4CYDA

Glxr bound to camp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
225
structure length
223
Chain Sequence
GVQEILSRAGIFQVDPTAVNNLIQDMETVRFPRGATIFDEGEPGDRLYIITSGKVKLARHAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSAVCVTEVHAATMNSDMLRNWVADHPAIAEQLLRVLARRLRRTNASLADLIFTDVPGRVAKTLLQLANRFGTQEAALRVNHDLTQEEIAQLVGASRETVNKALATFAHRGWIRLEGKSVLIVDTEHLARRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PROBABLE TRANSCRIPTION REGULATOR
publication title The Crystal Structures of Apo and Camp-Bound Glxr from Corynebacterium Glutamicum Reveal Structural and Dynamic Changes Upon Camp Binding in Crp/Fnr Family Transcription Factors.
pubmed doi rcsb
source organism Corynebacterium glutamicum
total genus 74
structure length 223
sequence length 225
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4cydA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4cydA01
3V8KA 1FPQA 5FB2A 4XETA 2PJPA 1TNSA 4R79A 4KYWA 4HN1A 1O5LA 1OI6A 1TW3A 3KP3A 2P5KA 3ZQ7A 5CVJA 2H09A 3SCFA 3IHUA 2DU9A 4DQ2A 1KU9A 5D6FA 2XAFA 1BI1A 3NEUA 2OPKA 4KU7A 3UKNA 1T0FA 4HSJA 2FRHA 4Q0UA 1QNTA 2M30A 2P5VA 1ZZ6A 4IRGA 3ZMTA 4META 1XMAA 1H1MA 1IN6A 3HOSA 2OD5A 4AVAA 4A0XA 1CF7B 1OYWA 1R1UA 2O8QA 4M74A 4LK1F 3MFKA 1B4AA 3H7JA 1J58A 1P2FA 1TBXA 2IRFG 4CGZA 3BJ6A 4UVAA 4QWQA 2FQPA 5JR3A 3SFZA 1OYYA 4HAMA 1E17A 3D82A 1S7AA 3CUQA 3HYIA 3L2HA 3FZVA 1S7OA 2FXAA 3CO6C 2VOPA 5F64A 1FBSA 1WWXA 4FBFA 1NXMA 1XRUA 1HKSA 3EYYA 4HLTA 3QU6A 4DINB 4YIFA 5L3CA 5LRSA 3GYDA 5LEJA 1IN4A 1ON1A 1YFWA 4Y15A 4KT5C 2ADUA 5A2QZ 1XGMA 1RIOH 3SMHA 4XFBA 5DD4A 5ILUA 4L9JA 1BC7C 3I59B 1IXRC 2VN2A 5AVPA 3PFIA 5FFXA 1B59A 1X8EA 1O3TA 2IXKA 3S2WA 2HKOA 2H6BA 3V4GA 2IW5A 3R4KA 2GC3A 2ZJ2A 4YARA 3VB2A 2PQQA 4LTAA 2EWNA 4XFCA 1IN7A 2O6GE 2VE8A 2LNBA 4KDPA 4FX0A 1R22A 3KFWX 4P9FA 1NE6A 2PAEA 4BYYA 2DBBA 5FFZA 1QXRA 2QVOA 4MGYE 1ZYRF 4CYDA 2Y75A 3F21A 4DNCA 4LLOA 1Q3EA 1Q43A 3LWFA 1R36A 4ESFA 3DKWA 3WTWC 1BM9A 5I0RA 2IA2A 4AVCA 4IF4A 1GVJA 1KQ8A 4IRHA 4A2UA 4U7BA 1T38A 4CO8A 1ZZ8A 3V7CA 5JSPA 1O7FA 3KEOA 4PGGA 5LHIA 1UHMA 1FOKA 2KXLA 4ENJA 5E1RA 5DDGA 5E8IA 4ZZDA 3BZ6A 2MH9A 1S8NA 3EETA 3ULQB 3ECHA 4RGRA 1IRGA 4AIHA 1CX4A 1V4RA 4FAGA 1T6SA 4X6RB 4CHUA 3HRUA 3FM5A 1IN8A 4YFXF 2D1VA 5EZWA 3Q5FA 3E5UA 1MDMB 2QNKA 4Y13A 2ELHA 3NSTA 2YSRA 4YG2F 4P9UA 3EYIA 2OQRA 3S7IA 1K6OA 4RB3C 2PAMA 3BPVA 3OOPA 4AXOA 3WTZA 2UXXA 3KP6A 3OGJA 5T3NA 5BY5A 5DUKA 1RUNA 3DV8A 4IESA 2ACJA 3EQLF 2KIFA 2R3SA 3U10A 2ZMEA 3LSTA 4IEOA 2QJVA 1D5VA 4NB5A 5DYMA 2HEOA 4G94A 2IC1A 4R1HA 2V79A 4I02A 2FNPA 2PAKA 4L11A 2ATFA 1XMKA 4XF1A 5ICCA 1O3QA 3I5UA 2VXZA 4N9IA 4R8HA 2IP2A 5E18F 4G7OF 3E5XA 1XSXA 4HYEA 3ZN1A 4N9HA 2G7UA 4XLNF 4L5JA 1FBQA 4XF9A 3CTAA 4HQMA 1EV7A 2Q30A 2EV6A 5D4SA 2B0LA 3ML6A 2EAAA 3CEWA 2EFWA 2MA3A 2CFXA 2OBPA 2Q4SA 2LSOA 2MD5A 4BHBA 5F1RA 1R58A 2RVCA 5BPXA 2I45A 5JSRA 1FBUA 1JXSA 3USSA 3MQ0A 2RGVA 2KIMA 4HVRA 1IRFA 5HLIA 3S0MA 5AIPA 4IJAA 2XL7A 4CXFA 2IA0A 2VBZA 1F9NA 4BNCA 1CAXB 5D5XB 2GQQA 4JBAA 5CJ9A 2R7DA 1SD4A 3IBMA 2WWYA 1BOAA 4P5OA 4ENKA 3IRRA 1YFXA 3FF5A 1Z6RA 2DQLA 3HUGA 5E1XA 2W85A 2XRNA 3BJAA 1HQCA 5HLHA 5KHKA 1KGSA 3HSFA 2BGCA 3ZP5A 5TJJA 3JZVA 1IPJA 2ISZA 4JV4A 2W24A 4HLYA 1TQ5A 1FX7A 2YU3A 2FBIA 4JTOA 2LF8A 2K4BA 3T0YA 2VC1A 3KLOA 3HTUA 4ETSA 2DK8A 2A61A 4E2SA 3KE2A 4AIKA 4M6YA 3LOIA 1MJAA 2NAZA 2VC0A 4QX5A 4S04A 4ZU5A 3RYKA 1XGNA 5A2QK 1FWZA 4QLCU 3GVAA 2XKPA 5LEKA 2VPVA 3FZ3A 4G6DA 3VHRA 3C3VA 1GQHA 3MDPA 4RGSA 3JW4A 2Q0OA 1H9GA 2OA2A 1W7PB 1OKRA 2L01A 2QLZA 1BIBA 2QWWA 3MZHA 3CUQC 3M3IA 4OIRF 1U3EM 3WW4A 3TNQA 1B1BA 2F5EA 3LA3A 4IEPA 3LAPA 2O3FA 2IXCA 2BBYA 1B9NA 4HV6A 1WRJA 4LG0A 4EM0B 2Z5UA 4CZZA 3V7SA 3RJPA 1K78B 4WZCA 4O5VA 5FD5A 4YYOA 4PIYA 2E1CA 2UXNA 4B8XA 2K4JA 4Z2YA 4P55A 3FWEA 5TRDA 2VT3A 5IT9Z 2FMLA 4AVPA 2KJCA 1ZZ9A 3AAFA 3BU7A 1ULYA 1HSJA 2QQBA 3VFZA 2AS5F 4HF0A 2UY8A 2ZBKA 3R0AA 2DT5A 2HOEA 1OD5A 3G7DA 3ZPLA 1Z7UA 4LB6B 4HX7A 3SCGA 2K0GA 1A04A 5BPDA 2ZNZA 2OU2A 2CYYA 2PEXA 5K5RA 1SAXA 1AOYA 1XDSA 3WGIA 4HZFA 3GFMA 2YPRA 2QM3A 3IKTA 1QY4A 5KHIA 3H50A 4E70A 3E6CC 4IXAA 1MKMA 3FXUA 1H0MA 2EJRA 1ZX5A 1D8JA 4F8AA 4QXKA 2PYTA 2Z2SB 1FY7A 2QUFA 3TKYA 1ZG3A 5LLQA 1YUDA 1Y9QA 3LA7A 2VBWA 5H20A 3K9TA 5DV5A 3H1MA 4O3MA 3DEUA 4HDVA 1J3RA 1FLIA 4A0ZA 2LKPA 2A07F 3JSOA 4MGRA 1UIKA 3B73A 4NVPA 3S7EA 4IEYA 2MLKA 2OA4A 2A6HF 5JCTA 3I71A 4YRDA 1IXSB 1T98A 1USTA 1J7KA 1D8KA 5HDGA 1TW2A 3O6BB 2DAOA 4ZYGA 1I6XA 5KHHA 2P7CB 4LLLA 2CSOA 1FSHA 2MC3A 2X4HA 1DDNA 4WVZA 1XN7A 3CJNA 1J9IA 3T1BA 3OF1A 4NQWA 2PLYA 1UW8A 1ZARA 3TO7A 2RN7A 1O7LA 1KQ9A 2C0ZA 5KBFA 1WI9A 2JSCA 1Q5OA 4KMUX 1HW2A 4RD7A 4OOIA 2F2EA 1FC3A 3WW3A 1HKTA 5HI0A 4GXOA 3I7DA 4MGIE 4OMYA 4LLNA 3H9AA 5L3DA 3J80Z 2IT0A 3WTUC 1FYMA 2L02A 5FD6A 2HZTA 1NYWA 1YW8A 4I0BA 1EH7A 1GXQA 4M71A 3QAHA 1R1TA 1JUHA 2E7WA 1IPKA 1BI3A 2Z33A 1AWCA 3WW1A 5J8CA 1J5YA 2B8MA 4M9SA 1YS7A 2QQ9A 3HRTA 1KU2A 3HT2A 1UIJA 2DK5A 5LRRA 5CLSA 4XSZF 5HS8A 5J48A 1G6NA 2K9ZA 2W84A 4KICA 4IEWA 2EV5A 3E6MA 1WQ2A 5DCMB 3RYPA 3GFLA 2L54A 2AXLA 3WE3A 4KWLA 4L5IA 2BNMA 2V1DA 3R60A 1LEBA 2Q1ZB 4HMZA 2XROA 4WF2A 1YFHA 4QGNA 1XGOA 2RC4A 1G3YA 3C3WA 1J75A 2D5HA 4Z82A 2XL9A 5DD8A 2P4WA 1S3JA 3F8NA 4HQEA 4MNUA 1ZLKA 3NRVA 2HDCA 2XKOA 2MLGA 4HBNA 4I01A 3DP7A 4J1XA 3GXOA 5E8GA 3QPHA 1DGWA 4EROA 1I1SA 3E97A 4M9XA 1UPIA 2DPUA 3DL3A 1LVAA 3KZYA 4WBBA 3KMHA 1LEAA 1L3LA 1P92A 3GZ6A 4BQAA 2FMYA 2MHFA 3EJKA 4LA2A 2L4MA 3W6JB 2V1UA 5D6EA 3O3KA 3ZMZA 3EO6A 2BYVE 4OFGA 4OIPF 1U5TA 4OU0A 3ES4A 3EBRA 2XIGA 1LB2A 3BJOA 5IT9K 3EUHA 2F5CA 1RL3A 1G3WA 4AD9A 1YHFA 1YLFA 1KYZA 3RKYA 4B29A 2F5DA 2OAZA 2HQNA 4ENMA 3LFKA 5LGUA 1TNTA 1SQ4A 4UUVA 4M72A 1XSVA 2O1QA 1CAVA 4GULA 4A6EA 1UB9A 2CO5A 4MZUA 1GXPA 2ESHA 4HW0A 2NS0A 1WSUA 3JTHA 4WXHA 2H94A 5H6QA 2PA7A 4M6XA 1IUYA 3CUQB 4UXAA 3HHHA 3CJXA 3F8BA 4XFAA 4U0WA 3CF6E 1YO5C 3HOTA 4G9YA 5JI6A 4GO1A 1LKNA 4M9ZA 1JHHA 2D45A 1K79A 1MDMA 3WTTC 1J0RA 4U7DA 3C18A 5EEHA 3VEPA 2GA2A 3N97A 2CAUA 4EWEA 1SFXA 4LUMA 5I91A 1SD7A 4EM2A 1QQIA 1RI7A 1ZRCA 3GEZA 3JTGA 1XCBA 3IL2A 1XE8A 2ET7A 3LQQA 4KFCA 2M5WA 1TQIA 2HYFA 4L9NA 1ZGJA 5DUIA 3U1DA 4O9EA 4Q0QA 4FAHA 4BAYA 2GIVA 4WXCA 4RGUA 3VOEA 2QDRA 1F4KA 3BPZA 5FDBA 4A5NA 4JTNA 3WU0A 1UD1A 3ETQA 4MTEA 1J3PA 3L00A 1E2XA 3PQJA 5FQ0A 4LJZF 1EYBA 4X6QB 3F8CA 1KU7A 2XAGA 1B9MA 3SXWA 2O0YA 3HIFA 3GF2A 4AVBA 4EM1A 1B6AA 4LGWA 2K02A 4KL1A 1W5TA 1YFYA 4OMZA 5E16A 3TOAA 2K7LA 4MH0E 3ST7A 2C6YA 3TDUC 3RTRA 1DZRA 4A0YA 1O3RA 1YYVA 1YTYA 2A69F 1SD6A 3W6KB 1ZZCA 2FOKA 1YW9A 1FNNA 4HA8A 3BP8A 3GO5A 5ERIA 2YX7A 2UYBA 3J80K 2HJIA 1PDNC 4P9GA 4I98B 2DLLA 1UCXA 2OZ6A 2EVXA 3RNSA 4R52A 3DXJF 1CAXA 4ESBA 4KMFA 4IHSA 3QACA 5ILSA 1SMYF 4HVOA 3WE2A 2Y0OA 3L09A 3M9AA 2PFWA 3H1YA 5ED4A 2CG4A 1O3SA 4PIXA 3RIRA 3WG9A 3LAJA 3M70A 3H7YA 1REPC 4LULA 1J2XA 3PVBB 1RNLA 5BXXA 4HVQA 2WFPA 4H0EA 3I53A 5JR7B 5BMZA 4ASNA 3GW2A 1ODDA 2XAHA 3DFGA 4M73A 5AONA 2D93A 1BJAA 4H7LA 1NHAA 5BOXA 1FI2A 2ZMEB 1EY2A 3FMQA 1LDDA 1U12A 3H1WA 3CL1A 4FT8A 5K5OA 4LK0F 3QRFF 2IXLA 2HTSA 3Q9VA 2QBYB 3O14A 3BOQA 4KIBA 1FP2A 1TLHB 4ON0A 2MPFA 2ZCWA 3EQEA 2RQPA 2JPBA 5FLXZ 4YFKF 3CDHA 5L3BA 3WW2A 2CGPA 4ENNA 3F72A 2PTMA 2EFQA 1TTYA 4UV8A 3IDBB 1X8MA 5FCCA 3V8LA 3IIAA 5JSOA 3K0LA 2DI3A 3PNAA 3Q9SA 3IWFA 2Y0MA 5BPIA 5E1WA 4I7HA 2EA2A 3MZYA 5I8TA 4Q29A 1ZG1A 4UV9A 5FLJA 1LJ9A 2XV4S 1DP7P 3U0ZA 4WXDA 2PMHA 4RB2C 1YLLA 1VP6A 3ZMSA 1Z05A 2K86A 2IVMA 3HSRA 3C7JA 3ISPA 2GC2A 1U5TC 3QU3A 5D5VB 3BDDA 3MPBA 1MZBA 3FMSA 4HF2A 4LB5A 4EJOA 2FQ3A 4HN0A 1SFUA 4MV2A 3FMRA 2GA1A 1GHCA 3RPUA 1WLTA 2EA4A 2Z99A 1R00A 1CAUA 4ONUA 2UY9A 2F4PA 5JVTA 1OPCA 2Z9OA 2STTA 1ZHFA 2J5OA 1YW7A 4P96A 3KLNA 2CWEA 3D0SA 4JK1X 3HSEA 2W57A 3CUOA 1J3QA 1RC6A 3DPTA 3KETA 3L9FA 5LHGA 3TNPB 5EEGA 1P4XA 4LFUA 2P7VB 2P5LC 2GWRA 2N7GA 2W25A 4AQ2A 3BCWA 3COAC 2FE3A 4K2EA 4XEZA 4LLGF 2GXBA 1ZGAA 5E20A 4B09A 1CAWA 2GU9A 1YQAA 3RDIA 5KK1A 3BPXA 5HOOA 3F3XA 5HS9A 3WTXC 1V3FA 4LG0B 4XF4A 5HVQC 1WGPA 4U0YA 3ECOA 2PBIA 1O57A 3GWZA 2M1BA 2FNAA 3CLPA 2ZFWA 2RNJA 5D1IA 1FT9A 2GZWA 1DUXC 5FLIA 2V9VA 2PMUA 2OYZA 3TO9A 2QVSB 1KYWA 3O2PE 2FSWA 5D5WB 4J1WA 4Q4ZF 2NNNA 5AIQA 4Z07A 2J5PA 3WGGA 2EFNA 5KHGA 3HTSB 4OINF 2P6TA 4UHTA 3KP5A 4IEZA 4IERA 1Y0UA 2R7FA 4YFNF 2UYAA 4EMSA 4JQFA 3WTVC 2XAQA 1DPUA 4UBHA 2JTVA 2VE9A 1LR5A 4QGMA 2Q2EA 2JPCA 4HF1A 2IXJA 1KU3A 3NJZA 2NRAC 3RI4A 1RGSA 1SEFA 3NL1A 3GFIA 4MEXF 5ICFA 1LDKB 4D7SA 2WC2A 3H3UA 1I27A 1XE7A 1LRHA 2H0VA 4KWJA 3G3ZA 4MGZE 5K1YA 3K1PA 2PQ8A 4E2GA 1U8RA 2Z3YA 4RS8A 2OZUA 1KQ0A 3KCCA 2D1HA 3FM3A 1TQPA 4PDKA 4BH9A 2BV6A 3HQXA 4ZZLA 2Z69A 1F5TA 2B5HA 3BALA 1QO0D 4KWKA 2DFIA 2CV6A 3MYXA 2EV0A 2XLFA 2JT1A 4ZU4A 4EJUA 4BIFA 2O03A 1CF7A 2COMA 2HFHA 4QMAA 4O9GA 2KJBA 3F22A 1ON2A 2XAJA 4K8FA 5D8LB 4G6QA 1I1GA 5EFUA 1ZN2A 1R5GA 4L18B 3MAJA 3KSCA 1NZCA 1IF1A 5HLGA 3GZ5A 2KIUA 2A3SA 4KIFA 4XFHA 3ZN0A 2IXIA 1IN5A 4XFIA 4OLLA 3P7NA 3P9KA 5I0SA 5FLXK 5DEQA 5CVRA 3ZMUA 2CW0F 2X0LA 1EH8A 5I0UA 3GLXA 1L0OC 1X3UA 1FZPB 1Z91A 3DPLC 1WKMA 4XRFA 4ESJA 3R0JA 1FYKA 3DF8A 1OR7A 4GYIA 1EPZA 2P17A 4LD5A 3NKTA 2PHLA 1YWKA 2DO7A 1SFNA 4Q0PA 3F6OA 4QGLA 5DCFA 1USSA 4HV5A 5IT3A 2IXHA 4KU8A 3FX3A 3I59A 4KIGA 3V8JA 4TV7A 2GAUA 3E6BA 4I2OA 4OIQF 1ZAOA 2PG4A 4I3PA 1XCVA 4D7TA 4HSLA 2KKOA 1YFUA 4PJYA 1OYIA 2VBYA 1BI0A 3F6VA 1C0WA 4CDGA 4EQQA 2M8EA 4N0BA 3HRMA 3SQNA 4BHPA 2ETEA 3BB6A 1YIOA 3IKVA 3FFQA 3GUDA 3UKVA 5HDKA 2RV8A 5FPXA 2ZXJA 4KN4X 3WGHA 3RPQA 3ROUA 3ZDSA 4Q5SF 4XFGA 2FEZA 5JHUA 3BWGA 3BROA 3L2CA 4G8XA 3NVCA 2EB7A 1P4WA 1GQGA 3J81Z 3SZPA 3RZZA 3ZMDA 3P9IA 2F5FA 3IRQA 3GYHX 3M1EA 1J1LA 1V70A 1BC8C 2WTEA 3P9CA 1R1VA 4MEYF 2UWMA 4RGXA 1K7AA 4EJWA 4XF0A 1RTVA 3REOA 3RKWA 4LUKA 5F6FA 1FP1D 2IA1A 4IEUA 3V7RA 1OMIA 1HW1A 4HDUA 5ILVA 1EH6A 5KVRA 2O8XA 4IRIA 3TO6A 2HGCA 2JRTA 5FO5A 5I0TA 1R23A 5D8KB 3D0JA 3FXQA 2QYOA 3C1DA 2VBXA 6PAXA 4IEVA 2ET1A 4QM9A 5CADA 4JVAA 4WX9A 2OZJA 2IJLA 1U5TB 5ICEA 1G4DA 4MQVA 4UVCA 3H8UA 3I64A 2DPDA 3FHIB 2VONA 1U78A 3WODF 2L4AA 5E1ZB 3KGLA 3U9GA 3FJSA 2HS5A 1T39A 1W4MA 1X7NA 3ABUA 2YX4A 2MBFA 1UHWA 3ABTA 1STZA 1VR3A 4A12A 5I8YA 1VTNC 2TDXA 1ZZ7A 1ZRFA 1JHFA 2Y48A 1LNWA 3TGNA 1KA8A 2E7XA 3B02A 4EWAA 4Q48A 4ORFA 1CAVB 3M8EA 2ZNYA 2EFPA 1FYLA 1H9TA 1HKQA 2V09A 5J3UA 3KP4A 4RAYA 4RB0A 1IXCA 4AQ6A 2P6SA 4UNOA 3DQVC 1QZZA 2QENA 5J8FA 4HLXA 4G7HF 4O6JA 1QXJA 1HXDA 3LA2A 1FSEA 2PN6A 3TQNA 5CVVA 2D2WA 4UVBA 2DQRA 4XSXF 5LGTA 3KEQA 4GYGA 4HBLA 4Q0SA 2FBHA 3SXYA 1EP0A 3RYRA 3F8MA 2XUBA 3DN7A 4U88A 2JZYA 1W5SA 2GC1A 4U0VA 4TLFA 3GBFA 2BE5F 2LDUA 2H6CA 2K27A 4MX3A 2Q0AA 2VQAA 3E6DA 1BN5A 3N4MA 2Q8KA 2NYXA 1IZ1A 5LBQA 1O5UA 3KP7A 4IVNA 3OCPA 1BBYA 4MUVA 5ICGA 3IDCB 5FQ0B 1MGTA 2DW4A 4I09A 2LF7A 1U2WA 3OV8A 2QBYA 1IW7F 1S6LA 3SZTA 3ES1A 3E5QA 2E1NA 4D0PA 4BXUA 5C6CA 2YR2A 5CU1A 2ISYA 2XGXA 1MJBA 2STWA 4KNYA 2XHKA 3WU1B 3EDPA 3FXRA 3PQKA 3D5LA 1YG2A 2OQGA 5BV6A 1ZLJA 1U6GA 2PI0A 2P8TA 3VODA 4HX4A 4Q0VA 1ZVFA 1I5ZA 4IEXA 4L0ZB 4WK8F 2D40A 1UFMA 1L3JA 5E17F 3H92A 3JAMZ 1CGPA 2GC0A 3HHGA 1LDJA 5JAXA 4L2NA 1PMIA 1HBXG 4XFFA 4UXNA 4Q47A 1W7PA 2G9WA 4EVIA 2A68F 1QZYA 5K5QA 3NQOA 4EWDA 1QGPA 5H6RA 4EJVA 1SD5A 1LQ1A 2V1XA 5LGNA 4HOBA 2RDPA 2PFBA 1W7PD 5I8SA 3CLOA 2HR3A 4XBFA 4ZYDA 3G73A 1K78A 4KN7X 3LAGA 4AWXB 2CQKA 1XD7A 3BY6A 4WWCA 4GGGA 3ERED 2ZKLA 1DPRA 1PM7A 3M8FA 3J81K 2VODA 1ZH5A 1S29A 1R5HA 1JGSA 2H27A 5CVUA 1O4TA 2VT2A 2XASA 4ZYHA 5KHJA 4IEQA 2KRFA 4HX8A 3ACLA 2QCSB 1SFEA 1XGSA 3ELKA 5BUVA 3PLQA 2WV0A 3SCHA 3GX4X 1RUOA 4I0AA 1QPMA 3K1MA 4FHTA 5FPZA 3I0TA 5BQTA 5L3FA 4IPAA 3LWCA 3NW4A 1Q1HA 3RKXA 1PP8F 2VECA 2HKXA 1BI2A 3I54A 4Y17A 3SHRA 2MH2A 1XSDA 2V6CA 5CVIA 3LQRA 2MNGA 4MTDA 1DZTA 5LHHA 3CO2A 3WTYC 1ZRRA 4LA3A 3OD0A 3M7GA 3I4PA 3IWZA 5HS7A 2DCTA 5JFRA 3KGZA 3FE5A 4EV0A 3K69A 4XLPF 3I58A 3F8FA 1P6RA 4WCGA 4LMYA 4E2QA 1RZ4A 3ZMVA 2HYGD 4ZYEA 2E9QA 5I93A 2FU4A 4PCQA 3GFJA 1WA4A 3KZZA 1Y3TA 2ETHA 4GCVA 1DGRA 4EGYA 3MWMA 2ZKZA 1QWRA 2CAVA 1HW5A 1ZG5A 1TQMA 4A5MA 3QP5A 3ELNA 2GH2A 5FLHA 5K8SA 1Z1DA 3KP2A 2FF4A 2EK5A 4RB1A 2NNYA 4ZU7A 5FGMA 2ZO4A 3T5XA 2QQAA 2RKHA 1P4AA 4S05A 3T8RA 4PGHA 2A5YB 2EFOA 3FHZA 3EHKA 4ZH4F 4RAZA 1CAUB 5D5UB 2DTRA 3UKTA 4KUMA 3LZZA 1OFNA 3WTSC 1JE8A 4PZJA 3E3VA 3H3ZA 3F23A 1J59A 2BNOA 4MHGA 1ZRDA 4LEJA 4L9VA 4KA4A 2HTJA 3MEXA 2BEOA 4IETA 1Z6TA 1PP7U 3HRSA 1D3YA 1X82A 2GXGA 3TOBA 4YSFA 4QM8A 3MCZA 2QZ8A 3QP6A 2BNNA 1CAWB 2XVCA 1XDUA 2G7HA 3K2ZA 4EJTA 4MQ9F 3JSPA 4L9TA 1FXZA 3OTFA 4A6DA 1XB4A 2L3DA 2O61A 2XLGA 2EA7A 1HSTA 3SHFA 3U2RA 2XLAA 5J6XA 4UBGA 2HQRA 1F1ZA 3U11A 1YS6A 4YNIA 4MGKE 4BHCA 5D4RA 1R7JA 2FBKA 2M87A 2PHDA 3CO7C 3IC7A 5L3GA 1ZZBA 5C8WA 1T2KA 1BIAA 4FX4A 5HDNA 2HWVA 3L7WA 1VJ2A 4NHJA 4AIJA 4G7ZF 5J7MA 1PUEE 5DCMA 1ONVA 1Z9CA 3TDZC 4YIIA 3T8TA 4IHTA 1MD0A 2FA5A 3QPTA 4OIOF 2B9UA 2IPQX 4EGZA 5L3EA 2ESNA 4XF3A 3K1NA 4F7ZA 1G3TA 3R61A 4PIZA 2D5FA 1QBJA 3JAMK 1ZREA 4L0YB 5BS6A 2UZKA 1ZNPA 2A6EF 1G3SA 5CYVA 4CICA 1NE4A 3J7AO 1UCRA 1IAWA 1SMTA 3QOPA 1MJ9A 3HT1A 3R6SA 1H1IA 2VOOA 2M45A
chains in the Genus database with same CATH superfamily
3ZN5A 3VV1A 1LPQA 1FPQA 4XKWA 1UAAA 4D8MA 3FXLA 4CDWA 3ZIXA 2V4VA 5T5PA 5HV0A 1O5LA 4FISA 3VZOA 4LORA 4INDA 4KBBA 3T3YA 2YGMA 5JLXA 3IHUA 4BE2A 2DMQA 2A5ZA 2RS53 1A3KA 2BPA2 4K9SA 2VOKA 2WUHA 1BI1A 3NEUA 2VUMJ 3O1MA 1WMEA 2EIKH 3URFA 3AYCA 4HSJA 4QDSA 3VYUB 4Q0UA 1X1CA 1PIV2 3PMEA 2L0KA 2DMUA 4N43C 2BVMA 1XMAA 2DA2A 5CAZA 3R05A 4PUSA 3B00A 4DY5A 4IUGA 3ZR5A 4AVAA 1OYWA 2DJIA 1Q8QA 3DEWA 2HPMA 2O8QA 2PELA 1B4AA 3H7JA 1J58A 4QX2A 2CHHA 4QU1A 4C30A 4KMQA 5FYSA 5FY0A 1DGWY 4RYDA 3LPFA 2FQPA 2HWC2 2AR6A 5TGTA 3SFZA 3F95A 2K3PA 4HAMA 3BTYA 3CP8A 2WO1A 4JQTA 3LF7A 2A5WA 3HYIA 2WSUA 3FZVA 4L0PA 2FXAA 4IZZA 2KISA 2WBMA 4P02B 4K1ZA 5L7OC 1HKSA 1WGXA 4IHYA 3EYYA 1N3PA 3WU2C 4DINB 4XKBA 4YIFA 4YM2A 2ZA9A 3P5JA 2XSJC 1VBE3 3GYDA 5LEJA 1ON1A 4CH7A 2PHUA 5LA2A 4JCKA 2ADUA 2LY2A 3JRGA 1RIOH 4AHYA 2ZGLA 1BC7C 1IXRC 4JZRA 3BU0A 1W5CC 1COV3 5E3NA 5AVPA 2Y31A 2HZDA 3HNMA 1PK6B 1B59A 2OPTA 1O3TA 2DVFA 3S2WA 3AMHA 1MS8A 1QGLA 3MIEA 4XLCA 1X2NA 2VMDA 3VB2A 5GZFA 5JXHA 3K4LA 4BUPA 1VQ8I 3O1OA 3KS7A 4XJ9A 4KDPA 1R22A 4A7YA 1K6YA 2PAEA 4CYDA 3PNTA 1JZ5A 2Y75A 3F21A 1D2SA 2YFZA 2PHTA 1R36A 2C6SA 4ESFA 2PX9A 3WTWC 5A3MA 3MI8A 4XLFA 3KVAA 3N36A 4A2UA 2K85A 3OYBA 5LD2C 1UHMA 4QWNA 4ENJA 4YZ4A 5E8IA 2Y9YA 2MH9A 3VDDC 3HPGA 3HWJA 1ZBE2 3UNPA 1W3VA 1YJNI 2R7RA 1V4RA 3CP2A 4WM8B 2R1DA 3ASNH 1ND2A 3KLSA 4FTBA 1JUMA 2JN6A 4YFXF 3ALQA 2D1VA 5EZWA 2ELHA 1ZQ3P 4YG2F 1NA1C 3ACHA 1N3QA 1BBT2 1YRNB 1ULOA 4RB3C 3KEYA 4M4PA 4AXOA 2ZGRA 3FBIB 5T3NA 1JMUB 2LRPA 4BM8A 4YVSB 1CVNA 5DUKA 4W6YA 5A1AA 4IESA 3ZYJB 2XUMA 4BKXA 3HOUJ 1X3ZB 4HXCA 1CPMA 3B5LB 2XPVA 5FO7B 1IDZA 3ZXLA 2E1MB 1AUYA 1K5MA 2PHWA 3S1NJ 3TRSB 2V79A 3PIJA 4DZPA 2FNPA 2PAKA 1XMKA 3IUOA 4XF1A 1RVF2 2ID6A 4IHXA 2RJ2A 1O3QA 3I5UA 5CQEA 2OQ6A 2OVUA 4N9IA 2WZR1 1QU3A 4R8HA 1ODNA 2H1KA 3TMOA 1O6UA 1XSXA 2ZX4A 3ZLIA 2G7UA 3MHZA 3WDUA 1B35B 1QJX2 3CTAA 2EV6A 5F6KA 3N7KA 2B0LA 2Y0SN 4AEJA 3PIOF 2Q4SA 2OTLI 2RVCA 1FPN2 2IZWA 3H8OA 4CEYC 2WWUA 4ES8A 2KZVA 2KIMA 1OUXA 1F15A 4M4RA 4W97A 1WCDJ 4QKFA 1XQNA 5ACA3 5BNPA 1APLC 4D5FA 1CAXB 3CJTB 3KV4A 2GQQA 3LIGA 1UOGA 1JTZX 1KGYA 2XJVA 2R7DA 2W92A 2WWYA 3ABMH 1SZBA 5LBCA 2RS11 1X50A 2JUCA 3FF5A 4I0WB 1Z6RA 3HUGA 1YQ6A 4IKFA 1ZGWA 2XRNA 4L99A 3I2FA 2JE9A 5HLHA 4C3IJ 4M3BA 4YWAA 4B43A 2GP3A 2ZX0A 4JV4A 3PTRB 3JQWA 3SQOA 2NOJB 4HLYA 2FBIA 1FNZA 2K4BA 2VJJA 3HTUA 1Y1WJ 1GNYA 2ZACA 4M6YA 2HBTA 2F6CA 4YELA 4QX5A 5FP4A 2QKDA 4XOPA 1VBB1 5CKTA 5A2QK 3L2WA 1AYN2 1S1AA 3WNNA 3ILFA 3GVAA 2ZXQA 2VPVA 3FXJA 3SFIA 2RG4A 3FZ3A 2DOAA 3IPVB 4G4FA 4CCOA 2OA2A 3KD4A 2VMHA 1W7PB 5HCBA 1RYYA 4BQ2A 4YZ1A 3CUQC 3B94A 3DECA 3AX4A 3M3IA 2Q8OA 4OHWA 4UT5A 3JRAA 2W7NA 3UGGA 2ME0A 2E60A 3K3NA 4RS5C 4IEPA 3LA3A 4A4AA 2BBYA 1WRJA 2KL4A 3PFYA 1QQP2 4O5VA 4YYOA 3H3VK 4Z2YA 3N9OA 4BOWA 5CEHA 4GJYA 1GWMA 1V5GA 2LD5A 2FMLA 3WNLA 4AVPA 2KJCA 2RR12 3BU7A 2HYKA 2LBFB 1E3PA 2AS5F 4HF0A 4L5EA 4XAEA 3Q8BA 2UY8A 1GR3A 1S2BA 4AFCA 3BZKA 3B6CA 2R062 4YFWA 1H2LA 5A3WA 4B44A 5FY1A 1ST8A 4HX7A 1MACA 2IUWA 3SCGA 4RQPA 1LHVA 1A04A 1H2NA 5BNOB 2OU2A 2LREA 3HOVJ 3LDRA 3SDGA 2PEXA 1VFCA 1DQ0A 4E7JA 1O4XA 4CVUA 2GOMA 3RZMA 5B66C 4FPGA 3CC7I 3DBRB 1ND3B 1RUD3 4AQSA 5APAA 4I30A 5B4NA 4E70A 4Y33A 2OS2A 4TN7A 4IXAA 1V9U1 3HR9A 4WV8A 1D8JA 4F8AA 3EXUA 4YFZA 3DKXA 3K70C 1FYUA 3WOGA 1ZG3A 3RI9A 3LA7A 4Q4V1 4OI0A 3LSIA 4O3MA 2HLEA 3S1MJ 1J3RA 1PGW2 2JG8C 4YM1A 2NVQJ 3UETA 4AEDA 2LKPA 1OLMA 1LFBA 2VW0A 3U14A 3WDVA 3VKLA 4II2A 1DQ1A 2OA4A 2P3JA 2A6HF 5JCTA 2E71A 2YHJA 1C8M3 5JPMB 4QSHA 4R4ZA 4ARXA 2PMWB 1J7KA 2XQXA 3M3QA 1WJ5A 5F5IA 1P7JA 2WNUB 3VBOC 1SMVA 1Q8VA 3ZXJA 3HXLA 2X48A 2X4HA 1TZOA 1H2MA 1LOGA 5D8AC 3ZR6A 5A6ZA 3N7JA 4QPWA 1XU2A 3OF1A 2XOMA 3WINE 4ASLA 2XXZA 4XW3A 3PJQA 2W4SA 1WI9A 1UZVA 3GF6A 1VAKA 4YW7A 2UU8A 1YCIA 1AR82 3OYHA 1UZWA 1B8IB 1HKTA 5CA6A 4ZTJA 1ASJ3 1MH3A 2Q2EB 2TEPA 1ERDA 1UX7A 4JRLA 1FYMA 4A3BJ 3OY8B 5KNLA 4FFIA 3S14J 1EH7A 1GXQA 3QAHA 1R1TA 1BI3A 2Z33A 1AWCA 3EYPA 5J8CA 1E5IA 3VBSC 4M9SA 2VOVA 3HRTA 2NQYA 1KU2A 1UIJA 4AGGA 2FOWA 3HB9A 3JUUA 3JB4C 2L7KA 3BQZA 1ZELA 5DDJ3 5IUQA 1RUH3 1ITYA 3QYEA 5JPNB 4GB31 4GA9A 2LY9A 5HS8A 1IS5A 4KICA 5CG8A 1ZA4A 2X51A 2BNMA 1UU4A 4HMZA 2HWE2 1REEA 4WF2A 4OZOA 1XGOA 3AYAA 1D4M3 4B3AA 1U0JA 5DN2A 2VG9A 1ZLKA 1ETOA 2MLGA 5HPOA 5L9VA 2D6PA 4J1XA 1QH6A 5ANQA 3K10A 3QPHA 3E97A 4M9XA 3PIGA 2LS6A 4PBPA 3BG3A 5FZLA 1XXNA 1QHHD 1WJEA 2LR8A 3WP3A 2FMYA 2WNVA 3I2GA 3EJKA 2VY0A 4D6RA 5FP8A 1RR7A 4HKLA 5D6EA 3O3KA 1X36A 1ZBE1 2VOTA 3TN93 4L9BA 4E7HA 4XJUA 2K9LA 4OZXA 3FL7A 3KT1A 1C57A 1GICA 5IK4A 2WYSA 3BJOA 5IT9K 2EH3A 2F5CA 2R041 2QQJA 3BOPA 2DU0A 1HV1A 3TAYA 3I3QA 5FY8A 4P5YA 2OAZA 1PVC3 2HQNA 1MS3A 4AUXA 3LFKA 5KC5A 1TNTA 1LGCA 1GNHA 2O1QA 3PVNA 2Z4FA 3U21A 1GXPA 1VMJA 5F37A 2J1EA 3DTEA 2XDVA 1WSUA 2V6EA 2FDKA 3I2OA 3HMYA 2CGOA 1FNYA 4RR3C 3CJXA 5LB6A 4XFAA 2W00A 4U0WA 4WM8A 1G9DA 2VKDA 1W2OA 1LKNA 4JKMA 4S2GA 3S1RJ 3ZVXA 2L9VA 3PUQA 1RVF1 5CG9A 2L7FP 2VKEA 1ZBA1 3CCSI 1XYPA 3N97A 2CAUA 4IL6C 4LHSA 1AA7A 4M3GA 1HKDA 5C9AB 5KR7A 2EALA 5I91A 3T30A 5CFCA 1YRNA 3BGAA 4S0HB 2HQAA 2E7AA 3JTGA 3IL2A 2KQRA 1BEV1 1QJX1 2M5WA 4LMFA 3OBRA 2HYFA 2R7VA 2VZUA 3JRHA 4FAHA 1H8TA 2GIVA 1F4KA 2DVBA 3BPZA 5FDBA 3WU0A 3N3HA 1UD1A 2RS32 4XLEA 3PQJA 3WNOA 4D5CA 1FATA 5JXJA 2IBDA 1G2HA 2PLV3 4X6QB 4LHKA 4FE7A 5LBFA 3EMRA 4NJ4A 3FLPA 5FJKA 2XAGA 3SXWA 4LK6A 4GMP3 1MZEA 2O0YA 4LO5B 5J36A 3HIFA 3GF2A 1I3QJ 4ZY9A 4MH0E 2C6YA 3RTRA 1YITI 3P3PA 3UNGC 2ZGUA 5JLVA 5GKAC 2VZVA 2UWCA 1YYVA 3BG9A 1SD6A 3PIPF 5ABJC 1Q8PA 1FNNA 4COZA 2Z42A 4HPKA 3AKRA 2ZFUA 4E7ZA 2L9RA 2QBXA 3J80K 1AHSA 1PDNC 2ZEZA 4I98B 2DLLA 2EVXA 1LHWA 1MBHA 3ABLH 4R52A 1CAXA 4CA9A 4HVOA 1MZFA 3J7HA 5F0FA 4H7MA 1W9TA 3E7LA 1NG7A 2ZGMA 4GQ7A 4PIXA 1FMVA 3BR2A 5SV5A 1U5YA 4HETA 3H7YA 3WQ0A 3I2DA 2WFPA 5A6YA 4GJZA 1ODDA 1AYM2 2E33A 1PO11 3UT0A 1YX5A 1S7EA 2VZRA 5BOXA 3U37A 4FPKA 3U78A 1DYPA 1EY2A 3FMQA 2A3YA 3CZUA 3M4OJ 1S55A 1VIWB 3QRFF 2RR11 4FASD 1RPWA 3O14A 1TVGA 4DMIA 1PVEA 1FP2A 3GTOJ 2ZCWA 5EJ1B 2WBKA 3POGA 1IG0A 2RQPA 1MS1A 1NY71 5FLXZ 4E4SA 4R9BA 4Y1UA 3T09A 5K7FA 1JGGA 2PTMA 3PL8A 1VALA 4AAPA 2W5FA 5FCCA 3LCPA 3HDDA 2DI3A 1VBC3 3BPSA 2CWMA 1POV1 3C7GA 5I8TA 3JR9A 1MPXA 3CCMI 4GH4B 2YDEA 2FQ4A 3PUSA 2C4XA 4AWDA 2ZKNA 1APNA 2B39A 2JG9B 1PGW1 1PM4A 4V2WA 5JI7A 4DBRA 3M8LA 3NJYA 3PVEA 1U5TC 2F6BA 3BDDA 1GT0C 4CYCB 1WH5A 3MPBA 2LY1A 3FMSA 3OL4A 3LEKA 1OKQA 3VZMA 4HF2A 4EJOA 1S0IA 4HN0A 1ND3A 3FMRA 3VZNA 4Y22B 1SFOJ 2CSGA 2ZTNA 2STTA 4XDPA 9ANTA 2AO9A 1F5FA 4JX4A 4NO4A 2IS2A 2E26A 1GSLA 3VHPA 1EUTA 1UPSA 4JK1X 3D0SA 1A36A 5C4WB 2VAUA 3Q0VA 4XTPA 5LHGA 1W05A 1P4XA 2P5LC 2DA4A 4K2EA 4LLGF 2GXBA 3WTXC 2YZ4A 2W2IA 5FKKA 5HVQC 2PJRB 1XNKA 4U0YA 3ECOA 3CC2I 1V6JA 2Y69H 4BY1J 3NKGA 2UWAA 2M1BA 5KXCA 5D1IA 2VNRA 5IK5A 2GZWA 1DUXC 1LECA 2V9VA 3LIHA 3CCUI 1AKHA 2OYZA 3AKPA 5B1BH 3BLYA 2R93J 1SLCA 3TO9A 2EIDA 3O2PE 5LW9A 3M2MA 2DV9A 5FIXA 4Q4ZF 1GP6A 4COVA 2NNNA 5FREA 1MEC3 2J5PA 2EFNA 3SEZA 3HTSB 1LULA 3WDWA 5C3SA 2R7FA 4IQ4A 4YFNF 5EZGA 1POGA 4BU2A 1V6OA 1B09A 3CDLA 5AFBA 4UBHA 1XNDA 2HWE1 2VE9A 2Q2EA 2IXJA 2Q8DA 1KU3A 2KRHA 4A3JJ 3S1QJ 4FETA 2VUJA 1D0GA 2B7YA 3BN6A 1LDKB 4F55A 4D7SA 3DWLE 2EQRA 4JRAA 2WC2A 3H3UA 5F39A 1EAH1 1XE7A 1Z7S3 4KWJA 4MGZE 3K1PA 2PQ8A 2HWF3 1U8RA 4KBZA 1O8PA 2DN0A 2VMEA 4XRMA 1W90A 3P1IA 4ZZLA 4P9IA 2X10A 3D5OA 1QO0D 5JZGC 1LEDA 4UUSB 1R71A 4FPEA 2QQWA 4AHZA 3PURA 1PO21 3MGUA 1XYNA 2AENA 3IMMA 4BIFA 3J7YJ 3VHNA 4QMAA 3AM2A 2KJBA 3F22A 5F27A 3DPRA 5FYCA 2EBIA 2J1SA 2HPIA 4QB6A 3CMAI 5LASA 2R7XA 1ON2A 4AIDA 5FPAA 2XH6A 4G6QA 4QHZA 1I1GA 4BJ5C 2DA6A 2O7OA 2QQ8A 5HLGA 1IDYA 2A3SA 5A3LA 1FMD2 1IN5A 2A6ZA 5A7SA 4OLLA 3JB8A 3P7NA 3P9KA 5I0SA 5DEQA 1ZRIA 5A33B 3HEFA 3I97A 2X0LA 1VQNI 1FZPB 2WQ8A 2XSDC 3R0JA 2ARCA 1W28A 1FYKA 3W9AA 1W8ZA 1OR7A 1IKPA 1SG3A 3BG5A 1EPZA 2P17A 2WY7Q 4XONA 2WWSA 4OCTA 3NKTA 1SLTA 3BOWA 1ENSA 1JZ7A 3F6OA 4JX6A 5DCFA 1USSA 5IT3A 4KU8A 4OMDA 4KIGA 1CJPA 3V8JA 3N9PA 4TV7A 2GAUA 4OIQF 3HBLA 4EATA 1AX0A 2WINB 5HLTA 1C0WA 1OH4A 4BZ4A 4XQDA 4AI0A 3SQNA 4BHPA 2JKBA 2P0WA 1UYZA 5KXBA 3IKVA 4BQXA 4N4NB 3ZQQA 3GUDA 5HDKA 3ZFFC 2EICA 2ZXJA 1LUJB 2DFBA 3RPQA 3ROUA 2RS52 2ZAHA 4Q5SF 4AFAA 4XFGA 2BOJA 3BWGA 3L2CA 2RS31 2JDUA 1YJ9I 2EB7A 5B2GB 3WP6A 2ZB9A 4YM0A 4Y5Z0 3MPPG 4FQGA 2F5FA 3GYHX 5GLWA 2O5RA 3P9CA 1ODMA 4V1PA 4RGXA 4XF0A 3ZXSA 2OIIA 2YYOA 2JD9A 3RMXA 5C33A 2IA1A 4IEUA 1OMIA 1YOVB 4HDUA 2LP0A 5ILVA 3S2HJ 3OYGA 2XR4A 4AVTA 2WB1N 5L73A 1EH6A 2BBVA 5KVRA 2AZ5A 2I07B 2WAFA 4AEMA 2O8XA 4P00B 3WG4A 4K7JA 5FO5A 2LH9A 3MUY1 4AYBA 5D8KB 3IDEA 2QYOA 2KD7A 1UYYA 2ET1A 2QQPA 1PGSA 1LENA 4WX9A 1RJ7A 1X9PA 2OZJA 4MO3M 1I50J 2IGMA 5C8CB 3I49A 2YUEA 3I64A 2DMNA 1W6OA 2KDZA 5E1ZB 4NHKA 5FJ8J 3U9GA 1GDTA 1JYTA 2XC7A 5FKOA 1W4MA 1DIWA 3ABUA 2J7MA 4BA6A 5B3SH 3O0VA 1U9OA 1COV2 5CISA 2WT1A 4M3CA 2I74A 4EWAA 1UG2A 3NAPA 5F2WA 2ZGKA 4AU7A 2ZNYA 2EFPA 1H9TA 2V09A 5LK5A 4XDQA 4IGOA 2WNEA 4JX0A 1B72B 3W5NA 5GADJ 2E7TA 4HLXA 2NLRA 4A3IJ 2Q1MA 3CLQA 2AGSA 3CZ6A 1DBNA 4QX1A 1FSEA 4TZDA 2OQ7A 2PN6A 3TQNA 3LOCA 1IRXA 4XSXF 4HBLA 4KWUA 1GP4A 3RYRA 4WZFA 2XUBA 1UY4A 2Y8KA 1VI0A 2JZYA 1N3OA 4FP2A 1W5SA 3UJOA 3K4AA 1CR7A 1HQNA 4U0VA 2CTVA 2O9LA 4MX3A 3WP4A 4MADA 3E6DA 4NIDA 1BN5A 2Q8KA 2QUOA 3ZKYA 2NYXA 4XUQA 3BI3A 5FY9A 1F8VA 3D6EA 3KP7A 3OCPA 4C1XA 1PVXA 5ICGA 1W8TA 5FMOL 1JYCA 5DG2A 2RM23 4BB3A 5A3UA 3E5QA 2E1NA 5LY2A 1JZ3A 3JRBA 2X09A 5KC6A 5C6CA 4LOTA 5IY5H 4KNYA 5IYYA 2FJ1A 5FZHA 3WU1B 5FWEA 2Z1DA 1OH3A 3PQKA 4FPJA 4XQ4A 2OQGA 4Y20B 1PJRA 2VI6A 5DZFA 5HBAA 1MBFA 1AL21 2EINH 1CPNA 1I5ZA 5FP3A 4FSJA 3OGVA 1UELB 1HRI2 2GC0A 5DUXA 1LDJA 1H1AA 1HBXG 4XFFA 1CESA 3OL3A 1A35A 2BDRA 4JGZB 1KQRA 5K5QA 2WZR3 1QGPA 4NUBA 1SD5A 2V1XA 2A70A 5EQUA 5TISC 1IHMA 1VRH1 2EILH 2HWB1 1PGL1 3IIIA 3NWKA 2HR3A 4XBFA 4BMEA 4OI1A 2M4GA 4F3JA 2V1NA 3BG6A 2N8GA 4KN7X 2WYFA 2VE1A 2DODA 1DPRA 3DYPA 1ULFA 3AZXA 4HKWA 2UWBA 3OYWB 3J81K 1ZH5A 1R5HA 2H27A 2VW2A 1XBFA 2XASA 4CCNA 2P81A 2WR9A 4KT6A 4HX8A 5HNFA 1ETVA 1XGSA 1PK6C 3PLQA 1WJBA 4QX7A 2ZS6B 3SCHA 3GX4X 1MMGA 3G71I 4XBNA 4CA0A 3HN3A 5C4WA 2WO7A 3SH3A 1UMQA 3K1MA 2W1WA 3AP9A 5CB7A 3OIPA 5BQTA 1XC6A 1OQDA 2G9GA 4IPAA 4COWA 1Q1HA 3RKXA 1T95A 4X1EA 1W0NA 4KI5M 5KAIC 3I54A 2MH2A 5E88A 2V6CA 4NC8A 1MZ5A 5FMDA 5LHHA 1DYKA 2Y26A 2HOSA 5JFRA 3MIFA 4EV0A 4YGCA 4XLPF 2X1EA 3I58A 4KG0A 2QZ3A 3ERMA 2IWGB 4LMYA 4E2QA 2O14A 4IE7A 4ZYEA 2ZJQF 4A3ZA 1WA4A 2IS4A 3KZZA 3G1LA 1DGRA 3SH5A 1R081 2X1CA 1ZR2A 1K4SA 3VL9A 3VD9A 4WM8C 2CQNA 3JQXA 4YVWA 2EXJA 5FLHA 4Z2AA 3H5AA 1UKGA 5K8SA 3TW6A 3KP2A 4RB1A 4ZU7A 4RGGA 3S16J 4XHXA 2GN3A 2ZO4A 1SEUA 1FX5A 1UZCA 3UGFA 1NG0A 3T8RA 3VDBA 1FOD1 4IV1B 4DS0A 3ZXKA 2XB0X 4XUTA 2YUSA 1XSRA 3LSRA 1XPXA 4YVSC 3FHZA 3EHKA 4KJZA 1A31A 4B1LA 1HOMA 1RUG1 3UKTA 3E1SA 4KUMA 5CPRB 3GCXA 3WTSC 1UY2A 4XUOA 1J59A 4CCKA 3T4HB 2E1MC 3A01B 1ZRDA 4QD2A 1NLRA 3VUOA 4L9VA 2LW8A 3RZLA 4QPIA 3S6PA 4RDUA 4IETA 1JOBA 4DZGA 4UUSA 2M0CA 5M5XJ 1X82A 4B7KA 4RLFA 4CDQB 3K4JA 1V54H 3HOYJ 4YSFA 2RAEA 2ZXWH 3MCZA 4GKXA 4QM8A 3J9SA 1VAMA 2VUDA 1CAWB 2RHPA 4WM7B 3F2ZA 3OTFA 2WQZC 5T55A 2R5ZA 1RUD2 1XB4A 3LFIA 4QHBA 1V9U3 1B35C 2HQRA 3U11A 1YS6A 4AR2A 5D4RA 2M87A 3K77A 4Q4V3 3S17J 4B4PA 4BQOA 3AYDA 1WD4A 1BL0A 4UB8C 1W0UA 4G7ZF 5J7MA 1LFUP 4BACA 5DCMA 4HRIA 4B8EA 4IHTA 4W8JA 5FOJB 3QPTA 4OIOF 3B6AA 4DXZA 2RS51 1QEXA 4ES9A 5LK7B 1U5XA 4XF3A 5I0DA 4K40A 5FRAA 4AFBA 1EKEA 2D5FA 1ZREA 2KT0A 5B5EC 5BS6A 5FZFA 1G3SA 1C8M2 4A41A 3J7AO 3USUA 2NOGA 1SPPB 2W82A 1MJ9A 3HT1A 3GNEA 3R6SA 2D97A 5FZBA 1H1IA 3OIQA 1IPSA 3SKVA 1N78A 4X0GA 5FB2A 4XETA 2PJPA 1TNSA 4R79A 1WJCA 4AGRA 4AZZA 4KYWA 4DPNA 1SBDA 5IWFA 2H09A 1JI8A 4PQQA 1UQXA 3WG1A 1KU9A 4A7KA 2XAFA 3OG2A 2OPKA 1MSFC 1QNTA 1ZZ6A 2J1TA 4CEWB 5F04A 1H1MA 3M4FA 2JDYA 1ASJ2 4DQAA 2J1AA 1R1UA 3V0BA 4M74A 2JUGA 3HL2A 4XK4A 1TBXA 2IRFG 3TEXA 3CDZB 4CGZA 3BJ6A 5FXXA 3ETPA 2D98A 4QWQA 1XNTA 2W46A 3O1UA 4FQ4A 5JR3A 1QF3A 4ABZA 4GDFA 1OYYA 3NV4A 1LTEA 1HIXA 5C5UA 1S7AA 1WMDA 2KZGA 3AKSA 1QZEA 3CO6C 4GB33 2Y33A 5DDJ2 3ZSJA 1FBSA 3POWA 5IVJA 3NJVA 2IFWA 3RJRA 4PFPA 1TP4A 1FTTA 4HLTA 3QU6A 4DJAA 2I10A 5J37A 3H8RA 3SC7X 5IVYA 3Q0UA 1QMJA 5HXMA 5LRSA 1D4M2 3VGIA 4KT5C 5FXZA 5A2QZ 2DBIA 3C2GA 2OTJI 4IHWA 5BNOC 1YNAA 1W8HA 2VTFA 1UXZA 2D5VA 2I8DA 3Q0WA 2AACA 4KITB 5FFXA 4F91B 4ZONA 2KPMA 1KXGA 2M2EA 2GC3A 3CJIA 1IUFA 2H0BA 1UNBA 3T0BA 2EWNA 2XPUA 4CU7A 4FX0A 1GZWA 3AP7A 2WO3A 1WPKA 1GVDA 1RUF1 1NE6A 2XJPA 1H2KA 1QXRA 4MGYE 1ZYRF 1UXXX 3OGGA 4NOTA 2QSGX 4W1UA 4DNCA 2R043 5J4YA 2X9DA 3FLRA 5LATA 3SEQA 1P7IA 2RJKA 3H1CA 1TWGJ 3J7ZI 2DVDA 2IA2A 4IF4A 1GVJA 1JZ6A 4ATEA 1KQ8A 4U7BA 3V7CA 5JSPA 1Z7LA 3KEOA 1D0YA 4PGGA 2LM3A 3IT8A 4Y1YA 1F2NA 4LIVA 5E1RA 2KFDA 1NT0A 4HG6B 1GOFA 4QB1A 3CMMA 3K70D 2ARBA 4RGRA 1Z0XA 4LBLA 2WNUC 4X6RB 1MQTB 3CCQI 1HRI1 1UKRA 1S2EA 3MN2A 4K3UA 4XJ8A 4M01A 3Q5FA 3E5UA 1RVF3 5F2SA 1W8OA 5IVVA 2QNKA 1ZBA3 4KGQA 2YSRA 4P9UA 1O4YA 1MSEC 4DIQA 1YQ2A 2OQRA 2X5IA 3S7IA 4AL9A 1WBFA 2Y2ZA 3OOPA 3VBRB 3W5MA 3AVRA 3KP6A 1T2XA 1BEV3 3H0GJ 3SYTA 1QJX3 4PDWB 5JI9A 5A70A 2GMEA 1GFF2 3WDXA 3FK7A 3EQLF 4N8MA 1DLCA 3U10A 2ZMEA 3LSTA 4IEOA 5EHDA 3H36A 2P37A 2VVDA 4NB5A 5DYMA 5JMOA 3OSGA 4DW6A 1JKRC 3AJZA 5J09A 2PLV2 2YC2A 4NPMA 4CDXB 3H8XA 5ICCA 1TWHJ 3V0AB 2ZEXA 1V55H 1S5LC 2OCEA 2BUKA 4B3NA 4G7OF 2K9MA 1W2UA 4XLNF 5D21A 4XF9A 4HQMA 3UESA 3CEWA 2EAAA 2EFWA 1MS0A 4NE9A 2DA3A 1R58A 5BPXA 1JH5A 4ZYAA 5C71A 2RGVA 2DFEA 4UF0A 1IRFA 5AIPA 5FYHA 3C7HA 2XL7A 5AC92 2PXJA 2VW1A 4BNCA 4DY3A 4XHBA 2WAQA 1K61A 1OJLA 2PHXA 3KZ4C 1JS9A 3PJRA 5JOYA 2WA4A 4CXXA 5JIAA 4A93J 4FPYA 3GZAA 4MXWA 5GALA 4N7UA 1LHUA 2DQLA 5F5QA 4D69A 2W85A 1HQCA 2K3FA 5KHKA 1T0FC 2XGDA 1KGSA 5TJJA 5J47A 2FCVA 5EGOA 4Y24A 3VBHB 2W24A 3AZZA 2E19A 2D6NA 2DF7A 3T0YA 1PO13 4XIKA 4ETSA 2DK8A 2A61A 3OR1C 3BIEA 2NAZA 1JUSA 2VC0A 1IG3A 4CU6A 4S04A 1T6BX 1LE8A 2PQSA 4H55A 3MIDA 4E7LA 2FX0A 2RR13 3GJBA 2XKPA 2CH0A 1SVLA 1GQHA 1H9GA 2RQQA 1OKRA 2L01A 2F17A 2Y6KA 4HFSA 4QQPA 1T56A 2A7AA 3O12A 5F5AA 4F52A 2NMOA 2QQUA 3TNQA 2JIGA 4DOUA 2O3FA 4EM0B 4CCJA 4CZZA 3LSDA 2V4AA 3PJYA 4PSWA 4IGPA 5M3MJ 3AC0A 1TNFA 4OUMA 3T08A 3ZYBA 2WL1A 3X29B 4P55A 5FZCA 5C9AC 4MLOA 4BQ5A 3WHBA 1SAUA 2V4JC 4BS9A 5TRDA 2QQOA 5FLVA 4DOZA 2VT3A 5IT9Z 5GTHC 1VBC2 3AAFA 1POV3 1W2TA 1FV2A 1K4TA 1ULYA 1IJWC 1HSJA 4DYCA 3LEIA 3O7OA 1H8AC 1OCOH 2HOEA 5FYBA 3G7DA 3ZPLA 3AZYA 5B1AH 3A01A 1RRJA 4ZXEA 1V6LA 3POSA 2ZNZA 5IPAA 1MS9A 5JHFA 1E5SA 2E6VA 1SAXA 3UR3C 5H2FC 4UYBA 1X4OA 1W6PB 4BQYA 2ID4A 3IKTA 4AI3A 5KHIA 4ZS3A 1N25A 1V00A 3IP4B 4WM7A 1C8M1 3C2BA 3SZGA 4XL9A 1CN1A 3FXUA 3W2AA 3BR6A 1E3OC 2OT7A 1ZX5A 3TB0A 5BNNC 1LHOA 3CCLI 4IQPA 4E27A 1V5FA 4MFEA 4X8NA 4BDZA 2QUFA 1YUDA 2VBWA 4PF1A 3LSEA 4HDVA 1W0OA 1XU1A 5FJHA 4CDUB 2NXNB 3DUIA 3QH6A 1X2MA 2AREA 3JSOA 4MGRA 1UIKA 1KS4A 3B73A 2PHFA 4HT1T 3GBWA 4ITVA 3FHNA 4IEYA 2MLKA 1PMHX 4M0NA 3ZYPA 2QKMB 2AHQA 1T98A 3JREA 1ASJ1 3A22A 1C8NA 2A6XA 1TW2A 4JAAA 1SPPA 1VQKI 1HC8A 1BR1A 3BTJA 1I6XA 4ZYGA 5KHHA 1EF4A 4LLLA 1FSHA 4CP9B 2ARAA 1TG7A 2DYCA 3AZWA 3K7AJ 4BQQA 3J7AY 1KFXL 1MEC2 3VBUB 2KIQA 5KBFA 1Q5OA 5FMOS 2G4IA 5DDJ1 1G8WA 4KISA 1UYXA 1YYNA 2M3AA 2HWE3 2Y6FA 4MGIE 3OIOA 1PNFA 3H9AA 1OFSA 3J80Z 2IT0A 3WTUC 5FD6A 2XWJB 3HAGA 3PUAA 1NYWA 3QH7A 1YW8A 3VD4A 2BW3B 2E7WA 3CBNA 4E8CA 1EAH3 1VQMI 1SCSA 2OV7A 2XJTA 1J5YA 4XKVA 1WZXA 1NCQA 1Z7S2 4KNCA 3NWTA 2DCJA 1W6NA 3ZFEC 3HT2A 2HWF2 5LRRA 2C1FA 1X1DA 5C7GA 4M6VA 5CLSA 4XIOA 3ASOH 5HNHA 3GLLA 3A2KA 1G6NA 4XYXA 2W84A 4IEWA 2EV5A 3GFLA 2AXLA 2XWBB 1H8VA 2V1DA 1LEBA 1PO23 2WFF2 3D5SC 4B48A 2RC4A 1UN1A 4GH4C 1G3YA 1J75A 3N7MA 4Z82A 4RFRB 5FZKA 2P4WA 1G86A 3V42A 4MNUA 4BQ1A 3DP7A 2JG9C 4JC1A 2QSFX 5DZGA 3CQZJ 2BVVA 3OGRA 1I1SA 3CF2A 3VKOA 2NVYJ 2XF7A 4NMIA 1L3LA 4W4ZA 4QPGA 4CDWB 4TWTA 2MHFA 4LA2A 1W2AX 1NLQA 3W58A 3DU5A 5GPCA 5FZ8A 2JA2A 2XUEA 2BYVE 5F5CA 3SH4A 2VVEA 3VZJA 3WEZA 4OU0A 2OUHA 3ES4A 5FZ6A 1OOPB 1BOBA 1OURA 2XIGA 1LB2A 3EUHA 4UUTA 5C4WC 4B4QA 2ENRA 3KT4A 1YHFA 2E2HJ 2Y6LA 1YLFA 2RDSA 3B9CA 1V0AA 3O1SA 2QA4I 4UUVA 1VQ4I 3JXSA 4A6EA 1UB9A 2IVIB 4MZUA 5HXVA 3ZYHA 3JTHA 4WXHA 4L97A 2H94A 5F8PA 3MVPA 4M6XA 4UXAA 5FR3A 2VMCA 4BGDA 4C3JJ 2VCCA 3HHHA 1QJU1 2RS33 5A7PA 2SLIA 4C3HJ 1ETYA 3KX2A 4NIAA 5IP9J 5JI6A 1TME1 1JHHA 1I9RA 2QQVA 3WG2A 2Q5TA 3ON7A 1K79A 3WTTC 1J0RA 5EEHA 5FZGA 1R091 2GA2A 5A7WA 2JA6J 1JN2P 2IGKA 3H0DA 2BVBA 2HWD2 2JVHA 3KVBA 4LUMA 1SD7A 1W03A 4J6GA 4BXFA 3GEZA 1XE8A 5A32A 3APBA 5K0UA 1ZGJA 5DUIA 4LBJA 3U1DA 1RIRA 2L5QA 1RMU3 4XTMA 4URTA 1TT5B 1Z67A 5F3GA 4HNUA 1D0ZA 4WVMA 4A5NA 4MTEA 1J3PA 1E2XA 2XF5A 5G05L 3WCSA 4LJZF 1EYBA 3F8CA 5AC91 3ZRGA 3GDBA 3BKZA 3KCYA 3A02A 4EM1A 1B6AA 3AJYA 5FZIA 3LFUA 1YFYA 5E16A 3TOAA 1W6QA 2JB4A 2CQ7A 3IH3A 1O3RA 4D9JA 3H35A 1HLCA 2R49A 1H4GA 1YTYA 2A69F 1Y8QB 1QDCA 4CCLA 1AR73 3LSMA 2FOKA 4A3CJ 1JJ6C 3I4IA 3ZXAC 3GO5A 4W65A 3BUCA 3NNJA 4XBLA 3WNKA 2HJIA 3MLKA 4A69C 1VMHA 5DAPA 3A0NA 2WZPP 2D3SA 4ESBA 1QVUA 2X29A 1SMYF 1ND2B 2Y0OA 2PFWA 5F6LB 5ISLA 1IGOA 1W3XA 4K21A 2RMU3 3VKNA 5K9YA 1TT0A 2YBKA 4I76A 1GP5A 3OYLA 3PVBB 3D5RC 4HVQA 2AEZA 1W0PA 3I53A 3VBHA 4ASNA 3GW2A 4M73A 4UFIA 5AONA 2D93A 4FFHA 1PHMA 3CMYA 1FI2A 3MD2A 2ZEWA 1D7PM 4AE2A 4D6SA 5DMYA 1K5MB 3H1WA 2RV9A 1JZ2A 4AFDA 4LK0F 4TSVA 4AVVA 2J22A 2V72A 2IXLA 1KFUL 2HTSA 3Q9VA 4MSVA 2QBYB 1GBGA 1BXHA 2RM22 4KIBA 2D43A 3A0BC 1TLHB 4ON0A 5EXOA 4Z1VA 5IJRA 3EQEA 2JPBA 1H9WA 3WW2A 1NQDA 4JDMA 3F72A 3VPRA 3ITQA 4FI9A 1AL23 1TTYA 4ZDLA 1H0BA 4UV8A 1HQWA 5A3OA 5LBEA 2FDFA 3V8LA 3O5SA 3T2TA 1AVBA 1QJZA 3D4KA 4SBVA 3IWFA 2I2SA 4DEVA 4M3DA 2M9HA 5BNPB 1DQ4A 3VDAA 4UV9A 4FOYA 2GDFA 2WZR2 3NV1A 3R4DB 3HKZA 3VDXA 2DVGA 2HWB3 1VRH3 1YLLA 3FISA 2VBDA 3TBIA 1C3HA 1N1TA 2NS8A 3HUGB 2IVMA 3WF4A 5FZ9A 1JYVA 3HSRA 2CGNA 4O65A 3QU3A 3TW7A 5C8CC 2J1UA 3A0HC 2CV0A 3L2RA 2FQ3A 1MZ6A 1WWYA 4MV2A 2GA1A 2IS1A 1XYOA 4AFMA 2EA4A 2Z99A 3QYFA 4B47A 1CAUA 2UY9A 3FXKA 1CZTA 3AB0A 2Z9OA 2MD0A 3K48A 1GV2A 2GNBA 3GTGJ 1VQ9I 3RPUD 4IL7A 1RHI1 2W57A 3CUOA 2ICWG 3DPTA 3K4MA 5JOWA 4BQWA 4WVWA 3VHOA 5K7ZA 1MEC1 2CUJA 3BCWA 2LYCA 4XEZA 3DBHB 5CKMA 1YQAA 2ZXIA 2NYYA 1JOPA 2NS7A 1A6QA 1DQ6A 4FTEA 1O57A 3DGTA 2D3PA 2RNJA 4N53C 2G9ZA 4CP9A 5FZ1A 5J3LA 2QVSB 3HN1A 2JIJA 2AUYA 2FSWA 3ZN6A 1DQUA 1RITA 3ZSLA 1Z7S1 3ZSMA 4Z07A 3WGGA 1R083 2HWF1 3KB5A 5KHGA 2QEXI 1Y0UA 2UYAA 3PU8A 4RQPB 1JODA 2VUAA 1OCPA 1Z0HA 2JTVA 2NVUB 1OPMA 2GMPA 1LR5A 1W8WA 2WFF1 2VQHA 4XJWA 1DGWX 3BTZA 4Q26A 1RGSA 1OLQA 3GFIA 4O7XA 1FOD3 5ICFA 2XAUA 3ZFGA 2BOLA 2BW3A 3W20A 1FMWA 4MFDA 3H5RA 4YG3A 1I27A 1LRHA 3NNLA 2EPFA 2MGQA 1RUG3 3QWLA 1OUSA 2Z3YA 3VBFA 1KQ0A 2A05A 4GZ9A 1QNWA 2BV6A 3HQXA 5FKNA 2Z69A 3KYDB 2ZSIB 3BALA 2WWJA 3ZPOA 1DDLA 3OYJA 2DFIA 1OPOA 3KT7A 1K12A 1G9AA 1LAJA 3A23A 4AEDB 5JUVA 3RQ4A 3HQRA 1CF7A 4JGZC 4O9GA 4CPBD 4AYBN 3ZQHA 4ANJA 1R5GA 3RZGA 4AVZA 4L18B 5J96B 4H14A 1IF1A 2IXIA 4L92A 2OCCH 4NIIA 4LIUA 4XQWA 1SVMA 1VBA1 4Q4V2 1OQEA 2CW0F 1EH8A 5I0UA 3GLXA 1L0OC 2DUPA 1Z91A 4NHMA 3RZJA 3HC7A 3PSFA 3OYEA 4GYIA 4RN5A 2A75A 1AX1A 2CUZA 1OOPA 1QH7A 4LD5A 5FTTC 2HXOA 3AMMA 2DO7A 4Q0PA 2QQMA 2TNFA 3A7QA 2TRTA 4YEJA 2IXHA 5FPLA 3FX3A 3I59A 2QKLB 2G9FA 2DURA 4I2OA 1ZAOA 2PG4A 5CKNA 2HWD1 4HSLA 5K7PA 1YFUA 1OYIA 2VBYA 1V5EA 5CZKA 2BGPA 1UU5A 4QQLA 2ETEA 1YIOA 4B7EA 3B93A 3FFQA 2D6KA 2R92J 3UKVA 2LVSA 3U4SA 2RV8A 5KXDA 3BTIA 1VBD1 1WCMJ 2FEZA 5JHUA 5IYDJ 5IW0A 3J81Z 1HXS1 3P9IA 1QIQA 4GWNA 3K6GA 1J1LA 2W9XA 3LMMA 1R1VA 1UAIA 1WCKA 3T2OA 3I56I 3RKWA 1XNBA 3M7AA 1FP1D 4XKCA 4G3YC 2BXZA 2MW8A 4IRIA 4IV3A 2LROA 3TO6A 2DMTA 1YIFA 3AKTA 2WNVB 2HQ5A 2JRTA 4IV1C 3WF3A 4GB32 1FV3A 2QCOA 2ZABA 4EQVA 1R23A 3G4SI 3FXQA 4IEVA 4QM9A 3S15J 4UW4A 3LKJA 2IJLA 2WA3A 3WHUA 4DRVA 3F0CA 1S0FA 2WO2A 4XILA 3BR3A 4MQVA 3ILNA 4QPQA 5A80A 3FHIB 3WODF 2ZX3A 3KGLA 3FJSA 2HI3A 1T39A 5DUWA 2MBFA 2ZGSA 4Q8KA 1UHWA 3ABTA 2XJQA 4A12A 2JEMA 4CDQC 5GLTA 2P2KA 4J00A 1ZZ7A 4FPCA 1JHFA 2BRTA 2Y48A 3IB3A 3TGNA 1KA8A 2E7XA 3B02A 1IS3A 2D44A 4JGYA 3M8EA 4YRVA 1SBFA 4WM7C 2KA3A 1OVSA 4P08A 1LOAA 4BK5A 1NQJA 5CFDA 4AQ6A 2WRAA 3AFKA 2GM4A 5FUIA 3FXOA 3ZXGA 3DQVC 1GZTA 2XJRA 4JX5A 3HOXJ 4D0QA 1KDMA 1R4MB 1RUF3 1RXGA 4O6JA 5C70A 1SBEA 3CCVI 2VCMA 4RHV1 1W6MA 2D2WA 2R042 4MGQA 5LGTA 4KH9A 2RM21 3QBQA 1VRBA 4Q0SA 5FLMJ 1EP0A 3F8MA 2ZJCA 2DYSH 5M0TA 1Z78A 5CFCB 5C3QA 1DHKB 1EA3A 5IP7J 1QKQA 4QPOA 2C9AA 2H6CA 3BR5A 2Q0AA 2VQAA 1GZCA 1H8TB 5LFAA 5LCWL 3N4MA 1LKXA 2BFUL 5A3NA 1IZ1A 1REDA 5FPVA 3C8XA 4IVNA 4YW5A 1BBYA 4MUVA 1MNMC 1HRI3 4XVHA 2LF7A 4XMYA 3OV8A 2QBYA 5FAXA 3BTXA 3OUHA 3H9QA 1MMAA 1WW4A 4D0PA 2IGOA 1ZBA2 5CU1A 4PJJA 4FP3A 5JLWA 4MG2A 2BQPA 2XHKA 2XJUA 3AP4A 3SJMA 3LEMA 3BQYA 2PMZA 1X3WB 4A6SA 1KONA 2HEVF 1MBEA 2VXJA 4CEWC 2ZHKA 1ETQA 1BEV2 1DGRN 2HH9A 1ZLJA 3S32A 4NWVA 2PI0A 3VODA 2YFUA 1ZVFA 4IEXA 4HSTA 4HPKB 4WK8F 1OCRH 4YZ2A 3CCRI 5E17F 1L3JA 3H92A 1H6YA 4N43A 4NC7A 2K9SA 4OHXA 1EUUA 1GUIA 1ZA7A 1QZYA 3NQOA 5IVCA 4EJVA 4AYUA 5LGNA 4HOBA 2PFBA 3DCFA 1W7PD 3WF2A 3CLOA 2VTXA 3SDBA 5GP9A 4LKFA 3G73A 1K78A 4XUPA 3C7EA 4AWXB 2CQKA 2ZAAA 4WWCA 4LOCA 2ZKLA 1IG7A 4FE4A 3JRFA 1PM7A 3M8FA 3VLBB 2VULA 5JOXA 5FMCA 1CQTA 1O4TA 5GLVA 2ECCA 4ZZ8A 2ZC2A 2B9VA 3LOBA 4ZYHA 4ISQA 4IEQA 1OHFA 2WJSA 3POBA 1SFPA 4RBOA 3NNGA 2HOTA 1BLZA 2L2OA 4EN6B 1SANA 3C2UA 1D2QA 1RUOA 4Q4X1 5FYIA 4Q4W3 4BY7J 3IMNA 4QAWA 1HJGA 3RG0A 5A6QA 2RREA 4NHYA 3LDBA 3I0TA 1X1AA 4JP0A 3LWCA 3HOZJ 4AQTA 1PP8F 3EUHC 4GWIA 1JOJA 4MVTA 2VECA 2HKXA 4F3QA 2L9SA 5DS9A 4Y17A 3RWKX 2CRGA 4D7NA 3PDQA 5EIYB 1PO12 2MNGA 1ZK8A 4MTDA 2M34A 4LA3A 3FC0A 3WT3A 3M7GA 2DCTA 3I4PA 5HS7A 4CZCA 1X1PA 3KGZA 4HPQA 3K69A 1HRV1 5FY5A 1YIPA 3J7NA 2B45X 3BG7A 2IS6A 4HNTA 4PCQA 3GFJA 4HNVA 2QQNA 2AXTC 3MWMA 4P9YA 1HW5A 3MBWA 4A5MA 4ZDPA 3ELNA 4BDVB 1MQTC 5DM7F 4XURA 3GBGA 4M3CF 1Z1DA 1K3IA 4LK7A 1NY72 2L7MP 3VDDA 5FGMA 1BK0A 4BISA 4Y7NJ 3T5XA 1D5YA 2QQAA 1X1BA 1AR91 2W48A 3VBRC 1YJKA 4PGHA 4NRPA 3DTIA 4PDWC 2AC1A 4ZH4F 1G59A 4FPHA 5D5UB 3CJQB 3LZZA 1JE8A 4PZJA 1WMFA 3H3ZA 5JMCA 1NA1A 4MHGA 4JHTA 4LEJA 3CMGA 3MEXA 2VXRA 2BEOA 3B3QE 1JKQC 3PNVA 4QDQA 3LSPA 5A3PA 3GHNA 1X33A 4CDXC 2QZ8A 5FYYA 4AF9A 3OYNA 1UMIA 1XDUA 3K2ZA 4EN0A 4EJTA 4L9TA 1DF0A 4C90A 1G9FA 2L3DA 3SHFA 2XLAA 3A4CA 4UBGA 1F1ZA 4YNIA 5JDBA 4V19K 1AKHB 2PHDA 3AYEA 1T2KA 1JUPA 4IDZA 4YW3A 2X6XA 3L7WA 1DP0A 4NHJA 1EJ9A 4BEHA 2Y0IA 2LTPA 1PUEE 1Z9CA 3THPA 3TDZC 4YGDA 3T8TA 4CCMA 1MR5A 1TWFJ 4NRMA 4F7ZA 1ORKA 4YGBA 1UYPA 1ZM1A 4L0YB 4CEYA 2UZKA 1WA6X 4EN9B 2A6EF 5CYVA 4CICA 4A44A 2E7QA 2V73A 5GZCA 1N1YA 3HBZA 2M45A 4LKEA 1E5HA 4DFSA 3UK9A 2DFHA 1OI6A 3KP3A 2P5KA 2YBSA 3ZQ7A 2LTNA 2W1QA 1W04A 4BQ4A 3SCFA 3QODA 1GWLA 1QVTA 4AGVA 2DU9A 5D6FA 1LEMA 5EEAA 3O1RA 2FRHA 1WKYA 1OCTC 4FTHA 3ZMTA 1DYOA 3OY9A 1IN6A 3HOSA 2OD5A 1WCUA 1TWCJ 3TOJA 3DEEA 3DPRB 2ZMNA 1CIYA 5IATA 1UZZA 1P2FA 1YI2I 2EIBA 2E2JJ 2JICA 5C44J 2WN2A 4CXYA 4BJTA 4UVAA 1EAH2 1UWWA 1E17A 3WUDA 3D82A 2XPWA 3CUQA 2JE7A 1GUUA 3QD6A 2VOPA 4W6WA 4RS5A 3S5QA 1WWXA 2H8RA 1R1ZA 1XRUA 5F32A 2CQXA 2HVQA 2XPJA 5GAHJ 1R1A1 1PO22 4N4OB 1ENHA 5AVAA 2EXHA 1IN4A 2RDNA 1J09A 3AG3H 3M07A 2DXIA 1L7QA 3HQUA 1XGMA 2BERA 3SMHA 4XFBA 2VIXA 4L9JA 5ILUA 1V6IA 1UX6A 2VN2A 1RUJ1 1KRIA 5EV7A 3I3DA 2IXKA 4HG2A 2HKOA 2H6BA 3V4GA 3R4KA 2HVRA 2FDHA 1I39A 2ZJ2A 1SHWB 4XFCA 5JIUA 1IN7A 3BYWA 2VE8A 3RCOA 2LNBA 1BCXA 1OD3A 3OMYA 4P9FA 2DBBA 2HU9A 2K40A 2BOIA 3W21A 3INAA 3JD71 4Z2WA 1Q3EA 1Q43A 1UF2C 5LY1A 3LWFA 2MC4A 3AL5A 2HEYF 1E3HA 3JBG1 3U4XA 1IQAA 4CDUC 3DKWA 2ZOEB 3WR0A 1GOGA 5I0RA 2WAQN 3BZCA 4XE9A 1W2NA 4IRHA 4OI2A 1YXWA 1ZZ8A 3ZO0B 1O7FA 1FOKA 5LHIA 2YU9J 2KXLA 3BZ6A 2QE3A 5IK7A 4OAYA 4GWMA 3EETA 1EPWA 2KDOA 2JG8A 2QQIA 3QPLA 1N77A 3KV5A 2EXKA 4NAOA 1IRGA 1CX4A 1QJU3 5IVBA 1T6SA 3DTKA 5FY4A 4CHUA 1SFYA 1TME3 1RUE2 1IN8A 2ERFA 4UAPA 2VXDA 3U75A 4Y13A 2E5NA 3VBUC 1R093 4FXKB 2CUEA 3S93A 1K6OA 1W6OB 3PMSA 4QXHA 3VBOA 4CSWA 3B9IA 3QCWA 3WTZA 5D8AA 2W47A 1K5JA 3OGJA 2V9KA 1RUNA 4D7YA 4LHLA 2ACJA 5EYXA 1QJFA 4M3CB 1PNGA 1RMU2 2KIFA 1Y0NA 1OKOA 5FZ7A 1IV8A 3NAPB 1J84A 2QJVA 1D5VA 2HEOA 1FJLA 5E89A 3DPUA 2R7WA 5AC93 2O8OA 1NLSA 3ME2A 2VXZA 2XRLA 2WADA 2IP2A 2C24A 4K1YA 5E18F 3E5XA 3H0OA 3VBSA 1FBQA 4J01A 1PZ7A 3A1YA 2Q30A 1LESA 3ATGA 2D6MA 2R6QA 1W39A 2LSOA 2MD5A 2IXSA 4BHBA 5IFTA 1AR72 5F1RA 3L2QA 4P14A 3TP0A 2PHRA 2ZZQA 2I45A 5JSRA 1FBUA 1YO8A 4BWOA 2YS9A 2P3KA 1QXPA 3SEEA 4IJAA 5A1LA 4CXFA 2IA0A 2VBZA 1QHGA 3VYRB 1JYWA 5FO8B 5D5XB 4JBAA 1RKTA 2NVTJ 3IH2A 4CDWC 1SD4A 3IBMA 3PTYA 4ENKA 3IRRA 2DU1A 3SISA 5FZOB 2BTVC 2JDAA 1XC5A 5E1XA 3DLLF 3KQ4B 3WQBA 3N7LA 3UV9A 2RMU2 1QU0A 1TEIA 3CESA 3JZVA 2QGUA 1FX7A 2YU3A 2ELKA 4BE3A 3WF0A 1HF0A 4H2AA 3ZQCA 1FOYA 4NAMA 4QQOA 4FFGA 1Z21A 3RYKA 4AOCA 3VD5A 4QLCU 5T52A 2JWTA 1ENQA 1Z77A 3ZQLA 4Z8BA 5LEKA 1QOTA 1HDDC 3MDPA 4RGSA 4LITA 3JW4A 2Q0OA 3N9NA 3MV01 4PFOA 2QLZA 1AR61 4CUCA 2QWWA 3MZHA 4OIRF 4BL0B 4C2TA 1U3EM 3WW4A 2F5EA 3LAPA 3Q3SA 4HV6A 1PUFA 4LG0A 1QJY1 2Z5UA 1HA8A 2XONA 5EG0A 3V7SA 4Y5TA 4WZCA 5FD5A 3NWSA 1OLRA 3DEMA 2DBNA 4PIYA 3CKHA 1D4VB 1AL22 1V6KA 4RR3A 3QQAA 2FCTA 1ZZ9A 2VLAA 4FFFA 4GRIA 5FZDA 2QQBA 3VFZA 2DFFA 1N1SA 4A3MJ 1HDKA 1Z7UA 2GOXB 3ASIA 2Y6JA 2K0GA 2HWB2 1VRH2 1GWKA 1PGL2 2CYYA 1UY0A 3BIWE 3P6BA 5FYVA 3GZNB 5K5RA 2P5BA 5B4XA 1AOYA 1XDSA 2VJXA 5HCFA 1G7YA 4PSXA 3M3OA 3VN4A 3WGIA 4HZFA 2XBO2 1O8SA 1CONA 1SLLA 3MLJA 2QM3A 1IKQA 3M3YJ 3H50A 4NBQA 4ITCA 5IVEA 4PF5A 1U8BA 3V56A 4C0HA 1NTCA 2YC0A 3IAPA 2PYTA 1HX6A 5DABA 2Z2SB 5FKBA 1JJ8C 2P6CA 1RUC3 1FY7A 3ZMOA 2Y6HA 2HYJA 3TKYA 5LLQA 1JU3A 1PX4A 1RHI3 3FBYA 2L9LA 5H20A 1WJFA 1J83A 3DEUA 1Q8OA 2NMNA 4A0ZA 3VYTB 5IYBJ 2DT6A 5EYRA 5J1XA 5ABJA 4K20A 2FUG2 2GH8A 4YVWB 2LALA 1ND2C 3CCJI 4Q27A 4F83A 2CDPA 2ZHLA 4YRDA 1IXSB 4K6BA 4UFKA 1D8KA 5HDGA 4LKSA 3ZYGA 2BWAA 5FZ3A 4ZHNA 1S4CA 2P7CB 5DM6F 1KITA 2MC3A 2GIZA 3OS0A 1DDNA 4WVZA 2FD8A 1XN7A 1H88C 2CWSA 1J9IA 3T1BA 3S3OA 4RM3A 4NQWA 3IM0A 4R9CA 1UW8A 1ZARA 3TO7A 1DU0A 2RN7A 1XPWA 4P9LA 3HOWJ 1R082 4OAZA 3S3NA 2CDOA 5FKMA 4V2FA 1K5MC 4OOIA 4QPIB 3WW3A 5HI0A 1S9HA 3I7DA 4D1QA 2WFF3 1D0XA 5L3DA 5KHDA 5H9RA 2A6TA 2L02A 1BVP1 5IYCJ 4I0BA 3K3OA 3NAUA 1IPKA 1NX9A 2RDQA 1FOD2 5FP7A 2R5ZB 3F9KA 2CY6A 1JT0A 5IT6A 3OS2A 3PVOA 1RUG2 1SLAA 2DK5A 2LMDA 1OCCH 4DBQA 4Q2FA 2COBA 4XSZF 1RR8C 1NKGA 2K9ZA 1I3HA 3E6MA 1WQ2A 5DCMB 3RYPA 4KWLA 2L54A 3WE3A 5FYTA 3PO3J 2WQ4A 5H9PA 3TL4X 4YGEA 5BNPC 1YFHA 4QGNA 4GWJA 2R7TA 2XL9A 5DD8A 1S3JA 4D6QA 4HQEA 1QPIA 1Y1VJ 2XKOA 4HBNA 2RJLA 4I01A 3GTMJ 3USUB 3ZQGA 4EROA 3IH4A 2VD7A 2DPUA 3DL3A 3KMHA 1P92A 4QU2A 3GZ6A 5DTDA 1WLDA 3L2UA 1VBA3 2L4MA 1FIPA 3W6JB 3ZDVA 4Y26A 3PUFA 3BTLA 3ZMZA 4XQFA 2VJ4A 2ME6A 4CU8A 3LQCA 2CQQA 2GSYA 4OIPF 2CJJA 1U5TA 1ULCA 3EBRA 1I3AA 1RL3A 1G3WA 2QQKA 1RUE1 4AD9A 3RKYA 4BLIA 4XIDA 5FMBA 1MS5A 1BR4A 3V0BB 5ANNA 4RA2A 1UJ8A 2HWD3 5LGUA 1Q56A 1XSVA 4ZPIA 1CAVA 1EV11 2CO5A 1BW5A 2H1LA 2NS0A 1W0TA 2DT7B 5IAVA 3I3BA 2GLOA 4PK4A 1PYVA 5H6QA 1RMU1 3POFA 1VBD3 2PA7A 3WHTA 3ZSEA 3CCEI 2JKXA 1S0BA 3CF6E 1YO5C 4OUEA 2LRDA 4MYEA 3HOTA 1HXS3 1JU4A 1G9CA 4G9YA 4GO1A 2D6OX 4M9ZA 4LHNA 3S5AA 3PNYA 4IX7A 4U7DA 4UI9L 3VEPA 4FOVA 4EWEA 3H42B 3OYIA 1SFXA 4MGTA 1BMV1 2ZXHA 4RQPC 4EM2A 4CTEA 1QQIA 4KFCA 2GMMA 1TQIA 4L9NA 2VOWA 2Y60A 4O9EA 4Q0QA 1Y39A 3FHQA 3DLAA 4CE8A 2QDRA 1AR71 4QX8A 4JDOA 2JK3A 4KG8A 3CJIB 2M7BA 3ETQA 3J7MA 2XQRA 4YPJA 4RLQA 5M5WJ 5FQ0A 3WVJA 3MFCA 3THDA 4E9KA 1GZWB 1VB2A 3AP6A 1WUVA 1C5HA 1B9MA 4G12A 1NH3A 3ZQFA 1SVOA 1RETA 2K02A 4KL1A 2F4MB 4OMZA 1RC9A 1NAEA 4FVVA 2VCAA 4RFT0 5T50A 4AEDC 3GGLA 2RMU1 1K83J 2VASA 3HKZN 2J1VA 3BP8A 5GAEJ 3GZTB 2YX7A 5JZGA 2CV2A 4BJ6C 3AKQA 1W9YA 3UJQA 2JDHA 3OBZA 4C8DA 1RINA 3RNSA 3OJBA 4KMFA 4YG0A 4OI4A 1RUF2 3QACA 5ILSA 5DPNA 3GHMA 4RHV3 3WE2A 2DCZA 4YW6A 3L09A 2R32A 3M9AA 4YG6A 2Z5WA 5FZOA 2VZ1A 3H1YA 5ED4A 3QOEA 3O0WA 2EZIA 1O3SA 3MICA 2BY0A 4HANA 4A45A 2E63A 1UO9A 3M70A 2X5IB 3K75B 4LULA 1REFA 4DXTA 3WCRA 5BXXA 4QT6A 4H0EA 2ID3A 5JR7B 2XB5A 5BMZA 3H3LA 2XAHA 4JYKA 5F3CA 2E36A 2BU9A 1BJAA 1NHAA 2WABA 4GAZA 1S0GA 1OQYA 1F31A 2ZMEB 3JU9A 3LEGA 1LDDA 5EYYA 3HJRA 5IP6A 4OHVA 3OYFA 4Y1ZA 3CL1A 5K5OA 1WHUA 3NJXA 4E8DA 3S57A 3UGHA 3MO4A 3HNYM 3BOQA 1OSGA 3ZSKA 4BK4A 5J98B 2M8GX 3WQ1A 2MPF