5FUPA

Crystal structure of human jarid1b in complex with 2-oxoglutarate.
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
463
structure length
454
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
publication title Structural Analysis of Human Kdm5B Guides Histone Demethylase Inhibitor Development.
pubmed doi rcsb
source organism Homo sapiens
total genus 142
structure length 454
sequence length 463
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fupA01
5FYIA 3AL5A 5FY0A 2YU1A 5FPUA 2GP5A 5IWFA 5FPBA 4BISA 5CEHA 2Q8CA 4UF0A 3K3OA 2YBPA 5FP3A 5IVYA 3KVAA 5FZLA 3N9LA 3PUSA 5FXVA 5FZOA 4IGOA 2OS2A 5F5IA 4BU2A 5F32A 5FP4A 5FJKA 5FZOB 4CCMA 5FJHA 5FY4A 5A7PA 5FYVA 4CCJA 5FP8A 4QXCA 5FWEA 4IGPA 5FZHA 3ZLIA 4CCOA 5FZ1A 5FYMA 4D6RA 5IVEA 3AVSA 4HONA 2OQ6A 5FZKA 4TN7A 5FY5A 5A7NA 3KV6A 5A7WA 5FZGA 3N9NA 5FWJA 3OPTA 4LXLA 4DIQA 4GJYA 5FYHA 3K2OA 5F5CA 4CUGA 5FZ0A 4URAA 4GD4A 2XDVA 5FV3A 5A1FA 5FZFA 5F2WA 4C8DA 5FZCA 5F3CA 5FZ9A 4DO0A 4ASKA 4UF0B 2PXJA 5FUNA 4E4HA 4EYUA 5FYZA 5A3WA 5ISLA 2P5BA 5FXXA 3PU8A 5E6HA 4IGQA 3KV4A 5F37A 4NUBA 4QU1A 2YPDA 5FPVA 5FY1A 5LY1A 5FP7A 4BXFA 5A1LA 4V2VA 4HOOA 5K4LA 2WWUA 2GP3A 4GJZA 5F5AA 3NJYA 5IVVA 3PUAA 3KVBA 4EZ4A 5A7WB 5F2SA 5IVJA 3DXTA 4LITA 4CCKA 5F39A 5A7OA 4EZHA 5ANQA 4XDPA 5FYSA 2W2IA 5IW0A 5LW9A 4Y4RA 2XMLA 5FYTA 5FZBA 3AVRA 1VRBA 5IVFA 3N9PA 2VD7A 4Y33A 5FZ6A 5FY7A 5FUPA 4CCNA 3PURA 3KV9A 5FYCA 5F3IA 5FZAA 5A3NA 3PTRB 2OQ7A 5FYYA 2XXZA 4LIUA 5FPLA 3K3NA 5F3GA 3PUQA 4AAPA 5FZEA 5IVCA 4LIVA 5FZIA 5LWBA 3AL6A 4QXHA 5A80A 5FZ4A 3LD8A 3N9MA 5A7SA 2YBSA 5FZ3A 4AI9A 4D6SA 3N9QA 4XDOA 5FBJA 5FP9A 5FZ7A 2Q8EA 5FYUA 5FZMA 5A7QA 5FPAA 5FXZA 5KR7A 4QWNA 4GAZA 5FZ8A 3PU3A 2OT7A 5A3PA 2OX0A 2YBKA 3PDQA 4Y3OA 5FXWA 3U78A 2WWJA 3OPWA 5LY2A 5FY8A 2Q8DA 2YU2A 3RVHA 3KV5A 3N9OA 5IVBA 4QX7A 3LDBA 4QX8A 4D6QA 4QXBA 3DXUA 3ZPOA 5FYBA 5A3TA 5F3EA 3UYJA 4CSWA 5FZDA 2XUEA 3U4SA 4CCLA 4V2WA 5FY9A
chains in the Genus database with same CATH superfamily
4ATEA 3AL5A 4XACA 4QQHA 4F3JA 4A45A 2Q8CA 2I45A 1CAXB 4UF0A 2GC0A 4C0BA 2WC2A 4HVOA 4YLZA 5FXVA 3ZFFB 5ABJC 3DUIA 1S0IA 2JEMA 3MIBA 2D5HA 4D7SA 3AXDA 2DUPA 3NNJA 4DPNA 2JKXA 3ZXEA 4UW6A 1RUI1 1FI2A 1Z78A 3SCGA 2Y6KA 2HWD1 2P3IA 1PX3A 1ND2C 1RUF3 4ARYA 1YQCA 4D6RA 3O0VA 4C91A 4MGTA 1MVEA 5FMDA 3W59A 1JYVA 1XNCA 2BGPA 3LDKA 2E7TA 4AFAA 1NA1C 4DIQA 5A70A 1FYUA 4Q4X2 5CFDB 5DG2A 4ES8A 1PO21 3FN9A 1PGW1 2BNNA 5FBZA 5FV3A 1ALYA 4MGYE 3DGTA 5DUUA 4Q5OA 2ZX2A 4QD2A 2ARBA 5DUWA 4E4HA 1O6UA 2HWE3 5FYZA 3DEMA 3I2IA 2QUOA 4YGBA 4EN9B 2GC2A 3GGLA 3CKHA 4E8DA 4RHV1 4XBLA 3VBUB 1CIYA 1W2OA 2HYKA 2JE8A 2P3KA 3FHAA 1N1TA 4IE7A 4H2AA 2CAVA 3ECQA 5FY1A 5H9PA 3ZIWA 2WO7A 5FP7A 4BXSV 4LTAA 1GNZA 4QHOA 1PMJX 4ZU5A 4AQTA 4N7UA 2B9VA 4E2GA 4GJZA 2GMPA 4LHNA 4KL1A 1QHDA 3AK0A 5T5OA 4OQ9A 3PMEA 5JSRA 2CGPA 4PT6A 1OD5A 4YW6A 2TBVA 3ZN5A 3N7MA 1W8HA 2BBVA 4Y4RA 2XMLA 3VLBB 2ILMA 1AL22 1OLQA 4FXGB 1D4M2 2IXIA 3H1MA 3LB9A 2PHFA 4W4ZA 5KHIA 2WKKA 3JBG3 5IFPA 2YYOA 4PQ9A 3GHNA 2CDOA 4NRPA 4R4ZA 2HEYF 3HNMA 5FZAA 1MACA 2TEPA 4XZUG 5DAPA 5JSOA 1ND2A 1VBC3 2XXZA 5BNNB 5IAXA 1AYN1 1XU2A 1PO13 3I3BA 3K51A 2DYCA 4AAPA 1ASJ2 1CPNA 1XU1A 4GIQA 4MO3M 4AVTA 1Q43A 1OOPC 2D3SA 1YXWA 1NA1A 4M3CA 3SKVA 1WMEA 4R4XA 4XBNA 2C5DA 2Y0IA 3GNEA 3ATGA 2Q8EA 2OPKA 4YW4A 3MIEA 5A3UA 4IV1B 4HG6B 4QWNA 4HMZA 3WDWA 2A7AA 3OD0A 1W9FA 3C7FA 1ZBA3 1QOOA 4LHLA 3ZDSA 4FTEA 1UY0A 5KHHA 4Q4Y3 5EFUA 1PZ7A 2W92A 3B9IA 4BZ4A 2N7GA 4YVWC 1NAEA 1H30A 3J8F2 2VTXJ 3WQ7A 4QPIC 1AUYA 5FDBA 1HQLA 2P3YA 5LATA 2YMZA 1QNYA 1UZWA 3CJXA 4OI2A 2WSUA 1HN0A 4CCLA 3PJYA 1H2MA 4XJWA 4IW3A 4MGSA 3M1HA 1DZTA 2R0FA 4FPJA 5IAVA 3N7JA 4WZCA 4JDMA 1H6YA 3LEIA 1W3XA 3ZOIA 5CKNA 2PHDA 4MGKE 4AFMA 5DZEA 2ZOEB 3BTAA 5F32A 4QQOA 4YZ5A 4LUMA 2BDRA 2Z42A 2Q1FA 3ZXJA 4LOTA 2L9LA 4AGVA 1BBT1 1JYTA 3ITQA 2FDGA 4XFHA 3UL2A 4YARA 3MW2A 2OUJA 5LRSA 4ZHNA 4KU8A 2DBIA 4NIGA 2DVFA 2R1DA 4MADA 4QPGC 1G9FA 4UFLA 4ZXEA 1WMXA 4OUEA 4XFGA 4EROA 2PHRA 3WHTA 5IVBA 1QXPA 1VALA 1HB1A 1W6PA 2GAUA 2QDNA 1GU3A 2XJPA 3K2OA 4XHXA 3BU0A 3IIAA 5FOJB 5HI0A 4XOGA 2WS91 1XC6A 4GD4A 1UYYA 2HWC2 2Z69A 5EYXA 3SC7X 1R092 5CKQA 1O5LA 4DXRA 3RZHA 4XMIA 5K9YA 3NAPB 4XF1A 2R16A 4HKOA 5G05L 4ET7A 5L73A 2JG8B 3MHZA 3OPZA 5F6KA 2P5BA 3GBFA 5GZCA 2ZX1A 3IB3A 1UAIA 3EB7A 3R05A 3FMGA 4NUBA 4OI4A 1MEC1 4YVWA 5BNPC 1J59A 5K0UA 3RJRA 2RS13 3J7HA 4FCAA 4QPIA 2B8MA 1FV3A 4Y22B 4E4ZA 4NVPA 2XVGA 3NJYA 1PVC1 2EVXA 3VL9A 3HMYA 2VPVA 4EWEA 3AP5A 1UMHA 4XW3A 1REEA 1RIRA 1UY1A 1ZA4A 2HBTA 1RXGA 2WSVA 2F17A 2WZR2 3KT7A 2JWPA 3WW2A 4BWOA 5LW9A 5JOYA 4P14A 1RGSA 1RUE3 1ULPA 4CEWC 2QQMA 3ILFA 1F35A 1Y4WA 2DVAA 2HLEA 4NN0A 4AHXA 5FZ6A 1ZRCA 4QQPA 4ZKTB 1NOVA 2WT0A 4OHXA 4O65A 2R7EB 3TN92 1JMUB 5LBFA 3D3AA 2Y26A 4UFHA 1UY2A 4KI5M 5FZEA 2ZA9A 4QPGA 2BW8A 1N3PA 1QQP2 2AH2A 2GSYA 4PJYA 2RDQA 5J48A 1XRUA 2WLQA 2DBNA 1NCRC 1ONAA 4RQPB 1WBFA 1RUG3 1C4RA 3VHRA 3S7EA 1SPPA 5HCBA 1L3JA 4EQVA 1AXZA 4HANA 4DNYA 2VQ0A 1OF4A 1DP0A 3AXEA 3U07A 3SCHA 3U1XA 3RJ2X 4EN8B 1W6QA 3CU7A 2ZKNA 2HKXA 4IETA 4BQ1A 5KC6A 4XAEA 1MS4A 3TNPB 5A3PA 5LEKA 1GP6A 2G4IA 1RHI2 5IK4A 2YBKA 3THDA 5BNPA 4WBBA 1NZCA 3HEIA 1AL0G 4G4FA 4P9LA 2EICA 3RPQA 4QX7A 1UOJA 1VRH1 1YQ2A 3L2YA 3UETA 1V6JA 2WYFA 5DZFA 4WM8C 3EXUA 3AMHA 2QNKA 4XTMA 3E5UA 3E5QA 5T54A 3KD4A 3KF5A 4YW5A 5IWFA 3WUCA 1POV1 3CF6E 5FZLA 4WM7B 4F7ZA 5D8AC 1HB2A 4CEWA 3KB5A 4QKFA 2YC2A 4UWDA 1A34A 4QGMA 4B3NA 1XE7A 2VQUA 4Q29A 2LW8A 3VBRB 2ET1A 2I07B 1JH5A 1OA3A 3LF7A 3WDTA 3A4UA 4CZSA 1MQTC 2FQPA 4UXAA 5AVPA 3VZMA 3H8RA 1AR81 5JDBA 2XBO2 2LRPA 3FL7A 3ZXGA 4BQXA 4COZA 2DWRA 3OOXA 1RUOA 4MH0E 1OA4A 3HIFA 1E5IA 1R1A1 4EN7B 1R1ZA 4M3CF 3OUIA 1NY71 1ZRIA 3MUZ1 4LXLA 4I0AA 4HVRA 3B9CA 4XFAA 1QDOA 4CUGA 3I2HA 5FZ0A 5C3QA 1KEXA 4OHZA 2ZGMA 3BKZA 3QOPA 3AJYA 4MV2A 4DO0A 1OT5A 4Q4X1 3B7MA 4UF0B 5FUNA 4K7JA 5FFOC 4A7YA 2XLFA 4GH4C 4U36A 4AVSA 4X8PA 1NUKA 5E6HA 5KXCA 3JZVA 1ND3C 5JPNB 3M3OA 1X9TA 4GALA 4Y5Z0 4GA9A 1VBE2 5T50A 3C7HA 2WWSA 1EPZA 5EXOA 3AFGA 1FMD3 4FPOB 5FPZA 3VKFC 1SLIA 3N36A 5I0SA 1MS9A 4TXWA 2PAKA 4WM8A 2P37A 1U5YA 3I3EA 4DRRA 4LBQD 3I2OA 3NQHA 3P6BA 4KWJA 4PF5A 1CAWA 1F5FA 2YPJA 3FUOA 4JGZC 1YO8A 4KQ7A 1DQ0A 4QX0A 4B7KA 1OUSA 3CDZB 5A32A 1IKQA 4RL7A 1OKQA 2YUEA 5ANQA 4ASMB 4BQ4A 4D8MA 5D8AA 1H1IA 4DY3A 1Y7BA 1XSQA 2RDSA 1SDWA 4QHBA 1H0BA 5LASA 1VPHA 2IFRA 4GKXA 1QJU3 4GB33 4PI2A 3SH3A 3TWIA 4BIFA 4QT6A 2NQYA 5TSWA 2XJSA 1QJX3 1MQTA 2O0OA 4WVMA 1D4M1 2AENA 3OUHA 3PTRB 3M3CA 1KITA 1NZIA 3K3NA 2EALA 3WDYA 2W87A 1JYWA 4GMP3 1QNWA 1E5RA 2E31A 2MEV1 1A6CA 3AL6A 2B42B 1EYBA 3J7MA 3AZZA 4QXHA 1S1AA 4XUQA 5GLZA 3THTA 2IVIB 4XIOA 4A6SA 3S6PA 1RUF2 1LGBA 1SFPA 2UY8A 4O9EA 4BQYA 5HXMA 1ASJ1 1AX0A 2HH9A 2BWCA 1HRV3 4JTOA 2VZTA 5AFBA 3FHQA 2E53A 1U5IA 2VE1A 4XXAA 2JICA 1IZ3A 1XPWA 5H9QA 3QBQA 4GH4A 4AVBA 2IFWA 2QQOA 1ULOA 4XQ4A 2EIGA 5ACA2 5IT6A 3ST7A 3PDQA 2RS52 3FX3A 1MS5A 2IXLA 1ND3A 3W21A 5ABJB 4NPLA 2QE3A 5DMYA 3I2GA 2ZGNA 5FY8A 2V72A 1VBD3 2HWE2 2RHPA 4AFBA 1CIWA 4NIDA 3OTFA 2YV8A 2XVLA 5D1IA 1WMFA 5F3EA 2AREA 2VMEA 3N4MA 4YG6A 1ND2B 3B00A 3J8F1 4Q4W3 3LWCA 3UKNA 1WGPA 2RDRA 4IV3C 4JGZA 1RUH2 3SITA 4NROA 1NA1B 4P9GA 5CA6A 2ZGUA 5BYNA 2VZRA 2BZDA 2NPIA 3GHMA 2E33A 2HWF1 2WO3A 1WW5A 3ETPA 1GZ9A 3I8TA 3MZHA 3D4KA 1HXS1 1RUJ2 2A1XA 5FLIA 2SLIA 1HB3A 2J1TA 4EWDA 2VZVA 2TNFA 3BI3A 4FVVA 2FD8A 1ODNA 4JRAA 5IVEA 3AX4A 5FKBA 3JBG2 2CYFA 2PA7A 3C7EA 3ZSLA 4BMBA 2PHXA 4YRDA 5FLHA 3WG2A 4HL0A 4CU7A 5ERLA 3POWA 3LFMA 5GLVA 3ZXAC 4FPHA 3H9AA 1D2QA 4NIHA 3HNYM 2VC9A 4GJYA 2WAOA 2GN3A 2DCJA 2P3JA 4HKLA 5F3CA 2JX9A 2F4PA 1ULDA 4CDWC 2Q4SA 1OQDA 2VOTA 3A0NA 3NSTA 3PVEA 1JXNA 2HWC1 1GICA 4LBLA 1R081 4OMDA 4NPMA 4HBNA 4LR4A 2C9KA 4FFFA 4ARXA 1T6GC 1H6XA 3AM2A 1KJRA 1KD7A 2WFPA 3P5BA 1XNTA 4LBMA 5FPVA 3MLJA 1X33A 3T1LA 2YZ4A 1VIWB 5DAVA 3B94A 4AHWA 1QJZA 5AC93 2WN2A 3SHRA 3M70A 2GP3A 1PGW2 3PUAA 5I0DA 4IV3A 2Y60A 4P5YA 3USSA 1W04A 5FMOL 4I01A 3RMYA 4IEQA 1W6PB 4BQWA 1BMV2 3H3ZA 1QY4A 1UL9A 3EO6A 3OF1A 1HDKA 4FPLA 3O1OA 5DG1A 1FPN1 1GSLA 5FYTA 3NW4A 5FZBA 4ZPIA 3SNMA 4Y1UA 3EMRA 1GQPA 3NL1A 1DCSA 3A21A 3QD6A 4RS5C 5GM0A 4AVCA 5C7GA 1LKNA 4M4PA 2DCTA 3AP4A 2WFF2 3IDCB 3MFAA 1UYZA 2LROA 1TG7A 3S5QA 3ZXLA 3VDDC 4YVWB 2R49A 1QEXA 4XFCA 1UMIA 4QPIB 4BIOA 1UIKA 2VM9A 2XJQA 3TN91 4HN0A 5B2GB 5CADA 2YGMA 4IV1A 4QDSA 5EIYB 1KJLA 1XNAA 4QB2A 2BBAA 4M0HA 2NM1A 4CDWA 1OI6A 3POJA 2YGLA 1LEDA 2ZEXA 4META 2JENA 2OYZA 3W20A 2V4AA 4RFT0 5F8PA 2JE9A 4Y3OA 1LU1A 3OPWA 3AKTA 1UXXX 4QKNA 4W50A 3B93A 1OC1A 3RVHA 2YU2A 3JCIA 4CUAA 2HJIA 1RHI1 2MPFA 1PMIA 2XLAA 3UNPA 5IK7A 3TOJA 3J7LA 1LHWA 5DAQA 2ZZQA 1J3QA 2XR4A 3LGRA 1W8WA 1TMF3 4QPGB 1S2EA 4QM9A 4D94A 4L92A 1D0GA 1D2SA 3ZFGC 1ZA7A 2WQ8A 4H55A 4OHYA 2OIIA 4J1WA 1QXJA 1SPPB 1SQ4A 3PUSA 1LOEA 4FI9A 5C70A 2WZEA 2QQUA 2XJTA 5F5IA 2FDFA 1EY2A 4BM8A 3T30A 3T09A 4FO9A 3D8CA 1W6QB 1QWRA 2VXJA 5FP8A 5FWEA 2VOXA 2DFBA 1BZWA 3E6DA 3ZLIA 3SMHA 1ACCA 3OGSA 5FYMA 3VDDA 5BNPB 1ZZCA 5FCCA 5C5TA 2BVBA 4ZU4A 2CDPA 3I49A 4CCDA 3FE5A 2VBBA 2XBO1 2C1FA 2J7MA 1IPKA 2VOKA 1MS1A 4Q0QA 1ZYBA 4ZS2A 3NV3A 4YG0A 2JXAA 2ZACA 4UAPA 2ZZJA 1HRI3 3KS7A 4LMFA 5FZFA 3UGFA 5A1FA 4JGYC 4PI0A 5IYYA 1E5SA 4LOSA 3HJRA 1GWMA 1BBT2 2ZX4A 1CQ9A 2EXIA 5FR3A 5KHGA 2ZX3A 4IEZA 3SEPA 4CEWB 3T2TA 2PHWA 5CZKA 4YM2A 4EWAA 3PVBB 2IC1A 2B9UA 5LY1A 5DABA 2XVKA 1PNGA 1V9U1 1POV0 5FTTC 3AYAA 3AKPA 1VBE1 3URFA 1YC61 4PBPA 2W68A 4GQ7A 1URXA 5JXIA 1L7QA 1T2XA 3CZUA 3NMBA 3O5SA 5G04L 5C4WC 3BTXA 5F39A 4EZHA 1KFXL 1NCRB 1VP6A 3ZFGA 3HR9A 2DVBA 3KT4A 1CAUA 1O5UA 1T6BX 3WG1A 4FOQA 4GWJA 4XUNA 4P9WA 2GN7A 4KH9A 3NJXA 1C1FA 5JXGA 3I59A 1W39A 1K12A 3POYA 4A44A 4TTGA 2ZGLA 1O7FA 2QKDA 3HT1A 4L99A 4NAOA 1CGPA 2A6VA 5I8TA 2ZMLA 3U75A 3PL0A 4PIYA 4ZZ8A 3WNMA 3AZYA 2R30A 3ZXFA 3B3QE 5J1XA 2KA3A 2W9XA 3AP9A 5FZIA 4QQ2A 1FXZA 2YBSA 3MICA 4WM8B 3FBMA 2XUMA 2CAUA 3CMGA 1YRZA 4MGQA 3O1MA 1NG0A 1STMA 4XDOA 1K45A 1PM7A 4EV0A 2MHFA 1CAWB 1S4CA 1W99A 4JGYA 5A32B 1RUF1 1FOD3 1EUTA 5FZ8A 3PU3A 3WUDA 1NLQA 1PK6C 2JDUA 3KCCA 1Q8QA 1TVGA 5D8AB 1V6NA 1V0AA 5CYYA 2CHHA 2R043 5C3RA 1GZWA 5A6XA 3UGGA 1V6KA 5EPAA 5ACA1 2RM23 1OKOA 1MQTB 3ACFA 3M3EA 2AYHA 2RS51 2ZGSA 4WVMB 4NRMA 4GWNA 1F5JA 2LM3A 1E57A 4CSWA 4OLLA 3VBSC 3SCFA 3I97A 2HWE1 5J3UA 4XC9A 5C4WA 1FMD2 1UYPA 2O14A 3PLQA 1BLZA 4UFJA 5FPUA 4KGQA 4K20A 5J96B 1OFSA 3EHKA 5L7OA 4FTBA 4AQ2A 2PMWB 1VE0A 2GALA 2PAMA 4IGOA 3OYWA 1XXNA 4OHVA 1ZRFA 2RVAA 5HBAA 1COV3 1K3IA 2ZXQA 2IUWA 3H7YA 4GH4B 5T5JA 3ZSJA 2ATFA 1J84A 1NX9A 4UFMA 1ND3B 2WAAA 4AFDA 1CWPA 1RUJ1 3A7QA 1PVXA 1JOBA 2ADEA 1UW8A 2VXRA 2D5FA 4E8CA 1AYM3 1DGRN 1W2NA 3JBG1 3JUUA 1GYKA 4ISQA 1AVBA 3SLIA 3LQCA 2YB7A 4ATFA 2ZGOA 2KXLA 4JGZB 4C8DA 1LHUA 1NKGA 2WA4A 2D7FA 2PLV2 4Q8KA 1VBC1 3WEZA 1OLRA 2WDBA 1PO11 5FZ9A 1VBA3 3SQOA 3VKLA 3VBHC 3WT3A 1PK6A 2CWSA 1EAH3 2V5DA 2R063 3WZ1A 1AX1A 1AR82 1IG3A 1QJEA 5CG9A 2W1QA 1LECA 3ELNA 4IGQA 3I4IA 1ENSA 1LGNA 2YPDA 3Q8CA 3VDCA 4AI0A 3FHIB 1BK1A 4B4RA 5JXHA 3H8XA 5CFCA 1R1A2 4PDWC 1YLLA 4DRVA 1XE8A 3LEGA 1NLSA 1HW5A 1NY72 3VD5A 4CPBA 4MG2A 3VBSA 2UWBA 3ZVXA 3W5MA 3RGBA 3N3HA 3CHXA 3WINE 3CBNA 2HWB3 4Q4Y1 3H3LA 3CEWA 3PUHA 3LEKA 4XF4A 5JCTA 3T0BA 5LRRA 3B01A 3ZN6A 2H6CA 2E6VA 5GZGA 2QTWB 2DCYA 1NXMA 1RINA 3HVDA 1BJQA 1VAMA 1OH3A 2IXCA 4CDQC 1DF0A 1TNRA 2ZHLA 1BMV1 2W47A 5IVFA 1C28A 1BQPA 3O12A 2ZMKA 3NV1A 3WDUA 5SV5A 5FUPA 2VZOA 2BGOA 3V64A 1OQ1A 3S30A 5JSPA 1W0PA 1U5XA 2QQLA 5KHKA 2K9ZA 2VOWA 1YFYA 1JI6A 1EPWA 4XBQA 1H1MA 4X8NA 1GZTA 5IVCA 2WFF1 4YW7A 1W8NA 3IWZA 2ZEWA 3T2PA 1JZ4A 5F9TA 3RZGA 4NWWA 3MI8A 3L2HA 3MUY1 5FZ7A 5FP9A 2FCVA 4OZXA 4IV3B 1HV0A 4UT5A 4QU2A 5A7QA 5FPAA 1J1LA 2EIEA 2JDKA 2Y6LA 4U2AA 1ENQA 1ULEA 3VBHA 5FPXA 2VVEA 3P3NA 1CAVA 3J9SA 1JZ8A 2OX0A 4K3UA 4ZY9A 4B1MA 5ABJA 3RRDA 2W5FA 5JZGC 1UN1A 4ITCA 1DYKA 1FNZA 2BUKA 2VCMA 4BLJA 2EAKA 1X82A 2NYYA 3BOPA 2MEV2 2BRTA 2VR4A 3N9OA 1YQ5A 1H8VA 3O7OA 4PDWA 3DXUA 3WP5A 1W03A 1UPIA 2EA7A 2V73A 3LKJA 4Z82A 1X8EA 2W46A 4CU8A 4IQPA 1Q56A 2E51A 1R64A 1AR63 5FYIA 1LOGA 2GP5A 1NE6A 5HV0A 1AJKA 3TEYA 2VMFA 3K3OA 2RS11 3IIIA 1JU4A 4MGIE 3W9AA 1W6MA 4DXTA 5A6QA 4CDQA 4CXXA 2GH2A 1M4WA 2LS6A 3NNGA 5FZOB 4CCCA 2Q5TA 4CDWB 5CISA 3TEZA 2DUOA 1C3HA 1WCKA 1A8DA 4I02A 4AI2A 2JECA 3ORJA 4XJZA 2BU9A 2A6YA 2BTVC 2B7YA 4JKLA 2G9ZA 2VMDA 4OI0A 2E9QA 4Z1VA 4HN1A 3GBGA 2LALA 2OQ6A 4Q1PA 3LCPA 1RUE1 3K48A 4ONUA 1BYHA 3POGA 1OLMA 3IM0A 5FY5A 4S2GA 3GDBA 3ZM8A 1X9PA 3ZYFA 5FYHA 4YNIA 2GC3A 3DYOA 4M00A 2JDYA 1MZFA 1CX4A 1US3A 2FZ2A 2HWF2 3LSDA 4C0HA 1HXS2 1OHFA 1DLCA 4FPKA 5A3WA 4ZU7A 4M01A 2VUAA 2P6HA 3E6BA 5DAWA 3RI8A 4RD7A 2EXHA 4MSVA 4Q4V3 3KV4A 4TLGA 3ZO0B 5JZGA 4C90A 3MPBA 4PHZA 1OVSA 1DLLA 1WKYA 2DVGA 4MVTA 3PMSA 4PIZA 4NIIA 1JZ5A 3ZYBA 4BLIA 3U14A 1QDCA 4JCKA 5FO9B 3FFQA 3ZMOA 2XL9A 2W95A 3ACGA 3VDDB 4F83A 1OPOA 4DB5A 1DGRA 1OOPA 4G9SB 3BPZA 3IKWA 5FAXA 1NQDA 4SBVA 3K4AA 4HVQA 3QACA 3AMPA 5A7OA 2IXKA 3I2JA 3RYPA 4D69A 1KRIA 4H7LA 1RTVA 4B7EA 1CZSA 1YJLA 1R082 3FZ3A 2W2IA 4TWTA 3WY6A 4Q1RA 4Y33A 4PQQA 1W28A 4IEOA 1B09A 4Y1XA 4RGAA 3NNLA 1ULCA 5KXDA 4MZUA 5ANNA 1YWKA 5FIXA 2E7QA 5FPLA 2VGDA 4GKYA 3VHOA 3NWKA 1VJ2A 4LIVA 4LO6B 1HJGA 3V0AA 4MXWA 4NPRA 2P34A 1YNAA 3N9MA 2OZJA 2ZAHA 4H7MA 1GUIA 1UU4A 5I0TA 5CKMA 4BQ3A 1K42A 4AEKA 5BNOC 1FPN2 4H3WA 4W6YA 1LB2A 3C3VA 4WVZA 5CIRA 3ZFGB 1JZ3A 4LO4B 1DQ1A 2OT7A 1DDLA 1CAUB 1XQNA 2BYVE 5D21A 5FMOS 5F7UA 1HRI2 4FQ4A 3I3MA 5EYYA 2CV6A 1IHMA 5LY2A 3I59B 4N9IA 1XYNA 2ADDA 2WQ4A 4FOVA 4UW4A 4CP0A 4FFGA 1P8JA 5L9RA 4AVAA 3IDBB 3LDBA 1BEV3 3T3YA 5LBCA 4Y1YA 3POEA 3PUIA 4K40A 1AR73 4B1LA 2Z5WA 3MLKA 4J25A 5IK8A 1DZQA 1ZBE3 2RV9A 3G7DA 3VN4A 2QQPA 2ET7A 4OI1A 4AW7A 4JX0A 3HBZA 4JHZA 1RB8G 5CEHA 3J4UH 3N9LA 1V6MA 1W2TA 4LULA 1FMD1 4JAAA 1CX1A 4R9DA 1O4YA 4JGYB 4RYDA 4OZOA 1Y43B 2AGSA 2Y6FA 4CDXC 2W1SA 3JU9A 4XFFA 4CCJA 4D7YA 3D5OA 4COWA 2J22A 2BJSA 2BGCA 5CNAA 4LK6A 1LHOA 3K46A 3KF3A 4K9SA 1GZWB 3M7AA 3OY8A 1X7NA 5LCWL 5KXBA 4TN7A 3OGGA 1TEIA 3N9NA 4RGKA 5DDJ3 2BPA2 1PNFA 1Y3TA 3DYPA 3WQBA 2DVDA 1QJU1 3EBRA 4GB31 4HSLA 1Q8OA 1JZ6A 2VAUA 3T1MA 1QJX1 5BNOA 2Y8KA 4AZZA 2R1BA 3LFIA 3ZYRA 1C8M3 1O91A 5C4WB 3C2UA 1LOBA 4Q0SA 4BYYA 3B02A 5L7OB 4CEYC 4QX5A 3ZN4A 4JDNA 2Y64A 4QHZA 5DQ0A 2PLV1 3KGZA 1H2NA 3INAA 3OYWB 4Q26A 3DN7A 2CSGA 5C9AC 1MS3A 2NMOA 2RMU3 4YVSC 1OUXA 1HRV1 3FC0A 4XQWA 4AVVA 1O3TA 1RUD3 2VULA 3V56A 3UT0A 5K4LA 1Y9QA 4A6OA 1Z0HA 2R042 5F5AA 3WF0A 3CLPA 5GLTA 2ZJCA 2KD7A 1MEC3 2NN8A 1NCRA 1BK0A 2RM22 2C24A 1M06G 4LK7A 1UKRA 4LBQA 4OVEA 1J1TA 3T0DA 1VMFA 2X5IC 1VBD1 2OA2A 5I93A 4IERA 2BP6A 3ZIXA 2CY6A 1SCSA 2WNOA 4GZ9A 2ARCA 1JHNA 4LLFA 1GP5A 1PVC3 1H8TC 1ZX5A 4M3CE 3AVRA 4CDXA 2PQQA 1ZVFA 1Y9GA 2ZGKA 3ACIA 2ZABA 1PK6B 1Q8PA 3PURA 4Q4W1 3WNOA 4CP1A 4B29A 4Q27A 5F3IA 3ES4A 1V9U2 2XB6C 4GULA 2QQWA 4IXLA 2VMHA 2AR6A 3F2ZA 5L9BA 3WF3A 4FBFA 3VDBA 4BOWA 1LEMA 3PIJA 3O0WA 5C5UA 1RC6A 4CXWA 5CFCB 4FPYA 5GZDA 1FNYA 2GZWA 2VMIA 1UCXA 2V4VA 4HXCA 4AI8A 4OFGA 3VBSB 2XG3A 3UGHA 3UKTA 5HXVA 3VV1A 2Q1ZB 2JD9A 5EWSA 2YDEA 1C1LA 3IT8A 3MBWA 4XAAA 5DUXA 4DINB 1AYM2 1W8FA 3BPSA 1S0JA 1IOAA 3CZJA 4W6XA 2JD4A 3WW3A 1YCIA 4BK4A 4FSJA 4CEYA 3OBAA 3ZN6B 4A7KA 4TSVA 2C4XA 3ILNA 5JOWA 4QB1A 5CG8A 2JIGA 4P02B 5LA1A 4HZFA 1RVF3 2RS33 1OSGA 5C9AA 2W91A 2ZCWA 4E9KA 2X09A 1VBA2 3TRSB 3E5XA 4Y1VA 2R062 1JYIA 5KHJA 4XETA 5IFTA 3R4SA 1YFXA 2Y33A 3LA2A 4HT1T 1SBDA 3KCYA 2A73B 4HK8A 4COYA 1S55A 1WD4A 1H9WA 3MIDA 5FY0A 4QPYA 2FMDA 2X5IA 2EXJA 1SLLA 2YBPA 4YZ3A 5GJ6A 4GXLA 2BNOA 4YYOA 2GH8A 5AC91 4L8QA 5FP4A 2VOVA 3IAQA 3HT2A 3VBHB 5C3PA 1CAVB 5FRAA 1Q8VA 3NNMA 1LNSA 2E7AA 2XJVA 4MHUA 3VDAA 4MLOA 3ACHA 1JS9A 3VD9A 1F15A 3MGUA 4PDWB 3DYMA 2BEOA 5FZKA 3D0JA 3TB0A 1A78A 2OPWA 3VZOA 1WD3A 3DV8A 4NRQA 4TZDA 4KWKA 1S0BA 5A3MA 3F95A 5C33A 1UMZA 5GLUA 1HB4A 1UZYA 3D0SA 4QX1A 1QXRA 4GWMA 3QLQA 3ZSMA 2DCZA 3GZUC 4JV4A 3VZKA 4EYUA 5LK7B 3WP3A 3LDRA 1SFYA 1W6MB 3FLPA 4KNCA 4WVVA 4FAHA 4DS0A 3D82A 4CDQB 2RJLA 3MIGA 1GOGA 2QDRA 2BFUL 4DFSA 4K1ZA 3J7NA 2RJKA 2RR13 3O1RA 4BXFA 3ZKYA 2UURA 2DU1A 4HPKA 1V00A 1K5JA 4XYXA 3P3PA 2A3WA 1TME3 2IWGB 3HPNA 3O1VA 1YUDA 1LU2A 4NHMA 2JB8A 1VBC2 3DXTA 1MPXA 4LQRA 5F2SA 1XNBA 1PO12 3ZFEC 1EP0A 2D6KA 2H6BA 4O7XA 2DFCA 5A33A 2XGXA 2VNRA 3JD73 1N1VA 5K0UC 1AR62 3WQ1A 3E6CC 3H8UA 2WINB 2XHNA 4XCBA 5LA9A 3RWNA 4DOUA 3OBTA 3ROUA 1BHGA 3AMNA 1KFUL 4CUCA 2GNMA 5JZGB 1QOSA 1ZBA2 1IQDC 5FO7B 4IL7A 2P2KA 3QH6A 4P5HA 3RZZA 4Q4Y2 4FPGA 4MUVA 4BJ0A 4IE5A 3LD8A 4NE9A 1RMU3 1AL23 3R0RA 4NAMA 2DURA 4YZ1A 2WZ8A 2HEWF 2PHUA 4JQRA 4LPLA 4B4PA 1OOPB 4XMAA 4FFIA 3TAYA 4OQ8A 3WDXA 1YFWA 2EAAA 3E1F1 2P6CA 1VMJA 4P9YA 1V70A 3U0ZA 1SG3A 4Y4YA 3H1YA 2R32A 1S0GA 1O3QA 2R073 1W9TA 4QMAA 4AG4A 2VVDA 1VBB3 5DZGA 4CUBA 1AXYA 4I0WB 4IEWA 4XABA 3NVCA 1UX7A 2RE9A 4KU7A 4XEZA 1HRI1 2OW4A 3H0OA 3WCRA 4ASLA 5I0UA 4Q4V2 2ZGQA 4YM0A 5FZDA 2Y34A 2O8QA 5FREA 2XUEA 2JDNA 2E63A 1W0NA 1WLCA 1VAKA 5FLJA 3I2DA 3V0AB 4MXWB 4D3WA 1I5PA 1O4ZA 2J42A 2VG9A 3ZFEA 4AEJA 3O1UA 1RL3A 2EIDA 1LHNA 1PZ8A 5FZOA 4AHZA 5J98B 3WV6A 2OS2A 4N9HA 3GJAA 5JUVA 1AR93 2P17A 2ZX0A 3AYCA 3GM8A 1UOFA 2WR9A 4XFBA 5FYVA 3WHUA 4BQ5A 1TE1B 4NO4A 3R4DB 2VBDA 4JC1A 1I5ZA 5H9RA 4N53C 5IHRA 3BCWA 2CNAA 4AR2A 4A3ZA 1GANA 1O8SA 1RUC3 2VTXA 3FLTA 5K7PA 3CJIC 5FMCA 1W8OA 2H0VA 2VZPA 3AZVA 2JIJA 2YC4A 1FV2A 3WF4A 4EN6B 2RS12 5BV6A 2WNUC 3KLSA 2CU5A 1SLAA 2ZHMA 4K8FA 5AFEA 1UPSA 2J1EA 2VBPA 3BU7A 4H14A 4URAA 2EF6A 5DN2A 4N43C 4P08A 1QJFA 3FFZA 3OEAA 2ZGTA 4Q0PA 3WCSA 2C6SA 2OXBA 2BV4A 3RG0A 2PXJA 5ISLA 4XUOA 5E1RA 5C3OA 1O3SA 2DV9A 1LAJA 1YIFA 3MFCA 1WCQA 4RS5A 1EV13 2Q0AA 2P4EA 4X6QB 1DGWX 2WT2A 3ETQA 1RUE2 4QKDA 4I3GA 4TYSA 1W06A 5J09A 4V2VA 1R093 1FOD1 4HKWA 1J3PA 2DCKA 3OG2A 3OY8B 1LOCA 3HQUA 4V1PA 2VZQA 2R041 4R9BA 4KGGA 4XDPA 1AR72 1E5HA 1NYWA 4QQLA 1ZBE2 2RM21 5BNOB 2QQNA 2XOMA 3BTYA 2Y6GA 4Y24A 1RUG2 3AFKA 4AAXA 4LBKA 2QJVA 1PGL2 3KV9A 1DFQA 1LOFC 2PHTA 1AJOA 4C1WA 4DEVA 5A3NA 4N53A 3J26N 2QQIA 4LKSA 5JMCA 3DCQA 4W6WA 3UV9A 3CJIA 2WZR3 2B5HA 3KGLA 2W08A 3THPA 3LA3A 1XYOA 2C26A 1POQA 4P00B 4YM1A 5FZ3A 1COV1 5HCHA 1JOPA 1X50A 3O1TA 3C8XA 5HV4A 4GMP0 4KBBA 4IE0A 1SCRA 5FKCA 4N43A 3KHCA 4UOJA 2YC0A 1N47A 4COUA 1JUHA 1RYYA 1XBFA 2I74A 3HN1A 1ZM1A 5KR7A 5JR7B 3CQOA 4GAZA 4LBQB 3HBKA 4KMQA 1Q3EA 1N3QA 1KS4A 3TN93 3HN3A 2AUYA 2VTFA 1AYM1 3M3QA 1QQP3 1GKBA 4CDXB 4PIXA 1TQ5A 4QX3A 1FT9A 2XLGA 2W39A 2WIIB 4D6QA 1UU5A 5FYBA 1XNDA 2B4KA 1VBA1 5DUVA 1EAH1 2R061 5LK5A 3U4SA 1AHSA 2Z2SB 4CVUA 4HLTA 1LRHA 5E16A 2B39A 3KQ4B 3PHMA 3FWEA 4FP3A 4KG0A 2A3XA 3ON7A 2XQXA 1WCUA 2ENRA 1CVNA 1JU3A 2ARAA 1VLNA 2ORZA 1ZZ7A 1GQHA 2GMMA 3HWJA 3ZX7A 1OMIA 2A6WA 2VZUA 4LA3A 3WQ0A 3FBYA 4RN5A 1YI7A 4A2UA 4CEYB 4E4SA 1LOFA 2HWB1 1NQJA 3WSOA 1SEFA 3MPPG 5I8SA 4YM3A 5C9AB 1Y9MA 5LEJA 5DAXA 3POSA 4N90A 1SACA 3HAGA 2WYSA 2WLPA 4A7ZA 5F1RA 5FWJA 1G86A 3VBFC 4CU9A 2R0HA 3L9JT 3A23A 1UNBA 2UYBA 2IVJA 4JHTA 2YXSA 3D6EA 3TNQA 1JBCA 2AEZA 1MS0A 5IK5A 4HETA 2WQZC 2BOIA 3LPGA 1JODA 2X5IB 3ZYIB 4Y5TA 5I0RA 2XPJA 2VCBA 4AFCA 5C8CC 1WA6X 3ZMNA 1SHWB 4Q2FA 1JYCA 3AMMA 3NO8A 1VR3A 4HK9A 3DECA 4WZFA 2CTVA 4XXPA 2QVSB 5A3OA 3IMMA 1QJU2 3G6JB 2RS32 3Q9OA 4FQZA 4GB32 2ZHNA 2W1UA 2D6NA 1QJX2 2PTMA 1A3KA 3RSJA 5IVVA 4RFRB 1BVP1 1YJKA 4JDOA 3LZZA 1RXFA 2OZ6A 1X8MA 1Z7S3 3VGIA 1DU3D 3BALA 1GLHA 4XTPA 5EZWA 1CZVA 2JDMA 2PN5A 5IW0A 3VKMA 1VBE3 4LHSA 3DPRC 2A6XA 3MYXA 2FZ1A 3K4DA 3N9PA 2VD7A 1HRV2 2ZMNA 5JIAA 3PIGA 1DQ6A 1WW4A 4NHYA 1AR61 1ENRA 5BY5A 3POIA 4Z8BA 3T2QA 5B4XA 5GKAC 2ZPXA 5L36A 4FPFA 3WF1A 1F31A 4YZ4A 5HCFA 4CYDA 5F3GA 4IEPA 3QCWA 3Q8FA 4IEUA 1LESA 1BCXA 2X53S 1C57A 3MEPA 3VBFA 1ZBA1 1VBD2 4HPKB 4AI9A 4D6SA 5CB7A 5FBJA 2NMNA 2VW0A 5T3NA 1IS4A 1W6OA 2QQJA 2OVUA 2RG4A 3WNLA 3AJZA 2HBUA 1HIXA 4FP2A 2CGOA 4Q4W2 3GXUA 5A33B 5C8CA 3IPVA 1UD1A 5T52A 5CVRA 3OGJA 2Y6HA 4IDZA 3IDAA 1CONA 1LHVA 2YG0A 1ZRRA 4NHXA 5A3TA 1HJFA 2IXJA 4XE9A 3UYJA 4AHYA 1RITA 2VNVA 1ZZBA 3HQXA 3X29B 4OMCA 3AZWA 4A3XA 1RJ7A 2RR12 1ZZ8A 3M8LA 1SLCA 3RI9A 4Q4V1 4Y1ZA 1LR5A 2Q8OA 5ACA3 3AKSA 1FX5A 2RS53 5FP3A 3GALA 3N35A 4YZ2A 2W1WA 1PIV3 1TME2 3DPRA 3RYRA 1TNFA 3UJQA 5C8WA 2HEVF 3WXPA 4CCMA 4UFIA 1QJY3 1ZZ9A 2G19A 1DHKB 3NV4A 4CPBD 1PX4A 2JDHA 3JD72 4IGPA 4QXKA 5J37A 1EUUA 1L7LA 3ZR6A 1BXHA 1RUH3 2QFEA 3QH7A 2GDFA 4SLIA 4W65A 4R9AA 4MGZE 1SDDB 2O1QA 2ARXA 1W6NA 4XQDA 1QF3A 3SISA 2A3YA 2YROA 3RWKX 4BQ2A 1OPMA 2G1MA 2WNEA 3VKNA 1GV9A 4IE4A 2FCTA 4LO5B 1VMHA 4IE6A 2FCUA 4JRLA 5F5CA 4XF3A 2WNVC 3AB0A 5AC92 1RUJ3 1H1AA 1X36A 1CJPA 3GZEA 3T2OA 4A41A 1RMU2 3ZFEB 1XYPA 3B5LB 4XJUA 5T5LA 5FXXA 4CDUC 1VB4A 3MIHA 2HYXA 1AXKA 2X8KA 1C8NA 3OJBA 1WLDA 1F9KA 4AI1A 4LEJA 3LAGA 3C7OA 1JYNA 1JZ7A 1ULGA 3BB6A 1SBFA 5IATA 2R072 3KHBA 4XILA 4UYBA 1VBB2 3BODA 4L2NA 2LTNA 1JTZX 2BOJA 4AL9A 4F8AA 2JB4A 4Z2AA 5LBEA 3WG3A 1RUI3 4CCKA 3A0KA 1W2UA 5EV7A 3BUCA 2HWD3 4BE3A 3UK9A 3GCXA 4UW3A 3KT1A 4DUWA 2OUHA 1BEV1 5FUIA 2JDZA 5GALA 3BN6A 4LO7A 4CP9A 2X29A 2VJXA 1AR71 2VU9A 1ZBE1 3DKWA 2VCAA 2D98A 1B35C 1GOHA 2JKBA 1ZREA 2NLRA 4LE3A 3POFA 4E4DX 1PO23 1UIJA 5FOBB 1RUG1 1GFF2 2XL7A 2GNDA 3IMNA 4RS5B 5LBBA 1AR92 4BMEA 1GP4A 5FYYA 1PGL1 4DEQA 1GMMA 2NZ9A 1AZDA 1K5MC 2TUNA 1IG0A 3KSCA 4QKBA 5FMBA 1UWWA 1W90A 2BFUS 5A7SA 4A4AA 1OD3A 1XOYA 2G9FA 1DYOA 2VUCA 3ASIA 3A22A 2UU8A 4RHV3 5M0TA 1RUC2 2WNVA 5DPNA 3VBOC 4XUTA 5FYUA 3R4UA 2AZ5A 4URTA 3R6SA 3SH5A 3O0XA 1WA4A 3T08A 4BDVB 2WFF3 1GWKA 3S7IA 2QZ2A 2QZ3A 1TMF2 3GYDA 2F4LA 5JI7A 4ZXKA 1W9WA 4ISRA 4CDUA 3ZXKA 5A6ZA 5DDJ1 2GC1A 4HSJA 4L97A 1LODA 2ES3A 2ZTNA 2WWJA 5I8YA 3TYJA 1WMDA 3PJQA 3IN9A 1BVVA 1C8M1 4QX8A 1WW6A 4QXBA 4L9BA 1EV12 2WO1A 4N53B 3MO4A 4I0BA 1YQ6A 2AACA 3U10A 2VCCA 2VUJA 5FQ0A 1HLCA 4DZGA 3CJIB 2VQAA 3B69A 3JB4C 4FPEA 4DXSA 4EJRA 3AZXA 1IQAA 3PNAA 2UWCA 2VMCA 4IEYA 4AQSA 1S0CA 2MNGA 5FPBA 2X05A 1D7PM 2RMU1 2WNUB 4XFIA 3FJSA 1RJ8A 1UOBA 1AYN3 1H2KA 4XJAA 1RUD1 4N43B 2VY0A 3HOBA 4WV8A 1PMHX 3BTZA 2ZKLA 3VHPA 4NHLA 2PQSA 4YPJA 4QX2A 5A7PA 4E2SA 1B35A 2D6PA 2XHKA 2Q30A 4Y5SA 1J58A 4QXCA 3ALQA 3NJVA 2OKXA 4CCOA 1JOJA 5C6CA 1ST8A 3ZXDA 1OBNA 1NCQC 4S2DA 4WVWA 1K5MA 4Z2WA 4IUGA 2ERFA 2VQTA 4AYUA 5A7WA 1IGOA 4D0QA 1A8MA 3MDPA 2VH9A 4FT8A 3WW1A 1KGYA 1SLBA 2EXKA 2R6QA 4NIAA 3VBOA 1G9CA 2J1RA 3ILRA 4JZRA 4OYUA 5F2WA 1I3HA 1DZRA 5FZCA 4LORA 1QOTA 1GQGA 1NXD1 1S2BA 4I30A 4RA0A 3GZTB 3IBMA 3OBRA 2IZWA 3DL3A 4QDQA 5LA0A 4XPVA 2CGNA 4YG3A 3KM5A 2PYTA 1KDMA 1KS5A 3GJBA 4Q8LA 3O1PA 1ULFA 5LA2A 1XNKA 1LOAA 2WWUA 5A3LA 1HX6A 3TEXA 1FATA 3JQXA 4O9GA 1BBT3 2A5ZA 3IAPA 3S0MA 4ZONA 1RVF1 2RS31 1YEWA 2XKPA 4XF9A 1NE4A 4I2OA 4O61A 4XVHA 5JPMB 4DXZA 1WZXA 1IPSA 4P9IA 4RR3C 4UW5A 2DF7A 2KR2A 3KQRA 1G8WA 1CR7A 2XH6A 4ZS3A 3NRUA 3I7DA 4GMP1 4CCNA 3C7GA 4NMIA 2FDHA 2D6MA 5KWRA 2WS93 5KC5A 1JHJA 2Y0OA 4AEDC 1FOD2 4W8JA 1U5ZA 3IDEA 3MW3A 3O14A 1NCQA 3P1IA 3EYPA 3UKVA 4DY5A 2YFZA 1KDKA 5LB6A 4Y20A 5CFCC 1ENXA 1G9AA 1CD3G 1QH6A 3V0BA 4IESA 5IUQA 1H9PA 3N7LA 4CA9A 4PLOA 1OURA 2DU0A 3WDVA 1V6IA 3JB8A 4LHKA 4N7IA 1F4HA 2AEYA 1PGSA 2WZPP 4L11A 1UY3A 1W2AX 4CE8A 5H9SA 4JTNA 4QPWA 1WCDJ 1YFUA 5BUVA 1MZ6A 5FXWA 2YFUA 4BH9A 5L19A 1LJ7A 1PZ9A 4BB3A 4TLFA 1UZVA 1COV2 4I09A 4NR1A 4PBOA 3RMXA 2XJRA 4CTEA 3BIEA 1JZ2A 3OB8A 1PHMA 3JXSA 4UFKA 4V2WA 4ASKA 2BQPA 5L9VA 1LTEA 1LGCA 2IXHA 3VBFB 2D40A 4NWVA 4BISA 4R8HA 2J1VA 3AKQA 1G9BA 5IVYA 2ETEA 3LIHA 2RR11 1SLTA 4RR3A 1OLME 2WO2A 4PLNA 1O4TA 3PVNA 4LBNA 4L0PA 1W6OB 3M2MA 4QM8A 5D2AA 5A1AA 1Z7S2 4AQ6A 5JWPA 1HQNA 3ZYHA 2W52A 1LCLA 3PTYA 1GZCA 5FY4A 1SFNA 4OUSA 2KM2A 4J6GA 3RS6A 5JXJA 1TME1 2XJUA 5C8CB 3IPVB 5BNQA 4EN0A 4AEDA 2JG9C 1XE0A 3KZ4C 4YVSA 2VVFA 2LUWA 3H42B 1EAH2 3OGVA 3LOBA 3JD71 4HONA 3VL8A 4MYEA 1UO9A 1W9SA 1WUVA 1W05A 2WUHA 1V6LA 3O1SA 1UOGA 1QH7A 1ZZ6A 1IS3A 1YI9A 1UY4A 2D6OX 3OBZA 2D3RA 3U37A 4FTSA 3CNAA 2UWAA 2ZBJA 4MHRA 2XDVA 4M0NA 3AKRA 3ZFFC 1N1YA 1VRH3 4ORFA 3USUA 4AI3A 3OCPA 5KBFA 2WT1A 1FAYA 5A6YA 2RDNA 3CIHA 2Y6JA 2HWB2 2XWBB 2JJ6A 3LE0A 1H8TA 1UZZA 3DPRB 1RMU1 4X6RB 3ZPYA 3GF6A 1AL21 4I3PA 4LUKA 2QBXA 5GLWA 4CRQA 1POV3 5HCAA 1APNA 4K21A 3RZLA 5T5PA 5CBLA 1Q5OA 5JMOA 1J3RA 3VZLA 2A70A 3H50A 4HOOA 1W9YA 2D6LX 2GNTA 3VUOA 4YW1A 2PLV3 3CL1A 3EQEA 2W94A 4XHBA 5CFDC 2J1UA 1W6NB 2W0XA 5T55A 3VD3A 4LITA 2R071 1AR83 4R9CA 1VBB1 5HPOA 3HNBM 3KWVA 1GR3A 4XF0A 5BPXA 2C9AA 1W8UA 4XCAA 5FO8B 4Z07A 4OCTA 3ME2A 1OQEA 1MS8A 1R1A3 2PFWA 3GBWA 3SEEA 1F8VA 4QGNA 1DYPA 3VBUC 4K8RB 2Z4FA 3BIWE 3UJOA 1N1SA 5FY7A 3HD8B 1S0EA 4P9JA 3RZMA 2DUQA 3T4HB 1PIV2 4CU6A 2JG9A 5SV8A 4FOWA 5EHDA 1V6OA 2BNMA 1L7RA 1QJY2 1I9RA 1YIPA 1G7YA 4LIUA 4Q4X3 4DQAA 1ODMA 1UX6A 3MF6A 2YY1A 3AMQA 3PUQA 4B4QA 3BGAA 5LZ6A 3RZKA 3WNKA 4E27A 3ZYGA 3AP6A 1QGLA 1AR91 1W0OA 3OGRA 4R52A 5FZ4A 4KG8A 2D43A 1CAXA 1BKZA 2XKOA 4FPCA 2ZEZA 3WP6A 2K0GA 4M3CB 2GMEA 2VNGA 1W3VA 5FZMA 2P1BA 3ZFFA 5EJ3A 4DUXA 4JKMA 3ABZA 2FDIA 3VHNA 1RUC1 1DIWA 4Y26A 5EP9A 4LLOA 4BHPA 3SXWA 3ZKUA 3RDIA 3NJZA 3LIGA 2ZS6B 4KBZA 4CP9B 2DDUA 1GBGA 4RGGA 1TMF1 5BNNC 2QQVA 1I1EA 2FDKA 1SMVA 3KMHA 1UZ0A 3S57A 2WJSA 2JDPA 5FK8A 4MX3A 3LSEA 1U12A 4P9XA 2DTWA 2V09A 1CZTA 1WBLA 5CFDA 3U11A 3WG4A 2J1AA 3ZDVA 1EV11 5JAXA 4YW3A 2RJ2A 1SBEA 1D4M3 3VB9A 4IV1C 1SZBA 4CCEA 3NKGA 2F6BA 3WD5A 3KVAA 1VB2A 2WNVB 1H2LA 3AP7A 1PM4A 4YGEA 3MV01 4PLMA 3U4XA 2A6ZA 2MEV3 1AF9A 4BU2A 1R091 1RUI2 4AK3A 3VBUA 1QMJA 2HWD2 1I6XA 4MOAA 5FJHA 1J83A 1ASJ3 4YGCA 4CDUB 2QCSB 3FUQA 3NNFA 4OULA 1XJAA 2AC1A 1US2A 2VMGA 3H7JA 4K6BA 4LBOA 5FZ1A 4YFZA 2VW1A 1S0FA 4FAGA 5JOXA 4XJ9A 5B4NA 1N3OA 1OVPA 4A42A 4FFHA 4QAWA 5A7NA 3VZJA 1PO22 3I54A 5FZGA 1XSRA 3OPTA 3VKOA 3LPFA 4LE4A 1WW7A 1CJDA 3OUJA 5FQ0B 1CPMA 1DGLA 3MF9A 4XDQA 4XUPA 2ZAAA 2JDAA 5IJRA 3WX5A 1C5HA 1CN1A 4RHV2 1UKGA 5CU1A 3RFRA 4AE2A 4Q0UA 2WZR1 3J8F3 2Y38A 1WLTA 3PU8A 4YFWA 1MZEA 1YYNA 4LKEA 4NJ4A 2B46X 1OXCA 5BNNA 3H3UA 3N7KA 1UYXA 1MZ5A 2JE7A 4PCRA 3VD7A 1B35B 3MW4A 5E89A 4AGRA 3K4ZA 5K0UB 1UQXA 2FDJA 3ZR5A 2PHLA 2VECA 1NT0A 3PVOA 3WVJA 2HWF3 1CESA 4NOTA 2X10A 2ZGPA 3WF2A 1K5MB 1GOFA 3RYKA 1HXS3 3THCA 4QB6A 3GZAA 1RUNA 4EZ4A 5A7WB 5IVJA 2A75A 1QQP1 1GNYA 2GU9A 2BWAA 2CL2A 3NAPC 3Q8BA 1DQ4A 2Q1MA 5EJ1B 3MIFA 3I2KA 5AVAA 1MR5A 2JG8C 1LENA 3BVCA 1JUIA 4ZZ5A 1HN1A 5GZEA 2FHRA 1WWYA 4KWUA 1O8PA 3VBOB 4YSFA 1HKDA 5K8SA 3H1WA 5APAA 2ZEYA 4ES9A 1VRBA 2VL4A 3I3DA 1DG6A 1DQ5A 1QKQA 2BVVA 1DBNA 1AYN2 1G9DA 3WW4A 5E8AA 1MVQA 2ZGRA 5FYCA 1YHFA 1WCSA 1GNHA 3WLUA 2XWJB 2ID4A 3WOGA 3T0AA 2H0BA 2WA3A 3TEWA 3LOIA 4YWAA 2UYAA 2XONA 3OD4A 2CWMA 3I3QA 4N8MA 2HWC3 3APBA 1R083 3BOWA 4LKDA 3W58A 3CO2A 4LJHA 4AOCA 4AEMA 4AGGA 4LKFA 4LO8A 4S2HA 1ZNPA 1BEV2 4QGLA 3N9QA 1DQ2A 3VZNA 3VD4A 5BXXA 4YW2A 3K75B 2GNBA 2VO5A 4LA2A 1IS6A 1IKPA 1WLWA 2E32A 3ENRA 3WNNA 2PAEA 3MV11 1W8ZA 4OUMA 1NLRA 5E88A 3HQRA 2WN3A 2K2SA 4XIKA 2VZSA 4EE2A 1S0DA 5JR2A 1JW6A 2O8OA 3ZPOA 1FPN3 2ORXA 1UF2C 4RQPC 3ZSEA 1NCQB 5JIUA 1QIQA 1D0HA 4QDRA 2E26A 5FY9A 4UI9L 2WABA 2WNUA 1JN2P 2YU1A 2G9GA 3NAPA 1GWLA 3DKQA 4Y20B 3DF0A 3S5AA 2VW2A 2JG8A 1UXZA 3V0BB 2K46A 3OSDA 5DDJ2 5GZFA 1OF3A 4MXVA 2B45X 2J1SA 5F6LB 5FJKA 4D7TA 3H8OA 4JVAA 4CP2A 5EJZB 4NHKA 1C8M2 4C1XA 1U0AA 2V5YA 4LT5A 1Z7S1 1YQ8A 3I2FA 2W3JA 4Y22A 5FZHA 5JLVA 3JQWA 1UU6A 4IEXA 4GWIA 1Q8SA 3AVSA 1AX2A 3Q8AA 5J36A 3ZSKA 2WS92 3KV6A 2YHJA 3LA7A 2NP0A 2RMU2 3M4FA 2VZ3A 2D44A 4OHWA 4LNVA 4AXOA 1RUD2 5DXDA 4WM7C 4B8EA 4YGDA 4COVA 1OFNA 4FOYA 1RHI3 2Z79A 3AYEA 4G3YC 1TZOA 3AC0A 5JVVA 5L7OC 1G6NA 2WBKA 3Q8EA 3VBRC 3WNXA 3ES1A 1MEC2 3ACLA 4RR3B 4BA6A 3K77A 4JKKA 3TBDA 2WL1A 1REFA 5F37A 4E2QA 1IPJA 2PELA 4QU1A 2C0ZA 3EJKA 1PVC2 5JOZA 5A1LA 3BYWA 5EQUA 2D93A 4AEDB 4YVSB 5F5QA 3T4VA 4RQPA 1H4GA 2VZ1A 4XURA 5J7MA 1S2KA 4XZPA 1LULA 4DMIA 1OA2A 2UY9A 3ZYPA 4DUVA 5CAZA 1DGWA 1O59A 2QQKA 3KVBA 4Z92B 1D4VB 4HFSA 2ZHKA 2FBEA 4IEVA 4BK5A 4AF9A 1H4HA 5FYSA 4CXYA 4PF1A 4BCUA 3RQ0A 4FXKB 3RNSA 3SKJE 2XBO3 1F4AA 4LBJA 3UESA 3USUB 4AWDA 1W8TA 4JQTA 1OH4A 3WP4A 4INDA 1H8TB 2I2SA 1O3RA 2WRAA 3W5NA 4UBGA 3POBA 3ZYJB 2OQ7A 1IS5A 1KXGA 4KWLA 4BPZA 2BERA 1PIV1 3NV2A 1RVF2 5LWBA 4Q0VA 2DTYA 5A80A 3SH4A 4RSUA 1QJY1 2VNOA 4S2FA 5JI9A 4J1XA 1F2NA 1HQWA 4WM7A 3OEBA 2A71A 1ZRDA 1KQRA 3LEMA 1RUH1 3E97A 2FMYA 1VAVA 4M4RA 1V9U3 5FXZA 3AYDA 3VBRA 2VUDA 4XJ8A 1HV1A 1QU0A 5FK7A 1REDA 3U78A 1VRH2 3M3IA 1C5IA 3V65A 3WR0A 3IZOA 2Q8DA 3NKTA 2SBAA 3KV5A 4K1YA 1JYXA 3RZJA 2EIBA 3MLLA 2JG9B 5I91A 5C71A 2XQRA 3KCXA 2D97A 2D3PA 1XB9A 3WNPA 3GCWA 4UBHA 5C3SA 3FLRA 5KXEA
chains in the Genus database with same CATH topology
5FYIA 3AL5A 5FY0A 2YU1A 5FPUA 2GP5A 5IWFA 5FPBA 4BISA 5CEHA 2Q8CA 4UF0A 3K3OA 2YBPA 5FP3A 5IVYA 3KVAA 5FZLA 3N9LA 3PUSA 5FXVA 5FZOA 4IGOA 2OS2A 5F5IA 4BU2A 5F32A 5FP4A 5FJKA 5FZOB 4CCMA 5FJHA 5FY4A 5A7PA 5FYVA 4CCJA 5FP8A 4QXCA 5FWEA 4IGPA 5FZHA 3ZLIA 4CCOA 5FZ1A 5FYMA 4D6RA 5IVEA 3AVSA 4HONA 2OQ6A 5FZKA 4TN7A 5FY5A 5A7NA 3KV6A 5A7WA 5FZGA 3N9NA 5FWJA 3OPTA 4LXLA 4DIQA 4GJYA 5FYHA 3K2OA 5F5CA 4CUGA 5FZ0A 4URAA 4GD4A 2XDVA 5FV3A 5A1FA 5FZFA 5F2WA 4C8DA 5FZCA 5F3CA 5FZ9A 4DO0A 4ASKA 4UF0B 2PXJA 5FUNA 4E4HA 4EYUA 5FYZA 5A3WA 5ISLA 2P5BA 5FXXA 3PU8A 5E6HA 4IGQA 3KV4A 5F37A 4NUBA 4QU1A 2YPDA 5FPVA 5FY1A 5LY1A 5FP7A 4BXFA 5A1LA 4V2VA 4HOOA 5K4LA 2WWUA 2GP3A 4GJZA 5F5AA 3NJYA 5IVVA 3PUAA 3KVBA 4EZ4A 5A7WB 5F2SA 5IVJA 3DXTA 4LITA 4CCKA 5F39A 5A7OA 4EZHA 5ANQA 4XDPA 5FYSA 2W2IA 5IW0A 5LW9A 4Y4RA 2XMLA 5FYTA 5FZBA 3AVRA 1VRBA 5IVFA 3N9PA 2VD7A 4Y33A 5FZ6A 5FY7A 5FUPA 4CCNA 3PURA 3KV9A 5FYCA 5F3IA 5FZAA 5A3NA 3PTRB 2OQ7A 5FYYA 2XXZA 4LIUA 5FPLA 3K3NA 5F3GA 3PUQA 4AAPA 5FZEA 5IVCA 4LIVA 5FZIA 5LWBA 3AL6A 4QXHA 5A80A 5FZ4A 3LD8A 3N9MA 5A7SA 2YBSA 5FZ3A 4AI9A 4D6SA 3N9QA 4XDOA 5FBJA 5FP9A 5FZ7A 2Q8EA 5FYUA 5FZMA 5A7QA 5FPAA 5FXZA 5KR7A 4QWNA 4GAZA 5FZ8A 3PU3A 2OT7A 5A3PA 2OX0A 2YBKA 3PDQA 4Y3OA 5FXWA 3U78A 2WWJA 3OPWA 5LY2A 5FY8A 2Q8DA 2YU2A 3RVHA 3KV5A 3N9OA 5IVBA 4QX7A 3LDBA 4QX8A 4D6QA 4QXBA 3DXUA 3ZPOA 5FYBA 5A3TA 5F3EA 3UYJA 4CSWA 5FZDA 2XUEA 3U4SA 4CCLA 4V2WA 5FY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FYI A;  3AL5 A;  5FY0 A;  2YU1 A;  5FPU A;  2GP5 A;  5IWF A;  5FPB A;  4BIS A;  5CEH A;  2Q8C A;  4UF0 A;  3K3O A;  2YBP A;  5FP3 A;  5IVY A;  3KVA A;  5FZL A;  3N9L A;  3PUS A;  5FXV A;  5FZO A;  4IGO A;  2OS2 A;  5F5I A;  4BU2 A;  5F32 A;  5FP4 A;  5FJK A;  5FZO B;  4CCM A;  5FJH A;  5FY4 A;  5A7P A;  5FYV A;  4CCJ A;  5FP8 A;  4QXC A;  5FWE A;  4IGP A;  5FZH A;  3ZLI A;  4CCO A;  5FZ1 A;  5FYM A;  4D6R A;  5IVE A;  3AVS A;  4HON A;  2OQ6 A;  5FZK A;  4TN7 A;  5FY5 A;  5A7N A;  3KV6 A;  5A7W A;  5FZG A;  3N9N A;  5FWJ A;  3OPT A;  4LXL A;  4DIQ A;  4GJY A;  5FYH A;  3K2O A;  5F5C A;  4CUG A;  5FZ0 A;  4URA A;  4GD4 A;  2XDV A;  5FV3 A;  5A1F A;  5FZF A;  5F2W A;  4C8D A;  5FZC A;  5F3C A;  5FZ9 A;  4DO0 A;  4ASK A;  4UF0 B;  2PXJ A;  5FUN A;  4E4H A;  4EYU A;  5FYZ A;  5A3W A;  5ISL A;  2P5B A;  5FXX A;  3PU8 A;  5E6H A;  4IGQ A;  3KV4 A;  5F37 A;  4NUB A;  4QU1 A;  2YPD A;  5FPV A;  5FY1 A;  5LY1 A;  5FP7 A;  4BXF A;  5A1L A;  4V2V A;  4HOO A;  5K4L A;  2WWU A;  2GP3 A;  4GJZ A;  5F5A A;  3NJY A;  5IVV A;  3PUA A;  3KVB A;  4EZ4 A;  5A7W B;  5F2S A;  5IVJ A;  3DXT A;  4LIT A;  4CCK A;  5F39 A;  5A7O A;  4EZH A;  5ANQ A;  4XDP A;  5FYS A;  2W2I A;  5IW0 A;  5LW9 A;  4Y4R A;  2XML A;  5FYT A;  5FZB A;  3AVR A;  1VRB A;  5IVF A;  3N9P A;  2VD7 A;  4Y33 A;  5FZ6 A;  5FY7 A;  5FUP A;  4CCN A;  3PUR A;  3KV9 A;  5FYC A;  5F3I A;  5FZA A;  5A3N A;  3PTR B;  2OQ7 A;  5FYY A;  2XXZ A;  4LIU A;  5FPL A;  3K3N A;  5F3G A;  3PUQ A;  4AAP A;  5FZE A;  5IVC A;  4LIV A;  5FZI A;  5LWB A;  3AL6 A;  4QXH A;  5A80 A;  5FZ4 A;  3LD8 A;  3N9M A;  5A7S A;  2YBS A;  5FZ3 A;  4AI9 A;  4D6S A;  3N9Q A;  4XDO A;  5FBJ A;  5FP9 A;  5FZ7 A;  2Q8E A;  5FYU A;  5FZM A;  5A7Q A;  5FPA A;  5FXZ A;  5KR7 A;  4QWN A;  4GAZ A;  5FZ8 A;  3PU3 A;  2OT7 A;  5A3P A;  2OX0 A;  2YBK A;  3PDQ A;  4Y3O A;  5FXW A;  3U78 A;  2WWJ A;  3OPW A;  5LY2 A;  5FY8 A;  2Q8D A;  2YU2 A;  3RVH A;  3KV5 A;  3N9O A;  5IVB A;  4QX7 A;  3LDB A;  4QX8 A;  4D6Q A;  4QXB A;  3DXU A;  3ZPO A;  5FYB A;  5A3T A;  5F3E A;  3UYJ A;  4CSW A;  5FZD A;  2XUE A;  3U4S A;  4CCL A;  4V2W A;  5FY9 A; 
#chains in the Genus database with same CATH topology
 4ATE A;  3AL5 A;  4XAC A;  4QQH A;  4F3J A;  4A45 A;  2Q8C A;  2I45 A;  1CAX B;  4UF0 A;  2GC0 A;  4C0B A;  2WC2 A;  4HVO A;  4YLZ A;  5FXV A;  3ZFF B;  5ABJ C;  3DUI A;  1S0I A;  2JEM A;  3MIB A;  2D5H A;  4D7S A;  3AXD A;  2DUP A;  3NNJ A;  4DPN A;  2JKX A;  3ZXE A;  4UW6 A;  1RUI 1;  1FI2 A;  1Z78 A;  3SCG A;  2Y6K A;  2HWD 1;  2P3I A;  1PX3 A;  1ND2 C;  1RUF 3;  4ARY A;  1YQC A;  4D6R A;  3O0V A;  4C91 A;  4MGT A;  1MVE A;  5FMD A;  3W59 A;  1JYV A;  1XNC A;  2BGP A;  3LDK A;  2E7T A;  4AFA A;  1NA1 C;  4DIQ A;  5A70 A;  1FYU A;  4Q4X 2;  5CFD B;  5DG2 A;  4ES8 A;  1PO2 1;  3FN9 A;  1PGW 1;  2BNN A;  5FBZ A;  5FV3 A;  1ALY A;  4MGY E;  3DGT A;  5DUU A;  4Q5O A;  2ZX2 A;  4QD2 A;  2ARB A;  5DUW A;  4E4H A;  1O6U A;  2HWE 3;  5FYZ A;  3DEM A;  3I2I A;  2QUO A;  4YGB A;  4EN9 B;  2GC2 A;  3GGL A;  3CKH A;  4E8D A;  4RHV 1;  4XBL A;  3VBU B;  1CIY A;  1W2O A;  2HYK A;  2JE8 A;  2P3K A;  3FHA A;  1N1T A;  4IE7 A;  4H2A A;  2CAV A;  3ECQ A;  5FY1 A;  5H9P A;  3ZIW A;  2WO7 A;  5FP7 A;  4BXS V;  4LTA A;  1GNZ A;  4QHO A;  1PMJ X;  4ZU5 A;  4AQT A;  4N7U A;  2B9V A;  4E2G A;  4GJZ A;  2GMP A;  4LHN A;  4KL1 A;  1QHD A;  3AK0 A;  5T5O A;  4OQ9 A;  3PME A;  5JSR A;  2CGP A;  4PT6 A;  1OD5 A;  4YW6 A;  2TBV A;  3ZN5 A;  3N7M A;  1W8H A;  2BBV A;  4Y4R A;  2XML A;  3VLB B;  2ILM A;  1AL2 2;  1OLQ A;  4FXG B;  1D4M 2;  2IXI A;  3H1M A;  3LB9 A;  2PHF A;  4W4Z A;  5KHI A;  2WKK A;  3JBG 3;  5IFP A;  2YYO A;  4PQ9 A;  3GHN A;  2CDO A;  4NRP A;  4R4Z A;  2HEY F;  3HNM A;  5FZA A;  1MAC A;  2TEP A;  4XZU G;  5DAP A;  5JSO A;  1ND2 A;  1VBC 3;  2XXZ A;  5BNN B;  5IAX A;  1AYN 1;  1XU2 A;  1PO1 3;  3I3B A;  3K51 A;  2DYC A;  4AAP A;  1ASJ 2;  1CPN A;  1XU1 A;  4GIQ A;  4MO3 M;  4AVT A;  1Q43 A;  1OOP C;  2D3S A;  1YXW A;  1NA1 A;  4M3C A;  3SKV A;  1WME A;  4R4X A;  4XBN A;  2C5D A;  2Y0I A;  3GNE A;  3ATG A;  2Q8E A;  2OPK A;  4YW4 A;  3MIE A;  5A3U A;  4IV1 B;  4HG6 B;  4QWN A;  4HMZ A;  3WDW A;  2A7A A;  3OD0 A;  1W9F A;  3C7F A;  1ZBA 3;  1QOO A;  4LHL A;  3ZDS A;  4FTE A;  1UY0 A;  5KHH A;  4Q4Y 3;  5EFU A;  1PZ7 A;  2W92 A;  3B9I A;  4BZ4 A;  2N7G A;  4YVW C;  1NAE A;  1H30 A;  3J8F 2;  2VTX J;  3WQ7 A;  4QPI C;  1AUY A;  5FDB A;  1HQL A;  2P3Y A;  5LAT A;  2YMZ A;  1QNY A;  1UZW A;  3CJX A;  4OI2 A;  2WSU A;  1HN0 A;  4CCL A;  3PJY A;  1H2M A;  4XJW A;  4IW3 A;  4MGS A;  3M1H A;  1DZT A;  2R0F A;  4FPJ A;  5IAV A;  3N7J A;  4WZC A;  4JDM A;  1H6Y A;  3LEI A;  1W3X A;  3ZOI A;  5CKN A;  2PHD A;  4MGK E;  4AFM A;  5DZE A;  2ZOE B;  3BTA A;  5F32 A;  4QQO A;  4YZ5 A;  4LUM A;  2BDR A;  2Z42 A;  2Q1F A;  3ZXJ A;  4LOT A;  2L9L A;  4AGV A;  1BBT 1;  1JYT A;  3ITQ A;  2FDG A;  4XFH A;  3UL2 A;  4YAR A;  3MW2 A;  2OUJ A;  5LRS A;  4ZHN A;  4KU8 A;  2DBI A;  4NIG A;  2DVF A;  2R1D A;  4MAD A;  4QPG C;  1G9F A;  4UFL A;  4ZXE A;  1WMX A;  4OUE A;  4XFG A;  4ERO A;  2PHR A;  3WHT A;  5IVB A;  1QXP A;  1VAL A;  1HB1 A;  1W6P A;  2GAU A;  2QDN A;  1GU3 A;  2XJP A;  3K2O A;  4XHX A;  3BU0 A;  3IIA A;  5FOJ B;  5HI0 A;  4XOG A;  2WS9 1;  1XC6 A;  4GD4 A;  1UYY A;  2HWC 2;  2Z69 A;  5EYX A;  3SC7 X;  1R09 2;  5CKQ A;  1O5L A;  4DXR A;  3RZH A;  4XMI A;  5K9Y A;  3NAP B;  4XF1 A;  2R16 A;  4HKO A;  5G05 L;  4ET7 A;  5L73 A;  2JG8 B;  3MHZ A;  3OPZ A;  5F6K A;  2P5B A;  3GBF A;  5GZC A;  2ZX1 A;  3IB3 A;  1UAI A;  3EB7 A;  3R05 A;  3FMG A;  4NUB A;  4OI4 A;  1MEC 1;  4YVW A;  5BNP C;  1J59 A;  5K0U A;  3RJR A;  2RS1 3;  3J7H A;  4FCA A;  4QPI A;  2B8M A;  1FV3 A;  4Y22 B;  4E4Z A;  4NVP A;  2XVG A;  3NJY A;  1PVC 1;  2EVX A;  3VL9 A;  3HMY A;  2VPV A;  4EWE A;  3AP5 A;  1UMH A;  4XW3 A;  1REE A;  1RIR A;  1UY1 A;  1ZA4 A;  2HBT A;  1RXG A;  2WSV A;  2F17 A;  2WZR 2;  3KT7 A;  2JWP A;  3WW2 A;  4BWO A;  5LW9 A;  5JOY A;  4P14 A;  1RGS A;  1RUE 3;  1ULP A;  4CEW C;  2QQM A;  3ILF A;  1F35 A;  1Y4W A;  2DVA A;  2HLE A;  4NN0 A;  4AHX A;  5FZ6 A;  1ZRC A;  4QQP A;  4ZKT B;  1NOV A;  2WT0 A;  4OHX A;  4O65 A;  2R7E B;  3TN9 2;  1JMU B;  5LBF A;  3D3A A;  2Y26 A;  4UFH A;  1UY2 A;  4KI5 M;  5FZE A;  2ZA9 A;  4QPG A;  2BW8 A;  1N3P A;  1QQP 2;  2AH2 A;  2GSY A;  4PJY A;  2RDQ A;  5J48 A;  1XRU A;  2WLQ A;  2DBN A;  1NCR C;  1ONA A;  4RQP B;  1WBF A;  1RUG 3;  1C4R A;  3VHR A;  3S7E A;  1SPP A;  5HCB A;  1L3J A;  4EQV A;  1AXZ A;  4HAN A;  4DNY A;  2VQ0 A;  1OF4 A;  1DP0 A;  3AXE A;  3U07 A;  3SCH A;  3U1X A;  3RJ2 X;  4EN8 B;  1W6Q A;  3CU7 A;  2ZKN A;  2HKX A;  4IET A;  4BQ1 A;  5KC6 A;  4XAE A;  1MS4 A;  3TNP B;  5A3P A;  5LEK A;  1GP6 A;  2G4I A;  1RHI 2;  5IK4 A;  2YBK A;  3THD A;  5BNP A;  4WBB A;  1NZC A;  3HEI A;  1AL0 G;  4G4F A;  4P9L A;  2EIC A;  3RPQ A;  4QX7 A;  1UOJ A;  1VRH 1;  1YQ2 A;  3L2Y A;  3UET A;  1V6J A;  2WYF A;  5DZF A;  4WM8 C;  3EXU A;  3AMH A;  2QNK A;  4XTM A;  3E5U A;  3E5Q A;  5T54 A;  3KD4 A;  3KF5 A;  4YW5 A;  5IWF A;  3WUC A;  1POV 1;  3CF6 E;  5FZL A;  4WM7 B;  4F7Z A;  5D8A C;  1HB2 A;  4CEW A;  3KB5 A;  4QKF A;  2YC2 A;  4UWD A;  1A34 A;  4QGM A;  4B3N A;  1XE7 A;  2VQU A;  4Q29 A;  2LW8 A;  3VBR B;  2ET1 A;  2I07 B;  1JH5 A;  1OA3 A;  3LF7 A;  3WDT A;  3A4U A;  4CZS A;  1MQT C;  2FQP A;  4UXA A;  5AVP A;  3VZM A;  3H8R A;  1AR8 1;  5JDB A;  2XBO 2;  2LRP A;  3FL7 A;  3ZXG A;  4BQX A;  4COZ A;  2DWR A;  3OOX A;  1RUO A;  4MH0 E;  1OA4 A;  3HIF A;  1E5I A;  1R1A 1;  4EN7 B;  1R1Z A;  4M3C F;  3OUI A;  1NY7 1;  1ZRI A;  3MUZ 1;  4LXL A;  4I0A A;  4HVR A;  3B9C A;  4XFA A;  1QDO A;  4CUG A;  3I2H A;  5FZ0 A;  5C3Q A;  1KEX A;  4OHZ A;  2ZGM A;  3BKZ A;  3QOP A;  3AJY A;  4MV2 A;  4DO0 A;  1OT5 A;  4Q4X 1;  3B7M A;  4UF0 B;  5FUN A;  4K7J A;  5FFO C;  4A7Y A;  2XLF A;  4GH4 C;  4U36 A;  4AVS A;  4X8P A;  1NUK A;  5E6H A;  5KXC A;  3JZV A;  1ND3 C;  5JPN B;  3M3O A;  1X9T A;  4GAL A;  4Y5Z 0;  4GA9 A;  1VBE 2;  5T50 A;  3C7H A;  2WWS A;  1EPZ A;  5EXO A;  3AFG A;  1FMD 3;  4FPO B;  5FPZ A;  3VKF C;  1SLI A;  3N36 A;  5I0S A;  1MS9 A;  4TXW A;  2PAK A;  4WM8 A;  2P37 A;  1U5Y A;  3I3E A;  4DRR A;  4LBQ D;  3I2O A;  3NQH A;  3P6B A;  4KWJ A;  4PF5 A;  1CAW A;  1F5F A;  2YPJ A;  3FUO A;  4JGZ C;  1YO8 A;  4KQ7 A;  1DQ0 A;  4QX0 A;  4B7K A;  1OUS A;  3CDZ B;  5A32 A;  1IKQ A;  4RL7 A;  1OKQ A;  2YUE A;  5ANQ A;  4ASM B;  4BQ4 A;  4D8M A;  5D8A A;  1H1I A;  4DY3 A;  1Y7B A;  1XSQ A;  2RDS A;  1SDW A;  4QHB A;  1H0B A;  5LAS A;  1VPH A;  2IFR A;  4GKX A;  1QJU 3;  4GB3 3;  4PI2 A;  3SH3 A;  3TWI A;  4BIF A;  4QT6 A;  2NQY A;  5TSW A;  2XJS A;  1QJX 3;  1MQT A;  2O0O A;  4WVM A;  1D4M 1;  2AEN A;  3OUH A;  3PTR B;  3M3C A;  1KIT A;  1NZI A;  3K3N A;  2EAL A;  3WDY A;  2W87 A;  1JYW A;  4GMP 3;  1QNW A;  1E5R A;  2E31 A;  2MEV 1;  1A6C A;  3AL6 A;  2B42 B;  1EYB A;  3J7M A;  3AZZ A;  4QXH A;  1S1A A;  4XUQ A;  5GLZ A;  3THT A;  2IVI B;  4XIO A;  4A6S A;  3S6P A;  1RUF 2;  1LGB A;  1SFP A;  2UY8 A;  4O9E A;  4BQY A;  5HXM A;  1ASJ 1;  1AX0 A;  2HH9 A;  2BWC A;  1HRV 3;  4JTO A;  2VZT A;  5AFB A;  3FHQ A;  2E53 A;  1U5I A;  2VE1 A;  4XXA A;  2JIC A;  1IZ3 A;  1XPW A;  5H9Q A;  3QBQ A;  4GH4 A;  4AVB A;  2IFW A;  2QQO A;  1ULO A;  4XQ4 A;  2EIG A;  5ACA 2;  5IT6 A;  3ST7 A;  3PDQ A;  2RS5 2;  3FX3 A;  1MS5 A;  2IXL A;  1ND3 A;  3W21 A;  5ABJ B;  4NPL A;  2QE3 A;  5DMY A;  3I2G A;  2ZGN A;  5FY8 A;  2V72 A;  1VBD 3;  2HWE 2;  2RHP A;  4AFB A;  1CIW A;  4NID A;  3OTF A;  2YV8 A;  2XVL A;  5D1I A;  1WMF A;  5F3E A;  2ARE A;  2VME A;  3N4M A;  4YG6 A;  1ND2 B;  3B00 A;  3J8F 1;  4Q4W 3;  3LWC A;  3UKN A;  1WGP A;  2RDR A;  4IV3 C;  4JGZ A;  1RUH 2;  3SIT A;  4NRO A;  1NA1 B;  4P9G A;  5CA6 A;  2ZGU A;  5BYN A;  2VZR A;  2BZD A;  2NPI A;  3GHM A;  2E33 A;  2HWF 1;  2WO3 A;  1WW5 A;  3ETP A;  1GZ9 A;  3I8T A;  3MZH A;  3D4K A;  1HXS 1;  1RUJ 2;  2A1X A;  5FLI A;  2SLI A;  1HB3 A;  2J1T A;  4EWD A;  2VZV A;  2TNF A;  3BI3 A;  4FVV A;  2FD8 A;  1ODN A;  4JRA A;  5IVE A;  3AX4 A;  5FKB A;  3JBG 2;  2CYF A;  2PA7 A;  3C7E A;  3ZSL A;  4BMB A;  2PHX A;  4YRD A;  5FLH A;  3WG2 A;  4HL0 A;  4CU7 A;  5ERL A;  3POW A;  3LFM A;  5GLV A;  3ZXA C;  4FPH A;  3H9A A;  1D2Q A;  4NIH A;  3HNY M;  2VC9 A;  4GJY A;  2WAO A;  2GN3 A;  2DCJ A;  2P3J A;  4HKL A;  5F3C A;  2JX9 A;  2F4P A;  1ULD A;  4CDW C;  2Q4S A;  1OQD A;  2VOT A;  3A0N A;  3NST A;  3PVE A;  1JXN A;  2HWC 1;  1GIC A;  4LBL A;  1R08 1;  4OMD A;  4NPM A;  4HBN A;  4LR4 A;  2C9K A;  4FFF A;  4ARX A;  1T6G C;  1H6X A;  3AM2 A;  1KJR A;  1KD7 A;  2WFP A;  3P5B A;  1XNT A;  4LBM A;  5FPV A;  3MLJ A;  1X33 A;  3T1L A;  2YZ4 A;  1VIW B;  5DAV A;  3B94 A;  4AHW A;  1QJZ A;  5AC9 3;  2WN2 A;  3SHR A;  3M70 A;  2GP3 A;  1PGW 2;  3PUA A;  5I0D A;  4IV3 A;  2Y60 A;  4P5Y A;  3USS A;  1W04 A;  5FMO L;  4I01 A;  3RMY A;  4IEQ A;  1W6P B;  4BQW A;  1BMV 2;  3H3Z A;  1QY4 A;  1UL9 A;  3EO6 A;  3OF1 A;  1HDK A;  4FPL A;  3O1O A;  5DG1 A;  1FPN 1;  1GSL A;  5FYT A;  3NW4 A;  5FZB A;  4ZPI A;  3SNM A;  4Y1U A;  3EMR A;  1GQP A;  3NL1 A;  1DCS A;  3A21 A;  3QD6 A;  4RS5 C;  5GM0 A;  4AVC A;  5C7G A;  1LKN A;  4M4P A;  2DCT A;  3AP4 A;  2WFF 2;  3IDC B;  3MFA A;  1UYZ A;  2LRO A;  1TG7 A;  3S5Q A;  3ZXL A;  3VDD C;  4YVW B;  2R49 A;  1QEX A;  4XFC A;  1UMI A;  4QPI B;  4BIO A;  1UIK A;  2VM9 A;  2XJQ A;  3TN9 1;  4HN0 A;  5B2G B;  5CAD A;  2YGM A;  4IV1 A;  4QDS A;  5EIY B;  1KJL A;  1XNA A;  4QB2 A;  2BBA A;  4M0H A;  2NM1 A;  4CDW A;  1OI6 A;  3POJ A;  2YGL A;  1LED A;  2ZEX A;  4MET A;  2JEN A;  2OYZ A;  3W20 A;  2V4A A;  4RFT 0;  5F8P A;  2JE9 A;  4Y3O A;  1LU1 A;  3OPW A;  3AKT A;  1UXX X;  4QKN A;  4W50 A;  3B93 A;  1OC1 A;  3RVH A;  2YU2 A;  3JCI A;  4CUA A;  2HJI A;  1RHI 1;  2MPF A;  1PMI A;  2XLA A;  3UNP A;  5IK7 A;  3TOJ A;  3J7L A;  1LHW A;  5DAQ A;  2ZZQ A;  1J3Q A;  2XR4 A;  3LGR A;  1W8W A;  1TMF 3;  4QPG B;  1S2E A;  4QM9 A;  4D94 A;  4L92 A;  1D0G A;  1D2S A;  3ZFG C;  1ZA7 A;  2WQ8 A;  4H55 A;  4OHY A;  2OII A;  4J1W A;  1QXJ A;  1SPP B;  1SQ4 A;  3PUS A;  1LOE A;  4FI9 A;  5C70 A;  2WZE A;  2QQU A;  2XJT A;  5F5I A;  2FDF A;  1EY2 A;  4BM8 A;  3T30 A;  3T09 A;  4FO9 A;  3D8C A;  1W6Q B;  1QWR A;  2VXJ A;  5FP8 A;  5FWE A;  2VOX A;  2DFB A;  1BZW A;  3E6D A;  3ZLI A;  3SMH A;  1ACC A;  3OGS A;  5FYM A;  3VDD A;  5BNP B;  1ZZC A;  5FCC A;  5C5T A;  2BVB A;  4ZU4 A;  2CDP A;  3I49 A;  4CCD A;  3FE5 A;  2VBB A;  2XBO 1;  2C1F A;  2J7M A;  1IPK A;  2VOK A;  1MS1 A;  4Q0Q A;  1ZYB A;  4ZS2 A;  3NV3 A;  4YG0 A;  2JXA A;  2ZAC A;  4UAP A;  2ZZJ A;  1HRI 3;  3KS7 A;  4LMF A;  5FZF A;  3UGF A;  5A1F A;  4JGY C;  4PI0 A;  5IYY A;  1E5S A;  4LOS A;  3HJR A;  1GWM A;  1BBT 2;  2ZX4 A;  1CQ9 A;  2EXI A;  5FR3 A;  5KHG A;  2ZX3 A;  4IEZ A;  3SEP A;  4CEW B;  3T2T A;  2PHW A;  5CZK A;  4YM2 A;  4EWA A;  3PVB B;  2IC1 A;  2B9U A;  5LY1 A;  5DAB A;  2XVK A;  1PNG A;  1V9U 1;  1POV 0;  5FTT C;  3AYA A;  3AKP A;  1VBE 1;  3URF A;  1YC6 1;  4PBP A;  2W68 A;  4GQ7 A;  1URX A;  5JXI A;  1L7Q A;  1T2X A;  3CZU A;  3NMB A;  3O5S A;  5G04 L;  5C4W C;  3BTX A;  5F39 A;  4EZH A;  1KFX L;  1NCR B;  1VP6 A;  3ZFG A;  3HR9 A;  2DVB A;  3KT4 A;  1CAU A;  1O5U A;  1T6B X;  3WG1 A;  4FOQ A;  4GWJ A;  4XUN A;  4P9W A;  2GN7 A;  4KH9 A;  3NJX A;  1C1F A;  5JXG A;  3I59 A;  1W39 A;  1K12 A;  3POY A;  4A44 A;  4TTG A;  2ZGL A;  1O7F A;  2QKD A;  3HT1 A;  4L99 A;  4NAO A;  1CGP A;  2A6V A;  5I8T A;  2ZML A;  3U75 A;  3PL0 A;  4PIY A;  4ZZ8 A;  3WNM A;  3AZY A;  2R30 A;  3ZXF A;  3B3Q E;  5J1X A;  2KA3 A;  2W9X A;  3AP9 A;  5FZI A;  4QQ2 A;  1FXZ A;  2YBS A;  3MIC A;  4WM8 B;  3FBM A;  2XUM A;  2CAU A;  3CMG A;  1YRZ A;  4MGQ A;  3O1M A;  1NG0 A;  1STM A;  4XDO A;  1K45 A;  1PM7 A;  4EV0 A;  2MHF A;  1CAW B;  1S4C A;  1W99 A;  4JGY A;  5A32 B;  1RUF 1;  1FOD 3;  1EUT A;  5FZ8 A;  3PU3 A;  3WUD A;  1NLQ A;  1PK6 C;  2JDU A;  3KCC A;  1Q8Q A;  1TVG A;  5D8A B;  1V6N A;  1V0A A;  5CYY A;  2CHH A;  2R04 3;  5C3R A;  1GZW A;  5A6X A;  3UGG A;  1V6K A;  5EPA A;  5ACA 1;  2RM2 3;  1OKO A;  1MQT B;  3ACF A;  3M3E A;  2AYH A;  2RS5 1;  2ZGS A;  4WVM B;  4NRM A;  4GWN A;  1F5J A;  2LM3 A;  1E57 A;  4CSW A;  4OLL A;  3VBS C;  3SCF A;  3I97 A;  2HWE 1;  5J3U A;  4XC9 A;  5C4W A;  1FMD 2;  1UYP A;  2O14 A;  3PLQ A;  1BLZ A;  4UFJ A;  5FPU A;  4KGQ A;  4K20 A;  5J96 B;  1OFS A;  3EHK A;  5L7O A;  4FTB A;  4AQ2 A;  2PMW B;  1VE0 A;  2GAL A;  2PAM A;  4IGO A;  3OYW A;  1XXN A;  4OHV A;  1ZRF A;  2RVA A;  5HBA A;  1COV 3;  1K3I A;  2ZXQ A;  2IUW A;  3H7Y A;  4GH4 B;  5T5J A;  3ZSJ A;  2ATF A;  1J84 A;  1NX9 A;  4UFM A;  1ND3 B;  2WAA A;  4AFD A;  1CWP A;  1RUJ 1;  3A7Q A;  1PVX A;  1JOB A;  2ADE A;  1UW8 A;  2VXR A;  2D5F A;  4E8C A;  1AYM 3;  1DGR N;  1W2N A;  3JBG 1;  3JUU A;  1GYK A;  4ISQ A;  1AVB A;  3SLI A;  3LQC A;  2YB7 A;  4ATF A;  2ZGO A;  2KXL A;  4JGZ B;  4C8D A;  1LHU A;  1NKG A;  2WA4 A;  2D7F A;  2PLV 2;  4Q8K A;  1VBC 1;  3WEZ A;  1OLR A;  2WDB A;  1PO1 1;  5FZ9 A;  1VBA 3;  3SQO A;  3VKL A;  3VBH C;  3WT3 A;  1PK6 A;  2CWS A;  1EAH 3;  2V5D A;  2R06 3;  3WZ1 A;  1AX1 A;  1AR8 2;  1IG3 A;  1QJE A;  5CG9 A;  2W1Q A;  1LEC A;  3ELN A;  4IGQ A;  3I4I A;  1ENS A;  1LGN A;  2YPD A;  3Q8C A;  3VDC A;  4AI0 A;  3FHI B;  1BK1 A;  4B4R A;  5JXH A;  3H8X A;  5CFC A;  1R1A 2;  4PDW C;  1YLL A;  4DRV A;  1XE8 A;  3LEG A;  1NLS A;  1HW5 A;  1NY7 2;  3VD5 A;  4CPB A;  4MG2 A;  3VBS A;  2UWB A;  3ZVX A;  3W5M A;  3RGB A;  3N3H A;  3CHX A;  3WIN E;  3CBN A;  2HWB 3;  4Q4Y 1;  3H3L A;  3CEW A;  3PUH A;  3LEK A;  4XF4 A;  5JCT A;  3T0B A;  5LRR A;  3B01 A;  3ZN6 A;  2H6C A;  2E6V A;  5GZG A;  2QTW B;  2DCY A;  1NXM A;  1RIN A;  3HVD A;  1BJQ A;  1VAM A;  1OH3 A;  2IXC A;  4CDQ C;  1DF0 A;  1TNR A;  2ZHL A;  1BMV 1;  2W47 A;  5IVF A;  1C28 A;  1BQP A;  3O12 A;  2ZMK A;  3NV1 A;  3WDU A;  5SV5 A;  5FUP A;  2VZO A;  2BGO A;  3V64 A;  1OQ1 A;  3S30 A;  5JSP A;  1W0P A;  1U5X A;  2QQL A;  5KHK A;  2K9Z A;  2VOW A;  1YFY A;  1JI6 A;  1EPW A;  4XBQ A;  1H1M A;  4X8N A;  1GZT A;  5IVC A;  2WFF 1;  4YW7 A;  1W8N A;  3IWZ A;  2ZEW A;  3T2P A;  1JZ4 A;  5F9T A;  3RZG A;  4NWW A;  3MI8 A;  3L2H A;  3MUY 1;  5FZ7 A;  5FP9 A;  2FCV A;  4OZX A;  4IV3 B;  1HV0 A;  4UT5 A;  4QU2 A;  5A7Q A;  5FPA A;  1J1L A;  2EIE A;  2JDK A;  2Y6L A;  4U2A A;  1ENQ A;  1ULE A;  3VBH A;  5FPX A;  2VVE A;  3P3N A;  1CAV A;  3J9S A;  1JZ8 A;  2OX0 A;  4K3U A;  4ZY9 A;  4B1M A;  5ABJ A;  3RRD A;  2W5F A;  5JZG C;  1UN1 A;  4ITC A;  1DYK A;  1FNZ A;  2BUK A;  2VCM A;  4BLJ A;  2EAK A;  1X82 A;  2NYY A;  3BOP A;  2MEV 2;  2BRT A;  2VR4 A;  3N9O A;  1YQ5 A;  1H8V A;  3O7O A;  4PDW A;  3DXU A;  3WP5 A;  1W03 A;  1UPI A;  2EA7 A;  2V73 A;  3LKJ A;  4Z82 A;  1X8E A;  2W46 A;  4CU8 A;  4IQP A;  1Q56 A;  2E51 A;  1R64 A;  1AR6 3;  5FYI A;  1LOG A;  2GP5 A;  1NE6 A;  5HV0 A;  1AJK A;  3TEY A;  2VMF A;  3K3O A;  2RS1 1;  3III A;  1JU4 A;  4MGI E;  3W9A A;  1W6M A;  4DXT A;  5A6Q A;  4CDQ A;  4CXX A;  2GH2 A;  1M4W A;  2LS6 A;  3NNG A;  5FZO B;  4CCC A;  2Q5T A;  4CDW B;  5CIS A;  3TEZ A;  2DUO A;  1C3H A;  1WCK A;  1A8D A;  4I02 A;  4AI2 A;  2JEC A;  3ORJ A;  4XJZ A;  2BU9 A;  2A6Y A;  2BTV C;  2B7Y A;  4JKL A;  2G9Z A;  2VMD A;  4OI0 A;  2E9Q A;  4Z1V A;  4HN1 A;  3GBG A;  2LAL A;  2OQ6 A;  4Q1P A;  3LCP A;  1RUE 1;  3K48 A;  4ONU A;  1BYH A;  3POG A;  1OLM A;  3IM0 A;  5FY5 A;  4S2G A;  3GDB A;  3ZM8 A;  1X9P A;  3ZYF A;  5FYH A;  4YNI A;  2GC3 A;  3DYO A;  4M00 A;  2JDY A;  1MZF A;  1CX4 A;  1US3 A;  2FZ2 A;  2HWF 2;  3LSD A;  4C0H A;  1HXS 2;  1OHF A;  1DLC A;  4FPK A;  5A3W A;  4ZU7 A;  4M01 A;  2VUA A;  2P6H A;  3E6B A;  5DAW A;  3RI8 A;  4RD7 A;  2EXH A;  4MSV A;  4Q4V 3;  3KV4 A;  4TLG A;  3ZO0 B;  5JZG A;  4C90 A;  3MPB A;  4PHZ A;  1OVS A;  1DLL A;  1WKY A;  2DVG A;  4MVT A;  3PMS A;  4PIZ A;  4NII A;  1JZ5 A;  3ZYB A;  4BLI A;  3U14 A;  1QDC A;  4JCK A;  5FO9 B;  3FFQ A;  3ZMO A;  2XL9 A;  2W95 A;  3ACG A;  3VDD B;  4F83 A;  1OPO A;  4DB5 A;  1DGR A;  1OOP A;  4G9S B;  3BPZ A;  3IKW A;  5FAX A;  1NQD A;  4SBV A;  3K4A A;  4HVQ A;  3QAC A;  3AMP A;  5A7O A;  2IXK A;  3I2J A;  3RYP A;  4D69 A;  1KRI A;  4H7L A;  1RTV A;  4B7E A;  1CZS A;  1YJL A;  1R08 2;  3FZ3 A;  2W2I A;  4TWT A;  3WY6 A;  4Q1R A;  4Y33 A;  4PQQ A;  1W28 A;  4IEO A;  1B09 A;  4Y1X A;  4RGA A;  3NNL A;  1ULC A;  5KXD A;  4MZU A;  5ANN A;  1YWK A;  5FIX A;  2E7Q A;  5FPL A;  2VGD A;  4GKY A;  3VHO A;  3NWK A;  1VJ2 A;  4LIV A;  4LO6 B;  1HJG A;  3V0A A;  4MXW A;  4NPR A;  2P34 A;  1YNA A;  3N9M A;  2OZJ A;  2ZAH A;  4H7M A;  1GUI A;  1UU4 A;  5I0T A;  5CKM A;  4BQ3 A;  1K42 A;  4AEK A;  5BNO C;  1FPN 2;  4H3W A;  4W6Y A;  1LB2 A;  3C3V A;  4WVZ A;  5CIR A;  3ZFG B;  1JZ3 A;  4LO4 B;  1DQ1 A;  2OT7 A;  1DDL A;  1CAU B;  1XQN A;  2BYV E;  5D21 A;  5FMO S;  5F7U A;  1HRI 2;  4FQ4 A;  3I3M A;  5EYY A;  2CV6 A;  1IHM A;  5LY2 A;  3I59 B;  4N9I A;  1XYN A;  2ADD A;  2WQ4 A;  4FOV A;  4UW4 A;  4CP0 A;  4FFG A;  1P8J A;  5L9R A;  4AVA A;  3IDB B;  3LDB A;  1BEV 3;  3T3Y A;  5LBC A;  4Y1Y A;  3POE A;  3PUI A;  4K40 A;  1AR7 3;  4B1L A;  2Z5W A;  3MLK A;  4J25 A;  5IK8 A;  1DZQ A;  1ZBE 3;  2RV9 A;  3G7D A;  3VN4 A;  2QQP A;  2ET7 A;  4OI1 A;  4AW7 A;  4JX0 A;  3HBZ A;  4JHZ A;  1RB8 G;  5CEH A;  3J4U H;  3N9L A;  1V6M A;  1W2T A;  4LUL A;  1FMD 1;  4JAA A;  1CX1 A;  4R9D A;  1O4Y A;  4JGY B;  4RYD A;  4OZO A;  1Y43 B;  2AGS A;  2Y6F A;  4CDX C;  2W1S A;  3JU9 A;  4XFF A;  4CCJ A;  4D7Y A;  3D5O A;  4COW A;  2J22 A;  2BJS A;  2BGC A;  5CNA A;  4LK6 A;  1LHO A;  3K46 A;  3KF3 A;  4K9S A;  1GZW B;  3M7A A;  3OY8 A;  1X7N A;  5LCW L;  5KXB A;  4TN7 A;  3OGG A;  1TEI A;  3N9N A;  4RGK A;  5DDJ 3;  2BPA 2;  1PNF A;  1Y3T A;  3DYP A;  3WQB A;  2DVD A;  1QJU 1;  3EBR A;  4GB3 1;  4HSL A;  1Q8O A;  1JZ6 A;  2VAU A;  3T1M A;  1QJX 1;  5BNO A;  2Y8K A;  4AZZ A;  2R1B A;  3LFI A;  3ZYR A;  1C8M 3;  1O91 A;  5C4W B;  3C2U A;  1LOB A;  4Q0S A;  4BYY A;  3B02 A;  5L7O B;  4CEY C;  4QX5 A;  3ZN4 A;  4JDN A;  2Y64 A;  4QHZ A;  5DQ0 A;  2PLV 1;  3KGZ A;  1H2N A;  3INA A;  3OYW B;  4Q26 A;  3DN7 A;  2CSG A;  5C9A C;  1MS3 A;  2NMO A;  2RMU 3;  4YVS C;  1OUX A;  1HRV 1;  3FC0 A;  4XQW A;  4AVV A;  1O3T A;  1RUD 3;  2VUL A;  3V56 A;  3UT0 A;  5K4L A;  1Y9Q A;  4A6O A;  1Z0H A;  2R04 2;  5F5A A;  3WF0 A;  3CLP A;  5GLT A;  2ZJC A;  2KD7 A;  1MEC 3;  2NN8 A;  1NCR A;  1BK0 A;  2RM2 2;  2C24 A;  1M06 G;  4LK7 A;  1UKR A;  4LBQ A;  4OVE A;  1J1T A;  3T0D A;  1VMF A;  2X5I C;  1VBD 1;  2OA2 A;  5I93 A;  4IER A;  2BP6 A;  3ZIX A;  2CY6 A;  1SCS A;  2WNO A;  4GZ9 A;  2ARC A;  1JHN A;  4LLF A;  1GP5 A;  1PVC 3;  1H8T C;  1ZX5 A;  4M3C E;  3AVR A;  4CDX A;  2PQQ A;  1ZVF A;  1Y9G A;  2ZGK A;  3ACI A;  2ZAB A;  1PK6 B;  1Q8P A;  3PUR A;  4Q4W 1;  3WNO A;  4CP1 A;  4B29 A;  4Q27 A;  5F3I A;  3ES4 A;  1V9U 2;  2XB6 C;  4GUL A;  2QQW A;  4IXL A;  2VMH A;  2AR6 A;  3F2Z A;  5L9B A;  3WF3 A;  4FBF A;  3VDB A;  4BOW A;  1LEM A;  3PIJ A;  3O0W A;  5C5U A;  1RC6 A;  4CXW A;  5CFC B;  4FPY A;  5GZD A;  1FNY A;  2GZW A;  2VMI A;  1UCX A;  2V4V A;  4HXC A;  4AI8 A;  4OFG A;  3VBS B;  2XG3 A;  3UGH A;  3UKT A;  5HXV A;  3VV1 A;  2Q1Z B;  2JD9 A;  5EWS A;  2YDE A;  1C1L A;  3IT8 A;  3MBW A;  4XAA A;  5DUX A;  4DIN B;  1AYM 2;  1W8F A;  3BPS A;  1S0J A;  1IOA A;  3CZJ A;  4W6X A;  2JD4 A;  3WW3 A;  1YCI A;  4BK4 A;  4FSJ A;  4CEY A;  3OBA A;  3ZN6 B;  4A7K A;  4TSV A;  2C4X A;  3ILN A;  5JOW A;  4QB1 A;  5CG8 A;  2JIG A;  4P02 B;  5LA1 A;  4HZF A;  1RVF 3;  2RS3 3;  1OSG A;  5C9A A;  2W91 A;  2ZCW A;  4E9K A;  2X09 A;  1VBA 2;  3TRS B;  3E5X A;  4Y1V A;  2R06 2;  1JYI A;  5KHJ A;  4XET A;  5IFT A;  3R4S A;  1YFX A;  2Y33 A;  3LA2 A;  4HT1 T;  1SBD A;  3KCY A;  2A73 B;  4HK8 A;  4COY A;  1S55 A;  1WD4 A;  1H9W A;  3MID A;  5FY0 A;  4QPY A;  2FMD A;  2X5I A;  2EXJ A;  1SLL A;  2YBP A;  4YZ3 A;  5GJ6 A;  4GXL A;  2BNO A;  4YYO A;  2GH8 A;  5AC9 1;  4L8Q A;  5FP4 A;  2VOV A;  3IAQ A;  3HT2 A;  3VBH B;  5C3P A;  1CAV B;  5FRA A;  1Q8V A;  3NNM A;  1LNS A;  2E7A A;  2XJV A;  4MHU A;  3VDA A;  4MLO A;  3ACH A;  1JS9 A;  3VD9 A;  1F15 A;  3MGU A;  4PDW B;  3DYM A;  2BEO A;  5FZK A;  3D0J A;  3TB0 A;  1A78 A;  2OPW A;  3VZO A;  1WD3 A;  3DV8 A;  4NRQ A;  4TZD A;  4KWK A;  1S0B A;  5A3M A;  3F95 A;  5C33 A;  1UMZ A;  5GLU A;  1HB4 A;  1UZY A;  3D0S A;  4QX1 A;  1QXR A;  4GWM A;  3QLQ A;  3ZSM A;  2DCZ A;  3GZU C;  4JV4 A;  3VZK A;  4EYU A;  5LK7 B;  3WP3 A;  3LDR A;  1SFY A;  1W6M B;  3FLP A;  4KNC A;  4WVV A;  4FAH A;  4DS0 A;  3D82 A;  4CDQ B;  2RJL A;  3MIG A;  1GOG A;  2QDR A;  2BFU L;  4DFS A;  4K1Z A;  3J7N A;  2RJK A;  2RR1 3;  3O1R A;  4BXF A;  3ZKY A;  2UUR A;  2DU1 A;  4HPK A;  1V00 A;  1K5J A;  4XYX A;  3P3P A;  2A3W A;  1TME 3;  2IWG B;  3HPN A;  3O1V A;  1YUD A;  1LU2 A;  4NHM A;  2JB8 A;  1VBC 2;  3DXT A;  1MPX A;  4LQR A;  5F2S A;  1XNB A;  1PO1 2;  3ZFE C;  1EP0 A;  2D6K A;  2H6B A;  4O7X A;  2DFC A;  5A33 A;  2XGX A;  2VNR A;  3JD7 3;  1N1V A;  5K0U C;  1AR6 2;  3WQ1 A;  3E6C C;  3H8U A;  2WIN B;  2XHN A;  4XCB A;  5LA9 A;  3RWN A;  4DOU A;  3OBT A;  3ROU A;  1BHG A;  3AMN A;  1KFU L;  4CUC A;  2GNM A;  5JZG B;  1QOS A;  1ZBA 2;  1IQD C;  5FO7 B;  4IL7 A;  2P2K A;  3QH6 A;  4P5H A;  3RZZ A;  4Q4Y 2;  4FPG A;  4MUV A;  4BJ0 A;  4IE5 A;  3LD8 A;  4NE9 A;  1RMU 3;  1AL2 3;  3R0R A;  4NAM A;  2DUR A;  4YZ1 A;  2WZ8 A;  2HEW F;  2PHU A;  4JQR A;  4LPL A;  4B4P A;  1OOP B;  4XMA A;  4FFI A;  3TAY A;  4OQ8 A;  3WDX A;  1YFW A;  2EAA A;  3E1F 1;  2P6C A;  1VMJ A;  4P9Y A;  1V70 A;  3U0Z A;  1SG3 A;  4Y4Y A;  3H1Y A;  2R32 A;  1S0G A;  1O3Q A;  2R07 3;  1W9T A;  4QMA A;  4AG4 A;  2VVD A;  1VBB 3;  5DZG A;  4CUB A;  1AXY A;  4I0W B;  4IEW A;  4XAB A;  3NVC A;  1UX7 A;  2RE9 A;  4KU7 A;  4XEZ A;  1HRI 1;  2OW4 A;  3H0O A;  3WCR A;  4ASL A;  5I0U A;  4Q4V 2;  2ZGQ A;  4YM0 A;  5FZD A;  2Y34 A;  2O8Q A;  5FRE A;  2XUE A;  2JDN A;  2E63 A;  1W0N A;  1WLC A;  1VAK A;  5FLJ A;  3I2D A;  3V0A B;  4MXW B;  4D3W A;  1I5P A;  1O4Z A;  2J42 A;  2VG9 A;  3ZFE A;  4AEJ A;  3O1U A;  1RL3 A;  2EID A;  1LHN A;  1PZ8 A;  5FZO A;  4AHZ A;  5J98 B;  3WV6 A;  2OS2 A;  4N9H A;  3GJA A;  5JUV A;  1AR9 3;  2P17 A;  2ZX0 A;  3AYC A;  3GM8 A;  1UOF A;  2WR9 A;  4XFB A;  5FYV A;  3WHU A;  4BQ5 A;  1TE1 B;  4NO4 A;  3R4D B;  2VBD A;  4JC1 A;  1I5Z A;  5H9R A;  4N53 C;  5IHR A;  3BCW A;  2CNA A;  4AR2 A;  4A3Z A;  1GAN A;  1O8S A;  1RUC 3;  2VTX A;  3FLT A;  5K7P A;  3CJI C;  5FMC A;  1W8O A;  2H0V A;  2VZP A;  3AZV A;  2JIJ A;  2YC4 A;  1FV2 A;  3WF4 A;  4EN6 B;  2RS1 2;  5BV6 A;  2WNU C;  3KLS A;  2CU5 A;  1SLA A;  2ZHM A;  4K8F A;  5AFE A;  1UPS A;  2J1E A;  2VBP A;  3BU7 A;  4H14 A;  4URA A;  2EF6 A;  5DN2 A;  4N43 C;  4P08 A;  1QJF A;  3FFZ A;  3OEA A;  2ZGT A;  4Q0P A;  3WCS A;  2C6S A;  2OXB A;  2BV4 A;  3RG0 A;  2PXJ A;  5ISL A;  4XUO A;  5E1R A;  5C3O A;  1O3S A;  2DV9 A;  1LAJ A;  1YIF A;  3MFC A;  1WCQ A;  4RS5 A;  1EV1 3;  2Q0A A;  2P4E A;  4X6Q B;  1DGW X;  2WT2 A;  3ETQ A;  1RUE 2;  4QKD A;  4I3G A;  4TYS A;  1W06 A;  5J09 A;  4V2V A;  1R09 3;  1FOD 1;  4HKW A;  1J3P A;  2DCK A;  3OG2 A;  3OY8 B;  1LOC A;  3HQU A;  4V1P A;  2VZQ A;  2R04 1;  4R9B A;  4KGG A;  4XDP A;  1AR7 2;  1E5H A;  1NYW A;  4QQL A;  1ZBE 2;  2RM2 1;  5BNO B;  2QQN A;  2XOM A;  3BTY A;  2Y6G A;  4Y24 A;  1RUG 2;  3AFK A;  4AAX A;  4LBK A;  2QJV A;  1PGL 2;  3KV9 A;  1DFQ A;  1LOF C;  2PHT A;  1AJO A;  4C1W A;  4DEV A;  5A3N A;  4N53 A;  3J26 N;  2QQI A;  4LKS A;  5JMC A;  3DCQ A;  4W6W A;  3UV9 A;  3CJI A;  2WZR 3;  2B5H A;  3KGL A;  2W08 A;  3THP A;  3LA3 A;  1XYO A;  2C26 A;  1POQ A;  4P00 B;  4YM1 A;  5FZ3 A;  1COV 1;  5HCH A;  1JOP A;  1X50 A;  3O1T A;  3C8X A;  5HV4 A;  4GMP 0;  4KBB A;  4IE0 A;  1SCR A;  5FKC A;  4N43 A;  3KHC A;  4UOJ A;  2YC0 A;  1N47 A;  4COU A;  1JUH A;  1RYY A;  1XBF A;  2I74 A;  3HN1 A;  1ZM1 A;  5KR7 A;  5JR7 B;  3CQO A;  4GAZ A;  4LBQ B;  3HBK A;  4KMQ A;  1Q3E A;  1N3Q A;  1KS4 A;  3TN9 3;  3HN3 A;  2AUY A;  2VTF A;  1AYM 1;  3M3Q A;  1QQP 3;  1GKB A;  4CDX B;  4PIX A;  1TQ5 A;  4QX3 A;  1FT9 A;  2XLG A;  2W39 A;  2WII B;  4D6Q A;  1UU5 A;  5FYB A;  1XND A;  2B4K A;  1VBA 1;  5DUV A;  1EAH 1;  2R06 1;  5LK5 A;  3U4S A;  1AHS A;  2Z2S B;  4CVU A;  4HLT A;  1LRH A;  5E16 A;  2B39 A;  3KQ4 B;  3PHM A;  3FWE A;  4FP3 A;  4KG0 A;  2A3X A;  3ON7 A;  2XQX A;  1WCU A;  2ENR A;  1CVN A;  1JU3 A;  2ARA A;  1VLN A;  2ORZ A;  1ZZ7 A;  1GQH A;  2GMM A;  3HWJ A;  3ZX7 A;  1OMI A;  2A6W A;  2VZU A;  4LA3 A;  3WQ0 A;  3FBY A;  4RN5 A;  1YI7 A;  4A2U A;  4CEY B;  4E4S A;  1LOF A;  2HWB 1;  1NQJ A;  3WSO A;  1SEF A;  3MPP G;  5I8S A;  4YM3 A;  5C9A B;  1Y9M A;  5LEJ A;  5DAX A;  3POS A;  4N90 A;  1SAC A;  3HAG A;  2WYS A;  2WLP A;  4A7Z A;  5F1R A;  5FWJ A;  1G86 A;  3VBF C;  4CU9 A;  2R0H A;  3L9J T;  3A23 A;  1UNB A;  2UYB A;  2IVJ A;  4JHT A;  2YXS A;  3D6E A;  3TNQ A;  1JBC A;  2AEZ A;  1MS0 A;  5IK5 A;  4HET A;  2WQZ C;  2BOI A;  3LPG A;  1JOD A;  2X5I B;  3ZYI B;  4Y5T A;  5I0R A;  2XPJ A;  2VCB A;  4AFC A;  5C8C C;  1WA6 X;  3ZMN A;  1SHW B;  4Q2F A;  1JYC A;  3AMM A;  3NO8 A;  1VR3 A;  4HK9 A;  3DEC A;  4WZF A;  2CTV A;  4XXP A;  2QVS B;  5A3O A;  3IMM A;  1QJU 2;  3G6J B;  2RS3 2;  3Q9O A;  4FQZ A;  4GB3 2;  2ZHN A;  2W1U A;  2D6N A;  1QJX 2;  2PTM A;  1A3K A;  3RSJ A;  5IVV A;  4RFR B;  1BVP 1;  1YJK A;  4JDO A;  3LZZ A;  1RXF A;  2OZ6 A;  1X8M A;  1Z7S 3;  3VGI A;  1DU3 D;  3BAL A;  1GLH A;  4XTP A;  5EZW A;  1CZV A;  2JDM A;  2PN5 A;  5IW0 A;  3VKM A;  1VBE 3;  4LHS A;  3DPR C;  2A6X A;  3MYX A;  2FZ1 A;  3K4D A;  3N9P A;  2VD7 A;  1HRV 2;  2ZMN A;  5JIA A;  3PIG A;  1DQ6 A;  1WW4 A;  4NHY A;  1AR6 1;  1ENR A;  5BY5 A;  3POI A;  4Z8B A;  3T2Q A;  5B4X A;  5GKA C;  2ZPX A;  5L36 A;  4FPF A;  3WF1 A;  1F31 A;  4YZ4 A;  5HCF A;  4CYD A;  5F3G A;  4IEP A;  3QCW A;  3Q8F A;  4IEU A;  1LES A;  1BCX A;  2X53 S;  1C57 A;  3MEP A;  3VBF A;  1ZBA 1;  1VBD 2;  4HPK B;  4AI9 A;  4D6S A;  5CB7 A;  5FBJ A;  2NMN A;  2VW0 A;  5T3N A;  1IS4 A;  1W6O A;  2QQJ A;  2OVU A;  2RG4 A;  3WNL A;  3AJZ A;  2HBU A;  1HIX A;  4FP2 A;  2CGO A;  4Q4W 2;  3GXU A;  5A33 B;  5C8C A;  3IPV A;  1UD1 A;  5T52 A;  5CVR A;  3OGJ A;  2Y6H A;  4IDZ A;  3IDA A;  1CON A;  1LHV A;  2YG0 A;  1ZRR A;  4NHX A;  5A3T A;  1HJF A;  2IXJ A;  4XE9 A;  3UYJ A;  4AHY A;  1RIT A;  2VNV A;  1ZZB A;  3HQX A;  3X29 B;  4OMC A;  3AZW A;  4A3X A;  1RJ7 A;  2RR1 2;  1ZZ8 A;  3M8L A;  1SLC A;  3RI9 A;  4Q4V 1;  4Y1Z A;  1LR5 A;  2Q8O A;  5ACA 3;  3AKS A;  1FX5 A;  2RS5 3;  5FP3 A;  3GAL A;  3N35 A;  4YZ2 A;  2W1W A;  1PIV 3;  1TME 2;  3DPR A;  3RYR A;  1TNF A;  3UJQ A;  5C8W A;  2HEV F;  3WXP A;  4CCM A;  4UFI A;  1QJY 3;  1ZZ9 A;  2G19 A;  1DHK B;  3NV4 A;  4CPB D;  1PX4 A;  2JDH A;  3JD7 2;  4IGP A;  4QXK A;  5J37 A;  1EUU A;  1L7L A;  3ZR6 A;  1BXH A;  1RUH 3;  2QFE A;  3QH7 A;  2GDF A;  4SLI A;  4W65 A;  4R9A A;  4MGZ E;  1SDD B;  2O1Q A;  2ARX A;  1W6N A;  4XQD A;  1QF3 A;  3SIS A;  2A3Y A;  2YRO A;  3RWK X;  4BQ2 A;  1OPM A;  2G1M A;  2WNE A;  3VKN A;  1GV9 A;  4IE4 A;  2FCT A;  4LO5 B;  1VMH A;  4IE6 A;  2FCU A;  4JRL A;  5F5C A;  4XF3 A;  2WNV C;  3AB0 A;  5AC9 2;  1RUJ 3;  1H1A A;  1X36 A;  1CJP A;  3GZE A;  3T2O A;  4A41 A;  1RMU 2;  3ZFE B;  1XYP A;  3B5L B;  4XJU A;  5T5L A;  5FXX A;  4CDU C;  1VB4 A;  3MIH A;  2HYX A;  1AXK A;  2X8K A;  1C8N A;  3OJB A;  1WLD A;  1F9K A;  4AI1 A;  4LEJ A;  3LAG A;  3C7O A;  1JYN A;  1JZ7 A;  1ULG A;  3BB6 A;  1SBF A;  5IAT A;  2R07 2;  3KHB A;  4XIL A;  4UYB A;  1VBB 2;  3BOD A;  4L2N A;  2LTN A;  1JTZ X;  2BOJ A;  4AL9 A;  4F8A A;  2JB4 A;  4Z2A A;  5LBE A;  3WG3 A;  1RUI 3;  4CCK A;  3A0K A;  1W2U A;  5EV7 A;  3BUC A;  2HWD 3;  4BE3 A;  3UK9 A;  3GCX A;  4UW3 A;  3KT1 A;  4DUW A;  2OUH A;  1BEV 1;  5FUI A;  2JDZ A;  5GAL A;  3BN6 A;  4LO7 A;  4CP9 A;  2X29 A;  2VJX A;  1AR7 1;  2VU9 A;  1ZBE 1;  3DKW A;  2VCA A;  2D98 A;  1B35 C;  1GOH A;  2JKB A;  1ZRE A;  2NLR A;  4LE3 A;  3POF A;  4E4D X;  1PO2 3;  1UIJ A;  5FOB B;  1RUG 1;  1GFF 2;  2XL7 A;  2GND A;  3IMN A;  4RS5 B;  5LBB A;  1AR9 2;  4BME A;  1GP4 A;  5FYY A;  1PGL 1;  4DEQ A;  1GMM A;  2NZ9 A;  1AZD A;  1K5M C;  2TUN A;  1IG0 A;  3KSC A;  4QKB A;  5FMB A;  1UWW A;  1W90 A;  2BFU S;  5A7S A;  4A4A A;  1OD3 A;  1XOY A;  2G9F A;  1DYO A;  2VUC A;  3ASI A;  3A22 A;  2UU8 A;  4RHV 3;  5M0T A;  1RUC 2;  2WNV A;  5DPN A;  3VBO C;  4XUT A;  5FYU A;  3R4U A;  2AZ5 A;  4URT A;  3R6S A;  3SH5 A;  3O0X A;  1WA4 A;  3T08 A;  4BDV B;  2WFF 3;  1GWK A;  3S7I A;  2QZ2 A;  2QZ3 A;  1TMF 2;  3GYD A;  2F4L A;  5JI7 A;  4ZXK A;  1W9W A;  4ISR A;  4CDU A;  3ZXK A;  5A6Z A;  5DDJ 1;  2GC1 A;  4HSJ A;  4L97 A;  1LOD A;  2ES3 A;  2ZTN A;  2WWJ A;  5I8Y A;  3TYJ A;  1WMD A;  3PJQ A;  3IN9 A;  1BVV A;  1C8M 1;  4QX8 A;  1WW6 A;  4QXB A;  4L9B A;  1EV1 2;  2WO1 A;  4N53 B;  3MO4 A;  4I0B A;  1YQ6 A;  2AAC A;  3U10 A;  2VCC A;  2VUJ A;  5FQ0 A;  1HLC A;  4DZG A;  3CJI B;  2VQA A;  3B69 A;  3JB4 C;  4FPE A;  4DXS A;  4EJR A;  3AZX A;  1IQA A;  3PNA A;  2UWC A;  2VMC A;  4IEY A;  4AQS A;  1S0C A;  2MNG A;  5FPB A;  2X05 A;  1D7P M;  2RMU 1;  2WNU B;  4XFI A;  3FJS A;  1RJ8 A;  1UOB A;  1AYN 3;  1H2K A;  4XJA A;  1RUD 1;  4N43 B;  2VY0 A;  3HOB A;  4WV8 A;  1PMH X;  3BTZ A;  2ZKL A;  3VHP A;  4NHL A;  2PQS A;  4YPJ A;  4QX2 A;  5A7P A;  4E2S A;  1B35 A;  2D6P A;  2XHK A;  2Q30 A;  4Y5S A;  1J58 A;  4QXC A;  3ALQ A;  3NJV A;  2OKX A;  4CCO A;  1JOJ A;  5C6C A;  1ST8 A;  3ZXD A;  1OBN A;  1NCQ C;  4S2D A;  4WVW A;  1K5M A;  4Z2W A;  4IUG A;  2ERF A;  2VQT A;  4AYU A;  5A7W A;  1IGO A;  4D0Q A;  1A8M A;  3MDP A;  2VH9 A;  4FT8 A;  3WW1 A;  1KGY A;  1SLB A;  2EXK A;  2R6Q A;  4NIA A;  3VBO A;  1G9C A;  2J1R A;  3ILR A;  4JZR A;  4OYU A;  5F2W A;  1I3H A;  1DZR A;  5FZC A;  4LOR A;  1QOT A;  1GQG A;  1NXD 1;  1S2B A;  4I30 A;  4RA0 A;  3GZT B;  3IBM A;  3OBR A;  2IZW A;  3DL3 A;  4QDQ A;  5LA0 A;  4XPV A;  2CGN A;  4YG3 A;  3KM5 A;  2PYT A;  1KDM A;  1KS5 A;  3GJB A;  4Q8L A;  3O1P A;  1ULF A;  5LA2 A;  1XNK A;  1LOA A;  2WWU A;  5A3L A;  1HX6 A;  3TEX A;  1FAT A;  3JQX A;  4O9G A;  1BBT 3;  2A5Z A;  3IAP A;  3S0M A;  4ZON A;  1RVF 1;  2RS3 1;  1YEW A;  2XKP A;  4XF9 A;  1NE4 A;  4I2O A;  4O61 A;  4XVH A;  5JPM B;  4DXZ A;  1WZX A;  1IPS A;  4P9I A;  4RR3 C;  4UW5 A;  2DF7 A;  2KR2 A;  3KQR A;  1G8W A;  1CR7 A;  2XH6 A;  4ZS3 A;  3NRU A;  3I7D A;  4GMP 1;  4CCN A;  3C7G A;  4NMI A;  2FDH A;  2D6M A;  5KWR A;  2WS9 3;  5KC5 A;  1JHJ A;  2Y0O A;  4AED C;  1FOD 2;  4W8J A;  1U5Z A;  3IDE A;  3MW3 A;  3O14 A;  1NCQ A;  3P1I A;  3EYP A;  3UKV A;  4DY5 A;  2YFZ A;  1KDK A;  5LB6 A;  4Y20 A;  5CFC C;  1ENX A;  1G9A A;  1CD3 G;  1QH6 A;  3V0B A;  4IES A;  5IUQ A;  1H9P A;  3N7L A;  4CA9 A;  4PLO A;  1OUR A;  2DU0 A;  3WDV A;  1V6I A;  3JB8 A;  4LHK A;  4N7I A;  1F4H A;  2AEY A;  1PGS A;  2WZP P;  4L11 A;  1UY3 A;  1W2A X;  4CE8 A;  5H9S A;  4JTN A;  4QPW A;  1WCD J;  1YFU A;  5BUV A;  1MZ6 A;  5FXW A;  2YFU A;  4BH9 A;  5L19 A;  1LJ7 A;  1PZ9 A;  4BB3 A;  4TLF A;  1UZV A;  1COV 2;  4I09 A;  4NR1 A;  4PBO A;  3RMX A;  2XJR A;  4CTE A;  3BIE A;  1JZ2 A;  3OB8 A;  1PHM A;  3JXS A;  4UFK A;  4V2W A;  4ASK A;  2BQP A;  5L9V A;  1LTE A;  1LGC A;  2IXH A;  3VBF B;  2D40 A;  4NWV A;  4BIS A;  4R8H A;  2J1V A;  3AKQ A;  1G9B A;  5IVY A;  2ETE A;  3LIH A;  2RR1 1;  1SLT A;  4RR3 A;  1OLM E;  2WO2 A;  4PLN A;  1O4T A;  3PVN A;  4LBN A;  4L0P A;  1W6O B;  3M2M A;  4QM8 A;  5D2A A;  5A1A A;  1Z7S 2;  4AQ6 A;  5JWP A;  1HQN A;  3ZYH A;  2W52 A;  1LCL A;  3PTY A;  1GZC A;  5FY4 A;  1SFN A;  4OUS A;  2KM2 A;  4J6G A;  3RS6 A;  5JXJ A;  1TME 1;  2XJU A;  5C8C B;  3IPV B;  5BNQ A;  4EN0 A;  4AED A;  2JG9 C;  1XE0 A;  3KZ4 C;  4YVS A;  2VVF A;  2LUW A;  3H42 B;  1EAH 2;  3OGV A;  3LOB A;  3JD7 1;  4HON A;  3VL8 A;  4MYE A;  1UO9 A;  1W9S A;  1WUV A;  1W05 A;  2WUH A;  1V6L A;  3O1S A;  1UOG A;  1QH7 A;  1ZZ6 A;  1IS3 A;  1YI9 A;  1UY4 A;  2D6O X;  3OBZ A;  2D3R A;  3U37 A;  4FTS A;  3CNA A;  2UWA A;  2ZBJ A;  4MHR A;  2XDV A;  4M0N A;  3AKR A;  3ZFF C;  1N1Y A;  1VRH 3;  4ORF A;  3USU A;  4AI3 A;  3OCP A;  5KBF A;  2WT1 A;  1FAY A;  5A6Y A;  2RDN A;  3CIH A;  2Y6J A;  2HWB 2;  2XWB B;  2JJ6 A;  3LE0 A;  1H8T A;  1UZZ A;  3DPR B;  1RMU 1;  4X6R B;  3ZPY A;  3GF6 A;  1AL2 1;  4I3P A;  4LUK A;  2QBX A;  5GLW A;  4CRQ A;  1POV 3;  5HCA A;  1APN A;  4K21 A;  3RZL A;  5T5P A;  5CBL A;  1Q5O A;  5JMO A;  1J3R A;  3VZL A;  2A70 A;  3H50 A;  4HOO A;  1W9Y A;  2D6L X;  2GNT A;  3VUO A;  4YW1 A;  2PLV 3;  3CL1 A;  3EQE A;  2W94 A;  4XHB A;  5CFD C;  2J1U A;  1W6N B;  2W0X A;  5T55 A;  3VD3 A;  4LIT A;  2R07 1;  1AR8 3;  4R9C A;  1VBB 1;  5HPO A;  3HNB M;  3KWV A;  1GR3 A;  4XF0 A;  5BPX A;  2C9A A;  1W8U A;  4XCA A;  5FO8 B;  4Z07 A;  4OCT A;  3ME2 A;  1OQE A;  1MS8 A;  1R1A 3;  2PFW A;  3GBW A;  3SEE A;  1F8V A;  4QGN A;  1DYP A;  3VBU C;  4K8R B;  2Z4F A;  3BIW E;  3UJO A;  1N1S A;  5FY7 A;  3HD8 B;  1S0E A;  4P9J A;  3RZM A;  2DUQ A;  3T4H B;  1PIV 2;  4CU6 A;  2JG9 A;  5SV8 A;  4FOW A;  5EHD A;  1V6O A;  2BNM A;  1L7R A;  1QJY 2;  1I9R A;  1YIP A;  1G7Y A;  4LIU A;  4Q4X 3;  4DQA A;  1ODM A;  1UX6 A;  3MF6 A;  2YY1 A;  3AMQ A;  3PUQ A;  4B4Q A;  3BGA A;  5LZ6 A;  3RZK A;  3WNK A;  4E27 A;  3ZYG A;  3AP6 A;  1QGL A;  1AR9 1;  1W0O A;  3OGR A;  4R52 A;  5FZ4 A;  4KG8 A;  2D43 A;  1CAX A;  1BKZ A;  2XKO A;  4FPC A;  2ZEZ A;  3WP6 A;  2K0G A;  4M3C B;  2GME A;  2VNG A;  1W3V A;  5FZM A;  2P1B A;  3ZFF A;  5EJ3 A;  4DUX A;  4JKM A;  3ABZ A;  2FDI A;  3VHN A;  1RUC 1;  1DIW A;  4Y26 A;  5EP9 A;  4LLO A;  4BHP A;  3SXW A;  3ZKU A;  3RDI A;  3NJZ A;  3LIG A;  2ZS6 B;  4KBZ A;  4CP9 B;  2DDU A;  1GBG A;  4RGG A;  1TMF 1;  5BNN C;  2QQV A;  1I1E A;  2FDK A;  1SMV A;  3KMH A;  1UZ0 A;  3S57 A;  2WJS A;  2JDP A;  5FK8 A;  4MX3 A;  3LSE A;  1U12 A;  4P9X A;  2DTW A;  2V09 A;  1CZT A;  1WBL A;  5CFD A;  3U11 A;  3WG4 A;  2J1A A;  3ZDV A;  1EV1 1;  5JAX A;  4YW3 A;  2RJ2 A;  1SBE A;  1D4M 3;  3VB9 A;  4IV1 C;  1SZB A;  4CCE A;  3NKG A;  2F6B A;  3WD5 A;  3KVA A;  1VB2 A;  2WNV B;  1H2L A;  3AP7 A;  1PM4 A;  4YGE A;  3MV0 1;  4PLM A;  3U4X A;  2A6Z A;  2MEV 3;  1AF9 A;  4BU2 A;  1R09 1;  1RUI 2;  4AK3 A;  3VBU A;  1QMJ A;  2HWD 2;  1I6X A;  4MOA A;  5FJH A;  1J83 A;  1ASJ 3;  4YGC A;  4CDU B;  2QCS B;  3FUQ A;  3NNF A;  4OUL A;  1XJA A;  2AC1 A;  1US2 A;  2VMG A;  3H7J A;  4K6B A;  4LBO A;  5FZ1 A;  4YFZ A;  2VW1 A;  1S0F A;  4FAG A;  5JOX A;  4XJ9 A;  5B4N A;  1N3O A;  1OVP A;  4A42 A;  4FFH A;  4QAW A;  5A7N A;  3VZJ A;  1PO2 2;  3I54 A;  5FZG A;  1XSR A;  3OPT A;  3VKO A;  3LPF A;  4LE4 A;  1WW7 A;  1CJD A;  3OUJ A;  5FQ0 B;  1CPM A;  1DGL A;  3MF9 A;  4XDQ A;  4XUP A;  2ZAA A;  2JDA A;  5IJR A;  3WX5 A;  1C5H A;  1CN1 A;  4RHV 2;  1UKG A;  5CU1 A;  3RFR A;  4AE2 A;  4Q0U A;  2WZR 1;  3J8F 3;  2Y38 A;  1WLT A;  3PU8 A;  4YFW A;  1MZE A;  1YYN A;  4LKE A;  4NJ4 A;  2B46 X;  1OXC A;  5BNN A;  3H3U A;  3N7K A;  1UYX A;  1MZ5 A;  2JE7 A;  4PCR A;  3VD7 A;  1B35 B;  3MW4 A;  5E89 A;  4AGR A;  3K4Z A;  5K0U B;  1UQX A;  2FDJ A;  3ZR5 A;  2PHL A;  2VEC A;  1NT0 A;  3PVO A;  3WVJ A;  2HWF 3;  1CES A;  4NOT A;  2X10 A;  2ZGP A;  3WF2 A;  1K5M B;  1GOF A;  3RYK A;  1HXS 3;  3THC A;  4QB6 A;  3GZA A;  1RUN A;  4EZ4 A;  5A7W B;  5IVJ A;  2A75 A;  1QQP 1;  1GNY A;  2GU9 A;  2BWA A;  2CL2 A;  3NAP C;  3Q8B A;  1DQ4 A;  2Q1M A;  5EJ1 B;  3MIF A;  3I2K A;  5AVA A;  1MR5 A;  2JG8 C;  1LEN A;  3BVC A;  1JUI A;  4ZZ5 A;  1HN1 A;  5GZE A;  2FHR A;  1WWY A;  4KWU A;  1O8P A;  3VBO B;  4YSF A;  1HKD A;  5K8S A;  3H1W A;  5APA A;  2ZEY A;  4ES9 A;  1VRB A;  2VL4 A;  3I3D A;  1DG6 A;  1DQ5 A;  1QKQ A;  2BVV A;  1DBN A;  1AYN 2;  1G9D A;  3WW4 A;  5E8A A;  1MVQ A;  2ZGR A;  5FYC A;  1YHF A;  1WCS A;  1GNH A;  3WLU A;  2XWJ B;  2ID4 A;  3WOG A;  3T0A A;  2H0B A;  2WA3 A;  3TEW A;  3LOI A;  4YWA A;  2UYA A;  2XON A;  3OD4 A;  2CWM A;  3I3Q A;  4N8M A;  2HWC 3;  3APB A;  1R08 3;  3BOW A;  4LKD A;  3W58 A;  3CO2 A;  4LJH A;  4AOC A;  4AEM A;  4AGG A;  4LKF A;  4LO8 A;  4S2H A;  1ZNP A;  1BEV 2;  4QGL A;  3N9Q A;  1DQ2 A;  3VZN A;  3VD4 A;  5BXX A;  4YW2 A;  3K75 B;  2GNB A;  2VO5 A;  4LA2 A;  1IS6 A;  1IKP A;  1WLW A;  2E32 A;  3ENR A;  3WNN A;  2PAE A;  3MV1 1;  1W8Z A;  4OUM A;  1NLR A;  5E88 A;  3HQR A;  2WN3 A;  2K2S A;  4XIK A;  2VZS A;  4EE2 A;  1S0D A;  5JR2 A;  1JW6 A;  2O8O A;  3ZPO A;  1FPN 3;  2ORX A;  1UF2 C;  4RQP C;  3ZSE A;  1NCQ B;  5JIU A;  1QIQ A;  1D0H A;  4QDR A;  2E26 A;  5FY9 A;  4UI9 L;  2WAB A;  2WNU A;  1JN2 P;  2YU1 A;  2G9G A;  3NAP A;  1GWL A;  3DKQ A;  4Y20 B;  3DF0 A;  3S5A A;  2VW2 A;  2JG8 A;  1UXZ A;  3V0B B;  2K46 A;  3OSD A;  5DDJ 2;  5GZF A;  1OF3 A;  4MXV A;  2B45 X;  2J1S A;  5F6L B;  5FJK A;  4D7T A;  3H8O A;  4JVA A;  4CP2 A;  5EJZ B;  4NHK A;  1C8M 2;  4C1X A;  1U0A A;  2V5Y A;  4LT5 A;  1Z7S 1;  1YQ8 A;  3I2F A;  2W3J A;  4Y22 A;  5FZH A;  5JLV A;  3JQW A;  1UU6 A;  4IEX A;  4GWI A;  1Q8S A;  3AVS A;  1AX2 A;  3Q8A A;  5J36 A;  3ZSK A;  2WS9 2;  3KV6 A;  2YHJ A;  3LA7 A;  2NP0 A;  2RMU 2;  3M4F A;  2VZ3 A;  2D44 A;  4OHW A;  4LNV A;  4AXO A;  1RUD 2;  5DXD A;  4WM7 C;  4B8E A;  4YGD A;  4COV A;  1OFN A;  4FOY A;  1RHI 3;  2Z79 A;  3AYE A;  4G3Y C;  1TZO A;  3AC0 A;  5JVV A;  5L7O C;  1G6N A;  2WBK A;  3Q8E A;  3VBR C;  3WNX A;  3ES1 A;  1MEC 2;  3ACL A;  4RR3 B;  4BA6 A;  3K77 A;  4JKK A;  3TBD A;  2WL1 A;  1REF A;  5F37 A;  4E2Q A;  1IPJ A;  2PEL A;  4QU1 A;  2C0Z A;  3EJK A;  1PVC 2;  5JOZ A;  5A1L A;  3BYW A;  5EQU A;  2D93 A;  4AED B;  4YVS B;  5F5Q A;  3T4V A;  4RQP A;  1H4G A;  2VZ1 A;  4XUR A;  5J7M A;  1S2K A;  4XZP A;  1LUL A;  4DMI A;  1OA2 A;  2UY9 A;  3ZYP A;  4DUV A;  5CAZ A;  1DGW A;  1O59 A;  2QQK A;  3KVB A;  4Z92 B;  1D4V B;  4HFS A;  2ZHK A;  2FBE A;  4IEV A;  4BK5 A;  4AF9 A;  1H4H A;  5FYS A;  4CXY A;  4PF1 A;  4BCU A;  3RQ0 A;  4FXK B;  3RNS A;  3SKJ E;  2XBO 3;  1F4A A;  4LBJ A;  3UES A;  3USU B;  4AWD A;  1W8T A;  4JQT A;  1OH4 A;  3WP4 A;  4IND A;  1H8T B;  2I2S A;  1O3R A;  2WRA A;  3W5N A;  4UBG A;  3POB A;  3ZYJ B;  2OQ7 A;  1IS5 A;  1KXG A;  4KWL A;  4BPZ A;  2BER A;  1PIV 1;  3NV2 A;  1RVF 2;  5LWB A;  4Q0V A;  2DTY A;  5A80 A;  3SH4 A;  4RSU A;  1QJY 1;  2VNO A;  4S2F A;  5JI9 A;  4J1X A;  1F2N A;  1HQW A;  4WM7 A;  3OEB A;  2A71 A;  1ZRD A;  1KQR A;  3LEM A;  1RUH 1;  3E97 A;  2FMY A;  1VAV A;  4M4R A;  1V9U 3;  5FXZ A;  3AYD A;  3VBR A;  2VUD A;  4XJ8 A;  1HV1 A;  1QU0 A;  5FK7 A;  1RED A;  3U78 A;  1VRH 2;  3M3I A;  1C5I A;  3V65 A;  3WR0 A;  3IZO A;  2Q8D A;  3NKT A;  2SBA A;  3KV5 A;  4K1Y A;  1JYX A;  3RZJ A;  2EIB A;  3MLL A;  2JG9 B;  5I91 A;  5C71 A;  2XQR A;  3KCX A;  2D97 A;  2D3P A;  1XB9 A;  3WNP A;  3GCW A;  4UBH A;  5C3S A;  3FLR A;  5KXE A; 
#chains in the Genus database with same CATH homology
 5FYI A;  3AL5 A;  5FY0 A;  2YU1 A;  5FPU A;  2GP5 A;  5IWF A;  5FPB A;  4BIS A;  5CEH A;  2Q8C A;  4UF0 A;  3K3O A;  2YBP A;  5FP3 A;  5IVY A;  3KVA A;  5FZL A;  3N9L A;  3PUS A;  5FXV A;  5FZO A;  4IGO A;  2OS2 A;  5F5I A;  4BU2 A;  5F32 A;  5FP4 A;  5FJK A;  5FZO B;  4CCM A;  5FJH A;  5FY4 A;  5A7P A;  5FYV A;  4CCJ A;  5FP8 A;  4QXC A;  5FWE A;  4IGP A;  5FZH A;  3ZLI A;  4CCO A;  5FZ1 A;  5FYM A;  4D6R A;  5IVE A;  3AVS A;  4HON A;  2OQ6 A;  5FZK A;  4TN7 A;  5FY5 A;  5A7N A;  3KV6 A;  5A7W A;  5FZG A;  3N9N A;  5FWJ A;  3OPT A;  4LXL A;  4DIQ A;  4GJY A;  5FYH A;  3K2O A;  5F5C A;  4CUG A;  5FZ0 A;  4URA A;  4GD4 A;  2XDV A;  5FV3 A;  5A1F A;  5FZF A;  5F2W A;  4C8D A;  5FZC A;  5F3C A;  5FZ9 A;  4DO0 A;  4ASK A;  4UF0 B;  2PXJ A;  5FUN A;  4E4H A;  4EYU A;  5FYZ A;  5A3W A;  5ISL A;  2P5B A;  5FXX A;  3PU8 A;  5E6H A;  4IGQ A;  3KV4 A;  5F37 A;  4NUB A;  4QU1 A;  2YPD A;  5FPV A;  5FY1 A;  5LY1 A;  5FP7 A;  4BXF A;  5A1L A;  4V2V A;  4HOO A;  5K4L A;  2WWU A;  2GP3 A;  4GJZ A;  5F5A A;  3NJY A;  5IVV A;  3PUA A;  3KVB A;  4EZ4 A;  5A7W B;  5F2S A;  5IVJ A;  3DXT A;  4LIT A;  4CCK A;  5F39 A;  5A7O A;  4EZH A;  5ANQ A;  4XDP A;  5FYS A;  2W2I A;  5IW0 A;  5LW9 A;  4Y4R A;  2XML A;  5FYT A;  5FZB A;  3AVR A;  1VRB A;  5IVF A;  3N9P A;  2VD7 A;  4Y33 A;  5FZ6 A;  5FY7 A;  5FUP A;  4CCN A;  3PUR A;  3KV9 A;  5FYC A;  5F3I A;  5FZA A;  5A3N A;  3PTR B;  2OQ7 A;  5FYY A;  2XXZ A;  4LIU A;  5FPL A;  3K3N A;  5F3G A;  3PUQ A;  4AAP A;  5FZE A;  5IVC A;  4LIV A;  5FZI A;  5LWB A;  3AL6 A;  4QXH A;  5A80 A;  5FZ4 A;  3LD8 A;  3N9M A;  5A7S A;  2YBS A;  5FZ3 A;  4AI9 A;  4D6S A;  3N9Q A;  4XDO A;  5FBJ A;  5FP9 A;  5FZ7 A;  2Q8E A;  5FYU A;  5FZM A;  5A7Q A;  5FPA A;  5FXZ A;  5KR7 A;  4QWN A;  4GAZ A;  5FZ8 A;  3PU3 A;  2OT7 A;  5A3P A;  2OX0 A;  2YBK A;  3PDQ A;  4Y3O A;  5FXW A;  3U78 A;  2WWJ A;  3OPW A;  5LY2 A;  5FY8 A;  2Q8D A;  2YU2 A;  3RVH A;  3KV5 A;  3N9O A;  5IVB A;  4QX7 A;  3LDB A;  4QX8 A;  4D6Q A;  4QXB A;  3DXU A;  3ZPO A;  5FYB A;  5A3T A;  5F3E A;  3UYJ A;  4CSW A;  5FZD A;  2XUE A;  3U4S A;  4CCL A;  4V2W A;  5FY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...