3IIIA

1.95 angstrom crystal structure of coce/nond family hydrolase (sacol2612) from staphylococcus aureus
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
558
structure length
556
Chain Sequence
QHLLGNPKLTVTHVNEVKAGINHIVVDSVQYGNQEMIMEKDGTVEMRDGEKLYINIFRPNKDGKFPVVMSADTYGKDNKPKNMGALWPTLGTIPTSSFTPEESPDPGFWVPNDYVVVKVALRGSDKSKGVLSPWSKREAEDYYEVIEWAANQSWSNGNIGTNGVSYLAVTQWWVASLNPPHLKAMIPWEGLNDMYREVAFHGGIPDTGFYRFWTQGIFARWTDNPNIEDLIQAQQEHPLFDDFWKQRQVPLSQIKTPLLTCASWSTQGLHNRGSFEGFKQAASEEKWLYVHGRKEWESYYARENLERQKSFFDFYLKEENNDWKDTPHVIYEVRDQFYKGEFKSASAFPLPNAEYTPLYLNAENHTLNHAKISSAHVAQYDSEDKQQDVSFKYTFDKDTELVGNMNLKLWVSTKDSDDMDLFAGIKKLDRRGNEVNFPDFNHIENGQVATGWLRVSHRELDQEKSSIAQPWHKHETELKLSQDEIVPVEIELLPSGTLFKQGETLEVVVKGSEIVIGNSTPGMKTRYEHEETVNKGMHMIYTGGKYDSQLIIPIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CocE/NonD family hydrolase
publication title 1.95 Angstrom Crystal Structure of CocE/NonD family hydrolase (SACOL2612) from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus col
molecule tags Hydrolase
total genus 189
structure length 556
sequence length 558
ec nomenclature
pdb deposition date 2009-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02129 Peptidase_S15 X-Pro dipeptidyl-peptidase (S15 family)
A PF08530 PepX_C X-Pro dipeptidyl-peptidase C-terminal non-catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3020.20 Mainly Alpha Orthogonal Bundle alpha-amino acid ester hydrolase ( Helical cap domain) alpha-amino acid ester hydrolase ( Helical cap domain) 3iiiA02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3iiiA03
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iiiA01
2OGSA 4K6KA 2QUBA 2HYXA 3IB3A 4JX0A 4DSZA 2R7EB 2I78A 2O2GA 3H0CA 4J0GA 4DMHA 3I1YA 5AM0A 5ALXA 5I0DA 2ROQA 4G8DA 3VVMA 1SC9A 2R11A 4BTLA 1DX4A 1ACLA 5HF8A 5LCWL 3AUKA 1DINA 5EGNA 5LLSA 4WY8A 4GZ9A 1P8JA 3DYPA 2WHPB 2WQ8A 4FBMA 1YSCA 4QDZA 1VXOA 5DYYA 3ZLUA 5CTAA 4XVHA 2XUGA 2HLEA 1AQLA 2B20A 5EHNA 1ODSA 1XRRA 1XZDA 3QBJA 4N8DA 2HU7A 2VCAA 4J0JA 4AN0A 1IVYA 2QM0A 4AO7A 5IH7A 1QO7A 2WFLA 2B9VA 3WL7A 2O2HA 4IHAA 3K4ZA 3WSOA 1ETHA 4TPKA 3DDUA 2VZTA 3FBWA 5ALLA 4UBLA 3W04A 5D7BA 2VZSA 1O6FA 1X2EA 3H2JA 1UMHA 1CUGA 4GWJA 1HL7A 5JD5A 3K2IA 3SKVA 3W05A 3WIBA 2HU5A 2WBKA 3PI6A 4D8MA 1K8QA 2Y2VA 1AKNA 2BUAA 4BVLA 5LZ9A 4L0CA 3VDCA 3K77A 3MO4A 1CUSA 3K4DA 5CW2A 4L9AA 2BFNA 3HNYM 2QJWA 1NU6A 1QTRA 2JGIA 4QA9A 5IVIA 3NJXA 2XMSA 3LCRA 3I3BA 1XZLA 4AZ3A 1GKKA 5I8PA 1QFSA 4JUIA 3BN6A 1A8UA 3D3AA 1YA8A 3C7GA 1THGA 3R3WA 4P93A 4DYHA 1CZTA 2YH2A 1W99A 3DOHA 1W75A 1ACJA 2EEPA 4W1PA 2J1UA 4E15A 1DT5A 2G5PA 3B12A 2ZYRA 2QTBA 2H9YA 3A70A 3THCA 2XUOA 3M81A 2XQJA 1CUEA 3K6KA 1Y37A 3WQBA 5IFPA 1Y7HA 5C81A 2J1AA 2R8BA 3A6ZA 4W8JA 4A23A 2QQKA 2WJ6A 1XRQA 1PV1A 4XURA 2BGNA 2PL5A 4HXEB 3P1IA 4H7DA 4NMWA 5ALHA 4I4CA 4CIBA 4MEAA 2JGKA 2YG0A 4A4AA 2X5XA 5AOAA 3K9BA 4UUQA 4LXGA 2Z8XA 2AJBA 1XROA 2HDWA 5DYWA 2W1QA 2CB9A 2YB7A 1TKRA 2XDWA 4FWBA 4UBJA 3H04A 2PBLA 5DJ5A 5JYCA 3HI4A 1CUJA 1VXRA 3QITA 2G63A 3HJUA 1HN1A 3PDCA 1XQWA 1EXWA 2WO3A 5ALFA 2C58A 4K6HA 2VOTA 3ZPXA 3ESBA 1KU0A 1UT6A 1N1MA 1BN6A 1HDEA 2JGEA 3DECA 2JE8A 4CG1A 1DU4A 3OURA 4UOJA 1DQZA 1EI9A 4DNFA 1JZ4A 1PMJX 2P8SA 4AN1A 4OB7A 3G0CA 4QLAA 3WMRA 4KACA 5ALKA 4BJ0A 1ZGBA 1BN7A 2XT0A 3DEAA 5AI5A 3F8SA 4WDRA 5K3AA 1CR6A 4PW0A 2VTVA 4BATA 2WIGA 3GDBA 3O4GA 5C8VA 2ZYIA 4CUCA 2WTNA 5LA2A 1EVEA 3G0GA 4DSAA 1EDEA 3ZI7A 4KWUA 4JKKA 2WUHA 4Q3OA 3UUFA 2QS9A 5CT9A 3G9XA 5K3FB 5J3JA 3V1KA 4GW3A 4HG6B 4X85A 5ALYA 5JANA 2FUKA 4XZUG 4KRYA 5B4XA 2Y8KA 5JXIA 4LKOA 1US2A 4GWLA 2WUFA 5AKIA 5DMYA 1BU8A 3WYDA 3KXPA 5BWCA 3R3UA 5FPQA 2PSEA 3V1LA 4RPCA 2OCGA 3GZJA 4X00A 2JEZA 4U2GA 5T4HA 2OGTA 2BKLA 1QZ3A 1K4YA 5ALIA 2Y6HA 1XZEA 1JYVA 3HSSA 1QOZA 3KOOA 4KJXA 4MADA 2JGMA 2BZDA 1LLFA 4UBIA 4UFPA 2XONA 3R0VA 4B83A 3VD9A 3ZWQA 2L9LA 2Y6LA 3VJMA 3T2QA 5JMOA 2XMDA 1QO9A 4D9JA 4DXTA 2WDBA 5AOCA 3I6ZA 2CJPA 2X10A 4KMQA 5KWJA 2B4KA 3R3VA 4QWWA 3GUUA 4TVKA 4Z49A 3IDAA 3LP5A 3FLEA 1OF3A 5AKZA 4EY6A 4QPWA 2WTMA 2J1SA 2QVBA 3X3HA 1XLWA 4W1RA 2Z4FA 3OEBA 3C43A 2J1RA 4MQLA 5HZGA 5JXHA 2Z3ZA 1CIJA 4MGSA 5FXMA 3ETPA 5T4FA 3BJMA 3C5WP 4J0DA 4ETWA 5JD4A 1BHGA 3R40A 3FSGD 4ZWNA 1K6EA 3E0XA 4A6OA 1ZIYA 3A7QA 5AI4A 2DQYA 1ZI9A 3CKHA 2O7VA 4B82A 4KAAA 4P08A 3D2AA 5EJ1B 3GBSA 2YASA 5DWDA 5D3ZA 5HKAA 2VJDA 4Y7DA 4NZZA 4ZV9A 4Y2TA 3PFCA 2VO5A 3WNLA 4G4IA 4WCVA 3WF1A 5AI0A 2Y6VA 1T4MA 4K2AA 4ZV7A 1GOHA 2BGRA 3W9UA 4FNGA 1Z68A 5E4TA 1QLWA 4FTWA 3FHQA 2DR0A 2H7YA 1PX3A 4DIUA 1BS9A 2WUDA 2XMQA 5AH0A 4DNOA 4XVCA 5FDFA 4QX0A 1SCQA 1P0IA 3WKEA 4AQDA 3K75B 2OXEA 2HFJA 2VZPA 2QUAA 1HKHA 3PICA 1VE6A 4UHCA 4N5HX 2VQUA 5ALNA 4C4YA 5A2GA 2HA5A 4EY7A 3FWHA 3O4JA 1TAHA 4OYUA 3HN3A 4EY4A 1BCRA 3EQ9A 4X91A 4FOLA 4RE5A 2C7BA 5K3BA 1JU3A 1L7AA 5CZKA 1JI6A 3QPAA 1GOFA 3AZQA 3OEAA 4XIIA 1XZAA 4P02B 1S8OA 2G5TA 3MV01 2ONCA 4BP9A 3P2MA 1IUNA 2YFUA 3WKDA 3C6ZA 4AG4A 3GGLA 2ES4A 1ZJ4A 2WO1A 2C0PA 4G4GA 4BVJA 3CZJA 4P00B 4GXNA 1GZ7A 1X70A 2ZEZA 4G9EA 5AIBA 2XUQA 4X90A 4CUAA 4YX9A 4JYMA 5CXUA 5AOBA 1CV2A 3AJAA 3WA7A 3CZUA 4X6YA 1H2YA 3G0IA 5CRIA 4JEIA 4CFSA 5HQ3A 5C8ZA 3I6MA 1J06A 2C5GA 3VJLA 3HNMA 2VQ6A 1FFEA 3T2PA 4LHSA 2OKXA 1DTEA 1GU3A 5JALA 3WQHA 1UK6A 5JAUA 4UBKA 3WNMA 2W6CX 1TRHA 1J07A 1Q0ZA 5FKJA 1DWQA 3HACA 4J0KA 1VJ5A 1EH5A 3DD5A 1YB6A 3MUY1 4H35A 5ALGA 2HA2A 1ZD3A 1XZMA 3MVEA 4W1QA 5J1XA 2Y6UA 1TVGA 4KI5M 3C87A 1CUFA 1CUAA 3IAPA 1BE0A 2WAOA 4Y2RA 5G04L 2LIPA 5HFNA 2VCCA 3PF8A 2WHRA 3O95A 3I2KA 5EIYB 5ALZA 5C8XA 4QX2A 1XC6A 3WNPA 2W92A 1UOOA 1EK1A 2PM8A 2GZRA 2VT7A 3H2GA 2XUAA 4MYDA 4CI9A 5FUMA 2QT9A 3H1AA 2XUDA 3O4IA 1ODTC 2XMRA 2RONA 2QBXA 3FLAA 4DGQA 3D3NA 1B41A 4N8EA 1J83A 3LLCA 4QDXA 1U2EA 2XQXA 3NGMA 5ALVA 5LZ2A 4DEVA 4J0IA 4LYEA 3LE0A 5AKXA 4QE3A 1JYNA 4MOAA 1N5RA 1QIFA 2E31A 3R3ZA 4BZWA 3WKBA 3KWFA 2WFLB 2AJLI 3T2OA 4H7HA 2UZ0A 3OPMA 2BGOA 3LEIA 2C0QA 2QR5A 1XRNA 1H2WA 3DQZA 2QQOA 2JDAA 4WJLA 3I97A 3M82A 2H7CA 3AZOA 4Y2JA 5HCUA 4HZGA 3M83A 1W8OA 3HEAA 2BUBA 2D0DA 2Z5GA 3OOSA 2VJAA 2JD9A 2WAAA 3WK8A 4CUBA 3N2ZB 4G8BA 5CYYA 4ET7A 1IUOA 3QPCA 1WHTA 4X3CA 3PUIA 5JAOA 1O6GA 5IFTA 2HIHA 3HABA 3L1JA 2DHDA 2X76A 3W5MA 1XQVA 3SK0A 3ZV7A 4YK7A 3W5NA 4BZZA 5FPPA 2RGUA 5IHRA 5LZ8A 3S8YA 3NNGA 2IX9A 2AJDA 3HNBM 3GROA 3IVMA 3ZLVA 1NUKA 2VMCA 4P9NA 4BK4A 1CUDA 4X6UA 1CEXA 3LEKA 1FFAA 2ECFA 2Q0XA 4GI1A 4DUVA 1NU8A 1FFBA 3H2IA 1CFJA 3RKSA 5ALWA 1D07A 2C5FA 3E3AA 2VJXA 3ACGA 2LW8A 3T09A 1HPLA 1G5FA 1ORVA 5SYNA 1TCAA 1LPSA 5AM1A 4KAJA 5AM3A 4OYYA 2XLBA 5BOVA 2WIJA 3WNOA 4XUNA 1QTIA 5HF5A 1O59A 4MWSA 1WHSA 4QB1A 2H1IA 2CUTA 2ZSIA 1F6WA 1FFDA 4JYPA 1LPMA 1MX1A 4ROTA 2VR4A 1R9MA 2W5FA 2ZYSA 2W87A 1N5MA 4L0PA 2WILA 4XUQA 3LPGA 2DFPA 3UETA 1E8NA 4G4JA 3M3DA 2RI6A 5EIEA 3UNPA 1XZGA 2J7MA 3FYUA 5JD6A 2VF2A 3U1TA 4LXHA 2WIDA 4QDSA 3MV11 2CBGA 1UYZA 1T2NA 5LKRA 4KE9A 4EA6A 1KGYA 4DXRA 3JYHA 3F97A 1UKAA 5ALSA 4AX4A 3WIOA 1MU0A 3WWEA 1XRMA 3QMVA 4W1SA 3AIOA 2OQVA 4FLMA 2BJHA 2VMEA 1D7PM 4A16A 3ICVA 3T4UA 3CIHA 5DTIA 3QYJA 5E4JA 5ALPA 1XLVA 1JYWA 4ARYA 3ESCA 1XKLA 1M33A 1ULPA 1EHYA 4BCCA 5E4YA 3SX4A 5ESRA 3TJMA 4GBGA 2BGPA 3ED1A 4AO8A 3KWJA 1CUUA 3C5VA 1E3QA 3BJRA 2WIFA 1EUTA 3BDIA 3P6BA 2HRRA 3O0DA 2FX5A 4OU4A 4X71A 5ALDA 4W50A 2PKYX 4W9RA 4QNNA 2DCJA 1MPXA 5DNUA 1XLUA 2OQIA 4H7IA 1W9WA 1CQWA 4FKBA 1EINA 4OPMA 3BIWA 3G9UA 2EIEA 2XQFA 1LPNA 3LEGA 5AM2A 3E4DA 1XRPA 2EDAA 2CKMA 5A1AA 1ZI6A 3DOIA 2KD7A 4FMPA 3CCBA 4HS9A 3WWCA 1JZ8A 4C4XA 4OYLA 5K3CA 1W6RA 1MO2A 3VKFA 4H7KA 5JADA 3ZLTA 4BC1A 4A3ZA 3DS8A 3A21A 3D7RA 4B7ZA 2ORZA 3HXKA 2EDCA 2WG2A 4EB0A 1DYOA 1GXSA 3C7FA 3OGVA 1QGED 5DTJA 1YS1X 1GGVA 3EQ7A 3E1GA 3G0BA 4QWMA 2EIBA 4W4ZA 3WF4A 3QH4A 4PT6A 1J84A 4BP8A 2IITA 3DKRA 4X6XA 4PO3X 1CZVA 4X92A 4IUGA 5F7UA 3KDAA 5KBYA 1QIDA 1HBJA 3I2GA 4UBOA 2XMZA 4DM7A 4MJ3A 3FVRA 4BB0A 3NRUA 1ODCA 5IJRA 5CXXA 1LPOA 4GDMA 3MUNA 1NKGA 3CN7A 2WU4A 4ARXA 3WF0A 4QEKA 3T08A 3WWPA 4AMYA 1UYYA 1MAAA 2W91A 1KEZA 3GELA 2J1VA 1CZSA 3SKJE 3WJ2A 3OG9A 3YASA 1DLCA 3VD3A 2W1UA 4FBLA 2WZ8A 4EY8A 1XFDA 3ESDA 4H18A 1CUXA 4DLNA 2VZRA 4QDQA 4QDRA 4B9AA 5AI8A 2XUKA 1UY1A 5AKEA 2OPHA 3IIIA 3QZUA 2XLCA 4AB1A 4ZXEA 4YPVA 2WHQA 3BIXA 5IYYA 3WNNA 4XUPA 1UOQA 5D3KA 2XUPA 1JZ7A 2DSNA 2AXEA 4WFIA 4DMCA 2VJCA 2XQIA 1BROA 1L7QA 4LKSA 4L3WA 2C26A 1BEEA 4XX1A 5AK6A 3IBTA 1DP0A 4BRZA 1PJAA 5B4NA 2C4HA 1RWQA 3PF9A 1A7UA 5DLPA 3WL6A 4FLFA 1CUCA 3DYVA 3JW8A 4HXGA 3BGAA 3ACIA 1NAEA 4DTCA 4C88A 2ZEYA 1E8DA 5IVKA 2AJCA 1T2XA 4U2FA 1G66A 1LBSA 4ZGBA 4ZXFA 2JIDA 4ARAA 5HF9A 5DN2A 6YASA 1CX1A 3AZPA 1X2BA 5DNVA 1CUYA 4U2EA 4U2CA 1WB5A 3U0VA 5FLKA 3WNKA 1NX9A 1CUVA 3HJRA 1CUHA 2DCKA 2PUJA 1BRTA 5CBKA 3E1F1 3FL7A 4RN5A 2W1SA 1UY3A 4Q82A 1LNSA 1GT6A 4HVTA 1XZFA 2CZQA 2Y6KA 2VCBA 4DEQA 5E2IA 2VZQA 3H19A 2VM9A 4DUXA 3EIOA 5EJZB 5HQ3B 4ZI5A 3ANSA 4NVRA 4AXBA 4F5ZA 1GQPA 5CT4A 3HRHA 4IQ4A 4BDTA 2D5LA 1UK7A 3WK6A 1C7IA 1PFQA 5ALTA 4BXSV 4YASA 2GYVA 3FCYA 5AK5A 5EHXA 3A22A 2I03A 1JFRA 4BE4A 3ZM8A 4C6HA 5JAHA 2VAXA 2XUIA 1E89A 2EIDA 2JKXA 4MEBA 1MTZA 4Y2XA 3UMJA 3WZLA 1MNAA 5A71A 3VISA 1AC5A 1GMMA 2WABA 1A8SA 4FNMA 2XQKA 4UHEA 1IMJA 2V98A 3IUMA 4X93A 5A62A 1F0NA 2XE4A 2W46A 3U37A 5JXJA 5JXGA 2JGLA 1CPYA 2WSLA 1WB6A 5FUIA 2NW6A 3QMMA 1EX9A 3VXKA 2OAGA 3NUZA 4KAFA 3HLKA 1UOPA 4GLBA 4B6GA 1JT2A 5C71A 2VSQA 2J1EA 4BDSA 3MUOA 4JKMA 4I3FA 3IUJA 1R3DA 4X95A 2CMFA 1YAJA 2JBWA 3FYTA 5K3FA 4INZA 2ORYA 2DDUA 2O2IA 3G0DA 4Q34A 4N8SA 3TGLA 2RJ2A 4CCYB 1OILA 4M0FA 5A7FA 3HYSA 4UHHA 3H17A 4IH4A 3SEEA 3QM1A 3WEZA 4DNPA 3R3XA 1ULOA 2AJ8A 5BV7A 3WWOA 4E11A 4IO0A 1GOGA 4Y2VA 5LZ7A 1SOMA 3WL8A 2VATA 2V96A 3STVA 1E5TA 1BEZA 5LZ5A 1DWPA 1IZ7A 1LZKA 1IZ8A 2PSJA 3C70A 1THTA 3DCNA 5G05L 4YPJA 4Z2AA 2E26A 1QIKA 2GBCA 1DT3A 3WA6A 4M4PA 1SCKA 4H7EA 3I2IA 3WLAA 2XB6A 3FYUC 1CIYA 3STWA 2PU7A 1MX5A 4HAIA 4DXSA 3FHAA 5HPOA 2BCEA 2X05A 3S2ZA 3A2LA 2HL6A 4M0EA 4ARBA 5F4ZA 1K45A 5H3HA 2YXPX 2JGFA 1JZ6A 1LPBB 2ID4A 2WG0A 3OTQA 1JZ3A 2O7RA 1H22A 4EUSA 3I2JA 3F2ZA 4G9GA 4UPDA 1OH4A 1P0QA 1VZ3A 3OGRA 2HRQA 1TIBA 1ISPA 5ALUA 5DPNA 1I5PA 2QZPA 2XUJA 4B0PA 3FAKA 3HZOA 4BYMA 3BF8A 1G4HA 1OT5A 3VDAA 3D0KA 2Y2UA 4QDTA 5T4BA 4E8CA 1UY0A 3WF3A 3NQHA 5CMLA 1UXZA 1CLEA 1R50A 2IIVA 2WM2A 1O8SA 4BTVA 3AIKA 5AM5A 2J22A 1GPNA 4QLOA 3KSRA 3ECQA 2QXTA 4JNCA 1W52X 2WQZA 2ZXQA 5IVHA 2WUEA 3LPFA 2PSFA 3G7NA 5SYMA 4CG2A 1ZICA 4O08A 5BWBA 5EIAA 2WN3A 5JARA 2XUHA 4J7AA 5D6OA 5KREA 1A88A 4C89A 5EHZA 3PFBA 1RYYA 4Q3LA 2XMGA 3I6YA 2HA0A 2WFZA 2YC2A 1QIEA 3Q8WA 4P92A 3IULA 1VKHA 4PSCA 2J4CA 5ALEA 1MN6A 1J2EA 3CN9A 3N0TA 2OGZA 3EYPA 4CU7A 3D5EA 1K42A 3FYUB 4XWGA 4XUOA 2ORXA 2GBIA 1XKTA 4MGQA 3G9TA 4Q05A 3TEJA 3F96A 3C8DA 4L72A 2PSDA 4CU9A 2W47A 3GFFA 5AKLA 2XQGA 4J0CA 4MWTA 1AMNA 2HA6A 2ZSHA 3O9MA 4JH0A 4Y2PA 1KEXA 1TQHA 5CT8A 1WCYA 2DCMA 4BK5A 3UUEA 2QQMA 3F9CA 2XMCA 1W76A 2QQLA 1EDDA 5LZ4A 4X94A 4PF1A 3AILA 2VAVA 4RGYA 3D2CA 5HKBA 3ABZA 2VQTA 4WDQA 2PPLA 4OMCA 4QZVA 2LS6A 4E8DA 4OSEA 3T0DA 1ORWA 4HXFB 3C7OA 4KR0A 2V72A 1H2XA 1US3A 1U4NA 5AKHA 1WM1A 3H1BA 4G1FA 5AP9A 3IURA 2YYSA 2XMBA 4Y2UA 4AO6A 3WWDA 2Y6GA 5CH8A 3OGSA 3RM3A 4BAZA 3T0BA 4KRXA 4WY5A 4BCBA 1XQXA 4ZREA 3GA7A 4CU6A 2CDPA 3GM8A 5JAPA 4QX3A 1UYXA 4BCDA 3C6BA 3SWWA 2OCLA 2HHAA 1VA5A 3DJYA 4BVKA 4DUWA 4QB2A 4G8CA 5AICA 4A44A 4B84A 1USWA 4UFOA 2OLEA 4B80A 1EA5A 1ZD4A 4H7FA 1QIGA 4W63A 2QOEA 3L1HA 2VEOA 1EK2A 3QPDA 1QFMA 4GEGA 3O9VA 2WLSA 2WU3A 3DL4A 1UY2A 1R1DA 4Q1VA 5LIPA 3JXSA 5AK3A 5JZSA 4A5SA 3RARA 5AI9A 1XZHA 4Y2YA 5DQ0A 4X7BA 4PV7A 1H6XA 1F4HA 1W9SA 2W94A 1DWOA 3V48A 4AZ0A 3V9AA 2W1WA 4IH9A 2V9ZA 3G02A 4EZIA 5I9IA 1GPLA 2CDOA 4UBMA 2XHNA 4GHWA 3I28A 4BDVB 2J4FA 3ANTA 2QJRA 4OB6A 2WJ3A 1FJ2A 2PQSA 4XUTA 4PSDA 1TG7A 1GQRA 2XI4A 3EQ8A 2PSHA 3DYIA 2HFKA 1UK9A 4OUEA 3BWXA 1LBTA 2ZJ6A 3IA2A 1SHWB 1F0PA 3VJKA 2ZVDA 3CMGA 2W9XA 4F21A 1XPWA 2B61A 1FFCA 3HOBA 1JJFA 3IUNA 5EIHA 4JKLA 4MQMA 1VA4A 4OB8A 1K5PA 2W22A 4N5IX 4J0HA 4LQRA 5JUVA 1LPPA 4PSUA 3DYMA 3WK4A 1QIJA 1BCSA 1CUIA 2ACKA 2E32A 4U2DA 1JJIA 4QB6A 3HC7A 2OCKA 3PUHA 1XQYA 3VDXA 2WZEA 1JI3A 1W8NA 1WOMA 3FLBA 4KYVA 4B0OA 3ICWA 1JU4A 3B3QA 1GUIA 2HM7A 2Z3WA 1E8MA 4FDMA 1UK8A 1UKBA 2QQJA 4BAGA 2PVSA 2QMQA 2VMDA 3BL8A 1ZD2P 1OF4A 3G8YA 2VT6A 1UXOA 3WK7A 1JJBA 5JATA 4FFVA 4A42A 2RV9A 4J3JA 1R9NA 2WHPA 1EB9A 3PE6A 4FLEA 4XJVA 3C6YA 3ESAA 5EI5A 1EDBA 3EBLA 1MJ5A 1SFRA 4H77A 4B81A 5KWIA 5AM4A 1LPAB 4CCWA 3MBWA 2PX6A 1RP1A 4LYDA 5JIBA 2RAUA 2H7XA 1YAHA 2OG1A 5HF6A 4OU5A 4QAWA 3KD2A 3OB8A 1JKMA 3STYA 2GYUA 1J1IA 1OCEA 1K12A 4K6GA 2VZUA 2WO2A 1VLQA 3I2FA 4NS4A 4PQEA 5FRDA 3SC2A 4A45A 2J3QA 4B85A 1HQDA 4K5QA 1EB8A 1N8SA 1KU6A 2Y6JA 1XZIA 5AKGA 2VMFA 1UWWA 3RLIA 1EUUA 3I2HA 2W3JA 5I7UA 3VVLA 1P0PA 4V2IA 5ALMA 2VA9A 3JWEA 7YASA 2HA4A 4KE7A 3DKKA 4FFWA 5AI6A 1CUWA 3H2HA 4AAXA 5JR2A 4F60A 1U65A 1UMIA 2WIKA 1QJ4A 3BF7A 5CH3A 3WZMA 1W1IA 3VD4A 3AC0A 5HK9A 4S0XA 1CVLA 4FHZA 2OCIA 2WJ4A 4H7JA 3THDA 4UHFA 5IKXA 2VZ3A 4B9EA 1IQDC 3F67A 4GECA 1SCIA 4C01A 4EBBA 1A8QA 4OZOA 1CUZA 4C87A 1CRLA 3EF3A 4OD0A 1PMHX 2JEYA 3UESA 1OXMA 2QXUA 2GBGA 1K63A 5T4EA 1TCBA 1YQ2A 2V5DA 3SEPA 5FV4A 2WN2A 2QQIA 1O8PA 5ALOA 5AK4A 3FVTA 2BBAA 1WPRA 1XZJA 2WG1A 2E3JA 1AGYA 2JF0A 5EFZA 3STUA 4Q3KA 2VZ1A 1MNQA 1K3IA 1H23A 3DLTA 1JMKC 2GZSA 5A6VA 1G42A 3C8HA 3OC0A 3MUZ1 4TXWA 1JZ5A 3V1MA 2X09A 3WF2A 2XUFA 3W2TA 3WL5A 5LA0A 5AKJA 2PUHA 5FP0A 1WKYA 2DQZA 1JYXA 3R3YA 1F4AA 1FSSA 2RIPA 2Y1KA 4MYSA 5HXMA 1UZ0A 3NOXA 4J03A 4RE6A 2X8BA 4TTGA 2C4XA 3A23A 1WB4A 3NJVA 4JHZA 3CXUA 4EY5A 1UWCA 4Y2QA 1TCCA 3HEIA 5CT6A 1GPKA 5A7HA 3D59A 2JGJA 4F0JA 2DHCA 3D2BA 1UX7A 2VTFA 1AZWA 2HU8A 4X97A 1QONA 1DX6A 1ZI8A 3VDBA 4WFJA 4HTAA 2ZEXA 5LYYA 2VJBA 4ITVA 5AKYA 3FN9A 1UFOA 1LZLA 4G5XA 5K3DA 2FJPA 1W4LA 5AHXA 1UY4A 1AX9A 2YC4A 1I6WA 2VZOA 3OG2A 4LPLA 4HRYA 3C6XA 5DNWA 1YB7A 2HA7A 3I3DA 1B6GA 4BE9A 4GWIA 3MGAA 5DYTA 4QDUA 3WYNA 4DMKA 1MX9A 3BDVA 1ZIXA 3LS2A 2EICA 4UI9L 3NWOA 1H6YA 2BAGA 4IH1A 2V97A 4WFKA 1R88A 3K46A 1QE3A 2WYSA 2V4VA 3STXA 3C7HA 3J7HA 5A7GA 4CG3A 4MO3M 5HFAA 4M0MA 3WKAA 4C4ZA 4UBNA 3C8XA 3VD7A 2GBFA 3BE8A 2W95A 4HRXA 4BC0A 5FOQA 3CQOA 1W9TA 2WFMA 1Q83A 2VC9A 3EB7A 3L1IA 2XOMA 1VOTA 3I3EA 5C7GA 4KE8A 2GYWA 1HLGA 2ZJFA 3T52A 1YA4A 5K5EA 3IAQA 3WI7A 1XZBA 2HADA 3A2MA 4P5YA 5ALQA 2ZJ7A 1JMYA 2DHEA 5YASA 4ZZ5A 4I19A 3STTA 1R4ZA 1C4XA 4BRSA 4RYDA 1F8UA 4E46A 1U8EA 1TK3A 1GKLA 4KEAA 1ZD5A 1MAHA 1Q0RA 5HK8A 4BBZA 4PQQA 3DL7A 5EHQA 3G9ZA 5AIAA 3H2KA 4PNZA 1C7JA 2I3DA 3ACHA 3W06A 1R64A 1YS2X 3B5EA 1YASA 1DQYA 3F98A 2C9KA 3BXPA 2Y64A 1YR2A 1H2ZA 2ZEWA 3CCCA 3OM8A 1XNTA 2QKYA 4OUKX 5ALJA 4M4RA 1Q84A 5CURA 3Q0TA 1XZCA 4DNQA 2HA3A 4OMDA 4E14A 2K2QB 4AMZA 3WK5A 4CIAA 2PU5A 1SG3A 4TGLA 1AUOA 2I3ZA 3D4LA 3RK4A 1MT3A 1ZGCA 3CDZB 4LIPD 1AURA 4UFNA 4KE6A 1LGYA 1SDDB 3WJ1A 1W0NA 2WUGA 1VE7A 2QRUA 3HPNA 2QQNA 1UKCA 5JZBA 5LA1A 2YFZA 5C7YA 5ALRA 5K3EA 5C70A 4D0QA 4Y9SA 3A2NA 4H0CA 3O4HA 3K4AA 5CT5A 1WCQA 3LIPA 2BERA 5LP1A 4CVUA 5JASA 1PX4A 2WKWA 4Y2SA 1ZOIA 4U2BA 4CU8A 2Z8ZA 3AINA 4FI9A 2CEKA 4RNCA 1QIIA 2RHWA 1CQZA 1GQSA 3QVMA 5ISMA 3T0AA 5AKKA 1JZ2A 3QMWA 3C45A 4CCYA 5AO9A 1XNAA 1YCDA 3C7EA 1XZKA 1OD3A 3V1NA 3FNBA 2VZVA 4OCZA 4QDOA 3AIMA 2VL4A 3ACFA 1UXXX 1EVQA 1ZJ5A 1UZAA 3I1IA 1E66A 1Y7IA 5JZ9A 2FJ0A 3LIIA 4LXIA 1CUBA 2BUCA 1JHJA 4MXDA 5CH5A 4A41A 4EHBA 3AFIA 3DNMA 1GNYA 3WKCA 3LQCA 4LHEA 3VD5A 3FSGA 4ZY9A 3R41A 1WPXA 1QIMA 4UHDA 4DMFA 4UHBA 2OAEA 2RVAA 3TRDA 2ZYHA 3DYOA 1XRLA 4UAPA 3FCXA 2ACEA 2E33A 4QX1A 4ZRDA 5IVDA 3OBAA 2RHTA 2J1TA 5AJHA 4BAUA 1IUPA 2G4LA 3FOBA 1L7RA 3W9BA 5LKAA 3ILSA 4ZZ8A 1VZ2A 3GXUA 3WK9A 3H18A 3IUQA 1P0MA 1QIHA 2J3DA
chains in the Genus database with same CATH superfamily
2YIVX 4DV5B 1RABA 3HBJA 5M7EA 1G20B 3IB3A 3ZHTA 4N7IA 1GFF2 2L0XA 3MPOA 3FZQA 3E9EA 4XEZA 2GEDA 4P83A 2ZDGA 2J3JA 2R8OA 4DXHA 4TQAA 4UTPA 5EGNA 2G0NA 3NAZA 4GZ9A 2ZS8A 2OUKA 3FDZA 3I9NA 5T52A 4V0MA 5LA6F 1FA9A 3Q8XB 2HLEA 1AQLA 1BVYF 2AOTB 3URMA 4J0JA 2XJ9A 3BSFA 2VUSA 1AKQA 5KSYA 5FZDA 2QE6A 2NXCA 3TBDA 1KO5A 1GLVA 1U8UA 4TPKA 2EG5A 1GITA 3TLCA 2VUIB 2BTOA 2WO7A 1PGSA 4GMXA 3LNTA 1TMKA 5JZVA 2Y2VA 1BXGB 1VYHA 4R2KA 2BZ0A 1EJ6A 5LZ9A 3GRUA 2JHAA 3RRYA 3IBSA 3K4DA 3EAQA 3WAGA 4LMFA 1BC5A 4S2UA 3IGFA 1OIXA 1KQRA 3NJXA 3EUWA 3MMSA 2OT3B 1A8UA 3U62A 2IV3A 3EF0A 5E6SB 2G4VA 4N53A 1QRSA 5CDSA 2HD4A 4P93A 1RQRA 4L2IB 2XKAA 2RMU2 2Z08A 3CO0S 1XP8A 4CZ2A 3T4HB 3T9BA 1JEJA 2CY6A 3PXEA 3EYWA 2IFRA 2LZ0A 2AOXA 1R0KA 4TMYA 1FFWA 2CTVA 4I9FA 1GRQA 3UXHA 5BR4A 1CAUB 1YYNA 4XF3A 2GN8A 4MV9A 5IUNC 4ITCA 5I7AA 5JVDF 1W8UA 2C57A 4HAYA 2JD4A 1W6MA 5AHRA 2E1RA 5IM4F 3D5TA 5DM1A 5WRFA 2GD0A 2CJFA 1N1EA 4GALA 3NNSA 5T5LA 3DECA 4HWOA 2JE8A 4JLKA 3H4MA 1SAYA 1BA3A 4OB7A 1ZUD1 2EBUA 4XQ0A 4KACA 2G1KA 3EGOA 3R8FA 4OIFA 1Z0AA 1K8ZB 5LBIA 2QQGA 3IKVA 2A0KA 5F3WB 1CS0B 1GNTA 2G9GA 4C1BA 4C7OB 3R7WB 1M4WA 4HWSA 2CF5A 2J87A 1FXZA 4Q3OA 1QPGA 3QV1A 1G6OA 3UWOA 5C53B 4AF6A 2JRCA 4IGAA 4LFAB 1C3VA 4BECA 1DPGA 5HQTA 3IP7A 3FIUA 1QG2A 5DMYA 5BWCA 1C9JA 2PSEA 1Z33A 4JHLA 2DPXA 3DUWA 1K4YA 3WB9A 5ALIA 2CV2A 1KETA 4KQKA 4OHFA 3GJ4A 2EXJA 3FUVA 2GEKA 1QDCA 1NQUA 3RJMA 4GPZA 1J33A 1IAVA 1DTWA 1E7RA 3V9PA 5AOCA 4B4WA 2X10A 1LSSA 4PZUA 1DJOA 2JFNA 3H0OA 2WFF2 4R8HA 4HWGA 3TIIA 4QM7A 3F4KA 2FXVA 4DA4A 1F5SA 4R41A 1K6EA 2Y27A 5HHTA 2JKBA 1YDHA 3U14A 4NARA 3RAGA 5JI3E 3ETDA 4X1IA 3C3YA 4OKNA 1L5RA 4EL0A 4JP3A 3TZ6A 3VR3D 4R7TA 1DDLA 2JIQA 1V8OA 2O8CA 1LHUA 4BLRA 2D5AA 1GKUB 3BSYA 4F3JA 2VNRA 3PC2A 4XTPA 5BXYA 3WR5A 3EEOA 1O8CA 4Q4X3 1HV8A 1LK7A 4RY9A 3CNBA 3P9KA 2HFJA 3C48A 2R2GA 4YP0A 3ED5A 1USKA 1QYIA 2XW6A 2C2HA 5KMGA 3OZVA 1I2BA 2FZ1A 3FWHA 3BE4A 2AXPA 5HRAA 1KMNA 1ULCA 2YWHA 3SIRA 3PDUA 4TWBA 1JI6A 4XIIA 4NN0A 3TNJA 1MG0A 4MVJI 4CTMA 1X7XA 1EVIA 4BQIA 4E0BA 3H11B 4KPUB 1ZJ4A 3BXGA 4U36A 5BV8A 2F48A 2C78A 2A5GA 4D9CA 1OLQA 1JVSA 1MS4A 3Q98A 5A5VA 3DZGA 1RZRD 5D3MB 4C4TA 4KLAA 2FF5A 3AH8A 1J06A 5K51A 1FFEA 4M3CA 4LHSA 2OKXA 3VU9A 5CG2A 3G88A 2QVZX 1JKIA 2IXTA 1V6IA 5CEHA 3ZV4A 3PIIA 3B1WA 4JDNA 4EH1A 1YB6A 4K9OA 4JLUA 5SV5A 5KIAA 4YJ2B 3MVEA 3WNCA 2C3OA 2NO5A 4YZ2A 3DN7A 4BFTA 3KT7A 5EEHA 1OHHD 4JC8A 4F45A 4XHXA 3DWFA 4AHWA 3GZTB 5K6TA 1BVP1 2RJLA 3UJBA 1L3JA 1NC3A 4YG0A 1PUXA 2H8KA 3Q8KA 1U0OC 1PZ8A 1OOPC 2VWGA 3PC3A 2WA3A 2JEMA 1E3SA 2ZZMA 1D0VA 1DGRN 1CZNA 1N5RA 2E31A 4S24A 1VE1A 1JDVA 5HJEA 3CVJA 5EPAA 1Y1KE 4UAUA 1WZNA 2PHFA 1OFVA 2P2YA 1HLPA 5JJIA 2F43B 1IXSB 1DZTA 2QQ0A 2QR5A 1L4NA 1XYVA 3VSEA 3SF8A 4UTXA 5JDCC 2ZWVA 2XDQB 3JRNA 1JS9A 4WXMA 4HZGA 2P3QA 2ZZJA 3THOA 4KWEA 2XA1A 5EUMA 5C4IA 3CVXA 2WAAA 2DH6A 3EMKA 4L73A 5KC8A 1Q12A 4I0AA 1ASJ2 4RS5C 3RZZA 4XGQA 2FW8A 4I4IA 3NORA 3W5NA 3Q1LA 4YW5A 1Z36A 3HADA 1YQ9A 4M0PA 1ZSYA 2R6ZA 4NL4H 4QXHA 5KQPA 3U0ZA 4Y4YA 2ZX3A 4KHZA 1FFBA 2ZRQA 5ALWA 1NT4A 2PH7A 1YUBA 3JZIA 2RHRA 4HDNB 1H4SA 5BW6B 5G41A 1SK8A 2C99A 3EFBA 5B4UA 1R5BA 1V47A 2P0EA 2BTVC 5JOZA 3UJNA 3K30A 5HF5A 3RUPA 3SQLA 2FVXA 3MW8A 3RFFA 3C3WA 4LBVA 4AULA 3GJ3A 5I7SA 2ZYSA 5L45A 3KD4A 2PZJA 5ES4B 4B6JA 3FRHA 2WILA 4LO6B 1S2EA 3UETA 2FEPA 3ROPA 2WT2A 2RI6A 2ZACA 1NQWA 1R27A 3IVRA 2IGBA 4RO0A 4ID3A 3FR7A 1T2NA 3P97A 1E99A 2FPKA 3JYHA 3FUCA 3G2NA 3RZGA 3SF0A 5G0UA 4RHXA 1W36C 4E2WA 3B3AA 2XVGA 3ICVA 3GCZA 1C8BA 4D2IA 2IDMA 3NNNA 1UIJA 1AD2A 3U9TA 3M6VA 1UKYA 4X8OA 3C5VA 1CB7A 1MEC1 2X29A 2JG9C 5A6SB 3RMXA 3OCVA 1XTSA 2XLAA 1AX0A 2DUWA 3MYXA 3LEGA 4JQZA 2CKMA 4DR2B 3QELA 1J90A 3NV2A 3I01M 3F7OA 1K97A 4EABA 4F93B 1KTIA 1A9PA 4BWGA 4K6BA 1QWSA 1JJ7A 1YQXA 3ELUA 2XCTB 4MB0A 4G5OA 5EHGA 4YCNA 1QQP1 4JT4A 1NBAA 1GGVA 3CRZA 5AVYA 3OD0A 3G0BA 4IX9A 4N7MA 3QH4A 4ZU4A 2JKVA 5DBOA 2IITA 4IW3B 2C4KA 2E53A 4X6RB 3KEFA 3L6CA 2I1LA 3O3MB 3T7KA 5LCXA 2VYNA 3EOAI 3OOWA 1ILEA 2E21A 1S2OA 1N2ZA 4MJ3A 3IXLA 4MARA 1WXGA 4CCOA 3MICA 4PIYA 4GKJB 3L0DA 2XVYA 1KXZA 2X2FA 4ARXA 3FDFA 1QGDA 3KZ4C 2W2LD 4AMYA 4MP8A 1KEZA 2IPOA 4EN6B 3B93A 3RT7A 4R84A 4BNKA 5BOSA 3BEDA 5JVVA 3QZUA 3S8MA 4QU2A 4TTJA 2RH9B 2AZ4A 1GUDA 2XUPA 4PX3A 1P5FA 2ATEA 1A9OA 4YV0A 2B46X 3KJEA 1OYVA 4IQ0A 4R8VA 4GQAA 2LV8A 4Q4DA 5HIKA 2AOVA 2C4HA 4QJBA 3L93A 4U9IS 2WKQA 5J2TB 4GYJA 3ACIA 2P3OA 1M5RA 2R16A 1ENYA 3OF1A 2DFKB 2ZJAA 3TZQA 5C33A 1H2KA 2YPJA 5T55A 4U2FA 1RMU1 2JIDA 3MWJA 4JL5A 4KK3A 2PN5A 3N05A 3TQTA 3ZXDA 3EB9A 4HVTA 1UXGA 1S02A 3F6YA 4D0SA 3KR0A 1ZMXA 4RZSA 3HRHA 3AVTA 3KZMA 3H86A 5C7IO 5IVVA 3BQ9A 1VAMA 5FOVA 3DAHA 1N3QA 1NN3A 4LJRA 3K92A 3W4JA 4FGJA 1ENSA 4GULA 3UMJA 5J40A 2M9MA 1EBUA 4WM7A 1DE0A 1J0BA 1GMMA 4BIIA 2XQKA 4GBED 5CDYA 2GN3A 2YZGA 1SY7A 1CPYA 2EZ4A 3CKMA 3TLYA 4FT8A 1L6IA 3ANLA 5I9NA 5IAAA 2WPDD 4KAFA 4N40A 5DNDA 2J1EA 4JOSA 3DR5A 1KTVA 3MILA 4IEVA 2R4QA 1KAHA 1YI8A 4IOLA 1Q14A 2MSKA 4LOLA 3LP8A 3EXHC 4EG7A 1FDWA 1C7FA 1RKVA 3VO8A 3KALA 5H82A 2JATA 4NIHA 4Z1VA 2Q1MA 1DEXA 3HJNA 3MTAA 2QL7A 4F7WA 3ZN6B 1EG2A 3LF7A 3NHZA 3M9WA 3KDPA 1IZ7A 2AOUA 4AY5A 2E1PA 4MKRA 4ZZ3A 2GBCA 1LECA 4YHBA 4M4PA 1WLTA 1HG1A 1P6XA 3C1UA 3STWA 3MOIA 4DXSA 4CMEC 2Q8OA 3ELYA 3AEQB 4AVYA 2PAMA 4EJSA 1A8IA 1MEJA 5ANNA 2ZBUA 4BZXA 4EUSA 3TUJC 4UPDA 3WP4A 3CNEA 3W4KA 3VAYA 5LPNA 5FYHA 2G1MA 3AG6A 3VGPA 5T4BA 5K8VA 3WF3A 2YIMA 1VR3A 4AL4A 3S7ZA 3R44A 1V9U3 3GF4A 1NV8A 1ZVMA 2IBMA 3T8YA 3LFUA 1ZM4A 3RB8A 4B8YA 5BP7A 1V95A 2DWQA 1N1GA 1I7QB 2B6NA 4LGYA 4ZO8A 3UG6A 3VNRA 5BWBA 3KQYA 1ICIA 2I8LA 3S2EA 2XUHA 1MS3A 3ZVMA 1WXEA 2FHPA 3WS7A 1P60A 5U4QA 1W2NA 2OV4A 3SXUA 3T41A 4KYUA 2ACVA 4KFSA 5KC9A 3RTCA 5BRJA 3UMFA 5T6BA 4BB6A 4FK8A 4NNJA 3HK2A 2M6SA 4ZAWA 1IIBA 3NETA 1XKTA 3B1JA 3H9UA 1W2HA 2W2NA 3H6GA 4KBBA 2SCUB 3Q7IA 5CKMA 5FI1B 1ABFA 1EFHA 1XE0A 4NICA 4MWTA 5J4YA 3JALB 2A70A 1J9ZA 4FJ0A 3JU9A 5C3RA 3GFRA 3N7KA 1SR8A 2QJOA 2ATCA 3BDAA 5EFOA 2XZTA 1CD3G 4UPEA 3NBKA 4E5NA 4JI4B 5AFBA 4OMCA 2CWWA 2EQAA 4JGZA 1VI6A 4Y5Z0 3L1UA 3ZU4A 3V34A 4M7RA 2R1VA 3RBZA 2VP3A 5GJCA 5F98A 1SEVA 1WBLA 2XBUA 1N47A 3X2FA 2Q2VA 4WLEA 4Q4JB 3ZS9A 1QUEA 1QJCA 3HT1A 3GCDA 4JJEA 1QXSA 1ENOA 1PI3A 4AMVA 1J8QA 4R5MA 4F46A 1NI4B 1B76A 3QXGA 1Z07A 2UVDA 3QUTA 2P5YA 1BMFD 3IVCA 3U61B 2I4MA 1CNEA 1GOTA 1E7MA 5T50A 2X42A 4J91A 5A1TA 2R6JA 3DBHA 2MINA 3NHYA 3PJQA 1KERA 3ZWXA 2N3ZA 3JXSA 5JNSA 3RV4A 1XNQB 1VPDA 1XZHA 2O8EA 2DH5A 3EVTA 2W94A 4K0KB 5LUBA 1KQPA 4MS4B 4QXMA 1XYNA 2GCIA 1GP5A 1T1JA 1G7CA 1U1GA 2CDOA 2WT8A 3IAFA 3KOZA 5FUYA 3WTCA 4OB6A 3JZFA 3HJFA 1FJ2A 1XEXA 2ZWIA 4MVYA 3T4EA 1KZ7B 1S6YA 3TH5A 1VB5A 3WNZA 1N4AA 5BPXA 2FCAA 1C4RA 3L7OA 1FT9A 3ELDA 4QOHA 3I5UA 4JB3A 1Y6FA 3PVOA 1W25A 4BEVA 1POXA 3IUNA 2WWRA 4LNHA 2VEDA 4UTNA 3LCCA 2JDYA 5CVCA 1IXZA 1TLTA 2ZANA 1E1QD 4B3TB 4BTEA 1R0RE 1UK8A 1FS4A 4MGYE 4H15A 4BAGA 3P96A 4IS2A 3FLRA 4BB9A 1FPQA 4TOIA 1BW9A 1LHNA 4CEYA 2GX6A 3HVKA 3ZVNA 1H0BA 4RX1A 1MKYA 3PVBB 3NB0A 3TXXA 1AS0A 5AM4A 1HFEL 2PX6A 1KF0A 1PQUA 2AWOA 1YAHA 4QUEA 3ZX5A 4PFKA 3X44A 4XWKA 3EZ9A 4HDKA 2YN0A 5A7WB 3ATGA 4Z7QB 3SZOA 3THRA 5C1BA 4LJKA 4PZ0A 2JLWA 4IEXA 4HH3C 1V9SA 3INTA 1QGUA 1U9ZA 1GKIA 2PKEA 3UTCA 4ARUA 1OH8A 1DADA 1PS9A 2MYPA 2Q3DA 3N35A 3HQUA 1ADCA 4FE4A 3PJFA 4OL0A 1L4MA 4B8EA 1R4MA 1W6OB 3AXDA 5D8AB 2VQDA 3EXEA 2ETEA 3KUDA 2WLQA 1FTYA 3AM3A 3MFYA 1XWIA 1BZWA 4R9RA 4AE2A 4EDHA 2EZ9A 4C87A 1V7QA 1CY0A 4TWAA 1KDVA 4X84A 5CFZA 1XUOA 1K63A 1V6CA 3EY4A 1UM8A 2WN2A 4PICA 1KY2A 5AK4A 1Y1RA 3L0IB 2X6RA 2G67A 3AR4A 1O95A 4I50F 1VE9A 2O3SA 2QP3A 1P5RA 1S2LA 4B74A 1G42A 1MR5A 3MQ4A 2D1YA 4YG6A 2A6XA 2GP5A 3UN1A 2AD5A 4JD5A 3D4KA 1TM3E 4JDMA 5EMNA 1RXUA 3NSTA 4IXMA 3LDFA 1R2QA 2ZQ5A 3LB9A 1AG9A 2H57A 5KCZA 1XCMA 2X6QA 2FR8A 1AR91 4FONA 5FL7A 2VNHA 3OPTA 4UU1A 1ZRDA 3LSTA 2AA3A 4ZOQI 3R5XA 3BWBA 2R073 4ZJZA 3NJVA 2J9ZB 3JZDA 2VYQA 2DCTA 1OFUA 2NXNA 4Q1AA 4OXXA 3RNOA 1GGEA 2V54A 5CEJA 1OBNA 1ONAA 4CQLB 2BVBA 1YIAA 2EJCA 3PE3A 3CVVA 3SNHA 5JJLA 3I9MA 3BL6A 2H5IA 2NLRA 4LPLA 4FW8A 4Y3UA 3UKTA 5HV0A 5U9CA 1I7NA 1YB2A 4DIEA 1D0SA 3N6RA 2XCQA 5IJ9B 4HNTA 1XTKA 3F46A 1VJ0A 3AUTA 1BH6A 4XFBA 4HDCA 3LS2A 3PVEA 1KYTA 4H3VA 2XXAA 4BQ3A 4GPTA 2V97A 5FXWA 5F21A 5IJZA 3TS1A 4P1ZA 3MTEA 5KWRA 2BMWA 3GJTA 4F86A 4MO3M 5FUXA 3LJKA 4M0MA 2I2SA 1U90A 1B8OA 4O0MA 5IKEA 4CGYA 1XQ1A 1A5ZA 1MIOB 4YAJA 2IYAA 4TS9A 1IOAA 1OWNA 1H4HA 3B20A 4NRQA 4RFLA 3WB0A 1EVKA 5ALQA 1W0OA 4ZZ5A 4BPRA 2ZJZA 4RGBA 4EJFA 3Q0IA 3O1IC 1JPJA 2VPQA 3TB0A 2QRPA 5EHQA 3H2KA 3W06A 1IOZA 1J0DA 2QJTA 2RG1A 1YR2A 3U3XA 4RAQA 1VCIA 4OUKX 4DABA 4M4RA 2FPPB 4GQBA 1RU3A 2A86A 4TUYA 3WP0A 3FPFA 3IE1A 2HXGA 1GQ2A 1G3QA 3F5FA 3RRDA 1QBKC 1W0NA 3BWYA 3WP1B 3HPNA 2FMIA 3F49S 1TT5A 4MLDA 2YFZA 5C7YA 5ALRA 3H9QA 4Y9SA 2AEFA 4UT5A 4C21A 2HUNA 1WCQA 1MC4A 4WK4B 3WGUA 1DIHA 3DHVA 2PMCA 4ZC1A 2O0OA 3O1UA 2Z98A 2XNHA 5KYXB 3QKIA 3GALA 3GRAA 3F5QA 5KQGA 4P2BA 1HXS2 1NPYA 4F7DA 3OZBA 2MMGA 3GG9A 3OKAA 3THTA 2FWPA 1EVQA 2QX8A 3MBKA 3UWMA 2FJ0A 4JXZA 2VDPB 3AUAA 2VXOA 1HE2A 2PWBA 3IOCA 3JRXA 4LO5B 3DNMA 5F6LB 2TMKA 4P32A 1W9MA 3TD2A 1G19A 3JQWA 4ZPIA 2RCYA 3LGSA 4HPKB 3FSGA 1M2KA 2FK8A 5DP2A 1G9AA 2BNNA 2O0LA 1GTSA 2OAEA 1K89A 3ITQA 4EW2A 5AJHA 2BFDA 2AACA 4V1CI 2IH5A 4WVLA 3IDEA 3U7EB 5LKAA 4LE4A 2WW8A 1HSZA 5A9SB 1SKQA 2QLJA 2XB2A 4CR7A 2RG7A 1S2GA 4MUMA 4K28A 4MVJD 5ANQA 4JJZA 1UPBA 2PPVA 3LIGA 5HF8A 4ZGWA 3RWBA 4PN7A 3S6JA 2GAIA 2N0SA 4J2HA 2PQQA 3ZLUA 2XOKA 1MABA 2BOVA 4J76A 1G8YA 2D6MA 1E3JA 4LZZA 3HPQA 5T54A 3RCBA 2WFLA 4WGFA 1HE3A 2HDOA 3T0FA 3RC7A 3K4ZA 2XIQA 3BH0A 3APBA 3LAWA 2GS9A 1A2KC 2ZUEA 5LMCA 3K2IA 2ZBDA 3R3HA 2VR1A 3HE3A 3S2YA 1FI2A 1XJCA 1H65A 1A5AB 5EA2A 1EFRA 2A75A 5J63A 5PGMA 3RT1A 2REBA 3MO4A 5AQ1A 2JC3A 2OA2A 3IAEA 4XETA 2NM0A 2O2DA 1VL0A 3A1VA 2VP4A 3DWEX 3D3AA 4XGRA 5TQ2A 3KVNA 1P5ZB 4OJTA 3DOHA 1J00A 4LF5B 3TBHA 2DBVO 5GONF 2HOQA 2DAPA 4NAVA 1Y7HA 3IHKA 3ND7A 2QQKA 1EE1A 1NVAA 3KAKA 4HGYA 4HXEB 1U5XA 3DMTA 3E61A 4Q1FA 4X62B 3V5NA 5DAQA 2E48A 4CIBA 4J0QA 4O8ZA 4F06A 4Z1MA 2HDWA 2CHQA 4F9EA 5IANA 2YCBA 1KAQA 2PLV3 1B0AA 1PDVA 4CKZA 3DOEA 1YB4A 3PLAE 2WO3A 1P1FA 5LYJF 1SQ6A 4NZPA 2B83A 4BISA 2EZTA 3SHOA 4MV5A 2O23A 2ALJA 3D6EA 2Z09A 4M1WA 3NHBA 2PHWA 2P8SA 3THWA 9GPBA 1GG8A 5ACA2 3EMBA 2OCBA 3H05A 4XD2A 2CEAA 2ZIVB 3JVEA 5IK8A 1H2HA 4EFLA 3ZWNA 1R9JA 4RLFA 4MMXB 3GZUC 3OPYB 4I5DA 2Y1LA 1HXS1 1G8JA 3E7FA 1YDFA 5H3LA 2OX0A 2P11A 2A1UB 1YO8A 1PD0A 1ZNXA 2RI0A 3E6DA 2WICA 5JANA 4MHOA 1FYWA 5LQUA 2BMAA 1DI0A 1JXMA 4GGPA 2VPXA 2AFIB 5LJLA 3DPRC 2I6FA 3ZXUB 1SEPA 2XTMA 4JQOA 3JD1A 3QLVC 2IEYA 3GT7A 2H3EA 5KTMA 3DMDA 3KT3A 4X8HA 1SQSA 4IGKA 1JVBA 3DBRB 4UCFA 3I6ZA 4NR0A 3I72A 3R7SA 1SUAA 5LU8A 1O5OA 4FKMA 1C80A 3ZHSA 4PLGA 4WESA 4XIOA 1R6XA 5FPYA 3C43A 3LT2A 3L5KA 3OJEA 1XVTA 4AHZA 1SCJA 2G04A 3ZBUA 4ETWA 3VO1A 2REOA 5F5CA 4EK9A 4UXAA 2NUPA 3FKQA 3O7MA 3A7QA 3BU0A 1YIFA 4MQ5A 1XVUA 1WU8A 4CCCA 4NZZA 4HX9A 2R68A 2WD9A 2TNFA 2E7TA 4BGIA 3LA2A 5HYVA 4NV1A 1FUYB 5U4XA 1JMVA 1Q43A 1NC1A 5EWSA 1ZKDA 1NZJA 3KAPA 4ZCRA 2XVXA 3L4BA 2G1AA 1U0LA 1T0PA 3G82C 1LI7A 3IHLA 4N5HX 5K01A 3AFKA 2PGOA 3A4LA 1DLLA 4YUWA 1MQAA 1DEKA 4W9NC 4QKNA 2WJHA 1DF0A 3EOZA 1Q1NA 3KYJB 3GAFA 1AO0A 3NZEA 4L78A 1LV8A 4LGMA 5F52A 4ZQFA 3FUWA 4MDFA 3AJYA 2RHCA 1KOLA 2JHCA 3VZOA 1IPHA 2PS9A 4KWJA 5LP6B 3U4XA 3MJHA 1YBVA 1QG0A 4CLDA 5ITZA 2WO1A 1GZ7A 1GRVA 1ZRIA 4IDZA 4LO4B 1GLNA 3RVJA 3V6MA 4A27A 3CRNA 5AIBA 3VBOC 1U63A 4D3XA 2OO5C 4Z9BA 4IICA 2PCLA 3DLCA 4AVSA 1Z2OX 3I45A 2C9CA 2AENA 4LZLA 4G23A 4D57A 3WNDA 1Q0ZA 5C4GB 4RL4A 4HAXA 1Q3KA 1GAXA 5EJ2A 4PX9A 1GUAA 1QO0D 1A9XA 1SUCA 2RJKA 5J1XA 5EYPB 4H2DA 1TVGA 1Y9DA 4J29A 1RYMA 4J1TC 2QRZA 2VCCA 2WHRA 2VDUE 1TO1E 4QICA 1ZN7A 3EJ6A 3WNPA 4IIDA 1SO8A 4AJKA 3SI7A 2QT9A 3DXTA 4M9SA 2Q30A 1B41A 5FTJA 3DL3A 3GJSA 2ZSEA 2P7HA 4BJHB 5LZ2A 4CV0A 4IRMA 3SHRA 4EELA 2H08A 4YONB 3A6KA 4LY9A 4BZWA 4YI3A 4MYCA 3OI7A 3GUYA 4KU8A 1UWVA 5FQNA 3OPMA 5IKPA 5H0IA 5DAWA 3MT7A 2D06A 3TAHA 4W99A 3N2KA 1L8OA 2PR2A 4WVFA 5EJGA 5DLEA 5FMDA 2GCOA 1RUJ2 3K31A 3W7VA 1N3OA 4ED9A 2ORWA 1KJWA 2NZJA 2JD9A 4MKZA 5CYYA 1TF7A 4ET7A 3QPCA 4IIJB 4ZU7A 5LVAA 3VNQA 3L1JA 2DHDA 3WYGA 3LWZA 2FQPA 1S9DA 3DZIA 3CUYA 1VBMA 5F3RA 1QIQA 1XP5A 4LOAA 1IYZA 3MF9A 3UK1A 3T5GA 4KQCA 2G9UA 4HNUA 5C8YB 2BMEA 3FX2A 3MLBA 1TJ3A 4JJ7A 3JQDA 3IJPA 4KC0A 1EV12 1CLUA 2VUJA 4OJQA 3VHRA 1NPDA 3HJBA 5AM1A 3HB7A 5FO8B 3PCTA 1YBAA 2EATA 2KS6A 1MX1A 3L6DA 1TECE 3RRBA 1EM8A 4JJIA 3MTJA 1GZHB 2H0RA 3VUFA 1U7XA 3VOBA 1R4NB 2KI5A 2NT4A 2P3YA 4UBHA 3U78A 3H50A 4P53A 3UNPA 2R7KA 3NNLA 1E9VA 5JD6A 3SZGA 1MP0A 3OM1A 4KSYA 5LKRA 2ZI3A 4Q18A 1KEEA 1LOCA 4GZ3A 3BPSA 4ND4A 5JHHB 1KEWA 3FPKA 4AX4A 2HWKA 1M2JA 2PJRA 3QEJA 3TNDA 2MSEB 1X6VA 3IOMA 3HKCA 4W1SA 2CXXA 4H17A 2VO1A 1W48A 5JS1A 4HK4A 3T4UA 4A03A 5E4JA 1RUG3 1XLVA 1E1CA 1JYWA 1XKLA 3RS8A 1ULPA 1EHYA 3D6JA 5I7WA 5JZOA 1SXJC 1SLAA 2OZKA 3CUSA 3BDIA 4O9EA 4TT3A 2REXB 4XJWA 1J1UA 3ZR5A 1MPXA 1JE1A 1J3RA 2BZ1A 1IK4A 1W49A 3MOGA 5IS2A 3WADA 4QYMA 1E58A 3KQPA 2EQBA 3VKVA 5A1AA 5KQLA 3VBFB 1QX3A 2HWC2 1ZGHA 1LDYA 1RT9A 5F1YA 2VF8A 2GRUA 1HURA 4B32A 2VHQA 4A3ZA 1HE5A 5HRCA 3KV9A 3NHLA 4YJ3A 5DE3A 2ORZA 5F51A 3RHSA 1SD1A 1G38A 3CJRA 1RACA 2XCSB 4KU4A 2P0YA 1NJ8A 4W4ZA 1CRWG 2V5YA 5T64A 3K1AA 1G9DA 2ZX1A 1M2OA 4CDWC 1W6PA 4RGKA 1Z4PX 4QODA 2G76A 5FLXA 1SBZA 2XE8A 4MDEA 3RROA 3MINB 1F8VA 2JJ8A 3E05A 4NF2A 4Q9AA 4JDOA 421PA 3TE6A 4IETA 1APBA 3V7UA 2PHZA 5FR2A 2RS32 3BMQA 1PT7A 5JRJA 1D1QA 4RQTA 3POGA 1PZNA 2XWBF 4XUPA 4URUR 3PUZA 3LQYA 4WFIA 4B3SB 2A6WA 2I6UA 4LKSA 2VTDA 5GZ3A 4EDFA 4CLXA 2Y8EA 1C5IA 1HYBA 5DLPA 5JNUA 5D8DA 1C7ZA 3I05A 2QTRA 4GWGA 4RH1A 1RUF1 5BMVB 2PFSA 5FBRB 1PZXA 3PVNA 1Y1LA 1LBSA 1L7PA 4RZUA 4ARAA 3L7NA 2O50A 3AVXA 4D3WA 3AZPA 4IFBA 1I5EA 4OXIA 4COVA 2IELA 3HJRA 4H6WA 4K40A 4ARCA 1FNZA 3E1F1 3FL7A 2JIJA 4Q82A 4ZU6X 2RHGB 3AY0A 3PEVA 3A4UA 5E2IA 3BMNB 2Z2ZA 3PKIA 1R093 4A36A 4AXBA 4CTNA 1DKMA 3VKHA 1EV11 2DFCA 3UIEA 2ATFA 4PR0A 2F1JA 3WLNA 1WMXA 3PA8A 4XCAA 1TEIA 5B4TA 2ZATA 1ADGA 1MTZA 5JSHA 2EKDA 1H1IA 1XPOA 1DBWA 1U0HC 2AOWA 3UGQA 3CM0A 4IIUA 3VOTA 2V98A 4NV3A 4QAQA 2H6CA 4YJKA 3SZLA 2ADOA 2P2NA 2BKVA 1TPZA 2IODA 4Q66C 3MUOA 1JSCA 5KSZA 2CL7X 1ZOPA 5K3FA 4P98A 1KZGB 4EHIA 3POIA 4OXNA 3OHPA 1W5TA 4Q34A 1QJY1 1LGNA 3WNVA 2PH3A 3ET5A 5JCXA 2D13A 4EP1A 4JR1A 2WNVC 3HZZA 2BFOA 3CJQA 2YIDA 4XM2A 4JLVA 3AVOA 4N54A 5JYDA 5IYZB 3UFBA 4P4SA 1GGHA 2V96A 4M9RA 1DWPA 2JIPA 3USSA 2GALA 3G8BA 4QYIB 4JZKA 4QXCA 4O4IB 5KTRA 1TM4E 4XW3A 2DU1A 5EXOA 5KQRA 4QX5A 2CXRA 1TUBB 3FWYA 4RR3B 4POOA 3FFQA 3JBG3 3CS3A 2CC2A 1N2SA 3NNJA 4J3NA 3A2LA 3MFAA 3LQ4A 5C8CA 4ARBA 2NZ8A 4Z2YA 1DC6A 2HWC1 5FZGA 2LVBA 4M3CF 3MCVA 1DJNA 3E6CC 2R30A 1REEA 4QXPA 3RFUA 4BYMA 2BFUL 1L7LA 2Q49A 2YHSA 2WC1A 4O59O 4C6RA 5EJIA 5KXCA 3VZNA 5KKAA 2ZRHA 2OB1A 4LFCB 2QLLA 4M7WA 4IXWA 2ZXQA 2E4UA 5IVHA 1AYN3 4MR7A 1PT6A 3DHYA 3FCCA 4PO8A 1N33B 3H5AA 3OKCA 4MVJM 4FC7A 1DJMA 4OQFA 5LUAA 2IXIA 3JASB 2WWTA 3GY0A 4M89A 4INDA 5KREA 1EUCA 4F3YA 3IXQA 4Q3LA 4IIVA 3G79A 4LHLA 1N9ZA 3A9VA 4NXMB 3JQAD 1N9GB 1H1LA 2O1SA 1K8XB 5EE5B 5BSGA 4B6SA 1PK7A 2ZR7A 4I1UA 3EA0A 3WG2A 3O8QB 3U6KA 2GPBA 2FW1A 4AEKA 3NVKI 1A9YA 4TSVA 5I47A 3NMBA 1V6NA 3GCXA 2PIDA 4OHUA 5H7XA 4LG1A 3WSWA 2FPIA 4J0CA 1Z6TA 2HA6A 4K3UA 3RSOA 3T5MA 1SMKA 1KEXA 4RQPC 1N0IA 2WSUA 3CXRA 3P9XA 5L3QB 4U7PB 2JD1A 1NDHA 1U2GC 3LHDA 4BQ5A 4E3WA 4QU0A 2B8JA 4WDQA 5IHXA 3GZAA 3O1LA 1POV0 3MELA 2ATVA 5AKHA 4FYPA 1KYZA 1PGNA 4PIZA 4HAZA 3BUCA 1T5IA 3BMCB 2EHJA 2X58A 2C0ZA 4O2AF 1OH3A 1YC2A 3DE6X 4BCBA 1T0BA 1VBFA 1ZGGA 3E9NA 5C1OA 2B1GA 2RK6A 3K9NA 2PL1A 5IULC 4EHLA 2JIZD 1GCOA 2OTCA 4D3DA 8LDHA 5JWRA 4GPD1 4F3RA 4D4GA 1IY8A 3U16A 3O26A 3FFXA 3R5HA 1FATA 3S44A 3I23A 2H18A 1EK2A 2IYVA 4HN1A 3LQQA 2YU1A 5CM9C 4RIEA 2B4AA 4JP8A 4DLSA 3CZCA 3WDTA 1L1QA 4JJKA 2XAUA 4G0UA 2JJ2D 3TAYA 3TQRA 1XV5A 4CKEB 2YUEA 1GPLA 3HUTA 3SC3A 3RTEA 4UFHA 2RK3A 1JAIA 1R8XA 2ZE8A 1OX6A 1JNYA 3DUIA 3KZXA 1BKDR 1V11B 1P74A 1GPBA 3AEKB 1BXRB 2G72A 4A1FA 3DAFA 1BE1A 1F51E 2G36A 3EBPA 5TJ9A 2HGSA 5L19A 2QG9A 3D7KA 2BY4A 1OF4A 3UEOA 1TU3A 5AVTA 4BFWA 4KUGA 4LITA 4JJ8A 1BK1A 3S1SA 3QGMA 4LNUA 2JLYA 4OBBA 2XJPA 1YQ5A 3BZWA 1Y3AA 4H77A 4UVDA 3BQMB 2XRZA 5LMUB 3R0RA 5CB4A 2H7XA 4BMNA 2HSEA 4OU5A 1Z5NA 3ZQKA 2F59A 3O75A 2ATXA 5B2ZA 4NYJQ 4KYTA 1QJFA 3CIOA 1M5TA 2OMEA 4K5QA 3GVXA 1C28A 5K0UC 5ITWA 2DFLA 2RC6A 3I2YX 2GXSA 4UDYX 3I2HA 3W5JA 2CNNA 2Q6OA 3NV4A 3M4NA 4B3CA 1P0PA 5ALMA 1GZVA 4LNVA 1KAMA 3C5CA 1Q16A 3SQDA 5A2QA 1SVNA 1EWQA 4YAKA 3EYAA 4F60A 5JOXA 1ZZBA 3TI9A 2Z4RA 4K88A 1E2KA 1YD7A 1G8PA 2R063 3GLFB 5AQEA 2Q8DA 2HMAA 2HJWA 1NCQA 1AV7A 2H17A 2QPAA 4KAXA 2QORA 1T9ZA 2OBLA 3ZIDA 4YRIA 3OPXA 3KHKA 1W88B 1RHQA 1AQYA 2NTJA 2ZRKA 2LP4Y 3D7MA 2GPNA 3TQCA 3PX7A 3KYIB 3L77A 4WK6A 3MGGA 1UFQA 2ZMLA 2Y0IA 1QB7A 5I93A 4Q4AA 2Z2JA 3EZ6A 2HEVF 4XOGA 1CAXB 1A69A 2VDWB 2BFEB 1Y1SA 1CX9B 2PG3A 1PUIA 5FMOL 4EVSA 1FJGB 3PD7A 5LU9A 3WXMA 1FZQA 3NEYA 2CMDA 4MYSA 4AFAA 4Q7QA 1TYDE 3RUHA 5IDWA 1RP7A 1XU7A 2CAUA 4KO8A 2HJVA 2X8BA 4RELA 4HK8A 4UDXX 2UKDA 3L05A 4EY5A 4LYJA 4FB4A 3P9RA 4MW4A 5ERLA 2FSGA 1AZWA 3AK4A 1JVNA 4V0ME 5FH9A 1XTPA 1FP7A 5LYYA 4TWRA 2BJWA 2RG4A 5C1DA 1J42A 1RYEA 4P6VF 3E35A 4AFMA 2I4NA 2DUJA 3DLBA 3FNIA 1XWFA 4TXLA 3ZD7A 4G0NA 3NNDA 1E57A 4LOHA 3D1VA 3Q5DA 4Q12A 4WVVA 1UDXA 1KZ1A 2B82A 1ZIXA 3G85A 4DKJA 4FDAA 2MYTA 3ZXKA 1WS6A 3LUFA 4DIMA 4JJAA 1EFKA 5A4JA 1U5BB 4G65A 3B70A 1Z6AA 5CISA 1Y34E 3VZSA 4GI5A 3W5AA 1AVBA 1CQIA 1Z7YA 1JWAB 1RUH3 3LPLA 1PVVA 3TIXB 3PFGA 1NQJA 3ROUA 1WW2A 4HYQA 1DC4A 3IIEA 1NT2A 2HADA 4P5YA 2ZJ7A 3O8CA 5SYAA 3C5HA 4BFLA 4QX7A 3RIYA 1T4CB 3DMGA 1MEC2 3GQBB 5CA1A 1PVDA 1D8TA 4QBFA 2V0CA 1QV9A 2LW7A 1FYFA 4RADA 1R64A 4KVAA 3JQGA 4QGMA 1QVVA 3H9CA 3T3PB 2QL6A 4AW9A 3HUFA 3B2NA 1GZ9A 1SUDA 2BLNA 4BV2A 4HNAB 5E0OA 2MIIA 4QWNA 3OJOA 2I3ZA 3W7BA 4HJRA 3D4LA 4W6QA 4HHEA 3VH2A 1EP2B 4N7JA 1PZ9A 4JL6A 4IVRA 1LGYA 3INNA 4D6SA 3QE2A 1AKWA 3RS2A 5GIOE 1QQP2 2Y60A 4E5VA 3BWEA 1V9CA 3QIAA 4H0FA 2R44A 3EA5A 2RIRA 5CT5A 4BJ3A 2PQMA 2WKKA 4YVFA 4GMP0 5BNOA 2JAWA 4E1AA 1ST8A 4IO1A 2VNKA 4BQQA 4BEBA 2BKEA 5EUQB 1U5IA 4W82A 2HEIA 1A97A 2AREA 3L8GA 4GR4A 1XNAA 5CFLA 3QV2A 1EVYA 4HGZA 3FTFA 4MGZR 3A6LA 4IV0A 1D0GA 5KNBA 5AJTA 3LF1A 5LASA 2DVFA 2WZCA 1GQQA 1JHZA 3QUQA 1S7CA 1JLLA 1NRIA 1TZJA 3CINA 2FUG6 5LBEA 5C3MA 1Y7IA 3BTZA 3GRCA 3IALA 1O3SA 4H1HA 4OOEA 4LQ4A 2QTZA 1JYTA 3R4VA 2ZAHA 1JHNA 1HB4A 1M1UA 2QM7A 3LPNA 3R0ZA 1BZYA 1XRJA 4OSOA 4R9NA 3NHKA 1RKXA 4HWPA 3INYA 4JC1A 2VDJA 2VOVA 4GZ5A 3W2FA 4ZMBA 2ACEA 4LQLA 2EFJA 1RMU2 1O1YA 3HUDA 4OQDA 5AVOA 4YUZA 4HLDA 3C7KA 1BCSB 3U5ZB 1H4QA 2GP3A 1H9PA 2R66A 2F6BA 1RLJA 1HB2A 2X15A 3QA3E 4GOXA 3NJYA 4MMZB 2JFZA 3SSOA 4O2AA 3I39X 2L42A 2AQHA 1IHPA 1TNFA 2WWSA 1SC9A 4YO7A 3U3ZA 2GEFA 4YXWA 4REQA 2C98A 1OA1A 5CFMA 1YSCA 2RGCA 1QZUA 3T54A 3RWMB 1PW5A 3C3EA 4V2UA 5JFTA 1FMLA 1E62A 1UPFA 1N34B 2F8TA 3I0NA 4HZUA 3QBJA 3K71B 3DZFA 4N8DA 4DUYB 3PC4A 3H5NA 2GFQA 4BL5A 4RF4A 2Z42A 1PM7A 1BFKA 1LBIA 3JVIA 1ETHA 5A70A 2Q2WA 3RFXA 3MQ2A 1OKKD 3MF6A 3ONVA 4N9WA 3OOHA 5TGZA 1WO8A 2AZTA 1KNXA 5DDIP 2GZAA 3IPAA 3OD5A 3NHWA 3VPCA 3M6UA 2I4TA 1HQKA 4IDNA 4BUCA 4ZJPA 2JGIA 2H2GA 2G1UA 2V7UA 3GGDA 2R86A 3DONA 5I8PA 4JUIA 4O4HA 1GD1O 2BPA2 6AT1A 2JLRA 5K45A 1W75A 2XNDA 2XUOA 1JLRA 3ND9A 3DLPX 4NXNB 4DVGA 1GBGA 1Y9GA 2IHKA 4RIFA 3POBA 3MGCA 4DN6A 5JI7A 1KQGA 2QE7A 3H0KA 4L4YA 3OCUA 1SBQA 1RR6A 1OVGA 4XPIB 2DXIA 3IAUA 1JBQA 2CXNA 2FW6A 4A6XA 1QP4A 5DYWA 3SC6A 4CF3A 4FWBA 1JYEA 4JLMA 4DIKA 2W52A 5DYGA 4DMLA 4TYWA 2ADFA 5IAGA 4I8DA 2PKRA 1VKJA 3CLUC 2V6IA 1O4ZA 2PGJA 4Q9JA 1DO0A 4RYLA 3X1JA 4Q4V2 3EA4A 3LWBA 2O6HA 4CG1A 3K0AA 1JZ4A 4OQ4A 1IGOA 2D6KA 1X80A 4QT6A 3IS3A 4H3HB 2WVJA 5K6RA 1AUYA 1USIA 1TXGA 4KK4A 1ZFNA 5FLHA 3RYIA 4CLRB 3JXEA 4KXMA 1XNRB 1Q0TA 2RHOA 4DSAA 3N0XA 4A3XA 4JUBA 2YGLA 1ISMA 4D8VA 1F2UB 2EU8A 3E15A 3UZUA 3UGGA 2VPIA 2NO4A 5AKIA 2ZBVA 4AUKA 1M1NA 2VTXJ 4DMGA 2QMZA 3ZDFA 1E3MA 4L7VA 1K6JA 2RGNA 2Y6HA 3VH4A 1VE0A 4M8NE 4R4JA 2BZDA 1Y7LA 2BR4A 3MCUA 3MLJA 4BZQA 1FK8A 4B4OA 1DDIA 1U94A 2ZQZA 3ZN2A 5SZJA 3IDAA 3FLEA 1NG1A 2AG6A 2GDZA 3CPHA 1Q1AA 5JECA 4DV6B 1Q56A 3ZKWA 1IJKA 4KH0A 2HSZA 1XMJA 1M1YE 3SYTA 1V25A 1TUEA 3BJMA 3ZGLA 2Q6VA 2X0JA 4ZOCA 2O8DA 1XALA 1MC8A 1QXPA 2R79A 3QU9A 1GKBA 5DWDA 5D3ZA 2BNMA 4QBGB 1KZ4A 1VRH3 4CP1A 4QGSA 3AW9A 2DFNA 3AZXA 1YR3A 5LXTB 3AVVA 2B36A 3VH1A 1NI5A 3OE4A 5FDFA 1LX7A 3I12A 4BNJA 1SKBA 3PICA 2C00A 5AHKA 1XN4A 5ALNA 3DVAA 5EN4A 2QU8A 2X19A 4QFMA 4YGEA 1BCXA 2WJPA 4WOKA 4B4DA 3IIMA 1SHKA 4DM3A 3SR3A 1RI3A 3PQCA 1GZ6A 1NQXA 3GAZA 3FR8A 1DG6A 2GC0A 1NIPA 3IERA 1A72A 3MV01 2G5TA 2ONCA 3CUVA 4JI7B 5F9HA 2F3PA 4GICA 4NYMQ 1SC4A 1NT0A 4AS1A 4GE0A 1EAH3 1MQTC 3LCPA 3KWMA 2YXEA 4GXNA 2ZEZA 1IB0A 2VP9A 3MWDB 2OG2A 3E9MA 1GAQA 5HDBB 1ZUIA 2AFHA 4UMDA 1U2PA 3G0IA 3CRVA 3FOCA 4PIVA 2RGXA 1R8QA 3BL5A 2HMSA 3L8EA 1VMHA 3D31A 4XDGA 5JALA 4Q0MA 4G0YA 1X0VA 4KWLA 1FLVA 3OSUA 3CNQS 2DBZA 1AXZA 4A8JC 3HACA 3LCVB 2QDRA 1MA0A 4NECA 3HQRA 2O6LA 1EFTA 3C2UA 4EHDA 1L5QA 1OKQA 4TUYF 1ICEA 1Q21A 4FPJA 3V7NA 5ES3A 4WCFC 4Q4V1 2ODBA 4IDQA 2P4SA 2IHYA 4LXUA 1P7YA 2XKJE 3DQQA 4DQDA 2BGTA 2DU8A 1KI7A 1PZHA 2XTAA 4JGYB 4G81A 2IYFA 4R81A 5FUMA 2JANA 3SHWA 3E23A 4HRAA 2C4UA 2CNWD 1AQ6A 1N2GA 2VZLA 1SCUB 3EY9A 3AKSA 4PYMA 1JEEA 3R9XB 4J0IA 2JBHA 3BGIA 5AKXA 3WHUA 5LJIA 3JAKB 3MIBA 2GA8A 4CF6A 5F7JA 4X1KA 4S2HA 1KEPA 4Y33A 1QB8A 3MCTA 3NO8A 1U0JA 1JUHA 1CJCA 2NXJA 3IDQA 1BQEA 3CCFA 3G7SA 1AIPA 1G2OA 3ZDDA 5IVBA 4Y1EA 5EQJB 1KFBB 4PHZA 5DG2A 3HEMA 2HHHB 2VJAA 1PJRA 2H1CA 4LV6A 4QXOA 3WK8A 1DZIA 1VQ1A 2ZAIA 1X7HA 3HABA 1PTJA 2X76A 3BMOA 3MW3A 2ZGQA 1Z73A 3ZJTA 1JLHA 3BH7A 3ZIXA 4X6UA 1FFAA 1W3XA 4E5PA 2CSUA 4E5MA 4HF7A 4XTCS 3RKSA 2HLHA 1V00A 2Y0BA 1U0TA 4Q4LA 1AR92 3T09A 1G5FA 1P9OA 1REFA 3AHEA 1SVMA 3MIGA 3NX4A 4X7MA 2GPWA 3ZXEA 3D0JA 4XUNA 4A6SA 4GJYA 1JKJB 3PWKA 4BKOA 4CL3A 4PU0A 1XD2B 1E9AA 4MS1B 4FFRA 1P7CA 1YFUA 2RM23 1U9CA 2FPOA 2GPSA 3G8CA 1T5LA 1H9WA 4NWVA 1OLSB 4EUNA 1VI5A 4WECA 1OSNA 1XXHA 4X60A 1LB2A 3GDHA 5AK0A 1JA0A 3WSVA 4TX1A 3OCXA 1IU9A 3F90A 5ALSA 3W77A 4BO5A 1KPGA 5E7JA 4RHV3 4M2LA 5KC5A 4DAOA 1D7PM 1Z74A 1T5DX 3QYJA 3MWFA 4ARYA 4H4CA 1M33A 1IG3A 3CTPA 4Z1OA 3RYFB 3AFMA 3W8EA 5IM5A 3WGNA 2O20A 3WLKX 4LWOA 3K1YA 4XRGA 4IV1C 3C4VA 3DDNA 4LEJA 4XAEA 5TC4A 2G4IA 2XQFA 3PK0A 5MN6A 2AEJA 3AOEA 5ENDA 1PSZA 1RAFA 4G8JA 1NVUQ 3E9ZA 1Z4MA 5BYNA 3PQ4A 3GLGA 3AWDA 4TV8A 4HWTA 1BDBA 4RF3A 4IF6A 1U5YA 1GNRA 3VPBA 3HJAA 3OZRA 2G9QA 2XF8A 3VR4A 4TXMA 4HEA1 1YS9A 2X9VA 5CW1A 1RUC1 2A0FA 1CX4A 2JJYA 3GBWA 3FJ1A 1ND3C 2PLRA 5IK2A 1REQB 3A3OA 1LJ8A 3WGZA 1CZVA 4BKRA 4ENRA 4AI6A 3R6WA 3SZUA 5KBYA 3D0RA 1VBD1 2JAQA 4XXHA 3JX9A 4ZAXA 2VOWA 1CR1A 1NKGA 3GXOA 1OLMA 4FYYA 3T08A 2JJ1A 4XD7D 4E5YA 3K96A 2ZHMA 2WKRA 3SOPA 3SHFA 1OR8A 4BRWA 3ESDA 1CUXA 3J8F3 3WCRA 2OPHA 4ACBA 4YP9A 1JTVA 3NBAA 1JW9B 4UMEA 2ZR9A 3EG9A 4HP8A 2XQIA 1LU2A 3D02A 2D54A 3AYEA 3AM5A 4P38A 4M0LA 3WP6A 1Z35A 1A76A 4XIFA 1D4ZA 2QI9C 2J6BA 1FYEA 2V7VA 1NAEA 5BNWA 1PHMA 3MZHA 4ZVNA 3TOJA 3OICA 1LHOA 1EMDA 1R18A 4U6QA 3E9CA 3HA5A 2XL9A 1Z39A 2JIBA 4XJXA 2BSQA 4HFMA 1UOEA 5FLKA 4W7IA 1NX9A 2OO3A 5B6JA 4Y22A 5AW6A 1Q8QA 1ZREA 3MQFA 4D7AA 5DDJ3 1AE1A 5HQ3B 3ANSA 3D6UA 2I6QA 2Q45A 1OJLA 3Q3EA 3AJZA 1THZA 3A0UA 1KAGA 3FCYA 4G5QA 1EDZA 3G8AA 3A22A 4R52A 3L3BA 3KQVA 2WTXA 3TSYA 2QQUA 3QBVA 1MAVA 1WDKA 4UQLA 5EJ4A 3MRSA 1A8SA 4JWTA 5FBVB 4G6ZA 4X93A 1KWGA 4AKHA 2WSLA 3SMVA 4DCTA 2AX3A 2ZUWA 1OA0A 1UOPA 1SFNA 1SFPA 2OYZA 3W2HA 4WN9B 7REQB 2OHIA 3NWJA 4ITRC 4X95A 3A4NA 1TFRA 1Y81A 1RJ8A 2E63A 3HJTA 2REQB 5KPJA 1W35A 2NVOA 1KIMA 4N8SA 3TGLA 5LQSA 3OD1A 2X5IC 1RUNA 1K08A 3REFA 4MGHA 2AJ8A 3UOWA 1RXFA 4EITA 4FCVA 2GN2A 1KGDA 1PIV1 4RHUA 5CK5A 5CD1A 1E5TA 3KXLA 4YNIA 5FZ9A 3KSZO 1E4EA 3GZEA 1IZ8A 3AMVA 3DCNA 1GNVA 3AFOA 2E37A 5DLQC 4WH0A 4C6TA 5CLIA 3ISTA 1OYYA 3V3KA 4Q0QA 4UFJA 3HGQA 4RV9A 2QIPA 5J98B 3DVQX 2CL2A 1QH1A 3FHAA 5HPOA 3TVYA 2PV7A 4FB5A 1FP4B 1YI1A 2WG0A 1DC5A 4Q27A 5FORA 4M1TA 1MS5A 4KWIA 3J7TA 1P4AA 5TSDA 4ZK6A 1JQLB 5FY1A 1W04A 4FPOB 3AL0C 2JFXA 3PD0A 2E6KA 1NW7A 2WM2A 4BEJA 4QPIA 3IZOA 4DW8A 4KQWA 2JDID 3TF5A 4RFVA 2UYHA 4KGDA 1G3IA 2J0EA 4WKPA 2DY0A 1E3EA 2BGCA 3IV6A 3AHDA 3QOXA 2F8SA 4TL7A 1UPCA 3B51X 2OWDA 3FZGA 4E2XA 1DL5A 3EBRA 4CKWB 4XFHA 3P0IA 3EVFA 4YYZA 5FHRA 2QVYX 1V6LA 2JW5A 4TMVA 5E3IA 1XHEA 2IHTA 3TZLA 4MAAA 1UP6A 3RI8A 1GZ3A 1B35C 3N0TA 2OGZA 3IVGA 3TOZA 4XWGA 1EK0A 3SG0A 2O59A 5K0ZA 3MOSA 4TWJA 5B6PA 5ABPA 3C4QA 3D8HA 3O1SA 5AKLA 4N01A 2C82A 3A58B 1BHQ1 1UBTS 4MOWA 3SNMA 1TPYA 1B4DA 3QK7A 5FPXA 1NQAO 3IYLW 1HZZA 1WCYA 3V0AA 3E2IA 3COJA 1LU1A 4E4ZA 2QQMA 5HWSA 3X1ZA 1UWKA 2JDZA 3OAAA 1U2TA 4BHTA 1GAEO 4X6QB 1I3KA 2PA0A 3IKLA 2PPLA 2H92A 2LS6A 1N9KA 1CQJA 5C9ZA 1F5FA 1ORWA 4XIGS 1JALA 3K0BA 4DIQA 3ZFGA 2ZSFA 3IURA 1ZJ6A 4PLWA 3PIGA 1LDBA 2Q50A 3L2OB 4YCJA 4BAZA 5FMCA 1JOPA 4BX9A 1OIVA 3A4TA 1IXYA 1UYXA 3NGXA 1FTNA 4E12A 4GUAA 2NN3C 1K9VF 3UT5A 3K4HA 3LA3A 1JDTA 4QRIA 1A77A 2K87A 4KG0A 1TEZA 1WD7A 5A7SA 2Z57A 1E5IA 3HP7A 5K20A 3PUVA 5KNCA 1ZD4A 3KR9A 3RU7A 3MWEA 4J16A 3LFIA 1QFMA 5E8JA 1ND2B 1X3SA 2RH5A 1X50A 4JCOA 1RI2A 3R09A 1ZM1A 1ZESA 4OI2A 3V48A 1W0JD 2FSHA 1R8SA 4AICA 5FPAA 1SC6A 3AZZA 1EK5A 3KLNA 4EI2A 3G3EA 3IO3A 1U2RA 5FI0B 1OU4A 3EVDA 4N76A 1K5MA 2IXDA 2IE0A 4RJJA 5TPZD 2EGGA 5IVCA 1VI2A 3ASIA 3WLIA 4DA7A 1PV4A 2KA3A 3H16A 4D9MA 2W9XA 2HK8A 2MU1A 3NOVA 1XPWA 3GEGA 4G0QA 5A04A 2XQRA 3RG2A 3ILHA 3OZCA 1ZUHA 5H9WA 5J7MA 4YXFA 2WSBA 3DOFA 5JYBA 3HCBA 2DUNA 3VKMA 3STHA 4OF4A 1F1BA 3ICWA 1YH3A 4FFBB 4JB2A 2O3UA 3VOAA 1KVTA 2GHIA 3BL8A 4DR7B 3OFNA 4FPGA 1ESCA 4QU1A 5HSGA 1M9NA 3VBSC 3WHKA 3S5AA 4EGCB 2VK2A 5HJ5A 4MHSA 4J3JA 3CUTA 2BEUB 5JQGB 2NYAA 4O29A 3DMYA 5F1PA 4FJ2A 1PQPA 5EQUA 3SCFA 4YJ3F 1G8WA 4UVEA 5IZCA 2Y9MB 4AKIA 2VYVA 3H5IA 3KXIA 2D7DA 3F2VA 4K6GA 4QD3A 4IGEA 5KVQA 3I30X 5A4AA 4D4KA 5G3ZA 4PYKA 4HH1A 3WLJA 1N1TA 1L8LA 5MFZA 2GN1A 4G1EB 4YBRA 1XL0A 3VVLA 3TFQA 1RWBA 7YASA 1RRVA 4FFWA 4ISQA 4BN0A 3TNLA 2PHUA 3BF7A 3AB0A 1TW2A 2PAKA 4ZIRA 1EJBA 1TKCA 4M0HA 5CX4A 5EUCA 3P2YA 3GYGA 4P7JA 1SOWA 4S2DA 1NE7A 3Q3VA 5JH7A 2AYHA 2VD7A 5FYQA 4H3SA 3KKOA 4WACA 1NVXQ 3D7LA 4Q0SA 1ZYUA 3JQXA 5F6KA 1FC0A 5C4WB 1O8PA 2R2AA 3KJQA 5H1YA 4O3FA 1K7FB 2FOXA 1BMV1 2A3RA 3KKQA 5TARA