3IIIA

1.95 angstrom crystal structure of coce/nond family hydrolase (sacol2612) from staphylococcus aureus
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
558
structure length
556
Chain Sequence
b'QHLLGNPKLTVTHVNEVKAGINHIVVDSVQYGNQEMIMEKDGTVEMRDGEKLYINIFRPNKDGKFPVVMSADTYGKDNKPKNMGALWPTLGTIPTSSFTPEESPDPGFWVPNDYVVVKVALRGSDKSKGVLSPWSKREAEDYYEVIEWAANQSWSNGNIGTNGVSYLAVTQWWVASLNPPHLKAMIPWEGLNDMYREVAFHGGIPDTGFYRFWTQGIFARWTDNPNIEDLIQAQQEHPLFDDFWKQRQVPLSQIKTPLLTCASWSTQGLHNRGSFEGFKQAASEEKWLYVHGRKEWESYYARENLERQKSFFDFYLKEENNDWKDTPHVIYEVRDQFYKGEFKSASAFPLPNAEYTPLYLNAENHTLNHAKISSAHVAQYDSEDKQQDVSFKYTFDKDTELVGNMNLKLWVSTKDSDDMDLFAGIKKLDRRGNEVNFPDFNHIENGQVATGWLRVSHRELDQEKSSIAQPWHKHETELKLSQDEIVPVEIELLPSGTLFKQGETLEVVVKGSEIVIGNSTPGMKTRYEHEETVNKGMHMIYTGGKYDSQLIIPIVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CocE/NonD family hydrolase
publication title 1.95 Angstrom Crystal Structure of CocE/NonD family hydrolase (SACOL2612) from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus col
molecule tags Hydrolase
total genus 189
structure length 556
sequence length 558
ec nomenclature
pdb deposition date 2009-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02129 Peptidase_S15 X-Pro dipeptidyl-peptidase (S15 family)
A PF08530 PepX_C X-Pro dipeptidyl-peptidase C-terminal non-catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3020.20 Mainly Alpha Orthogonal Bundle alpha-amino acid ester hydrolase ( Helical cap domain) alpha-amino acid ester hydrolase ( Helical cap domain) 3iiiA02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3iiiA03
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iiiA01
3ZV7A 3TGLA 1LPMA 3WK4A 4Q1VA 3W06A 2QS9A 5EHZA 3CN7A 5AIBA 1H6YA 1IMJA 2JIDA 2KD7A 3C8XA 4MADA 4BATA 5HCUA 2GBGA 3CQOA 3V1NA 3LEGA 4X93A 3QMWA 5DMYA 2JGJA 1MAHA 4MOAA 3IUMA 1QIEA 4C4YA 3ICWA 5HQ3B 1WPRA 5D3ZA 4ZXEA 5LZ8A 5ISMA 3QMMA 4TTGA 4QWWA 3HNBM 1L7RA 2VM9A 2PQSA 4OYYA 4IQ4A 5ALUA 4FI9A 1GUIA 4QLOA 2FUKA 1XRNA 3QMVA 5ALZA 3E3AA 4MQLA 1XZKA 5LIPA 2VCBA 1QIKA 3OURA 3SEEA 1CPYA 5K3BA 3WL6A 5C8XA 5HF5A 3NOXA 4CCYA 2WJ6A 1ZD4A 3T0AA 3WWPA 2QR5A 5D7BA 2C9KA 5BOVA 2XUIA 1K45A 5EIAA 1ORWA 4FMPA 4B82A 1MPXA 3HSSA 4WCVA 2EIEA 2WO1A 3DEAA 4G4IA 2HA5A 1WM1A 3DYIA 1JZ5A 1H2ZA 2WUFA 3OGSA 1UYYA 4N8SA 3ZLVA 4X00A 1J84A 2ZVDA 3PDCA 4G1FA 5E4TA 4BC1A 4LQRA 2Y6GA 4MGQA 2RGUA 2WABA 2ZEXA 3I2GA 4QB1A 4FNMA 2J7MA 1DWOA 1QIIA 4B0OA 4YK7A 1LPAB 1H2YA 3RLIA 2VQTA 4X94A 4ZZ8A 1A8UA 3W5NA 4J0DA 3H0CA 2WIFA 2BGRA 4H7HA 4JKLA 2OAEA 3FCYA 5EHNA 5AICA 4QDOA 2WN3A 3W5MA 2V96A 3FYUC 1UK7A 3STXA 1K63A 5I9IA 4UFOA 3IUJA 4Y2YA 1VE6A 1BS9A 3J7HA 4A6OA 3C7FA 2VL4A 1U2EA 3M81A 3VDXA 3FAKA 5CT4A 4XVCA 1UY4A 2XT0A 4HZGA 4G5XA 1HKHA 2O2GA 2Z5GA 3OOSA 3W9BA 1US3A 3STUA 4AO6A 4FWBA 3ICVA 3C6BA 3IAPA 3WLAA 3HXKA 4QDZA 2CJPA 5G04L 1XZMA 5HK9A 3VDCA 3A2MA 3WK6A 3GZJA 3AIKA 3WA7A 1ZIYA 1CZTA 5DNWA 3HEAA 4EY5A 5AM1A 4KACA 1MNQA 3K46A 5DQ0A 1OXMA 3PF9A 4AZ3A 4QDRA 1H2WA 5DYYA 2QUBA 2W95A 5ALHA 3A23A 3I3EA 3MGAA 1OT5A 4HXEB 3QPCA 5C8VA 1XZIA 4G8CA 1VJ5A 3AINA 4P92A 1UWCA 5LP1A 2XLBA 3AFIA 3GA7A 2J3DA 4K6HA 4DEVA 4FTWA 1I5PA 4LXHA 1CUVA 2EDCA 3ANSA 1CUXA 3F98A 4Y7DA 1VOTA 1EXWA 2GYUA 3DYVA 1AGYA 5A1AA 1F0NA 4EZIA 1JU4A 2PKYX 3NRUA 1UK6A 2PPLA 5CT8A 4Y2JA 1SHWB 5HF6A 4BP9A 3H1BA 5HQ3A 4X85A 1XQWA 1K6EA 4UHCA 4PT6A 4LPLA 1TKRA 2ZSIA 1LGYA 2C0QA 2QQMA 2XMDA 1W0NA 4AXBA 4GW3A 1CUJA 1J83A 3GFFA 1UXOA 5CT6A 3JYHA 2PUJA 1US2A 5ALWA 5CH8A 3A6ZA 3B3QA 1VKHA 3BWXA 4KRXA 2WU4A 3WK8A 3NUZA 1FSSA 3IAQA 2BBAA 1VZ3A 2ZYHA 1ZGCA 2QVBA 1CUIA 2WZEA 3VJMA 4UUQA 2FX5A 3BE8A 4GWJA 5JR2A 3T08A 4RYDA 1CR6A 5FOQA 4GWIA 4OB6A 2J3QA 2ZEWA 1U8EA 3DD5A 5BWCA 2EEPA 1JZ4A 3EYPA 4BCDA 1LPOA 3G0DA 2WQ8A 3UUFA 2OCKA 1WB5A 2AXEA 2OLEA 3CZUA 1TVGA 1GPLA 5AKHA 1UMHA 3HRHA 4X90A 1AQLA 4P02B 1NU8A 5C71A 1QLWA 5LYYA 4TXWA 4P93A 3FSGA 3VVMA 4EY4A 4P00B 3WJ2A 1W8NA 2WTNA 5ALEA 4MEAA 5AM5A 5JAPA 4CI9A 1UXZA 2DSNA 1ISPA 5C7YA 4B85A 3WNMA 2WIKA 3SEPA 5ALYA 3IUNA 1ZD5A 4KE8A 1JT2A 2QRUA 5FLKA 2VT6A 1FFDA 2WHRA 2W47A 3WWCA 1DX6A 1T2NA 4GLBA 7YASA 3I2IA 4YPJA 3D4LA 3ZWQA 2WFLB 4QB2A 4Y2PA 4KRYA 3VJLA 2QQJA 3WKCA 3WKAA 1XRRA 5LZ9A 1AX9A 3R3XA 3R40A 1QIMA 3H17A 3I97A 3DDUA 3FYUA 5AKLA 1EI9A 4U2DA 1UY2A 4P5YA 4DXTA 4FKBA 1P0IA 1HL7A 1E3QA 5A7FA 3DNMA 3G9XA 1ZD3A 2WJ3A 3I3DA 1FFAA 4L72A 4UBMA 2WTMA 4AN1A 1XQVA 2WIDA 4Y2XA 5A7HA 3ACGA 2YH2A 1W52X 2VZVA 3MUZ1 4QDXA 3D2BA 1P8JA 3KOOA 4MYSA 4MQMA 2JD9A 5BWBA 4AZ0A 4L3WA 4GBGA 5IHRA 5B4NA 2DCMA 4XUTA 2WBKA 4HAIA 3WZLA 1ULOA 1O8SA 1QE3A 1SC9A 4N5IX 1MAAA 2I78A 5SYMA 4CUBA 4HTAA 1XZAA 3VD7A 1XFDA 2Z4FA 1VXOA 4DIUA 3OEBA 4N5HX 1VE7A 1BU8A 4QPWA 1CX1A 3IBTA 4LXIA 4BCBA 1JZ2A 1Z68A 5EIYB 3V1LA 2XMBA 4BDTA 2WILA 2HA6A 1G66A 3HACA 1ZI8A 4LYDA 2HA2A 3AZQA 3BL8A 5IVKA 4RE5A 3WNKA 4L9AA 2DHCA 3FN9A 3FL7A 2WFZA 4X95A 5KREA 5EGNA 1Y7IA 3TJMA 4ZGBA 2OQVA 3QYJA 4CCYB 4KEAA 1EDDA 3WKDA 1YSCA 4U2CA 4HRXA 1LZLA 2CB9A 4BBZA 5ALTA 1XZCA 2ZYRA 1SDDB 4MJ3A 1B6GA 1YB6A 5K3DA 3QPDA 1IVYA 1MX5A 3CZJA 1WCYA 3SWWA 5I0DA 5A6VA 3FSGD 3GM8A 3ECQA 3VD5A 1CUAA 3HI4A 2I03A 3R41A 2JKXA 3WQBA 3R3UA 4BVKA 4HVTA 2PM8A 1SG3A 1XQXA 2GZSA 2J4CA 3FCXA 3I6YA 4M4PA 2QBXA 2OAGA 1XZGA 3LLCA 2HU7A 2OCIA 3DKRA 4MXDA 3STWA 2HRQA 2Z3WA 4BVJA 1ORVA 2VT7A 1K3IA 2HA0A 3KD2A 3TRDA 3TEJA 1CVLA 1ZIXA 1HDEA 4DEQA 1XRLA 3NQHA 2WM2A 2XQKA 2QXUA 4XUOA 1ETHA 3LP5A 4U2GA 1DYOA 1JHJA 5C8ZA 5LKRA 4DUVA 2VEOA 5AKKA 4XIIA 1CIYA 1JI3A 2I3DA 4KE6A 1GKLA 4KAJA 1T2XA 2XI4A 2BAGA 2BGOA 3ZLTA 3ETPA 5ALQA 2Y6VA 1CUUA 3B12A 5D6OA 3CMGA 4EB0A 4CIAA 5AK5A 4KJXA 3V9AA 3H2JA 1NAEA 1W9WA 4DGQA 2DR0A 2XUAA 1XROA 3ACFA 4QDSA 5H3HA 3W05A 3R3ZA 2ONCA 3GGLA 1XZLA 2WUGA 3FNBA 2VCCA 2VZQA 5ALSA 1MJ5A 4KAFA 1OF3A 1PX3A 3C5WP 4OZOA 2QXTA 1GNYA 5AJHA 4DMCA 4QX2A 1N5RA 2YASA 4IUGA 1ULPA 2XDWA 3KDAA 4H77A 1DQZA 2JE8A 2EIBA 4GXNA 3BN6A 1VA5A 4BJ0A 2P8SA 4DLNA 1W9TA 4DSZA 2YB7A 4L0CA 5CXXA 1JZ8A 4BTVA 5AKEA 4AAXA 4Y2SA 3DYPA 1UWWA 2I3ZA 1UMIA 1R88A 4I19A 1CRLA 4J0KA 2V5DA 1E8MA 3WWDA 2ID4A 1CQZA 3I2FA 4B7ZA 1ACJA 4A45A 3FLAA 3R3VA 2PL5A 4DNOA 2EICA 5ALLA 5ALRA 1TQHA 3A7QA 3H2KA 3ZPXA 2GBCA 4QDQA 3IA2A 1HPLA 3A21A 4X6UA 4D8MA 3DOIA 4TPKA 2LIPA 2JGMA 3BIXA 5DWDA 4ZXFA 5FUIA 5I8PA 4JKMA 2HDWA 4CUCA 2ORYA 2VZ1A 3WF3A 2RONA 3BF8A 1Y37A 3FOBA 5A62A 3DCNA 1SCIA 5AK6A 3IDAA 1XZJA 4FDMA 4EY6A 2OGZA 4U2EA 2WUDA 1RP1A 2Z8ZA 1IUNA 1B41A 3C6XA 3I2HA 3OGRA 5AKZA 3AIOA 4OSEA 2W87A 1CUBA 5BV7A 1CUSA 5CBKA 4W50A 1PX4A 2QM0A 5CH5A 2QQNA 2Y6UA 2W92A 3L1IA 3WNLA 4JYPA 4UOJA 3BDVA 4Y2UA 1FFEA 2RAUA 1XRMA 2JF0A 2PSFA 3R0VA 2VZTA 1UZ0A 3LPFA 3H04A 4G4GA 3G7NA 3PE6A 1RYYA 2C58A 4GHWA 2W1WA 4C89A 2ZYIA 2OGSA 3EQ9A 2DFPA 2G5TA 1AURA 3DOHA 3OPMA 2HIHA 3EF3A 4UBJA 1L7QA 1GGVA 3MBWA 1UZAA 3R3WA 2PU5A 3AUKA 1UK9A 2VJCA 1E8NA 3BDIA 1EINA 4KE7A 5JZBA 3D5EA 5EIEA 1J1IA 2OXEA 5IH7A 1WOMA 1PFQA 2EIDA 1MNAA 3FVRA 4GWLA 1W9SA 2J1EA 2AJDA 3IULA 1K12A 3HOBA 4BDSA 1QFMA 2VMFA 2DCKA 1T4MA 4K6GA 1ODCA 3FYUB 2OG1A 4U2FA 4QLAA 4XJVA 2W91A 3P6BA 4FOLA 2XONA 3I6ZA 2X76A 5F4ZA 2ZSHA 1G4HA 2XOMA 5JYCA 4UBNA 4JEIA 4XUQA 5LA1A 1CV2A 3WSOA 1N5MA 2GBIA 2YFZA 2WN2A 4XUPA 4M0MA 3GDBA 4QWMA 1YAHA 5LA0A 4MWTA 1AC5A 1P0PA 4J03A 1JYNA 1GPKA 3AZPA 2VJBA 1WKYA 4UHBA 3EQ7A 1QIFA 3D0KA 3WL8A 4WFIA 2RIPA 5DLPA 3O9MA 3VD9A 3OG9A 1OH4A 1F0PA 3T2OA 3O9VA 2BJHA 3IB3A 3SKJE 5FXMA 3IUQA 2W94A 1BCSA 3B5EA 1QTRA 4BAGA 1EX9A 1E66A 5HK8A 1F8UA 4AG4A 3F96A 2XQXA 3L1JA 1F6WA 5FUMA 5K3AA 1WB4A 4K5QA 3F8SA 4WFKA 1IUPA 2C0PA 5C7GA 5LZ4A 4S0XA 1OILA 2VAVA 4Q3LA 2E26A 4CUAA 2BGNA 3YASA 3SX4A 1UY3A 2HHAA 2PX6A 2WIGA 3T2QA 5K5EA 1CUZA 1WHTA 3H19A 5T4FA 2X05A 5AI4A 3OBAA 1H23A 3K77A 5DN2A 1KEZA 4F21A 1UYXA 1YS1X 4BZZA 3F97A 4PO3X 2Y64A 2ZJ7A 3C70A 2RJ2A 4QB6A 2YYSA 5E2IA 4B81A 1K8QA 3G9UA 1USWA 3L1HA 2XQGA 2JEYA 2EDAA 5JIBA 3WQHA 5LZ5A 2XMQA 3O95A 3S8YA 2JGEA 3FLEA 2R8BA 2XMRA 4K6KA 4QE3A 3UMJA 5C70A 5AKGA 5JZSA 1Y7HA 2XB6A 5AO9A 1XRQA 2Y2VA 4J3JA 1UOQA 5AM3A 5AH0A 4B80A 1JI6A 4PF1A 2ZJ6A 3KWJA 1YA4A 3D3AA 4XZUG 4ZWNA 3C5VA 1QZ3A 2CEKA 1QTIA 3GXUA 4CU8A 2GBFA 4DXSA 4DXRA 5EIHA 3H2GA 5ALKA 3VXKA 3LQCA 1MN6A 2QMQA 4E11A 4A23A 5HZGA 3K4AA 4XX1A 1UKBA 3JW8A 4A3ZA 6YASA 1WPXA 3A70A 5AI5A 5AI8A 5EJZB 5K3FA 2CUTA 2RHWA 4IH4A 2WDBA 1G5FA 1PMHX 3RK4A 4JYMA 1FFBA 3R3YA 2C5GA 3HYSA 2HU8A 3DQZA 4X3CA 1X2EA 3VKFA 2VZOA 3UNPA 4QA9A 2XUQA 2Y6JA 5AK3A 1JU3A 2VZ3A 4A4AA 3VVLA 5JATA 5DYWA 2WHPB 5AIAA 2YXPX 1CZVA 2WAOA 1GQRA 1FJ2A 1R9MA 1GMMA 4UBOA 4ARAA 4PSCA 1JFRA 4A44A 1YS2X 2CDPA 4DMHA 4P08A 4D0QA 4DNQA 1GZ7A 1XZFA 2X10A 4X92A 1GOHA 5JXGA 4PV7A 3CDZB 3C8DA 2DQZA 5AKIA 3VD4A 1UYZA 1YB7A 4B9AA 4GZ9A 4W8JA 2H7YA 4H7FA 4JHZA 2VA9A 4CCWA 4HG6B 4NZZA 1VZ2A 3C7GA 4EY8A 4A5SA 3P2MA 2VTVA 1I6WA 1WHSA 4JUIA 3HJUA 2DHDA 3E0XA 4XWGA 3WL7A 4U2BA 5ALDA 3V48A 4W4ZA 2WUEA 2O7VA 4BZWA 2VQ6A 4H7JA 1LPSA 2BCEA 2HFJA 1IUOA 2X8BA 1DQYA 3DECA 1XNAA 1GQPA 1CUYA 4IO0A 1DLCA 3LEKA 4XUNA 4GDMA 1CUWA 1EUUA 5A7GA 1CUHA 2YC4A 1SCQA 4ZI5A 4LHSA 3SKVA 2VMDA 2XQJA 4G4JA 5K3CA 4ZY9A 3ESCA 3WA6A 2ORXA 3PICA 1A8QA 1EHYA 3EQ8A 3U1TA 4OYLA 3O4HA 1LZKA 4X97A 3GROA 1TG7A 1UKCA 5YASA 3WK7A 2V9ZA 4W1QA 3G9ZA 2WQZA 4J0HA 2HA4A 1BRTA 1UFOA 1GPNA 4E8DA 2ZEYA 3ACHA 4BVLA 3P1IA 3PFCA 1UX7A 4LHEA 3AIMA 2H7XA 1GKKA 3M82A 5IVIA 2W3JA 3WNNA 2PVSA 5B4XA 2O7RA 2J1AA 4BK5A 4Q3OA 4BP8A 4CG2A 2V97A 3PFBA 3F67A 4E8CA 5FKJA 4X91A 4L0PA 4AN0A 1CFJA 4I3FA 1FFCA 1MX1A 2QQIA 3HZOA 5AOAA 3RKSA 1ZD2P 5DTIA 4B0PA 1D7PM 3MV01 4Y2TA 1WCQA 4W9RA 3STYA 3IIIA 2XE4A 1EUTA 2OGTA 1ZICA 5KBYA 4MWSA 2WLSA 1MU0A 5CURA 5FP0A 3OGVA 1YAJA 2NW6A 2ZJFA 4M0FA 4MEBA 5AKXA 3WZMA 4QDUA 2VJXA 5IVDA 4INZA 1ZI9A 4BC0A 3O4GA 3VISA 4LYEA 4ZZ5A 3LPGA 5HKBA 1SFRA 5ALNA 3C43A 5CMLA 4UHFA 4C4XA 2O2IA 4JH0A 3BF7A 4Y9SA 4JNCA 2YG0A 4BB0A 5ALIA 1R3DA 3HC7A 1E8DA 3STTA 2VTFA 4ITVA 4WY8A 1TAHA 3OTQA 2LS6A 3T2PA 1UY0A 5AI6A 5JADA 1KGYA 3WF1A 4PQQA 4KR0A 3WI7A 4OMDA 3WF4A 5ALXA 2W46A 1XZDA 1DT3A 1JZ6A 3F2ZA 2XUOA 2Y6LA 1JKMA 2CKMA 3WK9A 2QQKA 1Q83A 4ZV9A 1CUGA 5AM0A 1AMNA 1GT6A 4H18A 2QT9A 2WHPA 2H9YA 1F4AA 4DYHA 5CXUA 2B61A 2GYVA 2W1QA 1DWPA 1EDEA 1QIGA 4CG1A 2JGIA 3MUNA 1GOFA 4ARBA 2XQIA 3QPAA 4XURA 1QIJA 5LKAA 3CXUA 5E4YA 3WYNA 1THTA 4CIBA 4FFWA 5KWIA 4A16A 4G9EA 4IHAA 5FRDA 2QTBA 2AJCA 2W1UA 2QJWA 5C81A 4H7IA 3FBWA 3CN9A 5AKYA 3HJRA 5AK4A 4DSAA 1BEEA 4X7BA 1CQWA 3T4UA 3WWEA 1ODSA 2HA7A 1XKLA 2XMZA 2B4KA 1KEXA 5HF9A 4LXGA 1ZGBA 3OC0A 3T0DA 1EH5A 2VJDA 3WIBA 4J0IA 1TCBA 3ESDA 2WZ8A 4BAUA 1UXXX 2C4XA 4KAAA 1BN6A 1X70A 3E1F1 2B9VA 4GECA 5I7UA 4B83A 1UOPA 1O6FA 2BUCA 3LS2A 5JMOA 2PSDA 2BZDA 1EK1A 2OCGA 2VC9A 4Q05A 1EB9A 1XNTA 4OB8A 3I6MA 1X2BA 4EHBA 3CCBA 1LPBB 1MT3A 1XPWA 3MUY1 1JZ7A 3KSRA 3PF8A 4DMKA 4B84A 2HL6A 2LW8A 4MO3M 2DQYA 5D3KA 3VJKA 2ES4A 1XC6A 3BGAA 3ESBA 2YFUA 4G9GA 1NUKA 1XZEA 1O6GA 3MV11 3ZLUA 1W75A 1LPNA 4F60A 3BIWA 2DCJA 2XUFA 2WFMA 5JAOA 3D2CA 1BE0A 3C87A 3FHQA 3A2LA 3DLTA 2E33A 1GXSA 3ZM8A 1VA4A 5AI9A 1TK3A 1THGA 4AMYA 2HFKA 1JMKC 3NNGA 3A22A 1EA5A 2Q0XA 4UBLA 4W1SA 5JXIA 2FJPA 5JARA 2VATA 1C4XA 5LZ2A 3W2TA 4H7EA 3ESAA 4Z2AA 1UY1A 1JMYA 4CG3A 3NGMA 1W4LA 4UHEA 1AKNA 5CT5A 1QGED 1C7JA 4X6YA 4RE6A 3G0BA 4PQEA 3FHAA 2JBWA 1L7AA 2GYWA 3VDAA 4HXGA 3FVTA 2VSQA 1EVQA 2WUHA 3OG2A 5A2GA 4E15A 4CFSA 4NS4A 2WG0A 2JDAA 1G42A 4N8DA 4WY5A 3WK5A 2WG2A 1CZSA 2QQOA 4ZREA 3N2ZB 2VMCA 4Q34A 1ZJ5A 3SC2A 3C7OA 1LBSA 2C5FA 4LIPD 4DMFA 4QX0A 5K3FB 4DM7A 2Y8KA 4YPVA 4OYUA 3WF0A 1BHGA 5CT9A 4PSUA 5AOCA 2OPHA 1SOMA 1Q0ZA 3ED1A 1J07A 1DTEA 3JWEA 2YC2A 1ACLA 4RGYA 4OUEA 2HA3A 2V4VA 5SYNA 1ODTC 3LE0A 3S2ZA 3KXPA 2WO2A 1HBJA 2VJAA 3QVMA 5HPOA 4QDTA 3GUUA 3O4IA 2Y2UA 5JALA 5FV4A 3K4ZA 3ABZA 3D59A 1A7UA 1DT5A 1R9NA 1LLFA 3AJAA 3Q8WA 3G0CA 2ORZA 5AHXA 3RM3A 2VZUA 1DU4A 2L9LA 4ROTA 3K75B 2J4FA 4FLFA 4QEKA 2J1RA 1IQDC 2Z8XA 2J22A 4WFJA 3D7RA 3QZUA 4D9JA 4UAPA 5CZKA 1HN1A 1W6RA 2VF2A 5EJ1B 3BJMA 1XRPA 2XUDA 4RNCA 3U37A 1CUEA 4OUKX 5CRIA 3PUIA 3H2IA 2Z3ZA 1PJAA 5IKXA 1JJBA 1GQSA 2H7CA 3FYTA 1CUDA 5ALPA 3LCRA 5G05L 2G4LA 2VZPA 1SCKA 4CU6A 5FPQA 4GEGA 1AUOA 3I2JA 1AZWA 2UZ0A 3WKBA 1A88A 1YQ2A 1OF4A 5ALGA 2WAAA 4OB7A 2PUHA 1YASA 5FPPA 2R11A 4C4ZA 5EHXA 2QZPA 1LPPA 2CBGA 4ARYA 1CUCA 5ALJA 4FBLA 2OQIA 4FBMA 2WG1A 3HNMA 2E31A 2J1SA 1MX9A 3GBSA 3CCCA 3WL5A 5A71A 1BN7A 1R1DA 3BXPA 4ZRDA 2W22A 1M33A 3KWFA 2HYXA 2AJ8A 1PV1A 4FLMA 2WSLA 1QJ4A 5DNVA 2XMGA 1K42A 3IURA 4WDRA 1MTZA 4AB1A 2WJ4A 5DPNA 2PBLA 3DYOA 5CYYA 3LIPA 4NMWA 4X71A 5AM2A 2IX9A 4DUXA 3RARA 1JZ3A 1H6XA 1CLEA 2XLCA 4DTCA 2VZSA 1TCAA 2PU7A 1ZI6A 5HXMA 2D0DA 1CEXA 1XLVA 2RV9A 5HFNA 1ZJ4A 3E4DA 4KYVA 2XUHA 5AP9A 1O59A 5AOBA 1CUFA 3CKHA 5IFTA 3E1GA 5LCWL 2OCLA 3D3NA 3G0GA 4PW0A 5ALMA 2HU5A 1YCDA 4PSDA 3UETA 1R4ZA 5J1XA 4QZVA 2JGKA 2VCAA 3NJVA 4H7KA 3G0IA 1O8PA 1RWQA 3D2AA 3DKKA 3WKEA 3ILSA 2QJRA 4BDVB 4BAZA 5CH3A 3HNYM 3WNOA 4BCCA 1UT6A 2RVAA 2FJ0A 5HF8A 1XZBA 2XMCA 4C6HA 3FWHA 4AQDA 4J0JA 4XVHA 4EUSA 1DINA 4B6GA 4JX0A 4DNFA 4BTLA 1LNSA 2VZRA 3C45A 1TCCA 1U65A 4FLEA 1J06A 4H7DA 5CW2A 3OM8A 2CZQA 4W1PA 4F5ZA 4O08A 1QO9A 5F7UA 4I4CA 3VDBA 2ZXQA 1UKAA 2XUGA 2GZRA 1W8OA 1QO7A 3LIIA 4OCZA 3QM1A 3ANTA 1U4NA 2ROQA 3AC0A 3NJXA 4BK4A 2XUKA 5T4BA 4CU9A 3K2IA 4AO8A 3PUHA 1KU6A 4LKOA 1XLWA 3QBJA 4FNGA 3HLKA 4HS9A 3HN3A 5JZ9A 3DYMA 4QNNA 5JXHA 5T4HA 1XLUA 4ETWA 2QKYA 4GI1A 4NVRA 2HRRA 4QX3A 3H1AA 1TRHA 3WMRA 5ALOA 4G8DA 1BCRA 3OB8A 2CMFA 1Q0RA 4DUWA 3Q0TA 5E4JA 1GOGA 2WHQA 5IJRA 5AI0A 3C8HA 3PI6A 1W76A 4MGSA 4RPCA 4OU4A 1HLGA 3FLBA 3K9BA 2AJLI 2W6CX 2V72A 3WEZA 5JUVA 4OPMA 2ECFA 4W63A 4BXSV 2D5LA 2WKWA 1CIJA 1S8OA 4EY7A 5LA2A 1H2XA 2BFNA 3UUEA 1P0MA 2Y1KA 3WIOA 3ZI7A 5JANA 4ZV7A 5JD6A 2Y6HA 4C01A 5JD5A 5ESRA 2XHNA 1E89A 1GU3A 1DWQA 4BE9A 1K4YA 1W99A 3I1IA 1NKGA 3I2KA 1PMJX 4PNZA 1EB8A 4F0JA 1H22A 2ZEZA 4FFVA 1E5TA 2DHEA 3EIOA 3HABA 4IH9A 3F9CA 4QX1A 2VO5A 2K2QB 4AO7A 3WWOA 4W1RA 4OMCA 4LKSA 1BROA 3M3DA 3JXSA 5CTAA 1LBTA 1P0QA 2RHTA 4IH1A 2J1VA 4WJLA 4JKKA 2AJBA 2JGLA 3C7EA 2VOTA 3NWOA 2DDUA 3UESA 2BUAA 4M4RA 4P9NA 3VD3A 5DNUA 4AMZA 3GELA 2G63A 4TGLA 1R50A 3THCA 5DJ5A 2H1IA 3G02A 4CVUA 2BERA 2C7BA 2IIVA 4BYMA 2BUBA 4H35A 4MYDA 4BRSA 2G5PA 3T0BA 4ARXA 3C6YA 5AM4A 4KE9A 3I1YA 1QONA 4M0EA 1EDBA 4Q3KA 5HFAA 1N1MA 1BEZA 1HQDA 5EI5A 3STVA 1J2EA 4G8BA 3LEIA 3IVMA 4J0CA 3V1KA 3THDA 3N0TA 1XKTA 4HXFB 4A42A 2PSJA 3MVEA 4UBIA 1TIBA 5AKJA 4FHZA 5J3JA 1QOZA 4AX4A 3QITA 2IITA 4Y2VA 5LLSA 2WU3A 3O0DA 4UI9L 1IZ7A 2W9XA 2WO3A 2JGFA 3H18A 1QIDA 4V2IA 2HADA 5EFZA 1NU6A 2BKLA 2CDOA 3DL7A 1OD3A 4OU5A 4UFNA 2O2HA 4ET7A 2QQLA 4N8EA 1EK2A 2W5FA 2E32A 1R64A 4J7AA 4Y2QA 2C4HA 4UBKA 2ACEA 2QUAA 3WF2A 3H2HA 2WIJA 2XQFA 3W9UA 5IVHA 3SK0A 4WDQA 4C88A 2HLEA 3WNPA 1QFSA 4B9EA 1EVEA 3DS8A 1XZHA 5DTJA 5K3EA 3X3HA 1IZ8A 3U0VA 3C7HA 1JJIA 1NX9A 3K4DA 4Z49A 2PSHA 1YA8A 3T09A 2X09A 1A8SA 1QIHA 5KWJA 4DNPA 2V98A 1JYXA 2E3JA 1D07A 1YR2A 5FDFA 3G9TA 2VMEA 4YASA 4YX9A 4RN5A 1UOOA 2WYSA 1N8SA 3ACIA 3G8YA 2J1TA 3M83A 1DX4A 1KU0A 4CU7A 2JEZA 3WYDA 3OEAA 1WB6A 5JAUA 3HEIA 2RI6A 3I28A 3I3BA 2QOEA 4KMQA 5JD4A 5DYTA 1DP0A 5JAHA 4KI5M 2VAXA 2PSEA 2B20A 4EBBA 1W1IA 1C7IA 2XUJA 3AILA 2BGPA 4KWUA 1OCEA 1Q84A 2WFLA 3K6KA 5JASA 3DJYA 1K5PA 4QAWA 2ACKA 4E14A 3MUOA 1ZOIA 1VXRA 4HRYA 5ALFA 2XUPA 3O4JA 1MO2A 3QH4A 2X5XA 5IFPA 4E46A 3W04A 4K2AA 3A2NA 3MO4A 5JXJA 3HPNA 3WJ1A 3EB7A 5EHQA 2C26A 2R7EB 4UPDA 1XQYA 2J1UA 4BRZA 4Y2RA 4X6XA 3DL4A 4OD0A 4UHHA 2VR4A 4A41A 1UK8A 2Y6KA 1F4HA 2OKXA 4UFPA 3C6ZA 5LZ7A 2W1SA 4C87A 3BJRA 3EBLA 2HM7A 3T52A 3V1MA 4EA6A 1JYVA 4H0CA 3CIHA 2XMSA 5IYYA 4Q82A 4TVKA 5HKAA 1JYWA 5T4EA 4J0GA 2VQUA 5ALVA 1VLQA 4BE4A 4UHDA 1JJFA 2ZYSA 3AZOA
chains in the Genus database with same CATH superfamily
3TGLA 1QDUA 4FFBA 3W21A 3MWEA 5C1OA 3VAYA 1T0JB 1ISSA 1W0PA 3V1NA 3LEGA 2OHIA 1MAHA 3PA6A 3DHVA 2VQ3A 4XQGA 3WBFA 1QGUB 3QMMA 5IUKC 2L17A 1R74A 3CINA 1ZK3A 1BBT1 1YQDA 3DE5X 1U98A 4FKMA 1K06A 1KRIA 3ZS9A 1QOQB 1CPYA 1IJBA 5A9SA 3OD5A 3NWJA 1W2HA 4TT3D 5C8XA 2G1KA 3W2IA 1F15A 3N35A 1C8BA 1QGYA 5BOVA 4Z54A 1HM5A 2RMKA 5KJEA 2R071 1DV1A 4OHUA 2XCOA 2EIEA 1A5TA 3OGSA 4MW7A 2X0NA 5DO9A 3ZYCA 4D8TA 4Q12A 1KVUA 5DIZA 2JI9A 5ILQA 4LQRA 3UAYA 3NYQA 4FNMA 4B0OA 3RNOA 1EX6A 4AZZA 3K9WA 2R68A 4EAAA 4F3JA 4Y0NA 4AY5A 4MW9A 3HB4X 3DTNA 4K26A 3KF3A 2K2WA 1VBC1 1DLIA 2R8PA 3M81A 2NYYA 5CT4A 4R2WA 1O96A 2WJHA 5FQ0A 1QMPA 4Y67A 4ZAYA 2YZ7A 4WRRA 4G84A 4AY6A 3IZOA 2I91A 3CJIC 3C3BA 4BPZA 1B7GO 5BPHA 3OZGA 1Z35A 5DB4A 3WA7A 4EQVA 3K2EA 1YQGA 1M2NA 3FB1A 5CR9A 5CNIA 1U2DA 4CEWA 2YHUA 2QQFA 4CCOA 1UZLA 1LEDA 4I1OA 2B4TO 5BSUA 2HQSA 3NBYC 3N7LA 3H5OA 1FA9A 2E4YA 3N53A 3WP3A 1JZQA 4X0EA 3MW2A 1P9RA 1GKIA 2R3SA 1URPA 3K6JA 3AFNA 3DYVA 2UYGA 2YVQA 2CNOA 3HB1A 3LSYA 2QRKA 4MRMA 4QFCA 5A6SB 1SHWB 4L9BA 4MIKA 2CVFA 4BP9A 1TU0A 3NGXA 2Y1WA 1OX4A 1K4KA 4D92A 3KSBC 3LK7A 4CM7A 1U6JA 2JK0A 2B35A 3I8OA 4RY2A 3GFBA 1VIWB 3JWHA 2IT1A 3HXQA 2GEVA 4GJYA 2CCGA 2OTCA 4AEKA 3FOCA 4YP5A 1W8FA 1YZUA 5DGDA 4C5BA 1AQJA 4KO8A 5BUVA 4UNNA 4ZJUA 4YZ3A 4PSKA 1EV11 2FFQA 5BUCA 3G0DA 3NDRA 3BCSA 1L8OA 2VQSA 4AJPA 1AQLA 2Y4NA 5LYYA 2PWPA 2XNDD 4FP3A 1NONA 4EHLA 5K0FA 4PZLA 1ADGA 2CMKA 2FPKA 4TQAA 1L5ZA 5E6UA 4U7HA 1O6CA 2KBFA 2W47A 1UIKA 5FWXB 2XGOA 4QB2A 1GVNB 1XRRA 3TW8A 2VJKA 1M10A 1EI9A 1AXYA 4M0UA 1NXD1 4DZZA 4AI9A 1T9AA 2OXTA 3DAGA 2AFHE 4BQ5A 1Z0JA 4C43A 5JFGA 1TA0A 1EP3B 1W6NB 4BIIA 1VC2A 3BJZA 3QE9Y 1PLLA 4N54A 1SWWA 5FL3A 3AX6A 1VYVA 1QZZA 2F7SA 1UU6A 4L3WA 1JYSA 3JQGA 4HAIA 4E32A 2IODA 4KXUA 2VYVD 1JA0A 2VUCA 2JKVA 4X1KA 1UPFA 4AZWA 2ZXFA 2YL2A 4RFSA 4AURA 1VXOA 1B6RA 4L07A 3PC2A 1PN3A 4LF4B 3KD4A 1XPOA 4Q3AA 3UKNA 3WB2A 2EVWX 4A03A 1C7EA 3NV9A 3NV3A 1FQWA 4AG6A 1L7MA 3RWBA 4XWYA 3BL8A 2A5FA 5IVKA 1E1DA 3P20A 4DQAA 4OP1A 3MGKA 1UP7A 4LHLA 3TJMA 1P1HA 4UMVA 4DL9A 1TI7A 4EYGA 4M2LA 1ASJ1 2ISQA 2RHRA 3DEKA 3WW4A 3PEEA 5E95A 3VD5A 4GP9A 2VZ9A 4N5NA 5FY9A 4BVKA 5FYHA 3I6YA 2QU7A 4M4PA 3AHJA 4OUDA 2NP7A 1UJBA 5I9TA 5TXGA 1QG6A 1XZGA 3LLCA 4PRLA 3S2IA 2I8CA 4AZSA 3TRDA 4HB3A 2PHFA 1ZIXA 5KNDA 3R77A 1D6MA 1KEPA 3HBAA 3LP5A 4U2GA 4YLZA 2CY6A 3FA2A 1MENA 1NQXA 4D7YA 3RRYA 4WY2A 3SQXA 5FZDA 3EVTA 4MR8B 1TYZA 1U5IA 3LC1O 3USUA 3Q8AA 3RC2A 4HJXA 4ER7A 4RPIA 3BL5A 3NNJA 1KJZA 3U3KA 1WXEA 3ACFA 6CHYA 3R0ZA 4TKUB 3GGLA 3EA0A 2PAFA 3FNBA 1G3IA 4Z4CA 3KOUA 3GMDA 1CY6A 3DGFC 1PX3A 5BNOA 5BQ3A 1V2HE 2P6PA 1GNYA 3U26A 1SUBA 1BSVA 4B47A 3BREA 2BLLA 4QX2A 2CL6X 3LCJA 2PGDA 3O1LA 1DJQA 3N7AA 1DQZA 4LDJA 1J6UA 3LM8A 4C0HA 1XRUA 2VWPA 3FOWA 2Z8YM 3FVVA 2XEXA 3WQ1A 1CQZA 1KF0A 1ACJA 5FLHA 3TTUA 2IZOA 4QDQA 1ACMA 1U9JA 3OTGA 1HF3A 1TXGA 4Y9UA 4M7RA 1FV3A 3DBOB 3FOBA 4UARA 2EFHB 1VL5A 3TZEA 3JZIA 3HU5A 1SAYA 3I2HA 1AL22 4F3KA 2DCZA 3E6DA 3WWYA 2TNFA 1T3ZA 3UKJA 1WSBA 3L1IA 1T6BY 3KFLA 4YWAA 4ZO9A 1TFRA 3EFEA 1KJRA 3AYZB 4I2OA 4QVKA 3SSAA 3OA0A 3AVRA 3P8ZA 5EG5A 3RS4A 3WP4A 4JC5A 3LPFA 2OXBA 5KKAA 3ZVNA 2LCIA 2ECPA 3ZN6B 2GN3A 1IZYA 3O75A 2DFPA 2WOJA 4A73A 1E2DA 1WCWA 1MFPA 1RHQA 4TSFA 1Z5UA 2F1OA 4HN9A 5EIEA 3AG5A 2WR8A 4TKLA 3M4FA 1WOMA 2YHIA 5FUBA 2A9RA 1PVVA 3FVRA 2ZE5A 1QGOA 4ML3A 1HV1A 1N0IA 3MGGA 4QQKA 5CFQA 3HWRA 2BMEA 3HCBA 4AGGA 1VSTA 4I0WB 2EXXA 5U9CA 1YFUA 4UBNA 4FFHA 4MITA 5EJMA 2F55A 2B34A 2P9QA 4QT0A 4YAWA 3B5LB 2ORWA 1DCFA 5DG2A 5DHQA 3AZPA 2I1VB 4F2DA 4QU8A 2FPWA 4K9NA 1FDWA 3O1HB 3A6FA 4TKZA 4NYMR 1UQXA 3FDJA 2RIPA 2X41A 3OHSX 2KPOA 2JZOA 4PHHA 3FWPA 4JR0A 3GGPA 5J5CA 3M9XA 5FXMA 3ANXA 1XYVA 5B7GA 1X8EA 1OUXA 4AG4A 2R84A 1NQUA 5FUMA 5LRSA 3AJRA 2XA9A 3KJZA 1JHVA 2D1QA 3L7KA 2JJ6A 1QOPB 5DLQC 2HBYA 1I5RA 3TWOA 1SLCA 2QIOA 4RHTA 4BZ4A 5DK6A 3MS2A 4EVSA 3GNEA 3C70A 3OICA 4B81A 3G9UA 3RTAA 3NJ4A 4HKWA 3ANMA 1GNRA 1VE9A 5ULLA 3AV3A 3CVUA 4OXXA 2NTNA 2FYTA 3VR3D 1KO5A 2AZTA 3DOFA 1Z15A 1W6OA 2ZJ6A 2A86A 5EUMA 2IXDA 3D3AA 4FSHA 2GHRA 2GZ1A 4WN9B 1PT5A 1XXHE 5HZKA 5J40A 1Q1AA 2YCLA 4WZBE 4RQPC 1RI4A 1R1A3 3A3KA 4EOGA 1THMA 2BUKA 4YUVA 1S2BA 3QKSB 2W2KB 2A35A 3LDKA 3A70A 3WICA 3KEOA 1SXQA 3C8UA 1S8NA 2R4UA 5K3FA 1A4RA 3GZ4A 4I50A 2PJDA 3VKFA 3AHEA 1I3LA 2YXBA 1ZREA 2VZ3A 2HJIA 4ZGGA 4TQ9A 3L6UA 1AHSA 3VKLA 2HF8A 1JFRA 1LA2A 4A44A 4LXUA 1QG2A 3K35A 3THTA 5KYUB 3DE4X 1MRZA 4QFMA 3WG9A 2X10A 1GOHA 1PNRA 3CDZB 5CKQA 4ZHQB 2HREA 3VD4A 1UX6A 2PH3A 3TQTA 2XDQA 3ELBA 1ZEMA 1JLKA 3ZR5A 1I6WA 3VPFA 4URAA 4XWGA 4G5SA 4U2BA 2F3SA 1J97A 1KMHB 2FF5A 2NO1A 1TME2 4ZOLA 3A28A 1Z0UA 1GGNA 2WSYB 2N47A 4DLXA 1U4OA 1L6IA 2YN4A 4NI5A 3IPCA 4ZI5A 3RFFA 1U04A 2V5AA 2G76A 4ZY9A 4RF2A 1JDNA 2QZ2A 2IXTA 5ICFA 1NPYA 2EJBA 3IEUA 5YASA 5B7NA 2PT9A 4J0HA 4J0QA 3BQMB 3ACHA 1ULAA 3TBDA 4OZXA 1PR4A 1UC8A 4F45A 3B3JA 2IY9A 1TZJA 4KYTA 2PVSA 4L7QA 2D6LX 2PO7A 4JLNA 3BWCA 1V41E 5E2BA 4FYXA 2WZCA 5C4GB 3RCBA 5IT0A 4V1CB 1TW3A 4E8CA 2BFDB 2XSZA 4D6PA 1CFJA 3I0NA 1FFCA 1E59A 4QUDA 4UFLA 4CMBA 1XTJA 4QBKA 2R1TB 3FVQA 3WRXA 1XN4A 3NHWA 3QUTA 5I8TA 3GX1A 3VISA 1DNPA 3W3AD 4QGSA 2BHNA 4A6DA 3SGLA 2A3NA 3N0XA 5IANA 2QX9A 1TAHA 4BFTA 4D81A 1L4YA 2RBKA 4GOND 3LX4A 4WWHA 3SDSA 2Z9BA 1DT3A 2EJWA 5F39A 2ZT7A 3WK9A 1W36B 1JQAA 2P9BA 5HJ2A 4HPKA 1FMD2 4CKEB 3SN6A 3EIFA 3R5KA 1IS3A 3IVXA 4ARBA 1W96A 3I6IA 4NU5A 3LRPA 1AGRA 3QYPA 4ASMB 4ALNA 4CIBA 3V4FA 4JRLA 1PR2A 1EEXB 3LUFA 1C0PA 5J4VA 4CWAA 1JECA 4YONB 4MLCA 1X9GA 2V0GA 4G3YC 1SA0B 2QE7D 3TRJA 3TNPB 1Q0LA 4Q0UA 3D8NA 4YAGA 3JD73 1R0KA 3LY7A 3WIBA 4MGIR 5AXAA 1NLZA 2C4XA 1JDSA 1LB1B 3THWA 1VE3A 2VRBA 2HGZA 4L2NA 3K9FC 2AX3A 2BZDA 1XEXB 4HFNA 2Z1NA 2NQTA 4K21A 3V4SA 4MV6A 4WV8A 4B2LA 1D03A 3HJHA 3S1SA 3DEMA 1RTVA 3H9GA 2P40A 3BD6A 5F3GA 3RI8A 2QN7A 4PIXA 4J6EA 1P1RA 4WVMB 4FQZA 2VI5A 3Q3GE 5JDIA 1VKNA 1V16B 3FBMA 4CEJA 4JB8A 4RMGA 1NBMD 5L3RA 3KQTA 3MDPA 3LF2A 3QP9A 4GYWA 2AKYA 4IIJF 4NENA 3NU1A 1ADYA 3AT1A 2BEWB 3EBOA 5HXAA 2QGFA 3TFWA 4XYXA 4JT2A 3ER6A 4FN4A 4KB5A 1GL3A 3CM0A 3OG2A 1EGVB 3ACBA 1KY3A 2R6GA 4CF7A 1WMXA 5KJCA 4OM8A 3WR5A 1T2FA 3ZUPA 2VMCA 4RAOA 2C5FA 4YCNA 3WGUA 1GADO 4PGGA 5CT9A 2M6RA 4GB33 2OPHA 3HN2A 2IYQA 3TL6A 2NG1A 3HG7A 1W6PB 2GPJA 3UA4A 1L4NA 2A9PA 4TL7A 4E7OA 4C7OB 1HBJA 2VJAA 3PLRA 2FN7A 4C0BA 1YZYA 1T8SA 1Q12A 2VWQA 5CDGA 1LLFA 3ND7A 1TLFA 3AVXA 4PC6A 2XKPA 3RQSA 1P7PA 2XJQA 3G0OA 5TQVA 1MAUA 3R6GA 2F6BA 3OEYA 1RWBA 4UM8B 3ZU3A 4PFSA 3H9JA 5CZKA 1H05A 4NE9A 2G6TA 4CMIB 1B8PA 3PQ2A 1WHSB 2VF8A 1KO4A 5B6IA 1SPPA 4OUKX 2GNBA 2ZP1A 5B7QA 1SUDA 3FYTA 1RD4A 5ABJC 1Y89A 1SRRA 4D2IA 2KE5A 2OD7A 1BJTA 2PWYA 4D97A 3PL0A 2XZPA 2AC2A 4BHTA 3HE3A 2BE9A 3R09A 2ZGOA 1IHUA 2Z4SA 721PA 2EXJA 4G9BA 4R01A 3U4GA 1AUYA 1OMOA 5BXQC 1PV4A 4TV8F 4ZRDA 1J0AA 2AJ8A 4FLMA 4MS3A 3GLTA 1TZKA 3AL2A 4UE6A 1H0HA 2PX8A 5I9SA 2FZKA 3C2UA 1L4BA 3A7DA 4QBHA 3OX2A 4NH4A 4JFRA 4M1YA 3KT6A 3LZ6A 1MQAA 4QAJA 3CMMA 1V8OA 4C20A 1NURA 5HQJA 5I9NA 2IK8A 3SFVA 3PRHA 2YV1A 4TXJA 4FHGA 1J3QA 3PLQA 3E1GA 3AWDA 1E1YA 3PXXA 1R4ZA 4LS3A 2JGKA 3IE0A 1TAUA 3DKKA 5CAEA 4HF7A 4RD2A 5EE9A 2GAAA 5FOTA 1NQTA 4JVOA 1SACA 1XCJA 2R62A 5EINA 1ISGA 4NYJQ 2PZMA 1HYGA 2C95A 3ONVA 5KHOC 1HQWA 4KQ7A 4E5DA 1LJUA 4H7DA 1CVRA 1O58A 3UVEA 5I7AA 4DMRA 5FTLA 1C3LA 5AHOA 1EZZA 3KE8A 2ZULA 3HJAA 5EIXA 3CX7A 3FYHA 4L2IB 1H3EA 3UGQA 2GZRA 2KLHA 3D54D 3MPBA 1G2QA 3C3YA 4L15A 2NSLA 4R4JA 2Q7OE 5DUWA 1X1DA 4EROA 2KS6A 2CUZA 3CT4A 2CMFA 2GMEA 4DM4A 1PK7A 2CFTA 3H4TA 1YO6A 3B9BA 3BMCA 4H6XA 5DKFA 2CWDA 1RUNA 5THKA 2V72A 5L19A 4FZ3A 1YBHA 2ZI6A 1PZHA 4TUYA 3OZVA 3KLNA 1MH9A 3ZYHA 1CT9A 1RXIA 1NKVA 2DXIA 3RH0A 1TF2A 5C53B 1DWQA 3M3CA 3LAWA 1IYZA 4CCMA 4BE9A 5TX7A 2G7ZA 2PHUA 2CU5A 2NXCA 3FF4A 5LWHA 4TVOA 2CLEB 1W2WB 3QLTA 3CZQA 1DQRA 1RXEA 1GA6A 2HHJA 2RH8A 4YROA 1POV0 3GD5A 1M0TA 2RGXA 3MRXA 1QQTA 1Q8VA 1GITA 4DRXB 3VD3A 2J7PA 2BFMA 2JAHA 3THCA 3T5TA 1SXJD 1QB7A 1JXQA 3ZYFA 2OESA 4LRWA 1P7WA 4GC9A 2C7BA 1H6AA 1LUAA 3C7AA 5AT1A 2DE0X 4BRSA 4JGYB 2DUMA 1LLUA 4N9IA 1QONA 1EDBA 3RUAA 3LEIA 3ZV4A 3SJ7A 2QRHA 2W9XA 1XLTC 1GP5A 5EXEA 4X8PA 4EYOA 1UP6A 4DUGD 1NCQC 2ZREA 2ZJ5A 4HADA 2V3VA 1ZZ6A 3VR0A 3P4UA 3R6TA 1RHI2 4E4HA 3O1PA 1EVEA 2BWCA 1X1RA 1BXGB 4JBLA 5K3EA 2P2DA 4KQGA 1AR83 2ZXUA 4Z49A 5KYYB 2VDQB 2XNJA 1KJYA 4X45A 4WNAB 1YWGO 1KYZA 2GAIA 3VR5H 4Y0VA 3THXB 3MWGA 4QGMA 1HTTA 3SE0A 3ZDVA 5JAHA 3Q0IA 4CIWA 1C7IA 3EMRA 4E4YA 4DXAA 2GRUA 3DJYA 1T3SA 2WS93 3GT0A 4LJ7A 2WQ7A 4AEDB 2BOVA 4HRYA 1LXCA 3EGXA 5ALFA 4KXQA 4Z8YA 5CA1B 3W04A 3CUEF 1GV0A 4KDCA 1YBVA 3CZAA 3ZQKA 1XJQA 5FHQA 2OHHA 4MXWA 1SBTA 2R1VA 2D4AA 3LO5A 5EYXA 4G2NA 2ZUFA 5LQAA 2BNOA 4KREA 1QKQA 3ZHCA 4RKRA 4HB0A 2C84A 5LCXA 4AL9A 3JYLA 4IIHA 2ZIZA 5HKAA 4A7KA 2EWWA 3DLCA 3T7SA 2P41A 1MEJA 4OHYA 1CWPA 4DDTA 1TFUA 2H2IA 4US0R 3ZV7A 1Q7RA 4ZO6A 3GJBA 2B4QA 4PQRA 3K72B 1LVHA 2QD4A 3LY9A 3DYBA 1XNHA 3LLUA 3QQ5A 3WFZA 3R6SA 5E1DA 2IEAA 4NCHA 2QXYA 3AB7A 1E3LA 2DF7A 1U6KA 2ZGTA 5FY5A 4L0QA 3SEZA 1GRRA 4FI9A 4Q1CA 1JWBB 5LQJA 3II6X 3ZXGA 4EJ6A 2MSCB 2R66A 3KYIB 3ZWDA 4MZDA 4IOKA 2VMIA 3QWAA 3ESQA 2BMFA 4RVHA 3AMNA 1AKYA 1W5EA 2BSQA 1E79A 1VSBA 4ZP1A 1VBE2 4F9FA 2FQXA 4HD8A 3WWPA 5FOXA 1K45A 5EIAA 6GPBA 3NFRA 5IKMA 4LF6B 4DB4A 1UDCA 5IK7A 4B4VA 5DNAA 2D2XA 1YQ8A 1N1GA 3OPVA 5A5DA 1OAOA 1W49A 1GT91 1H0KA 3UXHA 1X13A 3EO6A 5ICMA 1NDUA 5IFKA 4QB1A 5DABA 1T5DX 3DXZA 5ETJA 2VD7A 2YHJA 5FO7B 1V5IA 3P2JA 1TMF1 4ZEWA 1XSRA 2OWEA 1GM5A 1EAH2 1XTVA 4P3PA 1KR5A 2IPAB 1FXWA 4YMGA 3N2GA 1YUDA 4KQXA 5KNBA 2XWJB 1D0VA 2H29A 4BMEA 5M5BA 3PIJA 1TNDA 4G5XA 4UVDA 2EX1A 3W9BA 4J1XA 5JOQA 3C6BA 2Y1XA 4II3A 4QGHA 4YYOA 1QX4A 3QELB 1TCUA 3ETNA 3DV0A 4IIYA 5FZCA 1N6NA 2R063 1L9KA 4ZDJA 2WO7A 1UEIA 5DQ0A 4HDCA 1H2WA 5ABPA 3N8KA 3U07A 5DYYA 1T9KA 2YY1A 3DWFA 1A69A 3OQIA 4LYFA 2W2MA 3B6IA 2XLBA 3AJ9A 1NA1B 2J3DA 3FDZA 3HO1A 2MWMA 4HVAA 4PONA 3AEUA 3ROTA 1TU3A 3B00A 5IM4F 3L9JT 3ES1A 3D1VA 3ZFEC 2OKCA 4QQHA 4BX8A 4AWDA 2NPOA 5FWNA 4UVHA 3FUXA 2NMNA 5T3NA 3ZCXA 2X42A 3WP1B 4DR4B 4UHCA 1LGYA 2ODNA 4ZVOA 1IS6A 2B6HA 4M60A 2IUYA 3WXMA 1I1OA 5FPXA 4NQRA 4B4RA 4IOMA 1O97D 1W34A 3Q9LA 2X8WA 4ZT6A 5I6DA 3FJSA 5EPAA 4LSMA 4H0NA 2ZI3A 2AN4A 4CEIA 5JCJD 4IEXA 4G2TA 1Q8PA 1SVWA 1YZNA 2P6UA 3K1AA 4MR9B 4OB6A 1G18A 3QH7A 1ZGJA 1KRXA 2JG9C 1PJZA 2GN4A 5F1YA 3QEMA 4A7YA 1A1SA 1NVVR 5EE0A 4FWTA 2XTAA 4KR2A 3VZNA 4J49A 2NTEA 3FSRA 3ASIA 4OXKA 1YGPA 5JAIA 5AM5A 4PC1A 3BULA 3LYUA 2FPUA 3WNMA 1KJJA 3ZHRA 4YV0A 2FUNB 1BGVA 5CFPA 2X5OA 4W9MC 2WFLB 4JOSA 1QIMA 5H3CA 4LQ4A 4JDUA 4RVCA 5BSKA 2LCQA 1ZZCA 2D1FA 4R4ZA 1DJNA 4MGZE 1MOPA 5C1PA 2HJVA 1URXA 4J25A 5EQFA 2D59A 4TXHA 2FRDC 4G0YA 5DHTA 3VBFC 4B75A 4LCEA 1UC4B 2AHRA 3CW9A 4DCSA 1N2ZA 3L2HA 5I4IA 1UOJA 1HNWB 1W4CA 1C1DB 3QLQA 3PPIA 4HDNB 1N7GA 3K8ZA 4FFBB 1XZAA 3MWEB 2IEGA 4PBTA 2CMHA 1IM5A 3BDAA 5J4HA 2ZQZA 5BURA 3F5QA 1DBIA 5KVQA 5ACA1 1JJAA 4ZZ3A 4QFBA 3KSMA 4WI1A 4YMWA 1HUQA 3ERCA 2Z42A 3EVBA 4HYTA 3AYAA 2P77A 1Y7IA 3G2PA 2AE2A 4ZCPA 1L5GB 5A9SB 4JSTA 5K6AC 4Z92B 4KEAA 4L28A 3N0VA 2YRXA 1EDDA 4LJ8A 3KB8A 1MS4A 1PNTA 1PKXA 1IVYA 2B2XA 3FZNA 5CK4A 4RD1A 3GM8A 1NQOA 2JECA 3MMPA 4HAYA 4JXJA 2PLRA 1A5ZA 3W4KA 5H9SA 4BEVA 1RABA 5E6HA 3OMWA 2FSFA 1UU5A 3DKRA 1Q8OA 3M3HA 4O25A 4B45A 1KDMA 2YJNA 3AF3A 3B85A 1LHNA 4U7JA 3VR1A 4GNRA 5IVVA 4E2ZA 4QRIA 3FRJA 2XYQA 1U0JA 1CRPA 2GSYA 2DETA 1L3CA 4X20A 2A0YA 4A82A 1XEWX 5GADl 2XLFA 3I4CA 2E37A 1O96B 5FQ0B 1VMIA 4FONA 1L7VC 4HL0A 4LORA 5E88A 3R9KA 3IPAA 1DEXA 1T3LA 8AT1A 3E2PA 1TJYA 3VH1A 4DGQA 4Y6OA 4QDSA 5H3HA 1M0SA 4GQAA 4KC0A 2WUGA 3MINA 2I1QA 3A10A 1VCNA 4BNTA 3C5WP 4CLRA 2P37A 2BZGA 5AJHA 4WCFC 4BNDA 5L4LA 3IOCA 4OATA 4CEWB 1P4GA 3BQNB 3GAMA 3TUJC 1E1KA 1WKVA 3U1XA 1KMNA 4YW5A 2FFHA 4IV3B 3GYBA 1GA1A 3VR4A 1R0YA 4KPGA 1YRBA 1AR93 2LALA 2FW6A 3DYPA 1BAPA 1K2VN 2Y1LA 3VPXA 4B4UA 3RYPA 1NVTA 3G49A 1BEV3 3S0MA 1M6VA 3OQNA 1LHVA 2Y1FA 4C7JA 4ENPA 2OB1A 1C3JA 4NG4A 4MRMB 3PT9A 1YDEA 1R091 2C2MA 3A1SA 2NADA 1R3UA 4KUHA 1DADA 4ZXFA 1OX4B 3TCKA 4HXYA 3H8VA 2Q0QA 2G06A 4JLMA 5ERXA 2VLIA 4XF3A 1ZH6A 3UK1A 5A6ZA 1Q0PA 3MWDA 1IDOA 5KC6A 1S8AA 3TZHA 3ENQA 2C5DA 1IHOA 4DLWA 2YN0A 1O08A 1UJCA 2FPMA 3HXOA 4L02A 3O93A 2WE8A 4LJYA 2I7DA 5G0UA 1OWNA 2YMQA 1AY0A 2HR1A 1YZGA 3E9QA 3H04A 3W3ZB 1RL3A 2DT8A 3PNPA 4HAVA 2F4PA 4GPTA 5JNUA 3PE6A 4BLRA 3A8TA 4JUDX 3MIBA 1FX1A 2ZPTX 2QYTA 4JBXA 1VHQA 1NJ1A 1J21A 2RI1A 1DQ4A 4AI1A 1IBLB 2YS7A 1Z7S2 2R0QC 1L7QA 5LUAA 5E6UB 3RG2A 4OXNA 1MQ8B 1EVIA 2AFIE 3L77A 4WKBA 3T0FA 5I5GA 3U3OA 4CL3A 5F21A 3PKIA 1IXKA 4BDSA 4R9BA 3TW8B 2C57A 3P6BA 1HB3A 4N48A 4N43A 2VCHA 5C9AA 1W2UA 4XUQA 3Q8CA 2CK3D 4D45A 3OCXA 5LA0A 4OJTA 1UKEA 4P3YA 2UVDA 1A27A 3HMYA 1GNSA 3IHWA 3LSDA 4RANA 4IQPA 3BIWE 3JQGB 4NV3A 3VD9A 3FZ3A 1OH4A 1MW8X 2AOTA 1G8KA 4A5OA 5F5NA 3GNSA 1NVBA 3L1JA 1GZHB 4F2HA 4JUFA 2B8TA 5C7GA 4RFSB 5ERGB 2O5EA 1SCBA 3UPDA 1PL8A 4CUAA 1YT5A 3UXEA 4BL5A 3WNBA 1EDOA 3CZ5A 4GE0A 3K3OA 2FPLA 1NW9B 3NTUA 4MKXA 3BMOA 3CYFA 3TSAA 3EJ6A 2XZDA 2JE7A 4ZAXA 2EF0A 4J07A 3G2OA 4LX8A 1NMXA 4N82A 2D7DA 1KJNA 4PDWB 3KUDA 1N33B 3D31A 3W3AH 4LLFA 3GLUA 5M7EA 4LBOA 2ZRKA 1DAOA 4W6QA 2GHQA 2PLV3 3N3BC 3X1JA 1KZYC 2YFKA 1DFIA 4UQLA 3D6VA 3R7BA 4DXRA 4EPWA 3CV3A 2VQ0A 3VXKA 1ECBA 1QU0A 1TT7A 4FGSA 2P2SA 3K4AA 4OUDB 2QZJA 3CJTA 1M2VB 2F90A 4OP3A 4P54A 5F23A 3RK4A 4MGYE 1M9NA 1X2EA 4HGNA 3WNDA 5JATA 1JU3A 1Z5VA 1XK7A 5BYKA 1R9MA 4FPEA 4UVIA 4R16A 1USVA 3USUB 4WZAA 2VSYA 5HX7A 2XZOA 4BASA 2XKJE 2QNBA 4BWVA 1YB7A 4AXXA 4O2BA 5DHSA 1SOWA 1IPHA 4AHWA 2RFLA 5GMOA 1IL0A 4Y1VA 4BKUA 4L51A 4YJ2A 4JUIA 2Q1FA 3HSYA 1U6IA 5B30A 5ALDA 4QGFA 1NQVA 1XPUA 1GN9A 4LUCA 4PZCA 3LFTA 1S1MA 3BHJA 2VPQA 3TR6A 4R8LA 5UKDA 4WOCA 4ALLA 3NM6B 4JA2A 1SCQA 2ONJA 2Q45A 2XZLA 4KI7A 2F3RA 2FZ2A 1N2EA 2WTAA 4YQZA 1JEJA 4POAA 1E63A 3GLQA 1LZKA 3B2QA 2TEPA 4KQCA 3FPBA 1PYDA 1VG9B 4MV1A 2CWWA 4UHKA 2XA1A 4YPOA 2QQUA 4O63O 5FI3A 4IDQA 4EKNB 2PZFA 4B33A 1QO0A 4F9GA 4S1NA 2VOEA 1Z9BA 4FD3A 4X91A 4Y26A 4L0PA 2C59A 1T9CA 2CLHB 2L42A 4NIHA 5KCMA 1G8YA 3D5OA 4L4YA 4AKGA 2H63A 2DUPA 4XUEA 3LL4A 1T8YA 3F5MA 3DE7X 4S2EA 2BTQA 3A6LA 2B42B 1MDFA 2WTXA 4CKWA 4HFRA 3QBEA 4FGKA 4DZGA 3O4GA 1H5QA 2VBBA 4C4XA 2JNWA 4ES8A 2VKTA 1MB2A 1BW9A 2YC2C 4HLUA 1CDDA 4QYXA 3CBQA 1E8DA 1VBA2 1C8LA 1WNFA 4YWHA 3WF4A 2HNBA 4RPHA 1RJGA 3KZNA 3TQOA 4DQKA 4C3OB 1K27A 3L7IA 4DS3A 2HHLA 2WAXA 2YHIB 4HWSA 1F4AA 5J9FA 4HDSA 4P2GA 3AY6A 3P96A 2RB4A 1YIPA 5JTTA 3VR6D 3GT4A 2F64A 4RABA 3MUNA 4BBPA 2H4FA 4XR9A 1CNEA 4XOGA 1G9DA 5FMOS 3KT0A 5AVAA 4K0RA 2AEJA 4BQWA 3ZMOA 3JD0A 4GMP3 4FPLA 5C8CA 3RS9A 2I71A 1UPSA 3SX0A 5FF9A 3RIYA 2O0LA 3K70D 5AK4A 1ZC4A 4D46A 2XMZA 1LTQA 4V0RA 3UHOA 4B4DA 1RM0A 3VDQA 1KEXA 4LDNA 4I3GA 2NYAA 1U0NA 3UMSA 4AGVA 2YWGA 2C20A 3OF3A 3RHFA 2ID7A 3OJ0A 1MB4A 1AZSC 2B9VA 2H2FA 1X3SA 1UOPA 2BUCA 4JI1B 3V7NA 3EASA 2WP0A 3H2SA 4KL8S 2XBMA 2C7QA 5FPTA 2A4MA 4N90A 1NXPA 1FP7A 5L7YA 2XE7A 2WWSA 3G2NA 1RXGA 2YFUA 1R8YA 5HILA 1NUKA 1JFFA 4EG6A 1SZDA 3GWGA 4ND8A 5BQFA 2W42A 1BS2A 1MVLA 1RVDA 1KC1A 5KMGB 5B3LA 2JFVA 1VA4A 3ZM8A 3I54A 2CAVA 1FFHA 1RXYA 5IW8A 5FZ6A 1EMDA 5DZSA 4FQ8A 1Q44A 4WKGA 1RPAA 4M1KA 4RZIA 3VTZA 1SFYA 1OAKA 2GYWA 1RUF2 4MVJF 2P65A 1EVQA 2QRLA 3BTVA 3GN1A 1EPUA 3SC4A 1PZ8A 1G5RA 5LDGA 4PYKA 1GWMA 3QVWA 4FVTA 1X9HA 4DMFA 5FPLA 5K3FB 4E13A 2H9AA 3OM1A 1BHGA 4I50B 5BXXA 4FJ2A 1ACLA 2JJYA 2CGOA 3H1EA 2J6BA 2QW1A 1V8DA 2NNWB 1W59A 4RCYA 1KH3A 1VSVA 3KQNA 5TPWA 3P27A 2IZWA 3TSOA 3TIFA 2DPGA 4OK3A 3JQPA 1CLUA 2VDPB 2X5KO 4GH4A 4WFJA 3D7RA 1CW2B 2XDQB 3AR2A 2IHNA 2VRNA 3WCSA 4NBUA 2WJAA 2HRBA 2QLNA 4EHNA 3U2QA 2ARKA 2MINB 4ZOLB 4CIYA 3U48A 2W0SA 3TLMA 4B6PA 1H2FA 3MXTA 3JRXA 5FPPA 2WJPA 1HE4A 1JYCA 3B5IA 5FMOL 1QG0A 1YJKA 1Y1SA 4B3JA 3ABOB 2QD3A 2E82A 1RXUA 1Y1QA 2AG1A 1IHPA 5DNVA 4M1TA 1XU1A 2R7LA 2YWHA 4DJFC 5AM2A 4X71A 2E51A 2NTVA 5LEJA 3UEOA 3LUAA 5IMSA 4ATEA 1NLYA 2H06A 1NE2A 3O74A 4B6FA 3VTAA 2PD4A 1YTLA 4UTVA 4C0QC 2UAGA 2BBWA 4IV1A 3MM4A 2ZSKA 3OC6A 3DSRA 5LCWL 3L2YA 2HSJA 5M29A 2WRZA 3PUXA 5JCTA 5J1XA 1W0KA 4WV3A 2VCAA 4UMEA 2Q4RA 3W2EA 3JAKA 3DKWA 1NJFA 3ZZMA 1SO8A 4Y9DA 3VX4A 2BC9A 3R5JA 3PNOA 4OHVA 1YHZA 4QOSA 2ZTUA 2CVHA 1TJ4A 1LBQA 4DWOA 1NR5A 4O4LA 5BV8A 1UM8A 4RO0A 4HPKB 3UHJA 2IGTA 3FPHA 5ISLA 2EZUA 1JG7A 4LWPA 2V6BA 4GVLA 1IJFA 4Q00A 3QUBA 1NYTA 2JIGA 2G88A 4KLNA 3LW8A 4O4JF 1I2DA 1QO7A 4P8RA 5K0CA 3RREA 5HZMA 2WDPA 3ZLJA 1E7SA 4JEMA 1COV3 3DT8A 3O7WA 1Q0SA 1JXAA 4B76A 2VTKA 2EJTA 2A9JA 3QBJA 3AP4A 2YV4A 1ZSYA 4R41A 3SMQA 3ER8A 1GTZA 5ALOA 4C4RA 5AVTA 1QHYA 4DUWA 2YOHA 2ZX2A 4NBRA 3RVLA 3PI6A 2ZOEB 3FRHA 3QBTA 2D44A 4RPCA 2JJMA 3BXOA 3FLBA 2I4NA 2M98A 4XTCS 2ECFA 5HOQA 2BFNA 2O4UX 4AJKA 1E6WA 1W88A 2NQ8A 2Y1KA 4XGRA 3PGJA 4IV5A 4NFHA 5K05A 4ODIA 3R5XA 1R4MB 3K1JA 3E81A 1IZ9A 1RRGA 2H2HA 3IUYA 3VKGA 3MMNA 5DNEA 4EPVA 2E7ZA 3MCUA 1D2QA 2CLFB 4UFKA 4FFVA 1E5TA 4Q01A 3OQVA 3PEYA 1QRRA 4IH9A 3B5JA 3N59A 1JDJA 2MNGA 3AF0A 2BEUA 3EXAA 1RMYA 3U39A 4D4IA 2AJBA 1PJSA 2JDHA 5K7PA 4NENB 2XB2A 4GX0A 3MJFA 2BTOA 2DUQA 4FPKA 2XVMA 4P7JA 4N0DA 3VZKA 5GVRA 2QG4A 3RS7A 5L7OC 4G8BA 1RUJ2 3CKMA 1C28A 1R1A2 3OHMA 1HQCA 4FYWA 5ELMA 1OD3A 5FOVA 4UFNA 3A0KA 1V6MA 2XWPA 4FGJA 2OUKA 4CM5A 2QX8A 2C4HA 3AHFA 1VI2A 4MAFA 1UF2C 2QUAA 1MEC2 1HEYA 2XQFA 4S3MA 1ZG3A 5IVHA 1W2AX 1QFSA 3O8DA 3DS8A 4CNQA 4IG9A 2G40A 4MV2A 4CCKA 3QVOA 4QGBA 3HDYA 2Q5CA 1GGFA 1XJAA 2Q5JA 3H5NA 4RVFA 1QJFA 1QIHA 3JYPA 4LT5A 2W6JD 3CG0A 4JB3A 5D6NA 5FDFA 4NZNA 4YASA 4JCKA 3SH3A 1UOOA 4I1PA 1VAVA 2JEZA 3W5HA 3BCHA 4DMLA 2BV4A 5AVJA 2WYHA 1SPPB 1LDGA 1IY9A 3KQWA 4JENA 4B43A 5BYNA 4OHZA 4RGVA 3U3DA 3BRQA 3QKTA 1QYIA 3WJ1A 4DCPA 4Y2RA 4DR6B 3AL0C 2P9GA 3LGAA 4G0ZA 5DW0A 4YIHA 1FSPA 5FYCA 3Q3CA 5C1DA 4HGRA 1MJHA 4RD4A 1XCGB 4L4SA 3EZGA 4TVKA 1UMCA 2ZSDA 3M33A 2VQUA 3AHCA 2QBYB 2ZYGA 2YROA 3D81A 3T35A 1NVXQ 3RC9A 3C8XA 1FRNA 1YBFA 1CIVA 4UCXA 3NHMA 4W9NA 5DMHA 1WPRA 2OUIA 2JIRA 2A4KA 3QA3E 2W2OA 3HNBM 2P9EA 4FPOB 2PQSA 5CAEB 2DVAA 1SXJC 4HDMA 2HCJB 2GEJA 4YRCA 3F2IA 2FUKA 5ELLA 3KM5A 4PANA 3DAYA 4LBQA 1S3GA 1EWRA 1SVUA 1II9A 1PE0A 2XUIA 3L43A 1DPGA 4F4FA 3PXAA 4TTIA 2VHWA 1W47A 3CX4A 4YGBA 3C7TA 4D9IA 5LY1A 4Z3KA 1WM1A 1JZ5A 2CLMB 3MMSA 1MS1A 3RUEA 4CP2A 3PDCA 1GTJ1 1PCXA 1PIV2 4JJ8A 3AUSA 3NWBA 1MRNA 3HJCA 1U0RA 1JG1A 4LKEA 2IZ7A 3VPGA 2VQTA 5A3NA 3OKCA 3EZYA 1U3FA 4H7HA 4WN3A 4NOKA 4IQ0A 1KEWA 1BXKA 4IJQA 2H4XA 4CTNA 2P8JA 1VE6A 3ZY5A 3O0XA 1PJTA 2QEQA 1RACA 1Z4JA 3UYKA 1ZOPA 1I3HA 1F2TB 3BMCB 2H1OA 4BQPA 2HEIA 2IH5A 1OGIA 1AYN2 3IAPA 1IN4A 2UUBB 5JPCA 4TUYB 2JL1A 2GNPA 3Q4GA 4GKAA 4I3PA 3LC7O 4KWIA 2FRVA 2CNWD 4FT4A 2OAP1 3X1ZA 2DAPA 5HRUA 3KU4A 1BMV1 1JAHA 2JS7A 5A4IS 4KACA 1MNQA 4OH7A 3JCZA 4AZ3A 2ZRGA 1RPNA 3F1LA 3BZUA 1B16A 2JFFA 5ALHA 4P80A 4KQFA 3UWOA 4JGZC 2OYSA 3LV8A 2NV0A 4HVCA 1QLHA 4LX0A 4IXDA 5LP1A 4YW1A 4OQMA 4LZLA 2AACA 2XGMA 3JQ9C 1K89A 1CUXA 1N2HA 2NM1A 3UIEA 1DKPA 1U8UA 2GAJA 5A1AA 1U3UA 5HMMA 1DELA 1JU4A 3UHAA 4CCAA 1J8QA 3NWPA 5HF6A 4RY0A 3WMFA 4YI3A 3WNVA 3PU8A 3X2FA 2C0QA 4KWCA 3KQUA 3KV4A 2A1UB 2FLWA 4M0HA 1G3RA 4XW2A 5C7LO 1PHPA 3ZDZB 4AYTA 4IO1A 4Z86A 1ESEA 5B7PA 2P1RA 4LYYA 4P22A 4RFT0 1Z3IX 2F9LA 4XASA 3A1FA 2FX5A 4PPNA 1Y7LA 4Q4CA 2QMZA 2RJNA 5HMLA 2PLFA 3R3SA 2QMEA 2IYOA 2BDUA 4LC9A 2J3QA 2YJ4A 4GXRA 2VF7A 2J31A 1Z63A 1RWVA 5IZ4A 3OPQA 1TQDA 2IWRA 4GB32 2CUNA 4AR2A 4OGKA 1QJY1 1UMHA 3HRHA 4WM7C 1Z07A 2M1XA 3BXXA 1AG9A 3K0SA 2RS53 5B12A 1K7SN 2WTNA 3C15C 4CI9A 1FLAA 2POQX 3GRZA 1CR0A 2OS2A 2RMU1 2YZ2A 3KEFA 3TRFA 4XJ8A 1WXGA 3I58A 4U7TB 4GLBA 3NC4A 4QBTA 3FDIA 3F6SA 1F9KA 3TN93 3ELYA 1TL7C 1OUSA 4P84A 3G0HA 1P5HA 4OO3A 1X7DA 3EGXB 4FZ5A 2PHRA 2FPGA 4G86A 3DDUA 2ZX0A 1D4AA 3LC0A 3NATA 5AKLA 2G8NA 4N47A 1RUI2 2PR7A 1I94B 2G82A 1MQSA 2B1QA 4DMMA 3IQHX 1HQNA 3PXBA 4MXWB 1P5RA 2R1VB 5HGJA 4ZD6A 2PHTA 3ZS8A 4LR4A 4DY3A 4YFYA 2J3EA 1RUH1 1XRJA 3KKMA 1CYDA 2DCMA 2W08A 4E22A 5JW6A 3HPRA 1SHTX 2AKEA 2ICAA 4J1TC 1KGSA 4NIDA 4QECA 4GS5A 3QUAA 2HNKA 4D4MA 1XPRA 1W90A 3CUYA 3EAGA 3Q72A 4WM8C 1BU8A 5IAJA 4MHTA 2FPPA 2GN9A 1Z68A 1JQ3A 3ADDA 3LGRA 3KXKA 2FU5C 4YJGA 2AW5A 2GSWA 4LYDA 1AQ6A 3VC2A 2WFZA 3ZGXA 2R6AA 5F37A 2O3UA 4L97A 2OYRA 1EJ2A 1KQRA 3KKNA 1KDPA 1ORHA 4QXKA 3LBIA 1O97C 5DYGA 5FWYA 1QWRA 4EYSA 1JQEA 4MYRA 4Q27A 2UYAA 4NBTA 4MHUA 3EC7A 4UFIA 5A3SA 2BONA 4TLLB 3HT1A 4F6CA 4FW9A 4L8FA 3W59A 5D1IA 3RJ2X 1T4BA 1JR4A 2GPSA 1VBB2 4YUZA 1NNI1 4UCFA 2O48X 4LC0A 3UM9A 5LKRA 3GJSA 1UADA 3R5TA 1Z6ZA 4XIIA 4HNQA 3FBYA 3ZHZA 1NNUA 2QRNA 2DVFA 2VEDA 5FRAA 3O0TA 3KOWA 4YI5A 2IS1A 3W0LB 2OV6A 1OU0A 2PS9A 2I99A 3IMMA 4KFSA 4IEYA 2VVDA 3FWZA 1GLGA 1K6JA 3DV0B 5EFOA 3JWPA 1T3TA 5KOJA 4XI9A 2VCCA 5CPFA 4LV5B 2ZTHA 4E6EA 3KETA 1RMQA 1GZ5A 3LA2A 2OXIA 4ND3A 5A0FA 4DG9A 3F47A 1LQUA 2IFTA 3MICA 3PRKE 1X9TA 3OQIB 1DARA 3DO6A 4LGVA 2GT1A 4G1MB 4R5HA 4ASUD 1GLHA 4ZU4A 2YB7A 5CFCC 1AKTA 2C92A 5BNTA 3I6BA 3AEUB 1JIXA 1GNPA 2P9ZA 3PEUA 1JR3D 3RHZA 3HGQA 3A06A 1XNCA 4LISA 2GC1A 2JCGA 4IRUB 1QVZA 4EWEA 1J2JA 4RL7A 4BB3A 1YJQA 4IESA 3UPUA 2R1ZA 4GOOD 1JS9A 5AYVA 2R16A 4Q4W1 3MT9A 3NV7A 1NBME 3DDHA 4QARA 3NLLA 4IDPA 1PWHA 4KQ2A 2BGWA 3L7LA 1I5OA 4BGDA 4MRPA 1CJUC 1SCIA 3E03A 1P2TA 4NLLA 2XOXA 2HQRA 1X87A 4D56A 4R8HA 2NSYA 2I74A 3FMPB 2JCXA 1C29B 2XVLA 5BYBA 1CUSA 1KIMA 4CEIB 5JJCA 1CONA 4D5EA 2R49A 3CGGA 2FZ5A 2J3IA 2VL7A 3K1AB 1Z56C 3LA3A 3P9IA 3HAGA 1AQYA 4M86A 2AEYA 3QEMB 5FBRB 2X5JO 4XC9A 3GGCA 3HLTA 3SNHA 3NYRA 2E5FA 1UZNA 3W6OA 1ZRNA 5A06A 4XHXA 1DZRA 3DOHA 3IN9A 4KBYA 2FN4A 3A6EA 1NW7A 4WVVA 5MGBA 1MZPA 1WBFA 4CDNA 1WMEA 2Z09A 1MNAA 2AK2A 4YGCA 3BBPA 4DLUA 4LKDA 1LTHR 3INTA 1QFYA 2R8YA 2LCFA 2PH7A 4F2WA 4WW0A 1W1UA 3WYAA 3KWMA 2Z4TA 2DBQA 1VBD2 5JMPA 5AJTA 4TN7A 2J45A 4QWNA 4RGQA 1N5MA 3IKWA 2FOLA 3EDRA 4LHWA 1WRBA 3ONEA 2CXNA 1K6MA 2O6HA 3PGLA 1XTTA 3D0KA 2UZ4A 4YW4A 3CPJB 1UKRA 4KGZA 3RVJA 3UY4A 1NTOA 1QH6A 3TDMA 1SIWA 3T2TA 1W94A 1WB4A 5ER6A 1A8DA 4CMKA 2RBGA 4QHSA 3TTVA 3WMEA 3B6JA 1UY3A 2O3TA 4BO2A 1CUZA 1XD9A 4X63A 4W6XA 3L0BA 2UZ3A 2C5BA 1IQAA 2ZUCA 1SOAA 1B1AA 1I36A 2Q1SA 3COSA 3MCWA 3WLMA 2OK7A 2GPAA 3HCCA 2WT1A 1ND3A 3SLIA 3S8YA 5GONA 3N58A 1TYEB 4O4HB 3PHHA 2Y2VA 2D4HA 1XYOA 1HXS3 4FGZA 3MTDA 1A2BA 2EGHA 5ICEA 2E4ZA 1DKUA 4S2GA 1D2CA 3AJ8A 3KR1A 4EA9A 2OIIA 1Z7GA 2RCNA 2WTUA 3HA2A 1Y7TA 4A23A 5KVSA 1D04A 1KZ1A 5DOZA 1AXGA 1SIBE 3Q6MA 3G23A 1MXFA 5AI8A 4I30A 4IETA 3LA8A 3CNLA 4LXTA 1KH1A 2VZOA 4RCVA 3CBGA 3L7CA 3RUDA 4CUKA 1CYEA 3LCUA 5ADVA 1FJ2A 4BNHA 3ZSKA 1B6TA 1BQPA 5FA5A 4ARAA 2Q3HA 3OQJA 4XYLA 5KYWB 4QGNA 3U7GA 4NOJA 1MP0A 2VR1A 1I4WA 3GY0A 3CWZA 5JQGA 4PBSA 4JUCA 1TTQB 4YUYA 1J3RA 1TCVA 5AKIA 5KJFA 1U4SA 2CB0A 2P0AA 1X94A 4P5DA 5KS2A 1FC0A 3MINB 1VE5A 4EB6B 2WJSA 3ZK8A 4D9KA 4CLRB 1PGJA 5ANNA 4H7JA 5HGXA 4BNDB 4WVLA 5CG8A 1P2SA 4MDYA 4EGJA 3FGNA 1YL6A 2MTBA 1E94E 3KVBA 1EUUA 3OFNA 3IKLA 1I9CA 3ZKWA 4G4JA 2QENA 1ORTA 5DULA 5K3CA 3OUIA 1CWUA 2CXRA 1IZ0A 1YIOA 1OPOA 4MB6A 1CF2O 2P6RA 1O3TA 1M6VB 2VUTA 4ZPXA 3WK7A 2WQZA 1I4LD 1Z0KA 2QRPA 5T6MA 5DXFA 5CNJA 4LRYA 1R66A 1OH7A 5BNPA 5T50A 3WGJA 1FOD1 1ZRCA 5JE8A 5B4XA 3QBDA 2H0AA 4RW0A 4LKRA 2GC2A 1SXJE 4PS1A 1ZNXA 2OFFA 3BK7A 4GKBA 3GRPA 2RS33 4OUMA 1U2QA 2VDUE 4Y2TA 3MWDB 3X1MA 2G4VA 4REQA 3W1VA 3SHWA 2DHQA 2IL1A 3CNQS 5FP0A 3A26A 4M0FA 4ZYXA 4IDNA 2HYIC 1KRWA 3HQUA 4FAGA 3VV2A 3WZMA 4BC0A 3TM4A 5DGHA 3N8DA 3NB0A 2D3SA 5JOWA 2O2IA 5KVCA 4MGHA 3T7JA 2HIAA 2YBEA 3IDSA 3T2PA 5AHWA 4KR0A 3KLOA 3UUGA 3TNFA 1HFEL 1Q1ZA 1NVKA 1O94C 1JKMA 1MO3A 4U8GA 4A2CA 3PUQA 1AMNA 4O2RA 2H9YA 4DC0A 1ZN7A 4I0BA 4PAMA 5JWRA 3DW3X 1OXCA 4WXEA 3JVIA 1ECGA 4N43B 4M89A 5CLQA 5C9AB 3B93A 4HVRA 3PDHA 3AG6A 2OOSA 1O95D 2B82A 4WXHA 3RDPA 3RTBA 2FSVA 1W5AA 1JQ5A 1XTIA 3MTBA 3PPWA 2GVDC 4I6EA 3CF2A 3JSXA 5HF9A 3U31A 4DLVA 2BU9A 3BGWA 1UXXX 2AOTB 5KSOA 1HJFA 5DHFA 2UV8A 5EMKA 3P52A 4COWA 2WNEA 1IPSA 3C1AA 3NUQA 3HR7A 2Z43A 3EW7A 1MT3A 4DMKA 2XR4A 4MO3M 4BQFA 5D3KA 5IYZA 3H0EA 4UEJA 5EWLA 1TRKA 3GT3A 2B7BA 4MGIE 1R9GA 2ILTA 4OGLA 1LPNA 3BMOB 1QVWA 3D2CA 4PZPA 3DLTA 4B3SB 5DLEA 2NYUA 2I7VA 4DPLA 1TK3A 3SNKA 4LMRA 3AYXB 1EA5A 2Q0XA 2F8SA 2FJPA 5A5EA 3OESA 4FD2A 4ZONA 4YRRA 3RSGA 3FBGA 2BZ1A 1NJ5A 4LIUA 5LP6F 2RM22 4Q4Y3 2B9EA 3E3MA 3KZOA 3ODGA 3GJQA 1DRKA 5A2GA 4RS3A 4R3UC 1WBLA 4NS4A 2WG0A 2P3IA 4R8MA 3V0BA 4PZUA 1GFWA 4HWPA 5TPZD 3QUQA 3UJHA 4BRUA 2J3KA 4BJ5A 4NMHA 1N2IA 2QAGC 2H31A 2HMAA 3OWOA 4LIPD 1CAUA 3AI2A 3RVOA 3OOEA 2SKDA 3ED1A 1FNZA 1VALA 2PJZA 2WINI 4KHZA 5F3EA 4MRNA 1V0JA 4V3CA 3QVMA 4Z82A 3C41J 5CNMA 4AQ2A 3TQFA 3B8HA 1A7UA 4S2UA 4HMOA 1MPTA 1TVMA 1M2OA 3LMKA 4LRQA 3FFZA 2ZBDA 4MB0A 3TSYA 4L4UA 2JBHA 4UAPA 4Y1EA 4EDHA 2GETA 4YJ2B 1RZ3A 1TLLA 3BA1A 5AVXA 4HBGA 1U0BB 4BLPA 3K70C 5GIPE 1N6OA 1W73A 5ECYA 4R98A 1K5MC 4LPSA 4F72A 4GEKA 5FYVA 4OQDA 1FRVA 1YFYA 3B9IA 1F2DA 5KDDA 5FQOA 3DWIA 3K0FA 521PA 2ORIA 4Y0AA 4XIKA 4I81A 5DGCA 5GZFA 5FT9A 1I80A 1VRWA 4RJLA 4BJ1A 4X8MA 3SLGA 2JH9A 1ZN8A 2QUOA 2H0BA 3WL5A 1ZW1A 3EJKA 2HJ9A 4OQ9A 3DMPA 5SV5A 3PG5A 4QOHA 3P9CA 3ZH2A 2PBLA 2HZ7A 5CB0A 4YMLA 3BRWA 2GK4A 1L3JA 1ZRFA 2IPXA 2E0IA 4OFZA 4K1XA 4QODA 2PU7A 3A6HA 4LJ6A 1JB1A 2HXGA 2D0DA 2Q2VA 1XLVA 1ZJ4A 5CDFE 2VTXA 3E4DA 5J47A 2QDKA 2OOKA 3KC2A 4NNJA 1SU7A 1WL8A 1J33A 3WINE 5IFTA 2BTQB 3CRRA 5K0LA 4PSDA 3SEAA 2PX3A 4CKWB 3WY6A 3Q9UA 1O8PA 4A2PA 3IAHA 4D3ZA 3ACCA 1JA1A 3IH5A 5DU2A 3RTCA 1JEAA 2SBAA 4QPCA 3M1AA 1DKQA 1CZUA 3TNLA 2KB0A 2VJQA 3EPPA 2VZRA 4FOPA 5G1PA 2NUAB 1RHMA 1AKWA 5BRNA 2C4VA 4KG7A 1VIVA 1V6NA 1TGVA 1WW8A 3A9SA 2V6IA 4HDSB 1GRQA 4I4CA 4JLJA 5BQ5A 4MSVA 4L0DA 1QHDA 4RSRA 1UXIA 1W44A 1HL3A 4XWTA 5C8CB 4HGPA 3ROGA 4E94A 3PTRB 1H9AA 4M8IA 3DYMA 4CDMA 1IOVA 3OSDA 2A30A 3KV3O 5A33B 4LMPA 3ZJUA 4JA0A 3H1AA 2WK1A 5KC5A 3D0SA 5J1TB 4OX9Y 3TKYA 2ODPA 3M9WA 2AYHA 5FPUA 4BXSV 1KMMA 1CIJA 1ETUA 1P1FA 4XSGA 3TNQA 5IFLA 2EQAA 4XTRA 3GFTA 1P7CA 1X1AA 5LBUA 4CKYA 5AVUA 3QVXA 1UKVY 1K4YA 3KUXA 3I1IA 4ND8B 4NESA 1H22A 1E2QA 2ZJ3A 3TZKA 2IOHA 3W2GA 2VK4A 1XX6A 4M3CE 2W00A 4JCCA 4X8NA 5JO9A 2FK8A 3M3DA 4PE5B 5FTWA 3ZDDA 4INJA 4GR5A 3TLKA 4D25A 1L5NA 4M4RA 3HJTA 4ONUA 2UU9B 3GELA 4NYIQ 4QEDA 4F84A 2ODQA 3BFPA 2RHDA 2AZMA 5DJ5A 2QE6A 2BP7A 3MIDA 3FPEA 1QS0A 2V7BA 3KYCA 4FDTA 4ARXA 1EFCA 2JFHA 4OI0A 3F8WA 3KQKA 2O54A 1ISFA 4ENTA 4FSDA 3Q87B 1GFF2 3EARA 2F1IA 3MVEA 4FHZA 1QOZA 3FB4A 2VDVE 1SN7A 1NU6A 2BKLA 4Q15A 1OFIA 2FG7C 4UOZA 1FATA 4ET7A 3WAGA 1U63A 4C1NA 5IC4A 2E32A 2ZYVX 3GBGA 1N0VC