4LBKA

Crystal structure of human galectin-3 crd k176l mutant in complex with lnnt
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
138
structure length
138
Chain Sequence
MLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTLLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-3
publication title Galectin-3 interactions with glycosphingolipids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 35
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4lbkA00
4DPNA 1LOFA 2AR6A 4P9XA 1V6NA 2ZMLA 1CIWA 1A78A 1LEDA 5EYYA 4DFSA 1BQPA 1KDMA 1QKQA 1G9CA 2R1BA 4XBQA 4RA0A 1YIFA 3FFZA 1UX6A 4BLIA 4K1YA 5FREA 2VW0A 1W0OA 4TZDA 3AK0A 1W6MA 1WD4A 2JKBA 5JOXA 1KJRA 1ZA4A 3FUQA 3N36A 2D43A 2WKKA 3NV3A 5F5QA 4YZ5A 3HMYA 3SNMA 2JD4A 2CL2A 4K20A 3SH4A 2ZGUA 1O4ZA 4LBQD 5DZFA 4HL0A 4YM0A 4AWDA 5T5LA 1IKQA 1YRZA 2GNBA 2WSVA 2HYKA 2EXIA 3IM0A 1DQ2A 4AGVA 4XE9A 4Q2FA 1SLBA 3AP6A 4GKXA 5JOYA 4FOYA 2R0FA 3ILNA 3IPVB 2ARBA 1UMZA 3WHTA 5IK5A 3BODA 3WV6A 4Q1RA 1WW6A 4FP3A 2G4IA 2Q5TA 1LOBA 4LBMA 1DBNA 4C1WA 2H0BA 1V6LA 4YFWA 1QOTA 2DV9A 3VV1A 3ATGA 1SLCA 1WBFA 1HKDA 2OUHA 3V0AA 1LHVA 1SFYA 1ENRA 1LHOA 1DQ5A 1UPSA 3POYA 3WLUA 1NXD1 1UN1A 4BMBA 2AYHA 1N1YA 1SACA 2ZHLA 4FPGA 5H9SA 5EYXA 2EXHA 4Z8BA 1LENA 2YZ4A 4FQ4A 3PJQA 2ZAAA 4Y1UA 1RITA 1IS4A 1G9FA 1BYHA 1UZZA 2D6LX 2A70A 3IMNA 2UWBA 4P9YA 5EWSA 3AJYA 1LOCA 2PHXA 2ZMKA 3O0XA 4BM8A 1W6MB 4YGBA 5JLVA 2VW1A 1U0AA 4XHBA 2A3YA 5L73A 2ZGNA 1MS3A 1CVNA 3I8TA 4M3CF 3WZ1A 5E89A 2EIGA 5GALA 1SLLA 2WNEA 4YG6A 3RS6A 3V0BB 2AUYA 3WCRA 2I2SA 3AZXA 3ZPYA 4Y1YA 1W6NA 4BPZA 3UJQA 2DWRA 1GV9A 1X50A 1MS5A 2V5YA 5KXCA 4KBBA 4WVWA 5GLZA 3QLQA 3ZSJA 3FUOA 3VUOA 1Q8VA 1QDCA 1YO8A 2A71A 1Y7BA 2CYFA 3BOPA 4Y1XA 1CPMA 5DUVA 3OBTA 5GZEA 5T5PA 1SCRA 3AP5A 3I4IA 3IN9A 1LGNA 2ZHMA 3RRDA 5IUQA 4DS0A 4LBLA 1J1TA 4YGCA 4FPCA 4AGRA 3V0AB 1MR5A 3GALA 1DYKA 1S1AA 2GMPA 4U36A 2W52A 4XBLA 4XZPA 4YM2A 2P2KA 1G9DA 1UL9A 2VU9A 4MYEA 2ERFA 4CZSA 1N1SA 3TAYA 4Y1ZA 1D0HA 2D6NA 5CNAA 2C9AA 4YZ3A 1GNHA 3FLRA 5GJ6A 3VKMA 1ULDA 4YGEA 4R9CA 2A75A 3MPPG 3WG1A 3BIWE 1YXWA 2DVFA 1Z78A 1IS5A 3V0BA 5JOWA 4FPFA 2P3IA 1AX2A 2EAKA 1KITA 1S0DA 2ZA9A 2DU1A 3B3QE 3POWA 3PVEA 4WV8A 4XILA 4BMEA 1AZDA 5AVAA 4R9DA 1AF9A 2A6YA 3B9CA 3H0OA 5CB7A 1DFQA 3N7KA 3PVOA 1JOJA 2LALA 3MEPA 4YW3A 1WLDA 1SLTA 2CY6A 1LOEA 2P3JA 4XTMA 1LEMA 3A4UA 2FHRA 1W6NB 2ZGRA 3W59A 4SLIA 2D6MA 2A6ZA 3M3CA 4XMAA 1F31A 5E88A 1Q8PA 4ISRA 4D69A 5E8AA 1S0CA 1WD3A 4K21A 3M3EA 3N7LA 4W65A 4JC1A 3B01A 4P9WA 1IKPA 2RHPA 1N1VA 5H9PA 4BOWA 3NV4A 1IOAA 1DLLA 2WJSA 3A0NA 3M2MA 2DU0A 5IK4A 4ZKTB 2ZZJA 2CWSA 1LHUA 1FATA 2JE7A 4Q27A 2OVUA 2ENRA 3ILRA 2SBAA 1GSLA 1YI7A 4UW5A 3RQ0A 2R0HA 1DYPA 2ES3A 1A3KA 2DUQA 5T54A 2D6KA 3HN1A 3INAA 5H9RA 1JBCA 3T1MA 4YW5A 2ZABA 4FPLA 5KXEA 4XJ8A 2ZBJA 1DQ1A 4R9BA 1IS3A 4TYSA 1F5FA 3OPZA 3WG4A 1ZM1A 3WCSA 1S0GA 5JMCA 3OJBA 3OGGA 1JW6A 2AENA 4WVVA 3ZSMA 1H9PA 4HANA 1Q8QA 4XHXA 1LODA 2ZMNA 3KM5A 3D4KA 4YW1A 5GLUA 2ZHKA 1LECA 1HLCA 1Q56A 3WDYA 4P14A 1AJKA 3Q9OA 1QOSA 5F9TA 1MS0A 3AP7A 1FV2A 5EXOA 4BQ1A 3T1LA 3APBA 5SV8A 1LU2A 5GZCA 4LBJA 2A6XA 1LU1A 2WQZC 4GALA 4FPOB 4FPYA 2W68A 4XMIA 3RMYA 2UU8A 5GLVA 3AZVA 2A7AA 4XOGA 1SLIA 1UAIA 1S0BA 3PVNA 4FPEA 2GNTA 1V6JA 3AZZA 1A8DA 3NWKA 4FPKA 4PQ9A 4Q1PA 2DUOA 4AVVA 2GMEA 1CESA 5JVVA 1QF3A 3MW4A 3AYAA 1S0IA 3BTAA 4NO4A 3WOGA 3WUCA 2WSUA 5CBLA 4M3CA 3JU9A 2ZKNA 1WW7A 3DUIA 1BJQA 1BXHA 1QNWA 2NN8A 3VKOA 1I1EA 2VW2A 3A0KA 1GZWB 1GZCA 1JXNA 4H55A 3WNXA 4F83A 2EXKA 2PHRA 1DQ6A 1DIWA 1APNA 1WUVA 3B69A 3T2TA 1HQWA 4UW3A 1WLWA 2D3PA 2DVBA 4PCRA 5GZFA 5HCBA 4Y22A 4YG0A 2E53A 1SBEA 4XJZA 1FYUA 1MVQA 2DTYA 1KQRA 4XJUA 5IK7A 1PZ8A 1KDKA 2JECA 5JOZA 3FBYA 1I3HA 3O0WA 1AX0A 2ZGLA 1QDOA 4FVVA 4JRAA 5IK8A 1JHNA 3O12A 1MS1A 3AYCA 2CTVA 3USUA 1MZ5A 2GN3A 1DGLA 3HR9A 1QNYA 1GKBA 1D2SA 1LOGA 3R4UA 4FOVA 4GXLA 2A5ZA 4XIOA 1S0FA 2E7TA 4DRRA 1WBLA 4FOQA 4JCKA 2R49A 3CNAA 4WZFA 5T5OA 1AVBA 1CN1A 3C2UA 5DZEA 5T50A 3WDXA 1MS9A 4M3CB 2DVDA 1XQNA 4LBOA 1JN2P 2ZGTA 1HDKA 1VLNA 2YY1A 5CA6A 1ENSA 1VAMA 5H9QA 4XTPA 1F9KA 3UK9A 3ZXFA 3KQRA 4C1XA 1CJPA 1FNYA 2NP0A 1EPWA 2ZGQA 1ULFA 4YFZA 3WG2A 2W08A 2A3XA 4YG3A 4LBQA 2WLQA 1G9AA 1LULA 2PHUA 2SLIA 3AJZA 2GMMA 3ZSKA 1LOAA 2V73A 1V6OA 2P3KA 1UZYA 2NYYA 4Y22B 4CTEA 1FX5A 2ZGSA 5DUWA 1B09A 3L2YA 3WG3A 4LBKA 1O4YA 2ARXA 2GDFA 2A6VA 2NMNA 2ZGKA 2D3RA 4GWMA 4RL7A 3WVJA 2W39A 3D6EA 1YYNA 2A6WA 2D7FA 5GM0A 1V00A 5GZGA 3V64A 3LCPA 2P34A 4DRVA 2GNMA 2JE9A 1C57A 4GA9A 4DQAA 1ONAA 4NOTA 3USUB 2LTNA 2GALA 4M3CE 2OUJA 4YLZA 1OKQA 3ZSLA 3ZXJA 1QMJA 1RIRA 5DZGA 2DURA 3ZXEA 1W6QA 3SITA 3ZXKA 3M1HA 4M01A 4XJAA 4YGDA 5T5JA 3MW3A 4R9AA 1LGCA 1VALA 2ZGPA 4Y20A 1CONA 4XJ9A 4YM1A 1RINA 1LJ7A 1WW5A 3B00A 5CAZA 4AYUA 1N1TA 4FP2A 1H30A 2VUAA 3O0VA 1V6KA 4FPJA 1PZ7A 1Q8OA 4PF5A 3N3HA 1GZWA 2PHFA 2EXJA 1ENQA 4Q8LA 4XBNA 1N3PA 4Q26A 2R16A 3OYWA 3NV1A 4LBQB 1LHNA 3AXDA 1V6IA 2CNAA 4YZ1A 3AP9A 5IT6A 1KJLA 1GZ9A 3ZVXA 4ISQA 1W0PA 1GYKA 3W58A 3WHUA 3M3OA 4XJWA 1GANA 1GNZA 5GLWA 3M3QA 3UJOA 1W6PA 1S0EA 1QU0A 1UKGA 1G9BA 2DTWA 1C4RA 1CR7A 1MS8A 2UWAA 2FMDA 1OQ1A 5BYNA 3QCWA 4YM3A 4AVSA 3O5SA 4Q8KA 4XYXA 2NZ9A 2TEPA 2CWMA 2C5DA 1W6QB 5KXDA 5DUUA 1MACA 1W6OB 2DVAA 1LHWA 1ULGA 4L8QA 4XXPA 1BKZA 5DUXA 4YZ2A 5JDBA 1WW4A 4Y20B 1SBDA 2JJ6A 1AXKA 1CPNA 1HQLA 1QOOA 5GZDA 3MW2A 4ITCA 2YMZA 4UW4A 3AFKA 5DXDA 1DQ0A 3RSJA 2AREA 1G8WA 2UURA 2ZHNA 3POSA 4YZ4A 5HCFA 3WDUA 4FQZA 3OYWB 3IKWA 3SISA 1ULEA 4XXAA 2R1DA 2WT0A 4CRQA 3AYDA 4I30A 2D6PA 1SBFA 2D3SA 3OY8A 3ENRA 3VKNA 1C1FA 1G86A 1LGBA 1MZ6A 3U4XA 5DG2A 2BQPA 1N3OA 4ATEA 1GBGA 1AJOA 2GN7A 1W6PB 3ZYPA 3AP4A 1WLCA 4Y1VA 4YW4A 5T55A 2E7QA 2XB6C 2NM1A 2PELA 4GKYA 3UL2A 1TEIA 4OZXA 1JYCA 3AX4A 3FLTA 3RMXA 5DG1A 3WUDA 3WDVA 1S0JA 1Z0HA 4U2AA 1WCSA 1GLHA 4ATFA 4UW6A 3SLIA 3LSEA 3AYEA 2ZGOA 1LOFC 1PZ9A 2DUPA 1N3QA 3VKFC 1AX1A 1LCLA 2GNDA 3LSDA 2VXRA 4ASMB 1IS6A 3V65A 1R1ZA 1G7YA 2XG3A 1N47A 1V6MA 3VKLA 5T52A 4AGGA 3WDWA 5LK5A 1CQ9A 1FV3A 2YXSA 3RG0A 3ZXLA 5HCAA 2D6OX 2AH2A 1Q8SA 2A3WA 4FPHA 2WT1A 4GWNA 1MVEA 1JUIA 3N7JA 3OY8B 2PHWA 2AGSA 2JDZA 4LBNA 4Y26A 4YW2A 2B7YA 2D44A 4K1ZA 1SLAA 2DYCA 1AXYA 2ZACA 1GICA 1JYIA 2E51A 3GNEA 2EF6A 2PHTA 2YROA 3AZYA 1KRIA 4PBPA 3ASIA 3PMEA 3TB0A 3ZYRA 4FOWA 1FNZA 1QGLA 3OBRA 1DZQA 2Z42A 3FLPA 2DVGA 3AZWA 4PBOA 4Y24A 3D5OA 4XIKA 1FAYA 3JUUA 1BZWA 1LESA 3ILFA 3N7MA 4AVTA 1VAVA 2NMOA 3NV2A 5FRAA 4IQPA 4BLJA 1W6OA 4XDQA 3R4SA 5GLTA 1C1LA 3SH5A 3IPVA 1DQ4A 2YV8A 2KM2A 3SH3A 1NLSA 2ZGMA 3N35A 1ULCA 1H9WA 1MS4A 2WT2A 1SCSA 2EALA 3AXEA 2E6VA 1OFSA 4M00A 1LTEA 1DHKB 1URXA 3DGTA 2OW4A 2P37A 3R05A 1AXZA 2UWCA 2VH9A 3WDTA 4ZXKA 2VY0A 5KXBA 1VIWB
chains in the Genus database with same CATH superfamily
4MSVA 2QDRA 3LQCA 4DPNA 1REEA 2W47A 3NAPA 2VTFA 4Q4X1 4P9XA 1MEC1 5FZ3A 2Y0OA 3SQOA 1UNBA 3PUQA 2D93A 1PO23 4KG8A 5A70A 2W91A 2J7MA 3HJRA 4QXHA 2R1BA 1UXZA 4RA0A 4P5HA 4A7ZA 5JZGB 3J8F1 1UX6A 4BLIA 1UOBA 2RV9A 4L99A 1GNYA 2XJQA 2Z5WA 1D4M3 4XQWA 2IXJA 4D6SA 5JOXA 1KJRA 1ZA4A 3FUQA 4OYUA 1LNSA 2D43A 2WKKA 3NV3A 1NE6A 3FL7A 2JX9A 1BK0A 1JYWA 3GF6A 3HNBM 2VBBA 3V0BA 4IESA 4LBQD 3Q8BA 3PTRB 2BWAA 3CHXA 2WSVA 5T5LA 1GP5A 2HYKA 2EXIA 4Q2FA 1PNFA 4GKXA 4QB6A 4WVMB 5CADA 1XJAA 3IAQA 5K0UC 1QJY3 3UKNA 4RD7A 5IK5A 3BODA 4Q1RA 4EZ4A 4R4XA 5A3OA 4RHV1 1PM7A 1NY72 4BIOA 2Q5TA 1TMF1 3OF1A 5JUVA 5LA0A 1EAH3 2WQ8A 4QM8A 1V6LA 3U11A 1ND3C 2DV9A 2WZEA 4EN6B 4RGKA 5L7OC 1W2OA 4GH4A 1PMHX 4AVCA 4OFGA 1HKDA 5A3LA 4AFMA 1CAWB 1UPSA 2X10A 5F2WA 1VBE3 2YPJA 4RS5A 2AYHA 3NAPB 1R1A2 3DYMA 2J1AA 2R7EB 4ZS2A 3NJZA 2CAUA 3FJSA 5H9SA 4DXRA 3H8RA 5HXVA 2EXHA 2WFF1 3VLBB 1DP0A 2YZ4A 1DLCA 2ZX2A 3ORJA 1OQEA 3BUCA 2Y34A 4KGQA 1U5ZA 1RITA 4P9YA 2Y64A 3IMNA 3BU7A 1VBC3 3AJYA 4FAGA 2PHXA 1YNAA 2HWF2 2ZMKA 4Z1VA 5JLVA 3VD5A 1AR61 3C7EA 1RUH1 4AFAA 5L73A 2VTXJ 4QWNA 1PGL1 3EB7A 3I8TA 4I02A 4NN0A 3P1IA 3ACLA 1SLLA 1XYNA 1KFXL 3V0BB 2AUYA 3BPZA 1EV12 5F3EA 2RR11 1B35A 2B9UA 4XF1A 1W6NA 2DWRA 1GV9A 1X50A 1MS5A 2V5YA 2NPIA 4Q0QA 3JBG2 2WLPA 5CKMA 3PTYA 2A71A 1YO8A 3M8LA 2IVIB 3OBTA 5T5PA 1SCRA 4NRPA 3I4IA 3S5QA 4IE7A 2ZHMA 2RS32 3AMQA 2RDSA 5BXXA 4CDXC 4LBLA 4YGCA 1YQ8A 4FPCA 2WZR3 2HWD1 1FMD2 3RDIA 3ME2A 2OYZA 3F2ZA 1DYKA 1S1AA 2QQNA 3RGBA 4YM2A 1OMIA 1G9DA 1JMUB 4RS5B 5K7PA 3ZKYA 4AHXA 4HKWA 4Y1ZA 5F32A 1D0HA 4AHWA 4BA6A 1JZ6A 3AL6A 2ORZA 3ES1A 2D6NA 4M4PA 5CNAA 5KHKA 2C9AA 4R9CA 3U10A 3WG1A 1JYXA 2QQMA 3J26N 4QX8A 2R043 3FFQA 1YXWA 2DVFA 1AL0G 1PX3A 4HPKA 4IV3A 2O0OA 1AX2A 2EAKA 1KITA 4LE4A 1VBD2 2DU1A 2PQQA 2VGDA 2ZA9A 4XFAA 2W95A 1NQJA 2A6YA 3B9CA 3ACIA 3LFIA 3ZSEA 3N7KA 4FBFA 1RVF3 2ID4A 1YCIA 2V4AA 2P3JA 2WQ4A 3MEPA 1B35B 2FHRA 1W6NB 1V9U3 5JPMB 2Q8EA 3UT0A 1POV1 1R083 4ISRA 1RMU2 4D69A 1EPZA 3MIBA 2XMLA 5K8SA 5FYVA 3M3EA 2FCTA 2WWUA 1UYYA 4QKNA 2OIIA 5FUIA 1AR82 4P9WA 3UGFA 1QJEA 1FPN2 4OHXA 2RS13 4C91A 3ZYGA 2Y6HA 4P9LA 2XR4A 3M2MA 5DN2A 4LT5A 2DU0A 5LY1A 5IJRA 1LHUA 4MVTA 2OZJA 1FOD1 2VZVA 3VD3A 2OXBA 2WO7A 2OPKA 4Q27A 2CHHA 2ENRA 5IYYA 1K42A 3A21A 1QQP1 1WKYA 2WS93 5DAPA 2G9ZA 5FZOA 4XZUG 3RQ0A 4HKOA 5LA1A 2ES3A 3R0RA 1HIXA 3ZYHA 2ARCA 3INAA 1OLQA 2E9QA 4HPKB 4IV3B 4QB2A 2FZ2A 4X6RB 5KXEA 5FLHA 4JGYA 4E8CA 1DQ1A 2E63A 1NE4A 4AAXA 1GUIA 1O3TA 1LRHA 2WNOA 5I0UA 2X29A 3PURA 1MQTC 2QCSB 4YW1A 5GLUA 5E1RA 5L9RA 1HLCA 3GHNA 4N7IA 1VBB2 3WDYA 1KFUL 1M06G 3I2FA 5F9TA 2UY9A 2BW8A 1Y9QA 1ZZ7A 2VG9A 4BQ1A 3APBA 3PU8A 3LIGA 2Y38A 4E9KA 4K9SA 3ZFFC 3P5BA 1ZBE2 4KWJA 4URAA 3P3PA 4GALA 5L36A 3LEIA 4CP1A 4FPOB 4TN7A 1JYTA 2YC0A 2UU8A 3RMYA 1SLIA 1UAIA 3PNAA 3PVNA 4MH0E 1VPHA 1ZA7A 4QKDA 1PMJX 2JENA 3IZOA 2DUOA 1CESA 4UFIA 3MW4A 5FZOB 3TOJA 3H8XA 4Q0VA 5L7OA 4FXGB 1DU3D 4HN0A 3BGAA 4OMCA 2E33A 3WOGA 2WNUA 2XLFA 1QEXA 2XGXA 1WW7A 2E26A 3DUIA 1QNWA 4JGYB 5A3UA 3VDDC 4GMP3 3U0ZA 2VZ1A 2RJLA 3A0KA 3JD73 1ZRFA 3CJIC 1GZWB 1JXNA 2D97A 3QD6A 4UXAA 2YHJA 5T3NA 1DIWA 4O61A 3T2TA 3B69A 4W4ZA 2BNMA 3ALQA 5FZEA 2D3PA 3EQEA 1W8ZA 3DYOA 2DVBA 1OH3A 2YBSA 1HX6A 4BIFA 4OQ8A 5GZFA 2W2IA 1RUE3 4ZU4A 5FWJA 1SBEA 4NIGA 2WL1A 1W0NA 2DTYA 4W8JA 1H0BA 4AXOA 4DMIA 2PLV1 2Y26A 3DXUA 3WW3A 4CCDA 3RZHA 4XUQA 1HV0A 2R30A 4OMDA 1OXCA 3SCFA 5JXGA 3OTFA 5AC91 3O12A 1JS9A 4INDA 2CTVA 2GP3A 2QQVA 2JIGA 5C6CA 4OI2A 4Z07A 1Y9MA 5E6HA 2CV6A 3R4UA 3TWIA 1JZ2A 4IEYA 5FZ7A 3GZEA 5FUNA 4FTEA 3MPBA 4DRRA 4QXCA 1YWKA 3CDZB 4B1MA 1REFA 2JDAA 2WNUB 3K4DA 2EICA 5LATA 5CFCA 2PQSA 5B4XA 3RWKX 1VMJA 3ST7A 4MADA 1UKRA 1TVGA 2YY1A 3KS7A 4ZY9A 1ENSA 1VAMA 5H9QA 5CA6A 3ZXFA 3UK9A 2MNGA 3KQRA 5LEJA 4DY3A 1CJPA 4IEWA 2WZ8A 4HVRA 4C0HA 4MHRA 4I0WB 3WW2A 1PO13 1H2MA 1OFNA 1O3QA 1H1MA 4I01A 2VJXA 5A32A 1EUUA 2B39A 4CPBD 1LULA 4W50A 1NKGA 3AJZA 1RUF1 1UU5A 4W6WA 1QJY2 1FX5A 5DUWA 1BVP1 3L2YA 3IT8A 1I6XA 2BNNA 3KVAA 2FDGA 1EAH2 2NMNA 2O8OA 2MEV3 2ZGKA 1JHJA 4GWMA 4NPLA 4RL7A 1JOBA 1AYM1 1YYNA 5GM0A 3S7IA 3V64A 4NIHA 3LCPA 2XWJB 4IEZA 1VBA3 2CAVA 2GNMA 2JE9A 1C57A 2GH2A 3VBOA 5LEKA 4NOTA 2Y6KA 1P8JA 1VBE2 2XPJA 2RS53 4M3CE 5FY1A 2OUJA 3PLQA 3GM8A 4MGKE 1HB2A 1PVC1 2XVGA 1RIRA 5BNOC 2DURA 5FY4A 2DFBA 3MGUA 3URFA 4M4RA 1W39A 4XJAA 5KC6A 1WMFA 5FLIA 1XNDA 4OUMA 5C3RA 3H42B 2W87A 5CFCB 1UY4A 4Y20A 2HYXA 2QTWB 3UV9A 1JUHA 2RM22 1RINA 1LJ7A 1JU4A 3SCGA 4CE8A 4LLOA 5FY9A 2X5IA 1WMEA 1HRV1 1K45A 3O0VA 1DDLA 1PZ7A 2WA4A 4DO0A 4PI2A 2FDJA 3P3NA 1UMIA 4Q4V2 4XBNA 4YW7A 1Z7S2 1N3PA 2LW8A 3ZN6A 1WCDJ 3MO4A 1ZRRA 2QJVA 1QJX3 1RUC1 4XURA 2F4LA 5A32B 3RZZA 1A8MA 3AP9A 4NMIA 5D2AA 1UY1A 3VBUC 4JQRA 4QU2A 4B7EA 4F3JA 1U5XA 2P3YA 3B7MA 4LPLA 4XJWA 2GC2A 1QIQA 1IHMA 1GANA 3EMRA 3ZMNA 1BVVA 4XAEA 4XF4A 4GB31 1W06A 1UKGA 2WZR2 1MS8A 4WBBA 5ANQA 3VBOB 1VJ2A 5FV3A 1BEV3 4TWTA 3O7OA 4YM3A 4AVSA 3D8CA 1OLMA 1NCRA 1OUSA 1QJU3 1W04A 4XFFA 5ANNA 5J1XA 5A7SA 4LITA 2CWMA 2C5DA 3C8XA 5J96B 1RXGA 5IAXA 4YWAA 2IVJA 2DBIA 5DUXA 2HWB3 4L8QA 4DUXA 4LXLA 5JDBA 4Y20B 4DXTA 1SBDA 3TEYA 2DF7A 5JAXA 2JB4A 3W5MA 3O1VA 3IIIA 4DXSA 4CEYC 5ACA3 3K48A 5JSPA 2X5IB 4JKLA 1BMV1 3AFKA 1CJDA 1X8EA 2HWC1 4RN5A 5FZAA 1RVF2 3RSJA 4CDWA 1V9U2 3IKWA 5JPNB 1VR3A 1R082 3K75B 4HVOA 3VBRC 4PIXA 2PFWA 2QFEA 1UY3A 1WCKA 4CRQA 5A3PA 2D6PA 3ENRA 1C1FA 1O5LA 4YVWC 1ZRDA 4A7KA 1X7NA 1ZNPA 1N3OA 1BHGA 2BQPA 2ILMA 3CMGA 3PMSA 3VBSA 5FO9B 1AJOA 1ZYBA 4CCOA 3LE0A 3ZYPA 4OVEA 4BU2A 3AP4A 4E2QA 4OI4A 1RJ8A 4N43C 3IAPA 3T4HB 4CA9A 2PELA 1C8NA 1J3PA 4GKYA 2ZX4A 2VQ0A 4HT1T 1NCRB 4OZXA 5FPUA 2VMHA 5IVCA 1OKOA 4KWKA 3RMXA 1YQ6A 2WS92 5DG1A 3QBQA 4U2AA 1F15A 1NQDA 4LQRA 3LSEA 3KQ4B 4RR3C 5JSRA 1PZ9A 2V09A 1N3QA 1XU1A 3VZMA 2BUKA 1HRI3 3D0SA 4K8FA 3VGIA 4GULA 1XE7A 4L11A 4IV1A 1G7YA 4XFIA 1C8M3 1UY2A 3VKLA 4CDWB 1OF4A 5J48A 2RMU2 4JGZA 3ZFGC 2R071 5LK5A 5FZLA 3POBA 4B1LA 4YSFA 1OURA 2NQYA 3O1UA 1QJFA 2AH2A 3TRSB 1SDWA 2WT1A 1UOFA 5L9BA 3VZKA 4HZFA 2ZEXA 2CGNA 4S2HA 4OQ9A 1XU2A 4YW2A 2B7YA 4JKKA 4K1ZA 1SLAA 3VBSB 1BBT2 3BOWA 1H1IA 2E51A 2IXIA 3GNEA 3AL5A 4GZ9A 4QD2A 3RJRA 4BYYA 5M0TA 2XJPA 1DZQA 4JVAA 4MXWA 1RUG3 4B29A 5IVBA 4NVPA 4AZZA 4OZOA 4XIKA 3KCXA 5DPNA 1LESA 5FKBA 5B4NA 4AVTA 1UO9A 1XBFA 1XSQA 1D0GA 1UWWA 4LR4A 4MLOA 4IDZA 3IPVA 1DQ4A 2BRTA 2KM2A 1CZTA 2AZ5A 4Q0UA 1FT9A 1H9WA 1MS4A 1UOGA 2EALA 2WFF3 3AXEA 5FY8A 5DABA 2WABA 2VZSA 3PIJA 5FBJA 5BUVA 4IV1B 1W99A 3CO2A 2HWE2 2YGLA 1AXZA 2VH9A 4IE5A 4P9IA 4JGZB 4PDWA 4JTNA 4BQXA 4OULA 4QX7A 1POV0 3HAGA 4NAOA 2XWBB 5I8TA 1H8TC 2IXHA 2WNVA 1V6NA 2ZMLA 3AVSA 4AI2A 3S0MA 2OZ6A 4B7KA 1CZVA 2XLAA 1KDMA 1QKQA 3ZXAC 1G9CA 1E5IA 2WRAA 4Q4W3 2ZEWA 4XBQA 1SEFA 5DQ0A 5FXZA 4EYUA 4LA3A 4K1YA 1ASJ3 4TZDA 1W0OA 3NKGA 1W6MA 5F2SA 4NIAA 3KMHA 2QQKA 5FXWA 1IPSA 5F5QA 2VE1A 3ACGA 4KQ7A 2HEYF 4MXWB 1UQXA 3RZMA 3SNMA 2VOXA 2CL2A 2ZGUA 1O4ZA 2TUNA 3MDPA 1IKQA 4JDOA 3WNOA 3NMBA 2HJIA 4BWOA 2R6QA 3FWEA 3IMMA 4QB1A 1G6NA 1PGSA 2HWD3 2XQRA 4PQQA 3WEZA 3I2DA 4AGVA 1U5YA 5JOYA 1NAEA 3IPVB 3LA3A 3LD8A 4HMZA 5FP3A 4FP3A 3SCHA 1XNAA 4P00B 4XUPA 4XUOA 1QOTA 1UOJA 4YFWA 3U14A 2JDKA 4JDMA 2WYSA 1WBFA 4HSLA 4PDWB 3RZGA 1LHOA 1DQ5A 3POYA 4CEWC 1PO12 3MIGA 5C8CC 4ZU5A 4HOOA 2WNVB 1SZBA 1SACA 5A7PA 1J1LA 5EYXA 4QGLA 3OUHA 3VD7A 1LENA 1SG3A 3MI8A 4OHZA 5IW0A 5CFDA 1O8PA 2ZAAA 1TZOA 1G9FA 1BYHA 5FZ6A 1ZZ6A 2W1QA 3I3DA 4JTOA 1POV3 4FTBA 2J1VA 3EO6A 1W6MB 2C9KA 4XACA 4XHBA 1E5SA 4E4SA 1YJKA 1MS3A 1CVNA 3DPRC 2EIGA 1Q43A 3MV11 5FPVA 1NA1A 4LHNA 1AR92 5GALA 4AQSA 1AHSA 1EUTA 1HN1A 3WCRA 4COVA 5C9AA 1RC6A 3ZPYA 2RDQA 4Y1YA 3HT2A 3RI8A 5KXCA 4KBBA 3PU3A 3QLQA 4B8EA 1PK6A 1L3JA 3SEPA 5JR7B 3MBWA 1AYN3 2CYFA 2C4XA 1I9RA 3JCIA 2OT7A 3L9JT 5GZEA 5FR3A 3K46A 5C3QA 2X53S 5F6LB 1ND2C 5FYSA 4QKBA 4L92A 2ZZQA 5ABJA 3KHCA 3SC7X 4N90A 5KHIA 1UX7A 3I3BA 4XC9A 5CVRA 4AGRA 1IQAA 1SPPA 4ORFA 4U36A 4XBLA 4ZU7A 1TE1B 4A44A 4CZSA 2ERFA 5EPAA 3TAYA 2JDHA 4EWEA 1UU6A 3NRUA 3PUAA 5CFDB 3FLRA 1GFF2 3NNGA 5L9VA 3FBMA 2A75A 3VBHA 5JIUA 2WO2A 1Z78A 4YVSC 4EJRA 5JOWA 5EIYB 5AVAA 3D3AA 4BMEA 3TEXA 4WV8A 1AZDA 2GC3A 4LHLA 2Y6LA 4NHKA 2H6CA 1YQCA 2J1TA 4AEKA 4B4PA 1BEV2 1NA1B 4KGGA 3O1MA 2LALA 3UKTA 5C9AB 1SLTA 1WLDA 4LMFA 4XTMA 5BNPC 5DAVA 5IVVA 2ZGRA 2XBO2 3WXPA 3C3VA 4XMAA 4EN9B 5FJKA 2V5DA 2K2SA 4HBNA 2VNRA 1PK6B 3NJYA 4FFHA 3KB5A 2HWB2 2VZRA 4W65A 4UFMA 4JC1A 3B01A 4IE4A 5AFBA 2KXLA 5FXVA 3BU0A 5LB6A 3NSTA 4XVHA 5ACA2 4AEMA 2WUHA 5H9PA 2DCKA 2OKXA 4BOWA 5ABJB 3VD9A 2WJSA 2TBVA 5C3SA 3E5QA 1UPIA 5IK4A 4BQ2A 4DEVA 1CZSA 5JI7A 5FZHA 3IDCB 2ZZJA 2QQUA 4ZKTB 4UI9L 1GMMA 4QT6A 4QX3A 2B9VA 3ZFFB 5APAA 2SBAA 5FP4A 3ELNA 1YI7A 4UW5A 4HK9A 4XABA 2R0HA 1DYPA 3BVCA 3VBHB 1POQA 1AR73 1R093 2Q1ZB 5T54A 2FDIA 2OQ6A 5A6XA 4AI0A 4JX0A 2B46X 2ZABA 4UFKA 5LY2A 4FPLA 3WNMA 5JXHA 1GWMA 2VO5A 2ZBJA 4E27A 2ZAHA 3ZYBA 4QPGC 1IQDC 4LLFA 2N7GA 1GWKA 3OJBA 3OGGA 3H1WA 4WVVA 1VMHA 1S55A 1Q8QA 3DECA 3M4FA 1VB2A 2ZMNA 3KM5A 3T2OA 4EN7B 2ZHKA 1NY71 1HV1A 3IDEA 3BI3A 3LOBA 4IEUA 5E16A 1AJKA 2XHNA 4QPIA 2K9ZA 3T1LA 3LPFA 3LZZA 3LPGA 4HETA 1HRI2 4I0AA 4LBJA 5FZCA 2C26A 5LZ6A 1R1A1 4GWJA 1C8M2 4XMIA 2JG8A 3ZYFA 5C7GA 4GAZA 3AZVA 2A7AA 5FYMA 1EP0A 1RB8G 4K3UA 3O1TA 3PIGA 1V6JA 3JXSA 4LOTA 2F4PA 4QGMA 4E2GA 4KI5M 2HWF1 4N53A 1H6YA 3AYAA 3ETPA 1S0IA 3VBFC 4JHTA 5FP7A 3HBKA 1IPJA 2ZKNA 1EV11 5A3MA 2DDUA 3VHNA 4JZRA 1PIV3 4NR1A 3VZJA 3ZFEC 3Q8FA 2VW2A 1RUG2 4M0HA 4XQ4A 5FYHA 3N4MA 4CU6A 3JBG1 4H55A 2EXKA 3VD4A 4ARXA 2PHRA 1DQ6A 2BZDA 2ZCWA 1APNA 2J1EA 3I54A 2V72A 3BKZA 4UW3A 4TLGA 4AOCA 2R063 1RTVA 4AQ6A 2UYBA 2RS31 3H50A 1S2EA 5F5CA 4LK6A 1RUJ3 4WZCA 4QPIB 2JG9A 2E53A 4YG0A 1MVQA 1FMD1 1D2QA 3MV01 3HVDA 1YFXA 1PVC3 4XJUA 1PZ8A 2QZ2A 5LBFA 1HXS3 5JOZA 1RUI3 1I3HA 3VZLA 3ON7A 3WNKA 4IXLA 4FVVA 2JG8B 3PUSA 4JRAA 5CYYA 5EJ3A 1JHNA 5F8PA 3IDBB 5D8AC 2IWGB 5BV6A 1AL23 3LOIA 4IERA 3USUA 1BLZA 2VUJA 1MZ5A 2GN3A 1QNYA 1C3HA 2IXKA 3ACHA 5IAVA 4BB3A 1HRV3 2W46A 4N53B 2A5ZA 2IXCA 1WGPA 1WBLA 4JCKA 5SV5A 1VBD1 3CNAA 4XDPA 2ORXA 1AVBA 4H3WA 1CN1A 4Q4W2 5FZMA 3C2UA 1XPWA 3ZYJB 2ARAA 1ASJ2 1MS9A 2W94A 3C7OA 2DVDA 1XQNA 4LEJA 1D4VB 2ZX0A 1IZ3A 2ZGTA 4I09A 4LBOA 1GOHA 1HDKA 2XL9A 1VLNA 4A6SA 3SKJE 2WBKA 3S57A 1W8FA 5C33A 5FXXA 4YRDA 1FNYA 1RMU1 3KHBA 4WM8C 2MPFA 2DCJA 2VNGA 2ZX1A 3OUIA 4YFZA 2Y0IA 4IE6A 2XVKA 1AR81 1C5HA 4AEDA 4LBQA 2VZPA 1FPN1 2WLQA 5FZ4A 4QKFA 3WNNA 4LTAA 1LOAA 4IEOA 1W8TA 3K77A 5FKCA 2JG9B 3FMGA 4CDQC 2ZGSA 4DZGA 3W5NA 4OHYA 1B09A 3I2JA 1RUD2 1O4YA 2ARXA 2F17A 2A6VA 5DAQA 2RG4A 2Z69A 2EIBA 2W39A 4KU7A 2A6WA 2FDHA 1V00A 4NJ4A 3Q8CA 2VZUA 4LE3A 1K5MA 4P9GA 3USUB 2ZJCA 2LTNA 1U5IA 1JOPA 2I45A 4P9JA 3H8OA 3ZSLA 1F5JA 1CAVA 1XOYA 1RXFA 1O6UA 1SQ4A 3K3NA 3WINE 2BWCA 1LGCA 1GQPA 1UY0A 1PGW2 1RGSA 4XJ9A 3DYPA 4YM1A 1YJLA 4NIDA 5BNNA 4AYUA 3Q8AA 4FPJA 4PF5A 3N3HA 1GZWA 1VBB1 2QNKA 1PMIA 2EXJA 3BN6A 3MF9A 4LORA 3TN91 2F6BA 2R16A 1STMA 2XQXA 4RYDA 5IVEA 4AEDB 4LBQB 3AXDA 1V6IA 2P1BA 2W5FA 1WA4A 3V56A 2D5FA 5IT6A 4F8AA 3RWNA 1AYN2 1H2KA 1ZBE1 1GZ9A 3TN92 3U4SA 3ZVXA 5I0RA 1GYKA 2XVLA 4OHWA 1ZZ8A 2P6CA 3M3OA 4MZUA 1O5UA 5FMBA 5GLWA 3I2HA 2O8QA 3UJOA 3PHMA 1XRUA 5CU1A 2QQJA 5FPXA 4AK3A 1X9TA 2DTWA 3RNSA 1C4RA 1KXGA 4MUVA 1UD1A 1K5MB 2FMDA 1OQ1A 1W9FA 2JWPA 5BYNA 3IB3A 1CAWA 1JZ7A 1FXZA 4QMAA 4XYXA 4Q0PA 1NCQC 2TEPA 1CAVB 2YB7A 4G3YC 4QPYA 3AB0A 3DKWA 1HB1A 4R52A 1ACCA 1S4CA 2ZOEB 1LHWA 1ULGA 3NNJA 4XXPA 5FYIA 2JJ6A 1OOPA 4V2WA 4DIQA 5BNNB 4EN8B 5GZDA 3VZNA 4I3GA 1ZZBA 1CWPA 3KCCA 5DXDA 5KR7A 4Y5TA 1NG0A 2CGOA 4ARYA 2UURA 5JZGC 1W8HA 2OQ7A 2WAAA 3QOPA 4RQPA 4EROA 3KCYA 4Q0SA 1DZRA 3DEMA 2PAEA 4FFGA 4Q4Y3 1WMDA 1COV3 5L19A 3T2PA 1OHFA 1MZ6A 5DG2A 3CBNA 1TME3 3N9PA 5FPBA 1OVPA 2VPVA 4I0BA 1ZRIA 2GN7A 2JDMA 2VL4A 4UT5A 3HIFA 4L9BA 4CXXA 5KHGA 3MYXA 4KMQA 1DGRA 2QQWA 3J7LA 4Y1VA 5T55A 1UW8A 3JB8A 1YEWA 2P4EA 2QBXA 3GZTB 3ETQA 1SMVA 3FLTA 4Y5Z0 1PO22 1DG6A 1S0JA 3CU7A 4UW6A 1JYNA 4LHSA 1HJFA 1R092 1OOPB 3AYEA 3HPNA 4EWDA 1D4M2 2NLRA 3MFCA 3NAPC 3N9QA 4QQOA 3VKFC 2PMWB 1LCLA 3LSDA 4LO8A 1L7RA 3WD5A 1NLQA 2VXRA 2YYOA 4ASMB 1IS6A 1JTZX 1R1ZA 3VHPA 1US3A 2XG3A 1QH6A 2XDVA 3WDWA 4PHZA 1S2BA 5BNQA 3RG0A 1FV3A 4AHYA 3ZXLA 4DB5A 5HCAA 1QJY1 4RQPB 5FZ1A 2D6OX 3N9LA 2A3WA 1W2TA 1MVEA 2W1WA 4GWNA 1EAH1 5JXJA 2K0GA 3USSA 4E4DX 5A7NA 2DCZA 2D44A 5FYCA 4CDUA 1OLME 4CU7A 1GICA 3ZLIA 1KD7A 1JYIA 2PHTA 1VBE1 3ASIA 3G7DA 3PMEA 3TB0A 4CP9A 3ZYRA 2WC2A 1OH4A 4FOWA 3LDKA 2Z42A 4JRLA 4C0BA 2BPA2 2RJKA 2VZOA 3AZWA 1ULOA 4PBOA 4Y24A 4Y3OA 1OI6A 4Y5SA 3U07A 1W28A 1FAYA 3JUUA 4EV0A 1EYBA 2ADDA 2PA7A 3ILFA 1VAVA 2RM21 4XW3A 4GH4C 3O1SA 4CCMA 1XNKA 4B4RA 4QHBA 3VHRA 3O1PA 4IQPA 2ET1A 1UZ0A 3IBMA 3SH5A 3SH3A 2Y60A 2QZ3A 1LKNA 1VBC2 4RS5C 3VB9A 3LGRA 5FY7A 4AI8A 1ULCA 2Q4SA 4Q4V1 4BXFA 1YIPA 2PYTA 1Z7S1 4BHPA 1OFSA 5FOBB 2JDUA 1PIV2 2UYAA 3LA2A 1URXA 3A22A 2P37A 3R05A 2UWCA 3WDTA 1H1AA 4ZXKA 4CP2A 1Y43B 2KR2A 1LOFA 4XAAA 5KHJA 3HEIA 3KZ4C 4DFSA 5B2GB 5EYYA 1A78A 1LEDA 4UAPA 5FMOS 1OPOA 3GCXA 5JCTA 1RUJ2 4PLNA 4MGIE 4UYBA 1DCSA 5EJZB 2WZR1 4A41A 5A7OA 3FFZA 1B35C 3POIA 4AF9A 4CDUB 5FIXA 1Y3TA 1HXS2 4IEXA 2VW0A 3GJBA 1RUI2 3AK0A 4ET7A 5FDBA 5LBEA 1WD4A 3B02A 4CP9B 5EV7A 3RVHA 1CD3G 3LF7A 3N36A 1WLTA 4YZ5A 4J1XA 3HMYA 3NKTA 1AL22 2JD4A 3HNMA 4AWDA 4AVAA 4WM7A 3GJAA 2GNBA 1VRH3 1ZBA3 4EQVA 1GOGA 1JZ4A 3POEA 4XE9A 5LW9A 4FOYA 2VULA 2R042 2ARBA 1UMZA 3U78A 4DUVA 1OF3A 4LJHA 4E8DA 1RVF1 4GD4A 2G4IA 3MFAA 2YPDA 2H0BA 3OCPA 1V9U1 5F37A 1X36A 1R081 3VV1A 3ATGA 2P17A 1UIKA 5FMOL 5A7WA 1O7FA 3V0AA 1LHVA 4O7XA 5FK7A 1ENRA 1GQHA 4LHKA 3OD0A 4LUMA 4XPVA 2VMEA 1CX1A 3K4ZA 4IV3C 1NXD1 1UN1A 3RZJA 3H7YA 2ZHLA 5GKAC 2RS11 4Z8BA 5DDJ3 5C4WA 3WT3A 1W2NA 2CDOA 1IS4A 2D6LX 1UZZA 4CPBA 1OVSA 1W9YA 2A70A 2BGPA 2UY8A 2WINB 3NJXA 4UOJA 5EWSA 5FZ9A 3M7AA 4EE2A 3O0XA 2AC1A 2DFCA 2RS12 2Q8DA 4V2VA 4BM8A 2W1SA 4BQWA 3G6JB 3HQRA 1UZVA 3H1YA 3P6BA 2J1UA 4META 4FI9A 3ZYIB 3WZ1A 4M3CF 3RS6A 2WS91 2WNEA 1O4TA 4FO9A 3QACA 2I2SA 4BZ4A 2A73B 2VQUA 3AZXA 2VCBA 4WM7B 4BPZA 2VBPA 3RYPA 3UJQA 4NWVA 3I2IA 4WVWA 2YC4A 4CUGA 5LCWL 3OBZA 4R4ZA 4BDVB 4MGYE 3FUOA 3UKVA 3ABZA 1RHI3 4JAAA 3O14A 2B42B 3WF1A 5DUVA 4AVBA 3HD8B 4OCTA 3AP5A 3IN9A 4Q4X3 2OX0A 1MEC3 1Y4WA 2RMU1 4NPRA 4UFLA 1XNTA 3KVBA 1A6CA 3GYDA 1J1TA 3POJA 5EP9A 5A7WB 3LDRA 2GZWA 2JB8A 3V0AB 1MR5A 3J8F3 1H2NA 5K0UA 4XZPA 4MYEA 1YHFA 4BH9A 1BBT1 4JGYC 5FY5A 4QDQA 3EJKA 3WNLA 4YZ3A 1ND3A 1GNHA 3NJVA 4QXKA 5GJ6A 3WF4A 1ULDA 2C6SA 3T09A 4MGSA 3SHRA 2W3JA 4D7SA 4XCBA 3ZX7A 3WF0A 1IS5A 5LA9A 2P3IA 3B3QE 3POWA 1S0DA 3PVEA 4XILA 5CG9A 2E31A 3SEEA 4QHOA 4R9DA 3VDCA 2CGPA 3I3MA 4KG0A 1DFQA 3PVOA 4YW3A 5C3OA 2CY6A 2AEYA 2TNFA 1LOEA 2ZTNA 4RHV3 1TMF3 2CSGA 2FQPA 5JXIA 2HLEA 4HVQA 4SLIA 2D6MA 3M3CA 3AKQA 1R1A3 1WMXA 1Q8PA 2B4KA 1JZ8A 3MF6A 5E8AA 3I2OA 5A3WA 5JIAA 3D0JA 2VMCA 3JZVA 4GMP1 5IVYA 4EN0A 2HWE1 3DV8A 4IETA 4IEVA 3C7FA 3GXUA 2VCAA 4I2OA 3POFA 5I8YA 2D5HA 1UZWA 2O1QA 1IKPA 1QHDA 1N1VA 2RHPA 2XHKA 3EYPA 1ULPA 3WNPA 3NV4A 1IOAA 5FK8A 1DLLA 1GU3A 3A0NA 1SDDB 3JD72 3OGRA 4HK8A 2H0VA 4QQHA 2WNUC 5TSWA 5K0UB 2CWSA 1QXPA 1RUE1 1F4AA 1AR63 4WVZA 1RUH3 4DXZA 4XFCA 2JDYA 2OVUA 2E7AA 1S2KA 3ILRA 3M70A 4Q4Y2 4AHZA 4CDXA 2Z79A 3H9AA 3ZN6B 1ND3B 5L7OB 4O9EA 5F39A 1W05A 1RUE2 2QUOA 3FN9A 2RR13 2XXZA 4MOAA 4QQ2A 1DGWX 1A3KA 2DUQA 2D6KA 3HN1A 4RGAA 4A7YA 4YW5A 3T4VA 5DAXA 4X8PA 5D21A 4M0NA 1V70A 3I97A 4XJ8A 5F3IA 3T3YA 4V1PA 5KHHA 4NAMA 3OPZA 3WG4A 2D98A 2YU2A 1ENXA 3KV4A 4BCUA 3KF5A 5JMCA 5FZ8A 1VP6A 2AENA 1VE0A 3ZSMA 3RZKA 3LKJA 1WCUA 2YFZA 1LODA 4XHXA 4AW7A 5JWPA 3WQ7A 1LECA 3ZO0B 5F7UA 4S2GA 4P14A 1YUDA 1VB4A 1QOSA 2DCYA 3B9IA 2ZPXA 3GCWA 1MS0A 2ZKLA 1FV2A 5EXOA 3WX5A 2RE9A 2YFUA 1LU2A 4YPJA 3ROUA 4KNCA 1FI2A 2A6XA 1PO11 1LU1A 2WQZC 2VAUA 3FX3A 2W68A 5FYBA 3MLKA 4OUSA 3BCWA 4IW3A 3FZ3A 5GLVA 2VQTA 2VNVA 4GJYA 4AEJA 4Z2WA 5CFCC 4NHYA 2GNTA 4L0PA 3GDBA 5FY0A 3QH6A 3HQUA 1A8DA 3AMMA 3NWKA 4CDXB 1CAXA 4AVVA 2GMEA 1W2UA 2KD7A 1RMU3 4B4QA 1IG0A 1ZX5A 4LKDA 4NO4A 5CG8A 1DF0A 3GZAA 3JQWA 3UGGA 3WUCA 2WSUA 4MGQA 5CBLA 1AR91 5DAWA 2MEV2 3VDBA 2RS51 4ZHNA 1BJQA 2W92A 5HI0A 1BXHA 3VKOA 1RJ7A 4L97A 4J1WA 1VBA2 4XDOA 4ES9A 3WNXA 2G9FA 2RS52 5A1FA 2BTVC 2VVDA 1WUVA 4AAPA 2C24A 1JYVA 4JV4A 1HQWA 4F7ZA 3NNFA 4CEYA 3K51A 3JB4C 3N9MA 2Q0AA 4HFSA 3VBOC 2YBPA 4NPMA 5LBBA 4HSJA 1T6BX 1UYXA 1FOD3 2JE8A 4XJZA 5FPZA 2JKXA 5C8WA 2WIIB 4OI1A 2VVFA 1KDKA 1QQP3 3VN4A 1MQTA 3FBYA 3OSDA 4AFDA 3CF6E 2ZGLA 5FPAA 5I0SA 1CIYA 1KS5A 5IK8A 3T08A 4GJZA 3AYCA 2IUWA 3THPA 1RUNA 4FXKB 4IE0A 1IGOA 1DGLA 1NXMA 1QJX2 1LOGA 1UYPA 2X5IC 3CKHA 2Y6FA 1CAXB 1YFUA 3HOBA 3J9SA 3OEBA 4FOVA 4N7UA 4PI0A 2E7TA 4XIOA 4ZONA 4DOUA 4FOQA 1X33A 4G9SB 5T5OA 1VBB3 4WZFA 3H3ZA 3PDQA 3Q8EA 5K4LA 3WP6A 5J3UA 5DZEA 3WDXA 1BEV1 4PF1A 5BPXA 4TTGA 1VAKA 2PTMA 2J42A 1EY2A 1JN2P 3AC0A 1W8WA 5EHDA 2XKPA 2XBO1 3HWJA 3OEAA 4HN1A 2BP6A 4Q5OA 2XH6A 1ODMA 4Z82A 4XTPA 1YLLA 3PJYA 2NP0A 3RI9A 2VVEA 2WAOA 1LAJA 2HWB1 4Y33A 2ZGQA 1QJU2 1VRH2 1ZBA2 3NW4A 3KV9A 4XFGA 2A3XA 4YG3A 4AI3A 5A1LA 1G9AA 4BQYA 5HCHA 2PHUA 2GMMA 5ACA1 2YBKA 2C1FA 2V73A 4IEPA 3CQOA 3VDDA 2BGCA 5LRRA 3ZIWA 3MLJA 3CJIA 1KS4A 1NCRC 2BU9A 1W03A 4LUKA 4CUBA 5IFTA 5IHRA 1C5IA 4LBKA 2W9XA 3WVJA 1K12A 1MQTB 2GDFA 2D3RA 1MZEA 1JU3A 2D7FA 5KC5A 1RL3A 2P34A 4DRVA 1A34A 3I2GA 4EWAA 3CLPA 4GA9A 3T30A 1GP6A 1ONAA 4KL1A 2Q8OA 2RDNA 1QY4A 4DQAA 2GALA 2GAUA 3UESA 3BTXA 4FSJA 4MX3A 1OT5A 5D1IA 1J58A 1OKQA 3ZXJA 4R8HA 1QMJA 2HEWF 2IFWA 3CJXA 3MIFA 1W6QA 4LKEA 4KU8A 2WYFA 5DDJ2 3ZXEA 2QQIA 4LK7A 3C7HA 3E5UA 3OPWA 4M01A 4YGDA 5F3GA 4CDWC 5T5JA 4LKSA 3ZR5A 1PHMA 4RSUA 3IIAA 2QQPA 2ZGPA 1NUKA 2VXJA 2OS2A 1H2LA 5A1AA 3B00A 1WW5A 5CAZA 2VMFA 1YQ5A 1NYWA 1N1TA 5FAXA 1H30A 3UGHA 1HN0A 1V6KA 1Q8OA 4ZPIA 4QPWA 4QU1A 4YYOA 3VBSC 1ENQA 2PLV3 2K46A 1NLRA 4CXYA 3NV1A 5F3CA 1LHNA 2CNAA 4YZ1A 2B45X 4CVUA 1HRI1 5AC93 1RHI2 3HN3A 3VDDB 4ISQA 1W0PA 2CDPA 3CJIB 1CAUA 1C8M1 2VCMA 2VOWA 4Q4X2 4DINB 2WA3A 1XSRA 1MEC2 3KF3A 1GNZA 2YUEA 3M3QA 1S0EA 5C5TA 3J7HA 5I0DA 2FCVA 2BBVA 1CR7A 2J22A 2UWAA 2VNOA 3GBGA 3J8F2 4PLMA 3WSOA 4BJ0A 2BBAA 2Q1FA 3QCWA 4MV2A 3O5SA 3ZMOA 4QQPA 4GWIA 4LULA 3AVRA 1W6QB 4IV1C 3VHOA 4LO6B 5KXDA 4MXVA 1XE8A 1MACA 2DVAA 1W6OB 1PVXA 3DN7A 4JGZC 4YZ2A 1BKZA 2LS6A 4CP0A 2BV4A 1RUG1 1AXKA 1CPNA 1HQLA 1HB4A 2ZXQA 3RFRA 1QOOA 2LM3A 3MW2A 4XUTA 3POGA 1RUF3 5BNOA 4UW4A 4P08A 5FYYA 2BYVE 5I0TA 2WWJA 4RHV2 1G8WA 1TMF2 5HCFA 2HH9A 3CZUA 5K9YA 1AYM3 3RYRA 1ULEA 3BYWA 2IC1A 4NE9A 4XXAA 2R1DA 2WT0A 3AYDA 4COWA 1SBFA 3OY8A 5FZKA 1W90A 1E57A 1OD3A 4QAWA 1R64A 5ISLA 1CAUB 5AVPA 2EIEA 4S2DA 1GBGA 2WFF2 4J25A 2RM23 3D82A 2FBEA 3FC0A 4NHMA 5KWRA 1UYZA 3WP3A 4RGGA 4YW4A 3ITQA 1K3IA 2RVAA 4FFIA 3VBUA 4AL9A 1UU4A 4GIQA 2FDFA 2NM1A 4D3WA 4XQDA 1Q3EA 3L2HA 5I8SA 3UL2A 4Q4V3 1TEIA 4Q4W1 1RUH2 1AR62 4Z92B 1PGL2 1Z7S3 5C70A 1H6XA 5HPOA 1ASJ1 3R6SA 4CCEA 4PT6A 3WDVA 5CZKA 3LEGA 1WCSA 1GLHA 2RR12 4PDWC 1TNRA 4IEQA 4N9IA 3SLIA 1OBNA 4XF0A 4CXWA 2ZGOA 4BE3A 1RUC3 2WNVC 4OI0A 4LO4B 3ZOIA 4ES8A 5BNOB 3U37A 4GH4B 4URTA 1V6MA 5T52A 1GOFA 4AGGA 2WO1A 2Q8CA 3TNQA 3W21A 2WDBA 1CQ9A 2YXSA 4COUA 4XFHA 4GB33 2XUEA 2HWD2 3GBWA 3KWVA 4FPHA 2G1MA 4AG4A 1RUD1 1F4HA 2RDRA 3OBAA 1WZXA 2G9GA 1JUIA 4K8RB 2Q30A 3OY8B 1NZCA 2PHWA 4FT8A 2AGSA 2JDZA 3I2KA 4JHZA 4Y26A 2XJUA 1ZRCA 1H4HA 2L9LA 3U1XA 4XEZA 2DYCA 1KEXA 1AXYA 3H7JA 2EF6A 2YROA 3BALA 3OPTA 1KRIA 3VBRA 4PBPA 3LFMA 1PNGA 3LEMA 3OBRA 3VBUB 2ZX3A 4LIUA 3FLPA 2DVGA 3ZM8A 4YVWA 3PUHA 2PN5A 3A23A 3AKTA 1WCQA 4H7MA 1PGW1 4HLTA 2HWC3 1W9WA 3N7MA 2NMOA 3NV2A 1O91A 4BLJA 1SFPA 4N43A 4CCCA 4YW6A 2YV8A 2ZGMA 3I59A 3WF2A 5FZ0A 2VCCA 2O14A 1GQGA 1SCSA 3DCQA 1HQNA 5EQUA 1LTEA 5FZIA 5CFDC 3O1OA 4DUWA 2JDPA 3BPSA 3TBDA 2JD9A 3DF0A 1J84A 1AYN1 3KLSA 2XJRA 4RR3A 3ZFFA 4KWUA 1H8VA 2AR6A 3AKPA 4CEYB 1CIWA 3TEWA 1BQPA 1NA1C 1UIJA 4GMP0 4IGQA 2MHFA 1FOD2 5C9AC 1IPKA 1YIFA 4ONUA 2XJTA 4KWLA 3FHIB 3BTZA 2PAMA 3WW4A 3ZFGA 1GZTA 5FREA 1QQP2 4CYDA 5IATA 2IFRA 4P5YA 3VBRB 2JKBA 3ZIXA 1PK6C 4X8NA 3LIHA 1GWLA 2ZEZA 5A3TA 4OLLA 2XUMA 2IXLA 4YVWB 3DL3A 3EXUA 3SH4A 4K20A 4LO7A 2RMU3 5DZFA 4HL0A 4YM0A 1O8SA 1YRZA 5I91A 4QQLA 4ZS3A 3BB6A 3IM0A 5ABJC 1DQ2A 1H4GA 5C4WB 1SLBA 3AP6A 4TXWA 4N43B 2R073 1W8UA 2R0FA 3ILNA 2GC1A 1BK1A 3WHTA 1D7PM 3I59B 3WV6A 3VZOA 1WW6A 1ZZ9A 1BBT3 5FP8A 4NRQA 4LBMA 4BK5A 1LOBA 3KD4A 1REDA 1DBNA 4N8MA 4C1WA 1ALYA 1AUYA 5AFEA 3UYJA 2ZS6B 3LA7A 5C3PA 4O65A 1SLCA 1MPXA 3VBHC 4CU9A 2OUHA 1XYPA 1SFYA 2WFPA 4JKMA 2FCUA 4J6GA 3ZDVA 5IWFA 4Q29A 4RR3B 2B5HA 3WLUA 4BMBA 2BGOA 3LDBA 2ADEA 1N1YA 1JZ3A 3EBRA 1W9TA 4FPGA 4P02B 3QH7A 3S30A 4AFCA 4D0QA 3HBZA 4D8MA 2JXAA 3MUY1 4FQ4A 2XL7A 3PJQA 4FFFA 2EVXA 4MGTA 3NL1A 4Y1UA 2UWBA 3ZFGB 3CZJA 5F6KA 3ZN4A 3VL9A 3WQ0A 5JR2A 1LOCA 2RJ2A 3E97A 4YGBA 3WF3A 2VW1A 1U0AA 2J1SA 1H8TA 2A3YA 2ZGNA 2PHLA 3HQXA 3ECQA 2VTXA 5E89A 2AACA 4YG6A 1PO21 2HWE3 2KA3A 4MO3M 4E2SA 3T0BA 3KGZA 4L2NA 2XLGA 1AR71 1R091 1OUXA 5BY5A 2VZQA 5GLZA 1D4M1 3ZSJA 2CU5A 1JI6A 4K40A 4RFT0 1PM4A 3ZN5A 3VUOA 1Q8VA 1QDCA 2VMDA 3BOPA 1Y7BA 4Y1XA 5A33A 1CPMA 1AR72 2OA2A 1QJZA 1LGNA 3I7DA 4LOSA 3RRDA 5DMYA 5IUQA 4DS0A 5I93A 1GR3A 3C7GA 4QHZA 5FZFA 4D6RA 1DZTA 5J7MA 1T6GC 2VZTA 2WO3A 3GALA 2PLV2 2GMPA 4LIVA 1OQDA 2LRPA 2W52A 3JQXA 2P2KA 4FCAA 4NIIA 1NZIA 1UL9A 2BEOA 2VU9A 3TEZA 1N1SA 3ZFEA 5J09A 2BOIA 4C90A 1UF2C 4CCJA 3E1F1 5AC92 2BJSA 3H1MA 3OD4A 3PL0A 3VKMA 4A3ZA 3HNYM 4SBVA 4YGEA 3PVBB 3MPPG 1OSGA 2C0ZA 3BIWE 4AR2A 1WWYA 3NQHA 4CEWA 2Q1MA 4MHUA 5C8CA 4FPFA 2BFUS 4LA2A 1H8TB 4IGPA 4K7JA 1O3RA 1I5PA 3WY6A 1AF9A 3H0OA 5CB7A 3WP5A 1RUOA 4D7TA 4QPIC 2EAAA 1JOJA 3MHZA 3OG2A 4CCLA 4UFJA 1LEMA 3A4UA 3DXTA 3S7EA 1M4WA 3OB8A 3W59A 2A6ZA 1VBC1 1F31A 2GP5A 5E88A 4PIZA 3AMHA 2JG8C 4HXCA 3UETA 3SXWA 1S0CA 1WD3A 4K21A 3RPQA 3DPRA 3N7LA 5A33B 1PIV1 1J59A 1X82A 1RUF2 2BDRA 3CIHA 4N53C 1T2XA 4FTSA 3ZDSA 4UFHA 2R061 3NNLA 3W20A 3I49A 1AR93 1HJGA 1TG7A 2B8MA 2JEMA 1RUJ1 3J7MA 4QXBA 1FATA 1AYM2 2J1RA 2JE7A 2LUWA 5FQ0A 1ND2A 2R062 3OGSA 4UWDA 1HXS1 2BFUL 3RZLA 1RUI1 3A7QA 5F5AA 3MZHA 1GSLA 1J83A 1VMFA 3AM2A 1W8NA 2VQAA 1HB3A 4UF0A 3BTYA 1XNCA 4ASKA 1PVC2 4G4FA 4CEWB 5H9RA 1JBCA 1AL21 2VOTA 5FZDA 3T1MA 5C8CB 1U12A 4R9BA 1F35A 3H8UA 1IS3A 4TYSA 1F5FA 2JG9C 2VUCA 3VDAA 1ZM1A 3WCSA 4CU8A 1YC61 1ODNA 1S0GA 3FHQA 1JW6A 2R041 4HONA 4YVSA 1E5HA 1H9PA 1HRV2 3H3UA 4HANA 3T0AA 3D4KA 4XUNA 1US2A 3W9AA 1RYYA 5LK7B 1Q56A 3Q9OA 2HBTA 2PXJA 3DPRB 3AP7A 2LROA 3MIHA 4KH9A 4HKLA 1OPMA 1RUC2 2I74A 2W1UA 3KSCA 5CIRA 5SV8A 5BNPA 5GZCA 5FYTA 2X8KA 5F5IA 4FPYA 4DNYA 2R32A 4IUGA 4NHLA 4CUAA 1UMHA 4PJYA 4QX0A 4XOGA 3GZUC 1S0BA 1W3XA 2Z4FA 1XB9A 3MUZ1 2BOJA 2PHDA 4FPEA 4GB32 4XF3A 3AZZA 2XBO3 1ND2B 5FQ0B 4COYA 4FPKA 4PQ9A 4Q1PA 4AQTA 5JVVA 3THTA 2P5BA 2XJVA 1QF3A 4Y4YA 3LEKA 3BTAA 1ZREA 4UF0B 4MGZE 2WR9A 2Y33A 1O3SA 3THDA 3OOXA 3AMNA 1XXNA 2Z2SB 4M3CA 4NRMA 3JU9A 5FPLA 4AEDC 2HKXA 2NN8A 4FAHA 2G19A 3WP4A 4H14A 2VZ3A 2WN2A 1I1EA 2FDKA 2BVBA 4COZA 5FOJB 1GZCA 4F83A 3K3OA 3ZXDA 2QQLA 1JZ5A 3KT7A 4YVSB 1BMV2 4AE2A 2HWC2 2XONA 4A6OA 1WLWA 3NVCA 2VM9A 4AQ2A 1DGWA 3MIDA 1K5MC 4PCRA 1SHWB 5HCBA 4Y22A 4QPGA 4K6BA 2E32A 2DCTA 1E5RA 1FYUA 2QQOA 1KQRA 1W3VA 2ET7A 4QGNA 5FWEA 4AI9A 5BNPB 5IK7A 5FO7B 2JECA 1XYOA 1LR5A 1AX0A 3O0WA 3NO8A 4LKFA 1QDOA 2ETEA 4PIYA 5EZWA 3AKSA 5G04L 3LB9A 4BQ5A 4RFRB 1MZFA 3THCA 3ZR6A 1MS1A 1YQ2A 4A42A 3B94A 1OA3A 3E6BA 5BNNC 3HR9A 3TNPB 3PUIA 2VOVA 1GKBA 1D2SA 5CKQA 4GXLA 3T2QA 3S5AA 1S0FA 1TQ5A 3K2OA 2R49A 4N9HA 2VOKA 1CGPA 2XKOA 4QX5A 2YC2A 4JDNA 4E4ZA 2H6BA 3OUJA 5T50A 2HEVF 4M3CB 4JQTA 2BVVA 2GSYA 1YFYA 1HW5A 1GP4A 5KBFA 3E5XA 1QWRA 3CEWA 3KT1A 1OLRA 4W6YA 2EA7A 1F9KA 3LAGA 2BNOA 4C1XA 5FO8B 3O1RA 2DBNA 4XCAA 3IDAA 3EHKA 1EPWA 4Y4RA 3VBFA 1ULFA 5A6YA 2PAKA 3WG2A 2W08A 3FHAA 3J7NA 4QDRA 1DYOA 3H3LA 1QXJA 2SLIA 2FMYA 4YNIA 3ZSKA 2R072 1V6OA 2P3KA 1UZYA 2NYYA 3FE5A 3I3QA 3KV6A 3OGVA 4QPGB 4Y22B 3SMHA 4CTEA 2IZWA 3JD71 3WG3A 5G05L 3T0DA 1F2NA 5CKNA 5JSOA 4IGOA 2HWF3 2VC9A 3D6EA 2GC0A 3I3EA 5GZGA 1L7QA 3AKRA 5JI9A 4A45A 4Q4Y1 5EJ1B 4ZXEA 4NWWA 1COV1 3J4UH 1OOPC 3OGJA 1EV13 5A6QA 1C28A 2JICA 4TSVA 4YLZA 5JMOA 2VD7A 5IVJA 1TME1 3AMPA 2VMIA 5DZGA 2EIDA 1COV2 4DEQA 3SITA 3JBG3 3ZXKA 3M1HA 3GGLA 3K4AA 5A6ZA 3MW3A 4R9AA 1VALA 2Y6JA 4GQ7A 3WQ1A 3X29B 5CISA 1TME2 1UCXA 1CONA 2Y6GA 4RQPC 2YDEA 5D8AA 5FJHA 4AFBA 4BQ4A 5FLJA 2RS33 5FYZA 3MLLA 2GU9A 4FP2A 2VUAA 1PX4A 1O59A 1I5ZA 1FMD3 2HBUA 3NNMA 3F95A 3KGLA 3VBFB 2PHFA 4Q8LA 1XC6A 4BK4A 3IWZA 4Q26A 3OYWA 2VECA 2A1XA 5LA2A 3MIEA 4NROA 3GHMA 3S6PA 1KJLA 3ZFEB 1UXXX 2XJSA 5FMDA 3W58A 3WHUA 4A4AA 2QE3A 2VMGA 4WM8A 1TNFA 3CL1A 1W6PA 4HG6B 4IL7A 1QU0A 1VBD3 4W6XA 1G9BA 1JODA 3HT1A 4QDSA 3MICA 1J3RA 4UBGA 5FBZA 2Y8KA 4CDQA 4CCKA 1L7LA 4Q8KA 2WZPP 2NZ9A 3ZKUA 3SKVA 4XETA 5LASA 4UBHA 1WA6X 2MEV1 5DUUA 3B5LB 1QH7A 2GH8A 1X8MA 1CX4A 1OC1A 4MG2A 4LNVA 3WQBA 1WW4A 1VBA1 3KT4A 5D8AB 3ZPOA 1AR83 1F8VA 2X05A 1K5JA 1RUD3 1FPN3 4KBZA 5LWBA 5FUPA 4ITCA 2YMZA 2YU1A 1DQ0A 3UNPA 3R4DB 1BCXA 2AREA 1Y9GA 2OPWA 1OA4A 2ZHNA 3POSA 4YZ4A 4CDUC 5CEHA 3WDUA 4FQZA 5FZBA 5HV4A 3OYWB 4CSWA 3SISA 1W2AX 3RJ2X 1W9SA 1XE0A 1ZVFA 5LRSA 5F1RA 5ERLA 4A3XA 5LBCA 4I30A 4D6QA 2D3SA 3VKNA 3GBFA 5J98B 3DKQA 1G86A 4BISA 1LGBA 3U4XA 4WM8B 2I07B 1IG3A 2YGMA 5FCCA 2WWSA 4ATEA 2QVSB 4CUCA 2YG0A 4DY5A 1NOVA 1W6PB 1YI9A 5A3NA 1OA2A 2QDNA 1WLCA 1QJX1 2D40A 2W0XA 5FFOC 2E7QA 5J37A 3VL8A 2XB6C 4CDQB 3WW1A 3B93A 5A7QA 5IVFA 4AI1A 4LO5B 1JYCA 3AX4A 1X9PA 2XOMA 5A80A 3WUDA 3ACFA 4ZZ8A 4OHVA 5FZGA 1Z0HA 2AEZA 4ATFA 1QXRA 3TN93 3LWCA 1LOFC 2DUPA 4H7LA 4E4HA 4H2AA 4XFBA 1W8OA 1AX1A 2GNDA 4NUBA 5FMCA 3RYKA 3ZXGA 2VBDA 1QJU1 1VRH1 1NCQA 1ZBA1 1ZBE3 2WN3A 4I3PA 3V65A 4ZZ5A 1N47A 4PLOA 4B3NA 2QKDA 4OUEA 2V4VA 4S2FA 3M3IA 4YARA 5EFUA 3E6CC 5FP9A 4Z2AA 1Q8SA 1XNBA 1V0AA 1VRBA 5HBAA 5HV0A 5J36A 3N7JA 4NHXA 4LBNA 2X09A 3U75A 4D94A 4WM7C 3KV5A 1DGRN 5JZGA 3TYJA 1OD5A 4QM9A 2ZACA 3WR0A 1LB2A 3AZYA 4A2UA 1JH5A 1ZZCA 4D7YA 4EZHA 5HXMA 5IFPA 1NX9A 2FZ1A 4C8DA 2JDNA 2ZEYA 4XF9A 1J3QA 1FNZA 1QGLA 3AFGA 4O9GA 5DDJ1 2VUDA 2BERA 4TLFA 4X6QB 3D5OA 2FD8A 2P6HA 5FTTC 4CCNA 1BZWA 2JIJA 5C5UA 1YFWA 5FRAA 4WVMA 3E6DA 1KGYA 1ST8A 1W6OA 3R4SA 1C1LA 4XDQA 5FYUA 5GLTA 1NLSA 3N35A 3ES4A 4BXSV 5C71A 1NT0A 2WT2A 4BQ3A 4QX2A 3BIEA 1NCQB 2E6VA 4M00A 1SFNA 1DHKB 5C4WC 4QX1A 1Q5OA 2ATFA 2OW4A 3DGTA 1SPPB 2VR4A 3N9OA 3N9NA 2VY0A 4ASLA 1RHI1 5KXBA 1VIWB
chains in the Genus database with same CATH topology
4MSVA 2QDRA 4DPNA 1REEA 4Q4X1 3NAPA 4P9XA 1MEC1 2Y0OA 2D93A 1PO23 4KG8A 2R1BA 4RA0A 4P5HA 4A7ZA 5JZGB 3J8F1 1UX6A 4BLIA 4L99A 2XJQA 2Z5WA 4XQWA 1D4M3 2IXJA 5JOXA 1KJRA 1ZA4A 3FUQA 2D43A 2WKKA 3NV3A 1NE6A 2JX9A 3V0BA 3GF6A 4IESA 4LBQD 5T5LA 2BWAA 2WSVA 2HYKA 2EXIA 4Q2FA 1PNFA 4GKXA 4WVMB 5CADA 5K0UC 1QJY3 3UKNA 4RD7A 5IK5A 3BODA 4Q1RA 4R4XA 4RHV1 1PM7A 1NY72 4BIOA 2Q5TA 1TMF1 3OF1A 1EAH3 4QM8A 1V6LA 3U11A 1ND3C 2DV9A 4EN6B 5L7OC 4GH4A 4AVCA 4OFGA 1HKDA 5A3LA 4AFMA 1CAWB 1UPSA 1VBE3 2YPJA 4RS5A 2AYHA 3NAPB 1R1A2 3NJZA 2CAUA 3FJSA 5H9SA 5HXVA 2EXHA 2WFF1 3VLBB 2YZ4A 2ZX2A 1OQEA 4KGQA 1U5ZA 1RITA 4P9YA 3IMNA 3BU7A 1VBC3 3AJYA 4FAGA 2PHXA 1YNAA 2HWF2 2ZMKA 4Z1VA 5JLVA 1AR61 1RUH1 4AFAA 5L73A 1PGL1 3I8TA 4I02A 4NN0A 3ACLA 1SLLA 1XYNA 1KFXL 3V0BB 2AUYA 3BPZA 1EV12 2RR11 1B35A 2B9UA 4XF1A 1W6NA 2DWRA 1GV9A 1X50A 1MS5A 2V5YA 2NPIA 4Q0QA 3JBG2 2WLPA 3PTYA 2A71A 1YO8A 3M8LA 3OBTA 5T5PA 1SCRA 3I4IA 2ZHMA 2RS32 3AMQA 5BXXA 4CDXC 4LBLA 4YGCA 4FPCA 2WZR3 2HWD1 1FMD2 3RDIA 3ME2A 2OYZA 1DYKA 1S1AA 4YM2A 1OMIA 1G9DA 4RS5B 4AHXA 4HKWA 4Y1ZA 4BA6A 1D0HA 4AHWA 5KHKA 3ES1A 2D6NA 5CNAA 2C9AA 4R9CA 3U10A 3WG1A 3J26N 2R043 3FFQA 1YXWA 2DVFA 1AL0G 4HPKA 4IV3A 2O0OA 1AX2A 2EAKA 1KITA 4LE4A 1VBD2 2DU1A 2PQQA 2VGDA 2ZA9A 1NQJA 2A6YA 3B9CA 3ZSEA 3N7KA 4FBFA 1RVF3 1YCIA 2WQ4A 2P3JA 3MEPA 1B35B 2FHRA 1W6NB 1V9U3 5JPMB 1POV1 1R083 4ISRA 1RMU2 4D69A 1EPZA 3MIBA 5K8SA 3M3EA 2OIIA 1AR82 4P9WA 1FPN2 4OHXA 2RS13 4C91A 3ZYGA 4P9LA 3M2MA 4LT5A 2DU0A 1LHUA 4MVTA 2OZJA 1FOD1 2OPKA 4Q27A 2ENRA 1QQP1 2WS93 3RQ0A 4HKOA 2ES3A 3R0RA 1HIXA 3INAA 1OLQA 2E9QA 4HPKB 4IV3B 2FZ2A 4X6RB 5KXEA 5FLHA 4JGYA 1DQ1A 2E63A 1NE4A 1O3TA 1LRHA 5I0UA 2X29A 1MQTC 2QCSB 4YW1A 5GLUA 5E1RA 1HLCA 3GHNA 4N7IA 1VBB2 3WDYA 1KFUL 1M06G 5F9TA 2UY9A 2BW8A 1Y9QA 1ZZ7A 2VG9A 4BQ1A 3APBA 2Y38A 4E9KA 4K9SA 3ZFFC 1ZBE2 4KWJA 5L36A 3P3PA 4GALA 4CP1A 4FPOB 2YC0A 2UU8A 3RMYA 1SLIA 1UAIA 3PNAA 3PVNA 4MH0E 2JENA 2DUOA 1CESA 3MW4A 3TOJA 4Q0VA 4FXGB 1DU3D 4HN0A 3WOGA 2WNUA 2XLFA 2XGXA 1WW7A 3DUIA 1QNWA 4JGYB 3VDDC 4GMP3 3U0ZA 2RJLA 3A0KA 3JD73 1ZRFA 3CJIC 1GZWB 1JXNA 2D97A 3QD6A 4UXAA 2YHJA 5T3NA 1DIWA 3T2TA 3B69A 2BNMA 3ALQA 2D3PA 3EQEA 2DVBA 1HX6A 4BIFA 5GZFA 1RUE3 4ZU4A 1SBEA 2WL1A 2DTYA 1H0BA 4AXOA 4DMIA 2PLV1 2Y26A 3WW3A 1HV0A 2R30A 3SCFA 3OTFA 5AC91 3O12A 4INDA 2CTVA 5C6CA 4OI2A 4Z07A 2CV6A 3R4UA 3TWIA 4IEYA 4FTEA 3MPBA 4DRRA 1YWKA 1REFA 2WNUB 5CFCA 3ST7A 1UKRA 3KS7A 2YY1A 5CA6A 1ENSA 1VAMA 5H9QA 3ZXFA 3UK9A 2MNGA 3KQRA 5LEJA 4DY3A 1CJPA 4IEWA 4HVRA 4C0HA 4I0WB 3WW2A 1PO13 1H2MA 1OFNA 1O3QA 1H1MA 4I01A 5A32A 2B39A 1LULA 3AJZA 1RUF1 1UU5A 4W6WA 1QJY2 1FX5A 5DUWA 1BVP1 3L2YA 3IT8A 1I6XA 2BNNA 1EAH2 2NMNA 2O8OA 2MEV3 2ZGKA 4GWMA 4RL7A 1YYNA 1AYM1 5GM0A 3S7IA 3V64A 3LCPA 2XWJB 4IEZA 1VBA3 2CAVA 2GNMA 2JE9A 1C57A 2GH2A 3VBOA 5LEKA 4NOTA 2XPJA 1VBE2 2RS53 4M3CE 2OUJA 3PLQA 4MGKE 1PVC1 2XVGA 1RIRA 5BNOC 2DURA 2DFBA 3MGUA 3URFA 1W39A 4XJAA 5KC6A 1WMFA 5FLIA 1XNDA 4OUMA 5CFCB 4Y20A 3UV9A 1JUHA 2RM22 1RINA 1LJ7A 3SCGA 4LLOA 2X5IA 1WMEA 1HRV1 3O0VA 1DDLA 1PZ7A 2WA4A 3P3NA 4Q4V2 4XBNA 1Z7S2 1N3PA 1WCDJ 1ZRRA 2QJVA 1QJX3 1RUC1 5A32B 3RZZA 1A8MA 3AP9A 3VBUC 4JQRA 4QU2A 4B7EA 4F3JA 1U5XA 3B7MA 4XJWA 2GC2A 1IHMA 1GANA 3ZMNA 1BVVA 4XF4A 4GB31 1UKGA 2WZR2 1MS8A 4WBBA 3VBOB 1VJ2A 1BEV3 4TWTA 3O7OA 4YM3A 4AVSA 3D8CA 1NCRA 1QJU3 4XFFA 2CWMA 2C5DA 5J96B 5DUXA 2HWB3 4L8QA 5JDBA 4Y20B 1SBDA 2DF7A 5JAXA 4CEYC 5ACA3 3K48A 5JSPA 2X5IB 1BMV1 3AFKA 1CJDA 1X8EA 2HWC1 1RVF2 3RSJA 4CDWA 1V9U2 3IKWA 5JPNB 1VR3A 1R082 4HVOA 3VBRC 4PIXA 2PFWA 2QFEA 1WCKA 4CRQA 2D6PA 3ENRA 1C1FA 1O5LA 4YVWC 1ZRDA 4A7KA 1X7NA 1ZNPA 1N3OA 2BQPA 2ILMA 3PMSA 3VBSA 5FO9B 1AJOA 1ZYBA 3ZYPA 4OVEA 3AP4A 4E2QA 4OI4A 1RJ8A 4N43C 2PELA 1C8NA 1J3PA 4GKYA 2ZX4A 2VQ0A 4HT1T 1NCRB 4OZXA 2VMHA 4KWKA 3RMXA 2WS92 5DG1A 3QBQA 4U2AA 1NQDA 3LSEA 4RR3C 5JSRA 1PZ9A 2V09A 1N3QA 1XU1A 3VZMA 2BUKA 1HRI3 3D0SA 4K8FA 3VGIA 4GULA 1XE7A 4L11A 4IV1A 1G7YA 4XFIA 1C8M3 3VKLA 4CDWB 5J48A 2RMU2 4JGZA 3ZFGC 2R071 5LK5A 4YSFA 2NQYA 2AH2A 3TRSB 1SDWA 2WT1A 3VZKA 4HZFA 2CGNA 4S2HA 1XU2A 4YW2A 2B7YA 4K1ZA 1SLAA 3VBSB 1BBT2 3BOWA 1H1IA 2E51A 2IXIA 3GNEA 4QD2A 3RJRA 4BYYA 2XJPA 1DZQA 4JVAA 4MXWA 1RUG3 4B29A 4NVPA 4XIKA 3KCXA 1LESA 4AVTA 1D0GA 4LR4A 4MLOA 3IPVA 1DQ4A 2KM2A 2AZ5A 4Q0UA 1FT9A 1H9WA 1MS4A 2EALA 2WFF3 3AXEA 5BUVA 4IV1B 3CO2A 2HWE2 2YGLA 1AXZA 2VH9A 4P9IA 4JGZB 4PDWA 4JTNA 4OULA 1POV0 3HAGA 2XWBB 5I8TA 1H8TC 2IXHA 2WNVA 1V6NA 2ZMLA 4AI2A 3S0MA 2OZ6A 4B7KA 2XLAA 1KDMA 1QKQA 3ZXAC 1G9CA 4Q4W3 4XBQA 1SEFA 4LA3A 4K1YA 1ASJ3 4TZDA 1W0OA 3NKGA 1W6MA 3KMHA 5F5QA 4KQ7A 2HEYF 4MXWB 3SNMA 2VOXA 2CL2A 2ZGUA 1O4ZA 2TUNA 3MDPA 1IKQA 4JDOA 2HJIA 4BWOA 2R6QA 3FWEA 1G6NA 1PGSA 2HWD3 4AGVA 3I2DA 1U5YA 5JOYA 3IPVB 3LA3A 4HMZA 3SCHA 4FP3A 4YFWA 1QOTA 4JDMA 1WBFA 4HSLA 4PDWB 1LHOA 1DQ5A 3POYA 4CEWC 1PO12 3MIGA 5C8CC 4ZU5A 2WNVB 1SACA 1J1LA 5EYXA 4QGLA 1LENA 3MI8A 4OHZA 5CFDA 2ZAAA 1G9FA 1BYHA 1ZZ6A 4JTOA 1POV3 4FTBA 3EO6A 1W6MB 4XHBA 4E4SA 1YJKA 1MS3A 1CVNA 3DPRC 2EIGA 1Q43A 5GALA 4AQSA 1NA1A 4LHNA 1AR92 1AHSA 4COVA 3WCRA 5C9AA 1RC6A 3ZPYA 4Y1YA 3HT2A 3RI8A 5KXCA 4KBBA 3QLQA 4B8EA 1PK6A 1L3JA 5JR7B 1AYN3 2CYFA 1I9RA 3JCIA 3L9JT 5GZEA 2X53S 5F6LB 1ND2C 4L92A 2ZZQA 5ABJA 4N90A 5KHIA 5CVRA 4AGRA 1IQAA 4ORFA 4U36A 4XBLA 4ZU7A 1TE1B 4CZSA 2ERFA 3TAYA 4EWEA 1UU6A 5CFDB 3FLRA 1GFF2 3FBMA 2A75A 3VBHA 5JIUA 1Z78A 4YVSC 4EJRA 5JOWA 5AVAA 4BMEA 4WV8A 1AZDA 2GC3A 4LHLA 4NHKA 2H6CA 4AEKA 4B4PA 1BEV2 1NA1B 4KGGA 2LALA 3UKTA 5C9AB 1SLTA 1WLDA 5BNPC 4XTMA 2ZGRA 2XBO2 3WXPA 3C3VA 4XMAA 4EN9B 2K2SA 4HBNA 2VNRA 1PK6B 3KB5A 2HWB2 4W65A 4JC1A 3B01A 5AFBA 2KXLA 3NSTA 5ACA2 4AEMA 5H9PA 2DCKA 4BOWA 5ABJB 2WJSA 2TBVA 3E5QA 1UPIA 5IK4A 5JI7A 4ZKTB 3IDCB 2ZZJA 4QT6A 3ZFFB 2SBAA 3ELNA 1YI7A 4UW5A 4HK9A 3VBHB 2R0HA 1DYPA 1AR73 1R093 2Q1ZB 5T54A 4AI0A 2B46X 2ZABA 4FPLA 2ZBJA 4E27A 2ZAHA 4QPGC 4LLFA 2N7GA 3OJBA 3OGGA 3H1WA 4WVVA 1S55A 1Q8QA 3M4FA 1VB2A 2ZMNA 3KM5A 4EN7B 2ZHKA 1NY71 1HV1A 3IDEA 3LOBA 4IEUA 5E16A 1AJKA 4QPIA 2K9ZA 3T1LA 3LZZA 4HETA 1HRI2 4I0AA 4LBJA 1R1A1 1C8M2 4XMIA 2JG8A 1RB8G 3AZVA 2A7AA 1EP0A 4K3UA 1V6JA 2F4PA 4QGMA 4E2GA 2HWF1 4N53A 3AYAA 1S0IA 3VBFC 1IPJA 2ZKNA 1EV11 5A3MA 3VHNA 3ZFEC 1PIV3 4NR1A 3VZJA 2VW2A 1RUG2 4M0HA 4XQ4A 3N4MA 3JBG1 4H55A 2EXKA 2PHRA 1DQ6A 3I54A 2ZCWA 1APNA 4UW3A 4AQ6A 2R063 1RTVA 2UYBA 2RS31 3H50A 1RUJ3 4WZCA 4QPIB 2JG9A 2E53A 4YG0A 1MVQA 1FMD1 1D2QA 1YFXA 1PVC3 4XJUA 1PZ8A 2QZ2A 1HXS3 5JOZA 1RUI3 1I3HA 3VZLA 4IXLA 4FVVA 2JG8B 4JRAA 5EJ3A 1JHNA 3IDBB 5D8AC 2IWGB 5BV6A 1AL23 3LOIA 4IERA 3USUA 2VUJA 1MZ5A 2GN3A 1QNYA 1C3HA 2IXKA 1HRV3 4N53B 2A5ZA 2IXCA 1WGPA 1WBLA 4JCKA 5SV5A 1VBD1 3CNAA 1AVBA 4H3WA 1CN1A 4Q4W2 3C2UA 3ZYJB 1ASJ2 1MS9A 2DVDA 1XQNA 4LEJA 1D4VB 2ZX0A 1IZ3A 2ZGTA 4I09A 4LBOA 1HDKA 2XL9A 1VLNA 5C33A 4YRDA 1FNYA 1RMU1 4WM8C 2MPFA 2DCJA 2VNGA 2ZX1A 4YFZA 2Y0IA 2XVKA 1AR81 1C5HA 4AEDA 4LBQA 1FPN1 2WLQA 4LTAA 1LOAA 4IEOA 4DZGA 4CDQC 2JG9B 3FMGA 2ZGSA 4OHYA 1B09A 1RUD2 1O4YA 2ARXA 2A6VA 2Z69A 2W39A 4KU7A 2A6WA 1V00A 4LE3A 1K5MA 4P9GA 3USUB 2ZJCA 2LTNA 1U5IA 2I45A 4P9JA 3ZSLA 1F5JA 1CAVA 1SQ4A 3WINE 2BWCA 1LGCA 1PGW2 1RGSA 4XJ9A 4YM1A 1YJLA 5BNNA 4AYUA 4FPJA 4PF5A 3N3HA 1GZWA 1VBB1 2QNKA 1PMIA 2EXJA 3MF9A 3TN91 2F6BA 2R16A 4AEDB 4LBQB 3AXDA 1V6IA 3V56A 1WA4A 2D5FA 5IT6A 4F8AA 3RWNA 1AYN2 1H2KA 1ZBE1 1GZ9A 3TN92 3ZVXA 5I0RA 1GYKA 2XVLA 4OHWA 1ZZ8A 3M3OA 4MZUA 1O5UA 5GLWA 2O8QA 3UJOA 3PHMA 1XRUA 5CU1A 4AK3A 2DTWA 3RNSA 1C4RA 1KXGA 4MUVA 1UD1A 1K5MB 2FMDA 1OQ1A 5BYNA 1CAWA 1FXZA 4QMAA 4XYXA 4Q0PA 1NCQC 2TEPA 1CAVB 4QPYA 4G3YC 3AB0A 3DKWA 4R52A 2ZOEB 1LHWA 1ULGA 4XXPA 2JJ6A 1OOPA 5BNNB 4EN8B 5GZDA 3VZNA 4I3GA 1ZZBA 3KCCA 5DXDA 1NG0A 2CGOA 2UURA 5JZGC 3QOPA