1LHVA

Crystal structure of the n-terminal lg-domain of shbg in complex with norgestrel
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
177
structure length
173
Chain Sequence
PPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords SEX HORMONE-BINDING GLOBULIN
publication title Steroid Ligands Bind Human Sex Hormone-binding Globulin in Specific Orientations and Produce Distinct Changes in Protein Conformation
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 173
sequence length 177
ec nomenclature
pdb deposition date 2002-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00054 Laminin_G_1 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lhvA00
1VIWB 1HKDA 3MW4A 4YZ1A 1G9BA 3ATGA 4BPZA 4Y1UA 3VV1A 5T55A 3I8TA 1FNZA 1DQ2A 1I3HA 4Y1ZA 4ZXKA 4AGGA 2WT2A 4MYEA 1Q8OA 1CR7A 4LBOA 2DWRA 4AVTA 2GMPA 1WW7A 3RMXA 3V0BA 2GNDA 4IQPA 4M3CA 3D4KA 3USUA 2PELA 1WBFA 3V0AA 3AP4A 1W6OB 1W6QB 2P34A 4BOWA 3O0WA 3CNAA 1ULFA 3ASIA 4GKXA 4FPYA 1RINA 1DBNA 2ZHLA 1APNA 2NM1A 1VAVA 3T2TA 3ZXFA 1BYHA 5CBLA 1GKBA 2DVAA 2DURA 5JMCA 3AYEA 3FUOA 4C1XA 5E8AA 4PBOA 1GICA 3WLUA 5BYNA 1Q8PA 2A7AA 5JOXA 4XJWA 1LJ7A 1AXYA 1DGLA 2XG3A 3N7MA 1ULEA 3WG2A 2AYHA 1GZWB 2A5ZA 1NXD1 3OY8B 3A0NA 2GALA 3WOGA 3WDWA 2EIGA 2D3RA 1QOTA 1FATA 4NO4A 3WHTA 2JJ6A 1D0HA 1IS4A 2PHXA 1O4YA 3M3EA 2NMNA 1S1AA 3O5SA 5HCAA 3WHUA 4YFWA 4PBPA 2D6OX 4FQ4A 5DG1A 4GA9A 1YI7A 2CNAA 2PHUA 1IS5A 2YY1A 4XJ9A 1ENQA 3ZPYA 3PVNA 4LBLA 1VAMA 2A6ZA 2ZGSA 3MPPG 5H9QA 5JLVA 1G8WA 1QNYA 4YM1A 4ATEA 1DYKA 4XIOA 4UW6A 3N3HA 4FVVA 1S0JA 1KJLA 1PZ9A 2C9AA 2WJSA 2NP0A 1HQLA 4FP2A 1N1TA 3NV3A 4GWMA 3ZSJA 1AX2A 1LENA 1V6KA 3AZXA 4LBNA 4YW5A 2OUJA 3O0VA 3PJQA 1GZWA 3OY8A 1IS3A 2JECA 3HN1A 3TAYA 1JYCA 4AYUA 2GNBA 3AZWA 4PF5A 3ZXJA 3AP7A 1LHVA 2ZBJA 2ZGTA 1FX5A 4GWNA 3AXEA 5GLZA 1S0FA 3ILFA 1GANA 2A6VA 3JUUA 1F9KA 3O0XA 4P9YA 1C57A 3WUDA 4Y22B 1Y7BA 3RRDA 1QMJA 3HMYA 2EXHA 3FBYA 4Q26A 4C1WA 1I1EA 3W58A 3IN9A 1N3OA 5GZDA 2ZMLA 1GBGA 2YZ4A 2WT0A 3NWKA 4YG6A 5T52A 3VKNA 1G7YA 1X50A 1YRZA 2GMEA 2R1DA 3BODA 5AVAA 3FUQA 5KXCA 1F5FA 5IUQA 5IK4A 4YZ5A 3L2YA 3QCWA 2WNEA 2W68A 2R0FA 2JE7A 1VLNA 3SNMA 2SBAA 2G4IA 1MS4A 1LU2A 1Q8SA 2A6XA 2V73A 3OPZA 4AGRA 3WG4A 3M3OA 1LU1A 1RITA 1SBFA 4LBJA 1LGCA 1B09A 1UN1A 2DTWA 1R1ZA 1N1VA 1NLSA 4K1ZA 4ASMB 5T5LA 4XIKA 2UU8A 2D6PA 2UWAA 1QKQA 4Y24A 1WW6A 4Y22A 1LOAA 1SLTA 1GZCA 2DVGA 3SH3A 5T54A 4XXPA 1CJPA 3WZ1A 4U2AA 2HYKA 3ZXKA 1GSLA 1SBDA 2E53A 3AP5A 4Q8LA 1V6LA 5JDBA 1SFYA 3MEPA 3ENRA 4RL7A 1KDMA 1N47A 2CL2A 1A3KA 1V6MA 5FRAA 1BJQA 3IPVB 4BMEA 1U0AA 2W08A 2EF6A 5KXDA 3IM0A 2ARXA 1QDCA 2ZAAA 3UJQA 1MS3A 3ZXLA 2GDFA 4Y20B 4LBQB 3ZYPA 1IKQA 4YW4A 5EXOA 1AF9A 3OJBA 1SBEA 2VY0A 3RS6A 3NV1A 1AJKA 4XJZA 3POSA 4XTPA 3V64A 4FOQA 2ARBA 5IT6A 5H9SA 1ULDA 1LHUA 2DU1A 2DUPA 4FQZA 4XYXA 1LOEA 1SCSA 1N1YA 1ENRA 3BIWE 4M00A 5H9PA 1S0EA 2AENA 4K1YA 4L8QA 3VUOA 2ES3A 2I2SA 1W6NB 1QU0A 4Y1VA 4XILA 4JCKA 1YXWA 1ULCA 5JVVA 3SH4A 4R9AA 2ZGNA 5CB7A 4CTEA 5GZGA 2UWCA 1CQ9A 5KXBA 5DZFA 5T5OA 3W59A 2CWSA 4DPNA 4P9XA 1RIRA 1MZ6A 2H0BA 1MS5A 4UW5A 1JXNA 1IS6A 1MZ5A 1WD4A 2KM2A 3AZYA 4ITCA 3FLRA 2VW1A 1HLCA 2D3SA 4K20A 4Y20A 3AFKA 4YZ2A 1KDKA 3NV2A 4XMIA 3WUCA 1ONAA 4YG3A 1OQ1A 3UJOA 4DQAA 3ZYRA 4P9WA 2GN7A 2D6KA 4YW3A 1C4RA 2AUYA 2E51A 4YM2A 1Q8VA 3WG3A 2D3PA 1W6OA 1W6QA 2XB6C 2NMOA 4FPGA 1DQ5A 3DGTA 1LOBA 1V6OA 1KRIA 1DHKB 1W6NA 5GALA 2NYYA 4YGDA 2VU9A 4YW1A 2R16A 3APBA 4JC1A 1G86A 2YROA 1SLLA 4Q2FA 2DUQA 3VKFC 1AX0A 3QLQA 3ZVXA 2D6MA 4TYSA 4DRVA 1SLAA 1CVNA 5GZCA 1MS8A 1G9AA 2OVUA 2ZHNA 1GZ9A 3AJYA 2ZGMA 2ZGUA 2DV9A 4FPFA 1XQNA 1W6MB 2Q5TA 1AX1A 2ZGKA 4AWDA 5T5JA 2A71A 2D43A 3POYA 2P3IA 3I4IA 1GYKA 1GLHA 1EPWA 1MR5A 2WQZC 4YG0A 3WDVA 1MVEA 4YGEA 1CPNA 2YXSA 1F31A 1DFQA 3A4UA 4FPOB 1WLCA 1AVBA 4DS0A 4KBBA 4Q1PA 1CONA 1FNYA 2CWMA 2A70A 2D7FA 4OZXA 1AXKA 1SCRA 2EAKA 1OKQA 2VW0A 2LALA 5GJ6A 4FPCA 3AYCA 1PZ7A 2DU0A 1N3QA 1SLBA 2YV8A 4YFZA 5GLUA 2GMMA 3KM5A 4ISQA 3UK9A 1WBLA 4PCRA 1QOOA 2P3KA 2VH9A 4D69A 1W6MA 4W65A 5F9TA 1ZM1A 2DVBA 4BLJA 2ZABA 1S0CA 5GM0A 4U36A 5JOWA 1LHOA 1DQ1A 3ILNA 3VKOA 3B00A 3C2UA 2ZGRA 3PVEA 2JDZA 1WD3A 1DZQA 1LHNA 3TB0A 1DQ4A 1V6IA 2BQPA 3WDUA 5HCFA 1HQWA 1Z78A 2V5YA 1LHWA 3FFZA 2WSUA 3OGGA 3T1MA 2TEPA 3AXDA 3M3CA 4SLIA 1IKPA 2GN3A 2ZZJA 4XZPA 1FAYA 1JN2P 2VUAA 3SITA 1LULA 5GLWA 1DQ0A 2EXIA 4GKYA 4I30A 2P37A 4FPEA 3LSDA 1PZ8A 2A3XA 4R9BA 2AREA 1W0OA 2WSVA 3B01A 1JW6A 2WKKA 1SLCA 2AGSA 4M3CB 4BMBA 1CESA 2C5DA 2VXRA 4ATFA 3N7KA 3O12A 4XBQA 2ZHKA 2EXKA 1Q56A 1O4ZA 3IMNA 4XBLA 2VW2A 1LOCA 5DUUA 2A6WA 4YZ3A 3R4UA 3ZXEA 4FPJA 1A8DA 1MVQA 4AVSA 1LOGA 3T1LA 1TEIA 2PHTA 3WDXA 3HR9A 1Q8QA 2CTVA 3D5OA 2DTYA 1LOFC 1WW5A 4YM3A 3WNXA 1H9PA 1ZA4A 1AXZA 2UURA 1WLDA 4XDQA 2AR6A 3M1HA 2ZA9A 1UKGA 1QNWA 4CZSA 4XTMA 2A3YA 3RSJA 1G9DA 2ZGOA 3AJZA 3LCPA 3RMYA 1N3PA 2FHRA 3M3QA 4LBMA 5IK5A 3H0OA 1GNZA 1MS9A 3IPVA 5CAZA 1LCLA 4Y1XA 4Y26A 2PHWA 2AH2A 1AJOA 1QDOA 2A6YA 1MACA 2B7YA 4BLIA 5GLVA 3B9CA 1V6NA 2A75A 1YYNA 4WV8A 4YM0A 1W6PB 3WV6A 3MW2A 5GZEA 4LBQA 5KXEA 4RA0A 1ULGA 4Z8BA 3AP6A 1JBCA 3A0KA 2ZMNA 3WVJA 3WG1A 2DYCA 2EXJA 1KQRA 1QF3A 1WW4A 3B3QE 3FLTA 4WVVA 1S0GA 3D6EA 3PMEA 1Z0HA 4HL0A 1LESA 1CIWA 4H55A 4XHBA 3PVOA 1JOJA 5L73A 1VALA 1V6JA 4HANA 1CPMA 1S0IA 2D44A 1J1TA 4K21A 2GNTA 1GV9A 2ZGQA 1LTEA 1C1FA 1WCSA 3INAA 3SISA 4FOVA 2FMDA 3RG0A 2ZKNA 2ZGPA 3N7LA 2EALA 2YMZA 3WDTA 5CNAA 4AVVA 1KJRA 3AYDA 1A78A 4YGCA 1C1LA 5DXDA 1LECA 4BM8A 4YGBA 1W6PA 4GXLA 1UZYA 4WVWA 1D2SA 4PQ9A 4BQ1A 3AX4A 3BOPA 1WLWA 4Q27A 5E88A 1WUVA 2E7QA 1QOSA 3U4XA 4TZDA 3WCRA 1N1SA 1DLLA 4WZFA 2CYFA 5CA6A 4R9CA 2R49A 5FREA 1LOFA 2LTNA 4XXAA 1UPSA 1KITA 1LODA 3N35A 4R9DA 1OFSA 4Q1RA 2WLQA 4YW2A 3VKLA 3SLIA 4JRAA 1UMZA 4XMAA 1FV3A 3KQRA 3R05A 4XHXA 3N36A 2R0HA 4GALA 3N7JA 1JHNA 4XJAA 3POWA 4AGVA 4ZKTB 1BXHA 5DG2A 3JU9A 2ZMKA 1BKZA 1H30A 4NOTA 4Y1YA 4YLZA 4XJ8A 2CY6A 1DIWA 2E7TA 2ZGLA 1MS1A 5HCBA 2P3JA 1W0PA 4UW4A 3IKWA 3MW3A 1GNHA 3FLPA 4XJUA 2OW4A 1URXA 2PHRA 2OUHA 3UL2A 4FPKA 1LGNA 1AZDA 2NN8A 4F83A 3OYWB 5E89A 3Q9OA 1S0BA 3OBRA 1LEDA 5EYYA 4XOGA 1DQ6A 3AK0A 4FP3A 5IK8A 3BTAA 1LEMA 5DZEA 1QGLA 1FYUA 3V65A 3GNEA 2JE9A 2RHPA 5GLTA 3LSEA 5GZFA 5SV8A 5JOZA 2ZACA 2WT1A 4YZ4A 5IK7A 3B69A 2P2KA 1S0DA 1DYPA 2D6NA 1ENSA 3OBTA 5DZGA 2A3WA 4FOWA 1SACA 2D6LX 1HDKA 5DUVA 5T5PA 5T50A 4DFSA 4DRRA 2E6VA 4ISRA 2JKBA 2R1BA 1G9FA 4UW3A 3M2MA 5DUWA 3ZSLA 5EYXA 5JOYA 4Q8KA 1G9CA 2ERFA 2DUOA 2Z42A 2NZ9A 3AZZA 2ENRA 2DVDA 3V0BB 4LBKA 3WCSA 5H9RA 2PHFA 4FPLA 1V00A 3AP9A 4M01A 5F5QA 3USUB 1LGBA 3GALA 4FOYA 4XE9A 3V0AB 5LK5A 3OYWA 2DVFA 4M3CE 3ZSKA 2W39A 2GNMA 2W52A 4M3CF 4XBNA 5DUXA 1UL9A 1CN1A 1YIFA 3RQ0A 4CRQA 1SLIA 1YO8A 1H9WA 3ZSMA 1JYIA 3AZVA 1UX6A 3ILRA 3R4SA 2UWBA 1JUIA 5EWSA 1MS0A 3VKMA 1FV2A 4P14A 1UAIA 1BZWA 3DUIA 3WDYA 2ZHMA 4LBQD 2JD4A 3AYAA 2SLIA 3SH5A 1IOAA 1UZZA 4FPHA 1BQPA 3NV4A
chains in the Genus database with same CATH superfamily
1G9BA 3MW4A 3ATGA 4Y1UA 2XLAA 1DQ2A 3KGLA 2HBTA 4AGGA 1O59A 4XF0A 1Q8OA 3JBG1 1CR7A 4AVTA 1ASJ2 3EO6A 5DAWA 2FDIA 5CFDC 2VZOA 2PELA 3ALQA 3V0AA 2BOJA 1TE1B 1W6OB 1W6QB 2WFF2 3B02A 1XNDA 4IEQA 2WYFA 1DBNA 1APNA 1VAVA 4GMP0 3ZXFA 4E4SA 1OA2A 4CDWC 1BYHA 1CZTA 2NPIA 1C3HA 1VMJA 1GKBA 2ZEWA 1HB1A 3CJIC 3HBKA 4GH4A 2DURA 1UZWA 3H8XA 1W3XA 4URAA 1OC1A 1U5ZA 3IAPA 3FFQA 3WQBA 1KXGA 5FY5A 3WLUA 3ZXAC 2GU9A 1Q8PA 1XNCA 2A7AA 3DYMA 5JOXA 2XG3A 1DGLA 3MPBA 3U4SA 4HSLA 3ZKYA 2H0VA 2VNOA 3RZHA 1GZWB 2A5ZA 1NXD1 4UWDA 3WOGA 2QQPA 1H2LA 2V4VA 2R073 4CCKA 3WNNA 5K7PA 1HRI2 1H6XA 1QXRA 1D0HA 3I3EA 4MADA 2NMNA 1SDDB 4MO3M 5APAA 5C9AA 4UXAA 1SMVA 4YFWA 3BU7A 4PBPA 2WAAA 2MPFA 4GB32 4D94A 2BGPA 4DEQA 2CNAA 2PHUA 2YY1A 4AEJA 1CX4A 3ZPYA 3ZFGA 2J42A 4CDWB 2FCUA 2ZGSA 3MPPG 3CJIB 5J3UA 1GWMA 4C91A 1GUIA 2WABA 4ATEA 4QQHA 4PIXA 3TN93 5FP9A 5FYSA 1ZZ9A 4XFAA 1ALYA 1ZBA2 1UZ0A 1T6GC 2B9VA 3OBAA 1VBC3 2J1TA 2IC1A 1HQLA 1AR93 1COV1 1L7QA 1N1TA 4IDZA 2Y8KA 3ZSJA 3LOIA 1H4GA 4OUEA 1XNAA 2IXJA 2VE1A 4YW5A 3O0VA 5A7WB 4I3GA 3HQUA 4IEUA 3OY8A 2RMU1 2JECA 1R092 4LHSA 4OZOA 1CAXB 1JYCA 4AFAA 5F2WA 4AYUA 4EWAA 5LBEA 1X8EA 1FX5A 4GWNA 1S0FA 4EN8B 3JUUA 1F9KA 3SEEA 4P9YA 4CCMA 3KWVA 3JBG3 3WUDA 4KGQA 4WVZA 4Y22B 4CDXC 1QMJA 3PL0A 3W58A 1BVP1 3IN9A 4QB2A 5GZDA 3VD3A 4BU2A 1H2KA 1GBGA 3JB4C 4IEWA 1FPN1 4CCEA 4G3YC 2YZ4A 2Z69A 5T52A 1FMD2 2VCBA 5IVEA 1J3QA 1G7YA 1NUKA 1X50A 4ASLA 2O14A 3K4ZA 1YRZA 2GMEA 2CV6A 2R1DA 3BPZA 1OPOA 4KI5M 3FUQA 5C3PA 4GQ7A 1HX6A 5F5CA 1NOVA 1X82A 4EZ4A 3L2YA 2WNEA 2VQ0A 2RS11 5G04L 1UU6A 2R0FA 2JENA 2JE7A 2K9ZA 2N7GA 3SNMA 2SBAA 2QCSB 2VBDA 4DOUA 4NRQA 5A7PA 1SBFA 3UETA 5FZEA 1WMDA 1F4AA 2IXKA 3HQXA 3QD6A 1R1ZA 1IG3A 1NLSA 2WZR1 1K5JA 3ETQA 4K1ZA 4MVTA 5FUNA 4CDUC 5E6HA 4CDXB 4JV4A 1JHJA 2UWAA 4AL9A 4DZGA 4PIYA 4O9GA 2IZWA 5K8SA 1CAVA 2DVGA 3CDZB 4XF3A 3SH3A 2Y6FA 1CJPA 3WZ1A 4U2AA 5A3MA 2DFCA 1SBDA 5BPXA 3NMBA 4RHV1 3I54A 2A1XA 4J25A 3RGBA 4DO0A 5C33A 3HEIA 3WW4A 3ENRA 4RL7A 1V6MA 2MNGA 1RUE1 3RWNA 2IWGB 2VGDA 1H2NA 5FKBA 2OS2A 5KXDA 2MHFA 4IEPA 4IV1C 5GKAC 3ZR5A 2BBVA 1RC6A 2B42B 1OHFA 2ARXA 2HYXA 2YB7A 4CDUB 4XUPA 2RMU3 1HRV3 1ND2C 3GDBA 3OJBA 1QJEA 1TME2 2FMYA 4NIDA 2OZJA 1VBB1 1POV1 4XJZA 4CCLA 3IBMA 4ZS2A 1LHUA 2DU1A 3EB7A 4HETA 2JDHA 2YPDA 4GWJA 2PXJA 4M00A 4LUMA 5H9PA 3ZN6B 4B3NA 3HVDA 1CAUA 2ES3A 2I2SA 3VUOA 5LEKA 3WDVA 3JD71 4B29A 1QU0A 2JE8A 4XILA 5KC6A 3H8OA 1QWRA 3KT4A 5JVVA 3KV6A 4XQDA 5CB7A 3VZNA 3SCGA 2QBXA 4IV1B 3W59A 1EUTA 3Q8FA 4DPNA 2CDPA 3LA7A 4QHBA 4NWWA 2RS13 4HZFA 1UXZA 1RJ8A 4ASKA 3MICA 4UW5A 1IS6A 4BQ2A 1W06A 1YQ5A 4ZY9A 1U5XA 1ND2B 3WF1A 1HLCA 5FIXA 1W28A 5IW0A 4Y20A 3POIA 3WR0A 2G9GA 3WUCA 2R042 2WZR3 3N9LA 1BBT3 2PAMA 3DKWA 4JHTA 3VDBA 1AYN2 2RS32 5DN2A 4OULA 4NHMA 5A7NA 2UYAA 3ACHA 3FHAA 4I09A 4KG8A 5FMOS 4B7EA 3JXSA 3WG3A 4GJYA 3NNJA 4ZXEA 3DGTA 4JGYA 1GU3A 1LOBA 4QX0A 4QB6A 2WL1A 3LD8A 4QPIC 4BQ5A 2NYYA 1YQ6A 2VVFA 4YGDA 4YW1A 4QX8A 1NE4A 4RHV3 2VZVA 4AFDA 1GQGA 5KC5A 1UNBA 1PO12 1SLLA 4JAAA 2DUQA 4JVAA 2WWSA 1ZA7A 4PF1A 5FPZA 2VUJA 3OD0A 4AEKA 1RUE3 1YIPA 2D6MA 4TYSA 4E4HA 2W1WA 2Q8OA 1QY4A 3M70A 1JOPA 1JUHA 5T3NA 1GZ9A 4CEYA 2ZGMA 2ZGUA 3B5LB 4L0PA 4HT1T 3VBOA 5AFEA 2HLEA 4AWDA 4XEZA 1L7RA 1X9PA 1XXNA 3T2PA 4TSVA 1V9U1 3POYA 2P3IA 3NL1A 1YUDA 2R7EB 2W87A 1GYKA 1EPWA 2PHDA 2RJ2A 2VMIA 2WQZC 1TMF2 2X5IA 1MVEA 3LF7A 4XFGA 1VBB3 1POV3 3A23A 3LPFA 2QZ3A 2YXSA 4P02B 3BYWA 5FP3A 1WLCA 2RV9A 5DAXA 4QPIB 5FY9A 2XJRA 2LUWA 1VBA1 4PJYA 4Q1PA 3LEMA 5FMCA 5LRRA 4E9KA 1GWKA 5LBBA 3JQWA 4N53C 1FNYA 2CWMA 2A70A 4MV2A 3S5AA 3GZAA 5FZ0A 2K2SA 2LALA 1VRH2 4FPCA 1RXGA 1PZ7A 4DXTA 1SLBA 2YV8A 5IFTA 1QEXA 4YFZA 5GLUA 2C9KA 3UK9A 1ZZ8A 3IAQA 3JZVA 3X29B 4D0QA 5CEHA 4W4ZA 1ASJ1 1POQA 3H3LA 2Q4SA 2RVAA 4D69A 2XQRA 3LAGA 1G9CA 2ZABA 1S0CA 3PU8A 4U36A 1I6XA 3H3UA 3KHCA 3B00A 1XE8A 2W46A 1I5ZA 2WFF1 4CCOA 1WD3A 4RFRB 3WINE 1RTVA 4FTEA 3KVAA 4K40A 4K8RB 4CU9A 1DQ4A 1V6IA 4BIFA 2HWD2 3O1UA 2BQPA 5HPOA 2WZPP 4W6YA 2FDGA 3LDRA 2V5YA 1LHWA 3J8F2 2EA7A 2TEPA 4N53B 4X6RB 2WZ8A 4XZPA 3SITA 4PHZA 4BYYA 5A3WA 3MYXA 5BNOA 3FE5A 4HOOA 5JXIA 4GKYA 1XB9A 1HB3A 2CHHA 4K8FA 1UD1A 3DCQA 3PTYA 4ET7A 2X53S 3NKTA 3QH7A 4Z82A 4BH9A 2WSVA 1JZ2A 2B46X 1JW6A 3RVHA 3DXUA 1HRI1 5ACA3 5IYYA 2AGSA 5CKQA 3ZM8A 2C5DA 2B5HA 3N7KA 1S4CA 4ATFA 3WSOA 4AQTA 3DPRA 2ZEYA 5A6ZA 4GB31 3MF6A 2OT7A 4FPJA 1A8DA 3F2ZA 4AVSA 4BWOA 1NCQA 4XUTA 3T1LA 1RUJ2 1TEIA 1V9U3 5LZ6A 2RR12 1DZTA 2VZRA 3OEBA 2DTYA 3AKRA 4AFMA 4P08A 1WW5A 4EQVA 5I91A 4FTBA 3WW3A 4QXKA 1ZBA1 3WNXA 4E4ZA 2J1EA 1ZRRA 4CXWA 2JEMA 1MZEA 2ZA9A 4UYBA 4CZSA 1YC61 5FYCA 4O7XA 2ZGOA 3AJZA 2JDNA 2JG9C 4QKBA 5K0UC 3M3QA 5LWBA 3LDBA 4A42A 3S0MA 1R091 4Q0VA 1LCLA 2ZX4A 4Y26A 5L7OC 2PHWA 3EMRA 2JWPA 2A6YA 3P3PA 4LKSA 1KD7A 3WNPA 5LK7B 3WX5A 3O1OA 3OF1A 5C9AB 2A75A 5A80A 3VD7A 4A6SA 1W6PB 1G6NA 3WV6A 5AFBA 4XETA 4COWA 1QHDA 1OLQA 1ASJ3 3UKNA 4RA0A 1RUG2 3ZFGB 2WZEA 4OUSA 1W0NA 3WVJA 1UYPA 4IUGA 1FMD1 1KQRA 1WW4A 5E1RA 4YWAA 3FLTA 2OQ7A 4DINB 4WVVA 1S0GA 5BNNC 3PMEA 4CUGA 4LO6B 1LESA 2VBPA 4MH0E 2W94A 3PVOA 1DGWA 1JOJA 1EYBA 4CCDA 2TNFA 3LA3A 4COZA 2F17A 1S0IA 2D44A 1J1TA 1PMIA 5L36A 2ZGQA 5C3QA 2JG9B 5K0UB 1LTEA 3INAA 3WP3A 2PN5A 3ZIWA 5AVPA 5FJHA 3SISA 2FMDA 2HWF2 2JDAA 2Y6KA 3LDKA 5IVFA 3N7LA 3WDTA 3GHNA 1VJ2A 3Q8BA 4XUOA 5A1LA 4AQ2A 3I2DA 4AVVA 4LKDA 4QKNA 2Y34A 2D40A 1C1LA 4MOAA 5C3RA 5JR2A 4JGZA 1HRI3 3THDA 3UGFA 3UV9A 3ZN5A 5I93A 4WVMA 4XDOA 1D2SA 2JB4A 2VMHA 3CEWA 4XDPA 4Q27A 1WLWA 5C8CC 4I3PA 1F2NA 2E7QA 3PURA 5E88A 1XBFA 5B2GB 4GB33 1EPZA 1NY72 4Z07A 3WCRA 4RQPC 3R6SA 2C0ZA 3KHBA 1ZZ7A 3CF6E 2R49A 3MIDA 4LR4A 2LTNA 5JUVA 3T09A 2W1SA 3O1TA 3I2OA 4R9DA 5C7GA 2VMFA 3VKLA 2VAUA 4JRAA 1UMZA 2W5FA 3SLIA 2R063 3LQCA 4ZU4A 3R05A 3N7JA 1ZBA3 4AGVA 1IPKA 4XPVA 4AHYA 2BWAA 4DY5A 4EN6B 1RUH2 5DG2A 5A70A 1H30A 4Y1YA 3THCA 4LLOA 3VDCA 2I45A 4BK5A 4XJ8A 2B4KA 2CY6A 1UOGA 2E7TA 1MS1A 5D21A 4YRDA 3ME2A 3RZKA 4LUKA 3U0ZA 3MW3A 1OMIA 1GNHA 1R093 2QQWA 2Y60A 4AW7A 1IZ3A 5A7SA 2J1RA 2VQTA 4BISA 1EV12 2BNOA 1TME1 4YW7A 3RYKA 5C8CB 1CAVB 1RUD2 3AC0A 1NG0A 1AZDA 1WGPA 2NN8A 3MGUA 2JIJA 1HB2A 4LE4A 4RQPB 4CP1A 3MUZ1 1WWYA 1DQ6A 1PK6C 3DYPA 3WF2A 4LJHA 1QGLA 2KXLA 3I7DA 4MGZE 3DN7A 1FMD3 5J98B 3GNEA 4B4PA 1VAKA 3BVCA 1ZRCA 2OXBA 1TVGA 5DPNA 4A7ZA 4ZZ5A 4AEMA 2WNUA 4TLGA 1D4M3 1RXFA 3O1RA 2W9XA 3T3YA 3D3AA 4E27A 4S2GA 1OI6A 1S0DA 1ND3A 3ES4A 3N9MA 3ZYBA 1RUNA 1AR62 1ENSA 3VBSA 1SACA 5DUVA 2Y6JA 2XL7A 5DUWA 5M0TA 3ZSLA 2ERFA 1YNAA 4K3UA 3EBRA 4QHZA 2DUOA 4QX3A 4LEJA 4L9BA 5F3IA 2Y6HA 3WQ1A 4AQSA 1CWPA 2R041 3U37A 1ZZBA 2PHFA 1AYN1 2GC2A 2RS31 4PT6A 5FZOB 3AL6A 1RUI3 4XF1A 2DVFA 4N8MA 4AEDC 5BY5A 1W2TA 4OI2A 1NA1C 4LXLA 2W52A 5F8PA 5B4NA 3S30A 4JGYC 1JOBA 3N9QA 3ILRA 1NLRA 2HEVF 2XQXA 2UWBA 2J1UA 1PO11 1OOPC 4GMP1 4PI2A 5JMOA 3N9NA 1MS0A 1NXMA 2EIBA 3GM8A 5EWSA 3U14A 3VKMA 3RZJA 4YNIA 3VL8A 2VTXJ 4I01A 4MHRA 4NE9A 1UZZA 2WJSA 4HFSA 4MYEA 5GLTA 3K48A 2E33A 5F3CA 1VIWB 2JDUA 2WNOA 1C8NA 2VECA 3VBHC 5BV6A 4BPZA 3I8TA 1FNZA 2XJSA 1YFUA 5D8AC 3CBNA 1HV1A 2J1AA 4LBOA 2DWRA 2O1QA 1WW7A 4Q4Y2 2GNDA 2I74A 3NW4A 1FOD2 4WM8C 5FPLA 4AEDB 3J9SA 5A32B 1OQDA 1TME3 2CAVA 1TMF1 1NA1B 3AP4A 5DQ0A 3KGZA 2DDUA 3W20A 2VQUA 4J1WA 4JGYB 4IGPA 4FPYA 5A6YA 3H50A 4JDNA 4QM9A 2C4XA 5CBLA 1OOPB 5L9RA 2ZEZA 4C1XA 5BNQA 3N4MA 4HN0A 3TEYA 1VRH1 1GICA 4MXWA 4COVA 5BYNA 2D98A 4XJWA 1YFYA 2BVVA 2WQ8A 4LK6A 5JZGA 1JI6A 1OA3A 3VBHB 5DMYA 3WG2A 4LIVA 1RUF3 4LHNA 5D8AB 1RHI2 3VBOB 2GALA 4BXFA 3VBRC 1AR83 2EIGA 4OMDA 4N9HA 1UO9A 2XUEA 5JXHA 3OB8A 3K2OA 5BNPC 4NO4A 1O4TA 4YVSA 1IS4A 3OBZA 3RJRA 3O5SA 1PIV2 2R043 4Z2AA 2AEZA 1AYN3 1XU1A 2RS33 2HWD1 1YI7A 1BCXA 3J8F1 4NPLA 3PVNA 4A2UA 4LBLA 3E5UA 3V56A 1G8WA 1QNYA 4QPYA 4HKOA 3ZFEA 1IG0A 5DAQA 4UW6A 3VD4A 5JXJA 1J83A 2RDQA 1VBE2 2C9AA 5A6QA 1OKOA 4GMP3 4NIIA 3GJBA 1W2OA 1GQHA 4A44A 1V6KA 1LENA 4XFIA 4CDQA 2OUJA 3PJQA 5FY0A 1OT5A 3NJVA 5BNPB 1IS3A 1SFNA 2J1VA 4NPRA 3ZXJA 3AP7A 2X8KA 3ILFA 5F3GA 2G9ZA 1VRBA 3PJYA 4KWJA 5J7MA 2VJXA 1Y7BA 1RUJ1 3HMYA 2RR11 4QMAA 3WP6A 4BCUA 2VTFA 2RDRA 1TMF3 1W8UA 3MV01 2PLV3 4J1XA 5CG9A 4LA3A 1C5IA 1VB4A 3HT2A 3E5XA 4IXLA 5BNOB 3I3MA 5DAPA 3BODA 4OHWA 1X33A 1Y9MA 1J58A 2GP5A 2HWB2 3NAPC 5IUQA 4YZ5A 2QQOA 4Q4W2 2W68A 4Y33A 2YBSA 4QPGC 5F2SA 4BK4A 1ZRDA 1MS4A 1LU2A 1UY4A 3CO2A 2WBKA 3WG4A 3M3OA 4CEWC 1RITA 5FZFA 5JR7B 4LOTA 2DTWA 1NCRC 1N1VA 4LO4B 2XJQA 4ASMB 5T5LA 4XIKA 1RUG1 4OI0A 3I97A 2D6PA 5FY1A 2FDJA 4XAAA 4Y24A 3VN4A 4HVQA 2WFPA 4FI9A 1WW6A 4BQXA 5ABJA 5KWRA 1SLTA 1GZCA 5T54A 4XXPA 4YYOA 1W3VA 3MHZA 4HVOA 5F5IA 3VHOA 2HYKA 2HWD3 3RI8A 1DGRN 4COUA 4E2GA 1EUUA 3ZDSA 4NIGA 1QQP2 3NAPB 4V2VA 5FK7A 1PO23 4HK9A 5C3SA 2YBKA 5JDBA 3ES1A 4YW6A 1SFYA 4JZRA 4QX7A 3I2KA 4WM7A 3WW1A 4QPGB 2HWC2 1KDMA 2CL2A 5FRAA 1ZYBA 2K46A 2Q8CA 1BJQA 2HWF1 4CP9A 1U0AA 3U10A 4N43A 2P1BA 5HV4A 3BPSA 4A6OA 4QQOA 3SCHA 2IFWA 4CEWB 3IM0A 1YJLA 3UJQA 4W50A 4D7TA 2ZOEB 3POFA 1NCRB 1I5PA 2VOVA 3ZXLA 5I8TA 5IK5A 3LGRA 1SQ4A 2GDFA 4JGZC 4MGTA 3KF5A 5EXOA 1AF9A 3R0RA 4FAGA 1SBEA 4QQLA 5FPVA 4AE2A 3NV1A 1E5RA 1NY71 2ARBA 5IT6A 4DXZA 1E5IA 1RUJ3 3NNLA 4FQZA 4GWIA 2RR13 4IE0A 4L99A 4IERA 2GSYA 1N1YA 4EN7B 1ENRA 2RS52 3NJYA 4K1YA 1HIXA 1W6NB 4UFLA 3KMHA 1OSGA 4JCKA 3MFAA 1H8TA 1YXWA 4HPKB 3RI9A 1M4WA 1RUH1 4Q4V2 1O3TA 5I0SA 1K5MA 2F4LA 4LO8A 5T5OA 2PHLA 2CWSA 2Q8EA 4NWVA 3TEWA 1BEV3 1MZ6A 1XE7A 2C6SA 2KM2A 4JGZB 4DXRA 3VBFC 1D7PM 2VW1A 2OIIA 1EV11 2R6QA 5DDJ3 3S5QA 4S2HA 4EWEA 1RUD1 4YZ2A 2Y0IA 3BGAA 4XCAA 4PQQA 1OQ1A 2Y6GA 3HN3A 3A7QA 3UJOA 1RUG3 4DQAA 2KR2A 2W95A 1RVF3 4YW3A 2GN7A 2D6KA 3MIFA 5FOBB 2Y26A 2E51A 4YM2A 1Q8VA 4GIQA 3E6CC 1JYNA 2BNNA 3JB8A 1V6OA 2ET7A 4DIQA 1KRIA 1GFF2 2I07B 2FD8A 3SCFA 1YWKA 4WZCA 4D7SA 2VU9A 2R16A 4JC1A 5A3NA 5EP9A 4OMCA 1G86A 1AR61 2VOKA 1QJY2 3GF6A 3H7YA 3VKFC 1AX0A 2VZSA 5C4WC 4DRVA 4MG2A 3C7OA 5GZCA 1S55A 3VBFB 1G9AA 1F8VA 3VZLA 4Q4X2 2XMLA 3H42B 1XQNA 1W6MB 1UMIA 2ZTNA 2ZGKA 3CU7A 4CUBA 5T5JA 1W8NA 3OGJA 4LOSA 4QU2A 5L9BA 4P00B 4WBBA 4YG0A 1GLHA 2K0GA 1PHMA 2F6BA 3KCXA 1SPPB 4YGEA 3I49A 1CPNA 1O3QA 1F31A 1HJGA 5FYYA 4IEVA 4LHKA 4KBBA 1FXZA 3VBUC 3I2GA 4M4PA 3O1VA 1CONA 2O0OA 5A1AA 2D7FA 4FFHA 3T4VA 1SCRA 2EAKA 3FZ3A 3ECQA 2EICA 4E8DA 4FAHA 5GJ6A 1RUH3 5C4WB 3EHKA 3P1IA 5FXVA 3IIIA 2YGLA 2FDHA 4AZZA 2QQMA 4ISQA 4OCTA 4RS5C 1Q5OA 1RYYA 1WBLA 1QOOA 3PMSA 4CVUA 4Q4Y1 2VH9A 4Q0PA 4W65A 1FOD1 5FMDA 1ZM1A 2DVBA 2UYBA 4V2WA 3USSA 4BLJA 5JOWA 3LIGA 1LHOA 5FZBA 3ILNA 4Z1VA 4AK3A 4BB3A 2WR9A 1KFXL 2BTVC 4AFCA 1UIJA 2JDZA 2LROA 1UY0A 3FN9A 1LHNA 4NHYA 4OHXA 1ZNPA 1R1A2 2HWE2 2XLGA 4TXWA 1HQWA 3T1MA 4DMIA 5C3OA 4QQPA 2WSUA 3VBUB 3P5BA 2ARCA 4MGSA 1XJAA 4MGYE 1KS4A 1ENXA 2XJVA 3AXDA 1OURA 2ZZJA 3M3CA 1J3PA 3I59B 1GR3A 4SLIA 4YVWC 3UYJA 5JPMB 1JS9A 1LULA 1DQ0A 2EXIA 1OF4A 2P37A 4N90A 5FYZA 1W03A 3POBA 3OOXA 1GMMA 1AR63 1RHI1 4GD4A 1W39A 4OI4A 4RS5B 2VO5A 5JAXA 1DG6A 1TQ5A 1X36A 3HWJA 1COV3 4IGQA 2WKKA 3ZYIB 2VXRA 2MEV2 3OEAA 4XBQA 1PIV1 1PGW2 2ZHKA 1Q56A 3IMNA 1LOCA 4B1LA 4BXSV 2WS92 4YZ3A 3K77A 1DP0A 3AMNA 4IW3A 4Q0UA 1LB2A 1PVC2 3ZPOA 3I3QA 1PX3A 3WDXA 5FZLA 2CTVA 2VXJA 3D5OA 1A6CA 4PDWA 5EHDA 3WQ7A 2ZX1A 4IV3C 5LY1A 4YVWB 4Y4RA 3AL5A 4XC9A 4UF0A 3MIBA 4MXWB 1ZA4A 1VBE1 2XWBB 4LULA 4H7LA 1FPN3 2UURA 1VBD2 1STMA 2JXAA 2GH2A 2V72A 1QJU2 1MQTC 2HEYF 5J37A 3KF3A 3OGVA 4XTMA 3MBWA 4HN1A 5FY8A 1YQCA 3LCPA 4LA2A 3UNPA 1BK1A 2BOIA 2VUCA 3IPVA 5CKMA 1M06G 1B35A 3A22A 4E4DX 4XAEA 1QDOA 4CP0A 2XHKA 5HI0A 2B7YA 5G05L 5GLVA 1V6NA 2IUWA 4IESA 1HN1A 4YM0A 1O5LA 4C0HA 5LASA 3MW2A 1HB4A 2UY8A 4LBQA 4Q4Y3 1W8OA 1BK0A 1FOD3 2LM3A 5A3OA 1ULGA 2DF7A 3AP6A 1OH4A 4ORFA 3ZYGA 1PMHX 4AFBA 4Z8BA 2VC9A 2DYCA 5JIUA 1K3IA 4EWDA 2WO2A 3ZFEB 4IV3B 3ZSEA 3D6EA 3EJKA 4HL0A 4H55A 4OLLA 2HWB1 4XHBA 2EAAA 1VALA 4HANA 1R082 2VNRA 4Q4W1 1MQTB 4MGQA 5IAVA 4AHXA 4OVEA 3VGIA 1UY3A 4I2OA 3SKJE 1WCSA 3RNSA 3J7NA 3MUY1 4MLOA 5F5AA 2YMZA 1XNTA 5CFCC 1A78A 5FUIA 5DXDA 5FZAA 4IL7A 4LITA 1QJZA 1UZYA 1UXXX 1YQ2A 4WVWA 3P6BA 2BYVE 1PIV3 5IVCA 2WA4A 1QOSA 4TZDA 3N9OA 4OHZA 4D7YA 1ZZ6A 4RR3C 4ZU7A 4KG0A 1SFPA 5CA6A 2WNVC 2XJUA 1JYXA 1QQP1 3HOBA 1LOFA 2P4EA 4RFT0 1UPSA 3NVCA 4YW2A 1IPSA 3U78A 1OFSA 1XNBA 4PIZA 1PX4A 2L9LA 2X05A 2ZX3A 5F7UA 4WM7C 2HWC1 3KQRA 2XWJB 3CMGA 1H8VA 1VBE3 1JYTA 2BRTA 3JD73 4NOTA 1UYZA 3T0DA 4PLNA 2ZXQA 4AG4A 5CFCB 2ZGLA 5LA1A 2GC1A 2P3JA 2XOMA 5A3LA 5IVBA 4GAZA 3N9PA 3IDAA 3FLPA 3LIHA 5FZ1A 4XJUA 2OW4A 3VHRA 3ZOIA 2PHRA 3VZMA 4B7KA 5ABJB 5FZ9A 1LGNA 5A33B 1H6YA 3K4AA 5FMOL 1OA4A 3OYWB 2ZS6B 3Q9OA 1SG3A 3HQRA 1WLTA 3OBRA 4LE3A 4RR3B 3ZN4A 5EYYA 1W99A 3VD9A 2WNVB 4KNCA 1QJX2 2RS51 3IDBB 1OD5A 3BTAA 1W04A 4TLFA 5DZEA 4AVAA 4IE6A 4WM7B 3A21A 2JE9A 1D4VB 3LSEA 4N7IA 3H9AA 4GH4C 4Q4V1 5J09A 3HNYM 3RDIA 1O6UA 2VL4A 2ZACA 2WT1A 3WD5A 1K5MC 2HWB3 2VG9A 4YZ4A 3B69A 2P2KA 4Q4W3 5FXWA 2CDOA 1GOFA 2FQPA 2D6LX 4L97A 5T50A 4DXSA 1UOJA 3C3VA 4ISRA 2VULA 4NHKA 4AVCA 3MLLA 2VCAA 3M2MA 5JOYA 3J4UH 1W2NA 4QU1A 3VB9A 4EV0A 2ENRA 2DVDA 2YFZA 3AFGA 3CIHA 4A3XA 1LGBA 4FOYA 4XE9A 3C8XA 4QKDA 5ANNA 5C9AC 3V0AB 2FDKA 4AI0A 4FTSA 4M3CE 2G19A 3I3BA 1W9SA 3LFMA 4AOCA 2W39A 3E5QA 1Q3EA 4ZS3A 1NE6A 4XBNA 5DUXA 1UL9A 1CN1A 3ZFGC 1T2XA 2RE9A 2D5FA 4RYDA 1YO8A 4GH4B 3OUIA 1JYIA 3AZVA 4XF9A 2BNMA 1K5MB 1QQP3 2QQLA 5HXMA 3G7DA 4BDVB 1QJY1 4OUMA 4UFKA 4P14A 2HWC3 4AF9A 1BZWA 4A3ZA 2ZHMA 4BJ0A 1XSRA 1VBA3 4LBQD 3SH5A 2SLIA 4HLTA 4HKLA 3NQHA 4FPHA 1BQPA 4K9SA 3IIAA 4LKEA 4Q4X1 1HKDA 1W2UA 3VV1A 5T55A 2IFRA 3BUCA 4Y1ZA 1OD3A 4ZXKA 2FCTA 2WYSA 2QDRA 5D2AA 3OG2A 4XFBA 3V0BA 4IQPA 4M3CA 1OXCA 1PNGA 4CU7A 3D4KA 3USUA 4XACA 1WBFA 5FZIA 4F8AA 5EJ3A 4BOWA 1EAH2 3O0WA 1H4HA 3CNAA 2RG4A 3ASIA 2P6HA 2ZHLA 3T2TA 1W8TA 2WFF3 2PQSA 2YC2A 3LZZA 2ILMA 1DYOA 1Y43B 2VNGA 4XABA 2DVAA 5FV3A 5JMCA 3AYEA 3FUOA 1PNFA 4IE7A 2BUKA 5FZ3A 4PBOA 4Q4V3 2KA3A 3ELNA 3VDDA 1AXYA 3N7MA 5FCCA 1CAWA 3SEPA 1ULEA 1VE0A 3J7HA 3PIGA 2NLRA 3OY8B 4JRLA 3AVRA 2VPVA 3A0NA 4EROA 3SMHA 1POV0 4OYUA 2D3RA 1QOTA 3LEIA 3UGGA 1FATA 4Q0QA 4D3WA 3RZGA 2JJ6A 2ORXA 1ZBE2 2XLFA 2PHXA 1O4YA 1S1AA 3ACFA 1NT0A 2XDVA 3QBQA 4UFHA 4XZUG 4AVBA 5DG1A 1R1A1 2HWE1 1WCUA 5A7OA 2ZX0A 4W6XA 5JLVA 4LIUA 2W91A 1ST8A 3T4HB 5EIYB 3WEZA 3K3NA 4QX2A 2PAKA 3MIHA 3D8CA 3N3HA 1S0JA 4HK8A 3DYOA 1HV0A 3GXUA 5HCHA 1KS5A 1PZ9A 3ACGA 4OFGA 4LT5A 4Y5TA 5F37A 3C7HA 2NP0A 2VR4A 1QJY3 2ZJCA 1W05A 3D82A 3NV3A 4GWMA 2X10A 2DFBA 3AZXA 4LBNA 3TNQA 3J7LA 1GZWA 3NRUA 2P17A 5FYUA 4RSUA 4CP2A 2RM22 3HN1A 3TAYA 2MEV1 3DKQA 1PGW1 3AZWA 4PF5A 1H0BA 1VB2A 3RWKX 1LHVA 2ZBJA 5GLZA 3WY6A 1VR3A 2WS91 3AXEA 3O0XA 5CFDA 5F39A 1PVC1 1SDWA 1UKRA 4Q26A 4C1WA 1RUC2 4UOJA 1I1EA 2W47A 4QGLA 3J26N 2WINB 1UU5A 2WLPA 2WT0A 3F95A 3NWKA 4YG6A 5FDBA 3VKNA 4CDWA 1U5YA 4QXBA 3CJIA 4KBZA 1PMJX 4HG6B 4LO5B 4O65A 3S7IA 1YQ8A 1VBD1 3LKJA 5KXCA 2XVLA 1PGSA 1QJU1 2E31A 5FMBA 5IK4A 2XJPA 1F5JA 2BGOA 4DUVA 4KWLA 3BIEA 2VZQA 2GAUA 3HD8B 5A7QA 2QNKA 3O14A 3CHXA 2QQUA 1VLNA 2JDPA 5A7WA 1Q8SA 3OPZA 2CAUA 4AGRA 4OHYA 3CL1A 3GHMA 3MF9A 1LGCA 1UN1A 2YGMA 5C6CA 1CAXA 2VVEA 2H6BA 3SQOA 2UU8A 4DUXA 3S7EA 5FZMA 4JKMA 4Y22A 4B4QA 4RGGA 5DAVA 4JTNA 3U11A 1WCDJ 2HWE3 3H1WA 3ZXKA 2E53A 1UF2C 1CAUB 1F15A 3AKTA 5IVJA 2RJLA 1V70A 2CSGA 1R081 2VCMA 3AP5A 4XW3A 3ST7A 2H6CA 4I0WB 5KBFA 2QE3A 1SHWB 5EPAA 4UAPA 3POJA 1N47A 4BMEA 3IPVB 4B4RA 3OTFA 3TBDA 1ZVFA 2Y64A 2W08A 4EYUA 2EF6A 1CZVA 3AMHA 4YPJA 1GOHA 3AVSA 1JH5A 2ADEA 1QDCA 2ZAAA 3U1XA 4QM8A 1HRV2 1MS3A 4CEYC 1UCXA 4Y20B 3ZDVA 4LBQB 3ZYPA 4D8MA 3LWCA 2IVIB 4UT5A 2DCYA 3VBOC 2P5BA 5F6KA 4AI2A 5JCTA 3OGRA 4PI0A 2WS93 5EQUA 1AYM2 1CGPA 3K46A 3WQ0A 1A8MA 5H9SA 1NQDA 3FC0A 4XYXA 5ANQA 3SHRA 1LOEA 2X5IC 4NPMA 1K42A 3BIWE 4CPBD 2BW8A 3MI8A 1XE0A 2BFUS 2ETEA 1EY2A 2W2IA 2J22A 2ZGNA 1VBD3 4CTEA 2UWCA 1CQ9A 5FO8B 2EIDA 3O7OA 5KXBA 2VOXA 1F35A 5FZKA 4URTA 2FCVA 4P9GA 3ROUA 5FJKA 4Q5OA 2BVBA 2W0XA 3OSDA 1MS5A 3O1SA 1JXNA 1MZ5A 1WD4A 3AZYA 3CJXA 4KWKA 4V1PA 4CEYB 5IJRA 3FLRA 3BTYA 2QVSB 2G9FA 2D3SA 3DXTA 3LFIA 1BBT2 1KDKA 3GYDA 3VZKA 4FBFA 4NAMA 5IAXA 1ONAA 4JKKA 4NRMA 4COYA 3ZX7A 4QDRA 3ACIA 1QJX1 3GGLA 5TSWA 3ZYRA 2X5IB 3PDQA 4P9WA 1JZ3A 1V0AA 1J84A 4MGIE 2D3PA 2XB6C 4FPGA 5KHHA 1UOFA 3MV11 4CU8A 5ISLA 3ZN6A 5KHGA 1CD3G 3QACA 5GALA 2LRPA 5LA9A 3UGHA 4DY3A 3IB3A 3WNLA 1R083 3APBA 5IATA 4A4AA 2YROA 4Q2FA 5FZ7A 5BNOC 3KSCA 3ZMOA 5FZDA 4LK7A 4IV1A 3FMGA 3IT8A 1PO13 3QLQA 2D5HA 3ZXGA 1FI2A 1Y9GA 1DCSA 1X8MA 5CVRA 1CVNA 2PA7A 4A7KA 4ZONA 1MS8A 1SZBA 3S57A 5FZ8A 3UKVA 5A1FA 2DV9A 3C7FA 3KV4A 1ND2A 1UWWA 4FPFA 2Q5TA 2XVGA 2QFEA 4Q29A 2JX9A 2A71A 4AHZA 1RGSA 1IQAA 4CE8A 3DPRC 4AI8A 1DU3D 1BMV2 2YFUA 3AMQA 1MR5A 3IDEA 1NCQC 1RL3A 3ORJA 2XJTA 1ZRIA 4EN0A 4D6QA 5L19A 2V09A 1DFQA 3A4UA 2WO7A 4FPOB 4INDA 1AVBA 4RGAA 5CZKA 3GCWA 3SXWA 2PTMA 3BTZA 3NNMA 3I3DA 2QQKA 2LW8A 3KT1A 3NNFA 1ULOA 3QH6A 3ETPA 5A6XA 4QPWA 3ACLA 3H7JA 4CA9A 3AYCA 1W9YA 3E97A 2DU0A 4GULA 1N3QA 4G4FA 4CSWA 1VRH3 2GMMA 3PUAA 2O8QA 1Y9QA 4KU7A 3BKZA 4JTOA 2WN3A 1GNYA 5F9TA 3DPRB 1S2KA 3MDPA 5GM0A 4BQ3A 3VKOA 1DQ1A 3I2JA 3C2UA 1EAH1 2ZGRA 4FFGA 5LA0A 1NCQB 3LOBA 1DZQA 3TB0A 5A3PA 2E32A 3I2FA 1VPHA 4ZHNA 1Y3TA 3KVBA 4RD7A 4QT6A 4UBGA 3WDUA 1NKGA 2OA2A 2ZKLA 1Z78A 3FFZA 3ON7A 3VD5A 3THPA 4DB5A 1FAYA 1ODMA 3J8F3 3LB9A 5GLWA 4A7YA 5FLHA 4KMQA 5SV5A 3WW2A 1DZRA 4XQWA 4TN7A 1BLZA 4M0HA 1JTZX 5FUPA 4FPEA 2A3XA 3KD4A 4R9BA 1QJFA 3OUJA 2AREA 4NHXA 1W0OA 1YJKA 1AHSA 3E6DA 1W2AX 3THTA 1SLCA 1ZBE1 3I2IA 4M3CB 4BMBA 5JPNB 1UX7A 3O12A 4M0NA 1ACCA 1O4ZA 2FBEA 4XBLA 2VW2A 1L3JA 2PMWB 3DV8A 1MVQA 2VZUA 2QUOA 3HJRA 3NSTA 1BVVA 2WRAA 4FFFA 5HV0A 1PM4A 5FY4A 1OF3A 1T6BX 4YM3A 1K45A 1H9PA 2OPKA 2Z4FA 1JZ6A 2YPJA 1AXZA 4I0AA 4GZ9A 1WLDA 2VZTA 1H1MA 2AR6A 1OH3A 2VTXA 2VOTA 3M1HA 3PUHA 1UYYA 5FXXA 1QNWA 5CIRA 2A3YA 4RN5A 3RSJA 5FYBA 4CPBA 1G9DA 3BOWA 4MHUA 3RMYA 1EP0A 2FHRA 4LBMA 1K12A 1GNZA 2WAOA 2RM21 3PTRB 2AH2A 1UW8A 1MACA 2JKXA 1PM7A 4CU6A 5FR3A 1YYNA 1ZX5A 4ARXA 2R30A 2XHNA 4WVMB 5GZEA 1RUC1 5KXEA 1JZ8A 3VHPA 3WNMA 1JBCA 2ZMNA 3WG1A 1EAH3 2EXJA 1IGOA 3SC7X 3AKPA 3ABZA 4FXGB 5FZGA 1KEXA 4LLFA 1Z0HA 1CIWA 2WA3A 2DCKA 4QKFA 1AL22 5L73A 4LHLA 3LEGA 4Y5Z0 1YCIA 3PIJA 1CPMA 2WNUC 2W1QA 3FX3A 2GNTA 1UMHA 1TNRA 1TG7A 3HNBM 1UQXA 4ZZ8A 1ND3C 1QXJA 2P3YA 2WWJA 2JB8A 3VBSC 2ZGPA 3MZHA 5CNAA 2HWF3 3ZFFA 4IEZA 3WNKA 5CFDB 4YGCA 3AYDA 3HNMA 4QXHA 5FPAA 1LECA 3T0AA 4BM8A 3L9JT 1U12A 4YGBA 1W6PA 1ZBE3 4GXLA 4AHWA 3CKHA 4BZ4A 1NLQA 5FOJB 1R64A 3LA2A 4PQ9A 5J48A 5EJ1B 2F4PA 1WUVA 4C90A 2BDRA 1FT9A 2VM9A 1N1SA 1P8JA 2VMDA 2GC3A 2PAEA 4FCAA 1HN0A 5I0RA 1OVSA 5K4LA 2V4AA 3WP5A 2BU9A 2R062 5FREA 3HPNA 5FYMA 4NRPA 3BU0A 3AM2A 1OPMA 4Q1RA 2WLQA 4JKLA 1JU4A 4XMAA 2WNUB 4CXXA 3MIEA 4XHXA 3UESA 3PUSA 5IVVA 5FBZA 1JHNA 1ND3B 4ARYA 1BXHA 2JG9A 2ET1A 5K0UA 3VBSB 3ZLIA 4JX0A 4AI9A 5EJZB 3VLBB 4IE5A 1DIWA 1HRV1 5HCBA 5L7OA 3B7MA 3S6PA 1WCKA 1MZFA 2YU2A 2RM23 1C8M2 2WUHA 2AACA 2OUHA 4R4ZA 4QAWA 2EIEA 4FPKA 5FLIA 1RB8G 1AYM1 4BQYA 2B8MA 2PYTA 3D0SA 2GP3A 1EV13 4NUBA 1I9RA 1LEDA 4META 3OPTA 1RUD3 5AC92 1RUC3 1W8ZA 3AK0A 4FP3A 4UFJA 5IWFA 5IK8A 4A41A 5BNNA 1LEMA 3CQOA 3K3OA 3V65A 2KD7A 5FPXA 1D4M2 3LE0A 2BERA 2RHPA 2Q1MA 5GZFA 3AKSA 2XBO2 1YLLA 1WMFA 5HXVA 5IK7A 4M4RA 2E63A 4NIAA 1XSQA 1DYPA 5DZGA 4FOWA 5T5PA 1HDKA 4EE2A 3G6JB 3NJZA 4QGMA 5JZGC 2JKBA 4OQ9A 1G9FA 1Y4WA 2VVDA 3ZYHA 3L2HA 1BBT1 3WXPA 5C5TA 2Z42A 3AZZA 2AEYA 3QOPA 4LBKA 1RUI2 2J7MA 1W9WA 4YVSC 3AP9A 3KV9A 1DLCA 1X9TA 4M01A 4Y5SA 5C8CA 3GALA 4HSJA 1A34A 4O9EA 2JDMA 3I2HA 4HVRA 4RQPA 3ZSKA 3BI3A 1PGL2 1CJDA 2QQIA 2YU1A 4M3CF 3J7MA 4NVPA 1YIFA 3RQ0A 4CRQA 1JYVA 4QWNA 2IXLA 5LRSA 1H9WA 1TZOA 3R4SA 3ZFEC 1SEFA 2CGPA 4K6BA 4H2AA 3RFRA 2DCJA 5FP7A 1OLME 1TNFA 2JD4A 5JZGB 1IOAA 3GJAA 3C7EA 3N36A 3NV4A 1RMU2 2JG8A 4MZUA 4YZ1A 3WT3A 4CDQC 1DF0A 3KS7A 1HXS2 5J1XA 5LCWL 1I3HA 5CYYA 2WO1A 2XL9A 1RUOA 2AZ5A 4EN9B 2WT2A 4YVSB 1NAEA 3TWIA 4W6WA 3PUQA 3WF0A 2GMPA 1GP6A 3M3IA 2D97A 3RMXA 3RYRA 5BUVA 5HBAA 1BMV1 4LO7A 5FK8A 4XUNA 5FZOA 2P34A 1AYM3 2Q0AA 4YSFA 1PK6A 3T2QA 1ULFA 2WO3A 1DGWX 3FL7A 4GKXA 1RINA 2RDNA 2NM1A 2R32A 5KR7A 1US3A 3ZIXA 4B8EA 2IXIA 4BQWA 2QQJA 2IXCA 4DUWA 5E8AA 1OLMA 1O8SA 4E8CA 1OLRA 1RUF2 5FPUA 3EXUA 5IHRA 1LJ7A 1AR82 4N9IA 4CDQB 1YFWA 1BHGA 4IE4A 2AYHA 5JI9A 5LEJA 3TOJA 4E2SA 3WDWA 2VMCA 4K7JA 5BXXA 1RHI3 4L2NA 4C0BA 3WHTA 2WIIB 4NN0A 1AR72 3M3EA 3URFA 3VDAA 5HCAA 2Y38A 3OUHA 3WHUA 1E5HA 1U5IA 2D6OX 2QZ2A 4AEDA 5A32A 5I8YA 4FQ4A 3IWZA 4GA9A 1NA1A 5ABJC 1NZCA 5FZCA 4XJ9A 1IS5A 1ENQA 4SBVA 1VAMA 2A6ZA 4KU8A 5H9QA 3DF0A 1XYPA 4YM1A 1E57A 4BE3A 5JSRA 5CG8A 1DYKA 5EFUA 2FDFA 4XIOA 2XKPA 1OOPA 5FLJA 4FVVA 1LRHA 1KJLA 1MEC2 3GZUC 3NKGA 4MUVA 5FPBA 4FP2A 3LEKA 2JDKA 4XCBA 1AX2A 4N43C 2X29A 3CZJA 1JU3A 4OI1A 3VBHA 4D6RA 5J96B 4HKWA 5D8AA 4ZU5A 1XC6A 2D93A 4FO9A 1YI9A 2BWCA 5LW9A 4BHPA 4L92A 2PFWA 2GNBA 1F4HA 3HIFA 2ZGTA 3T2OA 5FZ6A 4ZKTB 4J6GA 3HBZA 1GANA 2A6VA 3GZEA 4WM8A 3KCCA 2UY9A 5JWPA 1C57A 5FTTC 1REDA 3AKQA 3HAGA 2EXHA 3FBYA 2PLV2 2WC2A 3RRDA 2XPJA 4FSJA 1N3OA 2ZMLA 4CUAA 2YDEA 1J3RA 3Q8EA 3GCXA 3P3NA 4IGOA 3TEXA 4CCJA 2E9QA 1HJFA 3FHQA 4Q0SA 4CUCA 4NIHA 1AL0G 1ODNA 4NR1A 5AVAA 1F5FA 4XQ4A 4QQ2A 4I0BA 3B9IA 1H8TC 3FJSA 4FT8A 3MFCA 3QCWA 2E7AA 4CP9B 4Y4YA 1S2EA 4N43B 2ZX2A 5CADA 2Q1ZB 3VL9A 4EJRA 1W9TA 3CLPA 4DEVA 2G4IA 3RJ2X 1C5HA 4XURA 3VBRA 1D2QA 2A6XA 2V73A 2JIGA 5BNPA 1LU1A 4LBJA 4EZHA 5FWJA 1WA4A 1S2BA 1B09A 2LS6A 5K9YA 3U07A 4X8NA 1Z7S2 4AI1A 1ZREA 2XH6A 1US2A 4XVHA 3ZMNA 1QKQA 1LOAA 1O3SA 3VHNA 2VZ1A 2QQVA 2ADDA 3MO4A 2V5DA 4OQ8A 5FO7B 3M4FA 3PU3A 1PO22 1GSLA 2YC4A 1AL21 2OX0A 1J1LA 3H3ZA 4Q8LA 2XONA 1V6LA 4R4XA 4ES8A 1H8TB 4UFIA 4O61A 2ZEXA 3MEPA 3GZTB 5FBJA 2Q8DA 4LMFA 2VNVA 1A3KA 3TEZA 3OGSA 1QH7A 3RZMA 4NHLA 3KB5A 1W8HA 1UOBA 3UKTA 3ZFFC 2XR4A 3KCYA 2Z5WA 1WMEA 2ORZA 1H1IA 1Q43A 1XNKA 1XRUA 3M7AA 4ES9A 1IKQA 1MPXA 4YW4A 1QH6A 5JIAA 2J1SA 2G1MA 2C1FA 3RZLA 2VY0A 3RS6A 3ZXDA 5C5UA 1AJKA 1W8FA 3POSA 4XTPA 3V64A 3BCWA 4FOQA 1O7FA 2BZDA 3TYJA 1HW5A 4TTGA 5CKNA 1ULDA 2R061 2RDSA 2DUPA 3ZR6A 5KHIA 1SCSA 3FBMA 4XFHA 3BTXA 4XFCA 2W1UA 1S0EA 1W8WA 2AENA 4IEOA 4L8QA 1OUSA 2VD7A 2WDBA 5ACA2 5FQ0A 2RS53 2Z79A 3NAPA 4UFMA 4KWUA 4Y1VA 4GJZA 4IETA 2XVKA 4HMZA 1ULCA 3SH4A 2VQAA 3O1PA 4R9AA 5I0TA 3WNOA 4QPGA 5GZGA 2VZ3A 5DZFA 1BEV2 2CU5A 2QQNA 3ZFFB 4P9XA 1RIRA 3KV5A 2H0BA 4MXVA 5DDJ2 4NJ4A 4CEWA 3BALA 4ITCA 2R072 3AB0A 4HXCA 1GZTA 4LNVA 5J36A 1C8M1 1NCRA 2HH9A 2QKDA 5C8WA 4K20A 3RZZA 2VOWA 3AFKA 5FZ4A 4XMIA 3NV2A 1O8PA 5FO9B 4HONA 1RVF2 4KGGA 4YG3A 2CGOA 4AR2A 5AC91 4LQRA 1UY1A 4CCCA 2C26A 5LBFA 2VBBA 1NX9A 1C4RA 2AUYA 3GBFA 1D4M1 1W6OA 1W6QA 5FP8A 1QXPA 2NMOA 2Y33A 4JHZA 1DQ5A 2XBO1 4AAXA 3TN92 2OZ6A 1DHKB 3W5NA 1W6NA 1AL23 4QHOA 1UZVA 4RGKA 1VBC2 4HPKA 1AR92 5L7OB 1X7NA 1WMXA 1XPWA 3DECA 5JXGA 4XFFA 5C71A 3ZVXA 3Q8CA 1SLAA 5E16A 2OYZA 1OBNA 2C24A 5FAXA 2OVUA 2ZHNA 3AJYA 3POGA 3T08A 1UIKA 2IVJA 1NYWA 1RUI1 4XUQA 5LATA 2GH8A 2IXHA 1AX1A 4Q4X3 2GZWA 2D43A 2XUMA 3GBWA 3JBG2 5FFOC 5FYIA 3H8RA 5BNNB 1PGL1 3I4IA 3WF3A 4H14A 3W21A 2VZPA 5CU1A 3FHIB 4DS0A 4PDWC 2XGXA 1OVPA 3AMPA 3JCIA 4UBHA 3OD4A 4FFIA 4R8HA 2BJSA 4QD2A 3SKVA 2A73B 2ZCWA 3HT1A 4OZXA 5FYHA 1AXKA 2Z2SB 4H7MA 1OKQA 2VW0A 3ZO0B 1RMU1 2JG8C 2ZPXA 3TRSB 1JZ4A 4JQRA 1C28A 1HXS1 1WZXA 2ZAHA 3KM5A 3VBFA 1B35C 4PCRA 2P3KA 1NQJA 4QX1A 1JMUB 1GP5A 1C8M3 1W6MA 2XKOA 1HQNA 4NMIA 4X6QB 2BEOA 2B39A 2BBAA 5FKCA 2DBIA 3AMMA 3EQEA 4B1MA 3PVEA 4P9LA 4BIOA 3IDCB 5AC93 1OQEA 5FXZA 1JZ5A 2QDNA 1SPPA 1REEA 4PDWB 1OUXA 4S2DA 5HCFA 4C8DA 3OGGA 4L11A 1WKYA 4UF0B 1R1A3 2WN2A 1UPIA 3IMMA 4KQ7A 1IKPA 2GN3A 4UI9L 4BQ4A 1JN2P 1LNSA 2VUAA 2XBO3 3MLJA 4Z92B 3ZYJB 1LAJA 1RUF1 3PUIA 4I30A 1AR81 2JG8B 5L9VA 1KGYA 3KQ4B 4P5HA 5C4WA 2JICA 1COV2 1VMHA 1PZ8A 3LSDA 3B94A 1B35B 2QJVA 2YYOA 3MLKA 2ZZQA 3B01A 3EYPA 2ID4A 2RMU2 2BP6A 1AR71 2JD9A 1CESA 2VMGA 2XXZA 3FWEA 2EXKA 3WP4A 3ZKUA 5I0UA 1PK6B 2Q1FA 3PHMA 5DUUA 2A6WA 3T30A 2MEV3 3R4UA 4QDSA 3ZXEA 2W3JA 4QXCA 1GOGA 2Y0OA 4QDQA 3W5MA 4NROA 4CDXA 1LOGA 3VZJA 2PHTA 2QTWB 1J59A 5CISA 3BB6A 3HR9A 1PVC3 1Q8QA 1FPN2 5FP4A 3ITQA 1LOFC 3VBUA 1MEC1 3LPGA 4N7UA 4ONUA 4F3JA 4LKFA 3I59A 5EZWA 4XDQA 2W92A 4JDOA 1UKGA 3R4DB 2VCCA 4MSVA 3DEMA 4S2FA 5KHJA 1W9FA 1N3PA 2RS12 1PVXA 1QJU3 3CZUA 5LBCA 3H0OA 4PLOA 1MS9A 5DABA 3T0BA 1RMU3 4RS5A 5CAZA 4Y1XA 1NZIA 1AJOA 2TUNA 1HXS3 4ZPIA 4BLIA 2DCTA 3B9CA 3Q8AA 3VZOA 4WV8A 4CXYA 4CDUA 1JODA 2WZR2 1IQDC 1GP4A 4AXOA 2DCZA 2PLV1 3U75A 3GBGA 3A0KA 4FXKB 3M8LA 1QF3A 4CYDA 1CZSA 3B3QE 3KT7A 3POEA 3OPWA 4IEXA 4R52A 4QGNA 5I8SA 4YVWA 1V6JA 1XYNA 4Z2WA 5C70A 5IFPA 2P6CA 4RHV2 3NO8A 1JZ7A 3KZ4C 2EVXA 4K21A 2HJIA 3NJXA 1LKNA 3DL3A 1GV9A 5ERLA 3O1MA 3JQXA 2BGCA 1C1FA 1UYXA 1RUE2 4FOVA 3RG0A 1JYWA 4E2QA 2ZKNA 3PNAA 2X09A 1YFXA 2EALA 4PLMA 2HKXA 1Z7S1 1KJRA 1D0GA 2ATFA 2BV4A 3IZOA 1WCQA 4WM8B 4BA6A 4YARA 5A3UA 4G9SB 3H1YA 5KHKA 4F7ZA 1E5SA 1ZRFA 1AR73 1CX1A 4BQ1A 3AX4A 3BOPA 5FZHA 3PLQA 1YHFA 4QB1A 5B4XA 3C7GA 2YBPA 4H3WA 3U4XA 1PO21 2YUEA 1VBB2 5F32A 2YC0A 1DLLA 3K75B 4WZFA 2CYFA 3B93A 3K51A 4R9CA 1W90A 3H1MA 4IV3A 2BFUL 4XXAA 1KITA 1LODA 3N35A 5JSPA 2WQ4A 1IHMA 2B9UA 5EV7A 5FY7A 5LA2A 3RPQA 4AQ6A 5I0DA 1FV3A 2TBVA 1GQPA 4QX5A 3JD72 2R0HA 1MEC3 1MQTA 4GALA 4XJAA 3PVBB 3POWA 4XF4A 3VBRB 3JU9A 3ZYFA 2ZMKA 1BKZA 2AC1A 4TWTA 2YHJA 4P9JA 3K4DA 2JDYA 4YLZA 4CCNA 2FZ2A 1W0PA 4UW4A 4LTAA 3H8UA 2WWUA 3IKWA 2O8OA 4HBNA 5JSOA 2YG0A 1URXA 2FZ1A 3BN6A 5F1RA 1CIYA 3UL2A 5A3TA 5F3EA 2RJKA 1AUYA 4F83A 2GC0A 2VUDA 1S0BA 5E89A 1ZZCA 2BPA2 4XOGA 2OPWA 3W9AA 1DGRA 2ARAA 4P5YA 1ULPA 4MGKE 1UU4A 2E26A 1FYUA 5ACA1 1QJX3 4X8PA 2Q30A 3OCPA 5SV8A 5JOZA 1DDLA 4OHVA 5D1IA 4QPIA 1BEV1 5FWEA 3WF4A 1L7LA 4W8JA 5FYTA 1WA6X 2Y6LA 2D6NA 4IEYA 4MX3A 4AI3A 1YEWA 2OQ6A 3OBTA 2A3WA 1O5UA 5DDJ1 5F6LB 3VDDC 4DFSA 2R071 2CGNA 1UY2A 2E6VA 2PQQA 5FYVA 2R1BA 4DRRA 5CFCA 4DNYA 4UW3A 3UT0A 1O3RA 5EYXA 4Q8KA 2B45X 3NNGA 2NZ9A 4KH9A 1VP6A 1GWLA 1RVF1 1Z7S3 3V0BB 3WCSA 2HEWF 5H9RA 3E1F1 4A45A 4FPLA 1V00A 5F5QA 3USUB 5A33A 1XOYA 2DBNA 1O91A 2VMEA 3D0JA 1RJ7A 2NQYA 3MIGA 3OYWA 4LPLA 5LK5A 1V9U2 4AAPA 4RR3A 4Y3OA 4JQTA 2WNVA 2GNMA 1VMFA 2HBUA 4D6SA 5IVYA 4LORA 5FQ0B 4NAOA 1KFUL 5LB6A 3TN91 1OFNA 1SLIA 1IPJA 4P9IA 3ZSMA 1XYOA 1H2MA 3E6BA 1H1AA 1UX6A 1VBC1 1LR5A 4KL1A 1JUIA 3TNPB 1AR91 1VBA2 4JDMA 4N53A 1FV2A 3KLSA 1UAIA 3DUIA 3WDYA 1XU2A 3VDDB 3AYAA 1REFA 1CAWB 3RYPA 2OKXA 5LY2A 1QIQA 4I02A 5JI7A
chains in the Genus database with same CATH topology
1G9BA 3MW4A 3ATGA 4Y1UA 2XLAA 1DQ2A 3KGLA 4AGGA 4XF0A 1Q8OA 3JBG1 1CR7A 4AVTA 1ASJ2 3EO6A 5CFDC 2PELA 3ALQA 3V0AA 1TE1B 1W6OB 1W6QB 2WFF2 3B02A 1XNDA 4IEQA 1DBNA 1APNA 1VAVA 4GMP0 3ZXFA 4E4SA 1OA2A 4CDWC 1BYHA 2NPIA 4GH4A 1C3HA 3CJIC 1GKBA 5ACA3 2DURA 1U5ZA 3FFQA 1KXGA 3WLUA 3ZXAC 2GU9A 1Q8PA 1XNCA 2A7AA 5JOXA 2XG3A 1DGLA 3MPBA 4HSLA 2H0VA 2VNOA 1GZWB 2A5ZA 1NXD1 3WOGA 2QQPA 1H2LA 2R073 5K7PA 1HRI2 1QXRA 1D0HA 2NMNA 5C9AA 4UXAA 1SMVA 4YFWA 3BU7A 4PBPA 2MPFA 4GB32 4D94A 2CNAA 2PHUA 2YY1A 4AEJA 1CX4A 3ZPYA 3ZFGA 4CDWB 2ZGSA 3MPPG 3CJIB 5J3UA 4C91A 4ATEA 4QQHA 4PIXA 3TN93 1ZZ9A 4XFAA 1ALYA 1ZBA2 1T6GC 1VBC3 2IC1A 1HQLA 1AR93 1COV1 1N1TA 3ZSJA 3LOIA 1H4GA 2IXJA 4YW5A 3O0VA 4I3GA 4IEUA 3OY8A 2RMU1 2JECA 1R092 1CAXB 1JYCA 4AFAA 4AYUA 4EWAA 1X8EA 1FX5A 4GWNA 1S0FA 4EN8B 3JUUA 1F9KA 4P9YA 3JBG3 3WUDA 4KGQA 4WVZA 4Y22B 4CDXC 1QMJA 3W58A 1BVP1 3IN9A 5GZDA 1H2KA 1GBGA 3JB4C 4IEWA 1FPN1 4G3YC 2YZ4A 2Z69A 5T52A 1FMD2 1J3QA 1G7YA 1X50A 4ASLA 1YRZA 2GMEA 2CV6A 2R1DA 3BPZA 1OPOA 3FUQA 4GQ7A 1HX6A 1NOVA 1X82A 3L2YA 2WNEA 2VQ0A 2RS11 1UU6A 2R0FA 2JENA 2JE7A 2K9ZA 2N7GA 3SNMA 2SBAA 2QCSB 4DOUA 1SBFA 1WMDA 3HQXA 2IXKA 3QD6A 4P9JA 1R1ZA 1NLSA 2WZR1 3ETQA 4K1ZA 4CDUC 4MVTA 4CDXB 4JV4A 2UWAA 4DZGA 4PIYA 4O9GA 2IZWA 5K8SA 1CAVA 2DVGA 4XF3A 3SH3A 1CJPA 3WZ1A 4U2AA 5A3MA 2DFCA 1SBDA 5BPXA 4RHV1 3I54A 5C33A 3WW4A 3ENRA 4RL7A 1V6MA 2MNGA 1RUE1 3RWNA 2IWGB 2VGDA 1H2NA 5KXDA 2MHFA 4IEPA 4IV1C 5GKAC 2BBVA 1RC6A 2B42B 1OHFA 2ARXA 4CDUB 2RMU3 1HRV3 1ND2C 3OJBA 1TME2 2FMYA 2OZJA 1VBB1 1POV1 4XJZA 3IBMA 1LHUA 2DU1A 4HETA 4M00A 4LUMA 5H9PA 3ZN6B 4B3NA 3VUOA 1CAUA 2ES3A 2I2SA 5LEKA 3JD71 4B29A 1QU0A 4XILA 5KC6A 1QWRA 3KT4A 5JVVA 4XQDA 5CB7A 3VZNA 3SCGA 4IV1B 3W59A 4DPNA 3LA7A 4QHBA 4NWWA 2RS13 4HZFA 1RJ8A 3MICA 4UW5A 1IS6A 1U5XA 1ND2B 1HLCA 4Y20A 3WR0A 2G9GA 3WUCA 2R042 2WZR3 1BBT3 2PAMA 3DKWA 1AYN2 2RS32 4OULA 4NHMA 2UYAA 4I09A 4KG8A 5FMOS 4B7EA 3WG3A 3DGTA 4JGYA 1LOBA 2WL1A 4QPIC 2NYYA 4YGDA 2VVFA 4YW1A 4RHV3 1NE4A 4AFDA 5KC5A 1GQGA 1PO12 1SLLA 4JAAA 2DUQA 4JVAA 2WWSA 5FPZA 2VUJA 3OD0A 4AEKA 1RUE3 1YIPA 2D6MA 4TYSA 2Q8OA 1QY4A 3M70A 1JUHA 4CEYA 5T3NA 1GZ9A 2ZGMA 2ZGUA 3B5LB 4HT1T 3VBOA 5AFEA 4AWDA 4XEZA 1XXNA 4TSVA 1V9U1 3POYA 2P3IA 3NL1A 1YUDA 1GYKA 1EPWA 2PHDA 3WDVA 2WQZC 2VMIA 1TMF2 2X5IA 1MVEA 4XFGA 1VBB3 1POV3 2QZ3A 2YXSA 1WLCA 4QPIB 2XJRA 2LUWA 1VBA1 4PJYA 4Q1PA 5LRRA 4E9KA 3JQWA 4N53C 1FNYA 2CWMA 2A70A 4MV2A 3GZAA 2K2SA 2LALA 1VRH2 4FPCA 1PZ7A 1SLBA 2YV8A 4YFZA 5GLUA 3UK9A 1ZZ8A 3JZVA 3X29B 1ASJ1 2Q4SA 4D69A 3LAGA 1G9CA 2ZABA 1S0CA 4U36A 1I6XA 3H3UA 3B00A 1XE8A 1I5ZA 2WFF1 1WD3A 3WINE 1RTVA 4FTEA 4K40A 1DQ4A 1V6IA 4BIFA 2HWD2 2BQPA 2WZPP 4W6YA 2V5YA 1LHWA 3J8F2 2EA7A 2TEPA 4N53B 4X6RB 4XZPA 3SITA 4BYYA 3MYXA 5BNOA 3FE5A 4GKYA 4K8FA 1UD1A 3PTYA 2X53S 3NKTA 3QH7A 4Z82A 4BH9A 2WSVA 2B46X 1JW6A 1HRI1 2AGSA 2C5DA 2B5HA 3N7KA 4ATFA 4AQTA 3DPRA 4GB31 3MF6A 4FPJA 1A8DA 4BWOA 4AVSA 1NCQA 3T1LA 1RUJ2 1TEIA 1V9U3 2RR12 1DZTA 2DTYA 3AKRA 4AFMA 1WW5A 5I91A 4FTBA 3WW3A 4QXKA 1ZBA1 3WNXA 4E4ZA 1ZRRA 2JEMA 1MZEA 2ZA9A 4CZSA 2ZGOA 3AJZA 2JG9C 5K0UC 3M3QA 3S0MA 1R091 4Q0VA 1LCLA 2ZX4A 4Y26A 5L7OC 2PHWA 3P3PA 2A6YA 5LK7B 1KD7A 3WX5A 3OF1A 5C9AB 2A75A 1W6PB 1G6NA 3WV6A 5AFBA 4XETA 4COWA 1QHDA 1OLQA 1ASJ3 3UKNA 4RA0A 1RUG2 3ZFGB 4OUSA 3WVJA 1FMD1 1KQRA 1WW4A 5E1RA 3FLTA 4DINB 4WVVA 1S0GA 5BNNC 3PMEA 4LO6B 1LESA 4MH0E 3PVOA 1DGWA 1JOJA 1EYBA 2TNFA 3LA3A 4COZA 1S0IA 2D44A 1J1TA 1PMIA 5L36A 2ZGQA 2JG9B 5K0UB 1LTEA 3INAA 3WP3A 2PN5A 3ZIWA 5AVPA 3SISA 2FMDA 2HWF2 3N7LA 3WDTA 3GHNA 1VJ2A 4AQ2A 3I2DA 4AVVA 2D40A 1C1LA 4JGZA 1HRI3 3UV9A 3ZN5A 5I93A 4WVMA 1D2SA 2VMHA 3CEWA 4Q27A 1WLWA 5C8CC 4I3PA 1F2NA 2E7QA 5E88A 5B2GB 4GB33 1EPZA 1NY72 4Z07A 3WCRA 4RQPC 3R6SA 2C0ZA 1ZZ7A 3CF6E 2R49A 3MIDA 4LR4A 2LTNA 4R9DA 3VKLA 3SLIA 4JRAA 1UMZA 2R063 4ZU4A 3R05A 3N7JA 1ZBA3 4AGVA 1IPKA 4XPVA 4AHYA 2BWAA 4DY5A 4EN6B 1RUH2 5DG2A 1H30A 4Y1YA 4LLOA 2I45A 4XJ8A 2CY6A 2E7TA 1MS1A 4YRDA 3ME2A 4LUKA 3U0ZA 3MW3A 1OMIA 1GNHA 1R093 4AW7A 1IZ3A 1EV12 2BNOA 1TME1 3RYKA 5C8CB 1CAVB 1RUD2 1NG0A 1AZDA 1WGPA 2NN8A 3MGUA 4LE4A 4RQPB 4CP1A 1DQ6A 1PK6C 1QGLA 2KXLA 3I7DA 4MGZE 3DN7A 1FMD3 5J98B 3GNEA 4B4PA 1VAKA 1ZRCA 4A7ZA 4AEMA 2WNUA 1D4M3 4E27A 4S2GA 1OI6A 1S0DA 1ND3A 3ES4A 1RUNA 1AR62 1ENSA 3VBSA 1SACA 5DUVA 2XL7A 5DUWA 3ZSLA 2ERFA 1YNAA 4K3UA 3EBRA 2DUOA 4AQSA 4LEJA 4L9BA 3WQ1A 2R041 1ZZBA 2PHFA 1AYN1 2GC2A 2RS31 1RUI3 4XF1A 2DVFA 4AEDC 5BY5A 4OI2A 1NA1C 2W52A 3S30A 4JGYC 3ILRA 1NLRA 2HEVF 2UWBA 1PO11 1OOPC 4GMP1 5EWSA 1MS0A 1NXMA 3VKMA 4YNIA 3VL8A 4I01A 1UZZA 2WJSA 4HFSA 4MYEA 5GLTA 3K48A 1VIWB 1C8NA 2VECA 3VBHC 5BV6A 4BPZA 3I8TA 1FNZA 2XJSA 1YFUA 5D8AC 1HV1A 4LBOA 2DWRA 2O1QA 1WW7A 4Q4Y2 2GNDA 2I74A 3NW4A 1FOD2 4WM8C 4AEDB 3J9SA 5A32B 1OQDA 1TME3 2CAVA 1TMF1 1NA1B 3AP4A 3KGZA 4JGYB 4J1WA 4FPYA 3H50A 4JDNA 4QM9A 5CBLA 1OOPB 4C1XA 5BNQA 3N4MA 4HN0A 1VRH1 1GICA 4MXWA 4COVA 5BYNA 2D98A 4XJWA 1YFYA 2BVVA 5JZGA 1OA3A 3VBHB 3WG2A 1RUF3 4LHNA 5D8AB 1RHI2 3VBOB 2GALA 3VBRC 1AR83 2EIGA 4N9HA 5BNPC 4NO4A 1O4TA 4YVSA 1IS4A 3RJRA 3O5SA 1PIV2 2R043 1AYN3 1XU1A 2RS33 2HWD1 1YI7A 1BCXA 3J8F1 3PVNA 4A2UA 4LBLA 3E5UA 3V56A 1G8WA 1QNYA 4QPYA 4HKOA 3ZFEA 4UW6A 1VBE2 2C9AA 4GMP3 1GQHA 1V6KA 1LENA 4XFIA 4CDQA 2OUJA 3PJQA 5BNPB 1IS3A 1SFNA 4NPRA 3ZXJA 3AP7A 2X8KA 3ILFA 3PJYA 4KWJA 5J7MA 1Y7BA 1RUJ1 3HMYA 2RR11 4QMAA 3WP6A 4BCUA 1TMF3 4J1XA 2PLV3 5CG9A 4LA3A 1C5IA 1VB4A 3HT2A 3E5XA 4IXLA 5BNOB 3BODA 4OHWA 1X33A 1J58A 2HWB2 3NAPC 5IUQA 4YZ5A 4Q4W2 2W68A 4QPGC 1ZRDA 1MS4A 1LU2A 3CO2A 3WG4A 3M3OA 4CEWC 1RITA 5JR7B 2DTWA 1NCRC 1N1VA 4LO4B 2XJQA 4ASMB 5T5LA 4XIKA 1RUG1 4OI0A 2D6PA 4Y24A 3VN4A 4HVQA 2WFPA 5ABJA 1WW6A 5KWRA 1SLTA 1GZCA 5T54A 4XXPA 4YYOA 4HVOA 3VHOA 2HYKA 2HWD3 3RI8A 1DGRN 4COUA 4E2GA 3ZDSA 1QQP2 3NAPB 1PO23 4HK9A 5JDBA 3ES1A 1SFYA 4WM7A 3WW1A 4QPGB 2HWC2 1KDMA 2CL2A 5FRAA 1ZYBA 1BJQA 2HWF1 1U0AA 3U10A 4N43A 4QQOA 3SCHA 2IFWA 4CEWB 3IM0A 1YJLA 3UJQA 4D7TA 2ZOEB 1NCRB 2VOVA 3ZXLA 5I8TA 3LGRA 1SQ4A 2GDFA 4JGZC 5EXOA 1AF9A 3R0RA 4FAGA 1SBEA 4QQLA 4AE2A 3NV1A 1NY71 2ARBA 5IT6A 4DXZA 1RUJ3 4FQZA 2RR13 4L99A 4IERA 2GSYA 1N1YA 4EN7B 1ENRA 2RS52 4K1YA 1HIXA 1W6NB 3KMHA 1OSGA 4JCKA 3MFAA 1H8TA 1YXWA 4HPKB 3RI9A 1M4WA 1RUH1 4Q4V2 1O3TA 5I0SA 1K5MA 4LO8A 5T5OA 2PHLA 2CWSA 4NWVA 1BEV3 1MZ6A 1XE7A 2KM2A 4JGZB 3VBFC 2VW1A 2OIIA 1EV11 2R6QA 5DDJ3 4EWEA 4S2HA 1RUD1 4YZ2A 2Y0IA 1OQ1A 3UJOA 1RUG3 4DQAA 1RVF3 4YW3A 2GN7A 2D6KA 3MIFA 5FOBB 2Y26A 2E51A 4YM2A 1Q8VA 4GIQA 3E6CC 2BNNA 3JB8A 1V6OA 2ET7A 1KRIA 1GFF2 2I07B 3SCFA 1YWKA 4WZCA 4D7SA 2VU9A 2R16A 4JC1A 1G86A 1AR61 2VOKA 1QJY2 3GF6A 3H7YA 3VKFC 1AX0A 5C4WC 4DRVA 5GZCA 1S55A 3VBFB 1G9AA 1F8VA 3VZLA 4Q4X2 1XQNA 1W6MB 2ZTNA 3CU7A 2ZGKA 5T5JA 3OGJA 4QU2A 4WBBA 4YG0A 1GLHA 2K0GA 1PHMA 2F6BA 3KCXA 1O3QA 4YGEA 1CPNA 1F31A 4IEVA 4LHKA 4KBBA 1FXZA 3VBUC 1CONA 2O0OA 2D7FA 1SCRA 2EAKA 3FZ3A 3ECQA 4FAHA 5C4WB 5GJ6A 1RUH3 3EHKA 2YGLA 4ISQA 4RS5C 1Q5OA 1WBLA 1QOOA 3PMSA 4Q4Y1 2VH9A 4Q0PA 4W65A 1FOD1 3USSA 1ZM1A 2DVBA 2UYBA 4BLJA 5JOWA 1LHOA 3ILNA 4Z1VA 4AK3A 1KFXL 2BTVC 4AFCA 1UIJA 2JDZA 1LHNA 4OHXA 1ZNPA 1R1A2 2HWE2 2XLGA 1HQWA 3T1MA 4DMIA 4QQPA 2WSUA 3VBUB 4MGYE 1KS4A 1ENXA 2XJVA 3AXDA 3M3CA 2ZZJA 4SLIA 1J3PA 3I59B 1GR3A 4YVWC 5JPMB 1LULA 1DQ0A 2EXIA 2P37A 4N90A 1AR63 1RHI1 4RS5B 1W39A 4OI4A 5JAXA 1DG6A 1TQ5A 1X36A 3HWJA 1COV3 2WKKA 3ZYIB 2VXRA 2MEV2 4XBQA 1PIV1 1PGW2 2ZHKA 1Q56A 3IMNA 1LOCA 1LB2A 2WS92 4YZ3A 3AMNA 4Q0UA 1PVC2 3WDXA 2CTVA 3D5OA 4PDWA 1A6CA 3WQ7A 2ZX1A 4IV3C 4YVWB 3MIBA 4MXWB 1ZA4A 1VBE1 2XWBB 4LULA 4H7LA 1FPN3 2UURA 1VBD2 2JXAA 2GH2A 1QJU2 1MQTC 2HEYF 5J37A 4XTMA 4HN1A 3LCPA 4LA2A 1BK1A 3IPVA 1M06G 1B35A 4E4DX 1QDOA 4CP0A 2XHKA 5HI0A 2B7YA