3MLJA

Reduced (cu+) peptidylglycine alpha-hydroxylating monooxygenase (phm) with bound carbon monooxide (co)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
310
structure length
310
Chain Sequence
ECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peptidyl-glycine alpha-amidating monooxygenase
publication title Differential reactivity between two copper sites in peptidylglycine alpha-hydroxylating monooxygenase
pubmed doi rcsb
source organism Rattus norvegicus
total genus 68
structure length 310
sequence length 310
ec nomenclature ec 1.14.17.3: Peptidylglycine monooxygenase.
pdb deposition date 2010-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01082 Cu2_monooxygen Copper type II ascorbate-dependent monooxygenase, N-terminal domain
A PF03712 Cu2_monoox_C Copper type II ascorbate-dependent monooxygenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3mljA02
2.60.120.310 Mainly Beta Sandwich Jelly Rolls Copper type II, ascorbate-dependent monooxygenase, N-terminal domain 3mljA01
1SDWA 3PHMA 1PNFA 3MLLA 4R4ZA 1YJKA 3MLKA 3MIFA 3KS7A 3MIDA 4QHBA 3MIHA 3MICA 3MIBA 1PNGA 1PGSA 1YJLA 3MIGA 1YIPA 1OPMA 4E4ZA 3MLJA 3PMSA 1YI9A 1PHMA 3MIEA 4R4XA
chains in the Genus database with same CATH superfamily
3BODA 4PF1A 5KHKA 4YM2A 4LMFA 3O0VA 1AR93 4LR4A 5F3IA 1GR3A 2VVFA 4NHXA 4OLLA 3AP7A 4LKFA 1DU3D 2R32A 4DXTA 4HPKB 4AHXA 2P34A 1JN2P 4K8FA 2XGXA 3I3QA 4W6XA 5IVJA 1RHI3 4PJYA 4FQ4A 4AG4A 2TNFA 5DZEA 3POEA 2P1BA 5CKQA 1O4ZA 2A6ZA 1JUHA 2C9AA 2CAUA 1L7LA 1W8TA 3JD72 5FPVA 2LS6A 4X8NA 5E89A 4LEJA 5FBJA 2OKXA 3SHRA 3T09A 2XKPA 3WDVA 1XNDA 2VCAA 4P9LA 5FUNA 1SZBA 5A1FA 1HX6A 1X8MA 2JB4A 2XQXA 1TVGA 3CF6E 1SPPA 3MI8A 2PHDA 5IVCA 1GQPA 1MVEA 1VMFA 2BJSA 2R0FA 3J7LA 1YI9A 1PZ9A 2HWE2 4OHVA 3RYKA 2ERFA 2FQPA 4XF1A 5JMCA 3KWVA 2WO2A 5CVRA 2VZTA 1QOTA 3DV8A 4AI3A 4YVWB 4GWIA 2R063 1CJDA 2QKDA 5IATA 5F5AA 2ZXQA 3N3HA 2R041 1US2A 1XYOA 5M0TA 3SNMA 2VW1A 1PIV2 3FBMA 3J8F2 5A7SA 1EUUA 1N3PA 2FMYA 2OUHA 1C8NA 1Z7S3 1CIWA 1A6CA 1BMV2 1DIWA 5K8SA 2ZX1A 1QH6A 4R8HA 2WQZC 2HEWF 4PIXA 4UW3A 2CL2A 4YZ3A 5HCFA 1C4RA 4KBZA 5I8TA 1HRV3 2PQSA 3G7DA 1Q8QA 2ZKLA 4QPYA 5FP8A 3OEAA 1BEV2 2BTVC 1HQWA 3NNGA 2JDKA 1PNFA 5FY7A 4Z92B 4LBQD 4CP0A 2ORZA 2P37A 4O61A 3S5QA 4ATFA 1JZ5A 4WVWA 4RYDA 2BOIA 3AYAA 3N9NA 2E31A 4FPEA 2BFUL 2Z2SB 4K8RB 4RHV1 4YW1A 1MEC1 2WZPP 4MLOA 2QQNA 1R64A 2X53S 4OHWA 1JYCA 1YO8A 1W0NA 3OJBA 3PNAA 1RUC2 2Y6JA 3LFIA 4XJAA 3BTAA 2RS32 1R082 3AKRA 3EJKA 4RFRB 4DRVA 5CG8A 1NCRC 1KDKA 4QWNA 1Q8SA 4P08A 3FHAA 5BUVA 1ND2C 1F15A 4XABA 3I2OA 2B46X 1MR5A 3VBSC 5T5OA 1TE1B 4XZUG 1Y9GA 2E7AA 2VE1A 3I59A 3RMXA 3RPQA 4A45A 3ZN5A 1UZYA 1PGL1 3LFMA 2E6VA 1YFXA 4QKDA 3LIGA 1REDA 2XJPA 4EN8B 2VZSA 5BY5A 3KCCA 1DP0A 1W8UA 1SDDB 4D6RA 3RYPA 4CRQA 4NUBA 1W6QA 1FXZA 4RR3A 5JI7A 2Y60A 4YG6A 4A42A 1KJRA 2E26A 5FYVA 4CCKA 5E6HA 3AL6A 2J1RA 3ACGA 4FFIA 1I6XA 3SH5A 3NL1A 4FFFA 4SLIA 3U75A 3UYJA 3RYRA 2P4EA 4XBNA 5FZCA 3ZXKA 1JZ8A 3TOJA 2HEVF 1H8VA 3IPVB 1W8NA 3JD73 2Q1MA 5LY2A 1TEIA 4GXLA 3AYCA 4TWTA 5J3UA 4CCLA 2OA2A 2YG0A 3JQXA 3MIDA 1N1YA 5J1XA 4ES9A 1RUOA 3H8OA 1NE4A 5JSRA 1AR61 1NA1C 2HWE3 3IDEA 2VZRA 2XUMA 4LE3A 4PT6A 3A0KA 1YJLA 3N4MA 3VN4A 2JD4A 4GJYA 3O0XA 3AMPA 3FLRA 5E16A 4CU8A 1W8FA 3GXUA 4KNCA 3MLJA 2JG8A 1PK6A 4QQ2A 1DLCA 1P8JA 4QD2A 4FSJA 1PIV3 3J8F3 4GAZA 4PDWB 4IEZA 3PU3A 2WNUB 3NKTA 3VV1A 2RDNA 2EAKA 4Q4V1 4EN9B 1OKOA 1K5MB 2AACA 1ENQA 4FPLA 1CD3G 2GAUA 1L3JA 2KD7A 2D6MA 1FPN2 2P3KA 4QGLA 4W8JA 5ABJB 4O9GA 5HI0A 1NCQA 1RUD2 4N8MA 5T54A 2Q8DA 5F7UA 2E7QA 3TNQA 3Q9OA 4AVBA 1QGLA 5DPNA 2XR4A 1BEV3 4GD4A 1OD5A 4AK3A 1UOJA 2AZ5A 1EAH2 1TZOA 1QJY1 4ORFA 5C5UA 1AYM2 3WD5A 1X9PA 1DFQA 1RJ8A 4N7IA 2C5DA 4MSVA 5FZAA 5FP9A 5LWBA 4BQXA 2WO3A 5FY5A 4FPCA 2PHRA 1W03A 5LRRA 3ZIXA 2JIJA 1RUF1 4AI0A 2JG9C 2ZGMA 1RUC3 2JDYA 4L9BA 4RS5A 2DCYA 3C7OA 4IGOA 4G9SB 2RS33 4QQOA 2Y64A 3BGAA 3RZJA 1R083 4WVMA 2HH9A 1VE0A 5CFDB 3W5MA 1QQP1 1GZWA 1OHFA 3KQ4B 1OLRA 4QB1A 1RUJ2 4XHXA 4OZXA 3M7AA 4MGQA 5I0UA 1B35B 1ND3B 5FLJA 4QPIA 2VL4A 3ZR5A 2AC1A 5I93A 3MIGA 2G1MA 2G9FA 4RL7A 1FMD1 2XLGA 1YNAA 4DY5A 1VRBA 4QKNA 3UGHA 5F5CA 2UURA 4N53C 4MX3A 2EIDA 4YZ4A 1X8EA 5LBCA 5ACA2 1V6NA 3ZIWA 4ZU7A 2WBKA 1MZ5A 1J1TA 3DPRC 5JPMB 2F4PA 1COV2 1YJKA 3HT1A 2Y6KA 5DAWA 1H2LA 1ODNA 5FMOS 4D7SA 4HANA 2RS52 4COVA 4UFMA 5GZEA 3AVSA 5KR7A 5ISLA 1QKQA 1HJFA 1YWKA 4FI9A 4OUSA 2JE9A 4LA2A 5F3GA 4JKKA 2XKOA 2VR4A 2D44A 2WLQA 5FP7A 1JZ2A 3CZJA 3KCXA 2VW0A 3K2OA 1UU4A 2W1QA 3ZN6A 1UZVA 1XQNA 3FLPA 1HB4A 1X82A 2RMU1 5FZHA 2OYZA 4C0BA 3K4ZA 4LHKA 1NKGA 4DPNA 3WP4A 2XQRA 2AYHA 3O7OA 1CONA 3WDUA 3AYEA 4A7YA 2W92A 2BGCA 4A6SA 3SH3A 2IFRA 2R1BA 2YBSA 4Q1PA 1AR91 2RR11 4COZA 1UCXA 2VG9A 2YU2A 3LEGA 1F35A 2Q8OA 4ASLA 2K9ZA 2WNVC 3L9JT 3BUCA 1UYZA 1OFNA 4CDXA 2W95A 3WDWA 3ZN4A 3IWZA 3KV5A 1ZZ6A 2O14A 3H1YA 3T4HB 3KV6A 4CDQA 3IAPA 1FPN3 2CTVA 4WVVA 3RZMA 3FX3A 1RUD3 2ADEA 4C0HA 2ZX2A 3AZXA 4M3CF 3SMHA 3CZUA 5DDJ2 5FV3A 2EXJA 3BIEA 1LHOA 4DXSA 5J7MA 1PZ8A 2B4KA 2MNGA 5CISA 1EAH3 1LR5A 3I49A 5FZMA 1AYM3 4M00A 3VLBB 3MIHA 5F5QA 4BH9A 5KXCA 2D93A 3PVEA 1JZ6A 4AHYA 2OPKA 1PVC2 2R061 4KGQA 5FXXA 2J1EA 3U14A 5F6LB 5KHJA 4I3GA 3BYWA 4F8AA 2WZEA 4NHMA 5FO9B 1SHWB 3RGBA 4XEZA 4B4QA 2ARAA 1Z7S1 4XDPA 4E2GA 3ZYFA 3KHCA 5C70A 2ATFA 4XXAA 1CQ9A 4BQYA 1W6OA 1KXGA 3MIEA 1RUJ3 5A7NA 3S6PA 1POV0 1WA4A 1GOHA 4DRRA 3VZOA 2W9XA 1HRV1 4RN5A 2DYCA 4Y5TA 4NJ4A 1DQ2A 5EYXA 3UKVA 1ZRCA 4QPGA 3CJIB 3O1PA 3OPTA 4QB6A 1W6QB 2WWUA 4RR3B 4QX7A 1CZTA 2ZACA 4KU7A 1GKBA 5ACA3 4LJHA 5FZ0A 4GWMA 3GDBA 4AEDA 5C71A 4Y4RA 1JTZX 1NOVA 1COV3 1GUIA 2BNMA 2CNAA 1ZVFA 2Y8KA 5LASA 1K12A 3LZZA 4Q0UA 4NIAA 4XUQA 2RS53 1LHVA 1ZBA2 1E57A 4E2QA 4FCAA 3ZFFA 4JKLA 2ZEZA 3ZM8A 5EQUA 4CP9A 3LOBA 3H7JA 2C24A 3GCXA 3BTXA 1SBDA 3NJZA 1N1SA 2X09A 1ONAA 5JAXA 5JWPA 3ILNA 1XC6A 2B7YA 4QPWA 2E51A 4UBHA 3NNLA 3NWKA 3UESA 2Y6FA 3NAPB 4XJ9A 4UW4A 4EV0A 4KGGA 3AP4A 3ZYIB 3B00A 4GMP3 5FKBA 2YZ4A 1S1AA 5J48A 3AYDA 1UY0A 2J1AA 1W39A 3CLPA 3J7NA 1OPMA 2JG8B 3IDCB 2KA3A 4FPHA 5DAPA 1UAIA 1PK6B 3WOGA 2QZ3A 2UYBA 2HWF2 4AQ2A 3B02A 3NRUA 2BW8A 1NAEA 2ZMLA 3B3QE 5E1RA 1UNBA 3VD3A 1PMIA 1S2BA 5GZDA 2ZTNA 2FBEA 5FZ8A 1NCQB 1W2OA 3RZGA 4AE2A 2F6BA 4UBGA 1FT9A 1X7NA 3HBKA 2LTNA 3WQ1A 4XCAA 3M8LA 5APAA 3U0ZA 3KM5A 4AFMA 4JCKA 2GSYA 5DDJ3 3ZO0B 3HQUA 4XF3A 4CDUA 4Q2FA 1VMHA 2HWE1 5A7PA 2WINB 3EBRA 4CDWA 1N1VA 4WM7A 4AFDA 1EV12 2KM2A 4BQ3A 3R4DB 3E5XA 1LHWA 2TEPA 3B69A 4CSWA 2LROA 3ROUA 3ZYGA 4P9IA 4XQDA 2I74A 1PVC3 1R091 5I0RA 5LA0A 1CIYA 2LW8A 1UD1A 2XBO2 4JV4A 5EJ1B 4WVMB 4Y26A 5LATA 2ZGLA 4NHKA 1PIV1 4CUCA 1EYBA 4MXVA 3LSEA 1LKNA 3ZLIA 2ZEWA 4I3PA 3GM8A 3VD5A 4N43A 1RIRA 4RA0A 3TEZA 4Q8LA 4QPIB 3SITA 1D4M1 2VMEA 1JU3A 3WT3A 1XYNA 2XPJA 2MHFA 3V64A 5JLVA 1OT5A 1JZ7A 3B9IA 5JMOA 4JX0A 2L9LA 2WNUC 4S2HA 4E8DA 4META 4CU6A 2V5DA 1K5MC 4E2SA 1PZ7A 2B39A 4W4ZA 5ABJC 1MS9A 4JDMA 1IHMA 4HONA 4TSVA 2Q4SA 3ACFA 5JXIA 2IXHA 3DKQA 4GJZA 1W6MB 4FP3A 4FAGA 4BQ2A 3PVNA 1H6XA 1MS4A 4G3YC 2XH6A 1F9KA 4MADA 4Z2AA 1IKQA 1RUC1 4ARXA 4BE3A 1GLHA 2B9UA 1S0DA 2RS31 1OF4A 1ZBA3 3GBWA 4FPKA 4LIUA 1R081 4JGZA 2DVGA 5CB7A 2AEZA 1D0HA 1CAXA 1PGSA 2EAAA 1ZNPA 1C5HA 3HD8B 2X8KA 4JDNA 4QXCA 4XQ4A 5DUUA 3ZN6B 4DXZA 2BNOA 1F4AA 4Z1VA 4LHNA 4L99A 1XYPA 1AR72 2ZA9A 2UY8A 2GC3A 1XB9A 2P3IA 2R30A 2BGOA 4CCDA 4N7UA 1Q8PA 1HRI2 3J7HA 2ZHKA 1WA6X 1YYNA 3CJXA 4JTOA 1HQNA 2BVBA 2VZOA 5DXDA 1LJ7A 3OGGA 5FZ9A 2Z69A 1D4VB 3W5NA 2IVIB 3MBWA 1LRHA 1JUIA 2HWF3 2DBIA 2Y0IA 2ZGKA 4LO5B 3WP5A 2YPDA 3NV2A 3KT1A 4QX3A 4CDXB 1LNSA 1RUH2 1GWMA 1W8ZA 3HT2A 5DQ0A 1K5JA 1DF0A 1YFYA 2ZAHA 5F3CA 3WINE 2RDRA 5FY1A 3OB8A 4XIOA 4CDQB 5JXGA 1BCXA 1RYYA 1A3KA 2G4IA 5D1IA 1OA4A 1G7YA 1YLLA 2A6VA 5F37A 4K9SA 1VMJA 4C90A 5KHGA 3BPSA 5HCHA 3FE5A 1E5SA 1GWKA 1U5YA 3VGIA 4LBQB 1S0EA 3C8XA 4UF0A 5SV8A 3WQ7A 1IS5A 5CEHA 5AVAA 1GP5A 2BWAA 4KH9A 3TN92 1ST8A 3CDZB 4Q4W2 4DXRA 3N7KA 2HYKA 3KVAA 3MZHA 2VUJA 3U10A 1EV13 1GMMA 1SLLA 3SCFA 2BZDA 5ANQA 4BB3A 4E27A 4XAEA 4QM9A 4XF0A 4UFJA 2EF6A 3H1MA 1VIWB 3THTA 3ACLA 3GJBA 3IB3A 5JOXA 4HLTA 1DYOA 2XBO3 4HN0A 5LZ6A 1AZDA 2HWC2 1W6OB 3VDBA 1WBLA 1F2NA 2XL7A 3C2UA 4OI1A 4W6WA 1ULOA 2DFBA 4CCJA 1H1MA 3PHMA 2VQ0A 4A7KA 1FPN1 1RMU1 4FVVA 4QPGB 1CX4A 2E32A 4H55A 3WF3A 5C3PA 5F9TA 5KBFA 4G4FA 4LO7A 1B09A 1BQPA 2PHUA 3ES1A 1WD4A 4I2OA 5FZBA 5A3UA 4CZSA 1OMIA 2IXCA 4LO6B 1V6MA 5LBFA 2DURA 1EAH1 3EHKA 3MV01 1H4GA 1LENA 1PO12 4AEDB 1OKQA 1AYM1 4BA6A 4C91A 3QH6A 2BBAA 4AGRA 1W2AX 2EIGA 2WA4A 1AJOA 1QJEA 2KXLA 2VU9A 2XDVA 4LITA 2WN2A 1SMVA 5JSOA 3PUHA 4AVCA 3TNPB 4ZXKA 3T2QA 1DQ6A 1WLCA 3WW3A 3W21A 3ZFFB 4KQ7A 1BBT2 3HNMA 5FZOA 3U4XA 4CP9B 1PM4A 2VZ3A 3EYPA 1GQGA 1FYUA 2HYXA 3V0BA 2W0XA 1XE7A 3IMMA 1D2SA 2LRPA 5JOWA 1CVNA 4IEOA 4NIHA 4NWWA 1A78A 1KEXA 3GF6A 3IIIA 2Q30A 3BN6A 4EJRA 5C8CA 5DAXA 3AFKA 1IQDC 4QHBA 1Q43A 3PTRB 1DDLA 1AL22 3K3NA 3MV11 4ITCA 2ET7A 2C1FA 3B94A 1AR73 2PYTA 2XVLA 5A7WA 4BMBA 4XJWA 1QY4A 3LEIA 1RUI1 3HVDA 3LD8A 4OYUA 1HRI3 5LA1A 2QQPA 3AKSA 1ZBE2 3H8XA 1UMZA 1H1IA 3HJRA 1CPNA 3MF9A 4AWDA 4XIKA 4CEWA 1VBE1 3HQXA 3DECA 4NPRA 2FDHA 1WKYA 2GC0A 3LDKA 2EALA 1CJPA 2YFUA 4GZ9A 1FAYA 2MEV2 2XWJB 3IMNA 4RR3C 1COV1 3FUOA 2J22A 5F2WA 5FYMA 3LEKA 2GMPA 4XFBA 5T55A 3ST7A 1GYKA 1RUH3 5IW0A 4NR1A 3FFQA 5A3MA 3DYMA 3HAGA 1ENXA 3SEPA 1XRUA 4P00B 4H7LA 1W06A 5LW9A 1QH7A 2B9VA 1WCKA 2Z79A 5F6KA 1H1AA 1YIFA 4RSUA 4AQSA 4Y1VA 2QQJA 4I0WB 4AVSA 4YW3A 4CDUB 1IGOA 1IG3A 4AHWA 2PFWA 4Q0SA 1WBFA 2WZR1 2CAVA 4Z07A 5F1RA 5I8YA 4BQ5A 4CDWB 1HJGA 1W0PA 3E97A 4WM7B 3UGGA 2GH8A 3TN93 3Q8BA 4Q4W3 2D5FA 4AAXA 1QXRA 2GC2A 3BPZA 1Z78A 2GZWA 4GMP1 4K21A 3D82A 5E88A 1H9PA 4IW3A 2DTYA 2A6WA 5KWRA 2VULA 5A70A 4Z82A 1CPMA 5AVPA 1OSGA 4R9CA 3ON7A 1GNZA 3OBZA 1V9U2 4JTNA 3PIJA 5F5IA 2VM9A 3OOXA 3T2TA 2JIGA 5FK7A 3OUJA 4OULA 4XUOA 3AB0A 4YFWA 1WCSA 4CU9A 2JG8C 2HWC3 4OHZA 5FXVA 1PK6C 2YU1A 5FZGA 3AKQA 3I8TA 2VBPA 2OZJA 4R52A 3AM2A 5BNNA 2XVKA 3GJAA 1J84A 1C57A 2A71A 4E4ZA 5IYYA 4KBBA 1AX1A 4DMIA 1W9YA 1NCQC 3HN1A 1RUNA 2ZGNA 4MGIE 1OXCA 2DVFA 2UWBA 3PU8A 5FPUA 2JDNA 4QXBA 1AJKA 1O5LA 1PGW1 1PO13 2V73A 1RINA 2DVBA 5EFUA 3H7YA 3THCA 2Q1FA 1YQ6A 3JQWA 1EY2A 1PVC1 4MVTA 4EWDA 1PM7A 4OUEA 1BHGA 1POQA 1TMF2 4IE5A 4JGZB 2EICA 2DU0A 3SCHA 1BBT3 1RVF1 4XPVA 1UO9A 3ATGA 4PLNA 4V2WA 2V5YA 5FOBB 1E5RA 4RS5C 4Z8BA 4LA3A 5CIRA 4AI8A 4PBOA 1LHNA 1NZIA 3T08A 2D6PA 2R1DA 1O4TA 3I2FA 3J26N 5FMOL 1KFXL 1IOAA 3WW2A 1QNWA 1AL23 1V6LA 2WO1A 3DF0A 3V65A 5JZGA 4FPGA 1UL9A 5TSWA 3BI3A 1KRIA 1R1ZA 4QPIC 3KHBA 1GICA 1S0BA 2VOTA 2YHJA 1ZBE3 5J96B 3ZFEA 1TG7A 1J58A 2WLPA 4EE2A 5K7PA 1J83A 4OHYA 1QJU2 1SFPA 4Z2WA 3RFRA 1QU0A 1BZWA 2ZHNA 5EHDA 1UY4A 2MEV3 2WAAA 5EPAA 1ZM1A 4LK7A 1A8MA 2XMLA 2FDGA 4B7EA 2BNNA 4PI0A 3ZMNA 4ZZ5A 4YW7A 1UN1A 1ZBA1 4NO4A 5DZFA 1HKDA 1Y9MA 2PLV2 3LKJA 5I0TA 2BBVA 2W1SA 4IEXA 1OPOA 4BLIA 5H9RA 2OIIA 1C8M1 3HR9A 3EB7A 3DXUA 4UF0B 2PAEA 1TME2 1N47A 2RJKA 2W47A 2P17A 4LLFA 2VOWA 2YXSA 4YSFA 5FYUA 1XXNA 2VTXJ 3AZYA 1J3RA 2C9KA 4CP1A 3WQ0A 2PHWA 5B2GB 5G04L 1X9TA 2VD7A 2FCUA 5C7GA 3I2DA 3T0AA 2CDOA 2VZVA 5FPAA 1ZRDA 4E4SA 4P9GA 4DS0A 4BQ1A 3N9OA 3GBFA 1DLLA 3ABZA 4TXWA 3QOPA 1GOFA 2A73B 3EO6A 4IERA 3ACIA 1V9U3 1YQ5A 1ZZCA 1UF2C 3AJZA 1Y3TA 1VRH2 2DUQA 4LIVA 5FZ3A 4LBJA 3ZSKA 2OZ6A 2P3YA 2HLEA 1HN1A 2VOXA 4XJZA 4HKLA 4TLGA 1CR7A 4CDXC 2RJLA 1KITA 1HB3A 5I8SA 2FDJA 2JDAA 4A44A 1MS1A 2RV9A 2ADDA 3QLQA 4JRLA 5HXVA 3VBRA 3WW4A 4CDQC 3ECQA 3VKFC 2BU9A 5A7OA 3BALA 5BNPA 2J1VA 2ZGQA 3CL1A 3H3ZA 4FOYA 5BYNA 2YBPA 4NRMA 4ET7A 3JU9A 4LBNA 1U12A 1WMFA 3VD9A 1LOFA 1Y9QA 2DFCA 4NE9A 2WS91 5JVVA 4QKFA 3TAYA 5JDBA 5FZOB 3LA2A 1O91A 3SLIA 3NV3A 1EUTA 1W04A 4LPLA 2XBO1 1QJZA 3C7GA 1TMF3 5D8AB 3V0BB 2BUKA 2VMFA 4UFHA 3T2PA 3FFZA 1DZQA 3HEIA 5JPNB 4NIIA 2WJSA 3M2MA 5C8CB 1F5JA 4A7ZA 2WT0A 2XOMA 2LUWA 4B1MA 1JBCA 2X5IA 4QHOA 1XPWA 2R49A 5A7WB 2O8QA 4UFKA 5LA2A 4NRQA 4C1WA 4XETA 3MF6A 3OTFA 1M06G 2Y34A 5LB6A 1GBGA 4CEWB 5KXEA 5FYZA 1JOJA 5K0UA 4XFCA 1TNFA 4NWVA 2DV9A 3N7JA 4NHLA 4QPGC 1WMXA 1N3OA 4NAOA 5T3NA 1EPZA 5FMDA 4QB2A 1QJU3 2W91A 4K7JA 4R4XA 3KMHA 3R05A 3BU7A 4CA9A 1OLMA 2QQMA 4BM8A 3SISA 2NLRA 4AEDC 1VP6A 2ZZJA 2XJVA 3LA3A 1BXHA 3UJOA 3ZYBA 1HB2A 4D8MA 2W68A 2P3JA 2PLV3 1N3QA 4SBVA 1K3IA 1AX2A 3WDTA 3LSDA 3ZFFC 2D3RA 3IT8A 1ACCA 1TME3 1GZTA 2VNVA 1V00A 2YY1A 5DABA 1V6KA 2GC1A 2BV4A 2XG3A 1VALA 4GALA 3AX4A 1OVPA 1H2KA 4LKSA 5FREA 5SV5A 5GZGA 1HRI1 2YC0A 3IKWA 4DEQA 4M01A 4M3CA 3K4DA 5C8WA 3RDIA 2V72A 4FBFA 1VBB1 3U11A 2D6LX 3PL0A 1FV3A 3FLTA 3MLKA 3EXUA 2ZGSA 3N9QA 3ORJA 4GH4A 3IAQA 4NMIA 3AJYA 3W58A 2CGOA 2JICA 2SBAA 2A7AA 1FNZA 1VRH3 3S7IA 1OOPA 1SCRA 1T6BX 5BNNB 5LY1A 2HKXA 3X29B 3MDPA 1LGBA 2WN3A 2ZGRA 5I91A 3WNPA 2ZCWA 4R9AA 3HNYM 4UWDA 2DF7A 2VZ1A 2ZHMA 5F32A 4TYSA 2WT1A 3NJYA 3LDRA 2VMCA 5B4XA 3RVHA 4XMIA 2WA3A 3A4UA 1HXS2 2DCKA 3ZDVA 3AZVA 1FX5A 2ZS6B 4Q4W1 2VGDA 4B8EA 5GZFA 3LPGA 3ELNA 4NRPA 5FFOC 3ZXFA 1TNRA 4CDUC 4X8PA 5CA6A 3L2YA 2XONA 1PMJX 2B45X 2ZX3A 2XJRA 3JBG2 3P3NA 1UOGA 4R9DA 3VD7A 4CDWC 1UXZA 3USSA 4WM7C 3OBTA 1V6OA 5EP9A 4XBQA 3E6CC 3A23A 5LRSA 5CU1A 2BP6A 3I54A 4AQ6A 1UY3A 2BDRA 4URAA 4YW6A 3M3IA 3FUQA 4XVHA 4QQLA 3I2HA 1VBA2 1OQEA 3KV4A 2HWD2 5ERLA 2VZPA 3KT7A 1ASJ1 3MFAA 4XCBA 1J3QA 2WABA 5A6ZA 2V4AA 1SPPB 2A3XA 3DYPA 5FZFA 1QOOA 3K75B 2WRAA 2CDPA 4HL0A 2CV6A 2G19A 3I2KA 4N43C 5JZGB 4B4PA 1LGNA 2DU1A 5JR2A 1WUVA 3TYJA 2JDHA 5C6CA 4BCUA 1QJX2 3T0DA 3ZFEB 4GULA 3OBRA 4AOCA 3QD6A 1R1A1 4JQRA 3BTYA 4HKWA 2OVUA 1ZZ7A 1L7QA 2PA7A 1AL0G 4KI5M 1ULEA 1RJ7A 1O59A 3RJ2X 3J4UH 3WP6A 3VDDA 2JECA 1H0BA 2VVEA 3K51A 1VB4A 1KD7A 3MEPA 4IUGA 3T0BA 3WX5A 3ZR6A 1NG0A 1HV1A 4Y20A 4B4RA 1QNYA 5A6XA 1PX4A 3FN9A 1AYN2 1RHI1 5FZ6A 1BBT1 1VAKA 5GLWA 1RITA 2FHRA 2VPVA 2J1UA 2G9GA 1NZCA 3QH7A 1W8WA 3AKPA 3TBDA 3JB4C 4IE6A 1T6GC 5K9YA 1HQLA 4JGZC 1VBC2 3BOPA 1UY1A 1LESA 4OI2A 5F3EA 4CCMA 2QDRA 5FWEA 3OEBA 1AL21 5EV7A 4XQWA 2Q5TA 5FYYA 4PCRA 2D6KA 3O14A 3KLSA 5C9AA 4HFSA 4OFGA 1XOYA 1REEA 1ZBE1 3B01A 3UJQA 4COUA 4IQPA 4MYEA 3U78A 2WKKA 2RS12 4Q1RA 4WM8A 1C3HA 4LKDA 4I0BA 2WO7A 1S4CA 2MEV1 2VZQA 4Q27A 3T4VA 4B1LA 1JYIA 5IWFA 3ES4A 2QQVA 3SXWA 3O1UA 1ODMA 3I59B 2ZX0A 2A3WA 5CADA 2QCSB 1UWWA 4KU8A 3KD4A 4HN1A 1OC1A 1UZWA 5FIXA 1OBNA 2AR6A 3KB5A 4IE7A 2EVXA 4XDOA 3VBRB 5EYYA 4NVPA 1VPHA 3I3BA 4XACA 3N7LA 1MZFA 4ISRA 1S0FA 1YEWA 1HXS3 4DNYA 4CPBD 3WEZA 2R072 2OS2A 2C4XA 2WYFA 3OF1A 4NHYA 4WV8A 4FTEA 2JEMA 5FRAA 5FWJA 4AHZA 1AXKA 2VBDA 3ZMOA 3R4UA 1FOD2 1JODA 3I3EA 3MHZA 3JBG3 1OF3A 3OY8A 4QGMA 5DG1A 1H30A 1MPXA 4AI1A 2YMZA 2D40A 5FY8A 3JUUA 5CZKA 5FZ1A 1V9U1 5C3OA 3D4KA 2QQWA 3QBQA 2C0ZA 3LPFA 3WNXA 1SLIA 1VBA3 4XJ8A 2HWD3 3WF2A 4LULA 4ONUA 4N90A 2X5IB 3ZKUA 3KVBA 3GZEA 2E33A 1NQJA 1W3VA 3C7FA 3POFA 4RGAA 4AEJA 4Q0QA 1WW5A 4BJ0A 5IK4A 2PXJA 2GNTA 3ALQA 4ZKTB 4UAPA 1IKPA 3G6JB 5BNOA 5IFPA 5K0UB 1G9CA 3DUIA 4IDZA 1J1LA 4DINB 1NLQA 2GNDA 1CESA 3KCYA 3ZXDA 1QJX3 3UT0A 5FJHA 1V6IA 5FUPA 1XNBA 3P5BA 4LORA 4LBLA 3RI9A 3BVCA 4FPJA 1W99A 2H6CA 2VNOA 2YUEA 3AK0A 3BKZA 4TTGA 2BGPA 4UFIA 1U0AA 1SLTA 3URFA 4ASKA 4D69A 5EIYB 5ANNA 4AEMA 3O1VA 4HKOA 4XDQA 3LEMA 5CG9A 1QF3A 2Y6LA 4OVEA 5GLTA 1TMF1 1AYN3 4YFZA 5KC5A 4K1ZA 3PJQA 3CMGA 4FOQA 1ZX5A 4QM8A 4DUVA 3JD71 1G8WA 1MEC2 1UKRA 3POYA 1O3SA 1YCIA 4LNVA 1PNGA 2C6SA 4HBNA 4CUBA 5D8AC 1VBC3 1JHNA 4JHZA 4CU7A 1IPKA 2AENA 1UMHA 4ASMB 5A6YA 1H6YA 5C8CC 3BCWA 3PVBB 1ZYBA 2YV8A 4J1XA 4M3CB 5GALA 2JKBA 1W9TA 2VJXA 5GM0A 4XFAA 5T52A 2VBBA 3OGVA 4A2UA 1CZSA 5FZDA 4RS5B 1IPSA 1GU3A 1DG6A 1GP6A 3HIFA 3APBA 5CYYA 2RS13 2W39A 3DKWA 4CEWC 2IXJA 1YHFA 2XUEA 4GH4B 2FMDA 3J8F1 1GZWB 1PGL2 1ULFA 5AFEA 3VUOA 1OOPB 1GOGA 4XUNA 1XU1A 2E7TA 3RRDA 1BMV1 1UX7A 1H4HA 4IEPA 2PAMA 1NE6A 2D6NA 4D7YA 3Q8CA 4MV2A 4NN0A 3AP9A 1O3QA 3UGFA 2QE3A 2TBVA 2W52A 5HPOA 3RJRA 1TME1 2BVVA 2OT7A 1OA2A 2VQAA 3OGSA 1BEV1 4V2VA 2RJ2A 1KFUL 3HBZA 4I0AA 2CYFA 4JZRA 2J7MA 1ZZ9A 3DEMA 3OPWA 1LU2A 5IJRA 5IK7A 2R073 1ZRFA 3IZOA 3PIGA 4YRDA 1VJ2A 4Y1UA 1UOFA 2NMOA 1FOD3 3WXPA 4C8DA 2DVDA 1WWYA 4KWJA 2DVAA 3ZXLA 1JZ4A 4AW7A 1AF9A 1AR62 3U1XA 2HEYF 5GKAC 1YFUA 3M70A 3I4IA 1LOEA 4EZ4A 4ATEA 2P6CA 3N35A 5FKCA 3D6EA 5C33A 5IVFA 1CGPA 3PMSA 4JC1A 1WD3A 1H2NA 2ENRA 3W9AA 1NT0A 1MZEA 3GCWA 3MUZ1 4PIYA 5FLHA 2IXKA 3H50A 2XHKA 5BNNC 1T2XA 4IGQA 5IVVA 4XAAA 4YW2A 3M3OA 4RGGA 4QX1A 4Q4V2 3A0NA 3VDDB 1W6PA 2VMGA 2OX0A 2WWSA 3M1HA 5CKNA 1JI6A 3O0WA 2R0HA 4Y20B 1MS5A 1WLDA 3UETA 4IL7A 4AFAA 3ZOIA 1RUG2 2W87A 3PUSA 1VR3A 2PELA 5A3WA 4IXLA 1RUE2 4K1YA 4KWKA 4XOGA 1DHKB 1SEFA 2UWCA 3JCIA 3WNOA 1GSLA 3KGLA 2A75A 5IAXA 1J3PA 1G6NA 2E63A 5GJ6A 5H9SA 1MEC3 5IFTA 1OQ1A 1RXFA 1XSRA 3B5LB 1ZREA 1RXGA 5T5JA 1D7PM 5H9QA 3WQBA 2VCMA 4YVWA 3BTZA 3VBUA 5C9AB 2IVJA 2W2IA 3AZZA 1S55A 1JYNA 2WNEA 4HT1T 1OI6A 1PX3A 3IBMA 5JZGC 4CEYA 4WM8B 4XYXA 3LQCA 3PVOA 4J1WA 2EIBA 5FYSA 1TQ5A 1YI7A 1CAWA 5GZCA 4AAPA 3VBFA 1WZXA 2D97A 1OUXA 3ZFEC 4DFSA 1BYHA 2Z42A 3P6BA 1UY2A 4H3WA 2PAKA 5EJZB 4GKYA 4N9IA 2D6OX 4AL9A 2Y0OA 5FAXA 2CGPA 4XUPA 2Q8EA 2SLIA 1MACA 1RTVA 2NN8A 3HOBA 5IAVA 3K77A 2EXKA 1F31A 2CU5A 1Y43B 1JMUB 3PUQA 3Q8FA 1RUD1 5LEKA 3I2GA 1HW5A 4YPJA 2ILMA 3T3YA 2A5ZA 2Q8CA 1W2UA 3VBHA 4H7MA 4A3ZA 1W2TA 3ZPYA 1DGLA 2GNBA 2DBNA 3ZDSA 5FUIA 4J6GA 4AI2A 3M3CA 1AR82 4WZCA 1W6NA 4XTMA 3WG4A 4CPBA 2QUOA 4E9KA 1XNKA 1UIKA 1KDMA 3LDBA 2A1XA 2HBUA 5J36A 1LAJA 4JGYA 2R7EB 1HB1A 4JQTA 2WIIB 5FMBA 2WFPA 3FL7A 4JAAA 1ULCA 1V0AA 2OW4A 4XF9A 1RB8G 1NLSA 3N36A 2RMU2 3TWIA 5FYCA 1W2NA 4CCCA 3AMQA 5C3SA 4CXYA 1US3A 1AR63 2OQ6A 4DIQA 4QXKA 4RFT0 4Y22A 3KS7A 4LOSA 3WF0A 3UNPA 1RUJ1 3GZTB 2VUDA 5C3QA 5BNOB 5KXBA 5IHRA 5L7OA 4YM1A 1UIJA 4LKEA 3KSCA 2RR12 1QIQA 1QMJA 1CX1A 1DZRA 1ENSA 3ILFA 4AVAA 1JS9A 3OGRA 3H9AA 5L9BA 1UPIA 5DN2A 4EROA 2PMWB 4PLOA 2AREA 1VAVA 2JWPA 3WCSA 1HXS1 4Q4V3 1LU1A 3UV9A 3VBRC 4BQWA 2LM3A 5EZWA 4MZUA 4B7KA 4YARA 5JI9A 3U07A 3R6SA 4YVSA 5ACA1 4CE8A 1BKZA 3VBOA 3DCQA 2XL9A 1ULPA 3E1F1 3HMYA 4YGDA 5T5LA 1RUG3 4CP2A 3RG0A 4EZHA 2RS51 4LBKA 1LOFC 4UW6A 4C1XA 3T1MA 1UYXA 3ZFGA 1RUE3 1VBA1 2HWD1 2D7FA 4DQAA 1YRZA 3PUIA 2ORXA 3GALA 3ZPOA 4XFFA 1ZRRA 2PHFA 2QQUA 3MO4A 4XBLA 3AL5A 4MXWA 1IPJA 3CQOA 1DQ1A 5FZEA 1C5IA 4OHXA 1IZ3A 2CHHA 2K2SA 2X5IC 4Y4YA 4GB32 3CU7A 2BOJA 2ZAAA 1JXNA 4PDWA 3OD0A 4CCEA 2VH9A 3J7MA 1N1TA 4K40A 4EYUA 5K0UC 4FOVA 2UY9A 1HN0A 5A80A 4YLZA 4YGCA 3VKLA 1QXPA 4N43B 1UMIA 4NPLA 3O1MA 4IETA 3NSTA 5FZLA 1AYN1 1APNA 1X50A 3CIHA 1XSQA 2PHLA 3MW2A 3K48A 4L11A 4P9WA 3VL8A 1ALYA 1XBFA 2P5BA 4IV3A 5L73A 3SCGA 4P14A 2YPJA 3OG2A 1UPSA 1DGRA 1Y7BA 3IDBB 1VBC1 1W3XA 1YFWA 5DDJ1 4XFGA 5IVYA 1FI2A 5FY0A 1WGPA 3ILRA 1OA3A 4MGKE 4QGNA 1CN1A 1KQRA 1W05A 4P9XA 4XE9A 1AR83 3PMEA 1BJQA 5L9RA 1O8PA 3E5UA 3A7QA 4HETA 3WVJA 4RQPA 3DL3A 3N9LA 5F2SA 5CFDA 1SFYA 2OXBA 2A6XA 2WSUA 4Q4X2 1CAXB 1B35A 3KGZA 4DZGA 2RMU3 2VTXA 4WZFA 1ND3A 4QX2A 4OQ8A 3CBNA 2XJUA 5FP3A 3C7HA 3SH4A 3S57A 4HVQA 4XZPA 5FMCA 4YGEA 2QTWB 1DZTA 1POV3 5CKMA 4GMP0 5HXMA 3BU0A 4GH4C 1GANA 1NX9A 4QQPA 3NV4A 2QQOA 1OOPC 5FQ0A 3S0MA 2JDZA 2RR13 2YROA 3ZSLA 4PHZA 3POBA 1GP4A 2AUYA 4IV1A 5L9VA 2DUPA 1W6PB 4DEVA 1UQXA 1DQ4A 3ZXAC 1OFSA 2VVDA 2XLFA 2YGLA 3LCPA 5FZ7A 2R071 4YGBA 2Q1ZB 2KR2A 3QACA 4YZ5A 2EA7A 1S2KA 3C7EA 2G9ZA 4MO3M 4GKXA 4NROA 3VKNA 5HV4A 1FOD1 1HIXA 1UZ0A 3DYOA 3GZUC 3L2HA 3O1RA 3KV9A 5GLVA 2R6QA 5LK5A 2K46A 2YC2A 5EXOA 2ZEYA 5FYHA 3EMRA 2GP3A 1LOCA 2XHNA 3ZSEA 1AVBA 1MS8A 5FDBA 5FPBA 1MQTA 3E6DA 3AMMA 4XHBA 1AXYA 1YUDA 4FO9A 3VBUB 1R092 3NO8A 1KGYA 2RE9A 3I3MA 4X6RB 3RS6A 3K46A 4XXPA 3LB9A 4UYBA 1C1LA 4CEYB 1ENRA 1URXA 4XILA 1A8DA 4J25A 1U5IA 1LCLA 4X6QB 4GB33 4MGSA 3GGLA 1CAWB 1I5ZA 3NMBA 5A1AA 2W46A 4GA9A 3VBFB 1D4M2 4AF9A 2NM1A 2ARXA 1U5XA 2I45A 2PN5A 1OLQA 1UYPA 2WT2A 1E5HA 2HWF1 1H8TA 5FK8A 4NOTA 3VHRA 2D5HA 4O9EA 2JKXA 3O1SA 4IEWA 4B29A 4CTEA 5JOYA 2D43A 3VDDC 3ZVXA 4FAHA 4ZS3A 4LT5A 2VQUA 3WDXA 1XNTA 3WNMA 5DAQA 3LWCA 4COWA 4ZZ8A 4LHLA 2YGMA 1AXZA 4HOOA 4AFBA 2HJIA 3MIFA 2I07B 4XUTA 1AHSA 2JB8A 5T5PA 1WCUA 3ME2A 1F5FA 2ARCA 4QT6A 3VBHB 5DUVA 4Y5Z0 3P3PA 3D5OA 4FTSA 5EWSA 2VMHA 3AXEA 2ZPXA 1STMA 2AGSA 4INDA 4W6YA 1W6NB 4XC9A 3THPA 1JOBA 1ZZ8A 2CSGA 2AH2A 5A3OA 3WF1A 4KL1A 3N9MA 4JGYB 3D8CA 1EV11 4H2AA 5C4WA 3USUA 1XJAA 2QQLA 3KT4A 4AEKA 2V09A 3MFCA 4BXFA 5C9AC 3ETPA 4QX5A 2NZ9A 1HV0A 4UOJA 1OURA 1W8OA 2B42B 3POJA 2WFF2 3A21A 4Q4X3 1UU5A 2WWJA 1DGRN 4WM8C 4Y22B 5DMYA 1O8SA 1PO22 1CAUA 4OUMA 5L7OB 1A34A 1WMDA 1I3HA 3CJIA 1BK1A 4FOWA 4ZHNA 4EWEA 4TZDA 3CNAA 1QDCA 2XB6C 3ZSMA 2XXZA 2WUHA 4DB5A 2P6HA 4P5HA 1QOSA 1I1EA 4Y24A 3UL2A 3WP3A 3FHIB 1GNHA 3GZAA 4FPOB 5A1LA 4AGGA 4HZFA 5DAVA 4YVSB 4OMCA 5IK8A 3D3AA 3POIA 2WYSA 3VBOB 5CFCC 1JOPA 4QAWA 5FP4A 5KHIA 3ZYRA 2ARBA 5BV6A 3D0SA 1VBD2 2FCVA 3ZYJB 2RM22 3THDA 4I30A 3ZFGB 4NIGA 5FZ4A 4Q4Y2 1YC61 2ZX4A 2E53A 5FYIA 1MS0A 1NYWA 1O3TA 1NY72 2NPIA 2E9QA 4HVOA 4M4RA 3NAPA 4FFHA 4MXWB 4LHSA 2AEYA 4AR2A 1SLBA 4F3JA 1R093 4W65A 1AR71 1L7RA 2WNVB 4PF5A 5G05L 2X05A 5HCAA 1SBFA 1V70A 5BPXA 3MGUA 4OQ9A 3S5AA 5BNOC 1SDWA 2HWB2 4OMDA 2WR9A 4ES8A 5DG2A 2BERA 3GBGA 2WAOA 1D4M3 4IE0A 4UXAA 4I09A 4YWAA 2VC9A 1RMU2 2VMDA 1SG3A 5J98B 4BXSV 1IS6A 1QHDA 3IN9A 2Q0AA 3ZXJA 4F7ZA 1RUG1 1RUH1 4FPFA 1LOAA 3VKOA 2DCTA 4DUWA 1VB2A 5FXWA 1G9AA 3AP5A 3JB8A 4M4PA 1RUE1 4I01A 4IV3B 3OPZA 4IESA 4JKMA 1UXXX 4PIZA 2IC1A 5DUWA 3T30A 2XVGA 3VD4A 3J9SA 3N7MA 4YYOA 1UYYA 4Y1XA 4PBPA 5HBAA 2W5FA 5IVEA 3JZVA 3U37A 4U36A 2FZ2A 1ZRIA 1UOBA 2JX9A 3MW3A 5FO8B 3MPPG 3NNFA 3PUAA 2QVSB 5CFCA 3TN91 1X33A 2XJSA 1H2MA 3V0AA 3H0OA 4XURA 2OUJA 1DGWX 3RWKX 2BWCA 4RQPB 1JU4A 3K3OA 4OCTA 1LULA 3OCPA 4LK6A 2TUNA 1LOBA 3V56A 3OUHA 1G9FA 2FDFA 2WC2A 3MIBA 3NQHA 4XFHA 1CWPA 2PHTA 4V1PA 3ZKYA 2WFF3 2HWC1 2ZEXA 5C3RA 2W3JA 3I2JA 1RUI2 3LGRA 4BHPA 1WMEA 1PO23 1SCSA 4Q26A 2ZGUA 1WW6A 2D3SA 2QQIA 3TB0A 2EIEA 5FQ0B 5FBZA 1VBE2 2JDMA 3FMGA 5FY4A 4BYYA 3S30A 3LF7A 3H8RA 4IV1B 4GQ7A 2ZBJA 4HG6B 3S7EA 2GN7A 2O8OA 5I0SA 4IEQA 3VHNA 1EPWA 1WW7A 4ZU4A 1CZVA 3WZ1A 1W6MA 4D94A 4BU2A 5GLUA 1U5ZA 1WLWA 4YW5A 4MHUA 5JXHA 1O4YA 1PO11 3KQRA 3KZ4C 1AR81 1AUYA 2VQTA 2ZJCA 2VTFA 5D21A 5HV0A 3WF4A 2D98A 1XE0A 2RHPA 4AGVA 4BPZA 2VOKA 3H3LA 3IDAA 4QX8A 4I02A 2O1QA 2WL1A 1VBD3 5BXXA 1YIPA 5FO7B 2RM23 2WZR2 4QDQA 1C1FA 4LTAA 3FJSA 4UFLA 2BQPA 4BLJA 4BOWA 1MQTB 2CY6A 4Q4Y3 2IWGB 5FTTC 4R9BA 1OUSA 1NXMA 2JXAA 2GMMA 3WG2A 1AX0A 2V4VA 4K20A 1POV1 4UT5A 4E4DX 1WW4A 4UW5A 2JJ6A 1OD3A 3INAA 4FQZA 1G9DA 3WNNA 4BK4A 3WW1A 1NCRA 4QMAA 4YG3A 3WHTA 1F8VA 3NNMA 2Z4FA 4IEYA 1ND2A 3ETQA 2IXIA 2ZMKA 3POSA 5AC92 1LTEA 3O5SA 2RVAA 3VBSA 3VHOA 4BDVB 3AVRA 2PQQA 3WV6A 3WG3A 1KS4A 1Z0HA 5FZKA 1RGSA 4MG2A 1H8TB 2HWB3 3PURA 3B93A 1E5IA 5HCBA 2BFUS 1WLTA 2Y26A 3AMHA 3B9CA 4LE4A 4W50A 2GALA 1RMU3 1FV2A 3OGJA 4QDSA 3ZX7A 4JHTA 4KMQA 1QXJA 2UYAA 3LA7A 1BLZA 4CXWA 1BK0A 5D2AA 3VDAA 5B4NA 3KF5A 3SKJE 1CAVA 2Y6GA 5JIUA 4YW4A 4LBQA 4S2DA 1G9BA 3AMNA 1W9FA 1PGW2 3RWNA 1GQHA 2VY0A 2VAUA 5JOZA 3GYDA 1UZZA 3R4SA 1X36A 4H14A 3Q8AA 5BNPB 3JXSA 3K4AA 4YNIA 4DOUA 2VNRA 5IUQA 4ARYA 1VAMA 1GNYA 1SACA 2WQ4A 4AFCA 4BWOA 2VNGA 1RVF2 4ZONA 3USUB 3VDCA 5C4WB 4P9YA 5LEJA 4YVWC 1OVSA 3KF3A 4O65A 4GB31 3VBUC 1OLME 4Q8KA 5IVBA 2D3PA 1JH5A 2VXRA 4CUGA 3NVCA 4GIQA 1SLCA 4CCOA 2JENA 1Q5OA 4RD7A 2K0GA 1DGWA 1NA1A 2ETEA 4L8QA 5LBBA 4CEYC 1JZ3A 4IGPA 3RNSA 4E4HA 4D3WA 1CAUB 3T1LA 1RL3A 3VBFC 3WSOA 1DYKA 2OPWA 3IM0A 1REFA 4YZ2A 4QU2A 1RUI3 5A3NA 1XE8A 1MVQA 1UX6A 2GP5A 3D0JA 1OH3A 5J37A 1LOGA 3MICA 4P5YA 4QX0A 3VZLA 1NQDA 3OD4A 5CBLA 2NQYA 1VBE3 2GH2A 1LEDA 2BEOA 3MW4A 2R042 3P1IA 3WDYA 1XNCA 4FTBA 1KJLA 1EP0A 4GWNA 3VZNA 3GHMA 4OI0A 4M3CE 1YQ2A 3M3QA 2VXJA 2XJTA 5JSPA 3DN7A 4JDOA 4LUMA 3LE0A 4Y1ZA 3TRSB 5JIAA 5J09A 3VBHC 2XJQA 5FCCA 1F4HA 1I5PA 1C8M2 3AXDA 3W59A 1SQ4A 5JCTA 4EN7B 3T2OA 4EWAA 4UI9L 1YQ8A 4AXOA 4QXHA 2WZR3 3QCWA 1ULDA 4JGYC 1LHUA 4RGKA 4XJUA 4Q4X1 1NUKA 3VZJA 5A33A 4P9JA 5JXJA 2DCZA 3RI8A 1UU6A 4RHV2 1KS5A 2LALA 2ZGPA 3DGTA 3Q8EA 4Q0VA 2FDKA 2JG9A 3NV1A 1JW6A 1FATA 4BZ4A 1SLAA 1O5UA 1Q8VA 1WCQA 2CWMA 4MGTA 4MGYE 3ZYPA 4LBOA 2WDBA 2ZGOA 1K42A 2JDUA 1OQDA 2A6YA 2RG4A 3VKMA 5I0DA 5L7OC 3BIWE 5FYTA 3VZMA 5AC93 2XWBB 3BB6A 2DDUA 1RC6A 3MPBA 2XLAA 5BNQA 4OZOA 4D0QA 2DWRA 3C3VA 3NW4A 2UWAA 1QJU1 2H6BA 2VECA 4DO0A 4HK8A 4OI4A 3RMYA 2RDQA 2R16A 3CHXA 4N53A 1QEXA 3M3EA 4YVSC 3SC7X 2F4LA 4A3XA 3VBOC 4A6OA 4A4AA 3OYWA 4FFGA 4NIDA 1S0GA 3U4SA 3WNLA 5A32A 2EXHA 3DPRA 3HQRA 2PLV1 2PHXA 5F8PA 4CYDA 4GWJA 1J59A 3ZFGC 1DBNA 2P2KA 3O1TA 1Q56A 1DCSA 2WS92 1ZZBA 5A6QA 4BQ4A 5CFCB 4WVZA 4JVAA 3V0AB 4M0NA 1S2EA 1DQ5A 3MLLA 4TN7A 1SFNA 3DXTA 1RVF3 2W1UA 1S0CA 3IIAA 3FC0A 3SEEA 4LBMA 2MPFA 5KC6A 4MH0E 3WUDA 3HN3A 3RSJA 3F95A 4BMEA 1QJFA 1Q3EA 3PLQA 4S2FA 3HPNA 1W0OA 1JYVA 4ZPIA 3WR0A 2GN3A 4PDWC 4FT8A 5AFBA 3AC0A 1HLCA 3SKVA 4LXLA 4DY3A 2JD9A 4L92A 4Y1YA 3ZSJA 4QU1A 1PVXA 4TLFA 1VRH1 3VZKA 3FBYA 4CVUA 4L2NA 5FLIA 5LK7B 4S2GA 2IUWA 3VL9A 2YDEA 4Q0PA 5E8AA 2VOVA 1VLNA 5FPXA 2R043 2WNVA 1W9SA 2O0OA 5EJ3A 2CWSA 3WCRA 4QKBA 1NXD1 5K4LA 4IV3C 5H9PA 4K3UA 5FXZA 3VHPA 3TEXA 3ZXEA 5T50A 5LCWL 4AI9A 1YQCA 4HPKA 2A70A 4IEUA 1BVVA 3WHUA 1MS3A 3RZLA 2VCBA 4LOTA 4PQQA 3OSDA 1C8M3 5FJKA 4Y3OA 5DZGA 2QDNA 5IT6A 1JYWA 3TEYA 1SBEA 3EQEA 1GWLA 4RQPC 3NJXA 4LO8A 1JYTA 1QJY2 5CFDC 3RZZA 2WFF1 1HDKA 2ID4A 4BISA 3MUY1 4RHV3 1PO21 1B35C 4M0HA 1UW8A 3WY6A 1Q8OA 1ND3C 2UU8A 4R4ZA 4YM0A 1H9WA 4E8CA 1NCRB 1VBB2 1RUF2 2GU9A 2VUAA 3PTYA 1ND2B 1O7FA 3O12A 3VBSB 4ZXEA 5A3TA 2ES3A 3ASIA 1LGCA 2BYVE 3OBAA 3WUCA 1QQP2 5DUXA 3W20A 4Q29A 2Y33A 1I9RA 4IV1C 2ZOEB 2NYYA 2PTMA 3N9PA 1GZ9A 2DUOA 1JYXA 1D0GA 2NMNA 1IS3A 1FMD2 3HWJA 3NNJA 3ZXGA 1VBD1 1CAVB 4AVTA 2RM21 4F83A 4PI2A 1LODA 4YZ1A 3O1OA 4MUVA 2WQ8A 1G86A 4Q4Y1 4QQHA 4AZZA 1NY71 4LLOA 1PMHX 5C5TA 1LB2A 5FPZA 2ZGTA 3F2ZA 5F39A 3ACHA 3WNKA 4CCNA 4YM3A 4QHZA 2DTWA 1K45A 1DQ0A 1MQTC 2QZ2A 2WS93 2QBXA 5IK5A 5KHHA 2VW2A 4HXCA 2VUCA 1S0JA 3E6BA 4XF4A 3OY8B 3TEWA 4HSJA 2I2SA 2B8MA 1ASJ2 4LO4B 4D6QA 2WSVA 2ZKNA 3POGA 4YG0A 1NA1B 2HWB1 1M4WA 2ET1A 5A3PA 4XTPA 3PJYA 1ZA7A 2GMEA 3I7DA 3RZHA 4L97A 1LECA 4COYA 3H1WA 3FHQA 2VCCA 1YXWA 3UK9A 1H8TC 4KWLA 2J1TA 2YC4A 4FXKB 2FDIA 4BIFA 1R1A2 1UKGA 5FZIA 2ZMNA 4XFIA 4MOAA 1OH4A 1XU2A 2JE7A 3CO2A 1AR92 2W08A 4HVRA 4A41A 2C26A 3RZKA 3I97A 4D6SA 5A3LA 3B7MA 3ZYHA 2H0BA 4IE4A 4EN6B 4XMAA 3FWEA 1BVP1 2IZWA 4Y33A 1IG0A 2A3YA 2F17A 4PLMA 4LQRA 1RHI2 2GNMA 4AVVA 2W1WA 5LA9A 3M4FA 4ZU5A 3UKNA 4EQVA 3AP6A 4MHRA 4NPMA 5BNPC 2NP0A 5D8AA 1O6UA 2YFZA 3JBG1 2VZUA 5L36A 2Z5WA 4PQ9A 5C4WC 2CGNA 2QNKA 3IPVA 5A33B 2X10A 2J1SA 3A22A 2WNOA 1ULGA 1QJY3 2JDPA 2JG9B 3H42B 3OUIA 2ZABA 1WCDJ 2VMIA 2R062 4O7XA 5A7QA 4JRAA 2Y38A 1VBB3 4KG0A 3UKTA 4EN0A 1RUF3 1W90A 4IEVA 3PDQA 3AKTA 3CJIC 3GNEA 2BRTA 2FZ1A 5FOJB 1S0IA 3MYXA 1C28A 2IXLA 3BOWA 4K6BA 4MGZE 5FYBA 3WLUA 1Z7S2 1QJX1 1LEMA 2ZHLA 4ZY9A 3ENRA 2FCTA 2OQ7A 2W94A 3ITQA 1ZA4A 4QDRA 4U2AA 1QQP3 4ZS2A 1V6JA 1D2QA 4L0PA 1FNYA 4DUXA 2WNUA 3HNBM 2GDFA 2QFEA 2VO5A 4AQTA 5CAZA 3LIHA 4N53B 4WBBA 1K5MA 1W28A 1HRV2 4BK5A 5ABJA 2WZ8A 3OYWB 2J42A 4CXXA 1FMD3 2QQKA 4B3NA 1GV9A 2YBKA 5A32B 1QWRA 3DPRB 3CEWA 4ISQA 3I3DA 2HBTA 5JUVA 4Q5OA 1Y4WA 3NKGA 3NJVA 4CUAA 4N9HA 3LAGA 4HMZA 1W9WA 2B5HA 3RQ0A 4AYUA 4HK9A 5KXDA 3CKHA 2X29A 3H3UA 5LBEA 3FZ3A 5JR7B 4KG8A 4NAMA 1O3RA 2JE8A 2ZZQA 3H8UA 1GZCA 3NAPC 2FD8A 1JHJA 1NLRA 2DCJA 2H0VA 2BPA2 1XNAA 4FP2A 1IQAA 3I2IA 3E5QA 3LOIA 4KWUA 3AZWA 3GHNA 5L19A 5AC91 1QDOA 2Y6HA 2IFWA 1ASJ3 2YYOA 3POWA 4XW3A 5FPLA 3WG1A 2RDSA 2RS11 4URTA 4FXGB 2QJVA 4P02B 4BIOA 1DYPA 1MZ6A 4HSLA 1W8HA 2N7GA 4FPYA 4Y5SA 5GLZA 5FR3A 1IS4A 4LUKA 3AFGA 3SQOA 5CNAA 5FY9A 4D7TA 2YB7A 1R1A3 2EXIA 3VB9A 3R0RA 1PHMA 1GFF2
chains in the Genus database with same CATH topology
3BODA 5KHKA 4YM2A 3O0VA 1AR93 4LR4A 1GR3A 2VVFA 4OLLA 3AP7A 1DU3D 2R32A 4HPKB 4AHXA 2P34A 1JN2P 4K8FA 2XGXA 4W6XA 1RHI3 4PJYA 4FQ4A 4AG4A 2TNFA 5DZEA 1O4ZA 2A6ZA 1JUHA 2C9AA 2CAUA 3JD72 5CFCC 4X8NA 5E89A 4LEJA 3SHRA 2XKPA 3WDVA 1XNDA 4P9LA 1HX6A 1X8MA 3CF6E 3MI8A 2PHDA 1MVEA 2R0FA 1YI9A 1PZ9A 2HWE2 4OHVA 3RYKA 2ERFA 2FQPA 4XF1A 5JMCA 5CVRA 1QOTA 3DV8A 4AI3A 4YVWB 2R063 1CJDA 2QKDA 3N3HA 2R041 1XYOA 3SNMA 2VW1A 1PIV2 3FBMA 3J8F2 1N3PA 2FMYA 2OUHA 1C8NA 1Z7S3 1CIWA 1A6CA 1BMV2 1DIWA 5K8SA 2ZX1A 1QH6A 4R8HA 2WQZC 2HEWF 4PIXA 4UW3A 2CL2A 4YZ3A 5HCFA 1C4RA 5I8TA 1HRV3 3G7DA 1Q8QA 2ZKLA 4QPYA 1BEV2 2BTVC 1HQWA 4Z92B 1PNFA 4LBQD 4CP0A 2P37A 4ATFA 4WVWA 3AYAA 4FPEA 2BFUL 2Z2SB 4RHV1 4YW1A 1MEC1 2WZPP 4MLOA 2X53S 4OHWA 1JYCA 1YO8A 3OJBA 3PNAA 1RUC2 4XJAA 3BTAA 2RS32 1R082 3AKRA 3EJKA 4DRVA 5CG8A 1NCRC 1KDKA 1Q8SA 5BUVA 1ND2C 2B46X 1MR5A 3VBSC 5T5OA 1TE1B 3RPQA 2E7AA 3I59A 3ZN5A 1UZYA 1PGL1 2E6VA 1YFXA 1REDA 2XJPA 4EN8B 5BY5A 3KCCA 3RYPA 4CRQA 1W6QA 1FXZA 4RR3A 5JI7A 4YG6A 1KJRA 1I6XA 3SH5A 3NL1A 4SLIA 3RYRA 4XBNA 3ZXKA 3TOJA 2HEVF 1H8VA 3IPVB 3JD73 2Q1MA 1TEIA 4GXLA 3AYCA 4TWTA 5J3UA 2OA2A 3JQXA 3MIDA 1N1YA 1RUOA 4ES9A 1NE4A 5JSRA 1AR61 1NA1C 2HWE3 3IDEA 2XUMA 4LE3A 3A0KA 1YJLA 3N4MA 3VN4A 2JD4A 3O0XA 3AMPA 3FLRA 5E16A 4KNCA 3MLJA 2JG8A 1PK6A 4QQ2A 4QD2A 4FSJA 1PIV3 3J8F3 4PDWB 4IEZA 2WNUB 3NKTA 3VV1A 4Q4V1 2EAKA 4EN9B 1K5MB 1ENQA 4FPLA 1CD3G 2GAUA 1L3JA 2P3KA 2D6MA 1FPN2 4QGLA 5ABJB 4O9GA 5HI0A 1NCQA 1RUD2 5T54A 2E7QA 3TNQA 3Q9OA 4AVBA 1QGLA 1BEV3 1OD5A 4AK3A 2AZ5A 1EAH2 1QJY1 4ORFA 1AYM2 3WD5A 1DFQA 1RJ8A 4N7IA 2C5DA 4MSVA 4FPCA 2PHRA 5LRRA 3ZIXA 1RUF1 4AI0A 2JG9C 2ZGMA 1RUC3 4L9BA 4RS5A 2DCYA 4G9SB 2RS33 4QQOA 1R083 4WVMA 5CFDB 1QQP1 1GZWA 1OHFA 1OLRA 1RUJ2 4XHXA 4OZXA 3M7AA 5I0UA 1B35B 1ND3B 5FLJA 4QPIA 5I93A 3MIGA 2G9FA 4RL7A 1FMD1 2XLGA 1YNAA 4DY5A 2UURA 4N53C 4MX3A 1X8EA 5ACA2 1V6NA 3ZIWA 4ZU7A 1MZ5A 1J1TA 3DPRC 5JPMB 2F4PA 1COV2 1YJKA 3HT1A 1H2LA 4D7SA 5FMOS 4HANA 2RS52 4COVA 5GZEA 1QKQA 1YWKA 4OUSA 2JE9A 4LA2A 2XKOA 2D44A 2WLQA 3KCXA 2VW0A 1UU4A 3ZN6A 1XQNA 3FLPA 2OYZA 1X82A 2RMU1 4C0BA 4LHKA 4DPNA 3WP4A 2AYHA 3O7OA 1CONA 3WDUA 3AYEA 4A7YA 2BGCA 3SH3A 2IFRA 2R1BA 4Q1PA 1AR91 2RR11 4COZA 1UCXA 2VG9A 2Q8OA 4ASLA 2K9ZA 2WNVC 3L9JT 1OFNA 4CDXA 3WDWA 3ZN4A 3IWZA 1ZZ6A 3H1YA 4CDQA 1FPN3 2CTVA 4WVVA 3FX3A 1RUD3 4C0HA 2ZX2A 3AZXA 4M3CF 3SMHA 5DDJ2 2EXJA 1LHOA 5J7MA 1PZ8A 2MNGA 1EAH3 1LR5A 1AYM3 4M00A 3VLBB 3MIHA 5F5QA 4BH9A 5KXCA 2D93A 3PVEA 4AHYA 2OPKA 1PVC2 2R061 4KGQA 5F6LB 5KHJA 4I3GA 4F8AA 4NHMA 5FO9B 4XEZA 4B4QA 1Z7S1 4E2GA 2ATFA 4XXAA 1CQ9A 1W6OA 1KXGA 3MIEA 1RUJ3 3S6PA 1POV0 1WA4A 4DRRA 3VZOA 1HRV1 2DYCA 1DQ2A 5EYXA 3UKVA 1ZRCA 4QPGA 3CJIB 1W6QB 4RR3B 2ZACA 4KU7A 1GKBA 5ACA3 4GWMA 4AEDA 1JTZX 1NOVA 1COV3 2BNMA 2CNAA 1ZVFA 3LZZA 4Q0UA 2RS53 1LHVA 1ZBA2 1E57A 4E2QA 4FCAA 3ZFFA 3LOBA 3H7JA 1SBDA 3NJZA 1N1SA 1ONAA 5JAXA 5JWPA 3ILNA 2B7YA 2E51A 4UBHA 3NWKA 3NAPB 4XJ9A 4UW4A 4EV0A 4KGGA 3AP4A 3ZYIB 3B00A 4GMP3 5J48A 2YZ4A 1S1AA 3AYDA 3CLPA 1W39A 1OPMA 2JG8B 3IDCB 2KA3A 4FPHA 1UAIA 1PK6B 3WOGA 2QZ3A 2UYBA 2HWF2 4AQ2A 3B02A 2BW8A 2ZMLA 3B3QE 5E1RA 1PMIA 1S2BA 5GZDA 2ZTNA 2FBEA 1NCQB 4AE2A 2F6BA 4UBGA 1FT9A 1X7NA 2LTNA 3WQ1A 3M8LA 3U0ZA 3KM5A 4AFMA 4JCKA 2GSYA 5DDJ3 3ZO0B 4XF3A 4CDUA 4Q2FA 2HWE1 2WINB 3EBRA 4CDWA 1N1VA 4WM7A 4AFDA 1EV12 2KM2A 3R4DB 3E5XA 1LHWA 2TEPA 3B69A 3ROUA 3ZYGA 4P9IA 4XQDA 2I74A 1PVC3 1R091 5I0RA 1UD1A 2XBO2 4JV4A 4WVMB 4Y26A 2ZGLA 4NHKA 1PIV1 1EYBA 4MXVA 3LSEA 1LKNA 4I3PA 4N43A 1RIRA 4RA0A 4Q8LA 4QPIB 3SITA 1D4M1 3WT3A 1XYNA 2XPJA 2MHFA 3V64A 5JLVA 3B9IA 2WNUC 4S2HA 4META 1K5MC 4E2SA 1PZ7A 2B39A 5ABJC 1MS9A 4JDMA 1IHMA 4TSVA 2Q4SA 2IXHA 1W6MB 4FP3A 4FAGA 3PVNA 1MS4A 4G3YC 2XH6A 1F9KA 1IKQA 1RUC1 4BE3A 1GLHA 2B9UA 1S0DA 2RS31 1ZBA3 3GBWA 4FPKA 1R081 4JGZA 2DVGA 5CB7A 1D0HA 1CAXA 1PGSA 2EAAA 1ZNPA 1C5HA 3HD8B 2X8KA 4JDNA 4XQ4A 3ZN6B 5DUUA 4DXZA 2BNOA 4Z1VA 4LHNA 4L99A 1XYPA 1AR72 2ZA9A 2UY8A 2GC3A 2P3IA 2R30A 4N7UA 1Q8PA 1HRI2 2ZHKA 1YYNA 4JTOA 3CJXA 1HQNA 2BVBA 5DXDA 1LJ7A 3OGGA 2Z69A 1D4VB 1LRHA 1JUIA 2HWF3 2Y0IA 2ZGKA 4LO5B 3WP5A 3NV2A 3KT1A 4CDXB 1RUH2 3HT2A 1DF0A 1YFYA 2ZAHA 3WINE 4XIOA 4CDQB 1BCXA 1A3KA 2G4IA 5D1IA 1OA4A 1G7YA 1YLLA 2A6VA 4K9SA 4C90A 5KHGA 3FE5A 1U5YA 3VGIA 4LBQB 1S0EA 5SV8A 3WQ7A 1IS5A 5AVAA 2BWAA 4KH9A 3TN92 4Q4W2 3N7KA 2HYKA 3MZHA 2VUJA 3U10A 1EV13 1SLLA 3SCFA 4E27A 4QM9A 4XF0A 2EF6A 3H1MA 1VIWB 3THTA 3ACLA 5JOXA 4HLTA 2XBO3 4HN0A 1AZDA 2HWC2 1W6OB 1WBLA 1F2NA 2XL7A 3C2UA 4OI1A 4W6WA 2DFBA 1H1MA 3PHMA 2VQ0A 4A7KA 1FPN1 1RMU1 4FVVA 4QPGB 1CX4A 4H55A 5F9TA 5KBFA 4G4FA 4LO7A 1B09A 1BQPA 2PHUA 3ES1A 1WD4A 4I2OA 4CZSA 1OMIA 2IXCA 4LO6B 1V6MA 2DURA 1EAH1 3EHKA 1LENA 1H4GA 1PO12 4AEDB 1OKQA 1AYM1 4BA6A 4C91A 3QH6A 4AGRA 2EIGA 4YZ4A 2WA4A 1AJOA 3RMXA 2KXLA 2VU9A 1RB8G 5JSOA 1SMVA 4AVCA 3TNPB 4ZXKA 1DQ6A 1WLCA 3WW3A 3ZFFB 4KQ7A 1BBT2 3U4XA 1GQGA 1FYUA 3V0BA 2W0XA 1XE7A 1D2SA 5JOWA 1CVNA 4IEOA 4NWWA 1A78A 3GF6A 4EJRA 2Q30A 5C8CA 3AFKA 4QHBA 1Q43A 1DDLA 1AL22 4ITCA 2ET7A 2C1FA 3B94A 1AR73 2PYTA 2XVLA 4BMBA 4XJWA 1QY4A 1RUI1 1HRI3 2QQPA 3AKSA 1ZBE2 1UMZA 1H1IA 3MF9A 1CPNA 4AWDA 4CEWA 4XIKA 1VBE1 3HQXA 4NPRA 2GC0A 2EALA 1CJPA 1FAYA 2MEV2 2XWJB 3IMNA 4RR3C 1COV1 3FUOA 5T55A 2GMPA 4XFBA 3ST7A 1GYKA 1RUH3 4NR1A 3FFQA 5A3MA 3HAGA 1ENXA 1XRUA 4H7LA 1QH7A 1WCKA 2Z79A 5F6KA 1H1AA 1YIFA 4RSUA 4AQSA 4Y1VA 4I0WB 4AVSA 4YW3A 4CDUB 1IGOA 4AHWA 2PFWA 4Q0SA 1WBFA 2WZR1 2CAVA 4Z07A 5F1RA 5I8YA 4CDWB 1W0PA 3E97A 4WM7B 2GH8A 3TN93 4Q4W3 2D5FA 1QXRA 2GC2A 3BPZA 1Z78A 2GZWA 4GMP1 4K21A 3D82A 5E88A 1H9PA 2DTYA 2A6WA 5KWRA 2VULA 4Z82A 1CPMA 5AVPA 1OSGA 4R9CA 1GNZA 4JTNA 1V9U2 3T2TA 4OULA 3AB0A 4YFWA 1WCSA 2JG8C 2HWC3 4OHZA 1PK6C 3AKQA 3I8TA 2OZJA 4R52A 3AM2A 5BNNA 2XVKA 1C57A 2A71A 4E4ZA 4KBBA 1AX1A 4DMIA 1NCQC 3HN1A 1RUNA 2ZGNA 4MGIE 2DVFA 2UWBA 1AJKA 1O5LA 1PGW1 1PO13 2V73A 1RINA 2DVBA 5EFUA 3H7YA 3JQWA 1EY2A 1PVC1 4MVTA 4EWDA 1PM7A 4JGZB 1TMF2 2DU0A 3SCHA 1BBT3 1RVF1 4XPVA 4PLNA 3ATGA 5FOBB 2V5YA 4RS5C 4Z8BA 4LA3A 5CIRA 4AI8A 4PBOA 1LHNA 2D6PA 2R1DA 1O4TA 3J26N 5FMOL 1KFXL 1IOAA 3WW2A 1QNWA 1AL23 1V6LA 3DF0A 3V65A 5JZGA 4FPGA 1UL9A 5TSWA 1KRIA 1R1ZA 4QPIC 1GICA 1S0BA 2YHJA 1ZBE3 5J96B 3ZFEA 1J58A 2WLPA 5K7PA 4OHYA 1QJU2 4Z2WA 1QU0A 1BZWA 2ZHNA 2MEV3 1ZM1A 1A8MA 4B7EA 2BNNA 3ZMNA 1UN1A 1ZBA1 4NO4A 5DZFA 1HKDA 5I0TA 2PLV2 3LKJA 2BBVA 4IEXA 1OPOA 4BLIA 5H9RA 2OIIA 1C8M1 3HR9A 2PAEA 1TME2 1N47A 2RJKA 2P17A 4LLFA 2VOWA 2YXSA 4YSFA 1XXNA 3AZYA 4CP1A 1J3RA 5B2GB 3WQ0A 2PHWA 3I2DA 1ZRDA 4E4SA 4P9GA 4DS0A 4BQ1A 3GBFA 1DLLA 3QOPA 2A73B 3EO6A 4IERA 1V9U3 1ZZCA 1UF2C 3AJZA 1Y3TA 1VRH2 2DUQA 4LBJA 3ZSKA 2OZ6A 2VOXA 4XJZA 4HKLA 1CR7A 4CDXC 2RJLA 1KITA 5I8SA 1MS1A 4JRLA 3QLQA 5HXVA 3WW4A 3VBRA 4CDQC 3ECQA 3VKFC 3BALA 5BNPA 2ZGQA 3CL1A 3H3ZA 4FOYA 5BYNA 3JU9A 4LBNA 1U12A 1WMFA 1LOFA 1Y9QA 2DFCA 5JVVA 2WS91 3TAYA 5JDBA 3LA2A 1O91A 3SLIA 3NV3A 2XBO1 1QJZA 3V0BB 1TMF3 5D8AB 2BUKA 5JPNB 3FFZA 1DZQA 2WJSA 3M2MA 5C8CB 1F5JA 4A7ZA 2WT0A 2LUWA 1JBCA 2X5IA 2R49A 2O8QA 4C1WA 4XETA 3MF6A 3OTFA 1M06G 1GBGA 4CEWB 5KXEA 1JOJA 5K0UA 4XFCA 1TNFA 4NWVA 2DV9A 3N7JA 4NHLA 4QPGC 1N3OA 5T3NA 1EPZA 4R4XA 1QJU3 4K7JA 3KMHA 3R05A 3BU7A 4BM8A 3SISA 2NLRA 4AEDC 1VP6A 2ZZJA 2XJVA 3LA3A 1BXHA 3UJOA 2W68A 2P3JA 2PLV3 1N3QA 4SBVA 1AX2A 3WDTA 3LSDA 3ZFFC 2D3RA 3IT8A 1TME3 1V00A 2YY1A 1V6KA 2GC1A 2XG3A 4GALA 1VALA 5SV5A 3AX4A 5FREA 1H2KA 5GZGA 1HRI1 2YC0A 3IKWA 4M01A 4M3CA 5C8WA 3RDIA 4FBFA 1VBB1 3U11A 2D6LX 1FV3A 3FLTA 3MLKA 3EXUA 2ZGSA 4GH4A 3W58A 3AJYA 5I0SA 2CGOA 2JICA 2SBAA 2A7AA 1FNZA 1VRH3 3S7IA 1OOPA 1SCRA 5BNNB 2HKXA 3X29B 3MDPA 1LGBA 2ZGRA 5I91A 2ZCWA 4R9AA 2DF7A 2ZHMA 4TYSA 2WT1A 4XMIA 2WA3A 3A4UA 1HXS2 2DCKA 3AZVA 1FX5A 2ZS6B 4Q4W1 2VGDA 4B8EA 5GZFA 3ELNA 5FFOC 4CDUC 3ZXFA 1TNRA 4X8PA 5CA6A 3L2YA 2ZX3A 2B45X 2XJRA 3JBG2 3P3NA 4R9DA 4CDWC 3E6CC 3USSA 4WM7C 3OBTA 1V6OA 4XBQA 5LRSA 5CU1A 3I54A 4AQ6A 3M3IA 3FUQA 4QQLA 1VBA2 1OQEA 2HWD2 3KT7A 1ASJ1 3MFAA 1J3QA 2A3XA 1QOOA 5JZGB 4HL0A 2CV6A 4N43C 4B4PA 1LGNA 2DU1A 1WUVA 3TYJA 5C6CA 4BCUA 1QJX2 3ZFEB 4GULA 3OBRA 3QD6A 1R1A1 4JQRA 4HKWA 2OVUA 1ZZ7A 2PA7A 1AL0G 1ULEA 1RJ7A 3RJ2X 3J4UH 3WP6A 3VDDA 2JECA 1H0BA 2VVEA 3K51A 1VB4A 1KD7A 3MEPA 3WX5A 1NG0A 1HV1A 4Y20A 4B4RA 1QNYA 1AYN2 1RHI1 1BBT1 1VAKA 5GLWA 1RITA 2FHRA 2VPVA 2G9GA 1NZCA 3QH7A 3AKPA 3TBDA 3JB4C 1T6GC 5K9YA 1HQLA 4JGZC 1VBC2 3BOPA 4OI2A 1LESA 2QDRA 1AL21 5EV7A 4XQWA 2Q5TA 4PCRA 2D6KA 3O14A 3KLSA 5C9AA 4HFSA 4OFGA 1REEA 1ZBE1 3B01A 3UJQA 4COUA 4IQPA 4MYEA 2WKKA 2RS12 4Q1RA 4WM8A 1C3HA 4I0BA 2MEV1 4Q27A 1JYIA 3ES4A 3SXWA 3I59B 2ZX0A 2A3WA 5CADA 2QCSB 4KU8A 3KD4A 4HN1A 2AR6A 3KB5A 2EVXA 3VBRB 5EYYA 4NVPA 3N7LA 1MZFA 4ISRA 1S0FA 1HXS3 4DNYA 2R072 3OF1A 4FTEA 4WV8A 2JEMA 5FRAA 4AHZA 1AXKA 3ZMOA 3R4UA 1FOD2 3OY8A 3JBG3 4QGMA 1PHMA 5DG1A 1H30A 4AI1A 2YMZA 2D40A 3JUUA 1V9U1 3D4KA 3QBQA 2C0ZA 3WNXA 1SLIA 1VBA3 4XJ8A 2HWD3 4LULA 4ONUA 4N90A 2X5IB 4RGAA 1NQJA 4AEJA 4Q0QA 1WW5A 5IK4A 2GNTA 3ALQA 4ZKTB 1IKPA 3G6JB 5BNOA 5K0UB 1G9CA 3DUIA 1J1LA 4DINB 2GNDA 1CESA 3KCYA 3ZXDA 1QJX3 1V6IA 1XNBA 4LBLA 3RI9A 4FPJA 2YUEA 2H6CA 2VNOA 3AK0A 3URFA 4D69A 1U0AA 1SLTA 4AEMA 4HKOA 4XDQA 5CG9A 1QF3A 4OVEA 5GLTA 1TMF1 1AYN3 4YFZA 5KC5A 4K1ZA 3PJQA 4FOQA 1ZX5A 4QM8A 3JD71 1G8WA 1MEC2 1UKRA 3POYA 1O3SA 1YCIA 4LNVA 1PNGA 4HBNA 5D8AC 1VBC3 1JHNA 1IPKA 2AENA 4ASMB 5C8CC 3BCWA 3PVBB 1ZYBA 2YV8A 4J1XA 4M3CB 5GALA 2JKBA 5GM0A 4XFAA 5T52A 4A2UA 4RS5B 1DG6A 3HIFA 3APBA 2RS13 2W39A 3DKWA 4CEWC 2IXJA 1YHFA 4GH4B 2FMDA 3J8F1 1GZWB 1PGL2 1ULFA 5AFEA 3VUOA 1OOPB 1XU1A 2E7TA 3RRDA 1BMV1 1H4HA 4IEPA 2PAMA 1NE6A 2D6NA 4D7YA 4MV2A 4NN0A 3AP9A 1O3QA 2QE3A 2TBVA 2W52A 3RJRA 1TME1 2BVVA 1OA2A 2VQAA 1BEV1 1KFUL 3HBZA 4I0AA 2CYFA 1ZZ9A 1LU2A 5IK7A 2R073 1ZRFA 4YRDA 1VJ2A 4Y1UA 3WXPA 2NMOA 1FOD3 2DVDA 4KWJA 2DVAA 3ZXLA 4AW7A 1AF9A 1AR62 2HEYF 5GKAC 1YFUA 3M70A 3I4IA 1LOEA 4ATEA 3N35A 3D6EA 5C33A 1CGPA 3PMSA 4JC1A 1WD3A 1H2NA 2ENRA 3W9AA 1MZEA 4PIYA 5FLHA 2IXKA 3H50A 2XHKA 5BNNC 4YW2A 3M3OA 4RGGA 4Q4V2 3A0NA 3VDDB 1W6PA 2VMGA 2WWSA 3M1HA 3O0WA 2R0HA 4Y20B 1MS5A 1WLDA 4IL7A 4AFAA 1RUG2 1VR3A 2PELA 4IXLA 1RUE2 4K1YA 4KWKA 4XOGA 1DHKB 1SEFA 2UWCA 3JCIA 1GSLA 3KGLA 2A75A 1J3PA 1G6NA 2E63A 5GJ6A 5H9SA 1MEC3 1OQ1A 3B5LB 1ZREA 5T5JA 5H9QA 4YVWA 3VBUA 5C9AB 3AZZA 1S55A 2WNEA 4HT1T 1OI6A 3IBMA 5JZGC 4CEYA 4WM8B 4XYXA 3PVOA 4J1WA 1TQ5A 1YI7A 1CAWA 5GZCA 3VBFA 2D97A 3ZFEC 4DFSA 1BYHA 2Z42A 4H3WA 2PAKA 4GKYA 4N9IA 2D6OX 2Y0OA 5FAXA 2CGPA 2SLIA 1MACA 1RTVA 2NN8A 2EXKA 1F31A 1Y43B 1RUD1 5LEKA 1HW5A 2ILMA 2A5ZA 1W2UA 3VBHA 4H7MA 3ZPYA 1DGLA 2GNBA 3ZDSA 4AI2A 4J6GA 3M3CA 1AR82 4WZCA 1W6NA 4XTMA 3WG4A 4E9KA 2QUOA 1XNKA 1UIKA 1KDMA 5J36A 4JGYA 2WIIB 2WFPA 4JAAA 1ULCA 2OW4A 4XF9A 1NLSA 3N36A 2RMU2 3TWIA 3AMQA 1AR63 4QXKA 4RFT0 4Y22A 3KS7A 1RUJ1 3GZTB 5BNOB 5KXBA 5L7OA 4YM1A 1UIJA 3KSCA 2RR12 1QMJA 1DZRA 1ENSA 3ILFA 4AVAA 3H9AA 1UPIA 4EROA 4PLOA 3WCSA 2AREA 1VAVA 1HXS1 4Q4V3 1LU1A 3UV9A 3VBRC 4YARA 2LM3A 5EZWA 4MZUA 4B7KA 5JI9A 3U07A 3R6SA 4YVSA 5ACA1 1BKZA 3VBOA 2XL9A 4YGDA 5T5LA 3HMYA 1RUG3 4CP2A 3RG0A 2RS51 4LBKA 1LOFC 4UW6A 4C1XA 3T1MA 3ZFGA 1RUE3 1VBA1 2HWD1 2D7FA 4DQAA 1YRZA 3GALA 4XFFA 1ZRRA 2PHFA 4XBLA 4MXWA 1IPJA 1DQ1A 1C5IA 4OHXA 1IZ3A 2K2SA 2X5IC 4Y4YA 4GB32 3CU7A 2ZAAA 1JXNA 4PDWA 3OD0A 2VH9A 4K40A 1N1TA 5K0UC 4FOVA 2UY9A 4YLZA 4YGCA 3VKLA 1QXPA 4N43B 4IETA 3NSTA 1AYN1 1APNA 1X50A 4P9WA 2PHLA 3MW2A 3K48A 4L11A 3VL8A 1ALYA 4IV3A 5L73A 3SCGA 4P14A 2YPJA 1UPSA 1DGRA 1Y7BA 3IDBB 1VBC1 1YFWA 5DDJ1 4XFGA 1FI2A 1WGPA 3ILRA 1OA3A 4MGKE 4QGNA 1CN1A 1KQRA 4P9XA 4XE9A 1AR83 3PMEA 1BJQA 3E5UA 4HETA 3WVJA 4RQPA 3DL3A 5CFDA 1SFYA 2A6XA 2WSUA 4Q4X2 1CAXB 1B35A 3KGZA 4DZGA 2RMU3 4WZFA 1ND3A 2XJUA 3SH4A 4HVQA 4XZPA 4YGEA 1DZTA 1POV3 4GMP0 4GH4C 1GANA 4QQPA 3NV4A 1OOPC 5FQ0A 3S0MA 2JDZA 2RR13 2YROA 3ZSLA 2AUYA 4IV1A 2DUPA 1W6PB 1DQ4A 3ZXAC 1OFSA 2VVDA 2XLFA 2YGLA 3LCPA 2R071 4YGBA 2Q1ZB 3QACA 4YZ5A 2EA7A 1S2KA 4GKXA 3VKNA 1FOD1 1HIXA 3GZUC 3L2HA 5GLVA 2R6QA 5LK5A 5EXOA 1LOCA 3ZSEA 1AVBA 1MS8A 5FDBA 1MQTA 3E6DA 3AMMA 4XHBA 1AXYA 1YUDA 4FO9A 3VBUB 1R092 3NO8A 2RE9A 4X6RB 3RS6A 4XXPA 3LB9A 1C1LA 4CEYB 1ENRA 1URXA 4XILA 1A8DA 4X6QB 1U5IA 1LCLA 4GB33 1CAWB 1I5ZA 4GA9A 3VBFB 1D4M2 4AF9A 2NM1A 2ARXA 1U5XA 2I45A 2PN5A 1OLQA 2WT2A 2HWF1 1H8TA 3VHRA 4NOTA 2D5HA 4O9EA 4IEWA 4B29A 4CTEA 5JOYA 2D43A 3VDDC 3ZVXA 4FAHA 4LT5A 3WDXA 3LWCA 4COWA 4LHLA 2YGMA 1AXZA 4AFBA 2HJIA 3MIFA 2I07B 5T5PA 1AHSA 3ME2A 1F5FA 4QT6A 3VBHB 5DUVA 4Y5Z0 3P3PA 3D5OA 4FTSA 5EWSA 2VMHA 3AXEA 2ZPXA 4INDA 2AGSA 4W6YA 3THPA 1W6NB 1ZZ8A 2AH2A 4KL1A 4JGYB 3D8CA 1EV11 5C4WA 3USUA 3KT4A 4AEKA 2V09A 3MFCA 5C9AC 4QX5A 2NZ9A 1HV0A 2B42B 2WFF2 4Q4X3 1UU5A 4Y22B 1DGRN 4WM8C 1PO22 1CAUA 4OUMA 5L7OB 1WMDA 1I3HA 3CJIA 1BK1A 4FOWA 4EWEA 4TZDA 3CNAA 1QDCA 2XB6C 3ZSMA 4DB5A 4P5HA 1QOSA 1I1EA 4Y24A 3UL2A 3WP3A 3FHIB 1GNHA 3GZAA 4FPOB 4AGGA 4HZFA 4YVSB 5IK8A 3VBOB 5KHIA 3ZYRA 2ARBA 5BV6A 3D0SA 1VBD2 3ZYJB 2RM22 4I30A 3ZFGB 4Q4Y2 2ZX4A 2E53A 1MS0A 1NYWA 1O3TA 1NY72 2NPIA 2E9QA 4HVOA 3NAPA 4MXWB 1SLBA 4F3JA 1R093 4W65A 1AR71 4PF5A 5HCAA 1SBFA 1V70A 5BPXA 3MGUA 5BNOC 1SDWA 2HWB2 4ES8A 5DG2A 3GBGA 1D4M3 4UXAA 4I09A 1RMU2 5J98B 1IS6A 1QHDA 3IN9A 2Q0AA 3ZXJA 4F7ZA 1RUG1 1RUH1 4FPFA 1LOAA 3VKOA 2DCTA 1VB2A 1G9AA 3AP5A 3JB8A 1RUE1 4I01A 4IV3B 3OPZA 4IESA 4PIZA 5DUWA 2IC1A 2XVGA 3J9SA 3N7MA 4YYOA 4Y1XA 4PBPA 5HBAA 3JZVA 4U36A 2FZ2A 3MW3A 2JX9A 5FO8B 3MPPG 5CFCA 2QVSB 3TN91 1X33A 2XJSA 1H2MA 3V0AA 3H0OA 2OUJA 1DGWX 2BWCA 4RQPB 1LULA 3OCPA 2TUNA 1LOBA 3V56A 1G9FA 2WC2A 3MIBA 4XFHA 2PHTA 4V1PA 2WFF3 2HWC1 1RUI2 3LGRA 4BHPA 1WMEA 1PO23 1SCSA 4Q26A 2ZGUA