5C70A

The structure of aspergillus oryzae beta-glucuronidase
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
601
structure length
588
Chain Sequence
AAQGSAGSMLKPQQTTTRDLISLDGLWKFALASTQPWTSQLKTSLECPVPASYNDIFADSKIHDHVGWVYYQRDVIVPKGWSEERYLVRCEAATHHGRIYVNGNLVADHVGGYTPFEADITDLVAAGEQFRLTIAVDNELTYQTIPPGKVEILEATGKKVQTYQHDFYNYAGLARSVWLYSVPQQHIQDITVRTDVQGTTGLIDYNVVASTTQGTIQVAVIDEDGTTVATSSGSNGTIHIPSVHLWQPGAAYLYQLHASIIDSSKKTIDTYKLATGIRTVKVQGTQFLINDKPFYFTGFGKHEDTNIRGKGHDDAYMVHDFQLLHWMGANSFRTSHYPYAEEVMEYADRQGIVVIDETPAVGLAFSIPATFSPDRINNKTREAHAQAIRELIHRDKNHPSVVMWSIANEPASNEDGAREYFAPLPKLARQLDPTRPVTFANVGLATYKADRIADLFDVLCLNRYFGWYTQTAELDEAEAALEEELRGWTEKYDKPIVMTEYGADTVAGLHSVMVTPWSEEFQVEMLDMYHRVFDRFEAMAGEQVWNFADFQTAVGVSRVDGNKKGVFTRDRKPKAAAHLLRKRWTNLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Glucuronidase
publication title Enhancing the Thermostability of beta-Glucuronidase by Rationally Redesigning the Catalytic Domain Based on Sequence Alignment Strategy
doi rcsb
source organism Aspergillus oryzae
total genus 182
structure length 588
sequence length 601
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c70A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5c70A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5c70A03
5FYKD 5GGTH 5I79A 4HPOH 3KL3A 1MJUH 3WBDA 1MF2L 2EH7L 1NC4D 4BYHA 1H0GA 1QQDB 4GZEA 1KTLB 1XR8A 1PGRB 2AVGA 3VFUB 3WNPA 3BPNC 1IBGL 2EDWA 4EN3C 4MJ5B 4ZZ5A 2NW3A 4D9RD 3FT2A 1EDTA 1A14L 4R6UA 4Z7QF 3WF3A 2F54B 2HTKD 5FOBA 5JXGA 3KDMB 3O41A 4YH6A 1MIEL 3LKNA 1KFAH 4YX2L 3A21A 3KPPA 4LSQH 5DLML 4NHUA 3QNXB 4M6MH 3SE9H 3KPOB 4M7LH 3TBSB 2WSPA 4X4XA 1LE9B 2EDFA 1B6DA 3KR3H 5C6WH 5IB2A 3AAZB 2XTJD 5BMFH 2O5XL 1S7VA 1MFNA 3D6GA 1OP3H 5DWUH 3RA7L 2OZ4L 1U30A 1MCCA 4Z78A 1T7WA 1EVTC 5C7GA 3LY6A 1V5JA 1L8NA 3QT2A 2Z8SA 3ALPA 4R9HA 1D5MA 3IJ9A 1F8TH 2V5SA 3MLWL 5HGDA 1HXMB 4JKPL 4GXUM 4OZFG 5DRWB 3IDJA 1AKJB 4CCDA 4X6CE 4HPOL 4KWUA 3DTXB 2ZX7A 2FBJH 1MJUL 4ATDA 4EN3A 4NSKB 5IHZA 2DLEA 1XYZA 1X44A 1JFQH 1XF2B 1GQIA 5DZNA 3PNWB 4WIQA 4PMUA 1VACB 1UWGH 4TPRH 2IPKB 1V6UA 3QBTB 3MUAA 2XWEA 2V2XB 3P0GB 4M24A 3W27A 4ONGL 2CRZA 3WFDH 1CZSA 1H2JA 1KFAL 4UUJB 2YD2A 5I17B 4XI5D 2ZPKH 4LSQL 2P46B 3PTMA 3UTPE 4CD5A 1CK0L 1T7VA 4M6ML 2MHAA 4NM4H 5F9DC 3SE9L 5MEOB 4FFVD 1K4CB 1WVZA 2ADFH 4DN3H 5A2AA 4CCEA 4OJFH 2VWEC 5E7BA 3KR3L 1NGWA 3GJFK 1H3XA 3IAQA 1T04A 5BMFL 1WEJH 4X5XB 4UOJA 5DWUL 3WD4A 2MPAH 3B9AA 5DVLA 3QDAA 5EG6C 3UTOA 2VZPA 1EEUA 4Y4HC 1PQZB 1UCTA 3QA3A 4JRYA 4W68A 3C09B 1ORSB 4JFDB 4ZXBC 1FLRL 1F8TL 1OBAA 2ZX9A 3ZSSA 5LVEA 2L7JA 3JWDC 1E28B 4N0CC 2FBJL 1PEZA 5DJ8A 4HWNA 5CBEB 3OJDA 2L7UA 4PTUA 3U2SB 4RMTA 2YLAA 1F3DH 1ZB5A 5I24A 5JDSB 4JM4H 3MRPB 4OBRA 1JFQL 2VR9A 3IJHA 4ETQB 5GRVL 4OZHA 1I7TB 2R69H 4PGCA 4LBEA 4TPRL 3IVKA 1GCFA 3ARRA 4LAQH 4PJIF 5BRPA 4PJDB 4KRPB 4DK6A 3ARBB 2DQJH 1QR1B 3WFDL 1W1TA 3MV7D 3OGCB 4QWWD 3TFKC 2ZPKL 4P08A 3GNOA 4BXSV 5FEBA 4CU9A 1MHHA 5ESAA 3QR2A 2EXYC 3DX8A 4NM4L 3WIFA 3P77B 1NFDB 3TH2T 3IKCB 2N7BA 2ADFL 4DN3L 4XCCH 5FYLD 4OJFL 5IV2A 1HJSA 3LSOB 2CLVB 3F62A 5C0JB 3QIBB 3RDTC 4H5SB 1WEJL 4Y4HA 3U30B 1KGXA 2WMGA 4NQDB 4GRWB 5EBWA 4PUBH 4UI9L 2MPAL 3HE6C 4P5TD 2OJEB 4P4RB 1TMCB 2PW2A 1EGJA 3CFBB 3THMH 4ZXBA 5FL1A 2EPKX 1HL9A 3A3HA 2EIEA 1SQ2N 4XNYH 5JXED 3AB0B 3W6LA 4U7KA 1JDAA 4S2SB 1CEOA 4Q74A 3SCMB 1I8KB 4UIMB 3BH8B 4JIEA 4PJEA 5EA0L 2RR3A 2EIBA 2NXYD 4JM4L 3HNVH 4HZLB 4PB9H 5EU6E 2CK0H 4PGEA 1PFCA 1FVDA 5GNYA 1KXTB 3KPMB 1V6VA 2DQTH 2LTQB 5FM4A 2F8OA 3L7EB 1M7IA 4U1IB 3EOBB 3QIBD 2DQJL 1YEGH 2V5YA 4QT5A 3U36B 4XZUA 1XF5B 4JHZA 3DRQA 2DI8A 2KUTA 4C54A 4O5LH 4OD1L 1FG2A 3RDTA 1R3JB 4NRXA 5F1KC 5FCSH 3UZQA 3QXDA 2HWZH 3BKYH 4XCCL 4PLNC 1ES0B 3HE6A 3SUVA 1W1YA 5DFWH 4ODXB 3H9SB 3SDAB 4ONOA 1EFXB 2D31B 3MV8E 2AAAA 3WD0A 4G43B 1HCFX 4LF3B 3OXRA 4PJ5E 3CUPA 5ICZB 2JALA 3QXWA 4L3CA 4NQCE 4YHMH 5DJ2B 5BOPA 1H0IA 4XNYL 5HHPA 1PZ5B 4OZFB 4E0RA 1A9BB 5J1AA 2GAZB 4K7PY 3BGFB 5DZLA 3VFMB 1JNJA 2ZX5A 1KTDA 4K55A 2AMGA 1RZKH 2Y25A 5EFIA 1X5FA 3PWLB 3H3KA 4JO4H 1UR2A 1FNLA 4EUPH 4Q58C 1OLLA 25C8L 3IJSB 1ISWA 5IR1A 4P7OA 2LABA 1F4XL 3HNVL 3HA0A 1KV3A 4PMVA 2BSRB 2CK0L 1K8IA 3G5VA 5DEZA 1ITBB 2CD0A 2DQTL 1XPWA 5LA0A 4M6NL 4P2RA 4PRPB 1EGZA 1PPIA 5CZXD 3EOAB 3RJQB 3SDAD 1CLYH 5GIRB 1YEGL 4P8UA 4MX7A 4A45A 2K7QA 2VO5A 4O5LL 1DZBA 2BJMH 1DN2A 3L5XL 4WHTA 3HC3L 3OKNB 2XFRA 4KI5C 2HFEB 1GQKA 1G7JA 3BKYL 2VB5A 2WINB 4W50A 2W4XA 5J12C 4CD7A 2W0KA 3NH7H 5TQ0H 2VZQA 4D0BB 3E6HA 2W60A 1XCTA 3QUMB 4PG2C 3VFGH 4Z77B 3ACHA 5FO7A 4TUJA 4Z7WE 4MCYB 4X6DA 5I8EA 1SDDB 5AZEH 4P46C 3R0NA 1QNSA 1WDQA 4JFHE 3KYMB 3FAWA 3QG6B 4WHYG 2CYGA 1IL1A 1R8LA 3BDYH 3MLUH 4MA7H 4JO4L 1MVUB 2J6EA 8FABB 3TBWB 4P3DB 5F7HA 1H3GA 2WVVB 3ZDYF 2W9EH 1Q1JH 5C86A 3GMOA 5FCUH 3TIDA 4XX6A 4IHOA 5DJXA 5D2LA 1IJ9A 3DMMC 3UR8A 1CLYL 5C09A 4P00B 4OOZA 3BIBX 1P4IH 3HMXA 1HILA 4M4RA 2CITA 4NM8H 2EQDA 2H2PC 3N13A 3P73A 3KLHC 1VESA 4WSKA 3GSXA 2VL5B 1H3TA 1UR8A 1MPXA 1HKIA 2OJZH 2AJUH 4PG2A 2XTKA 1BOGA 1GNXA 2VRAA 4OZIE 4P46A 4JE4B 2Z31B 3UYOD 3NH7L 5TQ0L 4D1JA 4MDJB 3VXNA 4YDLC 2CKNA 1MJ8H 3VFGL 2VDML 1GOWA 4ZNCD 3PDOA 3MR9A 2LU4A 1BF8A 3N1PC 1OB0A 2FGWH 5J1XA 1GOQA 3QRFM 1KIRB 2FGZA 1A0QH 4MA7L 4HK3N 1ZT4A 3D3VD 4JQIH 1H09A 1MH5B 2BXZA 1CL7I 1I4FA 4HC1A 4TTDD 1H41A 1N59A 1P7QA 2W9EL 3DMMA 3R06B 1Q1JL 4MSWA 2D3NA 2OTWB 2V5TA 3FL7A 2MOVA 5A40E 1KBGH 1CX1A 4MO3M 4HUKB 1EEZB 3SO3C 2ED8A 1A3RH 2RBLA 3AS0A 4KQ4L 1C91A 5DFVC 1P4IL 5FYKH 4JN2A 1C08A 2VKWA 4NM8L 2H8PA 4JDZB 4X6CB 4NQVA 3K2UH 4YDVB 4R7DB 4E9LA 5C0AA 1IZKA 4JL2A 3QEGH 2BV9A 4Y5YC 4UFJA 2AJUL 1TFHA 4Y19D 1TCRA 3GXMA 4N0YH 2E26A 1KG0B 3EO9H 5SX4H 3SDYH 4YEEA 1CXHA 1MJ8L 1T1WB 1OY3B 4HKXB 4WI2A 1P69B 1IAKA 3F6LA 4CADA 2OMBA 4Z7QE 1RH9A 2V7HB 1Y6KR 2FGWL 4B7IA 1KEGH 1GC1L 1ZA3B 2F53E 4UZUA 3CVHA 2DQCH 1IM3A 5TDPB 2ENSA 5IXEA 1IGYB 3TESA 3MFFB 4LASH 1AD9B 1R5VB 2VN7A 1UXSB 4OZGF 2XQXA 4AD3A 1JRHH 4J27A 4U6YA 3GMRA 1NGZA 3MRLA 3WMBA 2BVDA 1K2DA 2PYFA 4NWUH 2Y8KA 3SGEH 5DK2B 4BJLA 1NUKA 2B9VA 2YL9A 5TQ2H 3LQZB 4BK5A 3FOMB 3MMEB 3S8WA 5K9KA 1KBGL 2VXSL 4NN5B 4P23B 1A3RL 4Y2DC 4QXGH 4LPUA 2AEIT 1A6PA 3UTZB 5A2KH 3WFEH 1W9DM 4Y5YA 3SDCB 2OSWA 4OM0H 3MRBB 5L8JB 5DR5H 3K2UL 5E70A 4HA3A 5ALBH 1R3KB 5HI5C 1A6AB 3UTPD 4KXZI 3V5KB 1JZ5A 1EUTA 4TUKH 4WFEE 4DEPC 1FYTA 2DDUA 1NCNA 3EO9L 4JEGB 4M9OA 1LO5A 3QHTC 5IVXF 4IOFC 3SDYL 4LQRA 4ZY9A 1AE6L 1AR1C 3QUYB 4WTZG 1BEYH 4TNVK 3B3IA 1LEKB 2P8MA 2Q20A 4LDLB 1VRXA 3QDMD 1CE1L 4NKDB 1MFVA 3WHXB 1KEGL 2PW1A 3LEVL 4PIRF 2DQCL 4LRNH 5IB3A 3P9LA 1U8LB 5JO5B 1PX8A 3I2FA 3EYUH 3VXSE 2C3GA 4NQSA 1EO7A 4LASL 4XVJH 2MJWA 3V7MA 1KELL 4H26B 1CD8A 1JRHL 5IESH 1E0WA 3DIFB 1N4XH 1MIML 4MNHB 3D2UA 1R3IH 5BVJB 4Q2ZA 1A7RH 5IBUB 5C08D 5IB5B 5HI3D 4W8JA 1U58A 4Y2DA 5TQ2L 3V0VA 3MO4A 1CLOL 1G1YA 3GSVA 1IILE 3WXVH 5EB9A 5E8NB 4TVPE 3OG2A 2XWJB 1AQ0A 1HWHB 1VPOH 2X4NA 3MREB 2P42B 4QXGL 1AGFB 4M7JH 1T0MB 4EI6B 2QEJA 4F37K 4XCFL 4RBPH 4C83A 4OM0L 2RGLA 5DR5L 4YHIB 1CWVA 4Z6AT 1YEJH 1VKXA 3NPSC 3QUKA 4GSDH 3DOSA 5MENE 4B9YA 2G3JA 5ALBL 5C0EA 3CFKA 5I2UA 3WKNA 3MV9D 5EU6B 3B8SA 4HGWB 1KENH 4P57A 4TUKL 4F7PB 1FA2A 4QCIA 3ARGC 3BWAA 1NDMB 5E2TL 1RAMA 4BQBA 1BEYL 2FWOB 1PZ2A 1K4DB 1KOAA 3SE3C 2FH8A 4V1DA 4JJHA 3SCTA 5IW6A 2IADB 1FGNH 1NH6A 3MUY1 3QJHA 3X3GH 4LRNL 1MYRA 2YC1B 4G7VL 3X13A 5FYLH 4U05A 3EYUL 5AUMB 1JAKA 3GI9L 4X5WA 3RMEA 5DA0B 1IC4L 3MV8B 5IESL 2AXGA 4X0KB 3LDBB 1N4XL 4HKJB 4YIQA 2VCBA 5SWZD 5DMJB 1R3IL 2B4CC 5M3WA 1A7RL 3P4OA 2FSEA 4PJ5B 1GGCH 4LVOB 2CLRB 2G75A 1T4KA 2YR3A 4NQCB 4YHNA 4AIUA 1G7HB 2HFGL 4FTVD 1FV1B 5E99H 1BJ1H 3KYOB 2O26U 3ZQ9A 3V6ZB 4XAKE 4J23A 3T2OA 3L3OA 4HS6A 1VPOL 2A6JA 2HJKB 5ABFB 4M7JL 2HJFA 1Q0YH 4JVUA 1MCOH 3ARWA 2EYTA 5E6ID 4M5ZL 5KEZA 5JIHA 3CIVA 1YEJL 5HXMA 4KKBC 2R1YA 2HVJB 3ARGA 3OKKA 2AK4D 2JLLA 3MSGA 1KENL 5FHBH 3SE3A 3IFOB 3KWWA 1RUAL 3VXOB 3MLSH 3V4PH 3FQRA 3RJDA 3PZMA 4HQQH 3OG6B 2V17H 4HF5H 1ZLUH 4Y4KB 3T4AA 4JO1L 4HS3B 3SGKC 1E6QM 1LWJA 4PTVA 4PJXA 1CGSH 2VDQH 2EDRA 4GG8B 4LGPB 3CDGB 5GZND 3U46A 5BCAA 5KAQF 2HISA 4PMYA 1VADB 5I75C 2J8FA 1FGNL 3SDXA 1CE6B 4UDUA 5ENWA 3X3GL 2WABA 1J7VR 4NQCD 1A4KB 1F6LL 3GSRA 1WTLA 4YZFF 4YDKH 2A3BA 3HUJA 1JDDA 1K6AA 3L3GA 4JPIB 2DM3A 1G0XA 3PWVA 1W1VA 1G9MH 1HDMB 4FRWA 5F88B 4LHUA 1GGCL 4PP2B 1PJ9A 3HRZA 4Z7WB 5F6HJ 1XYFA 4M1DL 5DEGA 1CWYA 1Z5LA 3IDYC 3IB4A 2JELL 5E99L 2C8NA 3UETA 4HS8L 5KS9E 1SY6A 1SJVA 3RNQA 1JWUB 3RGVB 1BG4A 2VN4A 4Z7UF 1ZLVH 4O58H 4XNMB 1S7QA 1Q0YL 4HMCA 1C1EL 1MCOL 1U3ZA 5BXRA 3S7GA 5I18H 1NMCC 2YHGA 3L7FB 5CIPA 1NUFA 3K8KA 4WENB 5ESVA 5DQ9A 3ACGA 3L3IB 4XHJD 3MLYH 1A6WH 1CT8B 3UTSE 4EI5B 2W9XA 1NGYB 3B8YA 2ICWA 3SGKA 5I1CH 1UWRA 4PG9A 1ORQA 2BNQE 3MLSL 2DD8L 1DQLH 1UQSB 2EDDA 4CW1B 4HQQL 2V17L 4HF5L 2EBNA 1C8QA 1IVLA 3QHOA 2J8GA 2VDQL 4LOUC 4JREB 3P3YA 4ZFOB 3WLBB 3MO1A 2VLKA 1WB0A 3FO1B 4CVZA 4FQHA 1E6OH 4ODUB 2BVQA 2F8VA 4OZFH 2XM1A 2B20A 4L3AA 2UY4A 4OZIB 4FLOA 1G9ML 1V3JA 3QH3A 1WFUA 1F3DJ 2OSYA 4AZHA 2PWDA 1TCMA 5BZDB 2BY2A 3OAYH 5CEYA 4CMMB 3MACH 5EOTB 3IDXH 4EI5D 4O58L 3I6GB 4YNYA 2ZUSA 1MCWW 1QOXA 4QLKA 3PHOB 2XTLA 2P44B 2P8PB 3RZCC 2MANA 2VX4A 4XTRD 3H0TA 3VX0A 3V5DB 4M8VA 3DVNB 1UB5B 1F97A 4WFHE 2V3GA 5JMRA 4WEUD 2NZ9D 4HZ8A 3MLYL 3KZSA 3MS8A 3RWIA 1OQXA 5KN5A 1DE4A 4G42A 1KFWA 3WIHH 1XCWA 1DQLL 4DKEH 1RK0A 1R24B 5G05L 3UPAA 1FVEA 4MXWH 2NQCA 3F12A 2OLHA 3T1WA 1A9EA 2GITB 2VXUH 5B3JF 4YBLC 1E6OL 4I0KA 4X80L 3F5JA 4P49A 1JD9A 1G7PB 2DQDH 3HLAA 2OTUB 3D85A 3PL6D 2X4RB 3BWUC 5HPOA 5GISH 3H8NA 4NNYB 2Q8AL 3CKHA 5A69A 5B8CC 3ARTA 4XNZC 1YEKH 3IJYA 2O93L 3BEWA 2NY4B 4PQQA 4EKJA 1MRCH 1N0LA 3HG1D 4E41A 2LU7A 5C07D 4TVDA 2F53B 4IIQB 3MJ9H 4RNRB 3DRTA 5INDB 4LLUA 3LKQA 3MACL 5CGYC 1F3RB 2O9RA 2UVFA 1GOMA 4LMQI 4X6BB 4U6XA 3W82A 1C7SA 4PJXF 4QRPD 1BSIA 2UY2A 2F58L 3D0LA 3VJ6A 4HFUH 3WUFA 3FB6A 5DD6B 4ZUVA 1FH7A 1QI5A 2LU3A 3QPQD 3PTKA 2BFGA 1ZVSA 1JHTA 3PZQA 4HIJA 2Z1SA 2YUXA 4KK8D 4ZOBA 4Z2HA 2GY5A 1W72B 2GUYA 4N5ED 4DKEL 1GOHA 3KLAA 2TAAA 3ILQC 4PJFB 5DK3A 1ZLSL 3B2UD 4MXWL 5DJDB 4Z76A 4XXDA 3LHPL 2VXUL 5DVKA 4JRXA 1GVIA 1AQKL 2W38A 3MC0A 1E0XA 2YPLB 2DQDL 5EBLB 1KCLA 4NZCA 5B8CA 4I48A 2GFTA 2W63A 3H7BB 3PHQA 4G3YH 5GISL 1YNLH 1OTUC 2XKNB 1HP4A 4NYLA 3RHWK 2NY5C 2QQKA 1S7UB 5GGVH 1EXPA 1IC1A 4JFEA 1YEKL 4Y5VC 1OTSD 1ITCA 1H8OA 1MRCL 4XNUH 1WFOA 2YD4A 1MFCL 5BV7H 4G9DB 4LKXA 4GBXD 4HUWB 4AG4H 3MRJA 3NA9H 1YC7A 4NUJB 1Z2KA 3VXSB 1LK2B 1JWMB 4LSPH 3L95A 1FNHA 2UV3A 3PG2A 4QHUA 4H8WH 4JANB 2CRIA 3U9UB 5EO0A 4OZGE 3ZT6A 2VRQA 4HFUL 4GW1A 4TX6A 3ARFB 5DJYA 3TA3B 3QOKA 5D70H 3TVMD 4JKMA 2XONA 4H04A 4UDTB 2EYSB 2X41A 1XGRB 2VXTL 3CSBA 3LKSB 4R2GB 4YFDB 1CFNB 2X10A 1HEZA 4WFED 4XH2A 3GSWA 4AZGA 1YEEH 3JTTB 5B4MD 2VDLL 1ZWIA 5DO8A 4P48A 1GOGA 4NDMB 2P5WD 1FNGA 3DV6B 5E56A 5HGAA 3TPUA 2ZUNA 4JPWH 1TTGA 4Y5VA 1QSFA 4G3YL 1G9NC 1JF5A 1YNLL 2FEEL 3RKDD 5J1SC 4HIIA 2X4UA 4P9HH 5I1EH 2B1AL 2WUHA 4U6VH 5F9WC 4XNUL 5BV7L 3O6FD 3V2AR 3ARFD 1HJVA 1H15B 4Z5RA 1V7MH 3NA9L 1T1XB 5CZKA 3KPQB 4XUNA 1QBLH 5FO8A 3TCLB 2YD5A 4LSPL 2AV1B 4LNVA 4MA8L 4C59B 4IPLA 2X70A 3S88L 2P24B 4H8WL 2W1SA 1FYHB 4DKDC 1M04A 3G08B 1GGBH 5IK3B 4J3XA 4JG1H 5TDOA 4Z0XB 2NY1D 3VFWA 5FECB 5MEND 2D23A 1HJWA 5L9DH 2OYMA 1JU4A 4PJGF 4LSSH 4D6IA 2WMPA 4B0MM 1IAOB 4F2MB 2CSPA 4XHQA 2W3JA 3AHYA 3EAKA 3ECQA 2ARJA 3VWJB 3MMWA 4JY6A 2B4KA 3U7WL 4JM2B 3FB8B 4L8DA 1I85C 4DVBB 4GO9A 1KJMB 1U91A 2D3VA 1U3HC 1W9TA 5LYRA 1BWWA 3S5LB 1EEYB 2CR3A 3DXAD 4P9HL 2EDHA 4PGBB 4APQC 5I1EL 5F6IB 5LWYH 3CHDA 1UZ8A 4U6VL 2E7HA 4HV8B 3IJ7A 1KIPB 3MUGA 1V7ML 4NQEE 4WUUE 3QEQE 5A2LH 1U8KB 1QBLL 1UWIA 3I50L 4CN6A 5IW1B 3W4RA 1G7LA 4JHAH 3KXFD 3UTTB 1OD9A 5I74B 1Z3GH 3D39A 3QDHA 1GGBL 4QHKJ 4JG1L 5D8WA 3CHCA 1EHLH 3BP5A 3BGAA 4LU5H 5INCB 5L9DL 3W29A 2Z92B 4PGZA 4QTHA 1KYOJ 5KS9B 1RK1A 3FMGL 1Q9LB 3MGOA 1ROWA 3DUUA 4DW2L 4JLRB 2DCJA 3OKDB 4NF7A 3DETD 4ZD3H 5EUOF 3NCBB 2ZWZA 4I0CC 5I1AA 4HK0A 3DYPA 1I85A 4A2MA 3OB0H 3DSFH 3IJ8A 4GW5B 5EO9A 3VH8A 2QMKA 1U3HA 2WZ8A 4XZBA 2VCCA 4ZXOA 4MB5A 1MHEB 4JCMA 1UVQA 3AS1A 4U1JB 4KDVA 3UTSB 4APQA 1MQPA 5A2BA 3L2LA 2GEEA 2HP4A 2BNQB 2WNGA 1KGUA 1Q38A 4QOKE 4JZOA 4Q6IB 3S6TA 5LWYL 4Y1AA 5FV2A 1NAMH 2J4WH 2NW2A 3QUXD 4BUGA 2E27H 3O6KH 3FQUA 4Z2IA 3VXRA 2CRMA 1ISYA 1NOWA 4NZRH 2UYLB 3A4XA 2QJDA 2J1VA 3NCEB 5F7MC 2O9TA 4EBQL 4JFOA 3V6OC 2WCGA 3ULSB 4G6JH 2XG4A 4JHAL 1JHJA 2LVEA 1T1ZB 4W81A 1Z3GL 2FJFB 5F9OH 3FCTA 3OHXA 3TIEA 3NCMA 2WLZA 1G6RA 3CJJA 3HZMA 4LU5L 1F11A 3VXTA 3FFDB 2OL3H 1PMJX 5D8ZA 5EU4A 4KUZL 4UQ3A 5CEZD 1SFSA 1NEUA 3QFJE 2Z4QB 1I7ZA 3UJTH 1NUDA 1ADQA 1K9EA 3VFTA 2YRPA 3QIWB 4ZUTA 1VGEH 4AM0A 1EVUA 3DSFL 5HGGS 1DANU 1HKKA 1AO7A 4NT6B 1F6AA 1JZ3A 2X6MA 3MOAL 5T33L 5C0CA 1KLUA 2DMKA 2NY6B 1GH7A 2EDTA 4LSDA 1CBGA 1BAFL 4G80B 5D2NE 5ACLA 2NLJB 4S1QH 4QRUB 1S9KC 3QIUC 3WD5H 4OKVA 4I4WA 3AU1B 5HHOD 1MFUA 5T3ZE 4L3ED 2J4WL 1JE6A 1GGIH 1GAFH 2E27L 1IC5H 4HUNB 4N9GB 1REIA 3V6OA 3PABB 7TAAA 1GGTA 4UOW0 5C6PB 1YY8A 4F3FA 5A8OA 4JAWA 2OYLA 1T5WB 1YEFH 3T04D 1XR9B 5F70A 4G6JL 5I1KL 5IQ7L 4RIRB 1CDUA 1OWWA 4GKZA 2PO6D 4GO8A 5DPNA 1KC5H 3TONA 5JIWA 3C5JA 4QGYA 4RL3A 1I8IA 3WV0A 2QQMA 2PC8A 2WBKA 3GB7A 4R4BA 3ZKND 4LIQH 2CIIA 1OGAA 5C0IB 5MEQA 3G6MA 3AXXA 3LKRB 2HLEA 5IMKB 3T77A 4DUVA 1E56A 1K3ZA 4U7MA 4ZUUB 1B3WA 1IC7H 1NBZB 2CIPA 4D94A 1JN6B 3GMPA 3CNKA 2CRYA 1CIDA 4IRSD 4HP5A 2MNUA 2BHUA 2JK5B 3BVNB 3FO9B 3CSPA 3QIUA 3WEOA 2P45B 5DUBB 4OCMC 2Y36H 4XBEH 1V3KA 4S1QL 3RWEA 3Q3GA 3ESUF 4N0CD 3WD5L 4PJBA 3T0WA 1F13A 4GW4B 3VIFA 4OFVA 1GGIL 2E3VA 1GAFL 4MD5A 1IC5L 4JJ5B 4UI2A 1YQVH 2HA1A 4XC1H 1FHLA 1T6VN 4UFLA 4LLDB 3BPLC 3RAJL 4XCYA 2N4IA 2X4TB 2D9CA 2J8UA 5DO2D 5B3JE 3ULUC 4HZ7A 1JNHA 1T0NB 2VLJA 3P40A 1TTFA 4X6EB 1U8JB 1A7NH 2XFYA 1KC5L 1IFHH 1UWTA 3RUGA 35C8H 1UR0A 1RZIA 3U57A 1L0PA 3NNGA 5J8OA 3NCYP 4LIQL 1LD9B 2HLFD 4E8CA 4FNLH 1FZOA 1KJ2A 5JLZA 2JIEA 1IC7L 4ZTOH 4MB3A 3W9DB 5KAQG 3I75A 4XGZB 1T21B 4OZGB 4BFIA 1CLZH 1DJSA 1FC2D 4LSUL 4KK6C 1BYBA 1HX0A 2B0SH 5DJZA 1RJLB 2Y36L 5DRXA 1MQKH 2IPTL 4XBEL 2XSBA 3P1IA 1OQOA 4HKZA 1GZJA 3RPIA 4DN4H 1UD5A 5T1LA 2I24N 4I18B 5TGBB 2FCBA 1YPZE 4EDXB 4MNMA 3X14A 1HKLH 3TTOA 4MCZB 3AXLB 4G6AD 3OR6A 1GSMA 3UG5A 1SJEA 1MCPL 2ZUYA 1YQVL 4OIBA 2RB8A 1D5ZA 3QULA 4EEEA 1ZLWH 3VFVA 4Z95H 2XVKA 3L4WA 5DDHA 5C0RH 5AG8A 5EU7C 4KK9C 5F21B 1IGTB 5JPMB 4PN2A 1Q6DA 3BEVA 4OLYH 4FXGA 5B4XA 4KTYA 3FO2A 5FYJL 4F15B 2BNJA 2PXYD 1A7NL 1G7IB 2HJLB 4F7MB 5T1MA 4CUBA 1KWGA 35C8L 3BRFA 1CD0A 5E8PB 2NY2D 2DQFA 3T65B 1SYTA 4PJAE 2QKIA 4NI3A 3BPOC 3OWEA 5EZJB 3U83A 4UFMA 1Q9WA 5CINH 3ECBA 1CU4H 4H2CA 2BVOA 1YY9C 1PMHX 2QQLA 1IM9B 3UTQB 3JWNC 1E4XI 4R27A 2BNUB 2WQRA 3VRJB 3SKUD 5IHUH 3TT1H 3LIZH 3MXWL 4DXSA 2KQMA 5L2KE 4K3GA 1MI5A 4PR5A 1VFFA 4POUB 2WBJC 3JWOH 4PTTB 3RIFK 4D0DA 3MU7A 1BBJA 1MQKL 5K9JH 2VC2H 1VBRA 1KB9J 3ZMRA 4DN4L 2HG5A 4A42A 1RZFL 5CYYA 4AY1A 1HKLL 1NCUA 4JKKA 4IRJD 5ABHA 1RHHB 3G6JF 3IFLL 3PP4H 2WANA 4QHNA 1HHKB 1KCUL 1M7XA 3RVVC 4RGMC 1ZS8A 1DHKA 3BQUC 4HCRA 3HAEA 4UINH 1J8HA 5IFHL 4RGNE 5C0RL 1FH9A 1TZIA 4WW2F 1J11A 3MCKB 2ZSVB 3B6SA 3B9KB 1QPPA 4ZS7L 5GRJH 5HI4C 4D3CH 1XIWB 5EIVA 1ZANH 2JB6B 2FIKB 2IWGA 5C09D 3V7AG 4J1UB 5H8DA 2W95A 1FVCA 3LQAH 5IJKC 3N18A 4OQTA 2KDGA 1J0YA 4HJGA 3WUWB 1JI6A 3JZ7A 5DUMH 2VI0A 3D25A 4NQEB 3QEQB 4X83A 1TA3A 2NCMA 1CCZA 3QO1B 3A23A 4A3HA 2YUWA 1INEH 4EOWH 5SWSD 3U5UA 3O6LL 4MS8D 2WBJA 3I84A 3ULVF 1FNAA 5BRZA 1N6VA 4X6FA 4YPGA 3LPOA 4C56D 5IHUL 3EGSB 4HGMA 2DQEH 3LIZL 4DJMA 3SCOA 2GKIA 3JWOL 1S5HA 3HNMA 1QLFA 3DYOA 5K9JL 2VC2L 4BSJA 4N1EA 5C9JA 3CVIH 2ZSWA 4N90D 4RWHA 3RVXC 4JY5H 4LDEB 3BQUA 5KSUA 5EIIB 2QQJA 4S0TD 2J1UA 2A9MH 3DX9B 3QWOA 1OAXH 3PP4L 3K1DA 1GCYA 2VTFA 2DLHA 1D6EA 2DSUA 3IDIB 5IWLC 1N8ZB 4UINL 5C0DB 3CUHA 3AMCA 4G9FE 5KZCD 5C0BD 2WIIB 5DF0A 3QDGE 4HMEA 2C1OA 3VDCA 4TUFA 4WUUD 5GRJL 3GH5A 4D3CL 4XP5L 3PTQA 5IJKA 1SMDA 1ZANL 2H2PD 3S36X 3HS0A 3IXAB 1FL5A 5CEXB 4JVWA 1KPVB 4XVTH 1CDBA 1UY2A 4P8VA 5J9PA 1ZHBB 2NXZC 3TN0B 3FO0H 2BDNL 2ZXDA 1OVZA 1OT1A 2D0HA 4M6AA 5D93C 3EDDA 3DECA 2XNAB 5DUML 5IBLC 3RL1A 2X05A 3CFIC 5L7XH 1RFDH 2HT4D 1N5AB 4FQQA 2R8SH 5TFSH 3TJHD 2EC8A 4JO2L 4EOWL 3VRIB 3T4YA 1U8NA 4Q9BA 3P4MB 1XNAA 2XQYK 2OK0H 3FFCD 3HRPA 1LO4H 4JDVB 3IANA 4LEXH 5EZOH 1J05B 5E0FA 3QNZB 3TWCH 1FL6A 3ZDZF 4JFWA 3HC0B 4HUVA 4G8IB 4OUUB 1T7XA 2QR0B 3O45B 3QFJB 2R29H 5IWLA 2XVGA 2D03H 3BESR 1CGYA 4X8JA 5TD4A 1NAKH 4QOKD 1OAXL 3KJ4C 4DQOH 3OQ3B 3U0TB 3F5KA 3T0AA 1BAGA 1K9FA 1KT2B 1OGGA 5JXJA 2VX5A 2WDBA 2EE9A 3IU3A 4MZ3A 1S9YB 2NR6D 4CCCA 5D7SH 1KJ3H 2W0FB 4L4PA 5D7LA 3R8BB 3SKNA 1JZ8A 3I2HA 5DJ6B 1CGTA 5D2NB 5IB4A 1NFIA 4JVPA 4ZSOA 1UWXK 5FHAL 4PJ7F 1QA9A 2QL1A 3MYJB 3PXJA 4XVTL 4YDJA 3DI3B 4YXHH 3DWTA 1X6NA 2C9KA 1MFDL 2VDKL 1U95B 1P4LB 3RWDB 3ESVF 1ISVA 2HT3C 4LLYA 5DK0B 1JMXA 3U7YH 5HHME 1HYSC 2R8SL 5TFSL 2YD1A 3W39A 4R96A 3GMLA 1YNTB 2HFTA 1FYTD 3QFJD 3IS0X 5IKCB 2XY1A 2OK0L 1LO4L 4L29A 4NRZB 5I5RA 1QRKA 5EZOL 5F7FA 1P7KA 3EO0A 1XAUA 1XGUB 4K71B 3ZDXF 4MD4A 4KZDL 3TWCL 5KVMC 3GZAA 4PRAA 4PGDB 3IGAB 1E6JL 4I5BA 3R8QA 5CEZH 2LAAA 3O4LA 4ZUSA 2AQ2A 5JMOC 2DH3A 4P2QA 4RMSA 2JEPA 4PLJC 2D03L 4NQTA 4TUOB 4M82A 4HU0A 1BQUA 1NAKL 2WHLA 3LEXB 1W9XA 4QRQA 3ZE1F 1MWAA 1VJSA 5GXBB 2Y23A 2VR4A 4PYHA 3ZR6A 1JK8A 4LHJB 1KQZA 5D7SL 5CSZB 2NT1A 5IM7B 5BJTA 1NBVH 4ZYKA 2JJSC 3VTRA 3QXTA 2GTZA 1ZHKB 2C3HA 5E1AB 1T2QH 1MUJB 1EDGA 4AK1A 5FF6B 2XY2A 4YXHL 1Q9OA 4XAWH 1WDRA 1UYWH 4R4FL 5IJVB 3CZKA 5FA3B 3N85H 1BFSA 3O8XD 4WTXA 3SE4C 1J8KA 3RWCA 3AFLA 4LCIH 1V0MA 3N12A 4X4MA 1M6OA 4KKLC 2B39A 2X42A 1F3JA 2FECI 4PEEA 1BVKB 2EZ0C 1I8MA 1JNDA 1DQJB 1RURL 4IJ3B 4PRHE 4Q22A 2OP4H 1LQ0A 2YMXH 5DHVA 1YMMA 5JMOA 3HNYM 1EZVY 1QSZA 4WO4B 5DJ0A 5CEZL 5CP7A 3VFNB 1WC7B 4PJ8C 3WELA 5HJ3A 4O00A 5ERWB 4Z7NF 3WFBL 2XACC 4WDIA 5ANMB 5LGHH 1MAKA 1S7WA 2FEDD 2W61A 3IT8D 2JJSA 5FYJE 1JV5B 1RV6X 1T5XA 2CUHA 4QYOA 1EGJH 3L5WB 2N1KA 3L4VA 1N3NB 1FZJB 4S11A 4YXKH 4O2FA 5FUZL 1MCFA 4LPWA 1YPZB 2CLZB 1T2QL 3MPCA 4HH9A 3SE4A 4QO1A 4F33B 1UYWL 1FHGA 5I8CB 2ESVE 3CPUA 2IAMD 3CU7A 3GSNB 5DD5H 4WJXA 5I9QB 1AJ7H 1XH3A 3N85L 1PVHA 1M71B 4P2OD 4L4JA 1E27B 3BH9B 3MKKA 3S37X 1MJJA 4LCIL 3NDYA 4XBPA 1OD7A 3GJEA 1XF4B 1MHPH 1PLGH 4UR9A 4FHBD 5E8DH 1IARB 4FG6D 2HT2C 5D6CA 3LE0A 4RAUA 2AS5M 4PS4H 5E00B 4AZ7A 2IPUK 3N0PB 5GGRB 2NY3C 3WH7A 4PJ8A 4GRMB 3JTSB 1DBMH 5JW4Q 4PJAB 3TYGL 5GZOC 1SR0A 2AXFA 1NL0L 2ZCHH 2WIMA 5MI0C 4RMWA 1NMBL 3I97A 5GGTA 1BQHB 4UNTA 5DHYA 5ETUB 1VFUA 3ARYA 5FGSA 2ZOKA 5FUCE 1YN6B 5GQBA 3VGGA 4QRRE 3S36H 5LGHL 2Y1VA 5CJOH 1DWJM 2ICCA 4QXWA 3MBWA 4BSWA 4NC0B 1BFVH 3SUSA 4QHMA 4CVWA 1EGJL 3QJFB 5L2KB 3VGAB 1PIGA 4DCQA 4NP4H 4MQ7A 3UERA 4ZAKB 3JV6A 4YXKL 32C2B 2ZIDA 2P5EA 4R0LB 5C3LD 1X7QA 4JFFE 2QQQA 4WJ5B 3ZJ7A 1JZ4A 2VLLA 1DUYB 1BFOB 4HUMB 2AEPH 4FLRA 1HHGB 4UT7L 2IG2L 4D8PB 4XWOC 1EPFA 2APBA 4RGNB 3KPSB 3WHE0 3C60C 2AXHA 5FB8A 1MHPL 3P30L 5CHNB 4R3SA 2N56A 2PTTA 2X44D 1AGEB 2J3SA 4PS4L 4LLWB 4EK7A 2GJZB 2E0PA 1A6ZB 4U49A 2ATPA 2KH2B 2MQ3A 1DBML 3S3PA 2V5MA 2JKXA 3I6KB 4JFYB 2WPGA 4H7VA 5CWSA 3U7VA 3FB7B 1DLHA 1N82A 5L0QC 3LN4A 1K42A 1T20B 4S1DC 1H5BC 5IMLB 4U3AA 1WV7T 4GRLC 3S36L 1V7NL 3IAPA 5CJOL 3WDPP 1FCCA 5KOMC 3O3BA 3MANA 1QEWA 1OP5H 3MRDA 1NCAH 1BFVL 4HU8A 3BHBB 3VGEA 1CXIA 5CSBA 5I1HH 3PGCA 1GONA 5B39G 1ZA6B 3QAZC 4XPFH 2ZG3A 2WXDM 1HSAB 4OB5H 4XMPH 3MLTB 4PRIE 2Z93A 3GM8A 4NCC1 1OWRM 2CDFA 3OPZH 3C60A 1BBDH 2AEPL 2D7MA 2XA3A 1PZUB 5JA8B 1OD8A 2CR6A 1G0CA 3G6JE 1T6WA 2DSZA 3QHFL 5JW4M 5F3BB 1KN2L 5H94B 4G9FB 1NUGA 1GPFA 4F7CA 3QDGB 4JPVL 2XPKA 3GGLA 5IHBA 2XVPA 1MCLA 3RI5K 5IMOB 1CBVH 3S96B 5HHVH 4HLZH 4WU5A 2IH3A 1XGQA 2CK2A 1U9KA 4PD4J 1N64H 4L1DA 2RJ2A 3GIVA 2VLRA 3AI0A 3QQ4A 3WJLC 5FGBC 5ID0B 1H5BA 1UZ4A 1MSPA 1PD6A 3DUSA 43C9B 4GRLA 2P47B 2XN9A 4G8GD 1T0PB 3MRQA 4WGWB 2EO1A 2PB1A 3QQNA 3VWKC 4AENB 3D85D 4CD8A 1ODZA 4A4AA 4NC1E 1B1YA 4XB3A 1UY1A 2CGRH 3FRPA 3SKMA 1NWRA 4E42A 5ICXA 2M26A 2VSDA 1NKOA 1RHFA 3ZJ8A 1IEAB 1CF8H 1NCAL 3MA7A 4JZJB 5ISZA 4RA3A 1JPGA 3DYMA 4YHYB 5I1HL 4YAQB 3BKMH 2HFFA 4XPFL 1OAZH 2ARWA 1A7QH 3E3QC 3SUTA 3T1FA 1BZ7A 4PTMA 1UEMA 3RJYA 4OB5L 3MRRB 2IALB 4ODWB 3OPZL 5BS0D 1CS6A 5LGJA 5FXCH 4Y16D 2C4FU 3UEQA 4FQXC 5GGSA 1NANI 5HBFA 3RTQD 4ML4A 3MRMA 1BIIB 1NDGB 3CLEH 3EYOA 3WJLA 5FGBA 3TO2A 5DRZB 3AZRA 5D1QB 1CBVL 1N64L 2YD9A 4RCAA 5HDOA 3VWKA 5DS8B 3OAUL 1HH6A 4LLMB 4MYWB 3NZ8B 5FGRA 5I1LA 5HHMB 3RWFA 3SOBH 2YEZB 2AEWA 4MAYC 1I1AC 4XBGB 2BCKA 4UTBH 1RZKC 2GVYA 2AJSH 5ID1B 5F7DB 4LSVH 4W8LA 2E9JA 4PMQA 4RRPA 3CFCL 2D4FA 2DOCA 1CF8L 3K1KC 5AG9A 1RZ8A 1KIQA 1JUFA 1AGBB 3FT3A 1DWIM 2BNRA 1I3UA 1KWKA 2UUDH 3BKML 3KHQA 3VXQA 4OJYA 3S37H 1WSST 3ZO0A 3LN5B 4M03A 3ZDZE 4JFUA 3CXDL 1JYVA 2I9LA 3MJ8B 2CXGA 1V02A 2W91A 4FQXA 4BA0A 2UZXB 2G3MA 2WC7A 3P9MB 5DVNA 2E9LA 4HEME 1DSFH 4NHCL 3AMLA 4GLRH 4HC1L 3T0EC 2EDJA 5HYJD 2DCKA 5F6HI 2NYYD 3CLEL 3ILQD 2GSJA 3C7GA 4FQ2H 1S7RA 5SX5K 3C9NA 5JR1L 1OW0C 2ITDB 4PJ7E 2QQIA 5H2BB 4MAYA 3WFZA 1AC0A 1I1AA 3MUZ1 2FO4A 1CICB 4M29A 1L0XA 4L4VE 3ZKMC 1UA7A 5ICYB 4PJ9C 4EUPA 3STBA 4QAWA 3SOBL 5I77A 4FLQA 1VFBB 4LP4A 1BQSA 2AJSL 4ZUWB 5LKNA 1FO0B 4ONHA 4I0PD 3VI4F 4PRHB 2XA8H 5JHDA 4JRYE 3NCYS 1A1OA 1DL7H 2QSCL 7FABH 3OV6A 5D1ZC 3CFDA 3S37L 4OLVH 1YYML 3HKFA 3ZDXE 3CVHL 1UC6A 3T0EA 1J0IA 3NZHH 5HD8C 2XHYA 2V2WB 1F42A 4U6HA 3DO7B 2ZUMA 1ISXA 4Z2KA 4OTXH 4LLVA 1E6NA 3PN8A 3DI2B 4OZHE 3POHA 1MCIA 3GJFB 5E9DA 3TZVC 1CD1B 1OINA 3NOIA 2Z91B 5JXAH 1OW0A 3E8UH 1VENA 2P8LA 3M17A 3GXUA 5K59E 2R1WB 1FL3B 2R23B 4MQSB 2VWEE 4X7DC 2G2RA 1R5WA 4D72A 4PJ9A 3S4SB 2ESVB 4HJ0D 1HNGA 3BZEB 1UMIA 1XGPA 4EJ1C 5HHQA 4H1LB 1K6QH 2FD6H 1TVNA 2GDUA 3G6DH 2A3EA 3VW3L 1DLFH 3QNYA 3UBXA 3HJRA 1EMTH 4EANA 1ZAGA 4CVXB 1JPTH 3OF6A 4K8RD 3CIHA 3KPNA 4LX4A 4OFYA 2OCFD 3QO0A 3C8KB 4P5MA 4Y5XB 4W87A 1FJ1B 2Y6SD 2XA8L 2DIJA 4OF6A 5D1ZA 3L3DA 4NO3B 1V0NA 2GK1B 1DL7L 1M05A 1R5IA 3FQWB 7FABL 2V9TA 3AIEA 1P2CB 5IF0B 4OLVL 3V5HA 2AW2A 4NQXA 2G9HA 1OP3K 3UC0L 3NZHL 4A6YB 4JFSA 3FT4A 4TSCH 3S98A 3TZVA 5HVHB 4QRRB 4OMCA 5HYIA 4BCEA 2YS4A 2RFXB 1V03A 2I60H 4BKLA 5E2JA 1QFUH 2DYPB 3BZ4B 3E8UL 2APVA 1QFOA 4KROB 2IGFH 2CXKA 4U1HA 3VXUA 4GZIA 3PZOA 3SY0A 3JV0A 2ZOLA 5JR2A 4LYQA 5I66B 4JFFB 4NOFA 2FLBT 2ZXBA 2HTKC 5HSFA 2DJSA 2PWFA 1W0VB 5FKAA 5HYQA 2X1XR 5GRVK 5MEPB 4TVSa 1K6QL 1F90H 4WFGE 5KG9A 4ACYA 4D9LL 2J1SA 2F5AH 5DI8A 5ITBH 1LG1A 4N8CL 1XCQB 3QUZC 4ONFH 2H26A 1HIZA 1LO3H 1JU3A 5ADOH 1X5JA 5FUOH 1TQBB 2XGBA 1J12A 2PKDA 2XTJC 2ZEZA 4WEBL 3A67L 3UXFA 4U33A 5D1XB 1LL6A 5I15L 1EAPA 2W65B 2ZNXA 1BD2D 4B7LA 1U8HA 1H49A 1LWRA 3F5WB 3G04A 1KGCD 3MBEB 1KJVB 5F7NC 3LRHA 4DWSD 4HKBA 3PQYA 3VXRD 3K4DA 3LKOA 1XH1A 1HQ4B 1ESWA 4EXKA 1RMFH 3BUYA 4X5LA 2APTA 1K45A 4TSCL 1NC4A 1JI2A 4NIKB 5HPMB 5F89B 1GQJA 1Q94B 1A6VH 2OYKA 4JFFD 1EXUA 1J87A 1JDCA 1FNEB 2I60L 3IF1B 1I7UB 4ZMAT 2XPGB 1QFUL 3N1QC 2CDOA 3OKLB 3RPKA 2XI9A 2F74A 5E2VH 4YK4C 3D48R 5EBGA 4NOBA 2D7TH 3GHEL 3Q6GL 2DTMH 2J7LA 3AROA 2YXFA 3CCHA 4WEMB 1IT9H 5CXPA 2IH1A 4PRIB 3QEUB 3QUZA 1RY7B 4XI5C 2Y6GA 1F90L 4KJPD 3W26A 1MJ7H 4X98B 2F5AL 5ITBL 1SJHA 4FFVC 5EC2B 5HGBA 4JFPA 5KSBF 4PJHF 4ONFL 4CU8A 5ADOL 1G9HA 1KTRL 5FUOL 4X6DE 1SMOA 4MJ6A 5D6DC 2CHNA 2IANE 2VLME 1QQDA 1DWGM 2NPLX 3REVB 2AJYH 4RAVA 3SCSA 1B0IA 4MJ5A 5T1KB 1QI2A 5D5MF 2X7LA 4YBQD 1JPFB 4X99B 3N50A 2ZE0A 2AJZA 2F54A 3WNKA 3OJMB 1Z0MA 1UG6A 3CUFA 1L7TH 1UZ6E 2VZRA 3PGFH 2VUOA 3CH1A 4OCXH 1A6VL 3INUL 4X4ZA 1K8DB 3N15A 3VG0H 3G5ZA 4MJID 3SDDB 3KPOA 3TBSA 4UIKH 4YFEA 1YZZA 3RO8A 3DX6A 2DL9A 5E2VL 1ZL1A 3X3FL 4ZO8A 2DQHH 3TBYA 2D7TL 4KI5E 1OGAD 5LAXA 3PWPD 3NIYA 3PHSA 2OR9H 3AIBA 1NBQA 2DTML 3FZUD 4QX1A 2GJRA 2VISA 4AT6A 2BSSA 4GT7A 4QWWC 1XR8B 4CMHB 3EO1A 2DAVA 5B38G 4A6OA 1AGCA 4OGZA 1MJ7L 1DDHB 1MCQA 2NW3B 4KC3B 1U3YA 3FT2B 4IDJH 5D6DA 4X7FC 4D6EA 4P02B 3VI3E 3C09C 3DTXA 3LKNB 3D9AH 1TJHH 5IB1A 2PETA 4NHUB 4RZCA 3VIJA 1O59A 4X4XB 1D9KD 1WITA 1NBYA 4AEIL 5JXEC 3ULVD 3NBNA 5IB2B 3O3UN 3GUTA 1L7TL 3L2MA 3PGFL 4OCXL 1AY1H 4Z78B 2E4TA 4A41A 3VG0L 1K4CA 2EDEA 5GGUA 1FOBA 3K74B 2AK1H 1QVOA 1U93A 5I73B 2NXYC 1UX7A 4UAOC 1D5MB 1UD4A 1E4KC 4AZ8A 3F7YB 4S10A 2DQGH 5D7IA 1FFOB 5HGDB 1NJ9A 2DQHL 2WUCL 4OUOA 3MV7A 3T2PA 5B4NA 2OR9L 1NCBH 1YECH 3BPNB 3LOWA 4EN3B 3QIBC 1ZHNA 3KLDA 5C0AE 5IHZB 3ZTJH 2VDOH 2APXA 1B0GA 1W2PA 5FCZA 1GHFL 5LA1A 4Y4FD 1BQCA 2GI7A 2XYLA 1Z9LA 4IDJL 4K9EH 2Z8RA 5IG7A 1MRFH 2WBGA 1J1PH 5GS1C 2VSCA 2DJ4A 1G9MC 5CBEA 1TJHL 3MRKA 3U2SA 2ENYA 5JXEA 4IM4A 2MHAB 3MRPA 4UILH 3TH4T 3BDXA 4GS7C 4OV6F 4QTIH 1G1CA 1NGWB 5HYSA 2BVEA 1LP9F 3GH7A 2PYED 5KBNC 3AMGA 4FF5A 5L88H 1TENA 1XD1A 3OGCA 2J88H 1AY1L 3BW9B 5HHNA 4W4ZA 4JY4B 3EJYD 2XT1B 1E4KA 1TZ7A 1WZ1L 3AMDA 1M1SA 2RV9A 1NFDA 1DBJL 3QA3B 4JRYB 3EYSH 5LA2A 1A4JA 5D7JD 5ABGA 3U6RA 3QIBA 2VVSA 2AABH 2DQGL 1LF1A 2AEQH 1BHGA 4XB7A 1NCBL 1YECL 4LFHG 5CZXC 1I9IL 1R0AH 1W9PA 5DJ8B 3I6LE 4P4RA 3SDAC 4DEVA 3NSMA 4PTUB 3VO0A 2WCAA 1W8OA 1DQMH 2VDOL 4KKNA 3DV4A 1UB6A 2XWTB 3IJHB 4X0NA 4OZHB 5GS1A 4PGCB 4LBEB 3RL2B 4AL8H 3TOPA 4L4VD 1I8KA 4UIMA 3ELAT 2D0GA 2YFZA 1J1PL 4NGHH 1VFOA 4XMLH 4MNQD 1B0WA 3JUGA 4MDIA 1MHHB 4HDIB 4QY8B 5ESAB 2WHJA 1FAIH 5JW3L 3DX8B 1N0XH 3L3HB 3WIFB 4UILL 3B4NA 1TJIL 5M7QA 4YFLI 4KK9D 5IV2B 2WK2A 1R87A 2YRLA 3HB3D 1R3HB 3ZO9A 3EOBA 5B21A 4Y4HB 2E31A 3VGHA 3VDAA 5EBWB 3U36A 2EDKA 2BX5A 2PW2B 4ZXBB 1CFQB 2LFGA 2A2QT 2C7UA 1BVLB 2H32H 5K93A 2QBXA 2G8ZA 1Q6CA 12E8H 1QFHA 1EHNA 3EYSL 2DM4A 5FDWA 3SDAA 2AABL 3LV3A 4HWBH 2AEQL 1D2KA 4WI7A 1YY9D 2VXVL 2EEAA 5EOCJ 1B6UA 1PYWA 5B38B 1R0AL 5ICZA 4FQIL 2KQNA 1DQML 3TF7C 1UH3A 1GOIA 1KGYA 5I8OH 4YHZH 4YHOL 2XG5A 4OZFA 1FVDB 2WBJD 4KDTC 3W9EA 1UD8A 4AL8L 1HJQA 3Q6FB 2DGAA 4TNWK 1M7IB 3WE6A 1CECA 1SG3A 4X9IA 1E3ZA 2D20A 4PRNB 4QT5B 5LG1A 1TVBA 4XZUB 5BROA 3IJSA 3DRQB 4V1DE 3EHBC 2R2BB 3REWB 3CHFA 1FG2B 1S9WA 3KL5A 3RDTB 1K12A 4NRXB 4G6FB 3QXDB 5T3XE 3HE6B 3WH8A 4PRPA 1A2YA 2NT0A 2ZCLH 4FFYH 5CJXC 2DSKA 5C7XH 1OH4A 5C0FA 3OXRB 2ZUWA 3K4AA 4K8RH 2GJXA 3CUPB 4B53A 3TNNA 1CZVA 1EHXA 5JORA 2W87A 4TTDC 5HHPB 4E0RB 5J1AB 4WTWA 1WWBX 4NPYA 2R0WH 3S35H 3WIHA 4PUDA 3IK2A 3AC0A 5JPNA 4HWBL 5EFIB 4ACPA 5ALCH 4KDTA 3WO4C 5IR1B 1B30A 2BC4B 2PTVA 3LVEA 1NX9A 1K8IB 4U6TA 3G5VB 3KYMA 3MOBH 3ARQA 1BFNA 1RP8A 3QG6A 4PJDF 3WMSA 1XCXA 1A6UH 4P2RB 3BKJH 3OGSA 1G7MA 3ZL4H 1X4ZA 4EZMA 1QP1A 3AYSA 1CLCA 5C3TA 8FABA 2ED9A 4MX7B 1C8XA 2P43B 3VKKA 3VFSA 1OARH 1NFDF 5DGRA 2WVVA 1CDCA 3SDXE 3H9HA 1IT0A 3MJ9A 5CJXA 4DUWA 1W0NA 3I2GA 2F8QA 1G7JB 4L9DA 3D3VA 4WI4A 4GRWF 1I3GH 2ZCLL 4FFYL 1XF3A 4IDLA 5EN2A 3BAKA 1AC6A 5C7XL 1UACH 3BE1L 3E6HB 3LMJH 1QRNE 2W60B 1XCTB 4GAJL 4K8RL 2EDOA 2EIDA 5D7LD 5FUIA 4M00A 5FO7B 4TUJB 5I8EB 4X6DB 4A6YH 3VM5A 4P7RA 4H8WC 5EZLB 3O3AA 1IKFH 4NNPH 3S35L 1HNFA 1IL1B 3PUHA 3BAIA 3LQMA 1YEIL 4GLRI 1RZGA 5ALCL 3OZPA 1TZHA 3D5OF 1W9VA 1FFNA 1UD6A 2DB8A 4XZWA 4K7PH 4YEFA 2W1QA 3SCUA 2D7PA 4BZ1L 1OAKH 1WDPA 4XWGH 5IFJB 4LAJH 3MOBL 4Y19A 3TIDB 1QFWI 1KIRA 5DJXB 3WDIA 1A6UL 1MY5A 5CQ1A 4OGYL 5F1IA 4GXUN 4OMDA 2UVEA 5K9OA 4RBPK 2ZCKH 4HBCH 4GQ9H 1CDJA 3VMPA 1HILB 1OARL 3LS4H 5BXSA 5J12B 1CDIA 2D24A 4WNQB 4UMGA 4AG4A 4AMKL 4P9HC 4YC2B 3ETPA 3GSXB 3C6LD 2IAND 4MNLA 4DKFH 1CGWA 2MTPA 1BOGB 1HYRC 4KRUA 4P46B 4LSRH 1CI5A 1UACL 3LMJL 3VXNB 1ZBKA 4KTEH 3AIQA 3PDOB 3MR9B 1V3LA 3GO1H 4RMUA 1INDH 1FN4B 1IKFL 3VGBA 4NNPL 1JBJA 5HI3C 2WMIA 3GTNA 4W7WA 1ZT4B 3CMOL 1P84J 1KG0A 3BXNA 1JZ7A 3OL2A 1DVFD 4YLQT 5IVNA 1T1WA 1I4FB 4K7PL 1UQYA 1JYWA 2CKBH 1N6QL 5F44A 3B2VH 1P7QB 1OAKL 3DMMB 1SBBA 5DJCB 3TEUA 1S3KH 4XWGL 2H9GA 4ZOAA 5ESQA 2J7FA 1ZA3A 4P7LA 3AHXA 1WZLA 5BW7C 3AUVA 4GMTH 2Y7QA 4XP1H 5F8RC 1UXSA 4K3EH 3GIZH 2ZCKL 4HBCL 3CIQA 4GQ9L 3QDMA 4TSAL 1B2WL 5GNZA 1C08B 5DQDH 2H8PB 4HXAL 2LVCA 4NQVB 4DGYL 3VOCA 1BP3B 1D5IH 1JVKA 4E4PA 1ADQL 4Z8FH 3M46A 2FGLA 5C0AB 5E6ZA 3MMEA 4YDLB 2WAHA 4X4YA 3PWNA 1TCRB 1KB3A 3MQIA 1DP0A 2X1QA 2X9YA 1E6PA 2GJ6E 2DWEA 3UTZA 2F8XC 1LDPH 5E8OA 2AJVH 4MNGE 4XURA 4KTEL 5C08A 3WN6A 1SEBA 1IAKB 3GO1L 3I2CL 1INDL 1WIOA 4CADB 1L7RA 2X0HA 4E41E 1A6AA 5LBSH 3P4NA 4XUYA 2J7DA 4UT6L 3CVHB 5TF0A 3GNMH 4X9FA 3V5KA 3ULVH 3BN3B 5AD0A 4U6YB 1W9WA 4MAUH 3GMRB 1NGZB 3MRLB 4CDHA 5BW7A 1W9BM 1LEKA 4G8EB 4PRDA 1K2DB 2PYFB 1GPOH 2Q86A 1HXYA 5ILTH 3B2VL 2YN3A 1S3KL 2CIKA 3SO3B 3MV9A 3G5YB 5E6IC 2E7LC 1QYGH 5D7KD 2DQXA 3ME0A 2YBUA 3H9ZA 1U8LA 4LHUG 5JO5A 5K9KB 4E2OA 4GMTL 4MB4A 4XP1L 3IFPA 3B83A 2ZUQC 3GIZL 3TO4D 2BY1A 4MNHA 4F7EA 3STZA 4Y5YB 5DQDL 1SM3H 1IKNC 4HIXH 4G7YH 4ELMA 4JRXE 5I1JH 1D5IL 2QADD 4Z8FL 1NOFA 3T3PE 3LDBC 1P6AB 5GZNC 2GW5A 1RUPH 5G04L 5SWZA 1LDPL 4XP4H 4OV5A 1P5VA 2AJVL 5IHRA 3WO3B 4PCSA 3B3IB 2P8MB 4JFEE 5D8JH 2P5ED 5LBSL 2DN7A 3NCJL 5IB3B 3GNML 5EU6A 3P9LB 3GI8L 4HGWA 4WI5A 5I30L 2ATKB 1W0YT 4NQSB 4ZFFB 3GBDA 4ZFZB 4U31A 4NRYA 4ORGA 3GXDA 5E6IA 2E7LA 3AVEA 3L9RA 3D2UB 1PBGA 4Q2ZB 5E09A 1GPOL 1X5HA 5E6YA 3UEZA 2UY3A 1U58B 2AK4A 1QYGL 3V0VB 1B0RA 5GHWH 3ZSTA 3GSVB 3WFLA 5GZOD 1DBBH 1VCAA 1IKNA 1S7XA 1T03L 1AHWC 2ICWJ 2AP2A 2E40A 2X4NB 1WBYB 4X6CF 4C83B 4HKJA 4PMOA 1NP0A 1NAMA 1YEDB 2EDBA 1OSPH 1SM3L 2A74A 4HIXL 4HFWA 1VKXB 3QUKB 4YWGH 2NX5E 5C0EB 4NQCA 4KMQA 4Q9QL 3AICA 4XNQB 2Q8XA 4P0DA 3FJTA 2JB5L 4GKLA 3V6ZA 4AH2A 3AM8C 1C16A 2FL5A 1QSFE 2IXVA 1S46A 4QCIB 4FFWD 4XP4L 1QFPA 3L6FA 3VD3A 3ZE0E 2JCCA 5D8JL 5LXGH 4HD9A 4V1DB 2FRGP 4JO3H 1OM3H 5IW6B 3NGBC 2OL3A 1R85A 2HVJA 4I13B 2A3CA 3L3JA 1B3VA 2DSWA 3PF2A 4EIZC 3X13B 2MSPA 5BZWB 3FN9A 3WBAA 5FOOA 3VXOA 1AD0B 1RU9H 3D18A 4NRSA 1DFBH 2AXGB 5GSVA 3CD4A 2J7MA 2Y72A 3PGDA 4EI5C 1YJDH 2FSEB 2A6DA 4GG6A 1S7SB 1AHWA 3TM6A 5I1DB 2YIHA 2G75B 1T4KB 4YHNB 2WYSA 4FLSA 4R26H 5GHWL 3DROB 3HU7A 1A4KA 2FJGB 1DBBL 3L3OB 4NO0B 4HS6B 2DQUH 2A6JB 2NZ9C 3LKPB 3NPSB 4JPIA 2WVTA 4GIAA 2HJFB 3BUTA 4L5FH 4OQTH 2W0PA 3CZFB 3W0WD 2XN9D 4PP2A 1HQRB 4PBWD 3AM8A 4YWGL 4L0PA 2R1YB 3UYRH 4WGVB 3ARGB 2QQLL 3OKKB 1U2CA 5I19H 1QUNA 2AQ3A 4JR9L 1QHZA 4JHOA 2FYYA 4Z18A 1HOCA 3KWWB 2CMRL 5T3XD 3MYZA 3RWJA 5HDQH 3I02A 3PL6C 5IMMA 3O9WD 4DFHA 2VAAA 3T4AB 5LXGL 3L7FA 1RSFA 2GUOA 3U46B 1HK6A 3RM8A 1OM3L 4ODVL 3SDXB 2A9NH 3WFHA 4UDUB 2GK0A 4ERSH 1HH9B 2OLDA 4WTZA 4EI5A 3BRGC 3HUJB 3FW6A 4ORZC 3L3GB 1UQSA 4NO0D 1DFBL 4OZ4B 4U0RB 1HE7A 3A6BH 4Y2OA 2EDNA 3D39E 1YJDL 2CPCA 4LHUB 3WLWD 3SKOA 3HRZB 2WQ8A 1U0QA 1EO8L 1QW8A 3V4VL 3P6BA 1UKOA 1H3UA 4U1LB 4FOMA 5F1NB 3RNQB 1NAEA 2A38A 2DQUL 2ED7A 4JFDE 3QPQC 5KVEH 4OZIA 4L5FL 4OQTL 4KK8C 5LCWL 1B4JH 3EZJB 3L3KB 2H3NA 4NJAH 3H6JA 4YBHA 4XVSH 5CIPB 3UJIH 5ESVB 5ADPH 5DQ9B 1BPVA 4AZCB 3UYRL 4F66A 5I19L 4FN0A 3PL6A 4P59L 5BVPH 1MELA 2ICWB 3QISA 5F7LB 1CL7H 3BPCA 5HDQL 4KKCC 4J8RB 1C5DA 4PJCA 1OIFA 1WISA 1BZ9A 2Z8VC 4NNXA 4Y1AE 1OGTB 1JFHA 5EU5A 2YKKA 1QRND 3HG1A 2WB5A 3MO1B 2VLKB 3CHEA 5C07A 3K0WA 1L6XA 4FQHB 1QNZH 2GSGA 2BVQB 1OTSC 5D9MA 3RGHA 1AIFB 3K80A 4GBXC 3ROLA 3QH3B 4QRPA 4PYGA 4PV9A 3A6BL 2XSAA 3IDYB 1CG9A 2WCSA 1O5DT 3I9GH 4BF7A 1MQQA 4XPAL 2GITA 1F2XK 1UGNA 2HTLD 5CEYB 1IRAY 1NMCB 2COQA 1FZMA 4K7FB 2ZEWA 2ICES 2DLGA 2XIDA 4HZAA 1I1RA 3TVMC 2IFFL 4GXPA 5KVEL 3JWOC 3NSXA 5BWFA 1H4PA 5I8KH 3O3DA 4F9PC 3NCCB 4L4TD 2Z35A 2DEPA 1D7FA 4R90H 4S3JA 4XVSL 1BQLL 1GOOA 3H0TB 1AO7E 5EULV 2JF7A 4GXVH 2YL5A 3QI9D 5C0CE 5B4MC 1DQQA 3SJVD 5BVPL 4RNRA 3RWIB 3RM9A 1JPSL 5KN5B 4G42B 1K3IA 2Z0BA 4JZNA 1CL7L 4OGXH 4KUCF 1RK0B 4UNUA 1CIUA 1FVEB 3W28A 2XICA 5GGRY 3RKDC 3V6OE 3JV4A 5D96C 1A9EB 1GW1A 4GBXA 1A7PH 1EEQA 4HX1A 4M43H 1QNZL 3RVTD 1C90A 3HLAB 1QNQA 2K7PA 1WBXB 2BERA 1VB9A 3LQAC 3O6FC 1W72A 3ARFC 5EMYA 2BY3A 5ITFA 4Z7WF 4I9WE 4WFFE 3I9GL 3C7OA 1V6XA 1CFTA 3IJYB 2RGSA 3TVMA 2NTSP 2VURA 4KXZH 2X2YA 1U42A 4E41B 2E33A 4F9PA 3WNOA 5FIPA 5J56B 2NY1C 3DRTB 4LLUB 3LKQB 3RZCB 2EC9T 1D3CA 3F7RA 1GYAA 4U6XB 3EFDH 5H37H 4BSVA 5I8KL 2XKNA 2M2DA 1U3JA 3KEHA 1SBSH 4R90L 5DQ0A 3D0LB 3VJ6B 3QDJD 1H6XA 3FB6B 4OFYD 4ZUVB 3F65A 3C08H 2WKLA 1ZVSB 1JHTB 1U33A 4HIJB 5DTFA 4YDIH 4NUJA 4ZPVA 4OGXL 1LK2A 1JWMA 3KLAB 4ZODA 5DYOA 4PJBE 4YBLB 4WKFA 1QBBA 5IT2H 1QFWM 2GJ6D 4DXRA 3VINA 1MPAH 2X4PB 4XXDB 3OB0K 4Z76B 3O6FA 3ARFA 4XCEA 3SQOH 1A7PL 4JRXB 4M43L 4UV4H 5AY7A 1SYVB 1XGRA 5E8EB 2J8UE 5EDXA 1H5VA 1MWAL 5B8CB 5C2BH 2VRJA 4I48B 2NNAA 4XNZB 5JIIA 3PHQB 2VLJE 1KEXA 4HAGA 1CFNA 1FDLH 1U36A 2VIRA 3OSKA 4NYLB 2BSED 5C9KA 3RUGE 3JTTA 3QFDB 3J7HA 3EMCA 1W0WA 2Y07L 4JFEB 4P3CH 3RU8H 4G5ZH 5MENA 1T1YA 4ARXA 3HI1A 4W7UA 3WEZA 2QHRH 3MRJB 1IAMA 2CEQA 3AHZA 1O7SA 3V6FB 1B9ZA 4NZJA 4RMQA 3AFBA 3EFDL 4P8XA 3L95B 2O5ZL 3T8XB 2Q3AA 4QHUB 1SBSL 4LK4A 5EO0B 3MNWA 5ABDE 4URIA 4PJIA 4GW1B 4QPWA 1JPST 4Y7EA 1JWSB 3C08L 1U8PA 2HKHH 4TVCA 5IEHA 3HPJA 4CUCA 4YDIL 1F4WH 2AV1A 3DXAA 1G5AA 3UZVB 1Q6GA 1HEZB 4U3HA 4XH2B 5IT2L 1MXGA 2P24A 3GSWB 3C5ZB 1MPAL 5IK3A 3ULUE 2WNWA 2ZWLT 1IE5A 5DD3H 1OCWH 5FECA 2NX5B 1P7HL 3K46A 2B7DT 5E2WH 3VD9A 1FNGB 3QUXC 5HGAB 1F4AA 3TPUB 4K3JH 1IAOA 3KXFA 4Y5VB 1QSFB 3RX5A 3X11B 4RWYL 5CMAA 1FDLL 3OGVA 3KS0H 5JOPD 2D7NA 2X4UB 4PMDA 3K7UA 4P3CL 3RU8L 4ENEC 1TXKA 4N1CA 3T09A 5IVZA 4G5ZL 4RX4D 1TTUA 3IAGC 4FQJH 4QP0A 4WWID 4AD0A 2QHRL 4Z5RB 1KJMA 3QUZD 3TYFB 2X0YA 2VMCA 3O2WH 4UQCA 2AGJH 2X70B 4RA0C 1EEYA 3CAFA 1NC2D 1CR9H 5TDOB 1TPXC 3MBXH 3VFWB 4YXLL 3CU1A 3VXME 1MI5E 2HKHL 4AWEA 3BJ91 2NX5D 3EYQD 2W9LA 1T7YA 4PJFF 1F4WL 3W81A 4P7QA 1QSEE 4U4BA 2BOCB 4JY6B 3ARXA 5EU7E 3QUXA 4AXNA 5GGTL 3N1MC 2ZG2A 1WCBA 3BAWA 1A3LH 2F54D 4KJWD 5DD3L 1OCWL 4HUUB 2P4AB 2J1RA 1J8HE 2AV7A 4GMSH 5E2WL 1WCQA 3C2AH 2Z92A 5DRNA 3DJ9A 3LS5H 4PD4K 4WW1A 4AY0A 2UWEE 1U91B 4FZEH 3OKDA 1OGSA 2EDYA 4HIEA 3RNKA 4QXUH 1UZ8B 2PO6C 2BHZA 5I2IB 1W32A 2WO2A 3QIWC 3UZEA 4M7LL 1E9LA 1FG9C 1UJTA 3U4BH 3ZKNC 3EFFA 1HKMA 2BNQA 2C1PA 4IM8A 3O6MH 2AXJA 4L8CA 2NY6C 3D39B 1UCBH 2O5YH 2JTDA 1CR9L 2Z1KA 4AZ5A 3MBXL 2MQ0A 3BP5B 1TDQA 4MLSA 1AKJD 2GSIA 3QP3A 4IRSC 1IZJA 1TQCB 1ZJBA 2BVYA 4QTHB 4GUPA 4GFTB 3MGOB 5DXWA 1PY4A 4PRBA 2EPNA 5TE4H 4PF1A 3WSOA 3DARA 5HHOA 5I1AB 4L3EA 4HK0B 1I3RA 2FJFA 4CL7A 3RWHA 4RDQG 5A3HA 3HZYB 4HXBH 1A3LL 1PG7H 1ZXQA 5EO9B 1U3HB 1XZ0A 5AAWA 2XZAH 3HNTH 3LS5L 4MVBD 4XPHH 4XVHA 3VX1A 1UVQB 4APQB 1MCDA 5DVOA 4FZEL 2WMFA 1UWGL 3MROA 1WLHA 5I78A 2PO6A 1WJ3A 4JZOB 5DO2C 5FK9A 1RJYA 5E1HB 2OSLB 3QIWA 3AZTA 4U7SA 1WFNA 4Y1AB 5JDJA 2VVNA 2NW2B 3FQNA 1FAKT 4J4PD 1MLBB 3OTTA 4QXTA 5FM5M 1WWAX 3U0PA 2K1MA 3RIKA 4JFOB 3WKMH 1UH4A 2NLJA 3U4BL 2ZXQA 3WQWA 3MV01 2X9WA 3EDJA 1XGZA 4J28A 4JFDD 2HLFC 1ZGLA 4MJ4A 1UJ3C 3HPLA 4IRSA 1VF8A 4LPCA 2O5YL 3FCTB 3OHXB 1YEHH 4MHHG 2J4GA 1G6RB 2Y5EA 3PABA 3HZMB 3VXTB 1F11B 1X5YA 5C6TH 2Y6LA 3QHNA 4IBLT 4UQ3B 1WK0A 1RIUH 4X9GA 1ED3A 1PBYA 1DWAM 1D5BA 3L1OH 4HTYA 5F9JA 4ZUTB 2Q87A 3T2QA 4JM2F 1UM5H 4HXBL 4KRPD 4AM0B 4DEQA 1PG7L 3ARBD 1B88A 4QLRA 3WF1A 2E6JA 4P9MH 3AIRA 4G6AC 1AO7B 3HNTL 5C0CB 4XPHL 1GHRA 3WENA 4FFZH 2PBGA 4YHKH 1GGUA 1U8OA 2HVKA 2R69L 1H0DB 4LAQL 1NBZA 4OKVB 2ITCB 1BGGA 4M7LT 3CXHK 3HR6A 4DGVH 4NQDD 2PXYC 5HVFB 4H8UA 2YB7A 5D9PA 1RVFH 3VFRB 1UJ3A 2NY2C 2DM2A 3WKML 4JGMA 3JXAA 3STLA 2IQ9H 4XUTA 4GKZB 3MGTA 3EYVB 4RMRA 4S3KA 5DHXB 4PUBL 4HPHA 4GW4A 1YEHL 3QB7C 3SCMD 3H3PH 1WIPA 1I8IB 2X1IA 3THML 5KS9F 4R4BB 4LLDA 4BH8A 4UU9B 2CIIB 2YA1A 5MEQB 1KCKA 5F8QC 5KTEH 3O4LE 3T77B 2VE6A 4D9QD 4P2QE 4YHLH 1F45A 1T0NA 1RIUL 3I3BA 4X6EA 4PV8A 3L1OL 4Z0BH 1TVDA 3PZVA 1UM5L 1AXSA 1AGDA 4IRJC 1I1YA 4F15C 5C8JA 5C92A 1GU3A 4PB9L 4FK9A 1LD9A 3PZGA 3DHPA 4M93C 4KFZC 4L9LB 2DICA 3RWEB 2PXYA 1HNYA 2OWCA 2AERT 2HRLA 3O2VH 1UWEH 4NBZB 1SYSA 2JJUA 4BM7A 4PJBB 3H9SD 4E8DA 3ACIA 1EFXD 4ZZ8A 4OZGA 4DGVL 4MD5B 2VZSA 3DHUA 2V9RA 3VE0A 2EYRA 3WCYA 3A6OA 5IFTA 1C3FA 1RVFL 1RUMH 1LEGA 5FM5O 4WY7H 1JL8A 2HWZL 2J8UB 4X4ME 1MNUH 2GYSA 3QR3A 4KMLB 3WY1A 2VLJB 3HTLX 1QI4A 4YN5A 3AXLA 4LRIC 1Q4NX 1KB5H 3RUGB 1G0DA 4OIIH 1RZIB 1YMME 4MS8C 4YHML 3NSNA 5KTEL 5JPMA 1TJGH 4YHLL 1FZOB 3HN3A 1RZKL 1KJ2B 4IRJA 5J0BA 3PHAA 1YUHB 4PRPD 2HJLA 4Z0BL 3I75B 4Y8AA 4BFIB 4CKQA 1NEZG 5IVXA 4JHWH 2EKJA 4TOYH 3CUJA 5DJZB 2GQHA 1GL4B 5DRXB 4M7ZC 3FQXB 4FMVA 4HKZB 2KZWA 1DR9A 4LGRB 5L8LB 3RPIB 5IBUG 1N7MH 5T1LB 1UWEL 3AHTA 4KHXH 1ZVHA 3OR6B 4Y89A 3CMGA 1SJEB 2K3TA 1IMHC 1ULVA 3QULB 2BJML 2E7MA 2FJHA 3VFVB 4PTTA 5DDHB 4HUXA 5KVGH 4QCFA 4LRIA 3BO8A 3BEVB 3M45A 5C2UB 4D6FA 5SWSA 4FXGB 4RGOH 4NN7C 4LKCA 3EHBD 4UT9H 4FMFA 5T1MB 2HT4C 4OIIL 4C56A 1PY9A 4TNWF 3TJHC 4ZNEE 3IDAA 3QEHA 2ZOXA 5AZEL 2DQFB 3BMWA 3APGA 4CNIB 2QKIB 1LNUA 3SE8H 3WS6A 5A8QA 1Q9WB 3BDYL 3ECBB 4PSPA 3MLUL 3O2LA 3EMQA 3RJXA 1WIUA 4XP6H 2BVOB 4AD4A 3OB8A 1I5PA 2PQSA 3S6CA 3G5XA 1PX3A 5JUVA 3Q2CA 4XUPA 2AQ1A 4EDWH 2J5LB 4JHWL 2DLFH 1HIMH 3GEWB 4U1MA 5C0BA 3VXMB 1MI5B 4POZD 4QGTA 2DDXA 2Q8BH 4D0DB 3W38A 5D71H 1BBJB 1F00I 1ZT1A 2J12B 3IKKA 5FCUL 3THDA 4D6DA 4WUUA 3IU4H 2E9BA 2NR6C 1N7ML 2HG5B 2BMKB 3QO1A 4FZ8H 4OT1H 1RPKA 2V72A 1QSEB 5CCKH 2ZJSH 2BRRH 2ORXA 2Z31D 3DUHA 3Q1SH 1Z9MA 4YR6A 3EGSA 4Z2LA 3OX8B 1WAAE 3HAEB 1MREH 1J8HB 4HPYH 5KVGL 1TZIB 3N1AA 2OJZL 4KAQH 4L8BA 3B6SB 5MP6H 1BPLB 4PMZA 2UWEB 3VNYA 4RGOL 5FYJU 1AR2A 5EIIA 1QOKA 4UT9L 1JGVH 3FFCA 3DC0A 1BM3H 4IPNB 3BPOB 3D0VA 2G5BB 4LSTH 5ABEA 4MWFA 4OCSH 4JG0H 1TETH 3SE8L 4CD6A 2RCSH 3T08A 1KCVH 4XRCB 1S7TA 2WIIA 3D25B 4JFZH 2OQJA 4GZ9A 1WAWA 3KG5A 1A0QL 2WSKA 2X1OA 4XP6L 5EH1A 4JQIL 4F7TA 4QOKA 4O9HH 1U6AH 4GWIA 1VBUA 3IXAA 3QXAA 5CEXA 5BRZB 3BJLA 3UDWC 4X6FB 4YPGB 1GMMA 5DURB 1ZHBA 2DLFL 4GKSA 3TN0A 1BMGA 1CGXA 1KR1A 4LYPA 3B43A 1E6RA 2FBOJ 3IDGB 1S5HB 3BP7A 3WUEA 5D71L 1QLFB 3WN5C 4D8MA 4JCLA 4W4NA 5A8PA 5C9JB 4YFLF 2ZSWB 4FP8H 2Q7YB 4WHDA 4FZ8L 2BSTA 4OT1L 4RGMB 3HMWH 3BQUB 5KSUB 4PJFE 2ZJSL 5J3HD 2BRRL 3Q1SL 3QWOB 5FYKL 2G3IA 3BCFA 1D6EB 2NW0A 1EV2E 4OI7A 3KPRE 4F79A 4HPYL 2YPLE 4W6WB 3QEGL 3N1GC 5T5FH 2A3AA 3BH4A 3L5JA 2C1OB 1B3ZA 4N42A 3O8XC 1EZVX 4N0YL 3QFJA 5FFLA 3GK8H 4HK3J 3II1A 5F9AC 2G60H 1L7QA 1BM3L 3HS0B 1FL5B 4Z7UA 4N0RA 1JNNH 4TXEA 5J9PB 1PIFA 3NDZA 4LSTL 4QDRA 1E55A 2F15A 5DURD 4JG0L 1IGFH 1TETL 2ESCA 4RQQB 2L9LA 1KCVL 2EXWD 3RL1B 3UDWA 1NEZB 2GT9A 4BQ2A 3R4DA 3HE7B 1U6AL 3T4YB 4P23D 1QNRA 2MQCA 3WN5A 4ET7A 5EUKA 1S9XA 1K9DA 4NWUL 3SDCD 5ISZE 1TVGA 1UZ0A 3SUWA 1U95A 4HG6B 3SCPA 3RWDA 4GZJA 5E5MA 3POCA 3WL0A 1FL6B 4HA1A 2FEDC 5MHSE 4CGTA 3BXWA 4FP8L 4HUVB 2DI9A 4X7EC 5GRZA 2FHBA 3K75B 3HMWL 1XGTA 4W84A 3PZ9A 1X5LA 1BJ8A 4X8JB 2I27N 3WFEL 3L4ZA 4NRZA 1OCQA 3QUYD 3S3SA 3O8XA 3IU3B 4YGVA 5EO1B 3LZFH 4QRTA 4GH7B 2IAMC 4MA1C 5T5FL 3PZUA 3MCLH 3SKNB 1AMYA 3KAAA 4J3VA 4P2OC 1NFIB 5IB4B 5GGQH 3BN6A 2G5RA 2NXZB 3DVGA 3PIQB 1J9CT 4WO4C 4LVNC 2V3FA 3GXFA 3LEXA 1JNNL 5D93B 1UADC 4FG6C 2IMNA 4M02A 1T83C 3BFOA 3WUZA 4LLYB 5JZ7D 3VIPA 3PP3K 4KGJA 1LQSR 1A47A 4WF7A 4XVJL 4FQPA 3W39B 3GMLB 1NCWH 3UAJD 5E1AA 3E3QE 3P0VH 4LVHC 2WVUA 1PKOA 1OF2B 1GRWA 2BNRE 4GJTB 5FA3A 1IQWH 1P7KB 3EO0B 2AJ3A 4H41A 4MD4B 2EEBA 3FOLA 3WH6A 3WXVL 4PRAB 4I5BB 3EJZD 3H42H 3O4LB 5EU6D 4ZUSB 5IUSA 4P2QB 5I9QC 1V02E 2XYCA 3BDBA 1ISZA 3GSOA 1DQJA 5CLTA 2FIRT 3K3QA 2IAMA 1HI6A 3QCTH 4QRQB 2YFUA 1MWAB 3C5SA 5E03A 1OP5K 4UB0H 4GSDL 4P2OA 1JK8B 15C8H 5AYUH 4XP9H 5IHLB 4WO4A 4DWHA 5JIKA 2VDPH 3SKJH 2VZUA 5K33A 5BJTB 5F1SA 5GGQL 1WC7A 4ZYKB 4TTGA 1H9VA 4OF7A 1T83A 5ERWA 2GFBA 2Q6WA 2VXQH 3VFOA 3AISA 2YBTA 4MD0A 3MV8D 1H3WM 4GRWH 1F4YH 4ZDHA 4PJ5D 5IFPA 1HHHA 3EYFA 1HF6A 5FYLL 1YMHA 2ZKHH 1M6OB 1T7ZA 4DZBA 4KH2A 2W9DH 1I8MB 1NCWL 3GBMH 3UTTE 3VGAC 3PV7A 3U37A 2EICA 4KKAD 2E32A 3P0VL 5J6GA 3KGRA 3NIGE 3WDHA 5DHVB 1YMMB 1HXJA 2YDQA 1RZJH 4OD3H 4KHTH 2FZ3B 3IB3A 4QX0A 4Z2JA 3E0GA 1MCNA 2JIXB 5DJ0B 4DZ8A 5CP7B 3H42L 1A8JH 1XF4A 3ES6A 8CGTA 3T0EE 5GS2D 2VQTA 4WDIB 2HLAB 3QCTL 4NO2B 2DJUA 5I6XB 4UB0L 1S7WB 3A6CH 4KUCD 4V2BA 4Y4KD 5DD1H 3UROR 3MRHA 5E9DE 2XIBA 5AYUL 4XP9L 4QYOB 4PJAA 3IFNH 6TAAA 2VDPL 3SKJL 1MVFA 3DPBA 4BQ8A 4M5YH 5FHBL 4H25A 2DBJA 1OLZA 4CU6A 3V4PL 5ETUA 5BXFA 2VXQL 1E4XH 4RMVA 4HH9B 1EH9A 5CG0A 1ONQA 1CGSL 4WRLA 5SV4A 4OLUH 1XH3B 1AFVH 5A6BD 1MJJB 4JFHD 3MUHL 2ZKHL 1JZ2A 4YDKL 3BSHA 3SCVA 2W9DL 1DBAH 3MNVA 4NCDA 3RGVD 5D6CB 4RAUB 2FNBA 2VZVA 1QO3B 1BFOA 3E6FA 1RZJL 4OD3L 1E6SM 4KHTL 4PJ8B 3DGCR 2E6PA 4WWKB 2AXFB 3U1SH 1A5FH 5I6SA 3RCNA 3OEBA 4W93A 1FP5A 4U1SB 1BWMA 4PLKD 3HJEA 3DURA 5CHNA 5DHYB 2XUCA 2ZOKB 3GBNH 1AGEA 2E9WA 3TTYA 5I18L 5IOPA 2JJTC 4LCUA 1LL7A 4NWTH 1XNTA 3KNBA 3OXSA 4LCWE 5DD1L 4RFNC 4CRPA 4QHMB 3TPKA 4F9JA 2UUDK 3I6KA 3IFNL 3EBVA 4JFYA 4DCQB 4MQ7B 1QPKA 3JV6B 4Y16C 1A6WL 1VFAA 5F7EH 1BTCA 3FB7A 4YPJA 3VXUE 5I1CL 5IIEA 3RTQC 3T0DA 3ALGA 2WO1A 1JAEA 4K9EC 1EQPA 1E4XL 2W62A 4NUGH 4DK3A 2NTFA 3BSGA 3RIAK 2D2OA 2VLLB 3NN8A 3GBEA 3UPRA 3MLVH 4H0IA 3QUMH 4OLUL 2SEBA 3BHBA 3CLFH 2I07A 1ACYH 4G8GA 4WWKD 5DT5A 4OLWH 3Q48A 4LKSA 3GMQA 4HIHB 3ACFA 1OPGH 4NFDA 2V4VA 2NY3B 1D7PM 4R3SB 4YHYC 4PJGA 1TUXA 2PTTB 1CDHA 2JJWA 4U5KA 2ATPB 3OJ2C 4NFCA 3MLRH 5IQ9A 4P5YA 2DIBA 3HCVB 3S5LG 3PQYE 3U1SL 1A5FL 5J11C 2P7TA 2JJTA 5FYKE 1DLHB 3TP4A 1OT2A 4UTFA 5A6AA 3IDXL 3LN4B 5D4YA 4UOZA 4DAGH 1LE5A 4K94H 5BS0A 4NWTL 3O3BB 4Y16A 1QEWB 1FFPA 3BP4B 1V0KA 1S78D 4G6MH 3MRDB 4D0CA 5A6LA 3RTQA 4D9RE 5ID0A 4N0FB 2ADJB 3PGCB 1B3YA 3F6IA 1G01A 4BFGA 1YPZF 4OF5A 3WIHL 4AENA 3I2KA 2NYYC 2FX8H 2H2SD 2Z93B 1V3HA 1XH2A 3C60B 2N7AA 3V4UH 4AIXA 3QUML 3HHRB 1UKPA 2NY4D 2XTJE 4YAQA 3KPRB 5KSVA 1BLNA 1CZ8H 4MXQC 4HAFA 4W4OC 4OLWL 4QEGA 1HP5A 4F7CB 1P5UA 4KKCD 1OPGL 3V9FA 2F53D 1B90A 3MRIB 2X4QA 1UM6H 3RWGA 1TR1A 5AYBA 4GKNA 1P84K 4XUOA 4WU5B 4HZ6A 2BXYA 1H8NA 1Q8MA 2IH3B 3W11D 4FMKA 5EUOA 3PDGA 4PJAF 3GIVB 4I0PC 1O7VA 3QQ4B 5L0QB 4W8BA 4A3YA 4P4KB 1H5BB 1U41A 3DUSB 3MJ9L 4GRLB 1JTOA 3HNSH 1BIIA 3T0XA 1WWCA 3MRQB 3CFJA 1ZGLP 3SKMB 3SPVA 5K9QI 1H1NA 3UBXG 4E42B 5ICXB 3QAZB 1P1ZA 3RX7A 5JNYB 5F71A 3QQ9D 5ISZB 5DS8A 5HYJA 1JPGB 4R97C 5CBAA 4LLMA 1CXEA 3NZ8A 2HFFB 4W5UA 3RKPA 2J7HA 1WGOA