3IIIA

1.95 angstrom crystal structure of coce/nond family hydrolase (sacol2612) from staphylococcus aureus
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
558
structure length
556
Chain Sequence
QHLLGNPKLTVTHVNEVKAGINHIVVDSVQYGNQEMIMEKDGTVEMRDGEKLYINIFRPNKDGKFPVVMSADTYGKDNKPKNMGALWPTLGTIPTSSFTPEESPDPGFWVPNDYVVVKVALRGSDKSKGVLSPWSKREAEDYYEVIEWAANQSWSNGNIGTNGVSYLAVTQWWVASLNPPHLKAMIPWEGLNDMYREVAFHGGIPDTGFYRFWTQGIFARWTDNPNIEDLIQAQQEHPLFDDFWKQRQVPLSQIKTPLLTCASWSTQGLHNRGSFEGFKQAASEEKWLYVHGRKEWESYYARENLERQKSFFDFYLKEENNDWKDTPHVIYEVRDQFYKGEFKSASAFPLPNAEYTPLYLNAENHTLNHAKISSAHVAQYDSEDKQQDVSFKYTFDKDTELVGNMNLKLWVSTKDSDDMDLFAGIKKLDRRGNEVNFPDFNHIENGQVATGWLRVSHRELDQEKSSIAQPWHKHETELKLSQDEIVPVEIELLPSGTLFKQGETLEVVVKGSEIVIGNSTPGMKTRYEHEETVNKGMHMIYTGGKYDSQLIIPIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title 1.95 Angstrom Crystal Structure of CocE/NonD family hydrolase (SACOL2612) from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus col
molecule tags Hydrolase
molecule keywords CocE/NonD family hydrolase
total genus 189
structure length 556
sequence length 558
ec nomenclature
pdb deposition date 2009-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02129 Peptidase_S15 X-Pro dipeptidyl-peptidase (S15 family)
A PF08530 PepX_C X-Pro dipeptidyl-peptidase C-terminal non-catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3020.20 Mainly Alpha Orthogonal Bundle alpha-amino acid ester hydrolase ( Helical cap domain) alpha-amino acid ester hydrolase ( Helical cap domain) 3iiiA02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3iiiA03
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iiiA01
4M0MA 1BS9A 5AI8A 5EIYB 3TRDA 1QO7A 3CZUA 1WB4A 4DTCA 1US2A 4BCDA 3G9TA 3IUJA 5AI5A 4CUBA 4BXSV 2WTNA 4ARYA 4M4PA 1R64A 1YB6A 1GPKA 2RHWA 3ED1A 3FLEA 1C7JA 2XMZA 4OYYA 2H7YA 1K3IA 2PM8A 3CCBA 4L3WA 2VC9A 1OCEA 3FOBA 4LXHA 3HJRA 1A8UA 3UUEA 3WF1A 2YC4A 2HA4A 3DOIA 4AB1A 1B41A 5EIAA 5CXUA 3LIIA 2FUKA 3I97A 2VZTA 3C7EA 1L7AA 2X05A 4QX1A 5ALEA 1KU6A 2QXTA 1JZ5A 3G02A 4JYPA 1DT5A 2GZRA 3HZOA 4HZGA 3PF8A 4KEAA 2EDCA 2GYUA 1A88A 1ZD4A 4QWMA 2BGNA 5K3BA 2O2HA 4KR0A 1QIEA 1YA8A 1JMKC 2DHDA 3FN9A 4EY8A 2GYWA 4MGQA 1VXRA 3C8HA 3WI7A 1GNYA 1EVQA 4FWBA 4A23A 4EUSA 2XE4A 3OURA 4WFIA 5HF5A 2P8SA 2HRQA 3GROA 1U65A 3GM8A 1H6YA 5AI0A 1W52X 2DSNA 2WHQA 4PW0A 2C0QA 1JHJA 2JGEA 3A2NA 2OCIA 3W5MA 4W8JA 4NMWA 1F0NA 3WNNA 2D0DA 5AI6A 1K12A 1R9NA 3DS8A 4E8DA 1CUWA 2W94A 4WY5A 1UYZA 2XOMA 1TG7A 5EHQA 2EIBA 4TTGA 3OGSA 5KBYA 5HFAA 3I3DA 1ZI8A 3NWOA 1FFEA 2B9VA 1CFJA 3NNGA 2ZSHA 5DJ5A 5AO9A 4UFNA 1E89A 4IO0A 5AK3A 1Q0RA 3WL7A 3UUFA 4C6HA 3I6ZA 3L1HA 4E46A 3STUA 3ZLUA 4LHEA 4ZXFA 3ZM8A 5DYWA 3EBLA 4QDZA 3DEAA 1IMJA 1QOZA 5BOVA 4X6XA 3NUZA 1BN6A 1HPLA 2DHCA 5ALIA 2VL4A 3PUIA 4P00B 1W9TA 2ORYA 3IB3A 1TK3A 1GOFA 1W99A 3WJ2A 2GBFA 5CT5A 5ALSA 3HABA 4D8MA 2WAOA 5JZ9A 4DSAA 4NZZA 5LKRA 2JKXA 2PX6A 4W1RA 3AIMA 1HN1A 1IUPA 1PV1A 4XURA 4Y2JA 3GBSA 1O59A 5AK6A 4MYDA 3WK9A 2WUDA 2J1SA 1DX4A 1MTZA 5DNVA 3WLAA 3D7RA 4UAPA 5E2IA 3IAPA 3DCNA 4W1PA 2W46A 4OB7A 3MBWA 2WAAA 3N0TA 5AM2A 5IVKA 5JYCA 3MO4A 1R88A 2X5XA 4QLOA 4TGLA 5AKJA 3UETA 3HN3A 2YFZA 3OBAA 1MAHA 2DHEA 1EUUA 3HJUA 4H0CA 4KAFA 3D59A 4QDUA 5CYYA 3C43A 3C6ZA 4A41A 2G63A 3QH4A 5HF6A 1OF3A 1GKKA 3BXPA 3OEAA 5EGNA 1H6XA 2J7MA 3I6YA 1UYXA 5CW2A 1GZ7A 2QUBA 3JW8A 2RVAA 2XT0A 3SC2A 2JGFA 2BERA 3C7HA 3IULA 3AUKA 2PUJA 3T08A 1XZCA 5C70A 1DU4A 5C81A 1CX1A 3FBWA 5LLSA 4Y2QA 2ZSIA 5JATA 4NS4A 4ZRDA 1NX9A 3GXUA 1PMHX 4MGSA 3QMVA 2W5FA 3B5EA 2V96A 2WFMA 1N1MA 4BC1A 3TJMA 2OG1A 1WCYA 4LKSA 1M33A 3WYNA 3STYA 3W04A 5B4NA 1MJ5A 3WK7A 4AO7A 1R1DA 4AO8A 1MX5A 1BN7A 3CIHA 5DMYA 2HU7A 1G66A 3D0KA 1CLEA 4B80A 1IQDC 3T52A 3V1KA 5BV7A 4ZI5A 5AICA 4LXGA 3ZLTA 1QTIA 3C6BA 3ESDA 3WZMA 2BBAA 2QQKA 3A70A 3BF7A 2XUPA 1LBTA 2O2GA 4GHWA 4BYMA 4L9AA 1W4LA 4KE9A 4MO3M 4QDRA 3IUNA 5JXIA 1O6GA 1X70A 3L1IA 4MJ3A 4XUPA 2VCCA 1G42A 5FOQA 4KAJA 3FVRA 4BP8A 1YS2X 2HA5A 5JD5A 4KACA 1EVEA 2E3JA 2VMEA 4MWSA 3V9AA 4B0PA 2EEPA 4Q34A 2VZQA 4H35A 3MUY1 2C5GA 5AOAA 3OGRA 4Y2YA 2G5PA 4BVLA 2QVBA 3DYVA 1F6WA 3AILA 2WFZA 5LZ4A 3M3DA 3WL6A 2CDOA 5LYYA 4U2EA 4CCWA 5AJHA 1P0QA 2PL5A 1GGVA 4LKOA 3LIPA 2DDUA 1WB6A 4JUIA 4E8CA 3O9MA 5JAOA 4X90A 3E4DA 2YB7A 2HU5A 3D2BA 1SOMA 4F21A 1GUIA 4CU9A 3DECA 3Q8WA 2ZYIA 2V97A 3THDA 1K8QA 3A22A 1ZGCA 3BE8A 1W8OA 4IH4A 2VZPA 3KWJA 1FFAA 3D2CA 4Q3OA 1OD3A 1XC6A 5ALOA 2G4LA 1IUNA 4L72A 3LCRA 1YSCA 3I2HA 3VJMA 2D5LA 3T2QA 2JGJA 2WIFA 3STXA 4AAXA 5HKAA 3WWDA 3D5EA 4N8SA 3F2ZA 1W1IA 2XUGA 3TGLA 3KDAA 3QZUA 1CR6A 1XQVA 1IZ7A 2XQIA 1DWQA 5JANA 4PF1A 4ZZ8A 2K2QB 3LLCA 5AM0A 4TXWA 2XUDA 5FXMA 3VD9A 1A8SA 4X97A 3H2HA 4I19A 2UZ0A 3WWEA 2V4VA 2QQNA 4P92A 4YPVA 1GQRA 1WPXA 3WWOA 4FKBA 4QX3A 3BF8A 3F97A 3OB8A 3WA6A 2PUHA 2O2IA 4W4ZA 4FTWA 4UBLA 1FSSA 4KWUA 1USWA 4X94A 2BCEA 3WKDA 2CZQA 5IYYA 2DCJA 1XRPA 1UY1A 3C7FA 5AIAA 1XQWA 4UHFA 3WNPA 1JFRA 2VAXA 1TVGA 5KREA 4U2DA 2EIEA 2AXEA 4FBLA 2LIPA 1L7QA 4EZIA 1UKAA 4M0EA 2OAEA 3FL7A 5K3DA 2VQUA 2VM9A 3I2GA 2XMQA 3FWHA 2OAGA 1GXSA 2PPLA 1UXZA 4BC0A 1UOPA 2CB9A 4UHHA 2ORZA 4FI9A 4KI5M 1VZ3A 5EFZA 5I7UA 5K3EA 1GKLA 1W9SA 5K3FA 4BAGA 1XKTA 2CDPA 1EDDA 2CBGA 3A21A 3FYUA 4N8EA 2HADA 1CUDA 3H1BA 1UKCA 2EIDA 4HS9A 3E1F1 1RP1A 1LBSA 4Y2TA 4QX0A 5JAHA 2PSDA 2BGOA 1U2EA 3FAKA 4KYVA 5HQ3B 4PV7A 5E4TA 1AMNA 1E8NA 4DIUA 1QZ3A 2ZYSA 4LHSA 2XDWA 3VD7A 2WIJA 2ZYHA 2VATA 2VR4A 1VE7A 1TCAA 1O8PA 4J0JA 4C01A 1YR2A 1GMMA 1ZD3A 1Q84A 4OSEA 3FSGD 2W1QA 4JHZA 4CG1A 1ZOIA 4KAAA 1H2YA 4CIBA 4W1SA 1KU0A 2Y2VA 4FNGA 2PSEA 3AC0A 3F96A 5AM4A 4RNCA 3EIOA 1W8NA 4I3FA 2B20A 3SX4A 4OUEA 2HDWA 4J0KA 4DUXA 3U1TA 2DCKA 5C8VA 4KRXA 3G9UA 1MNQA 1NU8A 4V2IA 2VEOA 2XLCA 2Z3WA 2ZJFA 4UFOA 5CRIA 5ALPA 2QZPA 2AJLI 3HRHA 3WK6A 3IURA 3UESA 3O9VA 4XUNA 3D4LA 1A7UA 4U2CA 2WIGA 3E1GA 2QRUA 2RV9A 2ZEWA 2Y6LA 3C7OA 1SC9A 3H04A 2PSJA 5LIPA 1UZAA 5IVDA 2ZJ7A 5HCUA 3I2KA 2VZOA 4IQ4A 2J1EA 2Y6JA 3H19A 2QS9A 1CIYA 1CRLA 5EJZB 5AI9A 3CMGA 4Q82A 1QIMA 4PQQA 4DGQA 1JJBA 2QMQA 1JZ7A 5EIHA 1GPNA 1Y37A 1ZI6A 3ZI7A 4K2AA 4HTAA 1ISPA 1LPAB 5JZSA 1R4ZA 3BIXA 2YXPX 2V98A 1F4HA 4LYDA 4G4IA 1S8OA 2VTFA 4HXGA 3W9BA 4YPJA 3H2JA 4X85A 1Y7HA 4C87A 4P5YA 2Y6UA 4UHCA 4FOLA 2PU5A 2VMDA 2XQGA 2XUAA 5ALMA 5FPQA 3OOSA 4CCYB 3JWEA 1JZ3A 4ARAA 1UZ0A 2BUCA 2WYSA 2XMDA 2VCAA 3I2IA 4ZXEA 2VZ1A 1THGA 3FCXA 4UBIA 2BGRA 1P0MA 1XROA 3R0VA 1F4AA 4J0HA 5IVIA 2O7VA 4AZ0A 3WNMA 2W1WA 5CH3A 3BJRA 1XZKA 5JMOA 4C89A 1QIDA 1SFRA 4EA6A 2ZEXA 3KD2A 1O8SA 4BRZA 5ALZA 1DQZA 3QM1A 2FJPA 5ESRA 2B4KA 1J2EA 3SEPA 4GBGA 2L9LA 3GGLA 5JXGA 5ALLA 3ETPA 1UY4A 3ACGA 3KXPA 4G1FA 4W9RA 2HA3A 1OH4A 2X8BA 5BWBA 4W63A 3DYMA 1JYXA 1XZFA 4UFPA 4IH1A 1XRNA 1J06A 3M82A 3T09A 5DTJA 2VCBA 1IZ8A 4CG2A 2QXUA 3NJXA 1ODCA 1O6FA 5C71A 1PX3A 4XZUG 4C88A 3M81A 2OPHA 2VJBA 3E3AA 5CURA 2GBCA 3R3UA 4BP9A 1NU6A 3FVTA 2YC2A 5C8ZA 5A6VA 5HK9A 5DNUA 5ALNA 4JH0A 3WF0A 5ALVA 1GU3A 3WNOA 4XVHA 3WYDA 5D3KA 2W47A 5FRDA 4WJLA 2DQYA 1CUFA 2Q0XA 4FDMA 3I2FA 3KWFA 1UY0A 3H2IA 4PSCA 2BJHA 4D9JA 4A3ZA 4HG6B 3G0CA 1XZDA 3GELA 2XUIA 5DN2A 4QB1A 3PI6A 1WHTA 4QE3A 3DDUA 1BU8A 2WN2A 1CUYA 4X3CA 3YASA 4J3JA 2VT7A 2CEKA 2DQZA 3MUNA 5JUVA 2H7XA 1KGYA 3S8YA 3BWXA 1BEZA 1QIJA 3CKHA 1CQWA 5AKHA 4L0CA 1QJ4A 4BATA 1QLWA 2HA2A 3MVEA 2YASA 3DNMA 1EB9A 2VAVA 4M4RA 2VMFA 1QTRA 4G8CA 3BDIA 1ACLA 1N5MA 5J3JA 3ZWQA 3DLTA 4UBMA 3VDBA 3ESAA 3IVMA 3RLIA 1P0PA 1AURA 4EHBA 2HU8A 2ZXQA 1F0PA 3C6YA 3K46A 2QTBA 3QMMA 1GPLA 3JXSA 1XRLA 4X93A 4EB0A 4LIPD 5AKYA 2WKWA 2XMRA 4DUVA 2QR5A 2PSFA 1NUKA 4IH9A 5JXHA 3ANSA 1CVLA 1VXOA 4AN0A 3RKSA 2RONA 5F7UA 7YASA 4FLEA 3LEKA 3VJKA 3SKVA 4A5SA 2Y6HA 1PMJX 3R40A 3UMJA 1HLGA 1T2XA 1QIKA 4PT6A 4GEGA 3KOOA 4B83A 1W6RA 1OF4A 2V9ZA 2RJ2A 3R41A 4BAUA 2J1TA 1TQHA 2ZVDA 3PFCA 1CUAA 5KWIA 1EINA 3STVA 3STTA 1DTEA 5LZ5A 4QWWA 4FBMA 2BZDA 2H7CA 2RIPA 2Y1KA 3PFBA 2WQ8A 3N2ZB 4FNMA 4JX0A 1CUGA 5FP0A 1ODSA 3H18A 4Y2XA 1AC5A 4F60A 5CXXA 2W1UA 1JI6A 2Z3ZA 3GA7A 4DEVA 4BDVB 2IX9A 5T4EA 2RHTA 2J22A 2JGMA 2EDAA 3HC7A 5IH7A 3KSRA 1N5RA 4X92A 4PSDA 1CUBA 1DP0A 2XONA 5E4YA 3U0VA 2O7RA 3CN7A 3HLKA 5ALYA 3STWA 1XLUA 3JYHA 1L7RA 5HXMA 2BGPA 2X09A 4CU8A 2XQFA 3RM3A 3DJYA 5AH0A 4OU5A 5JAUA 1LZKA 1LPMA 4DNFA 2WO2A 3OPMA 2YG0A 4ZY9A 4EY4A 4HXFB 3IDAA 1QGED 4MQLA 4CU6A 1UK6A 4P02B 1QIFA 2VJCA 2BUBA 1US3A 4BK4A 2OGZA 4N8DA 3EQ9A 3BGAA 2AJCA 4H18A 1XZAA 3J7HA 4QEKA 1JU4A 4OPMA 3WIOA 4FLMA 3LEGA 4DMHA 3V48A 4H7FA 4E15A 4OMCA 1JYNA 4QA9A 5LA2A 2WG2A 2QKYA 4BZWA 3MUZ1 3VD3A 1TAHA 1FFCA 3O4JA 1ZD5A 3MUOA 5A71A 1HL7A 2FJ0A 4AG4A 5CH8A 2JEYA 3AZOA 1CZTA 5HKBA 4G9GA 5ALDA 1RYYA 1TCCA 3WL5A 4BE9A 3WL8A 3I3EA 4RGYA 4UHEA 4B6GA 3O95A 1ZJ5A 3OG9A 5DQ0A 3WNKA 5A7FA 5JAPA 2WJ3A 3VKFA 4CCYA 3HOBA 1ORVA 4X6YA 2VT6A 4GZ9A 2QQOA 1BCRA 2JBWA 1W9WA 2XUKA 4Q3LA 2GZSA 2HL6A 5EJ1B 3VXKA 2Z5GA 3OC0A 1YAHA 2GYVA 1K63A 4DMFA 2C26A 1VE6A 1B6GA 1UY2A 1BHGA 3H2GA 1QE3A 4B9EA 5LZ7A 2BKLA 4DMKA 2ES4A 4QDSA 2AJ8A 3OTQA 2PBLA 1P8JA 1ZI9A 1SHWB 4QDTA 5AM3A 3QITA 3O0DA 5CT9A 5K3CA 2QJWA 4KE8A 4Y2UA 3X3HA 3F67A 3WMRA 4EY6A 4DXRA 4DM7A 2Y6KA 5C7YA 5K3FB 1XPWA 2Y6GA 1JZ8A 4Y9SA 1DINA 3G0GA 3OG2A 4DXSA 2WABA 2RI6A 5G04L 4BB0A 2XUQA 5AOCA 5SYNA 3FLBA 4QB6A 1QIGA 3ESCA 1Q83A 1CPYA 5IFPA 4WFKA 4OYUA 3H17A 1EK1A 3DOHA 5ALKA 2XMSA 1LPBB 1CUIA 2VJAA 5CMLA 3VJLA 1CV2A 3IUMA 4AQDA 4KRYA 4DNQA 2ZEYA 4XX1A 2QQJA 3VDCA 2X76A 5AKZA 2QQMA 1UXOA 1XQXA 2W6CX 1EK2A 2JGKA 1LPPA 4C4ZA 1AUOA 5T4BA 1XQYA 3FSGA 2VJDA 1T4MA 2VA9A 1SG3A 1EX9A 2WQZA 3ZLVA 1VLQA 1CUJA 2C4HA 1EHYA 1YCDA 4TVKA 5SYMA 1MAAA 1J1IA 2HA0A 4FHZA 2WJ4A 1LNSA 5ALHA 2C0PA 4GWLA 4MADA 2WUFA 1WM1A 3I2JA 2WFLA 1DYOA 5G05L 4Y2RA 2Y64A 3R3XA 2C4XA 5A7GA 4C4XA 5EI5A 1YA4A 3T2PA 1QIHA 5AI4A 1JT2A 1YAJA 2QJRA 2VZVA 1CUZA 3MGAA 1DT3A 5D3ZA 2JGLA 2WDBA 2W91A 1UK8A 3I28A 2J1RA 1WCQA 3CZJA 3WF4A 1XZBA 4AXBA 3EB7A 2WILA 1VA4A 2WBKA 4F0JA 5JD6A 1FFDA 2XHNA 4G4GA 1ULPA 4ZV7A 1YASA 3SK0A 3BIWA 5HPOA 5JASA 4G8DA 5I8PA 3AZQA 5I9IA 4GWJA 2HIHA 4GI1A 1OILA 1MNAA 2Y8KA 3GUUA 1BCSA 5C8XA 3H2KA 1VOTA 1XRRA 3WK5A 3IIIA 4QDXA 4H7EA 3AIKA 2OCLA 3T0AA 3SKJE 3ZV7A 3CN9A 2WIKA 3ACHA 5ALJA 2J3QA 2Z8ZA 1XZGA 3HEAA 1FJ2A 4P93A 4AN1A 3AJAA 2VZRA 1I6WA 2I3ZA 4ITVA 4JEIA 1UMHA 5DYTA 2WHPB 5HZGA 2XUOA 1CZVA 4ZREA 4B0OA 5AP9A 4UHDA 4G8BA 1AX9A 5AKEA 5A62A 1SDDB 1W0NA 2PSHA 2WHPA 3P1IA 2HYXA 5AKIA 1LPNA 4JYMA 1GQSA 1H2XA 4OYLA 3CCCA 3DL4A 1C4XA 5JXJA 2C5FA 4QNNA 4G4JA 3IA2A 4IHAA 2AJBA 4X7BA 2VOTA 4OU4A 5HF9A 4ZV9A 3ACIA 2HLEA 2EICA 1QFSA 1JYVA 4H7HA 3ZPXA 3QMWA 1NKGA 1C7IA 5AM5A 4P08A 1G5FA 3AFIA 3HI4A 1D07A 1TIBA 1PFQA 1H2WA 3ACFA 3UNPA 1A8QA 1ZGBA 2ACKA 2WZ8A 3NOXA 2HFKA 5A7HA 3G7NA 4Z2AA 3BN6A 4CIAA 2C7BA 5E4JA 4K5QA 4O08A 2W22A 1GOHA 5CZKA 4JKKA 2VQ6A 4XJVA 1JU3A 1PX4A 1HBJA 5JZBA 4A45A 5JALA 4MQMA 4XUTA 2WIDA 1JZ6A 1SCQA 3DL7A 2W3JA 5ISMA 2PKYX 1G4HA 2DR0A 2R7EB 3O4GA 1JI3A 4TPKA 2ECFA 1DLCA 3K6KA 4GLBA 2HRRA 4QDOA 5JIBA 3K4ZA 1WHSA 2C58A 1GOGA 4PNZA 4K6HA 1JMYA 4Y2VA 5CBKA 1GT6A 3SWWA 4WY8A 4BJ0A 4GW3A 1ODTC 4X6UA 3LQCA 3NQHA 1MO2A 4GWIA 4RYDA 3B12A 4OD0A 5FV4A 1XNTA 3ICWA 4XWGA 3A2MA 5ALFA 3LE0A 5CT8A 3LS2A 3K4DA 1MX1A 2PQSA 5AOBA 4UBNA 3RARA 1X2EA 4DSZA 4DMCA 3MV01 5A2GA 1UKBA 2VQTA 5C7GA 2XMBA 1E8MA 3BJMA 4ARBA 5IJRA 3WF3A 2GBIA 5ALTA 3LEIA 5F4ZA 3W5NA 3WQHA 1XNAA 4A4AA 2H9YA 1K42A 3E0XA 1W75A 3WKAA 2W87A 4UBJA 1HKHA 4BCCA 3FYTA 4PQEA 3QPCA 4E11A 5FLKA 1TCBA 4EBBA 4HRYA 5AHXA 2KD7A 4J0CA 5AKXA 2Z4FA 4IUGA 3FYUC 5HF8A 1QIIA 1ETHA 1CUXA 5LP1A 4PSUA 1E8DA 3WWCA 1GQPA 4B85A 1H2ZA 1YB7A 4BCBA 4QZVA 5K5EA 5DPNA 5FKJA 3VVLA 2HA6A 1VKHA 3Q0TA 3DYIA 2OQVA 2BAGA 2WZEA 2BFNA 1CUSA 1Z68A 4DEQA 2QBXA 1LZLA 2W95A 3HSSA 4J0IA 5IKXA 4W50A 5A1AA 1JZ4A 2XUFA 3NJVA 4D0QA 5LCWL 3CDZB 5BWCA 1H22A 1R3DA 1XFDA 3G8YA 2OKXA 3SEEA 3LPFA 5DNWA 3C8DA 4GECA 2ID4A 5LKAA 2OQIA 3VDXA 1YS1X 1RWQA 1XLWA 4LPLA 2QM0A 2HFJA 1EI9A 1XZEA 5CT4A 1DQYA 4JKLA 1EDBA 4BBZA 2XQJA 3WNLA 3VD5A 2VMCA 1BRTA 4P9NA 3FYUB 4DXTA 1E66A 4OMDA 1QFMA 2XUJA 2QT9A 2YFUA 5B4XA 4H7IA 3ABZA 2HHAA 3F8SA 2CMFA 4LQRA 2PU7A 3K9BA 4ZGBA 1CZSA 3R3VA 1P0IA 3K77A 2OXEA 3ICVA 3BDVA 5T4FA 5D7BA 2OCKA 4YK7A 1CUCA 4RN5A 2Y6VA 2XMGA 3G0DA 5IFTA 2VZUA 1XRQA 5JARA 1K5PA 4H77A 5ALGA 1CUUA 1AQLA 1DWOA 2R8BA 3HNYM 4RE6A 4DUWA 1UYYA 4A44A 2QUAA 5FUMA 4LYEA 5EHNA 3IBTA 4DNPA 2X10A 1KEZA 1VA5A 1LLFA 1CEXA 1CUEA 1J84A 1CIJA 4RPCA 2VO5A 3DYOA 4U2GA 3NGMA 3D2AA 3FCYA 4AMYA 2XUHA 4AX4A 3M83A 1IVYA 4CVUA 3EF3A 1LPOA 2WN3A 4G9EA 5HQ3A 4FFWA 2WUEA 4QAWA 3V1LA 3K4AA 3FHAA 1UOQA 3AINA 2WTMA 4C4YA 4UI9L 3WK8A 3R3YA 4YASA 2V72A 2VSQA 4BVKA 4K6GA 2XLBA 4KE7A 2VZ3A 4L0PA 2OLEA 3V1NA 3WZLA 2QQLA 4QB2A 3IUQA 3C70A 5LZ2A 3VVMA 1FFBA 3K75B 4A16A 4X71A 1AZWA 4Y2PA 1KEXA 4HAIA 1N8SA 2J3DA 1CQZA 4Q05A 3D3AA 3ANTA 2W92A 5CTAA 4X95A 1UK9A 3EQ8A 4GXNA 3CXUA 3AIOA 4ETWA 4Y2SA 2ZJ6A 4G5XA 4W1QA 3S2ZA 3TEJA 1W76A 1XZHA 1PJAA 1HDEA 5IHRA 3WWPA 1EB8A 4E14A 2FX5A 2CKMA 1BE0A 4U2FA 1F8UA 1ORWA 4B84A 1BROA 3WKBA 1E3QA 3QBJA 2OGSA 2J4FA 4RE5A 1J07A 1EUTA 2WJ6A 3OEBA 5HFNA 2XQXA 1VJ5A 3V1MA 2WO3A 3IAQA 2XB6A 3WQBA 2JE8A 2WHRA 2J1UA 1SCIA 3QYJA 2WUHA 2IITA 5K3AA 3GDBA 4JNCA 2WG1A 2XI4A 1DX6A 5ALUA 4MEBA 2ACEA 2JGIA 3U37A 5JD4A 4ET7A 4WCVA 3WJ1A 4CUCA 1R9MA 5LZ8A 3RK4A 1UY3A 4MXDA 3HXKA 1ULOA 2WO1A 1WPRA 4H7JA 4I4CA 3GZJA 1AKNA 4GDMA 5CT6A 4UHBA 3A7QA 2W9XA 4ZWNA 2E26A 4UBOA 5LZ9A 1NAEA 2ROQA 2QQIA 4F5ZA 2J1VA 2Z8XA 3AZPA 3WK4A 4OCZA 4JKMA 5AKGA 4PO3X 1CUHA 1AGYA 5AK4A 4J03A 4HVTA 3VDAA 4AZ3A 3R3WA 4XVCA 3W05A 3FNBA 2JD9A 1UFOA 2IIVA 1SCKA 3HYSA 4M0FA 3B3QA 3G0IA 3HNBM 1U4NA 2WSLA 1UWCA 6YASA 1TKRA 2QOEA 3GFFA 2I78A 1IUOA 1Y7IA 1U8EA 1T2NA 3BL8A 2VF2A 1UT6A 3R3ZA 1UWWA 4CU7A 1JZ2A 3EQ7A 2JF0A 1ZIXA 4Q1VA 2ONCA 2VTVA 4H7DA 1CUVA 1OT5A 2Y2UA 1TRHA 1ZJ4A 4EY7A 4MOAA 4J7AA 1XZIA 1THTA 1EDEA 4BK5A 3PDCA 4HXEB 1XZLA 4H7KA 5LA0A 2E31A 2ZYRA 3DD5A 4BDSA 3QPDA 4QPWA 4DLNA 4QDQA 3C5VA 3WSOA 4DYHA 4ARXA 3O4IA 4FMPA 4A42A 2ORXA 2JDAA 1QONA 2XMCA 3D3NA 3K2IA 1ZIYA 3T4UA 1UMIA 4BTLA 4J0GA 2J4CA 3I1YA 3C5WP 5H3HA 3OGVA 4N5HX 3VISA 5AIBA 3VD4A 2V5DA 2WFLB 2C9KA 2RGUA 2YH2A 2RAUA 2WG0A 3C8XA 1ACJA 2AJDA 3QPAA 4B7ZA 4CUAA 4KJXA 2WM2A 1UXXX 1LGYA 3HEIA 5J1XA 1H23A 3F9CA 4BVJA 3C6XA 3WA7A 3PICA 3P2MA 5T4HA 5KWJA 2XQKA 4BE4A 1ZD2P 4WDQA 4S0XA 1UX7A 2G5TA 3DQZA 4B82A 1XLVA 1XRMA 4K6KA 4BTVA 5ALQA 1DWPA 3NRUA 2JIDA 3ECQA 4INZA 3G9XA 1ZICA 5AKLA 1MN6A 5ALXA 4UOJA 1WB5A 5DLPA 4A6OA 3L1JA 1QO9A 4XIIA 3LPGA 2PVSA 2GBGA 4X91A 4NVRA 2CJPA 2YYSA 4QLAA 2HA7A 1WOMA 1WKYA 2DCMA 4WDRA 5FUIA 2VJXA 1LPSA 4KMQA 1I5PA 4WFJA 4X00A 1BEEA 5DWDA 3W06A 5I0DA 3HNMA 1MU0A 2DFPA 3QVMA 4AO6A 5EIEA 1JJFA 3HPNA 4XUQA 4UPDA 5FDFA 3WEZA 5DTIA 3G0BA 3WIBA 2H1IA 3A2LA 3PE6A 3ESBA 1JKMA 2VZSA 1JJIA 1EXWA 4Y7DA 4YX9A 1K4YA 4KE6A 2WU3A 2CUTA 4LXIA 4XUOA 2ZEZA 2OCGA 5DYYA 3LP5A 4CG3A 3A23A 3T2OA 5YASA 1JYWA 4HRXA 4MWTA 5JR2A 2B61A 4CFSA 1MPXA 3CQOA 3A6ZA 4CI9A 1YQ2A 3WF2A 3H0CA 4MYSA 4DNOA 5FPPA 4UUQA 3HACA 5D6OA 4B81A 3C45A 5EHZA 4OB6A 3I1IA 5AKKA 4B9AA 4BZZA 1EH5A 2R11A 5EHXA 3F98A 3DYPA 2WUGA 3FHQA 1MT3A 2OGTA 4J0DA 1R50A 4MEAA 1EA5A 1HQDA 4BDTA 5CH5A 4OB8A 5ALWA 1VZ2A 4QX2A 1D7PM 3WKCA 2E33A 3OM8A 3I3BA 3I6MA 1Q0ZA 4Z49A 2JEZA 4FLFA 3W2TA 1UOOA 3T0DA 1XZMA 3PF9A 1UK7A 2LW8A 3C7GA 5AM1A 5LA1A 2NW6A 3G9ZA 4AMZA 2I3DA 3MV11 2J1AA 3O4HA 4FFVA 1XKLA 1J83A 3W9UA 1XZJA 2W1SA 2LS6A 3WKEA 5HK8A 5AK5A 1K6EA 2E32A 4BRSA 5JADA 5IVHA 3THCA 1MX9A 3H1AA 4OUKX 4U2BA 2WLSA 4Q3KA 4ROTA 1OXMA 3T0BA 4BAZA 2BUAA 3PUHA 2HM7A 3C87A 3EYPA 3DKKA 3P6BA 4OZOA 4EY5A 3ILSA 1K45A 3FLAA 4UBKA 5ALRA 2I03A 1E5TA 3DKRA 4ZZ5A 4N5IX 1X2BA 2WU4A
chains in the Genus database with same CATH superfamily
1Y9AA 5IBPA 1QO7A 1ZH6A 1PS0A 1ECJA 2OO3A 5AI5A 3LUGA 4BXSV 5T5JA 4OQPA 1F9EA 1ML3A 2G4IA 5F1OA 1GPKA 3VC3A 3BCSA 1UPUA 1H9PA 2B1IA 4HNGA 4MP8A 4F2DA 3KQRA 1WE2A 2VDPB 4C0BA 2PUTA 2VJPA 3E0QA 2G36A 4FKMA 2Z2IA 2VYCA 3HCPA 3MPPG 2XLAA 2OVBA 3I97A 1VE5A 2BEUB 5CEEA 2BTVC 1D0SA 2X5IB 1G8PA 5B1EA 5LYJA 3UJPA 1ZMBA 1T5TA 1Q3HA 2B1GA 4N9HA 2VHJA 3IJPA 2D62A 2EDCA 2GYUA 3N4MA 1Z88A 4KR0A 3ID6C 5EE3A 4EHKA 5C2JB 3HYCA 4U7GA 3OTHA 5DWVA 1AJEA 2GYWA 3QVGA 1GNYA 4WM8C 1PS8A 5A33B 3NW9A 2ZSUA 3DWEX 3JR3A 3TPCA 5KNBD 4LYAA 1QU2A 1DO0A 2J0VA 2W6ZA 4JDPA 4GQIA 1N2ZA 1UYZA 4DIOA 4R2IA 2OZJA 4L4ZA 4BPBA 3OGSA 4G0UA 3K0HA 3I3DA 2PJUA 1PR5A 1Y1QA 4CMHA 5C3MA 1D1SA 2ZJ4A 2YWEA 1RWPA 3ZLUA 2RK6A 5BOVA 4MUGA 3EA0A 4KDEA 5HP4A 3P5SA 5E7QA 4D98A 1TK3A 4LORA 1KGSA 4W8GA 3LPMA 4AMVA 1K7XB 2C8JA 3IIJA 3ZNNA 3BG5A 4BNNA 4ZYXA 1A1SA 1GLVA 1H4VB 4JDMA 2WUDA 4AQ2A 1G5HA 3H0EA 1PKEA 1Z3CA 3ED5A 4Q3DA 4BFUA 4W1PA 2HKXA 3CRZA 3Q8FA 1ZZ7A 5JYCA 1LUAA 4OHXA 2X5XA 4IIJF 5DHAA 3COVA 4XJSA 3NKVA 3SHQA 4AU1A 1Z73A 4C1NA 1P6UA 1Y3IA 3EIUA 2G63A 4TTTS 1SXJC 1GRRA 1OVMA 1K4MA 1LK5A 2P0AA 1ORRA 1RHKA 4ZO9A 4JOBA 1HO3A 4ZPXA 1JHRA 3RVPA 4M22A 4UPVA 3ND7A 2BFEB 1RACA 5H9PA 1PMHX 1ZH4A 2XD4A 4FEEA 1W47A 5F7JA 3B5EA 3ZWYA 1VIMA 1BW9B 3DHEA 5FZ4A 2W6PA 1YXWA 3FNIA 4XWKA 1A96A 3OPXA 1UL1X 3M1LA 4Y1VA 1YFWA 3BIEA 5DMYA 3LQ2A 4D9MA 3MPUA 3USES 3VPAA 2NADA 2W2VA 4ZAYA 3MLJA 4LBMA 1OXSC 3RFTA 3IJEB 3K09A 3Q1LA 4LXGA 4Z3DA 3EGDB 3LAWA 4RHYA 4TS4A 5FYDA 2XUPA 3U3ZA 3TD6A 2BMVA 1P3DA 1NRIA 1MD9A 2PGJA 4ATFA 4MJ3A 2VCCA 3MGGA 4AF7A 3U0BA 4BP8A 1U3WA 4QX8A 2G40A 2WSMA 3AHHA 4RX1A 3THPA 1YQ5A 3O1JC 4PRYA 1PK6C 3Q9LA 3TQQA 4IIXA 4UC0A 3BI3A 2I6TA 2VKTA 2FSHA 3DMHA 3LTNC 4FYYA 1X9IA 4QTXA 2L2QA 4V38A 5E9WA 2OSVA 5FYHA 2JKZA 4CLRB 1KSHA 1X39A 721PA 4CT0A 4QJ4A 4F21A 4GLJA 3UW3A 2JDUA 5B3JC 2XBO3 5HRAA 3V4ZA 1YB2A 3BE8A 4JJAA 4EGQA 3UICA 2BM9A 2EFGA 3KQHA 5EOVA 3SJAA 1XWWA 3MD0A 1FUUA 3EVCA 1AKTA 3KDAA 2ZUTA 4BUJA 2PHZA 3TSZA 4XILA 4JXKA 3IKMB 2VW0A 3EJKA 5JANA 3D6VA 3DBLB 4OQ9A 2QQ0A 4Q9DA 5E0OA 5AW8A 2TMGA 2Q5JA 3GAMA 5B2FA 1SUDA 2WK1A 3EVFA 1XCPA 1GJRA 2FMYA 4GDFA 2O2IA 2PEZA 3NAQA 1OMOA 3CG0A 4ZZ3A 3TE7A 1FSSA 4QQ2A 1Q8SA 3U60B 1UODA 4FK8A 3C7FA 3U7FB 1PGSA 5FY7A 5JECA 2VTXA 1QAQA 3RAFC 1XAGA 4KQHA 4M7OA 2OAEA 4WZAA 3K35A 3F73A 3ROZA 1LU2A 1N4AA 4D97A 1MR3F 4ND7A 4YV1A 5LU9A 1EFVA 5EFZA 3O8NA 3AFGA 1ZXBA 3RS8A 3BPZA 1JYCA 2NPOA 4UU8A 1UZMA 2EIDA 4JI0B 3ZU3A 3C3VA 4B7EA 4ZT2A 4EZHA 4ZKTB 3B13B 5L51A 5MGNA 2AI3A 3TOSA 1M1YE 1QCZA 2QV0A 5C1DA 1SR8A 2K5UA 2VOVA 3FDZB 2XH6A 5DN6A 4PBPA 2ZK7A 2XDWA 5L3QB 5AVQA 4IV1A 1YR2A 8AT1A 1DDLA 2G77B 2W8BB 2JFWA 4YLEA 1KU0A 1SHLA 2PFWA 2R87A 3DN7A 1RC6A 4D02A 3JVDA 1G60A 4J0KA 1P9NA 4E1VA 2BR3A 2NU6B 4ZYWA 1HNNA 3V80A 3UESA 1QU3A 1XL0A 3U2QA 3UMYA 4U2CA 1QPZA 1QV9A 2AZXA 4IQ4A 4WT7A 2GKSA 3WGMA 3OMLA 1IRIA 4MV9A 3TQIA 4NENA 4A0RA 1IHYA 2WSSD 1XVIA 3EF1A 1RUC3 3CB4A 3AG5A 4JOSA 1RUJ1 2UWCA 5IHXA 4CCMA 3IO5A 2VTFA 4RZ2A 5CHEA 1V35A 1DQ5A 4CM1A 2JDID 3LP8A 5H9SA 1LW7A 2XQGA 2VMDA 2AN9A 2A5FA 3DFUA 4CIVA 4NPRA 4HQNA 1COV2 2GCNA 4FP3A 4P3KA 2IOQA 4HLNA 3KQ4B 2CYCA 5FJJA 3GDOA 1MQTC 3RSCA 4LBQB 1OXCA 1GVHA 4AYTA 1ZU5A 2IYUA 3EHKA 3FDXA 4MPDA 2WFF2 4G5GA 2HB6A 1DQZA 3AR6A 2GHIA 4RVHA 4QQHA 4BLVA 3NOVA 2VU9A 1CLUA 1YI8A 4AJHA 1O8BA 4KL8S 4WUVA 1BVHA 1XOIA 2FDIA 3EWNA 1OH4A 2ZIAA 4C20A 3RC1A 3LK6A 1E2FA 1EUYA 4RR3B 4R40A 1LX7A 3RBZA 1HEUA 1N9ZA 5DGCA 1H4HA 5D3KA 5A6YA 2DQYA 4BMZA 1I1NA 2Q0XA 3KWFA 1ULZA 4PG6A 2VNOA 1ZRSA 3L18A 4RZUA 1W8IA 2JFBA 3NX4A 2JLUA 3OF3A 4LFAB 2CLLB 3OT1A 1AG9A 3ZGYA 2H4FA 1LHVA 2YUTA 3BVPA 1KQOA 1PWZA 1SVIA 3M1HA 2ZABA 4CEHA 2GN9A 2F1HA 4TL8A 3BFKA 4HQ0A 1N5MA 4RABA 2FDRA 4R9VA 4RS5C 3OOEA 2APJA 3P4YA 3EAQA 1H6DA 3C6YA 1RHRA 3AUYA 2GBPA 4OXNA 1NUKA 5T7BA 3ZXAC 2OV1A 2X3YA 1I24A 1PZ8A 1BMFA 1ZMXA 3RD5A 1XNQB 2DQSA 3TG8A 5A3SA 3AJYA 1HLGA 1U28A 4UZEA 2HQ1A 1AUYA 1UZYA 1YZUA 3NEYA 3DB2A 5E1OA 2GU9A 2Q2QA 1R1A3 4GB31 2WD7A 1QP0A 2YFKA 4UUBA 4JLPA 3E5RA 4CIDA 2PQ2A 3HFSA 4CDQC 1Y5IA 5GGXA 3KSRA 1N5RA 1WVMA 2DHQA 4PQFA 4DDHA 3PJFA 4AVYA 2BI8A 3LA7A 3U0VA 3W6ZA 1QP4A 4MUKA 4WESA 1RJ8A 4AZTA 4BLPA 3EDRA 1W5EA 4A8TA 2EFJA 2JCSA 1PZXA 5AH0A 1U0SY 3UW1A 4HWRA 2WPDD 2P4EA 3LBAA 2WO2A 3T3HA 1DGQA 1YF3A 1GFZA 5AMXA 1J7KA 1GN9A 2HJHA 3VR5A 3LL7A 4Q21A 3BGAA 4Y1YA 1YFLA 4OPMA 3ERCA 1GZ4A 3VI4B 4JBIA 4POAA 1F2NA 3I09A 3T5MA 1JDNA 1UJ6A 2W43A 5FWXB 4FFHA 4JC4A 5FWDA 2FJ0A 2VHEA 4GC9A 4YGEA 2V59A 1GZWB 1E59A 1TCCA 1JTVA 2RHBA 2YXEA 1U0TA 3Q8AA 1UFVA 4B6GA 1L5ZA 3JD0A 1KY3A 4F92B 4EW1A 2BRUC 5JPCA 1BCRA 1NWCA 5L4NA 5I9MA 1KDVA 1P1JA 2WA1A 3N2LA 1CY0A 5EJ1B 2REQB 1UQRA 1YQWA 3ZX4A 2CJXA 2C9AA 5JNWA 2WYIA 2G0TA 2GHTA 1UY2A 3VBRA 5LZ7A 4PFKA 1T6XA 2ZWOA 1KK3A 4DTIA 2C07A 4U7PB 3IIKA 2XTAA 4Q9JA 4GYJA 4LDAA 4RY2A 3EODA 1RCFA 1I7NA 3X1MA 3JQRA 1JR3A 3AHJA 3W6UA 1VKZA 4PIZA 4LQDA 5LQSA 4DINB 5EMHA 3ITKA 3MW3A 1KRWA 4YAJA 2RMKA 4WFKA 4CI0B 3QU2A 1AL21 5EPOA 1SXQA 2ZM6B 5ALKA 1D7OA 1G7CA 1YVPA 2QYOA 1CUIA 1GDHA 1RFLA 5A1TA 2QQJA 1UXHA 1XQXA 1WNFA 1IK6A 4INOA 3NWEA 2IXJA 1DWUA 1A2KC 1PNQA 3P9IA 3QTBA 2VCEA 1DF0A 4E7PA 2NXWA 2RMU1 2KW5A 1CAVA 2GMWA 2YXLA 2C2BA 4F56A 5AI4A 2OR3A 4B3BA 1CUZA 4ZHQB 1JVNA 2J1RA 4Q4V2 3I59A 5E9AA 5ANQA 2ZHKA 5THXA 2WBKA 3RRZA 1Q7EA 4UMEA 2WSUA 4EZEA 4PO1A 4RFSB 4OQDA 3CGGA 2ID9A 1M74A 5IAJA 3U4CA 2DUWA 1U8FO 3IIIA 2CV1A 2XT9A 3GFPA 4P32A 2FMXA 3MCTA 2WIKA 3KQSA 3H6KA 3EGCA 3PEFA 2ZRFA 1F35A 5A9SA 3VH3A 1YDMA 3LK7A 5FY0A 2GXUA 3IKJA 3DV0B 4G1MB 1S01A 4B2YA 4JKYA 3UKTA 1W0NA 3PX7A 3P1IA 3EVDA 3HNRA 1C4XA 1L5QA 4NAHA 1OV6A 2WWVD 4V2WA 1PO23 2H8GA 2G9GA 4H0NA 4DCMA 4DFSA 2TMYA 2PWYA 1QS0B 3AFIA 5BSMA 4A7YA 3WD5A 5J4YA 3R0ZA 2G9VA 3KVBA 1E1CA 3EDMA 2B5VA 3WZ2A 3GJXC 2B4QA 3I4IA 5F5IA 1PVC1 2OCYC 4A45A 3VH2A 5HV4A 5ECGC 4FPOB 5F6LB 1T5IA 5HZMA 1DXOA 1R8QA 1YK1A 3FIUA 2B2CA 4EG3A 3ZW8A 1HMPA 4B09A 1KA9H 3U26A 4BHPA 1A3CA 4NIIA 1DJLA 1LOCA 1FOD1 3GGCA 16PKA 1EBUA 2X22A 3OEWA 3KTAB 4RYDA 1QHGA 1R081 2X40A 4KDCA 2B94A 3PE3A 4R9UC 1EPUA 1OI6A 1VYHA 1T1RA 4F8EA 1QDOA 3N0WA 1P6QA 2X15A 3FFQA 2B4AA 4KFSA 2PX8A 3CIFA 3EIQA 2YC0A 4TMTA 3FKQA 2JEMA 4M60A 4EBBA 3HXOA 2YJ3A 2XVZA 2ZSBA 2KD7A 5B2GB 3B3JA 1I9GA 3H16A 5HF8A 4AI3A 1LJ8A 4CKEB 4PSUA 1YB4A 2WM3A 1EWTA 3EGWA 3X43A 4ZYTA 2WR9A 3POSA 5JBQA 3VVLA 4BWVA 1AA9A 5JLJA 4PYIA 5A5FA 3JALB 2E87A 3HK2A 2O1EA 5JWPA 3MGBA 1LZLA 4D0QA 1VQ1A 1ZL0A 4QM9A 5DNWA 3BRQA 2VNKA 2R4UA 4MXVA 1PV2A 1HXS1 2R3SA 1AKWA 1BZYA 2BVNA 1CERA 3SDSA 1HT3A 4N7RA 3FZNA 3U5ZB 2JI9A 4RNDB 3TB4A 3V1YA 1E0JA 4AY6A 2QG9A 5LL6P 2CCGA 1OFUA 2OM2A 2NXNA 2Q0HA 1N5LA 4W65A 2PU7A 3IPCA 2C7PA 4WV3A 2HN9A 1YQ8A 1WCIA 1DL5A 1YI0A 2YXBA 1V5FA 4KN5A 2BFCA 4NYMQ 5HS4A 1F12A 1CBUA 2H2WA 3BMQA 1YS6A 2QUAA 3DPRC 1KI2A 1L5RA 1L3IA 1T9GS 4J75A 1NQUA 3Q98A 4YRIA 4XJWA 2MIIA 3EF3A 2WN3A 4G9EA 3RS3A 3HVUA 2O1WA 3FFWA 1FQJA 1OZHA 4YC7A 4GLLA 3ZNPA 4ANFA 4NBLA 2C2YA 1XXNA 1TJYA 1LTQA 2DZDA 2H8KA 4F6LA 3HR8A 4URTA 3IVAA 1XD2A 2JFNA 2Q2VA 1U1IA 1JUDA 3SC2B 1HRI1 4C90A 2R8YA 1ESZA 4OXIA 1DC6A 2AHRA 2PGIA 1FFBA 3TRHA 3CZ9A 4FP9A 2J3DA 1G5TA 5J47A 3BMCA 3U7QA 1GZ5A 3CLVA 4Y6OA 4IRUB 4AVVA 4X1KB 2ZJ6A 3AP4A 2O3TA 1KXJA 3MYRA 4GPZA 5B2ZA 3AZWA 5JCZA 4HZUB 1WEHA 1JH8A 3GGOA 1ZRFA 4PYKA 3WKBA 2IDMA 2QAIA 2Y99A 2B35A 3QBJA 2XWBB 5LYJB 1S2KA 2RM22 7GPBA 4TLGA 3GZTB 3V1MA 1RZ3A 4DDTA 3RBXA 3MF6A 2C3MA 2QEQA 2H65A 4B4OA 4KWHA 2N7GA 2JE8A 3TLZA 4Y18A 2OECA 4N9QA 3AXTA 4JTNA 1HUQA 5EJ5A 5D1NA 5FTJA 1I1QB 4B32A 2O59A 2ICAA 3S8MA 4DRYA 2A9VA 4J1TC 3VZNA 3MJFA 4Z9FA 1EZ1A 4OBEA 3F8WA 4GNKA 5L40A 5JD4A 1XQ9A 2MSEB 1R9MA 3KD4A 1ZK4A 2A33A 4MXDA 2P4QA 3E9DA 4AJ1A 3IAS6 1WPRA 3V0BB 1HRKA 2P2CA 1NUQA 3SLRA 2IE0A 5G1OA 5NLLA 2E63A 3SVZA 2ZT6A 2NU8A 3ADBA 4PLGA 1DEOA 1RLIA 5A04A 3R7SA 3PT9A 4G1EB 4V3CA 4OA8A 4AXXA 4MB6A 2I4NA 3QVJA 1RXWA 2HMTA 2OT7A 3BPSA 1KI6B 3RWKX 3H99A 4C4OA 4RD0A 3WRWA 3KJNA 1XVUA 2BFEA 1ZBE2 1Q7BA 1BDIA 1PTKA 3DMNA 2DR3A 4JP5A 2VQEB 4JGYA 1Y8ZA 3EAFA 1NBWB 4TL6A 3I01A 2EJUA 4PRKA 1QR2A 2GCOB 2VTVA 1LH0A 4KH0A 5C8CB 3PVEA 1WDKA 1TRHA 1ZJ4A 3LGRA 2G7MC 3EEYA 4CHTA 1ESEA 1QFZA 3U1VA 3FETA 4KIGA 3AMHA 2HC9A 2F90A 4AZSA 5FY4A 1G6HA 1KP2A 2IPXA 1JEAA 1UJBA 1ZKDA 3I3QA 2KWIA 1UMIA 4D9EA 1F7UA 3UWDA 1JR4A 4F3JA 5DBFA 3I1YA 5IVEA 3OOWA 4J9UE 2K2WA 4TRRA 3OEHD 5KNCA 3T0GA 4FE3A 2ZGMA 3ZDDA 1XWIA 2IDKA 3H11B 3BWYA 2PEYA 5KAMA 4YRLA 1RXCA 4B82A 5HXAA 4G4SO 3PDIB 2CF6A 4K6KA 1RQXA 3AX6A 3G9XA 3VOSA 2E18A 5AKLA 1E2UA 2GRUA 1GPDG 4YMWA 1EJ6A 1VIWB 1K9SA 1SA0B 2GFQA 1ZD1A 3WMGA 3P4XA 1YQDA 1XSEA 4I5IA 3GRKA 1W59A 6AT1A 3ZTYA 1KE1A 3SLIA 4PNPA 1NMYA 1A98A 4URVR 2VZSA 1JJIA 4AZ0B 4X41A 1OA1A 1SHUX 4YRTA 3MFYA 2LKDA 5FYVA 2OCXA 3QKRB 5L4SA 4ZDJA 3FRHA 3VNVA 2VTBB 1G41A 2DE0X 3L9JT 2G5CA 2W58A 3WF2A 5FPPA 3B48A 3QOXA 3HJHA 2OD7A 1GG5A 1BHQ1 4ESHA 4XSGA 2PQ6A 4YMUA 2ECKA 1N5OX 2QSUA 3ZY6A 1T0BA 3V0BA 4PNHA 4V0SA 2L69A 3NT4A 5B58T 3F9RA 4IW3B 3FDJA 1JVSA 1XRUA 1W6NA 1GRNA 2DUNA 2UVPA 4BBPA 2O8DB 2J0QA 2WWFA 2P7IA 3BIFA 1SZJG 4TWAA 1YCHA 4DLAA 3IPVB 4KU4A 2FQYA 4G9SB 2AE1A 3JYOA 4PRLA 3ZHOA 1J2UA 3TYXA 4OSPA 1BXRA 2Y1WA 2NSLA 3WGVA 4G4FA 4ZS3A 4WKCA 4LF6B 3ZDRA 3RAGA 5CG2A 2PXAA 4J0FA 1OKOA 4ZZ5A 3BTXA 1X2BA 4LOJA 3AL0C 3QKSA 2QUKA 4LTAA 3G9TA 3NHKA 1W5FA 1OLXB 3DAPA 1YKSA 2BT4A 5LA6A 1AUVA 2F43B 3E5XA 2CMDA 4G3XA 1NZCA 2HCRA 1ZBDA 3KVRA 5F3RA 5C1OA 4OQFA 1LVGA 3VKUA 2OFFA 4FHGA 2ZQ5A 4UYBA 4WD3A 2AMJA 2O2DA 5DRYA 3NMBA 5CISA 3WDVA 1SKQA 1VL5A 5KC5A 1N2IA 1U3CA 3KC2A 3VC2A 2QMHA 6REQA 5ALEA 4GSKA 3DUIA 4JX9A 4P5DA 1UXIA 4ITCA 4LBYA 5ABPA 1QF7A 4EKGA 4BV8A 5K3BA 3IFSA 3GEMA 3FUWA 1KIFA 2CVZA 4UU0A 1DYPA 3ZV5A 3K1ZA 4XOIA 1V6AA 5FBLB 4ZYZA 5FULA 4BFVA 2XAUA 1JLKA 4HAYA 1PDWA 4B4WA 3BFJA 4IIFA 1EUZA 4TMWA 1JRLA 3CXRA 3C3CA 4CPDA 4QUAA 4HXCA 3VR1A 3T94A 4E27A 4LJRA 3FSEA 2WZR1 1PVOA 3RASA 3RS2A 3L7MA 1U9CA 5AO9A 5DJ5A 3A1UA 4GXTA 4JUDX 1CZHA 4DQUA 3RYHB 4L9BA 3H5LA 2R84A 4BMPB 4A0FA 4FDTA 3U3MA 3QXSA 2FPGB 3DEAA 2IH4A 1P4RA 1QOZA 2IU6A 4D74A 2JD0A 4WOPA 4TVOA 1F8GA 3PQDA 3BRWD 3HP4A 3PNMA 4KBBA 5ESDA 2Q0SA 3EA5A 2B1JA 3AM4A 1W0JD 3K2BA 1JOPA 2ATCA 2GD1O 3O31A 4W1RA 5GZ6A 3BYWA 4XURA 2A59A 4LXLA 5KJ1A 3SZUA 3OIFA 3OUZA 4NCJA 1FX0B 1O59A 4L2IB 3L0IB 1WXHA 2NYAA 1N2OA 1IHUA 1D3AA 1C9JA 1W9HA 3O91A 2JANA 1OB2A 2IFWA 1SIBE 2P77A 5ERLA 1I7LA 4GKVA 3HCFA 4WXEA 1DZRA 3QF7A 1XHFA 2E7TA 3AETB 4J7XA 1Y8CA 1XYNA 2IZ1A 3CJIC 3ZXUB 1W49A 2VUIB 2WJAA 3PUKA 5HF6A 3PFGA 3HIFA 2XNKA 1AO3A 1J1UA 4GH4B 5E7JA 3BXFA 2X4IA 2WWTA 5HCBA 2WWWA 3A9TA 2V7GA 3THTA 4HLUC 3MQ2A 3H42B 3T08A 3V0AA 1PZGA 2UXCB 3JD72 5LLSA 4R51A 4UW6A 2J4DA 2NT3A 3QMVA 5EJ4A 4FHEA 4AI2A 4RHEA 4JYAB 3H7IA 1G7YA 2DFNA 4AO7A 1MB4A 1MJ5A 4PSVA 4AO8A 4HO1X 2O5EA 4RA9B 2P69A 1CY1A 3BZBA 2CNBA 4UUNA 1FDTA 1G66A 1GPUA 5J43A 5GZEA 3OJFA 3AR7A 2M9MA 3T52A 2IUSA 4ZI5A 5AICA 2IUWA 1VKOA 2DWRA 4OI4A 2HGZA 5DM70 1TVMA 4GHWA 4B3TB 1AR93 3AEQA 2NUAA 1HKDA 1WCSA 3N7AA 1RQ7A 4IEEA 2X9QA 4X66B 2VMEA 4GWNA 2DXIA 4KPFC 3NJYA 4C9BA 3B1JA 3VR6H 4WH0A 5AOAA 3MCZA 5JLVA 3K0CA 4MUNA 5JSYA 5GP1A 1QY4A 2JICA 2ACWA 4YCDA 3EWAA 5TF0A 3RREA 3MTGA 4JB2A 5LZ4A 1AS0A 5GINE 1I0LA 3IP5A 4IHJA 2WVGA 4O3FA 1D0IA 2XNCA 4UQOA 2Q6TA 3LIPA 3THXA 3QLUC 3NJ8A 1NRXA 1NXWA 2VYVA 3PRJA 5LQJA 3LIHA 5GLTA 5FUXA 3VDQA 4M98A 1XU1A 4CLHA 2PGXA 1NN0A 3DECA 3SKXA 2ZYIA 1DKQA 1AF9A 4NYIR 4OGKA 3SC6A 4WKOA 1FS5A 3SX0A 5LBUA 2JIOA 4KWLA 4QC2A 4EW2A 1VMAA 1YRYE 4HK8A 4HQ6A 1QC5A 2N47A 2VNRA 3D5EA 4N8SA 1HDIA 2H0BA 5B37A 3E6CC 3B7MA 4FFRA 2BV3A 1Y4DE 1E79A 4KPUA 3RIYA 2BKXA 4GH4C 4IZOA 3DT9A 1OYVA 1WW4A 3IIAA 3RQSA 3SYNA 1NY6A 1USUA 1RAIA 3IE2A 4I19A 1BVYF 2VWGA 3V4SA 3EVAA 4F7WA 2PUHA 2CHFA 3LMKA 2ZKLA 4LRSB 5GWXA 2C9OA 1I2CA 1J3PA 5CB7A 3EZFA 2FP3A 4JL6A 2AYHA 2CKDA 3KT3A 1L7QA 4M0EA 4JLBA 3MBIA 2CLEB 1A95A 4KHPB 1E2MA 5CTJA 3LDUA 4YMLA 1UPTA 1T4GA 1JODA 2JKBA 3FWKA 3BE6A 1JFSA 1VZ3A 2ZT5A 4QXRA 5C35A 4QT0A 1KWGA 4GA9A 4TT8A 2HADA 5EIXA 4OI2A 3KCQA 5DN6D 3GJ6A 1B6RA 2I67A 1JFFA 3EDQA 5FQ0B 1VP3A 4LDQA 4JUBA 2IBMA 3B1YA 1AMNA 1NDQA 4BQRA 3JZVA 4KWCA 2Y05A 1ONAA 2ZYHA 5IARA 4QD2A 1Y9DA 3KD3A 2V6GA 3MRSA 2ZROA 2WB2A 1S96A 2IX3A 3ADDA 4N76A 3G0OA 1E2DA 2VVTA 5C8VA 3JALA 2JDKA 3Q8BA 1ONSA 4LPSA 3PNQA 2J9XB 3QWBA 3HDGA 4CCLA 4KNCA 3WGIA 3H04A 5IVDA 4DUGD 3HVDA 2ZS7A 4QARA 2QS9A 1MZFA 3B2NA 1QH1B 1GYKA 4YREA 4PQQA 2CYAA 4IO1A 3KYDB 3FUVA 4MW4A 4D4GA 3SH3A 2W71A 1EUCA 3PNBA 2GP5A 3BBPA 2AKAB 4HZFA 4OI1A 3B6EA 5DI3B 5D8AB 3AJ8A 4CGYA 3QWIA 1NBEA 3AF6A 4RH0A 1CJKC 3GRYA 1JLMA 3RSGA 1V5EA 1XROA 2F9MA 5CXQA 4JLOA 3RUHA 2YHSA 1V70A 2EXXA 1V2HE 2EZTA 4EA6A 2ZRKA 5GADl 3SEPA 1KZ6A 5A5GA 4FPYA 4TYQA 4DF3A 1A04A 1L5WA 4IGPA 1FV3A 2X0JA 1I8TA 3O3MB 3VYVA 1JYXA 4IH1A 3VTZA 4CCOA 2DCZA 2GZHA 3BCWA 2PAMA 4TRJA 1O6FA 3REQB 3H7YA 4J29A 2WRAA 1PX3A 3M6VA 4XZUG 3UH1A 4YV2A 4EVRA 3QFTA 2GBCA 1EYBA 5KWSA 4NZNA 5IT5A 5ALNA 2X86A 4NV3A 5TLSA 3VU1A 4CTNA 1TEXA 4A0HA 4BQ4A 3BXZA 2XQVA 4M00A 2CGPA 4NMXB 5CIQA 3PK0A 4YN3A 4DLZA 3GYBA 4RSUA 4LYJA 5CVJA 1PO11 1UWLA 3YASA 1Y3HA 4TLBA 3U1BA 3PR3A 1QIJA 3AF3A 1ENXA 2K9ZA 4CMBA 1QHNA 4AS2A 4TTJA 2BGUA 3DNMA 1Y89A 4MW9A 3E6BA 3H05A 1KOLA 4XYMA 3RLIA 1P2BA 2V7WA 1S2OA 5FZDA 4PTLA 1Z4KA 3M6UA 4P53A 3E3MA 4Q47A 1QWSA 1Z16A 3I76A 2VRBA 3KOXA 3MWEA 2YCBA 1L9KA 4V0ME 1RNLA 1YVEI 2GEDA 3LEKA 1GDTA 4B29A 2ORWA 5IWCA 3WR0A 4YUAA 3VSAA 5TT0A 1D2NA 3AVSA 5LY2A 3ZHVA 5CJJA 3CBQA 4OHYA 2A3RA 5T50A 4LKRA 1NNSA 4BO1A 3WVJA 3QEKA 4OJMX 3M6LA 3VPFA 1XQ6A 1ODSA 1WLYA 5BV8A 2FMHA 2WP0A 3HKDA 1M2EA 4XQDA 2MJLA 2JRCA 1ZH2A 2E0IA 3FCCA 2RKBA 4U9HS 1W4BA 3VBOC 4C5AA 3E7PA 5T6MA 1YA6A 1DRWA 3CN7A 1F51E 3BWBA 3P1JA 4HQLA 4KR2A 2IODA 4U63A 3E6DA 1B93A 3V7NA 3RVQA 1UW8A 5DTEA 2LTNA 1OZ0A 1E2PA 5ER9A 1F8XA 2HBUA 4HBGA 2E82A 4BZ4A 1E2LA 1F1BA 1TDJA 3LZ6A 4Y1GA 2Q28A 2XDYA 2A7QA 1ZS9A 3VHPA 4QU5A 5JCXA 3NRJA 2ODQA 4YY3B 1JEYA 3DJFA 4YBRA 3FOEC 4K9SA 1JAXA 1UPCA 2PMFA 1OAAA 1M8GA 3WVNA 1FP7A 2ZCWA 5TMEA 3OFVA 2HWC3 2YV5A 3OD4A 3K6RA 1APNA 1CZOA 3GBGA 2JAQA 3LQ1A 3ND6A 3P71T 1WW2A 1COWD 3AZOA 3KQWA 5J98B 3EG9A 3KSMA 4YLYA 3OQOA 3HBKA 3J9SA 4KQKA 2ZR8A 3TZ6A 3PCRB 4KOAA 4C0LA 1PJ4A 2H4WA 1W9WA 1RQGA 5IT9A 1A9ZA 1JG6A 5BQXA 4MV0A 1YJKA 4LTNA 1XI2A 1KARA 3I9V6 3W5JA 4B9EA 1XD2B 1P8JA 4KITB 5AM3A 2OT3B 3E7WA 3COYA 2QRJA 2Y6KA 4XWYA 2YWBA 3CPJB 4K03A 3OG2A 3SYTA 5DPMA 4XXAA 2F64A 4KQ9A 5EEGA 4CYDA 1VHQA 4M83A 4OYUA 4J6FA 5BWMA 3DHYA 4PZCA 5K0UC 4ZXPA 2ZEYA 5LNK1 3WMEA 3ES1A 1U0LA 3CE6A 1C3OB 3T7DA 3MQFA 1RRKA 1DB3A 3OZVA 1GQHA 4BNDB 1VLQA 2Q41A 3KYCA 1EHYA 5SYMA 1BQ3A 1Z7S1 4FHZA 4GSLA 3HVJA 3LGXA 3SXPA 1UP4A 3UMFA 1IAVA 1TM2A 3ZYGA 2NO9A 3AB7A 3MJTA 2CNWA 3GUYA 5TC4A 1JT2A 2QJRA 2CCKA 1PIV1 3Q2IA 4QOSA 5DW0A 3I28A 3CLKA 3U6BA 3G8CA 1BDMA 4KRFA 1D4M1 2WILA 2Q8NA 3VMFA 2DBYA 1C1YA 1FDRA 3WLNA 4C0WA 3QXCA 2BGWA 1YASA 4CUKA 1UDCA 5JASA 2LE0A 2ZRAA 1Y3BE 2ZYAA 3DE0X 4PO9A 1CULC 5FP4A 2Z1NA 4OYHA 1M75A 1Z0HA 3VPCA 5ERYA 3NHZA 4Q1FA 2P2SA 4ZCRA 2Y3IA 3JQAD 3DZIA 1RVF2 4AN1A 3AJAA 1NYWA 2I3ZA 4Y20B 4WM7C 2WHPB 2C04A 4DR7B 1ZVJA 3CTPA 5JCPA 2NVOA 2ZYGA 3Q7QA 3LUPA 4OM8A 1RP7A 3PFKA 2ZAHA 3WP4A 4DE5A 4B3DA 3ESXA 3UJ6A 4L2IA 3BS4A 5A70A 4O4JA 4Y5SA 3PGMA 3AM2A 3CY6A 1JHDA 3AKTA 4P08A 2MOKA 1C30A 4O4HB 4ZJZA 4XABA 4D6PA 1RAEA 4AVCA 4BMDA 3T3NA 3ACFA 3TOJA 1EUCB 1ZGBA 1T1IA 2A73B 3GHMA 1YQXA 2ZU6A 3A6LA 4EMBA 1ECLA 4O08A 3THYA 1AN0A 4RZSA 4IUYA 4F11A 2JJ2D 4AKIA 3HUEA 3R6WA 3PVSA 4JQCA 1NV8A 3HVKA 4BHTA 4EF5A 5IDVA 3JTEA 3U11A 2I7XA 1O97C 5JNVA 2BN4A 1P77A 1ZGGA 5GZFA 2A0XA 3O83A 2JHAA 1IS5A 2DYKA 4MVJD 4GWIA 4IL7A 2FHRA 4REQA 4NG5A 5HCAA 3LE0A 3SNKA 4AECA 3IKWA 1WLCA 3DT6A 4D5GA 2IPLA 2HAEA 1OMIA 3SYMA 2XJQA 4EOGA 3VBFA 3GLIE 2J59A 4EEXA 1E2EA 3NHWA 2OXTA 3E0XA 3UBMA 3GIWA 1XC7A 4POOA 3CUSA 4F93B 4A6XA 1XJ0A 1SXJA 1G1AA 1RWBA 3B38A 4P6VF 2REBA 4J0CA 1N77A 3ZXSA 1GV9A 1GP5A 1XCMA 2ZRPA 3NUGA 1HZZA 3ZD6A 1ETHA 1JIIA 3DOEA 5LP1A 3LXRA 2Q1WA 5EQFA 3VZCA 2QRNA 4QZVA 4LUKA 4PAWA 3RAPR 5JSKA 3B93A 4M9CA 1KMHA 4QQNA 4RD7A 4BQFA 2G1AA 4ITRC 2X0RA 2OQVA 4DABA 1KJYA 3KV5A 4ZZIA 1E5RA 1LTHR 4WA8A 4N18A 3GFVA 1H22A 1SVKA 2HXSA 8GPBA 3S81A 3QKUA 4QBIA 4P0PB 4F38A 2PBFA 4K6CA 2XXAB 3IEKA 3CRVA 3H1GA 1JR3D 3X1KA 1P2GA 5E16A 2BNMA 1LDEA 2PT9A 3BEDA 1RWWA 3ZFGA 4FPHA 1RAHA 2YFUA 2D1FA 3G2NA 4ARZB 4ARSA 5FAXA 1NA1C 1M1YB 3WZ1A 2YOHA 3OOHA 2RS11 2XH8A 2OXEA 2I2CA 4FO9A 3VN4A 1RMQA 2DPYA 3C0KA 3D7NA 3TZBA 3G0DA 4M7RA 4PTZA 3LY8A 4M9XA 1V9U2 5ALGA 2UYHA 1PYGA 3L7CA 3KL2A 3FXAA 4AXOA 4LYEA 1EFDN 2X77A 3L8FA 5DLDA 4KO4S 3WOHA 4LFCB 3ZFFC 1N57A 5LB4A 1O6UA 2Y71A 4HEA6 1MQTB 2P3KA 2HMUA 1DNPA 4F6CA 5AW7A 1YIOA 4FFWA 4LRXA 1CAXA 3V1LA 2VVEA 3GRPA 3EW9A 5KTRA 1E4EA 4EUEA 1MRSA 4GP9A 2PMWB 4HX9A 4NH4A 2QQLA 4YO7A 4L28A 5LZ2A 2BBSA 2HWC2 3MINB 1XX6A 2CFTA 1ZVKA 1BCRB 4N6OA 4NATA 3QNWA 1W5SA 1UK9A 2AOUB 3CXUA 1LDNA 4MHOA 5CKQA 2Y34A 5FUYA 1W76A 4E08A 3ET5A 1I6LA 2BZ1A 4NDZA 1D6NA 4Q02A 4NU8X 5HFNA 1V48A 4QPPA 5ANNA 2XGMA 2J1UA 4LNAA 1KDKA 3W3ZB 4E4TA 2D54A 2NMNA 2RGNC 3NM5A 2QTAA 4QTUB 1TMF3 5B6JA 2EKQA 4QRIA 1OXVA 1JG4A 4TMYA 2ATFA 3KQNA 5LZ8A 1L1RA 2F8SA 3EPLA 5I7AA 2WYUA 4I8DA 3I8XA 1LRLA 1SNYA 4A8JC 2QPOA 4FQ5A 4IQPA 2OD9A 1M83A 2GBLC 1Q1GA 1CVIA 4ARUA 4FU0A 5JO0A 1CEEA 1AYN1 5CGZA 1DC8A 3EZNA 4LRWA 1NAEA 1OFIA 2QQIA 2Y9MB 5A32B 1WCUA 3TTSA 3NFYA 1VMDA 2ZGTA 1N7GA 1V6OA 5H68A 3VU3A 3MIGA 2YICA 1Z4OA 4R81A 2JASA 3E05A 3DBRA 2DG2A 4DCSA 2XA1A 1MO3A 1REFA 1RUC2 2X3FA 1UWCA 5FTNA 2QE6A 5A80A 3I59B 3JD73 4NJMB 3WG3A 4N43C 3IESA 1IEQA 5AR1A 3BL8A 4F9EA 3TN92 4XVUA 3IIEA 4HYYA 3I3OA 2TNFA 1CD3G 4H6VA 4EF4A 1MAVA 1S02A 1UWKA 2HO5A 1T3GA 1V00A 121PA 1PL6A 4EWEA 4MVJA 5DUUA 1XAIA 1Y9MA 3NO8A 3N28A 1RKXA 2I0FA 3DVSX 3S2GA 4YCJA 5L3QA 3C74A 3P0JA 3L92A 2ONKA 1PR4A 5G0VA 1U94A 3C5WP 4CCKA 3CZAA 3NGLA 4CKWB 3NHAA 1W6PB 2WFLB 2CLHB 2AWNA 2BJSA 4EIWA 4YJFA 2PUEA 1E9VA 3IBFA 3R8CA 1ECGA 1P5FA 4E2ZA 4CGZA 2XRYA 2CHHA 1XCBA 3VDNB 2BZSA 4H59A 1CS0B 4V0RA 1AL23 2G5TA 3VPSA 2C0CA 3KMHA 1WJGA 1VMEA 1QORA 1G9CA 1CJDA 1XLVA 2LUOA 1UU4A 4F96A 4BTVA 3UKOA 4BEJA 5I8SA 2JFZA 4RK0A 1WW8A 3AEUB 3MILA 1UDAA 2XHZA 2HR1A 3W5UA 4UOJA 1XJQA 3LPGA 4JD5A 5L8VA 4C7KA 3R7NA 2LZ0A 5FZAA 4AJLA 3PHBE 1T2CA 1HQCA 3GLGE 5I0DA 2H52A 2D2XA 3ELDA 1JJFA 1OQDA 3HPNA 3HU3A 4YZ4A 2FW0A 4AIIA 3WEZA 2GO1A 3RBAA 1YTUA 2POCA 4QFDA 2P3SA 3VBRB 2R2AA 4Y7DA 3D3WB 1QVWA 1RWXA 4PDWA 1KNXA 4A27A 1QJZA 4INDA 3ZYRA 3KTDA 2QRKA 3O2JA 1M6WA 3MJRA 1GWKA 3KPYA 1KRHA 3C8UA 4ZPIA 4O6VA 3U07A 5FL3A 1HJGA 1O5UA 1MT3A 4CF3A 1DQ2A 3II6X 1Z75A 4G0PA 4M0KA 1KEEA 2B8NA 1Y42X 3JWJA 3AKYA 3FLMA 4BDTA 2GWRA 3IBYA 3ZZ1A 1ND3C 3ZHCA 1GGEA 1R8JA 4AQYB 3JQDA 1VBD2 1PGJA 1J70A 5A7PA 1N2SA 1JJAA 1XE8A 4BNMA 4WZZA 5DN9A 5K8CA 4LZNA 4MRVA 2OFWA 3HM2A 4QTYA 4CXXA 4RZQA 1K6EA 3PPXA 3HDVA 3QQ5A 2XMLA 2R30A 5LWQA 2NAFA 5BNZA 4CTMA 5AXAA 4CMCA 1J49A 3F95A 2DV9A 5HBAA 4JNKA 3UBTA 3UT5B 4GICA 4TVSA 3RO7A 2DWOA 4LUMA 2WQ6A 4CM9A 1F2TA 5TQ2B 4RCYA 3GH1A 4O4IA 2BY4A 1J5PA 4U1RA 4XPIB 5JWHA 1CIVA 3A3KA 5F9MA 3RUAA 5FZEA 1LGNA 3CCBA 4FGKA 4I6JA 3BFXA 5K0JA 2HY7A 1U3GA 3WF1A 2YC4A 2PAKA 1QNLA 2YNMD 4Z3KA 3S7TA 5CXUA 1ZA1A 1XPOA 3C7EA 3F3SA 1L7AA 1BE8A 5AXDA 4C3OB 5C7OO 3CH5A 4I14A 5IK7A 3PF8A 4CKBA 5KYUB 1GG9A 5BNWA 2VP9A 1QIEA 2RS53 2AF3C 3P19A 1L7LA 5EXXA 1ZN7A 4PXSA 3PVOA 3M34A 2NU9A 3EZGA 3CH6A 5B53A 2JI4A 4R05A 4UW4A 3E27A 3GM8A 1H6YA 4D94A 5AI0A 1W52X 4CXYA 1PWYE 3OJCA 5G4LA 1F5JA 4LO5B 3WDTA 4R1OA 3UNXA 3O4VA 5EKTA 1Q50A 4AI6A 1TG7A 1ZGZA 5F3IA 4CMIB 1P1RA 3R6DA 1P9LA 2O8BB 1ZHHA 2H9IA 4KYIB 2JDIA 4C6TA 2JIZD 4EWAA 1EKXA 4IUCS 2JFPA 4YGXB 3L1HA 3Q7IA 5AJWA 1RJ9B 3DM5A 2MNGA 2WWYA 3SI7A 2W68A 3RQIA 4XJ9A 3PUIA 3OY7A 3U7GA 3IB3A 1W99A 3LDGA 3R7BA 4Q9HA 2J3JA 4FYJA 4QUDA 4MVXA 4WJZA 1JYTA 2ATEA 3GBSA 3WY6A 3SIPA 5CFPA 1BXGB 1OFNA 4COYA 1W0OA 3QYFA 4RYLA 3EGOA 4MGZE 1XPRA 1E1DA 4BFXA 2K2SA 1UR5A 3EASA 4KWJA 1ZQ1A 1R0KA 1R88A 1PUJA 1U0BB 3V56A 4IX1A 1D4M2 3WT3A 1JX6A 4H0CA 2D13A 3RIHA 4Q37A 4RHV1 2VLIA 1NA1B 5K0LA 4HP8A 1CZUA 2D5CA 1W25A 3MMNA 3UJ7A 3SDBA 5E1RA 1AUPA 4MO9A 3WGZA 3CCFA 2KLHA 4MKZA 2PUJA 4FW8A 5T57A 3OQ6A 4MIKA 1RD4A 5BW4A 5BYKA 3RRNA 4CBVA 4YQEA 1N1MA 1T3TA 1NVVR 2AMLA 2PH3A 5T67A 3BVCA 4RVUA 4RK7A 3GUZA 3M3QA 2OHHA 1ID8A 1IDN1 4PWZA 1EP3B 2CK3D 3SLKA 2E85A 2OBXA 3A70A 4MQFB 5FZGA 2HSEA 1TTTA 1I6KA 1GTL1 2HGSA 3SZLA 4FHFA 2VAUA 4KAJA 1G59A 2YWGA 5FYIA 3H2BA 4F97A 3ZGLA 4Q34A 2GNBA 4HONA 4BNLA 2QXYA 3LKBA 3EPPA 4M8SA 4QBFA 3VVBA 1EWQA 5D3MB 1F6WA 3AILA 2B7YA 2EYQA 4Y33A 3OZTA 4J94A 4CDNA 1P0QA 2ZPXA 1GOTA 4L16A 1FUEA 3PJEA 1DSSG 1IHMA 3ZDZB 2XIJA 3PCXA 1ZONA 2J9FB 3MT7A 3U3OA 2A1TR 2PLV2 2M32A 5TGTA 3EZYA 2FZVA 1ZL2A 3CMMA 3NTOA 3D2CA 2G67A 4AG6A 1FVHA 4MUVA 3L0PA 3FWYA 5BN5B 4BO7A 4Q1PA 3STXA 4J16C 3TGLA 2RHDA 3HDJA 1H8HD 2XQIA 1U2PA 4PHCA 1HB2A 3B6KA 3S2YA 1F7VA 5B55A 4BPRA 1DGRN 3N7KA 3EZLA 3H5OA 1ADFA 3UT6A 1KH2A 4H4EA 4UBLA 4WXYB 1X7DA 4QQKA 5IYYA 2DJIA 2Q1MA 2HUNA 5G1NA 3E58A 2IC1A 2H4ZA 1E3IA 5JSHA 1KI9A 1WTCA 1UKAA 1W85A 3TBFA 3PX3A 2VQUA 3LUAA 4R4XA 2MSNA 3DVAB 4BC0A 5AESA 3B6MA 4WMLA 2VWQA 5I7UA 3GMIA 4Z86A 3EY4A 4CEHB 3J26N 3WNXA 3HJCA 5KTKA 1AE1A 3H1BA 4HKOA 4XFBA 2WKKA 3D9QX 4E4RA 2O2ZA 1ZD9A 4UUOA 1WMDA 3TW8A 4W8HA 4Z4QA 5HQ3B 1QM5A 5E89A 3VBSB 1RVF3 1JIJA 3OZEA 2LPMA 3NHJA 1VJ0A 1SBDA 1RAAA 1V9U1 4U6SA 1EP2B 4EPXA 4JVSB 1KKLA 4MS4A 3AMNA 3OQJA 4JHZA 1ZOIA 1GZSA 4CIBA 4EB6B 3AC0A 5DNYB 3X1XA 3U1TA 2Q2WA 1WPGA 4LHZA 3ENVA 4DRXB 3GGJA 2Z3WA 2I65A 1VG8A 3OQVA 1TRKA 1IXSB 1TGYA 2JJQA 1M2KA 4MUHA 1A7UA 1YUDA 2OHVA 5IK5A 3L04A 2VK8A 3GN1A 5LIPA 3N0RA 4ZICA 2J1EA 1CIYA 1JJBA 2G9RA 1GPNA 1Z74A 1DKMA 4CL2A 5EJEA 3CW8X 2IGBA 2AG1A 5KHHA 2Z8YM 4ZS2A 2B0CA 3HO1A 1E6LA 4MPRA 2Z08A 4TKMA 2XL9A 3RYKA 5EWLB 4NXMB 1I36A 4CCYB 2IFRA 1COV1 4O4HF 4YW6A 3Q8EA 1AXRA 3RK0A 3FCXA 1THGA 2BHSA 3LDHA 1VPLA 2XCUA 1GTZA 4NRDA 3CGWA 5IVIA 3O12A 4CFYA 5JSUA 1Y1SA 2B25A 2XY4A 4WM7A 4CDQA 3WISA 2ZEXA 1CE8A 3K8YA 3RYPA 1TYBE 4I1SA 5IEBA 1QK4A 2HEIA 3OWXA 4IXLA 4ER5A 2PH5A 3S2FA 3UKNA 3A6PC 3HZZA 3AU9A 3USSA 3E9QA 1L4HA 4W63A 3DYMA 1J06A 3T09A 1SCUB 2WWHA 3LH5A 5HM6A 5DG1A 5AW0A 2XWJB 3UTCA 4CG2A 3GLIA 2I9KA 1TYCA 5K6AC 2RGYA 2R2GA 5LQCA 3LHKA 3W5IA 2UZ1B 3ZR4B 5DULA 1SCJA 3CH7A 2IWRA 1FRQA 5A7OA 1PF7E 5ALVA 1WZCA 5T3YA 3UT5A 1ISSA 2NUPB 5KVAA 1VIVA 1XZDA 2QENA 3VNUA 1NAHA 5BWOA 4RQPC 4QB1A 4HAOA 2XWBF 3PI6A 3MF4A 3M5CA 4K28A 4QUEA 2GKGA 3ZWDA 5F76A 5JUVA 1HYQA 3RODA 2QW0X 4R2MA 1CAXB 2X8AA 3AVRA 1EWYA 2Q1ZB 4X6LA 1IS4A 1VCNA 5KNDA 1IZZA 3Q5EA 3FOZA 5CVEA 2GCIA 3M3IA 3TUJC 3SC3A 3ZPOA 3ETDA 4RZIA 2C5DA 5FWNA 5KOHB 4LTMA 1XRLA 2QPTA 3RVHA 1V7ZA 9MHTA 2VPYA 3VBRC 4KG8A 5EG5A 1T3LA 3BUSA 3PR1A 3K8QA 1Y3FE 4N53C 1PR1A 2Y0IA 3RYCA 2J5XA 1ZBQA 2V7PA 4YNBA 2A86A 3PNYA 4EMTA 1CAVB 1VALA 2MEV3 4YO8A 5FV7A 1UZVA 3L7OA 3PSAA 5EMKA 2BZDA 2H7CA 1V11A 5BN1A 4MRAA 1XNHA 3ONEA 1KF0A 2UYCA 2EEZA 4IAOA 1JI6A 2GF9A 4Y2HA 2P41A 5TQ2A 5ITZB 2RHTA 1A2OA 1P1IA 2J22A 2JGMA 5BNTA 3LZZA 4F2HA 1CUBA 2ANBA 1P9OA 4YRNA 3HQUA 4XIJA 1T5HX 1XTZA 5CVRA 1AKQA 4ZQIA 3T3YA 4MV1A 3MZHA 4DA0A 2QBYA 1T0JB 4TL7A 3LRTA 4LE1A 1NJ2A 5CPBA 4BJ3A 1K7EB 2KM1A 4G5HA 4TYYA 5M0TA 1HRV2 4CLOB 2D0OB 4JQRA 3ZSKA 4IV3C 1W3VA 2V6JA 1G4AE 5AVJA 1OXBB 1ZJJA 1YRBA 4YS6A 3CJIB 5FPHA 5H02A 1YJXA 4LMFA 1FOD3 1ZSVA 1NE4A 2WR8A 3WIOA 5DDJ1 3LPCA 2A6VA 2XUMA 5HWSA 3V3TA 3PXUA 4H7FA 2OCAA 2ZRNA 2A9RA 3NPMA 4PCAA 4R1TA 1S0UA 5CW1A 5AVSA 1MB2A 1DZIA 5A71A 1HL7A 2G0AA 1QRDA 2WS91 3ORQA 3LT1A 3WL5A 4MKXA 2EWVA 4WJKB 1TQ2A 4HEQA 4XIOA 1EM8A 5JJKA 2Q99A 4FSXA 1KI1A 4LBZA 5LBEA 2HPZA 3VXKA 3CS3A 1G3MA 621PA 4RZXA 1AK9A 4UM9B 3JR7A 4NARA 1EJ0A 3ODGA 4TYNA 1XXHB 4G8JA 4UVIA 3CRW1 4RBNA 1TF5A 3MIZA 3PI7A 2QJWA 4KE8A 3K2OA 1IG3A 4RLQA 4DXRA 4W4TA 1PJ2A 2FJUA 2AC2A 4BB0A 3ZOIA 4EF6A 1JW9B 1SLLA 4S1OA 2XHKA 4ENVA 1PJTA 4CUJA 3KR1A 1HYBA 5B3KA 5CMLA 4JN6B 3IUMA 4KRYA 1XZPA 1YKGA 1U7WA 4B2IA 2B42B 4WPGA 2Y0CA 3NBQA 5T4BA 1Y5NA 4PQYA 4B8WA 5KYWA 2I3GA 4HWSA 3DWIA 2ZXEA 2C4WA 3O90A 2VO1A 1U2DA 1XL1A 4O4IF 5PGMA 2H1HA 3JVVA 3LCMA 1OPRA 2BDRA 4MADA 1S3FA 3RYFB 2VCMA 4Y2RA 3A3NA 1X15A 2E7QA 4Y1FA 4C4XA 2ZAGA 5GJBA 1LENA 3I8OA 1QVRA 2YS6A 4XVQA 3M70A 1DT3A 1YH3A 3D7MA 1YOVA 3WIUA 2XXZA 3IOMA 5AUOB 1F6BA 5GLWA 5J2TB 1U7XA 2NSDA 3IAHA 1BBT1 3CRRA 3SG0A 1QVZA 4NPCA 4HQRA 4Q7JB 3N9OA 4MYHA 1DE0A 5BUQA 1XEWY 4P4LA 1HLPA 4DYDA 3OT4A 1RJ9A 4NRPA 2A88A 2J42A 4QUBA 2GA9A 1U4OA 4FCAA 2VBIA 5DBGA 5EP3A 4P93A 2Z69A 3IVCA 4M1YA 1KBQA 4LNUA 1L4LA 3S7ZA 5JNSA 1AKYA 3T54A 4YV7A 5FZOB 5JI3E 3HEBA 3TWIA 2WHPA 4OYLA 3AP3A 5JSOA 2B92A 5GONA 4YV0A 2ISSD 3GJ5A 2HLEA 2D1SA 3NAPA 3QVGB 2J9YB 3D8NA 4EO4A 1N7HA 4INAA 2O20A 3U3KA 1PFQA 5FIXA 5FJKA 1AV7A 1PGPA 1M8PA 4ZEVA 1UDXA 4OEHA 1SBIA 1AJOA 2ZYTX 3R4VA 4PPYA 1Q1AA 5KNCD 3F6RA 3ISVA 1Q3EA 4TLCA 3UG7A 1THZA 4M53A 1D4VB 4OP3A 2XR1A 4LXTA 1QCDA 2HF9A 3HR4A 5L53A 1FFXB 1JT9A 3BCRA 3ILHA 2XWJI 3TAXA 1JI3A 4UE2A 4R8MA 3OM9A 4Q4JA 2HRRA 4S2UA 1U7OA 2DRIA 1D1QA 4DCPA 3L2OB 3SQMA 1GOGA 2Q5EA 1A1VA 2OQ2A 1XTQA 4DLVA 1MZEA 4BJ0A 3B1ZA 1BJKA 4FFBB 2YJ5A 2WYHA 2IEDA 1IONA 2GEUA 1UZWA 2ZAMA 2Q8OA 2EGGA 4GWMA 1OHHA 1RUH3 4CR8A 1IWOA 3UYKA 4QQPA 4C76A 1X2EA 4LXXA 1C0LA 4DMCA 1RJDA 1Q8OA 2GNTA 3NBKA 2VQTA 4HBZA 4A26A 2OVUA 2J3KA 5KYXA 3K9HA 2Y77A 4IZIA 5HQJA 5EPAA 2OE2A 3EMKA 5FZLA 5ADWA 1W6OB 1QYCA 2QJFA 1YHNA 1CIPA 1FVFA 4II7A 4K1XA 3HN7A 3FYUC 1K8RA 1OXTA 4Z4GA 2GM3A 4XCAA 1PZFA 4AQ7A 1FZQA 3KCNA 4GKBA 2HIMA 3ITQA 2R6ZA 3LQ4A 4XFKA 2AMFA 4EDHA 1EXNA 3E7FA 5CB4B 4RKYA 3GZNA 3CDZB 4E88A 2WINB 2E6VA 3BB3A 2EV9A 1IHOA 2II6A 2P30A 4W5HA 5JY1A 4BBZA 1WKVA 3HUTA 1YRHA 3DPRB 1TADA 1GTVA 4DMGA 3ZGOA 1MJNA 4KWKA 1FZTA 3CO5A 4H7IA 2GVZC 1QNWA 3BUCA 2HHAA 3F8SA 1ULSA 5AVVA 2ZJ5A 2BFFB 4FMBB 1QH8A 3KTAA 4WKBA 1YS4A 1T0IA 1A78A 1NCRB 1LX6A 4BIIA 5C52B 1AQLA 2R8BA 2P5BA 5HJ5A 2ZW9A 3RFCA 3ROFA 5JSQA 4UD2A 2AG6A 2W4MA 3V55A 2CDRA 2ZSAA 1IATA 3RSQA 1N2BA 3DMTA 3M83A 3PHMA 4FFNA 1SPPA 4ZV4A 4TVBA 2V3VA 3RDIA 4CFZA 3DZGA 4YVWC 1AL22 3BTYA 1WGPA 2QRGA 4HUQB 2Q49A 4C4YA 3HKDB 1HX6A 3TEZA 1YNAA 1Y34E 1I0ZA 2JFHA 2VHZA 4QB2A 1RXGA 3C70A 5F2WA 8ABPA 4MR7A 1WCWA 3GIDA 5ANRB 1AYM1 2X0NA 2RDRA 1LKZA 1HEYA 1RUG1 4N0EA 4CEYC 4D8UA 1FATA 4EL0A 1ZLYA 1GV1A 2R5FA 3FIJA 3JBG1 2JHCA 3L7NA 3OMWA 3S2ZA 1XZHA 1PX2A 1LU9A 2LALA 2I2AA 1IFXA 4YIHA 5HGJA 2D6PA 4U7DA 2C5HA 5EJ7A 1BDBA 2J4FA 4RE5A 4W8OA 3N7JA