4IEVA

Cys-only bound cysteine dioxygenase at ph 8.0 in the presence of cys
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cysteine Dioxygenase Structures from pH4 to 9: Consistent Cys-Persulfenate Formation at Intermediate pH and a Cys-Bound Enzyme at Higher pH.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
total genus 57
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ievA00
4E2QA 1QWRA 4QGNA 1ZZ9A 3OGJA 1O7FA 5LRRA 5I0SA 1UCXA 5FLIA 2ET7A 2GH2A 5I0UA 3EBRA 4Q0VA 1OD5A 4O9GA 4IEXA 4QMAA 3NSTA 4I01A 4CYDA 1RGSA 3JZVA 5KBFA 4Q29A 4KWKA 4HVRA 5I93A 4MGYE 3ES1A 2ET1A 1G6NA 4IEVA 1NZCA 4AVBA 3BU7A 5FDBA 4ORFA 3EO6A 1LR5A 3EJKA 3PLQA 1UIKA 3D0JA 4KU7A 1GQHA 3CLPA 3DN7A 4JTNA 4HMZA 2PQQA 4YRDA 2UY8A 3PNAA 4XF4A 4IEPA 2IXHA 4LUKA 1ZREA 4YSFA 4XFFA 3FFQA 4LTAA 2B5HA 3ST7A 4EWAA 5J7MA 4IEOA 3LA2A 1IPJA 2QNKA 1RC6A 1YFUA 2D5FA 3KGLA 4P9GA 4UBGA 4Q0SA 1YFWA 2UYBA 5JCTA 4OLLA 3PVBB 2GZWA 1H1MA 5I0RA 4HVQA 3LZZA 1OMIA 5T3NA 3RZZA 1DZTA 3RYKA 3BB6A 2ZKLA 3H7JA 4F8AA 4XFHA 2CAVA 3S7IA 5KHHA 5JSRA 1PM7A 3I54A 4D7SA 2PFWA 3FJSA 4X6RB 4QXKA 4AVAA 1WLTA 3D82A 3H3ZA 2DCTA 1UIJA 3IDCB 3FX3A 2XL7A 3MYXA 4JTOA 1SEFA 5E1RA 3OF1A 1YHFA 4KU8A 2HJIA 4UXAA 3KSCA 4WZCA 4XF1A 4L2NA 2IXCA 1EY2A 4L11A 4XFBA 1UD1A 3CL1A 1RL3A 1ZVFA 5CU1A 4HBNA 3E6BA 2VECA 2XKOA 3WW1A 3BPZA 4I02A 2XL9A 4PJYA 4RD7A 3KGZA 5JSOA 4D7TA 3R6SA 5BPXA 1NE6A 5BXXA 3B02A 2OZJA 3LWCA 3BALA 2KXLA 3G7DA 1OI6A 3SCHA 5I8TA 2PAKA 2BNNA 4Q0PA 3N4MA 2QVSB 3IWZA 3MDPA 1SFNA 4QGMA 4EROA 1XRUA 3O14A 3SXWA 5LEJA 3I7DA 3H8UA 3CEWA 3GBFA 2BNOA 3FZ3A 2ZCWA 3OTFA 1ZRDA 3KMHA 3CF6E 4WBBA 1CX4A 3TNQA 3SHRA 4JV4A 4PIXA 3ROUA 5KHJA 4J1WA 5I91A 5CVRA 4Z07A 4BIFA 5BY5A 1J59A 3KCCA 4Z82A 4AQ2A 1J3PA 1O5LA 1O3QA 1J58A 3FHIB 3SCFA 1X82A 1TQ5A 2CGPA 2O1QA 3USSA 4O9EA 5KHIA 4IEZA 1X7NA 1CAVB 5KHKA 1JUHA 3LAGA 4YARA 5HI0A 1WGPA 1J1LA 4HSLA 5BUVA 4IERA 3VHRA 2BNMA 4Q0UA 4YYOA 4AVCA 3I59A 5BV6A 2GC2A 1PMIA 2I45A 1DGWA 3H1YA 4MGZE 5EFUA 4PIZA 3ES4A 4XF9A 3UKNA 3GYDA 3FWEA 2Q30A 2B9UA 3RPQA 1QXRA 4F7ZA 1VP6A 2MNGA 1ZNPA 5EZWA 4FT8A 4IEWA 4I3PA 3HQXA 1QY4A 1GQGA 1UPIA 3H1WA 2GU9A 1NXMA 3ZDSA 2UY9A 4IEYA 5F1RA 3EHKA 2Q0AA 3FE5A 2H0VA 3WW2A 2Q1ZB 4AQ6A 4KWJA 1DZRA 2MHFA 4HN1A 4Q0QA 1EPZA 1CAUB 2BYVE 2V09A 3ACLA 1Y3TA 4LLOA 3OCPA 1OFNA 3M3IA 3RNSA 3WW3A 2XLFA 4DINB 5JSPA 3SMHA 4X6QB 2GC0A 4EV0A 4R52A 4KWLA 4B29A 4XEZA 4K8FA 2K9ZA 2WFPA 4ZU7A 2IC1A 3ELNA 3H3UA 1ZZ7A 2PAMA 4MGIE 2H6BA 2PHLA 3CJXA 4UBHA 4XF0A 1O3TA 3DL3A 1CAWA 2QJVA 1XE8A 3U10A 4QM8A 4QGLA 1NE4A 4XFIA 5D1IA 2XKPA 1ZX5A 4R8HA 4BYYA 4KL1A 2XHKA 4PIYA 2Y0OA 1SQ4A 5KHGA 2PAEA 3IIAA 2P17A 5FQ0A 3E5XA 4FAHA 1YWKA 4JVAA 2WC2A 1LKNA 4J1XA 3CO2A 3I59B 2XLGA 4HN0A 1QXJA 3E6CC 3H7YA 1EP0A 2ETEA 2OZ6A 1YLLA 2IXKA 3NKTA 4IEQA 3DV8A 2EVXA 1V70A 1YFXA 4E2SA 2HKXA 3HT1A 3QOPA 2CAUA 4HSJA 2PTMA 1ZZBA 2UYAA 1ZZ6A 4MX3A 2FQPA 3HT2A 3LOIA 5I8SA 3LA3A 1O3RA 3NJZA 2ATFA 2D5HA 4FAGA 5J48A 3WW4A 5J3UA 4XFGA 4LEJA 4QM9A 1DGRA 1Y9QA 3HIFA 1IPKA 3C3VA 4MZUA 4HZFA 2IXIA 2F4PA 4META 2OPKA 4MUVA 5K8SA 1EYBA 2IXLA 4IEUA 4XFAA 1O4TA 1L3JA 3IDBB 1FXZA 5AVPA 2CV6A 2QDRA 1UW8A 2XGXA 4FBFA 2XLAA 4LA3A 4I0BA 4AXOA 2VPVA 1FI2A 4MGKE 2VQAA 3E5UA 1NYWA 1HW5A 3RYPA 1O3SA 3UKVA 5E16A 1X8MA 3D0SA 3S0MA 1ZRRA 5FCCA 1ZRCA 5JR7B 3E6DA 4LA2A 1CAXB 5I0TA 1O5UA 4A2UA 2BGCA 3EQEA 4XFCA 1CAVA 5FLJA 5FQ0B 1XE7A 4I0AA 2H6CA 3DKWA 4E2GA 2BEOA 5LRSA 5I8YA 3IBMA 2O8QA 4MV2A 2Z2SB 3E97A 2OA2A 2OYZA 4N9HA 2GAUA 1J3QA 1U12A 1Q3EA 3SCGA 2IXJA 2PYTA 4LUMA 1YUDA 1Q5OA 2EAAA 2D93A 4LULA 5FPZA 3U0ZA 3MZHA 1I6XA 2QCSB 5CADA 2PHDA 1LB2A 4EWEA 3BCWA 4GULA 5JAXA 5FPXA 4OFGA 2D40A 1CGPA 2K0GA 2Z69A 2FMYA 4TLFA 3QACA 3U11A 1VJ2A 3RYRA 3E5QA 4NVPA 2N7GA 4IESA 4HLTA 1I5ZA 4MH0E 1RUNA 2C0ZA 2EA7A 3LA7A 4WVZA 3S7EA 1FT9A 1ZZCA 2E9QA 4XF3A 1J3RA 3RDIA 4QX5A 2PA7A 4I09A 3NL1A 2Q4SA 1ZRFA 3TNPB 3H9AA 1YFYA 3NVCA 4N9IA 4I2OA 4ZU4A 2GC1A 3L2HA 4XETA 2MPFA 3UKTA 1WA4A 4BHPA 4H7LA 2GC3A 5C6CA 3MPBA 1Q43A 5LEKA 3OD0A 1CAWB 4ONUA 1ZZ8A 4ZU5A 4HVOA 4EWDA 1LRHA 4YNIA 3M70A 1CAUA 3ETQA 1RUOA 1X8EA 4IETA 2B8MA 3NW4A 1CAXA 3H1MA 4BH9A 5FLHA 3H50A 5C8WA 1RTVA 1H1IA 1VR3A
chains in the Genus database with same CATH superfamily
1R1A1 4QGNA 1ZZ9A 2R1DA 4NWWA 1PIV1 2PMWB 2R7EB 5LRRA 1KS4A 4UT5A 2XUMA 2B4KA 5CYYA 5FLIA 2HEWF 1KRIA 4K6BA 4K8RB 3J26N 2ET7A 2GH2A 1PIV3 3Q8CA 3MIGA 2C26A 2VXJA 4KGGA 2WS91 5IJRA 1BZWA 5J96B 1PO11 4QX0A 1GANA 3ZXEA 4QMAA 1NCQB 1U5IA 4XBQA 5T5JA 1HQWA 2JD4A 3AKSA 4LPLA 4PDWB 5C4WB 3U75A 4C90A 4COZA 5DMYA 1BCXA 3AMQA 4H7MA 1QJX2 2XONA 3O0WA 1MEC2 3ZVXA 1HRI2 1IKPA 4MHUA 2QQIA 2IFRA 1IG3A 4AAXA 4OMDA 3WP5A 4HPKB 3BTXA 3BIEA 2R072 3O1PA 4ORFA 2W68A 3EO6A 2ZEYA 1LOFA 1R083 3NMBA 2VULA 4IW3A 4OUEA 2W08A 3JD72 5CISA 1JYCA 1UIKA 3D0JA 3ZN5A 1PNGA 4RGGA 2OPWA 1GWKA 3GALA 5FYYA 3TYJA 5JUVA 4AEKA 1W6MA 2D6KA 4GALA 4JTNA 4AE2A 1PVC1 3BN6A 2VCAA 1MS5A 1AX0A 2JDZA 2W92A 2IXHA 3JXSA 1MEC1 4UF0A 1AHSA 1ZREA 4YLZA 4B7KA 2E7TA 4OUSA 1CIYA 1KQRA 3FFQA 3OB8A 4QKFA 3BTZA 1WUVA 3ST7A 1S0GA 1YC61 2HH9A 2J1UA 2WO3A 1RC6A 2DFBA 1YJKA 2XB6C 4JKMA 4JQTA 2B9VA 4LHLA 1ZM1A 4UBGA 4FFFA 4D69A 1A34A 1AR73 5HV0A 1Z0HA 2VUDA 5A3MA 5JCTA 4LBQD 3TEZA 1HV1A 4OLLA 1OLQA 4ET7A 2DV9A 3U07A 5KXDA 1WMDA 1H1MA 2HWD1 2R043 3WF3A 5I0RA 3LZZA 1EAH1 1OFSA 1OMIA 2VCBA 5DG2A 1F5JA 4XIKA 3TN91 4EN0A 2WZPP 5FWJA 2VCMA 1Q8OA 2WWJA 4XQWA 5D8AC 4JGYC 4F8AA 4W6XA 1FOD2 4P00B 3ZYPA 4EN9B 5KHHA 1FNZA 4CUAA 1LTEA 1N1SA 1S0FA 3I54A 1JOJA 4AL9A 2FCUA 2P34A 5KR7A 1IG0A 2XUEA 2QQKA 3B5LB 5IAVA 1EV13 2LALA 1C57A 1WLTA 2UU8A 2DCTA 3J8F3 3OUIA 3WQ7A 4PLMA 2BU9A 3WDWA 3OBTA 4N90A 4KG8A 2Y38A 5JLVA 1SEFA 3IDAA 2BVBA 4MXVA 3LIHA 1W9WA 2DBNA 3UYJA 4Q4W1 3WNKA 5DXDA 1ZBE1 4KGQA 2HJIA 4R4XA 2BTVC 5FYIA 4A4AA 3THCA 4A6OA 5FPUA 4TTGA 3S30A 2P3IA 3I2FA 1CJDA 4YW6A 1EY2A 4GH4A 4XFBA 1WZXA 1ZVFA 2YGLA 4WVWA 1XC6A 4XJWA 1DFQA 4HBNA 1DP0A 4YZ1A 3BTYA 3RZHA 3BPZA 3AP5A 4XXAA 1G7YA 2CU5A 2ZZQA 1GYKA 4PJYA 3CQOA 4CCKA 4JRLA 4XDOA 5FYVA 3T2OA 5JSOA 3HPNA 1PK6B 1PX3A 3R6SA 4AEMA 1VBE2 2RDQA 2J22A 5DAPA 5BXXA 1BBT3 1YI7A 2JKXA 3O1UA 3BALA 3VBSB 1W9SA 2KXLA 3MF6A 4RQPC 4YZ4A 5I0DA 3NRUA 4BDVB 2Y6LA 3IWZA 1NY71 3MDPA 4N53A 3N9OA 4QGMA 4UW3A 4EROA 4OI0A 3LIGA 3AP9A 1OHFA 3UV9A 4DS0A 3H8UA 3CEWA 3GBFA 5CKMA 1PZ9A 4XXPA 1SBFA 1ST8A 3AKPA 2O0OA 1QOTA 4CP1A 3K4DA 5A32B 4AG4A 2ERFA 1XNBA 1L7QA 2QQOA 4UW4A 4WBBA 1GR3A 1CX4A 1QJY1 2WO1A 4Y33A 1RUE1 2DVFA 5FP7A 3ROUA 4CEYC 5FY1A 1MS9A 2KM2A 1NCRC 3FHAA 4TN7A 4EN8B 3OEAA 4Z07A 5TSWA 1AL22 4CE8A 4CP9B 4LKEA 1VMJA 2JE7A 1LHUA 4UWDA 4YW3A 3ZSMA 2RS31 5L9VA 4FOQA 1W8NA 3A7QA 4B8EA 5K7PA 2YMZA 2BOIA 1OQ1A 2VZUA 3FHIB 3SCFA 3SITA 5IAXA 1LEMA 2WFF1 3Q8AA 1BEV1 2O1QA 4XUPA 4O9EA 4Q5OA 1JMUB 1VIWB 4XYXA 1OOPB 4RGAA 4YGCA 4IEZA 3U14A 1PNFA 2VL4A 5A3PA 3VKFC 5BNQA 5G05L 1FV2A 4YARA 3T2QA 1VBD1 2WNVA 5H9QA 2ZXQA 4BU2A 5FWEA 1FOD1 1OKOA 4IERA 4Q0UA 5IVJA 1X36A 5DUWA 3I59A 3ZXKA 4G9SB 5FREA 1TME2 5T5PA 3VZMA 4D7YA 2HEVF 2WN3A 4P5YA 2QQMA 3WP6A 2Q8DA 3MIHA 4EYUA 4QXCA 3RVHA 1XU2A 5J37A 5EFUA 4I0WB 5FZ0A 1W6PB 4XF9A 3GYDA 2VMHA 4N7IA 3D6EA 1RUC2 2D44A 4YW7A 4L99A 4DY5A 3KHCA 2GP5A 1UKRA 4QDQA 2RS32 2W95A 1GV9A 2A6VA 3RQ0A 2XJTA 1ZNPA 4XVHA 3V0AB 3J7LA 4I3PA 1W8UA 1QY4A 1UPIA 3H1WA 4C8DA 4JGYB 3SEPA 2GU9A 2IZWA 1E5IA 1EV12 3K3OA 1XE0A 5C5TA 4LK6A 2UY9A 2GNDA 1XNKA 4IEYA 4TLGA 1UMIA 2ZGRA 4AQ6A 3UK9A 2H0VA 4QHBA 2Q1ZB 3WW2A 2BW8A 3UNPA 2DCYA 3IPVB 1B35B 4DEVA 5CBLA 1HQLA 2JIGA 1SHWB 1U5ZA 2CHHA 4XAAA 1IS6A 1L7RA 1DZQA 3ITQA 4RL7A 3FUQA 1JHNA 2E32A 2V09A 4M0NA 5FYTA 4LLOA 3KVBA 3RG0A 3VBUB 1HRV1 2BBAA 1H30A 5JZGA 1BK1A 1RUF2 1WD3A 3AVRA 4LT5A 1GOHA 3WW3A 2XLFA 2EIEA 3ME2A 4X6QB 4CSWA 4R52A 2WKKA 3WF2A 3WXPA 2DCKA 3NNMA 4B29A 5J36A 3VD7A 1HJGA 5LK5A 2WFPA 3LQCA 4FFIA 2KR2A 3ELNA 2WZR1 1EUTA 3AX4A 3H3UA 4ZXEA 1ZZ7A 2PAMA 2WS92 3S6PA 5FMBA 5JVVA 2H6BA 3BYWA 1O3TA 1RVF2 2YYOA 3VBFB 4C0HA 3FBYA 5FRAA 4IE4A 1GZCA 2JDKA 3TEYA 2YFZA 4JC1A 4M4RA 4QGLA 4CDXA 4XFIA 4URAA 2XOMA 5KXBA 2J1EA 2XKPA 5DABA 4XILA 1POV1 2JG9B 1JYNA 1KXGA 2GNTA 3L2YA 1JZ6A 2Y0OA 3FBMA 1RUJ2 5L7OB 1SQ4A 4ZXKA 2PAEA 3HN1A 3VDCA 1HN1A 5FZ8A 4QKNA 3N35A 4DOUA 1SACA 5FQ0A 1RHI3 1RUG1 3B3QE 1SMVA 1XYPA 4AI2A 2IWGB 4FPCA 2WC2A 3P6BA 2LW8A 1LKNA 1WA6X 4YZ2A 3CO2A 1RMU2 1VBA2 1GP5A 5ANQA 3KV6A 2CYFA 3H7YA 4Q4X3 2X5IB 5F3GA 5H9PA 4NMIA 3PU8A 3LKJA 2ZGLA 3MEPA 5C9AA 5JPMB 5F5CA 2D6NA 2BGPA 1UYPA 1ZBA2 1O8SA 1VAVA 3WNMA 1SLBA 3KQRA 2JD9A 4Y1VA 4YZ3A 1OLMA 2IXKA 5FMDA 3ZN6B 3U78A 4YM3A 1WCKA 2RR13 3H42B 4GB32 1V70A 4E8CA 3HT1A 3F2ZA 4LLFA 4C1XA 2CAUA 3PVOA 4OHZA 1W9TA 1ZZ6A 3MLKA 4YW5A 4QKBA 2HWC2 3HT2A 4ASKA 2A7AA 2MEV3 5FZGA 3RMYA 4LHSA 4LXLA 3VV1A 2P5BA 5AC91 4FCAA 1O3RA 5F6KA 1UY4A 2BQPA 2RS53 3V65A 1V9U2 1LOCA 2R061 3J7NA 4W4ZA 2HWB1 4QDRA 1AR93 3AMMA 2RR11 1RUF1 1VALA 2WO2A 3WW4A 5J48A 5J3UA 1D2SA 4LEJA 4QM9A 1S1AA 1RUI3 3HIFA 5CFDA 3VBRC 1ASJ3 3WQBA 3AJZA 5IK8A 3AMHA 1UF2C 2P4EA 5F37A 1JBCA 2IXIA 4Q4X1 3PUAA 3ZKUA 1S2BA 1GNZA 4NR1A 2OPKA 4Z8BA 1IHMA 5LBFA 1OF4A 2F17A 5DG1A 1Q8VA 1US3A 2XQXA 2CWSA 4L0PA 2ARAA 5FUPA 4GJYA 4IEUA 3VHOA 2WN2A 4IE0A 1MS0A 2D6PA 4KH9A 4NUBA 4CP0A 1DBNA 1YIFA 1WW5A 5FJHA 5FPLA 2E7QA 1MACA 1LEDA 3GJBA 5K0UC 1ND2A 2XGXA 3O7OA 2R1BA 5FXZA 2DURA 3ZKYA 1QKQA 1XOYA 4N43A 2Y6GA 2ARCA 4I0BA 4LA3A 1OD3A 3WG3A 2VQ0A 3KV9A 2PQSA 4FFHA 2VQAA 1YQ5A 2B45X 3E5UA 5A7WB 5DDJ2 3CJIC 1W6NB 2JWPA 3K3NA 1HW5A 4WV8A 4IE5A 4E4DX 1O3SA 4E4SA 2JKBA 2V4AA 1Y9MA 3ORJA 2Y60A 1ZRCA 4K21A 2DUPA 4LA2A 2QQPA 1CESA 2A73B 1AX2A 2GN3A 2WZR3 4P9WA 1UMZA 1T6BX 2BJSA 1O5UA 3GGLA 2D6LX 2YU1A 1WCQA 3RZMA 2P6HA 4Q26A 2NN8A 4HT1T 3DKWA 4I30A 1IS4A 5FK8A 5FP8A 4DFSA 1V9U3 2AACA 5LRSA 1PMHX 1UY1A 3ETPA 4XACA 4AVTA 3IBMA 5C3QA 4MV2A 3RRDA 5FZKA 2Z2SB 3SQOA 1HRV3 4LO5B 2GMPA 3VBOA 5JXIA 2DWRA 3MIDA 1D4M3 1U12A 3NO8A 4YM1A 1Q3EA 4FOWA 3J4UH 4FPEA 4CTEA 5DZEA 3N36A 2VD7A 2ZGOA 5HCHA 4SLIA 3DXUA 4UYBA 1XJAA 3L9JT 3MZHA 4WM8A 2QCSB 2E6VA 1LHWA 2PHDA 2ZGMA 1WCDJ 2ZOEB 1LOBA 4GULA 4XJZA 4EWEA 3KV5A 2WZEA 3Q8FA 5KC6A 4XHXA 5FPXA 1JODA 1WW6A 2D40A 2GSYA 4ARYA 2FZ2A 1BMV2 2JXAA 4JGZB 3ZXLA 2A3YA 4FPFA 2W39A 2Z69A 3FFZA 3OY8A 4Q4V3 1WD4A 3MW3A 3PTRB 5FP3A 5FIXA 4GJZA 4PQ9A 4INDA 5FV3A 1AR72 1AJKA 4A41A 5IVEA 4AWDA 2A5ZA 1QJEA 4FOYA 2DUQA 2EA7A 2J1RA 4R4ZA 3IMMA 1RUJ1 3S7EA 4S2HA 1UZ0A 1FT9A 3WOGA 3ZPYA 1ODNA 4A7ZA 4CDUA 5AC92 5FFOC 2VNRA 2VQTA 1DQ2A 1FPN3 4QX5A 4UW5A 3VBHB 2VUCA 1MR5A 2RM23 2WQZC 4URTA 1VRH2 4NIIA 2GMMA 2BRTA 1YFYA 1X33A 1FOD3 2ZHMA 2PXJA 2E31A 2D3RA 3EYPA 1NCQC 5C4WC 2QZ2A 5FZLA 5JXHA 1Q8QA 1UY0A 1C3HA 1RUI2 5FZHA 5LA2A 3WF4A 1CR7A 5GKAC 4B4RA 1R64A 3P1IA 1G9BA 3U1XA 3HEIA 1ZBE2 4K9SA 4XZUG 4H7LA 3THDA 4AI0A 1XNCA 5F5QA 3PL0A 4QPIA 3WP3A 3EMRA 4LBJA 4ASLA 5IVCA 3GNEA 4P14A 1CIWA 1TNRA 2C24A 4HL0A 4Y4YA 2ES3A 4LKSA 4N53C 4CDQC 4PDWC 4CU6A 1W6QA 2QBXA 2VZ3A 1GZWB 1H2LA 3M3OA 3MF9A 3OGVA 5FP9A 3NNFA 5T50A 3VBUC 5CFCA 4IV1C 1X8EA 1WW4A 2OQ7A 3N9PA 2B8MA 3CZUA 3TWIA 5LA1A 3P3PA 5LA9A 2GMEA 2XBO2 4B7EA 1RUNA 3SH5A 1F9KA 1S4CA 2DVBA 3RJ2X 1K42A 1OLRA 4QPIC 1O7FA 2YV8A 3MUZ1 4WZFA 1CX1A 5JXGA 2Q8EA 2CGNA 2ZGQA 5BNPC 1W8WA 3U4XA 1ND2C 1OVPA 1O4ZA 4RGKA 1XQNA 2WT1A 1AR62 4Q4Y1 1W6OA 2W47A 4H2AA 2FDIA 3M2MA 4O9GA 2WZR2 3AKRA 3QH6A 3R05A 2ZMNA 5B4XA 4DRRA 4FXGB 1JHJA 4KBBA 4I01A 2EAKA 4XJ8A 4EE2A 3ZSKA 3JZVA 3KT7A 3H0OA 5KBFA 1N47A 1AR61 2WWSA 2Q1MA 4HVRA 4NROA 1V6MA 5CFCC 4BLJA 3VN4A 1YQ6A 5I93A 1G6NA 5EYXA 3ZXGA 1TME1 1L7LA 3W21A 1AYM2 4AVBA 3RZJA 4Y20A 2YPDA 1GNYA 4L97A 3TB0A 1AUYA 3FC0A 5ACA2 3MLJA 4QPGB 2Y6KA 1POV0 1E5SA 4Q4W3 2EXJA 1UYXA 2DCZA 2VUAA 1GQHA 2W91A 3B69A 3MHZA 4KU7A 4Q8LA 1OOPC 4ATEA 4COUA 2VBDA 5E8AA 1SCRA 2ZS6B 4AVSA 2J1TA 4YRDA 3WDXA 1DYPA 3J7MA 1IOAA 4XF4A 3T1LA 1PO13 4JDNA 5BNNB 2C6SA 1PO22 2QQLA 2TNFA 1RJ8A 5GLTA 2WYSA 4LTAA 2B5HA 2JG8A 2WNOA 5FY9A 2VNVA 4IQPA 1GLHA 2BWCA 4KNCA 5JOXA 4IEOA 3I2OA 3R4DB 3LA2A 1IPJA 2QNKA 4IGPA 5F32A 2D5FA 3JCIA 3BUCA 4Q0SA 3AM2A 1YFWA 3CIHA 4LBLA 3ZFEC 3HNYM 1JU4A 3HJRA 5F2WA 1W3XA 1TME3 4COVA 1NKGA 1QNYA 2Z4FA 3PUHA 5JIUA 1G9CA 1EAH3 3TN93 2ORZA 3PIGA 4MHRA 4BQXA 3KT1A 3RZZA 3KWVA 3DKQA 2BGOA 4XABA 3RYKA 5DZFA 3H7JA 3O12A 4XFHA 3V0BA 1BQPA 2CAVA 2AR6A 3LDBA 3O1SA 1S2EA 2XWBB 5JSRA 1PM7A 2YXSA 4D7SA 2VMDA 5D21A 3C8XA 5JI9A 1RXGA 2AUYA 1PK6C 4MVTA 1MQTB 4GA9A 3D3AA 4ITCA 4QQOA 2ARBA 1E5HA 1F31A 3H3ZA 2X8KA 5BYNA 1UIJA 3FX3A 1QNWA 2DTWA 2JEMA 1V0AA 2ZEXA 3MYXA 1FAYA 4PBOA 4RFRB 2W5FA 4AGVA 2FDFA 3NV1A 4QDSA 4ARXA 2ZGUA 2ZAAA 3OYWB 5E1RA 5BNNC 2BFUS 1YHFA 2VG9A 3IT8A 3T2TA 2XJRA 1UY3A 4CP9A 2JENA 2VXRA 3N3HA 1M06G 1AXYA 2W87A 3SLIA 1K45A 2LTNA 4XF1A 2IXCA 1H8TB 1DIWA 3N9QA 1UD1A 4IXLA 4RS5B 1AVBA 3S5QA 3HNBM 4Z1VA 1UU4A 4PQQA 1XSQA 3LCPA 1AYN2 5T5LA 2VECA 2XKOA 4Q27A 5F3CA 4B3NA 1NX9A 4K20A 1O4YA 3QLQA 5GLUA 2E53A 1CPMA 4J6GA 2WNVB 4ZS3A 4NE9A 1H2NA 3ZFEB 2OZJA 2WR9A 4IV3B 2WS93 3INAA 4M3CA 4QQLA 3AYDA 4OI1A 4L92A 2W1UA 2W52A 1HXS2 4YVWA 4A45A 1XRUA 3O14A 3SXWA 5LCWL 5LEJA 4YFWA 1J83A 1APNA 4BE3A 2H0BA 4GXLA 1CQ9A 1Y9GA 1H4HA 4QX3A 3IAPA 4ZY9A 3UGFA 1H0BA 4AHXA 1R1A3 1FPN1 3FZ3A 4P02B 3DYMA 3UESA 1RUJ3 3AFKA 1SFPA 2PLV1 3DPRC 3ZPOA 4JV4A 4M3CE 4PIXA 3PMSA 2XJQA 1SPPA 4LBQA 4YVSB 1C1LA 4CRQA 3ZM8A 1JTZX 4BIFA 1BJQA 5BY5A 1XU1A 3D5OA 1J59A 1QOSA 4AI9A 1AJOA 1NA1B 1S0JA 2W2IA 4F83A 2ZX3A 1O5LA 3B94A 5T54A 5ABJC 3AP4A 1O3QA 3SEEA 4WVMA 1B35C 1Z7S1 2R32A 4PLOA 3WUCA 3AYAA 2D7FA 2J1VA 4PCRA 2CGPA 2C5DA 2YC0A 1Y7BA 1TG7A 4QB1A 4UFHA 1PHMA 5JIAA 3JUUA 1X7NA 2VAUA 3KLSA 1DG6A 3N7LA 4JGZA 3ZXDA 5JOWA 2XVKA 4GMP3 5HI0A 1UZYA 1J1LA 4HSLA 5BUVA 2E7AA 1MVQA 3T3YA 5C5UA 4XW3A 5FZ3A 2X29A 5M0TA 4CDWB 3HN3A 4W6WA 1RB8G 2Z5WA 5D8AB 4FI9A 4TYSA 4YGEA 1DGWA 4XIOA 4DY3A 1SDDB 2I74A 1VPHA 4CDUB 1V9U1 4DUWA 4PIZA 5FYUA 3ES4A 3UKNA 3N7JA 2XWJB 4BJ0A 3LSEA 3POSA 3R0RA 4NHXA 1QXRA 4F7ZA 2OXBA 1TNFA 4NAMA 2BV4A 1VP6A 4Z2AA 1FV3A 4FT8A 5T55A 2Y6JA 4HK9A 1SBEA 4YM2A 4CDXB 4COYA 2DVDA 5JOZA 1UX6A 2Q5TA 1NXMA 4LITA 5F3EA 3ZSEA 1HB1A 2A71A 4QU2A 1QU0A 4AZZA 1GBGA 2QQWA 3EHKA 2Q0AA 3FE5A 3WDUA 4B4QA 4PDWA 2ORXA 3M3QA 1IZ3A 5IVYA 1AR83 1DZRA 5J09A 1Q8SA 1AX1A 4RQPA 1WCSA 4QPYA 1REEA 1IQAA 3JD71 4Q0QA 3RZKA 2WA3A 1WLWA 4CU7A 3C7HA 3ACLA 4GAZA 5FZCA 4V1PA 5FO8B 1DQ4A 1QJX3 2VZSA 1OFNA 3IMNA 2V4VA 5FZ6A 3RNSA 3WINE 4CDQA 3ILRA 1GSLA 2K46A 5FZMA 4BZ4A 2X5IA 5DDJ1 4OI2A 4CZSA 1C5HA 4LR4A 3SMHA 4EV0A 3OPZA 3NAPA 4CDUC 3E1F1 4GWJA 4QQ2A 4XEZA 5BNPA 1PGL1 5IVBA 4LJHA 4ZU7A 1VBC3 2VMGA 2G9FA 2Y34A 3T1MA 5C3OA 3PJYA 1DGWX 1UXXX 1RUI1 3RI9A 4BLIA 4MGIE 4LQRA 5EJZB 3CJXA 4XF0A 3HBZA 5IWFA 1AR91 2HWB3 4E8DA 1C8M2 1XE8A 3U10A 2RS51 2G9ZA 5GLVA 4ATFA 2VW0A 2WNUA 3BU0A 2A6WA 3NKGA 4QM8A 2RVAA 3VDAA 2MEV1 2IFWA 4AQTA 1PGSA 1OA2A 4JDOA 2WA4A 5T5OA 4KL1A 4PIYA 2NQYA 5FO9B 5IYYA 3K77A 2KA3A 4OHVA 2ZGTA 3P5BA 2RR12 3IIAA 4WM8C 4HXCA 4C0BA 1QOOA 5KWRA 1RUG2 4HETA 4Y20B 2P17A 4UFIA 3VZNA 4FAHA 3VD3A 1JYTA 1FYUA 2FCVA 4MOAA 3KQ4B 5EJ3A 4WM7B 1PVXA 1VBC1 2YPJA 4XTMA 1AR82 3JU9A 1MVEA 4XCBA 3A21A 2P3KA 3DPRA 2F4LA 4M00A 3ABZA 5BNOA 2X05A 2ILMA 1GQPA 5SV5A 1AYN1 2WLPA 4Q4V2 1XB9A 1AR92 4NPMA 4XE9A 4OQ8A 2WLQA 3IDEA 3JQWA 5LW9A 2RE9A 3NKTA 2ZZJA 4E9KA 3GZEA 4E2SA 3OBRA 3WV6A 2PTMA 1ZZBA 2V5YA 3DEMA 1ULGA 2QQUA 4AFCA 1AR81 3GHMA 2RM22 5C8CA 4HANA 4XMAA 3VDBA 3HWJA 2OS2A 5GM0A 4XQ4A 4D6QA 1HKDA 2VW2A 1UO9A 1V6KA 2ZEWA 3OBZA 5E6HA 4FAGA 4XJ9A 1RUH3 2YC4A 4XUTA 3POYA 1DGRA 3VD9A 4SBVA 1ULDA 1N3QA 2A70A 2SLIA 1PK6A 2Y33A 4OHWA 1UQXA 4Y3OA 5FZOA 3AJYA 2E51A 2PELA 2VZQA 3CMGA 3GZAA 4META 4D8MA 2P3JA 4RHV1 4PLNA 5K8SA 1FX5A 1RVF1 4CXYA 1BK0A 5JR2A 2VY0A 2WFF2 3ZMOA 5JPNB 1Z7S2 2Y6FA 4FPYA 1QMJA 2LRPA 3JBG2 3V56A 1ND3A 4Y24A 2VBPA 1L3JA 3IDBB 5F39A 1SG3A 3TBDA 1OC1A 1D0GA 3T4VA 1UW8A 2EIDA 4GMP1 4OMCA 3H3LA 5IT6A 4MGQA 1AL21 5FTTC 2IVIB 2JE9A 3LOBA 4PHZA 5A3UA 1BKZA 1UZWA 2VMEA 2ID4A 3GZTB 3I3EA 3O0XA 3I2IA 4YWAA 1OA3A 4QHZA 2XMLA 5DZGA 3RYPA 2V73A 1VMFA 4GZ9A 1RINA 3VBHC 5E16A 2VOVA 1IGOA 4XUNA 4CU9A 4NN0A 5EQUA 2OQ6A 3F95A 1XSRA 5HCFA 1CAXB 5A1AA 3LD8A 4AEDB 4MG2A 4JCKA 1OOPA 2JG8C 3ZFEA 1GOGA 1S0CA 2BGCA 4XFCA 2JDPA 4TXWA 3VLBB 3WEZA 4P9LA 1WLDA 2VR4A 4E2GA 4NHKA 2D3PA 3KM5A 2YZ4A 4Q2FA 4CUGA 2O8QA 3KCYA 5L9RA 4AQSA 2WABA 5CB7A 4ES9A 2DF7A 3LEMA 4Q8KA 1VAKA 4QD2A 5F8PA 4N9HA 1RITA 1CZTA 3LGRA 4LK7A 5LY2A 1ENXA 2G4IA 2XVLA 5A7PA 3SCGA 5LA0A 3MW4A 1VBD3 4LUMA 2UWCA 2JB8A 2Z79A 1AZDA 2EAAA 3MBWA 5JMCA 5FPZA 3WZ1A 1LODA 1YQ8A 4EZHA 1SPPB 4YZ5A 1KD7A 2E63A 2WWUA 3VBRA 1I6XA 4COWA 1BEV3 3DGTA 2WFF3 4ZHNA 3CU7A 2HWF2 3W20A 2XBO3 3OPWA 1V6LA 5A6ZA 1AXKA 1VRH3 1NA1A 3K51A 3URFA 1OKQA 1UN1A 4JGYA 2A75A 1QJFA 2RS33 5DUVA 3OBAA 5F9TA 3VZJA 2EXIA 1S0DA 2OVUA 3SNMA 2VMCA 1LU2A 2WJSA 4DMIA 1W8FA 1SLLA 2BBVA 1F8VA 2HYKA 1RUE3 1A78A 2EIBA 2C0ZA 3M1HA 2ZMKA 3I8TA 4XF3A 3BTAA 4RSUA 2BOJA 3VKMA 2JG9C 1IQDC 2PA7A 4I09A 1W9FA 5LASA 2XPJA 1SBDA 5D8AA 1GUIA 2RJ2A 3VZKA 1SLTA 1URXA 5C9AC 3WDVA 1F5FA 2KD7A 3LEGA 4ZU4A 3H8XA 2VMFA 4XETA 3ZSLA 5GZFA 1U5XA 3THPA 1W0NA 3WUDA 2YDEA 3MV01 1LGNA 1JZ4A 1J84A 1S0BA 4QQPA 1CZSA 5ACA3 4JRAA 1LENA 3BGAA 3VZOA 2CNAA 2SBAA 1QQP3 3KZ4C 4GD4A 2D98A 4Q4W2 5LBEA 2FDHA 2ZHLA 4FPGA 1OH4A 2WQ8A 2TUNA 5LEKA 4QX8A 1HXS1 3EXUA 5A3OA 4UOJA 2JX9A 5IHRA 1HX6A 4EWDA 2NZ9A 3M70A 1VAMA 1OSGA 2AYHA 3T08A 5FUIA 2A6XA 4MLOA 5HV4A 3I2GA 3ZOIA 4DPNA 4BIOA 3LDRA 4RQPB 3B93A 3A23A 2HWF3 4MYEA 2ZX2A 4EJRA 2DYCA 4M0HA 5A70A 1VR3A 3OJBA 1IS3A 1ENSA 1MZFA 3HR9A 5GLZA 1QWRA 3VKOA 2DVAA 5C7GA 5I0SA 1TZOA 2YBPA 1UCXA 2GDFA 3J8F1 5AVAA 3I4IA 4AHZA 4FOVA 2WINB 1EV11 1JN2P 5I0UA 2CDPA 1LECA 2A3WA 2J7MA 4MSVA 4ZZ5A 1F4AA 1N1VA 3TOJA 1OD5A 3NV4A 5AFEA 5FYMA 3SKJE 5IW0A 3W5NA 1NCRB 3IAQA 1JUIA 2C4XA 4IEXA 2FDKA 4GIQA 4FO9A 1RMU3 5H9SA 1LGCA 1YI9A 2OIIA 4UI9L 4CYDA 1RGSA 2XHNA 1GFF2 3KCXA 4KWKA 4W50A 3USUB 1NUKA 3FLRA 4MGYE 1VE0A 3Q8BA 2HWD3 4JHZA 2NMNA 2X53S 4IEVA 1W39A 4Y22A 1GNHA 2E33A 1CJPA 1NZCA 4H55A 3BU7A 5FDBA 4MADA 4Y1XA 1W8ZA 3VD4A 1QQP1 3GCWA 4PI2A 5ACA1 1LR5A 3EJKA 3PLQA 4XDPA 4NRQA 2VUJA 4ZPIA 3GXUA 3LFMA 5FZIA 3TRSB 4A6SA 1GOFA 4HMZA 2PQQA 2QDNA 3PNAA 3IB3A 1JW6A 4XC9A 4IEPA 4CCMA 4LUKA 3R4SA 1ZA7A 1YEWA 1OUXA 2XQRA 4LHNA 5A32A 1QJU3 4XFFA 1SZBA 4LKFA 2CSGA 5EYYA 4BQ5A 4BQ4A 1DF0A 4EWAA 5FPVA 4ES8A 1N1TA 3M3CA 1R081 3AVSA 2UYBA 4AHYA 1OXCA 1UZVA 3POIA 4S2FA 5APAA 5F3IA 3SH4A 1PM4A 2VO5A 1OPOA 1QJY2 2RS11 1OQDA 2B46X 3J8F2 3PVBB 1AXZA 1A6CA 1G86A 1O91A 5F5IA 5L19A 1ULFA 5EV7A 5T3NA 4HVQA 1H4GA 1UNBA 4N43B 2ZX1A 2YBSA 1JZ3A 4IV3A 2QFEA 1VRH1 3BB6A 3CJIA 2ZKLA 3KVAA 4HKLA 4NWVA 2XBO1 1DQ5A 3ZIWA 2C1FA 4DQAA 1JYXA 3MGUA 1NQJA 5FBZA 1JS9A 1HB2A 3BPSA 3K2OA 3A0KA 1AYM1 2PHFA 2PFWA 2A3XA 2D3SA 3LPGA 4QXKA 4DUXA 2PHWA 1HIXA 3D82A 4FPKA 4DUVA 1JZ5A 1HJFA 3IDCB 4JGZC 4D6SA 1GMMA 1QF3A 2L9LA 2XL7A 2ADDA 3O5SA 3KV4A 4JTOA 4ZKTB 1K5MC 1YCIA 2RM21 2VVEA 5ABJB 2ZGKA 5IVFA 1BMV1 5FOJB 3OF1A 4FSJA 4FFGA 4JDMA 4KU8A 4XURA 2P2KA 2RMU2 1YRZA 4NHYA 3POEA 4YGBA 1K12A 2UWBA 4WZCA 3ENRA 1SLIA 3RJRA 3UETA 3I3BA 1ND3B 3PJQA 5CFDC 1RL3A 4AR2A 1Z78A 5DN2A 1W28A 4Q4V1 3E6BA 3WW1A 5FPAA 4Q1RA 4GQ7A 3A4UA 2OT7A 1V6NA 3AXDA 5EJ1B 3KGZA 1D4M2 2VZVA 4D7TA 3AFGA 3MPPG 4HPKA 3H8RA 1NE6A 2VOKA 4F3JA 4I3GA 2JB4A 2ZMLA 3VBUA 3G7DA 3G6JB 2ZBJA 2DUOA 3RMXA 1AL23 1NXD1 2PAKA 4AFAA 2BNNA 4Q0PA 4AI8A 4GKXA 4LBOA 2HLEA 1D4M1 1COV3 4AEDA 3ZSJA 3I7DA 2R0FA 3HNMA 1LJ7A 1DYOA 2YC2A 1OF3A 3VL8A 4QAWA 3MIEA 3Q9OA 4YG3A 2HWD2 2ZCWA 1NLQA 5A6QA 3OTFA 3VD5A 5A3LA 2C9KA 3LEKA 4IV1A 2ZHKA 1LOGA 3SHRA 1QDOA 2E26A 2VTXA 2AREA 1MS1A 5KHJA 3QCWA 1Y4WA 4IE7A 4XMIA 5I91A 2BPA2 2OW4A 1Q8PA 4KWUA 5CVRA 1BXHA 3WG1A 4AW7A 4NPLA 1DHKB 2Y0IA 4Z82A 5BNOC 4R9BA 4LKDA 5GJ6A 3LFIA 2CGOA 5CG9A 1LU1A 2VZPA 1X9PA 3W9AA 3HQUA 5IFTA 1F35A 4IL7A 1X82A 2RMU3 1TQ5A 1PX4A 2R0HA 1HLCA 3USSA 4ASMB 5KHIA 1GZ9A 1PVC2 5FYBA 1CAVB 5KHKA 4NIAA 1W9YA 5CG8A 1TVGA 1JUHA 2WNEA 2XR4A 3DYOA 5FZ4A 4N8MA 3ZYBA 1KDKA 4BOWA 5IATA 3N9NA 4RR3B 1CZVA 5A7SA 4AVCA 3M8LA 3WSOA 1WLCA 4XHBA 3ZO0B 3MFAA 5BV6A 4CXXA 4OZXA 4KQ7A 4OUMA 3MIBA 4XJAA 3THTA 2VW1A 3M3EA 2VZOA 5FZBA 4CCNA 5C9AB 2C9AA 5J1XA 4MXWB 1GP6A 4LO8A 4DXTA 3WVJA 2B9UA 3A22A 2RJKA 3ZFGB 1RUD1 5C33A 4V2WA 2F6BA 4UFLA 3ZFFA 4FPOB 3RPQA 4LOTA 4NOTA 2VBBA 1W04A 1OLME 4D3WA 2MNGA 1ASJ1 2YBKA 4DIQA 4FP2A 5EZWA 3I2KA 1D0HA 4Y1YA 1US2A 1DU3D 1GQGA 3DF0A 1RUF3 2CL2A 1PGW1 3SC7X 4B1LA 1ENQA 1K5MB 3AMNA 3WQ0A 3ZDSA 3TAYA 3LDKA 2BP6A 4TZDA 5AC93 1ZBA1 1YO8A 2ZABA 1PMJX 4Z92B 5FZ1A 4Z2WA 1EPWA 5B4NA 4XUQA 5DUXA 4HN1A 4W8JA 2LM3A 1ZRIA 2XH6A 1D2QA 4CPBD 5CFDB 3ZYIB 2QQVA 1OUSA 4CP2A 2BYVE 2ZJCA 2Y64A 1C1FA 1PZ7A 1LHNA 2J1SA 2ZX4A 3FLTA 2R062 3OCPA 2G1MA 4E27A 1JU3A 4BA6A 3ACIA 1FMD2 4N53B 3WDYA 3PVEA 2JE8A 2GC0A 4JZRA 3VHPA 3T2PA 1GICA 3K4AA 3CKHA 4K8FA 5JXJA 3GBWA 1JYIA 2LUWA 2HBTA 3ZIXA 2P3YA 3PUQA 1GU3A 3N9MA 1MZEA 4GB31 1RHI1 1RUG3 4RFT0 5FAXA 3RWKX 2QKDA 5EPAA 1CPNA 4UBHA 2ARXA 1RUH2 1CAWA 3MICA 1MZ5A 1V6OA 1Q56A 2QJVA 1N3OA 4ZS2A 4AVVA 1F4HA 1X9TA 4K3UA 4QKDA 1LOAA 2AEYA 1OPMA 1CONA 1NE4A 4LOSA 3B01A 1POV3 4Q4X2 3ZXFA 5D1IA 5A7OA 2FHRA 4BQ3A 3TEXA 3OGGA 1WMEA 4CVUA 2VTFA 3OOXA 2J42A 1VRBA 4NIDA 2VQUA 1JI6A 2W1SA 4DZGA 2A6YA 3ZN4A 1EUUA 4KI5M 3E5XA 5L36A 5F5AA 4JVAA 4NRPA 2JDMA 1VBE1 3OD4A 4B4PA 5DAWA 1UYYA 4J1XA 4QU1A 3I59B 3J9SA 2P37A 4K1ZA 3E6CC 1NG0A 4XDQA 1BYHA 1T2XA 2VMIA 4AI3A 5HCAA 1EP0A 1YYNA 1C8M1 2D6MA 3KF3A 2ETEA 2OZ6A 1YLLA 5AFBA 3LF7A 4GWIA 3ZR6A 4CCEA 2X10A 2FBEA 1E57A 1YNAA 3DV8A 3PMEA 1H6XA 4DRVA 1YFXA 2ZGPA 1R082 5L9BA 2HKXA 1BLZA 2FDJA 2P6CA 2HWE1 3AYEA 3KT4A 3POWA 3QOPA 3PHMA 5FYHA 1VBB3 5FZAA 3VDDC 2UYAA 1A3KA 3V0AA 4C1WA 4Y1ZA 2FQPA 2VOTA 1GZTA 3D4KA 3I2HA 2AENA 2WT0A 4LE3A 4RS5A 4YGDA 5HXVA 2QQJA 3ZYGA 5A1FA 1WWYA 1Z7S3 4A3ZA 1W6MB 1QDCA 1REFA 1OH3A 4K40A 4XFGA 3DCQA 1ALYA 5FXXA 3ZYFA 5LY1A 4MZUA 5FKBA 3T0AA 5A7QA 1QQP2 4LBNA 4IE6A 5FMCA 4AAPA 4JQRA 1UOFA 4D94A 2PLV3 3SISA 1WKYA 4MUVA 2EICA 1EAH2 3TN92 1VBE3 4BXSV 1BBT2 4LBMA 3OUHA 4RS5C 1QGLA 5GALA 1A8DA 1KJRA 2V72A 4RR3C 1ND3C 2VZTA 5C3RA 3Q8EA 1FXZA 5AVPA 4CEWC 5FXVA 2CV6A 3C2UA 2QDRA 4XPVA 3SKVA 3VBRB 1UY2A 1RUC1 1RYYA 2XLAA 4O7XA 2OKXA 4IV3C 4FBFA 5JWPA 3AK0A 2VPVA 1WW7A 4AXOA 3RGBA 1UOBA 4QB6A 4Y5TA 4YVSA 1V6IA 3VBFA 3VL9A 2HBUA 3WLUA 3NWKA 3BODA 3OPTA 4Y5Z0 5HBAA 3UKVA 5CFCB 1X8MA 4OYUA 3S0MA 1ZRRA 5FCCA 2RJLA 3WNOA 1IKQA 4UFKA 4WVMB 1TE1B 4HK8A 4G4FA 1G9AA 4XJUA 5ERLA 1POQA 2EIGA 4NIHA 5K0UB 5I0TA 1YJLA 2AEZA 3RWNA 1CWPA 1LAJA 4CXWA 4QPGC 5FQ0B 1XE7A 5FZDA 5EXOA 1BEV2 4I0AA 5LZ6A 2VU9A 5A3WA 2DU0A 3ILNA 2OX0A 5I8YA 3IKWA 4PF1A 1H8VA 4FVVA 5FPBA 4G3YC 1N1YA 3E97A 5A33A 2OA2A 2XJUA 2P1BA 2DTYA 1JZ7A 3MFCA 4P9XA 3C7FA 3V64A 1W6OB 3EB7A 3O1RA 1BVVA 2IXJA 2PYTA 3VBFC 1YUDA 5FZ7A 4CEWB 4R9CA 1RUE2 4A7YA 2D93A 4LULA 4YG6A 2RHPA 1R093 1G8WA 2PLV2 1K3IA 2VZRA 3FHQA 2WT2A 1BBT1 3K75B 4YW2A 1UAIA 1UOGA 5GLWA 4AI1A 4CUBA 5CADA 3N7KA 1LESA 1LB2A 2WNUC 4LO6B 5IFPA 5JAXA 3VBSA 1DYKA 3HQRA 4MO3M 2D6OX 2JDUA 2GNBA 3DXTA 3OGSA 1KITA 1YQCA 1SDWA 3POFA 2FMYA 5IUQA 1ULEA 3RSJA 3WHUA 1HB4A 4FPJA 3U11A 2DFCA 1VJ2A 3RYRA 2VVDA 4UAPA 5ANNA 1RUD3 4JX0A 5L73A 1I5ZA 1ZBE3 2VE1A 5EHDA 2YFUA 2ZAHA 5DAQA 1LGBA 3LA7A 3AZWA 3CZJA 1VBB2 1DLLA 1W03A 2VNOA 1O8PA 4AOCA 2YG0A 3NL1A 1KDMA 2X5IC 2DDUA 5HCBA 2Q4SA 1LCLA 3TNPB 4CDQB 3WNXA 3H9AA 1HDKA 3I97A 4N9IA 4E4HA 4YG0A 3VDDB 1NCRA 4MXWA 5FKCA 5FYSA 3AZZA 3VHNA 2GC1A 2GNMA 3MUY1 1WCUA 2CDOA 2JECA 1TMF2 3K4ZA 3ZFGA 1S2KA 5DPNA 1E5RA 1AF9A 5D2AA 3UKTA 4JAAA 1WA4A 1S0IA 1ND2B 2WRAA 3KF5A 1NAEA 4BHPA 3NQHA 3O0VA 2O8OA 1I9RA 2RMU1 4M01A 3S5AA 1DQ1A 3JQXA 4BQ2A 2RG4A 1CD3G 3MPBA 1Q43A 3K46A 4Y22B 5C6CA 1I5PA 1F2NA 3OD0A 4YFZA 3H8OA 4LIUA 2VNGA 3JB4C 4ONUA 5CEHA 1G9DA 2R041 4HVOA 3V0BB 5DAVA 3AC0A 2WNUB 1ONAA 1CAUA 1AR63 2RV9A 3ETQA 1W0OA 2ZACA 1SCSA 3GHNA 1J1TA 2PN5A 3C7EA 4IETA 3POGA 4M3CF 1C5IA 3NW4A 4XAEA 1U0AA 4BH9A 1HQNA 3ACFA 3WX5A 1JYWA 4L9BA 4P9JA 1UU6A 5GZCA 4Q4Y3 4E2QA 3OGJA 4YM0A 2D97A 4LBKA 5FY5A 1MPXA 1W8HA 4FPHA 4WVVA 1NLSA 1COV1 3W59A 4BK5A 4N43C 4DEQA 4WM7A 4GH4C 4FQ4A 3PU3A 5C71A 4D0QA 1OQEA 1NA1C 1H9PA 5FY4A 3EBRA 3NAPC 2RS12 2WQ4A 4Q0VA 3B7MA 2B42B 2BFUL 2TEPA 4UFMA 5CA6A 3UJOA 3NNJA 3DUIA 3NSTA 1W2OA 3DECA 3ECQA 1PO12 3IPVA 1B35A 1N3PA 4AYUA 1PO21 4Q29A 1H2KA 3HMYA 2CWMA 3CJIB 4UW6A 2B39A 5EWSA 2V5DA 3ES1A 2ET1A 4GKYA 4HONA 1TMF3 1W06A 3QH7A 3WT3A 2QQNA 3C7OA 4QWNA 2W9XA 1UXZA 3I3QA 1PIV2 4M3CB 4X8NA 5JZGB 3TEWA 5FZFA 2IUWA 2W0XA 3LPFA 3ZXAC 4AFMA 3UT0A 1JZ8A 1H8TC 1CN1A 2R071 3HBKA 4OQ9A 3WNPA 5FR3A 3CLPA 3DN7A 4FTBA 5A3NA 1GP4A 3W58A 2UY8A 1BHGA 2HWB2 2WAOA 4CCDA 5ABJA 4NJ4A 3BOPA 2R6QA 4YSFA 3QD6A 1W05A 3VBHA 2YHJA 1PGW2 4NAOA 3ZYRA 3PTYA 3GBGA 3HD8B 1REDA 3RI8A 2Y6HA 1AYM3 5J7MA 4LNVA 1NQDA 2R073 1ASJ2 3ZMNA 3KGLA 1YFUA 2WUHA 4IGQA 4P9GA 2QTWB 2NMOA 2AH2A 5A1LA 4E4ZA 3ZFGC 5A6XA 2YU2A 4OCTA 5IVVA 1TMF1 4RA0A 2BWAA 2GZWA 5L7OA 2BDRA 1B09A 4QPIB 3AYCA 2RS13 1VBA3 4YVWC 1DZTA 1PO23 5CIRA 1COV2 3NNGA 4ISQA 3WD5A 3T0BA 3IZOA 2I07B 3MI8A 5JMOA 1W6QB 3I49A 1LOFC 2G9GA 1BVP1 3S7IA 4DO0A 2XJSA 2YROA 3AL6A 3U4SA 3LEIA 1AL0G 1MS4A 4CCLA 4OHYA 4AFBA 3FJSA 1K5JA 1QJU1 2NPIA 4X6RB 3ZYJB 3O1OA 4AVAA 2BVVA 2WNVC 3RZLA 2Y8KA 3OG2A 4XUOA 3OSDA 5E89A 2WZ8A 1UX7A 3NNLA 3BOWA 3POBA 3ZN6A 1R1ZA 2HWC3 3LE0A 4QHOA 5KXCA 2JJ6A 2MEV2 4QQHA 3VKLA 3LSDA 4UF0B 4PF5A 5EIYB 1VMHA 2RS52 3MO4A 4HFSA 1F15A 5ISLA 3B9IA 2EXKA 3FUOA 1XYNA 4LHKA 1XPWA 3KSCA 2VVFA 2WBKA 4UXAA 4BQWA 2ZX0A 2BERA 4L2NA 4LIVA 4O65A 4PI0A 4L11A 4CEYB 5K9YA 3CL1A 4TSVA 5CU1A 2RDNA 3WF1A 2AC1A 5F6LB 1XBFA 5JI7A 1R1A2 5F2SA 5CKNA 3KS7A 1QEXA 1P8JA 1I3HA 4I02A 2XL9A 4RD7A 2G19A 3QBQA 3VBOC 4AF9A 5B2GB 1JZ2A 3O1MA 1FATA 1RMU1 5BPXA 3CBNA 3B02A 3LWCA 4XBNA 5CNAA 1W8TA 5C3SA 3WF0A 3T0DA 4YVSC 5SV8A 1OI6A 2Y26A 3PVNA 2AZ5A 3SCHA 3JBG3 5I8TA 3N7MA 1GWMA 2R042 4BPZA 4EN7B 1I1EA 3N4MA 2QVSB 1SFNA 1SLAA 1OBNA 4P5HA 5K0UA 4A7KA 1OA4A 3NAPB 3OGRA 3BVCA 2JICA 4Y4RA 4BB3A 3RZGA 3ZDVA 5FBJA 1ENRA 2BNOA 5FYCA 1HRI3 1MZ6A 5BNPB 3GM8A 5BNNA 4K1YA 3GZUC 2GP3A 1ZRDA 1C28A 1KS5A 3KMHA 3CF6E 4ZONA 2HWF1 2Q8OA 5JDBA 3OEBA 1ZA4A 1C4RA 2HYXA 3TNQA 4CDWC 5C3PA 2JG8B 4Y26A 1RIRA 4J1WA 3ZFFC 1D4VB 1JH5A 1ZYBA 2ZKNA 2GN7A 5HPOA 2XXZA 2JDNA 4ISRA 3ZYHA 2WO7A 4HG6B 4U36A 5DUUA 3KCCA 1WMXA 5DAXA 5GZEA 2NYYA 1W2AX 2D43A 4W6YA 4A42A 4CA9A 1HXS3 4CEWA 4YPJA 4AQ2A 5C70A 3CNAA 1J3PA 3O1TA 4GH4B 1J58A 2VJXA 4BMBA 2R063 3AP6A 2Q1FA 1UU5A 4XTPA 5CAZA 1XYOA 3ACHA 1NT0A 1FMD3 2Q8CA 3P3NA 1UWWA 4FP3A 3I3MA 2K2SA 2NLRA 2XDVA 4OVEA 3HAGA 1ULOA 1R091 1HRV2 3LAGA 3PUSA 4EZ4A 1WGPA 2AGSA 1FNYA 4Q1PA 2RDRA 1JOBA 3VHRA 1VBD2 2BNMA 1NZIA 4YYOA 5EP9A 2GC2A 1PMIA 4KBZA 3DPRB 1MQTA 2I45A 2QE3A 3KD4A 4W65A 2VOXA 3VBOB 4DXRA 5KC5A 2FDGA 3WY6A 3H1YA 2R16A 2BUKA 1WMFA 3A0NA 3R4UA 4MGZE 5G04L 4QXBA 3ZLIA 4CCOA 3FWEA 2ENRA 2Q30A 5FXWA 4LORA 4FQZA 4JKKA 3WR0A 4QX2A 3M7AA 3AP7A 4WM8B 4Y1UA 3VDDA 5FYZA 3JB8A 4BK4A 3W5MA 4IEWA 5IK4A 2FMDA 2GALA 3HQXA 2BZDA 5FY0A 4FPLA 2EXHA 3B9CA 2W3JA 2ZGSA 3S57A 5HXMA 5C8CB 2DU1A 1XXNA 1W0PA 5F1RA 3AKTA 3UL2A 3BIWE 1FPN2 2XJPA 1WBFA 1QHDA 4KWJA 1W2NA 2OUHA 2MHFA 4RHV2 1W99A 4LO4B 5FY7A 4QB2A 4QPWA 1RUC3 4P9IA 4O61A 1EPZA 1OT5A 1MQTC 3I2DA 3MLLA 1CAUB 5A6YA 1GKBA 1Y3TA 3NJVA 1KJLA 1YXWA 3M3IA 4PBPA 4BISA 4FTEA 3PURA 1OURA 3GF6A 4YVWB 5LATA 3DYPA 5JSPA 1JYVA 4DINB 4DB5A 3PUIA 5LBBA 4PT6A 3AZVA 3WP4A 4KWLA 1M4WA 2W94A 4OULA 2YUEA 4IGOA 2K9ZA 5CZKA 4WM7C 1KFXL 2IC1A 2RDSA 1GWLA 1JOPA 1NCQA 3AKQA 1SLCA 5C4WA 1W6PA 4AGGA 3BI3A 2J1AA 4CCJA 2PHTA 2YY1A 4OI4A 2PHLA 4LBQB 3D8CA 3WG2A 5LBCA 3DL3A 3FMGA 2YGMA 1H1AA 5A80A 1GZWA 3C7GA 3FN9A 4UFJA 2WIIB 1STMA 2B7YA 2X09A 4K7JA 1U5YA 1RXFA 3ZX7A 4GMP0 4NRMA 1ZX5A 4R8HA 4BYYA 1A8MA 2XHKA 1VBB1 4L8QA 4H14A 1LOEA 3PIJA 4AK3A 2HWE3 1O59A 3GJAA 4J25A 5CKQA 5A3TA 1NY72 5KHGA 4IUGA 1VB2A 3GDBA 4X8PA 5JZGC 1UPSA 1YWKA 2A6ZA 5E88A 5K4LA 2JDHA 2O14A 1RVF3 2QZ3A 2VH9A 5KXEA 3HOBA 3ALQA 1C8M3 2VTXJ 4RHV3 2XLGA 4HN0A 4AEJA 3T30A 4CDWA 1QXJA 3ZXJA 4V2VA 2XJVA 2JDYA 2WAAA 4S2GA 3VKNA 2EF6A 5FMOS 1DGRN 4AHWA 4DXZA 5FO7B 2WSVA 5FOBB 2GH8A 2FCTA 4N7UA 1HB3A 1O6UA 1RUH1 4IEQA 3UGGA 2EVXA 4BMEA 4LMFA 2ZHNA 2ADEA 2W1WA 2CTVA 2HEYF 4HSJA 2W46A 1UKGA 5L7OC 4RN5A 3ILFA 3K48A 4MX3A 4NHLA 5H9RA 3WCRA 4FXKB 1UL9A 1CVNA 3ZR5A 4C91A 1PGL2 3VZLA 2IVJA 3LOIA 5I8SA 4QPGA 3LA3A 3O1VA 3NJZA 2ATFA 4CPBA 1HN0A 1XNDA 3AL5A 2D5HA 4CU8A 4FTSA 1W8OA 1W90A 1XNAA 4TWTA 1QJU2 1IPSA 5FUNA 4P9YA 2JG9A 1QJZA 3T09A 3IIIA 1Y9QA 2UURA 1IPKA 4BM8A 3C3VA 3RS6A 4GB33 2PHRA 2R49A 4YW1A 1RJ7A 1AYN3 2JDAA 2VGDA 2DVGA 4HZFA 4QT6A 2WSUA 3AMPA 2F4PA 5A7NA 1QIQA 5A33B 1QJY3 1V00A 2PHXA 4QX1A 3NV2A 1S0EA 5IK5A 5FJKA 5FZEA 4XCAA 1EYBA 2IXLA 1Y43B 1V6JA 1KGYA 3B00A 1RHI2 1H9WA 4DXSA 4H3WA 4XFAA 1O4TA 1ULPA 2NM1A 3AZXA 1T6GC 1DQ6A 3I3DA 1ODMA 4S2DA 4XQDA 4AEDC 4NHMA 3FLPA 1MS3A 2VOWA 4IV1B 4NPRA 3WCSA 2JIJA 3IM0A 4Q4Y2 1FI2A 5GZDA 4MGKE 1RUD2 4CEYA 1ZBA3 3T4HB 4GWNA 1FMD1 3M4FA 3MIFA 4A3XA 5LK7B 1NYWA 3CDZB 1YIPA 3WNNA 3BKZA 4LE4A 3UJQA 3IN9A 3D0SA 1QH6A 5JR7B 2FZ1A 5DQ0A 3E6DA 3POJA 1DLCA 2DCJA 2PHUA 2VM9A 2EALA 1R092 4MGTA 3ASIA 2XG3A 4A2UA 4CCCA 3EQEA 1CAVA 3NJYA 4BWOA 1H6YA 1VB4A 3ON7A 5FLJA 2H6CA 1HV0A 2BEOA 3OYWA 1KEXA 3NV3A 3HVDA 1H2MA 4QX7A 2XVGA 4RR3A 5DDJ3 1W2TA 2VCCA 5FMOL 1HRI1 1JXNA 2A1XA 1UZZA 5FZ9A 4AFDA 1QJX1 5BNOB 2Z42A 1QXPA 1H8TA 2OYZA 3X29B 2GAUA 1KFUL 1J3QA 2HWE2 3MV11 1NOVA 1UMHA 3ATGA 4QXHA 3VUOA 5IK7A 2ZGNA 3JD73 3J7HA 1PZ8A 4HKWA 4AGRA 1Q5OA 3JBG1 2DBIA 3NJXA 1X50A 4IDZA 3U0ZA 5J98B 1YQ2A 4XZPA 3ZFFB 3UGHA 3USUA 1UYZA 4R9DA 4JHTA 3RFRA 3VGIA 3WQ1A 4R9AA 1TEIA 3BCWA 4NIGA 1ULCA 1MS8A 2QUOA 4OFGA 5FK7A 2CY6A 1CGPA 4YW4A 5A7WA 3AXEA 1LNSA 3AB0A 1C8NA 1K5MA 2R30A 4U2AA 3WHTA 2K0GA 1W6NA 1XNTA 2WL1A 4TLFA 5FY8A 1LHVA 3QACA 5GZGA 1IS5A 2OUJA 4CUCA 3E5QA 3ACGA 4NVPA 4RYDA 2N7GA 4HOOA 2FD8A 4IESA 2LROA 1AR71 2VZ1A 2YB7A 2WDBA 4HLTA 4M4PA 4MH0E 1DDLA 1LHOA 4WVZA 2E9QA 1ZZCA 5FZOB 1J3RA 3RDIA 2VC9A 1NLRA 3FL7A 3SH3A 3U37A 5LB6A 3N9LA 4OHXA 5F7UA 2HWC1 3KB5A 4GWMA 4BCUA 1LULA 4BXFA 1ZRFA 3CHXA 3WDTA 5T52A 1D7PM 4EN6B 1MEC3 1W2UA 2WYFA 3NVCA 1UOJA 4I2OA 1G9FA 4MGSA 4P08A 5C8CC 1PVC3 1S55A 3L2HA 3KHBA 3WG4A 3AZYA 4JKLA 1DQ0A 1ACCA 5LWBA 4NO4A 4XOGA 4D6RA 2MPFA 4B1MA 4KMQA 2W1QA 3VBSC 4A44A 3VB9A 1WBLA 5JOYA 3APBA 3OUJA 2GC3A 1DGLA 1SFYA 3PDQA 1W3VA 3I2JA 4LO7A 3LB9A 4ZZ8A 2LS6A 1VBA1 1CAWB 1VLNA 2ZA9A 1VBC2 1ZZ8A 2ZEZA 4ZU5A 4DNYA 1LRHA 4YNIA 3GCXA 1QH7A 1RUOA 3MW2A 3WNLA 4KG0A 4HKOA 1DCSA 2ZPXA 4OZOA 4CDXC 1OVSA 3OY8B 2NP0A 2I2SA 5FP4A 1CAXA 2ZTNA 3H1MA 4EQVA 2UWAA 5FLHA 4XBLA 3H50A 4Y5SA 2TBVA 4BQYA 4BQ1A 5C8WA 1RTVA 1H1IA
chains in the Genus database with same CATH topology
1R1A1 4QGNA 1ZZ9A 2R1DA 4NWWA 1PIV1 5LRRA 1KS4A 2XUMA 5FLIA 1KRIA 2HEWF 4K6BA 3J26N 2ET7A 2GH2A 1PIV3 3MIGA 4KGGA 2WS91 1BZWA 5J96B 1PO11 1GANA 3ZXEA 4QMAA 1NCQB 1U5IA 4XBQA 5T5JA 1HQWA 2JD4A 3AKSA 4PDWB 5C4WB 4C90A 4COZA 1BCXA 3AMQA 4H7MA 1QJX2 3O0WA 1MEC2 3ZVXA 1HRI2 1IKPA 2IFRA 3WP5A 4HPKB 2R072 4ORFA 2W68A 3EO6A 1LOFA 1R083 2VULA 2W08A 3JD72 1JYCA 1UIKA 3D0JA 3ZN5A 1PNGA 4RGGA 3GALA 3TYJA 4AEKA 1W6MA 2D6KA 4GALA 4JTNA 4AE2A 1PVC1 1MS5A 1AX0A 2JDZA 2IXHA 1MEC1 1AHSA 1ZREA 4YLZA 4B7KA 2E7TA 4OUSA 3FFQA 1KQRA 1WUVA 3ST7A 1S0GA 1RC6A 2DFBA 1YJKA 2XB6C 4UBGA 4LHLA 1ZM1A 4D69A 1AR73 5JCTA 1Z0HA 5A3MA 4LBQD 1HV1A 4OLLA 1OLQA 2DV9A 3U07A 5KXDA 1WMDA 1H1MA 2HWD1 2R043 5I0RA 3LZZA 1EAH1 1OFSA 1OMIA 5DG2A 3TN91 1F5JA 4XIKA 4EN0A 2WZPP 5D8AC 1Q8OA 4XQWA 4JGYC 4F8AA 4W6XA 1FOD2 3ZYPA 4EN9B 5KHHA 1FNZA 1LTEA 1N1SA 1S0FA 3I54A 1JOJA 2P34A 3B5LB 1EV13 2LALA 1C57A 1WLTA 2UU8A 2DCTA 3J8F3 3WQ7A 4PLMA 3WDWA 3OBTA 4N90A 4KG8A 2Y38A 5JLVA 1SEFA 2BVBA 4MXVA 4Q4W1 5DXDA 1ZBE1 4KGQA 2HJIA 4R4XA 2BTVC 3S30A 2P3IA 1CJDA 1EY2A 4GH4A 4XFBA 1ZVFA 2YGLA 4WVWA 4XJWA 1DFQA 4HBNA 4YZ1A 3BPZA 3AP5A 4XXAA 1G7YA 2ZZQA 1GYKA 4PJYA 4JRLA 5JSOA 1PK6B 3R6SA 4AEMA 1VBE2 5BXXA 1BBT3 1YI7A 3BALA 3VBSB 2KXLA 3MF6A 4RQPC 4YZ4A 3MDPA 3IWZA 1NY71 4QGMA 4N53A 4UW3A 4EROA 4OI0A 3AP9A 1OHFA 3UV9A 4DS0A 3H8UA 3CEWA 3GBFA 1PZ9A 4XXPA 1SBFA 3AKPA 2O0OA 1QOTA 4CP1A 5A32B 4AG4A 2ERFA 1XNBA 4WBBA 4UW4A 1GR3A 1CX4A 1QJY1 1RUE1 2DVFA 4CEYC 3ROUA 1MS9A 2KM2A 1NCRC 4EN8B 4Z07A 5TSWA 1AL22 2JE7A 1LHUA 4YW3A 3ZSMA 2RS31 4FOQA 4B8EA 5K7PA 2YMZA 1OQ1A 3FHIB 3SCFA 3SITA 1LEMA 2WFF1 1BEV1 2O1QA 4O9EA 4XYXA 4YGCA 1VIWB 1OOPB 4RGAA 4IEZA 1PNFA 3VKFC 5BNQA 1FV2A 4YARA 1VBD1 2WNVA 5H9QA 1FOD1 4IERA 4Q0UA 1X36A 5DUWA 3I59A 3ZXKA 4G9SB 5FREA 1TME2 5T5PA 3VZMA 4D7YA 2HEVF 3WP6A 3MIHA 1XU2A 5J37A 5EFUA 4I0WB 1W6PB 4XF9A 3GYDA 2VMHA 4N7IA 3D6EA 1RUC2 2D44A 4DY5A 4L99A 1UKRA 2RS32 1GV9A 2A6VA 3RQ0A 2XJTA 1ZNPA 3V0AB 4I3PA 1QY4A 1UPIA 3H1WA 4JGYB 2GU9A 2IZWA 1EV12 2UY9A 2GNDA 1XNKA 4IEYA 2ZGRA 4AQ6A 3UK9A 2H0VA 4QHBA 2Q1ZB 3WW2A 2BW8A 2DCYA 3IPVB 1B35B 5CBLA 1HQLA 1U5ZA 1IS6A 1DZQA 4RL7A 3FUQA 1JHNA 2V09A 4M0NA 3RG0A 3VBUB 4LLOA 1HRV1 1H30A 5JZGA 1BK1A 1RUF2 1WD3A 4LT5A 3WW3A 2XLFA 3ME2A 4X6QB 4R52A 2WKKA 3WXPA 2DCKA 4B29A 5J36A 5LK5A 2WFPA 3ELNA 2WZR1 3AX4A 3H3UA 1ZZ7A 2PAMA 2WS92 3S6PA 5JVVA 2H6BA 1O3TA 1RVF2 2YYOA 3VBFB 4C0HA 3FBYA 5FRAA 1GZCA 4JC1A 4QGLA 4CDXA 4XFIA 5KXBA 2XKPA 4XILA 1POV1 2JG9B 1KXGA 2GNTA 3L2YA 2Y0OA 3FBMA 1RUJ2 5L7OB 1SQ4A 4ZXKA 2PAEA 3HN1A 4DOUA 3N35A 1SACA 5FQ0A 1RHI3 1RUG1 3B3QE 1SMVA 1XYPA 4AI2A 2IWGB 4FPCA 2WC2A 1LKNA 4YZ2A 3CO2A 1RMU2 1VBA2 2CYFA 3H7YA 4Q4X3 2X5IB 5H9PA 5JPMB 5C9AA 3LKJA 2ZGLA 3MEPA 2D6NA 1ZBA2 1VAVA 1SLBA 3KQRA 4Y1VA 4YZ3A 2IXKA 3ZN6B 4YM3A 1WCKA 2RR13 4GB32 1V70A 3HT1A 4LLFA 4C1XA 2CAUA 3PVOA 4OHZA 1ZZ6A 3MLKA 4YW5A 2HWC2 3HT2A 2A7AA 2MEV3 3RMYA 5AC91 3VV1A 4FCAA 1O3RA 5F6KA 2RS53 2BQPA 3V65A 1V9U2 1LOCA 2R061 2HWB1 3AMMA 1AR93 2RR11 1RUF1 1VALA 3WW4A 5J48A 5J3UA 1D2SA 4LEJA 4QM9A 1S1AA 1RUI3 3HIFA 5CFDA 3VBRC 1ASJ3 3AJZA 5IK8A 3AMHA 1UF2C 1JBCA 2IXIA 4Q4X1 1S2BA 1GNZA 4NR1A 2OPKA 4Z8BA 1IHMA 5DG1A 1Q8VA 2CWSA 3VHOA 4IEUA 1MS0A 2D6PA 4KH9A 4CP0A 1DBNA 1YIFA 1WW5A 2E7QA 1MACA 1LEDA 5K0UC 1ND2A 2XGXA 3O7OA 2R1BA 2DURA 1QKQA 4N43A 4LA3A 3WG3A 4I0BA 2VQ0A 2VQAA 3E5UA 2B45X 5DDJ2 3CJIC 1W6NB 4WV8A 1HW5A 4E4DX 1O3SA 4E4SA 2JKBA 1ZRCA 4K21A 2DUPA 4LA2A 2QQPA 1CESA 2A73B 1AX2A 2GN3A 2WZR3 4P9WA 1UMZA 1O5UA 2D6LX 4Q26A 2NN8A 4HT1T 3DKWA 4I30A 1IS4A 4DFSA 1V9U3 5LRSA 4AVTA 3IBMA 4MV2A 3RRDA 2Z2SB 1HRV3 4LO5B 2GMPA 3VBOA 2DWRA 3MIDA 1D4M3 1U12A 3NO8A 4YM1A 1Q3EA 4FOWA 3J4UH 4FPEA 4CTEA 5DZEA 3N36A 2ZGOA 4SLIA 3L9JT 3MZHA 4WM8A 2QCSB 2E6VA 1LHWA 2PHDA 2ZGMA 1WCDJ 2ZOEB 1LOBA 4GULA 4XJZA 4EWEA 5KC6A 4XHXA 5FPXA 1WW6A 2GSYA 2D40A 1BMV2 2FZ2A 2JXAA 4JGZB 3ZXLA 2A3YA 4FPFA 2W39A 2Z69A 3FFZA 3OY8A 4Q4V3 1WD4A 3MW3A 4PQ9A 4INDA 1AR72 1AJKA 4AWDA 2A5ZA 4FOYA 1RUNA 2DUQA 2EA7A 4R4ZA 1RUJ1 3S7EA 4S2HA 3WOGA 1FT9A 3ZPYA 4A7ZA 4CDUA 5AC92 5FFOC 2VNRA 1DQ2A 1FPN3 4QX5A 4UW5A 3VBHB 1MR5A 2RM23 2WQZC 4URTA 1VRH2 2GMMA 1YFYA 1X33A 1FOD3 2ZHMA 2D3RA 1NCQC 5C4WC 2QZ2A 1Q8QA 1C3HA 1RUI2 1CR7A 5GKAC 4B4RA 1G9BA 1ZBE2 4K9SA 4H7LA 4AI0A 1XNCA 5F5QA 4QPIA 3WP3A 4LBJA 4ASLA 3GNEA 4P14A 1CIWA 1TNRA 4HL0A 4Y4YA 2ES3A 4CDQC 4N53C 4PDWC 1W6QA 1GZWB 1H2LA 3M3OA 3MF9A 5T50A 3VBUC 5CFCA 4IV1C 1X8EA 1WW4A 2B8MA 3TWIA 3P3PA 2GMEA 2XBO2 4B7EA 3SH5A 1F9KA 2DVBA 3RJ2X 1OLRA 4QPIC 1O7FA 2YV8A 4WZFA 2CGNA 2ZGQA 5BNPC 3U4XA 1ND2C 1O4ZA 1XQNA 2WT1A 1AR62 4Q4Y1 1W6OA 3M2MA 4O9GA 2WZR2 3AKRA 3QH6A 3R05A 2ZMNA 4DRRA 4FXGB 4KBBA 4I01A 2EAKA 4XJ8A 3ZSKA 3JZVA 3KT7A 3H0OA 5KBFA 1N47A 1AR61 2WWSA 2Q1MA 4HVRA 1V6MA 5CFCC 4BLJA 3VN4A 5I93A 1G6NA 5EYXA 3ZXGA 1TME1 4AVBA 1AYM2 4Y20A 4L97A 3TB0A 1AUYA 3FC0A 5ACA2 3MLJA 4QPGB 1POV0 4Q4W3 2EXJA 2DCZA 4KU7A 2VUAA 1GQHA 3B69A 4Q8LA 4Y24A 4ATEA 4COUA 1OOPC 5E8AA 1SCRA 2ZS6B 4AVSA 4YRDA 3WDXA 1DYPA 1IOAA 4XF4A 3T1LA 1PO13 4JDNA 5BNNB 1PO22 2TNFA 1RJ8A 5GLTA 4LTAA 2B5HA 2JG8A 4IQPA 4KNCA 1GLHA 2BWCA 5JOXA 4IEOA 3R4DB 3LA2A 1IPJA 2QNKA 2D5FA 3JCIA 4Q0SA 3AM2A 1YFWA 4LBLA 3ZFEC 1TME3 4COVA 1QNYA 1G9CA 5JIUA 1EAH3 3TN93 3KT1A 3RZZA 3RYKA 5DZFA 3H7JA 3O12A 4XFHA 3V0BA 1BQPA 2CAVA 2AR6A 2XWBB 5JSRA 1PM7A 2YXSA 4D7SA 5JI9A 2AUYA 1PK6C 4MVTA 1MQTB 4GA9A 4QQOA 4ITCA 2ARBA 1F31A 3H3ZA 2X8KA 5BYNA 1UIJA 3FX3A 1QNWA 2DTWA 2JEMA 3MYXA 1FAYA 4PBOA 4AGVA 3NV1A 2ZGUA 2ZAAA 3OYWB 5E1RA 5BNNC 2BFUS 1YHFA 2VG9A 3IT8A 3T2TA 2XJRA 2JENA 2VXRA 3N3HA 1M06G 1AXYA 3SLIA 2LTNA 4XF1A 2IXCA 1H8TB 1DIWA 1UD1A 4IXLA 4RS5B 1AVBA 4Z1VA 1UU4A 3LCPA 1AYN2 5T5LA 2VECA 2XKOA 4Q27A 4B3NA 4K20A 1O4YA 3QLQA 5GLUA 2E53A 1CPMA 4J6GA 2WNVB 1H2NA 3ZFEB 2OZJA 4IV3B 2WS93 3INAA 4M3CA 4QQLA 3AYDA 4OI1A 4L92A 2W52A 1HXS2 4YVWA 1XRUA 3O14A 3SXWA 5LEJA 4YFWA 1APNA 4BE3A 2H0BA 4GXLA 1CQ9A 1H4HA 4AHXA 1H0BA 1R1A3 1FPN1 3FZ3A 1RUJ3 3AFKA 2PLV1 3DPRC 4JV4A 4M3CE 4PIXA 3PMSA 2XJQA 4LBQA 4YVSB 1C1LA 4CRQA 1JTZX 4BIFA 1BJQA 5BY5A 1XU1A 3D5OA 1J59A 1QOSA 1AJOA 1NA1B 1S0JA 4F83A 2ZX3A 1O5LA 3B94A 5T54A 5ABJC 3AP4A 1O3QA 4WVMA 1B35C 1Z7S1 2R32A 4PLOA 3WUCA 3AYAA 2D7FA 4PCRA 2CGPA 2C5DA 2YC0A 1Y7BA 1PHMA 5JIAA 3JUUA 1X7NA 3KLSA 1DG6A 3N7LA 4JGZA 3ZXDA 5JOWA 2XVKA 4GMP3 5HI0A 1UZYA 1J1LA 4HSLA 5BUVA 2E7AA 1MVQA 4XW3A 2X29A 4CDWB 4W6WA 1RB8G 2Z5WA 5D8AB 4TYSA 4YGEA 1DGWA 4XIOA 4DY3A 2I74A 4CDUB 1V9U1 4PIZA 3ES4A 3UKNA 3N7JA 2XWJB 3LSEA 3POSA 3R0RA 4F7ZA 1QXRA 1TNFA 1VP6A 1FV3A 4FT8A 5T55A 4HK9A 1SBEA 4YM2A 4CDXB 4COYA 2DVDA 5JOZA 1UX6A 2Q5TA 1NXMA 3ZSEA 2A71A 4QU2A 1QU0A 1GBGA 3EHKA 2Q0AA 3FE5A 3WDUA 4B4QA 4PDWA 3M3QA 1IZ3A 1AR83 1DZRA 5J09A 1Q8SA 1AX1A 4RQPA 1WCSA 4QPYA 1REEA 1IQAA 3JD71 4Q0QA 2WA3A 1WLWA 3ACLA 5FO8B 4V1PA 1DQ4A 1QJX3 1OFNA 3IMNA 3WINE 4CDQA 3RNSA 3ILRA 1GSLA 4BZ4A 2X5IA 5DDJ1 4OI2A 4CZSA 1C5HA 4LR4A 3SMHA 4EV0A 3OPZA 3NAPA 4CDUC 4QQ2A 4XEZA 5BNPA 1PGL1 4ZU7A 1VBC3 2VMGA 2G9FA 3T1MA 3PJYA 1DGWX 1RUI1 3RI9A 4BLIA 4MGIE 3CJXA 4XF0A 3HBZA 1AR91 2HWB3 1C8M2 1XE8A 3U10A 2RS51 5GLVA 4ATFA 2VW0A 2WNUA 2A6WA 3NKGA 4QM8A 2MEV1 2IFWA 4AQTA 1PGSA 1OA2A 4JDOA 2WA4A 5T5OA 4KL1A 4PIYA 2NQYA 5FO9B 2KA3A 4OHVA 2ZGTA 2RR12 3IIAA 4WM8C 4C0BA 5KWRA 1QOOA 1RUG2 4HETA 4Y20B 2P17A 3VZNA 4FAHA 1FYUA 5EJ3A 4WM7B 1PVXA 1VBC1 2YPJA 4XTMA 1AR82 3JU9A 1MVEA 3DPRA 2P3KA 4M00A 5BNOA 2ILMA 5SV5A 1AYN1 2WLPA 4Q4V2 1AR92 4XE9A 2WLQA 3IDEA 3JQWA 2RE9A 3NKTA 2ZZJA 4E9KA 4E2SA 3OBRA 3WV6A 2PTMA 1ZZBA 2V5YA 1ULGA 4AFCA 1AR81 3GHMA 2RM22 5C8CA 4HANA 4XMAA 3HWJA 5GM0A 4XQ4A 1HKDA 2VW2A 1V6KA 4FAGA 4XJ9A 1RUH3 3POYA 1DGRA 4SBVA 1ULDA 1N3QA 2A70A 2SLIA 1PK6A 4OHWA 3AJYA 2E51A 2PELA 3GZAA 4META 2P3JA 4RHV1 4PLNA 5K8SA 1FX5A 1RVF1 2VY0A 2WFF2 3ZMOA 5JPNB 1Z7S2 4FPYA 1QMJA 3JBG2 3V56A 1ND3A 1L3JA 3IDBB 3TBDA 1D0GA 1UW8A 4GMP1 5IT6A 1AL21 5FTTC 2JE9A 3LOBA 1BKZA 3GZTB 3O0XA 1OA3A 5DZGA 3RYPA 2V73A 1RINA 3VBHC 5E16A 2VOVA 1IGOA 4NN0A 5HCFA 1CAXB 4AEDB 4JCKA 1OOPA 2JG8C 3ZFEA 2BGCA 1S0CA 4XFCA 3VLBB 4P9LA 1WLDA 4E2GA 4NHKA 2D3PA 3KM5A 2YZ4A 4Q2FA 2O8QA 3KCYA 4AQSA 5CB7A 4ES9A 2DF7A 4Q8KA 1VAKA 4QD2A 4N9HA 1RITA 3LGRA 1ENXA 2G4IA 2XVLA 3SCGA 3MW4A 1VBD3 4LUMA 2UWCA 2Z79A 1AZDA 2EAAA 5JMCA 5FPZA 3WZ1A 1LODA 4YZ5A 1KD7A 2E63A 3VBRA 1I6XA 4COWA 1BEV3 3DGTA 2WFF3 3CU7A 2HWF2 2XBO3 1V6LA 1AXKA 1VRH3 1NA1A 3K51A 3URFA 1OKQA 1UN1A 4JGYA 2A75A 2RS33 5DUVA 5F9TA 3VZJA 2EXIA 1S0DA 2OVUA 3SNMA 1LU2A 2WJSA 4DMIA 2BBVA 1SLLA 1F8VA 2HYKA 1RUE3 1A78A 2C0ZA 3M1HA 2ZMKA 3I8TA 4XF3A 3BTAA 4RSUA 3VKMA 2JG9C 2PA7A 4I09A 2XPJA 1SBDA 5D8AA 3VZKA 1SLTA 1URXA 5C9AC 3WDVA 1F5FA 4ZU4A 4XETA 3ZSLA 5GZFA 1U5XA 3THPA 3WUDA 2YDEA 1LGNA 1S0BA 4QQPA 5ACA3 4JRAA 1LENA 3VZOA 2CNAA 2SBAA 1QQP3 3KZ4C 2D98A 4Q4W2 2ZHLA 4FPGA 5LEKA 2TUNA 1HXS1 3EXUA 2JX9A 1HX6A 4EWDA 2NZ9A 3M70A 1VAMA 1OSGA 2AYHA 2A6XA 4MLOA 4DPNA 4BIOA 4RQPB 3B93A 2HWF3 4MYEA 2ZX2A 4EJRA 2DYCA 4M0HA 1VR3A 3OJBA 1IS3A 1ENSA 1MZFA 3HR9A 5GLZA 1QWRA 3VKOA 2DVAA 5I0SA 1UCXA 2GDFA 3J8F1 5AVAA 3I4IA 4AHZA 4FOVA 2WINB 1EV11 1JN2P 5I0UA 1LECA 2A3WA 4MSVA 1N1VA 3TOJA 1OD5A 3NV4A 5AFEA 1NCRB 1JUIA 4IEXA 4GIQA 4FO9A 1RMU3 5H9SA 1LGCA 1YI9A 2OIIA 4CYDA 1RGSA 1GFF2 3KCXA 4KWKA 3USUB 3FLRA 4MGYE 2HWD3 2NMNA 2X53S 4IEVA 1W39A 4Y22A 1GNHA 1CJPA 1NZCA 4H55A 3BU7A 5FDBA 4Y1XA 1QQP1 5ACA1 1LR5A 3EJKA 3PLQA 2VUJA 3TRSB 4HMZA 2PQQA 2QDNA 3PNAA 1JW6A 4IEPA 4LUKA 3R4SA 5A32A 4LHNA 1QJU3 4XFFA 5EYYA 1DF0A 4EWAA 4ES8A 1N1TA 3M3CA 1R081 2UYBA 4AHYA 4S2FA 3SH4A 1OPOA 1QJY2 2RS11 1OQDA 2B46X 3J8F2 3PVBB 1AXZA 1A6CA 1G86A 1O91A 5L19A 1ULFA 5EV7A 5T3NA 4HVQA 1H4GA 4N43B 2ZX1A 4IV3A 2QFEA 1VRH1 3BB6A 3CJIA 2ZKLA 4HKLA 4NWVA 3ZIWA 2XBO1 1DQ5A 4DQAA 2C1FA 3MGUA 1NQJA 5FBZA 3A0KA 1AYM1 2PHFA 2PFWA 2A3XA 2D3SA 4QXKA 2PHWA 1HIXA 3D82A 4FPKA 3IDCB 4JGZC 1QF3A 2XL7A 3O5SA 4JTOA 4ZKTB 1K5MC 1YCIA 2RM21 2VVEA 5ABJB 2ZGKA 1BMV1 5FOJB 3OF1A 4FSJA 4JDMA 4KU8A 2P2KA 2RMU2 1YRZA 4YGBA 2UWBA 4WZCA 3ENRA 1SLIA 3RJRA 1ND3B 3PJQA 5CFDC 1RL3A 1Z78A 4Q4V1 3E6BA 3WW1A 4Q1RA 4GQ7A 3A4UA 1V6NA 3AXDA 3KGZA 1D4M2 4D7TA 3AFGA 3MPPG 4HPKA 1NE6A 2VOKA 4F3JA 4I3GA