1LHVA

Crystal structure of the n-terminal lg-domain of shbg in complex with norgestrel
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
177
structure length
173
Chain Sequence
PPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Steroid Ligands Bind Human Sex Hormone-binding Globulin in Specific Orientations and Produce Distinct Changes in Protein Conformation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords SEX HORMONE-BINDING GLOBULIN
total genus 31
structure length 173
sequence length 177
ec nomenclature
pdb deposition date 2002-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00054 Laminin_G_1 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lhvA00
2DWRA 2GN3A 1GLHA 1ZM1A 4RL7A 4D69A 1LOAA 1SCRA 1CPNA 1GKBA 1TEIA 1Y7BA 3IPVB 3MEPA 1SCSA 4PCRA 5CNAA 2A6YA 5GLZA 3VUOA 2DVGA 3AFKA 1S0CA 4XJUA 1HKDA 4Y1YA 3M3QA 3NV3A 3ZVXA 3AZWA 2CL2A 4GXLA 2DVDA 1GANA 1B09A 1MS0A 5DXDA 2ZACA 3WDVA 1S0JA 1UZYA 3AK0A 4XMAA 1XQNA 2W39A 2GN7A 3O0WA 4YFWA 3A0KA 3WG3A 3V0AA 1O4ZA 3QLQA 1Q8PA 1H9WA 2ARXA 2D7FA 3WDYA 1LGBA 1Z0HA 1AX0A 2P37A 4XDQA 3FLTA 5E89A 2ZHLA 1JN2P 4FPGA 1WW4A 4CRQA 4FPOB 4YLZA 3V65A 3CNAA 4GALA 4WVVA 2NYYA 1ENRA 1A78A 1WBLA 2A6VA 2YMZA 3TAYA 4DRVA 1W6NB 1Q56A 1Q8VA 1SACA 2GALA 1ENSA 3N35A 1S0IA 5GALA 2E6VA 4FP3A 3O12A 4WVWA 3LSEA 2WKKA 4FPJA 4YM2A 2LTNA 1UN1A 1MVQA 1FATA 1MS9A 1LECA 3IMNA 4YG0A 2ENRA 4FPHA 2JKBA 2D6NA 4CTEA 5IK5A 3OBTA 4YZ3A 4YW4A 3AP9A 3AJYA 3RMYA 2VU9A 3I4IA 1W6MB 2ARBA 3ZPYA 2ZGNA 1ENQA 1SLCA 4NO4A 4AYUA 4XHBA 2R16A 4YM1A 2DUQA 2YZ4A 5HCFA 1V6MA 2PHXA 1DQ0A 2ZGMA 2NZ9A 2EXJA 2ZKNA 1S0EA 1N1TA 4JCKA 4UW6A 5EWSA 5T5JA 1LODA 4JC1A 1G9DA 4YW1A 4YW2A 4ZKTB 1LHVA 4LBNA 3WNXA 2A70A 3LCPA 1LENA 3FBYA 3ILNA 4LBMA 4UW4A 4Q26A 4SLIA 1WBFA 4XTPA 3QCWA 3UJOA 2YY1A 2A3YA 4K20A 1YYNA 1WD4A 2PHWA 1V6IA 3MW3A 4GKYA 4YGBA 1BQPA 1IS3A 1Q8QA 1F5FA 3M2MA 1HLCA 1IS6A 1PZ7A 1V6JA 3DGTA 1AJKA 5H9RA 2VH9A 1OQ1A 2P2KA 1KDKA 3AP5A 4W65A 3W58A 4BM8A 2JDZA 1Q8OA 3MPPG 3B69A 3VV1A 1QMJA 2JD4A 1I1EA 4U36A 2WQZC 3ENRA 3AJZA 3APBA 5DG1A 2PHRA 2DVFA 2ZGTA 5DG2A 2C9AA 3C2UA 1KDMA 2ZGLA 5T55A 1JOJA 3Q9OA 1RIRA 2ZMKA 1DQ2A 1UL9A 3WDXA 3AX4A 5BYNA 5CAZA 1S0GA 4XMIA 2EAKA 1V6NA 1LTEA 4ISRA 5DUUA 4LBJA 2R1BA 2EALA 2AENA 1JYIA 1GZWB 1UX6A 4Y22A 3NV4A 3FUOA 3OBRA 3VKMA 3ZXLA 1ULEA 5CBLA 1ULDA 4ITCA 4YZ2A 4TZDA 3BODA 2YXSA 3OYWA 1QOTA 3WHTA 1HDKA 4KBBA 3AXEA 1Q8SA 2FHRA 1DGLA 4XBNA 3A4UA 3B00A 1D0HA 1HQLA 1IOAA 4FPEA 3AP7A 3D5OA 4XILA 1DFQA 4IQPA 4TYSA 3R05A 3DUIA 2UWCA 3PVOA 1LEDA 4R9DA 3VKOA 4Q27A 1W6NA 3HMYA 4NOTA 1H9PA 1N1SA 3SH5A 4BQ1A 5KXEA 4LBQB 1G8WA 2DVBA 3B9CA 1QNYA 4LBKA 3FFZA 5T54A 3AP4A 1RINA 3IPVA 2ZGUA 2GMMA 2NM1A 1LHNA 4YG6A 3V0BB 3RSJA 2D3PA 4M3CA 5E88A 4YW5A 5F9TA 3AZZA 1APNA 1GV9A 1KJLA 2CNAA 3T1MA 2VUAA 4FPYA 5EXOA 5T5PA 2GMEA 3GNEA 3IN9A 1VAMA 4XJAA 1QDCA 2W68A 1NXD1 1UPSA 5IT6A 2WLQA 4P9YA 4ATFA 4DS0A 1SFYA 2D3RA 4YFZA 3IKWA 1CR7A 2ZGRA 5KXCA 2A6WA 3WG4A 2GNBA 1KQRA 2GNTA 4RA0A 2I2SA 3T2TA 1WW7A 1C57A 1LHWA 1LOCA 2E53A 2R1DA 2E7QA 1GSLA 2OVUA 5JLVA 2AGSA 5DZGA 1I3HA 1BKZA 2ZHNA 4ZXKA 3RMXA 4DPNA 3WVJA 4L8QA 3AYDA 3A0NA 5GLWA 4AVVA 1V6OA 3PJQA 1LCLA 1MS4A 2D6OX 5KXDA 1KITA 2B7YA 3OY8A 2JJ6A 4BMBA 1GNZA 2D43A 3ILFA 1C4RA 2DYCA 4XBLA 4XJWA 1RITA 5DUVA 3WG2A 5EYYA 5GZDA 5HCBA 3ASIA 3HN1A 1G9BA 1MS3A 2EXIA 4PBOA 1HQWA 4Y20A 3RS6A 3ILRA 3B3QE 4Q2FA 1IKQA 1AVBA 1G9FA 3WUDA 1N47A 1N1VA 1VIWB 3ZXFA 4LBQD 3WHUA 2A6ZA 2ZGOA 3AYCA 3USUA 1CN1A 2DVAA 2ES3A 5IK4A 1KJRA 1AXZA 1GZCA 1V6KA 2P3KA 2NN8A 1ULFA 1QNWA 3NV2A 1FNZA 4GA9A 4YZ5A 2ZGKA 1A3KA 3FLRA 5JVVA 2NP0A 1YRZA 3WDTA 3WV6A 1AX2A 3O5SA 3PVNA 4XXPA 3VKNA 4Y1UA 5GZGA 1DHKB 1EPWA 2XB6C 2P3JA 4AGVA 2WNEA 2VW2A 1U0AA 1W0PA 3V0BA 4R9BA 2AR6A 2GNDA 2YV8A 1LOGA 5FREA 4M3CE 1UAIA 4OZXA 5AVAA 3FUQA 3BIWE 2GDFA 1S0BA 1DIWA 1MZ6A 1YI7A 1BXHA 4Y1XA 3V0AB 1ULCA 1LOEA 2ZGQA 4FVVA 3D6EA 1FV2A 3ZSKA 1FV3A 2GNMA 5CA6A 1N3PA 3SH4A 5DZEA 4BOWA 2DTWA 2LALA 3BTAA 3M3OA 4FPKA 3N36A 5H9QA 5T5OA 3ZSLA 2DURA 2R0HA 1GBGA 3N7MA 1LOFA 1DLLA 1SBDA 3ZXKA 2ZZJA 2WSVA 4BLJA 4FOYA 3WUCA 1WLWA 2A75A 1URXA 3N7JA 4ISQA 1JXNA 4PQ9A 1SLTA 1YIFA 2OUHA 1DBNA 2ZA9A 1LEMA 4YGCA 1N3OA 3SISA 4HL0A 3AZVA 4XHXA 3PMEA 4FPFA 3ZYPA 2UWAA 1NLSA 1PZ8A 2DTYA 2ZHMA 4JRAA 3U4XA 2RHPA 1CJPA 1N1YA 2NMOA 1SLLA 1MS5A 4XZPA 2HYKA 2V5YA 1GZWA 4FPCA 1WW6A 4GWNA 4Y26A 2CTVA 3RRDA 1DZQA 1UMZA 1LOBA 1KRIA 1SLAA 1QDOA 4XJ8A 2UU8A 2EIGA 3O0VA 5GLVA 2VXRA 4MYEA 1FX5A 2W52A 3AP6A 5GLUA 5JOYA 3D4KA 5JDBA 3JUUA 1MS1A 4FOVA 2NMNA 4BMEA 5E8AA 2VY0A 3UK9A 4HANA 1MS8A 3M1HA 3AYAA 4XTMA 3AYEA 1LOFC 3L2YA 4GKXA 1SBFA 1JW6A 1GICA 2ZGPA 2GMPA 3V64A 2TEPA 4AVTA 2W08A 1AZDA 3SH3A 4M01A 3ZYRA 3N7LA 1WLDA 1W6QB 3ATGA 1LHUA 4R9AA 3POWA 1F31A 3NV1A 4M3CF 1DQ6A 4AVSA 1LHOA 5JOZA 2AYHA 4GWMA 4BPZA 3WG1A 5IUQA 2Z42A 2A5ZA 1OKQA 4ATEA 3WCSA 1LESA 1V00A 1W6PA 2CWSA 4Q1RA 5FRAA 2P3IA 5H9SA 4WV8A 3USUB 1GZ9A 1AX1A 2WT0A 2PELA 3PVEA 4LBLA 2VW1A 5T52A 2BQPA 1DQ5A 1LULA 5H9PA 1PZ9A 5F5QA 1W0OA 4R9CA 3I8TA 1JHNA 1JBCA 3NWKA 3AZXA 1MVEA 1DQ1A 1VAVA 4DFSA 5JOXA 5GZEA 4ASMB 5DZFA 1WLCA 1BZWA 2DUOA 3FLPA 2YROA 1VLNA 2WJSA 1S1AA 4LBOA 4Y1ZA 2EXHA 2FMDA 1VALA 4XOGA 3ZXJA 2G4IA 2V73A 3OYWB 1CVNA 1QKQA 2OW4A 1W6OA 5DUXA 1QOOA 2D6MA 4WZFA 2DV9A 3HR9A 1CQ9A 2JE7A 2ZABA 4P14A 3WCRA 1S0FA 3VKLA 1MZ5A 2WSUA 2JECA 1QGLA 2ZMNA 4XBQA 3WDUA 5GLTA 4Q1PA 4YGEA 4P9XA 2CWMA 3KQRA 1S0DA 2VW0A 1BJQA 1H30A 4BLIA 4Z8BA 1QU0A 1AXYA 4DRRA 1CONA 1C1FA 3POYA 4LBQA 4FQ4A 4C1XA 1GNHA 1DQ4A 1LU1A 3RQ0A 3N3HA 2A7AA 1G9AA 2SLIA 1IS5A 2ZHKA 4AGRA 2R49A 1ULGA 2EXKA 2ZMLA 3UJQA 1AXKA 4F83A 1WCSA 2D6LX 3OY8B 3W59A 2ZAAA 4XXAA 3MW2A 3UL2A 2A6XA 4Y22B 1QOSA 2PHTA 4UW3A 2SBAA 1BYHA 1WW5A 4PBPA 4DQAA 5IK7A 4YM0A 2H0BA 1J1TA 2PHUA 1IKPA 2CYFA 2CY6A 3VKFC 4Y20B 4C1WA 2AH2A 1R1ZA 2WT2A 1W6PB 4XYXA 1JYCA 5T50A 5EYXA 4AWDA 5JOWA 2KM2A 5GM0A 2A71A 4Y1VA 2OUJA 4M00A 1WD3A 1YO8A 4YZ4A 1MR5A 1G86A 3R4SA 4FOWA 4K1ZA 4Q8KA 3MW4A 1SLBA 3M3CA 3TB0A 3H0OA 1W6QA 2WT1A 3JU9A 4FPLA 4I30A 1IS4A 4XE9A 2D6KA 3GALA 1Z78A 3RG0A 2E7TA 4XJ9A 1JUIA 1WUVA 4CZSA 1CIWA 4YW3A 1LU2A 1A8DA 5L73A 5LK5A 5HCAA 5GJ6A 1G9CA 3OGGA 1ZA4A 3B01A 3INAA 1V6LA 1LGCA 1OFSA 2P34A 2ZGSA 5IK8A 1UZZA 4YGDA 3POSA 4Y24A 2UWBA 3KM5A 2EF6A 2PHFA 4XIKA 3OJBA 4FP2A 1F9KA 1CESA 1CPMA 3IM0A 3R4UA 3ZXEA 2ERFA 1O4YA 4AGGA 3WZ1A 2AREA 2XG3A 5GZCA 1LGNA 1YXWA 2D3SA 1FNYA 4H55A 3SITA 1SBEA 3AZYA 2R0FA 4UW5A 3SLIA 4M3CB 2ZBJA 4FQZA 1MACA 1QF3A 4U2AA 2Q5TA 5GZFA 2UURA 5JMCA 3OPZA 1LJ7A 4Q8LA 1AJOA 4YG3A 2A3WA 5T5LA 1N3QA 1DYPA 3LSDA 1C1LA 2DU1A 1FYUA 1W6OB 1X50A 1ONAA 3AXDA 1UKGA 4YM3A 2DU0A 1GYKA 1W6MA 2D6PA 3M3EA 5DUWA 2C5DA 4XIOA 3WDWA 4YZ1A 2AUYA 3N7KA 3WOGA 3SNMA 3T1LA 2D44A 4P9WA 5KXBA 4FOQA 4XJZA 2DUPA 4K1YA 4PF5A 3ZSJA 3WLUA 3ZSMA 3O0XA 1DYKA 5SV8A 1AF9A 1FAYA 5CB7A 2JE9A 3BOPA 1D2SA 1G7YA 2E51A 4K21A 1SLIA 2A3XA
chains in the Genus database with same CATH superfamily
4OQ8A 4YVSA 1LOAA 1CPNA 2KXLA 3MEPA 2DCKA 3JD71 3VUOA 2A6YA 1S0CA 4XJUA 1H1IA 4V2WA 2W46A 4Y1YA 4CEYB 4O9GA 4AAXA 2JXAA 5J98B 3ZOIA 3VBHC 5JZGC 4RFRB 4UYBA 3ZO0B 3GCXA 4GXLA 4AF9A 2DVDA 5KWRA 1GANA 1B09A 1MS0A 4PI2A 3AKRA 3LEIA 1QH6A 4YSFA 1IPJA 4DEQA 5A3NA 3AK0A 2VZOA 4XMAA 2VOVA 2PYTA 2W39A 1ZREA 2GN7A 3O0WA 3WP5A 1OOPA 2BVBA 1NE4A 4XUOA 2OS2A 3WG3A 2ORZA 1O4ZA 4A6SA 3QLQA 2HWC1 4Y33A 1H9WA 2ARXA 3GHNA 3LIHA 5L9RA 4NR1A 2D7FA 3WDYA 1ASJ1 4B4QA 5JSRA 3J26N 5E16A 2H6BA 3T4VA 1JYXA 4NRMA 2PFWA 2ZHLA 5F1RA 4FPGA 4XF4A 3E6CC 4MGZE 3KGLA 3KLSA 3WW2A 5D21A 3CNAA 4YVSB 2NYYA 4AFBA 2XQRA 3TAYA 2YMZA 4BXSV 3KZ4C 1D4M3 3J8F3 1W6NB 1Q56A 1SACA 3ITQA 4CCMA 5FZ9A 2CDPA 1D0GA 3NVCA 4QDSA 4FP3A 1QJY2 1OBNA 2X5IA 3LSEA 4MGIE 3J4UH 5A3OA 2EIEA 1D4VB 1FATA 4W6XA 4YG0A 1YNAA 4URTA 5IK5A 4CTEA 4XF0A 4YZ3A 1U5XA 3AMMA 3AP9A 4IV3B 1ST8A 2HBUA 3I4IA 2X05A 3PUHA 2ARBA 5LA0A 4GAZA 3UGHA 2ARCA 1BBT1 1ENQA 4HBNA 4D7SA 3FN9A 2QQUA 3NJYA 1ND3A 1PNGA 2FDHA 4Q4V1 4BQXA 2DUQA 2YZ4A 1VMHA 1UX7A 2PHXA 3RWNA 5HV0A 2WR9A 1RUD2 2NZ9A 2EXJA 1NOVA 1WCDJ 1N1TA 4UW6A 4DXSA 3H8UA 3U0ZA 5FOBB 4RQPC 3TEXA 4LBNA 3VZJA 4IE6A 4Y3OA 4K3UA 3VL8A 4CP0A 2R063 3BI3A 2JDNA 1V9U1 4LKSA 4Q26A 4AI1A 2PTMA 2QNKA 3K3NA 3NAPB 4A4AA 1WD4A 3RWKX 1Q8QA 2VOTA 3M2MA 5IVYA 5ACA2 3DGTA 4N43B 3I3EA 4HN0A 1ASJ3 1Z7S2 2VH9A 1W8ZA 5EHDA 2P5BA 1RUH1 4KI5M 5HPOA 1HW5A 1VE0A 3MPPG 5J09A 2RS13 2WFPA 4MZUA 4Q5OA 2B4KA 3H1MA 5J3UA 3RZMA 5IW0A 3CO2A 1EYBA 1UOJA 3WNKA 4FO9A 5FP8A 4RQPA 5CFCB 5CFCC 2PHRA 2W2IA 1AYN1 1W9SA 1KDMA 5T55A 3IIIA 3WF0A 3FBMA 4S2HA 2BZDA 5IVJA 1RIRA 1RJ7A 3J7MA 3VD7A 2YUEA 1DQ2A 1UL9A 2WYFA 3D0SA 3PL0A 4HT1T 4XMIA 4PDWC 1PO11 1XPWA 4IDZA 4Q0PA 2HYXA 1UX6A 3DXTA 4IEPA 2UYAA 2WNVB 2WINB 3NV4A 1YCIA 1K5MA 3UGFA 3E1F1 3O14A 4K6BA 1VBB3 1ULDA 4YZ2A 4GH4C 1QJZA 2EVXA 4IE7A 4WBBA 3OYWA 3VBUC 4UFJA 1US2A 4KBBA 1O5UA 1Q8SA 2FHRA 1K45A 4XBNA 4RR3C 3B00A 2C26A 1AUYA 2VTXJ 2XJSA 2XQXA 2YFUA 4I02A 4LO6B 5IFTA 4F3JA 2UWCA 4X6QB 3JD72 1RVF3 3O1TA 1W2UA 4Q27A 4NAOA 1W6NA 5FYIA 4Z92B 2CDOA 3R6SA 5KXEA 4NWVA 2VM9A 3B9CA 3IB3A 4HSLA 3LA3A 2QUOA 4LBKA 1HB1A 4RSUA 2ILMA 5T54A 5ANQA 1WKYA 1RINA 3A7QA 3AP4A 1OVSA 4QHOA 3SKVA 3LGRA 1EUUA 4M3CA 1HRV2 3N9OA 4CEYC 2G19A 4YW5A 1APNA 1KJLA 1MQTB 4OHXA 2W1UA 2VUAA 1W06A 1C8M3 4FPYA 1XNBA 5EXOA 4XFAA 1WA4A 4QHZA 1ENXA 3N9NA 5A3PA 1AYN3 3PJYA 3BB6A 2UYBA 1VBE1 2YC2A 3C7GA 4P9YA 4DS0A 2W92A 2GC2A 2JDMA 3MZHA 3WP6A 1KFXL 1NZIA 1CR7A 1OD5A 4HLTA 4URAA 2W87A 4GJYA 4E2SA 2I2SA 2MEV2 3CZUA 3SQOA 4BQ5A 1JYNA 1TMF1 2VMFA 4KWUA 2KR2A 2WQ8A 3IT8A 4W8JA 3W21A 5M0TA 2OKXA 4CVUA 4AXOA 1BKZA 1M4WA 5JPMB 4JGZA 3RZKA 2C1FA 3MFAA 5EJ1B 3NAPA 3AYDA 3A0NA 1TMF3 4UAPA 1V6OA 1VPHA 3PJQA 1ZRDA 3H50A 4I09A 2I74A 3J7HA 2BJSA 3ZIWA 1GNZA 3CHXA 4BH9A 2VNOA 1DGRN 3BYWA 2R071 5FYCA 2DF7A 1XOYA 4Z82A 3UESA 1RUNA 1RITA 4LEJA 3H3UA 4AAPA 2XLGA 3WG2A 2WLPA 4NRPA 4P9JA 2A1XA 5EYYA 5GZDA 3DV8A 1G9BA 1LRHA 2EXIA 4P9IA 4PBOA 1BVP1 4Y20A 3ILRA 3B3QE 3KV6A 2RDQA 3WUDA 2Z79A 1PGSA 3WHUA 4RN5A 2GH8A 1CN1A 5FUIA 2DVAA 2LROA 1TE1B 3MIFA 5IK4A 4J1WA 5FY4A 1RUF3 4GA9A 4YZ5A 1A3KA 1W9YA 3FLRA 5TSWA 3VBSC 2NP0A 4CSWA 3WV6A 3BPZA 4XXPA 3VKNA 5GZGA 4CEWB 4LA2A 1UZWA 2RR12 3HPNA 2HWF2 5FP3A 3CEWA 1XU2A 2VZRA 1U0AA 2VW2A 3HQUA 3C7FA 3OUIA 4QU1A 4Y4YA 1H1AA 3POGA 1QY4A 3FMGA 4OZXA 5L9BA 4AVCA 5C8CC 5CKNA 4LKDA 4UFMA 1S0BA 3MHZA 1YI7A 3ZXDA 1BXHA 1W0NA 3PIJA 3V0AB 5J48A 4P02B 2ZGQA 3FJSA 3D6EA 4NE9A 1AR81 2GNMA 5CA6A 3SH4A 3D82A 2LALA 3M3OA 4FPKA 4V1PA 3ZSLA 4HVQA 2DURA 1J3QA 1VJ2A 1SBDA 3GZAA 4LO5B 3ZX7A 1WLWA 2A75A 1URXA 2E26A 3UT0A 4IE4A 2RVAA 1YIFA 3HQXA 2C4XA 2D5HA 1A6CA 1LEMA 2XHKA 1ND2A 3AZVA 2VBPA 5I0TA 3PMEA 3VBFC 1XJAA 4B4RA 3OEAA 4JRAA 2DTYA 2ZHMA 1O4TA 3BN6A 4CYDA 1LNSA 1UOGA 3J7NA 5BPXA 5IVCA 5D8AA 4XZPA 3VBOB 5FMOS 1WW6A 2RM22 2CTVA 1PGW2 1DZQA 1D7PM 1LOBA 2XDVA 5FAXA 5IVVA 4XFIA 5FK7A 1XNCA 1SLAA 5HXVA 1RXFA 3U07A 2QDRA 2EIGA 2HBTA 3O0VA 2HWC2 2P1BA 2QBXA 4PLNA 4Q4X3 4AQ2A 2Q4SA 3GBGA 1HXS2 2QQJA 2FCVA 3K77A 1ZZ6A 2GZWA 1U5ZA 4P9LA 5JXJA 2VCMA 3CZJA 2R042 3VN4A 3T08A 3UK9A 3DCQA 4KU8A 2QZ3A 1KD7A 1OH3A 3EMRA 4EN8B 3IIAA 3AYEA 3L2YA 1HV1A 4AEKA 4D94A 4CDWA 2WABA 1GICA 3R4DB 4QQLA 2J7MA 1QIQA 1NAEA 3P5BA 4CXWA 4W50A 3HNBM 3LDRA 4IE0A 4TLFA 3UNPA 1BVVA 1RXGA 3FWEA 3HD8B 2OYZA 3ZYRA 1JODA 2ORXA 1R64A 3O1MA 4UT5A 5C7GA 1TMF2 2XGXA 4QPGC 4B29A 1DQ6A 1WZXA 1LHOA 1X8EA 3VZNA 4BIOA 4EZHA 2P17A 5CZKA 4NHXA 1REEA 2W95A 5IUQA 2R073 2A5ZA 1RUJ1 4ATEA 3ACFA 2P6CA 1HB4A 3GBWA 4DXRA 2ZPXA 1V0AA 1W6PA 5D2AA 5H9SA 1ACCA 4WV8A 1GZ9A 1AX1A 3PVEA 2PELA 1MEC2 3USUB 3THPA 1X9PA 3NW4A 1DQ5A 1LULA 2Q1FA 5FTTC 3QBQA 4FAGA 1OF4A 1W0OA 4R9CA 3ME2A 3I8TA 1F15A 3LIGA 4PIYA 1JBCA 1PK6B 1YQCA 4JV4A 5FO7B 3T2OA 2WWSA 3POIA 2BW8A 4HK8A 1SZBA 3TEYA 2XBO2 5DZFA 4LQRA 1BZWA 4LA3A 4C0BA 1O3RA 1H4HA 3EJKA 2YROA 5FK8A 3LWCA 1OF3A 3VBSA 1SDWA 2EXHA 2FMDA 4MXWB 5FZHA 3WINE 5IVBA 1GNYA 1H4GA 3I2FA 4A45A 1QKQA 1O8SA 1W8TA 1MZEA 3GZEA 5C4WB 4QX2A 4S2GA 3N9MA 4AQSA 3C7OA 3I3QA 5I0RA 4XZUG 1MZ5A 2BDRA 2WSUA 3A23A 3LEKA 4BWOA 4YGEA 4Q4W1 5FYSA 2CWMA 1POV3 1S0DA 2R7EB 4IV1B 2VW0A 4LITA 1YFYA 1S2EA 2XWJB 4A2UA 1QU0A 2B39A 5A7WB 5BNOA 4I2OA 1CONA 1E5IA 1YQ6A 4F83A 4C1XA 3G6JB 3WNNA 3IAQA 1UCXA 1GNHA 2VMEA 3NKGA 4SBVA 2IFWA 1J83A 3BCWA 5ANNA 3K3OA 3RQ0A 2Q8EA 5JCTA 3N3HA 5L9VA 4COUA 4LIUA 2ZJCA 3NJVA 1PHMA 2Q30A 3MUY1 4Q0QA 2ZMLA 4TXWA 4KGQA 1RL3A 2XJUA 3IWZA 3KSCA 1UYYA 2D6LX 2LS6A 2VUDA 1RUE2 2ZAAA 5LBBA 3T3YA 2A6XA 4UFKA 5LBEA 4LPLA 4CP9B 1BYHA 4PBPA 1VP6A 4FFHA 1K42A 1J1TA 2UY8A 4RFT0 1R1A1 4XW3A 3WF2A 4C1WA 4BQ4A 3DKWA 4AEJA 5LEJA 1QH7A 4QQPA 3GJBA 5DDJ1 3LOIA 5EYXA 5K0UC 5FP9A 5JOWA 1X7NA 1UY2A 2R072 2P6HA 2GC3A 4Q4X2 4Y1VA 3MGUA 3SCHA 5FZ7A 5FLJA 4YZ4A 2IVIB 2J1VA 3ZR5A 3Q8AA 4K1ZA 2HLEA 3OSDA 5F3EA 4EV0A 3HJRA 4BZ4A 3M3CA 4OFGA 3JU9A 1GOFA 4L11A 4WM8C 4Y5SA 3GALA 3KB5A 1EPZA 3CQOA 1RVF2 1W8OA 3LFMA 2X09A 4CZSA 4FI9A 5FZ0A 3H8RA 3S6PA 4EROA 3I2KA 4IL7A 2JIGA 4Q29A 3P1IA 3VB9A 5JXGA 5I0SA 2PLV3 5IWFA 5BNOC 2VXJA 5FXXA 4BA6A 3B01A 2YU1A 1WCQA 5A7OA 1YI9A 2Y60A 5E6HA 1OFSA 1HRI1 1S4CA 2JDAA 3OB8A 1JZ6A 3POSA 4K40A 1TZOA 2UY9A 1SFPA 1TG7A 3KM5A 3HBZA 2MHFA 1F9KA 1CESA 1CPMA 1DGWX 2RV9A 1K5MC 3IM0A 3KCCA 4K7JA 5I8SA 3FHIB 4QXHA 3WZ1A 2JEMA 1VBB1 2AREA 3OGRA 4J1XA 4M0NA 2FZ2A 4QX1A 1QJU1 2XKPA 3GDBA 3GZUC 4J25A 4JGZB 4ASLA 1SBEA 2VVDA 3AZYA 2RMU1 2XJRA 3LB9A 2Q8OA 4OI0A 4MGKE 2YU2A 3VZMA 3OD0A 4XAEA 4L0PA 1JZ2A 3VBFB 1LJ7A 1XC6A 4BMBA 1CIYA 3P3PA 3LSDA 4YGCA 1FYUA 2DU1A 1W6OB 3A21A 1ONAA 5SV5A 1GYKA 1W6MA 4YZ1A 3F95A 3M3EA 5LB6A 3ZN4A 4B3NA 1S2BA 4P9WA 4M4RA 1RUOA 5CVRA 4FOQA 1Y4WA 1OVPA 3MICA 4ZZ8A 1PVC2 1DYKA 3PUIA 2V4AA 5EIYB 1C8NA 1EAH1 4Z07A 2EA7A 4K21A 3T09A 1SLIA 4JGYC 2JD9A 4JQTA 2GN3A 2JG8C 1GLHA 2D5FA 1ODMA 1QXJA 1Y7BA 1GKBA 5GLZA 4OHWA 2DVGA 3AFKA 2BVVA 1PO12 1PIV2 4WVMA 2MEV3 4CEWC 1UXZA 2GAUA 4QX3A 3AZWA 1GR3A 5FCCA 3VDAA 3ZVXA 5FYMA 5C33A 5F7UA 3VBSB 5C4WA 3WDVA 1ZYBA 1SQ4A 1RUC1 1UZYA 1YJKA 4YFWA 5I0UA 2WA3A 3A0KA 1H8TC 4JDOA 3V0AA 4RHV2 2RS51 4QMAA 1Q8PA 1GZTA 3RFRA 1D4M2 3J8F2 1KFUL 4XDQA 5LBFA 3IDCB 2YBPA 3CJXA 4MOAA 2HWB1 5F8PA 3ZFEA 4CRQA 4XPVA 4QDRA 4YLZA 2Q1MA 5B2GB 4IEZA 1RUG1 1WBLA 4DRVA 2F17A 1OA3A 3SC7X 4N53C 1Q8VA 4AQTA 1I6XA 1MQTC 1ENSA 3N35A 2C9KA 1CGPA 4XFBA 2N7GA 2CGOA 3AVRA 1QQP2 2LTNA 2W3JA 4H2AA 1MS9A 5EQUA 1H2KA 3PNAA 4FPHA 2JKBA 4CDUA 3MYXA 1DLCA 1ZBE1 4DXTA 2Z4FA 4YW4A 2X29A 3MF6A 4BK4A 3PTRB 2EICA 2VU9A 3LEGA 4ZU7A 2XR4A 4INDA 1SMVA 3ZPYA 4DUXA 2FDGA 2ZGNA 4NO4A 1SLCA 4XUPA 4E8DA 3U78A 4Q4Y1 3T4HB 1AHSA 1OLME 1O6UA 1D4M1 2J1UA 3J8F1 4QQ2A 4CU9A 3PVBB 2ZGMA 2ZKNA 5FZLA 3O7OA 3L2HA 1LODA 5D1IA 2BV4A 2BFUS 4JC1A 3NMBA 4RD7A 2RM23 4YW2A 4ZKTB 2ZX2A 1ND2B 2PLV2 2ZS6B 2Y0IA 2XUMA 4CEWA 5FY0A 2WFF2 4UI9L 3ON7A 1CAXA 3ILNA 4LBMA 4UW4A 4EYUA 4SLIA 1WBFA 5FPAA 1H2LA 4K20A 4RR3A 2QTWB 3KV4A 4XFGA 4GKYA 4P5HA 5FJKA 1IS3A 2ZEWA 1IS6A 1OI6A 3LDBA 1IZ3A 3ALQA 2WNUC 1AJKA 5A32A 2BFUL 1CD3G 2QQOA 5CKQA 2ETEA 2OPKA 1UY4A 4CP9A 2OX0A 1CAVB 2BEOA 3M3IA 4GIQA 4HONA 1QMJA 2VECA 5FZOA 1E5HA 2RMU2 2XVGA 5FPBA 4QKBA 3ZM8A 1JI6A 4UFLA 1I1EA 1VBB2 5LATA 3H9AA 1R093 1KGYA 1OHFA 3AJZA 3APBA 3U1XA 3ZSEA 4EWEA 5F6KA 1DGWA 2ZGTA 5DG2A 2Y38A 4OZOA 4B8EA 1PMJX 4G9SB 5ABJA 4IESA 4C8DA 5LY2A 4LO4B 5L7OA 1ND3C 2BWCA 1F4AA 3ACIA 3AX4A 5KHHA 5BYNA 5CAZA 2X10A 1V6NA 2IXLA 3ZLIA 4PDWB 5AVPA 2DFCA 2EALA 2WZR2 1KS4A 3ZPOA 4Y22A 1BBT3 3E5UA 1LR5A 3VKMA 3ZXLA 5CBLA 4ORFA 1DU3D 4I3GA 5AFEA 3S7EA 2LRPA 2QQIA 3BODA 4TZDA 1RUI3 1HDKA 2QQWA 2WRAA 2VMCA 2XVKA 5KHKA 2YHJA 2BERA 2P4EA 5FY7A 3SMHA 4ARXA 4ASKA 4BQ3A 5BV6A 1DGLA 4DNYA 4AI0A 3PIGA 5IFPA 1W3VA 3U75A 1IOAA 2DCYA 4NRQA 3D5OA 5JMOA 1Q5OA 1DFQA 4X6RB 3DUIA 3LDKA 4BQ2A 3QH6A 1LEDA 4Y5TA 5FPZA 5FUNA 2W47A 1UU6A 4PIXA 5F5AA 3SXWA 1BMV2 1IG0A 4DUWA 3MIEA 4EWDA 2VOKA 4Z2AA 1B35A 4FTSA 4JDMA 3T0DA 1ZA7A 1MZFA 1TME3 3FFZA 2YBKA 3IPVA 3KVBA 3Q8CA 2GMMA 2NM1A 1LHNA 4QQHA 4CUGA 4CUBA 1RUH3 3VBUB 4UOJA 2AEZA 1GV9A 2RMU3 2HWD2 3T1MA 5JXHA 2JDKA 4UWDA 4CDUC 1ZRFA 1QDCA 1NXD1 1RHI1 1UPSA 1XNTA 2XXZA 3NO8A 4XETA 2FDIA 4ATFA 2R32A 1SFYA 3KVAA 2WN3A 4HMZA 2D3RA 3RVHA 4YFZA 2WFF1 1YQ8A 2K9ZA 4JHTA 4LHSA 2BWAA 1RMU3 1XB9A 2FDJA 4NPRA 4RA0A 2VJXA 2VZVA 1C57A 2E53A 1AR72 1JU3A 4K8RB 1W99A 3MLJA 4LE3A 4CU6A 2EIBA 4R4ZA 3RMXA 4ZXKA 1PO21 3QH7A 3WVJA 4AVVA 3AMNA 5FP7A 5FY1A 1JZ4A 1DDLA 2TUNA 4MXWA 5FY5A 3A22A 5A6YA 4M0HA 3I3BA 1QEXA 1KITA 3MIBA 4ZS2A 5FXVA 3VD5A 2JJ6A 3ZFGC 4BQWA 4E4ZA 4FSJA 5CU1A 3ILFA 2L9LA 5APAA 1R092 3GZTB 4EJRA 5FWEA 2ZX0A 4GWJA 1Q3EA 3FHAA 3HN1A 3VBRC 1MS3A 1DYOA 4LO7A 5JZGA 3GCWA 4Q2FA 3U37A 1IKQA 1UOBA 2X53S 5JUVA 1N47A 4Q4W2 1N1VA 4LBQD 2A6ZA 3AYCA 4HKOA 4QB2A 4CUAA 3I2DA 1HRV3 3ORJA 2BNOA 4JRLA 4LKFA 1AXZA 1RHI2 1V6KA 3NV2A 4CDWB 2AEYA 2VNRA 5JVVA 3WDTA 1QQP1 1V9U3 5G04L 1AX2A 1CX4A 4P08A 5FQ0A 2X8KA 3NRUA 3FHQA 3GM8A 4PJYA 4E4HA 4OULA 1DHKB 1K5MB 2HWE1 2WNEA 1WMXA 4I0WB 5C9AB 3VBRB 2YV8A 4XEZA 5AC91 1RUD3 1RMU1 3CKHA 3FUQA 1UIKA 3BKZA 3BTXA 3VBOA 4GZ9A 4EN0A 2W1SA 5JIAA 2DCJA 1EUTA 4XACA 1LOEA 1HX6A 1FV3A 4O61A 2JICA 3B02A 1VBC2 3E5QA 1O59A 1ZZBA 1C5HA 3KF3A 1GBGA 3ABZA 1EAH2 2ARAA 5C3QA 3AFGA 2PHLA 4PQ9A 5IVFA 1T6GC 1WMFA 3S57A 2OUHA 1K3IA 4GQ7A 4IE5A 1DBNA 1RUC3 3H8OA 1C3HA 1P8JA 3KWVA 3GBFA 4HOOA 3ZYPA 1UY3A 4JKLA 4LHLA 2WNVA 1NLSA 1PZ8A 1MQTA 3MV01 4N9IA 3LKJA 5F6LB 3U4XA 4PT6A 2ZEXA 4OQ9A 2WZPP 1SLLA 4DB5A 2HYKA 4CDXC 1NLQA 2QQVA 4EN6B 2BYVE 3RRDA 5KHGA 5CEHA 2JG9A 1YJLA 4X8NA 2XH6A 3AM2A 1YQ2A 3W5MA 4IEVA 2VXRA 3IMMA 4NN0A 5GLVA 3HOBA 3AL6A 2W52A 2IC1A 5GLUA 2B8MA 5FYHA 3D4KA 1YUDA 1MS1A 3JUUA 3LPGA 4MH0E 2VMIA 4NIDA 1DZRA 4XABA 2W91A 5E8AA 5CISA 2YC0A 1MS8A 2FD8A 1NG0A 1KEXA 5D8AC 5FZKA 3C8XA 2DCTA 4XTMA 4QT6A 5K0UA 3HWJA 4LR4A 4BQYA 1OLMA 1BEV2 1SBFA 2GSYA 1JW6A 4IETA 5IHRA 4XFHA 3V64A 4AHYA 4GMP3 2TEPA 3HEIA 3VBFA 5C3SA 5K8SA 1AR82 1HB3A 1AZDA 1QJU2 3GF6A 1RMU2 5CIRA 3QACA 1W6QB 3IDAA 3POWA 1IG3A 1F31A 4CU7A 4LLOA 5FPVA 5JOZA 1CAWA 2VMGA 3FE5A 3BUCA 3N9PA 2F6BA 1T6BX 3LAGA 3T0AA 1VBC1 1C8M1 3I2GA 4ZS3A 3WG1A 2Y6HA 1OURA 1HRI2 1V00A 4LTAA 3DF0A 1OD3A 2WT0A 3KT1A 4QKNA 3VHOA 2EAAA 5H9PA 4Q0UA 5F5QA 3JBG3 3UKVA 3RYRA 1ZBE2 3NWKA 1DQ1A 2HWE2 1RVF1 2WS92 5I0DA 1AR62 4HG6B 4E9KA 1R1A2 4ET7A 2W0XA 1UY0A 1IPKA 1WLCA 2RJKA 2P3YA 2DUOA 2XLFA 1OA4A 1UO9A 4L97A 2HEWF 1NA1B 5G05L 2CU5A 3VBRA 4LBOA 4Y1ZA 5FZBA 3KHCA 1RUE1 4P9GA 4XOGA 3ZXJA 1PM7A 2BGOA 2V73A 2WL1A 4IV3C 1CVNA 2YBSA 4KWKA 4R52A 5A33B 5F3GA 5DUXA 2D6MA 5A70A 3IAPA 1OMIA 1TME1 1NQDA 3I59A 4Q0VA 2XJQA 3I2OA 3WCRA 3ZFGA 4AFMA 2HWB2 1S0FA 2QFEA 2VE1A 5A7SA 1PO22 3VKLA 2C0ZA 5BNPC 1QGLA 3RPQA 5FO9B 3OTFA 1CAVA 1ULOA 1J3RA 3AC0A 4MO3M 2LM3A 4D8MA 3FC0A 5CADA 3EBRA 4GD4A 5L19A 4BLIA 3S5AA 3FL7A 4CP2A 2B9UA 1CZSA 4LBQA 1NA1C 3NKTA 1UYPA 5FP4A 1COV2 2RS31 1LU1A 3V56A 3S0MA 1PVC1 4JHZA 4AEDB 2VZQA 1G9AA 1GQPA 4AGRA 2R49A 2JDYA 3OPWA 4N53A 2J1EA 4OVEA 1UQXA 3UJQA 3POBA 3H3LA 1AXKA 1WCUA 4JZRA 4QGLA 4UFHA 1WCSA 3W59A 4QX0A 2WO3A 3FX3A 1F4HA 4QPGA 2Y6FA 1QOSA 4KG8A 2PHTA 2RS53 2WN2A 3EYPA 3VZLA 5A3LA 3PU8A 4DQAA 5IK7A 4YM0A 2PHUA 4FFGA 3K51A 1POQA 2CY6A 4A6OA 3VBHB 4IERA 2K0GA 1BMV1 2WT2A 4Q4V3 1JYCA 3RI8A 1ZZ9A 1UMIA 3JXSA 4B1MA 2A71A 4I3PA 2W5FA 1QHDA 2GU9A 4MHRA 3OCPA 4CDQC 2E7AA 2BGPA 3R4SA 4WVMB 1G6NA 2G9ZA 3FFQA 3ZFFA 1O91A 1J1LA 1W6QA 2WT1A 4FPLA 3H42B 3RJRA 1JS9A 1Z78A 1NYWA 5A32B 4XJ9A 1JUIA 1UW8A 1W39A 2I45A 1SG3A 3K48A 1A8DA 4P00B 4YYOA 4CA9A 1PK6C 3FZ3A 3AVSA 4BE3A 3OGGA 4I01A 1RYYA 1SFNA 2BNMA 2DCZA 1V6LA 2ZEZA 3ZYFA 3NL1A 4IW3A 2HWE3 2D40A 5A1FA 1OLRA 2HKXA 3D3AA 3H7JA 3NNMA 4Y24A 2UWBA 5GKAC 4CCDA 4CCJA 4XIKA 1W8FA 4FP2A 1VAKA 4QXKA 3NJZA 3JQXA 3MLLA 2YG0A 4AGGA 2YFZA 1HXS1 3B93A 1SPPB 4DOUA 2WZR1 3LEMA 4DY5A 4QD2A 5BNNC 4PDWA 1O3SA 2R043 4BU2A 3T30A 2ZBJA 4AOCA 1MACA 2VULA 1PGW1 4KBZA 4U2AA 5BNNA 5JMCA 1AR73 1UKRA 3OPZA 4Q8LA 1AJOA 4YG3A 2A3WA 2GC0A 4CDUB 2VNGA 3PUQA 1C1LA 3AXDA 5FMOL 4IV3A 2DU0A 4NHKA 3HQRA 4AR2A 4XIOA 4BK5A 3BU7A 1S2KA 4KL1A 3WOGA 4CDXB 2D44A 1AR63 2WS93 5DDJ2 4PF5A 2IWGB 3ZSJA 3WLUA 5FLIA 1A8MA 5DAXA 1AF9A 3POFA 2WO1A 3BOPA 5CYYA 2E51A 1BLZA 1U5IA 5I8TA 1AR61 2WS91 2A3XA 1RUH2 2DWRA 4D69A 4RL7A 4QQOA 5HXMA 1SCRA 2JB4A 1RUD1 3IPVB 4PI0A 1SCSA 3WQ0A 1GP5A 3PMSA 1BHGA 4E4SA 3M3QA 3BTYA 3OG2A 5AFBA 5A33A 2VO5A 4IXLA 3CLPA 4CDQA 1PVC3 1W2AX 2CL2A 1W8WA 4CDWC 4D6SA 5FZ6A 3O1UA 1JZ5A 3B5LB 2CGPA 1OT5A 3MPBA 2PXJA 1HJFA 5FKCA 1UY1A 4LJHA 1XQNA 1HXS3 4Y4RA 2BNNA 5HI0A 3H1YA 1ZX5A 4TN7A 4Q4Y2 5C9AC 2ZZQA 3VDBA 4ES8A 2XBO1 4BXFA 4CCOA 4AFDA 2CAVA 2QDNA 2QQKA 1Z0HA 3K2OA 1AX0A 4A7KA 4JGZC 1JN2P 1UMHA 1X82A 2XHNA 1BEV1 3V65A 4GALA 4LIVA 4YPJA 1W9TA 4WVVA 1NCRA 2A6VA 3ETPA 2V72A 3WF3A 4XF9A 1U12A 1H2MA 1S0IA 5GALA 3ZFFC 1F2NA 4CCLA 3CL1A 5C9AA 4PLOA 4WVWA 2XPJA 2WUHA 1JYTA 2XKOA 4YM2A 2W9XA 1NA1A 1EV13 4OUMA 4QB1A 3TRSB 2W94A 2ENRA 2D6NA 1RUG3 3B9IA 5J37A 2VNVA 3H1WA 2B5HA 3IBMA 3GGLA 4XHBA 4AYUA 5K9YA 2R16A 2EIDA 5DN2A 5C6CA 4GH4B 5BY5A 5JR2A 1DQ0A 4FXKB 4Q0SA 3THTA 3RZLA 1RUJ2 4JCKA 5T5JA 5EWSA 1HIXA 4OUEA 2VD7A 5A7PA 1G9DA 1RUF1 4GB33 4QPIC 2IXIA 1LHVA 3WNXA 3UKNA 2A70A 4QDQA 1LENA 3B7MA 4TWTA 1GWMA 3WQBA 1WLTA 4IEUA 4XTPA 1VBC3 3UJOA 4QX7A 3LD8A 4RS5A 2QQPA 4AEDA 1YYNA 2Y33A 2FDKA 4QM8A 3VBOC 2PAEA 3I49A 1HLCA 4M4PA 1V6JA 2R6QA 2IUWA 1QJFA 3NJXA 2JG9B 2RS33 2JG8B 1OQ1A 4COYA 3TEWA 2P2KA 2LUWA 1KDKA 3AP5A 3CIHA 4I0AA 5DAQA 5FZFA 3MIHA 4BM8A 4JX0A 5AC92 1BEV3 3POJA 3LA7A 3ZYBA 1W9FA 4QX5A 3MIDA 3SCFA 4QPIA 1UU4A 4BB3A 4AHZA 2WQZC 3SCGA 1J58A 1QQP3 4CXYA 2DVFA 2MNGA 2JB8A 1O3TA 4LNVA 3C2UA 1K5JA 1PX4A 2ZGLA 2ZEYA 3VL9A 1JOJA 5EJ3A 3Q9OA 3RZZA 5C71A 3J7LA 1H8TB 4FFFA 3SEPA 3KCYA 2KA3A 3WDXA 4XUNA 5EFUA 1S0GA 4LUKA 4CDQB 4ZHNA 3HN3A 1LTEA 5DUUA 4DUVA 4TTGA 3S30A 3U10A 5C8WA 5C8CB 2R1BA 5FYTA 1H2NA 1RJ8A 2RS11 3FUOA 3OBRA 1TNRA 4I0BA 4ITCA 2ZX3A 1OUSA 4IEYA 2YXSA 4Z2WA 4BYYA 2QQNA 3AXEA 3MI8A 4W6YA 1L7LA 1R091 2OQ6A 2YYOA 4R4XA 1FT9A 2R30A 4GB31 3GXUA 4FPEA 3AP7A 4Q4X1 4B7KA 4MGTA 1COV1 2RS32 3HT2A 2VQAA 4TYSA 1XYOA 3PVOA 1YLLA 4HETA 5BNOB 1ULPA 1XYNA 1N1SA 2BP6A 3PUSA 4IV1A 5HCHA 4YVWC 4LBQB 2DVBA 2ZKLA 1HRI3 3IDBB 4DXZA 2WNVC 4NAMA 2ZGUA 1XNAA 1POV1 4D6RA 2BBVA 1ND2C 3KQ4B 2YGMA 2O14A 2D3PA 4L9BA 3RSJA 5ISLA 2O0OA 4IGPA 1O3QA 5F9TA 2RDSA 2V4VA 4XF3A 5LRRA 1OPMA 3AMHA 4FFIA 3E6BA 4EE2A 2GMEA 3GNEA 3VGIA 1W05A 1VAMA 3C3VA 4XJAA 1A34A 1DF0A 2VCAA 3K75B 1XSRA 3R0RA 1NLRA 2K2SA 3WNOA 4CCCA 3OUJA 3IKWA 1CAUB 3B94A 4MG2A 5KXCA 5DAPA 2A6WA 3OEBA 2GNBA 1KQRA 2GNTA 2Z5WA 4AE2A 1C28A 1NKGA 3BOWA 1V70A 2RDRA 1JYVA 1LHWA 1LOCA 2E63A 4MGSA 2OVUA 2AGSA 1NUKA 2H6CA 3PTYA 5DZGA 2ZCWA 1OKOA 4DPNA 4B7EA 5A3WA 4L8QA 4TLGA 5GLWA 4MXVA 3D8CA 1LB2A 2D6OX 4N53B 4Z1VA 4BLJA 1GU3A 2B7YA 5K7PA 2GP3A 4LO8A 4HFSA 4HK9A 1PO23 5KHIA 3WNPA 1C4RA 4AZZA 1GOHA 1UNBA 5KBFA 2J1AA 4KGGA 2DYCA 4XBLA 5A6QA 1NZCA 1XNKA 4A3XA 1WMEA 4NROA 4OI4A 3I2JA 3OBZA 2Y34A 5BXXA 3OGVA 3NNLA 2HH9A 4AK3A 2H0VA 3VBHA 4C90A 3RS6A 5LW9A 4E8CA 4QKDA 1AVBA 1UPIA 4A44A 2WC2A 5LEKA 1VIWB 3ZXFA 1GWLA 2IXCA 4KG0A 4CUCA 1VRH2 1M06G 1U5YA 5FYUA 4QPYA 1KJRA 1GZCA 4QGNA 4NPLA 5F32A 2NN8A 1ULFA 5FUPA 3TN93 1FNZA 2O1QA 4IGOA 2ZGKA 3WF1A 1ZZCA 3HBKA 1YRZA 5FZ1A 3LF7A 3ZYIB 3PVNA 1DG6A 3EQEA 3O5SA 3ST7A 1FMD1 4Y1UA 4K8FA 1YC61 3I2IA 1RHI3 1PGL1 1MEC3 2QCSB 2XB6C 1CZTA 3AMQA 5C70A 5CG8A 2P3JA 3E6DA 5B4XA 4AGVA 1O8PA 1W03A 3V0BA 2GNDA 3UYJA 1LOGA 2CGNA 2OIIA 1W8HA 3BIWE 2OZJA 3S5QA 2GDFA 1DIWA 1MZ6A 1NX9A 4N9HA 3ZSKA 2WWUA 3OF1A 3X29B 3ZFEB 5DZEA 3BTAA 5T5OA 3N36A 5H9QA 4CCEA 5A3TA 4HVRA 3N7MA 2NLRA 1DLLA 1RGSA 5A80A 4OMCA 2VZ3A 3ZXKA 4DINB 4FOYA 1W90A 3I7DA 4QPIB 4ISQA 1YWKA 2VQUA 1LAJA 1SLTA 2OQ7A 3DYOA 4AHWA 5J1XA 2WNUB 2ZA9A 1F5JA 1N3OA 4COVA 4HL0A 4UFIA 4YWAA 2UWAA 3OGSA 4AI9A 3E5XA 2IXHA 1L7RA 1KXGA 2RHPA 2J1RA 1IQAA 3ZMOA 1CJPA 2NMOA 1MS5A 2QZ2A 1E5SA 3UETA 3KS7A 3I59B 1C5IA 1PNFA 2WA4A 4GWNA 4JAAA 3RGBA 1UMZA 3ACLA 3C7HA 5FBJA 3ES4A 2ADEA 3TN92 5JSPA 3VDDC 1JU4A 2JDPA 4AVBA 4MYEA 1W8UA 1FOD3 3AP6A 4MGYE 4KU7A 5FXZA 5JOYA 4XQ4A 4DFSA 1TVGA 2RE9A 3AKSA 3WF4A 4KWLA 1GUIA 4OUSA 3KV9A 4BMEA 2VY0A 1EV11 1Y43B 1Z7S1 1RUG2 4ZONA 1FOD1 1RC6A 3ZXAC 5ACA1 4AVTA 1H8TA 1IGOA 1Y9MA 1ZRIA 4PQQA 5IAVA 5L7OC 2J22A 4DZGA 3SH3A 3N7LA 1WLDA 4D0QA 4RGKA 3VHRA 3ZN6A 3ATGA 3ECQA 4QPGB 5EPAA 3JCIA 3F2ZA 3VDDB 4BIFA 5C3RA 1X8MA 3NV1A 4M3CF 4AVSA 4GWMA 2RR11 1POV0 4AFAA 5F2WA 5FPUA 1HB2A 4PHZA 3T2PA 3EHKA 2Z42A 5IYYA 1W9WA 1Y9GA 1ZBA1 2YDEA 4XF1A 2CWSA 5FRAA 4Q1RA 1OPOA 2P3IA 1VBE3 1XYPA 4WM8B 3WW3A 4NPMA 5T52A 1XBFA 2RR13 4DO0A 2VW1A 2Y6KA 4YVSC 1BBT2 2WZR3 1H6XA 4AG4A 3TBDA 1AR92 3CU7A 2FCTA 1JOBA 2VTXA 4Q4Y3 1RUJ3 2GC1A 5JOXA 2WIIB 5GZEA 1GP6A 2DFBA 4PF1A 4CU8A 3O1SA 1QJY1 3WQ7A 3OGJA 4RR3B 1S1AA 1FMD3 5ABJC 3RNSA 1VALA 2YPJA 4XCBA 1T2XA 4OHZA 5BUVA 4IEOA 4UF0B 1QOOA 5FJHA 2PAMA 4WZFA 2VUJA 4GB32 1CQ9A 2JE7A 4P14A 4NIAA 1UU5A 4R8HA 4D7TA 4XC9A 3WDUA 2JECA 5FPLA 1Z7S3 3URFA 5LK7B 2VL4A 5FZOB 1ZRRA 3H7YA 3NAPC 4EZ4A 3KQRA 4N43C 4HPKB 1XU1A 5J7MA 1H30A 4Z8BA 1AXYA 2HWB3 4DRRA 3CMGA 1C1FA 3POYA 4FQ4A 4YRDA 5CFDB 1HJGA 4A3ZA 2JE8A 5C5UA 5JAXA 2VVEA 4RS5B 5FWJA 2A7AA 3ZDVA 2ZHKA 1IS5A 4XCAA 1ULGA 4N7UA 3K4ZA 4HSJA 4XFFA 2BU9A 2EXKA 5F39A 3N4MA 1AR93 2JG9C 3TWIA 3MFCA 5FV3A 4XDOA 3CJIA 3DPRC 2XUEA 3MW2A 1XE7A 2D98A 1VRH1 2DDUA 4UW3A 2SBAA 3PDQA 2FCUA 2Q0AA 3MUZ1 2H0BA 2VCCA 3AKQA 1IKPA 2CYFA 3VD3A 2XWBB 3PU3A 1UXXX 1SEFA 2IVJA 4HPKA 4AHXA 4N90A 1OOPC 1R081 2G9FA 4LXLA 2WNOA 1PO13 1W6PB 3SEEA 4AWDA 3VD4A 1RUI1 2XMLA 3GHMA 4V2VA 5FZAA 4AFCA 4FXGB 5FZEA 3NNJA 1Y9QA 3WP4A 2OUJA 4B1LA 4M00A 4E4DX 4F8AA 1YO8A 5DMYA 1HRV1 4RYDA 4FOWA 4Q8KA 4ZY9A 3JD73 2R061 5EZWA 1CJDA 3BTZA 2D6KA 1PMIA 1SHWB 2IXKA 3VDDA 3WT3A 1F8VA 3O1OA 5IVEA 1WUVA 2JG8A 1ZNPA 3Q8BA 4YW3A 2CHHA 1LU2A 3EB7A 5L73A 5LK5A 5BNQA 5LWBA 1AL22 5GJ6A 1WMDA 4LHNA 5JWPA 1G9CA 1J3PA 1ZA4A 2OXBA 1I5ZA 3INAA 1QJX2 1NQJA 5HV4A 2ZGSA 4L99A 2ZX1A 1AYN2 4YGDA 2TNFA 5ERLA 4OI1A 1VBA1 4D7YA 3N9QA 1VBD3 2EF6A 5LA9A 3R4UA 1PVXA 2ATFA 4XAAA 3ZXEA 2ERFA 1FPN2 1WA6X 2VAUA 4LHKA 4AVAA 1O4YA 1JZ3A 3MF9A 4XURA 5GZCA 3OPTA 2XL9A 1FNYA 1YXWA 3DL3A 4HKLA 2VMDA 1J59A 3NNFA 2AC1A 2HEVF 4MX3A 4UW5A 1ZRCA 3VHPA 5A6ZA 4FQZA 2MPFA 1QF3A 2Q5TA 5T5LA 3RI9A 2FQPA 2XVLA 4GMP1 1DYPA 1EAH3 1HV0A 1X50A 5CG9A 4A7YA 3HAGA 2D6PA 4JGYA 2VZUA 2C5DA 1YFWA 3WXPA 1ZZ7A 2VMHA 4CCNA 2ET1A 3SNMA 3T1LA 1V9U2 2XJVA 4HVOA 2B9VA 2XL7A 3W20A 5F37A 4XJZA 5I8YA 2DUPA 4K1YA 3OOXA 1Y3TA 4QXCA 3RYPA 4QX8A 4COZA 3AKTA 5JPNB 2BTVC 4UXAA 1QWRA 4L2NA 4META 4NHYA 1OXCA 1EP0A 1C8M2 5CB7A 1NCQA 4UBGA 2BGCA 2JE9A 1D2SA 2YB7A 2XJPA 1NY71 2F4LA 2VQTA 2Y6JA 3W5NA 1ZM1A 3QD6A 4DEVA 4PCRA 1TEIA 5CNAA 5FZ8A 4FAHA 1W8NA 3KF5A 3P6BA 4RS5C 5FYZA 3PURA 1HKDA 4IEWA 4BCUA 4H7LA 5CFDC 4OCTA 3WNMA 2VC9A 3NV3A 2WAOA 3Q8FA 1ZZ8A 5FY9A 4IEQA 4O7XA 2VG9A 2ZACA 5DXDA 4X8PA 1S0JA 4W4ZA 3BVCA 3IZOA 3MBWA 4LE4A 2Q8DA 3JB8A 4MVTA 1REFA 3O1RA 1VBA3 1LGBA 2P37A 2HWF3 4HXCA 3DXUA 3FLTA 5E89A 5K0UB 1WW4A 4LOTA 4A42A 4FPOB 3ZN5A 3VDCA 5ABJB 4EN9B 3HIFA 2QE3A 1ENRA 1SDDB 1A78A 3ZFEC 1US3A 5HBAA 3WD5A 3JBG1 5C3OA 2R041 2JX9A 2OZ6A 5FYVA 2GALA 2VBBA 3HVDA 2VQ0A 3RZGA 4JQRA 2E6VA 3CJIB 3O12A 5F5CA 5LRSA 4GWIA 2NPIA 2WKKA 2JIJA 4FPJA 1HQNA 1KS5A 1UN1A 3ACGA 1MVQA 1AL0G 5DAVA 3TNQA 2BPA2 5LY1A 1LECA 5FZCA 3IMNA 2G9GA 2BOJA 4XQDA 1MPXA 3OBTA 2RM21 2Q1ZB 3AJYA 4G4FA 3RMYA 1NT0A 1PIV3 1ZVFA 2YPDA 3JZVA 1W6MB 1R1A3 1FPN3 1LKNA 2CAUA 4D3WA 4YW6A 5IJRA 4CE8A 4H7MA 4AW7A 3RDIA 4YM1A 5HCFA 5FXWA 1ODNA 1V6MA 3LFIA 3BGAA 4QPWA 1S0EA 4Y5Z0 2ZAHA 5FZ4A 2E31A 4UBHA 4YW1A 5LCWL 1PGL2 1AYM1 2VOXA 1CX1A 3LCPA 5DABA 1ALYA 3FBYA 4IEXA 5CFDA 4YW7A 4CPBD 5FFOC 2CV6A 2WO2A 2YY1A 3ELNA 3QCWA 2A3YA 2VZPA 4S2DA 2PHWA 1V6IA 3POEA 3MW3A 3PHMA 1J84A 4YGBA 3LOBA 1BQPA 3OBAA 1F5FA 2ET7A 3DN7A 5FY8A 4WM7A 5C8CA 1VBD2 1PZ7A 2WAAA 2XOMA 5H9RA 1NCQC 5LZ6A 1K12A 5KR7A 4QGMA 4OHVA 2B45X 4W65A 3W58A 2DBIA 2JDZA 2Q8CA 4FT8A 1Q8OA 2VZTA 3B69A 3VV1A 3VHNA 4AEDC 3O1VA 3LPFA 2E9QA 1OOPB 1PX3A 1XE8A 2HWF1 1NCQB 4O65A 2Z2SB 3EO6A 3J9SA 3MLKA 2JD4A 3UV9A 4P5YA 2FDFA 3OUHA 1CWPA 4U36A 3ENRA 5DG1A 3NSTA 5FIXA 1NXMA 2VZ1A 3SKJE 3KT4A 2C9AA 1TQ5A 3DKQA 4RHV3 2Y64A 3KD4A 5JR7B 2J1SA 5J36A 1OH4A 2ZMKA 3LE0A 4HKWA 2LW8A 3DECA 2EAKA 4ISRA 1QJX1 4MUVA 1GMMA 2XJTA 4LBJA 3ZN6B 2CSGA 3IDEA 2AENA 4IGQA 1JYIA 1YIPA 1GZWB 5DAWA 5A3MA 4QU2A 1H0BA 1VMFA 1ULEA 1DGRA 1O5LA 1JMUB 5F2SA 4FCAA 3AB0A 3CF6E 1AR71 5FPXA 1QOTA 3WHTA 3RZJA 4UF0A 4LORA 1OQEA 3HNYM 1YEWA 2IZWA 1TNFA 3U11A 4WM8A 3A4UA 1D0HA 1HQLA 3I3MA 3DEMA 2D97A 3AL5A 4XILA 4IQPA 3R05A 3M70A 1GFF2 5FR3A 4R9DA 3VKOA 3TNPB 1DP0A 2HEYF 4BHPA 1JUHA 1UF2C 4NOTA 3HMYA 1UD1A 1H9PA 3SH5A 4BQ1A 1AL21 5A7WA 1G8WA 1QNYA 1I5PA 4DY3A 1UYXA 2RJLA 4KNCA 5FMDA 4YG6A 3V0BB 4YNIA 3ZYJB 5E88A 4J6GA 1VRH3 1ZBA3 4NWWA 2J42A 3AZZA 2CNAA 5JI9A 5A7NA 4YVWA 4LMFA 3I54A 4IV1C 2PQSA 5T5PA 5C4WC 4H14A 3BIEA 3IN9A 3AMPA 1QXPA 4YARA 4RGAA 2W68A 3I3DA 4JGYB 3JB4C 2WLQA 2DBNA 5B4NA 5IT6A 4LK6A 4LLFA 4OHYA 1IQDC 4W6WA 3BU0A 4BJ0A 3GJAA 2JKXA 5CKMA 2RDNA 2JWPA 2ZGRA 3VZOA 2V5DA 3WG4A 3U14A 2JENA 3LZZA 1GQHA 4N7IA 5FZDA 2C6SA 3HT1A 3T2TA 1WW7A 1NCRC 2R1DA 2QJVA 2VGDA 1H8VA 2E7QA 1GSLA 4XQWA 5DQ0A 5JLVA 1HN1A 2V09A 4FTBA 1I3HA 2I07B 2VPVA 2QQMA 2ZHNA 4XUTA 1HN0A 1QXRA 1F35A 1JZ8A 3O1PA 1AYM3 1LCLA 1MS4A 2OA2A 5L7OB 5KXDA 4EQVA 1JH5A 4DMIA 3OY8A 2D43A 2ZTNA 2X5IB 3LQCA 2WO7A 1UYZA 1X9TA 3MIGA 3S7IA 4XJWA 5E1RA 5KC5A 4NUBA 5DUVA 2GP5A 4ZU4A 5HCBA 3ASIA 3WR0A 3KMHA 1HQWA 4NMIA 2XLAA 4TSVA 4AL9A 5C3PA 3TEZA 3H8XA 1AL23 5BNPA 2FMYA 4QB6A 1G9FA 5FYBA 4F7ZA 2XONA 1ND3B 2ZGOA 5LASA 2QVSB 3USUA 2AACA 2BBAA 2ES3A 1W3XA 4LULA 1AR91 3E97A 5FMCA 2P3KA 2WQ4A 3RYKA 2PHDA 3NQHA 3ZYHA 1QNWA 4E2QA 3MDPA 4G3YC 5IATA 4JDNA 4EN7B 3ZR6A 3PUAA 2Y6LA 4IUGA 3W9AA 4NVPA 2VVFA 1RUF2 4MLOA 1PMHX 1EPWA 3T0BA 3JBG2 4AI2A 1CAWB 1W0PA 4R9BA 3ZIXA 2AR6A 2W1WA 1W2NA 4QXBA 5FREA 4M3CE 1UAIA 4WM7C 5AVAA 5BNNB 4WM7B 4MGQA 1VB2A 3ETQA 2WBKA 4Y1XA 4E27A 1ULCA 1UZVA 3VLBB 5ACA3 4FVVA 5BNPB 1FV2A 2E33A 4AI3A 5J96B 2VBDA 2WZ8A 1H1MA 1N3PA 2HJIA 3ES1A 4BOWA 2BUKA 2DTWA 4RGGA 1Q43A 3DYPA 3VZKA 4DIQA 1TME2 2R0HA 1LOFA 4GMP0 5A6XA 5AC93 2ZZJA 1GQGA 1UZ0A 2WSVA 2PQQA 1EV12 1L7QA 1QJU3 2QKDA 3L9JT 3N7JA 4MSVA 3RJ2X 3WUCA 1JXNA 4S2FA 1YQ5A 1YFUA 4QWNA 3T2QA 4D6QA 3ROUA 1OA2A 1VR3A 3SISA 2VUCA 1I9RA 4XHXA 4FPFA 2Y6GA 4NHLA 1BK0A 1X33A 3AKPA 3HNMA 5FBZA 4E2GA 4Q4V2 1N1YA 4ONUA 3ZKUA 5JSOA 2V5YA 5LA2A 1NY72 4A7ZA 1GZWA 1FOD2 2PA7A 4FPCA 4Y26A 3ZFGB 4QKFA 5LBCA 2XBO3 3D0JA 4C0HA 5A3UA 1FI2A 1EY2A 2X5IC 1KRIA 1QDOA 2IFRA 3M4FA 4XJ8A 3CBNA 2B42B 2UU8A 4BISA 1UWWA 3M7AA 1QJY3 1S55A 1FX5A 2OT7A 4XUQA 5JDBA 1AYM2 2FBEA 4FOVA 2NMNA 4HN1A 4AI8A 3ZXGA 3PLQA 4HANA 3THCA 4OMDA 5EV7A 1VBA2 3KGZA 3M1HA 3MO4A 3WY6A 4WVZA 3AYAA 3ACHA 1LOFC 4GKXA 5C5TA 1NCRB 2PN5A 4NHMA 4CEYA 2ZGPA 1YHFA 3QOPA 4LKEA 1WGPA 2GMPA 2RS52 1PIV1 4RHV1 5LA1A 1MEC1 1L3JA 2W08A 1ASJ2 3BPSA 4GULA 5D8AB 4M01A 1NE6A 2NQYA 1XRUA 2HWC3 2QQLA 2VCBA 5A1LA 3WQ1A 1LHUA 4R9AA 3BALA 4CCKA 3LA2A 3KT7A 1RUC2 1FPN1 3G7DA 2FZ1A 5T3NA 1JOPA 3K4AA 2AYHA 5KHJA 5FZIA 1UOFA 5F5IA 2G1MA 4BPZA 1JHJA 2OPWA 4MADA 4CP1A 1GOGA 2O8OA 1OKQA 2R062 2WFF3 3WCSA 1QJEA 1LESA 3UGGA 1FMD2 3WP3A 4LBLA 2Y26A 5JI7A 2BQPA 5F3CA 2VZSA 4ZXEA 4C91A 1UIJA 1PZ9A 2B46X 2TBVA 3EXUA 2HWD1 4NIIA 4GH4A 3K4DA 1XSQA 1JHNA 1R082 2F4PA 4Q4W3 4HZFA 5FZGA 3AZXA 2ID4A 1MVEA 1VAVA 2MEV1 3M8LA 3ZFFB 1E57A 1REDA 4N8MA 4CPBA 4NIGA 4ASMB 2WWJA 1VB4A 4KQ7A 3KHBA 3FLPA 3OD4A 1CAXB 3C7EA 2K46A 1VLNA 2WJSA 1VBE2 3ZYGA 4WZCA 2VR4A 3TOJA 2G4IA 3MV11 4JVAA 3OYWB 4YVWB 2OW4A 2RG4A 1W6OA 2ZOEB 4OI2A 2DV9A 3HR9A 5FZMA 3USSA 2GH2A 2ZABA 4AQ6A 4KH9A 5I93A 1W04A 3THDA 5FDBA 2ZMNA 4XBQA 3I2HA 4ZZ5A 2WDBA 2ZX4A 5GLTA 3WSOA 4Q1PA 5L36A 4P9XA 4GJZA 1W2TA 3Q8EA 4MHUA 1AR83 1BJQA 4EWAA 1PK6A 1SPPA 3NNGA 2WNUA 1RB8G 5DPNA 1QJX3 1DQ4A 4JTNA 1RUE3 5DDJ3 3DPRB 4FBFA 2SLIA 4PLMA 3WNLA 4BDVB 3P3NA 3U4SA 1OC1A 3DYMA 4FTEA 1DCSA 3OY8B 4XXAA 1D2QA 4CDXA 3UL2A 1X36A 2C24A 1CZVA 3N9LA 4OYUA 4Y22B 5FZ3A 3KCXA 3WX5A 4A41A 1GP4A 2AZ5A 1WW5A 1XXNA 4MV2A 1YFXA 4ZPIA 5IAXA 2O8QA 2RJ2A 2VTFA 1OLQA 5JXIA 2Y8KA 3VKFC 3JQWA 2D93A 4Y20B 1XE0A 2AH2A 1R1ZA 4PIZA 4XYXA 5T50A 2HWD3 3I97A 2KM2A 5GM0A 4ES9A 4QM9A 4LK7A 3ZDSA 4LOSA 5KC6A 3CDZB 2PMWB 1WD3A 2BOIA 3CJIC 3DPRA 1GWKA 1MR5A 1G86A 1OFNA 1H6YA 2Z69A 3KV5A 4XDPA 5F3IA 4AEMA 4L92A 3ZMNA 3MW4A 1SLBA 3TB0A 3H0OA 4QHBA 1B35C 1W2OA 2PLV1 2A73B 1IS4A 4I30A 4XE9A 5FYYA 1B35B 1WWYA 4ARYA 2WYSA 3RG0A 2JDUA 2E7TA 1PM4A 5FMBA 4KWJA 2Y0OA 1CIWA 5A1AA 1O7FA 1W28A 3VBUA 5I91A 5JIUA 5HCAA 1R083 4JKMA 5JZGB 5EP9A 4CXXA 4N43A 1LGCA 1ZBA2 2P34A 1VRBA 1FXZA 4ZU5A 1STMA 1BCXA 1CAUA 1UZZA 4JTOA 5IK8A 4K9SA 4KMQA 4OLLA 5K4LA 2PHFA 1RTVA 5FOJB 1DZTA 2IXJA 3OJBA 4XVHA 1RUI2 1WCKA 2ADDA 5FLHA 5FQ0B 1BK1A 4NJ4A 4RQPB 1OUXA 3WW1A 5CFCA 2XG3A 1OSGA 1LGNA 2D3SA 2VOWA 4H55A 2RS12 3RZHA 3SHRA 3ZKYA 4LUMA 3SITA 3K46A 2R0FA 3SLIA 5FO8B 4M3CB 1E5RA 3UKTA 3TYJA 5GZFA 2UURA 2J1TA 1IHMA 1OQDA 4JKKA 5EJZB 1VBD1 4COWA 1N3QA 1JTZX 2PAKA 4LT5A 1COV3 1UKGA 4YM3A 5DUWA 3WDWA 1XNDA 1ZBE3 2AUYA 3N7KA 4H3WA 4O9EA 4XFCA 3VD9A 2YGLA 5KXBA 2BRTA 2W1QA 1JYWA 2YC4A 2ZXQA 5FKBA 3ZSMA 3O0XA 1JZ7A 3WW4A 1IPSA 1VMJA 3H3ZA 5A7QA 5SV8A 1FAYA 2WZEA 4QAWA 2JDHA 2E32A 3TN91 4B4PA 2KD7A 3WEZA 1G7YA 3GYDA 4NIHA
chains in the Genus database with same CATH topology
4YVSA 1LOAA 1CPNA 2KXLA 3MEPA 2DCKA 3JD71 3VUOA 2A6YA 1S0CA 4XJUA 1H1IA 4CEYB 4Y1YA 4O9GA 2JXAA 5J98B 5JZGC 3VBHC 3ZO0B 4GXLA 4AF9A 2DVDA 5KWRA 1GANA 1B09A 1MS0A 3AKRA 1QH6A 4YSFA 1IPJA 3AK0A 4XMAA 2VOVA 2PYTA 2W39A 1ZREA 2GN7A 3O0WA 3WP5A 1OOPA 2BVBA 1NE4A 3WG3A 1O4ZA 3QLQA 2HWC1 1H9WA 2ARXA 3GHNA 4NR1A 2D7FA 3WDYA 1ASJ1 4B4QA 5JSRA 3J26N 5E16A 2H6BA 2PFWA 2ZHLA 5F1RA 4FPGA 4XF4A 3E6CC 4MGZE 3KGLA 3KLSA 3WW2A 3CNAA 4YVSB 2NYYA 4AFBA 3TAYA 2YMZA 3KZ4C 1D4M3 3J8F3 1W6NB 1Q56A 1SACA 1D0GA 3NVCA 4FP3A 1QJY2 2X5IA 3LSEA 4MGIE 3J4UH 1D4VB 1FATA 4W6XA 4YG0A 1YNAA 4URTA 5IK5A 4CTEA 4XF0A 4YZ3A 1U5XA 3AMMA 3AP9A 4IV3B 3I4IA 2ARBA 1BBT1 1ENQA 4HBNA 4D7SA 1ND3A 1PNGA 4Q4V1 2DUQA 2YZ4A 2PHXA 3RWNA 1RUD2 2NZ9A 2EXJA 1NOVA 1WCDJ 1N1TA 4UW6A 3H8UA 3U0ZA 5FOBB 4RQPC 4LBNA 3VZJA 4K3UA 3VL8A 4CP0A 2R063 1V9U1 4Q26A 4AI1A 2PTMA 2QNKA 3NAPB 1WD4A 1Q8QA 5ACA2 3M2MA 3DGTA 4N43B 4HN0A 1ASJ3 1Z7S2 2VH9A 1RUH1 1HW5A 3MPPG 5J09A 2RS13 2WFPA 4MZUA 3H1MA 5J3UA 3CO2A 1EYBA 4FO9A 4RQPA 5CFCB 5CFCC 2PHRA 1AYN1 1KDMA 5T55A 3FBMA 4S2HA 1RIRA 1RJ7A 2YUEA 1DQ2A 1UL9A 3D0SA 4HT1T 4XMIA 4PDWC 1PO11 4Q0PA 1UX6A 4IEPA 2UYAA 2WNVB 2WINB 3NV4A 1YCIA 1K5MA 4K6BA 3O14A 1VBB3 1ULDA 4YZ2A 4GH4C 1QJZA 2EVXA 4WBBA 3VBUC 3OYWA 4KBBA 1O5UA 1Q8SA 2FHRA 4XBNA 4RR3C 3B00A 1AUYA 2XJSA 4I02A 4LO6B 4F3JA 2UWCA 4X6QB 3JD72 1RVF3 1W2UA 4Q27A 4Z92B 1W6NA 3R6SA 5KXEA 4NWVA 3B9CA 4HSLA 3LA3A 2QUOA 4LBKA 4RSUA 2ILMA 5T54A 3AP4A 1RINA 3LGRA 4M3CA 1HRV2 4CEYC 4YW5A 1APNA 1KJLA 1MQTB 4OHXA 2VUAA 1C8M3 4FPYA 1XNBA 5EXOA 4XFAA 1WA4A 1ENXA 1AYN3 3PJYA 3BB6A 2UYBA 1VBE1 4P9YA 4DS0A 2GC2A 3MZHA 3WP6A 1KFXL 1CR7A 1OD5A 4HLTA 4E2SA 2I2SA 2MEV2 1TMF1 3IT8A 4AXOA 1BKZA 1M4WA 5JPMB 4JGZA 2C1FA 3MFAA 3NAPA 3AYDA 3A0NA 1TMF3 1V6OA 3PJQA 1ZRDA 3H50A 4I09A 2I74A 3ZIWA 1GNZA 4BH9A 2VNOA 1DGRN 2R071 1RUNA 2DF7A 4Z82A 1RITA 4LEJA 3H3UA 2XLGA 3WG2A 2WLPA 5EYYA 4P9JA 5GZDA 3DV8A 1G9BA 1LRHA 2EXIA 4P9IA 4PBOA 1BVP1 4Y20A 3ILRA 3B3QE 3WUDA 2Z79A 1PGSA 3WHUA 2GH8A 1CN1A 2DVAA 1TE1B 3MIFA 5IK4A 4J1WA 1RUF3 4GA9A 4YZ5A 1A3KA 3FLRA 5TSWA 3VBSC 2NP0A 3WV6A 3BPZA 4XXPA 3VKNA 5GZGA 4CEWB 4LA2A 2RR12 2HWF2 3CEWA 1XU2A 2VW2A 1U0AA 4Y4YA 1H1AA 1QY4A 3FMGA 4OZXA 4AVCA 5C8CC 1S0BA 1YI7A 3ZXDA 1BXHA 3V0AB 5J48A 2ZGQA 3FJSA 3D6EA 1AR81 2GNMA 5CA6A 3SH4A 3D82A 2LALA 3M3OA 4FPKA 4V1PA 3ZSLA 4HVQA 2DURA 1J3QA 1VJ2A 1SBDA 3GZAA 4LO5B 3ZX7A 1WLWA 2A75A 1URXA 3HQXA 1YIFA 2D5HA 1A6CA 1LEMA 2XHKA 1ND2A 3AZVA 5I0TA 3PMEA 3VBFC 4B4RA 4JRAA 2DTYA 2ZHMA 1O4TA 4CYDA 5BPXA 5D8AA 4XZPA 3VBOB 5FMOS 1WW6A 2RM22 2CTVA 1PGW2 1DZQA 5FAXA 1LOBA 4XFIA 1XNCA 1SLAA 5HXVA 3U07A 2QDRA 2EIGA 3O0VA 4PLNA 2HWC2 4AQ2A 4Q4X3 2Q4SA 3GBGA 1HXS2 1ZZ6A 2GZWA 1U5ZA 4P9LA 2R042 3VN4A 3UK9A 4KU8A 2QZ3A 1KD7A 4EN8B 3IIAA 3AYEA 3L2YA 1HV1A 4AEKA 4D94A 4CDWA 1GICA 3R4DB 4QQLA 4TLFA 1BVVA 3FWEA 3HD8B 2OYZA 3ZYRA 1TMF2 2XGXA 4QPGC 4B29A 1DQ6A 1X8EA 1LHOA 3VZNA 4BIOA 2P17A 1REEA 5IUQA 2R073 2A5ZA 1RUJ1 4ATEA 3GBWA 2ZPXA 1W6PA 5H9SA 4WV8A 3USUB 1GZ9A 1AX1A 3PVEA 2PELA 1MEC2 3THPA 3NW4A 1DQ5A 1LULA 5FTTC 3QBQA 4FAGA 1W0OA 4R9CA 3ME2A 3I8TA 4PIYA 4EV0A 5FO7B 1JBCA 1PK6B 4JV4A 2WWSA 2BW8A 4HK8A 2XBO2 5DZFA 4C0BA 1BZWA 4LA3A 1O3RA 1H4HA 3EJKA 2YROA 3LWCA 3VBSA 1SDWA 2EXHA 2FMDA 4MXWB 3WINE 1H4GA 1QKQA 1MZEA 5C4WB 4S2GA 4AQSA 5I0RA 1MZ5A 2WSUA 4BWOA 4YGEA 4Q4W1 2CWMA 1POV3 1S0DA 4IV1B 2VW0A 1YFYA 2XWJB 4A2UA 1QU0A 2B39A 5BNOA 4I2OA 1CONA 4C1XA 3G6JB 3NKGA 1UCXA 1GNHA 4SBVA 2IFWA 3BCWA 3RQ0A 5JCTA 3N3HA 4COUA 2ZJCA 4Q0QA 1PHMA 2Q30A 2ZMLA 4KGQA 1RL3A 2XJUA 3IWZA 3KSCA 4F83A 2D6LX 1RUE2 2ZAAA 2A6XA 1BYHA 4PBPA 1VP6A 1J1TA 2UY8A 4RFT0 1R1A1 4XW3A 4C1WA 3DKWA 4AEJA 5LEJA 1QH7A 4QQPA 5DDJ1 3LOIA 5EYXA 5K0UC 5JOWA 1X7NA 2R072 4Y1VA 4Q4X2 2GC3A 3MGUA 3SCHA 5FLJA 4YZ4A 4K1ZA 4BZ4A 3M3CA 4OFGA 3JU9A 4L11A 4WM8C 3GALA 3KB5A 1EPZA 1RVF2 4CZSA 3S6PA 4EROA 4IL7A 4Q29A 5I0SA 2PLV3 5BNOC 4BA6A 3B01A 1YI9A 1OFSA 1HRI1 3POSA 4K40A 2UY9A 3KM5A 3HBZA 2MHFA 1F9KA 1CESA 1CPMA 1DGWX 3IM0A 1K5MC 4K7JA 3KCCA 5I8SA 3FHIB 3WZ1A 2JEMA 1VBB1 2AREA 4J1XA 4M0NA 2FZ2A 1QJU1 2XKPA 3GZUC 4JGZB 4ASLA 1SBEA 2VVDA 3AZYA 2RMU1 2XJRA 3LB9A 2Q8OA 4OI0A 4MGKE 3VZMA 3OD0A 3VBFB 1LJ7A 4BMBA 3P3PA 3LSDA 4YGCA 1FYUA 2DU1A 1W6OB 1ONAA 5SV5A 1GYKA 1W6MA 4YZ1A 3M3EA 3ZN4A 4B3NA 1S2BA 4P9WA 1RUOA 5CVRA 4FOQA 3MICA 1PVC2 1DYKA 1C8NA 1EAH1 4Z07A 2EA7A 4K21A 1SLIA 4JGYC 2GN3A 2JG8C 1GLHA 2D5FA 1QXJA 1Y7BA 1GKBA 5GLZA 4OHWA 2DVGA 3AFKA 2BVVA 1PO12 1PIV2 4WVMA 2MEV3 4CEWC 2GAUA 3ZVXA 3AZWA 1GR3A 5FCCA 5C33A 3VBSB 5C4WA 3WDVA 1ZYBA 1SQ4A 1RUC1 1UZYA 1YJKA 4YFWA 5I0UA 2WA3A 3A0KA 1H8TC 4JDOA 3V0AA 4RHV2 2RS51 4QMAA 1Q8PA 1D4M2 3J8F2 1KFUL 4XDQA 3IDCB 3CJXA 3ZFEA 2HWB1 4CRQA 4XPVA 4YLZA 2Q1MA 5B2GB 4IEZA 1RUG1 1WBLA 4DRVA 1OA3A 4N53C 1Q8VA 4AQTA 1I6XA 1MQTC 1ENSA 3N35A 1CGPA 4XFBA 2N7GA 2CGOA 1QQP2 2LTNA 1MS9A 1H2KA 3PNAA 4FPHA 2JKBA 4CDUA 3MYXA 1ZBE1 4YW4A 2X29A 3MF6A 2VU9A 4ZU7A 4INDA 1SMVA 3ZPYA 2ZGNA 4NO4A 1SLCA 4Q4Y1 1AHSA 4QQ2A 1D4M1 3J8F1 3PVBB 2ZGMA 2ZKNA 3O7OA 3L2HA 1LODA 5D1IA 2BFUS 4JC1A 4RD7A 2RM23 4YW2A 4ZKTB 2ZX2A 1ND2B 2PLV2 2ZS6B 2Y0IA 2XUMA 4CEWA 2WFF2 1CAXA 3ILNA 4LBMA 4UW4A 4SLIA 1WBFA 1H2LA 4K20A 4RR3A 4XFGA 4GKYA 4P5HA 1IS3A 1IS6A 1OI6A 1IZ3A 3ALQA 2WNUC 1AJKA 5A32A 2BFUL 1CD3G 2ETEA 2OPKA 1CAVB 2BEOA 3M3IA 4GIQA 1QMJA 2VECA 2RMU2 2XVGA 1I1EA 1VBB2 3H9AA 1R093 1OHFA 3AJZA 3APBA 3ZSEA 4EWEA 5F6KA 1DGWA 2ZGTA 5DG2A 2Y38A 4B8EA 4G9SB 5ABJA 4IESA 4LO4B 5L7OA 1ND3C 2BWCA 5BYNA 3AX4A 5KHHA 5CAZA 1V6NA 2IXLA 4PDWB 5AVPA 2DFCA 2EALA 2WZR2 1KS4A 4Y22A 1BBT3 3E5UA 1LR5A 3VKMA 3ZXLA 4ORFA 1DU3D 4I3GA 5AFEA 3S7EA 4TZDA 3BODA 1RUI3 1HDKA 2XVKA 5KHKA 2YHJA 3SMHA 5BV6A 1DGLA 4DNYA 4AI0A 1IOAA 2DCYA 3D5OA 1Q5OA 1DFQA 4X6RB 3DUIA 3QH6A 1LEDA 5FPZA 1UU6A 4PIXA 3SXWA 1BMV2 3MIEA 4EWDA 2VOKA 1B35A 4FTSA 4JDMA 3FFZA 1MZFA 1TME3 3IPVA 4QQHA 2GMMA 2NM1A 1LHNA 1RUH3 3VBUB 1GV9A 2RMU3 2HWD2 3T1MA 4CDUC 1ZRFA 1QDCA 1NXD1 1RHI1 1UPSA 3NO8A 4XETA 4ATFA 2R32A 1SFYA 4HMZA 2D3RA 4YFZA 2WFF1 2K9ZA 2BWAA 1RMU3 4NPRA 4RA0A 1C57A 2E53A 1AR72 3MLJA 4LE3A 4R4ZA 3RMXA 4ZXKA 1PO21 3QH7A 3WVJA 4AVVA 3AMNA 1DDLA 2TUNA 4MXWA 4M0HA 1KITA 3MIBA 3ZFGC 4FSJA 2JJ6A 4E4ZA 5CU1A 3ILFA 1R092 3GZTB 4EJRA 2ZX0A 1Q3EA 3HN1A 3VBRC 1MS3A 4LO7A 5JZGA 4Q2FA 1IKQA 2X53S 1N47A 4Q4W2 1N1VA 4LBQD 2A6ZA 3AYCA 4HKOA 3I2DA 1HRV3 4JRLA 2BNOA 1AXZA 1RHI2 1V6KA 3NV2A 4CDWB 2VNRA 5JVVA 3WDTA 1QQP1 1V9U3 1AX2A 1CX4A 5FQ0A 2X8KA 4PJYA 4OULA 1DHKB 1K5MB 2HWE1 2WNEA 5C9AB 4I0WB 3VBRB 2YV8A 4XEZA 5AC91 1RUD3 1RMU1 3FUQA 1UIKA 3VBOA 4EN0A 5JIAA 2DCJA 1LOEA 1HX6A 1FV3A 2JICA 3B02A 1VBC2 3E5QA 1ZZBA 1C5HA 1GBGA 1EAH2 3AFGA 2PHLA 4PQ9A 1T6GC 1WMFA 2OUHA 4GQ7A 1DBNA 1RUC3 1C3HA 3GBFA 3ZYPA 4LHLA 2WNVA 1NLSA 1PZ8A 1MQTA 5F6LB 4N9IA 3LKJA 3U4XA 2WZPP 1SLLA 4DB5A 2HYKA 4CDXC 4EN6B 5KHGA 2BYVE 3RRDA 2JG9A 1YJLA 4X8NA 2XH6A 3AM2A 4IEVA 2VXRA 4NN0A 5GLVA 2W52A 2IC1A 5GLUA 2B8MA 3D4KA 1YUDA 1MS1A 3JUUA 4MH0E 2VMIA 1DZRA 5E8AA 2YC0A 1MS8A 1NG0A 5D8AC 2DCTA 4XTMA 4QT6A 5K0UA 3HWJA 4LR4A 1BEV2 1SBFA 2GSYA 1JW6A 4IETA 4XFHA 3V64A 4AHYA 4GMP3 2TEPA 3VBFA 5K8SA 1AR82 1AZDA 1QJU2 3GF6A 1RMU2 5CIRA 3QACA 1W6QB 3POWA 1F31A 4LLOA 5JOZA 1CAWA 2VMGA 3FE5A 2F6BA 3WG1A 3LAGA 1VBC1 1C8M1 1HRI2 1V00A 4LTAA 3DF0A 2WT0A 3KT1A 3VHOA 2EAAA 5H9PA 4Q0UA 5F5QA 3JBG3 3UKVA 3RYRA 1ZBE2 3NWKA 1DQ1A 2HWE2 1RVF1 2WS92 1AR62 4E9KA 1R1A2 2W0XA 1IPKA 1WLCA 2RJKA 2XLFA 2DUOA 1OA4A 4L97A 2HEWF 1NA1B 3VBRA 4LBOA 4Y1ZA 1RUE1 4P9GA 4XOGA 3ZXJA 1PM7A 2V73A 2WL1A 4IV3C 4KWKA 1CVNA 4R52A 5A33B 5DUXA 2D6MA 1OMIA 1TME1 1NQDA 3I59A 4Q0VA 2XJQA 3WCRA 3ZFGA 4AFMA 2HWB2 1S0FA 2QFEA 3VKLA 5BNPC 1PO22 5FO9B 2C0ZA 1QGLA 3RPQA 3OTFA 1CAVA 1J3RA 2LM3A 3FC0A 5CADA 3EBRA 5L19A 4BLIA 4CP2A 2B9UA