4LBKA

Crystal structure of human galectin-3 crd k176l mutant in complex with lnnt
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
138
structure length
138
Chain Sequence
b'MLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTLLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-3
publication title Galectin-3 interactions with glycosphingolipids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 35
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4lbkA00
1FV3A 1LU1A 1FATA 1ULDA 5T55A 1LHNA 1F31A 2A6VA 4PBPA 1WBFA 3MPPG 3PVOA 3KQRA 4H55A 1S0EA 4Q1RA 1UKGA 4P9XA 4CTEA 3RRDA 1SFYA 3WV6A 3ZXJA 4XDQA 5JDBA 5T5LA 1A8DA 3T1MA 3B00A 3Q9OA 4FP3A 4PF5A 2P2KA 5IK8A 1NXD1 2AENA 3B3QE 3JU9A 5IK4A 2GN3A 3USUA 3WG3A 3IPVA 1J1TA 5GZGA 2A7AA 4UW4A 3IM0A 2D6OX 4YZ1A 3AJYA 3ZVXA 2VH9A 1VAVA 2AREA 1IOAA 1N1VA 1GZCA 1UN1A 1BZWA 1SACA 1G8WA 1DYKA 5IUQA 1SLAA 1DQ6A 1KITA 2ZGSA 4M3CA 3MEPA 4FVVA 3POWA 4Y20B 3B9CA 5AVAA 1MS0A 2E7TA 2PHTA 3ZYPA 2E53A 1GICA 2EAKA 2G4IA 2A3WA 4FPLA 4Y1ZA 3ZXFA 2DU1A 4ZKTB 3KM5A 2DU0A 4HANA 4YGEA 1KQRA 3OY8B 1AXKA 3QCWA 1GNZA 5H9SA 1QNYA 3AYEA 3WDXA 2WKKA 1MS8A 2JKBA 4MYEA 1SLTA 4M3CE 1V6IA 3H0OA 4R9DA 4K20A 5JMCA 3N35A 3V65A 1H30A 5JOYA 4LBQD 5GJ6A 3NV3A 5E89A 1AZDA 1LHUA 3POSA 1JHNA 4Y24A 1QNWA 1G9CA 1ZA4A 5DG2A 3T1LA 4M01A 1MR5A 4C1WA 4Q26A 1LGBA 1W6MB 2Z42A 4Q2FA 3AP6A 3NWKA 1QU0A 1CN1A 2ZKNA 2P3JA 1S0FA 1HQWA 2VUAA 1VALA 2AUYA 5JLVA 2YXSA 3NV1A 5H9RA 1V00A 1DQ0A 3WHTA 3FLPA 2GNDA 3AYAA 4RL7A 1V6KA 4GWMA 2VW2A 1GBGA 1QDOA 3VUOA 4GA9A 4YW1A 1ENQA 4GXLA 3C2UA 3VV1A 4FPGA 1V6OA 2E6VA 3AX4A 2PHFA 1LGCA 1MZ6A 2LALA 3ILNA 3WDWA 4YZ2A 1C57A 4XJZA 3O0WA 1AXZA 1YRZA 5DUWA 5GZDA 1KJLA 4FPFA 3MW3A 4LBMA 1X50A 4Z8BA 4XJ8A 1WLWA 1F5FA 1A3KA 2EALA 3AZYA 4K1YA 4UW5A 3B69A 3VKMA 4YW5A 4YW2A 4AYUA 4LBOA 4Y1UA 1YI7A 3FLTA 3D5OA 3BOPA 1GKBA 1V6MA 4C1XA 1VAMA 2PHUA 3D4KA 1SCRA 4M00A 2D3RA 4YM3A 3OPZA 1AX0A 2EF6A 4YFWA 2R49A 2ZHKA 2P34A 2PHXA 3AFKA 2NZ9A 4FPYA 5E88A 1GLHA 4Y1VA 1QKQA 3O5SA 4XJUA 5L73A 4AGVA 1KJRA 2UWBA 5HCBA 1G9DA 3AP4A 1F9KA 2EXHA 3PJQA 1TEIA 2NMNA 4KBBA 1WW5A 2JE9A 3W59A 2Q5TA 5T5OA 1LHWA 4XMAA 2D6PA 5DZGA 2ZMKA 4DRVA 4Y22A 1LOAA 1W6NB 1O4YA 3WCSA 3DGTA 2VY0A 3OBTA 1IS6A 2D6KA 1WUVA 2AYHA 3WG2A 1GANA 4F83A 1LHVA 4YG0A 1JBCA 3ENRA 2D3PA 1CJPA 3UK9A 1UPSA 1LTEA 1WW7A 3WG1A 3SISA 3VKOA 1MZ5A 1CPMA 1DLLA 3JUUA 2JJ6A 5DG1A 3V64A 2C9AA 1SBFA 2R0HA 3WHUA 2NP0A 3UL2A 3WLUA 3WDUA 4WVVA 4FPHA 4AVVA 1EPWA 5F5QA 4AVSA 1G9BA 1LU2A 4XTMA 1URXA 1ULFA 2H0BA 2ZHLA 3APBA 2OUHA 1VIWB 1JYCA 2DVGA 2ZGMA 4UW3A 3FUQA 4PBOA 4XILA 3WG4A 4BLIA 4ISRA 2C5DA 1D0HA 2WQZC 5KXDA 4DFSA 5GLZA 3AP5A 4ATFA 2JE7A 2R1BA 4FQZA 1G9FA 4GWNA 3ZYRA 3L2YA 1Q8QA 2JECA 3AJZA 3BTAA 4P9YA 3WNXA 1DQ1A 4XXPA 4XYXA 1Q8VA 4U36A 4LBNA 1DZQA 3AP7A 1R1ZA 2VW0A 3ZXEA 3TAYA 4YM0A 2GNBA 4PCRA 4Q27A 3SH4A 2ZGRA 4WZFA 2TEPA 1A78A 1S0JA 1FYUA 2CYFA 2D7FA 1IS5A 2ZGLA 4W65A 5CNAA 5GLTA 4GKYA 1UMZA 1ULCA 1W6PB 3N7MA 4CRQA 4LBKA 2AR6A 1H9PA 2ZZJA 3N7JA 2WJSA 4XBNA 3ZSJA 3U4XA 3WUCA 1IKQA 4U2AA 4FOYA 3SLIA 1C4RA 3W58A 1LESA 4UW6A 1ULEA 1BYHA 1GZWB 4XXAA 5HCFA 1N47A 3RSJA 1N1TA 4AVTA 3V0AA 3DUIA 4YW4A 1SBEA 2R1DA 2FMDA 1SLCA 1Z78A 2EXKA 1BJQA 2DVDA 5H9PA 2D6NA 5DZFA 3AZXA 2AGSA 5DUXA 3INAA 5DUUA 4K21A 1HQLA 5F9TA 4XIOA 3M3EA 3T2TA 4YG3A 1N3PA 3AZVA 1QOTA 1AJOA 1Q8OA 3A4UA 3ILRA 4YGDA 2GMMA 1LODA 3AP9A 1DQ5A 3M3OA 3GNEA 4R9CA 5GLWA 3WDVA 2A3XA 3LSDA 1B09A 3NV2A 4FP2A 1GV9A 1LOEA 4I30A 1BQPA 3MW2A 2SLIA 2OVUA 3IKWA 1HLCA 2ZGNA 2PHRA 4OZXA 1I3HA 4YLZA 1Z0HA 2ZGKA 4LBJA 2ZBJA 1YYNA 4XE9A 2GN7A 1GZ9A 1LEDA 2V5YA 2NM1A 2ARXA 1W6QB 1VLNA 2DVAA 2ZGQA 1D2SA 2ZMNA 3WVJA 1DHKB 3SNMA 1N3QA 4NO4A 3N7KA 2WT2A 3AZZA 3IMNA 2JDZA 1AX2A 1LJ7A 1UL9A 5T5PA 1YXWA 5CBLA 3AZWA 4YGBA 1DQ4A 4YZ4A 4Q8KA 3HMYA 4BQ1A 1MS3A 5GM0A 2LTNA 3USUB 4P14A 1GNHA 3IPVB 1UAIA 1S0CA 5T50A 1W6OB 2ZGOA 4XJWA 4XHXA 1YIFA 2SBAA 2W52A 3V0BB 1RINA 4Y20A 5E8AA 1G9AA 2ZA9A 2KM2A 1AX1A 2A6ZA 3PVNA 5GZEA 4BMEA 4BOWA 1RITA 3ZSLA 2UWCA 4M3CB 1QF3A 3ZPYA 4ISQA 3NV4A 4R9AA 1S0IA 1SLIA 1ULGA 4ASMB 5SV8A 3OYWB 5BYNA 3OY8A 2XG3A 2ARBA 2ZABA 4YZ5A 1W0PA 5CB7A 3PVEA 1MS5A 2OUJA 5JOXA 1C1LA 1V6LA 3M3QA 2CTVA 3R4SA 4JC1A 1LOBA 3SITA 2DYCA 1C1FA 4FOVA 2CNAA 2DV9A 4BM8A 5KXEA 1WD4A 5CAZA 2W68A 2DVFA 4XMIA 2DWRA 2VW1A 3UJQA 4DQAA 2DURA 3OJBA 4FPJA 2ES3A 2GMPA 1AVBA 1WLCA 2NN8A 5KXCA 2ZGPA 4YM1A 3ZSKA 2R16A 1W6MA 4XOGA 5JVVA 2V73A 2YROA 5H9QA 3RS6A 3N36A 1I1EA 1CPNA 3ATGA 3ILFA 4JCKA 5LK5A 2VU9A 2A3YA 4YFZA 2D6MA 4JRAA 4LBLA 1LOGA 3OBRA 1OKQA 1QOOA 1S1AA 5FREA 3SH3A 5JOWA 1V6NA 1U0AA 4ZXKA 3OGGA 1QGLA 1ENSA 1LULA 2ZHNA 1JYIA 1KRIA 3R4UA 1O4ZA 1ZM1A 1LGNA 3HR9A 4XZPA 1S0DA 5FRAA 1LOFA 1CIWA 1Q56A 2VXRA 5GZCA 3AYDA 2ZAAA 1Y7BA 3SH5A 1CQ9A 2ZACA 3HN1A 1WCSA 1LEMA 1DQ2A 3LSEA 4L8QA 3N3HA 2FHRA 1DIWA 2WNEA 3RQ0A 3AXEA 1WW4A 1BKZA 1MS9A 3I4IA 1FV2A 3RMXA 3FLRA 1SBDA 1JUIA 4Y26A 4XBQA 3B01A 2ZMLA 3POYA 2ZHMA 3ZSMA 1V6JA 5T54A 4XJAA 1LCLA 3ZXKA 2WLQA 1GSLA 1W6OA 2D43A 1JOJA 4BMBA 2GNTA 2A6WA 3TB0A 1G86A 1CR7A 2W39A 4ATEA 3V0BA 4DS0A 4PQ9A 1OQ1A 5IT6A 2XB6C 4IQPA 4R9BA 1N1SA 4FOWA 2DTYA 1CONA 2UU8A 1W0OA 1PZ9A 3LCPA 3OYWA 3WCRA 4NOTA 3AK0A 4FQ4A 5HCAA 2A70A 1W6NA 3D6EA 2EIGA 2YMZA 2EXIA 5GZFA 1JW6A 1FNZA 3I8TA 4LBQA 3M1HA 1UX6A 3ZXLA 4YZ3A 1PZ7A 1MACA 2I2SA 5EXOA 1S0BA 1LENA 5DZEA 2BQPA 3RMYA 4Y22B 1LOFC 3VKNA 1MS4A 4BLJA 3AYCA 2OW4A 2ZGTA 2UWAA 4Q8LA 4RA0A 5DUVA 5IK7A 3O12A 2GNMA 3CNAA 1XQNA 4Q1PA 1NLSA 4DPNA 1IS3A 3BODA 1ENRA 2A6XA 4XHBA 5EWSA 1DYPA 4HL0A 3M2MA 3RG0A 4FOQA 1CESA 4XBLA 2E51A 4BPZA 2CY6A 4LBQB 4K1ZA 2R0FA 4SLIA 2A71A 1MS1A 2GMEA 1CVNA 3BIWE 5CA6A 2ERFA 4TZDA 4Y1XA 2DVBA 2WT0A 4YM2A 3VKFC 2DUOA 5JOZA 2D6LX 2YY1A 4ITCA 1SLLA 1SLBA 5EYXA 2GDFA 3WUDA 5T52A 1H9WA 4AGGA 2ZGUA 4M3CF 2P3IA 1WW6A 2HYKA 3ASIA 1UZYA 2JD4A 1GYKA 3GALA 5IK5A 2A5ZA 2CWMA 4GALA 2ENRA 2AH2A 2NYYA 1HDKA 1SCSA 1WLDA 3MW4A 4CZSA 5DXDA 1W6PA 1JXNA 3A0KA 2CWSA 4Y1YA 2WT1A 1RIRA 4YG6A 3WOGA 1AF9A 1OFSA 3AXDA 1WD3A 4D69A 3FBYA 5EYYA 1FX5A 2RHPA 4WV8A 1QMJA 3VKLA 2CL2A 3WZ1A 2UURA 1FNYA 1PZ8A 1FAYA 1LOCA 1UZZA 3PMEA 1GZWA 2A75A 2D3SA 4FPCA 3UJOA 4YGCA 4AGRA 3M3CA 4WVWA 4XJ9A 2WSVA 3IN9A 2B7YA 1MVEA 1DBNA 3V0AB 2DUQA 1APNA 1DGLA 2W08A 2P3KA 1LECA 3A0NA 3O0VA 3QLQA 1MVQA 2E7QA 2YZ4A 4TYSA 1HKDA 5T5JA 4DRRA 2DTWA 2NMOA 1YO8A 5KXBA 2GALA 4P9WA 4AWDA 4XIKA 3O0XA 2PHWA 4GKXA 4FPKA 2EXJA 4XTPA 5GALA 2YV8A 1G7YA 3N7LA 2PELA 1JN2P 2WSUA 1ONAA 1QOSA 2P37A 4YW3A 5GLUA 3WDTA 1DFQA 1WBLA 1BXHA 1AXYA 1N3OA 2A6YA 1IKPA 3FUOA 3R05A 3WDYA 5GLVA 4FPEA 4FPOB 1KDKA 1KDMA 1Q8SA 1Q8PA 1S0GA 1QDCA 3FFZA 2DUPA 2D44A 1AJKA 1LHOA 1W6QA 1IS4A 1N1YA
chains in the Genus database with same CATH superfamily
1AR73 3OBAA 1F31A 5CKQA 3K4ZA 1WBFA 1NKGA 2IXLA 2QE3A 4Q1RA 3J7MA 4CTEA 1POV3 5F6LB 4D7TA 4HPKB 3WV6A 1HX6A 5J98B 3W5NA 1AR71 3T09A 5JDBA 4OLLA 1NXD1 2AENA 3B3QE 3JU9A 1FPN2 1POV1 2WA4A 4HLTA 5IK4A 4O9EA 2A7AA 4D7SA 5G05L 5JPMB 1PM7A 3ZVXA 1O4TA 3AB0A 5FXZA 2NLRA 3AKSA 3NO8A 3OPTA 4LOSA 3B93A 3WP6A 4JGYB 1AL23 4X8NA 4CDQC 2JENA 5IUQA 2ZGSA 4FXGB 2RMU1 3ACGA 4OI0A 4C90A 2E26A 5FK8A 1IPKA 1UKRA 3POWA 4Y20B 3LA7A 3TNQA 4FI9A 4XFIA 4LHNA 1I5ZA 4KWLA 4QX8A 2EAKA 3DEMA 1RUC3 2RE9A 4I0BA 4Q4X2 4Y1ZA 2Z69A 4ZKTB 2V4VA 1OSGA 1RUG2 1AXKA 3F2ZA 3QCWA 2XQRA 1QNYA 4S2FA 1NZCA 3AYEA 1RUC1 3WDXA 2A73B 2JKBA 4MYEA 4D6QA 1T6BX 4BQWA 4F3JA 3H0OA 4R9DA 1COV3 5KHIA 3IDBB 1KFXL 5JMCA 2XVLA 2PAEA 3KCXA 5JOYA 1BMV1 4G9SB 1JU4A 4N8MA 4AQ6A 5E89A 1S4CA 1COV1 4Y24A 2DCKA 4BU2A 3T1LA 2ZX3A 3WNKA 2CGPA 4HN0A 3CQOA 1OOPA 1ULOA 1HRV3 4LK7A 4Q0PA 5FWJA 4PLMA 3T4HB 4A7YA 2YPDA 2Z42A 4ZY9A 3VZOA 2K2SA 2ADDA 4WM8B 3HOBA 3AP6A 2N7GA 3B9IA 3C3VA 3NWKA 4BISA 5KHJA 1CN1A 2XLFA 3K2OA 1HQWA 1HRV1 5JLVA 2XJVA 4CU9A 3MF6A 5H9RA 2QCSB 2D93A 1V00A 1DQ0A 2BDRA 2JG9B 3F95A 4IE5A 2GNDA 3WHTA 4I0AA 2VW2A 1OMIA 4N9IA 3R4DB 1IHMA 4YW1A 2ZEWA 1ND2C 3VV1A 1J3QA 3BTYA 4LQRA 1I5PA 2E63A 3AX4A 4CP9B 2PHFA 1MZ6A 1VBA3 3WW2A 3R0RA 5E1RA 3H8UA 1OFNA 1C57A 1S55A 4W50A 3ZIXA 1KJLA 1UZ0A 3HAGA 4IEZA 1H8TA 3GCWA 1W8FA 1VBA1 1X50A 4A7KA 2VO5A 4UWDA 3GF6A 1L3JA 5EJZB 1NYWA 2ZEYA 4YW5A 1R091 3P3NA 4Y1UA 3S7EA 4NUBA 1O6UA 2CDOA 2VPVA 5CFCA 3IMMA 5FIXA 3D4KA 2RVAA 1SCRA 2JDKA 5ANNA 2R49A 3TN92 2B39A 2PHXA 2WAAA 1J1LA 2NZ9A 2Y6KA 2WYSA 3ZMNA 5DAVA 2VMGA 4UFMA 2FDFA 2WN2A 3EB7A 5DN2A 4UF0A 3MIFA 4AGVA 3NKGA 2RJLA 2XUEA 1AHSA 3ZXGA 2EXHA 2NMNA 3HNBM 1RYYA 4LKDA 4OULA 1WW5A 2JE9A 3IBMA 4O65A 2Q5TA 2OYZA 3H42B 4DXSA 3IDAA 4DRVA 1QXJA 3NSTA 5FY9A 1J58A 1LOAA 2VCAA 3C8XA 3OBTA 1IS6A 4S2GA 3VDDB 5IVBA 4F83A 2VVDA 4E2GA 1JBCA 4NWVA 4WBBA 3ZN6B 2VXJA 2QQIA 5AC92 1XU1A 2XWBB 4IERA 2WNUC 1UPSA 3CJIA 4K8FA 1LTEA 3WG1A 4MLOA 3ITQA 5FYCA 3IB3A 2VVEA 1RUJ2 1OD3A 3PDQA 1CPMA 1DLLA 5C4WC 5DG1A 2DCTA 1XXNA 3L9JT 3WLUA 2VOTA 4WVVA 1W8ZA 3MBWA 5SV5A 3VN4A 3TEZA 4XTMA 1OC1A 1URXA 1EV13 1ULPA 1A34A 1OXCA 5IATA 1VJ2A 5BNOC 3MFAA 2DVGA 4P00B 4UW3A 4V2VA 4XILA 3WG4A 4BA6A 2W3JA 1D0HA 2W1UA 4NR1A 3B94A 1NA1A 3IAQA 2JDHA 4JQTA 4Q5OA 5FY7A 3POJA 4JHTA 4D8MA 1SEFA 3BTAA 4P9YA 1JZ4A 4ORFA 1DQ1A 3J9SA 4UFJA 1Q8VA 1VRH1 2XKOA 4AFDA 5DDJ3 3I49A 2WS93 2VW0A 3ZXEA 3RYRA 3TAYA 4CUGA 4YM0A 1WMDA 2X29A 3SH4A 1JOPA 4LITA 5FPUA 1JZ7A 4N90A 2ZGLA 4DB5A 4W65A 3OEAA 5DDJ1 4CCLA 5DQ0A 1UMZA 1W6PB 3HJRA 2AR6A 1H9PA 2QUOA 2VMHA 3ZFFC 4AQSA 2EVXA 5JXJA 1ODMA 3U4XA 2OPWA 2VGDA 4EYUA 4FOYA 3W58A 4N9HA 5A3WA 5LW9A 1H2LA 4P02B 1K5MC 1OBNA 1REEA 1UY1A 3JQWA 4AI1A 2R1DA 1WWYA 3NJYA 1PVC2 1Z78A 2HWE3 1PHMA 1YCIA 2ETEA 1KGYA 1DCSA 2V72A 3AMHA 5H9PA 3EBRA 1O3SA 5ABJA 4CCEA 1Q5OA 3I3EA 1J59A 1HQLA 1RJ8A 1KS4A 1GZTA 2HWE1 3H9AA 1REDA 1NXMA 2VR4A 3OF1A 4H14A 3AZVA 5BNPC 1AJOA 2WR9A 4JDMA 1XJAA 2GMMA 1LODA 3KGZA 2K9ZA 3ZXDA 5GLWA 4Y5TA 2EICA 2JG8C 3NV2A 4D3WA 3MW2A 4K6BA 3NJZA 1CAWA 2XOMA 5A3LA 4FFGA 1JODA 3MI8A 4TSVA 4AVBA 5KBFA 1VBC3 3BGAA 1GZ9A 2YBSA 3D8CA 1HB2A 5FXVA 3D3AA 3TEWA 2CGNA 1KXGA 4PQQA 2PLV1 4E4SA 3SNMA 1N3QA 2O0OA 3Q8BA 3LF7A 3RVHA 1NCRC 1W8HA 1C8M3 3IMNA 4H7LA 5A7OA 3ZFGC 5T5PA 2K0GA 3LWCA 4XETA 1F35A 1OA3A 3I2KA 4ZPIA 3VBOC 2WWSA 4BIFA 3I3BA 3LFIA 1C8M1 4LORA 2B9VA 3CJXA 4Q0QA 3POBA 5JSPA 4M0HA 1EPZA 4CCNA 5CADA 5T50A 4CDUB 3AL5A 3QOPA 3E5QA 4PIZA 2Y34A 2VL4A 1AR63 4X6RB 3ST7A 5BV6A 5JWPA 1YUDA 3JB8A 1R082 5IAVA 1G9AA 2ZA9A 2KM2A 3AKPA 4MGIE 1HB1A 2A6ZA 1AR61 3PVNA 4BOWA 2OX0A 4BMEA 1RUF1 4ISQA 5I93A 4A3ZA 2W5FA 3KV4A 4XURA 3CL1A 3IAPA 4ZZ5A 2XG3A 1X7NA 2ZABA 4Q4Y3 3TNPB 5JXIA 2RJ2A 3PVEA 5AFEA 3PJYA 4ZS3A 5GKAC 5CKNA 1E57A 2DYCA 4IV3A 1AR72 1UZWA 4NHYA 1YC61 1BCXA 4IEOA 4LOTA 2DV9A 4NAMA 4JGZA 4GMP3 4XMIA 2G9FA 2XMLA 4CXWA 3RZKA 2VBDA 4OVEA 5I0UA 1HQNA 5CYYA 3RYPA 3VDCA 4YNIA 1CAUB 4GZ9A 1WLCA 1IZ3A 2NN8A 1CAXA 3KT4A 4IEUA 4QQ2A 4GMP1 4YM1A 5FWEA 3ZO0B 2R16A 1W6MA 4HSJA 4N53B 4MUVA 2RJKA 4GAZA 5F9TA 1P8JA 1GOGA 1U5ZA 2QDRA 3ATGA 4KBZA 5LK5A 3DN7A 2D6MA 4QGLA 3UKNA 2RMU2 2VJXA 4IEQA 2IUWA 4AHYA 1OKQA 5LWBA 4K9SA 5C9AC 3VBUC 1U0AA 2WNVA 3GCXA 2KA3A 3IWZA 4XFAA 3DYMA 2XL9A 2Y60A 1O4ZA 3T4VA 1SFNA 2NQYA 1XYOA 5EIYB 2QQLA 1S0DA 2WO7A 4AK3A 4PHZA 4Q4V3 3WEZA 1BHGA 3O1VA 3SEEA 4YVWA 3AYDA 1RUC2 5L7OB 1WCSA 2RS33 3W5MA 3LSEA 3A21A 4L0PA 1DIWA 4B7KA 1UW8A 3HD8B 3WW3A 1OUSA 1WW4A 2BNOA 1JS9A 2GSYA 4PDWA 4Q4V1 1I9RA 2VQUA 3NKTA 4RR3B 5IVFA 1UOJA 4KNCA 3FLRA 4LO6B 2LW8A 1SBDA 1JUIA 2IFWA 1BMV2 2XJQA 3B01A 4IESA 2GZWA 4F7ZA 1COV2 3POYA 2YYOA 5A7WA 3ZSMA 1V6JA 3KVAA 3PUIA 4N7IA 1F5JA 3FX3A 4XJAA 5APAA 1MQTA 2XJPA 5EJ1B 3MGUA 1RTVA 4E4DX 3K3OA 1JYVA 2VCCA 3UGFA 3SMHA 1OQ1A 3ZLIA 4EN7B 1FPN3 2XB6C 1UQXA 2OQ6A 2VUJA 3A7QA 2WBKA 1HRV2 1B35C 2DTYA 3RJ2X 5C3OA 3ZYBA 1O8SA 4LTAA 2MNGA 3MHZA 2D97A 2IXHA 4IEYA 3WCRA 3Q8EA 5HCAA 3KVBA 3CZUA 4IEVA 2BTVC 1XNBA 1RVF3 2EIGA 4D6RA 3DXUA 2HH9A 4YZ3A 1PZ7A 1MACA 2I2SA 5EXOA 5FY1A 2PA7A 3EO6A 2XJUA 2JB8A 3HT1A 3VZKA 1LOFC 1TMF3 4L11A 3VKNA 1RVF1 4CDQB 3LDKA 2G9GA 3AYCA 1OA4A 4Q4X3 3LAGA 3E6CC 1CAVB 2UWAA 5IK7A 1VBA2 5D21A 1RUG3 1QJEA 1SFPA 1F4HA 1TMF1 2QBXA 2ZJCA 3ACLA 1IS3A 3DF0A 5JIAA 1ENRA 1X8MA 4X6QB 4D6SA 1R092 3O1RA 5L19A 4GH4A 2IZWA 4HL0A 2HEWF 3RZJA 3RG0A 2LM3A 4L2NA 4BPZA 4E9KA 2CY6A 3MLJA 4PT6A 2RDQA 2R0FA 5FZOA 2TNFA 4A4AA 5HXVA 4QKDA 2GMEA 1Q3EA 1TQ5A 3BIWE 3VGIA 5CA6A 3GZTB 3JZVA 5IHRA 2DVBA 4E2QA 2WT0A 3VKFC 1W8TA 4RS5B 1SLLA 4LIVA 1AR93 3VL9A 5C7GA 3GZAA 1ZZ6A 3WUDA 1UY3A 4FAHA 1HW5A 4CPBA 2VULA 4M3CF 2BU9A 1WW6A 3JBG3 2XVGA 2V5DA 2JDPA 2JD4A 5FZ4A 4AAXA 3GALA 3WQ1A 1AR91 2A5ZA 3ETPA 3LQCA 5I8YA 4GALA 4NHLA 2ENRA 3VDDC 4IDZA 3JBG1 1HDKA 3WT3A 3AC0A 2UY8A 1OI6A 4FFHA 2CWSA 4YG6A 4QWNA 1OFSA 3AXDA 3K48A 4D69A 3FBYA 1FX5A 2RHPA 2ZX1A 4RFRB 4WV8A 2R072 2OIIA 1ND2B 4RFT0 1FT9A 4QPIA 4FPCA 4J6GA 3OUJA 2F17A 2YFUA 4XVHA 2WSVA 3IN9A 2Q0AA 4CEWA 2B7YA 1MVEA 1ZZBA 1RMU1 3AM2A 3V0AB 1DGLA 2WWUA 5CVRA 3J4UH 3QLQA 2YZ4A 2E7QA 4LO5B 1H2MA 4XDPA 2D40A 4OHWA 4PJYA 3RI9A 4AQTA 3U4SA 3TN93 3WQ7A 2GALA 3O0XA 3O1UA 5A70A 1YFXA 1OH4A 1VRH2 2EXJA 5GALA 4TTGA 3OSDA 2D98A 3LDRA 3Q8FA 1DGWA 2P37A 4YW3A 1E5IA 3TN91 1UOFA 5BPXA 3PUAA 3Q8AA 1GNYA 2WZR1 1BXHA 1GWMA 3BN6A 3H7JA 4S2DA 2HWC3 2ZXQA 4FPOB 3WSOA 3LFMA 2Q8CA 4CPBD 2DCJA 1IPSA 1OVSA 5FYZA 5FPAA 4QU2A 2C26A 2OZJA 1H8TC 1XNDA 2D44A 2YU1A 5DMYA 4OI4A 1C5IA 2HWC1 1W6QA 5KC5A 4LBQA 2HBTA 4MGSA 1N1YA 2Q30A 1LU1A 4LA3A 1ULDA 2BJSA 1LHNA 4IW3A 3MPPG 3H8OA 5JAXA 1UKGA 2BVBA 5CFCC 1UU5A 4QM8A 3MIEA 2AZ5A 3RRDA 4KG0A 4OUEA 3ZXJA 1UMHA 2WNUB 3DKWA 2VZQA 3N4MA 5FP4A 4JAAA 4UFIA 2GN3A 4Q4W3 3I54A 1E5HA 1TG7A 2VOXA 3IPVA 4ASKA 1ZRFA 2HWE2 3IM0A 3MIBA 1C5HA 3VDBA 1KS5A 5D1IA 5FYBA 2AREA 4Q4W1 5FZMA 1UN1A 1ALYA 1SACA 4LHKA 1H6XA 1NX9A 3DPRC 2XH6A 2TUNA 1DYKA 1DQ6A 1S2BA 4M3CA 3UETA 3MEPA 1VB4A 2WIIB 2VZSA 3ACHA 3B9CA 5AVAA 2W95A 5IW0A 1CJDA 2E7TA 1GICA 5FZBA 3CJIC 4I09A 4A44A 4E27A 4DZGA 5JMOA 4HKOA 3KM5A 1GP6A 2DU0A 4HANA 1Y9GA 3VDAA 1XE7A 2QQKA 1AYN1 5K9YA 2PLV2 2WKKA 3TOJA 1WCQA 1U5YA 1SLTA 5F2WA 5A33B 3O1OA 4PIXA 4CDXA 3N35A 1UCXA 3ZFFB 3P3PA 4AI3A 3E6BA 4LBQD 4AW7A 2IXJA 2DF7A 3MV01 5GJ6A 3BTZA 1NQJA 1ZA4A 1YHFA 4AVCA 4C1WA 2PQSA 1ZNPA 2XHNA 2IC1A 4XUQA 4ET7A 1DZRA 3OGVA 5B2GB 2B4KA 4DEVA 2BOIA 2DBIA 3IIAA 4QDSA 1HN1A 1S0FA 1WLTA 3BOWA 1O5LA 1RUF2 4MGKE 4XUTA 1W0NA 3NV1A 1XB9A 2Z4FA 5A6ZA 3FLPA 2QQVA 3FZ3A 4RL7A 4CUAA 1LKNA 3ES4A 4GWMA 2QZ3A 4LKFA 4RHV3 2XL7A 1BK0A 5BNPB 4GXLA 4UI9L 2C0ZA 4DUVA 2B5HA 3AL6A 3ELNA 4RHV1 1LGCA 5F3IA 3UGHA 3ILNA 3WDWA 2GP3A 5LBFA 3NAPA 4XJZA 1AXZA 2JG8B 2XWJB 1XSQA 3MF9A 4QHZA 5DUWA 2YC4A 3T30A 1IQDC 4LBMA 4LA2A 2JDAA 4Z8BA 5F3EA 5BNNB 1WLWA 1F5FA 1A3KA 1FXZA 3ECQA 4HVOA 4K1YA 1DGWX 4AYUA 2XGXA 1YI7A 2J22A 2X10A 4Y4YA 5IFPA 2RG4A 4N53C 1V6MA 1AX0A 4JGYA 4GQ7A 4JDOA 2ZHKA 2P34A 5E88A 1NCRB 4FPYA 1UMIA 2XR4A 1V0AA 4TLGA 4ZXEA 3ZFGB 4BIOA 4DMIA 4DUXA 1QKQA 1LB2A 3BYWA 5FMDA 2UWBA 2WO2A 4COZA 1G9DA 3VBOB 1OT5A 4LR4A 4GWJA 4KBBA 4Y5Z0 3S5AA 3ROUA 1X33A 1QJZA 2ZMKA 2GC2A 4FFIA 2WABA 3BVCA 3Q8CA 4LUKA 4MXWB 2AYHA 4OHXA 4AEDB 4K8RB 4CU8A 3CKHA 3DCQA 3VBRA 3I2HA 2G9ZA 1W9WA 3A22A 4BQ3A 1EYBA 4BDVB 3PLQA 3G6JB 1MZ5A 2WAOA 5FYMA 1GUIA 1T6GC 1F15A 2J1VA 2R0HA 1ZREA 2NP0A 4FPHA 2CV6A 1PK6A 1WGPA 4IETA 3KZ4C 4KWKA 1OLME 3DKQA 1LU2A 3JCIA 5F5QA 4AVSA 3UV9A 2W46A 2Y6HA 4FO9A 4FT8A 1D7PM 2ZHLA 4KI5M 1HIXA 4KU8A 4S2HA 3VBFA 1TME3 3DL3A 2C5DA 1US3A 2LRPA 4IEPA 3FMGA 3THCA 4DXTA 3BKZA 2FD8A 3MICA 5GLZA 4AOCA 4RGKA 3SKJE 3MV11 2WZ8A 4R8HA 1TME1 1WMEA 1G9FA 1UIJA 3ZYRA 5FZLA 1PMIA 3O14A 2ZX0A 2RMU3 3KS7A 4XXPA 4XYXA 4A42A 2AACA 2FBEA 2QQUA 4J1XA 4BZ4A 2OQ7A 2K46A 1R1ZA 2VOWA 3GBFA 1RVF2 3QBQA 2DFCA 3H3LA 4Q27A 3RGBA 1X8EA 4QX0A 5JCTA 5CNAA 4QXHA 2D7FA 5C9AB 4I3PA 3VBUB 2GH2A 1QWRA 1TMF2 4NHKA 1ASJ3 3N7MA 1WMXA 1EY2A 4KGQA 4JGZC 4DXZA 4MGZE 5BNQA 2HEYF 3KV5A 1K45A 3WUCA 5I0SA 1JYNA 1LR5A 2E31A 3NNMA 1ASJ1 4L99A 5LBCA 4UW6A 1PIV3 3OPWA 1BYHA 1PNGA 2RS13 4CU7A 5FO8B 3URFA 2ZKLA 2FMDA 4PLNA 3ZXAC 4GULA 2VZTA 4F8AA 1PIV1 3GZEA 5K0UC 2RS11 2EXKA 4RS5C 1BJQA 2A1XA 4QMAA 4ZS2A 4AL9A 4BK5A 4CYDA 2WC2A 2D6NA 2ET7A 5FLJA 2AGSA 5DUXA 4OI1A 1IG0A 2WFPA 4HVRA 5CZKA 1RUE2 4RGAA 4R4ZA 2W1WA 5DUUA 5FQ0A 5JZGC 4XIOA 3M3EA 1AR92 1UF2C 5I91A 1O59A 1RUD3 3A4UA 3K3NA 3U78A 2OPKA 2JEMA 4HK9A 3ILRA 3NJVA 3WF3A 4RQPA 3JBG2 3AP9A 2PXJA 1DQ5A 4K3UA 1B35B 3ZX7A 2A3XA 3LSDA 2WUHA 5FZEA 4RD7A 1RUD1 2WWJA 3O7OA 1BQPA 2JD9A 4R4XA 3THDA 2R061 3C7HA 1CZSA 2W2IA 4WM7A 3IKWA 1PO13 4PDWC 5C3PA 2EIDA 4OZXA 1I3HA 4YLZA 5LEJA 1Z0HA 2ZGKA 4OCTA 2ZBJA 3PHMA 4XE9A 2YB7A 2GN7A 5EP9A 5L9BA 4AE2A 1LEDA 5FZCA 4YPJA 3SXWA 3ZIWA 1PO11 4OHYA 2DVAA 2EIBA 1D2SA 1Y3TA 2XJSA 4UT5A 1MQTC 1DHKB 2W91A 4JRLA 4HSLA 5FPZA 1RMU2 2XHKA 2ZCWA 1R093 2RS53 1RUH1 2JDZA 1UL9A 3WR0A 2JWPA 3E6DA 4EZHA 3HQUA 3TEYA 5F1RA 3DV8A 4BQYA 5J3UA 2RS51 1K42A 1MS3A 1LRHA 5K7PA 4P14A 3KHBA 1GNHA 4I01A 4XJWA 2AEZA 3AMPA 3BU7A 1QJU1 3GBGA 2VE1A 2W1QA 2W52A 2WZR2 3J8F3 3U1XA 5JSRA 1NLQA 1RINA 4EE2A 5E8AA 1OA2A 5LBBA 3ZPOA 2LROA 1QF3A 4AEMA 2BERA 5F7UA 5FY4A 3J8F1 1JI6A 3OG2A 5C33A 3OYWB 2QDNA 1OH3A 1H6YA 2HWC2 2ZEXA 3MO4A 3OY8A 2O1QA 2ARBA 4M0NA 4QPWA 4DNYA 4NVPA 1QEXA 4Y4RA 5CB7A 4GH4C 5JOXA 5A32A 3SITA 3M3QA 5FJHA 2R6QA 5TSWA 2VBBA 1OPOA 4MG2A 2R073 2B45X 2DVFA 4CP0A 1Y9MA 3UJQA 3RPQA 4FPJA 2ES3A 5EHDA 2GH8A 1C28A 1RHI1 2VAUA 3WF2A 1AVBA 4YW7A 3IT8A 2ZGPA 2R071 3LPFA 1O8PA 1HJGA 1YWKA 3K46A 4XFHA 3THPA 3CF6E 3EHKA 1VBD1 4Y33A 3J26N 5A1FA 4Q4W2 3K4DA 4AF9A 1IGOA 4QB1A 1E5SA 1GFF2 1CPNA 3FC0A 1JU3A 2BZDA 4XF4A 4FBFA 4Q0UA 4UBGA 1UPIA 3T0DA 3PUHA 4LMFA 1LOGA 1S1AA 4HOOA 3T3YA 4ZXKA 3PUQA 2Y6LA 5KWRA 1TE1B 1LULA 1VRH3 2E32A 3ON7A 1YLLA 5F3CA 3BTXA 2X09A 4TLFA 5D2AA 3S0MA 1REFA 2WRAA 1MZEA 4XZPA 1W2TA 4A2UA 3JD73 4Q29A 2HLEA 3O1TA 2G1MA 1AYN2 4AI9A 4LT5A 5C5TA 1US2A 2PHLA 3HN1A 1LEMA 2X53S 3ZYGA 4BQ5A 2CSGA 2HJIA 3JD71 4LJHA 3RI8A 2X8KA 2TBVA 3ZR6A 3LGRA 2ZEZA 1MS9A 1QJX1 3I4IA 1YJKA 4CEWC 4XDOA 5C8WA 3B02A 4XBQA 1Y43B 1H8TB 1VBE1 3HT2A 2QQMA 5T54A 2BNNA 1LCLA 4CDUA 5L9VA 3ZXKA 1CX1A 3WP3A 4X8PA 2GNTA 2A6WA 3O1SA 3U11A 1POQA 2W39A 3I59A 1HXS1 4YWAA 4DS0A 5CFCB 5HCHA 2Y38A 3BALA 2W1SA 4DINB 5JI9A 3PL0A 1W9YA 3U37A 4FOWA 4EN0A 2BBVA 3LEGA 2UU8A 3H1WA 5F3GA 1XPWA 4QXBA 5E16A 1YQ8A 2CAUA 4B8EA 4FQ4A 4COVA 2ZS6B 2A70A 1W6NA 1S2KA 2VZRA 4OMDA 2EXIA 1JW6A 1FNZA 2JXAA 4MSVA 2ORZA 2R7EB 3ABZA 4RHV2 1O91A 2P6HA 4HN1A 5DZEA 4BE3A 3DPRB 1WA4A 3J7NA 1MS4A 3WW4A 3UT0A 4XFGA 2OW4A 4O7XA 4Q8LA 4RA0A 3SCHA 1OLRA 1VMFA 3O12A 2VMDA 5I8SA 1XQNA 4JTOA 5FZ7A 4NIDA 5BNNC 3WP4A 3BODA 2H0VA 4DXRA 5D8AA 3CJIB 2PLV3 1JMUB 4COYA 1JHJA 2W47A 4IXLA 1BK1A 1H1AA 4PI0A 1UY2A 2E51A 1TNRA 2WLPA 4KQ7A 4YVSA 1RXFA 1MS1A 3LEKA 4QKFA 4LO4B 4TZDA 2D5FA 2DCYA 3HEIA 4JTNA 4YM2A 2DUOA 1W2NA 3AMQA 4HMZA 4KGGA 4LLOA 4MZUA 5LB6A 3T0AA 4GJZA 1NCQC 1ZBE1 5FV3A 3MZHA 1JH5A 2JB4A 3HWJA 2GC0A 4ES8A 2P3IA 2HYKA 5LA1A 3MFCA 4P9LA 5A3PA 3OTFA 5IK5A 3D0JA 2XVKA 1RUF3 1V9U3 2HBUA 3W9AA 1IPJA 2O8OA 2Y0IA 3MW4A 1WLDA 4RR3A 5E6HA 4AEDC 1L7QA 3HVDA 5DXDA 3HBZA 3POGA 3A0KA 5FXXA 5J48A 2XUMA 1V9U1 3U10A 4CVUA 1RUOA 4QGNA 3WOGA 1AF9A 2XLAA 1WD3A 2E9QA 5EYYA 1XE8A 5FZ8A 4CDXC 4E4ZA 4LUMA 4WVMA 3LA3A 1FNYA 3B5LB 1UZZA 3PMEA 2BOJA 1GZWA 2X5IA 3FFQA 3WW1A 2D3SA 4H2AA 5IAXA 4CDWA 1OD5A 3M3CA 3PNAA 2J1TA 4XJ9A 2P17A 4CUCA 2BYVE 2JX9A 4MX3A 4D94A 1PGL1 3VZJA 1W8UA 5LBEA 1L7RA 4CEYA 1LECA 3N9PA 1UYXA 4IE4A 4Y5SA 1TME2 2FDJA 3K77A 3USSA 5ACA3 1EUTA 4XZUG 2ARCA 3GHMA 5JI7A 4NHMA 3OEBA 2PHWA 4AXOA 2WINB 1O3TA 3MIGA 4ZONA 5ACA1 2YV8A 4QDQA 5J7MA 2PELA 3HN3A 3ES1A 3TRSB 2WSUA 1XU2A 4C91A 3WDTA 1DFQA 2VCBA 3PMSA 1S2EA 4I0WB 3R05A 4CSWA 5GLVA 4FPEA 1KDKA 3OOXA 4XF9A 4UAPA 3NAPC 5IVYA 3BI3A 3VZNA 1Q8PA 3FFZA 1UOGA 3T08A 2W94A 1LHOA 2YDEA 5HI0A 1ASJ2 5I8TA 2Q1MA 1FV3A 4CP1A 5T55A 5LCWL 4PBPA 2A6VA 3QH6A 3KQRA 4H55A 1S0EA 4I3GA 5CFDA 4P9XA 4AAPA 2Q8DA 4QB6A 3UYJA 2QZ2A 1ZRCA 5FZ6A 5AVPA 5T5LA 1A8DA 1PIV2 4QHBA 3HNYM 2RS12 3AVSA 3OD0A 4FP3A 3WX5A 4JKKA 3WNPA 2P2KA 4HBNA 5IK8A 1NZIA 1UNBA 2ILMA 3USUA 3WG3A 4URAA 1W9FA 4IEXA 4HXCA 4UW4A 1ZYBA 2D6OX 2EIEA 1ENXA 3AJYA 5FCCA 2UYAA 4P5YA 2H6BA 2RDRA 1IOAA 3NL1A 1BZWA 2VNGA 1FOD1 4MGTA 4NJ4A 4CUBA 1G8WA 3ZMOA 5FYSA 1SLAA 4BXFA 1KITA 1RUD2 4BYYA 1UWWA 1OQDA 3ZFEA 2R062 4CXYA 3RZHA 3VBRC 3RNSA 2PHTA 5FPXA 2E53A 2G4IA 4FPLA 2WZEA 3ZXFA 3UGGA 5A3MA 4YGEA 1PO12 1M06G 1JYWA 5H9SA 1GNZA 4BQ4A 4ZZ8A 4KU7A 1MS8A 4LK6A 4MHRA 3THTA 1PK6C 1RUH2 4M4PA 3VBFC 4IV3B 1QJFA 1VPHA 4NPLA 4BB3A 4IGQA 4JGZB 2RS52 1ODNA 1BEV3 1I6XA 3VBSA 4GMP0 4A41A 1G9CA 5CG8A 5DG2A 2I45A 3O1PA 1MR5A 1CAXB 4UFHA 3K75B 3FL7A 2WA3A 3GJBA 3ALQA 3POIA 4Q26A 1QJU2 1BEV1 1W6MB 5KR7A 3T2PA 4HK8A 1JZ3A 4NE9A 2XDVA 2C1FA 5FZ1A 2ZKNA 3KQ4B 2P3JA 4AI0A 1RUE3 5K0UB 2VUAA 1VALA 5I0TA 2I74A 1WMFA 2YGMA 5KXCA 1RB8G 3J8F2 3H50A 1TNFA 4W6YA 1XSRA 1V6KA 5JZGB 2WNVB 1XNCA 1GBGA 1QDOA 1RUE1 4GA9A 3S30A 4COUA 3VUOA 4FTBA 4NWWA 1H8VA 3AMMA 3C2UA 1V6OA 5FZAA 1HRI3 2E6VA 2FZ2A 3NVCA 4BCUA 2LALA 3HIFA 4YZ2A 4XFFA 4I2OA 2KXLA 3O0WA 1HRI1 3GDBA 1YRZA 1UX7A 1NQDA 3J7LA 2VZ3A 2JKXA 3DYOA 4FCAA 5C4WA 1FMD3 1PGW1 4PDWB 1RHI2 4XJ8A 5KHKA 3VKMA 4JKMA 2EALA 3H1YA 4UW5A 3NNFA 1MEC1 4HETA 4G3YC 5C8CA 4YW2A 5F37A 4LBOA 2MEV3 3FLTA 1VBD2 3D5OA 1RMU3 1FMD1 3BOPA 5A7WB 5BNOA 4M00A 2VZVA 2EF6A 1X9PA 3OPZA 1MQTB 5FOBB 2MEV1 1OOPC 3VLBB 3AFKA 2WQ4A 1DGRA 2WZPP 2W87A 4RQPC 3O5SA 2C6SA 5L73A 1W03A 3B7MA 1D4M1 1KJRA 5J36A 4CA9A 3AP4A 5FKCA 1F9KA 5DAXA 4YSFA 1TEIA 4IV1A 1SPPA 4B1MA 1GOFA 1LHWA 2WZR3 2D6PA 4QPGA 4CP2A 5FZ9A 4CXXA 5L36A 4Y22A 1HJFA 1D4VB 5A33A 2VY0A 4B29A 2J1UA 3JD72 5FYIA 4QDRA 4B4RA 3H7YA 3WG2A 1CZVA 4HONA 4NPMA 5FP7A 1QJX2 2D3PA 1CJPA 3UK9A 3ZFFA 4D0QA 1HV1A 1W2OA 1WW7A 2O8QA 2ET1A 3VKOA 1VBE2 1HB3A 1L7LA 2BP6A 1GP4A 3JUUA 4GIQA 4XEZA 1EAH3 3CO2A 5LASA 3V64A 3WHUA 1PX4A 1OF3A 1SBFA 1WCDJ 5FY8A 3UL2A 3ZOIA 4AR2A 3GBWA 5LZ6A 4GH4B 1GWKA 1K5MA 1EPWA 3M70A 2Q8OA 1HXS2 4K40A 5FUPA 2H0BA 1PM4A 4JQRA 2VUDA 2IVJA 3C7FA 2XXZA 3APBA 1EAH1 1DG6A 1AR81 1ZZ7A 3OGJA 1VIWB 4N43A 1JYCA 2ID4A 2ZGMA 3FUQA 5FZOB 4BLIA 4ES9A 5A1AA 1KEXA 2W9XA 2WQZC 3I2DA 4OQ8A 4DFSA 3AP5A 1Q43A 2PYTA 2JE7A 5CISA 1K5JA 2R1BA 5BNPA 3EYPA 5FFOC 2VD7A 3L2YA 1Q8QA 2HWD1 1AUYA 3AJZA 1OLQA 5DABA 4NIHA 2L9LA 2Y6FA 4V1PA 4YARA 4B1LA 1UXXX 3GM8A 3ZN4A 2OXBA 1TVGA 3VD7A 4PCRA 2HWF3 4COWA 2P4EA 1BBT1 1A78A 2CYFA 1FYUA 5GLTA 1IS5A 2YG0A 2C4XA 3J7HA 4GKYA 4BJ0A 4CU6A 5I0RA 4OHVA 1ULCA 4CRQA 1AYN3 5A7NA 1H1MA 4XC9A 1STMA 2HWF1 2WJSA 4XBNA 3ZSJA 2ZPXA 4A45A 3SLIA 3E97A 1SDDB 2BNMA 4LULA 1C4RA 2RDSA 2BWCA 2QQNA 2RDNA 3KT1A 5FZIA 2H6CA 1ULEA 1XNTA 4XXAA 3RSJA 3ZFGA 1N1TA 4AHZA 3DUIA 2QKDA 2GU9A 1SBEA 5FOJB 1OF4A 2O14A 4LKEA 3ACFA 1SLCA 2B9UA 4P5HA 5A3OA 4D7YA 5F5CA 4CEWB 4HKLA 1ZBE2 1SHWB 3INAA 1NA1C 4K21A 2BFUL 3L2HA 2BGPA 2Y6GA 3LD8A 1ND3A 3T2TA 1N3PA 1QOTA 1NOVA 1Q8OA 2FCUA 4XCAA 2IXKA 4ASLA 4YGDA 3S57A 2J42A 3FHQA 2RV9A 4R9CA 4K7JA 1RJ7A 1V9U2 4Z82A 2P1BA 1GV9A 1D0GA 1JYXA 3O1MA 2SLIA 4B4QA 3OD4A 5A3NA 5JXHA 2ZGNA 3KCYA 5ERLA 5C5UA 3ZDVA 4AFAA 4LBJA 4QM9A 4PI2A 1ZX5A 4Q0SA 5DPNA 1YQCA 4OZOA 1SG3A 2NM1A 2V5YA 2ZAHA 3P6BA 2ARXA 2V4AA 1W6QB 1VLNA 2YBPA 2ZGQA 4HPKA 1VRBA 3GGLA 3ZDSA 3WVJA 3VZMA 2F6BA 1PGL2 4NO4A 4XW3A 4NIIA 2WT2A 5FYUA 1UOBA 3AZZA 1DZTA 4FTSA 1AX2A 1GP5A 1LJ7A 1RGSA 1X9TA 3AZWA 4YGBA 2VZPA 4YZ4A 3NNJA 4C0HA 2HWB3 5CU1A 4OYUA 1OHFA 2YC0A 3HMYA 4QX5A 4QX7A 4XQ4A 3T0BA 3WINE 5GM0A 2LTNA 2PHDA 5ABJC 3IPVB 5EQUA 4QHOA 5ACA2 3RWNA 2HWB1 4LE4A 4G4FA 1W6OB 2ZGOA 2DDUA 4QQPA 5FZ0A 2NPIA 5FLHA 2BEOA 2HKXA 5IVEA 1YIFA 2SBAA 3V0BB 1F4AA 5ISLA 5C9AA 5HV4A 5JIUA 3OB8A 4Y20A 3LA2A 3NNLA 3GHNA 1W3XA 3JB4C 2Y26A 3ZSLA 2UWCA 1NCQB 4M3CB 4QQLA 3ZPYA 3NV4A 4R9AA 1S0IA 1SLIA 1ULGA 3ACIA 1U12A 4AFBA 1E5RA 4ASMB 5SV8A 2LS6A 2JDNA 5FZDA 4QX2A 4LKSA 1VBB3 4DUWA 1K3IA 5CG9A 1WKYA 4YZ5A 5FMBA 5T3NA 1X82A 3PURA 4QXCA 1QXPA 5D8AC 5DAPA 1MS5A 4AFCA 4HG6B 1C1LA 3N9NA 2QNKA 4DO0A 1V6LA 4JC1A 2CTVA 3R4SA 3EXUA 1VBB1 3N9QA 2BRTA 4UFKA 1PVXA 1W3VA 4EROA 1WA6X 2CNAA 4AFMA 2XONA 5JR2A 5KXEA 1BVVA 4YVSC 4C8DA 5CAZA 2DWRA 5HBAA 1OVPA 4DQAA 1R64A 2DURA 1ZA7A 5FYVA 1ZBA3 5LATA 4RSUA 4CDXB 5I0DA 1NAEA 1JZ6A 1RC6A 1ZZ9A 4AG4A 3ORJA 5KHGA 3WY6A 2V09A 2XJRA 3NW4A 2W92A 3LPGA 4WZCA 4XOGA 4KH9A 1ZBA1 5JVVA 1NT0A 2V73A 2R32A 2YROA 1PMHX 1OUXA 1AYM3 1FOD2 4WM8A 3MLLA 3RS6A 3U0ZA 2VU9A 2C9KA 3EQEA 1LAJA 1AL0G 4JRAA 3CLPA 3OBRA 2XBO1 1QOOA 2JG9A 5M0TA 4W8JA 3SH3A 4E8DA 1AYM1 4LO8A 2DCZA 3POFA 3OGGA 1QGLA 2VOKA 4EWDA 1ENSA 4NIGA 2ZHNA 3R4UA 5FLIA 1ZM1A 2KD7A 1LGNA 4QX1A 4CP9A 4XCBA 4E8CA 3ZSEA 2F4LA 1KD7A 1C3HA 4IEWA 1LOFA 4QQHA 1RUNA 1QY4A 3SH5A 1Z7S3 2ZACA 2BPA2 3I7DA 1DQ2A 2X5IC 4L8QA 3N3HA 2FHRA 5FYYA 3SHRA 1JZ2A 5HPOA 4CDWC 3UKTA 5HXMA 5FYTA 3OGSA 4XF1A 1GMMA 4IV3C 1NY71 1VMJA 1Z7S1 3NAPB 3RMXA 1XOYA 3TYJA 5FY5A 3BU0A 4CEYC 2ZHMA 4NPRA 3BB6A 3MPBA 2WLQA 1GSLA 1JOJA 2JDUA 3C7EA 4AEKA 1BEV2 1CR7A 2OS2A 2J1SA 2QQWA 3D0SA 4PQ9A 5IT6A 5HV0A 1W04A 4IQPA 3QD6A 1W8NA 2D5HA 5FR3A 4AHWA 1N1SA 1CONA 3UKVA 3HBKA 1PZ9A 2YU2A 3OYWA 5FZ3A 3BPSA 4NOTA 2Q1FA 1AL21 2WNVC 4L92A 1VMHA 3BUCA 2YMZA 5JSOA 5B4NA 5GZFA 5F5IA 3I8TA 5JPNB 1OQEA 1HN0A 3VHRA 1UX6A 3ZXLA 1W99A 3VDDA 5DAQA 4XFCA 5FMCA 2G19A 2Y8KA 4XPVA 2R063 2BQPA 2BUKA 3RMYA 3ZN6A 2AC1A 4PLOA 4Z1VA 4YVWC 1HRI2 4MGYE 4Y3OA 5CFDC 5F8PA 1PGW2 3CNAA 3T2OA 3VBRB 2HEVF 5FPVA 1NLSA 2Y0OA 1MEC2 2XLGA 3WQBA 1W28A 4EV0A 1JYTA 1DYPA 2VCMA 5FPLA 3KSCA 4URTA 3AVRA 1FMD2 1RUH3 3MLKA 2WFF3 1W9SA 4YRDA 2MEV2 5FDBA 1PK6B 3PU3A 3WF0A 1BVP1 2A71A 5IYYA 1BLZA 5A3UA 2ERFA 3VBHB 3VBFB 3OUIA 1U5XA 2VG9A 2D6LX 1D4M2 2WFF1 3I2GA 4W4ZA 3VL8A 5JOZA 3H8RA 2J7MA 1POV0 2VOVA 1SLBA 2VZUA 4NRMA 1QH7A 4QKBA 2GDFA 5T52A 1QJU3 3ZFEC 2ZGUA 3CBNA 2UYBA 3ASIA 4JKLA 1PO23 3N9OA 4BK4A 5EV7A 4TN7A 3C7OA 3GYDA 4KWJA 4BQXA 2ZZQA 2CWMA 4EJRA 1C8NA 4L97A 2AH2A 1PO21 5A6XA 3WF1A 4CZSA 5IVJA 3RZMA 4ONUA 1W6PA 1JXNA 4Y1YA 2WT1A 3ME2A 1WZXA 3FHAA 1RL3A 2EA7A 5LK7B 1W39A 1XYNA 2DFBA 1QMJA 3VKLA 2CL2A 1XBFA 3WZ1A 3RYKA 1Y4WA 2ZTNA 5A1LA 1R1A2 2WL1A 4YGCA 3QACA 2VECA 3VBSC 1EAH2 1AR82 1RHI3 3VD5A 2JDYA 4XAEA 4EN6B 5F6KA 2WQ8A 1VBD3 5EJ3A 2P3KA 3A0NA 1MVQA 3P1IA 4META 4TYSA 5JR7B 1ST8A 2WNOA 4QQOA 5A6QA 2XJTA 2BVVA 3LEMA 3W21A 4P9WA 2HWD2 4AWDA 4XIKA 1RUI3 4NRQA 2IXIA 5C70A 3KV6A 4GKXA 1DP0A 4FPKA 4LO7A 5FQ0B 4OQ9A 3DPRA 5CEHA 1G7YA 2E7AA 3ZYIB 5FK7A 1JN2P 3UESA 5LRSA 1QOSA 1OOPB 1WBLA 1RUI1 1BBT2 4MHUA 3FE5A 2A6YA 4RQPB 1W9TA 2Y64A 3WDYA 2PTMA 5BY5A 2PQQA 3WNNA 2HWF2 4JZRA 1S0GA 1QDCA 4GD4A 1QQP3 1AJKA 3OBZA 4MOAA 4WM7B 1W05A 3DXTA 3LEIA 4LNVA 4XQWA 3SEPA 1IS4A 2FZ1A 1FATA 3LZZA 5C8CC 1QJX3 1CIYA 2F4PA 3LOIA 1QQP1 3PVOA 4QPIC 4GB33 1SFYA 1VBE3 4B4PA 4XDQA 1UY4A 4AEJA 2VNRA 3T1MA 3B00A 3Q9OA 4PF5A 1EV11 1W8WA 4GB31 1HV0A 1DLCA 1HXS3 3IDCB 3K4AA 3KCCA 4LE3A 1J1TA 5GZGA 1XE0A 4YZ1A 1H2NA 3TWIA 5A7SA 2VH9A 4I02A 1VAVA 3DECA 4IV1C 4A7ZA 1N1VA 1GZCA 2ARAA 1OPMA 2CGOA 4PIYA 4QPGC 1UXZA 1LNSA 2IXCA 3FHIB 5IVCA 5LY2A 2XPJA 2YGLA 2BBAA 1DYOA 4FVVA 4XABA 5IWFA 1VR3A 1NG0A 2WS91 3G7DA 4UF0B 5FZGA 1MS0A 3ZYPA 1UYPA 2LUWA 1ZRRA 2BGOA 4UBHA 2A3WA 3ZYHA 4A3XA 1UZVA 2DU1A 2AEYA 2Z2SB 1KQRA 1MPXA 3TBDA 3OY8B 4MXVA 1JZ8A 3T2QA 1OKOA 2JICA 2JE8A 4QKNA 4AZZA 3PIGA 3ZM8A 4QU1A 5IFTA 3CDZB 2VMFA 4M3CE 5EFUA 3MDPA 1V6IA 5A32B 3RWKX 3SCGA 5FBJA 5FAXA 1EUUA 1Y9QA 4K20A 4NAOA 4N43C 1CAUA 4QGMA 3K51A 3ZKUA 1QJY3 3V65A 1H30A 2YBKA 3NV3A 4N53A 4J25A 1J3RA 1AZDA 1LHUA 3POSA 1JHNA 4AVAA 1QNWA 2C24A 5K8SA 4YW6A 5ANQA 1QJY1 2HWB2 4M01A 2MHFA 3WP5A 4ZU7A 4CCCA 1LGBA 3MYXA 1ZBE3 2YUEA 3AKTA 4Q2FA 4LHSA 4NN0A 5FKBA 1QU0A 1NE6A 2Z5WA 1UU4A 2AUYA 4AQ2A 2QQJA 2YXSA 5L9RA 3HPNA 4HKWA 2VVFA 1T2XA 4XUNA 2BV4A 2P5BA 2Z79A 1NA1B 3AYAA 3PUSA 1G6NA 1YNAA 1GWLA 3SQOA 3VBHA 1ENQA 4KMQA 4FPGA 4AI2A 5L7OA 2FCVA 1VBB2 3RZZA 5A7QA 4EWAA 3VB9A 1DF0A 4LPLA 5FZKA 3ZN5A 1VBC1 1W2AX 5GZDA 3ZYFA 3OCPA 3MW3A 4FPFA 4QB2A 2JIGA 4BWOA 3VD4A 1A6CA 3H1MA 2Q8EA 3AZYA 2VC9A 3B69A 4KWUA 4Z2WA 4MV2A 2RR13 1VAKA 4BXSV 3HQXA 5FTTC 2RM23 5C71A 4FSJA 1ZBA2 1GKBA 1D2QA 1O7FA 1VAMA 2JDMA 2PHUA 3KV9A 4LEJA 2WO1A 1NLRA 2D3RA 4YM3A 4YFWA 5C3QA 1ND3C 3ZKYA 2RR11 3OGRA 1XRUA 2RM21 3I59B 1GLHA 2XBO2 5FMOL 1J83A 4Q0VA 4DEQA 4Y1VA 1M4WA 1J84A 1AYM2 4XJUA 5FMOS 1QHDA 3CZJA 2VBPA 5HCBA 3I3DA 3PJQA 3W59A 3MUZ1 4ZU4A 5T5OA 3CIHA 4XMAA 2XKPA 5DZGA 5EPAA 5ABJB 2J1EA 3LKJA 3S5QA 3PTYA 1W6NB 1IG3A 2FCTA 1O4YA 3N9MA 3WCSA 4CDQA 1U5IA 2VZOA 1OLMA 3DGTA 3LE0A 2GAUA 2D6KA 3KD4A 1TZOA 1CAVA 1WUVA 1QXRA 2YPJA 4H3WA 1GANA 3NNGA 4XACA 4CCDA 1LHVA 1VE0A 4Q4Y1 4YG0A 5K4LA 4BH9A 1NY72 3ENRA 4NMIA 1Z7S2 4UYBA 5JUVA 2QJVA 5J1XA 5LA9A 2VMEA 1ZZCA 3AKQA 4KG8A 3SISA 2OT7A 2UY9A 2JJ6A 1GR3A 1DGRN 2C9AA 1CAWB 1SDWA 2R043 5D8AB 3WDUA 4AVVA 4DY3A 4N7UA 4IUGA 1G9BA 3IIIA 4YYOA 1ULFA 4MH0E 1H4HA 2YFZA 3VHNA 1GQGA 2OUHA 2FDHA 5K0UA 1CGPA 2B8MA 1NUKA 1SZBA 2R041 3NRUA 4JGYC 4PBOA 4ISRA 4RS5A 4YVSB 4B7EA 2VZ1A 5BXXA 5BUVA 1W8OA 1CZTA 4V2WA 5KXDA 3I3MA 1H1IA 5JZGA 4ATFA 1W90A 5LA0A 3I2OA 1AL22 1GU3A 1V70A 1FOD3 4FQZA 2BW8A 4GWNA 3BCWA 1JZ5A 2JECA 3WNXA 5A6YA 1W06A 1GOHA 4JDNA 4LBNA 4U36A 1DZQA 1H4GA 3AP7A 2QQPA 3VD3A 4IGOA 2GNBA 2ORXA 2ZGRA 4WZFA 2TEPA 1S0JA 4E2SA 5J09A 1QH6A 5C3SA 3OUHA 3C7GA 4MGQA 2RS31 1ND2A 4LBKA 2ZZJA 3N7JA 3S7IA 3H3UA 2XQXA 3V56A 1ZRDA 3KWVA 4HT1T 4EZ4A 2PN5A 1IKQA 5FBZA 3KB5A 4B3NA 4U2AA 3I2FA 3U14A 1LESA 4WVMB 3A23A 1GZWB 2X5IB 5HCFA 1N47A 3V0AA 4AVTA 4CDWB 3I2JA 1ZVFA 1A8MA 3PIJA 4YW4A 4WM8C 3VBHC 4WVZA 2WFF2 3SCFA 2CDPA 2DVDA 4W6XA 5FUNA 4QX3A 1SMVA 4AI8A 1FPN1 2JG9C 5DZFA 2IFRA 3AZXA 2QQOA 4AHXA 4CEYB 3RZGA 4NIAA 3H3ZA 5FY0A 1GQHA 3LIHA 4YG3A 5JXGA 3WQ0A 4IE7A 2VTXA 3E1F1 5FP9A 5KC6A 5AFBA 2VTFA 4RN5A 1PO22 1SQ4A 3M3OA 4MVTA 3GNEA 3RJRA 2VMIA 3WDVA 5J37A 4FP2A 1B09A 3SC7X 3SKVA 1LOEA 4I30A 4EWEA 4HZFA 3GJAA 3WNOA 5G04L 2OVUA 2FDKA 1HB4A 1HLCA 1NE4A 3I97A 5FP3A 2PHRA 4TXWA 3KF5A 5LEKA 5F39A 3U07A 4Q4X1 3RFRA 3TEXA 1YYNA 3IZOA 3PVBB 1RUG1 3BPZA 3KF3A 4DOUA 2ZMNA 3I3QA 3HNMA 1K12A 2BGCA 2WNUA 4YVWB 4NRPA 1MEC3 3WNLA 2VNVA 3N7KA 5CFDB 1UYYA 2VQAA 1YXWA 4OFGA 1DU3D 5CBLA 1DQ4A 4Q8KA 4DY5A 3WNMA 1YFYA 5KHHA 4XUOA 1YQ6A 4OUSA 3FJSA 4BQ1A 3LB9A 4IE0A 3UNPA 3USUB 2P3YA 5IJRA 4XQDA 1UAIA 1S0CA 4QPYA 2VMCA 3NQHA 3QH7A 1CWPA 1QIQA 4XHXA 1D4M3 2HYXA 4QD2A 3AKRA 2CAVA 4P9IA 1RUI2 3PU8A 2IWGB 1CD3G 1YFWA 4LHLA 2GC3A 1AX1A 1UD1A 2DBNA 5GZEA 4Z92B 1RITA 3W20A 2X05A 1RXGA 4XF3A 1IQAA 1KFUL 4LLFA 4O9GA 5LRRA 4FTEA 3ZFEB 5BYNA 3LIGA 1JTZX 4WM7C 2CHHA 3EMRA 5FXWA 1W0PA 1J3PA 2ATFA 3ZR5A 2OUJA 1QQP2 2E33A 4C0BA 1YFUA 1LOBA 3CU7A 3EJKA 1C1FA 4FOVA 1ZRIA 1PNFA 4J1WA 5F32A 3FWEA 4BM8A 3KLSA 1WD4A 2W68A 1EV12 1O5UA 4GB32 2VW1A 1R1A3 5B4XA 3OJBA 1OURA 2GMPA 4CCJA 1AR83 1H0BA 4XAAA 5FZHA 3ZSKA 1YQ2A 3KMHA 1R1A1 4CCOA 3VBSB 2VQTA 1VP6A 5H9QA 4E4HA 3N36A 4OUMA 1I1EA 1X36A 3ILFA 3JXSA 4JCKA 4OI2A 2A3YA 4XF0A 4GJYA 4YFZA 4LBLA 4BQ2A 2WO3A 4RGGA 4HFSA 4NHXA 5FREA 2HWD3 1W2UA 1YI9A 1XC6A 1V6NA 1F2NA 2WS92 4KL1A 4MO3M 5DDJ2 2Q1ZB 5FJKA 5JOWA 1KRIA 2I07B 4QAWA 1JYIA 3M3IA 2ZX2A 3MIHA 4JX0A 3HR9A 5FRAA 5FZFA 1WCKA 5FYHA 4CE8A 1BBT3 2W0XA 3P5BA 4FXKB 4JHZA 5LY1A 1CIWA 1Q56A 2VXRA 5GZCA 5AC93 2ZAAA 1Y7BA 2OKXA 1CQ9A 4ARYA 4CCMA 2JG8A 1PX3A 2WNEA 4IE6A 2OZ6A 3RQ0A 1FI2A 1RUJ3 1YJLA 3AXEA 3WXPA 5BNNA 1BKZA 3E5UA 5AC91 1FV2A 4R52A 4Y26A 2ZMLA 2YC2A 1RUJ1 5LA2A 5C4WB 2R30A 2VM9A 2GP5A 1XYPA 5F5AA 4L9BA 1QJY2 5C3RA 1W6OA 2D43A 3U75A 4BMBA 5C8CB 3TB0A 2B46X 1G86A 2FDIA 1NCRA 4ATEA 3V0BA 4OHZA 4QPIB 2QFEA 4FAGA 5BNOB 2ZOEB 2IVIB 3E5XA 3IDEA 3KT7A 1JUHA 4R9BA 3MIDA 4GWIA 4UFLA 4A6SA 1NCQA 3VBOA 4HVQA 1W0OA 2WYFA 3LCPA 4ARXA 3VD9A 3AK0A 2VQ0A 2ZX4A 1EP0A 3D6EA 5FO9B 2BFUS 4IV1B 3S6PA 1SPPB 3M1HA 4FFFA 4MXWA 4RYDA 1S0BA 1LENA 4AEDA 4QPGB 5J96B 4QXKA 2VTXJ 5FP8A 3H8XA 4Y22B 3M8LA 1UU6A 4BLJA 1VBC2 4NROA 4PF1A 2ADEA 2ZGTA 4UOJA 2BWAA 5DUVA 1ZZ8A 5A7PA 3LOBA 2GNMA 3VHPA 4XUPA 4Q1PA 3MUY1 4DPNA 2PAKA 2A6XA 4XHBA 1C8M2 2EAAA 5EWSA 4MADA 4A6OA 2FQPA 3ZYJB 2CU5A 2QVSB 3M2MA 3D82A 4FOQA 2VUCA 3M7AA 1CESA 4XBLA 5DAWA 3FN9A 4LBQB 3PTRB 4CDUC 1PMJX 1PVC3 1H2KA 4K1ZA 3X29B 2RR12 3I2IA 4SLIA 1K5MB 2RM22 4ZU5A 1CVNA 2J1RA 1JOBA 2PMWB 2B42B 3WD5A 4Y1XA 1O3RA 5EZWA 4N43B 2QTWB 1UO9A 1AR62 2YY1A 1PVC1 4H7MA 4LXLA 4ITCA 4EN9B 2Q4SA 2WN3A 3GXUA 4BHPA 5EYXA 1O3QA 1H9WA 4JV4A 5A80A 4AGGA 2FDGA 1YIPA 3LDBA 4P9GA 1UZYA 5FPBA 1UIKA 3VZLA 1GYKA 4O61A 2PAMA 1WCUA 4W6WA 2Y33A 3M4FA 2KR2A 2GC1A 3RZLA 4C1XA 3POEA 2NYYA 3VBUA 1SCSA 3JQXA 4Q4Y2 4SBVA 3WF4A 5IVVA 1DDLA 3VHOA 1YQ5A 3DYPA 1RIRA 3AMNA 5CIRA 3FBMA 4QT6A 2UURA 3CHXA 1PZ8A 1FAYA 1LOCA 2A75A 5A3TA 2Y6JA 3UJOA 4AGRA 1MZFA 3AFGA 4WVWA 1ACCA 4JVAA 4EN8B 2PFWA 4EQVA 4P9JA 2R042 2P6CA 1DBNA 2DUQA 1APNA 2WDBA 2W08A 4IGPA 3O0VA 3KGLA 3HQRA 5FUIA 1HKDA 5T5JA 4DRRA 2MPFA 2DTWA 2NMOA 1YO8A 3N9LA 5F2SA 5FO7B 5KXBA 1XNAA 4Z07A 1XNKA 2J1AA 4Z2AA 4TWTA 3R6SA 2XBO3 1R083 4LIUA 4XTPA 4UXAA 4INDA 3N7LA 2OA2A 3KHCA 1ND3B 1YEWA 1B35A 2FMYA 1ONAA 5L7OC 5GLUA 4DIQA 4ZHNA 1VB2A 3ETQA 2VNOA 1N3OA 1AXYA 1R081 3GZUC 4P08A 4Q4V2 4M4RA 1IKPA 3FUOA 4CCKA 2JIJA 3RDIA 4RR3C 3NMBA 1GQPA 1KDMA 2RS32 4OMCA 5CKMA 4IL7A 1Q8SA 1F8VA 1UYZA 2DUPA 1CX4A 2YHJA 3NJXA 3BIEA 5C6CA 1PGSA 1UY0A 3CMGA 3CEWA 4XFBA
chains in the Genus database with same CATH topology
1AR73 1F31A 1WBFA 2IXLA 2QE3A 4Q1RA 4CTEA 1POV3 5F6LB 4D7TA 4HPKB 3WV6A 1HX6A 5J98B 1AR71 5JDBA 4OLLA 1NXD1 2AENA 3B3QE 3JU9A 1FPN2 1POV1 2WA4A 4HLTA 5IK4A 4O9EA 2A7AA 4D7SA 5JPMB 1PM7A 3ZVXA 1O4TA 3AB0A 2NLRA 3AKSA 3NO8A 3B93A 3WP6A 4JGYB 1AL23 4X8NA 4CDQC 2JENA 5IUQA 2ZGSA 4FXGB 2RMU1 4OI0A 4C90A 1IPKA 1UKRA 3POWA 4Y20B 3LA7A 3TNQA 4XFIA 4LHNA 1I5ZA 4KWLA 2EAKA 4I0BA 1RUC3 2RE9A 4Q4X2 4Y1ZA 2Z69A 4ZKTB 1OSGA 1RUG2 1AXKA 3QCWA 1QNYA 4S2FA 1NZCA 3AYEA 1RUC1 3WDXA 2A73B 2JKBA 4MYEA 4F3JA 3H0OA 4R9DA 1COV3 5KHIA 3IDBB 1KFXL 5JMCA 2XVLA 2PAEA 3KCXA 5JOYA 1BMV1 4G9SB 4AQ6A 5E89A 1COV1 4Y24A 2DCKA 3T1LA 2ZX3A 2CGPA 4HN0A 1OOPA 1HRV3 4Q0PA 4PLMA 4A7YA 3VZOA 2Z42A 2K2SA 4WM8B 3AP6A 2N7GA 3B9IA 3C3VA 3NWKA 5KHJA 1CN1A 2XLFA 1HQWA 1HRV1 5JLVA 2XJVA 3MF6A 5H9RA 2QCSB 2D93A 1V00A 1DQ0A 2JG9B 3WHTA 2GNDA 4I0AA 2VW2A 1OMIA 4N9IA 3R4DB 1IHMA 4YW1A 1ND2C 3VV1A 1J3QA 2E63A 3AX4A 2PHFA 1MZ6A 1VBA3 3WW2A 3R0RA 5E1RA 3H8UA 1OFNA 1C57A 1S55A 3ZIXA 1KJLA 3HAGA 4IEZA 1H8TA 1X50A 1VBA1 4A7KA 3GF6A 1L3JA 1NYWA 4YW5A 1R091 3P3NA 4Y1UA 3S7EA 2VPVA 5CFCA 3D4KA 1SCRA 2R49A 3TN92 2B39A 2PHXA 3ZMNA 1J1LA 2NZ9A 2VMGA 3MIFA 4AGVA 3NKGA 2RJLA 1AHSA 3ZXGA 2EXHA 2NMNA 4OULA 1WW5A 2JE9A 3IBMA 2OYZA 2Q5TA 4DRVA 1QXJA 3NSTA 1J58A 1LOAA 3OBTA 1IS6A 4S2GA 3VDDB 4F83A 2VVDA 4E2GA 1JBCA 4NWVA 4WBBA 3ZN6B 5AC92 1XU1A 2XWBB 4IERA 2WNUC 1UPSA 3CJIA 4K8FA 1LTEA 3WG1A 4MLOA 2VVEA 1RUJ2 1CPMA 1DLLA 5C4WC 5DG1A 2DCTA 1XXNA 3L9JT 3WLUA 4WVVA 5SV5A 3VN4A 4XTMA 1URXA 1EV13 1VJ2A 5BNOC 3MFAA 2DVGA 4XILA 4UW3A 3WG4A 4BA6A 1D0HA 4NR1A 3B94A 1NA1A 1SEFA 3BTAA 4P9YA 4ORFA 1DQ1A 3J9SA 1Q8VA 1VRH1 2XKOA 4AFDA 5DDJ3 2WS93 2VW0A 3ZXEA 3RYRA 3TAYA 4YM0A 1WMDA 2X29A 3SH4A 4N90A 2ZGLA 4DB5A 4W65A 5DDJ1 1UMZA 1W6PB 2AR6A 1H9PA 2QUOA 2VMHA 3ZFFC 4AQSA 2EVXA 3U4XA 2VGDA 4FOYA 3W58A 4N9HA 1H2LA 1K5MC 1REEA 3JQWA 4AI1A 2R1DA 1PVC2 1Z78A 2HWE3 1PHMA 1YCIA 2ETEA 3AMHA 5H9PA 3EBRA 1O3SA 5ABJA 1Q5OA 1J59A 1HQLA 1RJ8A 1KS4A 5F9TA 2HWE1 3H9AA 1REDA 1NXMA 3OF1A 5BNPC 4H14A 3AZVA 1AJOA 4JDMA 2GMMA 1LODA 3KGZA 2K9ZA 3ZXDA 5GLWA 2JG8C 3NV2A 4D3WA 3MW2A 4K6BA 3NJZA 1CAWA 5A3LA 4AVBA 3MI8A 4TSVA 5KBFA 1VBC3 3D8CA 1GZ9A 2CGNA 1KXGA 2PLV1 3SNMA 1N3QA 2O0OA 1NCRC 3IMNA 1C8M3 4H7LA 3ZFGC 5T5PA 2K0GA 3LWCA 4XETA 1OA3A 3VBOC 2WWSA 4BIFA 1C8M1 3CJXA 4Q0QA 5JSPA 4M0HA 1EPZA 5CADA 5T50A 4CDUB 1DDLA 3QOPA 3E5QA 4PIZA 4X6RB 1AR63 3ST7A 5BV6A 5JWPA 1YUDA 3JB8A 1R082 1G9AA 2ZA9A 2KM2A 3AKPA 4MGIE 2A6ZA 1AR61 3PVNA 4BOWA 4BMEA 1RUF1 4ISQA 5I93A 3CL1A 2XG3A 1X7NA 2ZABA 4Q4Y3 3TNPB 3PVEA 5AFEA 3PJYA 5GKAC 1E57A 2DYCA 4IV3A 1AR72 1BCXA 4IEOA 2DV9A 4JGZA 4GMP3 4XMIA 2G9FA 4OVEA 5I0UA 1HQNA 3RYPA 4YNIA 1CAUB 1WLCA 1IZ3A 2NN8A 1CAXA 3KT4A 4IEUA 4QQ2A 4GMP1 4YM1A 5KXCA 3ZO0B 2R16A 1W6MA 4HSJA 4N53B 4MUVA 2RJKA 1U5ZA 2QDRA 3ATGA 5LK5A 3DN7A 2D6MA 4QGLA 3UKNA 2RMU2 4IEQA 4AHYA 1OKQA 4K9SA 5C9AC 3VBUC 1U0AA 2WNVA 2KA3A 3IWZA 4XFAA 2XL9A 1O4ZA 1SFNA 2NQYA 1XYOA 1S0DA 4AK3A 4Q4V3 4YVWA 3AYDA 1RUC2 5L7OB 1WCSA 2RS33 3LSEA 1DIWA 4B7KA 1UW8A 3HD8B 3WW3A 2BNOA 1WW4A 2GSYA 4PDWA 4Q4V1 5FBZA 1I9RA 3NKTA 4RR3B 4KNCA 3FLRA 4LO6B 1SBDA 1JUIA 2IFWA 1BMV2 2XJQA 3B01A 4IESA 2GZWA 4F7ZA 1COV2 3POYA 2YYOA 3ZSMA 1V6JA 4N7IA 1F5JA 3FX3A 4XJAA 1MQTA 2XJPA 3MGUA 1RTVA 4E4DX 3SMHA 1OQ1A 4EN7B 1FPN3 2XB6C 2VUJA 1HRV2 1B35C 2DTYA 3RJ2X 4LTAA 2MNGA 4IEYA 2D97A 2IXHA 3WCRA 5HCAA 4IEVA 2BTVC 1XNBA 1RVF3 2EIGA 4YZ3A 1PZ7A 1MACA 2I2SA 5EXOA 2PA7A 3EO6A 2XJUA 3HT1A 3VZKA 1LOFC 1TMF3 4L11A 3VKNA 1RVF1 4CDQB 2G9GA 3AYCA 1OA4A 4Q4X3 3LAGA 3E6CC 1CAVB 2UWAA 5IK7A 1VBA2 1RUG3 3DF0A 1TMF1 3ACLA 2ZJCA 5JIAA 1IS3A 1ENRA 1X8MA 4X6QB 1R092 5L19A 4GH4A 2IZWA 4HL0A 2HEWF 3RG0A 2LM3A 4L2NA 4BPZA 4E9KA 2CY6A 3MLJA 2R0FA 2TNFA 5HXVA 1Q3EA 1TQ5A 2GMEA 3BIWE 3VGIA 5CA6A 3GZTB 3JZVA 2DVBA 4E2QA 2WT0A 3VKFC 4RS5B 1SLLA 1AR93 3VL9A 3GZAA 1ZZ6A 3WUDA 4FAHA 1HW5A 2VULA 4M3CF 1WW6A 3JBG3 2XVGA 2JD4A 3GALA 3WQ1A 1AR91 2A5ZA 5I8YA 4GALA 4NHLA 2ENRA 3VDDC 3JBG1 1HDKA 3WT3A 2UY8A 1OI6A 2CWSA 4YG6A 1OFSA 3AXDA 3K48A 4D69A 3FBYA 1FX5A 2RHPA 2ZX1A 4WV8A 2R072 2OIIA 1ND2B 4RFT0 1FT9A 4QPIA 4FPCA 4J6GA 2WSVA 3IN9A 2Q0AA 4CEWA 2B7YA 1MVEA 1ZZBA 1RMU1 3AM2A 3V0AB 1DGLA 5CVRA 3J4UH 3QLQA 2YZ4A 2E7QA 4LO5B 1H2MA 2D40A 4OHWA 4PJYA 3RI9A 4AQTA 3TN93 3WQ7A 2GALA 3O0XA 1YFXA 2EXJA 1VRH2 5GALA 2D98A 1DGWA 2P37A 4YW3A 3TN91 5BPXA 2WZR1 1BXHA 3H7JA 4S2DA 2HWC3 4FPOB 2DCJA 4QU2A 2OZJA 1H8TC 1XNDA 2D44A 4OI4A 1C5IA 2HWC1 1W6QA 5KC5A 4LBQA 1N1YA 2Q30A 1LU1A 4LA3A 1ULDA 1LHNA 3MPPG 5JAXA 1UKGA 2BVBA 5CFCC 1UU5A 4QM8A 3MIEA 2AZ5A 3RRDA 4KG0A 3ZXJA 2WNUB 3DKWA 3N4MA 4JAAA 2GN3A 4Q4W3 3I54A 2VOXA 3IPVA 1ZRFA 2HWE2 3IM0A 3MIBA 1C5HA 1KS5A 5D1IA 2AREA 4Q4W1 1UN1A 1ALYA 1SACA 4LHKA 3DPRC 2XH6A 2TUNA 1DYKA 1DQ6A 1S2BA 4M3CA 3MEPA 1VB4A 2WIIB 5AVAA 3B9CA 1CJDA 2E7TA 1GICA 3CJIC 4I09A 4E27A 4DZGA 4HKOA 3KM5A 2DU0A 4HANA 1XE7A 1AYN1 5K9YA 2PLV2 2WKKA 3TOJA 1U5YA 1SLTA 5A33B 4PIXA 4CDXA 3N35A 1UCXA 3ZFFB 3P3PA 4AI3A 3E6BA 4LBQD 4AW7A 2IXJA 2DF7A 5GJ6A 1NQJA 1ZA4A 1YHFA 4AVCA 4C1WA 1ZNPA 2IC1A 1DZRA 5B2GB 3IIAA 1S0FA 1WLTA 3BOWA 1O5LA 1RUF2 4MGKE 3NV1A 3FLPA 3FZ3A 4RL7A 1LKNA 3ES4A 4GWMA 2QZ3A 4RHV3 2XL7A 5BNPB 4GXLA 2C0ZA 2B5HA 3ELNA 4RHV1 1LGCA 3WDWA 3ILNA 3NAPA 4XJZA 1AXZA 2JG8B 2XWJB 3MF9A 5DUWA 4LBMA 4LA2A 4Z8BA 5BNNB 1WLWA 1F5FA 1A3KA 1FXZA 3ECQA 4HVOA 4K1YA 1DGWX 4AYUA 2XGXA 1YI7A 4Y4YA 4N53C 1V6MA 1AX0A 4JGYA 4GQ7A 4JDOA 2ZHKA 2P34A 5E88A 1NCRB 4FPYA 3ZFGB 4DMIA 4BIOA 1QKQA 1LB2A 2UWBA 4COZA 1G9DA 3VBOB 4LR4A 4Y5Z0 4KBBA 3ROUA 1X33A 1QJZA 2ZMKA 2GC2A 4LUKA 4MXWB 2AYHA 4OHXA 4AEDB 3VBRA 1EYBA 3PLQA 3G6JB 1MZ5A 1T6GC 2R0HA 1ZREA 2NP0A 4FPHA 2CV6A 1PK6A 1WGPA 4IETA 3KZ4C 4KWKA 5F5QA 3JCIA 1LU2A 4AVSA 3UV9A 3VBHA 4FO9A 4FT8A 4KU8A 3VBFA 2ZHLA 1HIXA 4S2HA 1TME3 3DL3A 2C5DA 4IEPA 3FMGA 3MICA 5GLZA 4R8HA 1TME1 1WMEA 1G9FA 1UIJA 3ZYRA 1PMIA 3O14A 2ZX0A 2RMU3 3KS7A 4XXPA 4XYXA 2FBEA 4J1XA 4BZ4A 3GBFA 3QBQA 1R1ZA 2VOWA 1RVF2 2DFCA 4Q27A 1X8EA 5JCTA 5CNAA 2D7FA 5C9AB 4I3PA 3VBUB 2GH2A 1QWRA 1TMF2 4NHKA 1ASJ3 3N7MA 1EY2A 4KGQA 4JGZC 4DXZA 4MGZE 5BNQA 2HEYF 3WUCA 5I0SA 1LR5A 4L99A 1ASJ1 4UW6A 1PIV3 1BYHA 1PNGA 2RS13 5FO8B 3URFA 2ZKLA 2FMDA 4PLNA 3ZXAC 4GULA 4F8AA 1PIV1 5K0UC 2RS11 2EXKA 4RS5C 1BJQA 4QMAA 4CYDA 2WC2A 2D6NA 2ET7A 5FLJA 2AGSA 5DUXA 4OI1A 2WFPA 4E4SA 4HVRA 5DUUA 1RUE2 4RGAA 4R4ZA 5FQ0A 5JZGC 4XIOA 3M3EA 1AR92 1UF2C 5I91A 3A4UA 1RUD3 2OPKA 2JEMA 4HK9A 3ILRA 4RQPA 3JBG2 3AP9A 1DQ5A 4K3UA 1B35B 3ZX7A 2A3XA 3LSDA 4RD7A 1RUD1 3O7OA 1BQPA 4R4XA 2R061 4WM7A 3IKWA 1PO13 4PDWC 4OZXA 1I3HA 4YLZA 5LEJA 1Z0HA 2ZGKA 2ZBJA 3PHMA 4XE9A 4AE2A 2GN7A 1LEDA 3SXWA 3ZIWA 1PO11 4OHYA 2DVAA 1D2SA 1Y3TA 2XJSA 1MQTC 1DHKB 4JRLA 4HSLA 5FPZA 1RMU2 2XHKA 2ZCWA 1R093 2RS53 1RUH1 2JDZA 1UL9A 3WR0A 3E6DA 5F1RA 3DV8A 5J3UA 2RS51 1MS3A 1LRHA 5K7PA 4P14A 1GNHA 4I01A 4XJWA 3BU7A 3AMPA 1QJU1 3GBGA 2W52A 2WZR2 3J8F3 5JSRA 1RINA 5E8AA 1OA2A 1QF3A 4AEMA 3J8F1 5C33A 3OYWB 2QDNA 2HWC2 3OY8A 4DNYA 2O1QA 2ARBA 4M0NA 4NVPA 5CB7A 4GH4C 5JOXA 5A32A 3SITA 3M3QA 2R6QA 5TSWA 1OPOA 2R073 2B45X 2DVFA 4CP0A 3UJQA 3RPQA 4FPJA 2ES3A 2GH8A 1C28A 1RHI1 1AVBA 3IT8A 2ZGPA 2R071 4XFHA 3WXPA 1YWKA 3THPA 3CF6E 3EHKA 1VBD1 3J26N 4Q4W2 4AF9A 1IGOA 3FC0A 1GFF2 1CPNA 4XF4A 4FBFA 4Q0UA 4UBGA 1UPIA 1LOGA 1S1AA 4ZXKA 5KWRA 1TE1B 1LULA 1VRH3 1YLLA 4TLFA 3S0MA 1REFA 1MZEA 4XZPA 4A2UA 3JD73 4Q29A 4LT5A 1AYN2 2PHLA 3HN1A 1LEMA 2X53S 3ZYGA 2HJIA 3JD71 3RI8A 2X8KA 2TBVA 3LGRA 1MS9A 1QJX1 3I4IA 1YJKA 4CEWC 5C8WA 3B02A 4XBQA 1Y43B 1H8TB 1VBE1 3HT2A 5T54A 2BNNA 1LCLA 4CDUA 3ZXKA 3WP3A 4X8PA 2GNTA 2A6WA 3U11A 2W39A 3I59A 1HXS1 4DS0A 5CFCB 2Y38A 3BALA 4DINB 5JI9A 4FOWA 4EN0A 2BBVA 2UU8A 3H1WA 5E16A 2CAUA 4B8EA 4FQ4A 4COVA 2ZS6B 2A70A 1W6NA 1S2KA