4CYDA

Glxr bound to camp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
225
structure length
223
Chain Sequence
b'GVQEILSRAGIFQVDPTAVNNLIQDMETVRFPRGATIFDEGEPGDRLYIITSGKVKLARHAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSAVCVTEVHAATMNSDMLRNWVADHPAIAEQLLRVLARRLRRTNASLADLIFTDVPGRVAKTLLQLANRFGTQEAALRVNHDLTQEEIAQLVGASRETVNKALATFAHRGWIRLEGKSVLIVDTEHLARRAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE TRANSCRIPTION REGULATOR
publication title The Crystal Structures of Apo and Camp-Bound Glxr from Corynebacterium Glutamicum Reveal Structural and Dynamic Changes Upon Camp Binding in Crp/Fnr Family Transcription Factors.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transcription
total genus 74
structure length 223
sequence length 225
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4cydA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4cydA01
2W85A 3LAJA 2P6TA 4A2UA 2EWNA 1SQ4A 4P9UA 1IRFA 3HSFA 1IN7A 1KU9A 3KMHA 2MD5A 4MV2A 1DPRA 2R7FA 4ESFA 2X4HA 2FEZA 5BXXA 1QPMA 1ZZ6A 2HKXA 2PAEA 2CWEA 4X6QB 3HTUA 3DKWA 2WTEA 4LLGF 1RTVA 5TRDA 2IA0A 4L0ZB 4M72A 1GXPA 2MLKA 2FSWA 3ZMDA 1G3YA 2PG4A 4JQFA 4U0VA 3SQNA 2JPBA 4RGRA 2PTMA 4KDPA 4BXUA 3FXRA 5FO5A 3F8BA 1FLIA 1Q1HA 2PN6A 4HYEA 1YFWA 1OFNA 1LNWA 4P55A 4FAHA 1CF7A 2RQPA 1TTYA 2YPRA 2FE3A 1XRUA 3ES1A 3K69A 2OPKA 4RGUA 4CXFA 3JSOA 1W5TA 3HUGA 2VOOA 5DUKA 4IF4A 3WTVC 2PYTA 2DI3A 2F5DA 2GQQA 1PP8F 2NS0A 3EBRA 2E1NA 4KN4X 4J1XA 2WC2A 5K8SA 1HW2A 3J7AO 1FBUA 3ZMTA 3H1WA 3LA2A 4F7ZA 1EV7A 5D6EA 4EMSA 1HBXG 2VBYA 3WTUC 1UHWA 3SXYA 2F2EA 3UKTA 1WI9A 3ACLA 3COAC 4IEYA 4JTOA 4I3PA 4EGZA 5FFZA 1O7FA 2BYVE 4AIKA 4PJYA 3WTZA 3FZ3A 1LEAA 4B29A 1UIKA 2IJLA 4O5VA 4HBNA 2V09A 3KP3A 4LB6B 1P2FA 2IXLA 1IPJA 3RYPA 2G7UA 1FWZA 3FE5A 1GVJA 4ZZDA 3JSPA 3KE2A 5H20A 4HDVA 4EM0B 1ON2A 5FFXA 3GBFA 2YR2A 4KNYA 5JHUA 3KP5A 2WWYA 4KN7X 3RJPA 3E6DA 4EJUA 4RS8A 3QP5A 3G7DA 4MH0E 3I58A 3TOBA 1OR7A 2J5PA 3ABTA 4PGHA 1W7PB 1Z91A 4O9GA 4MGIE 2A69F 4XFGA 3RTRA 3GYHX 1IZ1A 2P5KA 4Y13A 4IEZA 5FLHA 3E5UA 3GUDA 4P9FA 1RGSA 3F6OA 1SFNA 2D1HA 2E7XA 1S8NA 4KU7A 3BU7A 3KLNA 4MGYE 3DPTA 5CVRA 4UHTA 1IRGA 3KETA 4A6DA 2PMUA 3IDBB 3BWGA 1BN5A 1ZZCA 5D5UB 2O0YA 4XF3A 5BQTA 2GC1A 3K0LA 3HSRA 3CF6E 3F21A 5FPXA 2GC2A 3FFQA 4LLNA 4Q47A 5FPZA 4O9EA 4IETA 1YIOA 2HKOA 2LKPA 4LD5A 4I09A 2XLGA 4MHGA 3I53A 4UVBA 2XKPA 5T3NA 5ILUA 4I0BA 3TQNA 5CVUA 4JV4A 2QJVA 1R5HA 5D5WB 2QYOA 5FGMA 4U88A 3V7RA 1QWRA 1H9GA 4QM8A 2FMLA 1BI1A 1SFXA 2OQGA 1W7PA 5DV5A 5BPDA 2V1DA 2K86A 2DAOA 2DTRA 5HLHA 5KVRA 1Z1DA 1YO5C 1UW8A 1T6SA 2Y75A 3OF1A 4OIOF 3QPTA 2EA2A 3RPQA 4RAYA 4O3MA 1JHHA 1JE8A 3KFWX 2FBKA 5CJ9A 2IXHA 1MJ9A 2BV6A 4L11A 4PIXA 5K1YA 3MDPA 2IXCA 5IT3A 1HW5A 1QZYA 2D1VA 1E17A 1O3TA 4BAYA 1NZCA 3BOQA 4TLFA 1LVAA 2MH9A 2MH2A 4P9GA 1S6LA 5HS8A 2BNOA 3WGGA 3ABUA 1OYWA 3RDIA 1WGPA 1QXRA 4Q0QA 4I02A 2XUBA 1PP7U 1HSJA 1YLLA 4Q0SA 3B73A 3QRFF 4LLOA 3LAGA 1J3PA 4ZU4A 4ESJA 3WW1A 4HA8A 3ZDSA 2A61A 1QXJA 3RIRA 1J58A 3O3KA 1QY4A 5KHGA 3ELKA 4N0BA 5BUVA 3HHHA 2DT5A 2FNPA 4BHCA 4Z07A 4IEOA 4KWLA 4HV5A 1B9MA 3OTFA 4IVNA 2N7GA 4YSFA 5FB2A 3CUOA 2BE5F 4U7BA 4D0PA 2V9VA 2OBPA 4Q48A 4OIQF 5FD6A 2GZWA 2Q2EA 5DCFA 3TGNA 1CAWB 3LA3A 2B0LA 4M74A 4P5OA 1E2XA 2VXZA 3DXJF 4IRIA 2JTVA 2C6YA 3VHRA 2FF4A 2ZNYA 2FA5A 1FT9A 5E1RA 1WRJA 5D5XB 3K2ZA 3H7JA 2LF8A 1YLFA 4KFCA 4QMAA 1O3RA 4ENKA 2Y0MA 2LNBA 3I59B 2CAVA 3DQVC 3ZQ7A 1KQ9A 3D5LA 3TO6A 3CJNA 3T5XA 1UCRA 4MGKE 2MA3A 2UY8A 4FX4A 3EETA 3UKVA 2FXAA 3K1PA 2DU9A 3NL1A 3L09A 4EJWA 1EH6A 1O3SA 3KP7A 1J3QA 4G94A 3GFIA 1O5UA 5I8YA 1FBSA 2FOKA 3IKVA 2HDCA 3GVAA 5D5VB 2PBIA 4LA2A 4QWQA 5FDBA 4HF1A 4UXAA 1HXDA 4KMUX 1IUYA 1WQ2A 4AVAA 3QU6A 4OFGA 3MWMA 5I0SA 1U5TB 1RNLA 3EYYA 3F72A 1NE4A 1U6GA 1S7AA 3RYRA 5F1RA 1CAWA 4IXAA 1ZZ9A 1K6OA 3ZP5A 2UWMA 1EYBA 2Y0OA 1R1VA 3QPHA 3G73A 2KIUA 3CDHA 1CAXB 1R36A 3K1NA 2EA7A 3NW4A 1MZBA 3FF5A 2V6CA 3S0MA 4UXNA 2OYZA 4PCQA 2NNYA 2EJRA 3M9AA 3H1MA 1J7KA 3HOTA 2D40A 1QBJA 3SFZA 2EFWA 3I59A 4WVZA 1IPKA 4K2EA 5L3DA 4IEUA 3O2PE 2HYGD 1AWCA 2IPQX 5I93A 2M30A 1OKRA 2BBYA 1KQ0A 4HVRA 5LHIA 1K7AA 3ZN1A 4U0YA 2QQ9A 3P7NA 3EQEA 4AQ6A 4D7SA 3SHFA 3KCCA 4ESBA 3BJAA 3BROA 1X8MA 1BOAA 2XVCA 1K79A 2HR3A 4B09A 3FMRA 1RUNA 2QZ8A 4QGNA 2UY9A 2IRFG 2ZKLA 1S3JA 3GYDA 3SHRA 1ZRDA 3RYKA 2QQBA 5J7MA 5JR3A 1O57A 2JSCA 3QU3A 2ESNA 1U5TA 2L3DA 4HLTA 4KYWA 4HZFA 1F4KA 3E3VA 5L3BA 2E1CA 1ZN2A 1LDJA 3K1MA 3DL3A 2XV4S 1GXQA 2ZKZA 4XLNF 2OD5A 2ZNZA 5LEKA 5DD8A 2M5WA 1YW7A 3F23A 4JBAA 3L2HA 1B1BA 3VFZA 2XAFA 3IHUA 2RGVA 3U9GA 3WW2A 1IW7F 4NQWA 1O7LA 3HIFA 3ZN0A 4OU0A 1XGMA 1TNSA 2OAZA 3WTYC 1HKTA 3ROUA 3I71A 4Q4ZF 4G9YA 2K0GA 1XSXA 3JW4A 2A68F 1XDUA 2RVCA 5CU1A 3SZTA 3N97A 4LUMA 3LZZA 1IN8A 1BIBA 1QZZA 4RGSA 4L2NA 4OIPF 4CO8A 3KP2A 2F4PA 2UYAA 4FHTA 1S29A 1LB2A 5J8FA 3P9CA 3BCWA 4GYIA 2GC3A 2B9UA 4K8FA 3F22A 5JR7B 5J6XA 3FHZA 1TQMA 1I6XA 2O6GE 2CFXA 5HDGA 3P9KA 1JUHA 2DPUA 5FD5A 3GZ5A 2CYYA 1XCVA 5E1WA 4ONUA 1NXMA 4LJZF 3DP7A 2EK5A 2C0ZA 3FZVA 3PVBB 3V4GA 4AXOA 3L9FA 4CZZA 5ED4A 1PM7A 2XL7A 1TLHB 2VT3A 2UXNA 4ENJA 1BIAA 2PA7A 2M87A 3ECHA 1HKSA 1KU3A 1HSTA 1J3RA 4LG0B 2UXXA 2HEOA 1I27A 2E7WA 2CQKA 4HDUA 4M73A 5BV6A 4MNUA 1L3LA 2XLAA 2EAAA 3FXQA 1H1IA 1FYMA 4CYDA 1ZLKA 3SZPA 1J9IA 1FYLA 4ZYGA 3R61A 2RV8A 2AS5F 2VQAA 4IPAA 2CO5A 5J3UA 4EWAA 2D45A 4E2SA 4HW0A 3D0SA 3W6JB 1IXRC 4JK1X 3E97A 2R3SA 1EH7A 1VR3A 4HLYA 3ELNA 1IN4A 4Q5SF 3IKTA 4EGYA 4XLPF 4E70A 2Z9OA 2FMYA 1YQAA 3IRQA 1D8KA 5CYVA 3P9IA 1DUXC 3IC7A 2X0LA 3WU0A 3HRTA 2KRFA 3HRMA 2LDUA 1YYVA 4WCGA 1VJ2A 2IXKA 3H7YA 1ZG3A 4CDGA 2IXJA 2OZJA 4Z2YA 5D4SA 3GLXA 1XGOA 4AIHA 3ISPA 2VBXA 4AIJA 2XKOA 3NEUA 4AWXB 3KLOA 2FBHA 3F8FA 4YG2F 3GO5A 5CVJA 3HT1A 2K7LA 2A6HF 4QGLA 4LG0A 5FQ0B 2Q1ZB 2FNAA 3V8KA 1WLTA 5D4RA 4ON0A 3E5QA 4A0XA 2J5OA 3H3ZA 2M45A 1XGNA 4RB0A 2OZUA 2PEXA 1YFUA 4META 1L0OC 3HSEA 4XF4A 3H8UA 4IERA 4KA4A 2CGPA 4EJTA 5DYMA 3RKXA 5ERIA 3U1DA 4EWDA 1CX4A 1D3YA 2V1XA 1H9TA 3LFKA 1T98A 4NB5A 2ESHA 2NYXA 1OYYA 3L00A 4Q0PA 1MDMA 4MUVA 2O61A 1I1SA 2RNJA 1UD1A 1T39A 1HQCA 1V3FA 3TO9A 1AOYA 3EUHA 1X7NA 4ENMA 1R7JA 2LSOA 3OGJA 4BQAA 2PMHA 5HLIA 3FWEA 1UFMA 4XRFA 2XAGA 4QM9A 5HDKA 5LLQA 1DDNA 3AAFA 1ZG1A 2ET1A 5AIPA 4IHSA 4M9ZA 2DO7A 2FQ3A 3KEQA 4G8XA 1EH8A 1U8RA 5EEHA 4ZU7A 5FQ0A 3S7EA 4DQ2A 4A6EA 4ZZLA 5L3EA 1FSHA 3N4MA 1JGSA 1FNNA 2L02A 1FX7A 3GFLA 2FRHA 2XROA 4I01A 5J8CA 4ENNA 1CAUB 1ZRRA 3FM5A 4BH9A 3KGLA 1UHMA 1ZZ7A 2XGXA 4BHBA 1YWKA 4N9IA 4R1HA 1B59A 2QLZA 2M1BA 2COMA 1YFYA 2ELHA 1WWXA 3HTSB 3V7CA 2PFWA 2VBZA 2GH2A 2L01A 1T38A 3FX3A 2O8QA 1BC8C 3SCHA 4EM2A 2H6CA 3LSTA 4YNIA 2Q8KA 4A0YA 4QX5A 2KXLA 3OV8A 2MHFA 3WW4A 2GXGA 2QUFA 4HSLA 5AONA 4IEQA 2IW5A 2Q0OA 4XFCA 1CGPA 2VECA 1KYWA 2WV0A 1Y3TA 2ZXJA 1SMYF 3CO7C 3C3WA 3GF2A 1SD5A 4EWEA 1DZRA 5ICCA 2XASA 4G7ZF 2DPDA 4LK0F 5ICGA 2CAUA 1SEFA 3KGZA 4HAMA 2K27A 4LEJA 4MEYF 3IBMA 4RB3C 4GXOA 4OINF 4LB5A 3JTHA 2GA2A 4G6DA 5C8WA 5EFUA 1I5ZA 3WE2A 1ZNPA 2IA2A 1USTA 1FZPB 4DINB 3ES4A 3V8LA 3H92A 1XN7A 1CAUA 2VBWA 1EPZA 3QACA 4IHTA 1KQ8A 3WW3A 5FLXK 2DLLA 2H09A 4LFUA 2K4BA 3JAMK 1OYIA 2BEOA 1H1MA 1L3JA 4J1WA 2VONA 2HTJA 4RD7A 3FMSA 4YARA 4HVQA 5I0RA 1UCXA 2PI0A 4XBFA 1XMKA 4OLLA 4MQVA 4HX7A 2IXIA 2QWWA 2STWA 3ULQB 3SCGA 2A5YB 4M9XA 4I7HA 3V7SA 4XF1A 5A2QK 2MNGA 1OPCA 3BPXA 1SD6A 4UVCA 5TJJA 2CV6A 2A3SA 1G3WA 1NE6A 4NHJA 1O5LA 5I0UA 1GQHA 1NHAA 5ILVA 2P7VB 1MKMA 1MJBA 2K4JA 1RI7A 2RKHA 3M8EA 1WA4A 2YU3A 4KIFA 4HF0A 1YG2A 4HX8A 2IA1A 2PJPA 4LK1F 4EQQA 1ZRFA 1G3TA 2B8MA 1TNTA 1Y9QA 2P17A 5HOOA 3VB2A 4AVCA 5E17F 1ONVA 1FC3A 2H94A 1K78B 2OQRA 2OZ6A 4XEZA 2P8TA 3QAHA 2DK5A 3KSCA 1SFEA 2GU9A 3V8JA 1XCBA 1UPIA 5KK1A 4YYOA 1VP6A 2HFHA 1KU2A 1LRHA 2ZCWA 1P92A 1UIJA 5J48A 1BJAA 2DFIA 2QVOA 1ZGAA 5C6CA 1FOKA 1V70A 1G3SA 3HT2A 1LQ1A 2L4AA 1ZZ8A 1QNTA 3MCZA 4IEWA 5JFRA 1XD7A 1TW3A 3CL1A 2P5VA 4WBBA 2VN2A 3ZMUA 5IT9K 1ZAOA 3Q5FA 3NSTA 2H0VA 3GWZA 2Z69A 4MQ9F 4YIIA 2NAZA 2H6BA 3DEUA 3F8CA 3SXWA 1BI2A 1Z6TA 4NVPA 4P96A 2ATFA 1KYZA 2OU2A 3BPVA 2R7DA 5FLJA 4CICA 3ZMZA 4LULA 2EV6A 4WK8F 3PQKA 3CJXA 4HVOA 2ISYA 1CAVB 1IXCA 2G7HA 2ZMEB 5DD4A 3HYIA 3C3VA 5CLSA 3LQRA 1K78A 5H6QA 3CEWA 1MGTA 3BJ6A 3FM3A 1J75A 4GYGA 2IVMA 3OCPA 5E8GA 4CHUA 2ZFWA 3H9AA 4OOIA 1D5VA 3M70A 4LUKA 3FMQA 1IN6A 5EEGA 4E2GA 1UB9A 2JZYA 2RN7A 4AVBA 2P6SA 4KIBA 1U12A 3T1BA 2PQQA 1LJ9A 2HZTA 3PNAA 4L9JA 2EFPA 3OOPA 4IJAA 4I0AA 1ODDA 3HRUA 3C1DA 2M8EA 4S04A 4XSXF 3ETQA 1DPUA 2MLGA 4KICA 1C0WA 2A07F 1O3QA 2QBYA 3F6VA 2B5HA 3LA7A 4IESA 4KIGA 4QLCU 4HN0A 2ET7A 5ICFA 5K5QA 4UNOA 5LGTA 3BDDA 3CLOA 1XMAA 4HX4A 2HS5A 3K9TA 3Q9SA 3IL2A 1W7PD 3FXUA 2DQLA 2IT0A 3EDPA 3ERED 1ZH5A 4S05A 3LWFA 2EFNA 3LWCA 4CGZA 1Z6RA 3L7WA 1CAVA 2QDRA 2ZMEA 4KT5C 3IRRA 2ZJ2A 3M3IA 3M7GA 3CUQC 2UYBA 3QOPA 3J80K 2V1UA 3TKYA 3I54A 3MZHA 4QGMA 3R60A 2PHLA 4EV0A 3WGIA 1NYWA 3I7DA 2W25A 2VODA 2YX4A 1EY2A 4KU8A 3ZMSA 3E6CC 3I5UA 2IP2A 4MTDA 3CUQA 3U11A 2YSRA 3F8MA 5E1XA 2F5FA 4R79A 4KWJA 2EFQA 4IRGA 1IF1A 5BPIA 3USSA 3JTGA 4F8AA 4TV7A 2XAHA 4HOBA 3WE3A 2CG4A 4L9VA 4Q0VA 5D6FA 3J81K 2Z33A 1FYKA 5JI6A 3KZYA 1SD4A 1HW1A 1RZ4A 2O3FA 3GW2A 2Q30A 4L5IA 5E8IA 1D8JA 4B8XA 4AQ2A 4WX9A 3ML6A 2AXLA 1LKNA 4QXKA 4YFXF 1RC6A 1JXSA 4A5MA 5JVTA 3KP6A 1QGPA 3S7IA 4I98B 3DN7A 4JVAA 3U10A 4WXHA 2KKOA 5LEJA 3WTWC 1YTYA 1PMIA 3EHKA 1O4TA 2L54A 4LLLA 4YFNF 5L3GA 1J5YA 3E6BA 4PZJA 4O6JA 4HLXA 2EV5A 2NRAC 1V4RA 5FLXZ 4MGZE 5AIQA 3IIAA 4HQEA 1JHFA 3JAMZ 1B6AA 4LGWA 1MDMB 2HOEA 2ACJA 4PIZA 4WXCA 1WSUA 5I0TA 4G7HF 4YFKF 3TDUC 4RB1A 1DZTA 3HQXA 4M9SA 5I8TA 3DFGA 4FX0A 1SAXA 3PLQA 1Q43A 2XAJA 2E9QA 1YHFA 4H0EA 4EM1A 3ZMVA 5K5OA 4XF9A 3MQ0A 3TO7A 3RKWA 4WWCA 5A2QZ 4A0ZA 4IEPA 4BNCA 1BI0A 2GWRA 2ETHA 4FAGA 4XFAA 2Z5UA 3NVCA 3MPBA 5HLGA 4ASNA 3EQLF 3D0JA 3R6SA 5JSRA 4HMZA 3C18A 1R22A 4L0YB 5JSPA 3UKNA 4OIRF 2Z2SB 2GA1A 4RB2C 2EB7A 1TQIA 5KBFA 2HTSA 1YFXA 2MC3A 5F6FA 1XSVA 5LHGA 1YW9A 1SMTA 1MD0A 4BHPA 1TBXA 3WTTC 1J59A 1XDSA 2F5EA 1F1ZA 5AVPA 1W5SA 2NNNA 1B9NA 2VOPA 2D2WA 2HWVA 2WFPA 2RDPA 4Q0UA 4BYYA 3BP8A 5LGUA 3ZPLA 3RKYA 3HRSA 1U3EM 2HQNA 1WKMA 1DGWA 2XRNA 2XL9A 1ZRCA 4Y15A 2W57A 3MEXA 1R1TA 3DPLC 5DCMB 3F3XA 5FCCA 5IT9Z 4ZYHA 3EJKA 1FSEA 5L3FA 2EVXA 1ZLJA 1FBQA 4D7TA 1OMIA 2GC0A 1KU7A 5JCTA 2Q0AA 1HKQA 3SCFA 5ILSA 1LDKB 2VE9A 3DF8A 1W4MA 3R0JA 1BBYA 3WTSC 5BS6A 2O1QA 3EO6A 4LA3A 4ZYEA 1Y0UA 2CSOA 4XFBA 3SMHA 3HOSA 1MJAA 1ZZBA 4UBHA 4WZCA 4PDKA 4HSJA 4WXDA 2V79A 1XB4A 1FI2A 3IWFA 2ZO4A 3RI4A 2FQPA 1TQ5A 2Z99A 2VC1A 3I0TA 2Z3YA 2HQRA 2K02A 1SD7A 5ICEA 4YIFA 5LHHA 1BM9A 5CADA 1F5TA 4MGRA 4HBLA 4LTAA 3RPUA 2VE8A 4LMYA 3WG9A 3T0YA 4MZUA 2L4MA 4L5JA 5LRSA 4HF2A 1ZGJA 1FP2A 3RZZA 1IN5A 5HVQC 2PQ8A 1ULYA 1ZREA 3ST7A 1S7OA 5DDGA 1U78A 4E2QA 5DEQA 2GAUA 2QENA 5BMZA 3NRVA 4RAZA 5DCMA 4N9HA 2O03A 2P4WA 1U2WA 4FT8A 2DQRA 3BY6A 4MX3A 2OA4A 1ON1A 3I64A 1ZYRF 1B4AA 3IWZA 1P4AA 2QM3A 4GULA 3TNPB 2FBIA 5HS9A 1LDDA 3L2CA 4MEXF 3WGHA 5DUIA 1R23A 3CLPA 2KIFA 2MPFA 3CO2A 3F8NA 3QP6A 4EJOA 3H1YA 3KEOA 1J0RA 3WTXC 4YRDA 1Z7UA 3KP4A 4KMFA 4GGGA 2ETEA 2BGCA 2VC0A 5E16A 1Z9CA 4ZU5A 2F5CA 1XE8A 4ORFA 3J80Z 4OMZA 1GHCA 4ETSA 2IC1A 1Z05A 5KHIA 2HGCA 1FP1D 3H50A 2PHDA 3WU1B 4UUVA 3BPZA 3BALA 4RGXA 1TQPA 1DP7P 3T8TA 4XFHA 1G6NA 3NJZA 2ZBKA 6PAXA 2PFBA 5CVVA 3OD0A 1SFUA 4EROA 2QQAA 5D8LB 1KGSA 4UV9A 4XF0A 2KJBA 3U0ZA 2EFOA 4FBFA 2QCSB 2Y48A 1OD5A 2GIVA 4GCVA 2QNKA 3E5XA 3GFMA 3FJSA 3J81Z 1X3UA 4EJVA 4PGGA 1VTNC 3S2WA 1TW2A 3D82A 4HN1A 1T0FA 3C7JA 1YS6A 3GX4X 3JZVA 3O6BB 4IRHA 1XE7A 4A12A 1A04A 4Y17A 4UVAA 1Q3EA 1USSA 1YFHA 3H3UA 4BIFA 2W84A 3MYXA 5E18F 3MAJA 1RL3A 2EV0A 3TOAA 3T8RA 3NQOA 3BJOA 3CTAA 4ZH4F 5F64A 3ECOA 2EA4A 5KHHA 2CW0F 2VT2A 3R4KA 4X6RB 5KHJA 4XFFA 1FPQA 1RIOH 1BC7C 2JT1A 3BB6A 4IEVA 2XIGA 1QQIA 3VEPA 4HQMA 1R00A 1XSDA 4Z82A 3HHGA 1GQGA 2Q4SA 3FHIB 1QO0D 1LEBA 4WF2A 5D1IA 2BNMA 4PIYA 3KZZA 2QBYB 2DW4A 1R5GA 3GZ6A 4M6XA 3LAPA 4R52A 3TNQA 5HDNA 4UBGA 4JTNA 1X8EA 2QVSB 2G9WA 2P5LC 4KL1A 3M8FA 5HS7A 4U0WA 3U2RA 2W24A 3E6MA 4A5NA 4M6YA 4G6QA 1P4WA 3MZYA 3IDCB 5FLIA 4IEXA 1IXSB 4MTEA 4DNCA 5LBQA 4AD9A 4OMYA 2OA2A 4R8HA 1STZA 1FXZA 3G3ZA 4HV6A 3O14A 3GXOA 1ZARA 1FY7A 5D8KB 2XHKA 1H0MA 2PAKA 3M1EA 2DBBA 1IAWA 3PFIA 1ZX5A 2HJIA 1OI6A 3GFJA 5LRRA 4L18B 2KJCA 3LQQA 4KUMA 2H27A 3PQJA 1T2KA 4L9TA 4AVPA 2D93A 5EZWA 1PDNC 5I91A 1YW8A 3CUQB 1R1UA 2DCTA 3W6KB 3MFKA 3EYIA 4GO1A 1DGRA 2A6EF 2XLFA 5H6RA 1F9NA 1REPC 4XETA 2D5FA 1P4XA 2XAQA 2FU4A 5JSOA 1EP0A 1ZG5A 1U5TC 2LF7A 4UV8A 2D5HA 2I45A 2PAMA 1PUEE 3NKTA 2TDXA 3RNSA 3GEZA 5BY5A 5BPXA 2BNNA 2VPVA 2O8XA 3TDZC 2DK8A 3VODA 1R58A 4I2OA 4Q29A 2ISZA 4XFIA 4XSZF 4ZYDA 1J2XA 1P6RA 1XGSA 4U7DA 2MBFA 3VOEA 3Q9VA 5LGNA 4L9NA 1BI3A 5E20A 5E1ZB 5K5RA 5BOXA 2K9ZA 3REOA 5KHKA 3DV8A 4KWKA 1ZHFA 1CAXA 2RC4A 2HYFA 3LOIA 1X82A 3CO6C 2JRTA 3BZ6A 2UZKA 1CF7B 5HI0A 4G7OF 5JAXA 2ADUA 5CVIA 3I4PA 1LR5A 5L3CA 1KA8A 2YX7A 2P7CB 1Q5OA 2JPCA 2PLYA 3R0AA 1ZVFA 2KIMA 1RUOA 2GXBA 3WODF 5I8SA 1G4DA 1J1LA 1YUDA 4H7LA 3B02A 4M71A 1I1GA 4EVIA 1YS7A 2STTA
chains in the Genus database with same CATH superfamily
2K3PA 2KLOA 2X29A 3RCOA 3TP0A 4P9LA 1D1BA 2WA3A 1JZ4A 1ZZ6A 2HKXA 5KAFC 2WTEA 2WB1A 4ZDLA 4LBMA 4PF1A 1S0JA 4Y5TA 4QQLA 4SBVA 1VQLI 1W3XA 2BDRA 2FSWA 3ZMDA 3SQNA 2NMNA 4RGRA 4KDPA 4BXUA 2PHUA 4XLHA 3SFIA 5HPOA 4HYEA 1UELB 2GSYA 1YFWA 2X53S 4NBQA 1LNWA 4QIWN 3UESA 2IZWA 2RQPA 2EXJA 2YPRA 3WQ1A 1VZ0A 1BVP1 2E51A 2C6SA 2BZTA 4JAAA 5JOYA 4AEMA 2ZZJA 4YVSA 2YMZA 3WTVC 2DI3A 2YBPA 1XX5A 3TEWA 3LSPA 4PDWB 5FZOB 2NN8A 3EBRA 2WC2A 5K8SA 3C2BA 3ZMTA 3H1WA 3LA2A 3NWTA 3TEYA 4F7ZA 1EV7A 2MYSA 5M3FJ 5D6EA 1HJGA 4QXCA 3WTUC 2HWE3 2BV4A 1UHWA 4RSUA 4IGPA 1AYM3 2QQMA 4JTOA 3VDXA 3DBLB 2BYVE 2BU9A 1S1AA 1ONAA 2KL4A 4PJYA 3LSRA 4CDQA 1D0ZA 1KXGA 1SLLA 2AZ5A 2I10A 1XNCA 1PX4A 4ZC3A 5F5AA 1QH6A 2V1NA 2GMEA 2CTVA 5EDNA 3SKVA 4FTHA 2G7UA 2LLKA 1UY0A 1FWZA 3FE5A 2O9LA 3JSPA 3KE2A 2RS32 4CCDA 4EM0B 4AYUA 1LOFA 5FP7A 2YR2A 2HYXA 3WG1A 1HB2A 2WT2A 1MS3A 2E7QA 3RJPA 3IN9A 1Y43B 4FFGA 1JT0A 4F3QA 4M3CE 3G7DA 2HWB2 1MMGA 2VPRA 2WB1N 3A4CA 1OR7A 1WH7A 4LBKA 4YM1A 1ENXA 4WZFA 1YJWI 1W7PB 4O9GA 4IL7A 4XC9A 4MGIE 1RXGA 3GYHX 4C0BA 1IZ1A 1KDMA 3TB0A 2QZ3A 3DU5A 5FLHA 2VQHA 3CCYA 1LE8B 3E5UA 1VB4A 2DOFA 2DFBA 3F6OA 4IHXA 2RJLA 3GTGJ 4IHWA 5A7QA 1NLRA 4YFWA 4UHTA 4GQ7A 2X1EA 1UAAA 4F93B 1POV3 3BWGA 1BN5A 1QU0A 1S0IA 3J8F2 5BQTA 3K0LA 1O6UA 2VG9A 3CF6E 3F21A 1FMD3 4LLNA 3RFRA 3ZFGA 2HKOA 4EE2A 1XNTA 4FOYA 4A3KJ 4PSWA 2VUJA 4BQNA 4A93J 3I53A 2X9DA 3TQNA 2CU7A 3Q8CA 2B63J 4JV4A 2HQ5A 2D6MA 3HQUA 4C30A 3MKYB 4Q26A 4QM8A 2FMLA 4FPFA 2CUFA 3V0BB 3W21A 3A23A 2DAOA 3KB5A 2NM1A 5HLHA 3OUJA 2UWAA 3WHUA 5K4LA 2BRTA 2HOAA 1TT0A 4UFJA 1AYN1 3OF1A 2X6YA 2O8KA 2EA2A 3RPQA 3H0OA 4R9BA 2KIQA 4M0HA 4UAPA 1WMXA 1JE8A 3WT3A 2FBKA 4CDWA 1LHNA 3W2AA 1E3OC 5K1YA 4L8QA 1U5XA 2CWSA 1UU5A 4WVMB 3BOQA 5B4NA 2MH2A 1NY71 4AAXA 5HS8A 5JIUA 5F5IA 3WGGA 1SVMA 1UF2C 4WM8A 1GNZA 2ZGOA 1SBEA 4V19K 3ZN6B 4FPCA 5FYYA 4LIVA 2R7EB 5H9SA 1VMHA 3B73A 4A7KA 5A6ZA 5C70A 2PELA 2ZXWH 2R5YB 1J3PA 1X2NA 5GPAA 2E53A 5KXEA 2ME0A 3WW1A 4HA8A 5IVCA 3WQ0A 2EAKA 2HWD3 4MHUA 3VBHA 1PMHX 2OV7A 1VPHA 2L7FP 3K51A 5BUVA 3MUZ1 2DT5A 1MMAA 1BBT1 5FZDA 2F6CA 2CU5A 4BHCA 3BU0A 4Z07A 4HV5A 1R083 3OTFA 4IVNA 1PNFA 4YSFA 4OYUA 1UOJA 2BE5F 5FROA 4B3AA 2VVFA 3IMMA 4R9CA 4UB8C 3HNYM 2LROA 1KZHA 3TGNA 1W6PA 1OQDA 4CEWA 2W2IA 2B0LA 4I3GA 5I0DA 4M74A 4P5OA 2WINB 3P3NA 3MN2A 4IRIA 1N1TA 2C6YA 3H9GA 2WFF1 1F35A 3KHCA 5D5XB 1R092 1Y8RB 4ENKA 1JYNA 5FPAA 3ACGA 3ZQ7A 3AB0A 1O59A 3K4CA 4NPMA 3TO6A 5EJ3A 4MGKE 2MA3A 3PUAA 4FX4A 4EN9B 3EETA 5K0UC 3PFYA 3PMEA 2FXAA 3RJ2X 2PHXA 3D3AA 2LY9A 3L09A 3GM8A 1XPWA 4RAFA 3O1TA 4P14A 2BERA 5DDJ3 1A8MA 3IPVA 3K4KA 1NKGA 4A7ZA 4OUEA 2BY2A 4KG8A 4D5CA 4XONA 5D5VB 2PBIA 4KT6A 1HXDA 4KMUX 4GZ9A 2PJRA 1AL21 3BUCA 3F72A 1NE4A 3B94A 3U78A 3DCQA 3RSJA 2JD4A 3KZIC 4TXWA 1W9FA 1PO21 1ASJ2 2CFOA 2WAFA 1XNBA 1R36A 3K1NA 1HA8A 2GMPA 2P4EA 4JGYC 3FF5A 2A73B 2Y69H 3AYCA 2YHJA 3S0MA 4LNVA 2XSJC 4UXNA 2ZC2A 3SEEA 4CCJA 5C7GA 3H1MA 1J7KA 3HOTA 1IPKA 4IEUA 5L3DA 3O2PE 1ZELA 2ZGQA 2IPQX 5I93A 2D3SA 1OKRA 3H0GJ 2BBYA 2CWMA 4HVRA 2YFUA 4FOWA 4HSRA 3WU2C 2X5IC 4PBOA 4AQ6A 3JRHA 3KCCA 3AX4A 3U1XA 5A1FA 2UV1A 3BROA 1X8MA 1BKZA 4QPIB 1D0HA 2ZGPA 4AFDA 2FD8A 1OKOA 3G6EI 1VBD1 1RUNA 2FBEA 5LZ6A 1ZR4A 2UY9A 2IRFG 1S3JA 1QJY3 2WS92 3ME2A 2ZJPF 2QQVA 3BTLA 5J7MA 3KT7A 1VMFA 2RJ2A 5JR3A 1O57A 3RPUD 2ESNA 5C9AB 2L3DA 3VKLA 4HZFA 3E3VA 1ZN2A 2XV4S 4FQZA 4CXYA 2ZKZA 2ENRA 1W9TA 3OGSA 4YLZA 3GXUA 5DD8A 2NXNB 1HV0A 3K2AA 2EBIA 2CUZA 2O7OA 3X29B 1B1BA 4LHSA 5LW9A 2XAFA 3ZX7A 4XBNA 3AL0C 4NQWA 1O7LA 5LA0A 3HIFA 3ZN0A 4OU0A 4MG2A 1TNSA 3WTYC 3LD8A 3ROUA 4LO5B 2K0GA 2A68F 2GALA 2P37A 3JBG3 2PHRA 4LOCA 3Q8BA 4AK3A 3LZZA 1QZZA 2ID3A 2BBAA 3C7FA 2GIZA 1RHI1 3KP2A 4FHTA 1IO2A 5J8FA 2L5QA 1LOCA 2MGQA 3RZGA 4UUTA 4W6XA 1YJLA 1K4SA 1ZRIA 1RC9A 2CFXA 5HDGA 3P9KA 4QQPA 4RQPA 2BY1A 2LY1A 4ONUA 5FLVA 1NXMA 4LJZF 2VQGA 4N43C 4AXOA 1BA5A 3N9LA 1TLHB 2M7AA 2UXNA 1MBJA 1H9PA 4ENJA 1S0FA 2PA7A 4PQ9A 4YZ3A 3BKZA 1RINA 2HEOA 1V6OA 1I27A 4M73A 2WZR3 1L3LA 1NXD1 3FLRA 2XLAA 1H1IA 4AI3A 1FYMA 4B8EA 4DFSA 4XN0A 4NDLA 5ERLA 4CYDA 1ZLKA 3IIIA 4L97A 3TEDA 4A3EJ 1FYLA 3RKQA 2VIXA 3ZKUA 3DTIA 1MS4A 2AS5F 4CE8A 1ZTRA 1W6NB 2DMPA 4E2SA 2CQXA 4HW0A 2RDRA 1JZ3A 4DS0A 1IXRC 3E97A 3BG7A 1VR3A 3ELNA 3IKTA 4XLPF 4QPYA 4E70A 5FYCA 1YQAA 1AR61 2EIBA 2K46A 1MS1A 4AFMA 3I8TA 2P5BA 4WCGA 1LU2A 1NOVA 3GLXA 4AIHA 3WR0A 3ISPA 3OS1A 3K48A 2YU9J 1QJX1 4RHV1 2FBHA 4YG2F 2V72A 3GO5A 5CVJA 4OMCA 5FPUA 2EZIA 2Q1ZB 4OUSA 1AYN2 2W95A 3USUA 4UW4A 4A0XA 3H3ZA 1VF9A 2A3XA 5AC91 4CUCA 3CNAA 4META 3HSEA 1BYHA 1RUG3 2VMIA 1GUIA 3RZDJ 2QCOA 3RKXA 3WNPA 3S5AA 1CX4A 5T55A 1D3YA 3PHMA 3J7MA 4OZXA 5BNOA 3K7AJ 3WF2A 3PIPF 1JZ8A 3LOCA 4MUVA 5EEAA 1G9FA 1I1SA 5DABA 2ZZQA 4ZDOA 1AOYA 3EUHA 3ACFA 2D43A 1B72B 2CGNA 4BQAA 4K20A 3RQ4A 4Q4Y1 2DMUA 2XAGA 3BYWA 5DUVA 2LYCA 1W6OA 1DDNA 4D9JA 3AAFA 2KFDA 2Y6FA 1XOYA 2V9PA 1BBT2 3CJTB 2YROA 4XXPA 2DO7A 4JX6A 2JICA 3KEQA 2GM4A 4XK4A 3I2FA 1U8RA 3VL8A 1Y4WA 2DN0A 3OIQA 4DY3A 4Y20B 2Z16A 3ZR5A 3V65A 1X1CA 1RUE3 4C2TA 2CY6A 3IDAA 1CAUB 4JKMA 1K61A 3KGLA 3VBHB 1YWKA 2E26A 4N9IA 3DYPA 1DLLA 4MADA 2QLZA 2M1BA 5DZEA 5J4VA 4XACA 5FZCA 2L9NA 1DGWY 2WNVC 4JKKA 2WFF2 3CIHA 2L01A 3FX3A 1BC8C 3H3VK 4NIGA 2H6CA 3LSTA 2OCCH 1KDKA 4YNIA 4QX5A 2CRGA 3VYSB 3T08A 5A3MA 2GXGA 1NH3A 5AONA 4IEQA 2YBKA 1R4MB 1KITA 2WV0A 1UL9A 1AZDA 2ARXA 4W4ZA 1SMYF 4QWNA 1CQTA 1N3PA 2R062 1C8M1 1SD5A 3B6AA 1TL8A 4EWEA 3QBQA 4JQTA 5ICCA 4V2FA 1YRNB 3WX5A 4D7YA 4LK0F 4N4NB 3KGZA 1WCKA 3NNGA 4HSTA 4MEYF 3IBMA 3TN93 4RB3C 4CH7A 4OINF 3HJRA 1OCCH 4G6DA 2EH3A 5C8WA 5EFUA 1I5ZA 1Q8VA 2CV1A 1L7LA 1Y9MA 4YW6A 3WF4A 1SDWA 1USTA 3OWTA 1FZPB 4M3CF 1OT5A 2DA6A 3AXDA 1EPZA 2BW8A 3QACA 3UR3C 3PVOA 1GMMA 4IHTA 5IVJA 1PO22 3WW3A 3OGVA 4F83A 4UY8I 4QKFA 3T0BA 2K4BA 3JAMK 3CQOA 5DS9A 2LALA 1VQPI 1H1MA 2HTJA 4P9YA 1S72I 1WCUA 5EJCA 1UCXA 4JX5A 4XBFA 2RS12 2K9MA 2Z79A 1CN1A 2R7ZJ 2STWA 3QD6A 1YXWA 5GAEJ 5GAGJ 2BHZA 3V7SA 4M4PA 3VHOA 2QQNA 2DBNA 1SD6A 5TJJA 3S2HJ 4C3IJ 1G3WA 1NE6A 1O5LA 5I0UA 4PF5A 3ECQA 1GQHA 1NHAA 4ZXEA 1ENRA 5ILVA 3HB9A 3KYCB 2P7VB 2P2KA 4K3UA 3KV5A 1MJBA 1WA4A 2QE3A 4KIFA 3WHTA 3T2TA 2ZMLA 4LK1F 1Y9QA 4NHYA 5DG2A 4IV1A 3ZQLA 5FRNA 3VB2A 1ONVA 1FC3A 3FXLA 4LT5A 2OZ6A 1XS9A 4QX1A 1U5IA 3S17J 5HCAA 1GNHA 4OI2A 4YVWA 5EV7A 4XJWA 2WV1A 2FQ4A 2GU9A 5LD2C 1S0CA 2CYFA 4XHBA 1WLCA 3H0DA 4YYOA 2RREA 5ACA3 5LBBA 1KS4A 1FOXA 1UIJA 1W9WA 3WOGA 4OHZA 5J48A 1B09A 3VBRA 1VLNA 1PK6C 3BR5A 1RMU2 4II2A 5IP7J 3K75B 4XUPA 2P5VA 4HNUA 4WBBA 4P5HA 2E60A 1LOEA 4FI9A 2RR12 1COV1 4EATA 2Z69A 1TMF2 3GTLJ 2HU9A 3ILFA 2H6BA 2R071 1GLHA 3F8CA 5IVEA 5F3IA 1Z6TA 2W0XA 4YFZA 3VBSA 4LKEA 1RHI2 3O8GA 2WO2A 3D5SC 4INDA 3TYJA 1LCLA 3DYOA 1CAVB 2PXJA 4GWJA 1VQKI 4D5FA 3PM1A 2E7TA 3CEWA 2JG9A 1J75A 4BIOA 4CHUA 4XBQA 2QSGX 1OOPA 1CIWA 1UX7A 2JZYA 1CR7A 4KIBA 4B4PA 3ZPYA 2LC2A 2HZTA 3PNAA 2HBTA 1MBFA 1CIYA 4Y26A 2EFPA 3OOPA 2RMU2 5JZGA 2VAUA 4I0AA 4HK8A 5GTHC 4RQPB 1ODDA 2M8EA 2DVFA 1DPUA 2WABA 3DPRB 2A07F 1NUKA 2ZMEC 1CPNA 1T6BX 4HN0A 2ET7A 5ICFA 5K5QA 2WA4A 3EMRA 3BDDA 3CLOA 3K9TA 1PUFB 3IL2A 1H2LA 4RYDA 4HKOA 2IT0A 2CMPA 4YRVA 1ZH5A 3IH3A 2V4JC 1UMHA 1R5ID 2VOVA 1AR62 2ZX2A 4CGZA 2WJSA 5F2WA 2OUMA 1LOBA 4KT5C 3CLQA 3IRRA 2ZJ2A 2G4IA 1RXFA 2XPWA 3J80K 2V1UA 2DCKA 5EYXA 4BBRJ 4EV0A 1NYWA 3OOXA 2YX4A 3WDVA 1SLTA 4KU8A 1GZCA 3I5UA 5IK4A 5IHRA 4RHV2 3LSJA 2F5FA 2ZB9A 5DAWA 1JYVA 1JGGA 3CQZJ 1UY4A 3QPSA 5C8CB 3K4BA 1B35C 3POGA 4HPKA 3USSA 3JTGA 4CP9B 2HEWF 2XAHA 3BIWE 4HOBA 3MLLA 1JUSA 3WE3A 5AC92 1EJ9A 5F1JA 2CG4A 2QKDA 5DMYA 4LK6A 2F6BA 1DIWA 1V6KA 3J81K 2Z33A 1Z78A 1RZ4A 1DQ0A 3N35A 4OI1A 5KR7A 1H89C 3BG3A 4WX9A 3ML6A 2AXLA 3U1KA 5LB6A 2ZKNA 1FIPA 3VBUA 2HVQA 1JXSA 3KP6A 2D6LX 5EGOA 1VBC3 2WAEA 2Z1DA 3DN7A 1AKHA 2BTVC 1YI7A 3VLBB 2X10A 2VBPA 1IKPA 4FPGA 4YFNF 4Q4Y2 4B1LA 4IO9F 1C4RA 2ECBA 2EV5A 2HPMA 3CMGA 4M01A 2HOEA 4PIZA 4DBQA 3HQXA 2JVGA 3ZN5A 2LREA 4CDQC 2KA3A 1O4ZA 3HJEA 2I8DA 3ZMVA 2NQYA 4ZHNA 3TO7A 1U9OA 3MW3A 4A0ZA 1MMSA 4NPRA 4BNCA 3ZXKA 2DFFA 2ETHA 1W6OB 3CHXA 4FAGA 5B5EC 5JHFA 3FUOA 3MPBA 2DCJA 2FMDA 3EQLF 1OCOH 3R6SA 5C3OA 1LOAA 1MR5A 1PGL1 2O8OA 1LOFC 3F0CA 4LO6B 4F91B 2Z2SB 4Y4YA 1ULOA 5FZ0A 3JQWA 1HXS3 4RB2C 1JI8A 1JYTA 1NTCA 3NAPA 4D6RA 5F6FA 5LHGA 5FPLA 1MD0A 5JIAA 4UI9L 4BU2A 1YIPA 1XDSA 4R4XA 1KGYA 5AVPA 1H0BA 1B9NA 2VKVA 2HWVA 4W97A 2RDPA 4JGZA 4Q0UA 5A7PA 5LK5A 3HRSA 4PUSA 2JA6J 2IVJA 1WKMA 2VL4A 2W57A 5M5YJ 3DPLC 1HDKA 1R1A1 2DOAA 3B6CA 3LDBA 3F3XA 2W1OA 1V6LA 3F95A 2OCEA 3HBLA 4AFBA 5L3FA 3CKHA 1ZLJA 2YDEA 4GWMA 1FBQA 3VD3A 4BE1A 1VAMA 2P3KA 4UW3A 2FCTA 1KU7A 3PU3A 4OVEA 2Q0AA 4YEJA 4JHZA 5A80A 5A3PA 1W4MA 5IPAA 2DTYA 4K40A 1FOD3 3EO6A 1JKPC 4LA3A 4XFBA 4C2UA 2CUJA 1ZZBA 4BZ4A 4Y5Z0 4PSXA 3NRUA 3GTJJ 3S1NJ 4GFBA 2YGMA 2HQRA 2FUG2 1GT0C 2K02A 1SD7A 5FPVA 4YIFA 1BM9A 4MGRA 3D4KA 3ZFFA 3WG3A 3E7LA 5CQGA 1IS5A 3I3BA 2L4MA 4HF2A 4YGBA 4XOTA 3N7MA 3WHBA 5JOWA 2OT7A 3GTPJ 2AH2A 1S7OA 1MW7A 5DDGA 4RGKA 4NHKA 2YXSA 4FOVA 4E2QA 3D6EA 2W82A 1ITYA 3GTOJ 4KISA 1WPKA 4ISRA 4E4ZA 4K8RB 1UX6A 4FT8A 4BM8A 4DXTA 4HRIA 3HG9A 2XF5A 2ORZA 3IWZA 1P4AA 2QQJA 4AFCA 5EF6A 3MPPG 2XGEA 2FBIA 4WM8C 3FC0A 1P9QC 3WNOA 3WGHA 2VD7A 3CLPA 3A02A 4HONA 3DBRB 1RUJ2 3S6PA 1VRBA 2HVRA 3WF3A 1C28A 3WTXC 2VMGA 3KP4A 4KMFA 5ISLA 2BGCA 1Y7BA 4V2GA 3GMEA 1VRH2 2F5CA 1XE8A 1COV2 5FZBA 2R072 1Z05A 2HGCA 1FP1D 2PHDA 1LTEA 1V0AA 4UUVA 1OISA 4AG4A 1OQ1A 3BPZA 4FETA 3WUDA 1ZQ3P 4H7MA 2XBO3 3AKTA 3SZGA 1F36A 2ZBKA 3PURA 5FYZA 4UV9A 3PIOF 1T0FC 3ZQQA 3P3PA 5C4WB 2GIVA 3GBGA 4CEWC 2QNKA 1X1PA 1OPMA 3JRFA 3SEZA 5CFCB 3WNKA 2JRMA 1X3UA 4OHXA 2VZ3A 1VTNC 4N4OB 4PI2A 3VBSB 4HN1A 1QNWA 3JZVA 1JS9A 3WNLA 3TEXA 1ORKA 1USSA 3J7HA 4B43A 3H3UA 2W84A 1C8NA 3HN1A 3AYDA 5T5JA 3VKOA 5KWRA 4MHRA 3RG0A 2EV0A 3TOAA 3NQOA 3ECOA 2EA4A 1R081 3HGYA 2GH8A 5KHHA 3NO8A 5L9VA 2BVVA 2BXZA 4X6RB 2Q5TA 4TYSA 3OPWA 1OOPB 5KHJA 2JB4A 3O1VA 3NAUA 4Q2FA 5FOBB 4E4DX 5F9TA 3BB6A 4W1UA 2HOTA 1K42A 2K9NA 1OF4A 2VQ0A 2XVLA 1GP6A 1QQIA 1X1BA 1LVKA 2F4IA 4CCMA 3HHGA 2Q4SA 4WF2A 4IXLA 1YEWA 4RR3B 4RS5C 2DWRA 2Y26A 1O4YA 1QEXA 4M6XA 3TNQA 1YE9A 2YBSA 3M8FA 2Y31A 2CSGA 2IUWA 4XZPA 1I5PA 2R7XA 4B4QA 2ORXA 3T0AA 5J36A 5FLIA 1MNDA 2EF6A 1XC6A 2LRDA 1RPWA 1HJFA 2W39A 2C9KA 1UZZA 1H0MA 3M1EA 2DBBA 1NZIA 1ZX5A 5IK8A 3I49A 3GFJA 5LRRA 3RZLA 2ILMA 4AOCA 3PQJA 1R093 3KVAA 5FZLA 4MIMA 5E3LA 5GLUA 1PDNC 1DQ1A 2Y64A 4S2FA 1R1UA 3ON7A 2FOWA 4O7XA 4HPKB 1DGRA 5IAVA 2SBAA 5H9RA 2A71A 3ZXJA 1REPC 2O0OA 2OJED 4XETA 1P4XA 1ND2A 1OVSA 5JSOA 2KM2A 2EIEA 2GNMA 1QJZA 3LGRA 2IWGB 1UG2A 1ZG5A 2BWCA 2D5HA 4AR2A 1NA1C 3NKTA 5D8AA 4RGGA 2KZVA 1JHJA 3GZUC 2EALA 3GEZA 4I0WB 3CMEI 3RJRA 3LIHA 3AZZA 4OI0A 1GV2A 3TDZC 5IYCJ 4I2OA 1R58A 4Q29A 4XFIA 2MEV3 4WM7B 3VBUB 4ZYDA 1J2XA 1XGSA 4U7DA 2Y0SA 4Y22A 3SC7X 2X05A 1PX3A 1WJAA 3RVHA 2NS7A 3Q9VA 1W8NA 2WSUA 5KHKA 3REOA 1OH4A 1LFUP 2V26A 3IAM2 4RGAA 2RC4A 2RV9A 4AE2A 3CO6C 2JRTA 1R64A 2QEXI 2JDNA 4KBBA 3VKNA 5L9BA 4YELA 1W3VA 5CVIA 1LR5A 4YW3A 2FZ1A 1D2SA 2PN5A 1PGL2 1ZVFA 1G4DA 1VQMI 1J1LA 4H7LA 4E7JA 1YS7A 3BT9A 2P6TA 3OSGA 1G2HA 4A2UA 2EWNA 4P9UA 1AR73 3HSFA 1W9YA 1AX0A 1IN7A 1D0GA 3KMHA 4HKLA 2BPA2 1R4NB 2L7MP 1AYM2 1UU6A 3OEAA 4ESFA 4RL7A 2MABA 2X4HA 2FEZA 3MV11 3HAGA 3M2MA 5IJRA 3CF2A 2PAEA 2CWEA 4X6QB 4LLGF 5E3OA 1SFOJ 3MF9A 4NUBA 2CV2A 2R1BA 5GLZA 1VI0A 4M72A 1W99A 1G3YA 2PG4A 3APBA 3HEFA 1DGRN 2DFCA 3B9CA 3I3QA 5J09A 4B1RA 1R1A2 4NIHA 4KJZA 2LUWA 1IJWC 5GKAC 2XH6A 4FAHA 3KV4A 1TTYA 4CPBA 3AFHA 5D2AA 1XRUA 4LE3A 4XDPA 2W52A 2DMTA 3ES1A 2GOXB 4Y1ZA 4CXFA 4K21A 5GZFA 4W50A 3NV3A 1SLBA 2VOOA 2CDOA 4IF4A 2DODA 5JMCA 2NS0A 5APAA 2E1NA 5A3WA 3J7YJ 5FBZA 4BY7J 1V9U3 4EMSA 2PMZA 4RAGA 2VBYA 2BY3A 1WI9A 3ACLA 4N7IA 1SBDA 1NG6A 3CDLA 5FY9A 2DBIA 2XQXA 5J37A 1O7FA 3GBWA 2D3PA 3PL0A 4IZZA 3WTZA 4ATFA 3MEPA 4B29A 2VZ1A 3T1MA 4OULA 4WVWA 2L9VA 2V09A 1B8IA 4LB6B 2WO7A 1H2MA 2IXLA 5IW0A 1GVJA 4ZZDA 1FMD2 4PFPA 5H20A 4TSVA 2KT0A 3HL2A 3KP5A 2VNGA 4KN7X 5F0FA 1PZ8A 4M4RA 5FZIA 3S5QA 4CDXB 5J1UA 4EJUA 3QP5A 1RUF1 3I58A 3U21A 2ZJQF 1O91A 2C4XA 5GLTA 4UOJA 4M0NA 5BNNB 1RRJA 5IVBA 1UZ0A 4OWRB 5JR2A 3INAA 2DT7B 1RUH1 4XJ8A 3BCAA 3EUHC 2WAAA 1UHSA 2XXZA 5LATA 5CIRA 1VBA1 1JYCA 1NLSA 4LHKA 4P9FA 1F4HA 2D1HA 2L9LA 2E7XA 3M7AA 1VBB1 3BU7A 1IV8A 4X1EA 2VCCA 3OYIA 4MGYE 3DPTA 2NLRA 3K2OA 4BQOA 1EAH1 4MSVA 4CXWA 3DYMA 4A6DA 3IDBB 5D5UB 3AYEA 2O0YA 3B93A 3LEGA 2GC1A 2G19A 3ZQGA 1W90A 3GHNA 2GC2A 3HOZJ 3FFQA 1WWYA 2M9HA 4Q47A 4O9EA 1P7JA 4IETA 1YIOA 2WL1A 2PMZN 1SPPA 3O0WA 2FHRA 5FO8B 5C3RA 2NVYJ 2XLGA 3LFMA 4HKWA 4XICA 4X0GA 2DYRH 4UVBA 2XKPA 5ILUA 4I0BA 2AACA 1R5HA 1MEC1 5D5WB 5E3MA 4KITB 1QWRA 1H88C 1V6MA 5CKNA 2R93J 3ZYRA 1BI1A 3H5RA 3TEZA 3BR3A 1XJAA 1SFXA 5BPDA 5E8AA 2P3JA 2V1DA 1R082 2DTRA 2HYJA 3PNYA 5KVRA 4XIDA 3MKZA 1F5FA 3GZEA 1UW8A 2LOOA 2HLEA 2DJNA 1RVF3 2W68A 3WF1A 4RAYA 1UU4A 4O3MA 3UJQA 1JHHA 3KFWX 5CJ9A 3SQOA 1MJ9A 3NWSA 1UYZA 4L11A 4PIXA 1DFQA 2P0WA 4IE7A 4V1PA 3FHQA 5CQEA 1PO13 2D1VA 1QZYA 3Q8EA 1BK0A 4JC1A 2OTJI 4BAYA 1NZCA 4YIRX 1T8IA 2DVGA 2MH9A 4M3GA 4FPHA 5FY7A 3NJXA 3ABUA 1XC5A 3RDIA 2R92J 3K10A 2KR2A 4Q0QA 1RUC1 4I6ZA 1HLCA 3AP7A 1PP7U 1HSJA 1LJ7A 1ZA7A 3QRFF 5FXXA 5B66C 3LAGA 5A32A 1PMJX 1HB1A 1J58A 3O3KA 1UJ8A 3JB8A 1Z67A 3HHHA 5C4XJ 2A5ZA 2KISA 4AEDB 3TBIA 2E2HJ 3A0HC 4IEOA 1PZ7A 4KWLA 4NAMA 3OYKA 5FB2A 1W04A 4U7BA 2IBDA 4D0PA 2OBPA 2XSDC 4Z6YA 3ZN4A 3GHMA 4YGDA 4OIQF 2D3RA 5EZGA 4CCNA 5CNAA 2GZWA 2E1MC 3HN3A 4BGDA 1OLME 2G1MA 4L0PA 1CAWB 3LA3A 2HWF1 3THDA 3A0NA 3N05A 1H4GA 1KFUL 3PU8A 2XR4A 4ZS3A 1DHKB 3VHRA 2FF4A 5F32A 4FP3A 2ZNYA 2FA5A 2HEVF 1NCQC 5FKOA 4YVWC 3K2ZA 3H7JA 3WNXA 4KFCA 4FXGB 3I59B 2IS6A 1FJLA 2CAVA 3QYEA 2O5RA 2OQ7A 1UCRA 2D7FA 4RDUA 4AGGA 4NJ4A 2LY2A 4M6VA 5C5TA 1AL23 2YPJA 2TEPA 3Q3SA 2YPDA 1WFXA 3C7EA 4EJWA 2MD0A 3IH2A 3V42A 3KP7A 1ETQA 3RWKX 2ZX4A 1J3QA 5CKQA 4G94A 3GFIA 1O5UA 4XL9A 5I8YA 3E1SA 2FOKA 3ASNH 2HDCA 5K0UA 2DA1A 5FDBA 1QXPA 1MZFA 3KEYA 4QQOA 4XHXA 1WQ2A 1O8PA 5IATA 3QU6A 4CZSA 3MWMA 1RUD1 2M4KA 4M3CA 3BI3A 2MW8A 4PI0A 3EYYA 3LIGA 1S7AA 5F1RA 4IXAA 1ZZ9A 1Y1WJ 1K6OA 4OAZA 2VO5A 3K4NA 2UWMA 5ACA1 2RDSA 3G73A 3CDHA 1VQ5I 2GLOA 1NCRB 2B4KA 5HV0A 5E89A 2HVSA 2WRAA 4PCQA 2EJRA 3M9AA 1VBD3 2XPJA 4HOOA 4PQQA 3FN9A 3H1CA 5AVAA 4XVHA 4WVZA 4IDZA 2WO3A 2HYGD 2WN3A 2ZEYA 1KQ0A 4BEHA 3ZDVA 5LHIA 5DXDA 3ZN1A 1UOBA 2DDAA 4U0YA 3WP3A 5JZGC 5F08A 4ESBA 3RZJA 3BJAA 5IP9J 1K5MB 5FZAA 2W7NA 2HR3A 5JOZA 4B09A 3FMRA 1SDDB 3J7NA 5FZHA 2X5IA 1PHMA 3NJVA 3SHRA 5L36A 4MO3M 4Q8KA 3RYKA 1HRV3 3THPA 4XUTA 2CQQA 1U5TA 5A6QA 2K85A 5L73A 2ME6A 4AI0A 2VBBA 4JQRA 1YQ5A 2VPLA 1MBKA 3K1MA 4MGQA 1GXQA 1FMVA 3N7KA 3H8XA 3FDYA 4D6SA 1XQNA 2XOMA 3GCWA 5LEKA 2WZR2 2YUEA 3VBFC 3HBZA 3E0JB 3F23A 3L2YA 3BG5A 1SANA 3I2HA 5JPMB 3VZKA 2WNUA 3IHUA 3HR9A 3WW2A 4MXWB 4LOTA 1XGMA 1GOFA 1XSXA 1YX3A 1XDUA 5FKBA 3SZTA 5FUNA 4LUMA 1BIBA 2DTZA 4OIPF 1W6QB 2Y6JA 4CO8A 2F4PA 3C8XA 1S29A 5CPRB 3BCWA 1MS5A 3D5RC 3RS6A 2H0BA 3OB8A 5CISA 5A1LA 5EYRA 1DU3D 2O6GE 2IS1A 2DPUA 2Y0IA 2FDFA 3P5JA 1RJ8A 5E1WA 2XG3A 2C0ZA 5HCHA 2AGSA 3FZVA 2ICWG 3L9FA 4CZZA 1H8TC 5ED4A 3L9JT 3C7GA 2XB0X 4CUGA 1GZWB 2YU2A 1RUH2 1BIAA 1A3KA 2W5FA 3QWLA 1LHUA 2EXIA 4PFOA 1KU3A 1HSTA 4IQ4A 4LG0B 3T4HB 4HDUA 1VBA2 3BGAA 4N43A 2EAAA 4C90A 1AR63 5FK7A 1OVPA 3PUQA 4EN6B 5FAXA 2Q1MA 1RUG2 3AZVA 4ZYGA 3R61A 2RV8A 1EAH2 4LO8A 4EWAA 5HCBA 2E7AA 3SH4A 1QJFA 3D0SA 1V5GA 3W6JB 5FWEA 2E19A 5GM0A 4JK1X 1EH7A 4RFT0 4CCOA 1QJX3 4JZRA 5CFDC 1W6MB 3BTZA 3E1F1 4B44A 4MLOA 4Q4X3 2FMYA 3M4OJ 1VBC1 1D8KA 3KYLA 1SFPA 4AEJA 1SLIA 2K9LA 4DGWB 4XURA 4CU8A 4DEVA 4UFMA 4CU6A 1Z77A 1YYVA 3ZSLA 1ACCA 4FPJA 4LBNA 3BVCA 4Z2YA 1F43A 5F27A 1MEC2 5F2SA 2EINH 4AIJA 3HGGA 2XKOA 5J3LA 4WVVA 3NEUA 3KLOA 3R05A 3NAPC 4NROA 2K7LA 1T2XA 5FQ0B 1YQ6A 3P5BA 2E1OA 1TEIA 1K5JA 1XSQA 3L2QA 2ARAA 3J7LA 4ON0A 2VLAA 2J5OA 4KGGA 2JA5J 2M45A 1XGNA 2OZUA 3K4ZA 2A05A 1L0OC 4KA4A 4ET7A 2CGPA 4OUMA 4EJTA 5ERIA 3HOUJ 4EWDA 5TISC 1H9TA 1ZR2A 2WAQA 3KIOA 2K40A 2NYXA 2R30A 1OYYA 1WLWA 1V6IA 1RUC2 3A22A 4OHVA 2RNJA 1HXS1 2VZQA 1DG6A 3VPRA 1T39A 1HQCA 4CP0A 1DBNA 1GUUA 2O14A 4A3FJ 5GAHJ 3OGJA 3GGLA 4AHZA 1J84A 4XRFA 4NRMA 4QB2A 4QM9A 4XQWA 2ZXIA 5K7ZA 3MICA 3SITA 2JDKA 4IHSA 4QPGB 3H3LA 4UF0A 4A45A 1EH8A 3ZQFA 5EEHA 1VQ6I 5CAZA 3KQRA 2R16A 4XYXA 3S7EA 3A2KA 3M07A 4JP0A 4Z1VA 4JDMA 2R7OA 2QFEA 4HK9A 3N4MA 4CDUA 3ZFFC 5CKTA 2WLQA 4CP1A 5A32B 2XROA 1CJPA 3S3MA 5J8CA 4ENNA 5TSWA 1ZZ7A 2XGXA 2HWF2 4GALA 1OCRH 1HDDC 1IG3A 3WG2A 4CU7A 2DOEA 3N3HA 3H35A 2ELHA 2NVTJ 1C8M3 4QX0A 3HTSB 2ZGKA 4BQ1A 4Y1UA 3C7HA 2C5DA 3CCSI 3JUUA 3SCHA 5F3GA 2Q8KA 3N9NA 1QQP3 2W08A 1FIAA 2AC1A 1ULPA 3OYMA 2KXLA 2X8KA 2MHFA 1FAYA 3VSKA 3WW4A 2C9AA 2IW5A 4XFCA 4MOAA 3ZXEA 2VECA 4XCAA 3OUIA 1IDZA 3VYUB 4B3XA 3OY8A 4ABZA 1ZBE1 2BOLA 1S4CA 1CONA 3PNTA 3GF2A 3G1OA 4DQAA 2RS51 1LFBA 5FREA 3AP6A 5ICGA 1A8DA 1YO8A 3BTAA 4HAMA 2K27A 1WJCA 2PMWB 4LEJA 1Z7S3 4GXOA 5IVFA 2NP0A 5GTIC 4URAA 3OOUA 3WE2A 2IA2A 1Y9GA 3HEIA 2X6OA 4U87A 2E36A 5LCWL 4XIKA 5FZFA 1L7QA 3OYWA 2B9VA 1WMDA 1GP5A 2R5ZB 3S15J 5ACA2 5EG0B 4A6OA 4FFHA 4FQGA 2JE7A 2BEOA 4RD7A 1L3JA 3AP9A 3T4VA 3I2KA 1XMKA 5CG9A 4KBZA 4MQVA 4ZJZA 4HX7A 2IXIA 2QWWA 4CPBD 2GBYA 3V0AA 1WJFA 2A5YB 4M9XA 3MF6A 2CV6A 2A3SA 5JVVA 3CBNA 5F04A 2VTFA 4NHJA 1NLQA 2JG8A 2ZABA 4G3YC 2XGDA 3LCPA 4IE4A 3ENRA 2JDUA 2RKHA 3VYTB 2YU3A 4HF0A 3GZNB 4DOZA 3POWA 1YG2A 4AYBN 2VUAA 2CHHA 4EQQA 5A7OA 1ZRFA 1WLDA 1G3TA 3AKQA 5A7NA 5IT6A 2RNGA 5H2FC 3OSFA 2DVDA 4FCAA 1K78B 2P8TA 4BEHB 1JJ8C 2W1WA 1FATA 4AU7A 4JGYB 1R71A 2E5ZA 4QX2A 2BW3B 1RR7A 3MW2A 2TNFA 1UMZA 2JK3A 3V8JA 2R073 3JD71 4XJZA 1W0PA 5KK1A 3LSMA 4XIOA 4UFKA 2B7EA 1P92A 4C3HJ 1BJAA 1FOKA 1N75A 1LQ1A 2L4AA 3I2IA 1UQXA 1ZZ8A 2ZX0A 2DUPA 1QNTA 5ANNA 4J01A 3KT4A 1BK1A 3MCZA 1WCSA 4IEWA 4DXZA 2ZEZA 3HPGA 1TW3A 3KS7A 1GOGA 1CWPA 3NSTA 2G9FA 3WQ7A 1HQWA 1X1DA 2BJSA 3HWJA 4DYQA 3SXWA 4ZS2A 1PK6A 3KD4A 4A69C 1TME1 4YWAA 1VQ9I 5FLJA 1REEA 4W6WA 4HNVA 2M0CA 1LENA 3CJXA 2ISYA 1IXCA 5DD4A 3C3VA 5CLSA 3URFA 2R0FA 1TWFJ 1UKRA 4BPZA 1MGTA 3BJ6A 1WMFA 1R49A 5IK7A 5E8GA 3BZCA 3OGGA 4OOIA 2EIGA 1EUTA 3M70A 2JJ6A 5EXOA 1YHQI 3KV9A 3UGHA 3G1LA 3AL0B 4UUSA 3NNJA 2RN7A 5FP8A 3Q8FA 5FJKA 2PQQA 1X50A 4BISA 4NC6A 4L9JA 1ULGA 2YC4A 4S2GA 3QPLA 4IJAA 5EP9A 3ETPA 5T52A 3G1MA 3DKXA 1GYKA 2MLGA 1O3QA 3TWIA 3F6VA 3AG1H 3ZPOA 1G8WA 2F5VA 4UNOA 2NVXJ 1BJQA 5KNLA 4HX4A 2HS5A 3Q9SA 4LOSA 1BL0A 3WDWA 1VBC2 2BWAA 4PK4A 4CSWA 1BEV3 5F0CA 2QDRA 2E32A 2ZMEA 5JPNB 1QIQA 2VULA 3M3IA 3M7GA 2YGLA 3QOPA 5HXVA 2ZEWA 4QGMA 4RFRB 3R60A 4FISA 3I7DA 2W25A 2VODA 2AYHA 1JZ6A 3K77A 3VBOB 5JLWA 3E6CC 2P3IA 3GJAA 4MTDA 4I99C 2MEV1 1DGWX 2IFRA 3FLTA 2EQRA 2YSRA 2IXSA 2XB6C 2DDBA 4IRGA 1SEUA 4F8AA 3ZXGA 1XNKA 3PL8A 5D6FA 5B4XA 2M8GX 4ISQA 4G4FA 1B35A 3LF7A 2Q30A 4E7ZA 2WWJA 3Q0VA 4D94A 1LKNA 4QXKA 2DJIA 4YFXF 3K3NA 4CEYC 1RC6A 2NOGA 1WVRA 5JVTA 4AVSA 9ANTA 1HXS2 4GD4A 3S7IA 3RQ0A 4IV3A 3U10A 1AR71 5A7WA 4LXLA 4WXHA 3WTWC 2ZGUA 2RDQA 3EHKA 3VKFC 4UFIA 4YGEA 1J5YA 3E6BA 2VUMJ 4ARXA 5E79C 4HLXA 4A6SA 2DFHA 2JQ7A 3UYJA 3DECA 5ABJB 1JKRC 3DTEA 5F6LB 4LGWA 3DGTA 2ACJA 3A01B 4G7HF 3TDUC 1DZTA 3BR6A 4M9SA 3GALA 5FUPA 1KRIA 3CD6I 3DFGA 2XJSA 1SAXA 3WDYA 4IOCF 1WKYA 3WDUA 4L99A 4H0EA 1AJKA 3M4FA 5K5OA 4XF9A 4WWCA 5A2QZ 3AVRA 4BKXA 3WVJA 2VZUA 1BI0A 3RZHA 1VQOI 2DYCA 3SDBA 2VNOA 4ASNA 3MIEA 3ZKYA 1FOD2 1R22A 5JSPA 3UKNA 3MI8A 1GLNA 4OIRF 4DUVA 3IV5A 1V9U1 2JDZA 4XDQA 2HTSA 2IGKA 1YFXA 4NR1A 1QA6A 1XSVA 5LA1A 1R1A3 1HV1A 3NJYA 4YZ4A 3CJIC 1ZBE2 4XLEA 1TBXA 1J59A 5FMBA 1IS6A 2QF7A 5IYDJ 2IGOA 3VSLA 4COVA 2VW1A 3N9PA 5T5OA 4BYYA 4QHZA 3BP8A 2WT1A 3ZPLA 3UNGC 1RITA 1ETOA 2HQNA 5C71A 2XL9A 2VMFA 1UWWA 4BACA 4IE0A 3H9QA 1N47A 2FCVA 4HFSA 5FRAA 1HB3A 2WNVB 5DCMB 1SMVA 3S57A 3GNEA 2ARCA 1U0JA 2VKEA 3MD2A 1RR8C 1WJDA 3U4SA 1OCTC 3OJBA 1LDKB 2VE9A 4DZPA 3R0JA 2B39A 1XG1A 1JU4A 2BZDA 3WSOA 4ZYEA 2CSOA 3SMHA 3HOSA 3ZCOA 1OA2A 4UBHA 4BJ6C 1O8SA 2AENA 4WZCA 2V79A 1XB4A 2ELKA 2F17A 2VUCA 3IWFA 5DAPA 1D4M1 1BHGA 2Z99A 3I0TA 1UZVA 2XBO2 4LMYA 1G7YA 3WG9A 2R7RA 1EF4A 1X2MA 4MGTA 4AI8A 4L5JA 3ZSMA 1MBEA 3ASOH 3QYBA 5CYYA 1ZGJA 2J1SA 5HVQC 2UWBA 2F48A 3C2HA 5GJ6A 3ST7A 3UETA 2Y38A 1M4WA 4HPQA 5DEQA 2QQOA 4RAZA 3QODA 1W8FA 3BQYA 3LSEA 2P4WA 4PLOA 4XABA 3SKJE 4MX3A 2Q8DA 4H4KC 4XBLA 5KAIC 3WDXA 1GV5A 4DMIA 2JIGA 3PJYA 4YW5A 1DCSA 1ULDA 1Y8QB 4MEXF 5DUIA 3KM5A 3MO4A 3LPFA 5G05L 2YG0A 1CESA 5GPCA 2E33A 4C3JJ 5LFAA 5FYBA 5K7PA 2LBFB 2OS2A 1J0RA 4YRDA 4GGGA 2VC0A 2HWC3 3AYAA 4ORFA 3MV01 2XWJB 1FTZA 4ETSA 3LFIA 1RVF1 3H50A 1UZYA 1PVC1 2VKHA 3JRDA 2R043 4RGXA 1TQPA 2IVIB 4LBQA 1PO11 1Q8SA 3VDCA 3WV6A 4YGCA 3NJZA 3GLLA 1A6QA 6PAXA 4BXSV 2PFBA 2JDMA 4EROA 4YZ2A 3O0VA 4FBFA 2QCSB 2Y48A 4OHYA 3OL3A 4LBOA 4GCVA 3N7LA 1MH4A 3E5XA 3GFMA 1W2TA 2MFZA 3PNVA 2X51A 4A44A 4DB5A 3LSDA 1T0FA 2LM3A 1E57A 3O6BB 3ZQIA 1XE7A 1UZWA 4CCCA 2JN6A 1MMDA 1IDYA 3DU6A 4ARYA 3VV1A 2DA3A 2LVSA 4DZGA 1YFHA 1BCXA 4BIFA 2YUSA 1RL3A 3AL5A 3O1UA 4YW1A 3BJOA 3CTAA 4KMQA 5J98B 3VYRB 1YRZA 4ATEA 5C3EJ 4G12A 1HRI3 1PYVA 4QB1A 5HNFA 2K5CA 4XFFA 4JX0A 1GDTA 1RIOH 4IEVA 3AKZA 2XIGA 1G86A 4AHXA 2E71A 5C4WC 3W59A 4LE4A 4HQMA 4CYCA 4QU2A 4Z82A 1OLRA 5C4JJ 5FYUA 1GQGA 1QO0D 1LEBA 4XPVA 3RMYA 3PTRB 4E8CA 3I4MJ 2BNMA 1V00A 3KZZA 1BR4A 4QU1A 1X36A 1X8EA 2QVSB 5GADJ 1TE1B 5HS7A 4U0WA 1AL0G 3ZXAC 2MEV2 4M6YA 2KD7A 4RS5A 1P4WA 3MZYA 4CRQA 3WQBA 2BVLA 4MTEA 4PJLA 5LA2A 2KZGA 4OMYA 5FY0A 4EZHA 4EQVA 3G3ZA 1HQLA 1ST8A 4E4HA 3L2WA 2XHKA 2PAKA 1IAWA 4FTBA 1QJEA 2G9GA 1OF3A 5FUIA 1IRXA 2HJIA 3GJBA 1JOBA 1YIFA 1OI6A 1UY2A 4DO0A 3CCVI 3LQQA 4ZONA 4AGVA 2ID6A 4L9TA 4AVPA 2D93A 2KDZA 5EZWA 4A3XA 5I91A 3UJOA 4BJ5C 4YZ1A 3MFKA 3LE0A 3FXKA 3DKQA 4W8JA 3TP3A 2W00A 5FZ1A 2XAQA 1RB8G 1AR72 3DTKA 3CCJI 3IUOA 2IGMA 1U5TC 1LKXA 2I45A 1FNYA 4IL6C 3WHCA 1NK2P 3M3QA 5L7OC 1B35B 1K4TA 3TBDA 2O8XA 1C5IA 3WXPA 2ISZA 1L7RA 1XPXA 3GTKJ 3FMGA 3VOEA 1NA1A 5F8PA 2WNUC 3CCUI 1BI3A 3H36A 5E20A 3OYGA 1EPWA 1Y1VJ 1ZHFA 1CAXA 1MQTC 2VR4A 3ACIA 1PNGA 4ES9A 4PJ0C 1YQ2A 1D1CA 4KQ7A 1ZBA1 2BY0A 3TL4X 2UZKA 3I9V2 3CMMA 2WNOA 4G7OF 4HL0A 5JAXA 1JXNA 1LGNA 2X1DA 4YPJA 1GFF2 1HRV1 1KA8A 2OW4A 3PO2J 3CCMI 4YVSB 1UY3A 2PLYA 2HPIA 3R0AA 3WODF 1YQ8A 5FKMA 2NVUB 1H8AC 2STTA 3LAJA 1V9U2 3VDAA 4XCBA 3FBIB 1SG3A 1SQ4A 1IRFA 1JT6A 3ILRA 4LHNA 1LGBA 4MV2A 4GB31 3AL6A 4LMFA 2HDDA 1VQ7I 5BXXA 4NHLA 1AUYA 3HTUA 3DKWA 2VVEA 3U37A 4CDQB 5CKMA 2IA0A 4L0ZB 5E6HA 1JZ5A 1IGNA 4QPOA 4DPNA 4N53C 4BQQA 1GXPA 1TZOA 4JQFA 4U0VA 2JPBA 3BR1A 2PTMA 3FXRA 3JRGA 3F8BA 1FLIA 1Q1HA 1K6YA 5FZ6A 1HN1A 3FUQA 2FCUA 1RYYA 1CF7A 4OQ8A 4JDOA 3WLUA 3O1MA 1WMEA 2FE3A 3VWBA 5B1BH 4RGUA 2QTWB 3JSOA 5DAVA 1W5TA 3HUGA 1D5YA 2R6QA 2R49A 2GQQA 1PP8F 2V73A 1KJLA 3W2WA 1OKQA 2GNDA 5FO7B 5IYYA 5L19A 1HW2A 3J7AO 3ZR8X 3JREA 2M0MA 4BK5A 1NQJA 4EN7B 1D4M2 1HBXG 4NRPA 3ZSEA 1AR91 4HG6B 4URTA 2GNTA 1POGA 2QDNA 4IEYA 4I3PA 4EGZA 2JA8J 3I4NJ 3BLYA 4JRAA 4XTMA 2W46A 1UOGA 2P1BA 1WW4A 3FZ3A 1LEAA 2R0QC 4DBRA 1RUF3 1UIKA 2IJLA 4HBNA 1ERDA 4A4AA 3BG9A 3S1QJ 3RYPA 2Y9ZA 1RUH3 3FIWA 4Q4X1 2XGCA 3O7OA 5FFXA 3GBFA 2C24A 3TOJA 3X2QH 5JHUA 1VBA3 1GOHA 2C1FA 4C1WA 3ZFGB 1D1AA 2P34A 1QGLA 3KHBA 1SBFA 2VZTA 1VBB3 2W4SA 4MH0E 4KG0A 2KP6A 3BR0A 1EAH3 5FY8A 3K6GA 1C5HA 3TOBA 2XWBB 5FZOA 1REDA 1NY72 3ABTA 1Z91A 4DRVA 2PQSA 4BDZA 1W39A 3ZYFA 2ZMNA 4ZTFA 2VNRA 4IEZA 4FASD 3S14J 1RVF2 2WQ4A 2H8RA 1AXYA 4FVVA 1RGSA 1X4PA 1SFNA 2JWPA 3LQCA 3BTJA 4KU7A 4CDWB 3KLNA 5LWBA 4FO9A 5CVRA 3L2RA 5D21A 5A70A 1PO12 2ECCA 2YC0A 3W20A 1G9DA 3ZYGA 3KETA 2VJXA 2VOXA 3IKWA 3OL4A 4XN3A 2P6HA 4CDUC 1MEC3 2OUJA 1JBCA 2CGOA 4IUGA 4YM2A 4WM8B 2RM23 1QKQA 3HSRA 3QYFA 2RHPA 5FPXA 4LHLA 2WO1A 1CZVA 5FPZA 4QKDA 3DCFA 1VAKA 5DG1A 1MACA 5JLXA 3JU9A 5KXDA 4LD5A 4I09A 1XSRA 4MHGA 5T3NA 3VGIA 5CVUA 2V4VA 1XB9A 5FZ3A 5FZGA 2QJVA 2J1UA 3TMOA 1H9GA 2SLIA 2WDBA 2HXOA 2R7SA 2B46X 5DV5A 1W7PA 4Y33A 2RS31 1Z1DA 1Y56A 2Y75A 4EN8B 1LE8A 2L0KA 3OR2C 1RUC3 5JI9A 1QDOA 3OEBA 1W2NA 2VMEA 1S0EA 2IXHA 4BQ3A 1MPXA 4IQJA 2HWB1 2BGOA 1W6PB 3S2DJ 3WZ1A 4CEWB 2IXCA 1HW5A 2ZAHA 1O3TA 3FXMA 1E5SA 2I74A 4P9GA 5LY2A 1S6LA 4JRLA 2AREA 5C3SA 2WZEA 1OYWA 4XILA 1WGPA 1QQP1 2QSHX 2UWCA 2DU1A 1W2AX 4BB3A 5E88A 1YLLA 4Q0SA 2VNVA 2ZX1A 1W0NA 1XU1A 4GXLA 3POFA 1AL22 3HQRA 4BS9A 3OS0A 5JUVA 1W2UA 3VN4A 2F4OB 4FPEA 2P81A 3RIRA 1QY4A 2HWF3 5KHGA 1UMIA 4N0BA 1UAIA 2XJUA 3J8F1 3IPVB 1U5ZA 1E3PA 1ENHA 1Z7S1 1F5JA 1B9MA 1VNDA 2JG8C 3ZMOA 2N7GA 1WJ5A 4XKCA 4NIAA 2PJRB 2W3JA 4Q48A 4RS5B 3JCUC 1AF9A 5FD6A 2VTXJ 3G71I 3LMMA 3LFUA 5BNGA 1D0YA 1E2XA 4FQ4A 3DXJF 2DUOA 4DUXA 1FV3A 1RKWA 5LASA 3SEPA 2XB5A 1S5LC 1OFSA 5E1RA 3OYLA 5FXVA 5JMOA 1VBD2 3HNMA 4RM3A 2LF8A 1YLFA 1LHOA 3ZN6A 4QMAA 1O3RA 3PVNA 1VE0A 2Y0MA 4H3WA 3DQVC 4AEDC 5IUQA 3D5LA 3BOPA 2R5YA 4N7UA 4JCKA 2UY8A 1RUD3 1NCQA 3UKVA 2VZPA 3IMNA 3K1PA 2DU9A 3NL1A 3I2OA 3O8HA 1LODA 3CMYA 3P6BA 1O3SA 4C1XA 5FP9A 2XVGA 1WW6A 2FDIA 1FBSA 3IKVA 3GVAA 4LA2A 5BNPC 4QWQA 1GWMA 3DEWA 4UXAA 1MS0A 1IUYA 1HRV2 4OFGA 3EB7A 1GV9A 5I0SA 3VZNA 1TWCJ 4AI9A 2Q8CA 1RJ7A 1U6GA 1QOSA 3MIDA 1EV13 5FYIA 1WJBA 1BLZA 1EYBA 2R7UA 1R1VA 3QPHA 3RGBA 1CAXB 4PJJA 3RSNA 5B1AH 3NW4A 5DAQA 2YU1A 1JYXA 1MZBA 3GTQJ 1YJKA 3SISA 1H6YA 2V6CA 4EN0A 3AP5A 2OYZA 4ZKTB 2NNYA 1MH3A 4GB32 5DUWA 1W36C 2WZPP 3U14A 3OBZA 2RG4A 4NQWB 2M30A 1RUI1 1S0GA 5F37A 1SCRA 3WNMA 3AM2A 2WQZC 1V5FA 5FZKA 3EQEA 4LIUA 3SHFA 3AC0A 3AMMA 1WCDJ 1BOAA 3MHZA 1WBLA 2XVCA 3Q8AA 1CZSA 2G0EA 2XJRA 1C3HA 4QGNA 2ZKLA 2Y34A 1CQ9A 5FR3A 1BMV1 4E7LA 1NCRC 3CZUA 1PJRA 2VASA 2V5DA 4P1WA 4IKFA 4A41A 3ZYJB 1W8ZA 2CV0A 3QU3A 4IQPA 3H8RA 1X3WB 4L5EA 4HLTA 4KYWA 1OJLA 1F4KA 1OH3A 2VZVA 5GLWA 2LKXA 4RMNA 1PZ9A 3VD4A 1BR1A 4E7SA 1YITI 2E1CA 2R7VA 3A03A 2BOIA 1W0OA 2OD5A 2ZNZA 5JOXA 1K3IA 2J1TA 3LPGA 4JBAA 1AR92 2QQWA 1VBE3 2B45X 2RGVA 3U9GA 3KCXA 3A1YA 4COYA 1K5MC 4OZOA 3I71A 4V2WA 4Z2WA 1A6IA 3JW4A 2OF7A 3EUAA 3VBFA 2VKDA 3N97A 4XQFA 1IN8A 1QJX2 1WZ2A 4NPLA 4QPIA 1LB2A 5FMDA 2XAUA 4Q4X2 2GC3A 2B9UA 3F22A 5J6XA 1BEV1 5CB7A 1V5EA 1I9RA 3ZR6A 1VFCA 1TQMA 1KFXL 3DBHB 5FD5A 2RQQA 5J40A 1XCVA 2L9RA 2BOJA 3DP7A 2EK5A 1HF0A 4CCKA 1G8XA 2ZJCA 5C9AA 5FP4A 2W87A 3V4GA 4LBQD 1PM7A 2XL7A 2VT3A 4IV3C 3VB9A 3ECHA 3L2UA 1HKSA 1R6RA 4KI5M 4ANJA 1J3RA 2CQKA 1BW6A 3WD5A 1H8TA 2WS91 2ZGRA 3USUB 2VZSA 3FXQA 1ZM1A 2VE1A 2WY8Q 4PBPA 4MXVA 4P5YA 1OLMA 1BZWA 2VQAA 4IPAA 5J3UA 2R7WA 3UNPA 2D45A 1SCSA 5BNOB 2R3SA 1MNMC 3DPUA 4HLYA 1IN4A 3LDRA 4AVZA 1VQNI 4EGYA 2QQ8A 4RLQA 5FKLA 3IRQA 4FP2A 2X0LA 1QHDA 3WU0A 3HRTA 2VCBA 5EZHA 4WV8A 3AZYA 2LDUA 1Z0XA 1I50J 1VJ2A 2JDYA 2IXKA 5CFDA 2F4LA 2IXJA 2LTNA 1OXCA 1F4AA 1SFYA 1IS3A 2WKKA 3VL9A 4AWXB 4Y1YA 1JYIA 1IQDC 2LMDA 4QGLA 5A3NA 4LG3A 4P9IA 2YFZA 5D4RA 3E5QA 5GZCA 3TAYA 4RB0A 2PEXA 4ZZ5A 2WSVA 1OQEA 1YCIA 4H14A 4XF4A 3H8UA 1FPN1 5DYMA 1W6NA 3U1DA 1C8M2 2LRPA 2V1XA 4BXFA 2VH9A 4YW7A 4NB5A 4GH4C 1QQP2 2NVQJ 3L00A 4PT6A 4DIQA 1MDMA 2DUQA 1QZEA 3A4UA 4FCYA 2CS3A 3TO9A 2Y8KA 1KJRA 1A31A 4XQ4A 1LEDA 1OFCX 1UMQA 1DQ2A 4QAWA 1R7JA 2LSOA 1LEMA 5HNHA 3FWEA 2JA7J 1E0EA 3K70D 2M34A 5LLQA 1ZG1A 3IM0A 2ET1A 3A7QA 1A34A 5AIPA 4M9ZA 2Y6HA 2FQ3A 4C2MJ 2V4AA 4MVTA 1Z7S2 3W3CA 1QOOA 4A6EA 1H9WA 2XJVA 4ZZLA 2WN2A 4QSHA 3D1NI 3M3OA 1D2QA 2VBDA 4JHTA 3WDTA 4CXXA 3OS2A 2FRHA 4I01A 1FTTA 4IW3A 5FJHA 1UHMA 2VW2A 3S8PA 4R1HA 2COMA 1ZBE3 4A7YA 5JXJA 2JUCA 3K3OA 1WWXA 1AR83 1H2NA 2RS53 3V7CA 1T6GC 2VBZA 2VY0A 5E3NA 2O8QA 4NRQA 4NWVA 3RRDA 2FD5A 4HSLA 4QPGC 2E34A 3KF5A 1KYWA 1B72A 4A3DJ 1ACIA 1ND3C 4AIDA 2ZXJA 2HBUA 3CO7C 3C3WA 2OC6A 3H8OA 1JMUB 2Y33A 3S30A 2KRHA 5FYSA 4G7ZF 4A3CJ 2WADA 2CAUA 1SEFA 2E1MB 3MGUA 3WG7H 1VAVA 4L92A 4BDVB 1IS4A 4IHVA 2BQPA 4IV1B 4LB5A 3JTHA 1XNDA 1S55A 2DDUA 4QKBA 4Y20A 4COWA 1LPQA 1ZNPA 4CTEA 3M3YJ 4E9KA 3V8LA 3H92A 1NCQB 4YVWB 1CAUA 3ZSJA 1KQ8A 4NAOA 4XUQA 5KXBA 2DLLA 2H09A 4LFUA 1OYIA 2VONA 3VBRB 4YARA 4HVQA 3I56I 5I0RA 2A6YA 3J7AY 2PI0A 4OLLA 2HWC1 3AKPA 3ZFEC 1RUI2 1XYPA 5A2QK 2MNGA 1AJOA 4FOQA 2Y60A 4CCLA 3VD7A 4QKNA 2R041 3ZO0B 4JYKA 1RI7A 1X58A 3M8EA 1YRNA 3JD73 2D98A 3THTA 4HX8A 2D44A 3S1MJ 4E7KA 2YZ4A 1WHUA 2W94A 4Y24A 3M3CA 5HOOA 2WUHA 1BW5A 4AM3A 3O0XA 1HN0A 1BMV2 2H94A 3QAHA 5K9YA 2ES3A 2JG9B 5DQ0A 5FV3A