4CYDA

Glxr bound to camp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
225
structure length
223
Chain Sequence
GVQEILSRAGIFQVDPTAVNNLIQDMETVRFPRGATIFDEGEPGDRLYIITSGKVKLARHAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSAVCVTEVHAATMNSDMLRNWVADHPAIAEQLLRVLARRLRRTNASLADLIFTDVPGRVAKTLLQLANRFGTQEAALRVNHDLTQEEIAQLVGASRETVNKALATFAHRGWIRLEGKSVLIVDTEHLARRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structures of Apo and Camp-Bound Glxr from Corynebacterium Glutamicum Reveal Structural and Dynamic Changes Upon Camp Binding in Crp/Fnr Family Transcription Factors.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transcription
molecule keywords PROBABLE TRANSCRIPTION REGULATOR
total genus 74
structure length 223
sequence length 225
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4cydA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4cydA01
5E1ZB 5LBQA 1XSDA 3N97A 1J0RA 1R22A 4WZCA 3WTTC 2GIVA 1O7FA 1U3EM 1ZG1A 2IA0A 4DQ2A 4LUMA 1RIOH 2M5WA 2VBZA 4BHPA 1ZYRF 5F64A 4HF1A 2O3FA 2Q30A 5I93A 4AWXB 3H9AA 3FXQA 4J1WA 3EBRA 2RNJA 3W6KB 3W6JB 2QJVA 4G8XA 1QQIA 4TV7A 3RPQA 3GW2A 1R00A 4D7TA 3WTXC 4QXKA 3GFJA 5DYMA 1MJ9A 3O6BB 1XDSA 2FMYA 4AXOA 2X4HA 1HW2A 1IN7A 2EFOA 1YYVA 5K8SA 2ZBKA 4MGIE 2DLLA 2P17A 4LG0A 1WQ2A 2LSOA 3AAFA 2FXAA 1BM9A 5J6XA 4MGYE 1H9GA 4LLGF 1OYYA 5I8SA 1EH7A 3BALA 2HDCA 3P9KA 5L3FA 2AXLA 2B8MA 2ET7A 1O5UA 2VBYA 1FZPB 5KHHA 2IXLA 1G3WA 1SEFA 5DUIA 4AIKA 2D45A 3WE2A 1UIKA 1LDDA 3WGIA 2Q0OA 3I4PA 4Z07A 4FBFA 1QBJA 2F5FA 2UY8A 5KBFA 3KP2A 3P9CA 1YS7A 3BJOA 2ETEA 3KGLA 3GFMA 1QZZA 4YIIA 2MH9A 5D6FA 1O57A 3H8UA 1KA8A 2PMHA 1CF7B 4L11A 3U1DA 1YLFA 3HRMA 2AS5F 1X8EA 2BNOA 2FF4A 4ZU4A 3P7NA 5BPXA 2JPCA 4HX4A 3EQLF 4UXNA 3ZMTA 2M30A 2HGCA 4KIGA 3WTYC 4WF2A 1EH8A 4Q0UA 1O3QA 4WWCA 2R7DA 1G4DA 1B6AA 3HT2A 4FX0A 3E6MA 3I58A 2XVCA 5T3NA 4IF4A 4PGHA 5IT9K 2EFNA 4E2GA 4L9NA 4QGNA 2OU2A 2B0LA 3GO5A 1DZTA 2A69F 3BPXA 2ZO4A 3K0LA 1BI0A 3WODF 1IUYA 2OA2A 1JHFA 2MNGA 4NHJA 2G9WA 1X7NA 6PAXA 3DXJF 4U7DA 4YIFA 2WFPA 2B9UA 3NSTA 3QRFF 3RKYA 2L01A 3FMRA 3ELNA 2A07F 1OD5A 4IVNA 1U5TA 4KDPA 2DPDA 4HDVA 4BAYA 4A0XA 1DPRA 1O3RA 3QP6A 5LGUA 3ISPA 2XRNA 1J9IA 2PYTA 2O61A 4MEXF 4YFXF 4MH0E 4MZUA 3WW2A 1BN5A 1SD6A 1IN4A 5HVQC 2DPUA 2D5FA 2PHLA 4HSJA 3F8CA 1PP8F 3HSFA 1XSXA 3KEQA 4OLLA 5KHKA 1PUEE 2VOPA 3BP8A 4KNYA 2CQKA 1R36A 3RPUA 3HTUA 2Q8KA 3EO6A 3KP5A 4BXUA 1SD4A 4OU0A 5K1YA 4ON0A 1CAWB 3MZHA 4IRGA 5F1RA 1IPKA 2CAVA 3FXRA 1ZZ6A 3E5QA 1AWCA 4HV5A 3CJXA 2ETHA 2KXLA 2Z9OA 3S0MA 1FY7A 4RGRA 3L9FA 4ESFA 3O2PE 5BPIA 1O3TA 3T8RA 4YNIA 4OIPF 5DV5A 3TO9A 4PDKA 1FYLA 1XCVA 3NQOA 1YW7A 3ST7A 3DKWA 2G7HA 5DD4A 2E1CA 3K1MA 1F5TA 3FZ3A 5J8FA 4LLOA 3H7JA 4GULA 4WCGA 2RKHA 2ZKZA 5J7MA 3J80Z 3PNAA 2QWWA 2OYZA 5KHJA 2GA2A 4LK1F 1CX4A 3QPHA 3D82A 1QY4A 3H1WA 4LGWA 5E1WA 4U0YA 2HR3A 4RAZA 1PMIA 1IZ1A 1S7OA 2EJRA 1FC3A 1X82A 2EV0A 2PG4A 2Q0AA 3U2RA 4MGZE 2L4MA 3CO6C 3FF5A 1YUDA 2JPBA 5BXXA 1EY2A 4KICA 1LKNA 3RNSA 2OAZA 3FXUA 4L5IA 1S3JA 5ERIA 2DQRA 2A3SA 2CSOA 4BHBA 1FLIA 3U0ZA 4JVAA 5IT3A 3R4KA 1JE8A 2L54A 2HKOA 1RNLA 4Q48A 3MQ0A 2FMLA 2IA1A 1TW2A 1B1BA 3ACLA 5CVUA 3GZ6A 2MC3A 1UHMA 2FBHA 1CAUA 4M9SA 2BYVE 3ZDSA 5CJ9A 4ETSA 4LEJA 4YG2F 1JHHA 1YO5C 3CL1A 4MUVA 1Z7UA 3NKTA 5I0TA 2V1DA 2LNBA 3HHGA 4GYGA 3BY6A 4Z82A 3FX3A 4I0BA 1BIBA 3T5XA 3L00A 4FT8A 4UXAA 4LA2A 4Q0PA 2DTRA 2IC1A 4XF0A 3T8TA 1H1IA 1A04A 1LDJA 3FMQA 1S6LA 3ROUA 2BGCA 4TLFA 3J7AO 4IHSA 2WTEA 2UXNA 4XFFA 1KGSA 1J58A 4YARA 2QNKA 4RGUA 5JFRA 4N0BA 1Y0UA 3OD0A 5BS6A 2MBFA 2LF8A 4U88A 1MDMA 1DGRA 1T0FA 3F6VA 1J1LA 2ZXJA 4UV9A 3LA7A 4BYYA 2IW5A 3SQNA 2DW4A 1H1MA 2KIMA 1U6GA 3R0JA 4RB0A 1ZHFA 3S7EA 2GXBA 5L3CA 1PM7A 1NHAA 2EA7A 1UPIA 4MNUA 4QM9A 2QZ8A 1FSEA 3SZPA 3M8EA 5HDGA 4META 1USSA 4IPAA 2D1VA 4I98B 3GWZA 4R8HA 5C8WA 5D5WB 3GVAA 3JTHA 1V4RA 3I0TA 3G3ZA 4H0EA 2FRHA 4MTDA 4UNOA 3V8LA 2PBIA 3H50A 1J3PA 3GBFA 1F9NA 4R79A 4L18B 2UYAA 4LB5A 1MKMA 2OZJA 5HI0A 2E7WA 2M45A 3F3XA 2GU9A 4EM1A 3C1DA 5FPZA 3GYHX 4BH9A 4L9JA 5EZWA 3LQRA 4G6QA 2HZTA 4L0ZB 4P55A 2STWA 4AQ2A 2FU4A 4JBAA 2Z33A 2XLFA 2IXIA 1HSJA 1J5YA 1LEAA 3KETA 4CZZA 1MZBA 3BJAA 4LULA 3DV8A 4PIYA 4XF4A 3DF8A 4QM8A 1P6RA 2V6CA 4J1XA 1HW5A 4UV8A 3ES4A 1KYWA 2F2EA 4KFCA 4I02A 3WTSC 2WC2A 5FPXA 3HT1A 4M71A 3EJKA 1R1TA 2LDUA 2FE3A 1R5HA 3H92A 3EYIA 1ZGAA 3QAHA 1W7PD 1SMYF 1BIAA 5I0RA 2G7UA 5JR7B 2HQNA 4P9FA 3TDUC 1P4XA 1BI3A 1IN6A 5FLHA 1D3YA 5D1IA 3LWFA 4E2SA 4N9HA 3NRVA 4L9TA 1R7JA 2GWRA 3U9GA 4G94A 3RIRA 5JAXA 4LTAA 5HDKA 2CGPA 2D2WA 2PQ8A 2QYOA 3QPTA 2D1HA 1IF1A 3ZMVA 3CDHA 3F6OA 3RJPA 1HKQA 5LRRA 1LRHA 3LAPA 3OCPA 3KLNA 2GA1A 3PLQA 1I1GA 2PQQA 4XFGA 2PLYA 2QBYB 4F8AA 1I5ZA 3BB6A 2JRTA 2C0ZA 1YQAA 5HOOA 3O14A 2GC0A 2JTVA 2STTA 3IHUA 2W84A 2CO5A 4I0AA 2KJCA 1YFYA 3EQEA 2GAUA 3UKNA 1J75A 1QGPA 3K9TA 1YG2A 1UCXA 3DQVC 1LR5A 4QLCU 1VR3A 2NS0A 2ZFWA 3F23A 4XETA 1R58A 5C6CA 1ZX5A 2P5KA 2CFXA 1TQMA 1BBYA 2F4PA 1U12A 1Q1HA 1XSVA 3C18A 2FEZA 1JGSA 4KWLA 2QVOA 4MTEA 4JK1X 5DEQA 5CU1A 3L7WA 1H9TA 3RKXA 1WWXA 2VT2A 2EA4A 4GXOA 2IA2A 2O8QA 1GQGA 1MJBA 4L9VA 2YSRA 5A2QZ 2PEXA 2IRFG 2OA4A 2RV8A 1ON1A 1FYMA 4ENNA 5BUVA 3ECHA 3COAC 3H1MA 1O4TA 2FSWA 1Z9CA 2RC4A 2ELHA 3HSEA 3ZMDA 1H0MA 2KKOA 3BROA 1Y3TA 1KU3A 1E2XA 1OPCA 3WTVC 1ZARA 2C6YA 2KIFA 3CJNA 3SXYA 2XASA 1FWZA 2COMA 3I54A 4IEWA 2Y0MA 3KGZA 3HHHA 3GYDA 1FOKA 2Z3YA 2OQRA 3EHKA 4QWQA 4A0ZA 3UKVA 3SCHA 2OD5A 3IBMA 1XMKA 1UD1A 2EK5A 2H94A 5FDBA 1WSUA 2PN6A 4ORFA 1X3UA 4HZFA 1FSHA 1OFNA 5BY5A 3WE3A 1F4KA 5E8GA 1IN8A 2M87A 5I8TA 4ESBA 1DPUA 1LDKB 2DU9A 3WW4A 5FD5A 4P96A 2H27A 4FX4A 2V79A 3M8FA 3TO6A 1RZ4A 3M3IA 1VTNC 4LK0F 3M1EA 2O0YA 3V8KA 2VC1A 3FFQA 3HIFA 1TTYA 4KMFA 2ESHA 3SXWA 1G3SA 4AIJA 1LNWA 5EFUA 3TNQA 1I1SA 1TW3A 3C3WA 4BQAA 4JQFA 3MZYA 2OPKA 2OQGA 3TOAA 3J80K 5CADA 4UVBA 4EGZA 5BPDA 1ZLKA 2XL9A 3RYKA 1QO0D 1ZG5A 2Y48A 4GCVA 4N9IA 3J81K 1QWRA 3CUOA 3V7SA 5FLXK 4OIOF 2J5PA 1FNNA 3I59B 3KCCA 3ZMUA 5J3UA 3FHIB 4HLTA 4QMAA 3LAGA 3SMHA 2RN7A 3DPLC 1S7AA 2Y0OA 5FO5A 2ISZA 4HA8A 3HYIA 3CUQA 2FBIA 4DNCA 3D0SA 4LUKA 5D5XB 5AVPA 3U11A 4HBNA 4KN7X 1ZZCA 5HLHA 1U8RA 5LGTA 1LJ9A 5DUKA 3IKTA 1KYZA 5DCMA 4Q29A 3E5XA 1SFXA 1I6XA 1RI7A 1S8NA 5D6EA 1R1VA 2XHKA 4FHTA 2VE8A 1ODDA 1R5GA 3E6DA 3QOPA 2XKPA 3KZYA 2EA2A 2DBBA 3KP3A 1OKRA 4HLXA 1IXRC 3RDIA 3BPVA 2CYYA 2CW0F 2BNMA 2N7GA 3WU0A 4Q4ZF 3SCFA 3CLPA 3O3KA 1ZZ9A 5JVTA 1YFHA 1XN7A 1MDMB 1FPQA 2HTJA 1J3RA 3K69A 3GFLA 3KMHA 1V70A 1D5VA 2HS5A 5D4SA 1CAXB 4LLLA 3BDDA 4MX3A 3CUQB 3M9AA 2IXCA 1GXQA 1Q5OA 1ZRDA 1R23A 2UZKA 2K4JA 4M9XA 5DCMB 2GC1A 4O9EA 2BEOA 4HDUA 3ECOA 4ZYEA 5JR3A 2BV6A 1BJAA 4ZU7A 1U5TC 5CVVA 1B9NA 1XMAA 2GC2A 1Z91A 1TQ5A 5E17F 5FQ0A 5D8KB 3KEOA 2LKPA 1YFUA 4HW0A 4EM2A 1ZREA 5JSPA 2XUBA 3S7IA 4JV4A 5FFXA 2A6HF 3PFIA 3QACA 3KSCA 5DD8A 2D5HA 3WGGA 3CO7C 3KP4A 4KWKA 1IPJA 1HSTA 2M8EA 2RVCA 3KFWX 5ED4A 3F22A 4MQ9F 1XGMA 3FM5A 4R52A 3E3VA 2PMUA 2XAJA 1ZH5A 4IEVA 1T38A 1FI2A 4BHCA 4ENKA 2MHFA 3WTZA 4OMYA 3K2ZA 1HKTA 3OOPA 2UY9A 3ABTA 3F8BA 3WW3A 2A68F 3C7JA 2IPQX 2UXXA 1B9MA 1FYKA 1ZVFA 4LG0B 1XE8A 3IRQA 1NXMA 1PDNC 3TNPB 3CTAA 4XBFA 1MJAA 4P5OA 1IXCA 5E18F 3V8JA 4RS8A 1WA4A 1KQ8A 1L0OC 5CVJA 4IEXA 4ZYHA 4EJTA 4EJUA 3EUHA 2O03A 3M7GA 1ZNPA 4B8XA 4G7ZF 5E1RA 5ILSA 4IJAA 3JSPA 2E7XA 3E5UA 2PAMA 4A5MA 1HW1A 1WKMA 4WK8F 4KU8A 5HS9A 1CF7A 4D0PA 2A5YB 2EV5A 1ZN2A 3MAJA 2IXKA 2XGXA 1CAVA 1CGPA 2E9QA 3I7DA 2VBXA 4G9YA 1MGTA 1PP7U 3ZMSA 1Y9QA 1W5TA 2DI3A 4O6JA 1UIJA 4A5NA 1ZZ8A 3K1NA 2XAFA 1UFMA 3KE2A 2R7FA 3U10A 5LRSA 5FLIA 5K5RA 2W25A 5FLXZ 2K02A 4ENMA 5E1XA 5L3GA 4UBHA 3BU7A 2PHDA 2YX4A 4HSLA 1ZZ7A 2VPVA 5JCTA 2VODA 1EPZA 4M6XA 1TNSA 3SZTA 1XE7A 1D8KA 1WLTA 3LAJA 1YHFA 2UWMA 3HRUA 4A0YA 2VBWA 1LVAA 4NB5A 4IEQA 4EVIA 4IERA 1TQPA 3PQJA 2VONA 1J7KA 1YW8A 3ZPLA 4Q47A 4AVCA 5ILVA 5ICEA 1J59A 2ZJ2A 1G6NA 4WBBA 5TJJA 1CAVB 4EROA 3H1YA 1QZYA 2GZWA 4RD7A 3TQNA 4E2QA 5ICCA 4AVPA 3MCZA 4KA4A 2UYBA 3CO2A 3FHZA 3M70A 3NVCA 2K0GA 5BV6A 1XGOA 3ZP5A 4KL1A 4IEOA 2P5VA 4KYWA 1QNTA 3RZZA 2F5DA 4HLYA 3FMSA 3UKTA 1QXRA 3MPBA 2VC0A 5EEGA 4YFNF 1K78A 2HOEA 2PA7A 2W85A 1YS6A 3EETA 1L3LA 2HEOA 1B59A 4B09A 2V1XA 2DK8A 2A61A 2HKXA 2JT1A 2CV6A 5I91A 3F72A 2DO7A 1DUXC 5EEHA 1JUHA 2HTSA 1YFWA 2FA5A 3WTUC 3D0JA 3CF6E 5ILUA 1TQIA 1LQ1A 2XAQA 5JHUA 4IEPA 3VB2A 5FLJA 2BE5F 4OIRF 2PFWA 2ESNA 2RQPA 1G3YA 1NE4A 4UVAA 5H20A 4ASNA 4YRDA 1E17A 1ZRFA 3DFGA 3SHFA 3JAMK 5J48A 4LLNA 2Q4SA 2PI0A 2R3SA 5D5VB 2VE9A 3F8FA 3NL1A 1Z6TA 2P7VB 2HFHA 5E16A 3ML6A 3RTRA 2ACJA 4LD5A 3ZQ7A 3ZN0A 4ZZDA 2O8XA 1ZGJA 2ZMEA 1DGWA 1ZG3A 2A6EF 2V9VA 1MD0A 2B5HA 4ZZLA 2L3DA 3L09A 2CAUA 3OGJA 5FFZA 3TGNA 2IT0A 2EFPA 1IXSB 5HS7A 1TNTA 4HF0A 5J8CA 1SFEA 4QGLA 2XROA 3BCWA 4XF3A 1JXSA 4G7HF 3F8MA 5AIQA 3WG9A 3MWMA 4G7OF 2PAEA 3B02A 2DT5A 3HOSA 4XSXF 4HVRA 4A12A 3ZN1A 3ES1A 1CAXA 2WWYA 4WXCA 2FNPA 4I2OA 3IL2A 2ADUA 2QLZA 1YFXA 2P6TA 3C3VA 3H7YA 1LEBA 1FP2A 4MQVA 2LF7A 2M1BA 4GYIA 3HUGA 3MDPA 4O9GA 1P4AA 1IN5A 2YX7A 3IDBB 3KP6A 2MPFA 4M72A 4U7BA 1UHWA 3FM3A 1Q43A 3GLXA 1CAUB 5LEKA 2XL7A 1UB9A 2BBYA 4IEZA 2DFIA 4HN1A 1NZCA 4Q5SF 4K8FA 5CVRA 1P92A 2K9ZA 3VEPA 3N4MA 1BOAA 1YWKA 2VOOA 3MYXA 4WXHA 3I5UA 3IRRA 1WI9A 4AD9A 2YU3A 4U0VA 3CLOA 5L3DA 2XIGA 1LB2A 2MA3A 4EJVA 3DN7A 2KRFA 2MLGA 4CHUA 1ONVA 1W7PB 3QU3A 2NNYA 2P7CB 1KQ9A 3KLOA 3HRTA 3VOEA 4Q0SA 4IETA 4CDGA 4DINB 4HX7A 1OI6A 3USSA 2QQBA 4RGXA 4FAHA 4HN0A 1ZLJA 3ETQA 1HXDA 2F5EA 2O6GE 2HWVA 2IP2A 4CO8A 1VJ2A 2ATFA 1SD5A 1KU9A 3RKWA 1XRUA 2NNNA 3RYPA 2PFBA 2QM3A 3FE5A 1GVJA 4XFIA 4OMZA 5E20A 1C0WA 2FNAA 4ENJA 1SQ4A 3V7RA 4MGRA 5KK1A 3IDCB 4NQWA 4I09A 1GXPA 3IKVA 5A2QK 3FWEA 4LA3A 2NAZA 4UBGA 2O1QA 3TO7A 4HV6A 5HLIA 3TKYA 3H3UA 5HS8A 3F8NA 5DCFA 3TOBA 3DPTA 2XLAA 4L5JA 4PCQA 1K7AA 1RTVA 3VODA 2OZUA 1SMTA 2GQQA 4U0WA 1RC6A 3DEUA 1YW9A 1BI2A 1STZA 1Z1DA 5KHIA 2OZ6A 5ICFA 2NYXA 2DCTA 3RI4A 2DK5A 4CXFA 2XKOA 1ZRCA 4FAGA 1OYIA 2VXZA 4CGZA 4A6DA 2EB7A 3L2HA 5I0SA 2P8TA 4M6YA 4PGGA 1GQHA 3S2WA 3F21A 1DP7P 4Z2YA 4XFHA 5CVIA 3EDPA 1ZZBA 3V7CA 2FOKA 2QQ9A 3QP5A 2QUFA 4EWDA 1Z05A 4ZYGA 1FXZA 5LHHA 4BNCA 3R60A 4HBLA 1K6OA 4IRIA 3IC7A 1SFNA 4KIFA 4CYDA 3ZMZA 3BZ6A 4YYOA 3WW1A 2QENA 1ZRRA 3VHRA 4RGSA 3OV8A 4AIHA 4HAMA 2JZYA 4IXAA 1O7LA 1WRJA 3IIAA 2XV4S 4QX5A 1IRFA 3NEUA 1U2WA 4XFBA 4OIQF 3I53A 2F5CA 3GEZA 4M9ZA 2QVSB 4P9UA 4KT5C 2IXHA 4BIFA 3RYRA 2L4AA 3PVBB 5KVRA 2FQPA 4F7ZA 4RAYA 3GF2A 2FQ3A 4EGYA 2K4BA 1I27A 1RGSA 5I0UA 3LWCA 5CLSA 2J5OA 1L3JA 4AVBA 4UUVA 1XGNA 1T6SA 4EMSA 2EV6A 2Z5UA 5BMZA 3ABUA 4RB1A 1EH6A 2ZKLA 4ZU5A 4LFUA 1T98A 2IVMA 2IJLA 4I3PA 5AONA 2QBYA 3OTFA 2HQRA 2V1UA 2K7LA 1WGPA 5K5OA 4PIXA 5BQTA 3OF1A 4ZH4F 1SFUA 4K2EA 4MEYF 1GHCA 4EWEA 1YTYA 2W24A 4HVOA 1J3QA 5D5UB 1FP1D 1FBUA 5K5QA 4A2UA 2HYGD 4PZJA 5LHGA 3CUQC 5F6FA 4HMZA 1D8JA 3FZVA 1BC8C 2Q2EA 3ULQB 2EFQA 5LHIA 2IXJA 4X6RB 5JI6A 1QXJA 2QDRA 1O5LA 1P2FA 4KWJA 4QGMA 3G7DA 3KZZA 2D93A 2XAHA 2TDXA 2EFWA 3HSRA 4KUMA 3EYYA 4AVAA 1HKSA 4HX8A 1SD7A 3R6SA 2Y75A 3QU6A 5FD6A 5D8LB 3B73A 4OINF 3R0AA 3WTWC 2VN2A 3G73A 2NRAC 4Q0VA 1FX7A 4IEUA 3JZVA 4Q0QA 2L02A 1Z6RA 5H6RA 3ELKA 1W4MA 4HQMA 4YSFA 2VECA 4XLNF 4LJZF 3Q9VA 2CG4A 5ICGA 3JTGA 4OFGA 2PTMA 1T39A 4ONUA 3LA3A 3SFZA 3JSOA 2I45A 2P6SA 3LSTA 3R61A 2MLKA 3IWFA 2WV0A 1W5SA 4KU7A 3H3ZA 2Z69A 4RB3C 2HJIA 3LOIA 2ZCWA 1REPC 3LQQA 4L0YB 3SHRA 1ZAOA 4E70A 3BJ6A 1K78B 4HVQA 3DL3A 3P9IA 3MEXA 1Q3EA 1EV7A 2V09A 3FJSA 1NE6A 4CICA 3REOA 4XFCA 4UVCA 4EM0B 3Q9SA 4IESA 2Q1ZB 4P9GA 1HBXG 3J81Z 3I64A 5AIPA 1RUOA 2H6CA 4H7LA 3GUDA 2GH2A 1U5TB 5H6QA 4O5VA 4WVZA 3LA2A 4IRHA 1USTA 2YPRA 2P5LC 5E8IA 4WXDA 1RUNA 2H09A 4XF1A 1VP6A 1FBQA 2QQAA 2MH2A 3BPZA 4EV0A 1XGSA 3BOQA 2CWEA 1QPMA 4IHTA 1DZRA 2HYFA 1KQ0A 1V3FA 3HOTA 1XD7A 2Z2SB 2XLGA 3V4GA 1EP0A 2ZMEB 1YLLA 5KHGA 4S04A 2GC3A 4NVPA 1HQCA 3WU1B 2BNNA 1YIOA 5TRDA 4HQEA 5FCCA 1X8MA 1CAWA 4RB2C 4PJYA 1EYBA 3BWGA 4MGKE 5IT9Z 3GFIA 1IRGA 4ZYDA 5LEJA 1FT9A 3I71A 3Q5FA 4JTOA 3I59A 1ON2A 3IWZA 4YFKF 3NW4A 3HTSB 2EVXA 4UHTA 3NJZA 1OMIA 1RL3A 4OOIA 2D40A 3LZZA 4AQ6A 2KJBA 1KU2A 2VT3A 2VQAA 2YR2A 2JSCA 2K86A 4M74A 3HRSA 4HYEA 1UCRA 4XFAA 2P4WA 1XB4A 1XDUA 1K79A 3T1BA 1BC7C 4Y17A 2RGVA 5HDNA 2PAKA 4MHGA 3GXOA 3GX4X 3CEWA 4LB6B 2RDPA 3LFKA 3DP7A 3KP7A 3E6CC 4HOBA 3MFKA 4GO1A 2XAGA 4MV2A 3TDZC 3VFZA 1FBSA 1O3SA 4G6DA 1T2KA 3D5LA 2DAOA 1TLHB 1OR7A 4M73A 5DDGA 1IW7F 4EJOA 4ESJA 1U78A 5FGMA 4O3MA 2QCSB 2FBKA 2GXGA 2K27A 4KIBA 2ET1A 1XCBA 5L3BA 5LGNA 3HQXA 3SCGA 3T0YA 3K1PA 2X0LA 4EWAA 4XLPF 2ZNZA 2EWNA 5CYVA 1TBXA 4Y13A 2E1NA 4PIZA 4HF2A 1R1UA 2Z99A 3E97A 2W57A 1W7PA 4XSZF 5FB2A 3WGHA 4IEYA 1B4AA 3ERED 4WX9A 5D4RA 4L2NA 2PJPA 4XEZA 4X6QB 3L2CA 2EAAA 1OYWA 2ZNYA 2MD5A 4R1HA 4B29A 3GZ5A 4Y15A 1IAWA 1SAXA 5LLQA 5BOXA 1G3TA 1AOYA 5JSRA 5HLGA 4S05A 2H0VA 1NYWA 1F1ZA 3PQKA 2KIUA 4GGGA 4KN4X 1S29A 5I8YA 4XRFA 4XF9A 2H6BA 4EQQA 1KU7A 2ISYA 1BI1A 3JAMZ 4EJWA 4KMUX 4I01A 5FQ0B 1ULYA 4JTNA 5JSOA 4LMYA 4A6EA 2DQLA 5L3EA 1P4WA 2OBPA 3JW4A 3E6BA 1J2XA 4I7HA 4D7SA 1UW8A 1DDNA
chains in the Genus database with same CATH superfamily
5E1ZB 3N97A 4CP2A 3WTTC 4XLHA 4DUWA 1R093 3I4MJ 2QA4I 4A3GJ 3W2VA 1DGWX 2BTVC 2X5IB 2WB1A 3LSEA 2DA4A 3CCMI 2Q30A 3MKLA 5I93A 3H9AA 1RRJA 5ACA3 1IKPA 2KQRA 2YZ4A 5ANNA 2K85A 1F5JA 2QJVA 4G8XA 2NQYA 1QQIA 4TV7A 1HF0A 4QPOA 4AW7A 1UY0A 4D7TA 3WTXC 4QXKA 5A70A 1MJ9A 1XDSA 2EPFA 4AXOA 2X4HA 2RS52 2VCMA 1HW2A 1SFPA 1IN7A 1YYVA 5K8SA 4C30A 1H9GA 5IK5A 3RMXA 4D7NA 3EXUA 3ME2A 3TW7A 2ZKNA 4MGTA 5L3FA 2K9MA 5A1FA 5CISA 1E5SA 1DBNA 5KHHA 2P5BA 2CSGA 2PHRA 2DYRH 1LDDA 5IOZA 4HRIA 1SEUA 2WLPA 1QBJA 2F5FA 4FBFA 4BY7J 5KBFA 1SDWA 1YS7A 3BJOA 3KGLA 1AL21 4U36A 2MH9A 5D6FA 1IS5A 5GAHJ 2FDHA 1K4TA 3DXUA 5F2WA 5A7QA 3WY6A 5GALA 1AR73 2I74A 1X8EA 1JUMA 1OJLA 2PHTA 3P7NA 2ZHNA 1Z3XA 4XOTA 4RLFA 2JPCA 3BR5A 5IAVA 2JEMA 3ZMTA 4KIGA 5F5AA 1MBEA 3N05A 3OSDA 3K3OA 1ZELA 1SLLA 4TZDA 1R1A2 4FX0A 5HV4A 4CXWA 3VSKA 1FTTA 1DZTA 1VPHA 2ZO4A 2VQ0A 4LMFA 1POV1 2QSFX 2JQ7A 5CZKA 3H5RA 1PK6B 1YC61 1FTZA 3BTIA 1X7NA 1QHGA 5E3MA 1Q1VA 3DXJF 2R5ZB 2F6BA 3KVAA 4YIFA 2WFPA 2B9UA 4QPIA 2L01A 2VOTA 1OD5A 1YX5A 2W39A 4MIMA 2E1MC 2WINB 1W5CC 4HDVA 4E4ZA 4BAYA 4EQVA 1V9U2 5LGUA 3M4FA 4M3CF 2WJSA 1SDDB 2XRNA 4KBZA 5CFDB 2PYTA 1FIAA 3TRSB 2QQWA 3R0RA 2D5FA 1UELB 2PHLA 5KC6A 1B72B 3LEKA 4DY5A 4BXXJ 1XSXA 3FC0A 4JGYA 4RHV3 1LOGA 1R36A 3EO6A 4BDYA 1Y9GA 4UOJA 1V0AA 4LR4A 5B2GB 3IV5A 1SD4A 1RKTA 3QYEA 1QOSA 1W8NA 4ON0A 1ULGA 3KT4A 1JZ6A 4IRGA 3TL4X 2WS93 5F1RA 1IPKA 1H1AA 2CAVA 5GLUA 3VV1A 1ZZ6A 4FOWA 4LKSA 2QQPA 3AP4A 2KXLA 2Z9OA 3S0MA 4N43A 2F5VA 2BUKA 1RUC3 2UV1A 4Q1PA 4K9SA 3T8RA 4YNIA 1EV11 4RHV2 4PDKA 1FYLA 2VBBA 3T2TA 4CEWA 3DEMA 3HNBM 4NNJA 2IWGB 1RUF1 4GULA 4YZ3A 2ZKZA 4CDXA 5J7MA 2R061 1VALA 2QWWA 4J00A 5KHJA 5CKQA 2GA2A 5FKLA 4Q1RA 4CU8A 3EYPA 4QXCA 4YW2A 5FYIA 5JMOA 3M3YJ 1ZR4A 3O0XA 2VVDA 5KCMA 4U0YA 3MW4A 4PJLA 1PMIA 2QEXI 3S14J 2MW8A 2WQ8A 2W5FA 1FC3A 3JD71 2EV0A 3SLIA 2Q0AA 5JZGA 3FF5A 3OEBA 2NZ9A 3RNSA 1UX6A 2JDHA 3LSIA 2DQRA 2CSOA 4KBBA 2WYFA 4JVAA 4HNUA 2RQQA 1NCRC 3U75A 1W36D 1RUE1 3I2JA 3R4KA 2EIJH 2L54A 1JE8A 2HKOA 1RNLA 2XONA 3HDDA 3ACLA 2NN8A 3HOVJ 1JZ4A 1AL0G 3J4UH 4XKVA 5IJRA 2HOSA 1QA6A 3WVJA 3G6JB 4BQ2A 2VVEA 2MG4A 5APAA 4M9SA 5EIYB 3J8F1 3DU5A 5CJ9A 4YG2F 1JHHA 4QX0A 2F4MB 2J7MA 4MUVA 4DO0A 1QJY1 2V1NA 4BE1A 2LNBA 2BHYA 3FX3A 1W39A 4F93B 1R1ZA 3T5XA 4UXAA 2DTRA 4XF0A 3T8TA 2B39A 3AL6A 4K1YA 1J09A 1LDJA 2HPMA 1WJDA 1GNZA 3PJYA 2IS2A 4FQ4A 2ADDA 4XFFA 3WQ1A 1OOPA 1J58A 2HWC2 4FPYA 3ENRA 1Y0UA 3OD0A 4FPHA 3NWSA 1X3ZB 5IK7A 2LF8A 3F6VA 1O4XA 1J1LA 1PGSA 3K77A 3P5JA 4QU2A 3CDZB 3FK7A 4UV9A 1UZZA 2QZ2A 2LY9A 1JTYA 2DW4A 3POYA 4E4HA 5EJCA 1PIV2 1AJOA 1ZHFA 2D98A 5A3PA 1N3QA 3B93A 1HCRA 2EA7A 4XURA 1UPIA 4QM9A 3SZPA 3DWLE 4HEA2 4QXBA 2ARBA 4CXYA 2UUZA 4LKDA 2WZR1 3CJIA 4R8HA 4A3JJ 2Y30A 4XOGA 3I0TA 4FFIA 4QX1A 3V8LA 2PBIA 1YJKA 1F9NA 4R79A 2AH2A 4MSVA 3POSA 1N25A 2E7WA 1N1TA 2R16A 4EM1A 5LBFA 1FV2A 1MBFA 4P9YA 3T4HB 1UG2A 4COYA 5EZWA 3LQRA 3BTAA 4G6QA 4AQTA 2HZTA 3DBLB 3BCBA 2WT2A 2W2IA 2M0CA 1JH5A 2Y64A 5C3RA 3I3MA 1IQAA 2FU4A 3E0JB 3UNPA 4FE4A 3QODA 1YIPA 4ZXKA 1LEAA 3DCFA 2RHPA 1TC3C 1Z78A 2JX9A 2YYOA 2VULA 4XF4A 3K46A 1PJRA 1UOFA 2ZZQA 4UV8A 3GTQJ 4RR3B 4I02A 1UOGA 2A3WA 5FPXA 3EJKA 1R1TA 4BISA 4R4XA 4YZ1A 2LW8A 3WNOA 3H5NA 2ID4A 3H92A 2PMWB 5DAQA 3ZYGA 3EYIA 1RKWA 3SFIA 4NAMA 2ZGPA 2NXNB 1NOVA 2D6PA 5JR7B 2R5ZA 5EWSA 1GWKA 3MKYB 1IN6A 2V26A 5EQUA 4RAFA 2CY6A 3NRVA 2XVGA 4Q4X3 3U9GA 5GAEJ 4ZS3A 4AI8A 4Y1YA 5HXVA 1U0JA 4Y3OA 4LTAA 5GAGJ 5HDKA 2CGPA 2PQ8A 2NOJB 5E8AA 1ZBE1 1V5FA 5BNNA 2DXIA 5C5UA 5HBAA 1VBB2 4XRMA 5LRRA 1OLME 3GHNA 3OCPA 3KLNA 3PLQA 3RZHA 4QQLA 2PLYA 3VBHC 1K45A 1I5ZA 4QWNA 3BB6A 1ZBE3 2JRTA 2C0ZA 5HOOA 2JTVA 3IHUA 5H9QA 2Q2EB 1CPNA 1YFYA 5K7HA 2BRTA 3DGTA 3EQEA 2WA3A 2GOXB 2QQ8A 2GAUA 2QSHX 2CU7A 3PTYA 4BJ5C 4Q4V3 2E7QA 4CYCA 4DEQA 3DQVC 1CJDA 1LR5A 2BU9A 2NS0A 2GN7A 4S2FA 4XETA 4O65A 2OVUA 3SJMA 3NV3A 5T5LA 1BBYA 2F4PA 5CKMA 1WMDA 1XS9A 5DEQA 1APLC 3FLTA 3P1IA 1YQ2A 4XXAA 3L7WA 1H9TA 3RJ2X 1XQNA 4A3DJ 3K4DA 4XXPA 2EA4A 4GXOA 3UGHA 3RWKX 1GQGA 2QCOA 2DUQA 2CGOA 1FPN3 2OA4A 1H4GA 5FZ6A 2VNRA 2VZ3A 3TN93 1E5IA 4A93J 2WRAA 1RUH3 5BUVA 2KR2A 4UUSB 5CKNA 4GWIA 3OYHA 4KITB 1MSEC 4OZOA 1X33A 1UY3A 3HSEA 4BE3A 5F08A 3CCVI 1OPCA 3HOBA 1ASJ1 4PI2A 1AR62 4ZC3A 3CJIC 3VBUC 2AQFA 4Q26A 2GP5A 3C7EA 5C9AB 1FOKA 4IE7A 2OQRA 4K20A 5KAFC 4A0ZA 3DTKA 3IBMA 4AHYA 2WY7Q 1RIRA 1JJ8C 3KV4A 1Y7BA 1EAH1 3A4UA 1PZ8A 1HN1A 3QD6A 1A5JA 1RINA 3AL5A 2ZPXA 3AZZA 2CUJA 3KVBA 1WWYA 2VXDA 4F3QA 3A01B 1IN8A 4RQPB 5I8TA 5IAXA 3T0BA 1NX9A 4QB2A 1GWLA 4P96A 2VUMJ 4AQSA 4FX4A 3N9NA 1GMMA 1TME1 2HPIA 4LK0F 5A33B 2ZGLA 3IUOA 2VC1A 3FFQA 3HIFA 4M3FA 1T8IA 1RMU1 2ESHA 3VBOC 4GQ7A 1VMJA 5DXDA 1LJ7A 2ZGOA 2IZWA 1TMF1 4AIJA 2F6CA 1PNGA 4IV1C 4MO3M 1I1SA 4COUA 1RMU2 4Q4W3 1AR92 1TW3A 2AQEA 2M2EA 1YJ9I 3J80K 2G0EA 2ZHKA 1HLCA 4XL9A 3BTYA 4BQXA 3PO2J 3J81K 3BR1A 4M4PA 5FLXK 3S17J 2HWB3 1FNNA 3I59B 1WJAA 3VD3A 3RQ0A 2E26A 1KDKA 1SLCA 4QMAA 2R5YA 1OOPB 3SMHA 2HZDA 2D7FA 4P9LA 1S0JA 3KHBA 4P5YA 3PUSA 2Q8CA 4ABZA 5FPBA 5ACA1 5D8AC 1HJGA 2RDNA 3RS6A 4FXGB 5AVPA 1REDA 2DBIA 2P81A 2YUSA 5LGTA 1GLHA 2JWTA 4E7KA 1PK6C 2ZS6B 5D6EA 4FHTA 2VE8A 1ODDA 1R5GA 1LE8A 1UX7A 4CP9A 2EA2A 2DBBA 3KP3A 4JX6A 1BXHA 1RUE3 3AZYA 1ETOA 1VQPI 1LUJB 1QU0A 4YM1A 1UY4A 2EQRA 4KWUA 2BNMA 5CFDC 5F3CA 3D3AA 4URAA 3WU0A 3O3KA 3NNMA 1PUFA 1QKQA 5J09A 3WG2A 2HBTA 1S0DA 1YFHA 1I3QJ 4YW4A 3QYBA 1MDMB 4A3LJ 4G4FA 3KMHA 3PVEA 1GLNA 1V70A 2XGDA 3A22A 1UU4A 4OCTA 1CAXB 3NWTA 2Q8OA 4MX3A 3I3DA 1QNYA 2IXCA 3O1UA 1GXQA 1Z21A 1ZRDA 2ELJA 1H2LA 3A2KA 1SPPA 2DOEA 4FPCA 1O4ZA 2YBSA 4PLOA 4ZYEA 3ZYJB 1BJAA 3X2QH 5FY8A 1SFOJ 1R4MB 5IW0A 2BOIA 5H9PA 5T54A 4Q2FA 2R7XA 5E17F 5FQ0A 2P2KA 4ES8A 3GF6A 4K1ZA 3BTLA 3WT3A 1ZREA 5JSPA 5FKMA 5A3UA 1QH7A 4JV4A 5FFXA 4NC6A 2A6HF 3PFIA 5FMDA 5FZKA 4CRQA 2EH3A 3L2WA 2VJXA 1RPWA 3CO7C 2PXJA 1RUF2 2VLAA 4YVWB 1DZQA 4UW4A 2M8EA 2RVCA 3KFWX 4MQ9F 5FZIA 2BBAA 1ZH5A 5D8AB 1WCMJ 4GMP3 1K5MA 1E5RA 5JHFA 2R7EB 4Y1XA 2CQXA 3WTZA 2VE1A 1HKTA 1KRIA 3G2BA 4JP0A 4I0WB 5J40A 3O0WA 4Y22B 4PI0A 1D4VB 3ON7A 3GHMA 1LGBA 4A4AA 2JDZA 3KZ4C 4LG0B 4BEHB 1OHFA 2DURA 3IRQA 1NXMA 4ATEA 2ZHMA 1MJAA 1RB8G 2XVKA 3MGUA 3PUQA 1TE1B 4RS8A 3O1TA 2D43A 2WQ4A 1JOPA 1KQ8A 3HEFA 1W9TA 5CVJA 3VDXA 4IEXA 4EJTA 2HWF3 4M4RA 1NCQB 1NQJA 4B8XA 2DMUA 4G7ZF 3PUIA 4IUGA 4IJAA 3JSPA 3KCYA 1OKQA 3PJRA 3B7MA 5HS9A 3GBGA 2CMPA 5E89A 2EV5A 1X58A 2E71A 3MAJA 1R091 2IXKA 3WQBA 2HXIA 2XJRA 4AEKA 2EBIA 1R083 5FYTA 4R9BA 3JQXA 1UIJA 4A5NA 3BG9A 1PYVA 3K1NA 2L7ZA 1ETKA 2YBPA 1UFMA 3KE2A 3S3OA 2MYSA 4P9WA 3AC0A 5C9AA 2K02A 3D1NI 4ENMA 1PVC2 4UFHA 5L3GA 1ODNA 3K3NA 2YX4A 1ZZ7A 2YS9A 3BIWE 2ZGKA 3SZTA 1X4PA 3I56I 1D8KA 4JQRA 1UMHA 1YHFA 3THCA 3HRUA 2RR11 5JVGF 4NB5A 2DU0A 3POGA 1F4HA 1SHWB 1VAMA 4AVCA 4E8CA 2ZJ2A 2OW4A 3NV1A 4M3EA 3DPRA 2E7AA 2X05A 3MIDA 1CPMA 5ICCA 3NVCA 1S0IA 5J1YA 1VBD1 1MMAA 2XJTA 3FMSA 3UKTA 1LKXA 2XF6A 1JXNA 3CMMA 2HOEA 1B59A 3IP4B 1A31A 4BUPA 3Q0WA 3GCXA 4QDQA 2A61A 1TNFA 4Y24A 4LBQB 1PO11 1ZM1A 4AOCA 1L7LA 4XKCA 4HETA 5KXEA 1H8TB 2OXBA 1W8FA 4NROA 5JZGC 4MYEA 3D0JA 3CF6E 2LOOA 2HVSA 3VB2A 3BN6A 3PSFA 4IQPA 3VBFB 2VB6A 2RQPA 2YGMA 1E3OC 2JN6A 4YRDA 2Y6HA 2AENA 3WDXA 3SZGA 2DJNA 5F7UA 3E1F1 2R3SA 2VE9A 1RUI2 1W05A 5CPRB 2HFHA 3ML6A 3RTRA 4P08A 1W2AX 2Y31A 3W3CA 4CP9B 3GM8A 3ZN0A 4ZZDA 4A3EJ 3ZYPA 3PIOF 1UN1A 2V9VA 1OCCH 3D5SC 3OGJA 1C4RA 2RDQA 1OPOA 4BQOA 2ZJQF 2ZBJA 2EFPA 2DMPA 2VKEA 4ASLA 1C8M2 1C8NA 2X09A 4DPNA 5J8CA 5L7OC 1UMZA 1HN0A 5AIQA 2PAEA 2XBO2 2RJ2A 4XSXF 1SLTA 1PNFA 3ZN1A 2ZGNA 1CAXA 5LWBA 4GA9A 2ADUA 4XVHA 2VZRA 1Q8SA 3PIJA 4PDWB 4MQVA 3HUGA 4NRPA 3N36A 2MFZA 1P4AA 2VUCA 2MPFA 5CFCC 4BXSV 1UHWA 3F95A 1Q43A 4BJTA 2ZXWH 4HN1A 2DFIA 1BQPA 2HWE2 2DDBA 3FLPA 2J1SA 4HPQA 3H9JA 1SAUA 4LHKA 2K9ZA 1GUIA 4YW5A 3KT1A 2VOOA 4OAYA 3I5UA 2GNMA 4XBLA 1WI9A 1WCDJ 3AM2A 1S7EA 1OLMA 5HODA 3CLOA 1R1A3 2MA3A 3BQZA 1Q8OA 3HGGA 2KRFA 1W7PB 3QU3A 1DCSA 2JVHA 3KLOA 4Q0SA 2TUNA 1OI6A 5KNLA 3USSA 5M3FJ 3AKQA 4M3CE 4AG4A 3JRHA 2O6GE 1QJX3 2IP2A 5JDBA 2RNGA 4CO8A 3OIQA 3Q9OA 4PFOA 4UUTA 1VQ9I 1KU9A 3K4ZA 2QQMA 4XFIA 2DA1A 3GTMJ 5F9TA 4ENJA 5KK1A 1QOOA 3A4CA 4I09A 2KMUA 3IKVA 5E6HA 3VDAA 5J1XA 3CJIB 4NR1A 2PQSA 2G19A 2OTJI 3TKYA 5DCFA 5LD2C 4IHWA 1K7AA 2CWMA 2PLV3 5A6XA 4XCBA 3GZTB 3OMYA 1MMGA 5C3OA 4WVMA 1P9QC 3VYSB 1W0UA 1QQP1 1SMTA 2WNVC 3DEUA 1PMHX 1RUG2 1YW9A 1GP4A 2XUMA 2OZ6A 5ICFA 3RI4A 5A7WB 3RZJA 4XAAA 2DTWA 3O1OA 1GZTA 4L8QA 1V54H 2OCCH 4PBOA 2DMQA 3OPTA 4YFWA 4DUVA 2WBMA 2W52A 2DTYA 5A32A 2OX0A 2FMDA 4PCRA 3A0NA 3DEWA 4AYUA 2P6HA 1KDMA 1U5IA 3F21A 1AYM1 4N8MA 1DP7P 2I10A 5CVIA 4COVA 3ILNA 1RUH1 1LU1A 3UJQA 1MEC2 4XJ8A 3PNYA 3UV9A 4E6KG 5LHHA 4BNCA 1FXZA 2VI6A 3R60A 1K6OA 5EV7A 1AX0A 2WZEA 4Z1VA 3HZJA 4K7JA 5C3PA 4KIFA 3WW1A 2QENA 4EATA 4QPIC 3ZFFB 1QJU2 4HAMA 4IXAA 1O7LA 1WRJA 1X9TA 4AFMA 3C2BA 3NEUA 1JU4A 3WP3A 3GEZA 4M9ZA 4MHRA 3LDBA 5FZMA 3ZQQA 2IXHA 3RYRA 3PVBB 3D4KA 1NK3P 4QD2A 2ARAA 1W2NA 2DCEA 4W6WA 5FR3A 4AVBA 1QJU1 5HNHA 4CCMA 1XGNA 4BE0A 2F4OB 4EMSA 1J1TA 1X2MA 2Z5UA 4JGYC 1H9PA 3IDAA 5FZDA 4LFUA 1T98A 3W2WA 5E88A 2IJLA 2GIZA 3J7YJ 1V6LA 2V1UA 1DQ1A 4PIXA 3OYCA 3SQOA 1HRI1 3H3LA 3OF1A 4ZH4F 2HWE1 4HVOA 2B7YA 3OYWB 1B8IA 1EPWA 1J3QA 1JZ7A 1F43A 1FBUA 3NAUA 3CUQC 2IUWA 2ORZA 5FZGA 4IE0A 3BG5A 1O5LA 3ABMH 3G6EI 1SBFA 4KWJA 2R072 1CQTA 2TDXA 4V2FA 2FD5A 3HSRA 4JKKA 4IGOA 2BW3B 3QU6A 1IS3A 4BU2A 3LPGA 2EIKH 3R0AA 3WTWC 1HC8A 2VN2A 3G73A 2YMZA 3DYPA 5H2FC 3LMMA 1FOD2 4Q0QA 3ELKA 4S2GA 2WY8Q 3THDA 4YSFA 4Z6YA 4XLNF 4LJZF 3Q9VA 3JTGA 4OFGA 3OS1A 3LA3A 3SKVA 5JPNB 1U9OA 3LOBA 4PJ0C 1ETWA 5FYZA 3H3ZA 3FL7A 2QKLB 4GB33 3LQQA 1W0OA 2WNUA 1W99A 4E70A 4AFDA 1FX5A 1OQEA 4ZHNA 1PO22 3KCXA 3I3EA 3KB5A 1GZWB 5IYBJ 4CICA 2RREA 4CE8A 2RJKA 1B35B 1WZXA 5FXXA 4B48A 2GMPA 3J81Z 5C71A 4W6XA 1AR63 2Z16A 2C24A 1RUOA 2JVGA 4DXRA 2GH2A 4RQPA 3M8LA 4G9SB 3POJA 5H6QA 3LA2A 3ZVXA 1RXGA 1OURA 4V2WA 2AACA 4LBKA 4L99A 5C5TA 2YPRA 1IS4A 4WXDA 4NHMA 2IVJA 4NO4A 3H9GA 4LO5B 3ZIXA 4XF1A 4FFGA 3AMHA 4XUPA 4XN0A 2MH2A 4V1PA 3LSPA 4P5HA 4IHTA 3BIEA 5T5OA 3SITA 5GLZA 2E2JJ 4E7JA 2VXRA 1XD7A 2FCTA 2Z2SB 2XLGA 5IVJA 5FUIA 3MUY1 3UR3C 1HRV2 4LIUA 1SFYA 3WU1B 3T1LA 4G12A 5FCCA 1QRYA 3OYLA 2E6VA 4BBRJ 3BWGA 2ZX4A 4UYBA 2WWUA 2XF7A 1IRGA 2VUAA 3ABKH 2KFDA 2JG8A 3Q5FA 4JTOA 3ZYHA 3ZXKA 1MZFA 4JGZB 4XUNA 2EVXA 1G9AA 3J7AY 1OMIA 4DOUA 2HEVF 4AQ6A 5F3GA 2KJBA 1KU2A 3AP7A 3M3EA 3APBA 2COBA 1M4WA 5IUQA 5FROA 2KHMA 1OH3A 5DTDA 1BC7C 2WABA 3BYWA 1IG7A 1RUG3 3GX4X 4BQWA 1YRNB 3C8XA 1XPWA 3VFZA 1BVP1 3OYFA 2A5ZA 1UOBA 1W0PA 1Q8PA 3WHTA 1A6IA 2DAOA 1TLHB 1UPSA 3UK9A 4QSHA 2JKBA 4AEDA 4CDUC 1ND2B 4WM7A 5IYDJ 3OBTA 2GXGA 2FDFA 1SBEA 1DU6A 2ET1A 1SANA 2E31A 1OCTC 4XLPF 5CYVA 1TBXA 5E3NA 4WV8A 2Y0SN 2Z99A 5IVCA 4OULA 1WJFA 2ZMEC 5A7WA 2CUZA 1B4AA 3TEZA 2PJPA 3P3NA 4FPGA 3MD2A 2EAAA 2ZA9A 2V6EA 2WO3A 4B29A 3H5AA 3B6AA 4AE2A 3GZ5A 2GBYA 5A32B 4B7EA 1I6HJ 5LLQA 1ULEA 1G3TA 3CDIA 4S05A 4D6QA 5KXBA 5CEHA 2H8RA 2CNAA 3ZPOA 4XRFA 1YJWI 4Y4YA 2H6BA 1KU7A 4Y20A 1QDCA 1E3HA 3A03A 1XNDA 5D21A 1LOEA 2RG4A 5DAWA 5DMYA 5GLVA 4DJAA 4D9JA 1F8VA 4D0QA 5JSOA 4YVSC 2DQLA 5L3EA 1B35C 2ECCA 2OBPA 1T08B 3V0AB 1LOAA 4I7HA 4D7SA 1HQNA 2OC6A 3QPHA 3ONQA 4YZ4A 1XSDA 1W3XA 3JRCA 4WZCA 1S2BA 1W8TA 1OFSA 1O7FA 5LA1A 3POWA 2WSVA 4DQ2A 1LULA 1RIOH 2M5WA 2VBZA 1ZYRF 4LBNA 2O3FA 1MZ5A 3THPA 2DT6A 3KQ4B 1UY1A 1IDZA 3S57A 1LESA 2BOJA 3W6JB 3ASOH 4CEYB 3GW2A 1R00A 3AZWA 4Y5TA 3LSDA 2Q8EA 1WA6X 2FMYA 3OWTA 4Y22A 1PVXA 1LOCA 2LALA 2ZBKA 1XYOA 4DYQA 5FYCA 1WQ2A 1G86A 2FXAA 1DYPA 3HM5A 2R7TA 3I49A 2YFUA 1YI9A 2AXLA 2B8MA 2X9DA 1BL0A 1O5UA 3L9JT 4AVVA 5DUIA 3WE2A 3BTXA 1UIKA 1NCRB 2Q0OA 2A71A 4QPIB 1SCRA 4CCLA 2UY8A 5FRNA 2W82A 1PO13 3UL2A 3WR0A 2AYHA 1ND2C 3CCQI 4FTHA 4YIIA 3S6PA 2XOMA 1GDTA 5K7ZA 1H6XA 2E19A 2JA2A 1CF7B 4L11A 3U1DA 4N4OB 1VQ6I 3K2OA 2AS5F 1ETYA 2DOFA 2FF4A 1VBC1 3T3YA 2MEV1 4FFHA 2WBKA 3BT9A 4HX4A 4YW3A 4UXNA 2XPWA 2JA5J 1AYN1 1DQ4A 5FKOA 2CL2A 2CDPA 1EH8A 1ND3A 4B43A 1UU6A 1B6AA 3HT2A 2X29A 3MLJA 1BEV1 3E6MA 1YRZA 4C0BA 5T3NA 4IF4A 5IT9K 4D6RA 2VM9A 2OU2A 3WQ7A 3K0LA 4LO6B 1IUYA 1JHFA 4NHJA 4U7DA 1FMD1 3NSTA 5F5IA 3FMRA 2DMTA 3ELNA 4E4SA 1QOTA 1U5TA 3AL0B 5LA2A 4KDPA 2DPDA 2R1BA 2EINH 1GBGA 1WD3A 4A0XA 2WB1N 2F4IA 1O3RA 1WCSA 5LY1A 3WF0A 3OYGA 5JWPA 1VBA3 1PO12 4MEXF 4YFXF 3RZGA 4JKLA 1IN4A 3MHZA 4BCUA 3Q3SA 4QQHA 5L19A 4OLLA 5C4WA 3HTUA 2Q8KA 4AEMA 1A6CA 3I2HA 4BS9A 2D6KA 1VRH2 2R93J 3EMRA 4LQRA 1AR72 5K1YA 3E7LA 1CAWB 4D5FA 4RGAA 4PT6A 2VCAA 1AWCA 2LY1A 5F37A 3WP6A 2YPDA 3VBOB 4XMYA 3M1HA 2WT0A 1Z7LA 4CVUA 1WMXA 3PUFA 3L9FA 4RGRA 4ESFA 1O3TA 4BQNA 1N3OA 4OHWA 2Y8KA 4OIPF 1Z0HA 3TO9A 1C5IA 4OI0A 3ILFA 3DU6A 3CJRB 3DKWA 2G7HA 5DD4A 1F5TA 3K1MA 2E1CA 2OF7A 4AHWA 4IZZA 4LBMA 2VQUA 1XX5A 3H7JA 2LD5A 2LKXA 1VAVA 2BGOA 3B6CA 2FX0A 1RR8C 4Q4Y3 5DDJ3 2R7ZJ 3G1OA 2R7VA 1AR61 4LGWA 3AXDA 3AKRA 1IZ1A 1W6PA 4UW6A 4BGDA 1N1SA 2PG4A 2XAUA 1DU0A 1LFPA 4MGZE 5BXXA 2FBEA 1D4M3 1OFCX 1CVNA 2R7QA 4UFIA 4L5IA 1VE0A 2A3SA 5ERLA 1Q8VA 4BHBA 5EPAA 4B4PA 2ARCA 3Q0VA 1KFUL 4DZGA 1NXD1 2JXAA 5FMOL 4Q48A 3T0AA 3MQ0A 2FMLA 5AC93 1Y9MA 3ABZA 1B1BA 3OPZA 1F36A 3S3MA 3GZ6A 2MC3A 5FZAA 4RM2A 2R7UA 1EAH3 4Y20B 5G05L 3RQ4A 4WM8B 2OIIA 2XVLA 2ZX0A 4FVVA 4ETSA 3TEXA 3MICA 1YO5C 4K3UA 4NWWA 1MMNA 1F9KA 1H2KA 1IO2A 3SH4A 2V1DA 3NNGA 2XWBB 3V0AA 4OUMA 5L7OA 4B3XA 3CMAI 3R05A 4N7UA 2VOKA 1VBB1 1TL8A 1H1IA 3DKXA 1MVEA 1BCXA 1S6LA 2EAKA 5B4XA 1RC9A 4YZ5A 2Z5WA 2C9AA 4RGUA 4BOWA 5T5PA 5IK8A 4U88A 1DGRA 2ZXJA 4CEYA 1URXA 4N7IA 4FOQA 4BYYA 2EZKA 4CUGA 3SQNA 2ZFUA 3BOPA 2B63J 3NWKA 4CDQC 2WDBA 2WWSA 3S7EA 1MS9A 3K4KA 1JTXA 3GCMA 3OOXA 4MNUA 4B4CA 4IHVA 5FRMA 2QZ8A 4CCNA 3N9MA 3OR2C 2BXZA 3M8EA 5HDGA 3OG2A 2E34A 2X1CA 3JTHA 4H0EA 1WVRA 3H50A 3GBFA 2RM22 2UYAA 1MKMA 2OZJA 2SLIA 3FDYA 2GU9A 2E7TA 1E0EA 4LHLA 2HEWF 3GYHX 5FJHA 3OYDA 1DGRM 2PHXA 4BA6A 1ZBA3 3Q0UA 1CZTA 1G59A 4INDA 1GKBA 4MADA 3RQIA 2XLFA 2IXIA 4JDNA 1J83A 1MZBA 3BJAA 1BBT3 4LULA 1OSGA 2FDJA 2VR4A 4PIYA 1ND3B 3DF8A 3AKZA 1P6RA 4J1XA 3I4IA 2AC1A 2F2EA 2ZEYA 3RI8A 5FZCA 3WTSC 4B4QA 2DUOA 3HT1A 3OL4A 2J1VA 5JVVA 4I6ZA 1JJ6C 5IP6A 5F5QA 2HXOA 4I30A 4BQ1A 2NVYJ 3QAHA 1W7PD 2V7FA 1GV9A 2G7UA 3ZN5A 2ES3A 5JI9A 2KP6A 3U78A 2DV9A 2VW1A 1ULPA 1X36A 2ZZJA 3T4VA 2BY1A 1D3YA 4F83A 3LSHA 5D2AA 4L97A 1GUUA 1N47A 3BR3A 4N9HA 4EE2A 3B9IA 4L9TA 2GWRA 3BZCA 1OT5A 4YGCA 4J19A 2HWC1 5JAXA 5LY2A 2VJJA 4V19K 2ZMLA 4QB1A 4ZPIA 4Z2AA 1W0NA 2VMHA 5DUXA 4EN7B 3GLLA 4Q4V2 2QYOA 2D1HA 2XJSA 3O8GA 3ZMVA 5G04L 3BOWA 3RZMA 4P02B 5F6KA 2WFF3 3RJPA 4RYDA 3BTZA 4LKFA 1QJX2 4JAAA 1K42A 1I1GA 3KYDB 2RS31 3UETA 2QBYB 2CW7A 4CP0A 1QJY2 3ESWB 1K5MC 2AEZA 2ECBA 2STTA 3WNNA 2A75A 2CQNA 2CO5A 4DEVA 3ZN4A 1LODA 3K70D 2VG9A 3WNLA 1MS8A 1QGPA 1UCXA 3CBNA 4HPKB 5IT6A 5ISLA 2ZFWA 4BDZA 4N43B 1ZX5A 2UWCA 2CFXA 3VZLA 2PLV2 3MLLA 1AHDP 1U12A 4OMCA 3IPVB 1XSVA 2HWE3 1QF3A 3C18A 3IN9A 3KPHA 4KWLA 4MTEA 4JK1X 2ZOEB 5FZEA 3FIWA 3S1QJ 2UU8A 3NMBA 1XYNA 4IOCF 3M7AA 1MJBA 3HG9A 4L9VA 4Z2WA 5A2QZ 2IRFG 1ON1A 1FYMA 4PF5A 5CQGA 4ENNA 4GWMA 1FMD3 1I9RA 2R0FA 4BJ0A 1MS1A 1Z9CA 4X6AJ 2ELHA 1H0MA 1AYN2 2KKOA 4HKLA 1KU3A 5FY7A 2LG4A 3AYAA 3WTVC 4XM3A 1WCQA 2WUHA 2C6YA 3CJNA 4Q4V1 3I54A 4IEWA 1UXZA 1U5YA 1B35A 5F2SA 3ACIA 3DXTA 5HCBA 3VB9A 3SCHA 1XMKA 2H94A 1O6UA 2GP3A 4ANJA 2I8DA 4ZJZA 5A3LA 1X3UA 1MH4A 3RJRA 1NA1B 3MIBA 3UGGA 1MZEA 3T30A 2D3PA 2M87A 1RMU3 3TN91 3IMNA 2DU9A 3MKZA 1PX4A 5FD5A 5DG1A 2W47A 2X48A 3M8FA 4PFPA 1WW5A 3TO6A 3V0BB 1R092 4IGQA 4ZTFA 2XPJA 2YXSA 4A3CJ 4KMFA 1S0CA 2ZXQA 1W0TA 4JX4A 5A1AA 3SXWA 4RR3C 4XE9A 5EFUA 4XHBA 4F92B 4Q27A 5F32A 2FDIA 4BQAA 3KHCA 3TOJA 3MZYA 5CADA 1X19A 1CESA 1ZLKA 1WW4A 4RQPC 3VBSA 1ZG5A 4IEJA 2Y48A 3ZQIA 3VYTB 1WJBA 3A0BC 4OHVA 3ZMUA 3HPGA 5J3UA 2YV8A 3FHIB 3NAPC 4D5CA 2R063 4A3IJ 3ZKYA 3LAGA 4KG8A 3KEYA 3KWVA 3KD4A 4Q8KA 2ZACA 5FXWA 4AIDA 4E7SA 1XNKA 5FO5A 1W8HA 4OZXA 4IV3A 1KS5A 3OS0A 1VBA1 3D0SA 4LUKA 3HBKA 5D5XB 4KN7X 2XR4A 1ENHA 4RL7A 3OYKA 1KYZA 4HSTA 2FHRA 4Q29A 4DXSA 3WQ0A 4Q4W1 4LE4A 1RI7A 3H8RA 3ZFEA 5FP8A 2OQ7A 3H9QA 1R1VA 3GTPJ 5FP3A 1UZWA 3HR9A 2KT0A 3E6DA 3D5RC 1R1A1 5EG0B 3GTGJ 3IH3A 4HLXA 2XRLA 5CAZA 2HYKA 1G7YA 2MEV2 1GWMA 2CYYA 4AFCA 4XZUG 4CCJA 1D1BA 1BJZA 4Q4ZF 3CLPA 4DYRA 3WHBA 1RUJ3 3WOGA 2XGCA 5GTHC 5DUVA 1STMA 5EYXA 2C9KA 4BQYA 4NIHA 4UB8C 1J3RA 3OGGA 3K69A 2WN3A 1V5EA 4E9KA 2HS5A 5D4SA 4GMP1 3CZ6A 3BDDA 4KG0A 2O5RA 3CUQB 2NVQJ 5F27A 4QQOA 1EF4A 4M9XA 5DCMB 3OBRA 2M0MA 5TISC 4DBQA 2QQKA 2BEOA 4JOMA 5F0FA 2GH8A 3ECOA 5JR3A 2VY0A 3SDBA 4HOOA 1OC1A 1XBFA 4P1WA 4JRAA 3PMEA 2GC2A 2VMDA 4Y7NJ 3WDTA 4EM2A 5BNPB 3H36A 4ZS2A 3AX4A 4LOSA 1BK1A 3A7QA 4HANA 1TZLA 2EILH 3KSCA 5DD8A 1SFKA 4KWKA 4XYXA 3MI8A 4OAZA 1LU2A 3GJBA 2PMUA 2XAJA 2XPUA 4XQDA 5JXJA 4XDPA 3AK0A 4IEVA 3OY8B 1IOAA 3WP5A 4RR3A 4ENKA 2MHFA 3K2ZA 1D0HA 2XB5A 3WDUA 4BB3A 2YFZA 3JRGA 5JPMB 2CQ7A 2M4GA 3VBSC 1XPXA 1FYKA 1W2TA 5EJ3A 3AKPA 1G9BA 1XE8A 4OUEA 2I07B 3TNPB 1W6QB 1GP5A 3CQOA 4HPKA 1MBJA 4P5OA 2XQRA 3CLQA 2CUEA 1ENXA 1SVOA 3FKIJ 1F4AA 2D97A 4IE5A 1L0OC 1W2UA 4EJUA 4UWDA 1ZNPA 3GNEA 5E1RA 4OVEA 2WR9A 5ILSA 4XUQA 4RM3A 1XSQA 3K4AA 2AO9A 3CESA 2E7XA 5BNNB 3E5UA 1HIXA 4A5MA 1NKGA 1XNAA 2W46A 1WKMA 2CV0A 4C91A 4KU8A 2A5YB 3KIOA 2WNUC 2XGXA 2PHWA 4M0HA 1CX1A 1VQ7I 1CGPA 1JS9A 4EN9B 3KYCB 3JR9A 1C28A 1TP4A 1HRI3 1PP7U 2RS51 1W5TA 4O6JA 1VBD3 1ZZ8A 3T0DA 4JX0A 4NHXA 2EZIA 1GYKA 4NC7A 4AI1A 3U07A 2G1MA 1D2SA 4GB32 2DVGA 5FP9A 4IX7A 2E53A 2W25A 5C8CC 3EUHC 4UF0B 5E1XA 4UBHA 5M5XJ 3QH7A 1HXS3 3BU7A 4DGWB 1QHHD 3S32A 3BR2A 2V73A 1X1CA 1W36C 1D4M1 2VPVA 1RHI2 1EPZA 1R9TJ 1TNSA 2GNDA 3JCIA 3QBQA 4C0HA 2Y26A 2VBWA 4AI0A 1OLQA 2JE8A 2O14A 1LVAA 4IEQA 1W03A 1WZ2A 4NRQA 1ACIA 1TQPA 1K61A 2VONA 1MR5A 3ZPLA 4C2UA 2IGOA 1FEXA 5EJ1B 4UUSA 1NA1C 4H14A 2A6XA 1G6NA 3GCWA 2NVTJ 1Y8QB 2VTXA 3CHXA 5TJJA 2YU1A 2YBKA 5LW9A 1ERDA 3MCZA 3MV01 1IGNA 4KA4A 3CO2A 3FHZA 2VL4A 5BV6A 2N8GA 2M4KA 1G8XA 4URTA 4IEOA 2P5VA 4KYWA 3FXMA 4H55A 4E27A 1SMVA 3RZZA 2L7FP 3E1SA 2W95A 3AG2H 3VBSB 1WW7A 3NAPA 1K78A 1YS6A 3IAQA 2V4JC 4I3GA 2BDRA 3UT0A 4B09A 1Q56A 3DBHB 3MIFA 4YLZA 2V1XA 2PJRB 2DK8A 4NJ4A 5F1JA 4K40A 5I91A 3L2UA 2WFF2 1A8DA 1DUXC 4RA2A 3BVCA 5EEHA 2P34A 4F91B 1YFWA 3WTUC 5ILUA 3ZMOA 2NS8A 1XU1A 1TQIA 1LQ1A 5JHUA 4KI5M 3ZFEC 2BE5F 5FPAA 3CP8A 1Z7S1 4XKWA 4NIIA 1IGOA 1E17A 3SHFA 3CCEI 3TMOA 2PI0A 3NL1A 2F17A 3ACFA 4OI4A 1Z6TA 3KLSA 3DECA 2CW8A 2P7VB 5F0CA 4XKBA 1CIYA 3V64A 3PHMA 4XLEA 5JLVA 2W00A 4ZY9A 4C2TA 3MFCA 3W5NA 1ZGJA 3UESA 2VQTA 5AFEA 1JKRC 1XYPA 5FLVA 4OQ9A 5FKKA 1Y39A 5T50A 2IVIB 1QNWA 2IT0A 1PZ7A 2QTWB 3USUA 4ZDLA 2W68A 5HS7A 3AL0C 4G6TB 4QDSA 2A5WA 1XC6A 3K4BA 5FMCA 2QZ3A 3BCWA 4XF3A 4RMNA 3WG9A 1RUI3 3O1VA 3MWMA 2YC0A 5A3TA 3TEWA 1ENRA 4GWJA 1R4NB 1HX6A 2WWYA 4WXCA 4Y33A 3QQAA 2QLZA 3H7YA 3ZM8A 1UMIA 3OSGA 4BMBA 4GYIA 4AWDA 1KONA 4GIQA 3FUOA 1NG7A 2D5VA 3MDPA 1H8TC 3SEQA 3OOUA 3IDBB 4U7BA 2R7RA 4CEYC 3PIGA 1CAUB 4JHTA 5L7OB 2BBYA 4IEZA 1NZCA 4Q5SF 1L7QA 4RDUA 2W7NA 3VEPA 3MF9A 1UAIA 3MYXA 4BQ3A 1JZ3A 3X29B 2A7AA 4IQ4A 1LB2A 3MW3A 2MLGA 4EJRA 4C9YA 2MC4A 2P7CB 1VAKA 4KT6A 4LORA 4Q4X1 1WJCA 4IETA 3KX2A 3PJQA 4HX7A 2QQBA 4RGXA 4FAHA 4HN0A 5A80A 5CNAA 1KZHA 1ZA4A 2HWVA 5C8CB 2LTNA 3N3HA 1SD5A 1CIWA 1XRUA 2PFBA 1GVJA 4UT5A 1C0WA 1WH7A 4PQQA 3HOXJ 5A2QK 4LA3A 3VKNA 4ZONA 5KXDA 1VQLI 4J01A 1WJ5A 3TOBA 2XLAA 4BEHA 3O1MA 4IO9F 2JG9B 2UURA 1RTVA 4ZZ8A 2RMU3 5FYMA 3NNFA 4DMIA 2NLRA 1U8BA 4HKOA 3BLYA 4U0WA 5CBLA 3C2GA 1STZA 4D6SA 5KHIA 2GN3A 1D2QA 3TEYA 3MIHA 2R042 2XKOA 3WV6A 3ZXGA 2RVAA 4QPQA 2EIEA 1W8OA 3S2DJ 2MGQA 4A6DA 3PL0A 4M3BA 4Y1ZA 3J7MA 1GOGA 3L2HA 4C1XA 5I0SA 3JB8A 4M6YA 4HSRA 4PGGA 4CDUB 1YQ5A 2ILMA 5FLMJ 1GQHA 1W6MB 5BNOB 3S2HJ 2MSYA 1ZZBA 3V7CA 1M06G 1HRI2 3B5LB 1CQ9A 5FYSA 4ZYGA 3HN1A 4HBLA 1WLDA 4K6BA 3POEA 3IC7A 2LBFA 1WPKA 2HBUA 5J47A 3BZ6A 4U2AA 3VHRA 3PTRB 4QKDA 2D3RA 1JI6A 3SYTA 2XV4S 4FTSA 1U2WA 2QUOA 4XFBA 3WNXA 4XIDA 1VRBA 2F5CA 5C4XJ 2W1WA 4P9UA 4KT5C 2OQ6A 1MIJA 1US3A 2BW3A 5E3OA 5B5EC 4AI2A 4R9CA 4ARXA 2K4BA 3DBRB 5FZBA 2J5OA 4RAGA 1L3JA 1S2KA 5FY5A 4A3FJ 3J9SA 2B9SA 2ZGRA 2R0HA 5BMZA 1CR7A 4D69A 3ABUA 4ZU5A 1T6BX 4I3PA 2QBYA 2M7BA 2HQRA 5ABJA 1WGPA 3HAGA 1HQLA 5K0UC 5FK8A 3TAYA 1D0ZA 2LKSA 1SFUA 2LTPA 1R71A 2VQGA 4BQ4A 4MEYF 2L2OA 4DBRA 4AYBA 3VYRB 1VFCA 3ZXLA 4A2UA 4PZJA 1UO9A 1C8M1 4P9XA 1DQ0A 4RGGA 1POV3 1BC8C 2EFQA 1NH3A 5IYYA 5FWEA 2WYSA 1P2FA 1Z7S3 1RJ8A 1JI8A 4QGMA 3G7DA 1R081 5HV0A 3CD6I 2D93A 2XAHA 1PK6A 5DAXA 2LY2A 3N9LA 3MFAA 2VZSA 4ES9A 3EYYA 4AVAA 1HKSA 3R6SA 3WP4A 2OKXA 4GKYA 2Y75A 2LS6A 3KQRA 4IEUA 3LSGA 2L02A 2XF5A 5H6RA 2XJQA 1W4MA 1JYTA 3HKZA 4UFKA 5ICGA 2PTMA 4CU7A 2UWBA 2XSJC 2I45A 2QE3A 3R61A 4FFFA 4COZA 2WV0A 3A23A 1TWGJ 3S5QA 1PVC3 3WEZA 3WHUA 1SVMA 1LPQA 4MLOA 2ZCWA 1SVLA 3U1KA 3JD73 4BDVB 3BJ6A 3VKMA 3UYJA 3I3BA 4MFEA 3P9IA 2WS91 2VKHA 3FJSA 1NE6A 4IL6C 2A05A 4UVCA 1VQ4I 5LA0A 1BYHA 1AYN3 1W04A 1DLLA 1O8PA 4P9GA 4CSWA 5AIPA 3HMYA 2ZXIA 4O7XA 2C6SA 3GZNB 4NPMA 2HLEA 1DQ5A 4O5VA 4WVZA 3N9QA 1UNBA 1RUNA 4XMAA 4M3CA 1TME3 2DN0A 1VB4A 1VP6A 1FBQA 1UU5A 4AAXA 1NG6A 3PNVA 5IP9J 3BPZA 2KZGA 3DEEA 2HYFA 3B9CA 1LENA 1KQ0A 1V3FA 3VL8A 1FNYA 4AEDB 2K40A 3H8XA 5E79C 4AU7A 1JGGA 3RZDJ 1QIQA 1MMDA 1HQCA 4B1RA 1FPN1 1MVQA 1YIOA 5FYBA 5TRDA 4HQEA 1OQ1A 1X8MA 4RB2C 2NOGA 4PJYA 2K9LA 2DCYA 2E32A 4ZYDA 2MD0A 1YO8A 1TZOA 5FV3A 1OF3A 3IWZA 3VDDB 4YFKF 3NW4A 4OOIA 2K3PA 3EUKL 2VCBA 2DCZA 1SG3A 2K86A 3MKWB 1HDDC 3J7HA 5JXHA 1XDUA 2DF7A 2XMLA 4Y17A 1F35A 2RGVA 3AXEA 1RYYA 2PAKA 3CEWA 3DP7A 3K4MA 1YITI 3KP7A 4HOBA 3MFKA 3VD7A 4FP3A 1FBSA 1JZ8A 1T2KA 4EEFG 3VWBA 4OYUA 1W6OA 4XORA 4EJOA 5FGMA 4O3MA 2TEPA 2QCSB 2FBKA 1MZ6A 3DYOA 1XCBA 4FP2A 4D94A 4YELA 1D1CA 3HQXA 3SCGA 3K1PA 4XJUA 5DAVA 3B01A 2DCJA 4PIZA 3J26N 2K9SA 1K6YA 3E97A 3CC4I 2VTXJ 4Y1UA 2W57A 1FOWA 3U21A 2QFEA 3K4CA 4NHKA 3OD4A 3PU8A 2CQQA 1QQP3 2VJIA 5D4RA 1LHWA 5JOWA 4L9BA 2ZNYA 1VLNA 3T2OA 4FCYA 1LOFA 4TXWA 2XDVA 3ZQFA 5KAIC 1FAYA 4W4ZA 5H9RA 5BOXA 4CDUA 2OUJA 4WM7C 3PUHA 2KIUA 4XLFA 3RWNA 1UQXA 3LEMA 1JT6A 2GDFA 1N77A 4XF9A 2B7EA 1NT0A 1DGRN 3B3QE 2FOWA 2QQVA 5IHRA 3JAMZ 1X1BA 5FQ0B 1ULYA 4J25A 3MIEA 3JBG3 2QQIA 3AG1H 4TYSA 3ZFFA 2BFUS 1F5FA 5JOYA 2XSDC 4RS5A 5LBQA 1J0RA 5C33A 3ZKUA 3DPUA 3CCRI 4WVVA 1U3EM 1LEMA 1OUSA 4YVSB 2XJUA 2YROA 4PLMA 4LUMA 1HB1A 4HF1A 1LGNA 3NJVA 1OA4A 2RR13 2BXYA 3MLKA 4AWXB 5IVVA 2VNVA 1PGL1 4J1WA 3EBRA 5I0DA 1VBB3 3DTIA 2WFF1 5EF6A 2O8KA 2A6YA 3H3VK 2EXKA 4ISRA 2E35A 4H7MA 1C57A 2AGSA 2EFOA 2AREA 3GBWA 5BNOC 2ID6A 4MGIE 2DLLA 2JJ7A 1YYNA 4LG0A 2LSOA 4MGYE 5J6XA 1XG1A 1NLSA 3CIHA 5CG9A 1P8JA 1EH7A 3BALA 5LZ6A 3P9KA 3OGSA 2BGPA 3AVRA 2VBYA 1FZPB 1G3WA 1SEFA 3J7LA 1HRV3 4AC0A 2D45A 2LH9A 4Z07A 3FN9A 1AR83 4WVWA 3P9CA 1VBC3 3SEEA 3W58A 2ETEA 3B00A 3H8UA 4IV1B 2PMHA 4DQAA 4QX2A 1YLFA 3HRMA 2XWJB 2BNOA 1VBD2 2M7AA 2AXTC 4FISA 3IH4A 4KGGA 5BPXA 3EQLF 4JHZA 5SV8A 3VBUA 4AZZA 2M30A 1MS5A 4C3HJ 4WF2A 1D4M2 3RZOJ 1YIJI 4BM8A 1BBT2 4Q0UA 1O3QA 2WO2A 2VASA 2R7DA 5M5WJ 1G9FA 2R041 4MO7A 3S1RJ 1ZBA1 4GKXA 3LEGA 4UF0A 2XVCA 3KYLA 5DUUA 4IE4A 4MXWA 4PGHA 3OUHA 1UXXX 4E2GA 4L9NA 4QGNA 3I55I 4GB31 2B0LA 3PSIA 1PO23 1V55H 2A69F 3BPXA 1BI0A 4P00B 1DF0A 1XNTA 4XW3A 2MNGA 4LK7A 2G9WA 1G2HA 2OUHA 1ITYA 3K75B 4DUXA 4A7KA 3DTEA 3QRFF 3RKYA 2KL4A 3ZCOA 3OSFA 3WUDA 3JRBA 3BGAA 1VBE3 3PU3A 1H9WA 1I5PA 5BYNA 3VYUB 2JDPA 3V56A 4CDQB 3A0KA 3HL2A 2J1EA 3IAPA 2IXSA 2VQLA 3ISPA 2ZSHB 2LR8A 5HVQC 3TP0A 2XUEA 1PP8F 3KEQA 2HWC3 1ASJ3 5KHKA 1PUEE 4KNYA 3KF5A 3CMEI 1FOD1 3R4DB 5DAPA 3KP5A 4XJZA 2NVXJ 4DRRA 1ZBE2 4OU0A 3GTOJ 5GZFA 4YIRX 4RS5C 3CMGA 2GMMA 4A7ZA 3FXRA 4Y26A 4XABA 1JYXA 1FY7A 5F0HA 3LSRA 3W59A 5BPIA 3LL7A 4B4RA 2X5IC 4XDQA 3O8HA 4HG6B 5DV5A 4FPEA 1ASJ2 2HI3A 2ZJPF 3NQOA 1QU3A 3ST7A 4XILA 1C1FA 5CFCB 5C4WC 5J8FA 2D6OX 2DA7A 2JDKA 3RZLA 4WCGA 3VHOA 2RKHA 2WADA 1IDYA 2R0QC 2DFFA 1XSRA 1WLWA 3J80Z 3PNAA 3GJAA 4NDLA 2OYZA 4K8RB 3DCQA 1B72A 3OEAA 3D82A 4LITA 1QY4A 3H1WA 4JX5A 2HWB1 1ND2A 1GOHA 1S0FA 5E1WA 2HR3A 3BG3A 4RAZA 2NM1A 5A6QA 3BKZA 3BZKA 3ZXAC 2EJRA 1C8M3 4PBPA 3IAS2 5K7FA 2ZX2A 1BOBA 2HOAA 3ZOIA 3FBNB 3AFGA 3CO6C 1YUDA 2JPBA 1EY2A 4XUOA 3K4JA 3FXUA 2QKDA 1S3JA 5ERIA 2LREA 3W20A 3I3QA 3U0ZA 3M2MA 2D6MA 1JYIA 3GZEA 2IA1A 3W5MA 1TW2A 4B44A 1DQ2A 2JB4A 2ZGUA 3I2GA 4AGVA 4H2AA 4FSJA 5CVUA 3FBMA 5A7SA 1AR91 3O0VA 1OOPC 3IMMA 3SNMA 5F39A 2FBHA 1LCLA 4PUSA 4XK4A 5IOYA 1CAUA 4NRMA 3PMSA 3ZDSA 2EXIA 4HK8A 4LEJA 4P14A 3CCUI 3CF5F 3CL1A 2QSGX 1Z7UA 5I0TA 1YNAA 5GZEA 3AZVA 4JKMA 5IWFA 1A6QA 4GYGA 1RUJ1 3BY6A 2J42A 4I0BA 2ZGSA 2R1DA 1C1LA 3L00A 3F9KA 3VHNA 4RS5B 4LA2A 1RUG1 2X1EA 1PIV3 1UYXA 3HNMA 4M0NA 3H35A 1A04A 4LNVA 2YGLA 3FMQA 2XB0X 5FREA 3ROUA 3J7AO 4IHSA 2ZGTA 4XACA 1KGYA 3PURA 1KGSA 1AUYA 1OF4A 2E1OA 4YARA 2QNKA 2ELKA 4G3YC 1MBHA 2IS4A 2MBFA 3G4SI 1MDMA 3K48A 1VIWB 3LA7A 4ASMB 1S1AA 2JRMA 1H1MA 2HVQA 3NV2A 3J8F3 4DIQA 1U6GA 2M3AA 4RB0A 3GXUA 2WA4A 1WCKA 3PM1A 1ETQA 1PM7A 1NHAA 1UYPA 5EZHA 1VZ0A 1PM4A 1ULDA 2P37A 5FBZA 1ZA7A 4META 4UW5A 4IPAA 4I98B 1IZ3A 2DVBA 4WVMB 3RSJA 5KC5A 4XHXA 4FPJA 3GWZA 5D5WB 3G3ZA 2FRHA 3OY9A 2LRDA 2KLOA 4TLGA 5LBCA 4LB5A 5FMBA 5IK4A 4H4KC 2XPVA 2W1SA 5HI0A 2M45A 4R4ZA 4OMDA 1PGW2 3C1DA 5DZGA 1KEXA 5FPZA 1X50A 5FY0A 4XBNA 2EIBA 2NP0A 1ODMA 3PL8A 1V6JA 2JA6J 3ZSJA 4L0ZB 3S15J 1W6MA 4D7MA 4P55A 3IB3A 2VZTA 4AQ2A 1AYM3 2EALA 1FJLA 1OCOH 3OR1C 4Y5Z0 1TMF2 5A6ZA 2GLOA 1T2XA 2V4AA 5FAXA 1J5YA 3KETA 1W8ZA 4QQPA 1IRXA 1QPIA 2A6WA 4QM8A 2Q8DA 2ZC2A 1ULFA 2V6CA 3LFUA 1VMHA 5C9AC 4FPKA 1KYWA 3OL3A 5DPNA 2WC2A 5BNGA 3MMYB 4NIAA 3NNJA 1XB9A 1R5HA 2X1DA 1S55A 1AKHB 5FTTC 3PVOA 3KT7A 5I0RA 5FY4A 4BKXA 1UJ8A 5M3MJ 1MNMC 3TDUC 5GLWA 1P4XA 1BI3A 4BBSJ 4JRLA 5D1IA 3LWFA 3AP5A 1UOJA 4G94A 2V4VA 5EZGA 4XTPA 3RIRA 4FQGA 3VGIA 3PDQA 5TSWA 4Z92B 1EA3A 1R6RA 3QPTA 3TW6A 1IF1A 1VRH1 3FXOA 2D6NA 3CDHA 1HKQA 4DS0A 1LRHA 2DFEA 3LAPA 2RJLA 4GDFA 3BPSA 3ZPYA 4RFT0 1UY2A 2PQQA 2XG3A 4XFGA 4F8AA 4IQJA 2GC0A 4CP1A 5LASA 5EHDA 4C3IJ 4I0AA 1X3WB 1J75A 3K9TA 3TBDA 1W6NA 4NUBA 1QDOA 2O9LA 4C2MJ 1WUVA 1NQDA 2K46A 3F23A 1R58A 5C6CA 3OIPA 4A41A 2P5KA 5IVYA 1TQMA 2RDSA 5L9RA 1FMD2 1Q1HA 5FUPA 5FK7A 2P3YA 4NAOA 2QVOA 2EICA 2WZ8A 3NV4A 2DVFA 5FXVA 4GH4B 3RKXA 3NO8A 5K0UA 1WWXA 4IHYA 4AM3A 1OA3A 3ECQA 4XJWA 2IA2A 2O8QA 1N78A 1VQ8I 2WZR2 3ORJA 1X2NA 2RV8A 2DYSH 4DFSA 4DRVA 1NLRA 1WGXA 3UJOA 2HVRA 3COAC 3VN4A 3H1MA 2YB7A 1O4TA 2G9GA 3NRUA 2RC4A 3BROA 1Y3TA 1SC7A 3KZIC 1ZARA 2OPTA 2KIFA 1KS4A 1LGCA 1W6PB 1EV12 2BOLA 2JD4A 1FWZA 1APNA 4CDWC 2Y0MA 5DS9A 2ADEA 2CV2A 2Z3YA 4ET7A 1LEDA 5F04A 5JXIA 1DG6A 4QWQA 5CA6A 2TRTA 3WF1A 5J36A 5FDBA 2VKDA 5J98B 2B42B 3WCSA 1VI0A 2PN6A 1CJPA 5FOBB 4ORFA 4HZFA 2LK2A 2R5YB 1FSHA 4MGSA 1PVC1 4JYKA 1OFNA 4CEWB 5BY5A 4FETA 1R5ID 4LBQA 4Q4W2 5CB7A 1DLCA 4NE9A 5C70A 2BQPA 1F4KA 5E8GA 3N9PA 1I1EA 4OWRB 2B46X 3IIIA 3BODA 1LDKB 3QYFA 4FPFA 5KR7A 2DT7B 3A21A 4HT1T 4IDZA 2H27A 2V79A 3M3IA 1VTNC 1GP6A 2O0YA 5LBBA 3V8KA 4EZ4A 1TTYA 4XIKA 2J1RA 1LNWA 2OQGA 3TOAA 3JRIA 4EGZA 5BPDA 3S30A 3KM5A 2I2SA 4CH7A 1QO0D 1ZGWA 2W48A 1FNZA 4GCVA 4N9IA 1FMWA 5LB6A 1TWCJ 5J4VA 3CUOA 3V7SA 3WSOA 3W6VA 2J5PA 3O5SA 1XTAA 4Q4Y1 4QXHA 5DDJ1 1BW5A 2MABA 4W8JA 4HLTA 1YHQI 2RN7A 3DPLC 2QDNA 1V6OA 2X6XA 5T55A 1IS6A 1X1AA 1S7AA 4I76A 1E5HA 1DGWY 1ENQA 2VH9A 3HYIA 4DNCA 1D0XA 2ME6A 4NMIA 1TG7A 1LJ9A 5HLHA 3IKTA 5DCMA 4UFLA 4BL0B 1GICA 1SFXA 1S8NA 1C5HA 2KZVA 2QQUA 3VBHB 1BA5A 2HNHA 3AYCA 2DFBA 3L2RA 1GSLA 2EXJA 1NLQA 3QOPA 1BK0A 2JDYA 4IW3A 4PDWC 1IXRC 5GP9A 1O59A 1V6KA 5BNPA 1N3PA 3BPVA 1QVUA 3PIPF 2CW0F 4BE2A 1H30A 1ZZ9A 3M8JA 5JVTA 5F8PA 1QGLA 1GT0C 1W90A 2QQJA 3LGRA 3LNQA 1RVF3 1VQNI 2JDNA 1WHUA 2CFOA 3M9AA 4KJZA 1S5LC 1K5MB 1Q5OA 2L9SA 1R23A 4Q4Y2 5DDJ2 2UZKA 2K4JA 1FYUA 1REEA 1Y0NA 2GC1A 3MVPA 5B1BH 2C1FA 3WZ1A 2WIIB 2VVFA 3BR6A 2BV6A 1U5TC 1B9NA 4KNCA 2KISA 1VQOI 3HXLA 4MG2A 1LTEA 2JDAA 5CG8A 1KITA 4RGKA 1W1WE 3IZOA 2DU1A 2ME0A 2LKPA 1YFUA 1HV0A 5EJZB 1N1VA 4P9JA 3S7IA 3FHQA 3HOYJ 4GJYA 2IS6A 3WF3A 2CRGA 1MMSA 3QACA 2R073 2ENRA 2JECA 2CJJA 1VMFA 3HJRA 3KP4A 5E3LA 1VBE1 3OUIA 1FATA 1MNDA 1BVVA 3K6GA 1UKGA 5FPLA 5JIAA 2ORXA 3GTJJ 1JODA 1G8WA 5HNFA 5JOXA 3I2IA 4R52A 4AVTA 4BK5A 1PMJX 1JT0A 2JDUA