3IIIA

1.95 angstrom crystal structure of coce/nond family hydrolase (sacol2612) from staphylococcus aureus
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
558
structure length
556
Chain Sequence
QHLLGNPKLTVTHVNEVKAGINHIVVDSVQYGNQEMIMEKDGTVEMRDGEKLYINIFRPNKDGKFPVVMSADTYGKDNKPKNMGALWPTLGTIPTSSFTPEESPDPGFWVPNDYVVVKVALRGSDKSKGVLSPWSKREAEDYYEVIEWAANQSWSNGNIGTNGVSYLAVTQWWVASLNPPHLKAMIPWEGLNDMYREVAFHGGIPDTGFYRFWTQGIFARWTDNPNIEDLIQAQQEHPLFDDFWKQRQVPLSQIKTPLLTCASWSTQGLHNRGSFEGFKQAASEEKWLYVHGRKEWESYYARENLERQKSFFDFYLKEENNDWKDTPHVIYEVRDQFYKGEFKSASAFPLPNAEYTPLYLNAENHTLNHAKISSAHVAQYDSEDKQQDVSFKYTFDKDTELVGNMNLKLWVSTKDSDDMDLFAGIKKLDRRGNEVNFPDFNHIENGQVATGWLRVSHRELDQEKSSIAQPWHKHETELKLSQDEIVPVEIELLPSGTLFKQGETLEVVVKGSEIVIGNSTPGMKTRYEHEETVNKGMHMIYTGGKYDSQLIIPIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords CocE/NonD family hydrolase
publication title 1.95 Angstrom Crystal Structure of CocE/NonD family hydrolase (SACOL2612) from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus col
total genus 189
structure length 556
sequence length 558
ec nomenclature
pdb deposition date 2009-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02129 Peptidase_S15 X-Pro dipeptidyl-peptidase (S15 family)
A PF08530 PepX_C X-Pro dipeptidyl-peptidase C-terminal non-catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3020.20 Mainly Alpha Orthogonal Bundle alpha-amino acid ester hydrolase ( Helical cap domain) alpha-amino acid ester hydrolase ( Helical cap domain) 3iiiA02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3iiiA03
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iiiA01
5K3BA 4P08A 3C6XA 3I3BA 1EUUA 4QDTA 4E14A 1LPOA 2OGZA 5AKZA 3STWA 2E3JA 2WIJA 1T4MA 5ALQA 3FCXA 4UBLA 2WIKA 1FJ2A 2R8BA 3PDCA 2WO2A 5AKIA 1XZKA 3H04A 3A23A 2W3JA 4P00B 1WCQA 5LKAA 3FWHA 3MGAA 4LHEA 3KDAA 4LXGA 2ZYSA 1XZLA 4HXEB 3D4LA 4DGQA 5HF8A 3ABZA 2QZPA 3MUOA 3E0XA 4X97A 3CQOA 2X8BA 2ZXQA 1W6RA 2DDUA 1JJIA 1QIJA 3T0AA 2HADA 2Y6KA 4UUQA 1R9NA 3VVMA 4KE7A 4Q05A 3FLBA 1JMYA 4QE3A 4RGYA 1JU3A 4UBMA 2W95A 4OMCA 4NVRA 5LZ9A 2EIDA 1BE0A 3TGLA 2HA0A 2QVBA 4A16A 1O8SA 3ESBA 3K9BA 2W5FA 2VCBA 2B9VA 2HL6A 2ZSIA 4DMKA 4CU8A 1PMJX 2O7RA 3R40A 4W63A 4M4PA 2ACEA 3I2GA 4RE5A 3R3ZA 1X70A 4DUWA 1YR2A 1EUTA 4DUVA 2VAXA 5ALPA 3PE6A 3DYIA 3V48A 5AM5A 4F21A 4ZXEA 1VKHA 1IQDC 5FXMA 1CUCA 4MWTA 4A5SA 3LE0A 1CQZA 4WFKA 3EBLA 3WWOA 4DNFA 4ARAA 4OU5A 2QQMA 3FBWA 2Y6LA 4GWIA 4B9EA 5CT6A 1IVYA 4A41A 1GKLA 4QDOA 5IFTA 3R3UA 1LLFA 3ED1A 2JGFA 3WK4A 3FSGA 1FFAA 1JHJA 4EY8A 1XLUA 1JZ3A 2WKWA 4CG1A 1F8UA 3EQ9A 1DQYA 3K4DA 4BE9A 1QIDA 1TRHA 4BAGA 4L3WA 3SC2A 2QJRA 1YA4A 4LYEA 1JT2A 1Q84A 3UUEA 4QZVA 4GW3A 1BN6A 2XUQA 1L7QA 2CDOA 4OSEA 5AM3A 1H2WA 3I28A 5K3FB 1XZDA 1SC9A 2AJCA 3KOOA 2QBXA 1YCDA 3DECA 3GBSA 4B7ZA 1E66A 2WTMA 2VM9A 4QNNA 2V96A 3W5MA 5DYTA 2W1QA 3WIBA 4UAPA 4MQMA 4KE6A 5J1XA 2OKXA 5JR2A 3HLKA 1R50A 3STUA 3C8HA 2J1EA 4J7AA 1W4LA 4FWBA 3C6BA 3I6YA 2XUHA 1CUSA 4JX0A 4WY8A 4AB1A 1VE6A 5EIHA 1JYNA 1MX5A 2VTFA 4QDXA 1AZWA 3WA7A 1JZ7A 5FPQA 3DKKA 3G0GA 2RV9A 4U2GA 5EHZA 5JZ9A 5CT4A 3C8DA 4QX0A 4KAJA 1YQ2A 2HHAA 5AK5A 3ANSA 2YYSA 4AO6A 4ZZ5A 6YASA 1O6GA 5JXJA 1XQWA 1ORWA 3BF7A 4JHZA 1C7IA 3G0CA 3OEAA 4UFNA 4UHCA 2Y6JA 4Y2RA 2RJ2A 3D7RA 4UHFA 3X3HA 3V1NA 3FN9A 5AOAA 1XZBA 1CUAA 4H7IA 3WSOA 1TQHA 3L1HA 2JE8A 3WNKA 3OTQA 1UYXA 2QR5A 2EIBA 1HN1A 4QAWA 1PV1A 2J1VA 4X00A 4BYMA 3CIHA 2GBCA 2X76A 5LZ4A 5HF9A 5ALWA 2E26A 3I3EA 4NMWA 5DN2A 5IVIA 3ECQA 3D2BA 2PBLA 2HDWA 4HZGA 1XRMA 3E4DA 4QB1A 4DNOA 2GZSA 4PW0A 5D6OA 4OYLA 3AUKA 4IH4A 5T4FA 5HK9A 5ALEA 2XDWA 2BJHA 5A6VA 5H3HA 1W52X 5DYYA 1E3QA 5F4ZA 3OC0A 3WZMA 4G4JA 4Y2SA 4DSZA 2Z5GA 5CYYA 1XZJA 2RAUA 3UNPA 4P93A 3R3VA 3ZWQA 4U2FA 1QIHA 5CW2A 5JYCA 4WY5A 5E4JA 2VO5A 1XFDA 5C8VA 2XMCA 4JYPA 2XUOA 2W22A 3LIPA 3WWCA 4B80A 1YB7A 4OYUA 3WK6A 1CUVA 1XKTA 5JARA 3P1IA 4UI9L 1U65A 1LBSA 4AN0A 5DMYA 5CH5A 2J4CA 3WQHA 4JEIA 1U4NA 5FOQA 3WF0A 3OOSA 1QTRA 1XRRA 2W9XA 1N5MA 1LPSA 2JDAA 3DKRA 1UOPA 4WDQA 1XRNA 3A6ZA 3RLIA 2WFZA 2PU5A 1JZ2A 2VJDA 1MT3A 3K75B 1P0MA 2CUTA 1YS1X 4OUKX 4E8DA 5CBKA 3QH4A 5JANA 3T4UA 2H9YA 4H0CA 2D5LA 1IUPA 1JZ6A 4WFIA 4J03A 1W8NA 2XMBA 1UXOA 2H1IA 3RARA 2VR4A 1ISPA 5K3CA 4KI5M 4GXNA 4CCWA 3VDAA 5D3KA 5LZ5A 1JJFA 1ZGCA 3WL7A 4MYDA 4E15A 3TEJA 3G02A 1UMHA 3NNGA 2JEZA 3LEIA 3ICWA 3OG9A 1GXSA 1WHTA 3C7EA 1BEEA 2VZTA 1R1DA 5JAPA 1XZEA 4B81A 3D3NA 1Y7HA 4X3CA 3FYUA 1TCAA 4C01A 3KWJA 4X6XA 1XZCA 1HPLA 3H1BA 3LLCA 1ULPA 5C7GA 1K3IA 2CBGA 4UBIA 3HNBM 2QT9A 4FFVA 5ALHA 4LXHA 3VD9A 2XQFA 4TVKA 2J1UA 3HRHA 3AINA 3F97A 1GQSA 2HFKA 1JZ4A 1UYYA 5AI6A 5BWCA 2K2QB 2XUJA 3QM1A 4U2EA 3MV11 2E33A 4YPJA 4B84A 2VMCA 1PX4A 5JAHA 4H7HA 1X2BA 2W46A 5FDFA 2B20A 3U0VA 5E2IA 3WL8A 3DL7A 3FNBA 1ODSA 4WFJA 4W1RA 1H23A 5CTAA 2WU3A 5F7UA 4F5ZA 1QZ3A 1TKRA 2OG1A 2H7CA 2XQJA 1ORVA 1QIMA 3IB3A 5G05L 3VVLA 4ZGBA 1GPKA 5JZSA 1CV2A 4LYDA 5T4HA 3WWDA 2ID4A 5DLPA 3T0BA 1SHWB 4DEQA 4O08A 4Y2PA 4JYMA 3WF1A 1FFBA 3N0TA 3O0DA 4GZ9A 3ACHA 1HL7A 4N5HX 3OURA 4X6YA 2V98A 2VMDA 2G5PA 5CT5A 1OILA 1A8QA 3WMRA 2VTVA 1LZLA 3A22A 5LA1A 1UXXX 4XUPA 3LCRA 4DMHA 3PICA 5LCWL 5KWIA 5B4XA 5FP0A 4A6OA 1UKCA 1A88A 2VZRA 1DT3A 4HAIA 1CPYA 5DNUA 1EI9A 3WKDA 1T2NA 4DLNA 2WAOA 3KD2A 1EVQA 5C81A 1GU3A 2Z4FA 1DP0A 3YASA 4WCVA 4BVJA 3J7HA 4HRYA 5IHRA 1OT5A 5HQ3B 1Y7IA 4DUXA 1L7AA 4MADA 2FJ0A 3WNNA 1QIFA 4KJXA 2XUIA 3DNMA 1CZVA 1E8DA 1VZ3A 2CMFA 3VXKA 1IZ7A 2HU7A 4MWSA 3IAQA 3STTA 2PSDA 3LEKA 2OGTA 4XWGA 1XPWA 4IQ4A 3H2IA 3T2PA 4RNCA 2XUDA 1C7JA 1GOHA 1EB9A 5JD6A 1P0PA 2VT6A 5D7BA 2PPLA 4J0JA 5HQ3A 4A44A 4MYSA 2AJDA 3S8YA 1W0NA 1H2YA 4MEBA 2ORYA 2HIHA 5I8PA 3AIKA 3BXPA 2EEPA 3DS8A 2LIPA 5IVDA 5KBYA 2HM7A 4UHEA 2QUBA 4XIIA 1XQYA 1IUOA 2GYVA 1ACLA 5AKKA 4P92A 3VD3A 3AZQA 2OCKA 2WHQA 3OM8A 1H6XA 2I03A 3B3QA 4AO7A 4FLMA 2C58A 4AXBA 1AURA 3FOBA 4OB7A 1N8SA 1BCSA 3HNYM 4XJVA 5CURA 3WJ1A 5A7GA 3RKSA 1ZJ4A 4QA9A 2V9ZA 4G4IA 4TPKA 4DMFA 1SCKA 1KEXA 3LPGA 5CXUA 4BE4A 2WM2A 5AKXA 2EICA 5AK3A 3EQ7A 1W8OA 1R88A 4J0HA 3CN9A 2BUCA 4N5IX 5HF5A 1DWOA 2UZ0A 4ZWNA 3GM8A 5LA0A 2BUAA 4JKKA 2CDPA 2OLEA 4EY6A 3Q8WA 1EDDA 5ALLA 4QDRA 4FOLA 2AJLI 3HXKA 1LBTA 2PKYX 3H2JA 4W4ZA 4AAXA 5AM0A 4BTVA 1ODCA 3AZOA 2J4FA 4B0OA 5AKEA 3W2TA 4BDTA 2J22A 4BVKA 3WK5A 5SYMA 4I3FA 2QRUA 4B83A 4BBZA 2WDBA 4XUOA 2QUAA 2QQOA 2BGNA 5AK4A 3NRUA 4BCCA 4HVTA 1W9WA 1CR6A 1E5TA 2WIFA 1CUGA 4Y2TA 2WO3A 4UFPA 2PSJA 4OMDA 1NX9A 2V72A 4J0DA 2Y6VA 2WG0A 2C0PA 2XMZA 4H7DA 5AIBA 1THTA 2QJWA 3HEAA 3LQCA 1XZGA 3UMJA 4EBBA 1TG7A 1H2XA 3CCBA 3ACGA 2X10A 3FL7A 3PI6A 2JBWA 5G04L 5KREA 2WZ8A 2OQIA 1K12A 3G8YA 5EFZA 1BRTA 4W9RA 2PQSA 4GLBA 1UMIA 3WKAA 5A71A 3O9VA 4E8CA 2XT0A 3C43A 4FLEA 1G66A 1AQLA 5AJHA 3GELA 3I2FA 3STVA 4J0IA 4PV7A 1CVLA 2WILA 1UY3A 4XVCA 4KAAA 1JZ5A 1AUOA 1SCQA 4A42A 4GWLA 2O7VA 3QBJA 2ECFA 5ALNA 3M83A 5JZBA 3I97A 3BL8A 2XE4A 3DYVA 3BJMA 2J3QA 1K45A 5CXXA 4TXWA 3OPMA 3FLEA 5K3AA 3H2KA 1CUEA 2HRRA 4MEAA 3SKVA 5IVHA 1JYWA 3THCA 4ROTA 1CEXA 1DWQA 1BROA 3VD5A 1DLCA 3VISA 3W06A 1J84A 4Q3KA 2XB6A 4ZV7A 1YAHA 3RM3A 2WZEA 3C87A 1KEZA 1AMNA 5HCUA 5ALZA 5AI5A 4X94A 3HACA 2QS9A 5JAOA 2DQZA 4GHWA 3AIOA 4L72A 3DDUA 4E46A 4MO3M 2OAGA 5HKBA 4PQEA 3ZLTA 3EF3A 4FBLA 4QDZA 1FSSA 2WU4A 3I6ZA 2WG1A 3STXA 1CUDA 1DINA 3WKCA 4C87A 3P2MA 4N8EA 1CUFA 4P02B 4DXSA 2VZUA 1KU0A 5JXGA 3STYA 4J3JA 4BZWA 3U1TA 1WB4A 1QGED 5DWDA 2AJBA 2JGEA 4XURA 4A4AA 3TRDA 1P8JA 4XX1A 3G9XA 1EHYA 3M82A 3CZUA 2YXPX 4X93A 4G8BA 2WN2A 4BZZA 1CLEA 5AM1A 1Y37A 1ZI6A 4BDVB 4ET7A 2ZJ7A 4FLFA 3IUQA 3C6ZA 5BOVA 1TCCA 5CRIA 1QIIA 4Y9SA 3K6KA 2QXTA 5AKLA 2XI4A 5ALGA 1NUKA 4FI9A 4DMCA 5IFPA 3WJ2A 5FV4A 1VA5A 2HRQA 4QWWA 3BGAA 4GECA 3UUFA 5ISMA 5A1AA 5AM2A 1X2EA 3VJKA 3UESA 3K77A 3VDXA 4BRZA 2QQKA 1UWWA 3DYMA 4Y2JA 5CMLA 3O4JA 1US3A 4A45A 5AK6A 3WA6A 1XLWA 2O2IA 2Y1KA 3L1JA 5CT9A 3G9ZA 5EIEA 2X5XA 4DNPA 1XKLA 3F9CA 4I4CA 4FDMA 2RONA 2B61A 2H7YA 2VCCA 3HABA 2XUGA 2G63A 1CIJA 1MNQA 1OCEA 1MN6A 1NKGA 1UY0A 3BN6A 1QTIA 4CUAA 2IX9A 2BFNA 3ANTA 4Z49A 2QMQA 4YASA 3AZPA 3HSSA 3PF8A 2RIPA 4X6UA 4G4GA 3AILA 5FUMA 4CIAA 1CUBA 5AI4A 3I2IA 4Q34A 3T09A 3T08A 4W50A 1YS2X 1LPAB 4GDMA 4Y2YA 2VQUA 3WLAA 4EB0A 5SYNA 1M33A 3MVEA 3WK8A 4DSAA 1GZ7A 3W9BA 3AC0A 3PF9A 2PL5A 4IH9A 5FRDA 2E32A 3FHQA 4B85A 2W6CX 4ZI5A 4DYHA 2DQYA 3W04A 2XMRA 2VZQA 2C4HA 4YX9A 1TK3A 4BK5A 1JMKC 1EA5A 4X91A 4D8MA 3LS2A 3IUNA 3QYJA 5IJRA 3Q0TA 2JGIA 4AX4A 3H17A 3FCYA 5JD4A 4B82A 1R4ZA 1MJ5A 4BP9A 2VT7A 3CN7A 4AG4A 1MTZA 4UFOA 1JKMA 2XQXA 4KRXA 3A70A 4IHAA 3BE8A 2XONA 3G0BA 1TIBA 4G8CA 4ZRDA 3AJAA 4ZZ8A 1L7RA 1DYOA 5I0DA 3EB7A 1K63A 4WDRA 1JZ8A 2V4VA 2VZOA 4H77A 1TCBA 3F2ZA 2HA7A 1ZD3A 4K6KA 1D7PM 2WQZA 1PFQA 1G4HA 1ZD5A 2P8SA 1DWPA 2J1AA 2DCMA 1USWA 3HJUA 5AICA 1FFDA 3FYUB 1AKNA 4LXIA 4DTCA 1OF3A 3JXSA 7YASA 2OGSA 2JD9A 4MJ3A 4DNQA 1UK7A 3OB8A 1FFCA 3ZV7A 1EVEA 4IH1A 4C89A 3C8XA 3SEPA 5DYWA 1ZD4A 1E8NA 1QIEA 4L0PA 2WUGA 2YG0A 3OEBA 1B6GA 3KWFA 4PO3X 1SOMA 4BJ0A 4QPWA 4AMZA 3WKEA 1W75A 1OD3A 1D07A 5A7HA 4DEVA 4PF1A 2XQGA 3V1MA 3ESDA 2XLCA 4LQRA 3G0DA 1WCYA 3C7FA 4JKMA 3V9AA 1HQDA 5E4YA 4X7BA 3BJRA 5HKAA 2ZYHA 5AKHA 4OPMA 2YC2A 3H2GA 1UOQA 3VD4A 1VLQA 3BDVA 2QKYA 1VJ5A 3AIMA 4Y2UA 1CUXA 3JW8A 3ESAA 3QZUA 5EGNA 3WL6A 4HRXA 1ZGBA 2J3DA 3C7OA 1UKAA 3FSGD 3EQ8A 3NOXA 4LPLA 2WIDA 3NUZA 3WNLA 4EY4A 1ZJ5A 1J2EA 3IVMA 4HG6B 3T0DA 3GGLA 1N1MA 2FUKA 2V97A 5AI0A 3D3AA 4BCDA 1CIYA 1XNTA 5JXHA 5LYYA 5C8ZA 1VZ2A 4CFSA 1G5FA 1JI3A 1VXOA 3ZLUA 1R3DA 5A7FA 4OD0A 1UZAA 4IO0A 1J1IA 3MUNA 5EJZB 5CZKA 4ARBA 2HA2A 4G9EA 4QWMA 4ETWA 4DM7A 4FNMA 4FFWA 1UK9A 2IITA 2Y8KA 4Q3OA 1XRQA 1K4YA 3NQHA 2C5GA 2WO1A 3G9UA 1VXRA 5JADA 1AGYA 4JH0A 3IAPA 1F6WA 2ES4A 3IUMA 3WNOA 4ZREA 2ONCA 2ZJ6A 4YK7A 3ZLVA 4EZIA 1TVGA 1C4XA 4HXFB 3W9UA 3GROA 3BF8A 5FUIA 2HA6A 2XUAA 1XQXA 4QLOA 1YASA 3VKFA 2XMDA 3ILSA 1MU0A 2NW6A 1UK8A 5EHXA 3FLAA 2Z8ZA 5LIPA 3NJXA 1J07A 1WM1A 3FAKA 3U37A 1CUYA 2HLEA 2XUKA 2W92A 3WF2A 5HFAA 1EK2A 3HI4A 4U2DA 2VJBA 2FX5A 3SK0A 3WZLA 3I2JA 1UYZA 3T52A 4HTAA 3LEGA 2OCGA 2WLSA 5EI5A 4KMQA 2GZRA 3MUZ1 1EINA 5CH3A 4DXTA 1WPRA 4BC1A 3QPAA 5DNVA 3VJLA 2JIDA 4NZZA 3CXUA 1KGYA 1UFOA 2WG2A 4PT6A 1QLWA 2PSFA 5EHQA 3BIWA 3D0KA 1XZMA 1MPXA 1YAJA 5T4BA 4H7FA 5ALFA 1AC5A 4Q3LA 2AXEA 1SDDB 3WNMA 2WSLA 5FLKA 4X71A 3FVTA 2BKLA 4CI9A 2X09A 2QM0A 4D0QA 5EIYB 3FVRA 3LIIA 1W9TA 2Z3ZA 3C5WP 4ITVA 3KSRA 2R7EB 3I2HA 2HA3A 4C6HA 1WB6A 4QB6A 1YB6A 4C4XA 1WPXA 4OCZA 4UPDA 4QB2A 4KWUA 1H22A 3C7HA 2EDAA 2YC4A 5JIBA 5FPPA 3JYHA 3WYDA 4KEAA 1VA4A 4KE9A 1R64A 5HXMA 5AIAA 4UBKA 4UHHA 4AN1A 2W1SA 5LLSA 1GOFA 4Q82A 3DL4A 1KU6A 4FNGA 3HPNA 3NGMA 2W1WA 1GPNA 2RI6A 5ESRA 1NAEA 4IUGA 4M0FA 3IBTA 3MV01 4JKLA 5KWJA 1Q0ZA 1UY2A 3DOIA 4UHBA 3PUIA 4QDQA 5E4TA 2QTBA 2YFUA 1ZI9A 3R3YA 2J7MA 2VZSA 3S2ZA 4BK4A 1EK1A 1MX9A 1A8UA 1ZIYA 5DJ5A 4FMPA 1ODTC 3A2NA 2DR0A 3WKBA 5AKYA 3K46A 2J1RA 4CIBA 2E31A 1IMJA 3FYTA 2BGOA 2C4XA 5LP1A 3MBWA 1EXWA 4BTLA 1AX9A 3IA2A 2XMQA 1CUUA 2DSNA 5AHXA 2ORXA 3CCCA 1MAAA 2XUFA 2QOEA 3C7GA 4FTWA 3GDBA 4AMYA 3IDAA 2VA9A 3MO4A 2VMEA 4BXSV 2KD7A 4PSCA 5BWBA 3H2HA 1NU6A 1IZ8A 3K2IA 2XMSA 1A8SA 1GOGA 1MAHA 1QE3A 3IULA 4EA6A 4C88A 3QMVA 1NU8A 3GUUA 3W5NA 3WIOA 1UT6A 3CKHA 4C4ZA 1LPPA 1GGVA 4K6HA 4BATA 3ETPA 4U2CA 2PU7A 4BRSA 5AOBA 3C5VA 3DYPA 2G4LA 2VZ3A 3DQZA 2HU5A 2ZEXA 5ALOA 4M4RA 1LNSA 3H0CA 2J1SA 2B4KA 3SKJE 2RHWA 2Y6UA 4G9GA 5CT8A 4W1QA 1GNYA 4XUTA 1OXMA 4G5XA 3PFCA 2C0QA 1E8MA 1ZD2P 1WOMA 5JXIA 5LZ2A 1ZI8A 2I3DA 3BDIA 4J0KA 3WEZA 2AJ8A 5DPNA 4TGLA 4ARXA 2VQTA 3HEIA 5DQ0A 2BBAA 3HN3A 4OYYA 1Z68A 3RK4A 2QQIA 1Q83A 4CU7A 1XZIA 2HA4A 1EDBA 4G8DA 1JJBA 4N8DA 1XNAA 2OXEA 4TTGA 4MGSA 3EIOA 1XZFA 3PUHA 2OQVA 1ZIXA 4N8SA 3DOHA 3FYUC 4LHSA 4OUEA 2GBFA 2WYSA 4UBNA 3WWEA 2VAVA 5K5EA 2PM8A 3A7QA 4FHZA 5A62A 1GT6A 3ACIA 2BZDA 5ALTA 4AO8A 1F4HA 1W99A 3T2OA 1DT5A 1DX6A 4Y2XA 4RPCA 3BIXA 4GI1A 4MXDA 4EHBA 2O2HA 2LS6A 1XQVA 3C45A 2ZYIA 3E3AA 4RN5A 1GMMA 1O59A 4CCYB 1J06A 3HZOA 4UOJA 1XZHA 4XUNA 4H18A 4GBGA 4K6GA 1CUIA 1PJAA 2C5FA 1YSCA 5ALXA 2VSQA 4BDSA 3M3DA 2OCIA 3PFBA 2VATA 1BN7A 1CZSA 4BVLA 3M81A 2Y2VA 5JUVA 4B0PA 1QIKA 5AM4A 3OBAA 1W9SA 2VZVA 2FJPA 4QX2A 1BS9A 1JYVA 1ZOIA 1Q0RA 4AQDA 2OPHA 4P9NA 3N2ZB 2DCKA 3VDBA 5EIAA 1LPNA 2DHCA 4M0MA 2CKMA 1CUWA 2CB9A 4CCYA 3SX4A 4U2BA 2QQLA 2OCLA 1O6FA 4F0JA 2HYXA 2JGJA 3VJMA 4W8JA 4DIUA 2O2GA 1N5RA 2Y6GA 1US2A 2VJCA 3D2CA 4NS4A 2WN3A 1IUNA 2QQJA 5K3FA 3WWPA 4KYVA 2QQNA 4LIPD 2BGPA 2XQIA 4GEGA 1T2XA 4KR0A 1K8QA 3A21A 2WTNA 5HZGA 1W1IA 4INZA 2RVAA 3K4ZA 5JMOA 1UXZA 3B12A 5JALA 3HNMA 3OGVA 1VOTA 3CDZB 1ETHA 3DJYA 3SWWA 1QOZA 1QO9A 2VZPA 4CUCA 1UOOA 4K5QA 5D3ZA 2J1TA 5K3EA 1EDEA 2CEKA 4BAUA 5DTIA 1LPMA 1ZICA 5LZ8A 4E11A 4QX3A 1BCRA 3O4GA 4HXGA 3F98A 3GA7A 5FKJA 4BCBA 1WKYA 1JFRA 4CU6A 1U8EA 5ALSA 1F0PA 2I78A 5DNWA 5J3JA 3LPFA 5LKRA 2VZ1A 2JGMA 4LKOA 5HFNA 2Y2UA 1UY4A 1UX7A 2JGLA 1XRPA 3H19A 3ESCA 4HS9A 1YA8A 2HA5A 3OGSA 1DX4A 1MO2A 1JI6A 2GYWA 1UWCA 1SG3A 3V1LA 2ZEYA 3L1IA 1P0QA 2WUFA 5A2GA 4M0EA 2PUHA 4DXRA 4EY7A 4RYDA 1CZTA 1G42A 1F0NA 5ALMA 2VJXA 3B5EA 1RP1A 4K2AA 2JF0A 1DQZA 3CZJA 5AH0A 4C4YA 3D5EA 1OH4A 4BC0A 3R0VA 3HOBA 3W05A 1THGA 2HU8A 3G0IA 4PNZA 2XHNA 3BWXA 3E1GA 2XQKA 2ZYRA 4ZXFA 4YPVA 2RHTA 4QDSA 5YASA 4UBOA 1VE7A 2PSEA 1HLGA 4WJLA 1RYYA 3OG2A 5HK8A 2W94A 3I2KA 4QDUA 3HJRA 2IIVA 1WB5A 3IURA 3I1IA 3H18A 2RGUA 5ALDA 1CUJA 5K3DA 3TJMA 3LP5A 1QFSA 3DLTA 2DCJA 1QJ4A 2YASA 4G1FA 3WK9A 3FHAA 2Z8XA 2WUHA 1LZKA 1EB8A 1OF4A 4OB8A 1W76A 5ALRA 5C71A 1TAHA 5AKGA 3OGRA 2R11A 1E89A 3VDCA 2PVSA 2XMGA 2PX6A 5ALUA 4CG2A 2VCAA 2DHEA 1UY1A 2GBIA 2PSHA 4S0XA 5T4EA 3WK7A 2C26A 2WIGA 5AOCA 1DU4A 2XLBA 4ZY9A 3GXUA 2PUJA 1QFMA 4F60A 5C8XA 4XVHA 1XROA 3G9TA 3QPCA 4QX1A 3GFFA 2W1UA 2VQ6A 1JYXA 4X95A 2WJ4A 4CG3A 3F96A 4UBJA 4Y2QA 2WAAA 2WJ6A 2G5TA 1EH5A 5IKXA 1I5PA 3O9MA 2WJ3A 5JATA 3ACFA 1XLVA 4L9AA 3UETA 3DEAA 1J83A 4X90A 5IYYA 3AFIA 3IUJA 2ZEZA 1CFJA 2L9LA 3I1YA 2JGKA 4AZ0A 4Y7DA 4I19A 3R3WA 4MQLA 5AP9A 4PQQA 4B6GA 4CVUA 3I6MA 4H7EA 2YB7A 3KXPA 4CUBA 1GUIA 1U2EA 2ZEWA 3CMGA 2I3ZA 1K42A 1BEZA 3A2MA 5ALYA 2W87A 1GQPA 2BAGA 3V1KA 2BERA 3D2AA 1WHSA 2VL4A 5EJ1B 5CH8A 5ALVA 2WFMA 2X05A 4OU4A 1H2ZA 3O4HA 2GYUA 4QEKA 4ARYA 1XRLA 5AI8A 1JU4A 1LPBB 3HYSA 3T2QA 4XUQA 1CX1A 5JD5A 2WFLB 5B4NA 4A23A 2HFJA 3WNPA 1GQRA 3IIIA 2EIEA 1BU8A 3DYOA 2VOTA 2ACKA 5HPOA 2Z3WA 2Q0XA 3QITA 3WQBA 3C70A 4PSDA 1QONA 2D0DA 5DTJA 1MNAA 2EDCA 4GWJA 2V5DA 4LKSA 2C9KA 4EUSA 3C6YA 2WABA 3K4AA 1MX1A 4MOAA 3QMMA 4AZ3A 4BP8A 4FBMA 3ZM8A 4KRYA 2WFLA 1H6YA 2CZQA 1UK6A 3P6BA 3GZJA 3R3XA 1R9MA 2VC9A 2VEOA 3WL5A 2ZSHA 3R41A 2BUBA 2BGRA 1O8PA 3H1AA 2Y64A 2DFPA 3QPDA 1K6EA 1HDEA 2BCEA 5IVKA 5BV7A 4W1SA 3I3DA 2ZJFA 3MUY1 1CUHA 4FKBA 5ALIA 1F4AA 3WF3A 3JWEA 4H7JA 3QVMA 4D9JA 4EY5A 3QMWA 2CJPA 3ZI7A 2VF2A 2DHDA 5ALKA 1UKBA 2WQ8A 1B41A 4BB0A 2H7XA 4JUIA 1CUZA 3EYPA 2WUEA 3NJVA 1P0IA 2C7BA 4ZV9A 4MGQA 1GPLA 2XOMA 4W1PA 1XZAA 3O95A 3NWOA 4RE6A 4J0CA 4L0CA 4KAFA 5LA2A 1I6WA 4CU9A 3SEEA 5C70A 4V2IA 1SFRA 4X85A 2W91A 3VD7A 3D59A 3WF4A 5AKJA 3DCNA 5LZ7A 5AO9A 2YFZA 5I9IA 4Y2VA 1QO7A 1XC6A 4KE8A 1PMHX 1QIGA 5I7UA 4XZUG 3THDA 4J0GA 1ULOA 5AI9A 1A7UA 2VJAA 4H35A 2W47A 5JASA 2JKXA 3G7NA 5HF6A 1BHGA 3A2LA 4P5YA 1FFEA 5C7YA 2ROQA 4JNCA 1PX3A 2Y6HA 5EHNA 5ALJA 4QLAA 2WHPB 4H7KA 4BAZA 3F67A 3F8SA 4OB6A 1DTEA 3ZPXA 2GBGA 1S8OA 1SCIA 1CQWA 3WI7A 2QXUA 4B9AA 3WYNA 5IH7A 4PSUA 5JAUA 1UZ0A 3HC7A 2WHRA 1HKHA 4UHDA 1RWQA 2LW8A 4A3ZA 3ICVA 2OAEA 1LGYA 2ZVDA 2YH2A 4X92A 1CRLA 4Z2AA 2XUPA 1HBJA 1GKKA 4OZOA 2JEYA 2VMFA 2WHPA 4KACA 1K5PA 2WUDA 2WBKA 1ACJA 3DD5A 1EX9A 2ORZA 3O4IA 3E1F1 4Q1VA
chains in the Genus database with same CATH superfamily
4I81A 1QWSA 1WOYA 2YV1A 3JAKA 2GMMA 5DBGA 1ZMXA 2R8BA 4YREA 3MRTA 3I0MA 4Z6KA 4MDFA 2B45X 1WCSA 4LHEA 1RBQA 3U19A 3NNLA 4I1VA 4NBLA 3E05A 3WXBA 3JWPA 3W2GA 2WWJA 1R9NA 2VAWA 3PGLA 2IIBA 4FYWA 3PEYA 1UDBA 3WWZA 3G8CA 5K0NA 5FEUA 3Q15C 2MEV2 2QVBA 5B6JA 1PQYA 2ZE8A 3JZFA 2G9RA 3OJXA 3R7DA 4EPWA 5KSZA 3RIEA 5DRTA 4P14A 3R40A 4W63A 4MGZE 4RMNA 4DUVA 1EX6A 4XB1A 1PGOA 3RZHA 4M1EA 3HKBB 2B5VA 4N01A 2Q7DA 3RCBA 1CUCA 1WDKA 1WCV1 2JVIA 4KN9S 2Q27A 3HU5A 4JMPA 2GNPA 3UICA 2QX6A 3RW9A 1JMUB 3ED1A 3REFA 1X7GA 4BNDB 1I1OA 3P9ZA 3V5NA 2QX4A 3WFJA 3DDCA 1UEJA 4QPYA 3K4DA 4DCJA 3OEYA 1FFWA 5L3SB 3HP4A 4BAGA 4WTOA 4LYEA 3LAGA 1E3WB 2Y1FA 3C48A 2XUQA 4R9NA 1CAWB 1XZDA 1P60A 2NZXA 1QXSA 4CCNA 1NRWA 4A2PA 4L51A 4RTJA 3BK1A 1M75A 2PQMA 1FP4B 2W1QA 1MOPA 3BTZA 4O02B 5FY4A 4AP6A 5J1XA 1P4AA 2A9QA 4YALA 2GNBA 5JVVA 4QYSA 4JLSA 1WW5A 1QR2A 1IIRA 4X1IB 1VRH2 1PKEA 3JQFA 3RYRA 2XVAA 1HT2E 3R4DB 1Z6TA 4DLWA 3ZBTA 3ZN5A 5M04A 3OEAA 4EI7A 2WVAA 5AWFC 3ZCTA 3X3HA 2QNIA 2C7GA 1ZWKA 2P78A 4JODA 1TQHA 2WWWA 2PMCA 1PKXA 2ZBEA 4CM7A 5L9BA 2CWMA 3JZVA 1IXSB 4D4HA 1JWAB 4ZS2A 4NC9A 5TQ0B 1IATA 1DC4A 1OJLA 4ODIA 3AJDA 1P9LA 1LLCA 3Q9NA 2GK4A 3P2IA 1BJQA 5F5NA 2WD8A 1VG8A 3HN2A 3WLMA 1RWKA 3WBFA 1AHPA 1N36B 3ZG6A 1E79D 5A6VA 4V0KA 2VPYA 5H3HA 5F4ZA 1XDBA 3EVZA 4AZTA 4P93A 3R3VA 5KQGA 5IDVA 1QIHA 3AP5A 3OOXA 3FX3A 2QTFA 1JODA 2WSMA 4J1TC 4XEZA 2W22A 1LQTA 4G0VA 1G4AE 1SK8A 4OGLA 5MN4A 4Q15A 2BHRA 5TVGA 1U4NA 1YZTA 1YR6A 3HUFA 2X4LA 5HRUA 4QM7A 1YI8A 2VUTA 4Q4HA 1OAKA 3RJRA 4B3DA 3K75B 3AU9A 4UFLA 4EVSA 2G1PA 2RHMA 2EALA 5FTMA 1R0LA 2IVZA 2OO3A 4MQEA 1GUDA 4CM4A 4L07A 4QU9A 4PAMA 3MMXA 2IGBA 1Y1KE 5D3KA 1E2NA 5GM1A 2C7VA 3LEIA 5F2NA 1G291 2BDRA 2YW9A 4N3AA 3OTFA 3GZNB 2HPHA 1Q16A 3CGGA 4NYMQ 1XZEA 1VL8A 1ZHHA 2CBGA 2QIPA 3F97A 5GONB 2JIMA 4BNZA 4RZXA 5C4GB 1CAXA 1D4ZA 4YJKA 4ZGWA 2Z1NA 4FDVA 4F4JA 5FZKA 2PQ0A 4KVAA 4FEYA 4LHNA 5IT5A 4IF4A 3AL2A 3EFBA 4AJOA 1FEZA 4AI3A 4M53A 5JZSA 5LA6B 4BMVA 3HO1A 5A2QA 3JQAB 2JHAA 2G88A 3U60B 5K1ZA 3TGWA 3VBFC 1MFZA 3KQWA 4J6GA 1QH1B 4D3SA 4H27A 2FDFA 3DV0B 3EHEA 3H4TA 2ES3A 5CB0A 3V8EA 5A3OA 3A22A 1EM8A 3EVDA 1C5HA 3S2FA 4OHRA 4IMPA 5JCTA 4KPUA 3TQOA 4C0HA 3GLHB 3VR5D 1GLHA 2AR6A 5D00A 1EVQA 3EW7A 1DP0A 2H07A 2QZ2A 5JI2E 5HQ3B 1L3CA 3W5AA 1L7AA 3WNNA 1JIXA 1XK6A 3G1WA 4BNKA 4KJXA 2XUIA 3QACA 3T1QA 4BLOA 3STTA 4P9JA 1OIXA 1YK1A 4HHEA 3SEQA 2C94A 1SZCA 3V8MA 1C7JA 1GOHA 1O95A 3SHWA 2ZAYA 4Q4X2 4MYSA 2JI7A 1NXXA 1VYTA 2ORYA 4JQCA 5I8ZA 3ZHZA 2OK7A 4CYDA 4ONUA 1NSFA 1JEQA 4YUAA 9ABPA 4OMUA 3VD3A 3OD1A 4YC7A 2I3GA 2DT8A 1PHMA 2WHQA 4DUPA 2PX5A 1IN8A 1O8CA 4GC5A 4CT5A 3SH3A 1MO6A 1VG1A 3ZMNA 3MBIA 1BCSA 1UIKA 4QA9A 3LLMA 2V9ZA 1RQGA 4LV8B 5FY5A 4J0HA 3Q3VA 4MI3A 5SV2A 1TO1E 1RE1A 2QVXX 1CJCA 2PS9A 3TLGA 1E0DA 1K5MC 1OHHD 4XIGS 3GJYA 3FLRA 4B2IA 1HFWA 1U7HA 1GPUA 3FPAA 5AM0A 5AW0A 4FVVA 1L5WA 2IUUA 3OZGA 3QQPA 1G9BA 1W1WA 4HK4A 2QUOA 5IT6A 4H4DA 2WDBA 4X62B 4DQDA 5EP3A 1CR6A 3HO6A 3UG6A 1CUGA 3Q5EA 3ZVXA 5CK5A 3LW8A 1USKA 1VLZA 1DZIA 2IE8A 4BMOB 3HB4X 5EZ5A 4YN3A 5AIBA 5GVRA 4DRVA 2PKQP 3UMJA 1FRQA 2WA1A 5K0UC 3AT1A 4X6QB 3W4IA 2QLTA 3O83A 1YMVA 4O4HA 4GSLA 1K12A 4OFWA 3LP8A 4GUDA 4KUHA 2PQSA 1TMF1 4YZ3A 2FTKE 2O0HA 5DFAA 2GCGA 3VBSC 2QTZA 2BEUB 2J45A 4ZKDA 3HXPA 1MV5A 3GELA 5BQPA 4D0NA 4IEVA 2X7JA 2ZAAA 2AMJA 4HWTA 3ZWVA 1QVWA 4Q3BA 4XD7D 5K2OA 1QGUA 4UOQA 3KLSA 3UAYA 1C80A 2DX7A 1G16A 2R042 3KVVA 2FAXA 3MI8A 4EMSA 5HJ2A 1YJQA 4V0QA 3CUEF 4CVNA 3QKUA 1RYHA 4FR2A 2OVBA 1W36B 2ZS7A 4KGDA 1GPH1 1UJ6A 2IV3A 5KTOA 4WQMA 5HCUA 1V1RB 5ALZA 3UMBA 3AHGA 1JXQA 2ONYA 4I55A 3C3KA 2CUKA 3LPDA 3DDUA 4PHCA 4WXHA 1RJ7A 4IHJB 2YW2A 2GAOA 3BJIC 1E62A 4BHTA 3OPVA 2C8VA 4YAWA 2NSYA 2P2ZA 4OHBA 3TRDA 5AVUA 4CLOA 2XNKA 1T4CA 4QNMA 2WN2A 1SRQA 2E5FA 4AEMA 4AVTA 1S5PA 2QXTA 1DIGA 3MMSA 3BQNB 1BFDA 5F2SA 1Y5MA 3P4UA 3U4QA 3B20A 1W04A 4I1RA 4AMVA 5L3ZA 2L0XA 4ES8A 3JQ6A 1C9KA 3NI2A 3AXEA 2VMGA 3WB2A 4COZA 1LU2A 4WM8B 3L0CA 1XKLA 1WV0A 3I37X 5SICE 1QKKA 1FNBA 3SOZA 4ZQBA 1CF4A 1J0DA 1FRVA 2XE7A 2M6KA 2HK7A 1D4FA 5C51B 3SCGA 2HX1A 4P3KA 4OULA 1DE0A 1ZJJA 1CZHA 2ZRLA 4CFYA 1ATIA 1NV9A 3ZUGA 1JAHA 2FGJA 2BGJA 1XMJA 3D8BA 3W90A 3WLAA 3EXG1 3I58A 5FNZA 3OPYA 1I32A 1I5EA 4B85A 4GPTA 2XMPA 1JHMA 2W8ZA 2IBSA 3G2OA 4CKCA 3NKGA 2BN4A 2HPAA 1ZOPA 2VP3A 1TUBA 1MQ9A 2W6OA 2VUUA 1OVSA 2JH9A 1GAWA 2XYPA 1AQ6A 3EYWA 3A70A 1MZ6A 3WT3A 1W4CA 2ZIXA 1R083 4WH0A 1IUKA 3SYTA 5SY6A 4WDRA 2Q30A 4O0LA 5C8YB 2VZOA 2TEPA 3MPOA 3OZVA 5JCOC 5GJBA 4NCIA 5A6SB 3H1WA 3VZQA 2ZJ8A 3PHMA 4QQ8A 1YCFA 3ZDAA 2CNWA 4IGAA 2HHJA 2BVVA 2FXIA 3KWFA 4NTZA 3WIEA 1I7DA 5HS4A 2YOGA 4PBSA 1J9EA 1KFEB 4A6SA 4OQNA 1Y3DE 2W2OA 3PXDA 1HQDA 4X7BA 4B1FA 4IG4A 3LUAA 1GPWB 4R01A 5BUQA 1MC1A 2P67A 3JD71 4Y2UA 3ESAA 3OP1A 3U44B 1ENQA 1II9A 3I73A 5E95A 1T6NA 1H1LB 1TMKA 1UMCB 1YCGA 1JQKA 4BJ3A 3PEWA 3JWIA 1ZSYA 5HDQA 5DLDA 3UK7A 2VMHA 4NWIA 3EPJA 4KQ1A 4QAQA 3T1HB 2YVKA 2FR0A 5LJIA 1PO12 4TTAA 2PH3A 3ZHRA 3A6LA 2YV5A 2GN4A 5HNKA 3KM5A 3FZNA 4MUHA 2X9LA 4Q7JB 1UQTA 4DPMA 4JI3B 4JGYB 1DJPA 2W08A 1VXRA 1U0LA 1HIXA 3S55A 1A78A 1W6PB 4AG6A 2QLJA 5I3CA 4B7EA 3N5KA 1RUC3 2W98A 1ZVJA 4COYA 4G97A 5LFAA 1LLDA 3OETA 1HOTA 4QLOA 1H4QA 3VKFA 4FS3A 4EUHA 1KYTA 1UCXA 5IBPA 1E5SA 2XB4A 3T5BA 3ZCRA 1XJ0A 1Z7YA 4F5EA 1EK2A 2GO7A 2WE7A 3QI7A 2YICA 2D6OX 4KLRA 2VZ9A 2IBTA 4URXR 2QX8A 4QLBA 1PVC3 1NR5A 3S28A 4V0MA 5ERXA 4MGIR 1OY1A 1KGYA 4RCVA 5TARA 3OI7A 2QVSB 3G5UA 5T4BA 4DREA 4RVNA 4DJTA 3GCZA 2WSLA 1ZNPA 3EOZA 4G5OA 2Z3ZA 3C1AA 4QGHA 1KBQA 2NQ8A 1MG5A 2H6EA 5LBIA 4PXYA 4QB6A 2WM9B 3TKYA 4L6AA 4GD4A 4KBGA 4OCZA 4OSPA 2HV8A 5D85A 3LKDA 3IAS6 2O57A 1T25A 4Q4CA 4ZICA 1XMQB 5EN4A 3MINA 2AOTA 2DB3A 3PUZA 2PD3A 1LOBA 1GCOA 4HI0E 3E5QA 1JHVA 4KOAA 4Q82A 3GWGA 3AUFA 1XAGA 1KU6A 2QN8A 2HWB3 5JPMB 1MJFA 3CF6R 4ITRC 1QGDA 3GF6A 3HCPA 3I39X 3M3QA 1UBJS 1LDGA 2VNIA 5F3EA 4L99A 1EK6A 2GTPA 1KK0A 3UT5A 3B7MA 1W4BA 4QC2A 1HRKA 4FMPA 2TBVA 5FO1A 4FP3A 2QTTA 5C8CC 4KYIB 1L5RA 3TDNA 3ZNOA 3DO6A 1SH7A 1FTYA 4AMYA 1TM1E 3C5HA 1GP4A 2QTGA 2WSBA 5JFOA 3ERCA 4J1SA 5BWBA 2G80A 4LWQA 3M6XA 1YD7A 3RVDA 2OBYA 2J41A 3GUUA 1QY4A 2J9XB 2FWRA 4JK3A 1T6BX 1TXGA 2HQSA 3ROQA 3FDIA 2B4KA 4FC7A 3DEMA 4XUTA 4JITA 2P9CA 4CDXA 5KAMA 3R9WA 1ZD2P 1WOMA 3O3NB 2R79A 3GEIA 4TV8B 4IX1A 4A03A 4D57A 3AU8A 3ZLJA 4G86A 2IV7A 5DPNA 1WWYA 3NDRA 1F4PA 2RC6A 3AF2A 4F45A 1JJBA 4PY2A 3PE3A 1UBTS 4F11A 3W8RA 2PRKA 2VTXA 3BIEA 5KTNA 4WOPA 3NH6A 3FYUC 1UFKA 1QQP2 3WMEA 1P3DA 5LXTF 4O2AA 1NHWA 2X86A 3V46A 3N9QA 1OXXK 2XGJA 1F4HA 3QBVA 1PK6B 2I4RA 4MXDA 3GL9A 3USES 4KCGA 1UBNA 1R6BX 5IKOA 2NUPA 3ZTYA 5DX0A 4RN5A 3JQPA 2Y0DA 4UOJA 2P6CA 4OUMA 4URAA 4HOOA 2YMZA 3CH5A 3NMBA 1YSCA 3MWGA 1V4BA 4PGMA 3S1SA 1PE0A 5EFOA 1XEAA 1RWMA 3P9SA 3VYUB 1L4KA 3ETDA 2GALA 4QX2A 2I3AA 1Q0RA 4XDYA 1E6EA 3VDBA 4M0MA 1CUWA 5KNDA 1ATZA 4KSBA 2RDQA 4JKOA 3NBFA 1YI9A 4CF4A 3H5LA 1O95D 3MRXA 2ZB8A 3UVEA 2C96A 4J6FA 2FRXA 2F1OA 4MVJA 3TLCA 1IUNA 2QQJA 4RMGA 5JJKA 4QODA 1QKIA 3HXTA 4G2NA 1E6UA 5JQGB 2JLRA 2VXCA 5FPSA 2OPWA 4XSGA 5EJEA 2VG9A 3J8F3 3RU7A 4DOUA 1E32A 4LPSA 5IKMA 3PFKA 3LW7A 1HH4A 3BMCA 1JLHA 1LNQA 4O33A 1G18A 5D01A 3CIOA 4IEQA 3UK6A 3MWEA 2HWD3 16PKA 1U8EA 4DXDA 2D00A 3H8UA 2JGMA 2OGUA 3HVKA 4PU0A 4ZTBA 3EXEA 3GT3A 1FLNA 1YA8A 1CEEA 4AZSA 4N7MA 2GYWA 1UWCA 1J24A 1N5DA 3VUFA 2VJXA 1VBA2 3ZLBA 1RXGA 4K2AA 4XIOA 1J2TA 1DYKA 2JF0A 3H1PA 3O73A 3TF5A 3JYLA 1W85B 4RWEA 4Q8LA 2GWRA 5B3JA 2Z6AA 5GONF 4V39A 5E7MA 5B1IA 5FUNA 3DA8A 2IXDA 4KNYA 1XCMA 4QDUA 1JH5A 1KWGA 1A5ZA 1CUJA 1CU1A 1XTPA 1SHJA 2A7XA 1QFSA 3DLTA 5KOJB 3FHAA 5LA6F 5KMGB 2D0IA 1VJ0A 1CVNA 4HN2A 5ALRA 5J43A 1T2CA 3B82A 2E6VA 4LPKA 3AP6A 2P1ZA 1P2GA 1L5NA 4H3HB 3CRRA 1USGA 4L8GA 2Z6UA 5CFCC 2Q8QA 2JIQA 2EKDA 4BFLA 3OLQA 3L40A 4KL1A 4KKXB 5A33B 2VQ6A 3L1VA 1UU4A 3UJNA 4LJ8A 4Y2QA 3RASA 1H9CA 1NXVA 4YV2A 4AT1A 4LK6A 3EZ2A 5JC1A 2BGCA 2Z4RA 3NWKA 4KX3A 4QUDA 5FPYA 3I6MA 1RAFA 3TEWA 5J3UA 3C7AA 1W6NA 3VDRA 1W9HA 4MB6A 4YUXA 4JLPA 2I3ZA 1HDIA 1IK6A 1CS0A 2WWTA 3DM9B 5FPHA 3C3CA 4BOYA 3GMIA 4FCWA 1M72A 4XUQA 1U0TA 1C81A 2NUTA 4WXEA 3P2KA 1TZ2A 2DZDA 4LY0A 1BU8A 5J48A 1FP7A 1BX3A 1SVIA 1DKUA 3QITA 4LKSA 2NP7A 4JZRA 4MRMB 2TMGA 4IR7A 1GBGA 1FS4A 1RD4A 3IVRA 2WFLA 2XB6C 1SXQA 3PUXA 3OZRA 2KX7A 2Q45A 3DZKA 3H1AA 3RG0A 3CUTA 2I6TA 1KH2A 2ZIZA 4OH7A 1PTKA 4MZUA 3VAYA 1VYUA 4YXFA 4NBKA 1EP9A 5FAXA 2A0UA 2A0WA 4D0RA 1ZXBA 2XNSA 4D9JA 2YXBA 5ALKA 3UL2A 1YIPA 1ISMA 2FHSA 4MGQA 4OFGA 5JO0A 5I4IA 5A05A 4EN8B 4UXIA 3AZZA 4X8HA 2PYDA 1RDFA 3I30X 4LOTA 1CPMA 3AL3A 1MB3A 5EMNA 1DGWA 1K6MA 3RSCA 4TZTA 1DRJA 1T8YA 1ABEA 4LULA 4BO3A 5DF1A 4XGNA 5C7YA 3WB9A 3WQ7A 4K6FA 2G1AA 3O6VA 5K9YA 4XFGA 3H5AA 1H0HA 4EB8A 4DIKA 1AR63 1R081 1KOFA 2QXUA 1PF7E 4PSUA 4HT1T 3F8WA 4E2XA 1MHPA 2WHRA 5F2WA 1U9YA 1FMFA 4XMAA 3O4VA 1LGYA 2R1ZA 2VG8A 2JD2A 3CZ4A 1GKKA 2WZR3 1KSHA 1ULBA 2QZZA 2CNWD 2WT0A 2GNMA 1WQ3A 2WBKA 1EX9A 3GLQA 2WD7B 5K3BA 1P7WA 4KZKA 4E14A 3S44A 4KQKA 4KQFA 1GUZA 2VJOA 5IVVA 4X64B 4P7BA 5BSKA 4YLEA 2VCMA 2Z1MA 4HDRA 2QGNA 1WZEA 1QFZA 5HBGA 1LFAA 1E92A 3OUZA 3NNMA 4CP9B 2Q1WA 2L42A 4W6WA 3U62A 3DZFA 3SLIA 3FZGA 4OMCA 3I04A 2B1IA 2BNNA 1G1AA 1OBCA 1Y8RB 3ESBA 4BPBA 4O9EA 4URVR 1TAGA 1HJFA 1HFEL 4M38A 4Q29A 1GTZA 4JBXA 3U80A 4AQ7A 5F5AA 1N5IA 2NU9B 3CVJA 2AFIA 5IWFA 1DGWX 4G1VA 3RHSA 3WLUA 1EUTA 1BSVA 3NP7A 1ZSVA 2VYQA 3RWMB 4QQLA 2WJGA 3GNTA 3SJAA 1ZR4A 2AGSA 1YVDA 4WFKA 1L3IA 4GOND 4MMZB 3FBWA 5EXXA 4UXHA 4B9EA 5CT6A 1IVYA 1LV7A 2IYVA 3MT7A 3WK4A 2IP4A 3I2DA 5HS6A 2ZCUA 2VGDA 1NCQB 1W6QA 4LRYA 1WDLA 4QREA 2FCVA 4YJ3A 3NW4A 4JP5A 1YZGA 5HKLA 2M1ZA 3PPVA 1L7QA 2ZI3A 2BOVA 1H2WA 3I28A 1WLDA 1YUDA 1SIUA 3F4KA 4QHSA 4RH1A 2KLHA 4ID9A 3WBBA 1PVC1 1GFF2 1Y6JA 1PX2A 3R76A 3NLLA 3PNKA 1EFRA 4BJ5A 2QN3A 1O4YA 4ZOCA 1CYEA 3IV9A 3L4SO 2ZUUA 4QX0A 4GMP1 4KKVA 1W9FA 2YU2A 1Z38A 3UUWA 2JLXA 5DM4A 1ORWA 3UJCA 1EAYA 3G0CA 5K99A 3P97A 3HQUA 2XZPA 1EVIA 3ET4A 3WY6A 3LJKA 1PCXA 1MEOA 3L9JT 3WNKA 3E9CA 3MCZA 3HJCA 2BEOA 2WNUB 4P7JA 1CHNA 3IMGA 3H50A 1BMQA 2G09A 3WSWA 1X77A 3RABA 3D0OA 1UT8A 1L4HA 4RVGA 4JSYA 3D2BA 2PBLA 1YFYA 1PGNA 4BZPA 2W8BB 2GYYA 1A5SB 4QB1A 1SELA 5ULLA 4PX2A 2ZUDA 1D6NA 4ZYYA 2WJYA 1N5JA 3H87A 4W82A 5CYYA 1VPEA 2B4AA 3U40A 3GLFB 1FZQA 4PPFA 1SXJA 1W0JD 3QBEA 3JQGA 2CJWB 4KR2A 1C1FA 1QTQA 4IMJB 1ZITA 4B80A 3WK6A 4H9GA 2VDNB 2LNDA 4XDGA 1DBPA 4FOPA 1U65A 3BA1A 5JWPA 4IV1C 5FOQA 1XXNA 3QEOA 5A80A 2E9SA 1UXKA 4UKDA 5DVZA 3V8PA 1JZ2A 2V0NA 3CWQA 1R6AA 3IE0A 2EXIA 1KS5A 5EWLB 1ISPA 5K3CA 3FMOB 1R4MA 3BHMA 4PICA 4U8HA 3AR6A 1DRKA 1ZKMA 4MYDA 3LHIA 1KSFX 3GVXA 3IO3A 2VZTA 1WXIA 3NVAA 1PFYA 4YLYA 1ZW6A 3IIMA 4GXQA 1Y7HA 4C30A 2I87A 1TCAA 1JIQA 1ESCA 1CWPA 3E3MA 1VBNA 3TTWA 3K9LA 1F31A 5DHFA 4CGYA 2CU5A 2EXHA 5DHQA 2E33A 3URMA 4HMOA 4H7HA 4LJ4A 1BEUB 5G53C 5ECWA 1TJ3A 2VAPA 4W1RA 1YBAA 1Y3FE 1VI2A 3H1FA 2VJKA 1MAVA 2R4QA 2ZGLA 4RSMA 3T2TA 4AZ3B 4NLLA 3LUPA 4LYDA 1M2WA 3ZBPA 2ID4A 3JASA 5DLPA 1CJKC 2QAIA 3AJ9A 5KNDD 1RUE3 3F6EX 2GH2A 1POV0 5DBEX 2C2HA 1DZ3A 4XPZA 4CXXA 2HK8A 1VJ1A 4MVJD 4B73A 2ZAIA 4BFXA 1XE3A 4WL0A 2J31A 1C9JA 2IVJA 2L18A 2BLNA 4R1SA 1AL0G 2XAUA 4JBIA 1WPGA 2X1MA 1N3LA 2YWHA 3N7TA 4CV1A 3J8F1 4SBVA 1S1MA 2XA2A 2BFEB 1A27A 4B45A 3CU7A 3AEXA 1NVVR 4CDMA 4GX1A 4AZWA 4LA2A 4TWBA 4PZLA 2FJ0A 2CSXA 5KB3A 2E7ZA 1IQ0A 3H9AA 2D98A 4CU2A 3VKLA 2P40A 2HWD1 1V6NA 5EQDA 4KRFA 5TT1A 4CKWA 4HVAA 4IQ4A 2DBNA 3RS6A 5HBAA 5FLIA 2J3EA 4FMCF 2GRJA 4MH0R 3B78A 2RKWA 3DHEA 4QEDA 1RMTA 3BXPA 1H8TB 2EEPA 1NG9A 2A35A 2FCRA 5ANRB 3ZH9B 2QUBA 4NBUA 5ER9A 4P92A 5F3RA 3AZQA 3MTEA 4RLQA 1KWKA 2R1TB 2VTEA 1G0NA 5FBZA 4AXBA 3WYBA 3KEGA 1XELA 3K0BA 3KCXA 3SQNA 4CRWB 3IT3A 5FWEA 1SCKA 2G70A 4Y6RA 4TS9A 2QP9X 1CQIA 2DLCX 3W4KA 4WOKA 1LR5A 3WG2A 1B3BA 3V7NA 3W21A 2VDPB 1MQTA 1ZZ6A 2RBKA 1QWOA 2ZBUA 4LXQA 2FDRA 3CTMA 1J1UA 3WAJA 2O8FA 3PXAA 5ALLA 5EKSA 1E1RA 2OC4A 4AAXA 4RABA 1SKMA 2GM4A 3O93A 4YMUA 1KPHA 1FMLA 3K20A 3WK5A 3T1LA 2SKDA 5L7OB 4C04A 4JGZB 1E0SA 4HVTA 1E5TA 4OQDA 4HDOB 1K6JA 1Z5ZA 1KI1A 1NX9A 4DC9A 4C29A 3DGEC 1G8YA 4H7DA 1THTA 1SCSA 4C3UA 1XZGA 3URKA 2YRXA 1TG7A 2CL7X 3BULA 3HD8B 4YP7A 3QEMA 3RPEA 5GLWA 1MF7A 2R1VA 4GP7A 1DUSA 1TZMA 1GQQA 3BPZA 3ICQB 3N8DA 5BXYA 2RGRA 4FFLA 2JD1A 3EIQA 4BNXA 5A71A 3O9VA 4L2NA 2XT0A 3MCAA 3VHNA 1RYMA 3DVLA 4S05A 3N5CA 5IJ9B 1PL7A 1GPAA 3PENA 4RVHA 1NLZA 3K9NA 4GB33 4EABA 1WG8A 3ZS9A 4LMBA 5HGXA 2OHVA 3M83A 1HE1C 2H2DA 3LLUA 4BFYA 4KH1A 5JQGF 2FZ5A 3OPMA 4UBGA 3R75A 5FWNA 4Z4GA 4L2IA 3VZJA 2B42B 2OBBA 1M8JA 4Z8BA 4HAYA 3UA3A 4Q3KA 4JT4A 2BZSA 3UGHA 2O9JA 4Z7QB 5LN1A 3HACA 4D02A 5ITSA 5IK2A 3I62A 4BN5A 5DN6A 3BU7A 2PHWA 1UBUS 2Q2QA 1ZH2A 3LI2A 1YQ5A 2WU4A 3I6ZA 1R5OA 3JZMA 4I50A 1WB4A 1TCUA 5C2JB 4B3NA 1SCJA 2WUVA 4RPGA 1AYN3 1F15A 2FUG6 1L8XA 4LV5B 5IDXA 2A30A 3KR9A 2H5LA 2WF7A 1Z18A 3ZD9A 6REQB 4F4CA 2WNVC 4BB6A 2ZX4A 1DHKB 2BFBA 3JXEA 2HSWA 2NTVA 5BNWA 4BLJA 1W4ZA 3VJKA 1UZWA 4BRZA 3V00A 4TQ9A 1STMA 4JLMA 4G0YA 3SR3A 1XLWA 5TB5A 3RAPR 4YW3A 1LI7A 3MJHA 4LEJA 3PQ3A 1GRRA 1ZMBA 4FDMA 3NHPA 2R6JA 4TTJA 3B7GA 5A3PA 1MNQA 1N2EA 2WT9A 1AR61 5J59A 4EA9A 4IIXA 3PDUA 2P2DA 5JCPA 1U5AA 3LWCA 1R37A 1GKYA 1TYZA 3HWWA 4YASA 1Z7S1 2Q1XA 4Q6BA 2OMEA 2LRPA 2DCZA 1ZESA 4KWHA 2WZR1 3Q8CA 4DEXA 2PV0A 2IEZA 4AHYA 2HLPA 3A0KA 3AC0A 5IUKC 2E32A 4GFDA 4ZI5A 2AEFA 4MJ7A 2RK6A 4PZPA 3HDHA 3K09C 5HOQA 3W8FA 1EA5A 3LLSA 3LS2A 5IJRA 1EZ1A 4H16A 4Q1RA 4B82A 2HJRA 1C5IA 5F8PA 4YYEA 4NHMA 1T9AA 1U90A 1OAAA 4NRMA 4OVEA 4QJ4A 3UMYA 1AF4A 2BLLA 1Z8HA 3PQ2A 1ZK1A 2Y67A 4UXJA 3FYHA 1T9ZA 1JZ8A 1U2PA 3OOWA 3AONB 5BQXA 4PZEA 1U3UA 1PJQA 1Z0SA 3ZQ6A 5DO9A 2HA7A 1D7PM 2D97A 5DM0A 1EJ6A 1C41A 1VE0A 3VNAA 1EFVA 4DV6B 4ZARA 3DZJA 4JI5B 4G0OA 3AV0B 4UE6A 1IDOA 3MAJA 1SXIA 2OGSA 4K46A 3QLEA 1CERA 5DXFA 3ENRA 4EA7A 1EVEA 1NURA 2PWYA 1QIEA 5LBFA 1SOMA 4AMZA 1BH6A 3O1RA 3FCEA 4MVJM 4OXRA 2M6SA 2HUNA 3OQHA 1LDEA 2NVUB 3IV7A 4A9AA 5F77A 3PHCA 4JQZA 5C9AC 5LU9A 4MGYR 1Z5VA 4P4SB 4PQYA 5JNSA 5KX5B 3K5PA 2HF7A 2VQAA 1DB3A 4O2LA 4YIHA 4ALLA 5BUSA 5EKUA 4Y1XA 1EHCA 3V0BA 3PUYA 3ANLA 4HG6B 1J2RA 2FZGA 3H5IA 4M1QA 1N1MA 1IZ0A 1R0BA 3H5RA 1KVUA 3D3AA 4BCDA 2B34A 3V4LA 1A95A 4OZXA 1VC2A 3MMZA 2PGJA 4EN9B 3T5MA 3AKPA 3OFKA 4G9EA 1BKYA 3VNUA 1URPA 3QXSA 2BHTA 1Y4UA 2N42A 1YRYE 4AEDB 5T52A 3I9V6 2OV4A 1WUKS 1GDHA 1EFRD 2X6RA 3EEBA 3I8OA 4EZIA 1J39A 3KJQA 1RVF3 3U6KA 4H3SA 5BWLA 4RTQA 4DCGA 3CRW1 1PGW1 3D2LA 3UKJA 2HA6A 2WSYB 2VN8A 1HYQA 4DV7B 2XW6A 1O3RA 4BBAA 1MU0A 2HIGA 4YP1A 1J07A 2G1KA 4F2GA 3FTCA 3FOAA 3T9BA 4IEUA 1GL3A 2JD0A 5FZOB 2P9FA 4D81A 4BEJA 4U2DA 4NZPA 1MEC2 1W35A 4DQ0A 4NMHA 4RSUA 2EAAA 4IIUA 1V1MB 4MWBA 2QRLA 4XIKA 5EC8A 4CEYA 1DC8A 4BC1A 3EZFA 4ZHSA 1PNTA 1KPIA 4IUBS 2WG2A 5IWCA 4LUCA 1QLWA 1V6MA 3DBIA 2J3LA 2FYTA 1SIBE 2Q9AA 1T2FA 1CTQA 1CDZA 3B38A 4H7FA 2HMUA 1EV12 3VSDA 3ZN6A 3EXIA 1NPYA 3FSJX 3DFIA 2B7YA 1W9TA 2IJGX 3C5WP 4V24A 4BWFB 2VWHA 1SXJD 5FFNA 1JPUA 3VSAA 3KF3A 2WF9A 4UPDA 2J0SA 1E69A 5FZIA 1PUIA 4U6QA 4RD1A 4HLCA 5ICFA 3WYDA 2B37A 3GJ6A 2G1MA 1L5YA 4HX9A 4QU0A 3GRKA 3T8YA 7GPBA 2H3HA 2JLBA 4Y26A 4S1VA 4FFHA 4IUGA 3IR5A 4TTQA 3O3MB 4D4KA 5KWJA 3AUAA 3CBGA 3BCUA 4HZUB 4DMRA 4FYXA 3PXGA 2GQ0A 4MVJP 4N53C 4BEBA 4IDHA 5IAOA 4MSUA 4CM8A 3GGPA 2QE7A 2E31A 4U6SA 2CGEA 5FP8A 2CUNA 4E5UA 3L8MA 2H5JA 4HGYA 5CA6A 1ISGA 5CUQA 4XVUA 4G5FA 3T5TA 2WL1A 4RLFA 2EKQA 1JPVA 3UTDA 6ADHA 3RJZA 3OE5A 2PXJA 3LGRA 5KHIA 3O1MA 4QYTA 3HWJA 3GFBA 3LXUX 4HP8A 1ODIA 2NACA 2QZJA 4Y9DA 3WRYC 2ZEXA 3IC5A 2A9JA 2V7QD 1SM4A 1WMBA 4FMBB 4KYUA 2X1VA 1F8YA 2RSLA 1J1LA 5JXIA 3GH3A 4U7DA 4RFLA 4JP8A 3ZFEA 3C39A 2ARBA 2IHNA 5BOSA 4NIMA 4EO7A 3IP6A 4C2UA 4EX6A 1W49A 1KEPA 1P29A 3VR6H 3S5QA 3X1MA 1E4VA 4PFJA 2VQ0A 1Q3HA 2F8MA 5L51A 3DOHA 5GADl 5L4NA 1XF1A 3TSCA 1V39A 2VAVA 2WRZA 4FT2A 5FQOA 2ZXUA 1GT6A 3JX9A 3T3OA 1HEUA 4MV7A 5FOTA 1SBDA 4V1PA 3BIXA 1POQA 4RL4A 3VR5H 3AX4A 3R8FA 3M7IA 2CJFA 1GM5A 4F5YA 3GFTA 2C5FA 1M6YA 3DBOB 5DBFA 2ZBRA 5JMCA 1R0RE 4JWKA 4GH4C 4HR7A 4ENQA 4LF8B 1BS9A 3QEKA 4AQDA 2ZREA 1PO7A 3M3IA 3MUFA 3DR5A 4C7OB 3K1AB 1ZGAA 2QD3A 1US8B 3QELA 3LC7O 2VUHB 2WSSA 4B1LA 3V56A 3T0FA 1BAPA 2PUWA 4F4UA 3P0JA 2YR0A 3TZHA 1JXNA 4QD2A 2JFOA 4H6VA 4HMZA 4RM3A 2XODA 1LS1A 3ZU5A 3B51X 3MWYW 2DXIA 5U4XA 3P7MA 1M1YE 1NVEA 5TMPA 4XJUA 4B8YA 4K5QA 5D3ZA 2TNFA 3CR8A 4Q5OA 2AMYA 4HAZA 1Y5NA 2QY9A 1KKMA 4P4NA 3RGBA 1P2SA 4YIKA 2YNMC 1DOHA 1ZONA 1F0PA 1KY5A 3CEPB 4IE5A 1LK7A 3OKFA 1UX7A 4EFDA 4TYWA 4JCKA 4MLZA 1K7SN 2I9PA 2C5AA 3FFXA 1MO2A 5KJCA 3CW9A 2Q2VA 2QF7A 4OI1A 4ABTA 2WUFA 1J3QA 2QJFA 4N6OA 3PVOA 5AVQA 1G8GA 4CEHA 2AD1A 1NUHA 2WB4A 4MS1A 3IJEB 3R0QA 2WTUA 4NIGA 4FFIA 3D5EA 1N6LA 4LSGA 4EYOA 4XBNA 3R0VA 3IBYA 3KFLA 4GZMA 5JAQA 4NCAA 2XGSA 4AZZA 4BZXA 2PX2A 1OU4A 4GM4A 1GNRA 4JVAA 4NBSA 2OM2A 1E3MA 3OG2A 4XD2A 4A10A 3TJZA 4E2ZA 1IONA 2ZGMA 1P44A 1W2WB 3VYWA 3AETB 2YIMA 3TKLA 1VMDA 4TRRA 2CSGA 1Z6XA 3T6KA 4XWYA 2MEV3 1GP6A 4MRSA 3E1KA 4K3VA 3OQJA 4ZU3A 1XVVA 1OF4A 5KWRA 1X7DA 2BHLA 4M1MA 4FFRA 2EKPA 2CHQA 4HYYA 3LTEA 3EWAA 1F4VA 4BGEA 1E9VA 1T9GS 3OPQA 4UZEA 3KJFA 4EX7A 3UO8B 5FWXA 4HPXB 2ZSFA 3ST7A 2HSDA 3UIEA 1KYXA 1ZBDA 1P4HA 1XROA 1VJDA 2AOUA 2CKDA 3ISVA 1R0XA 3ZJ5A 1FOD2 1E9DA 4CL8A 1P62B 1V71A 3VO2A 5IYYA 3KL2A 4YMVA 4RY9A 4PFSA 2P4UA 2VA8A 1JXOA 5DNDA 3WDLA 1TEXA 2H2HA 3TW8A 5IK2D 1JR3A 1DBNA 1EWYA 4FXPA 2ZETA 2V3CC 4HL0A 1NY6A 4OUDA 3SICE 4MR7B 3GRVA 2QRVB 3O4HA 3OJFA 3HDQA 2JLAA 2O5RA 1V26A 1LPBB 2I4NA 3HYSA 1P3Y1 2P4EA 3TB4A 5CAZA 3PSAA 5HMLA 4CEJA 3LYLA 1H05A 5JFTA 4TYMA 2GXAA 2KM2A 3VR6D 5F39A 2VHYA 4Z7OB 1O2DA 4L8FA 4MOAA 1ZAYA 1YFWA 1TVKB 1AL22 1FI2A 1I3KA 2VEOA 4PPYA 5IJ0B 3CV3A 5BVGB 4G01B 5HDBB 2CBXA 4QVKA 4JBGA 1O57A 3H5WA 2H06A 4LV6A 2VF2A 1ZZCA 2DHDA 3P0HA 4CQMB 5EMHA 1UKBA 2VKTA 3GFGA 5EZWA 1XEXA 3ASIA 3ROZA 2YBPA 1ZD8A 3BUSA 4JROA 3SM3A 3GJ4A 3NTXA 3BCHA 1P7CA 3SMVA 3IDQA 5LY2A 4AF9A 3UJQA 4JSRA 1QIGA 1M7BA 4XQGA 3R5FA 4M21A 1V00A 3W5UA 1ULOA 4OHPA 1AKTA 5HF6A 4X8OA 5FNVB 1XTZA 2Y6HA 3OBRA 2PTMA 2J08A 2Q3DA 3LUCA 3CH4B 3E5MA 4WECA 3GDHA 4H7KA 5DM60 3L7AA 3B36A 1TEHA 3HC7A 4YRRA 2VECA 1IU9A 1G3RA 1HKHA 3ICPA 4R8VA 2OAEA 5HGJA 5IFLA 1NW4A 1XA4A 2Q5CA 4D7AA 2ZRHA 3PFIA 1OMOA 4X92A 1A2OA 2Y4NA 4YRPA 4F1JA 3WINE 2BBWA 4W5WA 4UMEA 2B4TO 3DKIA 2F4VB 1ZIOA 5DWQA 1PK7A 4HNQA 1BDJA 3EE6A 3U4SA 1OSNA 1TUEA 2CWWA 5ICSA 1H4SA 1L9XA 2R8ZA 3RODA 1S3GA 2PFKA 1XSEA 4I4IA 2AYHA 4FTBA 4UFJA 2P6MA 2FZWA 5B55A 2PXAA 3UV7A 4K1YA 1KO4A 1W6RA 3N7LA 3KB2A 4BJ1A 4BRWA 3KQQA 1ZZ9A 3VVMA 2IL1A 2R00C 3SD7A 2OD7A 2IS1A 4C4SA 1KO8A 2REOA 2AC2A 3TZCA 1KP9A 3N07A 5LZ9A 2EIDA 2IODA 1C0KA 4E3ZA 2XNCA 4QNRA 4WV8A 2Q9BA 1F4LA 5FUQA 3UC9A 4UFKA 4ESOA 4PNEA 2XH8A 3SIXA 3F5SA 3I2GA 4FSHA 4V0RA 1S8NA 5A9TA 4EPRA 5IT4A 1P2DA 2NQTA 2YC2C 3PTAA 3ZIAA 1KE1A 5FXMA 4A0HA 2RE9A 1WUTA 3B3JA 4IO1A 1NPDA 3FPFA 3R44A 4ON9A 3SIWA 3PVCA 4QDOA 1RVF1 1KMIY 5FO9B 1FCJA 2WP8J 1XNBA 2BRUC 2J3IA 4JLVA 1YB2A 2V7EA 3RC1A 1QIDA 3FTNA 2B4QA 1JKIA 3SC2A 5AM3A 1ZZEA 2ZUCA 4DUZB 3ZH2A 2C4TA 1EJ2A 4B2LA 2Y1OA 3G17A 4R9VA 5BR4A 1ZM2A 3DVQX 3OTWA 4GJZA 4QNNA 3IVCA 1ESEA 1HTTA 4KFUA 1REDA 1Y9EA 1NP6A 2JAUA 2YWBA 4JX0A 1VPDA 4DS3A 3GJ8A 4Q4X3 3W6PA 2HWC2 1MX5A 4LE4A 3ZYIB 1UBCA 4QDXA 3G0GA 4HKWA 1B35C 1ULZA 3BF7A 1C7IA 2FMDA 2QQVA 3EEYA 3VBUB 2MPFA 2GJ4A 4IOLA 4JQTA 4BQ2A 3ZFGA 2GDJA 3UGJA 2QR5A 4RKRA 5CG8A 3UXMA 2JLCA 5T5LA 4BFWA 2FETA 2ZS6B 2YVQA 1WMFA 5T64A 1E94E 2JG8A 2GEBA 3A32A 2E26A 2QTVA 2E85A 5JBNA 4D97A 2RAVA 5EWSA 5DW3A 3WX5A 4P7GA 3TSWA 3HB0A 1XYPA 4KU8A 3H6KA 4LJSA 3L4KA 3F7TA 7AT1A 5KTKA 1WW2A 1DBWA 2P9BA 3OC0A 4YJFB 2EF6A 2R49A 2ZWVA 5KX5F 1JHUA 3B1VA 2UUCB 5J09A 4G0NA 3Q8BA 2IPAB 1Y8QA 2VO5A 2GPBA 2O0OA 1P5JA 3WDWA 5EUQB 3AB7A 4J1WA 3RFCA 3HU2A 7REQB 5DMYA 3K48A 2H4ZA 4EG5A 4WLUA 3WF0A 3GMDA 2TRSB 2C84A 1QTRA 3FDXA 2QVYX 1VAKA 4KR9A 1UOPA 4WDQA 2FCTA 3QH4A 5JANA 1SULA 4TRMA 5A5FA 1DEXA 3RS3A 4MA0A 5K6AC 1QH8B 4KFRA 1YQGA 5AQEA 5J4VA 3LF7A 1T3GA 1COV2 2PV7A 1KZ1A 1D0HA 3OG9A 4XQWA 1LBEA 4RORA 3CVYA 2ZWOA 4X3CA 3DBHA 3O3CA 2G8NA 1XQ6A 1V35A 1BWQA 2R043 1LDNA 3NTVA 1RI3A 3TS1A 4IZOA 5IC6A 2ZMLA 2DBIA 2EZTA 2Q1ZB 1NQWA 1GQSA 3LH5A 4IV3C 1I4EB 4ZZ2A 2N47A 4AWAA 4E5KA 4ZT5A 3VO9A 2ACVA 3EPHA 3WCSA 1KRXA 4MQFB 4LY3A 2ZVPX 4DJDC 4N41A 1U0JA 4NPMA 1OXTA 2WVHA 4BX8A 2EU8A 1EX7A 5EQTA 1PT9A 3O2NA 3IQEA 4C22A 1GPKA 4DIOA 2XBUA 2O2XA 3E6CC 2IDMA 3RBAA 5JI9A 3P9QA 5JH7F 2CTVA 6NULA 3NRBA 4EGJA 5BVHA 4K9SA 1F3OA 5IT9A 1FFBA 1ZNXA 4I8XA 4Q0MA 3WFIA 5CT5A 3DL2A 3DE3X 8GPBA 2ZT5A 3UFXB 2OHGA 1TD9A 2XX3A 3MWFA 2B1JA 1LDBA 2Q7OE 4QU5A 2CW5A 2PHTA 1OKOA 2Z2JA 1P39A 1ADBA 5IM4F 3EPPA 1XLTC 1LESA 5IHRA 2J9FA 1QG4A 1JL3A 1LI5A 3B1JA 4XUEA 4BNUA 5C3SA 2NSLA 2HT6A 2JAWA 2PSDA 2O2CA 3SOPA 2JDPA 5KVCA 1J8QA 3N0VA 4XTRA 3UJPA 5BSGA 1G3UA 3VBHB 4XWAA 1BU5A 4CDQC 3VU1A 1AG9A 1JEJA 5AUOB 3BEOA 3OIYA 5L9VA 1YBVA 3GDFA 4TXHA 2PUCA 2JCYA 3EGCA 3JD2A 2ZYAA 4EFMA 3A4MA 2LIPA 4LMPA 2I45A 2P4SA 5GWXA 2JB4A 1HDXA 1JDVA 2ZEJA 1FU8A 1OXKB 4ZXKA 5JCZA 5L4SA 4DQUA 3T54A 1NNEA 1MGOA 4I5GA 2AOWA 5A7WA 2BGLA 4HFRA 1W4AA 2AQ8A 3QF4A 3BE5A 2EFHB 1KFXL 3AY0A 4R1PA 3DZ8A 3LSEA 5BNPB 4OKSA 3I12A 3KVAA 2F1JA 2FQYA 1VP9A 2LCFA 2FPKA 4JLOA 1OHFA 5B64A 2Q0QA 5IVPA 3ILYA 2GBLA 3UJ6A 3ZXIA 3IX7A 4OG2A 4NL4H 2A33A 3ZKAA 2UYHA 5DU2A 4FOLA 4H4EA 2AJLI 2GLTA 4A3XA 5ADUS 1XE0A 4LJ9A 1ND2C 1XEFA 2XWSA 2I2BA 3QOWA 2POCA 3B1XA 5DG1A 4IWNA 4E32A 4UFPA 1PVOA 2DERA 4ZIRA 4J0DA 1DAOA 3H86A 2EJUA 5F3DA 4XXHA 2RM22 1DAHA 4ECEA 5TSWA 4NAOA 4EBBA 1NE2A 1UBSB 2UY9A 3VZCA 5MN5A 2JBWA 3VMFA 1JR3D 1W3VA 2CGOA 3LF1A 1W73A 1ISSA 4RADA 5KYWA 3VPCA 1J99A 1OIWA 2CD9A 2GS9A 2Z2SB 3O47A 3TR0A 5JS6A 3I2FA 1B4DA 2PH7A 4YAUA 2GASA 4ARIA 1XD2B 2RR13 3IQWA 5EKDA 2BMFA 1KH3A 3U3ZA 4FGLA 1UY3A 3MOSA 2VJLA 4Y0VA 4CDUB 1I36A 5FX2A 1Q2XA 2ZGSA 4YG3A 3KAKA 4I6JA 5CXXA 1SKBA 2EP7A 4AIIA 1TRKA 3K70B 1ZVMA 2VNSA 2R6AA 2YS7A 1KJQA 3NHWA 5CJPA 2XVMA 4KL8S 1CEXA 1BROA 1U6IA 2AOXA 3VR4A 1FXWA 1BXRA 1YAHA 4YFYA 3RHTA 2ISSD 3RKUA 5AI5A 3MN1A 4YFWA 1WDMA 5AW9A 3VDDB 3A05A 3BT7A 5C4MA 1E2KA 1FSSA 4ARVA 5BPXA 2FDIA 3I5XA 1F9EA 2RHJA 1CUFA 3OE4A 2WKQA 3DTVB 4R98A 4XURA 1OFIA 2XRFA 4BFCA 3HVJA 2XJTA 4G8BA 4OO3A 3AVTA 1ZISA 2UZ3A 5CRIA 2LZ0A 4Q16A 1QF9A 2XI4A 2PKWA 2HSGA 1MDFA 3UESA 1NR7A 1ZW1A 2QQKA 3U7IA 4OCTA 1GZWA 4H2AA 1TKBA 4POAA 4G5YA 3B85A 4OF4A 2ZQYA 4RHXA 2Z9DA 1WP9A 1ECJA 5LQSA 2FY8A 2ST1A 1Z36A 2X0IA 3PF8A 1P2TA 2HT1A 3D4IA 4G4GA 2AUNA 3AIIA 2PUAA 4MRNA 1MXFA 3DPIA 3K8QA 1YTUA 2WY2D 2OFPA 4XUGB 1NVMB 5TEWA 3I6IA 3TIVA 4Y1EA 1MG0A 1T13A 4YX9A 5AVJA 2ZTHA 1SHUX 4ZT2A 1GFSA 1GZDA 4D8MA 1KEVA 4MOWA 4WK6A 4D79A 1UPTA 3IHKA 3VJRA 3ETJA 3NTUA 4IEEA 4GM0A 4C7VA 3V8QA 4NRDA 1NLYA 4S2DA 4LK3A 4LCEA 5DMXA 1WGPA 1TIBA 1UF9A 1DYOA 3OOJA 4QG7A 3WYFA 4KB5A 2BR3A 1U5ZA 3UB3A 1AZLA 3EMRA 4KQIA 1PWYE 1PFQA 3MRSA 5BQ5A 1ZD5A 4PZAA 1DWPA 2RK4A 1DIRA 1ML4A 1YBHA 4RD3A 1AKNA 1P74A 3OB8A 5EJ3A 4QATA 4HQLA 1Z4IA 4P54A 3PQFA 4MHOA 1T2DA 2J5KA 3VHXB 4LRXA 1CP2A 3E9DA 2RH9B 4RTNA 4XE5A 2DMRA 5KTPA 2BGTA 5FBHA 5G4KA 1IXYA 5IVFA 4EH1A 4EGCB 3ZIAD 1QQP3 1L5GB 1J59A 3H2GA 4AY2A 1X94A 3IB6A 3JW8A 3AG6A 3C7OA 4E4SA 2NXNA 1UKAA 1N1YA 1CHDA 2GD2A 3DO5A 5EJ4A 3O21A 3UXYA 4NECA 1ZCBA 5E6SB 3TLZA 4B3GA 2I6XA 2H6CA 2UUOA 3M8LA 2IYFA 7MHTA 3D6TB 4DUYB 1R3DA 1WX1A 2UYOA 4TKVA 5A3VA 5TE9A 4U7TB 3ROPA 3ELWA 3PK0A 4D82A 1T1GA 4ZHNA 4ETWA 2DFNA 4FNMA 3B93A 1J9ZA 3CLVA 3PQ8A 3RSQA 3BGDA 3N8HA 4HDSA 1FYVA 2PHZA 4RSRA 4E5VA 2VDWA 4GXTA 1VMFA 5B1SA 2B46X 1ZLXA 3TNJA 4GP6A 4R68A 3U1XA 1O96A 1TX4B 2ADOA 3JQ8B 1VBFA 3BF8A 5FUIA 4M3CB 3WGVA 1E7MA 4MIKA 3ILSA 4BMXA 5FNVF 3LPMA 3RG8A 3B9QA 3CF4A 3FAKA 2MDTA 3SSAA 2I0FA 4PC3A 1IY2A 4INOA 4AWBA 4XRRA 4D25A 2FR8A 4FPEA 1YR1A 3ECCA 4WERA 3LEGA 3KCQA 4MV2A 1XALA 2JC3A 3WW1A 3RI3A 2VHZA 2J33A 2O0MA 1WCKA 4DXTA 2VHTA 3FCUB 4XR9A 1YS4A 3SXPA 2J0UA 1JDJA 4IDFA 3IQGX 2HBQA 3TI7A 4LWZA 4XLTA 3I5YA 2BM9A 5JBQA 4XETA 3CIFA 5KYYA 1VBA3 2X19A 4DNYA 3PLAE 4U6NA 2PTHA 2BKLA 4CI9A 5BUCA 2ISCA 3ZV4A 1RUD2 4K2HA 2QMZA 3K9WA 4GO1A 3H8WA 3PYLA 1HEYA 2P6UA 1FNCA 4IUYA 3CA8A 5EWJA 2E1RA 1Y6FA 4B3IA 3HHPA 3CINA 1MQSA 5TS2A 3QW2A 4FK8A 2MYTA 4KXUA 1YOVA 2O8DA 1OA0A 5B12A 3FHLA 5GZGA 1UAIA 5KYXB 5KDDA 3G79A 4H2DA 2ZIGA 4HAXA 2W37A 3OLVA 1CPNA 3G5TA 4EM6A 4TV9B 1P4SA 5CBLA 1Z26A 3OF3A 3FHCB 5TGDA 5D8AC 5GLTA 3ZFFA 5E4TA 4N6NA 3VZDA 3QLJA 3IKTA 4GBED 1NMZA 4Q66C 3ZR5A 4M9QA 4KU7A 1A1SA 4QRDA 5ED4A 1Y1SA 5AHXA 3VKWA 2GEVA 3JVVA 5TQ2B 3CUSA 1Y5LA 2VA9A 3LF2A 3PJFA 1M0WA 1XF9A 5CVVA 4PSCA 2BE7A 3MQFA 3LT0A 5ICCA 1QE3A 1ADJA 4GR4A 1V6IA 2R041 4A2CA 3W5NA 4C4ZA 1NQTA 2IZ1A 4B3HA 3HVDA 4CQLB 1DQNA 4BATA 3RUCA 1I80A 1Z6ZA 5JYEA 3FMVA 4H08A 3C5VA 3L6EA 1D03A 2GVNA 1WNTA 4WM7A 4I1YA 4D4IA 1K8RA 5CT8A 3B2EA 3CYFA 3AYXB 5AW6A 4BNWA 3L93A 1FMD2 4QBIA 4IHJF 4N49A 5F6KA 1ND3A 1HTBA 5FTKA 2VXBA 2ZGKA 4NZOA 4P7FA 4RQTA 3JAWB 1NWCA 5KNDH 2XZOA 4BXFA 2PJUA 4PX9A 3IUBA 1QK3A 4F06A 1BQPA 2R5FA 3X1WA 1CF2O 4MVJH 2GKOA 4WZCA 3AESA 5ICEA 2X0NA 4FPOB 2WJWA 3ZWMA 5CFDA 2PHRA 2GN1A 4HLTA 4WN9B 2XRZA 3MLLA 1RUC1 5BNOB 1VAVA 3CNBA 4TT3A 3H5NA 4Y2XA 4MXWA 1GNSA 3FFTA 3KL4A 3GBGA 4EHBA 3N70A 1BIFA 2V6FA 4J0FA 1G8SA 3E3AA 1GMMA 3BIWE 1JA9A 2CFTA 4HL6A 2X15A 1LW7A 4Y2GA 3B89A 4EENA 3H2YA 4ZEOA 3M81A 2ZBJA 3KJIA 2YUEA 4P9NA 2IT1A 4C9BA 1Q6YA 1H5NA 2DHCA 1F38A 2RDSA 1DG9A 3K1ZA 3NZEA 5BO5A 2V4ZA 1O6FA 3IP7A 4B75A 4B7XA 5CA1A 5LQNA 5E89A 4UWDA 1U9IC 5FJKA 4UVEA 3A21A 1W1IA 4A73A 4MKRA 3GHYA 4CN8A 5J4LA 3UCFA 2YV8A 3WXMA 3E6BA 1LQUA 2O1EA 1BWRA 5JR3A 1RXFA 2J8ZA 1I8TA 2NPOA 5HQJA 4CI0B 3RDIA 1S2MA 4F85A 5C8YF 1YZUA 4BAUA 5GIPE 1OZFA 4YP6A 1CZLA 2IVFA 4MULA 1H9BA 3JRXA 1ZEJA 2RGYA 3O0TA 4BCBA 5FPBA 4CU6A 2VLIA 4YVWA 3GBVA 3M4JA 2HWB1 3N35A 1QDOA 3C3VA 3D6VA 2HA5A 1RTVA 1Z16A 1LBIA 5EXTA 1X1RA 2EATA 2Q0HA 1SCDA 4ASLA 4QVGA 1OROA 1E4EA 2H85A 4YPVA 3AG5A 3LWDA 4S04A 4Z1VA 5A3NA 1KBOA 1RYYA 4DMMA 2DF7A 4MYHA 4DUGA 4UU7A 4LFAB 5C1BA 5A1TA 3FCCA 3KZVA 1NCRC 2HDNB 2O5EA 2AMFA 3DMRA 4J3FA 2YJTD 2YN2A 4M49A 2BFFB 1RT9A 5LBBA 3D6HA 3MXTA 2XEDA 3T94A 4FNOA 3UMCA 3DLBA 1FNMA 5AKGA 1UPFA 5ABJA 1WCWA 1QJEA 3OGRA 4LA3A 3HU1A 2PVSA 4WKGA 2P3LA 2RR11 4OXQA 4KXXA 5EXPA 3OFVA 1GGHA 3DH0A 2PUJA 1SRRA 3TL2A 1AJEA 2V7PA 2ECKA 4G07A 1Y7TA 2IYEA 2W1UA 4I8IA 1RUJ2 1P4RA 3UWOA 2Q3FA 3PXCX 1I5PA 5JOWA 1E7RA 3ACFA 3TSYA 3A9UA 2HJWA 3DEAA 2WAXA 4FGSA 2PK3A 3PGA1 3JV7A 3VR4D 2PXCA 1ZVVA 4B6FA 1LHOA 4Y7DA