4CYDA

Glxr bound to camp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
225
structure length
223
Chain Sequence
GVQEILSRAGIFQVDPTAVNNLIQDMETVRFPRGATIFDEGEPGDRLYIITSGKVKLARHAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSAVCVTEVHAATMNSDMLRNWVADHPAIAEQLLRVLARRLRRTNASLADLIFTDVPGRVAKTLLQLANRFGTQEAALRVNHDLTQEEIAQLVGASRETVNKALATFAHRGWIRLEGKSVLIVDTEHLARRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE TRANSCRIPTION REGULATOR
publication title The Crystal Structures of Apo and Camp-Bound Glxr from Corynebacterium Glutamicum Reveal Structural and Dynamic Changes Upon Camp Binding in Crp/Fnr Family Transcription Factors.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transcription
total genus 74
structure length 223
sequence length 225
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4cydA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4cydA01
4R8HA 5JHUA 5HOOA 5JR3A 1H0MA 3V7SA 3RTRA 2WFPA 3LOIA 1QWRA 4GYGA 3EQLF 3HQXA 5TJJA 2P5KA 5LHGA 4BXUA 1CAUA 3CL1A 2QQAA 3HSRA 3D0SA 4XFAA 5C6CA 4WX9A 3F8BA 5DDGA 1LDDA 2ZXJA 2B9UA 3ABTA 3T8TA 4QLCU 2G7UA 1LEAA 1HQCA 2FQPA 1J7KA 3SXWA 2DCTA 3KMHA 3U2RA 4U0VA 3F21A 4RAYA 5HS9A 3RYRA 4EM0B 2Y0OA 2FA5A 1BIAA 2W85A 5DCFA 5ICFA 2JSCA 3F72A 3ISPA 2KRFA 4ZH4F 1NXMA 4BIFA 4DINB 2Z2SB 3CLPA 1GQHA 2O3FA 2MD5A 3NSTA 4JBAA 2D2WA 3FXQA 1MJ9A 3CUQC 2D5FA 2VBXA 4CICA 4GYIA 1G3SA 3UKVA 1W7PD 4HBLA 3L2HA 4QWQA 1ON1A 3TO9A 4XRFA 2ZCWA 1D8KA 4IJAA 2JPCA 3CTAA 1JXSA 1AWCA 3IC7A 2MNGA 1KQ8A 3KP6A 2EA4A 2NNYA 2FQ3A 4WWCA 1SFNA 2GH2A 2K4BA 3ELKA 5K8SA 1EH8A 1XSDA 5I0SA 2Z3YA 3D5LA 3WTZA 1S6LA 5KHHA 2EA2A 2JT1A 1NE6A 1EY2A 3RKWA 1KU3A 1D8JA 1HW1A 1QPMA 4KIGA 2J5OA 3RPQA 4M72A 2STTA 5J3UA 4TLFA 1DDNA 2COMA 2EB7A 2E7XA 2ET1A 1DZRA 5E16A 3RKYA 3DFGA 2OU2A 2J5PA 3BPZA 1UCRA 5I8TA 1TLHB 5HLIA 3LZZA 2QDRA 4KUMA 2V1XA 2O8XA 2O0YA 2IXJA 3CJXA 1SMTA 1GXPA 2PFBA 1LKNA 2H6CA 4JTNA 3FFQA 1EV7A 3EETA 4X6RB 2P17A 4KDPA 5ILUA 2PAKA 4M9XA 3SCHA 2HGCA 3WTWC 3WW4A 4IESA 4P96A 2QQ9A 2VODA 3V8LA 2EV5A 3LFKA 1RTVA 2ESNA 2VBWA 2QYOA 3FXRA 5J7MA 1QBJA 2LSOA 5AIQA 3LWCA 5BPIA 5BS6A 4QXKA 4B09A 3EDPA 2XGXA 2GQQA 2PQ8A 3H3ZA 2ZKZA 3H1MA 2ZNZA 2N7GA 2X4HA 5L3DA 4KIBA 3RDIA 3BP8A 4U0YA 5AVPA 4AQ6A 1Z6RA 1X7NA 1TQMA 1IRFA 4ESBA 1F4KA 3HTSB 1BBYA 3UKNA 4IRGA 3ZMSA 2NNNA 1H9GA 2MPFA 4LEJA 1PUEE 3BALA 3IDBB 3RYKA 4RS8A 5L3BA 3RZZA 2UY9A 5A2QK 3HRTA 5DEQA 3IBMA 3M7GA 3TO7A 5FLXZ 1QO0D 3HUGA 4YNIA 2CG4A 3L7WA 1FWZA 4LK1F 4G9YA 3I5UA 4EQQA 1XCVA 4ZZLA 3OGJA 5L3GA 4IPAA 2VC1A 3KSCA 2IVMA 2K27A 2IXHA 1J0RA 4I01A 2EAAA 5FFZA 1LJ9A 1J58A 4EJWA 2RC4A 4Q29A 4LA2A 4OFGA 4HAMA 4AVCA 4O9GA 4HF0A 1X8MA 1TW2A 3FXUA 4KIFA 1WLTA 4KWLA 2XAQA 3HTUA 4XFHA 1WKMA 3KEQA 1HKSA 2CWEA 1Y9QA 3EHKA 3MYXA 1LB2A 1UHMA 3VODA 3QPTA 3F8FA 2D45A 2NRAC 3BU7A 2GXBA 2IP2A 1I6XA 4RAZA 4G7OF 2EVXA 4KL1A 3JSPA 5ILVA 1SQ4A 4Q0VA 3WTUC 2O03A 2VE9A 1YLLA 3WG9A 4A2UA 2RV8A 1ON2A 2XKOA 2OQGA 3QPHA 1HXDA 2HYGD 3F6VA 1VR3A 3HOSA 1DP7P 2CW0F 4WVZA 4QGMA 3HRMA 4AXOA 4S05A 4HVOA 3M8FA 2DPDA 4Z82A 2MBFA 3GUDA 4I2OA 1S29A 3MZHA 1X3UA 2P5VA 4CYDA 2HQNA 2P7CB 1SD4A 4QGNA 4A6DA 1MKMA 1KU7A 1Q43A 4EROA 1FP2A 2W24A 5KHKA 2RGVA 2PTMA 5H6QA 5D6EA 2BE5F 1Q3EA 4L0YB 3BPVA 3E6DA 2BNNA 2PMUA 2EV6A 1FP1D 3OV8A 2GIVA 2GAUA 2H09A 4HYEA 1XMAA 1ZRFA 1BC7C 1QXRA 3EYIA 3BJAA 2DFIA 1LEBA 4ZU4A 1FNNA 2KKOA 4L9TA 4ESJA 2OZUA 2OA4A 2DU9A 1GXQA 1JGSA 3USSA 1K78A 4XF3A 3O3KA 3WTSC 4G6QA 3ZN1A 5LHHA 4WXDA 4AIHA 1FPQA 2GWRA 5J8FA 1K6OA 2RKHA 1D5VA 1R36A 2F5FA 2L01A 4ZYHA 3J80Z 2UZKA 4MQVA 5D5WB 1ZX5A 2FOKA 3MDPA 3TNQA 1KYWA 4ON0A 3ECOA 1MDMB 4AQ2A 3CDHA 2DLLA 1TQ5A 5CLSA 5HLHA 2M45A 4HMZA 2NYXA 2HOEA 5DYMA 2XROA 1Z7UA 4M71A 2HWVA 3DPLC 1MZBA 2FU4A 1XN7A 3FMRA 1IAWA 2UYBA 4P5OA 3KEOA 2IRFG 2GZWA 3ES1A 4B29A 1QZZA 1CAWA 3MCZA 2MLKA 2HTSA 3COAC 3C3WA 2XLAA 1FT9A 2K86A 1HW5A 1V3FA 4CDGA 1XE8A 4FX0A 5FLHA 4IF4A 2QLZA 4GGGA 1QY4A 4HF1A 1QNTA 1XE7A 3GFLA 3M8EA 3FZ3A 3VFZA 3EYYA 3S7IA 3J81Z 3PFIA 3I58A 4RGSA 1IN7A 1K78B 1OYWA 2ADUA 3F23A 3GXOA 2GA2A 4YFXF 2XIGA 4META 4L2NA 3FX3A 3HT2A 3KLOA 4EJOA 1ZN2A 5IT9Z 1O57A 1NZCA 3T5XA 4U7DA 3R0AA 1ZRRA 3NJZA 1YFYA 3QU3A 2YSRA 1B59A 2A68F 2XUBA 2VXZA 4KWJA 5I91A 1T6SA 5JI6A 5JSRA 4RGUA 2PAMA 1UFMA 2PHDA 1YYVA 3GYDA 3HIFA 1HBXG 2W25A 3EO6A 4KN7X 3H3UA 3U11A 2QZ8A 4WZCA 1J1LA 4KWKA 1ZHFA 2VBZA 2IXLA 3BZ6A 3GWZA 2PJPA 2Y48A 1IXSB 3H92A 1WWXA 3M3IA 4OOIA 1OR7A 5CVJA 4BNCA 4IVNA 1HSTA 4N0BA 1XD7A 2XV4S 5FFXA 1V70A 2VT3A 1CAWB 3FZVA 5EZWA 4MX3A 4UV9A 2V09A 4Q0PA 5L3EA 1O5UA 5I93A 1NYWA 2EJRA 3FF5A 3RKXA 1UPIA 4QX5A 3F8CA 5JCTA 1OYIA 2P4WA 1DGWA 3BROA 2K9ZA 3M9AA 2VECA 3NEUA 1CGPA 1PMIA 3K0LA 3HOTA 4XFFA 1EP0A 3KP4A 4MGKE 1FLIA 2QQBA 2RDPA 3Q9VA 5LGUA 2D1VA 4M74A 1VP6A 1CX4A 4NB5A 1YLFA 1FZPB 1OPCA 4MNUA 3MWMA 1DUXC 1I1SA 4RGXA 4WXCA 4XEZA 2V79A 1WQ2A 2MLGA 5CVUA 3PVBB 3K1PA 3G73A 4FAHA 1YW7A 2JZYA 4KNYA 2GXGA 1FXZA 2YU3A 3SZTA 3DP7A 1K7AA 3V8JA 5JSPA 4E2SA 3GW2A 1J5YA 4KA4A 2ETEA 4CHUA 3FM5A 5E1RA 4YFKF 5ILSA 3TKYA 4ASNA 3DPTA 5LRSA 1O7FA 4XFBA 3K1NA 1LQ1A 2BBYA 2GC2A 5D5UB 3F22A 1USSA 4RB1A 5LLQA 2IA1A 5HVQC 2HDCA 1SFXA 2XASA 2W84A 2LF8A 5KHGA 2VONA 3KP5A 3GEZA 1RGSA 4L18B 3ZMTA 3QAHA 1ZZ6A 4JV4A 3WW3A 3O6BB 3ML6A 1J9IA 1BOAA 3FE5A 4OMZA 4K2EA 4TV7A 4F7ZA 1RZ4A 1DPRA 2NAZA 2C0ZA 3HSEA 2F5DA 4IRHA 4HQMA 2O8QA 1VJ2A 2OA2A 1H9TA 3QACA 1K79A 2H6BA 2P6TA 4EJUA 3DQVC 5TRDA 2Q8KA 1MJBA 2XAJA 5E20A 4A0ZA 2R7FA 2ELHA 2F4PA 3L2CA 4MTEA 5FD5A 5D5VB 1UIKA 2KJBA 4KICA 4Q0QA 1X8EA 2FBKA 1S7AA 2OD5A 4MV2A 4YRDA 1FI2A 2B8MA 1ZG3A 3H8UA 2QENA 2P7VB 4L9JA 4PZJA 3FHIB 5LEJA 2M87A 2JTVA 1ZVFA 4RGRA 2XLFA 2CQKA 2UXNA 5A2QZ 3SZPA 4LUMA 1R1VA 4IHSA 1ODDA 2IPQX 3I7DA 2XAFA 4UUVA 5K5QA 1JUHA 1FYMA 1XGNA 4HA8A 3PQJA 1IN6A 1O3TA 2ACJA 2NS0A 1YW9A 4O3MA 5HS7A 1YFHA 1FX7A 3IIAA 3C7JA 3J7AO 2KJCA 3ST7A 3WTXC 2DT5A 4G7HF 2ISYA 5BOXA 4LA3A 4ZYGA 4EWDA 4HBNA 2ZO4A 3GFJA 3ROUA 4ESFA 5ICGA 1OFNA 2IW5A 2YX4A 1OKRA 2FEZA 4EWAA 3IWFA 1Y3TA 2PYTA 3HHGA 3GFIA 1T2KA 4Z07A 2ESHA 4IHTA 1P4XA 1WSUA 1OD5A 1SD6A 3D0JA 4RB3C 3VOEA 1MD0A 3ZMVA 3QRFF 4CXFA 4IXAA 3KE2A 3V4GA 1RI7A 4G7ZF 2VBYA 4E2QA 4BHPA 3I53A 3OCPA 1Z05A 4YYOA 5HDKA 3NKTA 1IUYA 2BGCA 3M70A 4GULA 1ZGJA 5D8KB 3IRRA 3B73A 2XKPA 1CAVA 3SXYA 5F1RA 5I8YA 4HLYA 2FSWA 3EQEA 2PFWA 4ZYDA 4Q0UA 2P8TA 1KYZA 1B1BA 2LKPA 3REOA 4LFUA 3M1EA 1R00A 3KLNA 2IXIA 4GXOA 4BHBA 1O3RA 5FLJA 3S2WA 2B5HA 2A07F 5CVRA 1R1TA 5F6FA 5JVTA 2Z5UA 2P5LC 1U3EM 2GC1A 3SCFA 4XFGA 1ZZ8A 4EM2A 3AAFA 4MTDA 5E17F 5BQTA 1U8RA 5BUVA 1VTNC 1XDUA 4QM9A 2EA7A 2G9WA 5CU1A 5D8LB 1FYKA 4A5MA 3GVAA 3T8RA 4EMSA 4QM8A 3ZP5A 1MJAA 1P6RA 3C18A 2YX7A 2XHKA 4U0WA 1STZA 4AVPA 2M8EA 3CO7C 4IRIA 2MA3A 3U10A 3H1WA 2CV6A 2CGPA 2OYZA 1EH7A 2HQRA 1ZZBA 4HVQA 2EFWA 1F5TA 5L3FA 2XAGA 1A04A 4WF2A 2VC0A 1FYLA 1L3LA 4L9VA 1YFWA 4KN4X 1MDMA 2OAZA 1WGPA 2GC0A 3QP6A 5I0UA 2Q4SA 3ERED 5LRRA 4HZFA 5ICCA 1ZG5A 5FD6A 3ECHA 1KU9A 3CO6C 4H0EA 2UWMA 1FSEA 4IEOA 4HX7A 2L54A 4OIOF 1CAVB 2WTEA 3CJNA 5D5XB 2A6HF 2L4MA 2ZKLA 2EFNA 3DF8A 3FMQA 4N9IA 3GZ6A 3CUOA 4L5JA 4UV8A 4PIYA 2DQRA 5L3CA 4LB5A 4FAGA 1B6AA 2L4AA 3KGZA 4P9GA 3NRVA 4P9UA 3I59A 4IEZA 4LULA 3WTYC 1FBUA 2PEXA 4R79A 3WW2A 3ULQB 3WU1B 1YQAA 4I0BA 1OMIA 4MQ9F 2DK8A 2MC3A 1IW7F 1U78A 4UXAA 1QZYA 4KMUX 1YIOA 4NHJA 2M1BA 4E70A 4M6XA 3C1DA 4ZZDA 4IEYA 2RNJA 1T38A 3F6OA 4XETA 2CFXA 4DNCA 4D7SA 4EM1A 2QBYA 3N97A 3MAJA 1ZH5A 1YFXA 5AIPA 4ENKA 1PP7U 1FBSA 3W6KB 1HKTA 4HN1A 3DEUA 5FO5A 4HX4A 2Z99A 1XSVA 4OIRF 4OIPF 1T39A 1Z91A 2PHLA 3GZ5A 2LDUA 4UVAA 3SQNA 5LGTA 2VQAA 4ZU5A 5JFRA 3R60A 2K7LA 2UXXA 5KHJA 2B0LA 1R58A 1I5ZA 4KU7A 3ZMUA 2CAUA 1S3JA 2H27A 4I0AA 5CADA 1TBXA 4WK8F 2WV0A 1ONVA 4EVIA 3IKTA 1UW8A 3F3XA 4I98B 1GVJA 3WE2A 4L9NA 4UBGA 4HQEA 3K2ZA 3WGGA 4ETSA 4R52A 3F8MA 5HLGA 5HDNA 4MGRA 5D4RA 2DW4A 1R22A 2A6EF 4HV6A 3PLQA 1Q5OA 4I7HA 2PLYA 3GX4X 1OI6A 4KFCA 3LQQA 3H9AA 3I59B 3SHFA 1IN5A 1OYYA 4Q47A 5LGNA 1SD7A 2E9QA 3S0MA 5FPZA 3KFWX 1V4RA 4LGWA 2VT2A 4YIFA 5BV6A 5CJ9A 4HF2A 4BAYA 2WWYA 2KIUA 5BMZA 3HHHA 2BV6A 3KZYA 3RYPA 3BOQA 1RL3A 1U5TA 2JPBA 1DGRA 2QBYB 4LD5A 4YSFA 3L09A 4XSXF 5DD4A 4Q0SA 5H20A 4HSLA 3EUHA 1CAXA 4AIKA 3LAPA 1LDJA 1ZG1A 2ET7A 4XSZF 2OQRA 4MEXF 2QNKA 4IEXA 4KYWA 2DI3A 4BH9A 3BDDA 5EEHA 3IWZA 3FJSA 4XF9A 2IA0A 4MZUA 2FNPA 3ZMZA 4HLTA 4MHGA 1FC3A 4KU8A 1IF1A 4A0YA 3HT1A 4HW0A 1IZ1A 4MGYE 2ZMEA 2O1QA 2XVCA 5KBFA 4IETA 2XL9A 1SFEA 3FM3A 1LRHA 3DL3A 2C6YA 2YPRA 3I71A 5FDBA 3TDZC 4Y13A 4WCGA 3ZDSA 3FMSA 5I0RA 2A69F 3L9FA 4UVCA 4ORFA 1WI9A 5HI0A 3DKWA 1YUDA 2Q0AA 1S7OA 4S04A 2K4JA 4MH0E 1G3WA 2FMYA 5K1YA 1PDNC 2KIMA 2PN6A 4GO1A 5J48A 2KIFA 2BEOA 1W4MA 3JTHA 3Q5FA 3BB6A 2DBBA 1ULYA 1ZYRF 4O5VA 5EEGA 3KGLA 2VOOA 2FNAA 5E1WA 1JHFA 3E3VA 4F8AA 4CGZA 4BYYA 2CSOA 1B9NA 1U5TB 3TNPB 4AVAA 3I0TA 5CVIA 3MQ0A 2F5CA 3RJPA 1JHHA 2CYYA 2ETHA 1CF7A 3KP7A 1CAXB 1NHAA 3VHRA 4D0PA 4AD9A 4CO8A 2ZBKA 3CEWA 4PDKA 4IEUA 3KZZA 2FF4A 2IJLA 2OZJA 1RUNA 2QM3A 5IT3A 5HDGA 2Z33A 2Q2EA 3ELNA 1KGSA 5KK1A 4EJVA 3TOAA 3LA2A 4Q48A 4OIQF 2E1NA 3GBFA 2ZMEB 4BHCA 3CO2A 3WW1A 1S8NA 1ZAOA 4IERA 3LA7A 5DCMA 3K9TA 4XFCA 1L3JA 5BPDA 2VOPA 1G6NA 3E5UA 4M9ZA 3JTGA 2WC2A 1UHWA 2IXKA 4QGLA 3SHRA 3I4PA 3IRQA 4YG2F 5DD8A 3GYHX 4MUVA 2FXAA 3KP2A 2EWNA 1RC6A 1F9NA 4L5IA 4R1HA 3RPUA 1B4AA 2HKOA 3E97A 3R6SA 3ZMDA 2OZ6A 1IPKA 1YS6A 1YWKA 5K5RA 3TGNA 1F1ZA 2ZFWA 1XRUA 1Q1HA 5FLIA 4YIIA 3TOBA 1SMYF 3ABUA 1RUOA 3IL2A 3HSFA 1J3RA 4HV5A 3U9GA 1W5SA 2R7DA 4EWEA 3MEXA 1GQGA 3EJKA 1T98A 3HYIA 3K69A 4CZZA 4NQWA 1IN8A 1U5TC 3OF1A 3G7DA 2VN2A 5LEKA 3L00A 3D82A 4HVRA 2P6SA 1BI1A 5ERIA 1O3SA 1CF7B 1UCXA 3JAMK 1KU2A 2GA1A 1C0WA 2GU9A 3P9IA 4UXNA 4WBBA 3FWEA 2V6CA 1JE8A 2QJVA 4AVBA 4K8FA 3VEPA 2V9VA 1BIBA 3MFKA 4P55A 3E6BA 2QVOA 2E1CA 2OPKA 5D4SA 4Q5SF 3R4KA 1XGOA 1YHFA 3ETQA 3C3VA 1SD5A 5DCMB 1CAUB 2H0VA 3LAJA 1LNWA 3NW4A 5LBQA 3WODF 1YTYA 1O7LA 4M73A 3ZPLA 1G4DA 4OMYA 1ZNPA 5T3NA 1MGTA 4I09A 3CLOA 5HS8A 1FOKA 3JZVA 1UB9A 1O3QA 3E6MA 2HR3A 4PIZA 3WGIA 2VE8A 1LVAA 4A0XA 2HFHA 1J3QA 3WTVC 2A61A 3MZYA 1GHCA 2L02A 3VB2A 5CYVA 3ZQ7A 4EV0A 2F5EA 4X6QB 3HRUA 1R23A 3FHZA 3PQKA 3H7JA 5K5OA 4U7BA 2UY8A 1DZTA 1BC8C 4LTAA 2Q0OA 3V7RA 1QGPA 2LNBA 3V8KA 3U0ZA 2FE3A 5FQ0A 4YFNF 3BJOA 4OINF 3EBRA 2IXCA 2ZJ2A 3LWFA 4LLLA 2K0GA 4LLNA 3R0JA 3S7EA 2PA7A 2RN7A 3ES4A 3JW4A 2GC3A 1R1UA 3E5QA 1L0OC 1HW2A 1ZLJA 3QOPA 1IRGA 3LSTA 1O5LA 4FHTA 1TTYA 4XF4A 1IXRC 3WU0A 1TQPA 2HKXA 1XGMA 1X82A 2AXLA 3OOPA 5E8GA 1J75A 1KQ9A 2A5YB 3U1DA 1P92A 2A3SA 4LLGF 3E5XA 1BN5A 2I45A 3NQOA 4D7TA 1QQIA 4ENJA 4AWXB 3BWGA 2HJIA 2Z9OA 4M9SA 1WA4A 4HOBA 1AOYA 1R5GA 5I0TA 2EFOA 3T0YA 1EPZA 4ONUA 1ZLKA 1WRJA 3O14A 1UD1A 3I54A 1ZZCA 5ICEA 2RQPA 3ZN0A 4LUKA 4HDVA 4HLXA 2AS5F 3R61A 4PCQA 3DV8A 5FGMA 4MGIE 1KQ0A 1W7PA 5LHIA 3GO5A 4N9HA 1UIJA 4WXHA 3P9CA 1TNTA 2HZTA 5EFUA 1SAXA 2KXLA 1XGSA 4HN0A 4B8XA 5C8WA 2XRNA 2IA2A 3V7CA 4RB0A 5BY5A 4LG0A 3NL1A 2FBIA 5FQ0B 3OTFA 4UHTA 1P4WA 2L3DA 5E18F 1W5TA 1HKQA 1YS7A 4M6YA 4RB2C 5BPXA 2HTJA 5JSOA 1REPC 1ZRDA 4U88A 1E2XA 4IEVA 4LK0F 3KP3A 5FCCA 4UNOA 3B02A 2D5HA 2Z69A 2OBPA 4PJYA 2QVSB 3QU6A 3SMHA 2JRTA 4XFIA 3WE3A 5E1XA 1R5HA 1J59A 5FLXK 5DUKA 2HS5A 5DUIA 3DN7A 5DV5A 3N4MA 2H94A 5CVVA 1T0FA 4LB6B 1EH6A 1LDKB 4EGYA 3K1MA 2PBIA 3RIRA 3WGHA 2E7WA 2PAEA 2IC1A 4E2GA 2BYVE 3T1BA 1J2XA 4FX4A 2M30A 1U6GA 4NVPA 1YW8A 3CF6E 4HDUA 3RI4A 1FY7A 2M5WA 3I64A 1DPUA 4LMYA 5H6RA 2D1HA 4L0ZB 2PQQA 1P2FA 2BNMA 4A5NA 4Y15A 2XL7A 2Y0MA 3LA3A 3TQNA 1W7PB 4Q4ZF 4H7LA 4YARA 2D93A 1IN4A 4KT5C 5FB2A 3UKTA 4FT8A 5E1ZB 2FMLA 2QWWA 4LG0B 3TDUC 4XLPF 2EFPA 3H7YA 4O6JA 5KHIA 4P9FA 1RIOH 2CAVA 1TW3A 1XDSA 2PMHA 2QCSB 1PM7A 1XB4A 3PNAA 4XBFA 2MH2A 3NVCA 4FBFA 4OU0A 4PGHA 2Q1ZB 4ZYEA 1P4AA 3SCGA 1XMKA 4I02A 2STWA 1KA8A 2EV0A 2HYFA 2PG4A 3HRSA 1I27A 4HSJA 2MHFA 3W6JB 2V1UA 1Z1DA 1YO5C 3QP5A 4QMAA 1EYBA 3BJ6A 4OLLA 2QUFA 1HSJA 3F8NA 2F2EA 2X0LA 3IHUA 3WTTC 2FBHA 4UBHA 5JR7B 1ZGAA 3P7NA 1O4TA 1BM9A 1SFUA 3CUQA 1SEFA 4KMFA 1NE4A 5JAXA 3BY6A 1FBQA 3E6CC 2BNOA 4GCVA 5E8IA 3SFZA 2ISZA 2RVCA 1B9MA 4G94A 5F64A 5D6FA 3DXJF 1Z6TA 2W57A 4JVAA 4DQ2A 2UYAA 4L11A 4ENMA 1TQIA 1BJAA 1IPJA 4XF0A 4UVBA 3KCCA 2K02A 2Q30A 2VPVA 2DK5A 2D40A 2TDXA 4I3PA 3BCWA 1YFUA 1YG2A 5J6XA 3Q9SA 4J1XA 2DPUA 3J80K 5J8CA 1D3YA 1ZREA 3BPXA 1RNLA 1H1IA 1ZRCA 4HX8A 1BI3A 3LQRA 2HEOA 4BQAA 2V1DA 3LAGA 4ZU7A 2O61A 4JK1X 5KVRA 4AIJA 4LJZF 1BI0A 6PAXA 4A12A 2DTRA 3P9KA 4LLOA 2LF7A 1QXJA 1R7JA 2EFQA 4JTOA 4J1WA 4ENNA 3IDCB 2PI0A 3ACLA 3O2PE 4RD7A 2DO7A 4G8XA 1PP8F 5BXXA 1U12A 1G3TA 2ATFA 4XLNF 1H1MA 2DAOA 4O9EA 4PGGA 1IXCA 2CO5A 4A6EA 3GLXA 1ZZ7A 1FSHA 3IKVA 1ZZ9A 1BI2A 3OD0A 5I8SA 1XSXA 1G3YA 4Y17A 3H1YA 5AONA 2R3SA 2MH9A 1U2WA 1Y0UA 5ED4A 4MGZE 2XLGA 1ZARA 4EGZA 3GF2A 3RNSA 1LR5A 3CUQB 1USTA 4G6DA 2FRHA 4XF1A 4JQFA 3J81K 4IEPA 4PIXA 5D1IA 2ZNYA 3MPBA 2EK5A 4MEYF 3KETA 1Z9CA 3GFMA 3G3ZA 3TO6A 1XCBA 2XAHA 1J3PA 5FPXA 1E17A 3JAMZ 3JSOA 2Y75A 2O6GE 2YR2A 5IT9K 1I1GA 4Z2YA 4IEWA 2G7HA 2DQLA 4EJTA 4IEQA 2IT0A 1TNSA 3H50A
chains in the Genus database with same CATH superfamily
1E3HA 5HOOA 1OQ1A 5C3PA 1H0MA 2WFPA 3RTRA 2E33A 4GB32 1QWRA 3VBSC 1IZ3A 3EQLF 2RDQA 5LHGA 4BXUA 1DYOA 2QQAA 1W8FA 3WLUA 2JDMA 1RUE3 5DDGA 2AYHA 2ZXJA 4A4AA 4COWA 3ABTA 5A3OA 3AMQA 1Q8QA 2J1UA 4LBQA 4BQ4A 2V9KA 4UY8I 5DQ0A 1G8XA 1RUF1 4L92A 2JK3A 1TL8A 2W85A 5K7FA 3ZCOA 2DFCA 5ICFA 1BXHA 2A05A 3QLQA 3ISPA 2KRFA 1LAJA 3JRBA 2QFEA 2EXKA 4ZH4F 5T50A 1NXMA 4LQRA 4BIFA 3MIDA 1C5IA 3VKLA 1TNFA 1SFKA 4LKFA 3FXQA 2XONA 2C1FA 4CDQB 1C8M1 4OAYA 3LSGA 1B35A 2JA7J 3VWBA 1TEIA 2AACA 4QQHA 4LOCA 2ZCWA 3O0VA 2QEXI 4ZZ5A 2JPCA 2CFOA 3ZFEB 1JXSA 1RVF3 1C1FA 3MIHA 2EA4A 3ZN4A 1Z21A 2LK2A 1SC7A 4XJAA 3UJQA 2K4BA 5IVCA 1W6MA 3ELKA 3EMRA 3HQRA 5CB7A 1A6QA 3RRDA 3WTZA 2KP6A 4F3QA 2JT1A 1EY2A 3RKWA 1HW1A 3HJRA 1QPMA 4KIGA 4IGQA 4IKFA 1GYKA 1YE9A 4OQ9A 2JDHA 4NE9A 4URTA 1JYTA 2ET1A 3RJ2X 1DZRA 4F55A 1GFF2 5JZGC 2J5PA 3BPZA 2X29A 2J1EA 2QDRA 2IXJA 2VPLA 3FFQA 3EETA 5IYDJ 4FQGA 2PAKA 2HGCA 4E7KA 3WW4A 1QMJA 3LFKA 5M3FJ 3FXRA 3FXMA 4BS9A 1JOBA 3BR1A 5AIQA 4TLGA 4FCYA 4B09A 3EDPA 2XGXA 3LGRA 3MI8A 5J47A 3J7HA 4GMP3 2GQQA 1PZ7A 1F43A 2PQ8A 3H3ZA 1X1DA 2ZKZA 3DKXA 3FMGA 5L3DA 4JAAA 5KAIC 4U0YA 2XJQA 5CAZA 4AQ6A 2YFUA 2RJLA 2R062 4ESBA 1OA2A 3ZRGA 3UKNA 3ZMSA 3OBZA 2NNNA 2XRLA 5FKKA 3CQOA 3JUUA 2V5YA 4IL6C 3WUCA 2LVSA 5EYYA 4RQPC 3ZDVA 3ATGA 1DF0A 5DEQA 4DRVA 3M7GA 3TO7A 2RNGA 4CCKA 1QO0D 3HUGA 1DGRN 3L7WA 4AVZA 5HNHA 2WKKA 3AMMA 5LFAA 5A33A 3E1SA 5L3GA 4XLCA 5ANQA 3VBRA 4IPAA 2VC1A 1PZ8A 3KF3A 1Q8OA 3IB3A 1MZEA 4BJTA 2DT6A 3INAA 2EAAA 2M0MA 2HYKA 1LJ9A 1XX5A 3B00A 4DFSA 3AVRA 4Q29A 3EPZA 4OFGA 3WXPA 1WLDA 2WZ8A 2WNVB 4IX7A 4BLIA 2A3XA 4D3WA 1B8IA 3FXUA 1N78A 1WLTA 1HX6A 3MW3A 1LFBA 3HTUA 1WI3A 2E31A 2SLIA 1WKMA 3PUHA 3OYBA 4FO9A 4CP9B 3VODA 5FP7A 1KITA 2BZTA 3BU7A 4KL1A 3JSPA 2WNOA 2VE9A 5BNNB 1WLCA 5BNOC 2OQGA 3QPHA 4V2FA 2OPWA 2VKDA 3D5OA 4LNVA 2VZVA 1HN1A 3HOSA 1DP7P 5JIUA 4MYEA 3M8FA 2DPDA 5FYBA 4Z82A 1V00A 4IHVA 2HVSA 3MZHA 3GCWA 3BI3A 1U0JA 3A0BC 1AYM3 2P5VA 4PQQA 2V26A 3ZR8X 1RUD2 2M8GX 5JMCA 5FZ8A 1MQTB 1E57A 4JDOA 3POEA 4BGDA 1WFXA 1BYHA 1FP2A 1X3WB 2F6CA 3CQZJ 3C7GA 2E26A 5KHKA 4QHOA 2JA8J 5H6QA 2R7TA 1UOFA 1Q3EA 4L0YB 3HB9A 3KF5A 4TZDA 2PMUA 1Z7LA 2DUPA 4Y3OA 4IXLA 2VE1A 4OCTA 1WJDA 2R5ZB 3ITQA 4ATEA 1XMAA 4YIRX 1OLQA 3DUIA 2ZTNA 5C5UA 5F2WA 1XNKA 2DFIA 1FNNA 4L9TA 1HV0A 4RLQA 1MNEA 4GALA 5K7PA 1NA1C 4NROA 5IP6A 3USSA 3GM8A 3TEDA 1PVC3 2VMCA 4H2AA 4FE4A 4D7NA 5KXCA 1FPQA 3ZXAC 2GWRA 1K6OA 4Y1ZA 1Z7S1 2RKHA 4XJWA 2DVFA 4CDUA 2F5FA 2R4GA 4BDYA 4IHYA 1ZX5A 2FOKA 4IOCF 5FXVA 1ENQA 3K4AA 1GV2A 4AQ2A 2GOMA 4RR3C 5E8AA 2XROA 1T6GC 5CFCB 1UJ8A 3DPLC 3MIEA 2AEYA 4Q4Y1 4FTHA 1A6IA 5LA2A 1CZVA 3T2OA 5FWJA 1ETWA 5J3LA 3HOBA 2GZWA 1XYPA 1DYPA 3ES1A 2XVGA 1PO21 5FKCA 1UU6A 3MV01 1V5EA 1PGW1 4E27A 1S2KA 2MLKA 3COAC 3C3WA 2IGNA 2XLAA 3MFAA 2K86A 4CDGA 2KL4A 2JIGA 2HWE3 5LBFA 1QY4A 5LA0A 2E5NA 3GHNA 3PDQA 3AYAA 3GFLA 4JOMA 3FZ3A 1Y0NA 3VFZA 3SDBA 3S1MJ 4Q4W2 3GJBA 3PFIA 1YNAA 1K78B 5FZKA 2R6QA 3GJAA 4B1MA 3GXOA 4ZC3A 4META 2RR13 4L2NA 3FX3A 4NJ4A 3KLOA 4MO3M 3UESA 3ZXLA 2HWD2 3HOZJ 5M3MJ 4IE4A 2VZTA 4U7DA 1QA6A 2YPJA 3OYHA 1YFYA 2Z16A 2A68F 2D3RA 2XUBA 4KWJA 3OOXA 5JSRA 3GYDA 4XL9A 2W25A 1COV1 4LG3A 3EO6A 1V6IA 1IGNA 4OQ8A 2VR4A 3POSA 3SDGA 1ZHFA 5FZIA 3JU9A 4AI1A 2PJPA 3GWZA 1W6OA 1SVOA 3H92A 2JB4A 4DMIA 3MV11 3M8JA 5CVJA 4BNCA 2VO5A 1HSTA 2DCKA 4CCEA 1S1AA 4LO4B 5FZ1A 1MNDA 3ZVXA 1I50J 1ACCA 3FZVA 1AU7A 1QJX1 2D6NA 3CC2I 2WQ4A 4BPZA 3OSFA 1YJNI 1OCZH 2BVLA 3CZ6A 3FF5A 3RKXA 3SH5A 3K4BA 3VBOB 2FD8A 3ZSLA 3U14A 3ABLH 1UPIA 3DPRB 5FP3A 4XRMA 4X8NA 2EILH 4Z2AA 2M4GA 5B4XA 1UOJA 2RDPA 1OQEA 2NS8A 1QHDA 1VP6A 1FNYA 2AZ5A 4NB5A 3OG2A 1YLFA 3L2QA 1FZPB 3MWMA 1DUXC 1I1SA 3ZQFA 1MBGA 3FKIJ 4E8CA 4BXSV 3FXJA 4XEZA 1WQ2A 1HDKA 5CVUA 2JA2A 1EV11 5LK7B 3G73A 4RHV2 4LE3A 1YW7A 3T09A 5DUXA 1AL22 2GXGA 2HDWA 4B4RA 1PUFB 2HH9A 3BYWA 1UAAA 5FP9A 1X1PA 3NNLA 3A0NA 3KZ4C 2XJTA 2DFEA 4OZOA 3BPSA 1QVTA 1LHOA 2WB1N 1O7FA 3CBNA 1F5FA 2ZHMA 1JZ6A 5F0HA 4RB1A 1VQ9I 2IA1A 1SFXA 4IQPA 2LF8A 3VKMA 4PJMA 3ZXEA 3DEWA 3GEZA 3QAHA 2UUZA 4Y1VA 5IVEA 3BTXA 4FTBA 3ML6A 4K2EA 4TV7A 2OJED 2LC2A 4JQTA 4V2GA 3BTYA 1DGWY 2F5DA 4EN0A 1SLBA 3MLJA 4BB3A 2DDBA 1FIAA 4IRHA 1W9YA 1XPWA 4GB31 2DA7A 2OA2A 1WZXA 1K79A 2P6TA 2Q8KA 2VMHA 2XAJA 1D4M2 4H7MA 5FD5A 3M3EA 3UGFA 4YM1A 1HQNA 4PJNA 3Q0VA 5DTDA 1X8EA 1I6HJ 3F95A 4CTEA 4FSJA 1BEV2 5DZGA 2HBUA 3GZAA 4FTEA 4R9DA 4XPVA 3PNYA 3FHIB 4PZJA 2JTVA 2VMDA 1BR1A 2UU8A 1W2NA 2R7XA 2XJVA 5H9PA 2F17A 1PGL1 3X2QH 3IZOA 1ODDA 1MMDA 2A6YA 1JU3A 1JUHA 1R4MB 2QQKA 4KGQA 3VZOA 4HA8A 4N43C 5FYYA 4E9KA 3BTAA 4XJUA 2BRTA 4JGZA 2DOEA 3JRIA 1OR7C 2JX9A 4XUTA 5M5YJ 4IV1A 1W04A 2DT5A 2ISYA 2OT7A 5BOXA 4N7UA 5ABJB 4EWDA 3QPSA 1DDLA 2ZO4A 1AX2A 3PVNA 3ROUA 4ESFA 1CPNA 5A7WB 3GMEA 2YX4A 2IGOA 4PJJA 2FDIA 4OUEA 4EWAA 2R0QC 1IS3A 4BE0A 2VXJA 2F4LA 4IDZA 3I2DA 4FFGA 3UGHA 4FQZA 3GFIA 3B94A 2YBKA 1TZOA 2PHUA 4B4QA 3LSKA 4IHTA 1P4XA 1D5YA 3PJYA 4DBQA 1SD6A 1LTEA 4RB3C 3UETA 1MD0A 5DM7F 3QRFF 4NHMA 1IQDC 4IQJA 4G7ZF 3NAPB 3SLIA 4ASLA 4E2QA 3OCPA 4H3WA 1MS5A 3JD72 1KQRA 3NKTA 2I8DA 2X48A 4BQNA 4GULA 5GLZA 4AEKA 2KPMA 2BZDA 2A70A 2YU9J 4CZSA 3SXYA 5F1RA 3TAYA 4HLYA 2FSWA 1XSRA 3OL4A 2GNTA 4ZHNA 4HT1T 1W6PA 3R05A 1KYZA 2VZ3A 3REOA 5H9QA 2F4IA 1LULA 3SEZA 4AG4A 4S0HB 2IGKA 2ID4A 1O3RA 5FLJA 4CH7A 2VASA 1OLTA 2A07F 3WDVA 2Q5TA 2YG0A 1MZ6A 3MKZA 3VBHA 5CVRA 1R1TA 2P5LC 2B9VA 1US3A 3QODA 4EM2A 1GP5A 4MTDA 4FP3A 2CMPA 5E17F 2ELJA 1DHKB 1C4RA 1VTNC 2BVVA 4QM9A 2EA7A 3A7QA 3I3BA 5M5XJ 3ZQQA 3UYJA 1FYKA 4BJ5C 1IKPA 4A5MA 3GVAA 3T8RA 2WINB 3ZP5A 4ZDOA 3NKGA 2M8EA 3CO7C 2FQ4A 2MA3A 2VPRA 4P9IA 2R061 4AI2A 3H1WA 1EH7A 3OYEA 4XJ8A 5A7QA 4A3JJ 1F5TA 1UU5A 2NLRA 2VC0A 3X29B 2QCOA 3ZFFC 2VBBA 4LMFA 2OIIA 1F8VA 2IVJA 1QPIA 3H9QA 3PJRA 3ASIA 2GC0A 2ME0A 1O8PA 5CFCA 2P3IA 2QQNA 4K1YA 2JD4A 1ZG5A 5FD6A 3SZGA 1FPN2 1AHDP 2Z4FA 2P34A 1OJLA 3N7KA 3CC4I 2KR2A 3U21A 2E19A 3I49A 2VJXA 1VALA 1AKHB 2R043 3FMQA 5L3CA 4LB5A 1TME2 1B6AA 4P9GA 3NV2A 3NRVA 4IEZA 3THTA 3I2JA 5GLUA 4QDRA 1JZ4A 5IAXA 2XVKA 2VCBA 2GM4A 2PMWB 4KMUX 1AYN3 3CHXA 2M1BA 4AVTA 3C1DA 1N25A 3CKHA 4A44A 4IEYA 2XUMA 4IOAF 3N97A 2OUJA 1R49A 5AIPA 3OBAA 4NC6A 1PP7U 2IUWA 4UF0B 1UOGA 1FBSA 1HKTA 1YQ5A 5FO5A 2Z99A 2KZGA 4OIPF 1RUD1 4X8PA 4CDWC 4JP0A 2WAFA 2WFF3 3LEKA 3I2FA 2IEKA 3SQNA 1EPWA 4CCMA 3AJZA 2CUJA 1DZQA 5LGTA 3SNMA 4HETA 5KHJA 3ZMUA 3OYFA 4FPHA 3DKYA 3Q8BA 4NHLA 4I0AA 3HPGA 1X33A 5FMOL 2ORZA 1GVJA 4XJZA 5AFBA 3WGGA 4ETSA 4R52A 3F8MA 1K5MB 2YYOA 1R22A 2A6EF 4HV6A 3PLQA 3VBOA 3VDBA 1SFPA 3JREA 5IYYA 4KFCA 3OS1A 5KXBA 3DU6A 1OYYA 2QSGX 4Q47A 1VBC2 4YZ1A 3S0MA 2KDZA 2EXJA 5F39A 2N8GA 3T0AA 1QJEA 4MLOA 5JOYA 1XNCA 2O14A 5CJ9A 1YO8A 5EG0B 4XW3A 3BOQA 5CNAA 4UFHA 1U5TA 2BOIA 4LD5A 4XSXF 5DD4A 1I1EA 2XDVA 3PIGA 1CAXA 4AIKA 4PSXA 2WZR3 4IEXA 4KYWA 2YB7A 5EEHA 5JPNB 4A3KJ 3FJSA 4RS5B 4YGBA 2XUEA 4HLTA 3K4LA 1FC3A 4KU8A 1IF1A 3VBSB 5KR7A 2WY7Q 3MVPA 4A0YA 2PMZA 1CN1A 1KD7A 2M4KA 2O1QA 5KBFA 4F91B 5K0UA 3UGGA 4OHZA 2C6YA 3WNOA 3ZPOA 2IS1A 3ZDSA 3IN9A 5I0RA 3RZJA 5FZHA 1IDZA 4GH4C 4Q4W1 4XUPA 3TW6A 3MHZA 5HI0A 4AI8A 3W5MA 2KT0A 2Q0AA 2LYCA 1S7OA 5E89A 4S04A 1WKYA 4MH0E 3GALA 2VUDA 4XABA 2KIMA 5JLWA 4XLHA 2YDEA 4NMIA 3RZOJ 1W2UA 4XQDA 2DBBA 1Y9GA 3LSIA 1ZYRF 2VOOA 1JHFA 4XXAA 3VD4A 1ST8A 2CGOA 1JH5A 2W08A 1MH4A 1HRV2 1OVSA 3HC7A 3RWKX 2JVGA 2M0CA 1NK2P 1JHHA 2ETHA 3KP7A 1NHAA 1QXPA 2ZBKA 1YJWI 3EYPA 2WO2A 1BR4A 3CEWA 3KZZA 2FF4A 2IJLA 4E7ZA 1YRNA 1LOFC 3CD6I 1UO9A 2K40A 1LFUP 2WZEA 1UOBA 1RUG2 3LA2A 2ZMEB 4AW7A 2EQRA 5ACA3 2VUCA 4BHCA 3WW1A 1RYYA 3BC8A 3LA7A 5JR2A 2C26A 2VGDA 4QGLA 2GP3A 1IDYA 1PK6A 4W6WA 5DD8A 1ORKA 5JZGB 2W91A 4AQTA 2IBDA 1F9NA 4D6RA 5FO9B 4L5IA 1LHWA 3O1SA 1QU0A 1B4AA 2R7ZJ 3PL8A 5A7WA 2HKOA 1UYYA 3R6SA 4AYBN 2K2SA 3K51A 4J00A 1XRUA 4YIIA 3PSIA 3SITA 1IC8A 2GNDA 5FO8B 3I55I 1JBCA 2RDSA 3KHCA 2DFFA 1VPHA 3U9GA 1AL21 5GJ6A 1UN1A 3LCPA 4MHUA 3I4IA 5IT6A 2WO1A 2P2KA 3HYIA 3K69A 2R7VA 1K61A 1PMHX 3OGGA 1WJBA 2BV4A 5LEKA 2LALA 1X4OA 2PLV2 2D5VA 4HVRA 4FISA 1BI1A 2VOTA 5A6XA 1UCXA 3SEEA 2VULA 1KU2A 1OCPA 1C0WA 1JODA 2GU9A 5A3UA 4WBBA 4QHZA 4P5HA 4AVBA 3VEPA 3H35A 5F6KA 1ETYA 4M4RA 1ENSA 2OPKA 3B6AA 4Q5SF 4AE2A 2E7TA 1DIWA 1CAUB 3LAJA 4K21A 5FWEA 2GMEA 4RMNA 3J8F3 3W6VA 1O7LA 4OMYA 2D6OX 3RI9A 3KPHA 3KV5A 1BOBA 1MGTA 1G7YA 1D0XA 2Z79A 3R4DB 3H1CA 4Y1YA 4M3BA 2E32A 2WYFA 1D2SA 3I2KA 3NRUA 4JDMA 2HFHA 2JDUA 2A61A 4Q26A 4RA0A 1RJ8A 5CYYA 3VDAA 3H3VK 1NG6A 3A2KA 4EV0A 5FY8A 2F5EA 5KC6A 1BEV1 1LJ7A 3N9QA 2VW2A 1AR83 3POWA 2VMFA 1G59A 4DXZA 5IFTA 1WCQA 3V7RA 2IS2A 3HBLA 1VBD3 2WN3A 5D21A 5BNOB 4OINF 2HPIA 5IHRA 3MUY1 4YM3A 3WF4A 1GUUA 1UXXX 2PA7A 3VD7A 5HXMA 4B43A 5CKQA 5FZBA 2A3WA 1OVPA 3VPRA 4C91A 3SH3A 4FFIA 1HW2A 1ZLJA 1ULEA 4Y4RA 2LM3A 2Y6JA 1ASJ3 2YY1A 1BBT3 2OC6A 2RQQA 4FHTA 5FZEA 4LE4A 1IXRC 1TT0A 1GU3A 1TT5B 2NVQJ 5SV8A 1XGMA 4NPLA 2AXLA 3H8XA 1KQ9A 4A41A 1VBB3 3U1DA 1P92A 5EJ3A 1G2HA 4ASMB 3VYRB 2WSVA 1ETQA 4Q4V2 5L9VA 4YG3A 2Z9OA 1XNTA 2RS32 3P3NA 2EFOA 2VQCA 1VRH2 3AP4A 2W5FA 3I2OA 2YV8A 3I54A 3JD71 4C2UA 2AS5F 5FO7B 5LHIA 4N9HA 3P9CA 2HZTA 4B8XA 5C8WA 1H2NA 2O9LA 5FQ0B 1X9TA 3OTFA 1QJU2 4QX0A 2HWC3 2Q8OA 2L3DA 1HKQA 1CPMA 1ZRDA 4RR3B 2JENA 2XWBB 4YVSC 3JB4C 5FCCA 4FPOB 2VW0A 2Z69A 1W2AX 4ZTFA 1W1WE 3SMHA 2JRTA 1IUFA 3KWVA 1TNRA 1R5HA 1N47A 4BOWA 5DXDA 4PT6A 2R1DA 1MBJA 4BXFA 2Q1MA 2H94A 3CCEI 1T0FA 5FY5A 1EH6A 2PBIA 3ZR5A 4NHXA 3RIRA 1OOPC 3VBUC 2HYXA 4M3DA 3WGHA 1LE8B 2YGMA 2VM9A 3L2VA 4C0BA 1RUE2 1STMA 2IC1A 2W52A 2QZ3A 3HKZA 1J2XA 1A34A 2M30A 5JPMB 2YFZA 1LESA 4CE8A 1YW8A 4IV3C 1K6YA 4QX8A 2IAIA 3U37A 4MFDA 2PQQA 1P2FA 4AGRA 1JI6A 2Y0MA 3LA3A 5IJRA 3OGRA 4K3UA 2ZX2A 5JOXA 3L2RA 2A71A 5FB2A 3VBSA 4FT8A 2FMLA 3H7YA 5KC5A 1RJ7A 3EXUA 3C7EA 3WSOA 1XDSA 2PMHA 1PM7A 3KQ4B 1TME1 2Q1ZB 4D7MA 2STWA 2VH9A 3AP7A 5LATA 2PG4A 3IAQA 1RVF2 1X2NA 2ZXQA 2V5DA 4HSJA 5CKNA 2MHFA 5JLXA 3LQCA 4E4SA 2LS6A 4C0HA 1Z1DA 1YO5C 4PDWB 4QMAA 2QSFX 1A31A 4OLLA 4YFWA 2F2EA 5EQUA 2X0LA 3IHUA 2RVAA 4UBHA 4AFMA 1LFPA 3TWIA 4JHZA 1ZGAA 5JUVA 2HWB3 4KMFA 2WO3A 1BR2A 3BY6A 3AYCA 3E6CC 4DGWB 3FC0A 3DXTA 1B9MA 4DYRA 5LY2A 5J4VA 3H0DA 4G94A 1DGWX 2QUOA 1Z6TA 3CJIC 3ERMA 4DQ2A 2UYAA 1ETXA 1GOFA 1VQPI 1GQPA 2P6CA 1T08B 2K02A 2FZ2A 3AXEA 2WA0A 2VPVA 2DK5A 2TDXA 4BJ0A 3N9NA 1OH4A 2D44A 2G0EA 3J80K 1UX7A 1D3YA 1RNLA 4QSHA 1ZRCA 2DMTA 5CPRB 3UK9A 2E71A 3OIOA 1XOYA 4CPBA 5GPAA 2GNBA 4JK1X 5K9YA 2Q8EA 4DY5A 3P9KA 2BBAA 4QPWA 4BU2A 4LLOA 1ZGWA 2VQGA 4AEDC 3GTJJ 1QDOA 4J1WA 4WM7C 3ACLA 3O2PE 4RD7A 4G8XA 2DXIA 2X51A 2DAOA 3OL3A 4GMP0 4XUNA 1Z3YA 4PGGA 1YIFA 2CQNA 5FAXA 5FK7A 4OI1A 3S30A 2EXIA 3K4NA 1FSHA 4XTMA 2BHZA 3OD0A 1VBE3 4E7JA 5I8SA 4JQRA 4Y17A 2B39A 3KVBA 4TN7A 3GTPJ 5EWSA 1K3IA 1Y0UA 4MGZE 5FY1A 4H4KC 1WUVA 3RWNA 2VTXJ 1S2BA 4W4ZA 3LDRA 4NOTA 2K9SA 1OCTC 3KETA 1IOAA 3OYNA 4AM3A 1WCKA 1I3HA 3GFMA 3CMAI 1VQ7I 4R9BA 4HK8A 3RI8A 1H2MA 2YR2A 5A1FA 5IT9K 1I1GA 3MIFA 5FUIA 3HPHA 4Z2YA 4IEWA 2G7HA 4EJTA 1YI2I 1MPXA 4IEQA 3VN4A 1YITI 2TUNA 1O59A 4R8HA 5JHUA 1GWLA 3LOIA 3V7SA 2Y60A 5JHFA 3VHNA 5IVFA 3KV4A 1R5ID 4KNCA 3HN3A 3H9JA 1CAUA 1H2LA 3WZ1A 4RQPA 3CL1A 3HSRA 3D0SA 5KAFC 5C6CA 4XZUG 4WX9A 1LDDA 4Y22A 3T8TA 3AZVA 4MXWB 2GBYA 1LEAA 4COVA 1PJRA 2K9LA 5DDJ3 1CONA 3T3YA 3KIOA 5HS9A 3RYRA 1IO2A 2EAKA 1HRV1 3HOWJ 5DCFA 4Z2WA 3ZYGA 2BW3A 1UQXA 4M4PA 3ZSJA 3BR5A 3GZNB 1AYM2 4CYCA 2Z2SB 3CLPA 2QZ2A 3OIQA 1DQ5A 4GWMA 2DYCA 1X58A 2D2WA 4AYUA 1MJ9A 2D5FA 4GYIA 3WP6A 2A6XA 1G3SA 4YW3A 1V6LA 3UKVA 1W7PD 4HBLA 3L2HA 4PLOA 1FMVA 4XRFA 4Y4YA 5BNOA 2VQLA 4P9XA 3TN93 4XAAA 3IPVA 3ZIWA 3ZIXA 1OLRA 1HOMA 3WG2A 2Y33A 3JRAA 1WCSA 2CUZA 5C4WC 1SCSA 2Y31A 1D4VB 1RUH1 1RUJ3 4YGDA 2ARXA 4BE1A 2FOWA 1PVC2 3O1TA 1RKWA 1XSDA 1LECA 3OUIA 3HPNA 1D8JA 2VTXA 4DXSA 2E6VA 4CU7A 2J5OA 2LBFB 3RPQA 5EJZB 1V6OA 4M72A 3RZHA 4XOTA 2YXSA 2E7XA 4GD4A 5E16A 2CQQA 4LLFA 3DFGA 5JXJA 5I8TA 4KUMA 2V1XA 1UY0A 3BR6A 2AXTC 1F36A 2H6CA 2ZC2A 5FLVA 4X6RB 2PLV1 2EXHA 1NA1A 3CCJI 4KDPA 5ILUA 4P96A 4YZ2A 5G04L 1XNAA 4O7XA 1RUC3 2VODA 1RTVA 2W87A 4CDQC 2ZGRA 2RS53 4QQ2A 3LWCA 4QXKA 3CESA 3MD2A 3ZMOA 2HWE2 4NIDA 1XJAA 3NWTA 1UL9A 3ZFFB 3D8CA 2ZOEB 2N7GA 2X4HA 4KIBA 2JSPA 1POV0 3ZFEC 4FPFA 4RR3A 5AVPA 1HDDC 1X7NA 5IWFA 3ZLIA 1IRFA 2E60A 4IRGA 1KS4A 1VBA3 1V5FA 1H8VA 1VFCA 4GZ9A 1PUEE 4J19A 2RR12 3MW2A 3MBWA 2I10A 4YM0A 3BOPA 5A2QK 1UWWA 4XDQA 1GT0C 3S6PA 3VBFB 3V0BB 5FLXZ 1RUF3 1PZ9A 4YNIA 3WF3A 2DN0A 4BQOA 2QGUA 2CG4A 4KT6A 3K7AJ 1YJLA 4G9YA 3I5UA 3ZYPA 4EQQA 1XCVA 4FXKB 1V0AA 2A6WA 1MR5A 1LE8A 1OURA 4AUXA 3M3CA 4Z92B 2K27A 4C2MJ 2IXHA 1J0RA 2JMWA 3CCLI 2OQ7A 5E3LA 1J58A 3ACGA 5DUWA 4QIWN 3VZJA 4AVCA 3VL9A 4II3A 5K7ZA 5ISLA 1X8MA 4IE0A 1TW2A 4RHV3 4KIFA 1RC9A 2XAQA 4XFHA 1JYVA 3KEQA 2F6BA 1HKSA 1Y9QA 5CISA 1UHMA 4LKEA 4HFSA 3ASNH 4G7OF 4Q0VA 2W7NA 4LBLA 1YLLA 3WG9A 2XJUA 2RV8A 3OYIA 1ON2A 2XKOA 3ZXFA 1HXDA 5FUPA 3F6VA 2ZMKA 2W95A 4LT5A 1VR3A 4GKYA 4DUXA 2CW0F 4WVZA 5C9AC 5IVVA 2BFUS 3J7YJ 3VSLA 4HVOA 4D6QA 4I6ZA 5BNPB 2MBFA 4CXXA 2KZVA 4A93J 2XB6C 4Q4V1 2FUG2 1SD4A 4QGNA 4A6DA 1FYUA 4NIIA 1KU7A 4A42A 1VRH1 3RQIA 2VU9A 1JTXA 3M3YJ 2RGVA 4HL0A 4QDSA 2PTMA 2BE5F 1DQUA 4N4OB 2PHFA 2EV6A 1GSLA 1KZHA 3P5JA 1FP1D 3HJEA 3S2DJ 5BNQA 3V65A 3BG3A 1D4M3 4BEHA 3BJAA 3IUOA 5T5JA 2IS6A 4ZU4A 2KKOA 3HNYM 2OA4A 4V1PA 1AR93 1CIWA 5T5PA 1S0JA 4FCAA 1QJU1 3O3KA 3WTSC 3BVCA 2W9XA 3ZN6B 1ZBA3 1Y8QB 4WXDA 3OGSA 1XMXA 5DZEA 2DFBA 2IXSA 1GNZA 2FDHA 1TVGA 1LOCA 1W8OA 1A8MA 1D7PM 5FFOC 3OPTA 2OPTA 2W1QA 4FPLA 3ECOA 3I2GA 3UL2A 1TQ5A 5FPUA 2M45A 5F5CA 3T08A 1JUPA 4BACA 4M71A 2HWVA 3GBGA 3I3LA 5E6HA 4DUVA 3T1MA 4TXWA 3FMRA 2VJIA 5J37A 3I56I 4P5OA 2IRFG 3LSMA 4LBQD 3M8LA 3ZKUA 3HAGA 1D0GA 1MQTC 1H8TC 1MMSA 1QZZA 1CAWA 4NRQA 1DFQA 5C3RA 2HTSA 3AP6A 1F31A 3QBQA 1ONAA 4IGOA 1V3FA 5FLHA 1K42A 5FYVA 1NCQC 3BR0A 1WBFA 2VUMJ 3CJRB 5FJKA 3AL6A 5B2GB 2BY0A 3L9JT 1HB3A 3RJRA 1UY4A 1OYWA 2GA2A 2QKLB 4YFXF 3D5RC 2XIGA 3WCSA 3OS0A 1BA5A 1W6QB 4EJOA 2JD9A 1O57A 2R7OA 2X85A 3T5XA 3WY6A 4KG0A 1ALYA 2JG8A 2NMOA 2L2OA 1UKGA 1X9PA 2VXZA 5LD2C 3MKLA 1RVF1 1PIV3 4J01A 2MYSA 1T6SA 2PAMA 2PJRB 2OVUA 4F3JA 3WNPA 1ETVA 3HIFA 1Y8RB 3QYBA 4IHWA 5JXGA 1AZDA 2QZ8A 1J1LA 4MXWA 2JUGA 3LEIA 4N43A 2VBZA 4NO4A 1BW6A 1CWPA 3G1MA 3OJBA 3PUAA 2Y48A 2D98A 1SDWA 1WWXA 1UMIA 4OOIA 4AOCA 5EGOA 2DOFA 1OR7A 4IVNA 3O0WA 4N0BA 2XV4S 5L36A 4FPCA 1V70A 2VT3A 3AMPA 1C8NA 4ZJZA 1O5UA 2XR4A 4Q8LA 1NYWA 2W3JA 3FBYA 2EJRA 3KYDB 2W4SA 3F8CA 2X10A 2P4WA 3WG3A 3AYDA 3GXUA 2XOMA 5A7OA 2VECA 3NEUA 3AFGA 5TSWA 1T56A 4XFFA 3OR1C 1EP0A 1ITYA 2VZPA 1FLIA 2QQBA 2RAEA 3Q9VA 2YHJA 1CX4A 3PMEA 4MNUA 1KDMA 4RGXA 4WM8C 4XJ9A 2V79A 5FPBA 1JW6A 4GMP1 1FOXA 4FPYA 1GBGA 3K4MA 3DBHB 4Y20A 3ZXGA 1K7AA 2WS93 3V8JA 1XXNA 4FPKA 3QPLA 1W0UA 5FKOA 3DCQA 5LBBA 3TKYA 1UF2C 2ZGSA 3CU7A 1WD4A 2QQVA 2DTZA 4XFBA 4YVWC 5D5UB 1USSA 1M4WA 3WOGA 4A45A 4Y5TA 5LLQA 4GWJA 2A75A 2HDCA 1I5PA 4LJHA 2W84A 1W0OA 5KHGA 3N05A 4MHRA 2RJ2A 2ZX1A 2VONA 3KP5A 2JDYA 2E51A 3LB9A 1RGSA 1FOYA 2ZGQA 2WT0A 1XYOA 1FV3A 5CKMA 4UUSB 1BOAA 5F08A 3AK0A 4LKDA 3DPRC 1RZ4A 4JZRA 4B7KA 1DPRA 2D6LX 1HB2A 2NAZA 3MIBA 3RS6A 2R042 4AR2A 2O8QA 4P02B 3BTJA 1VJ2A 1H9TA 4EJUA 2DMUA 5FTTC 3W9AA 3P5BA 1U5ZA 1MJBA 5E20A 3USUB 4A0ZA 3ZFFA 4NIHA 2ELHA 1QGLA 4MTEA 2VXDA 4PQ9A 1UIKA 2BXYA 4QB6A 3D3AA 1RINA 2FBKA 1S7AA 3B01A 1AYN2 3O1PA 3S3NA 3TYJA 3H8UA 1I3AA 2LY2A 2P7VB 4L9JA 5FPLA 2M87A 3TEYA 1XNBA 2WN2A 4UB6C 2H0BA 4MG2A 1ZVFA 3SQOA 3SZPA 2EH3A 1ULCA 4LUMA 3O8HA 2K9MA 4UUVA 1GUIA 1AYM1 1U9NA 5A1AA 3PQJA 2UV1A 4ZZ8A 2DVGA 2WFF2 1OKOA 1YW9A 1HRI1 4OHVA 4ZXEA 3B69A 1OBNA 1YFHA 3O1VA 4BQWA 2JKXA 2KJCA 4DYCA 4AHYA 2OX0A 4ZYGA 2XC7A 2ME6A 1DQ4A 4HBNA 3GFJA 2E36A 2WWUA 1OKRA 1GV9A 1M06G 4YLZA 3MPPG 3ZOBA 1G9FA 4URAA 3WX5A 5A3WA 4DXTA 5GZEA 4JCKA 4I76A 4Z07A 2ESHA 1PVC1 2W94A 1NAEA 1OD5A 1EV13 4EJRA 5GLTA 1BL0A 4CDWA 4CXFA 4IXAA 1IPSA 3KE2A 4E7SA 3V4GA 1RI7A 1FEXA 3W5NA 4YG6A 4BHPA 2D7FA 1MIJA 3KLSA 3WCRA 3IAPA 4M3CB 5HCAA 5HDKA 4II2A 5T5OA 3PTYA 1ZGJA 3IRRA 5C44J 5I8YA 5LB6A 3EQEA 2PFWA 1E5IA 2NP0A 4PI2A 4Q0UA 1SACA 1B1BA 2WZR2 2LKPA 1R00A 3KLNA 5FY7A 3PIJA 4XBLA 4BK5A 5C5TA 2XSJC 2M3AA 5E3MA 4BHBA 1XNDA 3ZOIA 4OHWA 1QZEA 2V9PA 3KD4A 2BWAA 4FOYA 4PF5A 3KV9A 5F6FA 5GKAC 1ZZ8A 1MSFC 3JR9A 2VLAA 3ZPYA 4UWDA 1OF4A 1OOPB 4BBSJ 4CCOA 5BUVA 1IRZA 1XDUA 2HWE1 3ZXKA 5CU1A 5D8LB 2VIXA 3AG4H 1S0CA 1P6RA 1ULOA 4IV3B 4AVPA 3QH6A 4IRIA 1BW5A 4RM3A 5CG9A 2EFWA 5CKTA 4M00A 5L3FA 2XAGA 1A04A 3M07A 4U2AA 3M7AA 1MMNA 1FYLA 5EP9A 3AB0A 2O5RA 2HDDA 1L7LA 4XLEA 3SEQA 4FOQA 5CQEA 3NAPC 5JIAA 4KGGA 2OAZA 3QP6A 5EHDA 2Q4SA 3ERED 3IMNA 5GM0A 3RGBA 1D1AA 3ECHA 1BVP1 2DYRH 3C8XA 3BQYA 1CAVB 5FMBA 1LKXA 2WTEA 4L8QA 3CJNA 5D5XB 4F93B 4GH4A 2PHRA 3H8OA 3FUQA 1OC1A 3WNKA 4FQ4A 4L5JA 1AF9A 1O4ZA 4PIYA 2VOKA 3HMYA 2L4AA 3KGZA 5FP4A 3I59A 1U8BA 3OY8A 3WTYC 3WU2C 5A32B 1FBUA 5ACA2 3WW2A 3ULQB 2E7AA 5B4NA 4MQ9F 2XPJA 2OUHA 1UG2A 1IW7F 3N9OA 1U78A 2NPIA 3FXOA 2VNVA 4IL7A 1OSGA 3KYLA 1T38A 2CFXA 1DGLA 1MW7A 1DLCA 4A6SA 3ZQGA 4AFDA 4ENKA 2Y0SN 2QKMB 4XILA 3CNAA 2CDPA 2DUOA 2DA5A 3LMMA 1GDTA 1XSVA 4N53C 4XMYA 1T39A 2XF7A 4N8MA 3TEZA 2UWCA 4UVAA 2WAQA 3GTQJ 2VQAA 3O5SA 1Y1VJ 1UXZA 1DCSA 2Z1DA 1S3JA 2H27A 2DTWA 4LBJA 1TBXA 3HNMA 4WK8F 4EVIA 3OYKA 1BJZA 4L9NA 2DFHA 3I8TA 3FN9A 4UBGA 4HQEA 3C7OA 4JX5A 4D6SA 1HC8A 3A03A 4AEDB 4EN8B 3FBIB 1AA7A 2DW4A 3VBRC 2PELA 2SBAA 2L9LA 4ES9A 4D5FA 3GX4X 1OI6A 5F37A 3HGGA 5F3EA 3SHFA 1IN5A 1X2MA 5JWPA 1SD7A 4XQWA 3FXLA 4CDXA 2XPUA 1DQ2A 1R093 2VT2A 4XKWA 3QYEA 2G9GA 5BV6A 1MS9A 2CW8A 5TISC 2I07B 4AFBA 4BAYA 2WWYA 3AP5A 5J1RA 3J8F2 4BZ4A 2BV6A 3RYPA 4QPQA 2D6KA 1N75A 2JPBA 3ZKYA 1DGRA 2QBYB 1UYZA 3JB8A 2ECCA 4HSLA 1GKBA 2X5IB 3OUJA 1ZG1A 1W2TA 4XSZF 1W8UA 4MEXF 3F0CA 2BW8A 3M1CA 2J1RA 1S0GA 2IA0A 3MN2A 3ZFGC 2VI6A 4IZZA 5GPCA 1AR71 3O1RA 1FNZA 1IZ1A 3TW7A 1AR82 3BGAA 2P0WA 1LRHA 1VBD2 3I71A 2GIZA 3JRCA 3TDZC 3VYTB 1VQ6I 4AZZA 2EICA 4E7LA 3U07A 3C2UA 4CEYC 1K5MC 1WI9A 3WHBA 2KDOA 3WP4A 5HODA 3DKWA 1YUDA 2C24A 1HCRA 4A3FJ 3E1F1 3K4ZA 1TMF1 2K4JA 4XQ4A 2FMYA 5K1YA 2LD5A 2XAUA 4Z8BA 2PN6A 4D1QA 3W20A 2BEOA 1ASJ2 1BBT2 3KEYA 3W2WA 1NQDA 2NZ9A 2QQWA 5EEGA 3KGLA 5E1WA 5B66C 3E3VA 4CGZA 4BYYA 4XE9A 2CSOA 4R4ZA 2Y6LA 3TNPB 1VBB2 5GZCA 2WWSA 4RFT0 3I0TA 2F5CA 2WBMA 3BN6A 3NJXA 1UKRA 1CF7A 4FP2A 4BQ1A 4D0PA 1XQNA 1GLNA 4CCLA 4IEUA 4E4ZA 2OZJA 2ECBA 3FBNB 5IT3A 2WA4A 4RS5C 3ZYFA 2CV0A 3HDDA 3ELNA 1KGSA 4UFMA 4COYA 4PSWA 3BG6A 4OIQF 3AP9A 4AGVA 2DU1A 3CC7I 4SBVA 1ZAOA 5EZHA 2O8KA 2DF7A 3PVOA 2E1MB 1W8ZA 2VOPA 3H3LA 2IXKA 3SHRA 4XN0A 3IRQA 4YG2F 4AC0A 2HWC2 2P81A 3M3QA 1H9PA 2VQTA 4CEWB 3RPUA 2B46X 1H89C 2W1SA 4GFBA 4COZA 3E97A 4YELA 1JKRC 1DQ0A 2Y2ZA 1YWKA 5IK8A 5K5RA 3S16J 2VD7A 3KVAA 4ATFA 1SG3A 1Q1HA 3TOBA 2LREA 3RFRA 1SMYF 3AJYA 2H8WA 1RUOA 4UFIA 5FXZA 3OYGA 3HSFA 5EJ1B 1J3RA 1FOD3 1N1TA 3M3OA 1CESA 3K4JA 1W5SA 2PHXA 5CA6A 3OOUA 5F3CA 3MEXA 1GQGA 2VY0A 2M7BA 3C2BA 4CZZA 2JDNA 3IP4B 5IYCJ 3L00A 5ERIA 2BPA2 3OYAA 3JAMK 3EUHC 1FIPA 3P9IA 2VZQA 1T2XA 1JZ5A 2V6CA 2VKVA 1JE8A 3ZX7A 4NHYA 4K8FA 1FX5A 2F4OB 4MXVA 1W39A 1QF3A 3H8RA 4YVSA 5DS9A 1W90A 1MSEC 2Q2EB 3MFKA 5JI9A 2QVOA 2E1CA 3ZXSA 4CXYA 3HOYJ 3MIGA 3GHMA 1S2EA 2YBSA 4KMQA 2ZMEC 1YHFA 3FXKA 4F92B 1QEXA 5DCMB 2VMIA 3JBG3 1OPMA 3N7MA 3VB9A 3FHQA 4XHBA 2P1BA 3NW4A 4P9LA 1YTYA 3S15J 2R041 4M73A 4YWAA 3VBUA 3PUFA 1G4DA 2R5YB 2DU0A 2JDAA 1X50A 2ZZQA 5HS8A 1O3QA 2JIJA 2ZHLA 2TRTA 2ZJPF 4FOVA 4A0XA 9ANTA 5KCMA 2V6EA 2PXJA 3WTVC 5F7UA 3VB2A 4QQOA 2FJ1A 3K77A 2YGLA 2W39A 2WAQN 3S93A 5E3NA 1AYN1 4X6QB 3P1IA 1E3OC 4R9CA 3H7JA 5FKBA 4Q1RA 1XG1A 2HEVF 2UY8A 1DZTA 1KEXA 1UY1A 2C6SA 4LTAA 4NQWB 1QGPA 3ENRA 1QJZA 3C7HA 4BA6A 2I2SA 2FE3A 3UKGA 1UAIA 1UELB 2HWB2 2ZJ2A 2HXOA 4BY7J 3ACIA 1R1A3 3R0JA 2WFF1 1WJAA 5C9AB 2WABA 1JXNA 1OT5A 2RN7A 3ES4A 3PIPF 4QX7A 3JW4A 1NG0A 5IK4A 4LORA 4XDOA 3HOVJ 2VVDA 2IS4A 4YGCA 1DP0A 1ZR2A 3K3OA 3ZQLA 4W97A 1FMD3 2AQEA 3QOPA 4XIOA 5F04A 4PLMA 1TC3C 3DEMA 2HI3A 4XF4A 1ULPA 3GDBA 5A32A 5K7HA 2GN7A 2ZKNA 4FFFA 1CVNA 2EBIA 4LLGF 1CZSA 3I2HA 2I45A 2F5VA 4D7TA 2HVRA 4BQ2A 4AWXB 3BWGA 4M9SA 1WA4A 2OTLI 5I0TA 3T0YA 2XB0X 2R32A 2WB1A 2X1DA 2LUWA 3TRSB 5IVJA 1WRJA 3O14A 4BK4A 2ZGKA 3K4KA 5ICEA 3APBA 2RE9A 4M3CF 4HDVA 4HLXA 3CJIA 1OCCH 3R61A 2VW1A 5FGMA 2XJRA 2VCAA 5GLWA 1SAXA 4OHYA 5F0CA 2L9RA 3V7CA 4RB0A 1WLWA 1VBE2 4PFPA 2WZR1 3NL1A 5FZOB 1H2KA 1W5TA 4JC1A 3VDXA 1YS7A 4UW6A 1TWFJ 2FDFA 4UYBA 1X1AA 1JS9A 5C4JJ 4RB2C 5BPXA 2JEMA 3CZJA 5JSOA 1YI7A 5FYTA 1REPC 5DAQA 1QOOA 2FCTA 5CBLA 4IEVA 4ANJA 4LHNA 2X05A 2LY1A 4UNOA 3WV6A 4CSWA 4AEDA 4WM7A 1TZLA 2NOGA 4DB5A 1W6NB 1HJFA 5E1XA 2D97A 2XJPA 2CJJA 1X1CA 4BDVB 2WYSA 2HS5A 1OHFA 2LLKA 1H8TB 5DV5A 3N4MA 4JGZC 4EGYA 3K1MA 4IV1C 1Z0HA 3R4SA 2XWJB 5A3PA 2K9NA 4WVMA 3RZKA 4GWNA 5SV5A 1NCQB 4YW6A 1PX3A 1U6GA 4QPGB 3QH7A 3CF6E 2Y6GA 3SJMA 2DT7B 5DDJ2 4LMYA 4L0ZB 5DPNA 3JRFA 1ZBE3 3VV1A 3N9MA 4Y15A 2VG9A 5H9SA 4YFZA 3TQNA 1W7PB 1QH6A 3H9GA 4YARA 4QDQA 4KT5C 5FKNA 3BIWE 2QWWA 4LG0B 1WMDA 1S72I 4M3EA 4O6JA 4ZYAA 5FZ0A 5FK8A 3A0KA 1RIOH 3HQUA 4NWVA 4UFLA 3O12A 1R6RA 2GH8A 1XB4A 2MH2A 1GR3A 5FBJA 4FBFA 2QQIA 3PM1A 1Q8SA 5EF6A 2RM23 1P4AA 1SPPB 5F8PA 1XMKA 5ACA1 3TN92 3HGYA 4LBOA 4PFOA 4AAPA 2VVEA 2EV0A 2DVAA 2NOJB 2EIKH 1Q1VA 1JYXA 3DGTA 3IIIA 1VNDA 1X36A 5T52A 1AR63 2XBO1 5HXVA 4C1WA 2V1UA 4OMCA 2WNUA 1RUJ2 5FZDA 4RAGA 4NBQA 4B3AA 4UUTA 2R0FA 3SKVA 5DABA 1P9QC 1HSJA 3F8NA 4DEQA 1LU2A 1POV3 5CQGA 2BTVC 5DAWA 1J83A 3AG1H 1S4CA 3URFA 2WLQA 4QXHA 1SEFA 4QHBA 4OYUA 4LO6B 3SC7X 1FBQA 2BNOA 5E8IA 2M7AA 1GWMA 2ID3A 4P5YA 1V5GA 4YZ5A 5D6FA 4HNTA 3PUBA 4RGGA 2YC0A 4XF0A 4UVBA 4WM8B 1Y43B 3KCCA 2Q30A 1YJ9I 3OWTA 3IAS2 2D40A 2EF6A 5C4WA 4A3EJ 4C1XA 5C70A 3BCWA 1YG2A 3LIGA 5J6XA 5FZ9A 4J1XA 1UZVA 1RUC2 5J8CA 3D1NI 2LROA 5JMOA 1IQAA 2ZMLA 3BPXA 1H1IA 2RS52 2HEOA 4BQAA 4UI9L 4Y1XA 4AIJA 4LJZF 2DTRA 5IW0A 5J96B 4YVWB 3VKOA 4JTOA 5DM6F 1AXKA 4ENNA 2KM2A 1Y56A 3ZYJB 1RR8C 3C2GA 2OCEA 5BXXA 1G3TA 2ATFA 4XLNF 3J8F1 5A6QA 4UW3A 1QOTA 5L19A 2CO5A 3NV4A 2UWBA 5JVGF 3GLXA 1VBA2 2JG9B 1KXGA 4JX4A 4PDWC 1MS4A 3LSHA 4XORA 1BI2A 2G19A 3HOXJ 3H1YA 3CP8A 5J1UA 5ED4A 1UZCA 1RUF2 1ZARA 2G9ZA 4EGZA 1FTTA 1LR5A 3KV6A 4CDQA 4IE6A 3CUQB 2DBIA 4XF1A 4JQFA 3J81K 1VRBA 4V2VA 4YW5A 5E3OA 2EK5A 4MEYF 1WPKA 4DOZA 1Z9CA 1AR81 3TO6A 1XCBA 1J3PA 2TBVA 3JSOA 2ERFA 3ZFEA 1YCIA 3ZR6A 1VBD1 2HEYF 3HBKA 3OBTA 4AU7A 1OF3A 1RHI3 4GYGA 3SISA 1MS3A 2P5KA 5JVVA 4AQSA 1ODNA 5D8AC 5LBCA 1B09A 3F8BA 3TEWA 4XMIA 2VBDA 2B9UA 3ZO0B 2L7ZA 2LRPA 1JKQC 4PBPA 1ASJ1 2FQPA 1J7KA 3SXWA 5FZ4A 3S8PA 3KMHA 3GTGJ 3SYTA 1CZTA 3U2RA 4U0VA 2D43A 4RAYA 3RQ4A 4EM0B 2Y0OA 2FA5A 2BDRA 5IK5A 2CU5A 5FROA 2B7EA 2F4MB 4IE7A 1GQHA 2O3FA 2MD5A 1VQKI 3Q9OA 2VAUA 5JOWA 3ECQA 2F48A 1DQ1A 1D0HA 1VE0A 2VBXA 4QWQA 1ON1A 1Z67A 1W8NA 3RZLA 1D8KA 2VCCA 2C5DA 3A1YA 1UZWA 3CTAA 1GWKA 5C9AA 1AWCA 2JVHA 4YW1A 5EJCA 1AR92 3KP6A 3WINE 3LDBA 2FQ3A 2HYJA 1SFNA 4KQ7A 1A8DA 2GH2A 2HWC1 1ZBA2 1EH8A 2W1OA 2ZXWH 3OPZA 2M34A 1C57A 2WO7A 5LZ6A 4SLIA 5J3UA 4JDNA 2ADEA 2COMA 1D0ZA 1LEMA 2EB7A 3S1RJ 5C3SA 4LBQB 3RKYA 2A5ZA 5A3LA 3ESWB 1VLNA 2OU2A 2OUMA 1QH7A 5J1XA 5HLIA 3LKJA 4HG6B 3LFMA 2O0YA 5A1LA 2PFBA 1LKNA 4JTNA 3BTZA 3J7ZI 2WNVA 2WQ8A 3WTWC 3UV9A 3ZSMA 3CZUA 2QQ9A 3FLTA 3D4KA 2J42A 1PNGA 2XMLA 2EV5A 2QYOA 5J7MA 2AR6A 1RITA 4QU2A 1B35B 4CP9A 2HQAA 5BS6A 3JRDA 5BNNA 4UW5A 3H1MA 3HOUJ 2BWCA 1HB1A 3BP8A 4QPIC 1W9SA 4G6TB 3S2HJ 1TQMA 2DBNA 1U5IA 1F4KA 1BBYA 1W6MB 3IDBB 4I30A 3RYKA 5F1JA 1MQTA 3IBMA 1H8TA 1MNMC 2HOSA 3HWJA 1QQP3 3QYFA 1PIV2 5FRNA 1GOHA 4ZZLA 3OGJA 2GSYA 4Y26A 3KSCA 3OYCA 1WBLA 1NY72 1WJCA 2IVMA 2R5ZA 1NCQA 4FFHA 2JXAA 3RZMA 4A3LJ 3WF2A 5FFZA 2RMU3 4BLJA 4ARYA 2RC4A 1DP3A 3WF0A 2AGSA 4O9GA 1W3XA 2HWB1 4HF0A 3WDXA 4KWLA 2WT1A 1YHQI 4QQLA 2CWEA 3UNPA 4XBNA 1LB2A 4OHXA 4AVVA 3KZIC 1AHSA 1HF0A 3H42B 2WY8Q 2D45A 5J09A 1S5LC 2NRAC 2IP2A 3JCUC 4RAZA 2EVXA 5ILVA 1SQ4A 2O03A 2HQ5A 3WNNA 2COBA 1R4NB 3WNMA 4YW4A 1WCMJ 1RUH3 2GP5A 4AYBA 4N53B 1NG7A 1YXWA 2IFRA 4ZS2A 3HRMA 3ZGKA 4S05A 4M3FA 1IG7A 2EIDA 5GAGJ 1IS6A 4CPBD 5JDBA 2VZSA 2B4KA 4HSTA 3T4VA 5AFEA 4CYDA 3IT8A 2HQNA 2CYFA 3OYLA 1W28A 1MKMA 3HUGB 2ZGMA 3VBFC 2W24A 5GZGA 3Q0WA 4L99A 2VNRA 4JRAA 5A33B 3E6DA 3WVJA 1GOGA 2BNNA 3VBRB 2WS92 1OFCX 1NTCA 1PHMA 1S0DA 3OV8A 2GIVA 2VZOA 4DRRA 3SEPA 5T54A 4HYEA 4RL7A 3BZCA 1QXRA 1C3HA 2ES3A 2OTJI 4RBOA 2J7MA 3DXUA 1LEBA 4GA9A 1SLCA 4ESJA 2OZUA 1VBE1 3CMGA 2DU9A 1K78A 1LHNA 4BXXJ 1B8IB 3HNBM 5LHHA 4ZKTB 4AIHA 3PURA 1HLVA 2MFZA 5J8FA 3NNJA 5JXHA 3FFZA 1O6UA 2HWF3 1LOEA 2ZX3A 1D5VA 2WNEA 1R36A 2L01A 4ZYHA 4Q1PA 1XTAA 2DTYA 3J80Z 2UZKA 3MDPA 3TNQA 1KYWA 1K83J 3ZFGB 1TWAJ 1MDMB 3CDHA 2DLLA 5HLHA 4HMZA 2JJ7A 2NYXA 2HOEA 3POIA 1N77A 1XSQA 1JYNA 5BNPC 1MZBA 1XN7A 2AUYA 3KEOA 1SFYA 2YU1A 3VZLA 1EAH3 4CEYB 1G9AA 1DYKA 4LO8A 1KJRA 4FVVA 4B29A 4F83A 1CIYA 1W9FA 2ICWG 5DDJ1 4FX0A 1ZA7A 5FZCA 1V54H 2WT2A 3DPRA 2QLZA 4GGGA 4HF1A 1QNTA 1XE7A 3ILRA 3M8EA 2X09A 3T4HB 1RB8G 1VAVA 4NPRA 3EYYA 3I58A 2JA6J 1H1AA 2QQMA 3SFIA 1UY3A 3OMYA 3RG0A 2ADUA 2MG4A 2G1MA 1O4XA 3LNQA 3HT2A 1HLCA 5IT9Z 1NZCA 4CA9A 3R0AA 1ZRRA 3NJZA 3TN91 3CJQB 1CQTA 1JOJA 2YSRA 1B59A 1C1LA 5I91A 1PUFA 4RGUA 2WSUA 3ZMNA 1RUJ1 2DYSH 4KN7X 3H3UA 4CP1A 4WZCA 1EV12 5IATA 1WMXA 4KWKA 5A3NA 2CL2A 2IXLA 2JDKA 1X1BA 3U4XA 3CMYA 1QVUA 3S1NJ 1UZZA 3WR0A 4AHWA 4DZGA 4IUGA 3JQXA 5A6YA 3T30A 1XD7A 3G1LA 4JX6A 5FFXA 1T0FC 2P3KA 4UV9A 2V09A 3MKWB 5L3EA 4O61A 4YPJA 2Y69H 5FOBB 3NO8A 3DTEA 3NV3A 4EN9B 2BBVA 1OYIA 3WT3A 4LK7A 3LL7A 2H1LA 3CF2A 1NCRC 1RMU3 1TE1B 3TB0A 2HWD1 4YEJA 4RYDA 4CCCA 3S32A 3K0LA 4ZPIA 3VDDC 3HOTA 3WUDA 1T8IA 1RUC1 3A01B 3KP4A 1BK1A 2DJNA 2D6MA 1V6MA 2KRHA 2X6XA 2CWSA 2RS51 4QWNA 2A7AA 1WW5A 3THDA 1H8AC 4WXCA 2MLGA 4Q4X3 1UG0A 3PVBB 1TWGJ 2JZYA 4B3XA 4KNYA 4E4HA 3SZTA 1APNA 3MLKA 2MW8A 3DP7A 2GMPA 1VZ0A 4HNVA 3Q8FA 3GW2A 1J5YA 3V0AB 1WH5A 4YFKF 5ILSA 1VBA1 1VQLI 3CP2A 3BOWA 4ASNA 1TWHJ 5LRSA 3K1NA 1RKTA 2BBYA 1W6OB 4XRSA 3F22A 3MGUA 4GIQA 1XC5A 4FETA 3OSGA 1SHWB 3WQ0A 4A69C 1PGL2 3AKZA 1F4HA 4L97A 4L18B 3ZMTA 2R073 4FOWA 5ABJA 4UAPA 2GALA 2CY6A 3O6BB 4LKSA 5L9RA 1MS8A 4DS0A 4F7ZA 1OCOH 3JRHA 1ERDA 1Y9MA 1NX9A 2Y0IA 2C0ZA 1XC6A 2VKEA 5ANNA 2JN6A 4HQMA 2W48A 3QACA 4RHV1 2H6BA 3LSDA 1RR7A 5TRDA 2R7FA 4BM8A 5FMCA 4DZJA 2KFDA 2F4PA 3L2CA 2BU9A 2ID6A 4MVTA 3FIWA 2KJBA 5FKLA 3NAPA 2E34A 4Q0QA 2LP0A 1ZYBA 2J22A 1QJY3 1OQYA 3ZYHA 3WHCA 4YRDA 1FI2A 2VVFA 2ZABA 1ZG3A 1WJFA 3RSNA 1AX0A 3OR2C 2GMMA 4Q2FA 3BT9A 2MSYA 3IH3A 5A70A 5JOZA 4RGRA 2CQKA 3CF5F 2LTNA 2UXNA 5A2QZ 1UX6A 1R1VA 1DU0A 3I7DA 4CCDA 2XAFA 2L0KA 3ONQA 3VZNA 4MGTA 4B4PA 3JQWA 1XGNA 3LD8A 1KFXL 1ZQ3P 1MZ5A 2Z5WA 4LR4A 5CIRA 1IN6A 4LPLA 1O3TA 2ACJA 3S14J 1WA6X 4LHSA 3HXLA 4O3MA 5HS7A 1FX7A 1ZRIA 3C7JA 3PUIA 1YOVB 3AFKA 2WZPP 4LA3A 4GJYA 4ES8A 3WDWA 5ICGA 1B72B 1D4M1 2IW5A 5FYCA 3ZXJA 3TBDA 5I0DA 4OAZA 3HZJA 2ZGPA 3IWFA 3ME2A 4DIQA 1AR91 5C7GA 1MBFA 2PYTA 3HHGA 4XBQA 3EB7A 2ZB9A 1T2KA 1ZBA1 3WG7H 1SEUA 4OMDA 3D0JA 2BY2A 4U36A 3VOEA 3CDIA 3IV5A 4N53A 3ZMVA 2FDGA 3J7AY 2VJ5A 4HXCA 1R092 3CJTB 3I53A 3WP5A 4P9JA 1IS5A 2BJSA 4YYOA 1UHSA 4XVHA 1YIPA 4DXRA 3MF6A 3M70A 1WCUA 5D8KB 2QF7A 3B73A 2O8OA 4NIGA 4U87A 4RDUA 1FAYA 2K46A 1WH7A 4QKBA 3A23A 1AKHA 2WBKA 4GWIA 4JKLA 3ON7A 4LFUA 1NLQA 1A78A 3GTLJ 2IXIA 2BOJA 2WR9A 4GXOA 3ILFA 3H5AA 3IAM2 2B5HA 3O1OA 4JGZB 5KXEA 2R30A 2GC1A 2EZKA 4IV1B 2RG4A 3BUCA 1RESA 1U8RA 2AHQA 4OI4A 2DJIA 2Y9ZA 4RLFA 2B9SA 4GAZA 3FK7A 4EMSA 1MJAA 1MS0A 3AKPA 2YX7A 3NARA 2XHKA 3AG3H 3UT0A 1C5HA 3ZM8A 4G3YC 5LA9A 2CGPA 2ZZJA 2G9FA 1HXS3 2HQRA 1ZZBA 4UF0A 5FR3A 1OUSA 3FLPA 3BR2A 2ZEZA 1IV6A 3ZFGA 2HBTA 1YFWA 4KN4X 5EZGA 1MDMA 5J40A 2ORXA 2VOWA 1AUYA 4PUSA 1LCLA 5GZFA 1BZWA 1PIV1 4DZPA 5LRRA 4HZFA 5ICCA 1MMAA 3G6EI 1MEC3 2VCMA 1NY71 2JDPA 3S57A 4IEOA 4HX7A 5AVAA 4NUBA 4OIOF 1WW4A 1GNHA 1NT0A 2CQ7A 4HKLA 4CEYA 5IPAA 1W6PB 2L4MA 1HRI3 2EFNA 1K5MA 4BDZA 1W8TA 3MICA 2E2IJ 1MH3A 4H55A 4BQQA 3GZ6A 4UV8A 4ZS3A 2C9KA 3KYCB 4FAGA 4CXWA 4P9UA 3VBHB 4LULA 4DPNA 4R79A 3WU1B 1ND2C 4BUPA 2DK8A 1E5SA 1PO13 2MC3A 2QQ8A 1QOSA 1YIOA 1F5JA 1JUIA 4NHJA 2ZAAA 1VIWB 4BKXA 5EG0A 5F0FA 4LIVA 3F6OA 4DNCA 4D7SA 2BGPA 2PHWA 4P08A 3MAJA 1A3KA 2QBXA 1X19A 2CRGA