5FUPA

Crystal structure of human jarid1b in complex with 2-oxoglutarate.
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
463
structure length
454
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
publication title Structural Analysis of Human Kdm5B Guides Histone Demethylase Inhibitor Development.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 142
structure length 454
sequence length 463
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fupA01
2PXJA 4Y33A 5FP9A 5FZ6A 3AVRA 3K3OA 4HOOA 5IVYA 5A7PA 4XDPA 3OPWA 5FZHA 5KR7A 2OX0A 3ZLIA 5FPUA 3KV6A 4CSWA 3PDQA 5FZKA 5FP4A 4ASKA 2XDVA 4LIUA 5F2WA 5A3WA 4E4HA 5A7WA 4IGQA 2YU1A 2Q8EA 5IW0A 5F5IA 5CEHA 3DXUA 3DXTA 2WWJA 5E6HA 3N9QA 3PURA 4QU1A 5FYZA 5IVFA 3RVHA 5ISLA 2VD7A 3K2OA 3PUAA 2XXZA 5FXVA 2YBPA 3KV9A 5F32A 5FZLA 2GP5A 2W2IA 3N9LA 4CUGA 3KV5A 5FWJA 5FJHA 5FY9A 4AI9A 3U78A 5FPVA 5FYMA 4CCMA 5FZ3A 3PTRB 4IGPA 4TN7A 4LITA 4LXLA 5FYBA 5FZ4A 5FYYA 5IVCA 5FP3A 5F39A 3KV4A 4UF0A 4GD4A 5LY2A 4BXFA 3N9OA 5FUNA 5FBJA 5A3PA 5A7WB 5IVVA 5FZIA 4V2WA 5FZGA 4QXCA 5FPAA 5FZEA 4Y3OA 5FZ9A 2Q8CA 3N9NA 4QX7A 4Y4RA 5FP8A 5A7OA 3AVSA 2OT7A 3K3NA 5A7SA 4GJYA 4D6SA 5FYCA 5FYHA 5FY1A 4CCOA 2P5BA 3N9PA 5FY7A 2OQ6A 5FZOA 2XUEA 5FV3A 5IVJA 2OQ7A 4NUBA 5A1LA 3N9MA 2XMLA 2YPDA 3KVAA 5FYVA 5F5AA 4DO0A 3AL6A 3PU3A 2YBSA 4BISA 5FZMA 4QWNA 4IGOA 4D6QA 5A3TA 5F2SA 5FYIA 5FYSA 4UF0B 5FZDA 5FWEA 5A7QA 2WWUA 5FZCA 4LIVA 4CCLA 5LY1A 4GJZA 5FZAA 4EYUA 4BU2A 2GP3A 5FZ1A 5F3IA 1VRBA 3NJYA 3AL5A 4CCKA 4URAA 5FZFA 5FY4A 5FZBA 5A7NA 3U4SA 5LW9A 5FUPA 2YU2A 5F37A 4QX8A 4EZHA 3PUSA 5LWBA 4CCNA 3LD8A 4QXBA 5A80A 5FZOB 5IVEA 5FY0A 2OS2A 5F3EA 2YBKA 5FXZA 4CCJA 5FXXA 5A1FA 5FZ7A 5FXWA 4DIQA 5FPBA 5IWFA 5K4LA 4EZ4A 4AAPA 3PU8A 5F3GA 3KVBA 5FY5A 4V2VA 2Q8DA 3PUQA 5F3CA 4D6RA 5ANQA 5FY8A 3ZPOA 5FYTA 4GAZA 5FZ8A 5FYUA 5A3NA 4HONA 4QXHA 5FPLA 5FP7A 5FZ0A 3LDBA 3UYJA 5IVBA 5FJKA 4C8DA 4XDOA 5F5CA 3OPTA
chains in the Genus database with same CATH superfamily
5DAQA 2PN5A 3NWKA 4FPKA 4I09A 3IDCB 5BNPC 3KCCA 1HB4A 3LB9A 1CONA 5FZHA 3RYKA 5JPNB 4A3XA 4QHZA 1Y4WA 3NV3A 3U4XA 2ZHLA 4CP0A 4ASKA 1B35A 2HEYF 2DCTA 2MEV2 2WABA 3VV1A 2Z69A 3GYDA 1Y43B 4DXRA 4RS5C 1DHKB 2FCVA 5AC92 5DMYA 3DXTA 2DF7A 4UOJA 1SHWB 3Q8AA 4AW7A 4EWAA 1QU0A 1HB1A 2YYOA 4CYDA 2YG0A 3M8LA 2LALA 4XPVA 1RXGA 4AEDA 5DDJ3 4KWLA 1HLCA 4UFKA 2FMDA 2VZUA 4XJ9A 3WW2A 1WUVA 1UKGA 4LO8A 3ILNA 1AXZA 1FPN3 4Q8KA 3GDBA 4E9KA 3THPA 4D94A 1W0OA 2UURA 4LO4B 4AI9A 1UAIA 3I2GA 2ZCWA 3QOPA 1XNAA 1E5RA 1RUJ3 4PBOA 3HN3A 2I74A 4QX2A 2WS92 1QJFA 3FFQA 5EIYB 2MEV1 3ZSLA 2UYBA 3K75B 4XFGA 1SQ4A 5G05L 1UZZA 3JQWA 5LY2A 1VBE3 5AC91 4MLOA 2VCCA 4Y24A 5L9RA 4FPJA 2DTWA 4LTAA 4HPKA 4Q4X1 5APAA 2DTYA 4DOUA 1K5MB 4CEYB 1IGOA 2HLEA 1ZVFA 1ZRFA 1HV1A 1MR5A 1QEXA 1KITA 3U07A 3POWA 3VDAA 2BP6A 4JZRA 3H8UA 5BNOB 1QJY3 1XSRA 4QDQA 1UOFA 1WMDA 1XNTA 2TNFA 4OI2A 5DAPA 2YGMA 4ZU5A 4I01A 4J6GA 1W6MB 2BWAA 3RYPA 3V0AA 1US2A 1S0DA 2DVGA 4NUBA 5FLHA 4AI3A 1FMD3 1ULDA 3CZUA 2WS91 2Y6HA 4H2AA 1L7LA 4M4PA 2V73A 5LCWL 1COV3 1OURA 5FOJB 2XL7A 4X8NA 3THCA 4NIDA 2W47A 1DP0A 3H9AA 1ND3C 1OT5A 3C7OA 1TE1B 3DPRC 4BK4A 4AHYA 5C4WC 2WBKA 2P6CA 3OSDA 2R7EB 4FOWA 4NWWA 1UIJA 2ZPXA 3GZEA 2RS52 4BQXA 1OA4A 3A4UA 1ZRCA 4FT8A 2BGOA 4Q0VA 3WHUA 2HBUA 1ZREA 2Q0AA 4AI8A 1TEIA 2ZTNA 3KCYA 3F95A 2FCTA 4QPWA 3WINE 3JCIA 5I8TA 1GZ9A 2VQTA 5JOZA 2BOJA 3IMNA 2CU5A 4ARXA 3C2UA 3ON7A 3NAPC 5LBFA 3RYRA 4DPNA 3KHBA 4BLIA 3UNPA 4AOCA 1UYZA 5IWFA 5LK7B 4F83A 2WFF2 2QZ3A 5IYYA 5CFDC 1RUD2 1W8OA 5A6XA 3A7QA 5ANQA 4Q4X3 4N53C 4CXXA 5IK5A 3B7MA 4PIXA 3UL2A 3UYJA 5IVBA 4N8MA 3VZOA 2HH9A 4XMIA 2P3JA 4JKMA 1RIRA 1O5UA 4LOSA 4Y5Z0 4EROA 3LKJA 5EWSA 1AR61 3ES1A 1MQTA 1OMIA 3NJXA 1HXS2 2XWJB 4XDPA 4JGYC 3JBG2 1C8NA 2G9FA 2CV6A 3K48A 2P4EA 2J1RA 2VW1A 5FZKA 3MYXA 2GH8A 1UOJA 2PFWA 2YV8A 1ZA4A 4IEVA 5FQ0B 5BPXA 4KWUA 1O3RA 5D8AA 2WC2A 5EZWA 2A7AA 4M3CE 3KMHA 2WFF1 1NCRB 2BNMA 2ZGNA 3RI9A 2QQOA 1ND3B 3DPRB 2YC2A 2VD7A 4GZ9A 5C4WB 3PUAA 2JDKA 1Y3TA 2XXZA 3J7HA 4XJ8A 2JG9B 4FPLA 1PVXA 3TEZA 1HRI3 2Z4FA 1UX7A 3KQRA 4IERA 3ZMOA 4W6XA 1MZ5A 1GOHA 2GNTA 1S1AA 3IB3A 2IVIB 1QJX2 2GZWA 3E5XA 5H9RA 2DBNA 5FZ4A 4F7ZA 1W04A 3DL3A 4FAGA 2GH2A 3RZZA 3NL1A 4JCKA 3NAPB 4MGYE 1RINA 4I3PA 1LHWA 1PK6C 2RMU2 3A0NA 3N3HA 4GH4A 3ZR6A 3RG0A 2DCYA 4NMIA 4YGDA 2VUAA 4UW5A 5FKCA 4E27A 1GZWA 1X82A 2RS32 3BU7A 5I0DA 1HQLA 3FN9A 2V5DA 2HWF1 1O8SA 3G6JB 1G6NA 1AR63 4QT6A 3EHKA 3HBZA 1U5XA 1ZZ8A 3O1MA 1UYYA 1WW7A 1JOPA 3C8XA 4MSVA 5IVJA 5EJ1B 3VDDB 2WT0A 3ZFFC 1QJX1 4YSFA 5A1AA 1VMHA 3WP5A 4JGYB 2D6NA 4S2DA 4DO0A 2X10A 4CDUC 1UIKA 4HLTA 2ZMNA 1VR3A 5FMBA 1H6XA 1W6PA 3T0AA 3WF4A 4IEUA 4LBMA 4B7KA 2ZJCA 3AZVA 1S0IA 2WO3A 2EAKA 2WWUA 4JC1A 4DFSA 2ET1A 4FSJA 3AB0A 4TSVA 1HB3A 1UO9A 4BU2A 1GSLA 4Y5TA 3WDUA 4Z2AA 2ZKNA 2W1SA 3HOBA 1UPIA 4XUPA 5FZFA 1JBCA 5FZBA 1LECA 3TN91 4QKFA 1AR71 2G9GA 4P9JA 5DUVA 2XJPA 1W6NB 5ACA1 1V9U2 3VKFC 1KJLA 1POV0 1K42A 5FZOB 2CNAA 5JWPA 2JE8A 1ZM1A 1D2QA 3OBRA 2J22A 3WNLA 5A1FA 4WVMA 5T5OA 4EWDA 1G8WA 3OYWA 5J3UA 3WLUA 3RJ2X 5J98B 2I07B 2KM2A 2IXKA 5L36A 4LHLA 5D2AA 3MI8A 4R8HA 5C6CA 3S5QA 2X5IA 3T2TA 5HV0A 4QXHA 1PK6B 2XJTA 4YZ2A 3UJOA 4BK5A 4C8DA 4OZXA 4I0AA 1GR3A 3WQ0A 2AGSA 3POJA 4XCAA 3THDA 4G4FA 5C5UA 2R071 1JH5A 2HWF3 3IKWA 4HOOA 4YM0A 4IE6A 5DUXA 3ZXFA 4B4QA 4A4AA 3IIIA 5JDBA 3VBHC 3WUCA 2FD8A 1R081 1ULGA 1Z78A 4HSJA 3I2KA 3ZFFB 3JD72 4I3GA 1SLCA 2JJ6A 1UZYA 2B39A 4IGQA 4XUNA 5HXVA 5ABJB 1EPZA 4CDUB 1ZRDA 3AJZA 4HANA 5JSOA 2XOMA 2VZPA 2FDFA 2VCAA 3FHIB 1W06A 4BQYA 4W6YA 2AEYA 5LBBA 1C28A 1N3PA 1LNSA 1PVC3 3D0SA 5CNAA 4FBFA 3MICA 1SLTA 1WMXA 4OYUA 2CL2A 1RUF2 2NN8A 2V4AA 2XVKA 3LA3A 4CVUA 3FHQA 4FCAA 2VNVA 3TN93 1AR73 2ZGOA 4NROA 3ZSKA 4JTNA 4HKOA 4BLJA 2H6CA 1S0FA 5CKNA 1LKNA 1LGNA 4XBLA 5ACA3 1OF3A 1JOBA 1DQ1A 2ZZQA 5FYBA 5T54A 1YJLA 2FQPA 1UL9A 2WO7A 2JDPA 2ZACA 1PZ9A 3JD71 1A8MA 5DZEA 3WNKA 5GLUA 5T5JA 1PHMA 3W9AA 4UF0A 4YZ1A 5I0SA 2OIIA 5DN2A 2VZ1A 3T0DA 3HJRA 4FQZA 4KBBA 2DUOA 2YY1A 2CGOA 3SLIA 4QXCA 4KGGA 4Q4Y2 4AZZA 2VXJA 3H42B 2IXIA 1MS0A 2JENA 4Y4RA 1FXZA 4XUTA 4RGAA 3HQUA 2OT7A 3VHOA 4YM2A 5E89A 3THTA 2E31A 4QU2A 1SMVA 1JYCA 5EJ3A 1NLQA 4FXGB 3HNMA 5C3SA 1G86A 2R073 2XUEA 3OY8A 3B69A 2ZHNA 1GV9A 1POV3 2XHKA 3D0JA 2Q1MA 2BOIA 3VHPA 3T2PA 1R083 1A3KA 4MGZE 2BVVA 3PU3A 2BNOA 2VBPA 3AP9A 3MLKA 5JOXA 4AFCA 4H7LA 3POIA 4ZXEA 1P8JA 5BXXA 3IMMA 5K0UA 4BIFA 1V6MA 1US3A 3O12A 1MZEA 3WNXA 4UFJA 1PGL2 3MFAA 3AYAA 4ITCA 4UT5A 1CZTA 1X33A 2XH6A 5EXOA 1URXA 1U5YA 4AXOA 3UT0A 2R043 3C3VA 3N36A 3SCHA 1VRH1 1TZOA 1MZFA 2PLV3 4FFIA 3WD5A 1AYM2 3ZXJA 5C9AA 4IE0A 4WV8A 2RM21 3I4IA 1OH3A 1F8VA 1ST8A 4AGGA 1NLSA 2B9VA 4AG4A 5FZ7A 4UFIA 4KL1A 4QX3A 2DCJA 3KB5A 1XYPA 4MHRA 4EZ4A 4K1YA 1NCQC 4UFMA 4P9GA 4INDA 4QD2A 2OUJA 4GAZA 1FAYA 3VBFC 1PGL1 2R30A 1YQ5A 5JCTA 1O59A 5AFEA 5TSWA 1HB2A 1AX0A 3OPTA 3ZSEA 1HV0A 4FVVA 2MHFA 4CDXC 5E1RA 3J7NA 4BB3A 1LHNA 2D5HA 4YVWA 4Q26A 4N43B 3LEKA 4J25A 1K5JA 3H3ZA 2XGXA 3CJIC 1NQDA 4XDQA 5DABA 5A3LA 1X8EA 2XBO2 2VTFA 3CL1A 4HL0A 4L97A 3FC0A 3USUA 4ES8A 2NM1A 1O4YA 5DPNA 2D93A 4FPHA 4P08A 2BFUL 3GHNA 4E2GA 4QPIA 3VZJA 1IKQA 3EYPA 1RVF2 1IPSA 3H7JA 1LHUA 2R16A 4R9BA 5GLWA 4K7JA 3KQ4B 2WZEA 4FPFA 3VL9A 5IVFA 3CIHA 2ZEXA 1KS4A 2YBPA 3AZYA 1CAWA 2ZHMA 2B7YA 5F9TA 3IDBB 5LASA 1JYIA 2NZ9A 5HCBA 2EF6A 1JYXA 1VRH3 2Y6FA 5I8SA 4CUGA 4DY5A 1R1A2 1H6YA 2XJRA 5FTTC 2RM23 2VOTA 5C7GA 1WW4A 3ATGA 2F6BA 4BXSV 4ONUA 5K7PA 3HEIA 1W6QA 2R062 1OFSA 2VG9A 3HD8B 4XURA 1O3TA 2P3IA 2OZ6A 1MACA 1CJPA 3NRUA 3ZIXA 3VGIA 4GD4A 5FOBB 4XFHA 4LT5A 3I3BA 3BU0A 5FUNA 1GP5A 2YPJA 4ZU4A 2YXSA 5FZIA 2W0XA 1QDCA 3I3MA 1A34A 5FPAA 5FLJA 1TMF1 1GOFA 1BK1A 2O8QA 2V5YA 1O8PA 2EIBA 4LUMA 2N7GA 3D5OA 3VBFB 3T2QA 5D1IA 2Z2SB 1A8DA 1IQAA 2NLRA 2QQNA 5FYCA 4UW3A 5FYHA 4O61A 2P6HA 3VL8A 2JDZA 4KQ7A 1QJZA 4CDXB 4IESA 4H3WA 2SBAA 2YPDA 4XACA 2R061 1AXYA 2J1EA 4Q2FA 3AYCA 4XJUA 5DZGA 5FO7B 4BA6A 4XQWA 3HWJA 4QPYA 1UMIA 1LU2A 2HWC2 3S6PA 5GZDA 3WG2A 2K0GA 4DZGA 3AZZA 2J1AA 2XUMA 4PQ9A 3GCXA 1V6NA 4HFSA 2A6VA 2W1UA 4Q4V3 5A7QA 4DMIA 3BN6A 1XB9A 3MEPA 3NKGA 2QQLA 1OKOA 4ES9A 1JHNA 2W68A 5FZ1A 1E57A 4XXPA 4AFMA 4OUMA 4AEJA 4EN8B 1PIV1 1JYNA 5J1XA 1JXNA 1RJ8A 1QXJA 4GULA 1D0HA 1QOSA 1ZBE1 3OPZA 4QQOA 3ZXLA 3IZOA 4BHPA 3O1UA 1A6CA 4QXBA 3FLRA 1NE4A 1BEV1 4MUVA 3S7EA 2ZZJA 2WNVA 5C70A 2IXHA 1I5PA 1E5IA 2RJLA 4QQPA 5IJRA 5SV5A 1WBFA 2HWC1 2J7MA 2WWSA 3FWEA 5K4LA 2E9QA 1LULA 4AAPA 4A7ZA 3BPZA 1L7RA 4JRLA 1PO21 1UY3A 1W9YA 3ABZA 1OLME 4I2OA 4PCRA 2R0HA 4Q0QA 2VUCA 1PO11 1CJDA 2JE9A 5FYUA 2J1VA 4IE7A 1TMF3 1W8UA 2Z79A 5FJKA 1M06G 3GALA 1MVEA 2F4PA 1OLRA 3H0OA 1PNGA 1WCKA 3S57A 1N3QA 3NNJA 3FZ3A 4ISQA 4CP2A 3EMRA 1UY4A 2ZOEB 3N7LA 3LPFA 3ZYJB 1QKQA 2OX0A 5FPUA 1UNBA 4CCCA 1W0NA 4KMQA 1Y9QA 4OFGA 2AENA 3D8CA 1OPMA 2R063 3O0VA 5IATA 2IZWA 3DYOA 2QCSB 3RMYA 1RMU2 3IAPA 3VHRA 5LBEA 4JDMA 3VKLA 3POGA 3WG4A 1RUG3 4J1XA 4E2QA 4CRQA 4XEZA 2ZX1A 4PDWC 3GZTB 1RUOA 3AMMA 2EXHA 2DBIA 5G04L 3MIDA 3CDZB 3BOPA 5LA1A 3ZYRA 4AI0A 5GZGA 2RV9A 2Q1FA 3KWVA 4FI9A 3KS7A 4CDWB 4DUWA 1PIV3 1JTZX 1W6OB 4LMFA 3FMGA 5FPXA 1PGW1 2C9KA 3HPNA 1F4AA 3N9LA 3USSA 3IIAA 3OUJA 4TLFA 2KD7A 1ZBE3 2C4XA 3M3CA 5F1RA 1DFQA 1XE7A 4FXKB 3WG1A 1T2XA 3OCPA 3JXSA 2UYAA 4FFGA 4Y22A 1I5ZA 4JKLA 1BEV3 4BCUA 1BK0A 5L7OC 1PMIA 3MLJA 5IAXA 1W8TA 1VBA3 1C8M2 4Y5SA 1H8TC 1PO23 5JIUA 2OKXA 4A44A 3BTAA 2TUNA 2Y6KA 3ZSMA 5JZGC 2XVGA 3VBSC 4BZ4A 1PO13 1QH6A 2A6YA 4AHWA 3ETQA 4OVEA 1PNFA 1U12A 4YFZA 4NIHA 4O9GA 4PJYA 4Q8LA 4XFCA 4YM1A 1JUIA 3R05A 3RWNA 1TVGA 1GFF2 4D3WA 1HJFA 2XLFA 4Z1VA 3PJQA 2WNUC 4Z92B 2EXIA 4OCTA 3EO6A 3WP4A 4TTGA 3ZYBA 3F2ZA 1DF0A 5GLTA 3I3EA 5A70A 2VTXA 4IGOA 2J1TA 2LRPA 4XF1A 4YW5A 5LRRA 3I3DA 4W4ZA 3MW3A 2WUHA 4AAXA 5FZCA 2KA3A 3MPBA 4KG0A 3ZFGC 4PDWB 1R1ZA 1W3XA 2PHWA 4Q0SA 5KC6A 5KXBA 3C7HA 3RRDA 4JRAA 4DINB 2BBAA 2RDQA 2C6SA 2JICA 4Y20B 4R4XA 4AI2A 1HX6A 4M3CB 2VVFA 2ZX3A 3KZ4C 4YNIA 4I30A 1GWMA 1D0GA 2ZS6B 5A3OA 5EYYA 3M1HA 1YWKA 1ZBA1 3HR9A 1NA1A 1CPMA 3OJBA 1Z0HA 3E6BA 3GHMA 4IV3C 1ND2A 4DXTA 2DUPA 4XTPA 4XFBA 5FXWA 3T1MA 2XB6C 3BYWA 1ZZ7A 2H0BA 4CEYA 4NHXA 2MNGA 5L7OB 3Q8BA 2BV4A 4LKFA 4MX3A 2BWCA 3B9IA 1H8TB 1XQNA 1OD5A 2UY9A 5BNOA 1UU6A 1SBEA 1KJRA 1WD4A 4YZ5A 1IS6A 1AR83 3O0WA 1HRV1 1O91A 1ULOA 3SNMA 1WLDA 1TNFA 1PM4A 2RJKA 3TNPB 3VB9A 1AYN1 3WNNA 1G9DA 5DXDA 1FV3A 2VPVA 2W92A 3B94A 1I9RA 3IT8A 4A2UA 4PT6A 4AL9A 3H8RA 5CIRA 2CAVA 1MS9A 4CZSA 1AL21 1UYXA 2LTNA 4CSWA 1T6BX 1ENRA 3MGUA 3FBYA 4PQQA 2XQRA 3WF0A 3WQBA 2OPWA 3QBQA 2WNUB 5FKBA 4B4RA 4LA3A 5CFCA 1FT9A 4YARA 2JG8C 3URFA 1DGWX 4UBGA 1APNA 1RUE1 3WR0A 3AFGA 4XJWA 2XQXA 4MXWA 4CU9A 2A6WA 5BY5A 4OQ9A 2ZGQA 4JTOA 3ZFGB 1ASJ1 1J84A 1D4VB 1SCSA 3EQEA 1AJKA 4BQWA 5LEJA 1KD7A 1S4CA 2FDJA 2W2IA 4PIZA 3ZKUA 3LE0A 4RA0A 3ZYFA 4KBZA 1XPWA 4LBQB 1LJ7A 3AK0A 4QGLA 3UKTA 1ZBA3 3RZJA 4IGPA 2V72A 1MEC2 2RDSA 3OGJA 1J3RA 4RR3B 4NAMA 5FP3A 4YGEA 5KWRA 1QNWA 2ZEYA 3LSDA 4RQPB 1VBC2 3KF3A 3AKSA 1BCXA 3WNPA 4LA2A 2Y6GA 4HXCA 4PLOA 1RL3A 2W9XA 1WBLA 5BNQA 1ULCA 1GP6A 3N9NA 1O5LA 1PX4A 3HT1A 3RGBA 2XWBB 1HRV3 3AVSA 1UN1A 1MS1A 1CVNA 4JGZB 5LK5A 1AYN3 1CIYA 2HWB2 4FFHA 1OKQA 5GJ6A 5A32B 5EFUA 2VMDA 2PHTA 4LKDA 3FUQA 1IG0A 4AFAA 1JN2P 5FV3A 1W8FA 4CUBA 2OQ7A 5FQ0A 2W91A 3RQ0A 2XMLA 1AL23 4M3CF 3MV11 2VTXJ 1NCRA 1CN1A 4KWKA 4R9CA 3D3AA 2RR13 3J7LA 5DUUA 1ND3A 5FYIA 1VBC1 2F17A 4NHLA 5C3QA 3ZM8A 2JG8B 2Y6LA 1RUE3 2JG9A 4XETA 4XF3A 4IV1B 5GZEA 5IHRA 1SBDA 3BODA 5F6KA 3WVJA 1DDLA 1H4HA 5F3IA 3ZOIA 4L0PA 4DY3A 3RZMA 1C5HA 2ARAA 3BGAA 1ASJ3 1EAH2 2P3KA 1W9TA 2HWB1 2WKKA 4GWMA 3IAQA 3ENRA 5JZGB 2WA3A 3CO2A 4TLGA 4DXZA 2O1QA 3J8F2 1QOOA 3M3QA 4EWEA 5EYXA 4YLZA 2WIIB 4W65A 5FUIA 2A70A 5BNPB 5FXZA 5F3EA 4XHXA 1B35C 1OI6A 4HK8A 1JHJA 2E7AA 2H6BA 3SKVA 3PU8A 1WGPA 3RNSA 1UZ0A 4RS5B 1DYPA 5A3NA 3H8XA 4AEDC 3FUOA 2PQQA 1GUIA 2WO1A 2XHNA 4WM8A 2R0FA 2BJSA 1EAH1 3POFA 3VDDA 4AQSA 4JGYA 4MGQA 1CX4A 4SBVA 5CBLA 3VBUA 5A33A 2JB8A 5JSRA 4XUQA 1S2KA 1HN1A 2OW4A 5K9YA 2WZ8A 2FMYA 2JB4A 3GCWA 5ANNA 3T30A 3HMYA 3SEEA 3N7MA 2WFPA 1YRZA 2MEV3 4JX0A 2K2SA 2B46X 2ZGLA 4NOTA 3V0BB 1RUH2 1S2BA 1F4HA 5AC93 5FAXA 3I49A 5IFPA 2WAOA 4RGKA 2BW8A 2EA7A 1MS4A 5KXCA 4MV2A 2R32A 1QF3A 4B3NA 4YM3A 3BCWA 2QVSB 1VB4A 3PMEA 4F8AA 2RS12 1W6NA 2NQYA 2RS51 1V6KA 3K51A 4OHZA 3VBOA 3WQ7A 3Q8FA 1S55A 4XOGA 3T09A 2ZX4A 4YW6A 3KV5A 2Q5TA 1W8ZA 3M2MA 4X6RB 4XCBA 1CAVB 3I2FA 3E6CC 1H2NA 1W8WA 3PTRB 2VCMA 4N90A 3T2OA 2WS93 1LR5A 1C1FA 2RVAA 4Q0UA 3CMGA 4RFRB 4WM7A 5GKAC 4CDQA 5JUVA 1UYPA 1B35B 2R1DA 4M0HA 1PK6A 4RHV2 4P5YA 5GLZA 5DAVA 1VE0A 2CY6A 1OD3A 2VMEA 1GANA 1QH7A 1VBB2 1RUD1 4QXKA 2AREA 2BRTA 3I2IA 4I02A 4H7MA 5CG8A 4GKYA 5FP8A 4NRPA 1GLHA 1UZVA 2UWCA 2QFEA 4WVZA 1UOBA 3SISA 4AEDB 3KT1A 4LULA 1J1TA 4RN5A 1EAH3 1SPPA 2PAKA 4LBOA 3C7EA 4MGKE 4FTEA 3DCQA 3POEA 1K45A 4OI1A 1HXS1 5JMCA 3AXEA 4ARYA 5C5TA 1QIQA 3LF7A 5DG2A 3JBG1 3N9MA 5ABJA 1JYWA 5FPZA 3JZVA 4LEJA 5FYVA 3S0MA 3D4KA 3OB8A 4LLOA 1ZRIA 1IS5A 1UX6A 4Y1VA 2ZXQA 1KFUL 2Y0IA 3L9JT 2C0ZA 4YW1A 3VD7A 3W21A 3WW4A 1S0JA 4RHV1 3ZIWA 3I2DA 1ONAA 5BV6A 1JZ2A 1Q8QA 5FZDA 1SDDB 5KXDA 1YI7A 3SCGA 1S0GA 4LOTA 3MHZA 4GJZA 4P9YA 4L2NA 5CFDB 4FAHA 4N53B 4COUA 4CCKA 2VZVA 5FCCA 3NNFA 4MOAA 5FY4A 2GN7A 2RS53 1H4GA 1OA2A 3KT7A 4XQ4A 5DAXA 5LRSA 1MQTC 4P00B 4AK3A 1LOCA 1GP4A 1SLBA 2WZPP 4CCNA 5C8WA 3B93A 3TNQA 4OULA 3O1RA 4XQDA 2YBKA 5IUQA 3RZHA 3QH7A 5IFTA 2VOVA 2LUWA 2D97A 1DQ6A 1IS3A 4R9DA 4M01A 5HXMA 4GXLA 1ENQA 5F3CA 1NE6A 1NX9A 1W39A 4YW3A 2WFF3 1KGYA 2I2SA 2RMU1 3IM0A 4EN7B 5LA0A 1RUD3 2GC0A 1NOVA 2LW8A 3VN4A 2VE1A 3J7MA 3M3OA 5FO9B 2GNDA 1BXHA 3MIEA 1JZ5A 1VMJA 3FFZA 1ZZCA 2RS31 3G7DA 4GALA 5FZ6A 4FPGA 1YFYA 5BNNA 1C57A 3HQXA 4XAEA 1JYVA 2VGDA 2HWE2 4F3JA 4XTMA 4MGTA 1HXS3 3PVBB 4OUEA 3V65A 1SACA 2WA4A 3JBG3 2VVEA 4K8FA 5FP4A 4AFBA 2C5DA 2XDVA 1LCLA 1MZ6A 1ZA7A 1LESA 1FOD2 3L2YA 5A7WA 3ZR5A 2BQPA 5T3NA 5IW0A 3Q8EA 4GB32 4NHKA 3ZN5A 2FDHA 4AFDA 1JZ6A 3NV4A 4GWIA 2D6OX 3RVHA 3V64A 5L19A 1VIWB 1VBD2 2CYFA 5C3OA 1OPOA 1STMA 2OYZA 2JEMA 4MG2A 2CHHA 1OSGA 3FL7A 2AEZA 3C7GA 5FR3A 3HVDA 2PHRA 1W2AX 1XC6A 3J26N 4YVSC 1ULFA 4QGNA 3ZFEA 2JDHA 4IL7A 3NNLA 1GQGA 2NMOA 2X09A 2W08A 5CZKA 4P5HA 1V9U1 4IDZA 1QJX3 3H3LA 2VR4A 1HN0A 1UW8A 3AC0A 2XLGA 4YGCA 3M7AA 4XF4A 1REDA 4N7UA 1NZIA 1NXD1 4BXFA 3KGZA 1HIXA 4GB31 1W90A 1JZ3A 2CDOA 5IVVA 1Q8VA 2UWBA 4K8RB 2A3WA 1BBT2 2RMU3 1X8MA 4META 2X53S 1RUI2 1RGSA 4DB5A 3UV9A 4N43A 3VD4A 4QM9A 2C9AA 1WMFA 1ODNA 4I0BA 1YFWA 4XAAA 1BMV2 2RS33 2CSGA 4P9WA 4GA9A 5FY1A 4ZKTB 3N7JA 1XBFA 5FREA 5A1LA 2FBEA 2VY0A 2WJSA 5F8PA 4BISA 3AFKA 2Y64A 4HMZA 4QWNA 1YI9A 1S0CA 1XU2A 3FLPA 1GZCA 2EXJA 1VAMA 3EBRA 1OA3A 4URTA 4DQAA 1ZYBA 2JE7A 2X5IC 4FPEA 3S5AA 2P17A 2WN2A 2ZHKA 4LKSA 3SXWA 2QQJA 2XG3A 3MIHA 2D6PA 4BYYA 1BMV1 3SC7X 1YJKA 2QQUA 2RHPA 4IW3A 3I2HA 1RUF1 2ID4A 2VMGA 4N7IA 1F31A 2VNGA 4W8JA 5A7NA 3ITQA 2VW2A 4EZHA 1W2OA 1EUTA 3GM8A 4YVSB 5FK7A 1D4M2 3LD8A 3ZXGA 2WYFA 4KU8A 5IAVA 3VHNA 1V9U3 1ZRRA 3VBHB 5FPBA 4JQTA 4PLMA 1OXCA 5FO8B 3SEPA 2EIDA 5FMOS 1IPKA 4V2VA 3RWKX 3VBRC 3SMHA 3C7FA 1F9KA 4LBQD 4E2SA 2R1BA 4Y1ZA 4Q4Y1 5I8YA 3PUHA 3ZSJA 1KQRA 4KNCA 1DCSA 2DVBA 1DQ4A 4ORFA 3WHTA 1V6LA 3LFIA 5EP9A 2VULA 5CKQA 4NRMA 5C3PA 3EJKA 5GLVA 2TBVA 2CGPA 2WSUA 4B1MA 4YWAA 1G9FA 4XW3A 2KR2A 4LIUA 4YG6A 3AKPA 2YHJA 5A3WA 4EJRA 4Q27A 4P9LA 3JD73 4IE5A 4WVMB 3A22A 3ZDVA 1TME2 1J83A 3OYWB 2AH2A 2GMEA 4LJHA 4AVBA 4XIOA 4XC9A 4XBQA 1CGPA 1H2KA 2A73B 1X9TA 3AKTA 4UW4A 4UYBA 1DGRN 3MO4A 3P3PA 2ZAHA 1DBNA 1ODMA 1REEA 2KXLA 2VOXA 3TOJA 2XLAA 4BPZA 1YEWA 2HEVF 4KU7A 3AKRA 2DVAA 4GWJA 5L9BA 2VOKA 3KM5A 2WNOA 1RUF3 1ENXA 1AYM1 5JI7A 2FHRA 4CCMA 3KLSA 1G9CA 2HBTA 3JB4C 4M00A 3WF1A 4QX0A 1G7YA 4ZPIA 5IT6A 2WZR2 3BTYA 4OLLA 1W2TA 1UMHA 4ZY9A 3TEXA 4AI1A 5IVCA 1IZ3A 4HKWA 4NIIA 1RYYA 2HWD2 3E1F1 4S2FA 2GN3A 5K0UC 3N9OA 1GNHA 1XSQA 1TME1 2D3RA 1YIPA 1SLAA 2BNNA 5FZEA 3VBRB 2GNBA 2PHXA 2XVLA 5FZ9A 3WNMA 4D69A 4Q4Y3 4LKEA 1V0AA 3ZVXA 1RHI2 1PMJX 1EV12 3D6EA 2PHDA 3OGGA 3D82A 4CCOA 4CU6A 5C9AC 3RSJA 2JWPA 2AC1A 1CAXB 2JX9A 1OHFA 3SQOA 5JXIA 1R092 1UCXA 2XBO1 5F5AA 2QQKA 5JVVA 2W46A 2YBSA 2A71A 2JDNA 3N35A 5FZMA 2FZ2A 1ZZ9A 4FP2A 2HWD1 4FOVA 2ATFA 3EB7A 1RVF1 5T52A 4LPLA 5EPAA 4UF0B 2WT2A 4HZFA 4XFFA 5C8CB 3H3UA 4CDWA 1NCQB 1W6OA 1O3QA 4EYUA 3W20A 4Q29A 3BALA 3H7YA 3OBAA 4AGVA 2VMFA 3WNOA 4AF9A 1OQEA 3POYA 4BM8A 1EV11 1ALYA 4YVWC 2G19A 3BVCA 3WF3A 2YU2A 3BIWE 4G3YC 1AYM3 1R1A1 3ELNA 3ILRA 5JXHA 5A3MA 3NJVA 5EHDA 2O8OA 4LK7A 3OY8B 2XPJA 3NJZA 1W05A 3CJIB 5CG9A 2ARXA 1XE0A 4DIQA 3IDEA 4QPIC 3T0BA 3PLQA 3E5UA 3O7OA 4NPRA 1QJU2 5IK7A 4B1LA 4D6RA 4Y1YA 2WLQA 5FY8A 4MYEA 5K0UB 2YMZA 4HONA 2D6MA 2HJIA 4W6WA 2HEWF 5FMDA 3UK9A 1A78A 4QHBA 2VZRA 3VDBA 3VLBB 2A6ZA 1J58A 2QJVA 4QQHA 1QDOA 2P2KA 5FP9A 4QB6A 1UXXX 2LS6A 4QPGA 3SITA 1VAKA 5A7PA 1JZ4A 5DZFA 3ZDSA 2WYSA 5IK8A 4HETA 4Y1XA 2DURA 2ZGRA 3KV6A 4G9SB 5J96B 3PDQA 3JB8A 3LQCA 2XBO3 3B01A 3SKJE 4E8CA 5CISA 3POSA 3UGGA 2K46A 1OF4A 2YFUA 2YU1A 3WZ1A 5F5IA 2NP0A 2ORXA 2WN3A 4HSLA 3CZJA 4DUVA 1RVF3 2QQPA 2QDRA 3N9QA 4ZONA 1HQNA 3GBFA 4R52A 2R6QA 2YC4A 4Y20A 1DQ2A 1XNDA 3CNAA 3UKNA 4Z2WA 4CEWA 1LENA 1YQCA 2WQ4A 2Q30A 1F5FA 5F32A 4A6SA 2QBXA 4BIOA 3WY6A 3ZN6B 4CA9A 2ETEA 4ATEA 3AYEA 3ME2A 3U78A 2PELA 3AMQA 3RJRA 1BKZA 4ASMB 4YVWB 1R1A3 4ZZ8A 1C5IA 2E7TA 2EAAA 2GDFA 1U0AA 1UU4A 1D2SA 3NV2A 4OI0A 1H8TA 3ASIA 3H1MA 5J36A 2D3SA 3R4UA 2JKXA 3P5BA 1GNZA 4MH0E 1GNYA 2YDEA 1LEDA 4QPIB 4OMCA 1AZDA 3AMPA 3B5LB 3OEAA 3FJSA 4B29A 2XKOA 1LB2A 2ENRA 2A6XA 2ZABA 1DLLA 2C24A 3OF1A 2Y38A 1UF2C 3WT3A 3CF6E 4X6QB 1RUC2 4JDOA 3M3IA 1YQ6A 1YUDA 2PTMA 1FATA 3T4VA 3N4MA 1CAWB 2JDUA 2P5BA 4Q4W2 3FBMA 1WLTA 4QKNA 1Y7BA 3WV6A 2DFBA 1OBNA 4Y4YA 3P6BA 3WX5A 1L3JA 1GKBA 4YPJA 2WNVC 5LB6A 3OD4A 4CXWA 1BJQA 4HK9A 3FLTA 3O0XA 1W6QB 2OA2A 3E5QA 3MF9A 3NO8A 4U36A 1RMU1 1Z7S2 3OGSA 4D6QA 2HWC3 3AXDA 3LAGA 4QX1A 4COWA 1QQP2 5FWEA 2YC0A 1ZZBA 5JXJA 2D7FA 4LBKA 4E4DX 1RUC1 4FO9A 2GC3A 5EQUA 4URAA 3B3QE 1XYOA 3GNEA 4LBQA 1CX1A 4LO6B 4IUGA 2WRAA 3OUHA 3CEWA 2WINB 4RGGA 3U10A 5F37A 2C1FA 5F6LB 4RR3A 5LEKA 3ZYHA 1R64A 1X50A 1IOAA 4RQPA 2VM9A 1LRHA 1C3HA 1O6UA 1DZRA 4AR2A 4CCJA 1AR92 3HNBM 3UGFA 1OLQA 2VBBA 1GMMA 1LOFA 3FX3A 4L92A 1Z7S1 5C3RA 1GWLA 4TZDA 1AXKA 1YQ8A 4AYUA 1C8M1 1KFXL 3LEMA 4IEWA 4GMP0 5LATA 1FV2A 2GALA 2BGPA 3O14A 4JGZA 1N1VA 4FPCA 5A32A 1QMJA 2RG4A 4AHXA 4Q5OA 5I0RA 1MS8A 3JU9A 5CVRA 2Y6JA 3B00A 3DYMA 3OG2A 1GBGA 1XRUA 2EICA 3GGLA 1Q56A 1VMFA 2BUKA 2WQ8A 2WR9A 3VD5A 4IV1A 3AZWA 3WW3A 1K5MA 1RMU3 1U5IA 4GMP1 1KS5A 4AWDA 3GZAA 4D7TA 1CPNA 5FK8A 1BVVA 3APBA 4UWDA 5DDJ2 3UETA 5FYZA 3CJXA 2QE3A 3I59B 3ZXKA 1FPN2 5JZGA 3VBSB 1Q43A 2DYCA 3LGRA 3ILFA 4WBBA 1W6MA 4CP9B 3HNYM 5BNPA 3AP7A 4UAPA 4BQ4A 1OOPC 4FFFA 2ZX0A 5FWJA 1RUJ2 1WKYA 1UKRA 5HBAA 4NN0A 3ZKYA 5HCHA 4A7YA 2QNKA 2D3PA 4BH9A 4GIQA 1WA6X 2VMIA 2VBDA 1VBE2 4ZHNA 2Q4SA 1V6OA 1H8VA 3LEIA 4RS5A 3VDCA 1BHGA 4CPBD 1IPJA 1LGCA 1H1AA 1UMZA 1C8M3 2ERFA 1H9PA 3ZYGA 4Y3OA 2PYTA 4E8DA 4K9SA 1Q8SA 1GQPA 1QJY2 1V6IA 5E8AA 3K3NA 3OEBA 4L99A 4XHBA 1SFYA 4NO4A 5E16A 2A1XA 1XNBA 3Q8CA 3N9PA 4QQ2A 2OQ6A 1RUJ1 5DQ0A 1FMD2 1LOBA 3L2HA 2ZEWA 2QQWA 1NA1C 5JR2A 3ZO0B 2WDBA 2W1QA 1XYNA 1ND2C 3MLLA 3V0BA 1RC6A 1COV2 4LHSA 4L8QA 5JMOA 1VBE1 4Y22B 2BEOA 4QB2A 3H8OA 4CEYC 4IV3B 4UXAA 5F2SA 4CXYA 2XONA 2HYXA 4GMP3 4C0BA 1JU4A 1ENSA 1UPSA 4LIVA 1DGWA 2PHFA 5BNOC 2EXKA 1GYKA 1H9WA 4YW4A 2YGLA 1WW6A 1UY2A 4P9XA 4CU7A 4JV4A 1CAVA 1X7NA 2YB7A 2VAUA 1W2UA 4KH9A 1W03A 1CWPA 4OHWA 4O7XA 3PIJA 1AX1A 1H2LA 1FMD1 2VU9A 1GQHA 1OOPB 2VZTA 3DKWA 4A41A 1GWKA 5FLIA 3SH5A 3JQXA 2OS2A 2BYVE 1MEC1 1NYWA 1COV1 5FDBA 2XKPA 2ZKLA 5CFCC 1JI6A 4BQ1A 4N9IA 2D98A 4AEKA 1DQ0A 3OBZA 1YO8A 3PUQA 3DPRA 2VC9A 3INAA 1LTEA 1WZXA 4Q4X2 5C4WA 5FYTA 1UQXA 3LOBA 3DN7A 1SCRA 1T6GC 3LDBA 4IE4A 5F5CA 1JS9A 3WEZA 3RMXA 1EYBA 3BTXA 2GU9A 3A23A 3WG3A 1TNRA 3AM2A 4ASLA 5KR7A 3ST7A 4KWJA 1UD1A 3P1IA 4XFIA 3PHMA 1AHSA 3NAPA 3I2OA 1SLIA 1NA1B 5A6ZA 3IPVB 2DVFA 2A5ZA 3K4AA 3MW4A 4IXLA 2PQSA 4OHVA 2Z5WA 1ND2B 5EJZB 4E4HA 5FFOC 3WCSA 3BB6A 4NWVA 3MV01 3LDRA 3GF6A 3TAYA 1MS3A 2X29A 4K40A 5CFDA 5E6HA 1ULPA 4AVSA 2V09A 3KD4A 4N53A 3CHXA 1RUNA 2BGCA 4LO7A 3WUDA 4CUAA 1YNAA 4TXWA 2FZ1A 1HRI2 2QQIA 2W52A 1CAUB 3DECA 4QMAA 1AJOA 5T55A 5A3UA 3TWIA 3W5NA 4HVRA 5FZLA 3OGRA 5FBZA 2SLIA 1H30A 1HW5A 4BQ5A 5FPVA 2UY8A 5JOYA 3J8F1 4ZS3A 2GC1A 2DU0A 4LXLA 1Q8OA 2ZEZA 4C91A 3IWZA 1MEC3 1NCRC 2QUOA 4MGSA 4OHXA 3QCWA 2VQAA 1YHFA 2ZAAA 3O1OA 1F5JA 1F2NA 5A3PA 5JR7B 3VD9A 5CFCB 1PGSA 4LK6A 5FZGA 1VBC3 2JG9C 4EQVA 1QXPA 1UOGA 4P02B 1JUHA 2Q8CA 4ATFA 1RB8G 1KRIA 1WLCA 1HRI1 2CWSA 2IFWA 3PVEA 4MXWB 2NYYA 1AR62 4C1WA 3MF6A 1FNZA 2HWB3 3R0RA 5FZOA 2PA7A 2FDIA 2OXBA 5CYYA 1SZBA 3ORJA 3BOWA 3MIBA 4LBJA 2ADEA 5AVAA 3ZYPA 1VAVA 3DUIA 4Q1RA 4AGRA 2XJSA 3ECQA 5KHJA 1XNKA 2A3YA 1KDKA 4H55A 4AHZA 3MUZ1 5JIAA 2P37A 1RUH1 2VJXA 4CCLA 3SCFA 3NMBA 4HKLA 5FZAA 4C90A 1GOGA 1WCUA 3DKQA 3GZUC 4BQ2A 4WM8C 1FYUA 3AL5A 1F15A 3U75A 5J48A 5DUWA 2RS11 1Y9GA 2W5FA 2Q1ZB 4YG0A 4OMDA 4HBNA 3VDDC 5KC5A 2BBVA 4S2HA 3ACLA 1FX5A 3GJAA 2Y34A 4OZOA 3VBUC 3PUSA 3AMHA 1MS5A 3ZFFA 3ZX7A 4EN0A 1SG3A 5J09A 3J8F3 1K3IA 4UW6A 1BQPA 4CDUA 4HG6B 2AACA 3LZZA 4R4ZA 3TEYA 1CIWA 2QTWB 4D7YA 4FTSA 4ZU7A 1UY0A 4FPOB 3VKMA 4NVPA 3FHAA 1WA4A 1QHDA 1UWWA 1LHVA 4XYXA 5B4XA 4ET7A 2K9ZA 1U5ZA 1VBB1 1WCQA 2VL4A 2ZMLA 4MVTA 4YYOA 4AEMA 1OLMA 4JVAA 4HPKB 4XJZA 5C71A 4JDNA 3OGVA 4CE8A 3VBOC 2HWF2 4HVOA 3W58A 1I3HA 1QOTA 4Y33A 4QGMA 1W99A 5H9QA 5T5LA 2YFZA 5IVYA 3ZXEA 5DAWA 3I7DA 1N3OA 2J1SA 3LWCA 4GQ7A 4AQ6A 5GZCA 2LROA 1F35A 1CR7A 3AP6A 1W3VA 2IXJA 3PIGA 3PJYA 2W95A 2ZGMA 4XE9A 4PIYA 2XJVA 5IK4A 2WT1A 4BE3A 2BU9A 4WM7C 3I97A 4LBNA 3V0AB 4BQ3A 5KHKA 4CDQC 2JD4A 3K46A 2Q8EA 5CEHA 5D8AC 3VUOA 4ZS2A 3LIGA 3O5SA 1MPXA 1RUH3 1PVC2 1NG0A 2VVDA 3UGHA 2Y0OA 5ISLA 4CPBA 3K2OA 3T08A 5KXEA 2E26A 3DEMA 1JOJA 4PI2A 4BMEA 3M70A 4AE2A 3TN92 3LPGA 2CAUA 1AR72 1OQDA 3NSTA 4YVSA 2AYHA 3UKVA 3WQ1A 2RS13 3ETPA 2GP5A 1J3QA 4WM8B 1VLNA 3AYDA 3KGLA 4WZCA 5EV7A 4MXVA 4E4ZA 5ACA2 5HI0A 2E63A 5FYMA 3DGTA 5T50A 4LNVA 3VBHA 2UU8A 4Q1PA 5ABJC 1VJ2A 3VBUB 3IBMA 3NNGA 5A33B 4XF9A 1WCSA 3ACGA 4XILA 1JYTA 3OUIA 2I45A 3IDAA 4Z82A 2DV9A 4A45A 4IEPA 5FBJA 1EPWA 1V6JA 1OUXA 4J1WA 3NVCA 4NPLA 4RHV3 4O9EA 2JDAA 3MW2A 4GH4C 4COVA 1PVC1 4YZ3A 2Q8OA 1VBB3 2AZ5A 2G1MA 4YFWA 2D5FA 4EV0A 3LCPA 1NQJA 3NV1A 4KGQA 3P3NA 4XUOA 3K77A 2R072 2TEPA 4D6SA 4JAAA 3I8TA 3X29B 2RJ2A 4O65A 2XL9A 4QAWA 3LFMA 3VBOB 3WW1A 1QJEA 1B09A 1QXRA 2DCKA 1R082 3MFCA 4WVWA 2HWE1 1DIWA 4MZUA 1MQTB 4FOQA 4AQTA 3B9CA 2ES3A 2EIEA 4XF0A 2OPKA 3WDYA 1O4ZA 4CCDA 2JD9A 4KI5M 1NY72 1FOD1 3O1SA 3BTZA 2IXLA 3MIFA 1BZWA 4WM7B 4QM8A 2VZ3A 2VQUA 2QKDA 2FCUA 2Y33A 3SH3A 1V00A 1YIFA 5D8AB 4LE4A 4CDQB 4UBHA 3QD6A 2ET7A 1HJGA 3HIFA 4EN6B 2R042 1KXGA 1XJAA 1WWYA 3NW4A 2PAMA 1VBD1 1VRBA 2PLV2 3NJYA 4UFLA 5JI9A 1DU3D 4FQ4A 5I0UA 3M4FA 2D44A 5LW9A 1N1TA 4X8PA 1POV1 3AZXA 4OI4A 4ZZ5A 5BNNC 1HQWA 2R49A 1OVPA 1SPPB 2ZGPA 4YG3A 2AUYA 3T4HB 5CA6A 4HT1T 4A7KA 3RZGA 2WQZC 2Y8KA 2W3JA 5FY0A 5LA9A 5F7UA 4D7SA 1W9WA 3MUY1 1UXZA 1LGBA 3QH6A 4NIGA 4CUCA 1NY71 4JHZA 3VBRA 1QNYA 3HAGA 1BYHA 2XJQA 3H1WA 4UI9L 1Q8PA 1SBFA 2P34A 5FY5A 3PVNA 2ARBA 4DRVA 3ZPOA 2VZSA 5FZ8A 2W94A 1BBT1 2VXRA 1C1LA 1YYNA 2R041 2YUEA 4XMAA 2QQVA 1RUI1 2YROA 4GH4B 1SFNA 1CAXA 4P14A 3BIEA 1GICA 2PLV1 2PHLA 1K12A 5CADA 3BPSA 2IFRA 1JODA 1GZWB 2BFUS 3AVRA 3K3OA 3I54A 1IS4A 3ZFEC 4AVTA 5BUVA 2W39A 4FP3A 2PHUA 4LUKA 3OPWA 2ZMKA 2VNOA 2HWE3 3ACFA 1AX2A 3HT2A 3MZHA 4OQ8A 1TQ5A 2VMCA 5C8CA 3PVOA 1FOD3 1NCQA 1IHMA 2D43A 3DXUA 2W87A 5GALA 5HCFA 1QWRA 1H1MA 4GB33 3KF5A 4YZ4A 3VBFA 1W6PB 2FDKA 1UU5A 2GC2A 1REFA 4TWTA 4FTBA 3T1LA 2C26A 3J4UH 4S2GA 5E88A 4N43C 1W9SA 3PL0A 2VZQA 5FXVA 1VBD3 1VRH2 3AMNA 1POQA 4CDXA 3GJBA 4BMBA 4QKDA 4P9IA 1AL0G 5HCAA 2RM22 4JHTA 5M0TA 1CD3G 3J9SA 2JIJA 3CJIA 4YGBA 4D8MA 3BI3A 2ZBJA 4KG8A 5JLVA 4NR1A 5BNNB 3S7IA 2GNMA 1HDKA 1D4M1 4I0WB 2X05A 2IVJA 4DXSA 4C0HA 4QB1A 4BWOA 4OUSA 1H2MA 1QGLA 5F39A 3KV4A 1DQ5A 3CU7A 5A7WB 2B5HA 1WMEA 2WL1A 3PNAA 5LBCA 4PHZA 3CBNA 4MO3M 4QX7A 4QHOA 4JQRA 1BBT3 2X5IB 1RUI3 3WP3A 2ZGSA 4MADA 1FI2A 1YXWA 3OD0A 4QDRA 5KHIA 3KSCA 2BTVC 4LE3A 3KCXA 3OBTA 3Q9OA 2JIGA 3ZFEB 3POBA 4D0QA 1XE8A 2E33A 4SLIA 1GU3A 3KVAA 3ZXDA 4HVQA 4FOYA 2D6LX 4K3UA 1UY1A 1PM7A 5H9SA 5KHGA 5A3TA 2WNEA 1CZSA 3DF0A 3AX4A 4Q4V2 1I6XA 1DZTA 2VMHA 3WSOA 1Q3EA 2JKBA 1YQ2A 1DYOA 2VW0A 1JZ8A 5LY1A 2G9ZA 4IETA 3HBKA 3ZN6A 5B2GB 4BOWA 4IEOA 2GP3A 3CQOA 4FPYA 3GBWA 4LR4A 3VKOA 5I0TA 3WCRA 4K21A 5LZ6A 3KHCA 3U4SA 4LO5B 1ZZ6A 3RDIA 2ZA9A 4HN0A 5LWBA 1NLRA 2DFCA 3LOIA 4PI0A 4XIKA 3U37A 4K1ZA 4RD7A 1ZX5A 1ZNPA 1D4M3 2E53A 2WZR1 5KHHA 1O7FA 4R9AA 1IKPA 3KVBA 3FE5A 2RDNA 4Q4V1 2E51A 4M0NA 1EY2A 1TMF2 1AUYA 1EP0A 1NXMA 1WCDJ 4MGIE 1PMHX 2NMNA 5FPLA 3UESA 4DRRA 4XDOA 1RITA 4RFT0 1W9FA 5FMOL 1MVQA 1J3PA 1CZVA 1V70A 2PXJA 3WF2A 1RHI1 2JECA 1DGRA 1VP6A 3RFRA 2ILMA 2GAUA 3WDWA 2HKXA 3LSEA 1J1LA 1DGLA 3ZLIA 4UFHA 3ACHA 4HN1A 1R091 1DZQA 3K4DA 1QY4A 1RUG2 5F2WA 4COYA 4XZUG 1E5HA 2J42A 3I2JA 2WWJA 5T5PA 5L9VA 2WAAA 5CU1A 1I1EA 4CTEA 3PURA 3E97A 4QU1A 1PZ7A 2BZDA 4XVHA 1TME3 1IQDC 1H1IA 2EIGA 1SEFA 2RE9A 2CGNA 2DCZA 2Z42A 1RTVA 4AVVA 1YFXA 2VO5A 1YFUA 1LOAA 1PIV2 1S0EA 3T3YA 1TG7A 2DU1A 5A6QA 3SHRA 5J7MA 5I93A 1DYKA 3WOGA 2VECA 5A6YA 5HV4A 1ZBE2 2VQ0A 5ERLA 1SDWA 5FJHA 1O3SA 5F5QA 5CB7A 3OOXA 2Y60A 4Z07A 1BEV2 1IG3A 2RDRA 4L11A 5C9AB 3RZLA 4Y26A 5L73A 4B7EA 3U1XA 1OC1A 1H0BA 1JW6A 1RUG1 1VBA2 2WZR3 1VPHA 2ZGUA 2IWGB 4MHUA 3A21A 1PO22 3TYJA 2A3XA 4XABA 2VUJA 1KEXA 4DEVA 1WD3A 1OFNA 4GWNA 1JMUB 1PO12 2HWD3 1QJU1 1SLLA 4PDWA 5DG1A 3RPQA 2BPA2 1HKDA 5AVPA 5JOWA 4K6BA 1Y9MA 4NIAA 4CDWC 3VZKA 2ZGTA 3K4ZA 4IEZA 1KDMA 4AQ2A 4M3CA 2JDYA 5A7OA 1EUUA 3BUCA 1LOEA 2A75A 5A7SA 2DUQA 4GJYA 2IC1A 4PBPA 4YW2A 1RHI3 1EV13 2VNRA 3IN9A 3V56A 4LHKA 4A3ZA 4OHYA 5FRAA 3CKHA 2W1WA 1S0BA 3EXUA 4QQLA 3TB0A 1LEMA 2XR4A 3RS6A 1SFPA 2WLPA 3U14A 2IXCA 3PMSA 4NRQA 3ACIA 1R093 4Y1UA 1XU1A 5L7OA 3O1VA 1VBA1 3USUB 2IUWA 3ROUA 1N1YA 4BJ0A 1GZTA 3VZMA 3I59A 3LA2A 3LA7A 3LDKA 5FIXA 5FYSA 4XBNA 3VBSA 1WLWA 2ARCA 2JDMA 2O0OA 4PLNA 4WVVA 4YRDA 3SH4A 3VKNA 4B8EA 4CP9A 1JZ7A 3ZPYA 1G9AA 3B02A 4QX5A 4NPMA 1OH4A 1VALA 2WO2A 4RYDA 1PGW2 3ZXAC 1LODA 3W5MA 4LBLA 2PMWB 2XJUA 4LQRA 4QPGC 2O14A 5CAZA 5JSPA 2VZOA 1E5SA 2ADDA 2WNUA 3GXUA 5A80A 1C4RA 3NKTA 2DVDA 1RXFA 4K20A 4ZXKA 3ZN4A 2B4KA 4V1PA 3VZLA 3LIHA 4NJ4A 2P1BA 2AR6A 2CWMA 5JAXA 1QJU3 4L9BA 4COZA 2FDGA 1AR82 2DWRA 2Y26A 3ZFGA 4IEXA 5FP7A 1XXNA 4XXAA 4JKKA 4CEWC 1OVSA 1N47A 5I91A 3PUIA 1D7PM 4NE9A 1BVP1 1LHOA 1YLLA 3AP5A 3VZNA 2D6KA 2QDNA 4Q4W1 4AVCA 1W28A 4TYSA 1NT0A 5D21A 2OVUA 2J1UA 4CP1A 5GM0A 2G4IA 4IV3A 3WP6A 2WSVA 4LORA 4B4PA 3WDXA 3A0KA 1O4TA 3PTYA 1Q5OA 2BERA 5AFBA 3KT4A 3U0ZA 1BLZA 3TEWA 3WDTA 2X8KA 5JPMB 4M4RA 4A42A 1QQP1 1AR81 3UJQA 4NAOA 5HPOA 3KV9A 3H1YA 2V4VA 4XFAA 5B4NA 2BVBA 4XZPA 2L9LA 1L7QA 1PX3A 1NKGA 1OOPA 3H50A 3R4SA 1AF9A 5J37A 4RSUA 5FY9A 1J59A 2CTVA 1ZBA2 5GZFA 5FZ3A 3AJYA 3RZKA 4U2AA 5K8SA 4PF1A 4QPGB 4TN7A 4LITA 4CCEA 4NHMA 2GMMA 1W2NA 1JU3A 1XNCA 2LM3A 1W8NA 2E7QA 2VH9A 5FYYA 3WXPA 1AR91 1VB2A 2JG8A 1DLCA 3GBGA 3VD3A 2WNVB 4W50A 5KBFA 1OQ1A 3N7KA 4A6OA 2VOWA 3JUUA 3DYPA 4V2WA 5FMCA 2QQMA 2D40A 3QLQA 2JXAA 1FNYA 5CKMA 1LAJA 1HRV2 2YZ4A 1ULEA 2ZX2A 4IEYA 4IEQA 4YW7A 1NAEA 1YCIA 3HN1A 1CESA 1AYN2 3O1TA 4LLFA 4QDSA 4CEWB 1RUC3 2F4LA 4DS0A 2E6VA 3TRSB 5C8CC 5FY7A 2PAEA 5SV8A 2HYKA 2P3YA 4GKXA 4DEQA 4Q4W3 1AL22 1W0PA 4RR3C 3IPVA 3NNMA 4E4SA 3R6SA 2NPIA 2GMPA 3ZYIB 4RQPC 3AL6A 2RR12 3R4DB 4QKBA 3ES4A 3QACA 1UZWA 1LOFC 2H0VA 3MPPG 3ZMNA 2MPFA 1PZ8A 2CDPA 1LU1A 1NUKA 2UWAA 1RUE2 3ALQA 4EE2A 3AP4A 1M4WA 3WDVA 1G9BA 4Z8BA 2BDRA 1Z7S3 3W59A 5LA2A 1CAUA 5JXGA 2B45X 1WW5A 5DDJ1 3NQHA 3RI8A 1QQP3 4JGZC 5BYNA 1X9PA 2VUDA 2OUHA 1S2EA 1ASJ2 1NZCA 3O1PA 3BKZA 4H14A 1FPN1 3DV8A 2ZGKA 1W8HA 4WZFA 3AKQA 1OUSA 4N9HA 5FUPA 4QX8A 3M3EA 5C33A 2B42B 3TBDA 3MDPA 1AVBA 5H9PA 1YC61 2B9UA 3U11A 5IVEA 2QZ2A 2EVXA 2DDUA 3LEGA 1DG6A 4DUXA 5FXXA 4BDVB 2RR11 4RL7A 4AVAA 4IQPA 1CQ9A 2ORZA 3MIGA 1AR93 4IV1C 4CU8A 2VCBA 3I3QA 4Q0PA 1K5MC 1ACCA 3E6DA 1N1SA 5F3GA 4PF5A 2OZJA 2Q8DA 2B8MA 1LOGA 3OTFA 4EN9B 3CLPA 1XOYA 3S30A 1X36A 4LHNA 4DNYA 3HQRA 4C1XA 5FZ0A 2GSYA 1RJ7A 2EALA 4XJAA 4NHYA 1QJY1 2E32A 4ISRA 3MBWA
chains in the Genus database with same CATH topology
2PXJA 4Y33A 5FP9A 5FZ6A 3AVRA 3K3OA 4HOOA 5IVYA 5A7PA 4XDPA 3OPWA 5FZHA 5KR7A 2OX0A 3ZLIA 5FPUA 3KV6A 4CSWA 3PDQA 5FZKA 5FP4A 4ASKA 2XDVA 4LIUA 5F2WA 5A3WA 4E4HA 5A7WA 4IGQA 2YU1A 2Q8EA 5IW0A 5F5IA 5CEHA 3DXUA 3DXTA 2WWJA 5E6HA 3N9QA 3PURA 4QU1A 5FYZA 5IVFA 3RVHA 5ISLA 2VD7A 3K2OA 3PUAA 2XXZA 5FXVA 2YBPA 3KV9A 5F32A 5FZLA 2GP5A 2W2IA 3N9LA 4CUGA 3KV5A 5FWJA 5FJHA 5FY9A 4AI9A 3U78A 5FPVA 5FYMA 4CCMA 5FZ3A 3PTRB 4IGPA 4TN7A 4LITA 4LXLA 5FYBA 5FZ4A 5FYYA 5IVCA 5FP3A 5F39A 3KV4A 4UF0A 4GD4A 5LY2A 4BXFA 3N9OA 5FUNA 5FBJA 5A3PA 5A7WB 5IVVA 5FZIA 4V2WA 5FZGA 4QXCA 5FPAA 5FZEA 4Y3OA 5FZ9A 2Q8CA 3N9NA 4QX7A 4Y4RA 5FP8A 5A7OA 3AVSA 2OT7A 3K3NA 5A7SA 4GJYA 4D6SA 5FYCA 5FYHA 5FY1A 4CCOA 2P5BA 3N9PA 5FY7A 2OQ6A 5FZOA 2XUEA 5FV3A 5IVJA 2OQ7A 4NUBA 5A1LA 3N9MA 2XMLA 2YPDA 3KVAA 5FYVA 5F5AA 4DO0A 3AL6A 3PU3A 2YBSA 4BISA 5FZMA 4QWNA 4IGOA 4D6QA 5A3TA 5F2SA 5FYIA 5FYSA 4UF0B 5FZDA 5FWEA 5A7QA 2WWUA 5FZCA 4LIVA 4CCLA 5LY1A 4GJZA 5FZAA 4EYUA 4BU2A 2GP3A 5FZ1A 5F3IA 1VRBA 3NJYA 3AL5A 4CCKA 4URAA 5FZFA 5FY4A 5FZBA 5A7NA 3U4SA 5LW9A 5FUPA 2YU2A 5F37A 4QX8A 4EZHA 3PUSA 5LWBA 4CCNA 3LD8A 4QXBA 5A80A 5FZOB 5IVEA 5FY0A 2OS2A 5F3EA 2YBKA 5FXZA 4CCJA 5FXXA 5A1FA 5FZ7A 5FXWA 4DIQA 5FPBA 5IWFA 5K4LA 4EZ4A 4AAPA 3PU8A 5F3GA 3KVBA 5FY5A 4V2VA 2Q8DA 3PUQA 5F3CA 4D6RA 5ANQA 5FY8A 3ZPOA 5FYTA 4GAZA 5FZ8A 5FYUA 5A3NA 4HONA 4QXHA 5FPLA 5FP7A 5FZ0A 3LDBA 3UYJA 5IVBA 5FJKA 4C8DA 4XDOA 5F5CA 3OPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PXJ A;  4Y33 A;  5FP9 A;  5FZ6 A;  3AVR A;  3K3O A;  4HOO A;  5IVY A;  5A7P A;  4XDP A;  3OPW A;  5FZH A;  5KR7 A;  2OX0 A;  3ZLI A;  5FPU A;  3KV6 A;  4CSW A;  3PDQ A;  5FZK A;  5FP4 A;  4ASK A;  2XDV A;  4LIU A;  5F2W A;  5A3W A;  4E4H A;  5A7W A;  4IGQ A;  2YU1 A;  2Q8E A;  5IW0 A;  5F5I A;  5CEH A;  3DXU A;  3DXT A;  2WWJ A;  5E6H A;  3N9Q A;  3PUR A;  4QU1 A;  5FYZ A;  5IVF A;  3RVH A;  5ISL A;  2VD7 A;  3K2O A;  3PUA A;  2XXZ A;  5FXV A;  2YBP A;  3KV9 A;  5F32 A;  5FZL A;  2GP5 A;  2W2I A;  3N9L A;  4CUG A;  3KV5 A;  5FWJ A;  5FJH A;  5FY9 A;  4AI9 A;  3U78 A;  5FPV A;  5FYM A;  4CCM A;  5FZ3 A;  3PTR B;  4IGP A;  4TN7 A;  4LIT A;  4LXL A;  5FYB A;  5FZ4 A;  5FYY A;  5IVC A;  5FP3 A;  5F39 A;  3KV4 A;  4UF0 A;  4GD4 A;  5LY2 A;  4BXF A;  3N9O A;  5FUN A;  5FBJ A;  5A3P A;  5A7W B;  5IVV A;  5FZI A;  4V2W A;  5FZG A;  4QXC A;  5FPA A;  5FZE A;  4Y3O A;  5FZ9 A;  2Q8C A;  3N9N A;  4QX7 A;  4Y4R A;  5FP8 A;  5A7O A;  3AVS A;  2OT7 A;  3K3N A;  5A7S A;  4GJY A;  4D6S A;  5FYC A;  5FYH A;  5FY1 A;  4CCO A;  2P5B A;  3N9P A;  5FY7 A;  2OQ6 A;  5FZO A;  2XUE A;  5FV3 A;  5IVJ A;  2OQ7 A;  4NUB A;  5A1L A;  3N9M A;  2XML A;  2YPD A;  3KVA A;  5FYV A;  5F5A A;  4DO0 A;  3AL6 A;  3PU3 A;  2YBS A;  4BIS A;  5FZM A;  4QWN A;  4IGO A;  4D6Q A;  5A3T A;  5F2S A;  5FYI A;  5FYS A;  4UF0 B;  5FZD A;  5FWE A;  5A7Q A;  2WWU A;  5FZC A;  4LIV A;  4CCL A;  5LY1 A;  4GJZ A;  5FZA A;  4EYU A;  4BU2 A;  2GP3 A;  5FZ1 A;  5F3I A;  1VRB A;  3NJY A;  3AL5 A;  4CCK A;  4URA A;  5FZF A;  5FY4 A;  5FZB A;  5A7N A;  3U4S A;  5LW9 A;  5FUP A;  2YU2 A;  5F37 A;  4QX8 A;  4EZH A;  3PUS A;  5LWB A;  4CCN A;  3LD8 A;  4QXB A;  5A80 A;  5FZO B;  5IVE A;  5FY0 A;  2OS2 A;  5F3E A;  2YBK A;  5FXZ A;  4CCJ A;  5FXX A;  5A1F A;  5FZ7 A;  5FXW A;  4DIQ A;  5FPB A;  5IWF A;  5K4L A;  4EZ4 A;  4AAP A;  3PU8 A;  5F3G A;  3KVB A;  5FY5 A;  4V2V A;  2Q8D A;  3PUQ A;  5F3C A;  4D6R A;  5ANQ A;  5FY8 A;  3ZPO A;  5FYT A;  4GAZ A;  5FZ8 A;  5FYU A;  5A3N A;  4HON A;  4QXH A;  5FPL A;  5FP7 A;  5FZ0 A;  3LDB A;  3UYJ A;  5IVB A;  5FJK A;  4C8D A;  4XDO A;  5F5C A;  3OPT A; 
#chains in the Genus database with same CATH topology
 5DAQ A;  2PN5 A;  3NWK A;  4FPK A;  4I09 A;  3IDC B;  5BNP C;  3KCC A;  1HB4 A;  3LB9 A;  1CON A;  5FZH A;  3RYK A;  5JPN B;  4A3X A;  4QHZ A;  1Y4W A;  3NV3 A;  3U4X A;  2ZHL A;  4CP0 A;  4ASK A;  1B35 A;  2HEY F;  2DCT A;  2MEV 2;  2WAB A;  3VV1 A;  2Z69 A;  3GYD A;  1Y43 B;  4DXR A;  4RS5 C;  1DHK B;  2FCV A;  5AC9 2;  5DMY A;  3DXT A;  2DF7 A;  4UOJ A;  1SHW B;  3Q8A A;  4AW7 A;  4EWA A;  1QU0 A;  1HB1 A;  2YYO A;  4CYD A;  2YG0 A;  3M8L A;  2LAL A;  4XPV A;  1RXG A;  4AED A;  5DDJ 3;  4KWL A;  1HLC A;  4UFK A;  2FMD A;  2VZU A;  4XJ9 A;  3WW2 A;  1WUV A;  1UKG A;  4LO8 A;  3ILN A;  1AXZ A;  1FPN 3;  4Q8K A;  3GDB A;  4E9K A;  3THP A;  4D94 A;  1W0O A;  2UUR A;  4LO4 B;  4AI9 A;  1UAI A;  3I2G A;  2ZCW A;  3QOP A;  1XNA A;  1E5R A;  1RUJ 3;  4PBO A;  3HN3 A;  2I74 A;  4QX2 A;  2WS9 2;  1QJF A;  3FFQ A;  5EIY B;  2MEV 1;  3ZSL A;  2UYB A;  3K75 B;  4XFG A;  1SQ4 A;  5G05 L;  1UZZ A;  3JQW A;  5LY2 A;  1VBE 3;  5AC9 1;  4MLO A;  2VCC A;  4Y24 A;  5L9R A;  4FPJ A;  2DTW A;  4LTA A;  4HPK A;  4Q4X 1;  5APA A;  2DTY A;  4DOU A;  1K5M B;  4CEY B;  1IGO A;  2HLE A;  1ZVF A;  1ZRF A;  1HV1 A;  1MR5 A;  1QEX A;  1KIT A;  3U07 A;  3POW A;  3VDA A;  2BP6 A;  4JZR A;  3H8U A;  5BNO B;  1QJY 3;  1XSR A;  4QDQ A;  1UOF A;  1WMD A;  1XNT A;  2TNF A;  4OI2 A;  5DAP A;  2YGM A;  4ZU5 A;  4I01 A;  4J6G A;  1W6M B;  2BWA A;  3RYP A;  3V0A A;  1US2 A;  1S0D A;  2DVG A;  4NUB A;  5FLH A;  4AI3 A;  1FMD 3;  1ULD A;  3CZU A;  2WS9 1;  2Y6H A;  4H2A A;  1L7L A;  4M4P A;  2V73 A;  5LCW L;  1COV 3;  1OUR A;  5FOJ B;  2XL7 A;  4X8N A;  3THC A;  4NID A;  2W47 A;  1DP0 A;  3H9A A;  1ND3 C;  1OT5 A;  3C7O A;  1TE1 B;  3DPR C;  4BK4 A;  4AHY A;  5C4W C;  2WBK A;  2P6C A;  3OSD A;  2R7E B;  4FOW A;  4NWW A;  1UIJ A;  2ZPX A;  3GZE A;  2RS5 2;  4BQX A;  1OA4 A;  3A4U A;  1ZRC A;  4FT8 A;  2BGO A;  4Q0V A;  3WHU A;  2HBU A;  1ZRE A;  2Q0A A;  4AI8 A;  1TEI A;  2ZTN A;  3KCY A;  3F95 A;  2FCT A;  4QPW A;  3WIN E;  3JCI A;  5I8T A;  1GZ9 A;  2VQT A;  5JOZ A;  2BOJ A;  3IMN A;  2CU5 A;  4ARX A;  3C2U A;  3ON7 A;  3NAP C;  5LBF A;  3RYR A;  4DPN A;  3KHB A;  4BLI A;  3UNP A;  4AOC A;  1UYZ A;  5IWF A;  5LK7 B;  4F83 A;  2WFF 2;  2QZ3 A;  5IYY A;  5CFD C;  1RUD 2;  1W8O A;  5A6X A;  3A7Q A;  5ANQ A;  4Q4X 3;  4N53 C;  4CXX A;  5IK5 A;  3B7M A;  4PIX A;  3UL2 A;  3UYJ A;  5IVB A;  4N8M A;  3VZO A;  2HH9 A;  4XMI A;  2P3J A;  4JKM A;  1RIR A;  1O5U A;  4LOS A;  4Y5Z 0;  4ERO A;  3LKJ A;  5EWS A;  1AR6 1;  3ES1 A;  1MQT A;  1OMI A;  3NJX A;  1HXS 2;  2XWJ B;  4XDP A;  4JGY C;  3JBG 2;  1C8N A;  2G9F A;  2CV6 A;  3K48 A;  2P4E A;  2J1R A;  2VW1 A;  5FZK A;  3MYX A;  2GH8 A;  1UOJ A;  2PFW A;  2YV8 A;  1ZA4 A;  4IEV A;  5FQ0 B;  5BPX A;  4KWU A;  1O3R A;  5D8A A;  2WC2 A;  5EZW A;  2A7A A;  4M3C E;  3KMH A;  2WFF 1;  1NCR B;  2BNM A;  2ZGN A;  3RI9 A;  2QQO A;  1ND3 B;  3DPR B;  2YC2 A;  2VD7 A;  4GZ9 A;  5C4W B;  3PUA A;  2JDK A;  1Y3T A;  2XXZ A;  3J7H A;  4XJ8 A;  2JG9 B;  4FPL A;  1PVX A;  3TEZ A;  1HRI 3;  2Z4F A;  1UX7 A;  3KQR A;  4IER A;  3ZMO A;  4W6X A;  1MZ5 A;  1GOH A;  2GNT A;  1S1A A;  3IB3 A;  2IVI B;  1QJX 2;  2GZW A;  3E5X A;  5H9R A;  2DBN A;  5FZ4 A;  4F7Z A;  1W04 A;  3DL3 A;  4FAG A;  2GH2 A;  3RZZ A;  3NL1 A;  4JCK A;  3NAP B;  4MGY E;  1RIN A;  4I3P A;  1LHW A;  1PK6 C;  2RMU 2;  3A0N A;  3N3H A;  4GH4 A;  3ZR6 A;  3RG0 A;  2DCY A;  4NMI A;  4YGD A;  2VUA A;  4UW5 A;  5FKC A;  4E27 A;  1GZW A;  1X82 A;  2RS3 2;  3BU7 A;  5I0D A;  1HQL A;  3FN9 A;  2V5D A;  2HWF 1;  1O8S A;  3G6J B;  1G6N A;  1AR6 3;  4QT6 A;  3EHK A;  3HBZ A;  1U5X A;  1ZZ8 A;  3O1M A;  1UYY A;  1WW7 A;  1JOP A;  3C8X A;  4MSV A;  5IVJ A;  5EJ1 B;  3VDD B;  2WT0 A;  3ZFF C;  1QJX 1;  4YSF A;  5A1A A;  1VMH A;  3WP5 A;  4JGY B;  2D6N A;  4S2D A;  4DO0 A;  2X10 A;  4CDU C;  1UIK A;  4HLT A;  2ZMN A;  1VR3 A;  5FMB A;  1H6X A;  1W6P A;  3T0A A;  3WF4 A;  4IEU A;  4LBM A;  4B7K A;  2ZJC A;  3AZV A;  1S0I A;  2WO3 A;  2EAK A;  2WWU A;  4JC1 A;  4DFS A;  2ET1 A;  4FSJ A;  3AB0 A;  4TSV A;  1HB3 A;  1UO9 A;  4BU2 A;  1GSL A;  4Y5T A;  3WDU A;  4Z2A A;  2ZKN A;  2W1S A;  3HOB A;  1UPI A;  4XUP A;  5FZF A;  1JBC A;  5FZB A;  1LEC A;  3TN9 1;  4QKF A;  1AR7 1;  2G9G A;  4P9J A;  5DUV A;  2XJP A;  1W6N B;  5ACA 1;  1V9U 2;  3VKF C;  1KJL A;  1POV 0;  1K42 A;  5FZO B;  2CNA A;  5JWP A;  2JE8 A;  1ZM1 A;  1D2Q A;  3OBR A;  2J22 A;  3WNL A;  5A1F A;  4WVM A;  5T5O A;  4EWD A;  1G8W A;  3OYW A;  5J3U A;  3WLU A;  3RJ2 X;  5J98 B;  2I07 B;  2KM2 A;  2IXK A;  5L36 A;  4LHL A;  5D2A A;  3MI8 A;  4R8H A;  5C6C A;  3S5Q A;  2X5I A;  3T2T A;  5HV0 A;  4QXH A;  1PK6 B;  2XJT A;  4YZ2 A;  3UJO A;  4BK5 A;  4C8D A;  4OZX A;  4I0A A;  1GR3 A;  3WQ0 A;  2AGS A;  3POJ A;  4XCA A;  3THD A;  4G4F A;  5C5U A;  2R07 1;  1JH5 A;  2HWF 3;  3IKW A;  4HOO A;  4YM0 A;  4IE6 A;  5DUX A;  3ZXF A;  4B4Q A;  4A4A A;  3III A;  5JDB A;  3VBH C;  3WUC A;  2FD8 A;  1R08 1;  1ULG A;  1Z78 A;  4HSJ A;  3I2K A;  3ZFF B;  3JD7 2;  4I3G A;  1SLC A;  2JJ6 A;  1UZY A;  2B39 A;  4IGQ A;  4XUN A;  5HXV A;  5ABJ B;  1EPZ A;  4CDU B;  1ZRD A;  3AJZ A;  4HAN A;  5JSO A;  2XOM A;  2VZP A;  2FDF A;  2VCA A;  3FHI B;  1W06 A;  4BQY A;  4W6Y A;  2AEY A;  5LBB A;  1C28 A;  1N3P A;  1LNS A;  1PVC 3;  3D0S A;  5CNA A;  4FBF A;  3MIC A;  1SLT A;  1WMX A;  4OYU A;  2CL2 A;  1RUF 2;  2NN8 A;  2V4A A;  2XVK A;  3LA3 A;  4CVU A;  3FHQ A;  4FCA A;  2VNV A;  3TN9 3;  1AR7 3;  2ZGO A;  4NRO A;  3ZSK A;  4JTN A;  4HKO A;  4BLJ A;  2H6C A;  1S0F A;  5CKN A;  1LKN A;  1LGN A;  4XBL A;  5ACA 3;  1OF3 A;  1JOB A;  1DQ1 A;  2ZZQ A;  5FYB A;  5T54 A;  1YJL A;  2FQP A;  1UL9 A;  2WO7 A;  2JDP A;  2ZAC A;  1PZ9 A;  3JD7 1;  1A8M A;  5DZE A;  3WNK A;  5GLU A;  5T5J A;  1PHM A;  3W9A A;  4UF0 A;  4YZ1 A;  5I0S A;  2OII A;  5DN2 A;  2VZ1 A;  3T0D A;  3HJR A;  4FQZ A;  4KBB A;  2DUO A;  2YY1 A;  2CGO A;  3SLI A;  4QXC A;  4KGG A;  4Q4Y 2;  4AZZ A;  2VXJ A;  3H42 B;  2IXI A;  1MS0 A;  2JEN A;  4Y4R A;  1FXZ A;  4XUT A;  4RGA A;  3HQU A;  2OT7 A;  3VHO A;  4YM2 A;  5E89 A;  3THT A;  2E31 A;  4QU2 A;  1SMV A;  1JYC A;  5EJ3 A;  1NLQ A;  4FXG B;  3HNM A;  5C3S A;  1G86 A;  2R07 3;  2XUE A;  3OY8 A;  3B69 A;  2ZHN A;  1GV9 A;  1POV 3;  2XHK A;  3D0J A;  2Q1M A;  2BOI A;  3VHP A;  3T2P A;  1R08 3;  1A3K A;  4MGZ E;  2BVV A;  3PU3 A;  2BNO A;  2VBP A;  3AP9 A;  3MLK A;  5JOX A;  4AFC A;  4H7L A;  3POI A;  4ZXE A;  1P8J A;  5BXX A;  3IMM A;  5K0U A;  4BIF A;  1V6M A;  1US3 A;  3O12 A;  1MZE A;  3WNX A;  4UFJ A;  1PGL 2;  3MFA A;  3AYA A;  4ITC A;  4UT5 A;  1CZT A;  1X33 A;  2XH6 A;  5EXO A;  1URX A;  1U5Y A;  4AXO A;  3UT0 A;  2R04 3;  3C3V A;  3N36 A;  3SCH A;  1VRH 1;  1TZO A;  1MZF A;  2PLV 3;  4FFI A;  3WD5 A;  1AYM 2;  3ZXJ A;  5C9A A;  4IE0 A;  4WV8 A;  2RM2 1;  3I4I A;  1OH3 A;  1F8V A;  1ST8 A;  4AGG A;  1NLS A;  2B9V A;  4AG4 A;  5FZ7 A;  4UFI A;  4KL1 A;  4QX3 A;  2DCJ A;  3KB5 A;  1XYP A;  4MHR A;  4EZ4 A;  4K1Y A;  1NCQ C;  4UFM A;  4P9G A;  4IND A;  4QD2 A;  2OUJ A;  4GAZ A;  1FAY A;  3VBF C;  1PGL 1;  2R30 A;  1YQ5 A;  5JCT A;  1O59 A;  5AFE A;  5TSW A;  1HB2 A;  1AX0 A;  3OPT A;  3ZSE A;  1HV0 A;  4FVV A;  2MHF A;  4CDX C;  5E1R A;  3J7N A;  4BB3 A;  1LHN A;  2D5H A;  4YVW A;  4Q26 A;  4N43 B;  3LEK A;  4J25 A;  1K5J A;  3H3Z A;  2XGX A;  3CJI C;  1NQD A;  4XDQ A;  5DAB A;  5A3L A;  1X8E A;  2XBO 2;  2VTF A;  3CL1 A;  4HL0 A;  4L97 A;  3FC0 A;  3USU A;  4ES8 A;  2NM1 A;  1O4Y A;  5DPN A;  2D93 A;  4FPH A;  4P08 A;  2BFU L;  3GHN A;  4E2G A;  4QPI A;  3VZJ A;  1IKQ A;  3EYP A;  1RVF 2;  1IPS A;  3H7J A;  1LHU A;  2R16 A;  4R9B A;  5GLW A;  4K7J A;  3KQ4 B;  2WZE A;  4FPF A;  3VL9 A;  5IVF A;  3CIH A;  2ZEX A;  1KS4 A;  2YBP A;  3AZY A;  1CAW A;  2ZHM A;  2B7Y A;  5F9T A;  3IDB B;  5LAS A;  1JYI A;  2NZ9 A;  5HCB A;  2EF6 A;  1JYX A;  1VRH 3;  2Y6F A;  5I8S A;  4CUG A;  4DY5 A;  1R1A 2;  1H6Y A;  2XJR A;  5FTT C;  2RM2 3;  2VOT A;  5C7G A;  1WW4 A;  3ATG A;  2F6B A;  4BXS V;  4ONU A;  5K7P A;  3HEI A;  1W6Q A;  2R06 2;  1OFS A;  2VG9 A;  3HD8 B;  4XUR A;  1O3T A;  2P3I A;  2OZ6 A;  1MAC A;  1CJP A;  3NRU A;  3ZIX A;  3VGI A;  4GD4 A;  5FOB B;  4XFH A;  4LT5 A;  3I3B A;  3BU0 A;  5FUN A;  1GP5 A;  2YPJ A;  4ZU4 A;  2YXS A;  5FZI A;  2W0X A;  1QDC A;  3I3M A;  1A34 A;  5FPA A;  5FLJ A;  1TMF 1;  1GOF A;  1BK1 A;  2O8Q A;  2V5Y A;  1O8P A;  2EIB A;  4LUM A;  2N7G A;  3D5O A;  3VBF B;  3T2Q A;  5D1I A;  2Z2S B;  1A8D A;  1IQA A;  2NLR A;  2QQN A;  5FYC A;  4UW3 A;  5FYH A;  4O61 A;  2P6H A;  3VL8 A;  2JDZ A;  4KQ7 A;  1QJZ A;  4CDX B;  4IES A;  4H3W A;  2SBA A;  2YPD A;  4XAC A;  2R06 1;  1AXY A;  2J1E A;  4Q2F A;  3AYC A;  4XJU A;  5DZG A;  5FO7 B;  4BA6 A;  4XQW A;  3HWJ A;  4QPY A;  1UMI A;  1LU2 A;  2HWC 2;  3S6P A;  5GZD A;  3WG2 A;  2K0G A;  4DZG A;  3AZZ A;  2J1A A;  2XUM A;  4PQ9 A;  3GCX A;  1V6N A;  4HFS A;  2A6V A;  2W1U A;  4Q4V 3;  5A7Q A;  4DMI A;  3BN6 A;  1XB9 A;  3MEP A;  3NKG A;  2QQL A;  1OKO A;  4ES9 A;  1JHN A;  2W68 A;  5FZ1 A;  1E57 A;  4XXP A;  4AFM A;  4OUM A;  4AEJ A;  4EN8 B;  1PIV 1;  1JYN A;  5J1X A;  1JXN A;  1RJ8 A;  1QXJ A;  4GUL A;  1D0H A;  1QOS A;  1ZBE 1;  3OPZ A;  4QQO A;  3ZXL A;  3IZO A;  4BHP A;  3O1U A;  1A6C A;  4QXB A;  3FLR A;  1NE4 A;  1BEV 1;  4MUV A;  3S7E A;  2ZZJ A;  2WNV A;  5C70 A;  2IXH A;  1I5P A;  1E5I A;  2RJL A;  4QQP A;  5IJR A;  5SV5 A;  1WBF A;  2HWC 1;  2J7M A;  2WWS A;  3FWE A;  5K4L A;  2E9Q A;  1LUL A;  4AAP A;  4A7Z A;  3BPZ A;  1L7R A;  4JRL A;  1PO2 1;  1UY3 A;  1W9Y A;  3ABZ A;  1OLM E;  4I2O A;  4PCR A;  2R0H A;  4Q0Q A;  2VUC A;  1PO1 1;  1CJD A;  2JE9 A;  5FYU A;  2J1V A;  4IE7 A;  1TMF 3;  1W8U A;  2Z79 A;  5FJK A;  1M06 G;  3GAL A;  1MVE A;  2F4P A;  1OLR A;  3H0O A;  1PNG A;  1WCK A;  3S57 A;  1N3Q A;  3NNJ A;  3FZ3 A;  4ISQ A;  4CP2 A;  3EMR A;  1UY4 A;  2ZOE B;  3N7L A;  3LPF A;  3ZYJ B;  1QKQ A;  2OX0 A;  5FPU A;  1UNB A;  4CCC A;  1W0N A;  4KMQ A;  1Y9Q A;  4OFG A;  2AEN A;  3D8C A;  1OPM A;  2R06 3;  3O0V A;  5IAT A;  2IZW A;  3DYO A;  2QCS B;  3RMY A;  1RMU 2;  3IAP A;  3VHR A;  5LBE A;  4JDM A;  3VKL A;  3POG A;  3WG4 A;  1RUG 3;  4J1X A;  4E2Q A;  4CRQ A;  4XEZ A;  2ZX1 A;  4PDW C;  3GZT B;  1RUO A;  3AMM A;  2EXH A;  2DBI A;  5G04 L;  3MID A;  3CDZ B;  3BOP A;  5LA1 A;  3ZYR A;  4AI0 A;  5GZG A;  2RV9 A;  2Q1F A;  3KWV A;  4FI9 A;  3KS7 A;  4CDW B;  4DUW A;  1PIV 3;  1JTZ X;  1W6O B;  4LMF A;  3FMG A;  5FPX A;  1PGW 1;  2C9K A;  3HPN A;  1F4A A;  3N9L A;  3USS A;  3IIA A;  3OUJ A;  4TLF A;  2KD7 A;  1ZBE 3;  2C4X A;  3M3C A;  5F1R A;  1DFQ A;  1XE7 A;  4FXK B;  3WG1 A;  1T2X A;  3OCP A;  3JXS A;  2UYA A;  4FFG A;  4Y22 A;  1I5Z A;  4JKL A;  1BEV 3;  4BCU A;  1BK0 A;  5L7O C;  1PMI A;  3MLJ A;  5IAX A;  1W8T A;  1VBA 3;  1C8M 2;  4Y5S A;  1H8T C;  1PO2 3;  5JIU A;  2OKX A;  4A44 A;  3BTA A;  2TUN A;  2Y6K A;  3ZSM A;  5JZG C;  2XVG A;  3VBS C;  4BZ4 A;  1PO1 3;  1QH6 A;  2A6Y A;  4AHW A;  3ETQ A;  4OVE A;  1PNF A;  1U12 A;  4YFZ A;  4NIH A;  4O9G A;  4PJY A;  4Q8L A;  4XFC A;  4YM1 A;  1JUI A;  3R05 A;  3RWN A;  1TVG A;  1GFF 2;  4D3W A;  1HJF A;  2XLF A;  4Z1V A;  3PJQ A;  2WNU C;  4Z92 B;  2EXI A;  4OCT A;  3EO6 A;  3WP4 A;  4TTG A;  3ZYB A;  3F2Z A;  1DF0 A;  5GLT A;  3I3E A;  5A70 A;  2VTX A;  4IGO A;  2J1T A;  2LRP A;  4XF1 A;  4YW5 A;  5LRR A;  3I3D A;  4W4Z A;  3MW3 A;  2WUH A;  4AAX A;  5FZC A;  2KA3 A;  3MPB A;  4KG0 A;  3ZFG C;  4PDW B;  1R1Z A;  1W3X A;  2PHW A;  4Q0S A;  5KC6 A;  5KXB A;  3C7H A;  3RRD A;  4JRA A;  4DIN B;  2BBA A;  2RDQ A;  2C6S A;  2JIC A;  4Y20 B;  4R4X A;  4AI2 A;  1HX6 A;  4M3C B;  2VVF A;  2ZX3 A;  3KZ4 C;  4YNI A;  4I30 A;  1GWM A;  1D0G A;  2ZS6 B;  5A3O A;  5EYY A;  3M1H A;  1YWK A;  1ZBA 1;  3HR9 A;  1NA1 A;  1CPM A;  3OJB A;  1Z0H A;  3E6B A;  3GHM A;  4IV3 C;  1ND2 A;  4DXT A;  2DUP A;  4XTP A;  4XFB A;  5FXW A;  3T1M A;  2XB6 C;  3BYW A;  1ZZ7 A;  2H0B A;  4CEY A;  4NHX A;  2MNG A;  5L7O B;  3Q8B A;  2BV4 A;  4LKF A;  4MX3 A;  2BWC A;  3B9I A;  1H8T B;  1XQN A;  1OD5 A;  2UY9 A;  5BNO A;  1UU6 A;  1SBE A;  1KJR A;  1WD4 A;  4YZ5 A;  1IS6 A;  1AR8 3;  3O0W A;  1HRV 1;  1O91 A;  1ULO A;  3SNM A;  1WLD A;  1TNF A;  1PM4 A;  2RJK A;  3TNP B;  3VB9 A;  1AYN 1;  3WNN A;  1G9D A;  5DXD A;  1FV3 A;  2VPV A;  2W92 A;  3B94 A;  1I9R A;  3IT8 A;  4A2U A;  4PT6 A;  4AL9 A;  3H8R A;  5CIR A;  2CAV A;  1MS9 A;  4CZS A;  1AL2 1;  1UYX A;  2LTN A;  4CSW A;  1T6B X;  1ENR A;  3MGU A;  3FBY A;  4PQQ A;  2XQR A;  3WF0 A;  3WQB A;  2OPW A;  3QBQ A;  2WNU B;  5FKB A;  4B4R A;  4LA3 A;  5CFC A;  1FT9 A;  4YAR A;  2JG8 C;  3URF A;  1DGW X;  4UBG A;  1APN A;  1RUE 1;  3WR0 A;  3AFG A;  4XJW A;  2XQX A;  4MXW A;  4CU9 A;  2A6W A;  5BY5 A;  4OQ9 A;  2ZGQ A;  4JTO A;  3ZFG B;  1ASJ 1;  1J84 A;  1D4V B;  1SCS A;  3EQE A;  1AJK A;  4BQW A;  5LEJ A;  1KD7 A;  1S4C A;  2FDJ A;  2W2I A;  4PIZ A;  3ZKU A;  3LE0 A;  4RA0 A;  3ZYF A;  4KBZ A;  1XPW A;  4LBQ B;  1LJ7 A;  3AK0 A;  4QGL A;  3UKT A;  1ZBA 3;  3RZJ A;  4IGP A;  2V72 A;  1MEC 2;  2RDS A;  3OGJ A;  1J3R A;  4RR3 B;  4NAM A;  5FP3 A;  4YGE A;  5KWR A;  1QNW A;  2ZEY A;  3LSD A;  4RQP B;  1VBC 2;  3KF3 A;  3AKS A;  1BCX A;  3WNP A;  4LA2 A;  2Y6G A;  4HXC A;  4PLO A;  1RL3 A;  2W9X A;  1WBL A;  5BNQ A;  1ULC A;  1GP6 A;  3N9N A;  1O5L A;  1PX4 A;  3HT1 A;  3RGB A;  2XWB B;  1HRV 3;  3AVS A;  1UN1 A;  1MS1 A;  1CVN A;  4JGZ B;  5LK5 A;  1AYN 3;  1CIY A;  2HWB 2;  4FFH A;  1OKQ A;  5GJ6 A;  5A32 B;  5EFU A;  2VMD A;  2PHT A;  4LKD A;  3FUQ A;  1IG0 A;  4AFA A;  1JN2 P;  5FV3 A;  1W8F A;  4CUB A;  2OQ7 A;  5FQ0 A;  2W91 A;  3RQ0 A;  2XML A;  1AL2 3;  4M3C F;  3MV1 1;  2VTX J;  1NCR A;  1CN1 A;  4KWK A;  4R9C A;  3D3A A;  2RR1 3;  3J7L A;  5DUU A;  1ND3 A;  5FYI A;  1VBC 1;  2F17 A;  4NHL A;  5C3Q A;  3ZM8 A;  2JG8 B;  2Y6L A;  1RUE 3;  2JG9 A;  4XET A;  4XF3 A;  4IV1 B;  5GZE A;  5IHR A;  1SBD A;  3BOD A;  5F6K A;  3WVJ A;  1DDL A;  1H4H A;  5F3I A;  3ZOI A;  4L0P A;  4DY3 A;  3RZM A;  1C5H A;  2ARA A;  3BGA A;  1ASJ 3;  1EAH 2;  2P3K A;  1W9T A;  2HWB 1;  2WKK A;  4GWM A;  3IAQ A;  3ENR A;  5JZG B;  2WA3 A;  3CO2 A;  4TLG A;  4DXZ A;  2O1Q A;  3J8F 2;  1QOO A;  3M3Q A;  4EWE A;  5EYX A;  4YLZ A;  2WII B;  4W65 A;  5FUI A;  2A70 A;  5BNP B;  5FXZ A;  5F3E A;  4XHX A;  1B35 C;  1OI6 A;  4HK8 A;  1JHJ A;  2E7A A;  2H6B A;  3SKV A;  3PU8 A;  1WGP A;  3RNS A;  1UZ0 A;  4RS5 B;  1DYP A;  5A3N A;  3H8X A;  4AED C;  3FUO A;  2PQQ A;  1GUI A;  2WO1 A;  2XHN A;  4WM8 A;  2R0F A;  2BJS A;  1EAH 1;  3POF A;  3VDD A;  4AQS A;  4JGY A;  4MGQ A;  1CX4 A;  4SBV A;  5CBL A;  3VBU A;  5A33 A;  2JB8 A;  5JSR A;  4XUQ A;  1S2K A;  1HN1 A;  2OW4 A;  5K9Y A;  2WZ8 A;  2FMY A;  2JB4 A;  3GCW A;  5ANN A;  3T30 A;  3HMY A;  3SEE A;  3N7M A;  2WFP A;  1YRZ A;  2MEV 3;  4JX0 A;  2K2S A;  2B46 X;  2ZGL A;  4NOT A;  3V0B B;  1RUH 2;  1S2B A;  1F4H A;  5AC9 3;  5FAX A;  3I49 A;  5IFP A;  2WAO A;  4RGK A;  2BW8 A;  2EA7 A;  1MS4 A;  5KXC A;  4MV2 A;  2R32 A;  1QF3 A;  4B3N A;  4YM3 A;  3BCW A;  2QVS B;  1VB4 A;  3PME A;  4F8A A;  2RS1 2;  1W6N A;  2NQY A;  2RS5 1;  1V6K A;  3K51 A;  4OHZ A;  3VBO A;  3WQ7 A;  3Q8F A;  1S55 A;  4XOG A;  3T09 A;  2ZX4 A;  4YW6 A;  3KV5 A;  2Q5T A;  1W8Z A;  3M2M A;  4X6R B;  4XCB A;  1CAV B;  3I2F A;  3E6C C;  1H2N A;  1W8W A;  3PTR B;  2VCM A;  4N90 A;  3T2O A;  2WS9 3;  1LR5 A;  1C1F A;  2RVA A;  4Q0U A;  3CMG A;  4RFR B;  4WM7 A;  5GKA C;  4CDQ A;  5JUV A;  1UYP A;  1B35 B;  2R1D A;  4M0H A;  1PK6 A;  4RHV 2;  4P5Y A;  5GLZ A;  5DAV A;  1VE0 A;  2CY6 A;  1OD3 A;  2VME A;  1GAN A;  1QH7 A;  1VBB 2;  1RUD 1;  4QXK A;  2ARE A;  2BRT A;  3I2I A;  4I02 A;  4H7M A;  5CG8 A;  4GKY A;  5FP8 A;  4NRP A;  1GLH A;  1UZV A;  2UWC A;  2QFE A;  4WVZ A;  1UOB A;  3SIS A;  4AED B;  3KT1 A;  4LUL A;  1J1T A;  4RN5 A;  1EAH 3;  1SPP A;  2PAK A;  4LBO A;  3C7E A;  4MGK E;  4FTE A;  3DCQ A;  3POE A;  1K45 A;  4OI1 A;  1HXS 1;  5JMC A;  3AXE A;  4ARY A;  5C5T A;  1QIQ A;  3LF7 A;  5DG2 A;  3JBG 1;  3N9M A;  5ABJ A;  1JYW A;  5FPZ A;  3JZV A;  4LEJ A;  5FYV A;  3S0M A;  3D4K A;  3OB8 A;  4LLO A;  1ZRI A;  1IS5 A;  1UX6 A;  4Y1V A;  2ZXQ A;  1KFU L;  2Y0I A;  3L9J T;  2C0Z A;  4YW1 A;  3VD7 A;  3W21 A;  3WW4 A;  1S0J A;  4RHV 1;  3ZIW A;  3I2D A;  1ONA A;  5BV6 A;  1JZ2 A;  1Q8Q A;  5FZD A;  1SDD B;  5KXD A;  1YI7 A;  3SCG A;  1S0G A;  4LOT A;  3MHZ A;  4GJZ A;  4P9Y A;  4L2N A;  5CFD B;  4FAH A;  4N53 B;  4COU A;  4CCK A;  2VZV A;  5FCC A;  3NNF A;  4MOA A;  5FY4 A;  2GN7 A;  2RS5 3;  1H4G A;  1OA2 A;  3KT7 A;  4XQ4 A;  5DAX A;  5LRS A;  1MQT C;  4P00 B;  4AK3 A;  1LOC A;  1GP4 A;  1SLB A;  2WZP P;  4CCN A;  5C8W A;  3B93 A;  3TNQ A;  4OUL A;  3O1R A;  4XQD A;  2YBK A;  5IUQ A;  3RZH A;  3QH7 A;  5IFT A;  2VOV A;  2LUW A;  2D97 A;  1DQ6 A;  1IS3 A;  4R9D A;  4M01 A;  5HXM A;  4GXL A;  1ENQ A;  5F3C A;  1NE6 A;  1NX9 A;  1W39 A;  4YW3 A;  2WFF 3;  1KGY A;  2I2S A;  2RMU 1;  3IM0 A;  4EN7 B;  5LA0 A;  1RUD 3;  2GC0 A;  1NOV A;  2LW8 A;  3VN4 A;  2VE1 A;  3J7M A;  3M3O A;  5FO9 B;  2GND A;  1BXH A;  3MIE A;  1JZ5 A;  1VMJ A;  3FFZ A;  1ZZC A;  2RS3 1;  3G7D A;  4GAL A;  5FZ6 A;  4FPG A;  1YFY A;  5BNN A;  1C57 A;  3HQX A;  4XAE A;  1JYV A;  2VGD A;  2HWE 2;  4F3J A;  4XTM A;  4MGT A;  1HXS 3;  3PVB B;  4OUE A;  3V65 A;  1SAC A;  2WA4 A;  3JBG 3;  2VVE A;  4K8F A;  5FP4 A;  4AFB A;  2C5D A;  2XDV A;  1LCL A;  1MZ6 A;  1ZA7 A;  1LES A;  1FOD 2;  3L2Y A;  5A7W A;  3ZR5 A;  2BQP A;  5T3N A;  5IW0 A;  3Q8E A;  4GB3 2;  4NHK A;  3ZN5 A;  2FDH A;  4AFD A;  1JZ6 A;  3NV4 A;  4GWI A;  2D6O X;  3RVH A;  3V64 A;  5L19 A;  1VIW B;  1VBD 2;  2CYF A;  5C3O A;  1OPO A;  1STM A;  2OYZ A;  2JEM A;  4MG2 A;  2CHH A;  1OSG A;  3FL7 A;  2AEZ A;  3C7G A;  5FR3 A;  3HVD A;  2PHR A;  1W2A X;  1XC6 A;  3J26 N;  4YVS C;  1ULF A;  4QGN A;  3ZFE A;  2JDH A;  4IL7 A;  3NNL A;  1GQG A;  2NMO A;  2X09 A;  2W08 A;  5CZK A;  4P5H A;  1V9U 1;  4IDZ A;  1QJX 3;  3H3L A;  2VR4 A;  1HN0 A;  1UW8 A;  3AC0 A;  2XLG A;  4YGC A;  3M7A A;  4XF4 A;  1RED A;  4N7U A;  1NZI A;  1NXD 1;  4BXF A;  3KGZ A;  1HIX A;  4GB3 1;  1W90 A;  1JZ3 A;  2CDO A;  5IVV A;  1Q8V A;  2UWB A;  4K8R B;  2A3W A;  1BBT 2;  2RMU 3;  1X8M A;  4MET A;  2X53 S;  1RUI 2;  1RGS A;  4DB5 A;  3UV9 A;  4N43 A;  3VD4 A;  4QM9 A;  2C9A A;  1WMF A;  1ODN A;  4I0B A;  1YFW A;  4XAA A;  1BMV 2;  2RS3 3;  2CSG A;  4P9W A;  4GA9 A;  5FY1 A;  4ZKT B;  3N7J A;  1XBF A;  5FRE A;  5A1L A;  2FBE A;  2VY0 A;  2WJS A;  5F8P A;  4BIS A;  3AFK A;  2Y64 A;  4HMZ A;  4QWN A;  1YI9 A;  1S0C A;  1XU2 A;  3FLP A;  1GZC A;  2EXJ A;  1VAM A;  3EBR A;  1OA3 A;  4URT A;  4DQA A;  1ZYB A;  2JE7 A;  2X5I C;  4FPE A;  3S5A A;  2P17 A;  2WN2 A;  2ZHK A;  4LKS A;  3SXW A;  2QQJ A;  2XG3 A;  3MIH A;  2D6P A;  4BYY A;  1BMV 1;  3SC7 X;  1YJK A;  2QQU A;  2RHP A;  4IW3 A;  3I2H A;  1RUF 1;  2ID4 A;  2VMG A;  4N7I A;  1F31 A;  2VNG A;  4W8J A;  5A7N A;  3ITQ A;  2VW2 A;  4EZH A;  1W2O A;  1EUT A;  3GM8 A;  4YVS B;  5FK7 A;  1D4M 2;  3LD8 A;  3ZXG A;  2WYF A;  4KU8 A;  5IAV A;  3VHN A;  1V9U 3;  1ZRR A;  3VBH B;  5FPB A;  4JQT A;  4PLM A;  1OXC A;  5FO8 B;  3SEP A;  2EID A;  5FMO S;  1IPK A;  4V2V A;  3RWK X;  3VBR C;  3SMH A;  3C7F A;  1F9K A;  4LBQ D;  4E2S A;  2R1B A;  4Y1Z A;  4Q4Y 1;  5I8Y A;  3PUH A;  3ZSJ A;  1KQR A;  4KNC A;  1DCS A;  2DVB A;  1DQ4 A;  4ORF A;  3WHT A;  1V6L A;  3LFI A;  5EP9 A;  2VUL A;  5CKQ A;  4NRM A;  5C3P A;  3EJK A;  5GLV A;  2TBV A;  2CGP A;  2WSU A;  4B1M A;  4YWA A;  1G9F A;  4XW3 A;  2KR2 A;  4LIU A;  4YG6 A;  3AKP A;  2YHJ A;  5A3W A;  4EJR A;  4Q27 A;  4P9L A;  3JD7 3;  4IE5 A;  4WVM B;  3A22 A;  3ZDV A;  1TME 2;  1J83 A;  3OYW B;  2AH2 A;  2GME A;  4LJH A;  4AVB A;  4XIO A;  4XC9 A;  4XBQ A;  1CGP A;  1H2K A;  2A73 B;  1X9T A;  3AKT A;  4UW4 A;  4UYB A;  1DGR N;  3MO4 A;  3P3P A;  2ZAH A;  1DBN A;  1ODM A;  1REE A;  2KXL A;  2VOX A;  3TOJ A;  2XLA A;  4BPZ A;  1YEW A;  2HEV F;  4KU7 A;  3AKR A;  2DVA A;  4GWJ A;  5L9B A;  2VOK A;  3KM5 A;  2WNO A;  1RUF 3;  1ENX A;  1AYM 1;  5JI7 A;  2FHR A;  4CCM A;  3KLS A;  1G9C A;  2HBT A;  3JB4 C;  4M00 A;  3WF1 A;  4QX0 A;  1G7Y A;  4ZPI A;  5IT6 A;  2WZR 2;  3BTY A;  4OLL A;  1W2T A;  1UMH A;  4ZY9 A;  3TEX A;  4AI1 A;  5IVC A;  1IZ3 A;  4HKW A;  4NII A;  1RYY A;  2HWD 2;  3E1F 1;  4S2F A;  2GN3 A;  5K0U C;  3N9O A;  1GNH A;  1XSQ A;  1TME 1;  2D3R A;  1YIP A;  1SLA A;  2BNN A;  5FZE A;  3VBR B;  2GNB A;  2PHX A;  2XVL A;  5FZ9 A;  3WNM A;  4D69 A;  4Q4Y 3;  4LKE A;  1V0A A;  3ZVX A;  1RHI 2;  1PMJ X;  1EV1 2;  3D6E A;  2PHD A;  3OGG A;  3D82 A;  4CCO A;  4CU6 A;  5C9A C;  3RSJ A;  2JWP A;  2AC1 A;  1CAX B;  2JX9 A;  1OHF A;  3SQO A;  5JXI A;  1R09 2;  1UCX A;  2XBO 1;  5F5A A;  2QQK A;  5JVV A;  2W46 A;  2YBS A;  2A71 A;  2JDN A;  3N35 A;  5FZM A;  2FZ2 A;  1ZZ9 A;  4FP2 A;  2HWD 1;  4FOV A;  2ATF A;  3EB7 A;  1RVF 1;  5T52 A;  4LPL A;  5EPA A;  4UF0 B;  2WT2 A;  4HZF A;  4XFF A;  5C8C B;  3H3U A;  4CDW A;  1NCQ B;  1W6O A;  1O3Q A;  4EYU A;  3W20 A;  4Q29 A;  3BAL A;  3H7Y A;  3OBA A;  4AGV A;  2VMF A;  3WNO A;  4AF9 A;  1OQE A;  3POY A;  4BM8 A;  1EV1 1;  1ALY A;  4YVW C;  2G19 A;  3BVC A;  3WF3 A;  2YU2 A;  3BIW E;  4G3Y C;  1AYM 3;  1R1A 1;  3ELN A;  3ILR A;  5JXH A;  5A3M A;  3NJV A;  5EHD A;  2O8O A;  4LK7 A;  3OY8 B;  2XPJ A;  3NJZ A;  1W05 A;  3CJI B;  5CG9 A;  2ARX A;  1XE0 A;  4DIQ A;  3IDE A;  4QPI C;  3T0B A;  3PLQ A;  3E5U A;  3O7O A;  4NPR A;  1QJU 2;  5IK7 A;  4B1L A;  4D6R A;  4Y1Y A;  2WLQ A;  5FY8 A;  4MYE A;  5K0U B;  2YMZ A;  4HON A;  2D6M A;  2HJI A;  4W6W A;  2HEW F;  5FMD A;  3UK9 A;  1A78 A;  4QHB A;  2VZR A;  3VDB A;  3VLB B;  2A6Z A;  1J58 A;  2QJV A;  4QQH A;  1QDO A;  2P2K A;  5FP9 A;  4QB6 A;  1UXX X;  2LS6 A;  4QPG A;  3SIT A;  1VAK A;  5A7P A;  1JZ4 A;  5DZF A;  3ZDS A;  2WYS A;  5IK8 A;  4HET A;  4Y1X A;  2DUR A;  2ZGR A;  3KV6 A;  4G9S B;  5J96 B;  3PDQ A;  3JB8 A;  3LQC A;  2XBO 3;  3B01 A;  3SKJ E;  4E8C A;  5CIS A;  3POS A;  3UGG A;  2K46 A;  1OF4 A;  2YFU A;  2YU1 A;  3WZ1 A;  5F5I A;  2NP0 A;  2ORX A;  2WN3 A;  4HSL A;  3CZJ A;  4DUV A;  1RVF 3;  2QQP A;  2QDR A;  3N9Q A;  4ZON A;  1HQN A;  3GBF A;  4R52 A;  2R6Q A;  2YC4 A;  4Y20 A;  1DQ2 A;  1XND A;  3CNA A;  3UKN A;  4Z2W A;  4CEW A;  1LEN A;  1YQC A;  2WQ4 A;  2Q30 A;  1F5F A;  5F32 A;  4A6S A;  2QBX A;  4BIO A;  3WY6 A;  3ZN6 B;  4CA9 A;  2ETE A;  4ATE A;  3AYE A;  3ME2 A;  3U78 A;  2PEL A;  3AMQ A;  3RJR A;  1BKZ A;  4ASM B;  4YVW B;  1R1A 3;  4ZZ8 A;  1C5I A;  2E7T A;  2EAA A;  2GDF A;  1U0A A;  1UU4 A;  1D2S A;  3NV2 A;  4OI0 A;  1H8T A;  3ASI A;  3H1M A;  5J36 A;  2D3S A;  3R4U A;  2JKX A;  3P5B A;  1GNZ A;  4MH0 E;  1GNY A;  2YDE A;  1LED A;  4QPI B;  4OMC A;  1AZD A;  3AMP A;  3B5L B;  3OEA A;  3FJS A;  4B29 A;  2XKO A;  1LB2 A;  2ENR A;  2A6X A;  2ZAB A;  1DLL A;  2C24 A;  3OF1 A;  2Y38 A;  1UF2 C;  3WT3 A;  3CF6 E;  4X6Q B;  1RUC 2;  4JDO A;  3M3I A;  1YQ6 A;  1YUD A;  2PTM A;  1FAT A;  3T4V A;  3N4M A;  1CAW B;  2JDU A;  2P5B A;  4Q4W 2;  3FBM A;  1WLT A;  4QKN A;  1Y7B A;  3WV6 A;  2DFB A;  1OBN A;  4Y4Y A;  3P6B A;  3WX5 A;  1L3J A;  1GKB A;  4YPJ A;  2WNV C;  5LB6 A;  3OD4 A;  4CXW A;  1BJQ A;  4HK9 A;  3FLT A;  3O0X A;  1W6Q B;  2OA2 A;  3E5Q A;  3MF9 A;  3NO8 A;  4U36 A;  1RMU 1;  1Z7S 2;  3OGS A;  4D6Q A;  2HWC 3;  3AXD A;  3LAG A;  4QX1 A;  4COW A;  1QQP 2;  5FWE A;  2YC0 A;  1ZZB A;  5JXJ A;  2D7F A;  4LBK A;  4E4D X;  1RUC 1;  4FO9 A;  2GC3 A;  5EQU A;  4URA A;  3B3Q E;  1XYO A;  3GNE A;  4LBQ A;  1CX1 A;  4LO6 B;  4IUG A;  2WRA A;  3OUH A;  3CEW A;  2WIN B;  4RGG A;  3U10 A;  5F37 A;  2C1F A;  5F6L B;  4RR3 A;  5LEK A;  3ZYH A;  1R64 A;  1X50 A;  1IOA A;  4RQP A;  2VM9 A;  1LRH A;  1C3H A;  1O6U A;  1DZR A;  4AR2 A;  4CCJ A;  1AR9 2;  3HNB M;  3UGF A;  1OLQ A;  2VBB A;  1GMM A;  1LOF A;  3FX3 A;  4L92 A;  1Z7S 1;  5C3R A;  1GWL A;  4TZD A;  1AXK A;  1YQ8 A;  4AYU A;  1C8M 1;  1KFX L;  3LEM A;  4IEW A;  4GMP 0;  5LAT A;  1FV2 A;  2GAL A;  2BGP A;  3O14 A;  4JGZ A;  1N1V A;  4FPC A;  5A32 A;  1QMJ A;  2RG4 A;  4AHX A;  4Q5O A;  5I0R A;  1MS8 A;  3JU9 A;  5CVR A;  2Y6J A;  3B00 A;  3DYM A;  3OG2 A;  1GBG A;  1XRU A;  2EIC A;  3GGL A;  1Q56 A;  1VMF A;  2BUK A;  2WQ8 A;  2WR9 A;  3VD5 A;  4IV1 A;  3AZW A;  3WW3 A;  1K5M A;  1RMU 3;  1U5I A;  4GMP 1;  1KS5 A;  4AWD A;  3GZA A;  4D7T A;  1CPN A;  5FK8 A;  1BVV A;  3APB A;  4UWD A;  5DDJ 2;  3UET A;  5FYZ A;  3CJX A;  2QE3 A;  3I59 B;  3ZXK A;  1FPN 2;  5JZG A;  3VBS B;  1Q43 A;  2DYC A;  3LGR A;  3ILF A;  4WBB A;  1W6M A;  4CP9 B;  3HNY M;  5BNP A;  3AP7 A;  4UAP A;  4BQ4 A;  1OOP C;  4FFF A;  2ZX0 A;  5FWJ A;  1RUJ 2;  1WKY A;  1UKR A;  5HBA A;  4NN0 A;  3ZKY A;  5HCH A;  4A7Y A;  2QNK A;  2D3P A;  4BH9 A;  4GIQ A;  1WA6 X;  2VMI A;  2VBD A;  1VBE 2;  4ZHN A;  2Q4S A;  1V6O A;  1H8V A;  3LEI A;  4RS5 A;  3VDC A;  1BHG A;  4CPB D;  1IPJ A;  1LGC A;  1H1A A;  1UMZ A;  1C8M 3;  2ERF A;  1H9P A;  3ZYG A;  4Y3O A;  2PYT A;  4E8D A;  4K9S A;  1Q8S A;  1GQP A;  1QJY 2;  1V6I A;  5E8A A;  3K3N A;  3OEB A;  4L99 A;  4XHB A;  1SFY A;  4NO4 A;  5E16 A;  2A1X A;  1XNB A;  3Q8C A;  3N9P A;  4QQ2 A;  2OQ6 A;  1RUJ 1;  5DQ0 A;  1FMD 2;  1LOB A;  3L2H A;  2ZEW A;  2QQW A;  1NA1 C;  5JR2 A;  3ZO0 B;  2WDB A;  2W1Q A;  1XYN A;  1ND2 C;  3MLL A;  3V0B A;  1RC6 A;  1COV 2;  4LHS A;  4L8Q A;  5JMO A;  1VBE 1;  4Y22 B;  2BEO A;  4QB2 A;  3H8O A;  4CEY C;  4IV3 B;  4UXA A;  5F2S A;  4CXY A;  2XON A;  2HYX A;  4GMP 3;  4C0B A;  1JU4 A;  1ENS A;  1UPS A;  4LIV A;  1DGW A;  2PHF A;  5BNO C;  2EXK A;  1GYK A;  1H9W A;  4YW4 A;  2YGL A;  1WW6 A;  1UY2 A;  4P9X A;  4CU7 A;  4JV4 A;  1CAV A;  1X7N A;  2YB7 A;  2VAU A;  1W2U A;  4KH9 A;  1W03 A;  1CWP A;  4OHW A;  4O7X A;  3PIJ A;  1AX1 A;  1H2L A;  1FMD 1;  2VU9 A;  1GQH A;  1OOP B;  2VZT A;  3DKW A;  4A41 A;  1GWK A;  5FLI A;  3SH5 A;  3JQX A;  2OS2 A;  2BYV E;  1MEC 1;  1NYW A;  1COV 1;  5FDB A;  2XKP A;  2ZKL A;  5CFC C;  1JI6 A;  4BQ1 A;  4N9I A;  2D98 A;  4AEK A;  1DQ0 A;  3OBZ A;  1YO8 A;  3PUQ A;  3DPR A;  2VC9 A;  3INA A;  1LTE A;  1WZX A;  4Q4X 2;  5C4W A;  5FYT A;  1UQX A;  3LOB A;  3DN7 A;  1SCR A;  1T6G C;  3LDB A;  4IE4 A;  5F5C A;  1JS9 A;  3WEZ A;  3RMX A;  1EYB A;  3BTX A;  2GU9 A;  3A23 A;  3WG3 A;  1TNR A;  3AM2 A;  4ASL A;  5KR7 A;  3ST7 A;  4KWJ A;  1UD1 A;  3P1I A;  4XFI A;  3PHM A;  1AHS A;  3NAP A;  3I2O A;  1SLI A;  1NA1 B;  5A6Z A;  3IPV B;  2DVF A;  2A5Z A;  3K4A A;  3MW4 A;  4IXL A;  2PQS A;  4OHV A;  2Z5W A;  1ND2 B;  5EJZ B;  4E4H A;  5FFO C;  3WCS A;  3BB6 A;  4NWV A;  3MV0 1;  3LDR A;  3GF6 A;  3TAY A;  1MS3 A;  2X29 A;  4K40 A;  5CFD A;  5E6H A;  1ULP A;  4AVS A;  2V09 A;  3KD4 A;  4N53 A;  3CHX A;  1RUN A;  2BGC A;  4LO7 A;  3WUD A;  4CUA A;  1YNA A;  4TXW A;  2FZ1 A;  1HRI 2;  2QQI A;  2W52 A;  1CAU B;  3DEC A;  4QMA A;  1AJO A;  5T55 A;  5A3U A;  3TWI A;  3W5N A;  4HVR A;  5FZL A;  3OGR A;  5FBZ A;  2SLI A;  1H30 A;  1HW5 A;  4BQ5 A;  5FPV A;  2UY8 A;  5JOY A;  3J8F 1;  4ZS3 A;  2GC1 A;  2DU0 A;  4LXL A;  1Q8O A;  2ZEZ A;  4C91 A;  3IWZ A;  1MEC 3;  1NCR C;  2QUO A;  4MGS A;  4OHX A;  3QCW A;  2VQA A;  1YHF A;  2ZAA A;  3O1O A;  1F5J A;  1F2N A;  5A3P A;  5JR7 B;  3VD9 A;  5CFC B;  1PGS A;  4LK6 A;  5FZG A;  1VBC 3;  2JG9 C;  4EQV A;  1QXP A;  1UOG A;  4P02 B;  1JUH A;  2Q8C A;  4ATF A;  1RB8 G;  1KRI A;  1WLC A;  1HRI 1;  2CWS A;  2IFW A;  3PVE A;  4MXW B;  2NYY A;  1AR6 2;  4C1W A;  3MF6 A;  1FNZ A;  2HWB 3;  3R0R A;  5FZO A;  2PA7 A;  2FDI A;  2OXB A;  5CYY A;  1SZB A;  3ORJ A;  3BOW A;  3MIB A;  4LBJ A;  2ADE A;  5AVA A;  3ZYP A;  1VAV A;  3DUI A;  4Q1R A;  4AGR A;  2XJS A;  3ECQ A;  5KHJ A;  1XNK A;  2A3Y A;  1KDK A;  4H55 A;  4AHZ A;  3MUZ 1;  5JIA A;  2P37 A;  1RUH 1;  2VJX A;  4CCL A;  3SCF A;  3NMB A;  4HKL A;  5FZA A;  4C90 A;  1GOG A;  1WCU A;  3DKQ A;  3GZU C;  4BQ2 A;  4WM8 C;  1FYU A;  3AL5 A;  1F15 A;  3U75 A;  5J48 A;  5DUW A;  2RS1 1;  1Y9G A;  2W5F A;  2Q1Z B;  4YG0 A;  4OMD A;  4HBN A;  3VDD C;  5KC5 A;  2BBV A;  4S2H A;  3ACL A;  1FX5 A;  3GJA A;  2Y34 A;  4OZO A;  3VBU C;  3PUS A;  3AMH A;  1MS5 A;  3ZFF A;  3ZX7 A;  4EN0 A;  1SG3 A;  5J09 A;  3J8F 3;  1K3I A;  4UW6 A;  1BQP A;  4CDU A;  4HG6 B;  2AAC A;  3LZZ A;  4R4Z A;  3TEY A;  1CIW A;  2QTW B;  4D7Y A;  4FTS A;  4ZU7 A;  1UY0 A;  4FPO B;  3VKM A;  4NVP A;  3FHA A;  1WA4 A;  1QHD A;  1UWW A;  1LHV A;  4XYX A;  5B4X A;  4ET7 A;  2K9Z A;  1U5Z A;  1VBB 1;  1WCQ A;  2VL4 A;  2ZML A;  4MVT A;  4YYO A;  4AEM A;  1OLM A;  4JVA A;  4HPK B;  4XJZ A;  5C71 A;  4JDN A;  3OGV A;  4CE8 A;  3VBO C;  2HWF 2;  4HVO A;  3W58 A;  1I3H A;  1QOT A;  4Y33 A;  4QGM A;  1W99 A;  5H9Q A;  5T5L A;  2YFZ A;  5IVY A;  3ZXE A;  5DAW A;  3I7D A;  1N3O A;  2J1S A;  3LWC A;  4GQ7 A;  4AQ6 A;  5GZC A;  2LRO A;  1F35 A;  1CR7 A;  3AP6 A;  1W3V A;  2IXJ A;  3PIG A;  3PJY A;  2W95 A;  2ZGM A;  4XE9 A;  4PIY A;  2XJV A;  5IK4 A;  2WT1 A;  4BE3 A;  2BU9 A;  4WM7 C;  3I97 A;  4LBN A;  3V0A B;  4BQ3 A;  5KHK A;  4CDQ C;  2JD4 A;  3K46 A;  2Q8E A;  5CEH A;  5D8A C;  3VUO A;  4ZS2 A;  3LIG A;  3O5S A;  1MPX A;  1RUH 3;  1PVC 2;  1NG0 A;  2VVD A;  3UGH A;  2Y0O A;  5ISL A;  4CPB A;  3K2O A;  3T08 A;  5KXE A;  2E26 A;  3DEM A;  1JOJ A;  4PI2 A;  4BME A;  3M70 A;  4AE2 A;  3TN9 2;  3LPG A;  2CAU A;  1AR7 2;  1OQD A;  3NST A;  4YVS A;  2AYH A;  3UKV A;  3WQ1 A;  2RS1 3;  3ETP A;  2GP5 A;  1J3Q A;  4WM8 B;  1VLN A;  3AYD A;  3KGL A;  4WZC A;  5EV7 A;  4MXV A;  4E4Z A;  5ACA 2;  5HI0 A;  2E63 A;  5FYM A;  3DGT A;  5T50 A;  4LNV A;  3VBH A;  2UU8 A;  4Q1P A;  5ABJ C;  1VJ2 A;  3VBU B;  3IBM A;  3NNG A;  5A33 B;  4XF9 A;  1WCS A;  3ACG A;  4XIL A;  1JYT A;  3OUI A;  2I45 A;  3IDA A;  4Z82 A;  2DV9 A;  4A45 A;  4IEP A;  5FBJ A;  1EPW A;  1V6J A;  1OUX A;  4J1W A;  3NVC A;  4NPL A;  4RHV 3;  4O9E A;  2JDA A;  3MW2 A;  4GH4 C;  4COV A;  1PVC 1;  4YZ3 A;  2Q8O A;  1VBB 3;  2AZ5 A;  2G1M A;  4YFW A;  2D5F A;  4EV0 A;  3LCP A;  1NQJ A;  3NV1 A;  4KGQ A;  3P3N A;  4XUO A;  3K77 A;  2R07 2;  2TEP A;  4D6S A;  4JAA A;  3I8T A;  3X29 B;  2RJ2 A;  4O65 A;  2XL9 A;  4QAW A;  3LFM A;  3VBO B;  3WW1 A;  1QJE A;  1B09 A;  1QXR A;  2DCK A;  1R08 2;  3MFC A;  4WVW A;  2HWE 1;  1DIW A;  4MZU A;  1MQT B;  4FOQ A;  4AQT A;  3B9C A;  2ES3 A;  2EIE A;  4XF0 A;  2OPK A;  3WDY A;  1O4Z A;  4CCD A;  2JD9 A;  4KI5 M;  1NY7 2;  1FOD 1;  3O1S A;  3BTZ A;  2IXL A;  3MIF A;  1BZW A;  4WM7 B;  4QM8 A;  2VZ3 A;  2VQU A;  2QKD A;  2FCU A;  2Y33 A;  3SH3 A;  1V00 A;  1YIF A;  5D8A B;  4LE4 A;  4CDQ B;  4UBH A;  3QD6 A;  2ET7 A;  1HJG A;  3HIF A;  4EN6 B;  2R04 2;  1KXG A;  1XJA A;  1WWY A;  3NW4 A;  2PAM A;  1VBD 1;  1VRB A;  2PLV 2;  3NJY A;  4UFL A;  5JI9 A;  1DU3 D;  4FQ4 A;  5I0U A;  3M4F A;  2D44 A;  5LW9 A;  1N1T A;  4X8P A;  1POV 1;  3AZX A;  4OI4 A;  4ZZ5 A;  5BNN C;  1HQW A;  2R49 A;  1OVP A;  1SPP B;  2ZGP A;  4YG3 A;  2AUY A;  3T4H B;  5CA6 A;  4HT1 T;  4A7K A;  3RZG A;  2WQZ C;  2Y8K A;  2W3J A;  5FY0 A;  5LA9 A;  5F7U A;  4D7S A;  1W9W A;  3MUY 1;  1UXZ A;  1LGB A;  3QH6 A;  4NIG A;  4CUC A;  1NY7 1;  4JHZ A;  3VBR A;  1QNY A;  3HAG A;  1BYH A;  2XJQ A;  3H1W A;  4UI9 L;  1Q8P A;  1SBF A;  2P34 A;  5FY5 A;  3PVN A;  2ARB A;  4DRV A;  3ZPO A;  2VZS A;  5FZ8 A;  2W94 A;  1BBT 1;  2VXR A;  1C1L A;  1YYN A;  2R04 1;  2YUE A;  4XMA A;  2QQV A;  1RUI 1;  2YRO A;  4GH4 B;  1SFN A;  1CAX A;  4P14 A;  3BIE A;  1GIC A;  2PLV 1;  2PHL A;  1K12 A;  5CAD A;  3BPS A;  2IFR A;  1JOD A;  1GZW B;  2BFU S;  3AVR A;  3K3O A;  3I54 A;  1IS4 A;  3ZFE C;  4AVT A;  5BUV A;  2W39 A;  4FP3 A;  2PHU A;  4LUK A;  3OPW A;  2ZMK A;  2VNO A;  2HWE 3;  3ACF A;  1AX2 A;  3HT2 A;  3MZH A;  4OQ8 A;  1TQ5 A;  2VMC A;  5C8C A;  3PVO A;  1FOD 3;  1NCQ A;  1IHM A;  2D43 A;  3DXU A;  2W87 A;  5GAL A;  5HCF A;  1QWR A;  1H1M A;  4GB3 3;  3KF5 A;  4YZ4 A;  3VBF A;  1W6P B;  2FDK A;  1UU5 A;  2GC2 A;  1REF A;  4TWT A;  4FTB A;  3T1L A;  2C26 A;  3J4U H;  4S2G A;  5E88 A;  4N43 C;  1W9S A;  3PL0 A;  2VZQ A;  5FXV A;  1VBD 3;  1VRH 2;  3AMN A;  1POQ A;  4CDX A;  3GJB A;  4BMB A;  4QKD A;  4P9I A;  1AL0 G;  5HCA A;  2RM2 2;  4JHT A;  5M0T A;  1CD3 G;  3J9S A;  2JIJ A;  3CJI A;  4YGB A;  4D8M A;  3BI3 A;  2ZBJ A;  4KG8 A;  5JLV A;  4NR1 A;  5BNN B;  3S7I A;  2GNM A;  1HDK A;  1D4M 1;  4I0W B;  2X05 A;  2IVJ A;  4DXS A;  4C0H A;  4QB1 A;  4BWO A;  4OUS A;  1H2M A;  1QGL A;  5F39 A;  3KV4 A;  1DQ5 A;  3CU7 A;  5A7W B;  2B5H A;  1WME A;  2WL1 A;  3PNA A;  5LBC A;  4PHZ A;  3CBN A;  4MO3 M;  4QX7 A;  4QHO A;  4JQR A;  1BBT 3;  2X5I B;  1RUI 3;  3WP3 A;  2ZGS A;  4MAD A;  1FI2 A;  1YXW A;  3OD0 A;  4QDR A;  5KHI A;  3KSC A;  2BTV C;  4LE3 A;  3KCX A;  3OBT A;  3Q9O A;  2JIG A;  3ZFE B;  3POB A;  4D0Q A;  1XE8 A;  2E33 A;  4SLI A;  1GU3 A;  3KVA A;  3ZXD A;  4HVQ A;  4FOY A;  2D6L X;  4K3U A;  1UY1 A;  1PM7 A;  5H9S A;  5KHG A;  5A3T A;  2WNE A;  1CZS A;  3DF0 A;  3AX4 A;  4Q4V 2;  1I6X A;  1DZT A;  2VMH A;  3WSO A;  1Q3E A;  2JKB A;  1YQ2 A;  1DYO A;  2VW0 A;  1JZ8 A;  5LY1 A;  2G9Z A;  4IET A;  3HBK A;  3ZN6 A;  5B2G B;  4BOW A;  4IEO A;  2GP3 A;  3CQO A;  4FPY A;  3GBW A;  4LR4 A;  3VKO A;  5I0T A;  3WCR A;  4K21 A;  5LZ6 A;  3KHC A;  3U4S A;  4LO5 B;  1ZZ6 A;  3RDI A;  2ZA9 A;  4HN0 A;  5LWB A;  1NLR A;  2DFC A;  3LOI A;  4PI0 A;  4XIK A;  3U37 A;  4K1Z A;  4RD7 A;  1ZX5 A;  1ZNP A;  1D4M 3;  2E53 A;  2WZR 1;  5KHH A;  1O7F A;  4R9A A;  1IKP A;  3KVB A;  3FE5 A;  2RDN A;  4Q4V 1;  2E51 A;  4M0N A;  1EY2 A;  1TMF 2;  1AUY A;  1EP0 A;  1NXM A;  1WCD J;  4MGI E;  1PMH X;  2NMN A;  5FPL A;  3UES A;  4DRR A;  4XDO A;  1RIT A;  4RFT 0;  1W9F A;  5FMO L;  1MVQ A;  1J3P A;  1CZV A;  1V70 A;  2PXJ A;  3WF2 A;  1RHI 1;  2JEC A;  1DGR A;  1VP6 A;  3RFR A;  2ILM A;  2GAU A;  3WDW A;  2HKX A;  3LSE A;  1J1L A;  1DGL A;  3ZLI A;  4UFH A;  3ACH A;  4HN1 A;  1R09 1;  1DZQ A;  3K4D A;  1QY4 A;  1RUG 2;  5F2W A;  4COY A;  4XZU G;  1E5H A;  2J42 A;  3I2J A;  2WWJ A;  5T5P A;  5L9V A;  2WAA A;  5CU1 A;  1I1E A;  4CTE A;  3PUR A;  3E97 A;  4QU1 A;  1PZ7 A;  2BZD A;  4XVH A;  1TME 3;  1IQD C;  1H1I A;  2EIG A;  1SEF A;  2RE9 A;  2CGN A;  2DCZ A;  2Z42 A;  1RTV A;  4AVV A;  1YFX A;  2VO5 A;  1YFU A;  1LOA A;  1PIV 2;  1S0E A;  3T3Y A;  1TG7 A;  2DU1 A;  5A6Q A;  3SHR A;  5J7M A;  5I93 A;  1DYK A;  3WOG A;  2VEC A;  5A6Y A;  5HV4 A;  1ZBE 2;  2VQ0 A;  5ERL A;  1SDW A;  5FJH A;  1O3S A;  5F5Q A;  5CB7 A;  3OOX A;  2Y60 A;  4Z07 A;  1BEV 2;  1IG3 A;  2RDR A;  4L11 A;  5C9A B;  3RZL A;  4Y26 A;  5L73 A;  4B7E A;  3U1X A;  1OC1 A;  1H0B A;  1JW6 A;  1RUG 1;  1VBA 2;  2WZR 3;  1VPH A;  2ZGU A;  2IWG B;  4MHU A;  3A21 A;  1PO2 2;  3TYJ A;  2A3X A;  4XAB A;  2VUJ A;  1KEX A;  4DEV A;  1WD3 A;  1OFN A;  4GWN A;  1JMU B;  1PO1 2;  2HWD 3;  1QJU 1;  1SLL A;  4PDW A;  5DG1 A;  3RPQ A;  2BPA 2;  1HKD A;  5AVP A;  5JOW A;  4K6B A;  1Y9M A;  4NIA A;  4CDW C;  3VZK A;  2ZGT A;  3K4Z A;  4IEZ A;  1KDM A;  4AQ2 A;  4M3C A;  2JDY A;  5A7O A;  1EUU A;  3BUC A;  1LOE A;  2A75 A;  5A7S A;  2DUQ A;  4GJY A;  2IC1 A;  4PBP A;  4YW2 A;  1RHI 3;  1EV1 3;  2VNR A;  3IN9 A;  3V56 A;  4LHK A;  4A3Z A;  4OHY A;  5FRA A;  3CKH A;  2W1W A;  1S0B A;  3EXU A;  4QQL A;  3TB0 A;  1LEM A;  2XR4 A;  3RS6 A;  1SFP A;  2WLP A;  3U14 A;  2IXC A;  3PMS A;  4NRQ A;  3ACI A;  1R09 3;  4Y1U A;  1XU1 A;  5L7O A;  3O1V A;  1VBA 1;  3USU B;  2IUW A;  3ROU A;  1N1Y A;  4BJ0 A;  1GZT A;  3VZM A;  3I59 A;  3LA2 A;  3LA7 A;  3LDK A;  5FIX A;  5FYS A;  4XBN A;  3VBS A;  1WLW A;  2ARC A;  2JDM A;  2O0O A;  4PLN A;  4WVV A;  4YRD A;  3SH4 A;  3VKN A;  4B8E A;  4CP9 A;  1JZ7 A;  3ZPY A;  1G9A A;  3B02 A;  4QX5 A;  4NPM A;  1OH4 A;  1VAL A;  2WO2 A;  4RYD A;  1PGW 2;  3ZXA C;  1LOD A;  3W5M A;  4LBL A;  2PMW B;  2XJU A;  4LQR A;  4QPG C;  2O14 A;  5CAZ A;  5JSP A;  2VZO A;  1E5S A;  2ADD A;  2WNU A;  3GXU A;  5A80 A;  1C4R A;  3NKT A;  2DVD A;  1RXF A;  4K20 A;  4ZXK A;  3ZN4 A;  2B4K A;  4V1P A;  3VZL A;  3LIH A;  4NJ4 A;  2P1B A;  2AR6 A;  2CWM A;  5JAX A;  1QJU 3;  4L9B A;  4COZ A;  2FDG A;  1AR8 2;  2DWR A;  2Y26 A;  3ZFG A;  4IEX A;  5FP7 A;  1XXN A;  4XXA A;  4JKK A;  4CEW C;  1OVS A;  1N47 A;  5I91 A;  3PUI A;  1D7P M;  4NE9 A;  1BVP 1;  1LHO A;  1YLL A;  3AP5 A;  3VZN A;  2D6K A;  2QDN A;  4Q4W 1;  4AVC A;  1W28 A;  4TYS A;  1NT0 A;  5D21 A;  2OVU A;  2J1U A;  4CP1 A;  5GM0 A;  2G4I A;  4IV3 A;  3WP6 A;  2WSV A;  4LOR A;  4B4P A;  3WDX A;  3A0K A;  1O4T A;  3PTY A;  1Q5O A;  2BER A;  5AFB A;  3KT4 A;  3U0Z A;  1BLZ A;  3TEW A;  3WDT A;  2X8K A;  5JPM B;  4M4R A;  4A42 A;  1QQP 1;  1AR8 1;  3UJQ A;  4NAO A;  5HPO A;  3KV9 A;  3H1Y A;  2V4V A;  4XFA A;  5B4N A;  2BVB A;  4XZP A;  2L9L A;  1L7Q A;  1PX3 A;  1NKG A;  1OOP A;  3H50 A;  3R4S A;  1AF9 A;  5J37 A;  4RSU A;  5FY9 A;  1J59 A;  2CTV A;  1ZBA 2;  5GZF A;  5FZ3 A;  3AJY A;  3RZK A;  4U2A A;  5K8S A;  4PF1 A;  4QPG B;  4TN7 A;  4LIT A;  4CCE A;  4NHM A;  2GMM A;  1W2N A;  1JU3 A;  1XNC A;  2LM3 A;  1W8N A;  2E7Q A;  2VH9 A;  5FYY A;  3WXP A;  1AR9 1;  1VB2 A;  2JG8 A;  1DLC A;  3GBG A;  3VD3 A;  2WNV B;  4W50 A;  5KBF A;  1OQ1 A;  3N7K A;  4A6O A;  2VOW A;  3JUU A;  3DYP A;  4V2W A;  5FMC A;  2QQM A;  2D40 A;  3QLQ A;  2JXA A;  1FNY A;  5CKM A;  1LAJ A;  1HRV 2;  2YZ4 A;  1ULE A;  2ZX2 A;  4IEY A;  4IEQ A;  4YW7 A;  1NAE A;  1YCI A;  3HN1 A;  1CES A;  1AYN 2;  3O1T A;  4LLF A;  4QDS A;  4CEW B;  1RUC 3;  2F4L A;  4DS0 A;  2E6V A;  3TRS B;  5C8C C;  5FY7 A;  2PAE A;  5SV8 A;  2HYK A;  2P3Y A;  4GKX A;  4DEQ A;  4Q4W 3;  1AL2 2;  1W0P A;  4RR3 C;  3IPV A;  3NNM A;  4E4S A;  3R6S A;  2NPI A;  2GMP A;  3ZYI B;  4RQP C;  3AL6 A;  2RR1 2;  3R4D B;  4QKB A;  3ES4 A;  3QAC A;  1UZW A;  1LOF C;  2H0V A;  3MPP G;  3ZMN A;  2MPF A;  1PZ8 A;  2CDP A;  1LU1 A;  1NUK A;  2UWA A;  1RUE 2;  3ALQ A;  4EE2 A;  3AP4 A;  1M4W A;  3WDV A;  1G9B A;  4Z8B A;  2BDR A;  1Z7S 3;  3W59 A;  5LA2 A;  1CAU A;  5JXG A;  2B45 X;  1WW5 A;  5DDJ 1;  3NQH A;  3RI8 A;  1QQP 3;  4JGZ C;  5BYN A;  1X9P A;  2VUD A;  2OUH A;  1S2E A;  1ASJ 2;  1NZC A;  3O1P A;  3BKZ A;  4H14 A;  1FPN 1;  3DV8 A;  2ZGK A;  1W8H A;  4WZF A;  3AKQ A;  1OUS A;  4N9H A;  5FUP A;  4QX8 A;  3M3E A;  5C33 A;  2B42 B;  3TBD A;  3MDP A;  1AVB A;  5H9P A;  1YC6 1;  2B9U A;  3U11 A;  5IVE A;  2QZ2 A;  2EVX A;  2DDU A;  3LEG A;  1DG6 A;  4DUX A;  5FXX A;  4BDV B;  2RR1 1;  4RL7 A;  4AVA A;  4IQP A;  1CQ9 A;  2ORZ A;  3MIG A;  1AR9 3;  4IV1 C;  4CU8 A;  2VCB A;  3I3Q A;  4Q0P A;  1K5M C;  1ACC A;  3E6D A;  1N1S A;  5F3G A;  4PF5 A;  2OZJ A;  2Q8D A;  2B8M A;  1LOG A;  3OTF A;  4EN9 B;  3CLP A;  1XOY A;  3S30 A;  1X36 A;  4LHN A;  4DNY A;  3HQR A;  4C1X A;  5FZ0 A;  2GSY A;  1RJ7 A;  2EAL A;  4XJA A;  4NHY A;  1QJY 1;  2E32 A;  4ISR A;  3MBW A; 
#chains in the Genus database with same CATH homology
 2PXJ A;  4Y33 A;  5FP9 A;  5FZ6 A;  3AVR A;  3K3O A;  4HOO A;  5IVY A;  5A7P A;  4XDP A;  3OPW A;  5FZH A;  5KR7 A;  2OX0 A;  3ZLI A;  5FPU A;  3KV6 A;  4CSW A;  3PDQ A;  5FZK A;  5FP4 A;  4ASK A;  2XDV A;  4LIU A;  5F2W A;  5A3W A;  4E4H A;  5A7W A;  4IGQ A;  2YU1 A;  2Q8E A;  5IW0 A;  5F5I A;  5CEH A;  3DXU A;  3DXT A;  2WWJ A;  5E6H A;  3N9Q A;  3PUR A;  4QU1 A;  5FYZ A;  5IVF A;  3RVH A;  5ISL A;  2VD7 A;  3K2O A;  3PUA A;  2XXZ A;  5FXV A;  2YBP A;  3KV9 A;  5F32 A;  5FZL A;  2GP5 A;  2W2I A;  3N9L A;  4CUG A;  3KV5 A;  5FWJ A;  5FJH A;  5FY9 A;  4AI9 A;  3U78 A;  5FPV A;  5FYM A;  4CCM A;  5FZ3 A;  3PTR B;  4IGP A;  4TN7 A;  4LIT A;  4LXL A;  5FYB A;  5FZ4 A;  5FYY A;  5IVC A;  5FP3 A;  5F39 A;  3KV4 A;  4UF0 A;  4GD4 A;  5LY2 A;  4BXF A;  3N9O A;  5FUN A;  5FBJ A;  5A3P A;  5A7W B;  5IVV A;  5FZI A;  4V2W A;  5FZG A;  4QXC A;  5FPA A;  5FZE A;  4Y3O A;  5FZ9 A;  2Q8C A;  3N9N A;  4QX7 A;  4Y4R A;  5FP8 A;  5A7O A;  3AVS A;  2OT7 A;  3K3N A;  5A7S A;  4GJY A;  4D6S A;  5FYC A;  5FYH A;  5FY1 A;  4CCO A;  2P5B A;  3N9P A;  5FY7 A;  2OQ6 A;  5FZO A;  2XUE A;  5FV3 A;  5IVJ A;  2OQ7 A;  4NUB A;  5A1L A;  3N9M A;  2XML A;  2YPD A;  3KVA A;  5FYV A;  5F5A A;  4DO0 A;  3AL6 A;  3PU3 A;  2YBS A;  4BIS A;  5FZM A;  4QWN A;  4IGO A;  4D6Q A;  5A3T A;  5F2S A;  5FYI A;  5FYS A;  4UF0 B;  5FZD A;  5FWE A;  5A7Q A;  2WWU A;  5FZC A;  4LIV A;  4CCL A;  5LY1 A;  4GJZ A;  5FZA A;  4EYU A;  4BU2 A;  2GP3 A;  5FZ1 A;  5F3I A;  1VRB A;  3NJY A;  3AL5 A;  4CCK A;  4URA A;  5FZF A;  5FY4 A;  5FZB A;  5A7N A;  3U4S A;  5LW9 A;  5FUP A;  2YU2 A;  5F37 A;  4QX8 A;  4EZH A;  3PUS A;  5LWB A;  4CCN A;  3LD8 A;  4QXB A;  5A80 A;  5FZO B;  5IVE A;  5FY0 A;  2OS2 A;  5F3E A;  2YBK A;  5FXZ A;  4CCJ A;  5FXX A;  5A1F A;  5FZ7 A;  5FXW A;  4DIQ A;  5FPB A;  5IWF A;  5K4L A;  4EZ4 A;  4AAP A;  3PU8 A;  5F3G A;  3KVB A;  5FY5 A;  4V2V A;  2Q8D A;  3PUQ A;  5F3C A;  4D6R A;  5ANQ A;  5FY8 A;  3ZPO A;  5FYT A;  4GAZ A;  5FZ8 A;  5FYU A;  5A3N A;  4HON A;  4QXH A;  5FPL A;  5FP7 A;  5FZ0 A;  3LDB A;  3UYJ A;  5IVB A;  5FJK A;  4C8D A;  4XDO A;  5F5C A;  3OPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...