4CYDA

Glxr bound to camp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
225
structure length
223
Chain Sequence
GVQEILSRAGIFQVDPTAVNNLIQDMETVRFPRGATIFDEGEPGDRLYIITSGKVKLARHAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSAVCVTEVHAATMNSDMLRNWVADHPAIAEQLLRVLARRLRRTNASLADLIFTDVPGRVAKTLLQLANRFGTQEAALRVNHDLTQEEIAQLVGASRETVNKALATFAHRGWIRLEGKSVLIVDTEHLARRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE TRANSCRIPTION REGULATOR
publication title The Crystal Structures of Apo and Camp-Bound Glxr from Corynebacterium Glutamicum Reveal Structural and Dynamic Changes Upon Camp Binding in Crp/Fnr Family Transcription Factors.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transcription
total genus 74
structure length 223
sequence length 225
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4cydA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4cydA01
4XFIA 4ZZLA 1U8RA 2DT5A 4YYOA 1H9TA 3GZ6A 2R7DA 2D40A 4YNIA 1KGSA 1SD6A 3F8FA 2GZWA 1ZG3A 3CL1A 1ZZBA 1U78A 2FMYA 4KWKA 3MYXA 2ELHA 1D8JA 2ZMEB 4XF0A 3QOPA 4PGGA 5I93A 5D4RA 1J0RA 1IRFA 4HZFA 4KWLA 3S7IA 5J8FA 4OINF 1MDMB 3H9AA 2COMA 2FQPA 3TQNA 1XE8A 3IKTA 3P7NA 3WU0A 1SMTA 5D1IA 4K2EA 4RAYA 1KU3A 3I0TA 2YPRA 3CUOA 4HV5A 1Z91A 5LLQA 2XLFA 2CG4A 1U3EM 4BH9A 2WWYA 1OR7A 3KSCA 5KBFA 1R7JA 2O0YA 3F23A 5CADA 5DUIA 3BB6A 4KIFA 1O7LA 2WV0A 4HV6A 3MZHA 3KMHA 3KEOA 1ON1A 4EJUA 5J3UA 2FEZA 4A12A 3EYIA 5FLHA 2DK8A 2MH2A 4LA3A 1Z1DA 3U9GA 3IWZA 3HSFA 1XDUA 1CAUA 3CF6E 5EFUA 4ASNA 4BYYA 4M6XA 4L9TA 2JTVA 1B9MA 4WXCA 2XHKA 1CGPA 4IRGA 4Y13A 1FSEA 1WI9A 3C1DA 3HRSA 2PFWA 5I0RA 1VTNC 1I1GA 3F72A 2VOPA 2VT3A 5BS6A 2IA1A 1CX4A 1ZX5A 4QX5A 2HQNA 1IUYA 5C8WA 3GFIA 3E3VA 2QYOA 4HF1A 2CO5A 1TQIA 1MD0A 3GO5A 2IT0A 3K1MA 4LLNA 4DQ2A 3EQEA 2XKPA 1NHAA 2W24A 2F5DA 2HZTA 2C6YA 4EJTA 4GYGA 5H20A 5D5UB 4HN1A 2GA1A 5E1XA 1ZRCA 4IEPA 3QAHA 3WTXC 2EFWA 1HW2A 2YR2A 1YW8A 2EV6A 3NRVA 3DP7A 2QQBA 3JSPA 2B8MA 2Q8KA 2XASA 2IXHA 3ABUA 1PUEE 1PDNC 3U0ZA 1YW7A 1U5TB 2NAZA 2A61A 4KU8A 2RN7A 4HF2A 5F64A 2IJLA 2LSOA 3LQRA 5BMZA 1ZZ9A 2YU3A 4LB6B 4WVZA 3BPXA 2Y0OA 3QPTA 4CDGA 4AIJA 2DO7A 4CYDA 5FGMA 1J3QA 4MUVA 3HT1A 4HSJA 2E7XA 3RDIA 5AONA 2GC1A 2VODA 1P2FA 1JHFA 2FA5A 4A0XA 1RGSA 1QO0D 3KP3A 3F8MA 4OOIA 2JPBA 3W6JB 1XDSA 4RGUA 1UHMA 1XMAA 2V09A 1YO5C 3I7DA 2A07F 1G3YA 3C18A 1X3UA 5KHIA 4P9UA 2JT1A 1YS7A 2AS5F 3KGZA 1CAXA 5LHIA 2JRTA 2K4BA 2MBFA 2PQ8A 4EJOA 1O3SA 1LB2A 1U12A 3RJPA 5CLSA 4IESA 4KN7X 4MTEA 3RKXA 4M73A 1TBXA 4YFNF 3UKVA 4IHTA 4N9HA 1FOKA 1UIJA 1QQIA 3EO6A 1OKRA 3DL3A 3PVBB 3FMSA 2M45A 5HVQC 3R6SA 4CGZA 2PYTA 1BI1A 2VBWA 4PDKA 4KFCA 4U7DA 4IEXA 1I27A 2PHLA 2JSCA 3EETA 4ZZDA 1ZRFA 3ELNA 4E2SA 2EFPA 3TGNA 4LFUA 3LSTA 2K27A 2XVCA 3V8KA 2HR3A 4MGRA 3QPHA 3HRUA 4HAMA 2XAJA 5I0TA 2M87A 1ZGJA 1Z6TA 4UBGA 2RGVA 4IEZA 1YWKA 1WGPA 2B9UA 4IEOA 1KU7A 4HSLA 1R58A 1J59A 4IEWA 5H6QA 3LZZA 3CJXA 4G7OF 3M1EA 3H50A 4HMZA 5K8SA 4UVBA 1EH6A 3BCWA 2IXJA 3I59A 3WW4A 2IRFG 3E97A 4GGGA 1YFHA 3IKVA 1GXPA 3ZMVA 2LF7A 2E1NA 1RZ4A 3QU6A 4HDUA 1YLFA 4KL1A 1F9NA 4OMYA 2VBZA 1S29A 1BC7C 5E1ZB 5L3BA 3J7AO 3DKWA 3NL1A 5LGTA 4HBNA 1CAUB 3E6DA 3MCZA 1QZZA 2K02A 3MAJA 4M6YA 2IXKA 3IL2A 1SFNA 4IERA 1O4TA 3M8EA 3RI4A 2HYFA 2BEOA 3E5QA 1VP6A 2OZ6A 3K1NA 3BU7A 1D5VA 4JTNA 4AXOA 3H7JA 5ICEA 3KP7A 4HOBA 2J5OA 1CF7A 4O6JA 1IPKA 3EQLF 4YFXF 1WLTA 2OBPA 3REOA 2HOEA 3E5XA 3KLOA 5HI0A 4IPAA 1UIKA 1YFWA 4U88A 2UXNA 1BN5A 1ODDA 3L2HA 2VECA 2QUFA 2WC2A 1J2XA 4FX4A 2TDXA 1DPRA 4HX8A 5JR7B 3WTYC 3D82A 4KICA 5L3EA 4Z82A 5DCMA 2V1UA 3WTSC 2BNNA 4L0YB 1ZHFA 3HHHA 5FLJA 5FDBA 3NKTA 1W7PD 4PCQA 2GAUA 3WTTC 4MEYF 1YS6A 2F2EA 1X7NA 3EDPA 5FD5A 4O3MA 2ACJA 1DUXC 2CAUA 5DYMA 3I64A 5LRSA 2QLZA 5HDKA 1IN5A 1BI2A 4L5JA 1IZ1A 1ZGAA 4F8AA 3IC7A 1J3RA 2QWWA 1K79A 4BHPA 1BM9A 3PFIA 5ILSA 3FX3A 4I02A 5ILUA 1I1SA 1UCXA 3TO7A 2VXZA 5ICGA 3ST7A 5FQ0A 1IRGA 4R8HA 4HBLA 4O9EA 2ETEA 1I5ZA 3KP6A 2VE8A 1CAXB 3ES1A 2IW5A 3WGIA 4XLPF 3MEXA 3OCPA 4EVIA 3QACA 1MJBA 2PTMA 4RB1A 4KUMA 1J9IA 3K1PA 5K5RA 2STTA 1E2XA 3O14A 3KZZA 1FNNA 2FE3A 2Y48A 2FOKA 1SEFA 4BQAA 1YW9A 2VN2A 2AXLA 3U10A 4I0BA 3CO6C 3GFJA 3NW4A 2L54A 2XUBA 4IRHA 2A3SA 5CVUA 2KIUA 2RVCA 5D5WB 4IF4A 3DXJF 3IRRA 4LEJA 1J3PA 5JVTA 3H7YA 1OI6A 1ZN2A 2MA3A 2GU9A 4AWXB 2P7CB 2V1DA 1BIAA 2KIFA 2PG4A 5HS7A 5JFRA 3BOQA 4I09A 4Q48A 1G3TA 1FI2A 3OGJA 1UCRA 1HXDA 3MWMA 3T5XA 3FXRA 1O7FA 4BHCA 3K9TA 5K1YA 2OA4A 3IBMA 1L3JA 3BP8A 4IEVA 4Z07A 3HTSB 3S2WA 3R0JA 3GW2A 3I59B 1B1BA 1BJAA 1X8MA 4Q0PA 4YIFA 5FLIA 2HKOA 2BBYA 3Q9VA 4G6DA 3V7SA 1G3WA 3NEUA 4ESFA 3RKWA 3OD0A 2H94A 3MFKA 1K78B 1F5TA 4QWQA 2EB7A 1YYVA 2PLYA 1R1UA 4MQ9F 1ZREA 4ORFA 3PQKA 3ERED 2VT2A 3WU1B 4HX7A 2Q30A 1V70A 3RZZA 3WTVC 2D1VA 2X0LA 2QVSB 1RI7A 3TDUC 1DGWA 2F5FA 1XSVA 3T8TA 5BPIA 1RTVA 3JZVA 4OLLA 2PFBA 4PIZA 4Q5SF 2D5FA 2LKPA 3J80Z 4LG0A 1SFUA 2V1XA 1USTA 1NYWA 5JR3A 2Y0MA 4AVAA 3SXWA 2XROA 2O61A 5L3GA 4JBAA 1B59A 2EA2A 2J5PA 2GH2A 1CF7B 4PIYA 4PZJA 1FXZA 3SCHA 2FBHA 1OFNA 4GYIA 2ATFA 2B5HA 2A5YB 2EAAA 2K86A 3L2CA 3TOAA 1SFXA 1BI3A 3SCFA 3HUGA 2W84A 3GYDA 2HKXA 4EM1A 2OPKA 1MJ9A 4YRDA 1Q43A 3U11A 1DZRA 4ZU4A 2RC4A 1X8EA 1KQ9A 4J1XA 4ZU7A 4MGYE 2Q1ZB 2DK5A 2MNGA 2MLKA 4S04A 1XRUA 3FXQA 5DCMB 1L0OC 3ABTA 3LFKA 4META 4AVPA 1GHCA 2H27A 4LJZF 4CXFA 2GXBA 3ZN0A 4OIQF 2EK5A 5BPDA 4Q0QA 2PHDA 3FHZA 4M72A 2ESHA 4I2OA 1NE6A 1Z05A 2R3SA 4G6QA 1Y0UA 2ZNZA 1FZPB 1IN7A 4EM2A 4OMZA 3FM3A 1O3QA 2KRFA 3GUDA 3KP4A 4RB2C 2G7HA 2VE9A 4LTAA 1EY2A 2CGPA 3LAPA 1O3TA 3GLXA 3WODF 1Y3TA 1KU2A 1S6LA 4ZYHA 5KHGA 1B6AA 3RKYA 5FQ0B 5FB2A 1XD7A 1FSHA 3QP6A 3ELKA 1LNWA 1W7PA 4IETA 3HSRA 5D5XB 2DW4A 3WTUC 4MV2A 2HJIA 2UYAA 4QM8A 2FRHA 4D7SA 1SAXA 4IRIA 2O8QA 4XRFA 5FPXA 1O57A 1YHFA 3F22A 2PI0A 3KCCA 5E16A 3GX4X 4LMYA 2FBKA 4HVOA 2STWA 4JQFA 3KFWX 1S7AA 1L3LA 1CAWA 1FYLA 1W4MA 2RKHA 4CZZA 4G7HF 3FFQA 5JCTA 3RYPA 1XGMA 1DGRA 1FWZA 2XV4S 4P9FA 4A2UA 1QBJA 2ISZA 3VB2A 3ZN1A 4A0YA 2MD5A 1QXJA 1HKQA 1J75A 2Y75A 2RV8A 3ISPA 3LWCA 2IVMA 3LA2A 1OMIA 4L0ZB 3K0LA 2EVXA 3FHIB 1TW3A 2NRAC 3QP5A 5ED4A 4QGNA 1ZZ7A 3FZ3A 4GO1A 1YFUA 3ACLA 2A6EF 4CHUA 2NYXA 4MHGA 2ZFWA 3LA7A 3BY6A 1RIOH 4S05A 4OIOF 4HW0A 4CICA 5I8YA 2OAZA 3P9KA 5HOOA 4FAHA 1F4KA 4UV9A 1R1VA 2PAEA 4XFAA 3RYKA 2ET1A 1IN6A 1ZZCA 3NSTA 2ESNA 1XE7A 1SD4A 2ZXJA 3G7DA 3I54A 2PN6A 3P9CA 2QQAA 1P4WA 3IDCB 2W57A 1FP1D 3F21A 2GXGA 2VONA 2HS5A 2P8TA 4NQWA 3MPBA 2HTJA 2V79A 2K9ZA 4WWCA 4DNCA 1SD7A 2CAVA 4XEZA 3VODA 4I7HA 1LEBA 2ZO4A 4BNCA 2PJPA 5I8SA 5FLXK 2IPQX 3E6BA 4QLCU 1IXCA 2ZKZA 2E1CA 1LVAA 5DUKA 4L18B 1WSUA 4ENJA 3V8JA 2CSOA 2P17A 4M9SA 4B29A 3BJAA 1ZYRF 1BIBA 1DP7P 2FBIA 1ZLKA 2HFHA 5HLHA 1X82A 1ZRRA 1LQ1A 2OU2A 4I98B 3GVAA 4I01A 2PBIA 2UXXA 4FBFA 2XAQA 2NS0A 1J7KA 2RDPA 2H09A 3BPVA 3PNAA 1GQGA 4Q29A 2GC0A 3WW2A 4J1WA 3WTZA 2OA2A 1S8NA 1SFEA 3CLOA 1UB9A 3AAFA 4XF1A 5BUVA 2QVOA 1W5TA 3EYYA 4LLOA 1V4RA 3BPZA 1UD1A 1YTYA 5JHUA 3M3IA 1BI0A 4UHTA 3HOSA 4MNUA 3N4MA 1LR5A 4JK1X 2XAFA 5KHHA 1QPMA 2VBXA 3L09A 5FPZA 3K2ZA 5JSPA 3B73A 2QZ8A 1ZG5A 5ILVA 3DV8A 2OQGA 4E2GA 3VFZA 3NJZA 2P5VA 2HEOA 4UVAA 3SQNA 1R23A 2ISYA 1TQMA 1TW2A 3E5UA 3F8NA 2L3DA 1W7PB 3IIAA 4R1HA 3ZMTA 4B8XA 1OYWA 4NHJA 1OPCA 5ICCA 2X4HA 5L3DA 2DBBA 2O3FA 1O5LA 4IVNA 3NVCA 1G3SA 5AIPA 1TNSA 3FE5A 4R52A 4UUVA 3SMHA 3C3WA 5D6FA 2WFPA 2DU9A 2XAGA 1XSDA 1CAWB 2IP2A 3U2RA 2Z3YA 1REPC 5FCCA 4MGKE 3V7RA 4RGXA 4JTOA 3G3ZA 1T98A 4LUMA 2WTEA 3RTRA 3KZYA 2EFOA 4JV4A 1EV7A 2DLLA 4RAZA 4YFKF 4M9ZA 2VPVA 4FX0A 3RIRA 1ZZ6A 4GULA 3FXUA 4QGLA 4BXUA 1JHHA 1MGTA 2XL9A 5FLXZ 2XIGA 4ESBA 1MDMA 3M8FA 3ZQ7A 5D8KB 2P5KA 5EEGA 5BXXA 3TO9A 4HVRA 2HTSA 4ZU5A 4FAGA 1XGSA 1RNLA 1IXRC 1C0WA 2GC2A 2M5WA 3T0YA 1OYYA 3D0SA 3T1BA 2PA7A 1GVJA 5E20A 2EV0A 4XF3A 4ENKA 4NVPA 5E18F 3K69A 4D0PA 3J80K 4M9XA 1JE8A 5H6RA 5JAXA 4HX4A 1FT9A 5CVVA 3KGLA 2XRNA 1SQ4A 5LHHA 5CYVA 1D3YA 2DCTA 2PQQA 1YQAA 2D2WA 4ZYEA 1Q1HA 1WWXA 2EFNA 4YSFA 1PMIA 3SHRA 3I5UA 2OQRA 3COAC 4EROA 1B9NA 4OIRF 2QNKA 2K4JA 1YG2A 4L2NA 5LRRA 1W5SA 3DN7A 1FPQA 4HYEA 5CU1A 4XF4A 2R7FA 3ZMZA 1AOYA 1T38A 2VOOA 3DQVC 3IWFA 5I91A 4WXDA 3DF8A 3F8BA 4UV8A 5IT3A 4B09A 1IAWA 5LBQA 3BZ6A 4KMFA 2XGXA 5KHKA 1ZARA 6PAXA 2L02A 4EGYA 4EWAA 3HT2A 3VEPA 4XFHA 2XLGA 1Z7UA 4QMAA 5TJJA 1XMKA 2PMUA 4MQVA 2P5LC 2IA2A 1GQHA 3UKNA 2HWVA 3EBRA 4GCVA 2C0ZA 3R61A 1KYZA 3WGGA 5HS9A 4WK8F 1OYIA 4GXOA 1JUHA 1U5TA 2VC0A 4P5OA 2CW0F 3OF1A 3LQQA 4U0WA 3MQ0A 1QGPA 2I45A 1DZTA 5KHJA 5DV5A 2LNBA 2Z99A 3R4KA 2OYZA 1ZG1A 1R5HA 1BOAA 2VC1A 4D7TA 3CO7C 4N9IA 1P92A 3GFMA 3F3XA 2A68F 2L4AA 5IT9K 3H1YA 3JSOA 3R60A 5DEQA 5JSOA 4MGZE 1WKMA 1R1TA 1D8KA 1LKNA 2P4WA 2KIMA 3MZYA 2FXAA 3KLNA 3SHFA 4EJVA 2F5EA 1J5YA 2ADUA 2BYVE 3CJNA 2EWNA 2Q2EA 4WXHA 4K8FA 5DDGA 4PJYA 1KU9A 3USSA 1CAVA 5CVRA 4JVAA 1P4AA 3SZTA 2IC1A 3EUHA 3PLQA 4A0ZA 2G7UA 4LD5A 2IXCA 3I71A 1E17A 4F7ZA 4XFFA 3J81K 4QM9A 2NNNA 1BBYA 1Y9QA 2PEXA 4EQQA 3M9AA 4U0VA 3G73A 1Z6RA 1NE4A 3HYIA 1WQ2A 4MEXF 2JPCA 3ECOA 3BDDA 1R36A 4AIKA 2UZKA 4IJAA 1SD5A 3HIFA 3CLPA 3UKTA 1T6SA 2JZYA 4OFGA 5I8TA 4WBBA 4U7BA 4KMUX 2ZCWA 5I0SA 3V4GA 3L9FA 3ZMUA 1NZCA 2QBYA 2IA0A 3BJOA 1R00A 3RPQA 2CQKA 4I0AA 1XSXA 2N7GA 2Z69A 1EP0A 5CVJA 4A6EA 4BAYA 4XFGA 2H0VA 5D8LB 3TDZC 2YSRA 1K6OA 1ULYA 2ZJ2A 3ROUA 1XN7A 1LRHA 4Q0UA 4RB3C 5D6EA 4YG2F 3Q5FA 4XETA 4G8XA 4N0BA 4KNYA 1A04A 3H3ZA 3WW3A 2XAHA 4ZH4F 2QCSB 4BIFA 1HKTA 1IXSB 4LB5A 3HRMA 5FD6A 3HQXA 3RNSA 3ZMDA 3C3VA 2EFQA 4PGHA 3CUQA 2W25A 3WG9A 5BY5A 1JGSA 3WE2A 3LOIA 1TQ5A 1ZVFA 5IT9Z 4LK1F 2HYGD 4ZYGA 2UY9A 3W6KB 4CO8A 4LLGF 1ZLJA 4ENMA 2GC3A 3CEWA 2OZUA 4ETSA 5AVPA 1HSTA 4KYWA 4QGMA 1RL3A 2BGCA 4H7LA 3TO6A 3H1MA 4FT8A 4WZCA 4L11A 4EWEA 3E6MA 4FHTA 4L9JA 4KIGA 2MPFA 2UYBA 5LGUA 2B0LA 1R22A 1H1IA 3GF2A 2M8EA 4EV0A 1RUOA 2OZJA 5EZWA 4LULA 3FJSA 4EJWA 2CFXA 4HVQA 2OD5A 2A69F 4MZUA 4IEYA 4G94A 3J81Z 2CYYA 2KXLA 4UXAA 2P6SA 1YLLA 1HW1A 2Z33A 4ENNA 1PM7A 5CVIA 1MJAA 5C6CA 4ON0A 5KK1A 2H6CA 1O5UA 3KP2A 4LK0F 4EGZA 4ZYDA 3FMRA 2F4PA 1U6GA 2FNPA 3H8UA 4AVBA 1P4XA 4G7ZF 2EA7A 2L01A 1ZAOA 4Q0SA 5D4SA 4YIIA 4EM0B 4WCGA 3KE2A 3TKYA 2QM3A 4P9GA 3SCGA 1USSA 4RB0A 3ECHA 1ZNPA 2BNMA 2A6HF 1LDJA 4LA2A 5HDGA 4HQEA 5ICFA 4IEUA 2GIVA 1FP2A 4KN4X 1YFYA 5HLGA 3P9IA 4OIPF 1MZBA 4LG0B 5T3NA 4RS8A 1UFMA 1QNTA 3ULQB 2Z9OA 3DEUA 5BOXA 1K7AA 4MTDA 3S7EA 1CAVB 4RGSA 3SXYA 2CWEA 2DAOA 4HQMA 4H0EA 4HA8A 1XCBA 2Q0AA 2MH9A 3HOTA 3B02A 3M7GA 3OV8A 3WGHA 2Z2SB 5K5QA 3ZDSA 4KA4A 1G4DA 4A5MA 1B4AA 1YUDA 1J1LA 1GXQA 2QENA 2ZKLA 2UWMA 3JTGA 5TRDA 3CTAA 3IHUA 2LF8A 2DTRA 2HQRA 4R79A 3WTWC 1H0MA 2MHFA 4ONUA 2W85A 3F8CA 4KIBA 5LHGA 1RC6A 5J8CA 4XFBA 4AQ2A 3SZPA 3WE3A 2G9WA 3O6BB 5JI6A 3BWGA 4L5IA 3FM5A 3SFZA 3V7CA 3QRFF 4WF2A 1QY4A 3GWZA 1HSJA 2GWRA 4M71A 3PQJA 4G9YA 4LLLA 4IHSA 1LJ9A 3RPUA 1V3FA 2FNAA 2QBYB 1YFXA 5LGNA 3ES4A 1KQ8A 1HKSA 1XGOA 3GYHX 3C7JA 3Q9SA 2XL7A 3KEQA 2V6CA 1FX7A 1QXRA 3ETQA 1STZA 3F6OA 3FMQA 4A6DA 5HS8A 4Q4ZF 2K0GA 3QU3A 3DPLC 1UHWA 1ZH5A 3KETA 1U5TC 5E1WA 1MKMA 5FFXA 3CO2A 4X6QB 1J58A 3IRQA 5LEJA 2IXLA 3O3KA 4XF9A 1K78A 1BC8C 3VHRA 4L9NA 2EJRA 4AVCA 1XB4A 4AIHA 3JAMK 3H3UA 2FU4A 4YARA 3I4PA 4HLYA 3EHKA 3D0JA 4P96A 1EYBA 1IF1A 3CUQB 4M74A 4TV7A 3FZVA 5HLIA 2M30A 3WW1A 1ONVA 4KT5C 3ZPLA 1LEAA 4XFCA 5FFZA 4XSZF 2BNOA 2FF4A 1JXSA 2VQAA 4KWJA 1ZZ8A 4MH0E 3H1WA 4Q47A 4HLXA 5L3FA 2YX7A 3BALA 3LA3A 5E8GA 2H6BA 3LAJA 3N97A 2BE5F 3EJKA 4LGWA 2FMLA 2XLAA 2KJBA 3HRTA 3GBFA 2M1BA 3U1DA 2FQ3A 4L9VA 4Z2YA 4MGIE 3HSEA 1XGNA 2E7WA 5BPXA 4RGRA 4DINB 2QDRA 2D5HA 2ZMEA 1PP7U 1S3JA 3R0AA 2O03A 4O9GA 2P7VB 2Q4SA 1NXMA 4QXKA 2VBYA 1KYWA 5DCFA 4AQ6A 1H9GA 2O1QA 3L00A 4XBFA 3IDBB 1UW8A 1IPJA 2PAMA 2LDUA 5EEHA 4OU0A 1AWCA 4I3PA 5A2QK 1HQCA 1FC3A 5HDNA 1LDDA 4EWDA 3MDPA 2ZBKA 4XSXF 5E8IA 5BV6A 1IW7F 1DPUA 1T0FA 3RYRA 1KQ0A 5D5VB 1DDNA 1EH8A 4TLFA 2E9QA 1T39A 1XCVA 4UVCA 4KU7A 2PMHA 1OD5A 5I0UA 1ZRDA 4KDPA 1WA4A 3FWEA 1P6RA 5BQTA 1SMYF 1EPZA 2ZNYA 2BV6A 3O2PE 1VJ2A 2O6GE 5E17F 1FBQA 1QZYA 1I6XA 5DD4A 1TNTA 3HTUA 3JTHA 2L4MA 5JSRA 4O5VA 5J7MA 2K7LA 2DQLA 2D1HA 5AIQA 2PAKA 2QJVA 3I53A 3E6CC 1KA8A 2IXIA 5J48A 3LWFA 2YX4A 1HW5A 3S0MA 1O3RA 5KVRA 2HGCA 4HF0A 1ON2A 1FY7A 2EA4A 3CDHA 3JAMZ 3L7WA 1IN8A 4ESJA 1EH7A 3CUQC 4IEQA 1T2KA 4Y15A 4RD7A 5F6FA 3D5LA 3GZ5A 2DPDA 5LEKA 2KJCA 3DFGA 5L3CA 3M70A 2P6TA 4UXNA 5J6XA 2F5CA 4Y17A 1QWRA 3H92A 4EMSA 4MX3A 3OOPA 1HBXG 3KP5A 1TTYA 5FO5A 1TLHB 4U0YA 2UY8A 1G6NA 4BHBA 1F1ZA 1FBSA 3NQOA 4HLTA 4WX9A 4X6RB 1PP8F 1Q3EA 1YIOA 1UPIA 1Z9CA 5ERIA 2ETHA 3T8RA 3F6VA 2D45A 4UBHA 1Q5OA 3TNQA 4P55A 3JW4A 1IN4A 2RQPA 2DPUA 2KKOA 2FSWA 3BJ6A 3BROA 1R5GA 1RUNA 1FBUA 3LAGA 1H1MA 4HN0A 5E1RA 3GEZA 1VR3A 2V9VA 4LUKA 2HDCA 4HDVA 2DFIA 4IXAA 2NNYA 2Z5UA 4AD9A 5K5OA 3ZMSA 5A2QZ 4A5NA 3GXOA 3ML6A 4UNOA 1S7OA 4E70A 1LDKB 3I58A 2DQRA 2CV6A 3FF5A 5CJ9A 3GFLA 4PIXA 2O8XA 2QQ9A 2D93A 2XKOA 1WRJA 2MLGA 3HHGA 2Q0OA 3DPTA 2DI3A 2GA2A 2MC3A 3V8LA 2GQQA 5F1RA 4Q0VA 1U2WA 1FYMA 1TQPA 2RNJA 2EV5A 1FLIA 3TNPB 3TOBA 4NB5A 5DD8A 3ZP5A 4E2QA 1FYKA 3OTFA 3VOEA 4XLNF 2ET7A
chains in the Genus database with same CATH superfamily
4XFIA 1IC8A 2JENA 3CJQB 4YYOA 1ZKGA 4XCAA 3VBOC 4C2MJ 4M3EA 4YNIA 3X29B 3D8CA 4YW2A 3MO4A 2V6EA 3KHCA 4PSWA 3HOWJ 2J1TA 2WT1A 2FDIA 5M5YJ 4LG3A 3MYXA 5EZGA 1YXWA 3QOPA 4PGGA 2O0OA 1OKOA 4F3QA 4AOCA 1IRFA 4KWLA 3ASIA 1VMJA 3S32A 3H3LA 1SG3A 1W5CC 1PK6A 3IPVA 3IKTA 2Q8OA 1JN2P 1SDDB 2E34A 3DYMA 2LS6A 5G04L 4K2EA 5IK5A 2WSVA 4JKKA 4HV5A 4W50A 3WQ0A 2XLFA 3OGSA 4W65A 2WWYA 1OR7A 2LP0A 3PTYA 4XLEA 3F23A 4CEWB 4D0QA 1TMF1 4HV6A 1WLCA 3KEOA 2XBO1 2BHYA 3TP3A 3K46A 2FDFA 1VAKA 3GTOJ 1Z1DA 3U9GA 3IWZA 1A8DA 5HCFA 2BVVA 5KNLA 4ASNA 1HQLA 1WHUA 3WV6A 4B7KA 1MNDA 1YQ8A 1B9MA 2XHKA 4Y4RA 5I0RA 3PO3J 2DCKA 3F72A 3AMQA 4L9BA 1CX4A 1ZX5A 5C8WA 4P9XA 3AL5A 3ZYIB 4HF1A 4DRVA 2CO5A 4KGGA 1OQEA 3F2ZA 2SLIA 1HDKA 4G12A 3LOBA 4N43B 1T8IA 2F5DA 2HZTA 4KI5M 1BL0A 2WFF1 4FP3A 4IEPA 3QAHA 3GTKJ 2YFUA 4OCTA 2YR2A 3SH5A 1YW8A 3AG3H 4DXRA 1OCTC 1K5MA 4YM1A 2QQBA 3KV4A 5JXIA 5JI7A 3I3EA 3MV01 3ZSEA 2IXHA 1PUEE 4YM0A 1U5TB 1W6PB 5GP9A 3ACHA 3CP2A 3Q3SA 2PMWB 1LOBA 4YM3A 2ZZJA 2ORXA 4W4ZA 2DU1A 4BDVB 5KAFC 2WNVB 2GBYA 4LB6B 3HPGA 3J7AY 3CC2I 4CCOA 1U5IA 4CYDA 4XBNA 1J3QA 1JYTA 4Z6YA 3U07A 2VODA 4QKBA 1JHFA 2VGDA 1FOYA 4A0XA 2YU1A 3OYJA 2HWF2 3W6JB 1S55A 1OBNA 4C3JJ 4RGUA 2ZJQF 1XMAA 2V09A 1YO5C 3I7DA 2A07F 1G3YA 1X3UA 3ACGA 2YU9J 5FZDA 1VBA1 4P9UA 4XTPA 2EXKA 1DQ6A 4A69C 1BR4A 1DCSA 4MYEA 4QU1A 4Q5OA 2OXBA 2Z16A 1O3SA 2Y64A 5IVBA 2HYXA 3RG0A 3RKXA 4M4RA 1Y8RB 4IHTA 1WW4A 3HN3A 4N9HA 1EUUA 2IZWA 5JXJA 4UUTA 5C4XJ 3KT7A 3PVBB 2Y26A 4P00B 2QQVA 3R6SA 5LZ6A 4PJ0C 2VBWA 3USUA 4RFT0 2BW8A 4GFBA 3SDBA 2IWGB 2FUG2 4BQYA 4DPNA 1DLCA 1X58A 3K70D 2COBA 2PHLA 4YFZA 3EETA 3ELNA 4ZZDA 4JYKA 5FYCA 4E2SA 3W5MA 2E53A 5AFEA 2K27A 2XVCA 2QSHX 2HR3A 4MGRA 3HRUA 1ZGJA 2W0XA 1RYYA 3MLKA 5LBFA 5GZDA 1YWKA 1XG1A 1SBFA 4BISA 3IDAA 3OBZA 3GCMA 2R061 4QHOA 1V9U3 3SH3A 3M1EA 3BCWA 1WLDA 3I59A 4ZXEA 1QJY3 5F3EA 3GTJJ 1IG3A 1VBB2 2DFHA 5F8PA 1TEIA 1KS5A 3OIOA 2VBZA 3NJVA 1R1A3 4LK7A 1Z7S1 2P3KA 2Q8EA 3LOCA 4QPYA 2GN7A 1MH4A 1CAUB 3FXLA 4D7YA 2OC6A 1ULGA 4UOJA 3AJYA 5FJKA 1LHVA 5IAVA 1RJ7A 3UNGC 4MLOA 4AM3A 2HYFA 2BEOA 1UOJA 2OZ6A 1NK3P 5AFBA 4M3FA 1R5ID 4XZPA 3NQHA 4ANJA 4AXOA 4HOBA 2HBTA 4AYUA 4O6JA 1RUJ1 4E4HA 5FP3A 1WH5A 3UK9A 1EPWA 1NY72 1S0CA 4BOWA 1YFWA 1IHMA 3T08A 2VECA 1J2XA 1XNTA 4HX8A 5JR7B 1ALYA 3N05A 1QZEA 1RUF2 5DCMA 3ZXDA 1Y7BA 5JOYA 1RKTA 4L0YB 5LBEA 1D7PM 4QPQA 4NR1A 4Q1PA 4CDUA 3H0DA 4PCQA 4BU2A 3HKZA 4COZA 4AG4A 1Y56A 2F2EA 5HPOA 3EDPA 1WKYA 3I64A 5HV4A 1OA2A 5HDKA 1W9SA 3AYCA 2BY3A 1IZ1A 1BBT2 2EH3A 3GDBA 3FK7A 2PLV2 1KEXA 4MO7A 1BM9A 1W8NA 5JOWA 1RETA 1WCSA 5ILSA 1A35A 2EALA 2HEVF 5ILUA 1I1SA 3ZPYA 3KHBA 3TO7A 3CQZJ 1ZA4A 3ST7A 3PUAA 4HBLA 3LDBA 1I5ZA 1W9YA 1YX3A 3GHNA 4GQ7A 1B35A 3KZ4C 2D44A 3ES1A 4BZ4A 3WGIA 4M01A 1D0XA 1R081 3T0DA 1PMHX 3OCPA 4EVIA 1X1CA 4AEDB 4RS5A 1QNYA 2FQ4A 1MMGA 3BTIA 3K1PA 5K5RA 2STTA 2CDOA 1WMFA 5JUVA 5CA6A 3B00A 1WLWA 3ITQA 2EF6A 2FOKA 1SEFA 3LPFA 1YW9A 2H0BA 3U10A 4I0BA 4RGGA 1QJU1 3NWSA 3OUIA 2ZEXA 4DZJA 5CVUA 3AL6A 1GP5A 2RVCA 4XBQA 4IF4A 3DXJF 1W0TA 2VO5A 1FOD1 3GTMJ 1RHI3 3H7YA 3DPRB 2GU9A 2P7CB 5C33A 3OR2C 1BIAA 3SFIA 5CFDA 1ND3A 3LGRA 2XJQA 5HS7A 1WJDA 2GDFA 2L7MP 3S1NJ 4I09A 3R4UA 4Q48A 3OGJA 1UCRA 5M0TA 3W3CA 4ZS3A 3T5XA 3FXRA 5BNOC 1UN1A 5HNFA 3PMSA 2OA4A 3M8JA 5A7SA 1GKBA 5C70A 4IEVA 4COVA 3OYGA 2CV0A 1WGXA 3R0JA 4HPQA 5J1RA 4E7JA 1MEC3 3IAS2 4HEA2 4YIFA 1GVDA 2HDWA 1G3WA 3NEUA 2BGPA 2M9HA 3OD0A 2H94A 3MFKA 4QDSA 1BMV1 3H5NA 5CFCC 1R1UA 1V6KA 2A6ZA 4ORFA 3VBUA 3PIPF 3MI8A 4UWDA 1LKXA 3H35A 2Q30A 2RVAA 2H8RA 2QTWB 4CDXA 1RI7A 1JKQC 2XH6A 3TDUC 4EN7B 1MH3A 2VXRA 1JHNA 2PFBA 3OPZA 4PIZA 5A7PA 4BE0A 4NAMA 5DZFA 1NH3A 2Y0MA 3U4XA 2YBKA 4PQ9A 2EA2A 1CF7B 2ZX0A 4Y22B 4PZJA 1AX2A 1EAH1 3SCHA 2HWC1 4RA2A 1OFNA 4GYIA 4UFIA 3OIPA 2EAAA 2P3YA 3DXUA 2K86A 1ZA7A 3L2CA 3B94A 1SFXA 1BI3A 2CTVA 1JW6A 3SQOA 4EM1A 2WN2A 3MFCA 4KH9A 1OLMA 4ZU4A 1Y6IA 1N1VA 4KMQA 2BRTA 3GTPJ 4N53A 2R93J 5H9SA 2R7EB 2AREA 1JI8A 2V5DA 1W6OA 1XRUA 3JD71 4AK3A 4L8QA 2FBEA 1GHCA 5T52A 4LHLA 2XVKA 5T50A 4YG3A 2W1UA 2JB4A 2PHFA 5IOZA 4KJZA 2EK5A 3MUY1 3FHZA 3VBFB 3H36A 1NE6A 3C2UA 3A0HC 1W06A 1Z05A 2NVXJ 3PVOA 4OMDA 4XDPA 1V6OA 1J09A 4OMZA 3WT3A 2MABA 2KRFA 3GUDA 2JG9C 1QU0A 2VE9A 4UFJA 3LAPA 1O3TA 2ARXA 5FPUA 5FY7A 4LHKA 3VSKA 1Y3TA 4NHLA 1S6LA 2VQCA 1RXFA 2WR9A 3RKYA 2TRTA 5A6QA 1WVRA 4IHVA 3FBMA 1W7PA 3VZJA 3Q8FA 1PIV1 3JB4C 3I2JA 5DM7F 1LULA 2HJIA 1OISA 2FRHA 2O8QA 2UURA 1O57A 1YHFA 3F22A 3IN9A 1Y4WA 2PI0A 3J4UH 4D6QA 4EN0A 4HG6B 3LSJA 4LMYA 5BNGA 3KFWX 3T2PA 1S7AA 1L3LA 5HODA 3OS1A 2BZTA 1FYLA 3VDCA 2RKHA 1QJU2 3VN4A 4CZZA 2RS53 1VQPI 3VWBA 1DQUA 5IK7A 4OMCA 4A2UA 3AMNA 4CP9A 2AUYA 3CZJA 3FMGA 3O1UA 1ZR4A 1QXJA 3OD4A 1RUG2 2Y75A 5EGOA 1WA6X 2OX0A 2VG9A 4BLIA 2WZR3 4NRMA 2X09A 1V6NA 3ABLH 5C7GA 2NOGA 4QPIB 3OYMA 2AQFA 3JB8A 2RDRA 4XE9A 3NAPA 2BVMA 4QGNA 4GO1A 5EJ1B 2JDHA 1V6IA 2JUGA 1GQPA 2A6EF 1MNMC 5KXCA 2NYXA 1O4YA 4Y5Z0 3LSHA 4A3EJ 5L9BA 2KFDA 4ISQA 3OSDA 2ZXQA 4S05A 4CEYB 4QTRA 4UI9L 3TAYA 2D6MA 5HOOA 4FAHA 5EEAA 3KYLA 5LA1A 1NXD1 2D6NA 3MW4A 2W94A 2IAIA 2BBVA 2DVGA 4XFAA 3RYKA 2D6KA 4W6XA 1JS9A 4LO6B 1AR81 1EV11 4YM2A 1SD4A 3I54A 2VTXJ 1RUE1 1UYYA 3P9CA 1NCRA 2V4AA 3NNFA 3JRHA 3ZQFA 3H8OA 4JRLA 4XIOA 2JG8B 3B69A 3BOPA 1S7EA 4WWCA 5EWSA 3VD3A 2CAVA 2Q1MA 3DKYA 3KIOA 4WVWA 2K85A 1ETOA 2ZO4A 5I8SA 1NCQB 4LNVA 3RZOJ 3D1NI 2SBAA 3AKPA 4QLCU 3I3DA 3O0WA 3L2UA 1LVAA 3BG9A 4CDQA 1W3XA 4ENJA 2ZHKA 4BK4A 3OYWB 4RM3A 5A3OA 2RR11 2VJXA 1BIBA 4XW3A 3WCRA 1W8OA 5JLXA 4Y1YA 4DOZA 1KRIA 4XOGA 2F48A 1ZRRA 2YPDA 4I98B 2VVDA 2PBIA 2UXXA 1WZXA 2GNTA 4FBFA 3BPSA 5FZ9A 1J7KA 4FFFA 3BPVA 4K1ZA 4A7KA 2VW1A 4Q29A 3VBHC 4AF9A 4HFSA 2IGKA 4CRQA 2XB0X 3ZSLA 4C3IJ 1SFEA 2KRHA 3NV4A 4OZOA 4A44A 3K2AA 4RQPB 5BUVA 3H0OA 2R7OA 5J1UA 1UD1A 2M0CA 3M3IA 4PDWB 4UHTA 3SEQA 1VQ7I 2XPJA 5EPAA 1QPMA 1OC1A 3PVNA 1UNBA 3K2ZA 1ZG5A 1C57A 3DV8A 2IXSA 4E2GA 2YGMA 3SQNA 1W2OA 2WWJA 2HLEA 1TW2A 3E5UA 2DURA 5IY5H 1XX5A 1AU7A 5FREA 3VBRA 1N3QA 4CU9A 3ZMTA 3CCQI 2FDHA 4B8XA 1OPCA 2X4HA 5FYSA 2R16A 2DBBA 1AJKA 4IVNA 3NVCA 1H2NA 2ECBA 3LSEA 4A3IJ 2L7KA 3TN91 4UUVA 1GOFA 1UZWA 2HWD2 2DU9A 2JN6A 1XSDA 4K1YA 3N9LA 5B5EC 3HPNA 3HL2A 3V7RA 1Z7S3 2VE1A 2M7AA 2WTEA 3KZYA 1E5HA 1TZOA 3O1MA 2E1MC 3HOYJ 2KRCA 3K10A 1BJQA 1AR91 3FLPA 4FX0A 3FXUA 4BXUA 1AHDP 1JHHA 2CQQA 3CF2A 5JPNB 1JTXA 5A7QA 3ZQ7A 2P5KA 4A3CJ 1W36C 1IXRC 5C4JJ 2YBSA 3GJBA 2EIKH 1GVJA 5E20A 1V5EA 4ENKA 4NVPA 3DWLE 2CS3A 4C1XA 2YUSA 4AFBA 2XSDC 1JE8A 2F4OB 2VBBA 5KXBA 1ENXA 1T6BX 3KGLA 1ITYA 1RVF1 5CYVA 2MGQA 1TWCJ 2HXIA 4Q27A 1E5RA 5I0DA 2XWBB 3OBTA 4CYCB 2QA4I 4EROA 2K4JA 5TSWA 1U9NA 3IP4B 4NC8A 2QQKA 5CU1A 3DBHB 2YG0A 2V73A 3EXUA 5L9VA 4XQDA 2VOOA 3DQVC 5K7ZA 5I91A 3DF8A 3F8BA 2FD8A 3ILNA 3OYAA 2AEZA 2B42B 4DXZA 5BNPA 4OVEA 1IAWA 1UMZA 1UO9A 3BZ6A 3O1OA 2A75A 2XGXA 2Q8CA 1A6QA 4HKOA 1C1FA 6PAXA 3GCXA 2L02A 4C3HJ 5E3OA 3VEPA 4NHMA 4XYXA 2XLGA 4PHZA 4LR4A 5TJJA 1XMKA 2LW8A 4QX3A 3FFZA 2GM4A 2HWVA 3SKJE 4Q1RA 4XLHA 1XTAA 4KBZA 1QU3A 2X10A 2C0ZA 2RG4A 5FO9B 2OV7A 4HSRA 3AL0B 1B8IB 1U5TA 1W6PA 2W1QA 1PX4A 3OF1A 2R30A 5LW9A 1QGPA 1HRV3 3CIHA 4AFMA 2Z99A 3RZLA 1ZG1A 2XUMA 2VC1A 1CQTA 1U9OA 5IVEA 3M2MA 1TP4A 4Y20A 4CCEA 2A68F 1SLLA 2L4AA 1MSEC 2DOFA 2R1BA 3JSOA 3I3QA 4CA0A 3WP4A 5JSOA 4XTMA 1V54H 2WV1A 1OPOA 1R1TA 1XB9A 3GZUC 1LKNA 2P4WA 5K4LA 4X6AJ 1VMFA 3K6GA 2NPIA 5B4NA 1PJRA 1JUIA 1AYN1 3AKRA 1RUH3 1PVEA 1UMHA 1QHGA 3LB9A 4E4SA 1XE0A 4JX4A 3SHFA 3IIIA 1DYOA 3GZAA 2EWNA 2Q2EA 1N1TA 1QKQA 1I5PA 4PJYA 2ZB9A 1KU9A 2CQXA 5A6XA 5CVRA 2XR4A 1P4AA 3SZTA 4IL6C 3EUHA 2DBIA 3RPUD 4AQSA 4FTBA 3I71A 5L7OC 3VZLA 1KZHA 2NNNA 1BBYA 5EYXA 4CCDA 2PEXA 2ENRA 1OJLA 4I99C 4RSUA 1OQ1A 2JWPA 5DAXA 4FETA 4GMP0 3W9AA 1BR2A 2JPCA 1U5YA 5D2AA 3ECOA 5FP7A 1UOBA 4INDA 2Y0SA 4IJAA 1UOGA 4IGQA 2JB8A 2B7EA 1QJFA 1UG2A 4OWRB 2D3SA 1R091 3CDLA 2JZYA 4A3KJ 4AYBN 4BQ3A 4YGDA 2NVYJ 3CKHA 1W2TA 2QBYA 1LECA 1R00A 4CU7A 1YJ9I 1NLQA 2CQKA 2C9AA 1XSXA 2YBPA 5BYNA 3F9KA 1SMVA 1EP0A 2VU9A 1HJFA 4XFGA 2H0VA 4ASMB 3CZUA 1EAH3 5FXZA 1I1EA 2HWB3 1JUPA 1HV1A 2ZJ2A 2RS31 2R7TA 1IS3A 3Q5FA 4XETA 2DVFA 4KNYA 2XAHA 1TL8A 5FYZA 2KPMA 2QCSB 3WX5A 4BIFA 1JJ6C 4K6BA 1HKTA 1ETKA 2AACA 4PGHA 5FKOA 1K61A 3JD73 3CUQA 1NX9A 1PVC3 1C1LA 1TQ5A 1ZVFA 2RNGA 4LKDA 1OVSA 4Y1VA 4CO8A 2WYSA 5DQ0A 4XJ9A 1ZLJA 2GC3A 1LHUA 2OZUA 1HSTA 4IV1B 4XPVA 5KC5A 5CYYA 1MBGA 3WQ7A 4FT8A 3VBSC 4EWEA 2LBFB 2OIIA 2E26A 3E6MA 2E32A 4FHTA 4E7ZA 1CN1A 1T33A 1DZQA 2MPFA 4CCJA 2UYBA 1XQNA 3GF2A 4C91A 5EZWA 4LULA 1FMVA 3FJSA 2MD0A 1UY0A 2A69F 4MZUA 2WB1N 1PIV3 4AGGA 1G86A 4JGZC 5LWBA 3G6EI 1JKOC 2JDYA 2O8KA 3HR9A 3IB3A 2K3FA 1MJAA 3M4OJ 4ON0A 4BY1J 4FPJA 4EEFG 1I9RA 3AG2H 2RM23 4GMP1 5IFPA 2NMOA 5JXGA 2JDKA 1W6MA 2ZHMA 4AVBA 4MFDA 1P4XA 4G7ZF 5HCBA 5D4SA 4WCGA 3TKYA 4P9GA 4OUEA 3BG7A 3SDGA 4J25A 2R041 1SLBA 1AR61 3ECHA 3IZOA 4D5CA 1AYN2 1RMU1 5J37A 4OI2A 1OLRA 4LA2A 3ZLIA 4HQEA 2ZHNA 4BQ5A 2LALA 2GIVA 1GICA 2XJUA 1W8TA 3P9IA 2YS9A 4SBVA 3DEUA 5BOXA 1G9DA 1K7AA 2VZQA 1NLSA 4HQMA 1MQTC 3S3MA 2Q0AA 2VCMA 4OUMA 2G19A 1COV2 1OKQA 5ANNA 5FY5A 3OV8A 5CPRB 4A5MA 1B4AA 1XNDA 2DYSH 5KXDA 1GXQA 4L97A 2QCOA 2QENA 2UWMA 4QX0A 4DXSA 3CTAA 1X36A 5A7WB 4DO0A 2DTRA 1QA6A 1I6HJ 3O1VA 4FXGB 3WTWC 1LNSA 1AR83 4ONUA 5EZHA 5C9AA 1X19A 4JKMA 2VMHA 3SLIA 3DU5A 1I3HA 2VKEA 2G9WA 4NAOA 5J36A 3HWJA 5SV8A 1PO11 4UY8I 2FDJA 2GWRA 2O9LA 2C5DA 3RZJA 2CH0A 2QZ3A 2FNAA 2BVBA 1UU5A 3GALA 3DU6A 3ES4A 3D4KA 1XGOA 4IQJA 3GYHX 4IZZA 2XL7A 1W2NA 5FZLA 2PMZN 3W20A 3KEQA 1YRNA 5CFDC 3LQCA 5C71A 1V5FA 3FMQA 4Q4ZF 2QQJA 3FXKA 2VKHA 2A7AA 3KETA 3TWIA 5FFXA 4X8NA 4HNVA 4K20A 3BTAA 5C5UA 4W97A 4BE2A 4XF9A 1RXGA 5F7UA 3VHRA 4L9NA 1XXNA 4Q4W1 5GKAC 2LLKA 2FU4A 4DMIA 1WCQA 4OI1A 3I4PA 5CB7A 4TV7A 4UW3A 3WW1A 2XSJC 4JAAA 1ZBE3 2WNEA 5J98B 3RI9A 4XFCA 5T55A 2BNOA 2FF4A 1BCXA 2CJJA 1HCRA 3S5QA 2VQAA 2HQAA 4ARXA 3IDEA 4Q47A 4NIGA 2YX7A 3LA3A 3N97A 4CDXC 2YXSA 2BE5F 4IW3A 2IGOA 1RPWA 3VV1A 4LGWA 5J4VA 2DFBA 2BXZA 3GBFA 4N7IA 4MGIE 4Q4X2 1F36A 2W52A 2QSGX 4HRIA 4CPBA 1XGNA 5BPXA 4DINB 2EICA 3ZFFA 2EZHA 4AQTA 2O03A 4O9GA 2D6LX 4CU6A 2B39A 1EF4A 4QXKA 3A2KA 2VBYA 2F4MB 1D4M1 3KCXA 1JOBA 4D9JA 1W6NB 1IPJA 2PAMA 1ODMA 3OBRA 5EEHA 4OU0A 1CZVA 1OUXA 1HQCA 1N47A 1FC3A 5HDNA 4XSXF 2R5YB 1DPUA 1QQP2 3RYRA 3TN93 2ZSHB 1KQ0A 1DDNA 1EH8A 3VBFA 4AGRA 3OY8A 5I0UA 1LU1A 3BC8A 1WA4A 1IGNA 1P6RA 3HBKA 1SMYF 4IOAF 2CDPA 2R042 2ZNYA 1PGL1 3BR6A 1VJ2A 4UYBA 1AR62 3CJTB 3O12A 1RMU2 2F4IA 1AKHB 1GV9A 3P3NA 1FOWA 5DD4A 1TNTA 3VDDB 5J7MA 3KX2A 1G8XA 2ZGPA 4EZ4A 2WSUA 3I53A 4NPLA 5F3CA 5FZCA 2EXHA 3DF0A 3S8PA 3ZVXA 2DCYA 4NBQA 4RHV2 2QDNA 3LWFA 4AI9A 1H8TB 2YX4A 3ZFEB 1HW5A 3S0MA 5D8AB 2HGCA 5FO8B 1FY7A 1OFSA 5K0UC 1VIWB 3L7WA 3JR9A 1W99A 4ESJA 5IP9J 1JZ6A 4GWJA 3ZXFA 2CUFA 5JZGC 4F55A 4Y15A 3M3QA 5F6FA 3D5LA 1O4ZA 2KJCA 3WNXA 1O91A 1GZWB 2PELA 3UT0A 4EJRA 4Y17A 3H92A 3LSMA 2C4XA 2XDVA 3KP5A 3QYEA 2XPVA 1SPPA 1TLHB 4U0YA 2WN3A 4BHBA 3NQOA 2B63J 3WP3A 1T56A 2E60A 4UFMA 2BTVC 3PUIA 4IEJA 1YIOA 2PHRA 1ENSA 1OVPA 5GADJ 1VBD2 4ZZ5A 2Q8DA 3T8RA 5ABJC 3F6VA 5F2SA 1ACIA 1VALA 4UBHA 1Q5OA 3UGFA 3JW4A 2BV4A 2JQ7A 1IGOA 5FZ8A 2DPUA 3AX4A 1F9KA 4XLAA 4CEYA 1R5GA 3RZDJ 3TEWA 1FBUA 2YYOA 3GEZA 1BVVA 4QQLA 1XSQA 2HDCA 4HDVA 1ST8A 2DFIA 1VAVA 3WHBA 4WM7B 5C4WC 1LDKB 2E35A 2DQRA 1W9TA 4XJWA 2CV6A 3BLYA 3A21A 3GFLA 4KITB 1VRH1 3V8LA 2GA2A 5F3IA 2WNOA 1IOAA 3T3YA 3UYJA 2JG8A 2HDDA 4LO5B 2HWF3 3TMOA 4E2QA 2Z79A 5IVCA 1RINA 3BZCA 4ABZA 4Z2WA 2MEV2 3GZ6A 2VR4A 1KGSA 2GZWA 2FCUA 2WNUC 4UFKA 1AL21 3OBAA 4W8JA 4Q26A 3CL1A 2PX9A 1ZZBA 2R7SA 4KWKA 5FYYA 3FUOA 4HPKB 4XF0A 1ETXA 2ZMEB 1D8JA 2ZGQA 5I93A 2DF7A 2DV9A 1IV6A 4HZFA 3THDA 5KHDA 5J8FA 2E71A 3H9AA 4XZUG 5GLTA 5DMYA 3K4DA 3TQNA 3P7NA 1HN1A 1HXS1 4YVWB 4RAYA 2YPRA 5E3LA 3ZCOA 2D3PA 1ORKA 5TISC 2ES3A 1Z91A 2CG4A 1X1AA 1JKRC 1U3EM 4MG2A 4YVSB 3IH4A 1HOMA 4K3UA 3BB6A 2X6WA 4C1WA 2QEXI 4CXWA 2QKMB 1N3PA 5J3UA 4A12A 3JXSA 1FTZA 4LA3A 4FFHA 5C8CB 3PSIA 2E2JJ 3V0BB 4PDWA 4ZHNA 3CF6E 5FKCA 2OCEA 2BDRA 1CESA 4WXCA 2CL2A 4BXSV 2TCTA 2M4KA 2VXDA 4XM3A 2ZACA 2RJLA 3HRSA 4UT5A 1XYPA 1RUC2 1VTNC 3AKQA 3POYA 1XS9A 5EHDA 4R9DA 1VBB3 2BY1A 2HQNA 3OIQA 3FIWA 3GFIA 4Z92B 2HWE1 2VPLA 4ZKTB 4WM8B 1SLCA 1YHQI 3GO5A 2XRLA 2IT0A 4LE3A 5M3FJ 1NHAA 1VQNI 2W24A 1PNFA 3R05A 3O8HA 2C6YA 3WF1A 4GYGA 5H20A 3FN9A 1ZRCA 2HYJA 1PO22 4H4KC 1FMD2 1U0AA 2VAUA 2NXNB 4M3BA 3LF7A 3NRVA 2X1DA 1AR72 4B44A 2AENA 1HKDA 2Q8KA 3G1MA 1FAYA 2VLAA 1ND2C 3S30A 3ABUA 2VI6A 1GZCA 2ZGMA 1IDYA 4QB6A 3U0ZA 1YW7A 5ISLA 2QGUA 2DMNA 2NN8A 5FIXA 4KU8A 2EIMH 5F64A 2LSOA 2VJ5A 4S2DA 3ON7A 1ZZ9A 1BW6A 3BPXA 3AFGA 5FUIA 4CDGA 4AIJA 2A6TA 3KM5A 3N9OA 2X6XA 3J8F1 1LFBA 2NZ9A 3T30A 3I97A 2R0HA 4BJ0A 2BOIA 3TP0A 1BEV2 4M3GA 5FY0A 1QO0D 1MVEA 1RUF3 2CU7A 4GWIA 3KP3A 2HH9A 1ZK8A 3OL3A 1E3HA 5JWPA 1H89C 2W08A 5DABA 3C18A 5KHIA 2E5NA 5C5TA 1YS7A 3KGZA 2XAUA 3JRGA 1S0JA 2Q1FA 4CYCA 3IAPA 5DPNA 4CEWC 2R7XA 1H8VA 2CSGA 5FPLA 2PQ8A 1XOYA 3WQBA 3RJPA 2LREA 4KN7X 4XN0A 3ZOIA 1BBT3 3BTZA 2XVGA 5C3EJ 3VKFC 5J47A 2PLV3 4GH4B 1FOKA 1QQIA 3E0JB 2R7RA 4XABA 1FPN1 1OCRH 4CGZA 1D2QA 4FTHA 3IMMA 1H6XA 1SFKA 1VB2A 5ACA2 4U7DA 4DBQA 4FVVA 1I27A 3TRSB 1ZBA2 2P0WA 4XNFA 2JDZA 2YZ4A 4QX2A 1BVP1 3FUQA 1UZYA 3LSTA 3A1YA 4N43C 5DN2A 5I0TA 3B9IA 3FC0A 4UBGA 3W2WA 1PUFA 2B9UA 4JRAA 1JBCA 4FOVA 1ZGWA 4HSLA 1PK6B 3OS0A 1J59A 3IPVB 4IEWA 4FISA 4A3DJ 3BI3A 3CJXA 3H50A 3MF9A 4HMZA 4KNCA 3E97A 2QQIA 4GGGA 1GXPA 1OA3A 1WCDJ 1VQ8I 2E1NA 3O1PA 2K2SA 1H2LA 4HDUA 3OG2A 2WNVC 1F9NA 2X51A 1W36D 1TWFJ 3WP6A 2QQPA 3K4AA 2EPFA 2J1SA 3BCBA 3E6DA 3MCZA 4GKXA 3ALQA 3T0BA 2K02A 2BW3A 3MAJA 4M6YA 1PO13 3IL2A 1SFNA 2IXKA 2VOKA 3AP5A 1ZM1A 2JE8A 5AC92 1O4TA 1NA1A 3HEIA 3RI4A 3E5QA 1BZWA 1H0BA 3BU7A 4JTNA 3NV2A 3AKTA 2AC1A 3H7JA 3KP7A 4OQ8A 2VNOA 1XPXA 3DUIA 2WO3A 3DEMA 4DXTA 3OSGA 4YZ3A 2PN5A 4X8PA 3S6PA 2OBPA 4IV3A 1G59A 3REOA 2HOEA 4XXAA 1LCLA 3KLOA 1GMMA 1N1YA 4CP2A 4IPAA 2D43A 4U88A 2UXNA 3L2HA 3N7MA 1AXZA 4FX4A 2TDXA 4R9AA 3WTYC 2XB5A 2R7QA 4KICA 1K5MB 2NOJB 5L3EA 4Z1VA 4XONA 5DAPA 3RWNA 3ASOH 3WTSC 4FOWA 3HHHA 4DY5A 4M0HA 2AHQA 5GTIC 4V2VA 1OT5A 3PJYA 3WHUA 4EN9B 3ILRA 1AZDA 4AHXA 3WTTC 3G1LA 3WG7H 4JGYA 4MEYF 2I07B 2DA4A 3HGGA 1PGW2 2WAEA 1DUXC 3J8F2 4AAPA 3RFRA 2QLZA 1X50A 4A7ZA 4L5JA 4F8AA 4LPLA 1MS0A 2GNDA 4YZ4A 1Q8VA 4II2A 2R7UA 3PFIA 4AFCA 5F6LB 5F39A 2VOWA 4AI8A 2VXZA 1C8NA 5FQ0A 4FPHA 3I2OA 4O9EA 2ETEA 4YLZA 2VL4A 3HOZJ 2HPMA 1XNAA 1R64A 4FQ4A 2R072 2Y0SN 3T1LA 3OUHA 2P3IA 1MJBA 5EF6A 4AE2A 2PTMA 2VH9A 4CA9A 4JQRA 1MR5A 3ZN6A 1DU3D 2FE3A 2Y48A 1K4TA 1FPN2 4NC7A 3QLQA 4F83A 2Y38A 1FNYA 4EATA 3GFJA 5A1AA 2XUBA 3USUB 1LOGA 3HBLA 4NO4A 2KIUA 3HOXJ 2WBKA 3IM0A 3HOUJ 2B46X 2YC0A 3ENRA 3PL0A 4JX5A 2GNBA 2W87A 3CJIC 4C0BA 3OJBA 3FLRA 3MHZA 1MW7A 1R9TJ 1RRJA 2ME6A 2KQRA 2G9FA 2DMUA 1FI2A 1F15A 2ZA9A 2DJIA 4BBRJ 1XMXA 5K1YA 5DDJ1 1BJZA 1L3JA 2VZPA 4DIQA 1CJPA 1QGLA 3IUOA 3AYEA 2JSPA 3I59B 1YQ5A 3UL2A 4H7MA 1BJAA 1R4NB 1GLHA 3C2GA 4RMNA 3P3PA 3CCMI 3Q9VA 4ESFA 1RUG3 3RKWA 1VMHA 3CCRI 4QWQA 2EB7A 1HDDC 4FXKB 2PLYA 4MQ9F 1LPQA 5FOBB 4K21A 3JBG2 3WU1B 2CWSA 5DS9A 1LVKA 2RE9A 1UXZA 2WS92 2D1VA 3WTVC 3AXEA 1GWKA 2X0LA 2JJ7A 2QVSB 2YROA 4KBBA 4I6ZA 5BPIA 2JDUA 1DU0A 4KWUA 3A01A 4Q5SF 2D5FA 3VGIA 3QWLA 3OPWA 5FPAA 3J80Z 2VTXA 2V1XA 1NYWA 2DCJA 4AVAA 3SXWA 2AGSA 1YI7A 4X0GA 4COWA 1LOFA 3T2OA 1JUSA 2RMU2 3RJ2X 3A0BC 1SANA 4AHZA 1JZ8A 2OUMA 2ZEZA 3NJYA 3AK0A 2WJSA 4AEDC 4J6GA 4QPWA 3CCSI 5CEHA 1BXHA 1W0OA 4B1LA 1TE1B 3HUGA 2W84A 1QMJA 2OPKA 1MJ9A 4YRDA 2RC4A 5FZOA 1X8EA 4J1XA 1FV3A 2Q1ZB 5IP7J 2MNGA 1N77A 2MLKA 4S04A 1VRH3 4CDWA 5DCMB 1L0OC 1OSGA 1SBEA 4FE7A 2WAQA 4P5YA 3E1F1 3K3NA 2EXIA 3AZZA 4CXFA 5FY1A 2Y8KA 1MS9A 5DG1A 3FHNA 4OIQF 1FATA 3DPRC 1NQJA 2Z4FA 1Z21A 1ULFA 1PZ8A 3I49A 2YGLA 1F8VA 2R3SA 2G4IA 4G6QA 1UX6A 1IN7A 4EM2A 1O3QA 4M3CF 3C7EA 1BA5A 3VHOA 5GLWA 1JI6A 4MOAA 4CP1A 1S2BA 1KU2A 1NT0A 5KHGA 4QB2A 1B6AA 4LXLA 5FB2A 4A3JJ 1FSHA 3H42B 2DYCA 1RUD3 4IETA 3S2DJ 1B35B 1GV2A 3L2QA 1NTCA 3ZXAC 2AO9A 4HG2A 1LAJA 2UYAA 1SAXA 3I2DA 4IRIA 3J7ZI 4RS5B 1OUSA 5E16A 1DGRM 3MZ8A 1TWAJ 4UFHA 3B93A 1CAWA 1OH3A 3HQUA 3KT1A 4G7HF 4S2HA 3OY9A 5JCTA 3OOUA 2A73B 4IDZA 4OHWA 2JA2A 2A1XA 1QVTA 2XV4S 3W2VA 3CQOA 1QBJA 2ISZA 5LY2A 4PFPA 4D3WA 4YW6A 1OOPA 3C2BA 3K2OA 2OUHA 3ISPA 2ECCA 1IG7A 4CH7A 4L0ZB 3I3MA 3PJQA 5DDJ2 1Y0NA 2NRAC 3QP5A 2HWD3 5EP9A 1K6YA 3SH4A 2AH2A 4A3BJ 2R5YA 1VQOI 3NNLA 1G7YA 2ZGKA 4V2WA 3MMYB 3BY6A 4YG0A 1AF9A 2E51A 1QJZA 4OIOF 1JZ7A 4HW0A 2JDPA 4Y3OA 3AC0A 2OAZA 3AFKA 2NVTJ 1VRBA 1AA7A 5LD2C 1B72B 1IN6A 1AKHA 3NSTA 4Y7NJ 3VBUB 1S4CA 1HQWA 1P8JA 2RHPA 1VZ0A 3J7NA 4RR3A 1FP1D 4FQZA 3VZMA 2HS5A 3DKXA 3MPBA 1SVOA 4GJYA 2JDAA 2MW8A 4I7HA 3O0VA 2CQNA 2PJPA 1AUYA 5FLXK 1YQ6A 1C8M2 5FMOL 1V9U1 2ZKZA 1SC7A 2E1CA 4YGEA 3N9MA 4H14A 4XVHA 5HXVA 5SV5A 5DUKA 4L18B 3ETPA 2OQ6A 1QJY1 5FYBA 3D6EA 2QQUA 4LJHA 4AI3A 1SFPA 4A3XA 4YW7A 1J83A 4NN0A 2LTPA 1DIWA 3BJAA 1GZWA 1VBC2 1AXKA 5LA9A 3LNQA 4ZPIA 1ZR2A 1Y8QB 1S0EA 1R1A1 1X82A 2M8GX 1O6UA 2OU2A 3GVAA 4OUSA 2YHJA 1W6OB 3SEZA 3GTQJ 1QEXA 4CCCA 4XR6A 5FJHA 2NS0A 3VKNA 2H09A 3J7YJ 5A7OA 2GC0A 1WJFA 2FCTA 1JODA 4J1WA 4QQPA 3WTZA 3SITA 4XKCA 3CLOA 4XF1A 2QVOA 2D6OX 5DAWA 3EYYA 4QPIC 3JRDA 4LLOA 2QQNA 2R32A 5JHUA 3ZYJB 1BI0A 3ZPOA 5FY4A 1UYZA 2XB6C 4AI1A 3L09A 1E57A 3LCPA 5FPZA 1NK2P 1US3A 2QZ8A 5ILVA 1N25A 4UB8C 2P5VA 2IFWA 2HEOA 2DODA 3OEAA 2HPIA 4XJUA 2NS7A 1HB4A 1TQMA 3F8NA 3LSRA 4BQ2A 4EZHA 1W7PB 1CIYA 3QD6A 5FTTC 2ID3A 5L3DA 3I3BA 3MN2A 1O5LA 3FE5A 2KMUA 5LK5A 4R52A 1DLLA 3C3WA 5D6FA 3G71I 4II3A 5CAZA 5J09A 4Q8LA 3ZR6A 3PSFA 2Z3YA 2E2IJ 4RGXA 4LUMA 1T98A 2X5IC 3A7QA 4JV4A 4A42A 2DLLA 1IDZA 3WD5A 3OSFA 1NCQC 4YFKF 3CLQA 2VPVA 1YQ2A 3Q0VA 1H8AC 2XJRA 2XL9A 5FLXZ 4X1EA 3H8RA 2RJ2A 1GR3A 4OULA 3U21A 5BXXA 3QPSA 3TO9A 2VUAA 4HVRA 3AMHA 1LEDA 4FAGA 2IS6A 1XGSA 4YVWA 3A02A 3WF2A 2UUZA 1C0WA 2ARBA 1OCCH 2M5WA 2PA7A 3T1BA 1SLAA 4XF3A 3WDTA 2V72A 4D0PA 4LLFA 2QUOA 5H6RA 5JAXA 5FXVA 1H4HA 2XRNA 4N90A 3BT9A 3MV11 5T54A 5FY9A 4XXPA 5C8CA 4D1QA 5FK7A 3ERMA 2OQRA 4FQGA 1YG2A 3IMNA 2L9NA 3HMYA 5LRRA 1W5SA 4RQPC 2ZGTA 4HYEA 2BFUL 4CUGA 1HA8A 5L36A 4XF4A 4DUVA 3ZMZA 3OL4A 1T38A 3UGHA 3B6CA 3PUHA 4UV8A 2XJSA 2JKBA 5IT3A 2VMGA 3JRFA 5LA2A 5LBQA 4UB6C 4KMFA 4Q8KA 1HC8A 1ZARA 5IK4A 2CW8A 2E5ZA 2Y6FA 1OCOH 1UPSA 3AZWA 2F5VA 3HT2A 1CWPA 4XFHA 3L2VA 1Z7UA 3RZMA 1U8BA 4CDQB 2P5LC 3MKYB 3SNMA 4BKXA 4AZZA 1M1EB 3R61A 1KYZA 3GCWA 1R1ZA 4WK8F 1OYIA 4GXOA 4IGOA 2CRGA 2CW0F 3LQQA 1ZYBA 4GWMA 1DZTA 4RFRB 1SFYA 3R4KA 2OYZA 1GUIA 4ASKA 3BG6A 1YO8A 4AI0A 4RBOA 3GFMA 3BR5A 4JQTA 3BUCA 2X6OA 2BWAA 1KITA 3H1YA 4J00A 5CKTA 2BU9A 2JIJA 3GLLA 3S1QJ 1XYOA 3Q9OA 2FX0A 3S3NA 2DA2A 3KLNA 1ZRIA 1CQ9A 5CISA 3V56A 1J5YA 2ADUA 3CJNA 1DGRN 1V6MA 3DYPA 3AP4A 4PLMA 3PUBA 5DDGA 3USSA 2WZEA 2A5ZA 3OYCA 2IC1A 3BYWA 4GH4A 5KC6A 2M3AA 3K4LA 2PQSA 1S1AA 3ASNH 1TG7A 4QKFA 3J81K 4LBQD 1W90A 3RQIA 1JZ3A 1VLNA 1Y9GA 5LA0A 1RUI2 4U0VA 4A6SA 3L1PA 4Q4Y1 3KYDB 5HXMA 1WQ2A 1YCIA 4FPEA 4AIKA 1D0HA 2EINH 3HIFA 5F5IA 3VDBA 3CLPA 1TME2 3UKTA 3M1CA 2L9RA 2XXZA 4FPLA 1PM4A 5I8TA 4WBBA 4U7BA 3JU9A 2ZCWA 1MZ6A 3ZMUA 1GOGA 3KT4A 4P14A 1T95A 2DN0A 2N7GA 4MXWA 2V1NA 5DZEA 1JYVA 4ATEA 3AL0C 2BBAA 3TDZC 1O8PA 4Q0UA 4AL9A 3I3LA 4RB3C 5D6EA 2OQ7A 4G8XA 3I8TA 3GM8A 3WW3A 3Q8EA 3KEYA 2ZJRF 2AEYA 1WD3A 2RS51 1IXSB 4NNJA 5FD6A 2E1OA 1LE8B 3CMEI 3C3VA 3QPLA 1REFA 2CY6A 5A33A 2W25A 4BXFA 2C26A 1WFXA 4JP0A 5BY5A 3WE2A 4LBJA 1RHI2 1QJX2 1KONA 2WZR1 4IL7A 4LIVA 5AVAA 4ENMA 3DECA 4KYWA 1ETYA 4QGMA 1RL3A 3TB0A 4P9IA 3TO6A 3H1MA 4QD2A 1BYHA 4WZCA 1WMEA 5BNPB 3LEMA 1IV8A 4KIGA 3ZXJA 4XIKA 2PHWA 2XUEA 1QH7A 5F3GA 1MEC2 1DBNA 4TZDA 3GTLJ 1H1IA 4EV0A 1RUOA 2V5YA 3WDVA 2OZJA 2ZSIB 3NJXA 3ZXSA 5GZFA 2CFXA 4LORA 3JQXA 1Q1VA 2OD5A 2HI3A 4QSHA 1XBFA 4QXBA 4IX7A 4G94A 3KF5A 3J81Z 2CYYA 4UXAA 2VMDA 2Z33A 4ENNA 1PM7A 2H6CA 3KP2A 3VL9A 3OGRA 4LK0F 4Q4X3 2LY2A 4D8MA 2Y9ZA 1ZELA 3OOXA 1S0GA 4CP0A 2F4PA 1JTYA 2V4JC 3WDXA 3HM5A 4Q4V1 3M3YJ 4AC0A 3IH2A 4Y20B 2GIZA 1ZAOA 3KE2A 2QM3A 1K5JA 2DA6A 4LKSA 4DW6A 2FCVA 1A31A 2PXJA 2RDNA 3KS7A 2A6HF 2ZGNA 2VQGA 5HDGA 4MXVA 2I10A 5ICFA 2EBIA 4GKYA 3VBOA 4KN4X 1MACA 3APBA 5HLGA 1QQP3 4RS8A 3SKVA 2Q2EB 1UFMA 1PGSA 3ULQB 2W95A 1WI3A 2WWSA 3EUAA 2XONA 4MTDA 3S7EA 5IYYA 3SXYA 4RN5A 2CWEA 2YV8A 4H0EA 4HA8A 3MICA 3HOTA 4E7SA 3B02A 1O8SA 3NRUA 2VQHA 3WGHA 1WCKA 1HB1A 3J9SA 1DQ5A 1HX6A 5TRDA 3IHUA 2LF8A 3BQZA 2VNRA 2KT0A 1R49A 2XQXA 5FZEA 1G2HA 1H0MA 1VBE3 4IV1C 5F0CA 2W85A 3F8CA 5G05L 4RHV3 3HBZA 4DYRA 3PO2J 3O6BB 5E88A 2KA3A 3FM5A 3SFZA 1W0PA 4ZYAA 1D1AA 4WF2A 1MS1A 2KIQA 5F1JA 5BNNC 4B7EA 4LLLA 4NIIA 4AEKA 1DG6A 2DOEA 3RPUA 1V3FA 2QBYB 1DQ4A 1YFXA 2X8KA 2NVUB 3MW3A 1SCSA 1T2XA 1FX7A 3ETQA 5FZGA 2MYSA 2I2SA 1GWLA 4N8MA 3M4FA 5JMOA 4NPMA 1OLTA 2GLOA 3A4UA 1UHWA 1ZH5A 1JU4A 1WPKA 3CO2A 5E1WA 1TMF2 4A3FJ 1UZZA 3LSDA 4XRSG 2XBO2 2XJVA 3MBWA 3C7HA 3MUZ1 1F2NA 1DGLA 4AVCA 4AIHA 3JAMK 5A3UA 1ASJ1 4DNYA 2ZEYA 3DBLB 3LKJA 4HLYA 3D0JA 2IFRA 4YFWA 5FKNA 1IF1A 3MLJA 3CUQB 5HLIA 2M30A 5FZ4A 3V64A 4BIOA 1ONVA 4KT5C 3ZPLA 4MSVA 4DZGA 1JXSA 1BLZA 4KWJA 2QQWA 2G9GA 4HLXA 5E8GA 3LAJA 2CWMA 5EYYA 3POWA 2FMLA 2WWUA 3LDKA 3MD2A 2M1BA 4JC1A 1QRYA 2WFF2 3VKMA 2Y9YA 1PP7U 2DVDA 4JDMA 1GBGA 2TEPA 1IS6A 4F93B 1GZ9A 4P9YA 1EUTA 3HOVJ 1KYWA 1H9GA 3C7OA 2O1QA 5J1YA 4NE9A 5GLUA 2WA0A 1LGNA 2Z42A 2H8WA 1MMSA 3HXLA 2MEV3 2DU0A 3WUCA 2LDUA 2GOMA 3NNMA 2LUWA 2FZ2A 2W91A 5A2QK 3T4HB 2V7FA 4EWDA 4AAXA 1QDCA 5E8IA 1TVGA 1LOAA 3ZXLA 3R0RA 5D5VB 4TLFA 1TWHJ 4YZ2A 4UVCA 1W6MB 1ZRDA 1ULCA 4BQNA 4XN3A 3INAA 1EPZA 3UGGA 3KV9A 2R5ZA 3BOWA 4YIRX 1UZ0A 2G9ZA 2B9SA 2JRMA 1W2UA 2DTYA 4P02B 4R9BA 2GALA 1VBA2 4G3YC 2DVBA 5EYRA 2L4MA 2K7LA 3G6JB 2D1HA 3WP5A 3AKZA 1UZVA 2PAKA 5IT6A 2WRAA 2ILMA 2IXIA 5J48A 4BE1A 3RS6A 2XJPA 2RREA 2W47A 2D98A 1ON2A 1HRV1 3JAMZ 2Y6JA 5BNQA 4GB31 1IN8A 2X6YA 1LHOA 4RD7A 2WKKA 5LEKA 4ITCA 3SEPA 5L3CA 1RUC3 4UXNA 2DVAA 2A3YA 2F5CA 1QWRA 3NWTA 4LOTA 4EMSA 3LFMA 1HBXG 5C9AB 1X9PA 2P6CA 1TTYA 5T5PA 1RUH1 2UY8A 1H2KA 1G6NA 3HEFA 1F1ZA 2W1SA 4HLTA 5DXDA 3ZYGA 1NZIA 4IGPA 1Q3EA 3JREA 1PO23 4MGSA 4QQHA 3IAQA 1FMD3 2R062 1OQDA 2LKSA 2DFCA 1AR73 4ZDLA 1YRNB 3ZSMA 2VNGA 2C24A 2J1AA 3BROA 4MO3M 4IE7A 2WUHA 2OKXA 1H1MA 4HN0A 1V5GA 5F5QA 4E6KG 4BQXA 4LUKA 2K3PA 3KQ4B 5A32B 5A2QZ 4A5NA 4OHVA 3GXOA 3ML6A 3UKGA 1B72A 1X3ZB 3VBSB 5CKNA 2ZZQA 2R0FA 1Z7S2 3Q8CA 3U4SA 4K9SA 3LSGA 1OH4A 4FCYA 5DAQA 1MMDA 4PF1A 5CJ9A 2VUJA 2O8XA 2L7FP 2FHRA 5GAGJ 1WMDA 2Q0OA 3DPTA 2DI3A 5KCMA 3DGTA 4DFSA 1U2WA 1BEV3 1AJOA 1FLIA 2D3RA 3TOBA 2WQZC 4YZ1A 2JD4A 4CUCA 3O8GA 5JLVA 5FPBA 2YC2A 3VDDC 2W48A 4ZZLA 2BWCA 1RUJ2 4JGZB 2Y33A 1H9TA 3ME2A 2HVQA 1ZG3A 1Y39A 2HWB1 4A3GJ 1H8TC 3ZFEC 4AFAA 2QQOA 1U78A 3EB7A 5D8AC 2ELHA 3ZFFB 5D4RA 1J0RA 2X85A 4YW1A 1HRI1 1P7JA 1S0DA 3S7IA 2ORZA 4OINF 2COMA 2FQPA 4O61A 1XE8A 1OCPA 1SMTA 3PNTA 1PVC1 3PMEA 5D1IA 3BN6A 5LATA 1MBFA 4LBMA 3PVEA 3I55I 5LLQA 5ACA3 3K77A 3M7AA 4EN8B 1R7JA 2O0YA 4WV8A 1ZBA3 1HLCA 5CADA 1O7LA 4GA9A 4XK4A 2L5QA 3MZHA 1B09A 1UX7A 3KMHA 1ON1A 1OHFA 2A70A 3JUUA 4QKDA 3T2TA 3I9V2 4Q4Y3 3EYIA 5FLHA 3OY8B 1X4OA 4CPBD 2W9XA 1REEA 1SVLA 1MS8A 3PL8A 1S0FA 5FZ0A 3HSFA 1MQTB 1BKZA 1TWGJ 3P6BA 3M07A 5EFUA 3M3OA 4L9TA 4DGWB 2JTVA 3ABMH 1DQ0A 3AMMA 2Y69H 1CGPA 1QDOA 4Y13A 1YJKA 4IE6A 3OMYA 1UY3A 4YEJA 2PFWA 2L7ZA 2V9PA 1I1GA 2VOPA 1W2AX 3AG4H 5BS6A 3POEA 5EXOA 5FAXA 3WHTA 2VKVA 5F0FA 1IUYA 1R082 4LBKA 4WM7C 2HQ5A 2QYOA 1TQIA 1HRV2 2JKXA 3K1MA 4DQ2A 1JGGA 2QZ2A 2ZXWH 4EJTA 2ZKNA 2RM21 2VBPA 5D5UB 4HN1A 1AVBA 2EFWA 3POGA 5BNOA 3F95A 4TSVA 1HW2A 1TT5B 1ULOA 5AC93 3IH3A 3RCOA 1Z0HA 3DP7A 2B8MA 2VL8A 3VKOA 2XASA 5DM6F 2XVLA 4CUAA 2X29A 4YRVA 1PDNC 4GRIA 1FOD2 4C30A 1HJGA 2IS2A 1SPPB 4HF2A 4KQ7A 2IJLA 5JVVA 2ZXIA 3LQRA 5EQUA 3BQYA 2YU3A 5CFCA 2K9QA 2O5RA 1GZTA 4AUXA 2ZMEC 2DO7A 1VQKI 2ZX2A 3RQ0A 5JOXA 4MUVA 3HT1A 4HSJA 5EG0A 3ZQQA 5AONA 1P2FA 2FA5A 5FKBA 1X1BA 3WU2C 5FRAA 4CXXA 1XDSA 1M06G 1UHMA 1H88C 1BMV2 1WJ5A 4YVSC 1JUMA 2HVRA 4OI0A 1CAXA 3WINE 1S9HA 1YRZA 1IUFA 1T0FC 2JRTA 3ZQHA 1MS4A 2D7FA 3VUOA 4DOUA 1U12A 5CLSA 5C8CC 5A6ZA 1Z77A 4MTEA 2X9DA 3GZNB 4M73A 1TBXA 4YFNF 3M3CA 3UKVA 1UIJA 2WL1A 1X33A 1OKRA 5FZHA 1P9QC 4Q4V3 3D5SC 3FMSA 2M45A 5HVQC 4PJMA 5M5XJ 1YIFA 4ATFA 5IFTA 4BS9A 3ZYPA 5B66C 4AIDA 4PDKA 1R71A 2VZUA 1EJ9A 1EAH2 2HWC2 2R073 3PM1A 3VL8A 1E5IA 2JSCA 1ZRFA 3DEEA 2ZJCA 5GLVA 3FBIB 4WM8C 3TGNA 4LFUA 3PUFA 4LBOA 2XAJA 2ERFA 1YC61 1Z6TA 1A78A 2RGVA 3KZIC 4IEOA 1KU7A 2JG9A 3JD72 1FJLA 2KZVA 1GP4A 1MBEA 4ZXKA 3CJRB 1UY2A 4UVBA 3OYIA 1ZBE1 2XQRA 1CVNA 2GP3A 3O0XA 2WZPP 3WW4A 3LMMA 4QPGC 2LF7A 4AU7A 1RZ4A 3QU6A 3OB8A 4BE3A 1YLFA 1W9WA 1BC7C 1S29A 4ZDOA 4A3LJ 5E1ZB 5L3BA 4AGVA 3J7AO 2C6SA 3NL1A 2DMPA 3S57A 4HBNA 2WO1A 4HKLA 4W6WA 1R4MB 3OGGA 2Y6HA 4IERA 4KGQA 1C28A 1TT0A 5GPAA 3CD6I 1KJRA 2LD5A 1D5VA 1XU1A 1PIV2 1LHWA 3HPHA 5ICEA 3BG5A 4BWOA 3EQLF 4YFXF 4TN7A 2OPTA 5CKMA 4GALA 2VASA 3E5XA 5K7HA 5IWFA 2JICA 1UIKA 3S5AA 2WS93 3JRIA 3F0CA 4XDQA 4YG6A 1W3VA 3KQRA 2JVHA 1SLTA 1YJWI 4TLGA 1ASJ3 4XDOA 1JOPA 3Q8AA 3MF6A 5J4YA 3N9NA 4Z82A 1CONA 2BNNA 1ZHFA 3OYKA 1WW6A 4LBNA 2XPWA 3NKTA 5J1XA 2RMU3 4GXLA 2ZX3A 4AR2A 1YS6A 3ZYFA 5FD5A 3DKQA 4V19K 2CAUA 1PHMA 2LK2A 4YGBA 1IN5A 1BI2A 3ABKH 3RMXA 3K4BA 4Z8BA 4Q2FA 1N78A 1LEMA 2J1EA 3L2RA 2X48A 1JZ5A 2QWWA 4BHPA 5JR2A 5FP8A 1PK6C 1OA4A 5A7NA 2W92A 2VJIA 3FX3A 1POGA 2VIXA 1UCXA 2BUKA 4R4XA 2NMNA 1HB2A 1UZCA 1OR7C 3AKSA 1LE8A 1YE9A 2VE8A 5DUXA 1AR82 1EV12 3VB9A 1D1CA 4YWAA 2WNUB 4IOCF 1X2MA 5FK8A 1RUE2 3MEXA 3I2KA 4QAWA 4B8EA 2WT2A 4KUMA 1J9IA 3O14A 4BK5A 1FNNA 1S0IA 4KISA 1MS3A 2A6VA 4HK9A 1S0BA 4BQAA 1VB4A 1YYNA 2AXLA 3EUKL 4FPKA 3WSOA 3NV1A 2L54A 4IRHA 3VBHA 5D5WB 3IRRA 1J3PA 4AHWA 4B47A 2O8OA 2RR12 1ZN2A 2Y60A 3U37A 1ULDA 2V1DA 5JFRA 1ZTRA 3HDDA 3H9QA 1G3TA 1PUFB 2KD7A 1HXDA 1O7FA 4BHCA 2P4EA 1WJAA 3IBMA 1K5MC 5LY1A 4GB33 1W39A 1W6QA 1B1BA 2HWF1 1X8MA 1W0NA 4HOOA 5FLIA 2HKOA 2P3JA 2BBYA 1YNAA 3WG4A 2Y30A 1K78B 3FDYA 4TTGA 1AX0A 2CUZA 3QQAA 1KXGA 3B01A 1T08B 4XICA 3PQKA 3ERED 1IKQA 2VT2A 3H5RA 5DG2A 4HX7A 1AHSA 1HDPA 3WR0A 3KVAA 3RZZA 2VZ3A 1L7QA 3WHCA 2F5FA 1XSVA 1RTVA 4XRMA 2DOAA 2BW3B 4WVVA 4OLLA 2LKPA 1NA1B 1USTA 4G4FA 4Y1UA 3MKWB 3L2WA 1KDMA 2E2HJ 2O61A 5L3GA 2L9LA 1H9PA 4JBAA 4XIDA 3TYJA 2JA7J 1XNKA 3MKZA 4PIYA 3NKGA 3RGBA 4ARYA 4N4OB 1N1SA 4LHNA 4IV3B 4J19A 4XC9A 3TN92 5FKKA 3BKZA 4DUWA 2RDSA 3TOAA 2RS13 2Y0IA 4UW6A 3GYDA 3ZM8A 4AWDA 1C3HA 1Q43A 1DZRA 3GXUA 2ZGLA 3DTEA 1KQ9A 2OW4A 4MGYE 5CKQA 3FXQA 1AR92 5E8AA 4FASD 1A34A 1YI9A 1C8M3 5DTDA 2H27A 1Y43B 5FYMA 4ZC3A 1JMUB 1BR1A 4GAZA 1MMNA 2CNAA 2GXBA 1XU2A 4JGYB 3FXJA 1VBB1 3BR1A 3PNYA 2ICWG 4M72A 2ESHA 1RR8C 4I2OA 1VBC3 1ERDA 1GWMA 1Y0UA 1FZPB 3N7JA 3HZJA 4XUNA 3LFIA 3KP4A 2ZGUA 2G7HA 5CG9A 5A6YA 1RVF2 3GLXA 3WODF 2EAKA 2KISA 3Q0WA 4ZYHA 5CIRA 3TEDA 1HRI3 3ZQCA 2JWTA 5FQ0B 1XD7A 2ZS6B 2DTZA 4B1MA 3ELKA 2QSFX 3HSRA 2VQUA 3CCUI 1W8UA 1K45A 3N35A 1SEUA 3J26N 4D7SA 3DLLF 4AEJA 2BVLA 1I3AA 5FPXA 1JT6A 4XUTA 1NY71 3VHPA 2ARCA 4HVOA 2STWA 3ZN6B 4JQFA 1MBHA 4XLCA 1POV3 4B3XA 1U5ZA 1W4MA 1UAIA 5F9TA 4IHXA 5IVVA 2P5BA 3RYPA 4D7MA 1RUF1 3CHXA 2EQRA 4A0YA 2MD5A 3HNYM 3ONQA 2LR8A 1J75A 2DJNA 3HJRA 1AYM3 3TOJA 4BBSJ 3LWCA 3K0LA 4BEHB 4A3ZA 2PHXA 4XOTA 2HEWF 4BLJA 5ED4A 3U78A 4B4CA 1UL9A 2WAAA 4CVUA 1YFUA 5T5JA 1XJAA 3AZVA 3DYOA 1BBT1 4MHGA 2ZFWA 3VPRA 4NROA 2PLV1 4E4ZA 4J01A 4MIMA 4UFLA 3WF0A 2PJRB 2CU5A 4CDUC 2K9SA 5EJZB 4AYBA 4UV9A 1H1AA 1R1VA 3DTIA 3BTCA 2PAEA 1LGBA 2R1DA 5KR7A 2DXIA 2ET1A 3ZN4A 1LESA 3N36A 5GZGA 5L7OA 1ZZCA 2GMEA 5B1BH 1GNYA 3FKJA 1XE7A 2W00A 5H2FC 3G7DA 3OUJA 2PN6A 2QQAA 1P4WA 2VD7A 2LVSA 3HG9A 2GXGA 3ZIWA 3AXDA 2VONA 3A4CA 2A3WA 2E31A 4NQWA 3A01B 1ODNA 1K3IA 4DNCA 1SD7A 4XEZA 1ETWA 5FKLA 4BNCA 1LTEA 4QIWN 2IPQX 2JDMA 3HKZN 1IXCA 5L73A 1B35C 1OCZH 1WSUA 5F04A 3CMAI 1W03A 5JLWA 3V8JA 2CSOA 4DEVA 2P17A 1GNZA 4RS5C 1ZYRF 4YZ5A 1DP7P 5L9RA 1ZLKA 3HUGB 5HLHA 4ZTJA 2BQPA 4QQ2A 1LQ1A 2VCAA 5FZOB 3WLUA 4RDUA 4I01A 1R092 4CDWB 3LPGA 2XAQA 2RDPA 3PNAA 3KYCB 3W2AA 3VD9A 2E7AA 2GN3A 3TBIA 4UAPA 5E89A 2K46A 4RGAA 1QHHD 1UB9A 5K7FA 1ND3C 2ZBJA 1W5TA 2CV2A 3ZQLA 3K4JA 3BPZA 1OXCA 2RS32 2WB1A