4CYDA

Glxr bound to camp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
225
structure length
223
Chain Sequence
GVQEILSRAGIFQVDPTAVNNLIQDMETVRFPRGATIFDEGEPGDRLYIITSGKVKLARHAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSAVCVTEVHAATMNSDMLRNWVADHPAIAEQLLRVLARRLRRTNASLADLIFTDVPGRVAKTLLQLANRFGTQEAALRVNHDLTQEEIAQLVGASRETVNKALATFAHRGWIRLEGKSVLIVDTEHLARRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structures of Apo and Camp-Bound Glxr from Corynebacterium Glutamicum Reveal Structural and Dynamic Changes Upon Camp Binding in Crp/Fnr Family Transcription Factors.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transcription
molecule keywords PROBABLE TRANSCRIPTION REGULATOR
total genus 74
structure length 223
sequence length 225
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4cydA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4cydA01
1SMTA 3QP5A 1S6LA 5ICFA 2ZFWA 4KWJA 5BXXA 4GYIA 2K0GA 1B9MA 1EH6A 4Z82A 3F3XA 4KU8A 4I2OA 3VODA 5HLIA 3ELNA 2MD5A 3O2PE 3LAJA 2HOEA 4YIFA 1LRHA 3R4KA 2RQPA 4A0XA 1DDNA 1PM7A 5DV5A 1XMAA 1HSJA 3LA3A 4F8AA 4IEQA 4LK1F 4OMYA 5ICGA 2KRFA 2Q0OA 3FMQA 1QO0D 1CF7B 4LB5A 3F8CA 3NSTA 1NYWA 2H6CA 3WTYC 3WW2A 1LQ1A 3H92A 2I45A 4CICA 4OLLA 4HF0A 3WW3A 1XSVA 3CUQB 4G8XA 1AOYA 3ZDSA 5I8TA 2VXZA 4ENKA 4ZU5A 1IN8A 2QNKA 5BPIA 4M9XA 1P92A 4ESBA 3E6CC 1J3RA 2OD5A 3R60A 4XF4A 4HVRA 3SHRA 2P5KA 4I7HA 1SD7A 1FY7A 2QZ8A 1EH8A 4EJVA 2QM3A 2D1VA 3RKYA 4EJUA 5LBQA 3RYRA 2ADUA 3J7AO 2DO7A 1UW8A 2R3SA 4HLTA 1O3SA 4RGRA 1V4RA 3H8UA 3IWZA 4XFCA 3U9GA 2P8TA 2QVOA 2CYYA 3E5UA 1T0FA 2IA2A 4L18B 3BALA 4AVPA 1QZYA 4L11A 1R7JA 4L2NA 1ZGJA 5TJJA 5FLHA 5E1XA 2CSOA 1CAXB 3F8NA 5L3GA 3M8FA 2AS5F 1FBQA 3WTUC 4KIFA 1H9GA 3CF6E 3HQXA 5FLIA 4ON0A 4WXDA 3O3KA 4OMZA 1ZARA 1XCVA 2RN7A 4P9GA 4HOBA 1YFWA 5HDNA 2BNMA 4J1WA 3ECOA 4XFGA 2FNAA 5I0TA 3HOSA 1EH7A 1ONVA 3HRSA 4KMUX 5D6EA 1YFYA 2JTVA 5CVIA 3NJZA 3FMRA 2MNGA 4YG2F 1W7PB 2PG4A 3I7DA 1YHFA 1HW5A 4WBBA 1DZRA 3QU6A 2D1HA 1IPJA 1YLLA 3FHIB 4YFXF 4UHTA 4G6QA 3FXUA 3KP2A 5JHUA 4JV4A 3P7NA 5A2QK 2ET7A 3FF5A 2HYGD 4EGZA 1U6GA 1V3FA 2QDRA 1RIOH 4YRDA 4OIOF 1LR5A 4MQVA 1RI7A 2F5DA 3FZVA 2PQQA 2IA1A 5JI6A 2K4JA 2Z33A 3H3UA 3I0TA 3MAJA 2VQAA 2Y48A 4GGGA 3HSEA 4PCQA 4L9VA 1V70A 3L2CA 5BQTA 4EJTA 3FM3A 3SHFA 2HS5A 3GWZA 4TV7A 3EYYA 3I64A 2F5EA 1JGSA 3J80K 2FSWA 3MYXA 3PQJA 5JSPA 1UFMA 3C3VA 5E20A 2HKXA 4A6EA 1IXSB 3RPUA 4Q4ZF 1JHFA 5ERIA 2J5PA 4BHBA 1Q3EA 2XUBA 4KT5C 4ENNA 5ED4A 2GC0A 3DL3A 1KYZA 1UHMA 2LKPA 3BPXA 2EK5A 2LSOA 1KQ8A 1MJ9A 2VE8A 3DV8A 5JR7B 3TGNA 4UUVA 2PQ8A 2K27A 2FEZA 4GCVA 2QJVA 3ES4A 1R1UA 2E1CA 2KKOA 2CQKA 5E17F 3H50A 2DCTA 4MGZE 2K86A 2IXIA 1OR7A 4D0PA 3E5QA 5LGTA 5AVPA 4HMZA 2PN6A 1SEFA 2GC3A 1JHHA 4AVBA 1FI2A 1XE7A 2GAUA 2A6HF 2DQRA 2HDCA 1QQIA 4CO8A 1FOKA 4IEWA 1Z1DA 2MLKA 3CUQA 1MGTA 3FJSA 2EJRA 4QX5A 5KHGA 4RB1A 4KYWA 4Q48A 4I0BA 5FCCA 3HRUA 4MGRA 3CLPA 1CF7A 1SD4A 1CGPA 1RNLA 1IN4A 3C7JA 4EMSA 1G3SA 3LSTA 1FSEA 2FBIA 2JRTA 2FMLA 4IRIA 5DD4A 3GYDA 4QM8A 1ZZ8A 4A6DA 2PHDA 4EGYA 3V7CA 4EV0A 5CVJA 4Q0UA 3J80Z 2UXXA 1FX7A 4EM1A 4ONUA 1FLIA 2GIVA 4I01A 1S7AA 2B8MA 1NE4A 3D0JA 4H7LA 4U88A 3H7JA 4LLLA 5F6FA 4M6YA 3SQNA 3MDPA 4WF2A 4N0BA 2QUFA 4GXOA 5FQ0A 2P7CB 3WU0A 2V79A 1H1MA 1J3PA 3HHHA 3WE2A 4LD5A 4O9EA 2XLAA 1P4AA 4WXCA 4Q0PA 2X4HA 3KEOA 4YFNF 4BQAA 3FHZA 4UBHA 5CVUA 3DXJF 3RIRA 2ZBKA 3WTVC 3KFWX 1ZZ9A 1Y9QA 1XB4A 3KETA 4G6DA 2COMA 2LF8A 4Q5SF 4ESFA 5LEKA 3OTFA 3W6KB 1EYBA 3LA2A 3I59A 4L0ZB 5CJ9A 4LJZF 4DQ2A 4JVAA 2VBZA 3TNPB 1DPUA 2IRFG 1Y3TA 2Q4SA 4XF0A 2K9ZA 4U0YA 1E17A 3QP6A 3DPTA 1VTNC 4XFBA 4AWXB 3MZHA 1U5TC 1RL3A 3SFZA 3I59B 3L2HA 2MBFA 5L3FA 2NNYA 3ULQB 1YUDA 3I53A 1XGNA 4M71A 1RC6A 2KIMA 1VJ2A 4BAYA 1MDMB 2F4PA 3RYKA 4MV2A 2CAVA 2GWRA 2QQ9A 4LLNA 4MUVA 4IVNA 4OIPF 3ZPLA 3CO7C 1ZG5A 2E1NA 3L00A 4UVCA 3LZZA 2BYVE 4QLCU 1YWKA 3EDPA 2VBWA 2Q30A 2DPUA 4E2QA 2EVXA 3IDBB 2IPQX 3C18A 1U5TB 3V4GA 2PAEA 1H0MA 3BWGA 2H09A 1LKNA 2EA4A 3S7EA 4H0EA 3OGJA 4D7TA 1BI3A 3NRVA 3UKNA 3TNQA 4P9FA 3RPQA 2GU9A 3GFMA 3K69A 4L0YB 3V8KA 4G9YA 1YW7A 2M1BA 4XRFA 3REOA 4E2SA 2O6GE 2JSCA 3J81Z 2EFNA 1F1ZA 3CO6C 1CX4A 2D40A 4XF1A 3LA7A 4O6JA 4HA8A 3CEWA 1HSTA 3RZZA 1J1LA 3BOQA 4WXHA 3U11A 5L3BA 1K6OA 2HWVA 5HS8A 2K7LA 1BIAA 4HF1A 3M9AA 3JSOA 5E1RA 4FAGA 2HQRA 2FMYA 2FQPA 4EJWA 3T8TA 1FBSA 4LMYA 3NQOA 2VONA 3FM5A 2IXCA 1DUXC 1F9NA 1YS6A 5BPDA 5FGMA 2EV0A 2FBKA 4L9NA 3W6JB 1HXDA 1MD0A 2P7VB 1FC3A 4ENJA 5E8IA 2Z3YA 1X82A 2VT2A 1TW2A 1Z05A 3F8FA 1RZ4A 1D5VA 1MKMA 4XETA 2XKPA 3JAMZ 1ZX5A 2G9WA 3E97A 2QBYB 4IRGA 2P5LC 5KHIA 2VBXA 2UWMA 1R1VA 3VEPA 1EPZA 3WU1B 4I02A 3HT2A 1FYLA 3WGIA 3LOIA 4YNIA 1WLTA 2L02A 2W84A 2L54A 3QACA 2BBYA 2A6EF 5D5VB 3K9TA 3IRRA 5D5UB 1L3LA 2IXLA 5I0RA 4RB3C 3KP3A 1STZA 3FXRA 4YSFA 3IDCB 1T6SA 2LNBA 3C3WA 3GW2A 5IT9Z 3KZYA 5F64A 4RB2C 5FFZA 1ZLJA 2F2EA 2BE5F 3IWFA 3BB6A 5E1ZB 5FPXA 3J81K 1X7NA 4IEOA 2H6BA 3ELKA 1ZZ6A 4CHUA 4IEYA 2OA2A 1XDSA 4ZZDA 2ZMEB 3IIAA 3OCPA 2EV6A 5D5XB 4ZU4A 1XDUA 3NL1A 2W85A 3GEZA 2FF4A 1OYIA 1BIBA 1J0RA 5I93A 5E1WA 3I71A 3PVBB 2DAOA 2NS0A 3M8EA 3N97A 4Q47A 5EEHA 1ZREA 3MFKA 3RKXA 1UIJA 3NVCA 4MEYF 4NQWA 4ZH4F 1O7FA 3RI4A 4GULA 2V6CA 3QPTA 2V9VA 3OV8A 3WTWC 2K4BA 4EVIA 2M87A 3T1BA 2STWA 5CVRA 5K5QA 1SFEA 2YSRA 2YU3A 2PFWA 1ZNPA 1QXRA 5D5WB 4XF9A 3EJKA 1YS7A 1ZVFA 3DQVC 4DNCA 1PP7U 2XROA 3IKTA 5BPXA 1IUYA 4N9HA 3R0JA 1D8KA 2M45A 2OQGA 4FAHA 1J58A 3Q9VA 1WGPA 4M9SA 2VN2A 2UYAA 1MJAA 2VOPA 3ZMDA 2H0VA 2V1XA 1HW2A 2B5HA 5KHHA 1GXQA 1CAWB 2V1UA 3PLQA 1YFHA 3RDIA 1QXJA 2O8QA 1P2FA 4MGYE 5BY5A 2QQBA 1IXRC 4AQ2A 2A5YB 1O3RA 1FP1D 3EQEA 4A12A 4BXUA 3DEUA 5ILSA 2F5CA 4U7DA 5I8YA 2GXBA 2IT0A 3ST7A 2HEOA 4ZU7A 1CAVA 1XGSA 1IN5A 5DYMA 3ZMZA 1R5GA 3ERED 4DINB 4AD9A 4UBGA 4HV5A 4LGWA 4PDKA 4M9ZA 4CGZA 3SXYA 4HSJA 2OYZA 4BNCA 2R7FA 4O3MA 5BV6A 3QPHA 4MTDA 1FP2A 3BP8A 1QNTA 2VPVA 4UV9A 1O5LA 4IERA 4KL1A 3ZMSA 5EZWA 3F23A 5JSOA 1B6AA 5DEQA 4A5MA 2E9QA 1Q5OA 1KGSA 2RVCA 1KA8A 4XSZF 2RC4A 2KXLA 1EY2A 1NE6A 3FWEA 4UVAA 3HT1A 1ZN2A 1D8JA 4KIGA 1IW7F 4PIXA 3U0ZA 3JTHA 4ESJA 1ZZBA 3ETQA 4MEXF 5ICEA 2YR2A 2OBPA 4XEZA 4KICA 1I5ZA 2XIGA 3K1MA 5L3DA 2HYFA 3KE2A 5J7MA 2FNPA 2KIUA 1ZHFA 2JPCA 2FRHA 2DT5A 2ACJA 3Q9SA 4PIYA 1USSA 4I0AA 1Z6TA 2EFQA 2L4AA 3KP6A 1REPC 2L3DA 4AQ6A 1TNTA 2RKHA 3EBRA 3F22A 4OIRF 2A3SA 3FFQA 3ZP5A 2IXKA 5D8LB 4WVZA 4PGHA 4G7OF 2RV8A 1ZZ7A 1FZPB 1SFNA 3ES1A 3BJOA 3IL2A 4QGMA 1R1TA 4KIBA 1NXMA 1ZG3A 2ZKZA 1K78A 1L0OC 5HOOA 3E6MA 3MWMA 3GFIA 1UHWA 4HQMA 5E18F 2D2WA 3O6BB 3IC7A 1TBXA 4CDGA 5CLSA 4G7HF 1LVAA 4FBFA 3BDDA 4RD7A 1ZG1A 2Z99A 2MH2A 4KMFA 1XSDA 2CGPA 3MPBA 2H27A 3GZ5A 2A07F 4Y17A 2PTMA 1GQGA 3E3VA 1B59A 3H9AA 3LQQA 1ZH5A 4BIFA 1WRJA 5K8SA 2E7WA 3SZTA 1TNSA 1YO5C 2VODA 2NRAC 3SCGA 1WQ2A 4GO1A 3R6SA 4EM0B 1W7PD 4HF2A 3DFGA 3JZVA 3GUDA 4LK0F 3SXWA 1J9IA 1T2KA 2VBYA 3TKYA 5JVTA 4KNYA 4LUKA 1W5TA 4RGSA 1MJBA 5CVVA 1OI6A 3V8LA 2Q8KA 4XFIA 4PGGA 1QBJA 1O3QA 5BUVA 3WGGA 4UXNA 2IJLA 4XBFA 1GXPA 1QY4A 4NHJA 1Q43A 1ZZCA 5KVRA 4KDPA 4WWCA 2XGXA 4MGKE 3KZZA 5LGUA 2K02A 3K2ZA 2IXHA 3C1DA 4I09A 1TLHB 1USTA 1YLFA 5C8WA 3VB2A 2YX4A 4K2EA 1F4KA 1YFXA 5I0UA 4IEVA 2ET1A 4QM9A 3WE3A 5ILVA 4HDVA 5FLXZ 4XFAA 1G3WA 2M8EA 4L9JA 5LRRA 3EQLF 4TLFA 1S29A 4GYGA 1X8MA 3BPVA 4BHPA 3ECHA 5J6XA 4META 4ZYGA 4ETSA 1O4TA 3GO5A 4MNUA 1XMKA 2PFBA 4R1HA 5ICCA 5BOXA 4XFFA 2Z2SB 3MZYA 4QXKA 2D93A 5JAXA 4Z07A 2OAZA 2XKOA 3BPZA 4LUMA 5FLJA 3E6DA 1DP7P 3G3ZA 4F7ZA 2ZMEA 5KBFA 4IPAA 2EWNA 2ELHA 4XLPF 2MA3A 3WTZA 2HFHA 4EM2A 4E2GA 3PQKA 5HS9A 3CJNA 4QGLA 5LGNA 4XSXF 2PMHA 5J48A 2O8XA 1HBXG 1JUHA 2OPKA 2CV6A 4EJOA 2ISYA 3ZN0A 2PAKA 1ULYA 1I1GA 4ZYDA 2YX7A 4MQ9F 1PUEE 1BM9A 1OYYA 3ML6A 4Y15A 1NZCA 1P4WA 3CO2A 1J75A 2OU2A 3VFZA 4P96A 3SCFA 4AIJA 2MH9A 1H9TA 4OIQF 1XSXA 3H1WA 4KWKA 3DF8A 3RNSA 2XLGA 3HOTA 1TTYA 4LA2A 3SCHA 1BBYA 3WGHA 4IJAA 1ZLKA 4QMAA 3L7WA 2EA2A 1G6NA 3JTGA 4AXOA 2IP2A 3KLOA 2HTJA 3FE5A 5FO5A 2ZCWA 4LG0A 1EV7A 2HGCA 5ILUA 2B0LA 3CDHA 4A0ZA 3MEXA 3EYIA 3E6BA 1IF1A 1U2WA 2ZNZA 1X3UA 4LLGF 1BC7C 4WK8F 5KK1A 3I54A 2D5FA 3F21A 1TQ5A 4MGIE 5C6CA 2DW4A 2IXJA 3BCWA 3EETA 1YTYA 3SMHA 1ZAOA 4L5JA 1WKMA 2BNOA 3HIFA 2O03A 3NKTA 2DTRA 5KHJA 3LFKA 1FNNA 1K7AA 5E16A 3ZN1A 2GXGA 4PIZA 2BEOA 3N4MA 4D7SA 1QGPA 2Q0AA 1KU9A 3LAGA 4BYYA 3I58A 5KHKA 5CYVA 1U8RA 4IETA 3CUOA 1UIKA 3CUQC 4MHGA 3P9IA 5TRDA 1OYWA 2Y0OA 1LDKB 3HRTA 2ZO4A 4M74A 3TOAA 4RGXA 2V09A 5D8KB 1IZ1A 4XFHA 2QENA 1OMIA 1HKSA 1G3TA 3FZ3A 4OOIA 3DKWA 4OINF 2W57A 3BU7A 5DUIA 3GLXA 4FHTA 3NW4A 1G4DA 2A69F 4CZZA 4Z2YA 3COAC 2Q2EA 1TQMA 1GVJA 3V8JA 1R36A 2QCSB 2ZKLA 1J59A 2G7HA 3K1NA 1I1SA 2Q1ZB 4KFCA 1LB2A 2XAHA 1O7LA 1XRUA 2GC1A 3ACLA 2DPDA 4RGUA 2M30A 3EUHA 1KU7A 2PA7A 3GXOA 3ABTA 3JW4A 5DCMB 1ZRDA 5EEGA 5D4RA 3ZMUA 2EA7A 1FBUA 3FMSA 2IC1A 4ENMA 1I27A 1YIOA 1CAUA 5CU1A 3H1MA 3O14A 4NVPA 4WZCA 2P6TA 4LFUA 1UPIA 5AONA 3F8BA 2GZWA 1FXZA 3IRQA 1I6XA 4IHSA 3QRFF 2FQ3A 3WW1A 1LDJA 2UY8A 1BC8C 4ASNA 4CXFA 2TDXA 3DPLC 1KU2A 4KN4X 4JTNA 4BH9A 2JPBA 1Y0UA 3OD0A 4Y13A 1PP8F 3V7RA 2F5FA 2QVSB 1XGMA 4ZZLA 2PHLA 3IHUA 1QZZA 4P5OA 2XAGA 1D3YA 1R00A 3G73A 4A2UA 4R52A 4HX8A 1HW1A 3WODF 1NHAA 2XASA 4EQQA 2ZXJA 3ZMTA 1YFUA 1U3EM 2A61A 3IBMA 3F8MA 1DGRA 4ZYEA 5H6RA 5DDGA 3HHGA 2GC2A 2CO5A 4XF3A 1RTVA 2MHFA 3HUGA 1FPQA 2EB7A 4HQEA 4FT8A 3ISPA 2PMUA 4MX3A 2VECA 2P17A 2UZKA 2HKOA 1L3JA 2UY9A 2LF7A 1ZGAA 1J3QA 4XLNF 4KU7A 4EWDA 4EWAA 4HLYA 1BJAA 2EFOA 3M7GA 2XRNA 4AIHA 4KWLA 5JCTA 1R22A 2L4MA 3BROA 4BHCA 3U2RA 1ZRCA 3M3IA 4S05A 2GA1A 2RGVA 3TO6A 4HV6A 4IESA 1Q1HA 5HDKA 2CG4A 4A0YA 1SFXA 1LJ9A 3K0LA 1QWRA 2PJPA 3D5LA 4IEUA 1E2XA 1O57A 1JE8A 4B09A 1YQAA 4X6RB 2M5WA 2O0YA 3F6VA 5LLQA 5FB2A 2WWYA 3RKWA 4M6XA 3ABUA 4JK1X 3MCZA 5CADA 3HSRA 3QU3A 2XAFA 2O1QA 5FDBA 1X8EA 2AXLA 4HAMA 4FX4A 2L01A 3KLNA 1IAWA 3BJ6A 3QOPA 3S7IA 5A2QZ 2RDPA 3R61A 5I8SA 3B73A 4AIKA 2XVCA 3H3ZA 5HI0A 1EP0A 2NYXA 2XAJA 3LWCA 1PDNC 5LEJA 2V1DA 2FBHA 3TQNA 1XD7A 1VP6A 4HDUA 1ODDA 1DZTA 4M73A 2C0ZA 1S3JA 4AVAA 4G94A 3BZ6A 1XGOA 3SZPA 2VOOA 4HN0A 2CW0F 1IXCA 5I91A 1IRGA 3B02A 4HBNA 1UD1A 1J5YA 1SMYF 3JSPA 5D1IA 2GA2A 1IN7A 4Q0VA 2E7XA 1CAWA 3CL1A 3S0MA 4MTEA 4OFGA 3TDUC 5J8CA 4IRHA 3P9CA 1YG2A 5AIPA 2UYBA 5J8FA 1FSHA 1R58A 3KMHA 4UV8A 1MZBA 3P9KA 2DK5A 4LB6B 4IEPA 1SD6A 2Z9OA 3L9FA 1T38A 4YARA 3EHKA 2WC2A 3HYIA 1BI2A 1ON1A 1U78A 1YW9A 5IT9K 2UXNA 4R79A 5LRSA 4HLXA 3G7DA 4IEZA 1ZRFA 5I0SA 3D82A 2IA0A 4JBAA 2PAMA 3IKVA 1RUNA 1CAUB 4RAZA 1KQ0A 1JXSA 3H1YA 3KP5A 3LWFA 3TO7A 1O3TA 4LULA 3HSFA 2DLLA 2XHKA 3T0YA 3PFIA 4G7ZF 3HTSB 5DD8A 2KIFA 1A04A 1Z91A 4LTAA 1CAVB 1ZYRF 3HRMA 3MQ0A 2YPRA 3T5XA 1KYWA 4L5IA 3TOBA 4B29A 3OF1A 2ETHA 2WV0A 5DUKA 2XAQA 1KU3A 5HVQC 2HR3A 2PBIA 3K1PA 3WTSC 3GZ6A 2P5VA 3L09A 2G7UA 4L9TA 4P9UA 1H1IA 4R8HA 2ETEA 3RTRA 1W7PA 2QYOA 1WI9A 4WX9A 1TQPA 1CAXA 3CTAA 3WTTC 3GVAA 3LQRA 4FX0A 3UKTA 2NNNA 3RJPA 1XCBA 2O3FA 5L3EA 4HSLA 2ESHA 1KQ9A 2QBYA 2CWEA 5H6QA 5HS7A 1R23A 2Z69A 2OZUA 2R7DA 1GQHA 2QWWA 2DK8A 3WW4A 2DFIA 3GF2A 5LHHA 4ORFA 1XN7A 4U0VA 5IT3A 3GYHX 1UB9A 3FX3A 1IPKA 2CFXA 2BGCA 1SAXA 5EFUA 4B8XA 2D5HA 3VHRA 6PAXA 2RNJA 3GFJA 4HX7A 4UXAA 4RAYA 4YIIA 1TQIA 2IW5A 1LNWA 3WG9A 5FD6A 4PZJA 4UNOA 2VT3A 1O5UA 2EFWA 4M72A 5K5RA 2WTEA 1R5HA 1YW8A 1K79A 3H7YA 1B1BA 1ZRRA 5HLGA 4IEXA 1P6RA 3CLOA 4LG0B 2DU9A 3PNAA 1ON2A 1WSUA 3BY6A 3DP7A 4CYDA 3TO9A 3T8RA 5FPZA 4O9GA 2HQNA 2PEXA 1B9NA 2QQAA 2P6SA 5FLXK 5BS6A 2VC0A 2MPFA 1P4XA 4RB0A 3U1DA 3AAFA 5D4SA 5FD5A 4S04A 3KP7A 5DCFA 4HBLA 2GH2A 2DBBA 4O5VA 1S7OA 3GBFA 2OQRA 2Z5UA 3V7SA 2STTA 4Q0QA 2FOKA 3KGLA 4LEJA 1FYKA 5K5OA 3F72A 3USSA 5K1YA 4MH0E 1U12A 2W24A 4QGNA 3S2WA 4E70A 3KGZA 3D0SA 5FFXA 4HYEA 1DPRA 2X0LA 5E8GA 4KA4A 2ISZA 4LA3A 1T39A 1BN5A 4X6QB 3GFLA 3LAPA 2OZJA 3ZQ7A 1SQ4A 3VOEA 2CAUA 3CJXA 1DGWA 2N7GA 3RYPA 4HX4A 3UKVA 4A5NA 3WTXC 2BV6A 2FE3A 4I98B 1SD5A 3TDZC 4IF4A 1BOAA 2ATFA 5HDGA 4HVQA 5JFRA 2C6YA 1MDMA 4JQFA 3KCCA 2QLZA 2Y0MA 2WFPA 2ZNYA 5T3NA 4ZYHA 2PLYA 1C0WA 1Z9CA 4I3PA 4HN1A 1W4MA 2D45A 2W25A 2Y75A 3ZMVA 1B4AA 1W5SA 4KUMA 4P55A 1FWZA 3EO6A 2HZTA 3Q5FA 1U5TA 2BNNA 4PJYA 2P4WA 1WWXA 2EV5A 2XV4S 3I5UA 2GQQA 3HTUA 4RS8A 2PI0A 3M1EA 5AIQA 1BI0A 4Q0SA 1RGSA 4YYOA 4IHTA 3E5XA 5JSRA 2FU4A 2XL9A 4UVBA 2XL7A 2KJCA 5DCMA 5LHGA 1PMIA 1UCRA 1AWCA 2NAZA 2B9UA 1J7KA 1LDDA 3QAHA 1OD5A 2JT1A 3KSCA 3KEQA 1XE8A 1RUOA 3KP4A 3FXQA 1HKTA 3BJAA 1T98A 4Q29A 2VE9A 2JZYA 1UCXA 1LEAA 4LLOA 2KJBA 4QWQA 2DI3A 2A68F 1QPMA 1VR3A 2EAAA 3OOPA 2ZJ2A 4HW0A 1Z6RA 4U7BA 4K8FA 2VC1A 4JTOA 2HJIA 4WCGA 1LEBA 4IXAA 1SFUA 3NEUA 1FT9A 2LDUA 5J3UA 2MLGA 1FYMA 4KN7X 5HLHA 5D6FA 2OA4A 2HTSA 1IRFA 1Z7UA 2DQLA 3JAMK 2MC3A 4EROA 1S8NA 1K78B 4NB5A 1HQCA 2XLFA 2H94A 5BMZA 4OU0A 1OFNA 5F1RA 2J5OA 4N9IA 2FA5A 4HVOA 5LHIA 3GX4X 3ROUA 3M70A 1WA4A 4YFKF 1IN6A 4U0WA 2EFPA 4HZFA 3DN7A 5H20A 4MZUA 4AVCA 1G3YA 1OPCA 4J1XA 1TW3A 5JR3A 3R0AA 3F6OA 1HKQA 1YYVA 2O61A 1GHCA 2FXAA 5L3CA 3U10A 1J2XA 2OZ6A 5FQ0B 2PYTA 2IVMA 4EWEA 3I4PA 1F5TA 1OKRA 2ESNA 1BI1A
chains in the Genus database with same CATH superfamily
5FYYA 3BOPA 4QPIC 1SMTA 3FBIB 2MEV3 4B44A 4Z82A 3F3XA 4KU8A 4QXBA 4FXGB 4NHXA 4AFDA 2ZAAA 4Q5OA 4W97A 3BN6A 4R9DA 2HVQA 2L7FP 3Q8AA 1JZ5A 2RQPA 1MS0A 1DDNA 5DV5A 5FMDA 4Z2AA 4JCKA 4I99C 3SH4A 1NCQB 4OMYA 2DA6A 5C5UA 4FPGA 3HAGA 3FMQA 1HRI3 4LB5A 1IV8A 3G71I 3WTYC 3WW2A 5J1XA 2I45A 4CICA 2O0OA 2GN7A 5IOZA 1O4YA 1AOYA 3ZDSA 5A1LA 2ZX3A 2VXZA 3GBGA 4ZU5A 1IN8A 4BDZA 5BPIA 4ESBA 1P92A 4WM8B 4BE2A 3QYEA 4XF4A 4CCEA 1D0GA 1TL8A 3H3LA 4DY5A 4UW4A 3VBSC 3OBRA 3UGHA 1Y6IA 1EAH3 3L2YA 4EN6B 2KRCA 1FY7A 1G9BA 2E5ZA 1VMJA 1S5LC 4C2TA 2QM3A 2ZZJA 2EF6A 1DGRN 2HYXA 2RR13 4XOTA 4TN7A 5HV4A 1YXWA 4NJ4A 2R3SA 1ULCA 1YRNA 3TMOA 1GYKA 1YQ6A 4XFCA 2JENA 1APNA 1GP4A 2ECCA 5LBEA 2OS2A 3E5UA 2OXBA 1T0FA 4L18B 5A3PA 3BALA 3SYTA 1AKHA 2M0MA 2VIXA 4AVPA 2EXKA 1R7JA 5TJJA 1O8SA 1EUUA 5E1XA 5L3GA 2CSGA 1BJQA 4Q4X2 1FBQA 2JG9C 1YIJI 3HOVJ 3VBSB 2BZTA 4LHLA 4KIFA 5DUUA 3AL0B 2P3KA 3DEMA 2VPRA 2XGDA 1JTZX 2DMQA 1ZARA 1DP3A 1G2HA 4HOBA 5HDNA 3HG9A 3ECOA 3TN92 2WLQA 1XYNA 3UKGA 1Y9MA 5FRAA 5I0TA 2BBAA 3NNJA 3HRSA 1UZZA 4XJ9A 2MNGA 3B3QE 1YI7A 1W7PB 4RS5B 2FCUA 2W0XA 2ZMNA 4IW3A 4GB31 1JT0A 4NPRA 3IMNA 1ETOA 4XXAA 1DZRA 2NP0A 2D1HA 2X51A 4E7JA 1YLLA 3LKJA 1HX6A 2ARBA 4UHTA 4G6QA 3FXUA 3KP2A 5JHUA 4GXLA 1PX4A 2E53A 2F17A 1ZKGA 3W2WA 4NRQA 4CDQC 5A2QK 1FYUA 1WLCA 2OJED 2B9SA 2X1CA 3FF5A 2RDSA 3LFUA 3T2OA 1URXA 2VZ3A 1V3FA 4FFHA 1OURA 4DPNA 4RDUA 1OA4A 4LOTA 3OGGA 3DBHB 2CQ7A 4FTSA 5T50A 4FP3A 3I0TA 2RMU2 4QKNA 4L9VA 3KS7A 3LEKA 5BNNA 5BQTA 5JMCA 2JG8A 4EJTA 3FM3A 4TSVA 1DG6A 4QQPA 1IS5A 2OUMA 5JPNB 5EHDA 3LOBA 1JGSA 3FXJA 4YFWA 1UFMA 1TZOA 1AVBA 3C3VA 2VU9A 2HKXA 3ILNA 5ERIA 4Z2WA 1Q3EA 2UU8A 4ZXEA 3CMMA 3DL3A 3AP5A 2WNVB 2LKPA 2NVTJ 3NARA 1KQ8A 5DAQA 3P5BA 3ZFEB 3DV8A 5JR7B 2W82A 1UQXA 2PQ8A 3KZIC 2XB6C 2FDJA 4GCVA 4WM7A 1VIWB 2E1CA 1CPNA 2G19A 3BTAA 2K86A 1W6NB 4PDWC 1MIJA 3JRGA 4TYSA 1W9WA 4ZDOA 4BQ5A 4WVMB 5AVPA 2PN6A 3CJIA 1V6KA 1JBCA 1FI2A 1QU0A 1ENXA 5L9VA 2BVLA 1JYNA 4PDWA 3FXOA 2YU2A 4JZRA 3POSA 4AGVA 1IC8A 1VBE2 5KHGA 4GWIA 3PMSA 3C8XA 2Y69H 3CLPA 1CF7A 2WO1A 1SD4A 2V9PA 3K6GA 2DTYA 2EQRA 2QQUA 3CQOA 1D7PM 3SNMA 1CVNA 4OULA 4QM8A 2M7BA 4A6DA 4YGEA 4EGYA 4GH4A 4AHYA 3V7CA 1CESA 3AG2H 4XN3A 1N1YA 4BBSJ 2UXXA 1A78A 3KV6A 3SDGA 1C1LA 1C1FA 4PLOA 2PHXA 3P3PA 1TP4A 2W08A 2QQMA 3D0JA 4YGCA 1BW5A 3H7JA 4XBLA 5IK4A 3FBNB 1QPIA 1KDMA 3C7FA 1OD3A 3UETA 4M6YA 3MDPA 4AUXA 2WNOA 4C2MJ 2JDUA 4WF2A 4HNVA 2JD9A 5FQ0A 2P7CB 3WU0A 3AVSA 4FPLA 4YM3A 4N4NB 4UFHA 3BTZA 1P4AA 4WXCA 2X4HA 9ANTA 4V2FA 2OKXA 2BERA 1SBFA 4UBHA 3WTVC 3B00A 3LNQA 1XB4A 3IH2A 2Z42A 4G6DA 4LXLA 2LF8A 3AJZA 1AR71 1WCUA 2VUJA 4Q26A 1DCSA 2JSPA 3OTFA 3W6KB 5EQUA 4D9JA 2VNRA 4B43A 3KT7A 4BE3A 2ILMA 3X29B 1JTYA 2ADDA 4IV1B 4XLFA 3MN2A 4XN0A 2A6YA 2K9ZA 4U0YA 4SBVA 3QP6A 2Y9YA 3BR0A 1VTNC 4E6KG 2HOAA 2CTVA 5CISA 3MZHA 1RL3A 1AHSA 3L2HA 4XR6A 5L3FA 2NNYA 1DQUA 5J47A 3LPGA 2WY7Q 2AO9A 4M71A 2WB1A 2KIMA 1VJ2A 2YZ4A 3W3CA 4PSWA 3K77A 4C9YA 5BNOA 5CKNA 4N90A 2F4PA 3RYKA 2LLKA 1EA3A 3WDUA 2JG9A 4MUVA 4OIPF 4JGZA 2BW3B 2VQHA 5JLWA 4L97A 1CJDA 2XBO2 2BY3A 1R5ID 5IYCJ 1XMXA 3G6EI 4ARYA 4BQ3A 4BMEA 2E1NA 3HOXJ 4HL0A 1W0PA 4F91B 4BQOA 1YJWI 4HPKA 5M3FJ 4XNFA 1S1AA 1XNBA 3DKQA 2Q30A 1NA1C 1A8DA 4E2QA 4COUA 4J01A 2IPQX 3CJTB 3K70D 2J1AA 1K83J 3PUIA 1H2LA 2XJUA 5FUNA 1MS3A 2A3YA 3HVDA 3M3EA 1HLVA 1LKNA 2EA4A 1EJ9A 1BI3A 3KB5A 4P9FA 1MH3A 3RPQA 3UK9A 1UY4A 4JDMA 5E79C 3W5NA 2M1BA 4BB3A 3REOA 3AKTA 1DGRM 1A5JA 1RVF3 4GALA 1XC5A 5K9YA 2R7SA 1MACA 5FWEA 2ZHLA 4WM8C 2VXRA 3BOQA 5JOWA 3HN1A 3D8CA 2RDQA 4Y52J 1PMJX 2DCYA 2K7LA 3CJIB 3NWKA 2ME0A 3JSOA 4X6AJ 5CKTA 4FAGA 3MPPG 1IRXA 2RS31 1KDKA 5BPDA 5C4WC 2FBKA 4L9NA 3JB8A 3IPVB 3AMHA 1RUG3 5E8IA 5LZ6A 1VALA 2VT2A 4AZZA 3WQBA 3RZGA 1RZ4A 1D5VA 1JT6A 3HBLA 1F31A 2XKPA 2WNVA 3A01A 3JUUA 4MO7A 1HXS3 1WD4A 2P3IA 3W2AA 5D8AA 3K3NA 1G7YA 1Y1WJ 4IX7A 3OPTA 2L02A 1BK0A 3IRRA 4XVHA 5B66C 4RB3C 2QGUA 1STZA 4I6ZA 1T6SA 1WJFA 3GW2A 3C3WA 3MI8A 4RB2C 5HNFA 5E1ZB 1BKZA 4GAZA 3J81K 1E5RA 2L9LA 4LKDA 2ZMEB 2BWAA 1Z78A 1HJGA 5D5XB 3GTMJ 3NL1A 4HKWA 3BCAA 2W85A 1O91A 3A7QA 4ZXKA 4KG0A 1J0RA 3LSPA 5T5PA 2JDKA 5I93A 4E4DX 3OYAA 3ZO0B 3FL7A 3K4LA 1UMZA 4XIOA 2HPMA 1ODMA 4KH9A 2CQNA 1UIJA 3NVCA 2AREA 3HNBM 3OL3A 3F0CA 4F3JA 3O1OA 2M87A 3T1BA 4K20A 5CVRA 5JDBA 2FQ4A 1VBA3 2VNOA 5K5QA 2YSRA 2PFWA 1QXRA 4Q4W1 3DYMA 1YS7A 5FZKA 4DNCA 5FP9A 3IKTA 3I4NJ 2GP3A 1IUYA 4CP1A 4N9HA 2CQXA 5IVEA 3VZOA 1QDCA 1WGPA 2R93J 4M9SA 2Y31A 2UYAA 1MJAA 4XOPA 3J8F1 1WKYA 2H0VA 1HW2A 2DDUA 1GXQA 2V1UA 1QXJA 1UY1A 4MGYE 1P2FA 2VJJA 2VB6A 1B8IB 5DAPA 1R093 2UUZA 3KLSA 2E51A 3T30A 5ILSA 4U7DA 3PL8A 2G1MA 2HVSA 4G4FA 4Q4V2 2JB4A 4ZU7A 1CAVA 1XGSA 5FZAA 1POQA 5DYMA 1UOJA 3JQWA 4WV8A 3WUDA 1XOYA 3N9MA 1C8M3 4AD9A 1MBGA 3AYDA 3LSGA 4CGZA 3OBZA 4YG3A 4MFEA 4G12A 1ULFA 2IFRA 1GR3A 2DA7A 2R073 2Y6LA 2R7FA 1LOGA 2P4EA 5FYZA 1RJ7A 1FP2A 3AB0A 1QNTA 3I97A 4UV9A 1O5LA 1RUJ2 3WNLA 1PO21 4KL1A 1VAVA 4DEVA 3VD3A 1KS4A 3UV9A 5F6KA 5JSOA 5FJHA 4A5MA 5DPNA 1KA8A 1WCSA 4HSTA 4XKWA 2E60A 4K3UA 5SV5A 2KXLA 1UYYA 3VZNA 1NE6A 1RB8G 5HPOA 3ZXJA 4HFSA 4DZPA 3P5JA 2HLEA 4PIXA 3SH5A 4ESJA 3THPA 1S2BA 5AC92 4FPYA 2JIJA 4HETA 3QODA 2YR2A 2OBPA 4XEZA 4HSRA 1U8BA 1I5ZA 2W2IA 5L3DA 4AL9A 5DMYA 1J09A 2DT7B 2FNPA 1WLWA 2EIMH 2JPCA 3Q9SA 1Z6TA 1JXNA 2L4AA 1Z7LA 2A1XA 3CF5F 3KF3A 4FOYA 4CA9A 2GN3A 3C7HA 2RV8A 3BTXA 1SFNA 3N35A 3ES1A 1OVPA 3ZR5A 3KVAA 4KIBA 1NXMA 4FFFA 3E6MA 1K5MC 3GFIA 1UHWA 3APBA 1UYZA 1VBB3 1FOD3 1RUE3 4OZXA 2XONA 1LVKA 2GP5A 1ZG1A 2RNGA 5IVBA 1XSDA 2CGPA 2WADA 1X36A 3NQHA 1B59A 4BXXJ 2NVQJ 1ZH5A 3POEA 5FZOB 1TNSA 2VBPA 5FZ0A 2VODA 5HCAA 1QIQA 4EM0B 4HPKB 4X1EA 3DFGA 3GUDA 2VCMA 4NHLA 1OKOA 2LR8A 3TKYA 1RUC2 3A2KA 3MW2A 1RKWA 3HDDA 4B3NA 4RGSA 1MJBA 5CVVA 1OI6A 3V8LA 2DA3A 4RN5A 4XFIA 4PGGA 1UL9A 2ORZA 2XGCA 2WL1A 1G9FA 3PIJA 1ST8A 2CUFA 5KXEA 4UXNA 4FP2A 4NHYA 4PJJA 5B4XA 4CZSA 4ISQA 5HNHA 1QY4A 2VUCA 2CUZA 3HWJA 5SV8A 5CZKA 3U1KA 1I9RA 5GJ6A 2VBDA 1AL21 4WWCA 1MNDA 3AG3H 3KZZA 4PFOA 2IS4A 3K2ZA 4O65A 4I09A 4TLGA 4WVWA 4NWVA 2A5WA 5C8WA 4BY1J 1IKPA 2E35A 4K2EA 2DOEA 4QM9A 4HDVA 2WQ4A 5FBJA 4Q8LA 4XUNA 3G1OA 1S29A 3MLJA 3BPVA 5FYSA 2IGMA 2BDRA 1EV13 3QWLA 1O4TA 3JRAA 2PFBA 1EF4A 1O4XA 3LSHA 5ICCA 5BOXA 2PHTA 2JJ7A 2Z2SB 1FOYA 2CGOA 4RMNA 3GZAA 1UU4A 5FYHA 4Z07A 1AL22 4LUMA 4UFLA 1SBEA 3E6DA 2ZGSA 2ZMEA 4DFSA 5KBFA 5F37A 2ELHA 2DA4A 3HEIA 4E2GA 4CEYA 5LGNA 4ZZ5A 5APAA 1CZSA 1JUPA 1RIRA 5F3GA 1ONAA 4BJTA 2OF7A 4Y3OA 2ISYA 4Y5Z0 4NO4A 2Y60A 5T5JA 4RQPA 2ARAA 2HEVF 2F48A 1BM9A 4OVEA 1SDDB 1XB9A 3ML6A 2EH3A 4CP9A 2WO3A 1J75A 1H6YA 4M6VA 3BIEA 3VFZA 4P96A 1IG0A 3KT1A 4AIJA 3SCFA 3F2ZA 3GTOJ 2BOJA 1W05A 1XSXA 1V6LA 3HZJA 4KWKA 3DF8A 2XLGA 3T1LA 3PMEA 3O1UA 4KBBA 4AHZA 2XHNA 4AC0A 3JTGA 1OKQA 4AXOA 2IP2A 5FYVA 1BBT3 2ZCWA 5ILUA 2B0LA 1S0BA 3DPRA 2Y34A 2YBSA 3J7YJ 3E6BA 3W5MA 2ZNZA 1BC7C 4KWUA 4OHZA 2RQQA 2DW4A 1YTYA 5ACA1 5C3OA 2BNOA 2IVJA 3DXTA 3AMPA 3AKSA 3SISA 4JX5A 2DCZA 2GM4A 1N75A 5IAVA 4IOAF 2HWE1 3OUIA 5E16A 2I10A 3OGSA 2MD0A 1BYHA 3TRSB 2P5BA 1DU0A 2BEOA 3N4MA 4CUAA 1QGPA 1JHJA 1KU9A 4B1LA 2ZGTA 2K40A 1VF9A 3OYWB 2NYYA 5IFPA 3CUOA 4QKFA 1BLZA 1UIKA 4NIAA 3CUQC 4MHGA 2WV1A 4GD4A 4XCBA 5CYYA 3TOAA 1JZ6A 1IZ1A 1COV2 2K9MA 1G3TA 3OSGA 4AF9A 2DODA 2QQVA 2A6WA 2YFZA 1A35A 2LRPA 3AX4A 2A69F 4FFGA 3COAC 1W8OA 3V8JA 5HCBA 1QJEA 5CFCB 3URFA 3THTA 1Z21A 4D6RA 2O14A 2R0QC 4P9IA 4U2AA 4L92A 4KFCA 2ID6A 1LB2A 2XAHA 1R091 1CN1A 3VB9A 1YX3A 3ACLA 1U5XA 4RGUA 2R042 4SLIA 2PA7A 5KNLA 2NPIA 3DU6A 5EEGA 2ZGMA 3OIPA 2X29A 2ZX2A 5CU1A 2VTXJ 3O14A 4NVPA 1TWCJ 1RYYA 4YVSC 3VBSA 1FJLA 3VBRA 2PHRA 3MHZA 4NIDA 3MGUA 1BC8C 2WY8Q 4ASNA 1KD7A 3ZN4A 1A8MA 2TNFA 1KU2A 4KN4X 2DU0A 4A3IJ 3ZX7A 3OD0A 4RLQA 4Y13A 1V55H 2F5FA 4Q4W2 3WNKA 3BG6A 1XGMA 1AR83 1GUIA 2PHLA 4AI1A 5FYIA 4IV3A 1W1WE 3IHUA 3FLPA 3J8F2 2R32A 5ISLA 2XDVA 2GXAA 3WODF 3EUKL 1JHNA 4EQQA 1YFUA 3NV2A 3B7MA 2A61A 4L0PA 3A0BC 2L9NA 5FK7A 2QKMB 1JI8A 4HK9A 5H6RA 1WCDJ 1XS9A 2VQ0A 1C28A 1RESA 3A22A 4HQEA 4CDWB 2EZLA 1L3JA 4KU7A 4F93B 3ILFA 4EWAA 4HLYA 4E4ZA 4Q4V1 2EFOA 3M7GA 4YVWC 2XRNA 4AIHA 4KWLA 5E3LA 1N3PA 2WNUA 2DFHA 2ME6A 2GA1A 3MZ8A 3DKYA 4BXSV 4HV6A 2AQFA 3K0LA 1QWRA 2PJPA 3RWNA 3SLIA 5JXHA 4XRSG 2IXSA 2VUMJ 4N4OB 1LEMA 5FY5A 1SBDA 5A1FA 4X0GA 4IEUA 1PO13 1E2XA 5IP9J 1O57A 4B09A 3F6VA 2BY1A 4CCOA 4M6XA 4A44A 2P1BA 3MCZA 1W2NA 2F6BA 2O1QA 1X8EA 4QXHA 3VD9A 2JE9A 3ZVXA 2RE9A 3ZFEC 1XNAA 2R1BA 1D2SA 4P5HA 2O7OA 3FUQA 2Z16A 3HUGB 3OYJA 1MBEA 2AXTC 5DG2A 4XLEA 5I8SA 3H3ZA 5HV0A 2R061 3ZFEA 5LEJA 4QXCA 1TMF2 1WMFA 4BQWA 3AZXA 2YV8A 2C0ZA 4AVAA 3NAUA 1XSRA 3SZPA 4U36A 3DEEA 2DA5A 5I91A 1IRGA 1AXZA 4Z92B 1D4M1 1J5YA 5D1IA 2GA2A 4YW1A 3C2BA 1CAWA 3TDUC 5AIPA 1YG2A 1FSHA 2X09A 2FCVA 3T0DA 3AKRA 2CY6A 3H3VK 5DTDA 3WCRA 4LB6B 2PN5A 4NR1A 2ZPXA 3CHXA 3I3MA 4YARA 1BI2A 3S14J 1YW9A 2FHRA 1NZIA 4R79A 2HEWF 4HLXA 5DAWA 3CIHA 4CDXC 3ZXEA 3H36A 4XK4A 5I0SA 3ME2A 4AVVA 5BNNB 1LECA 2PAMA 2CYFA 3VDDC 4Q4X1 3ZXFA 1H2MA 3C2GA 2E5NA 1KQ0A 2RJ2A 1O3TA 3HOBA 4E7SA 1MZ5A 4LULA 3HSFA 2DLLA 2XHKA 1Y0NA 3LQCA 5B3SH 3PFIA 5DAVA 3HTSB 3W6VA 5CG8A 3SZGA 4EEFG 1Z91A 2B4KA 2DFBA 2DMNA 2YPRA 3NRUA 1ETVA 4FPOB 2YDEA 2WV0A 4AIDA 1Q8QA 1XXNA 2X10A 4PJ0C 4Y22A 1MMGA 3VBRC 1R1ZA 2QYOA 1WI9A 3CTAA 2HPIA 4XRSA 3LQRA 1B35A 4FX0A 2P6HA 4GWMA 1K12A 1PHMA 3BU0A 4YVWB 2KMUA 2SBAA 3OS0A 1KQ9A 2Z69A 5A6QA 1NG6A 4G9SB 3A0KA 1TMF3 1NX9A 3WNXA 1MZEA 1VBC3 3ONQA 4D6SA 3UESA 4EE2A 2BQPA 4M00A 3K4ZA 4RYDA 4XONA 3VHRA 6PAXA 1ZRIA 1UOBA 4ZDLA 1TQIA 2WNEA 2IW5A 1W9YA 1H88C 5FD6A 3EMRA 2AEZA 5K5RA 4AGRA 2QA4I 4E8DA 2XPUA 1C4RA 3H7YA 3F95A 5HLGA 3K2OA 3CCEI 1I5PA 2FDFA 4K7JA 3KWVA 1WSUA 3VV1A 3V65A 4M4PA 3TO9A 2YBPA 4LO4B 3BTLA 1JYCA 2HQNA 3BR1A 2QQAA 1NCQA 3MLLA 5C70A 2W52A 2VC0A 3N7MA 1P4XA 4RB0A 4FQ4A 5D4SA 2HNHA 1T6BX 4S04A 5DCFA 4HBLA 3IAQA 2GH2A 3S1QJ 1S72I 5A70A 2YUEA 1S7OA 2ZC2A 2OQRA 4Q8KA 2IGNA 4LEJA 1FYKA 1C5HA 3BKZA 3O8HA 3F72A 2V72A 4IQ4A 1U12A 2W24A 2WYFA 3S2WA 4ZS2A 3VD7A 3ZSLA 3NWSA 2G9GA 4HKOA 3OYDA 4HYEA 1SPPA 1DPRA 2ISZA 4LA3A 3MF6A 4I30A 2WAEA 2PQSA 3LAPA 3N9QA 1JYVA 3ZQ7A 1POV3 3QOEA 2WYSA 3VOEA 2YY1A 2VOVA 3S1MJ 3VHOA 4Y1ZA 1I50J 4HX4A 3UKVA 4DQAA 3NV1A 4YG0A 4I98B 1SD5A 5FZGA 3WNPA 1NG7A 4YW4A 4HVQA 1X9PA 3J7ZI 2HWF2 3AXEA 2MC4A 2KPMA 2Y0IA 4F3QA 1P9QC 3ZQLA 4ZYHA 1W6PB 5KC6A 4B4RA 1GNZA 5F5IA 3PNVA 3ALQA 1Z9CA 2XH6A 3K7AJ 3L2QA 4I3PA 4CUGA 4CYCB 1N25A 1O59A 4CCLA 4R9AA 4A3FJ 2IS6A 2W25A 1VBC2 1PIV3 3H42B 5GLTA 5GAEJ 2Y75A 1REEA 1W8HA 1H2NA 3EO6A 3QQAA 3WNOA 4DZJA 4COYA 3Q5FA 3PTYA 3BTIA 2DYRH 2EV5A 1WUVA 3HTUA 2BW8A 2PI0A 4CVUA 1JOJA 1Y1VJ 1RGSA 4QPIA 5H9PA 1WW6A 2L2OA 3M3OA 5IW0A 1SLBA 1JS9A 2LD5A 2N8GA 1UCRA 4M3CB 2WA4A 2JDMA 2Z5WA 1OLME 2B9UA 5C9AC 5CBLA 4XDQA 1XG1A 2LM3A 2YMZA 1RUOA 1YJ9I 1T98A 1OUSA 1BBT1 1N1TA 4O61A 4LLOA 4C1XA 2DI3A 3AL0C 3VN4A 4FE4A 4GRIA 5DQ0A 4XZUG 2ADEA 3OSDA 4JTOA 1JKQC 1WCKA 1UYPA 3NEUA 2EIEA 1FT9A 1AYM3 4YVSA 3ZFFB 4KN7X 1LOCA 5HLHA 5D6FA 2VKVA 2OA4A 1Z7UA 4N53A 2DQLA 3JAMK 2Y64A 1V6IA 4EROA 1UXZA 2PHUA 1UG0A 2H94A 3RCOA 4IOCF 3MIDA 2FA5A 2XF7A 3MIBA 3HR9A 4HVOA 1OJLA 3ROUA 4J6GA 1IN6A 1F8VA 2DTWA 4LT5A 2KD7A 3DU5A 1D0ZA 2VZUA 1OC1A 1HOMA 3R0AA 4A3LJ 4CE8A 1GHCA 5ANNA 2FXAA 5L3CA 5IT6A 1W0OA 5K0UA 3U10A 1W06A 2OZ6A 3ZR6A 2PYTA 4QSHA 1ETKA 4M3DA 2R7OA 2ESNA 3WT3A 1D4M2 1W3VA 3QP5A 5ICFA 3MBWA 5BXXA 3O1SA 1EH6A 2JDZA 5HLIA 4TTGA 2HWC3 4DBQA 3ZMOA 2X1DA 2L7KA 3OYBA 3NJYA 4XUOA 2O5RA 1V54H 1TME3 1XMAA 4Y26A 1HSJA 1Y8QB 4LKEA 4JKLA 4LK1F 3I2DA 4AFAA 2WNVC 1RPWA 4COWA 2R92J 2CV2A 1QO0D 3ZSMA 1CF7B 3NSTA 2R5YA 3VYRB 1NK3P 1NYWA 1SCRA 3PUAA 2P6CA 1LQ1A 4XLCA 3JXSA 2L9VA 2B9VA 3CUQB 1FOXA 4PDWB 1PUFA 1HQLA 4DY3A 2VQLA 3E6CC 2MEV1 2OD5A 3R60A 4QD2A 1RR8C 2XVLA 1LOAA 4CH7A 5C7GA 1IGOA 5B1BH 2QZ8A 4EJVA 1IDYA 4EATA 5F3CA 5LBQA 1Y7BA 1SVMA 2VQUA 4A3KJ 4DYCA 4AR2A 4RR3A 5FXZA 4AWDA 3AK0A 1V4RA 1XNDA 1BEV2 3IWZA 1W8NA 3ZYHA 2DJIA 4PJLA 3ZFGB 2QVOA 4ZDPA 5C9AA 4FPKA 2E63A 1QZYA 3AMQA 4L2NA 4CDQB 5J1RA 1UMIA 3NO8A 1N3OA 2AS5F 1J84A 4XW3A 1YQ8A 2CV1A 3A0HC 5AC93 2PJRB 3CF6E 3HQXA 4WXDA 1VBB1 5CB7A 2E19A 4P9GA 2VQTA 1I1EA 4BQYA 5H9RA 3HPHA 3J9SA 3IV5A 3O0WA 3ETPA 4H4KC 1EH7A 3I3EA 4KMUX 1YFYA 4A3EJ 1WGXA 4YG2F 2PG4A 5A80A 3RQIA 2RJKA 1X4OA 2ZHMA 2BV4A 4IGPA 1IPJA 3K70C 3FHIB 1RUI2 4A3JJ 1X9TA 2DA1A 3VZKA 4JV4A 4IE7A 2TUNA 2HYGD 2KZGA 2DXIA 2WSVA 4D5CA 3S16J 1RIOH 4JKMA 2E7AA 4H55A 2F5DA 1VQ6I 1A6CA 3FZVA 1L7LA 1P7JA 2IA1A 3U21A 4A3XA 2K4JA 4HK8A 3H3UA 3MAJA 4PF1A 4QKDA 3VDCA 4L9BA 5LA0A 1APLC 4OI4A 2E1OA 5FXXA 1VQ9I 3LPFA 3GWZA 4TV7A 1PO23 1V6MA 2F5EA 2FSWA 4A42A 5JSPA 4UWDA 3GCMA 5E20A 3SDBA 3SEEA 1M06G 4A6EA 3RPUA 4Q4ZF 4L99A 5C33A 4BHBA 2XUBA 4DEQA 2VASA 1RJ8A 3V0AA 1U0JA 2LSOA 3WNMA 1YRNB 4UUVA 2JN6A 2V7FA 3ZYGA 2HEYF 1YEWA 2X8KA 2OC6A 4A45A 3WINE 1R1UA 2VZRA 4Y20B 2KKOA 3H50A 5K0UB 4MGZE 4URTA 4A3CJ 3IAPA 1QKQA 2LBFA 5LGTA 1GBGA 4CEYC 2YGLA 1GZ9A 1SACA 3GZUC 2A6HF 5FMOL 1MGTA 4QPQA 1GV9A 2LS6A 1T08B 4QX5A 5CKQA 2ELJA 4KYWA 4Q48A 4I0BA 4BUPA 5FCCA 2WAFA 5E3NA 5FO8B 1Y9GA 4EMSA 3FXLA 1PM4A 4HPQA 2ZHKA 1FSEA 1TWFJ 1OLTA 2FBIA 3WU2C 1R4NB 4UUTA 3GYDA 1YQ5A 1ZZ8A 2PHDA 4Q0UA 2R16A 4QX2A 4BJ5C 5J37A 4LIUA 3M8LA 2A71A 2B8MA 1C5IA 3VBOB 3MKZA 4D1QA 4LLLA 2JDPA 5F9TA 3OYKA 2J1UA 4XKBA 3PNTA 2JA2A 2QUFA 1UN1A 4GXOA 1PK6C 1H1MA 5DUXA 2Z79A 3ZOBA 2RM23 1WZXA 1VQPI 4Q0PA 4XYXA 4YFNF 4BQAA 3FBYA 3FHZA 2F4OB 5A7OA 1K5MB 5CVUA 3DXJF 1ZTRA 1G86A 1GICA 2L9RA 4AVZA 4XQ4A 3AKZA 5C4XJ 2XOMA 1EYBA 4RL7A 2UWAA 2LW8A 5JXGA 3LA2A 3I59A 4L0ZB 4DUWA 4BU2A 1GUUA 4LJZF 1LAJA 1QVUA 2RREA 3HXLA 4JVAA 3TNPB 4EQVA 1DPUA 5AC91 2DA2A 5EF6A 1RMU2 3A03A 5E8AA 2Q4SA 4IDZA 4XFBA 5JMOA 3SFZA 1NK2P 5A7QA 1LOBA 2LROA 1W6PA 1QF3A 1XGNA 3CC7I 1WCQA 1FNZA 4LBKA 4DXRA 2AC1A 4MV2A 4JRLA 4E9KA 1RRJA 2Q2EB 3WDXA 2XUEA 2VXJA 1REDA 2AACA 2PELA 2CW7A 3CO7C 2L5QA 4KISA 1ENQA 3V64A 5EPAA 1ZG5A 3L00A 4JGYA 1VQ5I 3S57A 3WDYA 2QQNA 3LZZA 1WH5A 2BYVE 4QLCU 1YWKA 2DPUA 2J1TA 2DVDA 2DMUA 2EPFA 4AQTA 1JJ8C 4C30A 4H14A 3S5AA 1YQCA 4Y33A 1FIAA 5LWBA 2H09A 3WP5A 4NIIA 2OUJA 1COV1 5T5OA 1EV11 2JA8J 1GOFA 1RUH3 2C5DA 3NRVA 1AR62 3UKNA 3NNFA 5FBZA 4BJ0A 1DHKB 2W91A 2WFF2 1NUKA 4L0YB 5CIRA 1YW7A 1Z7S1 2CU5A 4BM8A 3USUA 2YC4A 1XU1A 3HJEA 2JSCA 2EFNA 1F1ZA 2GALA 1NT0A 3MIFA 2D40A 3CEWA 3WR0A 1V6NA 4GMP3 2W1UA 2EAKA 4GQ7A 1GZCA 3MW3A 5HS8A 2W94A 2ZHNA 5EYXA 1LFUP 4HF1A 2NN8A 1MS5A 4XJZA 2VM9A 5E1RA 1RUG2 1QHDA 1MS9A 4EJWA 4LMYA 1UPSA 3NQOA 1UZ0A 2WIIB 4NIHA 4J19A 5L73A 3WD5A 3W6JB 2KLOA 2LP0A 3QH6A 1CWPA 4QDRA 5E3OA 1NCRA 1TW2A 4CEWB 3ZQIA 3TL4X 3LL7A 2XJQA 1TE1B 1X19A 3WEZA 1XX5A 3V0AB 1ZX5A 4BEHA 3E97A 1CIYA 3CKHA 5IVYA 3M4FA 2VBXA 2UWMA 4F55A 4Y5SA 1R1VA 4IV3C 3GJAA 4Q1PA 1FYLA 3WGIA 1HB1A 4LO6B 2BBYA 1TVGA 2WT1A 5I0RA 1MQTC 1RUH2 2FZ1A 1F5FA 2V73A 5LB6A 3IDCB 5IT9Z 4C2UA 5F64A 4E8CA 5FFZA 1ZLJA 1ZQ3P 3S17J 3J4UH 1WJDA 4B3XA 2TBVA 2VTFA 3BB6A 1GZWA 1VBE3 2WB1N 5FPXA 5L19A 3ELKA 1ZZ6A 5J4YA 2ZJPF 4CHUA 1XDSA 4ZZDA 3IIAA 2EV6A 4W8JA 5FY7A 2OIIA 1XDUA 4Z6YA 3CD6I 1LE8B 2FF4A 3OEBA 1OYIA 2E71A 2MEV2 3BTCA 5EEHA 3MFKA 4YRVA 4MEYF 3FHQA 3K48A 4MXVA 2V6CA 2V9VA 3WTWC 2K4BA 1KJRA 3SEZA 3I55I 4CCMA 1SLAA 1ZNPA 5D5WB 4QKBA 4JAAA 3RZMA 1ZVFA 3DQVC 1AX1A 2A6XA 4JQTA 1D8KA 4QPYA 1N1VA 1NOVA 2EZHA 4B7KA 1W0UA 1G8XA 1J58A 2R7EB 3OGVA 2YC2A 4IE4A 1WBFA 2W1QA 1DP0A 1W0NA 3QCWA 3ZMDA 3U75A 2OT7A 4LJHA 2LH9A 2B5HA 4AYBA 3OG2A 3BR5A 2O8QA 1SEUA 5BY5A 2QQBA 2A5YB 1RUD1 2ZABA 4AQSA 3ATGA 3DEUA 3GDBA 1VQ8I 1PMHX 4B4QA 2F5CA 4NRMA 1UU6A 2VZOA 2HEOA 3A4CA 1GQPA 2WAQA 4LR4A 1R5GA 1OCCH 4UBGA 5CFDB 3OJBA 4NIGA 3CDZB 3T0AA 4PDKA 1NAEA 1UHSA 2M34A 5FZBA 3ZSKA 2LREA 1W2UA 1DU6A 2ZMLA 4WVVA 5D2AA 3AP4A 4QB2A 1W6OA 3KX2A 2AHQA 2ZEYA 4MO3M 3VBOA 4HONA 5FR3A 5FP3A 2XPWA 3BP8A 5DABA 4YW6A 1F4HA 1Y43B 3OR1C 1JZ7A 1YIFA 2OX0A 2W9XA 3F23A 1ZM1A 1YCIA 2RVCA 1EY2A 1TG7A 3FWEA 1JZ4A 5F32A 1TNRA 1ZN2A 4EN7B 5FMBA 1IW7F 2XBO1 4XJWA 1XNKA 3ETQA 4MEXF 1IHMA 1LPQA 1UNBA 1MR5A 3VD5A 1S2EA 3K1MA 2HYFA 5C3EJ 1OLMA 3CCQI 3CMGA 1ZHFA 3HPGA 1UXXX 4ISRA 4TZDA 4PIYA 5C5TA 4D7NA 2HXIA 4AQ6A 3OSFA 2OQ7A 3F22A 2VZTA 3FFQA 1X3WB 4WVZA 1W6MB 1FZPB 5B5EC 3BJOA 3USUB 3IL2A 4QGMA 4LKFA 2EIDA 1Q8PA 5HOOA 4QQOA 5A3MA 4CRQA 3IC7A 2XXZA 1PJRA 4B47A 1LVAA 1BVVA 1T33A 4S2GA 1MBFA 5FUPA 2FZ2A 3H9QA 2Z99A 4BXFA 2CS3A 3MPBA 2XUMA 4Y17A 1W8ZA 1ULPA 5K8SA 1U5ZA 4JX0A 5CAZA 5FKMA 1YO5C 3SCGA 2NRAC 3K4CA 3GF6A 4JQRA 1WQ2A 4I76A 3R6SA 1VBA1 4HF2A 4LE3A 3JZVA 5FPBA 1RR7A 4P1WA 3SXWA 5IYDJ 2OPTA 1VQOI 1ODNA 2W3JA 3I4IA 3L2RA 5GPAA 2LUWA 4LUKA 2JD4A 1QBJA 5FZDA 2W4SA 4PK4A 4P02B 1FAYA 2JXAA 3AG4H 3WGGA 3OS1A 1G9DA 3GGLA 2IJLA 1R082 1GZTA 1F2NA 3DLLF 5JHFA 5K7FA 1Q43A 4ABZA 5FY8A 3GZNB 5FRNA 5BNPA 2K02A 4D94A 2RVAA 3C1DA 3QPLA 3N9LA 3AL5A 3BC8A 1AJKA 3DBRB 2YX4A 1VRH2 1OQYA 1YFXA 2XJTA 5I0UA 3VDAA 1FOD2 5IP7J 5ILVA 1OLQA 2YBKA 2YHJA 4CXYA 1S9HA 1K4TA 4V2WA 3ABKH 4TLFA 1OA2A 2QSFX 3OYWA 4C91A 4ZYGA 1HXS1 2DV9A 1OISA 2D97A 4CDQA 1EPWA 4BLIA 1NQDA 2XC7A 4COVA 2J1SA 4DIQA 4A3ZA 2D93A 5JAXA 2Y6GA 4XPVA 3SFIA 3ZFGA 3QD6A 1DP7P 1LUJB 4F7ZA 2L7MP 1OFCX 4IPAA 3POFA 3Q0UA 3VKOA 3O8GA 4XLPF 1LHOA 3TBIA 4EM2A 3CJIC 4QGLA 5FMOS 3V0BA 2PMHA 2ZMKA 1W6QA 1JUHA 1OQ1A 3N7JA 3T4HB 5C4WA 5IPAA 3R0RA 1ULYA 1LHUA 3TWIA 4ZYDA 3LCPA 1X1CA 4KNCA 1PUEE 1EAH2 4BACA 4FPFA 1SPPB 2I2SA 5IK7A 1NZCA 2BP6A 1HLCA 2M0CA 1T0FC 3RQ0A 5JXJA 1HN1A 2B39A 1V5GA 1H9TA 4OIQF 1QQP1 3NMBA 4CEWA 4AYBN 3HOTA 5IY5H 3WGHA 1B35C 4MSVA 2DBIA 1ZLKA 2DU1A 2R5ZA 3RFRA 1JYWA 2NVYJ 4CP2A 4C0BA 2AR6A 2LBFB 2IWGB 1MQTB 2WS92 4XHBA 3FLTA 3OEAA 2ECBA 3K4BA 5FZMA 5FP8A 1IF1A 1H4HA 3SKJE 5EDNA 2JQ7A 3I54A 2D5FA 1TQ5A 3VDXA 5C6CA 3CCUI 1QMJA 1XC6A 2IXJA 3BCWA 3IDAA 2I74A 1GANA 5C3QA 4M3GA 1IO2A 2PX9A 1DU3D 1FNNA 1RETA 1TWHJ 3ZN1A 4S2HA 1AYM2 5FPAA 4XZPA 3I58A 1DQ2A 1GNYA 1MSFC 2QQIA 3CZ6A 1S4CA 2CWMA 2WSUA 5B2GB 1TT5B 1VLNA 3VDBA 5FY4A 5HODA 2FD8A 5D8KB 1AR73 3ZQQA 2QENA 4OYUA 2XPVA 2FDKA 1HKSA 4GMP0 1TT0A 5FLMJ 5IWFA 2W57A 1WWYA 3C7OA 3ESWB 1G4DA 2JWTA 1YJLA 4XTPA 4Z2YA 2ZAHA 4CTEA 4LOSA 1CX1A 2TEPA 1K6YA 4EN8B 2VNVA 1XRUA 2GLOA 3WHTA 4LPLA 4ZYAA 4ZTJA 2KA3A 2CNAA 5DCMB 3CMEI 3ZQGA 5A3LA 5D4RA 3ZMUA 2FJ1A 2IC1A 3BG7A 1CAUA 5CQGA 5E3MA 4YW5A 3ZYJB 1PZ8A 2R7XA 4ANJA 2F4LA 3WF1A 1VE0A 2GZWA 3A02A 3IRQA 1FXZA 5JUVA 3PUHA 4IHSA 4HNTA 3DF0A 3WW1A 4KGGA 1LDJA 1W8WA 1S0DA 4PQ9A 1AR82 2UY8A 3H0GJ 4CXFA 2WR9A 3ZM8A 2J1VA 5IOYA 2GH8A 1HA8A 3ZIWA 4EJRA 2JPBA 1PP8F 4IHWA 4CYCA 4RS5C 4DXTA 5FO9B 4GH4C 2XAGA 4W4ZA 4HX8A 3OUHA 2HWE3 5GALA 3MO4A 1OCOH 4YW2A 3LSDA 4CA0A 2XSJC 1DGRA 2RS33 3JBG2 3OIOA 5HCHA 2GC2A 3F9KA 3HBZA 4A6OA 3HUGA 2JDAA 1FPQA 2EB7A 1VNDA 4FT8A 2PMUA 4JOMA 1GNHA 3AM2A 1VBE1 1RVF2 4COZA 2HKOA 3DPUA 4XLNF 1QZEA 4EWDA 1BJAA 4P9JA 3ABZA 3RZDJ 4OAZA 5JCTA 4NC8A 2L4MA 4LE4A 3S6PA 3ZFFC 3M3IA 1FNYA 2RGVA 1V5EA 2VC9A 3Q8EA 1Q1HA 4A0YA 1D1CA 3HKZA 2BGPA 4BQ4A 4LHNA 1JOBA 5JVGF 1SANA 5JR2A 3FXMA 4R9CA 1YQAA 4X6RB 3WDTA 1UY2A 2M5WA 5F0CA 1ZYBA 1X4PA 3U4SA 4XE9A 5DDJ3 2PHFA 3I2HA 4ARXA 3BODA 2M4KA 4CDUA 3HSRA 1Z77A 3POGA 4CDWC 3PDQA 5J3LA 4KGQA 4FX4A 2L01A 2O8KA 4PLNA 3QOPA 3R61A 5HXVA 2X5IA 1XTAA 2HU9A 5HI0A 2WNUB 4OI2A 3SC7X 5A6YA 4RSUA 3B6AA 2FBHA 3TQNA 1B72B 1MEC3 1XD7A 2WO2A 5IK5A 4B48A 4M73A 2X1EA 1S3JA 2D5VA 3ACIA 1SFKA 2VOOA 5L7OC 5C8CA 3E0JB 4YW7A 4HBNA 3TBDA 3JSPA 1IN7A 4LMFA 1NCQC 2W1OA 2E7XA 2Y2ZA 4OFGA 2CW8A 5FZIA 3CNAA 3BG9A 4L8QA 1AZDA 4PQQA 3KMHA 2DK5A 4K40A 2Z9OA 1X1BA 4UYBA 4BQ1A 2WC2A 1VQKI 2WNUC 1ON1A 4V19K 5IT9K 2UXNA 5GTIC 1WI3A 1WW7A 4W1UA 3VBRB 1OHFA 2ERFA 4DUVA 3PVEA 4IEZA 1UKGA 2EIJH 1ZRFA 2OPWA 4KI5M 1X58A 3RVHA 3GLLA 3GXUA 3D82A 5BNOC 4JBAA 1ULGA 4RAZA 1JXSA 3WY6A 1CQTA 3KP5A 2R49A 4D69A 5FZHA 4XORA 3M7AA 4RHV2 1E3OC 4G7ZF 3MIHA 3KPHA 3HRMA 2VZQA 2XR4A 1R71A 4L5IA 3VBHB 1BCXA 1JZ3A 2XAQA 1KU3A 3K1PA 1QQP2 1FEXA 1Q8OA 4QT6A 2P5VA 2DT6A 4L9TA 4P9UA 4FPCA 2ETEA 4BBRJ 3AMNA 4WX9A 2ZS6B 2JKXA 3E7LA 2LC2A 4U87A 5AVAA 4W6WA 1J83A 1CZVA 4LBQA 1GOGA 5C9AB 4K1YA 4E7HA 2ZFUA 1XCBA 2VMCA 1QHHD 2ESHA 2CWEA 4FASD 5LA2A 2DK8A 3ZIXA 1H9WA 4P5YA 5FO7B 5L36A 2ZJQF 2ARCA 5LHHA 5IT3A 4QAWA 1UB9A 3HKZN 4KG8A 3W20A 3AL6A 3FX3A 5C71A 3ZDVA 2RM21 2BGCA 1SAXA 5EFUA 4YPJA 4B8XA 3CDIA 1FMD3 2YU1A 4HX7A 3CJQB 4UXAA 4RAYA 4CDXA 1DYKA 1SFYA 4PZJA 1J1TA 3V42A 4P9YA 5EG0A 1PUFB 1NXD1 1QJX3 1QH6A 1BR4A 3D5RC 4DGWB 2CRGA 2AH2A 2GDFA 3BT9A 2YS9A 4IEXA 3VKFC 4AG4A 4BJ6C 2QEXI 2DU9A 1ON2A 2CUJA 3BY6A 2E7TA 2VW0A 3OBTA 4CP9B 2JECA 1H0BA 4CYDA 5FPZA 4O9GA 5FKCA 1E5HA 2P6SA 4PJNA 3S3MA 1ZR2A 5BS6A 3FN9A 3CC4I 2LKSA 1OA3A 4FTHA 3U1DA 2Y8KA 2JKBA 1AR72 4O5VA 2VPLA 2R6QA 1QA6A 3RKQA 1PVC3 4E27A 5FKKA 2W87A 5L9BA 4C90A 2Q5TA 5GZGA 3ABLH 4OHVA 3USSA 5GP9A 5T54A 2XJPA 3KGZA 5FFXA 2HWD2 2X0LA 3ASIA 1BN5A 4X6QB 2BZDA 1YIPA 2DMTA 1MMDA 4EZ4A 1SQ4A 3MV01 3D5OA 3MICA 1ZGWA 3R4UA 3WTXC 5A33B 1AYN1 2BW3A 4GB33 4IF4A 1TEIA 4CEYB 1BOAA 4LNVA 3VYTB 2X48A 1C8M1 2KM2A 5JFRA 2QLZA 5BNOB 3KM5A 2Y0MA 2WFPA 1WJBA 2PLYA 2RDRA 1OF3A 5LFAA 1ENSA 1H8TB 2XWBB 4D5FA 2EXJA 2IS1A 2HWE2 4CPBA 4HN1A 3S8PA 2D45A 4RM2A 5JWPA 1YE9A 4UY8I 1W5SA 3JQXA 4P55A 3WF4A 1JTXA 4Y22B 2HZTA 1U5TA 1N77A 4PBOA 4PJYA 2P4WA 3ACHA 1WWXA 2PMZN 3PSIA 3TP3A 1BI0A 3TEYA 1DQ5A 1WHUA 2P81A 4HG2A 4LK6A 4IHTA 1A6IA 1SCSA 1VQ4I 3ACGA 4N43C 3E5XA 5JSRA 2XL9A 2WBKA 2FMDA 5KAIC 2XL7A 2QDNA 2R7UA 2QZ3A 3ILRA 1GOHA 1KS5A 1F4AA 1JZ2A 4YELA 1QJX1 3QAHA 1OD5A 2JT1A 3KSCA 2ZGRA 3I3LA 3KP4A 3FXQA 3LD8A 3BJAA 4IO9F 2WBMA 2VE9A 5K4LA 4QWQA 4QDSA 4HG6B 3ZSJA 5GAGJ 1VR3A 2E1MB 1LHVA 3CC2I 1Z6RA 3THCA 2VC1A 4A69C 2JMWA 2HJIA 4AI8A 1LEBA 4IXAA 5EYRA 4IHXA 3NJXA 4XMAA 3M1HA 2MLGA 1GU3A 1FYMA 1Z3XA 1BXHA 3U1XA 1YRZA 4O7XA 1AR92 4XBQA 3N9NA 4QPIB 5DS9A 3AP6A 2MC3A 4MIMA 5IK8A 3ACFA 4NB5A 1MMSA 2DUOA 4OU0A 4CCJA 5F1RA 3OYEA 4N9IA 2HYJA 3GZTB 3WOGA 1OOPB 2B42B 4AFBA 1NG0A 3JREA 1QDOA 4YFKF 3WP6A 3DN7A 5H20A 4MZUA 4MGSA 3EPZA 5A3OA 5J1YA 4NC6A 4LG3A 4RA2A 1G3YA 1VRH3 1HKQA 3CBNA 1V6JA 1YYVA 2O61A 3HPNA 4LLFA 4FFIA 1M4WA 4XJ8A 5FREA 1AXKA 4A4AA 1AR91 3AVRA 2CH0A 4GYIA 3KQ4B 1B9MA 3EUAA 2E32A 1KFXL 2BWCA 5FZLA 4I2OA 2CU7A 3VODA 4QQLA 2M7AA 1MS1A 3ELNA 3O2PE 3LAJA 3ITQA 5L7OB 1LRHA 3R4KA 4D8MA 2ZXWH 1ULDA 5KXDA 1SLLA 1PM7A 3UGFA 2VCCA 1RVF1 3B93A 3HD8B 1ND3A 4IEQA 5ICGA 2KRFA 2Q0OA 4Q2FA 1YOVB 2HI3A 4XABA 4KMQA 3F8CA 2H6CA 4OLLA 3LOCA 4HF0A 3WW3A 4Y1VA 5K0UC 4G8XA 5I8TA 4DYRA 3PURA 2KDZA 2QNKA 4M9XA 1J3RA 5M5XJ 5BYNA 3LE0A 4HVRA 4UW6A 3SHRA 2HOTA 2P5KA 1SAUA 1PO12 3JBG3 1GV2A 1SD7A 3BZCA 5GTHC 2RS32 4YWAA 4FETA 3ZYIB 3M2MA 2DN0A 1JN2P 3OIQA 4RM3A 4RGKA 4GFBA 3PL0A 2D1VA 4UAPA 3VZJA 2CL2A 1JUIA 3RYRA 3PUQA 2DO7A 1MEC1 1UW8A 1X1DA 1ZBA2 5ABJA 4HLTA 1UZCA 2VKHA 1HN0A 5LATA 3VSLA 2C6SA 2P8TA 4CXXA 2CYYA 1D1BA 3VUOA 3IIIA 3BZKA 3DLAA 2ZTNA 1ZGJA 4YEJA 2P37A 1OLRA 4PUSA 5LY2A 4L5EA 2VCAA 1CAXB 1AHDP 3VSKA 3VD4A 4BK4A 5A7WA 2HWB1 2QQPA 2RS52 2VZ1A 5FLIA 1VMHA 4ON0A 5JZGA 3O3KA 4OMZA 1XCVA 3VWBA 1SVOA 2HWF3 4YVWA 1YFWA 5EZGA 2BNMA 4J1WA 4PJMA 1X50A 3FXKA 2WLPA 1F43A 2FNAA 3HOSA 1NLSA 4AI3A 1ONVA 1W2OA 2JTVA 1AXYA 4A3BJ 3OPWA 5CVIA 1Z3YA 3O7OA 3FMRA 1UZWA 1S0EA 3ZXGA 4A3GJ 2Y6HA 1RUC3 1HW5A 4JDNA 3H5RA 4BDVB 3QU6A 1YNAA 3ECQA 5J1UA 5BNGA 4BPZA 2FUG2 4EGZA 4J25A 1U6GA 2NMNA 2WUHA 1ITYA 2RDNA 4YRDA 4OIOF 2XBO3 1NQJA 4MQVA 1MPXA 1RI7A 5FOBB 4AHXA 4LBJA 4WM8A 5JI6A 2BHZA 4B3AA 2Z33A 3DEWA 2VQAA 5CEHA 2Y48A 4GGGA 1RUE2 3PTRB 4PCQA 5FPLA 3T3YA 2Y30A 3A01B 2WRAA 3ZR8X 1JYIA 2HS5A 1SMVA 1W5CC 3EYYA 1MNEA 3I64A 5FJKA 3OMYA 2MSYA 2PHWA 2Y6FA 2A6VA 3PQJA 2XVGA 4ZHNA 2VL8A 4AI9A 5CKMA 2D98A 3BVCA 1W99A 1IXSB 1Z0XA 2YFUA 1JHFA 2J5PA 2QE3A 4KT5C 2JJ6A 3HOYJ 4A7ZA 3JCIA 1UHMA 1YC61 2DDBA 1AUYA 3BPXA 1BVP1 1ZBA1 2R0HA 1YX5A 4BMBA 2K27A 5FFOC 1T56A 4K21A 4A93J 2VZPA 1MS4A 1IV6A 3B94A 1L7RA 2GIZA 5DZFA 2CMPA 2BGOA 3J7LA 3NAPB 4ITCA 2DCTA 3RWKX 2E2JJ 4BL0B 2IXIA 1OR7A 3E5QA 4AEKA 4GWNA 1ORKA 2AQEA 1IJWC 2W68A 3I3QA 3HM5A 2DCJA 3AFHA 1XE7A 2HDCA 1QQIA 4CO8A 3GTPJ 2J7MA 1FOKA 3JRHA 1Z1DA 3IAM2 3CUQA 1JMUB 2EJRA 2D6MA 3WUCA 4RB1A 2R5YB 3RMXA 1FOWA 3HRUA 4MGRA 1R49A 2ZB9A 4MGTA 1CGPA 3GTLJ 1RNLA 1IN4A 4CCCA 3BG3A 2WS93 1G3SA 3LSTA 1WA6X 2FMLA 5DD4A 2ZXIA 2R043 4H3WA 1W9FA 2EXHA 1BJZA 5G04L 1CIWA 4EV0A 1UOFA 2AENA 3J7MA 3J80Z 3Q8CA 3N7LA 1LGCA 1LOFC 4EM1A 4ONUA 4NBQA 4I01A 4Y7NJ 2QBXA 2VOXA 1NE4A 3JD72 4H7LA 4U88A 3NJVA 1Z7S2 3SQNA 4XXPA 2QKDA 5CA6A 5F3IA 2ZEWA 5FZFA 1C8NA 2LKXA 1FV3A 3NWTA 3WE2A 4QIWN 5FK8A 4O9EA 2XLAA 4QPWA 5A32A 2FD5A 2BPA2 2WA0A 3SEPA 2KISA 4JYKA 3I4MJ 4CDWA 1K4SA 4QDQA 3RIRA 2ZBKA 3KFWX 1ZZ9A 1Y9QA 1F15A 2BJSA 4ZJZA 3AMMA 2COMA 2NS8A 3ENRA 4Q5SF 1HB4A 3KZ4C 2WN2A 4ESFA 1HKDA 5F7UA 3L9JT 1OCRH 5IFTA 5CJ9A 4NDLA 3AC0A 4DQ2A 3U14A 1S0FA 2X6OA 2IRFG 1Y3TA 1T95A 1E17A 1R9TJ 4KT6A 3DPTA 3HBKA 4AWXB 3NNLA 1U5TC 2MBFA 1YUDA 5CQEA 1NKGA 3A21A 1RC6A 3TW7A 4K1ZA 4BAYA 2YC0A 4Y4RA 4F83A 1KXGA 2VLAA 1MDMB 1W28A 2CAVA 4R9BA 2GWRA 4IVNA 4M0HA 3N7KA 1K61A 4FPHA 4CP0A 1JKRC 4UF0B 2O9LA 1D5YA 3MMYB 1MMAA 5H2FC 4WM7C 4A41A 1OXCA 2RS13 1XPXA 3J7NA 4G6TB 3JBG1 5CFCA 3MLKA 2FOWA 3PVOA 3M4OJ 3IDBB 3S2HJ 2J42A 2COBA 2H8WA 5EJZB 1KQRA 3C18A 4OUMA 3OWTA 2VOKA 3KIOA 1H0MA 2HWB2 2C26A 2XGEA 4NRPA 1GKBA 4B4PA 4CSWA 4H0EA 2K85A 1VPHA 4MYEA 5EGOA 3PU3A 4F92B 3OD4A 3D1NI 3LFIA 4GH4B 2D6NA 2QQLA 3PJRA 3OYMA 3FMGA 2GU9A 3K69A 3V8KA 2IAIA 1HDDC 4JP0A 4RGAA 1L7QA 4XRFA 5GZDA 3LSIA 3SH3A 2I5UA 4IGQA 3BLYA 1BZWA 3J81Z 1NLQA 2OCCH 1VQNI 1AA7A 3AYAA 3CO6C 3T08A 3INAA 4XF1A 4O6JA 4HA8A 3RZZA 1J1LA 1FPN2 4WXHA 3U11A 5EG0B 5LK7B 5L3BA 1ZA7A 1K6OA 1U5IA 3IPVA 2HWVA 2Q8EA 2R063 1BIAA 2QFEA 2LTNA 3M9AA 2WZEA 5AFBA 4WVMA 2JDHA 2DUQA 2V6EA 3TN91 2HQRA 2FMYA 2FQPA 3DKXA 3T8TA 1FBSA 1BEV3 1IPSA 2IXCA 2XAUA 5F3EA 2WFF3 1IDZA 5FGMA 2EV0A 4IUGA 2CQQA 1MD0A 2P7VB 1FC3A 2HBTA 1LNSA 1ETQA 3TW6A 2VAUA 2DOAA 2ZEXA 4HXCA 1MKMA 4XETA 4PLMA 1BOBA 3JAMZ 2WZR1 1VQ7I 1IRZA 1ND3C 2RHPA 2G9WA 2QBYB 1OT5A 3PUBA 2P5LC 4MGQA 4Q4Y2 5KHIA 2LG4A 1JI6A 3PUFA 2VUAA 3BIWE 2LK2A 4TWTA 4Y1XA 3WU1B 4I02A 3KYLA 3HT2A 3LOIA 4RGGA 4YNIA 5F5AA 3AFKA 5EGOB 2O8OA 2W84A 3QACA 2A6EF 5D5VB 3K9TA 2YU9J 5D5UB 3KP3A 2B46X 3FXRA 4LO7A 3JRIA 1XJAA 2F2EA 1X7NA 4IEOA 1Q56A 1CZTA 3OCPA 4X8NA 3DWLE 3HOWJ 1HQWA 3KCYA 3S15J 3OYIA 4HNUA 4DXZA 1ETXA 5E1WA 3I71A 3PVBB 2DAOA 3M8EA 2HQ5A 1IQAA 2P3JA 1QJU3 3WG4A 3SITA 4ZH4F 3RI4A 2V4AA 2EILH 3OV8A 2JICA 1HRV1 1PNFA 2ZSHB 2STWA 2JA6J 3PFYA 3AXDA 3G1MA 1PP7U 2XROA 4QX1A 1MH4A 1AKHB 3VLBB 3R0JA 3NNMA 2M45A 3FK6A 1WZ2A 3C7GA 4G3YC 2X53S 2BVVA 3Q9VA 2ZJCA 3Q8BA 3T4VA 1QVTA 2B63J 1JUMA 3CCMI 1RMU3 2IVIB 1DZQA 3WF0A 2WQ8A 2V1XA 2VO5A 5IVFA 4LO5B 3PLQA 1OH3A 3RDIA 3I2KA 2FDGA 2EXIA 4AQ2A 5JPMB 3PSFA 1FP1D 3AJYA 5FMCA 3LSEA 4CUCA 4BXUA 1W36D 4LITA 4KQ7A 2Q8CA 2W5FA 5EIYB 5I8YA 4Q27A 3MIEA 2IT0A 1AYN2 3JD73 5JOXA 3DYPA 3ZMZA 2X9DA 3ERED 2NS7A 2LMDA 4ASKA 4AAXA 4M9ZA 1A34A 4BNCA 5C3PA 5BV6A 1E5SA 4IE6A 4MTDA 1DQ6A 5A1AA 1POGA 1RUI3 5FZ9A 2A6TA 2TRTA 1HQNA 2D6OX 1M1EB 1CQ9A 1VI0A 3WQ7A 3ZMSA 2VVDA 5EZWA 1QOOA 4BDYA 3WCSA 2Z1DA 4E4SA 5DEQA 1Q5OA 1IZ3A 2G9ZA 4AU7A 4Y1YA 2RC4A 2BTVC 5FZOA 3H9JA 4UVAA 5BNPC 2A70A 1D8JA 5J4VA 3CQZJ 4KIGA 4ATEA 4LORA 3U0ZA 1DLCA 1ZZBA 1FIPA 3BUCA 2ELKA 5ICEA 3RQ4A 5ACA3 5LK5A 4KJZA 4KICA 4OHXA 2NMOA 4Q4Y3 2XIGA 3O1PA 3KE2A 2OTLI 1JODA 3S30A 5FY1A 3I2JA 2FRHA 1YI9A 2DT5A 2GNDA 2JA5J 2ACJA 1NY71 1UJ8A 2ZGUA 3KP6A 2L3DA 2WZ8A 3NAPA 1BW6A 1YO8A 1Y39A 1DDLA 2HBUA 4OIRF 2A3SA 1AF9A 4PGHA 3JRCA 2ZXQA 3BQYA 3SJMA 2DCEA 4C0HA 4DMIA 1AR63 1R1TA 3EYPA 1K78A 1DGWX 4YGBA 3MWMA 5IHRA 3POBA 5E18F 1GLNA 1AJOA 1TBXA 2RV9A 4Y5TA 5CLSA 5D8AC 4G7HF 2HWD3 3O0VA 4IL6C 3BDDA 2MH2A 2H27A 1OOPA 5GLUA 4P9XA 3H9AA 1QJU2 2WN3A 1WRJA 4AFMA 2V5YA 2E7WA 3SZTA 3T09A 3O12A 4IHYA 3FK7A 4FPJA 2DCKA 4GO1A 4AGGA 1OBNA 1J9IA 1HRI2 2VBYA 4DO0A 1V9U3 2BOIA 1OQDA 1AL0G 4QHZA 1F35A 2VKDA 1VZ0A 2Q8KA 5DUVA 1O3QA 1V00A 3G6JB 3PM1A 1B8IA 3WG2A 3S93A 1GXPA 1H4GA 4RFRB 3PU8A 3ZPYA 2ZEZA 2WINB 5KHDA 1JUSA 2L0KA 2KDOA 3BPSA 5KVRA 4N7IA 2XGXA 1DGLA 4XKVA 5A6ZA 5F5CA 4NN0A 5A3WA 1TLHB 4HT1T 2WAAA 3DCQA 1YLFA 4M4RA 4PHZA 1VAKA 4CU9A 1F4KA 4UW3A 2VVEA 4OUSA 4YM0A 5FLXZ 4XFAA 3QYBA 5JZGB 4L9JA 3CMYA 2FDHA 5LRRA 1R1A1 1SC7A 4GYGA