4U36A

Crystal structure of a seed lectin from vatairea macrocarpa complexed with tn-antigen
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
233
structure length
229
Chain Sequence
SEVVSFSFTKFNPNPKDIILQGDALVTSKGKLQLTKVKDGKPVDHSLGRALYAAPIHIWDDSTDRVASFATSFSFVVEAPDESKTADGIAFFLAPPDTQPQKDGGFLGLFNDIQTVAVEFDTFSNTWDPSARHIGINVNSIESMKYVKWGWENGKVANVYISYEASTKTLTASLTYPSNATSYIVSANVDLKSALPEWVRVGFSATSGLSRDHVETHDVLDWSFTSTLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Seed lectin
publication title High-resolution structure of a new Tn antigen-binding lectin from Vatairea macrocarpa and a comparative analysis of Tn-binding legume lectins.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 51
structure length 229
sequence length 233
ec nomenclature
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4u36A00
2ZKNA 2JJ6A 3OYWA 1F9KA 2A3WA 1UPSA 3IMNA 4LBJA 1FV2A 2KM2A 1KJLA 3USUA 1Q8VA 4XJ8A 4DS0A 3N36A 3O5SA 1QMJA 3SH5A 5H9SA 2R1BA 2A75A 4DPNA 1H9WA 2NM1A 1DQ1A 2ZGOA 3ZXLA 3NV3A 1CPMA 2C9AA 3BIWE 4Y1UA 4UW4A 1W6NB 2DVDA 4FOQA 5E8AA 4Y1VA 5GLZA 3V0BB 2R0HA 3C2UA 4W65A 4BMBA 2JKBA 4XJAA 5T5JA 5IUQA 3UJOA 1YIFA 1DQ6A 2PELA 4XXAA 2ZBJA 3HR9A 2ZA9A 1LHWA 3AP9A 2C5DA 1CQ9A 1LEDA 5CAZA 4RL7A 5JOXA 2VW2A 1D2SA 1JHNA 1MS8A 1CVNA 3R05A 1QGLA 4Q8LA 4FQZA 2WT0A 2JD4A 3M2MA 4HL0A 1FNYA 2GALA 2P3KA 2ZGSA 1FV3A 1LOAA 2YROA 3N35A 3WVJA 1ULGA 1WW7A 4MYEA 2EXHA 1S0JA 1QKQA 1NLSA 1XQNA 5GALA 1G9FA 2DVBA 1KITA 4FPEA 2HYKA 1BKZA 1AZDA 4GA9A 1VLNA 2JE9A 1VIWB 3H0OA 5F9TA 1N1TA 5T55A 1GNHA 3ZXKA 3B00A 1Q8SA 2D6NA 1Q8OA 4JCKA 1W6OB 3UK9A 3AZWA 1C4RA 1ENRA 1YO8A 3PJQA 4R9AA 5IK4A 4GWNA 4JRAA 3VKMA 1W6PB 3B01A 4ATEA 2ZHKA 3OJBA 5FRAA 3WDYA 4K1YA 1DQ5A 5DG2A 5CBLA 2EALA 1WW5A 2WLQA 2D3PA 1MS0A 2VY0A 2WKKA 1UZZA 4Y20B 4YM3A 2NP0A 4LBNA 4XZPA 5JDBA 3WDUA 2OVUA 2ZGLA 3AYCA 3B69A 1GZWB 3KQRA 1ULDA 2VH9A 4XHXA 1OKQA 5GLWA 3OY8B 2DURA 3IM0A 4XXPA 3WDTA 1S0DA 3WV6A 1RINA 5DUXA 5BYNA 3UJQA 2D6KA 4FPFA 3W58A 3FUQA 2A5ZA 4Y26A 2A71A 1G7YA 1LODA 2ERFA 1BQPA 3M1HA 4K21A 1F5FA 3ZXEA 1WD4A 3WDVA 3A0KA 1LHNA 1GNZA 1V6LA 2GMEA 3IN9A 4PBPA 3VKNA 1D0HA 2A6VA 2H0BA 3AZZA 2EF6A 4LBQB 1MACA 5CA6A 1KDKA 5E88A 2ZHMA 3INAA 3ZPYA 3WDWA 2V5YA 1WLCA 2ZGUA 5JOZA 1MS1A 4XYXA 2E53A 1HKDA 1N1VA 3O0WA 2YY1A 3POWA 2ZMNA 3ZSLA 1URXA 2DU1A 4YG0A 2W39A 4XJZA 5SV8A 3GNEA 2NMNA 5GZFA 1S0FA 4KBBA 2YXSA 1LU1A 4NOTA 2D43A 3RS6A 1MZ6A 4YLZA 1LGCA 1JW6A 3M3CA 4R9CA 2EXJA 1WLWA 3IKWA 1C1FA 3RMXA 1AJOA 1N1SA 4XIOA 4YFWA 3WHTA 3AK0A 1QU0A 1UL9A 1AX1A 1GZCA 1VALA 3L2YA 3O0VA 2VXRA 4Y1YA 4ZXKA 3ZYPA 3AYEA 2P34A 2D6MA 1GICA 3N7MA 3PVNA 4FPGA 2WQZC 1V6OA 4BMEA 3WCSA 5IT6A 3OBRA 3RG0A 2JE7A 3JUUA 4P9XA 3RMYA 1MS4A 4RA0A 4XHBA 1PZ8A 2DWRA 5KXCA 3AP6A 2V73A 5HCAA 3AJYA 1CJPA 1BYHA 3ILNA 1GV9A 2PHUA 2WSVA 1LOFC 2ZACA 2R16A 4JC1A 1SACA 4YM1A 4GKYA 5JLVA 1LHOA 4YG3A 4YGBA 1N3OA 3VKOA 3PVEA 4SLIA 1YYNA 3M3EA 3M3OA 5KXDA 1SLAA 5LK5A 1PZ9A 2UWBA 1WW4A 3FFZA 4XJWA 1W0PA 2ARBA 2UU8A 3DGTA 1YRZA 2SLIA 1KJRA 2A3XA 2GN3A 2ZHLA 4PBOA 1AXKA 3OGGA 4Y22A 4ATFA 4BOWA 4UW6A 1LULA 1PZ7A 3FUOA 4YGDA 1MS3A 2GNMA 2P3IA 1YI7A 5GLTA 2D7FA 1S1AA 2WT1A 1BZWA 2CY6A 4U36A 3WZ1A 3FLTA 3POSA 5DG1A 4DRVA 2ZAAA 3NV4A 4YGEA 1V6IA 4YW3A 3SISA 3N7JA 4Z8BA 3D5OA 1O4YA 1QDCA 4XILA 3VKLA 2NMOA 2DVAA 1ULFA 4Q27A 3WUCA 1LOGA 4BQ1A 2CWMA 3ZXJA 1W6MA 3ENRA 1V00A 2D6LX 4IQPA 3SLIA 1Z78A 3UL2A 3ZSJA 4TZDA 1DYKA 2EXKA 4FPOB 1SLBA 3IPVA 5GM0A 4H55A 1DFQA 5CB7A 4DFSA 1QOSA 2W08A 1ONAA 3VUOA 1IS4A 3ASIA 1I1EA 4YZ3A 1ENQA 1SBFA 2E7TA 2E51A 2GMMA 5GJ6A 2AGSA 1DQ0A 3AZYA 3BOPA 2R49A 5JVVA 4AVTA 4F83A 2XB6C 1CIWA 3VV1A 2ZGKA 1N3PA 3AP7A 2P2KA 1CONA 2GNDA 2NYYA 2ZMLA 4ISRA 4C1WA 1CR7A 1R1ZA 5IK8A 5L73A 4GWMA 1AX0A 2WT2A 1W6NA 3V0AB 3AX4A 5JMCA 4UW3A 3V0BA 4YW2A 1EPWA 5CNAA 3RRDA 3WG2A 2PHTA 3RQ0A 4I30A 1SCRA 2DTYA 1MZ5A 1RITA 2P37A 1WD3A 4L8QA 4AWDA 2WNEA 1UAIA 1BJQA 3JU9A 4LBKA 3AZXA 4UW5A 4XJ9A 2VUAA 2A6WA 2GMPA 1JUIA 4FVVA 2NZ9A 1S0IA 4P9WA 4PQ9A 3AP4A 1FYUA 3B9CA 2A6ZA 1VAVA 2YZ4A 4FOYA 1V6KA 1JBCA 3V65A 4LBLA 2AUYA 2NN8A 2Q5TA 1WUVA 4AGVA 5H9PA 1IS6A 2FHRA 1DHKB 1N3QA 1DZQA 1SBDA 2RHPA 3AXDA 3ZVXA 1IS3A 1RIRA 2PHWA 1MS9A 1ULEA 2DYCA 3ILRA 3PVOA 3R4UA 4XDQA 4CZSA 4YZ1A 4YG6A 1W6QA 1V6MA 4AVSA 4WZFA 2E7QA 1O4ZA 1IS5A 1LGNA 5DZFA 4FOVA 4ASMB 1GYKA 5H9QA 4GKXA 1H30A 2BQPA 3GALA 1SLLA 4Y1XA 1SLIA 5DUUA 4ITCA 2DUPA 2UWCA 3OYWB 2ZZJA 4WVVA 1S0GA 1MVEA 1UZYA 2W68A 5T54A 3USUB 1NXD1 5T50A 3SH4A 2DU0A 1W6PA 4CRQA 1Q8QA 4P14A 2XG3A 5E89A 2WSUA 3WG3A 2AR6A 1DQ2A 1UKGA 1GANA 2ZGQA 5EWSA 4BLIA 2R0FA 4YW5A 1LENA 1S0EA 1QNWA 1S0CA 4Y20A 1HQWA 2D3SA 1LEMA 1G9DA 1JOJA 1GZWA 2ZGTA 2R1DA 3A0NA 4YZ4A 3OY8A 1LESA 1QDOA 3R4SA 1KDMA 2ZABA 5DXDA 1SCSA 2B7YA 4FPHA 4AVVA 5KXEA 4XMIA 4FPLA 2I2SA 4XTMA 1DBNA 2P3JA 2DUQA 2UWAA 1WBLA 2SBAA 3NV2A 4M3CA 4YM0A 5GZEA 2AYHA 1DYPA 1V6NA 3QCWA 3TAYA 3WNXA 1GKBA 1APNA 4Q1PA 3CNAA 4XJUA 3MEPA 2ZGNA 4ZKTB 2DTWA 4YFZA 4YM2A 3AP5A 1I3HA 1MR5A 2Z42A 3AJZA 3TB0A 1OQ1A 4PCRA 4Q8KA 1AF9A 1SLCA 1U0AA 3APBA 3LSEA 4LBQA 3RSJA 1TEIA 1DGLA 3PMEA 5JOYA 1LOBA 1FATA 2A6YA 2EIGA 2CTVA 1UX6A 4AGRA 2YMZA 1A8DA 4Y1ZA 3LSDA 3I8TA 2GNTA 1LCLA 3N3HA 4U2AA 2OW4A 1LOEA 4XMAA 1ULCA 2G4IA 5IK7A 3W59A 5AVAA 1ENSA 1F31A 1AVBA 2FMDA 4FPKA 2A3YA 2LTNA 5EYXA 1GLHA 3BTAA 3I4IA 3MPPG 3OBTA 1UN1A 4ISQA 5H9RA 4CTEA 1IOAA 4YZ5A 5IK5A 1QF3A 3HMYA 1DIWA 2OUHA 3ZSKA 1QOOA 4DRRA 3ATGA 3KM5A 4GXLA 2A6XA 4XTPA 5T5PA 2OUJA 1JYCA 4Q1RA 3ZSMA 4XIKA 5GZDA 4D69A 3Q9OA 2AH2A 1OFSA 4FPYA 4FQ4A 4K1ZA 3ZYRA 1HLCA 3FLPA 3MW3A 1W0OA 3WG1A 4C1XA 3POYA 1S0BA 4YW4A 4M01A 3T1MA 1WW6A 1UMZA 1CN1A 1LECA 3D4KA 4Q2FA 2DVFA 3AFKA 3SITA 1IKQA 1J1TA 1WCSA 4R9BA 1GBGA 4BLJA 1DQ4A 1JN2P 3T1LA 1FNZA 5JOWA 4FP2A 1C57A 1SBEA 2YV8A 1W6QB 5DUWA 1FAYA 1A3KA 3A4UA 3ILFA 4AGGA 1SLTA 4R9DA 1LOFA 2ES3A 2UURA 3WDXA 2PHFA 4DQAA 2CL2A 3NWKA 4YZ2A 5KXBA 4BPZA 1LOCA 1VAMA 2D44A 2VW1A 3WUDA 5GZGA 4OZXA 1Q56A 2CYFA 1CESA 1A78A 2EAKA 4P9YA 2CNAA 3M3QA 1GSLA 1AX2A 3DUIA 2AREA 1QOTA 4WV8A 1KRIA 1WBFA 2DUOA 5EXOA 5DUVA 3FLRA 2GNBA 5DZGA 3WG4A 4XBQA 1IKPA 1JYIA 2DVGA 3QLQA 2ZGPA 3HN1A 1QNYA 1Q8PA 3N7LA 5T5LA 4XBLA 1CPNA 2ENRA 3NV1A 4M3CE 2LALA 1C1LA 1G9AA 1FX5A 1H9PA 2VU9A 4YW1A 4FPCA 4FOWA 4HANA 3V64A 1G9CA 1G8WA 3B3QE 3AYAA 1N47A 4TYSA 1G9BA 1BXHA 4BM8A 3SNMA 1LTEA 4LBOA 1W6OA 2ZGMA 1SFYA 4M3CB 3ZXFA 3AZVA 4XE9A 2WJSA 3WCRA 2CWSA 2E6VA 4FPJA 1N1YA 3MW2A 3MW4A 2PHRA 2JDZA 1DLLA 3N7KA 1HQLA 4XOGA 5EYYA 1Z0HA 3O0XA 3WHUA 3WOGA 3V0AA 3AYDA 3BODA 1AJKA 4AYUA 3OPZA 1B09A 3O12A 4WVWA 2DV9A 4M3CF 4M00A 4LBQD 1X50A 4XBNA 4Y22B 4Q26A 2W52A 2ARXA 4FP3A 1JXNA 4PF5A 2GDFA 1WLDA 1ZA4A 3WLUA 1MVQA 5GLUA 3SH3A 2D3RA 5T52A 3U4XA 2ZGRA 3LCPA 1AXYA 2A70A 4LBMA 1LU2A 1YXWA 2ZHNA 2D6PA 1LJ7A 1GZ9A 1Y7BA 5HCBA 1V6JA 4YGCA 1HDKA 3D6EA 1LHVA 4NO4A 3T2TA 4Y24A 1AXZA 5GZCA 4GALA 2TEPA 2GN7A 5DZEA 1W6MB 1KQRA 2VW0A 3AXEA 1MS5A 1LHUA 1G86A 2JECA 5F5QA 2AENA 2EXIA 2A7AA 2D6OX 4K20A 3FBYA 3IPVB 5FREA 5GLVA 1LGBA 2PHXA 2ZMKA 5HCFA 3VKFC 1ZM1A 5T5OA
chains in the Genus database with same CATH superfamily
2ZX2A 1OOPC 1VBE2 4CCDA 1F9KA 3IMNA 1UPSA 2PLV3 2KM2A 1YI9A 2Q1FA 1Q8VA 1QJY3 1O5LA 3WNLA 1R083 3T4HB 1H6XA 1F8VA 5FBZA 3O5SA 4SBVA 4IGPA 1CAUB 3B9IA 4HVOA 2R1BA 2Y0IA 2Y26A 5H9SA 5JXHA 2OQ7A 1QJZA 3PU3A 5C33A 3TWIA 5LZ6A 4QX8A 3BIWE 1RYYA 3SCFA 4COUA 4PLOA 3BTZA 3SCGA 1PX3A 4W65A 2V09A 2JKBA 4HN0A 1EV11 1VBC1 5T5JA 1UXZA 1UW8A 1CZTA 1GP6A 1PO21 2DF7A 4NN0A 5HV0A 4LLOA 1XPWA 3LEIA 3S5AA 2ZA9A 4J1WA 4XZUG 4HK8A 2FDJA 3HNMA 1CQ9A 1LEDA 1OT5A 2DDUA 3DCQA 4LEJA 5CYYA 3D0JA 5D21A 3CHXA 2RV9A 1WMEA 4AZZA 5C6CA 1UIKA 1JHNA 4D6SA 2FD8A 2IXJA 3UGHA 4PF1A 2C26A 3GZAA 4HL0A 4LLFA 1AR92 4AEDC 4QXBA 1GWLA 1JTZX 2ZGSA 1LOAA 3PJYA 1AR71 1ULGA 1C8M1 4MZUA 1DF0A 1WW7A 4XF0A 3VDCA 3WQ0A 4MHRA 1BHGA 5BPXA 5FP7A 2JX9A 3H8XA 4D7SA 1BKZA 1ZBA1 5L7OC 2JDNA 3ZFFB 2P4EA 1N1TA 1PVXA 1GNHA 2QZ2A 3B00A 5DN2A 1R1A3 3ZXKA 2RM22 4JCKA 2RS51 3CJIA 3MPBA 5A32B 4EYUA 1C4RA 3EBRA 1YO8A 1TNRA 2XGXA 1J3RA 1W6PB 3KCXA 4DB5A 4KI5M 2VOVA 3OJBA 2G9ZA 1VRBA 4K1YA 2C6SA 3AVSA 3GZTB 4EWDA 2EALA 3NSTA 2D3PA 2VY0A 1US3A 2VZUA 3VHNA 1KS4A 2WKKA 4KL1A 2OVUA 2ZGLA 3AYCA 3B69A 4Q0UA 5JCTA 4QPGA 3WINE 1W05A 1BBT3 1LR5A 2JEMA 3H3ZA 1S2BA 4XXPA 3WDTA 5BNNA 1MEC1 1NZCA 5F8PA 4RHV3 4FI9A 4ZZ5A 5DAQA 3KQ4B 1VB2A 1XJAA 4BIFA 1UYZA 1VBE3 1VE0A 2RJLA 5A3LA 3CZJA 4EN0A 2OIIA 3FUQA 5FFOC 3ACGA 2A71A 1G7YA 4CE8A 1BQPA 2ZPXA 5F1RA 2CGNA 1F5FA 1JZ4A 3NNLA 1W39A 4AI1A 4W6XA 1AYN2 4MGKE 5CKMA 1GNZA 4AI9A 4MGZE 2BYVE 1V6LA 2GMEA 2ZX0A 2JB8A 4IESA 2A6VA 3WSOA 1PGL1 2NLRA 3AZZA 2HBUA 1C28A 2JDUA 4S2FA 4BB3A 2DCZA 3ZPYA 2ZHMA 3INAA 1XNCA 2MNGA 3OEBA 1W9FA 3ES1A 5LATA 3WD5A 4BQXA 4DUXA 5IYYA 1POQA 4NIDA 2W9XA 5DMYA 4J25A 4XDPA 1JOBA 1I6XA 4XYXA 1HKDA 4EN6B 2LRPA 1NLRA 3KB5A 3ZDVA 5CVRA 3WY6A 4FFGA 2DU1A 4XCBA 2W39A 5SV8A 2DCJA 3E5QA 2YXSA 4RQPA 5J7MA 1AR61 5FZOB 3IMMA 3NW4A 1W8WA 1MZ6A 2BGOA 1LGCA 2IXKA 3OGRA 1BEV3 4QQ2A 3BCWA 2BNNA 1AJOA 3E6DA 3AK0A 1HB1A 3L2YA 3Q8BA 1GZCA 1VALA 3O1PA 4ZXKA 1OLRA 4L2NA 3PIJA 3ETQA 4H7MA 5FWJA 2ZKLA 3O14A 4KNCA 1ZZ9A 4RS5C 4XUQA 3WCSA 1TMF2 1JHJA 1ODMA 2JG9C 1ZYBA 2JE7A 3OOXA 1R1A1 3ZKYA 2EVXA 3RZGA 2RM23 3DN7A 1GZTA 3KVBA 4Z07A 4N7UA 4Z1VA 4YVSB 5HCAA 3AJYA 1GWMA 3ILNA 2A1XA 4CEYA 2WSVA 2PHUA 1LOFC 1SACA 2BOJA 3GBWA 4KBZA 5FKBA 4WM7C 1LHOA 5JIUA 1FXZA 4ZU5A 1QQP2 3RZLA 4CDUC 2GZWA 1SLAA 2W91A 2UWBA 3FFZA 4XJWA 5A3WA 2ARBA 4FTBA 3DGTA 1KJRA 1H8TB 2ZHLA 4DXSA 4CCJA 1H2NA 3OGGA 2BV4A 2VMFA 1RHI2 1BBT1 3B02A 4IV3B 4ORFA 2VMEA 4Q0SA 5A1AA 2ETEA 5FK8A 3J4UH 3ZN6A 2JKXA 3RYRA 1DGRN 1JYWA 1IQDC 2CY6A 1K42A 4JKLA 5DG1A 3P3NA 4OHXA 5KHHA 3TEWA 4CCOA 1RUH2 4YW3A 3SISA 2VR4A 4AK3A 3AKQA 2VJXA 4Z8BA 1ZBE2 3M70A 5IAXA 3TEXA 5KHJA 4XILA 2WO7A 2X5IC 5I91A 1LOGA 1UOJA 3UL2A 3N4MA 1Z78A 1DYKA 4CCMA 2WFF1 3K4AA 3ELNA 5A3MA 4QX2A 2XPJA 2QJVA 2Z79A 4H55A 4M4PA 1DGWX 4JDMA 1QOSA 4DFSA 5IVVA 2W08A 1OQEA 3DL3A 4YZ3A 3BIEA 1FI2A 1ENQA 1SBFA 5FZ1A 3NJXA 1NE6A 3KV5A 4I3GA 5GJ6A 3DPRB 2LUWA 2WDBA 3KD4A 4COWA 3A22A 5FZ6A 1CAUA 2XB6C 4XCAA 5FYUA 4JGZC 1W8NA 1PMJX 3ZXGA 2ZXQA 1IPKA 2GNDA 1W2TA 1CR7A 5EZWA 5LWBA 3ZX7A 1YLLA 1RUI2 3WQ7A 3IB3A 4P9IA 1BEV1 2ZEWA 2W1SA 4JTNA 3OUJA 3LFMA 4YW2A 3AFGA 2PHTA 3EB7A 4OI2A 4ES8A 1MZ5A 4E2SA 2P37A 4L8QA 3ZFEC 4AQ6A 3LA3A 1UAIA 1W90A 1W06A 2WAAA 3JU9A 4D6QA 4LHKA 4XJ9A 3HBKA 3MLJA 1NY71 3LIHA 3PL0A 3PVBB 2MHFA 4FVVA 4P9WA 4ZPIA 5FWEA 2JIJA 2PQSA 4HVRA 1FYUA 3B9CA 2ZOEB 1OLME 1ZZCA 4YWAA 4CDQB 2NN8A 4QPWA 5IATA 4AGVA 4QXKA 4PIYA 4P9GA 4JZRA 3J8F2 5HXVA 1M4WA 5AFEA 1IG3A 2DYCA 3BYWA 3ILRA 5FLHA 4CZSA 3H8RA 4YZ1A 4CP0A 1MZEA 4WZFA 2PXJA 1QQP3 4YW7A 4QX5A 5DZFA 5F3EA 1LGNA 1AHSA 2BVVA 1UY1A 5JXGA 3H3LA 2C9KA 3ZFFA 1D2QA 2ZCWA 4LHNA 1H30A 1J3PA 2RS12 4Y1XA 1SLIA 4MGYE 4YNIA 3OYWB 1RHI3 2ZZJA 5A32A 2DBIA 2XBO1 3AVRA 1UZYA 1W2AX 5EQUA 3USUB 5JMOA 2VMGA 2XDVA 2DU0A 3KGZA 4MGQA 1W6PA 5DAPA 5T3NA 1VRH2 1Q8QA 1S55A 2Q8CA 5IVFA 5C3OA 5M0TA 3U75A 3SXWA 2ET1A 1GANA 1RVF1 5AC91 1EYBA 4GB32 2BP6A 4QKNA 4YW5A 1RUH3 3N9MA 1ZBE3 1YQCA 1UOGA 5LA2A 3FHAA 4Q4W2 5BV6A 1G9DA 1FOD2 1W9YA 3A0NA 3OGSA 3ZR6A 4H14A 3U11A 2HEYF 5FZHA 2B4KA 2X53S 2PTMA 2YGLA 3SEPA 1QDOA 1YFYA 3H9AA 1KDMA 1UYYA 1GP5A 1EY2A 1XOYA 2VCBA 2B7YA 5CEHA 4AVVA 3AL5A 2HWB2 1ZRDA 4FPLA 2I2SA 4OHWA 2IWGB 2H0VA 4GZ9A 4GD4A 4YM0A 3CIHA 4WM8A 2AYHA 2CDPA 2VZOA 3LEGA 3OBZA 4D6RA 1O3QA 2OXBA 3FX3A 3QCWA 3QH7A 5JDBA 5EPAA 4Q1PA 3MEPA 2ZGNA 4GQ7A 5G05L 2XOMA 3I54A 4COZA 1MR5A 2QQWA 3AJZA 1WMFA 4W50A 3CJIC 1RUI3 4PCRA 2CU5A 5FBJA 5C3PA 3ZMOA 5FZ3A 4QB2A 1AF9A 4CUBA 2FZ2A 5LCWL 4LE4A 1DGLA 3EYPA 4EN9B 2C4XA 5C3RA 4XUTA 2FDHA 2CTVA 3HIFA 3U4SA 1A8DA 1UD1A 3I7DA 1EUTA 2Y6HA 2OA2A 4XMAA 1MPXA 3O1MA 5A1FA 4P9LA 2FMDA 1VR3A 4D94A 3KF3A 2WWUA 1LNSA 2K2SA 4QAWA 5FZOA 1QJX1 4QPGC 4ISQA 1UOFA 4YZ5A 1IOAA 1QF3A 1REFA 1VBD2 2I74A 5FXWA 1GUIA 3ZSKA 1POV1 3J8F3 3ZPOA 5A3NA 5BNNC 1AR81 3ATGA 2P1BA 1UF2C 1TNFA 2A6XA 4GXLA 2OUJA 5J48A 5DPNA 3THPA 5JOXA 4MG2A 4Q1RA 4HK9A 4LHLA 3ACIA 3MFAA 2BZDA 3OUHA 4NHLA 1JYNA 3ZYRA 3ACFA 1GOFA 1BVP1 3FLPA 2WO3A 1W28A 1QJEA 4AI8A 3GBFA 3FL7A 3WG1A 1V9U2 2BFUL 4Q4Y1 3TEYA 1HX6A 1LECA 4OLLA 1OSGA 4YVSA 3AFKA 1UMIA 3AC0A 2PFWA 2HWC2 4UAPA 5CKNA 1QH6A 4BLJA 1VRH3 4OYUA 5J36A 3BUCA 4JQRA 1FNZA 4IXLA 4FP2A 5JOWA 1SBEA 4IDZA 1UY2A 3OEAA 2VMHA 3URFA 3DF0A 3LOBA 1K3IA 3A4UA 3SEEA 4AGGA 4GB33 3JZVA 1NZIA 3KT4A 3WDXA 3Q8AA 5LBEA 2PHFA 4DQAA 5J1XA 2CL2A 2HBTA 3NWKA 3RNSA 2RE9A 1H8TA 2WZR2 3LE0A 2VW1A 4NRMA 4QMAA 3U37A 1FOD3 3WUDA 4CEWB 5GZGA 1LKNA 5FAXA 1CWPA 4OZXA 1Q56A 3UGFA 4RQPC 5FV3A 2J1UA 2EAKA 5AVPA 2VOKA 2QUOA 3DUIA 5FYSA 4I2OA 4CXWA 1CJDA 4NPRA 2DUOA 2HWB3 5DUVA 3WQ1A 5DZGA 5JXIA 1FPN2 1WLTA 3ACLA 5ERLA 4XFBA 3VDAA 4OMDA 3K48A 4WZCA 1JYIA 4FSJA 2ZGPA 3HN1A 4DXRA 4I0BA 1QNYA 3W20A 3UYJA 5EJZB 3PDQA 5EP9A 2ENRA 1OA3A 4AAXA 3PTYA 1NA1B 4HT1T 1OVSA 1AYM2 1C1LA 1OD5A 5SV5A 1REEA 2VU9A 1QH7A 4YW1A 4FPCA 2P3YA 4JV4A 3V64A 4LORA 4MH0E 3RJ2X 4X8PA 2Y64A 1N47A 4TN7A 4TYSA 3QBQA 1BXHA 4Y5SA 2RJKA 3VHRA 4BDVB 4CEYC 2XL9A 3A7QA 5FUPA 1LAJA 5D8AB 2B42B 2TUNA 4XQ4A 1SFYA 2FMYA 4M3CB 3BKZA 3DPRA 4DY3A 2Y6GA 4HLTA 1RTVA 1XYNA 1NQJA 1C5HA 4NRQA 3NO8A 1X8MA 3VB9A 1PNFA 2E6VA 4FPJA 3BI3A 1HQNA 2JDZA 3EQEA 1DLLA 3N7KA 1HQLA 4D8MA 3MIFA 4QDRA 5CKQA 4ZS2A 4IGQA 2FCVA 4QX1A 3AYDA 1VBD3 1AJKA 1T2XA 3BODA 4R4ZA 5FY8A 1O3SA 2EIBA 3J7LA 3O12A 2GH2A 1Y3TA 2QQJA 2WINB 4LOSA 4M3CF 3RYPA 3DEMA 4LBQD 2G19A 4A42A 3ALQA 3N9NA 1XC6A 4LR4A 3PMSA 2GP5A 1V70A 2ARXA 2KA3A 3U4XA 5KC6A 1DP0A 3WLUA 4X6QB 4E4DX 2B9UA 4AE2A 1DGRA 3LCPA 1GU3A 5C3SA 1LU2A 1YXWA 1KGYA 2BOIA 2Y38A 2ZHNA 1GZ9A 2J7MA 1F15A 2ZX1A 1Y7BA 4CDQA 5HCBA 3C7HA 4FXKB 2BDRA 2HWC3 3RZHA 3T2TA 5FZLA 4Y24A 2XJVA 1TME3 4MOAA 3T0AA 2W1WA 4NPLA 5C71A 4B29A 2BWCA 4GALA 2BNOA 1EV12 1VBC2 3UETA 3CEWA 2QNKA 3OCPA 5A7WB 1W6MB 1PO22 2RS33 1KQRA 1VJ2A 2XJSA 4LT5A 1LHUA 1O4TA 5ACA3 2RR11 2A7AA 4ZXEA 5LRRA 2QQUA 3FBYA 4IEZA 5FREA 3VKFC 3J26N 4INDA 4K3UA 4L11A 2BTVC 3OYWA 2A3WA 1CAWB 4LBJA 1NCQA 2IVIB 1QY4A 3USUA 4J6GA 4C8DA 2XL7A 5FMDA 2ADDA 1GMMA 1AR72 1C8M2 2A75A 3E6CC 2WO1A 3VZNA 4ZONA 4AOCA 3O7OA 4H3WA 4QB6A 1H9WA 2NM1A 1FPN3 2ORXA 2VOXA 2C9AA 2QDNA 3ZXDA 4Y1UA 1WMDA 1ZBA2 1JYXA 4FOQA 4Y1VA 2R0HA 4FCAA 4BYYA 2CDOA 3HPNA 3I2JA 4BQYA 2RS52 3UJOA 1YIFA 1PGW1 4JVAA 1YFUA 2XR4A 3LDBA 4URTA 3POIA 5FZFA 3RWKX 1ND3B 3AP9A 3T0DA 5B2GB 1YEWA 3C7GA 4RL7A 3FBMA 1D2SA 1OA2A 3R05A 3A23A 3ZYBA 2XUEA 4Q8LA 4FQZA 2VZ3A 1B35B 5D1IA 2WAOA 4HN1A 2YROA 3WVJA 3ZFFC 2HWF1 2B46X 4LXLA 4LIVA 3BPZA 3ZYJB 1NLSA 2IUWA 5GALA 3ZN4A 1MEC2 2D40A 2HYKA 4EN8B 3EJKA 3ORJA 4GA9A 4LKFA 1JYTA 1E5HA 3HT2A 4HKOA 1RUD1 3ZYFA 3OPTA 1W3XA 4AI0A 1Q8SA 1Q8OA 4Y4YA 1W6OB 2XVGA 3S7IA 1ENRA 1OURA 4PIZA 3SCHA 1JH5A 5CFDB 4R9AA 3VKMA 2H6CA 2JICA 1WCUA 4BQ5A 4O7XA 1YQ5A 2W1UA 1X36A 2RDNA 4KH9A 4UFIA 5K7PA 5FRAA 2Q8OA 3NNJA 2VUCA 4A6OA 2PYTA 4UOJA 1PGL2 5F3GA 4IE6A 1X9PA 4Y20B 4META 1TME1 4E9KA 4XZPA 5C3QA 3WDUA 2PHDA 1EV13 1VBC3 2IFWA 4E8DA 1GZWB 4XHXA 1Y9GA 1HB3A 1PO23 2RS31 4RR3B 2WUHA 5FP4A 5GLWA 2HEWF 3OY8B 2DURA 2DCYA 3IM0A 5ACA1 4MADA 4WM8C 5DUXA 4WVMB 3ZIWA 2JB4A 3UJQA 4UXAA 1F35A 2BNMA 2D6KA 2ZS6B 4AL9A 2XKOA 3MLLA 5JPMB 1AR62 3POFA 1X9TA 3MV11 4NJ4A 4QGMA 2JG8A 1F4HA 4Y26A 1I9RA 1C8NA 5GKAC 5FZDA 1AR73 4K21A 5F6KA 1C8M3 1UNBA 3ZXEA 3BALA 1RL3A 1WD4A 3AMNA 3WDVA 2C24A 4CDWB 4CCKA 2B39A 5L9VA 4PBPA 3IN9A 3W5MA 1Y9MA 1ZBA3 3VKNA 4QM8A 3OUIA 2HWE3 2EF6A 3CU7A 4UI9L 1I5ZA 4HG6B 1KDKA 1R1A2 3ETPA 1OH4A 5E88A 4CEWA 3WDWA 1VAKA 3S5QA 4NHXA 5C4WB 3LD8A 1I5PA 1WWYA 2W2IA 2O0OA 1PK6B 5JOZA 1M06G 5FIXA 5ABJB 3O0WA 4PJYA 1N1VA 4NWWA 3SQOA 3I97A 3O1SA 2ZMNA 2R071 1URXA 3VZJA 4XJZA 1WA4A 5GZFA 3I2IA 4OI0A 3GGLA 4NOTA 4CU8A 3RS6A 5JI9A 4JX0A 3IKWA 3WHTA 2GAUA 1N1SA 2HEVF 1H8VA 2EICA 4BU2A 1T6GC 5FY4A 3ON7A 4AHXA 4OUSA 3I3BA 3SMHA 1BBT2 3AYEA 1CIYA 5FQ0B 1MEC3 4YVSC 4BMEA 4JHTA 3VZKA 1BLZA 5IT6A 4IEUA 3K75B 3IIIA 4QWNA 4UFMA 2JENA 2DWRA 3J7NA 4LNVA 3Q8CA 5D8AA 3T3YA 5KXCA 1Z7S1 3WNKA 4CP1A 1HRV1 2V73A 3MIGA 4XC9A 2VO5A 1BYHA 4MVTA 3THDA 1UZWA 4HSJA 4JC1A 4GKYA 4BIOA 5JLVA 4K8RB 3ZO0B 3VKOA 1H8TC 3PVEA 4SLIA 1YYNA 3M3EA 4O65A 4HETA 1R091 2WFF2 4IV3C 4OUEA 5EFUA 5KXDA 1JZ5A 4FBFA 4DEVA 2WNOA 4GMP1 3U0ZA 2JXAA 1U5XA 1YRZA 4CUAA 1NYWA 5FMOS 3WW3A 1YJKA 2BGCA 4RD7A 4NIIA 1PO13 2XLFA 4S2HA 3LQCA 4UW6A 4C90A 4E4ZA 5JSOA 4UF0B 5I0TA 1VMHA 3ZDSA 1NOVA 2GNMA 1UZ0A 2A73B 1RXGA 1BZWA 4QT6A 4FXGB 3KCCA 3POSA 3LKJA 3OG2A 1AR63 3A21A 5A33B 4DINB 1BEV2 3L2HA 4EJRA 3D5OA 1O4YA 2N7GA 2NMOA 2DVAA 1ULFA 3AB0A 4LO7A 2EIEA 2WN2A 4BQ1A 5FP8A 1W6MA 5A7WA 4XF4A 5JIAA 4IQPA 3SLIA 3HEIA 3VBSB 2J42A 3E1F1 4KMQA 4CU9A 2Y60A 1NY72 3GZEA 3HN3A 2VVEA 4K8FA 5A6QA 3W5NA 2HWE1 3DPRC 4EV0A 5CB7A 3ACHA 1VB4A 4ZY9A 2XJUA 4BA6A 2AC1A 1UX7A 5IVEA 2ID4A 4G9SB 1OUSA 1W9TA 1CAWA 4H7LA 2E7TA 4QHOA 2E51A 5TSWA 3S7EA 1X82A 4BXSV 1JZ8A 1VP6A 2VNVA 3BOPA 1YNAA 2R49A 4AVTA 4F83A 5CIRA 5FYYA 1UWWA 4F8AA 3ZFGB 4BHPA 1CONA 4H2AA 5FZIA 1R1ZA 5IK8A 3POGA 1AX0A 1XU1A 2WT2A 4LITA 2QQMA 3VN4A 3AX4A 4LA3A 1C3HA 4J1XA 3VGIA 4UBHA 1SCRA 4LKEA 3CL1A 3KT1A 1RITA 4HXCA 4ZHNA 2XBO2 1JOPA 2VPVA 4CDQC 1EP0A 4OVEA 2A6WA 2GMPA 1S0IA 1VMFA 4DZGA 2K9ZA 4M0NA 2W95A 3AP4A 3K77A 4YPJA 2A6ZA 1VAVA 2YZ4A 4AHYA 4Z2WA 3IDAA 4XETA 3NAPB 5D2AA 5AC92 1RVF2 4CU7A 3H42B 2NP0A 1B35A 2FHRA 1DHKB 1SDWA 3ZVXA 2ATFA 5ANNA 4GMP0 3PVOA 3R4UA 4JDOA 3ZXAC 1V6MA 2HH9A 2E7QA 4OQ8A 2WFF3 2EIDA 4ASMB 1NCQC 1GYKA 1NXMA 2ET7A 4GULA 3AM2A 1ZREA 2BQPA 5DUUA 1X33A 1ZZ8A 4D3WA 2HJIA 1PO11 4DOUA 4WVVA 5DAWA 1C5IA 1S0GA 3CJXA 5T54A 4CCNA 5FYVA 5CFDA 5T50A 5C5UA 1O6UA 3SH4A 1UU5A 4IE5A 3PNAA 1EUUA 4AW7A 4XAEA 1WGPA 3WG3A 3I3MA 4F3JA 4TLFA 3WR0A 5FPAA 2ZGQA 2R0FA 1LENA 1QNWA 4Y20A 1YJLA 4IERA 3LPFA 1RJ7A 2HYXA 1SG3A 1LEMA 2VUDA 2MEV3 1GZWA 5FY7A 1BMV1 1ASJ3 2R1DA 1ND2B 3NRUA 3T2PA 4RR3A 1L7QA 2UYBA 4YZ4A 2VTFA 1HW5A 3NKGA 3OY8A 4YSFA 4NUBA 2JDHA 3R4SA 3I49A 4B8EA 1SCSA 4WVMA 3UNPA 4A3XA 4AFBA 4B4RA 1OF3A 1XNBA 4OZOA 1DBNA 3LOIA 1QJX2 2VQ0A 1OUXA 1OH3A 5GZEA 1AR82 3CQOA 1GKBA 3PUAA 2XH6A 1D4M3 4RFRB 4XF3A 4DY5A 4YFZA 3T09A 2D97A 4CDWA 1YFXA 3JQWA 1DLCA 1CAXB 1JU3A 3WX5A 4ARXA 1U5YA 4L97A 3APBA 4ONUA 2VTXA 5FPZA 4AEMA 4HSLA 3PMEA 4Q4Y2 3G6JB 3D8CA 5FZKA 1FATA 5C4WA 2EIGA 1X8EA 1UX6A 2XBO3 1PK6A 4Y1ZA 5FZCA 5FZ8A 5ABJA 1LCLA 3FZ3A 4JKMA 1ULCA 2ZZQA 3W59A 4DXZA 3WNOA 2NQYA 1AVBA 4FPKA 3LFIA 4LE3A 1BCXA 4CCEA 1RVF3 3I4IA 3OBTA 5H9RA 1H1MA 1UN1A 4CTEA 5AC93 5IK5A 3HMYA 1DIWA 3K51A 1QOOA 2JD9A 4ZS3A 4XTPA 3KM5A 4DNYA 2O14A 5C7GA 3AMPA 4NVPA 1JYCA 2Z69A 4D69A 4DMIA 5FQ0A 1HB2A 4FPYA 4FQ4A 2WRAA 1UKRA 4MGIE 1IPSA 2JG8C 4QPIB 1JZ2A 4CSWA 3I2FA 3POYA 4NIGA 2WNUB 4TSVA 3AKRA 5FXZA 2P5BA 3T1MA 2R041 1CN1A 4IW3A 1YUDA 2XLAA 4QKDA 3D4KA 4Q2FA 5A7OA 1UPIA 1DGWA 3ES4A 4FFIA 1W2UA 1WCSA 2VM9A 2VZSA 2X10A 3ZYHA 1GBGA 4TLGA 1UY0A 1XNTA 4P5HA 2VBPA 1O8PA 1COV1 2EA7A 1C57A 3PTRB 3IDCB 4IV1B 1WMXA 1W6QB 4CEWC 5DUWA 1FAYA 3VBOB 1JODA 2VZVA 5L9BA 5KWRA 2UURA 1W3VA 3KCYA 2O8QA 4BPZA 5HPOA 2QCSB 2MEV1 1KEXA 1ASJ1 1NUKA 3H8UA 3DKQA 3LEKA 3P5BA 2CYFA 2IXIA 1FMD1 1XSRA 1A78A 2WC2A 3JBG3 3JCIA 4P9YA 4FAGA 2IXLA 3W21A 4WV8A 1GSLA 5IW0A 1QOTA 3CLPA 1KRIA 3IZOA 5EXOA 5FLJA 1O7FA 2QTWB 1IKPA 2VZPA 4L9BA 1QJX3 4XFCA 1L7RA 5A33A 1A34A 2VOWA 1VBA3 3N9QA 4K6BA 1POV3 3N7LA 1Q8PA 2WZ8A 1W2NA 4OUMA 1AR83 3TN91 4XBLA 1CPNA 4AFMA 4E27A 5EHDA 1D4M1 5IVBA 3CZUA 4CP9B 2WN3A 5D8AC 3VBSA 4BQ2A 2G9GA 5KHGA 1NAEA 2W5FA 3J7MA 1G8WA 3B3QE 3GHNA 3AYAA 5FY0A 5FR3A 2LROA 2ARCA 1XYOA 3NL1A 3NMBA 4XFAA 4Q4Y3 4Q4X1 2CGPA 4QHBA 2K0GA 4AG4A 3AKSA 4FTSA 1T6BX 3BTYA 3DYPA 2EAAA 1IG0A 4AI2A 3MW2A 5FMOL 3ZFGA 1J58A 2Y8KA 1Z0HA 2AACA 2C0ZA 3RI9A 1Q43A 4OHYA 2QDRA 2RR12 4AYUA 4M0HA 2VECA 4WVWA 2DV9A 2WBKA 3J9SA 4M00A 3LDKA 3NNGA 3LAGA 3TNQA 2BJSA 3BGAA 4BQWA 4PF5A 1YQ8A 3VBRB 5GLUA 2D3RA 2ZGRA 5CFCB 2VGDA 2D5HA 2FDFA 1SEFA 1OQDA 3ABZA 2D6PA 1LJ7A 1Q5OA 5I8YA 1AL23 3NAPA 2VNGA 4EWAA 5LY1A 4HPKB 4YGCA 3NQHA 1OFNA 3D6EA 3MIEA 1LHVA 4LKDA 1IQAA 4HZFA 5HXMA 1JZ7A 4I02A 1JMUB 2VMCA 1AXZA 1GWKA 5HBAA 1DG6A 2LW8A 3WNNA 2TEPA 2E31A 1RUJ1 1PGW2 3KHBA 2OYZA 2VW0A 3LZZA 4XVHA 1MS5A 2JECA 1G86A 1J1LA 2OKXA 3BTXA 1YQ6A 2EXIA 2O8OA 1XBFA 4UFHA 4GJYA 4BQ3A 1OLMA 2YBSA 5FZ7A 1LGBA 2PHXA 4COYA 5HCFA 1XNAA 2VC9A 1PVC1 2ZKNA 4XF9A 2JJ6A 5LEKA 2UY9A 1O91A 1FV2A 1KJLA 3HD8B 5FYZA 3GCXA 3JBG1 4IE4A 3N36A 1NX9A 1QMJA 3SH5A 3JXSA 4FFHA 4DPNA 1WKYA 2HWF2 3HOBA 5LW9A 2BWAA 2F4LA 3EO6A 3NV3A 2F17A 1CPMA 1J83A 5FZGA 4UW4A 1VBA1 2DVDA 2DCKA 5E8AA 5JSPA 5GLZA 1RUD2 3B7MA 4PT6A 3C2UA 3V0BB 4XJAA 2X05A 3PHMA 1ND2A 2VMIA 1OBNA 1K45A 2UYAA 1DQ6A 4XXAA 3HR9A 3ZOIA 1LHWA 2BUKA 1B35C 1HXS1 2C5DA 4Q4V3 5CAZA 3OBAA 4JHZA 2VW2A 4B4PA 3IT8A 2R6QA 2YFUA 1QGLA 5A3PA 4FFFA 4COVA 2WT0A 3M2MA 2Q8DA 2VQUA 4W4ZA 4LK6A 1VMJA 1TME2 1OA4A 2GALA 2P3KA 5A3OA 4QD2A 1FV3A 3CF6E 3N35A 5FZMA 3KWVA 1E5IA 1CD3G 1YHFA 2ORZA 2PA7A 2RS32 3UKVA 4LO5B 4Q0VA 1XQNA 5HCHA 1NE4A 1CAXA 1G9FA 1KITA 2DVBA 2V72A 2B45X 2RR13 1ALYA 4FPEA 1AZDA 4BJ0A 5ACA2 2W94A 5CFDC 5F9TA 4UFLA 2VZ1A 4IV3A 3UK9A 3I2GA 3AZWA 2JIGA 5APAA 3WF1A 3GYDA 4MX3A 2QQPA 4YVWB 4JRAA 4NRPA 4EN7B 4M4RA 3B01A 3POJA 2YG0A 5JR2A 4TTGA 3WW2A 5DG2A 1DQ5A 5FP9A 1AL21 4OI4A 2R30A 4P9JA 4RR3C 3GF6A 3HVDA 2BBVA 2WZEA 1UZZA 3L9JT 3T2QA 5JSRA 4YM3A 2UY8A 2HWD1 2OS2A 4AVBA 2VZRA 4PLNA 3KQRA 1ULDA 2VH9A 1JS9A 1OKQA 2FBEA 3FJSA 4AI3A 1GQHA 2FCUA 2P6HA 1HRI3 4QPIA 2R072 1W8UA 1PIV1 5FDBA 3V56A 4LIUA 2WNUA 5C9AB 4FPFA 1J84A 3W58A 4ET7A 1BK0A 4CDWC 2VXJA 1RJ8A 2A5ZA 5LA1A 4CDXB 4S2DA 2GU9A 3M1HA 4XF1A 3U78A 2HWF3 4IV1A 3A0KA 1LHNA 4UFJA 3RDIA 4CPBD 4QX7A 3VBOA 3T0BA 3O1TA 1NCRB 4X8NA 2B9VA 2VG9A 5C4WC 2WWJA 1D0HA 1PK6C 4P02B 5IHRA 5ABJC 4LBQB 5A6ZA 1MACA 1RUD3 2P17A 4IUGA 4GIQA 5CA6A 3MGUA 4RN5A 3D0SA 1CAVB 5FO9B 3E5UA 1Z7S2 2V5YA 3RZMA 3WNPA 2ZGUA 1HRV2 1TZOA 3ZYIB 3MLKA 4QGLA 1MS1A 4JQTA 2IVJA 2J1SA 3FHQA 3POWA 3ZSLA 4Q4V1 4ARYA 1RUG1 1D4VB 3QACA 2NMNA 4KGGA 1S0FA 1NQDA 2BVBA 3PUQA 5IVJA 5E1RA 3PU8A 1LU1A 1R092 3M7AA 2D43A 3ZN5A 2RMU3 4NPMA 3Q8EA 1JW6A 2FCTA 2EXJA 1WLWA 4V1PA 2WYFA 2OPKA 2YPDA 3AKPA 4XIOA 4NAOA 2E33A 4YFWA 1UL9A 3T1LA 3O0VA 4N43B 1K5MB 4CP9A 4Y1YA 2XHNA 1U12A 1EAH3 2D6MA 4DUVA 1KFXL 3MBWA 2TBVA 3C3VA 2AZ5A 3H1YA 4Q29A 4HMZA 2J1VA 3PUIA 3RG0A 3KS7A 3LPGA 4MUVA 1GOGA 4P9XA 2Q8EA 1MS4A 4RA0A 4XHBA 1PZ8A 1YCIA 4YARA 1PGSA 4MXVA 5CU1A 3MIDA 4N9IA 3HQXA 2CAUA 5CG9A 1CJPA 4S2GA 3VL9A 1GV9A 2DBNA 2JDYA 2RDQA 2ZACA 4NHMA 3VBHB 1RUOA 4YM1A 1DYOA 2FDKA 4IEWA 4LK7A 4ASLA 3S0MA 3WP5A 1OF4A 1N3OA 4AHZA 1HJFA 5LA9A 2GC0A 3M3OA 5LK5A 1TQ5A 1PZ9A 1OVPA 4QU1A 4ZZ8A 1W0PA 2HWE2 2VQAA 2UU8A 4LKSA 2SLIA 4X6RB 2OQ6A 5LA0A 1AXKA 1ZZ7A 2GC3A 2GP3A 4YW6A 4ATFA 5JZGB 3POEA 1D0GA 1LULA 4QQPA 3FUOA 4YGDA 3VBRA 4AXOA 1HRI1 1MS3A 2R073 3PIGA 5GLTA 5CFCA 2FZ1A 2ZAHA 3OF1A 3U10A 4Y3OA 2WT1A 5LK7B 4KQ7A 3WZ1A 5I0UA 1W9WA 3FLTA 3X29B 4A7ZA 4GH4B 1XNDA 4HPKA 3T30A 3VBSC 2X8KA 5IFPA 1OMIA 1P8JA 3N7JA 4XW3A 2Z2SB 4TXWA 3DKWA 2BBAA 3HWJA 5EJ3A 4Q27A 3GCWA 2W47A 3H1MA 1H1IA 2CWMA 3ZXJA 4CCCA 1Q3EA 2D6LX 3KV6A 5KHIA 4DUWA 3ZSJA 4TZDA 3TBDA 1MQTB 3I3EA 3OSDA 1GOHA 4FPOB 3JD71 4UYBA 5GM0A 4UWDA 5KHKA 4R8HA 4C0BA 3FC0A 1ONAA 2XJPA 3VUOA 2VNOA 1IS4A 1CX4A 3ASIA 1H2MA 5A7PA 1Z7S3 3VBUB 3ZR5A 4GAZA 3ZFGC 1HRV3 3WP4A 2GMMA 5A6XA 1SQ4A 2AGSA 2H6BA 2G9FA 3AZYA 5JVVA 2OZ6A 3KMHA 4BH9A 3VV1A 2ZGKA 4JAAA 1N3PA 3AP7A 4IEXA 1PX4A 4Y5TA 2P2KA 4ISRA 3VZMA 2Y0OA 4D7TA 2W1QA 2CSGA 1R093 2WO2A 1GNYA 1HJGA 1PNGA 2RMU1 3BPSA 3ST7A 4GMP3 1HV1A 5JMCA 3KVAA 4ZU7A 4UW3A 3V0BA 5CNAA 3WG2A 4HKWA 3ZM8A 3M4FA 2PQQA 1AL0G 3VL8A 4AEJA 2VZTA 5LASA 5BNOB 1PO12 4YRDA 1WD3A 4AWDA 1EAH1 2QQIA 1JU4A 5C8CB 3NAPC 4AF9A 1GR3A 4UF0A 4NE9A 1JUIA 4PQ9A 5AFBA 1ZX5A 2CV6A 2PAKA 1OPOA 4L92A 4LMFA 1V6KA 2DFCA 3V65A 4RSUA 3UGGA 2J1TA 2Q5TA 2L9LA 3FN9A 1N3QA 2RHPA 1DZQA 3AXDA 1W0NA 1IS3A 2PHWA 2YYOA 1MS9A 5J37A 1BMV2 4AVAA 4QQOA 4XURA 1IS5A 3MDPA 3ZLIA 1XE0A 3K4DA 3WXPA 4CP2A 4KWJA 5H9QA 5A3UA 3GALA 4ITCA 3VDDB 3OGJA 5F2SA 5FYCA 1XNKA 2UWCA 4OQ9A 4AFAA 2W68A 1MVEA 2WLPA 3RYKA 5FZ9A 1NXD1 2JDKA 3MFCA 4YVWA 1OKOA 2XJTA 4KGQA 5FPLA 1FT9A 1O59A 1JZ6A 1NKGA 2WSUA 1DCSA 1UQXA 1UKGA 2Z5WA 3LGRA 2MPFA 1ND2C 5FUIA 3SC7X 4QDQA 1S0EA 1S0CA 3CDZB 1HQWA 4V2VA 2D3SA 1ODNA 1XXNA 2CAVA 1JUHA 1NA1A 3VD3A 1JOJA 4E2GA 1RUC1 5F2WA 5FPXA 2ILMA 2VULA 3QOPA 4W6YA 4B1LA 3HNBM 1RMU1 3JB4C 2ZABA 2VUJA 2GSYA 2VNRA 4CUGA 4NROA 4LUMA 5C9AA 3HBZA 4XMIA 1RUF1 2XLGA 1WBLA 2SBAA 3MO4A 4M3CA 1SHWB 1VBB1 1GP4A 4O61A 4HBNA 4PLMA 4RGAA 3AMHA 1IGOA 1HN1A 1HN0A 1V6NA 1S2EA 4BXFA 4CDXA 3TAYA 1APNA 1F4AA 2VCAA 2Q1MA 2DTWA 2BGPA 1RUE1 3AP5A 5FP3A 1DZRA 1NCRA 4QXHA 5HV4A 2X09A 1QHDA 1OQ1A 1GFF2 3LEMA 5I0DA 1CGPA 4CCLA 3LSEA 1SLCA 1Y9QA 2VVFA 4LBQA 3RSJA 4BE3A 2R042 1CAVA 1LOBA 5CADA 3DXTA 5F39A 5JI7A 2A6YA 1L7LA 2VD7A 3IAQA 4AGRA 1W8HA 4BISA 3LSDA 3I8TA 1ACCA 3N3HA 4U2AA 3VLBB 2IZWA 1LOEA 2IXCA 2OW4A 2G4IA 4ZU4A 3THCA 1COV2 2WWSA 4IGOA 2GC2A 2PMWB 1F31A 2Y6JA 5EYXA 2LTNA 2VAUA 4JGYB 3BTAA 3MPPG 4NAMA 2B5HA 1VPHA 3BU7A 3RJRA 4DRRA 3MHZA 1OXCA 2OUHA 1QJU1 3FHIB 4FTEA 1ZRRA 3OB8A 4QPIC 5T5PA 5F32A 1SDDB 2MEV2 4N43A 1K5MA 4B1MA 1ASJ2 2WNUC 4XIKA 5F37A 3Q9OA 2WS93 1YIPA 1OFSA 1FMD2 3BOWA 1HLCA 2R061 4O9EA 5CISA 4MGTA 2ZEZA 4WBBA 1X7NA 1RB8G 4YW4A 1WW6A 1UMZA 5FJHA 4IV1C 4P5YA 3GHMA 2DVFA 3RPQA 2I07B 3GBGA 1J1TA 3VBOC 1H4HA 1W9SA 3TN92 2Y34A 2XJQA 5LEJA 2YBPA 3VBHA 1DQ4A 3UKTA 1E5SA 1D4M2 1YC61 2PAMA 4KU7A 4IEPA 2ZX4A 3FMGA 3ILFA 3RVHA 5DDJ3 1H4GA 2ES3A 2Y6LA 4AQSA 4CXYA 2E26A 4KWKA 4TWTA 4YZ2A 3POBA 1LOCA 2D44A 4Q4X2 2CGOA 5JZGA 1W8FA 1NT0A 5I8SA 2W92A 4MXWB 1CESA 5IFTA 1S2KA 5DAVA 5L9RA 1RC6A 1ND3A 5F7UA 3N9PA 2CNAA 3M3QA 4I3PA 1AX2A 2AREA 1U5ZA 3KV9A 1ZZBA 3SKVA 1WBFA 4W8JA 5JUVA 3MI8A 3FLRA 3WG4A 4HOOA 4GH4A 1W04A 3DV8A 2DVGA 1ZA7A 4QQHA 4EQVA 2ZEYA 2XQXA 2WNVB 5FTTC 5A7QA 5T5LA 3NV1A 4A41A 1G9AA 1FX5A 1H9PA 1RGSA 3JQXA 3NKTA 3RFRA 4EZ4A 5F5IA 1MQTA 4PDWB 1G9CA 1ZRIA 4CU6A 3U1XA 5KBFA 1G9BA 2R043 3VBUA 3WEZA 1W6OA 1DDLA 2ZGMA 4C91A 3VD9A 3ZXFA 2PLV1 5LBFA 3VZOA 4MHUA 4WM8B 2WIIB 1QJY1 1R081 3I59B 5K0UB 3UKNA 1LRHA 3LA7A 2WJSA 1COV3 1H0BA 4XEZA 4OHZA 1L3JA 1N1YA 1RUJ2 2BFUS 3VBFB 4QKBA 5K8SA 5LRSA 4AQ2A 5IJRA 4HONA 3PURA 3WHUA 5EYYA 3O0XA 3WOGA 3WW1A 4CUCA 2J1EA 1REDA 3OPZA 4B7EA 5FPVA 2D98A 3VBRC 5CFCC 3DECA 1PVC2 5BNOA 3I3QA 5C8CA 1X50A 4Y22B 2WS91 3T2OA 4Q26A 3VZLA 4CVUA 3GJBA 1FMD3 3ECQA 1JXNA 3JBG2 3RZZA 1UZVA 1PM4A 1WLDA 3E6BA 3H7YA 3SH3A 4E4SA 3K3NA 5KC5A 4IEYA 1AXYA 2A70A 5KR7A 3I2KA 4KWUA 5FCCA 4XUOA 3ZIXA 3RI8A 2VOTA 2XJRA 3P6BA 3C7EA 5LB6A 3T08A 1HDKA 1VBA2 5IWFA 4UBGA 5FO7B 1AR93 3TN93 4KG8A 1ZNPA 2Q1ZB 3DYMA 5GZCA 3ROUA 2DFBA 2GN7A 2PN5A 4PHZA 5LBCA 4XUNA 4N53B 1QXRA 4HKLA 5DDJ1 5F5QA 2AENA 1W8TA 2E63A 1HXS2 3IPVB 4K20A 4MGSA 5GLVA 3GDBA 1ZM1A 5T5OA 4Q4X3 3VDDA 2Q30A 1UYXA 4HFSA 2IFRA 4NHYA 4XJ8A 3S6PA 4DEQA 4DS0A 2QVSB 5BNPB 2J1AA 2W3JA 1OOPB 1OPMA 2F6BA 1ZVFA 3TNPB 1DQ1A 2ZGOA 3ZXLA 3LA2A 2BRTA 3GZUC 4KU8A 4BCUA 1W6NB 4CXXA 1ZRCA 1HIXA 3HQRA 3H7JA 3T4VA 2RJ2A 1KXGA 4BMBA 3EXUA 4NIAA 5IUQA 4A7KA 2ZX3A 5DQ0A 4D0QA 5BXXA 2W87A 2X29A 5FYHA 2PELA 2ZBJA 3R0RA 5EV7A 4RHV1 2VL4A 1UMHA 2OT7A 4XFIA 5C70A 5BY5A 2XWJB 2YUEA 1XRUA 3HJRA 1MS8A 1JI6A 1CVNA 1AL22 1K12A 2OZJA 4XFGA 1VBE1 2V4VA 2JD4A 2BU9A 5FZEA 1FNYA 2XWBB 5LBBA 3KGLA 3ITQA 1CZSA 2HWD2 3B5LB 3HQUA 2YPJA 4A3ZA 4MYEA 1RUJ3 2EXHA 5FPBA 1S0JA 1AYN3 4QHZA 1QKQA 1W8OA 1F2NA 3NJVA 4AEDB 2LM3A 1VLNA 2JE9A 1VIWB 1PIV2 2G1MA 3OPWA 4JTOA 3H0OA 4YVWC 1TG7A 3QD6A 5JR7B 5T55A 1PVC3 4L0PA 2D6NA 4AQTA 1O3RA 1O5UA 1Y43B 3HAGA 3MF6A 3CMGA 3WF0A 2VCMA 5L7OB 3NJZA 3PJQA 4B3NA 5IK4A 4GWNA 3M8LA 5E16A 4ATEA 4BZ4A 2ZHKA 3BN6A 2WA3A 2VCCA 3W9AA 2ARAA 3WDYA 5CBLA 1NA1C 2Z4FA 2HLEA 1WW5A 2WLQA 4JGYA 5FLIA 1MS0A 4LQRA 5K4LA 3ZKUA 4QX3A 4EWEA 5I8TA 4ASKA 1AR91 1WZXA 1ST8A 2YHJA 3WP3A 4LBNA 2WQ8A 2ZJCA 5C9AC 2YC2A 5ANQA 5FY1A 4NR1A 1S0DA 4LPLA 3WV6A 4I01A 1Y4WA 1HXS3 1RINA 4Q4V2 1TMF3 5J96B 5BYNA 3VD4A 1RUG2 4E4HA 3KHCA 4CDXC 5DAXA 2PAEA 2ZEXA 5IAVA 3I2DA 4Q5OA 2GC1A 2RM21 2XVLA 2Y33A 3S57A 3IWZA 1SFNA 3AMQA 1NCRC 5B4XA 1LODA 1HV0A 1YWKA 2ERFA 2VZQA 3AKTA 4DIQA 1STMA 5JAXA 4N90A 5FY9A 1DZTA 5CG8A 1TE1B 2RDSA 2E9QA 3O1OA 1V0AA 2QBXA 1E5RA 2H0BA 2Q4SA 5FZ0A 1S4CA 3LDRA 2O1QA 4LUKA 2YDEA 3WP6A 1UU4A 4XQDA 3TOJA 5F5CA 1WLCA 1UIJA 4MLOA 3U07A 4MXWA 3WF3A 4AHWA 1NCQB 3AMMA 3PUHA 2E53A 1G6NA 2YY1A 4RYDA 2RG4A 1KD7A 4YG0A 2KD7A 3GNEA 4FT8A 4LA2A 4C0HA 4KBBA 5HI0A 1QXPA 4N43C 1K5MC 2VQTA 5F5AA 4YLZA 3H3UA 3RMXA 2WNVA 3M3CA 4R9CA 4A44A 1C1FA 1XE8A 3KT7A 5E6HA 2HWD3 1QU0A 3IIAA 1AX1A 3ZYPA 2QQVA 2VXRA 4V2WA 4PI0A 1PMIA 1AYN1 1GICA 2NPIA 2P34A 3N7MA 3PVNA 5I93A 2C1FA 4PDWA 1F5JA 1J3QA 1HRI2 1V6OA 2WQZC 4FPGA 4PIXA 2R32A 2YC4A 3MF9A 1PIV3 2QZ3A 3OBRA 5A6YA 1PMHX 3HT1A 3RMYA 3JUUA 3J7HA 3D3AA 3PUSA 3VBHC 4LULA 5CZKA 3AP6A 4RS5B 4DXTA 4IE0A 4QKFA 2JG9B 5K0UA 3I59A 2R16A 4QDSA 3K4ZA 3VBFA 3B94A 4FO9A 4E8CA 4YG3A 4YGBA 3QH6A 5FPUA 1AUYA 3ME2A 5A3TA 5FXVA 1UY4A 5JZGC 5FMCA 3C8XA 1WW4A 2JDAA 1XSQA 3JD72 4G4FA 2R7EB 3I3DA 4E2QA 5A70A 1ND3C 4WM7B 5LY2A 1IHMA 1W03A 2A3XA 3MUY1 2GN3A 1D7PM 4EROA 4PBOA 2WL1A 3AL6A 4Y22A 4CDUB 4BOWA 5FUNA 4Y33A 4YYOA 2Q0AA 3NNFA 1PZ7A 5FY5A 3RWNA 3USSA 4GH4C 1W2OA 1H6YA 4HVQA 2P3IA 1YI7A 2VMDA 1TMF1 3OD4A 1UOBA 2D7FA 1RUG3 3FFQA 1S1AA 5C8WA 2CHHA 3PLQA 4U36A 1BVVA 3LB9A 2K46A 3DYOA 1ENXA 2XHKA 3WQBA 3VDBA 4L99A 3VD7A 4DRVA 2ZAAA 2RMU2 3NV4A 4LO8A 4XABA 1V6IA 4Z82A 4YGEA 3WF2A 1RXFA 1MQTC 2BPA2 2YBKA 1QDCA 1IPJA 1SPPB 3VKLA 4AR2A 5B4NA 3WUCA 1CX1A 1EAH2 3E97A 3ENRA 1V00A 4KWLA 4N53A 3UV9A 3VBUC 3WNMA 1QQP1 3H50A 2KXLA 5FO8B 3N9OA 2WA4A 2EXKA 4RGKA 1SLBA 1ULOA 2YC0A 3IPVA 3M3IA 1DFQA 2X5IB 5FMBA 1JZ3A 2RS13 3SHRA 3IAPA 1I1EA 4AEKA 4OMCA 1MZFA 3UESA 1RHI1 2JWPA 2JG8B 3P3PA 1DQ0A 3MIBA 5JWPA 5BNPA 1UO9A 3P1IA 4XACA 2WZPP 2D93A 1CIWA 2TNFA 1OOPA 2XMLA 1KFUL 3VD5A 3WW4A 2NYYA 2ZMLA 3G7DA 4LHSA 4C1WA 3MV01 5BNOC 5C8CC 5L73A 4KG0A 4GWMA 2F4PA 2BEOA 1W6NA 2QFEA 4Q0PA 4AVCA 1RUH1 5FOBB 4AFCA 5I0SA 3V0AB 5FYMA 1W8ZA 1EPWA 1ZBE1 4JGZB 3RRDA 1SZBA 1YQ2A 3RQ0A 1ZZ6A 4I30A 4AFDA 2DTYA 3ZMNA 4Q4W3 1GQGA 2WNEA 4NHKA 1BJQA 3FWEA 4LBKA 1XU2A 2AEYA 3AZXA 3MIHA 2VUAA 3NVCA 4UW5A 2NZ9A 5FKCA 4Z92B 4K7JA 3ZFEB 4FOYA 1UYPA 5FZAA 1JBCA 5FK7A 3VHOA 2VVDA 2XONA 2YGMA 2AUYA 4LBLA 4JDNA 4D7YA 1WUVA 5H9PA 1IS6A 1OLQA 1SBDA 5IVYA 5FXXA 5J98B 1RIRA 2Y6FA 4I0AA 1PM7A 1ULEA 3UT0A 2QE3A 4BQ4A 4XDQA 1RUC2 4K40A 5A1LA 1QJFA 4YG6A 1W6QA 4AVSA 3VDDC 4LTAA 3KSCA 1O4ZA 4AEDA 3MICA 2IXHA 4XFFA 1RMU2 4FOVA 3O1RA 1RUI1 3K2OA 3JD73 4OI1A 1LB2A 4GKXA 1A8MA 3GJAA 2HKXA 1SLLA 1RUF2 4G3YC 2PHLA 2DUPA 3BB6A 4Y4RA 2BERA 4PI2A 1VBB2 5L7OA 4EE2A 4QB1A 4URAA 4B7KA 1OHFA 5C5TA 4NMIA 4P08A 4CRQA 4XAAA 4P14A 2XG3A 3MYXA 5E89A 3KLSA 1POV0 1RUE2 2FDGA 2AR6A 1DQ2A 4IEVA 4JRLA 5EWSA 4BLIA 3K3OA 1W99A 4I09A 4PQQA 3MZHA 2I45A 4B4QA 1DU3D 3J8F1 5A80A 5FZBA 4OULA 1KS5A 3RZJA 2D5FA 4AAPA 3H8OA 1E57A 2ZGTA 3S30A 1JYVA 4FAHA 1LESA 4K9SA 5JXJA 5DXDA 4IL7A 2ADEA 3BU0A 4FPHA 1QXJA 1EPZA 1V9U3 2YU1A 2RS11 5DABA 5KXEA 1XB9A 3IBMA 4MO3M 2J1RA 4XTMA 2P3JA 3O1VA 1XYPA 2B8MA 2DUQA 2UWAA 2AEZA 2XVKA 3NV2A 1SFPA 5K9YA 1H2LA 2QQNA 4GWIA 1DYPA 1QJU2 1YFWA 3WNXA 2J22A 5EJ1B 1VRH1 3LF7A 3JB8A 3CNAA 4XJUA 4XPVA 4ZKTB 4R4XA 5L36A 4YM2A 1US2A 4Z2AA 2FDIA 1I3HA 2DCTA 2Z42A 5F3IA 2R062 5FYBA 3TB0A 2QQLA 4GB31 4Q8KA 2JDMA 5EIYB 1OC1A 1U0AA 2IC1A 1TEIA 1TVGA 4W6WA 1J59A 2WZR3 5JOYA 3F95A 4Q4W1 5G04L 2QKDA 1FOD1 5JPNB 3CJIB 2YMZA 3E5XA 4JGYC 2KR2A 4QX0A 2GNTA 4O9GA 3EHKA 5IK7A 4CYDA 3OD0A 1ULPA 4XDOA 5AVAA 4UFKA 1ENSA 2HWB1 2QQOA 1WCKA 2A3YA 4XQWA 1OI6A 1OD3A 1GLHA 2Y6KA 3VHPA 4QQLA 5I0RA 4IEOA 5FYIA 4XFHA 1NG0A 3U14A 4A6SA 4ES9A 1RUC3 3ZSMA 1AYM3 4OHVA 4QGNA 5GZDA 4QPGB 1UCXA 1O8SA 2AH2A 3CO2A 4K1ZA 2WR9A 3NNMA 5BNNB 1RMU3 5ISLA 1WA6X 3OTFA 3CKHA 3MW3A 3DXUA 1W0OA 5A7SA 5J09A 4C1XA 1S0BA 4M01A 3OGVA 1RUF3 5FOJB 4RGGA 3TRSB 3IDBB 4RS5A 1VBB3 5FJKA 3SITA 2YFZA 1IKQA 4R9BA 4F7ZA 2JG9A 4RFT0 1UXXX 2E32A 2RDRA 4N8MA 1JN2P 3NJYA 4IETA 1QEXA 1WCDJ 4N7IA 1RUE3 2YV8A 1NLQA 4P00B 5FYTA 1A3KA 1XE7A 2VBBA 4MSVA 3R6SA 1SLTA 4R9DA 1LOFA 3N9LA 1VBD1 4LO6B 4WM7A 5KXBA 4NWVA 1VAMA 2P6CA 2XQRA 5IVCA 4CDUA 3K46A 2LS6A 2PLV2 4QXCA 3MUZ1 1QJY2 4GWJA 1R082 4R52A 3B93A 2VBDA 2WNVC 4N9HA 1GQPA 4EZHA 1V9U1 1QWRA 3KZ4C 1K5JA 1CZVA 1A6CA 1UY3A 2GNBA 4RQPB 3BVCA 3LWCA 4XBQA 2XUMA 5FZ4A 5F3CA 3QLQA 1PHMA 1R64A 2HWC1 4A7YA 4BWOA 2JE8A 4QPYA 1QIQA 1QJU3 4PDWC 4A4AA 5J3UA 4JKKA 1SPPA 4M3CE 3GM8A 2LALA 4LO4B 2WS92 4OFGA 4FOWA 1SMVA 4HANA 2R063 1H2KA 2V4AA 3THTA 3O1UA 5L19A 1WCQA 2X5IA 5K0UC 2ZTNA 4BM8A 2WZR1 1LTEA 3C7FA 3SNMA 1RUNA 4LBOA 5BUVA 3VBFC 2GH8A 3RZKA 4NIHA 3CBNA 3WF4A 4CA9A 4LJHA 3AZVA 2RVAA 3H1WA 2YB7A 4GJZA 4XE9A 4CEYB 3GXUA 2W46A 5A7NA 3WCRA 2CWSA 3MW4A 2XXZA 2FQPA 2XKPA 2PHRA 4WVZA 4IE7A 3TEZA 1FPN1 2V5DA 2VE1A 2W0XA 3FE5A 3I2HA 4LOTA 4Q0QA 3D82A 4XOGA 2WQ4A 5DDJ2 3V0AA 1B09A 4A2UA 1BK1A 4JGZA 3F2ZA 3KV4A 4I0WB 1ZRFA 5F6LB 3WT3A 3TYJA 4XBNA 3KF5A 1AYM1 2RS53 2JDPA 2W52A 4FP3A 4BK4A 2GDFA 1ZA4A 3EMRA 4UT5A 1MVQA 4IEQA 3HNYM 4QM9A 5T52A 3ZN6B 4OCTA 2OPWA 3I2OA 1HB4A 4LBMA 3ZFEA 3ZSEA 2BW8A 1H1AA 2OX0A 1UU6A 1V6JA 3ZYGA 4N53C 3C7OA 2QQKA 4MV2A 4DO0A 2YU2A 3IDEA 4NO4A 5BNQA 2WFPA 4BK5A 4CPBA 2WABA 4A45A 5DZEA 3Q8FA 4QU2A 3LIGA 1IZ3A 3AXEA 3SKJE 3R4DB 1U5IA 4Y5Z0 4XUPA 4RHV2 2D6OX 1O3TA 2WYSA 2VTXJ 2ZMKA 3RGBA 5BNPC 2E7AA
chains in the Genus database with same CATH topology
2ZX2A 1OOPC 1VBE2 1F9KA 3IMNA 1UPSA 2PLV3 2KM2A 1YI9A 1Q8VA 1QJY3 1O5LA 1R083 1F8VA 5FBZA 3O5SA 4SBVA 1CAUB 3B9IA 4HVOA 2R1BA 2Y0IA 2Y26A 5H9SA 1QJZA 5C33A 3TWIA 3BIWE 3SCFA 4COUA 4PLOA 3SCGA 4W65A 2V09A 2JKBA 4HN0A 1EV11 1VBC1 5T5JA 1UW8A 1PO21 2DF7A 4NN0A 4LLOA 2ZA9A 4J1WA 4HK8A 1CQ9A 1LEDA 4LEJA 5C6CA 3D0JA 5JOXA 1WMEA 1UIKA 1JHNA 2IXJA 3GZAA 4LLFA 4HL0A 1AR92 4AEDC 2ZGSA 1JTZX 1LOAA 3PJYA 1AR71 1ULGA 1C8M1 4MZUA 1DF0A 1WW7A 4XF0A 3WQ0A 5BPXA 2JX9A 4D7SA 1BKZA 1ZBA1 5L7OC 3ZFFB 1N1TA 1PVXA 1GNHA 2QZ2A 3B00A 3ZXKA 1R1A3 2RM22 4JCKA 2RS51 3CJIA 3MPBA 5A32B 1C4RA 3EBRA 1YO8A 1TNRA 2XGXA 1J3RA 1W6PB 3KCXA 4DB5A 2VOVA 3OJBA 4K1YA 3GZTB 4EWDA 2EALA 3NSTA 2D3PA 2VY0A 3VHNA 1KS4A 2WKKA 4KL1A 2OVUA 2ZGLA 3AYCA 3B69A 4Q0UA 5JCTA 4QPGA 3WINE 1BBT3 1LR5A 2JEMA 3H3ZA 1S2BA 4XXPA 3WDTA 5BNNA 1MEC1 1NZCA 4RHV3 1VB2A 4BIFA 2RJLA 1VBE3 5A3LA 4EN0A 2OIIA 3FUQA 5FFOC 2A71A 1G7YA 1BQPA 2ZPXA 5F1RA 2CGNA 1F5FA 1W39A 4AI1A 4W6XA 1AYN2 4MGKE 1GNZA 4MGZE 2BYVE 1V6LA 2GMEA 2ZX0A 4IESA 2A6VA 1PGL1 2NLRA 3AZZA 1C28A 4S2FA 2DCZA 3ZPYA 2ZHMA 3INAA 1XNCA 2MNGA 3ES1A 3WD5A 4XYXA 1I6XA 1HKDA 4EN6B 1NLRA 3KB5A 5CVRA 3WY6A 2DU1A 2W39A 5SV8A 2DCJA 3E5QA 2YXSA 4RQPA 5J7MA 1AR61 3NW4A 1MZ6A 4QQ2A 1LGCA 2IXKA 1BEV3 3BCWA 2BNNA 1AJOA 3E6DA 3AK0A 3L2YA 1GZCA 1VALA 4ZXKA 1OLRA 4L2NA 4H7MA 3ETQA 2ZKLA 3O14A 4KNCA 1ZZ9A 4RS5C 3WCSA 1TMF2 2JG9C 1ZYBA 2JE7A 1R1A1 2EVXA 2RM23 3DN7A 4Z07A 4Z1VA 4N7UA 4YVSB 5HCAA 3AJYA 3ILNA 4CEYA 2WSVA 2PHUA 1LOFC 1SACA 3GBWA 4WM7C 1LHOA 5JIUA 1FXZA 4ZU5A 1QQP2 4CDUC 2GZWA 1SLAA 2UWBA 3FFZA 4XJWA 2ARBA 4FTBA 3DGTA 1KJRA 1H8TB 2ZHLA 1H2NA 3OGGA 1RHI2 1BBT1 3B02A 4IV3B 4ORFA 4Q0SA 2ETEA 3J4UH 3ZN6A 3RYRA 1DGRN 2CY6A 5DG1A 3P3NA 4OHXA 5KHHA 1RUH2 4YW3A 3SISA 4Z8BA 4AK3A 3AKQA 1ZBE2 3M70A 5KHJA 4XILA 2X5IC 5I91A 1LOGA 3UL2A 3N4MA 1Z78A 1DYKA 2WFF1 3ELNA 5A3MA 2XPJA 2QJVA 2Z79A 4H55A 1DGWX 4JDMA 1QOSA 4DFSA 2W08A 1OQEA 3DL3A 4YZ3A 1FI2A 1ENQA 1SBFA 5GJ6A 1NE6A 4I3GA 3DPRB 2LUWA 3KD4A 4COWA 1CAUA 2XB6C 4JGZC 3ZXGA 1IPKA 2GNDA 1CR7A 5EZWA 3ZX7A 1YLLA 1RUI2 3WQ7A 4P9IA 1BEV1 4JTNA 4YW2A 3AFGA 2PHTA 4OI2A 4ES8A 1MZ5A 4E2SA 2P37A 4L8QA 3ZFEC 4AQ6A 3LA3A 1UAIA 3JU9A 4LHKA 4XJ9A 3MLJA 1NY71 3PVBB 4FVVA 2MHFA 4P9WA 4HVRA 1FYUA 3B9CA 2ZOEB 1ZZCA 4CDQB 2NN8A 4AGVA 4QXKA 4PIYA 4P9GA 3J8F2 5HXVA 1M4WA 5AFEA 2DYCA 3ILRA 5FLHA 4CZSA 4YZ1A 4CP0A 1MZEA 4WZFA 1QQP3 4QX5A 5DZFA 1LGNA 1AHSA 2BVVA 3ZFFA 1D2QA 2ZCWA 4LHNA 1H30A 1J3PA 2RS12 4Y1XA 1SLIA 4MGYE 4YNIA 3OYWB 1RHI3 2ZZJA 5A32A 2XBO1 1UZYA 3USUB 2VMGA 2DU0A 3KGZA 1W6PA 5T3NA 1VRH2 1Q8QA 1S55A 3SXWA 2ET1A 1GANA 1RVF1 5AC91 1EYBA 4GB32 4YW5A 1RUH3 1ZBE3 4Q4W2 5BV6A 1G9DA 1FOD2 3A0NA 4H14A 3U11A 2HEYF 2X53S 2PTMA 2YGLA 1QDOA 1YFYA 3H9AA 1KDMA 1EY2A 2B7YA 4AVVA 2HWB2 1ZRDA 4FPLA 2I2SA 4OHWA 2IWGB 2H0VA 4YM0A 4WM8A 2AYHA 1O3QA 3FX3A 3QCWA 3QH7A 5JDBA 4Q1PA 3MEPA 2ZGNA 4GQ7A 3I54A 4COZA 1MR5A 3AJZA 1WMFA 3CJIC 1RUI3 4PCRA 3ZMOA 1AF9A 2FZ2A 4LE4A 1DGLA 4EN9B 2CTVA 3HIFA 1A8DA 1UD1A 3I7DA 4XMAA 2OA2A 4P9LA 2FMDA 1VR3A 4D94A 2K2SA 1QJX1 4QPGC 4ISQA 4YZ5A 1IOAA 1QF3A 1REFA 1VBD2 2I74A 5BNNC 3ZSKA 1POV1 3J8F3 1AR81 3ATGA 4GXLA 1UF2C 1TNFA 2A6XA 2OUJA 5J48A 3THPA 4Q1RA 4HK9A 4LHLA 3MFAA 4NHLA 3ZYRA 3FLPA 1BVP1 4AI8A 3GBFA 3WG1A 1V9U2 2BFUL 4Q4Y1 1HX6A 1LECA 4OLLA 1OSGA 4YVSA 3AFKA 2PFWA 2HWC2 1QH6A 4BLJA 1VRH3 5J36A 4JQRA 1FNZA 4IXLA 4FP2A 5JOWA 1SBEA 2VMHA 3URFA 3DF0A 3LOBA 3A4UA 4AGGA 4GB33 3JZVA 3KT4A 3WDXA 2PHFA 4DQAA 2CL2A 3NWKA 3RNSA 2RE9A 1H8TA 2WZR2 2VW1A 4QMAA 3WUDA 1FOD3 4CEWB 5GZGA 1LKNA 5FAXA 4OZXA 1Q56A 4RQPC 2EAKA 5AVPA 2VOKA 2QUOA 3DUIA 4I2OA 1CJDA 4NPRA 2DUOA 2HWB3 5DUVA 3WQ1A 5DZGA 1FPN2 1WLTA 3ACLA 4XFBA 1JYIA 3K48A 4WZCA 4FSJA 2ZGPA 3HN1A 4I0BA 1QNYA 2ENRA 1OA3A 3PTYA 1NA1B 4HT1T 1AYM2 1C1LA 1OD5A 5SV5A 1REEA 2VU9A 1QH7A 4YW1A 4FPCA 3V64A 4JV4A 4MH0E 3RJ2X 4X8PA 1N47A 4TYSA 3VHRA 3QBQA 1BXHA 4CEYC 2RJKA 2XL9A 5D8AB 2B42B 2TUNA 4XQ4A 1SFYA 2FMYA 4M3CB 3DPRA 4DY3A 4HLTA 1RTVA 1XYNA 1NQJA 1C5HA 3NO8A 1X8MA 1PNFA 2E6VA 4FPJA 1HQNA 2JDZA 3EQEA 1DLLA 3N7KA 1HQLA 3MIFA 4R4ZA 3AYDA 1VBD3 1AJKA 3BODA 1O3SA 3O12A 2GH2A 1Y3TA 2WINB 3RYPA 4M3CF 4LBQD 3ALQA 4LR4A 3PMSA 1V70A 2ARXA 2KA3A 3U4XA 5KC6A 3WLUA 4X6QB 4E4DX 2B9UA 4AE2A 1DGRA 3LCPA 1LU2A 1YXWA 2ZHNA 2Y38A 1GZ9A 2ZX1A 1Y7BA 4CDQA 5HCBA 4FXKB 2HWC3 3T2TA 4Y24A 2XJVA 1TME3 4B29A 2BWCA 4GALA 2BNOA 1EV12 1VBC2 3CEWA 2QNKA 3OCPA 1W6MB 1PO22 2RS33 1KQRA 1VJ2A 2XJSA 4LT5A 1LHUA 1O4TA 5ACA3 2RR11 2A7AA 5LRRA 3FBYA 4IEZA 5FREA 3VKFC 3J26N 4INDA 4K3UA 4L11A 2BTVC 3OYWA 2A3WA 1CAWB 4LBJA 1NCQA 1QY4A 3USUA 4J6GA 2XL7A 1AR72 1C8M2 2A75A 3E6CC 3VZNA 3O7OA 4H3WA 1H9WA 2NM1A 1FPN3 2VOXA 2C9AA 2QDNA 3ZXDA 4Y1UA 1WMDA 1ZBA2 4FOQA 4Y1VA 2R0HA 4FCAA 4BYYA 2RS52 3UJOA 1YIFA 1PGW1 4JVAA 1YFUA 4URTA 1ND3B 3AP9A 5B2GB 4RL7A 3FBMA 1D2SA 1OA2A 3R05A 4Q8LA 4FQZA 1B35B 5D1IA 4HN1A 2YROA 3WVJA 3ZFFC 2HWF1 2B46X 3BPZA 3ZYJB 1NLSA 5GALA 3ZN4A 1MEC2 2D40A 2HYKA 4EN8B 3EJKA 4GA9A 3HT2A 4HKOA 1RUD1 4AI0A 1Q8SA 1Q8OA 4Y4YA 1W6OB 2XVGA 3S7IA 1ENRA 4PIZA 3SCHA 1JH5A 5CFDB 4R9AA 3VKMA 2H6CA 2JICA 1X36A 5K7PA 4KH9A 5FRAA 2Q8OA 2PYTA 1PGL2 4Y20B 4META 1TME1 4E9KA 4XZPA 3WDUA 2PHDA 1EV13 1VBC3 2IFWA 1GZWB 4XHXA 2RS31 1PO23 4RR3B 5GLWA 2HEWF 3OY8B 2DURA 2DCYA 3IM0A 5ACA1 4WM8C 5DUXA 4WVMB 3ZIWA 3UJQA 4UXAA 2BNMA 2D6KA 2ZS6B 2XKOA 3MLLA 5JPMB 1AR62 4QGMA 2JG8A 4Y26A 1I9RA 1C8NA 5GKAC 1AR73 4K21A 5F6KA 1C8M3 3ZXEA 3BALA 1RL3A 1WD4A 3AMNA 3WDVA 4CDWB 2B39A 4PBPA 3IN9A 3VKNA 1ZBA3 4QM8A 2HWE3 2EF6A 3CU7A 1I5ZA 1KDKA 1R1A2 5E88A 4CEWA 3WDWA 1VAKA 5C4WB 2O0OA 1PK6B 5JOZA 1M06G 5ABJB 3O0WA 4PJYA 1N1VA 4NWWA 2ZMNA 2R071 1URXA 3VZJA 4XJZA 1WA4A 5GZFA 4OI0A 4NOTA 3RS6A 5JI9A 3IKWA 3WHTA 2GAUA 1N1SA 2HEVF 1H8VA 1T6GC 4AHXA 4OUSA 3SMHA 1BBT2 3AYEA 5FQ0B 1MEC3 4YVSC 4BMEA 3VZKA 5IT6A 4IEUA 2JENA 2DWRA 4LNVA 5D8AA 5KXCA 1Z7S1 4CP1A 1HRV1 2V73A 3MIGA 1BYHA 4MVTA 4HSJA 4JC1A 4GKYA 4BIOA 5JLVA 3ZO0B 3VKOA 1H8TC 3PVEA 4SLIA 1YYNA 3M3EA 5KXDA 4HETA 1R091 2WFF2 4IV3C 5EFUA 4FBFA 4GMP1 3U0ZA 2JXAA 1U5XA 1YRZA 1NYWA 5FMOS 3WW3A 1YJKA 2BGCA 4RD7A 1PO13 2XLFA 4S2HA 4UW6A 4C90A 4E4ZA 5JSOA 5I0TA 3ZDSA 1NOVA 2GNMA 2A73B 1BZWA 4QT6A 4FXGB 3KCCA 3POSA 3LKJA 1AR63 5A33B 4DINB 1BEV2 3L2HA 4EJRA 3D5OA 1O4YA 2N7GA 2NMOA 2DVAA 1ULFA 3AB0A 4LO7A 4BQ1A 1W6MA 3SLIA 4XF4A 5JIAA 4IQPA 3VBSB 1NY72 4K8FA 2VVEA 2HWE1 3DPRC 4EV0A 5CB7A 1VB4A 2XJUA 4BA6A 4G9SB 1CAWA 4H7LA 2E7TA 2E51A 5TSWA 3S7EA 1X82A 1VP6A 3BOPA 1YNAA 2R49A 4AVTA 4F83A 5CIRA 4F8AA 3ZFGB 4BHPA 1CONA 1R1ZA 5IK8A 1AX0A 2WT2A 1XU1A 3VN4A 3AX4A 4LA3A 1C3HA 4J1XA 3VGIA 4UBHA 1SCRA 3CL1A 3KT1A 1RITA 2XBO2 2VPVA 4CDQC 1EP0A 4OVEA 2A6WA 2GMPA 1S0IA 4DZGA 2K9ZA 4M0NA 3AP4A 4AHYA 2A6ZA 1VAVA 2YZ4A 4Z2WA 4XETA 3NAPB 5AC92 1RVF2 2NP0A 1B35A 2FHRA 1DHKB 1SDWA 3ZVXA 2ATFA 4GMP0 3PVOA 3R4UA 4JDOA 3ZXAC 1V6MA 2E7QA 2WFF3 4ASMB 1NCQC 1GYKA 1NXMA 2ET7A 4GULA 3AM2A 1ZREA 2BQPA 5DUUA 1X33A 1ZZ8A 4D3WA 2HJIA 1PO11 4DOUA 4WVVA 1C5IA 1S0GA 3CJXA 5T54A 5CFDA 5T50A 3SH4A 1UU5A 3PNAA 4AW7A 1WGPA 3WG3A 4F3JA 4TLFA 3WR0A 2ZGQA 2R0FA 1LENA 1QNWA 4Y20A 1YJLA 4IERA 1RJ7A 1LEMA 2MEV3 1GZWA 1BMV1 1ASJ3 2R1DA 1ND2B 4RR3A 2UYBA 4YZ4A 4YSFA 1HW5A 3NKGA 3OY8A 3R4SA 4B8EA 1SCSA 4WVMA 4A3XA 4AFBA 4B4RA 1XNBA 1DBNA 3LOIA 1QJX2 2VQ0A 5GZEA 1AR82 1GKBA 2XH6A 1D4M3 4DY5A 4XF3A 4YFZA 2D97A 4CDWA 1YFXA 3JQWA 1CAXB 3WX5A 1U5YA 4L97A 3APBA 4ONUA 5FPZA 4AEMA 4HSLA 3PMEA 4Q4Y2 3G6JB 3D8CA 1FATA 5C4WA 2EIGA 1X8EA 1UX6A 2XBO3 1PK6A 4Y1ZA 5ABJA 1LCLA 3FZ3A 1ULCA 2ZZQA 3W59A 4DXZA 2NQYA 1AVBA 4FPKA 4LE3A 1BCXA 5AC93 1RVF3 3I4IA 3OBTA 5H9RA 1H1MA 1UN1A 4CTEA 5IK5A 3HMYA 1DIWA 3K51A 1QOOA 4XTPA 3KM5A 4DNYA 3AMPA 4NVPA 1JYCA 2Z69A 4D69A 4DMIA 5FQ0A 4FPYA 4FQ4A 1UKRA 4MGIE 2JG8C 4QPIB 3POYA <