4LBKA

Crystal structure of human galectin-3 crd k176l mutant in complex with lnnt
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
138
structure length
138
Chain Sequence
MLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTLLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galectin-3
publication title Galectin-3 interactions with glycosphingolipids.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4lbkA00
1IS3A 1MVQA 5H9RA 2UURA 1GLHA 1JUIA 2GALA 1F9KA 2PHFA 2WNEA 1MS5A 2P34A 3PVNA 2PHRA 1DZQA 2XB6C 1ULFA 2WJSA 3IPVA 2D43A 1ULDA 1GYKA 1KDKA 2WSUA 4PCRA 3USUB 3ZSJA 2JJ6A 1KJLA 3IMNA 4SLIA 2ZGNA 1LU2A 3A0KA 3RSJA 4BLJA 5T5JA 1HLCA 1LOCA 1N3QA 2R1DA 2DU0A 3VKNA 1W6NB 3VUOA 3WDWA 2P37A 1V6KA 1UN1A 4FPJA 1B09A 1N1YA 2WT0A 2AREA 4XMIA 2PHWA 4ZKTB 1JYCA 1Y7BA 2ES3A 3H0OA 3M2MA 4XYXA 4YW3A 4XJ8A 5JOZA 4AGVA 1W6PA 1V6JA 1GV9A 1YYNA 1YRZA 5GLZA 5GZFA 1NXD1 3LSEA 1DBNA 3B9CA 1JYIA 4R9DA 2A6YA 1GZWB 2E53A 1ENRA 1C57A 1JBCA 4DS0A 4GWNA 2TEPA 2VUAA 4JRAA 1O4ZA 1SLCA 4XTMA 3TB0A 2LALA 1BJQA 1AXYA 2D7FA 2PHUA 1HQWA 2CL2A 4WZFA 5E88A 1MZ6A 2D6OX 1UAIA 4YZ5A 3ZXJA 4RL7A 2EXHA 3WLUA 1QU0A 3B01A 3D6EA 1C1FA 4HANA 3UJQA 3V0BB 1HDKA 1EPWA 3PMEA 4XXAA 1D2SA 3AP6A 3OY8A 1IOAA 3POWA 4XJZA 1WW6A 4AGGA 2CY6A 2VW0A 1F5FA 3AZYA 3D5OA 4Y20B 5IT6A 4Q1PA 1AXKA 1Q8QA 1AVBA 1G7YA 5JOWA 4YFWA 2GMEA 2DVBA 3IM0A 2YZ4A 3ILRA 4R9BA 1DYPA 4K20A 1GNZA 1SBFA 3M3CA 3BTAA 1AX0A 3WDYA 3WCSA 1Q8PA 1H30A 2A3YA 4PBOA 1ULEA 4FOVA 4YZ3A 2DVGA 3RG0A 3NV1A 3ASIA 5AVAA 4LBJA 3ZXKA 2ZHMA 4M3CE 3IPVB 3B00A 4Y24A 3WDVA 3V0AA 4XHBA 5T55A 1WUVA 2ZACA 4BPZA 1S1AA 1MS8A 1JW6A 2GNTA 4GWMA 3ZSLA 1GZCA 4LBLA 1LU1A 1IKPA 1SBEA 2D3RA 1WD3A 4P9YA 1WCSA 3FUQA 2ZA9A 5H9QA 1KDMA 4BOWA 2I2SA 2VW1A 3AXDA 2NZ9A 4BMBA 4ISRA 2KM2A 5KXDA 3FBYA 2DYCA 4XOGA 1H9WA 5GJ6A 1APNA 4L8QA 2EF6A 1ENSA 2R1BA 1A3KA 5DZFA 1SLLA 4YZ1A 5JOYA 1QF3A 2CNAA 1QDCA 2H0BA 1ULCA 5HCAA 2GNDA 1BKZA 1W6MA 1WLCA 1LESA 1Z78A 5FREA 2ENRA 1G8WA 1HQLA 4XTPA 1LODA 2DUPA 2A75A 3T1LA 3FLRA 3JUUA 1KJRA 2DUOA 2EXJA 1UX6A 1V6NA 3O0XA 4XMAA 4XXPA 3FLPA 4ASMB 1AX1A 4FPKA 3OY8B 2A3XA 1WW5A 2FHRA 1MS4A 3RMXA 3L2YA 4FPYA 1G9DA 4YGBA 4YLZA 5T5PA 5IK5A 3NV2A 3RMYA 4YM1A 1BQPA 2JE7A 4M3CF 1SBDA 1URXA 2VU9A 3PJQA 2ZGOA 1AF9A 1GSLA 2ARXA 1F31A 2P3KA 4YW5A 1IS5A 4CTEA 1VALA 4FP2A 1FNZA 2A6XA 2PELA 2R0HA 1BYHA 1CESA 3MW2A 4FPFA 4XJUA 4HL0A 5T52A 1DQ1A 3T1MA 3O0WA 4XIKA 3T2TA 4AVSA 4U36A 3WDUA 2DV9A 2ZGUA 3RS6A 1FAYA 1G9BA 2EIGA 4C1XA 3SLIA 1A78A 4ATFA 3V0AB 1CONA 4YM3A 5IK8A 2AR6A 3AK0A 3GNEA 1GZ9A 1MACA 1WW4A 2W39A 1OKQA 3HN1A 2CWSA 4GALA 2GN7A 5CB7A 4JCKA 1FATA 1QGLA 1V00A 3AXEA 3WZ1A 1QDOA 2VY0A 3WV6A 1QKQA 2JDZA 3M3OA 1AJKA 1MS1A 4K1ZA 3AYCA 1G9FA 1VIWB 1FX5A 2DTYA 2EAKA 2DURA 1DQ5A 1JXNA 3LCPA 1SFYA 3AZVA 3VKMA 4WVWA 4XJAA 2NMOA 1QNWA 4PQ9A 1GANA 3POSA 3WHTA 4PF5A 1LHWA 1CPMA 2UWCA 1MVEA 3N7JA 3I4IA 2B7YA 3AFKA 3AJYA 4BLIA 1W6MB 3AZWA 4YG6A 3WDTA 3QCWA 5JVVA 2ZHNA 1Q8VA 4XIOA 2NP0A 4BMEA 3ZYPA 1JHNA 3BIWE 2A70A 1W6OA 2GMMA 2W52A 4AWDA 2VW2A 1C1LA 2GNMA 2Z42A 3POYA 1G9AA 5EXOA 1DQ0A 3M3QA 3W58A 2DTWA 1LHOA 1SLIA 2DVAA 1HKDA 2D6MA 2JECA 5DUUA 3AYAA 5JOXA 3ZPYA 3N7MA 5F9TA 3ZXEA 3AP5A 4FP3A 1FYUA 1QMJA 1C4RA 5JDBA 5DG2A 2D3SA 4GXLA 4YM0A 1LECA 3SITA 5IK7A 4Q1RA 2ZABA 1SLAA 2HYKA 2DVDA 3FFZA 1GICA 5EWSA 2V5YA 4U2AA 4GKYA 3PVOA 5LK5A 2AYHA 3FLTA 2P2KA 4Q8LA 4YW2A 1SCRA 4Y22A 1DQ4A 1JOJA 4ZXKA 3ATGA 4YG3A 2ZMKA 3AP9A 3JU9A 3R4UA 4UW6A 2CWMA 2D6KA 3WDXA 2UU8A 2YY1A 1RINA 2D6PA 4LBQA 5IUQA 1CQ9A 1KQRA 2VH9A 3WG3A 1IS4A 1VLNA 2W68A 1DFQA 3TAYA 4YM2A 3WNXA 2E7TA 1BXHA 5GZGA 5E89A 3BODA 5JLVA 2EALA 3O0VA 3R4SA 3LSDA 4Q26A 2JD4A 3SH4A 4XZPA 3MEPA 1N1VA 1LOGA 1SLTA 1DQ2A 1GNHA 5GZEA 3WHUA 3RRDA 1W6PB 1MZ5A 1UMZA 3SISA 4DQAA 1W6OB 5DUWA 5GLVA 2G4IA 2C9AA 2GDFA 3MW3A 4MYEA 4RA0A 4XBQA 4YGDA 1V6IA 4ISQA 4R9AA 1VAVA 2E7QA 3W59A 4LBKA 4FPEA 2EXKA 5DZEA 1O4YA 1KRIA 1CN1A 2NYYA 2GMPA 2ZBJA 3M3EA 1QOSA 3ILNA 4IQPA 1NLSA 2ZGSA 3HMYA 5GLTA 3U4XA 3FUOA 2GN3A 2WT2A 3SNMA 1ONAA 4K1YA 2ZGKA 1I3HA 5CNAA 2A7AA 1IS6A 2ZHKA 4FVVA 5E8AA 5DUVA 4H55A 3SH3A 5EYYA 1FV3A 1AXZA 5GALA 1LEMA 2WQZC 2YV8A 3UL2A 3OBRA 3ZYRA 1YO8A 1ZA4A 4YW4A 1AJOA 2YXSA 4Y22B 1N3PA 4Y1XA 2ZHLA 4Y1ZA 2AH2A 3ENRA 4JC1A 4PBPA 1V6LA 3AP4A 3WG4A 3DGTA 2DU1A 1LGNA 1QOTA 1ZM1A 3INAA 4UW3A 4D69A 5JMCA 1Q56A 1PZ7A 5SV8A 2ZGLA 4FPGA 4LBQB 2CYFA 3OYWA 2E51A 1G86A 2A6WA 2V73A 2PHTA 2OVUA 2DWRA 4AGRA 2OUJA 3OJBA 3NV3A 4Y26A 3SH5A 1CIWA 1QNYA 5H9SA 1LGBA 1DIWA 4TYSA 4CRQA 2ZZJA 2XG3A 2UWBA 5T5LA 2D3PA 4UW4A 3M1HA 2D6NA 4Q2FA 5CBLA 1S0GA 2A3WA 3MW4A 4AVVA 1CJPA 4M00A 3ZSKA 1LGCA 1LTEA 3OGGA 3ZSMA 2WKKA 4Y1UA 3ILFA 4ITCA 4AYUA 4FQZA 1DQ6A 4FQ4A 2LTNA 2AGSA 2JE9A 3GALA 3NV4A 3ZXLA 1S0JA 3VKOA 1OFSA 4WVVA 2AENA 1YI7A 1DLLA 2EXIA 1KITA 4M3CA 5T54A 4C1WA 5IK4A 2ZGPA 5T5OA 3VKLA 4XBNA 3R05A 4WV8A 2A71A 1MS0A 2FMDA 2ZKNA 5GLWA 5L73A 1UZYA 1LCLA 1YXWA 2OUHA 2ZGQA 5EYXA 3WUCA 1JN2P 2A6ZA 1Z0HA 1GBGA 1LHVA 4FPOB 5KXEA 5T50A 2VXRA 3Q9OA 4Y1YA 2ZAAA 5DZGA 2C5DA 1UZZA 3B3QE 1N47A 1N1TA 3N3HA 4I30A 2BQPA 3VV1A 2W08A 5DG1A 5GM0A 1GKBA 3WCRA 1QOOA 1RITA 1XQNA 3AYEA 3B69A 1SLBA 1V6OA 4FPLA 3VKFC 1FV2A 2RHPA 1N1SA 4YGEA 1CVNA 4GA9A 3OYWB 1S0BA 3O12A 4XJWA 4YG0A 4CZSA 2DVFA 4FOYA 4YZ2A 2CTVA 1VAMA 2R16A 4K21A 4XE9A 2ZMLA 1X50A 4P14A 4W65A 1WBFA 4Y1VA 1FNYA 3KM5A 4LBNA 4DFSA 1DYKA 1SACA 2AUYA 2P3IA 1PZ8A 1MS9A 1AX2A 2JKBA 2PHXA 2R0FA 2WLQA 3QLQA 4NO4A 4Z8BA 5HCFA 1IKQA 5GLUA 2OW4A 1LULA 2P3JA 1WLDA 2D6LX 1S0DA 3UK9A 1Q8OA 1V6MA 1LENA 3WVJA 4XILA 4OZXA 1W0PA 1UL9A 4M3CB 3RQ0A 4F83A 1LOFC 1DGLA 1MR5A 2A6VA 2WSVA 4M01A 5GZCA 4NOTA 3PVEA 3N7LA 4BM8A 3WOGA 2ZMNA 2Q5TA 3N35A 1LOAA 1MS3A 2UWAA 1W6QA 2SLIA 1WBLA 2YMZA 3N36A 4XDQA 1TEIA 1LEDA 4ATEA 1S0EA 2ZGTA 3WUDA 2DUQA 4BQ1A 1RIRA 5HCBA 4UW5A 3IN9A 2ARBA 1AZDA 3I8TA 3HR9A 3A0NA 3BOPA 4FPHA 4YW1A 1U0AA 4Q27A 5H9PA 5BYNA 1BZWA 1SCSA 3DUIA 1YIFA 4FPCA 1S0FA 3AZZA 4LBMA 1OQ1A 3N7KA 1Q8SA 3CNAA 1ULGA 3D4KA 3WG2A 3AP7A 2E6VA 3AX4A 3WG1A 3USUA 3OBTA 5F5QA 2WT1A 4AVTA 3UJOA 1LJ7A 4GKXA 5DXDA 1ENQA 2ERFA 1W6NA 4XBLA 4P9WA 1WW7A 1WLWA 1S0IA 5KXCA 4KBBA 4YGCA 1N3OA 1LOEA 5KXBA 3AZXA 3IKWA 1LOFA 3ZXFA 5FRAA 4YFZA 4YZ4A 1A8DA 3AJZA 3APBA 4LBQD 5GZDA 1I1EA 5DUXA 1UPSA 2SBAA 1CPNA 2D44A 1D0HA 1CR7A 3KQRA 3V65A 5CAZA 2R49A 4DRVA 1GZWA 1WD4A 2ZGRA 4FOWA 3AYDA 4DRRA 1LHNA 1S0CA 2NM1A 3OPZA 4FOQA 1W0OA 1DHKB 3NWKA 4LBOA 1J1TA 4P9XA 1LOBA 2YROA 4XHXA 3ZVXA 3V0BA 1PZ9A 4R9CA 1G9CA 3C2UA 5CA6A 1H9PA 1LHUA 3MPPG 3A4UA 2A5ZA 4Y20A 1W6QB 3V64A 4TZDA 4DPNA 4Q8KA 1UKGA 2ZGMA 4XJ9A 1R1ZA 2GNBA 2NMNA 3O5SA 2NN8A
chains in the Genus database with same CATH superfamily
2R061 5LBCA 5JIAA 2BEOA 2UURA 2GALA 1F9KA 4QHOA 2BVVA 1US3A 3OTFA 4OYUA 4EN8B 1DDLA 3I59B 3ZFEC 4A6OA 4P9GA 3OF1A 1K5MA 3IPVA 3AKSA 4E4SA 1KDKA 4HLTA 3IMNA 3AMQA 2ZGNA 3LWCA 3TOJA 4JGYC 1VR3A 2Y34A 1LOCA 1N3QA 2VVFA 1W9WA 3KGZA 2D93A 3DF0A 1JU4A 3KV4A 3LDRA 3WDWA 2FQPA 2P37A 1V6KA 3WT3A 2AREA 2PHWA 1TZOA 5K0UC 2W2IA 4GQ7A 3BU7A 1WCKA 2XBO2 2PTMA 1R1A1 1QXJA 2B45X 3KV9A 5FYMA 3ZN6B 4KU8A 1NX9A 2WZR1 1GV9A 5ABJA 4C0HA 3RZGA 5FUNA 1L3JA 2RS33 1DBNA 3POJA 2LRPA 2FD8A 2KA3A 1EP0A 2E53A 4S2HA 3C8XA 3JBG2 1C57A 5FP3A 2TEPA 2BPA2 1SLCA 4PHZA 3B5LB 1T2XA 2LALA 1BVP1 5EPAA 1BJQA 3N9OA 4KBZA 5E88A 1MZ6A 3KT4A 1C28A 1JZ2A 2VVEA 3ZXJA 1EAH1 4IE7A 2Y60A 1QU0A 3B01A 4LHKA 5DAPA 1DGRA 1QJU3 1FPN3 2E9QA 4XCBA 1ZBA3 3POBA 2HJIA 3AP6A 3OY8A 4XJZA 5CFDC 1WW6A 4AGGA 3AZYA 2W91A 4Y20B 4Z07A 4Z2AA 1YCIA 1UW8A 2OPKA 5I0TA 1G7YA 4I0AA 2YFZA 1OH4A 1DYPA 1WMFA 3M3CA 3VHOA 1AX0A 1MQTC 5LK7B 2QJVA 3WDYA 1VBB3 4DIQA 4D94A 3IDCB 5I0RA 4KG8A 1HX6A 1ULEA 2ZEXA 4YZ3A 3CBNA 4PDWC 1QJFA 4CP1A 3NV1A 3ZXDA 5JI9A 1X9TA 2DCKA 1SPPB 1OA3A 1QH6A 2L9LA 1UYYA 4QX3A 2JENA 3V0AA 1HW5A 4XHBA 4C91A 2BWAA 1W39A 2RS31 1MS8A 4GZ9A 1GZCA 1E57A 3VD4A 3FWEA 4DB5A 3EXUA 3VD3A 1WD3A 3MLJA 1KDMA 4H2AA 4IE5A 4NHMA 4COWA 2NZ9A 4YVWA 2ZPXA 2KM2A 4BU2A 4CDQC 3EHKA 4MV2A 1QJU1 1FPN1 1ZBA1 3NQHA 4OHZA 3LF7A 3MBWA 4NIHA 5JOYA 3MIGA 2BV4A 1QDCA 2Y6KA 3UKNA 4A45A 1DGWX 1ULCA 4ZY9A 4AR2A 1WLCA 5FREA 2ENRA 3PIGA 4RFRB 4LXLA 4Q4Y3 4QX0A 1HQLA 3POGA 4JTNA 3TWIA 3O1MA 1LODA 1O8PA 4N9IA 5FZHA 3DN7A 3FLRA 2WNVC 2DUOA 2EXJA 4I3PA 3ZFEB 4XXPA 4ASMB 1AX1A 4FPKA 5LA0A 5C4WA 2A3XA 3RJRA 4A7KA 1MS4A 3MIBA 3FN9A 2NQYA 1XNKA 4FPYA 4YGBA 3NMBA 4JGYB 1BLZA 4UF0B 4YLZA 1DF0A 3I2KA 3P1IA 3LIGA 3H9AA 4YVSC 2RDRA 5C3SA 2JE7A 4UFMA 2ZGOA 3VBSB 4DNYA 4E9KA 2RS12 4HVOA 4YW5A 1IS5A 5IYYA 1TG7A 2A6XA 1NXMA 2R0HA 4CE8A 5K0UB 1J59A 2ZEYA 2VZSA 3ZFFB 3KCXA 3T1MA 1F2NA 3O0WA 1CAXB 2FZ1A 3QH7A 3T2TA 4AVSA 1Y9GA 2BGPA 2F4LA 3RS6A 3OCPA 2Y6HA 1G9BA 2JWPA 2PXJA 4C1XA 3SLIA 4ATFA 2DCTA 1CONA 4YM3A 4R52A 3OD0A 1TMF1 1MACA 4AI3A 1PVC2 3HN1A 2CWSA 4H3WA 3WF0A 3LQCA 5A3MA 4BQ5A 3VBRA 2GZWA 4AVAA 3AKPA 2QE3A 3AXEA 3I2FA 1RUE3 4BDVB 2Q1FA 4XVHA 1AJKA 2E32A 2P4EA 2E63A 4Q4Y1 4K1ZA 1F15A 2QQOA 3I2IA 1VIWB 3MIFA 2QNKA 3A23A 5LBFA 2EAKA 2X5IC 1RUNA 1E5SA 3OGRA 4LEJA 2QQKA 1DQ5A 5CFDB 3LCPA 1SFYA 2C24A 3AZVA 4WVWA 3WW1A 4PF5A 2UWCA 3N7JA 4MSVA 1MVEA 1EPZA 4OCTA 3S7EA 2B7YA 3AFKA 3VDDC 4COUA 3I2JA 4BK5A 4BIOA 2B9UA 1MQTB 3QCWA 4NHLA 1WA4A 1UPIA 2VZOA 3J8F3 5FZ3A 1WKYA 3T4HB 3OBAA 3BIWE 2UY9A 3JD72 3HNMA 4A3ZA 2W52A 2MEV1 4LO5B 2VW2A 5FZ7A 4AWDA 4EQVA 4EZ4A 5CADA 2FCUA 1R093 2D97A 4D8MA 2BGOA 4HONA 2YU1A 1HKDA 5DUUA 4QKFA 4BB3A 1CD3G 1FYUA 1QMJA 4K3UA 1V9U3 1OUSA 1PMIA 1W05A 4IEZA 5JDBA 2D3SA 3IBMA 5IW0A 3VBUC 4Z2WA 1RUE1 3LB9A 3VBHA 4EN6B 4CDQB 2HYKA 3ZSEA 1RHI2 4QPIC 2OXBA 1RXGA 1WLTA 2UYBA 5FUPA 4CCKA 5LW9A 2XXZA 2DCZA 1JYVA 5EWSA 3PVOA 3AKRA 4LHLA 3X29B 1SCRA 3SKVA 3UYJA 3UESA 5CEHA 3ON7A 3GBWA 5DMYA 2EIBA 5IVEA 5IVVA 2QBXA 5JSRA 2ZX2A 3WDXA 5FWEA 2YY1A 3OEAA 4CCJA 2WNVB 4V2WA 5JXGA 3WG3A 1IS4A 2YC2A 5J36A 4LO8A 3J8F1 1OI6A 2W68A 2WC2A 1XNDA 1JI6A 5FMOS 5HXVA 1NQDA 1OVPA 1MEC1 2RJLA 4O65A 5FUIA 1QJEA 3PL0A 1R091 4I09A 1ULOA 4IE6A 4YVSB 1DZRA 3PJYA 1RUI3 4LO7A 3LSDA 2JD4A 2XLAA 4XZPA 3MEPA 4YPJA 1LOGA 4AE2A 5LRRA 5EZWA 1V9U1 2Q0AA 1Y9QA 1C8M2 1WGPA 1MZ5A 4XAEA 3SISA 2DF7A 1W6OB 3EB7A 4DQAA 1GOFA 1W04A 1NZCA 2OA2A 2WNUC 3GJBA 4AEJA 3SEEA 4ISQA 4PI0A 3B93A 2HWB3 1HV0A 1VAVA 2E7QA 2W1QA 3O1PA 2EXKA 1O4YA 1TNRA 5F3IA 4ES9A 4AI2A 4I0WB 2BBAA 2GMPA 2NYYA 1QY4A 3M3EA 3ILNA 3OUIA 3NKGA 4HPKB 2ZGSA 3HMYA 1VBC2 4Q4V3 2RMU2 2QQNA 1J84A 3RZKA 5IATA 1ONAA 2R6QA 1L7LA 2CDOA 2A7AA 1NCRB 2TNFA 5HBAA 4K8RB 5FZGA 2EVXA 3I59A 4XETA 4XCAA 2Z69A 1VBE3 2JG9A 4H55A 2X5IB 3C7GA 4F7ZA 2W46A 4MVTA 4XUPA 4FFFA 1YFYA 4PLNA 5A3LA 2XJSA 5DABA 5F5IA 3KS7A 3ZLIA 3LFMA 1N3PA 4Y1XA 5FYCA 2ZHLA 4Y1ZA 1PHMA 2AH2A 1CWPA 2YBKA 4FI9A 2IWGB 2J1EA 4LTAA 3WP4A 4WM7A 3PU8A 2YBSA 3ME2A 1ZM1A 4UW3A 1RUI1 2AEZA 4MOAA 2JDMA 2K0GA 4JKKA 5FZEA 1PZ7A 1W3XA 2BWCA 2FDKA 4LBQB 1VMHA 2WWUA 3CJXA 4Z82A 2CYFA 4OI0A 4HK8A 4RS5A 1G86A 1EV13 2PHTA 4GD4A 1AL23 1JZ8A 3BUCA 1X8MA 2HWB1 1XNTA 1VBD3 5CU1A 2QVSB 1V0AA 2RR13 1PX4A 3M1HA 3NNFA 4CDWC 1S0GA 1CJPA 1PIV2 4Q4V1 4F8AA 1LGCA 4N53C 1LTEA 4WM8C 3VBUB 2R073 3F2ZA 3J9SA 1JOBA 2VQTA 1POV1 1PNGA 1W8OA 3ILFA 4RSUA 4AYUA 4AAPA 4ZHNA 1VBE1 3HBKA 5A6QA 5FZOA 3NV4A 4I02A 1RUG3 1S0JA 3BI3A 2UYAA 5FWJA 1OFSA 5L9BA 2WDBA 5IAVA 3CLPA 2F4PA 1KITA 2BP6A 2VD7A 4M3CA 3VHRA 2ZGPA 3WQBA 4AF9A 2ADDA 4AFBA 4XBNA 2Y8KA 1BMV2 1ACCA 4PIYA 2A71A 3ORJA 4AHZA 4EYUA 4CEYC 1OFNA 1JN2P 4OI4A 4QGLA 3HVDA 1Z0HA 1LHVA 1PO22 3I97A 1G6NA 3MFAA 4FPOB 1VB4A 1ALYA 3C7HA 3UGFA 3AB0A 5DZGA 1VJ2A 2C5DA 1EV11 3RYPA 3SHRA 3WNKA 1CAVA 3N3HA 4AG4A 3LDKA 4ZZ5A 4OUMA 5FK7A 1HN0A 3ITQA 1VBD1 1XYOA 1NG0A 1UQXA 3WCRA 2RR11 3AYEA 3B69A 3AMNA 3VBOC 3VKFC 2QQWA 2GC0A 5FYTA 1AYN2 5LASA 1X33A 2OYZA 1CVNA 1X8EA 2HWF3 4IV3C 1S0BA 2R071 2WNUB 5FZ6A 1RGSA 5HV0A 3TN91 3KT1A 2YGMA 2WBKA 4MXWB 4XFIA 2HWE1 1RUG1 3TBDA 3IWZA 2JDPA 3DL3A 4Y1VA 1FNYA 1AR82 3KM5A 3JQWA 5FPBA 3S6PA 2AUYA 3D3AA 4R4XA 1PZ8A 4XFGA 2J1RA 2WRAA 4YNIA 3ZFEA 4Z8BA 1XSRA 5F7UA 2WS93 3Q8EA 4AEDC 3ZN4A 4CUAA 2OW4A 4GH4C 4RGAA 5A3WA 4AQTA 1Q8OA 1V6MA 3WEZA 2A73B 3RQ0A 2V4AA 2VZTA 3ACFA 1XU2A 4CXXA 3T30A 4NOTA 4OI1A 3PVEA 4EWAA 4G4FA 2JDAA 4QMAA 3DPRC 2R30A 2O8QA 1OVSA 1MS3A 5BNOC 3N36A 4NIDA 4CEWB 1ND2A 2HWF1 3E6DA 2BTVC 4L99A 4XQWA 3ZKUA 2ZGTA 3DXTA 5BPXA 1H8TC 3A7QA 5B4NA 3HQUA 5HCHA 1XYNA 2ARBA 2VTXA 2VOVA 4AI8A 1OUXA 4E4ZA 4CDWB 4FPHA 4YW1A 1BZWA 1UCXA 2VNGA 3NAPC 2K46A 3OGSA 3AZZA 5GKAC 4N53B 1COV2 3PTYA 3CNAA 2YU2A 3K3OA 1UO9A 3D4KA 4YARA 5JUVA 3PUIA 3WG1A 2G9GA 2XHNA 3ALQA 3AX4A 4RGGA 5F5QA 2VMHA 2QDRA 4XZUG 3K77A 1CGPA 1LJ7A 2XOMA 5DXDA 4G3YC 2WS91 4ZS3A 4CCMA 5FQ0A 4XUQA 3KVAA 1I5PA 2VNRA 1PMJX 4BISA 1J3QA 2C1FA 3HT1A 4XEZA 1WW7A 4WVZA 2BDRA 1UOGA 3J7LA 1MQTA 1H1IA 2VG9A 3K51A 2Y26A 3MFCA 2QUOA 5FY9A 3AJZA 4PDWA 4ASLA 1I1EA 4CEYB 1UPSA 2SBAA 4YYOA 2W1UA 1D0HA 1GZTA 1RUC3 2VQ0A 5CVRA 1F8VA 1GZWA 1K45A 2R042 1PK6A 1OPMA 2I74A 4H7MA 4Q4W3 1CAWA 3AYDA 4CCEA 1UXXX 5HXMA 5FY0A 2YG0A 3THTA 1S0CA 1RMU2 4FOQA 1AR62 3KZ4C 5KHHA 4Z1VA 3ZVXA 1HRI2 1PGL2 5LZ6A 4WZCA 5C3PA 2Z79A 5CA6A 4XDPA 4CDQA 1H9PA 1YI9A 4NE9A 2ILMA 4IV3B 3RYKA 3CL1A 1J3RA 1PGW1 3VBFC 2B46X 1W8FA 3B94A 2VUJA 3DCQA 4XJ9A 3ZPOA 4AEMA 1W90A 2NN8A 4QU1A 3KLSA 5K9YA 1MVQA 2Y38A 4Q0VA 1JYWA 5FZDA 1SFPA 3E5UA 2P34A 1QQP1 2E26A 5IFPA 5KC5A 3KHCA 4RGKA 1H4GA 2WNVA 5EP9A 5A7PA 2WJSA 5FZ0A 4XFCA 4SLIA 1LU2A 1EYBA 1NY72 4AEDB 1RUC1 1FI2A 4GH4B 3ZXGA 4MO3M 5KBFA 4NIGA 3F95A 3LPGA 1W28A 2H6CA 2B42B 4LOTA 4FPJA 1UN1A 4Q4W1 3MV01 3O1TA 1LNSA 1N1YA 5LATA 1LR5A 2ES3A 4XFHA 4EN9B 4JGZC 1VE0A 4YW3A 2NLRA 2JDYA 1JOPA 3GBGA 3MIDA 1V6JA 3S5QA 5CFCB 5JOZA 1JYNA 3DPRB 1B35C 5GLZA 4JZRA 1NXD1 5GZFA 5BNOB 4URAA 5JR7B 4UT5A 4QDRA 2YGLA 1O4ZA 1H8TB 1NLQA 2PLV3 3GZEA 2DFBA 4MGKE 4O9EA 2C0ZA 2AC1A 2EXHA 4P5HA 2P6HA 4XACA 3NAPB 2IZWA 4FT8A 1HRV2 1HDKA 1EPWA 2HLEA 2Y6JA 3PMEA 4XXAA 3UJQA 1XSQA 3J4UH 1GWMA 2IUWA 3I2GA 4OVEA 3W5NA 1RUD2 2X5IA 3MYXA 4B7KA 1F5FA 4A44A 1STMA 1QJY3 5JZGA 1FMD2 5JOWA 5ISLA 4YFWA 2TUNA 4V2VA 2GC3A 3ILRA 4R9BA 3VDDA 4K20A 4MH0E 5A80A 1W0NA 2XHKA 3WCSA 4FFHA 1JYXA 2A3YA 4PBOA 3T2OA 1OLRA 3N9NA 2P3YA 3WR0A 5FP4A 5KR7A 2HKXA 5AVAA 3ZXKA 4LBJA 4UYBA 1ENXA 3K48A 4M3CE 3WF3A 3T0AA 4UWDA 2W3JA 4Y24A 1E5IA 3NJXA 1WUVA 5FXVA 4BPZA 1D2QA 3P3NA 1RUH3 1LU1A 1AR73 1SBEA 2BUKA 5LCWL 4MGIE 5BV6A 2PLV1 2W94A 2ZA9A 3KGLA 3IIIA 2VW1A 3AXDA 2RDNA 4Q0SA 5C6CA 4ISRA 5KXDA 4LULA 3VBUA 4XOGA 1DCSA 3VDCA 2E33A 4OMCA 4QPIA 1ZX5A 1IPSA 1IZ3A 2EF6A 2ID4A 2WA3A 4LA2A 4XDOA 2HH9A 1NA1A 2WZEA 2VCAA 3FE5A 1QJY1 3I3EA 2X05A 3VBFB 4DOUA 1D4VB 4O61A 4W8JA 4OFGA 2C4XA 2GNDA 1W6MA 4B1MA 1LESA 4R4ZA 1ZA7A 1EY2A 4XF3A 1OURA 4E2GA 1G8WA 5JCTA 4JVAA 3H1MA 4XTPA 3ACIA 2QDNA 3JUUA 4PLOA 1KD7A 1OLMA 3O0XA 4BK4A 1QH7A 2XONA 4V1PA 2EA7A 3WXPA 4PJYA 3ZFGA 5C8WA 3LA2A 4UI9L 5D8AC 4GMP1 5FZ1A 1HIXA 5C8CB 4QGNA 2OQ6A 4L11A 3RMYA 1YQ5A 4A42A 1BQPA 4M3CF 2JEMA 1JH5A 1AF9A 1GSLA 4HKWA 4BYYA 4N43C 5FXWA 3NW4A 2PYTA 2XL9A 4XJUA 2CAVA 4BJ0A 1CESA 4JGZB 5FCCA 3WW3A 4BQWA 3DECA 4ZPIA 4DZGA 5C5TA 5FO8B 1E5HA 3MLLA 4BQ3A 5FOJB 1B35B 2XUMA 4H14A 5ANNA 2ZX4A 2WNUA 2QQLA 4QGMA 4UFJA 4B29A 5IK8A 2AR6A 1LAJA 4QHBA 1WW4A 5LA1A 3H3ZA 1OKQA 1UY2A 4NJ4A 3VN4A 3W20A 1UWWA 4LKSA 2XVLA 4P9LA 1ZRDA 1ASJ2 2ARCA 4KWJA 4NROA 1V00A 2BERA 4KL1A 5FZ9A 3EYPA 3OUHA 5CKMA 3M3OA 4IGPA 3BKZA 1MS1A 2PN5A 2ZZQA 1Y9MA 4NHYA 2RS11 3GZUC 4MLOA 3IDEA 3I3MA 1VRH2 2DTYA 3ZDSA 3KV5A 2VE1A 1BK0A 4XFFA 3BTYA 4IV1C 2Q8CA 2WN3A 3VKMA 4AAXA 4LK7A 3NNMA 2RM22 5FZIA 3KHBA 5FYBA 1GANA 3POSA 1CAUB 3LEMA 4AZZA 4CU7A 2O8OA 2QQUA 5AC93 2K9ZA 3VBSC 3AJYA 4LE4A 5FLJA 2YC4A 5FTTC 3B9IA 1BHGA 1F4HA 2G9ZA 4ORFA 4JX0A 4ZXEA 3WQ1A 3ZFFC 1K42A 4JAAA 3MO4A 2WO1A 2A70A 2GMMA 1RHI3 5F2WA 2D98A 4CDXA 1DQ0A 3PHMA 5A70A 1W3VA 1F4AA 3J7HA 2CDPA 2D6MA 4FSJA 4EN0A 5JOXA 1GWKA 1PX3A 5FMOL 4RQPB 5J98B 5F9TA 2Q1MA 4C8DA 1C4RA 1AYM2 5LA9A 2XGXA 5IHRA 4QT6A 3W9AA 3BPSA 4FTBA 1DZTA 1VAKA 1W8HA 3R4DB 3SITA 4DY3A 2ZABA 4CP2A 5J37A 3B7MA 1SLAA 1WCUA 4N53A 4UFIA 2DVDA 3KF5A 4WM8A 5JWPA 1Y43B 2IVIB 2MPFA 2VZ3A 1GICA 5F3GA 3HIFA 2V5YA 3JD71 3I49A 5LK5A 3RZHA 1WMXA 1XE0A 1JZ5A 5APAA 4XURA 2WN2A 2Z4FA 2CGOA 4XQDA 4RR3C 2BNNA 3ATGA 3ECQA 1DP0A 1XBFA 3JU9A 2ADEA 4YG3A 4AQSA 5AC91 4UW6A 3J7NA 1ST8A 4PIXA 2CWMA 3RDIA 4OHYA 4JDMA 4ZONA 1RINA 2D6PA 1SZBA 2TBVA 1JYTA 1CQ9A 2VH9A 4EZHA 5F2SA 2UY8A 4CEYA 2VECA 3NVCA 4UBHA 5L7OB 1VLNA 5D8AB 4LJHA 3WD5A 4ONUA 3BTZA 3TAYA 4IEYA 1OA2A 1RHI1 4B1LA 2ZX1A 1GNYA 3U1XA 3WQ7A 5GZGA 4BA6A 3R6SA 4I2OA 2EALA 2B9VA 4FFGA 1UOJA 5D2AA 4FXGB 3I2HA 4N43B 3H50A 2VJXA 3MIEA 2BW8A 1VPHA 1J83A 2WYSA 4P00B 1K3IA 1GNHA 5GZEA 3PDQA 1SDWA 3VBOA 4IE0A 2BBVA 1TMF3 2F17A 5SV5A 1YFWA 4NPRA 2GDFA 5FY7A 1RUF2 2QQIA 2ATFA 1BEV2 4AFMA 1CN1A 1OH3A 3HNBM 4P9IA 1JZ6A 1O3RA 3S57A 1NLSA 2P5BA 3U4XA 2JX9A 3SNMA 5L36A 1WA6X 2I07B 4JQTA 1GOHA 2ZHKA 2HWC2 3Q8AA 4FVVA 5E8AA 3U07A 4DY5A 1L7RA 3KV6A 5C3QA 4CXYA 4IV1B 3HT2A 3KVBA 3CF6E 3WY6A 4D7TA 2YV8A 4UOJA 3ZYRA 1TME2 4IDZA 5FLHA 4BCUA 1ZA4A 2MHFA 1AJOA 3K75B 4Y22B 5FMDA 3CZJA 1KFUL 2VPVA 1V6LA 4LKFA 1DU3D 2DU1A 1XC6A 3POEA 3VZKA 2MEV3 4L9BA 1FT9A 3OB8A 1UU6A 2IXKA 4BZ4A 3VZNA 1GQGA 3IT8A 3WSOA 1OQDA 3DPRA 4Y5Z0 1DLCA 4URTA 4DINB 1Q5OA 2OUJA 3NV3A 2R062 1M4WA 3SH5A 2FDHA 3FX3A 5I0UA 4LPLA 1DIWA 4TYSA 1SQ4A 4CRQA 5LBBA 4A7ZA 2D3PA 2IVJA 3PUAA 1QIQA 4UW4A 1UXZA 3EJKA 3CJIB 4NIIA 3ACHA 1NCRC 3MW4A 3LFIA 5DAWA 1UZWA 5A1LA 4XF0A 1WCDJ 3NAPA 1GFF2 5FKBA 1HXS2 5F6LB 3IMMA 1W2OA 4KU7A 1DQ6A 1MZEA 5C9AC 2LTNA 3KWVA 2AGSA 3GALA 3CKHA 5JSOA 1PO23 4ASKA 1JODA 4NMIA 4UBGA 1VB2A 2XL7A 4OUSA 1YI7A 1F5JA 1YQ2A 4BQ4A 1DLLA 4RR3B 3WNPA 2Y0OA 5T54A 1UY1A 4RHV3 3VKLA 2GSYA 5BNNA 3R05A 4WVMB 2WZR2 2LM3A 4WV8A 3VGIA 1MS0A 2FMDA 3RPQA 5GLWA 3MF9A 1LCLA 1TQ5A 2OUHA 2P17A 3NRUA 5EYXA 1MEC3 3UT0A 1PIV1 2BJSA 1LB2A 1OLME 2VMGA 2VZQA 4IE4A 1AR93 3Q9OA 4NR1A 4KMQA 3B02A 4CCDA 5BNPA 4FTSA 2C6SA 3PNAA 5EQUA 3B3QE 1N1TA 1EAH2 3ZIWA 5LRSA 4HVQA 5CZKA 2BQPA 1PO13 4W50A 4QXKA 4XQ4A 1S2KA 4QXCA 1AR83 1GQHA 3ZYIB 1OT5A 1SLBA 4FPLA 4Y33A 1FV2A 2IXJA 4DO0A 1N1SA 2VM9A 4FO9A 4XFBA 3MF6A 1BMV1 1NLRA 3OYWB 1IG0A 2VOTA 4YG0A 3S30A 4YZ2A 3MI8A 2Z5WA 2R16A 1VAMA 1OD5A 4XE9A 1PO21 2ZMLA 4LE3A 1X50A 1UX7A 5A7WB 4CCCA 5DAXA 3OEBA 4W65A 4CU9A 4Z92B 2JXAA 4RN5A 2DBNA 3NJZA 3H1WA 5KWRA 2ZX3A 2WWSA 4AEKA 5A1AA 2PQSA 1AX2A 2R0FA 2PHXA 4RHV1 1UY0A 4D7YA 3N9MA 5DAQA 5HCFA 4O9GA 2V72A 5GLUA 2RS32 1UYXA 2YYOA 5F39A 2ZXQA 2QZ3A 4KNCA 3UETA 2Q30A 4ZZ8A 5FZ4A 4QQPA 2B39A 4W4ZA 2ETEA 4W6XA 1S0DA 1DGWA 4CDUC 5B2GB 1ZBE3 1AR91 2HEVF 4FXKB 5D1IA 3UK9A 4E8DA 5HV4A 5LEKA 3LEKA 3ZO0B 1W0PA 1Q43A 1UL9A 2XVKA 2E31A 3ZXAC 1LOFC 2VOKA 5K4LA 1DGLA 4FFIA 2A6VA 4CA9A 4C90A 1PO11 5FPUA 5GZCA 1FPN2 3BB6A 4J1WA 2VBBA 1AR81 3GDBA 5A3PA 1RVF2 3WOGA 2Y0IA 3N35A 1LOAA 1UMHA 4BE3A 2UWAA 1B35A 4LT5A 1MZFA 2VQUA 4XDQA 1NQJA 1TEIA 2P1BA 1LEDA 3RWKX 3WUDA 5FPLA 4BWOA 2GC2A 1RIRA 4HXCA 4QKDA 3FHAA 3LA7A 2AEYA 3HR9A 4NAOA 1VBB2 1OA4A 5IVCA 5H9PA 2BOJA 2XLFA 5A7OA 4XF4A 3WP6A 1POV3 2VZ1A 1M06G 4FPCA 1QWRA 2YPJA 3N7KA 1Z7S2 1Q8SA 1GP6A 3JB8A 5BXXA 2WQ4A 3AP7A 4AI9A 2E6VA 3OBTA 5C9AB 1S4CA 2VC9A 3RGBA 3GJAA 2WL1A 3USSA 2R043 5IVFA 5F37A 2QFEA 1CIYA 4XBLA 2VCBA 4FAHA 5JR2A 1WLWA 5EV7A 1N3OA 1LOEA 1ZBE1 1AR63 4QDSA 5KXBA 4K7JA 3UKTA 5I0DA 5F5AA 1K5MC 4Q4X2 4YZ4A 1A8DA 5GZDA 2ORXA 4LBQD 5DUXA 4NUBA 3ZN6A 3KQRA 5FLIA 2D44A 5ACA2 2GP5A 5CAZA 1YJKA 1IG3A 4CEWC 2XDVA 4TTGA 2BGCA 1COV1 2R49A 3GCXA 2XJPA 1WD4A 2ZGRA 3BCWA 3O1UA 5CIRA 2HYXA 4LHSA 1LHNA 4LBOA 2JDKA 2NM1A 1W0OA 4Q4Y2 2BFUS 3HWJA 4L92A 3L9JT 4FCAA 5JXIA 1PZ9A 3BN6A 3BGAA 1AHSA 1G9CA 1OMIA 5ABJC 3TN93 1LHUA 3TEWA 2J1UA 4D6QA 2A5ZA 4NHXA 1W6QB 4Y20A 5FMBA 2HWE3 3DYPA 3V64A 4Q8KA 2F6BA 4D6SA 4TZDA 3OUJA 1UOFA 1ZZ9A 3FHIB 5B4XA 2C9KA 2NMNA 1H1MA 1S2EA 2R041 1KXGA 4LIUA 1D4M2 1GLHA 1NCQB 3TYJA 3RI8A 1CX4A 2FCTA 4DXTA 1O5UA 1MS5A 2WNEA 1YFUA 2PHRA 1XNAA 3T4VA 1AR61 5HI0A 2XB6C 3DKQA 2VNOA 2WINB 4BHPA 1SPPA 1ULFA 2JE8A 4QD2A 1GYKA 2WSUA 3ZSJA 4XAAA 1DYOA 3PUHA 2RG4A 3U37A 3RSJA 3USUB 3A0KA 3C7EA 4BLJA 4MGQA 3M7AA 3VKNA 3Q8BA 2DU0A 3HQRA 2J1TA 4TLFA 1W6NB 1YNAA 3IAQA 3VUOA 4CDUB 2IXHA 4O7XA 1B09A 2WT0A 4XMIA 1JYCA 1VBA3 1H6YA 4HSLA 3H0OA 4M4RA 2YHJA 1BCXA 3M2MA 4XYXA 2JB8A 1S55A 3H3LA 4OHVA 3GHNA 1O6UA 1YRZA 3NNGA 1W2UA 3LSEA 3M3IA 2JG8B 3ZYHA 2YC0A 1JYIA 1H1AA 4R9DA 2A6YA 3ZYGA 2W0XA 2BZDA 2W1WA 4KG0A 4JDNA 3ZYJB 3N4MA 5JMOA 2EIDA 1AXYA 3RZLA 1O3QA 4AOCA 1HQWA 3LD8A 1ND3B 4CUGA 2C26A 2D6OX 4QX1A 1UAIA 3QBQA 4N90A 4RL7A 1C8NA 4GJYA 5FY8A 2OQ7A 3WLUA 3D6EA 3J8F2 1C1FA 2X29A 3Q8FA 4DXSA 3V0BB 5FPZA 3H8OA 3PMSA 3UKVA 1IOAA 5FZ8A 2H6BA 5C3OA 2VW0A 4ZU4A 1R092 1TE1B 1Q8QA 1XE7A 4UF0A 4JGYA 2GMEA 3DYOA 4EROA 1UIKA 1GNZA 1AL0G 1SBFA 1OBNA 3VBSA 1V9U2 1X82A 2VL4A 4MXVA 5EFUA 1Q8PA 3FJSA 1KS4A 1DG6A 2FDJA 4HVRA 5K0UA 1ZVFA 2DVGA 4YRDA 3RG0A 1VBA1 3VZJA 4QAWA 1K5MB 1CAXA 1XNBA 2VMFA 4QQHA 3ZFFA 2ZHMA 3URFA 5C4WC 3IPVB 3R0RA 3B00A 1HRV1 4QQLA 3CHXA 5BY5A 5I0SA 3CMGA 2ZACA 1RUD1 5EHDA 1JW6A 3ZSLA 3MDPA 5K8SA 4L97A 4IW3A 1FMD1 2P6CA 2D3RA 3LPFA 5FBJA 5CG8A 1FXZA 1WCSA 5I8YA 3ZX7A 4BOWA 1VRBA 2XJTA 1CZVA 2VTXJ 3FBYA 4J1XA 2DYCA 1JTZX 1RUJ2 1H9WA 5GJ6A 5CFDA 5ABJB 1APNA 2PHLA 4L8QA 4NWVA 3ZIXA 2R1BA 1A3KA 2CU5A 4KQ7A 1POQA 5FYIA 1K5JA 5L9RA 1DGRN 1UIJA 3ZDVA 2H0BA 3LEGA 3VBRC 5HCAA 2BVBA 1QQP3 4LK6A 3SEPA 2WWJA 4RR3A 2A75A 5M0TA 4KWKA 4W6WA 4XMAA 1UX6A 1V6NA 3MUZ1 4M0NA 2JIGA 3H7YA 3OY8B 4TN7A 3NKTA 3RMXA 3L2YA 2ZEWA 5FZFA 1G9DA 5T5PA 3NV2A 2XUEA 4KWUA 4YM1A 3VD5A 3CO2A 2B5HA 1URXA 2J42A 4LR4A 2ARXA 3J26N 1VP6A 1F31A 1W8UA 1ASJ3 4HK9A 4Q29A 4OZOA 2PELA 1BYHA 4P08A 4FPFA 4DUVA 4HL0A 2ARAA 3GF6A 4QWNA 4XIKA 4U36A 2DV9A 4ZU5A 4N7IA 5FPAA 4FAGA 1FAYA 4OLLA 2PAEA 3V0AB 1A78A 3NSTA 3AK0A 3GNEA 1GZ9A 5D21A 1US2A 2W39A 4BIFA 4Q0PA 4GALA 1Q3EA 1YLLA 1POV0 2VNVA 5CB7A 4OMDA 2KXLA 3I2DA 4JCKA 1QGLA 1QDOA 1UMIA 3WV6A 1QKQA 2YDEA 1O3SA 2XWBB 1HJGA 4CYDA 3DV8A 3AYCA 4XUNA 2XBO3 1G9FA 4B3NA 5A33B 4XF9A 5C8CC 2RDQA 4LUKA 1UF2C 4XJAA 2IXCA 3ES1A 3CDZB 2NMOA 1I5ZA 1AL22 1QNWA 3JBG3 3WHTA 1PGSA 5FOBB 4YVSA 1VBD2 3I4IA 2RR12 1U12A 3WW4A 4Y4RA 3WDTA 1YQ8A 5JVVA 5HPOA 1Q8VA 2RDSA 1ASJ1 5J48A 1OC1A 4BMEA 2R072 4QX2A 3THPA 5C4WB 1W6OA 5A1FA 2DBIA 1G9AA 2GNMA 3C7OA 3POYA 5E6HA 1VRH1 2RV9A 3M3QA 2G19A 1RUG2 2XR4A 3W58A 3V56A 3C7FA 3JB4C 1SLIA 1A6CA 2ZTNA 5CKQA 2CHHA 4EJRA 5FP9A 3D82A 3SC7X 3AVSA 3ZPYA 2RM21 3AP5A 4HPKA 3ZXEA 2CSGA 1U5ZA 1UYPA 4M4PA 5KHGA 5DG2A 2VCCA 4XW3A 1NCRA 1LECA 4N9HA 4Q1RA 3OOXA 3VDAA 4DUWA 2D40A 5LB6A 1RJ7A 1H2KA 5F3EA 2JIJA 1MPXA 2XBO1 5IVBA 3GHMA 5KHJA 1W8NA 3HNYM 4DXZA 5C9AA 1O8SA 4GKYA 1BBT2 3FLTA 4Q8LA 4E4DX 4YW2A 3GGLA 1H2NA 1ZYBA 3M70A 5F3CA 2DDUA 4XUOA 3JBG1 2QZ2A 1JOJA 3VBRB 2XWJB 2ZMKA 3AP9A 3R4UA 3BPZA 2OIIA 4Y5TA 3JXSA 2V5DA 3I2OA 2UU8A 4PQQA 4GMP3 1AYM1 4LBQA 5FIXA 1KQRA 3SXWA 4JDOA 5FO7B 5DQ0A 4PF1A 5AVPA 1NE6A 2DFCA 3TEXA 1RUF3 1UU5A 3PLQA 3E6CC 4LO4B 3U10A 4YM2A 4OULA 3WNXA 3SMHA 2E7TA 1BXHA 2JB4A 4TWTA 4RQPC 4NRQA 4A2UA 3ZMNA 1J3PA 1X36A 1RXFA 3KSCA 4COVA 2LROA 5JPMB 3GYDA 3O0VA 4WM7C 4DXRA 3SH4A 1H2MA 2OS2A 2O0OA 2AACA 2W95A 5FYYA 4CCLA 1DQ2A 4QKBA 3WHUA 4CVUA 1W6PB 2HWC3 4GWIA 4D7SA 1UMZA 2W87A 4QPGC 5DUWA 4DUXA 4MYEA 2C9AA 4XBQA 2WS92 4YGDA 1GU3A 3A21A 2VXJA 2XJQA 1KRIA 4FPEA 1A8MA 5CYYA 3ZMOA 3O1OA 4AK3A 4LUMA 4IQPA 1QJX2 3LGRA 2QCSB 5GLTA 5JI7A 3CQOA 2RS13 4GJZA 2WT2A 3D8CA 3T08A 2Q8EA 1K12A 1IS6A 1AUYA 3VBHB 5L7OC 5ANQA 4AI0A 3U0ZA 5EYYA 1D7PM 1PM7A 4HT1T 1FV3A 2OX0A 5GALA 2WQZC 3UL2A 2XJUA 3OBRA 1YO8A 4CSWA 4QB1A 2YPDA 4OQ8A 5FV3A 2ZOEB 3K46A 1RUF1 1PVC3 4UFKA 3ENRA 4EN7B 1BEV1 2JDNA 3AP4A 1HB2A 4IGQA 2IXIA 4ZU7A 3INAA 1EUTA 4LORA 4D69A 5SV8A 4EV0A 2ZGLA 4FPGA 3FC0A 4NRMA 3ETPA 1HXS3 1KFXL 3J7MA 4HBNA 3RYRA 3LIHA 2JICA 4IESA 2HWC1 2A6WA 1VMFA 5FZAA 4AGRA 1RC6A 1I9RA 3OJBA 3AM2A 4Y26A 3W21A 3LAGA 1CIWA 1QNYA 5H9SA 4MXWA 3OG2A 2RS52 2ZZJA 2XG3A 2UWBA 5T5LA 1ZZ8A 4JTOA 5AFBA 1W2TA 4JV4A 4K40A 2PQQA 2WFF2 3ELNA 2QQMA 2JD9A 3PUQA 1GWLA 4I3GA 2WKKA 5LBEA 4D3WA 3JD73 4Y1UA 4ITCA 3T2QA 2ZS6B 3K2OA 1XYPA 2FDFA 1S2BA 1SDDB 5EJ3A 2JE9A 1U5XA 2ET7A 4ET7A 2NPIA 4QPYA 5J3UA 1XB9A 2KD7A 3G7DA 4Q4W2 4A3XA 2VAUA 2AENA 1O59A 2W92A 4MZUA 1WWYA 3K3NA 5IWFA 1PVC1 2EXIA 2Y64A 4C1WA 3QD6A 5T5OA 2J1VA 5FZMA 1GR3A 4EWEA 4JRLA 2GH2A 4XC9A 2ZKNA 4N7UA 1UZYA 1W9YA 2JG9B 2ZGQA 4MHRA 4NN0A 2K2SA 2E7AA 2A6ZA 2WO3A 2XKOA 1GBGA 1HXS1 2VMDA 4CEWA 4KGQA 4UAPA 1O4TA 5KHKA 3OPWA 2VGDA 2YBPA 4A41A 3CJIC 4I30A 1XU1A 3E6BA 4WM7B 4CDWA 5GM0A 5DG1A 1O5LA 1RITA 5DDJ2 5I8TA 1QHDA 2HEWF 4KGGA 2RHPA 3DYMA 4LITA 4OUEA 4YGEA 5ERLA 3NJVA 4GA9A 4QPGB 4RS5B 1YFXA 3O12A 4XJWA 1ND2C 4CZSA 2DVFA 2IC1A 4CCOA 4HMZA 1FOD2 3U14A 1ZZ7A 4UFLA 1H4HA 2KR2A 3ZOIA 2V4VA 1T6GC 2ORZA 1WBFA 4DFSA 1DYKA 1W03A 4QM8A 1SACA 3ZR6A 2P3IA 4AQ6A 4J6GA 2PMWB 1JZ4A 3QLQA 1GUIA 1R082 4OHXA 1C8M3 5FJKA 3ZYFA 4MG2A 4RYDA 4KI5M 3L2HA 1RVF3 1X9PA 4LMFA 4QM9A 3O1SA 2RJKA 4I0BA 5FZOB 5F5CA 3RFRA 3HAGA 3BIEA 1NT0A 3GZTB 3KT7A 2P3JA 5FPVA 1TVGA 5IJRA 5JXHA 1R64A 3LOIA 2PLV2 4GIQA 4BH9A 1LENA 4FBFA 3OGVA 1SMVA 1VBC3 4XILA 2HWD2 2RMU3 2VUDA 4M3CB 4ES8A 3H1YA 4F83A 4NWWA 5FYSA 1MR5A 2WSVA 4CXWA 1H0BA 1QEXA 3N7LA 3RNSA 1Z7S3 3HQXA 1W9SA 2XH6A 2ZMNA 2WAAA 4GB32 2I45A 1QJY2 4IV3A 1WBLA 3TRSB 4CUBA 4TLGA 3BU0A 1PK6C 4A4AA 5A32B 3QOPA 3THDA 1UYZA 1S0EA 2DUQA 1CX1A 1CAVB 4UW5A 3IN9A 4IEWA 1AZDA 3I8TA 5FP7A 5DN2A 2X53S 3POFA 3IB3A 3FHQA 1U0AA 1YWKA 5BYNA 1W06A 1W8ZA 1CJDA 2R32A 4IXLA 4MGYE 3HBZA 3I3BA 4LBMA 1OQ1A 4IUGA 2BFUL 4X6QB 4Q4X3 5IAXA 4QQOA 4F3JA 1GP4A 5A33A 2EICA 3BYWA 2D5FA 2B8MA 4RD7A 1C8M1 5ACA3 1KEXA 4NIAA 2WT1A 3E1F1 1RVF1 1OSGA 3UJOA 4AEDA 2J1SA 5A3TA 4GKXA 2X09A 2ERFA 4GH4A 1RUH2 4MGSA 4IGOA 3WP3A 4S2GA 1AR72 4P9WA 1WMEA 4IEOA 4GMP0 5FZLA 1O3TA 1S0IA 4S2DA 4KBBA 3CU7A 4Q0QA 2D5HA 3N9LA 1ZZ6A 3AZXA 5EJZB 3IKWA 4XABA 2VBPA 3U75A 1PIV3 1VBC1 3ZXFA 2RMU1 3P3PA 1VBB1 3APBA 5CFCA 3FBMA 3OGJA 4PI2A 1CPNA 3RVHA 5BNOA 2WLPA 3FZ3A 1Z7S1 4LA3A 3H3UA 4DRVA 1UZ0A 4DRRA 1H8TA 3H8XA 1O91A 4B4RA 1NUKA 3DXUA 1REEA 4MGZE 3NWKA 1Y4WA 4YW6A 1D4M3 1OOPC 4AVBA 1LOBA 4XHXA 2A1XA 3WNLA 1BVVA 3C2UA 3DKWA 5C5UA 4IEVA 3JQXA 2W9XA 4PLMA 3A4UA 4Q4X1 1W2AX 4L2NA 4XF1A 3T2PA 3VZOA 1UOBA 3MGUA 1UKGA 1ND2B 2GU9A 1L7QA 3PVBB 4CCNA 2X8KA 2ZGMA 3IDAA 3O5SA 5G05L 1XXNA 2HBTA 5IVYA 5ACA1 4LIVA 2PAKA 2QQPA 2X10A 2GNBA 5FKCA 1W99A 1IS3A 1OPOA 1R1A2 2LUWA 1JUIA 5H9RA 3QACA 3WF2A 2PHFA 3W5MA 5JSPA 3PVNA 4IL7A 3JCIA 1Y3TA 2VZUA 5LA2A 2FDGA 3MIHA 1VMJA 1DZQA 1AYN3 3MZHA 1CZTA 3OBZA 5FXZA 2WUHA 2D43A 1HB3A 1ULDA 4XPVA 1C3HA 1KGYA 4PCRA 1YQ6A 2JJ6A 1KJLA 4MADA 2Q1ZB 2XKPA 5JZGC 4Q0UA 5T5JA 5FQ0B 1HLCA 4H7LA 3AL6A 2R1DA 5A6XA 1XPWA 1OXCA 2XQXA 4GAZA 4OQ9A 5E16A 3HD8B 4IEUA 4IERA 4ZKTB 5JAXA 3OSDA 5FY5A 1Y7BA 5FJHA 4XFAA 5FY4A 3SCGA 4UXAA 5A7SA 4XJ8A 1D4M1 4PDWB 5F6KA 1W6PA 4AGVA 1YYNA 5CFCC 5DAVA 2H0VA 3B9CA 1GZWB 2O14A 1ENRA 1PK6B 1JBCA 3D0JA 4G9SB 4GWNA 3VBFA 4DS0A 5AC92 2VUAA 4JRAA 1CAWB 4XTMA 4XUTA 3TB0A 4AHXA 5C7GA 2D7FA 4YWAA 2PHUA 1NCQC 2B4KA 2CL2A 4WZFA 5BUVA 4YZ5A 3VZMA 2WZ8A 2BYVE 4R8HA 5FPXA 4HANA 4NVPA 3DEMA 1OD3A 3HEIA 3EQEA 4COZA 1HQNA 1D2SA 2GH8A 3POWA 1O7FA 5C8CA 2CY6A 3D5OA 1AYN1 5IT6A 2QQJA 5I93A 3MV11 1AXKA 3KQ4B 4Q1PA 2XPJA 3CEWA 1NA1C 1AVBA 4CP9B 4CPBA 3VL9A 1XOYA 2DVBA 3IM0A 2YZ4A 2JDHA 1X7NA 3BTAA 1UNBA 4IEXA 4S2FA 1JHJA 5A7QA 3SKJE 1H30A 4HN0A 4IEPA 5FZKA 1QJU2 4FOVA 4JGZA 5K7PA 3SQOA 1ZBA2 2WIIB 3CZUA 3ES4A 3ASIA 5FAXA 5I91A 5L9VA 1COV3 2OKXA 2Y6GA 3ZFGC 3H7JA 1RUJ3 2JG8C 4AVCA 1REFA 3WDVA 3PTRB 5JXJA 5T55A 2Q4SA 2IXLA 2PAMA 1S1AA 3I54A 5FFOC 4QQ2A 3VHNA 5C71A 2XVGA 4GWMA 1OF4A 2GNTA 1W2NA 3E5XA 4W6YA 4COYA 1J58A 4LBLA 1ND3C 5FP8A 5CISA 1IKPA 4TSVA 4AFAA 4YSFA 4P9YA 3FUQA 3KF3A 5H9QA 2I2SA 1OOPB 4BMBA 4TXWA 4K8FA 2IFWA 3VD9A 4Y5SA 4KH9A 1ENSA 4K9SA 2RJ2A 3NNLA 4JKMA 1SLLA 5DZFA 4YZ1A 1CAUA 4QXHA 4JHTA 1QF3A 2CNAA 1W9TA 3K4AA 3LA3A 1BKZA 2VMEA 1Z78A 2LS6A 1RMU3 2VBDA 4QHZA 1IQAA 3HOBA 4X8PA 2ZKLA 1ZZCA 4HETA 2J1AA 4HKOA 3BALA 1C5IA 2DUPA 2ET1A 3E5QA 3T1LA 5E1RA 1HRI3 1KJRA 2VCMA 3S0MA 5EJ1B 5KC6A 3FLPA 3VZLA 4QB6A 3S5AA 1TMF2 1WW5A 3LKJA 2FHRA 1HB4A 3AMMA 5A6YA 3LE0A 5JZGB 1RUJ1 4META 3UNPA 1A34A 1W9FA 4Y4YA 5T3NA 4EE2A 5FZBA 3KCYA 2BNOA 4RQPA 1HJFA 1SBDA 2VU9A 1QJZA 2VULA 3PJQA 3VDDB 2IFRA 2P3KA 4CTEA 2ZAHA 1VALA 4FP2A 4QX8A 1FNZA 3MW2A 4AFCA 3VDBA 5T52A 1DQ1A 4KWLA 1RUOA 3KD4A 4L0PA 2PHDA 3O1RA 2RE9A 3WDUA 2ZGUA 3NO8A 2EIGA 3SCHA 4MHUA 4QPGA 1YC61 4CDXC 3WINE 3IAPA 2FBEA 5F32A 4CU8A 3H42B 1TNFA 3LDBA 3IZOA 4LKDA 5FBZA 2FDIA 4HSJA 3ROUA 1WMDA 3MUY1 3HN3A 3ACLA 2GN7A 2EIEA 1FATA 3JZVA 3WZ1A 2WFPA 4WBBA 2VY0A 4C0BA 3ZR5A 4YW7A 2JDZA 1RMU1 2MEV2 5C33A 4AW7A 2WR9A 1FX5A 1F35A 1PVXA 3MLKA 3WNMA 2DURA 3H8RA 1HRI1 5L7OA 1PGL1 1JXNA 3IIAA 4QPIB 4OHWA 5D8AA 4E8CA 3U4SA 1RTVA 4LKEA 4PQ9A 1OQEA 5FZCA 1NA1B 1LHWA 1CPMA 5LY2A 3ZKYA 4QDQA 4BLIA 1W6MB 4GULA 3AZWA 5FMCA 4YG6A 2QQVA 1RUE2 4N43A 4JKLA 1UKRA 3AL5A 2ZHNA 3BTXA 4XIOA 2NP0A 1U5IA 4BQ2A 5FK8A 1HRV3 4NHKA 3ZYPA 1JHNA 1YJLA 4PT6A 2CGNA 1RB8G 2GAUA 3ZFGB 2BNMA 5J1XA 1RUD3 1C1LA 2Z42A 2VO5A 5EXOA 3ZN5A 2DTWA 1ZZBA 2PFWA 1LHOA 3PU3A 4AFDA 3RI9A 3O7OA 1FMD3 1SFNA 2DVAA 2JECA 2OT7A 1BBT3 3T0BA 5A32A 4AQ2A 3AYAA 3N7MA 1NY71 2ZEZA 4FP3A 1AL21 1SHWB 1NOVA 3S7IA 5A3UA 2VVDA 4RHV2 4EWDA 1ULPA 2VOXA 4YVWC 1YIPA 4NPLA 1ZNPA 1D0GA 1PMHX 4GXLA 4YM0A 5IK7A 1NAEA 1NZIA 4LLOA 5JIUA 1GP5A 1MEC2 2EAAA 3HPNA 4IV1A 3FFZA 3KMHA 3LZZA 2OZ6A 5IK5A 4B8EA 5IFTA 1AR92 4U2AA 3SCFA 2AYHA 1UD1A 2P2KA 3BVCA 3TNQA 3EMRA 3QH6A 2VZPA 4Y22A 1DQ4A 2HEYF 3FFQA 3RJ2X 1W8WA 3H8UA 1JZ3A 3PUSA 2YB7A 1P8JA 4ZXKA 1PO12 5FO9B 3AMPA 4AI1A 3WF1A 2Z2SB 2D6KA 4MGTA 3RZMA 2VOWA 5IUQA 5A7NA 4ARYA 4CP0A 2VR4A 2BU9A 4QPWA 1PM4A 1DFQA 3PIJA 4B4QA 4E4HA 1LRHA 1H2LA 3MHZA 2VUCA 1QXPA 5E89A 3MPBA 3BODA 4I01A 5JLVA 3HJRA 3R4SA 1BBT1 4Q26A 1QJX3 3CJIA 1XNCA 2WO7A 4M0HA 1N1VA 1JZ7A 3I3QA 2Q8OA 3M8LA 1SLTA 4UFHA 2GC1A 3RRDA 2WQ8A 1QXRA 2GP3A 4AHYA 3AKTA 5GLVA 1NKGA 2G4IA 3THCA 3MW3A 1XRUA 3E97A 3P5BA 4RA0A 1PNFA 4CDXB 1V6IA 3KCCA 3A22A 4R9AA 3W59A 1YUDA 2G9FA 4LBKA 5DZEA 5FY1A 4LNVA 3N9PA 5F8PA 1RUI2 1ZBE2 2ZBJA 4PIZA 1QOSA 3VLBB 4E27A 3FUOA 2GN3A 1NYWA 3BOWA 4K6BA 3WW2A 4K1YA 1REDA 2MNGA 2ZGKA 4LHNA 1HN1A 4X6RB 3UV9A 4ZS2A 1I3HA 5CNAA 2CGPA 4WVMA 5J96B 3FL7A 2R7EB 5DUVA 5LWBA 4QX5A 1GMMA 4WM8B 1C5HA 2CV6A 3SH3A 3WX5A 5C3RA 2XQRA 4AHWA 1AXZA 1HB1A 1LEMA 4QB2A 3RZJA 2HWB2 5KHIA 3GXUA 1ODNA 3P6BA 3NNJA 2XJVA 2J7MA 2YXSA 4YW4A 2QTWB 2YFUA 1OKOA 4JC1A 4PBPA 4MUVA 2RS53 4Q4V2 4P9JA 1JU3A 3NL1A 4QKNA 3WG4A 3DGTA 5JMCA 1LGNA 1QOTA 3ACGA 3O14A 5BNNC 1Q56A 1QJX1 2WFF3 3ZYBA 1VBE2 3EBRA 5FXXA 1VRH3 5G04L 5FYVA 3K4DA 4NRPA 1OF3A 3T09A 2JKXA 3OYWA 2E51A 3WNNA 4SBVA 1IPKA 1RYYA 2V73A 2OVUA 2DWRA 2RM23 4QU2A 5BNPC 4INDA 4HN1A 3WP5A 3AFGA 5JPNB 1LGBA 4QX7A 2JDUA 1H6XA 5A7WA 1UU4A 4Q2FA 2D6NA 3GCWA 1KS5A 5CBLA 2A3WA 1YQCA 1BK1A 4AVVA 2VZVA 4M00A 3U78A 4YVWB 3ZSKA 3VBHC 3Q8CA 3RWNA 3OGGA 3AMHA 3UGGA 3VBOB 1SEFA 3ZSMA 3U11A 3WF4A 4FQZA 1IHMA 1EV12 2FMYA 4FQ4A 2OPWA 4P02B 2Y33A 1I6XA 1IQDC 2WO2A 3ZXLA 4A7YA 5C70A 1IPJA 2AZ5A 3VKOA 4CP9A 4WVVA 3GZAA 5AFEA 3FMGA 3GBFA 2VTFA 1AYM3 1ZRIA 5FDBA 5IK4A 4BQXA 3AVRA 3VL8A 2RS51 3MICA 3POIA 5DDJ3 4HOOA 3TNPB 5L73A 3WUCA 1YXWA 2WFF1 3TN92 2Y6LA 1OHFA 2HWE2 1CZSA 1EUUA 5T50A 5KXEA 2VXRA 1H8VA 2G1MA 3EO6A 4Y1YA 2ZAAA 1YEWA 1XE8A 1FOD3 3I3DA 3VHPA 1UY3A 1UZZA 4NPMA 1N47A 5DPNA 3RZZA 3WNOA 2VQAA 2XJRA 1T6BX 3VV1A 2W08A 3ZM8A 4DMIA 1GKBA 1QOOA 2Y6FA 1XQNA 2N7GA 1V6OA 1OOPA 4AL9A 2V09A 2XLGA 5A6ZA 3VD7A 1R083 4HG6B 4NAMA 2OZJA 3LEIA 4BXFA 5EIYB 5FR3A 3ST7A 3TEZA 4P5YA 4FOYA 3GM8A 3KB5A 4D6RA 2CTVA 4K21A 3VB9A 4GWJA 2VMIA 4P14A 1IGOA 4LBNA 1VBA2 2HWD3 4MX3A 1UZVA 2JG9C 1MS9A 2JKBA 3UGHA 2WLQA 4NO4A 4B4PA 2HWF2 2W47A 4LLFA 5DDJ1 1IKQA 2DCYA 1ZRCA 2PA7A 4GB33 2YUEA 1BEV3 1LULA 1WLDA 3C3VA 3WQ0A 2D6LX 2RVAA 3LOBA 5LEJA 3WVJA 1FOD1 3N9QA 4BXSV 4OZXA 4E2QA 2FZ2A 4CUCA 4M01A 5BNNB 1YHFA 5TSWA 4BQYA 2WA4A 2ZJCA 1J1LA 3AC0A 4BM8A 4RS5C 5IVJA 2Q5TA 5BNQA 4J25A 1XJAA 1W6QA 1R081 2SLIA 2YMZA 1E5RA 4LO6B 1TME3 2WNOA 4D0QA 4Q5OA 5BNPB 4LQRA 4ATEA 1ZRFA 4QXBA 5FYUA 3AKQA 2BOIA 4N8MA 5HCBA 4BQ1A 1V70A 1JMUB 3A0NA 2WAOA 2J22A 3BOPA 4DEVA 4Q27A 3ETQA 1NCQA 4ARXA 1U5YA 2LW8A 2FCVA 1SCSA 2BRTA 3DUIA 1HV1A 1YIFA 4E2SA 1S0FA 2HWD1 1NE4A 2HBUA 4LOSA 1ULGA 3WG2A 2WYFA 4CU6A 3USUA 5J09A 4AVTA 1ODMA 1RJ8A 1ENQA 2R063 3D0SA 4GB31 4CPBD 1WZXA 5A3NA 5I8SA 1W6NA 1LKNA 1GQPA 3I7DA 4CDUA 3ABZA 5LY1A 5KXCA 2VMCA 1JUHA 4YGCA 3T3YA 2QKDA 4DEQA 1LOFA 3CIHA 4B7EA 4HKLA 5FRAA 4YFZA 1PGW2 3IDBB 3PURA 4OI2A 4Y3OA 3V65A 1CR7A 2W5FA 5CKNA 2JG8A 5FYZA 4HZFA 5CG9A 2W1SA 5F1RA 2CAUA 2XMLA 4JQRA 1JS9A 1UY4A 4RFT0 4FOWA 2WZPP 4AXOA 1TME1 4JHZA 5J7MA 3O1VA 2ZX0A 3OPZA 1QQP2 5A3OA 3TEYA 4IETA 1DHKB 1ND3A 5L19A 1J1TA 2O1QA 1RUH1 1R1A3 4P9XA 1W8TA 2WABA 1AR71 2YROA 3G6JB 1GOGA 3NJYA 4A6SA 2WZR3 3V0BA 3M4FA 2VZRA 5FYHA 4R9CA 2ZCWA 1RUC2 4HFSA 3MPPG 1SG3A 1ZRRA 4X8NA 4DPNA 1ZREA 3K4ZA 2DCJA 2Q8DA 3T0DA 3OPTA 1WCQA 4IEQA 1R1ZA 4FTEA 3OD4A 1OLQA 1EAH3 1RL3A
chains in the Genus database with same CATH topology
2R061 5JIAA 2BEOA 2UURA 2GALA 1F9KA 2BVVA 3OTFA 1DDLA 3I59B 3ZFEC 4P9GA 3OF1A 1K5MA 3IPVA 3AKSA 4E4SA 1KDKA 4HLTA 3IMNA 3AMQA 2ZGNA 3LWCA 3TOJA 4JGYC 1VR3A 1LOCA 1N3QA 2VVFA 3KGZA 2D93A 3DF0A 3WDWA 2FQPA 2P37A 1V6KA 3WT3A 2AREA 2PHWA 5K0UC 4GQ7A 3BU7A 1WCKA 2XBO2 2PTMA 1R1A1 1QXJA 2B45X 3ZN6B 4KU8A 2WZR1 1GV9A 5ABJA 4C0HA 1L3JA 2RS33 1DBNA 2KA3A 1EP0A 2E53A 4S2HA 3JBG2 1C57A 2TEPA 2BPA2 1SLCA 3B5LB 2LALA 1BVP1 1BJQA 5E88A 1MZ6A 3KT4A 1C28A 2VVEA 3ZXJA 1EAH1 1QU0A 3B01A 4LHKA 1DGRA 1QJU3 1FPN3 2E9QA 1ZBA3 2HJIA 3AP6A 3OY8A 4XJZA 5CFDC 1WW6A 4AGGA 3AZYA 4Y20B 4Z07A 1YCIA 1UW8A 2OPKA 5I0TA 1G7YA 4I0AA 1DYPA 1WMFA 3M3CA 3VHOA 1AX0A 1MQTC 5LK7B 2QJVA 3WDYA 1VBB3 4D94A 3IDCB 5I0RA 4KG8A 1HX6A 1ULEA 4YZ3A 4PDWC 4CP1A 3NV1A 3ZXDA 5JI9A 2DCKA 1OA3A 1QH6A 2JENA 3V0AA 1HW5A 4XHBA 4C91A 2BWAA 1W39A 2RS31 1MS8A 1GZCA 1E57A 3FWEA 4DB5A 3EXUA 1WD3A 3MLJA 1KDMA 4COWA 4NHMA 2NZ9A 4YVWA 2ZPXA 2KM2A 4CDQC 3EHKA 4MV2A 1QJU1 1FPN1 1ZBA1 4OHZA 5JOYA 3MIGA 3UKNA 1QDCA 1DGWX 1ULCA 1WLCA 5FREA 2ENRA 4Q4Y3 1HQLA 4JTNA 3TWIA 1LODA 4N9IA 3DN7A 3FLRA 2WNVC 2DUOA 2EXJA 4I3PA 3ZFEB 4XXPA 4ASMB 1AX1A 4FPKA 5C4WA 2A3XA 3RJRA 4A7KA 1MS4A 3MIBA 2NQYA 1XNKA 4FPYA 4YGBA 4YLZA 4JGYB 5IK5A 1DF0A 4YVSC 3H9AA 2JE7A 4DNYA 2ZGOA 3VBSB 4E9KA 2RS12 4HVOA 4YW5A 1IS5A 2A6XA 1NXMA 2R0HA 5K0UB 1J59A 3ZFFB 3KCXA 3T1MA 1F2NA 3O0WA 1CAXB 2FZ1A 3QH7A 3T2TA 4AVSA 3RS6A 3OCPA 1G9BA 4C1XA 3SLIA 4ATFA 2DCTA 1CONA 4YM3A 4R52A 3OD0A 1TMF1 1MACA 4AI3A 1PVC2 3HN1A 2CWSA 4H3WA 5A3MA 3VBRA 2GZWA 4AVAA 3AKPA 2QE3A 3AXEA 1RUE3 1AJKA 4Q4Y1 2E63A 4K1ZA 1RUNA 1VIWB 3MIFA 2QNKA 2EAKA 2X5IC 4LEJA 1DQ5A 5CFDB 3LCPA 1SFYA 3AZVA 4WVWA 3WW1A 4PF5A 2UWCA 3N7JA 4MSVA 1MVEA 1EPZA 3S7EA 3VDDC 2B7YA 3AFKA 4COUA 4BIOA 2B9UA 1MQTB 3QCWA 4NHLA 1WA4A 1UPIA 3J8F3 3BIWE 2UY9A 3JD72 2W52A 2MEV1 4LO5B 2VW2A 4AWDA 5CADA 1R093 2D97A 1HKDA 5DUUA 1CD3G 1FYUA 1QMJA 4K3UA 1V9U3 1PMIA 5JDBA 4IEZA 2D3SA 3IBMA 3VBUC 4Z2WA 1RUE1 3LB9A 3VBHA 4EN6B 4CDQB 2HYKA 3ZSEA 1RHI2 4QPIC 1WLTA 2UYBA 2DCZA 5EWSA 3PVOA 3AKRA 4LHLA 3X29B 1SCRA 3GBWA 5JSRA 2ZX2A 3WDXA 2YY1A 2WNVB 3WG3A 1IS4A 5J36A 4LO8A 3J8F1 1OI6A 2W68A 2WC2A 1XNDA 5HXVA 5FMOS 1NQDA 1MEC1 2RJLA 1R091 4I09A 4YVSB 1DZRA 3PJYA 1RUI3 4LO7A 3LSDA 2JD4A 2XLAA 4XZPA 3MEPA 1LOGA 4AE2A 5LRRA 5EZWA 1V9U1 2Q0AA 1Y9QA 1C8M2 1WGPA 1MZ5A 3SISA 2DF7A 1W6OB 4DQAA 2OA2A 1NZCA 2WNUC 4AEJA 4ISQA 3B93A 2HWB3 1HV0A 1VAVA 2E7QA 2EXKA 1O4YA 1TNRA 4ES9A 4AI2A 4I0WB 2NYYA 2GMPA 3M3EA 1QY4A 3ILNA 4HPKB 3NKGA 2ZGSA 3HMYA 1VBC2 4Q4V3 2RMU2 1ONAA 2R6QA 2A7AA 1NCRB 2TNFA 5HBAA 2EVXA 3I59A 4XETA 2Z69A 1VBE3 2JG9A 4H55A 2X5IB 4F7ZA 5A3LA 4MVTA 4PLNA 1YFYA 2XJSA 3KS7A 1N3PA 4Y1XA 2ZHLA 4Y1ZA 1PHMA 2AH2A 2IWGB 4LTAA 3WP4A 4WM7A 3ME2A 4EN8B 1ZM1A 4UW3A 1RUI1 2K0GA 1PZ7A 2BWCA 4LBQB 4Z82A 3CJXA 2CYFA 4OI0A 4HK8A 4RS5A 1G86A 1EV13 2PHTA 1AL23 1X8MA 2HWB1 1VBD3 5CU1A 2QVSB 2RR13 4CDWC 3M1HA 1S0GA 1CJPA 1PIV2 4Q4V1 4F8AA 1LGCA 4N53C 1LTEA 4WM8C 3VBUB 2R073 3J9SA 1POV1 1PNGA 3ILFA 4RSUA 4AYUA 1VBE1 3NV4A 4I02A 1RUG3 1S0JA 2UYAA 1OFSA 3CLPA 2F4PA 1KITA 4M3CA 3VHRA 2ZGPA 4AF9A 4AFBA 4XBNA 1BMV2 4PIYA 2A71A 4AHZA 4CEYC 1OFNA 1JN2P 4OI4A 4QGLA 1Z0HA 1LHVA 1PO22 3MFAA 1G6NA 4FPOB 1VB4A 1ALYA 3AB0A 5DZGA 1VJ2A 2C5DA 1EV11 3RYPA 3SHRA 1CAVA 3N3HA 4AG4A 4OUMA 3WCRA 1VBD1 1XYOA 1NG0A 2RR11 3AYEA 3B69A 3AMNA 3VBOC 3VKFC 2GC0A 1AYN2 1X33A 2OYZA 1CVNA 1X8EA 2HWF3 4IV3C 1S0BA 2R071 2WNUB 1RGSA 3TN91 3KT1A 2YGMA 4MXWB 4XFIA 2HWE1 1RUG1 3TBDA 3IWZA 3DL3A 4Y1VA 1FNYA 1AR82 3KM5A 3JQWA 3S6PA 2AUYA 4R4XA 1PZ8A 4XFGA 4YNIA 3ZFEA 4Z8BA 2WS93 4AEDC 3ZN4A 2OW4A 4GH4C 4RGAA 4AQTA 1Q8OA 1V6MA 2A73B 3RQ0A 1XU2A 4NOTA 4OI1A 3PVEA 4EWAA 4G4FA 4QMAA 3DPRC 2R30A 2O8QA 1MS3A 5BNOC 3N36A 4CEWB 1ND2A 2HWF1 3E6DA 2BTVC 4L99A 4XQWA 2ZGTA 5BPXA 1H8TC 1XYNA 2ARBA 2VOVA 4AI8A 4E4ZA 4CDWB 4FPHA 4YW1A 1BZWA 1UCXA 2VNGA 3NAPC 3AZZA 5GKAC 4N53B 1COV2 3PTYA 3CNAA 4YARA 3D4KA 3WG1A 2G9GA 3ALQA 3AX4A 4RGGA 5F5QA 2VMHA 2QDRA 1CGPA 1LJ7A 5DXDA 4G3YC 2WS91 5FQ0A 2VNRA 1J3QA 2C1FA 3HT1A 4XEZA 1WW7A 4WVZA 1MQTA 1H1IA 2VG9A 3K51A 2Y26A 3MFCA 2QUOA 3AJZA 4PDWA 4ASLA 1I1EA 4CEYB 1UPSA 2SBAA 4YYOA 1D0HA 1RUC3 2VQ0A 5CVRA 1F8VA 1GZWA 2R042 1PK6A 1OPMA 2I74A 4H7MA 4Q4W3 1CAWA 3AYDA 3THTA 1S0CA 1RMU2 4FOQA 1AR62 3KZ4C 5KHHA 4Z1VA 3ZVXA 1HRI2 1PGL2 4WZCA 2Z79A 5CA6A 4CDQA 1H9PA 1YI9A 2ILMA 4IV3B 3RYKA 3CL1A 1J3RA 1PGW1 3VBFC 2B46X 3B94A 2VUJA 4XJ9A 4AEMA 2NN8A 3KLSA 5K9YA 1MVQA 2Y38A 4Q0VA 3E5UA 2P34A 1QQP1 5KC5A 1H4GA 2WNVA 2WJSA 4XFCA 4SLIA 1LU2A 1EYBA 1NY72 4AEDB 1RUC1 1FI2A 4GH4B 3ZXGA 5KBFA 2H6CA 2B42B 4FPJA 1UN1A 4Q4W1 1N1YA 1LR5A 2ES3A 4XFHA 4EN9B 4JGZC 4YW3A 2NLRA 3MIDA 3GBGA 5CFCB 5JOZA 1V6JA 3DPRB 1B35C 5GLZA 5GZFA 1NXD1 5BNOB 5JR7B 2YGLA 1O4ZA 1H8TB 2PLV3 4O9EA 2DFBA 4MGKE 2C0ZA 2EXHA 4P5HA 3NAPB 2IZWA 4FT8A 1HRV2 1HDKA 1EPWA 3PMEA 4XXAA 3UJQA 3J4UH 4OVEA 1RUD2 2X5IA 3MYXA 4B7KA 1F5FA 1QJY3 5JZGA 1FMD2 5JOWA 4YFWA 2TUNA 2GC3A 3ILRA 4R9BA 3VDDA 4K20A 4MH0E 2XHKA 3WCSA 2A3YA 4PBOA 1OLRA 3WR0A 2HKXA 5AVAA 3ZXKA 4LBJA 1ENXA 3K48A 4M3CE 4Y24A 1WUVA 4BPZA 1D2QA 3P3NA 1RUH3 1LU1A 1AR73 1SBEA 2BUKA 4MGIE 5BV6A 2PLV1 2ZA9A 3KGLA 2VW1A 3AXDA 4Q0SA 5C6CA 4ISRA 5KXDA 4LULA 3VBUA 4XOGA 4QPIA 1ZX5A 2EF6A 1IZ3A 2WA3A 4LA2A 1NA1A 3VBFB 3FE5A 1QJY1 4DOUA 1D4VB 4OFGA 2GNDA 1W6MA 1LESA 4R4ZA 1EY2A 4XF3A 4E2GA 1G8WA 5JCTA 4JVAA 3H1MA 4XTPA 2QDNA 3JUUA 4PLOA 1KD7A 3O0XA 1QH7A 4V1PA 2EA7A 3WXPA 4PJYA 3ZFGA 5C8WA 3LA2A 5D8AC 5C8CB 4GMP1 1HIXA 4QGNA 4L11A 3RMYA 1BQPA 4M3CF 2JEMA 1JH5A 1AF9A 1GSLA 4HKWA 4BYYA 4N43C 3NW4A 2PYTA 2XL9A 4XJUA 2CAVA 1CESA 4JGZB 5FCCA 3WW3A 4DZGA 5FO8B 3MLLA 5FOJB 1B35B 2XUMA 4H14A 2ZX4A 2WNUA 4QGMA 4B29A 5IK8A 2AR6A 4QHBA 1WW4A 3H3ZA 1OKQA 3VN4A 2XVLA 4P9LA 1ZRDA 1ASJ2 4KWJA 1V00A 4KL1A 3M3OA 1MS1A 2PN5A 2ZZQA 2RS11 3GZUC 4MLOA 3IDEA 1VRH2 2DTYA 3ZDSA 4XFFA 4IV1C 3VKMA 2RM22 1GANA 3POSA 1CAUB 2O8OA 5AC93 2K9ZA 3VBSC 3AJYA 4LE4A 5FLJA 5FTTC 3B9IA 4ORFA 3WQ1A 3ZFFC 4JAAA 2A70A 2GMMA 1RHI3 2D98A 4CDXA 1DQ0A 3PHMA 2D6MA 4FSJA 4EN0A 5JOXA 5FMOL 4RQPB 5J98B 5F9TA 2Q1MA 1C4RA 1AYM2 2XGXA 4QT6A 3W9AA 1DZTA 1VAKA 3R4DB 3SITA 4DY3A 2ZABA 4CP2A 5J37A 3B7MA 1SLAA 4N53A 4WM8A 2DVDA 5JWPA 1Y43B 2MPFA 1GICA 3HIFA 2V5YA 3JD71 5LK5A 2CGOA 4XQDA 4RR3C 2BNNA 3ATGA 3ECQA 4YG3A 4AQSA 3JU9A 5AC91 4UW6A 4PIXA 3RDIA 2CWMA 4OHYA 4JDMA 1RINA 2D6PA 2TBVA 1CQ9A 2VH9A 2UY8A 4CEYA 2VECA 3NVCA 4UBHA 5L7OB 1VLNA 5D8AB 3WD5A 4ONUA 3TAYA 4IEYA 1OA2A 1RHI1 2ZX1A 3WQ7A 5GZGA 4BA6A 3R6SA 2EALA 4FXGB 4N43B 3H50A 3MIEA 2BW8A 1GNHA 5GZEA 1SDWA 3VBOA 2BBVA 1TMF3 5SV5A 1YFWA 4NPRA 2GDFA 1RUF2 2ATFA 1BEV2 4AFMA 1CN1A 4P9IA 1O3RA 1NLSA 3U4XA 2JX9A 3SNMA 5L36A 2I07B 2ZHKA 2HWC2 4FVVA 5E8AA 3U07A 4DY5A 4IV1B 3HT2A 3WY6A 3CF6E 4D7TA 2YV8A 3ZYRA 4BCUA 1TME2 5FLHA 1ZA4A 2MHFA 1AJOA 4Y22B 1KFUL 2VPVA 1V6LA 1DU3D 2DU1A 3VZKA 2MEV3 4L9BA 1FT9A 1UU6A 2IXKA 4BZ4A 3VZNA 1GQGA 3IT8A 1OQDA 3DPRA 4Y5Z0 4URTA 4DINB 1Q5OA 2OUJA 3NV3A 2R062 1M4WA 3SH5A 3FX3A 5I0UA 1DIWA 4TYSA 1SQ4A 4CRQA 4A7ZA 2D3PA 4UW4A 3EJKA 3CJIB 3MW4A 1NCRC 4XF0A 1WCDJ 3NAPA 1GFF2 1HXS2 5F6LB 4KU7A 1DQ6A 1MZEA 5C9AC 2LTNA 2AGSA 3GALA 5JSOA 1PO23 4UBGA 1VB2A 2XL7A 4OUSA 1YI7A 1F5JA 1DLLA 4RR3B 2Y0OA 5T54A 4RHV3 3VKLA 2GSYA 5BNNA 3R05A 4WVMB 2WZR2 2LM3A 4WV8A 3VGIA 1MS0A 2FMDA 3RPQA 5GLWA 3MF9A 1LCLA 1TQ5A 2OUHA 2P17A 5EYXA 1MEC3 1PIV1 1LB2A 2VMGA 1AR93 3Q9OA 4NR1A 5BNPA 3B02A 4FTSA 3PNAA 3B3QE 1N1TA 1EAH2 3ZIWA 5LRSA 4HVQA 2BQPA 1PO13 4QXKA 4XQ4A 1S2KA 1AR83 1GQHA 3ZYIB 1SLBA 4FPLA 1FV2A 2IXJA 1N1SA 4FO9A 4XFBA 3MF6A 1BMV1 1NLRA 3OYWB 4YG0A 3S30A 4YZ2A 3MI8A 2Z5WA 2R16A 1VAMA 1OD5A 4XE9A 1PO21 2ZMLA 4LE3A 1X50A 4W65A 4Z92B 2JXAA 3NJZA 3H1WA 5KWRA 2ZX3A 2WWSA 4AEKA 2R0FA 1AX2A 4D7YA 2PHXA 4RHV1 5HCF