5FYUA

Crystal structure of the catalytic domain of human jarid1b in complex with 3d fragment 3-amino-4-methyl-1,3-dihydro-2h-indol-2-one (n10042a)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
463
structure length
456
Chain Sequence
b'SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKLRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDGIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with N10042A
rcsb
total genus 144
structure length 456
sequence length 463
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fyuA01
4NUBA 5FWJA 5F5CA 5FYMA 3AL5A 4D6RA 5FZHA 5LY1A 2OQ6A 4QXBA 5A80A 4CCLA 5FWEA 5FYTA 3NJYA 5FZDA 5FYIA 4ASKA 5FBJA 3UYJA 5FZGA 4D6QA 5F2WA 4CCMA 5FYBA 5F2SA 4D6SA 4GAZA 5FY9A 4AAPA 5FV3A 2YU1A 4UF0A 4BXFA 2GP5A 4CCNA 5A1FA 4GD4A 5FZ4A 2Q8CA 3AVRA 5ISLA 5FYHA 3AL6A 3DXUA 2OQ7A 4IGQA 2W2IA 3N9MA 2P5BA 3LDBA 2OT7A 3KV9A 2Q8EA 5IVFA 3PUSA 3ZLIA 4LITA 5FZ0A 3ZPOA 5FP7A 5FXXA 5FPVA 5A7QA 5FZOB 5FYYA 5K4LA 3K3NA 4V2VA 5F5IA 5A7OA 4XDPA 5ANQA 3U4SA 4E4HA 5A1LA 5IWFA 4V2WA 2YBPA 4URAA 2XUEA 5A3PA 5A7WB 3K2OA 5A3WA 4QX8A 5FYVA 4CCKA 5FXZA 3KV6A 4QWNA 3KVAA 5IVCA 3N9QA 3OPWA 3N9OA 5FP4A 5KR7A 5FY7A 5FZ1A 4EZ4A 3KV5A 5IW0A 4BISA 2VD7A 5IVYA 5FZIA 5FZ3A 5F39A 4EYUA 4IGOA 2OX0A 3PU8A 5FZ6A 5FZFA 5FZAA 4BU2A 5F3IA 4LIVA 3U78A 5FPLA 5E6HA 3N9LA 5A7PA 2YU2A 4CSWA 3PTRB 5FZBA 3PUQA 4HOOA 4TN7A 3LD8A 2Q8DA 4DO0A 5FP3A 5LY2A 3DXTA 4GJZA 4AI9A 5A7SA 5FY0A 4QX7A 5FP8A 5FZ9A 2OS2A 4LIUA 5F3GA 5FZKA 4QXHA 4CCOA 5LWBA 4IGPA 5A3NA 5CEHA 2XXZA 4Y33A 5FPBA 5FP9A 5FPAA 4CCJA 3PDQA 3PURA 5FPUA 5F37A 3RVHA 5FZ8A 4UF0B 5FZ7A 5A7NA 3AVSA 5FYSA 4Y3OA 5F32A 4QU1A 5F3CA 5FUPA 2YBKA 5FZMA 5FJKA 3KVBA 5FZCA 5FXVA 3N9PA 5FY8A 5FJHA 5LW9A 5FYUA 2GP3A 2XMLA 5F3EA 5FZLA 2WWJA 2WWUA 2XDVA 4QXCA 2PXJA 5IVJA 5FYZA 2YBSA 5IVBA 5FZOA 3K3OA 5FY1A 4DIQA 3N9NA 4XDOA 5FY5A 5FXWA 4C8DA 5FZEA 3OPTA 4HONA 4EZHA 5F5AA 4CUGA 5IVEA 3PUAA 5A7WA 4GJYA 3KV4A 5FUNA 2YPDA 5A3TA 1VRBA 5IVVA 4Y4RA 3PU3A 5FYCA 4LXLA 5FY4A
chains in the Genus database with same CATH superfamily
4N8MA 4LORA 3S6PA 2KXLA 4I0BA 4O7XA 5DAWA 1MS5A 5LY1A 4CEYC 1J84A 3PNAA 4QX3A 3GBWA 4XW3A 4B7KA 4ARYA 1W0NA 2D5HA 4LE4A 2HWD3 2HBTA 4BLIA 4BZ4A 1W6MA 1YLLA 4NJ4A 2IUWA 1RUF2 2D6OX 5KBFA 5FK7A 4D6SA 1LEMA 2UURA 1A3KA 4W6WA 5FY9A 1V6LA 4S2HA 3ZYBA 2DBNA 1W6QA 5H9RA 1CPMA 2GP5A 2VH9A 4KWLA 2RS33 2HWD1 3AVRA 4RFRB 4JRLA 2D6KA 3HWJA 4DS0A 5FPXA 4BQ5A 2GNTA 1RINA 3JZVA 4QM8A 1HRI3 3ZXGA 3HQXA 3N9MA 2GAUA 4L9BA 2WT2A 1REFA 3URFA 5C6CA 1NXD1 4LHLA 1YFXA 2DU1A 1RUE2 3AZXA 3ZLIA 4NPMA 1OA3A 2JB8A 3F95A 1XJAA 2YG0A 1W6OB 5FYYA 4XAEA 1DZRA 1GV9A 2WBKA 3I3BA 3K3NA 1Y9GA 2RDNA 4LLFA 2Z79A 2RS12 1JZ2A 3K2OA 1G7YA 1UMHA 4GH4C 1KDKA 4NHXA 1SG3A 5CFCA 2J42A 1OBNA 2QQUA 2DVAA 2DTYA 3PJYA 4ES9A 1ULCA 1JH5A 1H1IA 2ZGNA 1G86A 1VMHA 4YVWA 2JDKA 1AX2A 2VXRA 4B1LA 1GWKA 1D0GA 1LOBA 1UY1A 2ZGMA 3KCYA 2GDFA 4JTNA 5LA2A 3VL9A 1XU2A 3AMMA 3LWCA 4XF0A 3LSDA 3WNPA 1JZ3A 4HSJA 1RUG2 4HOOA 2BFUS 4P5YA 4P9XA 2A3WA 4CCCA 2E7QA 4FTEA 4ZS3A 1BLZA 4AI9A 4QX7A 2VZRA 4QB6A 5GLTA 3VB9A 4RQPA 2V73A 2ZGLA 4DRRA 5L73A 2Y6KA 2P3KA 1TMF1 1Q43A 2XL9A 2ZAAA 4Y5TA 2DVFA 3WOGA 1N3OA 3NJZA 1ZZ7A 4RHV3 4JHZA 4I02A 4ISRA 3VDAA 3UJQA 1AR73 3VBRB 5CFDA 1PVC3 1V6JA 3E5XA 4YGDA 1ZBE1 3FMGA 4PLMA 2WZ8A 4Q4V2 1GQGA 4CU9A 5TSWA 2Q0AA 2HYKA 4I09A 4ZXKA 3ZR6A 1GLHA 3CJIC 4IE0A 4R4ZA 1MQTB 2W46A 1TVGA 3CNAA 2WN3A 4FOWA 2XMLA 4INDA 1QMJA 1JYWA 2FDHA 1ENRA 2WDBA 2Z4FA 5DZEA 5GZEA 2FDFA 2DCKA 1W8TA 4EQVA 2WQ8A 2F4LA 4A7YA 5EJ3A 1W2TA 3OTFA 5SV8A 2ZPXA 2VNGA 1Y9QA 3UKTA 2XLGA 1QJZA 1A8MA 2DYCA 2JECA 1ASJ2 3OB8A 4QU2A 4GJYA 1ZM1A 1UZWA 2DWRA 1S2BA 4XIKA 4YVSB 5A3MA 1CAVB 4Q4Y2 3LA2A 3MW3A 1T2XA 1QF3A 3MIEA 1WCDJ 1QDOA 5K7PA 4OYUA 2RMU3 4YWAA 3Q8CA 5IK4A 2WAOA 3FN9A 1ENQA 3C2UA 4WM7B 2RMU1 5FZDA 5C9AA 3SKVA 4AFAA 4EN7B 5CZKA 2GC0A 1RXGA 2WNUC 1FI2A 4RQPC 5IAVA 1LGCA 2JE7A 3SLIA 4Y1UA 1W2NA 4BIOA 3TEYA 1BZWA 3CJXA 1AL22 3QH6A 2D98A 2YU1A 3T2QA 4XCBA 2XBO1 4HK8A 1O3SA 1N3QA 4XFBA 1VBD2 3ZXJA 2UU8A 1PM4A 1AR82 5LBCA 4GB32 4FAGA 1RUOA 1VB2A 1OMIA 2DF7A 2SLIA 5FZ0A 1WCUA 1UKRA 2HWE3 4BQXA 3ME2A 1F2NA 3EJKA 5EQUA 4YW2A 4QPGB 4AVAA 1Y7BA 5AC91 2R042 1PMIA 2JIJA 4XUTA 2XJQA 1ENSA 4DXTA 1UY0A 1AYN3 3RI8A 2YBPA 4J1WA 1POV1 4YW6A 2EICA 4NHLA 1W3VA 4AGRA 1MS8A 1TMF2 3AZWA 3IIIA 1RUH3 4EV0A 3M8LA 1W2OA 5AFBA 4BWOA 4AQ2A 5C4WC 3KGLA 4DQAA 2P17A 3RMYA 1ULEA 4BOWA 4DFSA 3S0MA 1FYUA 1WA6X 4JV4A 4E8CA 1UD1A 2RJ2A 1L3JA 2OX0A 1QJFA 1YIFA 3W58A 3VBUC 1S0EA 5A33B 4YW7A 2JXAA 2JENA 2DUQA 2P2KA 1DYPA 2RE9A 2WO1A 2JG8B 3JB8A 1QQP1 4LBLA 4PF5A 1UZZA 3ZYIB 4MVTA 1D4M2 1Z7S3 2BOJA 3MFCA 3MV11 1IGOA 5LWBA 5E16A 1G9CA 4FQZA 1HXS2 3VD5A 4LK6A 1PO21 4Q0VA 1QOOA 1SLIA 5BNPA 1PGL2 3ES4A 3RG0A 1XSRA 4XQWA 5F8PA 1RIRA 5FZ7A 2Q8OA 3U1XA 1S55A 3L2YA 1NLSA 2Y6HA 4RA0A 2ZGKA 1RJ8A 2V5DA 2R0HA 4QKBA 1I5ZA 5I91A 2A75A 5HI0A 1MS3A 2VXJA 4X6QB 2XQXA 5F3EA 3JD72 3QACA 4MH0E 4N90A 1X9PA 3ZFEC 1NCQB 2D5FA 2JDZA 1CQ9A 1O8SA 1VR3A 3S7EA 5KHHA 4HL0A 1LU1A 3J8F3 1Y43B 2ET1A 1HQNA 4XDOA 4UT5A 3K75B 2ZBJA 4CDUA 3PUAA 5FAXA 2R1DA 1EUUA 1FNYA 4RN5A 5FRAA 3WNLA 3APBA 1IZ3A 3WDUA 3C7EA 1RUC3 3I3EA 4QPIA 5FLHA 1MEC1 1DQ1A 2RS51 3N4MA 1OD3A 2Q4SA 1GZWA 4JZRA 5FYMA 4FXKB 2VQ0A 3ACIA 1PMHX 3AP7A 5H9SA 5FREA 3VKFC 2Y6JA 3CEWA 2R073 4OI2A 3HVDA 3WXPA 3IPVB 2ZAHA 1JI6A 5FYBA 2W1QA 2VUJA 1UXZA 3D6EA 3LF7A 4IL7A 2R063 1GOGA 1UL9A 5FZ4A 4PHZA 5L9VA 3NAPB 3RZMA 3G7DA 1X82A 2J1AA 3DYOA 3HJRA 4DEQA 2RDSA 1AVBA 3BUCA 4SBVA 4BB3A 4DY5A 2IVIB 3MDPA 4B8EA 5EXOA 1H2KA 3D4KA 3LCPA 3LKJA 4QQLA 1QH6A 4ZY9A 4ZU4A 1H1MA 3UNPA 3POWA 4LT5A 5L7OC 3OEBA 1CAWB 1DDLA 1REEA 2OUHA 2YXSA 3I59B 3NKTA 5A32B 5HXMA 4PCRA 1VRH2 1RITA 3P5BA 4AWDA 1X8EA 4HT1T 4IXLA 4MGSA 5BNOB 2Z69A 5JZGA 3KVAA 3MUY1 2DFCA 5IVCA 1Y9MA 2YB7A 2FDGA 3PVBB 1N1YA 2DU0A 5FZ6A 5FZAA 5A70A 1AXKA 4TTGA 4BU2A 3WP4A 2YC2A 3BIWE 4N43A 1PVC1 2C9AA 5FTTC 1IQAA 2QQJA 3IZOA 4Q4W3 5AC93 1XRUA 5FZBA 4G9SB 1ZYBA 3I2DA 4LQRA 2Q1MA 5JMCA 2PLV1 1YXWA 2HYXA 3ORJA 1C5HA 3F2ZA 4P9GA 3OD4A 5FY0A 3ZYRA 3VBOB 1GR3A 1LGBA 4UXAA 3MEPA 3ZVXA 1AYM3 4PF1A 1C28A 5F9TA 1HXS3 2PAEA 3WW2A 1NOVA 4IV3B 4QT6A 4E2SA 3ZN5A 2VNVA 5I0UA 3N7LA 1MEC2 1JYVA 5BY5A 1J3PA 4COVA 5D8AA 4PIZA 1RUJ3 4L8QA 2G9GA 2JG9B 4IV1B 3L2HA 4BXSV 1HB4A 4J6GA 4HVOA 2IC1A 1QNWA 4ARXA 1JODA 3CZJA 1EV13 5A6QA 2WNVA 2XHNA 2GH2A 1BEV3 3K3OA 4K9SA 4LKDA 4AFDA 4CPBA 5T5OA 3ZMNA 1GYKA 3BPSA 3D82A 3OYWB 4FPYA 3BALA 1VE0A 4JX0A 4XJ8A 5FOJB 3MIFA 5FZEA 4EZHA 5IFTA 1IKPA 3P3NA 1OURA 1AR62 5T3NA 1M06G 2BNMA 5FQ0A 2V5YA 1H4GA 4YVWB 5LA0A 3AX4A 3I3MA 2LM3A 4ONUA 4WVMA 4PIYA 1H9PA 4QB1A 2DTWA 5F6LB 3G6JB 5KXEA 2VULA 4QX5A 2HWE2 1LTEA 5FZHA 5CG9A 5IUQA 1UYZA 5L7OA 1DGLA 1KS4A 4NIIA 4N7IA 3VBUB 3N7KA 1CJPA 1L7LA 2JD4A 3FX3A 3JU9A 4RQPB 1OT5A 4L0PA 1OVPA 3VBOC 2AC1A 4NPLA 1I6XA 3ZFFC 4QKDA 4RR3B 1W8UA 1CWPA 4IEUA 4FPEA 2VOVA 3CMGA 4ZS2A 4HBNA 1YFUA 3ALQA 5C4WB 2OXBA 1W8FA 1W6PB 5A1FA 1V6KA 2PHTA 3U75A 2P3JA 2YPJA 4WM8A 4XFHA 1I3HA 3W59A 1A8DA 4K1ZA 3SQOA 1WLCA 2VUDA 3AL6A 3FL7A 2VZUA 1TEIA 2XLAA 3GXUA 4PQ9A 4YRDA 4MXVA 3VN4A 4L99A 4LBQD 5C9AC 2D7FA 2W2IA 5JVVA 3OEAA 4RSUA 1B35B 3A21A 3WW3A 2DCTA 4QMAA 3KB5A 3WG4A 1MZ5A 5DPNA 4HPKA 5M0TA 2A3YA 3FHIB 3HAGA 5FKBA 3JXSA 3ZXKA 3ZFEB 1BKZA 4K8FA 5FDBA 3AZZA 3SNMA 2PQSA 3NNMA 5BYNA 5LRSA 2XBO2 3KWVA 4ITCA 4XJ9A 1VBB2 5T55A 3OGJA 3KF3A 2MPFA 2FDJA 1VBD1 3H1MA 3ZIWA 2X5IB 4W6XA 3EQEA 3UKNA 3EO6A 4XUPA 4IGOA 4WM7A 3WNNA 2QNKA 1BMV1 1ULFA 1W39A 2TUNA 4MSVA 3GGLA 5D1IA 5HXVA 3D8CA 4LE3A 3WHTA 3TN93 3GYDA 3ACFA 1XYNA 3V0AA 3DYPA 1W06A 5HCHA 5F7UA 2CAUA 3ZFFA 1C8M3 1LHOA 4D8MA 3LZZA 5A7SA 1LHVA 1Q8SA 1W9FA 2D6LX 3B5LB 4Q4Y1 1HRI1 4CCOA 5IAXA 1F9KA 4RHV2 5A3OA 3GJBA 1UOJA 3T4HB 2RDQA 2RS31 5CVRA 1GUIA 2HEWF 4GALA 1JYTA 2DVDA 3AVSA 5AVPA 5EFUA 1L7QA 1MQTC 5KWRA 1QH7A 4CUCA 4IW3A 1Y3TA 3FLPA 3HT1A 3KVBA 2OPWA 5CG8A 2PAKA 2G4IA 1QXJA 2X53S 4XUNA 4RS5A 4BPZA 3N7MA 1GP6A 4YW3A 1O5LA 3SXWA 4I30A 2R072 1NA1C 1OUXA 5JR2A 1OA2A 2O8OA 1Y4WA 4XF4A 5FZOA 1D2QA 3O1VA 4L11A 2XKOA 3AP4A 1BBT2 1BXHA 2WRAA 3OPTA 4XHXA 5KHKA 1I5PA 3O1UA 1WZXA 1XOYA 4LBNA 5F1RA 2WN2A 3KHBA 1US2A 2P6HA 1LENA 2ZTNA 1KFXL 4K1YA 5ABJA 5C3PA 4LPLA 4UAPA 2K0GA 1C57A 5K0UB 3HQUA 1ZA4A 4KI5M 4XVHA 1OHFA 4YM1A 5D2AA 5C5TA 1TZOA 2XJSA 4FOYA 2VUCA 4ISQA 1MVEA 5DG1A 4NUBA 4LBQB 5FFOC 5FWJA 2VZPA 4AK3A 1I9RA 2VNOA 1TNRA 1XC6A 4WZCA 3K46A 3PUIA 1JU3A 4JGZC 2WNUB 4DB5A 3ZMOA 4XMIA 1NKGA 2VR4A 1COV1 1NQDA 3IIAA 4Y20B 4IEYA 4AZZA 4B7EA 4CCMA 3AYAA 1WW5A 3H7YA 1ENXA 2QDNA 4E4DX 3K4AA 3PVOA 2VAUA 1JW6A 4LO7A 4LO8A 4D7YA 3JD71 3GF6A 4D94A 4W4ZA 3ZXLA 1WUVA 3RZKA 3WDTA 1ND3A 4YGEA 2MEV2 2FQPA 3WP6A 4BK5A 2HEVF 1DGWA 4Q4X1 1HIXA 1UN1A 1W2AX 1CVNA 1W8ZA 2B9VA 1IS6A 2ILMA 4FOVA 2NZ9A 3WG3A 4N9IA 1UF2C 5KXBA 1AX1A 3BTXA 5APAA 2F6BA 3EHKA 1VBC1 5FPVA 5A7QA 2PHWA 5K4LA 3O1OA 3Q8FA 3HOBA 2IWGB 4KWUA 4XBQA 2PHXA 3CF6E 2WC2A 2BU9A 2HWB2 3ZFGA 2BTVC 3TB0A 1R1ZA 1S0IA 3ZXAC 4WV8A 5JWPA 1LOAA 1W6NB 1JMUB 4P02B 3D0JA 4XETA 2RS32 1FOD2 1GSLA 3WNMA 4QM9A 2XVKA 5FP4A 4DY3A 4HETA 1MEC3 3NVCA 5IW0A 5FZ3A 4M01A 3KT1A 5FK8A 1WMDA 2IFWA 3CU7A 3GZAA 3AP6A 5DDJ1 4GIQA 4XCAA 3VHOA 3O1SA 2YU2A 2XLFA 3VDDA 3IPVA 2R043 4MO3M 5DUXA 3AKSA 3ZYGA 5LY2A 4WZFA 1CZTA 3ATGA 3OBRA 2FD8A 4META 2OW4A 2RR12 2NM1A 3VHPA 1AF9A 1K12A 1E5IA 2ERFA 3WD5A 4FFFA 4Y33A 5CEHA 4IEPA 4YG0A 4NHYA 5J36A 4FPOB 5JSOA 1W8WA 2DV9A 2ID4A 4CDUC 4RR3C 4UF0B 1OOPA 1Q8OA 2ENRA 1H9WA 4UI9L 3GALA 4UW6A 2FMYA 3NJVA 1LRHA 1SCRA 5C3OA 3DKWA 1VRH1 5I93A 5BV6A 3FFQA 4XQ4A 1MS1A 2WO3A 3THPA 4R9BA 2J1UA 4GMP3 1HKDA 3AMQA 2GP3A 2OUJA 3CDZB 4GWNA 4D0QA 1NQJA 3AM2A 1DLCA 4ZU7A 2R1BA 4QB2A 3R4DB 2BOIA 4U36A 3BPZA 3PLQA 1LB2A 2BWAA 1Q8PA 3VBSC 2A6ZA 3LDKA 4M4PA 4I3GA 2ADEA 4YZ1A 5BNPC 3LEGA 3VD7A 5KC5A 4HKOA 4B4PA 1EAH3 2VPVA 5LK7B 1HRV3 1OH4A 3T2TA 3FC0A 1K5JA 1GU3A 2B45X 3ENRA 2XHKA 3GM8A 4CCEA 1RXFA 5CIRA 4FSJA 4JHTA 1VRBA 2ZX1A 1WW6A 1W3XA 4PLOA 5J1XA 1PM7A 3U37A 4XBLA 4TLFA 1G6NA 2X5IC 1GKBA 4KGGA 5LBEA 3KT7A 2R30A 2W1SA 4OHXA 1ZVFA 1QXRA 2E7AA 3ZSKA 4COZA 4EN0A 4Z1VA 4P9WA 4CP0A 1UO9A 1XYPA 1UQXA 1H0BA 5GALA 3WP3A 1NCRC 3HEIA 3AXEA 3TEXA 3RI9A 4R8HA 2VVFA 1PO12 1WD3A 1JYNA 1PVC2 5T5JA 3ETPA 1WLWA 3AFGA 5D8AB 5BXXA 3NWKA 1RUC2 5LB6A 1OQ1A 3I2KA 3MHZA 4OI4A 3UT0A 5LZ6A 4A3XA 4QGNA 2J22A 4M3CE 1QJY2 2ZEWA 1CAUB 1CZSA 1QJY3 1V6IA 4Q2FA 1O3QA 1WBLA 4GMP1 5DXDA 1OLQA 4QPIC 1IOAA 1RUE3 1UU6A 4UFIA 2OYZA 4M3CB 3MBWA 3TEWA 4XDPA 5A1LA 5GZFA 5E88A 4AFBA 1BBT3 1E5RA 2PHRA 3FE5A 2O1QA 4V2WA 4WVVA 4CU8A 3KF5A 1WBFA 2W5FA 1US3A 1X50A 3AB0A 1Z78A 2XJRA 3MFAA 1ZZ6A 3C7OA 1F5JA 4AVBA 4BYYA 1MACA 2BVBA 1JYXA 3N9QA 1DGWX 2WT1A 4EZ4A 3WG2A 4AHZA 4AVSA 1UZ0A 3SISA 1RUJ1 2B9UA 4NAOA 1R083 2HWD2 1OQDA 1NY72 1TME3 3DEMA 1G9FA 3T0AA 3S57A 1DGRN 1R092 1AYM1 3CZUA 4KL1A 2JG8C 4W6YA 3MW2A 3ZN4A 4CXWA 1RMU3 1ZA7A 2DDUA 3CLPA 5CFDB 4OHWA 3OF1A 4H2AA 2P37A 3S5QA 3T09A 1Z0HA 2VW2A 2J7MA 1KITA 2EAAA 4N7UA 4DXRA 1VAKA 2H0BA 2JG9C 2GNDA 5IJRA 4CDQB 2IVJA 5AFEA 2D93A 5FUPA 2CL2A 1DCSA 2B5HA 5FZMA 3A7QA 5HCAA 1RUF1 1MZFA 3JQWA 1H2NA 4HMZA 2WO7A 4PDWB 1BMV2 2E63A 4QPYA 5LRRA 5CBLA 4URTA 4CTEA 4H7MA 2XG3A 4KNCA 1WW4A 2WWUA 4EN8B 1IQDC 4HVQA 4Z8BA 2VMEA 3ZYFA 3OBAA 2AEYA 3WSOA 1J3QA 2XL7A 1FMD3 1GMMA 1NUKA 4OZXA 4C1WA 1CR7A 3NSTA 1C5IA 4YVSA 3VZNA 3H8XA 4HONA 2Q30A 4AQ6A 4CUGA 2VCAA 3ZSLA 1X36A 1JYIA 5A7WA 4MYEA 1GZTA 1RUE1 1UOFA 4Q1RA 1C8NA 1JTZX 3VKNA 1PGW1 3KV4A 3B3QE 1FT9A 1VBD3 2VNRA 1PIV2 4ATFA 4XJZA 1RYYA 4IV1C 5KC6A 4CEWB 2WYSA 5FUIA 3AL5A 5G05L 4BLJA 3INAA 4TLGA 4NPRA 4LNVA 4YPJA 4N53A 4YW5A 2EF6A 1ZBE2 4IE6A 4AR2A 3MLKA 5BNNB 1ALYA 1H8TB 3PVEA 1CAXA 5A3LA 2ZMKA 1BK0A 3X29B 4F8AA 1YI7A 1HB1A 3W5NA 2VUAA 1FV3A 2VU9A 4WBBA 3O0XA 2RR13 1DLLA 1W05A 1HQWA 4XHBA 4JC1A 3R0RA 2VQAA 3M70A 3E6BA 5CADA 2Y33A 1GNZA 4KU7A 3VZLA 4PI2A 5KHGA 4XAAA 3BVCA 4S2DA 4AVCA 3MICA 4NWWA 1N1TA 2W3JA 4BQ2A 4XE9A 2HKXA 3R6SA 4AE2A 5I0SA 4CP1A 4LA3A 4AGVA 3ZPOA 4LO5B 3RZLA 1VMJA 2D3RA 4FAHA 1EP0A 1GP5A 1GQPA 2A6VA 5FZOB 3CL1A 4XJUA 4GWIA 3NNLA 2RV9A 1ZRRA 2KD7A 2RG4A 2VO5A 4RGGA 4V2VA 3HPNA 1WCKA 4LHNA 2Z42A 3AKRA 4XFIA 1QOSA 3U07A 2XUEA 2BBVA 4YW4A 5FOBB 2DCJA 4CU6A 3VD4A 4CCKA 4IEOA 1SCSA 3S7IA 2NMNA 3BOWA 5I8YA 3RRDA 2C4XA 2JE9A 1WMEA 2I07B 3LB9A 4RGAA 2VTXA 5C7GA 5KXCA 4XPVA 2QQLA 5A33A 3RWKX 1GANA 2QBXA 3KV5A 3AK0A 1DP0A 3Q9OA 3PIJA 4M0NA 4NMIA 4Q4X2 3DPRB 4YZ4A 2CGNA 5F39A 4CEWC 5GZGA 1U5YA 3K4DA 2JG8A 5FPLA 1YQ5A 1ODMA 3LOIA 1GOHA 3I2GA 4Y26A 4Q5OA 5KHJA 4M4RA 3ST7A 1GNHA 3N35A 2X29A 3PUQA 4UBHA 1UX6A 4BQYA 1NX9A 3B9CA 2F17A 4IEZA 1PNGA 2BVVA 4GJZA 3J7HA 1XB9A 2OS2A 1W8HA 4QQOA 2L9LA 4AI0A 4BK4A 2QQWA 3U0ZA 2CHHA 1BHGA 3GZUC 5FPBA 2BERA 1LOEA 3AP5A 3KMHA 3V65A 1YJKA 2DCYA 3WQ1A 2E6VA 3RNSA 1QU0A 2CYFA 2VMFA 2HWB1 5DDJ3 1IHMA 3O12A 2WWSA 2BRTA 5D21A 5FZCA 2EIDA 1V9U3 4Y1YA 1A34A 2VCMA 1AL21 5FYUA 2W47A 2ZHMA 1XYOA 2ZCWA 2PXJA 3H9AA 3MIDA 3MZHA 4KH9A 4ATEA 5FY1A 4ES8A 3ZSJA 4SLIA 4R9CA 5CISA 3S30A 3OY8B 4Q4W1 2JEMA 1AYN1 1DQ0A 2G9ZA 4FFHA 4QX0A 3PL0A 1A78A 2NP0A 3KCCA 1YC61 3OGGA 2I2SA 4AXOA 1BYHA 2LUWA 3JBG2 5C8CA 2YYOA 1YO8A 4XMAA 2E53A 1AR81 5JXJA 1ZX5A 1U5IA 2D6NA 4ZHNA 3E97A 1QJX1 3NV4A 4H14A 4JCKA 1O3TA 2PMWB 3LPFA 3NNGA 4EROA 1EUTA 3GZEA 5FYTA 1Q5OA 3RDIA 1W8OA 5JXHA 2ZS6B 2LS6A 1NCRB 1SPPA 3WT3A 2CDPA 5JMOA 2C9KA 2P34A 4QHZA 3ZSEA 4BIFA 3OBZA 4AAPA 3U11A 4E4ZA 4CVUA 1W6MB 4BXFA 1EAH2 4OUMA 5IT6A 1V00A 1W9WA 1X33A 2GN7A 1SLBA 5CFDC 4LUKA 2X8KA 3KQ4B 1LR5A 3KM5A 4Y5Z0 1FMD1 3K51A 3PVNA 3D3AA 3U14A 4YZ2A 4NR1A 4P08A 4FTSA 4COWA 3WEZA 4HVRA 4AVVA 3A23A 2UYAA 3LDBA 1D4M1 4XFCA 5IVFA 3IM0A 2R061 1J59A 2DURA 3GCWA 4GWMA 5ACA1 3SC7X 3NV1A 3WNXA 3OBTA 3BTAA 2BGCA 4Y5SA 4PDWC 5FBZA 4FI9A 5GLWA 4ASMB 4CDWA 5BNOA 5ANQA 2HLEA 4PBPA 5FO9B 5IWFA 4URAA 1KJRA 1UKGA 2Y6GA 1ZZ8A 3POJA 4O61A 4I0AA 5GLUA 4A45A 1WWYA 1ND3C 3AJZA 4Z07A 2E9QA 2VM9A 2NYYA 2XR4A 1ULDA 4AF9A 1HN0A 1CAVA 1RMU1 3SCGA 1FAYA 1UY4A 3VBRC 5LASA 5IHRA 5FY7A 3I54A 1FPN2 3ITQA 3LSEA 2VJXA 3FBYA 4MGZE 5CAZA 5FR3A 5EZWA 5LA1A 3WINE 2XONA 1OFNA 2RM21 1GWLA 1NCQC 3I2IA 4HXCA 3B93A 1WCSA 4XXPA 5GLVA 2R32A 2VL4A 4RD7A 3CKHA 1ZRFA 1TNFA 2D3PA 2WZR2 2ZMLA 3ILRA 1VBC3 3POFA 2Q8DA 1UIJA 3POEA 3DXTA 4P9LA 1M4WA 1Q3EA 1D4M3 1K5MB 2E51A 1CJDA 3J9SA 5JSPA 3LFMA 5EV7A 1SFYA 1QWRA 5A3NA 1FOD3 2TBVA 3MUZ1 5FPAA 2JG9A 3MI8A 4RYDA 2G1MA 2H6CA 4AHWA 3RVHA 3PUHA 2K9ZA 5EWSA 4QDRA 4C1XA 1DF0A 3LEIA 2ORXA 4Y3OA 3VDCA 1F31A 2PTMA 5FXVA 5BPXA 1J1TA 3KHCA 4D7TA 1UOBA 2Y34A 3RGBA 1JHJA 4GZ9A 3ZFGC 1JUHA 1SBFA 5EHDA 4K8RB 4AGGA 1F15A 4LMFA 1LHWA 2QUOA 5JOXA 2XDVA 3VBFB 3QH7A 4NHMA 4YLZA 5H9PA 3T1MA 1XU1A 4HG6B 4K20A 2BDRA 4S2FA 3Q8BA 2RJLA 1QKQA 4FPGA 1AYM2 3PMSA 4DUXA 1D0HA 2WT0A 2RVAA 3U4XA 2WS91 1UCXA 4P9JA 4CP2A 3HNBM 3R4UA 2K46A 3J4UH 5BNOC 3TRSB 3ASIA 3VBSB 2BPA2 1NAEA 2GN3A 1APNA 2CAVA 4OUSA 1H4HA 4QGMA 2GU9A 1R1A2 3O14A 4EN6B 3ZIXA 1CPNA 1RHI1 4QX1A 5A7NA 1ND2A 4XIOA 5CB7A 3RJRA 3VKLA 4DUWA 1UW8A 2VZ1A 3QLQA 1YUDA 4FFGA 2ZZQA 3ZO0B 3ZR5A 3VGIA 1AZDA 2A1XA 2DUOA 3MV01 1YQ8A 4Y1ZA 4MGKE 3UYJA 3WF0A 3J7LA 2E32A 5I0DA 5DQ0A 1OUSA 3FFZA 4Q4V1 4IUGA 1H30A 5F5QA 4WM8B 1OXCA 5F2SA 3V56A 2ADDA 1DHKB 1S4CA 1RUH2 4KMQA 1HRV1 5JI9A 3SKJE 1S0DA 3SEPA 1C3HA 4MXWB 4C0HA 5K0UC 4BHPA 4D7SA 4GKYA 3CIHA 4IERA 1LECA 4YG6A 4B4QA 3VDBA 3O1PA 2XWBB 5ISLA 1DQ4A 1HDKA 2ZGSA 3IT8A 1PGW2 1B35A 2WYFA 3HBZA 4NIHA 3DPRC 2W94A 4DUVA 3AC0A 1ZZCA 4Q4Y3 4EWEA 2P5BA 4FP3A 4UFJA 2YFZA 2DCZA 1JS9A 2ATFA 1NA1A 4IQPA 3DKQA 2J1TA 3H0OA 3HR9A 1LGNA 2B42B 1KXGA 3T0DA 1PIV1 4MUVA 2QQOA 4U2AA 4C91A 1JZ4A 3R05A 5LEKA 5DAQA 1W9YA 1ST8A 2EIEA 4MLOA 4BMBA 2CU5A 3VD9A 4NE9A 3B01A 5DZFA 3CO2A 4QKFA 4Y22B 4AFCA 5HV0A 1CZVA 1BCXA 3RYPA 2PHUA 3KV6A 3R4SA 2PFWA 2H6BA 2WZEA 4O9EA 2XVGA 2NQYA 2QFEA 1YQ6A 2A6XA 2HWF2 2LROA 4JGZB 2VD7A 3TNQA 5FZIA 3V0AB 2VBBA 2JD9A 1C1FA 5JCTA 5F3IA 4LIVA 2OA2A 3LA3A 4AEMA 4DEVA 2YMZA 5JPNB 2BGPA 3J7MA 1PK6A 2FHRA 1LJ7A 2CSGA 1AR61 2P3IA 1H8TA 1XQNA 4OLLA 4X6RB 4BDVB 1VALA 2HEYF 1UMIA 5DAXA 2EIGA 2B4KA 3W5MA 1UAIA 5FZ9A 4UFKA 2WUHA 2WQZC 4EWDA 4XOGA 2FZ2A 2YHJA 3KCXA 1URXA 1W2UA 1H6XA 1V6NA 4YVWC 1AJOA 1ZBA3 1SLAA 1CIYA 3V64A 1POV0 3LIHA 5FPUA 2C6SA 1JOJA 1WLTA 2ZEYA 4LKFA 4RS5B 4EE2A 4HANA 4OFGA 3MLJA 3OD0A 2QQMA 3JBG3 4AYUA 1SBDA 5C3SA 1QY4A 5E89A 1S0BA 2O8QA 3UKVA 4WM7C 4P00B 2VMCA 1WCQA 1FNZA 3ZXEA 2WNVC 3LDRA 3WCSA 2UWBA 4W65A 1JOBA 1YNAA 1W03A 5ABJB 2ZA9A 3KLSA 1CIWA 4BCUA 1NG0A 2J1RA 3P1IA 1AR63 1Q8VA 5K0UA 3T3YA 1Z7S2 1HV1A 3VBHA 2XJUA 1GZCA 4NO4A 4IESA 5JUVA 3ETQA 1KDMA 4JGYA 2R0FA 3WLUA 5C8CC 4AI1A 4YM0A 3DPRA 3DGTA 4FP2A 4E2GA 4YM3A 1GNYA 3PU3A 1W04A 2PYTA 4N43B 4IEQA 2B7YA 4ZKTB 2ZHLA 2BJSA 1JBCA 2QQVA 4AI3A 3NJYA 3RSJA 4OQ9A 4ASKA 3I2OA 1VBA3 1O91A 2ETEA 2XJPA 4A41A 1NE4A 2EXIA 4LULA 3V0BA 3SH3A 2KA3A 4XJWA 4DZGA 4I2OA 2EVXA 1XE7A 2ZGQA 1UY3A 3GNEA 3POSA 4M00A 1V6OA 3NQHA 4TWTA 5T54A 3RFRA 1H8VA 3BKZA 3WUDA 3H8UA 4A6SA 3WCRA 2RS13 3ZKUA 2AUYA 5BNQA 3WF2A 1LHNA 2QQPA 4W8JA 2R071 4CCNA 4UWDA 1VBB1 2JE8A 2QKDA 4GD4A 5DUWA 2Q8CA 2VECA 3WHUA 2WQ4A 4BH9A 2WO2A 1UIKA 1XE8A 1E57A 2ZGPA 3NW4A 2I45A 1O7FA 1KS5A 4GB33 1SLCA 1AL0G 1AR83 1HRI2 5FMDA 2VTFA 3EBRA 2WNVB 1NZIA 2DBIA 5GKAC 3AFKA 1VB4A 1W6NA 2A7AA 3ON7A 4LO6B 1ZBE3 4LR4A 3SITA 4I01A 2Y6FA 1SQ4A 2VY0A 4RFT0 5DMYA 2HH9A 3VBHC 2DFBA 1IPJA 2F4PA 4LBKA 4FBFA 3TEZA 5D8AC 4Q29A 5A3WA 1IG0A 4KGQA 1TMF3 3IDEA 5T50A 1OLMA 3FLRA 3E5UA 2LALA 3WVJA 1AUYA 2K2SA 2FCTA 4KWJA 2N7GA 1V9U1 4PI0A 2ZGTA 3M3IA 1OKOA 5IYYA 2OKXA 3VV1A 3DV8A 3B7MA 1EAH1 1BBT1 1SLTA 1XNKA 4QQPA 5HBAA 1GWMA 5FMBA 4Q4W2 4HZFA 4JKMA 5T5LA 4OQ8A 3OGVA 1F35A 3GBGA 4TN7A 4ET7A 4A6OA 2IXCA 2WNEA 3I2JA 2A6WA 1Z7S1 5F3GA 3GDBA 3ILFA 5FZKA 4KBBA 1W6PA 3RS6A 3VBRA 1PGSA 3H1YA 3C7HA 2XOMA 1CD3G 4NVPA 2EXKA 1PVXA 3TWIA 1VBE3 1UXXX 3M1HA 1VRH3 1W6QB 3HD8B 4ORFA 3VBOA 1LOFA 1XNTA 3M4FA 4AEDA 1COV2 3E6DA 3IAPA 2ORZA 2VZQA 1FPN1 3BB6A 1NZCA 1PIV3 2ZJCA 4GQ7A 4WVZA 4AAXA 2GSYA 3N9PA 1DIWA 3ROUA 1NLQA 4AQTA 5LW9A 4JKKA 2RMU2 5GLZA 1FOD1 2ES3A 5T5PA 4BQWA 4YW1A 4CDWB 3AKPA 1J3RA 2W91A 2NPIA 4IV1A 3I4IA 4GKXA 1KJLA 2JDHA 2ZKNA 3ES1A 1TME2 2VMGA 2JX9A 5FMOS 3DECA 2HJIA 1UOGA 1FMD2 1XSQA 4ZPIA 1IS5A 2QTWB 1KEXA 2C5DA 1YFWA 3LQCA 5DN2A 2HBUA 4AW7A 2VGDA 2ZGRA 4P9YA 2ZGUA 2R062 2MEV1 2CTVA 2UY9A 4N9HA 3WQBA 1S2KA 4GH4A 5CFCC 2MEV3 1G9DA 3T4VA 2WA3A 5L36A 5FKCA 5C9AB 1P8JA 4YFWA 5FMCA 4C0BA 5C8WA 3HIFA 2PN5A 3AMPA 4PT6A 4QXBA 1OFSA 1ZZ9A 2W52A 1OOPC 2QQKA 2VVDA 5A80A 3WDYA 1JZ7A 1B35C 2VMHA 3MIGA 3M3QA 3VDDC 3BTZA 1OH3A 1F4AA 1RMU2 2D43A 2MHFA 4HLTA 1R093 4OZOA 1GOFA 4FPFA 4FVVA 5H9QA 1DYKA 4DPNA 1W28A 5CYYA 1POQA 4MZUA 4NRQA 3I97A 4AHYA 4CDXC 5A3UA 1UPIA 5C71A 3AMHA 2CGOA 3EYPA 4LJHA 1BEV1 1V9U2 1PZ9A 3DXUA 4FCAA 1IS4A 4Q4X3 2OQ7A 4QPGA 3WF1A 3B02A 1S0CA 4RS5C 1N1SA 1ZREA 3I2FA 4Y1VA 4B29A 4BQ1A 3SEEA 3VBFA 3JD73 2ZXQA 4QX2A 2BZDA 3SHRA 1MQTA 1SACA 3D5OA 2WAAA 4JVAA 4JTOA 2VW0A 5F5IA 1QQP2 2E26A 2NLRA 1F5FA 4EWAA 5F6KA 1UYPA 4NIGA 3N36A 4XUOA 1HXS1 1O4YA 3LGRA 3WW4A 2LRPA 4XFAA 5HCBA 2WSUA 1LOFC 1RL3A 2OVUA 1IPKA 1UX7A 3KGZA 1GBGA 3PTYA 4IEVA 2D3SA 1DG6A 5EP9A 1G8WA 3EXUA 2BFUL 3FHQA 3OSDA 2O14A 4IE5A 1RUH1 4QPWA 3B94A 2WNUA 4CYDA 1KD7A 2JDAA 1PK6C 2YV8A 2H0VA 2EIBA 4UOJA 1JHNA 4BQ4A 3AZYA 4Q0PA 2FMDA 1RJ7A 2D40A 4FQ4A 5A7PA 3RZJA 3PTRB 3P6BA 4DMIA 3HN3A 4XACA 4XFGA 5T52A 4D69A 1V70A 2XH6A 2D6PA 1OI6A 1FXZA 4KQ7A 5GM0A 4NIDA 5BNPB 2CWSA 1ZNPA 5DZGA 5GZDA 1H1AA 1XNDA 5JIAA 4MXWA 1RHI2 4CDQA 1VBE2 3RQ0A 1AL23 4CDXB 3E6CC 2W0XA 3PURA 3RZHA 3OUJA 3ZN6A 3MF6A 4UW4A 5JXIA 2G19A 1EY2A 2VMIA 2XGXA 1VBB3 1W9SA 5E8AA 2XBO3 2X10A 2XWJB 4QU1A 2B46X 4LO4B 4BE3A 2RS52 3BODA 2Q1ZB 3K77A 1NCQA 4XZUG 5A6ZA 1XNBA 2J1SA 4NRMA 2Y8KA 1PNFA 2I74A 4FPKA 3E5QA 3HNYM 2RDRA 4FOQA 5LK5A 4RL7A 2HWF1 3ZFGB 3O7OA 1C8M1 4R52A 3VL8A 4YZ5A 1CX1A 4Y22A 3KSCA 3O5SA 5FY5A 3T2PA 1ASJ3 4C8DA 1OLRA 1LODA 1BVVA 5BUVA 2XUMA 4AHXA 3E1F1 1GZWB 1SFNA 3WNOA 2X09A 1GFF2 5FUNA 3POYA 2OPKA 4OULA 3NMBA 1AR91 4N53C 4NROA 2ARXA 2D97A 3PJQA 1QJY1 2C24A 4GWJA 4LK7A 2GC2A 5J48A 4FPCA 4HN0A 3FHAA 1DQ2A 2OQ6A 3EB7A 3OGRA 4AEJA 4X8NA 2VOWA 2NN8A 5FWEA 5B2GB 4AL9A 1GQHA 4CE8A 1R64A 2PQQA 1S0JA 2AR6A 2YY1A 2WINB 1YFYA 3AMNA 3BU7A 3IWZA 4YARA 5FLJA 2YUEA 5KXDA 1YCIA 2VMDA 3NAPA 1QJU3 1V0AA 4OHYA 4GAZA 3LAGA 4YVSC 1DFQA 4UF0A 3Q8AA 2UY8A 1AR71 4P9IA 1MZEA 3HNMA 2ZABA 4K6BA 4CXYA 1CONA 2BNOA 2IZWA 4OVEA 4COYA 1DQ5A 3J8F1 3FUQA 4PIXA 2GNMA 1SZBA 4YG3A 3M7AA 1CAWA 1PZ7A 1XBFA 1S0FA 2CNAA 1VPHA 5LBBA 2ZGOA 3PUSA 1DU3D 2YFUA 5A32A 3RZZA 3ZYJB 4F7ZA 2WL1A 4S2GA 3RMXA 4XILA 2IFRA 5EJ1B 2PLV2 1NE6A 2WR9A 4CUAA 2CY6A 1H2LA 2AREA 2HWB3 2Y0IA 3U4SA 3CJIA 3DYMA 3SH5A 5GJ6A 5J98B 3VBHB 1RVF2 1UPSA 2WFF2 1U0AA 4GXLA 3ZYHA 1VBE1 1WA4A 5A3PA 3FUOA 3JUUA 4JGYB 3PIGA 1OSGA 2BV4A 4QX8A 4CDQC 1YEWA 2A3XA 3WUCA 4YM2A 2QQIA 4QGLA 3VZJA 2GMPA 2PA7A 4CDUB 4MV2A 4IETA 1LCLA 5DABA 3ECQA 2ET7A 4XF1A 4Z82A 3W9AA 2YGLA 1YQ2A 1O3RA 4AOCA 1UZYA 1J58A 1QJEA 1PX4A 2UWAA 5CFCB 1ZRCA 3U78A 5FMOL 5JDBA 5KHIA 5E6HA 4L97A 4ZXEA 3O0VA 4Z2WA 3V0BB 3RZGA 3N9LA 1TE1B 1SLLA 2Y6LA 4LOSA 3WY6A 4XF9A 5FPZA 4DO0A 3LFIA 5AC92 3WX5A 2JJ6A 2ARCA 2BNNA 3ELNA 2JKBA 2EA7A 3VDDB 3ZPYA 4XTMA 3MW4A 5C33A 4MGIE 4LUMA 4MX3A 3USSA 1LEDA 2WJSA 3IDAA 2R041 4CCDA 2Z2SB 5C3RA 4FPHA 2UWCA 5F3CA 3RWNA 3MIHA 1B09A 1VIWB 4AQSA 1FATA 2HWE1 2FCUA 2ZMNA 4DXSA 1OOPB 5FCCA 3DCQA 1AX0A 3OY8A 4YNIA 2Y38A 4R4XA 4JRAA 4A3ZA 4KWKA 1ZZBA 2FZ1A 4Z92B 1YHFA 5EIYB 3TN92 2PLV3 4AFMA 2R49A 4P14A 1IKQA 5C8CB 3LEKA 5ABJC 3I59A 1SMVA 1AR93 1OKQA 4LOTA 2QZ3A 4MGYE 3QD6A 3TAYA 4UFLA 1OVSA 5ANNA 2VW1A 3PMEA 1JZ6A 5JZGB 3I2HA 5IVVA 5CNAA 5FYCA 2GZWA 5DAPA 3VBUA 4DIQA 2WS93 1MVQA 5FIXA 1UU4A 4O65A 4CRQA 5JIUA 3GBFA 3SH4A 4MGTA 4GA9A 1NCRA 1SPPB 2Y64A 2ZX3A 3BYWA 1PGL1 1SDWA 1K3IA 1O8PA 1HLCA 4J25A 4H7LA 3VHNA 3AZVA 4D6QA 5F2WA 5C4WA 4YFZA 4J1XA 3JCIA 5SV5A 4XUQA 5DG2A 5JPMB 2R7EB 2BGOA 2VC9A 4OMDA 2BQPA 4XBNA 1EPZA 1O4TA 2P1BA 3LEMA 4AEDB 1GZ9A 1QGLA 1COV3 1S0GA 1JU4A 2AZ5A 2W92A 3LA7A 3OJBA 3T0BA 1ZRIA 5FYHA 4ZZ8A 1IG3A 4Q27A 3CHXA 4JDOA 3ZM8A 4XYXA 2ZX4A 2A71A 4JDMA 3I7DA 4IV3A 2ZHNA 3USUA 5DUVA 3C7FA 3UK9A 3K4ZA 4BQ3A 1XNAA 3B9IA 3O1RA 1JYCA 4H3WA 1PO22 1W9TA 3JBG1 4XEZA 2VQUA 3HMYA 4OUEA 1QOTA 4QKNA 4G3YC 1MS0A 5A7OA 4TYSA 4XXAA 1OF3A 4K7JA 1O4ZA 1GICA 2OIIA 1XE0A 3C8XA 4RHV1 4Z2AA 3K48A 4LBJA 1JOPA 5A7WB 3M2MA 3EMRA 4QDSA 3SMHA 3T30A 2JDPA 4GH4B 5FYVA 5FXZA 2R6QA 4M3CA 5CKMA 2RHPA 5CU1A 3UV9A 1WMXA 4P5HA 4QWNA 3ZKYA 3BIEA 3OPWA 3WV6A 2RS53 2P6CA 1L7RA 2B39A 4QQHA 1AXYA 4CEWA 2FCVA 3MO4A 5FQ0B 4LKEA 1TME1 3RYRA 5EYYA 3KS7A 5IVEA 4B3NA 4YZ3A 4FFIA 1HB2A 4WVMB 2VBPA 4XDQA 4N53B 2V09A 5JLVA 2VG9A 4NN0A 2XVLA 2XB6C 4FPLA 4D3WA 4EJRA 2IXLA 3NJXA 1VP6A 1BEV2 1DQ6A 2MNGA 5A6XA 1EV12 4KBZA 1CX4A 4LIUA 4QXHA 3OUIA 2W39A 3ZOIA 3NV2A 1QJX2 1RUD2 2JDYA 2ZEXA 3WG1A 4CP9B 5F37A 1AXZA 5EPAA 5FZ8A 3WZ1A 1H6YA 5FYSA 2W68A 3AP9A 1REDA 4UW3A 1HQLA 1OPOA 1STMA 2W87A 5IK5A 4NWVA 1JZ5A 2PELA 2A6YA 2BWCA 2JDUA 1BVP1 2ZACA 3I3QA 3M3CA 4PBOA 4CEYB 2XKPA 2YGMA 4Y4YA 4QXCA 1UY2A 4MADA 1QQP3 3WP5A 4F3JA 1VBA2 1VAVA 3VBSA 4PDWA 3UGFA 3T2OA 4XF3A 1RUD3 3S5AA 3ACLA 4HPKB 3M3OA 5FXWA 3I49A 3ACGA 4LHKA 2DVGA 4IV3C 3IKWA 1LNSA 3POIA 1EPWA 3ZFEA 1LULA 1ULGA 3BI3A 3H3LA 1ULOA 2E7TA 2WZR1 4JQTA 4ASLA 1RC6A 5JOWA 1ZBA2 1QEXA 3HN1A 1LAJA 1W90A 5JOYA 4M0HA 5A3TA 2AH2A 4AEDC 4W50A 4Q1PA 5FO7B 5F5CA 4Y20A 4D6RA 4CCJA 2VCCA 3A0KA 1K42A 1XNCA 1RUI2 1OC1A 1X8MA 5B4XA 5C70A 1ULPA 1VBC2 2IXHA 4PQQA 1F4HA 5ACA2 1RB8G 3C7GA 3RPQA 3LOBA 4A7ZA 4K40A 3BCWA 1POV3 1T6GC 3VD3A 1UZVA 1HJFA 1C8M2 3ILNA 1ND3B 2VCBA 1FV2A 2TNFA 1J83A 4A42A 3H3UA 1K45A 1QJU1 3MPPG 1NYWA 1HB3A 1JXNA 3JQXA 5FV3A 1N47A 3B69A 3LPGA 2RM22 2XJVA 4TSVA 5IK8A 3AYCA 2AYHA 3FBMA 3NNFA 3ZDSA 2ZOEB 2EAKA 2QZ2A 5HCFA 2YC0A 4DINB 3WF4A 3NO8A 4IGQA 5JXGA 1RUNA 4A2UA 3VZOA 1UMZA 3KV9A 2Q8EA 3KZ4C 3POBA 3N3HA 4KU8A 2D6MA 3WDXA 4DOUA 2CGPA 1R1A1 2WLQA 5J3UA 4K3UA 2QVSB 1MZ6A 2YC4A 3ZDVA 4E4HA 3ABZA 3C3VA 4R9AA 4B1MA 1O6UA 1LOGA 3IBMA 3H1WA 3UGGA 2BEOA 2VQTA 3QCWA 1HJGA 3A4UA 4TZDA 2PHDA 2YROA 2PAMA 1AR72 2HWF3 2FBEA 2CDOA 2JIGA 2W08A 4CZSA 4V1PA 3SCHA 4YSFA 1PK6B 5C3QA 2VVEA 4LLOA 4KG0A 5FZ1A 2IXJA 4CUBA 4BJ0A 4ZU5A 1DZTA 3BN6A 2WZPP 5FZFA 2G9FA 3GHNA 4Y1XA 1XXNA 1UYYA 1ND2C 2EXHA 5L9RA 5JZGC 2VOTA 2WS92 4LBQA 1AJKA 2W9XA 2IXIA 2HWC1 3ZYPA 2GH8A 4YGCA 1HW5A 1VJ2A 3ZXDA 3J8F2 3KT4A 3VZMA 3LD8A 1HV0A 2BW8A 5FP3A 4QDQA 1W0PA 1JN2P 1AR92 3VBFC 3KD4A 3NRUA 4FPJA 3MYXA 4GULA 4AI8A 4A44A 2CV6A 2P3YA 4IGPA 2XXZA 1LKNA 1SEFA 2B8MA 5FP9A 3PDQA 3J26N 4BMEA 4H55A 3H50A 5I0TA 4BM8A 4Q0SA 4FT8A 5B4NA 5CKQA 4O9GA 2VZSA 3WNKA 4PLNA 4UBGA 2TEPA 2RS11 4AVTA 4OI0A 3O1TA 2WFPA 2VZTA 1O5UA 1VMFA 5ACA3 3U10A 4QD2A 5FY8A 4KG8A 5I8TA 1PX3A 1AHSA 2C1FA 4DNYA 2WWJA 3CJIB 4XTPA 2YBSA 3CBNA 5IVBA 3WR0A 1W6OA 2EXJA 5LCWL 2JKXA 1RVF3 2WFF3 2VZOA 3H8OA 1G9BA 5CA6A 5F5AA 4Q26A 2VZ3A 5EYXA 1WD4A 1R1A3 2ZX2A 2VBDA 1U5XA 3IAQA 3OYWA 1NT0A 5LBFA 5LEJA 2VE1A 3FZ3A 2RJKA 2C26A 3WDWA 4COUA 4GMP0 1LHUA 1X9TA 4TXWA 1S1AA 4WVWA 4X8PA 5FY4A 3OCPA 3N7JA 2FDKA 1RVF1 2V72A 2QE3A 2WFF1 3GZTB 3JB4C 5FLIA 2AGSA 1PZ8A 2V4VA 4CCLA 3OGSA 3LE0A 5FBJA 5FYIA 1C4RA 1O59A 4A4AA 1TG7A 2A5ZA 1QIQA 1OF4A 2QCSB 4I3PA 5AVAA 1OQEA 1BK1A 5EJZB 4OCTA 4HFSA 4UYBA 1QNYA 4UFHA 5L7OB 2C0ZA 4XURA 3UETA 3NL1A 1X7NA 5JI7A 1SDDB 2GMMA 3IB3A 3TOJA 3VLBB 1U12A 1YJLA 4G4FA 5IATA 4OHVA 1CAUA 1N3PA 3QBQA 3BTYA 1RUG1 4RR3A 1BQPA 2LTNA 2E33A 2OZJA 1RUJ2 1W99A 4CXXA 4QPGC 2CWMA 1SHWB 2OT7A 5JSRA 1WKYA 4LITA 3I3DA 4YYOA 2W1WA 5FP7A 1E5HA 4Y24A 5FXXA 5LA9A 4NIAA 3W20A 1SFPA 1W0OA 2QDRA 4OI1A 2WZR3 2HWC3 2JDNA 3DUIA 4JGYC 5BNNC 2PHFA 2BYVE 3ZXFA 5G04L 3THDA 5J37A 2QQNA 2V4AA 1WW7A 3VZKA 3OPZA 2LW8A 3NNJA 3NKGA 3AKTA 3B00A 2W95A 1KGYA 3RYKA 4FXGB 3T08A 2Y0OA 3THTA 3PHMA 5A1AA 1RGSA 5K9YA 2VOXA 3MF9A 1WGPA 3N9OA 4DXZA 3A22A 2SBAA 3H8RA 4EYUA 3TN91 3P3PA 4N43C 1U5ZA 5IFPA 5JR7B 1QHDA 3T1LA 4HK9A 3L9JT 2A73B 2KR2A 4XC9A 5FO8B 5DAVA 4ZONA 1UNBA 4AI2A 4CSWA 3UESA 2X5IA 1WMFA 1KRIA 1ASJ1 3AKQA 3HBKA 3IDBB 2R16A 2QJVA 3OG2A 5JOZA 5A6YA 1DYOA 4E2QA 5FP8A 2ARAA 3WF3A 4E8DA 3TNPB 3SCFA 4LHSA 2BUKA 4MHUA 3HQRA 1MS9A 3I8TA 4IDZA 4UW5A 3BGAA 3ZFFB 1K5MA 3QOPA 1G9AA 3USUB 2BBAA 5F32A 3VKOA 2O0OA 2Y26A 2YBKA 2ZX0A 2A70A 5FJKA 5DUUA 1KQRA 4E9KA 1IPSA 2E31A 1E5SA 2JDMA 4HKLA 3TYJA 5LATA 4PJYA 4LBMA 5FJHA 1R082 4M3CF 3AYEA 5FZLA 3H42B 1KFUL 4XQDA 5HPOA 3POGA 3UL2A 5IVJA 2VOKA 1OLME 1RUG3 1WLDA 2GMEA 4EN9B 3AJYA 3N9NA 1JZ8A 1V6MA 2EALA 2Q1FA 3MIBA 2WNOA 1RHI3 2RR11 1H2MA 4QXKA 3WQ0A 1SBEA 4F83A 2AEZA 3FWEA 4HSLA 2RM23 3LIGA 3J7NA 4JGZA 1XPWA 4Q8LA 1S2EA 3IMMA 4JAAA 2NMOA 5I8SA 2YPDA 2WKKA 3VHRA 4Y4RA 2ZZJA 1NXMA 4LXLA 4GB31 4E27A 2ZKLA 5GZCA 4BA6A 1RUD1 3FLTA 3OUHA 4Q8KA 5BNNA 1ONAA 3MPBA 1CAXB 4JDNA 1IS3A 2OZ6A 4Q0UA 2PHLA 1VAMA 3H7JA 5K8SA 2BP6A 2Q5TA 1D4VB 1RUI3 5L9BA 3DL3A 5FZGA 1ND2B 1UWWA 3GJAA 1QXPA 1LOCA 1LU2A 1PHMA 3NAPC 1CN1A 4CP9A 2Y60A 1BJQA 1Q56A 1MR5A 5DDJ2 1VBA1 4IE4A 4RGKA 2D44A 2GC3A 3AXDA 3ZSMA 4FO9A 2X05A 3RJ2X 2P4EA 4LBOA 2WSVA 4FTBA 1EV11 4MGQA 1ACCA 4CEYA 3UGHA 2GALA 3ZX7A 3DF0A 3VUOA 1QDCA 4HN1A 2WLPA 4QQ2A 4UFMA 4ZZ5A 3TBDA 3OOXA 4CDWC 1RUF3 1UYXA 1YIPA 3VKMA 1ODNA 4QHBA 2XQRA 4A7KA 1H8TC 1F8VA 1Q8QA 2DVBA 1K5MC 3FJSA 1RUI1 1NA1B 1J1LA 1NLRA 1QJU2 3GHMA 3Q8EA 1HRV2 4LTAA 4XZPA 4OHZA 1DZQA 4Q0QA 3BU0A 2UYBA 1EYBA 1PO11 1QJX3 4XABA 1LESA 4IEXA 1PO13 4DRVA 5KR7A 1MS4A 1RUC1 3CQOA 4L2NA 3MLLA 4BISA 5IVYA 3ACHA 2AENA 1UU5A 3PU8A 3A0NA 2ZHKA 4QPIB 5C5UA 1C1LA 1R081 3M3EA 2JICA 5JAXA 2WIIB 3W21A 3O1MA 1JUIA 2KM2A 4MG2A 4CDXA 5J7MA 1RTVA 1FX5A 2VTXJ 4LA2A 4JKLA 1OA4A 1ZBA1 1OPMA 1T6BX 3ZN6B 5IK7A 1YYNA 2FDIA 5J96B 4LKSA 2ZEZA 1MPXA 4NAMA 3WW1A 1YI9A 1AYN2 4JQRA 4YGBA 3GCXA 4CA9A 3IDCB 1VLNA 3IMNA 4I0WB 2YZ4A 1DBNA 3H3ZA 4B4RA 1N1VA 4QAWA 2DUPA 4XFFA 4LEJA 1FPN3 4R9DA 4C90A 2WA4A 3DN7A 2YDEA 3UJOA 3WQ7A 4OMCA 4MHRA 1HN1A 4AEKA 4MOAA 4HKWA 2XPJA 1PO23 2GC1A 1ZRDA 3WDVA 4CPBD 1W8NA 3NV3A 2GNBA 1CESA 2HWC2 1YWKA 2Z5WA 1HX6A 4AG4A 4IEWA 5FYZA 2JWPA 5E1RA 1YRZA 2XJTA 1NY71 4E4SA 2W1UA 4WM8C 2ARBA 1A6CA 5L19A 4CU7A 1DGRA 1I1EA 1OD5A 2VZVA 2WABA 3BOPA 1D2SA 2J1VA 1TQ5A 3D0SA 4IE7A 2J1EA 4XJAA 4NHKA 5CKNA 1CGPA 3HT2A 3THCA 5I0RA 4NOTA 3MGUA 3KQRA 2AACA 4L92A 5J09A 4QHOA 5HV4A 1PMJX 1R091 3AYDA 1YQCA 2JB4A 4K21A 4Q4V3 5ERLA 3O0WA 1D7PM 2IXKA 4NRPA 1GP4A 3IN9A
chains in the Genus database with same CATH topology
4NUBA 5FWJA 5F5CA 5FYMA 3AL5A 4D6RA 5FZHA 5LY1A 2OQ6A 4QXBA 5A80A 4CCLA 5FWEA 5FYTA 3NJYA 5FZDA 5FYIA 4ASKA 5FBJA 3UYJA 5FZGA 4D6QA 5F2WA 4CCMA 5FYBA 5F2SA 4D6SA 4GAZA 5FY9A 4AAPA 5FV3A 2YU1A 4UF0A 4BXFA 2GP5A 4CCNA 5A1FA 4GD4A 5FZ4A 2Q8CA 3AVRA 5ISLA 5FYHA 3AL6A 3DXUA 2OQ7A 4IGQA 2W2IA 3N9MA 2P5BA 3LDBA 2OT7A 3KV9A 2Q8EA 5IVFA 3PUSA 3ZLIA 4LITA 5FZ0A 3ZPOA 5FP7A 5FXXA 5FPVA 5A7QA 5FZOB 5FYYA 5K4LA 3K3NA 4V2VA 5F5IA 5A7OA 4XDPA 5ANQA 3U4SA 4E4HA 5A1LA 5IWFA 4V2WA 2YBPA 4URAA 2XUEA 5A3PA 5A7WB 3K2OA 5A3WA 4QX8A 5FYVA 4CCKA 5FXZA 3KV6A 4QWNA 3KVAA 5IVCA 3N9QA 3OPWA 3N9OA 5FP4A 5KR7A 5FY7A 5FZ1A 4EZ4A 3KV5A 5IW0A 4BISA 2VD7A 5IVYA 5FZIA 5FZ3A 5F39A 4EYUA 4IGOA 2OX0A 3PU8A 5FZ6A 5FZFA 5FZAA 4BU2A 5F3IA 4LIVA 3U78A 5FPLA 5E6HA 3N9LA 5A7PA 2YU2A 4CSWA 3PTRB 5FZBA 3PUQA 4HOOA 4TN7A 3LD8A 2Q8DA 4DO0A 5FP3A 5LY2A 3DXTA 4GJZA 4AI9A 5A7SA 5FY0A 4QX7A 5FP8A 5FZ9A 2OS2A 4LIUA 5F3GA 5FZKA 4QXHA 4CCOA 5LWBA 4IGPA 5A3NA 5CEHA 2XXZA 4Y33A 5FPBA 5FP9A 5FPAA 4CCJA 3PDQA 3PURA 5FPUA 5F37A 3RVHA 5FZ8A 4UF0B 5FZ7A 5A7NA 3AVSA 5FYSA 4Y3OA 5F32A 4QU1A 5F3CA 5FUPA 2YBKA 5FZMA 5FJKA 3KVBA 5FZCA 5FXVA 3N9PA 5FY8A 5FJHA 5LW9A 5FYUA 2GP3A 2XMLA 5F3EA 5FZLA 2WWJA 2WWUA 2XDVA 4QXCA 2PXJA 5IVJA 5FYZA 2YBSA 5IVBA 5FZOA 3K3OA 5FY1A 4DIQA 3N9NA 4XDOA 5FY5A 5FXWA 4C8DA 5FZEA 3OPTA 4HONA 4EZHA 5F5AA 4CUGA 5IVEA 3PUAA 5A7WA 4GJYA 3KV4A 5FUNA 2YPDA 5A3TA 1VRBA 5IVVA 4Y4RA 3PU3A 5FYCA 4LXLA 5FY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NUB A;  5FWJ A;  5F5C A;  5FYM A;  3AL5 A;  4D6R A;  5FZH A;  5LY1 A;  2OQ6 A;  4QXB A;  5A80 A;  4CCL A;  5FWE A;  5FYT A;  3NJY A;  5FZD A;  5FYI A;  4ASK A;  5FBJ A;  3UYJ A;  5FZG A;  4D6Q A;  5F2W A;  4CCM A;  5FYB A;  5F2S A;  4D6S A;  4GAZ A;  5FY9 A;  4AAP A;  5FV3 A;  2YU1 A;  4UF0 A;  4BXF A;  2GP5 A;  4CCN A;  5A1F A;  4GD4 A;  5FZ4 A;  2Q8C A;  3AVR A;  5ISL A;  5FYH A;  3AL6 A;  3DXU A;  2OQ7 A;  4IGQ A;  2W2I A;  3N9M A;  2P5B A;  3LDB A;  2OT7 A;  3KV9 A;  2Q8E A;  5IVF A;  3PUS A;  3ZLI A;  4LIT A;  5FZ0 A;  3ZPO A;  5FP7 A;  5FXX A;  5FPV A;  5A7Q A;  5FZO B;  5FYY A;  5K4L A;  3K3N A;  4V2V A;  5F5I A;  5A7O A;  4XDP A;  5ANQ A;  3U4S A;  4E4H A;  5A1L A;  5IWF A;  4V2W A;  2YBP A;  4URA A;  2XUE A;  5A3P A;  5A7W B;  3K2O A;  5A3W A;  4QX8 A;  5FYV A;  4CCK A;  5FXZ A;  3KV6 A;  4QWN A;  3KVA A;  5IVC A;  3N9Q A;  3OPW A;  3N9O A;  5FP4 A;  5KR7 A;  5FY7 A;  5FZ1 A;  4EZ4 A;  3KV5 A;  5IW0 A;  4BIS A;  2VD7 A;  5IVY A;  5FZI A;  5FZ3 A;  5F39 A;  4EYU A;  4IGO A;  2OX0 A;  3PU8 A;  5FZ6 A;  5FZF A;  5FZA A;  4BU2 A;  5F3I A;  4LIV A;  3U78 A;  5FPL A;  5E6H A;  3N9L A;  5A7P A;  2YU2 A;  4CSW A;  3PTR B;  5FZB A;  3PUQ A;  4HOO A;  4TN7 A;  3LD8 A;  2Q8D A;  4DO0 A;  5FP3 A;  5LY2 A;  3DXT A;  4GJZ A;  4AI9 A;  5A7S A;  5FY0 A;  4QX7 A;  5FP8 A;  5FZ9 A;  2OS2 A;  4LIU A;  5F3G A;  5FZK A;  4QXH A;  4CCO A;  5LWB A;  4IGP A;  5A3N A;  5CEH A;  2XXZ A;  4Y33 A;  5FPB A;  5FP9 A;  5FPA A;  4CCJ A;  3PDQ A;  3PUR A;  5FPU A;  5F37 A;  3RVH A;  5FZ8 A;  4UF0 B;  5FZ7 A;  5A7N A;  3AVS A;  5FYS A;  4Y3O A;  5F32 A;  4QU1 A;  5F3C A;  5FUP A;  2YBK A;  5FZM A;  5FJK A;  3KVB A;  5FZC A;  5FXV A;  3N9P A;  5FY8 A;  5FJH A;  5LW9 A;  5FYU A;  2GP3 A;  2XML A;  5F3E A;  5FZL A;  2WWJ A;  2WWU A;  2XDV A;  4QXC A;  2PXJ A;  5IVJ A;  5FYZ A;  2YBS A;  5IVB A;  5FZO A;  3K3O A;  5FY1 A;  4DIQ A;  3N9N A;  4XDO A;  5FY5 A;  5FXW A;  4C8D A;  5FZE A;  3OPT A;  4HON A;  4EZH A;  5F5A A;  4CUG A;  5IVE A;  3PUA A;  5A7W A;  4GJY A;  3KV4 A;  5FUN A;  2YPD A;  5A3T A;  1VRB A;  5IVV A;  4Y4R A;  3PU3 A;  5FYC A;  4LXL A;  5FY4 A; 
#chains in the Genus database with same CATH topology
 4N8M A;  4LOR A;  3S6P A;  2KXL A;  4I0B A;  4O7X A;  5DAW A;  1MS5 A;  5LY1 A;  4CEY C;  1J84 A;  3PNA A;  4QX3 A;  3GBW A;  4XW3 A;  4B7K A;  4ARY A;  1W0N A;  2D5H A;  4LE4 A;  2HWD 3;  2HBT A;  4BLI A;  4BZ4 A;  1W6M A;  1YLL A;  4NJ4 A;  2IUW A;  1RUF 2;  2D6O X;  5KBF A;  5FK7 A;  4D6S A;  1LEM A;  2UUR A;  1A3K A;  4W6W A;  5FY9 A;  1V6L A;  4S2H A;  3ZYB A;  2DBN A;  1W6Q A;  5H9R A;  1CPM A;  2GP5 A;  2VH9 A;  4KWL A;  2RS3 3;  2HWD 1;  3AVR A;  4RFR B;  4JRL A;  2D6K A;  3HWJ A;  4DS0 A;  5FPX A;  4BQ5 A;  2GNT A;  1RIN A;  3JZV A;  4QM8 A;  1HRI 3;  3ZXG A;  3HQX A;  3N9M A;  2GAU A;  4L9B A;  2WT2 A;  1REF A;  3URF A;  5C6C A;  1NXD 1;  4LHL A;  1YFX A;  2DU1 A;  1RUE 2;  3AZX A;  3ZLI A;  4NPM A;  1OA3 A;  2JB8 A;  3F95 A;  1XJA A;  2YG0 A;  1W6O B;  5FYY A;  4XAE A;  1DZR A;  1GV9 A;  2WBK A;  3I3B A;  3K3N A;  1Y9G A;  2RDN A;  4LLF A;  2Z79 A;  2RS1 2;  1JZ2 A;  3K2O A;  1G7Y A;  1UMH A;  4GH4 C;  1KDK A;  4NHX A;  1SG3 A;  5CFC A;  2J42 A;  1OBN A;  2QQU A;  2DVA A;  2DTY A;  3PJY A;  4ES9 A;  1ULC A;  1JH5 A;  1H1I A;  2ZGN A;  1G86 A;  1VMH A;  4YVW A;  2JDK A;  1AX2 A;  2VXR A;  4B1L A;  1GWK A;  1D0G A;  1LOB A;  1UY1 A;  2ZGM A;  3KCY A;  2GDF A;  4JTN A;  5LA2 A;  3VL9 A;  1XU2 A;  3AMM A;  3LWC A;  4XF0 A;  3LSD A;  3WNP A;  1JZ3 A;  4HSJ A;  1RUG 2;  4HOO A;  2BFU S;  4P5Y A;  4P9X A;  2A3W A;  4CCC A;  2E7Q A;  4FTE A;  4ZS3 A;  1BLZ A;  4AI9 A;  4QX7 A;  2VZR A;  4QB6 A;  5GLT A;  3VB9 A;  4RQP A;  2V73 A;  2ZGL A;  4DRR A;  5L73 A;  2Y6K A;  2P3K A;  1TMF 1;  1Q43 A;  2XL9 A;  2ZAA A;  4Y5T A;  2DVF A;  3WOG A;  1N3O A;  3NJZ A;  1ZZ7 A;  4RHV 3;  4JHZ A;  4I02 A;  4ISR A;  3VDA A;  3UJQ A;  1AR7 3;  3VBR B;  5CFD A;  1PVC 3;  1V6J A;  3E5X A;  4YGD A;  1ZBE 1;  3FMG A;  4PLM A;  2WZ8 A;  4Q4V 2;  1GQG A;  4CU9 A;  5TSW A;  2Q0A A;  2HYK A;  4I09 A;  4ZXK A;  3ZR6 A;  1GLH A;  3CJI C;  4IE0 A;  4R4Z A;  1MQT B;  2W46 A;  1TVG A;  3CNA A;  2WN3 A;  4FOW A;  2XML A;  4IND A;  1QMJ A;  1JYW A;  2FDH A;  1ENR A;  2WDB A;  2Z4F A;  5DZE A;  5GZE A;  2FDF A;  2DCK A;  1W8T A;  4EQV A;  2WQ8 A;  2F4L A;  4A7Y A;  5EJ3 A;  1W2T A;  3OTF A;  5SV8 A;  2ZPX A;  2VNG A;  1Y9Q A;  3UKT A;  2XLG A;  1QJZ A;  1A8M A;  2DYC A;  2JEC A;  1ASJ 2;  3OB8 A;  4QU2 A;  4GJY A;  1ZM1 A;  1UZW A;  2DWR A;  1S2B A;  4XIK A;  4YVS B;  5A3M A;  1CAV B;  4Q4Y 2;  3LA2 A;  3MW3 A;  1T2X A;  1QF3 A;  3MIE A;  1WCD J;  1QDO A;  5K7P A;  4OYU A;  2RMU 3;  4YWA A;  3Q8C A;  5IK4 A;  2WAO A;  3FN9 A;  1ENQ A;  3C2U A;  4WM7 B;  2RMU 1;  5FZD A;  5C9A A;  3SKV A;  4AFA A;  4EN7 B;  5CZK A;  2GC0 A;  1RXG A;  2WNU C;  1FI2 A;  4RQP C;  5IAV A;  1LGC A;  2JE7 A;  3SLI A;  4Y1U A;  1W2N A;  4BIO A;  3TEY A;  1BZW A;  3CJX A;  1AL2 2;  3QH6 A;  2D98 A;  2YU1 A;  3T2Q A;  4XCB A;  2XBO 1;  4HK8 A;  1O3S A;  1N3Q A;  4XFB A;  1VBD 2;  3ZXJ A;  2UU8 A;  1PM4 A;  1AR8 2;  5LBC A;  4GB3 2;  4FAG A;  1RUO A;  1VB2 A;  1OMI A;  2DF7 A;  2SLI A;  5FZ0 A;  1WCU A;  1UKR A;  2HWE 3;  4BQX A;  3ME2 A;  1F2N A;  3EJK A;  5EQU A;  4YW2 A;  4QPG B;  4AVA A;  1Y7B A;  5AC9 1;  2R04 2;  1PMI A;  2JIJ A;  4XUT A;  2XJQ A;  1ENS A;  4DXT A;  1UY0 A;  1AYN 3;  3RI8 A;  2YBP A;  4J1W A;  1POV 1;  4YW6 A;  2EIC A;  4NHL A;  1W3V A;  4AGR A;  1MS8 A;  1TMF 2;  3AZW A;  3III A;  1RUH 3;  4EV0 A;  3M8L A;  1W2O A;  5AFB A;  4BWO A;  4AQ2 A;  5C4W C;  3KGL A;  4DQA A;  2P17 A;  3RMY A;  1ULE A;  4BOW A;  4DFS A;  3S0M A;  1FYU A;  1WA6 X;  4JV4 A;  4E8C A;  1UD1 A;  2RJ2 A;  1L3J A;  2OX0 A;  1QJF A;  1YIF A;  3W58 A;  3VBU C;  1S0E A;  5A33 B;  4YW7 A;  2JXA A;  2JEN A;  2DUQ A;  2P2K A;  1DYP A;  2RE9 A;  2WO1 A;  2JG8 B;  3JB8 A;  1QQP 1;  4LBL A;  4PF5 A;  1UZZ A;  3ZYI B;  4MVT A;  1D4M 2;  1Z7S 3;  2BOJ A;  3MFC A;  3MV1 1;  1IGO A;  5LWB A;  5E16 A;  1G9C A;  4FQZ A;  1HXS 2;  3VD5 A;  4LK6 A;  1PO2 1;  4Q0V A;  1QOO A;  1SLI A;  5BNP A;  1PGL 2;  3ES4 A;  3RG0 A;  1XSR A;  4XQW A;  5F8P A;  1RIR A;  5FZ7 A;  2Q8O A;  3U1X A;  1S55 A;  3L2Y A;  1NLS A;  2Y6H A;  4RA0 A;  2ZGK A;  1RJ8 A;  2V5D A;  2R0H A;  4QKB A;  1I5Z A;  5I91 A;  2A75 A;  5HI0 A;  1MS3 A;  2VXJ A;  4X6Q B;  2XQX A;  5F3E A;  3JD7 2;  3QAC A;  4MH0 E;  4N90 A;  1X9P A;  3ZFE C;  1NCQ B;  2D5F A;  2JDZ A;  1CQ9 A;  1O8S A;  1VR3 A;  3S7E A;  5KHH A;  4HL0 A;  1LU1 A;  3J8F 3;  1Y43 B;  2ET1 A;  1HQN A;  4XDO A;  4UT5 A;  3K75 B;  2ZBJ A;  4CDU A;  3PUA A;  5FAX A;  2R1D A;  1EUU A;  1FNY A;  4RN5 A;  5FRA A;  3WNL A;  3APB A;  1IZ3 A;  3WDU A;  3C7E A;  1RUC 3;  3I3E A;  4QPI A;  5FLH A;  1MEC 1;  1DQ1 A;  2RS5 1;  3N4M A;  1OD3 A;  2Q4S A;  1GZW A;  4JZR A;  5FYM A;  4FXK B;  2VQ0 A;  3ACI A;  1PMH X;  3AP7 A;  5H9S A;  5FRE A;  3VKF C;  2Y6J A;  3CEW A;  2R07 3;  4OI2 A;  3HVD A;  3WXP A;  3IPV B;  2ZAH A;  1JI6 A;  5FYB A;  2W1Q A;  2VUJ A;  1UXZ A;  3D6E A;  3LF7 A;  4IL7 A;  2R06 3;  1GOG A;  1UL9 A;  5FZ4 A;  4PHZ A;  5L9V A;  3NAP B;  3RZM A;  3G7D A;  1X82 A;  2J1A A;  3DYO A;  3HJR A;  4DEQ A;  2RDS A;  1AVB A;  3BUC A;  4SBV A;  4BB3 A;  4DY5 A;  2IVI B;  3MDP A;  4B8E A;  5EXO A;  1H2K A;  3D4K A;  3LCP A;  3LKJ A;  4QQL A;  1QH6 A;  4ZY9 A;  4ZU4 A;  1H1M A;  3UNP A;  3POW A;  4LT5 A;  5L7O C;  3OEB A;  1CAW B;  1DDL A;  1REE A;  2OUH A;  2YXS A;  3I59 B;  3NKT A;  5A32 B;  5HXM A;  4PCR A;  1VRH 2;  1RIT A;  3P5B A;  4AWD A;  1X8E A;  4HT1 T;  4IXL A;  4MGS A;  5BNO B;  2Z69 A;  5JZG A;  3KVA A;  3MUY 1;  2DFC A;  5IVC A;  1Y9M A;  2YB7 A;  2FDG A;  3PVB B;  1N1Y A;  2DU0 A;  5FZ6 A;  5FZA A;  5A70 A;  1AXK A;  4TTG A;  4BU2 A;  3WP4 A;  2YC2 A;  3BIW E;  4N43 A;  1PVC 1;  2C9A A;  5FTT C;  1IQA A;  2QQJ A;  3IZO A;  4Q4W 3;  5AC9 3;  1XRU A;  5FZB A;  4G9S B;  1ZYB A;  3I2D A;  4LQR A;  2Q1M A;  5JMC A;  2PLV 1;  1YXW A;  2HYX A;  3ORJ A;  1C5H A;  3F2Z A;  4P9G A;  3OD4 A;  5FY0 A;  3ZYR A;  3VBO B;  1GR3 A;  1LGB A;  4UXA A;  3MEP A;  3ZVX A;  1AYM 3;  4PF1 A;  1C28 A;  5F9T A;  1HXS 3;  2PAE A;  3WW2 A;  1NOV A;  4IV3 B;  4QT6 A;  4E2S A;  3ZN5 A;  2VNV A;  5I0U A;  3N7L A;  1MEC 2;  1JYV A;  5BY5 A;  1J3P A;  4COV A;  5D8A A;  4PIZ A;  1RUJ 3;  4L8Q A;  2G9G A;  2JG9 B;  4IV1 B;  3L2H A;  4BXS V;  1HB4 A;  4J6G A;  4HVO A;  2IC1 A;  1QNW A;  4ARX A;  1JOD A;  3CZJ A;  1EV1 3;  5A6Q A;  2WNV A;  2XHN A;  2GH2 A;  1BEV 3;  3K3O A;  4K9S A;  4LKD A;  4AFD A;  4CPB A;  5T5O A;  3ZMN A;  1GYK A;  3BPS A;  3D82 A;  3OYW B;  4FPY A;  3BAL A;  1VE0 A;  4JX0 A;  4XJ8 A;  5FOJ B;  3MIF A;  5FZE A;  4EZH A;  5IFT A;  1IKP A;  3P3N A;  1OUR A;  1AR6 2;  5T3N A;  1M06 G;  2BNM A;  5FQ0 A;  2V5Y A;  1H4G A;  4YVW B;  5LA0 A;  3AX4 A;  3I3M A;  2LM3 A;  4ONU A;  4WVM A;  4PIY A;  1H9P A;  4QB1 A;  2DTW A;  5F6L B;  3G6J B;  5KXE A;  2VUL A;  4QX5 A;  2HWE 2;  1LTE A;  5FZH A;  5CG9 A;  5IUQ A;  1UYZ A;  5L7O A;  1DGL A;  1KS4 A;  4NII A;  4N7I A;  3VBU B;  3N7K A;  1CJP A;  1L7L A;  2JD4 A;  3FX3 A;  3JU9 A;  4RQP B;  1OT5 A;  4L0P A;  1OVP A;  3VBO C;  2AC1 A;  4NPL A;  1I6X A;  3ZFF C;  4QKD A;  4RR3 B;  1W8U A;  1CWP A;  4IEU A;  4FPE A;  2VOV A;  3CMG A;  4ZS2 A;  4HBN A;  1YFU A;  3ALQ A;  5C4W B;  2OXB A;  1W8F A;  1W6P B;  5A1F A;  1V6K A;  2PHT A;  3U75 A;  2P3J A;  2YPJ A;  4WM8 A;  4XFH A;  1I3H A;  3W59 A;  1A8D A;  4K1Z A;  3SQO A;  1WLC A;  2VUD A;  3AL6 A;  3FL7 A;  2VZU A;  1TEI A;  2XLA A;  3GXU A;  4PQ9 A;  4YRD A;  4MXV A;  3VN4 A;  4L99 A;  4LBQ D;  5C9A C;  2D7F A;  2W2I A;  5JVV A;  3OEA A;  4RSU A;  1B35 B;  3A21 A;  3WW3 A;  2DCT A;  4QMA A;  3KB5 A;  3WG4 A;  1MZ5 A;  5DPN A;  4HPK A;  5M0T A;  2A3Y A;  3FHI B;  3HAG A;  5FKB A;  3JXS A;  3ZXK A;  3ZFE B;  1BKZ A;  4K8F A;  5FDB A;  3AZZ A;  3SNM A;  2PQS A;  3NNM A;  5BYN A;  5LRS A;  2XBO 2;  3KWV A;  4ITC A;  4XJ9 A;  1VBB 2;  5T55 A;  3OGJ A;  3KF3 A;  2MPF A;  2FDJ A;  1VBD 1;  3H1M A;  3ZIW A;  2X5I B;  4W6X A;  3EQE A;  3UKN A;  3EO6 A;  4XUP A;  4IGO A;  4WM7 A;  3WNN A;  2QNK A;  1BMV 1;  1ULF A;  1W39 A;  2TUN A;  4MSV A;  3GGL A;  5D1I A;  5HXV A;  3D8C A;  4LE3 A;  3WHT A;  3TN9 3;  3GYD A;  3ACF A;  1XYN A;  3V0A A;  3DYP A;  1W06 A;  5HCH A;  5F7U A;  2CAU A;  3ZFF A;  1C8M 3;  1LHO A;  4D8M A;  3LZZ A;  5A7S A;  1LHV A;  1Q8S A;  1W9F A;  2D6L X;  3B5L B;  4Q4Y 1;  1HRI 1;  4CCO A;  5IAX A;  1F9K A;  4RHV 2;  5A3O A;  3GJB A;  1UOJ A;  3T4H B;  2RDQ A;  2RS3 1;  5CVR A;  1GUI A;  2HEW F;  4GAL A;  1JYT A;  2DVD A;  3AVS A;  5AVP A;  5EFU A;  1L7Q A;  1MQT C;  5KWR A;  1QH7 A;  4CUC A;  4IW3 A;  1Y3T A;  3FLP A;  3HT1 A;  3KVB A;  2OPW A;  5CG8 A;  2PAK A;  2G4I A;  1QXJ A;  2X53 S;  4XUN A;  4RS5 A;  4BPZ A;  3N7M A;  1GP6 A;  4YW3 A;  1O5L A;  3SXW A;  4I30 A;  2R07 2;  1NA1 C;  1OUX A;  5JR2 A;  1OA2 A;  2O8O A;  1Y4W A;  4XF4 A;  5FZO A;  1D2Q A;  3O1V A;  4L11 A;  2XKO A;  3AP4 A;  1BBT 2;  1BXH A;  2WRA A;  3OPT A;  4XHX A;  5KHK A;  1I5P A;  3O1U A;  1WZX A;  1XOY A;  4LBN A;  5F1R A;  2WN2 A;  3KHB A;  1US2 A;  2P6H A;  1LEN A;  2ZTN A;  1KFX L;  4K1Y A;  5ABJ A;  5C3P A;  4LPL A;  4UAP A;  2K0G A;  1C57 A;  5K0U B;  3HQU A;  1ZA4 A;  4KI5 M;  4XVH A;  1OHF A;  4YM1 A;  5D2A A;  5C5T A;  1TZO A;  2XJS A;  4FOY A;  2VUC A;  4ISQ A;  1MVE A;  5DG1 A;  4NUB A;  4LBQ B;  5FFO C;  5FWJ A;  2VZP A;  4AK3 A;  1I9R A;  2VNO A;  1TNR A;  1XC6 A;  4WZC A;  3K46 A;  3PUI A;  1JU3 A;  4JGZ C;  2WNU B;  4DB5 A;  3ZMO A;  4XMI A;  1NKG A;  2VR4 A;  1COV 1;  1NQD A;  3IIA A;  4Y20 B;  4IEY A;  4AZZ A;  4B7E A;  4CCM A;  3AYA A;  1WW5 A;  3H7Y A;  1ENX A;  2QDN A;  4E4D X;  3K4A A;  3PVO A;  2VAU A;  1JW6 A;  4LO7 A;  4LO8 A;  4D7Y A;  3JD7 1;  3GF6 A;  4D94 A;  4W4Z A;  3ZXL A;  1WUV A;  3RZK A;  3WDT A;  1ND3 A;  4YGE A;  2MEV 2;  2FQP A;  3WP6 A;  4BK5 A;  2HEV F;  1DGW A;  4Q4X 1;  1HIX A;  1UN1 A;  1W2A X;  1CVN A;  1W8Z A;  2B9V A;  1IS6 A;  2ILM A;  4FOV A;  2NZ9 A;  3WG3 A;  4N9I A;  1UF2 C;  5KXB A;  1AX1 A;  3BTX A;  5APA A;  2F6B A;  3EHK A;  1VBC 1;  5FPV A;  5A7Q A;  2PHW A;  5K4L A;  3O1O A;  3Q8F A;  3HOB A;  2IWG B;  4KWU A;  4XBQ A;  2PHX A;  3CF6 E;  2WC2 A;  2BU9 A;  2HWB 2;  3ZFG A;  2BTV C;  3TB0 A;  1R1Z A;  1S0I A;  3ZXA C;  4WV8 A;  5JWP A;  1LOA A;  1W6N B;  1JMU B;  4P02 B;  3D0J A;  4XET A;  2RS3 2;  1FOD 2;  1GSL A;  3WNM A;  4QM9 A;  2XVK A;  5FP4 A;  4DY3 A;  4HET A;  1MEC 3;  3NVC A;  5IW0 A;  5FZ3 A;  4M01 A;  3KT1 A;  5FK8 A;  1WMD A;  2IFW A;  3CU7 A;  3GZA A;  3AP6 A;  5DDJ 1;  4GIQ A;  4XCA A;  3VHO A;  3O1S A;  2YU2 A;  2XLF A;  3VDD A;  3IPV A;  2R04 3;  4MO3 M;  5DUX A;  3AKS A;  3ZYG A;  5LY2 A;  4WZF A;  1CZT A;  3ATG A;  3OBR A;  2FD8 A;  4MET A;  2OW4 A;  2RR1 2;  2NM1 A;  3VHP A;  1AF9 A;  1K12 A;  1E5I A;  2ERF A;  3WD5 A;  4FFF A;  4Y33 A;  5CEH A;  4IEP A;  4YG0 A;  4NHY A;  5J36 A;  4FPO B;  5JSO A;  1W8W A;  2DV9 A;  2ID4 A;  4CDU C;  4RR3 C;  4UF0 B;  1OOP A;  1Q8O A;  2ENR A;  1H9W A;  4UI9 L;  3GAL A;  4UW6 A;  2FMY A;  3NJV A;  1LRH A;  1SCR A;  5C3O A;  3DKW A;  1VRH 1;  5I93 A;  5BV6 A;  3FFQ A;  4XQ4 A;  1MS1 A;  2WO3 A;  3THP A;  4R9B A;  2J1U A;  4GMP 3;  1HKD A;  3AMQ A;  2GP3 A;  2OUJ A;  3CDZ B;  4GWN A;  4D0Q A;  1NQJ A;  3AM2 A;  1DLC A;  4ZU7 A;  2R1B A;  4QB2 A;  3R4D B;  2BOI A;  4U36 A;  3BPZ A;  3PLQ A;  1LB2 A;  2BWA A;  1Q8P A;  3VBS C;  2A6Z A;  3LDK A;  4M4P A;  4I3G A;  2ADE A;  4YZ1 A;  5BNP C;  3LEG A;  3VD7 A;  5KC5 A;  4HKO A;  4B4P A;  1EAH 3;  2VPV A;  5LK7 B;  1HRV 3;  1OH4 A;  3T2T A;  3FC0 A;  1K5J A;  1GU3 A;  2B45 X;  3ENR A;  2XHK A;  3GM8 A;  4CCE A;  1RXF A;  5CIR A;  4FSJ A;  4JHT A;  1VRB A;  2ZX1 A;  1WW6 A;  1W3X A;  4PLO A;  5J1X A;  1PM7 A;  3U37 A;  4XBL A;  4TLF A;  1G6N A;  2X5I C;  1GKB A;  4KGG A;  5LBE A;  3KT7 A;  2R30 A;  2W1S A;  4OHX A;  1ZVF A;  1QXR A;  2E7A A;  3ZSK A;  4COZ A;  4EN0 A;  4Z1V A;  4P9W A;  4CP0 A;  1UO9 A;  1XYP A;  1UQX A;  1H0B A;  5GAL A;  3WP3 A;  1NCR C;  3HEI A;  3AXE A;  3TEX A;  3RI9 A;  4R8H A;  2VVF A;  1PO1 2;  1WD3 A;  1JYN A;  1PVC 2;  5T5J A;  3ETP A;  1WLW A;  3AFG A;  5D8A B;  5BXX A;  3NWK A;  1RUC 2;  5LB6 A;  1OQ1 A;  3I2K A;  3MHZ A;  4OI4 A;  3UT0 A;  5LZ6 A;  4A3X A;  4QGN A;  2J22 A;  4M3C E;  1QJY 2;  2ZEW A;  1CAU B;  1CZS A;  1QJY 3;  1V6I A;  4Q2F A;  1O3Q A;  1WBL A;  4GMP 1;  5DXD A;  1OLQ A;  4QPI C;  1IOA A;  1RUE 3;  1UU6 A;  4UFI A;  2OYZ A;  4M3C B;  3MBW A;  3TEW A;  4XDP A;  5A1L A;  5GZF A;  5E88 A;  4AFB A;  1BBT 3;  1E5R A;  2PHR A;  3FE5 A;  2O1Q A;  4V2W A;  4WVV A;  4CU8 A;  3KF5 A;  1WBF A;  2W5F A;  1US3 A;  1X50 A;  3AB0 A;  1Z78 A;  2XJR A;  3MFA A;  1ZZ6 A;  3C7O A;  1F5J A;  4AVB A;  4BYY A;  1MAC A;  2BVB A;  1JYX A;  3N9Q A;  1DGW X;  2WT1 A;  4EZ4 A;  3WG2 A;  4AHZ A;  4AVS A;  1UZ0 A;  3SIS A;  1RUJ 1;  2B9U A;  4NAO A;  1R08 3;  2HWD 2;  1OQD A;  1NY7 2;  1TME 3;  3DEM A;  1G9F A;  3T0A A;  3S57 A;  1DGR N;  1R09 2;  1AYM 1;  3CZU A;  4KL1 A;  2JG8 C;  4W6Y A;  3MW2 A;  3ZN4 A;  4CXW A;  1RMU 3;  1ZA7 A;  2DDU A;  3CLP A;  5CFD B;  4OHW A;  3OF1 A;  4H2A A;  2P37 A;  3S5Q A;  3T09 A;  1Z0H A;  2VW2 A;  2J7M A;  1KIT A;  2EAA A;  4N7U A;  4DXR A;  1VAK A;  2H0B A;  2JG9 C;  2GND A;  5IJR A;  4CDQ B;  2IVJ A;  5AFE A;  2D93 A;  5FUP A;  2CL2 A;  1DCS A;  2B5H A;  5FZM A;  3A7Q A;  5HCA A;  1RUF 1;  1MZF A;  3JQW A;  1H2N A;  4HMZ A;  2WO7 A;  4PDW B;  1BMV 2;  2E63 A;  4QPY A;  5LRR A;  5CBL A;  4URT A;  4CTE A;  4H7M A;  2XG3 A;  4KNC A;  1WW4 A;  2WWU A;  4EN8 B;  1IQD C;  4HVQ A;  4Z8B A;  2VME A;  3ZYF A;  3OBA A;  2AEY A;  3WSO A;  1J3Q A;  2XL7 A;  1FMD 3;  1GMM A;  1NUK A;  4OZX A;  4C1W A;  1CR7 A;  3NST A;  1C5I A;  4YVS A;  3VZN A;  3H8X A;  4HON A;  2Q30 A;  4AQ6 A;  4CUG A;  2VCA A;  3ZSL A;  1X36 A;  1JYI A;  5A7W A;  4MYE A;  1GZT A;  1RUE 1;  1UOF A;  4Q1R A;  1C8N A;  1JTZ X;  3VKN A;  1PGW 1;  3KV4 A;  3B3Q E;  1FT9 A;  1VBD 3;  2VNR A;  1PIV 2;  4ATF A;  4XJZ A;  1RYY A;  4IV1 C;  5KC6 A;  4CEW B;  2WYS A;  5FUI A;  3AL5 A;  5G05 L;  4BLJ A;  3INA A;  4TLG A;  4NPR A;  4LNV A;  4YPJ A;  4N53 A;  4YW5 A;  2EF6 A;  1ZBE 2;  4IE6 A;  4AR2 A;  3MLK A;  5BNN B;  1ALY A;  1H8T B;  3PVE A;  1CAX A;  5A3L A;  2ZMK A;  1BK0 A;  3X29 B;  4F8A A;  1YI7 A;  1HB1 A;  3W5N A;  2VUA A;  1FV3 A;  2VU9 A;  4WBB A;  3O0X A;  2RR1 3;  1DLL A;  1W05 A;  1HQW A;  4XHB A;  4JC1 A;  3R0R A;  2VQA A;  3M70 A;  3E6B A;  5CAD A;  2Y33 A;  1GNZ A;  4KU7 A;  3VZL A;  4PI2 A;  5KHG A;  4XAA A;  3BVC A;  4S2D A;  4AVC A;  3MIC A;  4NWW A;  1N1T A;  2W3J A;  4BQ2 A;  4XE9 A;  2HKX A;  3R6S A;  4AE2 A;  5I0S A;  4CP1 A;  4LA3 A;  4AGV A;  3ZPO A;  4LO5 B;  3RZL A;  1VMJ A;  2D3R A;  4FAH A;  1EP0 A;  1GP5 A;  1GQP A;  2A6V A;  5FZO B;  3CL1 A;  4XJU A;  4GWI A;  3NNL A;  2RV9 A;  1ZRR A;  2KD7 A;  2RG4 A;  2VO5 A;  4RGG A;  4V2V A;  3HPN A;  1WCK A;  4LHN A;  2Z42 A;  3AKR A;  4XFI A;  1QOS A;  3U07 A;  2XUE A;  2BBV A;  4YW4 A;  5FOB B;  2DCJ A;  4CU6 A;  3VD4 A;  4CCK A;  4IEO A;  1SCS A;  3S7I A;  2NMN A;  3BOW A;  5I8Y A;  3RRD A;  2C4X A;  2JE9 A;  1WME A;  2I07 B;  3LB9 A;  4RGA A;  2VTX A;  5C7G A;  5KXC A;  4XPV A;  2QQL A;  5A33 A;  3RWK X;  1GAN A;  2QBX A;  3KV5 A;  3AK0 A;  1DP0 A;  3Q9O A;  3PIJ A;  4M0N A;  4NMI A;  4Q4X 2;  3DPR B;  4YZ4 A;  2CGN A;  5F39 A;  4CEW C;  5GZG A;  1U5Y A;  3K4D A;  2JG8 A;  5FPL A;  1YQ5 A;  1ODM A;  3LOI A;  1GOH A;  3I2G A;  4Y26 A;  4Q5O A;  5KHJ A;  4M4R A;  3ST7 A;  1GNH A;  3N35 A;  2X29 A;  3PUQ A;  4UBH A;  1UX6 A;  4BQY A;  1NX9 A;  3B9C A;  2F17 A;  4IEZ A;  1PNG A;  2BVV A;  4GJZ A;  3J7H A;  1XB9 A;  2OS2 A;  1W8H A;  4QQO A;  2L9L A;  4AI0 A;  4BK4 A;  2QQW A;  3U0Z A;  2CHH A;  1BHG A;  3GZU C;  5FPB A;  2BER A;  1LOE A;  3AP5 A;  3KMH A;  3V65 A;  1YJK A;  2DCY A;  3WQ1 A;  2E6V A;  3RNS A;  1QU0 A;  2CYF A;  2VMF A;  2HWB 1;  5DDJ 3;  1IHM A;  3O12 A;  2WWS A;  2BRT A;  5D21 A;  5FZC A;  2EID A;  1V9U 3;  4Y1Y A;  1A34 A;  2VCM A;  1AL2 1;  5FYU A;  2W47 A;  2ZHM A;  1XYO A;  2ZCW A;  2PXJ A;  3H9A A;  3MID A;  3MZH A;  4KH9 A;  4ATE A;  5FY1 A;  4ES8 A;  3ZSJ A;  4SLI A;  4R9C A;  5CIS A;  3S30 A;  3OY8 B;  4Q4W 1;  2JEM A;  1AYN 1;  1DQ0 A;  2G9Z A;  4FFH A;  4QX0 A;  3PL0 A;  1A78 A;  2NP0 A;  3KCC A;  1YC6 1;  3OGG A;  2I2S A;  4AXO A;  1BYH A;  2LUW A;  3JBG 2;  5C8C A;  2YYO A;  1YO8 A;  4XMA A;  2E53 A;  1AR8 1;  5JXJ A;  1ZX5 A;  1U5I A;  2D6N A;  4ZHN A;  3E97 A;  1QJX 1;  3NV4 A;  4H14 A;  4JCK A;  1O3T A;  2PMW B;  3LPF A;  3NNG A;  4ERO A;  1EUT A;  3GZE A;  5FYT A;  1Q5O A;  3RDI A;  1W8O A;  5JXH A;  2ZS6 B;  2LS6 A;  1NCR B;  1SPP A;  3WT3 A;  2CDP A;  5JMO A;  2C9K A;  2P34 A;  4QHZ A;  3ZSE A;  4BIF A;  3OBZ A;  4AAP A;  3U11 A;  4E4Z A;  4CVU A;  1W6M B;  4BXF A;  1EAH 2;  4OUM A;  5IT6 A;  1V00 A;  1W9W A;  1X33 A;  2GN7 A;  1SLB A;  5CFD C;  4LUK A;  2X8K A;  3KQ4 B;  1LR5 A;  3KM5 A;  4Y5Z 0;  1FMD 1;  3K51 A;  3PVN A;  3D3A A;  3U14 A;  4YZ2 A;  4NR1 A;  4P08 A;  4FTS A;  4COW A;  3WEZ A;  4HVR A;  4AVV A;  3A23 A;  2UYA A;  3LDB A;  1D4M 1;  4XFC A;  5IVF A;  3IM0 A;  2R06 1;  1J59 A;  2DUR A;  3GCW A;  4GWM A;  5ACA 1;  3SC7 X;  3NV1 A;  3WNX A;  3OBT A;  3BTA A;  2BGC A;  4Y5S A;  4PDW C;  5FBZ A;  4FI9 A;  5GLW A;  4ASM B;  4CDW A;  5BNO A;  5ANQ A;  2HLE A;  4PBP A;  5FO9 B;  5IWF A;  4URA A;  1KJR A;  1UKG A;  2Y6G A;  1ZZ8 A;  3POJ A;  4O61 A;  4I0A A;  5GLU A;  4A45 A;  1WWY A;  1ND3 C;  3AJZ A;  4Z07 A;  2E9Q A;  2VM9 A;  2NYY A;  2XR4 A;  1ULD A;  4AF9 A;  1HN0 A;  1CAV A;  1RMU 1;  3SCG A;  1FAY A;  1UY4 A;  3VBR C;  5LAS A;  5IHR A;  5FY7 A;  3I54 A;  1FPN 2;  3ITQ A;  3LSE A;  2VJX A;  3FBY A;  4MGZ E;  5CAZ A;  5FR3 A;  5EZW A;  5LA1 A;  3WIN E;  2XON A;  1OFN A;  2RM2 1;  1GWL A;  1NCQ C;  3I2I A;  4HXC A;  3B93 A;  1WCS A;  4XXP A;  5GLV A;  2R32 A;  2VL4 A;  4RD7 A;  3CKH A;  1ZRF A;  1TNF A;  2D3P A;  2WZR 2;  2ZML A;  3ILR A;  1VBC 3;  3POF A;  2Q8D A;  1UIJ A;  3POE A;  3DXT A;  4P9L A;  1M4W A;  1Q3E A;  1D4M 3;  1K5M B;  2E51 A;  1CJD A;  3J9S A;  5JSP A;  3LFM A;  5EV7 A;  1SFY A;  1QWR A;  5A3N A;  1FOD 3;  2TBV A;  3MUZ 1;  5FPA A;  2JG9 A;  3MI8 A;  4RYD A;  2G1M A;  2H6C A;  4AHW A;  3RVH A;  3PUH A;  2K9Z A;  5EWS A;  4QDR A;  4C1X A;  1DF0 A;  3LEI A;  2ORX A;  4Y3O A;  3VDC A;  1F31 A;  2PTM A;  5FXV A;  5BPX A;  1J1T A;  3KHC A;  4D7T A;  1UOB A;  2Y34 A;  3RGB A;  1JHJ A;  4GZ9 A;  3ZFG C;  1JUH A;  1SBF A;  5EHD A;  4K8R B;  4AGG A;  1F15 A;  4LMF A;  1LHW A;  2QUO A;  5JOX A;  2XDV A;  3VBF B;  3QH7 A;  4NHM A;  4YLZ A;  5H9P A;  3T1M A;  1XU1 A;  4HG6 B;  4K20 A;  2BDR A;  4S2F A;  3Q8B A;  2RJL A;  1QKQ A;  4FPG A;  1AYM 2;  3PMS A;  4DUX A;  1D0H A;  2WT0 A;  2RVA A;  3U4X A;  2WS9 1;  1UCX A;  4P9J A;  4CP2 A;  3HNB M;  3R4U A;  2K46 A;  3J4U H;  5BNO C;  3TRS B;  3ASI A;  3VBS B;  2BPA 2;  1NAE A;  2GN3 A;  1APN A;  2CAV A;  4OUS A;  1H4H A;  4QGM A;  2GU9 A;  1R1A 2;  3O14 A;  4EN6 B;  3ZIX A;  1CPN A;  1RHI 1;  4QX1 A;  5A7N A;  1ND2 A;  4XIO A;  5CB7 A;  3RJR A;  3VKL A;  4DUW A;  1UW8 A;  2VZ1 A;  3QLQ A;  1YUD A;  4FFG A;  2ZZQ A;  3ZO0 B;  3ZR5 A;  3VGI A;  1AZD A;  2A1X A;  2DUO A;  3MV0 1;  1YQ8 A;  4Y1Z A;  4MGK E;  3UYJ A;  3WF0 A;  3J7L A;  2E32 A;  5I0D A;  5DQ0 A;  1OUS A;  3FFZ A;  4Q4V 1;  4IUG A;  1H30 A;  5F5Q A;  4WM8 B;  1OXC A;  5F2S A;  3V56 A;  2ADD A;  1DHK B;  1S4C A;  1RUH 2;  4KMQ A;  1HRV 1;  5JI9 A;  3SKJ E;  1S0D A;  3SEP A;  1C3H A;  4MXW B;  4C0H A;  5K0U C;  4BHP A;  4D7S A;  4GKY A;  3CIH A;  4IER A;  1LEC A;  4YG6 A;  4B4Q A;  3VDB A;  3O1P A;  2XWB B;  5ISL A;  1DQ4 A;  1HDK A;  2ZGS A;  3IT8 A;  1PGW 2;  1B35 A;  2WYF A;  3HBZ A;  4NIH A;  3DPR C;  2W94 A;  4DUV A;  3AC0 A;  1ZZC A;  4Q4Y 3;  4EWE A;  2P5B A;  4FP3 A;  4UFJ A;  2YFZ A;  2DCZ A;  1JS9 A;  2ATF A;  1NA1 A;  4IQP A;  3DKQ A;  2J1T A;  3H0O A;  3HR9 A;  1LGN A;  2B42 B;  1KXG A;  3T0D A;  1PIV 1;  4MUV A;  2QQO A;  4U2A A;  4C91 A;  1JZ4 A;  3R05 A;  5LEK A;  5DAQ A;  1W9Y A;  1ST8 A;  2EIE A;  4MLO A;  4BMB A;  2CU5 A;  3VD9 A;  4NE9 A;  3B01 A;  5DZF A;  3CO2 A;  4QKF A;  4Y22 B;  4AFC A;  5HV0 A;  1CZV A;  1BCX A;  3RYP A;  2PHU A;  3KV6 A;  3R4S A;  2PFW A;  2H6B A;  2WZE A;  4O9E A;  2XVG A;  2NQY A;  2QFE A;  1YQ6 A;  2A6X A;  2HWF 2;  2LRO A;  4JGZ B;  2VD7 A;  3TNQ A;  5FZI A;  3V0A B;  2VBB A;  2JD9 A;  1C1F A;  5JCT A;  5F3I A;  4LIV A;  2OA2 A;  3LA3 A;  4AEM A;  4DEV A;  2YMZ A;  5JPN B;  2BGP A;  3J7M A;  1PK6 A;  2FHR A;  1LJ7 A;  2CSG A;  1AR6 1;  2P3I A;  1H8T A;  1XQN A;  4OLL A;  4X6R B;  4BDV B;  1VAL A;  2HEY F;  1UMI A;  5DAX A;  2EIG A;  2B4K A;  3W5M A;  1UAI A;  5FZ9 A;  4UFK A;  2WUH A;  2WQZ C;  4EWD A;  4XOG A;  2FZ2 A;  2YHJ A;  3KCX A;  1URX A;  1W2U A;  1H6X A;  1V6N A;  4YVW C;  1AJO A;  1ZBA 3;  1SLA A;  1CIY A;  3V64 A;  1POV 0;  3LIH A;  5FPU A;  2C6S A;  1JOJ A;  1WLT A;  2ZEY A;  4LKF A;  4RS5 B;  4EE2 A;  4HAN A;  4OFG A;  3MLJ A;  3OD0 A;  2QQM A;  3JBG 3;  4AYU A;  1SBD A;  5C3S A;  1QY4 A;  5E89 A;  1S0B A;  2O8Q A;  3UKV A;  4WM7 C;  4P00 B;  2VMC A;  1WCQ A;  1FNZ A;  3ZXE A;  2WNV C;  3LDR A;  3WCS A;  2UWB A;  4W65 A;  1JOB A;  1YNA A;  1W03 A;  5ABJ B;  2ZA9 A;  3KLS A;  1CIW A;  4BCU A;  1NG0 A;  2J1R A;  3P1I A;  1AR6 3;  1Q8V A;  5K0U A;  3T3Y A;  1Z7S 2;  1HV1 A;  3VBH A;  2XJU A;  1GZC A;  4NO4 A;  4IES A;  5JUV A;  3ETQ A;  1KDM A;  4JGY A;  2R0F A;  3WLU A;  5C8C C;  4AI1 A;  4YM0 A;  3DPR A;  3DGT A;  4FP2 A;  4E2G A;  4YM3 A;  1GNY A;  3PU3 A;  1W04 A;  2PYT A;  4N43 B;  4IEQ A;  2B7Y A;  4ZKT B;  2ZHL A;  2BJS A;  1JBC A;  2QQV A;  4AI3 A;  3NJY A;  3RSJ A;  4OQ9 A;  4ASK A;  3I2O A;  1VBA 3;  1O91 A;  2ETE A;  2XJP A;  4A41 A;  1NE4 A;  2EXI A;  4LUL A;  3V0B A;  3SH3 A;  2KA3 A;  4XJW A;  4DZG A;  4I2O A;  2EVX A;  1XE7 A;  2ZGQ A;  1UY3 A;  3GNE A;  3POS A;  4M00 A;  1V6O A;  3NQH A;  4TWT A;  5T54 A;  3RFR A;  1H8V A;  3BKZ A;  3WUD A;  3H8U A;  4A6S A;  3WCR A;  2RS1 3;  3ZKU A;  2AUY A;  5BNQ A;  3WF2 A;  1LHN A;  2QQP A;  4W8J A;  2R07 1;  4CCN A;  4UWD A;  1VBB 1;  2JE8 A;  2QKD A;  4GD4 A;  5DUW A;  2Q8C A;  2VEC A;  3WHU A;  2WQ4 A;  4BH9 A;  2WO2 A;  1UIK A;  1XE8 A;  1E57 A;  2ZGP A;  3NW4 A;  2I45 A;  1O7F A;  1KS5 A;  4GB3 3;  1SLC A;  1AL0 G;  1AR8 3;  1HRI 2;  5FMD A;  2VTF A;  3EBR A;  2WNV B;  1NZI A;  2DBI A;  5GKA C;  3AFK A;  1VB4 A;  1W6N A;  2A7A A;  3ON7 A;  4LO6 B;  1ZBE 3;  4LR4 A;  3SIT A;  4I01 A;  2Y6F A;  1SQ4 A;  2VY0 A;  4RFT 0;  5DMY A;  2HH9 A;  3VBH C;  2DFB A;  1IPJ A;  2F4P A;  4LBK A;  4FBF A;  3TEZ A;  5D8A C;  4Q29 A;  5A3W A;  1IG0 A;  4KGQ A;  1TMF 3;  3IDE A;  5T50 A;  1OLM A;  3FLR A;  3E5U A;  2LAL A;  3WVJ A;  1AUY A;  2K2S A;  2FCT A;  4KWJ A;  2N7G A;  1V9U 1;  4PI0 A;  2ZGT A;  3M3I A;  1OKO A;  5IYY A;  2OKX A;  3VV1 A;  3DV8 A;  3B7M A;  1EAH 1;  1BBT 1;  1SLT A;  1XNK A;  4QQP A;  5HBA A;  1GWM A;  5FMB A;  4Q4W 2;  4HZF A;  4JKM A;  5T5L A;  4OQ8 A;  3OGV A;  1F35 A;  3GBG A;  4TN7 A;  4ET7 A;  4A6O A;  2IXC A;  2WNE A;  3I2J A;  2A6W A;  1Z7S 1;  5F3G A;  3GDB A;  3ILF A;  5FZK A;  4KBB A;  1W6P A;  3RS6 A;  3VBR A;  1PGS A;  3H1Y A;  3C7H A;  2XOM A;  1CD3 G;  4NVP A;  2EXK A;  1PVX A;  3TWI A;  1VBE 3;  1UXX X;  3M1H A;  1VRH 3;  1W6Q B;  3HD8 B;  4ORF A;  3VBO A;  1LOF A;  1XNT A;  3M4F A;  4AED A;  1COV 2;  3E6D A;  3IAP A;  2ORZ A;  2VZQ A;  1FPN 1;  3BB6 A;  1NZC A;  1PIV 3;  2ZJC A;  4GQ7 A;  4WVZ A;  4AAX A;  2GSY A;  3N9P A;  1DIW A;  3ROU A;  1NLQ A;  4AQT A;  5LW9 A;  4JKK A;  2RMU 2;  5GLZ A;  1FOD 1;  2ES3 A;  5T5P A;  4BQW A;  4YW1 A;  4CDW B;  3AKP A;  1J3R A;  2W91 A;  2NPI A;  4IV1 A;  3I4I A;  4GKX A;  1KJL A;  2JDH A;  2ZKN A;  3ES1 A;  1TME 2;  2VMG A;  2JX9 A;  5FMO S;  3DEC A;  2HJI A;  1UOG A;  1FMD 2;  1XSQ A;  4ZPI A;  1IS5 A;  2QTW B;  1KEX A;  2C5D A;  1YFW A;  3LQC A;  5DN2 A;  2HBU A;  4AW7 A;  2VGD A;  2ZGR A;  4P9Y A;  2ZGU A;  2R06 2;  2MEV 1;  2CTV A;  2UY9 A;  4N9H A;  3WQB A;  1S2K A;  4GH4 A;  5CFC C;  2MEV 3;  1G9D A;  3T4V A;  2WA3 A;  5L36 A;  5FKC A;  5C9A B;  1P8J A;  4YFW A;  5FMC A;  4C0B A;  5C8W A;  3HIF A;  2PN5 A;  3AMP A;  4PT6 A;  4QXB A;  1OFS A;  1ZZ9 A;  2W52 A;  1OOP C;  2QQK A;  2VVD A;  5A80 A;  3WDY A;  1JZ7 A;  1B35 C;  2VMH A;  3MIG A;  3M3Q A;  3VDD C;  3BTZ A;  1OH3 A;  1F4A A;  1RMU 2;  2D43 A;  2MHF A;  4HLT A;  1R09 3;  4OZO A;  1GOF A;  4FPF A;  4FVV A;  5H9Q A;  1DYK A;  4DPN A;  1W28 A;  5CYY A;  1POQ A;  4MZU A;  4NRQ A;  3I97 A;  4AHY A;  4CDX C;  5A3U A;  1UPI A;  5C71 A;  3AMH A;  2CGO A;  3EYP A;  4LJH A;  1BEV 1;  1V9U 2;  1PZ9 A;  3DXU A;  4FCA A;  1IS4 A;  4Q4X 3;  2OQ7 A;  4QPG A;  3WF1 A;  3B02 A;  1S0C A;  4RS5 C;  1N1S A;  1ZRE A;  3I2F A;  4Y1V A;  4B29 A;  4BQ1 A;  3SEE A;  3VBF A;  3JD7 3;  2ZXQ A;  4QX2 A;  2BZD A;  3SHR A;  1MQT A;  1SAC A;  3D5O A;  2WAA A;  4JVA A;  4JTO A;  2VW0 A;  5F5I A;  1QQP 2;  2E26 A;  2NLR A;  1F5F A;  4EWA A;  5F6K A;  1UYP A;  4NIG A;  3N36 A;  4XUO A;  1HXS 1;  1O4Y A;  3LGR A;  3WW4 A;  2LRP A;  4XFA A;  5HCB A;  2WSU A;  1LOF C;  1RL3 A;  2OVU A;  1IPK A;  1UX7 A;  3KGZ A;  1GBG A;  3PTY A;  4IEV A;  2D3S A;  1DG6 A;  5EP9 A;  1G8W A;  3EXU A;  2BFU L;  3FHQ A;  3OSD A;  2O14 A;  4IE5 A;  1RUH 1;  4QPW A;  3B94 A;  2WNU A;  4CYD A;  1KD7 A;  2JDA A;  1PK6 C;  2YV8 A;  2H0V A;  2EIB A;  4UOJ A;  1JHN A;  4BQ4 A;  3AZY A;  4Q0P A;  2FMD A;  1RJ7 A;  2D40 A;  4FQ4 A;  5A7P A;  3RZJ A;  3PTR B;  3P6B A;  4DMI A;  3HN3 A;  4XAC A;  4XFG A;  5T52 A;  4D69 A;  1V70 A;  2XH6 A;  2D6P A;  1OI6 A;  1FXZ A;  4KQ7 A;  5GM0 A;  4NID A;  5BNP B;  2CWS A;  1ZNP A;  5DZG A;  5GZD A;  1H1A A;  1XND A;  5JIA A;  4MXW A;  1RHI 2;  4CDQ A;  1VBE 2;  3RQ0 A;  1AL2 3;  4CDX B;  3E6C C;  2W0X A;  3PUR A;  3RZH A;  3OUJ A;  3ZN6 A;  3MF6 A;  4UW4 A;  5JXI A;  2G19 A;  1EY2 A;  2VMI A;  2XGX A;  1VBB 3;  1W9S A;  5E8A A;  2XBO 3;  2X10 A;  2XWJ B;  4QU1 A;  2B46 X;  4LO4 B;  4BE3 A;  2RS5 2;  3BOD A;  2Q1Z B;  3K77 A;  1NCQ A;  4XZU G;  5A6Z A;  1XNB A;  2J1S A;  4NRM A;  2Y8K A;  1PNF A;  2I74 A;  4FPK A;  3E5Q A;  3HNY M;  2RDR A;  4FOQ A;  5LK5 A;  4RL7 A;  2HWF 1;  3ZFG B;  3O7O A;  1C8M 1;  4R52 A;  3VL8 A;  4YZ5 A;  1CX1 A;  4Y22 A;  3KSC A;  3O5S A;  5FY5 A;  3T2P A;  1ASJ 3;  4C8D A;  1OLR A;  1LOD A;  1BVV A;  5BUV A;  2XUM A;  4AHX A;  3E1F 1;  1GZW B;  1SFN A;  3WNO A;  2X09 A;  1GFF 2;  5FUN A;  3POY A;  2OPK A;  4OUL A;  3NMB A;  1AR9 1;  4N53 C;  4NRO A;  2ARX A;  2D97 A;  3PJQ A;  1QJY 1;  2C24 A;  4GWJ A;  4LK7 A;  2GC2 A;  5J48 A;  4FPC A;  4HN0 A;  3FHA A;  1DQ2 A;  2OQ6 A;  3EB7 A;  3OGR A;  4AEJ A;  4X8N A;  2VOW A;  2NN8 A;  5FWE A;  5B2G B;  4AL9 A;  1GQH A;  4CE8 A;  1R64 A;  2PQQ A;  1S0J A;  2AR6 A;  2YY1 A;  2WIN B;  1YFY A;  3AMN A;  3BU7 A;  3IWZ A;  4YAR A;  5FLJ A;  2YUE A;  5KXD A;  1YCI A;  2VMD A;  3NAP A;  1QJU 3;  1V0A A;  4OHY A;  4GAZ A;  3LAG A;  4YVS C;  1DFQ A;  4UF0 A;  3Q8A A;  2UY8 A;  1AR7 1;  4P9I A;  1MZE A;  3HNM A;  2ZAB A;  4K6B A;  4CXY A;  1CON A;  2BNO A;  2IZW A;  4OVE A;  4COY A;  1DQ5 A;  3J8F 1;  3FUQ A;  4PIX A;  2GNM A;  1SZB A;  4YG3 A;  3M7A A;  1CAW A;  1PZ7 A;  1XBF A;  1S0F A;  2CNA A;  1VPH A;  5LBB A;  2ZGO A;  3PUS A;  1DU3 D;  2YFU A;  5A32 A;  3RZZ A;  3ZYJ B;  4F7Z A;  2WL1 A;  4S2G A;  3RMX A;  4XIL A;  2IFR A;  5EJ1 B;  2PLV 2;  1NE6 A;  2WR9 A;  4CUA A;  2CY6 A;  1H2L A;  2ARE A;  2HWB 3;  2Y0I A;  3U4S A;  3CJI A;  3DYM A;  3SH5 A;  5GJ6 A;  5J98 B;  3VBH B;  1RVF 2;  1UPS A;  2WFF 2;  1U0A A;  4GXL A;  3ZYH A;  1VBE 1;  1WA4 A;  5A3P A;  3FUO A;  3JUU A;  4JGY B;  3PIG A;  1OSG A;  2BV4 A;  4QX8 A;  4CDQ C;  1YEW A;  2A3X A;  3WUC A;  4YM2 A;  2QQI A;  4QGL A;  3VZJ A;  2GMP A;  2PA7 A;  4CDU B;  4MV2 A;  4IET A;  1LCL A;  5DAB A;  3ECQ A;  2ET7 A;  4XF1 A;  4Z82 A;  3W9A A;  2YGL A;  1YQ2 A;  1O3R A;  4AOC A;  1UZY A;  1J58 A;  1QJE A;  1PX4 A;  2UWA A;  5CFC B;  1ZRC A;  3U78 A;  5FMO L;  5JDB A;  5KHI A;  5E6H A;  4L97 A;  4ZXE A;  3O0V A;  4Z2W A;  3V0B B;  3RZG A;  3N9L A;  1TE1 B;  1SLL A;  2Y6L A;  4LOS A;  3WY6 A;  4XF9 A;  5FPZ A;  4DO0 A;  3LFI A;  5AC9 2;  3WX5 A;  2JJ6 A;  2ARC A;  2BNN A;  3ELN A;  2JKB A;  2EA7 A;  3VDD B;  3ZPY A;  4XTM A;  3MW4 A;  5C33 A;  4MGI E;  4LUM A;  4MX3 A;  3USS A;  1LED A;  2WJS A;  3IDA A;  2R04 1;  4CCD A;  2Z2S B;  5C3R A;  4FPH A;  2UWC A;  5F3C A;  3RWN A;  3MIH A;  1B09 A;  1VIW B;  4AQS A;  1FAT A;  2HWE 1;  2FCU A;  2ZMN A;  4DXS A;  1OOP B;  5FCC A;  3DCQ A;  1AX0 A;  3OY8 A;  4YNI A;  2Y38 A;  4R4X A;  4JRA A;  4A3Z A;  4KWK A;  1ZZB A;  2FZ1 A;  4Z92 B;  1YHF A;  5EIY B;  3TN9 2;  2PLV 3;  4AFM A;  2R49 A;  4P14 A;  1IKQ A;  5C8C B;  3LEK A;  5ABJ C;  3I59 A;  1SMV A;  1AR9 3;  1OKQ A;  4LOT A;  2QZ3 A;  4MGY E;  3QD6 A;  3TAY A;  4UFL A;  1OVS A;  5ANN A;  2VW1 A;  3PME A;  1JZ6 A;  5JZG B;  3I2H A;  5IVV A;  5CNA A;  5FYC A;  2GZW A;  5DAP A;  3VBU A;  4DIQ A;  2WS9 3;  1MVQ A;  5FIX A;  1UU4 A;  4O65 A;  4CRQ A;  5JIU A;  3GBF A;  3SH4 A;  4MGT A;  4GA9 A;  1NCR A;  1SPP B;  2Y64 A;  2ZX3 A;  3BYW A;  1PGL 1;  1SDW A;  1K3I A;  1O8P A;  1HLC A;  4J25 A;  4H7L A;  3VHN A;  3AZV A;  4D6Q A;  5F2W A;  5C4W A;  4YFZ A;  4J1X A;  3JCI A;  5SV5 A;  4XUQ A;  5DG2 A;  5JPM B;  2R7E B;  2BGO A;  2VC9 A;  4OMD A;  2BQP A;  4XBN A;  1EPZ A;  1O4T A;  2P1B A;  3LEM A;  4AED B;  1GZ9 A;  1QGL A;  1COV 3;  1S0G A;  1JU4 A;  2AZ5 A;  2W92 A;  3LA7 A;  3OJB A;  3T0B A;  1ZRI A;  5FYH A;  4ZZ8 A;  1IG3 A;  4Q27 A;  3CHX A;  4JDO A;  3ZM8 A;  4XYX A;  2ZX4 A;  2A71 A;  4JDM A;  3I7D A;  4IV3 A;  2ZHN A;  3USU A;  5DUV A;  3C7F A;  3UK9 A;  3K4Z A;  4BQ3 A;  1XNA A;  3B9I A;  3O1R A;  1JYC A;  4H3W A;  1PO2 2;  1W9T A;  3JBG 1;  4XEZ A;  2VQU A;  3HMY A;  4OUE A;  1QOT A;  4QKN A;  4G3Y C;  1MS0 A;  5A7O A;  4TYS A;  4XXA A;  1OF3 A;  4K7J A;  1O4Z A;  1GIC A;  2OII A;  1XE0 A;  3C8X A;  4RHV 1;  4Z2A A;  3K48 A;  4LBJ A;  1JOP A;  5A7W B;  3M2M A;  3EMR A;  4QDS A;  3SMH A;  3T30 A;  2JDP A;  4GH4 B;  5FYV A;  5FXZ A;  2R6Q A;  4M3C A;  5CKM A;  2RHP A;  5CU1 A;  3UV9 A;  1WMX A;  4P5H A;  4QWN A;  3ZKY A;  3BIE A;  3OPW A;  3WV6 A;  2RS5 3;  2P6C A;  1L7R A;  2B39 A;  4QQH A;  1AXY A;  4CEW A;  2FCV A;  3MO4 A;  5FQ0 B;  4LKE A;  1TME 1;  3RYR A;  5EYY A;  3KS7 A;  5IVE A;  4B3N A;  4YZ3 A;  4FFI A;  1HB2 A;  4WVM B;  2VBP A;  4XDQ A;  4N53 B;  2V09 A;  5JLV A;  2VG9 A;  4NN0 A;  2XVL A;  2XB6 C;  4FPL A;  4D3W A;  4EJR A;  2IXL A;  3NJX A;  1VP6 A;  1BEV 2;  1DQ6 A;  2MNG A;  5A6X A;  1EV1 2;  4KBZ A;  1CX4 A;  4LIU A;  4QXH A;  3OUI A;  2W39 A;  3ZOI A;  3NV2 A;  1QJX 2;  1RUD 2;  2JDY A;  2ZEX A;  3WG1 A;  4CP9 B;  5F37 A;  1AXZ A;  5EPA A;  5FZ8 A;  3WZ1 A;  1H6Y A;  5FYS A;  2W68 A;  3AP9 A;  1RED A;  4UW3 A;  1HQL A;  1OPO A;  1STM A;  2W87 A;  5IK5 A;  4NWV A;  1JZ5 A;  2PEL A;  2A6Y A;  2BWC A;  2JDU A;  1BVP 1;  2ZAC A;  3I3Q A;  3M3C A;  4PBO A;  4CEY B;  2XKP A;  2YGM A;  4Y4Y A;  4QXC A;  1UY2 A;  4MAD A;  1QQP 3;  3WP5 A;  4F3J A;  1VBA 2;  1VAV A;  3VBS A;  4PDW A;  3UGF A;  3T2O A;  4XF3 A;  1RUD 3;  3S5A A;  3ACL A;  4HPK B;  3M3O A;  5FXW A;  3I49 A;  3ACG A;  4LHK A;  2DVG A;  4IV3 C;  3IKW A;  1LNS A;  3POI A;  1EPW A;  3ZFE A;  1LUL A;  1ULG A;  3BI3 A;  3H3L A;  1ULO A;  2E7T A;  2WZR 1;  4JQT A;  4ASL A;  1RC6 A;  5JOW A;  1ZBA 2;  1QEX A;  3HN1 A;  1LAJ A;  1W90 A;  5JOY A;  4M0H A;  5A3T A;  2AH2 A;  4AED C;  4W50 A;  4Q1P A;  5FO7 B;  5F5C A;  4Y20 A;  4D6R A;  4CCJ A;  2VCC A;  3A0K A;  1K42 A;  1XNC A;  1RUI 2;  1OC1 A;  1X8M A;  5B4X A;  5C70 A;  1ULP A;  1VBC 2;  2IXH A;  4PQQ A;  1F4H A;  5ACA 2;  1RB8 G;  3C7G A;  3RPQ A;  3LOB A;  4A7Z A;  4K40 A;  3BCW A;  1POV 3;  1T6G C;  3VD3 A;  1UZV A;  1HJF A;  1C8M 2;  3ILN A;  1ND3 B;  2VCB A;  1FV2 A;  2TNF A;  1J83 A;  4A42 A;  3H3U A;  1K45 A;  1QJU 1;  3MPP G;  1NYW A;  1HB3 A;  1JXN A;  3JQX A;  5FV3 A;  1N47 A;  3B69 A;  3LPG A;  2RM2 2;  2XJV A;  4TSV A;  5IK8 A;  3AYC A;  2AYH A;  3FBM A;  3NNF A;  3ZDS A;  2ZOE B;  2EAK A;  2QZ2 A;  5HCF A;  2YC0 A;  4DIN B;  3WF4 A;  3NO8 A;  4IGQ A;  5JXG A;  1RUN A;  4A2U A;  3VZO A;  1UMZ A;  3KV9 A;  2Q8E A;  3KZ4 C;  3POB A;  3N3H A;  4KU8 A;  2D6M A;  3WDX A;  4DOU A;  2CGP A;  1R1A 1;  2WLQ A;  5J3U A;  4K3U A;  2QVS B;  1MZ6 A;  2YC4 A;  3ZDV A;  4E4H A;  3ABZ A;  3C3V A;  4R9A A;  4B1M A;  1O6U A;  1LOG A;  3IBM A;  3H1W A;  3UGG A;  2BEO A;  2VQT A;  3QCW A;  1HJG A;  3A4U A;  4TZD A;  2PHD A;  2YRO A;  2PAM A;  1AR7 2;  2HWF 3;  2FBE A;  2CDO A;  2JIG A;  2W08 A;  4CZS A;  4V1P A;  3SCH A;  4YSF A;  1PK6 B;  5C3Q A;  2VVE A;  4LLO A;  4KG0 A;  5FZ1 A;  2IXJ A;  4CUB A;  4BJ0 A;  4ZU5 A;  1DZT A;  3BN6 A;  2WZP P;  5FZF A;  2G9F A;  3GHN A;  4Y1X A;  1XXN A;  1UYY A;  1ND2 C;  2EXH A;  5L9R A;  5JZG C;  2VOT A;  2WS9 2;  4LBQ A;  1AJK A;  2W9X A;  2IXI A;  2HWC 1;  3ZYP A;  2GH8 A;  4YGC A;  1HW5 A;  1VJ2 A;  3ZXD A;  3J8F 2;  3KT4 A;  3VZM A;  3LD8 A;  1HV0 A;  2BW8 A;  5FP3 A;  4QDQ A;  1W0P A;  1JN2 P;  1AR9 2;  3VBF C;  3KD4 A;  3NRU A;  4FPJ A;  3MYX A;  4GUL A;  4AI8 A;  4A44 A;  2CV6 A;  2P3Y A;  4IGP A;  2XXZ A;  1LKN A;  1SEF A;  2B8M A;  5FP9 A;  3PDQ A;  3J26 N;  4BME A;  4H55 A;  3H50 A;  5I0T A;  4BM8 A;  4Q0S A;  4FT8 A;  5B4N A;  5CKQ A;  4O9G A;  2VZS A;  3WNK A;  4PLN A;  4UBG A;  2TEP A;  2RS1 1;  4AVT A;  4OI0 A;  3O1T A;  2WFP A;  2VZT A;  1O5U A;  1VMF A;  5ACA 3;  3U10 A;  4QD2 A;  5FY8 A;  4KG8 A;  5I8T A;  1PX3 A;  1AHS A;  2C1F A;  4DNY A;  2WWJ A;  3CJI B;  4XTP A;  2YBS A;  3CBN A;  5IVB A;  3WR0 A;  1W6O A;  2EXJ A;  5LCW L;  2JKX A;  1RVF 3;  2WFF 3;  2VZO A;  3H8O A;  1G9B A;  5CA6 A;  5F5A A;  4Q26 A;  2VZ3 A;  5EYX A;  1WD4 A;  1R1A 3;  2ZX2 A;  2VBD A;  1U5X A;  3IAQ A;  3OYW A;  1NT0 A;  5LBF A;  5LEJ A;  2VE1 A;  3FZ3 A;  2RJK A;  2C26 A;  3WDW A;  4COU A;  4GMP 0;  1LHU A;  1X9T A;  4TXW A;  1S1A A;  4WVW A;  4X8P A;  5FY4 A;  3OCP A;  3N7J A;  2FDK A;  1RVF 1;  2V72 A;  2QE3 A;  2WFF 1;  3GZT B;  3JB4 C;  5FLI A;  2AGS A;  1PZ8 A;  2V4V A;  4CCL A;  3OGS A;  3LE0 A;  5FBJ A;  5FYI A;  1C4R A;  1O59 A;  4A4A A;  1TG7 A;  2A5Z A;  1QIQ A;  1OF4 A;  2QCS B;  4I3P A;  5AVA A;  1OQE A;  1BK1 A;  5EJZ B;  4OCT A;  4HFS A;  4UYB A;  1QNY A;  4UFH A;  5L7O B;  2C0Z A;  4XUR A;  3UET A;  3NL1 A;  1X7N A;  5JI7 A;  1SDD B;  2GMM A;  3IB3 A;  3TOJ A;  3VLB B;  1U12 A;  1YJL A;  4G4F A;  5IAT A;  4OHV A;  1CAU A;  1N3P A;  3QBQ A;  3BTY A;  1RUG 1;  4RR3 A;  1BQP A;  2LTN A;  2E33 A;  2OZJ A;  1RUJ 2;  1W99 A;  4CXX A;  4QPG C;  2CWM A;  1SHW B;  2OT7 A;  5JSR A;  1WKY A;  4LIT A;  3I3D A;  4YYO A;  2W1W A;  5FP7 A;  1E5H A;  4Y24 A;  5FXX A;  5LA9 A;  4NIA A;  3W20 A;  1SFP A;  1W0O A;  2QDR A;  4OI1 A;  2WZR 3;  2HWC 3;  2JDN A;  3DUI A;  4JGY C;  5BNN C;  2PHF A;  2BYV E;  3ZXF A;  5G04 L;  3THD A;  5J37 A;  2QQN A;  2V4A A;  1WW7 A;  3VZK A;  3OPZ A;  2LW8 A;  3NNJ A;  3NKG A;  3AKT A;  3B00 A;  2W95 A;  1KGY A;  3RYK A;  4FXG B;  3T08 A;  2Y0O A;  3THT A;  3PHM A;  5A1A A;  1RGS A;  5K9Y A;  2VOX A;  3MF9 A;  1WGP A;  3N9O A;  4DXZ A;  3A22 A;  2SBA A;  3H8R A;  4EYU A;  3TN9 1;  3P3P A;  4N43 C;  1U5Z A;  5IFP A;  5JR7 B;  1QHD A;  3T1L A;  4HK9 A;  3L9J T;  2A73 B;  2KR2 A;  4XC9 A;  5FO8 B;  5DAV A;  4ZON A;  1UNB A;  4AI2 A;  4CSW A;  3UES A;  2X5I A;  1WMF A;  1KRI A;  1ASJ 1;  3AKQ A;  3HBK A;  3IDB B;  2R16 A;  2QJV A;  3OG2 A;  5JOZ A;  5A6Y A;  1DYO A;  4E2Q A;  5FP8 A;  2ARA A;  3WF3 A;  4E8D A;  3TNP B;  3SCF A;  4LHS A;  2BUK A;  4MHU A;  3HQR A;  1MS9 A;  3I8T A;  4IDZ A;  4UW5 A;  3BGA A;  3ZFF B;  1K5M A;  3QOP A;  1G9A A;  3USU B;  2BBA A;  5F32 A;  3VKO A;  2O0O A;  2Y26 A;  2YBK A;  2ZX0 A;  2A70 A;  5FJK A;  5DUU A;  1KQR A;  4E9K A;  1IPS A;  2E31 A;  1E5S A;  2JDM A;  4HKL A;  3TYJ A;  5LAT A;  4PJY A;  4LBM A;  5FJH A;  1R08 2;  4M3C F;  3AYE A;  5FZL A;  3H42 B;  1KFU L;  4XQD A;  5HPO A;  3POG A;  3UL2 A;  5IVJ A;  2VOK A;  1OLM E;  1RUG 3;  1WLD A;  2GME A;  4EN9 B;  3AJY A;  3N9N A;  1JZ8 A;  1V6M A;  2EAL A;  2Q1F A;  3MIB A;  2WNO A;  1RHI 3;  2RR1 1;  1H2M A;  4QXK A;  3WQ0 A;  1SBE A;  4F83 A;  2AEZ A;  3FWE A;  4HSL A;  2RM2 3;  3LIG A;  3J7N A;  4JGZ A;  1XPW A;  4Q8L A;  1S2E A;  3IMM A;  4JAA A;  2NMO A;  5I8S A;  2YPD A;  2WKK A;  3VHR A;  4Y4R A;  2ZZJ A;  1NXM A;  4LXL A;  4GB3 1;  4E27 A;  2ZKL A;  5GZC A;  4BA6 A;  1RUD 1;  3FLT A;  3OUH A;  4Q8K A;  5BNN A;  1ONA A;  3MPB A;  1CAX B;  4JDN A;  1IS3 A;  2OZ6 A;  4Q0U A;  2PHL A;  1VAM A;  3H7J A;  5K8S A;  2BP6 A;  2Q5T A;  1D4V B;  1RUI 3;  5L9B A;  3DL3 A;  5FZG A;  1ND2 B;  1UWW A;  3GJA A;  1QXP A;  1LOC A;  1LU2 A;  1PHM A;  3NAP C;  1CN1 A;  4CP9 A;  2Y60 A;  1BJQ A;  1Q56 A;  1MR5 A;  5DDJ 2;  1VBA 1;  4IE4 A;  4RGK A;  2D44 A;  2GC3 A;  3AXD A;  3ZSM A;  4FO9 A;  2X05 A;  3RJ2 X;  2P4E A;  4LBO A;  2WSV A;  4FTB A;  1EV1 1;  4MGQ A;  1ACC A;  4CEY A;  3UGH A;  2GAL A;  3ZX7 A;  3DF0 A;  3VUO A;  1QDC A;  4HN1 A;  2WLP A;  4QQ2 A;  4UFM A;  4ZZ5 A;  3TBD A;  3OOX A;  4CDW C;  1RUF 3;  1UYX A;  1YIP A;  3VKM A;  1ODN A;  4QHB A;  2XQR A;  4A7K A;  1H8T C;  1F8V A;  1Q8Q A;  2DVB A;  1K5M C;  3FJS A;  1RUI 1;  1NA1 B;  1J1L A;  1NLR A;  1QJU 2;  3GHM A;  3Q8E A;  1HRV 2;  4LTA A;  4XZP A;  4OHZ A;  1DZQ A;  4Q0Q A;  3BU0 A;  2UYB A;  1EYB A;  1PO1 1;  1QJX 3;  4XAB A;  1LES A;  4IEX A;  1PO1 3;  4DRV A;  5KR7 A;  1MS4 A;  1RUC 1;  3CQO A;  4L2N A;  3MLL A;  4BIS A;  5IVY A;  3ACH A;  2AEN A;  1UU5 A;  3PU8 A;  3A0N A;  2ZHK A;  4QPI B;  5C5U A;  1C1L A;  1R08 1;  3M3E A;  2JIC A;  5JAX A;  2WII B;  3W21 A;  3O1M A;  1JUI A;  2KM2 A;  4MG2 A;  4CDX A;  5J7M A;  1RTV A;  1FX5 A;  2VTX J;  4LA2 A;  4JKL A;  1OA4 A;  1ZBA 1;  1OPM A;  1T6B X;  3ZN6 B;  5IK7 A;  1YYN A;  2FDI A;  5J96 B;  4LKS A;  2ZEZ A;  1MPX A;  4NAM A;  3WW1 A;  1YI9 A;  1AYN 2;  4JQR A;  4YGB A;  3GCX A;  4CA9 A;  3IDC B;  1VLN A;  3IMN A;  4I0W B;  2YZ4 A;  1DBN A;  3H3Z A;  4B4R A;  1N1V A;  4QAW A;  2DUP A;  4XFF A;  4LEJ A;  1FPN 3;  4R9D A;  4C90 A;  2WA4 A;  3DN7 A;  2YDE A;  3UJO A;  3WQ7 A;  4OMC A;  4MHR A;  1HN1 A;  4AEK A;  4MOA A;  4HKW A;  2XPJ A;  1PO2 3;  2GC1 A;  1ZRD A;  3WDV A;  4CPB D;  1W8N A;  3NV3 A;  2GNB A;  1CES A;  2HWC 2;  1YWK A;  2Z5W A;  1HX6 A;  4AG4 A;  4IEW A;  5FYZ A;  2JWP A;  5E1R A;  1YRZ A;  2XJT A;  1NY7 1;  4E4S A;  2W1U A;  4WM8 C;  2ARB A;  1A6C A;  5L19 A;  4CU7 A;  1DGR A;  1I1E A;  1OD5 A;  2VZV A;  2WAB A;  3BOP A;  1D2S A;  2J1V A;  1TQ5 A;  3D0S A;  4IE7 A;  2J1E A;  4XJA A;  4NHK A;  5CKN A;  1CGP A;  3HT2 A;  3THC A;  5I0R A;  4NOT A;  3MGU A;  3KQR A;  2AAC A;  4L92 A;  5J09 A;  4QHO A;  5HV4 A;  1PMJ X;  1R09 1;  3AYD A;  1YQC A;  2JB4 A;  4K21 A;  4Q4V 3;  5ERL A;  3O0W A;  1D7P M;  2IXK A;  4NRP A;  1GP4 A;  3IN9 A; 
#chains in the Genus database with same CATH homology
 4NUB A;  5FWJ A;  5F5C A;  5FYM A;  3AL5 A;  4D6R A;  5FZH A;  5LY1 A;  2OQ6 A;  4QXB A;  5A80 A;  4CCL A;  5FWE A;  5FYT A;  3NJY A;  5FZD A;  5FYI A;  4ASK A;  5FBJ A;  3UYJ A;  5FZG A;  4D6Q A;  5F2W A;  4CCM A;  5FYB A;  5F2S A;  4D6S A;  4GAZ A;  5FY9 A;  4AAP A;  5FV3 A;  2YU1 A;  4UF0 A;  4BXF A;  2GP5 A;  4CCN A;  5A1F A;  4GD4 A;  5FZ4 A;  2Q8C A;  3AVR A;  5ISL A;  5FYH A;  3AL6 A;  3DXU A;  2OQ7 A;  4IGQ A;  2W2I A;  3N9M A;  2P5B A;  3LDB A;  2OT7 A;  3KV9 A;  2Q8E A;  5IVF A;  3PUS A;  3ZLI A;  4LIT A;  5FZ0 A;  3ZPO A;  5FP7 A;  5FXX A;  5FPV A;  5A7Q A;  5FZO B;  5FYY A;  5K4L A;  3K3N A;  4V2V A;  5F5I A;  5A7O A;  4XDP A;  5ANQ A;  3U4S A;  4E4H A;  5A1L A;  5IWF A;  4V2W A;  2YBP A;  4URA A;  2XUE A;  5A3P A;  5A7W B;  3K2O A;  5A3W A;  4QX8 A;  5FYV A;  4CCK A;  5FXZ A;  3KV6 A;  4QWN A;  3KVA A;  5IVC A;  3N9Q A;  3OPW A;  3N9O A;  5FP4 A;  5KR7 A;  5FY7 A;  5FZ1 A;  4EZ4 A;  3KV5 A;  5IW0 A;  4BIS A;  2VD7 A;  5IVY A;  5FZI A;  5FZ3 A;  5F39 A;  4EYU A;  4IGO A;  2OX0 A;  3PU8 A;  5FZ6 A;  5FZF A;  5FZA A;  4BU2 A;  5F3I A;  4LIV A;  3U78 A;  5FPL A;  5E6H A;  3N9L A;  5A7P A;  2YU2 A;  4CSW A;  3PTR B;  5FZB A;  3PUQ A;  4HOO A;  4TN7 A;  3LD8 A;  2Q8D A;  4DO0 A;  5FP3 A;  5LY2 A;  3DXT A;  4GJZ A;  4AI9 A;  5A7S A;  5FY0 A;  4QX7 A;  5FP8 A;  5FZ9 A;  2OS2 A;  4LIU A;  5F3G A;  5FZK A;  4QXH A;  4CCO A;  5LWB A;  4IGP A;  5A3N A;  5CEH A;  2XXZ A;  4Y33 A;  5FPB A;  5FP9 A;  5FPA A;  4CCJ A;  3PDQ A;  3PUR A;  5FPU A;  5F37 A;  3RVH A;  5FZ8 A;  4UF0 B;  5FZ7 A;  5A7N A;  3AVS A;  5FYS A;  4Y3O A;  5F32 A;  4QU1 A;  5F3C A;  5FUP A;  2YBK A;  5FZM A;  5FJK A;  3KVB A;  5FZC A;  5FXV A;  3N9P A;  5FY8 A;  5FJH A;  5LW9 A;  5FYU A;  2GP3 A;  2XML A;  5F3E A;  5FZL A;  2WWJ A;  2WWU A;  2XDV A;  4QXC A;  2PXJ A;  5IVJ A;  5FYZ A;  2YBS A;  5IVB A;  5FZO A;  3K3O A;  5FY1 A;  4DIQ A;  3N9N A;  4XDO A;  5FY5 A;  5FXW A;  4C8D A;  5FZE A;  3OPT A;  4HON A;  4EZH A;  5F5A A;  4CUG A;  5IVE A;  3PUA A;  5A7W A;  4GJY A;  3KV4 A;  5FUN A;  2YPD A;  5A3T A;  1VRB A;  5IVV A;  4Y4R A;  3PU3 A;  5FYC A;  4LXL A;  5FY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...