4CYDA

Glxr bound to camp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
225
structure length
223
Chain Sequence
GVQEILSRAGIFQVDPTAVNNLIQDMETVRFPRGATIFDEGEPGDRLYIITSGKVKLARHAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSAVCVTEVHAATMNSDMLRNWVADHPAIAEQLLRVLARRLRRTNASLADLIFTDVPGRVAKTLLQLANRFGTQEAALRVNHDLTQEEIAQLVGASRETVNKALATFAHRGWIRLEGKSVLIVDTEHLARRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structures of Apo and Camp-Bound Glxr from Corynebacterium Glutamicum Reveal Structural and Dynamic Changes Upon Camp Binding in Crp/Fnr Family Transcription Factors.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transcription
molecule keywords PROBABLE TRANSCRIPTION REGULATOR
total genus 74
structure length 223
sequence length 225
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4cydA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4cydA01
1UHWA 4Z82A 2ZO4A 1F1ZA 2GU9A 2H09A 1C0WA 4ESFA 1H1IA 4LLLA 3FZVA 3BPXA 1CAUB 1QY4A 3VOEA 4RB1A 3S7IA 4ZYGA 1TQIA 2EAAA 1DPRA 3QPTA 5E1WA 2EV0A 2PG4A 1CAWB 3WW1A 1IN7A 4B8XA 2O3FA 5CVUA 2EFNA 2FBIA 1ON1A 5FO5A 4CZZA 1QZYA 4PGHA 4MGZE 1J0RA 1MJAA 2RNJA 2DAOA 3MYXA 1U12A 4HSLA 3WG9A 3HHHA 3RI4A 2L4AA 4XF4A 1OFNA 2B5HA 1TW2A 4KICA 1NXMA 4MHGA 4IXAA 2E1NA 3OCPA 4XFFA 4GYIA 1YFHA 3QU3A 4U7DA 1ZYRF 5FFXA 1LQ1A 4L18B 2DO7A 1OYWA 4F8AA 4Z2YA 3I53A 5KHKA 3REOA 3H1WA 4K2EA 3WTSC 3BY6A 4UVBA 2KIFA 1WSUA 3GFIA 4OINF 1JHFA 4XFHA 3T8TA 3I7DA 3MAJA 2FE3A 3R6SA 4IRIA 2K9ZA 1FP2A 5I8SA 3D82A 3BJOA 4IF4A 3GBFA 1S7AA 3WTWC 3ZMUA 3KCCA 3RIRA 3FMQA 2X4HA 1XCBA 5K5RA 2L02A 4FX4A 3LSTA 5JR7B 3ELKA 3C3VA 4D7TA 1X8EA 2D5HA 5E8GA 4S05A 3DF8A 1D8JA 5HI0A 4LUMA 2MA3A 2XROA 1O3TA 4OIPF 4ZU5A 3CUQC 4G9YA 1PUEE 4MGYE 3SZTA 4EVIA 1U5TA 2DT5A 4MQ9F 3MEXA 3K69A 4IEQA 1YHFA 5CJ9A 1V3FA 2OAZA 3TGNA 1WGPA 1JE8A 2EA2A 1X8MA 4Q0VA 4JTNA 1FZPB 3LA2A 4E2SA 3HT2A 1HKQA 3ECHA 1GHCA 3SMHA 1KU3A 4AQ2A 1J59A 3S7EA 2B9UA 4LA3A 2TDXA 1RI7A 3I64A 1FT9A 2M30A 3SFZA 2RVCA 1T2KA 4M6XA 2HEOA 2F5EA 2QENA 1Q1HA 3GFJA 3DP7A 2O61A 1WA4A 2OZUA 3NQOA 1CAVA 4OIRF 4RS8A 1KGSA 2PBIA 4QXKA 2VQAA 1HW1A 2DBBA 4L11A 3IWFA 2K4BA 1R1VA 4H7LA 3BALA 3I5UA 5FPXA 1UFMA 2IW5A 3RKWA 1PP8F 1MD0A 2QM3A 5LHIA 3DV8A 1BN5A 5FLIA 3OGJA 1ZZCA 4RGRA 2V79A 3FX3A 5JFRA 1DP7P 1VR3A 3E5XA 2PA7A 3EDPA 1B9MA 2P6TA 2UZKA 2JSCA 1OI6A 2QQAA 2C0ZA 3QAHA 1IXRC 2ELHA 3LQQA 2PN6A 5F64A 2FSWA 1ZZ9A 3SHFA 3GZ6A 4HF2A 3CUQA 1R36A 1ZRRA 1HSTA 1UB9A 5ICEA 3SCHA 3QRFF 1YFWA 3WGHA 1CAUA 3TKYA 5J6XA 2FQ3A 4YFNF 4MV2A 4BIFA 1R00A 2VXZA 1EH7A 1I1GA 1XE8A 2FA5A 1BIAA 5LHHA 2WTEA 5TJJA 2C6YA 4EM2A 2A69F 3H7YA 3E6MA 4CICA 1P4AA 1ZARA 3BPVA 4HLTA 5D8KB 4UV8A 5LHGA 4QX5A 5E1XA 4M9SA 2B8MA 3F8BA 2R7FA 4KL1A 4KWLA 1YTYA 3M9AA 4HA8A 1PMIA 2A07F 1ZG1A 2FQPA 2GC3A 2OBPA 2LF7A 2E1CA 3CO7C 1NE6A 4LK1F 1PM7A 3UKVA 3GX4X 1FI2A 5JCTA 5BPIA 2IA1A 4KIBA 1UCXA 3HYIA 2RN7A 3O14A 1W7PB 1I1SA 3BZ6A 1KQ9A 1JHHA 3LZZA 2R3SA 3MCZA 5E20A 5HOOA 3RDIA 3CDHA 4BHPA 1S29A 2NYXA 4KWKA 5LGNA 4G6DA 4P55A 2VODA 4L0ZB 4ETSA 5EFUA 4FT8A 4CYDA 4XF0A 5FPZA 2K86A 3I59A 2K7LA 1NZCA 5E1RA 1YIOA 3KLNA 4O6JA 4HOBA 2RQPA 2BE5F 3K2ZA 2KJBA 2W84A 3K1PA 1XMKA 3K1MA 1CX4A 2IVMA 4HZFA 4IPAA 2RV8A 4IETA 2DW4A 1HW2A 1J2XA 1ZLKA 3PFIA 4AD9A 2HZTA 1W7PD 2NS0A 3F3XA 4YG2F 4XETA 2DU9A 1YUDA 1UHMA 2ISZA 1B6AA 4Q48A 5D6EA 2KKOA 3ABTA 3OOPA 1Y3TA 2B0LA 4IEXA 1K78A 3GF2A 1EP0A 3KP3A 4A0XA 2EV5A 1Q5OA 1ZNPA 3GWZA 5H6RA 2GXGA 1TW3A 2MD5A 3TQNA 1R1TA 5A2QK 2GC2A 3FWEA 5D5UB 5JSPA 4NVPA 5L3CA 3H92A 3LOIA 1BC8C 2QBYA 1EYBA 3DXJF 5KK1A 3GYDA 1XDSA 1Z05A 4EJOA 2PTMA 2Z5UA 1U3EM 4WWCA 2ISYA 1CGPA 3ACLA 4WK8F 2OA4A 2VONA 2VBWA 2P5LC 2XUBA 2ESHA 2CFXA 3T1BA 3I0TA 1XD7A 1SD5A 2DK8A 4L5JA 3ZN1A 2DK5A 4ZU4A 2V1UA 4LLGF 4U88A 5ICFA 1Z6TA 2XAFA 3EYYA 4B09A 1XN7A 3H3ZA 3RYRA 4HX7A 3EJKA 4HX8A 2ET7A 4Q0QA 3OTFA 3P9CA 4R1HA 2O8XA 3TO6A 2WFPA 4JQFA 3LQRA 1ZZ7A 2Z2SB 2OQRA 5FLHA 4EV0A 1OYIA 4Y15A 1U5TC 1O5UA 5L3GA 1LJ9A 4OIQF 2KXLA 3JSPA 3QPHA 2HFHA 4E70A 1IAWA 3TOAA 2RDPA 3WE3A 3I71A 4KFCA 5KHHA 3IL2A 4HBLA 4EGZA 2GA2A 4FX0A 4EMSA 4HF0A 4OOIA 2IP2A 5E8IA 1FP1D 2QDRA 1IW7F 5CYVA 3RYKA 5E18F 3EO6A 2ZKLA 2EFWA 4HW0A 4K8FA 1OD5A 4BH9A 5DCMB 2F5CA 3KZYA 4MZUA 4GCVA 4ENJA 1ULYA 4OIOF 3U0ZA 4B29A 1RNLA 3Q9SA 5EEHA 3CL1A 2UY9A 4QM9A 4A6EA 4A5MA 2MNGA 4AWXB 1SFUA 4MGIE 4QM8A 4EJTA 3H3UA 2QYOA 5JR3A 3FHZA 2OPKA 2EA4A 1SD7A 2ZNYA 2VC0A 4TV7A 2LF8A 3GFLA 3FMSA 1QNTA 2W25A 1YLLA 3WW3A 1QXJA 3ES4A 1XGMA 2PHLA 4D7SA 5D5XB 3ZP5A 2ZFWA 2FBHA 3SXYA 1XDUA 3W6JB 2ZMEA 3ZDSA 1AWCA 2PQ8A 4MTEA 4HV5A 1IN5A 4WXCA 2O03A 3I4PA 4HN0A 2XGXA 1S6LA 3SZPA 4HF1A 2XAHA 1ZH5A 3M70A 2XKOA 4YRDA 1KYZA 3ULQB 3M3IA 2K0GA 3CTAA 2D5FA 1X82A 4P9UA 2P17A 4XFGA 4ZU7A 3FHIB 4XSXF 3F72A 1X7NA 3WGGA 1IXCA 3PQJA 5J8CA 3ZMDA 5D5WB 1U5TB 3BB6A 4PIZA 2OQGA 4EM0B 3L9FA 1HKTA 4PZJA 3MPBA 4QMAA 3TOBA 1ODDA 5BPDA 1USSA 4L9TA 1Q43A 4U0VA 3WODF 4Q47A 2ZBKA 4UVCA 2ACJA 4ORFA 3DFGA 2YX7A 3L2CA 3CJXA 2NRAC 1UIJA 3U11A 3GZ5A 4ENMA 1LNWA 4LB6B 4EQQA 4L9JA 5J8FA 2XHKA 4N9IA 3KGZA 4KNYA 3G3ZA 2Q1ZB 1TBXA 2BNMA 1FBQA 3I58A 1XSDA 3FXQA 4EM1A 2HDCA 3CF6E 1IPJA 3IC7A 4KU8A 1TTYA 2HQNA 4U0YA 4KU7A 4META 2QLZA 1TLHB 5FLXZ 5DDGA 3HSRA 3ABUA 1LR5A 2GAUA 1ZG3A 3RTRA 4RB0A 2VT2A 4I0AA 4KDPA 5HVQC 2Y0OA 5I0SA 2EA7A 5FCCA 3IDCB 3WU0A 2UXXA 3L00A 3FM5A 4RAZA 2FXAA 3EYIA 1UD1A 1FNNA 5FQ0B 1WKMA 4HQMA 3LAPA 4NQWA 4Q0SA 3ETQA 2ETEA 1Z91A 5K5OA 1STZA 1SD4A 2O6GE 4RB2C 1DZTA 3NSTA 3HOSA 1P4WA 1YFXA 4F7ZA 1QZZA 1LVAA 3HTUA 3PQKA 3C18A 3V7RA 4OMZA 1UW8A 3IBMA 2K27A 4AIKA 5FD5A 4IERA 1FSHA 2Y0MA 4UBGA 3H8UA 1Y0UA 3LWCA 2QNKA 3HRUA 5FD6A 3WE2A 1SD6A 2LKPA 4XBFA 2QVSB 2YPRA 3WU1B 1XSVA 2ET1A 5A2QZ 5AIQA 3LFKA 1T38A 2MPFA 5D1IA 4EJUA 2XVCA 3F22A 4ZYEA 3HSFA 4IEVA 2RKHA 2MLKA 3ST7A 4CDGA 3ZQ7A 5JVTA 3HSEA 1RTVA 2BV6A 2PYTA 5D4RA 3F8FA 3TNQA 3M8EA 3F8CA 3HHGA 2QZ8A 2F4PA 2PJPA 1ONVA 4HAMA 4M72A 4YYOA 2R7DA 1YWKA 5KHJA 3SHRA 3JAMK 1E17A 4EWAA 2DCTA 2HR3A 5DD4A 3BDDA 2GXBA 1BC7C 1WRJA 4Q4ZF 4WF2A 5J48A 3GLXA 5T3NA 1REPC 5H6QA 1IF1A 1ZRDA 2IPQX 1YYVA 4P96A 4MNUA 4RB3C 2MH2A 1I5ZA 3HRTA 1ZG5A 3MDPA 1R5HA 1HBXG 1HXDA 2OZ6A 3MQ0A 3J80Z 3G73A 1G3TA 4XF1A 4HX4A 4PIYA 5BUVA 3KSCA 4N0BA 2A61A 4UUVA 1UCRA 1JXSA 1GXQA 3QU6A 4ON0A 5EEGA 1KU7A 2VT3A 2EVXA 2FMLA 2PFBA 1MDMB 4WZCA 5CVIA 1IN4A 4EJWA 1L3JA 3HUGA 1CAXA 2RC4A 4QWQA 3R4KA 2OZJA 1D5VA 3DPLC 3R61A 2EK5A 5BXXA 2F2EA 1G3SA 2L54A 5HDKA 1R23A 1SFEA 2NAZA 3N4MA 4BHCA 3R60A 1V70A 1IN6A 4PCQA 5J3UA 5ILUA 1CAWA 4AIJA 1IN8A 3EBRA 3MZYA 1QWRA 3NL1A 2EB7A 3M8FA 4IHSA 4AIHA 1CAXB 1TNSA 2A68F 3E6CC 2F5FA 5JI6A 3ROUA 3H9AA 3V4GA 5HS8A 5J7MA 3BJ6A 4IHTA 3GFMA 3WTTC 1HW5A 3GO5A 5DUIA 4D0PA 1KA8A 4L9VA 5AONA 3T5XA 3DPTA 5HDGA 1SFNA 1IUYA 4IEYA 2Y48A 1MJBA 4A2UA 4Q0PA 5I93A 1MZBA 3R0JA 4CXFA 4KMUX 3BPZA 1JUHA 1LB2A 2UY8A 2VPVA 2CAUA 2VBXA 3H1MA 3J7AO 2L4MA 4MEXF 5L3EA 4E2QA 3QP5A 2DPUA 5CLSA 5LEKA 3COAC 3F6OA 2FEZA 4EJVA 2MLGA 4ENNA 4LG0A 4RD7A 2XASA 3IKTA 2IXKA 3VHRA 1OR7A 3DKWA 1YW7A 2L3DA 4BYYA 4MEYF 5LGUA 3CUQB 4KIGA 2BYVE 4KWJA 2K02A 5HLIA 5DEQA 1K78B 1XRUA 4NHJA 3TO7A 2EWNA 3BROA 4XLNF 2UYBA 1TQMA 4LGWA 2XL7A 4H0EA 4AVPA 4IEUA 4M74A 1CF7B 3DL3A 2D1HA 2MC3A 2JZYA 2IT0A 1AOYA 1PP7U 2D2WA 4A0ZA 1BJAA 1T6SA 4OLLA 5LLQA 2GC1A 4DINB 2IRFG 3KP4A 2FBKA 3LAGA 2O8QA 2D40A 2D1VA 1ZLJA 1BI3A 3MZHA 1O3SA 5DCFA 4G7ZF 5IT9Z 2YSRA 5K5QA 5JSRA 2BNNA 2H0VA 1YFUA 2STWA 2P7VB 4LK0F 2WC2A 3TDZC 5AVPA 4GULA 3FZ3A 5ED4A 2Q30A 2Z3YA 1IXSB 1FC3A 1O7FA 3W6KB 2JT1A 2V1DA 2QQBA 1J3RA 2BGCA 3S0MA 4ENKA 2OYZA 3DQVC 3U2RA 5DD8A 2BBYA 2ESNA 3KP6A 2LNBA 1P92A 2EFOA 4ASNA 3GVAA 5K1YA 3TNPB 4HVOA 1R22A 2IA2A 4ESJA 1SMYF 2CG4A 4AVAA 3HRMA 3L2HA 4X6QB 4GYGA 1ZZ6A 2IC1A 2XAQA 3Q9VA 2CO5A 2YR2A 3N97A 2D45A 3VB2A 4YFXF 5LEJA 4CO8A 4XLPF 4WBBA 4LLNA 3LWFA 1TQ5A 1S7OA 2Q8KA 3E6BA 4ESBA 3K1NA 1RUOA 4G7OF 1D8KA 3FF5A 2I45A 5JSOA 1QGPA 4JK1X 3WGIA 3CLPA 3ELNA 1DGRA 2P7CB 2FNAA 3WTUC 1SEFA 1MGTA 4Q5SF 3HTSB 2CSOA 3EETA 4G8XA 3E3VA 2PEXA 5HDNA 3RKYA 1K6OA 1RIOH 2PFWA 1OPCA 5JHUA 2D93A 4Q0UA 4UBHA 5I8TA 1O57A 2P6SA 1ZAOA 5CVJA 4KA4A 4IEZA 2P5VA 4M6YA 4YSFA 2O1QA 2Z69A 1DDNA 3BCWA 5L3DA 4EROA 3IWZA 2FRHA 4JTOA 2JPBA 2FMYA 5FB2A 1ZVFA 4R8HA 1FYLA 3H50A 3EQLF 1H9TA 2QWWA 2HQRA 3IIAA 1T0FA 3H1YA 2ZCWA 4U0WA 2XRNA 3ZPLA 2N7GA 3KMHA 3F21A 2MHFA 3U9GA 3SCGA 1PDNC 4LA2A 1LRHA 5FDBA 2MH9A 2VBYA 3BJAA 4LB5A 1GXPA 4KT5C 4XFBA 4E2GA 3IRRA 5JAXA 2PMUA 1WQ2A 3JAMZ 2CGPA 5BV6A 5F6FA 4YFKF 2CYYA 4HSJA 2LDUA 3D5LA 2KRFA 4GXOA 1Z7UA 5D6FA 1FSEA 3ECOA 3T0YA 5FFZA 1UPIA 3WW2A 1XB4A 2MBFA 3JSOA 1R58A 2ZMEB 4MX3A 1J3PA 2GWRA 2X0LA 5D4SA 2CW0F 2M1BA 3ZN0A 3C3WA 2Y75A 4RGSA 3FXUA 3WTZA 4EGYA 2RGVA 3R0AA 1XSXA 2DFIA 3CUOA 1NE4A 3D0JA 1WWXA 3P7NA 1O3QA 2H6CA 2Q4SA 4MTDA 5LGTA 4IJAA 4UHTA 4WXDA 3S2WA 1BOAA 3KE2A 2HKOA 3OF1A 4P5OA 3VFZA 4A5NA 5DCMA 1LKNA 3L7WA 4I98B 5F1RA 5TRDA 1U8RA 1J3QA 2ZXJA 1W5TA 4XFAA 3GUDA 2BNOA 4KN7X 4MGRA 3PVBB 3M7GA 4I02A 1H0MA 1FY7A 5BQTA 2XAJA 2QJVA 1LEBA 1VP6A 3MFKA 2PAKA 1JGSA 4L0YB 3FJSA 1DGWA 2JTVA 4ZYDA 1SQ4A 2XLFA 2IXHA 3FFQA 4OU0A 4ZZDA 3SCFA 4HN1A 3CJNA 1B59A 2J5PA 2DQRA 3K9TA 3SXWA 4QGNA 3CO2A 2BEOA 4UNOA 5FGMA 2JPCA 3HOTA 4FHTA 2COMA 2XIGA 1YS7A 4IVNA 3ZMTA 1ZX5A 4UXNA 2KJCA 2O0YA 3P9IA 1LDJA 1IPKA 1S8NA 2KIUA 1SFXA 3TDUC 2IXCA 2VBZA 1MDMA 4QLCU 1J7KA 1MKMA 2VC1A 3KP2A 2AXLA 5BY5A 2VN2A 5H20A 1TQPA 1B9NA 2ATFA 3ZMSA 1FXZA 1W4MA 3GEZA 4BQAA 3JZVA 5I8YA 4YIIA 2K4JA 3KGLA 3PNAA 4N9HA 4KUMA 1XGOA 1BM9A 4HLXA 2VOPA 1A04A 1XGNA 3VODA 1MJ9A 3RPUA 3RNSA 1BI2A 3NRVA 3WW4A 4I2OA 4UXAA 3C7JA 3UKTA 2QUFA 4M9ZA 4AVBA 3M1EA 4IEPA 5AIPA 4YIFA 5BS6A 4Y17A 3O2PE 2QBYB 2VE8A 4RGUA 1DZRA 4ZH4F 1YW8A 2W57A 3RYPA 2FU4A 2PAEA 1T39A 1ZZ8A 1SMTA 3V8JA 1UIKA 2HTSA 2HWVA 2L01A 3T8RA 3ZMVA 4A0YA 4BNCA 1ZRCA 5HS7A 2EFPA 3QACA 5BOXA 1BI1A 3GW2A 3EHKA 2FOKA 4M9XA 5IT3A 4HBNA 2Z9OA 3DEUA 5L3FA 1NHAA 3D0SA 3VEPA 2QCSB 4HQEA 2OU2A 3BU7A 1P4XA 2V1XA 1FOKA 1TNTA 1QXRA 3KZZA 4R79A 1J9IA 3HQXA 1ZZBA 4Z07A 2F5DA 3F6VA 3H7JA 2M5WA 5I91A 5IT9K 1O4TA 2XLGA 3RZZA 1XMAA 2GZWA 1FBSA 5ICGA 2XKPA 2H94A 5CVRA 2DPDA 3O3KA 1FBUA 2HYFA 4LJZF 3E5UA 5ERIA 3BP8A 4BHBA 3ZMZA 4WXHA 1K7AA 5FLJA 1Q3EA 3ERED 1VJ2A 5C6CA 2STTA 2P5KA 2XLAA 4I0BA 2QVOA 3USSA 1VTNC 2CAVA 2DTRA 1T98A 4UVAA 1YFYA 1HQCA 3QOPA 5FQ0A 4QGLA 3SQNA 3F8NA 2A6EF 4Y13A 1R1UA 1S3JA 5DUKA 3UKNA 1BI0A 4IEWA 1YO5C 1K79A 2XAGA 2GA1A 3E6DA 2V9VA 2A3SA 3FM3A 3J81K 5HLHA 2VOOA 1RZ4A 3I59B 2A6HF 4Q29A 4PGGA 1FX7A 1J5YA 4XRFA 2NNYA 4P9FA 3TO9A 3FXRA 2XL9A 3LA7A 4LUKA 1ZGAA 5BPXA 4ONUA 4WCGA 2HTJA 2IXLA 1W7PA 3FMRA 2ADUA 2EJRA 3IRQA 1OYYA 2AS5F 1XCVA 4IESA 1B1BA 4YNIA 1HSJA 1QBJA 1Z9CA 1FYKA 3E97A 3L09A 1D3YA 3AAFA 3OV8A 5LRRA 2PLYA 1CAVB 4P9GA 2HGCA 1H1MA 5I0UA 4HDUA 4AVCA 5CADA 5HLGA 4LULA 4L9NA 1Z1DA 2DQLA 1SAXA 3GXOA 2Q0AA 1KQ0A 1I6XA 3C1DA 2EFQA 4KIFA 3BWGA 3EQEA 4HMZA 4EWDA 3KP5A 1YG2A 3F23A 1R5GA 5KBFA 2VECA 4L2NA 2PAMA 5L3BA 2KIMA 4JV4A 2NNNA 2H27A 2PI0A 1ZRFA 1F4KA 4I09A 4HVRA 2H6BA 1U78A 3J81Z 1F5TA 2PMHA 2WWYA 3LAJA 1P6RA 1LEAA 4XF3A 2Z33A 4UV9A 2UWMA 4O9EA 4RGXA 1V4RA 4TLFA 4O3MA 4J1WA 1L3LA 4CHUA 4PIXA 3O6BB 3ML6A 3B73A 1YQAA 2J5OA 4G6QA 4XFCA 4CGZA 3CO6C 3ISPA 4LFUA 1KU9A 2ETHA 1FLIA 4OFGA 1Y9QA 6PAXA 2IXIA 4I01A 1I27A 3CLOA 1GQHA 1O5LA 2P8TA 1YS6A 3B02A 2OD5A 2V09A 2DI3A 1EH8A 5K8SA 1B4AA 3DN7A 3BOQA 1CF7A 1QPMA 5ICCA 1F9NA 2YX4A 3ES1A 4MH0E 2GC0A 3EUHA 1RUNA 2OA2A 4G7HF 4IEOA 3JTGA 3CEWA 1LDDA 5E1ZB 3P9KA 3IDBB 1L0OC 3V7CA 2E7XA 2G7HA 5LBQA 5I0RA 2W24A 1ZHFA 3V8KA 4S04A 4GO1A 1O3RA 4JVAA 1EPZA 4LD5A 1EH6A 2G9WA 5DYMA 2YU3A 2IXJA 4YARA 5KHGA 1USTA 2HYGD 3HT1A 5DV5A 4I3PA 5CU1A 2FNPA 2HKXA 3WTXC 1QQIA 2ZNZA 2CWEA 2P4WA 2GQQA 2ZKZA 2CV6A 3NW4A 2JRTA 4J1XA 5BMZA 4A12A 4HYEA 1KQ8A 1J75A 4KN4X 1DPUA 4BXUA 1FWZA 2W85A 4LEJA 4AXOA 1J58A 2IJLA 4XFIA 1GVJA 4FAGA 1J1LA 3V7SA 1EV7A 3V8LA 1H9GA 1O7LA 1ZREA 4O9GA 4U7BA 4X6RB 2UYAA 2EV6A 1BIBA 3U10A 3KFWX 4M71A 1P2FA 3GYHX 4L5IA 4LG0B 1XE7A 2M45A 1X3UA 2DLLA 5HS9A 4GGGA 5E16A 1E2XA 5D8LB 4OMYA 3IHUA 1WLTA 5EZWA 2E9QA 5ILSA 3RPQA 2GH2A 3KETA 1NYWA 1BBYA 3Q5FA 2PQQA 4XSZF 1ON2A 1FPQA 1QO0D 3HRSA 4AQ6A 2FF4A 1RGSA 4LLOA 2LSOA 5C8WA 2UXNA 1ZGJA 4R52A 4HDVA 3KEQA 3WTVC 5I0TA 3MWMA 2CQKA 3NKTA 4PDKA 2V6CA 3JW4A 3QP6A 4XF9A 3PLQA 3OD0A 2M87A 3IKVA 1GQGA 1G3YA 5CVVA 3K0LA 4KYWA 4HLYA 3G7DA 4A6DA 4PJYA 5ILVA 4NB5A 2G7UA 4FAHA 3JTHA 2WV0A 1RC6A 2HS5A 2Q2EA 3RJPA 4MQVA 2XV4S 2GIVA 1KU2A 4MGKE 4KMFA 3NJZA 2A5YB 2Z99A 1DUXC 4ZZLA 2E7WA 1FYMA 5KHIA 3LA3A 1HKSA 1YW9A 2ZJ2A 4BAYA 4I7HA 1YLFA 3KEOA 4HVQA 3NEUA 5E17F 1IRFA 1IZ1A 1XGSA 3F8MA 4QGMA 4XEZA 4FBFA 4ZYHA 1G6NA 1IRGA 4DNCA 1OMIA 2Q0OA 1Z6RA 3KP7A 1KYWA 1LDKB 4IRGA 4DQ2A 2VE9A 4WX9A 4RAYA 1RL3A 1W5SA 1G4DA 3E5QA 4G94A 3I54A 2PHDA 3NVCA 1OKRA 2QQ9A 3KLOA 4HV6A 2HOEA 4LTAA 1U6GA 1U2WA 4JBAA 5FLXK 3J80K 3FE5A 4LMYA 5LRSA 1R7JA 2M8EA 4IRHA 1WI9A 1EY2A 4M73A 2HJIA 3HIFA 3WTYC 4MUVA 3RKXA 4O5VA 5D5VB 1ZN2A 4WVZA 3U1DA 4EWEA 5KVRA 1G3WA 2IA0A
chains in the Genus database with same CATH superfamily
1UHWA 3ME2A 3UR3C 4OQ9A 2ZO4A 1VRBA 3X2QH 1H1IA 1I3HA 1G9AA 1FOD1 3MIHA 2BFUS 1C8M2 4ZYGA 1TQIA 5FYMA 2PG4A 1IN7A 1DQUA 3JUUA 2HVRA 4S2GA 4C3HJ 3AZYA 2FBIA 1ENSA 5FO5A 3J7YJ 1V9U3 1J0RA 2LW8A 2RNJA 2BW3A 2J1EA 5FXVA 3MYXA 3H5AA 3OIQA 3WG9A 4IV3A 2FMDA 2KRCA 4JDMA 4XF4A 1F36A 1OFNA 4I6ZA 2UWCA 2TBVA 3QD6A 4MHGA 1PO21 3A4UA 1R5ID 3KF5A 1YFHA 3QU3A 2P34A 1ZYRF 4L18B 2Y2ZA 1S0FA 3ZMOA 3BR6A 1SCSA 1DP3A 4GMP3 3VZMA 4C9YA 4QWNA 1UPSA 3OR2C 4UVBA 2NVUB 2L2OA 2QZ2A 4JGZA 1GZCA 4IRIA 2K9ZA 3MUZ1 3KVAA 2JB4A 1S7AA 2XB5A 5GLZA 3J7AY 2E6VA 1PNFA 3AYAA 2KMUA 3I2GA 1XCBA 2JG8A 3OGRA 4CEYB 4FX4A 1VBC1 3TOJA 4BM8A 2W3JA 1CVNA 4XQ4A 3DF8A 1HN1A 4BACA 2EILH 3ERMA 1G9BA 5HI0A 3HDDA 1Z21A 4AQSA 3BVCA 4PLNA 1PUEE 1U5TA 3M4FA 3VBHC 3RJRA 3AKTA 3MV11 4C2UA 3K69A 1YHFA 4JX6A 4RQPB 5BNNC 3Q0UA 4AL9A 3C7GA 4HFSA 3THTA 2CW7A 2MD0A 1JE8A 4UFMA 5HCHA 1C28A 5JMCA 2V4JC 2WLPA 3USUA 3POSA 2R92J 2AEZA 1J59A 3S7EA 3N7JA 1GZTA 1OISA 2VASA 3M8JA 3GFJA 2XWBB 3S17J 5E88A 1YQCA 1WA4A 2W5FA 5FRNA 4OIRF 3T2TA 4QXKA 3PVNA 2DJIA 2DBBA 3MFAA 4E7KA 3IWFA 3JREA 3B6CA 2K4BA 2B7YA 2D44A 5FKBA 1QRYA 4HK9A 3I2KA 2DURA 1UFMA 1L7RA 2QM3A 4CUGA 5LHIA 3S5QA 2VQUA 1BEV2 4RGRA 3W9AA 3FX3A 3DTKA 1DP7P 2A70A 3E5XA 1WW6A 2PA7A 1VBA3 3S5AA 2QQPA 3N9LA 2JSCA 1BK1A 2C0ZA 1TWCJ 2BW3B 3LQQA 4FPHA 2A6ZA 3BTAA 4C2TA 4OUSA 2NVXJ 1ZRRA 4KH9A 5ICEA 2H0BA 3TKYA 1SBFA 1JN2P 4BIFA 3P6BA 1R00A 2VXZA 1I1GA 4QTRA 1YI2I 1TWHJ 2FA5A 1YJWI 1WJFA 5A7NA 3W20A 5FZ9A 3VZJA 4EM2A 2C6YA 1P4AA 3TAYA 1PX3A 4NDLA 1ZARA 1S0EA 5ABJA 2KDOA 3RI8A 4BXXJ 3T1MA 3N9MA 5D8KB 2O8OA 3F2ZA 5C8CB 1RUC2 3ZQGA 4F93B 1W8HA 4ZONA 4AU7A 5FZ1A 2JD4A 3LSDA 2EH3A 3WZ1A 4HA8A 1PMIA 2A07F 2P3IA 2FD5A 2XQRA 2FQPA 2GC3A 3HPNA 2LF7A 4GJZA 1TME1 2VXRA 4QPYA 1WA6X 1LHWA 1PM7A 3POIA 4DQAA 5JCTA 4KIBA 1Z7S1 1J84A 1JHHA 4IUGA 2QKLB 2R3SA 3HJEA 3MCZA 5DQ0A 4LO7A 5HOOA 3RDIA 2VQGA 3IZOA 2NYXA 3BYWA 4G6DA 4P55A 3IAPA 4L0ZB 1A36A 3AG1H 5C3QA 2GN7A 2Y6JA 4G3YC 2M4GA 5FPZA 4RHV2 2K86A 1NZCA 3DU6A 3WF4A 2RQPA 3LCPA 1LFPA 3K2ZA 4V19K 4A93J 4LBLA 2JDMA 4A7ZA 4HZFA 1C1FA 3OS1A 1AU7A 2ID6A 3ASOH 4AD9A 5C5TA 3RGBA 1UYYA 4M3CE 1LFUP 2DYCA 4XETA 3VZNA 2P37A 2YZ4A 4HPKA 1W03A 5CKQA 5ACA1 3ABTA 3ZSMA 1Y3TA 1GMMA 1FMVA 3CMMA 2EV5A 1Q5OA 1DQ1A 1ZNPA 3MIEA 4BMBA 5GLTA 2ZS6B 5LY2A 3C7OA 2ID4A 5H6RA 1JUIA 3BIEA 2WO1A 5A2QK 1OH3A 5FR3A 1AR83 5GLVA 4NVPA 1XNBA 5J3LA 5L3CA 3H92A 3KCXA 3HUGB 2EZLA 3OYCA 4Y1XA 4EJOA 3Q8CA 2EQRA 1GNHA 1W8UA 3SJMA 2C9AA 1V00A 4WK8F 3MBWA 4LHLA 4FVVA 1B35B 4XDPA 4L5JA 3ZN1A 2W1UA 3J7HA 3WR0A 3M7AA 1Z6TA 2ORXA 1RUD2 2IBDA 1D2QA 3RYRA 4HX7A 4HX8A 1T6GC 3P9CA 2ARBA 4DFSA 3AMHA 1W90A 3ASIA 4A6SA 5B1BH 1JZ2A 4BQOA 4YZ2A 3B9CA 4AFBA 4A7KA 3I3LA 3MI8A 1QJU1 2OJED 1VQOI 3W5MA 5IVYA 1U5TC 3HMYA 1O5UA 4CCDA 5L3GA 1UZYA 3HQRA 2JIJA 3INAA 3QPHA 1T6BX 3TOAA 5C71A 5KHHA 4AVZA 3TEXA 2CDOA 1SC7A 3TEDA 3KYLA 5E8IA 1JZ8A 2F6CA 3RWKX 1VZ0A 5FO8B 3HWJA 4K8FA 2O14A 4ZKTB 2DF7A 1MQTA 3VYTB 2ZACA 2D3SA 2WZR1 2WAOA 3KZYA 1ULYA 4OIOF 2L9LA 2BGPA 3VHNA 4E7IA 1W9YA 5EEHA 5FZMA 5FXZA 2UY9A 4XOTA 2JDPA 3CMAI 2Y33A 4QM8A 4EJTA 3BC8A 4DW6A 3BTLA 2VC0A 4EN7B 3AX4A 3OYKA 4TV7A 3FMSA 4BDYA 1M1EB 5J47A 3O1MA 5A3PA 4WVMA 5M3MJ 1XGMA 1W6QA 2J1SA 3LEMA 4IE6A 3OYGA 4XLFA 4OCTA 4JP0A 3ZP5A 5A3TA 2ENRA 3I2HA 4LORA 2PQ8A 4MTEA 3FLPA 4HV5A 4WXCA 1N1YA 2R0HA 3T4VA 2A05A 3BG3A 3BG9A 1S6LA 4RM2A 2BBVA 1CQ9A 2W48A 1JJ8C 4DUVA 1ZH5A 5DAPA 3WCRA 3M3QA 3C2BA 4Q2FA 4YRDA 2L5QA 4U2AA 5DMYA 2K0GA 4XFGA 4ZU7A 2ARAA 5EF6A 3FHIB 5EYXA 1ZBA3 5T54A 3F72A 5JXHA 1X7NA 1Q8QA 3HOWJ 3ZX7A 2PHTA 3ZMDA 5J37A 2OQGA 2R5YA 1RVF3 1HKTA 2R041 4LBQB 1DDLA 3N9QA 4LKDA 2DVFA 4Y20B 2HYXA 1S72I 5LBCA 1I3QJ 4XONA 1WJ5A 3DFGA 3VPRA 4X8PA 3CJXA 1VQ8I 3RJ2X 3OIOA 4PK4A 4L9JA 1HRI3 3WHBA 3G1MA 1ULGA 4A7YA 2RHPA 4KNYA 2YFZA 1R081 2B39A 3N7LA 2BNMA 4KG8A 1XSDA 2FCTA 3MW4A 3BTJA 1MMDA 1IPJA 3THDA 1G9FA 1SZBA 1TTYA 3ZXKA 4U0YA 1CIWA 3N9NA 1TLHB 1UQXA 2VZQA 1LR5A 2EALA 3WY6A 2VT2A 3HN1A 4I0AA 5I0SA 2W1QA 3HZJA 2EA7A 4NROA 3IDCB 2E2JJ 4WM7A 3WU0A 3CMYA 2UXXA 1S1AA 4M3CB 4RAZA 3VDDB 3DLAA 4Q26A 1WKMA 4HQMA 1MS0A 3MFCA 3IH4A 2XHNA 2LBFA 3ZCOA 3ETQA 4GXLA 5IVBA 1Z91A 2G4IA 2OUMA 4M00A 3ORJA 2ZZQA 1IV8A 4C3JJ 3MZ8A 1VB2A 5K7PA 3JU9A 2EIJH 2LUWA 2PXJA 3H9QA 5F6LB 4NBQA 2R30A 3IBMA 2W4SA 1YO8A 4B44A 5FD5A 1WLWA 1FSHA 2Y0MA 4UBGA 1T08B 1QJY2 3Q8AA 5C3OA 3ZQHA 1W8ZA 5FBJA 1AHSA 1NY71 2QVSB 3BR0A 4DIQA 5KC5A 2YPRA 3WU1B 1ND3C 1I5PA 2VQTA 5A2QZ 4II3A 1MH3A 1T38A 1UXZA 4EJUA 4BS9A 3ZSEA 2BVLA 1LOBA 3F22A 2BV4A 2JD9A 1Q8VA 5C3RA 2MLKA 4R4ZA 4CDGA 1CESA 2PMZA 4K7JA 3IMMA 1LECA 3LB9A 3M8EA 2QZ8A 2F4PA 2PJPA 4BOWA 3BG7A 3H1CA 2YBKA 4JZRA 4DRRA 5G04L 4ZDOA 3S32A 4Q4X1 3IPVB 4J25A 4AFDA 1E17A 2DCTA 3KYDB 2HR3A 4XUOA 4A3IJ 3ACHA 5F8PA 4WF2A 4FQZA 2VJ5A 2P4EA 5J48A 2JG9B 4DYRA 2ZHKA 3U1KA 3F95A 1V5EA 4P96A 4RB3C 2XONA 4GKYA 4G6TB 1I5ZA 3SH3A 1RUI2 3U1XA 4CCEA 1R5HA 1MQTC 1HBXG 1LUJB 1HA8A 3MQ0A 3J80Z 1G3TA 4PIYA 3TYJA 5BUVA 4N0BA 3VBHA 4EATA 2WT1A 2MEV1 1JXSA 1R64A 1V6IA 4Y7NJ 3VHPA 3M3CA 2VZRA 1I39A 1KU7A 1H4GA 2NLRA 3U14A 2I10A 1UU4A 2EVXA 4A45A 2FMLA 1GICA 3FMGA 2VQHA 2GXAA 2VZUA 1IN4A 2V4AA 3MLKA 1K61A 5FROA 2HOTA 1CJPA 2NOGA 4OUEA 4IO9F 3WVJA 3O0WA 3BR2A 1VBB3 1G3SA 3WQBA 2L54A 5GAEJ 1R23A 1SFEA 2DN0A 1AR72 5FYIA 5EZHA 4ATFA 1ZBE2 3N4MA 4AEDA 2IWGB 3R60A 3LDBA 5FUPA 4CDQA 4XHBA 4PCQA 5J3UA 1T0FC 1CAWA 2YG0A 1W8NA 3M8FA 5H9RA 1X1BA 1CAXB 1W9WA 1TNSA 3PFYA 2Y69H 3ROUA 3WNMA 5FXXA 3V4GA 2FQ4A 3W21A 3GFMA 4QQLA 3BZCA 2CUJA 1HW5A 4H2AA 2A6YA 5DUIA 4D0PA 4HNVA 5AONA 1AYM2 3KV9A 5GP9A 5JZGC 5KXEA 2M3AA 4LBJA 4KMUX 3BPZA 1VQKI 4DYCA 3WF1A 1YRNA 3J7AO 1XS9A 2QQLA 1F5FA 2ZGTA 4ZC3A 2XJPA 2GBYA 4ZJZA 5DUUA 2VI6A 5LEKA 3F6OA 3LOCA 4BCUA 3POJA 1ENQA 2RR12 1RHI3 1Z67A 4ZS3A 5A6QA 1RXGA 4LG0A 3ZM8A 3IKTA 1NX9A 4CH7A 4I99C 1YW7A 2L3DA 4IZZA 3WP4A 4MEYF 4YVSC 1R49A 2WZ8A 1GVDA 3PIJA 2BYVE 1JYIA 5HLIA 3DLLF 1OKQA 2NPIA 3SDBA 2EWNA 4XLNF 4UW6A 4YZ4A 1UKRA 3DYOA 3P1IA 4Y33A 4AVPA 4DUXA 4JCKA 4B47A 1Y8QB 2BXYA 1WMDA 3A23A 1UMHA 4Q4Y1 3ZFGA 1MS1A 4Y5Z0 4A0ZA 2JKXA 1MBEA 4OLLA 1NZIA 4DINB 1H6XA 3LAGA 2D40A 3DCQA 2PMZN 1N3QA 5DCFA 2YSRA 1BBT2 1MR5A 2RREA 1POV1 4LK0F 4GAZA 4UWDA 5AVPA 4AGGA 1WHUA 4GULA 3FZ3A 4HK8A 3LPGA 5FZAA 1OQDA 3E7LA 3W6KB 1V6KA 2QQBA 2E1MC 4ENKA 2OYZA 2WV1A 5HCFA 5FZ6A 1V9U2 5DD8A 4CYCA 1K12A 5D21A 5IHRA 4XMIA 3KP6A 2LNBA 4DZGA 5GZFA 1X1DA 2Y6KA 3JD72 3GVAA 3POGA 4O7XA 5K1YA 4HVOA 3M4OJ 4CVUA 3QCWA 4Q4Y3 4NO4A 4Y20A 2ZGSA 4IEJA 2RS52 4GYGA 1GWMA 1HDPA 2Z4FA 3N97A 2SLIA 4BXSV 1N3OA 4QXCA 3JRGA 5LEJA 1WLDA 2Q8EA 3J8F1 3W2WA 2OXBA 3O12A 4WBBA 5KNLA 5FYHA 4PFPA 2R4GA 1S7OA 4E7ZA 2PMWB 1KFUL 4XTMA 2BVVA 3RG0A 1PVC3 3CZJA 5JSOA 1XXNA 1NT0A 1DGRA 4FFHA 3WHUA 4GD4A 2MG4A 2ZGKA 5FZDA 1NKGA 1UZCA 4Q5SF 4FOVA 3E3VA 1AR93 2ZHLA 4UYBA 4ZS2A 2P0WA 4HETA 2RS13 3LSMA 2VW1A 3THCA 4GB31 2W82A 5CBLA 3ACGA 2DU1A 2DOAA 2P6SA 1VAVA 5JZGA 1K5MB 3X29B 1OA4A 4QD2A 1GZWA 1SFPA 3BCWA 1EAH2 1XTAA 2QCOA 4Y1VA 2OCCH 2FRHA 2JPBA 5FB2A 3LSEA 5TSWA 3ZFEB 1FYLA 5FZHA 3BPSA 1LJ7A 2AEYA 1COV2 4LE4A 1T0FA 5J1UA 5J09A 2ZCWA 1DLLA 3A0BC 5A1LA 2DMNA 4N43C 3WDTA 1POGA 2MHFA 3SCGA 5FDBA 1A8DA 2VBYA 3BJAA 1T56A 4KT5C 2ZGNA 4OYUA 4E4HA 2ZC2A 1KS4A 5FZ8A 2PMUA 1WQ2A 5BV6A 1HRV1 2QQWA 2OPTA 2CYYA 3VD4A 4GRIA 3B93A 4CCCA 4J00A 4QPWA 2HPMA 1JKOC 5D6FA 4WVMB 2CWSA 3GHNA 3T0YA 5FFZA 2A3WA 4LBNA 3WW2A 2JRMA 1R58A 2V72A 1FOXA 2ZMEB 1J3PA 4MXVA 2XJSA 2CW0F 2M1BA 3ZN0A 3A0KA 3FXUA 3ZYIB 3WTZA 2RGVA 3LSGA 2QUOA 1NA1B 1NE4A 2QSHX 3D0JA 1WWXA 2AQFA 3P7NA 1O3QA 5D8AB 5A3OA 4JGZC 1C5IA 4MTDA 1RUC1 4IJAA 4XIDA 2K9QA 4UHTA 4WXDA 1AXKA 2HKOA 1X4OA 2QZ3A 3S16J 3BT9A 3VD3A 3PVOA 1YEWA 3ZYFA 4DJAA 4YLZA 4KN7X 2B7EA 1RUG2 3R05A 3H9GA 5F5AA 2XAJA 2QJVA 3KB5A 4RM3A 1PZ7A 3FJSA 1M4WA 3VBRA 1DGWA 4ZYDA 1BJZA 2D5VA 2DFCA 1B59A 1WUVA 3SXWA 5K7FA 5J1XA 2EIMH 5JWPA 1UL9A 1A8MA 2R5ZA 1ZX5A 1MNDA 3HD8B 1QVUA 1UWWA 2KJCA 5J96B 1GOHA 1RUC3 1UY2A 1QU0A 1RUH1 3TDUC 1MDMA 3KD4A 4QLCU 5IP7J 2EINH 2W47A 2AXLA 5BY5A 1POV3 5ISLA 2O0OA 3ZFEC 1TQPA 1B9NA 4YW4A 2ATFA 3GJAA 3H9JA 3DPRC 4DY5A 3TB0A 2VJIA 4BQAA 4Y4RA 4PI0A 5I8YA 3UK9A 5LBEA 2DYRH 4YIIA 3PNAA 1VBE3 2PJRA 1W05A 4LG3A 3VBFC 4ZY9A 3RPUA 4KMQA 1BW5A 3RNSA 2VB6A 5FFOC 3PUSA 4Q4V3 3C7JA 1KONA 1VF9A 4PDWB 4AVBA 4IEPA 2WADA 2XSDC 3O2PE 2AC1A 5LBBA 2VE8A 2ZPXA 1IGOA 2QA4I 4ZH4F 1AL0G 4K1ZA 4UW5A 1GBGA 2FU4A 2PAEA 4TSVA 4LT5A 1ZZ8A 4OUMA 4UY8I 1UIKA 4C2MJ 2VOKA 4QU2A 3T8RA 3ZMVA 2AUYA 2YC2A 2HI3A 3CDLA 5EJ1B 1ZRCA 3LEIA 2VNGA 2O9LA 2NS8A 2Z9OA 1GU3A 3I9V2 5FWEA 4INDA 1NHAA 3TN93 3D0SA 4GJYA 1P7IA 3NRUA 3ZFGC 4HQEA 2OU2A 3IUOA 4YZ5A 2EXIA 1FOKA 2NS7A 1YC61 3KX2A 1VQ4I 4R79A 5LATA 1J9IA 3HQXA 1ZZBA 3DEEA 4Z07A 2Y34A 4QB1A 3RZOJ 2BJSA 2M5WA 5I91A 4CDWB 3JRDA 3IN9A 5IT9K 1O4TA 1YQ2A 1XMAA 2YUEA 3ZXJA 5CPRB 1SLLA 1I3AA 4BQ4A 4D6RA 2OF7A 2CSGA 5ICGA 3O3KA 3KV4A 4YVSA 3OYAA 5FP8A 3B6AA 4FFGA 2R061 5C6CA 3LEGA 4K8RB 3CC7I 2STTA 3BTXA 3USSA 4W50A 2D6MA 1VTNC 1OUSA 1WI3A 3V0BB 3DWLE 1EA3A 3OYDA 4LMFA 4QGLA 2V4VA 3SQNA 4LK6A 3S15J 3F9KA 4IEWA 1YO5C 3K70C 1N25A 4B1LA 1JU4A 4V2WA 4O65A 4RAFA 3J81K 3I59B 1Z77A 1FAYA 2B63J 3VB9A 4L8QA 2DUPA 4IQ4A 4XRFA 4AVVA 4P9FA 4GWNA 4XE9A 4E4DX 2LBFB 2DYSH 2MGQA 4N53A 5IVEA 4WCGA 5K7HA 1VQ7I 5A1AA 1W7PA 1WKYA 1RVF1 3UJQA 2FDFA 1QHDA 5DAQA 1OYYA 2AS5F 2W39A 5L9BA 4IESA 4YNIA 1QBJA 4QKDA 4F91B 1Z9CA 1D3YA 3AAFA 3ENRA 4AK3A 4AHZA 4CDQC 1GNYA 1H1MA 1CR7A 4BPZA 4AVCA 4D9JA 1AX1A 1Y0NA 1XNTA 4ISQA 3LFIA 4M3CF 1SAXA 2DQLA 2R062 2B42B 4RQPA 2CWMA 3C1DA 2EFQA 4QPGA 3EQEA 5SV5A 4L0PA 2E35A 4EWDA 1YG2A 1FOYA 1R5GA 5KBFA 1R1A2 3FHNA 1OLRA 3GCWA 1B8IA 4LQRA 5L3BA 2NNNA 4YG6A 3H0OA 3VBOC 1F4KA 4F3QA 2Y31A 3CCYA 4C91A 2J7MA 2H6BA 4TN7A 3DTEA 1U78A 1UAIA 2DA2A 2VCAA 3LAJA 4XF3A 2Z33A 4UV9A 2G9GA 3B5LB 2DXIA 4O9EA 4NMIA 2HH9A 1JYWA 2X6YA 3C2GA 2UUZA 1DQ6A 5CKMA 3V64A 4CDWC 4CGZA 1QEXA 5EQUA 4LFUA 1DU3D 4OZXA 1KU9A 2CY6A 4OFGA 5FZOA 3PUBA 2YBSA 4NRMA 1LOEA 1WJDA 3AKRA 2PLV2 1IUFA 1YS6A 1AL22 2HWE2 5FK7A 1B4AA 1XNDA 3DN7A 5FIXA 1K3IA 1F43A 1CF7A 2E5NA 1D0GA 3O1PA 5L7OC 2KIQA 4MH0E 4IEOA 1W6PB 3JTGA 4W4ZA 3O7OA 1V5GA 3P9KA 1SPPA 1L0OC 5F2SA 4CCJA 3I8TA 1ZHFA 1IS4A 2WNVA 4UUTA 3FUQA 1X9PA 4JVAA 4LD5A 1EH6A 3G6EI 2D6KA 1QU3A 3DYMA 1ST8A 1SVLA 1USTA 4COWA 2HYGD 2E53A 4XUTA 4NC6A 3CCLI 1PGW1 2P4WA 2ZKZA 3J8F3 4Y24A 2CQNA 1HQWA 2DWRA 4HNUA 1COV1 4A12A 1W6OB 2WO2A 3RZGA 1Y1VJ 4JRLA 2NVYJ 4BXUA 2W85A 3NMBA 1RUJ1 1D5YA 3QWLA 5T5JA 3HNYM 4R9AA 2FZ2A 3V7SA 5BNOC 1H9GA 3UGGA 1ZREA 1EAH1 3U37A 4V2FA 4O9GA 4U7BA 3CCUI 5FKMA 1Q8OA 2XJRA 3GYHX 4L5IA 1SHWB 2M45A 1W0PA 2DLLA 4GGGA 5D8LB 4OMYA 2WY8Q 1WLTA 1JYCA 1W04A 2E71A 4KGGA 2GH2A 4IE0A 4XSZF 2IUWA 2A71A 1AF9A 3NNGA 1IRZA 2FF4A 1TVGA 1RGSA 4PQQA 3VBOB 5C8WA 2UXNA 5FZKA 3SC7X 5I0TA 2BP6A 4XQDA 3K75B 1HB1A 4AHWA 1NCQC 1QDOA 4XF9A 5AC91 3NV4A 3K7AJ 1GYKA 3OD0A 3OIPA 4XOGA 3G1OA 2WJSA 5HXMA 2G7UA 3AMMA 3LDKA 1RC6A 2HS5A 1LEMA 4FE7A 3GTOJ 5A6YA 4UFIA 1KU2A 4MGKE 3NJZA 1QQP2 2R5ZB 5DG2A 5CFDA 1BVVA 3R4UA 4L97A 5KHIA 4UW4A 3LA3A 1QH6A 2XOMA 4B1RA 1YW9A 3VBSB 2VQCA 2ZJ2A 4I7HA 4BAYA 4NE9A 2B9VA 1G59A 1YLFA 3O1UA 3DGTA 1AZDA 3NEUA 3MW2A 1XGSA 2C26A 3JB4C 3VD7A 1RUI3 1IKQA 2OV7A 2WZR2 2CS3A 2RM23 2Q0OA 4B7EA 2X29A 2KLOA 4IRGA 2XF6A 4AI9A 1UJ8A 5GADJ 3I3EA 3E5QA 2C6SA 3LKJA 4QPQA 2FCUA 3NNMA 1BKZA 1QDCA 1HB2A 1MBFA 3IMNA 2FDKA 2ZGUA 1U6GA 5DM7F 3FE5A 4LMYA 5LRSA 4Y5SA 2VOXA 4AQTA 3OYNA 4RYDA 1R7JA 2M8EA 4IRHA 3RI9A 2HJIA 5F5QA 3WTYC 1HKDA 4OVEA 4XVHA 3VL9A 4XOPA 3RKXA 1NG6A 4O5VA 3DCFA 1VBB2 2VQ0A 1SDDB 1G3WA 1UX7A 1AR73 5LB6A 1C0WA 5IAVA 4ESFA 1IS5A 1U5ZA 3BPXA 4RA0A 5A7WA 4RB1A 1GZ9A 5T50A 1DPRA 5C4WC 4B8XA 4J01A 2R7OA 2ZSIB 1EUUA 1H8TB 1ON1A 5IFPA 4CZZA 1QZYA 1MJAA 4Y26A 3KS7A 5F3IA 2WKKA 3SDGA 2EXHA 4UFKA 2V6EA 1PZ9A 3HHHA 3AKZA 3IIIA 1VB4A 2L4AA 5JOWA 4C30A 4FPYA 5JLVA 4CPBD 1S9HA 1PNGA 4X1EA 1NXMA 4IXAA 4MYEA 3WD5A 2L9VA 2E1NA 3OCPA 3O5SA 4XFFA 2VW0A 4NOTA 4AIDA 5FFXA 1LQ1A 1OYWA 3NO8A 4F8AA 1VBC2 3JD71 3GZUC 3L1PA 3MF9A 2RS32 4FPFA 1M06G 1G8XA 2KIFA 3K48A 3GFIA 1H30A 3ZOIA 3ONQA 2RR13 1MS9A 2KR2A 4A3CJ 2FE3A 2BPA2 1FP2A 5I8SA 1GUUA 4GMP0 3MKYB 3BJOA 3AFHA 4IF4A 3WTWC 1RPWA 3RIRA 5FMOL 3OG2A 4RGAA 5K5RA 5BNNA 1PM4A 1XYOA 3LSTA 4YVWB 1DYPA 3BR3A 2WZEA 4UFJA 4S05A 1BXHA 5CQGA 5B4XA 5FLVA 2A1XA 1DGRN 5L9RA 3OYWB 3B9IA 3OSDA 3DEMA 3SZTA 5C8CA 4EVIA 4MQ9F 1JJ6C 3MEXA 4IEQA 3VZOA 4BA6A 1H8VA 5FZEA 4JX4A 1X1PA 2D3RA 2EIDA 2BTVC 3USUB 2E2HJ 2X53S 3LFUA 1WGPA 3JQXA 4YWAA 4Q0VA 4AW7A 3ZYJB 3LA2A 1RHI1 3ECHA 3SMHA 4M3BA 4PFOA 1Y39A 1OQ1A 4AQ2A 2VUMJ 3A4CA 2JA6J 5IYYA 5ANNA 4DBQA 3I64A 1FT9A 2M30A 4CCOA 2VXJA 2RVCA 1WCQA 4M6XA 2HEOA 5B3SH 3HOVJ 2QENA 2XJQA 4URTA 2E26A 4XLHA 3FXLA 2O61A 3VBFB 1MS4A 4CUCA 2VG9A 3KEYA 5DDJ1 2ZXQA 4KG0A 1KGSA 4BY7J 2OS2A 1SDWA 3JRIA 2VQAA 1YQ6A 3W6VA 4A41A 5GZDA 2HWD1 1R1VA 4H7LA 4XMAA 3BALA 4M6VA 2GOXB 3RKWA 1PP8F 4AHXA 3PU3A 1WCUA 3R4SA 5HPOA 1ZZCA 2V79A 1OOPB 4P02B 1SVOA 2M8GX 1PVC2 3EDPA 3NAUA 1B9MA 1O91A 2P6TA 2UZKA 2QQAA 2HU9A 1IXRC 4CPBA 2ZXWH 3ZXGA 4HF2A 2HZDA 3B01A 1R36A 2EIBA 3BODA 1S0CA 3T1LA 3O8GA 1CAUA 5J6XA 5FY7A 2FQ3A 5K0UC 1WPKA 4MV2A 5EJZB 2PN5A 1FOWA 2RDNA 3RSNA 4CEWC 3MMYB 2Q5TA 3TP0A 2A69F 4CDXA 4CICA 3MICA 4BIOA 3KT1A 4ITCA 4CP2A 3BR1A 5LHGA 4N4NB 5KXBA 3UGFA 2B8MA 3NWTA 2XF7A 1WCDJ 4G4FA 1PK6C 2VU9A 2R7FA 2V26A 2LY1A 2CDPA 3TEZA 1ENXA 4Y1UA 3WDVA 1CD3G 2VNRA 3CD6I 4HSRA 1U5XA 4LK1F 2EICA 1VPHA 1JMUB 3UKVA 4SBVA 1FI2A 3K4LA 1UCXA 1W7PB 2WNVC 1KQ9A 2WBMA 3QBQA 1FNZA 1AR81 3RZMA 3CDHA 4BHPA 3KIOA 1H2KA 5LGNA 1QOSA 4HKWA 3AZWA 2CYFA 2VY0A 2Y9YA 4XF0A 2UWAA 3I59A 2K7LA 4BLJA 1WCKA 4XBLA 1KJRA 3KLNA 1H8AC 2EIGA 3FHAA 2W84A 3K1PA 3H5NA 2DTYA 3K1MA 1W1WE 2RV8A 1UZZA 2DW4A 2HOSA 4AGVA 1HB3A 1BEV1 1J2XA 4RAGA 4BWOA 4EYUA 3PFIA 2VMFA 1RC9A 3KQ4B 5CKTA 1UZWA 2ISZA 1ZTRA 3CCJI 1DGLA 2KKOA 1Q56A 2K40A 3RVHA 3AFGA 4IEXA 1VAKA 1EP0A 3GF2A 3KP3A 4A0XA 2O8KA 2AHQA 2BOIA 2QKMB 1N77A 3GTMJ 3GTKJ 1NQJA 3SQOA 2MD5A 2WSUA 1JKPC 4O61A 3I49A 2GC2A 4QPIA 3WNPA 2EZHA 2HYJA 4BXFA 3LOIA 3QYBA 5FWJA 2QBYA 2FOWA 3KYCB 1DZQA 1LHOA 3H0GJ 1O8SA 4W8JA 2P2KA 5KK1A 3GYDA 1XDSA 2ORZA 4M0NA 1U3EM 4L9BA 1LESA 4NIIA 2KRHA 1DYKA 2LH9A 4LJHA 3UJOA 3OPZA 3FXJA 2VBWA 2P5LC 2ESHA 2CFXA 3NKGA 3I0TA 2WN2A 5J36A 4XLCA 4ZU4A 2DK5A 3Q8EA 3IP4B 4LLGF 3KM5A 2XAFA 3PURA 2CV2A 4B09A 5FTTC 1K6YA 2D6NA 3WG1A 4H3WA 2ZABA 1TL8A 4Q0QA 3OTFA 2WN3A 2ZOEB 4V1PA 3TO6A 3GCXA 3LQRA 1JZ7A 2OQRA 2HEYF 4NAOA 2C1FA 2VMGA 4EV0A 3PMEA 4YVWC 1OYIA 3ZIWA 1G9DA 1VBE2 1EV11 4OIQF 2GMMA 2PJRB 2D97A 4RGKA 1O4YA 1WW5A 3ZQFA 5C9AA 4TXWA 2HEVF 4E70A 3WE3A 3I71A 5F0CA 2R042 4FX0A 4EMSA 4Q4V2 4NC8A 1K4SA 2VZOA 3EO6A 4M3EA 1OD5A 2HXOA 3CJTB 2R7VA 1N1SA 2F5CA 1W36C 1JHNA 4MZUA 3OYHA 4ENJA 1BEV3 1IDZA 4B29A 4Z2AA 4A5MA 2JUGA 2QBXA 1T95A 4MGIE 3I97A 1RIRA 3FHZA 3KQRA 3WG3A 2OPKA 4JX5A 2HQ5A 2LF8A 2W52A 3ZYBA 3EB7A 2W25A 1YLLA 3WW3A 1QXJA 3NJYA 3A2KA 1ZGWA 4MFDA 2M0CA 2XVLA 1OF4A 4QKFA 2JA2A 4V2VA 5H9SA 5A1FA 2FBHA 3SXYA 2RMU2 1AX2A 5JVVA 2CU5A 3HBKA 1QNYA 2AREA 1S2KA 1J83A 1SVMA 3G4SI 4W1UA 2JSPA 4BEHA 4E7JA 3HJRA 3NQHA 1TNFA 4P00B 1D0HA 1LFBA 4FOYA 1FOD2 4BU2A 2WT2A 3MEPA 3ULQB 3TBDA 5LA0A 3PO2J 2R7ZJ 4XSXF 5A6ZA 1BCXA 2VUAA 2XXZA 3I2JA 3HGGA 2VOTA 4D7MA 1HRI1 2R7TA 5T5OA 1AVBA 5HXVA 1YXWA 4QKBA 4EM0B 2J22A 1X1AA 4DB5A 1JTZX 1NA1C 3MPBA 1GP4A 1W6NB 4WVVA 2IZWA 3GXUA 4L9TA 1Q43A 1AYM1 1UOJA 2YX7A 3L2CA 5A32A 2NRAC 1JUMA 3U11A 1YHQI 4EQQA 2QQIA 2TCTA 3S3NA 5T5LA 3KGZA 4QPGB 1BMV1 2HBUA 3CNAA 2WR9A 1REDA 4XKBA 4COZA 4CDWA 4BK5A 2HDCA 1UMIA 1VBA1 5BYNA 1B72B 3P3NA 3ZOBA 1OCZH 5FPBA 2ID3A 3T0BA 3ZR8X 2QLZA 4BUPA 3POFA 1ZK8A 3L2WA 3HSRA 2GP3A 4YFZA 2VZPA 2QQNA 3RTRA 2NMNA 4XORA 4KDPA 5HVQC 2LY9A 2Y0OA 2R063 2A6VA 4G12A 2FXAA 3EYIA 1UD1A 1FNNA 5FQ0B 2YPJA 1S0JA 2VW2A 3OYWA 5A6XA 3BR5A 2JA8J 2O6GE 4RB2C 1EF4A 1DZTA 3RZKA 4GWMA 1B72A 5F27A 2NVQJ 1YFXA 2L7MP 4F7ZA 1QZZA 2KP6A 4YVWA 4BKXA 1Z7S3 3HTUA 5DM6F 3V7RA 3PJRA 4UW3A 4MADA 2WA3A 3GGLA 3DBRB 4IERA 2NMOA 4UB6C 1WBLA 5FD6A 1D1BA 4DY3A 1RRJA 1DF0A 4JDOA 1VBD1 1Z0XA 3LFKA 3A1YA 2VQLA 2E1MB 4LBOA 5DTDA 3AL5A 5BNNB 5D1IA 2G19A 3OSGA 2WLQA 4XW3A 3HSFA 2WUHA 2RKHA 2JJ7A 1H89C 3HSEA 3VYSB 2PYTA 4HANA 4X6AJ 2PLV3 1GQPA 3PUQA 5HCBA 2XJUA 4RHV1 3NV3A 5KC6A 5J4VA 2HWE3 3K77A 3ZO0B 1MZFA 3KZIC 2HLEA 4FSJA 2DFEA 4I3GA 4EWAA 2R16A 3UT0A 4RA2A 1SANA 3BDDA 4CDUA 1BC7C 1WGXA 1JZ3A 3GLXA 2WO3A 4MVTA 4LNVA 1ZRDA 1YYVA 3AKSA 1GP5A 2DUOA 3HRTA 1KZHA 2VMDA 2VD7A 4JX0A 2OZ6A 3G73A 1SG3A 1AYN3 4ZDPA 5DAVA 3ESWB 3J4UH 1UCRA 1GXQA 1E5HA 5DG1A 3PNVA 4YFWA 2VT3A 4P9IA 5F0HA 4WZCA 4BMEA 4FPJA 5F3EA 1L3JA 4UUSB 2ME6A 2OZJA 1D5VA 2YC0A 3CCSI 4U36A 4NHLA 3R61A 3CQZJ 1UYZA 4CE8A 2F2EA 1CQTA 5T52A 4YM0A 2CGNA 1MSEC 2WRAA 3S30A 5CZKA 5FJKA 3QLQA 1UYXA 1IN6A 1Y56A 4D8MA 1TWFJ 4ASMB 5C3EJ 2VMCA 1IN8A 4CZSA 3MZYA 2LVSA 3AP4A 1XNCA 2WAQA 4AIHA 1RINA 1JT6A 5DZEA 2F5FA 4XUQA 1PMHX 3H9AA 2XJTA 3K4BA 1ETQA 5FY0A 2CFOA 4QPOA 5HS8A 2JA7J 4IHTA 5JIUA 3GO5A 1T2XA 2DTWA 2E1OA 1D4VB 1IUYA 4NWWA 3K2OA 4A2UA 3R0JA 3OYEA 1S0IA 1GANA 4D0QA 4P5HA 1JUHA 1LB2A 1PO22 2VBXA 3H1MA 5K0UA 2DOFA 2L4MA 1QQP3 1Q8PA 4E2QA 4RBOA 1HRI2 2W92A 3KCYA 3ABKH 3COAC 4RSUA 3CJIA 3N3HA 4P9YA 2EXJA 2MLGA 4B8EA 2IXKA 1OR7A 2R7XA 2F17A 2HNHA 4GA9A 4GFBA 2ZGQA 4BYYA 4N7IA 2RM22 5FUNA 5LGUA 4QB2A 4RR3C 3OYLA 4KIGA 1X36A 4KWJA 2CUZA 2Y0SA 5E79C 1XRUA 4P9JA 4XJAA 1ENRA 3K70D 2C24A 2UYBA 3QH7A 4LGWA 2UV1A 5FO7B 1D0YA 5C9AC 4H0EA 1FNYA 3ZFFB 1CF7B 3RMXA 3VBRC 4HRIA 2WB1A 2D1HA 2YGMA 3R0RA 4CUBA 2JZYA 2R073 2IT0A 2D2WA 3VBFA 1BJAA 1T6SA 1OA2A 2V7FA 2GC1A 4K6BA 2FBKA 3TP3A 4ZDLA 3AP5A 4KBZA 1ZLJA 1LGBA 4D6QA 1X19A 1O3SA 3AJYA 1C8NA 2DFBA 3AP6A 2ZJRF 2IFWA 1YFUA 2STWA 2P7VB 3TDZC 1IXSB 4I30A 5FK8A 5FYSA 4NUBA 3T08A 1J3RA 2BGCA 5A80A 3DQVC 2ZB9A 3U2RA 4Q4V1 5A3MA 2BBYA 2ESNA 5FMCA 1S5LC 5FKLA 3EPZA 2LK2A 1W39A 4DS0A 5DDJ3 2R071 5F39A 3GF6A 3HRMA 2CMPA 2X9DA 5GM0A 1XB9A 2FX0A 1ZZ6A 2YHJA 3Q9VA 4P08A 1PIV1 2D45A 1D0ZA 3QQAA 4YFXF 2ZFUA 1U5IA 4BJ0A 4CO8A 3WU2C 2VTFA 3PNTA 2Q8KA 3MO4A 5IAXA 4ESBA 4CP0A 3CZ6A 3K1NA 3FF5A 3CDZB 1C1LA 1QGPA 2CQXA 4JK1X 3WGIA 3CLPA 3ELNA 5BNPC 2P7CB 2FNAA 1SEFA 2WBKA 4QHOA 4ASLA 3KVBA 3HTSB 1GV2A 2CSOA 1VIWB 4BISA 3IDAA 4AEDC 3RKYA 1K6OA 2PFWA 4OHXA 1OPCA 4BGDA 5JHUA 2D93A 2OW4A 4A3XA 5I8TA 2BXZA 5IWFA 4COUA 1YNAA 3MIDA 4KA4A 4DYQA 4FOWA 4XRSG 5L3DA 4AGRA 2RE9A 2Y6HA 1ZR4A 4CYCB 1ETWA 4AI2A 4QKNA 3M8LA 3RKQA 2HWC2 1UY1A 4Z6YA 5AC93 1X3ZB 4YGDA 1ZBE3 3URFA 1MEC1 2HQRA 2P1BA 3IIAA 3O0XA 4XL9A 5E3NA 4MGTA 2N7GA 3KMHA 2OUHA 1VBD2 3U9GA 5LD2C 4N43A 4LA2A 2IFRA 3AL0C 2W08A 2KL4A 3SKJE 3AP7A 5CFCB 2MH9A 2YB7A 1IZ3A 4QQPA 2HWB3 2RNGA 1W2OA 1X33A 1QHHD 1ND2B 2A3XA 1AYM3 3QPLA 3S14J 2KRFA 4GDFA 4Q4X3 4GXOA 2TNFA 1Z7UA 4KQ7A 4PQ9A 3ECOA 4CP1A 4QDQA 3JRAA 1UPIA 3I2OA 2KFDA 2GMEA 5CQEA 4LLFA 1YI7A 1UG0A 3AM2A 3OS2A 4AF9A 4MX3A 2GWRA 3E1F1 5A3NA 3HOBA 1RHI2 2QQUA 2EAKA 2FUG2 3R0AA 1XSXA 2H6CA 1LU1A 5LGTA 1H9WA 4F52A 1BOAA 2L7FP 3KE2A 3CHXA 4I76A 2AO9A 2QGUA 3OF1A 1U8RA 1XYNA 2X09A 5TRDA 2VM9A 4EN6B 2ZXJA 2JQ7A 2GN3A 4CA9A 2BNOA 4MGRA 4I02A 1H0MA 3VBSA 2GLOA 5B4NA 4WM8B 4CCKA 1VP6A 2JVGA 1JGSA 3WDYA 3BG5A 3WV6A 2Z1DA 1GKBA 2VZ1A 4XKWA 2JTVA 1SQ4A 3WOGA 1OA3A 4R4XA 3CJNA 5BNQA 4XURA 5L36A 4UNOA 3FXMA 5FGMA 1O4XA 2JPCA 1HX6A 2ZGRA 5IUQA 1W6MA 5J1RA 4IVNA 3ZMTA 3TW7A 3NNLA 2ZGOA 4AZZA 2O0YA 2XVGA 1IPKA 2KIUA 2LREA 2X8KA 1MKMA 4CEWB 2BOJA 3KP2A 2Q1FA 4DRVA 1PVXA 3PM1A 1MPXA 2ADDA 1EJ9A 3EUHC 4YM1A 1F35A 3JD73 1V54H 2DBNA 3MIGA 5GTHC 1QJFA 4Q4Y2 4NIDA 3OY8B 3VBRB 2VOPA 2NVTJ 2D3PA 2RS53 1GOGA 4NWVA 1MJ9A 5FZ4A 2BWAA 2W1WA 3ZYHA 2ZX2A 3ABZA 1BI2A 2LY2A 3WW4A 1LEDA 3GTPJ 4YGBA 4M9ZA 3ZKUA 1UKGA 1VLNA 1AR62 5AIPA 5F5CA 5BS6A 4Y17A 3MF6A 1DZRA 1YW8A 2W57A 2CGOA 1DQ4A 3VLBB 3CCMI 1VQLI 4Y22B 2HTSA 2HWVA 2L01A 1WWYA 2VUCA 5EYYA 4RMNA 1JYNA 4JKKA 4Y4YA 2RR11 3GMEA 3FHQA 4AYBA 3QACA 5A3UA 5BOXA 3MLJA 1BI1A 2RS12 2LKXA 5L3FA 3IKWA 2ECBA 4BQ3A 3VEPA 3ZN6B 3OS0A 2QQOA 5M5WJ 2YFUA 2F5DA 3K4CA 1EAH3 1RKWA 3C8XA 3F6VA 3H7JA 1FIAA 2HBTA 2JK3A 2ZKNA 4S2FA 1G9CA 5IP9J 5C4XJ 2GDFA 4CP9B 2DPDA 2C4XA 3E5UA 3PMSA 1COV3 1YCIA 4WXHA 1K7AA 1Q3EA 4B3NA 2D7FA 2R7EB 1SBEA 1VJ2A 2Z42A 2JKBA 1DCSA 4I0BA 2CAVA 2BDRA 2DTRA 1V6MA 4RL7A 1T98A 4UVAA 1H2NA 2J1UA 4UB8C 3S6PA 1PUFA 1QGLA 2YC4A 4LOCA 1R1UA 1FV3A 4OMDA 5DUKA 4EZ4A 2DUQA 2F4LA 3HG9A 1G7YA 2NN8A 1IQAA 4CDUB 4LOTA 2GA1A 4Q4W2 3OEAA 2M4KA 2VOOA 5IPAA 1QJZA 2WNOA 4Y1ZA 4AHYA 5D8AC 4B7KA 4FTBA 1FX7A 2QQVA 1ZGAA 1OPOA 2P6CA 2R043 3DF0A 1JTXA 4ONUA 3FMRA 1HXS3 2EJRA 2QKDA 1JKQC 5ACA2 1OCPA 4FE4A 3M3EA 1B1BA 1WCSA 1NCRB 2A7AA 2M34A 3HOUJ 1QIQA 3N9OA 3E97A 4CU9A 4M0HA 4P9GA 3HXLA 2LALA 5I0UA 1LTEA 2VMHA 5HLGA 4L9NA 1I6XA 3QPSA 1JUSA 4C0HA 1J1TA 4HMZA 1AA7A 3F23A 1R6RA 3SH5A 1IRXA 1QJX2 3IAM2 4N53C 2AR6A 1RITA 4R9CA 4JV4A 1POQA 2E36A 1ZRFA 2IS2A 5LA1A 2J1TA 3J81Z 3LNQA 2KHMA 1P6RA 2WNVB 3O1OA 2UU8A 1FTZA 4O3MA 2RV9A 4LR4A 2RDQA 3MLLA 3LFMA 3F0CA 1WCMJ 3O6BB 5FY9A 2DT6A 1X58A 1FOD3 4XFCA 3BQYA 4M01A 1IHMA 1MBHA 4XKVA 1TEIA 4C0BA 2IXIA 1Q1VA 2ZAHA 3MVPA 1GNZA 2P8TA 1S0BA 2AZ5A 2CHHA 1Y9GA 4W6YA 5K8SA 3CQOA 2Q8CA 4ZTJA 1TT5B 3GZAA 2RJKA 3ES1A 2YX4A 3EUHA 1RUNA 4OI4A 3BI3A 4NJ4A 5CEHA 5IYDJ 3CJIB 5I0RA 4S04A 1MBGA 1O3RA 5FKCA 2LKSA 2G9WA 1RESA 5LY1A 2VBDA 3HOYJ 3VKFC 1Z0HA 1BR2A 5E3LA 4I3PA 1VQ6I 5CU1A 4BLIA 1ZR2A 2BBAA 2ZNZA 2GQQA 5EG0B 3NW4A 2JRTA 4M3DA 5FRMA 2LP0A 4S2HA 1DPUA 3MW3A 4ARXA 3CMGA 4BDZA 3GTGJ 1W8FA 3LQCA 5J40A 1W0TA 3TN92 3BLYA 4LEJA 5L7OA 1X1CA 1NK2P 1OT5A 4JQRA 4XFIA 2VNVA 1JOPA 3HL2A 1GVJA 2HWF3 4FAGA 1STMA 4OULA 1EV7A 2C5DA 3V8LA 5JVGF 3IH2A 1YRZA 4E4SA 4D5FA 3ZQLA 4M71A 1UOGA 3ZYPA 4LIUA 3ZN4A 3OL4A 1P2FA 4Z92B 2ZX4A 1S0GA 2DCEA 1ZA7A 5HS9A 5A33B 5E16A 1Z7S2 1NXD1 2E9QA 2WDBA 4WZFA 2R7WA 1XJAA 1ON2A 1OCCH 3O1VA 3QH6A 1VE0A 4C8DA 3JCUC 5FJHA 4BQ1A 4LLOA 2WWSA 1AX0A 2WB1N 3ZXAC 4GKXA 4BDVB 3RRDA 4A69C 1A31A 3GBGA 3HN3A 1SLBA 4FI9A 4YG0A 4GH4A 4E7LA 5ANQA 3NKTA 2VL4A 1OF3A 3JW4A 1GT0C 5C8CC 4HNTA 1WMEA 3D3AA 1G3YA 1TWAJ 4LKSA 2XB6C 2VOVA 3APBA 1NLQA 3Q9OA 3HKZN 3JTHA 3FUOA 1YRNB 3C2HA 2WV0A 1Y1WJ 1JYTA 4NN0A 4P9LA 3RJPA 1U0AA 1HRV3 4Z2WA 4KMFA 1VFCA 1TE1B 3ACFA 3J7MA 5ABJB 3EYPA 4CU7A 3K3NA 3RWNA 4FETA 4AYUA 3LSJA 1ITYA 5CB7A 2VCMA 3NV2A 4AR2A 4HVQA 2QQ8A 1N3PA 1VQ9I 3K6GA 3S8PA 1NQDA 2VMEA 2Q8DA 4ZYHA 2L7ZA 1G6NA 2KA3A 2CV0A 2BZDA 4DNCA 3FLTA 1SLAA 3AP9A 3KP7A 2ZEZA 1PGL2 3A03A 2LRDA 1UU5A 2VE9A 1NG7A 1AYN2 3POYA 4DMIA 4YRVA 4G94A 1VQPI 3I54A 1R1A3 1V6OA 3NVCA 1OKRA 1MBJA 3ZXLA 5M5YJ 2ZJQF 5F04A 3BQZA 4JBAA 2XRLA 5DABA 5GLWA 2F4MB 1ODMA 3CCQI 1EY2A 4JQTA 3HM5A 4DBRA 3ETPA 1DQ2A 3HIFA 4AOCA 4YEJA 2EZKA 3ALQA 5H9PA 1IS6A 5D5VB 4WVZA 4EWEA 1VRH2 1WW7A 5FP9A 4ASKA 1PO13 5KWRA 4FFIA 2GU9A 3ZR5A 4F55A 3ZKYA 1CIYA 3FZVA 4F3JA 4RQPC 2P3KA 3S7IA 3JBG1 2EAAA 3QPTA 5E1WA 2DVAA 2O3FA 5CVUA 2ES3A 2EFNA 4PGHA 1OLQA 1JTYA 2DAOA 1B35C 5FZBA 1AL23 1W0OA 3H5RA 4AG4A 4OAZA 3RI4A 1R4NB 1S7EA 1F4AA 5B2GB 1ZM1A 3NJXA 3PSFA 4KICA 4P9XA 2W94A 3BTIA 1FPN2 5IVFA 3T0DA 3IAQA 1PO23 3WT3A 4GYIA 3IV5A 3M07A 4U7DA 4B4CA 1JI8A 3BTZA 2YBPA 2Y30A 3I53A 5KHKA 3H1WA 1OQEA 3WTSC 5BNGA 3B3QE 4LO6B 4NIGA 1WSUA 1I1EA 1AYN1 4W97A 3B7MA 1K4TA 1JHFA 2VKDA 4XICA 3OGSA 4XBNA 3JBG3 4YW1A 2X5IC 2DVBA 3I7DA 3MAJA 3R6SA 1OPMA 4QX7A 2ZJPF 1W8TA 3ZMUA 3KCCA 4JAAA 1BBT1 1MMNA 3K10A 2VPRA 3K4KA 2X4HA 3K3OA 5FP3A 5FZOB 1C5HA 3S1MJ 2L02A 1H9PA 3MKZA 2P81A 4J6GA 3WUCA 3C3VA 3S1RJ 1D4M2 2PHWA 5E8GA 2QTWB 3HVDA 4FOQA 1BR1A 2MA3A 4YW3A 2XROA 1L7QA 4MGYE 3HC7A 2GP5A 5FJ8J 2E2IJ 5JOZA 2P3YA 4WM7B 2EPFA 3KZ4C 1RUD1 5JOYA 1XG1A 1V3FA 2XH6A 1DBNA 2YYOA 2YPDA 5M3FJ 2EA2A 1X8MA 3J9SA 3PHMA 4JTNA 1XPWA 3HT2A 4LBKA 1GHCA 4K20A 4M3CA 2XR4A 1QOOA 1KU3A 2HWD3 3VD5A 2B9UA 1RI7A 5A7OA 2LG4A 3SFZA 1T2KA 2ZMNA 3TBIA 1Q1HA 5BNOA 2DMTA 3DP7A 2WL1A 2OZUA 4UOJA 5GTIC 4RS8A 2ADEA 4LHKA 1RXFA 1UZVA 3RFRA 5GAHJ 1AJOA 3H3LA 4RS5A 5FPXA 2IW5A 3CJRB 4BE3A 4IE7A 3I55I 4FASD 1BN5A 5FLIA 4XBQA 4OHZA 3AL6A 3ABMH 2I07B 3TWIA 3AMQA 1K5MA 4OI0A 2ICWG 1OFCX 4FCAA 1OI6A 4FXKB 3ABLH 1A35A 3QAHA 1R1ZA 2ELHA 5IYCJ 2FSWA 1IG3A 3PIOF 3SHFA 1SEUA 2DCKA 4GWIA 3DXTA 2IAIA 3K4JA 3MUY1 4CXYA 3PNYA 3QOEA 1YFWA 3WGHA 4LO5B 2E7QA 3S1QJ 1RUE2 2Z5WA 3ZFFA 4YFNF 1XC5A 5FREA 1EH7A 1W9FA 2JG8C 1XE8A 1E5IA 1J09A 3W5NA 4BQQA 1BIAA 1XNAA 5TJJA 3H7YA 3E6MA 4UFHA 2W00A 5AC92 4HLTA 4UV8A 4QX5A 2LYCA 4M9SA 4OHVA 5EDNA 4QU1A 5KAIC 2AQEA 2IS4A 4LO8A 3F8BA 1S0DA 1YTYA 3M9AA 2VIXA 2BHZA 1E0EA 2OBPA 3CJQB 1UU6A 1X4PA 4CDUC 5EGOB 3HB9A 3GX4X 2HWB2 3KT7A 2IA1A 3HYIA 1LPQA 2RN7A 4G9SB 1CZTA 3BZ6A 2YU9J 1H8TA 2XSJC 1PGSA 5APAA 5J4YA 1CONA 2XB0X 3KF3A 1S29A 4Q4X2 3ZXDA 4FQ4A 4PUSA 5EFUA 3ILFA 4DPNA 1F2NA 1O6UA 1VBC3 5E1RA 4KNCA 1YIOA 5FO9B 4O6JA 4HOBA 2RS33 2E19A 3POWA 2BE5F 2AENA 1XMKA 1CX4A 1PMJX 5EJ3A 2ZMKA 3B94A 4QDSA 4IPAA 3A21A 3JRFA 1HW2A 2GH8A 2VKVA 2R7RA 4COYA 2DA7A 4HEA2 4URAA 2VBBA 4YG2F 3OGGA 2MC4A 1YUDA 1UHMA 2ELJA 2JENA 1QA6A 2KPMA 4Q48A 1OCOH 2X85A 5D6EA 2RAEA 3WHTA 2XBO3 4RS5C 3GWZA 4XLEA 3TQNA 3AXEA 1CN1A 1H88C 5D5UB 5JSPA 4V2GA 1KD7A 1EV13 2VKHA 1BC8C 2WAQN 3DXJF 5TISC 1Z05A 5AVAA 2PTMA 2JDUA 3BU0A 4WWCA 2ISYA 2AGSA 4YM2A 2VR4A 4JKLA 1REEA 1F8VA 5FY4A 2XUBA 3EXUA 4OI2A 1UXXX 2JJ6A 1E3HA 4Y52J 1SD5A 2DK8A 2V1UA 4A3ZA 3BGAA 5FKOA 5ICFA 3EYYA 3MKLA 1GFF2 1XN7A 2R93J 1RJ8A 2ET7A 2BVMA 2LOOA 2R0FA 1RMU1 4PLOA 2WZPP 2O8XA 2DCJA 3DYPA 3FBMA 4QQ2A 4Y15A 1ETXA 4XZUG 2K9SA 1LJ9A 2L9RA 2KXLA 4W6WA 1WJCA 2X1EA 5EPAA 1IAWA 5LASA 2RDPA 1NOVA 2IP2A 4FTSA 2QDRA 1W2TA 5G05L 3RZJA 1AR63 4JHZA 4RLFA 4HW0A 5DCMB 4WM7C 3TL4X 1US3A 3FLRA 4H7MA 4GCVA 4FPKA 3Q9SA 3CL1A 2A6TA 4A6EA 4AI0A 1DIWA 3H3UA 1VQMI 2QYOA 5JR3A 4E4ZA 4MHRA 1HXS1 2EA4A 1SD7A 2ZNYA 1X50A 4PJ0C 3WUDA 4BZ4A 3ZLIA 3VBHB 1UY4A 1QNTA 3OBTA 1DGWX 1TP4A 2MSYA 1SLCA 4K21A 1ETOA 5EV7A 3GHMA 3SISA 2A6WA 4D7SA 5D5XB 1PX4A 2XMLA 1XU2A 3DPRA 2IXSA 3W6JB 3MD2A 1V0AA 2MEV2 1IN5A 2NYYA 5CKNA 2XGXA 2JG9A 4RS5B 4HF1A 2XAHA 1YE9A 2D6LX 2V9PA 3M70A 3HPHA 4AVTA 2DBIA 1LKXA 1UMQA 3LL7A 3IPVA 5M5XJ 3LPFA 1GSLA 4P1WA 1RUH2 3CTAA 1X82A 1YJ9I 2P17A 4OHWA 1IGNA 3EUKL 2QF7A 2GIZA 1R083 3MGUA 3P5BA 4M3FA 4XZPA 1R092 1SPPB 1IXCA 5J8CA 1VQNI 4QT6A 1U5TB 4BL0B 1YQ8A 1APLC 3L9FA 4XKCA 2LTNA 2BQPA 2LROA 4LKFA 4ES8A 1USSA 3BUCA 3VHOA 4U0VA 1H8TC 3WODF 1KJLA 4Q47A 2DU0A 4AI1A 5IK4A 2X6WA 3MPPG 5FZCA 1UAAA 1GV9A 3ZGKA 1UIJA 3GZ5A 2JG8B 3NWSA 4GWJA 1ULCA 1IPSA 3G3ZA 2XVKA 2BUKA 5LK7B 2Q1ZB 1TBXA 2HWB1 3I58A 4EM1A 3AVRA 2O7OA 1PJRA 4Q1PA 4KU7A 4META 1Y8RB 3N05A 2KD7A 1CZVA 5DDGA 3LF7A 2GAUA 2A5ZA 3S93A 4RB0A 2WNEA 3BN6A 2XJVA 4XAAA 1RB8G 3L00A 3NAPC 3ZFFC 1QJX3 3LAPA 1LE8B 3GTLJ 1NG0A 1UF2C 2HEWF 1STZA 1SD4A 1LHVA 2WQZC 1DFQA 2XBO1 3HOSA 5EIYB 2ZX1A 5H9QA 4PCRA 1S55A 3PQKA 5IYBJ 3C18A 1KRIA 1ASJ1 4MLOA 2K27A 1XE0A 1ZYBA 4LOSA 4JYKA 3H8UA 4XTPA 3WE2A 1HLVA 4CXWA 2H1LA 5B66C 4GH4C 2P3JA 3VZKA 4JDNA 2L0KA 4C1XA 2ET1A 4ZZ8A 5AIQA 2MPFA 1H2LA 4IEVA 1QOTA 1MZ5A 1YYNA 1JZ4A 5JVTA 1U8BA 3OYFA 5A70A 3ZXEA 3L2VA 4PT6A 3TNQA 4HPQA 4PBOA 3M1CA 1ONVA 4HAMA 3S2HJ 4M72A 5E89A 3MN2A 3DKYA 1YWKA 3LOBA 3WXPA 1H6YA 1E57A 5DD4A 4AVSA 5J1YA 1WRJA 4NHYA 1W9SA 1SMVA 1TMF2 5T3NA 1I6HJ 1MS3A 2W2IA 4NHKA 1IF1A 1OQYA 2IPQX 4E9KA 4MNUA 2MH2A 1C57A 3MDPA 2XC7A 3FBNB 4H14A 1REFA 2CL2A 4KBBA 1LENA 2EF6A 1W0NA 4XF1A 1A6QA 3AYEA 2A61A 1U0JA 4GMP1 2VBPA 4UUVA 1W28A 5KCMA 3V0AA 1F5JA 4ON0A 5EEGA 3AZVA 1PIV2 1HCRA 3SFIA 4QPIB 2HWF2 5CVIA 4IV1A 5F3GA 2OX0A 1XPXA 2YU2A 1CAXA 1RUE1 2RC4A 1PYVA 3I2IA 3R4KA 3T2PA 2RMU3 1MS8A 4AC0A 2XGCA 1HV1A 2R1DA 1XYPA 5BXXA 4A3FJ 4KGQA 4PI2A 5HDKA 4QXBA 2NAZA 4FCYA 1OH4A 1KDMA 1UOBA 4AFAA 1V70A 2FDJA 4CRQA 3CC2I 5ILUA 5K4LA 4X8NA 3NL1A 2EB7A 4A3KJ 1KGYA 1OVSA 2VC9A 3HEIA 4BQ2A 1PVC1 1GOFA 1GUIA 5JI6A 1P7JA 5A7SA 3AK0A 2JN6A 3BJ6A 2JWPA 2DVGA 3ECQA 1ORKA 1KA8A 2W87A 3T5XA 5HDGA 3CP2A 2P5BA 3POBA 2B45X 4IEYA 4W65A 3PVEA 2Y48A 1MJBA 1PVEA 5I93A 1MZBA 4CXFA 1FPN1 2E33A 4AYBN 4D1QA 4FPCA 2UY8A 4D94A 1B35A 3IB3A 4Y5TA 3BKZA 2PHFA 4XAEA 3PUIA 4F92B 1ONAA 5FOBB 3QP5A 2DPUA 3I3MA 2DDAA 5CLSA 3OR1C 3GDBA 1EPWA 3A01A 4EJVA 2OVUA 2DA6A 1W99A 4RD7A 3S3OA 1MMAA 4ISRA 2KQRA 3A0HC 3WNNA 3RZLA 5JLXA