4U36A

Crystal structure of a seed lectin from vatairea macrocarpa complexed with tn-antigen
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
233
structure length
229
Chain Sequence
SEVVSFSFTKFNPNPKDIILQGDALVTSKGKLQLTKVKDGKPVDHSLGRALYAAPIHIWDDSTDRVASFATSFSFVVEAPDESKTADGIAFFLAPPDTQPQKDGGFLGLFNDIQTVAVEFDTFSNTWDPSARHIGINVNSIESMKYVKWGWENGKVANVYISYEASTKTLTASLTYPSNATSYIVSANVDLKSALPEWVRVGFSATSGLSRDHVETHDVLDWSFTSTLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Seed lectin
publication title High-resolution structure of a new Tn antigen-binding lectin from Vatairea macrocarpa and a comparative analysis of Tn-binding legume lectins.
pubmed doi rcsb
total genus 51
structure length 229
sequence length 233
ec nomenclature
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4u36A00
3W59A 2ZMLA 2P37A 1CONA 4GA9A 3C2UA 3RS6A 3VKFC 3AZYA 1U0AA 2AYHA 4DQAA 1S0JA 1S0FA 4UW3A 3ZYRA 1MS3A 1GNHA 2PELA 3M3EA 4Y26A 1GSLA 3OGGA 4BLIA 1SLCA 2I2SA 2D6KA 5T54A 1ULCA 1DQ6A 1WCSA 2AENA 3JUUA 5GZEA 5H9PA 5EYXA 1IS5A 3M3QA 1PZ7A 2A3XA 2ZHLA 1UL9A 5DZGA 2DWRA 1QKQA 3B01A 3WG1A 4YM1A 4ZKTB 2EALA 3R4UA 2GNBA 2DU0A 2CL2A 1IOAA 3FLPA 3AP6A 1LCLA 4P14A 5JMCA 4JC1A 5EXOA 3FLTA 4YW4A 5JLVA 5KXBA 1DIWA 4AGVA 5AVAA 1HDKA 4HL0A 4RA0A 1MACA 1W0PA 1Z78A 1CVNA 3RRDA 4CTEA 1GBGA 2EF6A 5F9TA 5GJ6A 3SITA 1CN1A 4NOTA 4FOQA 1N3QA 2R16A 3POSA 4BMBA 3V0AA 3B00A 1BJQA 2D7FA 3AP5A 4FVVA 4YW1A 4LBNA 2GALA 1JYCA 1PZ9A 1SACA 4LBLA 4FQ4A 2D43A 4M3CB 4XJWA 1HQWA 1ULGA 2DTWA 2JDZA 2R0FA 2VUAA 4FPLA 1Y7BA 2ZABA 4BLJA 3NV1A 3ZXFA 1WW4A 1YI7A 1AZDA 1XQNA 1V6OA 1H30A 3ZSJA 1FYUA 2ARXA 1LHVA 5CB7A 3RSJA 1WBFA 1EPWA 2ZBJA 1V00A 4M00A 4LBQA 4YGCA 3POWA 1N1SA 4XJ9A 1LGCA 1UZZA 3ZXJA 5IK4A 2ZGSA 3AFKA 5JOXA 4YZ5A 1LEDA 5LK5A 2VU9A 3ATGA 3AX4A 1IS6A 2ZGTA 1JW6A 2NN8A 1X50A 3IM0A 4R9AA 4XMIA 1AX1A 4GXLA 4CRQA 1I3HA 1MZ5A 1CR7A 2DVFA 2WT1A 2ZMKA 4U36A 5IUQA 5GZGA 1N3PA 3AYDA 1G86A 3WG3A 2JE7A 2EXJA 1AX2A 2NMNA 4OZXA 5JDBA 2A5ZA 2DVAA 1BZWA 1DQ1A 1C4RA 1SLIA 1UKGA 2ZGQA 3WLUA 1SLLA 1D0HA 4Y24A 2WSVA 1ZA4A 3B3QE 4XE9A 3I8TA 3FLRA 2UURA 1MVEA 3N7LA 2CNAA 4AVSA 5KXCA 1JBCA 4YGDA 4AVTA 1WLWA 2WQZC 3PVNA 4XJ8A 2JE9A 1LOFA 5GLTA 3WDTA 4U2AA 1GZ9A 3N3HA 3R4SA 2OUJA 4P9WA 3T1LA 3W58A 1H9WA 1F5FA 2ENRA 4K21A 1NLSA 3LCPA 2PHTA 1LHUA 4Y22A 5DUUA 3AYEA 3M1HA 2DUQA 1BXHA 4AYUA 2PHUA 4Q2FA 2Z42A 4MYEA 3BOPA 1G9AA 1W6NA 3V0BA 1DBNA 2BQPA 3FFZA 1UPSA 3L2YA 1BKZA 2D6NA 3PJQA 2CWMA 3WCRA 3BIWE 2UWCA 2ZGRA 3AP9A 1S0CA 4DPNA 1YO8A 1DQ4A 1N1VA 3IKWA 3ZSKA 2A75A 2E53A 2ZGPA 5EWSA 1OKQA 3UJQA 4DRRA 2G4IA 1S0EA 1QOOA 3VKNA 5GM0A 4BM8A 1KDKA 4YZ4A 2CY6A 2JJ6A 2WT0A 4Y20A 5T5PA 3WNXA 4SLIA 2A6YA 1V6MA 1MZ6A 1S0DA 4K20A 1HQLA 1LESA 2ZGNA 5KXEA 4FOYA 5DG2A 3VV1A 2DTYA 1CQ9A 1H9PA 3IPVA 1SLTA 4XIOA 1QF3A 5JOZA 1MVQA 1A3KA 3GNEA 1AJKA 3DGTA 4F83A 1W6OA 3ZXKA 3KM5A 1FATA 4ISQA 1UN1A 3QCWA 1DGLA 2A3YA 1W6QA 4Q8LA 5IT6A 2ZZJA 4LBKA 5GLZA 4FPGA 4YM2A 4YG0A 1CIWA 3RMXA 2DYCA 2P3JA 5GZFA 2D6OX 4GWMA 2ERFA 4DS0A 3AZVA 5CNAA 2OUHA 2WNEA 3WUCA 4FPEA 1V6NA 1GANA 4M01A 4WVVA 3PVEA 1ZM1A 3ZXLA 1FNYA 1FX5A 2EXIA 3B9CA 3ZVXA 4YFZA 4XJAA 1MS8A 1ENRA 4FOWA 5E8AA 3MW3A 3DUIA 2CYFA 1JHNA 1Q56A 2JD4A 1OQ1A 2R0HA 3MPPG 3NV2A 1IKPA 4XDQA 5DXDA 3VKOA 4FPHA 2EXKA 4Y20B 3OBTA 2XG3A 1BYHA 1WW6A 4FP3A 2GNDA 4YG3A 4FPYA 1MR5A 5E88A 5T50A 4XIKA 2ZGKA 2A6XA 4PF5A 2A6VA 3AK0A 1IS4A 3HN1A 2ZGMA 2FHRA 3PMEA 2PHFA 3WZ1A 1CPMA 2EIGA 4YFWA 4XHXA 4ATEA 1LOBA 1SBDA 2D3SA 2AUYA 4YGEA 3O5SA 1AXKA 3MEPA 1SBFA 2E51A 1OFSA 1G9DA 1JXNA 1LHWA 1G8WA 1LODA 4FPCA 2R1DA 2GNTA 4YM3A 1DZQA 4RL7A 2CWSA 2NMOA 3FBYA 4M3CE 3N36A 4C1XA 1NXD1 2UU8A 3D6EA 3V0AB 4HANA 1BQPA 2B7YA 1FV3A 1S1AA 4XMAA 2Q5TA 3VKLA 1LTEA 5T5OA 3WUDA 1KITA 5DG1A 2A7AA 5H9SA 4XJUA 3ZSMA 3T1MA 1ULDA 3TAYA 1LULA 4WVWA 2VXRA 3SH3A 5FRAA 5DUWA 1V6LA 2XB6C 1B09A 1HKDA 5T5JA 1C1FA 3OYWA 2CTVA 4P9XA 2VW1A 4BPZA 4LBQD 1Q8PA 3OY8A 4YM0A 3TB0A 2A70A 4LBQB 4M3CF 3AZZA 4Q8KA 1DLLA 2YZ4A 1DQ5A 4AGRA 2AGSA 4FPFA 1Q8SA 1LOAA 5BYNA 2R49A 4TYSA 4UW5A 2D3PA 1QDCA 4Y1UA 1UMZA 1URXA 4FOVA 4XJZA 3IMNA 1J1TA 1N3OA 1W6PA 3U4XA 2ES3A 3ENRA 4Q1PA 1GZWA 3A4UA 2DVDA 4Q27A 4XBNA 1CJPA 2TEPA 3LSEA 3ASIA 3AXDA 3CNAA 1MS9A 3I4IA 3WDUA 2EXHA 2AH2A 2D6LX 4LBJA 1Q8OA 2YV8A 3NV4A 2A3WA 2W68A 2PHXA 4W65A 5JOYA 2D3RA 2GMEA 1ONAA 3QLQA 4YLZA 5T55A 1VLNA 2A6WA 4L8QA 1AJOA 3SNMA 2NM1A 4FQZA 5T52A 3FUOA 4XILA 5JOWA 3O0WA 5GLWA 1ULEA 4K1ZA 4XHBA 1JYIA 2GN3A 3N7KA 2ARBA 2UWAA 1KJRA 3PVOA 1V6IA 1WW7A 1WUVA 4XBQA 3RQ0A 4GKXA 1W6MA 1DQ0A 1UZYA 1F31A 4Y22B 1MS5A 4ITCA 4YW5A 3V0BB 1W6NB 1G9FA 2VH9A 3A0KA 5DZFA 4LBMA 1VAMA 4Y1ZA 3AXEA 2LALA 1N1YA 1SBEA 3AYCA 4ATFA 1WD3A 2NYYA 2DVGA 3USUA 4PBPA 1MS0A 1LU2A 4I30A 3NV3A 1LENA 1JOJA 5CA6A 3RG0A 4YW2A 4AVVA 4XBLA 1F9KA 4UW6A 1RINA 1I1EA 1AXYA 1O4ZA 2C9AA 1IS3A 1YXWA 2A6ZA 2ZGOA 3B69A 3N7MA 3O0XA 3O12A 4JRAA 4Y1VA 3MW4A 1PZ8A 5F5QA 2WJSA 3OPZA 1GLHA 1AF9A 1GICA 3AP7A 4GKYA 1ULFA 4YZ3A 3USUB 2VW2A 3D5OA 4UW4A 3SH5A 1Q8QA 1FAYA 3D4KA 3IPVB 3N7JA 1QDOA 2UWBA 5L73A 1S0IA 1W6OB 3SISA 5IK8A 2ZGUA 1C1LA 2DVBA 1R1ZA 3AJYA 4XYXA 1QOSA 1W6QB 1YYNA 5HCAA 3ZPYA 1KRIA 1LJ7A 1MS4A 2RHPA 4P9YA 3SLIA 3V64A 1IKQA 1KJLA 1YRZA 1GV9A 2JKBA 2P34A 1DYPA 3OBRA 5GLUA 3WOGA 1A78A 1SFYA 3IN9A 2SLIA 2H0BA 3APBA 1SLAA 5E89A 2YXSA 5EYYA 3ZXEA 3UL2A 1Q8VA 2AREA 1CESA 4WZFA 5JVVA 2ZACA 3WDYA 4R9DA 1QU0A 1LOEA 1MS1A 2W52A 3RMYA 1AVBA 2YROA 5H9RA 3AZWA 5SV8A 2ZGLA 4Q26A 5CBLA 4FPJA 3WDWA 1SCRA 4H55A 2OVUA 3KQRA 1DFQA 4WV8A 4R9BA 4PQ9A 3VKMA 3T2TA 4C1WA 2P2KA 5IK7A 4TZDA 2V5YA 1LEMA 4M3CA 4YZ1A 5HCFA 1KQRA 2OW4A 1GYKA 4R9CA 4Y1YA 3ZYPA 3OJBA 1QNYA 1VALA 5IK5A 1N47A 3AJZA 1GNZA 5DUXA 1YIFA 2D44A 3N35A 3HMYA 1WD4A 2KM2A 3JU9A 2VW0A 2JECA 3A0NA 3M2MA 4GWNA 4PCRA 4AGGA 5GZDA 3INAA 2P3KA 1LU1A 1D2SA 1WBLA 4YW3A 5HCBA 4Y1XA 4YZ2A 2GN7A 1WLDA 4FP2A 3LSDA 1LOFC 2AR6A 1JUIA 2LTNA 4JCKA 1GKBA 1A8DA 1FNZA 4LBOA 3Q9OA 4FPOB 3H0OA 3NWKA 2D6MA 3O0VA 3ZSLA 2WSUA 1LOGA 3UJOA 1LHOA 1CPNA 1G9BA 2ZHNA 3POYA 3ILFA 1GZCA 2EAKA 1N1TA 2DU1A 3WCSA 3WG2A 2ZHMA 2PHWA 1G7YA 1SCSA 3OYWB 2NP0A 3AP4A 2WLQA 1ENQA 4KBBA 2DUPA 3AYAA 2YY1A 2WT2A 3OY8B 3HR9A 4ZXKA 4CZSA 4IQPA 5CAZA 4XZPA 2ZMNA 4DRVA 2V73A 1RIRA 1HLCA 1QOTA 2GNMA 1S0BA 4NO4A 4XTPA 3R05A 4ASMB 5GZCA 4BQ1A 3M3OA 1LOCA 4XXAA 1VAVA 1WLCA 1Z0HA 1W6PB 5GLVA 2GMPA 3V65A 3WDVA 1GZWB 3ILRA 3M3CA 4FPKA 1LGBA 4D69A 2ZA9A 1DYKA 1FV2A 1O4YA 1JN2P 1RITA 2ZKNA 1UX6A 3MW2A 2A71A 3GALA 5DZEA 2DUOA 5DUVA 4YGBA 5GALA 4BMEA 4PBOA 4BOWA 3ILNA 2DURA 2W39A 5KXDA 3AZXA 4Z8BA 1TEIA 2GDFA 1G9CA 2FMDA 2P3IA 1AX0A 2W08A 1KDMA 1LHNA 4XXPA 3WV6A 3WVJA 3FUQA 1DQ2A 1ENSA 1QNWA 2E6VA 1VIWB 1V6KA 1QGLA 2E7QA 5T5LA 2ZHKA 1APNA 1LGNA 3BODA 2YMZA 1QMJA 1W0OA 4K1YA 1S0GA 1W6MB 2SBAA 1DHKB 2NZ9A 2HYKA 3VUOA 1LECA 1C57A 1V6JA 4ISRA 3WHTA 1WW5A 2WKKA 2PHRA 3UK9A 5H9QA 4XTMA 3WG4A 1AXZA 2R1BA 3BTAA 3SH4A 3WDXA 4Q1RA 2GMMA 4AWDA 2C5DA 2D6PA 2DV9A 3WHUA 2VY0A 4GALA 4XOGA 4YG6A 2ZAAA 5FREA 2E7TA 1SLBA 4DFSA 1UAIA
chains in the Genus database with same CATH superfamily
2QQVA 3W59A 1X7NA 4PF1A 4LE3A 2OQ6A 2R062 4LKFA 4XFCA 1QQP2 3BTXA 1JTZX 3NVCA 5F2WA 1J3PA 3OD0A 4XC9A 4UBHA 1MS3A 3M3EA 1SDWA 2QQUA 2PAEA 1GSLA 3J8F3 3W20A 1PO21 3VGIA 1ULCA 1DQ6A 4FFHA 3JUUA 4G3YC 4V2WA 5H9PA 4QAWA 5FJHA 1GFF2 1UW8A 1ZZ9A 1RUD3 2PAKA 2IVJA 4OZOA 2ZHLA 4QB2A 3S5QA 1ZBA3 4XACA 4QX3A 4Z2AA 1QKQA 1H6XA 3B01A 5FFOC 1FOD1 4CA9A 4ZKTB 1CAWA 1BK0A 5FZ0A 3VB9A 3VHPA 4UFKA 4D7TA 4AXOA 1W2OA 2DU0A 3W5NA 3WP5A 1LCLA 2VULA 3JQWA 4JC1A 4Q4W3 5J37A 3FLTA 5A3TA 4CCKA 3OGVA 4KWKA 2W0XA 1D7PM 1DIWA 4GH4C 1OVSA 5LBEA 2BDRA 3GBFA 2BUKA 3HT2A 1MACA 1Z78A 2R073 2E32A 3PIGA 2B8MA 4EZHA 5F9TA 2VGDA 4A7ZA 2VZQA 3E6DA 3SITA 1RUJ2 1QXPA 1QJY2 1N3QA 3POSA 3MV11 1UYXA 4QB1A 4DEVA 3TRSB 3IIAA 5FR3A 3TYJA 1T6BX 3LE0A 1YFYA 3C7GA 2GALA 4TSVA 1SACA 3UGFA 2ZX4A 2XJTA 4LR4A 1ULGA 2JDZA 3I3EA 1K5MC 1QXRA 4LIVA 5J98B 2JG9A 2ZEYA 1XQNA 4AQ2A 3ZSJA 1VMHA 2C6SA 3DKWA 1W0NA 2VTXA 2X8KA 4CP0A 2R7EB 3OBAA 5LASA 1NZCA 3H9AA 5CB7A 3VBUC 3ZO0B 2YFUA 3BYWA 5BNOA 5KHIA 1BVP1 1V00A 1AR82 5FBZA 2JB4A 1N1SA 2D93A 3I54A 5FZOB 5IVCA 4AOCA 1UZZA 2QFEA 1S2KA 2C1FA 3A21A 4FFIA 4HBNA 1JW6A 3MDPA 4XMIA 5DAVA 2BNOA 3HIFA 4KGQA 3RZHA 2ZKLA 4U36A 1GP4A 5IUQA 1BLZA 3HQUA 1PO12 1PK6A 2PMWB 3J7NA 1M4WA 3WQ7A 3KB5A 3KZ4C 2FDHA 3RWNA 2RS12 2JE7A 3G7DA 2VOWA 5HXVA 2BOJA 5FV3A 1L3JA 1SG3A 1DQ1A 1C4RA 1SLIA 4CEWC 2PQQA 2ZGQA 3J8F1 3WLUA 4D6QA 1SLLA 2Z69A 1XNAA 3HJRA 4AHYA 1Q43A 4XE9A 3B3QE 2HWE2 2R30A 3EHKA 1RUD1 4IGQA 4QXKA 2CNAA 1HN0A 4YGDA 4XF3A 4PDWC 5I0UA 3WF0A 4IV3C 2R061 4XJ8A 3RZGA 1QQP1 4U2AA 1GZ9A 3EYPA 3N3HA 3R4SA 4P9WA 1DZTA 2H6CA 4A3XA 1PGSA 2YPJA 3H8XA 4Z07A 4K21A 4AEJA 1O8SA 5L7OB 2Q1ZB 4L11A 4CUBA 5FY4A 1I9RA 3MLJA 1XYNA 3N9QA 3SCGA 1X8EA 4Y22A 4D0QA 1NX9A 1PNGA 3BOPA 1W9YA 1W6NA 3QOPA 1UD1A 2VNVA 5IAXA 3H8RA 1GMMA 2BV4A 2VMEA 5J96B 2D6NA 2CWMA 2K9ZA 3WCRA 2UWCA 3AP9A 1S0CA 4DPNA 1YO8A 1DQ4A 2Q8EA 4AEDB 2E53A 2KR2A 1EAH2 2ZGPA 5EWSA 2DBNA 2G4IA 2RJKA 2DCJA 4LOTA 5FP4A 1QOOA 1J1LA 5EFUA 3THCA 2JENA 3ZKUA 5FZHA 4BQ2A 3GYDA 1RGSA 2Z4FA 4QDSA 3BTYA 2CY6A 2G9GA 5ABJA 2WT0A 2XJVA 1W3XA 4HK9A 5K8SA 4COVA 2PTMA 5JR7B 3JQXA 2E9QA 4BE3A 1Y3TA 1L7RA 1BEV2 2VMHA 1JH5A 3ACFA 3VHNA 1H9PA 3W21A 4LOSA 4XIOA 3OGJA 4NE9A 3TBDA 1PVC2 3JZVA 3KT4A 4F83A 4Z1VA 5BNPB 4Q4Y2 2YBKA 3KM5A 4KMQA 3KMHA 1VRH2 3LD8A 1DGLA 1W6QA 3CQOA 1Q3EA 5IT6A 1UY0A 5C3PA 3I97A 2HBUA 4E4SA 2P3JA 5GZFA 4GWMA 3D3AA 3MZHA 1O3RA 2V4AA 2WNEA 3K51A 4Q4V2 4FPEA 1E5HA 2WNUB 2BOIA 1CIYA 1H6YA 4XW3A 5LY1A 1FNYA 3B9CA 3K3NA 3ZVXA 1JZ6A 3ZIXA 4LO5B 4IEXA 4O61A 4QXHA 4PIZA 3NV2A 4XDQA 3K4AA 1IKPA 4J25A 4HSJA 1GQHA 4NWWA 4QM8A 5A1FA 5DDJ2 1WW6A 4YG3A 2AC1A 3GM8A 4XIKA 2ZGKA 1NA1B 2VQAA 1IS4A 5A6ZA 3AVSA 5FZFA 2GC1A 2PHFA 4LUKA 5DAQA 1X36A 2HWE1 3O1SA 3WZ1A 1XSRA 4Q0SA 4H2AA 3T4VA 4YFWA 5LA0A 5JI9A 2ZEZA 3IZOA 4ATEA 5SV5A 3O1MA 1GUIA 1LOBA 2C24A 4MVTA 1PX4A 1SBFA 1QH6A 3VBHA 2RDRA 4GB33 2ZX1A 4HKLA 5FPZA 5JR2A 4N53B 3ZFGA 1X33A 4NRPA 2PHLA 3N36A 5FY7A 4BISA 4BQ5A 4CSWA 1PMIA 2ZXQA 1NYWA 3LQCA 1BQPA 4CP9B 1UO9A 2Q5TA 1DGWA 2UYBA 4QQOA 4HVQA 5DG1A 4CUAA 5L7OC 2O8OA 3S7IA 1ULDA 3GJAA 4AHXA 1H4GA 3M3IA 4CCCA 3SH3A 5I0RA 4ARYA 5F3EA 1IG0A 3AVRA 1HKDA 4Q5OA 5FKCA 2GU9A 3PUIA 3H3LA 1NLRA 2VW1A 4BPZA 1UPIA 5FY8A 4CDXA 5A70A 3PIJA 3EBRA 3K4ZA 2FDGA 4EZ4A 4AEDC 4LBQB 4M3CF 1DG6A 1P8JA 2CDOA 3S30A 2VMDA 2JDAA 3T08A 3VZOA 4CU6A 1JZ4A 2LS6A 4FPFA 2CGNA 3VBRB 4FTBA 5BYNA 3NAPB 1AL0G 3VDDB 4JHZA 5K9YA 4J1WA 1URXA 4XJZA 1UMHA 1XNKA 1N3OA 1W6PA 2IVIB 1J3QA 2ILMA 3OOXA 4Q1PA 1PVC1 4RQPB 4ZPIA 1CJPA 5FZ9A 2FD8A 4JQRA 4UFIA 3WDUA 2EXHA 4XUQA 2J1TA 3NV4A 3O1UA 2PHXA 1WCKA 4N43A 5JOYA 4QQ2A 2ZZQA 5FZ3A 1V70A 3OCPA 2GMEA 1CZTA 3QLQA 5T55A 1VLNA 4BQWA 1AJOA 1O5UA 5BNPC 2XBO2 4CDWB 3NSTA 2XJPA 5T52A 3WW4A 2VCCA 3FUOA 5JSPA 5JOWA 4I09A 1C5HA 4RHV2 4CXWA 5I8TA 1V9U3 5I0SA 2RJLA 4W6WA 1MEC3 2B4KA 4JDNA 3FHIB 3N7KA 2WNUC 3U75A 1KJRA 3PVOA 2QJVA 4FI9A 1PIV3 1QXJA 2FCTA 4IETA 1NCQA 2Y34A 3Q8EA 3KGLA 5APAA 1W6MA 2VE1A 1F31A 3KVAA 4GB31 5EV7A 1CAVA 1KFUL 3VBSA 4A41A 3V0BB 2HWD2 3THPA 4LK6A 4CCOA 2WYSA 2LALA 4ATFA 1SBEA 1VE0A 3AYCA 4OHVA 1CX4A 2DVGA 2IFRA 3ZM8A 4LULA 4PBPA 1NA1C 3H1WA 1OF3A 1XE0A 1GOHA 4IEOA 3NV3A 2VPVA 1H1IA 3PDQA 1LENA 4BCUA 4JDMA 4H7LA 3E5QA 4QX0A 3ZN6B 2G1MA 1O5LA 4N7IA 3RG0A 1F9KA 2XL9A 3KV5A 1RINA 2OA2A 1I1EA 4Y20B 4ORFA 2A6ZA 2Z5WA 1RXGA 2D98A 1FXZA 4IXLA 3O12A 1RB8G 1RC6A 1OA3A 3HQRA 5EJ3A 2J42A 5F5QA 3N4MA 4PHZA 1GLHA 3C3VA 1RUH3 1ULFA 2VW2A 1K45A 3AKSA 3D5OA 4N53C 4UW4A 1XOYA 2TUNA 3SC7X 1H2KA 1DDLA 3GZUC 3AL6A 4UF0B 1E57A 2OZ6A 5FPAA 1S0IA 3UGGA 5I93A 1W6OB 1AR73 2VOTA 5LA9A 3UGHA 5DAWA 3VD5A 2ZGUA 3WQ0A 5F2SA 3BI3A 1MZEA 1VBD2 2DDUA 2QQWA 3GHNA 3MLKA 4ZXEA 2F17A 4NHXA 2HWF2 4WVZA 2IXJA 2QTWB 3SLIA 1ST8A 4P9YA 1SFPA 3F95A 1KJLA 3V64A 3U0ZA 4MSVA 2OPWA 3DPRC 4QU1A 2JKBA 1R093 1UWWA 1NKGA 3IWZA 3Q8FA 5FYCA 2GP5A 1DYPA 2MEV2 3SEEA 3UYJA 1A78A 3IN9A 5JXJA 2VMGA 2Q8DA 3UV9A 4E27A 2YXSA 3QACA 1HJFA 4KWLA 2RMU3 4V1PA 4AAXA 1CESA 2ZACA 2VXJA 3I3BA 1PGL1 4I3PA 1QU0A 1MS1A 1HN1A 5GKAC 4JGYB 4DO0A 2VZUA 5KHKA 1W03A 4B4QA 3ZLIA 3VBRC 3LA3A 5CYYA 4EN7B 3POEA 3NAPC 3I2KA 2VL4A 5C4WA 4HFSA 3TNQA 3VDDC 4WV8A 2ZS6B 2ZX2A 4R9BA 4TZDA 2XDVA 1NCRA 1SMVA 2CU5A 2QQMA 4R9CA 4Y1YA 4RQPC 1QNYA 5FY0A 1Z7S2 5IK5A 4R8HA 2VVFA 3WINE 4F7ZA 1YIFA 4AQSA 3N35A 1QJX3 3HMYA 4TLFA 4F3JA 5CG8A 4NWVA 5FMOS 2VW0A 2WNVB 4UFJA 3I2DA 2HEWF 4NHKA 2GC2A 3RJRA 2PFWA 4BYYA 3SKJE 4AGGA 2P3KA 1LU1A 4OHXA 1W05A 5IYYA 2J1UA 1WA4A 3RZJA 4CDWC 4DNYA 2RR13 3J9SA 4YZ2A 2GN7A 5JZGA 1LOFC 3FN9A 4WM8A 5IWFA 3N9NA 3U10A 1O91A 1STMA 4KG0A 4LBOA 3Q9OA 4ET7A 3ZSLA 1W8HA 3O0VA 4L2NA 4W6XA 4CCJA 1U5YA 4YWAA 3SEPA 1LHOA 1ZZ8A 3MIHA 1CPNA 4Y4YA 5KBFA 4AFAA 1RUE3 3ILFA 4K8FA 3D8CA 3LDBA 4Q0PA 2EAKA 4QPIA 2QKDA 5F6KA 3WG2A 2HBTA 1RUH1 2ZHMA 5D8AC 1SCSA 4QGMA 1D4VB 4BJ0A 2OT7A 1H8VA 5EZWA 2YY1A 4HETA 3ACGA 3HR9A 1AR71 4ZXKA 2ARAA 4IQPA 4PI0A 4IE4A 4XFAA 5FZKA 4NRQA 1W8ZA 2YUEA 4XZPA 4BQXA 2WFF3 1RIRA 5FZLA 1YQ5A 2IXHA 5C3OA 3R05A 1JZ7A 5GZCA 1JU3A 3DEMA 1LOCA 1ZNPA 1B35A 3L9JT 3ZOIA 2GMPA 1EYBA 3ILRA 3M3CA 4OHWA 1ND2B 4DXRA 3UT0A 3AKQA 3BALA 3ROUA 5JPMB 1W2UA 3AFGA 2AACA 1JN2P 5FO7B 2VOKA 4PT6A 4FAGA 2HWF1 3OGRA 1C8M3 2NPIA 2GC0A 4BMEA 2ATFA 5IVVA 3ILNA 2X09A 3UKVA 3H50A 5FZIA 3ZFFB 2HLEA 4IUGA 1PX3A 1YLLA 4WM7B 1TME3 1AX0A 2MEV1 1AYN3 1LHNA 4GWJA 4FO9A 4LHLA 4QDRA 3WVJA 4DB5A 1ENSA 5LK7B 1VMFA 1JYXA 2ET7A 1H0BA 2E7QA 5JXHA 1POV0 3SMHA 1NZIA 4LJHA 4L97A 5FZBA 4CEYB 4MLOA 4NPMA 4XQ4A 5KHGA 1UU6A 3JBG2 1YWKA 2SBAA 3NNFA 1NQJA 2JXAA 4KWJA 5F39A 2NZ9A 2HYKA 3VUOA 1LECA 1RUI2 2IXKA 4OYUA 3AMHA 3OTFA 3SCFA 2PHRA 5A32B 2H0VA 4AFDA 1ZX5A 4JGYC 3U37A 1YHFA 1Z7S1 2WZR3 1EPZA 2BGCA 2XR4A 1WWYA 5IK8A 4Q1RA 2YC4A 3LKJA 2DV9A 4AFMA 2YC0A 1W39A 4K8RB 2WUHA 3O7OA 4XOGA 1GOFA 1VB2A 2ZAAA 3X29B 2E7TA 4DMIA 4DFSA 3ECQA 2IZWA 2ZOEB 4MG2A 1OOPB 2VD7A 2BFUS 2WNVC 1OA2A 4E2QA 4O9GA 1S0JA 1S0FA 3CJIA 2VCMA 4UW3A 4AEMA 1ND3B 3OGGA 4R4XA 4RGAA 4A7YA 4N8MA 1WCSA 4XDPA 2AENA 4IE6A 1Q5OA 4OCTA 1PZ7A 5DABA 2A3XA 2PLV2 2Y6GA 3C8XA 3DN7A 3NNLA 5DZGA 4LNVA 3M4FA 1OXCA 5C7GA 2RS53 1OLQA 3LOBA 4P00B 3R4UA 5FUNA 5HXMA 2GNBA 1RYYA 2CL2A 3HPNA 1COV2 4P14A 2XXZA 3VBOA 5EXOA 4YW4A 4LPLA 3WP4A 2Y6LA 4AEKA 4MGQA 3KVBA 2XVLA 1CZVA 5KXBA 4E8CA 4QX1A 1C8M1 1HB4A 4RA0A 1UMIA 3MI8A 3RRDA 1CVNA 4JV4A 1GBGA 2EF6A 5KHHA 2VZVA 2ARCA 4H3WA 1TQ5A 1OURA 4AVBA 1TME1 1CN1A 3H1YA 5FP8A 4FOQA 5FY1A 4BMBA 5BUVA 1RJ7A 5J3UA 5FOJB 2D7FA 3AP5A 5F37A 4O7XA 4LBNA 1XE7A 3I2JA 4LBLA 2R32A 5TSWA 1JHJA 2JICA 1T2XA 1ZZ7A 2ZABA 4E4HA 3ZXFA 1WW4A 1NT0A 1DGRN 5A3NA 5A3WA 1FYUA 4TN7A 3RZLA 3ZXDA 3RSJA 1WBFA 3RVHA 1FPN2 2WZR1 4I2OA 4YGCA 3LEGA 4M00A 1ZRCA 1D0GA 4XJ9A 1HB3A 1LGCA 5FMBA 2RDNA 3FWEA 2ZGSA 2W1WA 3AFKA 3JBG1 4GH4B 5JOXA 3AX4A 3IM0A 2NN8A 4CRQA 1AX1A 3VDCA 1I3HA 1MZ5A 1U12A 2DVFA 5FXXA 2RVAA 3BOWA 2WQ4A 4RN5A 5BNNB 5FMOL 4HSLA 4MXWA 1YQCA 4C0BA 4EJRA 5JDBA 3LEIA 1X9TA 1Y4WA 2A5ZA 4NHLA 1DLCA 1ZZBA 2VNOA 2BZDA 1AHSA 3IBMA 5K4LA 1NE6A 4Y24A 2WSVA 4S2GA 5B2GB 2KD7A 4YPJA 1HX6A 2Y60A 4AVSA 4AVTA 3IT8A 2RS51 4KU8A 3PVNA 5J48A 1AR92 3WDTA 4YVWA 4HN1A 3IAPA 3W58A 1CX1A 1H9WA 3POGA 3WNPA 1IPJA 1TNFA 3KGZA 3WP6A 4AAPA 1OOPC 2Y38A 4MO3M 3LCPA 3RNSA 4BQ4A 1KXGA 5FTTC 1LHUA 2PLV1 2TBVA 2G19A 5DUUA 4CCEA 2YGLA 2DUQA 1ND3C 4CPBA 4AYUA 4XUTA 3KS7A 4Q2FA 2Z42A 5C8CA 2JWPA 3IDCB 2WLPA 1UKRA 2BQPA 3FHAA 4RYDA 2VNRA 2EIEA 1RUG3 2XQXA 4K40A 3ZSKA 3IKWA 1N1VA 3LOIA 4HVOA 4HK8A 1O8PA 2WIIB 3PUSA 5KC6A 3R6SA 2XPJA 1OKQA 3WSOA 4BXSV 3HVDA 3MUY1 4LQRA 2XQRA 1U5IA 3VKNA 3GZTB 4JAAA 1GP6A 3VBFB 2HKXA 5D21A 2C4XA 2JJ6A 2DCKA 3U11A 4I0AA 3C7EA 1NY71 4PIYA 1S0DA 1DGWX 4K20A 2HWC1 5CFDB 5CVRA 2WAAA 3LZZA 5FYTA 2FBEA 4NAMA 1DGRA 3IPVA 1SLTA 2F4LA 4Q4X3 1J83A 1MVQA 2ET1A 1A3KA 3GNEA 4NHMA 3SXWA 3ZYIB 4COYA 5A3UA 5C3SA 4IEPA 5LWBA 5F1RA 2K2SA 3NNJA 4AI1A 1XXNA 3PUQA 4M4PA 2ZEWA 2XWJB 1IZ3A 4XETA 2VZ1A 4Q8LA 3RWKX 3CL1A 5GLZA 4YG0A 3PHMA 1UY4A 4NJ4A 4FTSA 2D6OX 2ERFA 4RGKA 1Y43B 2OUHA 3Q8CA 4KL1A 3RDIA 1W8WA 1QIQA 4DXSA 5KC5A 2R063 5FP3A 1QQP3 4X6RB 5FP9A 1YQ8A 4M01A 3PVEA 4WVVA 3ON7A 3N9MA 3S5AA 3CDZB 4CDQB 4Y5Z0 4Q0QA 3DXTA 5D1IA 1ENRA 4JVAA 5E8AA 5FMCA 4AQ6A 3MW3A 4DY3A 5A1AA 2W2IA 1OF4A 2L9LA 1Q56A 2JD4A 1OQ1A 4IL7A 1F35A 4OI1A 2B39A 2XG3A 1BYHA 4FP3A 2GNDA 4Q4W2 1MR5A 4OI4A 3EQEA 1OD5A 3ZKYA 1XNDA 2A6VA 3EJKA 4PJYA 2FHRA 5BNNC 2BFUL 4B7KA 3E6CC 4ZONA 1VJ2A 1CPMA 5LRSA 1W8TA 1W3VA 1ODMA 4GD4A 2Y0OA 4JKKA 3POBA 5FZDA 5EPAA 2FQPA 1OFSA 1JS9A 5C70A 1RUG1 1G8WA 1LODA 1XNTA 2GNTA 1REDA 2W87A 1DZQA 1ZRDA 3P3NA 3LEMA 2QCSB 4C1XA 1RUJ3 4XCAA 1QJY3 4ES9A 3V0AB 3AMQA 2B7YA 1J3RA 1FV3A 1S1AA 1SFNA 2WABA 1U5XA 3QH7A 1DCSA 1LTEA 4QPGB 2FCUA 4YNIA 4MGIE 1CAUA 5T5OA 2A7AA 5H9SA 3WUDA 4C90A 3T1MA 3A23A 3TAYA 3DXUA 2VXRA 5DQ0A 3TOJA 1CAXB 5FRAA 4F8AA 1V6LA 2XB6C 1B09A 1SPPB 5T5JA 4BXFA 1C1FA 3OYWA 4KGGA 4CYDA 3T0DA 2ID4A 4P9XA 2P5BA 4Q4X1 1ZRIA 2MPFA 2CGPA 3OY8A 4YM0A 1OC1A 2VMIA 1IQAA 4UFLA 3GZAA 4LKEA 1DQ5A 1RMU2 5FLIA 4DUXA 4J1XA 2PAMA 3VBFC 1IHMA 3IMMA 3OUIA 4Y1UA 5LZ6A 1PO13 2JDMA 3ENRA 2BU9A 1GZWA 1UCXA 2DVDA 2ZCWA 2RS13 3A4UA 3KCXA 3MFAA 3ASIA 4MHRA 4GWIA 3AXDA 3CNAA 4O65A 3I4IA 4RS5B 1K5MA 5CFDC 1AL22 2D6LX 2YHJA 4N90A 1Q8OA 5JPNB 2W68A 2VQTA 3LIGA 2LM3A 2Q0AA 4W65A 4CXYA 4O9EA 1ONAA 2HWE3 4YLZA 3VBUA 2FDIA 2A6WA 2JDKA 2UY8A 2WYFA 4FQZA 1PGW2 2R042 4Z2WA 3RZKA 1O7FA 1OKOA 4K1ZA 4LO7A 2W92A 4NPLA 3WNOA 4ZZ5A 3LWCA 4JQTA 1JYIA 2GN3A 1QJEA 4OFGA 1V6IA 2K46A 3OPTA 4CPBD 4LKSA 5HI0A 3KSCA 1UZYA 1XE8A 1YCIA 4CDQC 1ZZ6A 5DAPA 2BTVC 3PTRB 2VAUA 4JKLA 4MHUA 4YW5A 4CEWA 2WN2A 1MZFA 3A0KA 4GIQA 1QH7A 2A1XA 1O4TA 1UQXA 2ORZA 2VZTA 1LAJA 1RUJ1 1VAMA 1QJY1 2WAOA 3CLPA 2VCBA 3MICA 1WD3A 1GWLA 2WZ8A 4PDWA 1ENXA 3USUA 3WQ1A 3KF3A 1MS0A 4IV3A 4Y3OA 1EAH3 1W9WA 2HJIA 2Q1FA 4RSUA 4E4ZA 3K75B 2ZX3A 1JOJA 1J84A 4YW2A 3MHZA 4UW6A 1UY1A 3U14A 1AXYA 1O4ZA 2C9AA 1IS3A 3B69A 3CKHA 3N7MA 4I0BA 4D6RA 4JRAA 5JIUA 1PMHX 3BU0A 3MW4A 1REFA 1CJDA 2WJSA 3JB4C 3OPZA 3VN4A 3HNBM 3ZR6A 5IFPA 1OQEA 1GICA 3DYPA 1GWMA 3DV8A 3F2ZA 5F7UA 1BEV3 5HV4A 1QJU2 1AR81 1RTVA 3D4KA 1HXS2 3N7JA 4CDUB 1H2MA 2MHFA 1PVC3 1REEA 2F6BA 4XVHA 4P08A 3VLBB 1LRHA 4Q4Y3 4C8DA 4COZA 3ACLA 4QPGC 3NJXA 1VRH3 5DN2A 3WW3A 1R1A2 4CCLA 2VC9A 4HPKB 4MZUA 1HJGA 1YYNA 2YB7A 3KQ4B 3ZPYA 1PO11 3H42B 1MS4A 1YC61 4IV1B 1LR5A 4M4RA 4RR3B 2RS11 1GV9A 4RD7A 2P34A 4Q4V3 1GU3A 4OUSA 3WOGA 1WLTA 2SLIA 3EB7A 4ZZ8A 2ZAHA 5E89A 1POV3 3RZZA 5AFEA 1Y9GA 3UL2A 5D2AA 3NJZA 2FCVA 5JVVA 3VZJA 1UNBA 2C0ZA 4FFGA 4LE4A 3VDBA 2X05A 4HLTA 1W9SA 3RMYA 2YROA 2PXJA 2EICA 2VQUA 5SV8A 2XH6A 2ZGLA 1CD3G 4Q26A 2QZ3A 5DDJ3 5FZEA 5CBLA 5DMYA 3U4SA 3WDWA 3KQRA 4NVPA 5IK7A 4C1WA 1MQTA 3E5UA 4YZ1A 2QQPA 3ZYPA 2NQYA 2Y6JA 1OPMA 1XJAA 3FX3A 4RS5C 1UOJA 5A3PA 4QD2A 2X29A 5C5UA 1JI6A 2D44A 2R041 3A7QA 4IEVA 1ZRRA 4XUPA 1O3QA 2FDKA 1QJFA 5FP7A 2W3JA 1RHI2 1W04A 1X8MA 3INAA 5F5CA 5JCTA 3DPRB 1D2SA 2WO1A 5HCBA 4Y1XA 4URAA 1WLDA 2B5HA 5FZOA 1EAH1 3LSDA 2AR6A 3KV6A 4DZGA 3DF0A 4JCKA 3E1F1 4JGZB 5FZ1A 3W5MA 4KG8A 2D6MA 3I3QA 4D3WA 1LOGA 3I2FA 5CU1A 4CU7A 3ZMNA 1OH3A 2ZHNA 4MX3A 5ACA2 4PLMA 2WL1A 3ZFEB 1YUDA 4EE2A 2BVVA 1S2BA 5LBBA 2C26A 1GZCA 5FK8A 3OPWA 3OD4A 3BGAA 3JD72 5E6HA 4YW6A 3TEWA 1BEV1 4MUVA 4UWDA 5FYYA 2EIBA 1H4HA 1RUOA 2JB8A 3ACIA 1HRI2 5EHDA 4LO6B 4Q4Y1 1VRH1 4XFBA 4AFBA 4CCMA 3MFCA 3HBKA 2QQKA 4NO4A 4XUOA 4P9JA 1VBB2 4BQ1A 2XVKA 5FBJA 5L7OA 4Q4V1 4M0NA 4XXAA 5LB6A 1D2QA 1Z0HA 3MBWA 5GLVA 3WDVA 3MGUA 4M0HA 2O0OA 1ASJ2 1POV1 2QDRA 3HQXA 5IVBA 2LW8A 3IDBB 2LROA 4L99A 1GP5A 4LUMA 3ME2A 1UX6A 1XSQA 4CDUC 5FXWA 4W6YA 3HWJA 1WCDJ 3IAQA 3P6BA 5FQ0B 1JYTA 1BK1A 5DDJ1 1EUTA 2DURA 4BK4A 2XBO3 4LIUA 4AEDA 3AZXA 5A6YA 1TEIA 1W8UA 2GDFA 5D8AB 1G9CA 5T3NA 1FMD2 2PHDA 2VZOA 4KNCA 5K0UB 2CAUA 3WV6A 1RUC2 4RHV3 1WA6X 1DQ2A 1QNWA 1NLQA 1ULPA 2E6VA 4IV1C 1V6KA 4RR3C 2FDJA 5FYVA 5T5LA 1APNA 3BODA 4BH9A 3V56A 2YMZA 5JMOA 1AYM2 4A4AA 1PM7A 1ACCA 1ODNA 5FZAA 2JDYA 3QD6A 4OULA 4X6QB 3OB8A 1VRBA 4PI2A 1W8OA 1C57A 1OLRA 2HWD3 2CAVA 1WW5A 5A80A 2QNKA 5H9QA 3HNYM 2VG9A 2R1BA 3BTAA 5BNPA 2GH2A 3MV01 1XPWA 5A33B 4NIDA 3GCWA 2GMMA 4AWDA 3URFA 4QKDA 3BIEA 2B42B 2D6PA 5LEJA 4J6GA 1RHI1 4H7MA 4IEQA 1OMIA 2DFCA 3PURA 3H1MA 5E16A 2P3IA 1SLBA 1J58A 2VOXA 2WFPA 4TXWA 4UT5A 5FREA 4XF1A 2E63A 2WNUA 5FZGA 3RS6A 4GA9A 3C2UA 3HBZA 2QQNA 2WS92 4DQAA 5FXZA 1GNHA 2OIIA 1LKNA 2O14A 2R6QA 4Y26A 3THTA 3QBQA 2D6KA 3T3YA 4LA2A 5GZEA 5ACA1 2GH8A 1NCRC 1IS5A 3M3QA 2ZTNA 3KV9A 4FCAA 3HOBA 2WR9A 1WCUA 5IAVA 1DU3D 1UL9A 1QY4A 2DWRA 3CHXA 4JGZC 4NHYA 3WG1A 4ARXA 5L36A 2EALA 1NA1A 3CJXA 1VBD3 1WMXA 3WNMA 1IGOA 2HWF3 2P17A 5FPXA 3ZFEC 1VBE2 3ZYGA 3MIDA 3AP6A 5JMCA 1H8TB 1V0AA 2J7MA 4A2UA 2XJQA 3ZN4A 4JX0A 5LBFA 5AC92 4YVSB 2MEV3 4DOUA 4UBGA 5C5TA 1BMV2 4WVMB 4ES8A 4AGVA 1FT9A 1HDKA 3KT1A 3LPGA 4HL0A 1W0PA 4IERA 1F4AA 2D97A 1UIKA 3J26N 4N53A 4Q27A 2XBO1 2JDHA 3WNLA 4C0HA 2Z2SB 3PUHA 5FJKA 2JG8B 2IXCA 4RHV1 2R16A 5CFCB 1IG3A 3B00A 4CP9A 1BJQA 1YJLA 3P5BA 4FVVA 3K48A 5FWJA 5FWEA 2P4EA 4LK7A 5F6LB 4LTAA 1JYCA 1PZ9A 1UF2C 3NMBA 4M3CB 5C9AB 1HQWA 1Z7S3 2R0FA 2Z79A 3OUJA 1Y7BA 2Y0IA 4ZY9A 2HWB2 2VM9A 3NV1A 1FMD1 1AZDA 2HWD1 4IESA 1V6OA 1RUC1 3MF6A 2WA4A 3I7DA 5A7NA 2BRTA 1W9TA 4S2FA 1EPWA 2ZBJA 3J7MA 4LBQA 3POWA 3DKQA 2BWCA 3AMMA 1RUE2 3I59B 5K0UC 5IK4A 4Y5SA 1NQDA 3VBRA 1LEDA 5LK5A 1Y9MA 2RS32 2VU9A 1IS6A 1OD3A 3ATGA 3NAPA 1X50A 4R9AA 1VBC2 5JI7A 4XABA 3J4UH 3LDKA 4GXLA 3VDDA 2WT1A 1CR7A 5GZGA 5FYIA 4XF4A 4QX2A 1E5SA 1G86A 4RQPA 3WG3A 4WZCA 2NMNA 4OZXA 4QQHA 5FYBA 5A7WB 3WX5A 3ZN5A 1UKGA 4IE0A 3TEXA 2Q8CA 4E8DA 1D0HA 3OG2A 5C3QA 5LW9A 2VZPA 1ZA7A 2UURA 1MVEA 3N7LA 4PLOA 3AKRA 1U5ZA 4CDWA 4LKDA 4CP2A 5A1LA 3MPBA 1VBD1 2JE9A 1LOFA 5GLTA 1H2NA 3T1LA 1VAKA 5ANQA 1E5IA 4AVAA 5LRRA 1GQGA 4DXTA 2OPKA 5BY5A 4ZU4A 4LHSA 1NLSA 1EUUA 3K4DA 2XL7A 2PHTA 1RVF2 1ZYBA 3ETPA 5FPLA 4AFCA 1G9AA 3V0BA 1DBNA 4CU8A 5A3LA 3FFZA 3WEZA 3T0BA 1UPSA 2BBAA 4JHTA 1VBE1 2YYOA 1XB9A 1C8NA 5CADA 5IATA 4UXAA 2A75A 3BPZA 5AC91 5CG9A 1HRV2 4JKMA 1W99A 3USSA 4DRRA 1BMV1 1S0EA 5FIXA 4CXXA 1PMJX 4QXCA 3L2HA 1H8TC 3ZN6A 2X5IA 3KCCA 3UKTA 4YZ4A 4QQLA 2WC2A 4Y20A 5T5PA 3WNXA 2A6YA 4YVSC 1V6MA 3K77A 3VD9A 3JBG3 2JDNA 5IHRA 4EN8B 3D0JA 1HQLA 1D4M2 1LESA 1UXXX 1RUI3 2EAAA 2OS2A 2YGMA 2ZGNA 2JIJA 4OI2A 1EP0A 3VV1A 1BBT2 1VPHA 2HEYF 5BV6A 5JOZA 2JG8C 4XQDA 4UF0A 3HT1A 1F15A 4B1MA 3JXSA 4QGLA 3S6PA 1W6OA 1O59A 3BCWA 5CFCC 1AUYA 4BZ4A 3ZXKA 4ISQA 3BN6A 1EV12 3QCWA 4OQ9A 4BK5A 3KWVA 3BKZA 4KI5M 4FTEA 4LBKA 4KQ7A 2J1VA 2Y26A 5C9AC 3RMXA 3VL8A 4NIAA 3VHOA 4NAOA 4URTA 4DS0A 5CNAA 3WUCA 5FCCA 1V6NA 5HV0A 1GANA 3GBGA 5EIYB 3DECA 1ZM1A 2EXIA 5LY2A 1JUHA 2RS31 4XJAA 4FOWA 3DUIA 2CYFA 3WF2A 1ZBE2 3ORJA 2R0HA 1VR3A 4JGYA 3B93A 2W1UA 3VKOA 1XYOA 4FPHA 2EXKA 2PLV3 3OBTA 3MO4A 5FZ7A 4P02B 4FPYA 2WN3A 1CAWB 2WDBA 1W90A 3AK0A 4CP1A 4ZHNA 3HN1A 4DUWA 2ZGMA 1O6UA 3WD5A 1OQDA 4QQPA 1COV3 1WMDA 1I5PA 3OGSA 4QB6A 2EIGA 4XFGA 3QH6A 4A44A 4K7JA 1HQNA 2I07B 4XHXA 3ZPOA 1SBDA 2QQOA 2AUYA 2WNVA 3A22A 4YGEA 1AXKA 1VBA2 2E51A 3GF6A 2JX9A 5CKMA 1G9DA 1A6CA 1PHMA 2JEMA 1JXNA 1LHWA 1UYPA 5G05L 4FPCA 4QMAA 3RYRA 1OUXA 2R1DA 4YM3A 4A6OA 2ETEA 2CWSA 1L7QA 2NMOA 2WNOA 4M3CE 5C33A 3B9IA 4XF0A 4I02A 5FO9B 3D6EA 2HWC3 4E9KA 1YFWA 3CIHA 2OQ7A 4QXBA 2BYVE 1RVF1 4EV0A 4BWOA 2D40A 4OMCA 1RUF2 1XNCA 3VKLA 1KITA 2XLGA 4RGGA 2W1QA 1VMJA 1XU1A 4RFRB 5FO8B 1LULA 5CKNA 4AW7A 2DCTA 4HG6B 1TMF2 1GNYA 1RUI1 2CTVA 2JG9B 3UESA 5KWRA 1AR62 5BNQA 4X8PA 4LBQD 3FL7A 5EJ1B 1FPN3 2XJUA 5BNOB 1PO22 2BVBA 3ALQA 3E5XA 5JWPA 3ZSEA 1DLLA 2HEVF 3WW2A 4AGRA 3OBZA 3RFRA 1UU4A 3HD8B 1Q8SA 1LOAA 3RI8A 3S57A 3LDRA 1FOD2 1D4M1 3E97A 2R49A 4TYSA 4UW5A 1KFXL 1M06G 1BBT1 2GAUA 2JIGA 2WWSA 4FOVA 3E6BA 4IE5A 1PK6B 1JZ8A 1L7LA 4EN9B 4W50A 5J7MA 4XBNA 1ND2A 1OFNA 1MS9A 5I0TA 4QPWA 3THDA 5LBCA 5DPNA 2D3RA 2PYTA 2OX0A 5A3OA 4AZZA 4L8QA 1R082 2ZX0A 3B02A 1JYVA 3N9LA 5FZ8A 4QX5A 3ZFFA 1NXMA 4E2SA 4WM7A 4XILA 3MYXA 4QX8A 5FY5A 1AR93 3O0WA 4HKWA 5GLWA 4V2VA 2RDQA 1ULEA 3LPFA 4XHBA 2G9ZA 3TN92 1COV1 5LEKA 3LA7A 4KH9A 4LO8A 4CEYA 2ARBA 1ZBE1 3MIGA 2UWAA 4X8NA 3ZYHA 5C8WA 4XCBA 1WW7A 4XBQA 4P9GA 4GKXA 1DQ0A 4Y22B 2RM22 1MS5A 4ITCA 3O1OA 1W6NB 1G9FA 2A73B 4Y4RA 5F3GA 2VH9A 5A32A 4OVEA 4LBMA 4Y1ZA 4LHKA 4NRMA 3AXEA 4BB3A 2VBDA 2QQLA 2IFWA 2NYYA 2Y6HA 2YU1A 1W9FA 4HXCA 1UX7A 2O8QA 2BW8A 1JZ2A 5CA6A 4AVVA 2B45X 5ABJB 3MIEA 1OOPA 2ZGOA 3EXUA 3TEZA 2DF7A 1HV0A 4Y1VA 5JXIA 1XU2A 1PZ8A 3K2OA 2W5FA 1OHFA 2I45A 2QBXA 3AP7A 1ND3A 3RI9A 4B7EA 3USUB 1HW5A 3J8F2 4GJZA 4HOOA 3I2HA 1FPN1 4GMP1 4QM9A 4YZ3A 1Q8QA 2PA7A 2XJRA 5ANNA 3SH5A 2MNGA 5EQUA 1QDOA 2JD9A 1OLME 4MXVA 1RUNA 1RUD2 1NE4A 2Y64A 1ZBA2 4GJYA 1TMF1 3SISA 1C1LA 1ZVFA 5F3IA 4R4ZA 4LXLA 4QHBA 4META 1GQPA 2VNGA 3AJYA 1AR61 4XYXA 5L9VA 1W6QB 2E31A 5HCAA 1KRIA 3C7FA 4B8EA 2W95A 1BCXA 2XUEA 4D6SA 4DXZA 2XKPA 2VO5A 4FXKB 4MGSA 4NIIA 2JG9C 3OBRA 1JOBA 3J7HA 3PUAA 3D0SA 1YFUA 2H0BA 2IXLA 1SLAA 1YQ6A 5EYYA 4XFFA 4P9IA 2R072 2VTXJ 3ZIWA 2GSYA 5BNOC 4NROA 5B4XA 4R9DA 3WDYA 2W52A 5HCHA 1AVBA 1W2NA 4AR2A 1Y9QA 2N7GA 1AR91 4OUMA 5H9RA 3K46A 3IB3A 3CU7A 1WCQA 4FPJA 3PTYA 1OI6A 5AVPA 4FFFA 2OVUA 1TG7A 5IJRA 4XDOA 3GCXA 4ZU5A 2BBVA 1LEMA 1PK6C 5HCFA 1KQRA 2OW4A 1GYKA 1UY3A 1DZRA 2XGXA 3AM2A 1VALA 3OJBA 4NN0A 3AJZA 1R081 3FJSA 1KGYA 5F3CA 5IVJA 2CV6A 3UKNA 1WD4A 2JECA 3A0NA 2FZ1A 3M2MA 1RL3A 4IEYA 3VBHB 5GZDA 3TN91 3EMRA 1UOFA 2W94A 3H8UA 1GOGA 3ZFGB 2HH9A 1MQTB 4MGTA 3BB6A 1SZBA 4EWDA 4A6SA 1JUIA 4GH4A 5HPOA 4BQYA 4IGOA 1A8DA 1FNZA 2RM21 4HN0A 1ALYA 1YEWA 1TZOA 4FPOB 3H0OA 3NWKA 4K6BA 2WSUA 3UJOA 1AR83 5CISA 4XPVA 1G9BA 1W2TA 3POYA 3WQBA 3WW1A 3O1TA 2XUMA 5BNNA 4KU7A 2WWUA 1UZVA 3ACHA 4P9LA 1QEXA 1UYZA 4EWAA 4HONA 4BDVB 2PHWA 1G7YA 3AP4A 3LGRA 4MOAA 3C7HA 3JCIA 4GZ9A 4KBBA 4CDXB 2DUPA 3AYAA 5L9RA 3R0RA 3S7EA 4W8JA 4CZSA 5K7PA 2YC2A 3ZYFA 2FZ2A 2ZMNA 3P3PA 1RMU3 4AE2A 4DRVA 1I5ZA 3ITQA 1HLCA 5BXXA 3U07A 4Y5TA 4KWUA 2GNMA 4DUVA 4XTPA 3VZMA 4EROA 1XNBA 5ABJC 4GAZA 4QKBA 4OMDA 4QU2A 5FZ6A 1W6PB 3PJYA 1JYWA 2CDPA 3D82A 4CCDA 3TEYA 5FPUA 4QGNA 1ZBA1 2J22A 2RE9A 4FPKA 4UAPA 5I91A 4D69A 1XBFA 1AL23 5FPVA 1O4YA 1RITA 4NUBA 4S2HA 3DYOA 2GP3A 2ZKNA 4Q29A 1JZ5A 1JYNA 3MW2A 3GALA 4N43B 5DZEA 4B1LA 2QZ2A 5DUVA 1OPOA 5GALA 5A7OA 1C28A 2ORXA 4BOWA 2W39A 3OUHA 4Q4W1 5F8PA 2R043 4FXGB 3S0MA 2FMDA 1KDMA 4DEQA 3I2IA 2JDUA 2BERA 2VR4A 1VIWB 3GGLA 1A34A 3VBFA 2R071 3T09A 3TNPB 4HT1T 3AKPA 4K1YA 1W0OA 2VTFA 2YDEA 4EN6B 2VZ3A 5LA1A 1NCQB 1J59A 2GC3A 1W6MB 5J09A 3HEIA 1DHKB 5CFDA 4YW7A 1CAVB 2QDNA 3DL3A 1V6JA 3ST7A 3VBSB 4ISRA 3WHTA 2WKKA 4AI8A 4CU9A 3UK9A 4PLNA 3GDBA 4XTMA 2X53S 3RJ2X 4G4FA 3WG4A 1AXZA 1HB2A 1YIPA 2XOMA 3VZLA 1OVPA 2VZSA 3WDXA 3WY6A 5A6QA 2VVDA 3NQHA 3RZMA 2C5DA 4NR1A 3WHUA 2VY0A 4NIGA 2XVGA 5F32A 3POFA 4YG6A 4ASKA 3H3ZA 1WZXA 1W8NA 2WO2A 2ZMLA 4IEWA 5J36A 2P37A 1CONA 3VKFC 2IC1A 3AZYA 3OEAA 3VBHC 1U0AA 2AYHA 4EYUA 5ERLA 3ZYRA 4CDQA 3LFIA 2PELA 4MADA 4Q0VA 4BLIA 5LA2A 1SLCA 2I2SA 5T54A 1QJU3 3ZFGC 5FUIA 5C71A 1HXS3 1MQTC 2JDPA 4GMP0 2AEZA 2LUWA 1QJZA 5EYXA 4BIOA 4CUGA 1H1MA 1RMU1 4JTOA 3U78A 5CKQA 2RDSA 2DBIA 5JXGA 4YM1A 2VUDA 5DAXA 1R1A3 1SEFA 2VBBA 2W47A 2Q30A 4AHWA 3NO8A 1IOAA 3FLPA 3VD4A 1LNSA 1AL21 3LA2A 5FYHA 5JLVA 2JKXA 4MV2A 3BU7A 3B7MA 5AVAA 3MUZ1 4GB32 1C3HA 4MGYE 4CDXC 3I3MA 2P3YA 4K3UA 4CTEA 3FMGA 3T30A 1PGW1 3AC0A 4UOJA 5GJ6A 2XLAA 4IW3A 4NOTA 1GZTA 3I2OA 4S2DA 4B4PA 3M7AA 3SQOA 4XQWA 3V0AA 2VOVA 5A7QA 1QHDA 4QPGA 4YW1A 5C4WB 5FPBA 3NL1A 3MLLA 5FAXA 5HBAA 2XHNA 3HN3A 3LIHA 3PVBB 2D43A 4FQ4A 1NCRB 4XJWA 5EP9A 4XURA 1CAXA 2DTWA 2VUAA 4FPLA 4YSFA 1SPPA 1RXFA 2EVXA 3SCHA 4D94A 3ES4A 4R52A 4BLJA 1F4HA 2BP6A 3PU8A 2D5FA 1YI7A 3VDAA 4DIQA 1H30A 4N43C 1WMFA 1RHI3 2ARXA 1LHVA 2Y33A 4L9BA 4N9HA 1K12A 1NG0A 3MIBA 2WZEA 3LEKA 2IXIA 3ELNA 5JZGB 1O3TA 3ZXJA 3KHBA 4TLGA 4WM8B 4YZ5A 3UJQA 5FY9A 3KD4A 2ZGTA 2J1EA 3ZXAC 3FC0A 1KD7A 3GBWA 3J7LA 3KT7A 2ZMKA 1N3PA 5ACA3 2HYXA 3T0AA 4BHPA 3AYDA 1NCQC 1A8MA 4QPIB 2EXJA 1AX2A 1VP6A 4RS5A 1UIJA 4AI2A 2DVAA 1BZWA 1SQ4A 3JD73 4LORA 4OLLA 3VBSC 4E4DX 1QJU1 4HKOA 4A42A 4PIXA 1HXS1 3O14A 3ZDSA 1ZA4A 1HB1A 3POJA 2WO7A 3FLRA 3I8TA 2RG4A 3ES1A 5KXCA 1JBCA 1HRI3 3LFMA 1PGL2 1WLWA 1LB2A 2WQZC 1R1A1 3LB9A 3KCYA 5LATA 1V9U2 2OUJA 1MEC2 1OUSA 1HIXA 4XZUG 3T2QA 2YFZA 3ZX7A 1F5FA 4COUA 2ENRA 1F2NA 1VBB3 1XRUA 2P6CA 2VMCA 3NRUA 5IVEA 1B35B 1PIV2 1YJKA 2WA3A 3LAGA 2WWJA 4JZRA 5FYZA 1ASJ3 3AYEA 3M1HA 1BXHA 2PHUA 4RFT0 4MYEA 3PNAA 2X10A 5FKBA 5CZKA 3CBNA 1BKZA 3L2YA 3PJQA 3BIWE 2ZGRA 4I0WB 4L0PA 4ZS2A 4AQTA 1K3IA 2PN5A 1FMD3 4UFHA 1OBNA 2G9FA 1RUC3 4LHNA 4QHOA 4FBFA 4FSJA 1S4CA 3WP3A 2KXLA 5GM0A 2UY9A 4C91A 4BM8A 1KDKA 5I8SA 1JZ3A 3PMSA 1AYM3 1F5JA 4SLIA 1MZ6A 3JB8A 4PQQA 3TWIA 4OI0A 2H6BA 1G6NA 2VCAA 1YI9A 1RUH2 5KXEA 4FOYA 1X9PA 5DG2A 2DTYA 1CQ9A 4CDUA 5KR7A 4KBZA 3BUCA 1QF3A 2KA3A 1AJKA 2CHHA 3DGTA 3CZJA 3GJBA 4INDA 2X5IB 3WNKA 4OUEA 4AL9A 1AR72 5C4WC 1FATA 2E26A 1UN1A 1UZWA 2OXBA 2VUCA 2WQ8A 2WBKA 4HPKA 2A3YA 1WMEA 5A3MA 1K42A 2ZZJA 1JODA 2ZEXA 3BVCA 4FPGA 1CIWA 4YM2A 4IV1A 3WNNA 4OQ8A 2DYCA 4RR3A 3AL5A 1R092 4LA3A 3AZVA 2OZJA 2YBPA 3H7JA 4LEJA 5FOBB 5KHJA 3JD71 4UFMA 4DY5A 1XC6A 2FMYA 1MPXA 3BPSA 2EA7A 2WS93 1YNAA 3GXUA 2DFBA 3ZXLA 4AVCA 1DP0A 1FX5A 3CJIB 3RPQA 1UOBA 2RMU2 4YFZA 3GZEA 5I0DA 3T2OA 2YU2A 1MS8A 3ETQA 2B9UA 3RGBA 5FYMA 1ZRFA 4HZFA 1HRI1 3VHRA 1JHNA 3MPPG 5DXDA 3T2PA 4A7KA 4COWA 5JZGC 3Q8BA 1C5IA 5LCWL 3LF7A 4WM8C 4I3GA 5FZMA 5E88A 3VD3A 5E1RA 5T50A 3I3DA 2A6XA 4PF5A 1VBB1 2BGPA 1H1AA 3PMEA 3SHRA 1VBE3 4IGPA 4QPIC 1ASJ1 2F4PA 3OSDA 4XFHA 4QKNA 4FT8A 3VBOB 3CF6E 5AC93 1QJX2 1TVGA 3GHMA 2AEYA 4H14A 2GZWA 3B5LB 2D3SA 4W4ZA 4IEUA 4AHZA 3O5SA 3MEPA 3O1PA 1V9U1 4IDZA 3WT3A 1MEC1 1CZSA 5B4NA 3DPRA 1YFXA 5FLJA 4Z92B 2RR12 4RL7A 3FBYA 2OKXA 1PIV1 4BIFA 4D8MA 1NXD1 2UU8A 4N9IA 5J1XA 4TWTA 3HNMA 4HANA 4CVUA 4JGZA 3NNMA 2J1RA 3WF1A 1PNFA 5IW0A 3RYPA 4NIHA 4XJUA 3ZSMA 1CGPA 1AYM1 1B35C 3T4HB 4QDQA 3ZYBA 3ZFEA 4WVWA 5FZCA 1RJ8A 5DUWA 1PM4A 2HWB3 3PLQA 1R64A 4B29A 2P1BA 4CE8A 1FI2A 2W1SA 1Q8PA 3G6JB 4EQVA 1JU4A 3TB0A 2Y8KA 2W91A 2A70A 1BHGA 4Q8KA 3AZZA 5JSRA 3CMGA 1UYYA 2YZ4A 3VZKA 5CEHA 5IFTA 2AGSA 2WFF2 2P6HA 2RS33 3AKTA 5L9BA 1KS4A 4B3NA 1K5JA 1VBC3 2BNMA 1NAEA 2D3PA 1QDCA 1UMZA 2CSGA 2VUJA 3IMNA 1OA4A 2QQIA 1J1TA 2BGOA 3IDAA 3U4XA 2ES3A 5JSOA 3I49A 5FYSA 4AI3A 2WS91 3LSEA 2TEPA 3POIA 4MXWB 4CCNA 4YARA 1IQDC 1X82A 1GR3A 1OSGA 2BNNA 2AH2A 4LBJA 1UY2A 1QWRA 2YV8A 4LT5A 2A3WA 5BPXA 1C8M2 5I8YA 2XLFA 5FQ0A 4XAEA 4DINB 3SNMA 2X5IC 3NKTA 1R091 2NM1A 3NJYA 4IEZA 5D8AA 3P1IA 4B4RA 2XHKA 4LLOA 1TME2 5K0UA 3ZR5A 1AYN2 3AMNA 3N9PA 4YVWB 3M70A 2RMU1 4UYBA 3OEBA 5FMDA 3KHCA 1O3SA 3I2GA 2XONA 1W8FA 3NJVA 3H3UA 2WRAA 5FK7A 2D5HA 1WUVA 3RQ0A 2Q8OA 2YBSA 2FDFA 3CJIC 1RVF3 5C8CB 3EO6A 3FE5A 2BPA2 2WINB 2XJSA 1VB4A 2ADEA 1N1YA 2WZR2 5A33A 1QJX1 3ZMOA 2QVSB 1HRV3 4XUNA 2TNFA 1LU2A 2IUWA 4I30A 1KEXA 4ZS3A 2LRPA 1YQ2A 3CEWA 1E5RA 3FFQA 3H8OA 4XBLA 3VBOC 2VBPA 4MGKE 2RR11 4XF9A 5DZFA 1YXWA 2HWB1 3O0XA 3DCQA 3AMPA 3ZXGA 2J1AA 5FZ4A 1ULOA 2OYZA 2V4VA 4P5YA 1AF9A 1EY2A 4AI0A 1D4M3 2XKOA 4GKYA 4SBVA 4FAHA 2ZJCA 1BBT3 1FAYA 4ASLA 3IPVB 4BU2A 2UWBA 1RUE1 5JUVA 4GULA 2J1SA 2AZ5A 5L73A 1OH4A 2VVEA 2ADDA 2RS52 4IE7A 2DVBA 1VBC1 1EV13 3BTZA 1R1ZA 1QOSA 1S2EA 3OF1A 3K3OA 4QHZA 1LJ7A 2RHPA 1W28A 3WR0A 1IKQA 3NNGA 1H8TA 1YRZA 3RYKA 2WO3A 4AI9A 5JAXA 1WGPA 1ZREA 3CZUA 3ABZA 4YVSA 3NW4A 5GLUA 1SFYA 4QWNA 2WFF1 4WVMA 3APBA 5L19A 5A7SA 5M0TA 2IWGB 3M8LA 3UNPA 2WZPP 1CWPA 4AF9A 3Q8AA 1TE1B 3ZXEA 1Q8VA 2AREA 4WZFA 1WKYA 2RJ2A 1ZBE3 1LOEA 1SDDB 4Z82A 2V72A 3B94A 2JG8A 2VJXA 3AZWA 4XEZA 5CFCA 2QQJA 1US3A 1T6GC 1SCRA 4JDOA 3R4DB 4H55A 4Q0UA 1DFQA 5A7PA 3VKMA 4PQ9A 1UZ0A 3T2TA 3O1VA 2P2KA 5AFBA 2V5YA 4M3CA 4AG4A 1XYPA 1OT5A 5C9AA 1HV1A 2ZPXA 3AB0A 3HAGA 3FBMA 1N47A 1GNZA 4LLFA 5DUXA 4TTGA 3DYMA 2VQ0A 4XAAA 5EJZB 1NY72 2KM2A 2QUOA 1AYN1 3JU9A 4ONUA 4BA6A 5G04L 2VMFA 2HWC2 1VBA3 5CIRA 5C3RA 4GWNA 3NKGA 2Q4SA 4PCRA 4YYOA 5ISLA 1KS5A 3VL9A 4CUCA 1DYOA 1WBLA 3CO2A 2BJSA 3IIIA 4YW3A 2V09A 4LITA 3FZ3A 2EIDA 2K0GA 2NLRA 3SKVA 1HRV1 3I59A 4FP2A 2BWAA 2Y6KA 2LTNA 1ND2C 4YVWC 1GKBA 2RV9A 3C7OA 5IVYA 1RUF3 3MIFA 4GMP3 3FHQA 1CAUB 4P5HA 5F5AA 1GWKA 1I6XA 5FXVA 5C6CA 2YPDA 2QE3A 5A7WA 1N1TA 2DU1A 4OHZA 3W9AA 3WCSA 1TMF3 2VECA 3ZFFC 5C8CC 2BEOA 4LMFA 4WM7C 3IDEA 3OYWB 5JIAA 2NP0A 1UU5A 4OHYA 1PVXA 2WLQA 1AR63 3WF4A 5F5IA 1ENQA 4HVRA 2WT2A 5FYUA 3OY8B 1PO23 4QX7A 1JOPA 4CEYC 2DCYA 4K9SA 3UETA 1DF0A 3ZYJB 5CAZA 4QT6A 1EV11 4EN0A 5FLHA 4AK3A 2V73A 1QOTA 1JMUB 1S0BA 1FOD3 2C9KA 4QPYA 4LO4B 3ZDVA 2XWBB 4ASMB 3M3OA 2I74A 3MF9A 2B9VA 4NPRA 4Y33A 2UYAA 4EWEA 5IVFA 3PU3A 1NOVA 1VAVA 1WLCA 3V65A 2B46X 3PL0A 1GZWB 1S55A 1H2LA 4YRDA 4UI9L 1LGBA 5A6XA 1K5MB 2ZA9A 5FDBA 1UXZA 1DYKA 1FV2A 1US2A 4A45A 2W9XA 1UOGA 4QKFA 4MGZE 1POQA 4D7SA 2A71A 2Y6FA 2DUOA 1RUG2 1NUKA 5FUPA 4YGBA 3U1XA 3WF3A 1F8VA 4PBOA 1IPSA 3KV4A 2PQSA 1R083 4N7UA 1W06A 3VBUB 5KXDA 4Z8BA 1TNRA 2DCZA 2W08A 4G9SB 4XXPA 3KF5A 3FUQA 4BQ3A 3TN93 3H7YA 3VD7A 3O1RA 1QGLA 1IPKA 1LGNA 2ZHKA 4XMAA 1QMJA 2VZRA 1S0GA 4GQ7A 4XFIA 2E33A 1BVVA 2V5DA 4JRLA 4JTNA 4WBBA 1VBA1 2RM23 4I01A 3VZNA 4CEWB 4NMIA 3KLSA 4HMZA 1SHWB 4Q4X2 2XMLA 3WXPA 2E7AA 2O1QA 1W2AX 4ZU7A 4MH0E 3SH4A 4PDWB 1RUF1 4IV3B 2Q1MA 3N9OA 4L92A 4D7YA 4A3ZA 2W46A 2JE8A 1OLMA 4GALA 1ZZCA 2YG0A 4E2GA 2CGOA 1UAIA
chains in the Genus database with same CATH topology
3W59A 1X7NA 4LE3A 2R062 4XFCA 1QQP2 1JTZX 3NVCA 1J3PA 3OD0A 4UBHA 1MS3A 3M3EA 1SDWA 3J8F3 2PAEA 1GSLA 1PO21 3VGIA 1ULCA 1DQ6A 4G3YC 3JUUA 5H9PA 1GFF2 1UW8A 1ZZ9A 1RUD3 2PAKA 3E6CC 2ZHLA 1ZBA3 4ZKTB 1QKQA 3B01A 5FFOC 1FOD1 1CAWA 3VHPA 4D7TA 4AXOA 2DU0A 3WP5A 1LCLA 2VULA 3JQWA 4JC1A 4Q4W3 5J37A 3FLTA 4KWKA 2W0XA 4GH4C 1DIWA 3GBFA 2BUKA 3HT2A 1MACA 1Z78A 2R073 2B8MA 5F9TA 2VGDA 4A7ZA 3E6DA 3SITA 1RUJ2 1QXPA 1QJY2 1N3QA 3POSA 3TRSB 3IIAA 3TYJA 1YFYA 2GALA 4TSVA 1SACA 2ZX4A 2XJTA 4LR4A 1ULGA 2JDZA 1K5MC 1QXRA 5J98B 2JG9A 1XQNA 4AQ2A 3ZSJA 3DKWA 4CP0A 2X8KA 5CB7A 1NZCA 3H9AA 3VBUC 3ZO0B 5KHIA 5BNOA 1BVP1 1V00A 1AR82 5FBZA 1N1SA 2D93A 3I54A 1UZZA 2QFEA 1S2KA 2C1FA 4HBNA 1JW6A 3MDPA 4XMIA 2BNOA 3HIFA 4KGQA 2ZKLA 4U36A 5IUQA 1PO12 1PK6A 1M4WA 3WQ7A 3KB5A 3KZ4C 3RWNA 2RS12 2JE7A 3G7DA 2VOWA 5HXVA 1L3JA 1DQ1A 1C4RA 1SLIA 4CEWC 2PQQA 2ZGQA 3J8F1 3WLUA 1SLLA 2Z69A 4AHYA 1Q43A 4XE9A 3B3QE 2HWE2 2R30A 3EHKA 1RUD1 4QXKA 2CNAA 4YGDA 4XF3A 4PDWC 5I0UA 4IV3C 2R061 4XJ8A 1QQP1 4U2AA 1GZ9A 3N3HA 3R4SA 4P9WA 1DZTA 2H6CA 4A3XA 1PGSA 2YPJA 4Z07A 4K21A 4AEJA 5L7OB 2Q1ZB 4L11A 1I9RA 3MLJA 1XYNA 3SCGA 1X8EA 4Y22A 1PNGA 3BOPA 1W6NA 3QOPA 1UD1A 5J96B 2D6NA 2CWMA 2K9ZA 3WCRA 2UWCA 3AP9A 1S0CA 4DPNA 1YO8A 1DQ4A 4AEDB 2E53A 1EAH2 2ZGPA 5EWSA 2G4IA 2RJKA 2DCJA 1QOOA 1J1LA 5EFUA 2JENA 3GYDA 1RGSA 2CY6A 2G9GA 5ABJA 2WT0A 2XJVA 4HK9A 5K8SA 4COVA 2PTMA 5JR7B 3JQXA 2E9QA 4BE3A 1Y3TA 2VMHA 1BEV2 1JH5A 3VHNA 1H9PA 4XIOA 3OGJA 3TBDA 1PVC2 3JZVA 3KT4A 4F83A 4Z1VA 5BNPB 4Q4Y2 3KM5A 3KMHA 1VRH2 1DGLA 1W6QA 5IT6A 1Q3EA 4E4SA 2P3JA 5GZFA 4GWMA 3MZHA 1O3RA 3K51A 2WNEA 4Q4V2 4FPEA 2WNUB 4XW3A 1FNYA 3B9CA 3ZVXA 3ZIXA 4LO5B 4IEXA 4PIZA 3NV2A 4XDQA 1IKPA 4NWWA 4HSJA 1GQHA 4QM8A 5DDJ2 1WW6A 4YG3A 4XIKA 2ZGKA 1NA1B 2VQAA 1IS4A 2GC1A 2PHFA 4LUKA 1X36A 2HWE1 3WZ1A 4Q0SA 4YFWA 5JI9A 4ATEA 5SV5A 1LOBA 4MVTA 1SBFA 1QH6A 3VBHA 4GB33 2ZX1A 4HKLA 5FPZA 4N53B 3ZFGA 1X33A 2PHLA 3N36A 1PMIA 1NYWA 1BQPA 2Q5TA 1DGWA 2UYBA 4QQOA 4HVQA 5DG1A 5L7OC 2O8OA 3S7IA 1ULDA 4AHXA 1H4GA 3M3IA 3SH3A 5I0RA 1HKDA 2GU9A 1NLRA 2VW1A 4BPZA 1UPIA 4CDXA 3EBRA 4AEDC 4LBQB 4M3CF 1DG6A 3S30A 3VZOA 4FPFA 2CGNA 3VBRB 4FTBA 5BYNA 3NAPB 1AL0G 3VDDB 5K9YA 4J1WA 1URXA 4XJZA 1XNKA 1N3OA 1W6PA 1J3QA 2ILMA 4Q1PA 1PVC1 4RQPB 1CJPA 4JQRA 3WDUA 2EXHA 3NV4A 2PHXA 1WCKA 4N43A 5JOYA 4QQ2A 2ZZQA 1V70A 3OCPA 2GMEA 3QLQA 5T55A 1VLNA 1AJOA 1O5UA 5BNPC 2XBO2 4CDWB 3NSTA 2XJPA 5T52A 3WW4A 3FUOA 5JSPA 5JOWA 4I09A 1C5HA 4RHV2 5I8TA 1V9U3 5I0SA 2RJLA 4W6WA 1MEC3 4JDNA 3FHIB 3N7KA 2WNUC 1KJRA 3PVOA 2QJVA 4IETA 1PIV3 1QXJA 1NCQA 3KGLA 1W6MA 1F31A 4GB31 5EV7A 1CAVA 1KFUL 3VBSA 3V0BB 2HWD2 3THPA 2LALA 4ATFA 1SBEA 3AYCA 4OHVA 1CX4A 2DVGA 2IFRA 4LULA 4PBPA 1NA1C 3H1WA 4IEOA 3NV3A 2VPVA 1H1IA 1LENA 4BCUA 4JDMA 4H7LA 3E5QA 3ZN6B 3RG0A 1O5LA 4N7IA 1F9KA 2XL9A 1RINA 2OA2A 1I1EA 4Y20B 4ORFA 2A6ZA 2Z5WA 2D98A 1FXZA 4IXLA 3O12A 1RB8G 1RC6A 1OA3A 5F5QA 5EJ3A 3N4MA 1GLHA 3C3VA 1RUH3 1ULFA 2VW2A 3AKSA 3D5OA 4N53C 4UW4A 2TUNA 1H2KA 1DDLA 3GZUC 1E57A 2OZ6A 1S0IA 5I93A 1W6OB 1AR73 3WQ0A 2ZGUA 1MZEA 1VBD2 3MLKA 3GHNA 4WVZA 2HWF2 2IXJA 3SLIA 4P9YA 3V64A 1KJLA 3U0ZA 4MSVA 3DPRC 2JKBA 1R093 3IWZA 1DYPA 2MEV2 1A78A 3IN9A 2VMGA 3UV9A 4E27A 2YXSA 3QACA 4KWLA 2RMU3 4V1PA 1CESA 2ZACA 1PGL1 4I3PA 1QU0A 1MS1A 5GKAC 4JGYB 5KHKA 4B4QA 3VBRC 3LA3A 4EN7B 3NAPC 5C4WA 3TNQA 4HFSA 3VDDC 4WV8A 2ZS6B 2ZX2A 4R9BA 4TZDA 1NCRA 1SMVA 4R9CA 4Y1YA 4RQPC 1QNYA 5IK5A 1Z7S2 4R8HA 2VVFA 3WINE 4F7ZA 1YIFA 4AQSA 3N35A 1QJX3 3HMYA 4TLFA 4F3JA 5CG8A 4NWVA 5FMOS 2VW0A 2WNVB 3I2DA 2HEWF 4NHKA 2GC2A 3RJRA 2PFWA 4BYYA 4AGGA 2P3KA 1LU1A 4OHXA 1WA4A 4CDWC 4DNYA 2RR13 3J9SA 4YZ2A 2GN7A 5JZGA 1LOFC 4WM8A 3U10A 1O91A 4LBOA 4KG0A 3Q9OA 3ZSLA 4L2NA 3O0VA 4W6XA 1U5YA 1LHOA 1ZZ8A 3MIHA 1CPNA 4Y4YA 5KBFA 4AFAA 1RUE3 3ILFA 4K8FA 3D8CA 4Q0PA 2EAKA 4QPIA 2QKDA 5F6KA 3WG2A 1RUH1 2ZHMA 5D8AC 1SCSA 4QGMA 1D4VB 1H8VA 5EZWA 2YY1A 4HETA 3HR9A 1AR71 4ZXKA 4IQPA 4XFAA 2YUEA 4XZPA 2WFF3 1RIRA 2IXHA 3R05A 5GZCA 1LOCA 1ZNPA 1B35A 3L9JT 2GMPA 1EYBA 3ILRA 3M3CA 4OHWA 1ND2B 3AKQA 3BALA 3ROUA 5JPMB 1W2UA 3AFGA 1JN2P 5FO7B 2VOKA 4FAGA 2HWF1 1C8M3 2NPIA 2GC0A 4BMEA 2ATFA 3ILNA 3UKVA 3H50A 3ZFFB 1YLLA 4WM7B 1TME3 1AX0A 2MEV1 1AYN3 1LHNA 4LHLA 4FO9A 3WVJA 4DB5A 5LK7B 1ENSA 2ET7A 1H0BA 2E7QA 1POV0 3SMHA 4CEYB 4L97A 4MLOA 4XQ4A 5KHGA 1UU6A 3JBG2 1YWKA 2SBAA 1NQJA 2JXAA 4KWJA 2NZ9A 2HYKA 3VUOA 1LECA 1RUI2 2IXKA 3AMHA 3OTFA 3SCFA 2PHRA 5A32B 2H0VA 4AFDA 1ZX5A 4JGYC 1YHFA 1Z7S1 2WZR3 1EPZA 2BGCA 4Q1RA 3LKJA 2DV9A 4AFMA 2YC0A 1W39A 4DMIA 4XOGA 3O7OA 1VB2A 2ZAAA 3X29B 2E7TA 4DFSA 3ECQA 2IZWA 2ZOEB 1OOPB 2BFUS 2WNVC 1OA2A 4E2QA 4O9GA 1S0JA 1S0FA 3CJIA 4UW3A 4AEMA 1ND3B 3OGGA 4R4XA 4RGAA 4A7YA 1WCSA 2AENA 1Q5OA 1PZ7A 2A3XA 2PLV2 3DN7A 5DZGA 4LNVA 3M4FA 2RS53 1OLQA 3LOBA 3R4UA 2GNBA 2CL2A 1COV2 4P14A 3VBOA 5EXOA 4YW4A 3WP4A 4AEKA 2XVLA 5KXBA 1C8M1 4RA0A 3MI8A 3RRDA 1CVNA 4JV4A 1GBGA 2EF6A 5KHHA 4H3WA 1TQ5A 4AVBA 1TME1 1CN1A 3H1YA 4FOQA 4BMBA 5BUVA 1RJ7A 5J3UA 5FOJB 2D7FA 3AP5A 4LBNA 1XE7A 4LBLA 2R32A 5TSWA 2JICA 1ZZ7A 2ZABA 3ZXFA 1WW4A 1DGRN 1FYUA 3ZXDA 3RSJA 1WBFA 1FPN2 2WZR1 4I2OA 4YGCA 4M00A 1ZRCA 1D0GA 4XJ9A 1LGCA 3FWEA 2ZGSA 4GH4B 3AFKA 3JBG1 5JOXA 3AX4A 3IM0A 2NN8A 4CRQA 1AX1A 1I3HA 1MZ5A 1U12A 2DVFA 3BOWA 2WQ4A 5BNNB 5FMOL 4HSLA 4MXWA 4EJRA 4C0BA 5JDBA 2A5ZA 4NHLA 1ZZBA 2VNOA 1AHSA 3IBMA 1NE6A 4Y24A 2WSVA 4S2GA 5B2GB 1HX6A 4AVSA 4AVTA 3IT8A 2RS51 4KU8A 3PVNA 5J48A 1AR92 3WDTA 4YVWA 4HN1A 3W58A 1H9WA 1IPJA 1TNFA 3KGZA 3WP6A 1OOPC 2Y38A 3LCPA 3RNSA 1KXGA 5FTTC 1LHUA 2PLV1 2TBVA 5DUUA 2YGLA 2DUQA 1ND3C 5C8CA 4AYUA 3KS7A 4Q2FA 2Z42A 3IDCB 2WLPA 1UKRA 2BQPA 2VNRA 1RUG3 4K40A 3ZSKA 3IKWA 1N1VA 3LOIA 4HVOA 4HK8A 2WIIB 5KC6A 2XPJA 3R6SA 1OKQA 1U5IA 3VKNA 3GZTB 4JAAA 3VBFB 2HKXA 2JJ6A 2DCKA 3U11A 4I0AA 1NY71 4PIYA 1S0DA 1DGWX 4K20A 2HWC1 5CFDB 5CVRA 3LZZA 2FBEA 1DGRA 3IPVA 1SLTA 4Q4X3 1MVQA 2ET1A 1A3KA 3GNEA 4NHMA 3SXWA 3ZYIB 4COYA 4IEPA 5F1RA 2K2SA 4AI1A 1XXNA 2XWJB 1IZ3A 4XETA 4Q8LA 3CL1A 5GLZA 4YG0A 3PHMA 4FTSA 2D6OX 2ERFA 1Y43B 2OUHA 4KL1A 3RDIA 5KC5A 2R063 1QQP3 4X6RB 4M01A 4WVVA 3PVEA 4CDQB 4Y5Z0 4Q0QA 5D1IA 1ENRA 4JVAA 5E8AA 4AQ6A 3MW3A 4DY3A 1Q56A 2JD4A 1OQ1A 4IL7A 4OI1A 2B39A 2XG3A 1BYHA 4FP3A 2GNDA 4Q4W2 1MR5A 4OI4A 3EQEA 1OD5A 1XNDA 2A6VA 3EJKA 4PJYA 2FHRA 5BNNC 2BFUL 4B7KA 1VJ2A 1CPMA 5LRSA 2Y0OA 2FQPA 1OFSA 1RUG1 1G8WA 1LODA 2GNTA 1REDA 1DZQA 1ZRDA 3P3NA 2QCSB 4C1XA 1RUJ3 1QJY3 4ES9A 3V0AB 3AMQA 1J3RA 2B7YA 1FV3A 1S1AA 1SFNA 4XMAA 1U5XA 3QH7A 4QPGB 1LTEA 4YNIA 5T5OA 3WUDA 4MGIE 1CAUA 4C90A 2A7AA 5H9SA 3T1MA 3TAYA 2VXRA 3TOJA 1CAXB 5FRAA 4F8AA 1V6LA 2XB6C 1B09A 5T5JA 1C1FA 3OYWA 4KGGA 4CYDA 4P9XA 4Q4X1 2MPFA 2CGPA 3OY8A 4YM0A 2VMIA 1IQAA 3GZAA 1DQ5A 1RMU2 5FLIA 4J1XA 2PAMA 3VBFC 1IHMA 4Y1UA 1PO13 3ENRA 1GZWA 1UCXA 2DVDA 2ZCWA 2RS13 3A4UA 3KCXA 3MFAA 3ASIA 4Q27A 5CFDC 3AXDA 3CNAA 4RS5B 3I4IA 1K5MA 1AL22 2D6LX 2YHJA 4N90A 1Q8OA 5JPNB 2W68A 2LM3A 2Q0AA 4W65A 4O9EA 1ONAA 2HWE3 4YLZA 3VBUA 2A6WA 2UY8A 4FQZA 1PGW2 2R042 4Z2WA 1O7FA 4K1ZA 4LO7A 3LWCA 1JYIA 2GN3A 4OFGA 1V6IA 5HI0A 3KSCA 1UZYA 1XE8A 1YCIA 4CDQC 1ZZ6A 2BTVC 4YW5A 4CEWA 1MZFA 3A0KA 4GIQA 1QH7A 1O4TA 1RUJ1 1VAMA 1QJY1 3CLPA 3MICA 1WD3A 4PDWA 1ENXA 3USUA 3WQ1A 1MS0A 4IV3A 1EAH3 2HJIA 4RSUA 4E4ZA 2ZX3A 1JOJA 4YW2A 4UW6A 1AXYA 1O4ZA 2C9AA 1IS3A 3B69A 3N7MA 4I0BA 4JRAA 5JIUA 3MW4A 1REFA 1CJDA 2WJSA 3JB4C 3OPZA 3VN4A 1OQEA 1GICA 3DV8A 1BEV3 1QJU2 1AR81 1RTVA 3D4KA 1HXS2 3N7JA 4CDUB 1H2MA 2MHFA 1PVC3 1REEA 2F6BA 3VLBB 1LRHA 4Q4Y3 4COZA 5IK8A 3ACLA 4QPGC 1VRH3 3WW3A 1R1A2 4HPKB 4MZUA 1YYNA 3ZPYA 1PO11 1MS4A 4IV1B 1LR5A 4RR3B 2RS11 1GV9A 4RD7A 2P34A 4Q4V3 4OUSA 3WOGA 1WLTA 2SLIA 2ZAHA 5E89A 1POV3 3RZZA 5AFEA 3UL2A 3NJZA 5JVVA 3VZJA 2C0ZA 4LE4A