1LHVA

Crystal structure of the n-terminal lg-domain of shbg in complex with norgestrel
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
177
structure length
173
Chain Sequence
b'PPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEX HORMONE-BINDING GLOBULIN
publication title Steroid Ligands Bind Human Sex Hormone-binding Globulin in Specific Orientations and Produce Distinct Changes in Protein Conformation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 31
structure length 173
sequence length 177
ec nomenclature
pdb deposition date 2002-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00054 Laminin_G_1 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lhvA00
3TAYA 4UW6A 2V5YA 3JU9A 4Y1UA 3VKFC 4BPZA 4FOWA 2JE9A 1UMZA 1AVBA 4FQZA 3AZVA 3KQRA 1WCSA 4BOWA 4YW2A 3FLPA 1LHVA 2FMDA 1LJ7A 1Z78A 1FNYA 1S0BA 2P34A 1LECA 5DUUA 3BOPA 3OYWB 3UJQA 1YXWA 3RRDA 1W6OA 3ZXEA 1MS8A 4XDQA 4XMAA 1CESA 2ZHMA 3LSDA 4XTPA 4LBLA 4YW3A 4BLJA 2YV8A 3VKMA 1HDKA 4D69A 1LU2A 3WDUA 1W6MB 3I8TA 4HANA 4KBBA 3NV3A 3O0WA 1CR7A 3LCPA 2GNDA 1S1AA 4GKYA 2DVFA 2BQPA 3WNXA 3OJBA 1FAYA 5DUWA 4YFZA 2E7QA 3D4KA 5IK5A 2PHUA 3T1LA 4YM2A 5H9RA 4M3CB 2DYCA 4K1ZA 2LALA 3ZSLA 5F9TA 3OBRA 4FPJA 2EIGA 1G9BA 1UX6A 2JJ6A 1LGBA 3D5OA 4Y20B 4BLIA 1Q8PA 3CNAA 1DIWA 2AGSA 2OW4A 4YW5A 3N7JA 5CBLA 1SBEA 2E6VA 4FQ4A 2V73A 1DHKB 1LHWA 3IKWA 2AREA 1EPWA 3TB0A 2A3XA 1QU0A 1I3HA 2VW1A 3WDWA 2UURA 3R4SA 4Q8KA 1LHNA 3AX4A 2VU9A 3HMYA 1W0OA 1DYPA 1HLCA 2EAKA 2DUPA 2ZGOA 3AZWA 3FLRA 2H0BA 1S0GA 1S0CA 1VLNA 3WUCA 5DG2A 1CQ9A 1N3QA 1AX2A 4DRVA 2YZ4A 2NM1A 3JUUA 5E8AA 3B9CA 1N3OA 3AJYA 3M3QA 1MVQA 4M3CE 1LEDA 1LULA 2AR6A 4LBJA 3ZXKA 3AJZA 4YZ3A 3FFZA 4YM3A 1LGCA 5JVVA 2A3WA 4XJ8A 2ZGPA 2DWRA 3ZXFA 3FLTA 2B7YA 3AFKA 1I1EA 2JDZA 1BKZA 3FUQA 2JD4A 5F5QA 1D0HA 3SITA 1LOBA 2D6LX 2W52A 4XZPA 1LU1A 3USUA 1GZWA 3IM0A 3BIWE 4ISRA 1MS4A 2VXRA 4DS0A 4ZKTB 4GWNA 1G8WA 1UAIA 3B3QE 5HCBA 4C1XA 1KDMA 4FPYA 4LBOA 4XMIA 3ENRA 2ZHKA 1QGLA 5HCAA 3VKNA 1S0EA 1KRIA 3AP6A 4XIOA 1ENQA 3ZVXA 1W6PA 3SH5A 2JKBA 2NN8A 3B00A 3VV1A 2GMEA 2ZGQA 4YGEA 4Y1XA 2PELA 4XJ9A 4AGVA 4WVVA 3AZYA 1UZZA 5H9PA 2A3YA 1MZ6A 2ENRA 2UWAA 5T54A 2DUOA 1G86A 4L8QA 1H30A 3UJOA 2ZA9A 1CN1A 3WZ1A 2D6KA 4AYUA 4FPEA 1UKGA 5JMCA 4GKXA 2KM2A 2W08A 4UW5A 3T1MA 1B09A 1UPSA 5GLWA 3WUDA 1WBLA 1JXNA 3WG3A 2VW2A 4NO4A 2ZGKA 5T50A 1MS9A 3A0NA 1WLWA 4FOVA 2D3SA 4YFWA 3WCRA 2ARBA 2DTWA 3BTAA 4LBNA 4W65A 2A71A 1QNYA 1VAMA 1LHOA 1Q56A 5KXEA 1Q8SA 1A3KA 1JYCA 2DU0A 2GMMA 1F5FA 3IMNA 5EYXA 5IUQA 1MS5A 1H9PA 1VIWB 1KJLA 2VH9A 4K1YA 3M3CA 1GZWB 3USUB 4DQAA 5T5PA 3ZXJA 1IS4A 5IK7A 5H9SA 1DQ0A 3M3EA 4ASMB 1JBCA 1LEMA 3V64A 1ZM1A 4LBMA 4AVVA 2TEPA 4PCRA 1QDCA 1W6PB 1LOEA 4AVTA 2D6NA 1CJPA 1LOFC 4ATEA 1ULGA 3NV1A 1NXD1 4Y22A 2EXHA 3BODA 3DGTA 1GSLA 1IS6A 1J1TA 2A6YA 3B01A 2A6ZA 1ULDA 4IQPA 2ZGRA 3PVNA 5CNAA 3GALA 1URXA 4Q2FA 4UW3A 1V00A 4JCKA 2C5DA 2Z42A 4FP2A 1V6MA 5FRAA 3AXDA 3IN9A 4YZ4A 1SBFA 3FUOA 5E89A 1XQNA 5JLVA 3PVOA 4Y24A 2DVBA 4YG0A 4Q1RA 4YLZA 2NP0A 2WQZC 5DZEA 4M01A 1WLDA 1WW5A 3AP4A 4H55A 3GNEA 1N47A 2ZGUA 4XHBA 1DZQA 4RA0A 1GANA 2PHWA 4U36A 5EXOA 5GLZA 3RQ0A 3VUOA 4P9WA 2EXIA 2P3JA 4Y1YA 3NV4A 3WG1A 5KXDA 1U0AA 1SFYA 1DQ4A 4XBQA 2D6PA 1YYNA 1JOJA 1QOSA 1VALA 2DV9A 2E53A 2ZABA 1N1TA 2DTYA 4PQ9A 3VKLA 4BMEA 3PVEA 3QCWA 4YGBA 1IKPA 3M1HA 1ENRA 2UWCA 4DFSA 4UW4A 1MACA 3MEPA 4FPCA 1DGLA 1WD3A 1JHNA 1F9KA 1DLLA 5LK5A 4FP3A 1LHUA 1SLAA 3W59A 1V6OA 3RMXA 1MR5A 2GMPA 1AXYA 1YRZA 2GNBA 2NMNA 2CL2A 2YROA 3O0VA 1W6OB 4Y22B 1NLSA 5T52A 1WW4A 2GNTA 1S0JA 5DUVA 5T5OA 3A4UA 5DUXA 1S0FA 4XHXA 3WHUA 1G9FA 3WG4A 1FV2A 2R49A 4YZ1A 1ZA4A 1AZDA 1QOTA 1WD4A 1QMJA 3MW4A 3ILRA 1V6LA 3RS6A 3RMYA 4AWDA 1RITA 5EWSA 3R05A 2A75A 3SH3A 3WDXA 4XJUA 2CTVA 2A6XA 5T5JA 4BMBA 3V0BA 1WLCA 1UN1A 2OUHA 2ZAAA 5DZGA 3POYA 3SH4A 1IS3A 4XE9A 2NZ9A 4NOTA 1DQ2A 1AX1A 1DQ1A 1OFSA 3B69A 4HL0A 4M3CF 5CB7A 3WV6A 4SLIA 2DUQA 4XXAA 2R0FA 3ATGA 4OZXA 1QOOA 1IKQA 1DYKA 1GICA 1ONAA 1GZCA 1D2SA 2A6WA 5SV8A 1UL9A 4YGCA 2YMZA 2ZGSA 3ZSJA 3ZYRA 5GM0A 2DVAA 1GV9A 2XB6C 4MYEA 4WV8A 1AJKA 2AH2A 3HN1A 5KXBA 1S0IA 2DVGA 3WOGA 4YG6A 4XOGA 4Y1VA 1WBFA 4BM8A 1KITA 1H9WA 2EALA 3W58A 3M3OA 3ASIA 1LOFA 3N36A 2ZMKA 2GNMA 3U4XA 3WDVA 5KXCA 1WW6A 4PF5A 1BQPA 3AXEA 5CAZA 4GXLA 1MS0A 1HQLA 4Q26A 4XIKA 4XYXA 2A7AA 3D6EA 4AGRA 1BZWA 1Q8QA 3OYWA 5DXDA 1LODA 3AYCA 1FX5A 2ZHLA 2AENA 4P14A 5GLUA 4CRQA 4M00A 4BQ1A 4YW4A 1MZ5A 1N3PA 2R1BA 4JC1A 5EYYA 1G7YA 1GYKA 4GALA 3V0BB 1SCRA 3I4IA 3SISA 1FNZA 1ULEA 2D6MA 4PBPA 4Q27A 3C2UA 4XXPA 4XTMA 2PHFA 1LOAA 3PMEA 5IK8A 3M2MA 1V6NA 1ENSA 2A5ZA 3MW3A 4XJWA 3POWA 1FYUA 1X50A 2ZGNA 4ITCA 4YG3A 4Y26A 5L73A 1LOCA 3ILNA 4R9BA 2HYKA 1G9DA 4FOYA 3AYDA 1GBGA 2I2SA 2ZBJA 1SLIA 2A6VA 1JW6A 2E51A 2ZKNA 4WZFA 2GN3A 1LOGA 3Q9OA 4Y1ZA 5BYNA 1W6QA 5CA6A 2VW0A 1DFQA 1JUIA 3AP9A 1BYHA 2Q5TA 5GZDA 4XBLA 3N35A 4RL7A 4YW1A 3WDTA 2GN7A 3O12A 1OKQA 1F31A 2OVUA 2P37A 5IK4A 1Q8OA 3UL2A 1CVNA 1A78A 2CNAA 1KJRA 2CY6A 3AP7A 1CPMA 3AZXA 5DG1A 3V65A 4DRRA 2ERFA 2RHPA 1JYIA 2GALA 1FATA 3N3HA 4YM1A 4YM0A 3ZPYA 1FV3A 1VAVA 3APBA 5GLVA 1G9AA 1O4YA 3OGGA 4AVSA 1AJOA 2NYYA 2VY0A 1SLBA 4FPFA 5FREA 1GZ9A 3PJQA 4FPHA 4TYSA 2WJSA 5GALA 2EXJA 3H0OA 2D43A 1V6IA 4DPNA 4P9XA 1AXKA 3POSA 3RSJA 4Q1PA 3RG0A 3WDYA 2JE7A 4FPGA 3WCSA 3WG2A 1A8DA 1BXHA 1YIFA 2R16A 1W6NA 2UU8A 3ZXLA 4YZ5A 2R1DA 5JOZA 2P3KA 5H9QA 1YO8A 4YGDA 5JDBA 3AK0A 1CONA 1JN2P 2AYHA 3N7KA 3AYAA 2DURA 4FPOB 3IPVA 1SBDA 2D6OX 2P2KA 5GZFA 2VUAA 2UWBA 5JOXA 1W6QB 3LSEA 2EXKA 3DUIA 4CTEA 4XBNA 4CZSA 1V6KA 2CWSA 3NV2A 2PHRA 5DZFA 5T5LA 4ISQA 1UZYA 4PBOA 1AF9A 1AXZA 1MS3A 3SLIA 2LTNA 5IT6A 1LESA 2CYFA 2D3PA 5GLTA 3HR9A 5T55A 2WT0A 3N7LA 3ZSMA 2ZHNA 1DQ5A 1GNZA 4K21A 4LBQA 3R4UA 4XJAA 2ZGTA 4F83A 2ZMLA 2E7TA 3O5SA 3UK9A 1CIWA 4FOQA 1C1LA 1KDKA 1TEIA 1V6JA 2ZGMA 3AP5A 3V0AA 1PZ9A 3T2TA 4ZXKA 4FVVA 2FHRA 3VKOA 1Q8VA 2WKKA 1SLCA 1W0PA 2WNEA 4FPKA 4GWMA 2W68A 1C57A 2ZGLA 4K20A 4AGGA 3A0KA 4YZ2A 5GZCA 1WW7A 1ULFA 1QDOA 2YXSA 2YY1A 3OPZA 3WHTA 1SLTA 2R0HA 1PZ7A 4XJZA 1RIRA 4U2AA 1LENA 3OY8A 4LBKA 5E88A 2W39A 2EF6A 2XG3A 3MPPG 4R9DA 1W6NB 3AYEA 3OBTA 3WVJA 1HKDA 2WLQA 3IPVB 3L2YA 1QKQA 2ARXA 1S0DA 2GDFA 3ZSKA 2ES3A 1G9CA 2JECA 5HCFA 1DBNA 1WUVA 2AUYA 2P3IA 1YI7A 4GA9A 2C9AA 2WT1A 3FBYA 4R9AA 1GKBA 2PHXA 1O4ZA 2ZACA 1HQWA 3N7MA 1IS5A 1ULCA 1N1SA 2A70A 1APNA 4R9CA 1AX0A 4XILA 4LBQB 4ATFA 2ZMNA 1Z0HA 2WT2A 4WVWA 1MVEA 3ILFA 2SBAA 1W6MA 1QF3A 1N1YA 2DVDA 1QNWA 1SACA 1BJQA 3INAA 3V0AB 1N1VA 2PHTA 3MW2A 4LBQD 5GZGA 1MS1A 3WLUA 5GZEA 2CWMA 3O0XA 1GNHA 5JOWA 1OQ1A 2D44A 1GLHA 4FPLA 1SCSA 2DU1A 1IOAA 3SNMA 2SLIA 4Q8LA 5GJ6A 3ZYPA 2D7FA 4Z8BA 1PZ8A 2WSUA 4I30A 4JRAA 1C1FA 2D3RA 4M3CA 2ZZJA 4P9YA 4TZDA 1R1ZA 1CPNA 1LTEA 3QLQA 3KM5A 1RINA 4C1WA 5JOYA 1DQ6A 1SLLA 3NWKA 2OUJA 4Y20A 2G4IA 2NMOA 1KQRA 3OY8B 1LCLA 1C4RA 5AVAA 1Y7BA 3AZZA 1LGNA 2WSVA
chains in the Genus database with same CATH superfamily
1PMJX 2I07B 2PHLA 4FAGA 2V5YA 2JG8C 3JU9A 4QXBA 4BPZA 3GDBA 4FCAA 4FOWA 1F4AA 5KHKA 3BB6A 5C9AC 5SV5A 3CZJA 3KQRA 4BE3A 1OLMA 1HX6A 1O5LA 1QH6A 2FDHA 4CEYA 5C4WA 4B4QA 2VCMA 4FSJA 4ZHNA 1FI2A 2CHHA 3OYWB 1COV3 1UOFA 1W6OA 4OI4A 1WCQA 2X05A 4CYDA 3VBFC 3LSDA 3HBZA 1Y3TA 3O1VA 4Q29A 5FYHA 4ZZ5A 4D69A 3DXUA 5FKCA 1R093 1W6MB 2QVSB 4BB3A 1W8HA 5BNPB 4IE5A 4E4ZA 3AVRA 3LA2A 3P1IA 4HFSA 4TN7A 4Y33A 1Q3EA 3O0WA 4NAOA 4XZUG 3UGHA 5IVJA 3DPRB 1PNFA 3OPTA 3OCPA 4FT8A 4LO6B 5LRSA 3H8XA 2J1UA 3WEZA 5BNQA 1REEA 3LDRA 3PNAA 4HLTA 2XJUA 2DYCA 3ZSLA 4FPJA 4D6SA 4K3UA 1UX6A 1DU3D 4W50A 2J1RA 1DIWA 2AGSA 3KMHA 4LEJA 5A32B 2UYAA 2VZTA 1PO23 1SBEA 2WUHA 1XYNA 4FQ4A 2JKXA 1RMU3 2FCUA 3JBG2 1QQP3 4NWVA 1GNYA 3OUHA 3TB0A 2VVFA 1EUTA 2XL7A 1QU0A 3CBNA 2VW1A 1TME1 4IETA 4JHTA 1D4M2 1W9TA 2W1WA 4JRLA 1MQTA 3AX4A 3VDCA 4C0HA 1W0OA 2EICA 3THDA 3U07A 1HRI2 1O4TA 3ES1A 1VP6A 1MEC3 2P17A 3FHQA 3HN3A 3FL7A 3LEGA 4J25A 3LB9A 1XYOA 2TUNA 4CXXA 3I2IA 2O8QA 1YWKA 5IVEA 4XQWA 1N3OA 2WWJA 1LEDA 1LULA 2AR6A 4LBJA 5C3QA 3AJZA 3NO8A 5I93A 1TNRA 1EUUA 2ZGPA 4F8AA 1OXCA 2I45A 2WZEA 1RVF2 3CU7A 4Y4YA 1D0HA 3SITA 1UW8A 1QJU3 1W8TA 2W52A 2ZS6B 2KA3A 2WNUB 2WN3A 4GWNA 3OUJA 2Y6HA 1OLME 5HCBA 2RS51 4URTA 4CCMA 1PK6B 1EP0A 4LBOA 5A33A 4CUAA 3POFA 2HWE2 1HRV2 3FZ3A 3LPGA 4NPRA 1YJKA 4GQ7A 4PF1A 4N9HA 2JKBA 2NN8A 3B00A 3UGGA 3VV1A 3CJXA 1DGWA 2QUOA 3SEEA 4B7KA 4CDUA 1B35B 3AFGA 2PELA 2PFWA 2C0ZA 2Y64A 4YGEA 3VBUB 4AI1A 1IGOA 1WA6X 4B1LA 4W4ZA 3KGZA 4A3XA 3UKTA 1OMIA 3BYWA 1FPN2 2D6KA 4QWNA 4XFHA 1NCQA 1VBA1 5CADA 4JGYC 5I91A 1JOPA 1RUH3 4GKXA 5DAPA 2RS32 2GC1A 1UPSA 2B5HA 2LM3A 1WGPA 2RR12 4IEVA 2HWD3 3WG3A 4NO4A 2WRAA 1Q43A 2ZGKA 3PTYA 2HWB2 3OGVA 4WM8A 5FZ8A 3E5XA 5K0UB 1SG3A 2J1EA 3VBOB 4YFWA 2D3SA 2WQ4A 4XFFA 4RR3B 1BVP1 4LBNA 1OHFA 4BQYA 2H6CA 2VMHA 2X29A 2E31A 3N9OA 2JG9A 4K9SA 3ZFFA 2RM23 1Q56A 1KFXL 1OQEA 1ULPA 2IXCA 4NRMA 2DU0A 1JYCA 5EYXA 5KXEA 1I9RA 2DCJA 3SKVA 3MIHA 1T2XA 2XBO3 3PIJA 1ZRDA 5FYSA 2W1SA 3VZMA 3ROUA 5C3RA 4OCTA 4K40A 1NQDA 4PLMA 4CXYA 5FR3A 3O1UA 2G9FA 4IDZA 5H9SA 1DQ0A 3M3EA 1JYWA 4NJ4A 5F6KA 3V64A 4LBMA 2OS2A 3B5LB 4WVZA 1LOEA 1NA1C 1XNKA 3O1RA 1HQNA 1LOFC 1WMXA 4ATEA 5IVCA 1MZEA 5CEHA 2R32A 1YNAA 3MIFA 3NV1A 1AL22 3T30A 4Y22A 2EXHA 2XR4A 1MZFA 3VDDB 2VCAA 4CVUA 1JZ3A 3J7NA 4HKWA 1UU4A 1O3RA 4IEPA 4AOCA 4CEWB 2A6YA 2P4EA 3I2GA 4UBGA 1ULDA 2R043 4WM7B 4AZZA 4QPGB 4UFMA 4CDXC 4GMP3 2Z42A 5JAXA 3AXDA 1SBFA 4NRPA 3FUOA 2BGPA 2W9XA 2R30A 2G9GA 2QQOA 2R6QA 4I02A 4C0BA 4AFCA 3MBWA 4Y24A 2DVBA 2NP0A 2VVEA 2WQZC 2O1QA 2B8MA 5BPXA 2WZPP 2BERA 5JZGA 2ET1A 2ZGUA 1OUSA 2VZ3A 3NVCA 2RDSA 5B2GB 1ULOA 2XUEA 1BHGA 5GLZA 4C8DA 1RUJ1 2ZZQA 3VUOA 2P3JA 4CDWC 1SFNA 1HXS2 2VECA 5KXDA 3AC0A 2WO2A 5BUVA 4AEDC 1YYNA 1GQHA 1ND2C 2FMYA 1UXZA 2WS91 2HBUA 1N1TA 2O0OA 2X8KA 2DTYA 4PQ9A 5D8AB 5KC6A 3NAPA 3I3BA 4BMEA 1UMHA 4YGBA 3UNPA 1D4M3 4DFSA 5A80A 1MACA 1O3TA 1WD3A 3E97A 5LK5A 4N43C 4XF4A 2B39A 1FMD2 1V6OA 1MR5A 1AXYA 2NMNA 1U5ZA 4FI9A 4LXLA 3HQRA 2EIBA 5T52A 1PVXA 3UGFA 3A4UA 3BVCA 1S0FA 1ZZ7A 4FXKB 2X09A 3WF3A 4CUCA 2X5IC 4XCBA 2GH8A 4XW3A 5I0DA 2PXJA 4NPLA 4QGLA 1VBB1 2FZ1A 4YZ1A 4JQTA 1RUE2 2ORXA 1WD4A 3GZTB 2ADDA 3ILRA 4D3WA 1OC1A 1X8MA 3SEPA 2QDNA 5EWSA 2VULA 4C90A 1PVC3 5JXGA 5I0TA 4B4PA 4LA2A 2R062 3WDXA 4XJUA 3CIHA 4V1PA 1WLCA 4UOJA 2OUHA 3MGUA 1IS3A 4CCCA 5JXIA 3HNMA 5CB7A 5JSOA 1JUHA 5JR7B 4YVSB 4D94A 4QPWA 1HRV3 4XXAA 2R0FA 1CJDA 4M4PA 1H8TA 3EQEA 4PDWC 4Y3OA 5SV8A 1UL9A 3RZKA 2XQRA 5FQ0B 1CAWB 4PIZA 4IXLA 2HWF2 3H8UA 2DVAA 2VQUA 3NKTA 2CV6A 1RUC2 3FC0A 4KWUA 4CP9A 1YC61 4CDQB 5C9AA 1AJKA 2AH2A 4OUSA 3TNPB 3BU0A 2VZUA 1S0IA 5FZ9A 1U12A 1RTVA 1XNCA 3UV9A 1F4HA 5C7GA 4IE6A 5LWBA 1IPJA 1H9WA 3M3OA 1JU3A 2BP6A 2C6SA 3ASIA 3OOXA 3S5AA 2D93A 2RS33 2VNOA 3AMQA 2ZMKA 3PTRB 2GNMA 4NHYA 5CFDB 3WDVA 4K6BA 5M0TA 4PF5A 3AXEA 3IDCB 4DOUA 1OT5A 3VZOA 4N53C 5FO7B 3P3NA 4B4RA 2Q30A 4MXVA 1RUF2 4ASKA 4HG6B 4PQQA 4LMFA 5KHHA 4AGRA 4HOOA 1S55A 4PHZA 3OYWA 4E4HA 5FDBA 1LODA 4IV1A 1W9SA 2HH9A 2AEZA 5GLUA 5LB6A 2CGNA 3W5MA 1MZ5A 1V9U1 2R1BA 5FYYA 1HB1A 4JC1A 5EYYA 1G7YA 1EAH2 2VPVA 1GYKA 2VZSA 3I3QA 4LR4A 3OB8A 4IEQA 1SCRA 4XUTA 4ZPIA 3SISA 3VZNA 4MVTA 1PGSA 5GKAC 4XTMA 2QQVA 1LOAA 3WXPA 1OPMA 3OBZA 3MIDA 4ASLA 2OZ6A 3LA7A 5EIYB 4HN1A 1X50A 3ZO0B 2MEV2 2W5FA 4XDOA 3K77A 1W05A 3ILNA 2HYKA 5AC92 2OT7A 2GSYA 4LE3A 1R082 5FBJA 1GBGA 5FIXA 1COV1 2QQMA 3GXUA 3KHBA 5BNNC 5FPLA 2A6VA 4MX3A 3VB9A 2GN3A 2KD7A 3ZXGA 3Q9OA 5L7OB 4AFDA 4FTBA 2CAVA 5DAVA 1GWKA 1FOD3 1R091 1DFQA 5IVBA 4RYDA 2Q5TA 1VR3A 4EV0A 4YW1A 5CZKA 3O1OA 4BISA 3RZHA 2GN7A 2XOMA 4BA6A 1CZSA 3NSTA 2YB7A 2WINB 2DF7A 2J1VA 5L19A 1XNDA 2CNAA 5FJKA 3KD4A 3GCXA 5DG1A 3ITQA 4JHZA 2GC2A 4NPMA 1FXZA 1E57A 2LS6A 1WMDA 2RHPA 3Q8BA 1CD3G 3O1SA 1HXS3 4GULA 4WVMA 3BOWA 1PO21 4O7XA 3ZX7A 3PIGA 5F6LB 5L36A 4QQOA 1AJOA 2NYYA 2XLGA 3THTA 2HEWF 2VY0A 2WZR2 2HJIA 3HWJA 2BFUS 3U75A 1YQ8A 4FPHA 4TYSA 4AL9A 1QQP1 4QM9A 3WQ1A 3ABZA 3H0OA 4Q0UA 1AXKA 2W0XA 2IXJA 1OI6A 4PT6A 1PGL2 4GWIA 1AR62 3K4ZA 1A8DA 2UU8A 4YZ5A 5AFBA 3LEIA 1VBD3 1R1A2 1YO8A 4CCKA 2JIJA 1CONA 1JN2P 2AYHA 1W03A 1MEC1 3E5QA 3QH6A 5A3MA 2BPA2 3BALA 2J1TA 2D6OX 4CEYC 5C4WC 4NIHA 1K5MB 2EXKA 4XBNA 3NL1A 4FAHA 1RUE3 1W04A 5LBFA 4LIVA 1CAUA 5J3UA 4ISQA 1UZYA 1AF9A 1AXZA 1MS3A 4XURA 2LTNA 1TME3 3K75B 1OLQA 4AI9A 3F95A 4MGZE 3LKJA 3C7FA 3T09A 1CZTA 2OZJA 3ECQA 1QJU1 2R063 4HKOA 4S2GA 2E7TA 5E16A 5FYTA 4E2QA 1O5UA 3WNOA 3MF9A 3V0AA 1PZ9A 1ZVFA 5G04L 4B3NA 5LW9A 4NMIA 5JXHA 2PLV2 1STMA 3MUY1 1QJX2 1JYNA 3LA3A 2FHRA 3JD72 1W0PA 4FPKA 1UY1A 4HVOA 1XE7A 4AGGA 2E32A 2YXSA 2FQPA 2DCKA 3DF0A 4HBNA 5FZBA 5IW0A 5B4NA 4Z2AA 5FO9B 4AAPA 3BI3A 3WF0A 5FUPA 4AFBA 4U2AA 3NJZA 3RZZA 2L9LA 5E88A 2EF6A 3DXTA 4UF0B 1RUD1 3MPPG 4HPKA 3MV11 3FE5A 2ILMA 3AYEA 5E1RA 3WW2A 2QNKA 2BJSA 1RUH1 2ZXQA 3R0RA 3U11A 4FBFA 3L2YA 4EE2A 1HV1A 3CJIA 3H1YA 2ES3A 5IAVA 3R6SA 2IWGB 5FMCA 1WUVA 5FZ1A 2AUYA 2P3IA 1PM4A 5BNOC 1ASJ2 3IMMA 1OA3A 1YQ5A 2D98A 3FBYA 5ABJB 1GKBA 2PHXA 3N7MA 2VZOA 1ULCA 1N1SA 2A70A 2IFWA 4R9CA 1JYTA 4ATFA 4LBQB 4D6QA 3RZJA 1Z0HA 2O14A 2QTWB 2EAAA 1J59A 1EAH3 1MVEA 5DN2A 2WNVB 2XBO1 4Y4RA 1E5RA 4MGTA 5DPNA 5GZGA 3WLUA 4UWDA 1H6XA 2F4LA 2CWMA 2JXAA 3MHZA 3O0XA 1UY0A 3AKTA 1OQ1A 2D5HA 3LF7A 5EFUA 1GP5A 3BUCA 3LEMA 5JIUA 2JIGA 2JDUA 1SCSA 1UXXX 1HIXA 1RXGA 2MEV3 5GJ6A 2D7FA 4DMIA 1PZ8A 4HVRA 4I30A 2D3RA 3LE0A 4M3CA 1EYBA 5FZ3A 4KU7A 5FOBB 2GH2A 4C1WA 1VMJA 1RINA 5AC93 2Z4FA 2ZPXA 5A3OA 4L11A 4Y20A 2WLPA 2NMOA 2W3JA 2XDVA 1LCLA 3TRSB 1QY4A 4WBBA 4UT5A 3UKVA 4KNCA 1C4RA 3HNBM 4OZOA 5FZGA 3TEXA 4EWAA 2WSVA 2J42A 3KCYA 2R041 2BUKA 4CDUC 4GMP1 1UMZA 1AVBA 3ZN6A 1W3VA 3KF5A 1DF0A 1UY4A 3AZVA 4QHBA 4PIYA 2K46A 4QKBA 2VOVA 2Q0AA 3MIGA 2RMU2 1RUI3 4YW2A 1NCQC 3MLJA 3RDIA 4KG0A 4FFIA 2TBVA 2P34A 2YYOA 3LFIA 2Q4SA 3J8F2 3UJQA 4AVAA 5A7OA 4E8DA 4XMAA 4AFMA 4WM8C 5FP7A 2IXLA 4CPBD 4XTPA 5I0RA 1NCRA 4RQPA 3P6BA 4I0WB 5A7WB 3VKMA 4CXWA 1I6XA 4JVAA 2FZ2A 3I8TA 3RYRA 3MUZ1 3AKSA 3LDBA 2WWUA 2ZOEB 2JG9C 1AHSA 5JMOA 4XUNA 3ZFFC 1CR7A 2GNDA 1S1AA 2RDNA 3CHXA 3JBG1 3JXSA 2W87A 4UAPA 2VR4A 1JZ2A 1AL0G 4YW7A 2QE3A 4B29A 4C91A 4YFZA 4XUQA 1H1AA 1D4M1 3LIHA 3D4KA 2PHUA 3CL1A 5IFTA 2RJ2A 5H9RA 1PX3A 5EP9A 1BBT3 2ZEZA 5ACA2 4RS5B 2XKOA 1OOPA 3D5OA 1ZRFA 1Q8PA 3AVSA 2GP3A 2OW4A 4YW5A 3N7JA 4XAAA 2JDAA 1UPIA 3BTXA 1PIV2 4QPIB 1REFA 4G9SB 4MOAA 1LHWA 4KGQA 2V72A 3F2ZA 2AREA 4QDRA 2BRTA 3WDWA 3RI8A 4QQLA 3R4SA 1W2NA 3ZLIA 3HMYA 4H7LA 4Q8KA 3KT7A 5F5IA 3H50A 3IB3A 1H1MA 3T0BA 3AMMA 3ST7A 3IZOA 2DUPA 3P5BA 2WIIB 1W0NA 1AYM2 3AZWA 3AL6A 4DO0A 2Q1MA 4D6RA 1F8VA 1S0GA 4XFCA 2PLV3 3WUCA 5LASA 1QJX3 5LBBA 3THPA 1N3QA 5FZDA 2HWE1 3JD73 5E8AA 3AJYA 3M3QA 1HRV1 1L7QA 5JZGC 1AYN2 4M3CE 4YM3A 3DL3A 1LGCA 5EQUA 2DWRA 3GYDA 2H6BA 4JV4A 4Q5OA 4YW6A 3ZXFA 1YQCA 5FPXA 2WO1A 3HAGA 4RHV3 3UT0A 5F5QA 1X36A 2BFUL 1LOBA 3DV8A 5FYMA 1LU1A 1GZWA 2RV9A 3O1TA 3BIWE 2UY9A 4ISRA 2VMGA 1POV0 2RS13 1WMEA 3NAPC 2W1QA 3D0JA 3J7LA 4LO4B 4W6XA 2K9ZA 4DS0A 1JZ8A 1E5IA 4A4AA 3I2DA 1W9FA 2RS31 1HN1A 4FPYA 4GH4A 5LA0A 3C8XA 3E6CC 2ZHKA 3WNLA 5HCAA 3KF3A 1F35A 3AP6A 4XIOA 3VBSB 3ZVXA 3SH5A 1ASJ3 5C3SA 4R52A 3HIFA 3I2FA 2Z5WA 2FD8A 5CFCB 1VBC2 3ZFEB 4AGVA 4WVVA 3HT1A 3I2HA 2ENRA 1G86A 2QZ3A 2R072 3BU7A 4L8QA 5FZCA 2VQAA 4BIOA 4PLOA 4MXWA 3VBRA 3OGSA 4UYBA 5FZIA 3VLBB 1Y9QA 4UW5A 5DABA 4QKNA 5JI9A 2QQIA 1B09A 3L2HA 5J7MA 1WBLA 5A6QA 3B93A 4NIAA 5T50A 2XJQA 2VOTA 1VBE2 3SCHA 3WQBA 3PHMA 1TZOA 4NWWA 2D5FA 4V2WA 1OURA 1ND3B 3BTAA 1J1LA 1E5SA 3NJXA 5I0UA 3FFQA 5C5UA 2VZRA 1V9U3 1Q8SA 4RFRB 4K7JA 1H8TC 1UKRA 3QH7A 4D0QA 1JZ5A 4K1YA 4UFKA 2VH9A 1KJLA 2FCVA 2Y6FA 5A7QA 4L9BA 3QACA 1JU4A 3USUB 4DQAA 4XF0A 1FOD1 5LY1A 3MF6A 4ZXEA 3NMBA 4EN9B 2QZ2A 4HMZA 4O9GA 1ZM1A 5F32A 2RMU3 1QDCA 1P8JA 1W6PB 2ZJCA 3KHCA 4BK4A 4DINB 2QFEA 2D6NA 3HD8B 3G7DA 2Q1ZB 5L9RA 2XJTA 2JG8B 3GBFA 5A7SA 1UU5A 4XQDA 5FMDA 1CX4A 1YJLA 3DGTA 3MICA 1IS6A 4TTGA 2ATFA 4BXSV 3B01A 2A6ZA 1REDA 1CAVB 2WL1A 2ZGRA 3PVNA 1HXS1 3GALA 5CNAA 5DAQA 4Q4W3 5FP9A 3ZPOA 3J7HA 4YVWA 1Z7S2 4IV1C 4JCKA 4FP2A 1V6MA 2DCTA 4DZGA 1D7PM 4IE4A 1JI6A 3O14A 1XQNA 1C3HA 2Y38A 3V56A 3VBFB 4AHYA 2VNGA 4Q1RA 1AR93 1IPSA 3Q8EA 5DZEA 3T4VA 4LLFA 3AP4A 5ACA3 5A6ZA 1FMD1 3T2PA 1XSQA 4PJYA 2PHWA 1NQJA 1NT0A 1VBD1 3K3NA 4D8MA 3AMNA 2PQSA 2XGXA 3RQ0A 1PO12 2EXIA 4BHPA 3WG1A 4N90A 5JPNB 2P5BA 4XBQA 1JOJA 1RJ7A 1VALA 4LUKA 4QXCA 1XE0A 1PGW2 3VKLA 1RUE1 4RGAA 5LATA 1O91A 3QCWA 3M1HA 2VUCA 1ENRA 2C26A 2B46X 4UW4A 5CU1A 5IVVA 1DLLA 2VTFA 4FP3A 4P00B 3ZYIB 4XCAA 2WFF2 2R061 2VOXA 1GWLA 3GZUC 4LJHA 4QX5A 3U10A 3WINE 4FFHA 4MO3M 5BNOA 4HN0A 1YEWA 5FYIA 4LOSA 3VGIA 5DUXA 3VN4A 2VZ1A 2UYBA 1TG7A 4QGNA 3ZFGA 1G9FA 4XFAA 1FV2A 4CP0A 5FUIA 1ZA4A 3U14A 1AZDA 1QOTA 1QMJA 2VBPA 3MW4A 2HLEA 2OA2A 3RMYA 4INDA 4QU1A 2BBAA 4EN8B 1C8M2 1BEV3 2A6XA 3V0BA 1UN1A 5T3NA 4DXTA 2NZ9A 3I3DA 1DQ2A 1OFSA 1RUOA 3I3EA 4HL0A 2PAEA 1O8PA 2DUQA 2GP5A 3FBMA 3MIBA 2W92A 3W5NA 1R64A 3B94A 2WNUC 4JGZA 4P02B 2B4KA 1ONAA 5IAXA 1GZCA 3BTYA 3ON7A 2YMZA 1GFF2 5FZOA 1VBC3 2OXBA 2XB6C 3I3MA 1U5YA 4RGKA 2R073 2DVGA 1H1IA 1RUD3 3WOGA 2W95A 4Y1VA 1EAH1 4BM8A 1KITA 3W58A 2EALA 3T3YA 4AW7A 1PM7A 2ARAA 4ORFA 4I01A 5CKNA 3FMGA 5KXCA 5JUVA 1POV3 2QBXA 2C24A 1QJY2 5CAZA 1VBE3 1ALYA 4DXZA 1CAXA 3QOPA 4AF9A 2XMLA 4Q26A 4XYXA 1XU1A 2XQXA 2MEV1 1BZWA 5FKBA 4XUOA 2P6CA 1FX5A 3AYCA 4JGYB 5B4XA 5FUNA 3SCFA 4DXSA 5A3UA 2E63A 4M00A 5FZ7A 5AC91 1TMF2 3D0SA 3IDEA 3ZMOA 4RR3C 2YBKA 3ELNA 4COVA 4V2VA 3FX3A 3AL5A 4GALA 1US3A 5J96B 4PBPA 4Q27A 3KGLA 1W8UA 1TE1B 3CO2A 4AQSA 3OD4A 4IV3A 4IEXA 1ENSA 4QKDA 5C8CA 1FYUA 4NE9A 2ZGNA 2XVLA 4AQ6A 2WO3A 5FYUA 2Q8EA 1RUI1 3NKGA 4Y26A 3JCIA 5L73A 3EHKA 2DBIA 4QDSA 4A7KA 4R9BA 1L3JA 4BK5A 4AXOA 1POQA 2I2SA 2ZBJA 3CJIC 4ONUA 1SLIA 5C3OA 3NNLA 1NLQA 1ZYBA 2ZKNA 3WP6A 2JDKA 1W6QA 5CA6A 1J3QA 1NA1B 1Z7S3 2VW0A 1JUIA 1BYHA 1W9WA 2DDUA 3NNGA 5GZDA 3N35A 5ANQA 1EY2A 1HB3A 3ZYHA 2YGMA 2WO7A 3MFAA 2YFUA 3OGJA 5FY1A 1OSGA 1ZX5A 1PGL1 1KGYA 2OVUA 2AZ5A 4CDXB 4OHYA 3M4FA 4JTNA 4NIIA 1KJRA 1BBT1 4Y5TA 3AP7A 3AKRA 2PMWB 3V65A 4DRRA 2KXLA 4NHKA 4HXCA 5A7PA 1W8OA 1FATA 3VBHA 1FV3A 3OEAA 3RZLA 1O4YA 3OGGA 3AB0A 3JB8A 4M4RA 1GQPA 3JBG3 1K12A 1SLBA 4CCNA 5GALA 4RN5A 4Q4X2 2BEOA 4COZA 5JR2A 2Y60A 4P9XA 1NG0A 2GAUA 2Y6LA 3POSA 1VRH2 4Q1PA 4CDWB 2ZX4A 1A8MA 2MNGA 4CCLA 1HRI3 4AI0A 2FDIA 1K5JA 3P3PA 3WCSA 1BXHA 2R16A 4GJZA 4AEDB 1W6NA 1ND2B 1S2EA 5JOZA 2KR2A 5LK7B 2WABA 5H9QA 5IATA 1RC6A 5JDBA 1DZTA 3AK0A 2QQWA 2PAKA 4Q0PA 3VDBA 3B02A 1ZREA 3AYAA 2RVAA 1H2NA 3IPVA 2PLV1 1QJX1 5GZFA 2VUAA 1U5XA 2UWBA 3JD71 3DUIA 4COWA 1V6KA 4N43B 1PMIA 3S7IA 3CLPA 1NCRC 4RQPC 5T5LA 4PBOA 4N7UA 3SLIA 4AEJA 1RVF3 1LESA 2CYFA 2D3PA 3PU8A 4RHV1 3ZSMA 1DQ5A 3HBKA 2X5IB 3I59B 1CIWA 3UK9A 4YSFA 1RL3A 1TEIA 1V6JA 2ZGMA 3T08A 3URFA 4HSJA 3T2TA 2RS11 5FZEA 1LRHA 5F37A 2YHJA 1ZRRA 4KU8A 3T2QA 4FVVA 5IVYA 2HWE3 5I8YA 1Q8VA 4IGQA 3WF4A 3O1MA 3SMHA 2E7AA 2ZGLA 3LAGA 1OOPC 1ASJ1 2ZX2A 1WW7A 2RDRA 1OVPA 2YY1A 5J48A 3ME2A 1JZ6A 3DEMA 1SLTA 4KGGA 2R0HA 3VL8A 2CAUA 2P3YA 1KEXA 1LENA 3OY8A 3ZMNA 4CUGA 4XFBA 3ZYFA 2W39A 3M8LA 1T6GC 1NX9A 1W3XA 2IXKA 2XG3A 1FPN3 3LWCA 2EVXA 5HXVA 4R9DA 2ADEA 4PDWB 2WLQA 2LUWA 5F5CA 1WCKA 4QB6A 3RFRA 2RR13 3OTFA 3PDQA 1DG6A 4M0NA 2ZEWA 1QKQA 1QJY3 1S0DA 2ARXA 4Q0VA 2HWB3 3TN92 4CCJA 4CPBA 5IWFA 5FLJA 1YI7A 1CX1A 4A2UA 1V0AA 3ALQA 1KS5A 1O4ZA 3MFCA 1TMF3 2ZEYA 3C3VA 5GZEA 2DFBA 3PVBB 5D1IA 5DQ0A 1CAVA 4WVWA 4BIFA 2A1XA 2BNMA 4N53B 4O9EA 1W6MA 1J84A 2DVDA 3FN9A 5LA9A 3KCCA 5FP8A 4YPJA 3RYPA 1AR82 1NZIA 5BNPA 1H8VA 4LBQD 1RB8G 1UNBA 3OF1A 4BU2A 4MHUA 1NYWA 4ES8A 1UO9A 5A6XA 3DPRA 3KLSA 4JZRA 4FPLA 1RYYA 1DP0A 5A1AA 2DU1A 3RYKA 1SEFA 2RMU1 3ZYPA 3TBDA 3K4DA 1UD1A 3U1XA 4P9YA 4HZFA 1R1ZA 1CPNA 4GH4C 1UY2A 4LTAA 5JOYA 1AL23 5EHDA 4I3GA 3NWKA 1SZBA 4D7SA 1K42A 1KQRA 4MGQA 5A32A 5AVAA 1LGNA 1VBA2 4TLGA 3TAYA 4UW6A 2BGOA 2VZVA 4Q4W1 2HEYF 1S2KA 3N9QA 1WCSA 2G1MA 3WSOA 2VMIA 2OIIA 1XXNA 4BOWA 5BNNB 2PTMA 3VBRC 4ZZ8A 5K8SA 1LHVA 2FMDA 1LJ7A 5K7PA 1Z78A 1FNYA 1AR91 2Y26A 1S0BA 3AM2A 5AVPA 4LPLA 5FY7A 2HEVF 5DUUA 3BOPA 3N9PA 4AK3A 1UYZA 2PA7A 5FZLA 1YXWA 3RRDA 5ACA1 1MS8A 4XDQA 2J22A 2ZHMA 4YW3A 4LBLA 4COYA 4MUVA 3RJ2X 5FFOC 2XJPA 4QHOA 4FTSA 1LKNA 3ZN5A 1LU2A 4LKSA 1PIV1 2WWSA 4HANA 4ET7A 4KBBA 2JEMA 3NV3A 4BDVB 5A7NA 3RWNA 4Q4X3 2YUEA 4GKYA 3WNXA 3OJBA 1FAYA 5DUWA 2V4VA 3GF6A 4JAAA 3EJKA 1VRH3 5FTTC 5FOJB 3K46A 4NRQA 4AE2A 5IK5A 3IIAA 2W94A 4GIQA 1FMD3 2WNUA 3LDKA 4J1WA 4K1ZA 4YM2A 2LALA 4JDOA 5CG8A 3OBRA 1NKGA 2JJ6A 4JQRA 1AUYA 1PK6A 3CNAA 4OHWA 3PL0A 3N9LA 2QDRA 2XLAA 4CCEA 5CBLA 1SPPB 4CU6A 5F3CA 2E6VA 1XPWA 5FAXA 1IQDC 4QQHA 1C8NA 4EN6B 1UF2C 4P08A 3I2JA 4QB2A 2HBTA 1B35A 1EPWA 2X10A 3VBUA 2VNVA 2UURA 1ODMA 2VU9A 2VMCA 4YVWC 3WNNA 4AHWA 3O1PA 5FPZA 1BEV1 1HLCA 1JHJA 2EAKA 4AI3A 4CEYB 2ZGOA 5C4WB 4QXKA 4AEMA 5KHGA 2H0BA 4IEYA 5A1LA 1O3QA 1W8FA 1OQDA 5IVFA 1VLNA 1VRBA 1W28A 4K8RB 4LKDA 4XABA 5DG2A 1CQ9A 2G19A 3GHNA 3JUUA 3B9CA 3KWVA 4OUMA 5K0UA 1BLZA 1MVQA 2VE1A 2WR9A 3JB4C 2BWCA 5DDJ2 3VBOA 4EN7B 5FZHA 4RR3A 5JVVA 2A3WA 3ZXAC 2XONA 3HEIA 3AFKA 3FHAA 1ACCA 2BWAA 4LOTA 4YARA 2HWF3 1VBC1 1BKZA 3FUQA 4FXGB 1RUC3 4LO5B 2YFZA 4X6RB 4E27A 5FYVA 2WBKA 1J58A 5CIRA 2GZWA 2R071 3J4UH 1GP4A 1NOVA 5FZKA 3ACHA 4I09A 1MS4A 2VXRA 4YYOA 1XNBA 1G8WA 3B3QE 3VD5A 2ID4A 4KG8A 4C1XA 1KDMA 2JB4A 4XMIA 4MGKE 3ENRA 3TN93 3J26N 1POV1 3POIA 1HN0A 1VBB2 1VBE1 1H4HA 4QQ2A 2JB8A 1RUF3 4EZ4A 1IG0A 2VTXJ 5TSWA 1EV12 2GMEA 2IZWA 3MLLA 3ZIXA 4NIDA 3WW1A 4L2NA 5HV4A 4DY3A 3VDDA 3AZYA 3ZFGC 5A70A 1MZ6A 2A3YA 1MQTB 2UWAA 2DUOA 2LROA 3VHNA 4CEWA 3DECA 3MZHA 3PUAA 1CN1A 4WM7A 4QPGA 4AYUA 5F5AA 1UZ0A 1UKGA 1AR83 3I7DA 3PU3A 1C28A 1V70A 3KZ4C 5JMCA 4XDPA 4UBHA 4YNIA 5FP4A 3WUDA 3VD7A 1JXNA 5BY5A 2CGPA 4OI0A 2VXJA 4XF9A 2VO5A 2WN2A 1MS9A 2CU5A 2B9UA 4FOVA 2V5DA 4IEOA 4AVCA 3DCQA 3LOBA 1TVGA 5FK8A 2ARBA 2K2SA 3WCRA 3MO4A 1AR72 3J9SA 3OBAA 2A71A 1VAMA 1R083 1WKYA 1TNFA 1QXRA 4JGZC 1YFXA 2GMMA 1F5FA 1YHFA 1RUG2 3ACGA 4LE4A 1VPHA 4NR1A 4JX0A 4AG4A 3C7GA 4GB32 1IS4A 1Z7S1 1BK1A 2BZDA 2NLRA 3X29B 3ETPA 4IEUA 5LA2A 1LEMA 5D8AA 1W2UA 5A33B 5KC5A 2QQLA 4LITA 4EWDA 2TEPA 1Y9MA 4QM8A 1H6YA 1CJPA 1UWWA 2ET7A 1BMV2 1O3SA 1QJEA 1ULGA 5FY9A 4CDUB 5KHIA 1NXD1 4ZS2A 1ZRCA 1ZNPA 3BODA 4MZUA 4DUVA 2HYXA 4ES9A 1J1TA 2YC2A 1LNSA 4IQPA 1O8SA 2VM9A 3GZAA 5I0SA 1NCQB 2YG0A 4AVBA 1W9YA 3DKQA 3TEYA 4R4XA 2C5DA 3OSDA 1H2MA 3R4DB 5FRAA 3H8RA 1JYVA 1SHWB 2WZR3 3IN9A 4CA9A 2VCCA 5JLVA 4WM8B 3W20A 1S4CA 2QQUA 4EYUA 2YC0A 2FBEA 2VUJA 3H7YA 5DMYA 3HVDA 1AR63 4LHSA 4M01A 1WW5A 4Q4Y2 4WZCA 1W8NA 3GNEA 1HRI1 3A22A 1ZBA2 4N9IA 4XHBA 5C8CC 4IV3C 4U36A 1R1A3 3ZFFB 1H4GA 1W90A 2HKXA 4HK8A 3ZSEA 5KR7A 4IE0A 4P9WA 4Y1YA 5FYBA 4YVSA 5F2SA 5A3PA 1WWYA 3AMPA 1DQ4A 4JKMA 2D6PA 3AMHA 2R7EB 2DV9A 1QOSA 2PYTA 5D2AA 1CZVA 2NPIA 2ZABA 3KT4A 4N8MA 3GHMA 5FQ0A 1CAWA 3VZLA 4GWJA 1UIKA 5A1FA 3KSCA 1VB2A 1UYXA 3GZEA 1RVF1 2GC0A 1DGWX 2UWCA 4CDQA 1DGRA 2Q8CA 3MEPA 1C8M1 2VZPA 1F9KA 1J83A 1SLAA 2QQKA 3W59A 1YIPA 4DPNA 2GMPA 2AACA 2GNBA 2YROA 3K3OA 2CL2A 4OHXA 3O0VA 2FDFA 2MHFA 4Y22B 4PIXA 1WW4A 5CFDA 4Q0SA 2W2IA 3WQ0A 1NXMA 3DYPA 3NRUA 4XHXA 4XETA 4QAWA 4MHRA 4Y5SA 5HXMA 1NE6A 2RDQA 4IW3A 3WHUA 5LBEA 3WG4A 2IXHA 2XLFA 2Q1FA 1UZVA 1RMU2 1W8ZA 1QQP2 4Q0QA 2UY8A 3EYPA 3B9IA 3K51A 3SKJE 1V6LA 4AAXA 3A7QA 4AWDA 4E2GA 1JS9A 1RITA 3LZZA 3VBHC 5FMBA 1KD7A 3S6PA 2P6HA 3R05A 2CSGA 4OLLA 1CIYA 4KH9A 5JZGB 4BMBA 5HBAA 1FPN1 1ODNA 2ZAAA 5DZGA 3POYA 4XE9A 1AX1A 1DQ1A 4GJYA 4M3CF 5EJ3A 4SLIA 1X33A 1VMFA 3T0AA 4E9KA 2RR11 4GZ9A 3ATGA 3Q8AA 4OZXA 1QJY1 1IKQA 2HWB1 1GICA 4COUA 4DEVA 3BPSA 4AEKA 5LCWL 1EV13 3ZSJA 1Y9GA 3NAPB 1GV9A 1UY3A 3BTZA 1F5JA 4WV8A 5J1XA 5FXXA 1QJU2 2Y6GA 1TMF1 3HN1A 5L7OA 1SFPA 3E6BA 3HJRA 4OFGA 4XOGA 4YG6A 1WBFA 4O65A 3VD3A 5CKMA 3VDAA 3POJA 3H42B 4OYUA 2VGDA 5DAWA 2BU9A 4OI2A 4KWLA 4XF1A 3U4XA 4XQ4A 3U4SA 5F8PA 4LO8A 4MV2A 4IGOA 1BQPA 5IHRA 2BYVE 3K4AA 3ZDSA 1ZBE2 2A7AA 4A42A 4TXWA 3D6EA 1AR73 1W2AX 3WP3A 4AQ2A 1Q8QA 2BVBA 5JWPA 4ARXA 2ZHLA 3HQXA 4P14A 1S2BA 2VMEA 3THCA 1AL21 4JDNA 4P9IA 3HNYM 2EIDA 4YW4A 4BQ1A 1RUG3 1Y43B 5ERLA 5FXWA 2YBSA 2A73B 3VHRA 1ULEA 1RUH2 1SDWA 3C2UA 3ZYGA 1O6UA 2YC4A 2VQ0A 2PHFA 3PMEA 2HWD2 1GP6A 3M2MA 1V6NA 4B7EA 4IEZA 4XJWA 3VZKA 3POWA 3T4HB 2BTVC 1XSRA 1H8TB 4UXAA 4TLFA 4P5HA 4X8NA 3UYJA 2VQTA 1G9DA 5IYYA 4FOYA 3J8F3 3SC7X 4BQWA 2J1AA 2RM22 1I5ZA 2P1BA 3ZDVA 4CP9B 2HWC2 5C9AB 5FYZA 2XBO2 1XBFA 1LOGA 3BPZA 4IERA 2V4AA 4PI0A 5D21A 4LT5A 5BYNA 1K5MA 1QXJA 3MIEA 1O7FA 5JIAA 2OYZA 4GD4A 3AP9A 2VMFA 1YQ6A 3NJVA 2Y6KA 1HV0A 4RL7A 4XBLA 5EZWA 4CP1A 5KWRA 2J1SA 3WX5A 4Q4X1 1LB2A 5BNPC 4JKLA 4HVQA 1OKQA 1F31A 2BVVA 1VRH1 2WA3A 3HOBA 1Q8OA 4Q4Y3 4BQ3A 1CVNA 4X6QB 1ZBA3 4IL7A 4IV1B 2CY6A 4H3WA 1CPMA 3AZXA 3DPRC 4EN0A 1KS4A 2BNNA 1XRUA 5FZFA 2QQNA 4Z2WA 2FCTA 2TNFA 4Q4V2 2ERFA 4P9LA 1JYIA 1VJ2A 2R042 3ZPYA 1UCXA 1PIV3 3APBA 1VAVA 3BGAA 5GLVA 5LA1A 3MV01 2QCSB 4XFGA 5C71A 5BV6A 3UETA 1W39A 4FPFA 4P9GA 2EXJA 2VG9A 3ZM8A 5C33A 4E8CA 2JDPA 1DDLA 1RGSA 3QBQA 1QH7A 2JE7A 1VE0A 4UF0A 4QT6A 1DLCA 3C7EA 1YIFA 3KV9A 3WG2A 1AYM3 3ZXLA 2BOIA 2R1DA 3CDZB 2Y0OA 2P3KA 3OUIA 4ZU4A 4YGDA 3ZR5A 5FWJA 3OPWA 2Y0IA 3CEWA 1I5PA 3LQCA 3ZYBA 2DURA 2XH6A 4FPOB 4W6WA 1SBDA 2P2KA 2RJKA 3OD0A 4LA3A 3H1WA 3LSEA 4A6OA 1AYN3 4CZSA 2WYSA 2CWSA 2XWJB 2PHRA 4Z92B 1ZZCA 5ABJA 4OHZA 4LKFA 5LY2A 5LEKA 3N9MA 4XACA 5IT6A 5GLTA 2HWF1 3HR9A 5T55A 4S2HA 5HV0A 1OKOA 4LBQA 2GC3A 2Y8KA 3KV6A 1RUC1 2JDNA 3R4UA 1DYOA 3A21A 4K21A 4PI2A 4XJAA 2ZMLA 3ZOIA 2WNVA 3O5SA 5APAA 1UQXA 3AP5A 5FPVA 1XNTA 1UU6A 1QEXA 2VNRA 3WD5A 1YUDA 1RHI2 4XC9A 4ZXKA 4CU9A 3PUHA 3D82A 3EXUA 2FDGA 2WKKA 3TN91 1SLCA 1D0GA 4WVMB 2C1FA 3RZGA 1VAKA 4LORA 4K20A 4JDMA 1WMFA 1JYXA 1RUF1 4CCOA 3VD9A 1YQ2A 3WNMA 1H2KA 1PK6C 1QDOA 1ULFA 1YCIA 4JTOA 1PHMA 4L92A 5FZ6A 3OPZA 1JOBA 4B8EA 5CYYA 5FY8A 4XJZA 4CCDA 4EWEA 1PVC2 2Z69A 3C7OA 4YRDA 5FY4A 2WFPA 5C70A 4E4SA 4G3YC 1OD5A 3NNFA 4KQ7A 1B35C 3WVJA 1HKDA 1AR81 1W2TA 3VBUC 4ZU7A 3EO6A 5FMOS 4ZS3A 2RG4A 4DEQA 1G9CA 2GDFA 4P9JA 3ES4A 2JECA 1DBNA 1ZBE3 1U5IA 3USSA 2OPWA 1NY72 4GA9A 2C4XA 4LK6A 5LBCA 2WT1A 2N7GA 4UFJA 2VVDA 1CAUB 1UOBA 3ACIA 3M70A 4I3PA 4QB1A 4R9AA 1HQWA 2CDPA 3WF1A 1IS5A 4UI9L 1GQGA 1APNA 1R081 5C8WA 1AX0A 5K0UC 4XILA 3VL9A 3VBOC 2ZMNA 5A7WA 3WNPA 2WT2A 3ILFA 3NJYA 4QMAA 1C5IA 3INAA 5FZAA 1QNWA 1SACA 3NW4A 4LO7A 3V0AB 1GZTA 1J3PA 3MW2A 1MS1A 1HJGA 3KQ4B 4AQTA 1GNHA 4NVPA 5FK7A 1H2LA 3ZXDA 1GLHA 4XF3A 1IOAA 5FY5A 2SLIA 1DCSA 1PX4A 2WZ8A 1HJFA 4JRAA 4Y5Z0 2OKXA 4BXFA 4URAA 2ZZJA 3SQOA 3WW3A 4QX0A 4BQ2A 3DYMA 4RS5A 4EQVA 4TZDA 2VL4A 3DN7A 1A34A 3S57A 1L7RA 4BQ5A 2Q8DA 2OUJA 2G4IA 3GM8A 4CU8A 3I49A 2HWC3 2YDEA 3KVAA 3RZMA 3A23A 3K2OA 4XFIA 1Y7BA 3AZZA 3IBMA 3TOJA 4HPKB 4QPIA 1BVVA 4Y1UA 2OQ7A 3VKFC 2JE9A 4BCUA 4FQZA 3VDDC 4OVEA 2E26A 2WZR1 4CEWC 2QQJA 3W21A 1X8EA 3CJIB 4WM7C 2K0GA 4QPGC 2PQQA 4SBVA 1FT9A 4J1XA 3FLPA 3VHOA 4GAZA 4KBZA 3LGRA 1LECA 1AR61 2FDJA 5C5TA 3ZXEA 3CF6E 4A7ZA 4DUWA 1IG3A 1CESA 4UFLA 2ZAHA 3ACFA 4BLJA 1R1A1 1PO13 2YV8A 4Q4V3 5ANNA 3IDAA 2PN5A 1HDKA 2XHNA 3GBWA 5A3WA 3WDUA 2RJLA 4H2AA 1FOD2 1WLTA 3E5UA 5I8SA 1OBNA 4LULA 1XE8A 5F39A 1ZRIA 5J37A 1BCXA 2IVJA 3I2KA 3LCPA 4YWAA 2DVFA 2BQPA 1W2OA 1D2QA 2JE8A 2WQ8A 2E7QA 3WR0A 3T1LA 1WA4A 1UZWA 4M3CB 2WFF3 3WQ7A 5C3PA 5D8AC 4EZHA 2F17A 5F9TA 1G9BA 2EIGA 3LFMA 1LGBA 4Y20B 2CDOA 4BLIA 2W1UA 3EMRA 4LHLA 5BXXA 4HK9A 4FTEA 3POEA 5A6YA 5F3GA 4D7YA 3VBSA 5A3NA 3SCGA 2V73A 3M7AA 1XB9A 5DDJ1 3ZN6B 1DHKB 5CG9A 3MI8A 3IKWA 3KV4A 5CFCA 3ZFEA 1D4VB 4I0BA 2A3XA 1I3HA 1QJFA 2QKDA 1YFWA 5E6HA 2BV4A 1LHNA 1C8M3 2DFCA 4BWOA 1DGRN 1DYPA 3ACLA 4HSLA 3VZJA 1OUXA 3LIGA 1M4WA 1VBD2 3FLRA 5CKQA 5FPBA 5JCTA 1NCRB 1S0CA 4RQPB 1RHI3 3D3AA 3DKWA 4DRVA 1AX2A 2YZ4A 1BK0A 2NM1A 4DUXA 1OPOA 1OD3A 4H7MA 3ZXKA 4UFHA 4YZ3A 3FFZA 3RNSA 1ND3A 1IPKA 2JDYA 2ZKLA 4A41A 4QU2A 4XJ8A 2X53S 3FLTA 2B7YA 1EV11 5F3IA 3T2OA 1I1EA 3IDBB 2JDZA 3KV5A 4YVSC 1TME2 5CISA 2JD4A 4S2DA 5F1RA 1M06G 2D6LX 4XZPA 2YU1A 3USUA 4BJ0A 3IM0A 4XEZA 4MGYE 4QD2A 2PHDA 1OOPB 3WP5A 4ZKTB 1UAIA 1SQ4A 2D40A 1GOGA 3U78A 1F2NA 2D97A 4CDQC 4NHMA 3LEKA 1QGLA 2XWBB 1S0EA 3VKNA 4QKFA 1KRIA 1ENQA 1OF4A 1W6PA 3LD8A 4IESA 1Y4WA 1YFUA 4LHKA 3NNMA 5CFDC 4QHZA 5JXJA 3M3IA 1AR71 2JG8A 2ZGQA 3H1MA 3KB5A 2DCYA 4Y1XA 4XJ9A 4AR2A 1QJZA 1UZZA 4QX7A 5H9PA 1ZZ8A 5T54A 3GCWA 1H30A 4QDQA 2ZA9A 3IAQA 4R8HA 1RUG1 3UJOA 3WZ1A 4E4DX 1CGPA 2PAMA 1T6BX 2BOJA 4FPEA 4MGIE 5JI7A 2GU9A 2RS52 4GB31 2KM2A 2W08A 1XOYA 3T1MA 2WDBA 3H8OA 2WNOA 5GLWA 3HQUA 3ORJA 5FZMA 3S5QA 2VW2A 2YGLA 2W47A 3AKQA 3WNKA 3VBFA 4CUBA 4RGGA 2BGCA 5HCHA 5KHJA 1GWMA 1WLWA 1XYPA 3A0NA 4CE8A 2DTWA 3KVBA 3WP4A 4W65A 1W8WA 3S30A 1QNYA 2Z79A 4NROA 2XJVA 1LHOA 3PURA 4MH0E 3SXWA 2NQYA 1BMV1 3LPFA 4LK7A 3L9JT 3J8F1 4M0HA 3GJAA 5LEJA 3K48A 1VB4A 3FWEA 1A3KA 3IMNA 2W46A 3UESA 5IUQA 2JWPA 1MS5A 1H9PA 1VIWB 3NNJA 2F4PA 3M3CA 1GZWB 3WT3A 2DBNA 5T5PA 3Q8FA 1JZ7A 1LAJA 2BW8A 3ZXJA 1F15A 4A3ZA 5IK7A 4ASMB 1JBCA 4GH4B 1RXFA 4MSVA 3RGBA 1K3IA 3JQXA 2OPKA 4AVVA 1IZ3A 5L7OC 2IC1A 4PCRA 2V09A 3C7HA 5FMOL 4I2OA 1GUIA 4AVTA 3JZVA 5LRRA 2XKPA 5EJZB 4Q4Y1 4BH9A 2VAUA 4L99A 1ZBA1 2EA7A 5F3EA 1QHDA 1WCDJ 4LUMA 1L7LA 4NIGA 1GSLA 3U0ZA 1XC6A 1JZ4A 3H3LA 4MXWB 5J36A 1URXA 4Q2FA 4UW3A 1V00A 3VBRB 3VHPA 4CU7A 4QX3A 3VD4A 4HONA 3S0MA 5KBFA 3T0DA 3RWKX 4YZ4A 1QXPA 1OA4A 2IFRA 2WAOA 4X8PA 5E89A 3ZKYA 3WF2A 3PUQA 4CSWA 5L9VA 2H0VA 4Z07A 4L0PA 4LLOA 3PVOA 5LZ6A 4YG0A 1RUI2 4FO9A 4YLZA 1WLDA 1UMIA 4H55A 1N47A 1TQ5A 5EJ1B 4AHZA 1DZQA 4EROA 4RA0A 1QWRA 1GANA 1AYM1 3MDPA 3U37A 3DYOA 5EXOA 3LOIA 3I54A 4QXHA 1GU3A 5FO8B 2G9ZA 1ZZBA 3CZUA 3NV4A 4J6GA 1U0AA 1SFYA 1W06A 2VMDA 4D7TA 1GR3A 1KFUL 1WZXA 3I97A 1MPXA 2E53A 3MYXA 1AYN1 5FXZA 4B1MA 1RMU1 2AEYA 1UIJA 3JQWA 3PVEA 1IKPA 5FZ0A 4Z1VA 4LQRA 1DZRA 4RSUA 1K5MC 4DIQA 2VD7A 4FPCA 1DGLA 1JHNA 2YU2A 1LHUA 1JH5A 3RJRA 1BBT2 1UX7A 2BDRA 2WYFA 1YRZA 2Y34A 3RMXA 1ZZ6A 1W6OB 1NLSA 3H7JA 4IUGA 2GNTA 1RUJ2 1S0JA 2VOWA 2WC2A 5DUVA 5T5OA 3O7OA 2Z2SB 3TEZA 5FYCA 4NHLA 4ARYA 3I2OA 2WS92 1NLRA 3PJYA 3CQOA 4TWTA 4YVWB 2R49A 2JX9A 2XJSA 3IT8A 3IWZA 4BYYA 3RS6A 2OX0A 4JGYA 3HT2A 1X9TA 1YFYA 4O61A 2A75A 3SH3A 2XJRA 4F7ZA 2JD9A 2BNOA 2CTVA 5T5JA 3SH4A 2MPFA 4FFFA 4NOTA 4UFIA 3B69A 3WV6A 3RI9A 1X82A 5JPMB 1LR5A 5EV7A 1KXGA 2BBVA 3CKHA 1OFNA 2XUMA 4OQ8A 1CWPA 1QOOA 2ZTNA 1NUKA 1DYKA 4A7YA 1ZBE1 1D2SA 3PLQA 2A6WA 2WA4A 3Q8CA 4OHVA 5EPAA 2B42B 3WW4A 4BZ4A 4KWJA 4YGCA 2ZGSA 3ZYRA 3POBA 5GM0A 3PUIA 4RHV2 4LHNA 1JODA 2JICA 4MYEA 2CGOA 4E2SA 2B9VA 3EB7A 5IJRA 5FPUA 5KXBA 5A3LA 5FLHA 4AFAA 1UOGA 4W6YA 1SMVA 5K9YA 1HB2A 5ABJC 2RS12 5FWEA 5BNOB 1NA1A 2OQ6A 1NZCA 2RS53 1LOFA 3N36A 2O8OA 5HI0A 1MQTC 3B7MA 4ZU5A 3NQHA 3ZN4A 1WW6A 2HWD1 5G05L 3ZFGB 4GXLA 2WNVC 1NE4A 1OH3A 1MS0A 4AHXA 1HQLA 4RFT0 2ZX1A 2JENA 2VCBA 1OA2A 3IIIA 4META 4XIKA 2ZEXA 3TWIA 1G6NA 4CDXA 4IGPA 4OULA 3ZIWA 4LIUA 5DXDA 4A44A 4NAMA 4ZY9A 2AENA 1O59A 4IE7A 4CRQA 2AC1A 2E9QA 1Q5OA 4P5YA 5F2WA 5I8TA 2RM21 2HWC1 1N3PA 3TEWA 2VUDA 1SDDB 1VBA3 4KI5M 3V0BB 1RUNA 3I4IA 1FNZA 2D6MA 4XXPA 3S7EA 2XL9A 3ZR6A 4DB5A 5FLIA 1OLRA 5IK8A 1GMMA 3AKPA 3E1F1 4S2FA 2A5ZA 1OF3A 3BN6A 3MW3A 4JGZB 5FBZA 4BQXA 1X7NA 2W91A 4KWKA 4ITCA 4YG3A 4RD7A 1UYYA 4CDWA 3BIEA 2QQPA 4DXRA 3ETQA 4QPYA 1LOCA 5FZOB 4LKEA 4AEDA 1QIQA 1ND2A 3AYDA 4F3JA 1ZZ9A 1PMHX 3D8CA 1V9U2 1JW6A 2E51A 4WZFA 1YI9A 1ENXA 1PO11 4NUBA 4Q4V1 3HPNA 4Y1ZA 5FP3A 2EIEA 3QD6A 4N43A 4Z82A 1A6CA 2DCZA 4K8FA 3W9AA 1PGW1 4HT1T 2JDHA 4HETA 3WDTA 2VBDA 4HKLA 4KL1A 1CAXB 3O12A 1US2A 5K4LA 2ZX3A 3FHIB 2P37A 5IK4A 2X5IA 3UL2A 3I59A 1A78A 3OEBA 2WFF1 1COV2 3GJBA 5C6CA 2JG9B 1ST8A 1IQAA 1W99A 2GALA 2VC9A 3N3HA 4YM1A 1R092 4IEWA 4Q4W2 1X9PA 3KCXA 5FCCA 4RS5C 1G9AA 4G4FA 4MADA 2YBPA 1K45A 4AVSA 5CVRA 5FREA 1GZ9A 3PJQA 3TNQA 2WJSA 5C8CB 2VOKA 4IV3B 2ZCWA 2D43A 1V6IA 2XVKA 5FV3A 4QPIC 1AR92 2ZX0A 3RSJA 2C9KA 1UYPA 3G6JB 3RG0A 3WDYA 2VBBA 4FPGA 1GOHA 4DY5A 2IXIA 4I0AA 4PDWA 2XVGA 1RUJ3 3UKNA 4ZONA 4MGSA 1XNAA 3N7KA 2YPJA 4MG2A 1RHI1 2VZQA 1PO22 5JOXA 2WS93 3MLKA 1W6QB 4QX2A 4OI1A 2Y6JA 2YPDA 4H14A 5DDJ3 4CTEA 3J7MA 3NV2A 5DZFA 5J09A 5F7UA 5JSPA 4XAEA 2E33A 1GOFA 2Y33A 1YLLA 4OMCA 4TSVA 3WY6A 2ETEA 2WT0A 3KT1A 2XXZA 3N7LA 2ZHNA 3TYJA 1GNZA 3GBGA 4R4ZA 1HB4A 1PVC1 2IVIB 2ZGTA 2ARCA 4F83A 3CMGA 1RJ8A 4N53A 1NAEA 1C1LA 1KDKA 4FOQA 4A6SA 3E6DA 5A3TA 4CP2A 1MEC2 3BKZA 4KMQA 5ISLA 3VKOA 4QX1A 4NHXA 2WNEA 3VBHB 3OGRA 4GWMA 4BQ4A 2XHKA 1VBB3 2W68A 4FFGA 1C57A 4XVHA 3OG2A 4QGMA 1NY71 3A0KA 4YZ2A 5GZCA 2JDMA 5L9BA 4OUEA 1XU2A 3WHTA 1PZ7A 4MLOA 1RIRA 1ZA7A 2ORZA 3VBSC 2WAAA 1BEV2 5J98B 4LBKA 4XPVA 4AI8A 1IHMA 3PMSA 1W6NB 2QJVA 3OBTA 3ZFEC 5CFCC 3BCWA 4A45A 4AI2A 1H0BA 1JTZX 3IAPA 3N9NA 4JKKA 2VJXA 2XPJA 3IPVB 3ZYJB 4LNVA 3ZSKA 5HCFA 3SHRA 5BNNA 5HPOA 5FJHA 3EBRA 2C9AA 1VMHA 4W8JA 4OQ9A 3RVHA 2Q8OA 2ZACA 3H3ZA 2RE9A 2LRPA 5FZ4A 5JSRA 3N4MA 1WCUA 3FJSA 1HW5A 5FXVA 1RUD2 1ND3C 3MPBA 1UOJA 2SBAA 4QQPA 2FDKA 1QF3A 1N1YA 1BJQA 4DNYA 1OH4A 4PLNA 3POGA 2F6BA 1N1VA 2PHTA 4GB33 1EPZA 2J7MA 4L97A 1PNGA 2I74A 5JOWA 1C5HA 2D44A 4OMDA 5FPAA 5AFEA 3SNMA 1JMUB 5DAXA 4Q8LA 4Z8BA 1J3RA 4EJRA 1E5HA 2WSUA 4XUPA 1C1FA 4NN0A 3KS7A 1LTEA 1OVSA 2VTXA 3KM5A 3QLQA 5FY0A 1DQ6A 1SLLA 2IUWA 3H3UA 3ZKUA 3H9AA 1XJAA 4GMP0 3OY8B 5IFPA 3GGLA 4QX8A 2B45X 3RPQA 4N7IA 4YM0A 3PUSA 2LW8A 1SPPA
chains in the Genus database with same CATH topology
2I07B 2PHLA 4FAGA 2V5YA 2JG8C 3JU9A 4BPZA 4FOWA 4FCAA 5KHKA 3BB6A 5C9AC 5SV5A 3KQRA 4BE3A 1HX6A 1O5LA 1QH6A 4CEYA 5C4WA 4B4QA 4FSJA 1FI2A 3OYWB 1COV3 1W6OA 4OI4A 4CYDA 3VBFC 3LSDA 3HBZA 1Y3TA 4Q29A 4D69A 1R093 1W6MB 2QVSB 5BNPB 4E4ZA 3LA2A 4HFSA 1Q3EA 3O0WA 3DPRB 1PNFA 3OCPA 4FT8A 4LO6B 5LRSA 5BNQA 1REEA 3PNAA 4HLTA 2XJUA 2DYCA 3ZSLA 4FPJA 4K3UA 1UX6A 1DU3D 1DIWA 2AGSA 3KMHA 4LEJA 5A32B 2UYAA 1PO23 1SBEA 1XYNA 4FQ4A 1RMU3 3JBG2 1QQP3 4NWVA 3TB0A 2VVFA 2XL7A 1QU0A 4JRLA 2VW1A 1TME1 4IETA 1D4M2 1MQTA 3AX4A 4C0HA 1W0OA 3U07A 1HRI2 1O4TA 3ES1A 1VP6A 1MEC3 2P17A 3LB9A 1XYOA 2TUNA 2O8QA 1YWKA 4XQWA 1N3OA 1LEDA 1LULA 2AR6A 4LBJA 3AJZA 3NO8A 5I93A 1TNRA 2ZGPA 4F8AA 2I45A 1RVF2 3CU7A 4Y4YA 1D0HA 3SITA 1UW8A 1QJU3 2W52A 2ZS6B 2KA3A 2WNUB 4GWNA 5HCBA 2RS51 4URTA 1PK6B 1EP0A 4LBOA 5A33A 2HWE2 1HRV2 3FZ3A 4NPRA 1YJKA 4GQ7A 4N9HA 2JKBA 2NN8A 3B00A 3VV1A 3CJXA 1DGWA 2QUOA 4B7KA 4CDUA 1B35B 3AFGA 2PELA 2PFWA 2C0ZA 4YGEA 3VBUB 4AI1A 1IGOA 4A3XA 3KGZA 3UKTA 1OMIA 1FPN2 2D6KA 4XFHA 1NCQA 1VBA1 5CADA 4JGYC 5I91A 1RUH3 4GKXA 2RS32 2GC1A 1UPSA 2B5HA 2LM3A 1WGPA 2RR12 4IEVA 2HWD3 3WG3A 4NO4A 3PTYA 1Q43A 2ZGKA 4WM8A 2HWB2 5K0UB 3E5XA 3VBOB 4YFWA 2D3SA 2WQ4A 4XFFA 4RR3B 1BVP1 4LBNA 1OHFA 2H6CA 2VMHA 2X29A 4K9SA 2JG9A 3ZFFA 2RM23 1Q56A 1KFXL 1OQEA 2IXCA 5KXEA 2DU0A 1JYCA 5EYXA 1I9RA 2DCJA 3MIHA 2XBO3 1ZRDA 3VZMA 3ROUA 4K40A 1NQDA 4PLMA 2G9FA 5H9SA 1DQ0A 3M3EA 5F6KA 3V64A 4LBMA 3B5LB 4WVZA 1LOEA 1NA1C 1XNKA 1HQNA 1LOFC 4ATEA 1MZEA 2R32A 1YNAA 3MIFA 3NV1A 1AL22 4Y22A 2EXHA 3VDDB 1MZFA 4HKWA 1UU4A 1O3RA 4IEPA 4CEWB 2A6YA 4UBGA 1ULDA 2R043 4WM7B 4QPGB 4CDXC 4GMP3 2Z42A 5JAXA 3AXDA 1SBFA 3FUOA 2R30A 2G9GA 2R6QA 4I02A 4C0BA 4AFCA 4Y24A 2DVBA 2NP0A 2VVEA 2WQZC 2O1QA 2B8MA 5BPXA 2WZPP 5JZGA 2ET1A 2ZGUA 3NVCA 5B2GB 5GLZA 1RUJ1 2ZZQA 3VUOA 2P3JA 4CDWC 1SFNA 1HXS2 2VECA 5KXDA 5BUVA 4AEDC 1YYNA 1GQHA 1ND2C 2FMYA 2WS91 1N1TA 2O0OA 2X8KA 2DTYA 4PQ9A 5D8AB 5KC6A 3NAPA 4BMEA 4YGBA 1D4M3 4DFSA 1MACA 1O3TA 1WD3A 3E97A 5LK5A 4N43C 4XF4A 1FMD2 1V6OA 2B39A 1MR5A 1AXYA 2NMNA 1U5ZA 5T52A 1PVXA 3A4UA 1S0FA 1ZZ7A 4FXKB 2X5IC 2GH8A 4XW3A 4QGLA 1VBB1 2FZ1A 4YZ1A 1RUE2 1WD4A 3GZTB 3ILRA 4D3WA 1X8MA 4C90A 2QDNA 5EWSA 2VULA 1PVC3 5I0TA 4B4PA 4LA2A 2R062 3WDXA 4XJUA 4V1PA 1WLCA 2OUHA 3MGUA 1IS3A 5CB7A 5JSOA 1JUHA 5JR7B 4YVSB 4D94A 1HRV3 4XXAA 2R0FA 1CJDA 1H8TA 3EQEA 4PDWC 5SV8A 1UL9A 5FQ0B 1CAWB 4PIZA 4IXLA 2HWF2 3H8UA 2DVAA 3NKTA 2CV6A 1RUC2 3FC0A 5C9AA 4CDQB 1AJKA 2AH2A 4OUSA 3TNPB 1S0IA 1U12A 1RTVA 1XNCA 3UV9A 1IPJA 1H9WA 3M3OA 3ASIA 2D93A 2RS33 2VNOA 3AMQA 2ZMKA 5CFDB 2GNMA 3WDVA 4K6BA 4PF5A 3AXEA 3IDCB 4DOUA 3VZOA 4N53C 5FO7B 3P3NA 4B4RA 2Q30A 4MXVA 1RUF2 5KHHA 4AGRA 1S55A 3OYWA 5FDBA 1LODA 4IV1A 5GLUA 2CGNA 1MZ5A 1V9U1 2R1BA 4JC1A 5EYYA 1G7YA 1EAH2 2VPVA 1GYKA 4LR4A 4IEQA 1SCRA 3SISA 3VZNA 4MVTA 1PGSA 5GKAC 4XTMA 1LOAA 3WXPA 1OPMA 3MIDA 4ASLA 2OZ6A 3LA7A 4HN1A 1X50A 3ZO0B 2MEV2 3ILNA 2HYKA 5AC92 4LE3A 2GSYA 1R082 1GBGA 1COV1 5BNNC 2A6VA 4MX3A 2GN3A 3ZXGA 5L7OB 3Q9OA 4AFDA 4FTBA 2CAVA 1FOD3 1R091 1DFQA 2Q5TA 1VR3A 4EV0A 4YW1A 2GN7A 4BA6A 3NSTA 2WINB 2DF7A 5L19A 1XNDA 2CNAA 3KD4A 5DG1A 2GC2A 1FXZA 1E57A 1WMDA 2RHPA 1CD3G 1HXS3 4GULA 4WVMA 3BOWA 1PO21 3ZX7A 5L36A 5F6LB 4QQOA 1AJOA 2NYYA 2XLGA 3THTA 2HEWF 2VY0A 2WZR2 2HJIA 3HWJA 2BFUS 4FPHA 4TYSA 1QQP1 4QM9A 3WQ1A 3H0OA 4Q0UA 1AXKA 2W0XA 2IXJA 1OI6A 1PGL2 1AR62 2UU8A 1A8DA 4YZ5A 5AFBA 1VBD3 1R1A2 1YO8A 1CONA 1JN2P 2AYHA 3E5QA 1MEC1 3QH6A 2BPA2 5A3MA 3BALA 2D6OX 4CEYC 5C4WC 1K5MB 2EXKA 4XBNA 3NL1A 4FAHA 1RUE3 1CAUA 5J3UA 4ISQA 1UZYA 1AF9A 1AXZA 1MS3A 2LTNA 1TME3 1OLQA 4MGZE 3LKJA 4HKOA 2OZJA 3ECQA 1QJU1 2R063 4S2GA 5E16A 2E7TA 4E2QA 1O5UA 3MF9A 3V0AA 1PZ9A 1ZVFA 4B3NA 2PLV2 1QJX2 3LA3A 2FHRA 3JD72 1W0PA 4FPKA 4HVOA 1XE7A 4AGGA 2YXSA 2FQPA 2DCKA 3DF0A 4HBNA 5FO9B 4AFBA 4U2AA 3NJZA 3RZZA 5E88A 2EF6A 1RUD1 3MPPG 4HPKA 3FE5A 2ILMA 3AYEA 5E1RA 3WW2A 2QNKA 1RUH1 3R0RA 3U11A 4FBFA 3L2YA 1HV1A 3CJIA 3H1YA 2ES3A 3R6SA 2IWGB 1WUVA 5BNOC 2AUYA 2P3IA 1ASJ2 1OA3A 2D98A 3FBYA 5ABJB 1GKBA 2PHXA 3N7MA 1ULCA 1N1SA 2A70A 2IFWA 4R9CA 4ATFA 4LBQB 1Z0HA 1J59A 2EAAA 1EAH3 1MVEA 2WNVB 2XBO1 5GZGA 3WLUA 2JXAA 5GZEA 2CWMA 3O0XA 3AKTA 1OQ1A 2D5HA 5EFUA 5JIUA 1SCSA 1HIXA 2MEV3 5GJ6A 2D7FA 4DMIA 1PZ8A 4HVRA 4I30A 2D3RA 4M3CA 1EYBA 4KU7A 5FOBB 2GH2A 4C1WA 5AC93 1RINA 2ZPXA 4L11A 4Y20A 2WLPA 2NMOA 3TRSB 1LCLA 1QY4A 4WBBA 3UKVA 4KNCA 1C4RA 4EWAA 2WSVA 3KCYA 2R041 2BUKA 4CDUC 4GMP1 1UMZA 1AVBA 3ZN6A 1DF0A 3AZVA 4QHBA 4PIYA 2VOVA 2Q0AA 3MIGA 2RMU2 1RUI3 4YW2A 1NCQC 3MLJA 3RDIA 4KG0A 2TBVA 2P34A 2YYOA 2Q4SA 3J8F2 3UJQA 4AVAA 4XMAA 4AFMA 4WM8C 2IXLA 4XTPA 5I0RA 1NCRA 4RQPA 4I0WB 3VKMA 1I6XA 4JVAA 2FZ2A 3I8TA 3RYRA 3AKSA 2ZOEB 2JG9C 1AHSA 3ZFFC 1CR7A 2GNDA 1S1AA 3JBG1 1AL0G 2QE3A 4B29A 4C91A 4YFZA 1H1AA 1D4M1 3D4KA 2PHUA 3CL1A 5H9RA 5ACA2 1BBT3 4RS5B 2XKOA 1OOPA 3D5OA 1ZRFA 1Q8PA 2OW4A 4YW5A 3N7JA 1UPIA 1PIV2 4QPIB 1REFA 4G9SB 1LHWA 4KGQA 2AREA 3WDWA 3RI8A 4QQLA 3R4SA 4Q8KA 3HMYA 4H7LA 3KT7A 3H50A 1H1MA 3AMMA 3ST7A 2DUPA 2WIIB 1AYM2 3AZWA 2Q1MA 1F8VA 1S0GA 4XFCA 2PLV3 3WUCA 3THPA 1QJX3 1N3QA 2HWE1 3JD73 5E8AA 3AJYA 3M3QA 1HRV1 5JZGC 1AYN2 4M3CE 4YM3A 3DL3A 1LGCA 2DWRA 3GYDA 2H6BA 4JV4A 3ZXFA 5FPXA 3HAGA 4RHV3 5F5QA 1X36A 2BFUL 1LOBA 3DV8A 1LU1A 1GZWA 3BIWE 2UY9A 4ISRA 2VMGA 1POV0 2RS13 1WMEA 3NAPC 4LO4B 3D0JA 4W6XA 4DS0A 2K9ZA 3I2DA 2RS31 4FPYA 4GH4A 3E6CC 2ZHKA 5HCAA 3AP6A 4XIOA 3VBSB 3ZVXA 3SH5A 1ASJ3 4R52A 3HIFA 2Z5WA 5CFCB 1VBC2 3ZFEB 4AGVA 4WVVA 3HT1A 2ENRA 1G86A 2QZ3A 2R072 3BU7A 4L8QA 2VQAA 4BIOA 4PLOA 4MXWA 3VBRA 3VLBB 1Y9QA 4UW5A 5JI9A 5J7MA 1B09A 3L2HA 1WBLA 3B93A 5T50A 2XJQA 3SCHA 1VBE2 3PHMA 4NWWA 2D5FA 1ND3B 3BTAA 1J1LA 5I0UA 3FFQA 1V9U3 1Q8SA 4K7JA 1H8TC 1UKRA 3QH7A 4K1YA 2VH9A 1KJLA 3USUB 4DQAA 4L9BA 3QACA 4XF0A 1FOD1 3MF6A 4EN9B 2QZ2A 4HMZA 4O9GA 1ZM1A 2RMU3 1QDCA 1W6PB 2ZJCA 4DINB 2QFEA 2D6NA 3HD8B 3G7DA 2Q1ZB 2XJTA 2JG8B 3GBFA 1UU5A 4XQDA 1CX4A 1YJLA 3DGTA 3MICA 1IS6A 2ATFA 3B01A 2A6ZA 1REDA 1CAVB 2WL1A 2ZGRA 3PVNA 1HXS1 3GALA 5CNAA 4Q4W3 4YVWA 1Z7S2 4IV1C 4JCKA 4FP2A 1V6MA 2DCTA 4DZGA 3O14A 1XQNA 1C3HA 2Y38A 3V56A 3VBFB 4AHYA 2VNGA 4Q1RA 1AR93 5DZEA 4LLFA 3AP4A 5ACA3 1FMD1 4PJYA 2PHWA 1NQJA 1VBD1 3AMNA 2XGXA 3RQ0A 1PO12 2EXIA 4BHPA 3WG1A 4N90A 5JPNB 4XBQA 1JOJA 1RJ7A 1VALA 4LUKA 1PGW2 3VKLA 1RUE1 4RGAA 1O91A 3QCWA 3M1HA 1ENRA 2B46X 4UW4A 5CU1A 1DLLA 4FP3A 3ZYIB 2WFF2 2R061 2VOXA 3GZUC 4QX5A 3WINE 3U10A 5BNOA 4HN0A 3VGIA 5DUXA 3VN4A 2UYBA 4QGNA 3ZFGA 1G9FA 4XFAA 1FV2A 4CP0A 1ZA4A 1AZDA 1QOTA 1QMJA 3MW4A 2OA2A 3RMYA 4INDA 4EN8B 1C8M2 1BEV3 2A6XA 3V0BA 1UN1A 5T3NA 2NZ9A 1DQ2A 1OFSA 1RUOA 4HL0A 2PAEA 2DUQA 3FBMA 3MIBA 3B94A 4JGZA 2WNUC 1ONAA 1GZCA 2YMZA 1GFF2 1VBC3 2XB6C 1U5YA 2R073 2DVGA 1H1IA 1RUD3 3WOGA 4Y1VA 1EAH1 4BM8A 1KITA 3W58A 2EALA 4AW7A 1PM7A 4ORFA 4I01A 3FMGA 5KXCA 1POV3 5CAZA 1QJY2 1VBE3 1ALYA 4DXZA 1CAXA 3QOPA 4AF9A 4Q26A 4XYXA 1XU1A 2MEV1 1BZWA 3AYCA 1FX5A 4JGYB 3SCFA 5AC91 2E63A 4M00A 1TMF2 3D0SA 3IDEA 3ZMOA 4RR3C 4COVA 3ELNA 3FX3A 4GALA 5J96B 4PBPA 4Q27A 3KGLA 1TE1B 3CO2A 4AQSA 3OD4A 4IV3A 4IEXA 1ENSA 5C8CA 1FYUA 2ZGNA 2XVLA 4AQ6A 1RUI1 3NKGA 4Y26A 3JCIA 5L73A 3EHKA 4A7KA 4R9BA 1L3JA 4AXOA 2I2SA 2ZBJA 3CJIC 4ONUA 1SLIA 1ZYBA 2ZKNA 3WP6A 1W6QA 5CA6A 1J3QA 1NA1B 1Z7S3 2VW0A 1JUIA 1BYHA 5GZDA 3N35A 1EY2A 2YGMA 3MFAA 3OGJA 1OSGA 1ZX5A 1PGL1 2OVUA 2AZ5A 4CDXB 4OHYA 3M4FA 4JTNA 1KJRA 1BBT1 3AP7A 3AKRA 3V65A 4DRRA 2KXLA 4NHKA 1FATA 3VBHA 1FV3A 1O4YA 3OGGA 3AB0A 3JB8A 3JBG3 1SLBA 5GALA 4COZA 4Q4X2 2BEOA 4P9XA 1NG0A 2GAUA 3POSA 1VRH2 4Q1PA 4CDWB 2ZX4A 1A8MA 2MNGA 1HRI3 4AI0A 3P3PA 3WCSA 1BXHA 2R16A 4AEDB 5JOZA 1W6NA 1ND2B 5LK7B 5H9QA 1RC6A 5JDBA 1DZTA 3AK0A 4Q0PA 2PAKA 1ZREA 3B02A 3AYAA 1H2NA 3IPVA