1RUH1

Rhinovirus 14 mutant n1219s complexed with antiviral compound win 52084
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
273
structure length
273
Chain Sequence
b'TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLSHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 42
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ruh100
1RUI1 4IV3C 5CFCA 3JD73 5ABJC 1NCRB 2RS51 3ZFFB 1COV3 1VRH2 1FMD1 1OOPA 4CDUA 1GFF2 1AL0G 3ZFEB 2RR13 5CFDA 1RVF2 3NAPA 5A33A 5C9AB 1HXS2 1PIV3 1Z7S3 4Q4V1 4Q4X2 1AUYA 2BUKA 5DDJ3 3VBRA 5JZGB 1RUH3 5J98B 1PVC2 2BFUS 5FOJB 2PLV3 1RUC2 1ASJ1 1MQTB 1NCRA 3ZFFA 1RUF1 1RUD3 5BNNC 1EAH1 1BBT2 1RHI2 1AYN1 2HWD1 3ZFEA 4CEWB 1FOD3 3J8F3 1DDLA 1VBB1 1K5MC 1R081 2WZR1 5K0UC 5C9AA 1BEV3 1V9U1 1HRV2 2RMU1 2R042 4GMP0 1EV12 2FZ2A 5D8AB 1POV0 5JZGA 2HWB2 2XBO2 4Q4Y2 4FTBA 2WFF1 1RUI2 1MQTA 5AC93 2RS52 5LK7B 2Y26A 3M8LA 1FMD2 1QJX3 1VBC1 4CEWA 4CDXC 1ZBA1 4IV3B 5ACA3 3JB4C 5ABJB 1BMV1 1ZBE1 5D8AA 1VRH3 1PO13 4AEDC 1QJU3 3IDEA 1QQP1 1SMVA 3JD72 4CEYC 1RVF3 1VAKA 1ASJ2 1HXS3 1RUF2 4Q4W1 1AR61 1EAH2 1AYN2 2HWD2 2RR12 4IV3A 1VBB2 5ABJA 2WZR2 1PIV2 1PVC3 4NWWA 1RUC3 2QQPA 5BNNB 2RM21 2RMU2 1PGW1 4RFT0 1HX6A 5DDJ2 1BBT3 1K5MB 4FSJA 2MEV1 2R071 1RUE1 3VBFC 1HRV3 4JGYC 2R043 1EV13 4CDWC 1FOD2 1VBE3 1VBC2 2HWB3 1ZBA2 4N43C 2WWSA 1PGL1 1RUI3 1BMV2 5BNNA 5FMOS 1FPN1 1C8M1 1ZBE2 2X5IC 2RS53 1K5MA 1FMD3 2HWE1 1QQP2 2GH8A 2HWC1 1QJY1 1PO21 1QJX2 1AR91 3JBG1 4Q4V3 4Q4W2 1AR62 1H8TC 5ACA2 4FTEA 4CEYB 3VDDC 2BPA2 2ZTNA 1ASJ3 1PO12 2RS31 1OHFA 1RUF3 1QJU2 4GB31 1EAH3 1AYN3 2HWD3 2RS11 4Y5Z0 1VBB3 3VBSC 4FTSA 2MEV2 2R072 1R083 2WZR3 4JGZB 1ND3C 1AR71 1V9U3 2WS91 2RMU3 4RS5B 5BNPC 1E57A 1X36A 5C4WC 4CEYA 4QPGC 3VBFB 2WFF3 1PGL2 2GSYA 1AR81 4CDWB 1C8M2 1RUJ1 4N43B 1VBC3 2HWE2 2DF7A 1ZBA3 1NOVA 4JGZA 1NCQC 2HWC2 4RS5A 1QJY2 1PO22 1VBE2 1AR92 1ZBE3 5BNOC 3VBFA 1QQP3 4GMP1 5A32B 4N53C 1POV1 4Q4W3 1AR63 4N43A 3VDDB 2HWF1 3LOBA 1D4M1 2VQ0A 1X33A 4Q4V2 1WCDJ 2RM23 2WS92 1HQNA 4QPIC 3CJIC 3VBSB 4GH4C 1ND3B 5A32A 1QJZA 2R073 2MEV3 1R091 1RUE3 1AYM1 1F8VA 1AR82 5BNPB 1TME1 5C4WB 1NY71 3ZFGC 4WM8C 1RUJ2 3VDDA 4QPGB 1NA1C 4SBVA 1R082 2BFUL 4RQPC 1V9U2 4YVSC 1FPN3 1C8M3 3VBUC 3VBSA 3VBRC 5K0UB 3VBHC 1ND3A 2HWE3 2WFF2 4Y4YA 1NCQB 3ZFFC 5C8CC 4RHV1 1HRI1 1AL21 5BNPA 2HWC3 1QJY3 5C4WA 1PO23 1AR93 2R061 3JBG3 4CDQC 4QPGA 1R1A1 4N53B 4EJRA 1D4M2 1MEC1 1VBD1 3TN91 4CDXB 1M06G 2RS33 5K0UA 4GB33 2RS13 3JB8A 1NCQA 1TMF1 4Q4X1 1AYM2 1VBA1 4QPIB 1AR73 4AEDB 3HAGA 4YVWC 2WS93 3CJIB 3S6PA 4CEWC 4GH4B 1OPOA 3FBMA 4N53A 1RHI1 2RM22 3ZFGB 4CDXA 4IV1C 1AR83 1PGW2 4WM8B 1ND2C 2ZAHA 1NA1B 1RUJ3 4RQPB 1HRV1 5L7OC 1RUE2 4YVSB 1F2NA 4QPIA 4AEDA 1AL22 3VBUB 3CJIA 2XBO1 3DPRC 4Q4Y1 4GH4A 2R062 3VBHB 1R1A2 5C8CB 1RUG1 1MEC2 1VBD2 4GMP3 4JGYB 3ZFGA 1POV3 3TN92 2TBVA 1FPN2 4WM8A 1B35C 4CDQB 3ZXAC 1NA1A 4RQPA 1A6CA 2HWF3 4YVSA 1D4M3 1TMF2 2X5IB 5FMOL 1RMU1 3VBUA 1VBA2 3JBG2 4PDWC 3VBHA 3JD71 4WM7C 1COV1 5C8CA 4LLFA 4JGYA 4CDWA 4YVWB 2RR11 1R093 3VBOC 1RB8G 1H8TB 1AYM3 2RS32 4CDQA 2ZZQA 1VB4A 4GB32 1TME3 1PIV1 1Z7S1 2RS12 2X5IA 4IV1B 5DDJ1 1AR72 4RR3C 1ND2B 1RUH1 2PLV1 5L7OB 1RUD1 5CFCC 1RUG2 4YVWA 1FOD1 3J8F1 1H8TA 3DPRB 4RHV3 1HRI3 1OOPC 1AL23 4CDUC 4Z92B 1BEV1 2R063 5CFDC 3NAPC 2FZ1A 1R1A3 4IV1A 1MEC3 1ND2A 1B35B 1VBD3 1C8NA 2XPJA 3TN93 1RMU2 2IZWA 5AC91 5L7OA 1IHMA 1COV2 5J96B 1QJX1 1NCRC 1TMF3 4Q4X3 3DPRA 4PDWB 5ACA1 4WM7B 1VBA3 5BNOB 3ZFEC 2WLPA 2HWF2 1Z7S2 1VRH1 5C9AC 1PO11 4JGZC 3VBOB 1B35A 1QJU1 4RS5C 1RUH2 1RHI3 2PLV2 1RVF1 5JZGC 1HXS1 4BCUA 1RUD2 1MQTC 4NWVA 4RR3B 1R092 1W39A 3J8F2 4PDWA 4WM7A 5BNOA 1TME2 1PVC1 1NY72 1RUC1 2XBO3 4Q4Y3 1BEV2 5CFCB 1CD3G 3VBOA 1BBT1 1RUG3 1OOPB 4CDUB 5D8AC 2BBVA 5AC92 5CFDB 3NAPB 5A33B 2R041 4RR3A 1EV11 1VBE1 5GKAC 4RHV2 1HRI2 1CJDA 1NG0A 2HWB1 1VB2A 3VBRB 1RMU3
chains in the Genus database with same CATH superfamily
1G86A 1RUI1 3UKTA 3VD3A 4BQWA 1W0OA 2F4PA 4IV3C 1H6XA 4J1WA 5ABJC 4KG0A 1WBLA 1NCRB 3A4UA 5DAVA 5FP7A 3P3NA 5FO7B 4UT5A 4HKOA 2H0VA 4LA2A 1AL0G 4XC9A 4Y33A 5CIRA 4DUVA 3ZFEB 1DIWA 3K51A 3A23A 5T5LA 2VMEA 3WNKA 3PNAA 5IFPA 4IEZA 5CFDA 1RVF2 2VOXA 3NAPA 3OPTA 5A33A 3UJOA 3DKQA 1PX4A 4YM2A 1GSLA 5A6YA 4IEVA 2P4EA 2JG9A 2V4AA 2G4IA 3A7QA 3CBNA 4Q4X2 4WVMA 1XE0A 5FRAA 2B4KA 1KS5A 2ZA9A 3T4HB 4XF1A 3VZMA 4URTA 2J22A 5JZGB 4XJ9A 4XXAA 1WWYA 3CHXA 5H9RA 4YSFA 4PCRA 4XOGA 1W8OA 3OD0A 1RUF1 1LOAA 4W50A 1RUD3 5FUPA 4ARYA 1S2EA 3LOIA 1WW5A 2RJLA 3RWNA 1PMIA 5DXDA 3U10A 4Q2FA 2WT1A 1LEMA 1DDLA 4YM1A 5EQUA 2XLFA 5M0TA 1R081 4PIYA 5DUVA 5K0UC 5FZ9A 3U4SA 3ZX7A 5C9AA 3BIEA 1V9U1 2RMU1 3H9AA 3JUUA 3LEGA 3M7AA 4DINB 2W1QA 5CISA 1BK1A 3LSDA 4MXWA 3S7EA 3T2PA 2ARAA 1C5IA 5LBBA 1YWKA 2R1DA 4QT6A 3VZLA 4H7MA 2Y6LA 3BB6A 3IIAA 4Q0VA 4QB6A 4LHNA 4PF1A 1RUI2 1WLCA 4XUOA 3AMMA 4HL0A 3MEPA 3KCXA 4BLIA 1CAVA 2D6LX 2JB8A 1XNDA 2BNMA 3ZMNA 5IK8A 1OI6A 4Q27A 5LK7B 1DGRN 1QJX3 4AW7A 2W2IA 1VBC1 1ZBA1 4QKFA 4CCLA 4IV3B 1XNAA 5DZFA 1ODNA 2OKXA 2PQQA 2W5FA 2ZGUA 2ZS6B 5ABJB 1BMV1 2K2SA 1ZM1A 2W1WA 3L2HA 3RI9A 2G9FA 2VUJA 1ZBE1 5JUVA 1DHKB 3AKRA 5F5QA 4L0PA 3DYMA 4LHSA 1J3PA 2LALA 1WW4A 4DXTA 1ZZBA 4XEZA 5FZBA 2CYFA 2NN8A 5FOBB 1TG7A 3T2TA 1S0EA 2WINB 2OZJA 3A0NA 3JD72 5FP8A 1RVF3 4Q29A 1G9FA 1VAKA 5H9QA 4CEYC 1H30A 4GXLA 2D98A 1RUF2 2Q8EA 3VN4A 2X05A 3E97A 1AR61 2P34A 4LUKA 2JIJA 3I2DA 1EUTA 3WP6A 1NE4A 4XIKA 3W59A 4DXRA 3E6BA 1PIV2 2YV8A 3AMPA 3WT3A 3BUCA 3VKOA 3N9MA 4ASLA 2RMU2 1YFUA 3AB0A 5DMYA 3AZYA 5CKMA 3KM5A 4X6QB 1LCLA 3HT1A 1PMJX 1REEA 4LQRA 3RMYA 3ZIWA 1W6OB 3J9SA 3PUIA 1IQDC 5HXMA 2D3RA 3IKWA 2A6ZA 3FFZA 3DYPA 2XR4A 5EJ1B 3WNXA 4YZ5A 5JOXA 3T0AA 5CB7A 3M3OA 3MW4A 3VBFC 5IT6A 3AYAA 4AFBA 1JYIA 5C33A 4JGYC 4LKEA 4O61A 4XJAA 2JXAA 1VBC2 4FOWA 3ZDVA 1ZBA2 1GV9A 1JU4A 2JE8A 4N43C 3ES1A 2WWSA 5L36A 1RUI3 1BMV2 5FMOS 2IVJA 4PQQA 3V0AB 3PIGA 3RS6A 1FPN1 4F3JA 1BVVA 1ZBE2 2X5IC 1LOFC 3OUJA 1G6NA 1CPMA 1K5MA 1W8TA 5FPLA 4ZY9A 4EWDA 2IWGB 3V0BB 3BTXA 2CGOA 2F4LA 1NKGA 2D6KA 5FP9A 3GZTB 1ONAA 2AUYA 4MOAA 3K4ZA 3BVCA 2CU5A 3SCGA 1JYCA 3JCIA 1N3QA 5KXDA 3AXDA 2E33A 2FMYA 3H1WA 5FP3A 1GWKA 1UIJA 1UY4A 2JB4A 4RFRB 3V65A 4BK4A 1AR62 2W87A 1Y43B 2JDUA 4A41A 4JCKA 4CEYB 2WZPP 1PM7A 3SKVA 4YZ4A 4EZHA 4YPJA 2D97A 2CAUA 3WQ7A 1OHFA 4IEYA 4E27A 1RUF3 4N9HA 3PHMA 1ZA7A 3IDCB 1NE6A 1O6UA 1IOAA 3AVRA 3MIEA 3V56A 1WW7A 3WQ1A 3VZKA 2CSGA 2F17A 3AYEA 1R083 3HR9A 4OQ8A 3EHKA 2G1MA 4QGMA 1ND3C 5FZLA 2DUOA 2XJPA 5BXXA 4CP1A 1JZ6A 1XSRA 1V9U3 2O1QA 2RMU3 4RS5B 2DUPA 1PK6A 2C1FA 3ZSKA 1H8VA 4BMEA 1JZ8A 2XQRA 2VVEA 1JYNA 3HQUA 2CWMA 3HEIA 1GZWA 1TQ5A 4YYOA 1BLZA 1WLWA 2D6MA 3VBFB 2WZEA 1ULDA 4CVUA 2GSYA 2AC1A 1AR81 3WP5A 4LMFA 3D0SA 3IAQA 2W3JA 2Q1MA 4XQ4A 5I8SA 4CP2A 3O1SA 4XF9A 5DAPA 4N43B 1VBC3 4HPKB 3ZYPA 4YLZA 4HKLA 1ZBA3 3WEZA 1DQ6A 3SNMA 3WUDA 1A78A 1W2UA 4OLLA 5JXJA 4EN0A 2W1SA 2D3SA 1VBE2 4MGSA 1ZBE3 2XUMA 2ZPXA 4XUTA 2EIGA 5FYIA 5FY1A 1QJFA 4IE7A 2GMPA 5A3MA 3KB5A 4R9BA 1S4CA 3P3PA 1POV1 3DYOA 2VOKA 4I0BA 1I5PA 5FZ1A 2D40A 2GC3A 1UIKA 3WINE 2GN3A 2Z42A 4GWMA 1AR63 5IVCA 2A7AA 1XU1A 5FYYA 4NIAA 1DYOA 3N9LA 3LOBA 3DKWA 2FDKA 3NVCA 4ZXKA 4TTGA 3V64A 2TNFA 4H7LA 1O5LA 5L73A 4KH9A 3GZAA 4ISRA 4Q4V2 4XCBA 4H2AA 1DFQA 5C3PA 3LA2A 4XMIA 3D5OA 4UOJA 3RZHA 4XHXA 2RG4A 1C4RA 2YC2A 1I9RA 2Z69A 4AI2A 1ND3B 3BI3A 1GR3A 1LHOA 2WT0A 1R091 3H3LA 5CU1A 1AR82 4ZZ8A 3ZKUA 2ETEA 3OY8A 1QOTA 2P2KA 4WM8C 3VDDA 4E8CA 1NA1C 3PIJA 4KNCA 5F6LB 5K9YA 3SH3A 1OQDA 2WC2A 4LBMA 3UK9A 3WDWA 1YQCA 4OHYA 3WW3A 4DQAA 1OC1A 4FFGA 4E4DX 3H8RA 1FPN3 1TEIA 3DF0A 3QACA 4NJ4A 4NE9A 3CIHA 1ODMA 1CZTA 1SCSA 1XOYA 4PT6A 1UO9A 3VBHC 5C3OA 4F83A 4NHMA 3U4XA 3QH7A 1FATA 5C8CC 3U0ZA 2ARCA 2A3WA 4COUA 2ZOEB 4FXGB 4NPMA 3HIFA 4ONUA 5FPAA 5T55A 3HNYM 3ZR6A 2CNAA 2IXLA 5EWSA 2BYVE 4LE3A 4EYUA 4GZ9A 1IPSA 1UF2C 4XJWA 4AFMA 1JZ2A 2DCZA 2XJRA 5GLZA 4JTOA 1MEC1 1ZNPA 1VBD1 3S0MA 1S1AA 4XAAA 4NVPA 3WX5A 3K2OA 1W2AX 3IIIA 2ATFA 4C0BA 5IHRA 4CDXB 2YFUA 2ZGMA 4QB2A 4XETA 2PXJA 3VV1A 4AVVA 4CUGA 3OB8A 2XH6A 4C1XA 3JB8A 1XPWA 3OGSA 1NCQA 1IPJA 4KL1A 2E32A 4IEXA 2BRTA 3WCSA 4AGGA 3B5LB 5FWEA 1VBA1 1JOPA 3AL5A 1L3JA 2EIDA 3HNMA 1IPKA 1MVQA 2R6QA 2UY9A 1C3HA 1OPOA 4NAOA 4Y24A 5FYVA 2D93A 5FFOC 3SMHA 3LFIA 4AK3A 3DUIA 4N53A 2XL7A 5FREA 1LOEA 5A7NA 3UV9A 4GWJA 5A3OA 4COYA 3WDTA 2R0FA 3BYWA 4TYSA 3THPA 3LDBA 2E63A 1AR83 1PGW2 4WM8B 3KT4A 3URFA 3OG2A 1NA1B 3J26N 3VDAA 3KS7A 2VCBA 2W1UA 4X8PA 4ASKA 1HRV1 2VJXA 1WLDA 5L7OC 1KRIA 2HBTA 2C0ZA 3B00A 3IPVB 5DPNA 3G7DA 5C3SA 4GD4A 3MV01 1ENQA 3THCA 2FCUA 2AR6A 2BJSA 4YG6A 2W46A 2XBO1 3CJIA 4Q4Y1 2EA7A 5FMBA 1RJ8A 4ES8A 2YMZA 4SLIA 3VBHB 3GF6A 4R4ZA 2DFCA 3ATGA 3EXUA 5KHKA 5C8CB 5FWJA 1MEC2 5FZKA 1VBD2 1S0BA 5IAVA 4PLNA 2XVGA 3B02A 1POV3 3ETPA 2BNOA 3ZFGA 3OBTA 3MFCA 5CVRA 1JUHA 1OLME 2WQZC 3IMNA 1JZ7A 1W8ZA 2VCCA 1QH6A 1UWWA 3GDBA 1A6CA 3MIBA 2WQ8A 2DUQA 4C8DA 3MLKA 1W6NA 5L9RA 4QD2A 3WNOA 3ELNA 4W4ZA 1O8SA 5C5UA 1ST8A 5FUNA 1VBA2 2FCTA 3NMBA 1VRBA 2KR2A 3AZWA 4QX8A 2IFRA 3U78A 3GALA 1COV1 1QKQA 3B9IA 3FJSA 1ENXA 4TLFA 2YROA 5ANQA 3T4VA 1UZVA 5FY9A 5CADA 3BTYA 1R093 1POQA 1SPPA 2RS32 2UURA 4L2NA 2X8KA 4CDQA 4DB5A 5C7GA 1O4TA 3K46A 1VB4A 3OOXA 2J1RA 4GB32 1SLAA 1GZCA 2CTVA 1Z7S1 2RS12 1NLRA 1TE1B 2Y60A 3B3QE 1MS1A 3IN9A 3HBKA 1FV3A 3EYPA 1CZSA 4KBBA 1W6QA 5DDJ1 1DU3D 3QH6A 4F8AA 4JHTA 1EPZA 3H8OA 2DVBA 3JQWA 3VHPA 2YXSA 5L7OB 1SFNA 1WLTA 4PLMA 1S0FA 3I8TA 5IWFA 3FHQA 5JR2A 4RA0A 4DRRA 2D6OX 5FY4A 3ZIXA 1FOD1 3ACHA 4FP3A 3RRDA 5F7UA 1QMJA 1XJAA 5FYZA 1OOPC 3WW2A 4GALA 5IW0A 4CDUC 4Z92B 2DCKA 2VZVA 4OMCA 4AHZA 1LESA 2WSUA 3M2MA 5E1RA 2VCMA 3N3HA 3LPGA 5FR3A 1MEC3 1VBD3 3KVAA 4YWAA 3SLIA 3ACFA 1KDMA 3ABZA 3GZEA 1LR5A 1UMIA 1XYOA 1N1YA 4GA9A 3N9NA 5FZDA 1YUDA 3ZN6A 3UGHA 1COV2 2QQLA 5GZGA 4IQPA 2VULA 1QH7A 2LS6A 3I59A 3T1LA 3WDYA 1VE0A 4BM8A 1ZRRA 4A4AA 1PVXA 3DPRA 4ZPIA 5A3UA 2D3PA 5ACA1 4MVTA 4IGPA 4AI9A 1VBA3 3POBA 3OCPA 1J58A 1LGCA 3IZOA 2KXLA 1Z7S2 3PVEA 4IL7A 1UOJA 1MS5A 2J1EA 1J3QA 1VRH1 2W68A 1PO11 2PFWA 3M3EA 2WFPA 1QJU1 3ENRA 3IM0A 2ERFA 2WO3A 3FFQA 5FXXA 4K7JA 3THTA 3PVNA 1QGLA 5LA1A 4YW5A 1PZ7A 2VECA 3NKGA 2Q8CA 2ET7A 4BCUA 1A3KA 3LF7A 4B8EA 1TZOA 4M4PA 4AHWA 4AZZA 5FQ0A 1DLCA 2WNVA 3K4AA 4NWVA 2GNMA 2YBKA 1WUVA 3O1OA 3LE0A 2DBNA 4LO4B 1OH4A 2Y38A 5BNOA 2XHKA 4EN7B 2YU2A 4FAGA 5I0DA 2XBO3 4Q4Y3 1UZWA 1U0AA 1Q56A 1CAUB 2LRPA 4ASMB 5IVBA 2VVDA 3VBOA 1UY1A 1BBT1 1UD1A 3WCRA 3BPSA 1Y9GA 4DY3A 1OOPB 2NMNA 4CDUB 5D8AC 2HYXA 2ZXQA 4Y5SA 1DGWA 5LASA 4BPZA 1C1LA 5HV0A 2BBVA 1Q8VA 5LW9A 3C7FA 4QDQA 1X50A 5CG9A 4DS0A 3OBAA 4AI1A 4FPYA 2VTFA 2XLAA 1VALA 1KFUL 4LORA 4NRPA 4TN7A 5GKAC 3WW4A 1PNGA 1HRI2 4D69A 3O14A 4OUEA 3VBRB 2OUHA 3MW2A 2D43A 3FBYA 4L11A 3CF6E 4DO0A 3WF1A 4ATFA 4HVOA 3LCPA 1OMIA 1S0GA 1COV3 1VRH2 2K0GA 4KGQA 2VO5A 2DU1A 2RDNA 2WJSA 3S5AA 1HJFA 5KXCA 4R9CA 5B2GB 2NM1A 2OX0A 1W6PA 4RL7A 4LBQA 3AFKA 4L97A 2E53A 2A70A 2GDFA 1KQRA 2QNKA 2VBPA 4Q5OA 2R0HA 4G9SB 1Z7S3 1K3IA 1OVPA 2PHFA 3CL1A 3RZZA 3HQRA 2Q8DA 5FV3A 1FT9A 1AUYA 3OD4A 4XPVA 3AP6A 3D6EA 5DDJ3 1SBDA 4OHZA 3USUA 4LULA 4CCKA 2BEOA 2BFUS 3C8XA 4UWDA 2UY8A 1YXWA 4XQWA 1ASJ1 1T6BX 4XFFA 3LD8A 3ZFFA 2ES3A 3LDKA 4YM0A 5BNNC 3AP9A 5FZ7A 1BBT2 1JW6A 1F35A 2EALA 1RHI2 1SBEA 2HWD1 2VTXJ 4JVAA 5HXVA 3WSOA 4CEWB 1FOD3 3WVJA 1K5JA 5FMCA 1W6MA 4XBNA 2E7TA 3H8UA 1UOGA 4ZU5A 3VKMA 3ACIA 1W8NA 3HD8B 4QM9A 5D8AB 1POV0 4DIQA 3J7LA 1N3OA 3Q8AA 5JIAA 3N9OA 4XYXA 3M3IA 1KJLA 3VDDB 2VZTA 4HZFA 3ZYRA 4BXFA 2FDFA 1J83A 2HKXA 4PQ9A 5FO9B 1MQTA 4XBLA 4HN0A 1W04A 3ZYFA 2QQMA 2YUEA 4MGTA 4HFSA 3KF5A 2Y26A 3M8LA 3GCWA 3T2OA 2VBBA 4U2AA 4BIFA 3ZKYA 4WBBA 1PM4A 5FPBA 5ACA3 4V1PA 5DABA 3U14A 2JG8A 2VQUA 3JB4C 3RSJA 3N7JA 4JRAA 5T5OA 5JR7B 1CWPA 3H50A 4MGIE 1VRH3 1PO13 1UU4A 2PN5A 1QJU3 3IDEA 1W9YA 1YRZA 3AMQA 1UXZA 3TNQA 1V6LA 2VXRA 5DG1A 2FDIA 2WSVA 5J37A 1ASJ2 2PMWB 2YG0A 1LGNA 3RJ2X 4AWDA 1ZZ8A 3B69A 1H2KA 1XQNA 2VQAA 3ZN4A 5CKNA 1D4VB 5E8AA 5IK7A 2Q4SA 2EXKA 1YFWA 1ZX5A 2HWD2 2I2SA 2VQTA 4AI0A 5IATA 5T3NA 3DCQA 4BQ3A 5BY5A 4AQ6A 2XOMA 1W2NA 3Q8EA 4UFIA 3I49A 5BNNB 1IS3A 4XBQA 5FJKA 1RJ7A 4RFT0 5FJHA 5JWPA 2ZAAA 1MZ6A 1BBT3 2C4XA 2XB6C 3VZNA 2YBSA 5FBJA 5HCBA 2Y34A 2QQWA 3WW1A 3VD4A 3W20A 5DAXA 2W0XA 5G04L 1D7PM 4I3GA 4OI4A 1RUNA 1BK0A 3J7MA 1S0IA 2NLRA 1XRUA 2IXJA 4FPGA 4D6SA 4ZZ5A 2A3YA 4FOVA 1GLHA 1GOGA 1GANA 1AX0A 4OHXA 4RYDA 3NNFA 1GZTA 2WL1A 1PGL1 3NSTA 3ZXLA 2KD7A 3OJBA 1C8M1 1UY3A 2B46X 3TEYA 3F2ZA 4HN1A 5A3WA 1VR3A 4UFJA 4RGAA 2XL9A 3MICA 4ZU4A 4XURA 2GH8A 1XNCA 3RQ0A 2HWC1 3O0WA 3POYA 4BJ0A 1QJX2 4UF0A 3OEBA 1T2XA 2GC0A 5JI7A 1CONA 4FTEA 1W05A 1H2NA 2TUNA 5DZEA 4GJYA 4CZSA 1IG3A 3I2HA 1ASJ3 1LENA 2VOVA 2HEYF 4CUBA 1BYHA 1GQHA 4UXAA 2F6BA 2HWD3 1QOSA 4K1YA 4I01A 2VNVA 3VBSC 1S2BA 1REFA 3LB9A 1CGPA 3RYPA 4NHLA 5GM0A 2KA3A 3RDIA 1SQ4A 1XB9A 2ADEA 2BP6A 4N90A 4XZUG 1SCRA 3TB0A 3DXUA 5F6KA 1GWMA 4D6QA 1OURA 4Q26A 5IVYA 4Y3OA 4UFMA 4XE9A 3MF6A 3RPQA 4AGVA 2VNGA 3ILRA 3MV11 2FQPA 2ID4A 3KV5A 2JX9A 3ZN5A 5A7WB 1PGL2 2EVXA 3RZLA 5SV8A 1JZ4A 3IB3A 1V6NA 3OBRA 3AJZA 1C8M2 2FMDA 3SH5A 1YQ6A 2QQVA 2XJVA 4LE4A 1OSGA 5I93A 2O8QA 4R8HA 2A6XA 3D0JA 3ROUA 2GP5A 4JGZA 2UYBA 3FZ3A 1V0AA 1XBFA 3BIWE 4AHXA 4CXYA 2HWC2 2UU8A 1XNBA 4RD7A 4IGQA 2WNVC 3WR0A 1UYXA 3MYXA 1N1SA 3BTZA 1JHJA 1YJKA 5BNOC 4JKKA 4DXZA 5FZOB 4ORFA 4GULA 5EP9A 1HB1A 1GOHA 3E5UA 4M3CE 1UOBA 5GZFA 4IGOA 1DQ2A 1Z0HA 4B1LA 1HQLA 4MGYE 4KWJA 4TLGA 5G05L 3POIA 3N7LA 1ZZCA 2UYAA 3NJYA 2YHJA 3OGJA 3H7YA 4GKXA 4OI0A 4LBOA 4CU8A 2LW8A 2DVFA 5JXGA 5J7MA 3MW3A 1ULFA 2VQ0A 3ZXJA 2ZGNA 4RGGA 4FI9A 1WCDJ 3AP5A 3I97A 1ULEA 1WCQA 5FYCA 5EV7A 1VAVA 5DAQA 5L9VA 3VBSB 4XTPA 4JDNA 1J59A 1GP6A 2PHUA 4GH4C 4HONA 3O1RA 3WG1A 5A32A 2JECA 5IVJA 3DN7A 1W9FA 4A45A 4LNVA 2J1UA 3UETA 2QCSB 5AFBA 5IFTA 4P02B 3HN3A 3RI8A 1NXMA 1NY71 3AXEA 5K8SA 4E2GA 1TNFA 3I7DA 3T3YA 2NPIA 3LFMA 1UMHA 4SBVA 2A6WA 1R082 2JDZA 5FKBA 5E6HA 1NXD1 2VBDA 4BB3A 3VLBB 1V9U2 3VKLA 4OMDA 2VZOA 1MS8A 4J6GA 5B4NA 1GKBA 2WWUA 1SLTA 3L9JT 1O4YA 2VUCA 1C8M3 3BU7A 3WF3A 5K0UB 3B9CA 4MGKE 4Y4YA 3CEWA 3C7HA 4GKYA 3HT2A 1CAXB 2WNVB 3ZFFC 2BWAA 3F95A 3CKHA 1YQ2A 1D0GA 1H1AA 2ZGQA 2HWC3 4PBOA 5BNPA 1V00A 2D5FA 3R4DB 5C4WA 2WYFA 4AAPA 5FPUA 5HCHA 3PTRB 1PHMA 4QKNA 2E26A 1S2KA 4QPGA 4D6RA 3I3MA 4D94A 5FCCA 3RZJA 4M3CB 3T2QA 1UPSA 1WBFA 1DQ4A 4CE8A 3NNLA 2OVUA 4WVVA 3TN91 3ITQA 4I2OA 2WWJA 4EE2A 1JZ3A 1M06G 3HOBA 5HPOA 4LO6B 3LA7A 4P9JA 4Z2AA 1IQAA 1AXKA 1ENRA 3CNAA 4XUNA 4DUXA 5FLHA 4BA6A 1HN0A 5GLTA 1QDOA 3NJXA 3T08A 5LBFA 1MZ5A 4XXPA 3T0BA 1AX2A 3NRUA 1G9CA 3HAGA 4QQ2A 4YVWC 4L8QA 4PJYA 3S6PA 5J09A 2XKOA 4GH4B 2JENA 1CAWA 2LROA 4QX2A 5CKQA 3PMEA 1IG0A 1Y3TA 2NYYA 3O7OA 4A7ZA 2W92A 2WN2A 4BLJA 1OUSA 4Y20A 5FZ4A 4P9WA 2GNDA 2B42B 5FXVA 1LU1A 4Q0UA 5D21A 5A80A 2DTYA 3VD9A 2ZGLA 2YGMA 1Q43A 1YIFA 1QIQA 5FY8A 3LEKA 4QHBA 3WNMA 1GQGA 2BVVA 3ZXEA 5C5TA 4FPFA 4MG2A 5FZCA 2XWJB 1FAYA 2OQ7A 4QPIA 2LM3A 4AEDA 5KHHA 4FOYA 4CP0A 5F2WA 4FPKA 1QOOA 4W6YA 1A34A 5FK8A 3T09A 5I0UA 2BWCA 4CCJA 2J1AA 2ZMLA 4YW7A 4NHXA 1H9PA 2Q1FA 4Y4RA 4JGYB 4OVEA 2W95A 3TN92 2TBVA 1FPN2 2ORZA 3ZYJB 4CCMA 4QDRA 1B35C 4QDSA 2LTNA 2XG3A 3K77A 3ZXAC 4XDPA 1EY2A 2PHDA 3FL7A 4B7KA 2B5HA 4OHVA 4RQPA 5LBCA 1O91A 2Y6HA 2O8OA 4DRVA 4YVSA 1IS4A 2X5IB 1QEXA 3ETQA 4UBHA 1NZCA 3OYWA 3WD5A 5BUVA 1RMU1 1N47A 3VBUA 2RV9A 1UY2A 2PELA 1F5FA 4YGBA 3E6DA 4ZXEA 4CCCA 4WM7C 3BN6A 1REDA 1OA4A 2HH9A 2PHTA 3K4DA 4HT1T 4S2HA 4D0QA 1HLCA 4CP9B 1WKYA 3C3VA 3VHRA 2HJIA 5A70A 5FZEA 3WP3A 4CDWA 4YVWB 1G9AA 2RR11 1H1MA 2P17A 2WA4A 4JX0A 1JYVA 3UGFA 3CDZB 5F9TA 3Q9OA 1CX4A 3O1MA 5FO8B 3OGGA 4AI3A 4QGNA 1I6XA 5FDBA 2WDBA 3N4MA 5C6CA 5FYHA 3TYJA 1JMUB 3GBFA 4RR3C 2DDUA 1RUH1 3B01A 4NRQA 5LY2A 1O7FA 4MYEA 4OQ9A 1W8UA 5GLVA 4A3XA 1U12A 5FZAA 4I02A 2JKXA 1ZRIA 1K12A 2DVGA 4ES9A 4NIDA 1W2TA 2IFWA 3H3ZA 4NUBA 4XIOA 1H8TA 1YC61 4NAMA 4KGGA 5F5IA 2NQYA 1QHDA 2WBKA 5LA9A 4K8FA 2WNUA 3POEA 1AXYA 3K48A 1JHNA 4Y22A 2WT2A 2XMLA 4KBZA 4A6OA 4DEQA 5CFDC 1E5IA 3NAPC 4FXKB 2FZ1A 5FY0A 1WD4A 2JKBA 5D2AA 4IV1A 3ZXKA 1S55A 3OEAA 1ND2A 1B35B 4ZU7A 2JG9C 2R16A 1R64A 3TN93 2E9QA 2XKPA 1RMU2 3L2YA 3LA3A 4BYYA 2IZWA 1YHFA 2D7FA 3O1PA 3AFGA 3WHUA 4KWUA 1HW5A 3GYDA 1IS5A 3WDUA 2I07B 1F4AA 2GMEA 4A44A 2QQOA 2Y6GA 2ZCWA 1WA6X 3A22A 4JQRA 4B29A 4YW6A 4WM7B 4CRQA 5EYYA 1WW6A 2WLPA 3VL9A 2VZRA 2XJTA 4LOTA 1R1ZA 5C9AC 1IKQA 2DBIA 2I74A 4JGZC 1E5SA 3MIHA 1RUH2 4ITCA 1VP6A 3RMXA 2W94A 3ON7A 4GJZA 4XF4A 5E89A 5A3PA 2VUDA 1DBNA 4FBFA 4UFKA 4JDMA 4LBKA 2BERA 5CG8A 3O1VA 3BPZA 5C8WA 3SC7X 4RR3B 4RSUA 4AFDA 1JYTA 1R092 1W39A 1GNZA 2YY1A 3CU7A 4PDWA 4URAA 4Q0SA 1UQXA 5F37A 2NP0A 3G6JB 3SEEA 4HK9A 5EIYB 3PU3A 3HN1A 4QX7A 1ZRDA 5C70A 4R9AA 1N3PA 1UYPA 1OLRA 1QU0A 3MLJA 4JHZA 2E31A 1SFPA 2MPFA 2ZGOA 4K3UA 1RINA 2RJ2A 3R05A 5AFEA 4XCAA 4OUMA 2PHLA 1XE7A 5DN2A 2OIIA 3I2GA 1G7YA 1BHGA 5CFDB 5A7PA 2Q5TA 3NAPB 5A33B 3WNNA 2DCTA 2WO2A 4ZS2A 1QDCA 4XFCA 2R041 3VKNA 3LIGA 1YFXA 4PLOA 2JG9B 4WVMB 2VMIA 4OI1A 4D7TA 1IS6A 3NV4A 2HWB1 1NG0A 3DV8A 3KV4A 3TRSB 1H4GA 1ULPA 1RMU3 3ACGA 4I0AA 4HLTA 4A2UA 3DL3A 3EQEA 3FUQA 4KU8A 1OKQA 4WZFA 4BE3A 5CFCA 4D7SA 4YZ3A 4EROA 4KI5M 3E6CC 1FV2A 1EP0A 2P37A 1FMD1 1HKDA 4EWAA 3ALQA 4TWTA 2B45X 3D3AA 5FAXA 2RR13 3UGGA 3LQCA 5IK5A 4IEUA 3I3DA 1YI9A 4TXWA 5C9AB 3TEWA 1N1TA 3POFA 1W99A 1VMHA 5KC6A 1DGLA 2V4VA 4MXWB 2BV4A 3I2FA 2BUKA 2W39A 1J1LA 1PGSA 1RUH3 4FO9A 3LWCA 5J98B 4CCEA 4X8NA 3B7MA 5FOJB 5JMCA 3GJBA 1NCRA 1CAVB 1UY0A 5FMDA 3S7IA 1EAH1 1W9WA 2DVDA 4YG3A 1CN1A 1EYBA 2JWPA 3ZFEA 3GXUA 3BCWA 4FPLA 5FZHA 1K5MC 4YW4A 3DECA 3MIFA 4K1ZA 2ZHKA 5LA2A 2ZGKA 4JC1A 5I0RA 2QTWB 2VUAA 3A0KA 3RWKX 1BJQA 1HRV2 5LCWL 2BGCA 4LLOA 1JU3A 3H8XA 2XJSA 2A73B 2R042 2FZ2A 2WO7A 4O9GA 1GOFA 4LKFA 4DMIA 5JZGA 2HWB2 1MS4A 2UWBA 2QKDA 1LECA 2ZHLA 4NHYA 4TSVA 2XBO2 1YNAA 4FFHA 1CIWA 4Q4Y2 2WFF1 4AR2A 4FTBA 1Q8OA 1LOGA 1OVSA 1VIWB 2B9VA 4FQZA 3UNPA 5APAA 2AENA 2VNOA 4FQ4A 1FMD2 4IE5A 3FE5A 2ZKNA 1OFNA 1XYNA 3CQOA 4I30A 4K20A 4YG0A 3PURA 2A1XA 1HV0A 5DUXA 5JXHA 1RITA 1MACA 2BDRA 4I0WB 3TBDA 3HNBM 4YARA 1G9BA 3CZUA 5K7PA 4PI2A 4QQLA 3UYJA 2KM2A 2H6BA 4W8JA 3CO2A 4R4XA 1P8JA 3N9QA 4AEDC 3BODA 4F7ZA 1PK6C 3OGRA 5LRSA 3WG2A 5KHGA 2X53S 1QQP1 2FDHA 5GLUA 1JXNA 1MS9A 3RYRA 2C5DA 1AHSA 4Z82A 1QF3A 3MUY1 3EBRA 3OSDA 4BMBA 5JMOA 5FK7A 2VNRA 1K42A 5F5AA 1EAH2 2E51A 4KU7A 4ATEA 3I2IA 4IV3A 1SLLA 3SXWA 1Y4WA 5ABJA 2A71A 4NWWA 2GNBA 1UU5A 1LODA 5AC92 2AH2A 3ZXDA 3OF1A 2RM21 1GQPA 1AXZA 2JE7A 1SHWB 4V2WA 5DDJ2 1K5MB 1US3A 4QU2A 3E5XA 4PIZA 3N7KA 2MEV1 2R071 1RUE1 5L9BA 3U1XA 1UAIA 1HRV3 2R043 4MH0E 4CDWC 1FOD2 3TAYA 4MO3M 2VTXA 4IE6A 4FPJA 1H2MA 1X82A 2QZ3A 2YDEA 2HWB3 3Q8BA 5IUQA 3ZMOA 3J7HA 2PAMA 4CCOA 1LKNA 3U07A 2B39A 4N8MA 4YGEA 3BALA 2ET1A 2VZPA 3ILNA 3KF3A 1I1EA 3H1MA 3Q8FA 2QQNA 1SG3A 1FMD3 1W90A 2GN7A 4M0NA 1W6OA 4E8DA 2CGNA 4YGDA 4K8RB 1ULGA 1WCSA 2BGOA 4LTAA 2DFBA 1QQP2 2VZ1A 3KQ4B 1GUIA 3FWEA 2YPJA 3QLQA 3W5MA 3MFAA 1QJY1 5I8YA 1LEDA 4XJ8A 1PO21 2CY6A 1AR91 2C9AA 3JBG1 1PK6B 4XFGA 2DV9A 2OS2A 3O0XA 1H8TC 5TSWA 2WAAA 5LZ6A 2GNTA 5ACA2 4IEOA 1WMXA 2WNUC 3N36A 1GZWB 3VDDC 2HYKA 3VHOA 3JXSA 5FYMA 4AFCA 2BPA2 3V0AA 1QXPA 4LKDA 1OLQA 1AF9A 1WA4A 1PO12 1DZRA 4OZXA 4B3NA 5C71A 1QJU2 1RL3A 1CJPA 4X6RB 3V0BA 1EAH3 1FXZA 3H3UA 4QB1A 1XE8A 2P3IA 1D2QA 1OA3A 4Y5Z0 2E7QA 4OULA 4FTSA 1NYWA 2MEV2 2R072 3VKFC 1DP0A 1AR71 3WY6A 2RDQA 3NO8A 3RYKA 2WAOA 1UW8A 4LKSA 4U36A 5H9SA 3WOGA 4AVAA 4YW1A 4CEYA 1D0HA 1SEFA 3QCWA 1JOJA 1SZBA 3O5SA 2WFF3 4A3ZA 2ZX1A 4AEKA 1YO8A 4CDWB 4HSLA 4XHBA 3OUIA 1RIRA 1WMFA 1RXGA 1RUJ1 5C3RA 4QKDA 1PMHX 1W9TA 5T50A 4XFIA 1RC6A 3TEXA 2JD4A 4YM3A 3UL2A 3ZPYA 1DF0A 3R0RA 4BQ4A 1LRHA 1NCQC 2DVAA 2PYTA 1QJY2 4RS5A 2YB7A 1HDKA 1PO22 5E16A 1APNA 1AR92 2VL4A 1UU6A 3WXPA 4WVZA 5FZ0A 2ZX0A 4OCTA 2P6CA 2ZGTA 1N1VA 2CL2A 3NWKA 4P9LA 3PUHA 3VBFA 3GJAA 1V6JA 1QQP3 2JDKA 4GMP1 1GICA 2VOTA 2Z4FA 4IUGA 4MGQA 4N53C 5F3GA 5J3UA 1UX7A 5KHJA 4XAEA 4QXHA 3AX4A 1JZ5A 3KWVA 2DU0A 3AZXA 3OY8B 1EUUA 4N43A 2VPVA 3BGAA 1SFYA 2IXHA 2YU1A 4HPKA 4WVWA 2HWF1 1YCIA 3RJRA 1UOFA 1GMMA 1ULCA 2K46A 2PHRA 1CVNA 1GYKA 3FUOA 4QX3A 1ZA4A 3AP7A 1F15A 3P1IA 1LOFA 5LBEA 2DWRA 3QD6A 4IEQA 1SDWA 2RM23 1HQNA 1VMJA 2AEZA 4R52A 1NUKA 3FC0A 2VW2A 2W52A 3CJIC 3VGIA 4NRMA 5T52A 2J7MA 1QJZA 2MEV3 2R073 2VW0A 1HIXA 1RUE3 4CCNA 1AYM1 2OQ6A 5C3QA 1O3QA 4NPLA 2VZUA 2R1BA 5EJZB 1TME1 3LKJA 5JDBA 3ZFGC 5JXIA 4XJUA 1RUJ2 3RZGA 3M1HA 2XUEA 4WZCA 1X9TA 4XABA 2A6VA 4MADA 4GWIA 1U5IA 4EWEA 3LIHA 3WQBA 3JQXA 3O12A 1MZEA 3SCHA 4B7EA 5J1XA 3NV3A 5T54A 5JSRA 2X29A 4LO7A 1DGRA 1GP5A 3LPFA 5F3EA 4W6WA 4KWLA 2QUOA 3I3QA 4Y1XA 4LT5A 2WKKA 2Z2SB 4FP2A 1ND3A 2VM9A 2R49A 3S57A 1NCQB 2IUWA 4GIQA 4RHV1 1AL21 1W3XA 4N7IA 1QJY3 1PO23 2V09A 2C9KA 1AR93 3JBG3 4AF9A 2HEVF 3KVBA 3ZYGA 4CDQC 2NZ9A 2QQIA 4M01A 3B94A 3AC0A 2BU9A 4N53B 4EJRA 3NNGA 3WNLA 2FD8A 5IJRA 1WCKA 3ZYBA 1UKGA 2ZEZA 4QXBA 3TOJA 2A3XA 5JIUA 1BXHA 3WUCA 1OD5A 5EJ3A 3HMYA 2YGLA 3LZZA 3PMSA 4IESA 2GC1A 3AJYA 2SBAA 3T1MA 5IVVA 4JKMA 4C90A 4ET7A 2GZWA 2HLEA 2VU9A 1V6IA 4HVRA 1LTEA 4Q4X1 5GALA 5J96B 5FZFA 2FCVA 4PI0A 2WUHA 1AYM2 1UCXA 4LK6A 4P9IA 1AR73 3AMNA 3R4SA 2WQ4A 4K9SA 3CJIB 3NL1A 4CUCA 1G9DA 3M3QA 3KQRA 3FBMA 1DG6A 4BIOA 4CPBD 3SISA 4XFHA 3VB9A 1RGSA 4E4HA 2VVFA 3KHBA 2BOIA 4Q8KA 2CGPA 5D1IA 3VD5A 1LB2A 4XF0A 3ZFGB 4CDXA 4EN8B 1YQ8A 3OPZA 4NN0A 4LEJA 1LOBA 4AGRA 3CZJA 1RUJ3 5JAXA 3AMHA 4CU9A 5A1LA 4AFAA 1W6NB 4BQXA 5FZ6A 1F2NA 2A5ZA 2OA2A 1J84A 3THDA 2WO1A 2FDJA 1LU2A 3DGTA 4NPRA 1AL22 1JUIA 3R4UA 3BKZA 1UMZA 4JRLA 3AKQA 1QNYA 3DPRC 3NV2A 1H4HA 3RFRA 1DLLA 1HJGA 4AI8A 2AZ5A 5LA0A 3B93A 1ZZ9A 3ZYIB 3OPWA 5KC5A 1RUG1 2K9ZA 4GMP3 1W2OA 1KXGA 2BQPA 2Y6JA 1DZQA 3IAPA 4WM8A 4QWNA 1SPPB 2JICA 4XVHA 5BV6A 2QFEA 2WIIB 2EIEA 1NA1A 3CJXA 4CDQB 5HBAA 4C91A 2RHPA 1UZZA 1L7RA 4ARXA 5CNAA 5FYBA 4HOOA 5EXOA 5JPNB 3PVOA 5LWBA 1WGPA 2HWF3 3IPVA 4HANA 1OKOA 2B9UA 1SDDB 1O3RA 1OA2A 3I3EA 3ST7A 5KR7A 5FMOL 1W6QB 4C1WA 5FZGA 4MSVA 3VUOA 2JJ6A 3HPNA 3VBHA 4EN6B 3JD71 1E5HA 4QHOA 2UWCA 3IMMA 3E1F1 3POWA 5C8CA 4ZKTB 4LBLA 2XVKA 3SCFA 5KXBA 2OT7A 4XMAA 1MVEA 1T6GC 4P5YA 1CZVA 1AYM3 2VC9A 2JD9A 4LITA 4QPYA 4YGCA 5LEKA 1RB8G 2ZZQA 5DQ0A 3SEPA 1TME3 1PIV1 1GZ9A 3WHTA 5DUWA 1FNZA 4NIHA 1NLQA 4OYUA 3VD7A 4FOQA 1BKZA 2EXJA 2D6NA 2VXJA 4LBNA 2PLV1 3FHIB 5GJ6A 1QXRA 2OYZA 1V6KA 1HB3A 4IEPA 1GBGA 1XNKA 1OFSA 3UESA 3ZN6B 1CQ9A 5B4XA 5A7OA 3W21A 2JIGA 3I59B 2Y64A 4JDOA 1RUG2 1BQPA 2CV6A 4XDOA 1ZRFA 3J8F1 1UKRA 3DPRB 3KMHA 2VGDA 4RHV3 3O1UA 1AL23 5F3IA 1S0CA 1BEV1 1I3HA 4DEVA 2YBPA 2RDRA 5JLVA 4XW3A 3I2OA 2YC4A 3C7EA 5ISLA 4LHKA 2XPJA 1O59A 3MGUA 4QX5A 3ES4A 5AC91 5L7OA 1PZ9A 4G3YC 2CDPA 5LATA 1IHMA 2ZMNA 2QBXA 3NJVA 3Q8CA 5LK5A 2J42A 5FQ0B 5HCFA 5FLJA 1US2A 5BYNA 4LBJA 1BCXA 4Q4X3 4BISA 5FP4A 1GNHA 1WCUA 2VCAA 3RZMA 5I91A 1KITA 3H1YA 5AVAA 4HK8A 5BNOB 2PTMA 5KXEA 3AKTA 4M00A 4TZDA 1O4ZA 1DGWX 4YRDA 3LEIA 1ZRCA 3AZVA 4P14A 2NMOA 1ACCA 4AXOA 3GZUC 3VBOB 1YFYA 2RE9A 1OLMA 2Y33A 3PDQA 4RS5C 3J7NA 5FZ8A 1WMDA 3BU0A 2B7YA 2PLV2 2XONA 5DG2A 4A7YA 2VMCA 4E2SA 4BDVB 1HXS1 3GBWA 2XJUA 4KMQA 4AVSA 3VZOA 3EJKA 3KGLA 1MQTC 4BHPA 1LGBA 4CTEA 2WA3A 4QAWA 2H0BA 3NKTA 1SLBA 3J8F2 4O65A 3FMGA 3KCCA 3OUHA 4MGZE 4Y5TA 1PVC1 1NY72 1OXCA 1RUC1 1MR5A 1BEV2 4A6SA 3I3BA 5FYSA 3K3NA 2WNOA 1U5ZA 2JG8C 3PLQA 3WF2A 2JDPA 5J36A 1CD3G 3ASIA 4H55A 1NQDA 1HB2A 1YEWA 3AP4A 1SBFA 3WZ1A 2J1SA 1RUG3 1KFXL 4Z07A 1W6PB 1FYUA 4CXWA 4YW2A 4LBQB 2DCJA 4UFLA 2XVLA 4E4SA 4FPCA 4HG6B 3PL0A 4BQ5A 2VAUA 1CESA 4XF3A 2PQSA 4B1MA 4E2QA 3S5QA 2ADDA 1JTZX 2WRAA 1C57A 4ZONA 4J1XA 1EV11 2ARXA 2VMGA 2ZHMA 5F2SA 3K3OA 1VBE1 3KZ4C 5FPVA 1GWLA 3KCYA 2DTWA 2X10A 1CJDA 1F5JA 4FAHA 2VD7A 4IEWA 4QQHA 3ZYHA 3ACLA 3USUB 1NAEA 1KEXA 1U5XA 1DYPA 1LAJA 1CAUA 3JD73 4BZ4A 2RS51 3ZFFB 5GZDA 4FCAA 2MHFA 2JDHA 4LR4A 1OOPA 1ULOA 1TVGA 1GFF2 3NQHA 4CDUA 5GZCA 4YZ1A 5J48A 4XFAA 2Y8KA 3PUAA 1ENSA 2Y6FA 3KSCA 3NJZA 1W6MB 1OBNA 3H42B 1HXS2 1PIV3 3NV1A 5SV5A 5EZWA 4OFGA 4Q4V1 3O0VA 3IDBB 3AVSA 3KD4A 3MO4A 2WR9A 5A3LA 2XHNA 1W03A 1O3TA 1C5HA 5T5JA 3VBRA 1VAMA 1W9SA 2WZ8A 1PVC2 4HXCA 2PLV3 1RUC2 2ZEXA 1OPMA 2AEYA 2ZJCA 1MQTB 3NNJA 4HVQA 3K75B 4QX0A 3SITA 2VZ3A 2GU9A 3C7OA 4D7YA 1AYN1 2ZX2A 3INAA 5ANNA 4EN9B 2YZ4A 3J8F3 1VBB1 3SH4A 4HBNA 4XDQA 1J1TA 2IVIB 2VMFA 2WZR1 4HSJA 2JG8B 1XU2A 4UI9L 3R6SA 1ZREA 1BEV3 1MPXA 1E5RA 2L9LA 2QJVA 4IERA 3WF4A 2IXCA 3LDRA 4AVTA 1PX3A 1EV12 4GMP0 1ALYA 1H1IA 2Q1ZB 1JH5A 1Y9QA 3MPPG 1MS3A 2BOJA 4MZUA 3DEMA 3WDVA 3ZOIA 1W0PA 2PAEA 4BK5A 4QQOA 3CMGA 2YC0A 5AC93 2A75A 1RYYA 3BOWA 2BTVC 3WLUA 4AVCA 4CSWA 2QE3A 1UZYA 2A6YA 3OBZA 2RS52 5F39A 5FIXA 1ZYBA 1C1FA 3APBA 1JI6A 3HBZA 2DYCA 4CEWA 2EF6A 4CDXC 1AZDA 3KV6A 5FUIA 2D44A 4CUAA 4UW6A 2WYSA 4BQ1A 2CDOA 1LULA 3MLLA 4FPEA 3FLRA 4FFFA 5FZ3A 4B4RA 3M4FA 4Q0PA 2MNGA 3JZVA 4RN5A 5D8AA 4LK7A 5CEHA 4AEMA 2OPWA 1HB4A 4XILA 3ZDSA 1W0NA 4FT8A 2BW8A 4MHUA 1SMVA 3U75A 3BOPA 4BQYA 1HXS3 2JDMA 4QQPA 3ZPOA 4BWOA 1XSQA 1ZZ6A 3I54A 4Q4W1 4XUQA 4NIGA 1SLIA 1EPWA 1AYN2 2RR12 2EAKA 2JEMA 1VBB2 2VW1A 5BPXA 5FBZA 1F31A 2WZR2 1PVC3 1CIYA 1ZZ7A 1RUC3 2QQPA 3H0OA 3PVBB 3FLTA 3KT1A 2OZ6A 4AQ2A 1PGW1 4K40A 1JODA 1HX6A 1AX1A 5FZIA 4AOCA 2LUWA 2ZEWA 5JPMB 5JOZA 2DURA 4FSJA 1DCSA 4DY5A 5E88A 2PHXA 2Z5WA 4LIUA 3WP4A 4AYUA 3SHRA 2XXZA 3WG3A 1SLCA 2X09A 2PHWA 2QVSB 4P00B 5FLIA 2G9GA 4QGLA 4P5HA 4UF0B 1EV13 3TWIA 1Y9MA 1VBE3 3GM8A 3AK0A 5DUUA 3VHNA 3ZXFA 4FFIA 1S0JA 5BNNA 3AKSA 3MHZA 4LJHA 3VZJA 1KJRA 1W8FA 2RS53 2W9XA 1ZVFA 1JS9A 2HWE1 4YFWA 1W8WA 2VMDA 2ENRA 2Y0OA 2P3JA 3SQOA 3WG4A 1CR7A 1WZXA 3S30A 3ZSJA 1FI2A 1JOBA 3AYCA 2W08A 2ZGSA 2XGXA 4Q4V3 4Q4W2 4GAZA 2CHHA 3HQXA 4MLOA 2AREA 1BZWA 4Z1VA 4DUWA 2VZSA 3ZSLA 3NNMA 4GWNA 4NROA 4MHRA 5FPZA 1H0BA 4DNYA 2H6CA 3U37A 4A42A 2ZTNA 5A3TA 2RDSA 2RS31 2XQXA 3N35A 2ILMA 5K4LA 3T0DA 4GB31 2ZGRA 1O8PA 1J3RA 5F32A 4CU6A 1XC6A 1AYN3 2D6PA 2FHRA 2RS11 4GQ7A 4BQ2A 2E6VA 5I0SA 3KHCA 1OD3A 1VBB3 4MX3A 1YI7A 5AVPA 1VMFA 5KHIA 4UAPA 2EIBA 2OUJA 2WZR3 3E5QA 4JGZB 4CCDA 1UYYA 2WS91 1NT0A 2EXHA 3FHAA 3I2JA 2PAKA 1UZ0A 4O9EA 1GP4A 1JYWA 5BNPC 1MZFA 1E57A 1OQEA 1VLNA 1SACA 1X36A 2EXIA 2R7EB 3GHNA 5C4WC 5JCTA 1Q3EA 4QPGC 1OQ1A 3LGRA 3M3CA 1V6OA 4Y1YA 4IW3A 1U5YA 4I3PA 4UBGA 2ZEYA 4INDA 3ZR5A 5KBFA 5IVEA 3KT7A 3RVHA 3SKJE 2WNEA 1DQ5A 1HV1A 4ZS3A 4AG4A 1PNFA 2HWE2 1PZ8A 2DF7A 2RJKA 4XTMA 3P5BA 5FXWA 1NOVA 2VG9A 1C28A 1NZIA 3DXTA 4AVBA 1OT5A 5H9PA 1G8WA 1X8MA 4M3CF 4LUMA 5CBLA 4PHZA 3I4IA 1JBCA 2IXIA 5A7WA 5T5PA 1DQ0A 5A32B 2SLIA 1DYKA 1LNSA 5HCAA 4BU2A 1L7QA 4JKLA 4AQTA 2V72A 4QU1A 1A8DA 3KGZA 4Q4W3 3N9PA 4WV8A 5IVFA 3N7MA 4K21A 5FZMA 4I09A 3IDAA 5CYYA 4ZHNA 4UW5A 1LOCA 1D4M1 1YJLA 3D8CA 2JDYA 4AEJA 1I5ZA 1X7NA 3LEMA 1VPHA 1X33A 2OPKA 1YYNA 2WS92 2FBEA 3C2UA 3C7GA 3PTYA 4QPIC 4QX1A 5EYXA 4JAAA 1L7LA 2WLQA 5JSPA 2Q0AA 4IDZA 4Y1UA 5FZOA 4NHKA 4NIIA 3ZSEA 3MZHA 2ZKLA 4YFZA 4YZ2A 3VDBA 2YFZA 1F8VA 4B4QA 5FPXA 1S0DA 2VH9A 4FPHA 5FYUA 2YYOA 2W91A 3ILFA 4HETA 4Z2WA 5BNPB 5FTTC 1Q8SA 5C4WB 2PA7A 3ZO0B 5LY1A 2GMMA 5JVVA 4LXLA 4QPGB 2J1TA 2VOWA 3WDXA 4FVVA 2BFUL 4RQPC 4V2VA 1W8HA 5F1RA 1OH3A 1VJ2A 2OXBA 4YVSC 4LHLA 2BNNA 4CU7A 3VBUC 3VBSA 3VBRC 4CA9A 5CAZA 2GALA 4P08A 1KDKA 1WD3A 1RXFA 2GAUA 2HWE3 2WFF2 4XJZA 3GGLA 1XNTA 3W5NA 5A3NA 3FX3A 5IK4A 1HRI1 1LHVA 1HN1A 2ZABA 2ZZJA 3KLSA 4OUSA 4AE2A 4DPNA 4S2GA 2R061 4JQTA 1O3SA 3USSA 1F4HA 1Q8PA 1CAWB 3M70A 1R1A1 4PF5A 1D4M2 3MF9A 4D8MA 3PU8A 3HJRA 3ZVXA 3D4KA 4HMZA 4Y20B 4D3WA 2AYHA 4LPLA 2RS33 3ZSMA 5K0UA 2XJQA 4GB33 2EICA 3AKPA 5F3CA 1LHWA 2RS13 4JV4A 3ZXGA 1IGOA 5EHDA 1TMF1 1Q8QA 2BVBA 2QQUA 1CAXA 4Q1RA 4RGKA 5DZGA 2I45A 4DOUA 5CZKA 2Y0IA 5FY7A 4QPIB 2OW4A 2QQKA 4AEDB 2WS93 2FDGA 1D2SA 4AL9A 2ZACA 4P9XA 4CEWC 3GNEA 3IT8A 4BOWA 4EZ4A 2BZDA 5KWRA 2C6SA 2WABA 1LHNA 2JE9A 3PUSA 4M3CA 3WQ0A 4CYDA 3POGA 5A1AA 2HBUA 4YW3A 4QXKA 1QY4A 5DAWA 4EV0A 1RHI1 2E7AA 2RM22 2JDAA 2EAAA 4IV1C 1H6YA 4P9GA 5LEJA 1ND2C 4LO8A 3EB7A 2ZAHA 2N7GA 4Y1ZA 2IC1A 2QQJA 3VL8A 4RQPB 1CPNA 1X8EA 4O7XA 2VY0A 3WNPA 1A8MA 1RUE2 4YVSB 3MIGA 3O1TA 4QPWA 2Q8OA 3OYWB 5FKCA 4N9IA 5FXZA 3VBUB 1JYXA 4GH4A 2O14A 3I2KA 2R062 2P6HA 3P6BA 2R30A 2CWSA 3ME2A 3TNPB 2W47A 3MI8A 1X9PA 4COZA 1R1A2 1FX5A 5IYYA 3EMRA 3QOPA 1QXJA 2WN3A 2ZMKA 4FPOB 4MUVA 4NOTA 4NR1A 4PBPA 4XZPA 5F5CA 4E4ZA 5A1FA 3FLPA 3POSA 2P5BA 4LBQD 4AHYA 1CX1A 3ZM8A 1AJOA 1NX9A 2ZBJA 1UL9A 1OF3A 5ERLA 3MBWA 1GU3A 1GNYA 3GHMA 4S2FA 2IXKA 3POJA 1MS0A 2BGPA 2Z79A 1D4M3 1KD7A 1TMF2 1XXNA 4H14A 4BXSV 5BNQA 1OUXA 3KV9A 1RTVA 1QNWA 3JBG2 3UJQA 4PDWC 1Q5OA 1TNRA 3H7JA 1YLLA 2ZGPA 1DZTA 2CAVA 3EO6A 2B8MA 1WMEA 4LA3A 4LO5B 4IETA 4LLFA 4JGYA 4EQVA 1UNBA 4QXCA 3CLPA 1H8TB 4COVA 2P1BA 4C0HA 1Y7BA 4L99A 2WNUB 3VDCA 1KS4A 4UFHA 1W3VA 2GC2A 3MDPA 3ORJA 4G4FA 4H3WA 4Y22B 3GCXA 4AAXA 1KGYA 1UYZA 2Y6KA 5EPAA 3T30A 2ZX4A 3UT0A 4IXLA 4ISQA 4B4PA 1YIPA 2X5IA 5HV4A 4IV1B 4NO4A 1AR72 3MUZ1 1ND2B 3OTFA 3X29B 1H9WA 4HKWA 4OI2A 4YNIA 2G19A 4XACA 2XLGA 1UXXX 5GZEA 2C24A 4N7UA 4JTNA 2GH2A 4UYBA 3UKVA 4COWA 2TEPA 5A6XA 1O5UA 1RUD1 1AJKA 3W58A 4AQSA 4CP9A 2O0OA 4L92A 5CFCC 1DQ1A 1B09A 4YVWA 1QWRA 4KG8A 4NMIA 4Z8BA 1HRI3 4BH9A 1IZ3A 3OGVA 4E9KA 5A6QA 4QHZA 3U11A 5JOYA 2ORXA 2V73A 2D5HA 1V6MA 2R063 2VR4A 4XFBA 2UWAA 3MIDA 4Y26A 3RG0A 4DXSA 5I8TA 2QDRA 1AVBA 1R1A3 3RZKA 4W65A 4OHWA 1C8NA 1K45A 1LHUA 1URXA 1QJEA 1LJ7A 1UX6A 3TEZA 4M4RA 2ZX3A 3IBMA 4XQDA 1NQJA 3RGBA 2V5DA 4IE0A 1IKPA 2XDVA 4DFSA 2RVAA 4R9DA 3HWJA 1QJX1 1FNYA 4P9YA 5JSOA 1V70A 1NCRC 1TMF3 4PIXA 3PJQA 1UN1A 3QBQA 1OF4A 2VZQA 1XYPA 4KQ7A 4OZOA 4PDWB 4S2DA 3ECQA 4KWKA 4JZRA 2BBAA 3ZFEC 4Y1VA 5JI9A 2ZHNA 2HWF2 2P3KA 4QKBA 4A7KA 3WF0A 5L19A 1BVP1 2ARBA 3VBOC 3HVDA 1UPIA 2J1VA 1B35A 3AM2A 2R32A 3J4UH 5LRRA 4MXVA 1RHI3 4IE4A 1JN2P 4Q8LA 2HEWF 4META 1F9KA 5I0TA 4L9BA 4K6BA 5GLWA 1RVF1 2P3YA 2QDNA 5IAXA 5JZGC 3PUQA 1NLSA 3D82A 5A6ZA 4J25A 5FYTA 5A7SA 1RUD2 2V5YA 2Q30A 5HI0A 1YQ5A 4LIVA 4UW4A 1HQWA 4QM8A 3UKNA 3IWZA 2VE1A 4WM7A 4Q1PA 1TME2 3W9AA 1RUOA 4UW3A 4QMAA 3AZZA 3GBGA 2QZ2A 3MPBA 1M4WA 1Z78A 5EFUA 5CA6A 5JOWA 4CXXA 3PJYA 2C26A 4CPBA 5CFCB 3BTAA 2G9ZA 4Q0QA 4M0HA 3FN9A 5A7QA 5LB6A 1W06A 5F8PA 2YPDA 3NW4A 3ZLIA 3WV6A 3LSEA 2JDNA 3A21A 2AACA 3AL6A 4RR3A 2GP3A 3LAGA 2VMHA 4LOSA 1H2LA 2XWBB 4W6XA 4XUPA 3JU9A 4RHV2 5FY5A 4DZGA 1W28A 3RNSA 3AYDA 1VB2A 2DCYA 4MV2A 1STMA 2AGSA
chains in the Genus database with same CATH topology
1G86A 1RUI1 3UKTA 1W0OA 2F4PA 4IV3C 4J1WA 5ABJC 4KG0A 1WBLA 1NCRB 3A4UA 5FO7B 3P3NA 4HKOA 2H0VA 4LA2A 1AL0G 5CIRA 3ZFEB 1DIWA 3K51A 5T5LA 3PNAA 4IEZA 5CFDA 1RVF2 2VOXA 3NAPA 5A33A 3UJOA 4YM2A 1GSLA 4IEVA 5FRAA 2JG9A 4Q4X2 2G4IA 4WVMA 1KS5A 2ZA9A 4XF1A 3VZMA 4URTA 5JZGB 4XJ9A 4XXAA 5H9RA 4YSFA 4PCRA 4XOGA 3OD0A 1RUF1 1LOAA 1RUD3 3LOIA 1WW5A 2RJLA 3RWNA 1PMIA 5DXDA 3U10A 4Q2FA 2WT1A 1LEMA 1DDLA 4YM1A 2XLFA 1R081 4PIYA 5DUVA 5K0UC 5C9AA 3ZX7A 1V9U1 2RMU1 3H9AA 3JUUA 3M7AA 4DINB 1BK1A 3LSDA 4MXWA 3S7EA 1C5IA 1YWKA 2R1DA 4QT6A 3VZLA 4H7MA 3BB6A 3IIAA 4Q0VA 4LHNA 1RUI2 1WLCA 3AMMA 4HL0A 3MEPA 3KCXA 4BLIA 1CAVA 2D6LX 3ZMNA 1XNDA 2BNMA 5IK8A 1OI6A 4Q27A 5LK7B 1DGRN 1QJX3 4AW7A 1VBC1 1ZBA1 4IV3B 5DZFA 2PQQA 2ZS6B 2ZGUA 5ABJB 1BMV1 2K2SA 1ZM1A 3L2HA 3RI9A 2G9FA 2VUJA 1ZBE1 1DHKB 3AKRA 5F5QA 1J3PA 2LALA 1WW4A 1ZZBA 4XEZA 2CYFA 2NN8A 5FOBB 3T2TA 1S0EA 2WINB 2OZJA 3A0NA 3JD72 4CEYC 1RVF3 4Q29A 1G9FA 1VAKA 5H9QA 1H30A 4GXLA 2D98A 1RUF2 3VN4A 3E97A 1AR61 2P34A 4LUKA 3I2DA 3WP6A 1NE4A 4XIKA 3W59A 3E6BA 1PIV2 2YV8A 3AMPA 3WT3A 3VKOA 4ASLA 2RMU2 1YFUA 3AB0A 3AZYA 3KM5A 4X6QB 1LCLA 3HT1A 1REEA 3RMYA 3ZIWA 1W6OB 3J9SA 2D3RA 3IKWA 2A6ZA 3FFZA 3WNXA 4YZ5A 5JOXA 5CB7A 3M3OA 3MW4A 3VBFC 5IT6A 3AYAA 4AFBA 1JYIA 5C33A 4JGYC 4XJAA 2JXAA 1VBC2 4FOWA 1ZBA2 1GV9A 4N43C 3ES1A 2WWSA 5L36A 1RUI3 1BMV2 5FMOS 3V0AB 3RS6A 4F3JA 1FPN1 1BVVA 1ZBE2 2X5IC 1LOFC 1G6NA 1CPMA 1K5MA 4EWDA 2IWGB 3V0BB 2CGOA 2D6KA 3GZTB 1ONAA 2AUYA 3SCGA 1JYCA 3JCIA 1N3QA 5KXDA 3AXDA 2FMYA 3H1WA 1UIJA 3V65A 1AR62 1Y43B 4JCKA 4CEYB 2WZPP 1PM7A 4YZ4A 2D97A 2CAUA 3WQ7A 1OHFA 4IEYA 4E27A 1RUF3 4N9HA 3PHMA 3V56A 3IDCB 1NE6A 1IOAA 3MIEA 1WW7A 3WQ1A 3VZKA 3AYEA 1R083 3HR9A 3EHKA 4QGMA 1ND3C 2DUOA 2XJPA 5BXXA 4CP1A 1V9U3 2O1QA 2RMU3 4RS5B 2DUPA 1PK6A 2C1FA 3ZSKA 1H8VA 4BMEA 2VVEA 2CWMA 1GZWA 1TQ5A 4YYOA 1WLWA 2D6MA 3VBFB 1ULDA 2GSYA 3WP5A 1AR81 3D0SA 2Q1MA 4XQ4A 5I8SA 4CP2A 4XF9A 4N43B 1VBC3 4HPKB 3ZYPA 4YLZA 4HKLA 1ZBA3 1DQ6A 3SNMA 3WUDA 1A78A 1W2UA 4OLLA 4EN0A 2D3SA 1VBE2 1ZBE3 2XUMA 2ZPXA 2EIGA 2GMPA 5A3MA 3KB5A 4R9BA 3P3PA 1POV1 2VOKA 4I0BA 2D40A 2GC3A 1UIKA 3WINE 2GN3A 2Z42A 4GWMA 1AR63 2A7AA 1XU1A 3LOBA 3DKWA 3NVCA 4ZXKA 3V64A 2TNFA 4H7LA 1O5LA 5L73A 4KH9A 3GZAA 4ISRA 4Q4V2 1DFQA 3LA2A 4XMIA 3D5OA 4XHXA 1C4RA 1I9RA 2Z69A 4AI2A 1ND3B 1GR3A 1LHOA 2WT0A 1R091 5CU1A 1AR82 2ETEA 3OY8A 1QOTA 2P2KA 4WM8C 3VDDA 1NA1C 4KNCA 5F6LB 5K9YA 3SH3A 1OQDA 2WC2A 4LBMA 3UK9A 3WDWA 4OHYA 3WW3A 4DQAA 4E4DX 1FPN3 1TEIA 3DF0A 3QACA 1SCSA 3VBHC 4F83A 4NHMA 3U4XA 3QH7A 1FATA 5C8CC 3U0ZA 2A3WA 4COUA 2ZOEB 4FXGB 3HIFA 4ONUA 5T55A 2CNAA 2IXLA 5EWSA 2BYVE 4LE3A 1UF2C 4XJWA 4AFMA 2DCZA 2XJRA 5GLZA 4JTOA 1MEC1 1ZNPA 1VBD1 3S0MA 1S1AA 4NVPA 3WX5A 2ATFA 4C0BA 4CDXB 2ZGMA 4XETA 4AVVA 3VV1A 2XH6A 4C1XA 3JB8A 1NCQA 1IPJA 4KL1A 4IEXA 3WCSA 4AGGA 3B5LB 1VBA1 1L3JA 1IPKA 1MVQA 2R6QA 2UY9A 1C3HA 1OPOA 4Y24A 2D93A 5FFOC 3SMHA 4AK3A 3DUIA 4N53A 2XL7A 5FREA 1LOEA 3UV9A 4COYA 3WDTA 2R0FA 4TYSA 3THPA 2E63A 1AR83 1PGW2 4WM8B 3KT4A 3URFA 1NA1B 3J26N 3KS7A 4X8PA 1KRIA 1HRV1 5L7OC 1WLDA 3B00A 2C0ZA 3IPVB 3G7DA 1ENQA 2AR6A 4YG6A 3CJIA 2XBO1 4Q4Y1 2EA7A 1RJ8A 4ES8A 2YMZA 4SLIA 3VBHB 3GF6A 4R4ZA 2DFCA 3ATGA 3EXUA 5KHKA 5C8CB 1MEC2 1VBD2 1S0BA 4PLNA 2XVGA 3B02A 1POV3 3ZFGA 2BNOA 3OBTA 3MFCA 5CVRA 1JUHA 2WQZC 3IMNA 1QH6A 1A6CA 3MIBA 2DUQA 3MLKA 1W6NA 4QD2A 3ELNA 1VBA2 3AZWA 2IFRA 3GALA 1COV1 1QKQA 3B9IA 3FJSA 1ENXA 4TLFA 2YROA 5CADA 1R093 4L2NA 2RS32 2UURA 4DB5A 2X8KA 4CDQA 1O4TA 1VB4A 4GB32 1SLAA 1GZCA 2CTVA 1Z7S1 2RS12 1NLRA 1TE1B 3B3QE 1MS1A 3IN9A 1FV3A 4KBBA 5DDJ1 1W6QA 1DU3D 3QH6A 4F8AA 1EPZA 2DVBA 3JQWA 3VHPA 2YXSA 5L7OB 1SFNA 1WLTA 4PLMA 1S0FA 3I8TA 4RA0A 4DRRA 2D6OX 3ZIXA 1FOD1 4FP3A 3RRDA 1QMJA 1OOPC 3WW2A 4GALA 4CDUC 4Z92B 2DCKA 4AHZA 1LESA 2WSUA 3M2MA 5E1RA 3N3HA 1MEC3 1VBD3 3SLIA 1KDMA 4GA9A 1LR5A 1XYOA 1N1YA 1YUDA 3ZN6A 1COV2 5J96B 5GZGA 4IQPA 2VULA 1QH7A 3T1LA 3I59A 4BM8A 3WDYA 1ZRRA 1PVXA 3DPRA 2D3PA 5ACA1 4MVTA 1VBA3 3OCPA 1J58A 1LGCA 2KXLA 1Z7S2 3PVEA 4IL7A 4BIOA 1MS5A 2W68A 1J3QA 1VRH1 1PO11 2PFWA 3M3EA 2WFPA 1QJU1 3ENRA 3IM0A 2ERFA 3FFQA 4K7JA 3THTA 3PVNA 1QGLA 4YW5A 1PZ7A 2VECA 3NKGA 2ET7A 4BCUA 1A3KA 4B8EA 4AHWA 5FQ0A 2WNVA 4NWVA 2GNMA 1WUVA 4LO4B 2Y38A 5BNOA 2XHKA 4EN7B 4FAGA 2XBO3 4Q4Y3 1U0AA 1Q56A 1CAUB 4ASMB 2VVDA 3VBOA 1BBT1 1UD1A 3WCRA 4DY3A 1OOPB 2NMNA 4CDUB 5D8AC 1DGWA 4BPZA 1C1LA 2BBVA 1Q8VA 5CG9A 1X50A 4DS0A 4AI1A 4FPYA 2XLAA 1VALA 1KFUL 5GKAC 3WW4A 1PNGA 1HRI2 4D69A 3O14A 3VBRB 2OUHA 3MW2A 2D43A 3FBYA 4L11A 3CF6E 4ATFA 4HVOA 3LCPA 1OMIA 1S0GA 1COV3 1VRH2 2K0GA 4KGQA 2WJSA 2DU1A 5KXCA 4R9CA 5B2GB 2NM1A 1W6PA 4RL7A 4LBQA 3AFKA 4L97A 2E53A 2A70A 2GDFA 1KQRA 2QNKA 2R0HA 4G9SB 1Z7S3 2PHFA 3CL1A 3RZZA 1FT9A 1AUYA 3OD4A 4XPVA 3AP6A 3D6EA 5DDJ3 1SBDA 4OHZA 3USUA 4LULA 2BEOA 2BFUS 2UY8A 1YXWA 4XQWA 1ASJ1 4XFFA 3ZFFA 2ES3A 4YM0A 5BNNC 3AP9A 1BBT2 1JW6A 2EALA 1RHI2 1SBEA 2HWD1 4JVAA 5HXVA 4CEWB 1FOD3 3WVJA 1W6MA 4XBNA 2E7TA 3H8UA 4ZU5A 3VKMA 3HD8B 4QM9A 5D8AB 1POV0 1N3OA 5JIAA 4XYXA 3M3IA 1KJLA 4HZFA 3ZYRA 2HKXA 4PQ9A 5FO9B 1MQTA 4XBLA 4HN0A 2YUEA 4HFSA 2Y26A 3M8LA 4U2AA 4BIFA 4WBBA 5ACA3 4V1PA 2JG8A 3JB4C 3RSJA 3N7JA 4JRAA 5T5OA 5JR7B 3H50A 4MGIE 1VRH3 1PO13 1UU4A 2PN5A 1QJU3 3IDEA 1YRZA 3AMQA 3TNQA 1V6LA 2VXRA 5DG1A 2WSVA 5J37A 1ASJ2 1LGNA 3RJ2X 4AWDA 1ZZ8A 3B69A 1H2KA 1XQNA 2VQAA 3ZN4A 5IK7A 1D4VB 5E8AA 2Q4SA 2EXKA 1YFWA 1ZX5A 2HWD2 2I2SA 4AI0A 5T3NA 5BY5A 4AQ6A 5BNNB 1IS3A 4XBQA 1RJ7A 4RFT0 5JWPA 2ZAAA 1MZ6A 1BBT3 2XB6C 3VZNA 5HCBA 3WW1A 2W0XA 1RUNA 4I3GA 4OI4A 1S0IA 2NLRA 1XRUA 2IXJA 4FPGA 2A3YA 4FOVA 1GLHA 1GANA 1AX0A 4OHXA 1PGL1 2WL1A 3NSTA 3ZXLA 3OJBA 1C8M1 2B46X 4HN1A 1VR3A 4RGAA 2XL9A 3MICA 4ZU4A 2GH8A 1XNCA 3RQ0A 2HWC1 3O0WA 3POYA 1QJX2 2GC0A 5JI7A 1CONA 4FTEA 1H2NA 2TUNA 5DZEA 4CZSA 1LENA 1ASJ3 2VOVA 2HEYF 1BYHA 1GQHA 4UXAA 2F6BA 2HWD3 1QOSA 4K1YA 4I01A 3VBSC 1CGPA 1S2BA 1REFA 3LB9A 3RYPA 4NHLA 5GM0A 2KA3A 3RDIA 1SQ4A 4N90A 1SCRA 3TB0A 5F6KA 4Q26A 3RPQA 4XE9A 3MF6A 4AGVA 2VNGA 3ILRA 2FQPA 2JX9A 3ZN5A 1PGL2 2EVXA 5SV8A 1V6NA 3OBRA 3AJZA 1C8M2 2FMDA 3SH5A 2XJVA 4LE4A 1OSGA 5I93A 2O8QA 4R8HA 2A6XA 3D0JA 3ROUA 4JGZA 2UYBA 3FZ3A 3BIWE 4AHXA 2HWC2 2UU8A 1XNBA 4RD7A 2WNVC 3WR0A 3MYXA 1N1SA 1YJKA 5BNOC 4DXZA 4ORFA 4GULA 4M3CE 3E5UA 5GZFA 1DQ2A 1Z0HA 1HQLA 4MGYE 4KWJA 3N7LA 1ZZCA 2UYAA 2YHJA 3OGJA 3H7YA 4GKXA 4OI0A 4LBOA 2DVFA 5J7MA 3MW3A 1ULFA 2VQ0A 3ZXJA 2ZGNA 4RGGA 1WCDJ 3AP5A 1ULEA 5EV7A 1VAVA 1J59A 3VBSB 4XTPA 4JDNA 2PHUA 4GH4C 3WG1A 5A32A 2JECA 3DN7A 4LNVA 2QCSB 5AFBA 3RI8A 1NXMA 1NY71 3AXEA 5K8SA 4E2GA 1TNFA 3I7DA 2NPIA 4SBVA 2A6WA 1R082 2JDZA 1NXD1 3VLBB 1V9U2 3VKLA 4J6GA 1MS8A 1GKBA 1SLTA 3L9JT 1O4YA 1C8M3 3BU7A 5K0UB 3B9CA 4MGKE 4Y4YA 3CEWA 4GKYA 3HT2A 1CAXB 2WNVB 3ZFFC 2BWAA 1D0GA 1H1AA 2ZGQA 2HWC3 4PBOA 5BNPA 1V00A 2D5FA 3R4DB 5C4WA 1PHMA 1S2KA 4QPGA 4D94A 5FCCA 4M3CB 1UPSA 1WBFA 1DQ4A 2OVUA 4WVVA 3TN91 4I2OA 1M06G 4LO6B 3LA7A 4P9JA 1IQAA 1AXKA 1ENRA 3CNAA 5FLHA 4BA6A 5GLTA 1QDOA 1MZ5A 4XXPA 1AX2A 1G9CA 3HAGA 4QQ2A 4YVWC 4L8QA 4PJYA 3S6PA 5J09A 2XKOA 4GH4B 2JENA 1CAWA 3PMEA 1Y3TA 2NYYA 4A7ZA 3O7OA 4BLJA 4Y20A 4P9WA 2GNDA 2B42B 1LU1A 4Q0UA 2DTYA 2ZGLA 2YGMA 1Q43A 1YIFA 4QHBA 3ZXEA 1GQGA 2BVVA 4FPFA 2XWJB 1FAYA 4QPIA 2LM3A 4AEDA 5KHHA 4FOYA 4CP0A 4FPKA 1QOOA 4W6YA 5I0UA 2BWCA 2ZMLA 1H9PA 4JGYB 4OVEA 3TN92 2TBVA 1FPN2 3ZYJB 1B35C 2LTNA 2XG3A 3ZXAC 4B7KA 1EY2A 2PHDA 2B5HA 4OHVA 4RQPA 1O91A 2O8OA 4DRVA 4YVSA 1IS4A 2X5IB 3WD5A 3ETQA 4UBHA 1NZCA 3OYWA 5BUVA 1RMU1 1N47A 3VBUA 4YGBA 2PELA 1F5FA 3E6DA 4WM7C 1REDA 1OA4A 2PHTA 4S2HA 4HT1T 1HLCA 3C3VA 3VHRA 2HJIA 3WP3A 4CDWA 4YVWB 1G9AA 2RR11 1H1MA 2P17A 2WA4A 5F9TA 3Q9OA 1CX4A 5FO8B 3OGGA 4AI3A 4QGNA 1I6XA 5FDBA 3N4MA 5C6CA 3TYJA 3GBFA 4RR3C 1RUH1 3B01A 1O7FA 4MYEA 5GLVA 4A3XA 1U12A 4I02A 2DVGA 4ES9A 2IFWA 3H3ZA 4XIOA 1H8TA 4KGGA 2NQYA 1QHDA 4K8FA 2WNUA 1AXYA 3K48A 1JHNA 4Y22A 2WT2A 5CFDC 3NAPC 4FXKB 2FZ1A 1WD4A 2JKBA 4IV1A 3ZXKA 1S55A 1ND2A 1B35B 4ZU7A 2JG9C 2R16A 3TN93 2E9QA 2XKPA 1RMU2 3L2YA 3LA3A 4BYYA 2IZWA 1YHFA 2D7FA 3AFGA 3WHUA 1HW5A 3GYDA 1IS5A 3WDUA 2I07B 2GMEA 2ZCWA 4JQRA 4B29A 4WM7B 4CRQA 5EYYA 1WW6A 2WLPA 3VL9A 2XJTA 1R1ZA 5C9AC 1IKQA 4JGZC 2I74A 3MIHA 1RUH2 4ITCA 1VP6A 3RMXA 5E89A 4XF4A 1DBNA 4FBFA 4JDMA 4LBKA 5CG8A 3BPZA 5C8WA 4RR3B 4RSUA 4AFDA 1R092 1W39A 1GNZA 2YY1A 3CU7A 4PDWA 4Q0SA 2NP0A 3G6JB 4HK9A 3HN1A 1ZRDA 4R9AA 1N3PA 1OLRA 1QU0A 3MLJA 2MPFA 2ZGOA 4K3UA 1RINA 3R05A 5AFEA 4OUMA 2PHLA 1XE7A 2OIIA 1G7YA 5CFDB 2Q5TA 3NAPB 5A33B 2DCTA 1QDCA 4XFCA 2R041 3VKNA 1YFXA 4PLOA 2JG9B 4WVMB 2VMIA 4OI1A 4D7TA 1IS6A 3NV4A 2HWB1 1NG0A 3DV8A 3TRSB 1H4GA 1RMU3 4I0AA 4HLTA 4A2UA 3DL3A 3EQEA 3FUQA 4KU8A 1OKQA 4WZFA 4BE3A 5CFCA 4D7SA 4YZ3A 4EROA 3E6CC 1FV2A 1EP0A 2P37A 1FMD1 1HKDA 4EWAA 3ALQA 4TWTA 2B45X 5FAXA 2RR13 5IK5A 4IEUA 1YI9A 5C9AB 1N1TA 5KC6A 1DGLA 4MXWB 2BUKA 2W39A 1J1LA 1PGSA 1RUH3 4FO9A 3LWCA 5J98B 4X8NA 3B7MA 5FOJB 5JMCA 1NCRA 1CAVB 3S7IA 1EAH1 2DVDA 4YG3A 1CN1A 1EYBA 3ZFEA 3BCWA 4FPLA 1K5MC 4YW4A 3MIFA 4K1ZA 2ZHKA 2ZGKA 4JC1A 5I0RA 2VUAA 3A0KA 1BJQA 1HRV2 2BGCA 4LLOA 2XJSA 2A73B 2R042 2FZ2A 4O9GA 4DMIA 5JZGA 2HWB2 1MS4A 2UWBA 2QKDA 1LECA 2ZHLA 4TSVA 4Z2WA 2XBO2 1YNAA 4Q4Y2 1CIWA 4FTBA 2WFF1 1Q8OA 1LOGA 1VIWB 4FQZA 2AENA 2VNOA 4FQ4A 1FMD2 3FE5A 2ZKNA 1OFNA 1XYNA 4I30A 4K20A 4YG0A 1HV0A 5DUXA 1RITA 1MACA 3TBDA 4I0WB 4YARA 1G9BA 5K7PA 4QQLA 2KM2A 2H6BA 3CO2A 4R4XA 4F7ZA 4AEDC 3BODA 1PK6C 5LRSA 3WG2A 5KHGA 2X53S 1QQP1 5GLUA 1JXNA 1MS9A 3RYRA 2C5DA 1AHSA 4Z82A 1QF3A 3EBRA 4BMBA 2VNRA 1EAH2 2E51A 4KU7A 4ATEA 4IV3A 1SLLA 3SXWA 5ABJA 2A71A 4NWWA 2GNBA 1UU5A 1LODA 2AH2A 3ZXDA 3OF1A 2RM21 1AXZA 2JE7A 5DDJ2 1K5MB 4QU2A 3E5XA 4PIZA 3N7KA 2MEV1 2R071 1RUE1 1UAIA 1HRV3 2R043 4MH0E 4CDWC 1FOD2 3TAYA 4FPJA 1H2MA 1X82A 2QZ3A 2YDEA 2HWB3 5IUQA 3ZMOA 2PAMA 1LKNA 3U07A 2B39A 4YGEA 1I1EA 3BALA 2ET1A 3ILNA 3H1MA 2GN7A 1FMD3 4M0NA 1W6OA 2CGNA 4YGDA 1ULGA 1WCSA 4LTAA 2DFBA 1QQP2 3FWEA 2YPJA 3QLQA 3MFAA 1QJY1 5I8YA 1LEDA 4XJ8A 1PO21 2CY6A 1AR91 2C9AA 3JBG1 1PK6B 4XFGA 2DV9A 3O0XA 1H8TC 5TSWA 2GNTA 5ACA2 4IEOA 2WNUC 3N36A 1GZWB 3VDDC 2HYKA 3VHOA 4AFCA 2BPA2 3V0AA 1QXPA 1OLQA 1AF9A 1WA4A 1PO12 1DZRA 4OZXA 4B3NA 1QJU2 1RL3A 1CJPA 4X6RB 3V0BA 1EAH3 1FXZA 3H3UA 1XE8A 2P3IA 1D2QA 1OA3A 4Y5Z0 2E7QA 4OULA 4FTSA 1NYWA 2MEV2 2R072 3VKFC 1AR71 3WY6A 3NO8A 3RYKA 1UW8A 4U36A 5H9SA 3WOGA 4AVAA 4YW1A 4CEYA 1D0HA 1SEFA 3QCWA