA 2ORYA 1W99A 3BJRA 5EI5A 1EA5A 5BV7A 1PX4A 2XMZA 2WUFA 3V1MA 1ACJA 2QBXA 3I3BA 3E4DA 3GDBA 3NOXA 1BRTA 1MTZA 2X09A 4CU8A 1F4HA 3LPFA 4NMWA 1OD3A 2FJPA 1UXXX 3SEEA 2GZRA 1THTA 3IUMA 3HJRA 2QJWA 3DYMA 3HN3A 1SDDB 3MUNA 4FI9A 2WFMA 2GZSA 2E32A 2W87A 3T4UA 4FKBA 5CT9A 3C5WP 4X91A 4KE7A 3WQBA 2ID4A 4QLAA 1UOQA 1JU3A 4MQLA 5JXJA 2JGLA 1XRPA 4HZGA 2G5PA 2ZEZA 2ZYHA 4W4ZA 3DOHA 4DTCA 4XUTA 1EI9A 1EH5A 4DNOA 2WHQA 1EB8A 3R3WA 4IHAA 1QIEA 3GROA 3ESCA 5D7BA 5ALEA 5AKKA 3HNBM 4Q82A 4LYEA 3C70A 3FSGD 4U2DA 5T4FA 3WIBA 5CMLA 1MAHA 1MPXA 1X70A 4DSZA 4BAUA 2WJ3A 4KR0A 2C0QA 1AKNA 1UKBA 2QQOA 4B84A 1CFJA 3C7GA 4GBGA 2QTBA 1CUUA 5JARA 3Q0TA 1JI3A 2OGZA 4XVHA 3VJMA 2XMCA 1H2WA 4A44A 2PUJA 1ZGBA 3QPDA 2XQFA 2ZEXA 4ET7A 3L1JA 3R3YA 4EHBA 3NQHA 4ZY9A 1XZJA 4X6XA 4AN0A 4OYYA 1JJIA 1IUPA 2C4HA 1EDBA 3MUOA 3RARA 3K4DA 1ODSA 3K9BA 4MGSA 3LLCA 3WNLA 4CCYB 1B41A 4MGQA 1YCDA 5AIBA 2J1EA 1XZCA 1NAEA 4A42A 3IAPA 2BZDA 2YFUA 2I3DA 4C01A 4KE6A 1AURA 4XURA 2VOTA 1UK7A 3L1IA 1J84A 1IUOA 4AAXA 4D8MA 2LIPA 4UBNA 2YXPX 2V4VA 4DMHA 4X3CA 5G04L 4Z2AA 2V9ZA 1VLQA 2E26A 5HF5A 5EHZA 1UK9A 2BGRA 2HHAA 4BZWA 2ACKA 5IFTA 3R40A 5JAPA 1DQZA 2YG0A 2VT6A 5IHRA 2WU4A 1EX9A 2CEKA 3O4JA 3R3XA 2PM8A 3WK7A 5CXUA 4U2CA 1W0NA 2RGUA 5ESRA 2X10A 1G5FA 1AC5A 1ZJ4A 3ANTA 5HK8A 1FFBA 4X94A 3O95A 2RV9A 5A7FA 3CZJA 3K46A 1C7JA 2BAGA 4DEQA 3OBAA 1MAAA 5JAHA 1JYXA 5DJ5A 1TAHA 3SX4A 1DTEA 1Q0RA 2I03A 4RN5A 2QQMA 4DMFA 2ZVDA 4X92A 2JGKA 2PUHA 3W5NA 3FYUC 4W50A 4BK4A 4FNGA 4DMKA 3PUIA 3VDXA 2AJBA 4CUAA 4XUNA 2VZOA 1QLWA 3T52A 4JKKA 1W9WA 2H7XA 3SK0A 1WHSA 1UXOA 2J4FA 2PX6A 3G9UA 2YASA 2WIJA 4DGQA 4BB0A 3CCBA 3W04A 1CUYA 3I6YA 2HA5A 2WILA 4EA6A 3QMWA 3H19A 5FXMA 2XE4A 4IUGA 3IBTA 4KYVA 1N1MA 1XROA 1XRLA 5CH5A 5AKEA 4KWUA 1TQHA 4BTVA 4OSEA 5CT4A 2RI6A 3ILSA 1R50A 4QWMA 2WN2A 3O4HA 4B80A 4OYUA 1DWPA 3R3VA 3SKJE 1TG7A 3ESAA 1WB6A 3FCXA 3AZPA 1FJ2A 1E3QA 2BGPA 2ZJFA 3C7OA 2QKYA 1T2XA 2HRRA 3A7QA 2PQSA 1UOOA 2OCIA 4QX1A 4JKMA 1UXZA 1ACLA 3WWPA 4J0HA 3GFFA 5CT6A 1BS9A 2HA3A 1XQWA 3UESA 4YASA 1LPSA 4LXHA 5AM5A 2O7VA 1WHTA 5IVKA 2VATA 2WM2A 2Y1KA 1UZ0A 3J7HA 1IUNA 4X00A 4A6OA 5AM4A 5DYTA 3STYA 3NNGA 4BZZA 3H2KA 3C8HA 5LIPA 3ACFA 1DX6A 1QIGA 1XFDA 2JGMA 3D2CA 5DYWA 2B9VA 4ZV7A 4QEKA 3QZUA 3DKRA 4DYHA 1EDEA 1MJ5A 1XZBA 3FHAA 2YC2A 2O2HA 1ULOA 1CUFA 3IUJA 5ALUA 2W46A 1GOFA 2PL5A 2ZEWA 2WUGA 1PMJX 2DCKA 3LEKA 1XNAA 1P0QA 1ETHA 2O7RA 1IZ8A 4BAGA 5D3KA 2QJRA 1AGYA 4J7AA 4PW0A 1UY3A 1GPKA 5ALNA 3AFIA 1EVQA 3ACGA 3WK6A 1H6YA 3ICWA 5DNWA 4CCYA 4MEBA 1YSCA 2Y64A 2HA4A 3WF0A 2Z3ZA 2VQ6A 4J0CA 3FL7A 2EICA 5IFPA 2XQIA 2VJBA 2XQKA 3W06A 1XZKA 3UUEA 4A23A 5AKJA 5JZ9A 1UX7A 2CB9A 4LIPD 3WNOA 3QM1A 1VJ5A 4MXDA 4Y2JA 2JE8A 3SC2A 3ECQA 4Y2UA 4PSCA 3E1GA 4AXBA 3NJXA 1TKRA 1W4LA 3SWWA 4RYDA 1R4ZA 2JGJA 2XMGA 4V2IA 4S0XA 4FFVA 3C8XA 3PFBA 4MQMA 2H7CA 1UMIA 3DQZA 4KI5M 3KOOA 4ZZ8A 4KMQA 2GYVA 4Q3LA 1JI6A 4BP8A 2DFPA 4XZUG 3P6BA 4W1QA 1IMJA 4Z49A 3DJYA 3BDVA 3I2HA 5C8ZA 4AZ0A 4H7DA 4XUOA 4ZI5A 1XPWA 2VF2A 4MJ3A 2HM7A 1NX9A 1UYZA 1UY4A 3VDAA 2OCGA 4ZREA 4YPJA 4OUEA 1XRNA 1T4MA 3A21A 4G4JA 1Y7IA 3WF1A 5DYYA 5F4ZA 1O8SA 5FUMA 3HEAA 3FSGA 4WY8A 2WTNA 5EGNA 2OQIA 3ABZA 4IO0A 3G0DA 5JXIA 5CXXA 5CZKA 5C7GA 3R0VA 1UWCA 3JWEA 3F98A 3G9TA 3PF8A 5IJRA 1VKHA 5FLKA 3G9ZA 1EINA 5CH3A 3DNMA 4WJLA 1NUKA 1RP1A 2WFZA 1DWQA 1U4NA 2VTVA 3A2LA 2HA2A 2YC4A 2CDPA 3JYHA 1W9SA 3F67A 2VZ1A 4IQ4A 4G9GA 2QUBA 4B9EA 3A2MA 2XUDA 3E3AA 4Q3KA 4OMDA 3WQHA 5K3FB 3ZI7A 1QO9A 4OCZA 2PKYX 2P8SA 3O0DA 1JZ2A 1YB7A 3RLIA 4W1RA 4CIBA 3W9BA 4CG3A 4H7EA 1K8QA 3RK4A 3I6MA 4AX4A 4Q1VA 1U65A 1E8NA 4AMZA 3WNPA 1IVYA 3PFCA 1CIJA 1WCQA 5LZ5A 2I78A 2ZYIA 2FUKA 1JYWA 3DDUA 4AO6A 1QIKA 4LXGA 1YB6A 4A45A 4DNQA 1WM1A 2BERA 1E66A 2YYSA 5IVDA 2WQZA 2QQIA 1VA5A 2AXEA 2XUAA 2FJ0A 2Y6JA 1UYXA 5AKIA 2BUCA 4MADA 2ZSHA 1J2EA 1O6FA 5HFNA 2V96A 4X90A 1K3IA 2Z4FA 1LBTA 3T08A 5LZ2A 1O59A 4X6YA 4KRXA 4UHFA 1FFAA 5CW2A 1ZD5A 5FKJA 5K3BA 5HPOA 4XUQA 1L7RA 3WSOA 1G66A 1OF4A 2W9XA 4RE5A 2WIDA 4KE8A 5JASA 5HXMA 3AILA 4Y2YA 1HKHA 2VT7A 2L9LA 3H2JA 3ACIA 3P1IA 1ORVA 2I3ZA 4HG6B 2QS9A 4BCCA 1N8SA 4PQEA 3C7FA 4G1FA 3BDIA 2Q0XA 5DNVA 4J0DA 5LA2A 1HDEA 2XI4A 4KAAA 4QE3A 1DLCA 3ESBA 1F6WA 4YX9A 5JXGA 2EDAA 5ALKA 2VJAA 4N5HX 5BWBA 2WDBA 5HCUA 1SCQA 3HXKA 5AI4A 4P00B 5BWCA 5B4XA 4DNFA 4H18A 4UI9L 3WKDA 1E5TA 1K42A 4Y9SA 1GU3A 3C6XA 4X7BA 3BXPA 4AG4A 1VXOA 3EQ7A 4Y2XA 1LPPA 1QGED 1UT6A 1AZWA 1LPOA 3WJ1A 4EY6A 1DP0A 5HQ3A 1CZTA 5E2IA 4WY5A 2J1UA 3UETA 2JF0A 3B5EA 4F5ZA 4UPDA 1Y37A 3W9UA 2J1VA 2ACEA 4JH0A 2VZUA 1K4YA 2CMFA 2XT0A 4C89A 1ZD3A 2Y6UA 2XB6A 4KAFA 3C7HA 3AIOA 4U2BA 3VKFA 2BUBA 2Y2VA 1K5PA 2Y8KA 2HA7A 1ULPA 3F8SA 4L0PA 3ICVA 2CZQA 5AM0A 3EQ8A 1R9MA 3RM3A 3GBSA 1FFEA 3OOSA 3C45A 3C5VA 4QX3A 1FSSA 1PFQA 4GWLA 3K6KA 3FLEA 2J1RA 5C8VA 2WFLA 3ZPXA 5CTAA 2Y6VA 1CZSA 2QT9A 3BWXA 2JGIA 3QBJA 4ZGBA 3CMGA 1F0NA 1DU4A 1JFRA 3M82A 5AKYA 5JAUA 1YA8A 4G4GA 5K3CA 5IVHA 1XRRA 4E11A 2WN3A 1GXSA 1QZ3A 3CKHA 3KDAA 3NJVA 4UBMA 3G0IA 2J3DA
chains in the Genus database with same CATH superfamily
1KU6A 3JWJA 2VHYA 4TZ6A 3L1UA 4KPUA 4KQFA 3VI4B 3DBRB 2V5DA 3EG9B 3L3BA 4Z0NA 4AVBA 1YQ9A 2FVXA 4KITB 4MUHA 3VD5A 1LK0A 5FYHA 2CE7A 5EYYA 3L1HA 2B46X 1G21A 2J9FB 3IAHA 2VZTA 3K1AA 3C87A 4OO3A 3ZNQA 4DKXA 3DFMA 1EXDA 4MRSA 4D4GA 1MT0A 2TRSB 3W05A 4BQNA 2OR3A 3ZJTA 5DWVA 2FW7A 4ARBA 5BSFA 1XA4A 4SBVA 5A6ZA 4IXTA 1HDCA 1U2TA 1Z4NA 4CE8A 2Q0AA 1ZEMA 4GPBA 4F7DA 2WFF3 2WIGA 3NWOA 1ZZCA 4CEHA 4A8JA 2WJIA 2J85A 4BNTA 2E4UA 3L0YA 3A6LA 2GPSA 5A3MA 2Y26A 3TLEA 5COQA 3FC0A 1EDDA 2GRUA 2HYIC 2CLCX 3ORYA 3HQ4O 1T4CA 1E7WA 4NQRA 3HGTA 2IXDA 4E4ZA 4KXXA 1Z0FA 5KTMA 4EENA 4G1MB 5B37A 2YWCA 1NVAA 1M8KA 3C6MA 3VYRB 1OF3A 1NYQA 4L5CA 3W79A 2A9FA 2DBIA 1O0BA 2J1SA 4FSJA 1E63A 3D3EA 3D3KA 2D7CA 5AW1A 2Q3HA 1GHTA 1C4OA 2ID8A 3IUQA 2LR0A 2EG5A 1P9RA 1QGOA 3ORFA 2C26A 1NYWA 3OQOA 4L95C 3BWDD 4ETWA 3DUFB 3GLIB 2FMTA 5CVCA 1VE7A 4J76A 4JJKA 1TZMA 1CTQA 2RHGB 1W0KD 1CUDA 4X5OA 1U02A 4MWGA 1NLZA 1V8BA 5IDQA 4MVJH 3P71T 4J0QA 1GFZA 4LWQA 5EIBC 3POJA 2WZPP 4NSNA 2YJ3A 3IP1A 4ZAZA 3U09A 2X0IA 3AIMA 3DBRA 1O96A 5EKUA 2CFRA 3CJIC 1UC9A 1UEIA 1SHTX 3H3UA 5IK8A 1UBGA 2OHJA 3MGAA 1QFSA 4PWYA 2IC1A 2VD7A 1H2XA 4PHCA 3EX7C 3GRFA 3SYNA 5EHXA 3LS2A 1QTIA 2RH4A 4NP6A 3I53A 4I1UA 3GOHA 2YYAA 1A34A 1IKPA 5JVDA 3TEWA 1F4AA 1H9BA 1JLMA 1GZ9A 4BKQA 5KSWB 1IBSA 5JD6A 2XZDA 2FLWA 3GIWA 1YIFA 1K4KA 1OLSB 4AJJA 5J37A 4DT1A 4A5SA 1XVLA 1IEWA 4R7TA 1DG1G 4E5VA 1P2VA 1IOWA 2GDFA 2Y1DA 3OZIA 2XVZA 1E59A 2HA0A 2QVCA 4QULA 2GASA 3VKNA 3QSYA 3VBRB 3DFFA 4AKIA 5DI3B 4LJ4A 4WK0B 3H6GA 4YONB 2B9EA 2G9ZA 1EGQA 1UPBA 3CKMA 5IBPA 1CT9A 2A1XA 2R6R1 4OPMA 1GQRA 3WDKA 3OIUA 4HOYA 3BRWD 1XZDA 3UH1A 1NGSA 4I7EA 3ORHA 1P0IA 2ZAHA 4NECA 1XEAA 4NARA 4M83A 3WNCA 2XUJA 4HNAA 4EUFA 3ZMOA 1OQEA 4NHMA 3MYYA 4CA9A 1V8OA 1BQEA 4CPBA 2AFIA 4IG9A 3KKQA 5F7OA 1D2EA 3FUWA 1GFWA 4LORA 6GPBA 1EJ0A 3D1VA 2ZR9A 3EBOA 3OZDA 3AT1A 3SQMA 4INPA 5AOBA 5FYBA 5B3LA 3K75B 3RIGA 5K8VA 4WA7A 4C6RA 1AKMA 1OA4A 1R9GA 3JTMA 2JCBA 2BZGA 2MR5A 2CMHA 1W5EA 5BYAA 3EXFB 4BJ3A 1EWQA 2P6UA 2EP5A 4LWPA 5T4EA 4M4SA 1L5QA 3I6ZA 2NV6A 1HZJA 1V9LA 4LKSA 1UWWA 4PICA 4E30A 3NT5A 1M6WA 4YAOA 3LQCA 3VVLA 2O1XA 3M6MD 3IURA 3RUEA 4OJQA 1BE1A 4IEYA 4CDQB 2JC3A 3C5CA 4PGMA 1NURA 2CXRA 5LA0A 2QYTA 5KTTA 3THPA 4UNPA 4P4SA 1Z4PX 1KI3A 2YFHA 2JLXA 1FMJA 4EHHA 3HCBA 1PK7A 5LDGA 4EJ2A 4K0KB 3AXEA 4B3CA 1Q6ZA 3RG8A 3F5DA 2FPKA 5A4JA 1SC1A 1Q8PA 1SGWA 5JC8A 3KVVA 1TIPA 2IUSA 1T43A 2BKLA 2UVQA 4NPMA 2YZMA 4IWNA 1ZLXA 5C52B 4A3ZA 4EVRA 4RX1A 3Q5DA 3M2MA 1KVSA 2XWJB 4LMBA 4BOWA 3GZAA 2B25A 4H14A 3I8OA 1O4VA 3JSAA 4RIFA 4WCDA 4QL3A 3A32A 5EFUA 5C8CC 1M5UA 4G5QA 2DH5A 3OOJA 2XUOA 1WEHA 1Y5NA 1IJEA 3EZYA 4TYMA 3DMYA 1C9NA 1H4SA 2FF5A 1YQ5A 4LBNA 2UYAA 1JZQA 4OAOA 3E3NA 3ZXXA 1JG4A 1AOXA 1BXRB 3MCTA 1X1EA 1W5FA 4EB0A 2XLCA 2B37A 2AUTA 1XNGA 3L05A 5BSVA 4OMFG 4GD3Q 3LO8A 2II6A 4I4TA 2GBLA 5GZ6A 2ZX0A 4GMXA 3I5UA 1OXCA 3ROZA 4JYMA 2WWGA 2PWBA 4XXHA 3J7NA 1BXGA 3DMTC 5TSWA 4GI1A 1DAIA 2P5YA 5TT1A 2GBCA 2W47A 3OF2A 2OWEA 1LHVA 1MVEA 2HLHA 3K9QO 4BN0A 3DVAA 4P4UA 2WIKA 4H2AA 3DPUA 2O4CA 3E03A 3SHVA 4TGLA 1SCIA 4DCOA 2JA1A 1TM5E 4OYRA 1NM5A 5AXBA 1RWBA 4ARYA 5LYJB 5C4GB 3QLVA 2C5EA 3UMRA 5JAMA 4CZ2A 2JG8B 1OZHA 4MOWA 1BBT2 3GY0A 3O47A 3DMRA 3WDUA 3ZXYA 4I0WB 2BM9A 3SM9A 4B48A 3BBLA 4DEYA 2IEAA 2C2MA 4E8CA 4W5HA 4TKZA 4RZSA 3ZWYA 2YPDA 3QG1A 4ONUA 2PX2A 2LALA 3OFNA 1WLTA 2HBYA 3L9JT 1NZIA 1VG0B 1FK8A 4CM9A 4N40A 2P68A 2MSCB 5ALQA 1WLYA 3I04M 2E4ZA 3K4PA 3LPGA 1P6UA 1V39A 5DAQA 1Q8QA 1E3JA 4L6CA 4KG8A 1O9HA 4RA0A 4J16C 1MRZA 2RC6A 5CEJA 2Q29A 4IDCA 3PSHA 2BMVA 1G8YA 5CNMA 1T3ZA 4ZDKA 3O90A 3FHQA 1W88B 3ENZA 2H8GA 4BDSA 2WAXA 1TJPB 1WCSA 4LXQA 1XE8A 1Q83A 1RXYA 1LDNA 5C35A 4PX9A 1CY1A 4MQ6A 3C16C 4OYLA 1Q77A 3HACA 9ABPA 3K6SA 3RQSA 2DWQA 2CHQA 3K9FC 4YR7A 1HT0A 1Y4SA 2O0HA 3JAWA 3KZVA 5L6LB 4CV2A 5CURA 2NUTA 1GV0A 4Q9DA 3K09C 1R88A 2WWHA 1US3A 3FVRA 5KAPA 4RFSA 4B6FA 1WBLA 1QR2A 4F9TA 5F98A 4R8VA 3LQ2A 5JT1A 2IPLA 1VECA 4CP1A 5HOEA 3Q9LA 1RUF3 4CMCA 2XNDA 2R7EB 4EPTA 4CODB 1MKYA 4UDOA 2GF9A 3NXKA 4LYDA 4IDHA 5KJFA 1M8PA 4LBOA 4N5IX 1T0UA 5BRNA 1MNAA 3BODA 2YW9A 1DLJA 4BQ4A 1Y9EA 3BREA 3WXPA 2PA7A 3MUFA 1JXNA 2YCLA 2VZVA 4QGSA 3PLAE 2XCLA 1U2QA 4ZAYA 1XA0A 2HFKA 1NN3A 2DRIA 3LEMA 2NZJA 2R6GA 1USVA 4LO7A 4OBWA 4C30A 4AF7A 2CVZA 3JASB 5IU6A 5T4HA 3ZO0B 2BGNA 4TXNA 1ODIA 3MB8A 1SCBA 5DCUA 5CT5A 5CA0F 2E3JA 1SBNE 4GH4A 3MW8A 2WM9B 4UMFA 5ALLA 1AQNA 2YYYA 3PRKE 2NQ2C 2PQQA 3QUTA 3FJOA 3DO5A 4Q16A 1EM8A 2BNMA 1K8XB 3TL6A 1OBNA 2FSVA 2KE5A 5EHNA 2ZJ3A 4JHLA 4FDUA 1ZUNB 1RB8G 4DJAA 1JFFA 3BTYA 4MGZE 3V8EA 1UM9B 1Y3AA 3BZUA 1CAVB 3TKAA 1Y9MA 5AK4A 2N9UA 2LUWA 2BUAA 3VBOA 1GZ5A 2PT9A 2WG2A 1GG8A 2RJ2A 3AB3A 3LBIA 4AULA 4MH0E 1SHLA 1Z62A 2EJUA 4KCGA 1UOEA 3U3JA 2Z6UA 1BHGA 3QLJA 1PHRA 1HDKA 3T95A 3FTCA 1JG1A 3SDZA 3COJA 1VL2A 4OUDB 4BJ6A 5H16A 4JJFA 4HGZA 2P5TB 2VNAA 2WWXA 5T5PA 1DBNA 1ODTC 2H4ZA 5IW0A 2HPAA 4RHEA 1UAAA 1KS9A 4RPGA 3L07A 1LDBA 1OHFA 2HX1A 1U0HC 4PQFA 3RVRA 1QJU2 2AIRA 1O7FA 3HWSA 3GXOA 1O9GA 3C6ZA 1J2TA 3HEBA 4B3NA 4MW5A 3VNVA 2XGJA 2Y0DA 4J03A 4BQEA 1X80B 1LLDA 4JV5B 1GNYA 2VNGA 4DMRA 4LC1A 4R8HA 3TBDA 4YRAA 3IO3A 3B38A 1NYTA 4AJEA 4I5GA 2HUPA 4TRNA 3PK0A 3GQBA 1EP3B 3ZYIB 1RTKA 2A86A 3I8SA 3OH8A 3BFKA 4ZHQF 1CZHA 1Q5PA 3T7JA 4E6PA 4LDRA 1U5ZA 5CB7A 2FUG6 2PX0A 3TIFA 1FXUA 2N42A 2BEVA 3OBBA 5AKHA 3TEXA 5A03A 3WLEA 1YJAA 1ULHA 3PQ8A 1YL6A 4F86A 2JH3A 1OFTA 2P0YA 1VCMA 2WC2A 4GALA 1YDEA 3I28A 4BRUA 3MYXA 2HQOA 2VUSA 3OZRA 4DIOA 3KUKA 3C3EA 3ZVRA 5E4TA 1UCFA 3OY8B 4D4JA 1ENZA 3TZEA 4QPGC 1UKZA 4B5LA 3VV2A 4XJ9A 2VYFA 5BN5A 1QS0B 3AY6A 3EVFA 4DLSA 1OXVA 4CVUA 2B2CA 3N28A 4LZNA 1YZGA 3HNRA 2FCRA 3EXEA 4J0JA 3UKOA 4LEJA 1HQCA 2C54A 4P2BA 1RM4A 3I92A 5CBKA 13PKA 1N2CB 2QM8A 4GWMA 5G4KA 3GZNB 3WZ2A 4LHWA 2Y2UA 4B7ZA 1CHNA 4PN7A 1WLDA 3OOEA 2Z2XA 4RIGA 5ADVA 1AGRA 1H9PA 1XKLA 5IULC 1QQP3 2J5QA 4WDQA 3KJIA 1I1NA 4C88A 1Z78A 3MI8A 3QKRA 3P2EA 5I9MA 2VZ8A 4NVPA 3KLOA 1LSUA 4UPVA 4O4JA 1KOLA 3DBHB 1TAQA 3GDBA 2ZRLA 1YR3A 1CBUA 1RJ7A 5DM0A 4K9OA 4OIFA 5E2BA 1LTEA 2WFMA 1HZZC 4U00A 2WFPA 1DOHA 1JFLA 1ECCA 5K2OA 5FI0B 5C34B 2O0KA 4LF4B 3PJGA 3R3WA 1M2HA 2H1OA 1O5IA 2YGMA 3KPVA 4GZLA 4IHQA 2ZWPA 3T3OA 3Q3GE 4XFHA 2XDYA 2NO9A 1X70A 3AMPA 4W6ZA 1C9EA 4EG8A 4A2WA 1NNEA 1XX6A 4GBGA 4OBXA 5CCXA 1M7BA 2QVZX 2YQ5A 3VJMA 2UWAA 3MJDA 4HQLA 4K28A 3BHNA 2D6LX 1ORDA 1JH5A 5DHUA 2UZ4A 2O2JA 1JZTA 1KO1A 1M6EX 4H1VA 2Q8OA 2QLJA 1E9RA 2VHXA 3RARA 2A0FA 1ODSA 2ZJ8A 4CUGA 3D3QA 4WXRA 2PLWA 4I55F 1LODA 4HN0A 3KHTA 4MO9A 3GLRA 3NAZA 1D5WA 1Y3HA 1R27A 5DHQA 2CVQA 3CURA 1PVVA 3L1IA 2LIPA 3BWVA 1WSAA 4CCDA 5CX1B 3IIMA 4ZT7A 2BGRA 1K92A 4B6EA 3R40A 2EFJA 2FSGA 4CMAA 1U28C 3D6UA 3JALA 3HUUA 5DULA 1X87A 3NBMA 3UA3A 2RV9A 2PYIA 4D0SA 1WSWA 2HMSA 1J5XA 3B9BA 5DJ5A 4MGIE 1IH8A 4CN8A 4PC1A 3HR8A 1Q0RA 2I03A 1JB1A 1NLUA 3TW0A 3OCVA 3BOPA 3U39A 3DBLA 3SK0A 3EOZA 3NAQA 4JEMA 3JPYA 1HETA 2CXSA 1KITA 3WHPA 1LDEA 2AOXA 1Z74A 3VR4H 2JAXA 7MHTA 3HVUA 1PLLA 1T1JA 1TZJA 3UT5A 5IABA 4XYEA 5I9SA 5CH5A 4M0NA 4LDJA 5LDHA 1JKJA 5D21A 1R50A 5LBBA 5SY4A 3W0LB 3O4HA 4HLTA 3LHKA 1E18A 3E5QA 2DHRA 2A5ZA 1E3QA 4MK4A 1E7SA 1PO23 4N49A 5CA0B 2J0EA 4AZ3B 7ADHA 1KVTA 1WBFA 2P75A 5FOBB 4CEYC 1H8HA 1OLME 3L49A 3ZSEA 1TM1E 1F2TB 5AM5A 4YQZA 4Z7QB 3G0HA 1F5FA 1DKLA 3RYIB 2FU5C 3O8RA 1NBMD 3A4MA 1WDKA 3BMNA 2A0XA 1JQLB 2OC9A 2CV0A 3D2CA 3VGJA 4YZ3A 2Q49A 1DYKA 1MJ5A 1RAEA 4BFZA 2YC2A 5IWAB 2K46A 3N7TA 4JKIA 3IL2A 4DQKA 1IAQA 4LSZA 2ZEWA 1PJTA 1V1MA 3OPVA 1G38A 2O7RA 2DF8A 1P6QA 2ZIFA 2Y0PA 5DLQC 2Z4RA 1ZM2A 5A7WB 2DFBA 1K0UA 3WLRA 3MGUA 3QM1A 2JE8A 1MW9X 4XYBA 3SC2A 2VMGA 3D8NA 4KWEA 1IM5A 3B85A 1LX6A 2I0FA 3NPAA 3EY9A 3A27A 4CV0A 3T4HB 5F1PA 4TKVA 1ZITA 5KOIA 1RMU2 3KQTA 1PSDA 1SWWA 4RVFA 3EJWA 3O8CA 5CLHA 5DNYB 4LLOA 1VJ0A 2RSLA 4R4XA 3NBXX 3CWZA 2WYUA 1OY1A 1QRDA 4W1QA 1YS4A 2E2WA 2NUPB 1E2GA 1Z88A 4KDRA 1JECA 4XLZA 3ME5A 1UZLA 3BDVA 1J4AA 1KVUA 1RRMA 4AIRA 5K7PA 1ZD8A 1RWWA 2VUTA 3VDAA 4PFSA 4NDNE 3ZY2A 2VXYA 3L93A 2ST1A 5KYXA 5D3QA 1PLJA 3RS8A 5LA6B 5CITA 1V43A 3WGKA 1U0OC 2DFVA 5JCOA 4JYZA 4I4LA 1GAEO 3J7LA 3G9TA 4UT5A 1RZ3A 4ZU5A 1CX4A 2KLHA 2CZGA 3TX2A 2R1TB 3QE3A 5FWXB 5L45A 4LOIA 4RO0A 2CDPA 2Q8CA 4C5AA 1QRTA 4TTPA 5FFOC 3I05A 1E69A 3KZXA 4F3RA 5F5AA 3OZ7A 1TU4A 1KH1A 5JQWA 4G1UC 2WP0A 4H3KB 5AVXA 1J0EA 4Q1VA 2H6EA 3DEFA 3FMPB 5H0IA 3BI3A 2X2OA 4JENA 3U61B 4WZAB 5FPTA 4FP2A 3ZWDA 1JJ7A 2RDQA 3JR7A 4QNRA 1PN3A 2XKBA 4EA7A 4LBVA 3H86A 1ZSYA 1KIFA 4H55A 4ZCIA 4U7FA 4UXHA 2R061 4X24A 3SGLA 1XZQA 1Y6RA 1AH2A 4ZODA 1N0VC 4ZVMA 1VSBA 4B2PA 3UWMA 1ZMRA 3RYCA 4JLDA 1OKOA 1E5LA 1LBTA 1I2CA 2X4DA 4X6YA 4X41A 2QU7A 1FFAA 4XWAA 1LBQA 5J2TB 3WGGA 4RE5A 2ZFUA 3HLTA 3MJSA 3GGJA 1K7CA 4YY3B 2GC3A 4AXOA 4G37A 4RMNA 2CDCA 3VO8A 5E95A 3K9CA 1VLZA 4X20B 2NTJA 1P3JA 1K5MB 3PHBE 4HEJA 3T1QA 4BQQA 3LGSA 1QHHA 1TCVA 2ZMLA 1A9XB 1JDZA 3C7CB 4H18A 3UFXB 4MGEA 4ZJZA 1GU3A 1HDIA 4HG2A 5A5VA 5M29A 2ACVA 1WW5A 3E8MA 3CF2A 4F5ZA 3RDIA 1U8CB 3T3YA 3RYIA 1TCUA 2DBNA 1COWA 1TMF1 2QQWA 2NVBA 4TYPA 3VU1A 1H2MA 4L2IA 3BMQA 1FV2A 1PFQA 3PHLA 1XTQA 1J58A 2J1RA 2V7XA 2OV3A 3MHTA 5CTAA 1DAHA 3V33A 4XZPA 4ITCA 4ZXKA 4JI3B 2JGIA 3K5IA 2VUIB 1RKXA 1V45E 1U1DA 5KNDA 1F3OA 4FGSA 3PWSA 3LBYA 1YJ8A 4XEHA 3I01A 2PHDA 3Q3VA 4QXRA 4QASA 4CFYA 4AI6A 3BF7A 1Z5PA 2CLDX 5DEOA 1JT2A 3QQPA 4QDOA 4UHDA 2PRZA 4CTKA 1I36A 4FHZA 3KTAB 4AHZA 4R81A 3V5NA 2D3WA 4GA9A 3R7DA 4D3YA 4JI2B 1R12A 1K7EB 4IQGA 2PEZA 2PKWA 2JDKA 3GJYA 1UY0A 4ZIRB 5LQDA 1KJNA 5AUPB 4DCMA 5KWVA 1RXEA 2DX7A 3GARA 1VA4A 2WSIA 5C7YA 1M2VB 3N9QA 3S2IA 4JLNA 4D8WA 4ZMSA 1S0GA 3FUOA 2H7YA 2E4AA 1XCOA 1Q3KA 4B1LA 5FO0A 3NUGA 2VUJA 1PCXA 4IRXA 3GI1A 2XGXA 2XVKA 4AE2A 3BE4A 4JJ7A 4IL5A 3V6LA 2XJRA 3KDPA 3SDSA 4FAGA 4M4PA 2ZJ5A 4BMPB 3ZXDA 3GJ0A 5H7XA 3E5UA 1QX3A 2SKEA 1D7AA 1B6TA 1ZJJA 4YRZA 3BKXA 3LPDA 1NW6A 4MVJM 1E58A 2R1TA 3V4VB 5DM70 2QAIA 5EZQA 1DRUA 3J8F3 1E9FA 2GF2A 3OM0A 4DR2B 3ZFFC 3R9IA 1P19A 2WWVD 3ROFA 4AJ4A 4DT1B 3HCPA 1OPOA 1QWRA 2KJQA 4I50B 3EN0A 4H1WA 1G291 4YK7A 5BT9A 4BV2A 4HQRA 5AVJA 2G25A 1RPNA 2JH8A 1ODLA 3SF8B 2AOUB 1MA3A 2ZYSA 2Q99A 3QBTA 3I3MA 2PMWB 2R49A 2G17A 1Y3FE 2XUPA 4JR1A 3QJ5A 1VL8A 4XX0A 4ZOQI 4Y18A 1U63A 2IU6A 4ZVPA 2DY1A 5LCWL 1PT6A 1NHWA 3LFIA 3A0RB 3PYMA 1F8XA 4LCBA 1X1CA 1YQEA 2WDZA 5FYYA 1IHMA 1JW9B 1ZAYA 3OJEA 2WB2A 2WY2D 4Q1EA 2GHQA 1X14A 3SHOA 2WUDA 2ONZA 4IVPA 3GVCA 2F48A 5J1XA 2QUZA 4EPWA 5ALTA 5AICA 3KWMA 4XRRA 3KJGA 2JG9A 1N5JA 5CKQA 5JO0A 1AL21 2WTMA 1RC0A 3N75A 5AW6A 4UDNA 1P2DA 4OHKA 5EN4A 1PJSA 2PBLA 2BCEA 1X7GA 4EG0A 1HBJA 3HD8B 5A06A 4H27A 1EGMB 1PG2A 1UD1A 4WKGA 2IHNA 3QOYA 1IOZA 2H0AA 2I76A 3E9RA 4L72A 1YI1A 1JTZX 2VJNA 1TW2A 1BFUA 4W5OA 4DJDC 3EA5A 3SIPA 1US2A 2HGZA 1EAH3 5F2WA 4YBZA 1LSJA 5ALWA 2BTQB 3GLSA 4OB6A 2FPGA 4L07A 1KEXA 5C1DA 2NYYA 4MHOA 2FPPB 4PT6A 1FP7A 3JASA 1NW9B 1XWWA 1U2DA 4RHV1 2D1FA 4NOLA 1W9MA 2DTEA 4Q1PA 1OWNA 1OI7A 2D5FA 4NBSA 2ENUA 1WXWA 6NULA 3EUEA 1VL1A 4P4TA 4BNUA 4IOLA 4FYYA 3CUTA 4BLTA 4WBNA 3S70A 2ZT8A 2Z09A 4WUTA 1E6MA 1EFPA 1D2MA 2R7KA 1OYWA 1KZ4A 3ETPA 1O97C 1VJGA 3T3MB 3OD0A 1MVQA 4IRMA 5J2TA 5A7HA 1XK6A 3A1EA 5GM0A 1F35A 4P92A 4ETMA 4J3NA 10MHA 1EK5A 1L5KA 5BNOA 1A9RA 1DQSA 4KYTA 4D8UA 4PPGA 4FOTA 1V71A 1G2PA 1YMVA 2VRBA 1VBD1 4X71A 1FOEB 2AX3A 3ZY4A 1ULDA 1BJTA 4F12A 4AJ1A 3W9AA 3TM4A 1EJBA 3K3NA 4Q21A 1IOLA 4J0FA 5ARDA 4GIQA 3H1PA 3LEIA 2HJIA 2OM2A 4NONA 5LYJA 4ZP1A 1FUYB 3B7GA 3HU2A 1RUI3 4NK5A 1ZI6A 4XF4A 3P0RA 4NIIA 4OUMA 5EFZA 2ZUWA 3ZHVA 4OHBA 3FSJX 2G9RA 4E4HA 4IRUB 3ZV5A 3B02A 3ZSMA 3DTTA 1OFVA 4MUGA 3NGLA 1DIOB 5HTKA 2E5FA 1C1DA 4UUQA 1BYHA 2FEXA 4CIVA 2JZOA 2EX1A 4EI2A 3IKMB 2XUGA 4EB8A 3OA0A 5HDBB 4HEA1 4FO9A 1LK7A 4QGHA 4LJ7A 1Z83A 5DAWA 4E14A 721PA 3KUXA 3DEAA 2J3LA 5KXDA 1ZXBA 5KHKA 2PL1A 1MS8A 1H2RS 2BI4A 1VB3A 2WUVA 4NZZA 1TMYA 4U0KA 3GLKA 1Q7EA 3KZCA 5AJYA 3LIPA 4QU0A 2PGDA 2ORWA 1H1TA 4HCJA 1U0TA 3GRPA 3OC0A 1EM8B 5AESA 2DGDA 4UUMA 4XX0B 3WIEA 5CFDA 2Q4SA 1MABB 1CPYA 4DLUA 2JDNA 3GAMA 4B6PA 4OX9B 2A59A 4CUBA 4CEWC 4KK4A 4B71A 4TX1A 3ATGA 4HWRA 2HLNA 1JJVA 4K9QA 2CFOA 4WNAB 1LI4A 3N2IA 2BGTA 4CDUB 1Z75A 4HBNA 3CYFA 1HKDA 1JDBB 2HLPA 2I22A 3D31A 4Z5XA 3F6BX 3AKCA 4BO9A 5EJ1B 4OXIA 3WQ0A 5FZKA 2XGOA 1GP5A 4I55A 1CZOA 4EN6B 2QLFA 4CIAA 2VG9A 3RWKX 3HCNA 3TLGA 4L8YA 1M0EA 4JDOA 5HKOA 2ZAYA 1OVSA 3OSDA 1HRI1 3UMFA 3DPIA 4C5BA 3GGSA 2JXAA 2WO7A 3IMMA 5CP8A 2UURA 2W2XA 1SIUA 2VG8A 3WLFA 3PPXA 1UANA 2BGIA 1I0ZA 1C4KA 5D1NA 4GZ9A 4BV8A 1XNBA 3A4YA 3TN7A 2VJMB 4RULA 2YZGA 3JQ7A 5IN5A 3CBQA 1LU1A 2Q45A 2M98A 4N7BA 2IZ0A 2RGYA 2OTCA 2VP5A 3NDPA 4LGCA 3VAAA 4MTLA 3KYJB 1UFRA 4O9EA 4LJ8A 5JANA 3SVTA 1I3NA 3OKFA 3HK2A 1IS4A 4WKNA 1II8B 4K03A 2B98A 4B5KA 2GNAA 3FZEA 3STWA 2OMEA 1ULZA 3RTCA 4YVSB 2O2CA 4E5NA 4YG3A 1B1CA 5B36A 1DADA 1R00A 1S2IA 3TPCA 4ZN6A 3UBMA 4ZQFA 2UYGA 1E2HA 2EXJA 1F0KA 3WL8A 3Q0EA 4AQ7A 3PPIA 1GGVA 2YHIA 2MSNA 4IHJF 5FA6A 3DFZA 2DETA 2XE7A 4Y2QA 4B7CA 3LIHA 1ULFA 1DS6A 3QMPA 4IHJB 2OA0A 3FY4A 3E9CA 1ZHHA 9LDTA 1BE0A 3Q7SA 2HLEA 4WUVA 5F51A 3P3NA 2ET7A 3AZQA 5FP4A 3BTOA 1UU5A 2ZIZA 4KREA 2VHZA 3FFWA 3WQ7A 4HQ0A 3IELA 5FP9A 2PT7A 4YM0A 1HDYA 3NIGB 4HVRA 4BISA 1KAMA 1BN7A 2EJWA 1IGOA 1NRJB 1O03A 4INZA 5DX8A 5GZGA 1PYGA 2PRSA 2XJQA 1RUJ1 3T1TA 1GP4A 2ZB2A 5DCLA 4C0XA 3LF7A 1DFQA 1SZJG 4CLOA 3AP6A 3W8NA 3R0XA 2J22A 5GM2A 1LHOA 2GJKA 2XA1A 1G6Q1 1W9TA 5SYMA 3GPIA 4A8HA 2QX6A 2LM3A 2OVFA 3V1UA 3LQ4A 2WZEA 3PTYA 3SY8A 1NQOA 5TF0A 3BXEA 5JFOA 1WKVA 3ELYA 3M4JA 1I9CA 4W8JA 4YVWC 4B3HA 5J4HA 3CJRA 1MEOA 4DXSA 1ZLYA 1O0CA 1NLFA 4AOCA 1WPQA 3E7XA 3ED5A 2JHFA 1RPZA 4TVKA 4ILKA 4LBMA 1NVUQ 4HDRB 1UY2A 1PWHA 2QG6A 3AGQA 4EHAA 1I0LA 3PS9A 1T9CA 4MVJG 3KLSA 4A41A 1X7WB 2AQIA 3AHDA 4BIIA 5AFEA 4CCLA 4Q4Y3 4Q4JA 3SIWA 1RQXA 4RTMA 5FUYA 1SQFA 3NKLA 4UM8B 4QDUA 3WADA 2IYWA 4BKUA 1Q0QA 3KLBA 5FPXA 1W8NA 3FNBA 1TNRA 1Z5GA 3RRZA 1SUDA 2Z5WA 2Q6LA 1KDVA 1ARZA 3WB2A 1ULGA 4N6OA 3ZZNA 1IQUA 2NZUG 4ZVQA 1WUTA 2R8ZA 2PD4A 4BQYA 3GH1A 1QBKC 3H97A 2R8BA 3U6KA 1PGL2 1A7KA 3BK2A 4K2AA 2DT8A 3P52A 4F04A 2HF7A 4PLVA 3KZOA 1NFRA 1D1SA 5ICCA 2VCMA 2Q1ZB 4KV7A 3HEIA 4FFFA 3TB0A 3CNEA 1KL7A 3L92A 3G68A 1UL1X 5AVYA 3VX4A 3CGWA 3NBZC 3DYPA 2OQ6A 3OECA 1RVF3 1Y6JA 4YZ1A 3DVQX 4ZD6A 2YXDA 3WJAA 4HN1A 3WB9A 3F78A 1DEHA 4DQXA 2WPNA 3OGJA 2XMRA 4F83A 3ZYHA 3HT2A 2HFJA 5F76A 5ES3A 1AL22 1WXXA 3ZDFA 1WLCA 2I1VB 1G0OA 3M4NA 1TECE 4MPPA 1T26A 3K9HA 4S2HA 3W1EA 1X15A 3N39C 3AVRA 2ROQA 3OPNA 4CKXA 1NNSA 4PZPA 4QXAA 3R76A 5I7RA 1ABEA 2XWSA 3IBGA 3K9GA 4I6JA 4CHTA 1VLNA 1QF7A 4HS4A 2Q6OA 3BJZA 1NVFA 1EEHA 2ODQA 2IFTA 1TVGA 1HQDA 4U3JA 3K0HA 4JWKA 4UEJA 5G4LA 3R4VA 4QPZA 3FNGA 1UOFA 1TADA 2VYVA 3SOZA 1THGA 1LS6A 4R4JA 5F7UA 4DS0A 4JLUA 1QOSA 4JP3A 3IMGA 4A2CA 4CIWA 2B7CA 3T41A 5B1SA 2DR2A 3THYA 2QG9A 1UXJA 2Y0EA 3QLVC 2IUWA 3NT4A 3ZHYA 4R2WA 4POAA 3S55A 4LJHA 1H6XA 4KO1S 2B4AA 3TSAA 1Y5LA 1P1CA 5E0KB 4IZOA 4ZVTA 4YVWA 2GAFA 1Y4UA 4C6TA 2GYWA 1C80A 4HZUB 5L3QA 4KJXA 3PSAA 2P3KA 2EYUA 2G28A 4TPKA 1GCUA 3EZLA 2G0TA 4INDA 3VHLB 1W49A 4LE2A 4H17A 1Q74A 5AOAA 4BVKA 3UMYA 4WVVA 2JBHA 3EIEA 3WDXA 3AZOA 5A4KA 2FX3A 1W47A 4AN1A 4P7GA 4Q0QA 3V0AB 2UAGA 2OT7A 3HRKA 3D82A 5H4GA 5KNLA 2CYFA 2ZIUB 3LY8A 4KBGA 1RGSA 4DINB 4PIMA 2XF2A 2IVJA 2XGMA 1SEFA 1ZGJA 2CDNA 3GZJA 3V48A 2GMPA 2QP3A 3UA4A 3RNOA 4DMMA 2VYCA 1DL5A 5HA5A 2Q7XA 1D2NA 4MUAA 5EZ5A 4RQPB 3KCNA 4EAQA 2A0UA 4FU0A 3DWFA 4HFJA 2QQUA 1MTZA 4TOIA 5BR8B 1S7GA 2WMNB 3HN3A 2YVUA 2GA8A 4FKBA 2Q6KA 4P2GA 4KE7A 4UC0A 1UOQA 4RAOA 2IXIA 5JXJA 2UYBA 1JAZA 1DWUA 3DOHA 2O8DB 1KARA 2WHQA 4MNTA 5DYNA 1HLCA 4RSRA 2A3WA 5AKKA 5HIAA 1Q8VA 1KAHA 3SSMA 3EMDA 4COYA 2AZDA 3OWHA 3B1FA 3R0JA 2HTFA 4XQCA 4YT2A 3F5MA 4KR0A 2C0QA 4ZU3A 1UKBA 4N7RA 3THTA 1Q43A 1YUMA 4HK4A 4ZOAA 2M1ZA 3U7RA 1IL0A 3S2EA 3NC4A 4U2AA 4NJ4A 1IJBA 3RS0A 3DKQA 4JI8B 4YCMA 3H8JA 4Y1FA 3ZFFB 4YDSA 1YFWA 2JFYA 2Q6VA 3OIGA 4AUKA 5FUXA 1IUPA 2RKOA 3VDDA 2QM3A 3AUSA 5MF6A 4GKKB 4LV6A 1JTFA 3TR0A 3GEMA 1TFRA 3ZWXA 3TDMA 1LS1A 5EE5B 2FZEA 3P9IA 3G2HA 2VOTA 4UBNA 2V4VA 5HF5A 5FTTC 5EHZA 1NZJA 3S6JA 3QFCA 3UJHA 2ZW9A 1DQZA 5DTQA 2ONJA 2WU4A 4AFDA 3EULA 4FMDF 1NR1A 1IBRA 1XXHB 2YICA 4CKBA 1MQTA 1C0LA 1P9WA 3FRJA 1ZA2A 1JKXA 1PZNA 1QSGA 1UP4A 5B30A 5FQOA 4UDYX 1KJ9A 4LJ5A 4X92A 1JQBA 4B4WA 1M2KA 1YIOA 4RSUA 4F6RB 3PUIA 1GZCA 2BISA 4OEHA 5FTWA 3LBFA 1TTTA 2IOQA 4MMZB 4LMFA 3U5TA 3KG2A 4L8QA 4I55B 1P60A 3WLHA 3ZDZB 3FFAA 2HWD3 2DPGA 3D8RA 1Y6GA 2WYVA 3AM1A 3HWJA 4ETIA 4B4QA 4UCFA 1HT1E 4X61A 2W43A 2IS4A 2JHAA 1DKQA 4ZQIA 4FDVA 3H5IA 3AUAA 5GPBA 1TG7A 5FWAA 2VF5X 1WDLA 2OOKA 3MCUA 4RVHA 2JBAB 3DOEA 1XLTA 2OCIA 5F52A 3VC2A 1JQDA 5JZGA 3WX0A 2AS0A 1XQWA 4KK3A 3VR2D 3GG2A 1ZBA1 1UINA 3RFRA 4OQZA 4BWGA 4FM9A 3NHYA 2VOWA 1K68A 3QUCA 3C8HA 5LIPA 4WEQA 4JGGA 4G5HA 4R1PA 5EJIA 2A88A 4NDAA 5G02A 3JARA 4ASUD 4QUJA 3BZWA 2POQX 2O0MA 1WY7A 3AF0A 3BRSA 2M6SA 3RTBA 2WUGA 1U3WA 2XYHA 4LDZA 5E1OA 2DCKA 2C04A 2ZBRA 1AS2A 1YJCA 4WH0A 5BMVB 2FETA 2C3PA 4KB5A 5D3KA 1QUFA 2WF9A 3UT5B 4RQTA 3RVJA 3WK6A 4FS8A 1HB3A 3O2NA 3OAAA 1L7MA 2Z1MA 1MQTC 4R7ZA 1KZYC 1E9AA 2HA4A 5DTEA 3FRHA 4JI5B 2XQIA 5LMZA 4L97A 4UM9D 2WIIB 1VJ5A 3ECQA 2AG8A 4CMIA 1CAXB 2A7QA 4A3XA 4GUAA 5KOHA 1PMIA 4XB6B 3C97A 1UPFA 4NIDA 3SC3A 3CEPB 4ZZ8A 1X7ZA 2HMVA 3HBLA 4FK8A 5B6JA 2A57A 1USUA 4R1LA 5L9AA 3LFHA 1S01A 2C7GA 3IPCA 4YHBA 2JZNA 3HVDA 5M04A 4ZO9A 1V37A 5ETJA 1G8WA 4D9CA 3HJFA 1RJ8A 3LY5A 1UY4A 1Y7LA 2G19A 1PU2A 3I3SR 1WMSA 4JJGA 1Y7IA 2OXBA 2AD1A 1QJZA 4E1BA 5F4ZA 3QE2A 2QAGB 2WTNA 3C3YA 3VPDA 1PGNA 2K6GA 3PVCA 4BB9A 3BWYA 3ZIAD 4HNHA 3VMMA 1AF9A 2NMNA 3UPTA 4ZOEA 1DC7A 2WFZA 1BE6A 2NADA 3A2LA 2GN0A 3BG5A 1H2BA 3OLZA 3DGFC 3QXGA 5EE1A 3UT6A 1DUVG 3CC8A 3R23A 1ZDMA 4AVSA 3S5QA 3F9RA 2AEYA 5HBAA 2IUFA 3OZVA 4CPBD 3WNPA 2RD2A 3KVOA 4WLFA 2DURA 4OL9A 2VJPA 4XGQA 4AO6A 4LXGA 3DZ8A 1C7EA 5AWFC 1P2SA 4KOAA 1IXYA 4ZEMA 1H8TB 2X53S 3RODA 2BUCA 3T1VA 5DSTA 2UVDA 1Z0UA 2V96A 4I5FA 3I76A 2Z4FA 1I6KA 4JXXA 2XADA 2OBLA 4B32A 1PJCA 1QQP2 3RSFA 2D0OB 1CERA 2W9XA 1NL3A 3ADDA 4WM7C 4TTIA 1EWYA 1UOJA 1TAUA 2I3ZA 4O3FA 4HG6B 3PQ5A 1H05A 3WDMA 2IVIB 2DUUA 2IP4A 4J0DA 1G9XA 1HDEA 3NAGA 3EVZA 4C22A 3RUCA 2B4YA 3ZK9A 4L4ZA 1ZGHA 3BSWA 3WGQA 4PBRA 1F6WA 1SRRA 3CG0A 5JXGA 2FMUA 4CDUA 4RR3C 3O8OB 3M3HA 4HL6A 3IXLA 5BWCA 4P00B 1FLAA 2BU9A 3MIZA 2B99A 2WZR2 3KQYA 1H30A 1Z2NX 1XAGA 3QD6A 4ERXA 4IDBA 4DZRA 5AHKA 4E1VA 4RSMA 5LSAA 3IYLW 5GIOE 3H8RA 3JS5A 1T5IA 1VBE2 5C9AA 2XSZA 2E4XA 3L0PA 1Q56A 2HHLA 1G8GA 2FMHA 2VOJA 1QKQA 3EQ8A 3VN4A 4QG7A 1E0KA 2EQBA 4V3BA 5BNNA 1RIFA 3N70A 2Q2QA 3PQ7A 3PDWA 2YN4A 4KQMA 2VP0A 4WESA 1LXCA 2X7HA 2TEPA 3M82A 1DO8A 1FSPA 5ESXA 3PKIA 5IVHA 1KE1A 3CR3C 1GDHA 2RR13 4D9JA 1FW8A 3E48A 2GRJA 5KDLA 3OEYA 1G9CA 1H5QA 4FT8A 1GWMA 5JYEA 3VX3A 1NFFA 2P3JA 1W3XA 4H6XA 1DJNA 5DF1A 1L4HA 3PR3A 4RE6A 3D3JA 1KIAA 5FLHA 3N86A 1JU4A 5M2QA 2PU7A 3DZFA 5IMBA 2I2SA 1RUOA 4ZCMA 2PFWA 2I7XA 4AUMA 2NMOA 3IB6A 4DLPA 3ZXEA 5FPZA 2XF8A 4JBXA 1U31A 3CRNA 5E4YA 4JR2A 2VUHB 4CXMA 2PZMA 3CF0A 1AQ6A 3R6DA 4BP3A 5KYYA 1UM9A 4UZEA 1IN4A 4BMCA 4Y2VA 3RZHA 4HDAA 4XDZA 3T1OA 2GN2A 3QNUA 1Z9BA 4MV2A 1QDEA 2Y77A 2G6BA 1QKJA 4IJVA 1AS3A 5FYCA 3UCXA 4L5YA 1WQ3A 2WIFA 4F4JA 1L7QA 5I51A 2IPMA 4BMXA 1GNZA 1WJGA 1ZM4A 2PXCA 3HNOA 2R8RA 1YZHA 1UU4A 2PUCA 2RHMA 3VYVA 2VXRA 1DHTA 4DXRA 3UICA 5JD3A 1I6WA 2JIZA 2HWXA 4S2EA 4JKYA 4K6HA 1W8TA 3ZSLA 2PS3A 2JVJA 1U0FA 3RB8A 2W6JD 1D7PM 2ZZKA 4EY3A 4P3YA 3IP9A 1N8TA 3ER6A 1BTOA 4ZK6A 1BCSA 3GVXA 1WVIA 1ENSA 5DLDA 3WG1A 2VM9A 4GULA 1H2AS 2OLKA 2VSXA 4E15A 1VHDA 3JQ8A 1RUC3 4RIIA 1O54A 1GQPA 1EESA 5BNNB 2K2QB 4UMVA 2E51A 2XV1A 2RGAA 1XVIA 2H4YA 3KYBA 3FRIA 5FEUA 1DO0A 1J5EB 4MYEA 1QLJA 1XQVA 2ADFA 1Z0HA 4UCQA 3W1WA 1OW3B 3MPBA 2I29A 1KOJA 2EHJA 1C1XA 3K05A 1AR92 1SBFA 4JQZA 3GL9A 3FBWA 2KW5A 5LRSA 2FI1A 2GCPA 4OJMX 3LUJA 2VUUA 4BC1A 5FFMA 2HU8A 1JGTA 1NY5A 1P1KA 1SY7A 1MOZA 5A4MS 3LYAA 3ZGYA 4YC7A 1W2HA 1JU9A 4QSHA 1ADYA 2HRZA 2D13A 3MV01 2X8LA 3CW8X 3COZA 3CHXA 4YWJA 3D8TA 4BO6A 4RFT0 1L4UA 1DEKA 4XGNA 4ZC8A 1ENRA 1FVFA 3S1SA 4NJEB 3CRW1 2GWRA 1CJPA 1HYHA 1E5QA 2Y6LA 3UC5A 2C4UA 3S2ZA 1D2SA 1I10A 2H85A 3M6VA 1XXHA 3KVNA 3T1NA 2DVBA 3H1YA 2E4YA 1AZSC 5KJ1A 2XT6A 5AW9A 3W6ZA 1SC9A 3ZLVA 5FYDA 5ALRA 4P35A 2ICAA 1MH9A 1U8FO 3VU8A 2ASVA 2FOLA 3OUHA 3LQ1A 2Y66A 3H13A 1IVNA 2QG4A 4NU5A 5FOXA 3I9NA 2B83A 5JDIC 3G2LA 1LBHA 1W4BA 4Y67A 5CLQA 3I30X 3LC7O 5EHGA 1KK3A 3OOYA 4LK2A 1L7VC 1J8VA 3NM5A 1W8UA 3U9LA 3WQQA 4RHXA 1YS1X 4NH0A 1XCJA 3VJRA 4ZHSA 4NZ9A 3QVGB 3KSAC 2XVXA 1P31A 3HMQA 1OQDA 3Q3EA 4GBMA 3ZLUA 5LK7B 3D7MA 2M32A 1QHEA 2C61A 1N92A 3WF2A 5EV7A 5JTUA 2IHBA 5CADA 4D44A 3H83A 1OKQA 2ZHKA 1TQ8A 1X7YA 4I08A 4EEXA 2BZSA 2V7QD 5HZMA 2WSYB 1OAOC 1TDJA 5DHRA 5H3HA 2WHPB 3VFDA 5BNTA 5KXBA 5JHHB 3DE2X 1VIVA 3O3NB 2F4PA 3JARB 1JMKC 1CRLA 3SC7X 4NEHB 1Z7EA 3DNFA 3QWHA 4U5QA 1OLUB 3WLAA 521PA 5K3AA 3WFJA 2QZZA 4U9IS 1JXAA 1D4M2 5C31A 3E4CA 4BWYA 1IRIA 2PJDA 3ZVXA 1XNCA 4YJGA 2V1XA 2ERYA 2IYFA 2WZR3 2AOVA 4DR1B 5JVDB 3ZHUA 5TXGA 3HQXA 1MS5A 2WF8A 4ATNA 4CMEA 1XPRA 4QQLA 1D4FA 1X7HA 3C24A 2H54A 5ALSA 3CH5A 1ZESA 2A75A 4AEDA 2ZWIA 2Y05A 2DQYA 1WV1A 5U4QA 3OU6A 5JH7A 1VPVA 5JC1A 3CUEF 3LW7A 1WB4A 2GKSA 3DBIA 2BMDA 2SBAA 5TC4A 2G9NA 5JEEA 5H4HA 4LQCA 5KYGA 2VTBA 2HWD1 4ZT4A 2E55A 2B78A 1R8YA 4ND6A 2MR6A 3TDKA 3R2JA 3DW3X 3TIIA 2YYZA 2PPVA 3PHGA 1NC1A 1XDDA 1R8XA 3RZKA 2AUMA 3U7JA 1H23A 4HXEB 1WF6A 1UMBB 2Z0MA 4CXYA 1CG6A 4P7JA 3H5LA 4MOAA 2CNLA 1MR3F 2GNTA 4M21A 1KI1A 2QMUA 2O52A 4GE0A 4ROTA 4O0MA 5K5EA 5H5JA 4YRIA 5GZDA 3EPRA 4OU5A 5C81A 3PCTA 1RLUA 1S0CA 4UXJA 2C84A 4XAEA 1NVWQ 1XU7A 4MXVA 4QXHA 2XYVA 2N46A 4QOIA 3REGA 1KD7A 4M6WA 1GCOA 1HX6A 1US8B 2P2KA 2EKPA 2L82A 1CETA 5SV8A 3BIFA 2NSHA 2EWWA 3DWGA 3IR7A 4ESVA 2ZE7A 5J3UA 5L73A 1MP0A 3HYLA 1ECFA 4FTEA 5FA8A 3D1JA 4QG3A 3QRWA 4PQRA 5JPNB 4DIUA 2IYVA 2QTVA 5I3ZA 4NC9A 4NHKA 1VP6A 4G65A 2GKOA 2J6HA 3D4PA 3QY0A 1THZA 4HN9A 4UFOA 4GPTA 4Q26A 3KBOA 1M75A 1FSGA 1N1YA 2REXB 2RK3A 4H0CA 3BIEA 5EIXA 1ZZ8A 2GK7A 1Z0SA 4QO8A 2W58A 2JAQA 2G83A 3QVUA 1FFWA 4DMGA 1SCKA 4F38A 1YCGA 3K1AB 3OHPA 4A16A 1U5BA 3WHUA 2YS6A 3KU1A 1GA4A 3ZE8A 3X43A 4EI9A 1VKNA 3ZLIA 2A92A 1W93A 1Z3CA 4IDGA 4HGOA 2HYKA 4Q7MB 4ZV4A 1K5JA 1JW6A 1YZVA 4E03A 1HYBA 2C3UA 4B09A 1C1DB 2VL7A 1VFPA 2P6RA 3L04A 1ORWA 1Y9GA 1L4LA 5JLVA 5HM8A 3T9FA 5C8XA 4FFBA 4K5QA 3QEMA 2YFZA 1BRMA 2UKDA 1IY0A 4RHUA 4ZVVA 3DOFA 4QDSA 4YZ5A 2Y1LA 3PNQA 3PURA 5J47A 1JSXA 1JZ6A 4D1YA 3WE7A 3GFRA 3A1DA 2H7VA 2WNSA 2O7SA 2H29A 4AQYB 2LROA 2O3TA 4CNBA 4M1SA 1ZOPA 4Q7LA 2C77A 4P34A 3NBUA 2CLKB 2PLAA 1G5IA 4D46A 1XC6A 2XB9A 1NOKA 5FFFA 2X05A 1SELA 4B46A 4ZVLA 3JQFC 3FTPA 4YRNA 2I4NA 3QU7A 4QHSA 3IP7A 5IT5A 1F5JA 1MOPA 3IALA 4WERA 3H65A 2P1ZA 2FFHA 2P0AA 1OLUA 4QQPA 3VXKA 5KHJA 1RI2A 3ZXUB 3CINA 2RARA 3WA6A 5IAEA 4WM8A 4D4KA 4GG1A 3GJZA 4P5HA 5LZ8A 1H9CA 1DTSA 5A5DA 4GKAA 5KTRA 1NSFA 5TMPA 4UJ3A 2QRZA 1OLOA 4FPYA 4X64B 1UWVA 2V4AA 4NBUA 2V4MA 1GUYA 1YS2X 3DLIA 3O4VA 4E33A 1YQDA 2ZJ1A 5EP4A 4AP6A 4FGKA 3RPEA 3ZQ6A 1NBMA 4CKBB 2R65A 2JI8A 2WABA 5AW2A 1QB7A 2ZBVA 1C1YA 1YBFA 1E5XA 2VA8A 3MTQA 4LFBB 5CFMA 1YULA 1E2EA 3FPLA 1CEXA 4RTOA 1IZZA 3HJTA 1QH8A 5JSFA 1RRGA 3P8ZA 2ZIWB 3ECCA 1FZTA 4ES6A 4CUJA 1YRWA 3BTAA 1GKLA 3I0ZA 1O6CA 3LOPA 5CAEB 1YXWA 4RS5A 1B6SA 3LDAA 1J1IA 4MVJD 4KJZA 1N5MA 1EP2B 5GJBA 5FZ6A 2RGXA 2B6HA 2C98A 4QBFA 4BBZA 4EYEA 3HJGA 5HSGA 3K1TA 4A6PA 1QZTA 4PM4A 2HWE3 1BGVA 4FYHA 4ABTA 4M0UA 4WZBE 3SF0A 2F59A 3UUGA 1PJAA 4WV3A 2R66A 5HRUA 4C0KA 3WKCA 2PUAA 2HK7A 1YC61 3GXBA 4U8HA 1LRJA 3NGXA 2WFF2 4FEEA 4R1MA 1KKLA 2HL6A 1VI6A 3OEEA 2QVSB 3GV0A 1ONAA 4J6EA 1Q5OA 3TSYA 2O07A 4MP6A 2MJLA 4OFXA 2IXCA 1MZFA 1G3QA 4HK9A 1FMD3 2P3SA 2GS9A 4YDRA 1RIIA 1EXVA 5EHQA 4BLVA 2HWB2 1CJVC 2HDWA 3Q8MA 5E7IA 5FNVB 3BXZA 1WWKA 3FR8A 2DCZA 3NM4A 2ISQA 1P4SA 2IYZA 3GFQA 2O5EA 3W2IA 4BL5A 2QTWB 1QYDA 2RAUA 1IZ3A 2PKRA 4BLSA 1CIYA 1FTWA 3UG6A 3WDTA 4GKXA 1PAUA 3RRMA 5A6SB 5C5CA 1OVGA 1P0CA 5KWJA 2Y67A 2NVUB 3JW8A 3LZCA 3TYXA 4LUCA 3OQMA 1R3UA 3CRVA 1R0WA 3SS7X 1RJ9B 4WN3A 3NVDA 5AI6A 4HWPA 4YM1A 2O20A 3SKVA 2PQMA 3VLBB 1YHNA 4FZJA 3LKBA 1I3CA 1AQLA 1NZFA 1E1KA 4QAQA 1T9GS 1N6NA 3U48A 4DQ0A 1NI4A 2XXAB 1AL0G 5H8WA 4XFJA 1OC1A 1LNZA 4BN4A 1MZ6A 1WW3A 4B3JA 1GUAA 4WV8A 2BVVA 4BRZA 1AQYA 3CNLA 2GZ1A 3K8YA 2QJVA 2BELA 4D9EA 1S02A 3FCYA 3S30A 2QRVA 1NM5C 4N4AA 4L92A 2NPOA 3HL0A 2ZJZA 3OURA 2YMQA 2Q1MA 3KQUA 3NEJA 2WZDA 1Z39A 2JLBA 4NR0A 2UWBA 1RQLA 2ZGOA 3IA2A 3U16A 1FFYA 1GRCA 2FMYA 5EA2A 1P8JA 5C8WA 5I0DA 1VHWA 2YDYA 4MKXA 3KKLA 2QQPA 4JDNA 3DO6A 2HWC2 1N5LA 1NKTA 3NHZA 2V7EA 1HN0A 4Q7JB 3BRQA 2OFFA 1QH7A 4M7OA 5EPOA 1JMYA 3AWIA 3Q3CA 3FCAA 1RL3A 4FMPA 4G89A 5ILQA 4DM7A 1GQFA 4UNQA 1Q0SA 1V1MB 1OA3A 4HAIA 3N36A 4ALJA 1X1BA 4JLKA 3P0FA 2CNDA 2FB9A 5EYPA 1LY1A 3LYHA 2OYCA 5JROA 4RJJA 3I3BA 4GH4C 3NOXA 4BEVA 3Q6NA 2C42A 4W65A 4GKJB 4JAAA 3AOEC 1OV4A 4HUQB 1VB2A 1TT5B 2YNMD 1AUXA 3T4UA 1LV8A 3JYNA 2QX7A 1HG0A 2PKQO 5AHRA 5HKKD 4NRMA 5H82A 5IWFA 5FZOA 4RCYA 1QIEA 1X8JA 2I7CA 3UFXA 1N2SA 1XMOB 5KDOA 5BSMA 4UQOA 4AY6A 3P32A 1KXZA 3TM5A 3KWVA 4DV7B 4RD7A 1P4JA 1PD0A 3ASVA 1OFNA 3BCRA 1PX2A 4Y1RA 2D1QA 3IBSA 5LP6C 3ENNA 4N0QA 3MN1A 3IBCA 2X1MA 1P9OA 4MGSA 4ODIA 3RHZA 1P4HA 3KSZO 2P4UA 3AP2A 1QIQA 4PIYA 1UNBA 1XZCA 5JMPA 3IAPA 1W6MA 2XKPA 3OBZA 1IUOA 2JDHA 4Y1XA 4AAXA 5E89A 2YXPX 2L0XA 2EU8A 2E53A 2BYTA 5G04L 2V9ZA 4LBQB 3I4IA 3AKZA 3RS5A 2NXJA 5A4IS 3S27A 2R1BA 3BWMA 3WK7A 3T7IA 5J2UF 3U80A 5AVZA 2EV9A 4UM5A 2VDNB 3BKWA 3SM3A 4JEUA 3GAZA 4BU0A 4A5OA 1C3OA 4QGLA 3H3FA 1OWMA 4Q1FA 2J4DA 2YS7A 5IVJA 4A7KA 1DTEA 3EAQA 4JOCA 2GNDA 1OFSA 5E16A 2WWTA 1M1NA 3CNHA 1X19A 3SQWA 1L9KA 3AFKA 1WHSA 1ZRNA 1KBOA 1M2GA 1HIXA 4P3OA 2WYHA 5P8WA 3HO6A 5GP1A 1VLVA 2NQYA 3ZQJA 4TROA 3ZDQA 5BW4A 5EPEA 3RRNA 3HA2A 4BMZA 3CKKA 1JE0A 1Z4KA 2RI6A 3WGLA 4MCIA 2XPJA 3G85A 4V0SA 3N2YA 2BGWA 1FPN3 1AUYA 3WP3A 3C3CA 1M72A 2QTAA 4QM7A 5IC4A 3AVUA 1QVRA 3GPDG 1T3TA 4G5YA 2IZ7A 4BTEA 3RPQA 3V1TC 2R072 2O05A 2QHXA 3COYA 5FCDA 2O7VA 2FSHA 3SAJA 2C2WA 5IVKA 4KBYA 4UUBA 4R1SA 4BZZA 2YOFA 3FPGA 3U14A 1AKWA 3LXMA 5JE8A 4LJAA 2VKTA 4MLDA 2GN3A 1QAQA 2C59A 4M9CA 4MQ4A 3F74A 2I07B 4C7BA 3CRMA 4O5OA 1PMJX 4E32A 5T50A 5HOQA 5IJWA 2X3YA 1BOFA 2QUKA 1TKAA 2QJRA 4JGYC 3HDJA 5J4YA 4IUBS 3AFIA 3OT1A 3H3XA 1P7VA 4HMPA 1UKRA 4WVMA 5JWRA 4L3OA 1OB2A 4DVJA 2IIBA 5DGIA 2B21A 4AMBA 2FDFA 3I4LA 2VQ6A