3IIIA

1.95 angstrom crystal structure of coce/nond family hydrolase (sacol2612) from staphylococcus aureus
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
558
structure length
556
Chain Sequence
QHLLGNPKLTVTHVNEVKAGINHIVVDSVQYGNQEMIMEKDGTVEMRDGEKLYINIFRPNKDGKFPVVMSADTYGKDNKPKNMGALWPTLGTIPTSSFTPEESPDPGFWVPNDYVVVKVALRGSDKSKGVLSPWSKREAEDYYEVIEWAANQSWSNGNIGTNGVSYLAVTQWWVASLNPPHLKAMIPWEGLNDMYREVAFHGGIPDTGFYRFWTQGIFARWTDNPNIEDLIQAQQEHPLFDDFWKQRQVPLSQIKTPLLTCASWSTQGLHNRGSFEGFKQAASEEKWLYVHGRKEWESYYARENLERQKSFFDFYLKEENNDWKDTPHVIYEVRDQFYKGEFKSASAFPLPNAEYTPLYLNAENHTLNHAKISSAHVAQYDSEDKQQDVSFKYTFDKDTELVGNMNLKLWVSTKDSDDMDLFAGIKKLDRRGNEVNFPDFNHIENGQVATGWLRVSHRELDQEKSSIAQPWHKHETELKLSQDEIVPVEIELLPSGTLFKQGETLEVVVKGSEIVIGNSTPGMKTRYEHEETVNKGMHMIYTGGKYDSQLIIPIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title 1.95 Angstrom Crystal Structure of CocE/NonD family hydrolase (SACOL2612) from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus col
molecule tags Hydrolase
molecule keywords CocE/NonD family hydrolase
total genus 189
structure length 556
sequence length 558
ec nomenclature
pdb deposition date 2009-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02129 Peptidase_S15 X-Pro dipeptidyl-peptidase (S15 family)
A PF08530 PepX_C X-Pro dipeptidyl-peptidase C-terminal non-catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3020.20 Mainly Alpha Orthogonal Bundle alpha-amino acid ester hydrolase ( Helical cap domain) alpha-amino acid ester hydrolase ( Helical cap domain) 3iiiA02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3iiiA03
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iiiA01
4PF1A 5LLSA 4GXNA 4LXHA 4H7FA 3H19A 1XLWA 3CIHA 3F96A 4BVKA 3VD7A 1X2EA 3B5EA 5FRDA 2VF2A 4QB6A 4QX2A 3HABA 1XZMA 3VD4A 5YASA 3RLIA 2PVSA 1P8JA 5JZSA 1XQWA 1W9SA 5J1XA 4WY5A 4OPMA 4H7HA 3W06A 4QWMA 3C8XA 3NWOA 1IZ8A 3DS8A 2H7YA 2YC4A 4J0CA 3HNYM 3ED1A 1GPLA 4KE9A 1BE0A 1BN7A 4UHHA 5EIEA 1O59A 3IB3A 2VSQA 5JANA 2GYVA 1EDDA 3BN6A 1OCEA 5CXUA 1OF4A 4LXGA 1LPNA 3DYMA 5FUIA 3I3EA 3FHQA 3LP5A 1XNAA 3I1IA 3E1F1 2VJDA 4B0OA 4CG2A 5DYWA 1G66A 1XZJA 3QVMA 3WQHA 1XZDA 4JKLA 3GGLA 5AM1A 1ZICA 4HRXA 4QDSA 3R3ZA 5HK8A 1A8SA 3GM8A 4RN5A 3G0CA 1CUCA 4W1PA 1T2XA 4UFPA 5AM3A 3AUKA 2C58A 3AFIA 3DOIA 1CUVA 5I0DA 1LPOA 3ZLUA 3CKHA 3C45A 5FDFA 1CUZA 1GOGA 1XFDA 5T4EA 5JD5A 4C4ZA 1ISPA 2VJCA 3BDVA 2W95A 1BROA 3HRHA 3LLCA 2V97A 2YG0A 2XOMA 3RARA 1XRRA 4UHCA 4DIUA 1UX7A 2WN2A 2ECFA 4AO6A 4FLFA 5ALMA 4BE4A 5DNWA 1CRLA 2E26A 1PMHX 3WNOA 4GWLA 1RP1A 4Y2XA 3PF8A 4NVRA 2J1TA 2RJ2A 1YB7A 5ESRA 1W8OA 3ESAA 4EZIA 2PUJA 4XJVA 1GPKA 1YR2A 3WSOA 3FYTA 4OU5A 3VDAA 3SEPA 2XUIA 2JDAA 4M0EA 2VCAA 1CPYA 4GDMA 5ALJA 3QPCA 5JAPA 2DHDA 2G5TA 4JEIA 2Z5GA 1LPAB 3WWDA 4KYVA 3QH4A 1MN6A 1BU8A 4TPKA 4Y7DA 4PT6A 2JBWA 4Z49A 4WY8A 2WLSA 1EB9A 2W47A 2W46A 3GXUA 4J0JA 2Y6UA 4YK7A 3I2FA 5A62A 2XHNA 5A6VA 3K9BA 3WNKA 1JT2A 4A45A 5G04L 2W91A 1OD3A 1TCBA 1W4LA 3I1YA 5ALUA 2ZJFA 3MBWA 1JU3A 3FLAA 2ORXA 1EVQA 1VE6A 5CH3A 4WDRA 1H6XA 3C7OA 3VISA 3LPGA 3KD2A 4XX1A 3BF7A 1H6YA 4ZI5A 3LEKA 2GYUA 1GQRA 4QE3A 4EUSA 1QIHA 2RIPA 2WZEA 1IMJA 5HF9A 4ARXA 3V9AA 2X10A 1O6FA 1WB6A 1VZ3A 2I78A 1W0NA 4U2FA 3VDCA 4C89A 2DSNA 3YASA 3O4IA 3C5WP 4KE8A 2RONA 4BP8A 2WO1A 3HJRA 4OYUA 2W1WA 1LPMA 5LIPA 3HACA 4I4CA 1UY0A 2HA3A 1QIIA 4KAFA 1LPPA 3BIXA 4U2EA 2HRQA 3WJ2A 4LKOA 1DTEA 1ZOIA 4PSDA 3Q0TA 3UMJA 4UAPA 1BRTA 2XMBA 4ZV9A 2YH2A 3WF2A 4Y2TA 4N5IX 2QOEA 1QOZA 4DSAA 4H77A 4BDVB 4IHAA 3H2KA 3R3VA 4OZOA 1YCDA 1GKLA 2J22A 3ESDA 3U1TA 1O8SA 1B6GA 2JGIA 4JUIA 1W9WA 2W87A 2J7MA 1RWQA 2OG1A 1MJ5A 2WSLA 4W1SA 4J0KA 5AKHA 4D8MA 1H22A 2JEYA 2QTBA 2X05A 1DX4A 4P93A 4X92A 3E1GA 3F9CA 1AURA 1Q0ZA 1QTIA 3W9UA 3BJRA 3B3QA 1UYZA 2BJHA 5JR2A 1P0MA 7YASA 2WTMA 4BYMA 4DYHA 4UHEA 3A21A 5E2IA 3CCCA 1N5MA 2WBKA 5EJZB 3OOSA 1A7UA 3AZPA 2GBFA 3CQOA 3HLKA 1HDEA 4B83A 3AZQA 3GUUA 1UKBA 4B84A 4E8DA 3D2CA 1XC6A 1DX6A 2OAGA 4ZZ5A 1J07A 1SCKA 3FWHA 5AI6A 1JI6A 1EH5A 2OXEA 1QIKA 3WKAA 1UT6A 1G4HA 2ZVDA 4P02B 4Q3KA 1USWA 1GOFA 2CB9A 1XZEA 3LQCA 4NS4A 1NU8A 4PQQA 4OB7A 5HFNA 1US3A 2QQJA 5DLPA 4OYLA 5FLKA 4QPWA 4E8CA 2Q0XA 1G5FA 2HU8A 4AO8A 2RI6A 5JIBA 2O2GA 3PI6A 2J1RA 2VAVA 3QITA 1QIJA 1DWQA 3R40A 1CEXA 3DYVA 1H23A 3WWEA 2VZQA 3TEJA 5IYYA 1TCAA 3WYDA 2KD7A 5DPNA 4EBBA 2EIBA 4K2AA 1ULPA 5CT5A 2X5XA 5AKJA 5CT9A 2WFMA 2HLEA 1THTA 2ZYIA 1HKHA 2J3QA 2V5DA 4QLOA 5K3CA 2CMFA 4UBNA 5AKGA 4OSEA 5JYCA 1CR6A 4XZUG 3C70A 2GZSA 4OMDA 5HKAA 4RE5A 4CFSA 1CX1A 4NZZA 5AK6A 2WYSA 5C70A 1JJIA 3N0TA 4DNFA 5E4TA 2HFJA 4L72A 2VMEA 3FVTA 1YS2X 1IUOA 4A5SA 4K5QA 4FTWA 5AO9A 1T2NA 3D2BA 3UESA 1QIDA 2VMCA 4N8EA 3OTQA 5AP9A 4DGQA 1SDDB 2WHQA 4MXDA 4PV7A 4XUPA 2Y6VA 1ZIYA 5G05L 3AIKA 3RKSA 5ALDA 2JF0A 3WA7A 5AK4A 4KRYA 4H7DA 1R1DA 1GXSA 5BWCA 3FYUB 2G4LA 5LZ2A 5CT8A 5LZ9A 1UMIA 2BUBA 3T4UA 3FVRA 4DMCA 1CUSA 3LEGA 3L1IA 4MOAA 2Y2VA 4KEAA 5HF6A 2JGKA 4HVTA 4RPCA 2XUQA 3DQZA 3WK5A 1ZJ5A 2WG2A 1L7RA 1K45A 2BGOA 4DXRA 4MEBA 3DECA 2VTVA 3C6YA 2AJ8A 4KI5M 3PFBA 1YSCA 5DMYA 4AAXA 3O4HA 5CTAA 5JMOA 3VDBA 3WYNA 4UOJA 1JJBA 3FNBA 5AM0A 5A7HA 2WZ8A 2CEKA 1CUXA 2J1VA 5C7YA 1JZ7A 3VJKA 3D4LA 1JYXA 1FFCA 1LPBB 4X93A 2Z3ZA 4W50A 4C87A 5F4ZA 4WDQA 1MO2A 3I6YA 3QMWA 4EY6A 4KE7A 2LIPA 2WUFA 4ROTA 2C26A 3OGVA 2CJPA 4OMCA 1QO7A 4KACA 4GBGA 4HXFB 1YS1X 1XRQA 5A2GA 1KEXA 1K5PA 1ZI9A 2QM0A 5H3HA 3K75B 3G0BA 1OXMA 1UYXA 1JZ6A 4MWTA 3ILSA 1WB4A 4FBLA 4PSCA 1EINA 3WL6A 2EEPA 2OCGA 5CW2A 4ZRDA 4BTLA 1H2YA 1AMNA 1GOHA 3ZV7A 3DKKA 2Y6LA 3OB8A 4TXWA 1JFRA 1LPSA 4P9NA 3WNMA 1MNAA 3T52A 5HXMA 1UY2A 1UK9A 1WPRA 3SKVA 5IFPA 2HA6A 2VT7A 2VATA 4XVHA 2C7BA 3WZMA 1XRPA 4B7ZA 2VTFA 2JD9A 4HZGA 4U2BA 1UMHA 4Y2SA 3KWFA 1E66A 2XDWA 3EB7A 4AMZA 5LZ7A 4I19A 4CVUA 4FNMA 2JGEA 4J0HA 3E3AA 2C0QA 3O4GA 4M4PA 2OQVA 3C6BA 5AK5A 1I6WA 3FCYA 2FUKA 1JZ8A 2QRUA 3IVMA 3C8HA 4GLBA 3BF8A 4Y2JA 2VQUA 1CUGA 1ETHA 4K6KA 1ODTC 4BAUA 1TVGA 1CUHA 2E32A 2HU7A 4EB0A 5LKAA 5JXHA 2I03A 5AIAA 3PUHA 4A6OA 1BS9A 3QZUA 3W9BA 3C7FA 1CUEA 1XNTA 1EHYA 3OPMA 3PDCA 1XZFA 2H9YA 4HTAA 1EX9A 2PU5A 1R64A 2ACKA 1CFJA 3IAPA 4UFNA 1K12A 3WK4A 5ALZA 5JD6A 1NAEA 2ZSHA 5EI5A 4DUWA 1BHGA 1G42A 4N8DA 1XZLA 2E3JA 1UK8A 2YYSA 1VA5A 2XUHA 2JEZA 2D5LA 4G4JA 5BWBA 2H7XA 4LHSA 2G63A 2C4XA 5LKRA 2B4KA 3K4AA 1GUIA 2J3DA 2QQKA 3V1MA 1TG7A 1DWOA 2BCEA 5AIBA 2BGNA 3VVMA 3DNMA 2PPLA 1UXXX 2PSDA 1N5RA 3G0DA 3OBAA 4CG3A 2DHCA 3TJMA 2OCIA 2ZEWA 4G8DA 3LEIA 5AKEA 5ALIA 2ACEA 2YC2A 4Y2VA 1UXZA 2GBGA 2XMDA 2R7EB 1PX3A 5CRIA 3WK6A 1WHTA 4UBLA 3H1AA 1SHWB 1ACJA 4ZY9A 4Q82A 2WO2A 4XUOA 1N1MA 3ANSA 1QJ4A 4Q34A 2OCLA 4U2GA 3ICWA 4E15A 2HFKA 4A4AA 5LA2A 4DMHA 3PFCA 4E14A 4LIPD 1J83A 4FLMA 2W1QA 4DLNA 1MAAA 3KDAA 1ZD5A 3D3AA 5C8VA 1UKCA 3Q8WA 4B9AA 5ALSA 4UBIA 3GROA 3NGMA 2QT9A 4HAIA 3I3DA 3ZPXA 4DXSA 3HEAA 3QBJA 3M82A 5LZ8A 3ACFA 4GHWA 4ET7A 5DTIA 3SWWA 2Y6JA 1ZI6A 2ONCA 2XUFA 2WU3A 4G9EA 3P6BA 1R88A 2QS9A 4K6HA 3WA6A 3E4DA 3IBTA 2DHEA 4KMQA 1UYYA 1J1IA 4ZXEA 1XQXA 2OGSA 5ALYA 3AINA 5CH8A 2GBIA 4HG6B 1LLFA 3WF4A 1VXRA 4J7AA 3GBSA 1UWWA 1K6EA 4CIBA 5HF5A 2CUTA 2VOTA 2VCBA 5AI4A 3WZLA 5JXJA 4HS9A 3S8YA 1QIEA 1E89A 2BKLA 2XUOA 4RGYA 3A2LA 1EI9A 5HPOA 4DUXA 4LKSA 4B82A 4CU9A 1CZSA 4LPLA 4A44A 2P8SA 5K3EA 2GBCA 2WFLA 3W04A 2V4VA 3WNLA 2ZXQA 1W52X 4ZZ8A 3GA7A 4RE6A 1U65A 1P0PA 2W22A 1UFOA 2EDAA 4CCYB 2QXTA 4L0CA 3TRDA 5LZ5A 5KWIA 5CT6A 1M33A 1PJAA 1SOMA 4OCZA 4IH1A 3MUZ1 3SK0A 3VJLA 5JZ9A 1N8SA 5JAUA 1OILA 1CLEA 2OCKA 3I6ZA 2WJ3A 2VZRA 1SG3A 2WJ6A 5K3AA 3IUQA 4X91A 3A23A 2HL6A 4BP9A 2WHPB 1GPNA 1LZLA 4Y2UA 3LPFA 1H2ZA 3F67A 4X71A 5IH7A 5ALHA 2W5FA 3BGAA 2VZTA 5T4FA 4QB1A 4A16A 1NKGA 4OB6A 4JYMA 3SX4A 5AKZA 2W6CX 2H1IA 3C7EA 4G1FA 5JXIA 2QJWA 3THCA 3K77A 3I97A 3H2GA 3C6ZA 5ALRA 4H0CA 4P92A 1UKAA 2WG0A 3D59A 4OUKX 1B41A 1H2WA 3ICVA 3MUY1 4J0DA 1IZ7A 2XB6A 4MYDA 3CXUA 4LYEA 2PL5A 3WIOA 3HOBA 1UY3A 5ALQA 5CH5A 1F4AA 4AG4A 4L9AA 3UUEA 3M81A 3D0KA 1CV2A 4LQRA 3KXPA 4JKMA 4OB8A 5AK3A 5ALVA 3EIOA 5JALA 1WM1A 4QDQA 1WCQA 3IAQA 2XMRA 4BJ0A 4Y2YA 3R0VA 1IUPA 3BIWA 3D5EA 3PUIA 2RV9A 4Y2RA 4KRXA 3R3YA 1XRMA 3OEBA 5AHXA 4W4ZA 3TGLA 3VD3A 4RYDA 4JX0A 1XRNA 5ALOA 1OH4A 3STWA 2J1UA 1JZ2A 1XROA 4CI9A 1KU0A 4YPVA 1EDBA 4L0PA 3DKRA 4PNZA 3M3DA 2XUGA 2XQFA 2E31A 1SCQA 3GZJA 5A1AA 1EVEA 3FAKA 1AGYA 1GMMA 3ESCA 2B9VA 3FOBA 4MO3M 3QMVA 5K5EA 5D3KA 2HADA 4DMFA 1QONA 5K3BA 3KWJA 2QR5A 2RVAA 4EY7A 3F98A 3FL7A 5B4NA 4X95A 5CXXA 3WJ1A 5CT4A 1DWPA 1EK2A 3N2ZB 2C9KA 2V72A 1GU3A 1XZCA 3HI4A 2WUEA 1CIYA 5JAHA 3AZOA 4NMWA 2UZ0A 3NRUA 2XI4A 5A7GA 5C71A 3OURA 1E8NA 5F7UA 1FSSA 4EY8A 4V2IA 4MWSA 3H2JA 2QQNA 2QQMA 1DYOA 5ALKA 5AM5A 1CIJA 3C87A 2HYXA 2X76A 2PM8A 1AQLA 2VZPA 2CDOA 2WQ8A 2CZQA 3WI7A 3W05A 1ZIXA 4BDSA 4ZREA 4KWUA 3OM8A 4UBJA 4UFOA 3D2AA 3PICA 4ZV7A 1XRLA 5LA0A 4AQDA 2ZYHA 4YPJA 1YA4A 3O9VA 3STYA 3G0IA 5HZGA 3WWCA 2WDBA 3LS2A 2WIDA 1HLGA 3M83A 1D7PM 1OF3A 3VD9A 1JU4A 4KR0A 4QDTA 5ALGA 4WCVA 4ZXFA 1E3QA 2VZUA 1CUAA 3P2MA 5AKLA 4BRSA 1QO9A 2ZYSA 4Q3OA 5JZBA 1IUNA 3F2ZA 4C6HA 1R3DA 1XQVA 3C8DA 4X90A 2WU4A 3HNBM 1QLWA 3QPDA 1W75A 1XZKA 2OQIA 3ZLVA 5AKIA 4QDUA 1MTZA 4N8SA 3X3HA 1CUDA 1MNQA 3BE8A 3P1IA 5AI9A 3VKFA 5KBYA 3V1NA 3BL8A 3WF1A 2VAXA 3PE6A 3DD5A 1HL7A 2QZPA 4UI9L 4A42A 2VL4A 5AI8A 4HRYA 3THDA 1BCRA 4FKBA 5CURA 1QIMA 4U2CA 1P0IA 3WL8A 1J84A 3HC7A 2WIFA 4F5ZA 2VA9A 1MT3A 1UXOA 3IUJA 3IDAA 3KSRA 2V98A 3OGRA 5AKYA 2VJAA 4DXTA 4A3ZA 1DINA 1QE3A 5HK9A 4QZVA 1WOMA 1C7JA 1CVLA 3F97A 4KJXA 3C43A 4O08A 1PX4A 5I9IA 2BERA 3T2QA 1ZD2P 4P00B 5EIHA 4HXEB 2ZJ7A 5JATA 3ETPA 2WIKA 4DUVA 2XUJA 5IVHA 5ALTA 2EDCA 3R3XA 4AB1A 1CUUA 3A6ZA 3SKJE 3DOHA 5LA1A 5DYTA 2QQLA 1HPLA 1Q83A 4S0XA 4U2DA 4TTGA 4JHZA 3HNMA 4BK5A 2AJDA 2ORYA 3HPNA 2G5PA 2DR0A 1C4XA 2RGUA 4EY4A 4QDOA 3BXPA 4AXBA 2QUBA 1P0QA 2R11A 3ZWQA 4CU7A 3BWXA 4BC0A 4CCWA 1GQPA 1E8MA 3G9UA 3I3BA 4QAWA 1TK3A 4BZZA 4BE9A 1XZHA 1MX9A 4FMPA 2VJBA 4H7EA 5ALEA 3CZJA 4WFKA 4QNNA 4XIIA 4AN1A 4EHBA 1HN1A 3STXA 3AC0A 1JYVA 1A8UA 2B20A 5LYYA 3FSGD 2VZSA 3ACIA 4GWJA 2O2IA 4BCBA 5EHXA 2XQGA 4C01A 1EUTA 1QGED 5FUMA 2I3DA 1VZ2A 3CZUA 3GFFA 3GELA 4AX4A 4YX9A 5JARA 3T08A 4OYYA 1F0NA 3I2HA 1KGYA 5AJHA 1AKNA 4IUGA 5AKKA 2WIJA 1CUBA 1JHJA 3OEAA 4KE6A 4QB2A 2CKMA 3PF9A 5IVDA 4F21A 4KAAA 2XQKA 4DEVA 2JGJA 3R41A 1UK7A 2QQOA 4GW3A 1J2EA 3EQ9A 3L1HA 3BJMA 4A23A 4DM7A 1EDEA 3WKBA 3AIMA 2PSFA 2VM9A 5K3DA 3EYPA 1SCIA 5EFZA 1DP0A 5AICA 4GWIA 1DU4A 4OUEA 2Z8XA 1YQ2A 3H1BA 4H7JA 3CN9A 4IO0A 5BV7A 3AIOA 4W1RA 2QQIA 1F8UA 2VO5A 1ORWA 1ZGBA 3WQBA 3C5VA 4PSUA 1O6GA 4AO7A 1TCCA 3CMGA 4ITVA 1WKYA 2QMQA 1A8QA 1ZI8A 2XMSA 3HN3A 2J4CA 2ZJ6A 1D07A 4JYPA 1F4HA 4FWBA 4RNCA 1QFSA 3W5NA 1WB5A 3FHAA 1F6WA 3FN9A 2RHWA 3FYUC 1JKMA 4JH0A 2Y6HA 1E5TA 1ORVA 2HDWA 3NOXA 4AN0A 3IURA 1TIBA 3G0GA 2W9XA 3FBWA 1DLCA 5JXGA 3A2NA 4G5XA 3T2PA 3I28A 3K2IA 4J03A 3K46A 5EHNA 4Z2AA 3R3UA 5C8ZA 2I3ZA 4BATA 3WNPA 1DT3A 4GEGA 1CZTA 3LIPA 1FFBA 3MGAA 2NW6A 4UHBA 5AM2A 5IVKA 4ARBA 1PV1A 1E8DA 2BGPA 3AJAA 5ALPA 2BAGA 2O2HA 2WQZA 2DDUA 4DNPA 2GZRA 2PBLA 3ESBA 2Y6KA 1Q0RA 2JE8A 1VA4A 2Y1KA 4WFJA 1DQYA 3BDIA 4XWGA 3AILA 3RM3A 3QPAA 5KREA 4BZWA 3IULA 1Z68A 4BVLA 1CUYA 3KOOA 1ZGCA 5DNVA 4C4XA 1VOTA 3STTA 1Y7HA 3O4JA 4JKKA 3STVA 4IH9A 1MAHA 1JZ3A 1CUIA 2QUAA 4W9RA 2DFPA 1CQWA 4M0MA 2HRRA 3WMRA 2QKYA 3NJXA 4QLAA 1EK1A 1GT6A 2JGFA 3WK8A 2YB7A 4PQEA 2HA0A 4DEQA 2PQSA 1HBJA 1LGYA 5BOVA 4MYSA 4G8BA 2OKXA 3G9XA 2BBAA 2YASA 2CBGA 2YFUA 3ACGA 3OGSA 4FLEA 3VD5A 5ALXA 3D7RA 3LCRA 2XT0A 1NU6A 3S2ZA 4FBMA 3H18A 1UOQA 1UK6A 4AZ3A 2EIDA 4UUQA 2W3JA 2W94A 5ALFA 1TKRA 3O0DA 5DJ5A 5DNUA 2WAOA 2WUHA 1W1IA 2HM7A 2Z8ZA 3CDZB 2JKXA 4B9EA 4B0PA 2VZ1A 4BRZA 1JZ5A 4IQ4A 5D7BA 3G02A 5C81A 2DCKA 1R4ZA 3FCXA 3WWOA 1NUKA 4EY5A 5FXMA 1GGVA 1U4NA 3HYSA 1AX9A 2C4HA 2FX5A 3DYOA 3JWEA 3J7HA 1WCYA 1AZWA 2XONA 1JI3A 2E33A 4W1QA 2QBXA 5JASA 1ULOA 1Q84A 4INZA 1O8PA 2BGRA 1LZKA 1K4YA 4TGLA 2ZEYA 3I2GA 5K3FA 3EF3A 3A2MA 1YAHA 3DDUA 4JNCA 4B6GA 1FFAA 1CUWA 5EHZA 2AJCA 2V96A 3OG2A 4X6UA 3DL4A 4ARYA 1XZBA 1YA8A 4H7KA 2GYWA 2ZEXA 4W63A 4UBOA 1L7QA 2BUCA 4CU8A 4K6GA 3UETA 1R50A 1NX9A 5AOAA 2RHTA 2DCMA 4ARAA 5E4YA 2AJBA 4X3CA 3V1LA 2VQTA 4F0JA 4GZ9A 1THGA 1UOPA 3G9TA 4G4IA 2WFZA 5FV4A 3T09A 4BCDA 3U0VA 1C7IA 2YFZA 3ANTA 5DWDA 4WJLA 2VJXA 2OGTA 4MGQA 2YXPX 4F60A 3WNNA 1UZAA 2C0PA 3VVLA 5LCWL 3JYHA 1K8QA 4MQLA 1KU6A 1Y37A 5T4BA 5AM4A 4BK4A 2PX6A 5CBKA 2QJRA 2BZDA 5HCUA 3WEZA 2PSHA 3C7HA 3T0DA 3NJVA 4UPDA 1ZD3A 1AC5A 5FKJA 5I8PA 2HA7A 4CUAA 5EIAA 2D0DA 3VDXA 4ZWNA 3EQ7A 4MEAA 1EA5A 4Q1VA 4XVCA 2LS6A 2QXUA 4CUCA 5IVIA 2QVBA 1YB6A 4Q05A 1VXOA 3HJUA 1TQHA 1CUJA 3A7QA 4MQMA 5J3JA 2XUDA 4BTVA 1LNSA 1LBSA 4MADA 1FJ2A 3U37A 3H2HA 4G4GA 1U8EA 4X85A 3IIIA 5ALLA 5ISMA 2W92A 2VCCA 4ZGBA 1XZGA 1TRHA 3MUOA 2VQ6A 4XUNA 2PSEA 1AUOA 4QX1A 1UY4A 1SFRA 1XLUA 2WAAA 4BDTA 5DN2A 1GNYA 1VLQA 5A7FA 2HIHA 2J1SA 5IKXA 4FOLA 4UBKA 3H04A 5AI0A 5CMLA 5EGNA 4CG1A 3WF3A 1EXWA 3HEIA 3LIIA 5FPPA 2WUGA 3WKCA 2AXEA 2XLCA 4LHEA 4B85A 3K4ZA 2WFLB 4Y9SA 2ROQA 1R9NA 4L3WA 4M0FA 1UOOA 4BBZA 2O7RA 1QTRA 1RYYA 3K6KA 2IX9A 2R8BA 4W8JA 3C6XA 5AOCA 2Y2UA 4HXGA 1W76A 4GI1A 2XMQA 2WABA 3VXKA 5K3FB 1US2A 3IUNA 2HA4A 3I2IA 4J3JA 3WK9A 2VT6A 3C7GA 4A41A 2V9ZA 3FLEA 2XMGA 3ABZA 1MU0A 3G9ZA 5HFAA 4J0IA 3H17A 1XQYA 3ECQA 4DTCA 1K42A 5ALWA 1PMJX 5D3ZA 1PFQA 3WLAA 1UY1A 5EJ1B 1QIGA 2JGLA 3DL7A 3MVEA 3DJYA 1JMKC 3R3WA 4D9JA 1JZ4A 3W2TA 3W5MA 3QYJA 3WWPA 1XZAA 1JYNA 1Y7IA 3ZI7A 2Z4FA 3G8YA 4X00A 1XLVA 1MX1A 3ACHA 1OT5A 3OG9A 2EIEA 1FFDA 1XKLA 1YAJA 5LZ4A 4UHFA 4DNOA 3ZM8A 2ZYRA 1SC9A 3UUFA 1CUFA 1UWCA 1T4MA 1WPXA 3G7NA 2OPHA 1W8NA 2FJPA 5HQ3B 5AH0A 4H7IA 1BEEA 1EB8A 1W6RA 2HA5A 4QWWA 4J0GA 4LXIA 3FYUA 1R9MA 3EBLA 3JXSA 2VZVA 4BC1A 5SYNA 4FFWA 2XMZA 5DQ0A 3H0CA 4N5HX 3UNPA 4QEKA 5FP0A 2BUAA 3DCNA 2VZ3A 4FI9A 3LE0A 2JIDA 4QX3A 4QDZA 2XMCA 4BAGA 4AZ0A 3HSSA 4FNGA 2WN3A 1ZD4A 2AJLI 4G8CA 4IH4A 5AKXA 2OAEA 1CZVA 3OC0A 4G9GA 4XUQA 3A70A 5C8XA 2ORZA 1KEZA 1WHSA 5D6OA 2ES4A 2XE4A 1L7AA 2PSJA 2VC9A 4OD0A 4X94A 3F8SA 3WKDA 5B4XA 1VE7A 4QX0A 1QZ3A 5CYYA 3IA2A 2J1AA 4X97A 4OU4A 3STUA 3NNGA 1ZJ4A 2W1UA 2WHRA 2Y6GA 5HF8A 2EICA 1K63A 2IITA 2JGMA 2O7VA 4XUTA 3FSGA 1X70A 2VZOA 3SEEA 4PW0A 2XQIA 5DYYA 4P5YA 2H7CA 4QDXA 2OGZA 2LW8A 5ALNA 2J4FA 4DNQA 2WO3A 5KWJA 4MGSA 4EA6A 2K2QB 4LYDA 5AI5A 4XURA 1U2EA 3JW8A 3A22A 1W99A 1MPXA 4E46A 3MV11 3EQ8A 1X2BA 4X6YA 4UHDA 1YASA 3VJMA 4DMKA 4UBMA 2ID4A 2WHPA 3CN7A 2W1SA 2HHAA 1IQDC 5HKBA 5EIYB 3V48A 4BAZA 1TAHA 2CDPA 4H35A 1A88A 1BEZA 2PUHA 2ZEZA 1I5PA 2PKYX 4X7BA 4QDRA 5LP1A 5C7GA 3ZLTA 3D3NA 3WF0A 4B80A 5IFTA 1JMYA 3O9MA 4CU6A 2C5GA 4Y2PA 3HXKA 4KAJA 1HQDA 2Z3WA 2VMDA 2XUKA 4FHZA 2DCJA 3WK7A 3I2KA 4BB0A 3MO4A 4H18A 1ODSA 3DEAA 5FPQA 3K4DA 1JJFA 4YASA 4PO3X 3E0XA 2FJ0A 2WTNA 1ACLA 2DQZA 4Q3LA 3V1KA 2BFNA 3MUNA 3CCBA 2RAUA 1K3IA 1IVYA 2XQXA 1ODCA 3MV01 2B61A 4FFVA 3DLTA 1UZ0A 2HA2A 2ZSIA 3QM1A 2OLEA 2J1EA 4Y2QA 3WL7A 2WIGA 5I7UA 4DSZA 3WKEA 2VMFA 2XLBA 2XQJA 2VEOA 4TVKA 1GQSA 4CUBA 1W9TA 4C88A 3GDBA 4D0QA 3FLBA 1BN6A 5CZKA 2Y8KA 5A71A 4AMYA 3QMMA 1H2XA 3DYPA 5IJRA 4C4YA 2L9LA 5AOBA 1GZ7A 3I2JA 4FDMA 2PU7A 3WIBA 1BCSA 1EUUA 4GECA 5T4HA 1FFEA 2WILA 1CQZA 1QIFA 3T0AA 1QFMA 1JYWA 4CIAA 5HQ3A 4B81A 4WFIA 2Y64A 6YASA 4MJ3A 3IUMA 4BXSV 3L1JA 4ETWA 1MX5A 2IIVA 1DQZA 1S8OA 2WG1A 1DT5A 2WM2A 2WUDA 5JAOA 4QA9A 1XPWA 2XUAA 4BVJA 3I6MA 4E11A 4P08A 1XZIA 2X8BA 4BCCA 3T0BA 3NUZA 5EHQA 3NQHA 3H2IA 3WL5A 2X09A 1XKTA 5JADA 5JUVA 2WKWA 2WJ4A 2XUPA 1VKHA 4I3FA 3DYIA 3SC2A 1VJ5A 2VR4A 5E4JA 4CCYA 5FOQA 1F0PA 2C5FA 3RK4A 4M4RA 2HU5A 1LBTA 3HZOA 1GKKA 5DTJA 5SYMA 5JD4A 3B12A 2DQYA 4X6XA 5IHRA 3T2OA 1J06A 3O95A
chains in the Genus database with same CATH superfamily
3ZYZA 3CIHA 2NNWB 3TDNA 4M3CB 3O38A 3B5EA 3RNLA 4N49A 3WDXA 2WD9A 3ZN4A 4RK0A 4YMWA 3EIEA 4AP9A 1DYPA 3RLIA 3E9NA 4KOEC 1AXKA 3E61A 3TNYA 2JCXA 3QVGA 5J1XA 4MWEA 2WJZB 3SEFA 2G9GA 5JV5A 3HNYM 4R01A 5BYBA 5A9SA 3QKSA 2CBXA 2PYDA 5FZ9A 4O4JF 1BJQA 5CDHA 4Q1AA 1MPTA 4CU2A 3P9KA 4ZZ3A 3QBEA 1ZICA 3NJ4A 4U5XA 4PI2A 4RN5A 2DU1A 2CXPA 3IESA 3MRSA 3BRWA 4SBVA 2WYFA 5EJMA 5PGMA 2RDNA 3TMAA 1A50B 1P1KA 2I7XA 2ZI6A 1D2SA 2OHOA 4ARUA 1XJWA 1PZ9A 4BIOA 1D1PA 2FQWA 1FBTA 1L7BA 4S24A 2EJCA 1NPYA 1T5TA 3WSVA 3RARA 1DNPA 5IDYA 3HG7A 4Q4W1 2M6KA 1R5NA 3ER6A 3ONVA 4BE4A 4JGIA 2BC9A 1GKUB 3WNOA 1CB0A 3UAOA 5G0WA 3RTAA 1OVPA 4I5IA 2JECA 4AGVA 4MWGA 4OHKA 4C0AC 3USCS 5IK8A 3SEPA 3HCOA 4GO1A 1RMQA 2C54A 3ML1A 2ZTUA 3VC2A 1E3SA 1KQNA 4ZMRA 3D6JA 4Y7DA 4FB4A 1Y9DA 4Z49A 4BU1A 2PS3A 5TLSA 4C08A 3ROEA 3K9BA 1FATA 3POYA 4IQFA 1E2UA 2FWJA 1EVQA 4P86A 5LYJF 2ATXA 3LPGA 3VH4A 3D6FA 1H9PA 3FPAA 2ZHNA 1TD1A 1SXHA 1STOA 2H0BA 1IMJA 2ZZJA 3RSZA 1W0NA 3TSYA 1DZIA 3NRBA 1FY2A 1R0CA 1W5BA 2VKTA 3PQCA 5EWLA 5LP6B 4C0QC 2BIFA 4B7UA 1H2HA 3PQ7A 3NUQA 1YOBA 1EDZA 4RPGA 2RJKA 2CSUA 4O9EA 1KYWA 4F71A 4YP1A 5CDYA 5K0EA 3Q0TA 4QU9A 3GD5A 2XDQB 1RYDA 2DJ5A 3T1TA 1P60A 2YXSA 3N6XA 3UT0A 2Q1SA 4GOJA 3E8SA 5BQXA 2BFPA 4IIUA 2B82A 4GVLA 4C0KA 3NYRA 1LDGA 2VPQA 3BXFA 2WZCA 5HTKA 2RH9B 2OG1A 3QE3A 3CUVA 5FMOL 3KYBA 2VQSA 5D00A 2K6GA 4Z99A 1KDVA 2V8OA 4P38A 6LDHA 3N36A 2DBQA 4YDQA 3POIA 2WIBA 1KI3A 5FUXA 3E58A 1C7RA 5TNXA 5AK0A 1APNA 1IN1A 1X7WB 4CDWB 3U7JA 1E3WB 4YVSB 1RUJ3 1J07A 5L6LB 2OXEA 3EHDA 4KQ6A 4R8HA 4HPKA 3PJRA 1JJ7A 1Q1NA 5F7ZA 3GU3A 5HFNA 3GZUC 2WSMA 5I7SA 2J9XB 1E2LA 4OYLA 3VKUA 2A57A 2GRAA 1X1EA 3QKWA 1SHLA 4QPIC 3PR3A 3QELA 2X0EA 2O07A 1HXS1 6AT1A 4QXRA 5BRAA 1ULPA 4OKIA 2X1MA 2V4MA 4ZYYA 1YVPA 3LU1A 4YQYA 5K3CA 4PZ0A 1MO5A 3AZWA 2QMOA 5J36A 2GZSA 2Q27A 1WZXA 1RTKA 1E0DA 5B30A 1STMA 4QQLA 4R41A 4XMIA 4AVVA 2DKOA 2E87A 4GQAA 4KXNA 1FDIA 5JZVA 3G5TA 4FTWA 3ISJA 2PHZA 3RFUA 1OZFA 2DJIA 2HMSA 3C7CB 3NUGA 3O8OB 4DGQA 1YIDA 2HMTA 3U31A 4KQGA 3OCUA 2FXIA 5ALDA 2FMDA 5HXVA 4JJAA 3WA7A 4KRYA 4BLTA 2C5DA 1XAJA 1MRZA 1OWMA 3HCEA 3LEGA 3L1IA 3OIYA 4BGEA 4IMJB 3DT6A 2IVJA 3DQZA 3BCRA 1ZJ5A 1K45A 3Q6NA 2NO7A 3GJQA 3UJ3X 3UA4A 2VTVA 4O4HB 3VYWA 3VZOA 4IYJA 4XPZA 1NXWA 1KFCB 1JYCA 3GVIA 3CZRA 2ZTSA 4J1WA 1UEIA 1CAVB 1QHEA 3GYBA 3VR4D 4GC9A 2ZB7A 3WYNA 4GXRA 5F2KA 5KOHB 1OV6A 3B9IA 4KIFA 5E1OA 1TYDE 1OURA 1JZ7A 3VJKA 4Y1EA 3AEKA 4MH0E 2VOEA 4XTMA 4NOLA 3ACLA 1WBDA 3O12A 5JMTA 4BLQA 2GMMA 2LIPA 2G72A 4NENB 3OGVA 1X0VA 1TAUA 1J7JA 2HBQA 4B8ZA 1U7TA 2MHFA 1P2FA 2GZWA 3G5LA 1OXMA 4PAOA 2J0UB 3RWMB 4DV4B 4FOYA 3CO2A 4XUDA 5TB5A 1MS3A 1HGXA 2GO1A 2HMWA 4G5FA 1GUFA 2IRWA 1RP7A 4JP8A 3NAPB 3WYEA 2CDCA 1GO2A 1V6CA 1OLXA 4O63O 3GOHA 2Q2OA 4RFT0 4C05A 1XRPA 1WXEA 3JYOA 1TQ8A 2VTFA 2EC5A 5DZSA 4XCBA 3PZBA 3EB7A 1NUHA 2JGEA 3MLJA 3ZTTA 2B5WA 4HGYA 3PHHA 1WGPA 4BCUA 2YHIB 1J8QA 2I7CA 3HA7A 3GEEA 3KQ4B 3JD1A 4D0RA 1XTJA 2A14A 1S0JA 4DA7A 4F3NA 2X4GA 2H9YA 1JAXA 1EX9A 3VPXA 3P5SA 3VHLB 3W9SA 3UJAA 2GVNA 3MIDA 2HDHA 4N8DA 5CX4A 2YYSA 2IPNA 2C4XA 1VPLA 3U4GA 2I74A 4HZUA 3V1MA 2A75A 2OW4A 5F6KA 3BHMA 1N5RA 3UMMA 2PWPA 4BFXA 1GZSA 1TYEB 2OCIA 1QG2A 1SXIA 4CF6A 1KC1A 4I5FA 4RANA 1ZKDA 3FZNA 3ZWMA 3WG4A 3TCXB 4WESA 1AXGA 1YQQA 2RHMA 1OWLA 1VBA1 3MLBA 4BFUA 4DIKA 1I6KA 2C84A 4URWR 1U0JA 2FSVC 3GROA 5LOVA 3I3DA 2RGNC 1VL6A 4FFSA 1EP3B 4UUAA 1W9YA 2QLJA 4P9IA 5IT0A 4BUZA 4FFOA 3PNKA 3E4DA 3IBTA 5KPDA 1QH0A 1OR8A 3EPKA 4FQ4A 1RD4A 1SG0A 2AZTA 1F4PA 1O5UA 4FYVA 2XJPA 1YE5A 5IU6A 4IETA 2VCBA 1Z7YA 5AVQA 1ZK4A 2VXYA 1WHSB 4XBQA 3ZWDA 3V8PA 4BU0A 5HGJA 3LY5A 1OJ7A 1JFVA 3FUVA 2AREA 4IXDA 2BZ0A 4FU0A 3WRYA 2ZXQA 4CYMA 1W52X 3EJ6A 2V3VA 4C4SA 1L6RA 2BKXA 2AUMA 1KI6B 4GMFA 3JASA 3BK2A 3BTVA 3M3IA 4FVTA 3B1XA 4CEHB 4ID3A 1KZ4A 1YDMA 2DZDA 3MUZ1 3SK0A 4BLUA 4OI2A 5JAUA 2O48X 3I6ZA 3EFHA 2NQYA 5GZCA 2ZZQA 1ZCAA 4QQPA 4M0DA 1DGRN 5FMOS 2B37A 4XQ9A 1JFTA 3CUSA 4PYKA 3DTVB 4AY6A 4F86A 4DPMA 1LOFA 4QB1A 4L9WA 1Z6AA 2H1IA 3C7EA 3PXGA 4X54A 3HVUA 3DM5A 4AQ7A 1II8A 1IHDA 2YUEA 1CTQA 2DFKB 2VG8A 5K0NA 4I2NA 2CK3A 1C3EA 1URXA 1KO1A 4TKUA 2P0EA 1NZJA 1NZCA 4IEUA 3Q12A 3KXPA 1JKJA 1YB1A 2WWSA 1D0GA 1QHDA 1YBMA 2D0PB 1FRZA 3UTDA 1NW7A 2C04A 5BR8B 2GARA 3GPCA 3W1EA 4Z7QB 1QO0D 3PUIA 3OIGA 5B58C 1KEPA 5EXEA 2W2MA 3B1YA 4CI9A 2PUEA 4YAGA 2H54A 1T3TA 5KTYA 4EJMA 1M1ZA 2FSVA 3QFSA 5D3KA 3AHCA 4N3NA 1PHPA 2RVAA 4LEIA 3JB8A 4S1OA 5KXBA 1DGLA 5FADA 3KV4A 1XZCA 5AVPA 2FDGA 1OIVA 2RS11 5H80A 3AZOA 1E3DA 4ER0A 4BZPA 5F7UA 2AN3A 3JARA 3BUSA 4BOWA 4DA8A 2PHUA 2QQNA 4PZLA 3DMFA 4HBNA 4YRDA 3NETA 4XAEA 3C87A 4V38A 3UYKA 4X8NA 3N9LA 3QUBA 3ZWOA 1JG7A 1OSNA 4QDKA 4F12A 1G41A 2BFEA 5HZGA 3TLZA 3IUPA 1J0BA 3KQKA 2EWMA 4GRIA 4ZXFA 2W71A 2VMIA 2I1LA 3PJYA 1DDOA 1LVUA 1QO9A 2Z2IA 4Q9JA 2AUYA 5GM2A 2BELA 4A73A 4X90A 2WU4A 1FMLA 2FB9A 1LVGA 3TRSB 2WT9A 4YWJA 2GM3A 2D6NA 3CZCA 3ZIWA 5GWXA 1MNQA 3BE8A 3URMA 4RFLA 4BGDA 4KFRA 1UC4B 1WXFA 3FR7A 2R751 4L3OA 4ZVKA 5CURA 1Y1LA 2GXUA 5C9AC 1G64A 1MT3A 2VNSA 3GQVA 1IU9A 3RS8A 3KKZA 3PNSA 4Q4CA 1CJUC 2GAAA 4JXJA 4MNTA 3W5DA 1NM5C 1GTRA 3QUAA 4KQMA 1M06G 3TL3A 2V5AA 3GF6A 3ZYJB 4MOWA 1WMEA 3NBMA 2JCGA 4COYA 1T0IA 1EYZA 2XUJA 4DADA 5ENVA 4DA0A 1T6ZA 4JYZA 4FFHA 5KHGA 1YFXA 2QQLA 2NZJA 5CUQA 3IERA 1T43A 1POV1 2HF8A 2DBYA 5CHEA 3JD73 1RIIA 2QUBA 1S6YA 5CK4A 4JCOA 2GNBA 1FC0A 4BE9A 2ZROA 1WNTA 2VJBA 1LHNA 4XFIA 3K94A 1A4UA 1SQSA 1HN1A 2NX2A 2QSYA 4FGJA 1CDOA 4YGBA 3T0IA 1HW5A 4BCBA 3LLMA 5B3LA 4DCOA 3WGUA 1C0PA 4C01A 1X7ZA 3IPLA 1NQJA 5FUMA 1TJ3A 2X40A 3PFHA 1H4GA 4QJ3A 3GVHA 2D2VA 4M99A 1XU4A 2JDUA 1D4OA 3ZDYB 3PF9A 1S9HA 2VZEA 4F21A 2V0CA 3OY2A 2IHUA 2JFHA 2XUZA 2ZGSA 1BMTA 1RI5A 2VM9A 3TLKA 1O4WA 3OYWB 4ZS2A 2IOFA 1P2DA 2L18A 2RIRA 3F2VA 5C0OE 1MQAA 1YXMA 5I4IA 2RGNA 3OOJA 3A1WA 2XMSA 2YFKA 3RSFA 1RM0A 4KLAA 1PIWA 3I72A 2EBWA 2G82A 3EGWA 5FO9B 4FWBA 4LULA 5C5EA 1F6WA 3UJQA 3PGVA 5DMXA 1W94A 5LMZA 4Q0PA 3GZEA 1YU9A 4PLFA 5FORA 2A92A 3IURA 4B3DA 2VUDA 3P96A 1XMSA 3S2GA 1Y3FE 2YQ4A 3EEYA 3PNQA 2YU1A 4ETIA 4G5XA 4LXXA 1CESA 3H9QA 1RUH2 4CA9A 4XDZA 1GA1A 4D6RA 4ALLA 3RIGA 2Y1WA 4DQDA 1NLZA 3V8EA 3DJFA 4LO4B 2ZDQA 3SR4A 3SEAA 1IXZA 1E2GA 1VA4A 4OZXA 4QEZA 4J29A 3EXHB 2HWC1 4RULA 4HDSB 5L4LA 2QBYB 3MD9A 3F6RA 1CR1A 3T1VA 4JGZA 1BW9A 4KLCA 5DNVA 5HWSA 1JAHA 4IUDS 4QU8A 3VNBA 2QUAA 1UF9A 2O6LA 4GP9A 4YLEA 1HBJA 3ICOA 3BIFA 5HRCA 4G8BA 3NSTA 3RHTA 2AGVA 3VUOA 1V5IA 1RVF2 3AUJB 5FWYB 1OTXA 2BZSA 3L92A 4FLEA 4F5EA 3X29B 3S2ZA 5AJVB 3PGXA 1ENQA 1PL8A 2B78A 3V8MA 4QHOA 3A1TA 1CPNA 3OCPA 1KI2A 2JKXA 3OEED 4B6PA 4TTJA 5KYUB 4H15A 3USZA 2RBKA 3TOXA 3VR6D 1VG0B 1VKOA 3FVQA 2ANBA 3QU9A 2RGWA 2ZJBA 3W8RA 1O3YA 2F8MA 4XABA 1V6JA 1BX0A 4FS3A 2D3PA 4ZP1A 1XU1A 1EJ2A 1Y3HA 2G8LA 5COQA 4MS4B 4F4IA 2WPDA 4XARA 1ULOA 2D1FA 2RSLA 1E77A 3RPQA 3OFSA 1DTWB 1ZRRA 2RGAA 3QOYA 1G3UA 3I23A 3W5CA 3QBTA 1JN2P 4H1UA 1N6RA 2SBAA 4NECA 4DG9A 3UYJA 4H08A 4GX1A 3N7JA 2YROA 1U9YA 2NAFA 3DV0B 3EPHA 5C8CB 1NSFA 4I1IA 1PWHA 2QTMA 5B7NA 1W4AA 2WFZA 4BCDA 4QATA 3G2MA 1DQPA 4QX5A 3MGKA 5ADWA 1COV2 1PFGA 1QZUA 1RAAA 2FSSA 3ASYA 4B4VA 1BHJA 3I5XA 2ZRNA 4E12A 3DBLB 2PXXA 4NMIA 4ITUA 5IVFA 3DTTA 2OCDA 3BX1A 4HLTA 1AC5A 3Q6IA 2G71A 1Z2PX 2MMGA 3EQ7A 2HBTA 4IIBA 4XB1A 2VDJA 5C33A 4IDGA 4CUCA 1O3SA 3I62A 3HPQA 1YUNA 3RROA 1H05A 2FDJA 3C1AA 2HNBA 3I6BA 2C4NA 1LBSA 3I54A 1RQRA 1ZK0A 4HH3C 5D5QA 2XG3A 3B60A 4XUNA 2CC2A 3NX4A 2PSEA 1UJ2A 4EB3A 1VMFA 4D9BA 4YRSA 4EI7A 1S55A 2HQBA 4B8EA 1HYHA 3EGXA 3ENVA 4LNAA 1RVF3 1IZZA 3CS3A 2ZUCA 3H75A 1C3HA 1WD7A 6REQA 5A3OA 5B3JA 1YRBA 3CUWA 1U6JA 5I9NA 4NE9A 3HB7A 2C2YA 2IBTA 1PD1A 2OL4A 4J3JA 2JFBA 1XBFA 1H2KA 3TQTA 3I4FA 3U0ZA 4YJ2B 3PDIA 1GUBA 3NPAA 3W2TA 4BO4A 4TL7A 5C4WB 1SA0A 3HR7A 1R4NA 2QMHA 1JYNA 4YCBA 3AY6A 2B25A 5JDCA 1ZK1A 3OG9A 4ZODA 2KW5A 1TEIA 1EX1A 1SXGA 2PH3A 1DXQA 3PD0A 2NZ9A 3UUFA 4NABA 5ITZA 1UOJA 1AO0A 5IAKA 4DMUB 4DJEC 4RD7A 5JZMA 1NOIA 4TT8A 3ZWKA 3PFIA 4D9GA 1R9MA 1IYZA 4K9RA 1UIJA 3PRKE 4QQ8A 1RAHA 4LGVA 2JDPA 1UW8A 4H9GA 2XMZA 1KFXL 5E7IA 5FP0A 3INAA 2YV8A 3TSAA 4DHWA 4PFSA 5FO7B 1K08A 3NB0A 2ZWOA 2QAIA 2W08A 3H7AA 3WGHA 1NG0A 3FZ3A 5G0TA 2I6UA 3A0KA 4EI9A 3OZUA 5AXCA 1VFNA 4FNGA 2AR9A 1U6IA 3F9IA 4IH4A 4HQLA 1G6KA 1UBMS 5CPFA 3QYPA 4BQQA 1V26A 4RKEA 3ELNA 1M34A 4X94A 4HJXA 2PKWA 1W49A 3GW8A 4U2KA 3GUZA 4CLEA 2Y0EA 3STUA 1NP6A 4LHVA 1P2GA 4UNSA 4LYGA 3DA8A 1S02A 3MGUA 2BJSA 1H9WA 2A94A 5L3QA 2GU9A 3B7PA 4EHLA 2WZQA 4FR0A 2QE7A 1T91A 3GLFE 3ZZ1A 2WHPA 3EEQA 3ZY6A 4M55A 3HLTA 4ZU1X 1B0PA 3HP4A 1KIMA 2AX4A 2FK8A 1JIVA 2RGDA 4Y1GA 1P7WA 4A8PA 1P4SA 5JOWA 3ETQA 2N3ZA 1L5HA 1W87A 3NHSA 1EVKA 4XFJA 3A1VA 3OJLA 2DAPA 5I47A 1Y8QA 4CPBA 1CN1A 3WSTA 2X5JO 3HN2A 3IAUA 1QGUA 3RSJA 1NVEA 5GADl 4JXXA 2QQ5A 1TM2A 3EZXA 2XQXA 1ATIA 4BFCA 4R3NA 2GN3A 3TNQA 4PDWC 1ZGAA 2UV8A 5I01A 3VR4A 1E7MA 5BT9A 2ERCA 4KCGA 1Y81A 4DLZA 1OGIA 3MF6A 1R6DA 2I2AA 2Y33A 3GARA 3QVOA 1A9TA 3R0IA 3BK7A 2MYUA 5CB4F 2Y8KA 2GPYA 4DDWA 1C4WA 2WWYA 5AW9A 5LL6P 5A7WA 1YRWA 4C6SA 3QOWA 4CIAA 5J96B 4BUCA 4R9AA 1J3PA 2Y64A 5C80A 3ADDA 4WKBA 5BUCA 3FGPA 2ZUWA 5FZFA 1QQP1 3I83A 4G97A 3ZXFA 6ADHA 5JPCA 1Y4SA 2WUVA 2QUJA 3N7MA 1IDOA 1CDDA 3ZYGA 3AEZA 4KV7A 2ZTHA 5JUVA 4PGHA 1YBAA 4G1UC 4N0MA 3RK4A 4M4RA 2B1IA 5T55A 4Q1FA 5FTWA 3NPMA 4HEHA 2DQYA 4RGAA 1BFKA 3B7WA 1RI1A 3WD5A 1SPXA 4KH0A 1N3IA 1C1LA 2MJLA 4PPFA 4NMMA 4U39A 2P11A 2XV1A 4HYTA 4B44A 4E1BA 4OBXA 4LOAA 3HABA 5CB7A 2ZYUX 4BFYA 1D4ZA 4WOJA 4KBFA 2ZMLA 2D13A 3ER9A 1G8YA 1N5KA 1XQWA 3WY9A 4A6DA 3U75A 1FMD1 4BNJA 1FS6A 3LQ4A 4FAHA 4QWMA 3OFND 2D5FA 4H7MA 4Q4AB 1ZN2A 3RFVA 3ED1A 3B2QA 1YZ3A 2CMGA 1XNKA 1BE0A 3G85A 1O59A 4E5UA 5CVRA 3MLAA 1I80A 1F60A 3W6OA 2JB9A 3FDZA 1EP0A 4U7TB 5EQFA 2GNAA 3S5JA 3UL2A 5EE9A 3CU5A 3T5CA 1XZDA 1B2LA 4HO1X 5FWEA 1W34A 4FSXA 3LDRA 4GZMA 3VZNA 2HSJA 3BD8A 5IAGA 2BM1A 4EX6A 2DMRA 3JYQA 3IQIX 2ECQA 5B1EA 3SNMA 2EIGA 2V5YA 3PQ4A 2X3YA 2R073 1IY0A 4R5MA 5CR9A 3Q1KA 3NOVA 3DVAB 4M1MA 3P9NA 1UWLA 3E8XA 5EHGA 2D2FA 3O1JC 1EV13 1CRLA 2E26A 2QD1A 1PMHX 4RJ2A 3JQCA 4JEHA 1EFVB 3SVZA 5DX1A 4K6FA 1EVLA 4UE2A 3ATGA 5H70A 4D4GA 2G9NA 1LQTA 5CLFA 3OLQA 1KXGA 2P4UA 4MI1A 1N9ZA 3AX6A 5ALJA 3WDVA 2VK1A 1OPRA 5IBQA 1K8RA 1JZTA 5CNKA 3WP6A 2I4OA 3TR5A 3ZYCA 4P80A 3R2JA 1NJSA 2JL1A 3VAAA 3PL5A 3AGPA 4Z2YA 1TW3A 2JZCA 1J8DA 1V2HE 4PCUA 1Z6XA 4FONA 3PFNA 1H6XA 3HBAA 5HBAA 4JOBA 3RQ0A 2JJ1A 3B2EA 4ZKEA 2ID7A 1GQRA 4EUSA 4FT4A 1YUMA 5IKMA 3DKVA 3IAFA 1EDOA 4U2FA 2BRTA 4KL1A 3EGIA 4OP1A 4YJ3B 2IU4A 5ICMA 3E9ZA 2UU9B 2WWRA 4O4LF 4N9HA 5IVJA 1DTEA 1CQIB 4WERA 4UAPA 4MRMB 3DP7A 1HR0B 5ICCA 3QWAA 1HDXA 2BE9A 1QOZA 3ECCA 3II6X 4WNAB 3Q8CA 3WLSA 4HDKB 2J9FA 1SUCA 3HCPA 1GDDA 4YFYA 4N9QA 2JAUA 4RDCA 4LDRA 1JEQB 1QYDA 3RSOA 2ECOA 1Y63A 4I1VA 4QUJA 2O52A 3UGKA 5FIXA 5CX1B 4F4CA 3PIGA 1HOTA 1CLUA 2UYQA 1FV2A 1P1HA 1RC8A 3KUCA 1AURA 5A4FS 4HAVA 1GAJA 5EMLA 3NAQA 3EVAA 4HV4A 2CLLB 4PC1A 3DEYX 3WLLA 2OWEA 2YFYA 2PL9A 2EFDB 1FXZA 1RUD1 3I45A 1KI8A 4Z86A 4CL2A 3MW3A 3AZPA 3CQOA 5K0BA 1X9HA 3CURA 4GZ3A 1FTQA 3D2CA 2Y1CA 3VV1A 3RFCA 1E59A 4LYYA 1DFIA 1N9KA 3MCTA 2G5CA 4R9BA 4HVQA 1RJGA 3EJWA 2Q0XA 2WF9A 5DLQC 1VDZA 3G2IA 3VBEA 1KEUA 1JSRA 4Q8LA 4YFWA 4K6OA 3X1MA 2QU8A 3WWEA 4ENWA 5FUPA 3UT5A 4ZV4A 2VZQA 2V6JA 4K2AA 4YJDA 4W5WA 3VU9A 4MX3A 4BMYA 4WACA 2EX4A 3LX8A 2GF9A 1NLQA 1PIV3 4QBIA 5AKGA 4XF4A 1SU6A 1NP7A 5JYCA 2JH9A 1Q0UA 4RPLA 1CX1A 2I9KA 4I55A 5E4TA 3BE6A 3NHPA 3FVTA 3AB0A 4V0RA 2VG9A 4INOA 1FPQA 4LO5B 2WHQA 3V55A 4EROA 1PLJA 1Z7S2 4ND3A 4TWJA 1ND2C 1QCYA 2GLXA 4N47A 2FWRA 3SNKA 3ZYIB 3AZZA 2G4LA 2HH9A 2GN8A 2BUBA 4I4NA 2VFAA 3EASA 2ID9A 5EUBA 3HYLA 2C1ZA 2WV9A 5BQ5A 4MGIR 3PXBA 2A3RA 4IOJA 1AKRA 3EUFA 1VMDA 3HMQA 2FH5B 2PUGA 3JB4C 5FLJA 4C1XA 2OXRA 2ZJ1A 5FL7A 4XSHA 1Y4WA 4CKBB 4KQHA 4DRYA 4U7JA 5LDDC 3L6OO 5IANA 2F2TA 2JAPA 3OF5A 2F48A 4OFZA 3RRNA 1BHQ1 4BNKA 3QMWA 4BJ1A 5BPXA 2QVYX 1W3VA 4MO2A 2O8QA 4HR7A 3F4LA 3V33A 1GLNA 5FYCA 1XRQA 2QM0A 3FWPA 1RRPA 2W83A 1YACA 1U8YA 3TL6A 3M3HA 4E2FA 5FA6A 3PDWA 3CGGA 3QVSA 1NC1A 3H11B 3IEIA 1OLOA 3PTRB 3OB8A 4TXWA 4ACBA 1WPRA 1IHXA 2XTNA 3M6VA 2Z2KA 1GA6A 2ZU6A 4XVHA 2HLPA 3BXOA 3QOFA 1WCKA 4QHYA 2E55A 3THXA 1K8ZB 1VIYA 4OYHA 2ZU0C 1QQ5A 3AVQA 3E8MA 5IJ0A 3O4GA 3ZGNA 1I6WA 2EATA 3A9SA 3C8HA 4UQPA 5CDFA 1U63A 2AXQA 4BAUA 3LZCA 1JKIA 1FOEB 2PUFA 5JQGB 1K6JA 3PUHA 2C77A 1AK2A 1KI7A 3QJ5A 3T9EA 3PDCA 3UHJA 1XZFA 1R64A 4UFNA 3WHPA 3K1ZA 3N28A 2E63A 2Q4TA 1GG9A 1N1GA 4A10A 1BHGA 2OFPA 3V7UA 3ORRA 4DZTA 3GRRA 4WV8A 1IJKA 3KT8A 1L7VC 2I2CA 5CDSA 5AVAA 1YZQA 4R9VA 5KCZA 1OYWA 3CLSD 5P21A 4CG3A 4EEKA 2DHCA 2W4MA 5JRDS 2IE0A 2YC2A 2XMDA 3IKWA 2R7EB 3VAZA 1SHWB 2KHZA 5ABJB 4DIEA 2GS9A 2GJ8A 2QDKA 3DLBA 4LIPD 5F3GA 4YPOA 2CHUA 2C2MA 3D3AA 3RWBA 1L5SA 2YN0A 1X1DA 3WNXA 1ORDA 1CAXB 3MXTA 9LDTA 1G20E 1JB9A 1Z75A 3JV7A 3IHLA 1DRVA 2W43A 4E32A 2DH6A 1V96A 5ACA2 1E2FA 4BV3A 5FT9A 1E5XA 1VXRA 1EGVB 4J16C 5K51A 1C9DB 1WMSA 4D98A 5IHXA 2VH2A 1G7RA 4NDNE 3RADC 4Z0HO 1HRI3 1RADA 4BHPA 2VYCA 4PU0A 3ENWA 2HMAA 3G6JB 2O8FA 1NYTA 4EHKA 5ARDA 1RE0A 3ZY5A 1JTFA 3OJFA 5LSAA 2W00A 5EESA 1TO6A 2X23A 3KOUA 1UCFA 1DHRA 2LRHA 4B4WA 4O4LB 4Y20B 2QRVA 3WHTA 1VBD1 1PJAA 1HV8A 5LD2C 1JSZA 3GJTA 4KH1A 4KV9A 4O2LA 2C98A 2PFSA 1CF9A 1VLNA 2QYHA 4HNTA 3FFXA 4B3TB 4KGDA 5BNPA 2JI6A 4TN1A 3AM1A 3F67A 4O2BA 1GG2A 3ZQUA 3W34A 5T4FA 4XD2A 4QNMA 2YHIA 1IXKA 4FPOB 5T50A 1OF1A 2B7LA 3C6ZA 1TM4E 5E9JA 4U3JB 3D59A 3BWMA 4KRGA 4BGUA 2XB6A 5IEBA 4BKRA 2MOKA 2O3RA 2FSPA 2VH9A 2HF7A 3MHPA 3JQAA 3AETB 5IZCC 1U3VA 1R7RA 2VWQA 1VE9A 1M2VB 1SCRA 5EUMA 3D0KA 4LQRA 2PZGA 5TJHA 3DPSA 5GONA 1FOD3 3ZD9A 3BMNA 2ZJ8A 1KGDA 2Z5LA 4OIFA 3QPVA 5BNNA 1RHQA 1XRNA 3DF9A 3CV3A 3L4KA 3X43A 4C20A 2RAVA 1CX4A 3AYXB 4WKGA 4YB8A 3NIGB 4URFA 3JCZA 1DKUA 3OU6A 5JMWA 5AOVA 3ZE1B 3FOBA 1DLLA 4P8RA 5K3BA 1B4DA 2QR5A 3TXYA 4EY7A 3J7NA 3F98A 5B4NA 3O84A 4K8RB 2V72A 4XJUA 5TARA 1RCFA 3MTAA 4RCVA 1INLA 1C3LA 2YIDA 4K0RA 3X1WA 2PZAA 4V2IA 2R043 4D6PA 4NK4A 4F3TA 1EUDB 4Z9YA 3IKJA 3GL9A 1A6CA 2OTCA 1QEXA 3EBOA 2H5EA 1UDRA 4KWUA 3FVVA 5LA0A 4OGWA 3S3TA 3CVWA 2AUNA 4HKOA 1QQAA 1TM1E 4R9DA 1I0IA 2WDBA 4URTA 1YK1A 1LI7A 1TLTA 3P2MA 3VN4A 2BGIA 4EM6A 4M8NE 2R8YA 4Q3OA 3UHAA 1IUNA 1Z2DA 4QSHA 3DXZA 1J21A 3ZDDA 1EZ1A 1MG0A 3I1JA 1IAVA 5AI9A 1Y80A 5FBLB 1PCXA 4BECA 1DQ5A 2XNKA 1CJVC 2Q99A 4W5QA 1NVTA 3WLOA 1N6IA 2WJGA 1K9VF 4EH1A 3H9BA 2B4AA 2VA9A 4BWVA 3IDBB 5T54A 1LXCA 3PWKA 2B83A 2QRNA 1NQTA 3IDAA 3CQ9A 3PKZA 3QNWA 4PPQA 4C3VA 1Z7BA 2A9PA 4PNPA 1IBLB 1OXSC 3MTGA 3Q2OA 4ZU4A 2JAWA 3L6EA 4BXOB 5KYYB 3UPUA 3OZGA 1ISJA 1OWPA 4B3CA 1P4HA 2P35A 2XJ4A 4KUEA 4BMNA 1LDNA 4FTSA 4L8GA 4HSLA 2QAGB 1LBQA 5LATA 4TZDA 1C4XA 4YNBA 4FXKB 1GNTA 2YVAA 1P0QA 1RWVA 3C3JA 2GEUA 4IZHA 1FXWA 1MX9A 2XJTA 3EZ2A 4M36A 2RM22 4AN1A 5INTA 1TVCA 3IKVA 4EG4A 1CAWA 5JVDA 4QYIA 3KL2A 1GZWB 4W6WA 2H4FA 3BH0A 4ZC8A 5EHXA 1UMDB 2Y6FA 2IHZA 1QGED 4Y5Z0 4F6RB 3GFFA 5AVJA 4E5DA 1I7DA 3K9GA 2QL6A 3NW9A 1KGYA 5JZOA 5AKKA 4D1YA 1SURA 4XXAA 3UUGA 2E21A 2PEZA 1RJFA 4GW3A 2H4YA 3OOWA 1J2EA 4DM7A 1O8CA 4IEQA 3S7IA 2JKYA 4A7KA 1HQWA 5FY4A 4ZOLF 3GEBA 4M76B 4PO1A 3A4YA 1IY1A 4NJMB 4HD8A 1XMQB 5K0UB 4AZZA 1QYIA 4Z1MD 3RTGA 1S7CA 4CMHA 3L6DA 1K4MA 3F90A 3FPJA 3WAJA 1NPTO 1W88B 4HDMB 1NFRA 3M6IA 4G4SO 4Z8YA 2J4CA 4RK5A 3ODPA 4AN4A 4KWHA 4TUYF 5K3OA 1CQJA 3TZBA 3AFHA 2Y93A 4TTVA 1G3RA 4AN0A 4HB0A 1RI2A 1RQXA 3FAZA 1PM4A 4B1FA 4BBAA 1EWQA 1Y8RA 4IGOA 2W93A 2FTKE 3K3PA 2CXNA 2OENG 5JDCC 3DXTA 2VDMB 2QY6A 4P32A 2Z1DA 1XTTA 1L5KA 3O4RA 3ANNA 1PSZA 4BZWA 3UWMA 2YV4A 2V45A 4J1TC 1KH3A 1S8FA 1Q0LA 4QUKA 5BNOC 1KSHA 1JZ3A 5B3JC 2EGGA 3PJDA 4US2R 1E6WA 1HV0A 3B9RA 1NVUQ 4FFMA 3ZO0B 2PGJA 3GDWA 3I3MA 3VYVA 4AW7A 3DFFA 2YFUA 4F1JA 4GOMD 2CXQA 1CVRA 3V8BA 2XZDA 4D8XA 3RHSA 1N1SA 1U3WA 1NU6A 5H9VA 3RFTA 5A03A 4Y98A 3IXQA 5CB4A 1ZSNA 4JB0A 2QGNA 2I0FA 2Z6AA 4IHJB 2V6IA 2JJ1D 4ND8B 4TS4A 3KVAA 4LBKA 5E2AA 3UFXA 4JL8A 1NXMA 4DLPA 3P94A 1KYVA 1IDN1 3O3MB 3PL0A 1TEVA 4UEWA 3QFRA 1TK2A 2WSSD 3C3KA 4O1IA 1NDHA 1IZ3A 4MLOA 5KHKA 3S68A 4H2DA 5FUQA 3TD6A 3D8UA 2HK6A 3I9V1 1XALA 3SNHA 4EN7B 3SF8B 2JB4A 4L16A 4A2UA 5DDJ3 4W63A 3OYWA 1ZBE2 1NCQB 3HCNA 5E4YA 4F0JA 3G9TA 1YI7A 1C9MA 4DR2B 4ZEMA 4RLQA 3SZOA 1U0GA 4MB6A 4WZZA 4WXRA 3LMKA 2WSYB 4E5VA 1NNSA 5G4KB 1A5TA 4B1LA 2YBSA 2PO5A 2Q1WA 2H07A 3JYHA 4M83A 5CFDB 1KNQA 2HSEA 2BZDA 4TMXA 3MTBA 5J1TB 3U4XA 4P7FA 4KVGA 5L3VA 3NJVA 4DJFC 4N5DA 4EWAA 1O4ZA 3ZGLA 4BVAA 3ZEAA 3LDGA 4GSKA 3P2IA 2H3EA 1O9GA 2QNBA 4QQHA 5EAIA 1DBPA 1XVUA 5FQNA 4OUSA 2MEV2 2KBFA 4CM9A 5CYGA 5D3QA 1ZKMA 1RXYA 3K9HA 4RGBA 2D54A 1EE2A 3HJAA 5A06A 1E1QD 1NM5A 1LTHR 2XGOA 5EJFA 3LA7A 3V2IA 2AKAB 4CLXA 4WCDA 2QL7A 3EG9B 5DN2A 3ON7A 4DDMA 1AB5A 4KXVA 2W70A 1U3TA 1M1YA 3KJZA 4RTOA 3C3CA 3V4OA 2I71A 4FOLA 2EVWX 4J7UA 3H04A 5JSZA 1GWNA 3PZRA 4WLFA 1K89A 3ILYA 3E5HA 1XHFA 3UBTA 2ZJZA 2P2NA 3RABA 1NLFA 4AI0A 5AOCA 1RVF1 1RHMA 2LROA 2AYZA 1CS0B 3ABSB 3I2IA 3S1AA 4AVYA 5DSZA 3IAHA 4N0DA 3AVXA 1YFJA 3SC6A 1BVUA 3TZLA 4IQ0A 2HGZA 1QIGA 4HTFB 4H4CA 4I8XA 4OGKA 3CUYA 2CVZA 4Z5XA 2L17A 3QYJA 4PSVA 3B6KA 3U2QA 4WNYA 1HFWA 4IIXA 2OV3A 3MCUA 3T8YA 1SVIA 4HDQB 5H9WA 3T95A 3T4HB 2I76A 1CUFA 4FHEA 3C98A 1W8NA 1U0EA 3BMXA 5BW4A 1II8B 3D7MA 3S6PA 1DTWA 1V5EA 1XYVA 4YP5A 4BJ3A 2PMBA 4C0WA 4Y6GB 3LZ6A 3LE0A 2X8JA 3NI2A 3ZWPA 4KGQA 1JFFA 2WNSA 4QDZA 3DF7A 1KZYC 4G8CA 1YKSA 1YMQA 1CZVA 1DKQA 3DDOA 4OA8A 3HCDA 1QJY1 3WL3A 3GYGA 4PAQA 1OFTA 5D6OA 1L7AA 4BNDB 2C6SA 1PJQA 2NXCA 1QZ3A 2J1AA 4UNQA 4MEJA 1ZNPA 3NHBA 1JECA 4LDQA 4RMHA 5CIYA 1M72A 5FK8A 1GD1O 3KB1A 4B29A 1E6EA 3SJAA 1SVNA 4M1SA 4KPEC 3LPCA 1TE2A 1V3TA 3F8TA 1S4MA 3MFAA 1ZO8A 5T52A 4FYWA 2QHXA 3FWEA 1JWBB 3HXLA 3MEPA 4ZOLB 4BB5A 3PGMA 1ODIA 1FFYA 3JQDA 2IHJA 4S3MA 1KZ6A 3HS3A 5KKNB 3OZSA 4EKGA 3GLVA 1FFHA 2VHTA 3QFCA 2ZI9A 5E4FA 3NTQA 3DBHA 4CPDA 4AF6A 1KDZA 3MO4A 2ZBRA 1Z29A 3CLKA 3VSDA 1KFEB 3LKZA 3RS9A 1RLIA 1TEZA 3IAEA 1EBFA 4TYSA 3CLTC 4H6WA 1NW8A 3L0CA 4FFVA 3LFUA 1GGHA 2C9CA 4PR3A 3HV2A 4PNEA 1RZVA 2REQB 4QECA 4W7SA 1WZUA 1W9TA 4DQ0A 1C50A 4LWPA 1RHI2 1D7AA 4YCMA 5CZKA 2ZQZA 3TZQA 3I61A 4QVGA 2GJAA 2D7FA 5G41A 5IJRA 1QVVA 2I2BA 1Z2EA 3A6DA 1RHUA 4EYKA 3VDMA 5GJBA 1EUUA 4A8JA 3IDCB 2F3SA 4FYIA 1AMOA 5ITZB 3HKCA 3RSCA 3AWIA 4F8EA 1U8XX 4WFIA 3LKJA 3IUMA 1OPMA 3HN7A 4PG6A 5F3RA 1F5JA 4K0KB 1PGW1 2WUDA 3DLAA 1E1NA 2HRCA 2VYND 3E9DA 3ROMA 2CNAA 4F84A 3GF4A 4LKRA 5JAQA 2HWYA 3JQ9C 3RO7A 4YZ4A 5DK4A 1RACA 2VZ9A 2X5NA 3U26A 5FY0A 2G8NA 4CF5A 3M6WA 4TVOA 1AUQA 3TZHA 5IHRA 3GN1A 4Q8KA 2O59A 4DEXA 1N4DA 3RSHA 2OLJA 3OFJA 3TAUA 4X63A 1P1BA 4L92A 1H1TA 5JZSA 2Z5VA 1YWGO 4K2HA 4MVXA 3KYCB 4KYUA 1MT0A 2FFHA 1RUE3 1PG0A 4JJ6A 1KFUL 2E5FA 4AKEA 5ENZA 3VTZA 3WHUA 3AGQA 4RM2A 5HDBB 1WW7A 4IF4A 4Y2GA 3GP5A 1DBRA 4WECA 3HQXA 4EHJA 1SBTA 2H1RA 2DWCA 4AEJA 1XZJA 2ZANA 4BO3A 4FW8A 5SZIA 3GM8A 3UIEA 2OCXA 4DGSA 5CA0A 4TWTA 1YVUA 4CEIB 2N46A 2PLFA 5AM3A 3U07A 1PT6A 3NXKA 1YQXA 2FSGA 1KJJA 3CKHA 1PP4A 2XKOA 1L4HA 2BEVA 3CMMA 5JD5A 4GKXA 2WC2A 4YZ1A 4C4ZA 2OP1A 3BIOA 5KMGA 2N42A 4L57A 4YMLA 1ZNZA 1JXMA 1P7YA 3VVCA 4YG3A 3L41A 3T3GA 3IBYA 4QXPA 4CDUB 1YZNA 1OA3A 4PRYA 1ALYA 1FAYA 2RJ2A 3WBJA 2YDXA 4DA4A 3WSOA 3OQNA 4MARA 4M0EA 1VALA 2Z9CA 5A33A 3VI3B 4UM5A 3ZDCA 1PHRA 1OHHD 1PZ8A 1Y3TA 4TLAA 3HWRA 3IJEB 3EBPA 2G4IA 2JGAA 3BGWA 4QUEA 4ZI5A 5E1BA 3QU7A 4GRDA 4R2WA 3RRMA 1N6LA 5T8KA 2HOQA 2RIPA 1F15A 4ZEWA 5CFZA 1O6FA 3HUEA 3IOCA 5FWYA 1CONA 3VL9A 2DYCA 3TG8A 4C89A 4P4SA 5A0FA 3GJ3A 4QXOA 2FEAA 4O2AF 2XDQA 5AMXA 4O59O 5IT9A 4OI0A 4I4CA 4N82A 4PSDA 3RDIA 3VKNA 4MW9A 2AFRA 2AG1A 1NZFA 4FKMA 3TSCA 3FDJA 3MT7A 3EUWA 3N0XA 1YCDA 4B35A 4XXPA 3DOEA 1DIGA 3RJRA 2J7MA 3VJRA 3EQEA 1XU7A 3O2SB 4YAIA 4ZRNA 4R31A 3ORQA 4B31A 1JP7A 2XA2A 2B8TA 2X3UA 5C37A 3MXOA 3GFOA 1X7XB 4XWYA 4YVSA 7YASA 3KHCA 1NL3A 5FPAA 4DDHA 5BY2A 3UW1A 2K7ZA 3H6GA 4MKFA 3Q85A 3AHGA 3ZNOA 1LY1A 3VUEA 4MYUA 5F39A 5IFLA 1HDEA 2YWGA 4B83A 2A3XA 3O91A 1UMKA 4GNKA 5BPFA 4XILA 1SCKA 3T9AA 1C7QA 2V55B 1B6TA 1IN6A 1DHKB 2O23A 1VRVA 4URAA 3MJ4A 3NDJA 3SD7A 1GSAA 4YM2A 4LKFA 4DRRA 5K4HA 5BRNA 4QPWA 1M8GA 5LMCA 5DW3A 1TNRA 1FTGA 5D2AA 1GYPA 1E63A 1E2KA 4YI5A 1QCZA 3E6DA 3CJQA 5ANNA 5CVTA 1N1VA 4IIYA 4B4KA 1N92A 3OY7A 2XADA 4OJYA 4EBBA 3N9NA 3PFWO 2WFF3 4QLOA 1HKDA 3K0KA 3TQSA 1MENA 2Z09A 2HMYB 3C70A 3BH6A 4RZSA 3RR2A 3L7LA 2P9QA 3UYLA 5L3RA 2JB8A 4AM8A 3QE0A 4KO4S 1AS0A 1NY72 3L9JT 2ZRMA 4F4FA 3T3NA 3UESA 4I01A 4Q1CA 4IV8A 4HMZA 4M6WA 1XN1A 3JTMA 4BNLA 1TPYA 2XWQA 1P0FA 2Q5LA 3FVRA 4GWMA 1EGAA 3OPVA 3VKVA 3W5UA 4PLPA 1W35A 1KVQA 4R2XA 3BK1A 4H16A 2BV3A 1QU2A 1DRJA 4DQUA 3RJMA 2P0AA 1R6TA 4LITA 1NJ6A 1XTUA 1II9A 5BQ3A 1AT1A 3ZH9B 1OAAA 1LRHA 2QD2A 2NUAB 2OCPA 1R0YA 1CD5A 4CXMA 3GGPA 1W6NB 4GOKA 4D26A 2CDRA 3OPZA 3C5HA 1GRVA 1PD0A 3HFSA 4R68A 3JU3A 2UU8A 1CY0A 4EY6A 5KZMB 5D84A 1X77A 1COV3 4JL5A 1MBZA 4CQMA 3FZYA 3DBRB 3IP5A 5EKUA 2PCLA 1XRJA 4EKYA 2E4ZA 3OBTA 1C0EA 3QXSA 1Z5WA 2VF5X 4NFYA 4YAUA 3OMWA 1A5AB 2ONJA 1OFHA 2GFQA 1PK6C 3PP8A 2CKDA 4MCAA 5HJ5A 3WNMA 4RHUA 3B70A 3RZZA 1RT9A 2OO3A 2UYGA 1HE4A 2M6RA 4MUMA 3ME2A 1DO2A 1QNWA 4JBWA 1HSOA 4F56A 5IM4F 1CC1S 1KO7A 3C6KA 1BGVA 3A1SA 5IUQA 1NVXQ 2ZBDA 4JTNA 3JATA 4KU7A 4IJKA 3ZQKA 2HJRA 1RUD3 3SC7X 2HU7A 5LKAA 3ZZ0A 3WB9A 4ZDKA 1ADJA 4M3NA 1TDJA 5L9VA 4EGFA 3DFKA 4PIYA 4DCSA 4Q01A 2AR0A 3H84A 4HYEA 3ES1A 4PYNA 1ZYUA 4LYFA 2VSOA 2EKBA 2FZ2A 4HF7A 2FQ1A 2ZIAA 2NLRA 2ARKA 1DMSA 2QQ0A 1ASJ2 2WTUA 5E6RA 2OYZA 3SR0A 1R2QA 2NYUA 3ZX4A 2JKZA 1DDIA 3OBAA 5HCNA 5MF6A 4MWCA 2DH5A 2VQAA 1Z13A 4DREA 1ZA7A 1T5DX 3Q3GE 3GMTA 4OHVA 2X5KO 3ZD6A 1P7ZA 3A3YA 1IPKA 2C3UA 2ZRKA 1FT9A 2B35A 2ZSUA 1MAAA 3O5SA 2V5VA 2C1EA 2CCJA 1GV1A 4HAIA 1HXS2 3P2EA 4W5OA 4A4DA 5LWHA 1S0IA 3M82A 1IQAA 1PR1A 3WGIA 2YHBA 3QI2A 1ZI6A 3NL1A 5T6MA 5CA1F 1C1XB 1YL6A 1D4VB 1WXGA 3OZAA 2ZOSA 1KKMA 5CH8A 4UOEA 1RKUA 4HG6B 2VHEA 1NN3A 4C21A 2ZAMA 1C4RA 3SBOA 1MDBA 4ZYTA 3ETEA 1EI9A 3CUEF 1AB6A 3Q98A 4CCNA 1CZSA 4ITRC 5K3EA 4EJSB 3W04A 4XYLA 3WV4A 5BYJA 1E9SA 1P0PA 3QUSA 2V7UA 1KBOA 1T1GA 3W6ZA 1XNQB 1NE6A 5HKOA 2VOVA 2N9UA 4IH1A 2GD1O 3LF1A 1P1JA 1JJAA 1SXQA 1SG3A 4C2UA 3L5KA 2WJIA 3E4CA 1RSZA 5IXSA 4X91A 1UM8A 1FZTA 1SCDA 2QL5A 4HKTA 3M6XA 4WKPA 4Y22A 1W0KD 2HZBA 1G7YA 2VAUA 1P2BA 5GLWA 2CK3D 3EOAI 3FRJA 4D6YA 1XT6A 2XECA 2YMZA 1YYNA 1R1ZA 4AG5A 4J4HA 1JKJB 2E89A 1SM4A 2DFCA 3JD72 1F4AA 4QPGB 4TKVB 1R0BA 4A0QA 5GLVA 1BJRE 3RYPA 5DNAA 3OBBA 3WYBA 1SB8A 2PXAA 5EZYA 4MB2A 2PLAA 1NW9B 1DKNA 2P6PA 2W0XA 2OXIA 3UK7A 3C3PA 1OI3A 3WLHA 2XRZA 2JG8C 3ZNQA 4CEJB 4GAZA 3BIEA 4QGLA 1LH0A 4KRXA 4CLOB 1DEXA 5I9TA 4BQNA 4H14A 4W4ZA 3R7BA 4UEOA 3T54A 3I2OA 4M8LA 4PNZA 3JZVA 2PWAA 1TTQB 4ZMSA 2QW1A 4PWZA 3GJBA 2IEIA 1PYOA 1TLLA 5KC6A 3PTLA 5DRTA 4MVJE 3OO0A 4WOCA 3AMNA 1NVWQ 2O3UA 4ESVA 4XVQA 4TYMA 3RWKX 2O57A 2ZATA 1E0KA 1RQ7A 4UAJA 1J09A 5A7GA 4FC7A 1OLRA 2AQKA 3H83A 3JALB 1T1JA 4LRXA 3L8FA 1SLCA 1LW7A 3ODGA 1IRIA 4IX1A 4MZXA 5JLVA 3BFPA 4K9SA 1L5MA 5KC5A 1HRDA 1P2SA 2ZE8A 3SP1A 3L8CA 4ZCTA 4NCXA 2QVGA 4UTNA 3RGGA 1MZPA 3ROGA 4QARA 2XKAA 1B23P 2HJVA 3IVXA 4QKBA 4QG7A 2GZ2A 1ISGA 2ZJ2A 3CX7A 2OQIA 2ZRQA 2P34A 1RRMA 2AMLA 2O2EA 3VRHA 2CDAA 3Q7TA 5G0SA 1T4CA 1H1LB 3IH5A 2IYOA 3P1IA 3I8OA 1JZQA 3PIRA 2QNRA 3ZI4A 2BLLA 1FLAA 3LUCA 1QF7A 1U5CA 4LMAA 3SLKA 3N59A 3HWSA 1J84A 1F2DA 6CHYA 1W4ZA 1W7AA 1Y8AA 1OD6A 4Q26A 2VU9A 3WYAA 1XXLA 4A3ZA 2EKDA 1VKNA 4QZVA 4JI1B 4JP1A 4MUJA 2FFBA 1JE1A 1PX4A 2CGEA 3AF1A 2ODWA 1GNQA 4QJ5A 2IDKA 3GAFA 5IN5A 5JATA 1N6NA 3VU8A 2AEFA 2QZ9A 4YV2A 1OH6A 4RA0A 3BFVA 3NV1A 3SCFA 2W2QA 4E2WA 3KX2A 3EC7A 3DGEC 1V7CA 1QRUA 4JUDX 3KNZA 3VR5D 4IYRA 2GFHA 4AXBA 4ZVTA 2D43A 1SCAA 2E4VA 1OWNA 3RYIA 2LRPA 4Y4YA 4HFSA 2J3LA 1N8TA 1YK0A 3BD6A 3LPDA 4R8KA 3AC0A 3AV3A 1W03A 1VL0A 4YIHA 2FHRA 1UZWA 3D5QA 5LEKA 4C7OA 2XXZA 2GHTA 4H3SA 4IKPA 5JARA 3WV6A 1DCKA 1U0RA 4HDNB 1S7GA 5FWAA 4CYDA 1Y34E 4LOKA 3CNAA 3A9TA 4YS6A 3SJCA 1FVFA 1SCIA 5DDIP 4XM2A 1DU4A 1JFLA 4YV0A 4OUEA 1QVZA 3KPYA 4UW9A 3AIOA 1UBSB 1KJ8A 2QQIA 2RHHA 3SHRA 4HEJA 3RJ9A 5KHLB 1W8IA 1MW9X 1FFGA 2XL9A 4DWOA 4XCVA 3A1FA 5TV2A 4U7WA 16PKA 1F4HA 3AERA 1SR8A 5J4VA 3AI3A 1COWD 2P17A 4GI7A 5KVQA 3G7UA 5AVOA 2H6BA 1RDFA 4O3FA 1FYDA 3ZHYA 3D4OA 1RNLA 5CAZA 5HCHA 5BXYA 5EHNA 3S2IA 1FYVA 4MPDA 5LB6A 2IL1A 3N2YA 5FZ3A 3LOPA 4ZCSA 4B4UA 3CF4A 1YCGA 4F93B 5J23A 4RVNA 3FB1A 3ESBA 3WHKA 2AFHA 3H1FA 4QUDA 5ANQA 2Y1KA 3RSGA 4NWWA 1SN7A 5K8UA 4E33A 4PC2A 3ZZNA 4RTJA 4IWYA 2WQ6A 3H5WA 4JLPA 1VOTA 1QF9A 3JVIA 1AX0A 3AF3A 1G9TA 4NCKA 1MZFA 4Y6QA 2NYAA 3F78A 1X8EA 1KJRA 2WNEA 1EK1A 2GSDA 2YB7A 2HA0A 1LDEA 2EZTA 4X45A 2O2DA 3V4PB 2H51A 4LZAA 4ZU7A 4DY4A 2N75A 4FBMA 2UYOA 2W3JA 4D69A 2A84A 4D9KA 3VO9A 5DNDA 2WAOA 1AUXA 3THXB 3VVBA 3HA3A 5IT6A 1U0HC 4BMEA 1JZ5A 4PQ9A 3VBCA 3AY7A 5I91A 3B69A 1RXVA 3A4NA 3RV4A 1S0GA 3SCGA 2QMYA 2XONA 3GGOA 2E33A 1H0SA 3WGOA 4CTMA 5TS2A 2D8MA 5TQVA 5FBVB 1YQEA 2F17A 1WQ4A 1FFAA 5HBRA 1VE0A 3P20A 2QSZA 4X6UA 5A5FA 2FCRA 2BH2A 1D6JA 2IC1A 2QQUA 2FX2A 4UTZA 4I46A 1E4EB 5KSOA 4UBOA 1NMYA 3NGXA 4UF0A 3EXEB 4UOZA 5LBBA 3V1LA 4JLNA 4J6EA 5LEJA 5KX5F 3J7LA 1D03A 1LODA 1L8AA 4BX3A 3CR7A 4MW2A 1TM3E 5GV8A 1XDDA 2AD1A 4RU1A 1RAEA 3EARA 4M89A 4INPA 3A9UA 4GWNA 2QJRA 5HCUA 3WMFA 4KO8A 1ZD3A 1E69A 1X1AA 3TD2A 2BFFA 3IBCA 2HA7A 1HNZB 3PPVA 1I1OA 1ZM2A 3WX5A 2OPKA 5C4GB 1N36B 4HWSA 2Z95A 5HCIA 4KPUB 3KV1A 1DG3A 3H0KA 1N0HA 2CNNA 1CX9B 4Z07A 2IYYA 1KAQA 1VXOA 5J3JA 4MADA 4JBIA 2W8BB 4G4GA 1FNSA 3IIIA 1VBC3 3BB3A 4ZGBA 2GPNA 4EYOA 1Y9MA 1XZGA 1TRHA 3CX4A 4EB8A 2RDQA 1OBVA 4C0JA 3A05A 1GNZA 1BG6A 1M2JA 1WLCA 1ZBE3 2BH9A 1M74A 5ILOA 2XOEA 3D0RA 4Q48A 3TBHA 5BVHA 5CIRA 2O1WA 3R9XB 3FKQA 4GMXA 2WJJA 2Q3EA 1IWBB 3WKCA 3WWZA 3K4ZA 4U0JA 1NA1C 4Q4X2 4IFBA 1A9PA 4HDRA 2AG0A 3OPNA 4E03A 3GHNA 4M46A 2XMQA 4HVOA 2BQPA 4WN9B 3V2GA 2QUKA 1E9EA 2O0JA 2YNMC 1C8M3 3FIJA 3ZHBA 2DC1A 1H8HA 4FYJA 1PV4A 1P9OA 1JV2B 1US8B 2VT3A 2UUAB 1WUVA 1GU7A 2D1TA 1MZ6A 3MWKA 3PFGA 4KTTE 1PU2A 1W39A 3S0JA 4EUNA 2ZIWB 2I87A 3KV6A 5LZ4A 5A4DA 4JJEA 3AP4A 2JCYA 3AXTA 6NULA 4DM3A 1HZJA 1TU3A 1EVJA 2FJPA 3H6KA 3PMEA 1Q1BA 3OZXA 4XR4A 2H18A 4LFCB 1EB8A 1W0KA 4RD1A 3WCSA 2MR6A 4JEMA 3GLSA 4YP6A 2CWWA 4KXUA 4XJZA 4IOLA 1UZLA 2QTVB 1JKXA 5JBNA 3OKPA 3I9FA 1BDHA 2JRLA 3A4TA 3GG2A 3KEOA 1NUAA 3VOSA 4JGGA 2XOXA 5AKXA 2Q41A 4QXAA 1GZ5A 1TZKA 4LO6B 5KOHA 4J25A 2A9OA 1FX1A 3ZVLA 4ND5A 1XPJA 5FPVA 1RUE2 1DIBA 1HX7A 2AD5A