4U36A

Crystal structure of a seed lectin from vatairea macrocarpa complexed with tn-antigen
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
233
structure length
229
Chain Sequence
SEVVSFSFTKFNPNPKDIILQGDALVTSKGKLQLTKVKDGKPVDHSLGRALYAAPIHIWDDSTDRVASFATSFSFVVEAPDESKTADGIAFFLAPPDTQPQKDGGFLGLFNDIQTVAVEFDTFSNTWDPSARHIGINVNSIESMKYVKWGWENGKVANVYISYEASTKTLTASLTYPSNATSYIVSANVDLKSALPEWVRVGFSATSGLSRDHVETHDVLDWSFTSTLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structure of a new Tn antigen-binding lectin from Vatairea macrocarpa and a comparative analysis of Tn-binding legume lectins.
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords Seed lectin
total genus 51
structure length 229
sequence length 233
ec nomenclature
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4u36A00
3WV6A 2AUYA 1GZCA 3FUOA 4YZ4A 2UU8A 4WVWA 5SV8A 3UK9A 1LODA 5EYYA 5GLZA 3RMYA 3WDWA 1LECA 2EIGA 1FX5A 4FP3A 3WDXA 1N3OA 1DQ1A 4YM2A 3R05A 3SH3A 2V5YA 3NV3A 1DYKA 1F9KA 1FV3A 3NV2A 3L2YA 3M2MA 4JRAA 4LBNA 1IKPA 4LBJA 5CAZA 1Q8OA 2Z42A 2DVFA 3I8TA 1AZDA 1LHNA 2DWRA 1I3HA 2D3SA 5IUQA 2ZGLA 4LBLA 3O0VA 2ZGTA 2JECA 2ZHMA 4FPKA 3M3CA 5E8AA 3WCRA 4XBNA 4XYXA 1GZWB 2CYFA 4AVTA 1MS3A 2ZGNA 4CZSA 4JC1A 1FATA 5GZDA 3WZ1A 5JMCA 1S0BA 5H9SA 1AVBA 2DTWA 2R49A 2PHRA 3FLTA 1Q8VA 1SFYA 1LGNA 4C1WA 4DPNA 3UJQA 1WUVA 1C4RA 4PF5A 1SCSA 4PQ9A 1SBEA 5T5PA 4FQZA 1QOSA 3AJZA 1RINA 1LOBA 3B9CA 3MPPG 1UAIA 4GWNA 2DVBA 4R9DA 2A71A 5JDBA 3O5SA 4YW1A 3FBYA 1N3PA 2JDZA 4FPCA 2R0HA 2W68A 1SLBA 1OQ1A 2A6WA 3SITA 3LSEA 1V6LA 3C2UA 2XB6C 3I4IA 3N35A 4FPEA 1ENRA 4YG0A 3SNMA 3WLUA 1ENSA 2A3XA 4P9WA 4NO4A 2OUJA 5T55A 2FHRA 4K21A 3BTAA 4YZ3A 4KBBA 3RRDA 2A3YA 2LTNA 3PVNA 1AX1A 2UWAA 3ZXLA 4F83A 2CL2A 4UW4A 3OJBA 1GNHA 5GLUA 2EF6A 1MACA 4YZ2A 1CPMA 2A6VA 5DUVA 3ENRA 1S1AA 1MS4A 1N3QA 4HANA 1UZYA 2YROA 5IK4A 3FUQA 3PMEA 1FYUA 5GLVA 4PBOA 4Y22A 5JOZA 3MW3A 5H9QA 3QLQA 5E88A 4LBQA 3USUB 2ZAAA 4XJZA 1APNA 4RL7A 5T5LA 5AVAA 4Y1UA 1KJRA 3OBTA 1DZQA 2VY0A 3D5OA 1WW7A 2PELA 1W0OA 1ONAA 4XMAA 2GNBA 2D6MA 2DU0A 3B3QE 2W52A 3N7JA 2XG3A 3OY8A 4K1YA 4XIOA 2A6ZA 1WCSA 4XHXA 1JN2P 1QGLA 1SCRA 1CIWA 1G9AA 1MS8A 2WSVA 1MZ5A 3W58A 2W08A 3D6EA 3ATGA 2W39A 2C5DA 1WBFA 1LOCA 4Y24A 3VUOA 4K20A 2P3JA 3ILNA 1LOFC 2P3IA 2A6YA 4SLIA 1ZA4A 4YG3A 3WG2A 1LJ7A 1Q8SA 3N3HA 4GA9A 4YM1A 5DZGA 4AGGA 4XJAA 5E89A 4BLJA 4DFSA 1RIRA 4XTPA 1WBLA 3WG1A 4ASMB 4YM3A 2CWSA 1DQ2A 3ZXEA 2GALA 4XIKA 2CY6A 3IKWA 1LOFA 4GKXA 3WG3A 3QCWA 1A8DA 3WOGA 1W6QA 2DU1A 3BIWE 1MS9A 1ZM1A 2KM2A 1O4YA 1WW5A 2YV8A 1AJOA 4YLZA 2NN8A 1CR7A 3N7LA 3GALA 1LHVA 2PHXA 2NZ9A 4FOWA 5DG2A 2JJ6A 4AGVA 3O0WA 2GNMA 1LOEA 1VAMA 3MEPA 2ZHLA 3M3QA 4Y22B 3ZYRA 2E7TA 2WQZC 4Q1PA 2PHFA 5GZFA 1SACA 3CNAA 3T2TA 1DLLA 1J1TA 2VU9A 1S0EA 4Y26A 4GKYA 3AXDA 1WD3A 2CTVA 3FLPA 1DQ0A 2VW1A 1XQNA 1AX2A 2D6PA 2VH9A 1Q8QA 2ZMNA 3OYWB 4PCRA 1S0JA 1GNZA 1YI7A 2AGSA 1WLCA 2BQPA 1VAVA 4FOQA 4ITCA 3AP7A 2A70A 2EAKA 4FP2A 1QNWA 1JUIA 3AZVA 3HR9A 3MW2A 1AXKA 5FREA 2DYCA 1CESA 4Y20A 5DUXA 3AYAA 3AZYA 1Z0HA 1URXA 2G4IA 1IS4A 4FPOB 2PHUA 2ZBJA 4NOTA 1FNZA 1GANA 2ENRA 1W6MA 1S0GA 3O12A 3WHUA 4MYEA 1MVEA 1KRIA 2WJSA 4DS0A 3U4XA 4XJ9A 4FPJA 4I30A 3WDVA 4RA0A 3IM0A 4M01A 1LENA 1ULCA 3AP5A 4FPGA 4Y1XA 5IK5A 3H0OA 1V6IA 1JOJA 1JXNA 1KQRA 3HMYA 4XZPA 5IK8A 1W6OB 1S0DA 3A4UA 3KM5A 1N1YA 1VALA 4YGCA 4Y1YA 5L73A 1JYCA 1SLCA 2YXSA 4LBKA 4XJUA 4Q26A 4AGRA 1MZ6A 4LBQD 2ZGRA 1C1FA 2A7AA 4Y1ZA 1A78A 3WDTA 4FOYA 4HL0A 3M3OA 2WNEA 5GM0A 3ZSLA 1AXZA 1BKZA 4ZXKA 3OYWA 2A6XA 2GMMA 1SLIA 1G9BA 4FPYA 2EXIA 3RQ0A 4FPHA 3ZSMA 1Q8PA 5JOXA 1CONA 3NWKA 4FQ4A 5BYNA 3AX4A 4XXAA 2JE9A 2EXHA 2NMOA 1JBCA 2PHTA 4BPZA 3A0KA 4ISQA 1DQ5A 2GN3A 2AENA 1BZWA 3FLRA 1QDCA 3RS6A 3V65A 1G9DA 2NP0A 1V6KA 5GZEA 5KXBA 2TEPA 2ZGOA 5H9PA 3APBA 2V73A 3PVEA 5EWSA 1LHOA 3AFKA 1NXD1 5EYXA 4K1ZA 4AVVA 5GZGA 4ZKTB 1WW6A 3AZXA 4M3CA 2EXJA 1UL9A 2D6KA 2E6VA 4BLIA 5CA6A 4R9BA 1GKBA 2R1BA 1G9CA 4FPLA 4M3CE 3AJYA 1QDOA 1QKQA 3INAA 3VKOA 2GNDA 1YO8A 1GBGA 1G86A 3OPZA 3UJOA 3AZWA 4YW3A 1CVNA 5JOYA 3IPVA 1WLWA 5DXDA 2P34A 5CB7A 5GLTA 3ILFA 2ZMLA 5CNAA 3VKLA 1U0AA 4CRQA 3IPVB 2NMNA 1BXHA 1OFSA 4R9CA 1SBFA 4LBMA 1WW4A 3WVJA 1AX0A 1UKGA 1LOAA 2EXKA 1LGBA 2A5ZA 4LBOA 2H0BA 4XTMA 3TAYA 1PZ8A 3M1HA 4GALA 2WLQA 4CTEA 4AVSA 2HYKA 3VKFC 4YFWA 3ZXJA 1A3KA 2PHWA 2ERFA 2D6OX 3VKMA 4DRVA 2YY1A 2GN7A 4ATFA 3OY8B 4XILA 5FRAA 5DZEA 1UPSA 2D43A 4WV8A 5T52A 2GDFA 1MS5A 1S0IA 5IT6A 1W6MB 1GICA 1H9PA 5F9TA 4BMEA 4YG6A 4YW5A 3RG0A 2VXRA 3B01A 3TB0A 3ZSKA 1HLCA 3HN1A 5IK7A 1V00A 4XMIA 5GALA 2VUAA 4JCKA 4C1XA 1IKQA 3MW4A 4L8QA 2Q5TA 1UZZA 4U36A 4XXPA 1IS3A 5JVVA 5LK5A 1KJLA 4DRRA 1GZ9A 1B09A 3NV4A 1UX6A 5DG1A 1CQ9A 1SLLA 4WZFA 1W6NB 1ENQA 4P9XA 1FV2A 1BQPA 1G9FA 4GWMA 4YGDA 1H30A 1IOAA 1CJPA 3PVOA 3RMXA 3WNXA 4XBQA 1F31A 4Y1VA 4PBPA 1GV9A 3B00A 1N1VA 3D4KA 3WDYA 1DBNA 1QU0A 2WSUA 2R1DA 3IMNA 3AYEA 2ES3A 1N47A 2OW4A 1MS0A 1SLAA 3VV1A 4Z8BA 1DYPA 2DVAA 1CPNA 1ULFA 1VLNA 1W6QB 1YXWA 2CNAA 2D7FA 2E53A 3JUUA 2D3RA 4U2AA 1QF3A 1YRZA 1DIWA 5EXOA 5CBLA 2ZGKA 3R4SA 2SBAA 1UN1A 5T5OA 1JW6A 2YZ4A 2WT1A 3AYDA 1V6OA 2WT2A 4AYUA 2SLIA 4YZ5A 2DUOA 4YGEA 5DZFA 4H55A 3BOPA 3W59A 4P14A 3T1MA 3RSJA 2OVUA 3N7KA 4WVVA 1RITA 4YW4A 5T5JA 5HCBA 2AREA 3AP9A 4UW3A 3ZSJA 1AF9A 2OUHA 1QNYA 1ULGA 1DFQA 1DGLA 3O0XA 1QOOA 4BQ1A 1EPWA 1W6NA 1YYNA 2A75A 3FFZA 2GNTA 3V0BB 2JD4A 3A0NA 2ZA9A 3WCSA 4DQAA 3AXEA 2R16A 4M00A 3AP4A 3KQRA 4W65A 3AK0A 4YW2A 4D69A 3ZXFA 1N1TA 2DV9A 3ZPYA 4Q27A 2GMPA 2ZMKA 3M3EA 3ZXKA 2YMZA 5DUWA 1LHWA 4Q8LA 2GMEA 3SLIA 1D0HA 4P9YA 5JOWA 3UL2A 4XBLA 1HDKA 1WD4A 1TEIA 3AYCA 2JKBA 1LHUA 3DUIA 3ILRA 3JU9A 4Q1RA 5KXEA 1CN1A 2DVGA 1I1EA 2P37A 2ZKNA 2UWBA 1QMJA 1BYHA 2ARBA 1LEDA 1V6JA 3WG4A 3VKNA 1W6PA 4BM8A 2C9AA 4UW5A 4AWDA 1IS6A 3WDUA 4XE9A 2DURA 4ATEA 1WLDA 3WUCA 2WKKA 1KDMA 1N1SA 2FMDA 4OZXA 3N36A 1SBDA 2ZGSA 2NM1A 1GSLA 3POWA 4BMBA 1S0FA 5HCAA 1W6OA 1BJQA 1HQLA 5JLVA 4YGBA 1ULEA 1AXYA 2ZHKA 2D3PA 1KDKA 1PZ9A 1X50A 2AR6A 2ZABA 2ZGMA 3B69A 2NYYA 4Q8KA 1MR5A 4M3CF 1S0CA 2RHPA 2DUQA 4Q2FA 1O4ZA 4XJ8A 5GZCA 4FVVA 1DQ6A 3POSA 4XOGA 2LALA 2ZGQA 3PJQA 1D2SA 2ZGPA 5H9RA 2P3KA 5HCFA 1FAYA 2EALA 3SH5A 3ZYPA 3Q9OA 1OKQA 3GNEA 4LBQB 3USUA 3POYA 4FOVA 1HQWA 2ARXA 3OGGA 1YIFA 4XJWA 3LSDA 2DUPA 1PZ7A 1IS5A 2JE7A 1HKDA 2CWMA 3SH4A 2E51A 5GJ6A 3SISA 2ZGUA 1Y7BA 1G7YA 4TZDA 3R4UA 3BODA 1NLSA 2AH2A 3WHTA 3LCPA 3AZZA 2D6LX 1C1LA 3V64A 1H9WA 4GXLA 1LU2A 2D6NA 5F5QA 4XHBA 5KXDA 1VIWB 1GLHA 2B7YA 2D44A 2VW2A 1W6PB 1LCLA 2I2SA 1LESA 2DVDA 1GZWA 3IN9A 3V0BA 3ASIA 1MS1A 1V6MA 2A3WA 4ISRA 5T54A 1KITA 1Z78A 4FPFA 4R9AA 4XDQA 2VW0A 4BOWA 2AYHA 5KXCA 1FNYA 3V0AA 1C57A 5GLWA 1Q56A 2R0FA 1R1ZA 3V0AB 1GYKA 2DTYA 1MVQA 1LULA 1LOGA 3ZVXA 1LEMA 2P2KA 2ZHNA 1SLTA 3N7MA 3T1LA 1UMZA 1AJKA 1JYIA 2ZZJA 1LGCA 2ZACA 1V6NA 4Y20B 3WUDA 1JHNA 1F5FA 4TYSA 1DQ4A 1G8WA 4YM0A 3DGTA 1QOTA 1DHKB 4YFZA 4YZ1A 1LU1A 2E7QA 4UW6A 1LTEA 2UWCA 1W0PA 2UURA 3AP6A 5T50A 5DUUA 2WT0A 3OBRA 3NV1A 4M3CB 1ULDA 4IQPA
chains in the Genus database with same CATH superfamily
2ET7A 5CFCB 2WZR2 4YZ4A 5SV8A 5FP4A 3UK9A 5EYYA 1LECA 2RM23 2V4VA 1FX5A 4BXFA 1DQ1A 4QX2A 2ZJCA 1AR71 2ET1A 2FD8A 2QFEA 2YDEA 3VL8A 1F9KA 1FV3A 1VBE3 1CAXA 1ZREA 4K8RB 4MO3M 5FXZA 5DQ0A 4MGYE 1H4HA 1X8MA 4R4ZA 1COV3 4XAEA 4ZS2A 2GP5A 1AYM3 3OEBA 3AKRA 4QM8A 5FYIA 5LEJA 1RVF1 3O0VA 3FFQA 1NAEA 1NOVA 3IAPA 5LRSA 2Y64A 2ZHMA 1GUIA 2Z4FA 3LEKA 1W8WA 4Q0VA 5K8SA 3B9IA 2JB8A 5FZ6A 2JDKA 1W2UA 4AVTA 1MS3A 4JGZA 2VXJA 3U07A 1RJ7A 2F4PA 3OPWA 1PX3A 5FZDA 4BE3A 5FWEA 2L9LA 2ZCWA 3AFGA 3FLTA 3LPFA 4HBNA 5ACA3 3KT7A 3VZLA 3UJQA 3LB9A 1WUVA 4PF5A 3OPTA 4PQ9A 2BRTA 5DMYA 1H6YA 2G9ZA 3HNYM 3N9MA 2ZEXA 4L9BA 3MPPG 3TYJA 1MZEA 1HB1A 4M0NA 4R9DA 3VB9A 1YQ8A 1YFYA 4QHZA 5JDBA 1PIV3 3TWIA 3A22A 4FPCA 3PLQA 4XUNA 4WM7A 5C9AA 4CXYA 1HJFA 3LSEA 3I4IA 1EUUA 3N35A 2X10A 2ORZA 3SNMA 2K46A 1W05A 3C7OA 1QJY3 3KV9A 1RUG1 2A3XA 3B7MA 4A45A 2WNOA 2OUJA 1V0AA 3BTAA 5DAVA 2WFPA 4G4FA 4LMFA 1RUH2 2CL2A 2OX0A 2GSYA 1C28A 2VOXA 4MHRA 4UW4A 4CCCA 1X7NA 4EV0A 1UZVA 5HXVA 4XFAA 2Q8DA 4ASKA 1OMIA 5IVBA 2A6VA 4ZY9A 1NY71 2QVSB 2ARAA 4NJ4A 1UZYA 1QH7A 5JZGA 2B46X 4CDWA 1IGOA 2OZJA 2VMGA 2BNNA 3H7YA 2JIJA 5GLVA 3K48A 1XE8A 1FOD3 4UI9L 3QLQA 3AVSA 5F3IA 3RPQA 5F5IA 2ZAAA 5LA2A 4RL7A 2D40A 4N7IA 4Q4X1 1H8TB 2VY0A 4OI2A 3K51A 3BPZA 1A34A 1R1A1 3JZVA 3N9OA 4RYDA 5KHKA 3GGLA 5FP9A 4LO5B 4V2WA 3OGRA 1FPN1 3LZZA 3S0MA 1RL3A 3OY8A 2QQWA 4K1YA 4QX8A 4ZU5A 5FZIA 2ZTNA 1WCSA 2QQKA 3MLKA 4XHXA 3LD8A 3LIHA 4RHV2 4UFLA 4WM7B 3WEZA 1CIWA 4DO0A 5A33B 2VOTA 4JHTA 3BI3A 2OPWA 2CDPA 5K0UB 2C5DA 3T0DA 4S2GA 4RSUA 4XDPA 2WDBA 2XBO3 1POV0 1LOFC 1WCUA 4KWKA 1D4M1 1HN1A 2P3IA 4SLIA 4WZCA 2EIEA 2BGOA 3E6BA 4YVSA 5I0UA 3MF6A 3DYOA 4YM1A 5K0UC 3ZIXA 4XETA 1JTZX 4KBZA 3NNFA 1J3PA 1VBD3 4XJAA 5FZAA 4LHNA 4BLJA 1MQTB 1VRH3 3N9LA 1JZ3A 1S2BA 5CADA 1HRI1 2PAMA 4FI9A 4BH9A 5FPXA 1QHDA 5FP8A 3BTZA 5FZKA 4CPBD 2BGPA 2DDUA 2GALA 3ME2A 4JV4A 1QH6A 1LOFA 5FY7A 3QOPA 4BISA 1W0NA 4WVMB 4I0BA 1A8DA 3DXUA 3BIWE 1MS9A 1ZM1A 5C4WA 3E5UA 1O4YA 4IEQA 3KWVA 1ZRRA 3N7LA 4Q4V3 1LHVA 2PHXA 2HBUA 1DGWA 3C3VA 4AGVA 2BPA2 3MBWA 1LOEA 1VAMA 4ZXEA 2WA4A 1VRH1 2VQUA 1CAXB 3TNQA 1AYN3 1UQXA 2OPKA 4Q1PA 3ES4A 3ZN6B 4Q0PA 4AQ6A 2LROA 2PHFA 2VNRA 2ZX1A 4QXKA 5GZFA 3T2TA 5A1AA 5ANNA 4NWWA 2O8OA 4AQTA 3H3LA 4GKYA 3AXDA 5C4WC 1W99A 2CTVA 3O1UA 3OCPA 1DQ0A 3I2JA 4AI2A 2W87A 3P6BA 3ZSEA 3ZDVA 1AR92 1JZ6A 5A3LA 2BQPA 3KS7A 1VAVA 5LY1A 2R7EB 1OOPA 2DCZA 3FL7A 3ORJA 4HZFA 1Q43A 1H8VA 1W2AX 4CUAA 1AXKA 2CAVA 1HIXA 1PO12 2WZ8A 5E16A 3W9AA 2OQ6A 1Z0HA 1URXA 1IS4A 4FPOB 3OG2A 2WN3A 5FPZA 2WS91 3KF3A 1ULPA 1W6MA 3WHUA 1TG7A 2HWE2 3ST7A 1KRIA 2YFZA 3K77A 5FYUA 5K7PA 4FPJA 1A6CA 4I30A 5FYCA 5BUVA 1BCXA 3WDVA 4NRQA 4IETA 5J3UA 4M01A 4Y1XA 2BOJA 1R093 1QJX3 2ZKLA 4ARYA 5F5CA 2DBNA 4BIFA 2RS52 1VALA 4Q4W1 4MVTA 4CCLA 4XFHA 4S2HA 3BKZA 2YXSA 4YARA 2HEVF 1QJX2 4Q26A 4AGRA 1CAWB 3IZOA 4LBQD 5C8CC 1A78A 3WDTA 4ZHNA 4MXWB 3FMGA 4HL0A 5GM0A 2QQOA 1DDLA 2PXJA 1W04A 2A6XA 4PI2A 1ND2B 1SLIA 3K75B 4RR3A 4BIOA 3RQ0A 4IV3C 1Q8PA 2Y33A 3VDDB 5A7NA 5BYNA 3O7OA 1J1LA 1HN0A 2YU1A 1MQTA 3PIJA 1W9WA 3U37A 2PHTA 4CVUA 3J7LA 1DQ5A 3NL1A 1EV12 1RJ8A 1D4VB 2AENA 3GBFA 3FLRA 1QDCA 4W6XA 2R062 4YVWB 1H2KA 4P02B 3RZZA 5C3QA 2EICA 1V6KA 4IEPA 1ZA7A 4E4SA 3EO6A 2MNGA 4UFIA 4IGQA 2TEPA 5KXBA 2Y6FA 1EV13 2ZGOA 4FT8A 2OXBA 5FY4A 1RXFA 4Q0QA 4NIAA 5EYXA 5GZGA 3VN4A 5IFTA 1WW6A 3AZXA 2OYZA 2R071 1XNDA 3CU7A 2D6KA 1P8JA 1GKBA 4M3CE 3WINE 4BYYA 3N9QA 1QDOA 5BNOA 5BXXA 1XNTA 1PM7A 1W8UA 2YUEA 3ZOIA 1UWWA 3U78A 3VZJA 1VBB3 1FPN3 2TUNA 4BQ2A 5CNAA 4MXWA 4CCKA 3ITQA 3JD71 3CZUA 1OUSA 2JWPA 1COV1 2K9ZA 5FLHA 1AX0A 4LA3A 2B9UA 2EXKA 2R073 3FC0A 3R4DB 1U5ZA 1PZ8A 3M1HA 4CTEA 2WLQA 4AXOA 3BCWA 4AVSA 4EWEA 3ZXJA 3ZX7A 4A7KA 3NQHA 2ERFA 2YY1A 3UGGA 4IGOA 5FRAA 1UIJA 4NWVA 1WKYA 2ETEA 5DZEA 3VBUC 3GJAA 3W5NA 4WVZA 4K6BA 1RUC2 5IT6A 1W6MB 1GICA 3TBDA 5F9TA 2IWGB 2W0XA 3RG0A 3RGBA 4Q4V1 5IK7A 2WO3A 4LPLA 3WNPA 3TN91 1POV3 1REEA 1RUC3 4XXPA 4DRRA 1IS3A 4OYUA 5LK5A 1B09A 4HLTA 2J22A 3ZN4A 5IVJA 4QX1A 4IE7A 1W6NB 2R30A 2YFUA 3H9AA 3PVOA 3RMXA 4QDSA 3ZFFB 1H6XA 3GZUC 4XBQA 5BNNA 3WX5A 1OLQA 5IAXA 3GZTB 3D4KA 1US2A 3IMNA 4N53A 4XPVA 4QU1A 2E7AA 5J98B 4JX0A 1DYPA 2UY9A 1XNKA 1ULFA 1W6QB 3ZKYA 1YXWA 4CDUA 4E4HA 2D3RA 1AR82 4IEWA 5FAXA 1DIWA 3T2PA 3WQ0A 4IEOA 1O5UA 2SBAA 2XLAA 2RS53 1EP0A 2YZ4A 3AYDA 4MHUA 2WT2A 4QKDA 5FPUA 5I8TA 4CUBA 4QDQA 1XYPA 4ZS3A 3BTXA 3NRUA 3ZYIB 3W59A 4P14A 3T1MA 3GDBA 4XVHA 3HEIA 4EZHA 4B4PA 1RUI2 4DEQA 4META 4WM8C 4WVMA 2HYXA 2AREA 5HCBA 5A7OA 3EQEA 4UW3A 1NCRA 4IEUA 4XF9A 2OUHA 1QNYA 1ULGA 3U14A 1DFQA 2ADEA 2IXCA 1QOOA 3DN7A 3RNSA 2A75A 1YNAA 3RJRA 5IHRA 1VBC2 4QKNA 1YUDA 1W9TA 3WCSA 3OUIA 2FDIA 1UO9A 1H2LA 3AK0A 3LE0A 4UBGA 3ZLIA 4PLMA 3WW3A 4O9GA 2LS6A 5FMDA 2GMPA 5BNNB 2ZMKA 4JKLA 1WA6X 3PIGA 1ST8A 1ZZ6A 4HVOA 1MZFA 1NCRC 1POV1 3OF1A 4Q8LA 3SLIA 3LEGA 5JOWA 3ZFEC 1NQJA 3S7IA 1DGWX 3ILRA 3THCA 3GF6A 2MEV3 3HT2A 1SMVA 2ZKNA 2RR13 3WF2A 3VLBB 1LB2A 2ARBA 5D8AA 5JSPA 3TEZA 1W6PA 1RUH3 2Y6GA 4DXRA 1U5YA 4HKWA 4P9IA 4XE9A 4ATEA 1RMU3 1OQEA 4QDRA 1WLDA 3WT3A 1ULOA 3WUCA 4CDQB 2E9QA 1JUHA 4XCBA 4AFMA 5FFOC 3J8F3 3B5LB 2ID4A 4BMBA 1S0FA 2DCTA 5JLVA 3AMQA 4K40A 1UU4A 2VZ1A 5LEKA 2FDGA 1KDKA 4R8HA 1XE0A 1UU6A 2ZGMA 2E26A 4Y33A 2VVEA 5FY8A 5AVPA 1EPZA 2W47A 5FZ1A 1PVXA 1K12A 3LA7A 5FK8A 3MI8A 1O6UA 4I2OA 5C33A 5KC6A 5A6XA 5L19A 1D2QA 5FPAA 4XOGA 3SEEA 2ZGQA 5HCFA 3P3NA 1JZ5A 1WMEA 1D7PM 3MLJA 3POIA 2ZEZA 4LO7A 4QGMA 3Q9OA 4HSLA 4UAPA 4FOVA 4EE2A 3H1WA 3LSDA 3EHKA 5LZ6A 4H14A 3JQWA 4JKKA 2HJIA 2JE7A 4E4DX 4OQ8A 2EIDA 3KSCA 5CFDB 2PMWB 4A4AA 1KFUL 3LF7A 3H8OA 1R082 4UFHA 3VD5A 3SISA 2MEV1 4IV1A 1WWYA 3VBOA 4LORA 4JDNA 4CP0A 2C9KA 3BODA 1NLSA 4QMAA 3KT4A 4NHKA 4OLLA 4AI9A 2PTMA 2TBVA 1COV2 3DPRA 3S30A 3PTYA 1LRHA 4ZZ8A 1JYVA 4JHZA 2B7YA 3VBFB 2VW2A 1LESA 2XHNA 1GZWA 3ASIA 4IV1C 5JIUA 5FXVA 2VQ0A 1YJKA 5T54A 1WMXA 2JDNA 4JDMA 4CDXB 3KT1A 4RS5B 2PAKA 1CX4A 4QQOA 4BOWA 1FNYA 4JDOA 5GLWA 1Q56A 1XPWA 4CEWB 1R081 3N4MA 1GYKA 3ZR5A 1LULA 1LOGA 5AC92 5IAVA 1SLTA 4B1MA 4NHLA 1YIPA 2ZZJA 2MHFA 1LGCA 5LATA 1BEV3 3WUDA 4SBVA 2D93A 1Q5OA 4TYSA 4YM0A 1QOTA 2BU9A 1LU1A 3UGFA 3UKTA 2HH9A 4JQRA 1YFUA 3DEMA 4XF3A 3AP6A 3HAGA 1AR72 4IEYA 2XKOA 3FE5A 1UYYA 5FYYA 4AI0A 4Z2WA 4D94A 2WT0A 3OBRA 2BV4A 4LO8A 4M3CB 1ULDA 4PHZA 3TEWA 1ZBA2 1DCSA 1GZCA 4CDQA 3FUOA 2GU9A 4LKSA 2UU8A 4WVWA 1OVSA 1ZX5A 3WDWA 5FZOA 3CJIA 3RMYA 1AHSA 1GOHA 2DFCA 2V5YA 3NV3A 4BQXA 4QPIB 1DYKA 1MEC3 4YNIA 3S6PA 3L2YA 1IHMA 2MEV2 5CAZA 4LBJA 3LAGA 1Q8OA 2Z42A 5DABA 2DVFA 5HXMA 5FZ0A 1CD3G 4EN7B 2ZGLA 4LBLA 4DIQA 4GWIA 1JZ2A 1EUTA 2ZGTA 2JECA 4YVWC 4BZ4A 5DAQA 5ABJA 1IQAA 4QGLA 1RMU2 4FPKA 1OUXA 4AOCA 1GWLA 1ZNPA 3WCRA 1FOD2 3BPSA 4AEDA 3PURA 4XBNA 4A3ZA 1GZWB 1WGPA 2CYFA 2RE9A 4FFHA 5C8WA 4GH4B 4OMCA 1FATA 1S0BA 1O4TA 3WNKA 3M4FA 1OA3A 2DTWA 2CGOA 1R1A2 2PHRA 4D7YA 1C8NA 3H42B 1Q8VA 4C1WA 2W94A 2XDVA 4Q4X2 1C4RA 3RZHA 1KD7A 3VHRA 1EY2A 2HLEA 2RG4A 1DZTA 5FDBA 1ND3C 3WQBA 5T5PA 2YC4A 3B9CA 5AFBA 1LOBA 1QEXA 4NMIA 2VBPA 4RS5A 2B5HA 2A71A 2BNOA 3MIFA 3POFA 4PT6A 1W9YA 3SQOA 1CX1A 1SLBA 1OQ1A 2A6WA 4F8AA 4GB33 5J36A 3WLUA 5FY5A 1PO11 4CDWC 4LXLA 1X9PA 3WXPA 2DF7A 2JKXA 3VBRB 4OHYA 4A42A 4NO4A 2PLV2 3RRDA 4CEYB 4TTGA 2BVBA 3WF4A 3T09A 3PVNA 4XEZA 5JSOA 3JCIA 4F83A 2VNGA 2FDFA 3OJBA 4NIDA 1GNHA 2GP3A 3ZFGA 2V09A 2V5DA 2VZTA 1ZRCA 4KMQA 1CPMA 3LOIA 5A32A 3GZAA 3AKTA 4B7KA 1S1AA 3ZO0B 1W8TA 2OKXA 1N3QA 4PIZA 1UOFA 5FCCA 5I91A 3VL9A 4OHXA 2VMIA 1TE1B 5IK4A 3FUQA 3CDZB 3DKQA 5BNNC 5FO9B 4Y22A 2JE8A 1TMF2 2XVLA 5E88A 1NG0A 3QACA 4FAHA 4PQQA 2VBBA 4Y1UA 5AVAA 3EYPA 3D5OA 2WL1A 4FSJA 3ZFGC 1PK6B 1YFXA 2PELA 3OD0A 1W0OA 1HV0A 4XMAA 2KD7A 4L11A 1D4M2 2Q1MA 4I0WB 2DU0A 4EN0A 2VQAA 1UNBA 3B02A 1VRBA 2IC1A 2XG3A 3C7HA 3N7JA 3OOXA 4MUVA 5A7PA 4XIOA 4LJHA 3SCFA 4QB6A 2P4EA 1JN2P 1QGLA 1SCRA 1XYNA 5ISLA 1XXNA 3I97A 1MZ5A 2W08A 3A21A 4PJYA 3ATGA 5JUVA 1UOGA 3NAPB 4Y24A 3RWKX 3RZLA 4Q4Y1 1W28A 5F6KA 3HBZA 5IWFA 1PGL2 1ASJ2 1W9FA 2ZEYA 3I3EA 4KU7A 2QNKA 5CFCC 4GA9A 5DZGA 1CZTA 5E89A 1B35B 4AE2A 2HWF2 3BTYA 1OH4A 3ZXGA 2RS11 2YGLA 3DKWA 4YM3A 1AL0G 3V56A 2CWSA 1NUKA 1S55A 5C3PA 1VBA3 1GFF2 2QUOA 3E5QA 3FZ3A 4X6QB 4GKXA 2XPJA 1UF2C 3NAPC 1K5MC 4LR4A 2Q8CA 3WOGA 3LEIA 4MV2A 4MX3A 4YLZA 2NN8A 3IBMA 1CR7A 5BPXA 2NZ9A 4E8CA 1OA4A 4FOWA 1QJU2 4CCMA 3HN3A 2JJ6A 3TNPB 3PNAA 4UYBA 4L97A 3TRSB 5A3TA 2ZHLA 3VD4A 2WA3A 4CA9A 2JXAA 2H0VA 3RYPA 3J8F1 5LBFA 2ADDA 1SACA 3Q8AA 2VMFA 1DLLA 1OF3A 2XQRA 1J1TA 2B8MA 4YW7A 2VU9A 4AVBA 3VDAA 2FZ2A 2WBKA 5BNPC 3LPGA 2IFWA 5L9BA 3OYWB 5FZ9A 1XSRA 3NVCA 4QHOA 3ZFFA 4AQSA 4YYOA 1US3A 2AGSA 2PQSA 3ROUA 3VDCA 4FOQA 1D0GA 1ZYBA 2VCMA 5FBJA 2A70A 4FP2A 3LFMA 4LOTA 2VVDA 2WUHA 3OUJA 5A32B 3T2QA 2HBTA 5A3UA 2WZR1 3IT8A 1CESA 4Y20A 5DUXA 2FQPA 1RVF2 2QCSB 3LA2A 4BQ4A 4RFRB 2Y6KA 4NHYA 2ENRA 3NJZA 5FZCA 3RI9A 1DLCA 1BLZA 1QJZA 2QDRA 2W1QA 3ZFFC 1NZIA 4AK3A 1O3QA 4X6RB 1QJX1 1NCQC 3I3QA 2YBSA 4DUVA 4EWDA 3IM0A 4MXVA 3AP5A 2UYAA 3CL1A 4FPGA 5IK5A 5BNPB 2PN5A 1JXNA 3HMYA 1F35A 4QB2A 3HJRA 4XZPA 4BU2A 5IK8A 3ZIWA 2VR4A 1S0DA 3A4UA 3EB7A 2YC0A 1UPIA 2Z2SB 4Y1YA 4C0BA 2J1UA 4OVEA 4P9LA 4LBKA 1IQDC 3W21A 4Y1ZA 1C1FA 2A7AA 1O91A 1LR5A 1PMIA 2P6CA 4YWAA 3ZXDA 1TNFA 4Q29A 1AXZA 2XJPA 4ZONA 4Y5SA 4QXCA 1NE6A 1H8TC 3OYWA 1NCQB 2WABA 4YPJA 1BEV1 4ZPIA 3USSA 4FXKB 3ZSMA 2IUWA 5JOXA 1CONA 1JZ7A 1PVC2 4FXGB 3LDKA 4XXAA 2JE9A 5C70A 1RUE2 3OSDA 4MGQA 1JBCA 5A7WB 4NHMA 5IJRA 1QY4A 3QBQA 4EN9B 4XUPA 1WCQA 3T0AA 5EFUA 3C7EA 3V65A 4LQRA 4I09A 5A7SA 5K0UA 5F3CA 1JYWA 1G9DA 4XABA 3ELNA 1AR93 3E6CC 3OBZA 4CDXC 5H9PA 2H6BA 2V73A 3THTA 3MUZ1 4AVVA 1NXD1 5CEHA 4V2VA 4Q4Y3 4FFFA 5C9AB 3UETA 1W2OA 3LFIA 4GD4A 2GC0A 1UL9A 4BLIA 1WCDJ 1O8PA 1RUD3 4FPLA 4J6GA 3AJYA 4LUMA 4PLNA 1LAJA 3ACLA 3JB4C 2XVKA 3BALA 3CJIB 2HWF3 3PMSA 4NAMA 5IVYA 2XL9A 1C8M1 5I8YA 1GBGA 2FCUA 3K4AA 4YW3A 1CAUB 3AMHA 5L9RA 2CGNA 3IPVA 4OCTA 1UD1A 3POBA 3ZR6A 2ZMLA 1J83A 3IPVB 4R9CA 1SBFA 2Q4SA 4B8EA 1WW4A 3DECA 3T30A 4E9KA 5LY2A 5K9YA 5A33A 1LOAA 5J96B 4RFT0 1GOGA 1LGBA 1QJEA 2A5ZA 1IG0A 2W9XA 4XTMA 3TAYA 3U1XA 5JPMB 2HYKA 5FJHA 5FR3A 1HRV3 2BW8A 3IAQA 1A3KA 1AR91 4DRVA 2VBDA 1HXS2 2JDAA 2XVGA 4XILA 1UPSA 1FI2A 3MLLA 1RUI1 2GDFA 2FDHA 1S0IA 2XQXA 1TME3 4BMEA 4BA6A 2QQVA 4Q0SA 3B01A 3TB0A 3ZSKA 1HLCA 1OHFA 5LBCA 1UY4A 2W3JA 4XMIA 5GALA 1BHGA 3BVCA 3MW4A 4L8QA 1UZZA 5KHGA 2BFUS 1AYM1 1PO13 4LKDA 5CG8A 2X5IA 5DG1A 2P5BA 1CQ9A 3RYRA 1Y9MA 3IDAA 4JVAA 4P9XA 1T6GC 1ENQA 1F2NA 1BQPA 1G9FA 1OKOA 1PNGA 5KR7A 1SG3A 2A1XA 2RS13 3HNBM 1XNCA 3WNXA 4OI1A 1UZWA 3URFA 5C5TA 3I49A 4FO9A 4Y1VA 4IEXA 1GV9A 3B00A 5JAXA 4BQWA 5JSRA 4NPLA 4H7MA 3PU8A 3AYEA 1ZRIA 4BHPA 1QJY2 1C5HA 1FMD3 3N9PA 2VZUA 4Z8BA 2ZACA 2R32A 2QE3A 1VLNA 3JUUA 2D7FA 2ZZQA 2CNAA 3PTRB 4U2AA 5CFDA 4I01A 1OC1A 1VJ2A 4CYDA 3J7MA 1OF4A 3ABZA 5EXOA 4CUCA 4GWJA 5CBLA 2DBIA 5T5OA 4TLFA 3ACFA 1RGSA 3J8F2 5FKCA 1JYTA 5F2SA 1HRI2 3GHMA 2AACA 4HMZA 4YGEA 1Y9GA 1RUD1 4B29A 4MG2A 3RSJA 3JB8A 3J7NA 1KGYA 1RITA 3C7GA 5FZ7A 5T5JA 4IEZA 1SFPA 4P00B 1W9SA 4D6RA 2ZEWA 3HBKA 3IIAA 4HN1A 2FCVA 2VUDA 4C8DA 4URAA 3GXUA 2R6QA 1DGLA 3GBWA 2V72A 4D6SA 5A3PA 3O0XA 5EJZB 5LWBA 4KWJA 3VDDC 3V0BB 1V9U2 1UXXX 2DCKA 3WW2A 5CISA 3CIHA 2RS32 1XSQA 4G9SB 3BU7A 4M00A 4CDQC 5BNOB 4D69A 5HPOA 4GH4A 1ZBE3 2VQTA 2ZS6B 2LW8A 2VD7A 2HWD1 5LA9A 5DN2A 3ZPYA 5I0RA 5HV4A 2WLPA 1NZCA 4DZGA 5DUWA 1LHWA 4JTNA 2GMEA 2G1MA 3KCXA 5J48A 2VZVA 4LKEA 1L7RA 3I2DA 1KS5A 4CP9B 2R042 3JU9A 4AFBA 4CP1A 1TME1 3DUIA 1CIYA 1OLRA 3R0RA 4JAAA 4FTEA 1I1EA 2O14A 2UWBA 1NT0A 1FT9A 5C3OA 1BK0A 3VKNA 4DEVA 3WW4A 3UNPA 4LE3A 3X29B 1RUJ2 3WDUA 2JDUA 2DURA 4BK4A 3M70A 4TN7A 2WO2A 2WZEA 1KDMA 1N1SA 1CAVB 4L92A 4AHZA 1PHMA 1QJFA 1SBDA 1AYN1 2EVXA 2YGMA 2ZGSA 4DB5A 2P1BA 1GSLA 4JRLA 4UFJA 1RUC1 1WMFA 1W6OA 1BJQA 1HQLA 2JG9C 2QTWB 2WFF2 4YGBA 1OOPC 2D3PA 4I3PA 4Q4V2 1HRV2 1AL22 1PZ9A 2ZX2A 4HK8A 4KGQA 2ZABA 4UF0B 4XUOA 5F8PA 1RUE3 2J1RA 1MR5A 4WM8B 3LA3A 1S0CA 2RHPA 3D3AA 4B7EA 3J7HA 5A70A 4XJ8A 5C7GA 4K7JA 4NHXA 2W95A 4FVVA 4MGKE 1DQ6A 3POSA 4BXSV 5F32A 3PJQA 3I54A 1D2SA 3NKTA 2P3KA 1FAYA 2EALA 3ZYPA 3M3IA 1AUYA 3POYA 4XJWA 2VOWA 2FDKA 2JICA 1QWRA 1RB8G 1PZ7A 5FP3A 1ZRDA 1W90A 2RM22 1HKDA 1ND3A 2CWMA 4Q4W3 2B39A 3PUAA 3WF1A 3ACHA 2JEMA 2YB7A 1OPMA 2WS93 5FYMA 1BVP1 2HWC1 3ZYFA 1O3SA 4CEWC 4HSJA 2QQJA 1J84A 4KU8A 1XU1A 1OOPB 1Y7BA 1OT5A 3B94A 4OHWA 5E6HA 4TZDA 4HVRA 3MYXA 2X5IC 5JMOA 4NPMA 2AH2A 3CQOA 5FZHA 3WHTA 2X53S 5HBAA 3O14A 1C1LA 1WLTA 2QKDA 2Q8EA 3GBGA 2PLV1 3LEMA 1CAVA 1I5ZA 3HT1A 4GXLA 2D6NA 1HB2A 4L0PA 2B9VA 1GQHA 3VBOB 3AM2A 3WNLA 5KXDA 4B3NA 4HG6B 3BUCA 2BNMA 3I2IA 5JI7A 1RUNA 1U12A 1JZ4A 3AMMA 3IN9A 2BBVA 1V6MA 5CFDC 1CJDA 2BWCA 4LK7A 4IE5A 4QPIA 1XC6A 5G04L 1Z7S1 4FPFA 1TQ5A 2RMU2 3VHPA 3V0AA 4IE0A 5CYYA 4GMP3 4QWNA 3DYMA 1FOD1 1R1ZA 4ASLA 4Z1VA 1S2KA 4KG8A 2JG8C 5EQUA 4RQPB 4W50A 3RWNA 1XE7A 2RJ2A 4HFSA 1LEMA 2ZHNA 3N7MA 3ZN6A 3I2KA 1UMZA 1AJKA 2XLGA 4D8MA 2ZX3A 1HB3A 5AFEA 1H1IA 1DQ4A 1G8WA 4GULA 4NE9A 5A6ZA 1DHKB 2PAEA 1JI6A 3OGSA 3UYJA 4UW6A 5F39A 1VE0A 2F17A 4QPWA 1RHI2 3NV1A 1XNAA 2IXJA 1H1AA 2XBO2 3WR0A 4QU2A 3WV6A 2Y6HA 1WA4A 2AUYA 2WAOA 3AB0A 3F95A 4LO4B 1QQP2 1RHI3 5GLZA 3MPBA 4UT5A 4FP3A 4XZUG 1R091 4HPKB 3R05A 1UKRA 4OQ9A 3SH3A 3HWJA 5K4LA 5JOZA 3H50A 5LW9A 5F6LB 2PHLA 1YFWA 2VMEA 4X8NA 4HOOA 1K3IA 3I8TA 1AZDA 1I3HA 4CU9A 2D3SA 2VAUA 5IUQA 5L7OC 1J3QA 5FZLA 5A7QA 5IVCA 5HV0A 2B42B 2I74A 2PHDA 2XWBB 1VBB1 1EAH2 3AC0A 3M3CA 4EYUA 3CEWA 4R4XA 4XYXA 4Y5Z0 4ZU4A 4AFDA 2ZGNA 1CZVA 5C8CB 3WZ1A 2XUMA 4XQ4A 5FQ0A 5JMCA 5H9SA 1AVBA 2WYSA 3C8XA 3CO2A 3MIGA 1I5PA 2DCJA 3A7QA 3AMNA 3KVAA 3MIBA 2J1TA 3WP6A 5J7MA 2R49A 3H7JA 4NIGA 1AL23 1VBA1 3I2FA 4Y3OA 4DPNA 5FUPA 1HRV1 3MZHA 4D7SA 3O1MA 1SCSA 5JCTA 1Y43B 3KGZA 1SBEA 4CP2A 3VD9A 3PUSA 1Y3TA 2Q1ZB 2QQLA 3LQCA 4CE8A 3SKVA 1Y9QA 3AJZA 4IDZA 1RINA 3O1SA 3IWZA 4W8JA 4FAGA 1DP0A 2AC1A 3O5SA 4GAZA 2JDZA 2R0HA 4UXAA 2G9FA 3GYDA 1VAKA 4LHSA 1V6LA 2X8KA 2XB6C 4FPEA 5FP7A 3G6JB 2WC2A 1ENSA 3PHMA 4Q4Y2 2O0OA 4N53B 2HWD2 2XJVA 3CJXA 4AFAA 5C3RA 4AVAA 1UZ0A 5DPNA 2FHRA 4K21A 4YZ3A 2CU5A 3M7AA 4KBBA 3QH6A 1RUJ3 1AX1A 4GJYA 4GJZA 4LNVA 4QB1A 5F37A 4FTBA 5GLUA 2HWF1 2EF6A 4YZ2A 2R041 2IVJA 1ZZCA 1VBE2 1FPN2 5F1RA 5DUVA 2KA3A 3ENRA 3PJYA 4NAOA 5C8CA 1MS4A 1XJAA 2VL4A 3MHZA 3MDPA 2WZPP 4N43C 3PMEA 4MSVA 3IMMA 4PBOA 3MW3A 4DXSA 4PDWA 4QX5A 5TSWA 4N53C 4XJZA 3I59A 2RMU3 5T5LA 3BGAA 4LITA 1KJRA 2N7GA 3OBTA 5FO8B 1AR63 1DZQA 4GZ9A 4HKLA 5FUIA 2OIIA 4E2GA 5A6YA 3KZ4C 1HXS3 2BOIA 1BMV1 5IW0A 2D6MA 3ZMNA 3B3QE 3TEXA 5CKNA 2AZ5A 3H3UA 3UGHA 5B2GB 4PF1A 3SMHA 1R1A3 2QQUA 1JZ8A 4UOJA 1OFNA 4YRDA 2B4KA 4LUKA 4BDVB 3TOJA 3W58A 4MGZE 1BBT2 3D6EA 1GU3A 3AL5A 2W39A 3FHQA 3VDBA 1LOCA 1UY2A 3P3PA 4K20A 2P3JA 2XONA 4LEJA 3ILNA 3R6SA 4DXZA 1UIKA 4EN6B 4C91A 2E33A 3WG2A 1UYZA 3PUIA 2QQPA 3FBMA 5HCHA 1RUF3 3BU0A 2LUWA 4AGGA 1XRUA 1PM4A 2RR11 1E5SA 5I0DA 1C5IA 2JENA 3SCHA 4XTPA 1R64A 3H8UA 1IPJA 3WG1A 4COZA 1GQGA 4MOAA 1DQ2A 3ZXEA 3W5MA 3FHIB 3HPNA 5EIYB 4XIKA 2CY6A 2XJUA 1B35A 4XF0A 3WG3A 5FZGA 3QCWA 3WF3A 4A7YA 3H8XA 4B4QA 1W6QA 1JS9A 2DU1A 5FXWA 5LB6A 4BK5A 2KM2A 4LTAA 3NMBA 5EJ3A 1W2TA 1J3RA 2HWB1 1YQ5A 1JU4A 3SHRA 5KBFA 3GJBA 3HD8B 5DG2A 4YVWA 2W2IA 2BTVC 3O0WA 3VBUA 1HRI3 3O1PA 3KCYA 2OA2A 3M3QA 5ABJC 3HQXA 2E7TA 1ND2C 1UXZA 2XH6A 4P5HA 5F2WA 3E6DA 2AEZA 3ZKUA 1S0EA 4Y26A 2IZWA 5JPNB 2VNOA 2ARCA 3FLPA 2VW1A 1XQNA 2D6PA 2VH9A 3D0SA 2ZMNA 2XOMA 1KFXL 5CG9A 1DU3D 4IEVA 1Z7S3 3AKQA 4ITCA 3AP7A 1QNWA 2VMHA 5IVEA 1JUIA 3AZVA 3FX3A 5IVFA 5AC91 5FREA 1OXCA 5FJKA 1HXS1 2W1WA 3AYAA 4ONUA 2PHUA 4AEDB 4P5YA 4IESA 4NOTA 1FNZA 4XFIA 1GANA 5BNPA 5BV6A 3VBRC 1QXJA 2PLV3 4GB31 4MYEA 1MVEA 4DS0A 3U4XA 5I8SA 1C8M2 2JDMA 1W8FA 1NA1A 3DF0A 4AI1A 1VBB2 2EAAA 4RA0A 1O59A 1LENA 1F15A 2P17A 1V6IA 2BDRA 2VZOA 2R072 3U11A 2XUEA 3NKGA 1W6OB 5JXJA 1AR83 2I45A 2XJQA 3OEAA 1N1YA 4YGCA 4IE6A 4MLOA 1WMDA 1JYCA 2EA7A 2CV6A 1XYOA 2JDPA 5LCWL 2QZ3A 3VBHB 1MZ6A 1RUE1 4QD2A 2HWE1 4QQHA 3WY6A 2R061 4LIUA 4M4RA 3TN92 3D0JA 4FOYA 3M3OA 2IXHA 2WNEA 4GIQA 5FZ4A 3WNMA 4QPGA 3ZSLA 5I93A 1EAH1 2GMMA 1ZZBA 3S7EA 3VBSA 1G9BA 3U0ZA 3CBNA 3WD5A 4FPHA 1NX9A 4QXHA 3FN9A 4FQ4A 4RHV3 1ZZ9A 1NQDA 3CKHA 2EXHA 1PIV1 2XL7A 1ND3B 3MICA 3SCGA 3KV4A 3ZYBA 3A0KA 2A73B 4BPZA 2BERA 1RXGA 2GZWA 2GN3A 4CCDA 1VBC3 3HNMA 5FXXA 1FMD1 2C4XA 3MV01 3IDBB 4COUA 1NLRA 2NP0A 4MGSA 2IXLA 1RUF1 4PIXA 2J1VA 5GZEA 4PLOA 3O1VA 2JG8A 2BYVE 2WNUC 4IERA 2KR2A 1GOFA 5FO7B 4B4RA 1ODNA 3JD72 4K1ZA 1VB4A 1AL21 2EXJA 2VECA 4L2NA 2Q0AA 2YPDA 5CA6A 1G9CA 5D8AC 3PU3A 1BK1A 1B35C 1GP6A 2E31A 4KH9A 1QKQA 1X9TA 2GAUA 3T2OA 5CZKA 3T3YA 2GNDA 2RVAA 2VZPA 1G86A 3OPZA 3MFCA 3THPA 3AZWA 4JTOA 4MZUA 3OD4A 5JOYA 4QGNA 4RD7A 4RGGA 5DXDA 3B93A 3DCQA 2P34A 5CB7A 5GLTA 3RI8A 5FYZA 3VKLA 1U0AA 4QXBA 1BXHA 1UY0A 4KWLA 2JIGA 3RYKA 2BJSA 3WVJA 1AR62 5DAWA 1VBC1 3EBRA 2CSGA 2O8QA 3KMHA 2VO5A 1AYN2 3NO8A 3VKFC 4YFWA 1EV11 3MV11 1W3VA 2XR4A 3VKMA 4UFKA 5FZFA 2K2SA 3KB5A 4TLGA 4YW6A 3OY8B 1O5LA 1ODMA 3MFAA 4ATFA 2D43A 3CF6E 1NKGA 1UMIA 1UYPA 5FZEA 2Y0OA 1MS5A 1ND2A 5E1RA 4ES9A 5C4WB 4KI5M 3I3MA 1H9PA 1HQNA 2W92A 4YG6A 4W4ZA 1TMF1 3VGIA 2HWB3 1ACCA 2WO1A 3HN1A 1JOBA 2VUAA 4GB32 4NN0A 2VTFA 1IKQA 4OFGA 4XFFA 2Q5TA 4C0HA 5IYYA 5JVVA 1Q3EA 1Z7S2 1KJLA 1DF0A 1DYOA 1NY72 4P9JA 4IW3A 1AR81 3NV4A 4I02A 5FV3A 3KQ4B 1UX6A 3VZNA 4AW7A 1OLMA 2RJLA 3KCCA 4S2DA 4YGDA 5C71A 4GWMA 5IFPA 2G19A 4NIIA 1IOAA 1VBD2 1K42A 2FMYA 3DPRC 3SKJE 1YC61 2WFF1 3BOWA 5ABJB 4PBPA 4GMP1 1N1VA 2VVFA 2R1DA 2WQ4A 1N47A 2OW4A 4QPGB 4EJRA 3VV1A 2DVAA 5FZ3A 3UL2A 1E5RA 3VBRA 3BYWA 4QQ2A 1YRZA 3E97A 4UWDA 3OUHA 1W39A 2ZGKA 2WQ8A 3R4SA 2WT1A 1V6OA 1T2XA 5KHHA 2SLIA 4AYUA 2BEOA 3BN6A 4QQLA 3ZDSA 1JOPA 3ECQA 4H55A 3MIEA 5LASA 4AEJA 3WNNA 2VCAA 1LKNA 3NJVA 1WZXA 2NPIA 1L7LA 2OVUA 2H6CA 4GH4C 4YW4A 3S5QA 3VD7A 3AP9A 4CU7A 1JHJA 4D7TA 4NIHA 4WBBA 5CKMA 4BQ1A 1YYNA 3FFZA 2D5FA 2QZ2A 2GNTA 4DUWA 3I7DA 2JD4A 3A0NA 2Q8OA 2ZA9A 4S2FA 4N9HA 1E5HA 3AXEA 2R16A 1CGPA 4W65A 4TWTA 3I2GA 1N1TA 1YJLA 4HXCA 4LOSA 4CP9A 3I3DA 4FCAA 4K9SA 4FTSA 2P3YA 2TNFA 3M3EA 3ZXKA 1YCIA 3PVBB 2YMZA 3RZKA 1SZBA 1K5MA 5A80A 2Q30A 4CXWA 4P9YA 1ZZ8A 4XBLA 1RUJ1 1S4CA 2EIBA 4W6YA 1VB2A 2HWE3 3AYCA 2IFRA 5L9VA 1GWMA 4CDXA 3PUQA 2D98A 2DVGA 4BB3A 5A3WA 1VBD1 3LIGA 5C6CA 1YQ6A 1BYHA 4Y4YA 2WYFA 3WG4A 4O7XA 2BUKA 4UW5A 5FYVA 1IS6A 3DXTA 1OI6A 5A1LA 4LK6A 1UOJA 3I2HA 2XXZA 3K4DA 2FBEA 2WKKA 4XUQA 1ZRFA 1ASJ1 1DG6A 3ZYHA 4Z2AA 3CLPA 1HB4A 5FYSA 4LHLA 3I2OA 2NM1A 1F4AA 3POWA 2ZX4A 1CAUA 3KHCA 1RUOA 2VUCA 3VHNA 1GP5A 1AXYA 2FZ1A 3HQRA 3CZJA 1O7FA 5CIRA 4AEDC 1BEV2 3VBUB 5AC93 3DV8A 4IL7A 5J09A 2X09A 2NYYA 1ZBA1 4M3CF 3NJYA 5KHJA 1WCKA 2WR9A 3Q8FA 4EWAA 4Q2FA 2WRAA 1O4ZA 1EYBA 1HX6A 1U5XA 2D97A 2WNVA 3GZEA 3VBOC 4DINB 4BCUA 1UX7A 2DCYA 2LALA 4D0QA 1GP4A 4WM7C 5C9AC 3EJKA 2J7MA 3SH5A 5DAXA 5KHIA 2W91A 1OKQA 3GNEA 4MGTA 5T3NA 2XMLA 1RVF3 4DUXA 4N90A 1IS5A 5A7WA 1QQP3 3SH4A 2W46A 2CGPA 1ASJ3 1FXZA 1MEC2 1YQCA 3AMPA 1PMHX 2WAAA 1NYWA 4EN8B 4CCNA 3IDEA 1W8NA 3ZYGA 2Z79A 4Z92B 1RUF2 1G7YA 3R4UA 1R092 1U5IA 5B4XA 3SXWA 3NNLA 3LCPA 3OGJA 2D6LX 2P6HA 3FHAA 3V64A 2WINB 4QT6A 4AI8A 1LU2A 3I59B 5FZBA 1DZRA 4LO6B 1CAWA 1RUG2 4XHBA 3THDA 1VIWB 4XC9A 1W6PB 5J37A 2I2SA 4QM9A 4AHWA 1OVPA 2DVDA 1TZOA 2Y26A 4V1PA 4ISRA 4URTA 1RUG3 2OZ6A 2QJVA 1Z78A 4A7ZA 4XDQA 4ORFA 5KXCA 2AYHA 2PQQA 2Y34A 4XW3A 1C57A 4HKOA 5JZGC 2R0FA 2Y38A 5D21A 1VMHA 2BVVA 1MEC1 5FMOS 3L2HA 4TSVA 3LKJA 4XUTA 1GR3A 1KS4A 2YPJA 4AHYA 1PGW1 3ZVXA 4UFMA 1RC6A 2P2KA 4M0HA 5EPAA 2WWJA 4OMDA 5IATA 4XFGA 4Y20B 5F3GA 3F2ZA 1JHNA 4YFZA 1H4GA 1SHWB 4YZ1A 3DGTA 3H8RA 1V9U3 3K4ZA 2GC2A 3ETQA 1W0PA 4HONA 4NPRA 1IZ3A 5DUUA 1NE4A 5JZGB 4E2QA 2YG0A 1RTVA 3VZOA 3VZKA 4JZRA 4IQPA 1IPSA 5L36A 4H7LA 1TNRA 4JKMA 2B45X 1G6NA 3POGA 2RS51 2JG8B 4NROA 1T6BX 2HWD3 3KHBA 1LODA 3WNOA 2EIGA 4KGGA 4CEYC 1MQTC 3WDXA 1N3OA 1S2EA 4NRPA 4YM2A 2KXLA 2RR12 2WS92 1QIQA 5JR7B 4EQVA 3NV2A 1R083 3MUY1 4JRAA 4LBNA 3M2MA 4UBHA 5BY5A 1IKPA 1QXRA 3LDRA 1K45A 1REFA 3P5BA 3ON7A 5CVRA 4F3JA 1PK6A 1LHNA 2DWRA 2MPFA 3DL3A 4YVSB 2XWJB 3LWCA 2JDHA 3U75A 3ACGA 3BIEA 2WNVB 3MF9A 1ZVFA 1BBT1 3RZJA 2VOKA 1TMF3 5E8AA 4A44A 2WNUB 4F7ZA 4JGYB 4OI4A 4KG0A 3ZM8A 1L3JA 3SEPA 4CZSA 5DDJ2 4JC1A 1CWPA 5GZDA 2VMDA 4A3XA 4AG4A 2OS2A 4LE4A 5HI0A 2RJKA 4E4ZA 1W06A 5EV7A 4NVPA 5JIAA 1H2MA 3KV6A 5DDJ3 4BQ3A 1SFYA 1LGNA 4CCJA 4CU6A 5C5UA 5F7UA 4IV3B 3RJ2X 3ZN5A 4Y4RA 3M8LA 2IVIB 4NR1A 1STMA 3CHXA 1YI9A 4FQZA 1QOSA 4LHKA 4BJ0A 1UAIA 4GWNA 2DVBA 4AR2A 2RDRA 2WNVC 4YW1A 3D82A 3FBYA 4XFCA 3UKVA 4AZZA 1N3PA 1OH3A 2BZDA 5FMCA 4ES8A 1F8VA 2W68A 1YQ2A 4CUGA 1UY3A 3SITA 4Q4W2 3C2UA 4YG0A 4B1LA 1PGL1 1ENRA 2BP6A 4DXTA 4FBFA 4P9WA 5T55A 3K3OA 5FLJA 3TEYA 4QX7A 1QJU1 4COYA 2Y60A 2A3YA 2LTNA 1H0BA 2UWAA 3PUHA 2RS12 3ZXLA 4CEWA 3AL6A 1V9U1 5FY0A 1H2NA 1X36A 3VBFC 1MACA 4OHVA 5G05L 2C6SA 1AYM2 3RZMA 2BBAA 4HANA 3VBSB 3WP5A 2QQIA 2YROA 4XDOA 4XF1A 5A3NA 4NRMA 5FZOB 1FYUA 2YHJA 5H9QA 1PX4A 5LBBA 3T0BA 4AEKA 4D6QA 4LBQA 3USUB 2JG9B 4RR3C 1APNA 3LOBA 5FPLA 2YC2A 1X8EA 2FCTA 2VZQA 1WW7A 4XQDA 1ONAA 2VC9A 4H3WA 2VZ3A 3HIFA 5JXGA 2GNBA 2W52A 2YBPA 3OB8A 2A6ZA 3OBAA 1YWKA 3Q8EA 3LGRA 5FIXA 3VBSC 1G9AA 1MS8A 2WSVA 3KGLA 4JGYA 3C7FA 2X29A 4K8FA 4Y5TA 5M0TA 5JXHA 1JYXA 4R52A 1XNBA 1KXGA 4AQ2A 1GNYA 1WBFA 2ILMA 4XCAA 5JI9A 2XLFA 2R063 4MADA 3VUOA 4KL1A 2HWB2 4L99A 2BFUL 4RR3B 2A6YA 4YG3A 1ZA4A 1XU2A 2RS33 5I0TA 2VE1A 4QKFA 3UKNA 2C1FA 2F4LA 5FKBA 1JH5A 1LJ7A 1I6XA 1Q8SA 2ZX0A 3N3HA 3H1MA 1O3TA 4XQWA 2DFBA 4DFSA 4CDWB 4MH0E 3PL0A 4OHZA 1RIRA 3T4HB 4QHBA 1WBLA 4ASMB 1XOYA 4AHXA 4LULA 3CJIC 5FPBA 3MGUA 2J1AA 3HVDA 2C24A 3IKWA 4I0AA 3FWEA 5A6QA 3O1OA 3WQ7A 4A2UA 3EMRA 1QXPA 1ALYA 2X05A 5FMOL 1SPPB 4HN0A 1WW5A 2YV8A 1AJOA 1UU5A 5IVVA 2G9GA 2V4AA 4PI0A 3GALA 4XACA 3G7DA 5A3OA 3OTFA 3NNJA 3POJA 2GNMA 1IG3A 3RVHA 3MEPA 4ZZ5A 3BB6A 4Y22B 3ZYRA 4IE4A 1PVC3 4IXLA 5F3EA 2WQZC 2E63A 4RQPC 1GWKA 3CNAA 4O9EA 4QKBA 3AKPA 2VG9A 2J42A 3A23A 2WFF3 5FYHA 1L7QA 3KV5A 3VD3A 1WD3A 5DDJ1 5GKAC 4IGPA 1AX2A 1Q8QA 2IXKA 4PCRA 1S0JA 1GNZA 1YI7A 2IXIA 2LM3A 2VJXA 2Z5WA 1WLCA 3JXSA 3MO4A 1LNSA 5FOBB 3DYPA 3SC7X 3O1RA 2JG9A 3QH7A 3WSOA 2EAKA 5BNQA 1BVVA 2VZSA 3HR9A 3MW2A 3E5XA 3HQUA 1BBT3 2DYCA 2JDYA 1NCRB 3KVBA 4KQ7A 4KWUA 3O1TA 3AZYA 1NA1B 2G4IA 3L9JT 1E57A 4XFBA 2ZBJA 1ZZ7A 4CDUC 1ENXA 1S0GA 1SFNA 3O12A 1O3RA 3JBG2 4Z07A 4QX0A 2WWUA 2WJSA 4QPYA 4Z82A 4XJ9A 1W8HA 1MPXA 4CPBA 1VPHA 2VNVA 1ULCA 5D1IA 2RDQA 3GHNA 3H0OA 1UOBA 1JOJA 2XBO1 2FDJA 1KQRA 3ZPOA 3AVRA 3ES1A 3MIDA 3ACIA 5FPVA 3IIIA 1HJGA 1QQP1 2XJTA 3KM5A 2GH2A 1VBA2 3ALQA 1POQA 1XB9A 3POEA 4FFGA 5L73A 1DGRN 1SLCA 3VBFA 4XJUA 4PIYA 3IDCB 4E2SA 4K3UA 2ZGRA 4N9IA 1E5IA 1QJU3 4CDUB 1NCQA 1J58A 4AEMA 4DMIA 1NA1C 3GCWA 1BKZA 4ZXKA 4XAAA 1RUI3 2HKXA 5ACA2 3NW4A 5FLIA 3WP3A 4Q4X3 5A3MA 4E8DA 3VBHA 4FPYA 1UMHA 1GZTA 2EXIA 2GH8A 3NWKA 5FQ0B 5FUNA 3AX4A 4C90A 4J1XA 4JQTA 3ZMOA 2NMOA 3GM8A 1JMUB 4AL9A 4ISQA 1BZWA 1PIV2 3RS6A 1KEXA 3I3BA 1M06G 2GC1A 2RMU1 3VDDA 2AEYA 4CCEA 1OD5A 1W2NA 1YHFA 5FY9A 1IPKA 3U10A 4JGYC 1HW5A 3APBA 1RMU1 3PVEA 5EWSA 1LHOA 3AFKA 1AR73 2NQYA 1SPPA 1UCXA 3K2OA 4ZKTB 5DAPA 3WW1A 4M3CA 1REDA 2UY8A 2E6VA 3H3ZA 1W8ZA 4R9BA 2R1BA 3ZXAC 2VULA 3WP4A 3GCXA 2R043 2X5IB 2PYTA 3NNGA 3INAA 3U4SA 3VKOA 1SDDB 4BWOA 1YO8A 3ZFEA 3Q8CA 3UJOA 1PO21 4DOUA 1DGRA 1CVNA 1K5MB 1WLWA 1O8SA 2VCBA 4N8MA 4CRQA 1C8M3 2Q1FA 3ILFA 3NSTA 2NMNA 3NJXA 1OFSA 3ETPA 5FK7A 4LBMA 5FYTA 1UY1A 3LDBA 4IV1B 1UKGA 4CEYA 4LBOA 2H0BA 1CZSA 2VPVA 1W8OA 4GALA 5D8AB 4RS5C 4AI3A 3MIHA 4COVA 2PHWA 2D6OX 2QQMA 3T4VA 1PK6C 2J1EA 2GN7A 1YEWA 5FZMA 1OLME 1PVC1 2HEWF 4WV8A 5T52A 2VTXJ 4OUEA 5CU1A 5LRRA 1C3HA 1ZBE2 4BQYA 4ZU7A 5ACA1 2HEYF 3WF0A 4YW5A 2VXRA 1J59A 3VHOA 4QAWA 4LKFA 5D2AA 1V00A 3H1YA 2UYBA 3JBG1 4JCKA 4C1XA 4U36A 3RDIA 1GZ9A 1K5JA 1HV1A 4COWA 5KWRA 4AAXA 1OBNA 1SLLA 4Q5OA 4LLOA 5LA1A 4WZFA 3RZGA 1FV2A 3E1F1 5FWJA 3KF5A 1H1MA 1CJPA 1H30A 4N43A 4LIVA 4RGKA 2Y0IA 4XURA 5EZWA 1VRH2 2VOVA 2K0GA 3QD6A 1F31A 2HWC3 1PGSA 4I3GA 1RUD2 4PDWC 1OD3A 4CSWA 3WDYA 1DBNA 1QU0A 2WSUA 4DY3A 2ES3A 2VM9A 3KD4A 2VMCA 4INDA 1MS0A 4XF4A 1SLAA 1VR3A 2WN2A 2Y8KA 1JU3A 1CPNA 2E53A 2VGDA 2XKPA 5J1XA 1YLLA 1QF3A 2RV9A 5L7OB 5FYBA 4OULA 5FZ8A 1PO23 2VCCA 1UN1A 1JW6A 3CMGA 4O65A 4TXWA 1QJY1 2VTXA 3T08A 3NNMA 4YZ5A 1EAH3 2VZRA 2DUOA 5JXIA 5DZFA 2BGCA 3TN93 3BOPA 4J1WA 3VBHC 3DPRB 5F5AA 4QX3A 2PA7A 5LBEA 5JR2A 4IV3A 3N7KA 3P1IA 4WVVA 2PFWA 2YBKA 4HVQA 2CAUA 1OPOA 2ORXA 2XJRA 3ZSJA 1AF9A 4PDWB 3KLSA 4A6SA 3EXUA 4NUBA 4P9GA 5KC5A 1BMV2 4O61A 1EPWA 1W6NA 4HPKA 2GC3A 1V70A 2WNUA 5ANQA 1F4HA 1D4M3 2Z69A 1VMFA 5FY1A 2JB4A 4DQAA 2O1QA 2C0ZA 3AP4A 3KQRA 4MGIE 4YW2A 3ZXFA 1TME2 2DV9A 4Q27A 2ZOEB 4AFCA 4DY5A 4CXXA 3JD73 3NAPA 4D3WA 3JBG3 1D0HA 1ZBA3 3J26N 5FMBA 4HK9A 1HDKA 1WD4A 1TEIA 2I07B 2JKBA 1LHUA 4KNCA 4Q1RA 3D8CA 2WIIB 2QBXA 4JGZB 5APAA 2ZXQA 1CN1A 5KXEA 5L7OA 5LA0A 2P37A 2NLRA 4HT1T 4AF9A 2VUJA 1QMJA 1AR61 1VP6A 3J4UH 2ZAHA 4J25A 2W5FA 1GQPA 1LEDA 1V6JA 1ZBE1 4RQPA 4BM8A 1F5JA 1PMJX 2C9AA 5A1FA 4AWDA 1UYXA 4QQPA 1VBE1 5C3SA 1OA2A 1OSGA 4YVSC 1NXMA 1OURA 3AKSA 1NLQA 5CFCA 2LRPA 3K3NA 3ZYJB 1RUH1 4LA2A 4OZOA 4N43B 2FMDA 1Y4WA 4OZXA 3N36A 2BWAA 1UW8A 2Y6JA 5HCAA 1SDWA 2W1SA 1ULEA 2RS31 2F6BA 2ZHKA 5FTTC 5SV5A 3ZFEB 2WWSA 1X50A 4RHV1 2AR6A 3B69A 3ZFGB 4X8PA 4Q8KA 2J1SA 2QQNA 4JGZC 4P08A 3S5AA 2DUQA 4EROA 1W03A 5GZCA 3JQXA 4RN5A 3OGVA 5H9RA 3UT0A 4ET7A 2ZGPA 1JYNA 4LT5A 5I0SA 1SQ4A 3Q8BA 2Y6LA 2QDNA 4LBQB 3USUA 3FJSA 3W20A 1HQWA 2ARXA 3OGGA 1YIFA 5ERLA 2DUPA 5JWPA 2E51A 4W6WA 5GJ6A 3UV9A 2ZGUA 4GMP0 4BQ5A 4AVCA 4FFIA 4QPIC 4GQ7A 3WQ1A 1W3XA 3VZMA 1SEFA 2YU2A 1I9RA 1FMD2 2OQ7A 3AZZA 3HOBA 4EZ4A 4HETA 4CU8A 1H9WA 4G3YC 1RYYA 4DNYA 4QPGC 2RDNA 2JD9A 3RFRA 3S57A 4YSFA 5F5QA 2ATFA 4ARXA 4H2AA 4IUGA 1GLHA 1PNFA 4RGAA 2D44A 5EHDA 3PDQA 4N7UA 1LCLA 2W1UA 1TVGA 5EJ1B 3V0BA 2XJSA 1OQDA 1MS1A 1PO22 2A3WA 2YYOA 4OI0A 3J9SA 2C26A 1M4WA 4A41A 1A8MA 1KITA 4R9AA 2RDSA 5FBZA 5B4NA 2VW0A 4Q0UA 1X82A 1XBFA 2XGXA 3N9NA 3UESA 2OT7A 5CKQA 4A6OA 3IB3A 3V0AB 2DTYA 4CCOA 5FOJB 2CHHA 1MVQA 1GMMA 1X33A 4UF0A 3T1LA 4E27A 2RM21 1RHI1 1JODA 1JYIA 5LK7B 1PGW2 1V6NA 4WM8A 4AAPA 1F5FA 2XHKA 2E32A 2ZPXA 4OUMA 5BNOC 2E7QA 4M4PA 1LTEA 2JX9A 2UWCA 5EP9A 2UURA 5T50A 2WZR3 2WO7A 1VMJA 4LLFA 2CDOA 4OUSA 3K46A 1H8TA 2D5HA 2HWC2
chains in the Genus database with same CATH topology
2ET7A 5CFCB 2WZR2 4YZ4A 5SV8A 3UK9A 5EYYA 1LECA 2RM23 1FX5A 1DQ1A 2ZJCA 1AR71 2ET1A 2QFEA 2YDEA 3VL8A 1F9KA 1FV3A 1VBE3 1CAXA 1ZREA 4MGYE 1H4HA 1X8MA 4R4ZA 1COV3 3WP5A 5LEJA 1AYM3 4QM8A 3AKRA 1RVF1 3O0VA 3FFQA 1NOVA 5LRSA 2ZHMA 4Q0VA 5K8SA 3B9IA 1W2UA 4AVTA 1MS3A 4JGZA 3U07A 1RJ7A 2F4PA 4BE3A 2ZCWA 3FLTA 3AFGA 4HBNA 5ACA3 3KT7A 3VZLA 3UJQA 3LB9A 1WUVA 4PF5A 4PQ9A 4L9BA 3MPPG 3TYJA 1MZEA 4M0NA 4R9DA 5JDBA 1YFYA 1PIV3 3TWIA 4FPCA 3PLQA 4WM7A 5C9AA 3LSEA 3I4IA 3N35A 3SNMA 1QJY3 1RUG1 2A3XA 3B7MA 2OUJA 3BTAA 2WFPA 4G4FA 1RUH2 2CL2A 2VOXA 2GSYA 1C28A 4UW4A 1X7NA 4EV0A 5HXVA 4XFAA 1OMIA 2A6VA 1NY71 2QVSB 1UZYA 1QH7A 5JZGA 2B46X 4CDWA 1IGOA 2OZJA 2VMGA 2BNNA 3H7YA 5GLVA 3K48A 1XE8A 1FOD3 3QLQA 3RPQA 2ZAAA 4RL7A 2D40A 4N7IA 4Q4X1 1H8TB 2VY0A 4OI2A 3K51A 3BPZA 1R1A1 3JZVA 5KHKA 4LO5B 1FPN1 3LZZA 3S0MA 1RL3A 3OY8A 4K1YA 4ZU5A 2ZTNA 1WCSA 3MLKA 4XHXA 4FTSA 4RHV2 4WM7B 5C9AB 1CIWA 5A33B 2C5DA 4S2GA 4RSUA 2XBO3 1POV0 1LOFC 4KWKA 1D4M1 2P3IA 4SLIA 4WZCA 3E6BA 4YVSA 5I0UA 3MF6A 4YM1A 5K0UC 3ZIXA 4XETA 1JTZX 4XJAA 1J3PA 1VBD3 4BLJA 4LHNA 1MQTB 1VRH3 1S2BA 5CADA 1HRI1 2PAMA 4BH9A 5FPXA 1QHDA 2GALA 3ME2A 4JV4A 1QH6A 1LOFA 3QOPA 4WVMB 4I0BA 1A8DA 3BIWE 1MS9A 1ZM1A 5C4WA 3E5UA 1O4YA 4IEQA 1ZRRA 3N7LA 4Q4V3 1LHVA 2PHXA 1DGWA 3C3VA 4AGVA 2BPA2 1LOEA 1VAMA 2WA4A 1VRH1 1CAXB 3TNQA 1AYN3 2OPKA 4Q1PA 3ES4A 3ZN6B 4Q0PA 4AQ6A 2PHFA 2VNRA 2ZX1A 4QXKA 5GZFA 3T2TA 4NWWA 2O8OA 4AQTA 4GKYA 5C4WC 3AXDA 2CTVA 3OCPA 1DQ0A 4AI2A 3ZSEA 1AR92 5A3LA 2BQPA 3KS7A 1VAVA 4HZFA 1OOPA 2DCZA 1Q43A 1H8VA 1AXKA 2CAVA 1HIXA 1PO12 5E16A 3W9AA 1Z0HA 1URXA 1IS4A 4FPOB 5FPZA 2WS91 1W6MA 3WHUA 2HWE2 3ST7A 1KRIA 5K7PA 4FPJA 1A6CA 4I30A 5BUVA 1BCXA 3WDVA 4IETA 5J3UA 4M01A 4Y1XA 1R093 1QJX3 2ZKLA 4BIFA 2RS52 1VALA 4Q4W1 4MVTA 4XFHA 4S2HA 2YXSA 4YARA 2HEVF 1QJX2 4Q26A 4AGRA 1CAWB 4LBQD 5C8CC 1A78A 3WDTA 4MXWB 3FMGA 4HL0A 5GM0A 1DDLA 2A6XA 1ND2B 1SLIA 4RR3A 4BIOA 3RQ0A 4IV3C 1Q8PA 3VDDB 5BYNA 3O7OA 1J1LA 1MQTA 2PHTA 1DQ5A 3NL1A 1EV12 1RJ8A 1D4VB 2AENA 3GBFA 3FLRA 1QDCA 4W6XA 2R062 4YVWB 1H2KA 3RZZA 1V6KA 4IEPA 4E4SA 3EO6A 2MNGA 5KXBA 2TEPA 1EV13 2ZGOA 4FT8A 4Q0QA 5EYXA 5GZGA 3VN4A 1WW6A 3AZXA 2OYZA 2R071 1XNDA 3CU7A 2D6KA 1GKBA 4M3CE 3WINE 4BYYA 5BNOA 1QDOA 5BXXA 1PM7A 2YUEA 3VZJA 1VBB3 1FPN3 2TUNA 5CNAA 4MXWA 3JD71 2K9ZA 1COV1 5FLHA 1AX0A 4LA3A 2B9UA 2EXKA 2R073 3FC0A 3R4DB 1U5ZA 1PZ8A 3M1HA 4CTEA 2WLQA 4AXOA 3BCWA 4AVSA 4EWEA 3ZXJA 3ZX7A 4A7KA 2ERFA 2YY1A 5FRAA 1UIJA 4NWVA 5DZEA 2ETEA 3VBUC 4WVZA 4K6BA 1RUC2 5IT6A 1W6MB 1GICA 3TBDA 5F9TA 2IWGB 2W0XA 3RG0A 4Q4V1 5IK7A 3TN91 1POV3 1REEA 1RUC3 4XXPA 4DRRA 1IS3A 5LK5A 1B09A 4HLTA 3ZN4A 2R30A 1W6NB 3H9AA 3PVOA 3RMXA 3ZFFB 3GZUC 4XBQA 5BNNA 3WX5A 1OLQA 3GZTB 3D4KA 4N53A 3IMNA 4XPVA 2E7AA 5J98B 4CDUA 2UY9A 1DYPA 1XNKA 1ULFA 1W6QB 1YXWA 2D3RA 1AR82 4IEWA 5FAXA 1DIWA 3WQ0A 4IEOA 1O5UA 2SBAA 2XLAA 2RS53 1EP0A 2YZ4A 3AYDA 5I8TA 2WT2A 1XYPA 3ZYIB 3W59A 4P14A 3T1MA 4B4PA 1RUI2 4META 4WM8C 4WVMA 5HCBA 2AREA 3EQEA 4UW3A 1NCRA 4IEUA 4XF9A 2OUHA 1QNYA 1ULGA 1DFQA 2IXCA 1QOOA 3DN7A 3RNSA 2A75A 1YNAA 3RJRA 1VBC2 1YUDA 3WCSA 1H2LA 3AK0A 4UBGA 4PLMA 3WW3A 4O9GA 2GMPA 5BNNB 2ZMKA 4HVOA 1ZZ6A 1MZFA 1NCRC 1POV1 3OF1A 4Q8LA 3SLIA 5JOWA 3ZFEC 1NQJA 3S7IA 1DGWX 3ILRA 3GF6A 2MEV3 3HT2A 1SMVA 2ZKNA 2RR13 3VLBB 1LB2A 2ARBA 5D8AA 5JSPA 1W6PA 1RUH3 1U5YA 4HKWA 4P9IA 4XE9A 4ATEA 1RMU3 1OQEA 3WT3A 1WLDA 3WUCA 4CDQB 2E9QA 1JUHA 4AFMA 5FFOC 3J8F3 3B5LB 4BMBA 1S0FA 2DCTA 5JLVA 3AMQA 4K40A 1UU4A 5LEKA 1KDKA 4R8HA 1UU6A 2ZGMA 2VVEA 5AVPA 1EPZA 1PVXA 3LA7A 3MI8A 4I2OA 5C33A 5KC6A 5L19A 1D2QA 4XOGA 2ZGQA 5HCFA 3P3NA 1WMEA 3MLJA 4LO7A 4QGMA 3Q9OA 4HSLA 4FOVA 3H1WA 3LSDA 3EHKA 4H14A 3JQWA 2HJIA 2JE7A 4E4DX 3KSCA 5CFDB 1KFUL 1R082 3SISA 2MEV1 4IV1A 3VBOA 4JDNA 4CP0A 3BODA 1NLSA 4QMAA 3KT4A 4NHKA 4OLLA 2PTMA 2TBVA 1COV2 3DPRA 3S30A 3PTYA 1LRHA 2B7YA 3VBFB 2VW2A 1LESA 1GZWA 3ASIA 4IV1C 5JIUA 2VQ0A 1YJKA 5T54A 4JDMA 4CDXB 3KT1A 4RS5B 2PAKA 1CX4A 4QQOA 4BOWA 1FNYA 4JDOA 5GLWA 1Q56A 4CEWB 1R081 3N4MA 1GYKA 1LULA 1LOGA 5AC92 1SLTA 4NHLA 1YIPA 2ZZJA 2MHFA 1LGCA 1BEV3 3WUDA 4SBVA 1Q5OA 2D93A 4TYSA 4YM0A 1QOTA 1LU1A 3UKTA 4JQRA 1YFUA 4XF3A 3AP6A 3HAGA 1AR72 4IEYA 2XKOA 3FE5A 4AI0A 4Z2WA 4D94A 2WT0A 3OBRA 4LO8A 4M3CB 1ULDA 1ZBA2 1GZCA 4CDQA 3FUOA 2GU9A 2UU8A 4WVWA 1ZX5A 3WDWA 3CJIA 3RMYA 1AHSA 2DFCA 2V5YA 3NV3A 4QPIB 1DYKA 1MEC3 4YNIA 3S6PA 3L2YA 1IHMA 2MEV2 5CAZA 4LBJA 3LAGA 1Q8OA 2Z42A 2DVFA 1CD3G 4EN7B 2ZGLA 4LBLA 2ZGTA 2JECA 4YVWC 4BZ4A 5ABJA 1IQAA 4QGLA 1RMU2 4FPKA 1ZNPA 3WCRA 1FOD2 4AEDA 4XBNA 1GZWB 1WGPA 2CYFA 2RE9A 5C8WA 4GH4B 1FATA 1S0BA 1O4TA 3M4FA 1OA3A 2DTWA 2CGOA 1R1A2 2PHRA 4D7YA 1C8NA 1Q8VA 4C1WA 4Q4X2 1C4RA 1KD7A 3VHRA 1EY2A 1DZTA 5FDBA 1ND3C 5T5PA 3B9CA 5AFBA 1LOBA 4RS5A 2B5HA 2A71A 2BNOA 3MIFA 1SLBA 1OQ1A 2A6WA 4F8AA 4GB33 5J36A 3WLUA 1PO11 4CDWC 3WXPA 2DF7A 3VBRB 4OHYA 4NO4A 2PLV2 3RRDA 4CEYB 2BVBA 3PVNA 4XEZA 5JSOA 3JCIA 4F83A 2VNGA 3OJBA 1GNHA 3ZFGA 2V09A 1ZRCA 1CPMA 3LOIA 5A32A 3GZAA 3AKTA 4B7KA 1S1AA 3ZO0B 5I91A 1N3QA 4PIZA 5FCCA 3VL9A 4OHXA 2VMIA 1TE1B 5IK4A 3FUQA 5BNNC 5FO9B 4Y22A 1TMF2 2XVLA 5E88A 1NG0A 3QACA 4FAHA 5AVAA 4Y1UA 3D5OA 2WL1A 4FSJA 3ZFGC 1PK6B 1YFXA 2PELA 3OD0A 1W0OA 1HV0A 4XMAA 4L11A 1D4M2 2Q1MA 4I0WB 2DU0A 4EN0A 2VQAA 3N7JA 3B02A 2IC1A 2XG3A 4MUVA 4XIOA 3SCFA 1JN2P 1QGLA 1SCRA 1XYNA 1XXNA 1MZ5A 2W08A 4PJYA 3ATGA 3NAPB 4Y24A 4Q4Y1 5F6KA 3HBZA 1PGL2 1ASJ2 4KU7A 2QNKA 5CFCC 4GA9A 5DZGA 5E89A 1B35B 4AE2A 2HWF2 3ZXGA 2RS11 2YGLA 3DKWA 4YM3A 1AL0G 3V56A 2CWSA 1S55A 1VBA3 1GFF2 2QUOA 3E5QA 3FZ3A 4X6QB 4GKXA 2XPJA 1UF2C 3NAPC 1K5MC 4LR4A 3WOGA 4MV2A 4MX3A 4YLZA 2NN8A 3IBMA 1CR7A 5BPXA 2NZ9A 1OA4A 4FOWA 1QJU2 2JJ6A 3TNPB 3PNAA 4L97A 3TRSB 2ZHLA 2WA3A 2JXAA 2H0VA 3RYPA 3J8F1 1SACA 1DLLA 1J1TA 2B8MA 2VU9A 4AVBA 2FZ2A 5BNPC 2IFWA 3OYWB 3NVCA 3ZFFA 4AQSA 4YYOA 2AGSA 3ROUA 4FOQA 1D0GA 1ZYBA 2A70A 4FP2A 2VVDA 5A32B 2WZR1 3IT8A 1CESA 4Y20A 5DUXA 2FQPA 1RVF2 2QCSB 3LA2A 2ENRA 3NJZA 3RI9A 1QJZA 3ZFFC 2QDRA 4AK3A 1O3QA 4X6RB 1QJX1 1NCQC 4EWDA 3IM0A 4MXVA 3AP5A 2UYAA 3CL1A 4FPGA 5IK5A 5BNPB 2PN5A 1JXNA 3HMYA 4XZPA 5IK8A 3ZIWA 3A4UA 1S0DA 2YC0A 1UPIA 2Z2SB 4Y1YA 4C0BA 4OVEA 4P9LA 4LBKA 4Y1ZA 1C1FA 2A7AA 1O91A 1LR5A 1PMIA 3ZXDA 1TNFA 4Q29A 1AXZA 2XJPA 1NE6A 1H8TC 3OYWA 1NCQB 1BEV1 3USSA 4FXKB 3ZSMA 5JOXA 1CONA 1PVC2 4FXGB 4XXAA 2JE9A 1RUE2 1JBCA 4NHMA 1QY4A 3QBQA 4EN9B 5EFUA 3V65A 4I09A 1G9DA 5K0UA 3ELNA 1AR93 3E6CC 4CDXC 5H9PA 2H6BA 2V73A 3THTA 4AVVA 1NXD1 4Q4Y3 2GC0A 1UL9A 4BLIA 1WCDJ 1RUD3 4FPLA 4J6GA 3AJYA 4LUMA 4PLNA 3ACLA 3JB4C 2XVKA 3BALA 3CJIB 2HWF3 3PMSA 2XL9A 1C8M1 5I8YA 1GBGA 4YW3A 1CAUB 3AMHA 2CGNA 3IPVA 1UD1A 2ZMLA 3IPVB 4R9CA 1SBFA 2Q4SA 4B8EA 1WW4A 5K9YA 4E9KA 5A33A 1LOAA 5J96B 4RFT0 4XTMA 1LGBA 2A5ZA 3TAYA 5JPMB 2HYKA 1HRV3 2BW8A 1A3KA 1AR91 4DRVA 1HXS2 2XVGA 4XILA 1UPSA 1FI2A 3MLLA 1RUI1 2GDFA 1S0IA 1TME3 4BMEA 4BA6A 4Q0SA 3B01A 3TB0A 3ZSKA 1HLCA 1OHFA 4XMIA 5GALA 3MW4A 4L8QA 1UZZA 5KHGA 2BFUS 1AYM1 1PO13 5CG8A 2X5IA 5DG1A 1CQ9A 3RYRA 4JVAA 4P9XA 1ENQA 1F2NA 1G9FA 1BQPA 1PNGA 1T6GC 2RS13 1XNCA 3WNXA 4OI1A 3URFA 4FO9A 4Y1VA 4IEXA 1GV9A 3B00A 5JAXA 5JSRA 4H7MA 3AYEA 4BHPA 1QJY2 1C5HA 1FMD3 4Z8BA 2ZACA 2R32A 2QE3A 1VLNA 3JUUA 2D7FA 2ZZQA 2CNAA 4U2AA 5CFDA 4I01A 1VJ2A 4CYDA 5EXOA 5CBLA 5T5OA 4TLFA 1RGSA 3J8F2 1HRI2 3GHMA 4YGEA 4HMZA 1RUD1 4B29A 3RSJA 3JB8A 1RITA 5T5JA 4IEZA 3IIAA 4HN1A 2R6QA 1DGLA 3GBWA 3O0XA 4KWJA 3VDDC 3V0BB 1V9U2 2DCKA 3WW2A 2RS32 4G9SB 3BU7A 4M00A 4CDQC 5BNOB 4D69A 4GH4A 1ZBE3 2ZS6B 3ZPYA 2HWD1 5I0RA 2WLPA 1NZCA 4DZGA 5DUWA 1LHWA 4JTNA 2GMEA 3KCXA 3I2DA 1KS5A 2R042 3JU9A 4AFBA 4CP1A 1TME1 3DUIA 1OLRA 3R0RA 4JAAA 4FTEA 1I1EA 2UWBA 1FT9A 3VKNA 3WW4A 4LE3A 3X29B 1RUJ2 3WDUA 2DURA 3M70A 4L92A 1KDMA 1N1SA