4U36A

Crystal structure of a seed lectin from vatairea macrocarpa complexed with tn-antigen
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
233
structure length
229
Chain Sequence
b'SEVVSFSFTKFNPNPKDIILQGDALVTSKGKLQLTKVKDGKPVDHSLGRALYAAPIHIWDDSTDRVASFATSFSFVVEAPDESKTADGIAFFLAPPDTQPQKDGGFLGLFNDIQTVAVEFDTFSNTWDPSARHIGINVNSIESMKYVKWGWENGKVANVYISYEASTKTLTASLTYPSNATSYIVSANVDLKSALPEWVRVGFSATSGLSRDHVETHDVLDWSFTSTLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Seed lectin
publication title High-resolution structure of a new Tn antigen-binding lectin from Vatairea macrocarpa and a comparative analysis of Tn-binding legume lectins.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 51
structure length 229
sequence length 233
ec nomenclature
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4u36A00
1SLCA 1V6JA 5JOZA 3PVOA 3DGTA 1SCRA 1EPWA 5DZEA 3RMYA 3IMNA 5GZDA 1QF3A 3FLTA 1FNYA 1HQLA 1SBDA 2DUOA 5JDBA 1PZ7A 4U2AA 3V0AB 2WLQA 1KQRA 1ENRA 2PHUA 1GSLA 3NV3A 2ZHNA 2R0HA 1W6PA 1V00A 4PBOA 4D69A 1QOTA 1LEMA 1XQNA 2JD4A 4LBQD 4LBLA 5EYYA 4Y20A 2D3PA 4FOYA 5KXEA 2A71A 1ONAA 3OGGA 2YXSA 4FPJA 4XYXA 1DZQA 1JBCA 1GZWB 4FQZA 2WNEA 4FPEA 2DVAA 3RQ0A 4AWDA 1C1FA 2ZMNA 1A78A 1IS6A 2UURA 1G9CA 3ZSJA 1QNWA 1CONA 1V6KA 4LBQB 1WLWA 2Z42A 2JE7A 2R1DA 2JE9A 2W39A 1JYCA 3SH4A 1MACA 3PVNA 3TB0A 1CPNA 4NO4A 3UL2A 5DUWA 2D6LX 1GZCA 3OBRA 1MS3A 1N3PA 1LEDA 4C1WA 2OVUA 2VW0A 4AVVA 4WV8A 3M2MA 1LOCA 2CWMA 3WG2A 3M3QA 1BQPA 3APBA 5E88A 4LBNA 1AZDA 3LSDA 3ILFA 1SLTA 1WD3A 2EIGA 4XHXA 2A70A 1SBEA 2VU9A 1PZ8A 1O4YA 2D6KA 1AJKA 5T5PA 4YGDA 3V0BA 1MVQA 5HCAA 5KXBA 3FLRA 3FFZA 3WNXA 4RA0A 3ZXEA 2EAKA 4KBBA 3AP9A 1NXD1 1Y7BA 2DV9A 2GN3A 1KITA 1YO8A 4R9BA 4YW1A 4LBOA 1GZ9A 4FP2A 4ATEA 1V6OA 1JOJA 1QU0A 1UX6A 1GNZA 4FP3A 2NM1A 3WV6A 2PHTA 3AJYA 3ZXFA 2AYHA 3ATGA 5H9RA 4XIKA 4LBMA 4YGCA 3ZYRA 4CTEA 2DYCA 1UN1A 5JMCA 2C5DA 1V6IA 2GN7A 2ZAAA 1CESA 1D2SA 2OUJA 3WUCA 1N1YA 2CTVA 4XDQA 1KDKA 4YW2A 1LHWA 2XG3A 2E53A 1LOFC 3B9CA 4R9DA 4Y22B 3V64A 1YYNA 1X50A 4GALA 2JKBA 5FRAA 1N3OA 1SLBA 1WBFA 2GNBA 3JUUA 2UWAA 2A6YA 4AYUA 1PZ9A 4GKXA 3ZXJA 4C1XA 3ILNA 3HN1A 5CAZA 3RS6A 1BJQA 5EYXA 3WDTA 4DQAA 3V0AA 3QCWA 1DFQA 3AYEA 4YM1A 3O0VA 3ZXLA 5JVVA 5GLVA 3ZSKA 1Q8QA 1QMJA 2DTYA 3ENRA 5JOYA 1LHOA 3WUDA 2NYYA 5F5QA 1LHUA 1I3HA 5GALA 4BPZA 3B01A 1DQ5A 1LODA 4FOWA 1YXWA 3MPPG 4FPHA 4XJ9A 3D5OA 3UJQA 4K21A 5DZGA 1Q8SA 1GZWA 1FNZA 2DVDA 4FPFA 3SLIA 3UJOA 3WG1A 1AF9A 3U4XA 3M1HA 5GZEA 5GLUA 1LOFA 4YGBA 2AREA 2VUAA 3AP4A 1S0FA 1YIFA 1AVBA 2WT1A 3O5SA 3POWA 3ZSLA 2JJ6A 5E89A 5HCBA 1LECA 4P14A 2A7AA 5T5OA 1UKGA 1UZYA 1W6NB 2JDZA 2A6VA 3CNAA 1KJRA 1DQ6A 1LGBA 1LGCA 3ASIA 1NLSA 1W6OB 4RL7A 4DFSA 5IT6A 4P9WA 1S0GA 2I2SA 3WOGA 1HLCA 2DUPA 3AZVA 3N7MA 4JRAA 4YW5A 2GNMA 1UPSA 2ZGUA 3A0KA 4XILA 3A4UA 3USUB 4JC1A 1S0CA 2R16A 4ZKTB 1LHNA 1ZM1A 1Q8VA 3M3CA 3VUOA 2ZZJA 4YG3A 3BODA 5AVAA 4XJAA 1MS5A 1MZ6A 2C9AA 1LOEA 4M3CE 1D0HA 4XBNA 5T50A 1SACA 1IS4A 4XMAA 1FATA 3WZ1A 2WKKA 1WBLA 1S0DA 3OY8B 4ISRA 4R9CA 1IKQA 4XBQA 2WSVA 4UW5A 1LULA 1OKQA 3VKOA 1G9FA 2D6PA 4YM3A 1W6MB 3POSA 1QOOA 4UW3A 2NN8A 1DIWA 1FX5A 1W6QB 2ES3A 1AJOA 2W52A 2WQZC 2A3YA 2WT0A 3JU9A 3KM5A 1G86A 5T5LA 2NP0A 5H9SA 1MS0A 5T55A 3MW2A 4WZFA 2A6ZA 1WW7A 2P3KA 3NWKA 4F83A 1H9PA 3DUIA 3FBYA 2WT2A 4NOTA 2CWSA 4P9XA 1GANA 5JLVA 4DRVA 3AX4A 1WUVA 3MEPA 2ZABA 1GLHA 1V6LA 2D6OX 1W0PA 2PHWA 4FPLA 1UL9A 2P3IA 2DURA 2GMMA 1BXHA 4I30A 1MZ5A 1UMZA 1A3KA 1LU1A 4Y26A 4BM8A 2G4IA 4YZ4A 1N1VA 4BQ1A 4UW6A 3A0NA 4YZ3A 1JYIA 2ZGOA 1Z0HA 2AGSA 4YM2A 1F9KA 2DUQA 3IKWA 4FPGA 4YGEA 4M3CF 2PHXA 2ZGPA 4JCKA 4M3CA 4Z8BA 2ARBA 4XBLA 2ERFA 1Q8OA 1ENSA 1S0JA 4BLJA 2LTNA 3BOPA 3PJQA 1YRZA 1C1LA 5LK5A 1LCLA 2ZGRA 1CPMA 1KRIA 4ASMB 2ZGNA 5L73A 1MVEA 2GNTA 1MS8A 4XXAA 3VKFC 3W58A 1DQ4A 1ULEA 2D3SA 3WDYA 3HR9A 1JN2P 1GBGA 1LGNA 2SBAA 1IS5A 2ZGLA 3VKMA 4PCRA 5F9TA 1DYKA 1W0OA 2DVFA 2GALA 4AGRA 4Y1XA 4YZ1A 1V6NA 4WVVA 2V73A 4YFWA 2VH9A 3AXDA 1ULGA 3POYA 2A3WA 1UAIA 5GM0A 3WDUA 3RRDA 4GWNA 4XOGA 1MS4A 2P34A 3VKLA 5IK7A 3AK0A 2GNDA 2WJSA 1ULFA 1N3QA 4M3CB 4FQ4A 3D6EA 2ZACA 2A6WA 4YW4A 1LJ7A 3I4IA 1JW6A 4YG6A 1LOGA 1WCSA 4ITCA 1IKPA 1C57A 2ZA9A 4R9AA 4XTMA 4GWMA 1CN1A 1LOAA 4AGVA 5BYNA 3L2YA 1W6PB 3NV1A 5GLTA 2YZ4A 1TEIA 3PMEA 3AP7A 4ISQA 5H9PA 4YM0A 1VALA 1H30A 4GA9A 4GKYA 2E7QA 2R0FA 4IQPA 2DWRA 3LSEA 4TZDA 2ZGTA 1QDOA 3N7JA 3IN9A 3OJBA 1W6QA 1ULCA 5GJ6A 2CY6A 2OW4A 1QGLA 4HL0A 4OZXA 2BQPA 1AXKA 5E8AA 3M3EA 1AX1A 1GKBA 1FAYA 1AXZA 1CIWA 1LTEA 1G9AA 3ZXKA 1Z78A 4Q8LA 5DG2A 2EALA 3VKNA 2ARXA 1UZZA 4LBQA 2ZHLA 5GZFA 1WD4A 1R1ZA 3ZYPA 1SLAA 2ENRA 1YI7A 4PQ9A 1GNHA 1S0BA 3FUOA 5DXDA 3D4KA 1J1TA 5HCFA 4BOWA 1SCSA 4K20A 4FPCA 3C2UA 1VLNA 2H0BA 4XTPA 1G9BA 5CBLA 2PHFA 1IOAA 4AVTA 5FREA 2Q5TA 5IUQA 3R05A 1V6MA 2B7YA 2CL2A 1GYKA 1Q56A 2TEPA 4BLIA 4Q8KA 2UU8A 3AP6A 3V0BB 1U0AA 4YG0A 3AYCA 3AJZA 4XXPA 1LOBA 1CVNA 1AXYA 1OQ1A 5DUVA 3H0OA 3WG3A 2CYFA 3ZSMA 2DTWA 4XZPA 4LBKA 1JXNA 4U36A 1APNA 3M3OA 5EXOA 4AGGA 1F31A 2FMDA 5CNAA 4YW3A 3N3HA 3OPZA 2YROA 5SV8A 3WVJA 1I1EA 3B00A 2V5YA 3IPVB 1WLCA 2GMEA 4M01A 2VW2A 1DGLA 2ZHKA 4HANA 1BZWA 1RIRA 4SLIA 4M00A 2D3RA 3WDVA 3B3QE 3AFKA 3GNEA 3WCRA 4YFZA 4XJZA 2E6VA 4YZ5A 2P3JA 2ZGMA 3BTAA 3O0XA 2NMOA 3R4SA 4XE9A 1DQ0A 5KXDA 3NV4A 4K1YA 5IK5A 1CJPA 3AYDA 3I8TA 2DU0A 3WG4A 4Y22A 2W68A 4CRQA 5KXCA 3RG0A 4XHBA 1QKQA 4H55A 3OYWB 3QLQA 1VAVA 1QOSA 1ZA4A 3O0WA 2FHRA 5GLWA 5CB7A 2YMZA 1MS9A 3B69A 3TAYA 1DBNA 1DHKB 5CA6A 3ZVXA 5EWSA 1DQ1A 3O12A 2EXHA 2P37A 3AZWA 2XB6C 4Q26A 3UK9A 2JECA 4TYSA 4FOVA 1GV9A 1HQWA 1SBFA 2GMPA 1DQ2A 3KQRA 4Y24A 1BYHA 1VAMA 2PHRA 3T2TA 3WDXA 2W08A 2E7TA 1FV3A 2HYKA 2AENA 3R4UA 5T54A 3T1LA 4FPOB 4FPYA 1S1AA 3OBTA 5JOWA 1RITA 2R49A 3AZXA 1W6NA 1WW5A 2WSUA 4Y1ZA 3FLPA 2A5ZA 1LHVA 2A75A 2PELA 4DRRA 2RHPA 4PBPA 1W6OA 4FOQA 2ZKNA 2DU1A 2VW1A 4XJWA 2D43A 5T52A 1WLDA 2UWCA 1H9WA 1JUIA 1KJLA 3AP5A 4FVVA 3USUA 5IK8A 1QNYA 1BKZA 1LU2A 2EF6A 3BIWE 3Q9OA 1IS3A 1GICA 4LBJA 1F5FA 3LCPA 2A3XA 4BMBA 5DZFA 3WDWA 2VY0A 1S0EA 4Q27A 2D44A 4XMIA 4DS0A 2LALA 3RMXA 1KDMA 1MR5A 3IM0A 2NMNA 4DPNA 3W59A 4UW4A 3SISA 4YLZA 5GZCA 5GLZA 3ILRA 3OY8A 3N35A 2R1BA 4Y20B 5T5JA 5JOXA 3IPVA 4ZXKA 4Y1VA 2AR6A 1URXA 3SH3A 1B09A 1O4ZA 1W6MA 3AXEA 2ZMLA 3HMYA 1G7YA 2EXJA 1LENA 5GZGA 1N1SA 2E51A 3AZZA 4Y1UA 1RINA 1SLIA 2ZMKA 1ENQA 3SNMA 2DVBA 1G8WA 3PVEA 1MS1A 4Q1PA 2VXRA 4K1ZA 4P9YA 1WW6A 1ULDA 5IK4A 3SITA 2KM2A 3T1MA 1DLLA 2EXKA 4L8QA 2ZGKA 2UWBA 4AVSA 4Q2FA 2YV8A 3VV1A 3OYWA 5DUXA 4GXLA 3N36A 1CR7A 3V65A 2AUYA 4W65A 3N7KA 1C4RA 3N7LA 2ZGSA 3ZPYA 3FUQA 4ATFA 1HKDA 2A6XA 5H9QA 2ZBJA 1FYUA 2ZHMA 3MW4A 3NV2A 1DYPA 1N1TA 2P2KA 1WW4A 4XJUA 2AH2A 2DVGA 1LESA 2GDFA 1SFYA 2EXIA 4BMEA 3WLUA 2ZGQA 4MYEA 3MW3A 3AYAA 1CQ9A 1OFSA 5DG1A 4Q1RA 3INAA 1AX0A 1QDCA 4XIOA 3SH5A 4CZSA 3AZYA 4YZ2A 4Y1YA 3GALA 3WCSA 1A8DA 1AX2A 4PF5A 3RSJA 2OUHA 4XJ8A 2CNAA 4FPKA 2SLIA 2D7FA 5DUUA 1N47A 1G9DA 2D6NA 1Q8PA 4WVWA 2NZ9A 2D6MA 1JHNA 1VIWB 2YY1A 1SLLA 3WHUA 1HDKA 1S0IA 1FV2A 3WHTA
chains in the Genus database with same CATH superfamily
5FK8A 4XVHA 4AI9A 2FDJA 1NXMA 1ZBE1 2QZ3A 3DGTA 5IJRA 5LA2A 3RMYA 5J98B 1OA2A 4COUA 5A70A 3FLTA 1FNYA 1QJU1 1PO11 1YFXA 1W04A 3RZKA 3V0AB 1RHI2 3I3EA 3EO6A 5IFPA 2PHUA 4NROA 5IVFA 3NV3A 2JKXA 3LDRA 5FZFA 2EIDA 3PURA 2QQMA 4PBOA 4Y5TA 3MF9A 1HRI2 3MFAA 4ZPIA 3X29B 1XQNA 4UBGA 4OLLA 4LOSA 4LBLA 1DGRA 5EYYA 3ZO0B 2D3PA 3FN9A 1JOPA 1O3RA 3OEBA 3OGGA 2YXSA 4D6RA 3NJZA 4FQZA 4FPEA 3S5AA 5A7WA 3N9QA 1Q43A 3RPQA 2P6HA 3EBRA 2YC4A 3ZSJA 2ZXQA 1RB8G 1HB1A 1V6KA 1RUOA 4RYDA 5L19A 1D2QA 2AEYA 2ID4A 2Q30A 3MIFA 4V1PA 2R1DA 4E8DA 4CDUB 1NCRB 5EZWA 2BGCA 2W39A 2VMIA 5LB6A 1VRH3 5CZKA 5DUWA 2XHNA 2D6LX 5FY7A 1GZCA 2UY8A 2JE8A 1J3PA 4N8MA 2QTWB 5FXZA 1MS3A 1POV3 2VW0A 3E5UA 3H9AA 5TSWA 2CWMA 4IV1A 3KV9A 2QQJA 4QPWA 3DYPA 3QOPA 1SLTA 2EIGA 4XHXA 4B7EA 5FUNA 5JXHA 1JYWA 3BTXA 3EMRA 3BTYA 1PK6B 1PZ8A 1AJKA 3D82A 2ZX0A 4Y5Z0 4YGDA 4JKMA 5T5PA 4GJZA 4BDVB 3NMBA 2OX0A 1AR62 2RS52 1B35C 2EAKA 4KBBA 1RUF3 3AP9A 5FTTC 2OIIA 1NXD1 3H3ZA 2OA2A 3ECQA 3VBHA 4R9BA 1DLCA 4QQLA 4EZHA 1V6OA 3DYMA 2VBDA 5FYZA 1UX6A 3HPNA 1IG0A 2B9UA 3NNLA 4XAAA 4AVAA 2PHTA 3VDDB 1H8TB 2W91A 2XJQA 3AVRA 5H9RA 2WFF2 3ZYRA 2DYCA 4TTGA 4LHLA 1F2NA 4C0BA 3MLKA 4XFFA 4ORFA 1OOPA 4KWLA 4YWAA 1FPN3 2J22A 1KDKA 2FZ1A 4YW2A 1W28A 2Z5WA 1LOFC 2R7EB 4O7XA 2VTFA 4QPIA 1QQP3 3I3QA 1OKOA 4R9DA 4Y22B 4CCKA 3VD3A 2JKBA 1XU1A 1N3OA 1NLRA 4OYUA 4V2VA 4B3NA 1VBD2 5C4WA 2WA4A 1YI9A 2YC0A 3OSDA 4YARA 4IERA 3RS6A 4W6XA 5SV5A 1CZVA 3BIEA 1DGWA 3VZKA 1YUDA 1DFQA 3AYEA 4FCAA 3O0VA 4BE3A 5F7UA 1QMJA 1XU2A 2RM21 3SCGA 5IHRA 4AEDC 1ZRIA 2GC1A 2NYYA 2VMGA 3NQHA 4M0NA 3B9IA 2W94A 1I3HA 3OEAA 5F39A 3ZFEA 4F7ZA 4BPZA 3ZFFC 3IBMA 3I59B 1LODA 1OPMA 4N7IA 4H14A 3MPPG 4FPHA 4TWTA 4XJ9A 3HQUA 1QJFA 5FZ0A 1CAVA 4BWOA 5DZGA 1Q8SA 1GZWA 1FNZA 3THDA 4FPFA 3UJOA 2VVFA 3U4XA 1YIPA 3KHBA 1SPPA 2FDKA 2JDAA 4FTSA 1LRHA 2AREA 1VRBA 2VPVA 2X53S 3ALQA 3KVBA 3O5SA 2WT1A 5F37A 5E89A 5CFCB 2Q1ZB 2RR13 3N9MA 4LKFA 4Q0PA 5FPXA 4I0BA 1O5LA 4CCNA 3SEEA 3I7DA 4UAPA 4C91A 1RVF2 5A7QA 1LGBA 1ZVFA 2Y6JA 3GCWA 1UWWA 4LPLA 2PLV3 4XETA 1CX1A 2WWJA 4UYBA 1NZIA 1PVC3 2DUPA 4JRAA 3N7MA 3USUB 2HWC2 1UPSA 1PGL2 4RS5B 2J1TA 1TG7A 3LEMA 1S0CA 3PVBB 4JC1A 5FUPA 4B4QA 1LHNA 3TYJA 2C9KA 1QJY1 1P8JA 5AFBA 3DEMA 3VD5A 5C9AC 2O14A 1F5JA 4E4HA 1B35B 4M3CE 3GXUA 3ZKYA 3WW4A 1WMDA 1IS4A 4AHXA 4A6SA 4P08A 1EV11 1GU3A 5L9BA 3H8OA 1C28A 4A44A 5F2WA 1ZRCA 1H6YA 1UOJA 1G9FA 2JWPA 1VBA1 3N9PA 1I6XA 3R6SA 2VNVA 2NN8A 1DIWA 1FX5A 1UIKA 3CDZB 1AJOA 1RMU3 2VCMA 2A3YA 4Y1ZA 4BM8A 5T5LA 5FOJB 2XJVA 4S2DA 3MW2A 4XUQA 4DXRA 1OD5A 1XJAA 4CPBA 4YNIA 2WINB 3NWKA 2HWE3 3FBYA 4EN0A 2RS12 5C8CB 4P9XA 1O91A 3BCWA 3K4AA 1WUVA 3LDKA 5FZCA 3HD8B 4UXAA 2HWB3 4K6BA 2JG8C 2VMEA 2PHWA 2WS91 4OHVA 1JZ2A 1AR93 2O0OA 2QE3A 4CEWC 3CJXA 1BXHA 3KCCA 1HB4A 4UFIA 4MVTA 3RI8A 1AR73 2H6BA 2W1QA 4PLOA 1WA6X 1QXPA 1C5HA 3T08A 3WW1A 4DXTA 5K8SA 3O1UA 2Z4FA 4FTBA 1O7FA 3LB9A 1H1AA 1ASJ3 2DUQA 3IKWA 4Z2AA 2ZGPA 2XWJB 1S0JA 1ND2C 2LTNA 3BOPA 3E6DA 4O65A 4RGKA 1CPMA 4ASMB 3MIGA 2YFUA 1UX7A 1HXS3 1DDLA 1KS5A 1ULEA 5A3OA 4XF1A 2VZPA 1CWPA 1GBGA 1COV2 3W9AA 4PCRA 1YC61 2QQKA 5F2SA 2VZSA 2DVFA 2CGPA 2R30A 1V9U2 2GALA 2VNOA 2VGDA 2WNUC 4IE4A 1HJFA 4LO4B 2V73A 4CP9A 4CP0A 1IPSA 4CU6A 3CEWA 1UAIA 3JZVA 5GM0A 3WDUA 4QM8A 4GWNA 2YC2A 1MS4A 2PQQA 3GM8A 1ZZ6A 2O1QA 2WJSA 1H1MA 3VBSC 1OUSA 1YQ5A 3UGGA 3D6EA 4AVCA 4PDWC 1RC6A 1SQ4A 3HBZA 3WP5A 3ZM8A 2MEV2 5IVEA 1RUJ2 1C8M3 2BVVA 3HQXA 1O3TA 2QUOA 4HFSA 3N4MA 1TNFA 3DPRC 2RMU2 2WAOA 1PX4A 1SMVA 2BW8A 3VZOA 1PIV3 1Y43B 3L2YA 1W03A 3RZLA 2CSGA 1ZNPA 4OUEA 1K5JA 2JENA 4YVWA 1K12A 4GA9A 1POV1 2PQSA 4QHZA 4GH4A 2CHHA 4GKYA 2CAUA 1JZ3A 1RXFA 1BBT2 4IQPA 3LIGA 4DXSA 2XH6A 4H7LA 5A7WB 3IDAA 1W6QA 1OBNA 2AZ5A 2CY6A 3FMGA 4AR2A 4Q0UA 5JZGC 5AC93 4OQ8A 2O8OA 3POBA 2R6QA 3DCQA 5I0DA 3TEZA 1FOD2 2VCCA 3CJIA 1W8NA 1AXZA 2C6SA 2IXIA 1G9AA 1ENXA 4FFIA 4NAOA 4LBQA 3BOWA 4GIQA 4PQ9A 5DAVA 1W06A 5DXDA 1VBE3 1PNFA 4IV1B 2E33A 1GP6A 1VLNA 4Q0VA 5FREA 2HWF2 3S6PA 2Q5TA 3UETA 5LCWL 1V6MA 3IDCB 4N9HA 4NHYA 5JR7B 5I0SA 1GYKA 1Q56A 3J7MA 1QXRA 3FZ3A 2JIGA 1FMD2 1LKNA 3WQ7A 3AP6A 3J4UH 1U0AA 1FPN1 4LEJA 4YVSA 2JEMA 2Q8DA 5A6QA 4XFIA 5FO9B 1LOBA 2R042 3MPBA 2WO3A 1QQP1 3WG3A 2CYFA 3ZSMA 3IAPA 5D8AA 4KBZA 1APNA 1MQTB 2VTXJ 1VRH2 3T0AA 2BYVE 1YQ8A 1F31A 4LT5A 4YW3A 1MZEA 1VPHA 3N3HA 3WVJA 3ZYFA 3IPVB 2V5YA 2BFUS 4M01A 4JVAA 1OOPB 5LEJA 5ABJB 2B5HA 4LKDA 5LRRA 1OQDA 4SLIA 4M00A 2I45A 4HK9A 2P3JA 2WAAA 3BTAA 3LKJA 1NOVA 5IK5A 1OHFA 1PGSA 1XC6A 2NQYA 1NCQB 3AYDA 4A2UA 2VCBA 4XF4A 4XHBA 5CIRA 1W2NA 4NVPA 4META 3RWKX 4BK4A 2IC1A 4FI9A 2RR11 1JI6A 1D7PM 4AF9A 4FFGA 4QDSA 1QOSA 2D98A 3KCXA 2QQOA 5LEKA 4E27A 3ZFEB 5GLWA 1QJX2 5C71A 5CB7A 5JIUA 5FPVA 3O1RA 3TAYA 4OULA 1DHKB 4BCUA 5CA6A 5LZ6A 3ZVXA 4W8JA 1DQ1A 3NJYA 3O12A 2EXHA 3AZWA 4YYOA 3AVSA 2VNGA 3AMHA 3ZXDA 2JECA 2W0XA 3KV4A 4LTAA 4HKOA 4QXKA 1HQWA 1SPPB 2ZEZA 3OG2A 5HI0A 3BYWA 5KBFA 2J1AA 2CGOA 3KQRA 1H1IA 4MX3A 4AFCA 5C3SA 3MUY1 5L7OC 1RUH2 1EAH2 5A3NA 1Y9GA 5FZMA 5C7GA 4ASLA 5CKQA 4O9EA 2Q8OA 3WDXA 2J1SA 3PUSA 2LRPA 3U11A 1DP0A 4UFJA 4MGYE 3BPZA 2E7TA 4MHRA 4KQ7A 5T54A 3USSA 5FZEA 5BV6A 1O3SA 4C90A 2GH2A 2BBAA 1SDDB 1RITA 4AOCA 3U10A 3AZXA 3KF5A 1LB2A 1UOFA 4NIHA 1ND3B 2XOMA 4XFBA 1AL22 2KD7A 4LULA 2VM9A 4FOQA 2VW1A 1RMU1 4LKEA 3MLJA 1KJLA 3PHMA 4FVVA 5FXWA 3VBRC 4MH0E 1LU2A 4LIUA 2VMCA 3Q9OA 4XDOA 5BY5A 1YNAA 3U0ZA 1GWLA 3LCPA 3AFGA 3WF4A 4MGZE 2VY0A 4Q4X2 2HWB1 1W0NA 4E4DX 3RMXA 4CPBD 3VD9A 1K42A 2NMNA 1H4GA 4FXKB 1AR91 5FZ3A 4BK5A 4IE7A 4ZU4A 4DUXA 3JQXA 4HKLA 2Y33A 3OY8A 2PLV2 2R1BA 1HB2A 1JTZX 4G3YC 4Y20B 2Q8CA 5B4NA 5JOXA 4ZXKA 1PVC2 5FZ7A 4Y1VA 2AR6A 1URXA 1EY2A 3WF1A 5HV4A 3CQOA 1DU3D 3ZN5A 4BQWA 4CEYB 4GD4A 3S57A 1JU4A 1N1SA 2E51A 3KSCA 4LUKA 4XQWA 5FIXA 4A7KA 2VO5A 4QX5A 3PVEA 4MGIE 2ATFA 4RQPC 2WWSA 1WCKA 1U5ZA 1KEXA 1EUUA 1NE6A 3PNAA 1XPWA 3SITA 2E9QA 3T1MA 2EXKA 4W50A 5DAWA 3K3NA 2Y64A 4JV4A 2W46A 5JSRA 3LPGA 3K4DA 2R073 4E8CA 3LGRA 4GXLA 2R32A 1VBB2 2YHJA 5JXJA 4W65A 3T0DA 4N43A 1XYOA 4PLNA 4OUSA 5FQ0B 2GSYA 3RI9A 4JGZB 4I02A 3FUQA 3K75B 4B1MA 2WDBA 5H9QA 3NV2A 1DYPA 4IEVA 5K9YA 5F6KA 3LF7A 1LESA 5FY8A 1SFYA 1ZBA3 3IT8A 5L7OB 4V2WA 1C8M1 4GULA 3S30A 4BQ3A 3E97A 2R062 3INAA 1AX0A 1QDCA 2RDRA 4NHLA 2B42B 3AZYA 1ACCA 3TWIA 5C70A 1ZYBA 1UOGA 3KV5A 4XCBA 1PIV1 2Q1MA 2VOWA 1A8DA 3RSJA 4XJ8A 4CP9B 3KQ4B 3GZTB 4CEWA 4MGKE 5ERLA 4ZU7A 2D7FA 2D6NA 3T30A 4WVWA 1MPXA 4K8FA 2CU5A 4ZY9A 1XE7A 2D6MA 2YDEA 2CGNA 1VIWB 3M70A 5A7SA 5AC91 1SLLA 1HDKA 3K48A 1FV2A 1J84A 3NJXA 4RHV1 1ZZ8A 3OBAA 3GZEA 5JOZA 1HXS2 4EWDA 2OKXA 3M4FA 3N9OA 3JCIA 1H6XA 3IMNA 5F8PA 2WLPA 1QF3A 5GZDA 3NAPA 4IE0A 2DUOA 5I8SA 1RUG2 4IEXA 2Y6LA 5I93A 4U2AA 1R091 1UY1A 3AKRA 3OPTA 1ENRA 1WA4A 2IWGB 1GSLA 1REDA 2XWBB 3DF0A 3ELNA 3OGVA 4YVWB 5A3WA 2MHFA 3AKQA 4D69A 4WZCA 2XR4A 4I01A 1LEMA 3M3IA 3POIA 4LBQD 4S2FA 1Z7S3 2VZRA 1TMF1 4J6GA 3SEPA 3TN92 5I8TA 1UD1A 4FOYA 2A71A 1EP0A 1ONAA 2BDRA 4B4PA 1DZQA 2FDHA 2WNEA 3PLQA 4XDPA 3RQ0A 4UFKA 1C1FA 2HBUA 3WW3A 5K7PA 2Y26A 3CJIB 1M06G 2ZMNA 2UURA 4GMP1 1G9CA 1QNWA 1CONA 2QQLA 5A3PA 5FBZA 3FX3A 1O8SA 4LBQB 1WLWA 3EB7A 5BNOC 2BBVA 1AL0G 5JWPA 3LWCA 1AYN3 1CPNA 2DBIA 4NO4A 3UL2A 2WZEA 1KFXL 4IETA 4WM8B 2KA3A 5HXVA 1ZZCA 1RUD1 3OBRA 4PI2A 2OVUA 4NAMA 3IDBB 5GLTA 3M2MA 4IE6A 4GB33 2DCJA 5K0UA 1AUYA 1BQPA 3APBA 4LBNA 4MADA 2TNFA 1D0GA 2BWCA 4XURA 5CYYA 4COVA 1S55A 1W2AX 4CDQA 2A70A 2A1XA 2VU9A 1GOGA 1ZREA 5EPAA 2VBBA 4I0AA 1DG6A 3CHXA 2WN2A 4F8AA 1WCQA 5CFDA 3WF0A 1H2NA 2DV9A 2VZOA 4CXXA 5FZDA 1QEXA 2O8QA 3R4DB 1JOJA 2XLFA 4RFRB 4N53A 4KG8A 2NM1A 4AAXA 4LKSA 2AYHA 3CZJA 4BU2A 3VBOA 4LBMA 4R8HA 1WMEA 5L36A 2BUKA 2C5DA 1I5PA 5C5UA 1CESA 1D2SA 2OUJA 4HKWA 3ZYJB 2XG3A 2E53A 4COWA 4ASKA 3C7HA 1QJY3 2Y0IA 3B9CA 2H6CA 5C33A 1WZXA 3LDBA 3WG2A 3V64A 2LROA 1T6GC 2UWAA 2VQAA 3MUZ1 1G6NA 2YUEA 1NCRC 3HN1A 5CAZA 3I2GA 1BJQA 4YPJA 1OVPA 4N9IA 3W21A 5FMBA 3H8UA 3QCWA 4MV2A 3ZSKA 2DTYA 5IVVA 5FYCA 3ENRA 5FXVA 4CP2A 1JOBA 1VBA3 1HX6A 1EUTA 1J3QA 1YXWA 3HT1A 5FZOA 4K21A 1NG0A 3BPSA 3VBFC 4E2GA 4EN9B 1JUHA 3KT4A 2IXJA 3GHNA 4MSVA 4EQVA 1LOFA 1UZ0A 2EA7A 2JDUA 2VUAA 4WM7B 1J59A 3POWA 1AVBA 1D4M3 5BNOB 2WS93 5J48A 5C3RA 3E5QA 1VMFA 1H2MA 4M4PA 5FLJA 5T5OA 1KS4A 4L92A 3KT1A 1TZOA 3WP3A 2JDZA 5FZBA 3O1PA 4LJHA 1C3HA 3GJAA 1HRI1 1GP5A 3ASIA 4DIQA 1YFUA 3I2KA 3RYKA 1R083 5IT6A 3VDDC 3KCYA 1H8TC 1S0GA 3WOGA 1VBC3 3ZFFA 2Z2SB 3K46A 2ZGUA 3A0KA 3AMMA 4RR3B 4XILA 1RUC2 3A22A 5HXMA 4CA9A 1RXGA 1ZM1A 1Q8VA 2ZZJA 3RZJA 5AVAA 2FMYA 4FAHA 1MZ6A 2C9AA 5F6LB 1LOEA 4LLOA 5DPNA 1XE8A 1AYM2 4NRPA 1ULPA 3UGFA 3I49A 1OF4A 2C24A 4HVRA 3ZN4A 5T50A 2LUWA 1RUI2 4XMAA 4G4FA 3WZ1A 4DNYA 1WBLA 1S0DA 3OY8B 4ISRA 5L9VA 1W9SA 2R071 1PHMA 1LULA 3H3UA 3H7JA 3A23A 5FP8A 3UESA 1EPZA 3ST7A 1X7NA 1QOOA 2ZX2A 4UW3A 2ES3A 2PHDA 2WT0A 4DB5A 1A34A 1DZTA 1UYXA 2YB7A 3GBFA 5T55A 1OD3A 2JIJA 2RS33 1WW7A 4LQRA 1LNSA 1LAJA 3NRUA 2CWSA 3OGJA 1BEV2 3MEPA 2C0ZA 2OZ6A 2ZEYA 1GLHA 1ZBA1 4KWJA 5DAXA 4AFBA 2D6OX 4C0HA 4FPLA 5KHIA 1V70A 2P3IA 1TME2 2RJ2A 3AM2A 2DURA 4J1XA 4NIIA 3VZMA 2GMMA 3I2JA 2Y6GA 3JXSA 5CFCC 4O9GA 4AI8A 1FI2A 2BJSA 3J9SA 4NE9A 1UMZA 2Z79A 3ZIWA 3LA2A 3NVCA 3UYJA 3FE5A 4N43B 2E7AA 4XF3A 5J37A 3ZXAC 2DFBA 4NUBA 3P3PA 4YM2A 2WO1A 1ZA7A 4M0HA 2XBO3 4M3CF 2J7MA 4JCKA 4RS5C 4ZXEA 5JIAA 1GUIA 1Q8OA 1ENSA 3VBFB 1ZRDA 1PO23 5DN2A 2UY9A 3LA3A 1UYPA 4CP1A 1UF2C 2ZGRA 5FJHA 1KRIA 5C5TA 2YPJA 1U5XA 1I9RA 1ZBE2 2ZGNA 1K5MB 1CX4A 1VBD1 3JBG2 2HEWF 5FYYA 3W58A 1QJU2 2JG8A 1PO12 4IUGA 2IVJA 3HR9A 3PDQA 4D8MA 2BRTA 1Q3EA 1PNGA 3KF3A 1AHSA 1DYKA 1W0OA 2WZ8A 2VMHA 2VVEA 4Q0QA 5FYBA 4CEWB 4JTOA 1TQ5A 4QU1A 5FP7A 3HIFA 3WT3A 4AGRA 4Y1XA 4YZ1A 3SXWA 2BP6A 2QQUA 1V6NA 1IPJA 4WVVA 2VH9A 3AXDA 1ULGA 5FY5A 3UT0A 3E6CC 1Z7S1 2WZR3 3FFQA 3RRDA 5FMOL 3RJ2X 2P34A 5LY1A 4EN8B 3VZJA 3POFA 1ULFA 5FLHA 2FDGA 4NWWA 3BI3A 3I2HA 1BK1A 1W8ZA 1ND2A 2A6WA 1LJ7A 1JW6A 1YQ6A 4Q4W3 4OI1A 2XVKA 3ZR6A 1LOGA 5C8CC 1NA1A 3HOBA 3J7HA 5FWEA 1IKPA 2VZTA 4AFMA 1CN1A 1DYOA 5BYNA 3ZKUA 1AYN1 4NWVA 5A32B 3H1MA 4IDZA 3A7QA 5LW9A 1X33A 3PMEA 4ISQA 4YM0A 1VALA 2TUNA 2WO2A 3RZMA 2QDRA 1RUE3 4EROA 4QPGA 3U4SA 2R0FA 3D0JA 3OF1A 3LSEA 3L2HA 1ODNA 4GB31 1LR5A 2ZGTA 4OI4A 5D2AA 4CUCA 1JZ4A 4TZDA 4B4RA 3O1SA 1ULCA 5GJ6A 4ZHNA 2OW4A 1QGLA 3LQCA 4JHTA 2BTVC 2BQPA 5FZGA 1AXKA 4IEWA 3GHMA 3VBSA 5E8AA 5I0TA 2WNVB 3M3EA 3U07A 4PDWA 3LFMA 1GKBA 3HJRA 5BNNA 2XVGA 2Q8EA 3LEKA 1QY4A 1LTEA 3ZXKA 4Q8LA 5DG2A 2X05A 1BMV1 3VKNA 3IZOA 4D6SA 2IVIB 3SKJE 5A7NA 1GWMA 3VHOA 1WD4A 1SFPA 2ENRA 2HJIA 4QGMA 2FBEA 3FUOA 4CDWB 5KC5A 3D4KA 5HCFA 1SCSA 3FL7A 4JGYB 2VG9A 4HN0A 2PHFA 5K0UB 3MF6A 4LE3A 4AVTA 3D8CA 4HMZA 2HKXA 3R05A 4CDQB 4A42A 3C7GA 5BUVA 2YU2A 3ZR5A 4I09A 3DYOA 2UU8A 3ACGA 4N90A 4AHZA 1ODMA 5JZGA 1J3RA 3AJZA 2RS11 2HWD3 3VN4A 4Y3OA 4I2OA 4IV3A 5CFDB 3H0OA 4QGLA 3DXTA 1UY2A 4CU9A 2CV6A 4HVQA 5EXOA 4N53B 4K9SA 4TLGA 3WQBA 4AGGA 4D3WA 1VE0A 2FMDA 4LO8A 3I54A 3MZHA 4HBNA 2GAUA 1PM4A 3OPZA 4MXWB 2RM22 1DF0A 2YROA 3VGIA 1R1A2 3B00A 5APAA 3ZFGA 2X5IA 1GZTA 5M0TA 1BZWA 1RIRA 2GC3A 5EP9A 3WDVA 3MLLA 3B3QE 3AFKA 3GNEA 5IVYA 4XJZA 2E6VA 2LS6A 3R4SA 3H50A 2JICA 4I3PA 1GQHA 4P5YA 4KGGA 1D4M1 4CCCA 3THTA 4CRQA 2EICA 2ZKLA 4NR1A 1QKQA 2QVSB 3I2DA 3CF6E 3OYWB 4Q4Y2 5FZ8A 4EN6B 2FZ2A 1VAVA 4BISA 3VDBA 1V9U1 4IV1C 1MEC3 4UF0A 5FZOB 1R081 3IMMA 4QWNA 2ORXA 1VBC1 2WZPP 4TYSA 3FHQA 1BHGA 1GV9A 1UYZA 2RV9A 4P02B 1WGPA 3Q8CA 1VP6A 4JQRA 4Y24A 2X09A 1BYHA 1VAMA 4R52A 3T2TA 3OUJA 1VJ2A 4IESA 1MQTC 4BQ2A 5FWJA 1J1LA 3VD7A 1EV12 3H8XA 4FPOB 5JOWA 1BVP1 3NNJA 1WW5A 2CDPA 2WSUA 1CD3G 1GMMA 3WNLA 1LHVA 1ZZ9A 4EWAA 1VBA2 4UFHA 2RHPA 4E2SA 4IXLA 1OOPC 1W6OA 5ABJC 5KHGA 2ZKNA 2YGMA 5T52A 4I3GA 1WLDA 2Y8KA 2OQ6A 1BKZA 2RS31 3EXUA 2EF6A 5C6CA 3K2OA 5FPLA 1IS3A 1GICA 4LBJA 1F5FA 2Y38A 2P6CA 5FYTA 3GGLA 4Y4RA 3WDWA 1NCQC 3ZOIA 2DFCA 5FYSA 5A6ZA 2GP5A 2P17A 1ZRRA 4XABA 1L3JA 1HRV3 2JG9A 3HNYM 4A3XA 5ACA2 3WF3A 3AL6A 4OUMA 1POV0 4UBHA 4TSVA 1JYXA 5FLIA 2F4PA 3UKTA 4LIVA 3ZFEC 1IG3A 4XUNA 2ILMA 5J96B 4LO6B 5IWFA 5BNQA 3AXEA 2ZMLA 3HMYA 2XBO1 2UYBA 5LBEA 3N9LA 1LENA 3VBRA 5GZGA 2FDFA 3MIEA 4W6WA 1RINA 1PO21 3IWZA 2K9ZA 4JZRA 4RHV3 2ARAA 2DVBA 4NN0A 4K1ZA 2ARCA 1WW6A 1ULDA 4OHZA 5KHHA 4YM3A 4UI9L 2KM2A 1DLLA 1CAUA 4L8QA 1R093 1YQCA 5DAQA 2ZGKA 3A21A 3KGZA 4HPKA 4L11A 2PN5A 5EFUA 5FY0A 3VV1A 3S0MA 2CAVA 1QJEA 2XL9A 3MIHA 5JUVA 4DZGA 2PAMA 1CR7A 5FZAA 1DGWX 1XBFA 1TMF3 5FPAA 3UV9A 1ND3C 4UFMA 1YLLA 2OT7A 2WZR1 2ZGSA 3PUAA 3ZPYA 2VE1A 2XDVA 5BNPA 3ACLA 2J1EA 1HKDA 2A6XA 3PUIA 3HQRA 1MZFA 3RYPA 2ZHMA 3WQ1A 1O8PA 2GU9A 1WW4A 4GMP3 2AH2A 2DVGA 3HAGA 1UQXA 2GDFA 1NZCA 1QH6A 1RGSA 3WLUA 3JD73 4Q4W1 4BMEA 1VB2A 1RUNA 1CQ9A 4CXWA 1OFSA 3E1F1 3VBHB 4MG2A 3ES4A 4XIOA 3ZYGA 4CZSA 4LHKA 4IGQA 4CXYA 1W90A 2DF7A 3L9JT 1ST8A 4PF5A 1AX2A 1RUD3 3T2PA 3PIGA 3P3NA 4FPKA 4EN7B 5T3NA 1PGW1 3VBUA 1RUE1 4EWEA 2QBXA 1US2A 5KHKA 1N47A 5EJ3A 2NLRA 3AMNA 2BNMA 1G9DA 4OMDA 2PFWA 1Q8PA 3VL8A 3MV11 1POQA 1RL3A 1V0AA 4QPIB 4CEYC 3WHUA 2PAEA 1NA1B 3EQEA 4Q4V3 4M3CA 2PAKA 1Q5OA 1RUH1 1EAH1 1OH3A 5C4WB 1V6JA 3PVOA 1EPWA 2VMFA 3KMHA 4S2GA 5LATA 3SCHA 3J8F3 1RUF2 1HQLA 3O1VA 1JH5A 1PZ7A 1L7RA 2YBKA 1QHDA 5DDJ3 4QX1A 1H2LA 1L7QA 2R0HA 2ZHNA 4DEVA 4QPGB 3ABZA 4Z1VA 1JU3A 2QQPA 2X8KA 3KVAA 4MGQA 2JD4A 4Z2WA 1UZWA 5KXEA 1CAVB 2V09A 4FFHA 4JKLA 1GZWB 3S5QA 2RDQA 2QQVA 2DVAA 2BNOA 4JGZC 4AWDA 3DL3A 3LA7A 3QD6A 5FV3A 1FPN2 4AQTA 1E5IA 2WWUA 3RNSA 5BNNB 1HV0A 1A78A 1IS6A 3ZDSA 2HWD1 1QQP2 4XFGA 2Z42A 2K46A 2JE7A 3RYRA 2BOJA 4BQYA 4ARYA 4BQ4A 4ZZ5A 5A1AA 2VQ0A 1JYCA 2HBTA 2VOKA 3PVNA 4N7UA 4WVMA 4NJ4A 4AAPA 1XNDA 4HSLA 4QXCA 3BGAA 4ONUA 4P9IA 2Y6FA 4FFFA 1LEDA 1RYYA 1AR83 4AVVA 3LD8A 1OLQA 4WV8A 1LOCA 2G9ZA 2JB8A 2C26A 2XONA 5C8WA 3M3QA 5E88A 2WYSA 1AZDA 2VCAA 2WNOA 3WSOA 1KD7A 2ZS6B 4KU7A 2FD8A 4FT8A 1WD3A 3V56A 1XNKA 4OVEA 1JYTA 1CZSA 3DKQA 4KWUA 4A7ZA 5KXBA 1W8WA 3FLRA 3FFZA 2BVBA 1PM7A 4HN1A 2PA7A 3ZXEA 1GOFA 4MUVA 4YW1A 1KITA 3C7EA 3D0SA 5F3EA 4LBOA 3S7EA 1GZ9A 4ET7A 4FP2A 2RR12 2J1UA 4NRMA 5BPXA 4YVWC 3WQ0A 5IVJA 1QU0A 2XJRA 2X5IB 4FP3A 4AQ2A 1HRI3 2D97A 4DOUA 4QMAA 3OUIA 1MEC1 3ATGA 4OHYA 1QWRA 3MIBA 4ZU5A 4CTEA 5C3OA 5FZIA 1V6IA 4JDMA 2GN7A 1XNBA 2W9XA 1DZRA 5JMOA 2HH9A 4XDQA 2VUCA 5KHJA 2OZJA 4CU7A 4ES9A 3CJIC 4G9SB 3WW2A 4JQTA 3IIAA 2YBPA 4EV0A 1CJDA 4GALA 4QKFA 4QX3A 4Y33A 5FRAA 1SLBA 3JUUA 3UKNA 3FC0A 5EQUA 2A6YA 1J83A 3WNMA 5I91A 3ZXJA 4URTA 5EYXA 4DQAA 3V0AA 4WM8C 3ZXLA 3SMHA 4Q29A 2PTMA 5JOYA 1LHOA 4AEKA 3I97A 3QH7A 1LHUA 4UFLA 2PYTA 3NNMA 1F15A 5GALA 3B01A 5FPZA 5DABA 1RMU2 4QB2A 3UJQA 2DCYA 5FBJA 4QD2A 4BB3A 4INDA 3RZHA 4XQDA 2DVDA 2FDIA 3SLIA 1AF9A 2AC1A 4NPLA 3M1HA 2RDNA 2HWE2 1WCDJ 5GZEA 5FY4A 2KR2A 5GLUA 4RSUA 1SG3A 4YGBA 3AP4A 5D8AC 3U37A 3VHPA 1AR63 1S0FA 2RS53 5LWBA 4AI2A 2HWB2 3SQOA 3ZSLA 5HCBA 3U78A 3KS7A 4CDUA 1AR92 1NCRA 2A7AA 2XUMA 4P14A 5FPBA 2W1UA 1HRV1 5LRSA 2EIEA 2A6VA 2LW8A 1UOBA 3CNAA 5FY9A 1AR72 1KJRA 3AC0A 1NLSA 1W6OB 2HYXA 4RL7A 3TN91 2WFF3 4X6QB 4CCMA 4P9WA 4DFSA 4NIDA 3VHRA 2I74A 3AZVA 2YG0A 1VAKA 1ASJ2 3ZLIA 5F3IA 3A4UA 3BU0A 1F4HA 2GC0A 4X8NA 5FMCA 3M3CA 3WD5A 4A45A 3RZGA 5FZ4A 4BJ0A 1U12A 3O7OA 4XJAA 1MS5A 1YFYA 1PK6A 4ARXA 4CDXA 3C7OA 2JG9B 1VBD3 4QX7A 3RZZA 4KMQA 4BZ4A 4QX2A 1D0HA 1GQGA 4Z82A 2VNRA 4LE4A 4CVUA 1U5YA 3ETQA 1SACA 1UYYA 4RGAA 4XAEA 1FATA 2WKKA 4R9CA 1IKQA 4XBQA 4COYA 1XSRA 2WSVA 5FP9A 4GH4B 1ZRFA 4UW5A 3LIHA 2ZZQA 1UU6A 3I2IA 1IHMA 3K4ZA 2QQWA 3VKOA 4A3ZA 1S2BA 3POSA 3W59A 1QXJA 1W6QB 2W52A 5JPNB 2WQZC 3KM5A 1OF3A 4GAZA 1GP4A 4GMP0 2ET7A 4XEZA 4DY5A 1NT0A 1PX3A 5H9SA 1MS0A 2NP0A 2A6ZA 3PUQA 1JZ8A 4F83A 1XYNA 3DUIA 2WRAA 4LHNA 1PMIA 2Y0OA 4D7TA 4FAGA 1GANA 5JLVA 1NY71 4DRVA 1C8M2 4QXHA 4QHBA 4WM7C 1CAUB 3JD71 1V6LA 5J7MA 2QZ2A 1W0PA 2VBPA 1UL9A 1OPOA 4IW3A 1PMHX 1H0BA 1H4HA 1PIV2 3DXUA 4E4SA 4BA6A 5CVRA 1RVF3 1LU1A 2FCUA 3GJBA 3WY6A 1U5IA 2ET1A 4IEQA 3SCFA 1VR3A 3MYXA 4BQ1A 4UW6A 3RJRA 3A0NA 4YZ3A 1JYIA 1Z0HA 1E5RA 3MHZA 3U75A 2HWC3 1F9KA 4YGEA 4JAAA 5J09A 2PHXA 4RR3C 4YVSB 2ARBA 2X10A 4XBLA 5AC92 1W8FA 3PTYA 1UY0A 5IAXA 1UMHA 1YQ2A 3PJQA 1OQEA 4L2NA 1C1LA 5LK5A 1LCLA 3POJA 5FJKA 3DN7A 3QBQA 5FKCA 4Q4V1 2W1WA 5D8AB 4AVBA 5L73A 5A3MA 1MVEA 1YHFA 1MS8A 2VD7A 3O14A 1DQ4A 1K45A 3WDYA 3LOIA 4P00B 1H2KA 1JODA 3RDIA 3H8RA 1L7LA 1SEFA 3J8F1 2SBAA 1GQPA 4IEOA 2I07B 1IS5A 5FYMA 3VKMA 2IXHA 4D94A 1W3VA 3OBZA 1T2XA 1VBE2 1YJKA 2G9GA 1E5SA 5DDJ1 3NNFA 1JYVA 5LA0A 3QACA 1W8HA 3IDEA 1EYBA 1TMF2 2JX9A 4YFWA 3VD4A 5K4LA 1W9TA 2BZDA 5C3PA 1WCUA 2JDMA 4XW3A 3MDPA 3VKLA 5IK7A 4RN5A 1US3A 4M3CB 4FQ4A 4MLOA 3ZXGA 4QKBA 2DBNA 2VL4A 5ISLA 5A1FA 2ZACA 5DAPA 2RS13 4YG6A 2XJUA 5ANNA 2XJPA 4HXCA 1OT5A 1WCSA 1JZ5A 2ZA9A 2JDHA 3HVDA 1B35A 2QCSB 4XTMA 5FFOC 2VOVA 4MXVA 5CKMA 1W9WA 3NV1A 1XB9A 3I2OA 2VC9A 3W20A 4BIFA 3AP7A 2RJKA 1OURA 5A7OA 3NO8A 5C3QA 2XUEA 3WINE 2XPJA 2ZCWA 2XXZA 4N43C 1AR81 2AEZA 2DWRA 3IAQA 4OZXA 1CAXA 4HL0A 3TEXA 5J36A 2ZX3A 3J7NA 3OGRA 1AX1A 1JS9A 2IFWA 1FAYA 1WLTA 3BTZA 1NQDA 4E2QA 4CUAA 2WN3A 4AHYA 1KXGA 2EALA 2ZTNA 1K5MC 2ARXA 1UZZA 2VJXA 1OLRA 1COV3 1R1ZA 3JQWA 1RHI1 1S0BA 3H1WA 4BOWA 1J1TA 1UMIA 4NHXA 4PQQA 4EZ4A 1V9U3 4FPCA 3C2UA 2H0BA 1O59A 4LHSA 2GC2A 2QKDA 4D0QA 5CBLA 4LK6A 4AEDA 5IUQA 2DCKA 1F4AA 4LOTA 1UY4A 1CZTA 5D21A 3ROUA 2TEPA 4TN7A 4K40A 5FZLA 2V4AA 3AYCA 1OXCA 4XXPA 2RDSA 2MEV3 1OQ1A 1CVNA 1HN0A 1RUJ3 3MO4A 5DUVA 3ZPOA 3B94A 3I3DA 5JCTA 2J42A 5LA1A 4BH9A 2Q1FA 2RMU3 4XZPA 1ULOA 4U36A 2CDOA 4L9BA 3M3OA 5A3UA 1TME1 5A3TA 4PHZA 4B8EA 1UCXA 4YW7A 4AQ6A 4CCLA 2W5FA 1X82A 3MGUA 3HT2A 5SV8A 2D5FA 1IZ3A 3MFCA 1I1EA 4FTEA 2GMEA 4S2HA 3CIHA 4QKNA 1BBT3 3I2FA 1DGLA 3H3LA 4HANA 3THCA 1W2TA 1XNCA 2J1RA 4LO5B 3T2OA 4YFZA 4QGNA 1FOD3 5EHDA 3KB5A 4L99A 2WYFA 4XE9A 2WNVC 4C8DA 4IL7A 3NV4A 2L9LA 4QQ2A 5JXGA 4OFGA 4YW6A 2HLEA 3JBG1 1REEA 1W8OA 2W47A 1AR61 5C9AA 2DU0A 2RS51 3WG4A 2E26A 3RG0A 2WFPA 5CADA 1Y3TA 1XRUA 2OPWA 4KI5M 2W2IA 2MNGA 4CCOA 3O0WA 4CDWC 2ETEA 3CO2A 2YMZA 1MS9A 4JGYC 1DBNA 4Y4YA 2HWF3 5K0UC 2DCZA 1FXZA 4DEQA 2D5HA 2WFF1 2WR9A 1SZBA 2XB6C 5E1RA 5FP4A 3TEWA 4CDQC 2Y6KA 2YYOA 2MPFA 1FMD3 4FOVA 5CISA 4IEUA 1STMA 2BU9A 3LZZA 3OD0A 2WQ8A 3DECA 2GMPA 3PL0A 5JAXA 1OSGA 2F6BA 2R043 3T2QA 3I3MA 5CFDC 2G9FA 3ME2A 3G6JB 2PHRA 4QQPA 4X6RB 3NSTA 5F3GA 4AL9A 3Q8AA 5FO7B 3GCXA 3C7FA 3POGA 2NPIA 1FV3A 3R4UA 4N53C 5G05L 3TBDA 5J1XA 3T1LA 2VZ3A 4QX0A 1JZ6A 3DKWA 3LAGA 2R072 3PTRB 1W6NA 4QT6A 4Z07A 3FLPA 1HIXA 3VBOC 4E4ZA 2PELA 5HPOA 4A6OA 4LORA 4PBPA 3EJKA 2VAUA 4CUBA 2DU1A 4XJWA 3LEIA 3PUHA 2UWCA 1JUIA 3ZYIB 5IK8A 3J7LA 4CDXB 5FKBA 5FK7A 3T4VA 1W8UA 2GH8A 3WX5A 1HW5A 4BYYA 2RG4A 3O1MA 1OFNA 1ZBA2 3ACHA 5DZFA 3NAPB 4UT5A 1S0EA 4Q27A 4SBVA 2WIIB 2LALA 4XACA 1KDMA 3IM0A 1MQTA 3ZSEA 4M4RA 3KD4A 3WF2A 3KHCA 1UPIA 5FZ6A 2FCTA 1VB4A 4LNVA 1QJX3 1RVF1 5GZCA 4F3JA 5FAXA 1GOHA 3N35A 2XJTA 2W95A 4CSWA 2VZ1A 2WNUA 2ZJCA 3IPVA 2XKOA 3SH3A 1WMFA 1M4WA 1K3IA 4LA2A 3WR0A 5ABJA 1W6MA 2HWC1 4H7MA 2VMDA 1PGL1 3J26N 3GDBA 4P9JA 3AZZA 3ES1A 1RUH3 1EAH3 3SNMA 5CU1A 3PIJA 4Q1PA 4K3UA 4LO7A 3FHIB 5IK4A 2IUWA 1NCQA 4XCAA 3LOBA 3ON7A 3DPRA 2BNNA 4AVSA 4Q2FA 2YV8A 4NPRA 3KGLA 4LMFA 5DUXA 3BUCA 1R1A1 3N36A 4ES8A 2YGLA 4K7JA 3WP6A 3NL1A 5IVBA 1IPKA 4FO9A 1Z7S2 1UO9A 1AL23 1UU4A 1C4RA 2BV4A 4RGGA 4DMIA 4ATFA 4L97A 4NMIA 2XLAA 3AMPA 2W92A 2GP3A 1FYUA 3MW4A 3VLBB 3FHAA 2P2KA 4XJUA 4OMCA 2EXIA 3PU3A 1W05A 4MYEA 5F5CA 3FWEA 4Q4X3 5DG1A 5LA9A 4Q1RA 1QIQA 3SH5A 4EJRA 1AYN2 4Q4Y1 4ZS3A 4YZ2A 4Y1YA 2Y60A 4EYUA 2K0GA 3GALA 3WCSA 3U1XA 4AEJA 2OUHA 3ACFA 3ZX7A 1RJ8A 4LLFA 4AI0A 1NX9A 3T09A 4BHPA 2SLIA 3VBOB 1XYPA 5DUUA 1D4VB 2VZVA 4GB32 1ND3A 1S2EA 4J25A 4AE2A 1GFF2 4IE5A 5JPMB 2BFUL 4AI1A 1Y4WA 1OVSA 4AW7A 4KL1A 4KH9A 2PHLA 1S0IA 3U14A 1SLCA 2J1VA 2BERA 1SCRA 1BMV2 5DZEA 1VMHA 1OC1A 5FP3A 4LA3A 1SBDA 5JDBA 4PIZA 4XFHA 2WLQA 5IFTA 1KQRA 4JDNA 3Q8FA 3RWNA 1BK0A 1COV1 2WBKA 3CU7A 4UWDA 4AFDA 4ZZ8A 2XMLA 1W6PA 1E5HA 1V00A 3G7DA 3ZIXA 5LBFA 1UXZA 1UNBA 2C1FA 1QOTA 2B46X 1VBB3 2ZX4A 5E6HA 1YJLA 4Y20A 1CAXB 4FPJA 2E31A 4XYXA 1JBCA 3FJSA 4NIAA 3VL9A 2P4EA 1YFWA 4HONA 1GNYA 1JMUB 3MV01 4D6QA 3VZNA 4IGPA 4CEYA 4KNCA 4PIXA 1QJY2 1QH7A 4P9LA 3VHNA 2MEV1 1RUJ1 4O61A 4CE8A 3HWJA 1W9YA 3H1YA 2JE9A 4YSFA 2R063 2JDPA 2RMU1 3VBHC 3OPWA 3SH4A 1MACA 3D3AA 4XFCA 3TB0A 5ACA1 1JYNA 3OGSA 4B1LA 1JZ7A 2PMWB 1CIYA 3PMSA 1RTVA 1O3QA 4AEDB 1N3PA 4C1WA 1X8EA 1UU5A 1IGOA 4FBFA 2XKPA 3ZFFB 2YU1A 4FSJA 3MI8A 4OHWA 1BBT1 4HK8A 3LSDA 3ILFA 3IB3A 5FQ0A 2HEVF 5JSPA 4JGZA 4QXBA 5FOBB 1S2KA 3NW4A 4QPIC 1FOD1 1SBEA 1NA1C 1O4YA 1XNAA 2D6KA 3SKVA 4Z92B 3V0BA 1MVQA 5HCAA 5C4WC 3WNXA 1A6CA 5L7OA 4RA0A 3POEA 1D4M2 2WS92 1RUG3 1Y7BA 2B8MA 1YO8A 2GN3A 5AVPA 4ATEA 2XHKA 3DV8A 5F1RA 1UXXX 3B93A 5FYVA 1GNZA 3F95A 3F2ZA 4QPGC 2BOIA 5FMOS 5GKAC 3WV6A 3AJYA 2B4KA 2VVDA 3ZXFA 3TN93 4B7KA 1R082 4XIKA 4YGCA 2HWF1 4B29A 5HBAA 1UN1A 1VBC2 3CKHA 4J1WA 5JMCA 2ZAAA 3WUCA 1N1YA 1ZZ7A 2CTVA 4RFT0 5LBBA 1FMD1 1LHWA 5BNNC 4JDOA 5C9AB 2Q0AA 2R041 1YYNA 1X50A 4QM9A 4ZONA 1WBFA 1UW8A 2GNBA 2LM3A 4AYUA 1NLQA 1OA3A 1OUXA 1PZ9A 2ZEWA 3ILNA 4GKXA 4LITA 4C1XA 3WDTA 1VRH1 4QU2A 3HEIA 4YM1A 1HV1A 2OXBA 3UNPA 3GBGA 1UKRA 5JVVA 5GLVA 3SC7X 1Q8QA 2WABA 5CKNA 4MGTA 5F5AA 2VUDA 4HG6B 2P3YA 3ITQA 5F5QA 3WUDA 5F5IA 2DDUA 1DQ5A 1OLME 4FOWA 1NUKA 3LEGA 3D5OA 3WG1A 1J58A 2RS32 1YWKA 3TRSB 1XXNA 4IV3C 5A7PA 3KV6A 1KFUL 3B02A 2BGOA 2JG8B 1YIFA 4PF1A 1CAWA 1RUF1 2JJ6A 2Y6HA 4QHOA 4RQPA 1SHWB 1LECA 4CYDA 3AMQA 2W1SA 4EE2A 1UKGA 1UZYA 2QDNA 1W39A 1W6NB 2QQIA 5IATA 4WM8A 1DQ6A 4BQXA 4HLTA 1LGCA 3E6BA 2KXLA 3NJVA 2X5IC 1QJX1 3AB0A 3ZFGC 5A3LA 2VULA 1CGPA 2I2SA 1HLCA 4H2AA 4YW5A 3Q8EA 2GNMA 1OH4A 3URFA 5FZ1A 2XBO2 4XPVA 1BCXA 3S7IA 1ND2B 2R16A 4CCJA 4ZKTB 2BEOA 4QQHA 1W99A 1PO22 3H42B 3VUOA 1SFNA 4Q5OA 4AHWA 4PT6A 4GZ9A 2QQNA 3BODA 4YG3A 2EAAA 1X36A 2BPA2 4I0WB 3TNQA 3VDAA 5J3UA 1OI6A 3EYPA 3PJYA 2Z69A 4YRDA 4BXFA 4XUOA 1OA4A 2EVXA 3B5LB 4IGOA 4XBNA 1OMIA 1PMJX 4URAA 1C5IA 3ETPA 5I0RA 4JTNA 3RFRA 2DCTA 3T3YA 4Q0SA 2WNUB 3N9NA 4JRLA 5F32A 1OKQA 1W9FA 2UYAA 2D6PA 1W6MB 5LASA 5L9RA 5A33A 4GWJA 4W6YA 5B2GB 2WZR2 3JU9A 1AL21 3MBWA 1F8VA 3VBSB 1G86A 1DCSA 2OS2A 4WZFA 4NRQA 1ZX5A 2E63A 2JXAA 2P3KA 4PDWB 1X9TA 4WBBA 3O1OA 1H9PA 2WT2A 2ZOEB 2V4VA 4HSJA 4NOTA 3AX4A 4Q4W2 3BVCA 2ZABA 3AKPA 3DPRB 4TLFA 4DY3A 4GWIA 4Q4X1 3NNGA 3MIDA 3ZN6A 5I8YA 2YFZA 2XLGA 1QJZA 2ZEXA 1T6BX 1NYWA 4HVOA 1MZ5A 2GZWA 4I30A 4QAWA 5IVCA 1A3KA 5DQ0A 4Y26A 4X8PA 2G4IA 4YZ4A 1N1VA 1PGW2 2VTXA 2Y34A 1HJGA 1RUE2 4JKKA 3ZMNA 5B4XA 2PLV1 2ZGOA 5FO8B 2AGSA 4ZS2A 2VXJA 3P1IA 1PVC1 4COZA 4FPGA 1IQDC 1R64A 1RUC3 5JZGB 4Z8BA 5BXXA 2HEYF 2ERFA 1XOYA 4BLJA 2OQ7A 4IV3B 1YRZA 2W87A 4H3WA 2V72A 1W8TA 1RJ7A 1SDWA 2GNTA 4XXAA 5JI7A 1AYM3 2JG9C 4WM7A 2B9VA 2D3SA 3VKFC 2F17A 1H8VA 5BNOA 1JN2P 5FR3A 1LGNA 3AL5A 1RHI3 1RUI3 2ZGLA 5AFEA 5F9TA 4GJYA 4QDRA 4LK7A 5FXXA 4MGSA 3TNPB 3ZFGB 4GH4C 4AI3A 2X29A 2IXLA 1O6UA 1VBB1 1YCIA 3POYA 4R4XA 2A3WA 5F3CA 2RVAA 4XOGA 4UOJA 4NIGA 4XF0A 3AK0A 2GNDA 5EJZB 1N3QA 4RR3A 2ZX1A 4Y5SA 3OTFA 3JB8A 5HV0A 2HWE1 4YW4A 1ALYA 1BEV3 2HWD2 3I4IA 4ITCA 1C57A 3BU7A 4LR4A 4MOAA 1TME3 4R9AA 5FYHA 3ZDVA 4GWMA 4AGVA 1LOAA 2R061 4LXLA 1W6PB 2IXKA 3OUHA 1S4CA 5FUIA 4NHMA 1E57A 1NAEA 1TEIA 1XSQA 2JDNA 2YZ4A 2ZAHA 1AR71 4XUTA 4XQ4A 5H9PA 1HB3A 4UF0B 1H30A 3HNBM 2FCVA 2E7QA 2WUHA 3WEZA 5BNPC 1WWYA 5FYIA 3CLPA 1ASJ1 1QDOA 3N7JA 3IN9A 3OD4A 3OJBA 4FXGB 4OZOA 4XUPA 5G04L 5FZ9A 3R0RA 3SISA 3E5XA 4DINB 4YVSC 2WC2A 1KGYA 2WA3A 1O5UA 3WXPA 2QJVA 2RE9A 4D7SA 1ZBE3 3CZUA 1UY3A 3GZUC 1CIWA 1JHJA 3JBG3 2C4XA 1Z78A 1HXS1 1QJU3 1PO13 3WP4A 4NHKA 2ZHLA 4MO3M 5FPUA 3ZMOA 5GZFA 1RUG1 3BALA 2YPDA 3ZYPA 1XNTA 1SLAA 3HBKA 1YI7A 5EIYB 1WMXA 1GNHA 2VOTA 3JB4C 3ZYHA 4K20A 1OLMA 4XTPA 1G9BA 3IIIA 3VBUC 1MEC2 4BXSV 1IOAA 4DUVA 3P5BA 3EHKA 3PU8A 2B7YA 1W3XA 2CL2A 2H0VA 2K2SA 1BVVA 2V5DA 4KG0A 3WNKA 4Q8KA 4BQ5A 1VMJA 3BN6A 3V0BB 4YG0A 1TE1B 3HN3A 3VBFA 4AZZA 4E9KA 1HN1A 1PVXA 1AXYA 4CU8A 1TVGA 3T0BA 4HT1T 2DTWA 4LBKA 1JXNA 3K77A 3HNMA 5KR7A 1K5MA 4HETA 1C8NA 3P6BA 5D1IA 5JXIA 5KWRA 4GQ7A 1X9PA 5CNAA 2ADDA 2IXCA 1O4TA 4LUMA 2WO7A 3KT7A 5JSOA 3WNOA 1IQAA 2JDKA 2XL7A 2TBVA 1WLCA 5IYYA 3THPA 2VW2A 2W3JA 2ZHKA 3M7AA 5FZHA 3VDDA 1H8TA 3VBRB 4D7YA 2F4LA 2D3RA 2JDYA 4QB1A 5EJ1B 3WCRA 4KGQA 5I0UA 5HCHA 2D93A 4YZ5A 3B7MA 2ZGMA 3O0XA 5KXDA 2NMOA 1DQ0A 4K1YA 4AXOA 4QPYA 4QX8A 4DO0A 1TNRA 1CJPA 3I8TA 2OPKA 4QB6A 3OB8A 4Y22A 3WNNA 2W68A 5KXCA 4HPKB 2IZWA 1HRV2 4IEZA 3O1TA 1UZVA 1A8MA 1HQNA 1W2UA 4H55A 4P9GA 3QLQA 5DMYA 3SHRA 1ZA4A 5A32A 1VBE1 1F35A 2FHRA 3CL1A 3NKGA 3BB6A 3VB9A 2PXJA 3B69A 4XF9A 1NQJA 5A6XA 5EWSA 5FMDA 5BNPB 2P37A 3UK9A 4Q26A 2RJLA 5A6YA 3OOXA 2XVLA 4CCDA 3I59A 4L0PA 1SBFA 2BGPA 1DQ2A 4KU8A 3W5NA 4JHZA 2WNVA 5ANQA 5CG9A 4JX0A 1CAWB 4RHV2 4CCEA 4RQPB 2BWAA 3GYDA 5EV7A 5IW0A 3NKTA 4AK3A 1BLZA 3M8LA 3LFIA 4OHXA 2W08A 4XC9A 4PIYA 1NE4A 1R092 1Y9QA 2AENA 2HYKA 5FZKA 2JB4A 2RM23 3KLSA 4FPYA 4A4AA 1S1AA 3OBTA 5CFCA 2R49A 5JR2A 1R1A3 4CDWA 1GWKA 3VBUB 5JI9A 2G1MA 5LBCA 2A5ZA 2A75A 4JGYA 4DRRA 3VDCA 3QH6A 1XE0A 5FDBA 1W2OA 4R4ZA 2EIBA 2D43A 1H9WA 5A80A 2VZUA 3AP5A 4PI0A 3USUA 1QNYA 4RS5A 3BKZA 4OI0A 3BIWE 3RVHA 1NY72 5FYUA 1NKGA 3VZLA 3C8XA 5FCCA 3CMGA 2A3XA 1WKYA 1REFA 2FQPA 3GF6A 3JD72 2XGXA 4XFAA 4BMBA 2D44A 4XMIA 4AFAA 4DS0A 4HOOA 1MR5A 4PLMA 4Q4Y3 4DPNA 4IEPA 4UW4A 3T4HB 3AKSA 1RUD2 4NPMA 2Q4SA 4YLZA 5LY2A 4A41A 3OCPA 4MXWA 2B39A 5GLZA 5A33B 3ILRA 3GZAA 5T5JA 4MHUA 2ADEA 3H7YA 2VOXA 3ZYBA 1Y9MA 1YEWA 1B09A 1O4ZA 2ZPXA 4OQ9A 3ORJA 3CBNA 1RUC1 4OI2A 1G7YA 2EXJA 4DXZA 3LPFA 3AKTA 4PJYA 4CUGA 5A1LA 4Y1UA 2ZMKA 1SLIA 2N7GA 4OCTA 4BIOA 4Q4V2 3GBWA 1ENQA 5LK7B 2WQ4A 2AACA 1G8WA 2VZQA 1MS1A 3ZN6B 2VXRA 5C8CA 3LE0A 4P9YA 4CDUC 4WVMB 1AYM1 4KWKA 3J8F2 2ORZA 4P5HA 5E16A 2QNKA 1EV13 2UWBA 3KZ4C 2D40A 4XZUG 1RUI1 5DDJ2 3OYWA 4QDQA 2B45X 2VQTA 4WVZA 4AQSA 3W5MA 2P5BA 3V65A 2G19A 3UKVA 2YBSA 4IEYA 2XQRA 2AUYA 2XQXA 5CG8A 3N7KA 3UGHA 4MZUA 3N7LA 1FT9A 3RGBA 3Q8BA 2ZBJA 1N1TA 3KWVA 4CDXC 1PK6C 3K3OA 1X8MA 3MICA 1BEV1 2XJSA 2IFRA 2ZGQA 3MW3A 4K8RB 3AYAA 5CEHA 3TOJA 3NAPC 2VECA 5ACA3 5IAVA 2VR4A 4HZFA 1DGRN 3ACIA 4DUWA 4W4ZA 2CNAA 2VQUA 2VUJA 5FY1A 3WNPA 4QKDA 1AR82 1I5ZA 1GR3A 2QFEA 4QQOA 4AG4A 3K51A 1UIJA 3I3BA 4RD7A 4A7YA 2WL1A 1ZZBA 2OYZA 4TXWA 3C3VA 2P1BA 2E32A 2NZ9A 5KC6A 4AEMA 3FBMA 1JHNA 2YY1A 3TEYA 2JD9A 2A73B 4BLIA 3WHTA
chains in the Genus database with same CATH topology
1NXMA 1ZBE1 2QZ3A 3DGTA 3RMYA 5J98B 1OA2A 4COUA 3FLTA 1FNYA 1QJU1 1PO11 1YFXA 3V0AB 1RHI2 3EO6A 2PHUA 3NV3A 4PBOA 3MF9A 1HRI2 3MFAA 3X29B 1XQNA 4UBGA 4OLLA 4LBLA 1DGRA 5EYYA 3ZO0B 2D3PA 1O3RA 3OGGA 2YXSA 3NJZA 4FQZA 4FPEA 1Q43A 3RPQA 3EBRA 3ZSJA 1RB8G 1V6KA 1RUOA 5L19A 1D2QA 2Q30A 3MIFA 4V1PA 2R1DA 4CDUB 1NCRB 5EZWA 2BGCA 2W39A 2VMIA 1VRH3 5DUWA 2D6LX 1GZCA 2UY8A 1J3PA 1MS3A 1POV3 2VW0A 3E5UA 3H9AA 5TSWA 2CWMA 4IV1A 3QOPA 1SLTA 2EIGA 4XHXA 4B7EA 1PK6B 1PZ8A 1AJKA 3D82A 2ZX0A 4Y5Z0 4YGDA 5T5PA 1AR62 2RS52 1B35C 2EAKA 4KBBA 1RUF3 3AP9A 5FTTC 2OIIA 1NXD1 3H3ZA 2OA2A 3ECQA 3VBHA 4R9BA 4QQLA 1V6OA 1UX6A 2B9UA 4AVAA 2PHTA 3VDDB 1H8TB 5H9RA 2XJQA 2WFF2 3ZYRA 2DYCA 4LHLA 1F2NA 4C0BA 3MLKA 4XFFA 4ORFA 1OOPA 4KWLA 1FPN3 1KDKA 2FZ1A 4YW2A 2Z5WA 1LOFC 4QPIA 1QQP3 4R9DA 4Y22B 2JKBA 1XU1A 1N3OA 1NLRA 4B3NA 1VBD2 5C4WA 2WA4A 1YI9A 2YC0A 4YARA 4IERA 3RS6A 4W6XA 5SV5A 1DGWA 3VZKA 1YUDA 1DFQA 3AYEA 4FCAA 3O0VA 4BE3A 1QMJA 1XU2A 2RM21 3SCGA 4AEDC 2GC1A 2NYYA 2VMGA 4M0NA 3B9IA 1I3HA 3ZFEA 4F7ZA 4BPZA 3ZFFC 3IBMA 3I59B 1LODA 1OPMA 4N7IA 4H14A 3MPPG 4FPHA 4TWTA 4XJ9A 1CAVA 4BWOA 5DZGA 1Q8SA 1GZWA 1FNZA 3UJOA 4FPFA 2VVFA 3U4XA 1YIPA 4FTSA 1LRHA 2AREA 2VPVA 2X53S 3ALQA 3O5SA 2WT1A 5E89A 5CFCB 2Q1ZB 2RR13 4Q0PA 5FPXA 4I0BA 1O5LA 3I7DA 4C91A 1RVF2 1LGBA 1ZVFA 2PLV3 4XETA 1PVC3 2DUPA 4JRAA 3N7MA 3USUB 2HWC2 1UPSA 1PGL2 4RS5B 4JC1A 1S0CA 3PVBB 4B4QA 1LHNA 3TYJA 1QJY1 5AFBA 5C9AC 1F5JA 1B35B 4M3CE 3WW4A 1WMDA 1IS4A 4AHXA 1EV11 1C28A 1ZRCA 1G9FA 3R6SA 1VBA1 4YM3A 1I6XA 3HT2A 2NN8A 1DIWA 1FX5A 1UIKA 4Y1ZA 1AJOA 1RMU3 4BM8A 2A3YA 5FOJB 5T5LA 2XJVA 4S2DA 3MW2A 1OD5A 4YNIA 2WINB 3NWKA 2HWE3 3FBYA 4EN0A 2RS12 5C8CB 4P9XA 1O91A 3BCWA 1WUVA 3HD8B 4UXAA 2HWB3 4K6BA 2JG8C 2PHWA 2WS91 4OHVA 1AR93 2O0OA 2QE3A 3CJXA 1BXHA 3KCCA 4MVTA 3RI8A 1AR73 2H6BA 4PLOA 1QXPA 1C5HA 3WW1A 5K8SA 4FTBA 1O7FA 3LB9A 1H1AA 1ASJ3 2DUQA 3IKWA 2ZGPA 2XWJB 1S0JA 1ND2C 2LTNA 3BOPA 3E6DA 1CPMA 4ASMB 3MIGA 1HXS3 1DDLA 1KS5A 1ULEA 4XF1A 1GBGA 1COV2 3W9AA 4PCRA 2DVFA 2CGPA 2R30A 1V9U2 2GALA 2VNOA 2VGDA 2WNUC 4LO4B 2V73A 4CP0A 3CEWA 1UAIA 3JZVA 5GM0A 3WDUA 4QM8A 4GWNA 1MS4A 2PQQA 1ZZ6A 2O1QA 2WJSA 1H1MA 3VBSC 3D6EA 4AVCA 4PDWC 1RC6A 1SQ4A 3HBZA 3WP5A 2MEV2 1RUJ2 1C8M3 2BVVA 3HQXA 1O3TA 2QUOA 4HFSA 3N4MA 1TNFA 3DPRC 2RMU2 1SMVA 2BW8A 3VZOA 1PIV3 1Y43B 3L2YA 1ZNPA 2JENA 4YVWA 4GA9A 1POV1 4GH4A 4GKYA 2CAUA 1BBT2 4IQPA 2XH6A 4H7LA 1W6QA 2AZ5A 2CY6A 3FMGA 4Q0UA 5JZGC 5AC93 2O8OA 2R6QA 1FOD2 3CJIA 1AXZA 2IXIA 1G9AA 1ENXA 4LBQA 3BOWA 4GIQA 4PQ9A 5DXDA 1VBE3 1PNFA 4IV1B 1VLNA 4Q0VA 5FREA 2HWF2 3S6PA 2Q5TA 1V6MA 3IDCB 4N9HA 5JR7B 5I0SA 1GYKA 1Q56A 1QXRA 3FZ3A 1FMD2 1LKNA 3WQ7A 3AP6A 3J4UH 1U0AA 1FPN1 4LEJA 4YVSA 2JEMA 5FO9B 4XFIA 1LOBA 2R042 3MPBA 1QQP1 3WG3A 2CYFA 3ZSMA 5D8AA 1APNA 1MQTB 1VRH2 2BYVE 1F31A 4LT5A 4YW3A 1MZEA 3N3HA 3WVJA 3IPVB 2V5YA 2BFUS 4M01A 4JVAA 1OOPB 5LEJA 5ABJB 2B5HA 5LRRA 1OQDA 4SLIA 4M00A 2I45A 4HK9A 2P3JA 3BTAA 3LKJA 1NOVA 5IK5A 1OHFA 1PGSA 2NQYA 1NCQB 3AYDA 4A2UA 4XF4A 4XHBA 5CIRA 4NVPA 4META 2IC1A 2RR11 4AF9A 5LEKA 1QOSA 2D98A 3KCXA 4E27A 3ZFEB 5GLWA 1QJX2 5JIUA 5CB7A 3TAYA 4OULA 1DHKB 4BCUA 5CA6A 3ZVXA 1DQ1A 3O12A 4YYOA 2EXHA 3AZWA 2VNGA 3AMHA 3ZXDA 2JECA 2W0XA 4LTAA 4HKOA 4QXKA 1HQWA 5HI0A 5KBFA 2CGOA 3KQRA 1H1IA 4MX3A 4AFCA 5L7OC 1RUH2 1EAH2 4ASLA 3WDXA 4O9EA 2Q8OA 3U11A 4MGYE 3BPZA 2E7TA 4KQ7A 5T54A 3USSA 5BV6A 1O3SA 4C90A 2GH2A 1RITA 3U10A 3AZXA 1LB2A 1ND3B 4XFBA 1AL22 4LULA 4FOQA 2VW1A 1RMU1 3MLJA 1KJLA 3PHMA 4FVVA 3VBRC 4MH0E 1LU2A 3Q9OA 5BY5A 1YNAA 3U0ZA 3LCPA 3AFGA 4MGZE 2VY0A 4Q4X2 2HWB1 4E4DX 3RMXA 2NMNA 1H4GA 4FXKB 1AR91 4ZU4A 3JQXA 4HKLA 3OY8A 2PLV2 2R1BA 4G3YC 1JTZX 4Y20B 5JOXA 4ZXKA 1PVC2 4Y1VA 2AR6A 1URXA 1EY2A 1DU3D 3ZN5A 4CEYB 1N1SA 2E51A 3KSCA 4LUKA 4XQWA 4A7KA 4QX5A 3PVEA 4MGIE 2ATFA 4RQPC 2WWSA 1WCKA 1U5ZA 1NE6A 3PNAA 3SITA 2E9QA 3T1MA 2EXKA 4JV4A 5JSRA 2R073 3LGRA 4GXLA 2R32A 1VBB2 2YHJA 4W65A 4N43A 1XYOA 4PLNA 4OUSA 5FQ0B 2GSYA 3RI9A 4JGZB 4I02A 3FUQA 5H9QA 3NV2A 1DYPA 4IEVA 5K9YA 5F6KA 1LESA 1SFYA 1ZBA3 3IT8A 5L7OB 1C8M1 4GULA 3S30A 3E97A 2R062 3INAA 1AX0A 1QDCA 4NHLA 2B42B 3AZYA 3TWIA 1ZYBA 1PIV1 2Q1MA 2VOWA 1A8DA 3RSJA 4XJ8A 3GZTB 4CEWA 4MGKE 4ZU7A 2D7FA 2D6NA 4WVWA 4K8FA 1XE7A 2D6MA 2YDEA 2CGNA 1VIWB 3M70A 5AC91 1SLLA 1HDKA 3K48A 1FV2A 4RHV1 1ZZ8A 5JOZA 1HXS2 4EWDA 3M4FA 3JCIA 3IMNA 3VHOA 2WLPA 1QF3A 5GZDA 3NAPA 5I8SA 2DUOA 5I93A 1RUG2 4IEXA 4U2AA 1R091 3AKRA 1ENRA 1WA4A 2IWGB 1GSLA 1REDA 2XWBB 3DF0A 3ELNA 4YVWB 2MHFA 3AKQA 4D69A 4WZCA 4I01A 1LEMA 3M3IA 4S2FA 4LBQD 1Z7S3 3TN92 1TMF1 4J6GA 5I8TA 1UD1A 4FOYA 2A71A 1EP0A 1ONAA 4B4PA 1DZQA 2WNEA 3PLQA 3RQ0A 3WW3A 1C1FA 5K7PA 2Y26A 3CJIB 1M06G 2ZMNA 2UURA 4GMP1 1G9CA 1QNWA 1CONA 5FBZA 3FX3A 4LBQB 1WLWA 5BNOC 2BBVA 1AL0G 5JWPA 3LWCA 1AYN3 1CPNA 4NO4A 3UL2A 1KFXL 4IETA 4WM8B 2KA3A 5HXVA 1ZZCA 1RUD1 3OBRA 2OVUA 3IDBB 3M2MA 4GB33 2DCJA 5K0UA 1AUYA 1BQPA 3APBA 4LBNA 2TNFA 1D0GA 2BWCA 4COVA 1S55A 4CDQA 2A70A 2VU9A 1ZREA 4I0AA 1DG6A 4F8AA 5CFDA 1H2NA 2DV9A 2O8QA 3R4DB 1JOJA 2XLFA 4N53A 4KG8A 2NM1A 2AYHA 3VBOA 4LBMA 4R8HA 1WMEA 5L36A 2BUKA 2C5DA 1CESA 1D2SA 2OUJA 4HKWA 3ZYJB 2XG3A 2E53A 4COWA 1QJY3 2Y0IA 3B9CA 2H6CA 5C33A 3WG2A 3V64A 1T6GC 2UWAA 2VQAA 1G6NA 2YUEA 1NCRC 3HN1A 5CAZA 1BJQA 4N9IA 3H8UA 3QCWA 4MV2A 3ZSKA 2DTYA 3ENRA 4CP2A 1VBA3 1HX6A 1J3QA 1YXWA 3HT1A 4K21A 1NG0A 3VBFC 4E2GA 4EN9B 1JUHA 3KT4A 2IXJA 3GHNA 4MSVA 1LOFA 2EA7A 2VUAA 4WM7B 1J59A 3POWA 1AVBA 1D4M3 5BNOB 2WS93 5J48A 3E5QA 1H2MA 5FLJA 5T5OA 1KS4A 4L92A 3KT1A 3WP3A 2JDZA 1C3HA 1HRI1 3ASIA 1YFUA 3RYKA 1R083 5IT6A 3VDDC 3KCYA 1H8TC 1S0GA 3WOGA 1VBC3 3ZFFA 2Z2SB 2ZGUA 3A0KA 3AMMA 4RR3B 4XILA 1RUC2 1ZM1A 1Q8VA 2ZZJA 5AVAA 2FMYA 4FAHA 1MZ6A 2C9AA 5F6LB 1LOEA 4LLOA 1XE8A 1AYM2 4HVRA 3ZN4A 5T50A 2LUWA 1RUI2 4XMAA 4G4FA 3WZ1A 4DNYA 1WBLA 1S0DA 3OY8B 4ISRA 2R071 1PHMA 1LULA 3H3UA 3H7JA 1EPZA 3ST7A 1X7NA 1QOOA 2ZX2A 4UW3A 2ES3A 2WT0A 2PHDA 4DB5A 1DZTA 3GBFA 5T55A 2RS33 1WW7A 2CWSA 3OGJA 1BEV2 3MEPA 2C0ZA 2OZ6A 1GLHA 1ZBA1 4KWJA 4AFBA 2D6OX 4C0HA 4FPLA 5KHIA 1V70A 2P3IA 1TME2 3AM2A 3VZMA 2DURA 4J1XA 2GMMA 5CFCC 4O9GA 4AI8A 1FI2A 3J9SA 1UMZA 2Z79A 3ZIWA 3LA2A 3NVCA 3FE5A 4N43B 2E7AA 4XF3A 5J37A 3ZXAC 2DFBA 3P3PA 4YM2A 4M0HA 2XBO3 4M3CF 4JCKA 4RS5C 5JIAA 1Q8OA 1ENSA 3VBFB 1ZRDA 1PO23 2UY9A 3LA3A 4CP1A 1UF2C 2ZGRA 1KRIA 2YPJA 1U5XA 1I9RA 1ZBE2 2ZGNA 1K5MB 1CX4A 1VBD1 3JBG2 2HEWF 3W58A 1QJU2 2JG8A 1PO12 3HR9A 1Q3EA 1PNGA 1AHSA 1DYKA 1W0OA 4Q0QA 2VMHA 2VVEA 4CEWB 4JTOA 1TQ5A 3WT3A 3HIFA 4AGRA 4Y1XA 4YZ1A 3SXWA 1V6NA 1IPJA 4WVVA 2VH9A 3AXDA 1ULGA 3E6CC 1Z7S1 2WZR3 3FFQA 3RRDA 5FMOL 3RJ2X 2P34A 4EN8B 3VZJA 1ULFA 5FLHA 4NWWA 1BK1A 1ND2A 2A6WA 1LJ7A 1JW6A 4Q4W3 4OI1A 5C8CC 2XVKA 1LOGA 1NA1A 1IKPA 4AFMA 1CN1A 5BYNA 1AYN1 4NWVA 5A32B 3H1MA 1X33A 3PMEA 4ISQA 4YM0A 1VALA 2TUNA 2QDRA 1RUE3 4EROA 4QPGA 2R0FA 3D0JA 3OF1A 3LSEA 3L2HA 4GB31 4OI4A 1LR5A 2ZGTA 4TZDA 4B4RA 1ULCA 5GJ6A 2OW4A 1QGLA 2BTVC 2BQPA 3VBSA 1AXKA 4IEWA 3GHMA 5E8AA 5I0TA 2WNVB 3M3EA 3U07A 4PDWA 1GKBA 5BNNA 2XVGA 1QY4A 1LTEA 3ZXKA 4Q8LA 5DG2A 1BMV1 3VKNA 1WD4A 2ENRA 2HJIA 4QGMA 2FBEA 3FUOA 4CDWB 3D4KA 5HCFA 1SCSA 4JGYB 2VG9A 4HN0A 2PHFA 5K0UB 3MF6A 4LE3A 4AVTA 3D8CA 4HMZA 2HKXA 3R05A 4CDQB 5BUVA 4I09A 2UU8A 4AHZA 4N90A 5JZGA 1J3RA 3AJZA 2RS11 2HWD3 3VN4A 4I2OA 4IV3A 5CFDB 3H0OA 4QGLA 2CV6A 4HVQA 5EXOA 4N53B 4K9SA 4AGGA 4D3WA 4LO8A 2FMDA 3I54A 3MZHA 4HBNA 2GAUA 3OPZA 4MXWB 2RM22 1DF0A 2YROA 3VGIA 1R1A2 3B00A 3ZFGA 2X5IA 1BZWA 1RIRA 2GC3A 3WDVA 3MLLA 3B3QE 3AFKA 3GNEA 4XJZA 2E6VA 3R4SA 3H50A 2JICA 4I3PA 1GQHA 4KGGA 1D4M1 4CRQA 3THTA 2ZKLA 4NR1A 1QKQA 2QVSB 3I2DA 3CF6E 3OYWB 4Q4Y2 4EN6B 2FZ2A 1VAVA 1V9U1 4IV1C 1MEC3 1R081 2WZPP 1VBC1 4TYSA 1GV9A 1WGPA 4JQRA 1VP6A 4Y24A 1BYHA