5C70A

The structure of aspergillus oryzae beta-glucuronidase
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
601
structure length
588
Chain Sequence
AAQGSAGSMLKPQQTTTRDLISLDGLWKFALASTQPWTSQLKTSLECPVPASYNDIFADSKIHDHVGWVYYQRDVIVPKGWSEERYLVRCEAATHHGRIYVNGNLVADHVGGYTPFEADITDLVAAGEQFRLTIAVDNELTYQTIPPGKVEILEATGKKVQTYQHDFYNYAGLARSVWLYSVPQQHIQDITVRTDVQGTTGLIDYNVVASTTQGTIQVAVIDEDGTTVATSSGSNGTIHIPSVHLWQPGAAYLYQLHASIIDSSKKTIDTYKLATGIRTVKVQGTQFLINDKPFYFTGFGKHEDTNIRGKGHDDAYMVHDFQLLHWMGANSFRTSHYPYAEEVMEYADRQGIVVIDETPAVGLAFSIPATFSPDRINNKTREAHAQAIRELIHRDKNHPSVVMWSIANEPASNEDGAREYFAPLPKLARQLDPTRPVTFANVGLATYKADRIADLFDVLCLNRYFGWYTQTAELDEAEAALEEELRGWTEKYDKPIVMTEYGADTVAGLHSVMVTPWSEEFQVEMLDMYHRVFDRFEAMAGEQVWNFADFQTAVGVSRVDGNKKGVFTRDRKPKAAAHLLRKRWTNLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enhancing the Thermostability of beta-Glucuronidase by Rationally Redesigning the Catalytic Domain Based on Sequence Alignment Strategy
doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
molecule keywords Glucuronidase
total genus 182
structure length 588
sequence length 601
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c70A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5c70A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5c70A03
3UEQA 3QCUH 4TXWA 3D85B 5EU4B 3SUUA 1A02N 3RA7H 1XGTB 1D5MA 3IFNL 1K42A 1X3DA 4X6BA 4YE4L 5IFTA 1F58H 4UILH 4K9EC 1XR8B 3DGGB 2UWEF 3CMOH 3LDBC 1AQKL 1JRHI 1U8JA 4DN4H 1ZT4B 1W8NA 4Q0XH 3BKYH 4JFXA 1R3IH 4GW4A 1F4AA 4RN5A 3BP6B 2OMNA 3VI4E 4OLUH 1NSNL 1IEAB 4GKNA 4IRJD 5D2NA 5B38A 1CYGA 1HQRA 1U91B 4HWZA 1ED3A 3OSKA 3SCQA 3KPPA 4WU5A 5J0BA 3HZKA 4HK3N 3VGDA 1V7NL 4WTZG 2GJ6D 2VRQA 4LEOB 2CXKA 4GQQA 1T4KA 3TVMA 3O2WH 4JM2D 2VRAA 4GKSA 1OP5H 3I3EA 4P7NA 5E8PA 4PMXA 2GFTA 1SYSB 1IZJA 3STZB 1HH9B 3N9KA 5DD1H 4EDXB 2DWDA 3W5NA 1XF5A 4PJFA 2XWBB 1T22B 5T5NG 4HS8L 3W53A 4XPFH 4JCMA 2GQHA 1IAIL 2D31B 2V2XB 1VDGA 3SOBH 4M29A 2EICA 5HGDB 1ZHNA 5SWQB 4AZ6A 3NCJH 3MA9L 5K33A 4ZUTB 2VR4A 5C8JA 1KT2B 2GK2A 3OKYA 2X1WL 3UJIH 5I6XC 5CSUA 1NMBL 1VPOH 4K94L 5GGUA 5C0BD 4HOZA 5IB1A 4CU6A 4LLYA 4OF0A 4F7TA 2VMCA 3AM8A 4JO2L 1TZHA 1WPCA 3NZHH 3N12A 2W0PA 3GH5A 2CDPA 4XP4L 1AGFB 5T1DL 5AYUL 2AJZB 4XNZC 4WJ5B 3BAKA 3ULVD 4URIA 1IQDC 4UOJA 5H94B 4OGYH 3WH7A 4HWUA 3OKNA 4PMOA 1JZ3A 3ARFB 2WQ8A 5JXHA 1EQPA 3BKCH 5B38B 3GMNA 4WJXA 2QQKH 5I2UA 3EHBD 2BV9A 5DD0H 2RFXB 2BVPB 5D93C 3W81A 4QDSA 3GDBA 4U7MA 5HVFB 2BY0A 4HLZH 1JNNH 4FQ1H 4O51B 4FZEH 5C07D 3B6SB 5BMFH 5DC0A 1MF2L 3G6DL 3H9HA 1U2CA 2ITDA 3LZFL 4JRXA 4Z7WF 4NO3B 3HE7D 2WMJA 1F97A 1HHGB 2PKDA 3QWRD 1H3TA 1WTGT 2CRZA 1G6RH 2KBGA 4J27A 5HPMB 1UXWB 4P4RB 2WHJA 5EU4A 1WBYA 1LEKB 1UY4A 5F96L 4G8EA 3CFEB 4XRCA 1NARA 3OXSB 1ACYL 1O5DT 3U46B 5FDYA 1RU9H 3B8SA 1WAAF 3ZJ8A 5K9OB 1FHLA 2R0ZH 4G8IB 1UWUA 1AGEA 5CCKH 2VXVH 3IANA 3L6FB 1EQCA 4R3SA 5FA3B 5C0DA 4MCZA 5EZJB 4D8PA 1XIWC 3PWPA 1ZLWK 4GKZB 3DMMB 2GJ6B 2DM3A 1HHHB 3DBXB 5T5NF 4G7VH 5C71A 5ANMA 3EZ8A 2F8XC 2A9NL 4ZNEE 1LG2A 1CGWA 4HMCA 3OXRB 3ACGA 1L7TL 2JCCB 4XZWA 1UR8A 1JP5A 2PQSA 2WWCA 5CKAA 4OCXH 1SJVA 5IM7B 4MDPA 3MJ7A 1PLGH 1H5BB 2XM2A 1DBML 5K9KA 4TRPH 1C5BH 4ZYKB 3OB0H 1NUFA 3AMGA 4ELMA 3TTSA 4MDOA 2NY3D 3FJTA 1RZFL 2IAND 1E4WH 2EE2A 3SDAA 4FABH 2VZRA 3RY4A 2WWKT 1P2CB 4MSWA 1UXSA 3IETB 4LLUA 3TT1L 1A14L 5IHLB 3BE1L 2DS4A 4U1GC 1G7MB 1AO7A 1MJ8H 4F8QA 4X80H 3FO1B 3TWCH 5IW1A 2QQNA 1XF3A 4BA0A 2DQGL 2R0ZL 3PGDA 4U1JB 5DYOA 1CGTA 3ARBD 3N1PC 4DVBA 2J8GA 2DLGA 3PN8A 3MREA 3VE0A 3VGAC 3QUML 3EZJB 2FCBA 2BNQB 2GTZA 4LGRB 4NKIH 5KVEL 1OGAE 2YMXH 4PY7A 4M7KL 2Z31B 3INUL 5DUPH 3HNVH 4FN0A 4UQBA 2WMKA 2GSJA 2Z35A 1CBVL 4NHCH 1UWXK 4PRHE 1HIML 5E09A 4OD3L 2XT1B 3RP1A 1RUKL 2W0LA 3L7FB 3LN9A 3TPUA 4AIOA 1NC4D 4QLRA 2BY1A 3NH7H 3E1F1 4E9LA 2HLEA 4QT5B 1BOYA 4JN2A 5I16A 1B3VA 2BVYA 4PLNC 1QPPA 2VZ3A 1OAYL 1S9VA 3BP5B 5KN5B 2A38A 3QQ9D 5JXED 4ZO7A 4AL8L 2Y07H 4PV8B 1B0RB 3RRQA 5IIEB 1JN6A 3F12B 4D8PB 3QFJA 2RBLA 1TETH 4DXSA 1EEZB 3WFEH 2M26A 2VMEA 1TTGA 4KZDL 5F3BB 4XCCH 2PO6D 4I5BB 3IDIB 3MLSH 8FABB 4GWJA 4K8RH 1RY7B 3DSNA 5B22A 3H6JA 1E4LA 2OJZL 1MJJB 5HGBA 1FAKT 4U0RC 5LA2A 3HNSL 2Z8VC 4G8GE 2GVYA 5C7GA 2AJYH 3A67H 1FP5A 4IRJB 3MRFA 1T66D 1ZSDB 4A3ZA 5HI4D 4HEME 2XKNA 2CGRL 3ES6B 2YRLA 2JD9A 3I84A 2VDML 2FGWL 4LSPH 3IDIA 4LKCB 3C5ZC 1WZAA 1QO3A 3LEIA 5I30H 3F5WB 1JDAA 3VTRA 4JFQB 3V52L 5EPMB 3WD5L 4JVWA 1JMXA 3QQ4B 2EE9A 1CFSA 4L8CB 4DEVA 4HKJB 4K68A 3DUSB 3BRGC 3G6JE 2VCCA 5JXAL 4PJAB 3B83A 3DNKA 4NRYB 4JFHD 4Q9QL 1J1OH 1XF4B 4DGYH 2QQLA 1OAQH 5FO9A 5JHDE 3WFEL 1H0DA 3RY5A 4JZJB 5E6IC 2WUBH 4WJ5A 1A7NH 5KW9L 3LD8B 3O3BA 1VFAA 2NNAA 3GSVB 3QNZA 2FL5B 2JCCE 4F8TA 3QRGH 5ALCH 1ZLSL 5CMAA 2BNUB 3FMGH 2VLJE 5TE7H 2GCYA 1PY9A 3QXWA 4GQ9H 3BD4A 1QHOA 4OQTA 5D4YA 1BM3H 2PW1A 2P5EE 4UIKH 2BNQA 2GTZB 3O0RL 4LHQB 1HP5A 3ZLQC 4YO0B 5GGTA 5FHBL 5KSVB 1D5BB 3NA4A 1BF2A 3C09C 5KVDH 1U6AL 4GMTL 4X6CE 5HHOB 3BXNB 5HGHA 1YN7A 3AUVA 2YA2A 1RAMA 2GITA 1OVZA 3GHBH 4AK1A 3L5IA 3MROA 4IMKA 3OLGA 1A22B 1OF2B 3I2CL 5H35A 1WKYA 4Z2GA 1A8JH 4LEXL 1IMHC 1U8HB 3V7MA 5L0QC 3HRPA 3A47A 2B2XH 4GSDL 3LN4A 4M1DL 4HZ8A 4HWNA 1LWRA 4YDIL 1ZS8B 2CHOA 2ICWI 5F72S 4ELMB 2NW0A 2R4RH 4GQPH 1NBYA 4N0UB 3JV6B 3D9AH 5K9KB 3J7HA 3GSRA 3QDME 2QKIA 2EDYA 4R2GD 1XCQA 4XPGH 4PGEA 4WRLA 2YD1A 3FFCB 3IU4L 1CTNA 5GS3A 2J22A 3NZ8B 4AQOA 2EEDA 1I7RA 1T5WA 3D18B 4FHBD 1Q0YL 1Z0MA 1Z9MA 1Z3GH 5KSBB 5BW7C 3SDXE 4MVBD 4D0BA 4HJ0C 3I9GL 4GKZA 2O61A 4QX3A 1ZEAL 1J0KA 5EZJA 4HLZG 1IQDB 4M8QB 4QRSB 5E8EB 5C08A 1MWAL 1UCTA 3MRRB 4JM4L 1SVCP 2R1WA 3PWUA 4TVUA 3E6FA 3L5JA 2QQIA 4XCFL 3MLVL 1KIUA 2AERT 4G9FB 2G5RA 1JIBA 3BAXA 3TNNB 3VD9A 1NDGB 4YDIH 3SKJL 3BXWA 3L9RB 4XNMB 1RK1A 4G6KL 1S7XB 2HKFH 3WKZA 4R7NA 1A6ZB 1BGGA 4AY1A 4PTWA 3QUMB 4HF5L 4KKAC 3VGFA 4XP6H 4YH6A 2LW8A 2WAOA 4NCC2 4J6RH 1B9ZA 3PZUA 5LCVH 1LQ0A 3CZGA 3NFPB 2XZAL 4G6FB 2OYMA 1EHXA 3X3GH 3WEXB 3GO1L 3LPFA 2V72A 1KCLA 1T6VN 4TNVF 3KYMB 2WIMA 3ZTJH 1NUKA 5FKPB 3WO4C 1BJ1J 5DFWH 3NQHA 4HC1L 4OCLC 2DTMH 4XNUH 1KGCD 4JVUA 5H94A 1FGVL 1FDLL 5D5MA 4HS6A 1PYWB 3SCMA 2DICA 3ARTA 4QRPD 3LN4B 4UIKL 1XCXA 4P4KD 5FGCE 1I5PA 1S7TB 1CPUA 4GAJL 1FSKB 4NZUH 1JNDA 3EBVA 4U0QB 1A7QL 4OJYA 2M8XA 5DJ0A 3JV5A 1RZIB 3ISWA 3HPJA 3ORJA 4JFZL 2OZ4A 4L4TB 3UTSA 1GXEA 3KVQA 5K9QI 1JWMB 1KT2A 3C8KB 2WZIA 2WZPD 4C55A 3VIIA 2I26N 4LX4A 3TCXA 1EDTA 4YFLF 2R4RL 4JRYE 1QR1B 1JXJA 1M04A 4CUCA 3WELA 5JOEA 2LV4A 4OFYA 4PJXE 5I2IB 4LDOB 3LMYA 4PJBA 3MRPB 4AXNA 4LDLB 1L9MA 1B3ZA 1TITA 1GOIA 3E3QE 4S3JA 4MNHA 2W1WA 1BF8A 3PTQA 5ID1A 2F58L 4ODVL 4FFWD 1QACA 2OL3L 5HI5C 5DK0B 1T4KB 5IB3A 2YD6A 1UA6H 4QB1A 1GOWA 1BREA 4HKXB 3ZE2E 2A6DA 1NOUA 3SQBA 1IAKB 5E1HB 3WKNA 1QOKA 1VAHA 1FIGL 4KVNH 5GRJL 1BOGB 3M17B 5F44A 4QOKA 2XFFA 4FFVC 1NMAH 4TOQA 1TENA 3DV6A 1CICA 2WIIA 4C56E 4Z7NF 3LEKA 3SQOL 1O8SA 1MWAH 3NCMA 1DQDH 5B4MD 2EDQA 1X5KA 4PJAA 5IESL 1BQHA 1C7SA 2AV7A 1G9ML 3GJEB 3C5ZA 3OV6A 2V2TB 1CT8B 4G7YL 4PJ7B 1KQYA 1MRFH 1GGUA 1H3PL 4JFQA 3UPAA 3L4YA 3REVA 3BIAX 4ZS7H 2JB6B 1ZA6A 4OKVB 4Y2DD 5IVNA 2NCMA 2VKXA 1ZMYA 5D1ZB 1FBIL 4P2YA 5KS9F 4MA1B 4UDTB 4NQDB 1CICB 2WIIB 1HKJA 5IHUH 5EC2B 1OP3K 4FQJL 3EOAB 1RIHL 3TBWA 2LAAA 4MLIA 1UWXH 4M6MH 3QXUA 3T2OA 3UTPE 3QHTC 4CNIA 4PS4L 3F7YB 5DRWA 2ADIA 3CFJA 2VAAA 4PP1C 1TZHB 2PI6A 4Y1AB 1CGXA 2I60H 1P7QB 1TTFA 5E99L 1WWCA 5CSYA 2WUCH 1S7RB 1YMMD 3O8XC 3RDTD 3VH8B 2ZXBA 4JFOB 3S7GA 3U4BH 3I02B 4FQHA 1UG6A 2EH7H 1BQHG 3RWHB 1B0RA 5L2KB 1UUQA 4UFKA 5F1NA 5T33L 3UROR 3OG4B 4CAGA 5DQJA 3WL1A 1N3NA 1CDUA 3DUHA 3SCUA 3QWRA 1RI8A 4P9HH 5E8DL 3HR5A 5BO1H 3QR3A 4NQXB 1EBAA 2X42A 2FJFB 5FB8B 4XVHA 4XZUA 1EHNA 4OQTL 5D1QA 1FBIH 1T66C 4HIXH 3EOBB 4ZE5A 5KTEH 3PQYA 3QIUA 5IBUG 1U33A 1AE6L 1I3GL 3VGAB 2G75B 1BPLB 4WI7A 1GIGL 3ACHA 5K93A 5FHBH 1K2DA 5JOFB 4YHOL 3SJVB 3JTTB 3KYKL 1R86A 1VFFA 3CHEA 1XHGA 3C08H 1UWQA 1HJQA 2YD7A 3ROOB 5I1EL 1SEQH 4OZIE 1MNUL 3MSGA 1KGCE 3G5XB 1IEAA 5IHRA 1BYAA 4K7PX 5D7SL 2Y7QB 3FO9A 1IKNA 5TDNB 3OLDA 1YC8A 4P3CH 4M48H 5FYKU 4QP0A 3MRBB 4PJ9B 1U8JB 2WKLA 2ZWZA 4OCMC 1GUVA 3MLXL 4CKQA 1W3HA 4NZCA 1V0KA 1QKZH 2RHEA 1ES0A 1X5HA 2NLJA 4M93C 5IROC 5DVLA 2VITB 1WC7B 5DUBA 1D5MB 1J0HA 3DPBA 4XMKL 4OQTH 2ADIB 4ET7A 4L3EB 1C5CH 2O26U 3BDBA 3QO1B 1MJ7H 2A6IA 2K7PA 3QUXB 5FIPA 1T1WB 4U4BA 2J25A 4HIHA 1RZ7H 2XPGB 5TJWK 1F4YL 1UB5B 4JO3H 1SYVB 2Y4SA 3PWPB 5ADPL 5ICXA 1MNUH 4YN5A 4D6CA 1DWIM 3VG0H 5MENB 4PJ7E 3EB7A 3R1GL 1BG9A 4RNRB 3RU8L 2G41A 3C5ZB 3IRPX 3ROLB 2P4AB 3ZJ6A 2OL3A 1YYLL 3Q3GA 1KOAA 3HC3H 4NN5C 3JUZA 1UD6A 4CU7A 5A2IH 1FVCB 5C0GB 1BBJA 1HYSC 5D1QC 1GZQA 3A22A 5EOCJ 1DWJM 2ENYA 3FQUA 2EQDA 1SHWB 1KJVB 4EANA 3AXLB 5HDQL 5LCVL 3A6CL 1ZA3A 3Q48A 3FRUA 1A5FH 4QRRA 4NN7C 3O3DA 1DBKH 4V2CB 4PRPB 3CDZB 3UTZB 5CSZA 1GCFA 1TJHH 5F88A 3ARGD 1E4KC 3BJLA 4W6WB 1GQLA 1BGAA 3EYUL 4FXLA 4KMLB 3SKMA 3O6KL 4XUOA 4IMLA 3NACH 5B38G 5E2WL 1FHGA 1MW3A 3RL1B 3JWDH 2Q8BH 5IFAH 1EO8L 4LSRH 3UXFA 1JV5B 3C60A 5DT1H 4MYWB 1J1XL 5F3HA 4G3YL 4YX2L 3O6LL 5JZ7D 4GZIA 4RE3A 1GZPB 3O2LA 4FZEL 1DFBL 1B1YA 4XZBA 1I1AC 1C12A 1OAKL 4TX8A 5BCAA 2CMRH 5FGCB 2EDHA 2FL5A 5I17B 4R97B 1EZVX 5LGHH 2JKXA 4EKXA 3GJFB 5FKYA 2Y6SD 4WO4A 2V3DA 5IWLA 1JU3A 2FB4L 3KS0H 3L5HA 3R8BB 3LRGA 2ED7A 5C86A 4EZMA 5KJRH 1V0MA 1P4BH 2W9LA 2R0WL 2V5DA 1Z0NA 5FA4B 4V1DD 3VXRB 3PUCA 2WBGA 2W1SA 5IG7B 4N42A 2DCKA 1S7SA 3H7LA 5SV4A 1F00I 3HAEG 2OTWB 3WEXA 4NKMB 5F7HA 3IFNH 4RX4A 3ULUD 3WLBA 1I9EA 3IKKA 2X1IA 2HLAA 1LNSA 5F7KC 4NUGH 3V5KA 3ARUA 1KB5L 1NQ6A 2FIKB 1A9EA 4XVJH 1F3JB 1R3KA 1DBBL 3MUY1 1FO0B 2HJLA 4JPVL 1MIEL 1DWAM 1CS6A 1RK1B 2EDDA 3ZKMC 2P5WD 4KXZI 2HLFC 4LHUA 3N11A 3KPOA 3X13A 2V2WB 3MJGX 3AQUA 4D9QD 3MGAA 1FP9A 2O9PA 4KQ3H 2ICWA 1NAMA 2A9MH 3PWJA 3MGTA 5SX5K 3PZNA 3VWJA 3A4AA 4Y5YA 4W50A 1YMHA 3SKNA 4R96B 3UPRA 4L0PA 3MRRA 5DR5H 3PDOB 4AIZB 4JY5H 1EHLH 2YBUA 4KDTA 4JHZA 4QDMA 1FCGA 1JN6B 3F12A 1BX2A 3O8XD 3RDTC 4B0MM 1E6QM 1NBZB 1IBGH 2ORBH 1MQQA 2GAZA 2QV4A 3VFMB 2AKRA 2UUDK 1FJ1B 5EBLB 1CZ8L 4NN5B 5IB2A 2VWEE 3WXVH 4X9IA 5DT5A 2VH5H 4KRMB 1DUYA 5GJTH 3VXQA 3FFCA 1NCAL 4LQFL 5KSBF 2YDRA 1AMYA 1VERA 5TDPA 4OV6F 3HPLA 3D39D 4HUXA 2ZSVB 3W82A 4QEGA 3KL3A 3G5VA 4U1SA 5I1AB 1QEWB 3S96A 3T4AB 5EBWA 1R5IA 3SEPA 3MNWB 4Q74A 3AXHA 1K6QH 3H9YA 2ZKHL 2J8UB 3MYJA 2UY4A 3WNLA 4Y16D 4E8CA 4HWBL 3BUTA 1LL4A 1ROWA 2G2RB 3BQUB 5TDNA 4D94A 5B3JE 3AJ7A 4OOZA 4NRSA 4JEGB 5T1KA 1HSBA 1OSZA 3BPOB 4XCCL 4ZXEA 3O3AA 3WO4B 1FOBA 2BVDA 1MPAH 1TPXC 2XXMB 1KLUA 2HYXA 2JJTC 4UT6H 2WINA 3M07A 1E1FA 3QIBB 3C7OA 4W6XB 3P4MA 1YPZB 4L5FL 1UR0A 2UY3A 2QQLL 3FQTA 1IILE 3DHUA 5CIPH 2GCYB 3ZYJA 1F4YH 1T89C 4JO3L 2QR0B 4KWUA 4OV5B 1UYZA 4FTVE 1JFXA 4PGCB 2NY6B 1U8NA 2E6QA 3DO7B 1IAIH 4NO5A 4POYA 5IFJA 4I9WD 5HYEA 1BSIA 3QNYB 3GYCA 4RBPK 5IJKA 3PQYE 4ZS6C 4YEFA 1E40A 4LHSA 2PB1A 1K6QL 2YD9A 4GG8A 3GMMA 4P46C 8CGTA 2MWCA 4JB9H 2AV1B 3TN0B 1MCEA 1T7VA 3ARSA 2UY7A 3QEQE 4HIJB 4ZTOH 1UYWL 2QQOA 1CFVH 1U3JA 1UENA 3S35X 3TN0C 4X0NA 1XC6A 1QTYT 5I71C 4CDGC 4RISL 4JG0H 3SDCA 4J8RA 5K9OA 3PHQA 4FZ8H 3C7GA 4Y1AA 3M1BA 2R39A 2FO1A 3QDGD 4MZ3A 2FECI 1YEEL 4Y4FB 3RJXA 4XP9H 3VMNA 3EGSA 5A6AA 2CLRB 4Y4FC 4G8GB 1JUFA 1MCHA 4C59B 3ULUC 5IR1A 3P11H 4OZHE 4ZOAA 5L2KE 2GUYA 1GHFH 3OAYK 1FL3A 4H8WC 3HG1A 5KSUB 3OX8B 4Q9BA 1NGWB 4Y89A 1W2VA 2YLAA 4KVCH 2XTJC 3PV6A 4CGTA 3AY4A 1PLGL 1DP0A 4IPLA 1LP9E 1G7PA 1Y0LB 1ZA6B 5CUSL 5JW3L 7FABL 4HBQA 1OSPH 3PE9A 2R7EB 2BDNL 4D0CB 2EIEA 1HI6A 2W65A 1BIIA 1RIVL 1TPXB 4PJDE 5A6LA 4M02A 4Y5VC 5ABFA 1V3MA 4NKMA 4UFIA 4M1CC 1EGJH 5GNZA 5FF6A 1LO0H 4K7PL 5JPMA 4KKBD 1AGDB 5KN5A 5CWSB 3ARFA 1HHJB 2IQ9H 4AWEA 2Y6LA 3QULB 3HI1A 1L8NA 1XYZA 1KN4L 2YL8A 1IGML 2Z4QA 3A6BL 1C08A 4MXVE 3FO2B 2ZCHH 4I77L 3L3JA 4GI8A 1TJHL 5I8KL 1MQPA 1KJ2A 2WNWA 2OLHA 3VIKA 5DF0A 4OLWL 3U1SH 4QOKE 1J01A 2L0DA 2Y6KA 2W4XA 2EDLA 1DSFL 5FUOL 2QBWA 3MBED 2HJFA 3WN5B 4ONGH 4BFEA 1YUHB 4HZLB 3NIFE 2X2YA 4L8BB 5E0CA 2LAGB 1XGYL 4HXBH 4IMKC 2EXYC 3JWOL 2FWOA 1JPFA 3HAEA 4KDVA 2VZPA 4PJGF 5B21A 4ZUTA 1RZJL 1WFOA 3BQUC 3WBEA 1R5WA 5J12C 3RGVD 1MFUA 1U58A 3T0DA 2YFUA 1CR9H 5I1DA 2EDKA 4DVBB 3QIUD 1ITBB 1H09A 5D1QD 3EO9H 5KZCD 4ODXB 3IDYB 3RCNA 4MS8D 1KTKE 1OGBA 3TA3A 5GGSB 5DQDL 2YXFA 4AT6A 4JJ5B 3GK8H 1RQ5A 4CU9A 2V9QA 3ECBB 4OLUL 3ETBF 1ZHLA 3I2GA 4EDWL 3CFKB 1S7TA 4AISA 3FRUB 2DQHL 2XWTA 2X9YA 3VUPA 1MJUH 4DGVH 4RMTA 2J8UF 1QLFB 6FABH 3OAUL 5BOZG 2XFXA 4L29A 1UR2A 4HZAA 2WPGA 3TOPA 1CBGA 2XIBA 1MFAH 4FLSA 1KJ2L 3AY4C 1N64L 3BZEA 4BKLA 2JCCA 5ILTL 1NCWL 5ANMB 3D39E 1BVKA 3GI9H 1WQVT 1IM9D 1V5JA 4OLYL 3G5YA 3TH2T 4XCNB 2PUQT 3RWIA 1UKSA 3QWQB 3RJYA 3MV9E 4KI1A 1HL9A 4CN4A 3EDFA 4RZCA 3V0AC 4NGHL 5M17A 3NJXA 4QO1A 4WW2A 5LGJB 1B3JA 4F7EB 4HIHB 2FJGA 3NFSH 5DQ0A 3FQXB 3UJIL 4TVDA 1MFDH 1KCVH 4PJHA 1BLNB 2J1SA 1MCPH 4F58H 5A6MA 1BZ9A 2WK2A 3CH1B 5IQ9B 4P5TB 1R24A 5I8OL 1YY8B 4HKZA 5IQ9A 3I75A 1T20B 1LE5B 2RV9A 1A4JA 4PRIE 3T8XA 2UYLB 3BIKB 4DGVL 1VHPA 2BSSB 3MJ9L 4Y16A 4JCLA 4B15A 1ZBVA 3G6JB 3IDGB 3QI9C 4KKCD 1YHTA 1FHDA 3SKVA 1JZ7A 1KJ2H 5CP7B 2ZCLH 4YQXH 2YG0A 1CLXA 5EBGA 3OEAA 1NKGA 2A73A 3V4UL 3KLAA 1SMAA 1DQTA 3BHBA 4YK4C 1LL6A 1E70M 3VRJB 1NAKH 5FYLL 3VFGL 4RA0C 5I8CB 2BZDA 1NBVH 3MFGB 3FO9B 2V7NB 1NMCC 3RVVC 2MHAB 4UZSA 4Y4KA 3PZGA 1AD0A 2VXSL 4N5UA 3ZDXF 3LKSA 2NY1D 2VZSA 1J8HE 3LN5A 1KTRL 2HFFB 5JNYB 3GSUB 3F2ZA 3UYOD 4RWYH 2X9WA 2Z92B 1WDPA 1VRXA 2DLEA 2DQUL 4PV9B 2WHKA 3QHMA 4UOW1 5LQBL 2JDAA 2JCCF 3MRJB 4PB0L 5JXAH 1OAZH 1OF2A 5H35B 1WIUA 3O11A 4NWUH 5MEPB 2PYED 3LS5L 2FSEB 4M8VA 2WMIB 2W67A 2VVNA 1DBJH 1HL8A 4JG0L 4Q9RH 5ITBH 2K3TA 3MLRL 2J88H 2GJJA 4MJ5B 4CDHA 5CCKL 5FKAB 2QQLH 1OF3A 3MXVL 4UTAL 1R85A 1C7TA 5JOPE 4UBDD 3CU1A 4HZ7A 3F6IA 4S0TD 3K80A 1I8IA 5DTFB 2VUOA 2L7JA 4QNPE 2W07A 1RUMH 3W38A 1FNHA 3EYFB 5CYYA 5BYWA 3RIAF 1C8XA 2FBJL 1WBZA 1WUNT 2ITCA 5B8CA 3GMRB 3RBGA 3C6LB 4PJIE 2CBVA 3BGAA 1VJZA 3VIGA 5TE4L 4KJPC 3BVNB 5GZND 4JREC 4WKAA 1ERNA 2EH7L 2VCBA 4AW7A 4RGND 1U91A 4AZ8A 1BZ7A 5JUEL 3STBA 4F33B 4HIIA 3T3MF 2SEBA 3B5GA 4MNGA 4L8CA 3O4LA 1MHHB 1FZJB 3LD8C 3OKKA 5ESVB 1JPSH 1GONA 1A6UL 4F9PC 3OZOA 4LKCA 1T1ZB 5C07B 5E6ZA 2D3VA 2F74A 4U1MA 1GORA 1GC1L 2NY0C 1CL7L 1I1FB 3MRFB 5F7MC 1UM5L 3V0WL 3W29A 3GH7A 4U2YA 3SE4A 2Y23A 2AAVA 1AHWB 1Q0YH 3FN3A 3RWDB 5HVHB 3MZTA 3A4XA 4G6AD 4C4KT 1AE6H 1I3GH 2R1YB 4PMYA 2F53A 1HWGB 1MHEA 4NRXA 4KMTH 2RGLA 3AFBA 1SVZA 2P8LB 3MV7D 4JFPB 4RGOH 4LNRB 3BYYA 2MNUA 4D9LH 5F3BA 3DVGA 5BS0E 1P1ZB 5HGGS 2HRLA 3FB7A 3K75B 3NABL 4WO4C 1A6VH 4G5ZH 3JWOC 4KUCF 5KZ6A 1FL6B 3TV3L 1NCBH 2YC2A 3LKRA 5ADOL 3K1KC 5JHLH 2DLTA 1WB0A 5CJBA 3SPVA 1IL1B 4WFHD 1PKQE 4G6JH 1UWGH 5IW6A 4FQLL 4MD5A 4ARXA 4PMNA 3QUYB 1FNEA 4URTB 3BPCB 4LLVB 5A16B 4UV4L 1W72H 2GIYA 3OAZK 3QNYA 3QZWG 3T0AA 2ZUMA 4LP4A 4MXWL 1J9CT 3T0EA 4IJ3B 1K4DA 2F53D 4PGCA 4XP6L 3N1MC 4XGZA 3VFPA 4DCQA 1M71B 3L4WA 4QRQB 1M7IA 4HD9A 1WDSA 32C2B 4YPGA 3VXUA 4PBXA 2Z93B 3HCVA 4P2RD 3QXDA 2E31A 4JKPL 5JHDA 2W9DL 2WSKA 2VDNL 1VFUA 3CFBB 1UZ8B 4K3EH 4WWKB 5GRYA 1JWSB 1ITCA 2D7QA 3DJ9A 4EOWH 4QPWA 1A3RL 4GI6A 1ORQA 2VR5A 4PRID 5FCSH 2OK0L 4WY7L 5FO8A 3HMXL 2EO1A 2ADJB 4CN1A 3ARED 1MCQA 2C1OB 4PJXA 1BWMA 1U8PB 1P2CA 3EYSL 4YBQC 4L4JA 4NFCA 5GGRB 5JW4N 2Q8AL 1W9SA 3T04D 4R7NB 3TVMC 4XWGH 4QTHB 4LVOC 2W95A 3DX9A 4I4WB 4ERSH 2BP3A 4G8FA 1NFDA 4HMEA 1HIZA 4RE2A 3WUWA 1SBBA 1S78C 2OYPA 3MUAA 1CDCA 1XNTA 1HXMB 3RIFF 2CDEB 2F8VA 3CDFA 1QVBA 4W87A 1DUYB 5TE7L 1EPFA 1TQBB 2R9HC 3BUYA 4O2FB 4TSAL 1W9PA 4RMSA 1YNKL 5C08B 3KPSD 3Q6FB 3S35L 3FT3A 4L3ED 4DJMA 2VDRH 2BCKB 2XQBH 3D25B 3UMTA 4DW2H 5J9PB 3U2SA 3BC9A 3VD3A 4POZC 4XNXL 2R29H 5DJXA 4GG6B 5EJ1B 4Z7UB 3QG7H 4GKOA 3D18A 4KMTL 1FZMB 3LKQB 4DK6A 3AM8C 1OAZL 1KIRB 4KGLA 1AIFA 2QPUA 2VSCA 1ZJAA 1LEIA 1PG7W 1WE5A 1FZOB 4A6YA 5DO8A 2FB4H 3EYOA 4CW1B 2HKHH 5BVPL 1NBYB 4N0UA 3H9SA 3F4VA 3TYGH 1H11A 4D6JA 1GOHA 1P4BL 1V08A 1CGYA 4YXLH 4L1HA 5CINH 2C3WA 2E33A 2AQ1A 2YC1B 4I2XB 4Y4KD 4KRLB 4MLSA 2YPLA 4X8XA 4R4FL 5C0EB 4GAGL 1IC5L 5SWZD 3WLBB 2CLVB 5CUSH 5JW3H 1YEIH 2FJHA 4A2LA 2HMID 3KYKH 1P84K 1S7SB 2NYYD 2C4XA 2QLVB 4U3XA 3CHDA 1PJ9A 2YMXL 3MKKA 3LKNB 1FFOA 4XZUG 1EGJL 2EDTA 3OKNB 1T21B 3U9UB 1CZ1A 1QHPA 4ODHH 2FX7L 4PJ8C 5B39B 2ZOLB 2BBAA 3K7UA 4UNVA 4WO4D 4X99B 4P3CL 4EIGB 1NFDF 3RVXD 4ZD3H 1CEOA 3O45A 4OZHA 1NGPH 1XF2A 3WIFB 4JHOA 2X4RB 4LCUB 1OGAA 3MLXH 3O45B 1BFVH 3PP3K 4QKXB 2EKJA 2A9ML 3KXFD 1AO7D 4ENEC 3WFCH 2G9HB 3PDDA 1ZANH 3DYOA 3TGXA 3NCEB 4O2EA 1W9DM 4XNZB 4FP8L 1XF4A 4JG1H 2Q8AH 2HP4A 1T0PB 2VDKH 1IGCH 1VESA 3IS1X 1KTLA 4LPXA 4XPTH 5T3ZL 2X1PA 2AK4D 5E8OA 2EIZA 3ZE0E 5ISZD 4C7GA 2FHBA 4FRWA 3CIHA 1HOCA 4WI5A 4OGAC 3TYFA 1O8PA 4NC1E 3U0WH 4NQDD 4UR9A 1E6PA 4PRPA 1VB9A 2HVKB 3S5LG 1LO3L 4EIZC 1IM9B 1W72A 3T2QA 3L3DB 2VI0A 3EDDA 3S5LB 2WMFA 5HYIA 1KLGA 2MKLC 3MMEA 1CWVA 3HFMH 1PKQB 3MV8D 3P0VH 1CFTA 3NCCB 3UTSD 3QI9D 4MDIB 1D7PM 4H8HA 4P7LA 2D9CA 2PXYD 1TVDA 3UZVB 7TAAA 4TSCL 3ROLA 2D22A 1NAML 1N7ML 1OD0A 2ZNWA 5ENWA 3BT2H 3BPOC 1N0XL 1YEFH 4P3DB 2E7LA 3ILPA 3JV4A 5F9WB 5DJ8B 2OWWA 2CO7B 3UYRH 4PJ5A 2WHLA 3FQNB 3SCMD 5IIEA 3VIMA 4QCEA 5A94A 1ZGLB 4F7CB 1FH9A 5DEGB 5D8ZA 3GSOA 1S9VB 5EU7C 2IAMB 5E00A 4BSVA 3WN6A 4OZHF 1IV8A 4RFNC 4Y7MA 3PBGA 1ZLSH 3G04B 3PWLB 4NQCE 2WZEA 1P53A 1A7RH 1DANT 4UTBL 3SBWC 1LE9B 3KL0A 3CH9A 6CGTA 4PR5A 1VBRA 1CI5A 3S3JA 1WSST 4HFUL 2QBXA 1M6OB 4NM8L 3NYDA 5GSVB 1RVFH 5LYRA 4P2QD 5MEOB 1BM3L 1JGEB 2G5BB 3C87A 3PZIA 3K46A 1UEYA 5HOSA 2WBJD 2AI0L 1T5XB 2HVMA 1X5YA 3WFHB 3V5DA 1T04B 3W9DA 1B3WA 4P9HC 3WJLC 3KLHD 5JBFA 3MRBA 4K3JL 4X98A 1JNLL 5IDIA 1E28A 4P4KB 4LP5A 4R4NC 1K45A 2OQJA 5DRZB 4YC2C 4ZD3L 2D4DA 1PX3A 5TF1H 1J0ZA 1CD0A 3MBXL 1AY1L 2BFVH 2DRUA 3EOTH 5LVEA 1WV7T 3U7YH 2KZ1B 2OTUB 2XWEA 2AXJA 2X4TB 1CTOA 3ZQ9A 5BRQA 1K2DB 5EFIA 4MX7A 4J3XA 4XH2A 3G04A 3HCVB 3QJHB 5GHWL 3QUMH 4G6FD 1FLRL 1SEBB 3PQYD 3CC5B 5DMIL 4Q97A 3IT8D 3GB7A 1PQZB 1U8KB 1NJ9B 3BAIA 2XYLA 2EEAA 5I9QB 5D71H 1AQDB 5DJ8A 5FYKD 4OF8A 1O7AA 3SKUD 1U3HA 2GJ6A 3SPVB 4JFDB 1OAKH 1NANI 4KQ4L 2AK4B 4YXKL 1U2HA 3BKJH 2LTQB 4F37K 3BDXA 4BFBD 1OTUC 4YAQA 2PR4L 1TJGH 1O59A 4JHAH 1FVDB 3L95A 2YUWA 4LNRA 4Y2DC 4F9JA 2W9EL 2IQ9L 1UKOA 2CR3A 3IF1B 4DOHB 2F53B 3FQRB 2EEXA 2GFBB 5GRVL 1NFDE 2C8NA 4N90E 2W63A 1DQQB 2DQTL 4NQSA 3KAAA 4NQEB 5GHWH 3BEWA 4YHML 2DLHA 4X7FC 4XUNA 2DL2A 4OZIB 3LMJL 2ZX9A 3MR9B 4HULB 4O58H 2Y6SC 1JG9A 5B3NA 2XZCL 4N1HB 1HJXA 1F02I 5DO2C 1A4KA 4F37F 1K4CB 1WFTA 3CZFB 3WDHA 3DSFH 3H3PL 4J2XA 1AQ0A 1L0XA 4Z7VA 2J1AA 1AXSB 2XNAA 1J5OL 1FH7A 1IFHL 2DQEH 1U8IA 4R97C 4FFWC 4CD6A 3MV7B 3OJMB 1W1YA 2D7MA 4MTVA 5C9JB 1CECA 3G9AB 4JR9L 2ZX8A 3VXPB 3WQ4A 4XC1H 3UJJL 3SCVA 3MX0A 4X9GA 4CVUA 3BQUD 4M8UA 2VQ1B 4IS6B 4MNQE 3QEGH 4FQPA 3AMCA 2BXZA 2R8SH 5C0JB 2ZOLA 2CKBB 4FP8H 4JG1L 2J4GA 2NQCA 1FORL 3CSPA 4Z9KB 4OOUA 3V2AR 4I0CC 5D7JC 4YLQT 1I1RA 3WHXB 3VJ6B 3W9EB 2GSIB 3RA7L 5GSRA 4BFIB 2O9TA 5SWZE 5FM5M 1BVLA 2NR6C 3D39B 2ESVD 3S34L 1L7IL 1KIPB 1QR1A 4LLWA 4L9DA 2DN7A 4ONHB 3PGFL 5EMYA 4PMQA 2H8PA 4JQXA 1G0CA 5J1TC 1OIFA 1DLCA 2ZUUA 1IAMA 3RUGA 3ALGA 4PLKD 1F3DH 1PG7X 2A6KB 1R3IL 4X4XB 2EECA 2GDUA 3VWJD 1IAIM 3RPIA 1CU4H 4NHUA 4UQAA 4P8WA 1BD2E 4NPYB 3T2NH 4CMHC 3QHFL 2IH3B 5EN2A 2XQYK 3MFFA 4QX2A 3Q1SH 1KCUL 2VDKL 3GIVA 1N5AA 1QSFD 1AFVH 3CUHA 3GHBL 1LDPL 4LBEA 3AAZA 1J05A 4KRUA 1KN2H 5HI3C 2B2XL 4AD3A 4PCTA 1SY6L 1Q1JH 2VE6B 4HQQL 4XPHH 1UZ6F 3WBDA 5L88L 3ZKXB 3MRLA 1DDHA 5H37G 5HJ3A 5EOQL 4FF5A 4O5LL 1HSAB 1KNOA 3X3FH 5I77A 5F89B 4WEBL 3DROA 4MO3M 1NP0A 1HH6A 3GMQA 3QUMA 4DM2A 5J1AB 3OR7B 3UDWC 4WWKD 4LCCC 3S6TA 3WS6C 4KK6C 3SDAC 4MDJA 1NMBH 2IC2A 2EZ0C 3GJFK 4XCEA 1PSKL 3VCLA 4XP4H 4DOHE 5AC4A 2H32A 3V7AG 2Q3AA 1SJEB 1TVHB 4PBWD 1N2RB 1QFUL 2Y36H 4PJDB 1KFAL 1WJ3A 4LHJB 3KPLB 2VZQA 4XX6A 2ADJA 3E6FB 1KYOJ 1D6VH 4HA3A 2ENSA 3EOTL 1WZKA 1TZIB 2D9QB 4OD1L 5CJOH 3SN6N 4LDEB 4Y19B 4Z77A 4HUVA 3N9GH 4KI5F 3RUGF 4AENA 3S8WA 1LO2H 4PTTB 5IK3B 2DLFH 3O9WB 4OZFG 2FIRT 4LNVA 2OMBA 1CK0L 4K07A 4ZXBB 4ZAKB 1CGSL 1WT5A 5E0QA 2QQMA 1A47A 3UC0L 1EFXD 1QLRB 2Z31D 2F54B 5HHVH 3N04A 2JLLA 5I15L 1NFIB 2UZIL 3MRKA 3WEZA 4LLMA 1D6EA 3EFFB 4QFUA 1UCBH 3RY6A 3IAQA 1PZ5B 4P57B 2CIIB 4KK8C 1K4DB 2R56L 1MIEH 4OZ4A 5IBUB 2O5YH 2M2DA 2XSAA 1OAQL 4F7PA 4WTWA 4LLVA 5A16A 3LOWA 4ALAH 5A95A 4AD2A 1NLDH 4YNYA 1OB1A 3SE9L 5D7SH 5EU3A 1P9MC 5D1XA 1RU9L 3DYMA 3RWGA 2G60L 3GMLB 5DD6A 4R4BA 5TGBA 3BXNA 4HTYA 4YDVB 2J62A 4PJGE 2VLRE 3WH8A 3O3UN 3KWXA 4XB7A 1A7QH 5DR5L 2DYPB 3I6LD 1A0QH 5C09D 1JBJA 4JRYB 2DBLH 2NTFA 5INDA 3TC9A 4AG4L 5IHSA 3VPLA 3UAJD 1A9BA 2FHCA 4L8BA 1ADQH 4U6XB 1QNSA 3DTXB 2YRPA 5E7BA 5MI0B 3RI5K 4LXFA 5GXBB 1IZKA 1I75A 3HZMB 4O58L 4V28A 2EKSA 4XPBH 4WI8A 3ZR6A 3W26A 3NPSC 3FT4A 5EOQH 1JD9A 1KCSH 2E8ZA 1UHVA 3C6LD 1ZHBA 5C0FA 1JGUH 1UM6H 4MGSA 1XGPA 5JDSB 3SDXB 5T1LD 5JPNB 5ALBL 4P59H 2XRAL 2Z4QB 5D9SA 1I7ZB 1DUZB 4NN6B 2EC8A 5HHXH 5J11B 1WLHA 3QIWB 4LKXA 3IJ9A 2H9GB 3OJDB 3ZO0A 5T3ZD 1W99A 3LHPL 3FTGB 1E72M 1MJ8L 1KXTB 3MLTA 3EHBC 3EYQD 1UWWA 2D7TH 2N56A 2W1UA 1PBGA 2A3BA 5HYSA 4NO0A 3BISA 1G7IA 5HHQA 3PXHA 2EPNA 2AEPL 1KPUB 1PW3A 1CZTA 1QNZL 2WBJA 4C7DA 3TBSB 2VIRA 5IQ7L 2HTKC 3ULUH 1C1EH 1UWGL 4MNJA 1M05A 3LH2H 4JQIH 5I18L 3QIUC 4KJYB 4X5XA 5CHNA 1AKJD 3VWKA 3C6LA 4M82A 4MWFA 1Q9OA 2V5MA 1LGVA 4KROD 4N8VB 4X4YA 3VXSB 3FMGL 4XPAH 3REWA 3NSNA 3QA3A 3O6FC 5FYJU 4QGYA 5J12B 4G42A 1W0NA 5TPWH 2Y5TA 3WSUA 3D5OF 4LVEA 4OD3H 3CVHL 2R23A 3S4SB 3NTCL 4TXEA 5DTFA 5I76B 1IC7H 1CK0H 2KUTA 1KXVC 4K2UL 4JM2A 2NY1B 2PXYB 5BRZA 1R0AL 4G9DA 3U4EB 1VPOL 5SWSD 5EUKB 4D6IA 3U0PA 1RK0A 4XP1L 4P5TC 2X7LB 3OKLA 5D9NA 2ZP0T 1QSEB 3CUPB 5CPQA 3RWGB 2VUYA 5IVXE 4OM0L 1VGKA 1LP9F 3IS0X 3D0VB 4AJ0A 2IALB 3KJ6L 3QEHA 5D7LA 3V6OC 5E2TL 2MJWA 3DETD 3FONA 2A77L 3AB0C 5AAMA 3RX5A 3AIRA 1GC1C 1HYRC 3QOMA 3SO5A 3GXUA 2EYSB 4Z18A 4ZNCD 2D24A 4BH7B 4W4OC 5GGTL 5DJDB 3AROA 3BH8A 2V7NA 1YNTA 2Z31A 3CD4A 1EFXA 5FM4A 3HS0A 2XICA 5E4EB 2ZPKL 4GRWB 5BMFL 3IJHA 3RPMA 1NEZA 4X6FB 2XGIA 3WL9B 3MRIB 2VC2H 2CETA 5BS0D 4NUGL 4NZUL 1JD7A 2BSRA 5F21B 1DVFB 1JPST 3MJ8B 1I9RH 1U93A 2OXGA 3B9KD 5TDOB 3LKPA 3TZVA 1VADA 3NDYA 1I8KA 5I1EH 1S7VA 4XP1H 1ONQA 2FZ3B 4UQ2B 2DQFA 1OWQA 4Q9QH 4NNXB 2OR9H 3SGJC 3WJJA 2XY2A 4D1JA 1FFRA 4LVNC 4GAFB 3QHZL 3DV4B 5FO7A 1LJYA 2WLYA 1R5IB 1ADQA 3WQ6A 5T3XL 3QWOA 4WCYH 3ULVC 5F70A 5I79A 1A7PL 5ITBL 3JUGA 3W2DL 4GH7B 3R06A 4PUDA 1HEZB 2XPKA 5TD4A 1QFOA 1FLRH 3ALWA 4CVZA 2YRZA 3MJ6A 3AS2A 2DLFL 1KC5H 3D3AA 3O3EA 1FGNH 4LLDB 1MAML 2CHNA 2EXYD 5HHMB 1B4RA 3VFSB 3DBXA 5IWLC 4NDMB 5I19H 3GNMH 4BA8A 1QLEL 2DQXA 1E6OL 1UQSB 5EIYB 5JW4M 3FAWA 1LP9A 4S1SH 5FIEA 2DT0A 4KZEL 3VU2A 3NSMA 2HT4C 1U6AH 1D5IL 2MCPH 3OKMB 2FGLA 5IMLB 4PJBF 3KPRB 5E8NB 3P73B 4XT1C 1Y7VA 3AAZB 3U7AA 4P23C 3CFEA 4XRCB 1VEPA 3GIVB 1RMFH 5AY7A 3ZMRA 3K74B 1KV3A 1E4NA 4LSVH 3WXWH 1B2WH 3GXMA 1N59A 5EULV 2YIHA 5BV7C 2WBWB 3MV8E 4N0YH 4MXWH 3DI3B 5IBLC 5KG9A 3RIAK 5L7XH 3VMOA 2OWXA 2GEEA 1Z3GL 3WCYA 1QI2A 4O51A 1IVLA 4P2OD 1X5FA 4QY8A 2B4KA 4A41A 3D69B 3ZIZA 2RFXA 1B4JL 2DQJH 4W8JA 5A40E 4NHCL 5FYLE 4D6DA 1A6TB 1WAWA 5JUVA 2J79A 1M7XA 1IM3A 1KB9K 3U4BL 3ZT7A 3SCNA 4OLXH 4S1SL 4U05A 1WWWX 1W2KT 1IGJB 3T2PA 5DS8A 4MB5A 4X4ZA 3CKHA 4NO0D 1V6VA 3TA9A 2X4SA 3WJJC 3ZT6A 4M1GH 3HE6D 5C0JA 1QNRA 2J1TA 4HT1L 3UAJC 3QXTA 5IHZB 1GQPA 2P44B 4IS6A 3U48A 3UTTD 4P46B 1UY1A 1FN4B 3HMCA 1KELL 3M7SA 4PRIB 4F7TB 3L5WB 3B9KB 5CJQH 3NMEA 1R3LA 4O2CA 4F57H 4K7PY 1QSZA 3CAFA 4UQEA 4ELKB 4LMQE 4XBPA 4NQTA 3X14A 2W65B 2W59A 1LD9B 5KANI 4LSQL 1PG7L 1XH3A 1CD1A 4JFYB 5INCB 2NX5E 5A6JA 5EO0A 4S1RL 4A3YA 3W2DH 2DWDB 4L4VB 4NWTL 1UEMA 3WNOA 3DC0A 5D7IF 3P30H 1S9YB 5FHAL 1JGDA 4LARL 3WMCA 1S7UB 3ABZA 3EDEA 3FB6B 4NBXB 3C2SA 4ATDA 1ZA3B 5GGVL 5LCWL 1OAUH 5AD0B 2WAGA 3L2MA 1A2YB 2UWFA 5IMLA 3T0ED 1ULPA 4OIBA 5MERB 2IJ0C 2ARWA 5C07E 2MSPA 1O0VA 1UKTA 1ED3B 2W94A 5BV7L 1F4WH 4H0GA 1I9IH 1NLBH 3L5XL 1KXVA 4MPKA 1DQLH 4U6VL 4YDJB 4RGMC 1T03L 4KMQA 3BPNB 1EBPA 3VD4A 1K8IB 2Q7NA 1KG0A 5FL0A 1V3KA 1HJUA 3ULVF 2N7AA 4LCCA 5EBMB 3VXME 4WENB 3DHMA 4FQ1L 1Z5LA 1KJ3H 4YFLI 1NGXA 4X9FA 1CDHA 4XC3H 4PJIB 2B1HL 5J56B 4NWTH 3VIJA 2EBNA 3SURA 3I2JA 4Z5RA 3B5HA 4LKSA 1CD9B 5FUCE 5FYJL 1WGOA 1VKXB 3NPSB 4N90D 1NGZB 2E0PA 4KK9D 2WVSA 4H25A 1ECEA 1FYTA 4MQXD 2DT1A 3KL5A 3E8UH 2OJEA 4QCIA 1N26A 4HUUA 4NN7B 4N0CC 5I74B 5F7DB 4P5MA 5TDOA 3HRZB 5EA0L 3DMMC 4C56A 4DM1A 3AMLA 2P8PB 5J8OA 4ISVB 2A74A 1BFVL 4M6AA 1E28B 4IIQB 4TNVK 1DEEA 1ZL1A 4D8MA 4D6GA 3B3IA 5T5FL 4TPRH 5HY9A 4RAVA 3VXNA 3DXAE 4P7OA 4BQ5A 4NYLB 2NY7L 2CBJA 1KB3A 4XPGL 5J6GB 5CJQL 4ATWA 4QCIB 4AYFA 5D72H 3WMSA 3MLPA 5KVFL 4NZRL 4PR5B 3HPLB 4KJWD 1GJWA 5C0NC 4AD1A 3NCYP 1OL0A 1CDYA 3RHWF 3S37L 4UT6L 2JIWA 5DSCB 1V05A 1YEIL 1SHMA 4OZGF 5EORL 1J18A 4M5YL 1G6RB 4PGBB 4XWOD 5M03A 1MH5B 5EDXA 2CK0H 3GSOB 4WU7A 2AKRB 5TE6H 1MCNA 2F54E 2UZYB 2QADD 2A2QT 4AZIA 2ARJB 4XBEL 4PP1D 1J8KA 1BX2B 3V6BR 5IJRA 4ZXBC 5GRVK 5HDOA 3UPRB 3U83A 1ZKAA 1IKFH 3SKOA 2FYYB 2PYEA 2WM0A 1ZLVK 5K59F 4W68A 3WQWA 5H2BB 4M7ZB 3QEGL 1HINL 3BLPX 2RQ8A 3NIGF 1Z2KA 3IB4A 4Z6AT 5CAYB 5GNXA 2PCPA 4DZBB 2Q7YB 2VAAB 4OZFH 2XA8H 2PWFA 3LPWA 3IDUA 5FGBC 1I8MB 1T2QL 3L3DA 4NRZA 3OZPA 4HXAL 1T03H 4PJ8D 2DH3A 4X0VA 1PY4A 1TVBB 4DWSA 1MCBA 1B4JH 4GO8A 2YN3A 4IOIA 3RWFA 5EJZB 1KPUA 3UO1L 1EEUA 3MGOA 4NQDA 2VT0A 1QUNA 4JO4H 1HX0A 4IRSA 3BZFA 1LVEA 2CK0L 4ORGB 3SY0A 3ARWA 3CSYA 3G5ZA 4L8SC 2DIEA 2NZ9D 2H1PH 4J12A 1SM3H 2NSXA 4C7FA 4FQCH 3AICA 3K77A 1IGYA 4G3YH 5HXMA 1B2WL 3R4DA 3IFPB 4TUKL 5JQHC 1BWWA 2LU7A 1RH9A 1AI1L 2AXHA 4GOSA 5DJYA 1MI5D 3HMXA 1ZHBB 3STLA 5C0FB 1FNAA 1Q9WA 1FV1B 3EYSH 4CUBA 1DQJA 2AS5M 5BWFA 4W5ZA 5TQ0L 3M8OH 3TZVD 4LCUA 3UDWA 3LIZL 4OZGA 1T80A 3S3SA 3QDMD 3W0WB 1H6XA 3VRIA 1CZSA 1M7DB 1NGYA 4NM4L 2ZOXA 1TMQA 4X5LA 2OS7A 3HJEA 3CX2A 3LEXB 4HX1B 5I1LA 2LQRA 1NCAH 1ZVSA 3NA9H 1AC6A 2AEWA 4DXRA 2QLYA 3KG5A 3L4UA 1R7OA 1KN2L 2HFGL 4QXGL 1A1OB 4LSPL 2APBA 4KTEL 5C70A 2YC4A 2HH0L 2KZWA 4OD2A 2BHUA 4U6YB 4MNLA 5BXFB 4FMVA 2IPUG 3NN8A 3GMPA 3O6ML 5F7EH 1X5LA 3O6AA 1QA9A 3SCSA 1P7HL 3KE0A 3U36B 3WD2A 1YYLH 4YNYB 2X4OA 5F9JB 4ZPVB 3EW3B 2R2BA 5IVZA 2YC1A 4I2XA 2PBOA 4KJQD 1W3LA 5IOPA 3UBXB 3MZGB 1KB5B 1PDKA 3H9SB 5JMRA 1SJHB 3POHA 3PHOA 3DVNA 4IM4A 5DI8B 1FZOA 1KENL 1J10A 4RRPA 5TE4H 5IB5A 5C0GA 5AYBA 3ULUF 2XM1A 1FC2D 2P7TB 4JFWA 4R6UA 1RURL 3GK8L 3H2WA 3Q3GB 4JRXD 4PBVC 3P73A 5HVGB 5ABEA 3WIHL 4PJCF 5I3DA 2VABA 1WBXB 4J3UA 5HHPB 5IGXL 5CBEB 3KPTA 4UOZA 3HE7B 5IBTH 4Z76B 2DJUA 2ID4A 4UAOC 3CFDA 4GKLA 3U57A 4HLJA 1D5XA 1S8DB 1HCFX 4MNQA 2XPGA 1VFBB 1BAFH 2VLJB 2R15A 4HGKC 1N6QL 5BZWA 5IP4A 4DFIA 2L7UA 3O3EB 4WFFD 5C0RH 1EAPA 4OLYH 3JXAA 1E3ZA 2XGBA 4CRPA 3CXHJ 5KVDL 5FUIA 3GBML 3V6ZA 4WFGD 3SE8H 2MCG1 1SMDA 4Q0XL 5E4EC 3K8LA 5C0BA 5TFSL 3RWJA 1NH6A 2WNGA 3L7EB 5I75B 5C6PB 5CJ5A 1RURH 4RL3A 1TMCB 4HK3J 4M1DH 3IU4H 4J23A 2R8SL 3PL6B 1KXQE 5ADOH 2ICCA 5HHNB 3LKPB 1U8LA 2YWZA 1MPAL 3WNNA 1DN0A 4HIXL 3HMWL 4ZQKB 1NKOA 4L4PA 3QXAB 2ZG1A 5B39G 1YY9D 3VXMD 5CPTA 5ERWA 5DVKA 3WSQL 4A45A 5AWNL 2ERJC 4YGVA 3FCTB 1U42A 1FG2B 4JPVH 2VZUA 3B5TA 5DSCA 5TQ2H 1A1MA 2AVGA 15C8H 4UU9B 5E9DA 4AG4H 1HJWA 1ZLUK 1KPRB 2YD5A 5KAQF 1XH2A 5TE6L 2GTWB 1CX1A 2H2PC 2JK5A 1FA2A 4UZUA 5FV1L 4OFKA 2HH0H 5D2NC 3PHSA 3SEEA 3DX8A 4TULL 2QV2A 2BVQB 3JUYA 3NJ3A 2QL1A 1FVEB 3QUZD 1QW9A 3IDNB 4KUZL 3SGDI 2W62A 2HRPH 5HY9B 1V6XA 5IW6B 1N3NB 3L3IA 3WE6B 3U36A 4IIQA 4F9LA 3IXTB 3FB8A 3GSXA 3QDHA 4NO2A 2NW3B 1TQCB 2X4NB 4I0PB 3RZCD 1QBMH 4Y88A 4C4KO 3FOLA 4PLJD 1RP8A 3VW3L 3AMDA 4JZNA 1V7NH 3W27A 5LG1A 4ESKA 4G80A 3PP4H 4QX1A 1M53A 2WV3A 1ZVSB 3AXIA 3F7YA 2UY5A 4O4YH 1OM0A 1MUJA 2R1YA 4X7DC 2VLKB 4ZFZB 1XIWD 3ZE2F 4LAQH 2WWKO 3EO9L 3FO0H 3W25A 1F90H 4KVCL 4FQQB 3TT3H 1X1NA 1Z5LB 3BSHA 3O3BB 2I9LA 4MAZA 3AREC 4ODTL 1UY0A 2VX6A 3AHTA 4NJ9L 3QOKA 5IKCA 5BVJB 2B0SL 4OUUA 4OTXL 5ESVA 5J6HA 5JORA 4YFEA 1T7YA 3PGCB 4YHIB 4OM0H 2EDFA 4KHXL 2UWEE 5EWIL 1B31A 2Q76B 5I66B 1HNGA 5IJVA 2EPOA 4OUUB 3DURA 2XUCA 3UPCA 3SDDC 43CAB 1JI2A 4JGMA 4LGXA 3ES6A 5DD5H 4GRLA 4LPYA 3MS8A 4HQQH 3ZJ7A 5HYJE 2VB5A 3TFKC 4LPCA 5CD5D 5J3HD 5JLZA 2JIXB 3LEVH 4YR6B 4WIQA 2XTJB 2NPLX 2WMGA 4S1DC 2J7EA 5HGBB 2AMGA 1OAUL 5HHVL 3QDJB 2UUDH 5HBBA 5DUMH 4MJ6A 2ZCKH 2E4TA 3KPQB 3QDAA 2OP4H 1E43A 1EXUB 5HYJB 3AFLA 4M3KB 3H42H 1LD9A 1NEZG 1QSFA 4NNYA 3VG9C 3QGVA 4JFTA 2AXFB 3QFDB 4NCC1 1MRCL 2XQXA 4ELKA 2NYYC 3UTSB 1FFPA 4UB0L 1MXDA 1MIMH 3HKFA 1QSEE 4U1NB 4XAWH 5I1CH 1DANU 3KDMB 5FUZH 1KACB 2IH1A 4PRPE 4Z0XA 1A6VL 4QCFA 5BRPA 1C3FA 3TM6A 4KC3B 3WNMA 2B5IC 4Z7QF 2BVQA 3BE1H 4FQJH 3ZKMD 4KTEH 4PJHF 2VL5A 4NP4L 2C0HA 2HMIC 5DVNA 1BYBA 1LG1A 4Z2KA 3EYVA 4ODBD 4M6ML 4LU5H 1H15B 2GTWA 4BZYA 1A7PH 5C0AB 4PRDB 4PREA 4NQVA 4WHTA 2OR8A 3HZVA 2GY5A 2VC9A 1F3DJ 2QADC 5CEZL 2D0FA 4M61B 1IGTB 1K9TA 3RWCA 5DURB 1MW0A 5DJZB 1T2XA 3D69A 3SDYH 5D96C 1GU3A 1MWAB 1F2XK 4GRLD 3MV9A 1N8ZB 4JDTH 4JQVC 1DBMH 4E5XA 4V1DA 1C8YA 3KXFB 5CP7A 2V3EA 1UFUA 4ZEPA 4QWWC 2G5BA 5L0QB 1U30A 3A6BH 3KYNA 1MIML 3QUYD 4XAWL 4JZOA 3CXDL 3GGLA 4PP2A 1LNUB 3QUKB 3ARDC 3AXXA 4OUOA 1EV2E 3GSWB 4DZ8A 2V7HB 3GEWB 3O6FA 4ACZB 4Y5XB 1RPKA 1QPKA 4HWEH 1E5NA 2BHZA 3WD3A 1NANH 4PLJC 4HK0A 4N0YL 3PL6C 3WIIH 3CGTA 3IFLH 4IRSC 3DXAA 4I48A 4PGDB 1H5BA 4JANB 1NWSA 3V6OA 2R1WB 3PWUB 3CBWA 3FW6A 5JHDD 1WDQA 4RZCB 4RMQA 1KIQB 1EAJA 1VEMA 5AAWA 4M7KH 4QYOB 2A3EA 3TO4A 1CR9L 4H20H 2EYTA 1G7LA 3BKMH 1KNOB 4P46D 4MGQA 4OKDA 2VXUL 2OJZH 2APWA 3HNBM 1LO4H 2RGSA 4A42A 1Q72H 4F7MB 3SOBL 4R3SB 5FA3A 3N85L 1ZWIB 4U5KA 4WEUD 3RTQA 1SJXA 5IF0A 2ZWYA 5TFSH 3C8DA 1H3WM 3V4PH 1N4XH 1A7OL 4PJAE 2ZCKL 1N5YH 2GSGA 4APQC 4OAWA 2YDQA 4Y5XA 4LSUH 4E0RB 5CGMA 2B7DT 4NZDA 4AL8H 2DQCH 1F8TL 3MOAH 3OGOE 3NGBC 1MCSA 1H3UA 1JYXA 4JRXB 2PW2A 4UAPA 1L0PA 2XONA 4HHAA 4PJCB 1P4IL 3MRMA 3V6OE 1JGVH 1C1EL 2A83B 4JFYA 4X6FA 5HDBE 4F79A 5DEFB 4WFFE 3VFWB 3QG6A 3IDXL 2DAVA 3GMPB 1AR1D 3VFNB 2CDFB 1KIPA 4B41A 1YEHH 4K7FA 1WAAA 2FWOB 5FHAH 4UNTA 3G08A 2CUHA 1Z32X 3FZUD 3MUZ1 1KR0A 5F6HI 5IW3A 1ZTXH 5AG8A 3GTNA 1MF2H 2LS6A 5CQ1A 3WIFA 1KEML 1M4KA 5F71A 5CEZH 4AZCA 4V1DE 4PJEE 5A6BA 4PJIF 4PMDA 3MRCB 3HLAB 2DQGH 3TONA 4Y2OA 3X11B 4Y8DC 1QSED 3KPRE 2X70A 5ESAB 4LLYB 2ZCLL 2UVFA 4YQXL 3QNXA 2E6PA 2W47A 3G08B 3OKLB 2NY0D 1YY9C 4KH2A 4I0KA 1JNHA 4JFFA 3NA9L 4U31A 1ETZB 1KFAH 1RZKH 2NXZB 3D9AL 3FOLB 4MQ7A 3HNYM 1F11B 3WQBA 3PIQB 4QHKJ 1WIOA 3UJTH 3OKOB 1P4IH 2XFYA 3OB8A 5KW9H 4QF1A 3MSPA 4W4ZA 2A83A 4KI5C 3T09A 4M4RA 5JOPD 2ZXAA 4EQ3A 4ZOCA 3CSYB 4MA7H 2Q87A 1YDPA 3VFTB 3MR9A 5EFFA 3IDMB 4X6DB 2XTLA 1D5ZA 2EH8H 4EVNA 3F5LA 4YXHL 1I3VA 1JWUB 4K8RC 1ZBKA 4N8PA 2PTTB 3SE3C 3O6LH 1UZ0A 4XXCC 1FCCA 2CJUH 2NX5D 4NQSB 4JFSA 2BVEA 4IJ3C 4JFVA 1MJJA 4N8VA 2YPKB 4L8SB 3ARXA 2WANA 3ZT5A 1R5VB 2W60A 3N1GC 3L4XA 3RM8A 3EO1A 1UVQA 4N9GB 2AJSL 5HNNA 1KCRL 4QHNA 4YHPA 4HMDA 2VURA 1AGBA 3QPXL 4EI5A 4S1DD 5JQ6L 3HNMA 4XURA 1BLIA 5FK9A 1FYHB 1UT9A 2R2EB 4QB6A 4J4PC 3FAXA 5T3XH 5J6HB 5JORB 2D3NA 1VA9A 1HHIB 2YL5A 2ZE0A 3PWVA 1MLBB 5EOTB 3HZYB 4QXWA 4TSCH 1DR9A 4PRPD 2YA1A 1RP9A 3ME0A 5IUSA 3T0EE 3ECQA 3QEQB 2NXZD 5ACMA 1NX9A 1AHWC 4FQQA 2GUOA 3MRGB 1YA5A 4JAMB 4JHWL 2XZQL 5EIVA 3WD5H 4P4KC 2VISA 4GXPA 4CMHB 4Z78B 1IEBB 4TN9A 3W24A 2H6PA 3MO1A 5M94B 2O5ZL 1VEOA 4GW5B 5C09B 5D7JD 2BFGA 2VLJA 1C93A 1NEUA 2RCSH 1UD8A 1T3FB 3AHVA 1L9NA 3KXFA 5CGYD 1I9JL 1TNNA 4K3GA 1UD5A 3MJ9A 2V3GA 1G1CA 3MYZA 3GXFA 1OD8A 4PSRA 5A2AA 1FGVH 1KEMH 5C0CA 3W6LA 4RYDA 4ODWB 5F9OL 1MWOA 2WWMC 4OFDA 4UQ3B 4OI9A 3WUBA 3OAUH 4B7IA 2VLJD 2MFNA 3RVVD 5IEKB 5CKGA 1BMGA 4GBXB 4KZDH 4RDQF 1UM5H 3V0WH 3WS3A 4N0RA 4BH7A 5DZLA 4ZSOA 3S36H 5GSVA 1QKZL 5DI8A 3CDGA 5I18H 3CLWA 4K8RL 3CNKA 4DCQB 4UDUB 3LEGA 1UYYA 2ESCA 5SWZA 4LL9A 1Q6GA 4BQ9A 3ARDD 3AMKA 1Q1JL 4N68A 1BAGA 3MUGA 2YUVA 3W11C 4CMMA 1XZ0A 4H41A 2UWEB 2WMPA 5T1LB 1ZLWH 1FFNA 1IL1A 3PV7A 4XBGA 1PZ2A 2CDGA 2C7UB 1JF1B 3BN9D 2X7LA 3H9SD 5BXFA 4WFHE 2A3HA 4FXKA 3V4PL 3AS3A 4WI9A 3FB7B 3QG7L 2Y6HA 4ZENA 1G7QA 3G6DH 1MAJA 1RZKC 4U3HA 1U8MA 5GS2D 1KQZA 3MGTB 1F8TH 3MOAL 3F8UB 3EYQC 4LRNH 4G7YH 1GJIA 1JGIA 3WNKA 1FE8H 2I24N 1XGZA 3T65A 1RJZB 3GI8L 5GGSY 4YHLL 4Q7NA 4N0UE 3MRGA 2YB7A 4WWID 2ZJSH 3WQ5A 4HDIB 1G7JB 3VWKB 1TZGH 4PSPA 4NUJA 3SGKC 4H5SB 1LO4L 3PWNA 2Y6GA 3AOFA 2AJUL 4R4FH 3OB0K 1BPVA 1N82A 4AH2A 4ML4A 1FPTH 2EDEA 3QEQD 1WCGA 1ZHKB 2W9DH 2Q76A 4X6CB 2H2SC 1WNOA 5FK9B 4QWWD 1UWRA 4F8XA 1U8OA 2B0SH 1NM9A 4L4OA 3EYUH 1BZ7B 3VXRA 1TG7A 4DVRH 2AP2A 5BRZE 4ZTOL 1WCBB 3ARQA 1JF6A 3PJSA 3I2IA 1OD3A 4FQ2H 3UCQA 1P84J 4GO6B 1YYML 4G6KH 2NY5C 1YEFL 3ESVF 4ZTPL 5JXJA 2IBBA 2AXGB 5IB5B 4PRIA 4NFDA 4PRNB 1DBJL 1A64A 3F7VB 3F7PC 3MLZL 4GMSH 3ALPA 3CCHB 2VLKA 4LRIC 1I1WA 1RUPH 4Q22A 4M9PA 1S9WB 3EJYC 3LEVL 3CZKA 1HQ4B 2DTSA 5C09E 4K9EL 2X4SB 5F6IC 2Q6WA 1NC2B 3I6GA 1KTDB 2CEQA 1U8MB 3ARVA 5B3JF 1B90A 2H8PB 3D3VA 2QSCL 4ACYA 4DGIL 3BO8B 3MTRA 3H9ZA 2W46A 1I7UB 4QXTB 2R0WH 4TOYH 2VDLL 3T1FA 5I0DA 3F65A 4JFFB 5HGAA 3ARRA 1C5DB 1UJ3A 4GLRI 4XVTH 4YHEA 3JVGC 1OY3B 1PVHA 4XBGB 1X9QA 5GSRB 5DMKA 5HI5D 3RO8A 1U36A 1E6JH 3WKML 1EGZA 2AEIT 4NFBA 2M1KA 4X7SH 1YYMH 3SBWA 3NBNA 5D9OA 5T1MB 4UDUA 5E7FA 3QIWC 1RZKL 2Z4FA 5ESQA 4P2OB 4OCYL 3IK2A 4LLMB 5JQ6H 1DHKA 3LQCA 4XMLH 1E3XA 1INEL 4ZSOB 3I50L 2IAMC 2J7MA 2Z1SA 2MHAA 1I3RA 2XV6B 3A0OA 1HZHL 4FG6D 3ULVE 3T3PF 3MCG1 5AZ2L 5KSAD 1C16B 5CS7A 3HMWH 1BTCA 3HE7C 4WHYH 1EHAA 3U1SL 1AP2B 3OR6A 3ZYIA 1UH4A 3FT2B 4C54A 1AXTL 4HJJH 1R6VA 1RUAH 5IEHB 1U8OB 4ZXLA 1BFOA 4OGYL 5F7WC 1GMMA 3C9NA 4W7WA 4X6DE 1IBGL 2ORBL 1W91A 2VXQL 5BJTB 2ILLA 1OWWA 3HUJB 1K6AA 4OCXL 1OGGA 5CGTA 1HNFA 3MA7A 4N0FB 5AWNH 2AJXL 4P5KB 3MRNB 2Q86B 1NFDB 4FOMA 1KSRA 3OGCA 1GPFA 5CJXA 1GOQA 4NKDA 4GRWH 3L3OA 4RGNC 3TPKA 1RJZA 2Y8KA 5KVMC 35C8H 3HC4L 5I6SA 3T4YA 5JIWA 5JZ7C 1RZJC 1Y6KR 2JIEA 2HN7B 1U8PA 4FQ2L 4OCSL 1HZHH 4JFDA 3QCUL 2AK4E 1G7LB 3MV9D 5J13B 4H1LA 4XP5L 4KK5C 5C7XH 1J11A 3MJ8A 3HE6A 1ACYH 3THDA 4M80A 2VJXA 2XY1A 5D6CB 2CLZB 1S7QB 3BH9B 3GSQA 5CBEA 1IGFH 5J06A 2NY2C 4KU1A 2XG5A 5MERA 4PGDA 3H8NA 2NW2A 3PP4L 5IT2H 4Z0BL 1P6WA 2CKRA 3KHQA 1YNTB 3U9PL 4CVWA 2XVNA 2DSKA 2G75A 5E08H 3IVKB 4PMRA 4P2OA 3O6KH 3N06B 4EVNB 3TA3B 1CFNA 5GGRY 1CLOH 1U8QB 3GSNH 1ORSA 4JPIA 1RULH 2CMRL 1FNEB 1HDMB 3RZWA 4M81A 1NCDH 3MV7E 5F1KC 2R2BB 3RUGB 3TJHD 4TRPL 5I1DB 3PF2A 2OWCA 1EIBA 3Q0HA 3WH5A 1RHHB 1LMKA 4NJ9H 2P5WA 1WZ1H 3MNVB 3PIQA 3GM8A 5FDWA 5M3WA 2I9TB 2J1VA 4YHLH 3BW9B 4PREB 3MLWH 1VACA 4DKFL 4W93A 2NY6D 4JFOA 1AJ7L 1RD6A 1NBVL 1JGEA 1HILA 1JCKA 2C4FT 1YMMA 2CK2A 3RDTA 3C09B 3K8MA 3W6MA 3DWTA 3PL6D 1O6IA 1CIUA 5I76A 5IVXB 3ARDA 4PJFE 2H6PB 1QOXA 5SWSB 3DHJA 5C92A 2VISB 1OARH 4Z5RB 2YKKA 4FMFA 2HLFD 2C4FU 1JI1A 4MXVF 1I1AD 5DUPL 1HKKA 2XQYG 2X4QA 5CGYC 5AZEL 1HHJA 4BCEA 5E5MA 2KL6A 4LCCB 1ZE3C 4JPKH 4K3DL 3H3BC 3KGRA 5E99H 4Y8AA 4U2ZA 1V3HA 1U8IB 2Z91B 1PIGA 3QDMA 4GI9A 3B2UC 1KWGA 1IGYB 4UB0H 4NO0B 1X5IA 5HYJA 1XAUA 2EYRA 2R2EA 2ZWLT 4PG9A 3TBVB 1WK0A 2MCPL 1BIHA 4IIQC 2C7FA 1OTTD 5FGRA 5HTSA 5E2VL 2PW2B 4RQQB 3QIWA 2ZEYA 3U7WL 1AGBB 1IT0A 2NY7H 1DUZA 2J1UA 3BVNA 2OLDA 4W4OA 1J0JA 5DVMA 2EH8L 3S5LA 1XEDA 4Y5VA 2CLRA 4Q7DA 2E26A 3HUJE 3TIEB 3RBSA 5DJAB 4QHKI 4EUPB 2F5AH 5A2LH 3I6KA 2E27H 5C7XL 2JIXD 3RL2B 4U3AA 5EB8A 1HWHB 2FEEI 4J8RB 4PJHE 4LYPA 4JQIL 3ACIA 2A6JA 2W87A 1X44A 1MQKH 5F7NC 3ZE1E 3BGFB 1TDQA 4JL2A 3FQWB 5EO0B 4ZFGH 3IXAB 2NTFB 4XUYA 3ZDZF 1VFOA 3EFDH 5E6YA 1LHZA 4Z0BH 3FHQA 3RVUC 3E3QC 1A3HA 1MFVA 3BP7B 1V3IA 1SY6A 1AQDA 4LLDA 5GPRA 4F9PA 1A6UH 4O2CB 2C7UA 4CVZB 3QUZA 4PFEA 1E4IA 1MVFA 2NT1A 1CGUA 4MOAA 4DQOL 1OB1B 3DRQB 1QSVA 3MUGB 4OJFH 3VA2C 1FN4A 5E70A 4MCYB 5L2JB 1OCQA 1QBBA 2CESA 4HIEA 4HWBH 4NJAL 1FP8A 5SWSA 3AISA 3BEVA 5D5MB 3VNZA 3KLSA 3AGVA 2DSUA 4HXAH 1HVXA 2DT3A 2FLRT 4FLQA 3IFLL 4LPLA 5DPNA 1KLUB 4OLVL 1IQWH 5ABHA 3RGHA 3TZVB 1KPVB 4ZS6D 1BFOB 2W38A 2BSTB 3W5MA 1VF8A 4RGMB 4LAQL 4E5XB 4K23L 1OBAA 2CDFA 5AYQA 3OR6B 2OQJB 4KUCD 5DRZA 3GSXB 4AMKL 1UGNA 3QCVH 5DEFA 3VFWA 1OGTA 1I9JH 5A2FA 4RMVA 4WHDA 5K9JH 1PPIA 1QPXA 4YWGL 2A73B 1EFXB 2VLLB 2BSTA 4WFEE 4K55A 3D87B 4ZAKC 2PYFA 2D0HA 4JZ5A 4P2RE 3VDCA 3WH9A 5LBSH 3TEUA 1I9RL 3N50A 1EVUA 1BQSA 4X4ME 1IARB 1NMAL 3BT2L 3PUIA 3VXQB 3FONB 1INQA 1N6UA 2B5IB 2X6MA 4XP5H 1L4IA 5IESH 5DJXB 4TVPH 4KV5F 4KAQH 3MC0A 4MDJB 4UNUA 4IISA 3FB5A 1ZWIA 5F93C 1CFQA 5C08D 3VGEA 1FFPB 1XGRA 4Z2AA 3LB6C 4OGZA 3ARGB 1PX4A 2HFGH 4QXGH 4AIZA 2LE9A 2G3JA 3V7AE 4BQBA 3BD3A 1S5HB 1DJSA 3CZJA 1K8DB 1V3JA 2JB5H 4W89A 3S36X 5FYLH 3VFGH 1BD2D 3E2HC 1OTUD 3RNQA 2WB5A 2IANB 1LQSR 5CP3H 5EO1A 5BXSA 3UEZA 2C9AA 2VLME 1KFWA 5DJCB 4YX2H 2AI0H 2YJQA 1EEYA 4UQDA 5EC1A 5JMOA 1FZKB 1TETL 2NY2D 2OCFD 4HA4A 1FE8L 4OTXH 1G1YA 2W60B 3WUGA 4I18C 4UV7L 3UG4A 3SE9H 4JY4A 1IAII 4PJEB 1RIVH 5ETUA 4ZXOA 1IGMH 2WP3T 1JGDB 2DQFB 4KHXH 3N1QC 3OMZA 3KYNB 3CUFA 4BF7A 4PY8I 4RWHA 2KD7A 3VH8G 5DO2D 3VFTA 3WN5C 4JY6B 2BSED 3FT2A 5MEQA 4JFUA 1HKFA 4WW2C 1CD1B 1R3JB 3KNBB 4HJGB 1PMJX 1LWHA 1QRNB 3UZEA 1A1NB 3OKOA 3VGHA 4LFHD 1KWKA 4JN1H 4F2MA 1JVKA 3X14B 1CZVA 3LKOB 3RILA 1JHLL 3BD5A 4M62L 5BOPA 2Y24A 1OP5K 4XNXH 4NUJB 4J6RL 4H1LH 2I9LB 5F9WC 3QNXB 2ATKB 2FX8L 5T1KD 1NCNA 2NNAB 5EORH 4B5EA 1AD9B 1TCMA 1PSKH 1MYRA 4MB4A 2C5DC 1TA3A 1E9LA 4XMPH 1QFUH 5F1OB 4MCYA 5INDB 4KQ4H 4AM0A 2YZ1A 4J4PA 3AYRA 3RVTC 3C2AL 1NMCB 5HYQB 5JMOC 3TCLA 5KSAC 5EZLA 4OIFA 4PTXA 3OKEA 5F7YC 3MBEC 4BFGA 4RMUA 1T7ZA 5SV3A 3QRGL 5ALCL 1CDBA 3K4DA 3UTTA 4JM2F 4UFMA 1JF1A 5C0EA 4HFWB 5JW5B 1JPTH 3ZDZE 1MCJA 3UC0H 6A3HA 4CMMB 1VJSA 2B9VA 4JRYD 1G7PB 1J88A 1Y0LA 2F5AL 1L7TH 4MJ6B 1EOKA 3S4SA 4JN1L 1SDDB 3ZE1F 3WSQH 3C60C 3MPCA 4GUPA 3QDJA 1E56A 3GHEL 3DX8B 1FL3B 5ICYB 5A1AA 5AUMB 4PJAF 3V6FB 3WUZA 4WF7A 4IBLT 3RDKA 1OGSA 3O8XA 2O5ZH 3I6KB 2DLIA 4ALAL 1K12A 3SDYL 3WUWG 4BQ4A 5DMGC 5DJYB 1L7QA 2AEQL 2O5YL 4NRRA 2CYGA 3L4ZA 2Q3ZA 3O9WA 1ZT1A 2VQUA 5J7CC 1A1NA 1PZ3A 3DHPA 4RGOL 3A3HA 3HI6H 1RJYA 4RGNB 1S7QA 4JQXC 4K3HA 4ZY9A 2YHGA 5D70L 2Y9RT 1ODAA 3NNGA 4GG8B 1YPZE 3BUYB 1UYQA 2OBGA 1KBGL 3O9WD 1BHGA 1SBSH 4HOWA 4LASL 1MFBL 3MCLH 2Z8WC 2DSVA 1XNAA 2NY1C 4UFJA 5KTEL 4F9DA 4JGJA 5K9QG 1YNLH 5GS0D 4H8WH 1P6FA 1G7JA 2V9RA 5FL1A 3A23A 3AIQA 2HAZA 3TJEH 2V9TA 2VITA 1CICC 4JM4H 4K71C 4ZFMA 3CDCA 3MV01 3RVWD 3O6FB 1BJMA 5DQ9B 1KCSL 1NWRA 3OAZH 35C8L 3TT3L 3U6RB 3MODH 4B9YA 4JRYA 1LO5B 3H9SE 2Y07L 5D9PA 1UH2A 2XRAH 2DYPA 3V79C 4PY8J 2WMHA 4K94H 5DFAA 3CFDB 2XVKA 3MO4A 4KKCC 1II4E 1T0NA 4Z7WB 1X4YA 2G2RA 3BQUA 4GRMA 5IROA 3CFBA 4PGBA 3KWWB 3QT2A 3MRJA 4UUJB 2J88L 2AEPH 3SDAD 1INQB 4W7VA 1US2A 1MCKA 4HH9B 2JEQA 1CE6B 3BRDA 1PGRB 1HHKB 4K23H 3GMOB 4HGMA 3QIUB 5IHBA 4XP9L 5AUMA 3V6FA 1XIWA 3PABB 3MJ7B 3ULSA 4MAYC 2XZZA 1NFIA 1PEWA 5DRNB 5MP6H 5DD0L 4I3RH 1OCWL 1U0QA 4UAOB 1ZVYA 1OP3H 1YEJL 1FO0H 1FG9C 2IBZY 5A3ID 4EI5C 5D72L 4NYLA 2NXYB 2WO1A 3VM7A 1QHZA 1JNNL 2CJUL 1MLCB 4L3CA 4MD5B 2VDMH 5I8EA 2BMKB 1OGTB 5FD0A 3DMMA 1GIGH 3UTSE 2G3NA 3VILA 2A74B 1CIYA 2IADB 2C1PA 4HU0A 1YC7A 3ILQC 1NBZA 3QR2A 4PYSA 4HFUH 2VDQL 3HRZA 3QFDA 2DQHH 1UD3A 4J28A 1T3FA 1NCCH 3LB6D 4PJGB 1AQMA 1UD4A 2WVTA 3NIDE 4WFGE 3KHOA 4DW2L 2HN7A 3QZWB 1T83A 3OXSA 1YY8A 4HKZB 1JNLH 3ZTJG 1VIWA 5EU6B 2J78A 3HNTL 4YR6A 5LA1A 4LVOB 2P1YA 1F42A 2DQIH 5E9DD 3T0XA 4UTAH 5DWUL 3KEHA 2Y5EA 3FOMA 5C07A 2GJXA 3HZYA 4TUJA 3REVB 3GKWH 3BP7A 2F61A 5CP3A 5L6YH 1E4MM 1Q6CA 4S1QH 4NKOB 1S9XA 2FBJH 1H2JA 3L4TA 5IEHA 2BERA 4JY6A 2ZUQB 5HD8D 2YFZA 3BH4A 4FQXB 1DQMH 1Q0XH 1MEXL 2VDPH 3VA6A 15C8L 3NCBB 1I1XA 1T0MA 1ZT1B 1VGEH 4G5ZL 5D5ME 3N0PB 2ATPA 4NQEA 4OCWH 5ETUB 1QFPA 4BSWB 3EO1B 3FN9A 1I3RB 4DAGL 4Y5YC 1A14H 3AI0A 1QR4A 2J77A 2YLLA 4FQLH 4E8DA 4U49A 4FI9A 3HZMA 5DHVA 2V3FA 1PX8A 2PCPB 4WW2F 2VXTL 1FRGH 1NCBL 3F6LA 4JFEE 3MRPA 3OA5A 2MOVA 4NQED 3SDCC 4F7MA 4NIKB 4OT1H 1TVNA 1E27A 4FA8A 4YDLC 1E6ZA 5E2UH 4BZ2L 1NL0L 4ZFOL 1QA9B 5KEZA 4G80B 5AZ2H 3NDZA 4MJ5A 1H8OA 1JWMA 5I24A 4P5TD 4IMLB 1W9TA 1KGXA 2K1MA 5ITFB 2NXYD 3FFCE 3MBEB 2GK0A 1NJ9A 1RUKH 4Z2LA 2VXUH 5E5MB 4TQEH 1OAXL 3TFKD 3ULUE 3L5WA 1FO0L 1G6RA 4HKBA 2CKSA 3LEXA 3K1DA 4HX1A 4MD4B 3NVQA 1WITA 3N85H 5F8RC 1FVEA 1HQ4A 3TVMD 4OI7A 1F90L 5SWZB 4PB9H 4RFOH 3CCHA 4EXKA 5IFAL 3SCMB 4P9HL 2PWGA 3AXLA 1R7AA 3I3DA 4ZOEA 1LNUA 3VDAA 3U7BA 3SGKA 4ODTH 3VDHA 1OTSD 2E9LA 1CE6A 2YPLE 1LF1A 4YBLB 4RFEA 4IDJH 1YPZF 43C9A 4QRUB 1HN1A 2BOCA 1DQLL 3CK0H 3EJZC 4U6VH 5IEKA 3ETPA 4PTUA 5E6IB 2OSYA 3MV9B 2UY2A 3B3IB 5ERWB 1ZT4A 5GISH 2P49B 1RZ8A 3GRWL 12E8H 5KVGL 3G5ZB 3W39A 1DL7H 4HEPG 4P5MB 5C3LD 5HHNA 5HI3D 1F6LL 5C0AA 5TPWL 2CCRA 3CX5K 2I07A 2W1NA 1NC2D 2PBGA 3CX5J 2DCJA 3SDDD 1F45A 3PWNB 3RWJB 3SIMA 4N8CL 2DTML 2NY4B 4E0RA 2WKGA 4JZJC 3E8UL 4W8AA 2E5EA 2IAMA 3S35H 3QPQC 2FJGB 4KJPD 2JF7A 4U0RB 2V5TA 1DQML 4LQ1A 1WFNA 1XV8A 1C8PA 4DGYL 2P5EB 3RJDA 3KJ6H 2BNRB 4MA8H 4EBQH 3CK0L 1U3HB 2B8OT 4XPHL 4L8DA 5KSBA 4KI5E 3RUGE 2BNRA 2VRJA 1EO7A 5FUZL 5T3ZE 4ODUB 4OYUA 4KTDL 2DYPD 2D0GA 2VE6A 4YDKL 4PGEB 1UZ8A 3DUUA 4WWKA 4NZRH 4L1DA 1WBXA 3GB7B 1F13A 3L3OB 2IMMA 4M7JL 5HHMD 2AJUH 3OAYH 4KGJA 4CD5A 2OI9C 4POZD 4KVNL 5CZVH 1KXHA 2YPKA 2XWTB 4L8SA 1YPZA 4MX7B 4GWIA 1Q6DA 2GY7B 4UOQA 5GS0H 4P02B 4UT9L 5DJ2B 5AEAA 4GXUM 4X7SL 3MV8B 1DYOA 2R4SH 5D7LD 1J0YA 3JWNC 3NIDF 5J6GA 2DI9A 1XCTB 4FLOA 4XTRD 3ZHLA 4GG6F 1Q8MA 5E5RB 5IOPB 3WFLA 1BVZA 1NGPL 3BOVA 2W61A 4NT6A 5GNYA 3GIZH 2EDJA 1D6VL 5E0FA 1TVGA 1AP2A 3T3ME 4FFZL 4P4KA 2ADGA 4QF1B 2CPUA 3QHZH 2DEPA 5G04L 1F11A 2VOTA 5BVPH 1OPGL 1WVZA 2BNRE 2BGOA 1KPVA 3CIVA 3LSOA 1OCWH 3QUYC 2EO7A 2GSIA 5EU7E 4BFIA 1H15A 4JKPH 5FECB 2BVOA 3WN5A 3P0YH 1XFPA 1RPQA 1KJ3L 3MQIA 4CU8A 1SFSA 3SGJA 3HPNA 3VRIB 1MFAL 4D0QA 4AC1X 2FEDC 3KPSA 4QLKA 4Z2HA 5C6TH 2CERA 3JVGA 2ESVA 4ZNEA 2VQ1A 5E00B 3CVHB 2LTQC 4OQ1A 4ZOBA 4MXQD 1RUQL 1X7QB 1P4LB 3KDMA 3NFNB 4HCRL 3K0WA 4NQCB <