3MLJA

Reduced (cu+) peptidylglycine alpha-hydroxylating monooxygenase (phm) with bound carbon monooxide (co)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
310
structure length
310
Chain Sequence
ECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-glycine alpha-amidating monooxygenase
publication title Differential reactivity between two copper sites in peptidylglycine alpha-hydroxylating monooxygenase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 68
structure length 310
sequence length 310
ec nomenclature ec 1.14.17.3: Peptidylglycine monooxygenase.
pdb deposition date 2010-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01082 Cu2_monooxygen Copper type II ascorbate-dependent monooxygenase, N-terminal domain
A PF03712 Cu2_monoox_C Copper type II ascorbate-dependent monooxygenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3mljA02
2.60.120.310 Mainly Beta Sandwich Jelly Rolls Copper type II, ascorbate-dependent monooxygenase, N-terminal domain 3mljA01
4E4ZA 3MIEA 1YJKA 1SDWA 1PNGA 3PHMA 3MIFA 4R4ZA 3MLKA 1YJLA 3PMSA 3MIDA 1PHMA 3MIBA 1PGSA 1OPMA 4R4XA 4QHBA 3MICA 3KS7A 3MIHA 3MIGA 1PNFA 3MLLA 1YIPA 3MLJA 1YI9A
chains in the Genus database with same CATH superfamily
1C8NA 2RV9A 5LRRA 5A6QA 5CA6A 1I5ZA 4BLJA 5LBFA 2VL4A 3HQUA 2R0FA 3ZM8A 4L0PA 5JR2A 2WFPA 1WD4A 1BEV2 2J1TA 3B69A 3R6SA 2SLIA 5KHKA 1GSLA 1JODA 1CZVA 2YU2A 3DEMA 3HJRA 5FYVA 5FYYA 5LY1A 3AL5A 1A34A 1FAYA 1YFXA 2X53S 2XLFA 4GH4B 5JLVA 2NP0A 3J7HA 1PMIA 2DCKA 3ZN5A 3PLQA 4GH4A 1VBD3 2WLQA 2D3SA 1OA3A 2KD7A 5J37A 3LPFA 2P3YA 2ZX2A 1OLQA 3MZHA 4LO8A 1L7LA 3AK0A 2W1UA 4GB31 4COYA 1NE6A 1NX9A 3D8CA 1F35A 2HEYF 2EF6A 1W6OB 5FY5A 1W2UA 2UWCA 2YYOA 3VHNA 1HJGA 4C1XA 4OQ8A 1W6OA 2P6CA 1CAVB 2VQ0A 2OKXA 4H3WA 1YUDA 1R092 1COV1 1UY1A 2RDSA 3B00A 4JVAA 5A32B 4ZKTB 2VY0A 3VD4A 5ACA3 4A4AA 5FZIA 5C3QA 1FMD2 3X29B 3FLPA 3WCRA 3NJYA 2Z2SB 4JGZB 3HBKA 4NHKA 4AFAA 1SFNA 1DU3D 1RVF3 1WCUA 4IEWA 5L9RA 4AAPA 1AYM3 3ZFFB 2JDNA 2ZXQA 4JGZA 4BIOA 3B01A 1HDKA 2XDVA 1HW5A 4R8HA 3AJZA 3H3ZA 5D2AA 3TBDA 1W04A 5A3UA 3TOJA 2WO7A 3IMNA 3SLIA 4NOTA 2BYVE 5BNPA 2RS12 3VHPA 4A3XA 4CSWA 2OQ6A 1BEV3 3AP9A 4CE8A 5BYNA 1DHKB 2EAAA 4Q4Y3 2ETEA 4QQHA 3UJQA 3PUSA 4WZCA 5HCBA 4AHZA 4UF0B 5T54A 3GALA 1DIWA 2ZS6B 5FQ0A 3UGGA 5I0DA 1UZ0A 1VALA 1BYHA 4KGGA 4UF0A 5JXIA 1D0GA 4CU9A 1PHMA 2F4LA 5C71A 4LBLA 5A1LA 3ZXKA 5FP7A 3LEKA 4IEZA 4B4QA 1G9DA 3OGGA 4WZFA 3LFMA 5F7UA 5IJRA 4EN8B 3T2OA 3GBWA 4KWKA 4BZ4A 5FPXA 4UW4A 2RJ2A 3ZYRA 1XOYA 1R093 4FFFA 3WQ7A 3WF3A 2VMIA 1DQ2A 2VNOA 4XEZA 3KLSA 5A80A 4NJ4A 4GZ9A 4Y1YA 1GZ9A 1LR5A 4PF1A 4IEQA 4QAWA 5J98B 1FMD3 3WNOA 5A33B 2BZDA 3AMMA 2ZHNA 1C57A 5FZ3A 5CG9A 3DPRC 4ZY9A 3AMPA 2LRPA 4XQWA 3B9CA 4LBMA 4AI1A 1PVXA 3CL1A 5K7PA 3AYCA 3ON7A 5FTTC 5FREA 3LA7A 4XABA 4JV4A 1CAWA 2RS13 4PLNA 1QH6A 5H9SA 4AGGA 2OZJA 1JN2P 5FO8B 2PA7A 2WQZC 3THCA 3WY6A 4LLFA 4Y5SA 1KD7A 2PXJA 1CWPA 2R16A 4PQ9A 2E51A 3B93A 1AR72 1YEWA 1ND3B 4IE4A 1R082 3ZO0B 1NCRB 1ND3A 2G9FA 5C8CA 3IIAA 4TLFA 2P4EA 1W6PA 3KM5A 2IXCA 3KT1A 1RHI1 2GH2A 1DGRN 4H7LA 4P14A 5TSWA 1HV1A 3BOWA 4W50A 2TEPA 3GZAA 1YYNA 2Y26A 3WEZA 2PQQA 1VR3A 4ATEA 5T5OA 1ZA7A 4HPKB 1W0NA 2EIBA 2BW8A 1SCRA 5FPZA 3SH5A 1V9U2 1ASJ3 1R1A2 4ISRA 1NCQC 1O5UA 1OXCA 1YI9A 3GYDA 4QHOA 1YFUA 1PMJX 3E97A 4LKFA 1AL21 4JTOA 4XQ4A 1XNKA 3ZFEB 3WDVA 4R9DA 5I0RA 1JZ5A 4NRQA 2RE9A 2D43A 3RZLA 1TNFA 3ZR6A 1UCXA 3ZFEA 2XL9A 2XOMA 5GLTA 2Q4SA 5A7WB 4HK8A 4A42A 4EWEA 1EAH1 1RUJ1 1LOCA 1MZEA 1W6QA 4HVRA 3I2JA 1RUI1 2GC2A 2GNTA 3BVCA 5A7WA 1OT5A 3HVDA 4FI9A 2VE1A 2ZEZA 3WW3A 4QPYA 3J8F2 3OCPA 4QMAA 2PFWA 1T2XA 4ZU7A 4W65A 4AF9A 4UW6A 2WS91 4L8QA 4EE2A 5IVJA 3VD9A 5DDJ1 1SHWB 5FO7B 1CAXA 4XCAA 4UFIA 1RJ8A 1WA6X 3I2OA 5F1RA 2IXHA 1UOGA 1RL3A 3HWJA 1S0DA 1R083 3E1F1 4DB5A 2Q30A 3EQEA 2IVIB 4LBKA 1H0BA 4TXWA 4BQ5A 5SV8A 2GN3A 2PHRA 4ZONA 5FMCA 4BM8A 5L9VA 1B35A 1EUUA 1HXS2 1HRI2 5FZBA 5A7QA 2RS53 2BVVA 1SBFA 4HKWA 3AP4A 5AFBA 5A70A 1FPN1 2Q8EA 3BTZA 1JTZX 1UU4A 2EIDA 2GDFA 2BPA2 2W1SA 4KMQA 2WWJA 4QDSA 4EJRA 1UU6A 2KM2A 1R1A3 1UY2A 1G9CA 1RUG1 2YUEA 2PHWA 2R042 2Y34A 4K21A 5BPXA 4EN0A 2R6QA 3F2ZA 1UYXA 1LENA 4IERA 1W06A 4MHUA 4AXOA 4EN9B 2IXJA 2IFWA 1LHWA 3BB6A 3FE5A 3GJAA 1ZRRA 4PI0A 3LEMA 5FPLA 3WP4A 4NIAA 4P9IA 4SLIA 2VOVA 2PELA 3RGBA 2CYFA 3WVJA 4QKDA 2ZAHA 1OUXA 1Q56A 3OD0A 3ZKUA 3SCGA 4QD2A 4AI0A 2O8OA 1U0AA 1OOPA 2QQKA 2XBO1 1KFUL 2B42B 1GKBA 1L3JA 2PLV1 5BNPC 2ZX1A 1KXGA 4BA6A 4BXSV 2VNGA 1X50A 3BKZA 1D2QA 4B3NA 1F31A 4OMCA 3K75B 3LOBA 5HCAA 1N1YA 1PK6A 2XONA 3C2UA 3H1YA 3ZYFA 2Q8CA 1W8WA 3ILRA 3AMHA 3IAQA 3PTYA 4FT8A 4YM3A 2BFUS 2WWSA 3J4UH 4CEWB 4WM8B 5GALA 2V5DA 3K3NA 4UOJA 3VDDA 4AVBA 2O8QA 1DGWX 2A3XA 2VU9A 3BPZA 3ES4A 3DYOA 2WAOA 1YQ5A 2UU8A 2ZZJA 3JQXA 3POSA 4LKDA 5HI0A 1DQ1A 1AR62 1R64A 2VXRA 3U0ZA 1S0BA 2GU9A 4XF3A 1UQXA 1ZVFA 4LXLA 1NYWA 3UKNA 4PLMA 2GP5A 2C26A 4XF1A 4CDXB 2R043 5L36A 4QGLA 4FPKA 2JJ6A 2VMFA 3H3UA 4CDXA 4FFIA 5C4WC 1RYYA 2Y8KA 3CKHA 4NAOA 1STMA 2DUQA 1C8M2 1Y7BA 4CDWB 2ET7A 3CO2A 5FZ7A 2VC9A 1WCQA 1OLME 2ADDA 4DEQA 3NO8A 1Q8PA 3MW2A 1ENSA 4RFRB 1VRH1 5GLVA 2YZ4A 3HD8B 4B1MA 4NRPA 4NPMA 5EV7A 4DEVA 4P02B 5JI9A 4BCUA 4FPCA 1REFA 1GNZA 3VDCA 1WW6A 2W94A 1GZTA 3FBMA 1QJX1 5F2SA 2DWRA 4OYUA 3IDBB 1NZCA 5FMOL 2XUMA 3HT1A 2BWAA 5A3WA 1BMV1 2E7TA 3SCHA 4AEDC 5CFDC 2R49A 2TUNA 5C8CC 2ZMKA 4XFGA 1MS9A 4LE4A 4B7EA 4DS0A 4MG2A 3T0DA 2JDAA 4XJ8A 2ARCA 4JRLA 1GUIA 2HWC2 1A6CA 3LCPA 3HMYA 1ULCA 1AR63 2HWE2 3N9LA 1EP0A 2VQTA 3SKJE 1J3PA 2XJQA 4COWA 2D6MA 1RJ7A 1W90A 2TBVA 4TYSA 5FLIA 4BQYA 4RQPB 1S0CA 2VO5A 2WO2A 3KZ4C 2YC4A 2C9KA 1DGRA 2ZPXA 4RQPA 2R061 2ORZA 1QJY3 2WNOA 3BODA 3IIIA 1CGPA 4NPLA 4AFDA 4PBPA 1DQ6A 4Y5Z0 2RDRA 1L7QA 3CF6E 5C33A 1XQNA 1SDDB 1VAKA 3MF9A 2FDKA 4RS5B 2V4AA 1VP6A 1LGCA 2RM23 4XZPA 3FHQA 3CMGA 4AEMA 1SMVA 2VOWA 2IFRA 1SLAA 2LTNA 1ULOA 1BVP1 4N43B 3H1WA 5BNNC 5CKNA 4ZS3A 4BDVB 1PIV3 2EAKA 3JQWA 1DQ5A 2BJSA 5DG1A 4YW4A 1OVSA 4D6QA 2JG9B 2K46A 4YFZA 3MUZ1 5JOZA 4AW7A 1NY72 3LDKA 2X05A 1X82A 5C3PA 2D7FA 2DU1A 3T4VA 4OULA 4BQ1A 4L99A 4XURA 1H8TB 3KF3A 3USSA 1I5PA 1VBE1 1XRUA 3OPWA 4JCKA 3E5QA 5DMYA 1K45A 2QQPA 1H8TA 3I59B 1B35C 4R4XA 1NLSA 3KS7A 5GLUA 3VBOB 2RMU1 3UYJA 1VAMA 2VMCA 3DYPA 4UAPA 3JD72 2HWC3 1YIPA 4Q0VA 3VBOA 1JOBA 3LEIA 2HWE3 2ENRA 1V00A 4EZ4A 4B4PA 3ZXDA 4Q4X1 5CBLA 2BGPA 1DLCA 3OBTA 2W91A 5JAXA 3WQBA 1VIWB 2HWD1 1X8MA 3FBYA 3AFGA 4IEYA 2OVUA 2VOXA 5A7OA 4HL0A 4XBNA 3RYRA 1LHVA 3UGFA 4BISA 3G6JB 4MXVA 5FIXA 5FXVA 3PDQA 2CSGA 4HMZA 3NVCA 3ZXFA 1TME2 2D3PA 5FWJA 4RFT0 5FXXA 1XE8A 2YFUA 2DYCA 1PVC2 1OOPC 3FHIB 3JU9A 3BN6A 1UAIA 4Y22A 2B46X 3O0XA 3T4HB 5CISA 2FCTA 2HWB2 3MIEA 4RHV3 1QJU1 2GSYA 1PZ7A 4XACA 3PL0A 3BTXA 1RUD1 1PK6C 1VRH2 3DV8A 4YW5A 4Y20B 3AKPA 1RTVA 2ORXA 4OVEA 2SBAA 5ERLA 5FPVA 4YW7A 4A7KA 3N7JA 4C0HA 4R9BA 1RMU1 3ZYBA 4CXWA 3KGLA 3KCCA 5F9TA 5KHGA 3RQ0A 3VDDC 1GYKA 1J58A 1JUHA 1O8SA 2C5DA 1LOBA 4PI2A 4D7SA 2W39A 3JD73 1ZBA1 3A4UA 3MBWA 4OZOA 3VKOA 1PO12 1GR3A 5FOBB 4UWDA 4MXWB 1GNHA 4YVWC 2ET1A 2AZ5A 3WG4A 4NWVA 5A6ZA 1F4AA 2OS2A 1RB8G 2GNDA 3ETPA 4HN0A 3OYWB 3WXPA 3VGIA 3N3HA 4U2AA 5FY1A 3OYWA 1QU0A 3R4SA 4LO7A 1D4VB 3FFZA 3POWA 4XXAA 2ZCWA 3ME2A 3VUOA 3O1TA 3ROUA 3GHMA 3IAPA 1SEFA 5KXEA 3W21A 2WQ8A 3DF0A 1W8UA 4QXKA 5EZWA 3TEWA 2WNVB 5T5LA 3T1MA 1VMFA 2VOTA 1W28A 5JR7B 3TWIA 3LD8A 1J83A 3H50A 2WNVA 1V6IA 3C7EA 3MLJA 1ENXA 1VBB1 1WA4A 3O0VA 3ZFGB 2ZGNA 2JX9A 1RXFA 5D8AC 3FFQA 4IEOA 4Q4V2 1ULGA 5EP9A 2DFBA 1SLBA 3LWCA 4QKNA 5DABA 3IKWA 4LQRA 1E5RA 1NA1A 2NN8A 3AZYA 1S0JA 2RJKA 1C4RA 1XU2A 3I3EA 3TN92 2J42A 4CXXA 4COUA 1HB3A 2ZZQA 2AREA 2FDJA 1DDLA 1HV0A 2W5FA 1Z7S2 3ZMOA 1VBA2 3VBFC 2VUCA 1KITA 2LS6A 2W92A 5K8SA 1UMHA 2IXIA 3NJZA 3NNGA 4N90A 1A8MA 5E8AA 3OBZA 4UYBA 3N9MA 2XVLA 3KWVA 1MZFA 1Y3TA 2FZ2A 2EA7A 4CTEA 4BYYA 4TN7A 2JKBA 4QXHA 5LK7B 4LOTA 3I3BA 3ZIXA 2XB6C 4AE2A 5BUVA 1X8EA 4NHMA 5JIAA 4CEYA 2VJXA 1RUE3 4QQ2A 4R4ZA 3AP6A 5LA1A 4Z8BA 5DXDA 1JBCA 1FI2A 4QX8A 2WUHA 1C28A 5E1RA 4ZZ5A 2WNUA 1WMDA 2WFF2 3I8TA 2I07B 4NHYA 2E63A 1S0GA 3I2FA 5IWFA 4K8RB 2Q8OA 5FYZA 1H30A 1W2TA 3VZKA 1KJRA 2VTXA 3U10A 1SFYA 4CUBA 1PGW1 3IM0A 4XE9A 3T09A 2XJSA 4TWTA 3RFRA 1AR92 2Q1FA 3OBRA 5DAWA 1KJLA 1OPOA 5CKQA 1ZZ9A 1W8TA 2OZ6A 3ALQA 3O12A 5FZFA 4BQWA 1GU3A 3N4MA 4CP0A 3TN93 2VQUA 4IGPA 3IPVB 3MIFA 4Z1VA 2HBUA 1CESA 3L2YA 2ZACA 4P9XA 5KBFA 2PHDA 3IPVA 1FNYA 3B9IA 1VBA3 5CZKA 2XPJA 1O8PA 4PF5A 2ZX3A 3VV1A 5LASA 2JE8A 1AJKA 2Y0IA 5DN2A 1O3TA 3C7OA 2VQAA 1UKGA 3S5AA 3KVBA 1C5HA 3VBUC 3ZLIA 3ZYJB 5ACA1 3BI3A 3S57A 1CX1A 4LO5B 3TB0A 3WDWA 5IVFA 5G05L 2YG0A 3A23A 1FYUA 3KHBA 2VGDA 5JZGA 3PU3A 1WLDA 1OHFA 3FC0A 2VZ1A 1AYM1 4LK7A 3VBSC 3MW4A 3CJIA 2J22A 3VBHC 1HKDA 1QWRA 5D1IA 4XETA 4Q1RA 2O1QA 1LEMA 1CX4A 5JMOA 1IPKA 4K8FA 4K40A 1RXGA 3IZOA 4LO6B 4WVMB 5C70A 1MACA 1LU2A 2WFF3 4GMP1 2AACA 4CU7A 2GAUA 5A1FA 2QUOA 1BBT2 1H8VA 1W9TA 4Q4Y1 3FN9A 4BB3A 1YJLA 1JYXA 1F9KA 5J1XA 3KV6A 1OA2A 3N7MA 4GALA 3MPBA 4EWAA 3O0WA 2R30A 5F2WA 2XXZA 1AR93 3UKVA 2V73A 1IPSA 2D3RA 2AENA 3E6CC 1RITA 5DAPA 2BTVC 3S5QA 1QF3A 4MOAA 4P9GA 4E2GA 2EXJA 4UT5A 4KWJA 2E9QA 4KL1A 4OZXA 1W9FA 1QQP3 2DBIA 3GNEA 3KMHA 3KT7A 4FP3A 3POIA 2J1VA 2DTYA 4CCNA 4OUMA 4XVHA 5KC5A 2BVBA 1S1AA 5GJ6A 2GMMA 4K1ZA 4XPVA 1VJ2A 3FLRA 2IZWA 3EXUA 4P5YA 4CCMA 3AC0A 4LBQB 2AEZA 2G9GA 4IE7A 4CCKA 3ZSLA 2R072 5L7OC 2YPDA 1HRV2 3KCXA 5FYBA 4QGNA 2WZR2 4ES8A 1O5LA 3HBZA 4Q8KA 4BQ3A 3D0JA 3ZYIB 4AQ6A 1GP6A 1KQRA 1ZNPA 3VBRA 4FTBA 3AP5A 2PQSA 3O1PA 4IE5A 3W9AA 4O61A 4BK5A 1BZWA 3WX5A 2E7AA 2CTVA 3PIJA 1WZXA 4AG4A 2BDRA 4GWNA 1D7PM 2Y6FA 4M3CE 1ZZ6A 5GLZA 3E6BA 1CPMA 1K5MA 2DU0A 3EYPA 3RMYA 1JZ2A 2VZRA 4Y4RA 5HPOA 5ISLA 2C0ZA 4NHLA 1PMHX 4A7ZA 1N1SA 4XUQA 5IK4A 5LK5A 4TLGA 3W59A 1SBEA 1VMJA 3H8XA 5E89A 1NA1C 1WBFA 2ZEWA 2E26A 5AVAA 1O3QA 1LCLA 3ZN4A 1MQTA 4XCBA 4MADA 3O1MA 2MEV2 4DUVA 1UZYA 2QDNA 4Q0SA 2BGOA 1Y9QA 4WM7B 1J1TA 4L92A 4CDUA 4PQQA 4P9YA 4YGBA 5AC92 1ASJ1 4WM7A 4YM1A 5FZOB 3T2TA 1G9FA 4OFGA 4DXZA 5CFCA 1JZ6A 2G9ZA 3U4SA 5FZOA 1W9YA 5JUVA 2IVJA 2W1WA 5LA9A 1UN1A 4QQPA 1EV12 1HRV3 3ZVXA 2D6PA 1VBC1 4LA2A 4QB1A 1UXZA 4CCOA 1QHDA 1J1LA 5FKBA 3RPQA 4XC9A 4CEYC 4LITA 1JZ4A 3GCXA 4JTNA 4JAAA 1GICA 1PGSA 1XSQA 3I3DA 4HVQA 5CADA 1RUC1 4LNVA 4Y33A 3WNMA 1E57A 2WNUC 2P6HA 3WNLA 1GV9A 1PZ9A 4FFGA 4ASMB 1UXXX 3AVRA 4B4RA 1DG6A 1RGSA 2J1RA 3V64A 4E8CA 3OSDA 4S2DA 2PYTA 5FBZA 4DO0A 5LA0A 1X36A 1V6LA 3JUUA 1OKQA 1Y4WA 5A1AA 2D93A 5L19A 4XILA 4DMIA 4FPFA 3UESA 1CAVA 1AR81 1H1IA 2W47A 1WLWA 3FZ3A 3I4IA 5F6KA 5FY8A 5A7NA 4AQTA 2H0VA 5FMBA 5C8WA 1AXKA 2RS51 1WMXA 2D6NA 4Q4W3 5A32A 5JOXA 2MEV3 2VZSA 3HEIA 5JSOA 2AGSA 4B7KA 3PIGA 3PU8A 5FZGA 3J7NA 4O7XA 3J26N 3MDPA 3TNQA 1DZRA 2RR12 5AC93 2ZTNA 4AGVA 4NIHA 3WV6A 1XE0A 1ONAA 1S2KA 3DXUA 2VCCA 3ZFFA 1KDMA 1U5YA 5GZEA 3K77A 1POQA 3GF6A 1H2KA 3J9SA 5JZGC 2YU1A 5FWEA 2DVGA 1DZQA 2V72A 3HQRA 3M1HA 2CGPA 2DBNA 3HIFA 4RGAA 4XF0A 4A45A 4E4DX 2GNBA 1IGOA 1DYPA 3B7MA 4MX3A 4XFHA 4G9SB 3SKVA 4AAXA 3CJIC 4C90A 4Z92B 2WT0A 1AJOA 5FZLA 4CEWA 2R0HA 2BNOA 1IHMA 1CVNA 2X5IC 1XNBA 2NMOA 1F15A 1X9PA 2XLGA 2XJUA 4CDQB 3O1VA 3FX3A 2FBEA 3W5NA 3MO4A 1CIYA 3JBG2 2QQVA 1H6XA 2VBBA 4LBOA 1UYPA 2ZEYA 4I0WB 4M4RA 2B4KA 2FHRA 4YFWA 3LSEA 4RR3C 4C8DA 4Y3OA 3CEWA 1A78A 3HOBA 1LOFC 1O4TA 2A6XA 1LOGA 2AC1A 2BU9A 3QD6A 2NM1A 4K1YA 1SCSA 3R0RA 3T1LA 4AFCA 4KWLA 2YXSA 5KWRA 5F5IA 3NSTA 1CQ9A 2YMZA 3PURA 4QDQA 1I1EA 1LJ7A 4J6GA 1ND2C 3O5SA 1H2NA 3JB4C 3WG1A 2VUDA 3LSDA 1AX1A 3EBRA 3M4FA 4RYDA 1NLRA 3A21A 4WVZA 5A33A 2WJSA 2HWF2 2WINB 2RR13 2HBTA 4LHNA 4GXLA 3VDAA 1JOPA 4JHTA 4XFFA 3KGZA 2RS31 1POV1 1UOBA 2JG8B 2YBSA 3EB7A 3QLQA 4QB2A 2CDOA 3THPA 3ZYGA 3K46A 4XXPA 2DFCA 1BXHA 2VNVA 3TAYA 1OLMA 2PAKA 4N7UA 4IDZA 3RZHA 3I49A 3N9PA 2FDFA 3KD4A 3AYEA 1KS4A 4KH9A 2V5YA 4NIGA 5K0UB 4YGEA 3VBRC 2ES3A 2GC3A 1TMF1 2WLPA 3KV9A 3GGLA 3OUHA 4I30A 2PHXA 4LLOA 3H7JA 4LUKA 2FCVA 4CCCA 5I0TA 2WA3A 3N9OA 1NCRA 3JBG3 3NKGA 4QPGC 3UKTA 3ZKYA 1US2A 3RZMA 2C9AA 1K5MC 4IEUA 5FV3A 4O9EA 1LU1A 4E4HA 4E9KA 5T50A 4EYUA 5JXGA 1SACA 2JWPA 3D82A 4GB32 4QQOA 3BTAA 4JDOA 4HPKA 1V6NA 2Y6KA 2FCUA 3OBAA 5CFDB 3WR0A 1AF9A 1MQTC 1UNBA 1ZZ7A 1GZWB 2AEYA 2XMLA 1COV2 4H7MA 3WNXA 2XR4A 5FP3A 4CDUC 2WN2A 5FR3A 3LE0A 4QHZA 4WVVA 1JZ8A 4XTPA 3ST7A 1K42A 1SQ4A 5CFCC 5GKAC 1NXMA 4MV2A 4D8MA 1JYIA 2DCYA 5IK5A 5JCTA 1OD5A 3PJYA 4XFIA 4L11A 4BH9A 3M3IA 3I2IA 2XJVA 1OPMA 1QJY1 3QACA 2DVBA 2WQ4A 3FHAA 4HK9A 4CCJA 1PGL1 5FP8A 1LECA 1KRIA 2GNMA 4YLZA 4QPIB 1W3VA 3FUQA 1SBDA 1XBFA 4Y26A 5I91A 2JDUA 2A7AA 1AR73 3V56A 1S0EA 2RM21 5D21A 3AZVA 4GH4C 5KHHA 3ZDVA 5FZDA 2VAUA 4KG0A 1JU4A 1UZZA 2WR9A 3NRUA 2WYFA 4META 3SQOA 2ILMA 4XHBA 1WBLA 1W03A 4BXFA 3EMRA 1PIV1 3JCIA 4Y1XA 1IPJA 3DKQA 1H2LA 1ZZBA 3SC7X 5ABJB 2VW0A 2QNKA 5IVEA 1BK0A 2OXBA 2YHJA 5C9AB 1DYKA 1V9U3 3VD3A 4GIQA 1VLNA 1HN1A 1MZ6A 3QH6A 1J3QA 1H4GA 2WWUA 4HT1T 4NVPA 2QDRA 3IDCB 1UWWA 3T3YA 4AL9A 4TZDA 1JYTA 3NQHA 2D98A 4LUMA 4JGYB 3E6DA 3PUHA 2JXAA 2YGLA 3WP5A 4JGZC 4JGYA 1NZIA 5FZEA 1OA4A 1ACCA 4ARYA 3ZFFC 1YXWA 4BIFA 1D4M1 1FX5A 3B5LB 4AVSA 3J8F3 3RI8A 1H6YA 5A6YA 3WHTA 2DDUA 3VKNA 3IWZA 3OTFA 4IEXA 5FUIA 3POYA 2AUYA 3FJSA 2DVDA 5E88A 2LW8A 3HN3A 5EYXA 1OUSA 2A6WA 3P1IA 1UIJA 1UZWA 3OB8A 3C8XA 4UXAA 5FJKA 1OQEA 5K4LA 4MGIE 4KBBA 4XJWA 4QX5A 4ORFA 2JB8A 1MS1A 2ARAA 2B39A 1GQPA 1U12A 1YHFA 2MPFA 1LB2A 3WDYA 1ULPA 3POJA 1LHNA 2Y38A 2ZMNA 4JDNA 4QDRA 1W2OA 2JDMA 5IK8A 1HXS3 4RD7A 3VZJA 1HRI3 4ET7A 4RHV1 4FQ4A 5E16A 2Q1MA 3T2PA 4WM8A 4TTGA 2Y6HA 1VMHA 5AVPA 4AI9A 5T5JA 2IXLA 3L2HA 1RHI2 2NPIA 3ZXGA 2DVFA 3UGHA 2ZGKA 1GOGA 4BQ4A 4FOWA 1PO21 3E5UA 2PHLA 3RYPA 2X29A 1T6BX 3KT4A 4CCLA 5FPAA 5HBAA 3LQCA 4IE0A 4YVSB 1UYYA 3POBA 5KC6A 3O1OA 4IL7A 3A22A 2HEWF 4KU8A 4YSFA 5IVBA 1W8HA 4GMP0 1AL22 5KXCA 1VE0A 4E4ZA 1M4WA 2RJLA 4HVOA 4UFMA 4XUPA 3RWKX 4CDWA 3V65A 4N53B 5IVYA 2IUWA 4IXLA 5FUPA 4QB6A 5F8PA 5LRSA 4DRRA 2B5HA 1EAH2 1RUJ2 2H0BA 3NWKA 4I3PA 2VG9A 1RUI2 4OLLA 1A3KA 1RC6A 5KHJA 3WT3A 4UW3A 2ZBJA 4HFSA 5HCFA 1VPHA 4ZS2A 2WS92 1RUH1 1H4HA 3GM8A 5DDJ2 4IUGA 5FYCA 1Z0HA 1ND3C 4FXGB 3ZMNA 1UYZA 2WRAA 2VNRA 4IV1B 2WSVA 3C7FA 1DGLA 2DF7A 1NCRC 2XUEA 4BU2A 3V0AA 2W2IA 4IV1A 3JXSA 4BK4A 2PHTA 4BLIA 3CIHA 2EXKA 1E5HA 5FRAA 1XXNA 3J7MA 1OH4A 4FPYA 5JPNB 4LBJA 2VW1A 4NAMA 1SPPB 1GWKA 4C0BA 1ZREA 1RHI3 4Q2FA 1PZ8A 4OCTA 1V0AA 3RZZA 4XW3A 3NJVA 1NQJA 1FPN2 2WA4A 3SHRA 4NIIA 5KXBA 3NMBA 1KDKA 3WW2A 4P9LA 2Z69A 5CEHA 2BNMA 3ZFEC 1RUG2 2VCBA 5FYTA 1JOJA 1C8M3 2BFUL 2PTMA 1K3IA 4YW6A 1ZZ8A 4AVVA 3I3MA 2YC2A 1ENRA 2R1DA 4DINB 5T3NA 4MGZE 3OEBA 4MSVA 3WP6A 3D0SA 1NAEA 2QKDA 1NKGA 4O65A 1W8ZA 3J7LA 1W8OA 3EJKA 2BGCA 1W2NA 2WDBA 4XJAA 4ZZ8A 4GQ7A 4RS5A 3R4UA 5JXJA 1PNGA 2QQWA 1MEC1 1BHGA 5BV6A 1RUI3 2E32A 1DQ0A 4JDMA 1CPNA 1V6KA 2J1UA 4N43A 4S2GA 2G4IA 2XBO2 5H9PA 2Z4FA 4BJ0A 2PLV2 1ZYBA 1ODMA 1RUE1 3RZJA 2WZEA 3USUB 1XU1A 3GZEA 5SV5A 3AKQA 2WS93 2JG9A 4XIKA 5FZ0A 4XFCA 3ZSMA 3N7KA 3USUA 3GXUA 2JEMA 1OLRA 1QKQA 2VH9A 3Q9OA 3TRSB 4EQVA 3I59A 4XUOA 2A6VA 5LWBA 2CAUA 3CU7A 3K2OA 1K5JA 5FPUA 5DG2A 1M06G 2BWCA 3U75A 1SDWA 1CN1A 3O14A 1N1TA 1APNA 1FPN3 3GJBA 3KSCA 4IV3B 1AYN1 1G7YA 1R1ZA 2LROA 4HXCA 1O91A 3AP7A 4D3WA 2ZGLA 3LIGA 3V0BB 4JC1A 2EIEA 3RG0A 4RL7A 5IUQA 1RUG3 3PTRB 4UFLA 2WT2A 3V0BA 5F3EA 2Y6JA 4K3UA 2IXKA 3EHKA 1RUF1 4G3YC 3CNAA 1SLTA 4FP2A 4MO3M 1GOFA 4QX1A 3W58A 2JICA 3O7OA 1UZVA 1US3A 5T5PA 5FZ8A 2NMNA 5DAQA 2VCMA 4PCRA 1UKRA 4XFAA 3IMMA 1IQDC 2VUAA 1LEDA 5IVCA 1JI6A 3K4ZA 4GJZA 2XBO3 4D0QA 1MS8A 5BNOB 4X8PA 1ZRFA 1F8VA 4XAAA 4B8EA 1KEXA 4LOSA 4OHXA 3VBSB 1O4ZA 1QDCA 1FOD1 4Y20A 5M0TA 2QZ3A 2W3JA 2XH6A 3HPNA 4ARXA 1QJX2 3POGA 1Z78A 3W5MA 5HCHA 1U5ZA 1VB2A 2EXHA 1S2BA 2JE9A 1BMV2 1GOHA 1HB2A 3VKFC 2GP3A 3ZPYA 5A3PA 4CEWC 2YBKA 1KGYA 1E5IA 2CU5A 2O14A 4V2VA 4WM8C 5A3MA 5I8TA 1JYCA 4N9HA 5FBJA 4PDWB 4M01A 1Y9MA 4YGCA 5CKMA 1AX0A 3RDIA 2Q0AA 5F39A 3BYWA 5IK7A 3M2MA 1CZSA 3N7LA 4MXWA 4JQRA 3CDZB 3NNFA 5LBEA 4KG8A 2D97A 5GZFA 3D5OA 1QQP1 4K7JA 2QVSB 1YRZA 3Q8EA 4KI5M 4CDXC 1LGNA 5EFUA 1BJQA 3LGRA 3ZSKA 2JIGA 3LFIA 2CWMA 3Q8CA 4IGOA 2R062 4AZZA 4CDWC 1TME3 1C1LA 4D6SA 5IHRA 5FYHA 4M4PA 1PVC3 4IESA 4W6YA 1K12A 3HAGA 3BUCA 3NNMA 4LE3A 3OGVA 4E2SA 4GA9A 4AHWA 4LKEA 2BQPA 4LULA 3VHOA 2R1BA 2HWB3 2W95A 1AUYA 5J96B 5GZCA 4FOQA 1WLTA 1QJFA 2W9XA 1VRH3 1WD3A 1BK1A 3AL6A 3BOPA 4M3CB 3ZFGA 4DRVA 5FY7A 3DECA 1DGWA 4M3CA 4QPWA 1EPZA 1N47A 3AFKA 2YY1A 4AR2A 1QJX3 2VZ3A 4YZ1A 1WKYA 1OMIA 3M3QA 4PIZA 3WZ1A 1POV0 5FK7A 3K4AA 4GJYA 3TYJA 5C5TA 1VBE2 4LR4A 5EXOA 3MIBA 1PO13 4B1LA 1ZM1A 1NXD1 2A71A 3POEA 2RMU2 2JDHA 1OQ1A 3KF5A 1IS3A 3K51A 1W6NB 3NAPB 1F5JA 4C1WA 1W3XA 3MLLA 3OPTA 5AFEA 4AWDA 5C3RA 4RQPC 4AEKA 1WCSA 4Q4X2 1MS0A 1W6NA 1WMEA 2MHFA 2XHKA 3HQXA 3NAPA 4QKFA 3U14A 1ZBE1 5CIRA 1H2MA 5LATA 3S30A 3ZPOA 2BEOA 1UX7A 2HWD2 2W0XA 5DZFA 4Y5TA 3ZX7A 3MW3A 1G9AA 2X10A 2R063 2HH9A 3G7DA 3KCYA 4S2FA 2AYHA 4Q0PA 1OI6A 2HLEA 4QKBA 4RS5C 3WF1A 3M3OA 3SEPA 1QOSA 3WNKA 4ZXKA 1SLCA 3H0OA 2D5HA 2ARBA 2OPKA 4ASLA 4N43C 1WW7A 3RZGA 4EV0A 5EWSA 5C7GA 3LDBA 3D3AA 4Q4V3 3UL2A 2JG9C 3OOXA 2ZKLA 4XBQA 5I8YA 2OUHA 1VBD1 5JIUA 4FTSA 2PAEA 3T0AA 1WLCA 1QJU2 4YRDA 3OGRA 1H8TC 1KS5A 1RUD2 5I8SA 1NG0A 2VVFA 3Q8AA 2OIIA 2FMYA 4DZGA 4GKXA 2W52A 4D7TA 3S7EA 3UV9A 1VBE3 1Z7S3 3VBOC 1XJAA 1YC61 1XE7A 1N3PA 1FT9A 1RMU2 3AZWA 3HR9A 2ZKNA 4ZU5A 2RMU3 3PVBB 5FZMA 1HQWA 2CL2A 2W87A 5BXXA 2OYZA 3UJOA 2QCSB 1ZBA2 3PMEA 4UBGA 3LKJA 5DAXA 4Q4W1 4YGDA 2ZEXA 1HB1A 1DYOA 4OI0A 1PNFA 1YQ2A 1UY0A 1T6GC 4JHZA 2BRTA 1RVF1 2WZPP 2HWD3 3H7YA 2Q5TA 4FPOB 1MVQA 4LJHA 2F17A 2LM3A 5A3LA 1JH5A 1XPWA 4G4FA 5FYMA 1C3HA 1WCDJ 3OY8B 3ES1A 4GWJA 5J7MA 4YG6A 2VMGA 2YDEA 2WC2A 3ITQA 3RWNA 3WNPA 5I0SA 3KQ4B 1L7RA 1W6MB 2QQIA 2FQPA 1BEV1 2A75A 2P34A 4QQLA 5FZCA 1A8DA 4WVMA 1W6MA 2P3JA 1UD1A 2Y6GA 3SMHA 4FPLA 4Q0UA 3T0BA 2VBDA 4NUBA 2KR2A 1FATA 4LK6A 3ACLA 1QJU3 1VBB2 2ZGUA 2RG4A 1CJDA 2X5IB 4XUNA 5FYIA 5ANQA 2P5BA 1RUD3 1HLCA 4GD4A 5IAVA 4DQAA 2ZABA 1OKOA 1OC1A 1XNTA 1Q3EA 1UOFA 4MZUA 1S0IA 2EXIA 4RR3B 1RMU3 2XJRA 1CONA 4J25A 1R091 4YPJA 3QH7A 2OT7A 5FY0A 2RDNA 3WF2A 3ZN6B 4BHPA 1YFWA 4N9IA 1ZBA3 1W39A 1NLQA 4A6OA 3I2KA 1U5XA 5EHDA 1FMD1 3WW1A 3PVNA 4P5HA 2DURA 5GZDA 1IG3A 4LBQA 4RGKA 4CUAA 1C1FA 4X8NA 3AB0A 2V4VA 4ITCA 5IFTA 2EVXA 1XC6A 5DPNA 1BKZA 1LOAA 3DL3A 4FTEA 4S2HA 2VMHA 3K48A 4NWWA 3DPRB 2Z79A 3WSOA 4GAZA 3MFCA 3WOGA 3VD5A 3ZYHA 2GN7A 5T52A 2BERA 2V09A 2J7MA 3DPRA 1JXNA 1WW5A 4I01A 4YZ4A 4AQ2A 4E2QA 2RS11 2VBPA 4Z2WA 1UOJA 2ZGSA 1XSRA 2JENA 4H55A 4KNCA 1BBT3 2Q1ZB 2WNVC 3H8UA 4HONA 4Y1VA 4AI2A 3WD5A 4DOUA 3R4DB 5JSPA 2E53A 3SH3A 2CHHA 2VM9A 3OG2A 5J3UA 4FSJA 4Y1ZA 5CAZA 5DZEA 4LMFA 3ZFGC 1UY4A 2J1AA 3NV3A 4XDOA 4CCDA 2BV4A 3WP3A 4KU7A 2LALA 3RVHA 4IEVA 4QWNA 5FKCA 1UMZA 1VBB3 2IWGB 3CBNA 3AZZA 2J1EA 1PGW2 4QXCA 5F32A 3I7DA 1NE4A 3D4KA 2J1SA 3AJYA 4XIOA 1GFF2 4H14A 1OVPA 4GKYA 4OUSA 2WAAA 1ZA4A 3SITA 4QX7A 4LHKA 5A3TA 5EJ1B 3WINE 3DN7A 4A44A 4YW1A 3FUOA 5IYYA 4NO4A 2UY8A 4AFBA 1GBGA 1NCQB 1XNCA 3HT2A 4HETA 2QBXA 3PUQA 1AHSA 2R073 2VECA 4UW5A 4D94A 4LA3A 1NCQA 3S7IA 3WQ1A 2CY6A 4MH0E 5ACA2 2WZR3 2YBPA 3CHXA 1U5IA 4LEJA 1OFSA 5HV4A 5JSRA 3VB9A 4LT5A 4AVCA 2A3YA 1YI7A 4LO4B 4A6SA 4EROA 1AYM2 4P00B 1GQGA 4DXSA 3MV01 2B9VA 3RMXA 5FCCA 2VZTA 4AVAA 2VW2A 4IGQA 1HB4A 4MYEA 2P3IA 1AXZA 4INDA 1AR71 1OF4A 4HBNA 1R081 1GANA 3IDAA 3MV11 4Q4Y2 4I02A 3H8RA 4TSVA 1ZRDA 3MEPA 4UFKA 3MPPG 4RN5A 1S2EA 2OA2A 4PLOA 5F3GA 4CA9A 4C91A 2FMDA 2D5FA 3LDRA 3OGJA 4FPHA 1WGPA 2PN5A 1ZRCA 3SCFA 5FYUA 4DY3A 3T30A 4LBNA 1EUTA 1CR7A 1V9U1 1R1A1 1PX3A 2VVEA 2I2SA 3BIWE 3CZJA 4L2NA 4W6WA 5LY2A 4MHRA 5F6LB 5FDBA 1SLLA 3BTYA 2OX0A 4XZUG 4Q8LA 1TNRA 1EV13 4LIUA 4GULA 1CIWA 1S4CA 5GZGA 2QQJA 4N8MA 3BPSA 2ZGQA 4DFSA 2B9UA 4MGSA 2ZGOA 3J8F1 3LZZA 1FNZA 4XMIA 3C7HA 3Q8FA 1H9PA 5LCWL 1LTEA 2DVAA 2HYXA 2GZWA 3APBA 3WCSA 4CDQA 5BNPB 2D40A 5FK8A 4UBHA 1J59A 1KFXL 4J1XA 4GMP3 4HSJA 1I6XA 5FZ6A 2JDZA 3H3LA 5CB7A 2NZ9A 2C1FA 5FQ0B 5J09A 2WO1A 3MI8A 4CUGA 1HXS1 1VRBA 1HRI1 3NV4A 4LHSA 3ECQA 4R9AA 3LB9A 2HKXA 4ES9A 1W05A 1ULEA 2JE7A 2JD4A 2Y33A 3I54A 2Q8DA 5H9QA 2P17A 1CD3G 4MVTA 1O3RA 2I45A 3FMGA 5LBBA 4W8JA 3NV2A 3U78A 2I74A 2A1XA 2R041 3GCWA 4HZFA 1VAVA 3KHCA 2JDPA 2QQMA 2WKKA 4HN1A 1ASJ2 4XUTA 2XKOA 2GALA 2VD7A 2JG8A 3I2HA 1S55A 5FFOC 4OI1A 1YQ6A 1RUOA 3MUY1 2C6SA 4HG6B 1Q5OA 2Y60A 4QX3A 4W4ZA 5C4WB 1YCIA 4CPBA 2ZX4A 3ZXJA 4CP9B 2CNAA 5C4WA 4OQ9A 1TE1B 1VBC2 4OUEA 2UWBA 1GQHA 5C6CA 3GZUC 4CP9A 5K0UA 3AKRA 2C24A 3IBMA 3I2GA 4YNIA 3PJQA 1LHOA 4X6RB 2DCJA 4H2AA 1CAWB 2E31A 1O6UA 3AMQA 4BMBA 1RUC2 2QZ2A 3WHUA 3AYAA 1SG3A 5FZ1A 1UU5A 1W0OA 5LW9A 3DKWA 1QDOA 2BNNA 4WVWA 4IQPA 3AZXA 4HOOA 3WG2A 4F83A 3S0MA 3SEEA 4AEDB 5C8CB 1N3QA 4LIVA 1W6PB 1QOOA 5CFDA 4AEDA 4FAHA 1AX2A 3RNSA 2XHNA 1YIFA 5FXZA 5FZHA 1AR61 1AR82 3ACIA 2VTXJ 1GZWA 3A7QA 2HWF3 1TZOA 2RS52 3ILNA 3IB3A 4WM7C 4Z82A 4OHVA 2XWJB 3HNYM 4XHXA 1NUKA 5K9YA 2ZMLA 3WNNA 3H42B 1V6OA 4AI3A 4DPNA 5CG8A 3VL8A 2EICA 5A7PA 4BWOA 4JZRA 2D6OX 3TEXA 1X33A 3NW4A 4UFHA 1C8M1 4QM8A 1BVVA 4FPEA 1ODNA 4CUCA 4I2OA 1DBNA 2ZGTA 3N35A 3M3EA 4QPIA 4E27A 1AVBA 1VBC3 3ELNA 5LB6A 1W6QB 3RS6A 1X9TA 3P5BA 3PNAA 3H8OA 5H9RA 5JMCA 1G6NA 3ASIA 1LGBA 3RI9A 4YG0A 5CVRA 4KWUA 3VL9A 4AI8A 5B4XA 2FZ1A 2WBKA 1QXRA 1RUC3 4V1PA 5BNNB 3OEAA 2FDGA 1CAXB 3N9NA 3S6PA 2KXLA 2WN3A 4ATFA 5BNNA 4QHBA 4SBVA 3ZXLA 4AHXA 4GB33 4GWMA 3QBQA 5ABJA 2P2KA 4IW3A 4AYUA 1UMIA 3ACGA 5B4NA 2BBAA 2K2SA 2CGNA 2QE3A 1D2SA 4EN6B 5C9AA 2ZGPA 1JYVA 3ZDSA 1OSGA 4URTA 1B35B 2HWC1 1XYNA 1COV3 3LAGA 2ID4A 1TG7A 4FVVA 5JPMB 4L97A 4LKSA 2HWE1 1AR83 5CU1A 1JS9A 2HJIA 4JX0A 4Q1PA 4CP2A 4CRQA 2GC1A 1V6JA 1X7NA 4XYXA 5KXDA 4OMDA 3ETQA 4PIXA 4XTMA 4HKLA 2Z42A 5FPBA 1YQCA 5FXWA 4Q27A 4P08A 5HV0A 1FV2A 4BOWA 2OQ7A 1C5IA 3THTA 1UPIA 1LKNA 2B45X 4D69A 3LA3A 3CJXA 1EYBA 1Q8OA 2YROA 1JMUB 2L9LA 3DUIA 2ZAAA 2X8KA 2RS32 3WF0A 2WABA 2ZHLA 3F95A 4MGKE 1UL9A 3H1MA 4ISQA 5FMOS 4OHYA 1J84A 3VZOA 2G1MA 4YW3A 2WIIB 3RZKA 3SISA 3ZIWA 3QCWA 2YB7A 4NRMA 1Q8VA 1OOPB 3KV5A 1DZTA 1GMMA 2K9ZA 4CDQC 4DUWA 2P3KA 2A73B 3GBGA 4YZ3A 1TMF2 4FBFA 1E5SA 1WUVA 5IW0A 4I09A 4BMEA 1NY71 1QJZA 2GMPA 5IT6A 1OF3A 2C4XA 4GWIA 1PK6B 3HN1A 3SXWA 1GWMA 2P37A 3MFAA 3GBFA 5I0UA 5EIYB 4RGGA 4YZ2A 2KA3A 1URXA 2VZQA 5FZAA 2VZPA 4O9GA 4Q5OA 4PIYA 4AVTA 1DP0A 1LODA 4Y24A 3ZXAC 2ZHKA 2A6YA 4U36A 3ACHA 3JD71 2ATFA 1G8WA 2O0OA 4YVSA 4CZSA 5FOJB 4YYOA 5E6HA 3VDDB 3VN4A 1WWYA 5IFPA 3AKTA 1I9RA 4Q0QA 2BOIA 2W1QA 3URFA 3I2DA 1GP4A 2JKXA 4AOCA 5C3OA 3T2QA 2D44A 4AEJA 2GC0A 4YVWB 2AH2A 4N53A 3OPZA 2CV6A 3BU7A 3VZNA 4M3CF 4AFMA 2JG8C 2A3WA 1YO8A 4YVWA 1IOAA 3LOIA 1Y43B 4XF9A 3TNPB 2WT1A 2XJPA 2RS33 1POV3 3C3VA 5APAA 1FXZA 3MF6A 1TME1 4DXTA 1QJY2 5I93A 4PHZA 1PGL2 1PVC1 2MNGA 2P1BA 5FO9B 1SLIA 1W0PA 4DIQA 4EZHA 5K0UC 1V6MA 2UYBA 3P3NA 1Q8SA 2JDYA 5KR7A 1DFQA 4PBOA 1OBNA 2HWB1 3ATGA 3INAA 4LORA 5DUWA 2RM22 1NOVA 1TMF3 5J48A 2QFEA 4BQXA 3MHZA 1PM7A 4IE6A 2BUKA 1PIV2 5D8AB 1SPPA 2HEVF 2QQOA 1LAJA 1EPWA 2BP6A 1UX6A 2UY9A 5D8AA 5FY9A 4CCEA 3VD7A 5JXHA 5GM0A 2NLRA 3IT8A 2F4PA 2HYKA 4A3ZA 1YLLA 4P9WA 1YNAA 4DNYA 3WUDA 2YGMA 3ACFA 3KB5A 3UETA 2H6CA 1PO11 1AL23 5L73A 4CVUA 1UF2C 5B2GB 4V2WA 2FD8A 3BU0A 1LESA 4MLOA 1PM4A 3VBFB 5CYYA 4OI2A 2JDKA 1N3OA 4NE9A 4PJYA 3VBFA 3PHMA 4JKLA 4FQZA 1EAH3 1RUJ3 2EALA 3M8LA 5F3CA 2XGXA 3FL7A 2BOJA 3M70A 5FMDA 4NR1A 3OUJA 3VZLA 4DXRA 3THDA 2VPVA 1D4M2 5F3IA 2JECA 2JD9A 1IKQA 3ZR5A 1IZ3A 5FJHA 1MPXA 4QPIC 4FFHA 4FOYA 4B29A 5DDJ3 3ZXEA 1JYNA 3LEGA 3GDBA 2XL7A 1D0HA 1HIXA 1AXYA 2CAVA 4L9BA 4LBQD 1G9BA 1O4YA 1PX4A 2LUWA 4NHXA 3NL1A 3WDXA 4YARA 1HN0A 5JDBA 4LTAA 2XLAA 3WLUA 2EIGA 2DUOA 4A7YA 4DY5A 3O1UA 1I3HA 5EYYA 5IATA 1IS6A 1ENQA 1QNWA 4Q4V1 4M0HA 4OHWA 2WNEA 1S0FA 1DLLA 4RHV2 2W68A 2YC0A 3DGTA 4JRAA 1OH3A 5ABJC 1VB4A 4ZU4A 2X09A 5C9AC 1Y9GA 3VLBB 3AYDA 3TN91 5A3OA 4E4SA 2PHUA 3R05A 1QMJA 4AK3A 3AX4A 2XVGA 1HX6A 1MS5A 1ZRIA 3PMSA 4IV3A 1JZ3A 4WV8A 1Z7S1 1PO22 1SFPA 2ZA9A 4FXKB 1GP5A 1VBA1 4MGQA 4YM0A 4AHYA 1OQDA 2UWAA 3N9QA 1XNAA 4JGYC 3PVEA 4ONUA 5EQUA 2GH8A 5L9BA 2WL1A 4YG3A 4QU2A 4M00A 4K6BA 3VBUB 3P6BA 3RSJA 2VZVA 4XJZA 3WQ0A 3VBUA 1N1VA 1D4M3 4ZPIA 2XVKA 2PLV3 1J3RA 2VR4A 5BNOA 1W99A 2A70A 5F5QA 3VBHB 3U37A 3OD4A 3BIEA 3MGUA 4XDPA 1IKPA 3K4DA 3VBSA 5J36A 2WFF1 5FP9A 5FYSA 3VBHA 1XYPA 4Y22B 4FPGA 3ZOIA 2VXJA 4AQSA 1RUH2 2ARXA 3U11A 1JYWA 2RVAA 4AGRA 1GLHA 4RSUA 2YPJA 3ILFA 2W08A 1CAUB 1JHNA 1AR91 4A2UA 4PDWA 1QNYA 1CAUA 1QOTA 3M7AA 4Q26A 2RHPA 4FPJA 4A41A 1ST8A 1ZZCA 4YW2A 4E8DA 5KHIA 1ZX5A 1YFYA 1B09A 5EJ3A 3OGSA 3RJRA 4QM9A 2VUJA 4OHZA 4YVSC 3MLKA 2XQRA 4QT6A 1PO23 3BGAA 1CJPA 2A5ZA 1O3SA 2F6BA 2DUPA 4ZXEA 1YQ8A 4CYDA 2E33A 5LEJA 4CP1A 3MYXA 4F7ZA 3MIDA 3LF7A 1OFNA 1IG0A 1JW6A 1JU3A 1QJEA 1UIKA 3I3QA 1V70A 1DF0A 2WYSA 1TQ5A 5F5AA 3FWEA 2ZHMA 4JQTA 5CNAA 3UK9A 1BQPA 4N53C 3JZVA 4HANA 5EPAA 1YWKA 2VMDA 2ZJCA 5L7OB 1H1AA 4WBBA 5A6XA 4KGQA 3KVAA 3GHNA 4FOVA 1BLZA 2NQYA 5L7OA 1MEC2 2CDPA 2JB4A 2R7EB 1HJFA 2WO3A 3PUAA 4NIDA 1TVGA 3L9JT 5FY4A 3HNBM 3NKTA 3VZMA 2Y6LA 1RUNA 3AXDA 3WW4A 1RUE2 1ULFA 2DTWA 4COVA 3O1SA 1HQLA 1QH7A 1BBT1 4IV1C 5C5UA 1RUH3 3OJBA 4KQ7A 1Q43A 4FAGA 3OUIA 4NROA 4K9SA 4MGTA 1G86A 2BBVA 4R9CA 3T08A 4Z2AA 5LEKA 5ANNA 1O59A 3MICA 1AZDA 2D6LX 4QU1A 4K20A 4PT6A 1UPSA 2ZX0A 1SZBA 3AVSA 3U07A 2VTFA 1OURA 4NPRA 1NA1B 4HKOA 1QXJA 5HXMA 1O7FA 1AYN2 1QIQA 3POFA 2VOKA 3HNMA 4DUXA 1QEXA 4XJ9A 3AKSA 3DCQA 1ALYA 1TEIA 2XQXA 3WDTA 4YWAA 4NN0A 1RUF2 4F8AA 2R071 2ZOEB 2FDHA 1HRV1 1NT0A 4JKMA 3DYMA 5F5CA 3WUCA 3E5XA 1DQ4A 2K0GA 2WZR1 3ZSEA 2TNFA 3CZUA 4D6RA 2FDIA 3CQOA 3TEZA 1MS3A 3KQRA 5G04L 5FZ9A 4MUVA 5FUNA 3AM2A 1MEC3 2H6BA 1LHUA 4CEYB 1EY2A 4J1WA 4XFBA 4XAEA 1WMFA 3NJXA 4XF4A 2VULA 3V0AB 3PVOA 2QJVA 5LA2A 3ABZA 2WNUB 5C3SA 4CPBD 2D6KA 1FOD2 2RDQA 3A0KA 1BCXA 2DV9A 3IN9A 3M3CA 4Q29A 4YZ5A 2R32A 4QGMA 2B7YA 5JWPA 4LPLA 1OD3A 2VVDA 3SNMA 4BE3A 3K3OA 3A0NA 4XJUA 4Z07A 1LRHA 3OF1A 1MZ5A 2OW4A 3MIHA 3RYKA 4Q4X3 1UY3A 2MEV1 4I0BA 1IQAA 1ULDA 2PHFA 4IV3C 3BCWA 5DUVA 1W9WA 1GWLA 5A3NA 1HQNA 1UO9A 5JOYA 1AYN3 3WF4A 5AC91 1YJKA 1QQP2 1H9WA 1F5FA 4UFJA 5BNQA 4BPZA 3U1XA 1NQDA 1QY4A 4XOGA 1RUF3 3OY8A 4M0NA 3KV4A 1EV11 4CU6A 2QTWB 4YM2A 3ZYPA 2DCZA 5T55A 3Q8BA 2G19A 2YV8A 5JZGB 1IS5A 5JOWA 2XWBB 2XJTA 5JI7A 2VZOA 2DCTA 1JHJA 1LNSA 4OI4A 2PAMA 2XKPA 3SH4A 3CJIB 5BNOC 3TEYA 1WCKA 2OPWA 3ORJA 4I0AA 2E7QA 2YFZA 1W8NA 2E6VA 2WZ8A 3O1RA 1W2AX 1RIRA 1AL0G 4HSLA 4ZHNA 2W46A 4N7IA 2X5IA 4MGYE 1Q8QA 4RA0A 1P8JA 4BQ2A 4NMIA 1FOD3 2UURA 5FP4A 3RJ2X 5IVVA 3JB8A 2OUJA 3BALA 2CGOA 2VMEA 1MR5A 2ADEA 3AMNA 3CLPA 4PDWC 4RR3A 5EJZB 5JVVA 5LZ6A 3U4XA 2GMEA 4FCAA 3NNJA 1LOFA 1UW8A 3ZSJA 4P9JA 2QQLA 3ZN6A 5DZGA 4FO9A 2Y64A 1GNYA 3NV1A 5BY5A 2NYYA 2QQUA 1ND2B 1JUIA 2IC1A 3MIGA 2VZUA 2RR11 2AR6A 1ND2A 3EO6A 3C7GA 5FZKA 5FLJA 1F4HA 5A7SA 1ZBE2 2B8MA 1WW4A 1QGLA 3H9AA 3VKLA 4QXBA 4HLTA 5DQ0A 5HXVA 1MS4A 2QQNA 3N36A 3P3PA 1F2NA 1W8FA 3B3QE 4IEPA 1REDA 1FV3A 1CZTA 5FZ4A 2WSUA 4UI9L 1LULA 3FLTA 2ZGMA 2N7GA 4EWDA 1GZCA 2CWSA 4XBLA 2Z5WA 2ZGRA 1XYOA 4W6XA 5LBCA 5IAXA 3DXTA 3IDEA 4LHLA 3VBRB 4X6QB 4KBZA 3JBG1 3WG3A 4D7YA 4EN7B 4URAA 4XQDA 1H1MA 3UNPA 3W20A 5DUUA 1VBD2 2A6ZA 5FLHA 4Y4YA 2PMWB 4JKKA 4QPGB 3RRDA 2JIJA 1K5MB 3QOPA 2ERFA 5F37A 4QPGA 1IS4A 1JZ7A 4Y1UA 3VKMA 3WDUA 4CXYA 3VDBA 1REEA 4CU8A 1QXPA 3D6EA 2XG3A 3LPGA 5GLWA 3NNLA 3AXEA 3NAPC 1DCSA 3ENRA 3I97A 1XB9A 5FAXA 5DAVA 1MQTB 5DUXA 2VCAA 1W9SA 3LA2A 1LOEA 2HWF1 2Y0OA 2UYAA 3B02A 1MVEA 3B94A 4R52A 4XDQA 4Q4W2 4IETA 4I3GA 4XMAA 1RINA 3VHRA 3GZTB 4ASKA 4CDUB 3PUIA 4COZA 4F3JA 1ZBE3 1RVF2 5CFCB 4QX0A 1XNDA 4QX2A 3LIHA 3UT0A
chains in the Genus database with same CATH topology
1C8NA 5LRRA 5CA6A 1I5ZA 4BLJA 2R0FA 2WFPA 1WD4A 1BEV2 3B69A 3R6SA 2SLIA 5KHKA 1GSLA 1FAYA 1YFXA 2XLFA 2X53S 4GH4B 5JLVA 2NP0A 1PMIA 2DCKA 3ZN5A 3PLQA 4GH4A 1VBD3 2WLQA 2D3SA 1OA3A 5J37A 2ZX2A 1OLQA 3MZHA 4LO8A 3AK0A 4GB31 4COYA 1NE6A 3D8CA 2HEYF 2EF6A 1W6OB 1W2UA 2UWCA 2YYOA 3VHNA 4C1XA 1W6OA 1CAVB 2VQ0A 4H3WA 1YUDA 1R092 1COV1 3B00A 5A32B 4JVAA 4ZKTB 2VY0A 5ACA3 1FMD2 3X29B 3FLPA 3WCRA 4NHKA 2Z2SB 4JGZB 4AFAA 1SFNA 1DU3D 1RVF3 4IEWA 1AYM3 3ZFFB 4JGZA 4BIOA 3B01A 1HDKA 1HW5A 4R8HA 3AJZA 3H3ZA 3TBDA 3TOJA 3IMNA 3SLIA 4NOTA 2BYVE 5BNPA 2RS12 3VHPA 4A3XA 1BEV3 3AP9A 5BYNA 1DHKB 2EAAA 4Q4Y3 2ETEA 4QQHA 3UJQA 4WZCA 5HCBA 4AHZA 5T54A 3GALA 1DIWA 2ZS6B 5FQ0A 1VALA 1BYHA 4KGGA 1D0GA 1PHMA 4LBLA 3ZXKA 4IEZA 4B4QA 1G9DA 3OGGA 4WZFA 4EN8B 3GBWA 4KWKA 4BZ4A 5FPXA 4UW4A 3ZYRA 1R093 3WQ7A 2VMIA 1DQ2A 2VNOA 4XEZA 3KLSA 4Y1YA 1GZ9A 1LR5A 4IEQA 5J98B 5A33B 1FMD3 3AMMA 2ZHNA 1C57A 5CG9A 3DPRC 3AMPA 4XQWA 3B9CA 4LBMA 4AI1A 1PVXA 3CL1A 5K7PA 3AYCA 5FTTC 5FREA 3LA7A 1CAWA 2RS13 4PLNA 1QH6A 5H9SA 4AGGA 2OZJA 1JN2P 5FO8B 2PA7A 2WQZC 3WY6A 4LLFA 1KD7A 2R16A 4PQ9A 2E51A 3B93A 1AR72 1ND3B 1R082 3ZO0B 1NCRB 1ND3A 2G9FA 5C8CA 3IIAA 4TLFA 1W6PA 3KM5A 2IXCA 3KT1A 1RHI1 2GH2A 1DGRN 4H7LA 4P14A 5TSWA 1HV1A 3BOWA 2TEPA 3GZAA 1YYNA 2Y26A 2PQQA 1VR3A 4ATEA 5T5OA 4HPKB 2BW8A 1SCRA 5FPZA 3SH5A 1V9U2 1ASJ3 1R1A2 4ISRA 1NCQC 1O5UA 1YI9A 3GYDA 1YFUA 3E97A 1AL21 4JTOA 4XQ4A 1XNKA 3ZFEB 3WDVA 4R9DA 5I0RA 2RE9A 2D43A 1TNFA 1UCXA 3ZFEA 2XL9A 5GLTA 2Q4SA 4HK8A 4EWEA 1EAH1 1RUJ1 1LOCA 1MZEA 1W6QA 4HVRA 1RUI1 2GC2A 2GNTA 3WW3A 4QPYA 3J8F2 3OCPA 4QMAA 2PFWA 4ZU7A 4W65A 4AF9A 4UW6A 2WS91 4L8QA 5DDJ1 5FO7B 1CAXA 1RJ8A 5F1RA 2IXHA 1RL3A 3HWJA 1S0DA 1R083 4DB5A 2Q30A 3EQEA 4LBKA 1H0BA 5SV8A 2GN3A 2PHRA 4BM8A 1B35A 1HXS2 1HRI2 2RS53 2BVVA 1SBFA 4HKWA 3AP4A 5AFBA 1FPN1 1JTZX 1UU4A 2GDFA 2BPA2 4EJRA 1UU6A 2KM2A 1R1A3 1G9CA 1RUG1 2YUEA 2PHWA 2R042 4K21A 5BPXA 4EN0A 2R6QA 4EN9B 1LENA 4IERA 4AXOA 2IXJA 2IFWA 1LHWA 3BB6A 3FE5A 3WP4A 1ZRRA 4P9IA 4SLIA 2VOVA 2PELA 2CYFA 3WVJA 2ZAHA 1Q56A 3OD0A 3SCGA 4QD2A 4AI0A 2O8OA 1U0AA 1OOPA 2XBO1 1KFUL 2B42B 1GKBA 1L3JA 2PLV1 5BNPC 2ZX1A 1KXGA 4BA6A 2VNGA 1X50A 1D2QA 4B3NA 1F31A 3LOBA 5HCAA 1N1YA 1PK6A 3C2UA 3H1YA 3PTYA 3ILRA 3AMHA 4FT8A 4YM3A 2BFUS 2WWSA 3J4UH 4CEWB 4WM8B 5GALA 3VDDA 4AVBA 4CEWA 2O8QA 1DGWX 2A3XA 2VU9A 3BPZA 3ES4A 5HI0A 2ZZJA 2UU8A 3JQXA 3POSA 1AR62 1DQ1A 2VXRA 3U0ZA 1S0BA 2GU9A 4XF3A 1ZVFA 1NYWA 3UKNA 4PLMA 4XF1A 4CDXB 2R043 5L36A 4QGLA 4FPKA 2JJ6A 3H3UA 4CDXA 5C4WC 2DUQA 1C8M2 1Y7BA 4CDWB 2ET7A 3CO2A 3NO8A 1Q8PA 3MW2A 1ENSA 1VRH1 5GLVA 2YZ4A 3HD8B 5EV7A 5JI9A 4BCUA 4FPCA 1REFA 1GNZA 1WW6A 3FBMA 1QJX1 2DWRA 3IDBB 1NZCA 5FMOL 2XUMA 3HT1A 2BWAA 1BMV1 2E7TA 3SCHA 4AEDC 5CFDC 2R49A 2TUNA 5C8CC 2ZMKA 4XFGA 1MS9A 4LE4A 4B7EA 4DS0A 4XJ8A 4JRLA 2HWC2 1A6CA 3LCPA 3HMYA 1ULCA 1AR63 2HWE2 1EP0A 2XJQA 1J3PA 4COWA 2D6MA 1RJ7A 2TBVA 4TYSA 5FLIA 4RQPB 1S0CA 3KZ4C 1DGRA 2ZPXA 4RQPA 2R061 1QJY3 3BODA 1CGPA 4AFDA 4PBPA 1DQ6A 4Y5Z0 3CF6E 5C33A 1XQNA 3MF9A 1VAKA 4RS5B 1VP6A 1LGCA 2RM23 4XZPA 4AEMA 1SMVA 2VOWA 2IFRA 1SLAA 2LTNA 1BVP1 4N43B 3H1WA 5BNNC 1PIV3 2EAKA 3JQWA 1DQ5A 5DG1A 4YW4A 2JG9B 4YFZA 5JOZA 4AW7A 1NY72 1X82A 2D7FA 2DU1A 4BQ1A 4OULA 4L99A 1H8TB 3USSA 1VBE1 1XRUA 4JCKA 3E5QA 2QQPA 1H8TA 3I59B 1B35C 4R4XA 1NLSA 3KS7A 5GLUA 3VBOB 2RMU1 1VAMA 3JD72 1YIPA 2HWC3 4Q0VA 3VBOA 2HWE3 2ENRA 1V00A 5CBLA 4B4PA 3ZXDA 4Q4X1 3OBTA 5JAXA 1VIWB 2HWD1 1X8MA 3FBYA 3AFGA 4IEYA 2OVUA 2VOXA 4HL0A 4XBNA 3RYRA 1LHVA 3G6JB 4MXVA 4HMZA 3NVCA 3ZXFA 1TME2 2D3PA 4RFT0 1XE8A 2DYCA 1PVC2 1OOPC 3FHIB 3JU9A 4Y22A 1UAIA 2B46X 3O0XA 2HWB2 3MIEA 4RHV3 1QJU1 2GSYA 1PZ7A 1RUD1 1PK6C 1VRH2 3DV8A 4YW5A 4Y20B 3AKPA 1RTVA 4OVEA 2SBAA 4C0HA 4A7KA 3N7JA 4R9BA 1RMU1 3KGLA 3KCCA 5F9TA 5KHGA 3RQ0A 3VDDC 1GYKA 1J58A 1JUHA 2C5DA 1LOBA 4D7SA 2W39A 3JD73 1ZBA1 3A4UA 3VKOA 1PO12 1GR3A 5FOBB 4MXWB 1GNHA 4YVWC 2ET1A 2AZ5A 3WG4A 4NWVA 1RB8G 2GNDA 4HN0A 3OYWB 3WXPA 3VGIA 3N3HA 4U2AA 3OYWA 1QU0A 3R4SA 4LO7A 1D4VB 3FFZA 3POWA 4XXAA 2ZCWA 3ME2A 3VUOA 3ROUA 3GHMA 1SEFA 5KXEA 3DF0A 4QXKA 5EZWA 2WNVB 5T5LA 3T1MA 5JR7B 3TWIA 3H50A 2WNVA 1V6IA 3MLJA 1ENXA 1VBB1 1WA4A 3O0VA 3ZFGB 2ZGNA 2JX9A 5D8AC 3FFQA 4IEOA 4Q4V2 1ULGA 2DFBA 1SLBA 3LWCA 3IKWA 1NA1A 2NN8A 3AZYA 1S0JA 2RJKA 1C4RA 1XU2A 3TN92 4COUA 2ZZQA 2AREA 1DDLA 1HV0A 1Z7S2 3ZMOA 1VBA2 3VBFC 1KITA 5K8SA 2IXIA 3NJZA 4N90A 1A8MA 5E8AA 2XVLA 1MZFA 1Y3TA 2FZ2A 2EA7A 4CTEA 4BYYA 5LK7B 2JKBA 3ZIXA 2XB6C 4AE2A 5BUVA 1X8EA 4NHMA 5JIAA 4CEYA 1RUE3 4QQ2A 4R4ZA 3AP6A 4Z8BA 5DXDA 1JBCA 1FI2A 1C28A 5E1RA 2WNUA 1WMDA 2WFF2 3I8TA 2I07B 2E63A 1S0GA 2Q8OA 1H30A 3VZKA 1KJRA 3U10A 1SFYA 1PGW1 3IM0A 4XE9A 2XJSA 4TWTA 1AR92 3OBRA 1KJLA 1OPOA 1ZZ9A 2OZ6A 3ALQA 3N4MA 3O12A 4CP0A 3TN93 3IPVB 3MIFA 4Z1VA 1CESA 3L2YA 2ZACA 4P9XA 5KBFA 2PHDA 3IPVA 1FNYA 3B9IA 1VBA3 2XPJA 4PF5A 2ZX3A 3VV1A 1AJKA 2Y0IA 1O3TA 2VQAA 1UKGA 1C5HA 3VBUC 3ZYJB 5ACA1 4LO5B 3TB0A 3WDWA 1FYUA 2VGDA 5JZGA 1WLDA 1OHFA 3FC0A 1AYM1 3VBSC 3MW4A 3CJIA 3VBHC 1HKDA 1QWRA 5D1IA 4XETA 4Q1RA 2O1QA 1LEMA 1CX4A 1IPKA 4K8FA 4K40A 4LO6B 4WVMB 1MACA 1LU2A 2WFF3 4GMP1 2GAUA 2QUOA 1BBT2 1H8VA 4Q4Y1 1YJLA 1F9KA 3N7MA 1OA2A 4GALA 3MPBA 4EWAA 3O0WA 2R30A 1AR93 3UKVA 2V73A 2D3RA 2AENA 3E6CC 1RITA 2BTVC 1QF3A 4P9GA 4E2GA 2EXJA 4KWJA 2E9QA 4KL1A 4OZXA 3GNEA 1QQP3 3KMHA 3KT7A 4FP3A 2DTYA 4OUMA 5KC5A 2BVBA 1S1AA 5GJ6A 2GMMA 4K1ZA 4XPVA 1VJ2A 3FLRA 2IZWA 3EXUA 4LBQB 2G9GA 3ZSLA 2R072 5L7OC 1HRV2 3KCXA 4QGNA 2WZR2 4ES8A 1O5LA 3HBZA 4Q8KA 3D0JA 3ZYIB 4AQ6A 1KQRA 1ZNPA 3VBRA 4FTBA 3AP5A 3W9AA 1BZWA 3WX5A 2E7AA 2CTVA 4AG4A 4GWNA 4M3CE 1ZZ6A 5GLZA 3E6BA 1CPMA 1K5MA 2DU0A 3RMYA 2C0ZA 4NHLA 4A7ZA 1N1SA 5IK4A 5LK5A 3W59A 1SBEA 5E89A 1NA1C 1WBFA 5AVAA 1O3QA 1LCLA 3ZN4A 1MQTA 2MEV2 1UZYA 2QDNA 4Q0SA 1Y9QA 4WM7B 1J1TA 4L92A 4CDUA 4P9YA 4YGBA 5AC92 1ASJ1 4WM7A 4YM1A 3T2TA 4DXZA 1G9FA 4OFGA 5CFCA 1UN1A 4QQPA 1EV12 1HRV3 3ZVXA 2D6PA 1VBC1 4LA2A 1QHDA 1J1LA 3RPQA 4CEYC 4JTNA 4JAAA 1GICA 1PGSA 4HVQA 5CADA 1RUC1 4LNVA 1E57A 2WNUC 1GV9A 1PZ9A 4ASMB 4B4RA 1DG6A 1RGSA 3V64A 4S2DA 2PYTA 5FBZA 1X36A 1V6LA 3JUUA 1OKQA 2D93A 5L19A 4XILA 4DMIA 4FPFA 1CAVA 1AR81 1H1IA 3I4IA 1WLWA 3FZ3A 5F6KA 4AQTA 5C8WA 2H0VA 1AXKA 2RS51 5A32A 2D6NA 4Q4W3 5JOXA 2MEV3 5JSOA 2AGSA 4B7KA 3J26N 3MDPA 3TNQA 1DZRA 2RR12 5AC93 2ZTNA 4AGVA 3WV6A 1ONAA 1S2KA 3ZFFA 1KDMA 1U5YA 5GZEA 3GF6A 1H2KA 3J9SA 5JZGC 2DVGA 1DZQA 3M1HA 2CGPA 4XF0A 3HIFA 4RGAA 4E4DX 2GNBA 1IGOA 1DYPA 3B7MA 4MX3A 4XFHA 4G9SB 4C90A 4Z92B 3CJIC 2WT0A 1AJOA 2R0HA 2BNOA 1IHMA 1CVNA 2X5IC 1XNBA 2NMOA 2XLGA 2XJUA 4CDQB 3FX3A 2FBEA 3JBG2 4LBOA 4I0WB 2FHRA 4YFWA 3LSEA 4RR3C 3CEWA 1A78A 1LOFC 1O4TA 2A6XA 1LOGA 3QD6A 2NM1A 4K1YA 1SCSA 3R0RA 3T1LA 4AFCA 4KWLA 2YXSA 5KWRA 3NSTA 1CQ9A 2YMZA 1I1EA 1LJ7A 4J6GA 1ND2C 3O5SA 1H2NA 3JB4C 3WG1A 3LSDA 1AX1A 3EBRA 3M4FA 4WVZA 1NLRA 5A33A 2WJSA 2HWF2 2WINB 2RR13 4LHNA 4GXLA 4XFFA 3KGZA 2RS31 1POV1 2JG8B 3QLQA 3THPA 3ZYGA 4XXPA 2DFCA 1BXHA 3TAYA 2PAKA 4N7UA 3KD4A 3AYEA 1KS4A 4KH9A 2V5YA 5K0UB 4YGEA 3VBRC 2ES3A 2GC3A 1TMF1 2WLPA 4LUKA 4I30A 4LLOA 2PHXA 3H7JA 5I0TA 2WA3A 1NCRA 3JBG3 3NKGA 4QPGC 3UKTA 2C9AA 1K5MC 4IEUA 4O9EA 1LU1A 4E9KA 5T50A 1SACA 3D82A 4GB32 4QQOA 3BTAA 4JDOA 4HPKA 1V6NA 5CFDB 3WR0A 1AF9A 1MQTC 1ZZ7A 1GZWB 1COV2 4H7MA 3WNXA 4CDUC 4WVVA 4XTPA 3ST7A 1SQ4A 5CFCC 5GKAC 1NXMA 4MV2A 1JYIA 2DCYA 5IK5A 5JCTA 1OD5A 3PJYA 4XFIA 4L11A 4BH9A 3M3IA 2XJVA 1OPMA 1QJY1 3QACA 2DVBA 2WQ4A 1PGL1 4HK9A 1KRIA 1LECA 2GNMA 4YLZA 4QPIB 3FUQA 1SBDA 4Y26A 5I91A 2A7AA 1AR73 3V56A 1S0EA 2RM21 3AZVA 4GH4C 5KHHA 4KG0A 1UZZA 4META 2ILMA 4XHBA 1WBLA 1PIV1 3JCIA 4Y1XA 1IPJA 1H2LA 1ZZBA 5ABJB 2VW0A 2QNKA 2YHJA 5C9AB 1DYKA 1V9U3 4GIQA 1VLNA 1MZ6A 3QH6A 1J3QA 1H4GA 4HT1T 4NVPA 2QDRA 3IDCB 4TZDA 2D98A 4LUMA 4JGYB 3E6DA 2JXAA 2YGLA 3WP5A 4JGZC 4JGYA 1OA4A 3ZFFC 1YXWA 4BIFA 1D4M1 1FX5A 3B5LB 4AVSA 3J8F3 3RI8A 3WHTA 3VKNA 3IWZA 3OTFA 4IEXA 3POYA 2AUYA 3FJSA 2DVDA 5E88A 5EYXA 2A6WA 1UIJA 4UXAA 1OQEA 4MGIE 4KBBA 4XJWA 4QX5A 4ORFA 1MS1A 2B39A 1U12A 1YHFA 2MPFA 1LB2A 3WDYA 1LHNA 2Y38A 2ZMNA 4JDNA 5IK8A 1HXS3 4RD7A 3VZJA 1HRI3 4RHV1 4FQ4A 5E16A 2Q1MA 4WM8A 5AVPA 5T5JA 2IXLA 3L2HA 1RHI2 2NPIA 3ZXGA 2DVFA 2ZGKA 4FOWA 1PO21 3E5UA 2PHLA 3RYPA 2X29A 3KT4A 5HBAA 5KC6A 4YVSB 4IL7A 2HEWF 4KU8A 4YSFA 4GMP0 1AL22 5KXCA 4E4ZA 1M4WA 2RJLA 4HVOA 4CDWA 3V65A 4N53B 4IXLA 5LRSA 4DRRA 2B5HA 1EAH2 1RUJ2 2H0BA 3NWKA 4I3PA 2VG9A 1RUI2 4OLLA 1A3KA 1RC6A 5KHJA 3WT3A 4UW3A 2ZBJA 4HFSA 5HCFA 2WS92 1RUH1 1H4HA 5DDJ2 1Z0HA 1ND3C 4FXGB 3ZMNA 4IV1B 3V0AB 2VNRA 2WSVA 1DGLA 2DF7A 1NCRC 3V0AA 4IV1A 2PHTA 4BLIA 2EXKA 5FRAA 1XXNA 4FPYA 5JPNB 4LBJA 2VW1A 4C0BA 1ZREA 1RHI3 4Q2FA 1PZ8A 3RZZA 4XW3A 1NQJA 1FPN2 2WA4A 3SHRA 5KXBA 1KDKA 3WW2A 4P9LA 2Z69A 2BNMA 3ZFEC 1RUG2 1JOJA 1C8M3 2BFUL 2PTMA 4AVVA 1ZZ8A 1ENRA 2R1DA 4DINB 5T3NA 4MGZE 4MSVA 3WP6A 3D0SA 2QKDA 3EJKA 4XJAA 2BGCA 4GQ7A 4RS5A 3R4UA 1PNGA 1MEC1 5BV6A 1RUI3 1DQ0A 4JDMA 1CPNA 1V6KA 4N43A 4S2GA 2G4IA 2XBO2 5H9PA 2PLV2 1ZYBA 1RUE1 3USUB 1XU1A 5SV5A 3AKQA 2WS93 2JG9A 4XIKA 4XFCA 3ZSMA 3N7KA 3USUA 2JEMA 1OLRA 1QKQA 2VH9A 3Q9OA 3TRSB 3I59A 2A6VA 2CAUA 3CU7A 5DG2A 1M06G 2BWCA 1SDWA 1CN1A 3O14A 1N1TA 1APNA 1FPN3 3KSCA 4IV3B 1AYN1 1G7YA 1R1ZA 1O91A 3AP7A 4D3WA 2ZGLA 3V0BB 4JC1A 3RG0A 4RL7A 5IUQA 1RUG3 2WT2A 3V0BA 4K3UA 2IXKA 3EHKA 1RUF1 4G3YC 3CNAA 1SLTA 4FP2A 3W58A 2JICA 3O7OA 5T5PA 2NMNA 4PCRA 1UKRA 4XFAA 2VUAA 1LEDA 5BNOB 2XBO3 1MS8A 1ZRFA 4X8PA 1F8VA 4B8EA 4OHXA 3VBSB 1O4ZA 1QDCA 1FOD1 4Y20A 2QZ3A 2XH6A 1QJX2 1Z78A 1U5ZA 1VB2A 2EXHA 1S2BA 2JE9A 1BMV2 3ZPYA 3VKFC 4CEWC 4WM8C 5I8TA 5A3MA 1JYCA 4N9HA 4PDWB 4M01A 4YGCA 3RDIA 1AX0A 2Q0AA 5IK7A 3M2MA 3N7LA 4MXWA 4JQRA 4KG8A 2D97A 5GZFA 3D5OA 1QQP1 4K7JA 2QVSB 1YRZA 4CDXC 1LGNA 5EFUA 1BJQA 3LGRA 3ZSKA 2CWMA 2R062 4CDWC 1TME3 1C1LA 1PVC3 4IESA 4W6YA 3HAGA 4E2SA 4LE3A 4GA9A 4AHWA 2BQPA 4LULA 3VHOA 2R1BA 2HWB3 1AUYA 5J96B 5GZCA 4FOQA 1WLTA 1VRH3 1WD3A 1BK1A 3BOPA 4M3CB 4DRVA 3ZFGA 1DGWA 4M3CA 1EPZA 1N47A 3AFKA 2YY1A 1QJX3 4YZ1A 1OMIA 3M3QA 4PIZA 3WZ1A 1POV0 3TYJA 1VBE2 4LR4A 5EXOA 3MIBA 1PO13 1ZM1A 1NXD1 2A71A 2RMU2 1OQ1A 1IS3A 3K51A 1W6NB 3NAPB 1F5JA 4C1WA 3MLLA 5AFEA 4AWDA 4RQPC 4AEKA 1WCSA 4Q4X2 1MS0A 1W6NA 1WMEA 2MHFA 2XHKA 3HQXA 3NAPA 1ZBE1 5CIRA 1H2MA 3S30A 2BEOA 2HWD2 2W0XA 5DZFA 3ZX7A 3MW3A 1G9AA 2R063 3G7DA 3KCYA 4S2FA 2AYHA 4Q0PA 1OI6A 4RS5C 3M3OA 1QOSA 4ZXKA 1SLCA 3H0OA 2D5HA 2ARBA 2OPKA 4ASLA 4N43C 1WW7A 4EV0A 5EWSA 4Q4V3 3UL2A 2JG9C 4XBQA 2ZKLA 5I8YA 5JIUA 2OUHA 1VBD1 4FTSA 2PAEA 1WLCA 1QJU2 4YRDA 1H8TC 1KS5A 1RUD2 5I8SA 1NG0A 2VVFA 2OIIA 2FMYA 4DZGA 4GKXA 2W52A 4D7TA 3S7EA 3UV9A 1VBE3 1Z7S3 3VBOC 1N3PA 1XE7A 1FT9A 1RMU2 3AZWA 3HR9A 2ZKNA 4ZU5A 2RMU3 3PVBB 3UJOA 1HQWA 2CL2A 5BXXA 2OYZA 2QCSB 1ZBA2 3PMEA 4UBGA 3LKJA 4Q4W1 4YGDA 4OI0A 1PNFA 1T6GC 1RVF1 2WZPP 2HWD3 3H7YA 2Q5TA 4FPOB 1MVQA 2LM3A 5A3LA 1JH5A 4G4FA 1C3HA 1WCDJ 3OY8B 3ES1A 5J7MA 4YG6A 2VMGA 2YDEA 2WC2A 3RWNA 5I0SA 1W6MB 2FQPA 1BEV1 2A75A 2P34A 4QQLA 1A8DA 4WVMA 1W6MA 2P3JA 1UD1A 3SMHA 4FPLA 4Q0UA 1FATA 3ACLA 1QJU3 1VBB2 2ZGUA 1CJDA 2X5IB 1RUD3 1HLCA 4DQAA 2ZABA 1Q3EA 4MZUA 1S0IA 2EXIA 4RR3B 1RMU3 2XJRA 1CONA 1R091 3QH7A 3ZN6B 4BHPA 1YFWA 4N9IA 1ZBA3 1W39A 1U5XA 1FMD1 3WW1A 3PVNA 4P5HA 2DURA 5GZDA 4LBQA 1C1FA 4X8NA 3AB0A 4ITCA 2EVXA 1BKZA 1LOAA 3DL3A 4FTEA 4S2HA 2VMHA 3K48A 4NWWA 3DPRB 2Z79A 3MFCA 3WOGA 2GN7A 5T52A 2V09A 3DPRA 4I01A 1JXNA 1WW5A 4YZ4A 4AQ2A 4E2QA 2RS11 4Z2WA 2ZGSA 2JENA 4H55A 4KNCA 1BBT3 2Q1ZB 2WNVC 3H8UA 4AI2A 4Y1VA 3WD5A 4DOUA 3R4DB 5JSPA 2E53A 3SH3A 5J3UA 4FSJA 4Y1ZA 5CAZA 5DZEA 3ZFGC 3NV3A 3WP3A 4KU7A 2LALA 4IEVA 1UMZA 1VBB3 2IWGB 3AZZA 1PGW2 3I7DA 1NE4A 3D4KA 4XIOA 3AJYA 1GFF2 4H14A 4GKYA 4OUSA 1ZA4A 3SITA 4LHKA 3WINE 3DN7A 4YW1A 3FUOA 4NO4A 2UY8A 4AFBA 1GBGA 1NCQB 1XNCA 3HT2A 4HETA 1AHSA 2R073 2VECA 4UW5A 4D94A 4LA3A 1NCQA 3S7IA 3WQ1A 2CY6A 4MH0E 5ACA2 2WZR3 4LEJA 1U5IA 1OFSA 5JSRA 4LT5A 4AVCA 2A3YA 1YI7A 4LO4B 4EROA 1AYM2 1GQGA 3RMXA 5FCCA 4AVAA 2VW2A 4MYEA 2P3IA 1AXZA 4INDA 1AR71 4HBNA 1R081 1GANA 4Q4Y2 4I02A 4TSVA 1ZRDA 3MEPA 3MPPG 2OA2A 4PLOA 4C91A 2FMDA 2D5FA 3OGJA 4FPHA 1WGPA 2PN5A 1ZRCA 3SCFA 4DY3A 4LBNA 1CR7A 1V9U1 1R1A1 2VVEA 2I2SA 3BIWE 4W6WA 4L2NA 5FDBA 5F6LB 1SLLA 4Q8LA 1TNRA 1EV13 4GULA 1CIWA 5GZGA 2ZGQA 4DFSA 2B9UA 2ZGOA 3J8F1 3LZZA 1FNZA 4XMIA 1H9PA 1LTEA 2DVAA 3APBA 2GZWA 3WCSA 4CDQA 5BNPB 2D40A 4UBHA 1J59A 1KFXL 4J1XA 4GMP3 4HSJA 1I6XA 2JDZA 5CB7A 2NZ9A 2C1FA 5FQ0B 5J09A 3MI8A 1HXS1 1HRI1 3NV4A 3ECQA 4R9AA 3LB9A 2HKXA 4ES9A 1ULEA 2JE7A 2JD4A 3I54A 5H9QA 2P17A 1CD3G 4MVTA 1O3RA 2I45A 3FMGA 3NV2A 2I74A 2R041 4HZFA 1VAVA 2WKKA 4HN1A 1ASJ2 2XKOA 2GALA 5FFOC 2JG8A 4OI1A 1S55A 1RUOA 1Q5OA 5C4WB 1YCIA 2ZX4A 3ZXJA 2CNAA 5C4WA 1TE1B 1VBC2 2UWBA 1GQHA 5C6CA 3GZUC 5K0UA 3AKRA 3IBMA 4YNIA 3PJQA 1LHOA 4X6RB 2DCJA 1CAWB 3AMQA 4BMBA 1RUC2 2QZ2A 3WHUA 3AYAA 1UU5A 1W0OA 3DKWA 1QDOA 2BNNA 4WVWA 4IQPA 3AZXA 3WG2A 4F83A 3S0MA 4AEDB 5C8CB 1N3QA 1W6PB 1QOOA 5CFDA 4AEDA 4FAHA 1AX2A 3RNSA 1YIFA 1AR61 1AR82 1GZWA 2HWF3 2RS52 3ILNA 4WM7C 4Z82A 4OHVA 2XWJB 4XHXA 5K9YA 2ZMLA 1V6OA 4AI3A 4DPNA 5CG8A 3VL8A 4BWOA 2D6OX 1X33A 3NW4A 1C8M1 4QM8A 1BVVA 4FPEA 4I2OA 1DBNA 2ZGTA 3N35A 3M3EA 4QPIA 4E27A 1AVBA 1VBC3 3ELNA 3RS6A 1W6QB 3PNAA 5H9RA 5JMCA 1G6NA 3ASIA 1LGBA 3RI9A 4YG0A 5CVRA 3VL9A 4AI8A 2FZ1A 5BNNB 1QXRA 1RUC3 4V1PA 1CAXB 3S6PA 2KXLA 5BNNA 4ATFA 4QHBA 4SBVA 3ZXLA 4AHXA 4GB33 4GWMA 3QBQA 5ABJA 2P2KA 4AYUA 2K2SA 2CGNA 2QE3A 1D2SA 4EN6B 5C9AA 2ZGPA 3ZDSA 1OSGA 4URTA 1B35B 2HWC1 1XYNA 1COV3 3LAGA 5JPMB 4FVVA 4L97A 2HWE1 1AR83 5CU1A 2HJIA 4Q1PA 4CRQA 4CP2A 2GC1A 1V6JA 1X7NA 4XYXA 5KXDA 3ETQA 4PIXA 4XTMA 4HKLA 2Z42A 4Q27A 1FV2A 4BO