1LHVA

Crystal structure of the n-terminal lg-domain of shbg in complex with norgestrel
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
177
structure length
173
Chain Sequence
b'PPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEX HORMONE-BINDING GLOBULIN
molecule tags Transport protein
source organism Homo sapiens
publication title Steroid Ligands Bind Human Sex Hormone-binding Globulin in Specific Orientations and Produce Distinct Changes in Protein Conformation
pubmed doi rcsb
total genus 31
structure length 173
sequence length 177
ec nomenclature
pdb deposition date 2002-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00054 Laminin_G_1 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lhvA00
2ZGNA 2XG3A 4DS0A 1HLCA 1LECA 1SFYA 5GLTA 1UZYA 3FFZA 1Q8QA 2A6YA 4AYUA 1WW6A 1KJRA 1ZA4A 2ZAAA 1GBGA 2ZMKA 2JDZA 1MACA 4LBMA 4PCRA 4CZSA 5E89A 3IPVA 3R4UA 2WSVA 5GLVA 4Y24A 3RMYA 4Q26A 1KJLA 4LBQA 2ZGKA 1AX1A 4FPOB 4YZ5A 3PVEA 1A8DA 2P3JA 5EWSA 3NV1A 1YXWA 3JUUA 1WW4A 1SLTA 2ZHMA 4GKYA 1S0GA 4Y20A 3ZSJA 4FP2A 1JN2P 3BIWE 1W6OA 1SCSA 4FPLA 4XJWA 2R0FA 3ZYRA 4MYEA 3M3CA 3OJBA 3OPZA 2W08A 2EIGA 3VKFC 1WUVA 1N1TA 1UL9A 1YI7A 1MS5A 2C9AA 1RITA 2CTVA 3FUOA 3A0KA 4U36A 4ZKTB 1KDMA 2UU8A 5GLUA 5H9QA 2DUOA 1GYKA 4BLIA 1G9BA 1YO8A 2UWAA 3AK0A 2A7AA 2ARBA 2WKKA 1GLHA 3ILFA 2VH9A 5DUVA 1BYHA 1UPSA 2PHTA 5DG2A 5AVAA 3R4SA 1SLLA 1WLCA 3VKLA 4YW2A 4DFSA 3MW2A 1JXNA 2DUPA 3MEPA 2EXIA 1FX5A 3FLRA 2BQPA 4PBPA 2PHRA 2D6OX 1SLCA 3DUIA 3NV4A 4FQZA 1ENSA 1N3QA 2NN8A 1B09A 4NO4A 4YM1A 2E53A 4Y22A 1N3OA 3V0AB 3M1HA 3N7JA 2JE9A 3Q9OA 2W68A 1ULDA 2WNEA 3N35A 3WG1A 3B3QE 1V6LA 4BQ1A 4YW4A 2ZBJA 1MZ6A 4GKXA 1FV3A 4FPKA 3UJQA 3IMNA 1N1YA 4TYSA 3V64A 4YM2A 1GV9A 4K21A 3WHUA 2YXSA 2GN3A 4P9WA 3AZVA 2PHUA 2UWBA 2ZZJA 1LOCA 3HR9A 3OY8B 3WDTA 4BMBA 2ZGRA 2A6WA 3UK9A 3ZXFA 3V0BA 1H9WA 4LBLA 4P9YA 1TEIA 1UN1A 2AH2A 1QNWA 2D6MA 3A0NA 2A71A 1IS5A 3WZ1A 4KBBA 5GZGA 4JC1A 3PMEA 3PVNA 5GM0A 1QMJA 3PJQA 4PBOA 3WCRA 1JUIA 1CQ9A 1S0FA 3AZYA 4WZFA 1MS3A 1LHNA 1LHUA 1FYUA 2W39A 1GNZA 3WG4A 2E7TA 1W6QA 4LBKA 4GXLA 5T55A 2EXHA 1MS1A 2ZHLA 4YG6A 4WVWA 5CB7A 5GLWA 3RQ0A 1S0EA 1LEDA 2D6NA 4GWNA 1W6NA 2NMNA 3O5SA 1LOFA 3AJYA 4D69A 1A3KA 1S0JA 1ULGA 1WW7A 1S0DA 1S1AA 2KM2A 4YFZA 5JMCA 3LSEA 4HANA 4M3CB 1DQ0A 1QOTA 1D0HA 2GN7A 2PHWA 1SLIA 2ZKNA 3B9CA 3WDVA 3AX4A 1YIFA 1CIWA 3AJZA 3ATGA 1DLLA 1G9AA 2GNBA 1S0IA 4YZ3A 2R1DA 1CPNA 1EPWA 1SBFA 5JDBA 3ZXKA 3USUA 1V6OA 3I4IA 4XTPA 3O12A 2D3RA 1CVNA 2WSUA 1GNHA 1J1TA 1JYCA 1LHVA 4FP3A 5T54A 1WBLA 1LOEA 1UMZA 1I1EA 1CJPA 1MS9A 1AF9A 2P37A 3SITA 5GZEA 2ZGLA 3IM0A 4ISRA 3VKMA 1C57A 2PELA 3V65A 3OBTA 5IUQA 1AXZA 1APNA 4R9DA 5IT6A 5LK5A 1LCLA 2DURA 2D6LX 2Q5TA 3LCPA 4YW3A 4XOGA 4ZXKA 5EYYA 1CPMA 4FOVA 3ILNA 4Q8LA 5JOZA 3TB0A 5IK5A 1ZM1A 2LTNA 1LTEA 1JW6A 1GKBA 2R16A 4BOWA 2EALA 2V73A 3WHTA 4XJ9A 2VW2A 2GMMA 2ZA9A 4WVVA 5GZCA 1BXHA 1PZ8A 1QF3A 3ZSLA 1MR5A 4Q27A 4K1ZA 1Q8OA 2DV9A 4YW1A 3OGGA 4LBQB 3RMXA 1W6NB 5T5JA 3POYA 3AXDA 4R9BA 3AZXA 2GNTA 1HKDA 1GZWB 4FVVA 2A3WA 4U2AA 1KQRA 3ZSMA 3WLUA 4JRAA 2A6ZA 1GZ9A 1AX2A 1BQPA 1HQWA 4UW6A 4Y26A 4Y22B 4AVSA 3BODA 1Q56A 5CNAA 1WLWA 1LULA 5CAZA 4YG0A 3ZXEA 3M3QA 2A5ZA 4XMAA 1VIWB 2R1BA 2DVFA 3N7KA 2CWMA 2AR6A 3N7MA 1SLBA 4R9CA 2H0BA 4XIKA 3ENRA 1GZWA 1LU1A 1VAVA 4C1WA 5CBLA 4M3CE 4XXPA 2NP0A 2WT2A 3SLIA 2CWSA 1LOBA 4LBNA 4AGVA 5E8AA 1C4RA 1LOAA 1O4ZA 3KM5A 2W52A 1URXA 1LHWA 4FPGA 5L73A 3AP5A 2LALA 3SH3A 1G9FA 2AREA 2ZACA 2VW1A 4Y1UA 4K20A 5DG1A 1LGBA 5T5LA 1QOSA 2E6VA 1JHNA 1FNZA 1W6OB 2ZGOA 3SH5A 1R1ZA 2AENA 3ZXJA 1QU0A 2EAKA 2GNMA 1CR7A 2P34A 2ZGMA 2SBAA 1V6NA 3T1MA 2P2KA 1LOFC 1N47A 3AYCA 4XTMA 3ZVXA 3AYEA 3O0WA 2ARXA 4HL0A 4W65A 4YG3A 4RA0A 2RHPA 2A6VA 3RSJA 1DGLA 3AP7A 2DU1A 5T5OA 2CL2A 2NM1A 1N3PA 1W6PB 1X50A 3R05A 1CONA 1BKZA 1SCRA 3QCWA 4ATEA 3CNAA 3TAYA 1GANA 2FMDA 3LSDA 4M3CF 1Z78A 5IK7A 3AYDA 3DGTA 4Q1RA 1FATA 3POWA 1W0OA 5E88A 5KXBA 3AYAA 4WV8A 2OW4A 3D5OA 1MZ5A 4Y1ZA 4Y1XA 4DRRA 2EXJA 1O4YA 1G9CA 2DVDA 4UW4A 1Q8SA 1V6JA 3B00A 5H9PA 4I30A 4BPZA 1G9DA 2GMEA 2AGSA 2DU0A 2E7QA 3N7LA 3GALA 5HCAA 4YZ1A 4XIOA 1DBNA 5DZGA 1DFQA 2SLIA 5DUUA 4Q1PA 1FV2A 2A3XA 1W6MA 2ZGTA 2ZMLA 2AYHA 4AGGA 4FPFA 3RRDA 2D7FA 1SACA 2DYCA 3B69A 2TEPA 1V00A 1H9PA 2JD4A 2VXRA 3ZPYA 3O0XA 1QOOA 2NZ9A 1WCSA 4XBLA 1F31A 5GLZA 1A78A 3NV2A 1PZ9A 4YGEA 3IN9A 1ENRA 1C1LA 4CRQA 1VALA 1AX0A 1I3HA 1UKGA 2P3KA 5CA6A 3N36A 1RINA 2NYYA 1MS0A 2A6XA 4L8QA 5DUXA 1Y7BA 3IKWA 1OQ1A 2VW0A 2I2SA 3AZWA 1DQ6A 2UWCA 2DTYA 5EYXA 3M3EA 1UAIA 2OVUA 4XZPA 2V5YA 2ZGQA 1V6KA 4Y1YA 5DXDA 5HCBA 2CY6A 3APBA 1MS8A 4XJZA 1CESA 1UZZA 1S0BA 3ILRA 4YW5A 4PF5A 3WCSA 4FPJA 4FOYA 5JVVA 3WV6A 4XJ8A 2VU9A 2WT0A 3WUDA 1SLAA 1DQ2A 1F5FA 4UW3A 4GWMA 5FREA 1WD4A 2JKBA 1RIRA 1LJ7A 1SBDA 5JOWA 3INAA 3V0BB 1W6PA 3OBRA 1W6MB 5DZFA 2ZGSA 1OFSA 1VLNA 2A75A 5T50A 1V6MA 1KRIA 4YFWA 4FPYA 1IS6A 2WQZC 2GALA 3B01A 1QKQA 1DYKA 1WLDA 1YYNA 3RG0A 2GNDA 1GICA 2A70A 5GJ6A 2UURA 4YZ4A 3OYWA 3D4KA 2C5DA 5F5QA 3WDWA 4P9XA 2DWRA 3UJOA 4GA9A 3WOGA 1WD3A 4XJAA 2DVGA 4BMEA 4DQAA 4XBQA 2FHRA 3I8TA 3MPPG 1IS4A 4Y20B 1D2SA 3H0OA 3V0AA 4XMIA 4YGCA 5DUWA 5GZDA 3JU9A 4M01A 4ISQA 1IKPA 1LGNA 3M3OA 1AXYA 5GALA 1YRZA 1ENQA 3HMYA 2JE7A 2R0HA 2ES3A 1ULEA 1MS4A 2YY1A 1F9KA 1NLSA 4XHXA 1Q8VA 2ZMNA 1AXKA 3MW4A 2YZ4A 3VKOA 2GDFA 2A3YA 4LBQD 3FLTA 4XBNA 1LESA 1DHKB 2D6KA 3M2MA 4XYXA 4LBJA 2OUJA 2ZABA 5GZFA 3VV1A 2ZGPA 5IK4A 5JLVA 4M00A 2PHFA 4Y1VA 4P14A 3WVJA 3WDYA 1WW5A 4AVTA 1Z0HA 1DQ1A 2DVAA 3SH4A 3VKNA 1DZQA 1LHOA 1QDOA 3VUOA 5DZEA 3WUCA 4FPEA 1FAYA 1DQ5A 3AP4A 2G4IA 4JCKA 2ZHNA 4XJUA 2E51A 3BTAA 2D3SA 3HN1A 3SISA 2DTWA 1LODA 4SLIA 4PQ9A 2DVBA 1G86A 1MVEA 4FPCA 4YZ2A 4CTEA 1ULCA 3AP6A 2WLQA 2GMPA 2JJ6A 4ITCA 4YLZA 4YM0A 1JOJA 4FOWA 2VUAA 3WDUA 1OKQA 3POSA 1SBEA 3QLQA 4R9AA 1N1SA 5H9SA 3ASIA 3WG2A 2EF6A 3OYWB 5H9RA 2YV8A 2D3PA 3UL2A 4ATFA 1DQ4A 1KDKA 1GZCA 4FQ4A 1PZ7A 1JBCA 4F83A 5F9TA 3ZSKA 2ZGUA 2HYKA 4DRVA 2CYFA 4AGRA 3D6EA 3AZZA 3ZXLA 3ZYPA 3USUB 1H30A 1N1VA 1UX6A 3A4UA 3AXEA 1NXD1 2CNAA 1LOGA 4H55A 5EXOA 5KXCA 4XE9A 3L2YA 5KXDA 1MVQA 4NOTA 4OZXA 2AUYA 2OUHA 1ULFA 3AFKA 1JYIA 3O0VA 1ONAA 3AP9A 2ENRA 4XILA 4XXAA 4RL7A 3SNMA 1W0PA 1AZDA 3U4XA 4FOQA 1IKQA 3WG3A 1G7YA 3MW3A 1QDCA 2B7YA 1AVBA 2D6PA 3GNEA 4BM8A 2JECA 1FNYA 4K1YA 1CN1A 2WT1A 1HQLA 1LEMA 2PHXA 2P3IA 1IS3A 2WJSA 4YGBA 4BLJA 3N3HA 2YROA 4ASMB 1U0AA 1AJKA 1DYPA 5BYNA 4AVVA 2R49A 2D44A 3W58A 1BJQA 2Z42A 3PVOA 2NMOA 1XQNA 2D43A 4YGDA 4Q8KA 1BZWA 1C1FA 2EXKA 5FRAA 5JOYA 1VAMA 3IPVB 1LGCA 1QGLA 1QNYA 1WBFA 3WDXA 5JOXA 2ERFA 4IQPA 2ZHKA 4AWDA 5T52A 1IOAA 1Q8PA 3FBYA 3T1LA 2XB6C 3W59A 3OY8A 4Q2FA 1KITA 3WNXA 2VY0A 3FUQA 2YMZA 1V6IA 3NV3A 1AJOA 4M3CA 4XDQA 3NWKA 4GALA 1G8WA 4YM3A 1DIWA 5SV8A 4FPHA 5IK8A 1LU2A 3C2UA 3BOPA 5KXEA 4C1XA 4XHBA 4DPNA 1GSLA 1S0CA 3FLPA 5HCFA 1W6QB 1HDKA 2DUQA 4LBOA 3T2TA 4Z8BA 4TZDA 4UW5A 1LENA 3RS6A 5T5PA 3KQRA
chains in the Genus database with same CATH superfamily
2ZGNA 1RVF2 3BYWA 1GQPA 4P08A 2XG3A 3I3BA 4GZ9A 2AACA 1HLCA 2XUMA 3KV5A 4IXLA 3CDZB 1AYM1 3GCXA 1Q8QA 1JZ7A 1WW6A 4QAWA 4HN1A 2OT7A 1MACA 3SKVA 3TEZA 4FXGB 5E89A 3IPVA 3AVSA 4FO9A 4QKBA 2VUCA 2WSVA 4A6OA 4Q26A 1VBD2 2FBEA 5FJKA 5F6KA 5FZDA 2VM9A 1QH6A 4MGTA 4IGPA 3J7HA 1L7LA 3JCIA 4EN8B 3KV6A 2GU9A 3K46A 3LOIA 2E33A 4FTBA 1WW4A 1SLTA 5A6XA 4FTSA 2WWJA 1PMIA 2R063 5HBAA 2CAUA 5IVFA 3DXUA 4HONA 3ZSJA 4CP9B 5I0DA 4HK9A 1AR71 4JDOA 1GP5A 2X53S 4K7JA 3CJIB 3BPZA 1UY3A 1RITA 3A0KA 1OLRA 1HXS2 4A7YA 4LULA 3GCWA 1ZBA1 4QX3A 5D2AA 3H3ZA 1OOPC 4ZU4A 1EYBA 2PAKA 3GXUA 2UWAA 5T3NA 3U10A 4E8DA 4P9LA 3MIHA 4D7SA 3OOXA 3TNQA 4D6QA 5DG2A 5CFDB 1NCRC 2JDPA 3O1MA 1WLCA 2Y6JA 2QZ3A 2RDQA 3N9NA 1ZBA3 5FYUA 4CCMA 4C91A 3KF3A 1FX5A 2WDBA 4RS5A 1AL0G 1L7QA 2VMGA 3DUIA 3TBDA 3I3EA 4FQZA 1ENSA 5C9AC 3WNNA 1Q5OA 3C7HA 5FYYA 2E53A 4PDWA 3CJIC 3MLKA 4LPLA 2JE9A 2WA4A 5FXWA 1QJZA 2W68A 4QPIB 1HRV2 1UZVA 2W0XA 3N35A 2OYZA 3WG1A 3OEAA 1OMIA 4ASLA 4QX2A 2E26A 4C0HA 3HNBM 5IAXA 1MZ6A 4CDXB 3BOWA 3M8LA 1FV3A 4FPKA 4ARYA 3V64A 4YM2A 4JHTA 5FLIA 1DGWA 3J8F1 4LUKA 1RUI1 5FBJA 2C4XA 1SFPA 2QQIA 5J3UA 2PHUA 1YQ2A 2ZZJA 2YU2A 4QQPA 4MX3A 1MEC3 3IMMA 4XF0A 4NIHA 4XAAA 4Z2AA 1TEIA 1UN1A 2WFPA 1QNWA 2WR9A 2A71A 3MF9A 1UYYA 3POGA 3CJXA 3OBZA 4M4RA 5FV3A 4AEDA 5GZGA 4JC1A 3F2ZA 4QGMA 4CCEA 5GM0A 3O1RA 2VZQA 3PJQA 2OX0A 1CQ9A 1S0FA 3AZYA 1XSQA 4IE5A 4KH9A 5HPOA 2MNGA 1FYUA 2OZ6A 1COV3 1JS9A 2W39A 2YB7A 2FCTA 5IVJA 1NA1B 1PX4A 5J09A 3ZR6A 3BI3A 5GLWA 4NIGA 1S0EA 4Y4YA 4CUGA 2IXIA 3GM8A 3ZFFC 3MFCA 2ID4A 1LOFA 4MGIE 4QPGC 4O61A 1EY2A 3ZKYA 1S0JA 1ULGA 3FZ3A 4ZONA 2KM2A 1S1AA 5FYZA 1QJFA 4MGQA 1IQDC 2RE9A 2ZKNA 5L9RA 3GF6A 5J7MA 3AJZA 5D1IA 2VZVA 2Z5WA 3R4DB 2ZX2A 2WIIB 4QX7A 4XF1A 1CPNA 4AI1A 1EPWA 1PIV2 3ZDVA 1R64A 2CU5A 4Q0VA 1V6OA 4XTPA 3O12A 5FYBA 2D3RA 1CVNA 5FPUA 1GNHA 1JYCA 1RJ7A 1LHVA 4HETA 3TN92 1POV0 4FP3A 4QDQA 5T54A 3W5NA 4UFIA 5FBZA 1RUC1 1WCUA 4HSLA 4LORA 1MS9A 4LHNA 4OULA 4RR3C 4HVQA 4WM8B 2RDNA 4LKEA 1A6CA 4ISRA 3VKMA 4D7YA 1H8VA 2A1XA 3OBTA 4AEDB 2DFBA 2EIDA 1O3SA 1APNA 4R9DA 3VHRA 4B7EA 1RB8G 2DURA 3J7NA 2D6LX 2EIBA 3Q8CA 2X5IC 5JXIA 4QXHA 4ZXKA 5FZ1A 5EYYA 1HV1A 3ZN6B 3E6CC 4MOAA 5JOZA 4CPBD 5IK5A 3E5XA 4GB32 2CV6A 5APAA 2ZA9A 4MHUA 2IXLA 1I5ZA 1WKYA 4RN5A 3JQWA 5FMDA 4RHV2 3OGGA 5IVBA 3ZMOA 1W6NB 1W9FA 3OB8A 5D8AC 5T5JA 4EQVA 4IEYA 4OHXA 3OUIA 5EPAA 3PUSA 5C71A 3PIJA 4JTOA 3ZSMA 1RVF3 4Q4W1 2A6ZA 5C3SA 3O1OA 3JD72 1AX2A 2PMWB 1E5SA 4PDWB 4Y26A 1PVC3 2VZ3A 1XU2A 5LA2A 5CNAA 1WLWA 4FI9A 1LULA 1QIQA 4GIQA 1Y4WA 4GWIA 4YG0A 2P6HA 5CAZA 2A5ZA 3MIFA 3I7DA 4UFJA 4YVWA 2R1BA 2FD8A 5DAWA 1W8ZA 2WO1A 3N7MA 5A80A 2X09A 4C1WA 1GZWA 5CBLA 4A3ZA 4XXPA 4CCCA 2WT2A 5AFEA 2A73B 5LCWL 4AI9A 1LOAA 1O4ZA 2GC1A 2WC2A 2XVKA 5LY1A 2ARCA 1RUF2 4AQ2A 2VOKA 1VBC2 3AP5A 4XEZA 1UU4A 1G9FA 4IEQA 5LASA 3SH3A 2NPIA 4Y1UA 4K20A 5DZEA 3GBFA 2HLEA 2QNKA 4A4AA 4XABA 2Z69A 4OI0A 2Y6HA 4MGYE 1OPOA 1W6OB 4EV0A 1ZREA 2BU9A 3J4UH 1QQP3 2GNMA 1K5MB 2ILMA 2K2SA 3T1MA 3ES4A 4I0WB 3PJYA 1OOPA 4AK3A 1STMA 2ARXA 1ZZ6A 2R062 3DN7A 4A45A 1JYXA 4RA0A 2A6VA 2F4PA 2IXCA 1RC6A 1RTVA 5C5TA 2O0OA 5LRSA 2CL2A 3IDCB 1NCRA 3R05A 1X50A 3L9JT 1K3IA 4LHLA 4ATEA 4AG4A 3IAPA 4W6WA 3VBFC 2JKXA 5K8SA 1T6BX 3LSDA 3DGTA 4Q1RA 1W9YA 2H0VA 3HQUA 4J1XA 4N7UA 3THDA 3ZO0B 1GWLA 1ND2B 1QXPA 1OA2A 3ECQA 5E88A 2OW4A 2PAEA 4TLFA 4BQWA 4QHZA 4Y1ZA 2PXJA 1LR5A 5A7PA 2DCTA 1QQP2 2Z2SB 4QXKA 3UYJA 1QJY3 1J84A 1H1IA 3QD6A 1HV0A 4ZY9A 2DCKA 4XUPA 3VD4A 4CUBA 1G9DA 1WMXA 3E1F1 1J3PA 1H8TB 4PLOA 4YPJA 4AHXA 1DZTA 5HCAA 1ZZCA 1XRUA 5F5IA 4YZ1A 5DZGA 2YPJA 4KU8A 1GOFA 1AR81 3ZXGA 3VBSB 2AYHA 2XLGA 2YHJA 3B93A 4OI4A 2E9QA 5KHGA 5L7OC 4CDWA 1H9PA 1YUDA 3ZPYA 5FO8B 4CU9A 1QOOA 2JIGA 2NZ9A 2W95A 1RUI3 2WABA 3J8F3 4HVOA 1PO13 3G7DA 4LO5B 2XR4A 4XCBA 2HWF3 4YVSB 1D4M1 4AFMA 1VBA3 5CFCA 5F3EA 3IN9A 2WNUC 4AAXA 1VALA 2VMIA 3R0RA 1AX0A 1UKGA 3RPQA 2P6CA 1NAEA 2NYYA 1F35A 3IBMA 3N36A 3ZIXA 3T2OA 2A6XA 4RGAA 5CKMA 1VBA1 1Y7BA 1PVC2 5DUXA 2Q8DA 5FOBB 2J42A 3VD5A 3H42B 4JZRA 3W9AA 2W1QA 3THCA 4AHWA 4CSWA 4JKMA 3WP6A 2MPFA 2RG4A 1NT0A 4L0PA 1UAIA 5K9YA 5EFUA 2V5YA 1BEV3 2DBIA 5DXDA 3APBA 4RHV3 3J7MA 4OFGA 1AR63 3ILRA 2R042 3HPNA 4PF5A 4FPJA 5F3GA 5JVVA 1GZTA 2Y64A 2ZX0A 3R6SA 4AF9A 4NIIA 1SLAA 3T30A 3DCQA 1UWWA 5CG8A 2HEWF 3KF5A 4GWMA 3VL8A 2JKBA 1LJ7A 1SBDA 2XWBB 3I2IA 5HCHA 3N9MA 3PLQA 1W6PA 3OBRA 4LMFA 3WY6A 4AVBA 5DZFA 1VLNA 2Y6KA 2A75A 4QPWA 1WA4A 3FFQA 1EUUA 1NE6A 1UO9A 1IS6A 2RR12 2Y8KA 4FPYA 4I01A 1QKQA 2JG8B 1NYWA 3KCYA 3ZFEC 3FN9A 4B1MA 1GQGA 2A70A 1W8UA 5F3IA 3KSCA 3OYWA 5FK8A 2C5DA 5FPXA 1C28A 2DVGA 4BMEA 3EB7A 2B46X 3KD4A 4QPIA 4YNIA 4XBQA 2FHRA 5FMBA 1AHSA 3K51A 5C4WA 5F3CA 1NCQC 1JZ5A 1CAVB 3HBZA 3V0AA 3POFA 2W47A 2XBO2 3OGVA 5DUWA 2R6QA 1IKPA 5J36A 4BQ4A 1Y9GA 5BNQA 1YRZA 4B4QA 2YY1A 4XHXA 2VE1A 4BQYA 3MW4A 4L11A 4QX0A 2XJSA 2GDFA 4MGZE 4XQDA 4EWDA 2VNOA 1SQ4A 4IL7A 4BU2A 2VL4A 2PN5A 3KMHA 3N9QA 4OYUA 3H7JA 3M2MA 2R073 2DCJA 4QHBA 2ZABA 3OBAA 5DDJ2 5IK4A 4ZU7A 5JLVA 1R1A1 4M00A 1TQ5A 4P14A 1CAWA 2QDRA 4LNVA 3WDYA 5IVEA 2IXJA 3AMQA 2J7MA 1CAUB 1DZQA 2VBBA 3H9AA 4AFDA 1LHOA 3E5QA 2BFUS 3OGRA 5FUNA 1SDDB 3BUCA 5LA0A 1PGL1 3VLBB 1RUE2 3AKPA 3WUCA 1YJKA 1UCXA 2G9FA 2FCVA 3NJYA 5F32A 1PO11 4XJUA 2VMEA 3FMGA 2DTWA 4OUMA 1LODA 3CKHA 3WF4A 4J6GA 2W91A 3O1UA 3ES1A 2Q30A 3NJVA 2GMPA 2JJ6A 4ITCA 1RGSA 4YM0A 4EN7B 1M06G 3T09A 3POSA 1TVGA 1B35C 5I91A 3I2DA 5H9SA 4N8MA 2JDNA 5I0SA 2HWC3 3VBOC 1ZBE3 2WUHA 3AFGA 4MO3M 5LBCA 4C8DA 2BW8A 5BNNA 5A6ZA 4HK8A 4F83A 4RFT0 4CDUA 4BE3A 1ST8A 1TZOA 1ZBE1 4JTNA 1GOHA 5A32A 2CYFA 4AGRA 3D6EA 2DFCA 3AZZA 3UGGA 3ZXLA 4BQXA 1UY4A 1FMD2 3IIAA 5KXDA 3I49A 1W03A 1MVQA 3FWEA 3PUIA 3C3VA 4LA2A 1WLTA 4JGZC 2B4KA 2WZ8A 5FZIA 1O3QA 2KXLA 5FZOA 4B29A 2ZX3A 2XL9A 4UOJA 1K45A 1WMEA 3H3LA 3WQBA 3POJA 2QTWB 2Q8OA 1BVP1 5JZGB 2JECA 1RXFA 5FP4A 3VBRC 2WT1A 3UKTA 2PHXA 2WJSA 3ZX7A 4CEYA 2YU1A 4BLJA 3N3HA 3D82A 1RUJ2 2JG8A 5FY1A 3VBUA 3QOPA 4Q0SA 5DPNA 1UXZA 3BB6A 4QM8A 1D4M2 1CZVA 4CXYA 1BJQA 5C7GA 1YFYA 1RUD2 3PVOA 3FHQA 1RUH2 1WWYA 1BZWA 1C1FA 2EXKA 4NVPA 3BTYA 2L9LA 3O1SA 1LGCA 1WBFA 3CQOA 1XNTA 2AZ5A 3MIGA 1I9RA 1VBD3 4X6QB 4E9KA 1VBA2 4EROA 4BISA 4X8NA 5CFCC 2C6SA 5F2WA 3OY8A 1UQXA 1VP6A 2FDKA 3NQHA 1W3VA 1AJOA 4JVAA 3JB4C 1HXS1 2ZJCA 3VBRB 4RQPB 2X8KA 2Y0IA 4GALA 1TME1 4FPHA 2J1UA 1OC1A 4IV3B 3WNPA 1AR91 4C1XA 2QQOA 1GSLA 1S0CA 4I2OA 5DAPA 1W6QB 5JUVA 2DUQA 4LBOA 4OQ8A 1ND3C 2HWC2 4MADA 1LENA 1WMDA 3CBNA 1IPJA 2VXJA 4DS0A 1YFUA 4CXXA 5FPAA 5CFCB 4X6RB 3MHZA 4AI3A 2ZMKA 3MLJA 3H8RA 2QDNA 1REDA 1BEV1 5ISLA 5I8SA 3NNJA 1O59A 4LIUA 2Y60A 1KJLA 4CEYC 4LBQA 2ZGKA 2Z79A 3DKWA 4B4RA 4UYBA 4COZA 3S5QA 3WP3A 2X5IA 4FSJA 3HNYM 5EWSA 5KR7A 1YXWA 3Q8FA 5C8CC 4XFAA 2XJVA 4N43A 2JICA 1YI9A 3K75B 1S0GA 3QH6A 3EQEA 3ZYRA 1EP0A 4NWWA 2C26A 2FQPA 2HEVF 2R0FA 2NQYA 2ZS6B 3BPSA 4MYEA 3E6DA 3OPZA 2BOIA 1QJU3 3VKFC 3IB3A 1WUVA 2W46A 3K48A 1N1TA 3FUOA 3LFMA 2C9AA 2JIJA 4N53B 4BQ3A 5FIXA 5A1FA 4WVMA 5GLUA 4LO4B 3WQ7A 1ZA7A 4EE2A 4BLIA 5B4XA 3WXPA 3AK0A 1PIV3 2WKKA 3RZLA 5DDJ1 1GQHA 2VH9A 2X10A 1OH3A 1BYHA 2PHTA 2BGCA 4Q4V2 5IVYA 4AOCA 3R4SA 3VKLA 2XPJA 4LXLA 3VDAA 3MW2A 1XPWA 1JXNA 5FLHA 4R4ZA 2DUPA 3PURA 1NLRA 2EXIA 5JIUA 2JWPA 3FLRA 5BV6A 5KXBA 1UZ0A 1XNBA 4LQRA 4S2DA 5FXVA 2D6OX 3NV4A 4AHZA 1DP0A 5JPNB 1U5IA 1IHMA 3ACHA 4W8JA 3NKGA 4EN0A 2BBAA 2LS6A 1WMFA 3ORJA 4Y22A 3ZFGC 1CAVA 1N3OA 3Q8AA 4LOSA 2BRTA 3D8CA 3V0AB 5C4WB 3Q9OA 3ZYJB 1ULDA 2WNEA 1V6LA 3ITQA 4LE3A 4BQ1A 5BNOC 5C5UA 4GKXA 1F5JA 3OF1A 2WZR1 3BU0A 3TEYA 1PX3A 3IMNA 3MUZ1 5CKNA 5F1RA 4KG0A 1C5IA 4OCTA 3PMSA 1JOBA 3TN91 4A42A 3LPFA 2Y6LA 3U07A 4P9WA 3SMHA 1U5YA 3WEZA 3JXSA 3WW3A 1T2XA 4BCUA 3H8XA 2W5FA 1LOCA 3UK9A 3ZXFA 2JDMA 2VUDA 4P9YA 2P3YA 1NQDA 2FDJA 3NL1A 2D6MA 4LLFA 3K77A 1YQ8A 4E4HA 2O8OA 3WZ1A 5ABJA 1OXCA 3N9PA 1QMJA 3LEIA 1H8TC 2WRAA 4O7XA 4PBOA 1FOD3 4NIAA 4BWOA 4AI0A 4WZFA 4CXWA 4E4SA 1LHNA 1LHUA 2ZX4A 4UI9L 2AC1A 3WG4A 2ET7A 1W6QA 2IWGB 2XMLA 3LF7A 4N7IA 5F5CA 1TMF3 3IWZA 3BN6A 2EXHA 1MS1A 2ZHLA 4Y4RA 5DN2A 2HEYF 5T55A 4D8MA 4D94A 3RQ0A 4DO0A 4Z2WA 3PUAA 1FOD1 4COYA 3AKQA 2NMNA 3MGUA 1NA1C 4CUAA 4D69A 4OI2A 1F4AA 2IUWA 2WFF2 2BWAA 4GMP3 4Q5OA 1WW7A 2DBNA 3UKVA 1LNSA 3JQXA 3BTXA 3HBKA 5FZ7A 5JMCA 1QOTA 2PHWA 3AC0A 3WDVA 4CVUA 4AEKA 1VMFA 1YIFA 2XLFA 5FZFA 5BNPB 2VMDA 1IGOA 4YZ3A 4GMP1 1F4HA 2R1DA 5FZGA 3ELNA 4XUOA 5JDBA 5FZ9A 3USUA 1X36A 3WW2A 2Y34A 4WVZA 4BA6A 2HYXA 3WNOA 2YC4A 4P9JA 3I97A 2GH2A 2WYFA 4LR4A 4WM8A 1BMV1 4EWEA 2HBTA 3S7EA 3ETQA 2DDUA 1UMZA 2WAOA 3SITA 4BXFA 4M0NA 4P02B 2BV4A 4L9BA 1COV2 2PELA 4MXWA 5IUQA 3OUHA 3VHOA 1OFNA 4AVAA 3EMRA 4CCJA 2D5HA 4RR3B 4YW3A 3S5AA 1W8WA 3MIEA 4XOGA 2B42B 3ILNA 1AL23 5A7WB 2VMHA 2XJPA 4A41A 1J1LA 1PGL2 1IG0A 1JW6A 1GKBA 2QZ2A 2R16A 2EALA 1EUTA 2PLV1 4HZFA 4XJ9A 2VW2A 4DINB 4OMCA 4WVVA 1VBD1 1PZ8A 2X5IB 1QF3A 3CZJA 1MR5A 2IVIB 5JI7A 4BH9A 2JB8A 3RZJA 4LBQB 3ALQA 3MIDA 1A34A 4LLOA 4W6YA 2XOMA 3AXDA 3I59B 5FOJB 2WS92 2JENA 1H0BA 3A22A 2JD9A 4JRAA 4YW7A 1NA1A 3N4MA 1KD7A 1BQPA 3AM2A 3PUHA 2PQSA 3BODA 4XAEA 1HRV3 3ZM8A 2QUOA 3ZYHA 4DIQA 4MV2A 1H1AA 5FP9A 3FL7A 1VB4A 4NUBA 2XXZA 2VG9A 3N7KA 1PM4A 2FDHA 4R9CA 1SLBA 3ENRA 3ZFFB 5JCTA 2J1VA 3ZYIB 3LAGA 4UFHA 5FMCA 2IXKA 5E8AA 4URAA 1W8TA 2H6BA 2W52A 3WQ0A 4XZUG 1URXA 4QM9A 4NHLA 1SPPB 2ZXQA 2AREA 2ZACA 3LD8A 3KV4A 2XJUA 2E6VA 3CHXA 4UWDA 3KHCA 3WF2A 2WL1A 1FNZA 4LK6A 4V1PA 3RJRA 5FO9B 1R1ZA 1CAUA 4GH4B 4BK5A 2CGOA 5IHRA 1BLZA 1QU0A 2EAKA 2SBAA 3TYJA 3ZVXA 3VBUB 4DEVA 3I3MA 1G6NA 2CDOA 1RVF1 1DGLA 3BVCA 4Q4W3 4RS5B 2DU1A 1O5UA 3EYPA 4LITA 5FZAA 3ABZA 2Y26A 2NM1A 1S2EA 1XYPA 4AEDC 1PVC1 1BKZA 5FZLA 1O8SA 3P5BA 4YARA 4HXCA 5KBFA 2P4EA 1RUH1 3TAYA 4Z92B 1W9TA 3MIBA 1AL22 4Z82A 5BNPA 3U78A 1E5IA 1EAH2 2FMYA 1FATA 1KFUL 2YFUA 3O1VA 4HT1T 4N9HA 3TEXA 4LKFA 3VD7A 4PT6A 1MZ5A 2UY9A 1YIPA 2WBKA 4UFLA 5EQUA 5LBFA 3NNMA 3S30A 4DOUA 1ZZ8A 2DVDA 2RM23 1E57A 5F37A 4NPMA 1HJGA 1R081 2QQJA 5KWRA 1JZ4A 3B00A 4JKLA 4R4XA 2JDAA 4JRLA 3WNKA 5A32B 1RUG2 2BYVE 3KT4A 4QX5A 2AGSA 3H1WA 3N7LA 3VHNA 3SCGA 4BHPA 3I2GA 1WZXA 1OD5A 3B9IA 2HWB2 2RM21 3CIHA 4QX1A 5A3TA 1XJAA 4WZCA 4ZHNA 2VZRA 1XYOA 1C8M2 2ZGTA 1WCQA 5FYVA 1UU5A 3RRDA 3W20A 2HWD2 1SACA 2W9XA 3CL1A 3SXWA 3RI9A 2JD4A 4W50A 4CDUC 3IZOA 4XBLA 1VBE3 3WP5A 3CLPA 1F31A 3WNLA 1ZRCA 4ZS3A 2F4LA 1ENRA 1Z7S1 4CRQA 1JYNA 1I3HA 2W94A 4Y5Z0 3P3NA 5CA6A 4B7KA 5C3PA 2ZCWA 1RINA 4CEWA 5HXVA 1RUE3 1NZCA 4XFHA 5ACA3 1JOPA 4F8AA 3IKWA 1OQ1A 5LEKA 1CZSA 2JDKA 4YVWC 5EJ3A 3LWCA 3P3PA 2WS93 2D97A 2DTYA 4R52A 4QKDA 1DF0A 4XACA 5EYXA 5ACA1 1WCDJ 1GMMA 2VQ0A 2XKPA 4XZPA 3VBRA 2AEZA 1W9SA 4A44A 2VCCA 1QJY1 1X9TA 4CUCA 4EWAA 4NR1A 3C7FA 5FYMA 1UW8A 3MO4A 1CESA 1QJEA 4XJZA 3VD9A 4K8FA 1QJX3 4AAPA 4RQPC 3WV6A 4NWVA 1AYM2 2VU9A 2WT0A 1FPN3 2VOTA 4XF3A 5FREA 4CDWB 1RIRA 1KXGA 1UD1A 2QQLA 3INAA 5F8PA 3V0BB 4QU1A 2FDFA 5IFTA 3VBHC 1OFSA 1LAJA 4GJYA 1QJU1 4A6SA 4YFWA 1HRI1 1ND3B 1W8HA 2WQZC 2GALA 3B01A 4GULA 4PF1A 4COUA 1TNRA 1BVVA 2UURA 4K40A 5DAXA 4DMIA 1UF2C 5A3LA 2FDIA 1HRI3 3SHRA 4I09A 1ENXA 2Y6FA 3EO6A 4S2HA 3MPPG 1W2TA 1OI6A 4Y20B 3H0OA 5L9VA 4XMIA 1ND2A 2RS11 4OI1A 2WO3A 1CZTA 3U4SA 3JU9A 3O7OA 4ISQA 3M3OA 1ZBA2 1ND3A 3FX3A 4COWA 5A1LA 2EIEA 1JZ8A 3KS7A 3HMYA 4LHSA 5AVPA 2B9VA 4DY5A 4Q4V3 1UIKA 1Q8VA 2ZMNA 3H50A 4FFHA 5FJHA 1AYM3 5FKCA 3VKOA 5L7OB 4CPBA 2PTMA 1O3RA 5CFDC 4CU6A 4DNYA 1NCRB 1LESA 1DHKB 4KGGA 2QQNA 2JDUA 3VZNA 3O1PA 3W21A 4LKSA 4Q4Y3 4LBJA 4N9IA 3WD5A 3HQXA 4OZOA 3DPRA 2XL7A 5FZHA 2VJXA 1SEFA 3GDBA 3M70A 3WVJA 1WW5A 4IE6A 1DQ1A 3VKNA 2F6BA 3I2FA 4HSJA 5JPMB 1W04A 4BK4A 5D21A 2R061 1HRV1 1TNFA 2J1TA 2QCSB 2R072 1RJ8A 2RJ2A 1FAYA 4IV3A 4MZUA 4ORFA 3AP4A 5L7OA 2G4IA 5DQ0A 3ZOIA 2E31A 4Q0UA 4ES8A 3HIFA 4QKFA 3VZJA 3BTAA 2V72A 2XHNA 3OPTA 2GH8A 3KT7A 3SISA 4XQWA 4ASKA 4CEWB 4IE4A 3AMPA 4DXTA 1RUI2 2WNUA 5IW0A 4CTEA 1KFXL 3AP6A 1IG3A 3LB9A 2WLQA 4JQRA 2VZTA 4YLZA 1JOJA 4FOWA 2VUAA 3WDUA 1NLQA 4IE0A 1SBEA 4BZ4A 3KT1A 2XKOA 1N1SA 5FPBA 1JH5A 5C8CA 2R7EB 2YV8A 3UL2A 1W2NA 1DQ4A 1KDKA 1US3A 1NCQB 1PZ7A 5A3UA 5CU1A 2HYKA 3AL6A 3PU3A 3I54A 4QXBA 3LOBA 1SMVA 1R1A3 1PO21 5C8CB 4LKDA 5FPZA 3AXEA 5KXCA 2PHLA 2CNAA 1W90A 5CFDA 1AR92 1FPN1 3VDDC 3L2YA 1L3JA 2GC3A 4NOTA 2OUHA 2WQ4A 2DF7A 4YYOA 4NAOA 5C3QA 2ET1A 3S7IA 3O0VA 1ONAA 3AP9A 5K7PA 2V4VA 3CO2A 3S6PA 3SNMA 1AZDA 3U4XA 1OSGA 1QJX2 1G7YA 1XXNA 3MW3A 4XFBA 3JBG2 3ZYFA 1AVBA 2VOWA 5K0UA 2RS31 4OHWA 4CP9A 3I2KA 1BEV2 1FNYA 4BQ5A 4OLLA 1CN1A 2TUNA 4B8EA 3VHPA 1HQLA 2Y0OA 1LEMA 2P3IA 5F2SA 4MHRA 3UKNA 2YROA 1ZYBA 4BIFA 1DYPA 1NCQA 4AVVA 4AL9A 2RS13 2D44A 3VD3A 3LEKA 3ZMNA 4NPLA 1QWRA 4IESA 3FHAA 5CKQA 2NMOA 1Y3TA 5BNOA 1UYXA 1DG6A 5FRAA 1RHI2 5ABJB 2WA3A 3FC0A 4GH4A 2QKDA 4QQHA 2RJLA 2VOXA 3LDBA 2ZHKA 4AWDA 3HJRA 1Q8PA 5LY2A 3LDKA 3J8F2 3J9SA 5A70A 1U5XA 1V6IA 1UOBA 5FZEA 2G9ZA 1DGRN 4Z07A 3CZUA 2O1QA 1DIWA 4GAZA 5AC92 5IK8A 3BOPA 1UOFA 4JKKA 1BHGA 1W8OA 1WA6X 2VVEA 3W5MA 1HB3A 1W8NA 1D4VB 5D8AB 4DPNA 2BERA 1VRH2 2BPA2 5FZ3A 4PHZA 2C0ZA 1H2NA 1UYPA 2P5BA 1HDKA 3OPWA 2BWCA 3T2TA 4UW5A 2SLIA 1H6YA 4XIOA 3RS6A 5T5PA 3V65A 5CYYA 1UIJA 3OD4A 1CAXA 3WNMA 3DPRB 3PU8A 3PVBB 5GLTA 4JDNA 4AYUA 2XBO1 4R8HA 5EZWA 4AFBA 1REFA 1KJRA 2GC2A 2ZAAA 4K8RB 4LBMA 1O91A 2HH9A 1D7PM 3B5LB 2Z4FA 1JYTA 3A7QA 1OBNA 2MEV2 4KQ7A 4Y24A 2J1EA 1DU3D 2BZDA 5FMOL 4E2SA 4XC9A 4GMP0 1OA3A 3FE5A 1AX1A 1B35A 3KHBA 3LA3A 3PVEA 2P3JA 3NV1A 4I02A 3VBOA 1M4WA 4KWUA 4WVMB 4QU2A 3JUUA 3BU7A 1D4M3 4BB3A 2RS12 3OEBA 2ZHMA 1OA4A 4CEYB 5KHKA 1K42A 2CAVA 1AYN3 5BXXA 4Y20A 4YRDA 3GGLA 1JYWA 4MG2A 2PYTA 5C33A 3M3CA 3OJBA 3T4HB 4E4ZA 2W08A 2EIGA 3J7LA 1EPZA 1YI7A 1UL9A 4U36A 1MS5A 3HD8B 2CTVA 3OG2A 4ZKTB 2WAAA 1KDMA 4G3YC 5H9QA 2OKXA 5FDBA 5L36A 1G9BA 4JGZA 1GFF2 3DF0A 3HAGA 3ILFA 1GLHA 3NSTA 1WGPA 2GP5A 4PQQA 5DUVA 4CU7A 1UPSA 5A7QA 5AVAA 2FDGA 4YW2A 1VBB3 1AR61 2OA2A 3MEPA 5G05L 5KHJA 1NUKA 1PK6A 4CCDA 2ZKLA 1YQ6A 4CDUB 2QQPA 3ZDSA 4LE4A 1SLCA 1DZRA 4KMQA 2NN8A 1B09A 3A23A 3OSDA 4NO4A 1Q43A 1X82A 2RR11 3M1HA 2K46A 5FKBA 3VBUC 1Z7S2 3JZVA 3HN3A 4KGQA 4NROA 4DXSA 5BY5A 5F7UA 5C3RA 2TNFA 5CIRA 4IV3C 4COVA 4YW4A 1S2BA 2ZBJA 3BALA 3I59A 3ZFGB 2RR13 5A1AA 2D98A 2XJRA 2D40A 4TYSA 3OCPA 1GV9A 1DLCA 1JMUB 3WHUA 3SKJE 1BMV2 2IZWA 4AEJA 4D3WA 3AZVA 4I0BA 4Q4X3 3WDTA 5A7WA 4BMBA 2ZGRA 3IIIA 2XH6A 3I2JA 4UBHA 4YVSA 2LRPA 3A0NA 3AKTA 1IS5A 3D3AA 4C90A 4KBBA 3TNPB 3PVNA 2WINB 5FYCA 4A3XA 2VQTA 4D0QA 4QGNA 1F15A 3WCRA 1C8NA 1JUIA 3I2OA 1DGRA 3WINE 1MS3A 2GSYA 1DYOA 1KEXA 1GNZA 3QBQA 3Q8BA 4L97A 4LBKA 5IVCA 4YG6A 3RYRA 4EZHA 1EV12 1VE0A 5CB7A 3U11A 2R32A 2OS2A 1LEDA 2ZAHA 3ACFA 4GWNA 2QJVA 5FY9A 1W28A 1C5HA 1O5LA 1W6NA 1XNDA 3O5SA 2G19A 4XUNA 3AJYA 2I74A 1A3KA 4LO8A 1LB2A 2XUEA 3I3DA 4IERA 3VL9A 2RS51 2RV9A 2B5HA 1S0DA 5FP7A 3LA2A 4YFZA 1PO12 2QFEA 3LSEA 2VBDA 4M3CB 4RGGA 4KWJA 4ES9A 2GN7A 5C9AA 1SLIA 1HB2A 3B9CA 3AX4A 2RVAA 1CIWA 1MPXA 4Y33A 1DLLA 2ZEYA 3S57A 3MZHA 3RJ2X 5K0UC 4N43C 2XONA 5JSPA 3ZXKA 1QY4A 2J1RA 5A3NA 5J48A 3I4IA 1J3RA 4CDQC 2HWE3 1J1TA 4NPRA 4RSUA 4D7TA 3BKZA 5FUPA 2RS33 2CDPA 5BNNB 1S55A 2P37A 3DXTA 2UYBA 5FLJA 2HWC1 1C57A 3V56A 3A21A 2VCBA 1AXZA 2W1WA 4XDOA 4JGYA 1Y43B 5IT6A 5LK5A 1VMJA 1LCLA 3NJXA 3E6BA 3CEWA 2YG0A 2VECA 4QGLA 2WN3A 4N43B 2LTNA 5FTTC 1LTEA 2WNUB 5E1RA 5EHDA 4JX0A 4BOWA 2V73A 1H2MA 4DZGA 2GMMA 4XUTA 5CVRA 4Q27A 2BFUL 3DEMA 3NNLA 2DV9A 3RMXA 5M0TA 4XQ4A 1PMHX 3M7AA 3ZFGA 3I3QA 2WO2A 5FWEA 2ZOEB 2GC0A 2YDEA 1HKDA 3ZFFA 1MQTC 1BBT1 4QPGA 1PHMA 1GZ9A 2Q4SA 4LIVA 1W05A 5C70A 2OPKA 2VVDA 4KI5M 4AW7A 3M3IA 3OD0A 3M3QA 3T0AA 3KQ4B 3LKJA 5CISA 1R093 4PIZA 1QXRA 2DVFA 2CWMA 2I45A 4Q4X1 4XIKA 3KCXA 1W0NA 2VMFA 4TXWA 5K4LA 3SCFA 5I0TA 1JZ6A 4M3CE 3SLIA 1UMHA 1TE1B 1LOBA 1VBE2 2CWSA 3H8UA 2K0GA 4HFSA 4LBNA 4PIYA 4AGVA 5C8WA 4NMIA 1C4RA 1TG7A 3KM5A 4V2VA 1X8EA 4RQPA 4FPGA 1U12A 5L73A 5JXGA 4OUSA 4FCAA 1C8M3 2E32A 1LGBA 1H8TA 5T5LA 1QOSA 3F95A 3LGRA 4XETA 2HWB3 4QT6A 5FR3A 3MFAA 1D0GA 1HXS3 1GP6A 3IDBB 1RUG3 2ZGOA 3SH5A 1NG0A 1BCXA 4NHKA 3ZIWA 2AENA 4DXZA 1OUSA 3JBG1 1CR7A 4IEVA 1AYN1 2P2KA 4DB5A 4HKLA 4E4DX 1XC6A 3CMGA 3VBOB 4XTMA 3T0BA 2GZWA 4HL0A 4LT5A 4K9SA 4YG3A 4W65A 1NKGA 1X8MA 2EICA 5HV4A 3WT3A 5T5OA 1N3PA 1W6PB 3MLLA 2Q1ZB 1CONA 4LOTA 4QPYA 1SCRA 2BUKA 2LW8A 2HWF1 3QCWA 5JZGA 3SCHA 1FMD1 3POEA 4GB33 4NJ4A 4RS5C 4EYUA 1LRHA 4B3NA 2FMDA 4O9EA 1Z78A 1VR3A 3AYDA 2YYOA 4QB2A 2OQ6A 3GHMA 2VUJA 3THTA 2YGLA 1SG3A 3POWA 2OXBA 1K5MA 1AUYA 1H2LA 5FAXA 3AYAA 1FMD3 3CJIA 4KWKA 1I6XA 3D5OA 4WV8A 4DUXA 3SEPA 2F17A 4Y1XA 4DRRA 4IEOA 4UW4A 4AZZA 1W2UA 5DAQA 4HOOA 1E5HA 5A7NA 5H9PA 2CGNA 3RGBA 4I30A 1OLME 2DU0A 1VB2A 3J26N 4O9GA 1DBNA 5FYSA 1DFQA 3ZR5A 4E2QA 3ZFEA 3NMBA 4CA9A 1FV2A 3VDBA 1W6MA 2WFF1 4FPFA 1VBC3 3B69A 1JODA 1V00A 4TSVA 1KS4A 3O0XA 4LEJA 1J3QA 1WCSA 4TN7A 4ZZ5A 1FXZA 2C24A 1A78A 3E5UA 1PZ9A 2W3JA 5BUVA 2WFF3 2XHKA 4YGEA 5LBEA 2IFRA 1BBT3 5FYTA 2MEV1 4HN0A 3VDDA 3JD71 5CADA 1IPSA 5IYYA 3KLSA 2K9ZA 4HPKA 3QH7A 1RUH3 3RNSA 2X29A 3MBWA 2XQXA 4L8QA 2BNMA 1ZZ9A 4XFGA 2VW0A 2XLAA 1VMHA 3JD73 4AHYA 3KVBA 2OQ7A 3RDIA 3VZLA 3GHNA 5J37A 2I2SA 2XJQA 3AZWA 3WP4A 3M3EA 5FP8A 4LA3A 2Q8CA 4AFCA 4IDZA 1L7RA 1XSRA 3NAPA 1R083 4Y5TA 5DAVA 5FPLA 4QX8A 3I2HA 5I0UA 4YW5A 3WCSA 3N9OA 4FOYA 2W2IA 1HN0A 3L2HA 3WUDA 4FAGA 1PGW1 1US2A 1W99A 2RS53 3NNGA 4JQTA 5EP9A 1V9U1 4JV4A 5LEJA 2YFZA 2WO7A 4RYDA 1NE4A 5JOWA 2XDVA 3MICA 2R071 2E7AA 2Q0AA 3LIHA 2ZGSA 3IDEA 5T50A 4IV1A 1V6MA 1RUC2 1KRIA 3ME2A 3PHMA 4LO6B 3RZZA 1NX9A 1DYKA 1WLDA 1YYNA 1OLMA 2GNDA 3RG0A 3T3YA 4HKWA 4MUVA 3VBHB 5FZ8A 4YZ4A 2HWE1 2VR4A 1UKRA 4IEUA 5FO7B 1Z7S3 3PTRB 5F5QA 3RVHA 4BYYA 5LBBA 2DWRA 3UJOA 5A3MA 3AB0A 4GA9A 4MSVA 3WOGA 1O3TA 4S2GA 3I8TA 1IS4A 1OF4A 4K3UA 4IUGA 5F39A 4NN0A 1JUHA 5FCCA 5KC5A 5LA9A 2B9UA 2LROA 2VZSA 4GB31 4YGCA 4TWTA 1IZ3A 4H2AA 4N53C 4M01A 1HJFA 5GZDA 1LGNA 3EJKA 1T6GC 5ERLA 5GALA 4FFFA 4BQ2A 1OKOA 4RHV1 4QXCA 1CIYA 1PK6B 1UXXX 2ES3A 1ULEA 3DECA 4MXVA 1F9KA 1I5PA 3WDWA 4XFIA 3IAQA 2YZ4A 4IE7A 4JDMA 4UF0A 5EIYB 2A3YA 4LBQD 2W1SA 3FLTA 4M4PA 4META 2N7GA 5A6QA 5JI9A 1JYVA 1J59A 4XBNA 4QD2A 1QQP1 3PIGA 4HLTA 2VD7A 5LWBA 2D6KA 4FFIA 4XYXA 3X29B 1PNFA 4YVWB 5E16A 3AMNA 1EV13 2ZGPA 5B2GB 5C6CA 4I3GA 2PHFA 1TMF2 1BK1A 4G4FA 5EV7A 3WQ1A 2FZ1A 4AVTA 2FCUA 5FMOS 2DVAA 5L19A 1UY2A 4NRQA 2JE8A 4NHYA 1ZRFA 1QDOA 2LM3A 2V09A 3NKTA 4HBNA 1X33A 1IQAA 1UYZA 1YWKA 4JCKA 1R091 2XVLA 4FAHA 1HB4A 5FZMA 2P17A 4ZZ8A 1MVEA 3ZN4A 4FPCA 4Q4X2 2MEV3 1O6UA 4XURA 3VBSC 4EN9B 1UNBA 4DUVA 1AL21 3GZUC 3DV8A 1GWMA 3H7YA 2HWD3 1PIV1 4CCOA 2B8MA 4CEWC 3UT0A 4H3WA 5I8TA 1ASJ2 3QLQA 4R9AA 4XF9A 2KD7A 1UY1A 3FJSA 2RDSA 5JOXA 3ASIA 5A7OA 3WG2A 3RZKA 3UV9A 2TBVA 1ACCA 4X8PA 1BK0A 4ATFA 4AVCA 4CDQB 5CEHA 1GZCA 4FQ4A 2ADEA 1RUG1 3GYDA 4XCAA 1JBCA 5F9TA 1W3XA 3POIA 5FP3A 5AC93 5FZBA 2RM22 1W39A 3GZAA 3ZYPA 3USUB 3LDRA 1H30A 1N1VA 1UX6A 3A4UA 4ARXA 1LOGA 3VBFA 5EXOA 1V9U3 1SHWB 4OZXA 1ULFA 2V4AA 5A3PA 2W92A 1OURA 5FY4A 3QACA 1JYIA 3GJAA 3NVCA 2ENRA 1GP4A 1YC61 1YEWA 2VO5A 4RL7A 4XILA 4QQ2A 3U1XA 2ZEWA 4UFMA 5FUIA 4FOQA 3H3UA 4Q0QA 5A33B 1YQCA 1OF3A 3C8XA 1OLQA 5HXMA 1JU3A 1H6XA 3DL3A 3GNEA 4BM8A 4E2GA 1F8VA 1MZFA 4Q4W2 5A3OA 4K1YA 2B39A 5BNOB 3PL0A 1ODMA 1IS3A 3KZ4C 4YGBA 3VZMA 1RUJ3 3WW4A 1YFXA 1XYNA 1AJKA 5FZ6A 1QH7A 3GJBA 1AR82 1OOPB 2QE3A 3GZTB 4HKOA 4IV1B 3MV01 5ACA2 4B4PA 1XQNA 5A6YA 2D43A 1U5ZA 2YC2A 4QDSA 4YGDA 4MLOA 3TOJA 4Q8KA 5JOYA 3TEWA 1CGPA 1VAMA 2CHHA 3IPVB 1QGLA 2VBPA 3WDXA 3ZKUA 5K0UB 4GQ7A 4IQPA 4AXOA 2BP6A 1QHDA 1IOAA 3FBYA 4LK7A 3RWNA 3SEEA 3W59A 1VBC1 1KITA 3ON7A 4QHOA 3ZXAC 2WNVA 3FUQA 4XDQA 3B94A 4M3CA 3T08A 5C9AB 1W9WA 3ZYBA 3RFRA 5BNNC 1R1A2 2QQKA 3NWKA 1G8WA 3RZGA 4J1WA 5SV8A 1MZEA 4H7MA 4YSFA 3KB5A 2WZPP 5KXEA 4P5HA 3H1YA 2ZZQA 5HCFA 4TZDA 2DCYA 4Z8BA 4Q0PA 5FY8A 2HKXA 3EXUA 1ULOA 3K3NA 3KQRA 4CDQA 5GZCA 3JB8A 1Q3EA 3VDDB 1ASJ3 2WNVB 1LECA 1SFYA 3NNFA 1UZYA 3FFZA 2A6YA 4PJYA 5ANQA 1C8M1 4ZS2A 1ZA4A 1GBGA 2RMU2 2JDZA 3FBMA 4PCRA 3EBRA 1O7FA 4FBFA 4CZSA 4CP2A 4LO7A 2HWD1 3R4UA 5F6LB 1W2OA 5GLVA 3MV11 3DPRC 3RMYA 1PMJX 1HQNA 3GBWA 1DGWX 2YBKA 4FPOB 2JG8C 3ZFEB 4YZ5A 1A8DA 1ALYA 4P9IA 2BGPA 2OPWA 5I93A 1W2AX 3O14A 4LJHA 4GKYA 4L99A 3HWJA 1JU4A 1SFNA 2VNGA 3K2OA 4W6XA 4FP2A 1JN2P 3BIWE 1W6OA 1SCSA 4FPLA 1YCIA 4K6BA 4XJWA 4F3JA 2I07B 1VPHA 1RMU2 3RI8A 2KR2A 3ZPOA 4UAPA 3FHIB 5TSWA 1RYYA 2OZJA 3M4FA 3WX5A 3T0DA 3LA7A 2YBSA 3KVAA 1MQTA 2Q1FA 2UU8A 4QMAA 5JSOA 2DUOA 2JXAA 3CU7A 1GYKA 3DYOA 2J1SA 1YO8A 2A7AA 2ARBA 2WLPA 2HBUA 4GD4A 4PLNA 1SLLA 1QEXA 2VCMA 4KG8A 4AEMA 4DFSA 1OT5A 2QVSB 4QB1A 4N90A 2BQPA 2XBO3 4PBPA 4UXAA 2PHRA 2Y33A 3HQRA 1OQEA 4I0AA 3K3OA 4JGZB 3KGLA 2PLV2 2VGDA 4I3PA 4URTA 5KC6A 4OHYA 1N3QA 1RUJ1 4YM1A 1HRI2 3RYPA 4DXRA 1R092 3AL5A 3NRUA 5IJRA 5C3OA 1POQA 3N7JA 2Q8EA 3HT1A 5FZ0A 1H4GA 2WYSA 4WM7B 2XJTA 4XVHA 3B3QE 4BXSV 3RZHA 1HW5A 2JG9C 2WQ8A 3UJQA 1N1YA 4WM8C 4AQTA 4O65A 4K21A 4OUEA 2YXSA 2GN3A 4CYDA 1ZVFA 2Y6GA 1ZNPA 2UWBA 4BIOA 2JB4A 1UMIA 2ZPXA 1E5RA 1OVPA 3HR9A 2A6WA 3OY8B 1NQJA 4HG6B 1H9WA 4LBLA 3PUQA 4NE9A 3V0BA 2PFWA 1MEC2 2AH2A 4XUQA 3LFIA 4FT8A 2MHFA 3ZSEA 1JI6A 3ZLIA 4MXWB 3PMEA 1PGW2 5I8YA 3GZEA 2C9KA 3MYXA 4WM7C 2BTVC 1OH4A 2BOJA 2E7TA 5JAXA 4QPGB 1ASJ1 1OD3A 1GUIA 1H1MA 4GXLA 1HIXA 4Q4Y1 4P5YA 4WVWA 5FZ4A 2O8QA 4Y5SA 5JXHA 5FXXA 2D6NA 2VPVA 4FTEA 3LQCA 2JX9A 2VZ1A 2J1AA 2HWE2 2VQUA 1BBT2 3DKQA 2UY8A 4QDRA 2PLV3 3B02A 4HANA 5FZOB 1DQ0A 1D0HA 5JWPA 2YBPA 3ATGA 1VBB2 4FFGA 5KHHA 5JZGC 1G9AA 2GNBA 1S0IA 2WN2A 3UESA 1GU3A 3HT2A 4ZXEA 4JGYB 3ACLA 2XQRA 1XNCA 1DDLA 1SBFA 5L9BA 2H6CA 3D0JA 3KWVA 4TTGA 3VGIA 2WSUA 4CDWC 3RZMA 2EA7A 1VBE1 5J98B 3UGFA 1K5MC 3NJZA 3MPBA 1S2KA 1SZBA 1WBLA 2BVVA 2YPDA 3ST7A 1LOEA 4YW6A 4XDPA 2ETEA 1I1EA 1CJPA 1AF9A 3Q8EA 5GZEA 2ZGLA 2ATFA 3IM0A 3WF1A 2IC1A 2YC0A 1RUE1 1TMF1 4DUWA 5IWFA 2Q5TA 1EAH3 3LCPA 3MUY1 4IEPA 2GAUA 1CPMA 2BNOA 4FOVA 3ETPA 3LZZA 3POBA 1FPN2 4PI2A 2RJKA 4Q8LA 5FYIA 3TB0A 1ZM1A 5FXZA 1PO23 4EZ4A 3WHTA 4JHZA 4CP1A 1ZRRA 1BXHA 3ZSLA 1FI2A 4K1ZA 1Q8OA 3URFA 4H14A 2EVXA 4YW1A 3VBFB 3POYA 3PNAA 1QJX1 3ACGA 3NO8A 4IW3A 4PDWC 4R9BA 3PDQA 4CDXA 3AZXA 2GNTA 3ROUA 1GZWB 1NY71 2A3WA 1PNGA 2JDHA 4FVVA 1KQRA 4U2AA 3THPA 3WLUA 5AFBA 2C1FA 2FZ2A 2RMU1 4J25A 1HQWA 4UW6A 4AVSA 1GNYA 4Y22B 1Q56A 1CAWB 3USSA 2IFWA 3HVDA 5DMYA 2BEOA 5LB6A 4MGKE 3ZXEA 2O14A 4XMAA 1VIWB 1LKNA 3WF0A 3WF3A 2AR6A 2VNVA 4OHZA 2H0BA 1OUXA 2Q1MA 1LU1A 1VAVA 3AMMA 2E63A 2ADDA 2NP0A 4YVSC 2DCZA 3NAPC 2QQWA 2EAAA 5FYHA 4JAAA 1LHWA 4S2FA 3ACIA 4XF4A 5J96B 4UFKA 3S0MA 2LALA 1K5JA 2VW1A 2VULA 5DG1A 1X7NA 1JHJA 2XGXA 4N53A 4KNCA 3ZN6A 4UBGA 4CCLA 3C7EA 3GBGA 4IEZA 1GWKA 2BDRA 2D93A 3NW4A 2PA7A 1JHNA 1RUD3 4OHVA 3WW1A 5AC91 5IFPA 4M0HA 2RDRA 4TLGA 3ZXJA 1AR83 2JDYA 3UNPA 1QJU2 4ZU5A 1RMU3 2P34A 1YLLA 2ZGMA 1V6NA 3DYMA 1JZ2A 1LOFC 1N47A 3AYCA 5FY0A 3AYEA 1RUD1 3O0WA 1JTZX 1UPIA 2WWSA 2RHPA 2VC9A 3RSJA 5HI0A 3AP7A 4QPIC 3LEMA 1SDWA 1RMU1 3IDAA 5SV5A 3U14A 1JZ3A 3EHKA 4CDXC 2KA3A 4KWLA 2VAUA 3CF6E 1W8FA 4DY3A 2ORZA 3CNAA 4CU8A 1DCSA 1Y9QA 1GANA 5A33A 3TRSB 5IK7A 4M3CF 1P8JA 1O8PA 4L92A 5FK7A 4NAMA 1MQTB 1TME2 4YWAA 3OUJA 3WR0A 1W0OA 3K4ZA 1AR93 1XBFA 4EJRA 4XFCA 3RWKX 4NIDA 1AR72 2W1UA 5FZKA 2EXJA 1O4YA 4RR3A 4W4ZA 5LATA 1Q8SA 4V2WA 5JXJA 1V6JA 5LRRA 2NLRA 4RFRB 3VZOA 2VCAA 5BPXA 4AQSA 3VBHA 4BPZA 2R30A 2GMEA 3SQOA 2E7QA 2AEYA 1OHFA 1RUF1 1NZIA 2QQMA 3GALA 1ULPA 2W87A 1H4HA 1UOGA 1ZBE2 4BJ0A 4CE8A 2ZEXA 4QB6A 4IEXA 3HNMA 5DUUA 4E27A 4Q1PA 1CX1A 3VB9A 2A3XA 2V5DA 1OVSA 2ZMLA 4AGGA 1YJLA 2B45X 2HJIA 2WZEA 1NOVA 4NRPA 5DABA 2D7FA 1RUF3 4XPVA 2DYCA 2QBXA 2TEPA 3AKRA 2VXRA 4H7LA 1RHI1 2ZX1A 4EN6B 3N9LA 1RUNA 2IVJA 5ABJC 5GLZA 3NV2A 4IEWA 1J83A 4KL1A 1C1LA 3VBSA 5LK7B 1J58A 2X05A 1RHI3 2BJSA 2P3KA 4CCNA 1MEC1 5EJZB 3BCWA 1MS0A 4FXKB 3G6JB 2IXHA 3K4DA 2PQQA 3U75A 2WNOA 4AE2A 1VRBA 4D6RA 4MVTA 4GWJA 1XOYA 4B1LA 3ZYGA 1DQ6A 2UWCA 2WWUA 4AI2A 1VRH1 2OVUA 5DDJ3 2VNRA 2ZGQA 3TWIA 1V6KA 4Y1YA 4Q4Y2 5HCBA 1Y9MA 2CY6A 4A7KA 5BNPC 1MS8A 1YFWA 5FQ0B 5B4NA 3H1MA 1UZZA 1S0BA 4Q4V1 3SC7X 4XJ8A 1PO22 3LE0A 3OGSA 4MH0E 1DQ2A 1F5FA 4UW3A 4CP0A 3BIEA 5LW9A 1WD4A 3IT8A 4UF0B 3UGHA 1F2NA 5E6HA 1W6MB 5KHIA 5A3WA 1REEA 3VDCA 1VAKA 4PI0A 1XB9A 4OQ9A 4AFAA 4XFFA 5GKAC 2WNVC 1GICA 2WZR3 5GJ6A 5JR7B 5IATA 5EJ1B 3BTZA 2RS32 3D4KA 2VTFA 3C7GA 4P9XA 1G9CA 1PM7A 1WD3A 3HOBA 4XJAA 3TN93 4DQAA 2WZR2 3DYPA 4P00B 1ZRDA 2VMCA 1D2SA 1HX6A 1QXJA 3VN4A 4HVRA 1RUC3 2D5FA 3O1TA 1NY72 3AVRA 4ET7A 2UYAA 4CCKA 1X9PA 3ZN5A 4LUMA 2G1MA 1AXYA 1EAH1 1ENQA 4C0BA 2JE7A 2R0HA 1UY0A 1MS4A 5J1XA 1NLSA 4L2NA 2VZOA 2YUEA 2XWJB 1AXKA 1XE0A 5JSRA 2R043 2QQUA 5LA1A 3B7MA 1PK6C 4QWNA 3P6BA 2OUJA 5IAVA 5GZFA 3VV1A 5FQ0A 4Y1VA 3K4AA 1OPMA 5HV0A 1VJ2A 2R041 3AMHA 4GJZA 1CJDA 4P9GA 4DEQA 1Z0HA 1PVXA 3H8OA 1ZZ7A 3SH4A 1AYN2 1CD3G 5FPVA 5I0RA 4LTAA 1FOD2 2G9GA 2VZPA 4IGOA 1V0AA 3VUOA 3ZXDA 1XNKA 2PAMA 3U37A 4FPEA 2JEMA 4ZPIA 1DQ5A 4F7ZA 2ZHNA 2E51A 2D3SA 3HN1A 4IETA 4SBVA 1SPPA 5FY7A 4SLIA 4HPKB 2DVBA 1G86A 4PQ9A 4YZ2A 1B35B 2CSGA 4PIXA 1GOGA 1CX4A 3MF6A 4NRMA 4Y3OA 5JR2A 1ULCA 2ORXA 1YNAA 1UZWA 1YQ5A 2P1BA 5FFOC 4GH4C 4G9SB 3D0SA 1OKQA 1RL3A 1XE8A 3AKSA 2GP3A 4QKNA 4QQLA 4WBBA 5FY5A 3MI8A 3LPGA 1VBB1 1WCKA 4NHMA 3OGJA 2JG9B 1S4CA 3U0ZA 2EF6A 3OYWB 5H9RA 3KGZA 1ND2C 2D3PA 1VRH3 4A2UA 5FZCA 3T2QA 3ZSKA 5FWJA 2ZGUA 4AR2A 4RD7A 4DRVA 5ANNA 1EV11 1RUOA 3C7OA 1AR73 4OVEA 2PHDA 4BDVB 1NXD1 1ZZBA 4H55A 3LEGA 4XE9A 5CZKA 2YGMA 1TME3 2VTXA 2AUYA 5IVVA 1CWPA 3T4VA 4IGQA 5F5AA 3BGAA 4KBZA 3AFKA 1V70A 2BNNA 2RS52 4KU7A 1C3HA 4XXAA 5JIAA 2XVGA 1OQDA 4OMDA 1HN1A 1W0PA 4PLMA 2BBVA 3VZKA 4INDA 1IKQA 1KGYA 3WG3A 3OTFA 1QDCA 2B7YA 1A8MA 1AR62 1IPKA 1R082 2D6PA 1UU6A 2WS91 5JMOA 1KS5A 4AI8A 4A7ZA 2J22A 2LUWA 2VZUA 3MDPA 2HWB1 4ASMB 1U0AA 4Q29A 5BYNA 1NXMA 3WSOA 3KV9A 1GR3A 2R49A 1ZX5A 2VTXJ 3W58A 1W06A 1O4TA 2Z42A 1XE7A 4MGSA 3JBG3 3T2PA 1FT9A 2JG9A 1H2KA 1XNAA 5LZ6A 1QNYA 5CG9A 2BVBA 1HB1A 3P1IA 4JGYC 4IV1C 4UT5A 1UOJA 2ERFA 2ZTNA 3E97A 1PGSA 3PTYA 2CGPA 2HWF2 3HEIA 5T52A 1POV3 2ARAA 3T1LA 2XB6C 2BGOA 3WNXA 1CAXB 4Q2FA 4Z1VA 1K12A 2VY0A 3UETA 2RMU3 1V9U2 2YMZA 2VVFA 3NV3A 3NAPB 2ZEZA 4ONUA 4NHXA 1ODNA 4YM3A 3RYKA 4D6SA 1POV1 4HMZA 5C4WC 1ZRIA 1LU2A 3C2UA 5D8AA 3LIGA 4AQ6A 2QQVA 1RXGA 3KCCA 2Y38A 2VOVA 5G04L 4RGKA 4WM7A 4LHKA 4XHBA 1YHFA 4XW3A 2OIIA 4E8CA 3FLPA 1XU1A 2VQAA 1UX7A 4QQOA 1QJY2 5A7SA 1COV1 1D2QA
chains in the Genus database with same CATH topology
2ZGNA 1RVF2 2XG3A 4IXLA 2XUMA 1HLCA 1AYM1 1Q8QA 1WW6A 4HN1A 1MACA 4FXGB 5E89A 3IPVA 4FO9A 2WSVA 4Q26A 1VBD2 2FBEA 5F6KA 1QH6A 3JCIA 4EN8B 2GU9A 3LOIA 4FTBA 1WW4A 1SLTA 4FTSA 1PMIA 2R063 5HBAA 2CAUA 3ZSJA 4HK9A 1AR71 4JDOA 2X53S 4K7JA 3CJIB 3BPZA 1RITA 3A0KA 1OLRA 1HXS2 4A7YA 4LULA 1ZBA1 3H3ZA 1OOPC 4ZU4A 1EYBA 2PAKA 2UWAA 5T3NA 3U10A 4P9LA 3MIHA 4D7SA 3TNQA 5CFDB 5DG2A 1NCRC 1WLCA 2QZ3A 1ZBA3 4C91A 1FX5A 4RS5A 1AL0G 2VMGA 3DUIA 3TBDA 4FQZA 1ENSA 5C9AC 1Q5OA 2E53A 4PDWA 3CJIC 3MLKA 2JE9A 2WA4A 1QJZA 2W68A 4QPIB 1HRV2 2W0XA 2OYZA 3N35A 4ASLA 3WG1A 1OMIA 4C0HA 1MZ6A 4CDXB 3BOWA 3M8LA 1FV3A 4FPKA 3V64A 4YM2A 5FLIA 1DGWA 3J8F1 4LUKA 1RUI1 5J3UA 2PHUA 2ZZJA 4QQPA 4MX3A 1MEC3 4XF0A 1TEIA 1UN1A 2WFPA 1QNWA 2A71A 3MF9A 3CJXA 4AEDA 5GZGA 4JC1A 4QGMA 5GM0A 3PJQA 1CQ9A 1S0FA 3AZYA 4KH9A 2MNGA 1FYUA 1COV3 2OZ6A 2W39A 1NA1B 5J09A 5GLWA 1S0EA 4Y4YA 2IXIA 3ZFFC 3MFCA 4MGIE 1LOFA 4QPGC 1EY2A 1S0JA 1ULGA 3FZ3A 2KM2A 1S1AA 2RE9A 2ZKNA 3GF6A 5J7MA 3AJZA 5D1IA 2Z5WA 3R4DB 2ZX2A 2WIIB 4XF1A 1CPNA 4AI1A 1EPWA 1PIV2 4Q0VA 1V6OA 4XTPA 3O12A 2D3RA 1CVNA 1GNHA 1JYCA 1RJ7A 1LHVA 4HETA 3TN92 1POV0 4FP3A 5T54A 5FBZA 1RUC1 4HSLA 4OULA 1MS9A 4LHNA 4RR3C 4HVQA 4WM8B 1A6CA 4ISRA 3VKMA 4D7YA 1H8VA 3OBTA 4AEDB 2DFBA 1O3SA 1APNA 4R9DA 3VHRA 4B7EA 1RB8G 2DURA 2D6LX 2X5IC 4ZXKA 5EYYA 1HV1A 3ZN6B 3E6CC 5JOZA 5IK5A 3E5XA 4GB32 2CV6A 2ZA9A 2IXLA 1I5ZA 3JQWA 4RHV2 3OGGA 3ZMOA 1W6NB 5T5JA 5D8AC 4IEYA 4OHXA 4JTOA 3ZSMA 1RVF3 4Q4W1 2A6ZA 3JD72 1AX2A 4Y26A 4PDWB 1PVC3 1XU2A 5CNAA 1WLWA 1LULA 4GIQA 4YG0A 5CAZA 2A5ZA 3MIFA 3I7DA 4YVWA 2R1BA 3N7MA 4C1WA 1GZWA 5CBLA 4XXPA 2WT2A 5AFEA 2A73B 1LOAA 1O4ZA 2GC1A 2WC2A 2XVKA 1RUF2 4AQ2A 2VOKA 1VBC2 3AP5A 4XEZA 1UU4A 1G9FA 4IEQA 3SH3A 2NPIA 4Y1UA 4K20A 3GBFA 2QNKA 2Z69A 4OI0A 4MGYE 1OPOA 1W6OB 4EV0A 1ZREA 3J4UH 1QQP3 2GNMA 1K5MB 2ILMA 2K2SA 3T1MA 3ES4A 4I0WB 3PJYA 1OOPA 4AK3A 2ARXA 1ZZ6A 2R062 3DN7A 4RA0A 2A6VA 2F4PA 2IXCA 1RC6A 1RTVA 2O0OA 5LRSA 2CL2A 3IDCB 1NCRA 3R05A 1X50A 3L9JT 4LHLA 4ATEA 4AG4A 4W6WA 3VBFC 5K8SA 3LSDA 3DGTA 4Q1RA 2H0VA 4J1XA 4N7UA 3ZO0B 1ND2B 1QXPA 1OA2A 3ECQA 5E88A 2OW4A 2PAEA 4TLFA 4Y1ZA 1LR5A 2DCTA 1QQP2 2Z2SB 4QXKA 1QJY3 3QD6A 1H1IA 1HV0A 2DCKA 1G9DA 4PLOA 1J3PA 1H8TB 4AHXA 1DZTA 5HCAA 1ZZCA 1XRUA 4YZ1A 5DZGA 2YPJA 4KU8A 1AR81 3ZXGA 3VBSB 2AYHA 2XLGA 2YHJA 3B93A 4OI4A 2E9QA 5KHGA 5L7OC 4CDWA 1H9PA 1YUDA 3ZPYA 5FO8B 1QOOA 3J8F3 2NZ9A 1RUI3 4HVOA 1PO13 3G7DA 4LO5B 4YVSB 2HWF3 1D4M1 4AFMA 1VBA3 5CFCA 3IN9A 2WNUC 1VALA 2VMIA 3R0RA 1AX0A 1UKGA 3RPQA 3IBMA 2NYYA 3N36A 3ZIXA 2A6XA 4RGAA 5DUXA 1VBA1 1Y7BA 1PVC2 5FOBB 3W9AA 4AHWA 3WP6A 2MPFA 1UAIA 5K9YA 5EFUA 2V5YA 1BEV3 5DXDA 3APBA 4RHV3 4OFGA 1AR63 3ILRA 2R042 4PF5A 4FPJA 5JVVA 3R6SA 2ZX0A 4AF9A 1SLAA 5CG8A 2HEWF 4GWMA 3VL8A 2JKBA 2XWBB 1LJ7A 1SBDA 3PLQA 1W6PA 3OBRA 3WY6A 4AVBA 5DZFA 1VLNA 2A75A 1WA4A 3FFQA 1NE6A 2RR12 4FPYA 1IS6A 4I01A 1QKQA 2JG8B 1NYWA 3KCYA 3ZFEC 1GQGA 2A70A 3KSCA 3OYWA 2C5DA 5FPXA 1C28A 2DVGA 4BMEA 2B46X 3KD4A 4QPIA 4YNIA 4XBQA 2FHRA 1AHSA 3K51A 5C4WA 1NCQC 1CAVB 3HBZA 3V0AA 2XBO2 5DUWA 2R6QA 1IKPA 5J36A 5BNQA 1YRZA 4B4QA 2YY1A 4XHXA 3MW4A 4L11A 2XJSA 2GDFA 4MGZE 4XQDA 4EWDA 2VNOA 1SQ4A 4IL7A 2PN5A 3KMHA 3H7JA 3M2MA 2R073 2DCJA 4QHBA 2ZABA 5DDJ2 5IK4A 5JLVA 1R1A1 4M00A 1TQ5A 4P14A 1CAWA 2QDRA 4LNVA 3WDYA 2IXJA 3AMQA 1CAUB 1DZQA 4AFDA 3H9AA 1LHOA 3E5QA 2BFUS 1PGL1 3VLBB 3AKPA 1RUE2 3WUCA 1YJKA 1UCXA 2G9FA 1PO11 4XJUA 3FMGA 2DTWA 4OUMA 1LODA 4J6GA 3ES1A 2Q30A 2GMPA 2JJ6A 4ITCA 1RGSA 4YM0A 4EN7B 1M06G 3POSA 1B35C 5I91A 3I2DA 5H9SA 5I0SA 2HWC3 3VBOC 1ZBE3 3AFGA 2BW8A 5BNNA 4HK8A 4F83A 4RFT0 4CDUA 4BE3A 1ZBE1 4JTNA 5A32A 2CYFA 4AGRA 3D6EA 2DFCA 3AZZA 3ZXLA 1FMD2 3IIAA 5KXDA 1MVQA 3FWEA 3C3VA 4LA2A 1WLTA 4JGZC 1O3QA 2KXLA 4B29A 2ZX3A 2XL9A 1WMEA 2Q8OA 1BVP1 5JZGB 2JECA 3VBRC 2WT1A 3UKTA 2PHXA 2WJSA 3ZX7A 4CEYA 4BLJA 3N3HA 3D82A 1RUJ2 2JG8A 3VBUA 3QOPA 4Q0SA 3BB6A 4QM8A 1D4M2 1BJQA 1YFYA 1RUD2 3PVOA 1RUH2 1BZWA 1C1FA 2EXKA 4NVPA 1LGCA 1WBFA 3MIGA 2AZ5A 4X6QB 1I9RA 1VBD3 4E9KA 1VBA2 4EROA 4X8NA 5CFCC 3OY8A 1VP6A 1AJOA 4JVAA 3JB4C 1HXS1 2ZJCA 3VBRB 4RQPB 2X8KA 2Y0IA 4GALA 1TME1 4FPHA 4IV3B 4C1XA 1AR91 1GSLA 1S0CA 4I2OA 1W6QB 2DUQA 4LBOA 1ND3C 2HWC2 1LENA 1WMDA 1IPJA 4DS0A 1YFUA 5CFCB 4X6RB 4AI3A 2ZMKA 3MLJA 2QDNA 1REDA 1BEV1 5I8SA 1KJLA 4CEYC 4LBQA 2ZGKA 2Z79A 3DKWA 4B4RA 4COZA 3WP3A 2X5IA 4FSJA 5EWSA 1YXWA 5C8CC 4XFAA 2XJVA 4N43A 2JICA 1YI9A 1S0GA 3QH6A 3EQEA 3ZYRA 1EP0A 4NWWA 2HEVF 2FQPA 2R0FA 2NQYA 2ZS6B 4MYEA 3E6DA 3OPZA 1QJU3 3VKFC 1WUVA 3K48A 1N1TA 3FUOA 4N53B 2C9AA 4WVMA 5GLUA 4LO4B 3WQ7A 4BLIA 3WXPA 3AK0A 1PIV3 2WKKA 5DDJ1 1GQHA 2VH9A 4Q4V2 1BYHA 2PHTA 2BGCA 3R4SA 3VKLA 3MW2A 1JXNA 5FLHA 4R4ZA 2DUPA 1NLRA 2EXIA 5JIUA 3FLRA 5BV6A 1XNBA 4S2DA 2D6OX 3NV4A 4AHZA 5JPNB 1U5IA 1IHMA 4EN0A 3NKGA 1WMFA 4Y22A 3ZFGC 1CAVA 1N3OA 3V0AB 3D8CA 5C4WB 3Q9OA 3ZYJB 1ULDA 2WNEA 1V6LA 4BQ1A 4LE3A 5BNOC 4GKXA 1F5JA 3OF1A 2WZR1 3IMNA 5F1RA 4KG0A 1C5IA 3PMSA 3TN91 3U07A 4P9WA 3SMHA 1U5YA 3WW3A 4BCUA 1LOCA 3UK9A 3ZXFA 4P9YA 1NQDA 3NL1A 2D6MA 4LLFA 2O8OA 3WZ1A 5ABJA 1QMJA 4PBOA 1H8TC 1FOD3 4BWOA 4AI0A 4WZFA 4E4SA 1LHNA 1LHUA 2ZX4A 3WG4A 2ET7A 1W6QA 2IWGB 4ZU7A 4N7IA 1TMF3 3IWZA 5T55A 2EXHA 1MS1A 2ZHLA 2HEYF 4D94A 3RQ0A 4Z2WA 1FOD1 4COYA 3AKQA 2NMNA 3MGUA 1NA1C 4D69A 4OI2A 2WFF2 4GMP3 2BWAA 1WW7A 3UKVA 3JQXA 5JMCA 1QOTA 2PHWA 3WDVA 5BNPB 4AEKA 1YIFA 2XLFA 1IGOA 4YZ3A 4GMP1 2R1DA 3ELNA 5JDBA 3USUA 1X36A 3WW2A 4WVZA 4BA6A 4P9JA 2GH2A 4LR4A 4WM8A 1BMV1 4EWEA 3S7EA 3ETQA 1UMZA 3SITA 4M0NA 4L9BA 1COV2 2PELA 4MXWA 5IUQA 3VHOA 1OFNA 4AVAA 2D5HA 4RR3B 4YW3A 3MIEA 4XOGA 2B42B 3ILNA 1AL23 2VMHA 2XJPA 1J1LA 1PGL2 1JW6A 1GKBA 2QZ2A 2R16A 2EALA 2PLV1 4HZFA 4XJ9A 2VW2A 4DINB 4WVVA 1VBD1 1PZ8A 2X5IB 1QF3A 5JI7A 1MR5A 4BH9A 4LBQB 3ALQA 3MIDA 4LLOA 4W6YA 3AXDA 3I59B 5FOJB 2WS92 2JENA 1H0BA 4JRAA 1NA1A 3N4MA 1KD7A 1BQPA 3AM2A 3BODA 1HRV3 2QUOA 4MV2A 1H1AA 1VB4A 2VG9A 3N7KA 4R9CA 1SLBA 3ENRA 3ZFFB 5JCTA 3ZYIB 3LAGA 2IXKA 5E8AA 2H6BA 2W52A 3WQ0A 1URXA 4QM9A 4NHLA 2AREA 2ZACA 2XJUA 2E6VA 2WL1A 1FNZA 4V1PA 3RJRA 5FO9B 1R1ZA 1CAUA 4GH4B 2CGOA 1QU0A 2EAKA 2SBAA 3TYJA 3ZVXA 3VBUB 1G6NA 1RVF1 1DGLA 4Q4W3 4RS5B 2DU1A 1O5UA 2Y26A 2NM1A 1XYPA 4AEDC 1PVC1 1BKZA 4YARA 5KBFA 4Z92B 1RUH1 3TAYA 3MIBA 1AL22 4Z82A 5BNPA 2FMYA 1EAH2 1FATA 1KFUL 4HT1T 4N9HA 2XPJA 1MZ5A 2UY9A 1YIPA 3S30A 4DOUA 1ZZ8A 2DVDA 2RM23 1E57A 1R081 5KWRA 3B00A 4R4XA 4JRLA 5A32B 1RUG2 2BYVE 3KT4A 4QX5A 2AGSA 3H1WA 3N7LA 3VHNA 3SCGA 4BHPA 1OD5A 3B9IA 2HWB2 2RM21 4WZCA 1XYOA 1C8M2 2ZGTA 1UU5A 3RRDA 2HWD2 1SACA 3CL1A 3SXWA 3RI9A 2JD4A 4CDUC 4XBLA 1VBE3 3WP5A 3CLPA 1F31A 1ZRCA 1ENRA 1Z7S1 4CRQA 1I3HA 4Y5Z0 3P3NA 5CA6A 4B7KA 2ZCWA 1RINA 4CEWA 5HXVA 1RUE3 1NZCA 4XFHA 5ACA3 4F8AA 3IKWA 1OQ1A 5LEKA 4YVWC 5EJ3A 3LWCA 3P3PA 2WS93 2D97A 2DTYA 4R52A 5EYXA 1DF0A 5ACA1 1WCDJ 2VQ0A 2XKPA 4XZPA 3VBRA 1QJY1 4EWAA 4NR1A 1UW8A 4XJZA 1CESA 4K8FA 1QJX3 4RQPC 3WV6A 4NWVA 1AYM2 2VU9A 2WT0A 1FPN3 4XF3A 5FREA 4CDWB 1RIRA 1KXGA 1UD1A 3INAA 3V0BB 3VBHC 1OFSA 1QJU1 4YFWA 1HRI1 1ND3B 2WQZC 2GALA 3B01A 4GULA 4COUA 1TNRA 1BVVA 2UURA 4K40A 4DMIA 1UF2C 5A3LA 1HRI3 3SHRA 4I09A 1ENXA 3EO6A 4S2HA 3MPPG 1OI6A 4Y20B 3H0OA 4XMIA 1ND2A 2RS11 4OI1A 3JU9A 3O7OA 4ISQA 3M3OA 1ZBA2 1ND3A 3FX3A 4COWA 3KS7A 3HMYA 5AVPA 4DY5A 4Q4V3 1UIKA 1Q8VA 2ZMNA 3H50A 3VKOA 5L7OB 1AYM3 2PTMA 1O3RA 5CFDC 4DNYA 1NCRB 1LESA 1DHKB 4KGGA 3VZNA 4Q4Y3 4LBJA 4N9IA 3WD5A 3HQXA 3DPRA 2XL7A 1SEFA 3M70A 3WVJA 1WW5A 1DQ1A 3VKNA 2F6BA 4HSJA 5JPMB 2R061 1HRV1 1TNFA 2QCSB 4IV3A 2R072 1RJ8A 4MZUA 1FAYA 4ORFA 5DZEA 3AP4A 5L7OA 2G4IA 4ES8A 4Q0UA 3HIFA 3VZJA 3BTAA 2FZ2A 2GH8A 3KT7A 3SISA 4XQWA 4CEWB 3AMPA 1RUI2 2WNUA 4CTEA 1KFXL 3AP6A 3LB9A 2WLQA 4JQRA 4YLZA 1JOJA 4FOWA