3MLJA

Reduced (cu+) peptidylglycine alpha-hydroxylating monooxygenase (phm) with bound carbon monooxide (co)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
310
structure length
310
Chain Sequence
ECLGTIGPVTPLDASDFALDIRMPGVTPKESDTYFCMSMRLPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWFCDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKDCSGVSVHLTRVPQPLIAGMYLMMSVDTVIPPGEKVVNADISCQYKMYPMHVFAYRVHTHHLGKVVSGYRVRNGQWTLIGRQNPQLPQAFYPVEHPVDVTFGDILAARCVFTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKYALSFMTCTKNVAPDMFRTIPAEANIPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Differential reactivity between two copper sites in peptidylglycine alpha-hydroxylating monooxygenase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords Peptidyl-glycine alpha-amidating monooxygenase
total genus 68
structure length 310
sequence length 310
ec nomenclature ec 1.14.17.3: Peptidylglycine monooxygenase.
pdb deposition date 2010-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01082 Cu2_monooxygen Copper type II ascorbate-dependent monooxygenase, N-terminal domain
A PF03712 Cu2_monoox_C Copper type II ascorbate-dependent monooxygenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3mljA02
2.60.120.310 Mainly Beta Sandwich Jelly Rolls Copper type II, ascorbate-dependent monooxygenase, N-terminal domain 3mljA01
3MIFA 4R4XA 1YIPA 3KS7A 1PNGA 1OPMA 3MLLA 1PGSA 1SDWA 1YJKA 3MIHA 3MIGA 3PMSA 3MIEA 1PNFA 3MIDA 1YI9A 3MICA 1PHMA 4R4ZA 1YJLA 3MLKA 3MIBA 3PHMA 4QHBA 4E4ZA 3MLJA
chains in the Genus database with same CATH superfamily
4Y4YA 4QPIC 2RR13 4ZY9A 4UBHA 1IQAA 3DYOA 3M7AA 3WG4A 4YZ1A 2W39A 1ENRA 1W0NA 1QJX1 2Y60A 4NPLA 5F3GA 2Q8CA 3R4UA 1UU5A 3B94A 4BXFA 1GYKA 5FZKA 3R4DB 5FQ0B 1J3QA 2O1QA 4XCBA 4Y22A 1BMV1 1V6MA 4GH4B 4Y1UA 1UNBA 2HWF1 4URTA 2J1SA 4AHZA 4NN0A 4O9EA 5LA2A 2Q8OA 1XYPA 2RDQA 2RS33 3C7FA 3IIAA 2B4KA 1CQ9A 5C3SA 3MW4A 3NNMA 1K3IA 3DPRA 4D6RA 1A34A 1HJGA 4Q0SA 2QQOA 3RRDA 5T54A 3AVRA 1R092 1B09A 2SBAA 1PGW1 3BIWE 5IK8A 5FK8A 4ISRA 1NLQA 4B3NA 4QPYA 5GLTA 5E88A 3O0WA 4PI0A 3WP5A 4ZZ8A 3FLTA 1R081 3WNKA 2J1UA 3RI8A 1VRBA 2YFZA 3O0VA 4CCNA 1DIWA 4O9GA 1LEMA 3ZR5A 2WAOA 3ZKYA 5HCHA 2VQUA 3E5QA 1CN1A 5FYHA 3T4HB 2I07B 3NNFA 2XGXA 1OLMA 5EQUA 1CR7A 4DFSA 1UOBA 4OUEA 5FZ9A 1B35A 1GOGA 2VCCA 1AJOA 1LECA 4NHXA 2E31A 2Y8KA 3LDRA 1VAVA 3NJZA 2X8KA 1XBFA 4Q27A 1WW5A 2PLV2 3ZR6A 3MV11 4MGYE 1DQ5A 4BDVB 5J48A 3Q8BA 1JHNA 1YLLA 4JHTA 4HL0A 4Z82A 1KS4A 4NHMA 5JWPA 2R072 4GXLA 4AHWA 2ZGPA 4A41A 1REEA 2WFPA 3AM2A 4OVEA 5A80A 3LA3A 4WM8A 5FO7B 1NUKA 2BV4A 3K4ZA 1QEXA 2YXSA 2PELA 1DZTA 1UMIA 2K9ZA 1G9CA 1QJZA 4CDUA 1FAYA 3VKNA 2XR4A 4Y24A 5C9AA 3WUDA 5A3PA 5A3LA 1VBA1 2VZRA 1CX4A 1S2BA 1QJY2 2WIIB 4AI1A 4M3CF 1K42A 1IKPA 2CV6A 4R4XA 2ZZJA 1UYPA 1D4M2 4Q1PA 5ABJA 3UJOA 1OFNA 4IEZA 3MLLA 1EV13 1RXFA 1W9WA 2R043 5L73A 3QACA 4TZDA 1SDWA 3BOPA 3KVAA 4IE6A 4LHSA 3L2HA 1OD5A 1GZWA 3LKJA 4CCEA 4XAAA 4FFHA 1RUC3 2J1AA 4NAOA 2BOJA 1PK6B 4IGPA 1KEXA 3I8TA 2ILMA 1FATA 3GM8A 3UGHA 3ZN4A 5F9TA 4Y1YA 5L9VA 2ZOEB 3D6EA 5BY5A 4LOTA 2JDYA 1R093 5LZ6A 3OOXA 5A3NA 3MV01 4FCAA 4MO3M 2WWJA 1Y9QA 4IV3A 1D2SA 5BNPC 3TEZA 3ZXJA 1JHJA 2VZUA 3AC0A 2FDIA 4IL7A 2CGPA 4GULA 1S2KA 3IAPA 2FBEA 2QZ3A 1JN2P 2WLQA 2XKOA 3H1MA 4M3CB 2EICA 5C70A 3A7QA 4XXPA 3VD7A 3WXPA 2RDRA 4BISA 3CJIA 2D97A 2D43A 1QJX2 2D6PA 5C8WA 3O1RA 1YUDA 2Y33A 1QQP1 5DAVA 3MBWA 3O1VA 5HBAA 3PUSA 1M4WA 4YG0A 1J3PA 1UMHA 4BPZA 1H0BA 4XQWA 4YG3A 5DAXA 4YZ2A 1BVVA 1XU1A 2RJKA 5JXJA 5FXWA 2J42A 4PJYA 2IUWA 5KXBA 3WF2A 1O6UA 1QQP2 2OZJA 1HRI3 3I2HA 1NZCA 1K5MB 2WA4A 3KCCA 3ZXEA 1EP0A 5FUPA 1UMZA 4P5HA 4LK6A 3WDWA 4ATFA 3J8F1 5CKNA 3PJYA 4I3GA 1W2TA 3MIGA 2XDVA 1W28A 1W9TA 4CRQA 2ES3A 3IAQA 3KV9A 4GKXA 1QQP3 1Y9GA 3WVJA 1RHI2 4PDWB 4AVVA 1A8MA 2ZX4A 1IPSA 1HB1A 3UETA 4CDWC 3HT1A 1ZRRA 4CU8A 5BNNC 4AFAA 3WCRA 3FX3A 5FY5A 5A7SA 1JYWA 1W9SA 4XUPA 1ND2A 3NWKA 1QIQA 4BK5A 1PMIA 2XVLA 5F5IA 5AVPA 4FTEA 4D6QA 3PVNA 2MEV3 3T2OA 2VO5A 2BBAA 5C3QA 1X9PA 1YQ8A 2B5HA 4PCRA 4RHV3 4K8FA 1CD3G 2BQPA 1MACA 1C5IA 1PGSA 4EWDA 5JLVA 1ULOA 5I8SA 5BNPA 1ZBE1 1RUE3 1PNFA 1XNCA 2R0HA 1RUI2 2Y6JA 2VY0A 3O14A 2QQPA 1ZBA3 2DUPA 4HZFA 4I3PA 4IGOA 4QX2A 5AFBA 3O1SA 1NCQA 5FPAA 2AREA 3ACIA 5FUNA 1TNRA 3RJRA 1AVBA 2RS53 1B35B 4Q26A 2BP6A 3IB3A 4QGMA 1ENXA 2FHRA 2WDBA 3SCHA 2OQ6A 3FLRA 3ZSLA 1WBLA 1S0EA 5AC91 4LO8A 3OBAA 4OHZA 4AVCA 5JOYA 2PHDA 5BPXA 5FP4A 2VJXA 1ACCA 3IDCB 4NHYA 1R1ZA 2NLRA 4Y20B 2W1SA 3G7DA 3OYWA 4CA9A 4CYDA 1XSQA 5FYYA 1JYXA 4HFSA 4E4SA 2VCBA 2XHNA 2ZX1A 3G6JB 1WMDA 4RA0A 4RGKA 1W6PA 5IVEA 1RUF1 4RN5A 1ND3B 3LSEA 3NV4A 4FI9A 3U37A 1REDA 1YQ2A 2A3XA 2ZX2A 1JYIA 5EJ3A 3MICA 3ZSEA 3H8UA 3N4MA 1J59A 2JB4A 4GWIA 1RHI3 2K0GA 1LGBA 5F1RA 1YWKA 1SLCA 3UK9A 5K9YA 1NA1B 1HJFA 2UYAA 3IMNA 4EN9B 3KF5A 5KHJA 4MGTA 4DNYA 4FAHA 5T52A 1HDKA 2R061 1OLRA 1VBA3 3T30A 3THCA 4D6SA 3U10A 3I59A 4G3YC 1YQCA 1FPN3 1C57A 1SFYA 2O8QA 3NNJA 4HKWA 3ZSJA 2AYHA 4HANA 4URAA 3N9PA 5C7GA 3GBWA 2WNUA 3I3BA 4DIQA 1OHFA 1U5YA 1VBA2 2J1RA 1J58A 3KT1A 3MHZA 5JZGA 2GSYA 3IM0A 3IDAA 4K1ZA 4FPEA 4WV8A 2WO7A 3HQUA 2Z4FA 4YW3A 4CDQB 4L97A 4ZU5A 1MEC3 3T3YA 3HAGA 2HH9A 3JD71 3PJQA 2QDRA 4UFKA 1RITA 4N9HA 5C6CA 3V0AA 1GICA 1AZDA 5CU1A 5F5CA 5DUVA 4E4ZA 1GSLA 3ZN5A 1PX3A 3P6BA 3VHRA 4IV1A 5KXDA 5E6HA 1CIWA 1XYOA 2WAAA 2FMDA 4H7LA 4LPLA 1VBC1 3U4SA 3UL2A 1F5JA 4E2SA 5CFCB 4YVSC 1SLIA 1MS1A 1ALYA 1WCUA 5LEJA 4LHLA 4UAPA 4AI0A 5A7WA 2OA2A 3DGTA 4YGCA 1PX4A 1DYKA 3QBQA 4INDA 3H8RA 4KBBA 3FJSA 4M0NA 4QU2A 4E4HA 2CDOA 3D82A 4LIUA 3M8LA 3WNNA 4IEUA 1QHDA 1RUG1 4OHYA 3ILNA 4MHUA 2E51A 1ULDA 1G86A 2CNAA 5H9QA 4BQXA 2HWF3 1VJ2A 5JSRA 3NQHA 4DB5A 1H2LA 1W6QA 2Z79A 1JZ4A 4QX7A 3JBG1 4X8NA 1RUJ2 1LHUA 2HBTA 4QPGA 4FPGA 5FWEA 3POFA 1UWWA 2W08A 1CJPA 1OPOA 1ZVFA 2OPWA 2ZTNA 1O7FA 3RJ2X 4D8MA 1Y4WA 2VZ3A 1RMU3 5C9AB 1ND3C 1KJRA 2CL2A 5FMCA 2PYTA 2JDKA 5JXHA 3A4UA 3DL3A 1AR63 1W6NA 3HN3A 2UYBA 1WGPA 5FZMA 4CEWB 4DXZA 5CADA 4AL9A 3MFCA 4AGVA 1V00A 1Q8OA 1MEC2 1YFWA 2RDSA 1UU6A 5FJKA 5FY7A 4FSJA 2ZX0A 2EF6A 2RJLA 3GCWA 2QBXA 3BN6A 4AAPA 5FDBA 4AYUA 1XE0A 4XJAA 4ZONA 3ITQA 4A44A 5JIAA 1IS5A 1CX1A 4MGKE 4FPOB 5JIUA 4QHOA 3O1OA 5HI0A 5GLZA 2IXLA 1BVP1 4O7XA 1GV9A 4FP2A 5E16A 5FY4A 5FZ6A 3ZLIA 5FZ8A 4ORFA 2QZ2A 2IXHA 3OTFA 3AMHA 5IATA 2WKKA 1SDDB 3MIHA 3VZMA 3JB8A 1NCRA 5GZDA 3POIA 4YPJA 2ZHNA 1AL22 1CWPA 2YB7A 4LBOA 5CIRA 2PLV3 1VR3A 2PHUA 4LO4B 4LHNA 4OHXA 3SC7X 2Z69A 4UWDA 3LE0A 1W6OA 1FV2A 4HN1A 3UKTA 4AI8A 3F95A 5H9RA 2JICA 3KLSA 3WY6A 1LOGA 1CAWB 2OVUA 1RUH3 1ZA7A 4DPNA 1MS9A 3EMRA 4E8CA 4XIKA 4CCCA 3J8F2 1E5RA 4IEPA 1H2KA 1LGCA 1PM7A 1X7NA 2H0BA 3BGAA 4Q4V2 1VBE3 4I02A 4D94A 1TME1 4XF0A 2DU0A 4RS5C 1OLQA 1QXPA 3PUIA 4RGGA 4EE2A 3WNOA 2VQAA 2WO1A 3OPTA 1CGPA 4YNIA 3GNEA 4NOTA 3FHIB 4Q4V3 5K4LA 5CFDC 1OQDA 1OF3A 5F32A 4J6GA 5JI7A 2DTWA 1F31A 1H2MA 1QJFA 4DXRA 5DZEA 4LK7A 3H9AA 1GQGA 1VMFA 4W6WA 4AEMA 4XDOA 3RZLA 1DF0A 3N9MA 1LESA 4OYUA 3MUZ1 4COYA 1AF9A 5B4NA 4MLOA 4X8PA 2QQWA 4FO9A 2VBPA 1OOPB 5IUQA 1FOD2 1TVGA 3WF4A 4P9XA 2GC0A 2DCTA 1JBCA 2YZ4A 4JDNA 4CP2A 1AR92 1Y7BA 1ND2B 1Y43B 1PMHX 2DCJA 3NAPC 4UFJA 5FCCA 1VP6A 1W06A 2FCUA 2WN3A 5K0UB 1BZWA 1ZBE3 2A3YA 1JZ2A 3B5LB 3LB9A 5FZ3A 2A70A 3VBSB 1NKGA 1IHMA 2QQLA 3POEA 2O0OA 1LTEA 3LEKA 4HETA 4IV3B 1W04A 5DN2A 2C26A 2ZCWA 1HQWA 1H30A 1H8TA 1QJU3 4TWTA 1OQEA 3W58A 2GP5A 2MEV1 3AZWA 3WW1A 5F7UA 4Q0UA 2YBKA 1GP5A 3O1TA 1AR61 2AEZA 5JR2A 3SQOA 2VC9A 4QXKA 3WDVA 3ZFFB 1PMJX 5HV0A 2WYFA 3JBG2 1NY72 5F2SA 4OZXA 2Q8DA 4DXSA 1ND2C 1BKZA 1VBB2 3KCYA 4RS5A 3VZKA 1T2XA 2IZWA 3KSCA 5F6LB 1QH6A 3AZYA 3K4DA 2FZ2A 3DYPA 4XURA 1H1MA 3ZXKA 5H9PA 2AUYA 2HWE3 4YM0A 3TBDA 3CF6E 3MIFA 4PBPA 2E7QA 1YFUA 1O3RA 5CNAA 3JCIA 4NVPA 3RZHA 3AYDA 2YDEA 2HWC1 4XFCA 1DYPA 1UX6A 3ZXGA 3FE5A 1LEDA 1GU3A 5DQ0A 1NX9A 1RUD3 1SLAA 2B46X 4BLIA 4CEYC 3ACFA 3OGVA 2E53A 2XL9A 2QJVA 1F9KA 4CEWA 3VDBA 1CAVB 3OSDA 4UT5A 3WCSA 4ZKTB 4WBBA 3D3AA 3DECA 1VIWB 5F39A 1H9PA 3WNMA 1QDOA 3OF1A 5DZGA 2DFCA 4XF4A 4C90A 1POV1 1CAUB 1E5SA 5JOXA 1Z7S3 2QKDA 2RMU2 3POSA 5LA1A 4PLMA 1IPKA 4RYDA 4BQ2A 2Z2SB 2WRAA 3KF3A 3PTRB 2QQNA 1R1A3 4UYBA 4EYUA 2VULA 3NSTA 4PIZA 4Q4W2 4QQHA 3VBOB 3BALA 4JZRA 1JZ3A 1R091 1TE1B 3ZYRA 1GBGA 5F3IA 1COV1 2R1DA 2BERA 5K8SA 1NLRA 2H6BA 4TLFA 2PHRA 4QX3A 2DFBA 3S5QA 3T1LA 2YPDA 3AZVA 3R0RA 4W65A 4XPVA 3VKMA 1QJU2 1D0HA 4MGIE 2XJQA 4LBQB 5FPUA 3ZFGC 2B42B 3AX4A 4RGAA 2OXBA 4HK9A 1C8M1 1H1IA 3V0BB 4FPCA 1COV2 1HB2A 4QKDA 1DGRA 4LBJA 4X6QB 1BLZA 4YVSA 4AFMA 4ARYA 3LEMA 5IVFA 2YHJA 1ENSA 2ZHKA 1LKNA 3EHKA 2QQUA 4GA9A 2OQ7A 3H1WA 3HNYM 2OS2A 2P3YA 5FZAA 4MGSA 3LD8A 2R7EB 2JXAA 4BLJA 4N90A 3GBGA 1IZ3A 2CSGA 4ZS2A 1SEFA 2RHPA 3ELNA 1NA1A 3KHBA 3PIJA 4XHBA 4Y5Z0 2HWD2 5ACA2 4WVMA 3UKVA 5IVJA 2ZPXA 1URXA 3H1YA 5JPMB 2DVAA 1V6JA 1Q8SA 5GALA 3ROUA 5CA6A 3GZUC 2JDAA 1UD1A 5JPNB 2A71A 1PO21 2HWD1 5ACA1 2FQPA 2WZR3 2ZGQA 3ACHA 4P08A 1UAIA 1RL3A 1SCRA 1YI7A 3THTA 1V6IA 3ZXDA 2JB8A 3BB6A 3T0BA 3D5OA 4DZGA 3LPGA 4AF9A 1W05A 4C0BA 2RG4A 4GD4A 5FMBA 4ZHNA 2BBVA 2JIGA 1LOFA 5C8CA 2UU8A 3O1MA 1S0JA 4M4PA 4RQPA 4UFLA 2WZR2 2QTWB 3NNLA 1DLLA 5EJZB 4LHKA 3TWIA 1FX5A 4N53B 1O4ZA 1POV3 3L2YA 2R6QA 2YC4A 5L36A 2RJ2A 2DCKA 4PQQA 4P9WA 4K9SA 1U0AA 1WCKA 2W0XA 1RUD1 1XE7A 5KBFA 3AP5A 4JQRA 4K1YA 1S0FA 5A1FA 3Q8CA 2I45A 2JG9C 1JOJA 1WA4A 4XHXA 4ATEA 3T0AA 4TLGA 3DUIA 3TN91 1CPNA 2RR12 2TEPA 4XFBA 5J96B 1I9RA 4ZPIA 2XLFA 2A1XA 3FFQA 3WDUA 4LBMA 4Y20A 3TAYA 1UZZA 2JIJA 2P34A 1LB2A 3I2GA 2KXLA 2VBDA 5FXXA 4XBQA 3U75A 2BWCA 1COV3 4A7KA 4N43A 1DQ0A 1RGSA 2VZSA 4K3UA 3DN7A 2Q4SA 5FMOS 2J1TA 3DCQA 2PMWB 1JOPA 5DG1A 3T0DA 4CU6A 3LA7A 3T1MA 3WP4A 4AI2A 4ASLA 1LENA 1P8JA 2D3RA 1NCRC 2D5HA 2E32A 1E57A 2YGMA 3ZFEC 3M1HA 5CISA 3VLBB 4AG4A 2FDFA 1W0OA 4HPKB 3RFRA 2HWB1 1FMD2 1QJU1 4H14A 2XJRA 3P5BA 5C4WA 3RVHA 4BM8A 2W92A 5CB7A 2ZX3A 2XHKA 4YFZA 2PN5A 4IQPA 3HBKA 2ZAHA 5DG2A 3U78A 1T6GC 2DVDA 5A6XA 5B2GB 3F2ZA 2GU9A 1AYN2 2RDNA 4IE7A 4AGRA 1PGL1 2W1UA 3U07A 2RMU3 2XOMA 3CIHA 4HSLA 4TTGA 3H8OA 4GKYA 3HMYA 5T5PA 4OLLA 2LUWA 1HB3A 4HKLA 3E5UA 1MQTC 2HWC3 4KI5M 3WSOA 1WKYA 4AHYA 4WVZA 2D6KA 4E27A 2BZDA 4IW3A 5C3OA 1G6NA 1X33A 1HRI1 1YRZA 3VKFC 3OGJA 3CNAA 4LJHA 1XC6A 2ID4A 5FYVA 3ENRA 5K0UA 2VOKA 3N7KA 2EVXA 3OY8B 4P02B 3S57A 2L9LA 1D2QA 1TMF1 4YW4A 1JZ5A 3ALQA 3VZOA 4V2VA 4NHKA 1SBEA 5CFCA 3SEPA 3HD8B 3S6PA 3AP7A 1W2NA 1PIV3 2ZAAA 4QAWA 1GMMA 1V0AA 1VBC2 2JKBA 4K6BA 4LA3A 2X29A 4TN7A 1DP0A 4W6XA 2MEV2 3EQEA 4Q5OA 4DUXA 1O8SA 2JG8B 2HWC2 2QE3A 2LROA 3C3VA 3RYKA 5FIXA 4YFWA 2EIGA 2GAUA 2I2SA 1AL21 3AP4A 4YM3A 4K40A 1EV12 3JD72 3SKVA 2Y26A 4XJ9A 4MVTA 1XRUA 2OKXA 3WZ1A 1QOSA 2BFUL 1AL23 5FKCA 1GP6A 4N53C 2V73A 1H6YA 2WNVA 4FOVA 3SH4A 2VH9A 5FLJA 2VNVA 2WSVA 1UL9A 3JQWA 3J4UH 4LKFA 3ATGA 4P14A 4XFGA 2Q1FA 4BH9A 1MS8A 1C1LA 3DV8A 3KQ4B 5AC92 1UY4A 4FTSA 5I0DA 1AX2A 2A6YA 2G19A 4RFRB 3LWCA 4HVQA 3UYJA 1Z0HA 5LB6A 3I54A 1UXZA 3KB5A 3K77A 1PO13 3HQXA 2GH2A 3P3PA 1ULCA 4EWAA 4JDOA 2CTVA 1M06G 1VALA 3WNXA 1GR3A 1W2AX 2OT7A 1GZWB 3VBRC 3PL0A 4FT8A 3FBYA 1O59A 3VD4A 2D6NA 4XFHA 2VMHA 2LTNA 1DBNA 1S2EA 4V1PA 4IUGA 3KZ4C 5FZIA 1HRV1 5EYXA 4QM9A 2IFRA 3CHXA 3D0SA 3I3MA 1KGYA 1S55A 1WMFA 3VDDB 3VGIA 5K0UC 5LY1A 1XYNA 1X50A 5HCBA 5JOZA 1K5JA 3BTZA 3UNPA 2D7FA 2PHLA 3FHQA 2ZGUA 3V65A 4EJRA 3I3EA 1GZCA 3VDCA 1PVC1 2D98A 5JMOA 1LODA 1L3JA 1NCRB 2DBIA 2VOVA 4L2NA 4QKNA 4IESA 5LBCA 3VD3A 3MO4A 4XFAA 1OFSA 3B93A 4OQ8A 1CAXA 1W6OB 3SH5A 4K7JA 1S1AA 2VTFA 3A0NA 4GALA 3C8XA 3NRUA 1LGNA 1WWYA 4NRMA 4HT1T 2ZHLA 3LF7A 1GQHA 5JZGC 4XBLA 4HLTA 4LBLA 3S7EA 4YW1A 5D21A 2W47A 3A0KA 3JBG3 4JKKA 3A21A 4M4RA 4CCOA 2X5IA 4R9AA 5FY9A 1MS3A 2WYSA 1PVC3 1ST8A 2ZGSA 4DRVA 1RVF1 3WHTA 4CUAA 1R083 4DS0A 2DURA 1CPMA 3BI3A 4LO5B 1YIPA 1G9DA 4WVVA 3MDPA 1XOYA 2WQZC 3ES1A 2LM3A 2J1VA 2BUKA 1YJKA 3S7IA 1F8VA 1LU1A 1CIYA 1AX1A 2C1FA 4QPIB 1XU2A 2VOXA 4JGZC 2UY9A 3ZYGA 5EIYB 1H8VA 3N9NA 3ZFGA 1IG3A 2VR4A 2ZGRA 3FUOA 1NYWA 4JGZB 4FP3A 1LULA 4KU8A 5CVRA 5JZGB 3NMBA 4P9LA 2DVFA 4YGEA 4Q29A 1AUYA 4QXBA 3POJA 2H6CA 5E1RA 4XCAA 4ASMB 2NZ9A 4JQTA 2EIEA 3JU9A 3AYCA 1HB4A 3I2DA 3EJKA 3OJBA 3HNMA 2HWE1 2WQ8A 2XJUA 1VMJA 1QY4A 3C7GA 4KWJA 3NW4A 4CCLA 2QVSB 2YC0A 1ZZBA 3DXTA 1WW4A 1MZ5A 3KT7A 4UFHA 1NA1C 4G4FA 1K45A 2DWRA 2Y0IA 4Y33A 5IFPA 2JWPA 3NAPA 3OUIA 1D4M1 5FREA 5A7QA 2Y6FA 1RVF2 3PUQA 1V9U3 2B9VA 2VD7A 4GWMA 2WLPA 1YFYA 5C5TA 5L19A 4S2GA 3KGZA 1PIV2 2ZEXA 4BHPA 5J1XA 1I3HA 2JG8A 3ZOIA 5IWFA 1DLCA 1W9YA 1IOAA 2BDRA 2EXHA 2ZMNA 3FZ3A 4Y1ZA 4FAGA 1GNZA 4XILA 5D1IA 2CU5A 4RSUA 2KM2A 4META 3QH6A 4D69A 4XQDA 4YM1A 3DPRC 1OT5A 2B9UA 3AKRA 3FFZA 4OMCA 1Q5OA 5GLUA 2CAVA 1OXCA 5JSOA 1PGL2 1SQ4A 3HWJA 5FBZA 2BPA2 1WLTA 1BEV2 4G9SB 5FR3A 5JAXA 1XNBA 4CP0A 5HPOA 4QQPA 2RS32 4LE4A 4N7UA 4Y26A 3WG2A 1I1EA 1JUHA 3WW4A 1GP4A 4UF0B 3D4KA 4I2OA 5DPNA 1FMD1 4Z07A 2ZA9A 5FZ4A 1SBFA 3ORJA 5JMCA 1Q3EA 1JOBA 2XLGA 2DCYA 5D8AA 1MPXA 3J7MA 1CZVA 1Q8QA 2C24A 1ZRFA 4X6RB 1DG6A 4XVHA 4XUOA 1W8ZA 3V64A 3AMPA 5ANNA 1O4YA 4GIQA 5IYYA 4XTPA 1RUI1 1B35C 1RUE1 2AC1A 4LLOA 3RNSA 4WZFA 4AOCA 2R063 2A6WA 4BQ4A 5IVYA 3LOIA 4OHVA 2YU1A 1UY0A 4OI4A 1LHNA 5T5JA 4IV1B 4KBZA 2HEVF 5C8CB 1QOTA 2VG9A 2D6LX 3OD0A 2E9QA 3CDZB 5FYSA 5GZGA 3BUCA 2P2KA 3ST7A 5BNOB 1HXS1 1C8NA 4M3CA 5LBFA 4IE4A 3WNLA 1I5PA 1OKQA 1W2UA 3N7JA 4XJWA 1MQTA 1FOD1 3N7MA 2HWB2 2XONA 3CU7A 5F3EA 4GB31 4Q4W3 2WUHA 4MH0E 4IEYA 2XG3A 2ZGNA 5A7NA 2EXJA 1CAWA 1PZ8A 4HKOA 1GWLA 4BMBA 4AVBA 2YUEA 2ZZQA 3OUJA 3SMHA 2XLAA 1VAMA 1W3XA 1H6XA 5GKAC 5BV6A 2BRTA 4L9BA 2WZEA 4PI2A 5IJRA 4NIIA 3IBMA 1Q56A 3ZPOA 3PMSA 3QCWA 4QPWA 3ZPYA 2ZHMA 1K12A 1N47A 2PAMA 4LBNA 2EALA 2XWJB 4CZSA 3VN4A 3VZJA 1LOAA 3CMGA 4BQ5A 1GANA 4GB33 1Z7S2 1REFA 1N1YA 4TSVA 1ZRDA 5C9AC 3GZTB 3CO2A 2E7TA 2G9ZA 2JDHA 4OI2A 5JDBA 1QXRA 2VXJA 3Q8EA 2VAUA 4RHV1 2P3IA 1RJ7A 5D8AB 4NWVA 3HBZA 5FPZA 1WUVA 1ZBA2 1X8EA 4GH4A 5DDJ1 3WDXA 1N3QA 1VRH3 2VUJA 3O7OA 4WVMB 1PZ9A 4AFCA 1AHSA 4UW3A 3T2TA 5J36A 1C28A 4IE0A 2FZ1A 5GLWA 3OGRA 5DUUA 5LEKA 1GUIA 4RHV2 1GZTA 1HX6A 2J7MA 4NRQA 3J8F3 4B29A 2DUQA 4P00B 1HQNA 3X29B 3ZFEB 5DAQA 1GNHA 5FPLA 3VBUC 1BQPA 4N53A 1HLCA 2JG9B 1FMD3 5IW0A 4UW5A 5FZCA 3TRSB 3CZJA 1NQJA 2R1BA 2Q1MA 3MGUA 4E8DA 5GZFA 4YGDA 2Z42A 1JZ7A 3UT0A 1MZEA 2ZXQA 1RUNA 4K21A 3K48A 3RMYA 3MF6A 4Q0QA 4NHLA 1AYM2 1TNFA 1HV1A 2D44A 2F17A 2WT2A 1OUSA 4S2DA 1VE0A 4BMEA 1UW8A 2P4EA 3FMGA 1C3HA 1S0IA 4AAXA 1QH7A 2VE1A 2YBPA 3LIHA 5DDJ2 3CJIC 5FY1A 3ZFFC 5CBLA 1JI6A 2ZABA 1UZWA 4LT5A 4RS5B 1UY1A 4CP9B 5GLVA 2VMDA 5LY2A 1LOEA 5LBBA 4MXVA 2EIDA 3POGA 4GQ7A 3KV5A 1VBD3 3JQXA 1HRV2 4JV4A 4ET7A 1RUOA 1VB2A 2R16A 5ANQA 5APAA 4YG6A 3VDAA 3W21A 3AZZA 3JD73 5GZEA 1MEC1 4OMDA 4BU2A 3SITA 2A3WA 2XUMA 1LRHA 1KITA 4AVTA 2CY6A 4M00A 4PF5A 5FYUA 3SNMA 4FPLA 3UJQA 3O1PA 1DZQA 4QMAA 2W1QA 5I0UA 1ZRCA 2VNOA 1OLME 5JR7B 2PLV1 5SV8A 1PO23 1R1A1 4MZUA 5FAXA 5HCFA 3K4AA 2P6CA 5BUVA 3GF6A 2BTVC 2EIBA 4CVUA 4ES9A 4ARXA 2VZQA 2WA3A 3JB4C 1MS0A 3ZYHA 4YWAA 3OPWA 3VBUB 2BFUS 1VBD1 2XWBB 5ABJB 2R041 3NJXA 4LBKA 5FJHA 4YW6A 4CDQA 5BNNA 1TMF2 2HWF2 4LMFA 3GHMA 5IT6A 5IVVA 5LW9A 1AXZA 5FLHA 5BNQA 4EN8B 1HXS2 1FT9A 1W9FA 2D3PA 1Q43A 3OB8A 3UGGA 3FLPA 4C91A 2YY1A 4CU7A 3O1UA 4QX8A 1QMJA 2LRPA 1AR71 5K7PA 5JOWA 3VBHC 5J7MA 1WW6A 2EA7A 3PVOA 4XDQA 5FK7A 5G05L 3U0ZA 2WNEA 1O3SA 1KQRA 2PHWA 1CVNA 1N1VA 1V9U1 1JXNA 3VBSA 4F8AA 5DUXA 3LEGA 1APNA 4LE3A 3SLIA 1RVF3 3UESA 1ULFA 3VBOC 4BIOA 2XH6A 5EXOA 2RM22 4NMIA 2F4LA 3VBRB 1X9TA 4Q1RA 4WM8C 1BYHA 1UZ0A 4O65A 4DUWA 1ZZ8A 1RMU1 4L99A 4W8JA 5LA0A 3ZFFA 5I8TA 2OPKA 3OUHA 4OQ9A 4LTAA 3LZZA 5FY8A 4NWWA 4MGQA 4AR2A 3RZGA 2NPIA 2C9KA 4JX0A 3HPNA 3ZDSA 3H3ZA 4NAMA 3K46A 1MVEA 1RIRA 1RYYA 1PO12 1X36A 4PHZA 3GZAA 1N1SA 1VB4A 3QOPA 3USSA 2WJSA 3CJXA 4ONUA 5I0TA 3KQRA 2GALA 4NJ4A 5AFEA 1PVXA 3AVSA 2XQXA 2Q1ZB 1UKGA 2J22A 4XETA 4L11A 5DABA 2XQRA 2FDKA 1V70A 3H8XA 2ZACA 3J7NA 3C2UA 3KD4A 4QWNA 3MIBA 1ZYBA 4E2GA 1C1FA 1PM4A 4DQAA 1W6MB 2C6SA 2V5DA 4KMQA 4E4DX 4J1XA 4YVWB 4OULA 4RL7A 4EN0A 4P9JA 3RWNA 2CDPA 3MPBA 2XBO2 4LBQD 1HW5A 1G7YA 2V5YA 4Q4X1 5T5OA 4LA2A 4QB1A 5BNNB 1OQ1A 1GQPA 4UOJA 4BQWA 4XAEA 1ZREA 1ZRIA 2VNGA 3ILFA 3LDKA 5KXEA 1G9FA 1PK6C 2O8OA 2A6VA 1WD4A 2DCZA 2RS52 2OW4A 5FKBA 1G8WA 4GMP3 2WBKA 2CWSA 4JAAA 1U5ZA 3AKTA 5FZEA 2HKXA 3WLUA 4JTNA 4K8RB 1LOBA 1OURA 1DHKB 4BB3A 5F5QA 5JCTA 3ON7A 3UGFA 4KWKA 1F5FA 1JTZX 1EY2A 1H9WA 1HQLA 3ILRA 3LAGA 3LFMA 5JI9A 3VBOA 3VDDC 1QJEA 4XF3A 3I2IA 3EXUA 1KRIA 4W4ZA 2P37A 4A6OA 1C5HA 4ES8A 1OKOA 3WQ0A 4XYXA 1UYZA 4QPGC 3ZM8A 1RUH2 3C7HA 3DF0A 5KR7A 2WS92 4XZUG 5LK5A 3ZVXA 4Q0VA 3OBTA 2VM9A 3E6BA 2Y64A 3H7YA 2FMYA 4GWNA 1NLSA 1SBDA 2ZJCA 2X05A 4I01A 3ZYFA 1HRV3 4PT6A 5GZCA 4N7IA 3GGLA 3PHMA 4NRPA 4W6YA 4IEQA 2XL7A 4AEDB 4ZU7A 2EAAA 1VMHA 5I93A 2IC1A 2OUHA 2XKPA 5FZFA 3ACLA 4XFIA 3I2JA 4FOWA 4QU1A 4FPJA 4GMP0 4ASKA 1H2NA 4IEWA 4PIXA 2D40A 1C8M2 2O14A 1GWKA 2ZGTA 4LO7A 3M3OA 4R52A 3RG0A 4Y1VA 1BBT2 3RZJA 1GKBA 5CKQA 3M3QA 4QPIA 1J3RA 2GC2A 1SMVA 4HSJA 1LNSA 4V2WA 4YW2A 5E8AA 4CU9A 2X5IC 4QB6A 1TEIA 5EYYA 2W46A 2BOIA 2WN2A 3VD9A 3CZUA 3POYA 4XF1A 1KXGA 1HN1A 4AI9A 4DY5A 1RB8G 4JGYB 4AEJA 1GLHA 4BE3A 5JVVA 4NIHA 3HN1A 2ZEZA 3PMEA 3J7LA 1Y9MA 3AJYA 4DRRA 3EO6A 4N9IA 3VDDA 2Q30A 4GWJA 1VRH2 3LPFA 3E6CC 4LIVA 4CXXA 4KNCA 3J9SA 2GNDA 2DTYA 2XVGA 5FPXA 4Q4Y1 5C33A 1SG3A 1RUH1 2DF7A 2QFEA 4R9BA 2EAKA 5FOBB 1EAH2 1TMF3 2WO2A 2VQTA 4L92A 2ARAA 1OC1A 1ULEA 2VTXJ 2WR9A 5FP8A 2LALA 5FFOC 2PHFA 5FZ1A 4FPFA 2JKXA 2ZGLA 4MSVA 4GMP1 3LEIA 1V9U2 5FYZA 3WX5A 2GMMA 3OPZA 1RUG3 2AGSA 4COVA 4ZZ5A 2ZGOA 1NE4A 3S30A 2ET7A 3CKHA 4XDPA 4CCDA 5HXVA 1KJLA 2GP3A 2RMU1 2VOWA 3MZHA 2ZMLA 4WM8B 4RFT0 4YYOA 5F37A 2NQYA 3ETQA 1S4CA 1NAEA 1XJAA 1OVPA 1JW6A 5DAWA 3OEBA 3C7OA 5I8YA 3RZMA 3PURA 4Y5SA 4HONA 4FPHA 3ZIXA 5BXXA 5IAXA 1IQDC 4HMZA 5FXZA 1J1TA 2FDHA 1W3VA 2CHHA 1OBNA 3NKGA 4IE5A 1QU0A 4JTOA 4WM7A 4KG8A 1LCLA 2RS31 3RZZA 2AENA 1BXHA 2WFF1 2RM21 5FZLA 4B8EA 4KL1A 1O5LA 2P5BA 3EBRA 2CGNA 3HNBM 4O61A 4CDUC 3P3NA 2JJ6A 2P3KA 2RVAA 2G9FA 4QQLA 1WZXA 5HCAA 4IEVA 4YZ5A 2W91A 1POQA 3MIDA 4I0WB 1GOFA 4MX3A 3ABZA 3HIFA 2BU9A 1QJX3 3SCGA 3WQ1A 1ZZCA 3HQRA 3RYRA 3W20A 3K2OA 1R082 3AK0A 3O0XA 1RINA 3MW3A 4UBGA 3N7LA 1AR91 4UFMA 5KC5A 2JE9A 2R32A 3WD5A 2VU9A 5BNOC 1MQTB 2A73B 3KS7A 2WWSA 1YC61 2W2IA 4CXYA 2P1BA 3MF9A 3I2KA 2IXIA 4BYYA 1F35A 3T09A 2GNMA 1SFNA 1AR73 2IXKA 1DYOA 2RV9A 3H3LA 1RUF3 3M70A 2WZ8A 3OCPA 1A3KA 1F15A 1RUJ1 3IDEA 4CDQC 3JXSA 5A3MA 4XUTA 1MS4A 1ND3A 1RC6A 4WZCA 4CDXB 4CUCA 3J7HA 2VMCA 1RUE2 1RUF2 5AVAA 3BODA 3PNAA 1AR72 3JZVA 3OYWB 1W8WA 2VGDA 3IT8A 3MLJA 1PO11 3T08A 2TUNA 2WZR1 5FYIA 5LATA 2HWD3 5ACA3 1VBE2 2WNVB 1US3A 4MG2A 1NY71 1D4VB 2WQ4A 2XUEA 2A6ZA 1ENQA 2VUDA 1S0GA 3BCWA 4I0BA 5KHGA 3VBSC 3NV2A 4MXWB 1VBD2 2Z5WA 4OHWA 4YW5A 1UIJA 1DFQA 1K5MA 1YIFA 4IGQA 4WM7B 4LQRA 1ZX5A 3WQ7A 4CPBA 5KWRA 4JVAA 2AH2A 2ARBA 1KD7A 2OX0A 5F6KA 4AGGA 4QDSA 5FWJA 2ET1A 1FPN1 4L8QA 5L9RA 1PHMA 1JMUB 5A32B 2G4IA 2G9GA 2DUOA 2ZEWA 1UPIA 1YFXA 2N7GA 2XJVA 4QXCA 4FBFA 1DGRN 4ZXKA 4JDMA 5FLIA 5DXDA 3AXDA 5FYBA 3TOJA 5EJ1B 3DKQA 3I2OA 1OPMA 2VMGA 4JKMA 3U4XA 1XQNA 2D6OX 3HT2A 3PVEA 5LRRA 4LITA 1PIV1 2GNBA 1AXKA 1AR93 2BNMA 1RXGA 5LBEA 4FFFA 2ARCA 1OF4A 5BNOA 1UYXA 2GN3A 3BTXA 2BW8A 3MIEA 1CJDA 1U5XA 4BK4A 4BZ4A 5FO8B 1LOCA 1OSGA 4Q0PA 2ORZA 5T3NA 1ZBA1 1ASJ3 1N3OA 2DBNA 2E63A 1FV3A 4XACA 2JENA 4XC9A 5FMDA 2MPFA 1UCXA 2YG0A 4FFIA 3M3EA 2RM23 2KR2A 3H42B 2VUCA 2B7YA 4JHZA 3FBMA 3CJIB 3BU7A 1IS3A 4AQ2A 1Z7S1 1L7QA 4AFBA 1H4GA 1LJ7A 1Z78A 5EFUA 2VZPA 5LK7B 4AZZA 1DU3D 1ZA4A 2W3JA 4CDXA 4BQYA 2JDNA 3WP3A 4PDWC 3AP6A 2QQJA 1LAJA 4AEDA 2BGOA 4AHXA 1W6QB 4JKLA 3J26N 5KHKA 5C71A 4Q8KA 2GMEA 1A78A 4HPKA 3ZMNA 3SH3A 3E6DA 1TG7A 4AQSA 5F3CA 3GBFA 4AQ6A 5E89A 5FRAA 1OA4A 2CGOA 4MADA 5C8CC 4HVRA 1N1TA 4KGQA 3W5NA 4A7ZA 4COZA 5CAZA 1AJKA 2ZEYA 4XFFA 4KU7A 4QB2A 3DXUA 5EWSA 1A8DA 2G1MA 1DCSA 1VPHA 2WNUC 5FZOA 3S5AA 2EXKA 1JU3A 2XBO3 4Q8LA 2YU2A 3VD5A 4Z2AA 3TEYA 5CEHA 1MS5A 4TXWA 5A32A 4XF9A 2ADEA 1H8TC 3FN9A 3PU8A 2P17A 4FPKA 4MHRA 5LCWL 4PLOA 1US2A 2DDUA 3GJBA 4E9KA 2XPJA 4DMIA 4YZ3A 1UPSA 3AJZA 1EV11 1VBB3 1YJLA 5FZ7A 1FNYA 1EPWA 3I3QA 3OY8A 4QKBA 3WP6A 4QQ2A 3ZMOA 3KWVA 5C3RA 2E33A 1FYUA 1LU2A 3URFA 2VVFA 1IS6A 1YYNA 4MGZE 3T2QA 2Q8EA 5BNPB 4AQTA 4OUSA 4RR3A 1W0PA 5LASA 4A6SA 3K51A 2VTXA 5FZDA 3VBHA 1OI6A 3I4IA 1NCQB 2CAUA 1JODA 1W8HA 2A7AA 3OBRA 1DQ2A 1TME3 1QGLA 1I5ZA 2R062 3C7EA 3DYMA 1UY2A 3INAA 4R9CA 1WMEA 1YI9A 3AL6A 2E7AA 3FL7A 5J37A 3DKWA 1BK0A 5FTTC 4M01A 3MLKA 1HKDA 4CEYA 1WCDJ 4YVWC 1UY3A 3M2MA 4Z92B 1RUC1 4YVSB 3HOBA 1FXZA 3KMHA 2AEYA 2PAKA 1TZOA 4LNVA 3T4VA 4D0QA 1ONAA 3BVCA 4QPGB 4DUVA 1RUG2 4JCKA 3VBFC 1WBFA 3H3UA 4ZXEA 5D2AA 4A45A 3B9IA 4L0PA 5FYMA 3TEXA 1E5HA 4Y22B 1UX7A 2YBSA 4LOSA 4XUNA 4EZ4A 1W90A 4LXLA 1RUJ3 4GZ9A 4ITCA 5A1LA 5I91A 5EHDA 3VKLA 4PBOA 4XZPA 2ZBJA 2WZPP 3PVBB 3VUOA 2NP0A 3ZXLA 3GZEA 4WVWA 5L7OB 1OA2A 1ULPA 1WMXA 5A3TA 4FQZA 3AYAA 3MI8A 3ZO0B 1DGLA 3RPQA 3KV4A 1AYM1 5F2WA 5FYTA 1SLTA 4HXCA 3I97A 5CFCC 2IVIB 4XJ8A 3R4SA 5FZOB 1XNAA 3APBA 1WLCA 1FI2A 1UIKA 1FNZA 1W8FA 2BGCA 3WHUA 1NE6A 3Q8AA 4IXLA 4LLFA 1AYN3 3SKJE 4HG6B 5JUVA 4QX0A 1D4M3 3WQBA 4FOYA 5FXVA 4BWOA 4TYSA 3AKSA 5DUWA 5A6ZA 4QHZA 2HBUA 1F4HA 2GC3A 4UFIA 3NL1A 4A3ZA 3I7DA 4P5YA 1ZZ9A 2R30A 2TBVA 3NAPB 3ZN6A 4NIAA 4M3CE 3K75B 1QNWA 4FXKB 4QX1A 2QQKA 4B4QA 2B8MA 2LS6A 2NYYA 2WFF3 2UWBA 4AEKA 4LEJA 2PAEA 4MUVA 1BEV1 1KS5A 4YARA 3ACGA 1WD3A 3RWKX 4NIGA 1GWMA 4I0AA 4F7ZA 1WA6X 1SLLA 1ZBE2 1BK1A 3GDBA 2Y6HA 4LKEA 5IK4A 1IKQA 2GMPA 3OGGA 2V72A 3ZDVA 3ZYJB 2NMNA 2X5IB 3BYWA 3L9JT 3SHRA 4CUBA 2GDFA 5HV4A 2VL4A 3I49A 4XBNA 1JH5A 1SCSA 1SLBA 1IG0A 3VBFA 2HJIA 4FXGB 2C4XA 4YZ4A 5CFDA 5M0TA 1XNTA 4KQ7A 1F2NA 1KFXL 1H4HA 1VBC3 4D3WA 4R4ZA 2XXZA 4Z1VA 1W6MA 1G9AA 2QUOA 2W95A 4QDRA 5FUIA 4MXWA 1BEV3 1CAVA 2WWUA 3Q9OA 3MEPA 3WF3A 1BCXA 1YO8A 2P3JA 5LA9A 3AYEA 3FUQA 4CXWA 3PLQA 3AMQA 1W6NB 1DGWX 1NXMA 3KCXA 3ZSKA 1W8NA 2WNUB 2QQVA 1GOHA 5DZFA 1DGWA 2Y6KA 2ATFA 2E26A 3KVBA 3OGSA 3VV1A 1UZYA 4OCTA 3R05A 3LA2A 4XJZA 2JG9A 4AI3A 1TQ5A 2VW2A 3VHNA 3THDA 3TNQA 2BEOA 1BJQA 2UWAA 4ISQA 4BXSV 2D3SA 4OI1A 2YPJA 2RR11 1PO22 1R64A 3AFKA 5A33A 2R071 3IPVA 4XIOA 3WR0A 2VXRA 1IS4A 5EV7A 4CCJA 4EWEA 3OD4A 4EN7B 2W52A 2Y0OA 4H2AA 1ULGA 1RHI1 3GCXA 1W2OA 2DV9A 4YLZA 1NXD1 1CAXB 1VAKA 2VCAA 2V4VA 4RQPC 3N9LA 5KHHA 3LSDA 5A7WB 3VKOA 3ETPA 3QLQA 2GN7A 1O4TA 2WABA 1YXWA 3FC0A 3K3OA 3S0MA 1QJY1 4Y3OA 2YGLA 1AR81 4KG0A 4BIFA 4EROA 3PUHA 1L7LA 1POV0 1HRI2 2I74A 1XB9A 1W6PB 2V4AA 3KM5A 5C4WC 1SPPB 2WO3A 2ZGMA 1Y3TA 5FZHA 5AC93 5J09A 5IK7A 2XMLA 2ERFA 4LORA 4GJYA 4CDUB 1YCIA 1WCSA 3GJAA 4LR4A 4DO0A 1V6OA 3WDTA 4Z8BA 1HN0A 1LHWA 2PA7A 2YV8A 4MYEA 4A4AA 1ZZ7A 1S0DA 2YYOA 1MR5A 2TNFA 3P1IA 1UZVA 1AYN1 2GH8A 3BOWA 3VL9A 5FQ0A 1FPN2 3U1XA 2V09A 3NKTA 4KGGA 2A5ZA 1J83A 2IFWA 3WINE 3GHNA 3IWZA 4AXOA 1PVC2 4S2HA 1OUXA 4N43C 2FCTA 4XMAA 4AEDC 5I0SA 5LRSA 2KD7A 4QD2A 1O3TA 4JGZA 3E97A 1XPWA 1OH4A 4PF1A 2XVKA 2OIIA 4Y1XA 5F5AA 3RYPA 5JSPA 3LOBA 2VECA 1VBE1 3RI9A 2K46A 2B45X 1IPJA 1OH3A 4FQ4A 3TEWA 2FD8A 1BMV2 2AACA 4IDZA 5KHIA 3NV3A 1T6BX 3U14A 4AWDA 2P6HA 2PTMA 4OFGA 1CAUA 4WM7C 1RTVA 1VBB1 3IMMA 3UV9A 2VW0A 1QXJA 1OVSA 1J1LA 2BYVE 4NR1A 1W8TA 3KT4A 4CEWC 3IIIA 1EYBA 4Y4RA 5T50A 2JDMA 5IHRA 1MZ6A 2RS11 5FP3A 5A7PA 5C3PA 4CCMA 2DU1A 3W59A 3BKZA 2VQ0A 1O5UA 5IFTA 2IXJA 3SISA 4LKDA 4BCUA 4AW7A 1CONA 3PU3A 2BVBA 2VOTA 3CL1A 5FP9A 3ZN6B 4UW6A 4CE8A 1RJ8A 4CDWA 2HYKA 4FTBA 1ZNPA 1NT0A 4IEOA 4NUBA 4S2FA 3T2PA 2QQIA 3E5XA 2GZWA 1L7RA 4K20A 1Q8PA 3N36A 5F8PA 4C8DA 2JG8C 5I0RA 3V0BA 2W5FA 2W94A 1W8UA 4XW3A 4AK3A 2VMFA 1H1AA 2BJSA 3HEIA 4P9IA 1PNGA 2Y38A 5FYCA 1AXYA 3MYXA 2DYCA 3LIGA 2OYZA 5TSWA 2W1WA 3VB9A 1WLWA 3CEWA 1BBT3 5IAVA 1SPPA 2WNOA 3RMXA 4CEYB 2VUAA 2HWB3 3WG1A 4DY3A 4H55A 4ZS3A 4Y5TA 1N3PA 3SCFA 4C0HA 3IZOA 2WFF2 4MOAA 1SACA 4FPYA 1NQDA 1XE8A 2NMOA 2BGPA 4YVWA 3TN92 3B9CA 3D0JA 3GALA 1KDKA 2SLIA 1SHWB 5IK5A 1ODNA 1W8OA 1WW7A 4IEXA 1ASJ1 3ECQA 5FOJB 3I59B 3OEAA 4XMIA 2JDPA 4EZHA 1I6XA 4I30A 3LCPA 2Y6GA 3AKPA 5H9SA 4NIDA 3WNPA 3TN93 5L7OA 4F83A 4LULA 3NVCA 5CG8A 1ZZ6A 4BOWA 1UXXX 4CSWA 2ENRA 1UOFA 3VL8A 1U12A 3PUAA 2DVBA 5C5UA 2VZOA 3GXUA 4B4PA 4A2UA 3ZYBA 1PGW2 3O5SA 3O12A 4LO6B 4BQ1A 4EQVA 3WDYA 3SXWA 2XJPA 1QKQA 3ZX7A 5FY0A 2VNRA 3W9AA 3IPVB 1SFPA 4COUA 3ZXAC 4D7YA 4EN6B 1A6CA 1H8TB 3VHPA 2JD9A 2WS91 4RR3B 4UXAA 5J98B 2W68A 1VLNA 3NO8A 4W50A 3AKQA 1JYTA 1D0GA 4PQ9A 5A1AA 5DAPA 1LOFC 3MW2A 4CTEA 4NPRA 5EP9A 4C1WA 4XOGA 1UOJA 1NG0A 4HK8A 4CDWB 1GNYA 2D6MA 4LUMA 5T5LA 2VZTA 2WINB 4AFDA 1ODMA 5A6QA 2HEYF 3THPA 4RD7A 1IGOA 4OI0A 4GH4C 3IKWA 2JX9A 4QQOA 1QNYA 5GJ6A 4YM2A 2BWAA 4OUMA 3AMNA 1V6NA 2D93A 3B69A 3D8CA 4HOOA 1CESA 1LHVA 1YNAA 4XTMA 5HXMA 5IVCA 2VMEA 1UF2C 5T55A 4QHBA 3TNPB 1V6KA 3B02A 4IV1C 3RS6A 1DQ4A 5LWBA 2IXCA 4SLIA 1X8MA 4AE2A 1QOOA 4A3XA 1U5IA 3VBFB 5DMYA 1JU4A 3NV1A 2MHFA 2F4PA 1HV0A 2W87A 2Y6LA 2RE9A 2JE7A 3I2FA 4A7YA 5CFDB 4OZOA 2QDNA 3MUY1 4CCKA 3AB0A 3VBUA 4CDXC 1OD3A 3M3IA 1KFUL 5C4WB 4PIYA 4KWUA 4PDWA 3ZSMA 1EUTA 2NM1A 2R073 1C8M3 2IVJA 4UF0A 3RGBA 5L7OC 2GNTA 2HEWF 1F4AA 2HYXA 3ZKUA 4CUGA 4YSFA 3ASIA 2VCMA 5KXCA 5A3OA 1QDCA 1MZFA 2LW8A 4IETA 1G9BA 2AZ5A 1OOPA 2UWCA 4F3JA 1LR5A 1NCQC 3ZFEA 1YQ5A 2D5FA 3HR9A 2OUJA 4XJUA 4B7KA 4C1XA 3V0AB 3ZYIB 4LKSA 4XQ4A 4QX5A 2RS51 2X10A 3N35A 2WSUA 3EB7A 5B4XA 3WW2A 4BA6A 3LFIA 3AMMA 2VVDA 3BTYA 1KDMA 2YFUA 2FDGA 2AR6A 5FPBA 2QNKA 2WS93 4QDQA 1K5MC 4P9GA 3AL5A 1RMU2 1WCQA 4UI9L 3TYJA 4BQ3A 3AZXA 5SV5A 4NE9A 2CWMA 2UY8A 2YROA 3MPPG 4FFGA 1S0BA 3RSJA 1XNKA 4LBQA 3USUA 3QH7A 3VBHB 3CLPA 5G04L 2JE8A 3JUUA 2C0ZA 4QM8A 2JECA 1W39A 2VVEA 2J1EA 2PQQA 3B01A 4RR3C 1W03A 5GM0A 1JYCA 3CBNA 2ZS6B 2E6VA 2PHTA 2XB6C 5L9BA 4ZU4A 3AFGA 4KH9A 2IWGB 1DQ6A 3H50A 2ORXA 3POWA 3GYDA 3VZNA 2BNOA 1J84A 2ZKLA 1W99A 3AXEA 5CZKA 3HJRA 5D8AC 3ZXFA 2WNVC 5ABJC 3BPZA 1RUC2 3CQOA 1WLDA 4N43B 3TB0A 1DDLA 3FWEA 1QWRA 4IV3C 3BPSA 3VZLA 1OA3A 1DZRA 1UO9A 4DOUA 3B3QE 2OZ6A 3IDBB 1ASJ2 2R042 1UU4A 3PDQA 1EUUA 4GB32 3WOGA 5A70A 2ETEA 1GZ9A 2XBO1 3M3CA 1NZIA 2WT0A 3A23A 2ADDA 1O3QA 4BJ0A 2WT1A 2H0VA 3M4FA 1XXNA 4D7SA 4H3WA 3WEZA 3B7MA 2RS12 2QQMA 2MNGA 1NOVA 2Y34A 4NPMA 2C5DA 3B00A 4Q4W1 4H7MA 4QKFA 4Q2FA 5FO9B 1V6LA 1C4RA 2ZKNA 1BBT1 4HBNA 1S0CA 1OOPC 4JGYC 2YMZA 1VRH1 1GFF2 4M0HA 3OBZA 1UQXA 5DDJ3 5J3UA 1DQ1A 5CKMA 5FBJA 5A3WA 3WUCA 1CZTA 1JS9A 3HVDA 1LHOA 2VBBA 2JEMA 2PFWA 1AYM3 5IVBA 1JZ8A 5FZBA 3NNGA 4JRLA 1JUIA 1YEWA 2B39A 5ERLA 3BIEA 5FZGA 3WF0A 2PXJA 4JC1A 5FV3A 5A33B 3N3HA 2JDZA 1D7PM 2XJTA 4Q4X2 4FOQA 5FP7A 1AR62 1UKRA 3V56A 3VBRA 5JXIA 2Q0AA 1X82A 2BVVA 2W9XA 3ZIWA 2VW1A 1R1A2 3VHOA 3WT3A 3DEMA 5BYNA 4R9DA 5CG9A 2FDJA 2VPVA 4CPBD 5A7OA 4A42A 4CP9A 4D7TA 2KA3A 4YGBA 4U36A 3LDBA 4N8MA 2JDUA 3K3NA 1SZBA 3WG3A 3WF1A 5KC6A 3KGLA 4UW4A 4EV0A 2HLEA 1HIXA 4B7EA 1O91A 2Q5TA 3USUB 4DXTA 2RS13 1AR83 2C9AA 3OG2A 1UN1A 2YC2A 4Q4Y3 4COWA 2R0FA 5FZ0A 1FOD3 1O8PA 1YQ6A 4NO4A 4YRDA 1JYVA 2JD4A 2PQSA 5EPAA 1EPZA 1HXS3 1STMA 4Q4V1 2XJSA 1UYYA 2K2SA 3A22A 4GJZA 1PZ7A 1E5IA 2VZ1A 5FPVA 3U11A 3W5MA 4CP1A 4HN0A 3N9OA 1EAH3 3QD6A 3WW3A 4B4RA 2UURA 4AVAA 5A6YA 4XABA 4Z2WA 3LGRA 2A75A 3SEEA 1AL0G 2VMIA 3DPRB 2CYFA 1YHFA 2GC1A 1EAH1 1RUI3 4E2QA 3UKNA 3POBA 4YW7A 4Q4Y2 3PTYA 4I09A 4XEZA 4QGLA 1RUD2 2HWE2 4JGYA 4FVVA 4DEVA 2ZGKA 2ARXA 2FCVA 2QCSB 3AP9A 3ZFGB 3ZYPA 1PK6A 4DEQA 5ISLA 3BU0A 5A3UA 2DVGA 3WV6A 4AVSA 1AX0A 3LQCA 4B1LA 1MVQA 3H7JA 2PHXA 1XSRA 3FHAA 4IERA 5JXGA 4LUKA 3NJVA 1XNDA 3KHCA 1TME2 4RQPB 3Q8FA 4QT6A 1AR82 2EXIA 2X53S 2BNNA 1QJY3 4SBVA 4MV2A 4XE9A 1QF3A 3BTAA 4XXAA 4B1MA 3E1F1 4R8HA 4NROA 2X09A 3RQ0A 1BHGA 4DINB 1JYNA 4GAZA 1ZM1A 3KV6A 4XUQA 5CYYA 2WC2A 4P9YA 3H0OA 1OMIA 4J1WA 4J25A 3RZKA 1UOGA 2WL1A 3NJYA 1CZSA 3RDIA 4PLNA 3MFAA 3R6SA 3I3DA 4HVOA 2R49A 5FMOL 2ZMKA 2A6XA 3ME2A 4Q4X3 2VZVA 1JZ6A 3N9QA 4QGNA 2NN8A 3ES4A 3IN9A 3PIGA 4JRAA 2F6BA 4U2AA 4KWLA 5EZWA 1Q8VA 3EYPA 4QXHA
chains in the Genus database with same CATH topology
4Y4YA 4QPIC 2RR13 4UBHA 1IQAA 3M7AA 3WG4A 4YZ1A 2W39A 1ENRA 1QJX1 3R4UA 1UU5A 3B94A 1GYKA 3R4DB 5FQ0B 1J3QA 2O1QA 1BMV1 4Y22A 1V6MA 4GH4B 4Y1UA 2HWF1 4URTA 4AHZA 4NN0A 4O9EA 2Q8OA 1XYPA 2RS33 3IIAA 1CQ9A 3MW4A 3DPRA 4Q0SA 3RRDA 5T54A 1R092 1B09A 2SBAA 1PGW1 3BIWE 5IK8A 4ISRA 4B3NA 4QPYA 5GLTA 5E88A 3O0WA 3WP5A 3FLTA 1R081 3RI8A 3O0VA 1DIWA 4O9GA 1LEMA 3E5QA 1CN1A 2I07B 2XGXA 1CR7A 4DFSA 1B35A 1AJOA 1LECA 1VAVA 3NJZA 2X8KA 4Q27A 1WW5A 2PLV2 4MGYE 1DQ5A 5J48A 1JHNA 1YLLA 4HL0A 4Z82A 1KS4A 4NHMA 5JWPA 2R072 4GXLA 4AHWA 2ZGPA 1REEA 2WFPA 3AM2A 4OVEA 3LA3A 4WM8A 5FO7B 2YXSA 2PELA 1DZTA 1G9CA 2K9ZA 1QJZA 4CDUA 1FAYA 3VKNA 4Y24A 5C9AA 3WUDA 5A3LA 1VBA1 1CX4A 1S2BA 1QJY2 2WIIB 4AI1A 4M3CF 1IKPA 2CV6A 4R4XA 2ZZJA 1D4M2 4Q1PA 5ABJA 3UJOA 1OFNA 4IEZA 3MLLA 1EV13 2R043 5L73A 3QACA 4TZDA 1SDWA 3BOPA 3L2HA 1OD5A 1GZWA 3LKJA 1RUC3 1PK6B 3I8TA 2ILMA 1FATA 3ZN4A 5F9TA 4Y1YA 2ZOEB 3D6EA 5BY5A 1R093 4FCAA 1Y9QA 4IV3A 1D2SA 5BNPC 3ZXJA 4IL7A 2CGPA 4GULA 1S2KA 4M3CB 2FBEA 2QZ3A 1JN2P 2WLQA 2XKOA 3H1MA 4XXPA 3WXPA 3CJIA 2D97A 2D43A 1QJX2 2D6PA 5C8WA 1YUDA 1QQP1 5HBAA 4YG0A 1M4WA 4BPZA 1J3PA 1H0BA 4XQWA 4YG3A 4YZ2A 1BVVA 1XU1A 2RJKA 4PJYA 5KXBA 2OZJA 1QQP2 1HRI3 1NZCA 1K5MB 2WA4A 3KCCA 3ZXEA 1EP0A 1UMZA 4P5HA 3WDWA 4ATFA 3J8F1 3PJYA 4I3GA 3MIGA 4CRQA 2ES3A 4GKXA 1QQP3 3WVJA 4AVVA 1RHI2 4PDWB 1A8MA 2ZX4A 4CDWC 3HT1A 1ZRRA 5BNNC 4AFAA 3WCRA 3FX3A 1ND2A 3NWKA 1PMIA 2XVLA 4FTEA 5AVPA 3PVNA 2MEV3 2B5HA 4PCRA 4RHV3 4K8FA 1CD3G 2BQPA 1MACA 1C5IA 1PGSA 4EWDA 5JLVA 5I8SA 5BNPA 1ZBE1 1RUE3 1PNFA 1XNCA 2R0HA 1RUI2 2VY0A 3O14A 2QQPA 1ZBA3 2DUPA 4HZFA 4I3PA 5AFBA 1NCQA 2AREA 3RJRA 1TNRA 1AVBA 2RS53 1B35B 4Q26A 4QGMA 1ENXA 2FHRA 3SCHA 3FLRA 3ZSLA 1WBLA 1S0EA 5AC91 4LO8A 4OHZA 4AVCA 5JOYA 2PHDA 5BPXA 3IDCB 1R1ZA 2NLRA 4Y20B 3G7DA 3OYWA 4CYDA 4HFSA 4E4SA 3G6JB 2ZX1A 4RA0A 1WMDA 1W6PA 1RUF1 1ND3B 3LSEA 3NV4A 1REDA 2ZX2A 2A3XA 1JYIA 5EJ3A 3MICA 3ZSEA 3H8UA 3N4MA 1RHI3 2K0GA 1LGBA 5F1RA 1YWKA 1SLCA 5K9YA 1NA1B 2UYAA 3IMNA 4EN9B 5KHJA 4DNYA 4FAHA 5T52A 1HDKA 2R061 1OLRA 1VBA3 3U10A 3I59A 4G3YC 1FPN3 1C57A 1SFYA 2O8QA 4HKWA 3ZSJA 2AYHA 4HANA 3GBWA 2WNUA 1OHFA 1U5YA 1VBA2 1J58A 3KT1A 5JZGA 2GSYA 3IM0A 4K1ZA 4WV8A 4FPEA 4CDQB 4YW3A 4L97A 4ZU5A 1MEC3 3HAGA 3JD71 3PJQA 2QDRA 1RITA 4N9HA 5C6CA 3V0AA 1GICA 1AZDA 5CU1A 5DUVA 4E4ZA 1GSLA 3ZN5A 3VHRA 4IV1A 5KXDA 1CIWA 1XYOA 2FMDA 4H7LA 1VBC1 3UL2A 1F5JA 4E2SA 5CFCB 4YVSC 1SLIA 1MS1A 1ALYA 5LEJA 4LHLA 4AI0A 2OA2A 3DGTA 4YGCA 3QBQA 1DYKA 4INDA 4KBBA 3FJSA 4M0NA 4QU2A 3D82A 3M8LA 4IEUA 1QHDA 1RUG1 4OHYA 3ILNA 2E51A 1ULDA 1G86A 2CNAA 5H9QA 2HWF3 1VJ2A 5JSRA 4DB5A 1H2LA 1W6QA 2Z79A 3JBG1 4X8NA 1RUJ2 1LHUA 4QPGA 4FPGA 2W08A 1CJPA 1OPOA 1ZVFA 2ZTNA 3RJ2X 1O7FA 1RMU3 5C9AB 1ND3C 1KJRA 2CL2A 2PYTA 3DL3A 3A4UA 1AR63 1W6NA 4CEWB 2UYBA 1WGPA 4DXZA 5CADA 3MFCA 4AGVA 1V00A 1Q8OA 1MEC2 1YFWA 4FSJA 1UU6A 2ZX0A 2EF6A 2RJLA 5FDBA 4AYUA 4XJAA 5JIAA 1IS5A 4MGKE 4FPOB 5JIUA 5HI0A 5GLZA 2IXLA 1BVP1 1GV9A 4FP2A 5E16A 4ORFA 2QZ2A 2IXHA 3OTFA 3AMHA 2WKKA 3VZMA 3MIHA 3JB8A 1NCRA 5GZDA 2ZHNA 1AL22 4LBOA 5CIRA 2PLV3 1VR3A 2PHUA 4LO4B 4LHNA 4OHXA 2Z69A 4AI8A 1W6OA 1FV2A 4HN1A 3UKTA 5H9RA 2JICA 3KLSA 3WY6A 1LOGA 1CAWB 1RUH3 2OVUA 4DPNA 1MS9A 4XIKA 3J8F2 4IEPA 1H2KA 1LGCA 1PM7A 1X7NA 2H0BA 4Q4V2 1VBE3 4I02A 4D94A 1TME1 4XF0A 2DU0A 4RS5C 1OLQA 1QXPA 4RGGA 2VQAA 1CGPA 4YNIA 3GNEA 4NOTA 3FHIB 4Q4V3 5CFDC 1OQDA 4J6GA 5JI7A 2DTWA 1F31A 1H2MA 5DZEA 3H9AA 1GQGA 4W6WA 4AEMA 1DF0A 4COYA 1LESA 1AF9A 4MLOA 4X8PA 4FO9A 1OOPB 5IUQA 1FOD2 4P9XA 2GC0A 2DCTA 1JBCA 2YZ4A 4JDNA 4CP2A 1AR92 1Y7BA 1ND2B 1Y43B 2DCJA 3NAPC 5FCCA 1VP6A 5K0UB 1BZWA 1ZBE3 2A3YA 3B5LB 3LB9A 2A70A 3VBSB 1IHMA 2O0OA 1LTEA 4HETA 4IV3B 2ZCWA 1HQWA 1H30A 1H8TA 1QJU3 4TWTA 1OQEA 3W58A 2MEV1 3AZWA 3WW1A 4Q0UA 1AR61 4QXKA 3WDVA 3ZFFB 3JBG2 1NY72 4OZXA 1ND2C 1BKZA 1VBB2 3KCYA 4RS5A 3VZKA 2IZWA 3KSCA 5F6LB 1QH6A 3AZYA 2FZ2A 1H1MA 3ZXKA 5H9PA 2AUYA 2HWE3 4YM0A 3TBDA 3CF6E 3MIFA 4PBPA 2E7QA 1YFUA 1O3RA 5CNAA 3JCIA 4NVPA 3AYDA 2YDEA 2HWC1 4XFCA 1DYPA 1UX6A 3ZXGA 3FE5A 1LEDA 1SLAA 1RUD3 2B46X 4BLIA 4CEYC 2E53A 2XL9A 2QJVA 1F9KA 4CEWA 1CAVB 3WCSA 4ZKTB 4WBBA 1VIWB 1H9PA 1QDOA 3OF1A 5DZGA 2DFCA 4XF4A 4C90A 1POV1 1CAUB 5JOXA 1Z7S3 2QKDA 2RMU2 3POSA 4PLMA 1IPKA 2Z2SB 1R1A3 2VULA 3NSTA 4PIZA 4Q4W2 4QQHA 3VBOB 3BALA 1R091 1TE1B 3ZYRA 1GBGA 1COV1 2R1DA 5K8SA 1NLRA 2H6BA 4TLFA 2PHRA 3T1LA 2DFBA 3AZVA 3R0RA 4W65A 4XPVA 3VKMA 1QJU2 1D0HA 4MGIE 2XJQA 4LBQB 3ZFGC 2B42B 3AX4A 4RGAA 4HK9A 1C8M1 1H1IA 3V0BB 4FPCA 1COV2 4X6QB 1DGRA 4LBJA 4YVSA 4AFMA 2YHJA 1ENSA 2ZHKA 1LKNA 3EHKA 4GA9A 3H1WA 2JXAA 4BLJA 4N90A 3GBGA 1IZ3A 1SEFA 2RHPA 3ELNA 1NA1A 4XHBA 4Y5Z0 2HWD2 5ACA2 4WVMA 3UKVA 2ZPXA 1URXA 3H1YA 5JPMB 2DVAA 1V6JA 1Q8SA 5GALA 3ROUA 5CA6A 3GZUC 1UD1A 5JPNB 2A71A 1PO21 2HWD1 5ACA1 2FQPA 2WZR3 2ZGQA 1UAIA 1RL3A 1SCRA 1YI7A 3THTA 1V6IA 3ZXDA 3BB6A 4DZGA 3D5OA 4AF9A 4C0BA 2BBVA 5C8CA 1LOFA 1J59A 2UU8A 1S0JA 4RQPA 2WZR2 1DLLA 4LHKA 3TWIA 1FX5A 4N53B 1O4ZA 1POV3 3L2YA 2R6QA 5L36A 2DCKA 4P9WA 4K9SA 1U0AA 1WCKA 2W0XA 1RUD1 1XE7A 5KBFA 3AP5A 4JQRA 4K1YA 1S0FA 2I45A 2JG9C 1JOJA 1WA4A 4XHXA 4ATEA 3DUIA 3TN91 1CPNA 2RR12 2TEPA 4XFBA 5J96B 1I9RA 2XLFA 3FFQA 3WDUA 4LBMA 4Y20A 3TAYA 1UZZA 2P34A 1LB2A 2KXLA 4XBQA 2BWCA 1COV3 4A7KA 4N43A 1DQ0A 1RGSA 4K3UA 3DN7A 2Q4SA 5FMOS 5DG1A 3LA7A 3T1MA 3WP4A 4AI2A 4ASLA 1LENA 2D5HA 2D3RA 1NCRC 2YGMA 1E57A 3ZFEC 3M1HA 3VLBB 4AG4A 1W0OA 4HPKB 2HWB1 1FMD2 1QJU1 4H14A 2XJRA 5C4WA 4BM8A 5CB7A 2ZX3A 2XHKA 4YFZA 2PN5A 4IQPA 2ZAHA 5DG2A 1T6GC 2DVDA 5B2GB 2GU9A 1AYN2 4AGRA 1PGL1 3U07A 2RMU3 4HSLA 4GKYA 3HMYA 5T5PA 4OLLA 2LUWA 4HKLA 3E5UA 1MQTC 2HWC3 4AHYA 4WVZA 2D6KA 4E27A 1G6NA 1X33A 1HRI1 1YRZA 3VKFC 3OGJA 3CNAA 5K0UA 3ENRA 2VOKA 3N7KA 2EVXA 3OY8B 1D2QA 1TMF1 4YW4A 3ALQA 3VZOA 4NHKA 1SBEA 5CFCA 3HD8B 3S6PA 3AP7A 1PIV3 2ZAAA 4K6BA 2JKBA 1VBC2 4LA3A 2X29A 4W6XA 2MEV2 3EQEA 2JG8B 2HWC2 2QE3A 3C3VA 3RYKA 4YFWA 2EIGA 2GAUA 2I2SA 1AL21 3AP4A 4YM3A 4K40A 1EV12 3JD72 2Y26A 4XJ9A 4MVTA 1XRUA 3WZ1A 1QOSA 2BFUL 1AL23 4N53C 2V73A 2WNVA 4FOVA 3SH4A 2VH9A 5FLJA 2WSVA 1UL9A 3JQWA 3J4UH 4P14A 3ATGA 4XFGA 4BH9A 1MS8A 1C1LA 3DV8A 5AC92 4FTSA 1AX2A 2A6YA 3LWCA 4HVQA 1Z0HA 3I54A 3KB5A 1PO13 3HQXA 2GH2A 3P3PA 1ULCA 4EWAA 4JDOA 2CTVA 1M06G 1VALA 3WNXA 1GR3A 3VBRC 1GZWB 4FT8A 3FBYA 2D6NA 4XFHA 2VMHA 2LTNA 1DBNA 4V1PA 3KZ4C 1HRV1 5EYXA 4QM9A 2IFRA 3D0SA 1S55A 1WMFA 3VGIA 3VDDB 5K0UC 1XYNA 1X50A 5HCBA 5JOZA 2D7FA 2PHLA 2ZGUA 3V65A 4EJRA 1GZCA 1PVC1 2D98A 1LODA 1L3JA 1NCRB 4L2NA 2VOVA 4IESA 4XFAA 1OFSA 3B93A 1CAXA 1W6OB 3SH5A 4K7JA 1S1AA 3A0NA 4GALA 1LGNA 4HT1T 2ZHLA 1GQHA 5JZGC 4XBLA 4HLTA 4LBLA 3S7EA 4YW1A 3A0KA 3JBG3 2X5IA 4R9AA 1MS3A 1PVC3 2ZGSA 4DRVA 1RVF1 3WHTA 4DS0A 1R083 2DURA 1CPMA 4LO5B 1YIPA 1G9DA 4WVVA 3MDPA 2WQZC 3ES1A 2LM3A 2BUKA 1YJKA 3S7IA 1F8VA 1LU1A 4QPIB 1AX1A 2C1FA 2VOXA 1XU2A 4JGZC 2UY9A 3ZYGA 1H8VA 3ZFGA 2ZGRA 3FUOA 1NYWA 4JGZB 4FP3A 1LULA 4KU8A 5CVRA 5JZGB 4P9LA 2DVFA 4YGEA 4Q29A 1AUYA 2H6CA 5E1RA 4ASMB 2NZ9A 3JU9A 3AYCA 3I2DA 3EJKA 3OJBA 2HWE1 2XJUA 1QY4A 4KWJA 3NW4A 2QVSB 2YC0A 1ZZBA 1WW4A 1MZ5A 3KT7A 1NA1C 4G4FA 2DWRA 2Y0IA 3NAPA 1D4M1 5FREA 1RVF2 1V9U3 4GWMA 2WLPA 1YFYA 5L19A 4S2GA 3KGZA 1PIV2 4BHPA 1I3HA 2JG8A 3FZ3A 1IOAA 2EXHA 2ZMNA 4FAGA 4Y1ZA 1GNZA 4XILA 5D1IA 4RSUA 2KM2A 4META 3QH6A 4D69A 4XQDA 4YM1A 3DPRC 2B9UA 3AKRA 3FFZA 1Q5OA 5GLUA 2CAVA 1PGL2 5JSOA 1SQ4A 3HWJA 5FBZA 2BPA2 1WLTA 1BEV2 4G9SB 5JAXA 1XNBA 4CP0A 1I1EA 4QQPA 2RS32 4LE4A 4N7UA 4Y26A 3WG2A 1JUHA 3WW4A 3D4KA 4I2OA 1FMD1 4Z07A 2ZA9A 1SBFA 5JMCA 1Q3EA 2XLGA 2DCYA 5D8AA 1Q8QA 1ZRFA 4X6RB 1DG6A 3V64A 3AMPA 1O4YA 4GIQA 4XTPA 1RUI1 1B35C 1RUE1 4LLOA 3RNSA 4WZFA 2R063 2A6WA 3LOIA 4OHVA 4OI4A 1LHNA 5T5JA 4IV1B 5C8CB 2HEVF 1QOTA 2VG9A 2D6LX 3OD0A 2E9QA 5GZGA 2P2KA 3ST7A 5BNOB 1HXS1 1C8NA 4M3CA 1OKQA 1W2UA 3N7JA 4XJWA 1MQTA 1FOD1 3N7MA 2HWB2 3CU7A 4GB31 4Q4W3 4MH0E 4IEYA 2XG3A 2ZGNA 2EXJA 1CAWA 1PZ8A 4HKOA 4BMBA 4AVBA 2YUEA 2ZZQA 3SMHA 2XLAA 1VAMA 5GKAC 5BV6A 4L9BA 3IBMA 1Q56A 3PMSA 3QCWA 3ZPYA 2ZHMA 1N47A 2PAMA 4LBNA 2EALA 2XWJB 4CZSA 3VN4A 3VZJA 1LOAA 1GANA 4GB33 1Z7S2 1REFA 1N1YA 4TSVA 1ZRDA 5C9AC 3GZTB 3CO2A 2E7TA 4OI2A 5JDBA 1QXRA 4RHV1 2P3IA 1RJ7A 5D8AB 4NWVA 3HBZA 5FPZA 1WUVA 1ZBA2 1X8EA 4GH4A 5DDJ1 3WDXA 1N3QA 1VRH3 2VUJA 3O7OA 4WVMB 1PZ9A 4AFCA 1AHSA 4UW3A 3T2TA 5J36A 1C28A 2FZ1A 5GLWA 5LEKA 5DUUA 4RHV2 1HX6A 3J8F3 4B29A 2DUQA 3ZFEB 1HQNA 3X29B 1GNHA 3VBUC 1BQPA 4N53A 1HLCA 2JG9B 1FMD3 4UW5A 3TRSB 1NQJA 2R1BA 2Q1MA 3MGUA 5GZFA 4YGDA 2Z42A 1MZEA 4K21A 3K48A 3RMYA 3MF6A 4Q0QA 4NHLA 1AYM2 1TNFA 1HV1A 2D44A 2WT2A 4S2DA 4BMEA 1UW8A 3FMGA 1C3HA 1S0IA 1QH7A 5DDJ2 5CBLA 3CJIC 3ZFFC 2ZABA 4LT5A 4RS5B 5GLVA 1LOEA 4MXVA 4GQ7A 1VBD3 3JQXA 1HRV2 4JV4A 1RUOA 1VB2A 2R16A 4YG6A 3AZZA 3JD73 5GZEA 1MEC1 3SITA 2A3WA 2XUMA 1LRHA 1KITA 4AVTA 2CY6A 4M00A 4PF5A 3SNMA 4FPLA 3UJQA 1DZQA 4QMAA 5I0UA 1ZRCA 2VNOA 5JR7B 5SV8A 2PLV1 1PO23 1R1A1 4MZUA 5FAXA 5HCFA 5BUVA 3GF6A 2BTVC 4ES9A 2WA3A 3JB4C 1MS0A 3VBUB 2BFUS 1VBD1 2XWBB 5ABJB 2R041 4LBKA 5BNNA 4CDQA 1TMF2 2HWF2 5IT6A 3GHMA 1AXZA 5FLHA 5BNQA 4EN8B 1HXS2 1FT9A 2D3PA 1Q43A 4C91A 3FLPA 2YY1A 1QMJA 1AR71 5K7PA 5JOWA 3VBHC 5J7MA 1WW6A 2EA7A 3PVOA 4XDQA 3U0ZA 2WNEA 1O3SA 1KQRA 2PHWA 1CVNA 1N1VA 1V9U1 1JXNA 3VBSA 4F8AA 5DUXA 1APNA 4LE3A 3SLIA 1RVF3 1ULFA 3VBOC 4BIOA 2XH6A 5EXOA 2RM22 3VBRB 4Q1RA 4WM8C 1BYHA 1ZZ8A 1RMU1 4L99A 3ZFFA 5I8TA 2OPKA 4LTAA 3LZZA 4NWWA 2NPIA 3ZDSA 3H3ZA 1MVEA 1RIRA 1PO12 1X36A 3GZAA 1N1SA 1VB4A 3QOPA 3USSA 2WJSA 3CJXA 4ONUA 5I0TA 3KQRA 2GALA 5AFEA 1PVXA 2Q1ZB 1UKGA 4XETA 4L11A 1V70A 2ZACA 3C2UA 3KD4A 3MIBA 1ZYBA 4E2GA 1C1FA 4DQAA 4E4DX 1W6MB 4J1XA 4YVWB 4OULA 4RL7A 4EN0A 4P9JA 3RWNA 3MPBA 4LBQD 2XBO2 1HW5A 1G7YA 2V5YA 4Q4X1 5T5OA 4LA2A 5BNNB 1OQ1A 1ZREA 2VNGA 3ILFA 5KXEA 1G9FA 1PK6C 2O8OA 2A6VA 1WD4A 2DCZA 2RS52 2OW4A 1G8WA 4GMP3 2CWSA 4JAAA 1U5ZA 3AKTA 3WLUA 2HKXA 4JTNA 1LOBA 1DHKB 5F5QA 5JCTA 4KWKA 1F5FA 1JTZX 1EY2A 1H9WA 1HQLA 3ILRA 3LAGA 5JI9A 3VBOA 3VDDC 4XF3A 1KRIA 3EXUA 2P37A 1C5HA 4ES8A 3WQ0A 4XYXA 4QPGC 1RUH2 3DF0A 2WS92 5LK5A 3ZVXA 4Q0VA 3OBTA 3E6BA 3H7YA 2FMYA 4GWNA 1NLSA 1SBDA 2ZJCA 4I01A 1HRV3 5GZCA 4N7IA 3PHMA 4W6YA 4IEQA 2XL7A 4AEDB 4ZU7A 2EAAA 5I93A 2IC1A 2OUHA 2XKPA 3ACLA 4XFIA 4FOWA 4FPJA 4GMP0 1H2NA 4IEWA 4PIXA 2D40A 1C8M2 4LO7A 2ZGTA 4R52A 3M3OA 3RG0A 4Y1VA 1BBT2 1GKBA 3M3QA 4QPIA 1J3RA 2GC2A 1SMVA 4HSJA 4YW2A 5E8AA 2X5IC 1TEIA 5EYYA 3POYA 4XF1A 1KXGA 4DY5A 1RB8G 4JGYB 4AEJA 1GLHA 4BE3A 5JVVA 3HN1A 3PMEA 3AJYA 4DRRA 3EO6A 4N9IA 3VDDA 2Q30A 1VRH2 3E6CC 4KNCA 3J9SA 2GNDA 2DTYA 2XVGA 5FPXA 4Q4Y1 5C33A 1RUH1 2DF7A 2QFEA 4R9BA 2EAKA 5FOBB 1EAH2 1TMF3 4L92A 1ULEA 2LALA 5FFOC 2PHFA 4FPFA 2ZGLA 4MSVA 4GMP1 1V9U2 3WX5A 2GMMA 3OPZA 1RUG3 2AGSA 4COVA 2ZGOA 1NE4A 3S30A 2ET7A 5HXVA 1KJLA 2RMU1 2VOWA 3MZHA 2ZMLA 4WM8B 4RFT0 4YYOA 2NQYA 3ETQA 1JW6A 5I8YA 4FPHA 3ZIXA 5BXXA 4HMZA 1J1TA 3NKGA 1QU0A 4JTOA 4WM7A 4KG8A 2RS31 1LCLA 3RZZA 2AENA 1BXHA 2WFF1 2RM21 4B8EA 4KL1A 1O5LA 3EBRA 2CGNA 4CDUC 3P3NA 2JJ6A 2P3KA 2G9FA 4QQLA 5HCAA 4IEVA 4YZ5A 3MIDA 4I0WB 4MX3A 3HIFA 3SCGA 1QJX3 3WQ1A 1ZZCA 3RYRA 1R082 3AK0A 3O0XA 1RINA 3MW3A 4UBGA 3N7LA 1AR91 5KC5A 2JE9A 2R32A 3WD5A 2VU9A 5BNOC 1MQTB 2A73B 3KS7A 2WWSA 3MF9A 2IXIA 4BYYA 2GNMA 1SFNA 1AR73 2IXKA 1RUF3 3M70A 3OCPA 1A3KA 1RUJ1 3IDEA 4CDQC 5A3MA 1MS4A 1ND3A 1RC6A 4WZCA 4CDXB 1RUE2 1RUF2 5AVAA 3BODA 3PNAA 1AR72 3JZVA 3OYWB 2VGDA 3IT8A 3MLJA 1PO11 2TUNA 2WZR1 2HWD3 5ACA3 1VBE2 2WNVB 1NY71 1D4VB 2WQ4A 4I0BA 2A6ZA 3BCWA 1ENQA 1S0GA 5KHGA 3VBSC 3NV2A 4MXWB 1VBD2 2Z5WA 4OHWA 4YW5A 1UIJA 1DFQA 1K5MA 1YIFA 4WM7B 1ZX5A 3WQ7A 5KWRA 4JVAA 2AH2A 2ARBA 1KD7A 4AGGA 5F6KA 2ET1A 1FPN1 4L8QA 1PHMA 5A32B 2G4IA 2G9GA 2DUOA 1UPIA 1YFXA 2N7GA 2XJVA 4FBFA 1DGRN 4ZXKA 4JDMA 5FLIA 5DXDA 3AXDA 3TOJA 1OPMA 2VMGA 3U4XA 1XQNA 2D6OX 3HT2A 3PVEA 5LRRA 1PIV1 2GNBA 1AXKA 1AR93 2BNMA 5BNOA 2GN3A 2BW8A 3MIEA 1CJDA 1U5XA 4BZ4A 5FO8B 1LOCA 1OSGA 4Q0PA 5T3NA 1ZBA1 1ASJ3 1N3OA 2E63A 1FV3A 2JENA 2MPFA 1UCXA 3M3EA 2RM23 2B7YA 3FBMA 3CJIB 3BU7A 1IS3A 4AQ2A 1Z7S1 4AFBA 1H4GA 1LJ7A 1Z78A 5EFUA 5LK7B 1DU3D 1ZA4A 4CDXA 3WP3A 4PDWC 3AP6A 4AEDA 4AHXA 1W6QB 3J26N 5KHKA 4Q8KA 2GMEA 1A78A 4HPKA 3ZMNA 3SH3A 3E6DA 4AQSA 3GBFA 4AQ6A 5E89A 5FRAA 1OA4A 2CGOA 5C8CC 4HVRA 1N1TA 4KGQA 4A7ZA 4COZA 5CAZA 1AJKA 4XFFA 4KU7A 5EWSA 1A8DA 2WNUC 2EXKA 2XBO3 4Q8LA 1MS5A 5A32A 4XF9A 1H8TC 2P17A 4FPKA 4PLOA 4E9KA 2XPJA 4DMIA 4YZ3A 1UPSA 3AJZA 1EV11 1VBB3 1YJLA 1FNYA 1EPWA 3WP6A 3OY8A 3ZMOA 4QQ2A 1FYUA 1LU2A 3URFA 2VVFA 1IS6A 1YYNA 4MGZE 5BNPB 4AQTA 4OUSA 4RR3A 1W0PA 3K51A 3VBHA 1OI6A 3I4IA 1NCQB 2CAUA 2A7AA 3OBRA 1DQ2A 1TME3 1QGLA 1I5ZA 2R062 3INAA 4R9CA 1WMEA 1YI9A 2E7AA 5J37A 3DKWA 5FTTC 4M01A 3MLKA 1HKDA 4CEYA 1WCDJ 4YVWC 3M2MA 4Z92B 1RUC1 4YVSB 3KMHA 1FXZA 2PAKA 4LNVA 1ONAA 4QPGB 1RUG2 4JCKA 3VBFC 1WBFA 3H3UA 3B9IA 4Y22B 1RUJ3 4ITCA 5I91A 3VKLA 4PBOA 4XZPA 2ZBJA 2WZPP 3PVBB 3VUOA 2NP0A 3ZXLA 4WVWA 5L7OB 1OA2A 4FQZA 3AYAA 3MI8A 3ZO0B 1DGLA 3RPQA 1AYM1 1SLTA 5CFCC 4XJ8A 3R4SA 3APBA 1WLCA 1FI2A 1UIKA 1FNZA 2BGCA 3WHUA 1NE6A 4IXLA 4LLFA 1AYN3 1D4M3 4FOYA 4BWOA 4TYSA 3AKSA 5DUWA 2GC3A 3NL1A 3I7DA 1ZZ9A 2R30A 2TBVA 3NAPB 3ZN6A 4M3CE 1QNWA 4FXKB 4B4QA 2B8MA 2NYYA 2WFF3 2UWBA 4AEKA 4LEJA 2PAEA 4MUVA 1BEV1 1KS5A 4YARA 1WD3A 4I0AA 4F7ZA 1SLLA 1ZBE2 1BK1A 5IK4A 1IKQA 2GMPA 3OGGA 3ZYJB 2NMNA 2X5IB 3L9JT 3SHRA 2GDFA 4XBNA 1JH5A 1SCSA 1SLBA 3VBFA 2HJIA 4FXGB 4YZ4A 5CFDA 4KQ7A 1F2NA 1KFXL 1H4HA 1VBC3 4D3WA 4R4ZA 4Z1VA 1W6MA 1G9AA 2QUOA 4MXWA 1BEV3 1CAVA 3Q9OA 3MEPA 1BCXA 1YO8A 2P3JA 3AYEA 3FUQA 3PLQA 3AMQA 1W6NB 1DGWX 1NXMA 3KCXA 3ZSKA 2WNUB 5DZFA 1DGWA 2ATFA 3VV1A 1UZYA 3R05A 3LA2A 4XJZA 2JG9A <