4IEVA

Cys-only bound cysteine dioxygenase at ph 8.0 in the presence of cys
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
publication title Cysteine Dioxygenase Structures from pH4 to 9: Consistent Cys-Persulfenate Formation at Intermediate pH and a Cys-Bound Enzyme at Higher pH.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 57
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ievA00
1IPJA 2OPKA 4LA3A 2IC1A 1ZZCA 3KMHA 1QXRA 4X6RB 3I54A 3S7EA 3S0MA 4H7LA 3OD0A 4I3PA 4MV2A 1ZVFA 3FE5A 3E6CC 1J59A 2Q30A 3PLQA 1IPKA 5EZWA 1J3RA 3DL3A 3WW1A 3BPZA 4HZFA 4IEPA 3KGLA 5FPZA 1SEFA 1VJ2A 3CO2A 1FXZA 2QJVA 4KL1A 3NKTA 1O3SA 3R6SA 1EP0A 2IXIA 3G7DA 3KGZA 1Q5OA 5E16A 2PYTA 2PA7A 1O5UA 1CGPA 2OZJA 4WVZA 3H1MA 4XF0A 3U11A 1WGPA 1XE7A 2Z2SB 4YSFA 2GU9A 3RNSA 3H7JA 4XFBA 4PIXA 5D1IA 4EWEA 2QDRA 4IERA 1EYBA 3FWEA 3CEWA 2Q4SA 5J3UA 3I59B 3IBMA 1DZRA 4OLLA 1Q3EA 4YRDA 2QCSB 3SCFA 1Y3TA 2C0ZA 2CAUA 1RC6A 2XLGA 4Q0PA 4QM8A 2MPFA 3ACLA 1FT9A 1DZTA 4XFGA 4AVBA 2B5HA 1TQ5A 1O3QA 4KU7A 4Z07A 3NVCA 1ZX5A 2ATFA 4WZCA 1J3PA 4HVOA 4AVCA 3E5QA 3H8UA 4ZU5A 3NSTA 3U10A 4HN0A 2OYZA 1CAVA 3EO6A 2IXKA 4O9EA 3RYRA 1NXMA 4F7ZA 1QXJA 3DV8A 4XFFA 5E1RA 1UPIA 5CU1A 4LTAA 4YARA 3IDBB 4L2NA 4IEVA 4XFCA 1UIJA 3D0SA 4FT8A 2D93A 2Y0OA 3H1YA 5KHIA 2P17A 3FFQA 3MYXA 3EHKA 2QVSB 4HBNA 1DGWA 4X6QB 2ET7A 1X7NA 5C6CA 4L11A 4KWLA 1OD5A 4E2SA 2UY8A 1O7FA 1ZRDA 1J58A 4RD7A 5I0RA 2UYAA 2PHDA 4HLTA 3LA3A 1CAVB 3NW4A 3OCPA 4JVAA 4PJYA 3PNAA 4Q0QA 1OFNA 2QNKA 3HT2A 3WW3A 4I2OA 3EQEA 1L3JA 3PVBB 1WA4A 2UY9A 4LEJA 2OA2A 1ZZ7A 3GYDA 5EFUA 1HW5A 4KU8A 4MGZE 3IWZA 5CVRA 2XGXA 1DGRA 4QM9A 1X82A 4PIZA 4XFHA 5LRRA 3S7IA 1QWRA 2GC2A 2VPVA 1JUHA 3CL1A 3L2HA 3WW2A 3I59A 2CGPA 3TNPB 2PAEA 3RPQA 5I8YA 1ZZ6A 4TLFA 3FJSA 3IIAA 2GZWA 5BXXA 4IESA 5JR7B 1CAXA 1ZZ9A 4MGYE 5I8TA 4AQ2A 4N9HA 2H0VA 5I0UA 3LOIA 1NE6A 4DINB 1O3RA 2D5FA 4K8FA 4XF9A 1CAUA 1ZZBA 2XKPA 3H3ZA 4F8AA 5I93A 5JCTA 4QGLA 4PIYA 4IEOA 4GULA 4AQ6A 2K9ZA 4MX3A 3RYPA 2V09A 5BY5A 5I91A 2XHKA 3ROUA 4KWKA 2B8MA 4Q0SA 4BHPA 4HVQA 3EBRA 1ZREA 4IEWA 4MZUA 5LEKA 1XRUA 1RTVA 1SFNA 3OTFA 4FAHA 1OMIA 1CAXB 1I5ZA 3H9AA 1GQGA 4AXOA 3NL1A 4HMZA 4IETA 2VECA 4HSJA 2ETEA 3MDPA 4HN1A 3HT1A 4P9GA 1CAUB 1UD1A 1CAWB 5I8SA 4JV4A 1UW8A 2GC3A 2XLAA 4JTOA 2GC1A 5LEJA 1UIKA 3TNQA 5I0SA 3CF6E 4J1WA 4MGIE 4D7TA 2IXCA 1H1IA 3D82A 4IEUA 5FDBA 3ELNA 5KHHA 1PM7A 4I01A 3HIFA 4EV0A 2O8QA 4D7SA 4OFGA 1YFYA 1Q43A 1PMIA 4EWDA 2O1QA 1ZRCA 4O9GA 3SCHA 1YLLA 2WC2A 3E5UA 5CADA 2OZ6A 4BYYA 4BIFA 3DN7A 2PTMA 3WW4A 2EA7A 1RUNA 1WLTA 1X8EA 5FCCA 4Z82A 3H7YA 3HQXA 5AVPA 4LUKA 5FPXA 3GBFA 5K8SA 3MPBA 2FMYA 4YNIA 3SXWA 2MHFA 2XLFA 2BYVE 4IEZA 3UKVA 2Z69A 1J3QA 1O5LA 5BPXA 5FLHA 4IEYA 4QX5A 2IXJA 4ORFA 5KBFA 2VQAA 1ZRRA 5JAXA 5FLIA 4HSLA 1ZNPA 2HJIA 3O14A 4UXAA 2UYBA 3QOPA 2D5HA 4I02A 5KHGA 5FQ0A 4IEQA 5F1RA 1NE4A 1G6NA 3UKTA 1LR5A 4LUMA 1I6XA 3H50A 2GH2A 3RYKA 3KCCA 2BNNA 1NZCA 4XFAA 4E2GA 5JSRA 1QY4A 1LB2A 3ES1A 5BV6A 3EJKA 4Q0VA 4XEZA 4ONUA 3UKNA 2XL9A 2ZKLA 1YHFA 1U12A 3FZ3A 3LAGA 1O3TA 1CX4A 2EAAA 1VR3A 1EPZA 2PAMA 3DKWA 4I0BA 3SCGA 2E9QA 1CAWA 5J7MA 3BU7A 4JTNA 3BCWA 5KHJA 2K0GA 4QGNA 4WBBA 2HKXA 2GC0A 3C3VA 4R52A 3E97A 1YFWA 3I7DA 2PAKA 3LA2A 5FQ0B 1O4TA 4B29A 3ES4A 5JSPA 2BGCA 2GAUA 4QGMA 3OGJA 4XF3A 1UCXA 3B02A 3RDIA 3ETQA 4E2QA 4UBGA 3KSCA 3LZZA 4YYOA 2N7GA 1VP6A 2IXHA 3E6BA 3QACA 1X8MA 3BALA 5FLJA 1LRHA 1NYWA 2XL7A 2BEOA 2CV6A 2DCTA 2ZCWA 4XF4A 2H6BA 5J48A 2CAVA 3NJZA 3MZHA 5BUVA 5KHKA 3E5XA 3D0JA 3IDCB 4N9IA 5LRSA 3OF1A 4XF1A 3LWCA 1J1LA 3N4MA 2Q0AA 1V70A 4J1XA 3FHIB 2BNMA 2PFWA 3M70A 2XKOA 1RGSA 4BH9A 2PHLA 2B9UA 3CLPA 4LA2A 4IEXA 3VHRA 3JZVA 3H3UA 1ZRFA 5C8WA 4XFIA 5JSOA 4I09A 2I45A 3ST7A 4I0AA 4CYDA 1YUDA 4MGKE 3SMHA 4QXKA 4QMAA 4EWAA 4ZU7A 2WFPA 5I0TA 1YFUA 1ZZ8A 4Q0UA 3RZZA 3U0ZA 1YWKA 4UBHA 5HI0A 2KXLA 3BB6A 4MH0E 3M3IA 1YFXA 4R8HA 1SQ4A 4AVAA 4EROA 1RL3A 2ET1A 4NVPA 1EY2A 2Q1ZB 2MNGA 4HVRA 2H6CA 3E6DA 1RUOA 1H1MA 2EVXA 1LKNA 2PQQA 4FAGA 1XE8A 4FBFA 3LA7A 1FI2A 2D40A 4Q29A 4LLOA 1Y9QA 3FX3A 2F4PA 4ZU4A 1GQHA 4LULA 2IXLA 4MUVA 4XETA 4META 3H1WA 4KWJA 1OI6A 3CJXA 3ZDSA 4A2UA 3SHRA 3USSA 2BNOA 5T3NA 2FQPA
chains in the Genus database with same CATH superfamily
3KMHA 3TN93 1W03A 1QXRA 2D6MA 4Y22A 5T5OA 4H7LA 3OD4A 4AI2A 3LGRA 1H2LA 3VBFB 2FBEA 4FFHA 4ZS2A 3AXDA 3VZJA 5A6ZA 3E6CC 1OPMA 4V2VA 1LHWA 1MVEA 1IPKA 3H42B 4UFMA 5B4NA 5A33A 1K5MB 1GWKA 2P3KA 1IKQA 1R092 3V0AB 1M06G 2JICA 4KI5M 3RQ0A 3NNFA 1FXZA 4OUMA 3A7QA 5LBBA 3PJQA 3ACIA 4C91A 3R6SA 3MLLA 2IXIA 2Q1MA 3KGZA 4FFGA 4Y4YA 5FZ1A 3VDDB 5C3PA 4Z2AA 1F31A 5E16A 1F5JA 2PA7A 4PQ9A 1O5UA 1X9PA 4P08A 3CQOA 1JOJA 2OZJA 1WGPA 4AHYA 4OHYA 2DTYA 4YW7A 1XBFA 2OPWA 2Y6LA 4QKFA 5ABJB 1FOD2 2HWC1 3PUQA 4PIXA 5JI9A 2VM9A 5DN2A 2QDRA 1ODMA 3ACHA 3DYPA 2D43A 3JBG1 4CVUA 3CEWA 1YNAA 3F95A 5J3UA 3I59B 3O1VA 3O1UA 5IK5A 1S0GA 3N9NA 1TG7A 2UWCA 4JGYC 4QQHA 1R1ZA 1Y3TA 3VD7A 1BLZA 1RC6A 2DU1A 2VAUA 3W58A 4TYSA 5FZBA 1RITA 3VHPA 4AW7A 4D6SA 1GZTA 4AI3A 1BMV1 5FIXA 5GZGA 4BXFA 1TQ5A 1RUD2 2QQKA 1O3QA 5EXOA 4OUSA 1MEC3 2WZ8A 2YU2A 1UYZA 4UF0A 4ARXA 2D3SA 4PHZA 1UU5A 2RDNA 3OEBA 4X8PA 3UYJA 4D3WA 4RR3A 4IQPA 3FHAA 2OXBA 4RS5A 4WZCA 1AR91 1SLAA 2DCYA 3ZXAC 1DQ6A 3L9JT 5C8CB 1QJX3 3H8UA 4ZU5A 1O59A 4K9SA 1ZA4A 4KG0A 4YGCA 2VQ0A 2VNGA 4CU6A 1CZVA 1E5HA 4HN0A 2X5IB 2XONA 3EB7A 2RS13 2BRTA 5FUNA 5K4LA 2OYZA 4Y20B 3ZXKA 5F6LB 3WT3A 5J36A 1JZ8A 2P6HA 5M0TA 2R1DA 4IV1A 2IXKA 2VVEA 3I2DA 4A3ZA 4F7ZA 3WNOA 3MF6A 2WAOA 3OEAA 4YM2A 4AVVA 5T52A 1N1YA 3MW4A 3R0RA 1RUI3 2DFBA 3NJVA 5GLTA 1GOGA 1N47A 4IEVA 1EPWA 1N1SA 5FY9A 1B35B 1DCSA 1UIJA 4FT8A 4W8JA 2Y0OA 1HQWA 1SFYA 2P17A 4YM1A 4AL9A 5EYYA 2DUPA 3ZSEA 4HBNA 3AMQA 2JJ6A 3LD8A 4JQTA 4UW5A 2JD9A 4QU1A 1R081 4E2SA 1BVVA 4MXVA 2YBKA 2JECA 1O7FA 1ZBA2 1RMU1 2D6NA 4QDRA 4RD7A 4PQQA 3WXPA 2JE8A 3H8XA 2A6VA 2UYAA 4M4RA 3MW3A 4YZ4A 5C4WA 3IDAA 5BNOB 3OCPA 4Y26A 4F3JA 1UZWA 3POYA 4LK7A 2VMFA 4Y33A 2DVFA 1W28A 5FKCA 1WBLA 5JXIA 2XG3A 1SPPA 4WM7A 2W0XA 3WVJA 3WW3A 1HJGA 2VZRA 2J7MA 3ZR5A 4COUA 2C4XA 5B2GB 2RM22 1XC6A 1PGL1 2NLRA 3T30A 4IE6A 1J83A 2JDMA 1I1EA 5FWJA 4V2WA 3PVBB 1LU1A 3UGGA 2WQ8A 3FLTA 4H3WA 2ZGRA 2OA2A 3DUIA 3J4UH 2A6YA 1NA1C 4KU8A 1MS8A 3IWZA 4GA9A 4QM9A 3WQ0A 4A45A 5F39A 1OLQA 3AYAA 5C3OA 5HCHA 2WFF3 1ASJ1 3AZXA 4XZUG 4DEVA 4CEWC 1FATA 5A6YA 4CU8A 3VZKA 2J1VA 2VPVA 2LW8A 3LF7A 5F32A 1JUHA 1BK1A 1YO8A 4NWVA 2UWBA 5I8YA 1GZWA 4OI0A 5IK8A 4TLFA 5A3WA 4PDWC 2ZHLA 2VQTA 4EZHA 3IIAA 1ND2B 5CB7A 2GZWA 5DAQA 1Q56A 5CFDA 5JR7B 1VMHA 4N53A 3GBGA 2WYSA 4COZA 3M3OA 3I4IA 4AOCA 4AQ2A 2QQIA 3AZZA 1DQ2A 1W8UA 1Y4WA 1H9WA 5FYCA 5I0UA 4W6YA 2PMWB 1W8ZA 1DGRN 1SG3A 5FPLA 3ZYHA 4DINB 3FBMA 3ZYIB 1FYUA 1MS5A 2VOTA 3POFA 1N3OA 3OOXA 1NQDA 4K8FA 1CAUA 2XKPA 3H3ZA 4Q27A 4F8AA 2Y26A 2PLV3 1PO12 4AQSA 1PK6C 5CKNA 3T0BA 5LY1A 2OUJA 2WA3A 3QD6A 1ZBE2 1MZ6A 3U37A 2BW8A 5C9AC 2A73B 3WQBA 1DU3D 2VE1A 2B8MA 4GB32 4N43B 1DGLA 3EBRA 5D8AB 4JGZC 4PI0A 3M2MA 4CUAA 4MZUA 1XRUA 4GMP0 4XILA 1RTVA 2WA4A 4Y1VA 3OTFA 4ARYA 5IFPA 4A7YA 5LBFA 1GQGA 4QQLA 1EUTA 1FMD1 4AXOA 1VAKA 4FFIA 1CPMA 1VBE1 1VBC2 3NL1A 3UJOA 5JLVA 2JE9A 4XCBA 1EV11 1OLMA 2A6XA 5DDJ3 1WCKA 4WVMB 3HT1A 2Y33A 5IVEA 2FDKA 4QXHA 4BCUA 1DG6A 2A3XA 1PGSA 3KB5A 4DOUA 3H8RA 4LBKA 1CAWB 3ZYBA 1ENRA 4QPIC 1QJY2 2GC1A 2VW2A 3UT0A 5K7PA 5LZ6A 2JEMA 3VD9A 1QJU2 3CJIC 4JCKA 2KD7A 4LKSA 1VBD1 5A7QA 5K0UB 2Y60A 3HPNA 5FBJA 4YZ5A 2VZPA 5FDBA 3OBRA 2XOMA 1PM7A 2ZEYA 2ZHMA 1N1TA 5FZ7A 5KHHA 3K46A 4KGGA 3O1MA 2B9VA 4TLGA 3ZN5A 3KZ4C 5C3QA 4U2AA 3NQHA 3J7MA 3MIHA 1YFYA 3WNKA 1XE0A 1LJ7A 4B8EA 3SNMA 2VQUA 1FPN3 4AEDC 2VR4A 5LWBA 5D2AA 5A1LA 3RWNA 2Q8CA 3U4SA 5LASA 1WMXA 3E5UA 1G9FA 5GZCA 1GR3A 4BIFA 2PN5A 2PTMA 1OSGA 2RMU3 1DIWA 1GWMA 1W9FA 3AP6A 2EICA 5FY4A 3ZYJB 5KR7A 1Q8PA 3TAYA 5IJRA 4YW2A 4IDZA 2VNVA 2WKKA 3RZKA 5AVPA 3U78A 3ZYGA 1IS6A 2JKBA 1PIV2 2CDOA 3N9PA 2Q5TA 5FK8A 2UU8A 1W3XA 2R32A 5IVJA 1RUJ3 3I2OA 2BBAA 2FMYA 5JI7A 1LOFC 5F37A 4FP3A 3SXWA 1WKYA 4NPMA 2VMGA 3VBSC 4Q4X1 5CG9A 2ILMA 1Z0HA 3FUQA 3JQXA 2WNEA 2CSGA 3OUJA 4Z2WA 3C8XA 1HLCA 3RZMA 4QX5A 1LGBA 4AI0A 3HJRA 3GBWA 3ZXLA 4NROA 1X9TA 3HOBA 2R043 2GNBA 5I0DA 3N7LA 3U1XA 1OOPC 2HJIA 3JUUA 3FHQA 1VRH2 5E89A 2UYBA 1X50A 2AZ5A 2JG8B 3QOPA 1XNCA 4P02B 3WV6A 3B9CA 3SEPA 1FAYA 3WEZA 2A7AA 4LJHA 4FOVA 3DPRB 3DGTA 4OVEA 1HXS3 1NE4A 2DWRA 4GH4A 1Z7S1 3ZFGC 2VTXA 1OD3A 5A7NA 3UKTA 5A3LA 4LUMA 4HXCA 1W6QB 1I6XA 4CCCA 2LRPA 4R9BA 3NNJA 1XSQA 1NZCA 4EE2A 5JSRA 1TE1B 5JZGA 1BEV3 1SBEA 4P9XA 3AVRA 3PU3A 1COV2 4KMQA 3ES1A 5CFCB 5HCFA 4Q0VA 3O0VA 4XEZA 2QZ2A 5FTTC 5FKBA 5CA6A 1RJ7A 2DF7A 3VBOA 3CNAA 1MS9A 2XVLA 3W59A 2YMZA 1VIWB 3P5BA 3LCPA 1IGOA 4OHVA 3MV01 3DKWA 4P5YA 4P00B 1DYOA 1JI6A 3IIIA 2JDPA 3BU7A 1QQP1 4QPWA 3BCWA 2VZ1A 2WZR1 3VBRB 1R093 2QE3A 4PCRA 1HB4A 1FV3A 1PZ9A 3OSDA 2GC0A 2G9ZA 1JOBA 1GWLA 2JDKA 5EPAA 3VZLA 2R073 3I2JA 1LOGA 5FQ0B 1WZXA 4O61A 2FHRA 4HL0A 3UNPA 4GWMA 3VGIA 2VH9A 1U5IA 2WABA 1O4YA 5CAZA 4XUQA 3OPZA 4XZPA 4RR3C 3R05A 5HCAA 4XF3A 3GHNA 3EYPA 3L2YA 3BODA 1R64A 3KSCA 1HRV1 3NJXA 2JG9B 5FZCA 2E31A 2RS31 2WNUB 1AR71 4NE9A 1H1AA 1W05A 1FOD3 5FYMA 1NCRC 3PUAA 2RDQA 3QACA 5BNQA 3Q8BA 2SLIA 1YJKA 4LBMA 2ZHKA 1LRHA 1AL21 4IV1C 1ZA7A 4YVSB 2DCTA 1EUUA 2ZCWA 5HCBA 1QJX2 2H6BA 4HK8A 3ENRA 4LORA 3AP9A 1CX1A 4IV3C 2EIDA 2UWAA 1LODA 2VVFA 1CPNA 3K4AA 5JXJA 1RVF3 4NWWA 5IK4A 5KHKA 3E5XA 1RUD3 4CP9A 1V9U2 4AR2A 5HXMA 4K21A 1DLCA 1HV0A 2ZJCA 3OJBA 4JGYA 1J1LA 5FMBA 4MG2A 3N4MA 3N7JA 3T2OA 2RV9A 3GCXA 5L73A 2WBKA 2BNMA 5DAPA 1GNYA 4OQ8A 3WY6A 1KGYA 2Y6KA 4BH9A 2PHLA 4PBPA 2R1BA 3QH7A 4KWUA 3IDEA 1HV1A 1H8TC 1O4ZA 1P8JA 4J6GA 2HEYF 2YBPA 4NAOA 3SISA 5FZ0A 1GICA 4NMIA 5DPNA 2BJSA 3B3QE 5C8WA 4XFIA 3APBA 4I09A 3WCSA 1AJOA 1YUDA 4XBNA 4QXKA 2FDGA 4COYA 1YIFA 2C24A 3POBA 4QB2A 2CDPA 1FNYA 4LBQA 2Z42A 4ITCA 4XACA 3DF0A 3J9SA 4Q4V1 1UY0A 1UN1A 1W2OA 5I0TA 1AZDA 1JMUB 5FV3A 2RS52 4Q0UA 4K1ZA 1E5RA 3THCA 1YWKA 2NN8A 5FO7B 2D3PA 1W99A 3OGRA 1PX3A 3M3IA 4CCOA 4DFSA 1V6MA 1ZBA3 3J26N 2G4IA 4Q8LA 2LROA 3BIWE 4LO6B 4RHV1 4NVPA 4FCAA 1EY2A 1XNDA 1LEDA 3D5OA 1ULDA 5F8PA 3RWKX 4AF9A 1W04A 1UMHA 5DQ0A 3ZFFA 2ZEWA 4XMIA 1UF2C 1C5IA 2W91A 3AKTA 3WF0A 4HG6B 5BNPB 5CFDC 2VZVA 5E88A 4N53C 3WP4A 2Y6FA 3ZR6A 1UAIA 1RUC2 2R061 1U5ZA 4XIKA 1POV1 2XR4A 4META 1SFPA 1ODNA 5IK7A 4QPGC 2ARAA 4A6SA 4Q8KA 2VL4A 3AMMA 1ULGA 4PT6A 2RR12 3KLSA 5CG8A 1EAH1 1WMDA 4XYXA 3ILFA 3SHRA 3USSA 3NNLA 3T2PA 2VXRA 1QGLA 3NV4A 1HN1A 1QJFA 2DCJA 2Q8OA 1DQ5A 3MIGA 2FQPA 1IPJA 2OPKA 1UOFA 4E8DA 4NIDA 5L9RA 4X6RB 3I54A 2DCZA 2EIEA 1NA1A 3WDVA 4XUTA 2ZGUA 1LECA 3THPA 3ZO0B 1NX9A 4I3PA 4C0HA 5IVYA 3LPFA 3VDAA 2P2KA 3HN3A 4Q4Y1 2JENA 5DXDA 5C4WB 1SMVA 4GKYA 4I3GA 5FOJB 1AR62 3BPZA 3K3OA 5GJ6A 3JB4C 4IEPA 1AX2A 1VJ2A 3CO2A 4WM7B 1MQTC 3JD73 1BKZA 2VG9A 4Q4W1 1VBB1 3ZOIA 2ERFA 5J96B 3M3EA 1EP0A 1JUIA 3R4DB 4XJWA 4D8MA 1WD3A 1TME3 4D0QA 4A6OA 2PYTA 1VMJA 4Q5OA 2GMEA 1PO13 2W3JA 4ASMB 4D6QA 1LOBA 2W1UA 3AM2A 2XWBB 4QX1A 4WVZA 4CDWC 4EZ4A 5K0UC 1XE7A 1OQDA 3WUDA 2Z2SB 2JDHA 1ZBE3 2W46A 5FO9B 1PGW2 4YSFA 2C6SA 4LPLA 3USUA 3H7JA 4BQ3A 2WIIB 2ZX2A 4ASLA 4EWEA 1GMMA 4FO9A 4XJ9A 2NQYA 4IERA 1PNGA 4QDQA 1EYBA 1PMJX 3AKRA 3FWEA 3TRSB 4YZ1A 4CDUC 1GOFA 4OLLA 4YGEA 5JXHA 1Q3EA 4E4DX 3HEIA 3I8TA 4FVVA 3SCFA 1W6OB 3VBUA 2GDFA 4ES8A 2C0ZA 5FYUA 4J25A 3K51A 4QM8A 5C9AA 3ACLA 1O6UA 1RHI1 4XFGA 3ZIWA 5EIYB 4CPBA 2KA3A 4H7MA 4XAAA 2WWJA 2X10A 1K42A 2P37A 4JGZA 3NVCA 3RSJA 4ZXKA 4LIVA 2UURA 2ATFA 3M1HA 3BI3A 2GH8A 1O8SA 4AVCA 5F5CA 1LGNA 2ADDA 2DDUA 3GCWA 3IB3A 1PO22 1S0EA 2D7FA 4IGQA 2YXSA 1QJZA 3UV9A 3V64A 2BFUL 1UOBA 1W9YA 2FDFA 3U10A 1MZFA 3HQUA 1DYPA 3PURA 4XIOA 3OG2A 3T1LA 4E9KA 2P3YA 4XQDA 4NR1A 1JZ4A 3MIFA 3OB8A 3TWIA 4E4SA 1OLRA 3FC0A 4YW6A 2VOXA 3RYRA 4W6WA 5A7WA 5EP9A 2ZGMA 2D6PA 2RMU2 4IXLA 3DV8A 1E5IA 5E1RA 5CU1A 2J22A 4QPIA 3V0BA 4YG3A 4YARA 5AC91 3GALA 4AAPA 3WHTA 2W87A 3CJIA 3AL6A 4CEYC 2P1BA 4BWOA 1PX4A 2LALA 1JU3A 1I5PA 4LR4A 2HWD3 4INDA 2D93A 3H1YA 4DRVA 1RJ8A 3MI8A 5GLUA 1RUH2 5AVAA 3ZSJA 2GNMA 1LOEA 3PDQA 4GWJA 1RUJ2 1OFSA 1XNTA 3VBFC 1GQPA 3VBHC 2QVSB 4QU2A 4WZFA 2IFRA 4XXAA 2E33A 1G86A 3ZYFA 2ET7A 3PUHA 5EJ3A 1AYM2 2VNRA 2AH2A 2QUOA 1LHVA 5JVVA 3IAQA 3T4HB 3Q9OA 4MLOA 5C6CA 4AK3A 3RZJA 2GMPA 3PMSA 2UY8A 4YW1A 3D4KA 3LDBA 4AEDA 1H30A 1ZRDA 1TEIA 1G9DA 4FSJA 4FQ4A 2FDIA 1A78A 4HLTA 1PIV3 1WLDA 5EHDA 1C5HA 1CAVB 3FUOA 3NW4A 4JVAA 4PJYA 4EN8B 3VDDC 2HEWF 4LXLA 2K46A 3RI8A 3VD4A 2VTFA 2ZX0A 1WCDJ 3BGAA 3UESA 2QNKA 3HT2A 5HXVA 5JZGC 5T54A 4M3CB 5ACA2 5CZKA 3EQEA 4B4PA 4CXXA 5LY2A 4OHWA 4MXWB 3VBOC 3NV2A 2VBDA 2ENRA 4LEJA 4UWDA 4GB31 2A5ZA 1LOFA 5EJZB 4B7KA 1NY71 2DVBA 2G9FA 5FXVA 1HW5A 3ITQA 2WINB 3ATGA 4DPNA 1A6CA 5FYBA 1VRH3 2YPJA 2C9KA 2ZAHA 4Q26A 5DAWA 4CUCA 1DDLA 3I2IA 1AR93 1LHNA 4CCMA 1AYN1 3BTAA 1U5XA 2VULA 1IS4A 3POSA 1JZ6A 2I2SA 5FMOS 5IWFA 3WW2A 4CE8A 3ZYRA 3AMHA 5FUIA 5A7OA 3RGBA 4CA9A 1OOPA 3MUZ1 2PAEA 3RPQA 1S0DA 4Q2FA 1FV2A 1TMF2 5FRAA 3B93A 4LHNA 5IAXA 1VAMA 3MIEA 4H14A 4CDXA 1XOYA 2FZ2A 1BK0A 1C8M1 3WCRA 3FBYA 2E32A 4IESA 5CKQA 1COV3 4EN6B 5C8CC 5IT6A 2VUJA 3WF2A 3ZLIA 4HFSA 1RUF1 1WCUA 3ZFGA 2WZPP 2QQPA 2X5IC 1KD7A 1QJU1 2R072 2H0VA 2XUMA 5IVFA 2Y38A 1OA3A 3DYOA 5EYXA 3LOIA 2ZMNA 2F4LA 1RUG1 1QMJA 3VL8A 1Q8VA 4IUGA 4F83A 3B94A 3DEMA 5A3TA 5IVBA 4XF9A 5I93A 2GMMA 4K1YA 4AGGA 5FZKA 1HJFA 3RMYA 2OUHA 4QGLA 3CBNA 4PIYA 1G9AA 3MIDA 1W9TA 3PMEA 1IPSA 4YWAA 2HWE2 1URXA 4MX3A 3IT8A 1NAEA 3U75A 5BY5A 2XHKA 2A1XA 2EALA 4LK6A 5CBLA 3WNNA 3W5NA 1PVC1 3MV11 2TUNA 4R9DA 1RMU3 5FZFA 1KJLA 4L97A 1BBT3 4DIQA 3IZOA 4LNVA 1X36A 1GKBA 1WWYA 2WO1A 3DCQA 4LKEA 1PMHX 3WNMA 5LEKA 2YC4A 3P6BA 4FAHA 3LEIA 1RVF2 2VOVA 1CAXB 1HDKA 1I5ZA 4QKBA 2HWB1 5FO8B 1CWPA 4FOQA 1UO9A 1GZ9A 1D4M2 4XHBA 5J37A 2W94A 1GOHA 5FZ4A 1JYVA 2QQOA 1HQNA 5CEHA 2H0BA 1W90A 1RUE2 1N3QA 2BU9A 2WS91 5A6QA 4QKNA 5FPBA 2HWF1 1UOGA 2I07B 2VCCA 3B5LB 4P9LA 4R4ZA 3WHUA 4P9GA 2R0FA 1UD1A 5KXEA 1HB3A 1ND3C 3AC0A 3ACFA 3AFKA 4MYEA 4YGBA 2GC3A 5I8SA 1NCRA 3NAPB 2ZX1A 3CHXA 2ZGLA 3ZDVA 4BZ4A 2Y64A 4YG0A 5I0SA 1ENSA 1V9U3 5C7GA 4J1WA 3BOPA 2CGOA 1H1IA 4DXTA 4YW4A 4XBLA 1CQ9A 2ZGPA 2DTWA 4IV3A 5HPOA 4QDSA 1S2BA 2VCAA 1JXNA 2JB8A 3K75B 4QD2A 2O8QA 2VUDA 2X29A 2ZKNA 2WZEA 3OUHA 3TN91 1CZTA 2B45X 3U14A 1W8FA 1PZ8A 4XJAA 1NLQA 2O1QA 3DECA 4Y1UA 2BQPA 4OCTA 3IPVB 4QPYA 2QZ3A 5CADA 1UKRA 1SHWB 2OZ6A 2ZGNA 4BYYA 2WL1A 3DN7A 1VB4A 2W68A 1STMA 2WNVA 4FP2A 1NT0A 2EA7A 1N1VA 4RQPB 1RUNA 1XU1A 1RB8G 3ZFFC 1X8EA 4UFJA 3NNMA 1H8TA 5FP8A 3LEKA 3GBFA 1GANA 2D44A 5L9VA 1D2SA 2MEV3 4CXWA 5HBAA 5K8SA 2NM1A 1S0JA 2IVJA 2RS53 3MFCA 1S55A 2YY1A 1DLLA 3OBTA 4JAAA 4UFIA 5FMCA 1RIRA 4YNIA 1B09A 4C8DA 5JUVA 2XLFA 4LO7A 1F15A 1QIQA 1JS9A 5D21A 1KITA 4ASKA 5F6KA 4CDQB 2Z69A 4XC9A 2WRAA 3VZMA 5BPXA 4YW3A 2PHFA 2IWGB 4NRPA 4P9JA 2IXJA 2PHRA 3PTRB 2IUWA 4KNCA 4S2FA 1ZRRA 3VHNA 3WP6A 1H6XA 1S0FA 1ZNPA 5IYYA 4DY3A 1IQDC 2GP3A 1AUYA 4LHLA 1WCSA 2DU0A 4Y24A 3JB8A 5GKAC 1KEXA 2D5HA 2XJUA 3POWA 2Z4FA 3OY8A 4B1LA 4BPZA 3JQWA 2BOJA 1RUC3 2CTVA 2JX9A 1MEC1 4DZGA 1LR5A 2JDZA 3N7MA 4YVWC 2QTWB 4M01A 1WW6A 2B39A 5GLZA 5LA1A 3RYKA 1G8WA 1UY1A 2RR13 3KCCA 3KVBA 3OBAA 3O1RA 3H8OA 2BNNA 3ABZA 1HN0A 4B4QA 2V4AA 3D3AA 4LMFA 2PXJA 3T09A 1LB2A 5FY7A 5BV6A 3EJKA 1BHGA 3S6PA 4FPYA 4ONUA 2RS11 2XBO1 2XL9A 2ZKLA 3JD72 3UKNA 3VZNA 4DEQA 2R0HA 2JXAA 3V56A 5F2WA 3W5MA 3J7NA 4QPGA 3D6EA 2XJPA 1TME2 1VR3A 2XJRA 1EPZA 3K4DA 1AR63 2K0GA 3MLJA 4Y5SA 4JKLA 1RUI1 3THTA 3AJZA 3VBUC 4KH9A 4DXSA 4WM8A 5BNNB 4LOSA 3DXUA 5H9RA 1IKPA 1YFWA 2YGLA 2PAKA 2Z5WA 3I7DA 3IN9A 2I74A 3J8F1 2AEYA 4NRQA 2ARBA 3HN1A 2AUYA 3AP7A 4IE4A 2KR2A 1W9SA 3AZVA 1AR82 1SCSA 2BGCA 3I2KA 3SQOA 1V6LA 1ENQA 1F5FA 4YFWA 4BXSV 1C3HA 1XYNA 2XVKA 3HBZA 4JDMA 3RDIA 5FZDA 1MQTA 2FCVA 4W65A 2A71A 1ACCA 3ZN6B 4YYOA 1A8MA 2XXZA 4P9WA 4JQRA 5A32A 1BQPA 4ZXEA 5T5PA 3I2GA 1X8MA 3AVSA 5FLJA 1NYWA 4E4ZA 2XL7A 4KGQA 5APAA 5FMDA 3ZFEB 1UNBA 1W9WA 4CDWA 2CV6A 4NOTA 5K0UA 4HPKB 3LDKA 1NCQB 4HKWA 3W9AA 1R1A2 1PNFA 4DQAA 1CD3G 4M0NA 4NN0A 4QQOA 4TXWA 5JIUA 1H4HA 4CEWB 3NJZA 3I3MA 3MZHA 5LB6A 5L7OB 5LA9A 1GZCA 2D6LX 4XVHA 2VZ3A 4NJ4A 4CDUA 5LCWL 4BQYA 3JXSA 5LRSA 2VMIA 5FMOL 4NHYA 3TEXA 1YEWA 2EIGA 4XF1A 5SV5A 3BTXA 4XW3A 5EQUA 4PDWB 2ARCA 2O8OA 5A7SA 2WFF1 4COVA 4FOWA 3WLUA 1PO23 4Y1XA 3T3YA 2QQMA 3RJRA 4XHXA 3FHIB 5FY5A 1OA4A 2HWD2 2DUQA 1E57A 4Y1YA 3F2ZA 3POIA 5FXWA 3VKNA 2E6VA 4YGDA 2B9UA 1WW4A 1ALYA 5ANQA 4LA2A 4ZS3A 3JZVA 4AE2A 3SH5A 3USUB 4EN7B 2W1QA 3MBWA 2XH6A 2I45A 2ZGTA 1PK6B 4DUVA 3GHMA 1I3HA 4AFMA 3AYCA 2ZMLA 2YROA 2G1MA 1LULA 1JW6A 5BYNA 1RUH3 4ZU7A 2WFPA 1KDMA 3ZYPA 3VKFC 5JOWA 3JBG2 3WSOA 2V72A 2J1EA 2DUOA 1OA2A 2PLV1 1ZZ8A 3B69A 4XMAA 4C1WA 1AYM3 2E63A 4A4AA 4C90A 4CEYA 4AGVA 1UZZA 3LIGA 5LBEA 5HI0A 3OYWB 4XUNA 1US3A 2HEVF 1JZ3A 3MO4A 5EV7A 4IGPA 2ZACA 3VBFA 3N7KA 3B00A 3VN4A 2ET1A 4B7EA 3VBHA 4EROA 3VUOA 1BMV2 1VBA3 1W6PB 2MNGA 1Y43B 4IE0A 5EJ1B 4R9AA 3T4VA 3VL9A 2EVXA 4QAWA 5F3EA 4Z8BA 3A0KA 4N90A 1AL23 1VB2A 1YRZA 3N9QA 1AR92 4CDXC 3ZSMA 1XJAA 4RA0A 1LAJA 3SITA 4FBFA 1C57A 1TNRA 1OH3A 4LLOA 1WD4A 5FJKA 5ACA3 3VD3A 3S57A 1YQ8A 3FX3A 3HNBM 3ASIA 3WINE 3WF3A 2DBIA 2GSYA 4NPLA 4HT1T 3VDDA 3CJIB 4LO5B 1BVP1 4KWJA 2OX0A 2QQUA 3HD8B 5DDJ1 3NRUA 3CJXA 3W21A 4XE9A 3OPTA 3T2QA 1J1TA 1QOSA 1D4VB 4C1XA 4N9IA 3ZMOA 2IC1A 2XHNA 4YG6A 1VLNA 1YJLA 5KXBA 2HBTA 3S0MA 3OD0A 2WAAA 1TMF3 4GALA 4M0HA 2Y6GA 4MV2A 5T5JA 2VOKA 5EWSA 1J59A 3PLQA 4GWIA 3R4UA 5EZWA 1J3RA 3DL3A 4OHXA 5IFTA 3THDA 1W6MB 1UU6A 1V6JA 3EXUA 4HZFA 4UW4A 1FX5A 1R082 3KGLA 5FPZA 1SEFA 2ID4A 4NHKA 3LIHA 1FPN1 3O1OA 4JRAA 1RMU2 3C2UA 1JODA 1BBT2 2GALA 3OUIA 4GJYA 3E1F1 4BK4A 5IVCA 3MEPA 1PHMA 4GMP1 5C8CA 1Q5OA 4XBQA 1JYTA 4BMBA 2EXKA 4QX0A 1CGPA 3ZPOA 1MACA 1QF3A 2X5IA 4XF0A 2HWE3 3U11A 3VBSB 4CP1A 4Y20A 1JHJA 2BV4A 4CUBA 5C33A 4E8CA 2WT2A 3RNSA 1PGL2 4XFBA 1IS3A 5D1IA 4AHZA 1VMFA 4Y22B 1RUJ1 5C71A 2WN3A 4RHV3 5J98B 4A41A 1DZRA 4PI2A 2LM3A 2VW1A 4YRDA 5LATA 1HRI3 1OH4A 2XLGA 3BVCA 2MPFA 4DO0A 1ASJ2 1FT9A 4URTA 4Q1PA 4AVBA 2WO7A 4BQ2A 5A33B 4NRMA 2AACA 2EF6A 5A3PA 1D4M3 4FPJA 4RYDA 1XYPA 2R041 4QX2A 3ZFGB 4Z07A 5FFOC 1OUSA 1RUE3 1YYNA 4BDVB 1CESA 1POV3 2DVDA 1QJEA 5F2SA 1J3PA 4HVOA 1ULPA 4UOJA 2WNVC 1L7LA 5FP4A 3GZUC 5BNPC 2WSUA 2RHPA 3FLRA 1HXS1 1OF3A 2IVIB 1OQ1A 3LFMA 3KVAA 5BNOA 2DURA 1H6YA 5FAXA 1OBNA 2YUEA 3N3HA 2HBUA 5FYSA 2VBPA 1YC61 3I3EA 4UYBA 1WCQA 5GALA 3B9IA 1H2KA 3KF3A 2Y0IA 4O9EA 3O1PA 4CXYA 5FJHA 3DYMA 2VJXA 4AFAA 1BEV1 1C1LA 1ND3A 4XFFA 1W3VA 4LT5A 3T1MA 4BIOA 1A3KA 4LTAA 1QH6A 1AX1A 2G19A 2D97A 1W6NA 1AX0A 3HBKA 5C5UA 5DUUA 3KCXA 3UK9A 3D0SA 2VMCA 1ZM1A 2YDEA 5KHIA 1OC1A 2MEV2 4DUXA 3MYXA 4Q4W3 4RGKA 3EHKA 1WLWA 1XB9A 2WN2A 5H9PA 4YPJA 1DGWA 4X6QB 1UZ0A 4UF0B 3AJYA 1R091 1X7NA 1XU2A 4RR3B 3IM0A 2V73A 4RS5B 1PZ7A 4KWLA 1OD5A 4LHSA 2QQNA 3C7HA 4AFCA 2R071 5C3RA 1ULFA 4NIIA 1ULEA 5I0RA 2PHDA 4JC1A 1CVNA 1NCRB 3VB9A 1ND2A 3SH3A 3VKMA 1DGWX 1VBE2 5KWRA 1CN1A 1OFNA 4IV1B 4SBVA 1EV12 1OHFA 5CNAA 4BQWA 3KQRA 1QXPA 1JBCA 1CJPA 1LOCA 1QH7A 4FPOB 1UOJA 4I2OA 2W52A 4NPRA 3KT4A 3GZTB 1FOD1 4GZ9A 4MADA 1L3JA 4W6XA 5G04L 1RHI3 1NLRA 2YFUA 4WV8A 3VZOA 3WF4A 1WA4A 2UY9A 3NV1A 3GZAA 3TEYA 1VBD2 5EFUA 2BUKA 4DNYA 4UFLA 1KFUL 3N9OA 1DHKB 2XGXA 4DRRA 1XNAA 3MLKA 1X82A 4PIZA 3HAGA 1GP6A 4Y3OA 4BA6A 3PL0A 3GZEA 3ZIXA 1NUKA 2VU9A 3UGHA 4BK5A 3M7AA 2GC2A 4WM8C 1W8NA 2NZ9A 3FLPA 2W47A 1RUD1 1S2EA 3CL1A 3L2HA 4JHTA 4P5HA 4MHUA 2CGPA 1CZSA 5D8AA 3O5SA 4KG8A 3TNPB 1GV9A 2X09A 3M70A 3Q8CA 2OQ7A 2Q8EA 3FJSA 3OGGA 1GSLA 2RE9A 2VZTA 3VV1A 1SLLA 3AMNA 4OUEA 2BDRA 1ZZ9A 4MGYE 3ZM8A 3AYDA 1SPPB 4LKFA 5FPUA 4N9HA 4YVWA 5FXXA 4Q1RA 1UY4A 4XURA 4YLZA 2BTVC 1NE6A 1ULOA 2LUWA 3AFGA 1DQ0A 3N35A 5FYIA 1GFF2 4WVMA 1O3RA 2P4EA 4OMDA 1D0HA 5FPVA 3G6JB 1ZZBA 5F5AA 4BE3A 2OIIA 2GP5A 5KXDA 5FY1A 5FZ8A 1Y7BA 5L9BA 2XQXA 4AQ6A 2K9ZA 1YIPA 3CZJA 1IS5A 1UPSA 4CP0A 3RZHA 4DUWA 3CKHA 3LOBA 2WSVA 2B7YA 4KWKA 1MR5A 1QU0A 4FTBA 2VNOA 4QKDA 3AP4A 4Q0SA 4ZONA 1AR83 2WWUA 5CFCC 3C7OA 4RFRB 3A4UA 1GZWB 1QNYA 1OQEA 4IEWA 1L7QA 3O7OA 1APNA 3K4ZA 4OHZA 1W2NA 1ZBA1 2A70A 4IW3A 5CFDB 1OMIA 2Z79A 4N53B 3URFA 3U07A 1V6KA 5FZOA 5FYHA 1HB2A 4UFKA 1DBNA 2VZOA 5L36A 1Z7S2 3NJYA 3H0OA 2W5FA 4HMZA 4IETA 3PVEA 2VECA 1WW7A 2W2IA 1LGCA 2ZPXA 3I2FA 4QPGB 3WZ1A 5JDBA 3MDPA 3P3PA 1R1A3 2RM21 3AX4A 1CAUB 4LBJA 4K3UA 4Y5Z0 3GDBA 4CRQA 4JV4A 2HYXA 2YV8A 2XLAA 3K77A 5FOBB 2J1AA 4K6BA 1UIKA 1F2NA 3TNQA 3LPGA 3CF6E 1L7RA 3LSDA 2WQZC 4HK9A 3IKWA 4MGIE 1KQRA 2IXCA 2X8KA 4UAPA 4UFHA 5GZEA 3ME2A 1AXZA 3GXUA 4I0WB 4K40A 4QB1A 3D82A 4N7IA 3WDXA 4IEUA 3ELNA 3SKVA 3WQ7A 4XXPA 2VTXJ 3WX5A 2VVDA 3GF6A 4I01A 1JH5A 3DXTA 2IZWA 2WZR2 3HIFA 1GNZA 4EV0A 3ZXFA 3Q8AA 4EN0A 4QWNA 1KDKA 2BGPA 1RUF3 4ZZ8A 2JIJA 2R16A 1Q43A 1PMIA 3CDZB 3SCHA 2YC2A 1YLLA 2C9AA 1S0IA 2CY6A 2WC2A 2JG8A 5A32B 1MS0A 2ZS6B 1K5MC 3PUSA 3WW4A 4LBOA 3SH4A 1OURA 4BQXA 3DPRA 1WLTA 3RG0A 4NHMA 4MGQA 3RS6A 5FCCA 1HRV2 4Z82A 2VUAA 3H7YA 4PLOA 5B4XA 4DY5A 3HQXA 3UETA 5A3NA 1W8WA 3KV6A 4OZOA 1W6QA 3MF9A 2RS32 1AR72 1F4AA 1VBA2 5E6HA 4DMIA 4AEJA 2HWC3 5A1AA 4FPLA 4M3CE 3C7FA 1DZQA 1WMFA 2BP6A 2RVAA 2D3RA 3JBG3 4RSUA 5JPMB 5LW9A 3MPBA 4M00A 4V1PA 4JZRA 4CDUB 1PO11 1AL22 1H0BA 2RDRA 5CFCA 3WP3A 2ZXQA 5JWPA 4XDQA 4XTMA 5JIAA 2VUCA 1ZBE1 3I3QA 4U36A 3UKVA 2V5DA 1REDA 1J3QA 1OVPA 4OULA 1O5LA 5ABJC 2CHHA 1G9BA 3WP5A 2CYFA 4WVVA 4TZDA 3LB9A 4EJRA 5KBFA 4D69A 2VQAA 3MFAA 4ES9A 3WDYA 4QXCA 5FLIA 4HSLA 3VBRA 3N9MA 3O14A 3T08A 5C5TA 4Z92B 1TVGA 4A7ZA 1W8OA 4A7KA 3RMXA 2W39A 4BLIA 3CZUA 4P9YA 5FQ0A 1UL9A 3Q8EA 4BQ1A 1G6NA 4QX3A 1VBC1 1W8TA 2ZAAA 3BTZA 1OT5A 3H50A 2W95A 1YI9A 5JR2A 4M3CF 2GH2A 5JMOA 4WVWA 3S5QA 2WJSA 1F8VA 4FTEA 3ZVXA 2ZEZA 3WG4A 2JG9A 4XFAA 4P14A 2QDNA 2WNUA 2JWPA 4QT6A 1JTZX 1QJY1 4CCNA 4CP2A 2ADEA 4QHBA 2XWJB 4Z1VA 4CEYB 2R6QA 3LEMA 4AFBA 5A6XA 4TTGA 1O3TA 1CX4A 4BU2A 2EAAA 4GD4A 3HNMA 1LOAA 2JE7A 2PAMA 4S2DA 4YVSA 4D6RA 3VDCA 4Q4V2 2E9QA 3SCGA 3TB0A 4NIHA 1F35A 3VBHB 3A0NA 3TYJA 1REEA 1OF4A 2D6KA 2G9GA 4GWNA 2AEZA 4WBBA 1IHMA 2HKXA 2DCKA 4ZPIA 1R083 1B35C 1UX6A 2HWD1 2B4KA 1E5SA 2W1SA 5DAVA 1QHDA 5TSWA 4AI8A 2CWMA 1KRIA 4GH4B 1XQNA 4RHV2 1K45A 4GIQA 3ES4A 5JSPA 1KS5A 2DVAA 4MO3M 1AXYA 1D0GA 1HRI2 2BPA2 2OT7A 4RQPC 4JDNA 4SLIA 3TBDA 2RG4A 3KD4A 4UBGA 5DUWA 4YW5A 1H2NA 5J1XA 3NMBA 5JZGB 4G4FA 4ZKTB 3NNGA 1MVQA 3MIBA 1PIV1 1VP6A 5BNOC 2R062 3PVOA 2IXHA 3E6BA 1YQCA 3VBOB 1NOVA 1WBFA 3BALA 5JMCA 1YI7A 1CIWA 2VBBA 3ZPYA 3KCYA 3GGLA 5DABA 3I49A 4LIUA 4ATEA 3FMGA 5JOXA 1EAH2 4FI9A 1BJQA 4N7UA 4YZ2A 1ASJ3 2RJ2A 3GNEA 4KBZA 3S30A 2RJKA 2ZGSA 2PHWA 5IAVA 2OW4A 4CDQC 2ZTNA 3ILNA 2X05A 3A23A 1JZ5A 5KC6A 2O14A 1U5YA 3D0JA 3V65A 2WR9A 2WQ4A 3JU9A 2EIBA 1SCRA 1WLCA 3AB0A 3HQRA 4W50A 4A44A 1H4GA 1VRH1 5F3CA 3OPWA 1UYYA 4K7JA 2R49A 1RYYA 5FXZA 3NV3A 5JOZA 2Q0AA 2E7AA 4Q4Y2 1V70A 4AAXA 4XJZA 4LOTA 2TBVA 4J1XA 4URAA 4YM3A 4TSVA 1XNBA 1V00A 3I97A 2ARXA 3I3BA 3OGVA 2XKOA 2PHXA 3AZYA 2XBO3 4QX8A 3I2HA 4Q4W2 1AVBA 4AI1A 1VBB2 3KS7A 4H55A 4PF1A 4RN5A 3VHRA 4XOGA 1ND2C 3CIHA 1ZRFA 2P34A 5BNPA 4AVSA 5JSOA 1SZBA 1COV1 2DV9A 4MOAA 2XVGA 4XQWA 1CIYA 4OI2A 2D98A 3WDTA 4CYDA 5C70A 3POJA 3C7EA 1Q8QA 5L19A 5FZIA 3WOGA 4QMAA 5IW0A 3J8F3 4GJZA 4NO4A 4EWAA 4OI4A 3MGUA 5F3IA 4CP9B 5DZGA 4EQVA 2AC1A 1MPXA 4JGYB 4UBHA 1WW5A 4HKLA 4P9IA 2DYCA 3BYWA 4R4XA 5BNNC 1YXWA 2RJLA 4LQRA 3ZXGA 1DP0A 4MH0E 3NWKA 5GLWA 2FCUA 2GNTA 4R8HA 3RZLA 1RHI2 4LITA 5F3GA 2ZX4A 1BBT1 4N43C 1FMD3 1SLCA 2Q1ZB 5C3SA 3KV9A 1KS4A 4YZ3A 5F9TA 2H6CA 1VBE3 5D8AC 1RXFA 5GZDA 1EV13 1Q8SA 2YC0A 1LKNA 5JOYA 2NP0A 5FZ6A 2J1UA 3M3CA 1FI2A 3BKZA 1MS1A 3S5AA 3KT7A 3KWVA 3LE0A 1ND3B 2C5DA 1Y9QA 5A80A 1T6GC 2GNDA 4OYUA 5GZFA 2XDVA 2IXLA 1W6NB 4MUVA 4XETA 1K12A 1WUVA 1VBD3 3AL5A 1POQA 1W0PA 4EN9B 3ZFEC 1QJX1 4LBQB 2JDYA 4NHXA 2JDNA 1IG3A 1CJDA 2BWAA 3ILRA 1NCQC 2XB6C 1W2UA 4BOWA 1ULCA 2P6CA 5FZEA 5T3NA 5AC92 4LA3A 1WA6X 2WYFA 3PJYA 4PBOA 5L7OC 3QCWA 1ZZCA 1V9U1 5A7PA 1F9KA 5FYYA 3S7EA 2V5YA 3NKGA 3UGFA 4ATFA 2W9XA 2A6WA 2ZBJA 1W6OA 1ZVFA 3R4SA 1XXNA 3FE5A 1NXD1 3OGSA 2QQLA 3O1SA 3LSEA 2Q30A 4AYUA 1VE0A 3WW1A 2CU5A 4PLMA 2HYKA 2VW0A 1HB1A 2EXHA 3ZFFB 2CNAA 2JKXA 1AL0G 1IOAA 1SBFA 5FZHA 2BVVA 4PLNA 1QDCA 4IE7A 3QBQA 2QJVA 3AP5A 4KL1A 3ZKUA 3NKTA 2VO5A 1O3SA 2XJQA 2EXJA 3G7DA 5FBZA 4G9SB 1C28A 2WNOA 4XJUA 5FZ9A 4MGTA 4OZXA 2VMDA 3B7MA 2PQSA 1LENA 1VALA 2WUHA 3M3QA 5LK5A 3ZSKA 4FQZA 4FPHA 1V6IA 3H1MA 5F7UA 2QQJA 1JN2P 2VOWA 4Q4X3 4AHWA 4RFT0 2YHJA 1GBGA 2BVBA 3ZKYA 4BJ0A 2GU9A 4NIAA 4B1MA 2MEV1 2GN7A 4OMCA 3HWJA 2Q4SA 2RS51 1NA1B 3IBMA 3INAA 1QEXA 1NY72 3P3NA 4FPGA 1YQ2A 4LKDA 2QCSB 2CAUA 5KC5A 4JX0A 4M4PA 5JXGA 4Q0PA 2FMDA 1DZTA 2FCTA 1AYN2 2GN3A 2ORXA 2C26A 4KQ7A 1JYIA 2ES3A 2B5HA 4EYUA 5A3MA 4BLJA 1VRBA 1Z7S3 4KU7A 4K20A 2Q1FA 4YVWB 5CYYA 1ZX5A 3KQ4B 3ZN4A 2WO3A 1UZYA 5FYTA 1RXGA 2JG8C 2XMLA 4MVTA 3E5QA 1C8M2 5CKMA 1TNFA 3NSTA 1A8DA 1DYKA 1RUC1 2F17A 3DPRC 3X29B 1RUF2 1PVXA 1CAVA 1ZRIA 3BN6A 3EO6A 3LFIA 1OUXA 2P5BA 5F5IA 2ZMKA 1JU4A 2CGNA 4Y1ZA 5FUPA 3RRDA 4IL7A 3ZMNA 1RUG2 2RR11 1NXMA 1V6NA 1QXJA 2ZZJA 4XTPA 2VC9A 4GXLA 2CL2A 1PM4A 1QQP3 1UPIA 3A21A 4M3CA 2D6OX 3AZWA 2F6BA 2JDAA 2WZR3 1QNWA 3ORJA 4LBLA 3IDBB 5DG1A 3VBUB 4MXWA 4YM0A 2VD7A 4L2NA 3A22A 1D2QA 1MS4A 4XFCA 4CTEA 5C9AB 4XDOA 2KM2A 1JYNA 2HWC2 1PVC2 3FFQA 1NQJA 1C8NA 5FR3A 1OKOA 3N9LA 1UX7A 2W08A 2VZQA 2VMEA 5FZOB 1D7PM 1OXCA 1QOOA 2RDSA 3C7GA 1IZ3A 4JGZB 1AR61 4GMP3 3VBRC 4QB6A 4L11A 5LK7B 2P3IA 2YU1A 2WDBA 1HRV3 3PHMA 1W06A 3ON7A 4AEMA 3DKQA 1J58A 3IMMA 2QQVA 2RS33 1AR73 2HWB2 3LA3A 1QOTA 1UZVA 5FK7A 1K5MA 1UU4A 3V0AA 1UXZA 3PNAA 4Q0QA 3CU7A 2E51A 3SEEA 5T55A 1GUIA 2BERA 4L99A 3GJBA 2DFCA 2WS92 3O0XA 2JG9C 1RINA 2HWF2 5A7WB 2VGDA 1ENXA 1JOPA 1PGW1 4XAEA 1Y9GA 2WNUC 2YBSA 2ZOEB 1SLBA 4QPIB 3V0BB 4LO8A 5ANNA 4ZZ5A 1ONAA 4TN7A 5IVVA 2A3YA 1ZYBA 3GYDA 1SDWA 1ZZ7A 1N3PA 3HR9A 5T50A 2HLEA 4LHKA 4YVSC 3SLIA 2L9LA 4MGZE 3O0WA 4XCAA 2VY0A 5CVRA 1DGRA 3ECQA 4R9CA 3W20A 4XFHA 1LHUA 2AGSA 3O1TA 5ABJA 5LRRA 3S7IA 2E53A 2NYYA 2W1WA 1QWRA 1UMIA 4FFFA 3BOWA 2VMHA 1AHSA 3I59A 3TN92 1SBDA 2BZDA 4NUBA 4W4ZA 4AQTA 4AEDB 2J1SA 4RGAA 2C1FA 1LNSA 1ZZ6A 1JHNA 4RL7A 2AYHA 1K5JA 3JCIA 4XQ4A 1BXHA 1PO21 3BIEA 4XJ8A 1J84A 1POV0 2EAKA 2NMNA 5BXXA 3ZSLA 4E4HA 2K2SA 4BQ4A 2BFUS 5AFEA 1CAXA 2LS6A 1GP4A 5I8TA 4HOOA 2YFZA 3AMPA 4LLFA 1JYWA 4QXBA 3UL2A 1YQ6A 1GNHA 4FTSA 1Z78A 4CU9A 3KF5A 4AHXA 3AYEA 4Q4V3 2RMU1 1T6BX 2J1RA 4B4RA 4CCKA 2D5FA 5JCTA 1DQ4A 5K9YA 2ZA9A 5DZEA 4AGRA 4IEOA 2B42B 3WG1A 1NLSA 3NAPA 3T0DA 3CMGA 4GULA 3ETPA 4UW6A 3B01A 2QQWA 3MW2A 3RYPA 2V09A 5I91A 2WT1A 1LU2A 3ROUA 3SKJE 1RUH1 3AKSA 5A1FA 2W92A 4L0PA 2E26A 1NKGA 5DZFA 3ZX7A 4AZZA 3KHBA 4BHPA 4HVQA 1MZEA 1OOPB 5FZAA 1KXGA 1AYM1 3WD5A 4BMEA 4C0BA 1JZ2A 3SC7X 1VAVA 4COWA 1S4CA 1ZREA 1B35A 3KT1A 4FPKA 4RS5C 3RI9A 3MHZA 2YB7A 4CDXB 2PHUA 1SFNA 4S2HA 3GJAA 3VKLA 3H9AA 1JYXA 2FDJA 3HNYM 5FZ3A 1H2MA 3IPVA 4NHLA 1XSRA 1VBA1 2R063 5T5LA 4AFDA 2P3JA 1MEC2 3KM5A 3VKOA 1A34A 2A3WA 1V6OA 4RQPA 4HSJA 2ETEA 3BPSA 4Y5TA 4HN1A 2QBXA 1EAH3 5A3OA 3TEZA 3WNLA 5ACA1 3NO8A 1UW8A 2VZUA 3AKQA 4JTOA 3BU0A 4D7YA 5LEJA 2RS12 2XBO2 5FY0A 4DXRA 2TEPA 3ALQA 2A75A 1TZOA 1W2AX 1Y9MA 4D7TA 2R7EB 4LE4A 3WNXA 5FP3A 3WDUA 4Q4Y3 4CDQA 1XPWA 1SLIA 4AVTA 1HQLA 1UY3A 1RUI2 2B46X 4D7SA 2J42A 3K48A 3POEA 4OFGA 4UI9L 3WDWA 2XPJA 3J8F2 1F4HA 2PHTA 4AEKA 4CU7A 4EWDA 1ZRCA 1BZWA 1VBB3 1TMF1 2HH9A 4O9GA 4XABA 3WR0A 2J1TA 2XJSA 4JDOA 3LDRA 4JKMA 5KXCA 4FPCA 1GU3A 5FP9A 1QDOA 4OQ9A 5C4WC 1JZ7A 4DB5A 4TWTA 5FZGA 4X8NA 3D8CA 1C1FA 3FL7A 2WLPA 4L9BA 2FZ1A 4WM7C 3ZXEA 1I9RA 3M4FA 2FD8A 1US2A 3T0AA 2WO2A 1FMD2 1DQ1A 1V0AA 4LBQD 2ZHNA 4LUKA 3FFZA 5FPXA 5FZMA 5ERLA 3HVDA 3PVNA 1AXKA 5FYZA 5FREA 2YYOA 3HMYA 3AK0A 4ISQA 5IHRA 1UKGA 2ZZQA 3WNPA 2HWE1 2MHFA 5CISA 4HKOA 1VPHA 1KFXL 4IV3B 2BYVE 4IEZA 3WUCA 1LHOA 1Q8OA 1DF0A 5H9SA 4A3XA 5FLHA 4IEYA 4S2GA 1OPOA 2QKDA 2DVGA 4B3NA 1ST8A 3KHCA 4BB3A 3RZGA 1MZ5A 2X53S 4ORFA 4I30A 1BCXA 5LA0A 2Y8KA 3N36A 2YG0A 3ACGA 5IATA 5JAXA 3U4XA 5BNNA 3ZXDA 1HRI1 4UXAA 3TOJA 3ZXJA 1GYKA 1QKQA 4AG4A 3BTYA 2WFF2 4QQPA 1M4WA 1CR7A 1JYCA 3EMRA 1RVF1 1BYHA 2WNVB 4I02A 4CCLA 5KHGA 1NZIA 2RM23 3PU8A 4IEQA 1UYPA 4N43A 5F1RA 1D4M1 1G9CA 4QQ2A 4A42A 3PIGA 5FPAA 1DFQA 1HX6A 1H8TB 1RUE1 4HETA 3WG3A 2JD4A 4CUGA 2V4VA 4XUPA 5G05L 1FNZA 1LCLA 3J7LA 4LE3A 4MSVA 4E2GA 3FN9A 4ET7A 1QY4A 1S0CA 4O7XA 3ZN6A 3UJQA 1GP5A 1IG0A 3LQCA 2JB4A 5AC93 4E27A 1AJKA 2VCMA 2TNFA 2OVUA 1YHFA 1U12A 3FZ3A 2O0OA 1UWWA 3LAGA 1S2KA 5GLVA 3ZFEA 5E8AA 2E7QA 2EXIA 4L92A 4CCDA 5J09A 1H8VA 2PELA 4CSWA 4HPKA 2A6ZA 2BOIA 1NCQA 4I0BA 4BM8A 1CAWA 1XYOA 2BGOA 4JTNA 4QHOA 2IFWA 5J7MA 4DS0A 5FY8A 5KHJA 3AKPA 4CEWA 4GQ7A 2PLV2 3VDBA 1SLTA 1W39A 4QGNA 5L7OA 4Q4X2 2AR6A 2E7TA 2XJTA 3C3VA 3E97A 4R52A 2NMOA 1AF9A 2SBAA 3LA2A 3OY8B 1O4TA 3P1IA 4B29A 4PDWA 1REFA 1KJRA 1SDDB 2WWSA 2GAUA 4BISA 3GM8A 4QGMA 3H3LA 3OGJA 3WQ1A 1UCXA 2NPIA 3B02A 3ETQA 4E2QA 2Y6HA 2YGMA 4LBNA 4L8QA 4XUOA 3MPPG 4FXKB 3LZZA 4GAZA 5A70A 2N7GA 4IE5A 4JRLA 4KBBA 5DG2A 2JIGA 3KV4A 5DMYA 1O91A 1LEMA 2CWSA 1S1AA 3I3DA 4GB33 1HIXA 5FWEA 1O8PA 1H9PA 5AFBA 1W2TA 4MHRA 2BEOA 3K3NA 4XF4A 1PK6A 5DDJ2 5J48A 3VD5A 3M8LA 2OQ6A 1UYXA 1X33A 2CAVA 2VXJA 4GKXA 1T2XA 3MICA 4PF5A 1AYN3 5FZLA 5BUVA 5HV4A 3PUIA 4WM8B 5FP7A 4QHZA 3RJ2X 4CPBD 1WMEA 1SACA 3IDCB 4HANA 5SV8A 3POGA 4NIGA 2YZ4A 1UY2A 3OF1A 4ZHNA 5F5QA 4O65A 1VBC3 3QLQA 4QX7A 3LWCA 4UW3A 3MUY1 2QFEA 3WG2A 2OKXA 2WLQA 1QQP2 3KV5A 3OYWA 1S0BA 5LA2A 4DXZA 1C8M3 4FPFA 4K8RB 1YQ5A 2PFWA 4AWDA 2Y6JA 4N8MA 2AENA 5DUVA 1QJY3 1W6PA 2BWCA 1MQTB 1RGSA 2DBNA 3LEGA 2XUEA 1OLME 1QJU3 2R30A 2LTNA 4JKKA 4MGSA 2FDHA 3CLPA 3QH6A 1FPN2 4IGOA 5IUQA 4IEXA 4JHZA 3LKJA 1RUG3 4HONA 5ISLA 3H3UA 1UQXA 5FYVA 3O12A 3VHOA 4CCEA 3RFRA 3RVHA 1IQAA 2WT0A 3ST7A 4CDWB 2ZEXA 4UT5A 4I0AA 3JD71 3J7HA 2XQRA 4MGKE 3IMNA 2ZGKA 3SMHA 4ZY9A 5DUXA 2Y34A 1TME1 1PVC3 5HV0A 5LBCA 1HKDA 2XJVA 1LTEA 2AREA 3PTYA 1W0NA 1YFUA 3AXEA 3TEWA 3RZZA 4CCJA 2YPDA 3U0ZA 1K3IA 3IAPA 1U0AA 1MS3A 2OS2A 3WF1A 4D94A 1CONA 2KXLA 3BB6A 3OBZA 1YFXA 4AVAA 1SQ4A 1W0OA 4OI1A 1C4RA 1RL3A 1UMZA 2HWB3 5DAXA 3K2OA 3VLBB 5JPNB 1AR81 4G3YC 4RGGA 4GH4C 4HVRA 3E6DA 2VCBA 2R042 5H9QA 1H1MA 1RUOA 2BBVA 1W6MA 5A3UA 4FPEA 1XNKA 2WS93 2PQQA 3T2TA 2Q8DA 2ZABA 1NG0A 2HWF3 1XE8A 4FAGA 3LA7A 2D40A 4CZSA 4Q29A 1OKQA 4FXGB 4XDPA 2JDUA 1HXS2 2F4PA 1GQHA 4LULA 4ZU4A 3BUCA 4AI9A 1YCIA 1GLHA 4FOYA 4YFZA 1UXXX 4NAMA 3PIJA 4Y4RA 4BQ5A 3H1WA 5CIRA 1G7YA 2ORZA 2ZGOA 3Q8FA 4H2AA 4XPVA 1OI6A 4LO4B 3ZDSA 2ZGQA 1R1A1 3VBSA 4A2UA 1OVSA 1BEV2 4ISRA 2VZSA 1LESA 2BNOA 2ZX3A 3NAPC 1W8HA 5GM0A
chains in the Genus database with same CATH topology
3KMHA 3TN93 4Y22A 1QXRA 2D6MA 5T5OA 4H7LA 3OD4A 4AI2A 3LGRA 1H2LA 3VBFB 2FBEA 3VZJA 3AXDA 3E6CC 1OPMA 1LHWA 1MVEA 1IPKA 5A33A 1K5MB 2P3KA 1IKQA 1R092 3V0AB 1M06G 2JICA 3RQ0A 1FXZA 4OUMA 3PJQA 4C91A 3R6SA 3MLLA 2IXIA 2Q1MA 3KGZA 4Y4YA 3VDDB 1F31A 5E16A 1F5JA 2PA7A 4PQ9A 1O5UA 1JOJA 2OZJA 1WGPA 4AHYA 4OHYA 2DTYA 5ABJB 1FOD2 2HWC1 4PIXA 5JI9A 2QDRA 3JBG1 2D43A 3CEWA 1YNAA 5J3UA 3I59B 5IK5A 1S0GA 2UWCA 4JGYC 4QQHA 1R1ZA 1Y3TA 3W58A 1RC6A 2DU1A 4TYSA 1RITA 3VHPA 4AW7A 4AI3A 1BMV1 5GZGA 1TQ5A 1RUD2 1O3QA 5EXOA 4OUSA 1MEC3 4D3WA 2D3SA 1UU5A 4X8PA 4RR3A 4IQPA 4WZCA 4RS5A 1AR91 1SLAA 2DCYA 3ZXAC 1DQ6A 3L9JT 5C8CB 1QJX3 3H8UA 4ZU5A 4K9SA 1ZA4A 4KG0A 4YGCA 2VQ0A 2VNGA 4HN0A 2X5IB 2RS13 2OYZA 3ZXKA 4Y20B 5F6LB 3WT3A 5J36A 2R1DA 4IV1A 2IXKA 2VVEA 3I2DA 4F7ZA 3MF6A 4YM2A 4AVVA 5T52A 1N1YA 3MW4A 3R0RA 1RUI3 2DFBA 5GLTA 1N47A 4IEVA 1EPWA 1N1SA 1B35B 1UIJA 4FT8A 2Y0OA 1HQWA 1SFYA 2P17A 4YM1A 5EYYA 2DUPA 3ZSEA 4HBNA 3AMQA 2JJ6A 4UW5A 1R081 4E2SA 1BVVA 4MXVA 2JECA 1O7FA 1ZBA2 1RMU1 2D6NA 4RD7A 3WXPA 2A6VA 2UYAA 3MW3A 4YZ4A 5C4WA 5BNOB 3OCPA 4Y26A 4F3JA 3POYA 2DVFA 1WBLA 2XG3A 4WM7A 3WVJA 2W0XA 3WW3A 4COUA 5B2GB 2RM22 1PGL1 2NLRA 1I1EA 3PVBB 1LU1A 3FLTA 4H3WA 2ZGRA 2OA2A 3DUIA 3J4UH 2A6YA 1NA1C 4KU8A 1MS8A 3IWZA 4GA9A 4QM9A 3WQ0A 1OLQA 3AYAA 2WFF3 1ASJ1 3AZXA 4CEWC 1FATA 3VZKA 2VPVA 1JUHA 1BK1A 1YO8A 4NWVA 2UWBA 5I8YA 1GZWA 4OI0A 5IK8A 4TLFA 4PDWC 2ZHLA 3IIAA 1ND2B 5CB7A 2GZWA 1Q56A 5CFDA 5JR7B 4N53A 3GBGA 4COZA 3M3OA 3I4IA 4AQ2A 3AZZA 1DQ2A 5I0UA 1H9WA 4W6YA 1DGRN 4DINB 3FBMA 3ZYIB 1FYUA 1MS5A 1N3OA 1NQDA 4K8FA 1CAUA 2XKPA 3H3ZA 4Q27A 4F8AA 2Y26A 2PLV3 1PO12 4AQSA 1PK6C 2OUJA 2WA3A 3QD6A 1ZBE2 1MZ6A 2BW8A 5C9AC 2A73B 1DU3D 2B8MA 4GB32 4N43B 1DGLA 3EBRA 5D8AB 4JGZC 3M2MA 4MZUA 1XRUA 4GMP0 4XILA 1RTVA 2WA4A 4Y1VA 3OTFA 4A7YA 1GQGA 4QQLA 1FMD1 4AXOA 1VAKA 1CPMA 1VBE1 1VBC2 3NL1A 3UJOA 5JLVA 2JE9A 1EV11 2A6XA 5DDJ3 1WCKA 4WVMB 3HT1A 4BCUA 1DG6A 2A3XA 1PGSA 3KB5A 4DOUA 4LBKA 1CAWB 1ENRA 4QPIC 1QJY2 2GC1A 2VW2A 5K7PA 2JEMA 1QJU2 3CJIC 4JCKA 1VBD1 4YZ5A 5FDBA 3OBRA 5KHHA 1PM7A 2ZHMA 1N1TA 4KGGA 3ZN5A 3KZ4C 4U2AA 3MIHA 1YFYA 4B8EA 1LJ7A 3SNMA 1FPN3 4AEDC 3RWNA 3E5UA 1G9FA 5GZCA 1GR3A 4BIFA 2PN5A 2PTMA 1OSGA 2RMU3 1DIWA 3AP6A 3ZYJB 1Q8PA 3TAYA 4YW2A 2WKKA 5AVPA 3ZYGA 1IS6A 2JKBA 1PIV2 2Q5TA 2UU8A 2R32A 1RUJ3 2FMYA 5JI7A 1LOFC 4FP3A 3SXWA 5CG9A 2VMGA 3VBSC 4Q4X1 2ILMA 1Z0HA 3FUQA 3JQXA 2WNEA 4Z2WA 1HLCA 4QX5A 1LGBA 4AI0A 3GBWA 3ZXLA 2R043 2GNBA 3N7LA 1OOPC 2HJIA 3JUUA 1VRH2 5E89A 2UYBA 1X50A 2AZ5A 2JG8B 3QOPA 1XNCA 3WV6A 3B9CA 1FAYA 2A7AA 4FOVA 3DPRB 3DGTA 4OVEA 1HXS3 1NE4A 2DWRA 4GH4A 1Z7S1 3ZFGC 3UKTA 5A3LA 4LUMA 1W6QB 1I6XA 4R9BA 1NZCA 5JSRA 1TE1B 5JZGA 1BEV3 1SBEA 4P9XA 1COV2 5CFCB 3ES1A 5HCFA 4Q0VA 3O0VA 4XEZA 2QZ2A 5FTTC 5CA6A 1RJ7A 2DF7A 3VBOA 3CNAA 1MS9A 2XVLA 3W59A 2YMZA 1VIWB 3LCPA 1IGOA 4OHVA 3DKWA 3BU7A 1QQP1 3BCWA 2WZR1 3VBRB 1R093 2QE3A 4PCRA 1PZ9A 1FV3A 2GC0A 3VZLA 2R073 5FQ0B 1LOGA 2FHRA 4HL0A 4GWMA 3VGIA 2VH9A 1U5IA 5CAZA 1O4YA 3OPZA 4XZPA 4RR3C 3R05A 5HCAA 4XF3A 3GHNA 3L2YA 3BODA 3KSCA 1HRV1 2JG9B 2RS31 2WNUB 1AR71 1H1AA 1FOD3 1NCRC 5BNQA 3QACA 2SLIA 1YJKA 4LBMA 2ZHKA 1LRHA 1AL21 4IV1C 4YVSB 2DCTA 2ZCWA 5HCBA 1QJX2 2H6BA 4HK8A 3ENRA 3AP9A 4IV3C 2UWAA 1LODA 2VVFA 1CPNA 1RVF3 4NWWA 5IK4A 5KHKA 3E5XA 1RUD3 1V9U2 4K21A 1HV0A 2ZJCA 3OJBA 4JGYA 1J1LA 3N4MA 3N7JA 5L73A 2BNMA 3WY6A 4BH9A 2PHLA 4PBPA 2R1BA 3QH7A 3IDEA 1HV1A 1H8TC 1O4ZA 4J6GA 2HEYF 3SISA 1GICA 5C8WA 3B3QE 4XFIA 3APBA 4I09A 3WCSA 1AJOA 1YUDA 4XBNA 4QXKA 4COYA 1YIFA 1FNYA 4LBQA 2Z42A 4ITCA 3DF0A 3J9SA 4Q4V1 5I0TA 1UN1A 1AZDA 2RS52 4Q0UA 4K1ZA 1YWKA 2NN8A 5FO7B 2D3PA 3M3IA 4DFSA 1V6MA 1ZBA3 3J26N 2G4IA 4Q8LA 3BIWE 4LO6B 4RHV1 4NVPA 4FCAA 1EY2A 1XNDA 1LEDA 3D5OA 1ULDA 4AF9A 3ZFFA 4XMIA 1UF2C 1C5IA 3AKTA 5BNPB 5CFDC 5E88A 4N53C 3WP4A 1UAIA 1RUC2 2R061 1U5ZA 4XIKA 1POV1 4META 5IK7A 4QPGC 4Q8KA 3AMMA 1ULGA 5CG8A 2RR12 3KLSA 1EAH1 1WMDA 4XYXA 3ILFA 3SHRA 3USSA 2VXRA 1QGLA 3NV4A 2DCJA 2Q8OA 1DQ5A 3MIGA 2FQPA 1IPJA 2OPKA 4X6RB 3I54A 2DCZA 1NA1A 3WDVA 2ZGUA 1LECA 3THPA 3ZO0B 4I3PA 4C0HA 2P2KA 5DXDA 4Q4Y1 2JENA 5C4WB 1SMVA 4GKYA 4I3GA 5FOJB 1AR62 3BPZA 5GJ6A 3JB4C 4IEPA 1AX2A 1VJ2A 3CO2A 4WM7B 1MQTC 3JD73 1BKZA 2VG9A 4Q4W1 1VBB1 2ERFA 5J96B 3M3EA 1EP0A 1JUIA 3R4DB 4XJWA 1WD3A 1TME3 2PYTA 2GMEA 1PO13 4ASMB 1LOBA 3AM2A 4CDWC 2XWBB 4WVZA 5K0UC 1XE7A 1OQDA 3WUDA 2Z2SB 1ZBE3 5FO9B 1PGW2 4YSFA 3USUA 3H7JA 2WIIB 2ZX2A 4ASLA 4EWEA 4FO9A 4XJ9A 2NQYA 4IERA 1PNGA 1EYBA 3AKRA 3FWEA 3TRSB 4YZ1A 4CDUC 4OLLA 4YGEA 1Q3EA 4E4DX 3I8TA 4ES8A 4FVVA 3SCFA 1W6OB 3VBUA 2GDFA 2C0ZA 3K51A 4QM8A 5C9AA 3ACLA 1RHI1 4XFGA 3ZIWA 2KA3A 4H7MA 2P37A 4JGZA 3NVCA 3RSJA 4ZXKA 2UURA 2ATFA 3M1HA 2GH8A 4AVCA 1LGNA 1PO22 1S0EA 2D7FA 2YXSA 1QJZA 3UV9A 3V64A 2BFUL 3U10A 1MZFA 4XIOA 1DYPA 3T1LA 4E9KA 4XQDA 4NR1A 3MIFA 3TWIA 4E4SA 1OLRA 3FC0A 2VOXA 3RYRA 4W6WA 2ZGMA 2D6PA 2RMU2 4IXLA 3DV8A 5E1RA 5CU1A 4QPIA 3V0BA 4YG3A 4YARA 5AC91 3GALA 3WHTA 3CJIA 4CEYC 4BWOA 2LALA 4LR4A 2HWD3 4INDA 2D93A 3H1YA 4DRVA 1RJ8A 3MI8A 5GLUA 1RUH2 5AVAA 3ZSJA 2GNMA 1LOEA 3VBFC 1RUJ2 1OFSA 3VBHC 2QVSB 4QU2A 4WZFA 2IFRA 4XXAA 1G86A 2ET7A 5EJ3A 1AYM2 2VNRA 2AH2A 2QUOA 1LHVA 5JVVA 5C6CA 3Q9OA 4MLOA 4AK3A 2GMPA 3PMSA 2UY8A 4YW1A 3D4KA 4AEDA 1H30A 1ZRDA 1TEIA 1G9DA 4FSJA 4FQ4A 1A78A 4HLTA 1PIV3 1WLDA 1C5HA 1CAVB 3FUOA 3NW4A 4JVAA 4PJYA 4EN8B 3VDDC 2HEWF 3RI8A 2ZX0A 1WCDJ 2QNKA 3HT2A 5HXVA 5JZGC 5T54A 4M3CB 5ACA2 3EQEA 4B4PA 4OHWA 4MXWB 3VBOC 3NV2A 2ENRA 4LEJA 4GB31 2A5ZA 1LOFA 4B7KA 1NY71 2DVBA 2G9FA 1HW5A 2WINB 3ATGA 4DPNA 1A6CA 1VRH3 2YPJA 2ZAHA 4Q26A 1DDLA 1AR93 1LHNA 1AYN1 3BTAA 1U5XA 2VULA 1IS4A 3POSA 2I2SA 5FMOS 3WW2A 3ZYRA 3AMHA 1OOPA 2PAEA 3RPQA 1S0DA 4Q2FA 1FV2A 1TMF2 5FRAA 3B93A 4LHNA 1VAMA 3MIEA 4H14A 4CDXA 2FZ2A 1C8M1 4EN6B 3WCRA 3FBYA 4IESA 5C8CC 1COV3 5IT6A 2VUJA 4HFSA 1RUF1 3ZFGA 2WZPP 2QQPA 2X5IC 1KD7A 1QJU1 2R072 2H0VA 2XUMA 2Y38A 1OA3A 5EYXA 3LOIA 2ZMNA 1RUG1 1QMJA 3VL8A 1Q8VA 4F83A 3B94A 4XF9A 5I93A 2GMMA 4K1YA 4AGGA 3RMYA 2OUHA 4QGLA 1G9AA 4PIYA 3MIDA 3PMEA 2HWE2 1URXA 4MX3A 3IT8A 5BY5A 2XHKA 2EALA 5CBLA 1PVC1 2TUNA 4R9DA 1RMU3 1KJLA 4L97A 1BBT3 4LNVA 1X36A 1GKBA 5LEKA 4FAHA 1RVF2 2VOVA 1CAXB 1HDKA 1I5ZA 2HWB1 5FO8B 4FOQA 1GZ9A 1D4M2 4XHBA 5J37A 1HQNA 2H0BA 1RUE2 1N3QA 2WS91 2HWF1 2I07B 3B5LB 4P9LA 3WHUA 4R4ZA 4P9GA 2R0FA 1UD1A 5KXEA 1ND3C 4MYEA 3AFKA 4YGBA 5I8SA 2GC3A 1NCRA 3NAPB 2ZX1A 2ZGLA 4BZ4A 4YG0A 5I0SA 1ENSA 1V9U3 4J1WA 3BOPA 2CGOA 1H1IA 4YW4A 4XBLA 1CQ9A 2ZGPA 2DTWA 4IV3A 1S2BA 1JXNA 4QD2A 2O8QA 2X29A 2ZKNA 3TN91 2B45X 1PZ8A 4XJAA 2O1QA 4Y1UA 2BQPA 4QPYA 3IPVB 2QZ3A 5CADA 1UKRA 2OZ6A 2ZGNA 4BYYA 2WL1A 3DN7A 1VB4A 2W68A 2WNVA 4FP2A 4RQPB 2EA7A 1N1VA 1RUNA 1XU1A 1RB8G 3ZFFC 1X8EA 1H8TA 3GBFA 1GANA 2D44A 1D2SA 2MEV3 5HBAA 5K8SA 2NM1A 1S0JA 3MFCA 2RS53 3OBTA 1S55A 2YY1A 1DLLA 4JAAA 1RIRA 4YNIA 1B09A 2XLFA 4LO7A 1KITA 5F6KA 4CDQB 2Z69A 3VZMA 5BPXA 4YW3A 2PHFA 2IWGB 4P9JA 2IXJA 2PHRA 4KNCA 4S2FA 1ZRRA 3WP6A 1S0FA 1ZNPA 4DY3A 1AUYA 4LHLA 1WCSA 2DU0A 4Y24A 3JB8A 5GKAC 2D5HA 2XJUA 3POWA 3OY8A 4BPZA 3JQWA 1RUC3 2CTVA 2JX9A 1MEC1 4DZGA 1LR5A 2JDZA 3N7MA 4YVWC 4M01A 1WW6A 2B39A 5GLZA 3RYKA 1G8WA 2RR13 3KCCA 2BNNA 4B4QA 1LB2A 5BV6A 3EJKA 3S6PA 4FPYA 4ONUA 2RS11 2XBO1 2XL9A 2ZKLA 3JD72 3UKNA 3VZNA 2R0HA 2JXAA 3V56A 4QPGA 3D6EA 2XJPA 2XJRA 1TME2 1VR3A 1EPZA 1AR63 2K0GA 3MLJA 3THTA 1RUI1 3VBUC 3AJZA 5BNNB 4KH9A 4WM8A 5H9RA 1IKPA 1YFWA 2YGLA 2PAKA 2Z5WA 3I7DA 3IN9A 2I74A 3J8F1 2ARBA 3HN1A 2AUYA 3AP7A 3AZVA 1AR82 1SCSA 2BGCA 1V6LA 1ENQA 1F5FA 4YFWA 1C3HA 1XYNA 2XVKA 3HBZA 4JDMA 3RDIA 1MQTA 4W65A 2A71A 3ZN6B 4YYOA 1A8MA 4P9WA 4JQRA 5A32A 1BQPA 5T5PA 1X8MA 5FLJA 1NYWA 4E4ZA 2XL7A 4KGQA 3ZFEB 4CDWA 2CV6A 4NOTA 5K0UA 4HPKB 1NCQB 4HKWA 3W9AA 1R1A2 1PNFA 5JIUA 1CD3G 4M0NA 4NN0A 4QQOA 1H4HA 4CEWB 3NJZA 3MZHA 5L7OB 1GZCA 2D6LX 4CDUA 5LRSA 2VMIA 5FMOL 2EIGA 4XF1A 5SV5A 4XW3A 4PDWB 4COVA 2O8OA 2WFF1 4FOWA 3WLUA 1PO23 4Y1XA 3RJRA 4XHXA 3FHIB 1OA4A 2HWD2 2DUQA 1E57A 4Y1YA 3VKNA 2E6VA 4YGDA 2B9UA 1WW4A 1ALYA 4LA2A 3JZVA 4AE2A 3SH5A 3USUB 4EN7B 2XH6A 2I45A 2ZGTA 1PK6B 3GHMA 1I3HA 4AFMA 3AYCA 2ZMLA 2YROA 1LULA 1JW6A 5BYNA 1RUH3 4ZU7A 2WFPA 1KDMA 3ZYPA 3VKFC 5JOWA 3JBG2 2DUOA 1OA2A 2PLV1 1ZZ8A 3B69A 4XMAA 4C1WA 1AYM3 2E63A 4C90A 4CEYA 4AGVA 1UZZA 5HI0A 3OYWB 2HEVF 5EV7A 4EROA 2ZACA 3VBFA 3N7KA 3B00A 3VN4A 2ET1A 4B7EA 3VBHA 3VUOA 1BMV2 1VBA3 1W6PB 2MNGA 1Y43B 4R9AA 3VL9A 2EVXA 4Z8BA 3A0KA 4N90A 1AL23 1VB2A 1YRZA 1AR92 4CDXC 3ZSMA 4RA0A 3SITA 4FBFA 1C57A 1TNRA 5ACA3 4LLOA 1WD4A 3FX3A 3ASIA 3WINE 2GSYA 3VDDA 4HT1T 3CJIB 4LO5B 1BVP1 4KWJA 3HD8B 5DDJ1 3CJXA 4XE9A 1J1TA 1QOSA 1D4VB 4C1XA 4N9IA 3ZMOA 2IC1A 4YG6A 1VLNA 1YJLA 3S0MA 3OD0A 1TMF3 4GALA 4M0HA 4MV2A 5T5JA 2VOKA 5EWSA 1J59A 3PLQA 3R4UA 5EZWA 1J3RA 3DL3A 4OHXA 1W6MB 1UU6A 1V6JA 3EXUA 4HZFA 4UW4A 1FX5A 1R082 3KGLA 5FPZA 1SEFA 4NHKA 1FPN1 4JRAA 1RMU2 3C2UA 1BBT2 2GALA 3MEPA 1PHMA 4GMP1 5C8CA 1Q5OA 4XBQA 4BMBA 2EXKA 1CGPA 1MACA 1QF3A 2X5IA 4XF0A 2HWE3 3U11A 3VBSB 4CP1A 4Y20A 5C33A 1PGL2 2WT2A 3RNSA 4XFBA 1IS3A 5D1IA 4AHZA 4Y22B 1RUJ1 4RHV3 5J98B 1DZRA 2LM3A 2VW1A 4YRDA 1HRI3 2XLGA 2MPFA 1ASJ2 1FT9A 4URTA 4Q1PA 4AVBA 5A33B 2EF6A 1D4M3 4FPJA 1XYPA 2R041 3ZFGB 4Z07A 5FFOC 1RUE3 1YYNA 1CESA 1POV3 2DVDA 1J3PA 4HVOA 2WNVC 3GZUC 5BNPC 2WSUA 2RHPA 3FLRA 1HXS1 1OQ1A 5BNOA 2DURA 5FAXA 2YUEA 3N3HA 5GALA 3B9IA 1H2KA 4O9EA 2Y0IA 4AFAA 1BEV1 1C1LA 1ND3A 4XFFA 4LT5A 3T1MA 4BIOA 1A3KA 4LTAA 1QH6A 1AX1A 2D97A 1W6NA 1AX0A 5DUUA 3KCXA 3UK9A 3D0SA 1ZM1A 2YDEA 5KHIA 2MEV2 3MYXA 4Q4W3 3EHKA 1WLWA 5H9PA 1DGWA 4X6QB 3AJYA 1R091 1X7NA 1XU2A 4RR3B 3IM0A 2V73A 4RS5B 1PZ7A 4KWLA 1OD5A 4AFCA 2R071 1ULFA 5I0RA 1ULEA 2PHDA 4JC1A 1CVNA 1NCRB 1ND2A 3SH3A 3VKMA 1DGWX 1VBE2 5KWRA 1CN1A 1OFNA 4IV1B 4SBVA 1EV12 1OHFA 5CNAA 3KQRA 1QXPA 1JBCA 1CJPA 1LOCA 1QH7A 4FPOB 4I2OA 2W52A 4NPRA 3KT4A 3GZTB 1FOD1 1L3JA 4W6XA 1RHI3 1NLRA 3VZOA 4WV8A 1WA4A 2UY9A 3NV1A 3GZAA 1VBD2 5EFUA 2BUKA 4DNYA 1KFUL 1DHKB 2XGXA 4DRRA 3MLKA 1X82A 4PIZA 3HAGA 4BA6A 3ZIXA 2VU9A 4DQAA 3M7AA 2GC2A 4WM8C 3FLPA 2NZ9A 1RUD1 3CL1A 3L2HA 4P5HA 2CGPA 5D8AA 3O5SA 4KG8A 3TNPB