2UWAA

Crystal structure of the nasturtium seedling xyloglucanase isoform nxg1
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
274
structure length
274
Chain Sequence
AYVQGPPSPGYYPSSQITSLGFDQGYTNLWGPQHQRVDQGSLTIWLDSTSGSGFKSINRYRSGYFGANIKLQSGYTAGVITSFYLSNNQDYPGKHDEIDIEFLGTIPGKPYTLQTNVFIEGSGDYNIIGREMRIHLWFDPTQDYHNYAIYWTPSEIIFFVDDVPIRRYPRKSDATFPLRPLWVYGSVWDASSWATENGKYKADYRYQPFVGKYEDFKLGSCTVEAASSCNPASVSPYGQLSQQQVAAMEWVQKNYMVYNYCDDPTRDHTLTPEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CELLULASE
publication title Structural Evidence for the Evolution of Xyloglucanase Activity from Xyloglucan Endo-Transglycosylases: Biological Implications for Cell Wall Metabolism.
pubmed doi rcsb
source organism Tropaeolum majus
total genus 68
structure length 274
sequence length 274
chains with identical sequence B, C
ec nomenclature ec 3.2.1.151: Xyloglucan-specific endo-beta-1,4-glucanase.
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
A PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2uwaA00
2WT2A 4XBNA 4DQAA 3D5OA 2WKKA 3N35A 2GMMA 2ZGSA 2ENRA 3OBTA 4UW6A 1LGNA 3O0VA 2DWRA 4PBPA 3MW4A 4BQ1A 1ENSA 3WUCA 5DUWA 3SISA 1DYKA 3RRDA 1MS1A 1N3QA 4XJZA 3BIWE 2PHXA 1OKQA 1CN1A 1URXA 1BQPA 3PVNA 2ZGQA 1LHWA 4C1XA 5IK7A 3USUA 1WBFA 3B01A 1VIWB 5KXDA 3ZYPA 3SITA 1APNA 3WOGA 3M3CA 1S0GA 1W0OA 5GLUA 4XDQA 3O0XA 3IN9A 3SH4A 1IOAA 1DQ4A 3NV2A 1WCSA 4ITCA 4Y1VA 1ENRA 5DZEA 1A8DA 2R0HA 4FPCA 1Q8SA 3AZZA 1WD4A 1X50A 1JOJA 4FQZA 4K1YA 4LBLA 3HMYA 5JVVA 4ASMB 3ENRA 1UKGA 2WJSA 2VW1A 5IK5A 1QOTA 3ASIA 4PQ9A 5T52A 3N3HA 1LEMA 3D6EA 2R1DA 3T1LA 4XMIA 1S0CA 3UL2A 4XJWA 3IKWA 4UW5A 2ZGUA 2ZGKA 4R9CA 3OJBA 5FREA 2D3SA 2DUQA 1GZ9A 1PZ7A 5GJ6A 1HKDA 3VV1A 1AJOA 1QF3A 3FUOA 3W58A 2P34A 1MVEA 1KJRA 4DS0A 1SACA 1FX5A 2UWBA 4Q27A 4ATFA 1D2SA 1HLCA 5EYXA 4BLIA 5H9QA 1MZ5A 1ULCA 2ZGRA 4Y22A 5LK5A 3MW3A 4RA0A 3V0BB 1MS9A 2JKBA 2EAKA 3IPVB 4FPLA 1DHKB 4IQPA 5HCFA 1AJKA 4R9BA 1FYUA 3VKOA 2CTVA 1HQWA 4FOVA 4F83A 1S1AA 3KM5A 4PCRA 3AJYA 1DFQA 4Y20A 3OYWB 1Z0HA 1GNZA 3V0AA 1DQ5A 1SLTA 2ZA9A 5GZFA 3BOPA 2CNAA 2E7TA 3M1HA 4LBQD 1LOBA 2PHWA 4M00A 5HCBA 4XJUA 1NXD1 1LODA 3IPVA 3IM0A 1SBFA 3UJOA 4XXAA 1DQ0A 1S0FA 3POSA 4FPKA 5DZFA 2EALA 4XTMA 3WDYA 3BODA 3M3EA 1SLIA 1AXZA 1FNYA 2Z42A 1UAIA 1WW5A 2RHPA 3WG4A 1W6MB 1MR5A 2D3PA 2R16A 4XXPA 3LCPA 5IK4A 3A0KA 2PHTA 1CQ9A 2GALA 3OPZA 3ZPYA 2EIGA 1YXWA 3W59A 1JBCA 2DUOA 4KBBA 2ZGMA 4Q2FA 5E88A 1LU2A 4YGDA 3LSEA 5FRAA 5GLZA 1FV2A 1QMJA 1UL9A 1N1TA 3AZVA 5BYNA 2CWSA 2DVFA 3AP4A 2A6ZA 3T1MA 4AVTA 1Q8QA 1Z78A 4XJ8A 3WHTA 4AVVA 4PF5A 1DLLA 1G86A 3B9CA 1V6IA 4YFWA 1GLHA 3ZSKA 2NM1A 4ATEA 4M01A 2DV9A 2DUPA 3H0OA 1GICA 4FPJA 5T5PA 1QNWA 1LEDA 3AXEA 2VW2A 1ULEA 2YV8A 2TEPA 4FPEA 1UZZA 4FP3A 4XE9A 2GN3A 3N7MA 1LULA 3MEPA 2UWCA 1LHOA 2CY6A 2OVUA 5KXCA 3USUB 2AENA 4FOQA 4GWNA 3WG1A 3WDWA 2DVDA 3HN1A 2Q5TA 3O0WA 1WBLA 1AF9A 3KQRA 4Y1UA 4AWDA 3A4UA 1S0IA 3WHUA 4WV8A 1ENQA 3ZXJA 1QNYA 3MW2A 4YZ1A 1JN2P 1SCSA 2P3JA 3L2YA 2CYFA 5GLVA 5JOXA 4DFSA 3AXDA 2OUHA 3IMNA 3NV3A 2AREA 2CL2A 4BOWA 1MS3A 4YM1A 1C1LA 3ZSJA 1IKPA 4XILA 2DU0A 1HDKA 1QDCA 3B3QE 4GKYA 4UW3A 2OUJA 1W0PA 2NMOA 2NZ9A 1O4YA 3O5SA 2AR6A 2A6XA 4R9AA 4YG6A 3WCRA 4XBLA 2ARBA 4FPOB 1Q8VA 1UPSA 4GWMA 4U2AA 3TB0A 2W52A 3POYA 3GALA 3NV4A 4GA9A 4M3CB 5CBLA 4FVVA 2EXKA 2PELA 4YLZA 3N36A 4WVVA 3VKLA 4Z8BA 2LALA 3OY8A 3FLTA 1RIRA 1AXKA 1A78A 2VW0A 2UWAA 3Q9OA 4LBMA 2DU1A 4Q1RA 1JUIA 2YY1A 2NP0A 3NWKA 1CONA 1WLDA 5T55A 1ULGA 2A3XA 2FMDA 5JDBA 2FHRA 2PHRA 4D69A 3M3QA 4YZ5A 1FATA 1Q8OA 1ONAA 3AP7A 5T54A 5CAZA 1LTEA 3AYEA 4Y22B 1AX1A 2EF6A 1AX2A 1SLLA 1BYHA 2C9AA 4M3CA 4XIOA 1WUVA 2XG3A 3AJZA 3WDUA 2ZACA 1G7YA 3WG3A 1V00A 3SH3A 3AX4A 4XZPA 4Y20B 1TEIA 3I8TA 4JC1A 2VY0A 3RG0A 1IS5A 4XJAA 2GDFA 5GZGA 3V0AB 2A5ZA 4FPYA 1LOFC 3TAYA 3AYDA 1JYIA 1IS4A 1Q8PA 1QDOA 4M3CE 1LGCA 3AP5A 2D7FA 2V5YA 5GLTA 2E6VA 1MACA 4YGEA 2YZ4A 4YG3A 5JMCA 1V6OA 1F31A 4P9XA 1GZWA 3FBYA 5GZCA 5KXBA 3RMYA 3PMEA 2WT0A 4GXLA 1IKQA 2VH9A 2JE7A 1UN1A 3INAA 4LBQA 4BM8A 5F9TA 5JOWA 4C1WA 3RS6A 1CJPA 2A75A 4YG0A 3ZYRA 5CB7A 2ZGNA 4YZ2A 2JJ6A 1DIWA 2R49A 5DG1A 1CIWA 1MS0A 1PZ8A 5GZEA 3ZXFA 5EYYA 3ZSLA 4NO4A 2ZHLA 4NOTA 4Y1XA 3V65A 1N1VA 3WCSA 1LGBA 2ZGLA 4K1ZA 4LBKA 3ZVXA 5SV8A 1V6MA 4YW1A 3DUIA 1DQ1A 2GNTA 4K21A 2G4IA 1AZDA 5F5QA 1W6PA 2GNMA 3U4XA 2NYYA 1V6KA 4RL7A 4BLJA 1EPWA 1VALA 4U36A 1FNZA 1MVQA 4XMAA 5H9SA 1V6NA 3A0NA 1G9DA 1B09A 4LBOA 4W65A 1S0JA 1W6NB 4SLIA 4FOWA 4TZDA 3NV1A 5H9RA 1MS8A 2A6WA 1N47A 2D6PA 1GANA 3M2MA 2B7YA 4JRAA 3VKMA 1LESA 1UX6A 2E7QA 3AYAA 4P9WA 4DRRA 1R1ZA 2R0FA 4UW4A 3AZYA 2GNBA 3AP9A 1QKQA 5E8AA 4XHBA 3DGTA 1DYPA 2R1BA 2A3YA 4M3CF 1HQLA 4CTEA 1KITA 3OGGA 4Q1PA 3VKNA 2D3RA 1GBGA 1S0EA 2D6NA 1W6NA 1BZWA 2ZGPA 3ILRA 2I2SA 3PJQA 5E89A 5T5JA 2WQZC 2W68A 3B00A 3PVOA 1RITA 1ZM1A 2ZBJA 1YIFA 2VU9A 3JU9A 2ARXA 4HANA 3ZSMA 4BMEA 2W08A 4JCKA 5T5LA 2GNDA 3RQ0A 1LOFA 3N7KA 5EWSA 5GLWA 3WNXA 2ZGOA 3O12A 4AVSA 4XOGA 4YM3A 3FUQA 2D6MA 2PHFA 2YMZA 5CA6A 3C2UA 2ERFA 2DTYA 3SLIA 1CPMA 4Q8KA 3OY8B 1F5FA 3N7LA 1JW6A 3HR9A 3I4IA 3POWA 4LBJA 2ES3A 2WSVA 5GM0A 4YFZA 2WSUA 1G9AA 4WVWA 1N3OA 3WDVA 1D0HA 1WW7A 2C5DA 4ZKTB 1VAVA 2A6VA 2DTWA 5AVAA 1KRIA 3M3OA 4YW3A 2HYKA 5DUXA 1W6QA 1AX0A 1CR7A 4Y26A 5L73A 1G9BA 1BXHA 2SLIA 2DURA 1LECA 3UK9A 2D6LX 4YZ3A 1V6LA 2V73A 1MS5A 5H9PA 3V0BA 2GMPA 1WLWA 2AYHA 2CWMA 3CNAA 1C57A 3ILNA 5DG2A 4ISQA 2GMEA 2ZHKA 1SBEA 4FP2A 1PZ9A 4PBOA 1GV9A 4ZXKA 3WVJA 4BPZA 1JHNA 1QGLA 4AGRA 4OZXA 3AP6A 5DXDA 2EXHA 1LHUA 1JXNA 1H9WA 1KDKA 1S0BA 2P2KA 3SH5A 1J1TA 1GZWB 3GNEA 1KQRA 2ZMLA 3AZWA 1QOOA 1NLSA 1OQ1A 1SCRA 1CESA 1DBNA 3R4SA 1U0AA 1N1SA 3ZXKA 3RMXA 4LBQB 2ZGTA 5GZDA 4GKXA 1WW6A 2W39A 2EXIA 2KM2A 2D44A 4AYUA 1I1EA 1ULFA 3AK0A 2A70A 2PHUA 3ZXLA 4AGGA 1LJ7A 4P9YA 1GKBA 2DVAA 2P3IA 5EXOA 4DRVA 1GSLA 4Y1ZA 1UZYA 2WNEA 1LU1A 1YYNA 4YW4A 2A71A 4XHXA 3JUUA 5CNAA 1BKZA 3WV6A 2UURA 1W6PB 1YRZA 1LENA 1XQNA 2P3KA 2SBAA 4Q8LA 4R9DA 4Y24A 5JLVA 2BQPA 3APBA 4HL0A 5DUVA 4YM2A 3BTAA 1I3HA 4ISRA 3WZ1A 1W6OB 1SLBA 5DZGA 1DZQA 1V6JA 2VXRA 2EXJA 1LOEA 4XTPA 1BJQA 4XYXA 4FPHA 1CPNA 4CZSA 4XIKA 5IT6A 4XBQA 4K20A 4YGCA 1VAMA 3T2TA 1MS4A 3B69A 1F9KA 1ZA4A 1LCLA 2ZABA 5T50A 2JE9A 1A3KA 1C1FA 4YZ4A 1G9CA 4FPGA 3WLUA 3WUDA 1G9FA 3D4KA 3FFZA 2AH2A 3RSJA 4I30A 2WT1A 2VUAA 4Y1YA 4YM0A 2E53A 1IS3A 1SLCA 1W6OA 2DYCA 5KXEA 5DUUA 3N7JA 4TYSA 1FAYA 1GNHA 5IUQA 1WLCA 3ATGA 2A7AA 1SBDA 1IS6A 4GALA 1CVNA 1VLNA 1Y7BA 3OBRA 1QU0A 1H9PA 2ZHNA 3WDXA 1FV3A 2ZAAA 3AZXA 4Q26A 2D43A 1GYKA 1SLAA 4DPNA 2ZMNA 4MYEA 4YW2A 5T5OA 1LOGA 1OFSA 2DVBA 1YI7A 3LSDA 1N3PA 3OYWA 4P14A 1WW4A 1JYCA 2H0BA 3QLQA 2A3WA 3ZXEA 2D6OX 1YO8A 2D6KA 1GZCA 2NMNA 2UU8A 2JDZA 3SNMA 4CRQA 1RINA 3V64A 1DQ6A 2LTNA 1SFYA 1LHVA 2ZKNA 3FLPA 2WLQA 2YROA 5JOYA 2A6YA 5IK8A 4LBNA 4WZFA 5GALA 3WDTA 1S0DA 3MPPG 2ZMKA 1N1YA 3QCWA 4FQ4A 3AYCA 4YW5A 2NN8A 1QOSA 3FLRA 1LOAA 3UJQA 3R05A 1AXYA 1G8WA 5HCAA 2GN7A 1DQ2A 3AFKA 4XJ9A 2ZZJA 1W6QB 1WD3A 1ULDA 3PVEA 1W6MA 2ZHMA 1Q56A 2AGSA 2YXSA 2JD4A 4L8QA 2P37A 1C4RA 3R4UA 1LOCA 4H55A 3VUOA 2JECA 2E51A 3WG2A 1LHNA 1UMZA 4AGVA 4BMBA 1H30A 1DGLA 1O4ZA 2XB6C 1AVBA 1KJLA 4FOYA 4YGBA 2AUYA 1KDMA 2OW4A 3VKFC 1MZ6A 3ILFA 4FPFA 5JOZA 2DVGA
chains in the Genus database with same CATH superfamily
4XBNA 4DQAA 4AEKA 4D7YA 3D5OA 1K5MB 2PHLA 3N9QA 4GH4A 2RS31 3N35A 5BNOC 3NNMA 4BIOA 1CWPA 1NCQC 1H2NA 2BGOA 3MW4A 4Q4W2 4JDNA 1BEV3 1ENSA 3WUCA 4QGLA 1OMIA 5DUWA 3SISA 3WNLA 5HV0A 3RRDA 1MS1A 2VQAA 3K46A 3LE0A 4P08A 4UBHA 1OKQA 2WC2A 1BQPA 2VD7A 2HWF1 4MVTA 2BDRA 4Y5SA 4C1XA 1RMU2 5FPVA 3ZYPA 3SITA 1APNA 1CX4A 1OLMA 4XC9A 1W0OA 3K3NA 4QPGA 5FKBA 4XDQA 5GLUA 4BYYA 2VTXA 3SH4A 4HK8A 1YFXA 1ENRA 5K4LA 2Q30A 4AVCA 1RUF3 5BY5A 5C7GA 1XYPA 5CFCC 1XC6A 4G4FA 1JOJA 2WS93 5ANQA 4N43C 4QWNA 2WFF1 3ENRA 1M4WA 4Y5TA 5IK5A 2VW1A 1HJFA 3ASIA 2DCYA 2G9ZA 4LKEA 1PO13 3B02A 3D6EA 1PGW1 4IV3C 1CZSA 2R1DA 4XFBA 5LASA 2ADEA 2XKOA 1VBD2 2VUCA 4QX2A 3RYKA 5LWBA 4OFGA 4Q4X3 2ID4A 2ZGKA 2WFPA 3BPZA 2HLEA 3BOWA 4B7KA 1GZ9A 1X9TA 2PAMA 3AC0A 5CFDB 1ZA7A 3ZFFA 1HKDA 2VOVA 3EYPA 5JSRA 4M0HA 5FZAA 4S2HA 3RYPA 4MGSA 3SMHA 1PIV2 2WZR1 1HN1A 3DPRB 4P9GA 4QDSA 3IDBB 3VDDB 3POIA 4URTA 3C3VA 3SKJE 2RM21 1U5XA 2WNOA 2ZGRA 3GCXA 3ECQA 1GQPA 3DL3A 1FPN3 4N8MA 5J3UA 5A7WA 4FPLA 5A3OA 1CIYA 3VN4A 4IQPA 1PX4A 4R9BA 4KBZA 1FYUA 4NHYA 4QAWA 3NVCA 1RVF3 1UQXA 2CTVA 1JS9A 2VZRA 3KM5A 3FX3A 1DFQA 4LJHA 4Y20A 1Z0HA 4BU2A 1XU1A 1DP0A 2OQ7A 1GNZA 5KHJA 1DGRA 1SLTA 1ND3C 2ZA9A 3NRUA 2CNAA 4LHLA 5GZFA 3ZPOA 4BA6A 1VB2A 1LOBA 1VBA2 2PHWA 4CCKA 2WAOA 2RS33 3IIIA 1ZVFA 2JDMA 2XJTA 1W8TA 4RFRB 2PQQA 5F6KA 2B8MA 1BBT2 3EJKA 5FY5A 3MPBA 4YARA 1DZTA 3W5NA 3POSA 1NLQA 4COZA 3NAPB 3B94A 4IEXA 3VD9A 3BODA 3H8UA 4UXAA 1POV1 2Q8OA 1POV0 2I07B 1UO9A 2W46A 5APAA 4AK3A 5DMYA 2VZTA 4XXPA 2YC0A 5IK4A 1UYZA 2PHTA 1C8NA 5FYTA 2FDIA 2RDNA 3ZPYA 4BXFA 1UOFA 1DDLA 5FZ8A 1YXWA 1JBCA 1V9U2 2RS52 2V09A 2HBTA 4Q2FA 3RZGA 4V2VA 1PK6B 4P00B 1Y43B 3OD4A 3S6PA 4PLMA 3G6JB 3GZUC 1AYM2 2FDFA 5LA1A 2WFF3 4ZZ5A 1D4M1 2IXIA 3AP4A 2A6ZA 4CP1A 3LIHA 2UYBA 3LAGA 3B9CA 1PVXA 1XE0A 2IXKA 2OT7A 5ABJA 3ZSKA 2HWD2 2NM1A 3WXPA 3T0BA 1WA6X 2VGDA 1E5RA 2EA7A 1JYTA 1QNWA 1PK6A 1ULEA 5AC91 4QKNA 5FO9B 3FZ3A 2JIGA 5DAXA 1JZ3A 1LHOA 2WZR3 2Y34A 4QX0A 3WT3A 2X29A 3USUB 2AENA 4GWNA 4I3GA 4ES8A 4UT5A 2RJKA 1B35C 2BBVA 2W2IA 3BN6A 4OLLA 1ZBE1 4EWEA 5G04L 4XFAA 2RM23 1O3RA 4X8NA 3A4UA 2PQSA 3C7FA 4LXLA 3M8LA 3WHUA 5IWFA 1ZBA3 2GU9A 4IV1C 1XJAA 3OD0A 1IZ3A 2BNMA 1GU3A 3OG2A 3CJIC 4JGYB 4ONUA 1XB9A 4YZ1A 5LY1A 3KLSA 1JN2P 3CHXA 1ACCA 4QHOA 1NLRA 2AREA 2OS2A 1MS3A 1RUI3 3VD4A 2HEVF 4XILA 1JU3A 2YFUA 5A3NA 4QHBA 1W0PA 4IGPA 4RR3C 1RJ7A 1RUG1 2AR6A 3QOPA 4W6YA 2QQVA 4U2AA 3TB0A 2W52A 5FPUA 4KI5M 2FDHA 4M3CB 2EXKA 5FKCA 2QNKA 3N36A 3VKLA 3AB0A 3KZ4C 3H8XA 3FLTA 5L9RA 4JHZA 3VBSA 3AVSA 4CCLA 3PIGA 5CKNA 1JZ4A 3ZKYA 1JUIA 1AL0G 4CYDA 5T55A 1OLME 2A3XA 4E2SA 1POV3 4WM7B 2PHRA 1VE0A 4D69A 3M3QA 5KBFA 5CAZA 3QH6A 3SCFA 4Y22B 2YYOA 2JE8A 4W6WA 1TMF2 2CDPA 2VZSA 4HK9A 3RPQA 1BYHA 2C9AA 3HIFA 4M3CA 4XF3A 4B7EA 5FV3A 2WINB 2XG3A 5I8YA 1Y9GA 3WDUA 4BISA 3WG3A 2DF7A 4FFIA 2XGXA 2OQ6A 3SH3A 2YG0A 3I7DA 3AX4A 4XZPA 1FOD2 4Q5OA 2KA3A 2VY0A 1HXS2 3RG0A 3ELNA 4QXKA 1D4M3 4XFGA 1LOFC 5FZKA 5FWJA 5J09A 2PTMA 3AYDA 4OCTA 1EAH2 5FLIA 1QDOA 4QB2A 3VBHB 3FHQA 3WD5A 5IW0A 3FWEA 3AP5A 1PGSA 2V5YA 2WO3A 5GLTA 5ACA1 2G9FA 3PTRB 1W2NA 4YGEA 1VBC2 1SZBA 1F31A 2VQTA 1GZWA 3FBYA 4P9XA 5GZCA 5KXBA 4UI9L 4IEUA 2Y6HA 4IE7A 4KU8A 2VH9A 4QKDA 5AC93 1F5JA 2NQYA 2KXLA 1QIQA 3RS6A 4C1WA 3S0MA 5C8CB 4YG0A 1RXGA 5F1RA 5EIYB 2JJ6A 1J83A 4XVHA 5FZ1A 3ZXFA 2BBAA 1RHI3 5I0RA 3KQ4B 2JG8B 3WQ1A 1ZBE3 3V65A 5IJRA 5A7SA 4LBKA 4E4SA 5SV8A 3FHAA 4YW1A 5F3CA 3NO8A 4AFMA 2HWB1 1DQ1A 2HWE2 2ADDA 5F5QA 1W6PA 5FAXA 1W8NA 2Q1FA 1JOPA 4HG6B 2UY9A 4U36A 2CDOA 1PVC3 1OUXA 4XMAA 4YVWC 1MQTC 5HXVA 4LBOA 1U5ZA 2JG9B 5FZOB 5C8WA 1GOGA 4OHWA 1NA1A 3EQEA 1DG6A 4F7ZA 2XLAA 5JPMB 1K5MC 4UYBA 5BNNB 3BALA 2A6WA 5FQ0B 3P3NA 3POFA 2F6BA 1ND2B 2QQIA 2B7YA 1WCQA 4LE3A 2JEMA 3AYAA 2VMCA 3VBUB 4DRRA 4UW4A 4OI1A 1UZVA 2H0VA 2GNBA 2XKPA 2RR12 1W05A 5D1IA 3IDAA 1QKQA 3HN3A 1HX6A 5E8AA 4XHBA 1DYPA 2R1BA 4M3CF 2A1XA 1KITA 1HQNA 4Q1PA 2JG9A 4XUPA 5FZOA 1E57A 3VKNA 4ARYA 4CEWA 2Q1MA 2YUEA 2GH2A 2I2SA 4H7LA 5ISLA 3ZO0B 2W68A 3FFQA 4M4RA 5C3PA 2ZBJA 1ASJ1 4JKKA 5FJKA 2VCBA 3VDAA 4FXKB 3VHRA 5A70A 4CXWA 3RQ0A 4LK7A 4HSLA 4HONA 2YPDA 5GLWA 2CU5A 2YU1A 3WNXA 1SDWA 2BNNA 4AVSA 2X5IB 3WP5A 4XOGA 2BOJA 4D0QA 5KC5A 1VP6A 2OZJA 5ACA3 3BTXA 5DDJ2 2MHFA 4GJZA 3MF6A 2W94A 4Q8KA 3RWKX 1F5FA 5C5TA 1JW6A 3POWA 1RUD2 5CFDC 1IQDC 2ES3A 2WSVA 3E97A 4QDQA 5H9SA 4Q4V2 2WUHA 4GULA 1ZX5A 1VAVA 2A6VA 3WW2A 3KT7A 4UFLA 5C71A 5HI0A 4YW3A 1NT0A 3DPRC 3Q8BA 5DUXA 3U4SA 3VDDC 1D2QA 2B39A 3K75B 3THTA 1XU2A 2DURA 4WVMB 4DNYA 3L9JT 4LO5B 1ZRDA 1X9PA 3UK9A 4YZ3A 2HWB3 3T09A 1RUE2 2GMPA 3D0SA 2Y26A 1NY72 2AYHA 1HV1A 3ILNA 4RGAA 1JYWA 1QJZA 2E26A 1W8FA 2EVXA 5DG2A 4UFJA 2RDRA 4BQXA 2GMEA 2XLGA 4PBOA 4WM8A 1PZ9A 4Y4YA 1EY2A 3DKWA 5FTTC 1SPPA 4I01A 1AYN2 4NRMA 4N9IA 4W4ZA 2JIJA 3AP6A 3GHNA 3OUHA 1K5JA 1NG0A 1QH6A 1KDKA 2MEV1 5D8AB 1ZZBA 3OBZA 1KQRA 1C28A 2BW8A 2VCCA 1OQ1A 3AZWA 1SCRA 3R4SA 1DBNA 4RS5B 5FYBA 4HPKB 2Q8CA 2CHHA 4N90A 4CU6A 4CUCA 2EXIA 3NAPC 1REEA 2J1EA 4D6RA 3O1PA 4AYUA 3HWJA 1VBE2 1TME2 1GKBA 4QQ2A 2P3IA 2XBO2 5LCWL 4DRVA 4Y1ZA 2VTXJ 4BQYA 4NN0A 1PM4A 2B5HA 4YW4A 4QU1A 1AR62 1AHSA 1PO22 4JDMA 3DN7A 3WV6A 3KWVA 5JZGA 2UURA 1JYVA 1ASJ3 2LW8A 4R9DA 5FPBA 3EB7A 4GB32 4BQ2A 2FZ2A 5DUVA 4YM2A 2JX9A 2PN5A 1XPWA 5JIAA 2B45X 3N9PA 2VXRA 2EXJA 4OUMA 5FP4A 4XTPA 4XYXA 2JDHA 3RGBA 2QE3A 4Y3OA 4CZSA 3IDEA 4XBQA 4K20A 4QM8A 1JZ6A 1JZ5A 1F9KA 5T50A 2RDSA 2JE9A 3CZUA 3WP6A 4HZFA 4BZ4A 2W1SA 1OURA 1OVPA 3DV8A 3FFZA 2EIDA 2AH2A 2DDUA 4HVRA 1CAUA 5EQUA 4HN1A 4QXHA 2DYCA 1SLCA 4XPVA 5KXEA 3ZYIB 2XLFA 3MF9A 1W8OA 4MO3M 3WW3A 1WLCA 2A7AA 1YJLA 1WZXA 4CDXB 1C8M2 5KHKA 5FR3A 3VZLA 4EJRA 4IEYA 3OBRA 4A2UA 1GFF2 2ZOEB 3OPWA 4JGYC 1T6GC 1QJX2 1LOGA 1YI7A 1XYOA 4EZ4A 1H0BA 1D4VB 2A3WA 2VL4A 3ZXEA 4XFIA 2NMNA 1UYXA 1U12A 2MEV3 3CJXA 1DQ6A 3WW1A 5L7OA 2BERA 1LHVA 2YROA 3ZKUA 3ALQA 1C5HA 4FT8A 5IK8A 4WZFA 1S0DA 1QY4A 1OUSA 3J7NA 4FQ4A 3AYCA 2C0ZA 2NN8A 2VQ0A 4S2DA 1AR71 1QOSA 4XF9A 4DO0A 4O65A 1XOYA 2V4VA 1H8TB 1UD1A 4A6SA 5HCAA 4ZXEA 4EV0A 4OZOA 1XNKA 4F8AA 3J7LA 4WM7C 2AGSA 4Z07A 3FN9A 3H3LA 1C4RA 4MZUA 4K8RB 1VRH1 2ZPXA 3PMSA 4H55A 4PI2A 4AFCA 3VUOA 1RJ8A 4NJ4A 4LA2A 5LW9A 5A80A 4FOYA 3TEXA 1RUJ3 4LUMA 4NE9A 4I09A 4QHZA 5K9YA 4P5HA 3MUZ1 3VHPA 3ILFA 5KHHA 3AMPA 3SEEA 2DFCA 4FXGB 3KV4A 1W2AX 4DINB 5KWRA 1K12A 4LLFA 4XUTA 1OFNA 4P9LA 1RUC1 3C8XA 5A32A 5A1AA 2K2SA 1QJEA 5BNPB 3VBHC 4UW6A 4XCBA 4AQSA 3I3QA 5LATA 4XQWA 4PBPA 4D7SA 2JDAA 4HKOA 1GUIA 4BQ1A 2ORXA 4INDA 1KS4A 2F4PA 4Z2AA 5A3PA 5HCHA 3BIWE 4LPLA 3HBKA 4AZZA 2GSYA 2XH6A 2ZGQA 5C8CC 5KC6A 5IK7A 1RMU1 1SHWB 1AL22 3B01A 4XFHA 5KXDA 4CCCA 2JG8C 2BVVA 3T2PA 4UF0B 3WOGA 1S0GA 2D93A 5I93A 4UWDA 1YQ2A 3NKGA 3VBOB 4MGTA 5FYSA 2WZ8A 1BHGA 1W2UA 1WCSA 4Y1VA 2R0HA 1Q8SA 1WD4A 1U5YA 2VNGA 5K0UA 1VMFA 3HMYA 4M4PA 5JVVA 5F32A 5I0UA 2WJSA 5T52A 5J36A 2IXLA 1O91A 3GBFA 2YFZA 1XNTA 5FOBB 2ZGUA 5AFBA 1Z7S1 2JDPA 5I0TA 4R9CA 5FREA 5EHDA 5BNNC 1ND2C 1AJOA 4XF1A 3VBUC 1AR73 3LDBA 5L9VA 3ZN6B 3E1F1 1UCXA 3AM2A 4A7ZA 4ATFA 1D2SA 3WQBA 3LKJA 5EYXA 1OH4A 1TG7A 1VBB2 2D97A 5D2AA 4BLIA 2ARCA 3I2OA 1ZYBA 3RNSA 1VRH3 4RA0A 1RUNA 1OHFA 3O1VA 2VZQA 2EAKA 3H42B 1DHKB 3E5XA 2E9QA 1GNYA 3VBRA 5HCFA 1AJKA 1A34A 3VD3A 1T2XA 3VKOA 5K7PA 4ZU5A 1AR83 1HQWA 4F83A 4DUXA 4W8JA 3H3ZA 3MLLA 1QJU1 5IHRA 1F4AA 3BOPA 1RUC3 2E7TA 4LBQD 4M00A 3BTYA 2X5IC 1L7RA 1VBA1 2Y8KA 3PUSA 3I2HA 3PJYA 5LB6A 1NXD1 4HT1T 1LODA 2RMU2 4MHUA 3DF0A 4PIXA 5FK7A 3ZFEB 1SBFA 5FXZA 3DKQA 2BU9A 1UF2C 4FO9A 1E5HA 4XTMA 4I3PA 3O1MA 1HRV2 1AXZA 2WL1A 1R082 4CU9A 1R1A1 1YEWA 2RHPA 2WIIB 1PO11 3A7QA 4LE4A 1W6MB 4XDPA 2YBKA 3FBMA 1RMU3 3HQUA 3KS7A 3P6BA 4GD4A 3NKTA 4NMIA 4XF4A 1XXNA 5JIUA 2EIGA 4KQ7A 1EV12 2VOXA 4NROA 5IYYA 2IC1A 4IL7A 5FZGA 4YGDA 5FP8A 3LSEA 1TNFA 3N4MA 2ZEZA 2ORZA 3VDBA 5GLZA 2W1WA 1QMJA 1UL9A 4BK4A 3AZVA 5FYCA 2CWSA 3AFGA 2DCZA 2DVFA 3VHOA 3T1MA 4GH4B 1H2KA 4XCAA 4IEVA 4OULA 4LO7A 2OX0A 1UPIA 4ZPIA 5J96B 3G7DA 5D8AC 1OF3A 1RC6A 4XQ4A 1Z7S3 4FFGA 4QX1A 2DUPA 4FPJA 4ATEA 1JYXA 5FO8B 3CEWA 3AXEA 4MGQA 4RS5C 5J98B 3J8F1 1WMXA 1UZZA 2UWCA 5EP9A 3U10A 4GWIA 1J3RA 3OUIA 4X8PA 2DVDA 4OHVA 1UU4A 3K51A 2Q5TA 2J1TA 2OZ6A 2QFEA 3MIFA 3KQRA 3ZFGA 1S0IA 4QPGB 2JKXA 4MGZE 5FUIA 4CCDA 4DB5A 4COUA 2W1QA 4QQPA 2VJXA 5EV7A 3ZXJA 5BUVA 1QNYA 2AEZA 2WN2A 2VULA 4OUEA 2CYFA 5GLVA 4DFSA 1H4GA 1YNAA 3AXDA 3ZR5A 3ZSJA 2QCSB 4ASKA 4NIIA 4D7TA 5CADA 5FDBA 1QJU3 2DU0A 4GKYA 1LAJA 3K4DA 2OUJA 3O5SA 2QVSB 1D0GA 1JOBA 3B5LB 4R9AA 3PLQA 2ARBA 4YG6A 3V56A 4IXLA 1Q8VA 1UPSA 1IPSA 1VBA3 2WABA 1UIKA 3HQRA 4GWMA 4C0BA 1WCKA 5BV6A 2VNOA 2R062 2Y6FA 4GA9A 2RS12 4FVVA 4TLFA 4YLZA 3ZFFB 2LALA 3OY8A 2IXJA 1BBT3 4L9BA 1K3IA 1AXKA 3I2IA 4Q1RA 2UWAA 4LO4B 4ZONA 2VPVA 3NNLA 2CGNA 4LR4A 2XHNA 1CAWA 4AQTA 4UFIA 2YBPA 3TEWA 1ULGA 1R1A3 2VMEA 4YZ5A 4MH0E 4ZU4A 3P5BA 3VZKA 4AEDA 3MHZA 2CGOA 3O1UA 1AX2A 5F5IA 4L2NA 5F3IA 1YJKA 4CDXC 4P02B 5A7WB 2FDJA 1OD3A 3EHKA 1HJGA 1OKOA 3AJZA 4K8FA 3FE5A 4L97A 2PHDA 1V9U3 1G7YA 5L36A 2RS53 3HNMA 1XNDA 1QXPA 2BVBA 3M4FA 4HETA 4DEVA 3N9OA 3CZJA 5DAWA 5I0SA 1BVP1 1TEIA 4JC1A 4Y20B 1IS5A 2GDFA 2A5ZA 4OHZA 3VBFA 3AKTA 1HN0A 4CDWA 2XONA 4CCMA 1OH3A 4LMFA 3ZSEA 1IS4A 3FC0A 1LB2A 2ATFA 1LGCA 3MLKA 2D7FA 2JDUA 1QQP2 2E6VA 1MACA 5JMCA 2YZ4A 1ZBA1 2X8KA 4XURA 4YRDA 2ZJCA 4YG3A 3I49A 1H6YA 2VMDA 3ZN5A 1OVSA 3PMEA 2WT0A 2P1BA 5IVVA 4D6QA 5JOWA 1UN1A 3C7HA 3J8F3 4HN0A 4RQPB 5DN2A 4BM8A 2XOMA 5EFUA 1RUI1 1O3SA 1RTVA 3ZYRA 3MIBA 3SXWA 1DGWA 2R49A 1H8TC 1CIWA 1MS0A 1ZZCA 5EYYA 2DBIA 1H2MA 3T2QA 4XETA 3ZXGA 1ALYA 3VGIA 4BH9A 2ZGLA 1V6MA 4HMZA 3TNPB 1LR5A 2P3YA 4X6QB 3U1XA 3USSA 2V4AA 3SKVA 4AQ2A 3OPTA 4CP9A 2HWE1 1AZDA 4BQ4A 3GJBA 1V6KA 4RQPA 4RL7A 1C5IA 1EPWA 1QJY1 4BLJA 4KH9A 4XAEA 1G9DA 1ZRRA 4CEYA 2HYXA 5C4WA 4LK6A 5FPZA 5ABJB 4FOWA 4Z82A 3THCA 3E6CC 3RZMA 3ZXDA 5A3LA 3KVBA 5BNPC 1N47A 1GANA 1YFUA 4JRAA 1RUF2 4A7YA 4PDWA 3AP9A 5FYZA 1YFWA 4LHKA 1IQAA 4YNIA 3O14A 1NAEA 1I5PA 5BXXA 2OA2A 5E16A 4QD2A 2O1QA 2Y33A 4MSVA 3AL6A 1BZWA 3P1IA 3LA2A 5FYIA 3ZYGA 3T2OA 4LULA 4DY5A 1FI2A 1SQ4A 1UZWA 4YVSA 3B00A 3HEIA 3VBOC 1RITA 1WCDJ 1OA3A 3ZSMA 5T5LA 2XUEA 2E7AA 4R4XA 1OA4A 2RE9A 4SBVA 5KHGA 1RHI1 2DBNA 5C33A 2ZGOA 5FZ7A 3WF1A 3RFRA 4A3XA 4MLOA 2D6MA 2QQWA 4A41A 5CA6A 2NPIA 3UESA 1V0AA 1FPN2 4NHMA 5FXWA 4J1WA 4ZU7A 2GH8A 1Q5OA 3W5MA 1BMV1 4CDUB 3I54A 3VBSB 3I2DA 3I4IA 1FMD1 3UETA 1RVF2 5GM0A 5CU1A 4YFZA 1G9AA 4BCUA 3B7MA 1PVC1 4Q4V1 1WW7A 1O8PA 4IE6A 2C5DA 4CP0A 4Z1VA 3ZIXA 1KRIA 2HEWF 2PLV1 3M3OA 1YIPA 3BGAA 2HYKA 5IFPA 1W6QA 1IPKA 4Y26A 3L2HA 2RS32 1G9BA 1A8MA 3DYPA 1LECA 1W03A 1V6LA 2ZS6B 4CDUA 1BVVA 1MS5A 1H4HA 4N53B 1RUE1 3ZDSA 3GJAA 2HWE3 4TXWA 2J1VA 3S7EA 4EZHA 1C57A 5A3TA 2Q8DA 1NY71 1QJY3 2VCAA 2YU2A 2YB7A 4DIQA 5LEJA 1TVGA 4FP2A 2HWF2 3F2ZA 3JB8A 1OC1A 2MPFA 5FOJB 2XXZA 4W6XA 4OZXA 3KV6A 1RUH2 5CISA 1YI9A 4NRPA 4QDRA 4LNVA 3WF0A 3M7AA 1JXNA 1H9WA 4LLOA 4Y4RA 4C91A 5JXJA 3H8RA 2P2KA 2R30A 4JDOA 2P5BA 1GZWB 2G9GA 5C5UA 1CAXA 3NJXA 4MUVA 5DAQA 1U0AA 2PA7A 4N53A 1WA4A 5JSPA 1NZCA 3ZFEC 1WW6A 5LZ6A 2KM2A 3JD72 4Y33A 3WNPA 2WFF2 3ZOIA 1OT5A 2IXHA 1ULFA 3AK0A 3JZVA 1T6BX 3SC7X 2KR2A 2PHUA 3BCWA 4XUQA 4AGGA 4OQ9A 3KCYA 5A6YA 4NIHA 4XABA 1PGW2 4QKFA 5FMOL 5C3OA 2WNVA 2VVEA 1P8JA 1UZYA 5CEHA 4L11A 2A73B 1F8VA 1AR61 3BB6A 3CQOA 5F2WA 1NQDA 3JUUA 4KMQA 2I74A 2C26A 4IERA 1W6PB 1YQ6A 1XQNA 5JLVA 2GC2A 4HKLA 4HL0A 3TN92 5LRSA 3Q8CA 4PHZA 1AR91 4ISRA 2WZR2 1F2NA 1HB1A 1SLBA 5C9AA 4IGQA 3HPNA 1NA1B 1BJQA 3WNOA 4IESA 4GH4C 2TUNA 5IT6A 1MS4A 5FZHA 1R091 3KVAA 5DDJ3 2E63A 4JTNA 3K2OA 1G9CA 4FPGA 3WLUA 3WUDA 2BGCA 1H2LA 2WWUA 4MHRA 1FMD3 1L3JA 3D4KA 3OEAA 5FZFA 5A7OA 1KFXL 4Q4V3 2E33A 4YM0A 5J37A 2TNFA 5FPXA 2CSGA 2RDQA 4H7MA 4CEWB 4D6SA 5IVJA 2PLV3 1GNHA 1VR3A 1YQ5A 2X53S 4XUNA 5DAVA 1EPZA 4L0PA 4KG8A 1DZRA 1RL3A 4B1LA 2QQJA 3JBG2 4DY3A 1Y7BA 3CMGA 4QPGC 3ETQA 5FYHA 1O5LA 1QJFA 2ZAAA 4Q26A 3T4HB 3T3YA 3WDXA 1J59A 1GYKA 1RUE3 3DYMA 4XF0A 4MYEA 1W9FA 3NJYA 3BVCA 3IDCB 4CDQA 3ME2A 3H1MA 4ASLA 4QGMA 3OYWA 3PUHA 4ORFA 3I3EA 4CUBA 2H0BA 3QLQA 4JX0A 1NUKA 1XSQA 2XQXA 1YO8A 2D6KA 1GZCA 2UU8A 2ZX0A 2JDZA 1OQDA 3CIHA 1RINA 1ODMA 3QH7A 3R4DB 5CKMA 4KWUA 5FP7A 3BIEA 4JGZA 1I5ZA 4NRQA 4AFDA 2R32A 4LBNA 1L7QA 3ZFFC 1STMA 1OOPA 2Y6GA 1COV1 3QCWA 3THPA 5I8TA 2QJVA 5KR7A 3GCWA 2B42B 2YC2A 4QQOA 3LF7A 1D4M2 1G8WA 1DQ2A 2VBBA 3BTZA 2ZZJA 1WD3A 3MLJA 4UFMA 5I8SA 2ZHMA 2CV6A 1I6XA 4LOTA 2XBO3 4L8QA 2P37A 4CXXA 3F95A 2JWPA 5DABA 4GWJA 1AR63 4DXTA 5HXMA 4B4RA 4P9JA 1UMZA 2PAKA 4XFFA 1DGLA 1O4ZA 4BB3A 5AC92 1ZRIA 4HSJA 3WNKA 4FPFA 4WM8B 1AR93 3PDQA 1SPPB 1PX3A 4Q0SA 3ZIWA 5JOZA 3LIGA 2E32A 2WT2A 5CG8A 2WKKA 3GDBA 1ZBE2 2ENRA 3OBTA 3VL8A 3O0VA 4FSJA 4UBGA 2DWRA 2GC1A 4D8MA 1R093 3T0DA 2OPWA 1RUOA 1POQA 1UY1A 2ETEA 1OI6A 3JXSA 5C3RA 1N3QA 3PUAA 4K40A 5DPNA 2BZDA 1UX7A 3PVNA 2LROA 1H8VA 3AKRA 1QXJA 4JAAA 3UYJA 1W39A 1WBFA 1GWLA 1RUG2 1US2A 3DXTA 3DXUA 1NXMA 3K48A 4QPIA 1UXZA 4RGGA 3M3CA 3ES1A 2P6CA 4NWVA 1Q3EA 4HVOA 2HWC1 5JZGB 1IOAA 4ITCA 3NV2A 5DZEA 1A8DA 3AZZA 5FY8A 1X50A 1GOHA 3EO6A 4KWJA 2HEYF 3ES4A 1UY0A 2OXBA 4FBFA 2IFWA 3SHRA 3WNNA 3NMBA 1UKGA 4ASMB 5B4NA 5IVBA 3H7JA 4B3NA 3FJSA 3FHIB 4CU8A 3N3HA 1HIXA 1LEMA 2WNUA 5BNQA 1NE6A 3HOBA 1EUTA 4XMIA 1NOVA 1S0CA 4K6BA 5ABJC 4UW5A 3SEPA 3ZR6A 5G05L 3KV9A 3MIDA 4LKDA 1HB2A 1PZ7A 1RUJ1 3POBA 3UKTA 3RDIA 4H14A 1PK6C 4OYUA 4Q0QA 3BUCA 1CAUB 1COV3 3FUOA 2WO1A 2P34A 1KJRA 1PMJX 4CCJA 4Q27A 1RYYA 1NCRA 3ZYHA 4EWDA 2YBSA 1HLCA 3D0JA 3ACHA 4KG0A 4JZRA 4L92A 5H9QA 1ULCA 2YDEA 3VZOA 1YQ8A 3RZLA 2CAVA 5LK5A 3MW3A 2Q0AA 4DUVA 1LNSA 1MPXA 1MS9A 2JKBA 2X09A 3Q8EA 5FXVA 1NYWA 1W0NA 4AG4A 1VAKA 1PGL1 5A3MA 4QX7A 1MEC1 4Z2WA 4EN9B 3BPSA 3WF4A 4FOVA 5FYYA 3NW4A 5HPOA 3AJYA 2XUMA 5J1XA 2O8OA 4QT6A 3V0AA 1DQ5A 1X8EA 2W95A 5L9BA 3M1HA 1XE8A 5BNOA 5HCBA 3QACA 1NCQA 4JRLA 4XJUA 5L7OB 2AZ5A 2BFUL 2VOWA 3Q8FA 2HWB2 2YPJA 4BDVB 3PUIA 3QD6A 2RMU1 2C4XA 3AMQA 3VDCA 3FMGA 2QQUA 1DQ0A 3ETPA 3HNYM 3VBSC 4S2FA 5DZFA 1W8ZA 2B46X 2B4KA 2B9UA 1W9TA 2R041 3KGZA 3M3EA 2PYTA 4I02A 4CU7A 1UAIA 4RHV2 3OGVA 3WG4A 1R081 4O7XA 1MR5A 4Q0VA 5FY1A 4H2AA 2R16A 1EP0A 1JODA 1IHMA 3LCPA 4AXOA 2FDGA 3ZMOA 4E8DA 3U14A 4COVA 1CQ9A 3T4VA 4E4ZA 3ZYJB 1RB8G 2HWC3 3MYXA 1VPHA 3W59A 2DUOA 4LO8A 4OI2A 4KBBA 2ZGMA 5FZLA 2HH9A 2WZEA 3LWCA 5CFCA 2WO2A 5E88A 1GP4A 5FUNA 5FZ9A 2H6CA 3ACLA 4AQ6A 1RXFA 4N43A 5FP9A 1N1TA 3CU7A 2JDKA 4N7UA 3EBRA 3HQXA 2OPKA 3RZZA 4IEPA 3BYWA 1S55A 4LKFA 5A32B 2JICA 1Z78A 1UOJA 3GGLA 4IV3A 4XJ8A 2PFWA 1GP6A 3WHTA 4AVVA 5B2GB 1DLLA 1JYNA 4AL9A 1W8HA 1V6IA 1VJ2A 4YFWA 2RJ2A 2XQRA 4M01A 3AVRA 2R071 5T5PA 4IEOA 3S5QA 1LEDA 2TEPA 1AR81 4FP3A 4XE9A 2GN3A 3LA7A 4MOAA 2Y38A 2ZEYA 4CCEA 1X36A 3HD8B 1UZ0A 4CPBD 3WX5A 2CY6A 2OVUA 2VOTA 3PURA 1GWMA 2GP3A 4FOQA 3WG1A 5C3QA 3CDZB 3O0WA 1AF9A 4Y1UA 2GC3A 4OMCA 2QDNA 4NPMA 4J1XA 4Q4W1 3MBWA 4XAAA 4EYUA 2Y0IA 3MW2A 3W9AA 2RV9A 1SCSA 2P3JA 1MEC3 3KHBA 3L2YA 5JOXA 5K0UB 2OUHA 3IMNA 3WY6A 2CL2A 5FZEA 4BQ5A 1REFA 1C1LA 4YM1A 4OQ8A 1HDKA 1QDCA 1ND3A 3B3QE 3MDPA 3A23A 4C0HA 3O1TA 3I2GA 1JHJA 1O4YA 1PHMA 3I59B 3IAPA 3WCRA 4BIFA 1NA1C 4GQ7A 1WMFA 4XBLA 4FPOB 3TBDA 1SFNA 1SDDB 3LZZA 1ZRFA 3POYA 3NV4A 4DMIA 1JZ7A 2WAAA 5FXXA 2PELA 2QQLA 2RMU3 1KS5A 5FLJA 4KU7A 4IDZA 4I0BA 4EN7B 2VW0A 3MUY1 3WP3A 2VOKA 4RFT0 2O14A 2R043 2YY1A 4FAGA 3I2FA 3NWKA 3E6DA 4QKBA 1DLCA 1CONA 1ST8A 4A4AA 1CAVA 1QH7A 3ABZA 1R083 4CEWC 2JG9C 2W92A 1Q8OA 2WN3A 3I59A 4Q4Y2 5T54A 4A3ZA 1OQEA 1LTEA 3AKQA 1K42A 2MEV2 3AYEA 1VBD1 4MX3A 3ROUA 1YLLA 1SLLA 2ZX1A 3JQWA 1XE7A 5ANNA 4XIOA 1EV13 4HKWA 3VBRB 1UWWA 2ZACA 1Y3TA 2AC1A 1XNCA 3ZDVA 5IVCA 1S4CA 1XRUA 2VBPA 1DF0A 3I8TA 4A7KA 5GZGA 1WMEA 1PIV1 1ODNA 5LBBA 1GQHA 1JYIA 2C24A 5KHIA 1Q8PA 1F4HA 5LK7B 3DECA 4R8HA 4EE2A 2K46A 4HVQA 5F6LB 1V6OA 1W90A 3ZM8A 4E8CA 4CXYA 4YSFA 4ZS3A 2R073 2L9LA 2VMFA 3H7YA 4GXLA 5GKAC 3INAA 3KCXA 3JCIA 4LBQA 4AFBA 1CJPA 2A75A 4NHXA 2JDYA 3MO4A 2ZGNA 3J9SA 3B9IA 3T30A 1DIWA 5DG1A 5IATA 4FI9A 2WO7A 4QXCA 4QQHA 5IFTA 1B35A 3ZSLA 2I45A 5FYMA 4NUBA 2ZHLA 4N7IA 5FJHA 4Y1XA 2VM9A 3N9LA 1JU4A 2WWJA 2DCKA 3TOJA 3ZVXA 4EROA 3DUIA 4IV1A 5JAXA 3I3DA 1W28A 3U37A 4Q4W3 2G4IA 3CJIA 1BBT1 3OCPA 3KGLA 4G9SB 3U4XA 2GAUA 2XMLA 4JQRA 3MI8A 1VALA 2QQMA 1MVQA 1MZEA 1S2EA 4WM8C 4GJYA 5CYYA 3A0NA 1UIJA 1UMIA 2ZEXA 5D21A 3MZHA 4W65A 4RR3A 3ZYBA 1S0JA 4AI2A 5FZ6A 4J25A 1ULPA 1YFYA 1GOFA 3NJZA 5H9RA 2ET1A 4AF9A 3RYRA 4M0NA 1MS8A 4LA3A 3AMNA 3THDA 4HFSA 1V9U1 3RZJA 2RS51 5FZDA 3HT2A 2VVDA 5A33A 4OI0A 1R1ZA 2R0FA 4AHXA 5JSOA 4AI8A 2IUWA 2WYSA 1AYM1 2K9ZA 3ACGA 5A7QA 2A3YA 3AMMA 2XJRA 4CTEA 2FCVA 1HRI2 2IFRA 2D3RA 3TNQA 1SEFA 2XR4A 3I3MA 3WEZA 3K4AA 3ZFGB 1VB4A 4LHNA 1VBD3 1WMDA 3J26N 2HWD1 5E89A 5T5JA 4AW7A 5F7UA 2H6BA 3PVOA 2XVLA 5F5AA 5F39A 1ZM1A 4MXWA 4Q0PA 5JZGC 1IPJA 3JU9A 2ARXA 3LQCA 2WZPP 4CA9A 3VLBB 2W08A 5LA0A 4JCKA 3M70A 3DCQA 4G3YC 2GNDA 4XUOA 2XVGA 1AUYA 5EZWA 2KD7A 1LOFA 3JQXA 4OMDA 1PIV3 5EWSA 2YGLA 3KCCA 4OUSA 4YM3A 3WINE 1VRH2 2FCTA 4EN8B 4R4ZA 2LS6A 1CPMA 1LKNA 1XBFA 3OY8B 1QEXA 2ILMA 3N7LA 2C9KA 2WA3A 4DXRA 4LHSA 2P6HA 1N3OA 3CF6E 4O9GA 3CLPA 3MGUA 3WDVA 2B9VA 1CAWB 4FFHA 4UAPA 3URFA 5AVAA 3O1OA 2R7EB 1J3PA 1RUC2 2RG4A 5FO7B 5L73A 3WNMA 1AX0A 4AEDB 5A3WA 3OGJA 4N9HA 1NE4A 1KXGA 3S57A 4MADA 2VMHA 3IZOA 5F3EA 2VBDA 3BKZA 5FY0A 2D6LX 5A1LA 4XACA 2V73A 1OA2A 3V0BA 1W8UA 4IETA 4E2QA 1WLWA 2CWMA 2PXJA 3CNAA 5E6HA 5C6CA 3J4UH 5J7MA 3VBFB 3HVDA 1GV9A 1MQTA 4YVWA 4CDWB 4OHYA 1JHNA 1RGSA 1QXRA 1CD3G 4AGRA 4IEZA 3GZTB 5LEKA 1K5MA 1RUH1 2EXHA 1JZ8A 4ZHNA 1YC61 2FDKA 3SH5A 1OBNA 1TMF1 5L7OC 2ZMLA 4TSVA 2F17A 5F3GA 2J22A 5FMCA 1CESA 3U07A 5I0DA 3ZMNA 1N1SA 3RMXA 2YC4A 3O1SA 1J3QA 1AYM3 1FOD1 2D44A 2JDNA 1HXS1 2XJVA 3JD71 3PVBB 4BHPA 4PQQA 3ZXLA 3UGHA 1LJ7A 2QZ3A 2TBVA 1F35A 2WWSA 1EAH1 1GSLA 1W9YA 4AI1A 3UNPA 2XVKA 3LFIA 1Z7S2 1VBC1 2HWD3 2W0XA 5CNAA 4QX3A 4CP9B 4CE8A 2XHKA 4EN0A 2ZAHA 1LENA 4Q8LA 2SBAA 4CRQA 4Y24A 5FMOS 4NR1A 1UXXX 3TN91 5IVFA 3KD4A 4ET7A 4KL1A 3WZ1A 4BQWA 5DZGA 2OIIA 3OOXA 4KGQA 3VZMA 4CEYB 5C4WB 3RZKA 1SG3A 4COWA 3J7HA 2VCMA 4XIKA 4YWAA 5LY2A 1YHFA 3T2TA 1QHDA 3B69A 3MIEA 1ZA4A 2ZABA 3BI3A 1BEV2 5JI9A 1A3KA 2X05A 1BLZA 1X33A 4DZGA 3H8OA 4KWLA 5CFDA 4PDWB 3QBQA 2J1RA 1G9FA 3RSJA 4RN5A 4GMP1 5JXHA 2XJUA 2BWAA 4GMP0 4A6OA 1QJU2 5FZ0A 2ZX2A 3HT1A 3DPRA 5DUUA 3IAQA 5DQ0A 4QX5A 3VDDA 3VB9A 1J84A 2VZOA 5HBAA 3HBZA 5JI7A 1G6NA 2LRPA 2F4LA 4FTBA 4FAHA 1PMHX 2Y6LA 3MFCA 4B8EA 2C6SA 2K0GA 3IMMA 3IWZA 5CVRA 4YVSB 1CVNA 1VLNA 3JBG1 2Z5WA 1H9PA 2MNGA 2ZHNA 3C7OA 3LDRA 3AZXA 1ZZ9A 2D43A 4ES9A 3WSOA 1FXZA 2WS92 3MFAA 4DPNA 4YW2A 5T5OA 1NZIA 2RR11 1OFSA 4URAA 2NLRA 2DVBA 1WKYA 4OI4A 5K0UC 1CGPA 1R1A2 1N3PA 2HWF3 3H1YA 1PO12 4P14A 1JYCA 2ZTNA 1TE1B 1NQJA 2D98A 1RUH3 5EPAA 1TNRA 4Q4X2 3I2JA 3OGRA 1TMF3 2VR4A 2ZKNA 3FLPA 2WLQA 1W06A 3NL1A 3IT8A 2A6YA 5EJ1B 5FY4A 4A45A 1GQGA 2Y60A 3MPPG 3D8CA 2ZMKA 1N1YA 2CGPA 1S2KA 3GHMA 1S2BA 1XNBA 3NAPA 4JTOA 5F2SA 3GZAA 4YW5A 3MIHA 1FOD3 2WYFA 3JD73 3A22A 1HXS3 4XFCA 1GMMA 1AXYA 3UKVA 2Q1ZB 5F8PA 2GN7A 4PIYA 2QKDA 4QM9A 1HB3A 1W6QB 2ZX3A 4LO6B 3PVEA 1Q56A 3CO2A 1EAH3 3R4UA 3K3OA 1E5IA 4IE5A 5DDJ1 4DOUA 4I0WB 1YQCA 1VBC3 2JECA 4I0AA 4NHKA 5FY7A 2WA4A 2E51A 2VZ3A 3WG2A 4BMBA 1H30A 2XB6C 1KJLA 1RUD1 3J8F2 3VBRC 1KDMA 2OW4A 4EWAA 3AKSA 1MZ6A 5L19A 3TN93 3ACIA 1DU3D 2YXSA 4ARXA 3WW4A 5FIXA 4BXSV 4MGIE 4V1PA 5FYUA 3PU8A 1UY4A 5SV5A 4L99A 2GMMA 2ZGSA 4QQLA 2J1SA 2WBKA 1LGNA 3T08A 4AHYA 4QX8A 4X6RB 5I91A 4BE3A 1CAXB 2Z79A 1SFPA 4CCOA 1VRBA 1DYKA 4XJZA 4JHTA 3WR0A 2PHXA 2DFBA 1CN1A 1URXA 2FMYA 4GMP3 4PF1A 2PAEA 2Z4FA 3RWNA 4AI0A 1OPOA 2JB8A 1LHWA 1AYN1 3KT1A 4OHXA 2CAUA 3USUA 2WNVB 3EXUA 1VIWB 3W21A 2QQOA 3H1WA 3WQ7A 5IAXA 2VC9A 2ZCWA 5B4XA 3DYOA 3GBWA 4LEJA 3N9MA 3KF5A 3O0XA 3IN9A 5IVEA 1CZTA 1DQ4A 3JBG3 2BRTA 1YUDA 4KWKA 4TN7A 2W91A 4META 4FPCA 1D7PM 1HB4A 4QB1A 4JGYA 3VZNA 3CKHA 4FQZA 1UMHA 1LRHA 4K1YA 1O3QA 2Q4SA 2RR13 3RVHA 3H9AA 2ZEWA 3OF1A 2JXAA 4LBLA 5FLHA 5LBCA 5C9AB 1QOTA 4PQ9A 1VBE1 3AL5A 1O7FA 1TME1 1W9WA 3D82A 1ZREA 2XBO1 3MIGA 4DEQA 1UY3A 3WF3A 5C8CA 3LPFA 5JPNB 3T1LA 1W99A 3E5UA 5FWEA 2BEOA 4XJWA 3IKWA 5FFOC 4ZY9A 3UL2A 3LEMA 5A6QA 1PO21 4LTAA 3LD8A 5A6ZA 3OJBA 2D3SA 2DUQA 2VQUA 5FZCA 2BJSA 5GJ6A 4KNCA 2AEYA 2WLPA 5FZMA 3VV1A 4AHZA 4GB31 1QF3A 5FZIA 1GWKA 1U5IA 3P3PA 3W58A 3TEYA 4XEZA 1MVEA 3FL7A 1SACA 4Q0UA 1FX5A 2UWBA 3LA3A 4DS0A 4WM7A 4ZXKA 2V72A 5CKQA 2RM22 1O8SA 1O3TA 1MZ5A 1GP5A 2QQKA 4Y22A 4IGOA 3ZFGC 1ZBA2 2VNRA 1WLTA 1UY2A 3IPVB 3LOIA 1XSRA 4NAMA 3WF2A 1W9SA 4PI0A 1RUD3 3HNBM 3GF6A 4JQTA 3RJRA 1RUI2 4O9EA 4CDQB 1S1AA 4PCRA 4PLNA 2BWCA 3HJRA 3OYWB 1ULOA 3POEA 1XYNA 5FY9A 5A3UA 3RI8A 3GZEA 3VBHA 2FCUA 2WRAA 4DUWA 2BP6A 1C8M1 4JGZB 4IUGA 1MZFA 1VMJA 2Y6JA 1O4TA 3IPVA 3IM0A 4CUAA 4E27A 3PL0A 3UJOA 3LDKA 1OOPB 2WQ4A 2XL7A 1S0FA 2FZ1A 4FPKA 2XJPA 4XXAA 5JWPA 1QJY2 2EALA 1ENXA 3WDYA 3RZHA 1QJX1 3I3BA 5TSWA 4C8DA 2P17A 1SLIA 1FNYA 4QPYA 2Z42A 4QPWA 2G19A 2BFUS 1WW5A 3JB4C 3LPGA 2YGMA 3UGGA 1AYN3 3E5QA 3OB8A 4RHV1 2D3PA 1REDA 4E9KA 5JCTA 2JG8A 1RUG3 3A0KA 3IB3A 4AEDC 2VO5A 4AHWA 2GALA 3OPZA 1O5UA 2OKXA 5FYVA 4A42A 1BCXA 3KSCA 1UNBA 2N7GA 3NSTA 1LU2A 4UFKA 2PMWB 1H1IA 5FRAA 2J42A 1Y4WA 2O8QA 1FV2A 4B4PA 5BYNA 4QMAA 3CBNA 4JVAA 2W1UA 3VBFC 2BUKA 1E5SA 3ZYFA 1VBE3 2O0OA 5A7PA 1TME3 4AVTA 4CDWC 1Q8QA 1ZRCA 4RYDA 3TYJA 4PF5A 1G86A 2VZPA 3LB9A 3NNJA 4LQRA 4PIZA 2W87A 3U78A 3UT0A 1GLHA 4AFAA 1PO23 5BNNA 2DV9A 3H0OA 3U75A 1GICA 3ZLIA 1ND2A 1PMIA 5FQ0A 1OLQA 1DYOA 2BTVC 3S5AA 2VW2A 4HOOA 2YV8A 5A6XA 4FPEA 3VBUA 4GB33 5F5CA 3IBMA 3OBAA 2GC0A 3N7MA 1LULA 1UYYA 3MEPA 1RHI2 1W3XA 4XZUG 3NNFA 5KXCA 3ZX7A 4I2OA 3WDWA 1W2OA 4AVAA 3HN1A 1WBLA 4QPIB 3BU7A 3E6BA 4AWDA 4BQ3A 4LITA 4WV8A 1OLRA 1BMV2 1ENQA 1JH5A 1Y9MA 3KF3A 4NIGA 4JV4A 1FMD2 1R64A 1OD5A 3W20A 4RQPC 1PVC2 2BPA2 3NV3A 4BOWA 2QUOA 3LEIA 5FMDA 3WQ0A 1KGYA 1IKPA 2PLV2 1J58A 2WDBA 4UW3A 4YW7A 4NIAA 4AI9A 2WR9A 2NZ9A 2NMOA 1WCUA 2WNUB 3MV11 2Z69A 4CEYC 1AL21 2A6XA 2HBUA 2X5IA 5C4WC 1XNAA 3OTFA 4JKLA 4Z92B 5AVPA 1C3HA 1C8M3 2J7MA 2VNVA 3GALA 1X8MA 2VTFA 2UYAA 5IAVA 5CBLA 1OF4A 3OUJA 4Z8BA 4K7JA 4WVVA 4A44A 2EICA 4YW6A 1RIRA 1A78A 3Q9OA 4LBMA 4PDWC 2DU1A 4RSUA 2QDRA 3PUQA 2NP0A 1QJX3 4P5YA 2QTWB 1WLDA 4K3UA 1NCRB 5T3NA 2VUJA 2FMDA 5JDBA 5JXGA 3H3UA 2FHRA 3NQHA 4RHV3 5BPXA 1FATA 1ONAA 3AP7A 2VZVA 3ORJA 4Q4Y1 3I2KA 1AX1A 2EF6A 2HKXA 4WVMA 4FTEA 1WUVA 2X10A 4YVSC 2P4EA 1UOGA 2BYVE 3VL9A 1V00A 4LOSA 3AMHA 4HBNA 3PU3A 1J1LA 1ZNPA 2EIEA 4QU2A 4XJAA 1CJDA 2XWBB 4MXVA 2OYZA 3V0AB 2VVFA 4FPYA 3TAYA 1JUHA 5A1FA 2G1MA 3O7OA 3UKNA 4J6GA 5BNOB 3AKPA 1VBB1 4Y5Z0 1NCQB 2VZ1A 4M3CE 5ACA2 3K4ZA 3LEKA 5D8AA 3KMHA 3SCGA 3RJ2X 2UY8A 5JXIA 3RMYA 2D5HA 4RS5A 1IKQA 1WGPA 2IXCA 4H3WA 4HPKA 5FK8A 3SQOA 4BWOA 2JE7A 5CG9A 5F9TA 5ERLA 1AR92 1I9RA 3VZJA 4CCNA 1PNFA 4KGGA 5CB7A 1TQ5A 4UOJA 5FBJA 4FCAA 3X29B 4C90A 5EJ3A 4YZ2A 1WWYA 1PZ8A 3D3AA 5GZEA 4AAXA 1KD7A 3LOBA 3S30A 4NO4A 4XW3A 2Y64A 3R0RA 4NOTA 4AI3A 4YYOA 1UU5A 4RGKA 5C70A 3LEGA 1N1VA 4XQDA 1LGBA 4K1ZA 5LRRA 1OSGA 3IIAA 1R092 4UFHA 3WCSA 4ZZ8A 5J48A 4PLOA 2GNTA 4K21A 5CFCB 1JI6A 1FT9A 2D40A 2EIBA 3M3IA 4CDUC 3I97A 4CUGA 3GXUA 2GNMA 2NYYA 4N43B 3R6SA 1FNZA 3GM8A 4NWWA 1HRV1 4WBBA 1KEXA 1V6NA 1B09A 4DXSA 3MV01 4IV3B 1W6NB 1AL23 1Y9QA 4SLIA 4TZDA 5DAPA 3NV1A 5LBFA 4LORA 4IE4A 4HXCA 1HW5A 3ST7A 1EV11 4CP2A 1Q43A 2D6PA 3M2MA 4IEQA 5FCCA 3VKMA 1LESA 1UX6A 2E7QA 4TWTA 4DXZA 4CVUA 4N53C 4P9WA 5JUVA 3AZYA 4GAZA 1IGOA 4B29A 2C1FA 1GZTA 3DGTA 4QGNA 1PM7A 1HQLA 2XJSA 4TLGA 3OGGA 1HRI1 1DGWX 1GBGA 2VE1A 1S0EA 2D6NA 1W6NA 2LM3A 2WNVC 3A21A 2ZGPA 3DEMA 3ILRA 3ON7A 4Q4Y3 3PJQA 5C3SA 5M0TA 2FQPA 4CDXA 5HV4A 2DCJA 3K77A 2Y0OA 2Z2SB 3NNGA 2WQZC 3OSDA 4CPBA 1ASJ2 2FD8A 2GP5A 1YIFA 4FFFA 3PHMA 2VU9A 4GIQA 4BMEA 1COV2 4HANA 4E2GA 2VUDA 1OXCA 5IVYA 2QQNA 2YHJA 4YPJA 4AOCA 1ND3B 3GBGA 3KB5A 3N7KA 3VHNA 2VG9A 4P9IA 1W8WA 5C9AC 2IVJA 2VAUA 3O12A 3POJA 2WQ8A 1VBB3 3FUQA 4GZ9A 4LKSA 2PHFA 3T0AA 2YMZA 2XPJA 4NHLA 4QB6A 3C2UA 2ERFA 2DTYA 2IZWA 4ZS2A 3SLIA 2ET7A 5FPAA 4F3JA 5FPLA 3HR9A 4LBJA 4CSWA 3NJVA 2QBXA 4B1MA 2WSUA 2GZWA 4WVWA 1D0HA 2VMIA 3KT4A 1CAVB 4ZKTB 1DGRN 2DTWA 2V5DA 1BK1A 1H8TA 3B93A 3C7EA 1UOBA 1CX1A 3ZXAC 3TEZA 1CR7A 5LA9A 3VD7A 4PJYA 1BXHA 5JR7B 2SLIA 3S7IA 1QWRA 3O1RA 2JENA 1H6XA 4TTGA 3ACFA 2R061 1V70A 4WVZA 5FZBA 2RS11 4COYA 2DCTA 2R6QA 4AVBA 5FMBA 5H9PA 3BU0A 1JMUB 2IWGB 3TWIA 4B4QA 1A6CA 2W3JA 3UV9A 5CIRA 4ISQA 1YCIA 2ZHKA 1GR3A 1SBEA 1HRV3 3VD5A 3WVJA 4BPZA 2ZKLA 2J1AA 4NPRA 1W2TA 4W50A 4CDQC 5JR2A 1CZVA 1QGLA 1HV0A 4S2GA 4NPLA 5DXDA 2W47A 1LHUA 1S0BA 5LA2A 5BNPA 4LT5A 2HWC2 2VECA 1J1TA 3GNEA 2VMGA 1IG3A 1IG0A 1NLSA 1QOOA 2ZZQA 4JGZC 3ZN4A 4LIUA 4MGKE 3ZXKA 5EJZB 4LBQB 2ZGTA 5GZDA 4GKXA 1OOPC 1UYPA 2W39A 4PT6A 3Q8AA 4QXBA 1X7NA 1ZZ8A 1JTZX 1I1EA 2A70A 2AACA 2RVAA 1B35B 1OPMA 2D5FA 3C7GA 2DVAA 4P9YA 5E1RA 5EXOA 4LIVA 4AEJA 1HRI3 2W9XA 3KV5A 1YWKA 5FP3A 2WNEA 1LU1A 1YYNA 1UKRA 2W5FA 5FZ3A 2A71A 2XDVA 4UF0A 1QQP1 4IV1B 4D3WA 4XHXA 1NKGA 2ZXQA 3CJIB 3VBOA 1BKZA 5A7NA 1RUJ2 1YRZA 4MGYE 2P3KA 3UGFA 2BQPA 3J7MA 3APBA 1X82A 4E4HA 1W04A 3BTAA 3ITQA 1I3HA 1W6OB 3EMRA 1ZZ6A 1DZQA 1V6JA 4RR3B 4JKMA 1LOEA 1VMHA 2BGPA 2Q8EA 3LFMA 2ARAA 3U11A 1US3A 1DCSA 1CPNA 4FPHA 5K8SA 4YGCA 1VAMA 3GYDA 2XJQA 1L7LA 1LCLA 3LGRA 4YZ4A 1C1FA 1BEV1 1EYBA 5A33B 4IEWA 2Y6KA 1EUUA 1NX9A 1PGL2 1MEC2 4V2WA 1F15A 4I30A 4XDOA 2WT1A 3PIJA 4MG2A 2VUAA 4Y1YA 2E53A 4Q29A 1IS3A 1W6OA 3MICA 3ZN6A 3N7JA 4TYSA 4AE2A 1FAYA 5IUQA 3ATGA 3N9NA 1SBDA 2RJLA 2BNOA 4QPIC 1IS6A 1ZZ7A 4GALA 3WP4A 4BK5A 5AFEA 2IVIB 3OEBA 1BK0A 1K45A 2R063 1QU0A 3HAGA 4MXWB 2VZUA 1FV3A 2RS13 4AAPA 1RUF1 3CL1A 4EN6B 1PNGA 1SLAA 5FZ4A 4AEMA 3TRSB 2R042 2ZMNA 2LUWA 3U0ZA 2WS91 3PNAA 1W3VA 1SMVA 1UW8A 3LSDA 1WW4A 3KHCA 2D6OX 3H50A 4O61A 1KFUL 2WNUC 3SNMA 2J1UA 3RI9A 3POGA 5F37A 3V64A 5CZKA 1JZ2A 3SCHA 2LTNA 1SFYA 4Q4X1 2XL9A 5JMOA 5JOYA 2XWJB 4BJ0A 5GALA 2E31A 4RD7A 1TZOA 3WDTA 3ZFEA 3PTYA 4MV2A 4E4DX 1M06G 1AR72 2ZX4A 3FLRA 4LUKA 1LOAA 2BV4A 2JD9A 3UJQA 2EAAA 3R05A 5FBZA 4IW3A 3AFKA 4NAOA 4XJ9A 1NCRC 2BOIA 1O6UA 1ULDA 2VXJA 4OVEA 1O59A 1W6MA 4K9SA 4WZCA 1H1AA 3OGSA 2JD4A 4AR2A 1LOCA 4IE0A 4NIDA 1FPN1 1QQP3 1UU6A 2FBEA 2QZ2A 5LBEA 4D94A 4HLTA 5FUPA 2R072 4EQVA 3V0BB 1LHNA 4AGVA 2HJIA 1AVBA 4YGBA 2AUYA 1AR82 4R52A 1H1MA 1RVF1 3VKFC 2QQPA 4YVWB 1MQTB 4NVPA 4FTSA 2JB4A 2DVGA
chains in the Genus database with same CATH topology
4XBNA 4DQAA 4AEKA 4D7YA 3D5OA 1K5MB 2PHLA 4GH4A 2RS31 3N35A 5BNOC 4BIOA 1NCQC 1H2NA 3MW4A 4Q4W2 4JDNA 1BEV3 1ENSA 3WUCA 4QGLA 1OMIA 5DUWA 3SISA 3RRDA 1MS1A 2VQAA 4UBHA 1OKQA 2WC2A 1BQPA 2HWF1 4MVTA 4C1XA 1RMU2 3ZYPA 3SITA 1APNA 1CX4A 1W0OA 5GLUA 4QPGA 4XDQA 4BYYA 3SH4A 4HK8A 1YFXA 1ENRA 2Q30A 4AVCA 1RUF3 5BY5A 5CFCC 1XYPA 4G4FA 1JOJA 2WS93 4N43C 2WFF1 3ENRA 1M4WA 5IK5A 2VW1A 3ASIA 2DCYA 1PO13 3B02A 3D6EA 1PGW1 4IV3C 2R1DA 4XFBA 2XKOA 1VBD2 3RYKA 4OFGA 4Q4X3 3BOWA 2ZGKA 2WFPA 3BPZA 4B7KA 1GZ9A 5CFDB 2PAMA 3ZFFA 1HKDA 2VOVA 5JSRA 4M0HA 4S2HA 3RYPA 3SMHA 1PIV2 2WZR1 3DPRB 4P9GA 3IDBB 3VDDB 4URTA 3C3VA 2RM21 1U5XA 2ZGRA 3ECQA 3DL3A 1FPN3 5J3UA 4FPLA 3VN4A 4IQPA 4R9BA 1FYUA 3NVCA 1RVF3 2CTVA 3KM5A 4Y20A 3FX3A 1DFQA 1Z0HA 1XU1A 1GNZA 5KHJA 1DGRA 1SLTA 1ND3C 2ZA9A 4LHLA 2CNAA 5GZFA 4BA6A 1VB2A 1LOBA 1VBA2 2PHWA 2RS33 1ZVFA 2XJTA 2PQQA 5F6KA 2B8MA 1BBT2 3EJKA 4YARA 3MPBA 1DZTA 3POSA 4COZA 3NAPB 3B94A 4IEXA 3BODA 3H8UA 4UXAA 1POV1 2Q8OA 1POV0 2I07B 4AK3A 4XXPA 2YC0A 5IK4A 2PHTA 1C8NA 3ZPYA 1DDLA 1YXWA 1JBCA 1V9U2 2RS52 2V09A 4Q2FA 1PK6B 1Y43B 3OD4A 3S6PA 4PLMA 3G6JB 3GZUC 1AYM2 2WFF3 1D4M1 2IXIA 3AP4A 2A6ZA 4CP1A 2UYBA 3LAGA 3B9CA 1PVXA 2IXKA 5ABJA 3ZSKA 2HWD2 2NM1A 3WXPA 2VGDA 2EA7A 1QNWA 1PK6A 1ULEA 5AC91 5FO9B 3FZ3A 1LHOA 2WZR3 3WT3A 2X29A 3USUB 2AENA 4GWNA 4I3GA 4ES8A 2RJKA 1B35C 2BBVA 4OLLA 1ZBE1 4EWEA 4XFAA 2RM23 1O3RA 4X8NA 3A4UA 3M8LA 3WHUA 1ZBA3 2GU9A 4IV1C 3OD0A 1IZ3A 2BNMA 4ONUA 3CJIC 4JGYB 4YZ1A 3KLSA 1JN2P 1NLRA 2AREA 1MS3A 1RUI3 2HEVF 4XILA 4QHBA 1W0PA 4RR3C 1RJ7A 1RUG1 2AR6A 3QOPA 4W6YA 3TB0A 4U2AA 2W52A 4M3CB 2EXKA 2QNKA 3N36A 3VKLA 3AB0A 3KZ4C 3FLTA 3VBSA 1JUIA 1AL0G 4CYDA 5T55A 2A3XA 4E2SA 1POV3 4WM7B 2PHRA 4D69A 3M3QA 5KBFA 5CAZA 3QH6A 3SCFA 4Y22B 2YYOA 4W6WA 1TMF2 4HK9A 3RPQA 1BYHA 2C9AA 3HIFA 4M3CA 4XF3A 4B7EA 2WINB 2XG3A 5I8YA 3WDUA 3WG3A 2DF7A 2XGXA 3SH3A 3I7DA 3AX4A 4XZPA 1FOD2 3RG0A 2KA3A 2VY0A 1HXS2 3ELNA 4QXKA 1D4M3 4XFGA 1LOFC 5J09A 2PTMA 3AYDA 1EAH2 5FLIA 1QDOA 3VBHB 3WD5A 3FWEA 3AP5A 1PGSA 2V5YA 5GLTA 5ACA1 2G9FA 4YGEA 1VBC2 1F31A 4P9XA 1GZWA 3FBYA 5GZCA 5KXBA 4IEUA 4KU8A 2VH9A 5AC93 1F5JA 2NQYA 2KXLA 3RS6A 4C1WA 3S0MA 5C8CB 4YG0A 5F1RA 2JJ6A 3ZXFA 1RHI3 5I0RA 2JG8B 3WQ1A 1ZBE3 3V65A 4LBKA 4E4SA 5SV8A 4YW1A 3NO8A 4AFMA 2HWB1 1DQ1A 2HWE2 5F5QA 1W6PA 5FAXA 4U36A 2UY9A 4XMAA 1PVC3 4YVWC 1MQTC 5HXVA 4LBOA 1U5ZA 2JG9B 5C8WA 4OHWA 1NA1A 3EQEA 1DG6A 4F7ZA 2XLAA 5JPMB 1K5MC 5BNNB 3BALA 2A6WA 5FQ0B 3P3NA 2F6BA 1ND2B 2B7YA 4LE3A 2JEMA 3AYAA 3VBUB 4DRRA 4UW4A 4OI1A 2H0VA 5D1IA 2GNBA 2XKPA 2RR12 1QKQA 5E8AA 1HX6A 4XHBA 1DYPA 2R1BA 4M3CF 1KITA 1HQNA 4Q1PA 2JG9A 3VKNA 4CEWA 1E57A 2Q1MA 2YUEA 2GH2A 2I2SA 4H7LA 3ZO0B 2W68A 3FFQA 2ZBJA 1ASJ1 4FXKB 3VHRA 3RQ0A 4HSLA 5GLWA 3WNXA 1SDWA 2BNNA 4AVSA 2X5IB 3WP5A 4XOGA 5KC5A 1VP6A 2OZJA 5ACA3 5DDJ2 2MHFA 3MF6A 4Q8KA 1F5FA 1JW6A 3POWA 1RUD2 5CFDC 2ES3A 2WSVA 3E97A 4Q4V2 4GULA 1ZX5A 1VAVA 2A6VA 3WW2A 3KT7A 5HI0A 4YW3A 3DPRC 5DUXA 3VDDC 1D2QA 2B39A 3THTA 1XU2A 2DURA 4WVMB 4DNYA 3L9JT 4LO5B 1ZRDA 3UK9A 4YZ3A 2HWB3 1RUE2 2GMPA 3D0SA 2Y26A 1NY72 2AYHA 1HV1A 3ILNA 4RGAA 1QJZA 5DG2A 2EVXA 2GMEA 2XLGA 4PBOA 4WM8A 1PZ9A 4Y4YA 1EY2A 3DKWA 5FTTC 4ZXKA 4I01A 1AYN2 4N9IA 3AP6A 3GHNA 1NG0A 1QH6A 1KDKA 2MEV1 5D8AB 1ZZBA 1KQRA 1C28A 2BW8A 3AZWA 1OQ1A 3R4SA 1SCRA 1DBNA 4RS5B 4HPKB 4N90A 2EXIA 3NAPC 1REEA 4AYUA 3HWJA 1VBE2 1TME2 1GKBA 4QQ2A 2P3IA 2XBO2 4DRVA 4Y1ZA 4NN0A 2B5HA 4YW4A 1AR62 1AHSA 1PO22 4JDMA 3DN7A 3WV6A 5JZGA 2UURA 1ASJ3 4R9DA 4GB32 2FZ2A 5DUVA 4YM2A 2JX9A 2PN5A 5JIAA 2B45X 2VXRA 2EXJA 4OUMA 4XTPA 4XYXA 2QE3A 4CZSA 3IDEA 4XBQA 4K20A 4QM8A 1F9KA 5T50A 2JE9A 3WP6A 4HZFA 4BZ4A 3DV8A 3FFZA 2AH2A 4HVRA 1CAUA 4HN1A 2DYCA 1SLCA 4XPVA 5KXEA 3ZYIB 2XLFA 3MF9A 3WW3A 1WLCA 2A7AA 1YJLA 4CDXB 1C8M2 5KHKA 3VZLA 4EJRA 4IEYA 3OBRA 4A2UA 1GFF2 2ZOEB 4JGYC 1T6GC 1QJX2 1LOGA 1YI7A 1XYOA 1H0BA 1D4VB 2A3WA 3ZXEA 4XFIA 2NMNA 1U12A 2MEV3 3CJXA 1DQ6A 3WW1A 5L7OA 1LHVA 2YROA 3ALQA 1C5HA 4FT8A 5IK8A 4WZFA 1S0DA 1QY4A 4FQ4A 3AYCA 2C0ZA 2NN8A 2VQ0A 4S2DA 1AR71 1QOSA 4XF9A 1H8TB 1UD1A 5HCAA 4EV0A 1XNKA 4F8AA 4WM7C 2AGSA 4Z07A 1C4RA 4MZUA 1VRH1 2ZPXA 3PMSA 4H55A 4AFCA 3VUOA 1RJ8A 4LA2A 4FOYA 1RUJ3 4LUMA 4I09A 5K9YA 4P5HA 3VHPA 3ILFA 5KHHA 3AMPA 2DFCA 4FXGB 4DINB 5KWRA 4LLFA 1OFNA 4P9LA 1RUC1 5A32A 2K2SA 5BNPB 3VBHC 4UW6A 4AQSA 4XQWA 4PBPA 4D7SA 4HKOA 4BQ1A 4INDA 1KS4A 2F4PA 3BIWE 2GSYA 2XH6A 2ZGQA 5C8CC 5KC6A 5IK7A 1RMU1 3B01A 1AL22 5KXDA 4XFHA 2JG8C 2BVVA 3WOGA 1S0GA 2D93A 5I93A 3VBOB 3NKGA 1WCSA 1W2UA 4Y1VA 2R0HA 1Q8SA 1WD4A 1U5YA 2VNGA 5K0UA 3HMYA 5JVVA 5I0UA 2WJSA 5T52A 5J36A 2IXLA 1O91A 3GBFA 5FOBB 2ZGUA 5AFBA 1Z7S1 5I0TA 4R9CA 5FREA 5BNNC 1ND2C 1AJOA 4XF1A 3VBUC 1AR73 3ZN6B 1UCXA 3AM2A 4A7ZA 4ATFA 1D2SA 3LKJA 5EYXA 1VBB2 2D97A 4BLIA 1ZYBA 3RNSA 1VRH3 4RA0A 1RUNA 1OHFA 2EAKA 1DHKB 3E5XA 2E9QA 3VBRA 5HCFA 1AJKA 3VKOA 5K7PA 4ZU5A 1AR83 1HQWA 4F83A 3H3ZA 3MLLA 1QJU1 3BOPA 1RUC3 2E7TA 4LBQD 4M00A 2X5IC 1VBA1 3PJYA 1NXD1 4HT1T 1LODA 2RMU2 3DF0A 4PIXA 3ZFEB 1SBFA 1UF2C 4FO9A 4XTMA 4I3PA 1HRV2 1AXZA 2WL1A 1R082 1R1A1 2RHPA 4LE4A 2WIIB 1PO11 1W6MB 3FBMA 1RMU3 3KS7A 3NKTA 4XF4A 1XXNA 5JIUA 2EIGA 4KQ7A 1EV12 2VOXA 2IC1A 4IL7A 4YGDA 3LSEA 1TNFA 3N4MA 5GLZA 1QMJA 1UL9A 3AZVA 2CWSA 3AFGA 2DCZA 2DVFA 3VHOA 3T1MA 4GH4B 1H2KA 4IEVA 4OULA 4LO7A 5J96B 1UPIA 3G7DA 5D8AC 4ATEA 1RC6A 4XQ4A 1Z7S3 2DUPA 4FPJA 5FO8B 3CEWA 3AXEA 4RS5C 5J98B 3J8F1 1UZZA 2UWCA 3U10A 1J3RA 4X8PA 2DVDA 4OHVA 1UU4A 3K51A 2Q5TA 2OZ6A 2QFEA 3MIFA 3KQRA 3ZFGA 1S0IA 4QPGB 4MGZE 4DB5A 4COUA 4QQPA 3ZXJA 5EV7A 5BUVA 1QNYA 2VULA 2CYFA 5GLVA 4DFSA 1H4GA 1YNAA 3AXDA 3ZSJA 2QCSB 4D7TA 5CADA 5FDBA 1QJU3 2DU0A 4GKYA 2OUJA 3O5SA 2QVSB 1D0GA 3B5LB 4R9AA 4YG6A 3PLQA 2ARBA 3V56A 4IXLA 1Q8VA 1UPSA 1VBA3 4GWMA 1UIKA 4C0BA 1WCKA 5BV6A 2VNOA 2R062 4GA9A 2RS12 4FVVA 4TLFA 4YLZA 3ZFFB 2LALA 3OY8A 2IXJA 1BBT3 4L9BA 1AXKA 4Q1RA 2UWAA 4LO4B 2VPVA 2CGNA 4LR4A 4AQTA 1CAWA 1ULGA 1R1A3 4YZ5A 4MH0E 4ZU4A 3VZKA 4AEDA 2CGOA 1AX2A 4L2NA 1YJKA 4CDXC 3EHKA 3AJZA 4K8FA 3FE5A 4L97A 2PHDA 1V9U3 1G7YA 5L36A 2RS53 1XNDA 1QXPA 2BVBA 3M4FA 4HETA 5I0SA 1BVP1 1TEIA 4JC1A 4Y20B 1IS5A 2GDFA 2A5ZA 4OHZA 3VBFA 3AKTA 4CDWA 3ZSEA 1IS4A 3FC0A 1LB2A 2ATFA 1LGCA 3MLKA 2D7FA 1QQP2 2E6VA 1MACA 5JMCA 2YZ4A 1ZBA1 2X8KA 4YRDA 4YG3A 2ZJCA 3ZN5A 3PMEA 2WT0A 5JOWA 1UN1A 3J8F3 4HN0A 4RQPB 4BM8A 5EFUA 1RUI1 1O3SA 1RTVA 3ZYRA 3MIBA 3SXWA 1DGWA 2R49A 1H8TC 1CIWA 1MS0A 1ZZCA 5EYYA 1H2MA 4XETA 3ZXGA 1ALYA 3VGIA 4BH9A 2ZGLA 1V6MA 4HMZA 3TNPB 1LR5A 4X6QB 3USSA 4AQ2A 2HWE1 1AZDA 1V6KA 4RQPA 4RL7A 1C5IA 1EPWA 1QJY1 4BLJA 4KH9A 1G9DA 1ZRRA 4CEYA 5C4WA 5FPZA 5ABJB 4FOWA 4Z82A 3E6CC 3ZXDA 5A3LA 5BNPC 1N47A 1GANA 1YFUA 4JRAA 1RUF2 4A7YA 4PDWA 3AP9A 1YFWA 4LHKA 1IQAA 4YNIA 3O14A 5BXXA 2OA2A 5E16A 4QD2A 2O1QA 4MSVA 1BZWA 3LA2A 3ZYGA 4DY5A 4LULA 1FI2A 1SQ4A 4YVSA 3B00A 3VBOC 1RITA 1WCDJ 1OA3A 3ZSMA 5T5LA 2E7AA 4R4XA 1OA4A 2RE9A 4SBVA 5KHGA 1RHI1 5C33A 2ZGOA 4A3XA 4MLOA 2D6MA 5CA6A 2NPIA 1FPN2 4NHMA 4J1WA 4ZU7A 2GH8A 1Q5OA 1BMV1 4CDUB 3I54A 3VBSB 3I2DA 3I4IA 1FMD1 1RVF2 5GM0A 5CU1A 4YFZA 1G9AA 4BCUA 3B7MA 1PVC1 4Q4V1 1WW7A 2C5DA 4CP0A 4Z1VA 3ZIXA 1KRIA 2HEWF 2PLV1 3M3OA 1YIPA 2HYKA 1W6QA 1IPKA 4Y26A 3L2HA 2RS32 1G9BA 1A8MA 1LECA 1V6LA 2ZS6B 4CDUA 1BVVA 1MS5A 1H4HA 4N53B 1RUE1 3ZDSA 2HWE3 3S7EA 1C57A 1NY71 1QJY3 5LEJA 4FP2A 2HWF2 3JB8A 2MPFA 5FOJB 4W6XA 4OZXA 1RUH2 1YI9A 4LNVA 3M7AA 1JXNA 1H9WA 4LLOA 4C91A 2P2KA 2R30A 4JDOA 1GZWB 2G9GA 1CAXA 4MUVA 1U0AA 2PA7A 4N53A 1WA4A 5JSPA 1NZCA 3ZFEC 1WW6A 2KM2A 3JD72 2WFF2 2IXHA 1ULFA 3AK0A 3JZVA 2PHUA 3BCWA 4AGGA 3KCYA 1PGW2 5FMOL 2WNVA 2VVEA 1UZYA 4L11A 2A73B 1F8VA 1AR61 3BB6A 1NQDA 3JUUA 2I74A 4IERA </