The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
68
|
sequence length |
274
|
structure length |
274
|
Chain Sequence |
AYVQGPPSPGYYPSSQITSLGFDQGYTNLWGPQHQRVDQGSLTIWLDSTSGSGFKSINRYRSGYFGANIKLQSGYTAGVITSFYLSNNQDYPGKHDEIDIEFLGTIPGKPYTLQTNVFIEGSGDYNIIGREMRIHLWFDPTQDYHNYAIYWTPSEIIFFVDDVPIRRYPRKSDATFPLRPLWVYGSVWDASSWATENGKYKADYRYQPFVGKYEDFKLGSCTVEAASSCNPASVSPYGQLSQQQVAAMEWVQKNYMVYNYCDDPTRDHTLTPEC
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural Evidence for the Evolution of Xyloglucanase Activity from Xyloglucan Endo-Transglycosylases: Biological Implications for Cell Wall Metabolism.
pubmed doi rcsb |
source organism |
Tropaeolum majus
|
molecule tags |
Hydrolase
|
molecule keywords |
CELLULASE
|
total genus |
68
|
structure length |
274
|
sequence length |
274
|
chains with identical sequence |
B, C
|
ec nomenclature |
ec
3.2.1.151: Xyloglucan-specific endo-beta-1,4-glucanase. |
pdb deposition date | 2007-03-19 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00722 | Glyco_hydro_16 | Glycosyl hydrolases family 16 |
A | PF06955 | XET_C | Xyloglucan endo-transglycosylase (XET) C-terminus |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Jelly Rolls | Jelly Rolls |