4CYDA

Glxr bound to camp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
225
structure length
223
Chain Sequence
GVQEILSRAGIFQVDPTAVNNLIQDMETVRFPRGATIFDEGEPGDRLYIITSGKVKLARHAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSAVCVTEVHAATMNSDMLRNWVADHPAIAEQLLRVLARRLRRTNASLADLIFTDVPGRVAKTLLQLANRFGTQEAALRVNHDLTQEEIAQLVGASRETVNKALATFAHRGWIRLEGKSVLIVDTEHLARRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structures of Apo and Camp-Bound Glxr from Corynebacterium Glutamicum Reveal Structural and Dynamic Changes Upon Camp Binding in Crp/Fnr Family Transcription Factors.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transcription
molecule keywords PROBABLE TRANSCRIPTION REGULATOR
total genus 74
structure length 223
sequence length 225
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4cydA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4cydA01
2VOPA 3ABTA 1NZCA 2H27A 4HBLA 4XF0A 4A12A 4ASNA 4S04A 3RYRA 2EFNA 3FZ3A 3TDUC 1YW7A 3WODF 1Z9CA 4YRDA 2OZ6A 5E1WA 2Q0AA 1Z1DA 2DW4A 2DPUA 4KIGA 5E1RA 2JPCA 4RD7A 3ZP5A 4NHJA 4IEOA 5D6FA 2PHDA 3ZMVA 4AVPA 3JAMZ 5FD6A 1T6SA 3I54A 4LB5A 4RGXA 1ZX5A 2Y0OA 3MZHA 1HXDA 2QQ9A 4YNIA 2K9ZA 3WW2A 5BS6A 1U5TB 5HDNA 1P4AA 2AXLA 2D5HA 2QBYB 2ESNA 2PN6A 1QQIA 3GZ5A 4XEZA 4EJOA 5BMZA 5D8KB 5ERIA 4OIRF 1D5VA 3KGZA 4FAHA 2Y75A 4O3MA 1I27A 4NQWA 3NW4A 3S7EA 3HSFA 3RDIA 2GC3A 3PQJA 1W7PA 1X7NA 1XSXA 3FFQA 3HQXA 2FNAA 3GWZA 3H9AA 4YFXF 4X6QB 4L5JA 5KHJA 3ISPA 1JXSA 4E70A 5TJJA 4NVPA 3VODA 2IXJA 4UHTA 4U7BA 4JQFA 4AVCA 1NXMA 1S7OA 5KHKA 1AOYA 5ICGA 4FT8A 3M8FA 2MLKA 3JSOA 3VHRA 4JK1X 1ZZBA 5FLIA 3MPBA 4ZYDA 3ZN1A 3E97A 1P2FA 4ESBA 2GC2A 4YARA 3EHKA 1XD7A 4G8XA 1LRHA 1TW2A 2PLYA 3EO6A 1DPUA 3SHFA 4ETSA 3I59A 3ML6A 6PAXA 5AVPA 1RTVA 2QQBA 1U5TA 3UKVA 1KQ0A 1YHFA 4EWAA 4M9ZA 5CVRA 4A6DA 2HJIA 3R61A 4BXUA 2L01A 3LOIA 4QGNA 3UKNA 2ZCWA 4AIJA 5F1RA 3GUDA 2HR3A 2VOOA 5DUKA 3S7IA 2CWEA 5TRDA 1O3TA 4JVAA 5FPZA 4WX9A 4OFGA 4KUMA 5I0SA 1FOKA 1MJBA 4L11A 1ON2A 4G94A 4P96A 2HTJA 2DQLA 2R7DA 2EFOA 2P5KA 1R1VA 2M45A 4M72A 5HDKA 1TNTA 4WZCA 1H9GA 2D1VA 2PBIA 3KZYA 1YW8A 4HSLA 2QUFA 3RNSA 3V8KA 4LJZF 1O5UA 2O03A 1GHCA 3U10A 4E2QA 1WQ2A 1XGOA 2O0YA 2EV6A 2V1DA 1ZN2A 1SD7A 1IXSB 3SXWA 4LG0A 4XFAA 3H8UA 5DDGA 2WFPA 2VBWA 4OINF 3MWMA 3QAHA 1TQPA 1PP8F 1SMTA 3LAJA 3ELNA 3NKTA 2OA4A 3V7SA 1O5LA 1X82A 4ONUA 3V4GA 2XASA 2GAUA 5EFUA 2GH2A 4KL1A 2OQRA 4LA3A 2P17A 2EA4A 4PIZA 4BIFA 2O1QA 2XV4S 2GA1A 4AIKA 1Z6RA 4I09A 2Z3YA 1RUNA 1CX4A 1REPC 2K02A 4Y17A 3CF6E 3KCCA 2YSRA 4J1XA 4LTAA 1BI1A 2IA2A 4LGWA 1P4XA 4OMYA 4MGZE 1UIJA 3M1EA 3CLOA 1HQCA 4EGZA 2FXAA 3CTAA 3NSTA 1IUYA 4IPAA 3BROA 4I7HA 5J8FA 3LAGA 3COAC 1CAUA 5IT9Z 5J8CA 5FD5A 2VE8A 3E6DA 4MQ9F 4M73A 4XFCA 2L54A 3DFGA 4CYDA 5LGTA 4U0WA 3S2WA 1RIOH 1O7FA 4FAGA 4J1WA 1TTYA 2PMUA 1YWKA 1W5TA 4MGIE 2XLGA 2B0LA 2VT3A 3EDPA 2Q1ZB 5HOOA 2O6GE 2V9VA 2P6TA 3USSA 2YR2A 1OD5A 1OKRA 5LHIA 3VOEA 3H3ZA 1SMYF 1R23A 2QBYA 3Q9VA 4YG2F 2WC2A 3M3IA 4E2SA 4L9NA 3F6OA 1XDSA 3GW2A 3WTUC 4HVOA 1XCBA 5EEGA 4PDKA 4KNYA 4XF1A 1LEAA 4LA2A 1FP1D 4IEWA 3FMSA 4BAYA 1K7AA 1BI0A 3FM3A 1I1SA 5DCMA 2PHLA 2QM3A 5ILVA 2DBBA 4O9EA 5L3EA 4XLNF 2G7UA 1S29A 5HS7A 5C6CA 4MTEA 1ZHFA 4U7DA 2A6EF 1VR3A 3CDHA 5DEQA 3BB6A 5LRRA 2QLZA 3OTFA 4Q48A 2RNJA 2F5EA 4G6DA 4MGRA 4KU8A 3SCHA 2YU3A 1OMIA 4G7OF 4YYOA 2F2EA 1V4RA 3I59B 2JRTA 4EM2A 2HQNA 1LKNA 3JSPA 5H6RA 4KFCA 3IHUA 4KYWA 1AWCA 4LG0B 1U5TC 3RKWA 3CLPA 3HHGA 1XN7A 4KIFA 5LGUA 5CVJA 2ZKLA 3GVAA 1YG2A 3C3VA 3RYKA 1X8MA 4WXCA 3K9TA 3LFKA 5AONA 5JR3A 1K78A 2RGVA 3HIFA 1L3JA 3Q9SA 4AQ2A 3ZMUA 3WU1B 3ES1A 1KA8A 1QNTA 1RI7A 5E16A 2GU9A 2STWA 2BBYA 1I5ZA 4HA8A 3ABUA 4M6YA 1YTYA 2H6BA 4ESFA 1R58A 3F8CA 4KWJA 1EH6A 1HW1A 3KP7A 1OYWA 1ULYA 2RV8A 4P5OA 2IXKA 4KWKA 4M74A 3U2RA 4ESJA 5KVRA 4XSXF 2D93A 3GFMA 2RKHA 2PMHA 3G7DA 5FPXA 5K1YA 5I8SA 1WSUA 3VEPA 2DQRA 2MNGA 2B5HA 4CGZA 3EUHA 4XLPF 2F5DA 1EP0A 2QWWA 3CO7C 1B1BA 1QZZA 1JGSA 3O14A 1MJ9A 1D3YA 1X3UA 1B9MA 3CEWA 2GA2A 4I0AA 1T0FA 2K4JA 1S7AA 1B6AA 5K5QA 2P6SA 4HLYA 5FQ0B 5ICFA 2EWNA 2STTA 1TQ5A 2HGCA 4IEQA 1U3EM 3FZVA 2Q30A 1R1TA 3BOQA 1S3JA 4HX4A 3WTTC 1EH7A 4HAMA 2Z69A 2L4MA 2Q8KA 4I3PA 2XROA 1HKQA 3NJZA 3H3UA 2A5YB 4MV2A 3NL1A 1XSVA 1TLHB 4BHBA 2EV5A 4EROA 2HKOA 1H9TA 3GFJA 2GIVA 3F21A 2VONA 3OCPA 2CV6A 2XL7A 4KICA 2V09A 3BCWA 4EWEA 3LSTA 2W24A 1IPKA 4NB5A 1HBXG 1E2XA 2ZFWA 4HVQA 4UV8A 1Q3EA 5IT9K 5JVTA 1SFNA 1ZNPA 1S8NA 4JV4A 4L5IA 4UVAA 2IP2A 3QPTA 2ZMEA 2D1HA 2COMA 4PGHA 1V70A 3WE3A 1HW5A 2UYBA 2ET1A 3QOPA 1UIKA 3JTHA 2NYXA 4LLGF 3C18A 1MDMA 4YIFA 1A04A 1ZLJA 4OU0A 2QCSB 5D1IA 4JTOA 3GF2A 4HSJA 1IZ1A 4P55A 4IJAA 5HLIA 1P4WA 1XGNA 3KSCA 4N0BA 1WWXA 3I71A 4L0ZB 2EFQA 3LQRA 1ONVA 2QJVA 2B9UA 3KP4A 4KA4A 2KRFA 5K8SA 1YYVA 4AVBA 1W4MA 5FFZA 3IWZA 2BNNA 1QPMA 2VXZA 1P92A 5HS8A 5H20A 3LA7A 4QM9A 1D8JA 4FHTA 4B29A 3ZMDA 4UUVA 1LVAA 3TNPB 2BEOA 5KHHA 3RJPA 1C0WA 2OA2A 4IVNA 3LA3A 1E17A 2EFPA 4I2OA 3KEOA 1R22A 4LLNA 3KZZA 2N7GA 1ZARA 3CO2A 2P4WA 2IXLA 3TKYA 3CJNA 1FYMA 3IL2A 3L2HA 3BJAA 1T2KA 1LR5A 4BHCA 1FBQA 2A3SA 4IEZA 1STZA 4U0VA 4HZFA 3B73A 5L3GA 1SFEA 1ZYRF 2RC4A 2W25A 2E7WA 4KN7X 4EWDA 2PTMA 1XCVA 1RGSA 1R1UA 3MAJA 2BGCA 3I58A 3F3XA 3AAFA 1K78B 1GQGA 2KIUA 2CG4A 2PAEA 1RC6A 1TQIA 4EJTA 2GXBA 2JSCA 1Y9QA 4LFUA 4Q5SF 2MA3A 2DO7A 2XAGA 2XAHA 3NQOA 5FO5A 4QWQA 2FSWA 5ICEA 2OD5A 4E2GA 3R60A 5HLGA 3BP8A 1YIOA 3ZMZA 1J9IA 4LEJA 3U0ZA 2P5VA 5CU1A 4RS8A 1U8RA 4AXOA 3H50A 1UFMA 2IJLA 2UY9A 4IHTA 2M87A 5D6EA 5BPDA 3MZYA 2HOEA 3TO9A 4EGYA 2VBXA 4U0YA 2V79A 3L9FA 4LK0F 2H94A 4WK8F 1J1LA 5JSPA 3E5UA 1B9NA 3L2CA 2QVSB 4HDUA 1O3RA 2Z33A 2Q4SA 4N9IA 2QZ8A 2VECA 5JCTA 1J3PA 1R7JA 4OLLA 5LHGA 2YX7A 1ZZ8A 3MCZA 2VBZA 3V8JA 3T8TA 1H1IA 4G9YA 5DUIA 2IXHA 2OBPA 1IRGA 4HLTA 1J5YA 1CGPA 5CADA 2D2WA 4R79A 3W6KB 4RAYA 4OIOF 2E9QA 5E1XA 2GC1A 4M9XA 2KIFA 1L0OC 3I53A 2CW0F 2FNPA 4LB6B 3ZN0A 2L3DA 4MEYF 3J81K 3JZVA 4CZZA 1EV7A 1CAWB 5KHIA 2MD5A 2P7CB 1UD1A 4JTNA 5KHGA 4XF3A 2V1UA 3H7JA 1GXQA 3DQVC 1J59A 3Q5FA 1CAXB 1R5HA 3V7CA 2MH2A 5DCFA 1RUOA 2G9WA 1LDDA 1XSDA 2ZBKA 2CGPA 3R0AA 1Q5OA 2MPFA 4R52A 4YSFA 2GXGA 4S05A 2R3SA 3DXJF 2O8QA 4D7TA 1OR7A 3GX4X 4AVAA 3IRRA 5A2QK 4L9VA 4HV6A 1ZG1A 5LEKA 4ZZDA 1PP7U 2M30A 4YFNF 5HLHA 1CAVA 5DD4A 3WTVC 5LEJA 5K5RA 2EK5A 3MDPA 3ZPLA 3F72A 2DU9A 1KQ8A 1OFNA 2GC0A 4IHSA 3EQLF 1MDMB 3ES4A 1OYYA 1UCRA 3VFZA 4MGKE 4QM8A 2M1BA 3GYDA 5JFRA 5E20A 2D5FA 2XLFA 2Q2EA 4QLCU 4QGLA 2IT0A 4EQQA 4F8AA 2H0VA 4Q0SA 4GYIA 5L3DA 1DGRA 1G6NA 2L4AA 1W5SA 4IXAA 1HKTA 3CUQA 4AD9A 1J2XA 1YO5C 3SMHA 3RTRA 4O9GA 3KMHA 1KU9A 1ZREA 4GO1A 2JZYA 4HMZA 4RB3C 5H6QA 4XFIA 4LUMA 3BU7A 4HQEA 4HLXA 5D5VB 2HYGD 4Q0QA 1FSEA 2F5FA 1H1MA 2XUBA 3F8FA 3KFWX 5CYVA 2ISZA 4G7ZF 3EYIA 4WCGA 1Z91A 4Q0VA 3FHIB 2B8MA 2QVOA 1GQHA 2ETEA 3QP6A 2NS0A 2BYVE 1ZLKA 2PI0A 3EJKA 3B02A 1IXCA 4ZYEA 1IW7F 1K6OA 4BYYA 4UVBA 3T8RA 4EJVA 1WLTA 2FQ3A 1USTA 1OPCA 1KU7A 4MX3A 3FM5A 3BJOA 4B09A 2GZWA 1JUHA 3OGJA 1UB9A 4P9FA 2E7XA 1TNSA 1FZPB 1KU2A 3RPUA 3RI4A 3DKWA 4MZUA 5C8WA 2M5WA 2FMYA 4WXHA 3WTZA 2NNNA 1UW8A 1G3WA 1Q43A 3ZDSA 1R5GA 3S0MA 1BI2A 2F4PA 1DP7P 2QDRA 3J7AO 5ILUA 1SQ4A 3WW3A 2HZTA 1W7PD 1YW9A 3O2PE 2K0GA 3K0LA 2EA7A 1IN7A 3LWCA 4L18B 2E1CA 2P8TA 4LLLA 5FLJA 3DPTA 2VC1A 1XGMA 2Z9OA 5FFXA 5E8GA 3ZMTA 1CF7A 4ENJA 3FF5A 4XFBA 5F64A 3WGGA 2FBHA 2NRAC 4EM1A 3SHRA 2MHFA 2D40A 1HKSA 5I0TA 1W7PB 4LD5A 1RL3A 3WE2A 2K27A 4Q47A 1HSTA 3CO6C 1LB2A 4IRGA 4IRHA 5E1ZB 1BC7C 2IVMA 4RAZA 3EYYA 4HW0A 5JAXA 2PG4A 3LQQA 2FA5A 3BWGA 2DAOA 2OZJA 1DDNA 2FF4A 1I1GA 3U9GA 1FP2A 3KEQA 5HDGA 1FLIA 1GXPA 3ECHA 2VN2A 5I91A 4IEPA 3BJ6A 3KP2A 4QX5A 2FOKA 4O6JA 3RPQA 4ENKA 4PIYA 3J80K 2EA2A 5D4SA 3BPZA 1FYKA 2HWVA 2BNMA 2A68F 2A07F 5BPIA 3D0SA 1SD6A 3HRUA 4YIIA 3J81Z 1NHAA 4IEVA 5I93A 2H6CA 3T0YA 3G3ZA 1YQAA 2QYOA 2Y48A 4WBBA 1FXZA 4MQVA 1MKMA 1OYIA 2FBIA 3HT1A 3K1MA 5L3BA 5JR7B 4PJYA 2ADUA 2ZNZA 4IRIA 2DK5A 3HOSA 1CF7B 3F6VA 4Q0PA 1KYZA 1UCXA 3L7WA 5AIQA 4KDPA 3PVBB 1QY4A 3WW1A 1YUDA 3H1YA 5D5WB 4L0YB 3WTWC 3H1WA 4UXNA 5A2QZ 3QPHA 3DV8A 4M6XA 1VP6A 1YLLA 2C6YA 2GQQA 3KETA 1FY7A 1ZZ6A 3H1MA 1F4KA 4BNCA 1FT9A 3WTSC 2XIGA 2RQPA 4Y15A 2DK8A 2UZKA 2G7HA 5CJ9A 2XVCA 3L09A 4RB1A 3ACLA 1FBUA 1B59A 3BY6A 3KLNA 1DUXC 3WU0A 4MUVA 2YPRA 1EYBA 2GWRA 2OZUA 3JTGA 1D8KA 4HDVA 1UHWA 4KN4X 5IT3A 3T1BA 1HSJA 2QNKA 1FWZA 3EBRA 3DF8A 2XKPA 4QGMA 2QENA 4LUKA 3NVCA 1IRFA 5BXXA 3IWFA 2Z2SB 2LKPA 3R6SA 3N97A 3IC7A 3CL1A 2W57A 3FXUA 3C7JA 1J75A 1Z6TA 5DYMA 3TQNA 4Z2YA 1DZTA 4A0ZA 3ZMSA 1QGPA 1U6GA 4A0XA 2BV6A 4XRFA 2ZMEB 2IRFG 3BDDA 2XAFA 3SCFA 3DP7A 3ERED 2EAAA 4XETA 2XGXA 1SD5A 1PUEE 1MZBA 3RYPA 1T98A 1O3SA 2UXNA 3SQNA 3HUGA 1FBSA 3GBFA 3GZ6A 3M9AA 1RZ4A 4HN0A 3D5LA 3E6BA 3E3VA 1PDNC 5F6FA 1J3RA 3KP3A 1EY2A 3HT2A 1G4DA 2A6HF 1LJ9A 2KJBA 1H0MA 3DPLC 2PQQA 1P6RA 4WWCA 2OPKA 2PJPA 1EPZA 5J48A 2MBFA 3E5XA 5KBFA 3P9CA 3F8NA 4R1HA 4D7SA 4ZU7A 4XFHA 4YFKF 3E6CC 4MNUA 3K2ZA 1CAVB 5J6XA 2UXXA 5DCMB 2LF7A 4ZU4A 1TW3A 3KE2A 4D0PA 4Y13A 1TBXA 4TLFA 2H09A 2EJRA 2RN7A 4QMAA 5CLSA 2Z99A 3HRTA 2CQKA 2PQ8A 4EMSA 1QWRA 1BN5A 4WVZA 3PQKA 5FLHA 2M8EA 2PEXA 2HEOA 3ROUA 4UNOA 3BZ6A 4PGGA 5E18F 2KKOA 2HKXA 4DNCA 2OYZA 4GXOA 2XHKA 3FWEA 5FLXK 1XMAA 2WWYA 3HSRA 4G7HF 5I0UA 3ECOA 5FGMA 1LDKB 4HF0A 2DT5A 1ZRCA 5E17F 1XB4A 4HBNA 2JPBA 4PCQA 2CFXA 3DL3A 4K8FA 2FMLA 2NNYA 2DFIA 2VC0A 3BPVA 2DLLA 1MGTA 4OIQF 3D0JA 2NAZA 3F8BA 3G73A 1RNLA 4HYEA 1F9NA 3GYHX 3CUQC 4ON0A 1UHMA 3J80Z 1FPQA 1ZAOA 3PNAA 4EJUA 4IEXA 1ZZCA 1SEFA 5JSOA 3E5QA 1TQMA 3LWFA 1B4AA 3CJXA 1U78A 3U11A 1YS6A 4IF4A 2OAZA 1L3LA 1CAUB 1DGWA 4UBGA 1CAXA 2EVXA 1IPJA 3K1NA 2UYAA 4KT5C 1ON1A 4RB2C 1YFXA 4GYGA 3WGHA 4ORFA 3VB2A 4HX7A 1YFYA 4UBHA 3IIAA 3CUOA 4Q4ZF 5I8TA 2ELHA 5J3UA 1QXRA 3ST7A 5CVIA 1BI3A 2VBYA 3HHHA 3QU3A 1O7LA 2V1XA 4AWXB 2WTEA 2IA0A 1G3TA 2FU4A 3U1DA 2VQAA 3EETA 1IAWA 5LLQA 3W6JB 2UY8A 1JHHA 4DINB 4HOBA 4HVRA 2LF8A 4GULA 3FMQA 2FRHA 4BH9A 3IDCB 2PA7A 2XRNA 1ZG3A 2KJCA 2ZNYA 4EV0A 2OQGA 2EFWA 1WRJA 3P9IA 4ENNA 3N4MA 4FX4A 3V8LA 4UV9A 3DEUA 4X6RB 3ULQB 4MEXF 1NYWA 1XE7A 3BPXA 1J0RA 3I5UA 4MTDA 2QQAA 3TOAA 3RIRA 4OIPF 2K4BA 2HTSA 1FNNA 3TNQA 2V6CA 4IETA 2Z5UA 4FBFA 3FMRA 3HTSB 1PMIA 4HN1A 2EB7A 2DTRA 3M7GA 1QXJA 5E8IA 2A69F 3TO7A 5EEHA 3WTYC 5BUVA 2YX4A 4UVCA 1BM9A 1BBYA 3P7NA 4KU7A 1ZGJA 3ELKA 1EH8A 2CSOA 1ZRFA 5DV5A 1VJ2A 2ZO4A 5ILSA 2CO5A 5HVQC 5D5UB 1XE8A 1YFUA 2HYFA 1ZZ9A 1F1ZA 4LULA 3HRSA 2O8XA 2PAKA 3HYIA 4Q29A 3C1DA 3QU6A 2EV0A 4BHPA 3NEUA 3D82A 2Q0OA 1LNWA 1K79A 4JBAA 5BY5A 4EM0B 2CAVA 2LDUA 1ZGAA 3FE5A 3NRVA 1UPIA 2HQRA 3T5XA 3M70A 1IN8A 3O3KA 4CXFA 3HOTA 2JTVA 4O5VA 1MJAA 5L3CA 3ZQ7A 1T38A 5HI0A 3WTXC 5K5OA 2P5LC 1IF1A 4HX8A 4CHUA 4Z82A 3RKYA 2IXIA 1J58A 2ISYA 3E6MA 1ZVFA 4R8HA 3HRMA 2FQPA 1YLFA 4P9GA 3L00A 3JW4A 2F5CA 4HF2A 4XBFA 2X0LA 1R00A 1NE6A 4KWLA 3WGIA 1SFUA 3FHZA 1GVJA 3H92A 3R0JA 2ESHA 3WG9A 4XF9A 2FEZA 4F7ZA 4ZYHA 3UKTA 1NE4A 4I01A 3WW4A 5BPXA 4G6QA 3I7DA 3HTUA 5CVUA 1QBJA 1XGSA 1V3FA 3K69A 1I6XA 1R36A 4HF1A 4HV5A 4A2UA 4EVIA 3F22A 1J3QA 2A61A 3IRQA 4ZH4F 3GO5A 3KGLA 3OF1A 2LSOA 1BJAA 3FXRA 1IN6A 1YFHA 5FLXZ 2HS5A 4LMYA 5HS9A 1U2WA 4RGSA 1BC8C 4A0YA 1Y0UA 1WI9A 1JHFA 4FX0A 2HDCA 1HW2A 3QP5A 1XMKA 3LAPA 3SZTA 2XAJA 1KYWA 2FBKA 1SD4A 5D8LB 1QZYA 3JAMK 2ATFA 1DZRA 2R7FA 1F5TA 5KK1A 1G3SA 3V7RA 2IPQX 5DD8A 5ED4A 3O6BB 5I0RA 1BOAA 5BOXA 3M8EA 3K1PA 2BNOA 1USSA 4WXDA 4N9HA 3KLOA 2ZKZA 2VODA 3GFIA 5EZWA 3GXOA 4UXAA 3I64A 4IESA 2L02A 2K7LA 5T3NA 1J7KA 1OI6A 4DQ2A 3KP5A 1WA4A 2J5OA 1ZH5A 3H7YA 4ZZLA 2MLGA 1FYLA 2CYYA 3IKVA 2XL9A 1JE8A 2D45A 4P9UA 4MGYE 2CAUA 2AS5F 5LRSA 4XSZF 5FQ0A 1XRUA 1SAXA 2JT1A 3DN7A 4H0EA 1Z7UA 4HQMA 4I0BA 1Q1HA 1FI2A 4RGRA 1ZZ7A 1WKMA 2RDPA 4GCVA 2WV0A 2IW5A 4META 5FCCA 3QRFF 3BALA 1CAWA 3TGNA 4CO8A 2MC3A 3EQEA 5JI6A 3SZPA 5FDBA 4LK1F 1O3QA 2ACJA 5BV6A 3GLXA 2J5PA 2HFHA 4I98B 2BE5F 3LZZA 3MFKA 2P7VB 1ZRDA 4M9SA 2PAMA 5BQTA 4A5MA 1DPRA 4I02A 1LEBA 4M71A 2XAQA 2E1NA 1PM7A 2KXLA 1Z05A 1X8EA 3MEXA 3TO6A 2MH9A 2DI3A 3SXYA 2VPVA 3FXQA 2IA1A 3RZZA 4IERA 3GEZA 4KIBA 4IEUA 5LHHA 5JHUA 2ZXJA 4AIHA 4EJWA 2DPDA 1IN5A 4H7LA 4MH0E 4BQAA 2RVCA 5D4RA 3MQ0A 2LNBA 2IXCA 4L9TA 1O4TA 4MHGA 1YS7A 1BIBA 2VE9A 3HSEA 3REOA 4U88A 2UWMA 3OD0A 2W84A 1Y3TA 3OOPA 5L3FA 1KGSA 5CVVA 3TDZC 1U12A 2ZJ2A 3KP6A 4GGGA 4Q0UA 1BIAA 4PZJA 2PYTA 4K2EA 2VT2A 1LQ1A 4ZU5A 2X4HA 3SCGA 3IBMA 3LA2A 4A6EA 5ICCA 3FJSA 3R4KA 1ZG5A 3MYXA 4OMZA 1KU3A 4L9JA 1QO0D 4TV7A 2DCTA 1ODDA 2O61A 5LBQA 5D5XB 4KMFA 2TDXA 3TOBA 1T39A 5JSRA 2XLAA 2K86A 2W85A 3IDBB 3I4PA 2ET7A 3OV8A 3PLQA 4L2NA 2ETHA 1IXRC 2XKOA 1VTNC 1XDUA 5AIPA 5J7MA 1FX7A 1YFWA 4AQ6A 1ZRRA 4Z07A 4RGUA 3C3WA 4KMUX 3FX3A 3RKXA 3SFZA 3F23A 1SFXA 1KQ9A 3PFIA 1IN4A 5LGNA 2FE3A 5FB2A 1O57A 2PFWA 1S6LA 4ZYGA 4XFFA 3GFLA 3P9KA 2C0ZA 3I0TA 4QXKA 4B8XA 1G3YA 4OOIA 2IC1A 2O3FA 2PFBA 4A5NA 3QACA 3F8MA 3IKTA 4ENMA 2I45A 4IEYA 4LLOA 1WGPA 4CDGA 1MD0A 4XFGA 3CUQB 4RB0A 4CICA 2KIMA 1FC3A 4XF4A 1FSHA 2Y0MA 4WF2A 3ETQA 4PIXA 5I8YA 1LDJA 2OU2A
chains in the Genus database with same CATH superfamily
2VOPA 1JUSA 3ABTA 3HL2A 4HBLA 1E5SA 3W2VA 2EFNA 3VBHB 4MHRA 4TXWA 3WLUA 2VB6A 4BB3A 3HQRA 2DPUA 1UPSA 1DGWX 1QJFA 3JBG3 2Y9YA 2JE9A 5E1RA 3M8JA 2VUCA 3MO4A 4E7JA 5EYYA 3A1YA 2PHDA 3NKGA 4QPIA 3I54A 5FOBB 2Y0OA 4YZ1A 2LALA 2K9ZA 3WW2A 1VE0A 2DYCA 2WS93 3K2OA 2KMUA 2AXLA 1GDTA 1CQ9A 4AE2A 4DZPA 2ESNA 5A6ZA 1NCRA 3ZFFC 2X05A 3PIJA 1W8NA 5BMZA 4XBQA 3BKZA 2ELKA 4O3MA 1WLDA 2JG8B 4ZDOA 4TTGA 5EQUA 2ZACA 1DHKB 2F4IA 5IVCA 3G6EI 4TN7A 5FAXA 1XSXA 4AYBN 2FNAA 4X6QB 1IDYA 1W1WE 3N9LA 2VXJA 1D1BA 2K40A 4AI8A 5GAGJ 4H14A 3AZZA 2FHRA 4DOZA 5KHKA 4QPQA 1PNFA 3AVRA 5IVBA 1AOYA 4FT8A 2DMTA 2DT7B 2MLKA 1LU2A 1ZZBA 2H8WA 4ZYDA 3E97A 2GNTA 4B4PA 4CDXC 2GC2A 3EHKA 1XD7A 2NVQJ 5E89A 1HRV2 4KI5M 4NWVA 1W6NB 4QDQA 1JI6A 2BV4A 5AVPA 1TWGJ 4TSVA 1YHFA 4CH7A 1Y8QB 4EWAA 2WNUA 3GTQJ 3A01A 1F2NA 3ZQGA 2QE3A 2L01A 3LOIA 4QGNA 1LGCA 5BNQA 2UWBA 4MO7A 5F1RA 3GUDA 2HR3A 2QFEA 5FY8A 2MC4A 4HSTA 5TRDA 1O3TA 3GXUA 1CONA 4UW4A 1FOKA 1ON2A 4G94A 2QBXA 2R7DA 1HCRA 2M45A 3TEWA 4WZCA 4D5FA 5F7UA 1PYVA 5C8CA 3MHZA 2Z42A 1SFKA 1YW8A 1VQ6I 4U2AA 3RNSA 1LHWA 2HWE2 2ORZA 1O5UA 4OCTA 4E2QA 4OYUA 1ODMA 3SH5A 1NXD1 1COV3 1KXGA 2LOOA 4URTA 1BCXA 4GJYA 5DDGA 2WFPA 4A3JJ 4IQ4A 1U5XA 3MLKA 3JQXA 4UFKA 3ELNA 5EPAA 3NKTA 2ZXWH 1X82A 5FRNA 3V4GA 1B8IB 4D69A 5EFUA 4KL1A 2K5CA 4WZFA 2E2HJ 1RMU2 2YBSA 1W8OA 3ABMH 2XF6A 5LFAA 2E35A 2NMOA 2VQHA 1YJLA 2NQYA 2CWMA 4BIFA 2O1QA 3UR3C 4Y3OA 4ZS3A 1UHSA 1MZ6A 1V00A 4JGZB 2L7ZA 4XACA 1QF3A 1CX4A 4W6YA 4XILA 2R7RA 2BW3A 2HWD2 3JREA 1T08B 2AQFA 2DVFA 1FNZA 3TWIA 2RREA 1FMD2 3BCAA 2IA2A 1RUE1 3M1EA 2V4VA 3P6BA 3CTAA 1OH3A 1IUYA 4I7HA 1KONA 3COAC 3TEDA 1CAUA 3K4NA 1H4HA 5FYZA 5FD5A 5B5EC 1ITYA 4QX7A 3A02A 4QX2A 2K9SA 3DFGA 1RKWA 4U0WA 3S2WA 1RIOH 1R71A 1JKOC 1QXPA 1TTYA 2PMUA 2ADDA 1VBB1 3WT3A 2VT3A 2Q1ZB 2E2IJ 5HOOA 2QQNA 4YW6A 2P6TA 1UXXX 3S8PA 1REEA 1AHDP 1FTZA 4Q4V1 4NN0A 2WNUC 4YGBA 1A6QA 4C0BA 3Q9VA 4NPRA 1R092 2ZXHA 3M3IA 3LFUA 4L9NA 3F6OA 1XDSA 5LA1A 1JKQC 2AREA 2EIGA 4DBQA 2E2JJ 2K9NA 3OY9A 4KNYA 4NJ4A 4IEWA 3I3MA 3TMOA 3FMSA 3LEMA 4BAYA 1HC8A 1UXZA 4MG2A 2HYXA 4D7NA 4DUWA 1BI0A 3ZVXA 5EV7A 4P1WA 1K4TA 2PHLA 4LBNA 5ILVA 2DBBA 1G59A 2ID3A 1ZA4A 3AP9A 1AYN3 1S29A 5LY2A 2DU1A 2HH9A 4HT1T 1XPXA 2LROA 3B6CA 3CDHA 3THTA 4A3MJ 4AG4A 3MFAA 1RHI2 2D6MA 2YPDA 3BB6A 2QLZA 1GFF2 3I2HA 1E5HA 2F5EA 4G6DA 4MGRA 3K4CA 4KU8A 4EN8B 2YU3A 1OMIA 2FCTA 3UK9A 1FPN3 1CX1A 1WJCA 4EM2A 1PX3A 3IHUA 4KYWA 1WMFA 3CLPA 1NK3P 3HHGA 1XN7A 2RDRA 2JA2A 5GZCA 5FP8A 1YI9A 4B3NA 3MW3A 5D2AA 2DBIA 4C8DA 1LGBA 2RGVA 3Q9SA 4BCUA 3OOUA 2RM23 4NRQA 1KA8A 4JQTA 5E16A 2W94A 2BBYA 1VBD2 2WNVA 1UYXA 1I5ZA 4UB8C 1YTYA 2H6BA 4R4XA 2VMDA 1ZTRA 1V5EA 5LBCA 4QXBA 5CKQA 3J7NA 5HCFA 2CU5A 1MZEA 3U2RA 4KBZA 4XSXF 4M3CE 1AYM1 3MV11 3TAYA 1AR82 2WN2A 4YWAA 2R7UA 4JP0A 4PUSA 4COVA 3ZGKA 2DQRA 3MUZ1 4BDVB 5FROA 3ABLH 3O1VA 1ND3A 2DUQA 2RS13 5IOYA 1PZ9A 1X3ZB 1OA3A 3PUAA 4E4ZA 2RAEA 1MNMC 2DF7A 3CO7C 4RHV3 2ZEZA 2XRLA 3ZKUA 3E1SA 3NMBA 1S72I 1QZZA 3ZFEA 1MJ9A 2VUJA 2HDDA 2K4JA 1S7AA 5K5QA 4BDYA 5FY1A 3LF7A 3RI9A 1OD3A 2LR8A 3MZ8A 1OLQA 3BN6A 4HPQA 2A05A 4IEQA 1VBE3 1OISA 2KRCA 1GNHA 3FZVA 2Q30A 1F35A 1GVDA 1R1TA 3BOQA 3MICA 4MYEA 4XC9A 3LIHA 2VXRA 4HAMA 2WNVB 4NIGA 1X1CA 4JHZA 1D2QA 3NNLA 3RS6A 1HKQA 1VQ7I 4QPWA 3L2YA 1UYPA 1NQJA 3OSFA 4MV2A 3NL1A 5J4VA 3H0DA 2EV5A 2M34A 4XJWA 1H9TA 3F21A 4GMP1 2XL7A 2CV6A 2VG9A 3DXUA 4UAPA 2V09A 2DV9A 1Y8RB 2QQKA 4NB5A 2VASA 1QOOA 1E2XA 1H2LA 2FZ2A 4OQ9A 3RI8A 5A32B 4UV8A 4AK3A 1ZNPA 1S8NA 2BQPA 3MKLA 1YYNA 3LQCA 4ZXEA 1DU6A 3LL7A 4FQ4A 2AXTC 4PGHA 4AVVA 1U0JA 3CJRB 3FKIJ 1ULGA 3TEZA 2UYBA 4XQDA 3ZPYA 2GBYA 2NYXA 3NAPC 3C18A 3F9KA 4YIFA 1A04A 2ZGPA 3MKWB 4OU0A 2QCSB 4FASD 5D1IA 1E5RA 3GF2A 1GOFA 1IZ1A 3WP3A 4N0BA 2P6CA 5FY7A 3C2GA 3JD71 1H9PA 5A3PA 3I3QA 5F0FA 1SCRA 2QJVA 2B9UA 4YW7A 1HQWA 2BY1A 2AEZA 2WZPP 5CFCC 2ZAHA 1W90A 1P92A 5HS8A 1S0CA 2JE8A 4QQLA 3S15J 4CEYC 4FHTA 2WA0A 5JIUA 1LVAA 2YXSA 1QJX1 3TNPB 4AEJA 3RZKA 2BEOA 5KHHA 3ZQQA 3V0AB 5FY0A 2HQAA 1C0WA 3VSLA 5LBBA 1C4RA 2A73B 4I2OA 3KEOA 1R22A 1PIV2 1ZARA 2Y6KA 3OYCA 3BUCA 3AL5A 2YBKA 3CJNA 4DMIA 2LC2A 3HVDA 2CHHA 4FI9A 3BJAA 1BLZA 1LR5A 4BHCA 2I10A 1RRJA 1FBQA 1STZA 4A3LJ 1ZBA2 3B73A 3TB0A 1MPXA 1SFEA 2RC4A 5FZ7A 1D4M3 2PELA 3T0DA 3ZMNA 1BVP1 4K20A 3F3XA 2PHRA 1GQGA 2PAEA 2YC4A 2GXBA 4XLAA 1HXS1 1Y9QA 4Q5SF 2Q8DA 4FP2A 5LWBA 1AUYA 2XAHA 2EH3A 1H6YA 5ICEA 2C9AA 2XVGA 4FPJA 1YIOA 1QQP1 5KR7A 4RS8A 4AXOA 3ILRA 5IPAA 3H50A 4Y5TA 1UFMA 1U8BA 4IHTA 4W97A 3TO9A 1QNWA 4EGYA 4HKLA 2VZSA 4P9WA 5D21A 4LK0F 2IS2A 4NIAA 3O12A 5JSPA 3E5UA 2NYYA 3HAGA 4XABA 1B9NA 1M06G 1O3RA 1QA6A 1E5IA 3I3BA 5CEHA 1BMV2 4OLLA 3MCZA 1EV12 3GBGA 2P3IA 4G9YA 2DDUA 5DUIA 2JJ7A 1IRGA 2BFUS 2DFBA 4HLTA 2VNVA 3CQOA 4OIOF 5EZHA 2E9QA 2GM4A 3O1MA 2FNPA 1I3AA 4ES8A 4X6AJ 1HF0A 2YC0A 3JZVA 2VKHA 1CAWB 1KJRA 4M3FA 4W4ZA 2JIJA 4BQ1A 2JG8A 2P7CB 4JTNA 3RPUD 3VBSA 5KAFC 4AGRA 3PUSA 4RHV1 3H7JA 1RUE3 3OGGA 3DQVC 1J59A 1JOJA 3W21A 1OJLA 2OC6A 2KD7A 3V7CA 3WOGA 2G9WA 1XSDA 1PZ7A 5A6YA 1Q5OA 4R52A 1KQRA 4P02B 1S7EA 4S05A 3QLQA 3FHQA 2O8QA 4QX3A 4QKDA 2K9MA 2E6VA 2EIBA 2PHXA 2ZHLA 4P08A 3I49A 2ZX3A 1ZG1A 1MR5A 1GU3A 1PP7U 2WLPA 4L5EA 2E1OA 4YZ5A 3MDPA 1WJAA 4LHLA 4CEWC 3ZPLA 3VBFA 3F72A 5IK4A 2LTPA 1KQ8A 2P5BA 4NHKA 4F91B 1Q8OA 5J1XA 3QYFA 4ZPIA 5E20A 4P5YA 2XLFA 3IMMA 4D1QA 2DVAA 4L92A 3GCWA 3FXOA 4XJ8A 2L7MP 4FETA 4GKXA 4F92B 2XPWA 4Q1RA 5FJKA 1MNEA 4DZJA 3SMHA 1PK6B 4BXFA 4E9KA 3KMHA 1KU9A 4G4FA 1HDPA 4P14A 4HMZA 4D9JA 2P4EA 3DTEA 3S1RJ 4HQEA 4IE5A 4HLXA 3PSIA 2VM9A 4Y1XA 2HYGD 1VB2A 2WL1A 1LHUA 3PNTA 1H1MA 1OQDA 3ZIWA 3FXJA 2XUBA 5CYVA 3EYIA 4P00B 4FVVA 2QVOA 2JDMA 3OPTA 3MIDA 3L2WA 3C7EA 2BYVE 3EJKA 3LE0A 3B02A 1JT0A 2TUNA 4BYYA 1FOD1 2ZZQA 4EJVA 2PQSA 2VVEA 4FOVA 1APLC 1KU7A 3AP4A 2DA3A 1R081 3JU9A 4B09A 3UJOA 5GLWA 2HBUA 4AFDA 4GD4A 1JUHA 3U4XA 5D8AA 2DA7A 1POV0 1JTXA 3T3YA 3KV9A 1TME3 3VSKA 1QHDA 3RI4A 1H8TA 5FMOL 2BRTA 5C8WA 1YCIA 4BM8A 4UW5A 2KT0A 4INDA 1UW8A 4HG6B 2VBPA 3VBUB 5FZMA 5H9PA 1SG3A 3H5AA 1VQ4I 4ZYAA 1JTYA 1Q43A 1NX9A 5JOWA 3T4VA 1BI2A 3L1PA 1KZHA 1FIAA 2B63J 3ZYRA 1IGOA 1YW9A 4E7ZA 3K0LA 2FCVA 1IOAA 2VC1A 3H35A 2Z9OA 1IG3A 4FPCA 1W5CC 3WCSA 2CW7A 3HUGB 3FF5A 5EJ3A 2VZ3A 3H3LA 3VZNA 4AOCA 2NRAC 2G1MA 2D40A 1BR2A 5JOZA 5F6LB 4NAMA 4LD5A 1W6QB 5LBFA 2ZMNA 4JGYB 5GLZA 3CO6C 1JZ2A 5FXZA 1OLRA 1BR4A 4RAZA 4XJAA 4LOTA 2BVVA 2PG4A 2AQEA 2FA5A 2JVHA 4CXXA 1PGW1 2ZABA 4IGPA 1W8HA 4K9SA 5HDGA 4AZZA 5EZGA 1DCSA 5AFEA 4CXYA 2HYKA 4BE3A 3IH2A 2DOAA 4LBQA 3W6VA 3VBUC 3BJ6A 1P9QC 4ENKA 4NC6A 3RPQA 2LTNA 5D4SA 5M3FJ 3BPZA 4V2VA 2BNMA 3NV2A 2A07F 1PO21 2RMU1 5BPIA 2ZPXA 3SC7X 3HPHA 3HRUA 3J81Z 3KB5A 4P5HA 3OBAA 4XHBA 1DQ1A 3HT1A 5L3BA 4JGZC 4ZJZA 4I99C 2ORXA 1VBA3 4CDQA 2WADA 2B9SA 4M3DA 4XTMA 3C7HA 3DPRB 3LPFA 5EG0A 3VDDC 1QY4A 4JKLA 2V6EA 4HKOA 5F5QA 2OCEA 1SLLA 2Q8OA 2C6YA 1RMU1 1FY7A 5EYXA 2EAKA 1HB4A 2X1CA 2VZQA 5DG1A 4OI0A 4BNCA 4LPLA 4BQQA 4JX4A 2UZKA 5APAA 3ACLA 2XVCA 1B59A 1DQ2A 3BY6A 3KLNA 5A6QA 4MUVA 1VB4A 2HVSA 3CP8A 1EYBA 4Q4X2 2GWRA 5DN2A 4B47A 2HDWA 3T1BA 1HSJA 2BOJA 5EHDA 4H2AA 4QGMA 3DGTA 1EJ9A 2PXJA 4LUKA 4B44A 3IPVB 3NVCA 3O0VA 1UN1A 4CUGA 5JVVA 1QDOA 4XUQA 2W57A 3FHNA 4MXWA 2JEMA 3VD9A 4XYXA 5DYMA 1U6GA 2BV6A 1NY72 1BK0A 2DVGA 1CWPA 2FOWA 2Q8CA 1ETOA 5B3SH 1PUEE 2UXNA 3SQNA 3HUGA 1V6KA 4HN0A 1A34A 3HGYA 3D5LA 2LW8A 5F6FA 3I2FA 1X9PA 1OCOH 3DCFA 2AO9A 1JUPA 4JCKA 2KJBA 2DBNA 4CCLA 4BE1A 2DMQA 3VKMA 4COUA 2PQQA 4CUAA 2LBFA 1ACCA 3R4SA 2PJPA 1TP4A 2HWB3 1ERDA 4QPGA 3S16J 3NRUA 2K3FA 3P9CA 1WCUA 1VQ9I 4CDWB 4M00A 3ZXDA 3MKZA 4GWIA 2QF7A 1CAVB 2R30A 1EA3A 2E1MB 1RJ7A 4YM1A 5FR3A 1TBXA 2H09A 2EJRA 3SDGA 1WHUA 2M2EA 2VH9A 1HB3A 3HRTA 4EMSA 1QWRA 1RUC3 3K3OA 1N1TA 4GWJA 1GYKA 1U5YA 4Q8LA 4WVZA 2P2KA 4Q26A 2VL4A 2M8EA 4XRSA 3ROUA 4UNOA 1YJNI 4PGGA 5E18F 2KKOA 1UOFA 5F5AA 2DMUA 5F27A 3SQOA 2QSGX 4LNVA 3LCPA 4GXOA 1YRZA 1XMAA 3MBWA 2RV9A 3VYSB 4G7HF 5C8CC 1QJU2 2AC1A 3ZX7A 2JDPA 2L9SA 4KT6A 2HNHA 2WZR1 1GOGA 2FMLA 5FZOA 2PMZN 2P81A 1YX3A 5L9RA 3VKLA 1Y0NA 3BPVA 2QKMB 2L9VA 1QVUA 1VALA 3EUAA 2JDAA 1OOPB 1WCDJ 2CV1A 3E1F1 4Y5SA 1RNLA 3CDIA 3KD4A 4OMCA 4HYEA 1F9NA 2BVBA 1UMQA 3CUQC 4C3JJ 2LREA 4XORA 2DFHA 2H1LA 1IS6A 4LR4A 3WF2A 2YS9A 5JSOA 2WFF3 2J1UA 3TEXA 5I0DA 3OL4A 3U11A 1MACA 5JOXA 2K46A 1YIPA 5JPMB 1CAUB 1HDDC 5M5XJ 3WF4A 3NQHA 3WQ1A 4A45A 2EVXA 2IWGB 2O9LA 4PI2A 4XURA 2UYAA 1ON1A 4RB2C 3WGHA 4BQOA 2W82A 3PUQA 3CUOA 4BEHA 4Q4ZF 5I8TA 2LRDA 3ST7A 3DCQA 4UUTA 3RZGA 5C4WB 5EEAA 3LSRA 3MGUA 2WR9A 3HHHA 3QU3A 2V1XA 2XR4A 4A7KA 2EINH 3EETA 1WZXA 2XQRA 3W6JB 2ZJPF 5KXEA 4BLJA 1JHHA 4P9XA 4HOBA 1YX5A 1ALYA 1NKGA 3LSGA 4BH9A 4XOTA 2PA7A 4OI4A 3KT4A 3AG4H 1AF9A 2BBVA 2LBFB 4UV9A 2C6SA 1B35C 2RR11 3OPWA 4NNJA 1XE7A 3C7GA 4PK4A 3BPXA 1A8DA 3TOAA 1F5JA 1ND2B 2E7TA 2HTSA 2Y30A 5J37A 2ZSIB 4FBFA 3HTSB 1S0FA 2QQVA 4TZDA 1GZWA 5FKKA 5LA2A 5DDJ2 5EGOB 3VKNA 2W9XA 1FATA 2XPVA 5BNOC 3ELKA 1WCSA 1ZRFA 2QZ3A 4M0HA 1YC61 1RUG1 2HYJA 2ZO4A 2CO5A 1XE8A 4NQWB 2HYFA 3LDBA 1NCRC 3HRSA 3RFRA 2PAKA 3QD6A 1N3PA 1UY3A 4Q29A 5KWRA 3KIOA 5F2WA 2Q0OA 4JBAA 3K4JA 3NRVA 3K4ZA 1R4NB 3M70A 2W47A 1W28A 1EAH2 3NV4A 3HOTA 4ITCA 1RVF1 2W91A 3OY8A 1V6NA 3F95A 3MKYB 5K5OA 1AL0G 2L0KA 1VAMA 2ZMKA 2IXIA 3ME2A 1BEV1 2ISYA 2KQRA 1W0TA 4M4PA 5E3NA 3OG2A 1HRI2 1YLFA 3L00A 2UU8A 3OYFA 4XBFA 1R00A 4C2UA 3OYNA 3FHZA 3OYBA 4GIQA 4F7ZA 3UKTA 4ZYHA 4FPFA 1QBJA 4YGEA 1XGSA 2OS2A 2B42B 1R36A 3LDRA 3KV4A 1OPMA 4IHWA 1B72B 2JD4A 1N3OA 1SVOA 2VJ5A 1IN6A 3VZLA 4AC0A 1YFHA 5DMYA 2WABA 5FLXZ 4LMYA 1U2WA 3TN93 1LCLA 2E31A 2YUEA 1WI9A 1OLMA 1HW2A 3QP5A 4Y52J 1LEDA 2QSHX 4NPMA 1OLTA 3SZTA 2XAJA 4CA0A 2RJLA 4BS9A 2V5YA 3O8GA 5GAEJ 2HWE3 3V7RA 1W04A 5DD8A 5ED4A 3O6BB 1KFUL 2R071 2X5IC 4OZXA 4F3QA 1BOAA 1JU3A 1PVXA 3K1PA 3JRFA 1USSA 1AR93 1IHMA 4WXDA 2ZKZA 5C4WC 1GKBA 3INAA 1V6IA 3GMEA 4UXAA 3I64A 1JU4A 2BUKA 2R7QA 4DQ2A 1LOFC 2XL9A 4JQRA 2D45A 1VMHA 4E8CA 3PFYA 1KEXA 2NM1A 2Y60A 1H1AA 4AFAA 2XONA 2JT1A 2EIJH 1Z7UA 4HQMA 2DCKA 1P7IA 1FI2A 3AP7A 4GCVA 2WV0A 3TL4X 3BALA 4KISA 1CAWA 3HXLA 3TGNA 4CDQC 3SKVA 1HJGA 4E4DX 4HNUA 5FPBA 5JI6A 3FUOA 5DG2A 2HWD1 3IDEA 4ARYA 2ACJA 1R64A 1TMF2 3V64A 4Z6YA 1OOPC 4RR3A 2J1EA 2D6PA 4AM3A 1HQLA 3AZYA 3B3QE 1S55A 3V56A 3VHOA 1VPHA 5BQTA 1V5FA 4A5MA 3AP5A 1LEBA 4DFSA 1PHMA 1Z05A 1X8EA 3MEXA 3TO6A 1DBNA 1MVEA 2ME6A 2DI3A 4CPBA 2MEV2 4IEUA 3M4FA 1VQLI 2CQQA 4AIHA 3GHMA 3K77A 2WNUB 3ECQA 3MQ0A 2VW1A 2E7AA 4L9TA 1TWAJ 3GTLJ 4MHGA 2JIGA 2JJ6A 2VPLA 2JG9C 1F5FA 3N9NA 3CCMI 1GZCA 1B35B 4OI1A 2KZGA 1GMMA 3OYIA 1DQ6A 1CR7A 5CVVA 3KQ4B 2ARBA 4AQTA 1OKOA 4GGGA 4Q0UA 1BIAA 1BW6A 3H0GJ 5B1AH 4CCDA 3CIHA 4GB31 2CRGA 3IBMA 3LA2A 3CCSI 3FJSA 1UOGA 1U9OA 4HETA 4CZCA 2TDXA 3VWBA 2XLAA 4DXZA 1ZBE2 3OV8A 1IV6A 2LRPA 1UU5A 3AMMA 3K4DA 1S0IA 5A7WA 1JYCA 5FYIA 2XKOA 3Q9OA 1FX7A 5CZKA 1YFWA 5D8AC 1ZRRA 4Z07A 3NV3A 3TP3A 3C3WA 3CCJI 3H42B 1J84A 2WZR2 2DN0A 1GP4A 2NVTJ 2FE3A 4BOWA 3GFLA 3P9KA 4B3XA 3I0TA 2JECA 2X9DA 3M2MA 4S2GA 1Y43B 4ENMA 2XJQA 2I45A 4IEYA 1VBC2 2ZXIA 4CDGA 4XFGA 2FMDA 5J96B 3CUQB 5HLTA 5TISC 2IBDA 4QWNA 5JHFA 4KNCA 1TEIA 1DZQA 4ZONA 4PIXA 1R091 1A31A 3W2WA 4DBRA 2VW0A 2D6LX 4ZTFA 5CFCB 2H27A 3RJ2X 4ASNA 4IX7A 2HWE1 4S04A 1JBCA 3TDUC 1X9TA 1YW7A 1KDKA 2M7AA 4DY3A 2OZ6A 2WO2A 1Z1DA 1CESA 3NJYA 5FV3A 4E4SA 3PIGA 1PO23 2HQ5A 2JPCA 1JHJA 3ZP5A 4NHJA 4IEOA 5D6FA 5HNHA 4AVPA 1W6MA 5FD6A 1RXGA 4LB5A 1OHFA 4RGXA 1ZX5A 2QQ9A 2PLV1 4YNIA 2A3XA 3Q0VA 5BS6A 5FJHA 5HDNA 2XF7A 1FMD1 1IS5A 1QQIA 3MD2A 1RPWA 2X53S 4EJOA 3KV5A 4N53B 5ERIA 4OIRF 1D5VA 5CBLA 3WP4A 3S2HJ 2Y9ZA 3PNVA 4QXHA 4XIOA 1ETQA 1NH3A 3PQJA 1W7PA 1ODNA 2MEV1 3N36A 2E51A 3ISPA 3AKZA 3BCBA 2JA7J 5TJJA 5HODA 3VODA 2DFCA 1CZTA 4HRIA 1JUMA 4K40A 4U7BA 2DJNA 4K8RB 5ACA2 1NXMA 1SFYA 5E3LA 2A3YA 4YFWA 4IV1C 3M3QA 2JDYA 5FKCA 4JK1X 2WNVC 5FLIA 2JB4A 1YRNB 1L7RA 3ZN1A 3S14J 1P2FA 4PJLA 2JG8C 3HEFA 2L9RA 4PBPA 1TW2A 3EO6A 1OR7C 1RETA 1DPUA 4Q4W2 2Y2ZA 1HN1A 1ZQ3P 3TN92 3SHFA 1GV2A 3WDVA 3CCUI 2KR2A 4W6XA 1T0FC 3ZYGA 1W03A 3HKZA 4CZSA 1YE9A 5ACA3 1FV3A 2RS31 4JGYC 4B8EA 4M9ZA 2EQRA 5CVRA 3P3PA 4NIHA 4A6DA 2VZRA 2XHNA 2XJVA 3H9GA 3BTZA 2AEYA 2ZEYA 3GTOJ 4NOTA 3S7IA 2EZKA 2QKDA 4JVAA 3ORJA 1G9AA 2O14A 2VZVA 4OFGA 2AUYA 4K1ZA 4L11A 1YO8A 4Q4V3 1WLCA 1IRXA 1R1VA 3SEQA 1H9GA 2R041 1ENHA 2PHFA 3KZYA 3P1IA 4HSLA 5C3OA 4CDQB 3AM2A 5FKBA 4ASLA 1XGOA 2EBIA 2O0YA 1AVBA 3S32A 4Q5OA 2F48A 1YQCA 1SD7A 2WS92 3KLSA 4LG0A 1S0EA 4N43C 3VDBA 2A3WA 5FBJA 5A7SA 1LTEA 3JRCA 3DPRC 5H9SA 1TQPA 1PP8F 2X09A 5FZAA 4B48A 4JDOA 3V0BB 1XBFA 3LAJA 2N8GA 3I2OA 1YJ9I 1X50A 4BBSJ 1TMF3 2YU2A 4ONUA 4FE4A 2WA4A 2XASA 1RESA 2GAUA 2VL8A 2Z1DA 1POQA 2P17A 2YU9J 1H0BA 2NLRA 4PIZA 3CP2A 4YZ3A 4LBMA 4I09A 4B7KA 3NNFA 2Z3YA 2I07B 4FPGA 2VIXA 5EJZB 5CKMA 4WVVA 1CD3G 2YSRA 4J1XA 4LTAA 4PDWB 3WZ1A 5FMCA 4LGWA 4UW6A 1ASJ2 4OMYA 2CY6A 1PK6C 1HQCA 2FXAA 1OCCH 3F0CA 5J8FA 5FYMA 5IT9Z 4LIUA 5J8CA 3VPRA 5DZFA 2ZGSA 2J1TA 3CCLI 3MN2A 4M73A 3ACHA 2L54A 5HBAA 1O7FA 1X36A 1YWKA 1ULDA 1HIXA 5CNAA 3LSPA 2XLGA 2WYSA 3W58A 2B0LA 3EDPA 2O6GE 1ASJ1 3V0BA 3OBTA 2YR2A 2P3YA 1U9NA 5C3SA 1OKRA 3VOEA 1ZELA 2R5YA 4CEWB 1SMYF 3HJRA 2RMU2 4IL6C 2WC2A 2LUWA 3VYRB 1QMJA 1VQKI 4AFBA 3IZOA 1JHNA 1XCBA 1DLLA 3MMYB 1BR1A 4XF1A 3VL8A 3MW2A 3POFA 3UYJA 5EJ1B 3VZOA 1X58A 3CQZJ 4OAYA 3A0NA 2A6ZA 4O9EA 4Q8KA 2OTJI 3SH3A 3OYHA 5HS7A 1QJY1 1ZHFA 1N25A 3GBWA 2DA2A 3LEIA 2DA5A 5FRMA 5BYNA 2NVYJ 4Y4RA 1Q8QA 1QGLA 2RNJA 1YIFA 3SCHA 4XN3A 1VBE1 2RS12 2G0EA 3WDTA 4G7OF 3DLLF 5FP3A 2R7EB 5A7WB 1V4RA 2AHQA 2JRTA 2HQNA 5FZDA 1UYZA 2J7MA 4YM3A 4Q27A 3WHCA 2WN3A 3CNAA 4BE2A 2ZBJA 4KIFA 1RVF3 5A32A 4XLCA 4EZHA 2XJSA 5SV5A 1OC1A 1MBJA 1LFUP 5CVJA 4MXVA 4Z8BA 5FP4A 3GVAA 5IHRA 3JCIA 2AYHA 3RYKA 1HLVA 3K9TA 4N8MA 2ZTNA 1ND2C 1X4PA 3ZMUA 1X3WB 1JZ7A 3RZDJ 2STWA 2DA4A 5FPAA 4HA8A 3ABUA 2CQ7A 3I3DA 3B7MA 4ESFA 1R58A 1OT5A 5FZHA 5FXWA 4NHXA 1W9YA 2RV8A 4P5OA 4BA6A 1DF0A 4M3CF 3UETA 2VMEA 4PDWA 3GFMA 4BACA 2RKHA 5DAQA 3R0RA 4PHZA 2ZHNA 2BOLA 4Z2WA 2MNGA 1BVVA 4OUSA 2B5HA 4XLPF 1LUJB 3AZVA 2QWWA 2WYFA 4GH4A 3WQ7A 2EXIA 4A3FJ 1B1BA 4C90A 2HEYF 2ZGNA 3O14A 5H9RA 1B9MA 3CEWA 1B6AA 1K6YA 2XG3A 3ZYIB 1TQ5A 2HGCA 4KWUA 5M3MJ 1U3EM 1AYN1 4HX4A 2WAQN 3R4DB 2OUMA 2VOWA 2L4MA 2FD5A 4I3PA 2RQQA 4A7ZA 2VVDA 3H3UA 2A5YB 1XSVA 5C33A 4JZRA 4DRRA 2YC2A 4EROA 1JT6A 2HKOA 5FZEA 2GIVA 4AI2A 4V2GA 4KICA 3BCWA 1X1DA 4CDWA 4EWEA 2CFOA 3LSTA 5IJRA 4QKBA 2WO1A 4AIDA 1HBXG 4XXPA 2ZFWA 2VQUA 3RWNA 2A75A 5KC6A 3UNGC 1SFNA 5JVTA 3D3AA 3AFHA 4CCEA 4FP3A 2A1XA 2IP2A 2EILH 2ZMEA 4XLFA 1VBC1 1Z3XA 4XMIA 1R5ID 4U87A 1FOYA 4RA2A 3S5QA 3O7OA 1S4CA 1SMVA 2CUEA 3K4AA 4LLGF 2JRMA 3KHCA 3IN9A 3GZAA 1UZWA 4IOCF 3IAS2 5C9AA 1ENQA 4YG3A 1UKGA 4JTOA 3BYWA 4HSJA 2R7OA 4P55A 1P4WA 2E1MC 5FZKA 3I71A 5B4XA 3VBSC 2GMMA 3WD5A 2EFQA 4CDWC 2ZGMA 1ONVA 1US2A 3A2KA 2KRFA 5K8SA 3RZHA 2VE1A 2DU0A 4AVBA 1W4MA 5FFZA 1DQ0A 5DUVA 4RM2A 2BNNA 5FKLA 5KC5A 2VXZA 3BGAA 3SITA 1OURA 1A35A 2BZDA 1OOPA 3VHNA 1D8JA 1MS0A 3ZMDA 2VVFA 2WKKA 2VNGA 4NC8A 3RJPA 1XC6A 4XJZA 2R063 3ZFFA 3LA3A 2Z79A 3I4IA 4LLNA 1GZWB 2N7GA 1WJFA 3N05A 3CO2A 1JYWA 1WMDA 1R1ZA 5L9BA 1FYMA 5M0TA 3IL2A 4GB32 2IAIA 4HZFA 1Q1VA 2E7QA 1F15A 2KP6A 2QQMA 3BZCA 4YGDA 4EWDA 2PTMA 1XCVA 2CWSA 1KGYA 2VZPA 1RGSA 2VQLA 3KYCB 2XVLA 1IV8A 3SDBA 3AAFA 1K78B 3EUHC 2CG4A 1RC6A 1TQIA 4MIMA 4EJTA 2IXSA 4P9LA 3AG2H 2YB7A 1O8SA 2XAGA 3NQOA 1GV5A 5FO5A 2FSWA 1XNTA 2CTVA 3R60A 3S1NJ 3PVEA 3BP8A 2TNFA 4JDNA 2HPIA 5DDJ1 4V19K 3BG5A 1U8RA 5C4XJ 1HQNA 4G3YC 3GTJJ 4L99A 2IJLA 3CJTB 2UY9A 1JZ4A 2BZTA 2M87A 4H3WA 3VHPA 2V79A 1QU3A 4UFJA 3ZYBA 4WM7C 4XVHA 4RFT0 3GCMA 1G9FA 2E26A 3WDWA 3Q8BA 4H55A 3L2CA 2QVSB 3K48A 1DIWA 2Z33A 4N9IA 2QZ8A 3B5LB 2VECA 4GXLA 3Q8CA 3PHMA 1R7JA 3K4LA 5LHGA 2HZDA 5FTTC 3J9SA 1SC7A 2VBZA 1MBFA 1YXWA 4BJ0A 1FOD2 3PMEA 1H30A 3BODA 2BP6A 1S9HA 4B4CA 1MW7A 5DUUA 4C1XA 1G8WA 1J5YA 1CGPA 5DUXA 3K51A 3K7AJ 5CADA 2D2WA 1K5JA 3SISA 4RAYA 4MADA 5C3PA 2GC1A 5E1XA 3LDKA 4B7EA 4M9XA 2Y26A 3I53A 1T33A 2Y64A 1VBB3 3ZN0A 3S1MJ 4MEYF 1XPWA 4M4RA 4C0HA 1QZEA 5KHIA 2HBTA 3VUOA 1KRIA 1YIJI 1NQDA 1UD1A 2CUZA 4XQ4A 2YFZA 3GJBA 4J01A 4XF3A 2WS91 3WXPA 4A3IJ 4PFOA 1RUC2 4O7XA 3Q5FA 4UFHA 2ZXQA 1TC3C 1ZBE3 3FC0A 5DCFA 1JYNA 2MPFA 3R0AA 2HPMA 4Y20A 3FDYA 3DXJF 2ZFUA 1BA5A 1WJEA 3QH7A 1OR7A 3GX4X 1W8TA 3ESWB 3MPPG 5A2QK 4L9VA 4ZC3A 5LEKA 1YJKA 5CKTA 3ERMA 3CCVI 1LOFA 4PI0A 4ABZA 4ZDLA 5LEJA 5K5RA 2EK5A 1GWLA 3I2GA 3MF6A 1LOAA 4P9YA 4IHSA 3EQLF 1MDMB 3Q8FA 4BQYA 2P0WA 3ES4A 4UF0B 3LSHA 1OYYA 4MGKE 5GJ6A 3F2ZA 3J7YJ 1AYN2 5A3NA 3OUIA 1H88C 4QLCU 1W9SA 4GKYA 4HG2A 1VRH2 3W3CA 2H0VA 4Q0SA 4AI9A 3DYPA 1N47A 4D5CA 4FFIA 3JRBA 2L4AA 4IXAA 1DU0A 1HKTA 3IM0A 4AAXA 4YEJA 1SFOJ 4O9GA 3I55I 3DEWA 4FISA 1AL22 1CVNA 4XFIA 1AKHA 3BU7A 4BQ3A 4XXAA 5D5VB 4Q0QA 1UX7A 4NE9A 5FYBA 4R9CA 4AUXA 1GR3A 4GDFA 2JUCA 4LO4B 2V9PA 5AVAA 5LA0A 4L97A 2GNBA 2VBBA 1AYM3 2ISZA 3HN1A 3FFZA 4Q0VA 2ZB9A 1Z91A 2ARAA 3FHIB 4Y1VA 2LM3A 5L7OA 5CG9A 3QP6A 2NS0A 1ZLKA 4N43B 3HM5A 1IJWC 2BXYA 1K6OA 4YVSA 3T8RA 1JTZX 4HEA2 2FQ3A 5LY1A 1RUI3 2V72A 1OPCA 4MX3A 1V54H 3A21A 3CJIC 1A8MA 3VDAA 3OGJA 3DECA 4W8JA 4P9FA 2ZA9A 3K6GA 2GXAA 3M3OA 3M8LA 3AMHA 2OQ6A 3H5RA 2NNNA 2DA6A 3AKRA 1L7QA 4RS5B 1N1SA 4XDPA 1W6PB 1RYYA 3CDZB 2A5WA 1R5GA 4RHV2 2F4PA 1SDDB 1DP7P 4QQOA 4AEDB 2QDRA 1SQ4A 3WW3A 4XNFA 2KFDA 1SEUA 2EZIA 2NVXJ 4LLLA 3DPTA 1E3PA 4GMP0 1LENA 5EGOA 5A3MA 4ENJA 1VLNA 3AYEA 4XFBA 2FBHA 3SHRA 4D3WA 2MHFA 1HKSA 2AGSA 3WCRA 4BJ6C 4MGSA 1F4HA 1HB1A 4ATEA 1RL3A 2B4KA 1DQUA 2VKDA 3WE2A 2QCOA 4Q47A 1HSTA 1BC7C 3J4UH 5JAXA 1K5MA 2DAOA 1DDNA 3H36A 5FK8A 4COZA 2R32A 2BHYA 4DYQA 1B35A 2JN6A 3CHXA 4Y7NJ 3A01B 4IEPA 2R0HA 3K70C 5K4LA 4IHYA 4FFHA 1ZR2A 2Q1FA 4X8NA 3D0SA 3NNJA 2GP5A 4KG0A 5CA6A 3B69A 5JXGA 5I93A 4ASKA 1C28A 3T0YA 1AR83 3ZFEC 2XB0X 5DTDA 1IC8A 4N53C 2UURA 2QYOA 1JKRC 3JRDA 3KS7A 1SBEA 4MQVA 1MKMA 2FBIA 1YRNA 2ADUA 3POIA 2ZNZA 2JWPA 2X8KA 2DK5A 4QU1A 3HOSA 3FBNB 4RLFA 3F6VA 5JMCA 3L7WA 1YQ6A 3VD3A 3RGBA 3PVBB 2Q5TA 1SANA 3WW1A 2PHUA 1YUDA 3OYMA 2BY0A 2RDSA 4A3GJ 4OQ8A 4UXNA 1ZK8A 4BISA 3ZXFA 3DV8A 4M6XA 2CU7A 5DZEA 1B72A 1WMEA 4CYCB 1E57A 2XUEA 2KL4A 2C26A 2F6CA 3H1MA 2R5ZB 3WTSC 3DKXA 4M0NA 3DUIA 2RQPA 2DK8A 2I5UA 2G7HA 4DNYA 1D4M1 4ZS2A 5A7NA 4ATFA 3NWKA 5C3RA 2YPRA 3VBOA 3C7FA 2W4SA 1D8KA 1Z7S3 1AR92 5IT3A 3D5OA 2QNKA 3RZLA 2DVBA 2YFUA 2RVAA 3GNEA 2XKPA 1R082 5IK8A 3M3CA 4QSHA 4Y4YA 2DT6A 3M1HA 1VQ5I 2YDEA 1IRFA 3JB4C 2X6YA 3R6SA 5J47A 2R062 2JA5J 2JWTA 4FOYA 2DTZA 3POEA 2E5NA 1RUE2 1J75A 2WZR3 4Z2YA 4AYBA 2X5IA 1DZTA 4P9JA 1W6QA 3VDDA 1K5MC 5D8AB 2WNOA 3BDDA 1N1YA 3DP7A 3ERED 3DKQA 1HV1A 1REDA 2E19A 4R4ZA 1QQP3 4XETA 3VB9A 2XGXA 1SD5A 4DOUA 1Z7LA 2IS1A 2VCMA 4LITA 2KIQA 2MEV3 3GBFA 3CF2A 4M6VA 5A80A 1MS1A 3A23A 4C3HJ 2RMU3 1PDNC 2R49A 4LHNA 1MS8A 1AR71 1EY2A 3O5SA 3HT2A 3J7MA 1O4XA 4LIVA 3EUKL 1XQNA 2X1EA 4WWCA 2P37A 1SVLA 2OPKA 2QA4I 1NCQA 2HU9A 4QU2A 5J48A 2MBFA 1F9KA 3BIEA 5FYCA 4ZU7A 4XFHA 5GLVA 4YFKF 3V42A 4MNUA 3BTYA 2JMWA 2JG9B 4LHKA 4Q4W1 3KE2A 3WNMA 4D0PA 4Y13A 5FXVA 1X2NA 4AI0A 2ZZJA 3WNKA 3TW7A 4CCJA 4AFMA 2QZ2A 4QMAA 3J26N 5CLSA 3NAPB 2XJPA 2JXAA 4RQPC 1BN5A 1WW4A 1G8XA 1PO13 5GALA 2HEOA 1NAEA 3FIWA 2HKXA 4PJ0C 2XHKA 3LD8A 1SPPA 5K7HA 5I0UA 2Y69H 5FJ8J 3VBHC 2DT5A 4WM7A 4HBNA 1US3A 2W46A 4LORA 2YMZA 2NNYA 4M3CB 4J00A 4E8DA 3EMRA 1ZR4A 4RBOA 4G6TB 2M4GA 4BXSV 1AX2A 4XPVA 4OHWA 3G73A 1WJDA 1MBHA 4D7MA 3N7KA 4ISRA 4FTBA 4QX0A 1TZOA 1FPQA 4LQRA 2KRHA 4DUVA 1IKQA 3E5QA 1TQMA 3LWFA 1EAH1 4A4AA 3CJXA 2TEPA 3TYJA 1YS6A 4OAZA 1RUJ3 2OAZA 3GF6A 3KT7A 3TW6A 2HVQA 1CAXA 3MEPA 1IPJA 5T54A 1Z3YA 4KT5C 5L7OB 3QPSA 4GYGA 5LZ6A 3CU7A 2X5IB 2ELHA 1R49A 1SLCA 2BHZA 3S3OA 1W6OB 4FSJA 4PBOA 4AWXB 4Z2AA 3SKJE 2WTEA 3U1DA 3URFA 3C7OA 5T5OA 1RXFA 4XOPA 2UY8A 5FUPA 2IGOA 4HVRA 2GALA 2LF8A 1P8JA 4BE0A 3IB3A 1ULPA 4XAEA 3HOBA 1PO22 2JDNA 3IDCB 4SBVA 3CMYA 1XTAA 2OQGA 1WRJA 3RQ4A 3N4MA 4FX4A 4X6RB 4EATA 1GZTA 3AFKA 3I5UA 2QQAA 2BGPA 5F3GA 4OIPF 2K4BA 3TNQA 2KISA 4IETA 5EXOA 3T30A 3I9V2 3VKFC 4ES9A 1R6RA 2C5DA 1WBFA 4B1RA 3S6PA 1REFA 2V9KA 2CQXA 2A69F 3TO7A 4LO8A 1MS4A 3AVSA 5IP9J 5KCMA 1BM9A 1BBYA 3P7NA 4FTHA 1GV9A 1VBA1 5K7ZA 2M3AA 1EV11 2OV7A 3ZYHA 1AR62 3FL7A 3LSEA 1ACIA 2QQIA 1GNZA 1RUD1 2VOKA 4C3IJ 1K79A 1RUI1 2CH0A 1HX6A 1ZGAA 3RMXA 1AL21 2PHTA 2HQRA 3T5XA 3AFGA 1RC9A 3O3KA 3H9QA 1MH3A 2JTVA 4LOCA 1MJAA 4O5VA 5L3CA 1JZ5A 5GPCA 2BPA2 5HI0A 2E33A 3ZYPA 2P5LC 4HX8A 3ZN4A 5CFDA 4XL9A 5L9VA 3E6MA 2VTXA 3K4MA 4FQZA 3OUJA 2NZ9A 2FQPA 5FZ9A 3D5SC 2NXNB 5IFTA 4CP2A 3JW4A 4IO9F 3PL8A 2X0LA 2WZEA 1NE6A 4PLMA 1WZ2A 4F83A 1F8VA 1SFUA 4SLIA 1GVJA 4BBRJ 1AR73 4PCRA 3R0JA 3WG9A 2WY8Q 1NE4A 3WW4A 3D1NI 4OI2A 4MO3M 1V3FA 1CIYA 1IS4A 3AK0A 2NVUB 4RMNA 3F22A 1J3QA 2A61A 3K3NA 5A1LA 5K0UA 4ZH4F 3GO5A 5F1JA 1JXNA 1BJAA 1R1A1 1T8IA 1IPSA 4S2FA 5BNNA 5HS9A 5CFDC 2HWB1 2BOIA 1BC8C 4A0YA 1Y0UA 4B4QA 1JHFA 5FUNA 2HDCA 2IEKA 4GALA 3PTYA 4XDOA 3LEGA 1LOGA 5IYYA 1WW5A 1FX5A 3CDLA 2YY1A 1SD4A 3OYDA 3APBA 4FOWA 5ABJC 3JAMK 2ATFA 1DZRA 2VTXJ 4AI3A 3KX2A 5KK1A 3AYDA 4PT6A 1G3SA 2ILMA 4A6OA 4XTPA 1HJFA 1JGGA 3K2AA 5I0RA 3WHTA 1K4SA 5BOXA 1W8FA 3M8EA 3C8XA 2VZUA 1GQPA 3VDXA 3KLOA 3FN9A 3GFIA 5EZWA 2K7LA 3HC7A 5JZGA 4R9BA 3KP5A 2J5OA 4FO9A 2EIKH 3ZSMA 4IE7A 1FYLA 1PVEA 2MFZA 5IYCJ 1DGRM 5LRSA 2AS5F 1W06A 1SAXA 2H8RA 4RGRA 3Q8EA 1ZZ7A 1Z7S2 2CV0A 5FCCA 4D8MA 2PJRB 4CEYB 3NJVA 5BNPA 3QOEA 1SFPA 2C24A 4IE6A 2FD8A 4CXWA 2FDFA 3DTIA 1O3QA 4NAOA 1MMGA 3GLXA 4EN9B 4I98B 1GP5A 3LZZA 2ZMLA 2P7VB 2W1SA 1T95A 3EB7A 5C8CB 3ONQA 2Y6GA 4I02A 3S57A 4M71A 4HFSA 4HL0A 1RUF3 1BXHA 4HNVA 1QQP2 3MIGA 2R0FA 1N77A 4AHYA 2IA1A 2KDOA 2ZGRA 3S30A 4DS0A 3RJRA 2G9FA 4HSRA 2DPDA 2DA1A 4H7LA 2V73A 4BQAA 1VRBA 4MH0E 3SH4A 1KS5A 2RVCA 1OBNA 2LNBA 2IXCA 2EXKA 2W5FA 4G9SB 2QQ8A 3VD7A 1YS7A 1AR81 2KZVA 1BK1A 3REOA 4HPKA 2HLEA 5GTIC 3OD0A 1BBT2 2R6QA 1Y3TA 5E6HA 1KGSA 3O0XA 2QEXI 5BNPC 2R7VA 3TDZC 4KGGA 2KM2A 2ZJ2A 1PGL2 2HWC3 4DRVA 5GPAA 1QJU3 5KHDA 1DYPA 1JJ8C 2ID6A 1LQ1A 3UL2A 4A6EA 5FBZA 1LULA 1M1EB 1UJ8A 3R4KA 5IW0A 2MSYA 4Q4X3 2PLV3 1W2NA 4L9JA 1QO0D 4JRAA 2R061 2DCTA 1NK2P 2O61A 5LBQA 5D5XB 3PIOF 3DLAA 2XGEA 2K86A 2W85A 4CE8A 4UUSA 4X8PA 4JX0A 3FUQA 3B94A 2M8GX 3IIIA 3O1TA 2I74A 1VTNC 5AFBA 5J7MA 4S2DA 1V9U3 4RGUA 1LJ7A 3RKXA 3SFZA 2WZ8A 1IN4A 5LGNA 4JKKA 1O57A 2PFWA 1S6LA 5HCAA 4MSVA 2C0ZA 2VOXA 1RR7A 4IUGA 5C5TA 1IQDC 2PFBA 4A5NA 1ETYA 3F8MA 3IKTA 4QX8A 5A7QA 3WINE 2Z5WA 3UGGA 3LSIA 1NLSA 1WGPA 3OWTA 1MD0A 1QKQA 3LSKA 4C9YA 1TG7A 5JLWA 4XDQA 3TRSB 2IS4A 4XF4A 4B4RA 2Y6LA 2Y0MA 4WF2A 4CP1A 4FCAA 1BJZA 1LDJA 2OU2A 2XPJA 4Y1UA 3ZFGB 4WVWA 4A12A 3AL0C 3OYWB 4LE4A 1Z9CA 1DG6A 3ACIA 4KIGA 1RHI3 2UUZA 3ABKH 5EF6A 4A3KJ 1EAH3 3AKTA 4RD7A 4LO5B 3VDDB 2W1UA 3NAPA 1T6SA 4JC1A 3MZHA 1HXDA 4I6ZA 4I0WB 5CAZA 5T55A 3BIWE 3MLLA 5G05L 1EUTA 3U37A 3GTMJ 2D5HA 3OIPA 2ZHKA 5JXJA 3GZ5A 2W7NA 3HG9A 5K7FA 5FREA 2B45X 2VW2A 1I27A 4IXLA 2NP0A 3S7EA 3RDIA 4S0HB 1X7NA 3FFQA 3DU6A 1I3QJ 4YFXF 1XC5A 3MVPA 4L5JA 1OQYA 1JXSA 1VBD3 2GMEA 4NVPA 2V1NA 1W8UA 2IXJA 2VJXA 5A70A 4UHTA 4JQFA 4UF0A 3FXKA 4AVCA 1X33A 5FZ6A 1DU3D 2XB5A 3HOZJ 5ICGA 4JX5A 1D4VB 4BZ4A 4LT5A 3JUUA 4IDZA 3MPBA 4HNTA 3J7LA 1ZA7A 4ESBA 4YARA 1PGL1 4G8XA 1LRHA 2W1QA 1TNFA 3AG1H 3KCYA 5FY5A 4AEDA 5C9AC 3RKQA 2E63A 2ZJRF 2GP3A 4PQQA 4ETSA 1A5JA 3I4MJ 3LNQA 3OYGA 1RTVA 2HEWF 2AENA 1U5TA 3UKVA 2VUAA 3KF3A 2HJIA 3R61A 2A6XA 4BXUA 1WH5A 3UKNA 2ZMEC 2ZCWA 4AIJA 2LP0A 2VOOA 2JUGA 1QJEA 3ZQLA 4AL9A 5FPZA 1ORKA 4WX9A 5I0SA 4KUMA 1WKYA 2FDKA 5CFCA 2HTJA 2EFOA 3VL9A 3HNBM 2AR6A 5ABJA 1ASJ3 3MUY1 1D4M2 1QJY2 4BQXA 2PBIA 4OVEA 1UAAA 1ULEA 1GUIA 3RZJA 3V8KA 3SLIA 1HV0A 2O03A 4C91A 1WQ2A 5K0UC 4XN0A 2EV6A 2V1DA 1NA1A 3GALA 2EXHA 1IXSB 4XFAA 3H8UA 4YG6A 4WM8C 1GOHA 5A3WA 3MWMA 3QAHA 4FOQA 4D6SA 3IH4A 1W2AX 3AKSA 3NWTA 3RG0A 1QJZA 3WNPA 1O5LA 3RZOJ 1D0HA 2DJIA 5JXHA 2H0BA 4BY7J 1W39A 4DPNA 2TRTA 5JZGB 1RMU3 4LA3A 4RGAA 4BK5A 2EA4A 4KQ7A 3L2UA 1VZ0A 1F36A 4AIKA 2TBVA 1Z6RA 3LB9A 1A6IA 4B1MA 3BR1A 1REPC 2P3KA 5IOZA 2K02A 4IE0A 4Y17A 2XOMA 1AXYA 3CF6E 3A03A 4EN7B 3HPNA 3N9OA 1R1A3 3ZQCA 1P4XA 4MGZE 1OLME 4BPZA 4EGZA 3JRIA 1OH4A 3PO3J 5EWSA 3LAGA 2VE8A 3E6DA 4XFCA 1U5IA 1R9TJ 4L8QA 4J1WA 3LPGA 1OFCX 5CISA 1W5TA 4DUXA 1MVQA 2V9VA 3NNMA 3USSA 1MNDA 5FO8B 1OD5A 1GLHA 2A70A 5A3OA 4IHXA 3W5NA 2VQTA 2QBYA 5DPNA 3M3EA 3AX4A 4CYCA 5HV0A 4E2SA 1UG0A 1W9TA 4YPJA 4EE2A 5C70A 2JK3A 4OHVA 4NO4A 3P5BA 4W6WA 3WTUC 3TEYA 3FXMA 1H2NA 4HVOA 5EEGA 1WPKA 3G1MA 3CCRI 2RS33 4A93J 1FP1D 2R92J 4CDXB 3WNOA 5JR2A 4R9AA 1WWYA 1QH6A 3FM3A 3HOVJ 5DCMA 2QM3A 4XRMA 4IZZA 2L5QA 4GQ7A 1MEC3 1LHOA 4XLNF 4XQFA 2G7UA 2XC7A 5FZ1A 1CPNA 2R042 1EV13 3OL3A 2PJRA 4CEYA 1VR3A 1S0JA 1XXNA 1VQ8I 2XPUA 1A78A 5LRRA 3OTFA 4Q48A 3T1LA 3ZN6B 1HXS3 1QOSA 4F55A 5F6KA 1FAYA 5DM7F 4ET7A 2JENA 5E3MA 3GCXA 3FKJA 3I59B 1LKNA 3JSPA 1ENSA 4KFCA 1WH7A 3RKWA 1UY4A 2ADEA 3ZCOA 5LGUA 4CCKA 2ZKLA 3CC2I 3C3VA 2KLOA 4AWDA 4WV8A 3EPZA 1X8MA 4WXCA 2WB1A 3OIQA 5AONA 4CVUA 4RAFA 3KWVA 2QQPA 1K78A 3HIFA 4NHMA 4Q4Y2 3ITQA 4AQ2A 3WU1B 1OPOA 3ES1A 2BWCA 1QNTA 1RI7A 2GU9A 2BVMA 3DBLB 3D6EA 3E7LA 1D0YA 3F8CA 4IV1A 9ANTA 1UQXA 5F39A 4JGZA 2OIIA 2YPJA 1STMA 1ULYA 2IXKA 4KWKA 2HWC1 3GJAA 1PVC2 3HOXJ 5KVRA 4W65A 1ND2A 2FDJA 1OA2A 5FUIA 4RYDA 2RJKA 1QJX3 2PMHA 3G7DA 2WWSA 4ARXA 5I8SA 1WSUA 2YGLA 4NR1A 2WIIB 4YVSC 5FRAA 1E3HA 4DYCA 2F5DA 1W6OA 3ZXEA 1L7LA 4HKWA 2JSPA 1AZDA 1KD7A 3AL6A 2XJTA 2UWAA 1X3UA 3KYLA 4Q4Y1 2GA2A 1PVC3 2FCUA 2P6SA 4HLYA 5FQ0B 2EWNA 3C2UA 4RA0A 5GP9A 2EZHA 1H8VA 3PVNA 3AYCA 2ZS6B 4XUTA 2RDQA 5FXXA 1S3JA 3WTTC 1H8TC 1PO12 2O0OA 4LOSA 3HN3A 2ZJQF 2Q8KA 1DP0A 3CCEI 4RAGA 1YOVB 5BNNC 2O8OA 2CW8A 1J83A 4BHBA 3N35A 2VMIA 3OCPA 2VONA 4Q4W3 2ZGUA 1X1PA 4MFDA 2ECBA 2F4LA 3M4OJ 2V4JC 3PDQA 2W24A 1COV2 1NCQC 3VKOA 4AF9A 1TVGA 1IPKA 1ND3B 1O8PA 2ZX1A 2WINB 1URXA 4HVQA 4ZY9A 1Q3EA 2R7XA 5IT9K 3O1PA 4JV4A 1UOBA 2ID4A 3MIFA 3WF0A 3QPTA 5E88A 5FY4A 2COMA 1TMF1 1V70A 4JGYA 3FLRA 3WE3A 1HW5A 3KYDB 3S5AA 3HZJA 1UIKA 4QPIC 2D7FA 1MDMA 1G7YA 1ZLJA 3IAM2 3WEZA 5LCWL 4FPYA 1Y39A 1R4MB 4IJAA 2JE7A 5HLIA 3U4SA 1WWXA 2FZ1A 1VBD1 3HB9A 4L0ZB 1IZ3A 3LQRA 1MSFC 1V9U1 2CYFA 3ZR6A 4KA4A 1TME2 4XKVA 1UZYA 1YYVA 1EF4A 3IWZA 3CCYA 3CESA 2Y34A 3LOBA 2DFEA 3WG2A 5F3CA 1WI3A 3LA7A 4QM9A 1SLBA 3CZUA 4DZGA 1UG2A 3PNYA 3CBNA 2XBO3 5DAVA 2WAOA 3A4CA 2UV1A 2LK2A 2VJJA 4QXCA 3ZSLA 3PJRA 5DM6F 4FTEA 1FOD3 3FHAA 2X6WA 2WSVA 2P4WA 3ZPOA 4BMEA 2RS52 3TKYA 2J42A 4EN0A 1JYTA 1T2KA 4KBBA 4IEZA 3HBZA 2VR4A 5FZ8A 3QCWA 3VD4A 3T2QA 1RUH2 2R043 5BNGA 5L3GA 2EIEA 1ZYRF 2E7WA 4KN7X 2VLAA 1ZBE1 1DGLA 3HWJA 4Y22B 1V5GA 1MBKA 5HCBA 3MAJA 4MOAA 2BGCA 2DUOA 3I58A 4CU7A 5IFPA 4AYUA 2KIUA 1AXKA 5ANNA 2YYOA 4Y22A 2JSCA 2VKVA 4LFUA 3DPRA 3JRGA 2DO7A 3HBKA 4QWQA 2OD5A 4E2GA 4QTRA 4GJZA 1QDCA 5HLGA 4N43A 3KPHA 1NG0A 4CCOA 1TE1B 2EF6A 3ZMZA 1W2UA 5CU1A 2O8KA 3SEPA 2PHWA 1A36A 3I3LA 4J6GA 5GAHJ 2R073 4K7JA 2VTFA 4LBJA 3MF9A 5BPDA 3MZYA 2HOEA 2ZSHB 2PX9A 5EJCA 3GTPJ 1RJ8A 2P1BA 3ZYFA 4YW3A 1J1LA 3TP0A 1F43A 3AMNA 4HDUA 3IDAA 1POGA 1Y56A 5JCTA 1J3PA 1LGNA 1X4OA 4XMYA 5C3EJ 2CDPA 2ZHMA 3VZJA 4QB2A 2YX7A 1XSQA 2VUDA 3H3VK 1AX1A 4BJ5C 1D2SA 3WG1A 4NMIA 3DU5A 3VBFB 3NAUA 5AC91 1IS3A 2OBPA 4UFMA 2BW3B 2X6OA 1GUUA 1EKEA 4R79A 3W6KB 5ACA1 1WBLA 4E6KG 1C5IA 3KVBA 2Z16A 4UI9L 2KIFA 1L0OC 1IO2A 4II2A 1VMFA 2L3DA 1ETVA 1NCQB 5GZDA 1VAVA 1UY1A 2WBKA 3GZNB 2MD5A 5HXMA 1RKTA 3DXTA 4BJTA 4E7HA 2V1UA 3H5NA 2GOMA 4XIKA 3B93A 1FMD3 1CZSA 4JX6A 2R7SA 3IKWA 1QVTA 1R5HA 2MH2A 1RUOA 2E53A 2R0QC 3RWKX 2W00A 2CGPA 1AJOA 4YSFA 2R3SA 2JA8J 1GICA 4D7TA 4CDUC 2VCBA 4XZPA 3IRRA 4PSWA 1H4GA 2EALA 2TCTA 4OMDA 4ZZDA 4GMP3 1OQ1A 5IVYA 2ZEXA 3THPA 3ABZA 1CAVA 5DD4A 3ACGA 3WTVC 4K6BA 3JXSA 3CD6I 5GM0A 3JQWA 3WUCA 1UCRA 3VFZA 4QM8A 2M1BA 4PF1A 1WMXA 4RFRB 1IKPA 2D5FA 1K61A 4LKFA 1OCZH 2Q2EA 1HXS2 4QGLA 1C8M2 1IQAA 1FJLA 4EQQA 4F8AA 4KJZA 3N9PA 4FE7A 4YFZA 5T5PA 5F3IA 1DGRA 2HI3A 1G6NA 4V2FA 5F9TA 3CUQA 4AD9A 1J2XA 5A1FA 5FZLA 1VMJA 3RTRA 4Y24A 4BK4A 3FK7A 1ZREA 2JZYA 3ZQIA 3TBDA 4OWRB 5H6QA 4LUMA 3DYOA 4AW7A 4DEVA 2OX0A 2UWCA 1TWHJ 1BJQA 5J98B 4CA9A 2F5FA 2L9NA 2VCAA 1HDKA 2XWBB 3D4KA 2GSYA 3C2BA 4G7ZF 2NN8A 4CTEA 4GA9A