3MLJA

Reduced (cu+) peptidylglycine alpha-hydroxylating monooxygenase (phm) with bound carbon monooxide (co)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
310
structure length
310
Chain Sequence
b'ECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-glycine alpha-amidating monooxygenase
publication title Differential reactivity between two copper sites in peptidylglycine alpha-hydroxylating monooxygenase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 68
structure length 310
sequence length 310
ec nomenclature ec 1.14.17.3: Peptidylglycine monooxygenase.
pdb deposition date 2010-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01082 Cu2_monooxygen Copper type II ascorbate-dependent monooxygenase, N-terminal domain
A PF03712 Cu2_monoox_C Copper type II ascorbate-dependent monooxygenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3mljA02
2.60.120.310 Mainly Beta Sandwich Jelly Rolls Copper type II, ascorbate-dependent monooxygenase, N-terminal domain 3mljA01
1PHMA 3MIBA 3PMSA 3MIGA 1PGSA 3PHMA 4E4ZA 3MIHA 3MLKA 1YJKA 1YJLA 3MLJA 3MIDA 3MIFA 1PNFA 3MLLA 4R4XA 3KS7A 1SDWA 3MIEA 1PNGA 3MICA 1YI9A 4QHBA 1OPMA 4R4ZA 1YIPA
chains in the Genus database with same CATH superfamily
3KMHA 5A3TA 3FZ3A 3OOXA 4IV3C 2UWCA 1GMMA 4Q0UA 2J1EA 2VVFA 3O1RA 4PBPA 5F5QA 2NMNA 4KBBA 1H4HA 1DYPA 2O14A 3X29B 3O0XA 2AEZA 4FOQA 1V6MA 3AFGA 2I2SA 4BMEA 1JS9A 2KA3A 5FLJA 2W68A 4FPEA 4WM7B 1JUHA 4WVMB 5IVVA 3EO6A 1W04A 1MPXA 4LORA 3U78A 3CNAA 2A5ZA 2LTNA 3MUY1 3VLBB 3WX5A 1SG3A 2J1SA 5FMBA 5LASA 2PHFA 2WS92 1Q5OA 2E63A 3H1WA 1QDCA 4NWWA 3NNFA 1VBC1 4U36A 3GZUC 3IMNA 2HKXA 4YG6A 4EJRA 3N7KA 2MEV3 4NVPA 5FKCA 3RWNA 2EALA 5DG2A 1UO9A 2XGXA 1YFYA 3MPPG 5FXWA 4GJYA 3GCWA 4QXHA 1LB2A 2AC1A 2JE7A 1RITA 3VD5A 2W47A 3MI8A 2BTVC 1H1AA 1WBFA 5FREA 4DMIA 1NY72 5HCAA 3HQXA 4UFHA 5EWSA 3J7MA 2RDRA 3NW4A 3NJYA 4FOYA 1GKBA 4XE9A 1RUNA 2HWF1 2OYZA 2YB7A 3WG1A 1W6PB 2XJUA 3PUAA 4K8FA 5DABA 4NIHA 3T2QA 5K0UC 1JZ8A 3JB4C 1RL3A 4R9CA 4BQ4A 2YV8A 3ELNA 3B7MA 1JYVA 1Q56A 4HKWA 4LTAA 3ACIA 4CTEA 1NCRC 5DPNA 3Q8BA 1VJ2A 3CMGA 4LBQB 4QPGB 3OTFA 5KXDA 1SFPA 3T3YA 4Z92B 1R092 2IWGB 3CQOA 4C0HA 1RUE1 3THPA 1DZRA 2J1VA 1YCIA 4N43A 1W9TA 2BRTA 4ZS2A 4CDQB 3UYJA 3R0RA 4CCLA 5FXVA 3IZOA 4ZY9A 4BM8A 1NCQC 3ZSJA 4Q4Y3 3OUJA 1OFSA 1ZZ7A 1N3QA 3F95A 2IFWA 4CEWA 4CUGA 1RVF2 5JAXA 5IT6A 1FXZA 3BTXA 1XE7A 3A0KA 2OPWA 3O14A 4XXPA 4DINB 1ASJ2 2FBEA 1AYM2 4PLNA 2Q0AA 4QXCA 1ZA7A 3WXPA 2RMU2 3VKFC 5A1FA 3QCWA 1PK6A 2JE8A 2XQRA 2W87A 1XU1A 2ZBJA 1RUC3 5FXXA 5BXXA 4Z2WA 3TNPB 3K46A 4LBLA 4LXLA 1A34A 5ABJC 3AMMA 3K48A 5LY2A 4A4AA 3OGJA 5T5JA 2VXRA 3BOWA 5CISA 1NT0A 4S2HA 5FMOL 3U4XA 3VBFB 1R082 2ZGSA 3ZFFC 1CESA 3T2PA 4YW2A 1CWPA 3OF1A 3BOPA 2ZX2A 1O5UA 4CXYA 4UFKA 5HBAA 3Q9OA 2V4AA 4NO4A 1X8MA 4E2GA 1U5XA 4L8QA 1GZWB 1FT9A 1HB4A 3BN6A 4P9JA 5JOYA 1RUJ1 3BPSA 4GJZA 1OH3A 4O9EA 2Q8CA 2PLV1 1TE1B 3IDEA 4LEJA 4EN9B 5KWRA 4TWTA 5I93A 3KD4A 2B9UA 3V0BA 1XYPA 2OA2A 2UY8A 3AB0A 1VBE2 1BKZA 3FFQA 4IV3B 3VZLA 1T6GC 2GC1A 1UQXA 4A42A 4LK7A 1W8OA 2F17A 2FDFA 5I0TA 2HWB1 3P3PA 3K77A 2ARBA 2BYVE 2J22A 1DGRA 2UWBA 4Q1RA 2JDAA 4FOWA 1XRUA 2K2SA 1ZBE3 5L19A 3AP6A 1VPHA 5LK5A 1CONA 1ZRIA 2VULA 4PLMA 3PU3A 3RYPA 5FYSA 1IKPA 2WN3A 3PTRB 1PO13 2A70A 4QHZA 1F31A 1H1IA 5FKBA 3U37A 5L7OB 4M01A 1C57A 3MIDA 3ZM8A 2YBSA 5J96B 4GWMA 5FIXA 3U11A 2ZGNA 1ACCA 3M1HA 2Y38A 3ACFA 2VU9A 2WO7A 1C1FA 2IC1A 5FFOC 3WHTA 3OPZA 5FP4A 3U0ZA 3T4HB 5HCHA 1S0JA 1U5YA 1PNGA 3KCYA 5FZBA 3ZFGC 4KG8A 4RR3B 1WMFA 5T50A 4BLJA 5FZKA 4LE3A 4NE9A 5LEKA 2DUPA 4F83A 1LU2A 2BNOA 4XTPA 4LUKA 3VHNA 2NYYA 1V9U1 5BYNA 5HCBA 4JDMA 1N3PA 4N8MA 2DF7A 2V4VA 5K0UB 3OUHA 2LUWA 1UNBA 2W46A 3ABZA 3MLKA 1CVNA 5IHRA 1US3A 1LOGA 1HXS3 1QOSA 3Q8AA 5IUQA 5FPXA 4UW3A 2XWJB 4M00A 5FTTC 3PUQA 2GN3A 2DCZA 2JICA 1G86A 3ZYIB 5FMDA 2XKPA 3WLUA 4BDVB 4GH4B 1SDWA 1V6IA 2AYHA 3JQWA 5JVVA 1G7YA 1SCRA 3GYDA 4JRAA 1H1MA 3AM2A 4FPLA 5FZAA 3EMRA 3LIGA 2DVDA 1UMHA 3ZOIA 1N1YA 4YZ5A 1R64A 4ITCA 4XUQA 2QQKA 5A7WB 3IPVB 1HRI1 3TEXA 2G4IA 1NCQB 4IGQA 4CP2A 2OS2A 2VBBA 2WAOA 3MV01 4XFBA 5JOWA 4CPBA 3ALQA 1ULPA 2VUJA 3H9AA 4AFAA 1ZRFA 4YYOA 4AG4A 2VNRA 1BQPA 3SKJE 2HEWF 5FV3A 3SH5A 1KFUL 3BKZA 2EICA 4FO9A 4L11A 3GGLA 2RE9A 5F6LB 1ZZCA 1AJKA 4CEYA 1AYN2 1PO21 4CP0A 3ZN5A 1BBT2 2WFF3 3ME2A 4QX1A 4MGKE 4E8CA 1AR81 3THDA 1XNAA 1AXYA 2PHLA 1DU3D 4P9IA 3EJKA 2A6WA 3LDKA 3RJ2X 2VQUA 1FMD2 5FZ0A 4AHXA 5ABJB 4IE7A 3PJYA 5I0RA 2XHNA 5IVCA 4RD7A 2Y6GA 1QKQA 5JIAA 1OSGA 5FY9A 3R4UA 1H2NA 2BOIA 5EP9A 3WDWA 2QQWA 1COV2 2HBTA 5FPVA 1ZX5A 1ODMA 2DFCA 2XJRA 4N43C 4YW3A 4SLIA 1BLZA 1NZIA 3VL9A 4CCCA 2BBVA 1IS3A 1LECA 2VW2A 4Q4V2 1EAH1 1JXNA 4PQ9A 1UIJA 4R9DA 1VAVA 5JI7A 2VR4A 3JUUA 3D0JA 4Y26A 5FPUA 3AP9A 3LA3A 5FYTA 4AAPA 3AKPA 1JN2P 2BUKA 1X33A 1GSLA 3WCRA 2JG8A 3QD6A 1DCSA 2JG9A 1QJFA 4Q4W3 5GLWA 2WLQA 2A3XA 3SMHA 1VB2A 1E5RA 2Q30A 5J37A 5GJ6A 3MW4A 4D7SA 4DRRA 1UPSA 5A3PA 1GP5A 4QU2A 1OXCA 3FWEA 1GLHA 1X9TA 2ET1A 5A7NA 2Z4FA 5JPNB 1ZBA3 1YLLA 5E6HA 2FCTA 3D82A 2CDPA 1TNRA 4D7TA 4RS5B 5GLZA 1BYHA 3I8TA 3U10A 2ZGRA 2WNUA 3U14A 2R073 4DNYA 2Q8DA 1MR5A 1JZ3A 3CBNA 1HV0A 1FYUA 2FDGA 3NV3A 1UU4A 2KR2A 4DOUA 2EAAA 1MQTC 2JDZA 2RS52 3JU9A 3K4DA 1LOAA 5FAXA 1QQP3 5FK7A 4BOWA 2QQNA 4NIDA 2W52A 3ZYHA 5FWJA 2MNGA 3VKNA 1B35C 3WQ7A 4CU7A 2QE3A 2NLRA 1H30A 2J1UA 4NHKA 3RDIA 4AW7A 4CRQA 3CIHA 4FPGA 1UW8A 2XJPA 2ZGOA 4GULA 1YUDA 1ZM1A 4FPYA 4HKOA 4K1YA 5DDJ3 4YM3A 3LOBA 2AZ5A 3GBGA 3S6PA 5F1RA 1PVXA 4P00B 3R4SA 2VOKA 4A7KA 4E9KA 3WW4A 1UAIA 3N9QA 5FJKA 3H8XA 3RRDA 2CHHA 4XJUA 1L3JA 2B7YA 1W90A 1W2TA 5G04L 3ZDSA 4O65A 3APBA 3N35A 5F5CA 3T4VA 1GV9A 5F32A 1YRZA 3RZJA 2R49A 2XPJA 5LA0A 1AR71 1YFWA 2RR12 2WWSA 4UWDA 4CP9A 4XUNA 3HNYM 2YFUA 3IDCB 4COWA 4XILA 4D8MA 4XQDA 4XUOA 4B3NA 1K45A 3ZXLA 3TEWA 3JQXA 3RMXA 3IN9A 3CU7A 5FZEA 3OGVA 3UL2A 2GN7A 2OXBA 4HFSA 4XJAA 3KV9A 3D6EA 2X5IC 3ZXEA 3WT3A 3KVBA 3MIHA 1QGLA 3WF0A 4WM7A 3AXEA 5JR7B 1ZZ6A 4AFMA 1RUF3 1HRV2 1L7LA 1J1LA 3PTYA 1W2OA 3OD0A 4GWNA 1VBD2 4JZRA 5JXHA 3FUQA 3IAPA 3WF3A 4B1MA 5T54A 3I2KA 2GMMA 2UY9A 5KC6A 1C28A 4Y1YA 4UFMA 2E51A 1PVC2 4COYA 2VZUA 3WDUA 4D94A 1BXHA 1ULFA 3SCGA 3VB9A 3ZLIA 5DAWA 3VBOA 1RHI1 2XB6C 2WSUA 2W1WA 1G9DA 1LU1A 2WL1A 5JXGA 3WP6A 1DGWX 2DWRA 2QQIA 5FOBB 2VMHA 4HVQA 4HOOA 3ZYJB 2VMEA 1UY2A 1UMZA 5G05L 4QGNA 2C9AA 2A75A 2ZGUA 3LPGA 4YZ4A 3ZYGA 2GC2A 2Z5WA 4PBOA 3SQOA 5C6CA 3TN91 3T1LA 1IG0A 4QPIA 3RPQA 2ORZA 1U5IA 4AQ6A 3A22A 5F3IA 1G8WA 1IS4A 1JMUB 3RZGA 3E6CC 1WCUA 2R063 1KGYA 4N43B 4N53A 5CKNA 4Y1UA 1JYWA 1VRBA 5DXDA 4AEDC 4P9WA 1ZBE1 3GXUA 4XMAA 3HN1A 4LKEA 4DQAA 2A71A 2JDKA 3WNOA 2B4KA 1UY0A 3B9IA 3FHQA 1PO11 4LO7A 4LO4B 2ES3A 4JHZA 4CEWB 4Y5SA 4JGYA 1GQGA 5CA6A 4QX8A 5IJRA 4Q8KA 1QOOA 4LHSA 2ZABA 5JZGA 4QHOA 1AR62 1YNAA 4CU6A 3EB7A 3R4DB 5FYBA 1PK6B 1S55A 2W39A 1NAEA 2VCBA 3AMQA 4ZU5A 3GZAA 5AC93 3MDPA 4GKXA 5FZ1A 2QDRA 5BNPC 3KCCA 1ODNA 2G1MA 1REDA 3OSDA 3J26N 5A3WA 4FOVA 1DQ6A 1HXS1 1UZVA 3HNBM 3CF6E 4FT8A 3H42B 3I59A 1CN1A 2FMDA 2Q1ZB 2C5DA 4BQ1A 3K3OA 4XAAA 4M3CF 4JC1A 4XFFA 5GZCA 4CA9A 3O7OA 1MS9A 3UGFA 4UI9L 4NAOA 5FY4A 3VKOA 4AFCA 4QX7A 5SV5A 1D7PM 1DQ2A 1GWMA 2JG8C 3PMEA 1Y3TA 3DUIA 3W5MA 4D6QA 4QX2A 2VXJA 1E5SA 4KI5M 1LEMA 1LOEA 5LW9A 5EQUA 3WF1A 1HB2A 2EIEA 3NWKA 4AI3A 4LPLA 2E53A 4JQRA 3V0BB 2Y6LA 1KD7A 3MEPA 3DYMA 5FPZA 4YVWA 5JLVA 3NQHA 4HMZA 1GBGA 3H8OA 5FRAA 2VZQA 1JZ7A 1VMFA 1D0GA 2XLAA 1VBC2 2DU1A 5FZCA 2ZXQA 3B00A 1QJY1 4H2AA 1WCQA 4AGVA 2JJ6A 1HJFA 2UYBA 2VMIA 2WNUC 3H3UA 1RUI2 4Q4X3 1AL0G 3CZUA 4W8JA 5B4NA 1SBFA 2WFF1 5C3PA 2QZ3A 4JKLA 4LIUA 3LFIA 1C8M3 1V6JA 5FZ6A 1W28A 4BQ3A 1TMF1 3NL1A 4NR1A 1ND2A 2HWE3 3HMYA 3BIEA 1PIV3 3PVNA 1D0HA 3SCHA 2HWF2 2ADEA 3AC0A 4AR2A 4NUBA 4NOTA 2XJTA 3AZVA 3K51A 4JCKA 3TWIA 1W9YA 1SLTA 2WNEA 1R1A2 4F7ZA 4OUEA 2VTFA 1UYYA 3NJXA 5IWFA 1T2XA 2NQYA 1QXPA 3GNEA 3BYWA 3DL3A 3GZEA 2QQMA 5FY5A 1X7NA 4C8DA 5J48A 1XB9A 3FHIB 1XYOA 4OVEA 1TZOA 2Y6FA 1URXA 2B42B 2VY0A 2XJQA 3KF5A 3LEGA 4XABA 3PURA 3N9NA 2DCYA 2D7FA 1MZEA 3RG0A 5FZ9A 3BTAA 4Q4W1 4YG0A 1UXZA 5LCWL 1ZREA 4XACA 4XF4A 4S2FA 5F5IA 1XNBA 4BIFA 4FFHA 4Q8LA 4UFLA 2OKXA 1WLWA 1W99A 4KU8A 5IK4A 4LBJA 4NIAA 2JKBA 1MVQA 1VIWB 4ES8A 1CAXA 2WINB 1M06G 4MVTA 2EIGA 1NCRA 3ILRA 2R1DA 5ACA2 3HBZA 2PHXA 3T0AA 4HK8A 5FYMA 5CBLA 4MGZE 5IFPA 1RUH3 2W0XA 1WKYA 5I8SA 2IVIB 2GSYA 3JBG3 3AL5A 4O61A 4CSWA 1QQP1 2YG0A 2A6ZA 3HQUA 1Q3EA 4W4ZA 5CADA 4HPKA 1VRH3 2X10A 3HT2A 2ZX0A 4CEYB 1OQ1A 3ZN4A 1XE8A 3MW2A 4MGIE 1J59A 5LBBA 5FUIA 5FY7A 4TTGA 2XH6A 3AL6A 4MHRA 2ATFA 1GZTA 3N4MA 1J3PA 2JDMA 1RTVA 1VBA1 2ERFA 1QH7A 2G9ZA 2KXLA 4L0PA 1RUG2 1S2EA 3BPZA 4XYXA 5IVYA 4AOCA 3POJA 1D2QA 2YBKA 1Y43B 1TEIA 4FTSA 3JD73 4IEQA 5BNPB 1DYOA 2BFUL 3H7JA 4QPIC 3RNSA 5F3EA 3SCFA 1HN1A 3E5UA 2PLV2 3WDXA 3CJIC 4TZDA 4G9SB 1W2UA 2BNNA 4PIYA 4N53C 4HBNA 4QQLA 4K6BA 1YIFA 2BERA 4QMAA 5C5UA 2HJIA 4Q0PA 1J83A 2EIDA 2O8OA 4LHKA 4BE3A 4BJ0A 5C3OA 1TME1 2Y64A 3GBFA 4Q29A 1S0DA 4RGAA 3AJZA 4Q0SA 1PGW2 4CU9A 2JDYA 3BB6A 4BLIA 2HWB2 4W6XA 1QJX3 2EIBA 1XOYA 3ZFFA 4EZ4A 1OLQA 2JG8B 2MHFA 2P2KA 2JG9B 4JGYC 5J36A 3MZHA 2V5DA 2FDHA 1RUF1 1ULDA 1POV1 1E57A 3O0WA 5JZGC 1WWYA 4FFFA 1W6MA 2W91A 3O1TA 2I74A 4MG2A 1W2AX 1QNYA 1UU5A 3MBWA 4QWNA 3UJOA 3AYAA 5JSRA 3D0SA 4CDUC 4GMP0 1OF3A 4LO5B 4URAA 5C3SA 3KV5A 1AX0A 2XL7A 5FBJA 3VBHA 2WNUB 3S30A 1U0AA 1FNZA 4AYUA 1Z78A 4MGYE 1WBLA 2RS33 3PVOA 1YI7A 2VMFA 1SZBA 5CB7A 4D0QA 4FSJA 2JECA 5K7PA 1OOPC 3ZYFA 5JUVA 1MS1A 1OURA 1OI6A 1V9U2 1RYYA 5APAA 2GNDA 2HWC3 4WV8A 1WD3A 5KBFA 1DIWA 4QXKA 1SLAA 1I5PA 2HH9A 5DG1A 1N1TA 2BVVA 1AXKA 3QH7A 3GBWA 1QY4A 2V73A 3WD5A 2RDSA 5I8TA 3I2DA 1IG3A 1HW5A 2ZZJA 1Q8PA 3BGAA 2ZJCA 2TUNA 5C5TA 3POEA 2ZGPA 1CAVA 1U5ZA 4PHZA 4YVWC 4A7ZA 4E4DX 4IEOA 3AZWA 3ZFGA 1ZYBA 4M4RA 3ZPYA 4FPHA 5FCCA 2WLPA 5FJHA 2D5FA 1NE6A 3NNJA 4ATFA 4H55A 1WW6A 4CP9B 4Q0QA 3VBRA 2DUQA 1FOD1 4NHMA 3JB8A 1OT5A 1HRI2 4YARA 4ZU4A 5IAVA 2IXIA 4CPBD 1CAWA 3IBMA 2DU0A 1CAUA 4WVZA 4OQ8A 1ND2C 4Q1PA 3THTA 2G9GA 2ILMA 3AKQA 3VKMA 3WR0A 2ZX3A 4XW3A 5AC91 1UYXA 1UKRA 3MIEA 3WP5A 1DG6A 2ET7A 4Z07A 4MGTA 2XVLA 4IGOA 4EV0A 2Y0IA 3IIAA 3ACLA 4YW4A 1WCDJ 1AR82 2OUHA 3LA2A 1PMJX 2GNBA 1RJ7A 3ZXAC 4CCJA 4PT6A 2YC2A 4MO3M 1C1LA 4R8HA 3FBMA 3EQEA 4FPJA 2JEMA 2P37A 3LEMA 2VG9A 3RWKX 3VBOB 3C3VA 5JSPA 3A0NA 3CHXA 4NN0A 1QDOA 3I3DA 1XQNA 3AP7A 1WUVA 1LOFA 4WM8A 2FCVA 3W5NA 3NVCA 4I02A 4L9BA 4Q5OA 2WIIB 4HVRA 1VB4A 2VOTA 3S0MA 2GDFA 1EAH2 3N7JA 2VMCA 1XJAA 4RS5C 2P1BA 3OBTA 4QPIB 5L9BA 3ZMNA 2F4PA 4HLTA 4PJYA 2VNVA 1K12A 4BZ4A 2VGDA 2B46X 4N53B 1W8UA 1W9FA 2WJSA 2ZEZA 4Q4X1 1C4RA 1NQJA 2WWJA 1GP4A 1LHNA 4QKDA 3LSEA 3ZFEC 1WGPA 2JB8A 1CZVA 2X09A 1C8M1 4MGSA 4MYEA 1G9FA 1OVSA 4IL7A 3VZNA 1ENXA 4B7KA 3I3BA 4CUBA 3LWCA 2XKOA 4FFIA 2JIJA 4JGYB 1UOBA 2WNVC 4ASLA 1CX1A 4OUSA 1S4CA 4PIXA 3WF4A 3N9LA 4AHWA 1O3RA 2YGMA 5JZGB 5CG9A 2HLEA 2WA4A 2FD8A 4QDRA 1RVF3 2EXHA 1LEDA 2EXIA 2VOWA 2VAUA 1IQAA 2QQUA 1AYM3 2E7AA 2HEVF 3PMSA 4XURA 4A3ZA 4JKMA 4GWJA 2RMU3 4RFRB 1PGL2 4BH9A 1T6BX 3J9SA 1W0OA 1HJGA 2PHRA 5IVFA 3V56A 1W6OA 1W3XA 1W06A 3VL8A 4Z8BA 1NLRA 4LNVA 4IE5A 4TLGA 1J84A 4BQWA 4XDOA 5HXMA 3POWA 1DLLA 1UZZA 3I59B 1FPN2 4K7JA 1F4AA 2YC4A 2W92A 1STMA 4E8DA 1R083 1NOVA 4AGGA 2JD9A 2NZ9A 3DXUA 4LIVA 1ENRA 2OIIA 5T5LA 2WC2A 1DDLA 1A3KA 1AR72 4PF1A 1MQTA 2VMDA 4AGRA 5B2GB 1PHMA 5FYYA 1NX9A 3BU7A 2R30A 4BQ5A 2Y6JA 4AL9A 2C4XA 2BU9A 1B35A 2HEYF 3LA7A 1RUH1 4GB33 1CD3G 3E1F1 4FPCA 2VZ1A 2LM3A 1CJDA 3C7OA 3I2IA 1X8EA 2ADDA 2YMZA 4HN0A 4YVWB 3UNPA 4FTBA 4PIZA 3ZDVA 5KHJA 1KQRA 2W2IA 3JBG1 1G6NA 1UN1A 1GWLA 3PIJA 1C8NA 5CEHA 1G9CA 1VRH1 2VC9A 3LCPA 3WW1A 4DPNA 2J1TA 3VBHC 4P9GA 2R1BA 2GALA 3SLIA 2D5HA 5A80A 3DV8A 1XXNA 2CU5A 2VUAA 2XXZA 2D6LX 1RUOA 2YUEA 2BVBA 1ND2B 4RQPC 4K9SA 3VGIA 4EWDA 5FO9B 1RHI2 2SBAA 2AREA 3HR9A 3USUA 1ZRCA 5TSWA 3T08A 3JD71 5EPAA 1OKQA 4JTOA 3ZXKA 3J7LA 2BWAA 2JE9A 5F7UA 3DPRC 1HLCA 2X5IA 4E4HA 1IPJA 3VHRA 1IPSA 1GNYA 3DEMA 3WHUA 1MZFA 3BI3A 1AL21 1RUD3 2RS11 2YDEA 3IKWA 5D1IA 2NPIA 2VM9A 1S2BA 1W39A 1WZXA 4LA2A 3I2FA 4MX3A 3TN92 4GWIA 3ETPA 3OYWA 4DXRA 3TB0A 3W20A 2VBDA 5FXZA 3VZJA 1UY4A 5LY1A 1FI2A 1XPWA 1MZ6A 4UW6A 1FX5A 5L9VA 3VBRC 1GUIA 2OT7A 3HBKA 3HN3A 1ZBE2 3PUIA 4YLZA 4HXCA 4K20A 4DB5A 1IQDC 5F3CA 3JCIA 4URTA 5AVPA 3WW2A 4A44A 2GMPA 5GM0A 3WSOA 3WNPA 4QT6A 5FPAA 1JZ5A 4AI9A 4Y22A 3ATGA 1CAXB 3AFKA 3FUOA 1MS4A 3UK9A 3M3CA 3KGZA 1DHKB 2J7MA 5B4XA 1NCRB 1A78A 2JENA 2C6SA 2CGOA 4UF0A 2RS31 3KQ4B 3TRSB 2W5FA 4UBGA 1MEC1 4Q27A 5FZIA 1Y9GA 4Q26A 5IAXA 4ISRA 1G9AA 4L92A 4QB1A 5IVJA 1UF2C 1XSQA 5T5OA 4JTNA 5LBEA 1REFA 4AEDA 2W1QA 2R16A 3KB5A 3NRUA 3LE0A 4HPKB 5JOZA 1J1TA 4CCMA 1H8TA 2TBVA 4FVVA 2HWD3 3WNLA 4IDZA 1LOFC 4RHV1 4WM8C 3ON7A 4J25A 4YM1A 3SH4A 3LQCA 4AWDA 2D6OX 5IW0A 4CYDA 4YFWA 1ND3A 1BBT3 1W0PA 3BU0A 2VL4A 1MZ5A 4Y1XA 1DYKA 4NRQA 5HV0A 1KXGA 1AHSA 3MYXA 3POSA 3I3MA 3GCXA 1EV12 4I2OA 2D6KA 1FMD3 2PQSA 5CG8A 1EP0A 1OLME 3RI9A 4U2AA 1UIKA 3PU8A 3ENRA 2AGSA 1OUXA 4J6GA 1ENQA 3H3LA 5JDBA 1NXD1 1JW6A 3OGSA 5ANQA 1JZ4A 3WNXA 5BNPA 5DAVA 2Y60A 5FYUA 1PZ8A 1COV3 1VBB2 1KFXL 1LENA 1OLRA 1DQ5A 2XBO3 3UESA 1DQ0A 1QJU2 4NHYA 3ZX7A 1D4M3 5EXOA 4DO0A 5HPOA 4GZ9A 2R0HA 3AZXA 3ZFFB 4EN8B 3VBSC 2VZVA 2ZX4A 3H3ZA 4OI0A 1QJY2 4LHLA 2DVFA 3M3QA 4PF5A 2YROA 2FZ2A 2ZHKA 3HOBA 2AENA 2WFF2 1SLIA 5LRSA 1SFYA 3CEWA 4DZGA 5CKMA 1OQDA 1TMF2 1W6MB 3DF0A 3FLPA 1AUYA 4YGEA 4IEUA 3IMMA 1I3HA 4YW6A 3N36A 2BNMA 4PI2A 5LBFA 1GFF2 4YM2A 3TYJA 1HV1A 3DCQA 2MEV1 4I30A 3M3EA 2QUOA 2WKKA 4XFCA 1K3IA 4MSVA 1BZWA 2YHJA 4I09A 3VBHB 3WP4A 3IIIA 3L9JT 4S2GA 1SBDA 1R1ZA 1DQ1A 4YM0A 3WNKA 2A6YA 2JDHA 3I54A 5JIUA 3LKJA 2XLFA 4YWAA 4L2NA 2BWCA 4FXGB 5FK8A 5IK5A 4NPRA 3AMPA 1W6NA 5LB6A 4DUVA 5FQ0A 3B69A 2QQPA 2RS53 1MACA 3DPRB 4OHXA 4RL7A 4EZHA 3QLQA 5C9AA 2P5BA 3BIWE 3KHBA 1TNFA 2UU8A 4I0AA 1H9WA 4AVVA 5JXIA 1GOHA 3O1OA 4BISA 4C90A 1VMJA 1SMVA 2Z69A 2VOVA 1BEV3 1F4HA 3NMBA 1CAVB 1JBCA 5CFDC 3NNGA 3ZFGB 4AE2A 3O1SA 1W8HA 4FP2A 5LATA 3ZSEA 5A6ZA 2ZMKA 1UMIA 3AYCA 1FV2A 3AZZA 5JCTA 2BPA2 2KD7A 1JYNA 3VBRB 1RIRA 4IE6A 1LAJA 4FQZA 4UW5A 2YBPA 4ISQA 5FZFA 2WABA 4Q4Y1 1UZ0A 2RR13 3C7EA 1CAWB 2WQZC 4EQVA 1CAUB 1GZCA 4M3CE 1QQP2 1LHWA 4QHBA 4MV2A 1AYM1 4ZPIA 1H9PA 2WAAA 1SDDB 3O12A 3WVJA 4XF3A 4F8AA 2H0BA 2RMU1 4FQ4A 4ZZ8A 3P1IA 4XJ8A 2FQPA 3WP3A 2QCSB 4YZ3A 5F2WA 1RUC1 5A33A 3WF2A 1VMHA 1WA4A 2LS6A 2ZGQA 3ES4A 4XFGA 5GKAC 1VBA2 2O0OA 4FBFA 1DBNA 1VBD3 3T2TA 4IXLA 2VE1A 3VD4A 4GALA 2VJXA 4IEYA 2GC3A 1R081 1OD5A 1CIWA 3U75A 4YPJA 1N47A 4ZU7A 5DMYA 2CDOA 4JVAA 4OFGA 4IUGA 4UOJA 3UKVA 2YZ4A 1ULEA 1OA3A 2D98A 2FZ1A 3AXDA 1DGLA 2WDBA 3N7LA 3MHZA 4WM8B 3VHOA 2DDUA 1TME2 2VOXA 3KSCA 2BDRA 1RGSA 4FI9A 4TN7A 4CUCA 2Z42A 2B8MA 3OPWA 4GB31 2JD4A 1QJZA 4ZHNA 1WCSA 3LFMA 4LR4A 3ZVXA 4KNCA 1AVBA 3KGLA 4UXAA 2IUWA 3H8RA 2Z79A 2N7GA 3S57A 4QM9A 1K5JA 4GMP3 2DTWA 3WUDA 4JRLA 4PQQA 4QGMA 2WN2A 3DXTA 3LAGA 1O4TA 5CFCA 2WO1A 3CKHA 5F5AA 1YQ8A 1HQLA 2QQOA 1P8JA 3CJIA 5FMOS 3KZ4C 3WG2A 4E27A 2EF6A 1HB1A 3RYKA 5JMCA 2A6XA 5EFUA 3RFRA 3MV11 2ARAA 1ZA4A 4LLFA 3GALA 4XVHA 4D69A 1BCXA 4CCDA 4FCAA 1H8TC 5LK7B 1XBFA 5C33A 1A6CA 5EJZB 5CYYA 5KC5A 3M3OA 3ZMOA 5CIRA 3VBUC 4ARYA 3MPBA 2XUMA 5LA1A 2QFEA 3OBZA 4AFDA 5DUWA 3KWVA 1LHVA 2D44A 1RUD1 1BMV1 5JXJA 5AFBA 1ND3C 3FJSA 3ZR6A 2RJ2A 3CLPA 3FN9A 3QACA 2A7AA 4H14A 2CYFA 1KDKA 5IK8A 1W6OB 4PCRA 5IFTA 3IDAA 4K3UA 4UFJA 4CDUA 1Y4WA 1N3OA 3ACHA 2GU9A 2P3IA 2B45X 2BGOA 1HQNA 5FY1A 3VDDC 3L2YA 4QQ2A 5DZGA 1RINA 4ARXA 1RMU3 3Q8EA 2TEPA 4KQ7A 3VZKA 1BVVA 4Y24A 2ID4A 3ZXGA 1X9PA 5AFEA 4KWLA 2WZEA 4QKNA 1MQTB 4M0NA 1OOPA 1FOD2 4B29A 1Q8VA 1JTZX 2XMLA 4HSLA 3DN7A 4NRPA 4Y33A 1B35B 5C8CA 3BVCA 4JGZC 4Y5TA 4BCUA 4WZCA 2PFWA 5KXBA 4M4PA 2QJVA 4NWVA 5AC92 4UFIA 1QXJA 3OUIA 1SFNA 1UYZA 4FPOB 4OQ9A 4EN6B 3B01A 4UT5A 1O5LA 4QDSA 1N1SA 5FPLA 4E2SA 2HWD1 1Q8SA 2DCTA 2WZ8A 4IEXA 2GNTA 3TOJA 3LPFA 4C1XA 1RC6A 2AR6A 5E8AA 1RUI3 1H6YA 2ZACA 2B5HA 3USUB 1I9RA 2IZWA 2JDNA 1S1AA 4R9BA 2Q8EA 4CCNA 3SEPA 1JI6A 2RM23 3VZMA 1SLLA 1S0GA 1FAYA 2X8KA 3OGRA 5FZLA 3RVHA 3UKTA 3A4UA 4IW3A 4IGPA 4PI0A 1D2SA 1APNA 5F6KA 4XMIA 2E9QA 2X5IB 4TXWA 5C9AC 2DCKA 2HWF3 4P9XA 5L9RA 1UOGA 1Y9QA 4QB2A 1SHWB 3LIHA 1OA2A 4LBOA 1GZ9A 3C2UA 4ZS3A 3I2OA 4D7YA 2XBO1 3OYWB 4GIQA 4H3WA 4JV4A 1R1A3 4B4RA 5FPBA 1D4M1 1S0IA 1WLCA 3J8F3 3MFAA 2OQ7A 1V70A 2E7TA 2R043 3POFA 1BVP1 4XC9A 1Z7S3 2QZ2A 5F2SA 1KRIA 1LCLA 1WA6X 3KT1A 4UBHA 5FP3A 4KGQA 1O3TA 5BNOC 1UKGA 1C8M2 5EYYA 1RUE2 4XF0A 3GJBA 2GNMA 2A1XA 4DY5A 4J1WA 1PM4A 1WW7A 3AP4A 3PVEA 3MICA 3RGBA 4Y22B 4AEMA 1AR93 2QNKA 1H4GA 1OA4A 2G9FA 3P6BA 5IVEA 5IYYA 5H9PA 4MUVA 3RZHA 1CJPA 3IT8A 4QM8A 3BUCA 4I3GA 3J7HA 3RYRA 4UF0B 2WNOA 1O8SA 1ZBA1 3GF6A 3SKVA 4YFZA 2BOJA 4AI2A 2RDQA 1W8ZA 3KM5A 5ACA3 4OHZA 2Q8OA 2JDPA 4E4ZA 2AUYA 5EJ3A 2A6VA 3WV6A 5KXEA 5KXCA 4PLOA 1WLDA 2R071 2ZKLA 3NAPA 1AX1A 4AEDB 5I0DA 3N9OA 5JI9A 2ZHMA 3E6DA 5FZHA 3ZFEA 4BWOA 3B3QE 4NAMA 1H8TB 2RS51 5FP9A 3EYPA 2NP0A 1W8TA 1CPMA 2Q4SA 4X6RB 4X6QB 1OLMA 3HT1A 2Y33A 2WNVA 4COUA 3ACGA 3HEIA 2CWSA 2UWAA 1ND3B 1UOFA 1UZWA 3AX4A 3ECQA 2JDUA 3NV1A 5JWPA 3DYPA 1BEV1 2YFZA 3WG4A 3ZSMA 2JKXA 3UT0A 1ZZ9A 3HAGA 5LA9A 1YFUA 1AX2A 3K4AA 5K9YA 5DDJ1 1YEWA 3MFCA 3WNMA 1RUG3 4LBKA 5FYZA 4DUXA 1X36A 4QD2A 4KH9A 2PHDA 2VMGA 4YVSA 5CFCC 3ZKUA 1VAMA 4KU7A 1TQ5A 5JSOA 1A8DA 3K75B 4CUAA 1NKGA 3KCXA 1RUJ2 1LODA 3AK0A 3DKWA 5K4LA 1EY2A 2QKDA 3NKTA 1X50A 4E4SA 3JBG2 3E6BA 4LLOA 1VLNA 4SBVA 1ZZ8A 3AYDA 3NNLA 2DFBA 5KHGA 1VRH2 3DYOA 4XHXA 3QBQA 3U4SA 1NA1C 5E1RA 2HWB3 1OHFA 3VDCA 1AXZA 3OPTA 4X8NA 2WZR3 3CZJA 4GQ7A 4BA6A 3OB8A 5L73A 3SC7X 3U07A 4MZUA 5DZEA 2ZHNA 4DUWA 3NV4A 5DUVA 2D3SA 3LF7A 3R05A 3LGRA 4B4PA 1VBD1 4CVUA 5BNNC 1QXRA 1Y9MA 1YJKA 2K46A 2W9XA 3JD72 4MGQA 4W65A 1OD3A 3C7GA 1XNKA 4KMQA 4YW7A 1YQ2A 3HJRA 4TSVA 4MOAA 3VZOA 5K8SA 4JDNA 4WBBA 1AL22 1JOPA 2RS12 2J1RA 1YFXA 5ERLA 1O4ZA 4AVTA 2DTYA 2VUDA 5FZMA 3UGHA 4N7UA 1W6NB 2A3YA 2GP3A 2O8QA 2Q1MA 5FQ0B 2P3JA 4LA3A 3MIBA 2PYTA 4XUPA 3T0BA 3ZYPA 2D6NA 4I0BA 3RZKA 5FZGA 4RQPA 3ILNA 5C9AB 3M2MA 2RJKA 4GMP1 2CNAA 2Y6KA 3D3AA 3P5BA 3S7EA 3GM8A 3L2HA 5C8CC 1EPZA 2VQ0A 3M7AA 1WD4A 5AVAA 5GZEA 3DPRA 1V00A 2R061 4QPYA 2D3PA 5C3QA 4LUMA 4M3CA 2WFPA 3ETQA 3G6JB 3LEKA 3IWZA 2Q5TA 3WOGA 3AYEA 3KQRA 3ZR5A 2GMEA 3GDBA 4XFIA 4BB3A 2BBAA 1OPMA 5FZOA 4Q0VA 1UD1A 1MEC2 4R9AA 3RI8A 1Q8OA 3I49A 4TYSA 1K42A 2K0GA 4META 2R6QA 4IQPA 3EBRA 1LJ7A 3KV4A 4Y1ZA 3MIGA 3B9CA 1UCXA 1HRI3 3OY8B 2QVSB 1UX6A 4IE0A 3VBFC 4A3XA 5IK7A 4LK6A 1CZTA 5FZ8A 3V0AA 4UW4A 1ZRDA 4Y20A 1GOGA 4H7LA 1CR7A 1DLCA 4OCTA 4YW1A 2Y0OA 3T2OA 4RHV2 3O1UA 5A33B 1YQ5A 2FCUA 3EXUA 3T1MA 2G19A 3M3IA 2BV4A 1PO22 4XZUG 4Y4YA 2I45A 5FZ3A 4E2QA 1W8NA 3RQ0A 3V64A 3NNMA 1AR83 1H2LA 1BHGA 1ULGA 4OHWA 4R4ZA 5F9TA 1RMU1 2WS93 3MO4A 5GLTA 1JZ6A 1QF3A 4K21A 4LKDA 2P17A 4XCBA 3POYA 2VQAA 2XLGA 4LO8A 3HNMA 1DGRN 4LKSA 1OFNA 2WQ4A 4YNIA 3OBRA 5DAPA 3RSJA 3ZN6A 1JU4A 1GQPA 4AEKA 2BQPA 4ONUA 1VE0A 3KHCA 4QXBA 2CAVA 2RDNA 2WYSA 3MLLA 2QDNA 3J4UH 3WDYA 4HT1T 2BGCA 1EAH3 1JHNA 5L7OC 4QQHA 4KWKA 4C1WA 4Y4RA 5CFCB 3OEBA 2ZMNA 4P9LA 4AFBA 3BTYA 3I2HA 3HWJA 5GZDA 2IXJA 1H8VA 3CJIB 4A45A 4AAXA 3IDBB 1RUI1 1SEFA 2MEV2 3O1VA 4RR3C 1JU3A 2CY6A 3NAPC 4ZKTB 4RSUA 5FUNA 1R093 1NA1B 2RM21 4B1LA 5BY5A 4EN0A 1J3RA 4Y5Z0 1WLTA 4ORFA 1LOCA 5FOJB 4DIQA 2HWE1 3WDTA 5A3OA 5JMOA 1PIV1 1PNFA 3VBSA 1SPPA 3KS7A 4AQ2A 3OBAA 3Q8FA 3VHPA 5A1LA 3I2GA 5BNNB 3FC0A 3RJRA 4XEZA 3MUZ1 4EWAA 4NHLA 3LB9A 4AHZA 1R1A1 2H6BA 3AKRA 3J8F1 4BQ2A 1ASJ3 4IETA 2CGPA 1TVGA 3RS6A 2R041 4CDUB 3W21A 1Z7S1 4GH4C 4P5HA 1JH5A 1PGSA 4YVSC 2GAUA 4ES9A 2DV9A 4NIIA 2BZDA 1YJLA 2HYKA 4N7IA 4OZOA 4CDWA 1NXMA 5DZFA 5I0UA 3WQBA 2JB4A 3ZO0B 2GH2A 3PDQA 3ILFA 4QDQA 1JOJA 1SCSA 3A7QA 3QOPA 2ZAAA 1FPN3 4EYUA 1AR91 4D3WA 2X53S 4P5YA 3ZXFA 4OLLA 4XCAA 4R52A 1OOPB 2K9ZA 5FP8A 2ZPXA 4JQTA 4NPMA 1YI9A 1S0BA 3PNAA 2CGNA 3I7DA 5KHKA 2IVJA 2IXLA 2P6CA 4Q4Y2 1AR73 1XC6A 1W9SA 5C8CB 5D2AA 4OUMA 2P4EA 3OCPA 4PDWA 3PJQA 4IE4A 2WZPP 1W0NA 3RZZA 4AVSA 2RG4A 5ACA1 1EPWA 3CL1A 2OX0A 4XPVA 4BU2A 1BJQA 2X29A 4ET7A 4XXAA 4XBQA 3C7FA 1YO8A 1IKQA 1LULA 2JX9A 1RUC2 3GHMA 3N3HA 4EROA 2MPFA 3N9PA 2Z2SB 5CFDA 5A32A 3T30A 1PMIA 4QKFA 1SLCA 5GALA 2WO3A 3ZIXA 4BXFA 1HIXA 2CL2A 2XL9A 2P6HA 1VBE3 4XDPA 1NUKA 1PZ7A 5GZFA 3U1XA 3SISA 1IOAA 5FR3A 2DBIA 1KS4A 4XOGA 4FXKB 4OHVA 1V6OA 1NG0A 2FHRA 1QHDA 5FDBA 2ETEA 1RHI3 2PQQA 4IV1C 1RUG1 1J3QA 2DCJA 3BODA 5A3MA 4LQRA 3DKQA 1QH6A 3MGUA 4OI1A 3WCSA 1US2A 5T52A 1O7FA 2P34A 3H1YA 2XHKA 3DECA 4GB32 5EIYB 4YZ2A 5J7MA 2NMOA 1ZZBA 5F39A 3S7IA 1YQCA 2YPDA 1VAKA 3MF9A 3PVBB 4IERA 1W03A 5GLVA 1DP0A 4DEQA 3MIFA 2WSVA 3BALA 3TN93 1PGW1 2ZEYA 4QGLA 1CPNA 2OZ6A 5EV7A 4UYBA 2PMWB 4XFAA 4QQPA 2WZR1 1DZQA 2FDJA 3AZYA 2WA3A 2ZMLA 1QJX1 2WYFA 2YU2A 4HSJA 1V6KA 2NM1A 4NPLA 1UU6A 3VUOA 3C8XA 5EZWA 3LZZA 2WR9A 3W59A 1OKOA 4GD4A 4BK5A 3VD7A 2GZWA 5FO8B 1EYBA 3AMNA 4XQWA 5LBCA 5FYCA 1SACA 4C91A 4EN7B 2PTMA 3LSDA 2F6BA 1PO12 1YXWA 2WQ8A 5LA2A 2BFUS 1UOJA 4UAPA 5DN2A 1OH4A 2PHUA 4NRMA 2ZTNA 3SH3A 4LKFA 4RGGA 1RUD2 2BJSA 1BMV2 3N7MA 4X8PA 2SLIA 2VZ3A 5FY0A 1GQHA 3I4IA 3O5SA 2ZEXA 3NAPB 1MS0A 1RJ8A 1V6LA 2DBNA 5FZ4A 2ZGMA 2HBUA 3ZFEB 2A73B 2ZAHA 3B93A 4LBQD 1G9BA 3URFA 4COZA 4Y3OA 3HVDA 3WUCA 1OPOA 3DGTA 2BGPA 2QBXA 1F8VA 1Y7BA 1UY1A 4Q2FA 5M0TA 1GNHA 5KHIA 2HWC1 4N9IA 2WNVB 4G3YC 5D8AA 1AF9A 3OJBA 2ZKNA 3ZSKA 1ONAA 4OYUA 5GZGA 3OGGA 1MS8A 1LHUA 4AVAA 1GYKA 1HXS2 1QOTA 1QU0A 2OVUA 3ITQA 3POIA 4XJZA 4XJWA 3VBUA 1QWRA 2FDIA 4BXSV 2FMYA 1AYN3 1UL9A 4R4XA 1XU2A 4LITA 4AZZA 1MS3A 1GR3A 2V5YA 4DXZA 4YVSB 2PAKA 4MHUA 3AVRA 1JOBA 1EV13 4MXWA 3JXSA 2XOMA 3TEZA 5FYVA 4HN1A 5I0SA 1OVPA 5J98B 3R6SA 3WEZA 1CGPA 3ZSLA 2D40A 4HVOA 3AKTA 5SV8A 1VBB3 3UETA 4BQXA 3VD9A 5LEJA 4IESA 4FPFA 4FTEA 1HQWA 3VDDA 1QJU3 1ZNPA 2CTVA 2HWD2 1Q43A 4XIOA 5C4WA 4XBNA 2YU1A 5I91A 3POGA 3E97A 1QJY3 4H7MA 4L97A 4I3PA 3S5AA 1O4YA 2KM2A 1I6XA 2ARXA 4FFGA 2E6VA 1TG7A 1UXXX 5A7SA 4Q4V3 3T0DA 1W9WA 3SXWA 2VZRA 4HANA 4EWEA 4YW5A 1UX7A 2EA7A 1TMF3 2VVEA 3HPNA 4CCEA 2AACA 2WS91 3KV6A 1OC1A 2YC0A 1CQ9A 3LDBA 1J58A 2YY1A 4JGZA 1UY3A 4F3JA 4P02B 5BV6A 2CAUA 2VZOA 4JKKA 1GP6A 1YIPA 1M4WA 1L7RA 5H9QA 1WMDA 5DAQA 1SBEA 5LZ6A 1AJOA 5ISLA 1JODA 2XBO2 4CDWC 3ZXDA 2EXKA 4LT5A 1XNTA 1D4M2 2ZX1A 1NY71 3I2JA 4DRVA 1YC61 1POQA 3WDVA 3ZIWA 1C5HA 4LHNA 4IV1B 4JX0A 4RQPB 3ASIA 4RYDA 2LW8A 2H0VA 2VW1A 3MW3A 3WW3A 4CCKA 3JZVA 1H2KA 4D6SA 3AVSA 4RA0A 4EE2A 5CVRA 4CEWC 3USSA 1IPKA 3LEIA 4QB6A 4YZ1A 2FDKA 3WNNA 3OD4A 4PDWC 4XDQA 3CO2A 2LRPA 4Q4W2 1RB8G 1ENSA 1DF0A 5IVBA 1NQDA 4JAAA 2PN5A 4M3CB 1PK6C 4OMDA 5CNAA 3MF6A 1R091 1MS5A 4CDXA 5JOXA 1DQ4A 3FX3A 4BHPA 2C9KA 1LOBA 1ZBA2 2XUEA 3K4ZA 1OF4A 4V1PA 5FZOB 3NJVA 4KGGA 1HB3A 1K5MA 4KWJA 1GICA 4O7XA 4LOTA 4ZXKA 5EYXA 3AMHA 4XETA 2ZZQA 1E5HA 5A6XA 4GXLA 4RGKA 1HX6A 2R7EB 1B09A 2R072 5ANNA 5FYHA 5C7GA 3V0AB 4ATEA 1PX3A 2I07B 1FNYA 2EAKA 4HKLA 4K40A 1BK1A 4Y20B 1WMXA 4NMIA 5BNOA 1RVF1 2IXHA 5DUXA 4DXTA 2R0FA 3FFZA 1ASJ1 1WMEA 3TAYA 3O1PA 2VZSA 3OY8A 2JIGA 4OULA 1FV3A 3W9AA 1FATA 5BUVA 5L36A 2YGLA 1PGL1 4RN5A 1W8FA 4AI1A 1ZVFA 2WT2A 1I1EA 1EUUA 1BEV2 4LBMA 1W6QA 1JHJA 3KLSA 4HONA 3RMYA 4ZONA 2D3RA 2D6MA 1VBA3 5DDJ2 3BCWA 4XIKA 1H0BA 1FPN1 2F4LA 1HRV3 4L99A 3FLTA 5LRRA 4GKYA 2PAMA 2YXSA 4QQOA 1L7QA 1LGCA 4GA9A 2BEOA 2DVGA 4K8RB 2XWBB 4V2WA 3ZN6B 5BPXA 1QIQA 4A41A 3FE5A 4YSFA 1PVC3 3INAA 2XR4A 4LMFA 4BQYA 4QPWA 2IXCA 2UURA 3KVAA 4MH0E 1TME3 3I97A 4S2DA 2C26A 2A3WA 2JWPA 4IEVA 4DFSA 2VNOA 4LE4A 1OQEA 3VD3A 3ZPOA 3PUHA 5F37A 1UZYA 1YHFA 2V72A 2DVBA 5FLIA 3ORJA 1CX4A 3H8UA 4HG6B 2GC0A 4WVMA 2VVDA 3MLJA 1POV3 3UJQA 1LR5A 1VBE1 1RUF2 4O9GA 3N9MA 4Z82A 3UGGA 4CZSA 5T3NA 4AEJA 4JHTA 2X05A 3E5XA 1OUSA 4FP3A 1NYWA 2RV9A 5E88A 2ZOEB 2PXJA 5EJ1B 2LROA 1GOFA 1KJRA 1N1VA 2AH2A 3Q8CA 1YWKA 4YGBA 5F8PA 1EUTA 3VBSB 5J3UA 5DAXA 5F3GA 2BW8A 1SPPB 2NN8A 1NA1A 2R32A 2DVAA 5D8AC 2VQTA 2EXJA 2DURA 2VTXJ 4W50A 1VR3A 2XONA 3B5LB 4MADA 4QAWA 4AK3A 2ZGTA 3A21A 2RHPA 4ASMB 1CIYA 4LJHA 1C5IA 4IEPA 1IZ3A 2XDVA 1W6PA 1HDKA 3VKLA 4CXWA 1LHOA 3POBA 3GZTB 5BNNA 4B8EA 1AR63 2C0ZA 5C71A 2BP6A 3LOIA 1C3HA 3FL7A 1LNSA 3RZMA 1V0AA 2VW0A 4CDWB 3M4FA 3EHKA 3LD8A 1ULOA 4AI0A 4DS0A 2R062 4LBQA 4QPGA 3AKSA 2VCCA 1PZ9A 1KS5A 3WG3A 2ENRA 2RJLA 4COVA 1OBNA 4MXVA 4TLFA 4G4FA 3OG2A 5FY8A 1XNDA 5CKQA 2D93A 3H7YA 1S2KA 2VCMA 5C4WC 3H1MA 2Y8KA 2W94A 3D8CA 3D4KA 3NO8A 4XQ4A 4CDQA 3CJXA 4B4QA 3PL0A 1UPIA 1YYNA 1ZRRA 1FOD3 4PDWB 5HV4A 4CEYC 3T09A 3WQ0A 1O3SA 2WBKA 2QQVA 2Y34A 4P14A 1IGOA 4QU1A 4V2VA 2D97A 2WUHA 1O8PA 4GAZA 5D21A 4NIGA 3NV2A 2VZPA 2Y6HA 2E31A 5CFDB 1HKDA 5A32B 4RFT0 4M0HA 3G7DA 4AHYA 4I0WB 1F5FA 4HL0A 2VO5A 3HD8B 2D43A 2LALA 4INDA 2Q1FA 2TNFA 2E7QA 3V65A 3H0OA 3QH6A 1RMU2 1WW4A 4OMCA 4NJ4A 4WZFA 3FBYA 3C7HA 1VBC3 5A3UA 5T5PA 3I3EA 3K2OA 1ST8A 1WW5A 2QTWB 1DZTA 1RXFA 3IAQA 4AF9A 3RZLA 4IEWA 1AYN1 1LKNA 2C24A 3VBFA 2B39A 2WWUA 1BBT1 3GJAA 4OI2A 4CXXA 1QNWA 1EV11 2VECA 3ROUA 2JG9C 4OI4A 1A8MA 2WRAA 2XQXA 3B02A 3PUSA 4HK9A 4BYYA 3WY6A 2YPJA 5J09A 3THCA 4D6RA 1FMD1 1H2MA 2ZHLA 4XUTA 1GZWA 4Z2AA 3P3NA 4ZXEA 5FWEA 4CP1A 4XTMA 5GLUA 1VBB1 4QX0A 4WVVA 2XG3A 1IHMA 3B94A 3FHAA 4WVWA 5A7PA 1V6NA 1QEXA 4CDXC 1COV1 3BTZA 4OHYA 1QJU1 2E26A 2Y26A 3I3QA 4AI8A 2OZJA 2WT0A 5A6YA 2EVXA 1K5MC 3A23A 3VDBA 4IV3A 2ARCA 3KF3A 3WINE 1S0CA 4YRDA 1UWWA 4LBNA 5KHHA 5HCFA 4Q4V1 4DY3A 4Q4X2 1XE0A 3NSTA 2RM22 2J1AA 3TEYA 1RUE3 4B7EA 1GU3A 5A1AA 3SNMA 2PELA 2WO2A 4YG3A 3NJZA 4I01A 5FO7B 4A6OA 1O3QA 2RVAA 1IS6A 2HWE2 2VD7A 3IM0A 1PIV2 2UYAA 1PX4A 1GNZA 4CCOA 1JYCA 2D6PA 5FP7A 2E32A 1JYXA 5L7OA 1KITA 1KDMA 1NZCA 2ZGKA 5BNQA 2OUJA 1X82A 2ZCWA 1KEXA 1PM7A 3AJYA 4QKBA 2CV6A 3J8F2 1W8WA 1F35A 3ES1A 3PHMA 1LGBA 2R042 5I8YA 5J1XA 1Z7S2 1F5JA 2HYXA 4BPZA 3M8LA 4KWUA 1U12A 4XBLA 4RR3A 3UV9A 4N9HA 5DUUA 3ZKYA 4ZZ5A 1MVEA 5A70A 5A3NA 1I5ZA 1JYIA 4C0BA 3H50A 4LULA 5D8AB 5C8WA 2B9VA 3PLQA 1PMHX 5CAZA 1XYNA 5CZKA 3ST7A 2L9LA 3F2ZA 4YGDA 2XVGA 1GANA 1AR92 5DQ0A 2VH9A 3VBUB 1VP6A 5E16A 1E5IA 2ORXA 2C1FA 5HXVA 5K0UA 5JPMB 4N90A 4FAGA 2W08A 4HZFA 5FUPA 4K1ZA 4XHBA 4ASKA 5IATA 2H6CA 1REEA 4QX5A 4JDOA 4MXWB 3VN4A 5KR7A 4OZXA 4WM7C 4A2UA 2VUCA 2W1SA 1NE4A 5LWBA 3FLRA 1O59A 4FPKA 4LO6B 3SITA 1S0EA 2V09A 1NLQA 1D4VB 1S0FA 4GH4A 4NHXA 1WCKA 1GWKA 5FZDA 1RUJ3 1RUH2 2JXAA 2PLV3 1F15A 1NLSA 4AVBA 3VDDB 3VV1A 5C4WB 1KJLA 2RR11 2VBPA 4YGCA 2DUOA 4QX3A 5FBZA 4A7YA 4IEZA 3VBOC 4BIOA 3J7NA 5A3LA 5A7WA 3IPVA 3WQ1A 4Y1VA 1NCQA 4CU8A 4FAHA 1IS5A 2VPVA 2QQLA 4XFHA 2W3JA 1BK0A 4AXOA 1UYPA 1XSRA 4A6SA 2VNGA 4KBZA 2P3YA 4JGZB 1LRHA 4XF9A 2VCAA 2PA7A 3FMGA 5A7OA 5C3RA 5H9RA 2OQ6A 1HRV1 2P3KA 2PHWA 3AP5A 3S5QA 1F9KA 4DXSA 5E89A 3E5QA 4CE8A 2YYOA 1CZSA 1O91A 5CU1A 3LDRA 4XZPA 3HQRA 5T55A 1ALYA 1PVC1 2OW4A 2XJVA 3ZXJA 5ABJA 1POV0 2XJSA 1AL23 2RS13 4QPGC 1AZDA 2CWMA 4AQTA 1ULCA 1VALA 5H9SA 2PAEA 1H6XA 4KL1A 1LTEA 1DFQA 3GHNA 4CDQC 1Q8QA 3D5OA 5FYIA 2WZR2 2AEYA 1LESA 2W95A 4BK4A 1LGNA 1QJX2 2GH8A 4HETA 3TBDA 3WZ1A 5EHDA 4MLOA 1HN0A 2PHTA 3SEEA 4W6YA 4IV1A 4Z1VA 1JYTA 2IFRA 4P08A 2VTXA 1W05A 2ZGLA 1V9U3 5FMCA 3CDZB 1Z0HA 3KT4A 1O6UA 3PIGA 2DYCA 2WT1A 1SQ4A 2CSGA 5HI0A 1OMIA 2ZA9A 2W1UA 4CDXB 4P9YA 3ZYBA 4J1XA 2ZEWA 1YQ6A 5A6QA 4XJ9A 1F2NA 1K5MB 1DGWA 1XNCA 3OEAA 3HIFA 4KG0A 3ZYRA 5FZ7A 3TNQA 2O1QA 3SHRA 1SLBA 5C70A 1MEC3 3O1MA 2QQJA 2RS32 3W58A 1QJEA 2GP5A 2XVKA 3O0VA 2J42A 4AVCA 4RS5A 4BMBA 5BNOB 3K3NA 3KT7A 3UKNA 1QMJA 1AR61 2HWC2 5JR2A 1W2NA 2ZS6B 4RHV3 3IB3A 1W6QB 1JUIA 5FLHA 3NKGA 1JZ2A 4W6WA 4AQSA 5A7QA 2OPKA 4XF1A 4DEVA 1PO23 3VDAA 4XAEA 2VZTA 1W3VA 4LOSA 2IXKA 3M70A 4NROA 1RXGA 2E33A
chains in the Genus database with same CATH topology
3KMHA 3FZ3A 4IV3C 2UWCA 4Q0UA 2VVFA 4PBPA 5F5QA 2NMNA 4KBBA 1H4HA 1DYPA 3X29B 3O0XA 4FOQA 1V6MA 3AFGA 2I2SA 4BMEA 2KA3A 5FLJA 2W68A 4FPEA 4WM7B 1JUHA 4WVMB 3EO6A 3VLBB 3CNAA 2A5ZA 2LTNA 3WX5A 2PHFA 2WS92 1Q5OA 2E63A 3H1WA 1QDCA 4NWWA 4U36A 1VBC1 3GZUC 3IMNA 2HKXA 4YG6A 4EJRA 3N7KA 2MEV3 4NVPA 3RWNA 2EALA 5DG2A 2XGXA 1YFYA 3MPPG 1LB2A 2JE7A 1RITA 3MI8A 2BTVC 1H1AA 1WBFA 5FREA 4DMIA 1NY72 5HCAA 3HQXA 5EWSA 1RUNA 3NW4A 4FOYA 4XE9A 1GKBA 2HWF1 2OYZA 3WG1A 1W6PB 2XJUA 4K8FA 5K0UC 3JB4C 1RL3A 4R9CA 2YV8A 3ELNA 3B7MA 1Q56A 4HKWA 4LTAA 4CTEA 1NCRC 1VJ2A 4LBQB 4QPGB 3OTFA 5KXDA 4Z92B 1R092 2IWGB 4C0HA 1RUE1 3THPA 1DZRA 1YCIA 4N43A 4CDQB 3R0RA 4BM8A 1NCQC 3ZSJA 4Q4Y3 1OFSA 1ZZ7A 1N3QA 2IFWA 4CEWA 1RVF2 5JAXA 5IT6A 1FXZA 1XE7A 3A0KA 3O14A 4XXPA 4DINB 1ASJ2 2FBEA 1AYM2 4PLNA 2Q0AA 3WXPA 2RMU2 3VKFC 3QCWA 1PK6A 5BXXA 2ZBJA 1XU1A 1RUC3 4Z2WA 3TNPB 4LBLA 5ABJC 3AMMA 3K48A 3OGJA 5T5JA 2VXRA 3BOWA 4S2HA 5FMOL 3U4XA 3VBFB 1R082 2ZGSA 3ZFFC 1CESA 4YW2A 3OF1A 3BOPA 2ZX2A 1O5UA 5HBAA 3Q9OA 4NO4A 1X8MA 4E2GA 1U5XA 4L8QA 1GZWB 1FT9A 4P9JA 5JOYA 1RUJ1 4O9EA 2PLV1 1TE1B 3IDEA 4LEJA 4EN9B 5KWRA 4TWTA 5I93A 3KD4A 2B9UA 3V0BA 1XYPA 2OA2A 2UY8A 3AB0A 1VBE2 1BKZA 3FFQA 4IV3B 3VZLA 1T6GC 2GC1A 5I0TA 2HWB1 3P3PA 2ARBA 2BYVE 4Q1RA 1DGRA 2UWBA 4FOWA 1XRUA 2K2SA 1ZBE3 5L19A 3AP6A 5LK5A 1CONA 2VULA 4PLMA 3RYPA 1IKPA 1PO13 2A70A 5L7OB 1F31A 1H1IA 4M01A 1C57A 3MIDA 5J96B 4GWMA 3U11A 2ZGNA 3M1HA 2Y38A 2VU9A 1C1FA 2IC1A 5FFOC 3WHTA 3OPZA 3U0ZA 1S0JA 1U5YA 1PNGA 3KCYA 3ZFGC 4KG8A 4RR3B 1WMFA 5T50A 4BLJA 4LE3A 5LEKA 2DUPA 4F83A 1LU2A 2BNOA 4XTPA 4LUKA 3VHNA 2NYYA 1V9U1 5BYNA 5HCBA 4JDMA 1N3PA 2DF7A 5K0UB 2LUWA 3MLKA 1CVNA 1LOGA 1HXS3 1QOSA 5IUQA 5FPXA 4UW3A 2XWJB 4M00A 5FTTC 2GN3A 2DCZA 2JICA 1G86A 3ZYIB 2XKPA 3WLUA 4GH4B 1SDWA 1V6IA 2AYHA 3JQWA 5JVVA 1G7YA 1SCRA 3GYDA 4JRAA 1H1MA 3AM2A 4FPLA 2DVDA 1N1YA 4YZ5A 4ITCA 3IPVB 1HRI1 2G4IA 1NCQB 4CP2A 4XFBA 5JOWA 3ALQA 2VUJA 4AFAA 3H9AA 1ZRFA 4YYOA 4AG4A 2VNRA 1BQPA 2HEWF 3SH5A 1KFUL 4FO9A 4L11A 2RE9A 5F6LB 1ZZCA 1AJKA 4CEYA 1AYN2 1PO21 4CP0A 3ZN5A 1BBT2 2WFF3 3ME2A 4MGKE 1AR81 1AXYA 2PHLA 1DU3D 4P9IA 3EJKA 2A6WA 3RJ2X 1FMD2 4AHXA 5ABJB 5I0RA 3PJYA 4RD7A 1QKQA 5JIAA 1OSGA 3R4UA 1H2NA 3WDWA 1COV2 1ZX5A 2XJRA 2DFCA 4N43C 4YW3A 4SLIA 3VL9A 2BBVA 1IS3A 1LECA 2VW2A 4Q4V2 1EAH1 1JXNA 4PQ9A 1UIJA 4R9DA 1VAVA 5JI7A 3JUUA 3D0JA 4Y26A 3AP9A 3LA3A 3AKPA 1JN2P 2BUKA 1X33A 1GSLA 3WCRA 2JG8A 3QD6A 2JG9A 4Q4W3 5GLWA 2WLQA 2A3XA 3SMHA 1VB2A 2Q30A 5J37A 5GJ6A 3MW4A 4D7SA 4DRRA 1UPSA 4QU2A 3FWEA 1GLHA 2ET1A 5JPNB 1ZBA3 1YLLA 3D82A 1TNRA 4D7TA 4RS5B 5GLZA 1BYHA 3I8TA 3U10A 2ZGRA 2WNUA 2R073 4DNYA 1MR5A 1HV0A 1FYUA 3NV3A 1UU4A 4DOUA 2EAAA 1MQTC 2JDZA 2RS52 3JU9A 1I1EA 1LOAA 5FAXA 1QQP3 4BOWA 2W52A 2MNGA 3VKNA 1B35C 3WQ7A 2QE3A 2NLRA 1H30A 4NHKA 3RDIA 4AW7A 4CRQA 4FPGA 1UW8A 2XJPA 2ZGOA 4GULA 1YUDA 1ZM1A 4FPYA 4HKOA 4K1YA 5DDJ3 4YM3A 3LOBA 2AZ5A 3GBGA 3S6PA 5F1RA 1PVXA 4A7KA 3R4SA 2VOKA 4E9KA 3WW4A 1UAIA 3RRDA 4XJUA 1L3JA 2B7YA 3ZDSA 3APBA 3N35A 1GV9A 1YRZA 2R49A 2XPJA 1AR71 1YFWA 2RR12 2WWSA 4Z1VA 4COWA 3IDCB 4XILA 4XQDA 4B3NA 3ZXLA 3JQXA 3RMXA 3IN9A 3CU7A 3UL2A 2GN7A 4XJAA 4HFSA 3D6EA 2X5IC 3ZXEA 3WT3A 3MIHA 1QGLA 4WM7A 3AXEA 5JR7B 1ZZ6A 4AFMA 1RUF3 1HRV2 1J1LA 3PTYA 4GWNA 3OD0A 1VBD2 3FUQA 5T54A 2GMMA 2UY9A 5KC6A 1C28A 4Y1YA 4COYA 2E51A 1PVC2 4D94A 3WDUA 1BXHA 1ULFA 3SCGA 3VBOA 1RHI1 2XB6C 2WSUA 1G9DA 1LU1A 2WL1A 3WP6A 1DGWX 2DWRA 5FOBB 2VMHA 4HVQA 3ZYJB 1UMZA 4QGNA 2C9AA 2A75A 2ZGUA 4YZ4A 3ZYGA 2GC2A 2Z5WA 4PBOA 5C6CA 3TN91 3T1LA 4QPIA 3RPQA 1U5IA 4AQ6A 1G8WA 1IS4A 3E6CC 2R063 4N43B 4N53A 4Y1UA 5DXDA 4AEDC 4P9WA 1ZBE1 4XMAA 3HN1A 4DQAA 2A71A 3B9IA 1PO11 4LO7A 4LO4B 2ES3A 4CEWB 4JGYA 1GQGA 5CA6A 4Q8KA 1QOOA 2ZABA 5JZGA 1AR62 1YNAA 3R4DB 1PK6B 1S55A 2W39A 3AMQA 4ZU5A 3GZAA 5AC93 3MDPA 4GKXA 2QDRA 5BNPC 3KCCA 1REDA 3J26N 4FOVA 1DQ6A 1HXS1 3CF6E 4FT8A 3I59A 1CN1A 2FMDA 2Q1ZB 2C5DA 4BQ1A 4M3CF 4JC1A 4XFFA 5GZCA 3O7OA 1MS9A 3VKOA 4AFCA 5SV5A 1DQ2A 2JG8C 3PMEA 1Y3TA 3DUIA 1LEMA 1LOEA 4AI3A 3NWKA 3V0BB 2E53A 4JQRA 1KD7A 3MEPA 5FPZA 4YVWA 5JLVA 4HMZA 1GBGA 5FRAA 1D0GA 2XLAA 1VBC2 2DU1A 3B00A 1QJY1 4AGVA 2JJ6A 2UYBA 2VMIA 2WNUC 3H3UA 1RUI2 4Q4X3 1AL0G 1SBFA 2WFF1 2QZ3A 1C8M3 1V6JA 1TMF1 3NL1A 4NR1A 1ND2A 2HWE3 3HMYA 1PIV3 3PVNA 1D0HA 3SCHA 2HWF2 4NOTA 2XJTA 3AZVA 3K51A 4JCKA 3TWIA 1SLTA 2WNEA 1R1A2 4F7ZA 2NQYA 1QXPA 3GNEA 3DL3A 1X7NA 5J48A 3FHIB 1XYOA 4OVEA 1URXA 2B42B 2VY0A 2XJQA 2DCYA 2D7FA 1MZEA 3RG0A 1ZREA 3BTAA 4Q4W1 4YG0A 4XF4A 4S2FA 1XNBA 4BIFA 4Q8LA 1WLWA 4KU8A 5IK4A 4LBJA 2JKBA 1MVQA 1VIWB 4ES8A 1CAXA 2WINB 1M06G 4MVTA 2EIGA 1NCRA 3ILRA 2R1DA 5ACA2 3HBZA 2PHXA 4HK8A 5CBLA 4MGZE 1RUH3 2W0XA 5I8SA 2GSYA 3JBG3 1QQP1 2A6ZA 1Q3EA 5CADA 4HPKA 1VRH3 3HT2A 2ZX0A 4CEYB 1OQ1A 3ZN4A 1XE8A 3MW2A 4MGIE 1J59A 2XH6A 2ATFA 3N4MA 1J3PA 1RTVA 1VBA1 2ERFA 1QH7A 2KXLA 4XYXA 5CAZA 1RUG2 3BPZA 1D2QA 1Y43B 1TEIA 4FTSA 3JD73 4IEQA 5BNPB 2BFUL 3H7JA 4QPIC 3RNSA 3SCFA 3E5UA 3WDXA 2PLV2 4TZDA 3CJIC 4G9SB 1W2UA 2BNNA 4PIYA 4N53C 4HBNA 4QQLA 4K6BA 1YIFA 4QMAA 2HJIA 4Q0PA 2O8OA 4LHKA 4BE3A 1TME1 3GBFA 4Q29A 1S0DA 4RGAA 3AJZA 4Q0SA 1PGW2 3BB6A 4BLIA 2HWB2 4W6XA 1QJX3 3ZFFA 1OLQA 2JG8B 2MHFA 2P2KA 2JG9B 4JGYC 5J36A 3MZHA 1RUF1 1ULDA 1POV1 1E57A 3O0WA 5JZGC 1W6MA 2I74A 1QNYA 1UU5A 3UJOA 3AYAA 5JSRA 3D0SA 4CDUC 4GMP0 4LO5B 1AX0A 2XL7A 3VBHA 2WNUB 3S30A 1U0AA 1FNZA 4AYUA 1Z78A 4MGYE 1WBLA 2RS33 3PVOA 1YI7A 5CB7A 4FSJA 2JECA 5K7PA 1OOPC 1MS1A 1OI6A 1V9U2 2GNDA 2HWC3 4WV8A 1WD3A 5KBFA 1DIWA 4QXKA 1SLAA 5DG1A 1N1TA 2BVVA 1AXKA 3QH7A 3GBWA 2V73A 1QY4A 3WD5A 5I8TA 3I2DA 1HW5A 2ZZJA 1Q8PA 2ZJCA 2TUNA 2ZGPA 1CAVA 1U5ZA 4A7ZA 4YVWC 4E4DX 4IEOA 3AZWA 3ZFGA 1ZYBA 3ZPYA 4FPHA 5FCCA 2WLPA 2D5FA 1NE6A 4ATFA 4H55A 1WW6A 4Q0QA 3VBRA 2DUQA 1FOD1 4NHMA 3JB8A 1HRI2 4YARA 4ZU4A 2IXIA 1CAWA 3IBMA 2DU0A 1CAUA 4WVZA 1ND2C 4Q1PA 3THTA 2G9GA 2ILMA 3AKQA 3VKMA 3WR0A 2ZX3A 4XW3A 5AC91 1UKRA 3MIEA 3WP5A 1DG6A 2ET7A 4Z07A 2XVLA 4EV0A 2Y0IA 3IIAA 3ACLA 4YW4A 1WCDJ 1AR82 2OUHA 3LA2A 2GNBA 1RJ7A 3ZXAC 1C1LA 4R8HA 3FBMA 3EQEA 4FPJA 2JEMA 2P37A 3VBOB 2VG9A 3C3VA 5JSPA 3A0NA 4NN0A 1QDOA 1XQNA 3AP7A 1WUVA 1LOFA 4WM8A 3NVCA 4I02A 4L9BA 2WIIB 4HVRA 1VB4A 3S0MA 2GDFA 1EAH2 3N7JA 3OBTA 4QPIB 3ZMNA 2F4PA 4HLTA 4PJYA 4BZ4A 2VGDA 2B46X 4N53B 2WJSA 4Q4X1 1C4RA 1NQJA 1LHNA 3ZFEC 3LSEA 1WGPA 1C8M1 4MYEA 1G9FA 4IL7A 3VZNA 1ENXA 4B7KA 3LWCA 2XKOA 4JGYB 2WNVC 4ASLA 4OUSA 4AHWA 4PIXA 1O3RA 2YGMA 5JZGB 5CG9A 2WA4A 1RVF3 2EXHA 1LEDA 2EXIA 2VOWA 1IQAA 1AYM3 2E7AA 2HEVF 3PMSA 2RMU3 1PGL2 4BH9A 3J9SA 1W0OA 2PHRA 3V56A 1W6OA 3VL8A 4Z8BA 1NLRA 4LNVA 3POWA 1DLLA 1UZZA 3I59B 1FPN2 4K7JA 1R083 1NOVA 4AGGA 2NZ9A 5T5LA 1ENRA 2OIIA 2WC2A 1DDLA 1A3KA 1AR72 1MQTA 4AGRA 5B2GB 1PHMA 3BU7A 2R30A 1B35A 2HEYF 3LA7A 1RUH1 4GB33 1CD3G 4FPCA 2LM3A 1CJDA 1X8EA 2YMZA 4HN0A 4YVWB 4FTBA 4PIZA 5KHJA 1KQRA 3JBG1 1G6NA 1UN1A 1C8NA 1G9CA 1VRH1 3LCPA 3WW1A 4DPNA 3VBHC 4P9GA 2R1BA 2GALA 3SLIA 2D5HA 3DV8A 1XXNA 2VUAA 2D6LX 1RUOA 2YUEA 2BVBA 1ND2B 4RQPC 4K9SA 3VGIA 4EWDA 5FO9B 1RHI2 2SBAA 2AREA 3HR9A 3USUA 1ZRCA 5TSWA 3JD71 1OKQA 4JTOA 3ZXKA 2BWAA 2JE9A 3DPRC 1HLCA 2X5IA 1IPJA 3VHRA 3WHUA 1MZFA 1AL21 1RUD3 2RS11 2YDEA 3IKWA 5D1IA 2NPIA 1S2BA 1W39A 4LA2A 3TN92 4MX3A 3OYWA 3TB0A 3VZJA 1FI2A 1MZ6A 4UW6A 1FX5A 3VBRC 1ZBE2 4YLZA 4K20A 4DB5A 3JCIA 4URTA 5AVPA 3WW2A 2GMPA 5GM0A 4QT6A 4Y22A 3ATGA 1CAXB 3AFKA 3FUOA 1MS4A 3UK9A 3M3CA 3KGZA 1DHKB 1NCRB 1A78A 2JENA 2CGOA 2RS31 3TRSB 4UBGA 1MEC1 4Q27A 4Q26A 4ISRA 1G9AA 4L92A 1UF2C 5T5OA 4JTNA 1REFA 4AEDA 3KB5A 2R16A 4HPKB 5JOZA 1J1TA 1H8TA 2TBVA 4FVVA 2HWD3 1LOFC 4RHV1 4WM8C 4YM1A 3SH4A 4AWDA 2D6OX 4CYDA 4YFWA 1ND3A 1BBT3 1W0PA 1MZ5A 4Y1XA 1DYKA 1KXGA 1AHSA 3MYXA 3POSA 4I2OA 1EV12 2D6KA 1FMD3 5CG8A 1EP0A 3RI9A 4U2AA 1UIKA 3ENRA 2AGSA 4J6GA 1ENQA 5JDBA 1NXD1 1JW6A 3WNXA 5BNPA 1PZ8A 1COV3 1VBB2 1KFXL 1LENA 1OLRA 1DQ5A 2XBO3 1DQ0A 1QJU2 3ZX7A 1D4M3 5EXOA 2R0HA 3AZXA 3ZFFB 4EN8B 3VBSC 3H3ZA 2ZX4A 4OI0A 1QJY2 4LHLA 2DVFA 3M3QA 4PF5A 2YROA 2FZ2A 2ZHKA 2AENA 2WFF2 1SLIA 5LRSA 1SFYA 3CEWA 4DZGA 1OQDA 1TMF2 1W6MB 3DF0A 3FLPA 1AUYA 4YGEA 4IEUA 1I3HA 3N36A 2BNMA 1GFF2 4YM2A 3TYJA 1HV1A 2MEV1 4I30A 3M3EA 2QUOA 2WKKA 4XFCA 4MSVA 1BZWA 2YHJA 4I09A 3VBHB 3WP4A 3L9JT 4S2GA 1SBDA 1R1ZA 1DQ1A 4YM0A 2A6YA 3I54A 5JIUA 3LKJA 2XLFA 4L2NA 2BWCA 4FXGB 5IK5A 4NPRA 3AMPA 1W6NA 5FQ0A 3B69A 2QQPA 2RS53 1MACA 3DPRB 4OHXA 4RL7A 3QLQA 5C9AA 3BIWE 1TNFA 2UU8A 4I0AA 1H9WA 4AVVA 4C90A 1SMVA 2Z69A 2VOVA 1BEV3 1CAVB 1JBCA 5CFDC 3ZFGB 4AE2A 4FP2A 3ZSEA 2ZMKA 5JCTA 3AYCA 1FV2A 3AZZA 2BPA2 3VBRB 1RIRA 4FQZA 4UW5A 4ISQA 4Q4Y1 2RR13 1CAWB 2WQZC 1CAUB 1GZCA 4M3CE 1QQP2 1LHWA 4QHBA 4MV2A 1AYM1 1H9PA 4F8AA 3O12A 3WVJA 4XF3A 2H0BA 2RMU1 4FQ4A 4XJ8A 2FQPA 3WP3A 2QCSB 4YZ3A 5A33A 1RUC1 1WA4A 2ZGQA 3ES4A 4XFGA 5GKAC 1VBA2 2O0OA 4FBFA 1DBNA 1VBD3 3T2TA 4IXLA 4GALA 4IEYA 2GC3A 1R081 1OD5A 1CIWA 1N47A 4ZU7A 4OFGA 4JVAA 3UKVA 2YZ4A 1ULEA 1OA3A 2D98A 2FZ1A 3AXDA 1DGLA 3N7LA 4WM8B 3VHOA 1TME2 2VOXA 3KSCA 1RGSA 2Z42A 2B8MA 4GB31 2JD4A 1QJZA 1WCSA 3ZVXA 4LR4A 4KNCA 1AVBA 3KGLA 4UXAA 2Z79A 2N7GA 4QM9A 4GMP3 2DTWA 3WUDA 4JRLA 4QGMA 3LAGA 1O4TA 5CFCA 1HQLA 3CJIA 5FMOS 3KZ4C 3WG2A 4E27A 2EF6A 5JMCA 3RYKA 2A6XA 5EFUA 4LLFA 1ZA4A 3GALA 4D69A 1BCXA 4FCAA 1H8TC 5LK7B 5C33A 1A6CA 5KC5A 3M3OA 3ZMOA 5CIRA 3VBUC 3MPBA 2XUMA 2QFEA 4AFDA 5DUWA 1LHVA 2D44A 1RUD1 1BMV1 5AFBA 1ND3C 3FJSA 3CLPA 3QACA 2A7AA 4H14A 2CYFA 1KDKA 5IK8A 1W6OB 4PCRA 4K3UA 4CDUA 1N3OA 2GU9A 2P3IA 2B45X 1HQNA 3VDDC 3L2YA 4QQ2A 5DZGA 1RINA 1RMU3 2TEPA 4KQ7A 3VZKA 1BVVA 4Y24A 3ZXGA 5AFEA 4KWLA 4B29A 1MQTB 4M0NA 1OOPA 1FOD2 1Q8VA 1JTZX 4HSLA 3DN7A 1B35B 5C8CA 4JGZC 4BCUA 4WZCA 2PFWA 5KXBA 2QJVA 4NWVA 5AC92 1QXJA 1SFNA 4FPOB 4EN6B 3B01A 1O5LA 1N1SA 4E2SA 2HWD1 1Q8SA 2DCTA 4IEXA 2GNTA 3TOJA 4C1XA 1RC6A 2AR6A 5E8AA 1RUI3 2ZACA 2B5HA 3USUB 1I9RA 2IZWA 1S1AA 4R9BA 2RM23 3VZMA 1SLLA 1S0GA 1FAYA 2X8KA 3UKTA 3A4UA 1D2SA 1APNA 5F6KA 4XMIA 2E9QA 2X5IB 5C9AC 2DCKA 2HWF3 4P9XA 1Y9QA 1OA2A 4LBOA 1GZ9A 3C2UA 4D7YA 2XBO1 3OYWB 4GIQA 4H3WA 4JV4A 1R1A3 4B4RA 1D4M1 1S0IA 1WLCA 3J8F3 3MFAA 1V70A 2E7TA 2R043 1BVP1 1Z7S3 2QZ2A 1KRIA 1LCLA 3KT1A 4UBHA 4KGQA 1O3TA 5BNOC 1UKGA 1C8M2 5EYYA 1RUE2 4XF0A 2GNMA 4DY5A 4J1WA 1WW7A 3AP4A 3PVEA 3MICA 4Y22B 4AEMA 1AR93 2QNKA 1H4GA 1OA4A 2G9FA 5H9PA 4MUVA 1CJPA 3IT8A 4QM8A 4I3GA 3RYRA 3GF6A 1ZBA1 4YFZA 4AI2A 3KM5A 5ACA3 4OHZA 2Q8OA 4E4ZA 2AUYA 5EJ3A 2A6VA 3WV6A 5KXEA 5KXCA 4PLOA 1WLDA 2R071 2ZKLA 3NAPA 1AX1A 4AEDB 5JI9A 2ZHMA 3E6DA 3ZFEA 4BWOA 3B3QE 1H8TB 2RS51 2NP0A 1CPMA 2Q4SA 4X6RB 4X6QB 3HT1A 4COUA 2WNVA 2CWSA 2UWAA 1ND3B 3AX4A 3ECQA 3NV1A 5JWPA 1BEV1 3WG4A 3ZSMA 1ZZ9A 3HAGA 5K9YA 1YFUA 1AX2A 5DDJ1 3MFCA 1RUG3 4LBKA 1X36A 4QD2A 4KH9A 2PHDA 2VMGA 4YVSA 5CFCC 1VAMA 4KU7A 1TQ5A 5JSOA 1A8DA 3KCXA 1RUJ2 1LODA 3AK0A 3DKWA 1EY2A 2QKDA 3NKTA 1X50A 4E4SA 3JBG2 3E6BA 4LLOA 1VLNA 4SBVA 1ZZ8A 3AYDA 2DFBA 5KHGA 1VRH2 4XHXA 3QBQA 1NA1C 5E1RA 2HWB3 1OHFA 1AXZA 4X8NA 4BA6A 2WZR3 4GQ7A 3U07A 5L73A 4MZUA 5DZEA 2ZHNA 3NV4A 5DUVA 2D3SA 3R05A 3LGRA 4B4PA 1VBD1 5BNNC 1QXRA 1YJKA 4W65A 3JD72 1XNKA 4TSVA 3VZOA 5K8SA 4JDNA 4WBBA 1AL22 2RS12 1YFXA 1O4ZA 4AVTA 2DTYA 4N7UA 1W6NB 2A3YA 2O8QA 2Q1MA 5FQ0B 2P3JA 4LA3A 3MIBA 2PYTA 3ZYPA 2D6NA 4I0BA 4RQPA 3ILNA 5C9AB 3M2MA 2RJKA 4GMP1 2CNAA 3S7EA 3L2HA 5C8CC 1EPZA 2VQ0A 3M7AA 1WD4A 5AVAA 5GZEA 3DPRA 1V00A 2R061 4QPYA 2D3PA 4LUMA 4M3CA 2WFPA 3ETQA 3G6JB 3IWZA 2Q5TA 3WOGA 3AYEA 3KQRA 2GMEA 4XFIA 1OPMA 4Q0VA 1UD1A 1MEC2 4R9AA 3RI8A 1Q8OA 4TYSA 2K0GA 4META 2R6QA 4IQPA 3EBRA 1LJ7A 4Y1ZA 3MIGA 3B9CA 1UCXA 1HRI3 3OY8B 2QVSB 1UX6A 3VBFC 4A3XA 5IK7A 3V0AA 1ZRDA 4UW4A 4Y20A 4H7LA 1CR7A 4YW1A 2Y0OA 4RHV2 5A33B 3EXUA 3T1MA 3M3IA 4Y4YA 1PO22 2I45A 4E2QA 3RQ0A 3V64A 1AR83 1H2LA 1ULGA 4OHWA 4R4ZA 5F9TA 1RMU1 2WS93 5GLTA 1QF3A 4K21A 2P17A 3POYA 2VQAA 2XLGA 4LO8A 3RSJA 1DGRN 4YNIA 1OFNA 2WQ4A 3OBRA 3ZN6A 4AEKA 2BQPA 4ONUA 2CAVA 3MLLA 2QDNA 3J4UH 3WDYA 4HT1T 2BGCA 1EAH3 1JHNA 5L7OC 4QQHA 4KWKA 4C1WA 5CFCB 4AFBA 2ZMNA 4P9LA 3HWJA 5GZDA 2IXJA 1H8VA 3CJIB 3IDBB 1RUI1 1SEFA 2MEV2 4RR3C 2CY6A 3NAPC 4ZKTB 4RSUA 1R093 1NA1B 2RM21 5BY5A 4EN0A 1J3RA 4Y5Z0 1WLTA 4ORFA 1LOCA 5FOJB 2HWE1 3WDTA 1PIV1 1PNFA 3VBSA 3KS7A 4AQ2A 3VHPA 5BNNB 3FC0A 3RJRA 4XEZA 4EWAA 4NHLA 3LB9A 4AHZA 1R1A1 2H6BA 3AKRA 3J8F1 1ASJ3 4IETA 2CGPA 3RS6A 2R041 4CDUB 1Z7S1 4GH4C 4P5HA 1JH5A 1PGSA 4YVSC 2GAUA 4ES9A 2DV9A 1YJLA 2HYKA 4N7IA 4CDWA 1NXMA 5DZFA 5I0UA 3ZO0B 2GH2A 3ILFA 1JOJA 1SCSA 3QOPA 2ZAAA 1FPN3 1AR91 4D3WA 2X53S 3ZXFA 4OLLA 4R52A 1OOPB 2K9ZA 2ZPXA 1YI9A 1S0BA 3PNAA 2CGNA 3I7DA 5KHKA 2IXLA 4Q4Y2 1AR73 5C8CB 4OUMA 3OCPA 4PDWA 3PJQA 2WZPP 3RZZA 4AVSA 5ACA1 1EPWA 3CL1A 4XPVA 1BJQA 2X29A 4XXAA 4XBQA 1YO8A 2JX9A 1IKQA 1LULA 1RUC2 3GHMA 3N3HA 4EROA 2MPFA 2Z2SB 5CFDA 5A32A 1PMIA 5GALA 1SLCA 3ZIXA 1HIXA 2CL2A 2XL9A 1VBE3 1PZ7A 5GZFA 3SISA 1IOAA 1KS4A 4XOGA 4FXKB 4OHVA 1V6OA 1NG0A 2FHRA 1QHDA 5FDBA 2ETEA 1RHI3 2PQQA 4IV1C 1RUG1 1J3QA 2DCJA 3BODA 5A3MA 1QH6A 3MGUA 4OI1A 3WCSA 5T52A 1O7FA 2P34A 3H1YA 2XHKA 4GB32 4YZ2A 5J7MA 2NMOA 1ZZBA 3S7IA 1VAKA 3MF9A 3PVBB 4IERA 5GLVA 3MIFA 2WSVA 3BALA 3TN93 1PGW1 4QGLA 1CPNA 2OZ6A 5EV7A 4XFAA 4QQPA 2WZR1 1DZQA 4HSJA 3AZYA 2WA3A 2ZMLA 1QJX1 4RS5C 5FO7B 3VUOA 1V6KA 2NM1A 1UU6A 5EZWA 3LZZA 3W59A 2GZWA 5FO8B 1EYBA 3AMNA 4XQWA 1SACA 4C91A 4EN7B 2PTMA 3LSDA 2F6BA 1PO12 1YXWA 2BFUS 2PHUA 2ZTNA 3SH3A 4RGGA 1RUD2 1BMV2 3N7MA 4X8PA 2SLIA 1GQHA 3I4IA 3O5SA 3NAPB 1MS0A 1RJ8A 1V6LA 2ZGMA 3ZFEB 2A73B 2ZAHA 3B93A 4LBQD 1G9BA 3URFA 4COZA 3WUCA 1OPOA 3DGTA 1F8VA 1Y7BA 4Q2FA 1GNHA 5KHIA 2HWC1 4N9IA 2WNVB 4G3YC 5D8AA 1AF9A 3OJBA 2ZKNA 3ZSKA 1ONAA 5GZGA 3OGGA 1MS8A 1LHUA 4AVAA