3IIIA

1.95 angstrom crystal structure of coce/nond family hydrolase (sacol2612) from staphylococcus aureus
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
558
structure length
556
Chain Sequence
QHLLGNPKLTVTHVNEVKAGINHIVVDSVQYGNQEMIMEKDGTVEMRDGEKLYINIFRPNKDGKFPVVMSADTYGKDNKPKNMGALWPTLGTIPTSSFTPEESPDPGFWVPNDYVVVKVALRGSDKSKGVLSPWSKREAEDYYEVIEWAANQSWSNGNIGTNGVSYLAVTQWWVASLNPPHLKAMIPWEGLNDMYREVAFHGGIPDTGFYRFWTQGIFARWTDNPNIEDLIQAQQEHPLFDDFWKQRQVPLSQIKTPLLTCASWSTQGLHNRGSFEGFKQAASEEKWLYVHGRKEWESYYARENLERQKSFFDFYLKEENNDWKDTPHVIYEVRDQFYKGEFKSASAFPLPNAEYTPLYLNAENHTLNHAKISSAHVAQYDSEDKQQDVSFKYTFDKDTELVGNMNLKLWVSTKDSDDMDLFAGIKKLDRRGNEVNFPDFNHIENGQVATGWLRVSHRELDQEKSSIAQPWHKHETELKLSQDEIVPVEIELLPSGTLFKQGETLEVVVKGSEIVIGNSTPGMKTRYEHEETVNKGMHMIYTGGKYDSQLIIPIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CocE/NonD family hydrolase
publication title 1.95 Angstrom Crystal Structure of CocE/NonD family hydrolase (SACOL2612) from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus col
molecule tags Hydrolase
total genus 189
structure length 556
sequence length 558
ec nomenclature
pdb deposition date 2009-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02129 Peptidase_S15 X-Pro dipeptidyl-peptidase (S15 family)
A PF08530 PepX_C X-Pro dipeptidyl-peptidase C-terminal non-catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3020.20 Mainly Alpha Orthogonal Bundle alpha-amino acid ester hydrolase ( Helical cap domain) alpha-amino acid ester hydrolase ( Helical cap domain) 3iiiA02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3iiiA03
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iiiA01
1ACLA 1FFDA 4NMWA 2VZQA 4ZXEA 4FI9A 3IAQA 4BVJA 4G1FA 2Y2VA 4MADA 1UK7A 1J1IA 1UY0A 3H2JA 2VZTA 3O4GA 4HXEB 3CIHA 4WCVA 3OEAA 2HHAA 3F2ZA 3W2TA 1NKGA 4Y9SA 1R1DA 4BK4A 1JI3A 1ODSA 2PL5A 4IH1A 3ZLTA 3KD2A 4BJ0A 3WWCA 4U2CA 4P02B 1MNQA 3FYUC 4OPMA 4ARYA 5ALHA 3MBWA 4J0GA 1A7UA 5JUVA 3WF2A 4BE4A 1H6XA 2AJLI 4BTLA 3VJKA 5KREA 3GXUA 1CUZA 1R64A 2BGNA 2W6CX 4UBLA 5LZ4A 4OYLA 1BCRA 2OGZA 3KXPA 2VA9A 3H04A 3IDAA 4BDSA 1DINA 5LYYA 3PDCA 4QB1A 4J7AA 1BEZA 3OGVA 2ECFA 3WL5A 4EY5A 3DECA 3STTA 1GKLA 5CXUA 1R50A 4QLOA 3LEGA 5CT8A 2ORXA 1DTEA 1A8SA 3AZQA 4HG6B 4M0EA 2AJBA 1KEZA 3VD7A 4QWMA 5ALTA 1QIIA 3K4AA 5JAOA 4HXGA 3A2MA 3WWPA 5I7UA 5AOAA 1QONA 1XZGA 2C58A 4CIAA 3A2NA 2CMFA 3FOBA 3I6YA 1OCEA 1DX6A 1IZ7A 5AKIA 1R88A 1K8QA 4XUTA 4PQQA 4ZZ5A 5DTJA 4FOLA 3WK5A 2JIDA 2XLBA 1SCIA 4C4YA 2DHCA 2OKXA 4CUAA 5AI4A 4CUCA 2G5TA 4HRYA 2VZOA 1Y7HA 1IUOA 3GFFA 5T4FA 1THGA 2GBGA 5T4BA 5AI5A 2Y6GA 4AO6A 1VJ5A 2RVAA 1UYZA 2QQJA 1G42A 4GWLA 2VC9A 3ANTA 3QZUA 3WKEA 1WOMA 1VKHA 1CUVA 4FDMA 1AQLA 2VZ1A 1E8DA 1YCDA 3H0CA 3OG2A 3IUQA 1ODTC 3MUY1 1JJFA 3CZUA 2XMDA 4RGYA 2WN2A 3Q0TA 4DXRA 2WHRA 3W9UA 3RARA 4B81A 4OYYA 4KE9A 2QMQA 1W9WA 5LZ2A 2Y6LA 4OB6A 3B5EA 2BUCA 1ZI6A 5DLPA 3LEKA 4QDTA 4UFOA 2QTBA 4P9NA 2WG0A 1DWQA 2E3JA 1ZICA 2BZDA 3HNYM 4CU8A 1JZ4A 3U1TA 4PSUA 4MGQA 2VQTA 3GM8A 1CUGA 3YASA 1B6GA 2VCAA 5ALQA 3NJVA 5LIPA 1H2WA 3DOHA 1EB9A 4OD0A 2BGPA 1EA5A 6YASA 4BCBA 3ESDA 2OLEA 4OMCA 4E15A 3C8DA 2HM7A 4Q34A 4XUOA 5EHNA 4BE9A 5JYCA 2BGRA 2GBFA 3G9TA 1RYYA 5EHQA 2C9KA 4UHHA 5DWDA 5AKKA 2ZEZA 4LIPD 1JJIA 4CU7A 3H19A 4A42A 4P5YA 3D5EA 1LLFA 1TKRA 5FRDA 2WHQA 2QUBA 2WZEA 5AO9A 2DQYA 5FPQA 2YFUA 2PSDA 3IVMA 4BYMA 2C5FA 5F4ZA 2WDBA 4J0CA 4E46A 3HJUA 1EVQA 5AK3A 3I2HA 3MGAA 3C7HA 1CV2A 4LKSA 2Z3WA 3WIOA 4OCZA 3BDVA 3HC7A 4JH0A 4FNGA 3BL8A 2ONCA 4U2DA 4Y2RA 2KD7A 4C4XA 1XROA 4BZZA 5A7FA 1E8NA 3BDIA 3ACIA 4QA9A 5T4EA 4AXBA 2OG1A 4B0PA 5CMLA 5IVHA 3BGAA 4AQDA 3IUJA 4KAFA 3B12A 1YA8A 1YS2X 2V4VA 4ZY9A 3F96A 4X85A 2AJCA 1K3IA 3E3AA 3FSGA 3VISA 2X05A 2XUFA 1CUXA 2VSQA 1TVGA 1ODCA 1RP1A 3ED1A 5AM2A 4DLNA 4P08A 2OGSA 4Y2QA 4DNPA 3VDBA 2CUTA 1XRQA 1O6FA 5K3AA 2ZJFA 3K4DA 5JARA 3GBSA 5ALVA 2CDPA 2WUGA 5JXHA 1VLQA 4X90A 3HI4A 2J1RA 3E4DA 1EDDA 2H7YA 5C71A 2BAGA 3HACA 2E31A 3VD5A 2WUHA 3QPDA 2JE8A 3ICWA 2VATA 5EJZB 1JFRA 2JDAA 3MO4A 3H18A 5G04L 3VDAA 2VZVA 3OPMA 1JHJA 2J1EA 4M4PA 3LPGA 5JZBA 1YB6A 1OT5A 1CIYA 3T0AA 2VJXA 4X91A 5I8PA 1GPKA 4Y2UA 4Y2VA 2RGUA 1P0QA 3AUKA 2NW6A 3FAKA 4X95A 3WWEA 4DXTA 1LPPA 3A23A 3WNPA 5ALJA 2HRRA 3OEBA 3FL7A 3PI6A 1MNAA 2PSFA 5D7BA 4UHCA 4LYDA 4MQLA 2XQFA 5DQ0A 2GZSA 1K4YA 3DOIA 4V2IA 4MYDA 3DKKA 4BRSA 5SYMA 1JT2A 5K3FA 1WCQA 5C81A 5AI9A 2QOEA 5A71A 3AINA 3WQHA 1TRHA 1W9SA 2H9YA 5BV7A 3C7EA 4X6YA 5FDFA 4FNMA 4KE7A 1CUEA 2JEYA 1LPBB 1W0NA 3HNMA 5HF6A 2VZSA 4Y2XA 5JAPA 3LE0A 5DYWA 1WPRA 5JXJA 1F4HA 4D9JA 2OCKA 1F4AA 1L7AA 3SC2A 1UWWA 2BKLA 4ETWA 3U37A 3V48A 1FSSA 3DNMA 1XZHA 2XMQA 3P1IA 4G4JA 3WYNA 2ORYA 2C0PA 1H23A 1JU3A 1MT3A 4GI1A 2Y6UA 4BRZA 2LIPA 4U2EA 1LBTA 2WABA 5HQ3B 1UK9A 1XNTA 2VMDA 1CX1A 4OYUA 1AGYA 4GDMA 5AICA 4X92A 5AKYA 5LCWL 2XUIA 5EHXA 1QIGA 3FYUA 1XZIA 3T2PA 2QXUA 3WNKA 2ID4A 2IX9A 5JADA 4Z2AA 3BJMA 3HOBA 3DYMA 4J0IA 3FHAA 4OUKX 1DU4A 5FUIA 1GMMA 3G0IA 3HABA 3AILA 3BWXA 3I1IA 3AFIA 4UBKA 5E4JA 3M83A 3FN9A 1TAHA 5J3JA 3D2AA 3PFBA 3QM1A 1Z68A 3CMGA 4LYEA 2WU3A 4E8CA 1VZ2A 4DNOA 3DL7A 1YAJA 1BN6A 5B4NA 1ZOIA 4QDOA 5AK6A 2HA7A 1MN6A 4JYMA 2C7BA 2PUJA 2ZEWA 2HFJA 4GECA 1JYXA 3QVMA 4GEGA 1MX9A 4J0DA 2E33A 4ZV7A 1J2EA 4CG1A 3F9CA 3WQBA 2VAVA 4X94A 4C88A 2PSHA 3STUA 1QIHA 4AMZA 2PM8A 1QLWA 2O7VA 3C6ZA 1LZLA 3C5VA 1JYVA 4PO3X 3EQ8A 5ALEA 1SFRA 1UKBA 3SK0A 1XNAA 1DYOA 5AKHA 2XQKA 2BCEA 5ALWA 5A7HA 2WO1A 2D5LA 3BIWA 2W1SA 5JXIA 4KAAA 3A70A 5AM5A 3FLEA 4UOJA 5K3BA 2HIHA 2BERA 2XUPA 3DJYA 1A8UA 4DYHA 3PE6A 3GGLA 4IO0A 1GU3A 1XZCA 4AZ0A 2WLSA 4CCYB 4FLFA 4IH9A 2CZQA 3WKDA 5C7GA 2WM2A 3ICVA 3ZLVA 1XQXA 2XUJA 2WFLB 1CR6A 3BIXA 3C5WP 5FLKA 1CIJA 4N5IX 2I3ZA 2XMSA 2WJ6A 4Y2JA 1WB6A 1BHGA 3R3UA 3UETA 2VJAA 4WFKA 5CTAA 2Y6VA 4XUPA 3DYIA 4TVKA 1BEEA 4C87A 3CZJA 5LA1A 3ZLUA 2Q0XA 2J1UA 3JW8A 1L7RA 2YG0A 4B82A 4ZGBA 2WQZA 3V9AA 3C8HA 4KEAA 2ORZA 2O2GA 1K45A 4LPLA 3BXPA 3E0XA 3HSSA 4W50A 2X5XA 5LZ9A 5LZ5A 2WN3A 3W05A 2LS6A 1SCKA 3TJMA 3VDCA 4EBBA 4H7JA 4FTWA 1TQHA 4ET7A 3FLAA 4TXWA 4A23A 3KOOA 5D3ZA 2XUHA 2DCKA 1AKNA 1U65A 2WUDA 2PU5A 1W1IA 4KI5M 4RE5A 1UYYA 4OMDA 5JIBA 3DQZA 3DS8A 4X7BA 4Q1VA 1WKYA 1CQWA 3K75B 1UXXX 5BWBA 2WG2A 3T2QA 3FBWA 1JMYA 3ZI7A 1ULPA 4BDVB 2CBGA 4BC0A 1JU4A 4UPDA 2WU4A 1E5TA 1QOZA 2XMCA 2WTMA 2XUKA 1D7PM 3PUHA 4KMQA 4DMHA 4UBOA 2WQ8A 5AM0A 1HDEA 4H7EA 4H7HA 1XLVA 4QX3A 2PKYX 1CLEA 3JYHA 1DP0A 3WYDA 1ZGBA 3IBTA 1CZTA 1K42A 1ZJ5A 1KU0A 4UAPA 3WNNA 2Z8ZA 1XZAA 4BAGA 2HDWA 1SHWB 3CQOA 2VJDA 2Y6JA 1XKTA 3WK8A 5ALOA 2OXEA 1DT5A 1CUAA 4UHEA 1UOQA 1GKKA 3R41A 3OC0A 3TEJA 1VXRA 3HZOA 1J06A 4JNCA 3G9UA 5K3CA 5EIYB 2JF0A 4AO7A 4MEAA 2VR4A 1W99A 5DMYA 4KYVA 2Y64A 2QJRA 2JGMA 3FLBA 2VJBA 4DUXA 4F0JA 1JZ7A 4AN1A 4QPWA 5BOVA 2WTNA 1BRTA 3ACHA 2CB9A 4BB0A 2GYUA 3OGRA 2O2IA 3IURA 3L1JA 3D3AA 2VO5A 1XPWA 1UOOA 3HXKA 4DTCA 4J03A 4GWIA 1QIDA 4ZRDA 1QIFA 3VDXA 4H7KA 1P0MA 3F97A 2EIBA 1KGYA 5ALGA 3O95A 3WF4A 1ULOA 3RLIA 4B9AA 2XUDA 1CUWA 2X8BA 4A16A 4YX9A 1CEXA 4B80A 3I3EA 1C7IA 4MWTA 1N8SA 1LPAB 3D7RA 2WJ4A 2Y2UA 1QGED 3DEAA 2K2QB 4RYDA 1DQYA 1ISPA 4WDRA 1QO9A 1CZVA 1CZSA 1SG3A 2GBIA 4W9RA 5ALUA 1CUCA 2JEZA 1HBJA 5LP1A 5JD5A 2VEOA 1XZBA 2ACEA 2GZRA 1XRLA 5HFAA 1XQVA 1ZI9A 5AKEA 1TCBA 3ETPA 2VT7A 2VCCA 1CPYA 4DMKA 2W1WA 3T0BA 4RE6A 2VMCA 3OOSA 4N8DA 5EGNA 4J0KA 5I9IA 4EY7A 3DYPA 5HPOA 2VTFA 1UK6A 3WK7A 4KR0A 5ALYA 5H3HA 5FUMA 1IMJA 4X71A 1FFCA 2R11A 5IFTA 1I6WA 3G9ZA 4EZIA 4XURA 5KBYA 2BGOA 4X97A 1EI9A 3R3WA 2XDWA 5JD6A 2W94A 5HF9A 2HA6A 2VJCA 3NGMA 3WNOA 3R3ZA 1ETHA 3IUMA 2FUKA 4NZZA 3VVLA 3D2BA 3G0BA 4DMFA 3D59A 3BF7A 1NUKA 2VZUA 2H7XA 5ISMA 2O2HA 4ITVA 5IKXA 3SKVA 1F0NA 4IQ4A 3K2IA 2RONA 1K12A 2WFZA 1AZWA 4P00B 2AJDA 2GYWA 1XFDA 4C01A 3I28A 1GQPA 3WA6A 3K46A 4FBLA 4B6GA 2JGLA 1CUYA 1XC6A 3UESA 4ZREA 1XLUA 4QLAA 1GT6A 5JZ9A 4CIBA 1GNYA 4AB1A 3D0KA 4Y2YA 5A7GA 1W76A 2QQLA 3GZJA 1EH5A 2J4CA 3M81A 1JYNA 4QWWA 5HF8A 4N8EA 3V1LA 3SEPA 5J1XA 1MTZA 3H2KA 2V98A 4KWUA 2G5PA 5HKAA 1SC9A 1Q84A 2WHPA 1HKHA 1IUNA 3WZLA 2QQKA 4X00A 1VE6A 2RV9A 3HPNA 1Q0RA 4KRYA 4NS4A 2G4LA 2VQ6A 4UUQA 3TRDA 3G8YA 3R3VA 3C45A 2BBAA 3FVRA 2PBLA 3MVEA 4ARXA 1JJBA 3AIKA 1JYWA 2XMRA 2XHNA 3HRHA 4L3WA 2V9ZA 1GUIA 2DR0A 1TIBA 3O4IA 3C7GA 4M4RA 3IULA 3PF8A 4RNCA 2PVSA 4EHBA 4PQEA 3STWA 4BDTA 5C8VA 5HQ3A 1K63A 2R7EB 1UWCA 3NJXA 4D0QA 5A1AA 4INZA 1PV1A 3ESBA 4EY4A 1YAHA 1B41A 2XUOA 4A44A 2VL4A 3VD4A 3HYSA 4CI9A 4EUSA 3EQ7A 1XKLA 1XQYA 2G63A 1OF4A 3D3NA 3OGSA 3G7NA 3H1AA 2QVBA 4H35A 5ALKA 4AX4A 3WA7A 3A22A 3QPAA 1C4XA 2BFNA 1N1MA 4DM7A 3E1F1 5AM3A 2ZVDA 3WZMA 4CCWA 5FV4A 1H22A 4WFJA 4BP8A 3DCNA 1K5PA 3I6MA 5CZKA 5DNVA 2C4XA 1LGYA 3H2HA 2B4KA 5CRIA 1O59A 1QIEA 4I3FA 2JGIA 1GQRA 1P0IA 1WPXA 3N2ZB 3WJ1A 3OG9A 2HYXA 1VA5A 1ORWA 1F8UA 3DYVA 3I2JA 2ZYRA 4G4GA 3W04A 3WNLA 4WY8A 5AKGA 3GDBA 4CVUA 2HA3A 1XZEA 4Q3LA 2JGJA 2VCBA 1UFOA 3C6YA 5ALRA 3FVTA 1YS1X 2VAXA 5IVIA 4PSCA 1T2XA 1VXOA 3QMWA 1SDDB 2RHTA 3A21A 1RWQA 4CFSA 5KWIA 4GHWA 1O8PA 4B84A 2XUGA 5AK5A 1DWPA 2VM9A 2VOTA 4MYSA 3CN9A 1W75A 5AIBA 2QKYA 1QE3A 4E14A 3S2ZA 5AHXA 2ACKA 5AOBA 5HK8A 3WL8A 1AUOA 3GELA 4HAIA 1TCCA 3UUFA 2WAAA 2XQJA 4Q3OA 1MAHA 4LXHA 4QEKA 3WEZA 1J84A 3G0GA 5CH5A 4CUBA 3DD5A 3ZPXA 2EIDA 4U2FA 5A2GA 1JKMA 1AURA 1MU0A 5ALPA 2V5DA 3S8YA 5CURA 5AIAA 5E4YA 4BZWA 4EA6A 1CUBA 3ZM8A 4G8DA 5IYYA 2VMEA 1UY3A 2WAOA 1WB5A 2QQMA 3FNBA 4LXIA 5HK9A 2PSEA 1KU6A 2YC2A 1IZ8A 4FFWA 3I3BA 5T4HA 3UMJA 2XMBA 3D2CA 1P8JA 4UBIA 4ZZ8A 3WF1A 1LBSA 1XZJA 2IIVA 7YASA 1HPLA 3A6ZA 3EBLA 5ALLA 2JGKA 5JASA 1OD3A 5FPPA 2HU5A 2W87A 4AG4A 1NX9A 3QH4A 1EDEA 2EICA 3HLKA 4BXSV 3I97A 2YH2A 4DSZA 4Z49A 4AN0A 2J22A 2W47A 2WIDA 4IHAA 3DDUA 3G0DA 5DYYA 4KJXA 4QB2A 5D3KA 1CFJA 2ZJ7A 1ORVA 5AI8A 3WNMA 1LZKA 1EUUA 1QTRA 4F21A 4J0HA 1H2XA 1YQ2A 1SOMA 5HZGA 5E2IA 2V97A 3H2GA 3BF8A 3ILSA 5IJRA 4HVTA 3GUUA 4FKBA 3OURA 2WJ3A 5ALMA 4OB7A 3SKJE 3EQ9A 2XT0A 2I3DA 3K6KA 3UUEA 2ZYHA 2YC4A 1Y7IA 3I2IA 1AC5A 2CJPA 4K2AA 4UBNA 5JXGA 1UT6A 2HL6A 1PX3A 2EEPA 3G02A 2ZSHA 3O0DA 2DCJA 2JKXA 3WF3A 2W5FA 2RI6A 3WKCA 1ZD4A 4CG3A 2H7CA 2V72A 3WIBA 4LHEA 3MV01 1YR2A 2VTVA 4DSAA 3VKFA 2VZPA 2X76A 2XB6A 4WY5A 5JMOA 2J1TA 1W8NA 1UOPA 3FHQA 5IVDA 2DCMA 3AIOA 1UKCA 3WI7A 2Y8KA 2WIGA 4S0XA 1CQZA 4ZV9A 2Z5GA 4YK7A 1S8OA 4U2BA 1DWOA 5IHRA 4GWJA 2QUAA 3C7OA 4MWSA 5A62A 1QZ3A 5K3FB 5EHZA 2WZ8A 3RM3A 3DL4A 4TPKA 4B7ZA 4XJVA 1QTIA 5G05L 4E8DA 2HA2A 1W9TA 4TGLA 1C7JA 4BATA 2VQUA 2HA0A 3AZOA 5DN2A 3O9MA 5JANA 1BROA 1PMJX 2XQGA 1UY2A 3LLCA 4ZWNA 1I5PA 3IAPA 1VOTA 3BN6A 1J83A 1OXMA 2IITA 4JHZA 3LQCA 3AIMA 4EB0A 3VJLA 5AH0A 1JZ8A 1LNSA 2ZXQA 5CT5A 2B20A 1WM1A 2HU7A 3FYUB 4UBJA 1US2A 1UMIA 1ZD3A 1PMHX 1Q0ZA 2QRUA 1CVLA 1U8EA 3D4LA 1CUSA 1LPSA 3AC0A 5ALXA 4G5XA 3STXA 3WK9A 4EY6A 2QBXA 1USWA 5CBKA 3T4UA 1XLWA 1UZAA 5IFPA 1MAAA 1BN7A 4X6XA 5LZ7A 1UMHA 4LKOA 2W22A 2J3QA 1ZIXA 1GXSA 1EHYA 3ESCA 2J3DA 5AM1A 5CH3A 4XIIA 3WKAA 4RN5A 4PV7A 4AO8A 5C8XA 2B61A 4MOAA 3THDA 3VD9A 1FFAA 3VJMA 4I4CA 4QDXA 4CU6A 2C0QA 1XZLA 3GA7A 1W6RA 4HTAA 2DDUA 3ACFA 2QM0A 2Z8XA 1GOFA 5BWCA 1XRMA 4PF1A 1T4MA 1CUJA 1H2YA 2HU8A 3C6BA 1WHSA 4KE6A 2QXTA 1QFSA 3WSOA 2YXPX 3NRUA 4G9GA 4BCCA 2W91A 3K77A 3O9VA 5JALA 2FX5A 4K6GA 4KE8A 5ALZA 3O4JA 2WYSA 4DUWA 2OAGA 2HA4A 3WK4A 2W46A 5EFZA 4K5QA 4JKLA 2PX6A 2ZYIA 3WWOA 1HN1A 4KRXA 4FFVA 5HXMA 4A3ZA 2OAEA 1JZ2A 3BE8A 2ZSIA 5AKXA 4YASA 3ABZA 3IA2A 1YASA 4YPJA 1BE0A 4ZI5A 2AJ8A 4G8BA 5LA2A 1M33A 4ROTA 1Q83A 4ARBA 5DNUA 2WIKA 3IIIA 2YFZA 3WMRA 2OQVA 2PQSA 3SX4A 4PT6A 1Y37A 1THTA 1DT3A 1E66A 4BVLA 1QIJA 4K6KA 3C70A 1UX7A 5ALIA 2QJWA 1N5MA 5SYNA 2OPHA 4XVHA 1YB7A 4FWBA 3ANSA 2WBKA 4A6OA 3RKSA 1XZMA 4I19A 1VE7A 3FSGD 2LW8A 2PUHA 2DHDA 4PNZA 3PF9A 2XONA 2HA5A 4GXNA 5FKJA 3FYTA 3UNPA 4X93A 3C8XA 3R3YA 5HKBA 1UXZA 1MX5A 3F98A 5AM4A 2WILA 1ZI8A 3QITA 4DGQA 4FHZA 1YA4A 4UHFA 2BUBA 3THCA 1ZD5A 3ACGA 3C43A 2XUAA 5EIHA 4GZ9A 3JWEA 5HCUA 2I03A 3L1HA 1EDBA 1G4HA 5HF5A 2RIPA 1FFEA 4L0PA 4QDQA 4W1QA 4W8JA 3T52A 1X70A 4UFNA 5K3EA 2E26A 5DPNA 4G9EA 5B4XA 4AAXA 1E3QA 4L0CA 2YB7A 4AMYA 1QIKA 5EJ1B 2CKMA 2ROQA 1E8MA 2PU7A 3U0VA 1HL7A 4HRXA 5CYYA 4ARAA 1U4NA 4HXFB 4M0FA 1UY4A 4Y2TA 2EIEA 5EIAA 1DX4A 3HEIA 4Y2PA 4A5SA 3HN3A 4JKKA 4MGSA 1YSCA 5AK4A 1CUHA 3W5MA 5LKAA 1XRNA 4FBMA 5C8ZA 2P8SA 3EF3A 4X6UA 3F8SA 2WKWA 4H7IA 3OB8A 4DIUA 3KWJA 5AP9A 4Y2SA 1GZ7A 3KWFA 4G4IA 4QX1A 5CH8A 2W9XA 3M82A 2Z3ZA 1QFMA 1G66A 2CDOA 4F5ZA 1R9NA 4GW3A 2QQOA 2ZYSA 1CUDA 4DUVA 3I1YA 3WL7A 2DHEA 4B0OA 1TK3A 3C7FA 1FFBA 2J1AA 1ZGCA 3QBJA 3NUZA 4GLBA 2VT6A 1LPNA 2L9LA 1LPMA 3CKHA 2E32A 2XOMA 1WB4A 4PW0A 1UY1A 4RPCA 3CN7A 4DNQA 4EY8A 4XX1A 1U2EA 3NOXA 1VA4A 3N0TA 2J1SA 5JATA 2XLCA 4H7FA 3ECQA 3P2MA 3SEEA 5K3DA 1AMNA 3OM8A 5AOCA 3T09A 1MX1A 4F60A 4HZGA 2RJ2A 1GQSA 4BAUA 5C70A 5AI6A 4GBGA 1US3A 4IUGA 3ZWQA 4BTVA 1R3DA 2WIJA 1OF3A 1BS9A 2HRQA 2JGFA 5KWJA 4OB8A 5CT6A 2H1IA 4A41A 1XZDA 3T08A 1A88A 2V96A 2WG1A 1VZ3A 1LPOA 1PX4A 3STYA 2ES4A 2HFKA 5JZSA 4J0JA 4NVRA 4BK5A 1NU6A 2Y6KA 5FOQA 1PFQA 3TGLA 4OU5A 1EB8A 4QDZA 3QMMA 4FLMA 3QPCA 3LS2A 3LIPA 4CG2A 2WFMA 4LQRA 4C4ZA 3PUIA 1EX9A 1WCYA 4W1SA 1ZD2P 4QE3A 4W4ZA 3T2OA 4BVKA 3NNGA 3BJRA 4H7DA 1GOGA 1KEXA 2Z4FA 3I2KA 4BC1A 1CUFA 4QAWA 4WDQA 1QO7A 5AKJA 1K6EA 2J4FA 1EUTA 5CT4A 4BP9A 3A2LA 4CU9A 2XUQA 3AZPA 1A8QA 2XQXA 2OCGA 1MJ5A 1W52X 1FJ2A 2VZRA 3NWOA 3O4HA 1L7QA 3MUZ1 2W3JA 1P0PA 3WJ2A 3P6BA 4QDSA 3VD3A 2HADA 1O8SA 4MO3M 1N5RA 3I6ZA 2RAUA 3EYPA 1HQDA 4Q82A 4MEBA 2AXEA 4QDUA 4BAZA 1EXWA 1QJ4A 3PICA 5DYTA 5AKZA 3PFCA 3R3XA 4QX2A 4XUQA 2OCLA 4J3JA 1PJAA 2FJPA 3W9BA 5ALSA 4LXGA 2CEKA 5DNWA 4WFIA 3WKBA 4YPVA 2ZEXA 3EIOA 3HJRA 2PPLA 3WF0A 3VXKA 1UK8A 4OU4A 5FP0A 3R40A 5EI5A 3LPFA 1ZIYA 4KAJA 5JAHA 1MPXA 3W06A 5F7UA 3WL6A 5ALDA 5AI0A 4CCYA 3L1IA 1BU8A 3LEIA 1CUIA 1IUPA 1J07A 1R9MA 2O7RA 4TTGA 1T2NA 2JBWA 3HNBM 1ACJA 1UXOA 3OBAA 2Y6HA 4OUEA 4DXSA 2WFLA 4A45A 5ALNA 1H6YA 4JX0A 3FCXA 3WLAA 2WHPB 4W1PA 4UFPA 4OZOA 2WSLA 1UZ0A 1XZKA 3ESAA 4PSDA 2J1VA 1XQWA 4G8CA 4HS9A 4N8SA 5HFNA 3V1MA 1MO2A 1O6GA 4O08A 1NU8A 2DFPA 3WWDA 5JR2A 4MXDA 1DQZA 2WUEA 4QDRA 4U2GA 1GPNA 1W4LA 3C87A 3DLTA 2VF2A 1X2EA 3FCYA 4XVCA 2OGTA 2XE4A 5I0DA 1EVEA 5EIEA 3I3DA 5LKRA 4UHBA 3EB7A 3H17A 4L72A 4JUIA 2FJ0A 2EDAA 3LP5A 4B83A 1EK2A 1OILA 2QR5A 2ZJ6A 3E1GA 1E89A 4MQMA 1JZ5A 1JI6A 2WO2A 3AJAA 4Q3KA 1HLGA 4DEVA 4XZUG 2OCIA 3RK4A 1BCSA 1UYXA 2YASA 1WHTA 1DLCA 4DMCA 1XRPA 3M3DA 1F6WA 2VMFA 4A4AA 1EINA 4JKMA 1IVYA 3I2GA 4X3CA 3Q8WA 3H1BA 4IH4A 2W1QA 4BCDA 2OQIA 2XQIA 1W8OA 4W63A 5JAUA 4K6HA 4H77A 3DYOA 2BUAA 2J7MA 2XI4A 4W1RA 5A6VA 2ZEYA 3H2IA 1XRRA 4JYPA 1G5FA 2Y1KA 2C5GA 3I2FA 2WO3A 3A7QA 4E11A 4XWGA 3FWHA 2DQZA 2WUFA 1TG7A 3CDZB 2PSJA 5ALFA 2XMZA 5ESRA 4XUNA 4QZVA 3G0CA 1JMKC 3QMVA 3WK6A 1CRLA 3B3QA 2EDCA 4FMPA 4UBMA 3CCBA 4MJ3A 1X2BA 3HEAA 5DTIA 5JD4A 1F0PA 3CCCA 5K5EA 1GPLA 3LCRA 4DEQA 3DKRA 2UZ0A 3KDAA 4AZ3A 2BJHA 2W1UA 4KACA 3F67A 1XZFA 2B9VA 2RHWA 4Q05A 3OTQA 4QNNA 5IVKA 1QIMA 1CUUA 1GGVA 4Y7DA 1R4ZA 3IB3A 1IQDC 5C7YA 4QX0A 3CXUA 4N5HX 5DJ5A 3QYJA 4M0MA 2GYVA 4P92A 2W92A 5CXXA 3IUNA 2DSNA 1NAEA 4H0CA 2W95A 3W5NA 3G9XA 1TCAA 5CT9A 4L9AA 3GROA 4B9EA 3T0DA 4H18A 2C26A 3K4ZA 2YYSA 2QQIA 4LHSA 4BBZA 4JEIA 5LLSA 2QT9A 5CW2A 2C4HA 1EK1A 4OSEA 2HLEA 2X10A 4B85A 5LZ8A 4C89A 3MV11 4QB6A 5IH7A 1GOHA 4D8MA 4ZXFA 2QQNA 1JZ3A 1UKAA 1H2ZA 5LA0A 5D6OA 3MUOA 5AJHA 3K9BA 1D07A 2WIFA 3X3HA 3STVA 3MUNA 4UHDA 1JZ6A 2R8BA 4P93A 2QZPA 5FXMA 3C6XA 3V1NA 2QS9A 3ZV7A 4WJLA 5AKLA 4DNFA 3R0VA 3LIIA 3J7HA 3V1KA 2D0DA 3SWWA 4C6HA 3JXSA 4UI9L 2VZ3A 5YASA 2GBCA 3NQHA 2X09A 1ZJ4A 2I78A 1SCQA 3VVMA 3KSRA 1OH4A 1AX9A 5E4TA 2JD9A 2XMGA 4FLEA 2JGEA
chains in the Genus database with same CATH superfamily
4M86A 1LLCA 3E15A 4LO7A 2IVZA 2XKAA 1GO2A 1I10A 3KHTA 3O4GA 4HXEB 1R1DA 1HB3A 1P5JA 1A4IA 1X9IA 1E79A 4OHXA 5HM8A 1SLTA 4P02B 3SYKA 3EBOA 1DC3A 1JB1A 1BD4A 1BYIA 1XVLA 4DDMA 1YS7A 2WOJA 1KF0A 4MS3A 2JI9A 4UATA 1MF7A 1H8TA 1RRVA 1T1SA 3KZXA 3E58A 4BQXA 2ZRAA 3WP5A 3A7EA 3IDAA 1JHPA 2XWSA 4F3JA 3BAFA 2ZGTA 1D8TA 1D4OA 2VE1A 1D6MA 5TMBA 3LEGA 1NNSA 2RAVA 1FX5A 1KEZA 2KMLA 1GKYA 2QL7A 4Y6SA 2DB3A 1O0SA 4ZO6A 2X9NA 1X1CA 4CA9A 2LTNA 1K5JA 3FWNA 3T99A 1SCIA 1U9IA 1FXWA 4Z3DA 2HSGA 3AHCA 1PJQA 3QY0A 3VBHB 4U6NA 3GFFA 4KXNA 2AI1A 1K97A 1O6CA 4TKLA 4E30A 5C3SA 1IMOA 3PC6A 4EEKA 4TTTS 3UOAB 4AGRA 4O8ZA 1ZH4A 4Z4IA 3OAAA 1QKQA 3R4SA 3BYWA 3D6JA 4RGYA 3NJ8A 4MGEA 4PU0A 1OTHA 4FPGA 2VBPA 1VC2A 4WOKA 4FIZA 1QXPA 5KVCA 5J1TB 2BHSA 1LOFC 3JYLA 2R073 1RYNA 1B0UA 4BO2A 3TW0A 1EAH3 5FUWA 1JZ4A 4ZHQB 5HHTA 1MEJA 2Y27A 5AXAA 3SMVA 1LF0A 3NJVA 4KBBA 3TE7A 2Q4DA 2BGPA 4RQPC 1FQWA 2MDTA 3DHEA 5CUQA 1ZZ6A 3U1XA 3U3JA 4DHWA 4L0DA 1Y8QB 3O4RA 2IZOA 1I0IA 4LIPD 5FOXA 3PVCA 5FR1A 2XEXA 1TVKA 4XEZA 4BLPA 4IGAA 3KQHA 1S0FA 4KN6A 2NYUA 4DIDA 1DAPA 2HSZA 1EHCA 4P86A 3QVGB 3MRTA 3QG1A 4F11A 3O3CA 2RGNA 4BZZA 4ZT4A 4UTNA 1IEXA 4PIVA 2RGDA 3BDIA 3WIDA 3NHZA 4YZ1A 3JYQA 1LY1A 2OG1A 4V0ME 1KMCA 4CV0A 5JO9A 5FORA 5H7XA 4ECEA 3QEOA 3JQ9A 2NXJA 3DDCA 3FOEC 4AY4A 1MC5A 1MABB 4R2XA 1HJGA 1NXD1 2Q1FA 3BXEA 5E6UB 5DULA 4NCAA 4IRUB 1ECGA 1YQWA 1RP1A 3NTXA 4BGDA 2JH8A 1FE8A 3K4DA 3AQ4A 4J2HA 4Q21A 2G5CA 2J1RA 2H7YA 2Q3DA 2XGGA 3LC0A 4GZ6A 1YI0A 4CKWB 3ZZNA 4EW2A 1NT2A 3WQ1A 3GCGA 4MUJA 2B5VA 3L7JA 5E9QA 4D8TA 3R7LA 4CT5A 2J1EA 3KJXA 2FUEA 3ZWBA 3OZSA 1H1IA 2DKFA 3JWJA 3BB3A 3KQOA 2RGUA 1ENYA 4IDAA 1WX1A 2O2DA 4NPHA 4D25A 2VCMA 4BZQA 2WS91 3WNPA 1K6IA 4HV4A 2JFQA 3IKJA 3PDJA 1KZYC 5KYGA 4HYYA 1R00A 2GLTA 5D7BA 3DZ8A 1NVKA 3EMBA 3EPKA 1YKGA 4NESA 2XQFA 1JFFA 3HB5X 4I81A 1SUBA 3DL3A 3O8DA 3E7FA 1JT2A 2QQFA 3WQHA 3HB7A 2JEYA 1LPBB 1IFXA 3FCAA 5HF6A 4AEDB 2VA8A 4C3VA 2VZSA 5IT6A 1UXJA 3CMMA 4UEOA 4F8AA 1VJ2A 4H1VA 3ENWA 4LBNA 2C6SA 4HFSA 1BH6A 1E1CA 3ZGZA 2JFHA 2P90A 4RHV1 2F8TA 1HLDA 4UD2A 5C3MA 1MIHA 5U1PA 4MVJA 5A02A 3ZLJA 3TBDA 4ASUA 1O96A 4B3XA 4XX0B 2OQ6A 1DBSA 2DZDA 3H5WA 1NE6A 1XZIA 3AEUA 3FLMA 5K0BA 3WDXA 5DNDA 1FMD1 3MSXA 1E6LA 3HOBA 1TMF3 2WAXA 4IMIB 2O9JA 3AKDA 1RXCA 2C95A 3S2GA 5FUPA 2ZIAA 3HABA 1WXDA 4D99A 2HJHA 5K4AA 5ACA2 2WF7A 1G20E 5TF4A 3COJA 4MDFA 1HTBA 3NWKA 3CZ4A 5KX5F 1G20B 3JZVA 5B4NA 4QAJA 4RQAA 2CNWD 5AW6A 2H06A 1PK8A 1Y63A 4RDHA 4CMJA 2XHEA 1WLWA 4G97A 1N92A 4WUTA 2I2DA 3C6ZA 1Z5ZA 1OD6A 2H1HA 5IN4A 3Q8FA 5CCDA 5G41A 2C61A 4KP7A 4XQ9A 3VPSA 1L5OA 5LFAA 3A70A 2HMSA 1J20A 2ET1A 5INTA 1D7OA 4TTSA 4UQPA 2Q4SA 4AZ0A 4CCYB 3RT1A 1VPTA 2OQ2A 4DFSA 5EHGA 1QXJA 3V1UA 2G1JA 4ZZ1A 1CIJA 4PZEA 3V5NA 3TFOA 2FUG6 5A6SB 4S12A 4LXQA 4E2ZA 4LHYA 1SEVA 3OOJA 4B82A 4QUDA 2G1MA 4ZGBA 3LKBA 3S81A 4XASA 5E0OA 4Y1YA 4N76A 4QGAA 1W39A 3VDCA 1MC4A 2R97A 1GYPA 2R6QA 1LI5A 4Y26A 2KB0A 3DMRA 2NSJA 5DGHA 1XL1A 2D40A 4YAWA 4TM8A 3VO9A 3U11A 1JMYA 1RTVA 4XAEA 1ULPA 3RRNA 2C4TA 4CM4B 2GCOB 3T4EA 2PBZA 3AMMA 1XN1A 1DEXA 3VPAA 1T9KA 2WTMA 1UC8A 1D7PM 4MMXB 1JS9A 1FFGA 2RR11 4NYIQ 3LBYA 1GQOA 3UV7A 3LCMA 3OU6A 3VUEA 2WTEA 1XZAA 2H2IA 2VJDA 1K5MC 2XXAB 2NP0A 3PUQA 4ZHQA 4L5JA 1MS4A 3CF4G 2O3JA 5HYVA 1HXS3 3HCPA 3D1LA 2FWAA 3DXFA 1RXVA 3MS4A 5K3CA 3G9UA 2A3XA 5ARCA 2QJRA 1HJFA 3FLBA 3RJTA 4OFWA 4CEWB 1W94A 4MA0A 1ZZ7A 3ACHA 1ZITA 1VG0B 4BOYA 1U8AA 1M0SA 5EJ5A 4HDCA 3BMNB 2VO5A 1SWVA 5K99A 1ILEA 4CKXA 2Q9UA 2XE8A 3C97A 1QDCA 5I8TA 1VBA1 4HNRA 2UUPA 3PDHA 3QVGA 3VKFC 2BFBB 1OBOA 4UARA 1GV9A 1ZCJA 5C80A 4MV9A 3TTWA 4U7DA 1Z15A 3AH8A 1XNBA 1L7DA 3PHMA 1DCFA 4GPIB 5HCFA 2CFOA 1OLXB 2I4TA 1XK7A 3TLZA 3HR9A 2GXAA 3PRHA 2OXIA 2N42A 2PZGA 5CK4A 2ZYVX 3NNFA 1OJLA 2Y2UA 3IPVB 1YFWA 2O5EA 5E6UA 1CY6A 1JEAA 4KYIB 1HGXA 3WDUA 2GBIA 4ZPXA 3MT0A 1ZUNA 5BW6B 1VM6A 5L3SB 4M3CF 5F8PA 1NA5A 5HRAA 5C3PA 2GK7A 3FLTA 3LLUA 8MHTA 1Q8SA 4E07A 2Y92A 1CJCA 4DPNA 3PEUA 3IQHX 4FC6A 1JUDA 5EZ6B 1QANA 4MAFA 5FUMA 1MH1A 1Y6GA 4TSKA 2H6EA 3HU2A 4QULA 3H16A 4XDOA 4XIFA 2BGOA 5FXZA 1Z4OA 2B46X 1F4PA 1VCMA 2VDRB 3C7KA 3GL9A 1BYUA 4C7JA 2JLUA 1ZM7A 2BMVA 3HP7A 4WTOA 3D0SA 4YCBA 2JGLA 4JL8A 4L4XA 2C83A 1HRI2 4H3SA 4J1NA 4M9RA 4CIBA 3RJ5A 4CQNA 5A0VA 4HWGA 1PRYA 3MWEB 1S3FA 2RIRA 5TY0A 1MTZA 4AEDA 5LQMA 5HKAA 1HKHA 4KXMA 4LIVA 1EK5A 5F7ZA 4UMVA 4RY8A 3VMMA 3SNKA 5DXAA 3TRDA 1A76A 4ZGWA 5LBTA 1SUIA 5HCBA 1JYWA 4XFHA 2WJZB 1RUE1 1G9FA 3LF1A 4XX0A 1S01A 5GV8A 2VTKA 3UKOA 1VB5A 2VSFA 1W4AA 3DE3X 3TLKA 3CINA 2ID7A 3OM1A 2A70A 3VZSA 4KWLA 1AY0A 3VU3A 1XF9A 2J6CA 4LY6A 1HNWB 4N8MA 2A1UB 1XCLA 1EEXB 3DCNA 1CNFA 3NCTA 1LK0A 2C4XA 3CLVA 4R2IA 1D3AA 2GWRA 3CONA 5DCYA 4BQWA 1I2ZA 1PNOA 3OG9A 3S27A 3K53A 3OIWA 2J41A 4PHTA 1VI2A 5D5QA 1PT9A 5AW7A 3WP0A 2VAXA 4BGVA 2CHVA 4Y30A 4IXWA 1EHIA 4XD7A 2GD1O 1QBGA 5HIAA 2ZTMA 3P2IA 3WL3A 1S0BA 3IGFA 4PZCA 3N0WA 3PC3A 1JAYA 4ZTUB 4MWDA 3OQIB 1EYBA 5E8JA 4QDJA 2Q3JA 2XQJA 4QEKA 1M06G 2ZJCA 4YP9A 3NBUA 2I6QA 4FD2A 4YFYA 1ECBA 3QYFA 3H9UA 3AL2A 2FGJA 1AS2A 4BZWA 3ZM8A 4PAOA 4XDZA 5ADWA 4Z3OA 4XM1A 1OLME 4R9DA 4EBFA 3FKJA 1WB5A 5H9WA 1CAUA 3W2HA 3EVCA 2O3QA 5T4HA 7MHTA 1JDUA 5CR9A 4PJYA 1LBSA 5LLDA 2PWPA 1HDRA 2E9QA 3HDQA 3ZZUA 1E7RA 3QH4A 1LDYA 1V6SA 1TLFA 2J7PD 2Z3VA 5JNTA 2LGJA 4GFDA 5D3KA 3Q3GE 4EFDA 1NMSA 1QGYA 3I83A 4F1JA 4E2XA 1FDVA 4OXIA 3CUVA 3IWZA 4Z7NB 3B7GA 1VJCA 1YKFA 3A4LA 4HVTA 3GFTA 2GH2A 3SHQA 3WLLA 2XBO3 1WEHA 3T1OA 2R6R1 1COV1 4J6FA 2QPOA 4CM4A 2ZYHA 3ITDA 2ZB3A 2RHOA 3WMXA 3W90A 1IOVA 3D7LA 4J3NA 2RI6A 1BFDA 3DZHA 2PVPA 4I9NA 1KEUA 3D8HA 1C28A 2Q07A 3VU9B 4LLOA 3W5CA 3NFRA 4CMBA 3RBXA 3OJBA 4AWDA 1UOPA 3PD0A 4D2IA 4GPAA 4ZZ3A 5FQOA 3MEPA 3RS8A 4TTRA 2QUAA 5K3FB 2QTRA 3GV0A 3EEIA 3C48A 5EE1A 1YUNA 5EZ5A 4LXUA 3VRHA 1F1JA 4HK9A 3LWBA 5K0JA 3MJTA 1WNFA 5CA1B 2OD2A 2FHRA 5J59A 3KHBA 1LVGA 4FX2A 4JB2A 2BFBA 1AUVA 1KJYA 3W3AD 4D8VA 2HMVA 3ILFA 2HU7A 2D6NA 3RVPA 2P6RA 4J1WA 2D2XA 3BYZA 3UAOA 1MIOB 4IIXA 3PJDA 1Q0ZA 3NM6B 2FMFA 2JLBA 2D54A 4D46A 4G09A 3HBKA 3TNFA 4DLAA 4EY6A 2J9YB 2XRFA 1DQ4A 3R7BA 3IPVA 4QXKA 1EHYA 3K8QA 2GWHA 2O2JA 4XIIA 4AI6A 1BS1A 3IVRA 4MOAA 3L5KA 1W581 3R7AA 2NUTB 2DDUA 3TRIA 2KPOA 1UMDB 3MLKA 2FZ5A 1ZRHA 2VPQA 4DEXA 4ERNA 3K94A 2ZGPA 1N1EA 1R083 1FNMA 4Z4FA 3BIWE 2OHHA 2GEKA 3NTRA 1CAVA 2P2ZA 2ARAA 2HY7A 1PZGA 5DHSA 4RK5A 4JKLA 3IERA 2ONJA 4KITB 5LA2A 5DNUA 2F3TA 2HWE1 4G23A 5DAXA 3A9SA 4IRXA 2PSSA 3ITQA 4FQ4A 1HRV3 1KMMA 5CJPA 4A6OA 3RKSA 5IJ9B 4I19A 5HS6A 3GI1A 1YBFA 3S2EA 1SHUX 5JPNB 3MWEA 1A77A 3SEAA 3U7EB 4IZOA 4F5DA 2VP6A 2XVKA 2VRBA 4RW0A 1RJ7A 2GBLA 1D2CA 4JUAA 4NENA 1GR3A 1KOFA 3F98A 2WILA 4LYGA 4L5BA 4LC9A 1L4EA 2ZGOA 3FUVA 1QZZA 2IOHA 4B5LA 4AQSA 1SBYA 4J16A 2HU2A 2FBEA 3QE4A 2QYHA 1K5DA 2WWFA 2RDNA 2Q2OA 1D2SA 1DBIA 2P4QA 3LJKA 4XF1A 1CQXA 2JFVA 3M49A 4ZKTB 2OORC 5EIAA 5EQFA 3EDMA 3HP4A 2A1UA 1EEHA 5FWEA 3A3YA 5K0ZA 4NL4H 5JAXA 2ZUCA 3WR5A 1ZM4A 1GYRA 2PRSA 3I45A 3EIQA 3HHEA 4RA0A 2EP8A 2WEKA 4OGLA 4F5ZA 4XGIA 2DPLA 1QJX2 2D1TA 1JXMA 1IZ9A 1F5FA 5GQSA 1CUDA 1J0DA 1GAQA 5BV1A 1DJPA 3NXKA 2EKZA 1ZGCA 5THKA 3FZEA 4QVKA 5JS1A 9LDTA 4DLWA 4PFSA 2YDXA 1EPUA 2QG6A 2QU8A 1VA4A 3N0TA 3RQ0A 4LLFA 1C0IA 2ZSEA 3RPEA 1C9YA 2RG7A 1K1EA 1SLAA 1L5KA 4P9GA 1DL5A 4D79A 3IR6A 3QVUA 2RJ2A 5KVSA 1VYUA 5C70A 1IAQA 4GBGA 2HEVF 1H2MA 4BVFA 3P96A 3H5TA 3WP4A 1AYN1 3GBFA 5FR2A 3RABA 2RC5A 1YB5A 3BTUA 1VJTA 1W5AA 2ZGLA 4AVCA 4URVR 2A94A 4PTYA 3M2MA 1D2HA 3UUWA 3NM5A 3LS2A 4MZUA 2JH9A 3GARA 4ZIRB 1LSJA 4MLPA 2XD4A 2ZE6A 3OFKA 4FZ3A 3PQEA 1KEXA 1J3RA 2Y9PB 3FDFA 3D8RA 3P0JA 4AVBA 2WJSA 1TLLA 4RFT0 3N28A 1YL6A 2Z1DA 4MUMA 1W9HA 1ODFA 3FRHA 3ZJ4A 1SZJG 1O5TA 3U9LA 1YXWA 1ECCA 2GNOA 5FOTA 5F9HA 1F0KA 4HAWA 3O2NA 1EQUA 3KM0A 3WAKA 4X60A 4DY4A 1XDWA 3DOCA 1KJRA 1MVQA 5DYTA 3DFUA 2P75A 1D6JA 3ORQA 3W9AA 3VU9A 1BEV1 1FATA 2NSDA 4W99A 2EXXA 1UMCA 2FJPA 4QDKA 3P3PA 1UJ2A 2AVNA 2AMLA 5JLAA 5I3ZA 4PHGA 1CF2O 1AU9A 4A3XA 4KXQA 4OU4A 1ZCAA 4HG2A 5K8UA 1U4OA 1L4UA 1PZ7A 2I76A 4PZYA 3KAPA 2G08A 3PRKE 2OQ7A 1VMEA 4NHYA 2HBZA 3S28A 3OBAA 1JTVA 4PX9A 1X1AA 2D6PA 1HB1A 1JKXA 3GGOA 5L53A 4W5TA 4MV3A 1NU8A 3W5UA 1MB2A 1UPSA 1RGSA 5CA1A 3U44B 4CV3A 3N86A 2WUEA 3L8CA 1KKLA 3UM9A 3C87A 2ES3A 2B99A 1I01A 2YC0A 3ECCA 5B2ZA 3LPLA 4N3BA 1XMSA 3QACA 2FJ0A 3BU0A 3L9WA 1P73A 1EXVA 5FTWA 2ZRCA 2E21A 2Y1CA 3MWKA 1IVNA 1JI6A 3VBRB 3KV9A 5KVQA 4Q3KA 5LVAA 1VIAA 4HGNA 2VRWA 3UGJA 1A1SA 2P79A 3OZUA 3M6VA 4FE4A 3RAFC 1YQ6A 4HVCA 1USIA 3TNQA 1KY4A 1J24A 4BFVA 3A4VA 1YULA 1HDCA 2Z2SB 2NUTA 4WCFC 2FHSA 1VE5A 4DQAA 3IILA 2FQ1A 5AW2A 4UHJA 4US1R 4QM9A 2EVWX 3IOMA 1E0KA 3P9RA 4QZVA 4JVOA 3SFTA 5FTMA 3BCHA 2E85A 3E6BA 1B7GO 3QJ5A 2X3UA 3ZWOA 4DY6A 5K5EA 3DD1A 4QPJC 1DAHA 5HOQA 2W39A 3SSAA 1R4ZA 5IXYA 1XJ5A 3E48A 4D56A 1H2NA 4L9SA 1KJ9A 4YM3A 5BOSB 2GYVA 2VXRA 5M29A 4CVNA 1LGCA 1KI8A 1GKBA 2HF7A 1WLCA 3UGQA 2C8LA 2EOAA 3MDPA 3A06A 3QHPA 4INPA 4M8SA 4BBZA 5DHQA 3RVJA 1CJVC 3KETA 3DT9A 4NU6A 4IRMA 4Q8LA 5IJ9A 4ND3A 4ENVA 3WNBA 1XCOA 4BFZA 1GOHA 4CF3A 4BNDB 1AR71 4P98A 4GVXA 4YP0A 3K9BA 2YBSA 2WIFA 3Q5EA 3IJEB 1ISRA 4RFSA 5TVKA 3PENA 2WLPA 3EHEA 3LIIA 1NW8A 1UKVY 1ZN9A 1E1RD 5EFOA 1E3DA 5ITZB 1AUYA 1K06A 1A2BA 2EA7A 1OLUB 2XYGA 3MJDA 3J80A 1LTKA 4FI9A 1G8FA 2IY7A 4MO2A 4LVOA 2WDZA 2XJ9A 1RYZA 3GF6A 1Z34A 3CW8X 5EN4A 3OQBA 4IGOA 3IEIA 1QZTA 4Q4V1 4XW3A 1PJCA 3WWCA 2Z30A 2JGNA 1YU9A 4A27A 3E9RA 3I62A 1A7UA 3NJYA 5C31A 1CW2B 4OJQA 1Z5VA 3K31A 3L8EA 1N5LA 5FZ9A 3SMQA 2ZS6B 5C32A 2FFAA 4RV9A 4TLCA 3O3OB 2O8NA 3H04A 2AZTA 4BDSA 3THOA 3AVSA 4J7AA 1RKXA 3MYYA 4Y1GA 3STTA 3VNAA 5LD2C 4XCVA 1IN1A 1H0HA 5KYXB 5FYHA 1Z3IX 1XHEA 2O05A 4QWMA 4F4HA 1XRSB 2CMFA 2W11A 3FOBA 5FPBA 1R092 4BQYA 4LBKA 1BMFD 1QXRA 2PA0A 2XLBA 2J3KA 2V5YA 2D2IA 1QO0D 5L6LB 4BWYA 4KHZA 1KOLA 4F83A 3QUTA 3CJRA 5TMEA 2C9MA 2ATCA 1RM0A 3K6SA 1GPUA 2FCTA 2QT1A 2O4UX 3L4BA 2DTYA 3FOZA 3U19A 4BB3A 2O2ZA 3ZY3A 2ZVPX 5A3OA 4RHCA 1SHKA 2DULA 3EG9A 3UFBA 1NIPA 1ZH8A 1OWPA 4UCQA 2XGMA 2FCUA 2YMPA 1GSLA 1KPHA 1SZDA 4AJ2A 4IQFA 1KKMA 2JLXA 2BD0A 4UFOA 1FL9A 1NSFA 1Y3BE 3LGXA 4G4SO 3F4LA 1AGNA 2MU1A 4AJNA 4DSTA 4AF8A 1FS4A 5ALQA 4GQBA 2Z08A 5FWNA 6YASA 2KA3A 3ZV6A 5U4QA 2IV7A 3A2KA 5KSZA 1KC1A 1N2IA 1I7PA 2G77B 2GBFA 1JA1A 1VBE3 3MIFA 3BXXA 2MEV3 4QAQA 3TRSB 4A8PA 1MR5A 1NW9B 4DY5A 4RK0A 3BD6A 4YBRA 5FRDA 3N0RA 4K1XA 3H8OA 1S8NA 3A25A 2WF5A 2ILMA 1H42A 5JC8A 4WXHA 3K0EA 3NR2A 2VH1A 2IYZA 3DLBA 3WW4A 1XLTC 1AL0G 4OCZA 4JR2A 4F4UA 4EJSC 3ZNPA 1XROA 5HILA 4CUJA 3OJLA 4XJAA 4G1EB 5A1TA 4AXBA 1LENA 4JZKA 3TVTA 3BWMA 4ME6A 4ES6A 4KFRA 4JLKA 3C4VA 4A9AA 3QCWA 2ZE7A 5GAJA 1YCFA 1VBC2 2YXBA 3F96A 4HDAA 1DYKA 3E3AA 3ZHRA 1TVCA 1J3PA 1PNQA 2VSQA 3S2IA 3U44A 5AM2A 4GMP3 3ZUPA 3ADOA 4DNPA 1NUAA 4Q9AA 1L6RA 1ISSA 3QE9Y 1I5ZA 2CNBA 2NTNA 4KFSA 1SCRA 2AYHA 1FW6A 5A05A 2W6ZA 3EZNA 2WUHA 5REQA 4F92B 3CB2A 2Q8NA 3KQUA 2RGCA 4TMZA 4EZEA 1U3DA 1RZRD 3TXAA 5GIOE 1FP1D 2WKQA 2G25A 1DQ6A 2BNMA 2XXJA 2CVOA 4MRMB 2J3HA 4Q9IA 4GP7A 3GC6A 2QQVA 1UP7A 1F0YA 5FNZA 3T3MB 3M6XA 2PH3A 4AXXA 1QPZA 4LOSA 4YJFB 1GUZA 3LIGA 4I1VA 2FFQA 1EGHA 4QTUB 5AESA 2OIIA 2PA3A 1M1YA 4L9RA 4O0MA 3B02A 2NUAB 4NOKA 5AI9A 1JALA 5A71A 3ZXDA 1A72A 4MI9A 4JWTA 4M0PA 4NCJA 1W0NA 1PZEA 3FYDA 2O0JA 3IEUA 3LECA 4JJ6A 4MGHA 1OE0A 5BOSA 1I1NA 3EEQA 4CDWC 5CFCB 2ADDA 4ND2A 5A9TA 4G4JA 2C0PA 1ZD8A 4BASA 3JASB 3L0IB 1N3BA 1UK9A 1THMA 3S6JA 1W88A 2BM8A 2DH6A 2GHQA 4M38A 4BN5A 3HFSA 4RXUA 2YPDA 2QN2A 4AJEA 2OV8A 1PE0A 5B36A 1NVWQ 2YIJA 2B1QA 5IVBA 4QM6A 2QTTA 3BWXA 3RTGA 4JFRA 1CERA 3R1IA 3Q8XB 2J07A 2G0NA 2JDKA 3GGGA 4Q1BA 4OAOA 4AKEA 1YRQA 5CA6A 4LBQB 1ARZA 2PFGA 3SZOA 4CODB 5A5FA 4I5EA 4YRQA 2HWF3 1N6RA 1T8WA 3MTJA 2VSOA 2Y68A 3SK0A 4QQPA 4P80A 4DIBA 4JTNA 2XQKA 4IEVA 1DYPA 5DBIA 1YIAA 1WB9A 1U0JA 1C1FA 2XUPA 4C3OB 1O4YA 3GGLA 1TECE 4MKFA 2IYWA 1VSTA 2WLSA 3MELA 1BVHA 3D3EA 5A6QA 3MTAA 1MG0A 2DQSA 1R3UA 3LRTA 3BIXA 1I14A 3G7DA 3FMGA 4Y2JA 3LSTA 2A0XA 1V45E 4GZ5A 4JAVC 3UJDA 1C4RA 1L3BA 3CZJA 2WJAA 1DP4A 2HBUA 4HWTA 2QRLA 3SVLA 2XTZA 3LCCA 4ZVTA 1NQTA 2GB4A 2X5XA 4U7HA 3U49A 2IE0A 1CESA 1G9CA 1VP9A 1LW7A 4DV5B 2R2GA 4FKMA 1PS9A 1VSUA 1SQSA 2WUDA 2I2BA 3DQZA 3K92A 4XEHA 1CY2A 3WXMA 1Z0JA 3ZXYA 1CY7A 3SVZA 4DARA 4C78A 5D2CA 4URFA 4CL2A 4HSLA 4RCZA 1CZTA 1OPXA 2JHPA 2HDWA 3FTQA 2ODPA 1CX9B 1WV0A 1DAGA 5ALOA 1CUAA 3OCXA 4YW2A 1UOQA 1NJFA 3TEJA 4KWIA 5DEIA 3PTLA 2FWJA 5H9QA 4JC0A 1NE4A 4WNAB 4GKXA 1QV7A 2JGMA 3M3IA 4EG3A 2EP5A 2RGGA 5LRRA 4MV2A 4BPBA 5C37A 3VZMA 5BQXA 3RVQA 5JDCC 1I7NA 3IURA 3EQEA 3PHLA 5CIRA 1AQNA 4KXWA 4DTCA 4ERXA 1MZEA 4FMDF 1BVUA 3QPWA 4R9AA 3RZMA 5FI0B 3LKDA 5DOZA 4JKOA 1IN7A 1EYZA 4ZICA 1W36C 4ZGGA 4D4MA 2LXNA 2VKQA 1QJY3 3VBOC 2AUTA 1EFRD 3SZUA 4FEYA 1EFHA 1B8UA 2AX4A 1RM3A 3KO8A 1LPAB 1UBGA 4KGQA 1IZ3A 1KRHA 5KNCA 3ZWDA 4IEWA 1B09A 2WJ4A 4NK4A 1HYEA 1J1UA 4WDRA 4YARA 5AVPA 4QT0A 5ALUA 2P4HX 1WUHS 1N0WA 5C5TA 2VEOA 2YCBA 3CEHA 4XOUA 3DO8A 1ZI9A 1UBMS 3M8LA 1GPWB 5IBQA 2AQKA 3QKWA 2W1WA 2R7LA 4LGCA 1WHSB 3GNLA 3OOSA 4QUKA 1YI8A 4IIJF 4QGSA 2YXDA 3DYPA 1GY8A 3BI3A 3CKKA 5H3HA 3QXHA 2A1XA 4M1OA 3H6KA 4IE5A 3OJ0A 4M36A 4MRMA 3ZHCA 1H8TB 4LTNA 4WZBA 1TNRA 5EE0A 3R3ZA 4M55A 2PWZA 1UBUS 4KNVA 4ISRA 4OP1A 1YDHA 4YJFA 2NP6A 2XB8A 3IKWA 3JRWA 5LU8A 1K12A 2WKSA 3WA6A 2C84A 2NV2B 3WWZA 2TEPA 2EU8A 2YMQA 4NIIA 2NUAA 1SUDA 5B1EA 1L5RA 3M6FA 2IS4A 4N8EA 2PVCA 4HLTA 2W83A 4YDRA 5CA0F 4B1MA 4YQEA 1O9GA 3S2UA 1KFJB 4Y0VA 3KB5A 1I6KA 1FXZA 5CFCA 3V4OA 4CM1A 2FW0A 2IRWA 2ZWAA 3FW1A 2L82A 3GH3A 3JASA 4PQEA 4D81A 5DAQA 4FGWA 4HLCA 3G2LA 3VX3A 2J85A 4OVKA 1KJNA 1L8QA 1BX3A 3GBPA 3DL2A 2B37A 3WA7A 2BE9A 4CCJA 3FSRA 4EKIA 2I6SA 1QTQA 4URAA 4PIYA 1PS0A 1RUJ2 3BHIA 3MW3A 4HX5A 4AF7A 1W05A 3N2ZB 5CDFA 3VHOA 4Q1DA 2JB4A 1TIKA 3ONDA 1RRGA 3AZXA 2JGJA 5I6DA 1PR0A 2VCBA 2HHHB 3K9LA 5IVIA 2Y0DA 3ME5A 4LJ8A 1F2VA 1VXOA 1CEQA 2AWNA 1ZFNA 2B8WA 1SA0B 2XUGA 3B1ZA 5AK5A 4EGAA 2ZAYA 1L7XA 1GILA 5HQTA 2QKYA 4FWTA 2EGGA 5H9PA 1UBFA 2C3OA 5HK8A 2ATIA 3O0VA 1N0UA 1WABA 3SLIA 2WAAA 5B2GB 4WM7C 4QPNA 4QYTA 4OIFA 4Z86A 5HVNA 1HQLA 1JXNA 1C3JA 1JKMA 2JDYA 4PPQA 3F3SA 4MH0E 3DMDA 2CWSA 4RDXA 4P4TA 3H7AA 1H9PA 3OZDA 2EXJA 3I34X 4PLMA 4JB0A 1IK6A 3RVRA 4ZCMA 1RKVA 1GWLA 3H3ZA 1IZ8A 3VZLA 4ZKEA 1O4VA 2QMZA 2WVJA 2IIVA 3CRNA 5FPPA 4MITA 3ZHTA 5KQMA 4IHAA 3VYSB 5D1IA 2ZMKA 4BFLA 1H93A 2IY9A 3S2FA 2PH7A 4QOGA 1N7IA 2R00A 3OURA 3LC7O 3N35A 1U5IA 3MJEA 4Q4X2 4D69A 2R5NA 1AC5A 1B0AA 2FG5A 2MIIA 4B4UA 3ZXEA 3Q88A 4JUBA 3WKCA 4CG3A 4DIKA 4IHJA 2I87A 1NQAO 4LHEA 2VTVA 3QX8A 3IDQA 5D8AA 4I9FA 3RZHA 2EHJA 4ZO8A 2F3RA 4OJYA 3VNQA 1HN0A 4H2AA 2OCBA 1UZMA 3AIOA 8ABPA 4EJ0A 3FR7A 4ALNA 3DMTA 1BVRA 2CU5A 5DE3A 1SVLA 3C7OA 4ZQGA 1JYFA 3CCFA 5GZGA 3BGWA 4TN7A 2JLQA 4NCNA 3N6VA 1SHTX 3LRPA 4YHHB 1W5TA 3LXUX 4YZ5A 3KJQA 3UKDA 2QAGC 2HPZA 2XQGA 4ENPA 2NXNA 1E1CB 3GXBA 2DUPA 1X6VA 4MVJE 4OHZA 4KMRA 2PJRA 2UZAA 1Z35A 4MUYA 3JQCA 2A7QA 4YCSA 4YW4A 2GF9A 1VYTA 2O20A 1O96B 4TTAA 1GSAA 1JZ8A 3H2SA 5CT5A 5C4WC 5HUJA 2N1BA 2JWPA 5FR3A 2RH4A 3MJSA 2H31A 3J7TA 1TUIA 1Q0TA 3I59A 2PKEA 3ZDFA 2WNVB 2MTBA 4Q0PA 3DPUA 2YFHA 1RUF2 2FD8A 4G5XA 2BMDA 2GASA 5LZ7A 1WSWA 2C9YA 5TQ2B 2VS1A 2PZJA 2IEGA 5JH7F 4PX5A 3WKAA 2J08A 3TAUA 1H4GA 4MQ4A 3VD9A 4F4JA 4BMZA 3ZVMA 4XYLA 2PS3A 3EE6A 5EQTA 4CCAA 1L5FA 4N18A 4JGYB 2CCKA 2QM0A 1CRWG 4JJ4A 3B93A 4IDEA 2Q27A 3IL2A 3LA6A 4D82A 3VZCA 3SQDA 4A6SA 1IN8A 2IV2X 3U4CA 3IBFA 1WHSA 2JKZA 1OFVA 4YFWA 3JPWA 3W4IA 2Q29A 4H1WA 3NRUA 3JY6A 3OKAA 4BCCA 3Q15C 1OXKB 1UIJA 3FJ1A 3ZOKA 1DI0A 3E8XA 2I1VB 2OAGA 2ERXA 2IYEA 2C94A 4P4SB 2N46A 1I3MA 3ZOZA 3JBG3 3OZTA 4I3HA 3U4HA 1HN1A 3NAGA 5H83A 3N2EA 5HXMA 4EFMA 1ZRIA 4AZ0B 4GVPA 3ZYZA 4UULA 4DRRA 3QKIA 1Q83A 3WMRA 1BGWA 3T5BA 1WZ2A 2UZIR 4JT8A 1YJCA 1DMRA 3FBGA 4W9NC 4OOFA 4NWIA 3RFUA 1T29A 4EQZA 2O2XA 1NNUA 3TKLA 4IEXA 5A03A 5TPZA 3IPRA 1MAVA 1LS1A 1GWNA 2YUTA 1GPJA 1E2GA 3R3YA 2C42A 1PK9A 1WEKA 3QITA 3HBJA 3KK0A 4IYRA 1OR8A 4OL9A 1IBCA 1X9PA 3IAM6 3W7VA 1EDBA 2P9BA 1OOPC 3TTSA 2QENA 3MYXA 1I4OA 2YB7A 2OZ6A 3TN7A 2WR8A 3EZGA 4F8YA 3ACLA 2JD1A 2AC4A 1V6IA 1PFWA 1ODJA 4KQ2A 4WESB 4JKKA 4IQ8A 4D3ZA 2PYIA 5C8ZA 4X8HA 5GOZA 4X6UA 4CTEA 4H7IA 4RSGA 1QR6A 3SHVA 1P17A 1AQYA 4PG8A 3TEYA 3PSAA 1Y4ZA 4A10A 4OKIA 3JQ6A 2VHEA 4JT2A 3BK1A 3D5OA 2DBRA 1LKZA 1QCYA 4HYQA 3CUWA 1M9NA 1U99A 1HWYA 1SA0A 2BVNA 2D2VA 1SPXA 1NBEA 2CLEB 3CN7A 5ECWA 1GP5A 5EJGA 1RYFA 3W8EA 4LO8A 4R4ZA 4V02A 2B98A 1B6SA 3ZIUA 3K1YA 3OM8A 1DO2A 1BWPA 1Q15A 3NHBA 4WVMA 3DAHA 2FW7A 2DVFA 4AC9A 4LHNA 3SSOA 5J2TA 2GZDA 1QO0A 4AECA 4Q4LA 5G4KB 4NVRA 1THZA 3UNXA 3TN92 1V9U3 4TZKA 5I7HA 4PPGA 4WI1A 4BXOB 4EHFA 3PFFA 3V46A 4NKRA 1WCYA 3H8SA 1ZUNB 1H9CA 4Q9LA 4MH0R 1GOGA 1J00A 2CCJA 1KAOA 1EBFA 3I2KA 1OLRA 1QDOA 1K6EA 1BH2A 3FFZA 1CQPA 5IJAA 2BONA 4AF9A 1BC5A 2VJPA 3B7PA 3NWOA 2NNLD 2I22A 4V03A 2R0FA 3NHRA 4I1RA 1HV0A 2BJWA 5AW1A 3P6BA 2WVGA 3VVBA 3EYPA 4R05A 3WGNA 3K0CA 2FEPA 4MW7A 3UA4A 3M1IA 1PZMA 1GDHA 1RYDA 3MIEA 4CL0A 1C1DA 3H9AA 3GRFA 1WLTA 3I37X 1ZXBA 1V1RA 1G8YA 2YY1A 2N75A 4NXMB 3M9XA 1GSHA 5JAHA 4KAJA 2RHBA 4XPZA 3W06A 3U60B 1WMSA 2I45A 2HCFA 1N25A 1XDDA 4OULA 5I7RA 1X8KA 1TEIA 4BQPA 1I6LA 1MG5A 3ZWVA 4MPJA 4LHXA 5KJ6A 3AFHA 3ESAA 5IT9A 3RUAA 4R83A 5FYBA 4BYGA 5HZMA 1Q17A 1RYBA 2RKWA 2Q1UA 2EXIA 3WWDA 5IK8A 4BUCA 5LYJA 4EUFA 4DA9A 5COBA 1X2EA 1EFAA 5FZKA 2GLXA 3LZ6A 3F95A 1D9XA 2GEDA 1P61B 4BNGA 1Q1AA 4I1YA 1Z56C 4KGXA 4RMIA 5HSGA 5JG7A 3H65A 3E1GA 1BE8A 2WNVA 1F6BA 1FVHA 2YR0A 2OBNA 3TZBA 3ZDQA 1TNFA 3LQRA 2RDMA 4FXKB 2H4HA 2FZCA 1HDYA 2QN3A 1DLCA 1CQ9A 2ZUBA 5KWRA 1FS5A 3WHTA 4LQCA 4D0GA 5FOUA 5TE9A 3QWIA 5TQ2A 2PGDA 1X42A 1HV1A 1D04A 2WNSA 5CLGA 3QKRA 4EUHA 1TYBE 1O95C 1IRIA 1HM5A 4ARVA 2XAUA 4TYPA 1SRRA 3ZGXA 4AF6A 4TV8F 4Q4JB 3AVTA 1J23A 1XQ9A 4JGYA 1DJLA 5DHRA 3PR1A 5TT1A 3DV2A 3DR5A 2ZSDA 5ALFA 1F5NA 3QLQA 3HBLA 5CFRA 1A9PA 3VR5A 5JD4A 2AEEA 4U8GA 2YV8A 4P4SA 4BLVA 3FM9A 1ZVQA 3AM4A 2HK9A 2P9YA 1CDDA 4XTPA 3RZKA 3DTVD 3NVAA 4QASA 4L9AA 4RY0A 4B9EA 1C9MA 4M9SA 3OF3A 2GK4A 1CAUB 2BHNA 1OBNA 5JHGB 1E62A 2HC9A 1Z9BA 3BGSA 4FN4A 4IIFA 2CB0A 3MV11 5LL6P 3P4UA 4UJ5A 5CVRA 5BMOA 4N0QA 5LA0A 4OAPA 4EPWA 2ZX2A 2XL7A 5J4VA 1JZ6A 1C7QA 3I5UA 4DA0A 4EI7A 4C06A 1C8M2 4L9BA 3VSCA 3TQCA 4WXRA 2I78A 1YO8A 1XCMA 5IAGA 3CRRA 1AX9A 4B79A 1L1EA 1J7KA 2Z4SA 3BK2A 2GEFA 3QFHA 4E6PA 4BB9A 4MADA 1TKAA 3RS4A 2VZTA 2BGWA 2AF3C 3OEAA 1T2CA 1NKGA 3UTDA 1GCGA 1K68A 1VI5A 3NOQA 2GZ3A 2FWRA 3MBWA 3SPXA 1AR63 4WESA 4IDNA 3P5BA 3ZSLA 2QR3A 3Q8EA 1Q74A 3HP1A 1PK6B 1S7CA 5IVFA 2XR1A 1C9EA 4WE3A 4DLSA 4NP6A 3RASA 4HONA 5IK4A 2W6CX 2A1TS 5CDSA 1I36A 1TVMA 4OQEA 5LZ4A 2OGZA 1V7CA 2YX1A 3HIFA 4QB1A 1LI4A 5AVZA 1FLNA 2JDID 2Y34A 4QLOA 5CT8A 2C5DA 2D97A 5FP3A 4BN0A 1W8FA 5I9TA 3TQTA 3VB9A 3JRNA 4XYXA 2O1EA 5AOAA 1K8XB 5J98B 1IZ7A 3BWBA 4MDYA 1CZRA 1EP2B 3L7KA 3TAHA 5E7IA 4TXLA 3L7CA 4K2HA 1O0CA 1A5ZA 1XUOA 1C57A 4ER3A 1PO22 5KBFA 3KQNA 2G9FA 1G42A 1YQQA 2V7TA 5EY5B 2CMKA 2XVZA 3O47A 4AZWA 1B0PA 4RJLA 1OMIA 3A05A 4PCLA 1NQ5A 2HYIC 1NFQA 2Q6OA 2QY6A 4FM9A 3MUY1 1JJFA 5G4KA 3CZUA 1JG2A 4CYMA 2I0FA 4RPHA 2WN2A 5J7MA 3ABIA 3W9UA 1HE8B 2M32A 4EGCB 2O19A 3IFSA 4BXOA 3IMEA 3JQWA 3B1YA 5KKCA 5DNCA 1DIAA 1NNI1 2PMDA 2FF7A 4ZYYA 2B42B 4S0ZA 1NATA 3UXMA 4QGLA 4DT1B 5C8YB 1Q0PA 3DR3A 3EWNA 1FB5A 2Q3HA 3VOAA 2JFXA 4DPLA 3UKNA 1B6GA 3EOAI 5FXWA 4DCTA 1FW8A 1P18A 1BOOA 4OD0A 4WW0A 4BMEA 1I1QB 1X92A 5DM70 3WOVA 4LA2A 1GZSA 1SELA 1CAVB 4O4IB 4MP8A 3RHFA 3LVFO 2RDRA 1GTRA 4UAGA 3PWKA 3ZD8A 3KS7A 4MHRA 4Y18A 1FJHA 2BFPA 1WDMA 2R62A 3UJ3X 4IJUA 3FOFC 3MW4A 2FX3A 1DMSA 3HJUA 4RL4A 4EY3A 2P2LA 4YAEA 4QXQA 3LKZA 1T9CA 1WA6X 4JH0A 3THYA 1FOEB 1KO7A 3NALA 4DJ5X 4UUAA 3ACIA 2H48A 1H05A 1KL7A 3U0ZA 1OA2A 1YJQA 1QQP1 2JJ1D 3E18A 4CNQA 4NENB 5KTOA 1A34A 5BN5A 3ALQA 3CF0A 1K3IA 1T8UA 3KC2A 1VKNA 2X05A 2XUFA 1LOGA 2H1CA 3RNOA 4FCVA 5IABA 2C9OA 2ZRGA 5T5JA 3V00A 4BY9E 4NICA 3MT9A 3LEMA 1Q22A 4NE7A 3V1YA 4EJ6A 1IY1A 4OK3A 5FV7A 1OXCA 3S4YA 1TJYA 4Y67A 3I76A 1PZXA 5A7QA 1K0FA 1M2GA 4R0MA 3NXSA 4XTRA 1PN3A 2MR5A 1KY5A 1HOTA 4JZRA 1IAVA 2VZVA 2RE9A 5C8DA 3GHYA 1NVEA 1YB6A 4LOIA 3IAXA 3CZPA 5J40A 4HX2A 5I8PA 4IXTA 1P0QA 3ESQA 4IIGA 8GPBA 1R18A 2BNNA 3HVHA 3A10A 2OT3B 4Q4JA 3FL7A 5ABJB 3AM1A 4OKNA 3URMA 4ES8A 4M22A 2UXCB 4G07A 3HK2A 1VLHA 4RPJA 2D5BA 4XIJA 4V2IA 3QYPA 4BZXA 3TF5A 3ZXKA 1TZ2A 2X1LA 3ORRA 4MKXA 3LO5A 2OHJA 1WL8A 3OFVA 4C9BA 3F3KA 2OCKA 4Q02A 2QLFA 4PSVA 5GADl 2BKLA 4UTZA 1FSSA 3OE7D 1GQHA 2EWVA 1H23A 5CYOA 1DXHA 4U2KA 3AF3A 4P81A 1GANA 4DL9A 1VJGA 5HJ2A 1CX1A 2O3RA 4OYUA 1KAHA 4X92A 2Z09A 4OQLA 5EHXA 4URUR 3EHKA 3NIBA 4IOMA 4ZI3A 5I8ZA 1QNLA 2R063 3KXKA 1ZD1A 5AQ1A 5ICFA 4OUKX 1DU4A 3K3PA 4XWKA 3UANA 4H7PA 4WGFA 5J3JA 3D2AA 3PFBA 2Q62A 1L4BA 2L18A 2CXPA 5DKFA 4GKBA 2E6KA 3ZK7A 4N82A 2RHHA 4GP9A 4MRPA 1SM4A 3OH8A 5LQCA 1NLUA 3S99A 5A32A 5JS7A 4GECA 1XVTA 1SQ6A 1JXOA 2CBXA 3UK2A 3RVBA 4EVIA 1F3OA 1BZYA 3W78A 4JMPA 2YQ5A 3PVZA 2SBAA 1XD8A 1G6Q1 3JQQA 4P7FA 1NXMA 1OAOC 3HN6A 1U2RA 4FFGA 1UMCB 1PK6A 2O1QA 3AERA 2D5LA 1U5ZA 3UWPA 2CNAA 1U90A 4ZEVA 2BERA 4Y2GA 1Z0DA 4M46A 1XZCA 3PQFA 1QV9A 4Q7KA 5L51A 3AUXA 1QNWA 3FVVA 1FOD2 3KP1A 1V41E 4XW2A 5EAIA 4LO4B 3R3UA 4FS8A 3Q87B 4C87A 4YJKA 1QQAA 4FXPA 4DJTA 4KEAA 2ZT7A 1DLJA 1QG0A 4XKJA 2ZAOA 2XCLA 3R9KA 1QAMA 4ZDWA 1BJKA 2QSZA 4M3NA 4B6SA 4KSBA 1PIV2 4S1TA 4LC0A 2RAFA 2XUHA 5CVUA 2AMFA 3HLYA 1T4DA 3G5AA 2IV3A 1N4DA 3ZIAD 1Z2DA 4NECA 4Q1VA 4MROA 4RR3B 1T6YA 1XHFA 5F5XA 3O8QB 4DFDA 1ENRA 1IHPA 4BC0A 3BPSA 4GR4A 1R5NA 2CL7X 3PUHA 1IY8A 5FIUA 4DMHA 4Z8XA 4UBOA 3EUAA 2HPAA 3S7ZA 3JQAD 4NROA 2DWPA 5LMNB 3B6JA 2LRPA 4NYJR 3PHHA 4DT1A 1GQGA 3U3KA 3OF5A 5FTLA 5C8YA 1I6MA 3QEMA 3ZYBA 4HVAA 5BXYA 1QGAA 1YFUA 2D1YA 2H7VA 5BV0A 4AL9A 3EXHA 3R41A 3WG9A 3L8GA 4Y1EA 2JGAA 4B3CA 3QUCA 2AR7A 4UMFA 3EY4A 4HLDA 1NJ6A 3N8KA 5C9AC 4O4IA 1LSUA 2W0XA 5DN6D 4LKEA 1A9TA 4EZHA 5DRYA 3KS9A 3BSWA 3U81A 1Z6TA 1W44A 3OZXA 2FAXA 3OGRA 2H0QA 3NAPA 2ZLBA 1QHSA 1N7HA 3GEIA 4OF4A 1R9GA 4OQ4A 1HEUA 1Q7GA 4XJZA 3LQ2A 3UHFA 3J7MA 3ZBPA 2OS2A 1IOZA 4NHOA 4QYSA 5DM1A 4YIHA 3QD6A 1Y1SA 3Q12A 3MTQA 4A16A 3QFRA 3FMPB 4JN6B 4BVHA 1E3SA 3NH9A 3PUZA 3L43A 3RDPA 3VZPA 5HZKA 4BX3A 2JBHA 4R4JA 4RFSB 1W6QB 3B9CA 2A9FA 5H16A 4JU9A 1V4NA 3O7WA 1I2BA 2FR8A 2IYSA 3C3KA 1YJLA 4KVAA 3RKUA 1LF5A 1I3KA 2GO7A 5HBRA 5TC4A 2BHRA 4N01A 3H2BA 3G13A 1PZHA 5AKEA 3HEBA 1H1AA 3ZE6A 2VT7A 5T67A 4DPKA 3VBHC 4XF0A 2A5YB 5FZLA 2HK7A 3KCNA 4TM7A 1WPQA 5FPTA 4TQUS 5JFTA 1UK6A 3ZV3A 1I6WA 4WZCA 2HDNB 1YQUA 3MPPG 3KTDA 4CDMA 3B5JA 4LE4A 1N6NA 3PX2A 5HKOA 4H14A 2J7KA 2CNLA 3TSYA 1BKDR 3OZRA 2EFCB 3VVLA 1ZC3A 5A7SA 3RYFA 3I6IA 3VX4A 3BF7A 4ZVSA 2IGBA 5ABJA 2ASVA 4IE7A 1AZWA 4DMLA 4B32A 4DG8A 1M7BA 2EFHB 2JZOA 2IXBA 5AVJA 3O5SA 4RANA 1DHTA 3GZJA 3U78A 2J4CA 5DAPA 1WBFA 3DVAA 4B4WA 3QEKA 2FVYA 4KWUA 4RESA 3CBGA 3QLEA 3ZSJA 1JJ7A 5FYCA 3HWJA 2O8DA 2VUIB 2UURA 5FZIA 2QI9F 1VE6A 2IHJA 3K6SB 4KRYA 2VQ6A 1AHIA 2YWDA 1PLJA 3VUFA 4GYKA 3N2LA 3EG9B 1NBAA 4PBPA 3Q0EA 5ES3A 1X1TA 5LSAA 2BFEB 3EAQA 3E23A 4EWEA 4EY4A 2BISA 3RUDA 4QBFA 2V9PA 3PNQA 5K0UA 1YQXA 2QX4A 4CI9A 3UG6A 1V5GA 3KSCA 2INGX 3H1AA 1SKBA 3SNMA 3G2PA 1HUQA 1EPWA 1FFSA 5DNVA 1CEYA 2JANA 2G9UA 3POWA 1O59A 4DC1A 2GAJA 3PL0A 3QLUC 4EQ6A 3L9XA 2V8OA 3TXXA 4RF4A 1AXGA 4FCWA 1HTTA 3BWVA 1W6OB 5J4HA 2PNJA 2WU0A 5H59A 1YS1X 1I9GA 2PL1A 1OHHD 2XCOA 3OIGA 5BN4A 1N75A 2OZPA 2VOTA 4EFNA 1MXHA 1A3CA 3O75A 3BZBA 3D1VA 4E14A 10MHA 4ISQA 2ARCA 4EARA 2DPHA 5E1BA 3S68A 4KH9A 4XAQA 3VKWA 2I6XA 2WQ7A 2IVFA 4Q3OA 4LXHA 2GK6A 4EH1A 5F2NA 1Q6ZA 1YR1A 3P3NA 3KJEA 2G4IA 3RS0A 4GOKA 1I4EB 3MGKA 4B4VA 5JDIA 3VHXB 5GV7A 3AG6A 1K86A 2QQMA 4IW3A 1U5XA 2QNIA 3Q72A 3E9YA 3Q3JB 1EY2A 1OYWA 3GXOA 4HXCA 4YUVA 3LGRA 1W5SA 7YASA 4JBXA 1HPLA 5FY0A 4GB33 2CSGA 1QP8A 3WZ2A 1FT9A 4MWOA 4R1PA 3N70A 3N5KA 5DYYA 3IOBA 2MT9A 4AEDC 3OMXA 1G55A 3KYIB 4IEOA 1SBNE 1BA2A 5REQB 1HSOA 4RR3A 3RI9A 3O8QA 3EQ9A 1DTWA 1XEWY 2H63A 4B7UA 2WM9B 2MSEB 3JZMA 1VL8A 3ASYA 3LUGA 1ZGAA 1NVBA 1QBKC 3O0DA 4RQBA 2X42A 2WP0A 3RQIA 2D1FA 3D64A 4DV4B 3EZ9A 3D6AA 3WGVA 5TX7A 2IUYA 3COPA 5FL7D 4Y4RA 1X1EA 2GPSA 3QBDA 1CIWA 3KT1A 3LSYA 4K9LA 3C3XA 3WGKA 3SZMA 4YCDA 1M1YE 4E2WA 2BDRA 4EN6B 4GZLA 4URXR 5HCAA 1M1YB 2FQXA 3ZYGA 3WQQA 3L7OA 1XJAA 3EYAA 4QELA 2R16A 1RTKA 4AMBA 3ZFGB 1UFKA 2FCRA 3C41J 1NLRA 2XKPA 5CADA 3HU5A 3HDYA 5FAXA 4PYIA 5DN2A 2WJGA 4Q1EA 4H17A 1UY2A 4YVWC 5IAVA 2ESRA 4UQLA 3MIDA 4R98A 5EJ6A 1WS6A 2HDOA 4ZVRA 3F5QA 2OK8A 1F8VA 2B5HA 3VJLA 2J6BA 2BMJA 4Y3OA 1W5FA 1W88B 3CVOA 1UMIA 5THXA 1ZGJA 3AP3A 5LZ6A 2WT0A 1U8EA 2Q3FA 1AO0A 1IBKB 2I2AA 4Z99A 4NHKA 3PTZA 5EMHA 1W6QA 3B38A 1MAAA 2KE5A 3GR6A 1PVC2 4L8LA 3IOYA 2W22A 2ECOA 5H81A 1NC1A 1DFIA 3LX6A 2BFMA 3J7AC 1GYKA 4WXPA 1MACA 1TU0A 1E2PA 5F5LA 4EW3A 4DR2B 1X8EA 5C5DA 2JLWA 2IQ5A 3MUFA 3UT5A 1J2YA 3KHKA 4MCJA 1ADCA 5T5OA 1I3NA 3V8VA 3LG2A 1VMDA 2BTQA 1RPJA 4NQZA 3IR5A 3VHRA 2ZGRA 4RKWA 1RC8A 1G64A 2CNWA 2Q8PA 3HKCB 3HO1A 1GL7A 2FDIA 4OLJA 3QRWA 3U6KA 1KYTA 5DM4A 5J5AA 3ASIA 2CD7A 2H1SA 2ZIWB 3ZDRA 1JKFA 2V6JA 4BVAA 3O0TA 2R8OA 4LITA 3WOHA 2YHBA 3TSZA 1Z82A 2V73A 2AZDA 2VR1A 5JAIA 4OX9B 2PQSA 5FZHA 2X9GA 1AJEA 4N7UA 5FZDA 1ZA2A 1RWBA 5DH9A 3CRMA 5ALIA 3IKMB 1YB7A 5F73A 5IZCC 1WXEA 1A0OA 5J5CA 1ANKA 3BB1A 1JYCA 2D93A 1UQTA 4P4UA 3DTVA 2BN4A 2AF4C 1KE2A 3C8XA 2ZWPA 1UXZA 1AR92 5AM4A 4DINB 2C3YA 4CEWC 3TD6A 3FKQA 2IY8A 4L5YA 4GPTA 2X0IA 2JFYA 3HKEA 9ABPA 3EFBA 4PZZA 2QTCA 3HUEA 4KQFA 1ZPDA 4YP6A 2ECQA 3HWWA 2BFEA 4K9MA 2LD4A 1K8YB 2FX2A 4AAXA 2XT9A 5AVWA 4AMYA 4BS9A 2WHEA 3IEKA 3ZHVA 1VJRA 1HDOA 1C2YA 1UY4A 1J5EB 1TZKA 2OO5C 1RIIA 1YVRA 3I4LA 2VSYA 1XALA 5UKDA 4YW5A 2ZPXA 3EZ2A 3L05A 1U28A 5F98A 5B7QA 3KRTA 3KWJA 2EQ5A 1QJCA 1SXHA 2VJNA 4GNKA 3RVLA 3EZFA 5IU6A 4CIYA 4X24A 2D8MA 5DBOA 3DE4X 1QF3A 1W6OA 3VKHA 4OM8A 1DQPA 3ZI0A 1LHOA 3IQDB 2XNDD 4OQ8A 2JLZA 3QBJA 4HN1A 2VF5X 4CDGA 1SPPA 5EXEA 2CGNA 3FHJA 4HWRA 4JDOA 2YMMA 2HBTA 3GF4A 4EVRA 4FU0A 4KG8A 3L9JT 2PWYA 4UDYX 1QRDA 3RIGA 2JDIA 1X1BA 3A7DA 4Z6KA 3ECQA 3EDRA 1GFZA 4IJMA 2JX9A 4EELA 3VKLA 1AMNA 2GT1A 5JSYA 4Z8YA 1UXGA 2P40A 3Q8AA 3AFMA 3TKAA 4P9YA 1Z17A 4ZOBA 4OLFA 5CVCA 4LX0A 1OH8A 2HRQA 2XVLA 1A88A 2CTVA 4LKFA 3VHXA 1XA3A 3FUOA 2C2MA 2QPLA 1XYPA 2YKGA 3HM9A 3LQFA 5BSEA 2Y6KA 4FBFA 3AUUA 5E1DA 5JXWA 1E94E 3W0LB 4E32A 2NUPA 4FFBA 1ECFA 4B33A 5CIYA 3ZE9A 2IX3A 2C2BA 2JIOA 4W4ZA 4ABYA 1AKWA 4ZT2A 3VBSA 4E70A 4QBGB 1OI4A 3QV1A 2XV1A