1LHVA

Crystal structure of the n-terminal lg-domain of shbg in complex with norgestrel
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
177
structure length
173
Chain Sequence
PPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEX HORMONE-BINDING GLOBULIN
publication title Steroid Ligands Bind Human Sex Hormone-binding Globulin in Specific Orientations and Produce Distinct Changes in Protein Conformation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 31
structure length 173
sequence length 177
ec nomenclature
pdb deposition date 2002-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00054 Laminin_G_1 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lhvA00
1LOCA 2AGSA 3POSA 3ZYRA 4LBQB 4XMAA 3BTAA 1MZ6A 4AVSA 3SISA 4YGBA 4FQZA 1AXKA 1LOFC 2Z42A 4YW1A 1G86A 5JOWA 2ZMLA 1JYCA 1SBEA 2BQPA 1KDMA 2OVUA 4H55A 4K20A 3UL2A 1OFSA 5AVAA 3AJYA 3AXDA 3FUQA 3O0WA 1LCLA 3HR9A 4ZKTB 4Y1YA 1G9DA 4GA9A 2DVGA 5GM0A 3PVEA 5KXEA 4C1WA 4BPZA 1A8DA 3O0VA 2OUJA 2ZHKA 1ULEA 1QNWA 1BJQA 4XDQA 3VKNA 3VV1A 1FV3A 1N47A 2ZKNA 2GNMA 1UMZA 4LBQA 4XE9A 4LBJA 4PF5A 2UWBA 4U36A 1FAYA 5GLVA 3VKOA 2DU0A 3GALA 1QOSA 2D7FA 3QLQA 4BMEA 5T5OA 4HANA 4Q26A 2ZGSA 4ISRA 3WG2A 1IS5A 4YZ3A 3I4IA 2V5YA 2SLIA 1QOOA 4ATEA 2ZGNA 2ZMNA 4BLJA 1GV9A 4BLIA 3AZYA 3ZXEA 1ONAA 2DU1A 3RRDA 3OPZA 2LALA 2OW4A 4ZXKA 1IS4A 1G7YA 2LTNA 2ES3A 5JVVA 3WHTA 2R1BA 4FOQA 1IS3A 1IS6A 5T54A 1YIFA 3WV6A 4YGEA 4FP2A 1GZCA 5L73A 3SH5A 2R16A 1AVBA 2D6NA 1MR5A 1VAMA 2YY1A 1ULFA 5CA6A 4ATFA 4LBQD 1SCSA 3BIWE 4XXAA 5EWSA 3WUDA 3D5OA 4XIOA 3AXEA 1GBGA 3N7LA 3PVOA 3A4UA 1AX0A 3ILFA 2W39A 2DVBA 1LGNA 4YLZA 3NV1A 1AF9A 4OZXA 4YM2A 1RITA 3SH3A 1WBFA 1DQ2A 2JE7A 2XG3A 4YZ2A 4UW5A 2E7QA 1VLNA 2Q5TA 3WZ1A 1SLTA 4DS0A 1W6PA 2A5ZA 2GALA 5T5LA 1G8WA 3KM5A 1LOFA 2W52A 1GZ9A 4M3CE 1LGCA 2UWCA 3U4XA 1N3OA 4P9XA 4RL7A 2ZHMA 2EXJA 1LHUA 2KM2A 1CESA 1SBDA 4DRVA 5EYXA 1FYUA 2WSVA 2ZGOA 2ZHLA 3FBYA 4ASMB 1SCRA 1W6QB 3QCWA 4WVVA 2DUOA 4YG6A 3OYWB 5BYNA 1UAIA 1MACA 2D6PA 3LSDA 3ZSJA 3WDTA 4AVTA 1GKBA 1SBFA 2ZA9A 4PQ9A 1HKDA 1LOEA 1TEIA 2P37A 3VKFC 5LK5A 2R0FA 5JOXA 1MVEA 4XBQA 3LCPA 2ARBA 1QNYA 3AP9A 1S0CA 2PHUA 1JUIA 4Y1ZA 3RG0A 1N1YA 4XXPA 3WDYA 3M3QA 1NLSA 3RS6A 1Z0HA 2ZGKA 1AZDA 1DFQA 1LTEA 1UPSA 1DQ6A 2VH9A 1QMJA 2VY0A 5FRAA 2GNTA 2JD4A 1FNYA 1GANA 1S1AA 2NN8A 3AX4A 2JE9A 4XZPA 3FUOA 4F83A 5EYYA 1Q56A 5DUWA 4AWDA 4ISQA 4Y20A 2R1DA 1V6IA 2H0BA 3RMXA 2EXKA 5GLZA 4LBMA 5GZCA 1J1TA 1WLWA 3DGTA 3AP4A 2NZ9A 3JUUA 2ZGTA 4BMBA 5GZEA 3MW3A 2A3YA 4FP3A 1DQ4A 2JDZA 5E88A 1U0AA 1MS9A 1N3QA 3HMYA 3AK0A 2VW1A 2EAKA 1SLLA 1LHOA 1WW4A 4WZFA 5DUXA 4Q1PA 5GJ6A 3IKWA 2A7AA 3D4KA 4RA0A 2A6ZA 4R9AA 1LU2A 2A6VA 5E89A 1LEDA 4K21A 3ZSMA 1X50A 3POYA 1SLBA 1DYPA 1LOBA 1XQNA 2AENA 3IN9A 4JRAA 2R0HA 1QU0A 4FPFA 3O0XA 3ZPYA 1WD4A 1S0IA 4FPEA 1N1VA 1DYKA 1F5FA 3M3CA 3N3HA 2AR6A 2E7TA 5T50A 4U2AA 3AZVA 1FX5A 5F5QA 3AZXA 2EIGA 2JKBA 2P34A 2JJ6A 3B69A 5FREA 4XJWA 3WDUA 3T2TA 5GZFA 1W6OB 1HDKA 1YO8A 1G9BA 4YFZA 2YMZA 1AX2A 3ILRA 1LU1A 3A0KA 3APBA 4FPCA 4M3CF 1C1LA 3WDWA 5IK7A 5IUQA 1D2SA 5JOYA 2WNEA 3WOGA 2ZACA 4AVVA 4XYXA 3AYDA 1VAVA 5DG2A 5HCBA 1DBNA 2A6YA 2C9AA 2JECA 1S0JA 4LBNA 4YZ5A 2OUHA 3D6EA 1ENQA 4FPYA 3LSEA 4KBBA 3SNMA 4BM8A 1UL9A 5GLUA 1AXZA 1S0FA 1W6OA 4XMIA 4XTMA 1W6PB 1WW6A 1ULCA 2AH2A 1AX1A 4XTPA 1C57A 1F9KA 3N7MA 1S0GA 2G4IA 3KQRA 1SLCA 1AXYA 4L8QA 5CB7A 1Q8VA 3R4UA 1LOGA 4FPKA 1WUVA 1ULGA 1PZ9A 1WBLA 3B3QE 3O5SA 5JMCA 1I3HA 2ZGRA 1GSLA 4K1YA 2GMPA 4P9YA 1LULA 5T5PA 4XHXA 4JC1A 2VUAA 4GWNA 1ENSA 2VU9A 3R4SA 2GMEA 1QKQA 3AP5A 4XJUA 2EF6A 4FPLA 1URXA 3AYEA 4XIKA 4AYUA 1Z78A 1GZWA 2DURA 2I2SA 1D0HA 4WVWA 1GNHA 3AZZA 3ZXLA 1S0EA 4W65A 1APNA 3OBTA 1W6NA 3AP6A 1V6NA 1ULDA 1N3PA 1RIRA 3NV2A 4M01A 1ZA4A 2D6OX 1LODA 3WHUA 3JU9A 1WW5A 4YFWA 3ILNA 1KJLA 1PZ8A 2EXHA 1C1FA 1V6KA 3ZSLA 2PELA 3OY8A 3TB0A 4YW4A 2GDFA 2UURA 3L2YA 1SACA 3ZXKA 1DGLA 1FV2A 2FHRA 4DQAA 2D44A 2VXRA 2WQZC 4P9WA 4XJ9A 3V0BA 1V6MA 4Y20B 5HCAA 1BXHA 2WLQA 1VIWB 2P3KA 5T5JA 4FOWA 2GMMA 2EXIA 1W6MA 4ITCA 3SH4A 3ZVXA 2UWAA 1W0PA 5DUVA 4XBNA 1DHKB 1S0DA 2C5DA 4FPJA 1H9PA 4XOGA 3IPVA 3H0OA 4MYEA 2CWSA 2ZGLA 2CL2A 4WV8A 3WVJA 3OBRA 3BOPA 1KDKA 1MS0A 2HYKA 4YM1A 2ZAAA 5CNAA 2E6VA 3MPPG 5E8AA 2WSUA 2WT1A 1CQ9A 4Q1RA 1Y7BA 2A71A 3NWKA 5GLTA 4M00A 1WW7A 5GZGA 5JDBA 5IK5A 4YG3A 1LOAA 2CYFA 2XB6C 1GYKA 4Y22A 3WLUA 2DVAA 2ZBJA 1PZ7A 4YW5A 2W68A 2A3WA 2FMDA 4Y1UA 1CIWA 4YW3A 1FATA 2DV9A 3UK9A 1HQLA 4I30A 4NOTA 3N35A 1SLIA 3V0AA 2NP0A 5IT6A 4FVVA 3M2MA 1Q8SA 2D43A 2TEPA 1I1EA 1UKGA 3VKMA 4Y24A 4FPGA 2A75A 4UW3A 5H9QA 4XILA 4GXLA 2DWRA 3MEPA 1QF3A 3V64A 4CZSA 3NV3A 4P14A 1DQ1A 2GN7A 3MW2A 2D3PA 3VUOA 5DZEA 1WD3A 1CVNA 4Q8KA 3ZYPA 1IKQA 4LBLA 1IKPA 2DTWA 1A78A 4FOYA 1A3KA 5DG1A 4YW2A 1WCSA 3C2UA 4Z8BA 1CONA 5CBLA 1JOJA 5T52A 1N1TA 3AJZA 1ZM1A 1YYNA 3INAA 3WG3A 4YG0A 1Q8QA 1G9AA 4YM3A 1GNZA 4YGCA 1DIWA 4PBPA 1CPNA 2E53A 2P3IA 1YI7A 4PBOA 1Q8PA 3WCRA 1HQWA 3FFZA 2B7YA 1C4RA 1G9FA 4LBOA 2UU8A 2D3RA 5DZGA 1GLHA 2D6KA 1W0OA 3AYAA 4XJAA 4Y26A 3UJOA 3V65A 1JBCA 2NM1A 2ZABA 3RQ0A 4CRQA 1MZ5A 1WLDA 4R9BA 3SITA 4Q2FA 5DUUA 4DPNA 2WKKA 1V6OA 2NMOA 2WJSA 2RHPA 4M3CA 3FLPA 4SLIA 5GZDA 3USUA 3POWA 1LGBA 2PHTA 2NYYA 2YXSA 3W59A 1MS4A 2D6MA 4R9DA 4AGGA 1O4YA 1OQ1A 4YGDA 2ZGQA 3WDVA 2P2KA 4Y1XA 4Y1VA 1UN1A 3AZWA 3B01A 1DZQA 3ATGA 2A6XA 1VALA 2AYHA 3IM0A 1GZWB 2D6LX 3M3EA 3MW4A 1OKQA 5KXCA 1CR7A 4IQPA 1W6NB 2DUQA 2CY6A 2D3SA 1MS1A 2ZGPA 4XBLA 2DTYA 2PHFA 2E51A 3ZXJA 5DZFA 3N7KA 3WCSA 2ZGMA 4AGRA 4CTEA 3ZSKA 3ENRA 3PJQA 1V00A 4GKXA 3OY8B 2VW0A 3TAYA 1LHNA 3WDXA 3PMEA 3M1HA 4GALA 1QDCA 2GNBA 2CTVA 1SLAA 2NMNA 2ZGUA 4FPOB 3V0BB 4TYSA 1JHNA 2VW2A 4FQ4A 4DFSA 2SBAA 1LHWA 2PHRA 1G9CA 3PVNA 1YXWA 2DVDA 3UJQA 4D69A 5IK8A 1NXD1 3ZXFA 1CJPA 4UW4A 3AP7A 2DVFA 2DUPA 1W6MB 1SFYA 1S0BA 2GN3A 3ASIA 2CWMA 2YROA 2ZHNA 4XJ8A 5JOZA 1CN1A 1LJ7A 3FLRA 2GNDA 3SLIA 5H9SA 1HLCA 4FPHA 1KRIA 5CAZA 3IPVB 3Q9OA 1MS5A 3B00A 1RINA 3WG1A 2ERFA 1F31A 4R9CA 1JXNA 3CNAA 4XJZA 5GLWA 3RSJA 1R1ZA 4DRRA 2W08A 1YRZA 2WT2A 2A6WA 4UW6A 5T55A 1LECA 2PHWA 1WLCA 1MVQA 4AGVA 3FLTA 1N1SA 4GWMA 3T1MA 1MS8A 1LESA 4TZDA 1KITA 1BQPA 4Q27A 1FNZA 4Y22B 1BZWA 2AREA 2YZ4A 3WNXA 1DLLA 1DQ0A 2A3XA 1GICA 1LENA 4GKYA 2PHXA 3A0NA 5H9PA 5SV8A 1CPMA 3V0AB 1EPWA 3RMYA 2V73A 3O12A 3T1LA 5JLVA 1QOTA 4Q8LA 1QDOA 2EALA 1H9WA 2P3JA 3IMNA 4YZ4A 1B09A 5KXBA 1BKZA 1V6JA 5F9TA 1BYHA 2A70A 2DYCA 4JCKA 2CNAA 1UX6A 5H9RA 1Q8OA 3I8TA 5KXDA 2R49A 3B9CA 1IOAA 3HN1A 2ZMKA 3AFKA 3AYCA 4LBKA 1KJRA 3DUIA 1V6LA 5GALA 3M3OA 3N36A 3OGGA 1LEMA 5DXDA 1ENRA 1QGLA 3WG4A 1W6QA 1JW6A 3NV4A 1JN2P 3W58A 3N7JA 4XHBA 1UZYA 3GNEA 3OYWA 4YM0A 1UZZA 3BODA 2AUYA 4HL0A 2ENRA 4K1ZA 2WT0A 4BQ1A 1JYIA 4NO4A 1O4ZA 5EXOA 2ARXA 2YV8A 3OJBA 3WUCA 4BOWA 5HCFA 4YZ1A 2ZZJA 5IK4A 1KQRA 3VKLA 4FOVA 1AJOA 4C1XA 1DQ5A 1H30A 4M3CB 3USUB 3R05A 1MS3A 4PCRA 1AJKA 1LHVA
chains in the Genus database with same CATH superfamily
2CDPA 3POSA 4LBQB 1IPJA 5BNOC 1MZ6A 1DGWX 4I2OA 3NRUA 4MVTA 4OQ9A 5JOWA 4COYA 1T2XA 3HT1A 4F3JA 3UL2A 1W9WA 3RJRA 4EN9B 2ET1A 1CZVA 3FUQA 1ZZ7A 3O0WA 3HR9A 4Y1YA 5FYIA 1R1A1 2B9VA 1Y9QA 2WNUB 4FI9A 4XW3A 1QJU3 1QJX3 1PNFA 1EUTA 1QNWA 1OOPA 1US3A 3PVBB 4HLTA 2ZKNA 2VMHA 4NRQA 1OURA 5A1FA 2HWB3 1SDWA 2VZSA 1HV1A 2QTWB 2VZ3A 1ASJ3 3THPA 2UWBA 3U14A 1BEV3 1NYWA 2DU0A 2JDKA 1OPMA 4QHZA 3WG2A 4N53A 4RR3A 3VD7A 2SLIA 2ZGNA 3LQCA 3MPBA 5G04L 1QJY2 1UY2A 2ZEXA 3AZYA 2QDNA 3BI3A 1Z7S2 4NUBA 3RRDA 4AI3A 1W2UA 2BGPA 4JDNA 1R082 1QEXA 2FZ1A 2PHLA 2WYSA 1AYN3 1F2NA 1G7YA 1KFXL 3HNYM 3KS7A 5FV3A 3TYJA 4E2QA 2Z79A 4FAHA 5FBZA 2HBTA 2XQXA 4GH4A 3OD4A 4QPIB 1XNBA 2R16A 2D6NA 1VAMA 5BNOB 1O5LA 4P9LA 5JIAA 2XVLA 2WS92 2YY1A 2HBUA 4QQPA 4EN6B 3RGBA 1WA4A 1J84A 4GWJA 2ZS6B 4LBQD 2VZUA 2JDHA 1SCSA 3BIWE 5EWSA 1OQEA 2RJKA 1YHFA 2BERA 2UY8A 5KWRA 3I2FA 1MEC3 4Q4V1 3A4UA 3N9QA 4L99A 4UBHA 2F17A 1LGNA 2Z4FA 4Q4W2 4Q5OA 3POJA 1EV12 5IVJA 4O9GA 4YM2A 2JWPA 1DQ2A 1X8MA 4LA3A 4BXSV 1K5MB 5C5UA 1SFPA 4Z82A 2P5BA 5A1LA 5KC5A 3A7QA 4QQ2A 5IATA 1W6PA 1G8WA 1XPWA 2DBIA 2W52A 4EROA 2UWCA 1OOPC 3HVDA 2P1BA 3N9MA 4QAWA 2WA3A 2YPJA 1CAVB 2EXJA 4A3ZA 1PIV3 4IETA 1HIXA 3WEZA 3THDA 3RDIA 4ET7A 1UU4A 1JS9A 4QDRA 1PMHX 1W6QB 1RUI3 2CU5A 3BALA 4R4ZA 2IXKA 4QPGA 1GR3A 4XF4A 3HPNA 3OYWB 1UNBA 5F6KA 4AVTA 5FZFA 5BYNA 4HK9A 2P6CA 2FMYA 4GD4A 4XAAA 1TEIA 3MUY1 5ABJC 2R0FA 4RD7A 1MVEA 3SMHA 2B42B 4KBZA 1U5IA 5LW9A 4Q4Y1 2VVFA 3EQEA 4XXPA 4QM9A 1W2OA 1ZYBA 5DN2A 2ZKLA 3ZM8A 1W8HA 3GDBA 5FYSA 2JDNA 1OFNA 2WLPA 4PLOA 3I97A 2NLRA 4MXWB 2BWCA 1AZDA 1DFQA 4YVWC 3I49A 2JEMA 3J7HA 3GM8A 2WFF1 1CAXB 1US2A 1QMJA 1XOYA 2VY0A 3W21A 5FYHA 4QB6A 3CJXA 2OPWA 3H3ZA 3AX4A 5FP4A 3WY6A 3KQ4B 5LA9A 1O8SA 4E4ZA 3RZKA 3H7YA 5DUWA 4AWDA 4ISQA 1VP6A 1RUD2 2ADDA 1EYBA 2JDPA 4LBMA 1J1TA 2KD7A 5FZMA 5GZEA 3MW3A 4MO3M 3NJVA 2JDZA 4GMP3 5E88A 2LW8A 1MS9A 1OOPB 4EWEA 3OPWA 1BVVA 2EAKA 4KL1A 5FZDA 1QJU2 1WW4A 2ATFA 2XDVA 3QACA 4R8HA 5IWFA 5KHJA 2D98A 1RMU3 2WO7A 1QHDA 3OSDA 4AZZA 2E33A 2HWB2 1D0GA 5E89A 4WM7C 4E4DX 1ASJ2 4HFSA 1V0AA 3I3MA 4RR3B 3LIGA 4QXKA 4YWAA 3TN91 3LFIA 4FTBA 4CDQA 4AOCA 4IE7A 4NPMA 5FZIA 1VBC2 2AENA 1V9U3 5DDJ3 1W90A 1PO21 3O0XA 1W39A 1S0IA 4YVSC 3BPSA 4O7XA 1U5ZA 1DYKA 1F5FA 2QQIA 4MV2A 2B46X 4QPGC 1FPN2 5FY8A 3ZDSA 4NWWA 2VNOA 1G6NA 3KT7A 1DGWA 4RHV2 1BBT2 2VOKA 5HXMA 3VGIA 2BTVC 2EIGA 3VZNA 5I93A 1WLTA 2V72A 2YFUA 1ST8A 2JKBA 3HBZA 4LE3A 4ZU7A 4XACA 3T2TA 4GH4B 3RFRA 4KWLA 3ZXAC 2HWF3 4QXHA 2CAVA 4PI0A 4B8EA 2XBO3 3IMMA 4YFZA 2GU9A 1X82A 3ILRA 3GGLA 5A3MA 3VHRA 3APBA 3I2JA 3T3YA 1C1LA 5C33A 1WCKA 2BWAA 3PU8A 2GSYA 2FZ2A 3TEWA 1SFNA 1VE0A 3MFAA 1MEC2 1RUC3 2WO2A 3NNJA 2J1VA 3AYDA 3B9IA 4CE8A 1GP5A 2GH2A 2VGDA 4UFHA 4YZ5A 2J1EA 3LF7A 5FLIA 5FO8B 3LE0A 1AXZA 1W6OA 1ZX5A 4DINB 2E9QA 3NAPA 1RUJ1 1W6PB 5FP3A 4BHPA 2BFUS 1SG3A 1OVSA 5FZ4A 3T0AA 1C57A 2XOMA 1F9KA 3N7MA 4WM7B 5FCCA 3WXPA 1S0GA 2Y6JA 4NWVA 1ZRFA 3KQRA 3WD5A 4L8QA 5CB7A 3U1XA 1Q8VA 1LOGA 2KA3A 1W8UA 2HWE1 4EWAA 1PZ9A 1WBLA 3B3QE 2XLFA 3LD8A 4HKOA 4W4ZA 1I3HA 3VB9A 5HV0A 5LWBA 1PIV2 3J9SA 4TXWA 1WWYA 1GSLA 3W9AA 4K1YA 1VRH3 2GMPA 2IXCA 4P9YA 4F7ZA 1LULA 4QPGB 4AQ2A 5ACA3 1UOJA 4XHXA 4JC1A 2VZTA 4XDPA 2RG4A 2VUAA 1ENSA 5IVBA 1QKQA 5K8SA 3AP5A 4XJUA 2Y6GA 2QJVA 5FZ3A 4O61A 4XIKA 2D5HA 3LEKA 1Z78A 4LEJA 3PMSA 4D3WA 1S0EA 1XBFA 2HWC1 3ZR6A 1K12A 3N9LA 4TWTA 3NVCA 1VBB2 5FYZA 1RUG3 5F3IA 4ZS2A 3ZOIA 1WW5A 1OUSA 1POV3 5JPNB 2CDOA 4K3UA 3OY8A 1PGL1 4EQVA 2GDFA 4CUAA 1FV2A 1VBA1 2VXRA 5A6YA 5C3QA 3M8LA 4ZPIA 3HQXA 3I54A 2WNVC 1UD1A 2O8OA 4Z07A 3SCHA 1S55A 4I02A 5B4XA 1VIWB 3DYMA 1AR91 4AG4A 4FOWA 4CP9A 1NY72 4LO8A 1GOGA 3U4SA 3HBKA 5DUVA 3AL5A 4DNYA 2BBAA 4N9IA 2VZVA 2C4XA 4XOGA 3H0OA 2RS12 2C9KA 5FZ6A 2CWSA 1K3IA 2CL2A 2PAEA 5FY4A 2WWJA 1PX4A 5DQ0A 2ILMA 2XPJA 3M70A 1RMU2 1DG6A 2QQNA 3PDQA 2E6VA 2WSUA 4PIXA 5A32A 4CDQB 4C0BA 1Y7BA 1PMIA 3DXTA 3NWKA 5FPAA 1WW7A 5GZGA 1RUE2 5EP9A 5IK5A 4A3XA 3I2KA 1OD5A 1LOAA 4YG3A 5FDBA 5FPLA 2XB6C 1D4M3 4IGQA 4QX0A 1V9U2 5DDJ2 1UYZA 2G1MA 1XE0A 2ZBJA 1VBE3 1PZ7A 2W2IA 1YEWA 3IBMA 1XSQA 4I30A 3IAQA 5DAXA 4NOTA 4OI1A 5LEJA 3VLBB 1EP0A 4OHZA 5C7GA 2NP0A 3VD3A 3S57A 5FJKA 2X29A 2CAUA 4JHTA 4QHOA 3ZR5A 3VZLA 2G9GA 3P6BA 1QJY1 2BNNA 4UW3A 4LKSA 4W8JA 1UKRA 4GXLA 4COUA 1JZ2A 2HWF2 1QF3A 4CZSA 1RVF1 1R081 1AR72 3MW2A 5A3TA 4NHKA 1POV0 1WD3A 3K2OA 5EHDA 4CSWA 4LBLA 4YSFA 1HN0A 1S2EA 2AEZA 1H8TA 4K9SA 3DV8A 4YW2A 1WCSA 3K48A 1JOJA 3LZZA 1N1TA 3INAA 1YYNA 4YG0A 1O3QA 3OCPA 1RUC2 1Q8QA 5GKAC 4DUXA 5K0UC 5LY1A 5A6ZA 1RYYA 1BLZA 1CPNA 2E53A 2P3IA 2BU9A 1DU3D 3WCRA 1YLLA 2D97A 3NAPB 4H2AA 3FC0A 1WMEA 5HXVA 5LEKA 1GLHA 1UZ0A 1W0OA 2JICA 3KT1A 2J1AA 4XJAA 5AFEA 5J1XA 1MZ5A 5L7OC 4Q2FA 1HB2A 3LGRA 5A6QA 4AF9A 2RS33 4QX7A 3S7EA 5FYUA 1GP4A 1EV11 1W8WA 3FBMA 4RGAA 2WKKA 5FP7A 4C91A 2NMOA 2EIBA 4M3CA 4SLIA 3USUA 3J26N 2IZWA 2PHTA 2W3JA 4AGGA 2X5IC 3ZYIB 1QXPA 3E6BA 1VRH2 4LORA 3WDVA 2P2KA 1X9PA 5IHRA 5ACA2 1UN1A 3AZWA 3POGA 1NA1A 3ATGA 3JCIA 2X05A 2R043 2D6LX 3M7AA 4C8DA 4IQPA 2RR13 3AMNA 4MUVA 3OBAA 2CY6A 1F5JA 2D3SA 3KB5A 4RGGA 4AVBA 2DTYA 2I74A 3I3BA 4AK3A 1T6GC 4ZU4A 1ZZCA 4AGRA 4CTEA 1RUG2 2Y0IA 3K3OA 1IQDC 2YU1A 3CBNA 5EZWA 1AR62 4MOAA 2B39A 2VW0A 3OY8B 2RMU2 1LHNA 1OF4A 4HT1T 3KVAA 3TAYA 4BCUA 4GALA 4AE2A 3KHBA 4HKWA 3KMHA 1HRI2 4TYSA 5FYCA 2OIIA 4A7YA 2PHRA 3TOJA 1NAEA 4IEZA 1RJ7A 4HSJA 1H8TC 4ZU5A 5FZGA 2BEOA 3RYPA 4UF0A 3VDDA 5FZ9A 2BOJA 4CP9B 1SFYA 1S0BA 5JI9A 4FTEA 3WF4A 4HPKA 3FLRA 4Q0PA 1F35A 3G6JB 3VBFA 4AFBA 4EE2A 5L7OB 1ZBE2 4CXWA 5CAZA 3GHNA 1HJFA 2PLV2 3KWVA 3B00A 4P9IA 3WG1A 1PO13 2ERFA 4KI5M 4C0HA 2HJIA 5CISA 2B9UA 2W08A 4G3YC 1YRZA 2WT2A 4UW6A 4A41A 3P5BA 1WLCA 2OX0A 4OHVA 5B2GB 3I2IA 3OF1A 4AGVA 2C1FA 3T1MA 1D7PM 2J1SA 1KITA 4Q27A 1QJU1 1QJX1 4X6RB 1W06A 3WNXA 1D4M2 4I3GA 5ANQA 1DLLA 4B1LA 2A3XA 4HN0A 1JYVA 3VDBA 3MGUA 2PHXA 1VBE2 2VAUA 2HWB1 3ES4A 5ERLA 5FUIA 2R063 1ASJ1 4A6SA 3RMYA 1BEV1 1WCQA 4A44A 1QXJA 1X8EA 4JTOA 3F2ZA 4MXVA 4AI1A 2P3JA 3ZYGA 1L7RA 2D40A 2D93A 4YZ4A 3LB9A 3UNPA 2VTXJ 5KXBA 1XNKA 4FAGA 1V6JA 3UESA 2DYCA 2A70A 2ORZA 4JCKA 2VQ0A 1UX6A 3Q8EA 5JUVA 1QQP3 5IW0A 5F2WA 3HN1A 3JBG3 3AFKA 5LK7B 3AYCA 4BK5A 3ZSEA 5FTTC 4Q0QA 4RHV1 1H8TB 3M3OA 1AYN1 3HNBM 2XR4A 4OHYA 3AKSA 3JD73 5I0TA 1JN2P 1FMD3 2EICA 5F6LB 3WNNA 1JH5A 3VZOA 4XEZA 2FCUA 1TMF3 1UZYA 4XHBA 4BQ1A 3HNMA 2WT0A 1JYIA 4AI2A 3GJBA 2XXZA 2VR4A 2ZOEB 5JPMB 3RI9A 4HVQA 1F15A 5HCFA 3ROUA 3LKJA 2XJUA 3AMQA 1NLQA 2QE3A 3OGSA 4FOVA 1MEC1 1UMIA 3LIHA 4G4FA 4JQTA 4QU1A 5I0SA 1DQ5A 5IVFA 1W99A 2XMLA 2ARCA 4M3CB 4MGQA 2OXBA 3USUB 3R05A 3WNKA 5I0DA 1O3SA 4XQWA 1JZ7A 2BDRA 4IE6A 3ZYRA 2VE1A 4WVZA 4S2GA 5FY1A 1CWPA 3VBUA 3NQHA 4AVSA 2LUWA 4YGBA 1TVGA 2Y0OA 1LOFC 1QXRA 4YW1A 1G86A 1NA1B 4YYOA 1JYCA 2BQPA 5JXIA 1KDMA 4H55A 4K20A 5A7OA 1OFSA 5AVAA 2WO1A 4N9HA 1VMFA 2R042 1G9DA 3OBZA 4GA9A 1O3RA 1YFYA 1JHJA 1UIKA 4AW7A 5KXEA 1NCRA 1PIV1 3ORJA 1QH7A 3ZKYA 4BPZA 4INDA 1BJQA 1L3JA 1RUF3 1B35C 2VMIA 1RGSA 3J4UH 3VV1A 1FV3A 1RUI1 1N47A 2R073 3L2HA 5C8CA 2GNMA 5JZGA 1UMZA 4LBQA 2WAOA 4JVAA 4CU8A 4U36A 2J1RA 1FAYA 1R092 1H6XA 3BYWA 3GALA 2D7FA 4YPJA 3O1SA 3TBDA 4ZONA 2JDMA 1VBD3 3U0ZA 1J3RA 2G19A 3I4IA 2XKPA 5F5CA 4UF0B 1GV9A 4BLIA 2W87A 3NSTA 3ZXEA 4XVHA 2VUDA 2Y33A 3AKQA 3WINE 4HPKB 4GIQA 1DGRN 2BFUL 4ZXKA 3VBFB 4UFLA 3W5MA 1J58A 2R1BA 4NMIA 3AMPA 3E6DA 4UFMA 1YIFA 4Q0VA 2O1QA 4XPVA 1PO12 3WQ1A 5L73A 3SH5A 3LA2A 4MGZE 5IVVA 1AVBA 4WM8C 2VQTA 3H8XA 4TN7A 3VZJA 1Z7S3 4XXAA 3NJYA 3D5OA 4LHNA 4CDUA 5L9VA 3HQRA 4GMP1 3PVOA 1TNRA 2QQWA 1AX0A 3ILFA 5CFDC 2W39A 3ZN4A 3VBUC 1RUNA 1SMVA 1W8ZA 1OUXA 2Y6FA 4E2SA 5HV4A 4LNVA 4OZXA 3Q8BA 4BXFA 3SH3A 4DXSA 1CX4A 5FY7A 4HZFA 2VMEA 1RMU1 3MO4A 4QWNA 1BVP1 4D0QA 2FCTA 5LA1A 2E7QA 4AAPA 2WS93 5I8SA 5FXWA 5BNOA 4DS0A 4BZ4A 1OLME 1GZ9A 4KMQA 3K3NA 3U11A 3U4XA 1V9U1 4LIVA 4P9XA 5DDJ1 2PAKA 4E8DA 3KSCA 3U78A 1IHMA 4Q4W3 1CESA 3CLPA 4KWUA 1QQP2 4ZY9A 4DMIA 2BW8A 4DRVA 5JZGC 1FYUA 2ZGOA 3FBYA 1SCRA 2LM3A 3QCWA 1I6XA 3JD72 4QKNA 2YGLA 2BRTA 2VUCA 1H6YA 4LR4A 2HWF1 5E1RA 5FO9B 5JOXA 5I8YA 2XBO1 1KEXA 3BKZA 1JUIA 1KGYA 2VO5A 1UYPA 4B7KA 4QX3A 4DXZA 1CAVA 4XDOA 5E6HA 1EAH3 1TQ5A 4UOJA 1NLSA 2YU2A 3LPFA 4FBFA 2A1XA 1OT5A 1RUC1 3PHMA 2G9FA 1GWKA 2ZGKA 5FUNA 2QVSB 3ZXGA 1DQ6A 3VBUB 2GNTA 4OI2A 4NIHA 2VZ1A 1ALYA 1GANA 2GP3A 2JG9C 2NN8A 2JE9A 4LUMA 3FUOA 1IPKA 4CDUC 1V6IA 4IEOA 2EXKA 2BGCA 1WLWA 2ZEYA 4J6GA 2NZ9A 3E1F1 5A6XA 1NCRB 2BUKA 4FP3A 1DQ4A 1R64A 1JI6A 1U0AA 3H1WA 4GJYA 5HCHA 4NIDA 3BCWA 5FZHA 3HMYA 2VW1A 3KVBA 1RL3A 4WZFA 1RHI2 1VRH1 4BWOA 4CCEA 4CP2A 5C8CB 5JZGB 2TBVA 1RUF2 1H2MA 1XNAA 5ACA1 3QD6A 5J98B 1CAXA 1VPHA 4BIOA 4B1MA 2R072 1JZ6A 5FR3A 1RUD3 3ZSMA 4FFFA 3THTA 2J7MA 3POYA 1SLBA 3B94A 4FO9A 1DYPA 1VBD2 4LULA 3IN9A 4Y4YA 4AI9A 2R0HA 3IAPA 1QU0A 4FPFA 1UYXA 1GOFA 4HXCA 1WD4A 2B5HA 2JDUA 3AVSA 4CU7A 1RUG1 2ZCWA 4AI8A 3PL0A 1JU4A 2Q4SA 2PN5A 1JU3A 2YHJA 3M3CA 3N3HA 3KLSA 5LY2A 1BHGA 4NHLA 4K8RB 1POV1 4R52A 3OTFA 4I3PA 1S4CA 4K40A 1W9SA 5F1RA 4S2DA 3LEIA 3S30A 2QUOA 1DZRA 4MLOA 5FZCA 1VBC3 4MH0E 2PFWA 1WCDJ 3T4HB 2JG9B 3AB0A 3LDRA 1UY3A 5F7UA 3ABZA 3C3VA 5ABJA 5A3UA 1XU2A 4CDUB 3KGLA 4FPCA 1FPN3 4AFMA 4EJRA 1IG0A 5IK7A 2WNEA 4QB1A 1BBT3 1OLMA 2ZACA 4AVVA 3GCXA 4MHRA 4UXAA 1VAVA 4NHYA 5HCBA 1DBNA 4DOUA 3ZFGC 3LAGA 2W9XA 3FWEA 2WFPA 4O65A 2OUHA 2BVVA 3LSEA 3MUZ1 5FK8A 3LA7A 4D8MA 4YVWA 4JKMA 1UL9A 4JKLA 1S0FA 1E5HA 2RVAA 4XMIA 4Z2AA 4LPLA 4QX5A 5E16A 4XTPA 1AX1A 5AFBA 2F4LA 4CCNA 2BYVE 4PF1A 4XUNA 2VZRA 3IIIA 4PLNA 1YIPA 1H4HA 1NG0A 1D4M1 2NQYA 5FWEA 5FY9A 4XFAA 2JXAA 3R4UA 4FPKA 1VBE1 2ZGRA 3SHRA 3ACFA 1YNAA 4QKBA 5B4NA 4IXLA 4QD2A 3ZKUA 1HRV2 5T5PA 2GH8A 3RVHA 4B4RA 4H14A 4GWNA 3I3DA 2Q8EA 4XCAA 2GMEA 4XF3A 1EPZA 4QKFA 1KFUL 1AL22 1XYPA 2W94A 3UKTA 2YBKA 4FPLA 4MSVA 4W6WA 4LO4B 2MEV2 1ZZ8A 2VOTA 3T2QA 1D0HA 2ET7A 2ORXA 2XJRA 3RWKX 4OYUA 4WM7A 5FPZA 1CAUA 5DMYA 4LMFA 4MADA 4BB3A 1W2AX 4M01A 2VCBA 1ZA4A 2D6OX 4Y5SA 3C7OA 5FZLA 3ILNA 4LO5B 1EAH2 2EXHA 5FYBA 2PYTA 4PDWA 1RUH3 3QH7A 4QX8A 3MV01 4TLGA 4YVSA 5FO7B 5HPOA 1V6KA 4NIGA 2PELA 2FDJA 2RDNA 3L9JT 1AR83 3OGJA 4YW4A 2YBPA 4W50A 2UURA 3L2YA 1SACA 2AZ5A 2N7GA 2VCAA 1DGLA 5F2SA 1LRHA 2VCCA 2WAAA 3H3LA 4J25A 1EUUA 4P9WA 4JGYC 4DQAA 5IFTA 1F8VA 4GB32 1VMJA 1ND3C 3SEPA 1V6MA 1W0NA 3MI8A 2CV6A 4O9EA 1HV0A 5HCAA 3B5LB 1KXGA 1VBB3 3HEIA 3OG2A 2WLQA 2RS31 4G9SB 2EXIA 1LKNA 2J22A 2UWAA 1RB8G 2C5DA 2O14A 3GBGA 2W0XA 4FPJA 4FFIA 4UFJA 4Y33A 3WP3A 1W9FA 2Z69A 3IPVA 4XAEA 3KF5A 3GHMA 4MYEA 4WV8A 1IGOA 3U75A 1OKOA 3WVJA 1NKGA 3AFGA 3A23A 4E9KA 5A1AA 3BOPA 1KDKA 5F3GA 4XQDA 5APAA 1SZBA 2R041 4LJHA 5E8AA 2D5FA 4N43A 4Q1RA 3QOPA 5GLTA 3W20A 2RR11 5I91A 4M00A 1U5YA 2J1TA 4JQRA 3LDBA 4AVCA 3WF3A 1XC6A 4Y22A 3VHOA 2RM23 2RS13 5FQ0A 4YW5A 1JUHA 1GUIA 5CFCA 1CIWA 1PNGA 2IXIA 3RPQA 1F4HA 2Y8KA 5F39A 3O1MA 2YC4A 2ZX3A 3M4FA 5IT6A 3KCYA 3M2MA 1Q8SA 3J7NA 2D43A 2TEPA 2BP6A 3K4DA 3KT4A 1MZFA 1UKGA 2C24A 1H0BA 2ZX2A 2V09A 3JZVA 5C8WA 4OUEA 4CCOA 1RUE3 3KCXA 3O7OA 2DWRA 4JGYB 2BOIA 2PA7A 3OOXA 4AQTA 3V64A 5ABJB 3ES1A 2D3PA 4PDWC 3VUOA 3ZYPA 1W28A 3KV9A 1IKPA 5LBEA 5DG1A 4RQPC 1I5ZA 3ST7A 3C2UA 3UGFA 5C5TA 1PO11 3AJZA 3WG3A 5CG9A 3OB8A 1XU1A 4XFIA 2DCKA 1DIWA 5A7WA 3DECA 2Y60A 4YVWB 5LCWL 2QQUA 2B7YA 1G9FA 3LPGA 4XFFA 1Q43A 1W9TA 5AC93 3V65A 1AR73 1W3XA 3AYAA 4Q0SA 5BNNA 5I8TA 2NM1A 2UY9A 4CEWC 1WLDA 3SITA 2ZAHA 2WNVA 1QY4A 4CUGA 5LRRA 1CZSA 2QZ3A 5GZDA 4IV3C 3BGAA 3FLPA 2OPKA 3POWA 1LGBA 3C7HA 3W59A 5LZ6A 1MS4A 2D6MA 3ACGA 1GQHA 1O4YA 2R061 4YGDA 1LNSA 3VHPA 4N43C 1CAWA 2VXJA 4Y1XA 3AMHA 3WQ0A 3CO2A 1L7LA 4Y1VA 1TME2 3B01A 3IM0A 5KHGA 3D0SA 1CZTA 1OKQA 4QGNA 3R0RA 2RDSA 2H6CA 4XURA 2IWGB 5FYMA 1CR7A 1QQP1 1CAUB 2WA4A 2GAUA 2IC1A 2VNGA 2ZGPA 3JBG1 1PVC2 2OA2A 4QU2A 3RWNA 5CFCC 5IVCA 5JSPA 1T6BX 1JYWA 3ZXJA 1TNFA 5DZFA 2VQAA 3N7KA 4B29A 1NLRA 3T08A 2DBNA 3G7DA 2QQMA 3JD71 4PDWB 5FXXA 4YVSB 3PJQA 1FMD1 5LA2A 3BN6A 1U12A 3P3NA 1OD3A 1TMF1 1RUH2 4A7KA 2QNKA 3T4VA 2GNBA 1AR82 1SLAA 3NMBA 2ZGUA 1OF3A 2PQQA 4FPOB 2H6BA 5L9RA 3N4MA 1JHNA 4FQ4A 1YQ8A 1COV2 2GC3A 4D6RA 4DFSA 1D4VB 1PGW1 1GQGA 3HD8B 4IL7A 5A7NA 3WQ7A 3PVNA 2Y26A 2YBSA 4NN0A 3GZAA 4K7JA 3ZXFA 2J1UA 3WW2A 5HBAA 2GN3A 2XL9A 3ASIA 4CEWB 4IESA 1AR63 1CN1A 1GQPA 2LROA 4QDSA 5FUPA 3FZ3A 4QQOA 2RMU3 2Z5WA 4OUMA 5FFOC 2QQOA 3MIHA 3IPVB 5EJ3A 3Q9OA 1MS5A 3QH6A 2ZTNA 1POQA 4L97A 4PI2A 3O1RA 4IV3B 1F31A 4DRRA 1JXNA 1HRI3 5CKNA 1R1ZA 5BNNC 4WZCA 2PMWB 1RXGA 3IDCB 4X8NA 4B3NA 5JWPA 1MVQA 2GC2A 4N43B 5K0UA 3RZMA 2WIIB 4GWMA 4META 5EV7A 1HXS2 2W5FA 3OEBA 3KGZA 5FZAA 1AHSA 4Z92B 3MF9A 4BYYA 3RZHA 3ITQA 4FTSA 2IXJA 1ZBE3 2W1WA 3I3EA 1BZWA 2AREA 2PLV3 1RUF1 1UYYA 4Y22B 5FJHA 5FQ0B 5L7OA 2V4VA 5CFCB 4CPBD 1GICA 1LENA 4JRLA 3E5QA 2R071 4LO7A 5A3NA 1HX6A 2RM22 5BUVA 2WO3A 3B02A 3GF6A 5F5AA 1EPWA 4E8CA 2V73A 3T1LA 4P9GA 3R6SA 1ZZ9A 2XJPA 2Y6LA 2YC2A 5I0UA 2X5IA 5JLVA 1VBD1 4ZZ5A 1BKZA 5LA0A 5A33A 2GC1A 4Y5TA 4AFDA 3VD9A 5KXDA 1Q8OA 1SPPA 3VDCA 3PTRB 3CL1A 4PQQA 1KJRA 5GALA 1ZRCA 1LEMA 4QGLA 5FMOS 2IVJA 3X29B 2BPA2 1ENRA 2AACA 3NV4A 1JW6A 2X10A 3KZ4C 2HWD3 3RNSA 1QJEA 2MHFA 4LK7A 4J1XA 5A7WB 4JGZA 3T0DA 1YQ6A 4YM0A 3BODA 4AEKA 4Q4X3 4UT5A 4QB2A 4CCCA 5DAQA 1YCIA 5BNNB 1Z7S1 5IK4A 5J7MA 5AC92 5G05L 2WNVB 4I0WB 3VKLA 1C8NA 5IYYA 1AJOA 4MHUA 4C1XA 3CEWA 4QQLA 1HN1A 2JE8A 3O1VA 4IEYA 3D82A 1MS3A 3JQWA 1X33A 1AJKA 1LHVA 2AGSA 3UT0A 5C70A 2QFEA 4JKKA 1NX9A 1BCXA 1J83A 1CAWB 3BVCA 3SISA 5FZEA 4D7TA 2WS91 1AXKA 3I7DA 4A4AA 2ZMLA 1SBEA 3ZN6A 4MGKE 4ARYA 5TSWA 1YFUA 2WWSA 2DVGA 3AL6A 3PVEA 4OFGA 1AYM2 4IEWA 4Q4W1 3IWZA 1A8DA 1LB2A 3O0VA 4IV1C 1GWLA 4FSJA 4QXBA 2A73B 1ULOA 3PIGA 2FDIA 5C3PA 3H3UA 4LLFA 3H7JA 3PU3A 4AAXA 2V4AA 4ZZ8A 3V56A 2C26A 4IEPA 4LQRA 3S5QA 5KR7A 2DCJA 4AHWA 3VKOA 3PURA 2YC0A 1XJAA 4BMEA 4JZRA 1QOSA 4QM8A 3T30A 3J7LA 4Q26A 2UYBA 4ISRA 1OXCA 4FT8A 1DGRA 2C6SA 4J1WA 2V5YA 2RDQA 4QT6A 2PXJA 1FOD3 2ETEA 3ZMOA 1HB4A 2DCTA 4H3WA 5BXXA 4EV0A 1UXZA 4LKDA 2HKXA 5FZOA 1EAH1 2VCMA 2ZX1A 4A7ZA 1GU3A 1IS4A 2LTNA 2ES3A 4JGZC 1IS3A 3H9AA 3C7EA 1R093 3WV6A 4NROA 3ZX7A 3ZO0B 5J48A 5DAWA 1K45A 4FP2A 3WQBA 4EWDA 2IFRA 5K0UB 4WVMA 5LRSA 4QX1A 1O91A 4OCTA 4XIOA 1CJDA 4K6BA 4UBGA 5FZKA 3N7LA 4P9JA 3VBRA 1WCUA 3FHQA 1SQ4A 4XC9A 1VAKA 4YLZA 4ARXA 1UOFA 4JDMA 1R1A2 5K9YA 2EIEA 3TEYA 2VBBA 5FZ1A 5M0TA 1RITA 1VMHA 1WBFA 3UGGA 2JE7A 3K51A 4D7YA 3CMGA 4YZ2A 4UW5A 3TRSB 2E7AA 1VLNA 1RUD1 4HETA 3S6PA 2X5IB 3I59B 4L11A 2FDGA 2JDYA 2A5ZA 4QX2A 4UFIA 5CKMA 5T5LA 3KM5A 5A33B 1LOFA 1MQTA 3ETPA 2W1QA 4M4RA 1SPPB 1N3OA 1S2KA 3CU7A 2VL4A 2XWJB 2ZZQA 2ZHMA 4S2FA 1LHUA 2KM2A 2OZ6A 4FXGB 1SBDA 5EYXA 2WL1A 2WSVA 2ZHLA 1OA3A 1H8VA 4HK8A 1MZEA 4MGIE 4P00B 5FZ8A 2BNMA 2DUOA 5JXJA 3DEMA 3MIBA 2VZQA 4YG6A 4JGZB 3E5UA 1B35A 3FL7A 1UAIA 2D6PA 2WR9A 4PT6A 2HWD2 4NHMA 2BGOA 1GKBA 5C6CA 2P37A 1VBC1 4DB5A 5LK5A 1DCSA 2ARBA 2HEWF 3AP9A 1S0CA 2PHUA 4Q4X2 1TZOA 1YQ5A 3P3PA 1N1YA 4CCKA 1FPN1 1DF0A 1O8PA 5CVRA 3QBQA 4YW6A 5KBFA 3H1YA 3M3QA 3WW4A 1YFXA 5IVEA 1BBT1 1HB3A 1UY0A 4ASLA 3HWJA 3UGHA 5C3RA 2ZXQA 4Z1VA 1Z0HA 4Q4V2 1UPSA 2PHDA 5LASA 1CX1A 4D94A 4QHBA 4KNCA 3K77A 1FNYA 1O3TA 3ZN6B 1OH4A 3VD4A 4P08A 1GP6A 5EYYA 1A6CA 2VQUA 2IFWA 2R1DA 3JQXA 4Y20A 2H0BA 3RMXA 3VBRC 5GLZA 1DDLA 3AP4A 4BMBA 5FKCA 4WM8A 2R7EB 1N3QA 3MHZA 3AK0A 1ODMA 5FLJA 1SLLA 4BQ3A 4IEQA 1LHOA 4RSUA 3RZLA 2VTFA 5JSRA 4RA0A 2A7AA 2WYFA 3D4KA 5CFDA 2A6ZA 3KCCA 4R9AA 4D6QA 1MQTC 2VBPA 4GULA 1LEDA 4LKFA 4NRMA 5CYYA 5I0RA 3SKJE 5L36A 1OH3A 1UWWA 2VM9A 4HVOA 4HVRA 3JB4C 1SHWB 3WF2A 1HJGA 1LOBA 4Q0UA 1XQNA 4JRAA 2I07B 3USSA 4CDXA 3ZXDA 4DY3A 2BVBA 2DDUA 2Q30A 1FOD2 3MDPA 5FZOB 4FPEA 3ZPYA 1YQ2A 5C4WC 4OZOA 1RHI3 4N8MA 2K9ZA 4H7LA 3S0MA 2AR6A 2E7TA 5T50A 4U2AA 1RUH1 3AZVA 2VULA 3N9NA 3CZUA 1AR81 3VD5A 3UYJA 4DUWA 2ZJCA 2P34A 1H1MA 4LE4A 3K4ZA 4XJWA 3WDUA 2VJXA 5GZFA 4COZA 1HDKA 4OLLA 1HB1A 1JTZX 1YO8A 1UO9A 5AVPA 1UX7A 4WVMB 1G9BA 1BK0A 1VBB1 2IVIB 3MLJA 4UWDA 1LU1A 4AEJA 3DYOA 4NAOA 3BU7A 4AFAA 4B7EA 4COWA 3ZYHA 4EZHA 3VBRB 5FPXA 1E5IA 4M3CF 2GP5A 4Y5Z0 5T3NA 2Q8CA 3WDWA 5JOYA 3H8RA 3WOGA 3HQUA 4XYXA 1M06G 4GJZA 2P3YA 4BQXA 4M0NA 3NKGA 5DG2A 5FYTA 3C7FA 4CU9A 4BQ4A 1W3VA 1RTVA 1Y43B 5FY0A 2OQ6A 3VBSA 1W2NA 2YYOA 1C5IA 1TE1B 3D6EA 1O59A 3BUCA 1PK6A 4LK6A 3SNMA 4BM8A 1WW6A 1Q3EA 1ULCA 1MQTB 2Y6HA 1TG7A 4YNIA 2JG9A 2XVKA 1J3PA 1NY71 4V2WA 2G4IA 3WF0A 5A7PA 4CEYC 1XNCA 1SLCA 3B7MA 3TN92 3DYPA 2VECA 1JZ4A 2WN2A 3BOWA 3DN7A 3EB7A 1OBNA 2RM21 5JMCA 2RS11 5JMOA 2FDKA 2Z2SB 5D2AA 5FMBA 3VBHC 2TUNA 5C4WB 2C0ZA 3R4DB 5FY5A 4OMCA 1B35B 5LBFA 2R32A 2XJQA 2VU9A 4XF0A 1ND2C 1H2KA 2EF6A 3D0JA 4CDXC 4Q29A 4AYUA 1RUE1 4WVWA 1GZWA 2DURA 1W04A 2DCZA 2I2SA 3ZFEC 1GNHA 1C5HA 1ULPA 4W65A 3HIFA 1W6NA 1ZRRA 3IDBB 3AP6A 1V6NA 3ZYBA 2B4KA 1JZ8A 4NVPA 1N3PA 4N90A 4IERA 1LODA 3ZFFA 3TNPB 5C9AA 3THCA 1HRV3 1KJLA 1PZ8A 1XNTA 3I2DA 3Q8FA 3PTYA 1C1FA 3MF6A 1AL23 1UZWA 3VN4A 1ZA7A 4BA6A 2UYAA 2FHRA 1RUOA 1C3HA 2MEV3 1QH6A 1W05A 4QGMA 2WQZC 4XJ9A 1W03A 1NCQA 5AC91 1QIQA 3NJZA 3V0BA 4Y20B 3I2OA 1AR71 3E6CC 4JAAA 4NAMA 1RUJ2 4N7UA 4LA2A 5F3EA 3ZMNA 4NIAA 4BQYA 3KF3A 2ZEWA 4WM8B 4AHZA 5T5JA 5EQUA 4TTGA 3SH4A 1W0PA 3NNGA 2W92A 1DHKB 1YJKA 4XBNA 5FZ7A 3VBSC 4CEYB 1GWMA 2HWE2 1PK6C 1H9PA 5EJ1B 4R4XA 4KU7A 5CFDB 1IG3A 1K42A 4OMDA 1JYXA 4GB33 1H2LA 4FFGA 3Q8CA 2G9ZA 2MPFA 1ZBA3 1MS0A 1XYOA 2HYKA 4XCBA 4YM1A 5DAVA 3ZFGA 4NHXA 2K46A 5CNAA 5A80A 3ON7A 4OVEA 3RZJA 1CQ9A 3VZMA 2A71A 1I9RA 1ND2B 4LO6B 4CDXB 1YJLA 5KHIA 3BIEA 2QCSB 2QBXA 1DP0A 2CYFA 2EAAA 3LEMA 3MICA 1O7FA 4QQHA 3ZFEB 2HWC2 4EN8B 2VMDA 2XL7A 3IDEA 1L7QA 1H1IA 2DVAA 4LKEA 3WLUA 3I2HA 2A3WA 4P02B 4Y1UA 1UU5A 2XGXA 2DV9A 2AC1A 3AMMA 1FXZA 1GNYA 3N35A 1SLIA 4FVVA 1UQXA 4L92A 1PGL2 1I1EA 1HQNA 3KV5A 4XILA 1ZZ6A 2W46A 3ZFFC 5C9AC 2P4EA 4P14A 1DQ1A 2GN7A 5K7PA 1Y9GA 5JI7A 5DZEA 4Q8KA 1CVNA 1IKQA 1AR61 1VRBA 1UU6A 1ZVFA 1AR92 1A3KA 2RMU1 5J3UA 4LHLA 1GFF2 5T52A 2VTXA 1ZM1A 3H42B 4QPIC 3VBSB 1NCQC 1G9AA 1HRI1 4LIUA 4YM3A 1PK6B 4YRDA 1YI7A 3EMRA 2QKDA 4PBOA 3TWIA 1HQWA 3FFZA 2W91A 2UU8A 1O5UA 5DZGA 1OSGA 2D6KA 3ME2A 3MIDA 2KR2A 4Y26A 3UJOA 1XRUA 4QPWA 3ZYJB 2ZABA 4CRQA 1BMV2 4JGYA 1C28A 1H4GA 1ND3A 5DUUA 3ETQA 2JB8A 1C8M3 4MGSA 1D2QA 5EPAA 1A8MA 1ZBE1 4KH9A 4AEMA 2PLV1 4DPNA 3NNLA 3BTYA 1V6OA 2WJSA 1K5MC 3SEEA 3VZKA 3IB3A 1VB4A 2NYYA 2OZJA 3CF6E 4R9DA 3HOBA 2E26A 1OQ1A 1NE6A 2ZGQA 3WNOA 2XUMA 1ZRDA 1DZQA 4EYUA 4URAA 2A6XA 1VALA 2AYHA 1GZWB 4RFRB 4X8PA 3LFMA 5KXCA 3EO6A 2Q0AA 1KS5A 2WZEA 2VOVA 2XKOA 3CZJA 4YW7A 4FCAA 1W6NB 2DUQA 1OLRA 1MS1A 3SKVA 2WABA 1OLQA 4XBLA 2X53S 2PHFA 4AQSA 5F3CA 2E51A 3ZFFB 1RVF2 2VZPA 1NOVA 4BK4A 3WCSA 3SQOA 1PM4A 5C9AB 1JZ5A 3O1OA 3ENRA 2JB4A 2F4PA 2HWD1 4CDWA 3HAGA 3H8OA 2HEVF 1XB9A 3PMEA 1TME3 3M1HA 4C90A 4OI4A 4BH9A 2ZX4A 4UFKA 2XHKA 3DCQA 3DKWA 1NCQB 4Q4X1 4COVA 5BNPA 3V0BB 4B4QA 5LATA 4CPBA 2QQVA 1LHWA 1PVC3 4HBNA 3ZLIA 2PQSA 2CHHA 4N7IA 3UJQA 4D69A 5IK8A 4UW4A 3IDAA 4XFCA 2CWMA 5DABA 3LDKA 1PVXA 1LJ7A 2GNDA 1Q5OA 4MX3A 3SLIA 3OUHA 4Z2WA 5F5IA 4CXYA 1KRIA 3T2PA 1RINA 4QXCA 2E31A 3KHCA 4LXLA 3PUQA 1SEFA 1CIYA 2EIDA 3CNAA 4R9CA 4RQPA 4XJZA 1F4AA 4AHXA 4E27A 1COV3 3OUJA 3U37A 4JDOA 2A6WA 3DXUA 4CVUA 1LECA 3ZFGB 2PHWA 5FYVA 4HOOA 5A3PA 2FDHA 1ZBA2 5FOJB 5F8PA 2E63A 2WUHA 2GC0A 3ZN5A 1LESA 4H7MA 1BQPA 2CGNA 1UPIA 1WA6X 2VMCA 4BISA 3K46A 1X36A 2YG0A 3DPRA 4HONA 5IFPA 4CEWA 1BK1A 4QPYA 3EXUA 2WZPP 1SDDB 4PJYA 2DF7A 2JG8A 2IUWA 4M0HA 4IV3A 2WQ4A 4N53C 4RR3C 1OI6A 3U07A 3N9PA 3VL8A 3U10A 2B8MA 3GXUA 4Q8LA 3IMNA 3GJAA 4NPRA 3WP5A 1HXS3 1YQCA 2CSGA 2OS2A 4DXRA 5F9TA 1BYHA 1FOD1 1W8FA 3MBWA 2CNAA 5FYYA 5H9RA 3SXWA 2WZR3 5FPUA 1UY4A 2R49A 4ONUA 1OPOA 3BU0A 3DUIA 2EA7A 2IXHA 4RGKA 4CDWC 5F37A 4AQ6A 3GZUC 4OQ8A 5DXDA 3ECQA 4KWKA 1PHMA 3WG4A 1R091 4GH4C 4PIZA 1IQAA 4XQ4A 5IVYA 1OA4A 2LS6A 3W58A 5BNPC 1ZREA 4RS5A 5FKBA 1RC6A 4E4SA 2HYXA 3WSOA 2AUYA 2RS53 2PAMA 5D21A 5ANNA 2DFBA 1WKYA 3OGRA 1O4ZA 4IEVA 4CUCA 5EXOA 1NQJA 2ARXA 3JB8A 2YV8A 3OJBA 3WUCA 2ZZJA 1KQRA 3J8F3 3SC7X 1ND3B 3LWCA 2Q8DA 4LHSA 2YUEA 4UYBA 1H30A 1OQDA 3MIEA 1C8M2 1W8TA 4PCRA 4P5YA 5EJZB 1QJX2 1GZTA 2XHNA 2ZMNA 5CEHA 1LOCA 4XUQA 3NKTA 5JR7B 5IAXA 3ACIA 4XMAA 3POEA 5CU1A 3BTAA 4XABA 3NL1A 3VHNA 1UF2C 4FQZA 3AC0A 2Z42A 1J1LA 2Y64A 4BE3A 2OVUA 1P8JA 1BEV2 3NJXA 4LOSA 4N53B 3AJYA 3AXDA 3DPRC 1LCLA 4ZKTB 3E97A 4CXXA 1OHFA 4IUGA 5GM0A 4ASKA 1M4WA 1AL0G 2Q1ZB 4C1WA 5A3OA 2OUJA 2ZHKA 1ULEA 3RZZA 3EYPA 2JG8C 3DL3A 4XDQA 5FWJA 3VKNA 1H1AA 1NZCA 2JKXA 3MYXA 4MGYE 3EBRA 4CDWB 1YWKA 4IE0A 1AYN2 2R6QA 3URFA 4IGPA 4XE9A 5L19A 4LBJA 4PF5A 4YARA 5FLHA 5GLVA 3QLQA 1YC61 5T5OA 5BNPB 4HANA 2ZGSA 1IS5A 4YZ3A 3T0BA 2KXLA 2LRPA 1AYM3 1QOOA 2MNGA 5LBBA 2H0VA 4ATEA 4E2GA 1UY1A 4ES9A 4Y3OA 4BLJA 2I45A 3IT8A 1RXFA 4AEDA 1ONAA 2DU1A 1YUDA 1PM7A 3OPZA 2LALA 2OW4A 1JYNA 3RZGA 3D3AA 4NRPA 4RS5C 5JVVA 2RV9A 3WHTA 3MLKA 1QWRA 4FOQA 4D7SA 3BB6A 4IEXA 1IS6A 5T54A 1JYTA 3RJ2X 2X09A 2Y34A 2ARAA 4RQPB 4YGEA 1GZCA 1GOHA 1DYOA 4AHYA 3FMGA 5JAXA 1MR5A 2FQPA 5FP9A 1ULFA 5CA6A 4GMP0 4ATFA 2WZ8A 3WUDA 2Q1FA 3AXEA 4CCLA 1GBGA 2W95A 3DPRB 3GZTB 5IAVA 2XQRA 3M3IA 2VVEA 4A2UA 2DVBA 2XONA 3ELNA 2VD7A 5KHKA 3J7MA 3NV1A 1AF9A 1ZNPA 3D8CA 5FIXA 2QZ2A 1XE7A 2JG8B 3WP4A 5JXHA 3MV11 3IIAA 1RUI2 2XG3A 1O6UA 2FCVA 4CDQC 4IW3A 4CYDA 2Q5TA 2WQ8A 4BDVB 3PIJA 4A45A 3WZ1A 3ZYFA 5CKQA 1SLTA 1LAJA 2GALA 5FMCA 1Y3TA 4AI0A 3OGVA 1LGCA 2DFCA 4M3CE 4UI9L 3ALQA 3K75B 4RL7A 1R1A3 2VZOA 2WZR2 1RHI1 1KD7A 4BJ0A 4XZUG 4ASMB 1KS4A 1VR3A 4WVVA 4IV1A 5FOBB 1UCXA 1CD3G 5JSOA 3K4AA 3O1UA 2R30A 4RS5B 3LSDA 1MACA 3ZSJA 2QQJA 3WDTA 1STMA 1SBFA 2ZA9A 4PQ9A 1HKDA 1LOEA 3I59A 4XETA 3VKFC 3H8UA 3VBOA 4RFT0 5EFUA 4AEDC 4XBQA 2RS52 3LCPA 1QNYA 1JMUB 4FFHA 4XUPA 4Y1ZA 3RG0A 1PMJX 1UOGA 3CQOA 3MIGA 1WZXA 1EY2A 1XNDA 4URTA 3WDYA 3J8F2 3S7IA 3Q8AA 1FI2A 2VOXA 3RS6A 4HKLA 4NE9A 4AR2A 1LTEA 1WGPA 5C3OA 3ZIWA 2VH9A 3NAPC 4XF1A 3H50A 5FRAA 1REDA 1K5JA 2JD4A 1S1AA 4XZPA 3AKPA 4CCMA 4F83A 1BMV1 1Q56A 3F95A 4IEUA 4KU8A 4XFBA 3A22A 5GZCA 1IZ3A 3DGTA 3JUUA 2ZGTA 2OYZA 2A3YA 5L9BA 1YI9A 4JX0A 5C71A 3OEAA 4Q4V3 3WF1A 2VVDA 3OPTA 2Y6KA 1UMHA 3FHIB 3TEZA 5DUXA 3PUHA 4Q1PA 5GJ6A 2JENA 3GBFA 3IKWA 2WNOA 1IPSA 5FXVA 5JR2A 2JX9A 4QMAA 1LU2A 2A6VA 4RYDA 4K21A 1W8OA 3BTZA 2P17A 4AFCA 2CGOA 1V70A 2RJ2A 1X50A 1NUKA 1REFA 3FN9A 3PUIA 2XBO2 3SCGA 4AEDB 5FZ0A 3LOIA 3LEGA 3FHAA 1N1VA 2VPVA 2ZPXA 3IZOA 1HRV1 4I0AA 2PTMA 5J37A 4HSLA 1HW5A 3MFCA 1FX5A 5JIUA 4NR1A 2XWBB 3CJIA 3AZXA 1AL21 2YB7A 3C8XA 3MLLA 5F5QA 5HI0A 3VBOC 2JJ6A 3B69A 2XJSA 2MEV1 5FREA 4DIQA 1PGSA 1W6OB 2WBKA 5CADA 1JOBA 3KD4A 4MZUA 2YMZA 1AX2A 4Q4Y3 1LR5A 1ACCA 4XFHA 1E57A 2QQLA 3A0KA 1ZRIA 5J09A 1PX3A 5IUQA 1D2SA 1VB2A 3WNLA 2FD8A 4CA9A 4MGTA 2V5DA 2BZDA 3P1IA 3RYKA 4AL9A 3POBA 1ZZBA 2A6YA 2C9AA 2JECA 2WFF3 1S0JA 4LBNA 1WMDA 3WNMA 4GB31 4FPYA 1ENQA 5LB6A 2VNVA 4KBBA 2IXLA 1ZBA1 5GLUA 3ACHA 3UKNA 4XTMA 3NW4A 4EZ4A 2AH2A 2K2SA 3AVRA 1XSRA 1AXYA 4MG2A 1QJFA 4GAZA 1WUVA 1ULGA 2XH6A 3O5SA 3O14A 1UZVA 3WT3A 3CKHA 4B4PA 4CP1A 4IV1B 1NXMA 1U5XA 2TNFA 5KHHA 3LA3A 3O1TA 2VBDA 2XJTA 3R4SA 4QKDA 4BIFA 3ZIXA 2E32A 2VMFA 4LLOA 1URXA 3AYEA 3VBOB 5CZKA 3HN3A 3TN93 3AZZA 3ZXLA 1APNA 3OBTA 2WINB 1I5PA 2W1SA 5DPNA 5A7QA 2XVGA 3AM2A 2ZEZA 4V2VA 1PO23 3PUAA 1ULDA 5FXZA 1OA2A 1RIRA 3CJIC 3NV2A 4NPLA 3MIFA 5ISLA 2Q1MA 2WN3A 3JU9A 4W6XA 4YFWA 3WHUA 3A21A 3BTXA 5C4WA 3RI8A 3ZSLA 3TB0A 2YDEA 1WMXA 4K8FA 3HJRA 1QJZA 2GZWA 2RDRA 5FAXA 3ZXKA 4DEVA 4F8AA 3FJSA 2D44A 5D1IA 5C3SA 2F6BA 4I01A 4CUBA 2BV4A 4X6QB 5A32B 4S2HA 2WRAA 2XUEA 4IE5A 1BXHA 4OHWA 2JIJA 4IE4A 1C8M1 2P6HA 2P3KA 2GMMA 3N9OA 4ITCA 1W6MA 4EN7B 3ZVXA 1XXNA 4IGOA 4LUKA 1ODNA 2VG9A 1S0DA 2Y38A 5KC6A 3CIHA 4LHKA 5FBJA 1UW8A 2BNOA 1NA1C 2QQPA 2ZGLA 3DKQA 4BQ5A 2RE9A 3OBRA 4DO0A 2WC2A 1UIJA 3NO8A 2ZAAA 4CCJA 4IDZA 1RUJ3 3MPPG 3T2OA 2WT1A 2DCYA 3WX5A 5EIYB 1A34A 5LBCA 4DEQA 5JDBA 3LOBA 4SBVA 5JXGA 4PLMA 3AKTA 1GYKA 4XFGA 2HWE3 4CEYA 2OKXA 2W68A 5BPXA 2FMDA 4DY5A 4YW3A 3VL9A 4LT5A 1FATA 3CJIB 3UK9A 1HQLA 2WDBA 1TME1 3PJYA 1DZTA 4HG6B 4KGQA 3TEXA 3V0AA 2Q8OA 4KG0A 3VBHA 2XLAA 2W1UA 2K0GA 4L2NA 4PIYA 3VKMA 2BJSA 3VDDC 4Y24A 4FPGA 3I3QA 5J36A 1PVC1 2A75A 5H9QA 1CGPA 1ND2A 3MEPA 2HWC3 2W47A 4P5HA 3NV3A 2J42A 3OUIA 3VBFC 2OT7A 4E4HA 1Y9MA 2VOWA 4Q4Y2 3ZFEA 4CU6A 4HMZA 1W9YA 4L9BA 4OUSA 2DTWA 1A78A 4FOYA 2RS32 3GYDA 4Z8BA 1CONA 3WW1A 3OD0A 5CBLA 3CHXA 3ACLA 4OULA 1GNZA 4YGCA 1J59A 4GZ9A 1COV1 4PBPA 2QDRA 2WFF2 1OMIA 1Q8PA 1VBA3 5D8AA 1MPXA 4CCDA 1C4RA 4OI0A 2XJVA 4LBOA 2D3RA 1UXXX 2JDAA 2YGMA 1RJ8A 3TNQA 1YFWA 4BU2A 5A7SA 1NZIA 2VUJA 4BQ2A 1JBCA 3EHKA 3RQ0A 3RYRA 5JCTA 4R9BA 4RN5A 5FK7A 1REEA 1DLCA 1AR93 4PHZA 3VDAA 2RR12 3BPZA 2RHPA 3POIA 2YXSA 2QQKA 4LITA 3WW3A 4ZXEA 2O0OA 4ZHNA 3UKVA 2JD9A 3DF0A 4HN1A 1Y4WA 1HXS1 4DZGA 3MW4A 1XYNA 5J96B 3M3EA 1H2NA 5FPBA 3ZPOA 1XE8A 4V1PA 1S2BA 2WZR1 5F32A 2FDFA 3VDDB 1AUYA 2RJLA 4W6YA 2WNUA 4KQ7A 4WBBA 1JZ3A 1PO22 2ZGMA 1OVPA 3O1PA 4GQ7A 4XF9A 4I0BA 2HH9A 5FMDA 3ZSKA 4KGGA 1V00A 4GKXA 4M4PA 4ZS3A 2AEYA 2VMGA 2HEYF 3WDXA 3WR0A 2OQ7A 4L0PA 3WP6A 1QDCA 4D6SA 2RS51 2CTVA 4AXOA 2FBEA 2NMNA 4ORFA 4DUVA 3UV9A 2VNRA 2VW2A 3ZDVA 1QJY3 2SBAA 1OC1A 1G9CA 5FZBA 1YXWA 2DVDA 5IJRA 3AKRA 3J8F1 3PUSA 5BV6A 5SV5A 1NXD1 3W5NA 4JHZA 1RVF3 1CJPA 1R083 3AP7A 2DVFA 2DUPA 3I2GA 1W6MB 1E5SA 2YROA 3WNPA 2ZHNA 4XJ8A 3GBWA 3GZEA 4FXKB 4EN0A 5JOZA 1X9TA 5H9SA 1HLCA 4FPHA 3GCWA 5D8AC 5CG8A 1W8NA 5GLWA 4NIIA 3RSJA 2BBVA 2ZX0A 3T09A 2CGPA 2R062 4XUTA 5T55A 2B45X 2L9LA 4OHXA 1GMMA 4QPIA 5BY5A 1JOPA 1NE4A 1NCRC 3FLTA 1NQDA 3KV6A 1N1SA 4GWIA 1X7NA 4I09A 4XUOA 1MS8A 4TZDA 4LTAA 2ID4A 3PLQA 3NNFA 4UAPA 1FNZA 2HLEA 5C8CC 3FE5A 1EV13 1VJ2A 2YZ4A 3JBG2 4JTNA 1DQ0A 4TLFA 4GKYA 1UOBA 3HT2A 4NJ4A 4QDQA 1WMFA 3A0NA 5H9PA 3FFQA 1E5RA 5SV8A 4AVAA 4ES8A 1CPMA 1O4TA 3V0AB 5BNQA 3B93A 1K5MA 3O12A 1FMD2 3VBHB 2JIGA 3KV4A 5A70A 1QOTA 5FMOL 2EALA 1QDOA 1TMF2 1H9WA 1W2TA 4A6OA 4KG8A 1B09A 3JXSA 2YPDA 3FX3A 4Y4RA 5DAPA 4DXTA 5A3LA 1AYM1 2EVXA 2WNUC 3S5AA 1FT9A 3PNAA 2ADEA 3UETA 4CP0A 3I8TA 1J3QA 2X8KA 1IOAA 1PGW2 2ZMKA 3B9CA 4LBKA 1V6LA 2NPIA 5FP8A 3N36A 3OGGA 3POFA 5A3WA 3NNMA 1QGLA 3MZHA 2VC9A 1JODA 4BQWA 1W6QA 5K4LA 4JV4A 3N7JA 5FPVA 3GNEA 3OYWA 1NT0A 3C7GA 5CIRA 5D8AB 1UZZA 4HL0A 4KWJA 4K1ZA 2ENRA 4A42A 2XLGA 4NO4A 3SCFA 1VBA2 4TSVA 4BOWA 3E5XA 4YZ1A 2WWUA 3EJKA 1ENXA 4RHV3 2O8QA 3CDZB 4LOTA 3H1MA 2YFZA 4MXWA
chains in the Genus database with same CATH topology
3POSA 4LBQB 1IPJA 5BNOC 1MZ6A 1DGWX 4I2OA 4MVTA 5JOWA 4COYA 4F3JA 3HT1A 3UL2A 3RJRA 4EN9B 2ET1A 3FUQA 1ZZ7A 3O0WA 3HR9A 4Y1YA 1R1A1 1Y9QA 2WNUB 4XW3A 1QJU3 1QJX3 1PNFA 1QNWA 1OOPA 3PVBB 4HLTA 2ZKNA 2VMHA 2HWB3 1SDWA 1HV1A 3THPA 1ASJ3 2UWBA 1BEV3 1NYWA 2DU0A 1OPMA 3WG2A 4N53A 4RR3A 2SLIA 2ZGNA 3MPBA 1QJY2 3AZYA 2QDNA 1Z7S2 3RRDA 4AI3A 1W2UA 4JDNA 1R082 4RHV3 2FZ1A 2PHLA 1AYN3 1F2NA 1G7YA 1KFXL 3KS7A 3TYJA 4E2QA 2Z79A 4FAHA 5FBZA 4GH4A 3OD4A 4QPIB 1XNBA 2R16A 2D6NA 1VAMA 5BNOB 1O5LA 4P9LA 5JIAA 2XVLA 2WS92 2YY1A 4QQPA 4EN6B 1WA4A 2ZS6B 4LBQD 1SCSA 3BIWE 5EWSA 1OQEA 2RJKA 1YHFA 2UY8A 5KWRA 1MEC3 4Q4V1 3A4UA 4L99A 4UBHA 1LGNA 4Q4W2 1EV12 4O9GA 4YM2A 1DQ2A 1X8MA 4LA3A 1K5MB 4Z82A 5KC5A 4QQ2A 1W6PA 1G8WA 2W52A 4EROA 2UWCA 1OOPC 2WA3A 2YPJA 1CAVB 2EXJA 1PIV3 4IETA 1HIXA 3RDIA 1UU4A 1W6QB 1RUI3 3BALA 4R4ZA 2IXKA 4QPGA 1GR3A 4XF4A 3OYWB 5F6KA 5BYNA 4AVTA 4HK9A 2FMYA 1TEIA 5ABJC 2R0FA 4RD7A 1MVEA 3SMHA 2B42B 1U5IA 4Q4Y1 2VVFA 3EQEA 4XXPA 4QM9A 1ZYBA 2ZKLA 1OFNA 2WLPA 4PLOA 2NLRA 4MXWB 2BWCA 1AZDA 1DFQA 4YVWC 2JEMA 2WFF1 1CAXB 1QMJA 2VY0A 3CJXA 3H3ZA 3AX4A 3WY6A 4E4ZA 3H7YA 5DUWA 4AWDA 4ISQA 1VP6A 1RUD2 1EYBA 4LBMA 1J1TA 5GZEA 3MW3A 2JDZA 4GMP3 5E88A 4EWEA 1MS9A 1OOPB 1BVVA 2EAKA 4KL1A 1QJU2 1WW4A 2ATFA 3QACA 4R8HA 5KHJA 2D98A 1RMU3 1QHDA 2HWB2 1D0GA 5E89A 4WM7C 4E4DX 1ASJ2 4HFSA 4RR3B 4QXKA 3TN91 4FTBA 4CDQA 1VBC2 2AENA 1V9U3 5DDJ3 1PO21 3O0XA 1W39A 1S0IA 4YVSC 1U5ZA 1DYKA 1F5FA 4MV2A 4QPGC 2B46X 3ZDSA 1FPN2 4NWWA 2VNOA 1G6NA 3KT7A 1DGWA 4RHV2 1BBT2 2VOKA 3VGIA 2BTVC 2EIGA 3VZNA 5I93A 1WLTA 4LE3A 3HBZA 2JKBA 4ZU7A 3T2TA 4GH4B 4KWLA 3ZXAC 2HWF3 2CAVA 4B8EA 2XBO3 4YFZA 2GU9A 1X82A 3ILRA 5A3MA 3VHRA 3APBA 1C1LA 5C33A 1WCKA 2BWAA 2FZ2A 2GSYA 1SFNA 3MFAA 1MEC2 1RUC3 3AYDA 3B9IA 2GH2A 2VGDA 4YZ5A 5FLIA 5FO8B 1AXZA 1W6OA 1ZX5A 4DINB 2E9QA 3NAPA 1RUJ1 1W6PB 4BHPA 2BFUS 3WXPA 1C57A 5FCCA 1F9KA 3N7MA 4WM7B 1S0GA 4NWVA 1ZRFA 3KQRA 3WD5A 4L8QA 5CB7A 1Q8VA 1LOGA 2KA3A 2HWE1 4EWAA 1PZ9A 1WBLA 3B3QE 2XLFA 4HKOA 1I3HA 1PIV2 3J9SA 3W9AA 1GSLA 4K1YA 1VRH3 2GMPA 2IXCA 4P9YA 4F7ZA 1LULA 4QPGB 4AQ2A 5ACA3 4XHXA 4JC1A 2VUAA 1ENSA 1QKQA 5K8SA 3AP5A 4XJUA 2QJVA 4XIKA 2D5HA 1Z78A 4LEJA 3PMSA 4D3WA 1S0EA 2HWC1 4TWTA 3NVCA 1VBB2 1RUG3 1WW5A 1POV3 5JPNB 4K3UA 3OY8A 1PGL1 2GDFA 1FV2A 1VBA1 2VXRA 3M8LA 3HQXA 3I54A 2WNVC 1UD1A 2O8OA 4Z07A 3SCHA 1S55A 4I02A 1VIWB 1AR91 4AG4A 4FOWA 1NY72 4LO8A 5DUVA 4DNYA 4N9IA 4XOGA 3H0OA 2RS12 2CWSA 2CL2A 2PAEA 2ILMA 2XPJA 3M70A 1RMU2 1DG6A 2E6VA 2WSUA 4PIXA 5A32A 4CDQB 4C0BA 1Y7BA 1PMIA 3NWKA 1WW7A 5GZGA 1RUE2 5IK5A 4A3XA 4YG3A 1OD5A 1LOAA 5FDBA 2XB6C 1D4M3 1V9U2 5DDJ2 2ZBJA 1VBE3 1PZ7A 3IBMA 5LEJA 4I30A 4OI1A 4NOTA 3VLBB 1EP0A 4OHZA 2NP0A 2X29A 2CAUA 3VZLA 2G9GA 1QJY1 2BNNA 4UW3A 1UKRA 4GXLA 4COUA 2HWF2 1QF3A 4CZSA 1RVF1 1R081 1AR72 3MW2A 4NHKA 1POV0 1WD3A 4YSFA 4LBLA 4K9SA 1H8TA 3DV8A 4YW2A 1WCSA 3K48A 1JOJA 3LZZA 1N1TA 3INAA 1YYNA 4YG0A 1O3QA 3OCPA 1RUC2 1Q8QA 5GKAC 5K0UC 1CPNA 2E53A 2P3IA 1DU3D 3WCRA 1YLLA 2D97A 3NAPB 3FC0A 1WMEA 5HXVA 5LEKA 1GLHA 2JICA 1W0OA 3KT1A 4XJAA 5AFEA 1MZ5A 5L7OC 4Q2FA 3LGRA 4AF9A 2RS33 3S7EA 1EV11 3FBMA 4RGAA 2WKKA 4C91A 2NMOA 4M3CA 4SLIA 3USUA 3J26N 2IZWA 2PHTA 4AGGA 2X5IC 3ZYIB 1QXPA 3E6BA 1VRH2 3WDVA 2P2KA 5ACA2 1UN1A 3AZWA 1NA1A 3ATGA 3JCIA 2R043 2D6LX 3M7AA 4IQPA 2RR13 3AMNA 4MUVA 2CY6A 1F5JA 2D3SA 3KB5A 4RGGA 4AVBA 2DTYA 2I74A 4AK3A 1T6GC 4ZU4A 1ZZCA 4AGRA 4CTEA 1RUG2 2Y0IA 1AR62 5EZWA 2B39A 2VW0A 3OY8B 2RMU2 1LHNA 4HT1T 3TAYA 4BCUA 4GALA 4AE2A 4HKWA 3KMHA 1HRI2 4TYSA 2OIIA 4A7YA 2PHRA 3TOJA 4IEZA 1RJ7A 4HSJA 1H8TC 4ZU5A 2BEOA 3RYPA 3VDDA 1SFYA 1S0BA 5JI9A 4FTEA 4HPKA 3FLRA 4Q0PA 3G6JB 3VBFA 4AFBA 5L7OB 1ZBE2 5CAZA 3GHNA 4P9IA 2PLV2 3B00A 3WG1A 1PO13 2ERFA 4C0HA 2HJIA 2B9UA 2W08A 4G3YC 1YRZA 2WT2A 4UW6A 1WLCA 4OHVA 5B2GB 3OF1A 4AGVA 2C1FA 3T1MA 1KITA 4Q27A 1QJU1 1QJX1 4X6RB 3WNXA 1D4M2 4I3GA 1DLLA 2A3XA 4HN0A 3MGUA 2PHXA 1VBE2 3ES4A 2HWB1 2R063 1ASJ1 3RMYA 1BEV1 1QXJA 1X8EA 4JTOA 4MXVA 4AI1A 2P3JA 3ZYGA 2D40A 2D93A 4YZ4A 3LB9A 5KXBA 1XNKA 4FAGA 1V6JA 2DYCA 2A70A 4JCKA 2VQ0A 1UX6A 1QQP3 3HN1A 3JBG3 3AFKA 5LK7B 3AYCA 3ZSEA 5FTTC 4Q0QA 4RHV1 1H8TB 3M3OA 1AYN1 4OHYA 3AKSA 3JD73 5I0TA 1JN2P 1FMD3 5F6LB 1JH5A 3VZOA 4XEZA 4XHBA 1TMF3 1UZYA 4BQ1A 2WT0A 1JYIA 4AI2A 2ZOEB 5JPMB 3RI9A 4HVQA 5HCFA 3ROUA 3LKJA 2XJUA 3AMQA 2QE3A 4FOVA 5I0SA 1MEC1 4G4FA 1DQ5A 4M3CB 3USUB 3R05A 1O3SA 4XQWA 3ZYRA 4WVZA 4S2GA 3VBUA 4AVSA 2LUWA 4YGBA 2Y0OA 1LOFC 1QXRA 4YW1A 1G86A 1NA1B 4YYOA 1JYCA 2BQPA 1KDMA 4H55A 4K20A 1OFSA 5AVAA 4N9HA 2R042 1G9DA 1O3RA 4GA9A 1YFYA 4AW7A 1UIKA 5KXEA 1NCRA 1PIV1 4BPZA 1QH7A 4INDA 1BJQA 1L3JA 1RUF3 1B35C 2VMIA 1RGSA 3J4UH 3VV1A 1FV3A 1RUI1 1N47A 2R073 3L2HA 5C8CA 2GNMA 5JZGA 1UMZA 4LBQA 4JVAA 4U36A 1FAYA 1R092 3GALA 2D7FA 3TBDA 1VBD3 1J3RA 3I4IA 2XKPA 1GV9A 4BLIA 3NSTA 3ZXEA 3AKQA 3WINE 4HPKB 4GIQA 1DGRN 2BFUL 4ZXKA 3VBFB 1J58A 2R1BA 3AMPA 3E6DA 1YIFA 4Q0VA 2O1QA 4XPVA 1PO12 3WQ1A 5L73A 3SH5A 3LA2A 4MGZE 1AVBA 4WM8C 3VZJA 1Z7S3 4XXAA 4LHNA 3D5OA 4CDUA 4GMP1 3PVOA 1TNRA 1AX0A 3ILFA 5CFDC 2W39A 3ZN4A 3VBUC 1RUNA 1SMVA 4E2SA 4LNVA 4OZXA 3SH3A 1CX4A 4HZFA 1RMU1 1BVP1 2E7QA 2WS93 5I8SA 5BNOA 4DS0A 1GZ9A 3U11A 3U4XA 1V9U1 4P9XA 5DDJ1 2PAKA 3KSCA 1IHMA 4Q4W3 1CESA 3CLPA 4DMIA 1QQP2 5JZGC 4DRVA 2BW8A 1FYUA 2ZGOA 3FBYA 1SCRA 2LM3A 3QCWA 1I6XA 3JD72 2YGLA 4LR4A 2HWF1 5E1RA 5FO9B 5JOXA 5I8YA 2XBO1 1JUIA 4B7KA 4DXZA 1CAVA 1EAH3 1TQ5A 1NLSA 4FBFA 1RUC1 3PHMA 2G9FA 2ZGKA 2QVSB 3ZXGA 1DQ6A 3VBUB 2GNTA 4OI2A 1ALYA 1GANA 2NN8A 2JG9C 2JE9A 4LUMA 3FUOA 1IPKA 4CDUC 1V6IA 4IEOA 2EXKA 2BGCA 1WLWA 4J6GA 2NZ9A 1NCRB 2BUKA 4FP3A 1DQ4A 1U0AA 3H1WA 3BCWA 3HMYA 2VW1A 1RL3A 4WZFA 1RHI2 1VRH1 4BWOA 4CP2A 5C8CB 5JZGB 2TBVA 1RUF2 1H2MA 5ACA1 3QD6A 5J98B 1CAXA 4BIOA 2R072 1RUD3 3ZSMA 3THTA 3POYA 1SLBA 3B94A 4FO9A 1DYPA 1VBD2 4LULA 3IN9A 4Y4YA 2R0HA 1QU0A 4FPFA 1WD4A 2B5HA 1RUG1 2ZCWA 4AI8A 2Q4SA 2PN5A 2YHJA 3M3CA 3N3HA 3KLSA 4NHLA 1POV1 4R52A 3OTFA 4I3PA 4K40A 5F1RA 4S2DA 3S30A 2QUOA 1DZRA 4MLOA 1VBC3 4MH0E 2PFWA 1WCDJ 2JG9B 3AB0A 3C3VA 5ABJA 1XU2A 4CDUB 3KGLA 4FPCA 1FPN3 4AFMA 4EJRA 5IK7A 2WNEA 1BBT3 2ZACA 4AVVA 4UXAA 1VAVA 5HCBA 1DBNA 4DOUA 3ZFGC 3LAGA 3FWEA 2WFPA 2OUHA 2BVVA 3LSEA 3LA7A 4YVWA 1UL9A 1S0FA 4XMIA 4QX5A 5E16A 4XTPA 1AX1A 5AFBA 2BYVE 4PLNA 1YIPA 1H4HA 1NG0A 1D4M1 2NQYA 4XFAA 2JXAA 3R4UA 4FPKA 1VBE1 2ZGRA 3SHRA 1YNAA 4IXLA 4QD2A 4B4RA 1HRV2 5T5PA 2GH8A 4H14A 4GWNA 4XF3A 2GMEA 1EPZA 1KFUL 1AL22 1XYPA 3UKTA 4FPLA 4MSVA 4W6WA 4LO4B 2MEV2 1ZZ8A 1D0HA 2ET7A 2XJRA 4WM7A 5FPZA 1CAUA 4M01A 1ZA4A 2D6OX 3ILNA 4LO5B 1EAH2 2EXHA 2PYTA 4PDWA 1RUH3 3QH7A 4YVSA 5FO7B 1V6KA 2PELA 3L9JT 4YW4A 1AR83 3OGJA 2UURA 3L2YA 1SACA 2N7GA 2AZ5A 1DGLA 1LRHA 4DQAA 4P9WA 1F8VA 4JGYC 4GB32 1ND3C 1V6MA 4O9EA 3MI8A 2CV6A 1HV0A 5HCAA 3B5LB 1KXGA 1VBB3 2WLQA 2RS31 4G9SB 2EXIA 1LKNA 2UWAA 1RB8G 2C5DA 3GBGA 3WP3A 2W0XA 4FPJA 2Z69A 3IPVA 3GHMA 4MYEA 4WV8A 1IGOA 3WVJA 4E9KA 3AFGA 3BOPA 1KDKA 4XQDA 2R041 5E8AA 2D5FA 4N43A 4Q1RA 3QOPA 5GLTA 2RR11 5I91A 4M00A 1U5YA 4JQRA 4AVCA 4Y22A 3VHOA 2RM23 2RS13 5FQ0A 4YW5A 1JUHA 5CFCA 1CIWA 1PNGA 2IXIA 3RPQA 2ZX3A 3M4FA 5IT6A 3KCYA 3M2MA 1Q8SA 2D43A 2TEPA 3KT4A 1MZFA 1UKGA 2ZX2A 1H0BA 3JZVA 2V09A 5C8WA 1RUE3 3KCXA 3O7OA 2DWRA 4JGYB 2PA7A 4AQTA 3V64A 5ABJB 3ES1A 2D3PA 4PDWC 3VUOA 3ZYPA 1IKPA 5DG1A 4RQPC 1I5ZA 3ST7A 3C2UA 1PO11 3AJZA 3WG3A 5CG9A 1XU1A 4XFIA 2DCKA 1DIWA 4YVWB 2B7YA 1G9FA 4XFFA 1Q43A 5AC93 3V65A 1AR73 3AYAA 4Q0SA 5BNNA 5I8TA 2NM1A 2UY9A 4CEWC 1WLDA 3SITA 2ZAHA 2WNVA 1QY4A 5LRRA 2QZ3A 5GZDA 4IV3C 3FLPA 2OPKA 3POWA 1LGBA 3W59A 1MS4A 2D6MA 1GQHA 1O4YA 2R061 4YGDA 3VHPA 4N43C 1CAWA 4Y1XA 3WQ0A 3AMHA 3CO2A 4Y1VA 1TME2 3B01A 3IM0A 5KHGA 3D0SA 1OKQA 4QGNA 3R0RA 2H6CA