5FYUA

Crystal structure of the catalytic domain of human jarid1b in complex with 3d fragment 3-amino-4-methyl-1,3-dihydro-2h-indol-2-one (n10042a)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
463
structure length
456
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKLRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDGIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with N10042A
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 144
structure length 456
sequence length 463
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fyuA01
5IVBA 5A3NA 4GD4A 3LDBA 3PUSA 3PUQA 2WWJA 5FXZA 5A3PA 2GP5A 3PTRB 3PDQA 5LY2A 2Q8CA 5FUNA 2YPDA 5FPVA 5A7QA 5FP3A 3OPWA 5FZKA 5FYCA 3UYJA 4ASKA 4NUBA 4CCOA 4E4HA 4Y33A 5FPLA 3PU8A 4QXHA 5FJHA 5FZAA 5K4LA 5FP7A 4V2VA 5A7PA 4BISA 2Q8DA 3AVRA 5FYTA 3ZPOA 5FZGA 5A80A 2VD7A 4D6RA 3KV5A 3PURA 4LXLA 5FP8A 5FWEA 5FZ4A 5FZLA 4QXCA 5FXVA 3DXTA 5A7SA 5F3CA 3PUAA 4LITA 4IGPA 3KVAA 5FV3A 2WWUA 5A1FA 5FPBA 3KV6A 5F5CA 4QX7A 5A7OA 5FZOA 4UF0B 5IVEA 5F37A 5FY0A 2XDVA 5FBJA 3N9LA 5IVVA 3N9NA 2GP3A 3K3NA 5F2WA 5FYZA 3AL6A 5IWFA 3OPTA 4CSWA 3NJYA 5FYIA 5FY9A 2Q8EA 4URAA 4DIQA 5F3EA 4HOOA 5FP9A 4TN7A 2XUEA 5F39A 2OQ7A 4CCJA 3KVBA 3RVHA 4D6SA 4V2WA 5FZ1A 5LWBA 5FZ3A 5E6HA 5FZ9A 5FZIA 5IVYA 3K3OA 5FZFA 4LIUA 4HONA 5FXWA 5FZ8A 2P5BA 4XDOA 2XXZA 5FY8A 4EYUA 4EZ4A 5FYMA 5FZBA 4QXBA 5IW0A 5IVFA 2PXJA 1VRBA 4CCLA 4QX8A 3KV4A 3ZLIA 2OS2A 3LD8A 5ISLA 4Y3OA 4UF0A 5FZEA 3K2OA 5FP4A 5FZ6A 5A3WA 5FZ0A 5ANQA 2YBKA 2YU1A 5A7WB 3AVSA 4BU2A 5FY4A 5FZ7A 2YU2A 4C8DA 3U78A 4QWNA 5FWJA 5A7WA 4CCNA 3N9OA 3N9MA 5FY1A 5FXXA 4GJYA 5FPUA 2OT7A 2XMLA 4GAZA 5F32A 4BXFA 4LIVA 2OQ6A 3DXUA 5F3IA 2YBPA 5FYBA 5FZCA 5A7NA 4CCMA 4IGOA 4IGQA 5FJKA 4AAPA 5IVCA 5FPAA 5FZDA 4GJZA 3N9PA 4EZHA 5A3TA 5CEHA 2OX0A 3N9QA 3PU3A 4D6QA 5FYVA 5FYHA 5FY5A 4CCKA 2YBSA 4AI9A 5IVJA 5FZHA 5LW9A 3U4SA 5FYUA 4CUGA 2W2IA 4QU1A 4XDPA 3AL5A 3KV9A 5FYSA 5F5IA 5F5AA 5FZOB 4DO0A 5FZMA 5KR7A 5FYYA 4Y4RA 5F3GA 5F2SA 5A1LA 5LY1A 5FUPA 5FY7A
chains in the Genus database with same CATH superfamily
2HWD1 4AHWA 2QZ2A 1MVQA 2J1RA 4LBQB 5FQ0B 2CNAA 3IB3A 4FOQA 2YC4A 5KBFA 4CCDA 2BNMA 2BGPA 5CKNA 5JXIA 1A34A 1JTZX 3CO2A 1ENQA 4LBQA 3IWZA 2LROA 3M1HA 1DZQA 4JC1A 2QBXA 2WNUA 4GQ7A 1W2TA 5FJHA 3FUOA 4YVSB 1ZRRA 3MIGA 4JRLA 5GLZA 4CDXC 2BBVA 3OBZA 4BISA 4WM8C 3BTAA 2ZX2A 4RL7A 4XOGA 3TWIA 4K40A 1YC61 2EXHA 2Z42A 1NZCA 1T6BX 3OPZA 4IQPA 4YVSA 4ZU4A 4AVSA 1JZ5A 1Y3TA 2RMU3 2HWC1 3TB0A 2OUJA 4YSFA 2HWB2 2WO2A 3FFZA 4AGGA 1ULFA 5BNPB 4QX7A 2FDHA 5FZOA 1KJLA 2EXIA 4GIQA 4LMFA 1BZWA 2VQUA 2JDMA 1ULEA 3MDPA 5KXCA 1F15A 2ZHLA 4UFLA 2J1SA 1V00A 4Z92B 3WT3A 2JG9C 1H8TB 3U4XA 4FTEA 2PAKA 1W06A 2KR2A 2VM9A 2ZBJA 4MLOA 4BLIA 4BA6A 2G9GA 4DY5A 1UY4A 3BI3A 1ENRA 1H8TA 4QM8A 2K46A 5FBZA 3SNMA 3WP4A 1F35A 4MXWA 3VGIA 4FBFA 2JDHA 2HWF1 4XABA 1AR91 1W0OA 3T1LA 1QWRA 1R093 4BWOA 4CRQA 3BU0A 1YJLA 1MEC3 1UXZA 1YQ8A 4XYXA 5E6HA 1Z7S2 3CHXA 5A6QA 5FZIA 4NVPA 1X36A 5GM0A 4Y22B 3ZYHA 3FHQA 3ZXJA 5A33B 4AFMA 4AI8A 4EWDA 1FPN3 4IV3C 2CWMA 1J3RA 1SLLA 1VBC1 3TYJA 4JZRA 5JAXA 1VRH2 2BU9A 3ORJA 1HB1A 1W6NB 3FLTA 5L36A 4COYA 2X53S 1FOD2 1VBA2 2BBAA 1VP6A 3LA2A 2VMIA 4Y5SA 2ZGSA 2GMEA 5LA9A 4NE9A 2R1DA 3LSDA 2DTWA 3WR0A 1VAMA 5E89A 1N3OA 2HEWF 4NOTA 3M3OA 3WD5A 2AEYA 4CDQC 1UWWA 4CU9A 3DGTA 4LTAA 3VUOA 4IE4A 4QWNA 5I0TA 5L19A 1DQ5A 1GR3A 2HBTA 2WNVB 2MEV3 3LEIA 2LRPA 2XMLA 3JBG1 2R062 1QKQA 1KJRA 1VBB1 1XXNA 5FUIA 4GB33 5JSOA 4OHWA 1VB4A 3GZAA 1L7RA 4HK8A 3MLLA 4FVVA 4XF3A 3GF6A 5EJ3A 4OHXA 2PA7A 5DAQA 2CGNA 2VOXA 3ZN4A 1VBE1 1QJY1 1SG3A 1BKZA 4IDZA 3MBWA 3MYXA 4LO5B 3BU7A 4HPKA 4P9IA 2ZZJA 3I59B 4W50A 5FMCA 5GLVA 3VBSC 1UIKA 2E6VA 4AI9A 5JZGC 3DN7A 5LW9A 1CPNA 4MGSA 1OD5A 4LT5A 2YZ4A 5JI9A 5DAXA 5LCWL 1E5IA 1TVGA 2LALA 3I59A 5C3RA 4OLLA 5FMBA 3LPFA 4BYYA 4RQPC 4XFFA 5HBAA 2J1EA 3DL3A 4QGNA 2R7EB 1YI7A 2QUOA 2UYBA 1PK6C 1H1AA 1LOEA 3JB8A 3M4FA 3KS7A 3VKOA 2Q1ZB 5LY2A 1NE4A 3L9JT 4HKLA 5D8AC 2WFF3 2W5FA 2YPDA 3PUHA 4BQXA 2PYTA 1O59A 3MIEA 4YW6A 3UYJA 3C7OA 1PGW1 4CUCA 4COZA 3WW3A 2F6BA 1CIWA 3WQBA 1OKQA 4EN9B 3S57A 4LKEA 5J3UA 3WUDA 1JYNA 1UMHA 2E32A 5DZEA 1TME3 3MFAA 3ZR6A 4LXLA 5FZLA 1RJ7A 2A73B 3ZDSA 3TOJA 3INAA 3OBAA 4UFMA 3ALQA 3KVAA 2RM22 4UW5A 3WF0A 1X7NA 3H50A 4RD7A 2HLEA 3NAPC 4MX3A 1XYNA 1AX2A 3I7DA 3MIHA 4Q4W2 3N7MA 3C7EA 4AQTA 5D21A 1JYTA 1V6IA 2DWRA 5IVEA 4W65A 3ZO0B 3O14A 5FY9A 2JDNA 2WYSA 2WT0A 3BN6A 5T52A 1MS3A 1PO11 1R1ZA 1AR61 1YO8A 4UXAA 1JW6A 1OVPA 1U5ZA 4NRMA 2YC2A 1JYWA 2VUCA 1COV3 1BEV3 2JENA 2XLFA 4Q4V3 1WGPA 1ND2C 3MW3A 3VDAA 5C5UA 3A23A 3Q8EA 4M0NA 3P5BA 4OYUA 1VMJA 1LJ7A 3OY8B 4J6GA 1AXZA 2PHTA 4JGZB 4Y1UA 3U75A 1EV11 4XFAA 4ARYA 4CCJA 4QB6A 3HNMA 3P6BA 4QKNA 4XJAA 4NAOA 3TN91 1Q43A 3WDVA 2FZ2A 1C1FA 4YFWA 1RHI3 1ZRCA 3T09A 4FTBA 1RUI1 2PHWA 5IT6A 2P5BA 1LOCA 3NNGA 4N53C 1W90A 2WNEA 4AVBA 1Q8OA 3JD73 1S1AA 1ST8A 2EIDA 2Q30A 1W8NA 2P6CA 1A8DA 1UX6A 4META 3OBTA 2LTNA 5BNNC 1QQP1 4Y3OA 2CGPA 2ADEA 2CWSA 2KA3A 5FIXA 1G9BA 2JE8A 2H0VA 2H0BA 1L7QA 1TNRA 2GDFA 2BVBA 1OXCA 2GNMA 4M3CF 2ZZQA 3W58A 3SXWA 4XAAA 5DG1A 1RUG1 3ZMOA 5FXXA 4AQSA 1YI9A 3HQUA 1W0PA 4RHV1 3DYOA 3SKVA 5C3OA 1H6XA 3OYWB 3QACA 3WP5A 4PDWC 4Q0VA 4OI0A 1L3JA 3R05A 2AENA 1H9PA 1W3VA 1YCIA 2PLV2 3OF1A 2BGOA 1RUJ2 1YQCA 1A8MA 2YV8A 1DGLA 1IKPA 1IG3A 5L9VA 1W99A 1NCRB 4Y4YA 3JB4C 1VIWB 2VTXJ 4R8HA 2RS12 4KL1A 3ZX7A 4QKBA 4DUXA 1PHMA 1NCRA 3A0KA 1CAWA 1UZVA 2XB6C 4LEJA 1GNZA 3J8F2 2GNBA 4LBKA 4CPBA 3VDDA 1NY71 4MUVA 4HSJA 4CDUB 1NX9A 2ARAA 4LA2A 2RVAA 4NPRA 5DABA 2B45X 3O1SA 3AZYA 3VZJA 2EAKA 1LODA 4CVUA 2RS32 4Z2WA 2CYFA 2JDYA 5L9BA 4CDUA 5APAA 1OFSA 5FXZA 3I3QA 4CYDA 1OUSA 4NHYA 1F4AA 2NM1A 2RR12 1W9TA 2DFBA 4B4QA 3AZWA 1UY1A 3PDQA 2Q8CA 2A3XA 4DQAA 5FPVA 1ULDA 2H6CA 2ZKLA 1I3HA 4AI2A 4TLFA 4Y33A 5DN2A 3J26N 1DDLA 4IE6A 3RZKA 1HN1A 1JN2P 2F4LA 4JGYC 4C0BA 1JU4A 3KV5A 2I07B 2YMZA 4RGAA 4WM7B 5T5JA 4C1XA 4E9KA 5A7SA 4RR3B 4P00B 1SFNA 3GCXA 3HEIA 1PGSA 3HR9A 1JZ4A 3VL8A 3V65A 1S2BA 2WQ8A 4RR3A 1AL23 3RWKX 4AI3A 1XYOA 4O9GA 4XFHA 5F37A 4NJ4A 2XDVA 4NIHA 5FBJA 1V6KA 5GJ6A 3N7JA 3I3BA 4DRVA 1HQNA 3JCIA 3IDCB 3K3NA 4CEYB 4YW7A 2B9UA 2ORXA 1BYHA 1K42A 1C8M1 4Z1VA 5GLWA 5B4NA 4QPIC 2R1BA 2DVAA 1RL3A 1IS6A 3APBA 3VZMA 3SCFA 4ASLA 1W9WA 5CAZA 3T08A 5LATA 5DZFA 4ZHNA 1PMJX 1J84A 4OUEA 3EB7A 1OLRA 2BEOA 3AYDA 1UKRA 2QQNA 2W52A 5IATA 5JDBA 2ZX3A 4EN8B 3VBRB 2LW8A 2ZMKA 1W9YA 3IMNA 3VBHC 2QE3A 2YHJA 4B1MA 1KRIA 3ATGA 1DBNA 4QXBA 5IW0A 2ILMA 3VBRA 5DMYA 2ZX4A 4CU7A 3VBFB 3O12A 1R092 4ZXKA 3DKWA 1MEC2 2DCJA 3ILNA 3J7NA 4XUNA 5FZEA 4R9CA 1FAYA 5FP4A 5A3WA 3UJOA 4BK4A 1AYM3 2FZ1A 4FPLA 5ANQA 3VBFA 2B5HA 5LBFA 3M2MA 3PIJA 2E9QA 2ZGPA 2IWGB 1J59A 3ZFEB 5FY4A 1MS5A 3CZJA 1OPMA 2P2KA 5GZDA 4CE8A 2C9KA 1FPN2 1U12A 4CEWA 1YEWA 3SH4A 4XHXA 3MUZ1 1N1TA 1WBFA 3PUIA 5EP9A 3WG1A 3D82A 2GNTA 4GALA 1GZTA 2ZABA 4DXZA 1E5RA 1QEXA 1LHVA 1J3PA 1WCQA 3AJYA 1VR3A 5LBBA 1RUOA 4GJZA 3VL9A 3SQOA 4XZUG 1WMDA 2D6KA 2MEV2 3N9QA 3PU3A 4L0PA 1JYIA 1JZ2A 4NIAA 4B1LA 1PZ7A 5GALA 5C71A 2FDIA 2W0XA 2HWC3 3H3ZA 1D4VB 2V4VA 3RMYA 3VHOA 1CPMA 1UYZA 2QCSB 3MUY1 4YG3A 4L2NA 5FYYA 5FZMA 5T5LA 4AEDC 2FCTA 4XF9A 1FATA 4EN0A 5A1LA 5LY1A 4MGTA 3VV1A 2Z5WA 1RUC1 1LU1A 1CX1A 1MZ6A 3I2GA 4KWLA 5KHJA 2CL2A 2ZA9A 3AP4A 3PUSA 3RJ2X 1XE8A 1R64A 4A7ZA 1KEXA 5C4WA 1V9U1 2K0GA 2WAAA 3DPRC 5LBCA 2Z2SB 1S0BA 4AFDA 1Y9QA 3GXUA 5FMOS 1G9CA 3ZYGA 4QXHA 5FZAA 2DCTA 2HWF3 1AR93 4Y1YA 1H1IA 5KXDA 4LE4A 4PIYA 1STMA 1V0AA 2PHXA 2WO3A 2ZGMA 3AP7A 4IEQA 2B42B 5F8PA 3NNMA 1ZBE1 2W08A 3VDBA 5C3PA 4JAAA 2WFF2 1ZNPA 3IDBB 3IT8A 2Y6LA 4CTEA 1W6OA 4M3CB 1MVEA 4EN7B 1LEDA 3UV9A 1YYNA 4Q0QA 5A7OA 3CQOA 1UYPA 1VBC3 2WLQA 1ZYBA 3T4HB 3AKQA 1TME2 1IGOA 1W8TA 1W8OA 5ABJC 4BDVB 4A6OA 4CSWA 4OZOA 1S2KA 1LOAA 2C1FA 3HD8B 4Y1ZA 5DDJ1 1JUHA 2XUEA 1MZEA 3JBG3 1VBB3 4FFFA 1Y7BA 2ET7A 2VBDA 3OTFA 4FI9A 4MXVA 1DQ2A 3CIHA 2VTFA 2WN2A 4Z8BA 3OGVA 2JG8B 1COV2 1BEV2 3HVDA 2L9LA 4M01A 3B69A 2XXZA 4XDOA 1VBE3 3RSJA 1QJY3 1DZTA 2VCBA 4BQ5A 3ZSLA 4FXKB 3NV3A 4OCTA 5F6KA 2P3KA 1GQPA 4QM9A 5C9AB 5AC93 4YGBA 3WQ7A 4WVWA 4CCEA 4DUVA 5A6ZA 3BALA 1AYN1 2E33A 2XQXA 3WCRA 2C26A 5FLJA 4IL7A 5FZ0A 3WNOA 4HG6B 1VAKA 1KS4A 2P37A 4ITCA 4XCAA 4MYEA 5C9AA 2C5DA 2VQTA 1FT9A 1S2EA 2VY0A 4BU2A 2W1UA 5FZ7A 3JD72 4A2UA 3QH6A 2WZEA 5IHRA 4NMIA 4QQLA 4W6XA 3WQ0A 4UBHA 4BXFA 1NLQA 2VW0A 2ZS6B 3FBMA 5JMCA 5D1IA 4Y24A 1BXHA 1AJKA 2E26A 2VNVA 3FBYA 4NHXA 2WNOA 4E27A 3LGRA 1CAUA 3ES1A 2WRAA 3O1VA 2EICA 3TEXA 2HBUA 1R1A2 5AVAA 4F3JA 1JI6A 2Q5TA 2VMEA 3CL1A 5L7OC 2BW8A 1NQJA 5FPXA 3K4AA 1W28A 5CFCC 3KZ4C 5FZHA 1Y43B 4Q27A 3WINE 2BNNA 4XDPA 3POSA 3GBFA 3L2HA 3RDIA 4PBPA 1UOFA 5DUVA 2VZSA 5C8WA 4OI1A 2Y34A 5F2SA 1IQDC 1VJ2A 1LGCA 2ZHMA 1SCSA 2PHLA 5DAWA 4LPLA 1BQPA 1AZDA 1NLRA 2VZUA 1HXS1 3D3AA 4NHLA 2XHNA 4JRAA 4YZ1A 2EVXA 1J1TA 3CF6E 1PO13 2R0HA 1AR63 3PJYA 3KLSA 2ES3A 4PBOA 2X29A 3O1RA 3GCWA 2W87A 3MF6A 1G8WA 4RN5A 5KC6A 5EIYB 1PX3A 4NUBA 1YHFA 2A6WA 5FPLA 1RB8G 3RRDA 3GJAA 3H1MA 2JKXA 5JVVA 5FPZA 4KBBA 2ARCA 1XE0A 2BV4A 3AVRA 1VBD2 4LUKA 4P9JA 5FYTA 1B35B 5A3OA 2Q8DA 3TN93 2J1VA 3CEWA 4H14A 4GKXA 5FZGA 2FD8A 3ZIXA 4D6RA 3PURA 5FP8A 3LCPA 1RUI3 4YM2A 1IZ3A 4KWJA 3I54A 1NYWA 4WZCA 3S6PA 2PHRA 1B35A 4G9SB 2VZQA 4MHRA 3KV6A 3W20A 2C24A 1RUNA 1GP6A 1QQP3 1OA3A 1RUH1 3N7LA 3I3EA 2ORZA 1UMZA 2GU9A 4PLNA 4QT6A 3TNQA 1PNGA 2GNDA 2XJVA 2XL9A 3OGSA 1AXYA 1ZZ7A 1U5XA 1FMD1 3GJBA 4I3PA 3T30A 2WNUC 1RUG3 2GH8A 2QZ3A 1AL22 2VZRA 2F4PA 4B3NA 2Y0IA 4GWNA 3FMGA 2VMHA 3S0MA 1DP0A 1IG0A 1QGLA 4MH0E 4UYBA 1CQ9A 3EMRA 4HN0A 3AMQA 4RS5A 4OUMA 1PM4A 4QAWA 3RNSA 5FXWA 2VMDA 5KWRA 4EYUA 2IFWA 3Q8FA 4JTNA 3WF3A 3X29B 2X8KA 3WNNA 4AGVA 5KXBA 2VG9A 2D93A 2HWE1 3K46A 2VAUA 4XFGA 4ATEA 4Q26A 4E8DA 2R49A 5GZGA 3GDBA 1S0IA 2G9FA 1CZSA 4LK6A 2KXLA 4WVVA 5T3NA 4IEVA 2CV6A 4P02B 4YW1A 2ZKNA 2ID4A 2SLIA 3MLJA 2G19A 1UPIA 1BBT2 1XNDA 2DVGA 3FLRA 4IV1A 4PIXA 3T2TA 4ES9A 2QQLA 3U0ZA 4GAZA 5F6LB 5FZCA 4DNYA 5J36A 2NN8A 1RXGA 2XL7A 4O61A 4Q2FA 4BQWA 3OEAA 4RGGA 4Q4X3 4HT1T 1WMEA 2J22A 3O7OA 4JQTA 4XJUA 4YVWB 1REFA 4EWAA 1JYVA 2B7YA 1A3KA 1V6MA 4IEZA 4TWTA 3UT0A 4AHZA 4DXTA 3POIA 4QPGB 2D43A 4XUQA 4TSVA 1KDMA 1UU5A 4CUGA 3BGAA 3LA7A 2EIEA 3AZXA 1OQDA 5FK7A 1UYXA 4QPGA 4S2HA 4Q5OA 1WLTA 4FOYA 5F3GA 2BNOA 3ZMNA 2W1WA 2AH2A 5FK8A 4IXLA 5C6CA 2WSUA 5CFDC 3W5MA 4GH4B 3TEWA 1LULA 4N7UA 5FAXA 3PUQA 4P9YA 3F2ZA 4SLIA 5DAVA 4D7SA 4L99A 4Y5TA 1C8M3 2HWC2 1AXKA 4GH4A 3WCSA 1G9FA 5A70A 4XW3A 3AM2A 1C8NA 4FO9A 4ASKA 3CMGA 4PQ9A 1K5JA 1PO21 2BTVC 4D69A 5FP7A 3PJQA 3TNPB 1MQTB 3C3VA 3ZPOA 2QQKA 4A3ZA 4LO6B 5F5QA 4P9WA 2JE7A 2PAEA 2QQPA 2OW4A 4EN6B 3AYAA 3DKQA 1MQTA 1AHSA 1ZZCA 1QJX2 3SEPA 1ND3C 2RS52 1PVC1 1RUE1 3ZYFA 4KWKA 2BFUS 1FXZA 2HWF2 2KD7A 2VO5A 4LO8A 3IDAA 1F5JA 4ZY9A 3H7JA 1O3QA 4DRRA 2YXSA 4W6YA 2QFEA 2FDGA 3RZJA 1IQAA 3OCPA 3GZUC 4L8QA 3VZNA 5F2WA 5FQ0A 2GSYA 2C6SA 4CDWB 2W94A 3I3MA 4QQ2A 2BUKA 1NT0A 3MI8A 2PMWB 2X5IC 1HW5A 2W92A 1IS3A 4DIQA 3E1F1 5CB7A 4AVVA 1QU0A 2FHRA 5SV8A 1XNKA 2QQVA 3O0XA 3I2KA 4F83A 1POV1 3HIFA 5CG9A 1KDKA 1GZCA 1O4YA 3CJIB 4B4PA 1ZBA2 3ES4A 1O4TA 2HJIA 3UESA 2HH9A 1ZA4A 5A32B 3AKPA 4NIIA 1LTEA 2D5HA 3V0BB 3AFGA 3CJIA 4XACA 3S5AA 1PZ9A 5FY8A 2P34A 2WZ8A 1LCLA 5T5OA 5H9RA 2CAUA 1UZ0A 5K0UC 3LA3A 3ZYRA 3FE5A 3VKLA 4KU7A 5BNPA 1PVXA 3V0BA 3I2DA 4XEZA 4MVTA 1VBB2 3VBUB 3WNMA 3ZLIA 1MACA 4YNIA 1W6QB 4X6QB 1W6MB 1WW5A 2GMMA 1RUF1 1C5IA 4H7MA 4I0AA 3RZGA 2QQOA 1NA1B 2YBKA 3M70A 4OULA 1SHWB 2EAAA 4YZ3A 3VBUA 5BY5A 1RUC3 1HQWA 1W6QA 1W6MA 5JCTA 1VBE2 3VBOB 1FX5A 4MGQA 3B7MA 1NA1A 5J96B 3E5QA 2E7QA 4A6SA 3E6DA 3MEPA 1XNAA 4BM8A 2RJLA 2W1SA 1T2XA 2ARBA 3SEEA 4QKFA 3ILFA 1V9U3 5F32A 5AC92 3VBOA 3UKNA 3N4MA 5CADA 1QNWA 1DYKA 1NCQB 1SDDB 1V70A 4HL0A 4XFCA 1EPWA 2P1BA 3OGGA 4IEWA 1J83A 4FPCA 2BZDA 4K8FA 2FMYA 4W8JA 1DHKB 4LNVA 3USSA 2MPFA 3TEYA 4Z2AA 1ZRIA 4Y22A 1R082 3KF5A 2XR4A 2JIGA 4YG0A 3N9PA 5A33A 4MSVA 4S2DA 1SBDA 5BNOB 1YJKA 1DQ6A 3MIFA 1ZBE3 3DF0A 5FYVA 3T2PA 2A70A 1RYYA 2YUEA 1BK0A 2ZGRA 5ERLA 1CVNA 3I4IA 1V6OA 1NAEA 1W6NA 1PGW2 1BCXA 4BQ3A 5BNOA 5KR7A 2EXJA 5DXDA 5FKBA 5JR2A 1NQDA 3D4KA 3D5OA 1OD3A 5FY7A 3S7IA 3AMNA 1TE1B 4I09A 4XHBA 5JUVA 5DUXA 2WNVA 2YPJA 1W9FA 2XVGA 5FOJB 1GMMA 1GLHA 5FYCA 5DDJ3 5FZKA 4CU8A 1A78A 3ZSKA 1G9AA 5DZGA 1UZWA 2HEVF 5F1RA 2DBNA 2DTYA 4Y26A 1GBGA 4MGIE 4MGZE 3Q8AA 4Z82A 1GKBA 2EXKA 1PO12 2A6YA 2ZGNA 3HN3A 3RI9A 2OZJA 2JJ6A 1AR62 1GNHA 1OOPB 3LF7A 4GWJA 2V4AA 3VDDC 2P17A 2VECA 4JTOA 1SQ4A 2VR4A 4JVAA 2VUAA 1SPPB 2WFPA 1W6PB 1LOGA 3THTA 4UF0B 3WG3A 4DOUA 2QQJA 3TN92 1AYN3 1OQ1A 2C9AA 4B8EA 4C91A 1SPPA 1B09A 1RUI2 2JX9A 4TZDA 2V73A 4HETA 1HJFA 1Z7S1 5LA2A 1UIJA 2OKXA 3RYRA 4N9HA 1QOSA 4CUBA 1XNTA 2Q8EA 2XBO1 2NLRA 5FP9A 3BYWA 3EQEA 3MGUA 4U36A 5F39A 1QH6A 2Q8OA 1QQP2 3UL2A 4D6SA 5CISA 5LZ6A 5IAXA 1CAXB 2JD9A 2VE1A 1YLLA 3POYA 4XQ4A 1DQ0A 1VBA1 5FZ8A 1T6GC 4CDXB 2VQAA 1RJ8A 1CAXA 2YROA 1CX4A 4HSLA 1Y9GA 3LPGA 3ME2A 3OEBA 4WM8B 4XBLA 5J98B 3M3IA 4RR3C 1OT5A 4OUSA 1WMXA 2TEPA 3H9AA 2JDUA 4CDXA 5FR3A 1ZM1A 1YIPA 1H1MA 2BP6A 2GC0A 1K3IA 2A6VA 2D3RA 3WW4A 1LENA 4AE2A 3I49A 4NIDA 4PCRA 2D97A 1H2LA 1IHMA 2ZGTA 3OJBA 2O14A 1W3XA 4HVQA 1UXXX 3LEKA 2OPWA 1HXS3 1UKGA 1ASJ1 1Q8VA 2DCZA 2JG9B 5FWJA 5EYXA 1N3QA 3QCWA 1UOJA 5E16A 4DY3A 2XJPA 5FPUA 2WT1A 3I2HA 4LULA 4CCCA 3OY8A 4OQ9A 5F3IA 4JGZA 3NKTA 4XUPA 1K5MC 2VW1A 1NY72 4W4ZA 2JG9A 4AVTA 4BJ0A 4LBLA 4HBNA 3W9AA 1IPKA 3VLBB 5KHHA 4BQ1A 1O3SA 3BUCA 3L2YA 4A3XA 1H0BA 5C5TA 5EFUA 4XUOA 2O8QA 2D6NA 2WN3A 4EWEA 3HMYA 1JOJA 4Q0PA 2WINB 5EXOA 2ZGUA 1PMIA 4N7IA 1SBEA 1LGNA 5CNAA 5FYUA 3ZOIA 1U5IA 4GA9A 1C28A 5JOYA 3SKJE 4DZGA 3FFQA 3ASIA 4Q4X2 4QX1A 2VMCA 3B93A 3O0VA 4IV3B 4AVAA 3NMBA 1V6JA 4QKDA 4QX0A 1OQEA 4QDQA 2QQUA 1RUH3 4IEYA 3WY6A 3MLKA 5A3NA 4BLJA 4CEWC 3LDBA 1W05A 4AF9A 4IV3A 4ZXEA 3ZXLA 1ZZ6A 5JPNB 4BXSV 2XGXA 3GGLA 4TXWA 2Q1MA 2BERA 2V5DA 3KM5A 3DV8A 1FMD3 4AR2A 4MGKE 5C8CC 5J1XA 2EF6A 3OYWA 3AB0A 1E57A 4FT8A 1F9KA 1I5PA 1MS9A 1XNBA 3GBGA 3SH3A 1I9RA 4CCOA 4Y20B 4COWA 1VLNA 3M3QA 2RM21 2I45A 2D6PA 1GANA 4HKWA 5IJRA 5A7PA 5FRAA 4Q4W1 4AQ2A 2IFRA 4OMCA 2I2SA 1QH7A 4LHKA 4S2FA 1AR82 4FPKA 1C8M2 2X10A 4LITA 3RS6A 5FV3A 2CTVA 2YB7A 2JDPA 2OYZA 1ALYA 3FHAA 1JODA 2HWE3 3OD0A 1LHUA 3ZXAC 3VBSB 3MIBA 4K1ZA 4B29A 5JZGB 2WDBA 3EYPA 4AFBA 5A6YA 5C70A 2P6HA 2Y6HA 2PHFA 1QJU1 5C4WC 1QJFA 3TRSB 3VBSA 5JZGA 3BCWA 3KSCA 2R042 3AL6A 5DG2A 4RQPB 4IEXA 3NJYA 2XJRA 3N35A 1ODMA 1PK6B 1W2UA 1YNAA 3RFRA 4JDNA 3RVHA 4XAEA 4S2GA 5D8AB 5FMOL 3ZYJB 3QBQA 4JX0A 4QMAA 1RVF3 1DQ1A 1P8JA 4RGKA 4AAXA 4A7KA 3CU7A 2GMPA 5FO9B 2ADDA 4YM1A 5C7GA 5I0SA 4QX2A 4PLMA 4WM7A 4LOTA 1KQRA 3ENRA 4H55A 2ATFA 1L7LA 1PGL1 3LEMA 2ZX1A 4J1WA 3RZZA 3NQHA 3Q8BA 2ZPXA 2DURA 1VRBA 4QX8A 2DFCA 5T54A 3C8XA 2GZWA 4L92A 5ISLA 2VXJA 4PIZA 2RMU2 2YY1A 4ASMB 5GLUA 3NAPB 3ABZA 1HRI1 3IN9A 5EV7A 1GP4A 1MZFA 1IPJA 4CEYA 4M3CE 4LORA 2HEYF 2PLV1 4CXXA 3NL1A 3RZHA 4CCNA 5FY1A 5JPMB 5C3QA 2OT7A 4AL9A 2RS11 4AHYA 4BK5A 2YBPA 1S4CA 1ND2B 4CCMA 3H8XA 1GWLA 4DXRA 3VB9A 3POFA 4AI1A 2IXCA 2UWAA 1OF4A 2WKKA 3J8F1 1PO23 1RUC2 1NLSA 5ACA3 3LSEA 4M0HA 3KHCA 1ND2A 2R071 4JQRA 3ZSEA 3K77A 1OLME 2BDRA 3ECQA 3ZIWA 3AK0A 2WS91 4PF5A 3ZFFC 3QD6A 1AX1A 1OLQA 4D6QA 5IVJA 4FFIA 1ONAA 3FLPA 4YGCA 3VHRA 1YIFA 2W1QA 2VZTA 5IAVA 4N53B 5FLIA 1FNZA 1JHJA 2AEZA 4DO0A 5C9AC 1JYXA 3P1IA 2HWD3 1PVC3 1RUE3 3G6JB 1WKYA 2VXRA 4ZU5A 5FTTC 4ISRA 2JDAA 3H3LA 1D4M1 4N53A 1POV0 5BNNB 1URXA 1WA6X 4LKDA 3ZFEA 4XMIA 5A3PA 4E2QA 2VCMA 2Z79A 5LRRA 1ZVFA 5BNNA 4X8NA 4D7TA 1WUVA 1GOFA 1K45A 2FCUA 5I0DA 3WEZA 1QJEA 5LK5A 2WZR1 2A5ZA 3POBA 2Y26A 2YGLA 1POV3 1HRV1 4L11A 3GBWA 2RG4A 2WO7A 4ISQA 4PDWB 1UX7A 4FPGA 3UGFA 2XHKA 1LOFA 4IW3A 3LFIA 1CJPA 1UL9A 2QQIA 3B00A 2E51A 4GB32 3SITA 5LK7B 1IS5A 3H8UA 3K48A 5JI7A 4PDWA 2IVIB 1EYBA 2VOKA 4KU8A 3RG0A 2DUQA 2UU8A 2BPA2 5DDJ2 2ZCWA 1CWPA 3W21A 4AOCA 5BPXA 1K12A 3GZTB 4ZS2A 5EZWA 4E4ZA 5FY0A 1RUF3 2UWBA 2PTMA 5HI0A 1DGRN 1XBFA 5K9YA 2VC9A 4JKLA 3MFCA 1M06G 1BJQA 1D0HA 4P9XA 3FZ3A 4YGEA 2Y6KA 1VALA 3AJZA 4QXKA 1AR71 4JCKA 3EJKA 1XU2A 5E8AA 4ZPIA 4INDA 4BHPA 2CAVA 2IXHA 1XPWA 3MZHA 4IEUA 1AYN2 3KGZA 4ONUA 1QXJA 4LQRA 4NWWA 5FZ3A 3K51A 3ON7A 3VZKA 4FFGA 5IVYA 3UETA 3K3OA 2DYCA 4XF1A 3H0OA 4JV4A 3DEMA 5CG8A 2XONA 3O1TA 1XB9A 3I2OA 2NZ9A 3OGJA 3WQ1A 3WW2A 3P3PA 4EZ4A 1WCSA 1WCUA 2AUYA 2IZWA 3FWEA 4JGYB 3AP6A 4M3CA 3KB5A 5E88A 3WNXA 2FQPA 4CCLA 3N36A 2ZJCA 3KCYA 1FPN1 1FV2A 4F8AA 1XYPA 4QDRA 1ZX5A 2XLGA 3AMMA 3J7MA 1WLCA 4QPWA 5A7WB 4XVHA 4BOWA 2CDPA 4FSJA 2X05A 4UFHA 4N9IA 4XJZA 5BNQA 5FOBB 3HT2A 1LOBA 5A7WA 1UAIA 2NMOA 1OLMA 5A3UA 4NROA 2WWSA 4KBZA 2BRTA 2WABA 4MG2A 1GNYA 2O0OA 4RS5C 3I2JA 4QPIB 4Q4V2 4UFKA 5AFEA 4LHLA 1H2MA 1AX0A 3E6CC 1LESA 3QLQA 4QPIA 2JG8A 2QTWB 1HXS2 4Q0SA 3SCGA 4BPZA 3VN4A 5I93A 4XQWA 5EWSA 4I30A 2OX0A 1LGBA 4IESA 1ZZ8A 2YBSA 1RHI2 2DUPA 3VBHB 4QU1A 2NYYA 1QHDA 3RZMA 5DUWA 3K4ZA 4AGRA 1ULOA 4BQ4A 3ZVXA 3KF3A 3VBHA 1W8WA 5FUPA 1D0GA 4IV1C 1HB4A 3ZXFA 4PI0A 3AYCA 4C1WA 3O1UA 2WO1A 4W6WA 2AREA 5BV6A 4UFJA 2WC2A 1H6YA 1Z7S3 1UU6A 2GC3A 2K2SA 5A7QA 2V5YA 5LA0A 4XILA 2XBO3 3MPPG 5IVVA 5HV4A 1EP0A 3GM8A 2BWCA 3PU8A 2XOMA 3NSTA 4Q0UA 1NXD1 4ZU7A 2FDKA 3H3UA 1F8VA 1SEFA 1RUH2 4KWUA 3QH7A 5JOXA 1ULGA 4OMDA 1SLBA 5CU1A 4KG0A 4AEKA 3DUIA 2B9VA 4I0BA 1IOAA 3SHRA 1VBA3 4YW4A 2DVFA 3U10A 1YQ5A 1ENXA 3KQRA 1NG0A 2XVKA 3ACLA 3CLPA 2WQ4A 1O3RA 1OFNA 4QGMA 4HLTA 4PI2A 3BOPA 5DAPA 2XJQA 3MF9A 1OVSA 1XU1A 2ZXQA 3USUB 2VOTA 5CVRA 4I0WB 4AEDB 4QHZA 2GP3A 4P9GA 3U14A 3RQ0A 3VD4A 3USUA 1EV13 1ASJ3 1H4GA 1WBLA 1GWMA 3AFKA 4N43C 5AVPA 4HK9A 2HWE2 5F3EA 1COV1 1VPHA 4GWIA 1LHOA 2NQYA 1U5YA 3VKMA 1W04A 3KVBA 4GMP1 2Z4FA 3DPRB 1HV1A 4I01A 4XTMA 5T55A 3VDCA 2YFZA 5HXVA 2RJKA 3GALA 5FZFA 2Y38A 4LIUA 3DPRA 3ZFGC 4MO3M 2HYKA 4GZ9A 5FZBA 1Y4WA 2DV9A 4TTGA 1X50A 2JDZA 1YFYA 3V64A 1RUD1 4XE9A 3VD5A 3ROUA 3LQCA 2BFUL 1RVF2 2YYOA 5EQUA 2PQSA 1DCSA 1DLCA 2ZACA 3MICA 2JB8A 4FOWA 5TSWA 5FLHA 3AVSA 4B7EA 4BCUA 2G1MA 1SBFA 1VE0A 1SACA 1OKOA 1NE6A 3IKWA 1UY2A 1CD3G 2VMFA 4YW5A 2XWBB 2BOIA 4H3WA 4RHV3 4XBNA 5E1RA 4R9DA 2AYHA 5ABJB 1R1A1 4WZFA 4YVSC 4ATFA 1LNSA 1XNCA 3ZYPA 1EUUA 1LU2A 2B39A 2VTXA 3OGRA 4G3YC 1ULCA 1M4WA 5FPAA 3CJIC 4BH9A 2RM23 1CR7A 1RC6A 4LE3A 1UOBA 2W46A 3K4DA 4Q4W3 1UD1A 5BNPC 5CEHA 1XQNA 4FPJA 1C57A 1GP5A 1HV0A 2P3YA 3LOBA 4YG6A 4CCKA 1EAH1 4UW6A 3LFMA 1POQA 2VZPA 4Y1XA 2W2IA 3HAGA 1UMIA 4MGYE 4A42A 3KV9A 2Q1FA 2OXBA 2PAMA 4A45A 1JYCA 1H8TC 1PO22 1WLWA 1AL0G 3PMSA 5ACA2 1YQ2A 4FPFA 4M4RA 1IS4A 3HN1A 2ET1A 4LJHA 4NO4A 3ZXEA 5IVBA 3NKGA 1QJU3 4K3UA 2XUMA 3ILRA 3ZM8A 4EE2A 3PTRB 1AYM2 1VBD1 3TBDA 2VPVA 1SLTA 3AMPA 2D44A 1O3TA 2HWD2 1PVC2 1RUE2 3NV4A 3N7KA 1XSRA 4XF4A 4Y1VA 4YM0A 3J9SA 1GICA 1GQHA 1F4HA 2C4XA 3E5XA 3S5QA 2PELA 3NNJA 4BIFA 4V2VA 2Y33A 3JZVA 3IDEA 1HIXA 1ODNA 2RHPA 2I74A 1W8UA 2A7AA 2ZAHA 2VNGA 4YVWA 3ZKUA 5KHGA 5JSRA 3BB6A 3OOXA 5FO7B 1TMF1 1YFXA 4AFAA 4P5YA 1CGPA 2Y60A 5BNOC 2XWJB 4IGPA 4ZS3A 4XFBA 2BGCA 3WHUA 2EALA 5L7OB 5FPBA 5F5CA 3VD9A 1JHNA 1UCXA 1GV9A 2RDQA 4MOAA 5L73A 3ZSMA 4EJRA 4XQDA 5CFCB 3BIWE 3THPA 2JWPA 5L7OA 3BTZA 2RV9A 4AI0A 1HRI3 1S0DA 2WNVC 1CZVA 1W03A 4WVZA 4RSUA 3W59A 5FREA 1O5LA 2WSVA 4NHKA 4ES8A 3GYDA 4XZPA 5IWFA 4BMEA 1QIQA 3TAYA 2B4KA 2PHUA 3MW2A 2JECA 4IUGA 3HPNA 1I1EA 1Q8QA 2TNFA 4AG4A 3VKFC 2RS13 1WD4A 4O65A 5HCAA 3O1OA 2JDKA 2VZ1A 2O1QA 5FZ1A 1RUF2 1XOYA 3KD4A 3LIGA 3OB8A 4IEOA 3KMHA 4ORFA 3THCA 2XQRA 4P14A 2E7AA 3J8F3 3ZN5A 3A4UA 4YWAA 4CP0A 2OIIA 4HONA 1N47A 2QNKA 3HNBM 2R073 2VJXA 4L97A 4YGDA 4EQVA 2IVJA 4Q4Y1 1E5SA 1AR92 1VB2A 3HNYM 4UFIA 1BMV1 2Y64A 2XVLA 2WS93 1W8ZA 4NPMA 5J37A 2VNRA 4IERA 1H4HA 4XPVA 1YQ6A 4DS0A 4O9EA 1ZZBA 1BBT1 2G9ZA 4IE7A 2DU1A 3J7LA 4COUA 1S0FA 3R4DB 1QY4A 1PIV1 4LBNA 2FCVA 2DUOA 4OFGA 1D4M3 1DYOA 2A71A 5CKMA 1VBC2 4CDWA 5FFOC 5HV0A 3KT4A 1MS1A 1H8VA 2GN3A 3U78A 1S0JA 1Q3EA 3D0JA 3G7DA 4FPHA 1FYUA 1S55A 1DFQA 4LUMA 4GJYA 5DPNA 4JHZA 3CZUA 3MPBA 3DXUA 5FYBA 1RMU1 5IUQA 5A7NA 3ZDVA 1O8SA 1OMIA 2WNUB 3FJSA 2FDJA 1S0CA 2WZR3 2XLAA 2JD4A 3KWVA 4PQQA 2MNGA 5A32A 2UY8A 2D6OX 1HRV3 1SLCA 4I3GA 1PM7A 1U0AA 3JBG2 5T5PA 3URFA 3D6EA 1O4ZA 1Y9MA 4NRPA 2NPIA 2E63A 4YZ4A 5FY5A 2VCCA 4JKMA 3UGGA 2VZ3A 4NN0A 5JLVA 3U4SA 1OUXA 1DGWX 2NMNA 5FZOB 4DMIA 1X8EA 1XE7A 4OI2A 4BMBA 5LBEA 4LLOA 1QJY2 4Y4RA 5LB6A 2ZTNA 5J09A 3H42B 3IBMA 3NJZA 3RGBA 3AKSA 3RYPA 2FMDA 1HLCA 4I2OA 4HZFA 3W5NA 5FMDA 3LEGA 4NPLA 4YLZA 4CXWA 4JGZC 3BTYA 2F17A 1QF3A 3WDXA 3LZZA 3JQWA 1EY2A 1AR73 1QOTA 4MXWB 2A6ZA 1DQ4A 2LS6A 3O1MA 1NCQA 4E4HA 3RJRA 1QDCA 4OZXA 1QJX1 2N7GA 4BIOA 3UNPA 2RS51 1C3HA 1JU3A 4P08A 1C1LA 5A80A 2V72A 4IETA 1Q8SA 5FZ4A 1LB2A 1ENSA 3ZN6B 4K9SA 3DXTA 2VVFA 1RINA 3PUAA 4ZZ5A 2WYFA 3KCXA 3R4SA 2QKDA 3POEA 4WV8A 4H2AA 3KT7A 4RFT0 4D0QA 2XBO2 5A1FA 1DU3D 1KS5A 3ZN6A 2D3PA 2YDEA 1F2NA 1Z78A 2ZHNA 4CUAA 3HBKA 1UPSA 1DYPA 1OC1A 3EXUA 5M0TA 3WX5A 1CIYA 5G05L 3A7QA 1Q56A 4AEJA 4NRQA 1EPZA 2DVBA 1ZBA1 2K9ZA 1LKNA 2R0FA 4N90A 5CFDB 3SMHA 3WUCA 5LRSA 1MR5A 2JXAA 2HWB1 1WW7A 1XJAA 4XCBA 2A6XA 3PL0A 1UF2C 1NCRC 1G9DA 1OHFA 5CFDA 3ZXGA 4M00A 4V2WA 2D3SA 4CXYA 4QPYA 1G6NA 1E5HA 2DVDA 3BPSA 3FN9A 3WF2A 4XJ8A 2W9XA 2WA3A 5LEKA 3B9IA 4LA3A 1SCRA 2R6QA 4ARXA 1OOPA 5J7MA 3NW4A 3NNLA 1EV12 1ASJ2 3WF1A 1Z0HA 3FL7A 1UO9A 4U2AA 4HPKB 1GU3A 4CDUC 2P3JA 5B2GB 1OH4A 3FUQA 4K7JA 1W9SA 4FCAA 1SFPA 1W6PA 1RIRA 4UF0A 1ND3B 4BZ4A 1NXMA 3ZSJA 5AC91 2BOJA 3IIAA 1QOOA 3B3QE 4E4DX 5CKQA 2YU1A 2VBBA 1X8MA 3JUUA 5D2AA 4AEMA 4AYUA 4YW3A 4DEQA 1ND3A 3CKHA 3JU9A 3BKZA 1XSQA 4Q8LA 1GQGA 1ZREA 2Y8KA 2EIGA 2W95A 3N9MA 4LR4A 1R081 3E5UA 2YC0A 3UGHA 1US2A 4LBJA 4XIKA 2RDRA 3P3NA 1VRH1 4KMQA 4QGLA 3O5SA 2X5IB 1FOD1 1RGSA 4XDQA 5I8YA 1JXNA 2GC1A 4BQYA 4FP3A 4AZZA 1RUG2 1TNFA 1UZYA 2Q4SA 2VUJA 4WM7C 2IXLA 5I8TA 2AC1A 5KXEA 4KI5M 1SMVA 3AC0A 2X5IA 3NWKA 4RHV2 5L9RA 4WM8A 3H7YA 2MHFA 1H9WA 2PHDA 3HWJA 2R061 3EBRA 2W91A 2CY6A 4UBGA 2GALA 3C7GA 4KGGA 1YFWA 5K0UB 3UKVA 1DLLA 4CEYC 4P9LA 3WW1A 4GMP0 5CZKA 4UOJA 5FCCA 3WHTA 4HANA 5K0UA 2NP0A 2JICA 1CJDA 2CDOA 4XJ9A 2QQMA 5C3SA 4DPNA 2VGDA 3ZYIB 1Q8PA 4LHNA 4QX5A 1HN0A 3U1XA 2JKBA 2WQZC 5FP3A 3M8LA 1DZRA 3VBRC 4GMP3 3R6SA 5CA6A 3T0BA 2YG0A 5G04L 1QJU2 3WNKA 1HJGA 3F95A 5HXMA 4GXLA 4JDOA 3VBFC 3WSOA 1W8HA 3RWNA 4XJWA 4YM3A 1AJOA 4YYOA 2D5FA 1JUIA 3DCQA 1NOVA 2WWUA 3O0WA 4LBMA 4MZUA 4XC9A 4XMAA 1DG6A 5H9SA 1BVVA 2ERFA 3MIDA 1YUDA 5A3LA 2DCYA 1RUD3 2B46X 2ZEWA 2ZMLA 3ZFEC 1CN1A 1D2QA 1SLIA 2FDFA 3WDUA 3KT1A 1KD7A 1W8FA 1KFUL 4K20A 4CDQB 5KHIA 3H8RA 1N1YA 5FYZA 3KCCA 1N1SA 1BVP1 3WXPA 1MZ5A 3MO4A 3MV11 3OPTA 2WBKA 5ANNA 2J42A 1PGL2 1OSGA 3E6BA 4CDQA 1AF9A 1ZRDA 2Z69A 1GYKA 1R1A3 4TN7A 4V1PA 5CYYA 3O1PA 2GC2A 4LKFA 4LBQD 4HMZA 4Y20A 3AXEA 2YGMA 1LOFC 3BODA 2A3WA 3J4UH 4UWDA 4OHYA 1HRI2 1V6NA 2IXKA 4P5HA 4PT6A 1LR5A 4QQHA 4NIGA 2SBAA 5FYMA 2R32A 1CAWB 2WT2A 2PXJA 5C33A 3OBRA 1VAVA 3GNEA 3QOPA 1EAH3 2BQPA 3KV4A 5HCFA 4N8MA 3SLIA 3VDDB 2WJSA 2JIJA 2VNOA 4FQ4A 5EHDA 4RYDA 4ZKTB 3WOGA 3WP3A 4CA9A 2AR6A 4J1XA 2VVDA 4HXCA 2R072 1WW4A 1BLZA 2AGSA 1W39A 3ST7A 2WS92 1WLDA 4RQPA 3VZOA 2PFWA 1NUKA 2VCAA 4L9BA 3T2OA 2VMGA 3J7HA 3K75B 4DUWA 1PK6A 1US3A 1VBD3 3NV1A 4C90A 1HB2A 4LIVA 1KXGA 4LHSA 5IYYA 3VD3A 5D8AA 5IK8A 2E31A 3ACHA 5A1AA 2J7MA 3RPQA 2UURA 2D6MA 5IK4A 2RE9A 2WL1A 4UI9L 1D4M2 1REDA 3U37A 3WNLA 4E4SA 1BK1A 1ULPA 1XRUA 5FO8B 5LA1A 2XKPA 4Q4X1 4FTSA 1GFF2 2HYXA 1OF3A 1O5UA 3LKJA 3NO8A 1C5HA 1KGYA 1TMF3 4KH9A 3HT1A 1LAJA 2OA2A 1WWYA 4M4PA 3VHPA 4D3WA 2VZOA 4G4FA 2WZR2 1RUJ1 3NAPA 3LDRA 1D2SA 4R52A 4LOSA 1HRV2 3ZPYA 4D7YA 4D8MA 1UQXA 3VD7A 1WD3A 5LEJA 3ACGA 2Y0OA 4FAHA 3PLQA 1EUTA 4NR1A 2WWJA 1APNA 3KQ4B 4MADA 5AFBA 4UAPA 2WUHA 3BVCA 1RXFA 3PIGA 4MHUA 3T2QA 1MS0A 1HX6A 2XKOA 2R16A 2Y6JA 3AKTA 1ZZ9A 1W2NA 4X6RB 2G4IA 1AR81 4NWVA 2J1TA 5CBLA 2JG8C 2RDNA 3WP6A 1O91A 3ETQA 2W39A 4FQZA 4K8RB 1K5MB 4CZSA 1V9U2 2RS31 3ZKYA 3M3EA 2E53A 3I97A 2VD7A 4YARA 2WA4A 3DECA 4QXCA 2HKXA 2RR11 2ZOEB 5IFTA 5F3CA 1K5MA 1AR72 1F5FA 3KGLA 4Q4Y3 1I5ZA 3M7AA 5GLTA 3PVNA 2ZGKA 1OI6A 4GULA 1YFUA 2CGOA 2R041 3WZ1A 3GHMA 4OHZA 1ZBE2 3H8OA 2RJ2A 1X9TA 1QDOA 1BBT3 2ENRA 3A0NA 2JB4A 1PIV3 3IIIA 2P3IA 3AXDA 3WG4A 4QU2A 4R9BA 4QB2A 5IFPA 2VOWA 4KQ7A 4CEWB 4K21A 1UOGA 1CZTA 5JR7B 3UK9A 2IXIA 3R4UA 4O7XA 5H9PA 4F7ZA 4E8CA 2ZEXA 1OA4A 1RMU3 3NJVA 5C8CB 1H2KA 1H2NA 4QHOA 4SBVA 4GWMA 3SCHA 2VVEA 4CP2A 4TYSA 5KHKA 5C8CA 5IK5A 1I6XA 2RMU1 1A6CA 1UY0A 2ETEA 1N3PA 2X09A 2XH6A 3NVCA 3PVEA 1YRZA 5IVFA 3T0AA 5I8SA 2H6BA 3CNAA 1QXPA 1NKGA 1AUYA 2C0ZA 2D7FA 1X82A 4XUTA 3K2OA 1RITA 3ETPA 1GOGA 1SFYA 5HPOA 2RDSA 1CONA 4LO4B 4Q29A 1PZ8A 3WG2A 1J3QA 2DU0A 4FPYA 1S0EA 2P4EA 5C4WB 5JWPA 5K8SA 1DF0A 2GAUA 3BOWA 4A41A 3T0DA 3JQXA 3RI8A 1VMHA 3HOBA 1J1LA 1R091 2OQ6A 4IE5A 1B35C 1MEC1 1MS4A 1JOBA 2BYVE 2DCKA 5H9QA 3I8TA 4AAPA 3ZR5A 2CSGA 1QJX3 2ZMNA 1FNYA 1TG7A 2RS53 3HJRA 3POGA 3AP5A 3LB9A 2J1UA 1D7PM 4UW3A 4EZHA 5A3TA 3BIEA 4WVMB 3IPVB 2VZVA 4JGYA 5JOZA 5FYHA 3H1WA 4Q1PA 4AW7A 1LRHA 1WZXA 1W6OB 2ZGQA 5K7PA 3DYPA 1G86A 3AL5A 5JXGA 4QDSA 5FYSA 1KITA 5F5IA 2OUHA 1HQLA 4R4XA 5F5AA 4WVMA 3IPVA 3AYEA 3BPZA 2OVUA 3GZEA 1ACCA 1TQ5A 2JE9A 3IAPA 3OG2A 4K1YA 2DDUA 2WR9A 4JHTA 4GD4A 4C0HA 2PN5A 3E97A 3IAQA 2MEV1 1KFXL 2CHHA 5SV5A 3LE0A 1ZBA3 4XETA 5CIRA 5DQ0A 3S30A 4GB31 5I91A 2A3YA 2HWB3 3OPWA 4BE3A 1CESA 4PF1A 2W3JA 4FXGB 4J25A 3FHIB 1TEIA 5JMOA 4AXOA 3ELNA 3POJA 4OQ8A 2ZEZA 4R4ZA 4URAA 5KC5A 1FI2A 3H1YA 4PLOA 5JOWA 5FXVA 2GN7A 3V56A 2VUDA 3CJXA 1GSLA 1JZ3A 3ITQA 1YWKA 3ZFFB 1W0NA 1O8PA 2W47A 3I2IA 1JS9A 4GKYA 4YZ2A 3DYMA 2AZ5A 3NNFA 1PMHX 3OD4A 4CPBD 1IPSA 3M3CA 3RYKA 4OVEA 3ZFFA 1UYYA 2KM2A 4LKSA 4QX3A 3N9LA 5HCBA 1JZ6A 1ZRFA 1HDKA 4Q8KA 2TBVA 1SZBA 2ARXA 1JZ7A 2V09A 2VW2A 2WFF1 3R0RA 2VH9A 1DGRA 1JBCA 2IXJA 4RFRB 4HOOA 5BUVA 1R083 1RUD2 3JXSA 4YVWC 5JIUA 1VRH3 1SLAA 3ZYBA 3V0AB 4DEVA 1FOD3 1TME1 1CAUB 2LM3A 1FMD2 2WIIB 1QMJA 3EO6A 3AMHA 5DUUA 4QPGC 5FZ9A 3WV6A 2QDRA 1G7YA 1OBNA 1FV3A 2UY9A 3V0AA 1QNYA 1O6UA 2LUWA 2IUWA 2E7TA 4KGQA 1IKQA 1UY3A 1WCKA 2DBIA 2D40A 4NHMA 4XTPA 3UJQA 5JXJA 3BTXA 2O8OA 3U07A 3WVJA 4DB5A 3OUJA 3OSDA 2OS2A 2R063 3LD8A 3LDKA 3PHMA 2FBEA 4GH4C 4XF0A 3A21A 3Q8CA 1OH3A 3OUIA 3WF4A 4XBQA 2A1XA 3B5LB 4X8PA 4Y5Z0 4B4RA 4FFHA 4AEDA 3U11A 1UNBA 1RTVA 3CDZB 5BYNA 2Q0AA 1BEV1 4Q4V1 1HB3A 5I0UA 1GZ9A 5EJ1B 1UZZA 4C8DA 1QXRA 3CBNA 4HFSA 1NZIA 4OI4A 1WCDJ 4QB1A 5I0RA 1EAH2 3T1MA 4CP1A 3VKNA 4QD2A 5BXXA 3ACIA 3EHKA 4HVOA 1JOPA 1MQTC 3HQXA 3SC7X 3WDWA 1CAVB 4TLGA 3WLUA 4CP9B 1W2OA 4DXSA 3LIHA 1RHI1 2VL4A 5IVCA 4RA0A 1JH5A 3AX4A 4WBBA 5A3MA 2ZGLA 3VHNA 3WNPA 4CP9A 1CAVA 4LO7A 4E2GA 3IZOA 1N1VA 1JMUB 3JD71 4PHZA 4ZONA 3NJXA 2J1AA 2EIBA 2JEMA 2ZHKA 4A7YA 2GH2A 3GHNA 4NAMA 5LASA 3SH5A 5FKCA 1VMFA 1XC6A 1WA4A 2XJUA 3LAGA 2XJSA 4AVCA 4MV2A 5J48A 3LOIA 3SISA 4Q1RA 4CDWC 4IE0A 4HN1A 4XXAA 3B02A 2ZGOA 2A75A 2VOVA 1LECA 1TMF2 1REEA 3B9CA 2GP5A 1JZ8A 5B4XA 5ABJA 1X33A 5FUNA 3C7HA 5GZFA 3AZVA 3PVOA 4H7LA 1Q5OA 1WMFA 5A6XA 3RZLA 5K4LA 4FOVA 4YW2A 3PTYA 5F7UA 1TZOA 1AVBA 2VQ0A 2BVVA 2IC1A 4RS5B 4XURA 3MV01 4K6BA 5JXHA 4COVA 4DINB 5FWEA 3AKRA 4HKOA 4LLFA 4AK3A 2BWAA 5T50A 2CU5A 3PMEA 3D0SA 4QQPA 3VBUC 2WAOA 1F31A 3IMMA 4A44A 1OA2A 3D8CA 1S0GA 4IEPA 1DGWA 2DF7A 4AQ6A 1NA1C 3PNAA 3IM0A 2QVSB 3I3DA 2OZ6A 4LK7A 4YPJA 4B7KA 2W68A 1DIWA 3A22A 4KG8A 3T4VA 1X9PA 3MW4A 3VBOC 3VZLA 3ZXDA 4AFCA 4QQOA 3THDA 2OPKA 2WLPA 4YFZA 3AZZA 3N9NA 3Q9OA 3WDYA 5IK7A 3C7FA 4UT5A 4EROA 4Q4Y2 4JKKA 4PJYA 1UN1A 1BMV2 1NCQC 5FYIA 4IV1B 2WZPP 1OPOA 4CU6A 4ZZ8A 2YFUA 2XPJA 1HKDA 3FX3A 4HVRA 4I02A 1MS8A 4EV0A 1GWKA 2OQ7A 4LBOA 2B8MA 3PVBB 4XXPA 4FAGA 2ZEYA 4OHVA 1GOHA 5LWBA 4FPEA 1WW6A 3POWA 1UW8A 1PX4A 1MPXA 2D98A 1LEMA 1UU4A 1PIV2 3WDTA 4ET7A 3ACFA 2UYAA 2VU9A 4FP2A 1RVF1 4AWDA 1H30A 3B94A 4AHXA 4QHBA 4UW4A 4XFIA 3RMXA 5GZEA 2AACA 2VBPA 1AL21 4Z07A 1RMU2 2QJVA 2D6LX 5CFCA 1BHGA 2BJSA 3FC0A 3MHZA 5FZ6A 1C4RA 4BQ2A 3TEZA 2R30A 4R9AA 3OUHA 2PLV3 5EPAA 3KHBA 2XJTA 1RUJ3 2PQQA 5EYYA 5JIAA 3S7EA 1SDWA 2YU2A 1YXWA 4YRDA 4DFSA 5FDBA 1W2AX 3N9OA 4KNCA 1PNFA 2QQWA 3NV2A 3ZXKA 2TUNA 4FPOB 4YZ5A 1QJZA 4IGOA 4N43B 4IGQA 2VULA 4URTA 5FJKA 1AR83 5EJZB 1OOPC 1GUIA 3T3YA 3B01A 2XG3A 5FZDA 4N43A 2RS33 4BB3A 2ZX0A 5ACA1 2UWCA 5F9TA 5GKAC 3AP9A 1ZA7A 3HBZA 1O7FA 2QDNA 4XIOA 1GZWB 1LHNA 2RR13 5GZCA 2Y6GA 1J58A 3NRUA 1LHWA 4JDMA 3ZFGB 2Y6FA 4E2SA 2EA7A 4D94A 1V6LA 3UKTA 3HQRA 3I2FA 3N3HA 4A4AA 1AYM1 2ZAAA 3LWCA 1GZWA 2R043 5JSPA 5HCHA 1OURA 3C2UA 3ZFGA
chains in the Genus database with same CATH topology
5IVBA 5A3NA 4GD4A 3LDBA 3PUSA 3PUQA 2WWJA 5FXZA 5A3PA 2GP5A 3PTRB 3PDQA 5LY2A 2Q8CA 5FUNA 2YPDA 5FPVA 5A7QA 5FP3A 3OPWA 5FZKA 5FYCA 3UYJA 4ASKA 4NUBA 4CCOA 4E4HA 4Y33A 5FPLA 3PU8A 4QXHA 5FJHA 5FZAA 5K4LA 5FP7A 4V2VA 5A7PA 4BISA 2Q8DA 3AVRA 5FYTA 3ZPOA 5FZGA 5A80A 2VD7A 4D6RA 3KV5A 3PURA 4LXLA 5FP8A 5FWEA 5FZ4A 5FZLA 4QXCA 5FXVA 3DXTA 5A7SA 5F3CA 3PUAA 4LITA 4IGPA 3KVAA 5FV3A 2WWUA 5A1FA 5FPBA 3KV6A 5F5CA 4QX7A 5A7OA 5FZOA 4UF0B 5IVEA 5F37A 5FY0A 2XDVA 5FBJA 3N9LA 5IVVA 3N9NA 2GP3A 3K3NA 5F2WA 5FYZA 3AL6A 5IWFA 3OPTA 4CSWA 3NJYA 5FYIA 5FY9A 2Q8EA 4URAA 4DIQA 5F3EA 4HOOA 5FP9A 4TN7A 2XUEA 5F39A 2OQ7A 4CCJA 3KVBA 3RVHA 4D6SA 4V2WA 5FZ1A 5LWBA 5FZ3A 5E6HA 5FZ9A 5FZIA 5IVYA 3K3OA 5FZFA 4LIUA 4HONA 5FXWA 5FZ8A 2P5BA 4XDOA 2XXZA 5FY8A 4EYUA 4EZ4A 5FYMA 5FZBA 4QXBA 5IW0A 5IVFA 2PXJA 1VRBA 4CCLA 4QX8A 3KV4A 3ZLIA 2OS2A 3LD8A 5ISLA 4Y3OA 4UF0A 5FZEA 3K2OA 5FP4A 5FZ6A 5A3WA 5FZ0A 5ANQA 2YBKA 2YU1A 5A7WB 3AVSA 4BU2A 5FY4A 5FZ7A 2YU2A 4C8DA 3U78A 4QWNA 5FWJA 5A7WA 4CCNA 3N9OA 3N9MA 5FY1A 5FXXA 4GJYA 5FPUA 2OT7A 2XMLA 4GAZA 5F32A 4BXFA 4LIVA 2OQ6A 3DXUA 5F3IA 2YBPA 5FYBA 5FZCA 5A7NA 4CCMA 4IGOA 4IGQA 5FJKA 4AAPA 5IVCA 5FPAA 5FZDA 4GJZA 3N9PA 4EZHA 5A3TA 5CEHA 2OX0A 3N9QA 3PU3A 4D6QA 5FYVA 5FYHA 5FY5A 4CCKA 2YBSA 4AI9A 5IVJA 5FZHA 5LW9A 3U4SA 5FYUA 4CUGA 2W2IA 4QU1A 4XDPA 3AL5A 3KV9A 5FYSA 5F5IA 5F5AA 5FZOB 4DO0A 5FZMA 5KR7A 5FYYA 4Y4RA 5F3GA 5F2SA 5A1LA 5LY1A 5FUPA 5FY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IVB A;  5A3N A;  4GD4 A;  3LDB A;  3PUS A;  3PUQ A;  2WWJ A;  5FXZ A;  5A3P A;  2GP5 A;  3PTR B;  3PDQ A;  5LY2 A;  2Q8C A;  5FUN A;  2YPD A;  5FPV A;  5A7Q A;  5FP3 A;  3OPW A;  5FZK A;  5FYC A;  3UYJ A;  4ASK A;  4NUB A;  4CCO A;  4E4H A;  4Y33 A;  5FPL A;  3PU8 A;  4QXH A;  5FJH A;  5FZA A;  5K4L A;  5FP7 A;  4V2V A;  5A7P A;  4BIS A;  2Q8D A;  3AVR A;  5FYT A;  3ZPO A;  5FZG A;  5A80 A;  2VD7 A;  4D6R A;  3KV5 A;  3PUR A;  4LXL A;  5FP8 A;  5FWE A;  5FZ4 A;  5FZL A;  4QXC A;  5FXV A;  3DXT A;  5A7S A;  5F3C A;  3PUA A;  4LIT A;  4IGP A;  3KVA A;  5FV3 A;  2WWU A;  5A1F A;  5FPB A;  3KV6 A;  5F5C A;  4QX7 A;  5A7O A;  5FZO A;  4UF0 B;  5IVE A;  5F37 A;  5FY0 A;  2XDV A;  5FBJ A;  3N9L A;  5IVV A;  3N9N A;  2GP3 A;  3K3N A;  5F2W A;  5FYZ A;  3AL6 A;  5IWF A;  3OPT A;  4CSW A;  3NJY A;  5FYI A;  5FY9 A;  2Q8E A;  4URA A;  4DIQ A;  5F3E A;  4HOO A;  5FP9 A;  4TN7 A;  2XUE A;  5F39 A;  2OQ7 A;  4CCJ A;  3KVB A;  3RVH A;  4D6S A;  4V2W A;  5FZ1 A;  5LWB A;  5FZ3 A;  5E6H A;  5FZ9 A;  5FZI A;  5IVY A;  3K3O A;  5FZF A;  4LIU A;  4HON A;  5FXW A;  5FZ8 A;  2P5B A;  4XDO A;  2XXZ A;  5FY8 A;  4EYU A;  4EZ4 A;  5FYM A;  5FZB A;  4QXB A;  5IW0 A;  5IVF A;  2PXJ A;  1VRB A;  4CCL A;  4QX8 A;  3KV4 A;  3ZLI A;  2OS2 A;  3LD8 A;  5ISL A;  4Y3O A;  4UF0 A;  5FZE A;  3K2O A;  5FP4 A;  5FZ6 A;  5A3W A;  5FZ0 A;  5ANQ A;  2YBK A;  2YU1 A;  5A7W B;  3AVS A;  4BU2 A;  5FY4 A;  5FZ7 A;  2YU2 A;  4C8D A;  3U78 A;  4QWN A;  5FWJ A;  5A7W A;  4CCN A;  3N9O A;  3N9M A;  5FY1 A;  5FXX A;  4GJY A;  5FPU A;  2OT7 A;  2XML A;  4GAZ A;  5F32 A;  4BXF A;  4LIV A;  2OQ6 A;  3DXU A;  5F3I A;  2YBP A;  5FYB A;  5FZC A;  5A7N A;  4CCM A;  4IGO A;  4IGQ A;  5FJK A;  4AAP A;  5IVC A;  5FPA A;  5FZD A;  4GJZ A;  3N9P A;  4EZH A;  5A3T A;  5CEH A;  2OX0 A;  3N9Q A;  3PU3 A;  4D6Q A;  5FYV A;  5FYH A;  5FY5 A;  4CCK A;  2YBS A;  4AI9 A;  5IVJ A;  5FZH A;  5LW9 A;  3U4S A;  5FYU A;  4CUG A;  2W2I A;  4QU1 A;  4XDP A;  3AL5 A;  3KV9 A;  5FYS A;  5F5I A;  5F5A A;  5FZO B;  4DO0 A;  5FZM A;  5KR7 A;  5FYY A;  4Y4R A;  5F3G A;  5F2S A;  5A1L A;  5LY1 A;  5FUP A;  5FY7 A; 
#chains in the Genus database with same CATH topology
 2HWD 1;  4AHW A;  2QZ2 A;  1MVQ A;  2J1R A;  4LBQ B;  5FQ0 B;  2CNA A;  3IB3 A;  4FOQ A;  2YC4 A;  5KBF A;  4CCD A;  2BNM A;  2BGP A;  5CKN A;  5JXI A;  1A34 A;  1JTZ X;  3CO2 A;  1ENQ A;  4LBQ A;  3IWZ A;  2LRO A;  3M1H A;  1DZQ A;  4JC1 A;  2QBX A;  2WNU A;  4GQ7 A;  1W2T A;  5FJH A;  3FUO A;  4YVS B;  1ZRR A;  3MIG A;  4JRL A;  5GLZ A;  4CDX C;  2BBV A;  3OBZ A;  4BIS A;  4WM8 C;  3BTA A;  2ZX2 A;  4RL7 A;  4XOG A;  3TWI A;  4K40 A;  1YC6 1;  2EXH A;  2Z42 A;  1NZC A;  1T6B X;  3OPZ A;  4IQP A;  4YVS A;  4ZU4 A;  4AVS A;  1JZ5 A;  1Y3T A;  2RMU 3;  2HWC 1;  3TB0 A;  2OUJ A;  4YSF A;  2HWB 2;  2WO2 A;  3FFZ A;  4AGG A;  1ULF A;  5BNP B;  4QX7 A;  2FDH A;  5FZO A;  1KJL A;  2EXI A;  4GIQ A;  4LMF A;  1BZW A;  2VQU A;  2JDM A;  1ULE A;  3MDP A;  5KXC A;  1F15 A;  2ZHL A;  4UFL A;  2J1S A;  1V00 A;  4Z92 B;  3WT3 A;  2JG9 C;  1H8T B;  3U4X A;  4FTE A;  2PAK A;  1W06 A;  2KR2 A;  2VM9 A;  2ZBJ A;  4MLO A;  4BLI A;  4BA6 A;  2G9G A;  4DY5 A;  1UY4 A;  3BI3 A;  1ENR A;  1H8T A;  4QM8 A;  2K46 A;  5FBZ A;  3SNM A;  3WP4 A;  1F35 A;  4MXW A;  3VGI A;  4FBF A;  2JDH A;  2HWF 1;  4XAB A;  1AR9 1;  1W0O A;  3T1L A;  1QWR A;  1R09 3;  4BWO A;  4CRQ A;  3BU0 A;  1YJL A;  1MEC 3;  1UXZ A;  1YQ8 A;  4XYX A;  5E6H A;  1Z7S 2;  3CHX A;  5A6Q A;  5FZI A;  4NVP A;  1X36 A;  5GM0 A;  4Y22 B;  3ZYH A;  3FHQ A;  3ZXJ A;  5A33 B;  4AFM A;  4AI8 A;  4EWD A;  1FPN 3;  4IV3 C;  2CWM A;  1J3R A;  1SLL A;  1VBC 1;  3TYJ A;  4JZR A;  5JAX A;  1VRH 2;  2BU9 A;  3ORJ A;  1HB1 A;  1W6N B;  3FLT A;  5L36 A;  4COY A;  2X53 S;  1FOD 2;  1VBA 2;  2BBA A;  1VP6 A;  3LA2 A;  2VMI A;  4Y5S A;  2ZGS A;  2GME A;  5LA9 A;  4NE9 A;  2R1D A;  3LSD A;  2DTW A;  3WR0 A;  1VAM A;  5E89 A;  1N3O A;  2HEW F;  4NOT A;  3M3O A;  3WD5 A;  2AEY A;  4CDQ C;  1UWW A;  4CU9 A;  3DGT A;  4LTA A;  3VUO A;  4IE4 A;  4QWN A;  5I0T A;  5L19 A;  1DQ5 A;  1GR3 A;  2HBT A;  2WNV B;  2MEV 3;  3LEI A;  2LRP A;  2XML A;  3JBG 1;  2R06 2;  1QKQ A;  1KJR A;  1VBB 1;  1XXN A;  5FUI A;  4GB3 3;  5JSO A;  4OHW A;  1VB4 A;  3GZA A;  1L7R A;  4HK8 A;  3MLL A;  4FVV A;  4XF3 A;  3GF6 A;  5EJ3 A;  4OHX A;  2PA7 A;  5DAQ A;  2CGN A;  2VOX A;  3ZN4 A;  1VBE 1;  1QJY 1;  1SG3 A;  1BKZ A;  4IDZ A;  3MBW A;  3MYX A;  4LO5 B;  3BU7 A;  4HPK A;  4P9I A;  2ZZJ A;  3I59 B;  4W50 A;  5FMC A;  5GLV A;  3VBS C;  1UIK A;  2E6V A;  4AI9 A;  5JZG C;  3DN7 A;  5LW9 A;  1CPN A;  4MGS A;  1OD5 A;  4LT5 A;  2YZ4 A;  5JI9 A;  5DAX A;  5LCW L;  1E5I A;  1TVG A;  2LAL A;  3I59 A;  5C3R A;  4OLL A;  5FMB A;  3LPF A;  4BYY A;  4RQP C;  4XFF A;  5HBA A;  2J1E A;  3DL3 A;  4QGN A;  2R7E B;  1YI7 A;  2QUO A;  2UYB A;  1PK6 C;  1H1A A;  1LOE A;  3JB8 A;  3M4F A;  3KS7 A;  3VKO A;  2Q1Z B;  5LY2 A;  1NE4 A;  3L9J T;  4HKL A;  5D8A C;  2WFF 3;  2W5F A;  2YPD A;  3PUH A;  4BQX A;  2PYT A;  1O59 A;  3MIE A;  4YW6 A;  3UYJ A;  3C7O A;  1PGW 1;  4CUC A;  4COZ A;  3WW3 A;  2F6B A;  1CIW A;  3WQB A;  1OKQ A;  4EN9 B;  3S57 A;  4LKE A;  5J3U A;  3WUD A;  1JYN A;  1UMH A;  2E32 A;  5DZE A;  1TME 3;  3MFA A;  3ZR6 A;  4LXL A;  5FZL A;  1RJ7 A;  2A73 B;  3ZDS A;  3TOJ A;  3INA A;  3OBA A;  4UFM A;  3ALQ A;  3KVA A;  2RM2 2;  4UW5 A;  3WF0 A;  1X7N A;  3H50 A;  4RD7 A;  2HLE A;  3NAP C;  4MX3 A;  1XYN A;  1AX2 A;  3I7D A;  3MIH A;  4Q4W 2;  3N7M A;  3C7E A;  4AQT A;  5D21 A;  1JYT A;  1V6I A;  2DWR A;  5IVE A;  4W65 A;  3ZO0 B;  3O14 A;  5FY9 A;  2JDN A;  2WYS A;  2WT0 A;  3BN6 A;  5T52 A;  1MS3 A;  1PO1 1;  1R1Z A;  1AR6 1;  1YO8 A;  4UXA A;  1JW6 A;  1OVP A;  1U5Z A;  4NRM A;  2YC2 A;  1JYW A;  2VUC A;  1COV 3;  1BEV 3;  2JEN A;  2XLF A;  4Q4V 3;  1WGP A;  1ND2 C;  3MW3 A;  3VDA A;  5C5U A;  3A23 A;  3Q8E A;  4M0N A;  3P5B A;  4OYU A;  1VMJ A;  1LJ7 A;  3OY8 B;  4J6G A;  1AXZ A;  2PHT A;  4JGZ B;  4Y1U A;  3U75 A;  1EV1 1;  4XFA A;  4ARY A;  4CCJ A;  4QB6 A;  3HNM A;  3P6B A;  4QKN A;  4XJA A;  4NAO A;  3TN9 1;  1Q43 A;  3WDV A;  2FZ2 A;  1C1F A;  4YFW A;  1RHI 3;  1ZRC A;  3T09 A;  4FTB A;  1RUI 1;  2PHW A;  5IT6 A;  2P5B A;  1LOC A;  3NNG A;  4N53 C;  1W90 A;  2WNE A;  4AVB A;  1Q8O A;  3JD7 3;  1S1A A;  1ST8 A;  2EID A;  2Q30 A;  1W8N A;  2P6C A;  1A8D A;  1UX6 A;  4MET A;  3OBT A;  2LTN A;  5BNN C;  1QQP 1;  4Y3O A;  2CGP A;  2ADE A;  2CWS A;  2KA3 A;  5FIX A;  1G9B A;  2JE8 A;  2H0V A;  2H0B A;  1L7Q A;  1TNR A;  2GDF A;  2BVB A;  1OXC A;  2GNM A;  4M3C F;  2ZZQ A;  3W58 A;  3SXW A;  4XAA A;  5DG1 A;  1RUG 1;  3ZMO A;  5FXX A;  4AQS A;  1YI9 A;  3HQU A;  1W0P A;  4RHV 1;  3DYO A;  3SKV A;  5C3O A;  1H6X A;  3OYW B;  3QAC A;  3WP5 A;  4PDW C;  4Q0V A;  4OI0 A;  1L3J A;  3R05 A;  2AEN A;  1H9P A;  1W3V A;  1YCI A;  2PLV 2;  3OF1 A;  2BGO A;  1RUJ 2;  1YQC A;  1A8M A;  2YV8 A;  1DGL A;  1IKP A;  1IG3 A;  5L9V A;  1W99 A;  1NCR B;  4Y4Y A;  3JB4 C;  1VIW B;  2VTX J;  4R8H A;  2RS1 2;  4KL1 A;  3ZX7 A;  4QKB A;  4DUX A;  1PHM A;  1NCR A;  3A0K A;  1CAW A;  1UZV A;  2XB6 C;  4LEJ A;  1GNZ A;  3J8F 2;  2GNB A;  4LBK A;  4CPB A;  3VDD A;  1NY7 1;  4MUV A;  4HSJ A;  4CDU B;  1NX9 A;  2ARA A;  4LA2 A;  2RVA A;  4NPR A;  5DAB A;  2B45 X;  3O1S A;  3AZY A;  3VZJ A;  2EAK A;  1LOD A;  4CVU A;  2RS3 2;  4Z2W A;  2CYF A;  2JDY A;  5L9B A;  4CDU A;  5APA A;  1OFS A;  5FXZ A;  3I3Q A;  4CYD A;  1OUS A;  4NHY A;  1F4A A;  2NM1 A;  2RR1 2;  1W9T A;  2DFB A;  4B4Q A;  3AZW A;  1UY1 A;  3PDQ A;  2Q8C A;  2A3X A;  4DQA A;  5FPV A;  1ULD A;  2H6C A;  2ZKL A;  1I3H A;  4AI2 A;  4TLF A;  4Y33 A;  5DN2 A;  3J26 N;  1DDL A;  4IE6 A;  3RZK A;  1HN1 A;  1JN2 P;  2F4L A;  4JGY C;  4C0B A;  1JU4 A;  3KV5 A;  2I07 B;  2YMZ A;  4RGA A;  4WM7 B;  5T5J A;  4C1X A;  4E9K A;  5A7S A;  4RR3 B;  4P00 B;  1SFN A;  3GCX A;  3HEI A;  1PGS A;  3HR9 A;  1JZ4 A;  3VL8 A;  3V65 A;  1S2B A;  2WQ8 A;  4RR3 A;  1AL2 3;  3RWK X;  4AI3 A;  1XYO A;  4O9G A;  4XFH A;  5F37 A;  4NJ4 A;  2XDV A;  4NIH A;  5FBJ A;  1V6K A;  5GJ6 A;  3N7J A;  3I3B A;  4DRV A;  1HQN A;  3JCI A;  3IDC B;  3K3N A;  4CEY B;  4YW7 A;  2B9U A;  2ORX A;  1BYH A;  1K42 A;  1C8M 1;  4Z1V A;  5GLW A;  5B4N A;  4QPI C;  2R1B A;  2DVA A;  1RL3 A;  1IS6 A;  3APB A;  3VZM A;  3SCF A;  4ASL A;  1W9W A;  5CAZ A;  3T08 A;  5LAT A;  5DZF A;  4ZHN A;  1PMJ X;  1J84 A;  4OUE A;  3EB7 A;  1OLR A;  2BEO A;  3AYD A;  1UKR A;  2QQN A;  2W52 A;  5IAT A;  5JDB A;  2ZX3 A;  4EN8 B;  3VBR B;  2LW8 A;  2ZMK A;  1W9Y A;  3IMN A;  3VBH C;  2QE3 A;  2YHJ A;  4B1M A;  1KRI A;  3ATG A;  1DBN A;  4QXB A;  5IW0 A;  2ILM A;  3VBR A;  5DMY A;  2ZX4 A;  4CU7 A;  3VBF B;  3O12 A;  1R09 2;  4ZXK A;  3DKW A;  1MEC 2;  2DCJ A;  3ILN A;  3J7N A;  4XUN A;  5FZE A;  4R9C A;  1FAY A;  5FP4 A;  5A3W A;  3UJO A;  4BK4 A;  1AYM 3;  2FZ1 A;  4FPL A;  5ANQ A;  3VBF A;  2B5H A;  5LBF A;  3M2M A;  3PIJ A;  2E9Q A;  2ZGP A;  2IWG B;  1J59 A;  3ZFE B;  5FY4 A;  1MS5 A;  3CZJ A;  1OPM A;  2P2K A;  5GZD A;  4CE8 A;  2C9K A;  1FPN 2;  1U12 A;  4CEW A;  1YEW A;  3SH4 A;  4XHX A;  3MUZ 1;  1N1T A;  1WBF A;  3PUI A;  5EP9 A;  3WG1 A;  3D82 A;  2GNT A;  4GAL A;  1GZT A;  2ZAB A;  4DXZ A;  1E5R A;  1QEX A;  1LHV A;  1J3P A;  1WCQ A;  3AJY A;  1VR3 A;  5LBB A;  1RUO A;  4GJZ A;  3VL9 A;  3SQO A;  4XZU G;  1WMD A;  2D6K A;  2MEV 2;  3N9Q A;  3PU3 A;  4L0P A;  1JYI A;  1JZ2 A;  4NIA A;  4B1L A;  1PZ7 A;  5GAL A;  5C71 A;  2FDI A;  2W0X A;  2HWC 3;  3H3Z A;  1D4V B;  2V4V A;  3RMY A;  3VHO A;  1CPM A;  1UYZ A;  2QCS B;  3MUY 1;  4YG3 A;  4L2N A;  5FYY A;  5FZM A;  5T5L A;  4AED C;  2FCT A;  4XF9 A;  1FAT A;  4EN0 A;  5A1L A;  5LY1 A;  4MGT A;  3VV1 A;  2Z5W A;  1RUC 1;  1LU1 A;  1CX1 A;  1MZ6 A;  3I2G A;  4KWL A;  5KHJ A;  2CL2 A;  2ZA9 A;  3AP4 A;  3PUS A;  3RJ2 X;  1XE8 A;  1R64 A;  4A7Z A;  1KEX A;  5C4W A;  1V9U 1;  2K0G A;  2WAA A;  3DPR C;  5LBC A;  2Z2S B;  1S0B A;  4AFD A;  1Y9Q A;  3GXU A;  5FMO S;  1G9C A;  3ZYG A;  4QXH A;  5FZA A;  2DCT A;  2HWF 3;  1AR9 3;  4Y1Y A;  1H1I A;  5KXD A;  4LE4 A;  4PIY A;  1STM A;  1V0A A;  2PHX A;  2WO3 A;  2ZGM A;  3AP7 A;  4IEQ A;  2B42 B;  5F8P A;  3NNM A;  1ZBE 1;  2W08 A;  3VDB A;  5C3P A;  4JAA A;  2WFF 2;  1ZNP A;  3IDB B;  3IT8 A;  2Y6L A;  4CTE A;  1W6O A;  4M3C B;  1MVE A;  4EN7 B;  1LED A;  3UV9 A;  1YYN A;  4Q0Q A;  5A7O A;  3CQO A;  1UYP A;  1VBC 3;  2WLQ A;  1ZYB A;  3T4H B;  3AKQ A;  1TME 2;  1IGO A;  1W8T A;  1W8O A;  5ABJ C;  4BDV B;  4A6O A;  4CSW A;  4OZO A;  1S2K A;  1LOA A;  2C1F A;  3HD8 B;  4Y1Z A;  5DDJ 1;  1JUH A;  2XUE A;  1MZE A;  3JBG 3;  1VBB 3;  4FFF A;  1Y7B A;  2ET7 A;  2VBD A;  3OTF A;  4FI9 A;  4MXV A;  1DQ2 A;  3CIH A;  2VTF A;  2WN2 A;  4Z8B A;  3OGV A;  2JG8 B;  1COV 2;  1BEV 2;  3HVD A;  2L9L A;  4M01 A;  3B69 A;  2XXZ A;  4XDO A;  1VBE 3;  3RSJ A;  1QJY 3;  1DZT A;  2VCB A;  4BQ5 A;  3ZSL A;  4FXK B;  3NV3 A;  4OCT A;  5F6K A;  2P3K A;  1GQP A;  4QM9 A;  5C9A B;  5AC9 3;  4YGB A;  3WQ7 A;  4WVW A;  4CCE A;  4DUV A;  5A6Z A;  3BAL A;  1AYN 1;  2E33 A;  2XQX A;  3WCR A;  2C26 A;  5FLJ A;  4IL7 A;  5FZ0 A;  3WNO A;  4HG6 B;  1VAK A;  1KS4 A;  2P37 A;  4ITC A;  4XCA A;  4MYE A;  5C9A A;  2C5D A;  2VQT A;  1FT9 A;  1S2E A;  2VY0 A;  4BU2 A;  2W1U A;  5FZ7 A;  3JD7 2;  4A2U A;  3QH6 A;  2WZE A;  5IHR A;  4NMI A;  4QQL A;  4W6X A;  3WQ0 A;  4UBH A;  4BXF A;  1NLQ A;  2VW0 A;  2ZS6 B;  3FBM A;  5JMC A;  5D1I A;  4Y24 A;  1BXH A;  1AJK A;  2E26 A;  2VNV A;  3FBY A;  4NHX A;  2WNO A;  4E27 A;  3LGR A;  1CAU A;  3ES1 A;  2WRA A;  3O1V A;  2EIC A;  3TEX A;  2HBU A;  1R1A 2;  5AVA A;  4F3J A;  1JI6 A;  2Q5T A;  2VME A;  3CL1 A;  5L7O C;  2BW8 A;  1NQJ A;  5FPX A;  3K4A A;  1W28 A;  5CFC C;  3KZ4 C;  5FZH A;  1Y43 B;  4Q27 A;  3WIN E;  2BNN A;  4XDP A;  3POS A;  3GBF A;  3L2H A;  3RDI A;  4PBP A;  1UOF A;  5DUV A;  2VZS A;  5C8W A;  4OI1 A;  2Y34 A;  5F2S A;  1IQD C;  1VJ2 A;  1LGC A;  2ZHM A;  1SCS A;  2PHL A;  5DAW A;  4LPL A;  1BQP A;  1AZD A;  1NLR A;  2VZU A;  1HXS 1;  3D3A A;  4NHL A;  2XHN A;  4JRA A;  4YZ1 A;  2EVX A;  1J1T A;  3CF6 E;  1PO1 3;  2R0H A;  1AR6 3;  3PJY A;  3KLS A;  2ES3 A;  4PBO A;  2X29 A;  3O1R A;  3GCW A;  2W87 A;  3MF6 A;  1G8W A;  4RN5 A;  5KC6 A;  5EIY B;  1PX3 A;  4NUB A;  1YHF A;  2A6W A;  5FPL A;  1RB8 G;  3RRD A;  3GJA A;  3H1M A;  2JKX A;  5JVV A;  5FPZ A;  4KBB A;  2ARC A;  1XE0 A;  2BV4 A;  3AVR A;  1VBD 2;  4LUK A;  4P9J A;  5FYT A;  1B35 B;  5A3O A;  2Q8D A;  3TN9 3;  2J1V A;  3CEW A;  4H14 A;  4GKX A;  5FZG A;  2FD8 A;  3ZIX A;  4D6R A;  3PUR A;  5FP8 A;  3LCP A;  1RUI 3;  4YM2 A;  1IZ3 A;  4KWJ A;  3I54 A;  1NYW A;  4WZC A;  3S6P A;  2PHR A;  1B35 A;  4G9S B;  2VZQ A;  4MHR A;  3KV6 A;  3W20 A;  2C24 A;  1RUN A;  1GP6 A;  1QQP 3;  1OA3 A;  1RUH 1;  3N7L A;  3I3E A;  2ORZ A;  1UMZ A;  2GU9 A;  4PLN A;  4QT6 A;  3TNQ A;  1PNG A;  2GND A;  2XJV A;  2XL9 A;  3OGS A;  1AXY A;  1ZZ7 A;  1U5X A;  1FMD 1;  3GJB A;  4I3P A;  3T30 A;  2WNU C;  1RUG 3;  2GH8 A;  2QZ3 A;  1AL2 2;  2VZR A;  2F4P A;  4B3N A;  2Y0I A;  4GWN A;  3FMG A;  2VMH A;  3S0M A;  1DP0 A;  1IG0 A;  1QGL A;  4MH0 E;  4UYB A;  1CQ9 A;  3EMR A;  4HN0 A;  3AMQ A;  4RS5 A;  4OUM A;  1PM4 A;  4QAW A;  3RNS A;  5FXW A;  2VMD A;  5KWR A;  4EYU A;  2IFW A;  3Q8F A;  4JTN A;  3WF3 A;  3X29 B;  2X8K A;  3WNN A;  4AGV A;  5KXB A;  2VG9 A;  2D93 A;  2HWE 1;  3K46 A;  2VAU A;  4XFG A;  4ATE A;  4Q26 A;  4E8D A;  2R49 A;  5GZG A;  3GDB A;  1S0I A;  2G9F A;  1CZS A;  4LK6 A;  2KXL A;  4WVV A;  5T3N A;  4IEV A;  2CV6 A;  4P02 B;  4YW1 A;  2ZKN A;  2ID4 A;  2SLI A;  3MLJ A;  2G19 A;  1UPI A;  1BBT 2;  1XND A;  2DVG A;  3FLR A;  4IV1 A;  4PIX A;  3T2T A;  4ES9 A;  2QQL A;  3U0Z A;  4GAZ A;  5F6L B;  5FZC A;  4DNY A;  5J36 A;  2NN8 A;  1RXG A;  2XL7 A;  4O61 A;  4Q2F A;  4BQW A;  3OEA A;  4RGG A;  4Q4X 3;  4HT1 T;  1WME A;  2J22 A;  3O7O A;  4JQT A;  4XJU A;  4YVW B;  1REF A;  4EWA A;  1JYV A;  2B7Y A;  1A3K A;  1V6M A;  4IEZ A;  4TWT A;  3UT0 A;  4AHZ A;  4DXT A;  3POI A;  4QPG B;  2D43 A;  4XUQ A;  4TSV A;  1KDM A;  1UU5 A;  4CUG A;  3BGA A;  3LA7 A;  2EIE A;  3AZX A;  1OQD A;  5FK7 A;  1UYX A;  4QPG A;  4S2H A;  4Q5O A;  1WLT A;  4FOY A;  5F3G A;  2BNO A;  3ZMN A;  2W1W A;  2AH2 A;  5FK8 A;  4IXL A;  5C6C A;  2WSU A;  5CFD C;  3W5M A;  4GH4 B;  3TEW A;  1LUL A;  4N7U A;  5FAX A;  3PUQ A;  4P9Y A;  3F2Z A;  4SLI A;  5DAV A;  4D7S A;  4L99 A;  4Y5T A;  1C8M 3;  2HWC 2;  1AXK A;  4GH4 A;  3WCS A;  1G9F A;  5A70 A;  4XW3 A;  3AM2 A;  1C8N A;  4FO9 A;  4ASK A;  3CMG A;  4PQ9 A;  1K5J A;  1PO2 1;  2BTV C;  4D69 A;  5FP7 A;  3PJQ A;  3TNP B;  1MQT B;  3C3V A;  3ZPO A;  2QQK A;  4A3Z A;  4LO6 B;  5F5Q A;  4P9W A;  2JE7 A;  2PAE A;  2QQP A;  2OW4 A;  4EN6 B;  3AYA A;  3DKQ A;  1MQT A;  1AHS A;  1ZZC A;  1QJX 2;  3SEP A;  1ND3 C;  2RS5 2;  1PVC 1;  1RUE 1;  3ZYF A;  4KWK A;  2BFU S;  1FXZ A;  2HWF 2;  2KD7 A;  2VO5 A;  4LO8 A;  3IDA A;  1F5J A;  4ZY9 A;  3H7J A;  1O3Q A;  4DRR A;  2YXS A;  4W6Y A;  2QFE A;  2FDG A;  3RZJ A;  1IQA A;  3OCP A;  3GZU C;  4L8Q A;  3VZN A;  5F2W A;  5FQ0 A;  2GSY A;  2C6S A;  4CDW B;  2W94 A;  3I3M A;  4QQ2 A;  2BUK A;  1NT0 A;  3MI8 A;  2PMW B;  2X5I C;  1HW5 A;  2W92 A;  1IS3 A;  4DIQ A;  3E1F 1;  5CB7 A;  4AVV A;  1QU0 A;  2FHR A;  5SV8 A;  1XNK A;  2QQV A;  3O0X A;  3I2K A;  4F83 A;  1POV 1;  3HIF A;  5CG9 A;  1KDK A;  1GZC A;  1O4Y A;  3CJI B;  4B4P A;  1ZBA 2;  3ES4 A;  1O4T A;  2HJI A;  3UES A;  2HH9 A;  1ZA4 A;  5A32 B;  3AKP A;  4NII A;  1LTE A;  2D5H A;  3V0B B;  3AFG A;  3CJI A;  4XAC A;  3S5A A;  1PZ9 A;  5FY8 A;  2P34 A;  2WZ8 A;  1LCL A;  5T5O A;  5H9R A;  2CAU A;  1UZ0 A;  5K0U C;  3LA3 A;  3ZYR A;  3FE5 A;  3VKL A;  4KU7 A;  5BNP A;  1PVX A;  3V0B A;  3I2D A;  4XEZ A;  4MVT A;  1VBB 2;  3VBU B;  3WNM A;  3ZLI A;  1MAC A;  4YNI A;  1W6Q B;  4X6Q B;  1W6M B;  1WW5 A;  2GMM A;  1RUF 1;  1C5I A;  4H7M A;  4I0A A;  3RZG A;  2QQO A;  1NA1 B;  2YBK A;  3M70 A;  4OUL A;  1SHW B;  2EAA A;  4YZ3 A;  3VBU A;  5BY5 A;  1RUC 3;  1HQW A;  1W6Q A;  1W6M A;  5JCT A;  1VBE 2;  3VBO B;  1FX5 A;  4MGQ A;  3B7M A;  1NA1 A;  5J96 B;  3E5Q A;  2E7Q A;  4A6S A;  3E6D A;  3MEP A;  1XNA A;  4BM8 A;  2RJL A;  2W1S A;  1T2X A;  2ARB A;  3SEE A;  4QKF A;  3ILF A;  1V9U 3;  5F32 A;  5AC9 2;  3VBO A;  3UKN A;  3N4M A;  5CAD A;  1QNW A;  1DYK A;  1NCQ B;  1SDD B;  1V70 A;  4HL0 A;  4XFC A;  1EPW A;  2P1B A;  3OGG A;  4IEW A;  1J83 A;  4FPC A;  2BZD A;  4K8F A;  2FMY A;  4W8J A;  1DHK B;  4LNV A;  3USS A;  2MPF A;  3TEY A;  4Z2A A;  1ZRI A;  4Y22 A;  1R08 2;  3KF5 A;  2XR4 A;  2JIG A;  4YG0 A;  3N9P A;  5A33 A;  4MSV A;  4S2D A;  1SBD A;  5BNO B;  1YJK A;  1DQ6 A;  3MIF A;  1ZBE 3;  3DF0 A;  5FYV A;  3T2P A;  2A70 A;  1RYY A;  2YUE A;  1BK0 A;  2ZGR A;  5ERL A;  1CVN A;  3I4I A;  1V6O A;  1NAE A;  1W6N A;  1PGW 2;  1BCX A;  4BQ3 A;  5BNO A;  5KR7 A;  2EXJ A;  5DXD A;  5FKB A;  5JR2 A;  1NQD A;  3D4K A;  3D5O A;  1OD3 A;  5FY7 A;  3S7I A;  3AMN A;  1TE1 B;  4I09 A;  4XHB A;  5JUV A;  5DUX A;  2WNV A;  2YPJ A;  1W9F A;  2XVG A;  5FOJ B;  1GMM A;  1GLH A;  5FYC A;  5DDJ 3;  5FZK A;  4CU8 A;  1A78 A;  3ZSK A;  1G9A A;  5DZG A;  1UZW A;  2HEV F;  5F1R A;  2DBN A;  2DTY A;  4Y26 A;  1GBG A;  4MGI E;  4MGZ E;  3Q8A A;  4Z82 A;  1GKB A;  2EXK A;  1PO1 2;  2A6Y A;  2ZGN A;  3HN3 A;  3RI9 A;  2OZJ A;  2JJ6 A;  1AR6 2;  1GNH A;  1OOP B;  3LF7 A;  4GWJ A;  2V4A A;  3VDD C;  2P17 A;  2VEC A;  4JTO A;  1SQ4 A;  2VR4 A;  4JVA A;  2VUA A;  1SPP B;  2WFP A;  1W6P B;  1LOG A;  3THT A;  4UF0 B;  3WG3 A;  4DOU A;  2QQJ A;  3TN9 2;  1AYN 3;  1OQ1 A;  2C9A A;  4B8E A;  4C91 A;  1SPP A;  1B09 A;  1RUI 2;  2JX9 A;  4TZD A;  2V73 A;  4HET A;  1HJF A;  1Z7S 1;  5LA2 A;  1UIJ A;  2OKX A;  3RYR A;  4N9H A;  1QOS A;  4CUB A;  1XNT A;  2Q8E A;  2XBO 1;  2NLR A;  5FP9 A;  3BYW A;  3EQE A;  3MGU A;  4U36 A;  5F39 A;  1QH6 A;  2Q8O A;  1QQP 2;  3UL2 A;  4D6S A;  5CIS A;  5LZ6 A;  5IAX A;  1CAX B;  2JD9 A;  2VE1 A;  1YLL A;  3POY A;  4XQ4 A;  1DQ0 A;  1VBA 1;  5FZ8 A;  1T6G C;  4CDX B;  2VQA A;  1RJ8 A;  1CAX A;  2YRO A;  1CX4 A;  4HSL A;  1Y9G A;  3LPG A;  3ME2 A;  3OEB A;  4WM8 B;  4XBL A;  5J98 B;  3M3I A;  4RR3 C;  1OT5 A;  4OUS A;  1WMX A;  2TEP A;  3H9A A;  2JDU A;  4CDX A;  5FR3 A;  1ZM1 A;  1YIP A;  1H1M A;  2BP6 A;  2GC0 A;  1K3I A;  2A6V A;  2D3R A;  3WW4 A;  1LEN A;  4AE2 A;  3I49 A;  4NID A;  4PCR A;  2D97 A;  1H2L A;  1IHM A;  2ZGT A;  3OJB A;  2O14 A;  1W3X A;  4HVQ A;  1UXX X;  3LEK A;  2OPW A;  1HXS 3;  1UKG A;  1ASJ 1;  1Q8V A;  2DCZ A;  2JG9 B;  5FWJ A;  5EYX A;  1N3Q A;  3QCW A;  1UOJ A;  5E16 A;  4DY3 A;  2XJP A;  5FPU A;  2WT1 A;  3I2H A;  4LUL A;  4CCC A;  3OY8 A;  4OQ9 A;  5F3I A;  4JGZ A;  3NKT A;  4XUP A;  1K5M C;  2VW1 A;  1NY7 2;  4W4Z A;  2JG9 A;  4AVT A;  4BJ0 A;  4LBL A;  4HBN A;  3W9A A;  1IPK A;  3VLB B;  5KHH A;  4BQ1 A;  1O3S A;  3BUC A;  3L2Y A;  4A3X A;  1H0B A;  5C5T A;  5EFU A;  4XUO A;  2O8Q A;  2D6N A;  2WN3 A;  4EWE A;  3HMY A;  1JOJ A;  4Q0P A;  2WIN B;  5EXO A;  2ZGU A;  1PMI A;  4N7I A;  1SBE A;  1LGN A;  5CNA A;  5FYU A;  3ZOI A;  1U5I A;  4GA9 A;  1C28 A;  5JOY A;  3SKJ E;  4DZG A;  3FFQ A;  3ASI A;  4Q4X 2;  4QX1 A;  2VMC A;  3B93 A;  3O0V A;  4IV3 B;  4AVA A;  3NMB A;  1V6J A;  4QKD A;  4QX0 A;  1OQE A;  4QDQ A;  2QQU A;  1RUH 3;  4IEY A;  3WY6 A;  3MLK A;  5A3N A;  4BLJ A;  4CEW C;  3LDB A;  1W05 A;  4AF9 A;  4IV3 A;  4ZXE A;  3ZXL A;  1ZZ6 A;  5JPN B;  4BXS V;  2XGX A;  3GGL A;  4TXW A;  2Q1M A;  2BER A;  2V5D A;  3KM5 A;  3DV8 A;  1FMD 3;  4AR2 A;  4MGK E;  5C8C C;  5J1X A;  2EF6 A;  3OYW A;  3AB0 A;  1E57 A;  4FT8 A;  1F9K A;  1I5P A;  1MS9 A;  1XNB A;  3GBG A;  3SH3 A;  1I9R A;  4CCO A;  4Y20 B;  4COW A;  1VLN A;  3M3Q A;  2RM2 1;  2I45 A;  2D6P A;  1GAN A;  4HKW A;  5IJR A;  5A7P A;  5FRA A;  4Q4W 1;  4AQ2 A;  2IFR A;  4OMC A;  2I2S A;  1QH7 A;  4LHK A;  4S2F A;  1AR8 2;  4FPK A;  1C8M 2;  2X10 A;  4LIT A;  3RS6 A;  5FV3 A;  2CTV A;  2YB7 A;  2JDP A;  2OYZ A;  1ALY A;  3FHA A;  1JOD A;  2HWE 3;  3OD0 A;  1LHU A;  3ZXA C;  3VBS B;  3MIB A;  4K1Z A;  4B29 A;  5JZG B;  2WDB A;  3EYP A;  4AFB A;  5A6Y A;  5C70 A;  2P6H A;  2Y6H A;  2PHF A;  1QJU 1;  5C4W C;  1QJF A;  3TRS B;  3VBS A;  5JZG A;  3BCW A;  3KSC A;  2R04 2;  3AL6 A;  5DG2 A;  4RQP B;  4IEX A;  3NJY A;  2XJR A;  3N35 A;  1ODM A;  1PK6 B;  1W2U A;  1YNA A;  3RFR A;  4JDN A;  3RVH A;  4XAE A;  4S2G A;  5D8A B;  5FMO L;  3ZYJ B;  3QBQ A;  4JX0 A;  4QMA A;  1RVF 3;  1DQ1 A;  1P8J A;  4RGK A;  4AAX A;  4A7K A;  3CU7 A;  2GMP A;  5FO9 B;  2ADD A;  4YM1 A;  5C7G A;  5I0S A;  4QX2 A;  4PLM A;  4WM7 A;  4LOT A;  1KQR A;  3ENR A;  4H55 A;  2ATF A;  1L7L A;  1PGL 1;  3LEM A;  2ZX1 A;  4J1W A;  3RZZ A;  3NQH A;  3Q8B A;  2ZPX A;  2DUR A;  1VRB A;  4QX8 A;  2DFC A;  5T54 A;  3C8X A;  2GZW A;  4L92 A;  5ISL A;  2VXJ A;  4PIZ A;  2RMU 2;  2YY1 A;  4ASM B;  5GLU A;  3NAP B;  3ABZ A;  1HRI 1;  3IN9 A;  5EV7 A;  1GP4 A;  1MZF A;  1IPJ A;  4CEY A;  4M3C E;  4LOR A;  2HEY F;  2PLV 1;  4CXX A;  3NL1 A;  3RZH A;  4CCN A;  5FY1 A;  5JPM B;  5C3Q A;  2OT7 A;  4AL9 A;  2RS1 1;  4AHY A;  4BK5 A;  2YBP A;  1S4C A;  1ND2 B;  4CCM A;  3H8X A;  1GWL A;  4DXR A;  3VB9 A;  3POF A;  4AI1 A;  2IXC A;  2UWA A;  1OF4 A;  2WKK A;  3J8F 1;  1PO2 3;  1RUC 2;  1NLS A;  5ACA 3;  3LSE A;  4M0H A;  3KHC A;  1ND2 A;  2R07 1;  4JQR A;  3ZSE A;  3K77 A;  1OLM E;  2BDR A;  3ECQ A;  3ZIW A;  3AK0 A;  2WS9 1;  4PF5 A;  3ZFF C;  3QD6 A;  1AX1 A;  1OLQ A;  4D6Q A;  5IVJ A;  4FFI A;  1ONA A;  3FLP A;  4YGC A;  3VHR A;  1YIF A;  2W1Q A;  2VZT A;  5IAV A;  4N53 B;  5FLI A;  1FNZ A;  1JHJ A;  2AEZ A;  4DO0 A;  5C9A C;  1JYX A;  3P1I A;  2HWD 3;  1PVC 3;  1RUE 3;  3G6J B;  1WKY A;  2VXR A;  4ZU5 A;  5FTT C;  4ISR A;  2JDA A;  3H3L A;  1D4M 1;  4N53 A;  1POV 0;  5BNN B;  1URX A;  1WA6 X;  4LKD A;  3ZFE A;  4XMI A;  5A3P A;  4E2Q A;  2VCM A;  2Z79 A;  5LRR A;  1ZVF A;  5BNN A;  4X8N A;  4D7T A;  1WUV A;  1GOF A;  1K45 A;  2FCU A;  5I0D A;  3WEZ A;  1QJE A;  5LK5 A;  2WZR 1;  2A5Z A;  3POB A;  2Y26 A;  2YGL A;  1POV 3;  1HRV 1;  4L11 A;  3GBW A;  2RG4 A;  2WO7 A;  4ISQ A;  4PDW B;  1UX7 A;  4FPG A;  3UGF A;  2XHK A;  1LOF A;  4IW3 A;  3LFI A;  1CJP A;  1UL9 A;  2QQI A;  3B00 A;  2E51 A;  4GB3 2;  3SIT A;  5LK7 B;  1IS5 A;  3H8U A;  3K48 A;  5JI7 A;  4PDW A;  2IVI B;  1EYB A;  2VOK A;  4KU8 A;  3RG0 A;  2DUQ A;  2UU8 A;  2BPA 2;  5DDJ 2;  2ZCW A;  1CWP A;  3W21 A;  4AOC A;  5BPX A;  1K12 A;  3GZT B;  4ZS2 A;  5EZW A;  4E4Z A;  5FY0 A;  1RUF 3;  2UWB A;  2PTM A;  5HI0 A;  1DGR N;  1XBF A;  5K9Y A;  2VC9 A;  4JKL A;  3MFC A;  1M06 G;  1BJQ A;  1D0H A;  4P9X A;  3FZ3 A;  4YGE A;  2Y6K A;  1VAL A;  3AJZ A;  4QXK A;  1AR7 1;  4JCK A;  3EJK A;  1XU2 A;  5E8A A;  4ZPI A;  4IND A;  4BHP A;  2CAV A;  2IXH A;  1XPW A;  3MZH A;  4IEU A;  1AYN 2;  3KGZ A;  4ONU A;  1QXJ A;  4LQR A;  4NWW A;  5FZ3 A;  3K51 A;  3ON7 A;  3VZK A;  4FFG A;  5IVY A;  3UET A;  3K3O A;  2DYC A;  4XF1 A;  3H0O A;  4JV4 A;  3DEM A;  5CG8 A;  2XON A;  3O1T A;  1XB9 A;  3I2O A;  2NZ9 A;  3OGJ A;  3WQ1 A;  3WW2 A;  3P3P A;  4EZ4 A;  1WCS A;  1WCU A;  2AUY A;  2IZW A;  3FWE A;  4JGY B;  3AP6 A;  4M3C A;  3KB5 A;  5E88 A;  3WNX A;  2FQP A;  4CCL A;  3N36 A;  2ZJC A;  3KCY A;  1FPN 1;  1FV2 A;  4F8A A;  1XYP A;  4QDR A;  1ZX5 A;  2XLG A;  3AMM A;  3J7M A;  1WLC A;  4QPW A;  5A7W B;  4XVH A;  4BOW A;  2CDP A;  4FSJ A;  2X05 A;  4UFH A;  4N9I A;  4XJZ A;  5BNQ A;  5FOB B;  3HT2 A;  1LOB A;  5A7W A;  1UAI A;  2NMO A;  1OLM A;  5A3U A;  4NRO A;  2WWS A;  4KBZ A;  2BRT A;  2WAB A;  4MG2 A;  1GNY A;  2O0O A;  4RS5 C;  3I2J A;  4QPI B;  4Q4V 2;  4UFK A;  5AFE A;  4LHL A;  1H2M A;  1AX0 A;  3E6C C;  1LES A;  3QLQ A;  4QPI A;  2JG8 A;  2QTW B;  1HXS 2;  4Q0S A;  3SCG A;  4BPZ A;  3VN4 A;  5I93 A;  4XQW A;  5EWS A;  4I30 A;  2OX0 A;  1LGB A;  4IES A;  1ZZ8 A;  2YBS A;  1RHI 2;  2DUP A;  3VBH B;  4QU1 A;  2NYY A;  1QHD A;  3RZM A;  5DUW A;  3K4Z A;  4AGR A;  1ULO A;  4BQ4 A;  3ZVX A;  3KF3 A;  3VBH A;  1W8W A;  5FUP A;  1D0G A;  4IV1 C;  1HB4 A;  3ZXF A;  4PI0 A;  3AYC A;  4C1W A;  3O1U A;  2WO1 A;  4W6W A;  2ARE A;  5BV6 A;  4UFJ A;  2WC2 A;  1H6Y A;  1Z7S 3;  1UU6 A;  2GC3 A;  2K2S A;  5A7Q A;  2V5Y A;  5LA0 A;  4XIL A;  2XBO 3;  3MPP G;  5IVV A;  5HV4 A;  1EP0 A;  3GM8 A;  2BWC A;  3PU8 A;  2XOM A;  3NST A;  4Q0U A;  1NXD 1;  4ZU7 A;  2FDK A;  3H3U A;  1F8V A;  1SEF A;  1RUH 2;  4KWU A;  3QH7 A;  5JOX A;  1ULG A;  4OMD A;  1SLB A;  5CU1 A;  4KG0 A;  4AEK A;  3DUI A;  2B9V A;  4I0B A;  1IOA A;  3SHR A;  1VBA 3;  4YW4 A;  2DVF A;  3U10 A;  1YQ5 A;  1ENX A;  3KQR A;  1NG0 A;  2XVK A;  3ACL A;  3CLP A;  2WQ4 A;  1O3R A;  1OFN A;  4QGM A;  4HLT A;  4PI2 A;  3BOP A;  5DAP A;  2XJQ A;  3MF9 A;  1OVS A;  1XU1 A;  2ZXQ A;  3USU B;  2VOT A;  5CVR A;  4I0W B;  4AED B;  4QHZ A;  2GP3 A;  4P9G A;  3U14 A;  3RQ0 A;  3VD4 A;  3USU A;  1EV1 3;  1ASJ 3;  1H4G A;  1WBL A;  1GWM A;  3AFK A;  4N43 C;  5AVP A;  4HK9 A;  2HWE 2;  5F3E A;  1COV 1;  1VPH A;  4GWI A;  1LHO A;  2NQY A;  1U5Y A;  3VKM A;  1W04 A;  3KVB A;  4GMP 1;  2Z4F A;  3DPR B;  1HV1 A;  4I01 A;  4XTM A;  5T55 A;  3VDC A;  2YFZ A;  5HXV A;  2RJK A;  3GAL A;  5FZF A;  2Y38 A;  4LIU A;  3DPR A;  3ZFG C;  4MO3 M;  2HYK A;  4GZ9 A;  5FZB A;  1Y4W A;  2DV9 A;  4TTG A;  1X50 A;  2JDZ A;  1YFY A;  3V64 A;  1RUD 1;  4XE9 A;  3VD5 A;  3ROU A;  3LQC A;  2BFU L;  1RVF 2;  2YYO A;  5EQU A;  2PQS A;  1DCS A;  1DLC A;  2ZAC A;  3MIC A;  2JB8 A;  4FOW A;  5TSW A;  5FLH A;  3AVS A;  4B7E A;  4BCU A;  2G1M A;  1SBF A;  1VE0 A;  1SAC A;  1OKO A;  1NE6 A;  3IKW A;  1UY2 A;  1CD3 G;  2VMF A;  4YW5 A;  2XWB B;  2BOI A;  4H3W A;  4RHV 3;  4XBN A;  5E1R A;  4R9D A;  2AYH A;  5ABJ B;  1R1A 1;  4WZF A;  4YVS C;  4ATF A;  1LNS A;  1XNC A;  3ZYP A;  1EUU A;  1LU2 A;  2B39 A;  2VTX A;  3OGR A;  4G3Y C;  1ULC A;  1M4W A;  5FPA A;  3CJI C;  4BH9 A;  2RM2 3;  1CR7 A;  1RC6 A;  4LE3 A;  1UOB A;  2W46 A;  3K4D A;  4Q4W 3;  1UD1 A;  5BNP C;  5CEH A;  1XQN A;  4FPJ A;  1C57 A;  1GP5 A;  1HV0 A;  2P3Y A;  3LOB A;  4YG6 A;  4CCK A;  1EAH 1;  4UW6 A;  3LFM A;  1POQ A;  2VZP A;  4Y1X A;  2W2I A;  3HAG A;  1UMI A;  4MGY E;  4A42 A;  3KV9 A;  2Q1F A;  2OXB A;  2PAM A;  4A45 A;  1JYC A;  1H8T C;  1PO2 2;  1WLW A;  1AL0 G;  3PMS A;  5ACA 2;  1YQ2 A;  4FPF A;  4M4R A;  1IS4 A;  3HN1 A;  2ET1 A;  4LJH A;  4NO4 A;  3ZXE A;  5IVB A;  3NKG A;  1QJU 3;  4K3U A;  2XUM A;  3ILR A;  3ZM8 A;  4EE2 A;  3PTR B;  1AYM 2;  1VBD 1;  3TBD A;  2VPV A;  1SLT A;  3AMP A;  2D44 A;  1O3T A;  2HWD 2;  1PVC 2;  1RUE 2;  3NV4 A;  3N7K A;  1XSR A;  4XF4 A;  4Y1V A;  4YM0 A;  3J9S A;  1GIC A;  1GQH A;  1F4H A;  2C4X A;  3E5X A;  3S5Q A;  2PEL A;  3NNJ A;  4BIF A;  4V2V A;  2Y33 A;  3JZV A;  3IDE A;  1HIX A;  1ODN A;  2RHP A;  2I74 A;  1W8U A;  2A7A A;  2ZAH A;  2VNG A;  4YVW A;  3ZKU A;  5KHG A;  5JSR A;  3BB6 A;  3OOX A;  5FO7 B;  1TMF 1;  1YFX A;  4AFA A;  4P5Y A;  1CGP A;  2Y60 A;  5BNO C;  2XWJ B;  4IGP A;  4ZS3 A;  4XFB A;  2BGC A;  3WHU A;  2EAL A;  5L7O B;  5FPB A;  5F5C A;  3VD9 A;  1JHN A;  1UCX A;  1GV9 A;  2RDQ A;  4MOA A;  5L73 A;  3ZSM A;  4EJR A;  4XQD A;  5CFC B;  3BIW E;  3THP A;  2JWP A;  5L7O A;  3BTZ A;  2RV9 A;  4AI0 A;  1HRI 3;  1S0D A;  2WNV C;  1CZV A;  1W03 A;  4WVZ A;  4RSU A;  3W59 A;  5FRE A;  1O5L A;  2WSV A;  4NHK A;  4ES8 A;  3GYD A;  4XZP A;  5IWF A;  4BME A;  1QIQ A;  3TAY A;  2B4K A;  2PHU A;  3MW2 A;  2JEC A;  4IUG A;  3HPN A;  1I1E A;  1Q8Q A;  2TNF A;  4AG4 A;  3VKF C;  2RS1 3;  1WD4 A;  4O65 A;  5HCA A;  3O1O A;  2JDK A;  2VZ1 A;  2O1Q A;  5FZ1 A;  1RUF 2;  1XOY A;  3KD4 A;  3LIG A;  3OB8 A;  4IEO A;  3KMH A;  4ORF A;  3THC A;  2XQR A;  4P14 A;  2E7A A;  3J8F 3;  3ZN5 A;  3A4U A;  4YWA A;  4CP0 A;  2OII A;  4HON A;  1N47 A;  2QNK A;  3HNB M;  2R07 3;  2VJX A;  4L97 A;  4YGD A;  4EQV A;  2IVJ A;  4Q4Y 1;  1E5S A;  1AR9 2;  1VB2 A;  3HNY M;  4UFI A;  1BMV 1;  2Y64 A;  2XVL A;  2WS9 3;  1W8Z A;  4NPM A;  5J37 A;  2VNR A;  4IER A;  1H4H A;  4XPV A;  1YQ6 A;  4DS0 A;  4O9E A;  1ZZB A;  1BBT 1;  2G9Z A;  4IE7 A;  2DU1 A;  3J7L A;  4COU A;  1S0F A;  3R4D B;  1QY4 A;  1PIV 1;  4LBN A;  2FCV A;  2DUO A;  4OFG A;  1D4M 3;  1DYO A;  2A71 A;  5CKM A;  1VBC 2;  4CDW A;  5FFO C;  5HV0 A;  3KT4 A;  1MS1 A;  1H8V A;  2GN3 A;  3U78 A;  1S0J A;  1Q3E A;  3D0J A;  3G7D A;  4FPH A;  1FYU A;  1S55 A;  1DFQ A;  4LUM A;  4GJY A;  5DPN A;  4JHZ A;  3CZU A;  3MPB A;  3DXU A;  5FYB A;  1RMU 1;  5IUQ A;  5A7N A;  3ZDV A;  1O8S A;  1OMI A;  2WNU B;  3FJS A;  2FDJ A;  1S0C A;  2WZR 3;  2XLA A;  2JD4 A;  3KWV A;  4PQQ A;  2MNG A;  5A32 A;  2UY8 A;  2D6O X;  1HRV 3;  1SLC A;  4I3G A;  1PM7 A;  1U0A A;  3JBG 2;  5T5P A;  3URF A;  3D6E A;  1O4Z A;  1Y9M A;  4NRP A;  2NPI A;  2E63 A;  4YZ4 A;  5FY5 A;  2VCC A;  4JKM A;  3UGG A;  2VZ3 A;  4NN0 A;  5JLV A;  3U4S A;  1OUX A;  1DGW X;  2NMN A;  5FZO B;  4DMI A;  1X8E A;  1XE7 A;  4OI2 A;  4BMB A;  5LBE A;  4LLO A;  1QJY 2;  4Y4R A;  5LB6 A;  2ZTN A;  5J09 A;  3H42 B;  3IBM A;  3NJZ A;  3RGB A;  3AKS A;  3RYP A;  2FMD A;  1HLC A;  4I2O A;  4HZF A;  3W5N A;  5FMD A;  3LEG A;  4NPL A;  4YLZ A;  4CXW A;  4JGZ C;  3BTY A;  2F17 A;  1QF3 A;  3WDX A;  3LZZ A;  3JQW A;  1EY2 A;  1AR7 3;  1QOT A;  4MXW B;  2A6Z A;  1DQ4 A;  2LS6 A;  3O1M A;  1NCQ A;  4E4H A;  3RJR A;  1QDC A;  4OZX A;  1QJX 1;  2N7G A;  4BIO A;  3UNP A;  2RS5 1;  1C3H A;  1JU3 A;  4P08 A;  1C1L A;  5A80 A;  2V72 A;  4IET A;  1Q8S A;  5FZ4 A;  1LB2 A;  1ENS A;  3ZN6 B;  4K9S A;  3DXT A;  2VVF A;  1RIN A;  3PUA A;  4ZZ5 A;  2WYF A;  3KCX A;  3R4S A;  2QKD A;  3POE A;  4WV8 A;  4H2A A;  3KT7 A;  4RFT 0;  4D0Q A;  2XBO 2;  5A1F A;  1DU3 D;  1KS5 A;  3ZN6 A;  2D3P A;  2YDE A;  1F2N A;  1Z78 A;  2ZHN A;  4CUA A;  3HBK A;  1UPS A;  1DYP A;  1OC1 A;  3EXU A;  5M0T A;  3WX5 A;  1CIY A;  5G05 L;  3A7Q A;  1Q56 A;  4AEJ A;  4NRQ A;  1EPZ A;  2DVB A;  1ZBA 1;  2K9Z A;  1LKN A;  2R0F A;  4N90 A;  5CFD B;  3SMH A;  3WUC A;  5LRS A;  1MR5 A;  2JXA A;  2HWB 1;  1WW7 A;  1XJA A;  4XCB A;  2A6X A;  3PL0 A;  1UF2 C;  1NCR C;  1G9D A;  1OHF A;  5CFD A;  3ZXG A;  4M00 A;  4V2W A;  2D3S A;  4CXY A;  4QPY A;  1G6N A;  1E5H A;  2DVD A;  3BPS A;  3FN9 A;  3WF2 A;  4XJ8 A;  2W9X A;  2WA3 A;  5LEK A;  3B9I A;  4LA3 A;  1SCR A;  2R6Q A;  4ARX A;  1OOP A;  5J7M A;  3NW4 A;  3NNL A;  1EV1 2;  1ASJ 2;  3WF1 A;  1Z0H A;  3FL7 A;  1UO9 A;  4U2A A;  4HPK B;  1GU3 A;  4CDU C;  2P3J A;  5B2G B;  1OH4 A;  3FUQ A;  4K7J A;  1W9S A;  4FCA A;  1SFP A;  1W6P A;  1RIR A;  4UF0 A;  1ND3 B;  4BZ4 A;  1NXM A;  3ZSJ A;  5AC9 1;  2BOJ A;  3IIA A;  1QOO A;  3B3Q E;  4E4D X;  5CKQ A;  2YU1 A;  2VBB A;  1X8M A;  3JUU A;  5D2A A;  4AEM A;  4AYU A;  4YW3 A;  4DEQ A;  1ND3 A;  3CKH A;  3JU9 A;  3BKZ A;  1XSQ A;  4Q8L A;  1GQG A;  1ZRE A;  2Y8K A;  2EIG A;  2W95 A;  3N9M A;  4LR4 A;  1R08 1;  3E5U A;  2YC0 A;  3UGH A;  1US2 A;  4LBJ A;  4XIK A;  2RDR A;  3P3N A;  1VRH 1;  4KMQ A;  4QGL A;  3O5S A;  2X5I B;  1FOD 1;  1RGS A;  4XDQ A;  5I8Y A;  1JXN A;  2GC1 A;  4BQY A;  4FP3 A;  4AZZ A;  1RUG 2;  1TNF A;  1UZY A;  2Q4S A;  2VUJ A;  4WM7 C;  2IXL A;  5I8T A;  2AC1 A;  5KXE A;  4KI5 M;  1SMV A;  3AC0 A;  2X5I A;  3NWK A;  4RHV 2;  5L9R A;  4WM8 A;  3H7Y A;  2MHF A;  1H9W A;  2PHD A;  3HWJ A;  2R06 1;  3EBR A;  2W91 A;  2CY6 A;  4UBG A;  2GAL A;  3C7G A;  4KGG A;  1YFW A;  5K0U B;  3UKV A;  1DLL A;  4CEY C;  4P9L A;  3WW1 A;  4GMP 0;  5CZK A;  4UOJ A;  5FCC A;  3WHT A;  4HAN A;  5K0U A;  2NP0 A;  2JIC A;  1CJD A;  2CDO A;  4XJ9 A;  2QQM A;  5C3S A;  4DPN A;  2VGD A;  3ZYI B;  1Q8P A;  4LHN A;  4QX5 A;  1HN0 A;  3U1X A;  2JKB A;  2WQZ C;  5FP3 A;  3M8L A;  1DZR A;  3VBR C;  4GMP 3;  3R6S A;  5CA6 A;  3T0B A;  2YG0 A;  5G04 L;  1QJU 2;  3WNK A;  1HJG A;  3F95 A;  5HXM A;  4GXL A;  4JDO A;  3VBF C;  3WSO A;  1W8H A;  3RWN A;  4XJW A;  4YM3 A;  1AJO A;  4YYO A;  2D5F A;  1JUI A;  3DCQ A;  1NOV A;  2WWU A;  3O0W A;  4LBM A;  4MZU A;  4XC9 A;  4XMA A;  1DG6 A;  5H9S A;  1BVV A;  2ERF A;  3MID A;  1YUD A;  5A3L A;  2DCY A;  1RUD 3;  2B46 X;  2ZEW A;  2ZML A;  3ZFE C;  1CN1 A;  1D2Q A;  1SLI A;  2FDF A;  3WDU A;  3KT1 A;  1KD7 A;  1W8F A;  1KFU L;  4K20 A;  4CDQ B;  5KHI A;  3H8R A;  1N1Y A;  5FYZ A;  3KCC A;  1N1S A;  1BVP 1;  3WXP A;  1MZ5 A;  3MO4 A;  3MV1 1;  3OPT A;  2WBK A;  5ANN A;  2J42 A;  1PGL 2;  1OSG A;  3E6B A;  4CDQ A;  1AF9 A;  1ZRD A;  2Z69 A;  1GYK A;  1R1A 3;  4TN7 A;  4V1P A;  5CYY A;  3O1P A;  2GC2 A;  4LKF A;  4LBQ D;  4HMZ A;  4Y20 A;  3AXE A;  2YGM A;  1LOF C;  3BOD A;  2A3W A;  3J4U H;  4UWD A;  4OHY A;  1HRI 2;  1V6N A;  2IXK A;  4P5H A;  4PT6 A;  1LR5 A;  4QQH A;  4NIG A;  2SBA A;  5FYM A;  2R32 A;  1CAW B;  2WT2 A;  2PXJ A;  5C33 A;  3OBR A;  1VAV A;  3GNE A;  3QOP A;  1EAH 3;  2BQP A;  3KV4 A;  5HCF A;  4N8M A;  3SLI A;  3VDD B;  2WJS A;  2JIJ A;  2VNO A;  4FQ4 A;  5EHD A;  4RYD A;  4ZKT B;  3WOG A;  3WP3 A;  4CA9 A;  2AR6 A;  4J1X A;  2VVD A;  4HXC A;  2R07 2;  1WW4 A;  1BLZ A;  2AGS A;  1W39 A;  3ST7 A;  2WS9 2;  1WLD A;  4RQP A;  3VZO A;  2PFW A;  1NUK A;  2VCA A;  4L9B A;  3T2O A;  2VMG A;  3J7H A;  3K75 B;  4DUW A;  1PK6 A;  1US3 A;  1VBD 3;  3NV1 A;  4C90 A;  1HB2 A;  4LIV A;  1KXG A;  4LHS A;  5IYY A;  3VD3 A;  5D8A A;  5IK8 A;  2E31 A;  3ACH A;  5A1A A;  2J7M A;  3RPQ A;  2UUR A;  2D6M A;  5IK4 A;  2RE9 A;  2WL1 A;  4UI9 L;  1D4M 2;  1RED A;  3U37 A;  3WNL A;  4E4S A;  1BK1 A;  1ULP A;  1XRU A;  5FO8 B;  5LA1 A;  2XKP A;  4Q4X 1;  4FTS A;  1GFF 2;  2HYX A;  1OF3 A;  1O5U A;  3LKJ A;  3NO8 A;  1C5H A;  1KGY A;  1TMF 3;  4KH9 A;  3HT1 A;  1LAJ A;  2OA2 A;  1WWY A;  4M4P A;  3VHP A;  4D3W A;  2VZO A;  4G4F A;  2WZR 2;  1RUJ 1;  3NAP A;  3LDR A;  1D2S A;  4R52 A;  4LOS A;  1HRV 2;  3ZPY A;  4D7Y A;  4D8M A;  1UQX A;  3VD7 A;  1WD3 A;  5LEJ A;  3ACG A;  2Y0O A;  4FAH A;  3PLQ A;  1EUT A;  4NR1 A;  2WWJ A;  1APN A;  3KQ4 B;  4MAD A;  5AFB A;  4UAP A;  2WUH A;  3BVC A;  1RXF A;  3PIG A;  4MHU A;  3T2Q A;  1MS0 A;  1HX6 A;  2XKO A;  2R16 A;  2Y6J A;  3AKT A;  1ZZ9 A;  1W2N A;  4X6R B;  2G4I A;  1AR8 1;  4NWV A;  2J1T A;  5CBL A;  2JG8 C;  2RDN A;  3WP6 A;  1O91 A;  3ETQ A;  2W39 A;  4FQZ A;  4K8R B;  1K5M B;  4CZS A;  1V9U 2;  2RS3 1;  3ZKY A;  3M3E A;  2E53 A;  3I97 A;  2VD7 A;  4YAR A;  2WA4 A;  3DEC A;  4QXC A;  2HKX A;  2RR1 1;  2ZOE B;  5IFT A;  5F3C A;  1K5M A;  1AR7 2;  1F5F A;  3KGL A;  4Q4Y 3;  1I5Z A;  3M7A A;  5GLT A;  3PVN A;  2ZGK A;  1OI6 A;  4GUL A;  1YFU A;  2CGO A;  2R04 1;  3WZ1 A;  3GHM A;  4OHZ A;  1ZBE 2;  3H8O A;  2RJ2 A;  1X9T A;  1QDO A;  1BBT 3;  2ENR A;  3A0N A;  2JB4 A;  1PIV 3;  3III A;  2P3I A;  3AXD A;  3WG4 A;  4QU2 A;  4R9B A;  4QB2 A;  5IFP A;  2VOW A;  4KQ7 A;  4CEW B;  4K21 A;  1UOG A;  1CZT A;  5JR7 B;  3UK9 A;  2IXI A;  3R4U A;  4O7X A;  5H9P A;  4F7Z A;  4E8C A;  2ZEX A;  1OA4 A;  1RMU 3;  3NJV A;  5C8C B;  1H2K A;  1H2N A;  4QHO A;  4SBV A;  4GWM A;  3SCH A;  2VVE A;  4CP2 A;  4TYS A;  5KHK A;  5C8C A;  5IK5 A;  1I6X A;  2RMU 1;  1A6C A;  1UY0 A;  2ETE A;  1N3P A;  2X09 A;  2XH6 A;  3NVC A;  3PVE A;  1YRZ A;  5IVF A;  3T0A A;  5I8S A;  2H6B A;  3CNA A;  1QXP A;  1NKG A;  1AUY A;  2C0Z A;  2D7F A;  1X82 A;  4XUT A;  3K2O A;  1RIT A;  3ETP A;  1GOG A;  1SFY A;  5HPO A;  2RDS A;  1CON A;  4LO4 B;  4Q29 A;  1PZ8 A;  3WG2 A;  1J3Q A;  2DU0 A;  4FPY A;  1S0E A;  2P4E A;  5C4W B;  5JWP A;  5K8S A;  1DF0 A;  2GAU A;  3BOW A;  4A41 A;  3T0D A;  3JQX A;  3RI8 A;  1VMH A;  3HOB A;  1J1L A;  1R09 1;  2OQ6 A;  4IE5 A;  1B35 C;  1MEC 1;  1MS4 A;  1JOB A;  2BYV E;  2DCK A;  5H9Q A;  3I8T A;  4AAP A;  3ZR5 A;  2CSG A;  1QJX 3;  2ZMN A;  1FNY A;  1TG7 A;  2RS5 3;  3HJR A;  3POG A;  3AP5 A;  3LB9 A;  2J1U A;  1D7P M;  4UW3 A;  4EZH A;  5A3T A;  3BIE A;  4WVM B;  3IPV B;  2VZV A;  4JGY A;  5JOZ A;  5FYH A;  3H1W A;  4Q1P A;  4AW7 A;  1LRH A;  1WZX A;  1W6O B;  2ZGQ A;  5K7P A;  3DYP A;  1G86 A;  3AL5 A;  5JXG A;  4QDS A;  5FYS A;  1KIT A;  5F5I A;  2OUH A;  1HQL A;  4R4X A;  5F5A A;  4WVM A;  3IPV A;  3AYE A;  3BPZ A;  2OVU A;  3GZE A;  1ACC A;  1TQ5 A;  2JE9 A;  3IAP A;  3OG2 A;  4K1Y A;  2DDU A;  2WR9 A;  4JHT A;  4GD4 A;  4C0H A;  2PN5 A;  3E97 A;  3IAQ A;  2MEV 1;  1KFX L;  2CHH A;  5SV5 A;  3LE0 A;  1ZBA 3;  4XET A;  5CIR A;  5DQ0 A;  3S30 A;  4GB3 1;  5I91 A;  2A3Y A;  2HWB 3;  3OPW A;  4BE3 A;  1CES A;  4PF1 A;  2W3J A;  4FXG B;  4J25 A;  3FHI B;  1TEI A;  5JMO A;  4AXO A;  3ELN A;  3POJ A;  4OQ8 A;  2ZEZ A;  4R4Z A;  4URA A;  5KC5 A;  1FI2 A;  3H1Y A;  4PLO A;  5JOW A;  5FXV A;  2GN7 A;  3V56 A;  2VUD A;  3CJX A;  1GSL A;  1JZ3 A;  3ITQ A;  1YWK A;  3ZFF B;  1W0N A;  1O8P A;  2W47 A;  3I2I A;  1JS9 A;  4GKY A;  4YZ2 A;  3DYM A;  2AZ5 A;  3NNF A;  1PMH X;  3OD4 A;  4CPB D;  1IPS A;  3M3C A;  3RYK A;  4OVE A;  3ZFF A;  1UYY A;  2KM2 A;  4LKS A;  4QX3 A;  3N9L A;  5HCB A;  1JZ6 A;  1ZRF A;  1HDK A;  4Q8K A;  2TBV A;  1SZB A;  2ARX A;  1JZ7 A;  2V09 A;  2VW2 A;  2WFF 1;  3R0R A;  2VH9 A;  1DGR A;  1JBC A;  2IXJ A;  4RFR B;  4HOO A;  5BUV A;  1R08 3;  1RUD 2;  3JXS A;  4YVW C;  5JIU A;  1VRH 3;  1SLA A;  3ZYB A;  3V0A B;  4DEV A;  1FOD 3;  1TME 1;  1CAU B;  2LM3 A;  1FMD 2;  2WII B;  1QMJ A;  3EO6 A;  3AMH A;  5DUU A;  4QPG C;  5FZ9 A;  3WV6 A;  2QDR A;  1G7Y A;  1OBN A;  1FV3 A;  2UY9 A;  3V0A A;  1QNY A;  1O6U A;  2LUW A;  2IUW A;  2E7T A;  4KGQ A;  1IKQ A;  1UY3 A;  1WCK A;  2DBI A;  2D40 A;  4NHM A;  4XTP A;  3UJQ A;  5JXJ A;  3BTX A;  2O8O A;  3U07 A;  3WVJ A;  4DB5 A;  3OUJ A;  3OSD A;  2OS2 A;  2R06 3;  3LD8 A;  3LDK A;  3PHM A;  2FBE A;  4GH4 C;  4XF0 A;  3A21 A;  3Q8C A;  1OH3 A;  3OUI A;  3WF4 A;  4XBQ A;  2A1X A;  3B5L B;  4X8P A;  4Y5Z 0;  4B4R A;  4FFH A;  4AED A;  3U11 A;  1UNB A;  1RTV A;  3CDZ B;  5BYN A;  2Q0A A;  1BEV 1;  4Q4V 1;  1HB3 A;  5I0U A;  1GZ9 A;  5EJ1 B;  1UZZ A;  4C8D A;  1QXR A;  3CBN A;  4HFS A;  1NZI A;  4OI4 A;  1WCD J;  4QB1 A;  5I0R A;  1EAH 2;  3T1M A;  4CP1 A;  3VKN A;  4QD2 A;  5BXX A;  3ACI A;  3EHK A;  4HVO A;  1JOP A;  1MQT C;  3HQX A;  3SC7 X;  3WDW A;  1CAV B;  4TLG A;  3WLU A;  4CP9 B;  1W2O A;  4DXS A;  3LIH A;  1RHI 1;  2VL4 A;  5IVC A;  4RA0 A;  1JH5 A;  3AX4 A;  4WBB A;  5A3M A;  2ZGL A;  3VHN A;  3WNP A;  4CP9 A;  1CAV A;  4LO7 A;  4E2G A;  3IZO A;  1N1V A;  1JMU B;  3JD7 1;  4PHZ A;  4ZON A;  3NJX A;  2J1A A;  2EIB A;  2JEM A;  2ZHK A;  4A7Y A;  2GH2 A;  3GHN A;  4NAM A;  5LAS A;  3SH5 A;  5FKC A;  1VMF A;  1XC6 A;  1WA4 A;  2XJU A;  3LAG A;  2XJS A;  4AVC A;  4MV2 A;  5J48 A;  3LOI A;  3SIS A;  4Q1R A;  4CDW C;  4IE0 A;  4HN1 A;  4XXA A;  3B02 A;  2ZGO A;  2A75 A;  2VOV A;  1LEC A;  1TMF 2;  1REE A;  3B9C A;  2GP5 A;  1JZ8 A;  5B4X A;  5ABJ A;  1X33 A;  5FUN A;  3C7H A;  5GZF A;  3AZV A;  3PVO A;  4H7L A;  1Q5O A;  1WMF A;  5A6X A;  3RZL A;  5K4L A;  4FOV A;  4YW2 A;  3PTY A;  5F7U A;  1TZO A;  1AVB A;  2VQ0 A;  2BVV A;  2IC1 A;  4RS5 B;  4XUR A;  3MV0 1;  4K6B A;  5JXH A;  4COV A;  4DIN B;  5FWE A;  3AKR A;  4HKO A;  4LLF A;  4AK3 A;  2BWA A;  5T50 A;  2CU5 A;  3PME A;  3D0S A;  4QQP A;  3VBU C;  2WAO A;  1F31 A;  3IMM A;  4A44 A;  1OA2 A;  3D8C A;  1S0G A;  4IEP A;  1DGW A;  2DF7 A;  4AQ6 A;  1NA1 C;  3PNA A;  3IM0 A;  2QVS B;  3I3D A;  2OZ6 A;  4LK7 A;  4YPJ A;  4B7K A;  2W68 A;  1DIW A;  3A22 A;  4KG8 A;  3T4V A;  1X9P A;  3MW4 A;  3VBO C;  3VZL A;  3ZXD A;  4AFC A;  4QQO A;  3THD A;  2OPK A;  2WLP A;  4YFZ A;  3AZZ A;  3N9N A;  3Q9O A;  3WDY A;  5IK7 A;  3C7F A;  4UT5 A;  4ERO A;  4Q4Y 2;  4JKK A;  4PJY A;  1UN1 A;  1BMV 2;  1NCQ C;  5FYI A;  4IV1 B;  2WZP P;  1OPO A;  4CU6 A;  4ZZ8 A;  2YFU A;  2XPJ A;  1HKD A;  3FX3 A;  4HVR A;  4I02 A;  1MS8 A;  4EV0 A;  1GWK A;  2OQ7 A;  4LBO A;  2B8M A;  3PVB B;  4XXP A;  4FAG A;  2ZEY A;  4OHV A;  1GOH A;  5LWB A;  4FPE A;  1WW6 A;  3POW A;  1UW8 A;  1PX4 A;  1MPX A;  2D98 A;  1LEM A;  1UU4 A;  1PIV 2;  3WDT A;  4ET7 A;  3ACF A;  2UYA A;  2VU9 A;  4FP2 A;  1RVF 1;  4AWD A;  1H30 A;  3B94 A;  4AHX A;  4QHB A;  4UW4 A;  4XFI A;  3RMX A;  5GZE A;  2AAC A;  2VBP A;  1AL2 1;  4Z07 A;  1RMU 2;  2QJV A;  2D6L X;  5CFC A;  1BHG A;  2BJS A;  3FC0 A;  3MHZ A;  5FZ6 A;  1C4R A;  4BQ2 A;  3TEZ A;  2R30 A;  4R9A A;  3OUH A;  2PLV 3;  5EPA A;  3KHB A;  2XJT A;  1RUJ 3;  2PQQ A;  5EYY A;  5JIA A;  3S7E A;  1SDW A;  2YU2 A;  1YXW A;  4YRD A;  4DFS A;  5FDB A;  1W2A X;  3N9O A;  4KNC A;  1PNF A;  2QQW A;  3NV2 A;  3ZXK A;  2TUN A;  4FPO B;  4YZ5 A;  1QJZ A;  4IGO A;  4N43 B;  4IGQ A;  2VUL A;  4URT A;  5FJK A;  1AR8 3;  5EJZ B;  1OOP C;  1GUI A;  3T3Y A;  3B01 A;  2XG3 A;  5FZD A;  4N43 A;  2RS3 3;  4BB3 A;  2ZX0 A;  5ACA 1;  2UWC A;  5F9T A;  5GKA C;  3AP9 A;  1ZA7 A;  3HBZ A;  1O7F A;  2QDN A;  4XIO A;  1GZW B;  1LHN A;  2RR1 3;  5GZC A;  2Y6G A;  1J58 A;  3NRU A;  1LHW A;  4JDM A;  3ZFG B;  2Y6F A;  4E2S A;  2EA7 A;  4D94 A;  1V6L A;  3UKT A;  3HQR A;  3I2F A;  3N3H A;  4A4A A;  1AYM 1;  2ZAA A;  3LWC A;  1GZW A;  2R04 3;  5JSP A;  5HCH A;  1OUR A;  3C2U A;  3ZFG A; 
#chains in the Genus database with same CATH homology
 5IVB A;  5A3N A;  4GD4 A;  3LDB A;  3PUS A;  3PUQ A;  2WWJ A;  5FXZ A;  5A3P A;  2GP5 A;  3PTR B;  3PDQ A;  5LY2 A;  2Q8C A;  5FUN A;  2YPD A;  5FPV A;  5A7Q A;  5FP3 A;  3OPW A;  5FZK A;  5FYC A;  3UYJ A;  4ASK A;  4NUB A;  4CCO A;  4E4H A;  4Y33 A;  5FPL A;  3PU8 A;  4QXH A;  5FJH A;  5FZA A;  5K4L A;  5FP7 A;  4V2V A;  5A7P A;  4BIS A;  2Q8D A;  3AVR A;  5FYT A;  3ZPO A;  5FZG A;  5A80 A;  2VD7 A;  4D6R A;  3KV5 A;  3PUR A;  4LXL A;  5FP8 A;  5FWE A;  5FZ4 A;  5FZL A;  4QXC A;  5FXV A;  3DXT A;  5A7S A;  5F3C A;  3PUA A;  4LIT A;  4IGP A;  3KVA A;  5FV3 A;  2WWU A;  5A1F A;  5FPB A;  3KV6 A;  5F5C A;  4QX7 A;  5A7O A;  5FZO A;  4UF0 B;  5IVE A;  5F37 A;  5FY0 A;  2XDV A;  5FBJ A;  3N9L A;  5IVV A;  3N9N A;  2GP3 A;  3K3N A;  5F2W A;  5FYZ A;  3AL6 A;  5IWF A;  3OPT A;  4CSW A;  3NJY A;  5FYI A;  5FY9 A;  2Q8E A;  4URA A;  4DIQ A;  5F3E A;  4HOO A;  5FP9 A;  4TN7 A;  2XUE A;  5F39 A;  2OQ7 A;  4CCJ A;  3KVB A;  3RVH A;  4D6S A;  4V2W A;  5FZ1 A;  5LWB A;  5FZ3 A;  5E6H A;  5FZ9 A;  5FZI A;  5IVY A;  3K3O A;  5FZF A;  4LIU A;  4HON A;  5FXW A;  5FZ8 A;  2P5B A;  4XDO A;  2XXZ A;  5FY8 A;  4EYU A;  4EZ4 A;  5FYM A;  5FZB A;  4QXB A;  5IW0 A;  5IVF A;  2PXJ A;  1VRB A;  4CCL A;  4QX8 A;  3KV4 A;  3ZLI A;  2OS2 A;  3LD8 A;  5ISL A;  4Y3O A;  4UF0 A;  5FZE A;  3K2O A;  5FP4 A;  5FZ6 A;  5A3W A;  5FZ0 A;  5ANQ A;  2YBK A;  2YU1 A;  5A7W B;  3AVS A;  4BU2 A;  5FY4 A;  5FZ7 A;  2YU2 A;  4C8D A;  3U78 A;  4QWN A;  5FWJ A;  5A7W A;  4CCN A;  3N9O A;  3N9M A;  5FY1 A;  5FXX A;  4GJY A;  5FPU A;  2OT7 A;  2XML A;  4GAZ A;  5F32 A;  4BXF A;  4LIV A;  2OQ6 A;  3DXU A;  5F3I A;  2YBP A;  5FYB A;  5FZC A;  5A7N A;  4CCM A;  4IGO A;  4IGQ A;  5FJK A;  4AAP A;  5IVC A;  5FPA A;  5FZD A;  4GJZ A;  3N9P A;  4EZH A;  5A3T A;  5CEH A;  2OX0 A;  3N9Q A;  3PU3 A;  4D6Q A;  5FYV A;  5FYH A;  5FY5 A;  4CCK A;  2YBS A;  4AI9 A;  5IVJ A;  5FZH A;  5LW9 A;  3U4S A;  5FYU A;  4CUG A;  2W2I A;  4QU1 A;  4XDP A;  3AL5 A;  3KV9 A;  5FYS A;  5F5I A;  5F5A A;  5FZO B;  4DO0 A;  5FZM A;  5KR7 A;  5FYY A;  4Y4R A;  5F3G A;  5F2S A;  5A1L A;  5LY1 A;  5FUP A;  5FY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...