5C70A

The structure of aspergillus oryzae beta-glucuronidase
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
601
structure length
588
Chain Sequence
AAQGSAGSMLKPQQTTTRDLISLDGLWKFALASTQPWTSQLKTSLECPVPASYNDIFADSKIHDHVGWVYYQRDVIVPKGWSEERYLVRCEAATHHGRIYVNGNLVADHVGGYTPFEADITDLVAAGEQFRLTIAVDNELTYQTIPPGKVEILEATGKKVQTYQHDFYNYAGLARSVWLYSVPQQHIQDITVRTDVQGTTGLIDYNVVASTTQGTIQVAVIDEDGTTVATSSGSNGTIHIPSVHLWQPGAAYLYQLHASIIDSSKKTIDTYKLATGIRTVKVQGTQFLINDKPFYFTGFGKHEDTNIRGKGHDDAYMVHDFQLLHWMGANSFRTSHYPYAEEVMEYADRQGIVVIDETPAVGLAFSIPATFSPDRINNKTREAHAQAIRELIHRDKNHPSVVMWSIANEPASNEDGAREYFAPLPKLARQLDPTRPVTFANVGLATYKADRIADLFDVLCLNRYFGWYTQTAELDEAEAALEEELRGWTEKYDKPIVMTEYGADTVAGLHSVMVTPWSEEFQVEMLDMYHRVFDRFEAMAGEQVWNFADFQTAVGVSRVDGNKKGVFTRDRKPKAAAHLLRKRWTNLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glucuronidase
publication title Enhancing the Thermostability of beta-Glucuronidase by Rationally Redesigning the Catalytic Domain Based on Sequence Alignment Strategy
doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 182
structure length 588
sequence length 601
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c70A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5c70A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5c70A03
3BKYH 4F7EA 5M3WA 1H5BB 3VXOB 4TOQA 3T3MF 4EANA 3HPJB 4U2ZA 1T7VA 2YPKA 3LRHA 1W91A 1B0RA 3B9KB 4FQPA 3PP4H 3UZVB 2Q8XA 1PSKH 5IGXH 3BP5B 5J3HD 4FP8H 3V4PL 2YKLH 3ARQA 4MAVA 3D0LA 3QA3A 3ZLQC 1MFEH 3L5HA 5C7XH 4MO3M 2DH2A 1QFOA 1E6NA 43C9B 2MKWA 4HK3N 4YHZH 4MAUL 5JIHA 5DT1H 2A6IB 1MYRA 2Y24A 4ZO8A 4S0TD 5F97E 2ICEA 5CIPA 5HHVH 25C8H 2PO6C 4I0PA 3G6AA 2EKSB 4LASL 1H0IA 5MI0B 1X6NA 3PNWB 4HLJA 4JL1A 1T2JA 4F7PB 3LKQA 3KDMA 1M04A 3CD4A 3WN5B 4R97B 4ELKA 1FNGA 1TZGL 3PXHA 1T3FA 3KNBA 4UT7L 5DEZA 3WQ5A 1QFUL 1UMHA 1HHJB 1EIBA 4X8JA 4L9LB 2Z93A 1CLYL 1CICB 5GGRY 4LAJH 4NO3A 2JEQA 2WK2A 2VCAA 3HFMH 3GSNH 1TJGL 1YEDB 3I75B 3GBNL 5CBEA 4P3CH 3CZ8A 2NY7L 5FOBA 3C5JB 3HI6H 1EEQA 5EG6C 1WWAX 3TPUB 5D2LF 2EJ1A 4GI8A 3LH2L 2MPAH 2HJFA 1XIWC 1E3XA 2UWEB 3PGCB 4UNIA 4O51B 1HHHA 4A45A 3I84A 1IC4L 3STLB 4G3YL 4R4ND 3QG7H 2PWEA 4WFGD 5C0JB 2QQLH 4UIKH 3SUUA 1TJIH 3ZKSD 4MCYA 5ABHA 1IJ9A 2DDQH 1E4XH 2VZSA 3PDOB 3MXVH 1MI5E 4EI6B 4DJMA 3EDDA 1VEPA 3K1DA 4K2UL 4M8UA 1U8OA 2OSLB 3F4VA 5HYIA 2C3VA 5FO7B 4M5ZH 3S98A 5I76B 4WI8A 1QBBA 1UR2A 4ODTL 5D1QA 4HIEA 4GG6A 1G6VK 5IVXE 2ZOKA 3O6MH 5IM7A 3OGCA 2L4OA 3QEQD 4ONFL 3WQBA 5JW3L 1JYXA 4PJ7E 1U8HA 2EIDA 3HAEG 5KSAB 4RGMC 2XY2A 5DJDA 3EGSB 2BOBA 1ZBKA 4GWIA 4PLJD 4O2CB 4Y19D 2AEPL 4AL8H 4PD4J 3MBEB 1Q1JL 3I6GA 1QHZA 1HHIA 5GGRA 1SVCP 4UTBH 3BEVA 5C6PB 4XPTH 3WFCH 4L4VE 2ID5A 1O6IA 1R3IH 4JO4H 4OI8A 3AIWA 4PMNA 3AIBA 2JB5H 1KB3A 4EBQH 1QI3A 1U58B 2PTTA 2HWZL 1HKFA 1I9JL 12E8L 3FO9B 2P49B 3GRWH 1UH4A 4L4TD 4A44A 5BXFA 5EBLB 2IPTH 1PKQA 1ZK9A 1A1MB 1MRCH 4OZGF 3UX9B 4FLQA 2YC1B 1INQB 1VA9A 1YNTA 4P4RB 1FFPA 2FO4A 2YSSA 1DCLA 5IK3A 4MNLA 3PIQA 1LNUA 2R0WL 5EU7C 3CSBA 3U9UA 1HHKA 2WINB 1NC2B 1G7PA 4B50A 3N17A 3S4SA 3K4AA 3INUL 2AJZB 2OK0L 3CLEL 3ZE2E 3U7WH 1B2WL 2GUOB 5C09D 2VR9A 1ZSDA 4WU5B 4Y88A 3C09B 4Y4KC 1X5GA 2HTLC 4JZOA 1L7TL 4Z95H 4PJ5A 5GSRA 1CZ1A 1BOGB 1JTOA 1UM5L 4YWGL 5ACLA 4GUPA 4HCRL 5MEPA 5DTFB 3WQ6A 3EYFB 3HHRB 5KVEH 2QV2A 3CCHA 3WEMA 5DD1H 5EUOB 3IAQA 1GCYA 3IDYB 4AEHH 5FL0A 2GY7B 5TFSH 3VRJA 5IMMB 2JELH 4U1IB 3V52L 3LE0A 1EUUA 1IZJA 1IGML 5JA8B 3QIWC 3NBNA 4Z7VB 2DH3A 2X7LA 4GRMA 3T77B 1W2PA 4ZEPA 4FHBD 1J0HA 2VLJD 1XGUA 1DQMH 4NWUH 1KB9J 3FZUD 1UYZA 1CGVA 4WEMB 3RVUC 1CLOH 2LU3A 1JAEA 3GBML 4Q9RH 4IRSA 4G80A 2CHOA 3SGEI 2W0KA 1WBYA 2AP2A 3MJ8A 4JM2D 1UWXH 3PZVA 1KT2A 5I1LA 4L5FL 5B4MD 1T22A 4X0VA 2NXZC 3WLWD 3DVNA 4ZPTA 2R23B 1HYRC 3LQAH 5CHNA 1A6UL 2DM7A 2OI9B 1BGGA 4G9FD 3UERA 4HTYA 1DBBH 4OIIL 5E08H 2QQKL 4N42A 3O6LH 5DD0H 4FLSA 3QDGB 2CDEB 1W1TA 3U5YA 2AEIT 5E8OB 1G1YA 1E6PA 3AREA 2YRZA 4MXWH 3ZZ1A 2O9PA 2H32A 4NQDB 3TESA 3C7EA 4MAYB 2ZOLA 4POZC 4WIWA 3N1AA 4XX1E 3TN0B 2PYFA 4W8AA 1W3JA 1VFMA 3BXNA 4R7NA 3ARVA 3AY4A 3RX8A 1VFAB 1MFNA 3LIZL 1LO3L 1IGCL 3QWRA 5DMGC 1E9LA 5T3XL 5DYOA 1W72H 1ZANL 4QY8A 4P2OD 1OD8A 3RAJH 5DD3H 3AJ7A 3E3QC 3FO0L 5IHZA 4LPLA 4JDZA 3F7VB 1UY4A 3D39D 1RI8A 2R0LL 4U05A 5E4IA 1G7LB 2DMKA 3RA7H 2BSRB 5HGBA 2HFFA 2VWEE 1PY4A 5SX4I 4PJ8C 3UYRH 4UU9B 8CGTA 1G7IB 2ZNXA 4HJ0C 3DUHA 4R27A 4NN6B 4PY7A 5HGAB 1FE8L 1AHWB 3L7EA 1U41A 3T0AA 5JQHC 1VKXB 2HT4C 5C8BB 2I9LB 1HOCA 3CSGA 3ILQC 4K9EC 1MJUL 5D7IB 3RL2A 2ADFH 3F5LA 1UJTA 4HZLA 1B3JA 1ZA6B 4WY7H 2PXYB 2APVA 1CFNB 4HHAA 5E99H 5CPSA 5DZLA 5F9JA 1MCOH 1LE9A 4PJBB 1OTTD 1AJ7L 3NRUA 1V6UA 3HZKA 2WVVA 4LDLB 3MRHA 2YA0A 4FQHA 4WHTB 3FT3B 2G2RB 1QRNB 3CFDA 3O11A 3QI9D 1KC5L 4LHQB 1DHKA 3MPCA 4XZUB 4DAGH 1NOUA 4JPKL 2VN7A 1YNKH 2O9RA 2KL6A 2WUCH 2YEZB 5GRVK 1GJUA 5FD0A 5J89A 1QEWB 5KAQF 1W9VA 2E8YA 1N6QL 3MFGB 4XCNA 1V3HA 3QUZB 4IRJB 2R29H 4P23A 1EQPA 3H3KA 3OKMB 5HGDB 2W91A 5D70L 2BP3A 5SWSB 1I7TA 3OJVC 2C7UB 2G5BA 1NANH 5FM5O 2BGPA 1KIUA 3G5XB 4GG6E 2LVCA 2E3ZA 2VRJA 2VITA 4BKLB 1H5BC 5HVHB 4PP1C 4OFPA 2B31A 2OCFD 2Y06H 4OGAD 1LILA 4OCWL 4HWEH 4M7KL 4FQCL 1J87A 2PCPA 3IKCA 3OAZK 1N26A 3RWGB 5B3JF 4PJCA 2EDXA 1O59A 2VXTL 1AO7A 4QLRA 5DHVB 3FQUB 4X7SH 1S7TB 4A6YB 1CGSL 3KPRD 4K3DL 4JFSA 2X42A 3KXFD 4JZNA 1A5FL 1WVZA 3IRPX 2YD5A 4K3EL 2ZUNA 4OM1L 1I4FB 3GI9L 1R87A 4HZ7A 1MCNA 4M8VA 3DX6A 3QHFH 5JXJA 3QWOA 3TBWB 5E0FA 5MI0C 4FQXD 3KLAA 5D5MB 3BEWA 4F7MB 4ATLA 4LSSL 2VT0A 3WN5C 2XPGB 3CH1A 4R97C 3N04A 4ZFFB 3GBEA 4MQSB 5AUMA 3GZAA 4MJ6B 4NQCD 1S9WA 3VXPB 3TF7C 4O9HL 4L9LC 1A3LH 1CICC 4GSDH 3W27A 2HJLB 4GKNA 3PV6A 3FFCD 3CU1A 3LMYA 1QSVA 1VACB 2D4FA 5DJ8B 5I9QB 1ZV5A 1V0LA 2GTZA 1QSFA 1UVQA 2BFVL 2VDOL 3DO3A 4K94C 5DRWB 5ENWB 1JZ5A 4OCLC 1FGVL 4QXWA 3VPLA 1JHLH 4XZBA 3HN3A 2J88H 4R7DB 5A16A 5DQDH 3I97A 1ZAGA 4PJ5E 4UQ2B 3NFNA 4C4KT 3EOAB 3B8SA 4YDKL 1YUHA 5KSBB 4D3CH 3UTOA 5C86A 4GAYB 1ITXA 4AM0A 4PJIF 2X4SB 4Z7UF 3N1QC 5I8CB 2R0ZH 1N5AA 1U3JA 3PHQB 1OVZA 4KKLD 4PJGB 3NFSL 2XFFA 1V0KA 4UV4L 4ELMA 5JPMB 2DQHH 4Y2DC 4XX6A 4AENA 5GIRB 3CFJA 2D31A 1K4DA 5E03A 4BJ0A 5A6KA 2BSTA 2EEXA 1NDMA 4M1RA 3KPSB 3PWVA 4OZHB 3FHQA 3SDXF 4WVRA 3E1F1 3OEBA 5KSAC 3P2TA 1TENA 3MBEC 3O6KL 1ZBWA 4D9QD 3I2IA 3CDFA 1MRFL 3CFEB 3OJDB 4EE9A 5D6CB 2IAMA 4KY1H 5IBUB 3ZT7A 1AP2B 5E7FA 1YPZA 3BX7C 1VFUA 3CXDL 4OF5A 5FUOL 1RZGB 5B38B 1OGTA 4M43L 3X13B 1B4RA 1RIVH 5J9PA 4LEXH 4DGVH 1K42A 4XCEA 3DHPA 1BMGA 3ETBF 3MLUL 3OB0K 3CMOH 3W9DA 3HRZA 5T1LA 2OX5A 5T5FL 1P5VA 3DETD 4PY8I 4NZTH 1W3HA 2A83B 3W0WA 1XD0A 3RTQB 1JTPA 5I30H 1QLFB 1HKLL 4HG6B 1KNOB 1OB0A 3DVFA 2JEPA 1BD2B 1YEIH 3PTQA 3HB3C 3A6CL 3WFBL 2YPLB 1UD5A 1X5YA 1KEGH 2XFRA 4UQDA 1F4AA 3C09C 3BDXA 1KCUL 1T1ZA 3MRRA 4BH7B 3FO1A 5L6YL 2F8VA 2W1SA 2W95A 1EBPA 1J5OH 1EGJA 1WCGA 3CUPB 3F5JA 5I18H 2XA8L 4QRQA 1BREA 3IDYC 5FO8B 5KOVC 2RBLA 4N8VA 5IFAH 2R2EA 1EMTL 5DQ9B 1BLNA 15C8H 3NJXA 4HH9A 5IMLB 1UM6L 2CXGA 4D0BA 3QHNA 2VZTA 4UQ3A 3E8UL 3OMZA 1AXTL 3FCTA 5DURD 4QWWD 2BV9A 3SCVA 3NDZA 4BSVA 4IM4A 3BZ4B 4DWHA 1G94A 4LLUA 3UTPE 1WQVT 2I5YH 4NKIL 4D0DB 3UPRA 4HC1A 1J8KA 1Q72H 4HMDA 1QHOA 3HEIA 3AHXA 4PBXA 4DN4H 3R06A 2ZG1A 5JQ6L 1NKRA 4J3SA 3ALXA 4H1LH 1MXGA 1D6EB 3CO4A 4W70A 5IB4B 3GXIA 5FO9B 3I2CL 1U8JB 1ZVHA 2FX7L 4TXWA 2PYEB 4KI5D 3PZMA 1ODAA 2E7LA 2WUBH 2VXUL 4MAYC 2GSIA 2OP4L 5D7LB 3QUKB 4ZUTA 5FKAA 3T0EB 3TN0C 2VZOA 2DI8A 4JKPL 1KIQB 2I9TB 5AYIA 1E27A 3G08B 1TJHL 5FGSA 4PJCE 1RHHA 2Z92A 3TTQA 2VLRD 1AO7E 3Q6GH 3TZVD 1RJZB 2ENYA 2NY4D 1P53A 1RJCA 4WW2A 4ODVH 5IHUL 2WZ8A 2ZX5A 3SOBL 3QNYA 4S3JA 2CK2A 1MHCA 3WFHA 2F54A 5GGQH 4PRPA 3EZJB 2YA1A 1RZJC 4KU1A 4KPHL 1ORSA 4P5TD 2BVYA 4UV7H 1JUFA 5DMJB 1E6QM 2X1IA 3HZVB 4D6IA 1K85A 4NN6C 4JFXB 3EOYG 4LLAA 1GYAA 3RMEA 1Q6GA 4B16A 1AHWC 3UTZB 1VCAA 4JY6B 4FABL 4MA8H 4QCEA 3EHBC 5ABGA 4F7TA 3X12A 5I0DA 4I3RH 1QTYT 2MQ3A 1LD9B 4C56D 3W29A 3QRGL 1LK3L 1WTGT 2PXYC 4I5BB 4U1SA 5D7JB 4CCEA 1FP9A 2AGJH 3JZ7A 5J13B 3PGDA 3STZB 1QSFE 1NCDL 4TUOB 3P9WB 1AKJA 4LHUA 2ED8A 1FYHB 3LB6C 1S7UB 3VFTB 4WENB 1JFQL 4FXKB 4OLUL 4LVHB 5LAXA 1WIPA 4GO6B 2VMEA 1IEAA 4KQ3L 3SE4A 2G4FA 5BZDA 4ZO7A 1H8NA 4NUGL 1YN6A 1UQYA 3AI0A 1SJEB 1U6AL 1JMXA 3QUZC 4IRJC 4ZXBA 3V9FA 5C0NC 2DQIL 4B9ZA 4FG6C 4DGYH 4AW7A 1JPSH 4XGZB 4CMMA 3RIAF 4M3JA 1E70M 1OGAB 2D0GA 1Q0YL 2J74A 4DXTA 3MGOA 2J8OA 1FVDB 1T1YA 5FGBA 1SBSH 4DOHB 1DFBH 1A1OB 4U5KA 2CBVA 2O5XH 1CR9H 4ELME 4OB5L 1RAMA 4Q97A 3IETB 1W1YA 2BY0A 3I85A 2DAVA 4EUPH 2BDNL 3O45B 4OLVL 4I9WE 1BQHG 2WO2A 1K8DA 1GOWA 3NIGF 4MJ5A 3CVIH 3C8HA 3UG5A 4KGJA 5L2JB 2UY5A 1F8TL 4YHMH 4EDXB 4ZQKB 4U1NB 3C5ZD 4OUOA 5BS0A 1LG1A 5L7XH 1EUTA 4EQ2A 4GZ9A 1XGRA 1OP5H 2VDML 2CIPA 4ZAKD 4F9LC 1YPZE 3TV3L 4FQJL 2F53D 2A6KA 3NAAL 4YIQB 4EXPX 1D6VL 2XQBH 5ADOL 1KJ2B 3OG2A 5MERA 3CVHH 3ZO0A 4GW4B 4ODHL 2YLAA 3AXXA 4M61B 1NCWH 4ALAL 4JL2A 5IUSA 3RWCB 5IT2H 2P8MA 3QRFM 1OTUD 1S5IL 3QH3A 4PB0L 3FN0L 3VH8B 3HPNA 4OYUA 3W0WE 1E6ZA 3D2UA 4FZ8H 5DEFB 2VABA 1IC7L 1S3KH 4Z77B 4BQ2A 4P5MB 2HKHL 5DRXB 5I9QC 1SHWB 2RV9A 3VDCA 2DQFB 3IFPB 4EK7A 3H9SB 4N5EC 4OLXH 1GQJA 5EJ1B 2HJKB 3P0YL 1PAMA 1BECA 1WFNA 3BOVA 1WWCA 1ZWIB 3ILPB 2WMIB 1WK0A 3W11C 4EN3D 1LO0L 1CBVH 3QUXB 1MLCA 1PEWA 3P11H 4U1GB 3MJ9H 4RWYL 1VFBA 1YYMH 4YNYA 5F6IB 1AGBA 3BUYA 1NEZG 4FQ1H 4QHLB 2MWCA 3QFDB 1YYLH 2XZAH 3MCLH 3IGAA 3ARFA 5E6ID 2PQSA 3EYQD 2FJFA 4IISA 1QRKA 3O6AA 1SJXA 6FABL 3WKMH 2SEBB 2DCJA 2CRIA 4D6GA 4HG4K 5JIWA 5C6TH 1QFWL 3IDUA 1S5HB 1MVFA 1T7WA 4NKOB 1QQDA 4RDQF 1HXYA 1P2CA 2NZ9D 1XF2B 1CTNA 1DN0B 2VDQL 1YMHB 5HDRA 3VFSA 3AQUA 2CD0A 5KEZA 1P7KB 4YDIL 4MJ4A 1XAUA 2XVNA 5CGTA 3O3DB 5E2TL 5C07B 3B8YA 4XUOA 3CPLA 1HXJA 3BJLA 4HQQL 2G8ZA 1J1OL 3GH5A 4X80L 1OOAA 2D7TH 2YD1A 3RI5F 3MLWL 3UC0H 4PJFA 4OGZA 5E1AA 1H3GA 3THCA 1ZEAL 4AY0A 1UXZA 2QV4A 1BZ9B 1KGCD 1V7ML 3L3DA 5B3NA 2BFGA 4W93A 3OX8A 1A7OL 5A6BA 4GINA 5IB2A 4JLRA 1A6WL 3DSFH 5IG7B 3LPFA 4N0UA 2WZPD 3BI9X 5A2LH 2EPNA 5L8JB 3U57A 2PO6A 1S78D 3PWUB 3OGSA 3L5JA 2F54E 3WF1A 3J8F7 2QSVA 4PRPE 3VI4F 1GONA 1A7PH 1MJ8L 4WDIA 1LDPL 5CD5C 4JR9L 5FYJH 5E2VH 1LMKA 3VM5A 4MCZA 1NPUA 2GJ6A 1V0MA 3L3KB 4XHJC 3S35X 1JF1B 5H94A 1Z2KA 2EO1A 3IYLW 1CT8B 2ERJB 1KIRA 1JD9A 2LU4A 5EA0H 5ADPL 4Z2IA 5LCVH 4RIRB 4TN9A 1WB0A 4OUUB 3VOCA 1MWAH 2NR6D 2P5EB 1YEFL 5JBFA 2YBUA 1XIWA 3GMPB 3QDJB 5TH2A 2HN7A 1JRHL 1CDIA 1UKOA 3UMTA 5C0CA 1T03L 2VQTA 4HT1H 4S10A 2KBGA 2R69L 2GK1A 4CAGA 5IJRA 2AERT 2B8OT 4KJYA 4XVJL 5EO9B 1QNZL 3JV6A 3EJZD 1Z6JT 4ZOCA 3ES6A 4LCIH 3N1PC 4ENED 5FFLA 2WWKT 4P8XA 3L5XH 2EZ0C 5FGCB 1ZS8B 2AJVH 3MYJB 3VFVA 3OKYA 1U92B 1UA6H 4QXGL 4I0PD 3EW3B 1QNSA 5E5UB 2F58L 1EVUA 1ZLVH 1BF2A 3TA3B 3L4ZA 1TVNA 4PLOB 3BMVA 1H1NA 5HY9A 3ZSTA 3T0EC 4GRWH 2IMNA 5C92A 1JNEA 1CL7I 3VFNA 2P24B 1F4YH 1XF4A 2AQ1A 4M7ZB 4PFEA 4WHYH 1IAII 1CLVA 3HTLX 5BCAA 3CFCL 1KV3A 3H3PL 1FFOB 4WTWA 1MQKL 3P9LB 4HS6B 2A9ML 3B43A 2IWGA 3DV4A 5KZCD 3V4PH 4Y89A 5BS0E 1CWVA 4KHTL 1URLA 3E6FB 4RE2A 4NCDA 4MAUH 3ULUE 2VX5A 4RGNB 1MFUA 1KXTA 5C0GA 4M48L 3X11B 4ACYA 1UX7A 2NX5D 4LASH 3PE9A 1NCTA 2P8PA 3V79C 2NYYC 5CWSA 4H25B 4K3GA 3K4ZA 1TZGH 1C5DB 4MJID 3TO4A 1KJVB 4UT7H 3QXDB 1QFUH 1J8HD 4YBQC 5EZOL 1QA9A 1E0OB 1CLYH 1OSZB 2QQNA 1RD6A 3EO9L 5D7JC 3BKJL 5INCA 2GT9A 1TJGH 5DJXA 3GBNH 5J13C 5D1QD 4KWUA 2H1PL 4ZFGL 2ZX9A 4GXPA 2NY7H 1U3HD 2Y8KA 3OGOE 2WWCA 3V6BR 5JHDD 2YRPA 3TT3L 1CF8L 2DQCL 3LH2H 4EUPG 4Z8FL 1KJMB 4V27A 4HWZA 4LVHC 3MXWL 3PHOA 1N6UA 1FN4A 1I9EA 1IC4H 3F12A 2Q87A 4G3YH 1UOKA 5E9AA 4D8PB 1I75A 4HS3A 3EOTL 2IANA 4CD4A 4I48A 4N9OB 2UWFA 1MAKA 5DK0A 5H37H 4FQQA 1LEIB 3QIWA 1AGDA 1C92A 3BSGA 4APQA 1I1YB 5GS2H 2IC2A 3BSHA 2X05A 3IU3A 3GSOB 4AZIA 4CD7A 4K2UH 1OH4A 2Y6SD 3U0TA 4W50A 1BF8A 2EKJA 1EFXB 1TTUA 1QYGL 4ODTH 2XTJD 3BPOB 4BYHA 2ZUUA 4H26B 1UWGL 3BAEL 3W25A 5HHOA 4AEEA 5C0IA 1BX2B 1HEZB 1S7XA 4QX2A 4QHUA 1WDQA 1X4ZA 3GJFA 2R0KL 2YG0A 4PTXA 4ONFH 1RIHL 5JW3H 3S97C 2VDPL 3ZDYE 1EO8L 4HIXL 4IEFB 1FH8A 4X8XA 3VJ6A 2I07B 5JR2A 2X4QA 5L8LB 1BFOA 4KDVA 4XUYA 1B3XA 3GBDA 5JORB 1Q1JH 4PJ9D 5JXED 2DT3A 1FQ9C 1UGNA 1U8NA 4PJFE 3TOPA 1NDGB 3L4VA 5KVMC 4P59L 1G0YR 4PJDF 5DVKA 5C0BB 3V6FA 3TBVA 1Q94A 4J3XA 2VM9A 3HS0A 3DYMA 1I9JH 12E8H 2OR7A 1UWSA 5EB9A 1MXDA 4N0UE 4HC1L 3VIPA 4XXCC 1MCFA 3BVNB 5DD5L 1ZLUH 4PJAB 4PJ8A 3DO7A 3VWJB 1FVEA 3DX9A 4ZODA 3ULVD 4MXVE 2R0WH 2BBAA 1A9EB 3QFJA 1VEOA 3INUH 2GJ6E 2OK0H 1ZVYA 4JFOB 4JAWA 3CLEH 3O4LB 3ZDXE 1OPGL 4EQ3A 1B2WH 4CCDA 3FT2B 3MV7D 4MLSA 4ZFZA 4F66A 4E5XB 2E6JA 2A9NL 2XG9A 1B6DA 1L7TH 3EJYD 3QT2A 3QUXC 5CBAA 5IW6B 2FGWL 3CXHK 2JF6A 2UZIL 2VLME 4PRDB 3WIFB 4YWGH 4U1GC 1UM5H 1B3VA 4HCRH 3OTTA 2DIEA 4RA0C 1FO0A 1GZPB 5CEZD 3ECBA 3DBXA 1KEXA 3HNVL 3DI2B 3HC0A 5C0CE 3V52H 1IGMH 3FOLB 5CD3B 4Y2OA 1HQRA 1BVLA 3AOFA 2P5WA 1RK1A 3QXAA 2WAHA 1OM3L 2ZP0T 3FN9A 3O41A 4G8FA 4NQVB 2X4TB 1QPXA 4IJ3B 3ETPA 2X1OA 3NIDE 3GBMH 3GO1L 4IDJL 5ESAA 3MX0A 1GGCL 3OHXA 4ZUVA 2DBLL 1XYZA 3UXFA 3FB7B 4P8UA 1AGCA 2XICA 3LN4A 3E6HB 4L5FH 1LE5A 5DD6B 3RIFF 3ZKMD 1A6UH 1QLEL 4OIIH 1T7ZA 1H5BA 2QQKH 3SDCC 3VXOA 4A3YA 1P6FA 1CIUA 3S37X 4CN1A 4L3EB 4XNMB 1A14L 3JWOC 1JN6A 2WSPA 2WCGA 4JAMA 3WD4A 1AC6A 4PJXF 1A3HA 3QO0B 4HKZB 1CQKA 1I7ZB 3SCMB 3FB8B 43C9A 3LIZH 1Q38A 1LO3H 1IGCH 3ZYOA 3BAXA 5T3XH 3B2UD 1ZANH 4QXUL 2F74B 3B2VH 4ORZC 1N5YL 2EKSA 1U9KA 3GSUB 1QO3B 3FO0H 3DECA 3PNWA 4CADA 2VURA 4G8EB 2R0LH 4ELMF 1F3DJ 4PRNB 3WN5A 3VFRA 5MHSE 4UOQA 2XRAL 5I1DB 3SKVA 2NSXA 4JN1L 5D1XD 5JDSB 2RCSL 5C0EB 1UEMA 2B39A 1OTSC 1M4KA 4L9LA 1CICA 1FE8H 3ARUA 2ZSVB 2FCBA 4NRZB 3OAUL 2HP4A 5E94A 1GU3A 2ERJC 1YEDA 2JFEX 3PGFL 3ZO9A 2DWEA 4XC3L 1W9TA 4FMFA 1MJUH 3ACGA 5CXPA 3CLFL 2CR3A 2ZX7A 3TPUA 3LN9A 4UT6L 3AHZA 4FK9A 3V8OA 1XH3B 2IPKB 3PGCA 2XY1A 4GIAA 5EIIA 1YPZF 4MHHI 2IXUA 1AJ7H 3STLA 4Y19B 5GGUB 5I23A 1KC5H 5ERWB 5C0JA 3MV8E 3QP3A 4JPKH 3EMCA 3ULUL 1KXVA 3ACHA 1KYOK 1YQVL 4Q6YA 4EI6A 1VSCA 1YMMD 2FHFA 3KPNB 2IANE 5DT5A 2ZPKL 2JIWA 1N6QH 2HT3C 3GXFA 1XT5A 2DLTA 2OSLA 2PI6A 5GSVB 3NOIA 4WI3A 4MS8D 3VXMA 2HYMA 5FO7A 2GK0B 5I76A 1G5AA 5IEKA 1IEBB 3W53A 3CX5J 5D70H 4L4TB 2FIRT 1U3ZA 1IM9B 4JN2A 3AXHA 3WL1A 3I6LD 3NTCL 2WAGA 5D9SB 4Y2DA 3MSDA 3B9VA 5E2JA 4EVNB 5H8DA 3TA3C 4EDWL 5HHOE 5FUZL 1RY7B 2PETA 4POYA 1W0WB 1JXJA 5KSAA 5M95B 1YJDC 4PP2A 4MA7L 2HT2D 4OCWH 4BQBA 4G6FB 4M7KH 5I66B 4OD2A 4FQCH 3VIFA 4S1SL 2XVPA 4X6DA 1MREL 1OQOA 4K23L 4HUKB 1G6RA 5ICYB 2GFBA 3AB0B 1FDLL 3GMNA 3T4YB 2VXTH 4FQIL 2H3NA 1QSFD 4OGXL 1CGSH 4K3DH 1BFNA 4AG4A 2AXFB 1CFTB 3H0TA 5KJRL 1U58A 1AMYA 1PX4A 4K3EH 3VA6A 2NT0A 5D9MA 1BYAA 1Q9WA 2IPUG 4OM1H 4RGNC 4WFED 3GI9H 5J0BA 3LSOA 3QXUA 3WBAA 5EBLA 1V6YA 1A1MA 4U1HA 4QTHB 2B4CC 4LSSH 3E3QE 1IILE 2YC1A 5I1IL 3K2MC 3GTNA 1VBUA 4P4RA 2J1RA 4HKXB 4UOW0 1NP2A 2WINA 4M1DH 4O9HH 3ZYZA 4Z2KA 1IARB 5GGSB 4M4PA 3VGAB 2V5CA 1J0ZA 4JM2B 4DWSA 5I8EB 6CGTA 1ULPA 2YD3A 3AHYA 4WU5A 4PTVA 1B3WA 1A9BB 3QFJE 1NQBA 2BFVH 2VDOH 3QZWB 1FGVH 5DTFA 1BAFL 1JF6A 2IG2L 4AXNA 5EUOA 1W9UA 5KOMC 1JZ7A 2AJYL 4LL9A 4XMPL 32C2B 3VWKD 5IMMA 3ZKQD 1JG9A 2CESA 2ESVD 2DDXA 4YDKH 1S9XA 3MMWA 4XWGL 4Z7VA 1E6OL 4GKLA 3T77A 1GGIL 2QSCL 1W1VA 1SEQL 4YR6A 1V0NA 4OCNC 4P2OB 1F45A 3OR7B 2XZZA 2Z0BA 1M01A 1XH0A 3VM7A 3PN8A 2PBOA 2P5WE 1FSKB 3C08L 3D39B 3WUGA 4HUMB 1UENA 3NFSH 1FP5A 2Y8VA 4UV4H 4L8BA 1QI0A 4JZJC 1WIOA 2CPUA 5D9OA 3HLAB 5EOCJ 3TTOA 3QDGA 2CDEA 4PLKD 5E8OA 3VFPA 4NQDA 4MAYA 3O6KH 3TN0A 4ZS7L 5IVNA 1YHTA 5MP6L 1MRFH 1FNAA 3BKCL 3CSYB 2OR8A 3VDHA 5FB8B 7TAAA 4HZAA 3GUTB 1EZVX 1RQ5A 4IOSD 4TSBL 1NUDA 3CXDH 5FUOH 2VJXA 3QI9B 1CXLA 4M43H 5BRZD 4KMLB 2C1PB 4HOXA 4AJ0A 2OTWB 3MLUH 3A21A 5FDYA 1G7LA 1NKOA 2BSRA 3IDIB 2ICWA 5T5FH 2Q76B 4UU9A 1G7IA 3VWJC 3OF6D 3RNQB 1GOQA 1JV5B 5HGAA 3V7AG 4B3KA 1CDHA 1VKXA 2DT0A 1HKLH 3HI5L 2Z4FA 2JB6B 4PQQA 3VIIA 2R9HD 1KLFA 2A3AA 2FBJH 1FFQA 2QADD 3C6LB 2Y7QB 2I60L 3A6CH 5L2KB 3WFBH 1NX9A 5EPMA 1ZA6A 3OKKB 2PXYA 3PWPD 4XXDB 1CFNA 3VX1A 1KCUH 2M26A 5A2BA 1FJ1B 2CUMA 5L6YH 3AIVA 4PJBA 1MY5A 4HPOL 1OB1B 4HK0A 2XA8H 3FT3A 4O4YL 1JFHA 3UTTB 2X09A 1E1FA 2J7EA 5J3HC 5FAAA 1V02E 2CMRL 1EMTH 2YEZA 2CKBA 3I2KA 5J1AA 3NCOA 3MRDA 4KXZH 3MRNB 3OKNB 2R2BB 3FQRB 3KR3L 1UM6H 3MRFA 4LARL 5EU4B 4X99A 3E8UH 1AXTH 1D9KB 1XGYL 1G7JA 4IRJA 1YC7A 2FRGP 5A6MA 5CIPH 3OKMA 5HGDA 2YD4A 1N4XL 4LPYA 4IJ3C 4NKIH 5SWSA 4LOUD 1WLHA 5SWZB 3SDDD 1Q8MA 2DQEL 4RFOL 2C7UA 3B5TA 1Y0LB 1MPAL 3VXME 5MEQB 5JQ6H 5KSUA 2J79A 1KOAA 2YDSA 3ZHDA 2R4SL 4JREB 3I2CH 2E40A 2QQNL 4J6RL 3D6GA 2FX7H 4M7LL 5KANG 2VXUH 3QEHB 4MWFB 2RHEA 3CC5B 1UQZA 1FRGL 3IDNB 5LGHH 4Y4HB 1FHGA 3RWGA 5JLZB 2OP4H 3HAEA 2LQRA 5DHVA 4JKPH 4NO2B 1S7TA 5C8JA 4UFIA 3VD5A 4RX4A 1FYTD 1TJHH 2WKGA 4X6DE 3MQIA 4RN5A 3GNRA 4R4NC 3BHBA 2VNCA 4ETYA 3LD8B 4HFUL 1R85A 4G8GA 2H8PB 3C5SB 2JJUA 5IHUH 4RL3A 3TBWA 3SOBH 3HA0A 4KK9D 2J4WL 2LV4A 5D5MA 1RZ8A 2YD8A 1EO5A 4KPHH 2CYGA 5E2UL 4MJ6A 4NJAL 3VXPA 3IF1B 5F88B 1WFTA 3D1MC 4M29A 4QRUA 2J78A 2XVLA 2HJLA 1QPPA 4FABH 2VKXA 4PF1A 2NY6B 5DQJA 4RAUB 1VACA 3ORJA 1QG3A 4MNGA 1EA9C 5DJ8A 5DHYB 3SDAB 3AISA 1JYWA 3QRGH 1LK3H 5ENWA 2Y6JA 2Y25A 4WSJA 3RU8L 1S7SB 1ZHBB 2BVPB 3ARGD 4JFPB 3AYSA 2R15A 4LIQE 4PLJC 1NCDH 4PB9L 4TUFA 4UQ2A 3RUGB 1NCBL 2ZCKL 3L4XA 1I8IA 4Z5RB 3EOAA 1V3LA 4JFQA 2WB5A 3UJIL 2QQQA 4IMKC 5KSBA 3IJHB 1JFQH 2DJUA 2GEEA 1ETZB 1B0GB 4GAYA 4OLUH 2XN9D 2Z8VC 1NCCL 4KQ3H 1TG7A 1E6SM 1UD8A 1JNNL 1YA5A 1S9VB 5DDHB 4NUGH 4MDJB 3LOWA 5I8CA 1V7NL 2EC9T 1U6AH 1C91A 5F72S 4Z7VE 5HHPA 1AE6L 1F13A 2IEPA 2DQIH 4RZCA 1CGYA 4PJGA 5SWQB 5ILTL 4YHNB 1XCTB 1V3KA 1Q0YH 5JPMA 2F8QA 1DANU 1WFOA 5GIRA 3T4AB 2J8UB 3OKEB 1GOKA 4P7NA 3V2AR 1JYNA 4PGDA 5FM8A 3TYFA 1P8JA 4K9EL 3KPSA 5HYJB 5I0ZA 4OB5H 1FC2D 3S7GA 1FG2A 3PZOA 2BDNH 1I1AD 1S8DA 4OLVH 3QDGE 3D2UD 3TGXA 1ISYA 1UD6A 4YPGB 2OYPA 3CFEA 2YBRA 5D6CA 3AB0C 4RMSA 4NQDE 4Z7WF 4DK3A 1F8TH 2K7PA 1J01A 1H8OA 1TITA 1RZGA 3K0WA 5B38A 3X13A 4JY5L 1FO0L 2CDFA 2WQRA 4TRPL 2HRPL 4NI3A 2VDMH 2D0HA 3TV3H 3UPAA 1DVFD 4FQJH 3NIDF 3NAAH 1E15A 1D6VH 2OZ4A 5ADOH 2VC2L 2IXVA 4CGTA 5DURB 3AXIA 2I27N 2A83A 3FZUC 4P57B 5ETUA 4ODHH 1QLFA 3UROR 5ACMA 3RGVD 1KNOA 2X8RA 4ALAH 1RJLB 1RUKL 2AEWA 1BD2A 4GI9A 1S5IH 2XI9A 4PB0H 3FN0H 4TYUA 4WSKA 4JM2C 3OXRB 1N59B 5CJQL 2YPLA 1KXQA 5L88L 3FT4A 2DBJA 1IC7H 2WWMD 3QUYB 4KROD 2HKHH 5T5NG 3WDPP 2E0PA 2Q8AL 1VERA 2WHJA 3QOKA 4JFED 5TPWL 3FTGB 1FOBA 1EPFA 3P0YH 3CUPA 4JGUA 3MCKB 3N50A 4RRPA 5DRNB 3U6RB 4WUUD 4AMKL 3PZIA 3G04B 5FO8A 2X40A 1BJ8A 5GS2D 5FYKD 4PJBE 4QXTA 1LO0H 1J1PL 2ARJB 4FNLL 2ZIDA 5DQ9A 3TT1L 4RWYH 1W2VA 3TCXA 5IMLA 1UWXK 3BDYL 1MUJB 1G1CA 2ZXQA 2CITA 1LK2A 4P2OC 3N13A 3KPPA 4GG8A 3SN6N 3WDRA 1FSKC 4KRPB 4MYWB 1HI6A 3MMDA 6FABH 4P5TB 4EI5B 3RKPA 4WWKB 3SGDI 5FL1A 4XVUD 5SWSE 2XWEA 2VLKD 1B88A 5FO9A 1QFWH 1T20B 3N85L 1EFQA 3EJJX 5FA3B 2PYEA 4JFYA 2D7OA 4S2SB 3MRLA 3SCUA 2R1WB 4PG9B 3RKDC 4YDIH 5FYLD 2YRLA 4KKBC 3HJEA 4JVUA 5E2TH 4HK3J 3QUKA 5HVFB 3T0EA 4C56B 4PREB 3STBA 3KE0A 3WD1A 2I9TA 4HQQH 4I4WA 1MH5B 1J1OH 3ZE0E 4NRRA 4X80H 3G08A 3N9KA 4DK6A 4MX7A 3MLWH 5IMKA 4M1GL 4XX1G 3QI9C 3II1A 1ZEAH 4KMQA 3POHA 5C7GA 2IBGA 1V7MH 3GGWB 5C08D 3JXSA 3UESA 3ARXA 1A7OH 2IQAB 4QCIB 1CFQB 4U6HB 1GOFA 1A6WH 3L4YA 4G8GE 4L1DA 4MNQD 2DQJL 4AZ5A 3HZVA 4YHKL 1BFVL 4JFXA 5D5ME 1SDDB 4LFHD 2NT1A 1AXSB 3UTZA 3K3QA 1WZMA 1MJ8H 4JY6A 1LDPH 3WMSA 2V5TA 4JR9H 1JDCA 2XYLA 5T3ZE 4NQED 1S9YA 5HI5D 5BVJB 3FQTB 1ZJAA 1LD9A 3WO4B 3DXAA 3FB5B 4I5BA 2B0SL 3LKOB 1X4XA 5I77A 4LKXA 1DDHB 4JDVA 2A74B 1XCQA 4MNGE 4LYRA 4OGAC 4PRHB 3TBSB 3STZA 5ADPH 5C2BL 2EDKA 4TUOA 1A22B 5CEYB 5TE6L 5CLTA 3VGHA 4HLZG 4YHOL 1G6RL 5KS9A 1S7UA 3VFTA 5I1HL 1YEFH 5ESQA 6A3HA 1JL8A 1B3YA 5JIIA 4FXKA 4KC3B 3IFOA 1MHEB 4TUJB 4ACZA 1JRHH 2EIEA 3C6SA 1IFHL 4GKOA 2OTUB 5EO1B 1WF5A 1T03H 1SEBB 1LWHA 2J7CA 1D9KC 1SJEA 2R69H 4PPTA 3MRGB 3IDMB 3AMDA 4XVJH 4XGZA 1QNZH 5E6YA 3M45A 3PL6A 4Q74A 2F53B 1OGAA 5BXPA 1RURL 3OKLB 1AQKL 4H88L 4Y4FD 1FVDA 1VJSA 3GSNB 4DKEH 4TNWF 4PJGE 1A1OA 3BN6A 4Y8AA 5I79A 4OSUH 4QXGH 4GAGL 2J6EA 4DGIL 3IETA 4LHJB 1NMAL 4YGVB 5TDOB 3VXUA 5SX5K 2F58H 5DUML 3O45A 2R1XB 2EPLX 1SJHB 5IBLD 1CVSC 1E5NA 3KPSE 4Y4HC 4LIQL 3RJQB 1P1ZA 2CCRA 1D5BA 5L2JA 4LVEA 1FNLA 5JBEA 4EDXA 4ZQKA 4AQ1B 2AK1L 3DVIA 3U2SB 4NT6B 5FK9B 2C4XA 1WAAE 1IAIM 3CFCH 3H3PH 4W8JA 1H11A 1MQKH 1MY7A 3B5GA 4NNYB 4R6UA 4P7RA 3GH7A 3CU7A 4NGHL 1ERNA 1Z9LA 1U93B 2BX5A 3K8MA 4Y4KD 2RGMA 1U8KB 5F7EL 3RWFB 2LS6A 2VN4A 3DARA 3KPLA 4NYLB 4PRWA 4P08A 4KHTH 4CKVX 5I75B 5EO0B 1VEMA 4OZIA 1T2QL 2CO6B 4M61A 3ZIZA 4M48H 3RWCA 3TM6A 5E2WL 4KKLC 4NPYA 3VH8A 4F9DA 1BPVA 4GH7B 5I24A 1U0QA 3CMGA 1E1EA 5EOQL 1BD2E 5LVEA 4NSKB 4P5MA 4RMTA 5DRXA 5EZOH 3CNKA 3SDAC 2FEEL 3N1FC 2DQFA 3IFPA 1LWJA 4X98B 3H9SA 3EO9H 3BKJH 2YPLE 2YXMA 1K8IB 1MFAL 1KXQE 3FHAA 2XWTB 2H1PH 4ZFGH 1ZWIA 1YN7B 4BS0A 3ILPA 2ORZA 2WMIA 3TFKC 2NXZD 5E70A 3QUXA 2WMJA 3TT3H 1CF8H 2DQCH 1HP4A 1XR8B 1ULVA 2IFFL 3K2UL 4J4PD 4Z8FH 2COQA 4R0LB 3MXWH 3RDTA 4LBEB 3EOTH 1P6AB 3V6OE 4Z0BL 4X7TA 1RJYA 4MSWB 4XUTA 1Q0XL 3OR6A 4M7JL 3DYPA 4XAKD 1RZJL 1BYDA 4G8IB 3HE6D 2SEBA 3DETC 2RB8A 2MHAB 1B30A 2EDFA 2DLHA 1C16B 1GAFL 4FTVD 5DMGD 1TQCB 3RIKA 2ZUVA 1F11B 4NKOA 3IJ8A 3MNZA 2J1SA 1PIFA 4LU5L 1L0PA 1XF2A 2VI0A 1GORA 1QYGH 1LDSA 5BRQA 4XHQA 4H2CA 1UWGH 3NCMA 4CL7A 4WNQB 1XSIA 2PYEE 3O3DA 5C07A 3SCTA 4RYDA 3BP7A 3FQXB 3SDCA 2R0KH 2J7GA 4IOIB 1EXUB 1RIHH 4MNHB 4FLRA 4BFBD 4LVNB 5G04L 2VDPH 1EO8H 4HIXH 5GJSL 4PLNC 4N5UA 2J7MA 2GQHA 4CRPA 3H9HA 2DWDB 4M9PA 5GQBA 4GQ9L 1BZ9A 1FV1B 1ZBCA 2CKBL 2HMID 5I73B 4PMDA 1ZL1A 4OFVA 1KPUB 5LGJB 5IG7A 4HUWA 1LF1A 3BO8B 4P59H 1HT6A 4NZUL 2XSAA 2PTUA 4QWWC 3K74B 4S11A 2FX8L 2Y5TA 4LGRB 1I1FA 3OSKA 2F2HA 3W4RA 4HC1H 4WK9A 4JHBA 5EN2A 1BGXL 3CUIA 3LEXA 3SKMB 2Q1EA 3AGVA 5DD5H 5EIQA 2BY3A 1AR1D 4A42A 1KJ3L 3WCYA 2PKDA 3GB7A 1UKQA 4QDMA 3CZLA 4JFWA 4KI5C 3QULB 3AIRA 2OS7A 3QR3A 2V2WB 5IB3B 4RIRA 1OPGH 1PQZB 3DXAE 4M03A 4X6DF 1SVZA 5K59E 1W72B 2DJ4A 2A9NH 2W1UA 3QDJA 4XVTL 4J12A 5IHSA 2FGWH 2UZIH 5HHNB 3CH9A 3U5UA 1O7SA 2B5IB 1ZTXL 2E7HA 4GMSL 4PP1D 5KS9E 5ISZD 2DQTL 2YB7A 1KCKA 4YFLI 2IF7A 3B9EA 3KS0J 2VB5A 3QDHA 4KUZL 5IWLA 5EO9A 3B9KD 3IDJB 4F8QA 3HNVH 1CE6B 5IFHL 4X0KB 4U0RB 4KRPC 4OD3L 1GNYA 5A8QA 4ZUWB 4P5TC 3L5WB 4WV1A 4EI5C 5DLML 4WWKC 4BUHA 1ZS8A 1OGAE 3KGRA 5T3ZL 1OM3H 4LCWB 5KVDL 4YPJA 2NX5B 1U92A 5D8WA 1P69B 3GO1H 4IDJH 4J3UA 1GGCH 1TNMA 4XUQA 2DBLH 4DOHE 4QYOA 4M93B 1UG6A 2GIYA 4U1KB 3TA3A 2EDWA 1X3DA 4BQ6A 2PNDA 1QLEH 3VXUE 2Z8SA 1IAKB 5J6GB 4TNVK 4BELD 1OGSA 2OSXA 4OLWL 4LRIA 1FFOA 4XWOC 1U3HB 3P9LA 1ZHKB 4HS6A 3WHE1 5JHDB 1A14H 4AT6B 2FATL 4S1DD 1JZ4A 2JE8A 4ZXOA 4X5WB 3EO0A 1Z0MA 4ZUUB 1O7AA 3E6FA 2OJEB 1E6XM 1CDBA 1U8QB 4A2LA 5I1AA 3AVEA 5JNYB 4QXUH 4B3LA 4HX1B 1U8IB 1N5YH 2N7AA 3LMJL 5HPOA 1NGXB 4OZIE 4ZE5A 3ZR6A 3P4NA 3CZGA 4H25A 1PGRB 3KYNB 2L9LA 2XRAH 4JN1H 4U1JB 1KCSL 2RCSH 3DROB 5HTSA 3WO4C 3MGAA 3MRQA 1OSZA 3GXDA 2GSGB 1HIML 3W38A 3OAUH 3BAJA 1R5WB 1T5XB 1DQJB 3PGFH 3E2HB 4XC3H 4HMEA 1JHTA 3N18A 4JY4B 3RX7A 4XCYA 4QRRD 3CLFH 4OUEA 3H9SE 4PGCB 2NXYD 4UT6H 1GGBL 2XWBB 4OJYA 4OKVA 1DL7L 4RE3A 3CZUA 1J83A 1CZVA 5BW7C 3UAJD 3N9GL 3C5ZC 4D8PA 3NN8B 2QMJA 3B4NA 3PBGA 3MBED 1UG9A 5HDQL 1LEIA 2Y6HA 1NC4B 1EXPA 4ZAKC 4QHMB 2L7JA 4GXUN 4UIMB 2V2XB 1YQVH 4I2XB 4XB8A 3QIBD 1OHQA 1WBZB 3UEZA 1I1YA 2OZ4L 2DI9A 1MAJA 3GSOA 4N0RA 4PV8B 5M7QA 2ZPKH 2UVEA 2ED7A 4W5ZA 5EWIL 2D3LA 1OT2A 1EFXA 3DIFA 2BZDA 1XGTA 3P4OB 1HKJA 4WO4A 1OTUC 4H26A 5ALCL 3NTCH 4JZJA 2BRRL 1BX2A 1OP5K 4WU7B 5J11B 2DSWA 2X89A 5EZIL 1ZOXA 3EOBB 4F37F 4EDWH 5HYEA 5FUZH 1QBAA 1NC2D 5C07E 4P7OA 4MA7H 2WUHA 4QB6A 3MACL 1MCWM 5JORA 4S1SH 4IHOB 1DR9A 1MREH 2D7QA 4EN3C 4K23H 1N0LA 4O58L 1FDLH 1OSPL 4TOYL 4FQIH 1WV7T 4OGXH 5IROC 1BG4A 5C0BA 3VFWA 1YEJL 5I75C 5KJRH 1NFDA 5DS8A 1JF5A 2EBNA 4P5YA 3P6BA 5E6IC 2J1KA 3BVNA 5I1CL 4QB1A 1Y7VA 3CSPA 2WMPA 1E43A 4PJAA 1TZ7A 3VWJA 5I1IH 4LLVB 1WC7B 1A6AB 2GK2A 2WM0A 3WMCA 3C2AL 2J1TA 4AISA 4NQTA 5E0CA 3B6SB 2IQ9L 1INDL 1MCDA 1NGQH 4OLZL 3W9EB 4L8DA 3O4LA 2LAGB 5EIVA 3U48A 2EICA 4P0DA 4F33B 4AD1A 1TVBA 1FHDA 2ED9A 3LKRB 4E5XA 3S35L 2XTKA 5CPQA 3MNWB 3WIFA 4PRDA 4XBGB 1T0PB 4R0LC 1BAFH 2IG2H 3G5ZA 3DWTA 3BN9D 4LSUL 4EEEA 1HJSA 1XF1A 3QDJE 2QQOA 1GZPA 1JWSB 4TXEA 2AJYH 4XMPH 1H0GA 1UQSB 4QDRA 2YDRA 3W5MA 3TN0D 1FH5L 4U31A 2XQYG 1QVOB 3T65B 4N8VG 4XWGH 1E6OH 1FPTL 3FFDB 3FOLA 5CD3A 1G7QB 1GGIH 2QSCH 1U2CA 1SEQH 1TETL 2Z31B 5GRVL 3EO1B 2MANA 1O5DT 4NQVA 4E42B 1S78C 2WO3A 1HXMA 3WD0A 1DWHM 3AS1A 4WUKL 4X6BA 4D94A 2OLHA 1C5CL 4PTWA 3C08H 5FGCE 1BVZA 3LRSB 3FB7A 2JALA 3VXSB 5D1XB 5GZND 3E6HA 2CKRA 4Z7OE 4N90E 5DD6A 2P45B 4JO3L 4QF1B 4MD5B 4ACPA 1HYSD 4LDOB 4LVNC 2LTQB 4XNMA 3UBXI 3SEEA 4HGMA 2F19L 1I7UB 4KI5M 1JBJA 2BMKB 3F58L 4ZS7H 2NR6C 5LA0A 3VUPA 3SEPA 1NLDL 3LVEA 4GRLD 5MP6H 4JRXB 3QO1B 3FB8A 5I73C 4BSWB 5I17A 4TSBH 4X5XB 2F74A 5CZXD 5DJ2A 2FR4B 1QRND 1K45A 4H1LB 4DEQA 4ZXLA 4AZGA 1AGFA 3Q6FA 1ACZA 5EB8A 2GITB 3EJZC 3LQAC 1UA3A 1YMMB 2ZUMA 1MJ7L 4ENEC 4Y16B 5JDSA 4WWID 1XSJA 5C0EA 3AFBA 4HG4J 1W8OA 4HS8L 3QUZD 3O6FB 5C0ND 3HI5H 2ZSVA 4FG6D 4GBXD 2J6EL 2DOCA 2QBWA 3TCLB 1F3JB 3DGGA 2I60H 3L7FA 1WAAF 5DFAA 3QEQA 3P30L 2QLYA 5FDWA 1F90L 1XD1A 5I19L 4RMRA 1XH3A 1ZKAA 1BQLL 4DKAA 2DSZA 2B5IC 4HPOH 4Y19A 4LKSA 3GIZL 3LKPB 4MD0A 4O4YH 2OQJA 5ERWA 3SGKC 2EDBA 4AAXA 4IMKA 3BRGC 3RCNA 3OZOA 3HZYB 2J1UA 2CMRH 4XP1L 5EUKB 1BIIA 3KPNA 3NFPA 4U0RC 4LYPA 5LA1A 4LHUG 5J1TC 1IQDB 4JCLA 4LARH 3KR3H 5A69A 3CFKB 1XGYH 5GSVA 2OL3L 1CG9B 2GK0A 3ZTJG 5GISL 1N4XH 1IEBA 4L4TA 1JWMB 4UQBA 1JU3A 1B0WA 2DQEH 4RFOH 4JRYD 2D22A 1MPAH 4M93C 4M6NL 1HE7A 4TUKL 5HYQB 4EVNA 1ADQA 3TIEB 2FECI 2R4SH 5TF1L 5IB1B 3L3JA 1X5HA 2VQUA 2QQNH 4J6RH 4ERSL 1W0WA 3MUGB 3ULSB 3ZE1E 3ZHKA 1G7HA 1KIPB 4M7LH 3GGLA 2JK5B 3MNVB 3DJ9A 3QXWA 5C09A 1FRGH 3U9PL 4LSQH 1U3HC 2CHNA 1HQ4A 2EECA 5ICYA 2IH1B 5A8NA 3LPPA 4W7VA 4LLDB 5F1IB 1QW8A 2V2TB 3CHFA 2FYYA 2AXFA 4N5ED 3REVB 3JUYA 3RWEB 2HVJB 3I6KA 3LKNB 4HFUH 3VWKB 1DLCA 3GMRB 4O5LL 2PN5A 4OF7A 3W11D 5C0BE 2UY7A 3IDXL 5GS0D 2VCBA 2EE6A 3LDBB 2XWJA 4FRWA 2J4WH 5JPNB 1NFDE 5IR1A 2DYPB 5TDPA 4I8DA 4P4KB 5EJZB 2V7NA 3KL3A 2Y6SC 5E2UH 1J84A 4I77L 2XIIA 4QRPD 1MIEL 3FO2B 4HKXA 4NJAH 2IMMA 1B6UA 4BK4A 4KVCL 3OL2A 4PJAE 3SQBA 4BZ1L 4O00A 5EZLA 1NLBL 1BZ7A 4JM2A 5I8EA 4BZYA 3E2HC 1DLHB 1ZLSL 3P1IA 3WIHA 3GJFH 1ZLWK 3W37A 4KJPD 4AQOA 3O4LE 4QOKB 3QZWA 1MIML 3RU8H 2NNAA 2V4VA 2MCG1 3RO8A 3ZMRA 1L6XA 3MROA 5DC4B 1IT0A 1NCBH 2ZCKH 32C2A 3C60B 2W94A 1J12A 4W8BA 5D2NB 3UJIH 4Y7MA 3GFUA 1MELA 3LEYL 2HLFD 5IKCB 1NCCH 2W38A 3MRCB 3UEQA 3RVTD 1JNNH 4R2GD 1UB6B 4J1UB 5BRZB 4P2OA 2QQIA 1V7NH 3WIIL 2B1HL 3DOSA 2J8GA 1CZ8L 5A8PA 1AE6H 5D4QA 4UTAL 3A3HA 2WMGA 3D39A 1QI5A 5ILTH 4X4ZA 4EIZC 1HJUA 2W60B 5JO5A 2OSYA 4MGSA 1XC6A 3WUFA 4HEPG 4XPFL 4YK4B 3ULVC 1C5BL 2CDOA 3FRUB 3RTQD 5K59F 2ZG3A 2E6PA 1P4LB 4K9EH 4KDTC 1MCEA 5D2LB 1B1YA 2DLIA 1A1NA 1BD2D 5LJYH 3G9VA 2D24A 4UFHA 4AIZA 4B7IA 2XPKA 4Q2ZB 4L9DA 5KS9F 1UKSA 4TVCA 5SV4A 5EU6D 2VMCA 4TPRL 3PWPB 3MRJB 4X5LA 5MEOA 1ORQB 2XGIA 1FIEA 1XR9B 3S37L 3SY0A 5F1SA 4Q22A 3QEGL 4U4BA 1ZLUK 5FB8A 3GUTA 4OZOA 2FIKB 3QI9A 4JY5H 2UZYB 1FO0H 2Y07L 2C1PA 3QG6A 4TRPH 1YNLL 3WSUA 4ZFOB 4C83A 4KRUA 4XBPB 4NCC1 2BVQB 1M05A 2FB4L 4WFGE 5JR1L 5E5MA 1JZ8A 5BXRA 2Q76A 2M2DA 2VC2H 3ZT5A 2G3JA 1JV5A 4JHAL 1CDYA 1HH6A 2ZG2A 3AXLB 3KG5A 3O0RL 2JB6A 2NY1B 3QQ3B 1RUKH 1MCKA 5E00A 3SDDB 3UNPA 5HYSB 2VH5L 2C26A 5L2KA 2HFTA 4PBVC 5DMIL 3QNZA 3WUWB 5CFHA 2YC2A 5L88H 1MQPA 2W9EL 3ZKMC 3OKKA 4XXDA 1MHHB 3UBXB 4EAMA 2B2XL 1FJ1A 3L3HB 2Q8AH 1YJDL 2APBA 4HIJA 1Z9MA 4PV9B 5TPWH 1C93A 1TQBB 1GOGA 3QEQE 4AMKH 1Z5LA 3VRLE 1CD9B 4HA1A 5BYWA 4W6WB 5D7LD 1G7MB 1J1PH 4Y19E 4FNLH 3KPRA 3T0ED 4PRBB 4S3KA 3TT1H 1FYTB 1WUNT 2XOMA 1BAGA 3MRNA 3C9NB 1A3QA 3C2SA 3FQRA 3BDYH 1FIGL 3KXFA 5K9QI 4OZIF 5IMOB 1JI2A 1D9KA 5IFJA 5C0FB 3B2UC 3NYDA 4KKAD 4OZGB 1VRXA 4E2OA 3DHJA 5H2BB 3P4MA 1CK0L 4FQXA 3T2PA 5M17A 5SWZA 2QL1A 4LFHG 2B4CL 1JHKL 1RZ7L 5MEQA 1Y0LA 5AD0A 2A73B 1A4JB 1U91B 5D1XC 1BYBA 4P46B 4NO5B 4Q0XL 4ONOA 4L4TE 1N64L 4IDLA 2R39A 4LNVA 1C8PA 2GHWB 5ANMB 3N85H 1JCKA 3OIHA 2X4NA 1MWAB 1L0YA 2LTQC 3FFCA 3QEHA 3CC5A 3SDYL 2JTDA 4Y4HA 5JLZA 2WC3A 4D9RD 1VBRA 1RK0B 4YBQD 3CXHJ 4YHIA 4KVNL 5C09E 5K9QG 1UWUA 5D7JD 3ARGB 3OAYH 1IT9L 3OPZL 4M1GH 3EDFA 3V6ZB 1H49A 3BD4A 1OWRM 1H5VA 5A3ID 3ALFA 2XN9B 3T8XB 1FVCB 3MLSL 4ONHB 1OW0C 4U3AA 2DQJH 2YUWA 2XUCA 3BWAB 4YHKH 5I71B 4X7FC 4MS8C 4ZSOA 1BFVH 4MLIA 1QSEB 1W2KT 1ZT4B 4JKLA 2FGLA 3REWA 1UWEL 1MLBA 3LV3B 1ECEA 3MMEB 3VCLB 3D69B 5DHYA 2NY0B 2B0SH 1BTCA 4Z2JA 1S7SA 2BVPA 4JFPA 1DQLL 3W39A 2HT2C 2EEBA 4HV8B 4U3CA 5CSZA 5C2BH 4YBHA 3RUGA 1OP3H 3SJVD 4NZRL 5TE6H 5F7UA 4JCMA 3CDZB 4YHOH 1G6RH 1FZOB 5I1HH 4E4PA 3IJHA 1O0VA 4LNRB 1HJXA 1ETZA 3MLXL 1P4IL 1B0GA 4BSJA 4YHEA 1FHLA 3J7HA 1EK3A 1IFHH 4E8DA 1IQDC 1N6VA 1S9VA 3BPNB 3NCYS 1FZMB 3TNNA 3BGAA 1CGWA 2QHLA 4P2RB 4Z18A 1ES0B 2OM5A 1G0DA 1X7QA 1NSNL 1B31A 1XCTA 2CDPA 3DUSB 1RURH 1V6WA 1AQKH 4H88H 1RUML 5HJ3B 3VNYA 4WF7A 3D39E 1IQWL 1MCCA 4OFYD 3LPWA 3OKEA 3RGVB 3LKSB 5INDB 1G9ML 4GAGH 4U3HA 4DGIH 3RM8A 1NMAH 2VDKL 3BIAX 1LEKB 4XT1C 5HGHB 1TNNA 5DUMH 2ADGB 4YQXL 2EDQA 4LIQH 5DVMA 1UD3A 3QCUL 2I25N 2YC4A 1I8KB 3BH4A 4PGBB 4OI7A 3H9SD 2AK1H 2APWA 4WUUB 2WZEA 1VFFA 4PJEA 1Q9LA 4HKBB 2YXFA 5EH1A 3VWKC 5EC2B 4NGHH 1KYOJ 4UBDC 1R5IB 5F7EH 1BP3B 3LAFA 1CFVL 4PSRA 4KKNA 4P4KC 1SYVB 4P57A 1T2QH 4P9HC 1C8YA 2AAAA 3U4EB 4KTEL 4QLJA 5E2WH 1Y18A 4GPNA 3WMBA 1UA7A 4CVZB 3OXRA 1K2DA 5KVFL 4NDMB 2VLKB 5EOQH 5C0DA 3UTQB 3DMMB 2OBGA 2CBUA 4CDGC 4NN7B 4MDIA 5L2KE 4BDVB 1MFAH 4URIA 3U6RA 4MDPA 3RVVC 3BD5A 2XG5A 3SE3A 1AQDB 5GRWA 2DTSA 4KAQL 4HKJB 3C60C 1UR1A 1ISWA 3PWJA 5C07D 3UTSD 4GW5B 5D2NC 5DFWH 3IDAA 2PUQT 3RIAK 3K2UH 2IFFH 3LPOA 5TQ2L 3SCWA 1NBYB 1JVKA 5IV2B 3WL9A 2E32A 2VLRA 3TZVA 2XONA 1FL5B 2X4RB 3KPRE 2CIKB 4Z0BH 1A6PA 1Q0XH 4ATWA 2ARJQ 1K4CB 3IXTB 4AIEA 5C08B 3KXFE 4M7JH 1CENA 1EDQA 1WE5A 3M1BB 3VW3L 4GZIA 4OCRL 1RZJH 3ZYIA 4P5TA 5TGBB 5KW9L 4NBZB 3NIFF 4WWKA 1J86A 3FOMB 3TJEL 1GAFH 3S96A 2CIIB 5SWZE 4XVSL 1QLRA 4YK4C 2FLBT 5FA3A 4LU5H 3V0WL 3HE7B 2R9HC 4NQCE 4I13B 4G43A 2X70B 1KB5A 2WN2A 1FBIL 1CL7L 3QHOA 2MQCA 5BJTB 3SCSA 4C56A 4PREA 5HBFA 1IAIL 4J3VA 4TVPD 3FFCE 4GOSA 1OM0A 1MH5A 5GHWL 4G7YL 2AJXL 2CNCA 5GJSH 4JE4B 4YHLL 1Z9SA 1SY6A 5EBMB 5CILL 1XGQA 1CFSB 5ABEA 4GQ9H 1HDMB 4PJIB 3WJJC 4WI2A 4Z7UB 4H5SB 3GGWA 5ITBL 4MD4A 2P5ED 4E8CA 4W4NA 2CKBH 2IQAA 1MFBL 3T2NL 4DFHA 4U6HA 1MVUB 2RGSA 1CIYA 3S9DB 2ZEZA 2DL9A 2ATKA 1EBAA 4NZUH 3PHSA 4G6AC 3GSRA 3QAZB 3LQCA 2CERA 1E4IA 2FX8H 1H0DB 2G75B 2VISB 4OIFA 4LOUC 2CK0L 4D0CB 2NY1C 1W3KA 3SDDC 3TH4T 3V5KB 2X5PA 3ZE1F 4Y4FB 4ZSOE 1PEZA 3FONB 3SQOL 5BVJA 3FQTA 3SDXB 2HT3D 1KJ3H 2VXSL 3HR6A 3K81A 2FJGB 3FB5A 3LKOA 4G9DB 4M81A 2YKKA 3DHMA 2A74A 3SPVA 2ZXDA 4PRHA 3TBSA 4Q7NA 3PHAA 2GUYA 3SO3B 5CMAA 5CEYA 3CQOA 1DJSA 3FKUS 5KN5B 1LVEA 3HAEH 4JO2L 1BVNP 1MFCL 3T2OA 1CXFA 3NJVA 3UR7A 1BOYA 4XVTH 2G5RA 5BW7A 3RUGE 2EEAA 4OCSL 3D5OF 3CZFB 3C5ZA 2OTUA 1ZTXH 4D9QE 1SEBA 4MOAA 5D6DC 1INEL 1NFDF 1AGEB 2DQTH 2VVNA 3UZQA 3MRGA 2EEDA 3IDMA 4KUZH 4ZO9A 1PYWB 4ZAKA 1KLGB 3RWIA 4XNZB 5C9JB 5I1EL 3OEAA 5TD4A 3WKNA 1CXKA 2F53A 2XKSA 5IFHH 3EYSL 3OKLA 5B39B 1SM3L 4HA4A 4MQTB 3VG9B 5ID0A 3IVKB 4OD3H 3P40A 4P5KB 5T1DL 5DLMH 4DM1A 5T3ZH 1RIUL 4XPGL 5GS1B 4TTUA 5KVDH 2LABA 4RGND 5E24E 2IFGA 2D4DA 1MWOA 3MV9B 4MB1A 3C7GA 4OTXH 3RI5K 2R1XA 4OIAA 1SJHA 1RPQA 4QX0A 4H0GA 1H3XA 5ELIA 4M24A 1WTLA 3BIBX 1K5NA 2P7TB 4KJQC 3ARGC 4M6AA 4NT6A 3TP4A 1RZIA 4OLWH 4HBCL 4EN3A 5GRYA 2GJRA 3UJJL 2PW2A 3KPMB 2FATH 5ID1A 3RWFA 5IROA 4NYLA 4PJEE 1CE1L 1GXEA 1X44A 3RM9A 3WEXB 1E4LA 1R8LA 4F2MA 2ZEXA 5I71C 2ZEWA 2NQCA 1UZ0A 5E6IA 3D5HA 3LMJH 2Q8BL 1S7RA 1LL7A 1UZ4A 4FTVB 1KCSH 3LEKA 4L3CB 4WW1A 4NSKA 1LHZA 3I2HA 2UY4A 1JWUB 5EU5B 4D9LL 2W47A 1D7FA 2NY0C 3MLYL 4YZFF 3NZ8B 1PW3A 4V1DD 4Z76B 1HIMH 1K8IA 5IHBA 3WBEA 2GI7A 4D1JA 2HH0L 2HYXA 1YN7A 4KI5E 4WJ5B 1LEGB 2NLJA 1GGBH 3QDMD 4Z0XA 1DL7H 2KUTA 1FZKB 3GMQB 1J05A 4DXRA 1TR1A 4R0LA 2DDUA 3R1GL 3GRWA 4LBEA 4DZ8A 3N9GH 4BQCA 3BPNC 1EAPB 4MSWA 2WHMA 1SYSB 1GZJA 2FJHB 3MV11 1HH9A 4ODWB 5HDQH 5F7DB 3L3OB 1T4KB 1DVFC 2VLRE 1FORL 4G8IA 3MRIB 2OZ4H 1T21B 1YY9D 1C16A 4GLRI 3SGEH 1F11A 3GSQB 1EEZB 2H26B 3R8QA 3RGVC 4Y5VA 5K9KB 3HR5B 3GSXA 1T04B 5A8OA 4MA1B 5ALCH 1DWFM 4WNQA 1HINL 2BRRH 3UG4A 4YUEL 1L4IA 2WWMC 3FQXA 5EZIH 5HXMA 1E4NA 2DIJA 5EFFA 3U7AA 3G6JF 4MNHA 2C3GA 2XQXA 5DJYA 2BNRD 4S0SD 1S46A 1KLUA 1U8PB 4WI4A 4C56E 3BQUB 1ZA3B 2DWDA 3TA9A 4Y1AD 3MACH 1CDJA 4ZDHB 2GW5A 2JCCF 4P8VA 4O58H 1RYYA 4QDSA 1OSPH 3M8OL 1NGYB 4QT5A 4TOYH 1KPUA 4YDJB 5IQ7L 2HVKA 5HVWA 5ISZB 1YEJH 4M82A 3CIVA 3KHQA 4YGAB 2ITCB 43CAA 3OKOB 4G5ZL 5SX4H 3W26A 4NHUB 5DUBB 1JK8B 3SKMA 4OM0L 1YQ2A 1FNHA 5A6LA 1H3PL 1KPVB 1OT5A 4LKCB 4XVUC 2D7MA 3DX8B 5BV7B 1JGDA 1GUVA 2G9HA 3DMMC 3C2AH 4F3FB 5JIKA 4NN7C 4UNVA 2IQ9H 1INDH 5IB3A 1LWRA 1ZU8A 3KWWB 4OLZH 4LPTA 1PQZA 2OXGA 4W4OC 2GY5A 3S35H 1ZVSB 5HHNA 4X4XB 3U7YL 1BWMA 1FNEB 1REIA 3RNKB 3ROLB 1S7WB 5DJ6B 1RVFL 1NGZB 4L3ED 4LSUH 4LLMA 3GMOB 3SGKA 5L9DL 1TTFA 3IDJA 3U37A 3U1SL 4JQIL 2VL4A 1R3KA 2X6MA 3DUUB 1FH5H 1YY8B 4XZUG 1FPTH 2YDQA 4ZUWA 3EB7A 4P2YA 3L5WA 3SCMD 5KZ6A 1TETH 4ORGA 3UG3A 4KJWD 2F53E 3OXSB 5A6AA 3PDDA 2NX5A 3CDGB 4OQTL 4WUKH 3R0MA 4X9BA 4MPKA 3V4UL 1C5CH 5JDJA 3HE7C 3MTRA 5AC4A 4MJIA 1FP8A 1B90A 2YN3A 1H8SA 3UP1A 5FYKU 1J8HA 35C8L 4A2MA 1SHMA 5HI5C 2R4RL 4QEGA 4KV5F 4XMLL 4JO3H 1KTDB 1IAKA 4NBYB 2QF8A 4JKKA 2Q7YA 3BRFA 1MFVA 1NL0L 1US2A 3SCNA 3PUCA 4QRRB 1U3HA 1JE6A 2F19H 4I1NB 4YO0A 3BISA 2NXYB 5JHDA 1E55A 3F58H 3L4WA 1G01A 2JIXD 1NLDH 3OAZH 2C8NA 5ACZB 1V03A 5D9NA 2KPNA 2W92A 3AAZA 1N2RA 3G6AB 1DWGM 2VERN 5HGGS 4GXUM 5AY7A 4NF7A 5A94A 1U8QA 3LKQB 3KDMB 3U0WL 4M3KB 1FFNB 2E9BA 1DE4B 3QAZC 4DCQB 1T3FB 5EDXA 4FF5A 2X0YA 1U8IA 1F97A 4W5UA 1NGXA 4BQ8A 5LKNA 5LWYL 3QIBB 1ZBVA 5C0RL 1JPFB 4HDIB 4NO3B 1MJ7H 4Y4FC 5GRUL 2AKRB 5CBEB 4I3GA 1ZT1A 4X6CA 4HS8H 1KR0A 5FOBB 1U8MA 4GWJA 2GSGA 4OD1L 2J6EH 5E4EB 3DGCR 1DQJA 3WD2A 2YWZA 1IM9D 1EEYB 2CGRL 5A95A 4G7VL 5IBLC 4PGCA 3GMLA 2XWBA 3P30H 2DEPA 5FHBL 1GQLA 1F90H 4NZDA 2YL5A 5I19H 1E71M 4WKHA 1BQLH 2AMGA 1G0XA 5B22A 1JGIA 4EJ1C 3UJTL 3NN8A 4AH2B 4J7RA 4B0MM 4X9YA 3GIZH 2WMKA 4LSPL 1QBLL 4PJ9A 2DKMA 5JXEA 4G6FD 1W9PA 5DUPL 1M1SA 1U8OB 4UIMA 2V2XA 4I2XA 1WBZA 4XP1H 3F7YA 3G5VB 2X1WL 1CFBA 4HIEB 1J0YA 1KGCE 4PV8A 3VG9C 2ATPA 1IC5L 3MRPB 3VNZA 2ZOKB 2OL3H 3RIFK 1UXSB 5GISH 2LE9A 3HUJF 5GS1C 3OGCB 3P4OA 3QUMB 2J12B 3KLHD 3NVQA 4NC2B 3OJMB 1BZQK 2OYMA 4M6NH 4TUKH 4WU7A 1KENL 3F7QA 2VKWA 5DA0B 3EOBA 2DN7A 5EIYB 5TF1H 4PMQA 1OBAA 2EDLA 4KDTA 4RAHA 4ERSH 3BEVB 4QHKJ 1UZ1A 3I2FA 1OIFA 4PUEA 4U1MB 3MV7A 2EIZA 3I50L 4K8RD 3U9PH 2BS9A 4IHOA 3DI3B 1H3TA 1NAMA 4GRWF 2EYSA 4J4PC 1ODUA 5L0QB 3AMKA 2APFA 2W65B 2NY2B 4CBPA 3RVXD 1DBAL 4A6OA 5IBUG 5TE4L 3BLPX 3O3BA 1KCVL 1KWGA 4BUGA 4NIKB 3QJFA 3BC9A 4W88A 2LFGA 4O5LH 5B38G 3RILA 1YNTB 1FFPB 2YSSB 1JPST 4MGXA 3IDXH 3PIQB 3Q5YA 1LNUB 1MCJA 3WQWA 5BRPA 3HE6C 1G7PB 3D0VA 3I3DA 1L7QA 4HWNA 3S4SB 1UYXA 3UCRA 4G6JL 3U0PA 1BBDL 1WC7A 4I77H 1MIEH 1OAUL 3LS5L 5FHAL 4KVCH 1EOMA 2ICCA 3AMLA 3B6SA 4BZ1H 3HNYM 2L0DA 2Q7NA 1NLBH 3KLSA 3W9EA 2VTFA 5IF0B 5EULV 1KB5L 5GSRB 1JP5A 4GUPB 4F33A 1ZLSH 4HW6A 1HCFX 4WEUD 4PMOA 3MNWA 3VU2A 3VRJB 1MIMH 4XBGA 4JJHA 1F58L 1SY6L 5JOEA 3IB4A 3SGJC 4GRMB 3KAAA 3S6TA 1JWSA 3RKDD 5FOJA 4N9GB 3CTTA 4KKBD 4RRPG 1GVIA 1XGUB 1HHGA 4GRLB 2O5YL 4N0YL 2XZQL 2HMIC 3QSKB 3T65A 3LEYH 3FFDA 1G7QA 5FM4A 1QHPA 1QPKA 5I2IB 2ZSWA 1HZHL 5K9OB 1Q6CA 3WIIH 2B1HH 2VX6A 1T22B 5D72L 5D71L 1CZ8H 4UTAH 2AJ3A 4LGPB 5D7SL 1BG9A 2PWDA 1A6TB 1KGYA 4HIIB 4MA1C 3LRSA 5D1XA 5T1KD 1FNSL 1T66D 2NX5E 4XCFL 1AR1C 2Q3ZA 4QF1A 4XPFH 4KRMB 1KR1A 4FS0A 1C5BH 4MJIE 1AQMA 3O4OB 4GBXB 3V0VB 1J8HE 1S7VB 2GTWA 1NQ6A 3BXNB 1I7UA 3C6LD 2XKNB 2KD7A 1NCNA 5L2KD 2VQ1B 4UFJA 5JXIA 4TPRH 3QO1A 1E73M 2ZJSL 3S37H 5IHZB 4KZEL 5DK2B 3QEGH 4JDZB 5JHDE 4PGJA 2PWHA 4KZDL 2J2ZA 1UY1A 5D8JL 4LF3B 2VXVL 3AS0A 1D5ZA 4PBWD 5HGBB 2HFFB 2Z35B 2FR4A 2Y07H 4YJZL 4OBSA 3B9KC 1YNLH 4H1LA 2EXWC 3UTTD 2PW1A 2GITA 5F3BB 4PY7B 2WO1A 1JXKA 1YMMA 4ESKA 4V28A 4HSQA 3QJHA 4P99A 2A77L 2FB4H 1TZIA 1MAML 5JR1H 1VJZA 1OW0A 1MFDL 3TJHD 4JHAH 4HF5L 5FF6B 1D9KD 5BV7C 1ZT7B 3ZL4L 2AOSA 4HZLB 2VIRB 3O0RH 3UETA 2E6QA 3TCLA 5F9OL 1F3JA 4JRYB 5SWZD 2WV3A 4X6CE 2VH5H 5ITFB 4FQLL 5DMIH 2XTJE 3CKHA 3MRHB 2W9EH 4FQHB 2VMDA 1EHLL 1I9RL 2MCPL 3O11B 3PQYD 2B2XH 1PKQE 2CQVA 1YJDH 4PTUB 2QR0B 1JTTA 5LG1A 5I3DA 4PJEF 5GRJL 3U7BA 3LKPA 3NCBB 2J7HA 5ESVA 5BMFL 2B4KA 5CP7B 3H6JA 1HVQA 4PJDB 4XCNB 4Y4HD 5HHMD 3P4LA 3VRIA 4P23B 4S1DC 5HI3D 4GT7A 5EUKA 2ZX8A 2BNUA 1IQDA 4M9OA 5JHLL 1U30A 1FIGH 1I7TB 2BERA 3CFKA 2WWDA 2OWWA 4HULB 3KPOA 3ARBB 4JFFD 4I2XE 5F7NC 2YFZA 1UZ8A 2DMBA 3BT2H 2YD6A 2RFXB 1JWMA 4PJHA 1CK0H 2W59A 5F93C 1GPOL 3TTYA 2B4CH 2UVFA 1JHKH 1RZ7H 2VITB 2A38A 5ICXA 5EZJB 1LP9F 2VLLA 4Q0XH 4QRPB 1N64H 1U42A 4YXHL 4LQFL 1PZ3A 2MKLC 4L8CB 5DSCB 1NWRA 2EDJA 3IKCB 3ZJ6A 2DT1A 3ULSA 3MUGA 1KTRL 1KIPA 3RZWA 3MNVA 3ULVE 2MFNA 3OB8A 2OYKA 4B9YA 4GXVL 3SDYH 1ONQA 3NQHA 3ZKXB 2NY6D 2NXYC 1E28B 1DLFL 2W1NA 2W46A 4M62L 2HA1A 3SDAD 3WD5L 4RBPH 2IALB 4KVNH 3DX6B 3MV7E 4O2EB 1NGWA 5IDIA 3QWOB 1P6WA 5DT7A 3UAJC 3REVA 4AEIL 3RWEA 2HVJA 5DVLA 3LKNA 1N0XL 1IT9H 1EVTC 3OPZH 4RGOL 3VWKA 1CZTA 2ESVA 3TFKD 4AZ8A 3BGMB 1S9WB 3QIBC 2DKUA 4ZNEA 1BM3H 1E0XA 4ZPVA 3AZRA 5CEZE 4MNKA 3O2LA 2WBJD 4R2GB 3MLSH 4D71A 3BMWA 3FO2A 1YDPB 2V3DA 4WHDA 2YFUA 4UILL 5EC1A 2DGAA 4H8WC 4ZYKB 5C9KA 4PUBL 1UVQB 4AYSA 1UWEH 4QP0A 1C7TA 3PP3H 1DLHA 4F7CB 4ZOEA 3VH8G 3PZQA 5A16B 1CDUA 3QQNA 1ITBB 5IFTA 4P8WA 1CXIA 1YUHB 3HI1B 2XG4A 5HYJD 1DQLH 2AK4B 3IDGA 2QHRL 4PJXB 1UR4A 5FOOA 5EU6B 5F7WC 4NZRH 4H8VA 3LN5B 2ZUXA 4UFLA 2GKIA 1N5AB 3MLXH 1P4IH 1IGJA 2HG5A 5IKCA 1DBJL 3MRCA 1YC8A 1M7DA 2N7BA 4AZHA 1MOEA 4TTGA 5BRZA 5GPRA 1JDAA 2VZRA 4ELMB 1Y6NR 1XYFA 4MZ3A 2W66A 3LQAL 1VF8A 2WCAA 1NSNH 1K4DB 2D31B 5F6HJ 2W60A 4L0PA 1HP5A 4OV5B 2B9VA 1RUMH 5DI8B 3GHBL 3SKJE 3OF6A 3VA2C 1SMDA 2GDVA 3W6MA 3GXMA 1IQWH 3CUJA 1HKKA 2OYLA 2P42B 4XRCB 2ORXA 1G9MH 4GFTB 1F4WL 4NQSB 5D2LA 2VDKH 1MRDL 3MJ9A 1NUNB 2GJPA 5EBAA 3OZPA 4UDUB 4RAVB 4YHPA 4YQXH 1NKGA 1NAKL 1YPZB 2XHYA 3PWPA 1OGTB 1CN4A 3PXJA 1ORQA 2AEQL 3QUYD 1XR9A 2OI9C 3QCUH 3ARTA 3CIQA 1CEOA 4YE4L 3RQ3A 5L0QC 2YBTA 2WABA 3W9DB 5C1MB 3HRZB 2FIKA 5T1LB 3EBVA 2P8LA 3BN9C 5BWFA 5BXSA 3MBWA 4ZFOA 3C8DA 2H9GA 5DJAB 4IOFD 1JGEB 3W0WB 2Y23A 4NQUA 4J2XA 3BZDA 2Y64A 1CFVH 2V5SA 3TIDA 4CUBA 2J25A 4NKQB 2ADFL 1YMME 3KJ6L 3AXLA 1AH1A 4MB3A 2DLGA 4JANA 3GYCA 3G5YA 4KTEH 3QQ3A 3SDDA 4N1EA 5E95B 4XCCL 3JWNC 2VZ3A 1H09A 4PYHA 5HYSA 1DWAM 3MRRB 1O8PA 5GZNC 4KRPD 3QQ4B 1DSFL 5KVFH 4YBLB 4EI5D 5IVXF 4WWKD 3UBXA 1MHHA 3I6LE 1OD3A 2CKSA 1O8SA 3UYOD 2E7MA 3L3HA 1HYSC 3KWXA 2R2EB 5DMKB 1BLNB 4PJ7F 4HH9B 2J7BA 3QHZL 1C1EL 5IJVB 1X5XA 4KAQH 4UQ3B 4YN5A 3QBTB 5FM5M 1G7MA 4ATDA 4GRLC 4BSVB 1T2XA 3WDIA 1FYTA 3C9NA 5TQ2H 4JDTH 2CRZA 5D6DA 3EIFA 5IMOA 3AHVA 4HU0A 3CLWA 3WUEA 3NA9L 5EBWB 3TBYB 5C0FA 5MEND 3WYRA 1JZ6A 3R06B 4XWOD 5CZXC 3IANA 4OZGA 1OL0A 3AIEA 5H2BA 1XF3A 2H2SC 1X9QA 4D6JA 5B4NA 3VW3H 4OCRH 1GOOA 4WFEE 1T1XB 1A4JA 5KW9H 4F57L 3QHTC 2CEQA 1GGUA 4PJHE 3TJEH 3U30B 1BBJA 2JDAA 4XVSH 5ANMA 3GJEB 1MVYA 3V0WH 1MWAA 3SURA 3O4OC 4GBXC 5FKAB 1A02N 5CJOH 4YEEA 3AIQA 3HNBM 4DVBA 4KK8D 2OWCA 5T5NF 1E27B 4M56A 4DVRL 1FBIH 1CL7H 3HJRA 4JFUA 4XB3A 1A8JH 3ZE2F 1RK0A 1WAWA 1IAIH 5CJXA 5GHWH 1UYYA 2AJXH 1IGTB 5JW4R 3ARGA 3B3IA 3QNYB 5HVHC 4YHLH 1HSAA 1MHCB 3IJ9A 1DEEA 3SJVB 4PRHD 4PRPB 5E9DD 5CILH 3V6ZA 1UB5A 3DSNA 4NRYB 4CUAA 2GYSA 5ITBH 4I0KA 4O2FA 2XN9A 3T8XA 1MFBH 3T2NH 3BPLB 2Z9TA 3X14B 1SR0A 2ESVE 1MQRA 1R7AA 3ZR5A 4YC2B 4L3AA 4ZNEE 2ZEYA 1UADC 5IIEB 2YZ1A 2WHKA 1ZT4A 2CK0H 1ED3B 4D2NA 2Z91B 1B3ZA 4U1SB 4D8MA 3LV3A 1HWGB 4JRWA 5H35B 3MMEA 4BFIB 4CU6A 4A3ZA 3SQOH 3ULVL 3PGDB 3D69A 1KFWA 1F4HA 3B83A 2VXSH 1ZHNB 1FLRL 1HJQA 1UR9A 4LCYB 1YEKL 1EV2E 1AKJB 3T3ME 2CLRB 5IBTL 2C4FT 3EMZA 4HV8A 1I1AA 1IEAB 4L29B 4JHZA 1G9NL 4B41A 1NAML 4NJ9L 5J4MA 4JO2H 1MFCH 1YN6B 3O2DA 3M46A 2YS4A 3LEVL 4ZXBB 2BCKB 4CMMB 2NY3D 1UFUA 4OCSH 4S1RL 2FDBP 3B9DA 4MQ7B 1INEH 2XM2A 1FZMA 3ARBC 2YPVL 3BWUC 5CEZL 5C3LD 3MGOB 2VYRE 1T1YB 3RBSA 1BJMA 4P2RA 1ZB5A 5I1EH 3MLZL 3ALGA 1DVFA 1IAOB 1GQKA 1HL9A 5GS0C 3EYSH 5BRZE 1GHSA 3WL0A 1CLZL 1SM3H 5HJ3A 3F6LA 4LCUA 3V5DA 1RMFL 1PKOA 3MRMA 3JV5A 5T1DH 3WNMA 4OZFB 3RGVA 3U83A 1RIUH 4XPGH 5INDA 5F96L 4A41A 1B4JL 1LEKA 3ARPA 3S88L 3SE8L 2G3NA 3L9RA 3WH5A 3ZKXC 4AD3A 1W8NA 1I3RB 5D2LE 4MZ2A 3POCA 4KJPC 4JFEA 1RH9A 4UR9A 1I8KA 1Q9OB 4PGBA 4YX2L 4PG2C 4WUUA 5I2UA 1X5JA 3PWPE 2CH8A 3HNSL 1KCRL 4OZ4B 2MMXA 4HBCH 4HKBA 4JQXC 1TFHA 4HOWA 5HPCA 1CBGA 5EC2A 3UJJH 4P2QD 4L1HA 3UTSB 2WCSA 3A7QA 3JTSA 1H4PA 2YMXH 3NMEA 2HLFC 1UHVA 1CE1H 3ZJ8A 3CAFA 3RVTC 4R2GC 3VXRD 1SYVA 3U36B 4M8QB 3SKJL 2YLLA 3U4EA 2E9LA 1A21A 2W0FB 4IS6B 5CJBA 4UINL 2Q8BH 2A6JB 1T0MA 5J1XA 3QQ9D 4Q9BA 5FKYA 4NDMA 4Z2LA 3NNGA 2VLKA 4FXLA 5D7KD 5HD8D 4D9LH 3RTQC 3MLYH 1D5IL 1ODZA 2J75A 2RJ2A 4GG6F 5F7YC 4NSBA 2A2QT 2X4PB 4JPIA 1AQDA 3DVGA 1VFBB 2YA2A 4YNYB 2E4TA 4HKJA 2YL9A 5BO1L 1NBYA 3R1GH 5IV2A 3WSQL 1YEGL 2CRMA 2NZIA 4LPXA 4E0RB 1GQPA 3WLBB 2CIKA 4TNWK 2J7FA 1FYTE 3FMGL 4QB2A 4R90L 3ACFA 3VX0A 1K4CA 2AXJA 3GMMB 3IXTA 5C08A 3IS0X 4BM7A 3MRKB 1FORH 4MNQA 5CZKA 3VXTB 5TGBA 7A3HA 5ECJE 4XH2B 4OZGE 2ZUQB 4X6CF 2CIIA 3WNNA 4BCEA 1P5UA 3HU7A 4MAZA 2FH8A 3CPLB 4OT1L 2XNAA 3H2WA 4Q9CA 3K7UA 2BHZA 3D3VD 1WZKA 4K7PX 4LRNL 3D18A 5IVZB 2CLZB 4NQEA 3AU1B 5ANME 3GKWL 1HINH 3SBWC 5BJTA 4YUEH 1NAEA 1DQDL 2EPOA 1T80A 3MA7B 2XVGA 4HWBA 5EOTB 3L3DB 4P48A 4N0CD 3OX8B 2ZWLT 4GZEA 3W5NA 5EBMA