2VULA

Thermostable mutant of environmentally isolated gh11 xylanase
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
193
Chain Sequence
AQTCLTSPQTGFHNGFFYSFWKDSPGTVNFCLLEGGRYTSNWSGINNWVGGKGWQTGSRRNITYSGSFNTPGNGYLALYGWTTNPLVEYYVVDSWGSWRPPGSDGTFLGTVNSDGGTYDIYRAQRVNAPSIIGNATFYQYWSVRQSKRVGGTITTGNHFDAWASVGLNLGTHNYQIMATEGYQSSGSSDITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GH11 XYLANASE
publication title Engineering Hyperthermostability Into a Gh11 Xylanase is Mediated by Subtle Changes to Protein Structure.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 55
structure length 193
sequence length 193
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vulA00
3VL9A 3VZNA 3MF9A 2Z79A 1IGOA 3B7MA 3LB9A 1REDA 1XNDA 2BW8A 1AXKA 1NLRA 3RI8A 2VUJA 1H0BA 1H4HA 2NQYA 2QZ2A 1XXNA 2BWCA 3MFAA 2JENA 4S2HA 4XQ4A 1BCXA 4HK9A 2VG9A 1XNKA 1HIXA 1XNBA 1F5JA 1H4GA 4IXLA 1XYOA 3WX5A 1UKRA 3VL8A 1QH7A 3AMNA 2DCZA 4S2DA 1KS5A 1OA4A 2JEMA 3M4FA 1OA2A 3VZLA 1XYNA 1H1AA 3VZOA 3AMMA 2B42B 3AMHA 2DFCA 2C1FA 1H8VA 2D98A 1BVVA 2DFBA 3WT3A 3EXUA 3WXPA 2NLRA 2VGDA 4HK8A 3AKTA 1UU5A 4HKLA 1C5IA 3B5LB 1C5HA 4H7MA 3WP6A 1TE1B 3RI9A 1ENXA 1UU4A 3AKQA 2VULA 4XPVA 3WP5A 3VZKA 2B45X 1PVXA 5K7PA 1UU6A 3O7OA 1T6GC 5HXVA 5EJ3A 1OA3A 3ZSEA 2QZ3A 4S2GA 3MF6A 3AKPA 3VHOA 3WP4A 2DCYA 3LGRA 2DCKA 3AMPA 3VZMA 1BK1A 1QH6A 1REEA 3WY6A 3VZJA 2BWAA 1YNAA 2D97A 1XNCA 3MFCA 3WQ7A 3VGIA 2B46X 2BVVA 5K9YA 1XYPA 3VHNA 3WP3A 1HV0A 2DCJA 3WQ1A 3WR0A 1REFA 3HD8B 1OLRA 1W2UA 1KS4A 3VLBB 3AKSA 4HKOA 2JICA 1HV1A 4XQDA 4XQWA 3AMQA 3VHPA 1M4WA 4S2FA 3WQ0A 4NPRA 3AKRA 1OLQA 2F6BA 4HKWA
chains in the Genus database with same CATH superfamily
2VMGA 4NE9A 2MHFA 4TXWA 1CGPA 4CE8A 1QHDA 5A7QA 3N3HA 1RUG1 1V6OA 5J09A 1JI6A 2D3SA 4UF0B 1KJRA 2P17A 2PXJA 5JIAA 4Z2AA 4PDWA 1W3VA 1WCDJ 3N9PA 4A41A 3ZMNA 4EN9B 1LEDA 5FUIA 2JIJA 3VBRC 1W6MB 3CLPA 1JBCA 2J1VA 3ZN4A 2QZ2A 3OG2A 1VP6A 3OGRA 1YIFA 2VJXA 5FZ7A 1FMD3 2DURA 1Y9QA 2I07B 2WFF1 4XABA 1MS9A 2ZX3A 2WNUC 1LODA 5F6LB 1AXZA 3VKMA 1NXMA 2E33A 2IC1A 1L7QA 2AACA 5FV3A 5T54A 2OUHA 4XDOA 5E8AA 3CHXA 2QQLA 1K5MA 2VVDA 2NM1A 2P2KA 3P3PA 5DG1A 4YG6A 1RUF3 2FD8A 4MGYE 5LBEA 1SPPB 5C8CB 4IE6A 4BQ3A 4FPYA 4XFAA 4EWEA 3AMNA 3VD3A 4Q4V3 3RDIA 3VBFB 4XFCA 1YEWA 2WO3A 1RITA 4QB6A 2G1MA 4ZU5A 1VMFA 4JZRA 2O14A 3AMMA 4NWWA 5F2WA 3GHMA 5CIRA 3W58A 1QXRA 2ZX2A 4LITA 4NRPA 5T50A 1F2NA 2C1FA 3H0OA 3LFIA 4D6QA 4LBKA 2ARXA 3GGLA 3HQRA 1OC1A 5FZFA 4LQRA 1Y7BA 4Q1PA 2XXZA 2ZXQA 4IEOA 2XHKA 5BXXA 4HK8A 4M00A 1YIPA 2YC0A 2KXLA 2YFUA 3ZDSA 2QQIA 1U5IA 2RS53 1YUDA 2ARCA 4E2GA 1R1ZA 2PHDA 3N7LA 2HWD1 1UQXA 1WKYA 3RYRA 1WW7A 1OHFA 5F8PA 3A22A 3M3IA 4OQ8A 1CONA 4QU2A 1Q8VA 2OT7A 1QQP2 2HWC2 4ZZ5A 1JS9A 4Y22B 3NO8A 2HLEA 2QVSB 3GZTB 4A42A 2IXLA 2QBXA 1DQ5A 3TWIA 3N9LA 4Q4W3 1C8M2 2F4PA 3EYPA 3O5SA 5ACA1 3NJVA 3E1F1 3ETPA 2ZAAA 4KU7A 1KEXA 4ARXA 4COUA 5JCTA 1MEC3 2OXBA 1HJGA 3THDA 4AGVA 1BEV2 4MGQA 3VBOA 5C9AA 1H8TA 2TBVA 4AEDB 4PQ9A 4QXHA 1BK1A 4B29A 4BQ5A 3BALA 2WA4A 1D4M3 4D3WA 5BNPC 1KITA 5LWBA 3G6JB 3OY8B 4NHYA 4IE4A 3ZSJA 5J37A 3OPZA 4XJ8A 3LDBA 5K9YA 3JB8A 1AJOA 5F3EA 1C28A 5IK5A 4OMCA 5E1RA 4Y24A 2UU8A 4W65A 5JR2A 1O3SA 3QOPA 3JQXA 5GZFA 2DCJA 1NY72 3O1MA 1CPNA 4CEYA 4AVVA 3T0DA 2RDQA 5F3GA 3FHQA 4WM7A 1VAMA 1VBB3 4LK7A 2A3WA 4PI2A 5FZLA 4Q4X1 5KWRA 1W2OA 5T3NA 3CJIB 5G04L 3HAGA 5FP7A 3RZLA 2JDKA 3M7AA 3ACGA 1M4WA 3PL0A 5K0UB 3AKRA 2CGOA 3IWZA 3M3CA 2ZMNA 3C7EA 1CZTA 4YM2A 4LBLA 2IXHA 4HKWA 3T2PA 2RG4A 4AVAA 1OOPA 4YM1A 3GCXA 1EAH3 1RMU3 3KM5A 4GMP0 3LA3A 1ZRRA 4IEZA 1DYPA 2X8KA 1T6BX 4WVVA 1Y3TA 5JWPA 4FFHA 4ASLA 2DYCA 4F7ZA 4Q8KA 3VD4A 1CX4A 1C57A 2HYXA 3I3EA 1CAXB 3A0KA 3EQEA 3PTYA 1CR7A 5A7OA 2IFWA 4RQPA 1YXWA 2BWCA 1Q8PA 2XOMA 3VDDA 5CISA 4Y1VA 2A1XA 4KI5M 3ATGA 3POYA 4R9DA 5L36A 5AC91 1GNYA 5CB7A 1ND2C 3JCIA 3KCXA 4XC9A 4C91A 4S2HA 3T30A 2EA7A 3APBA 3KQ4B 4GA9A 3WG1A 2XBO1 2JG9C 1H4GA 3N7JA 4QWNA 3I49A 2D5HA 1D0GA 2VNRA 5IWFA 3ZFFB 4IDZA 1U5XA 3MDPA 1QH7A 4IE0A 3Q8EA 5J48A 3V64A 3VKNA 1V9U1 2OW4A 4JGYC 5AVPA 1OUSA 2EIBA 2EVXA 5A7NA 2YC2A 4DB5A 1CAWA 5EWSA 1QKQA 3UKNA 5C71A 5CFDA 3K75B 1ND3A 4LHNA 4EJRA 3M2MA 5BNNB 3RZMA 4HN1A 4I01A 3RSJA 5FPVA 4RGGA 3WW3A 1IQAA 4HVOA 4D6SA 1J84A 3WDWA 5ABJA 3WP6A 1LU1A 5EJ1B 3SEEA 4AVSA 5A3UA 3UV9A 1UW8A 5F5CA 1C3HA 2ZJCA 1O4TA 4CCEA 1SDDB 1X50A 1R1A1 1W6MA 3SISA 2ZPXA 5I8SA 2J1RA 4LKFA 4XXPA 3AXDA 4PBPA 5I91A 4P9JA 2WZR2 2FZ1A 2YC4A 3UL2A 5JSRA 4XF3A 2RVAA 2XGXA 2L9LA 4QQHA 4C0BA 5FZOB 2B9UA 2D6MA 2B4KA 3BGAA 4A6OA 1S0FA 2RM22 5K0UC 2IUWA 4HPKA 5FYTA 2Q4SA 1R082 4MV2A 3CU7A 4K40A 4DY5A 5C8CA 1YFXA 2GC3A 1TMF2 1Y9GA 4Q1RA 1K42A 2NPIA 4HETA 2XWBB 3VBFA 1HV0A 2VTXA 4Y20A 4OUEA 1LOGA 2J42A 2IXCA 4Z92B 2E9QA 3C7FA 1BHGA 3JU9A 1TME2 1KFUL 1BLZA 3ZX7A 1JUIA 1LOFA 4JDOA 1MACA 3IDAA 3INAA 1RUD3 3FZ3A 4E2SA 5LASA 4A3ZA 5FWEA 1RUG3 1J1TA 1VBC1 2CDOA 2GP3A 2VQTA 4GJYA 1OLQA 2XG3A 4DNYA 4MHRA 5DN2A 1ZRIA 2VM9A 1OVSA 1HQLA 1VRH2 1SZBA 3ASIA 4YPJA 4O7XA 3RGBA 1GLHA 3CO2A 4J1XA 1DGRA 1DHKB 2VOKA 1ODMA 4BXFA 3USUB 4Y22A 2VNGA 2AC1A 3SXWA 2XJUA 4CDUB 2BGCA 3F95A 3RWKX 3AYAA 4AHYA 2GNTA 3H7JA 2XKPA 4KWKA 1ZNPA 1G6NA 4Z2WA 2E53A 2GN3A 3MUY1 2NYYA 3KMHA 3LQCA 4R9AA 4AF9A 5FYSA 2QKDA 4AEDA 1N3OA 4RR3C 5FY4A 5FDBA 3AYCA 4IEYA 4PF5A 4FAHA 3DECA 1XNKA 4E8DA 3NJXA 3OY8A 4I09A 1MZ6A 3M3QA 4Y5SA 2AEZA 4C1XA 4HG6B 2R042 4XVHA 1DG6A 1KS5A 3FFQA 3NWKA 5HPOA 1W9SA 3I3DA 1XYNA 1IOAA 4P9XA 1UXXX 1UZ0A 4ZKTB 1RUOA 2ZGQA 3NQHA 3PJYA 4IV1C 3D4KA 4JGZC 1X9PA 3VBSB 3AYDA 5FRAA 4BQWA 2O1QA 4BXSV 2RV9A 2WT2A 4URTA 4K8FA 1AR91 4D94A 3LA7A 1YFYA 5FP8A 1UZZA 3H3LA 5FY7A 1FX5A 2EIEA 4QPGC 2O8QA 3I54A 5FXVA 5HCHA 5CEHA 2AZ5A 1QJZA 1IKQA 5FMOL 2R7EB 1PX3A 1UY3A 2Q8OA 4KWUA 4A4AA 2Y6KA 2ERFA 4IESA 3H42B 2P3YA 4AQSA 4COZA 4HT1T 4BQ1A 1NKGA 3AZYA 5ACA3 3ZYHA 3BVCA 2E26A 1LKNA 3WW2A 1YI7A 1QMJA 2P3IA 5FY9A 4UAPA 3MIHA 4BCUA 3T4HB 5A33B 3NNLA 4E4ZA 4CEWB 4TTGA 2B9VA 1D2SA 5DUUA 2RS32 4Q0VA 4KNCA 4JRLA 4YVWA 1W3XA 4INDA 4L92A 4QX1A 3WY6A 5FO8B 1AR62 2Y64A 2RDNA 3AP4A 4PIZA 1SG3A 4XUOA 3PIJA 3SCGA 3ZFFA 5A3MA 4SLIA 1PGL1 2EIGA 2VZ3A 4XF0A 2A71A 3K4AA 4Q4X3 5FMBA 1WLCA 3D0JA 1SFYA 2AREA 3THPA 4OZOA 3DL3A 4HONA 4RS5C 5KHHA 1RUI2 1HQNA 4E4HA 3HD8B 3RJRA 3POGA 5LA9A 4XFFA 5DDJ2 1L7RA 2H0BA 1UIJA 1WD4A 2D5FA 4OULA 1OPMA 1NZCA 3AVRA 1W2TA 4QM9A 2A6ZA 4P9LA 5T5LA 2R49A 2HWE2 4ISRA 1LNSA 4EWDA 5BNNA 2GH2A 1W0NA 1ZZ9A 5CBLA 3DPRC 1AX2A 5FQ0B 2ETEA 2DU0A 5FYVA 4BWOA 5A80A 3H8OA 3TN92 3HR9A 5EFUA 5I0TA 4ASKA 1LESA 1GZTA 1AL0G 1VAKA 4GKYA 1Y43B 2DU1A 3AL6A 3ZXAC 3TAYA 4XDPA 3V0AB 2B39A 1RUH1 4YZ2A 3MW3A 1QDCA 1DYOA 3J9SA 5FZKA 4HN0A 4A44A 5FK7A 1ZA4A 4D7TA 4DIQA 4QGMA 1NLRA 1D0HA 1VBD1 3LEGA 3FUOA 5AC93 3OCPA 1CIYA 1J1LA 1K12A 1GYKA 1H4HA 2WWJA 3E6BA 1HN1A 4LBQB 4LBQD 2W92A 1QDOA 5FY5A 4ET7A 5F3CA 3FLTA 3DN7A 4WM8A 2WS92 5FYUA 1MS0A 2CSGA 3ZYJB 2J1SA 3VHRA 3B01A 4KU8A 3BPSA 1W0OA 5BNOA 5K4LA 5FZOA 4L9BA 2FMDA 3LDKA 1X82A 2YFZA 3WNNA 4FPJA 4YFWA 2R061 2BNMA 1XNBA 1V9U3 4GH4A 3M1HA 2R0HA 1UKRA 1WLTA 2RR11 4CU9A 1QJU2 2W0XA 3LA2A 4GXLA 4AEJA 2NP0A 1OA2A 2XB6C 4TZDA 1TVGA 3DKWA 1YC61 2BUKA 2GSYA 4AI0A 4AHXA 1ZZ8A 1D2QA 1NLSA 5GZDA 3ELNA 3T0BA 4EZ4A 5C3QA 5K8SA 2KM2A 2VL4A 5GZGA 4JVAA 5KBFA 2WNOA 1CQ9A 3A0NA 2YY1A 3J7MA 1BXHA 3MIBA 3GBWA 1HLCA 4Y5Z0 4AGRA 4ES8A 2RJKA 3T08A 1AHSA 4XF4A 1POV3 3AP7A 3HVDA 1WCUA 1JZ8A 3BTAA 5FK8A 3TYJA 2RMU3 4RL7A 3POJA 2VVEA 1R1A3 4CSWA 3P1IA 1IPSA 3PHMA 5EQUA 2FQPA 4CDWC 4M4RA 1WLDA 1ENXA 5FZAA 3AKQA 5GALA 3TEXA 1WMXA 2CTVA 2HEYF 2WQZC 1YLLA 4P9IA 3IIIA 1UAIA 4LO5B 2VH9A 3CIHA 4DPNA 2UYBA 4CDUA 2JB4A 2ZMLA 1MS1A 2X09A 4HLTA 3VBUB 4LUMA 3AFGA 3ETQA 4GB32 4C90A 1QJFA 1S2KA 2VR4A 2KR2A 5DAQA 3TEZA 1BMV2 4JQRA 4ORFA 4OCTA 3WF1A 4N43A 3ZN6B 3E6DA 3BI3A 1NCRB 3DKQA 3ZYGA 1NX9A 3GZEA 4YGBA 1UD1A 3MIGA 1OUXA 2OQ7A 5JZGB 3PVBB 2ZEZA 1RHI2 1O8SA 1BBT2 1NCQA 1ZBE3 2V4AA 5I93A 4Y5TA 4XCBA 2BVVA 2RS13 1YQ8A 3KGLA 3SNMA 3ZFGA 2FDFA 2XPJA 4BISA 4FXKB 2BU9A 1SLAA 1GWLA 4Z82A 3BOWA 4XJAA 3I2GA 2QQOA 1EPWA 1SCRA 3NV4A 2XKOA 2A3XA 3EO6A 4K8RB 2W68A 5T52A 2HBUA 2ORXA 3NKTA 2KA3A 2FHRA 1PO23 3GALA 4OHWA 4QT6A 4LO7A 2GMMA 4ATEA 5A3PA 2D3PA 5C33A 2Q1ZB 4MGIE 1FI2A 3MHZA 5G05L 1QJY2 3NKGA 1JYIA 1A8DA 4QQPA 2LM3A 4NAMA 3LD8A 5FMOS 3URFA 2C9KA 3DXTA 1GU3A 4KH9A 1ZBA2 3B7MA 3NVCA 4AI1A 1NA1C 1LOEA 1QQP1 5IVBA 2HWC1 2ORZA 4NN0A 3PMSA 2HH9A 2W46A 2NZ9A 2ADEA 5FFOC 1C8M1 1AX1A 4GMP1 1XXNA 5LBFA 4CEWA 1JOJA 4WZCA 1JZ4A 3FBMA 1SACA 2DDUA 3MGUA 3KHCA 1BEV1 2PAKA 4MADA 4LT5A 1MS8A 3U1XA 1BCXA 2YBSA 4HK9A 4ATFA 2V09A 4R4XA 5FLJA 1HIXA 4FXGB 3CDZB 5A7SA 2OPWA 2JKBA 3PU3A 4AXOA 3P5BA 4PLNA 3ZPYA 1W8FA 4OI4A 2WAOA 4QKDA 4UYBA 1DGWA 4V2WA 5JXHA 3WUCA 2HEVF 3BU0A 1AR93 1ZRDA 2VOVA 3VN4A 1NY71 3AJYA 4COWA 1LCLA 1QOTA 2DUQA 2D98A 4IV3B 2VZPA 4AR2A 1XOYA 2DFBA 5L7OB 4H2AA 4UW5A 5CFCA 2Q5TA 4CCNA 4OHZA 3S7IA 3O0VA 2DTWA 3VKLA 3HQXA 3QLQA 1X8MA 4QPIC 3ZYPA 5CADA 5FPUA 5C9AB 3VBOB 5JSPA 4FT8A 4Q8LA 5C4WA 3WD5A 4LA2A 4JV4A 1H6YA 1ENRA 2JXAA 4D6RA 3V0AA 3ZYBA 4AVTA 4R9BA 1YQ6A 4MG2A 3KHBA 1NYWA 1W9FA 2J22A 3S0MA 3MLKA 3T09A 5DMYA 1ZREA 2YMZA 2VMIA 4QHOA 2JIGA 4UFIA 2PHRA 1IHMA 2QQUA 5JVVA 3ZLIA 3FLPA 1HW5A 1GNZA 4NOTA 1H2KA 3AJZA 5FZ1A 4DO0A 4PDWC 2Y6LA 2XL7A 2YV8A 3POFA 3M3OA 3PJQA 1S2BA 2XLGA 4XUQA 3G7DA 3U10A 3WG4A 2VXRA 3FLRA 4AHZA 3RZHA 1T6GC 1ULEA 1YRZA 3CKHA 4KGQA 1SEFA 1OA3A 4UW6A 1JODA 4XAEA 4E27A 3ES1A 1FOD2 1ACCA 3JD72 3WP4A 3H1MA 4UW4A 3R4SA 3UGFA 2OKXA 2E31A 2W87A 1RXGA 3LAGA 5KHKA 1QJX3 5FOBB 2ZACA 2MEV3 3KV9A 1YJKA 3QH6A 4LUKA 5JDBA 1YNAA 1OOPB 2AEYA 1K5MC 1RC6A 4LIUA 2GMEA 4OI1A 4B1MA 3MLJA 5E16A 1CAVB 1UY2A 3IDBB 5GLTA 2IXKA 1GKBA 3WF2A 2BV4A 4UFKA 1REFA 1VALA 2D6LX 1YFUA 2PLV2 1V0AA 2PAMA 4P00B 1ULFA 4DQAA 4RFRB 3A4UA 4W4ZA 1JYVA 1RUC2 1N1YA 1OI6A 4Y1UA 1OLMA 2VD7A 4QHBA 4G3YC 4RQPB 3VDDB 4D7YA 1OH4A 1CJDA 2D6OX 1F5FA 1HJFA 1Z78A 4Y4YA 3AMQA 4Z07A 1QU0A 4OQ9A 1RUH3 1V6JA 2QQNA 2LUWA 2YZ4A 1QNYA 3IDCB 4HBNA 4ZS3A 3WQ0A 2UWBA 3N9QA 5KHGA 4YM3A 1SFNA 5J3UA 3T0AA 2VBDA 3KZ4C 4ZY9A 3HNBM 5A1LA 1VBD3 5CA6A 2PQSA 3U37A 1IQDC 3W20A 1RUE2 4O65A 1H30A 4IEQA 5IVCA 2HWF3 2P4EA 1KQRA 1GNHA 3GBFA 3U0ZA 3H9AA 1W2NA 2VZOA 4B7EA 5ANQA 5FO9B 2ZGOA 4LTAA 3VDBA 2VOXA 3ACIA 3VBUA 1KD7A 1POQA 3H1WA 2R063 4LE3A 1CAWB 1XSRA 4YYOA 4E4DX 2WZR1 1QJEA 2XHNA 3DGTA 2EXKA 1UX6A 4KMQA 4A7YA 4AAPA 2BBAA 2TEPA 2RR13 3ZN6A 3LF7A 2Y34A 3W9AA 1NCRA 3HBKA 1NZIA 4FPLA 4N7UA 2RM21 2Q0AA 3I2DA 1H8TC 3E97A 1HDKA 1R081 1YWKA 4LHLA 4DINB 5JZGA 5ABJB 1AYM3 1TMF1 3B00A 5CU1A 4NO4A 3ZIWA 4Q4Y2 4S2DA 4CCMA 1Z7S3 4JHTA 4M4PA 4IGPA 1MZ5A 1F4HA 1S55A 1CPMA 2PN5A 3VBHB 5C70A 2P5BA 3IKWA 1JH5A 1RUNA 5EV7A 1TME1 1W8OA 4LR4A 2Q8DA 5CZKA 1XC6A 2AYHA 2VUAA 4P5HA 5GZCA 4WM7C 5F1RA 1LR5A 1RTVA 1UY1A 2EIDA 4U2AA 4YRDA 5IHRA 4QGLA 4N53A 3H8XA 3B69A 1DBNA 1U5ZA 3B02A 1I9RA 4GULA 4PIYA 5FZEA 5GLZA 1FMD2 4AW7A 1F35A 1H1IA 5FP4A 1PO12 4HPKB 2VVFA 5DAPA 5KXDA 3JQWA 5DUWA 1JHNA 1ASJ2 1VRH1 2WIIB 5FP3A 1H2MA 4HSJA 4I2OA 3HIFA 3M8LA 3ENRA 3UGHA 1RUF2 2VTXJ 4J1WA 1YYNA 1GOHA 2B45X 2VCAA 4Y20B 3ZFEA 1EYBA 2VZTA 2P6HA 2PMWB 1OQ1A 1L7LA 3KV4A 5IW0A 4CPBD 2G4IA 4PHZA 2Y8KA 4XEZA 3ZXGA 5F5QA 5J7MA 3VHOA 2PHWA 4Q29A 2O8OA 3N4MA 4AQTA 2GU9A 3K3NA 1L3JA 1IS5A 5T5JA 1WMEA 2XUEA 5FMCA 3I7DA 3AZXA 4YZ5A 5HXMA 4NPLA 1WUVA 4W6WA 4AHWA 5A32B 2ADDA 2YG0A 3RS6A 1XNCA 1LRHA 2CAVA 4NIAA 2R041 4FPGA 2ZGNA 1W9TA 3GZUC 3QD6A 1LGBA 3NNFA 4QX8A 1TZOA 1IS4A 3FL7A 2W39A 3PNAA 3W5MA 3VV1A 4L97A 1YI9A 4Q27A 3IT8A 4BA6A 3KB5A 4IV3A 5SV5A 1WD3A 1DU3D 2V5DA 4BHPA 5L7OA 2ENRA 2R072 1YQCA 5FOJB 2JDAA 1O3TA 1O6UA 4OLLA 5DQ0A 1UOBA 3VHPA 5CFDC 1ND3C 3POBA 4UFLA 3CL1A 3OEBA 3JBG2 2K9ZA 1XB9A 3NSTA 3HMYA 1JU3A 1MEC2 4GIQA 4LEJA 3PVEA 4DUVA 2X29A 1OQEA 1ZRCA 4N8MA 5ABJC 4GJZA 2E6VA 1C8M3 2ZAHA 3L2HA 4AAXA 4TN7A 1O3RA 4GMP3 1NOVA 2TUNA 4DXRA 4C1WA 3PIGA 3IAPA 1QNWA 4XYXA 3Q9OA 1S0BA 4L99A 1PM4A 2JDPA 1BQPA 3DXUA 4AQ2A 4AE2A 1H0BA 3S5AA 2D40A 2EICA 1D7PM 3AP9A 3ORJA 4JQTA 3VKOA 1G86A 1EV12 1N3PA 2J1UA 5FJKA 1VBB2 3C3VA 3I97A 3H1YA 1MPXA 2RS31 1OXCA 3IB3A 3ZVXA 3DYPA 5DZEA 5FXXA 1DGRN 1LOCA 2R0FA 4IE7A 1ULDA 5B4XA 4FPCA 2HWB2 5EJZB 1AR61 1CZVA 3WDVA 2D6PA 3ZKUA 4QX2A 4W6YA 4E4SA 1CAVA 2GNBA 5C8CC 2VUCA 3HNYM 4K6BA 3O14A 1RMU2 1H1AA 3SH5A 1DFQA 1VMHA 1YJLA 2X10A 3O0WA 4GQ7A 3VBFC 4PBOA 3WCSA 1RUI1 1JMUB 5DDJ1 3RQ0A 3RYPA 5JOWA 1TG7A 1S0DA 2HWE1 1G9BA 4LLFA 1AR82 1JZ5A 1LOFC 4XJUA 5F2SA 3PUHA 5EYYA 4ZONA 4FI9A 1GWMA 3TN91 1C5IA 1HX6A 2JD4A 1S0IA 2QE3A 4YNIA 4YVWB 4BLIA 1EY2A 2EF6A 3O1RA 3BOPA 2VY0A 4FSJA 2XUMA 5IVEA 3BCWA 1AYN3 5FYZA 2C24A 2W1QA 5IAVA 2VULA 5KHJA 3TEWA 3AZWA 4JDMA 1W06A 3K77A 2VAUA 4FOVA 3I2IA 4QX7A 3SCFA 2K2SA 4QGNA 3THCA 1PIV2 4PCRA 1MS3A 3U78A 4CXXA 4BIFA 4F3JA 4K1ZA 4JHZA 3MF6A 2WS91 3AKPA 2VQ0A 1V6KA 2VZSA 4BYYA 2BBVA 1W8ZA 3POWA 3AP6A 2BPA2 5JXGA 2VNOA 3NNGA 1AZDA 1WCSA 2PA7A 3B94A 3PUSA 4BE3A 2X5IB 4Q0PA 4XZPA 3WDXA 3D82A 3HN1A 3I3QA 4ZPIA 4AEDC 1I6XA 2W94A 1JN2P 3N7MA 1W99A 1WBFA 4FFGA 4GWMA 2EXIA 2ZEWA 3O1PA 2NMNA 2V72A 4CZSA 3NNMA 1V6NA 1QJU1 1UL9A 2WYFA 4FP3A 3SQOA 3VBHA 4QXCA 4ARYA 1BK0A 3KVBA 4ITCA 5A6ZA 3HQUA 4CXYA 1HB2A 3FC0A 1KS4A 3VLBB 1UIKA 3H50A 3CNAA 4YW7A 2XVKA 3HNMA 1HV1A 4WM8B 2ZS6B 3MV11 4M0NA 1NQDA 5J96B 1E5RA 1TNRA 3CZJA 3AL5A 3CJIC 2D6KA 5BNOB 2PHXA 4S2FA 4NPRA 4W50A 3LEIA 4EROA 2WSUA 4Y4RA 1XU2A 3OTFA 3PVOA 5JPMB 2OIIA 5FWJA 4V1PA 5DPNA 4GH4B 1PZ7A 2W3JA 4YWAA 4LKSA 3LCPA 2W47A 4IQPA 1O5LA 3RWNA 2X05A 4OYUA 1LEMA 1ZZ6A 2XONA 5KR7A 2WZR3 3AM2A 3OYWB 4NIIA 1ZA7A 1PK6B 1URXA 4FPKA 2A7AA 3E5QA 2BTVC 2ZCWA 2Z2SB 4MH0E 3U11A 1DLLA 4CPBA 2YXSA 4CXWA 4GB31 1GP5A 5A1AA 5CAZA 1OLME 1N1TA 3IN9A 1R083 4NHKA 1FT9A 1SLTA 3IPVB 3M3EA 5FXWA 1BMV1 4AL9A 1TMF3 3AZVA 3K2OA 2GDFA 5FCCA 1UMHA 4XHXA 1RUD2 1KFXL 5LB6A 5A32A 5LBCA 3WNXA 3KWVA 1RHI1 3WDUA 1BBT1 2F4LA 3MLLA 4B4PA 1TME3 1WMFA 4P9WA 3ZFFC 1UMZA 4JTNA 4BLJA 5LW9A 1XBFA 1RB8G 1B35B 2JDZA 1IPJA 2WFF3 5FKBA 2ZGLA 4NVPA 1G9AA 4AQ6A 4LBNA 4QQOA 3KSCA 5FYBA 1QGLA 3AFKA 1F9KA 4GAZA 1GZWB 3PUQA 1LAJA 2OX0A 4XMIA 2YBPA 3CMGA 2BOJA 1UOGA 5BNNC 3WINE 3BUCA 4N43B 3I59B 1C1LA 1MVQA 5EP9A 1QJY1 4YG3A 2YDEA 5I0DA 4AI3A 1SMVA 2JWPA 2QJVA 3KGZA 3DEMA 1SLCA 2PTMA 1TEIA 4PQQA 1NCQB 1ZBA1 3I2OA 1B09A 2N7GA 1GANA 3ZFGB 4DOUA 4IERA 4TLFA 5ERLA 1HRI2 4QX3A 2H6BA 1WGPA 1JYWA 3GZAA 4KWLA 3QCWA 3O7OA 5H9RA 1FPN2 1W8HA 4JTOA 1PMHX 3WCRA 1OH3A 2VO5A 5FJHA 4MGTA 2QZ3A 3C7GA 4D7SA 1XU1A 3J4UH 1O59A 1XQNA 1OKQA 3UESA 2EXJA 4CP2A 2KD7A 3RJ2X 1RUJ2 3RVHA 2HWD3 2WN3A 2WR9A 1GP6A 2XJQA 4M3CF 4PIXA 4Q0QA 1UOFA 3IMNA 4XBLA 3KF3A 4YZ1A 1OF4A 1JW6A 4JKMA 4OHXA 2WZEA 1RL3A 1UCXA 3AYEA 4L2NA 4XBQA 5F32A 3OPWA 4K7JA 4LNVA 4URAA 2FCTA 2CHHA 1JOBA 1PGSA 4GH4C 4NUBA 4TSVA 2FCVA 4ZZ8A 1G9CA 2VXJA 4CVUA 2CNAA 4PF1A 3KS7A 3WDYA 3ECQA 2WT1A 3O1SA 4E9KA 1JOPA 5CG9A 1RINA 2E51A 1HKDA 4ZU4A 3OGGA 4HKOA 3UGGA 1W8TA 4CCJA 4YW5A 2Q8EA 1PX4A 3W59A 4IE5A 2SBAA 2P37A 3MICA 4IEVA 5FKCA 4COYA 1U0AA 2F6BA 2BYVE 4YARA 3ZSLA 1VRBA 4LKDA 4HL0A 5FR3A 5IK7A 1AJKA 5FBZA 4O9EA 1REDA 5IK4A 2W52A 1AUYA 2RDRA 1UO9A 3EJKA 4A2UA 1GMMA 4DXSA 5FXZA 2YGLA 5JUVA 4CDUC 5CFCB 1Q8OA 4FTBA 1AR63 1WW4A 4CCCA 1FOD1 2BZDA 2XVGA 3ZYIB 3JD71 3RZJA 2VQUA 1RVF2 3ZSKA 2DVFA 1MQTB 1SBEA 2ZX4A 1CWPA 4BB3A 5C7GA 4RYDA 2LTNA 1AR72 3GM8A 2EXHA 3ILRA 3FHAA 2X5IA 3LEMA 5C4WB 2JDUA 4N43C 4W6XA 2ZGRA 2A73B 4HSLA 4P9YA 5FPZA 4U36A 1OPOA 3C7HA 4AFAA 5BUVA 1W6NA 2CWSA 1SDWA 5DDJ3 1PM7A 1NCQC 2CL2A 1US3A 2OPKA 5T5PA 2RE9A 5IK8A 2HWE3 3LKJA 3OEAA 3LWCA 4MUVA 4D8MA 3SH3A 5FLHA 1VPHA 2CU5A 2PLV1 2XDVA 3ZR5A 1J3PA 1R092 1J3QA 1W28A 2JDMA 1RUC1 3AZZA 4RGAA 3TN93 3WHTA 1HB4A 1OURA 4QX0A 3VBSC 4CDQB 2XBO3 2A75A 1AVBA 1H1MA 4E8CA 1LHVA 1W03A 1WW6A 4K21A 5A7PA 1YFWA 4C0HA 4YZ4A 2BVBA 1QOSA 1GBGA 3EBRA 4QDRA 5D8AB 3TNPB 4DS0A 1AL21 1ODNA 3K3OA 3O0XA 4AOCA 1C5HA 1QXJA 1VBA2 3VUOA 4OMDA 4M3CA 5CKNA 3S30A 1GQPA 5LRSA 4OHYA 1UNBA 3QH7A 4P5YA 3ZXFA 5A3LA 3AB0A 1RUE1 1UU4A 3F2ZA 3R0RA 2GNDA 1FXZA 2PELA 3H3ZA 2ZGTA 1ALYA 3OYWA 2FDHA 4ONUA 1PK6A 3WOGA 4DZGA 1GOFA 1MS5A 3KD4A 4QQ2A 4QPGA 4YSFA 1C1FA 4NAOA 5KHIA 3ZSEA 2BRTA 1O3QA 3BIWE 1PNFA 5F5IA 4EZHA 3DYMA 3W5NA 3IPVA 2VECA 4CEWC 2NN8A 2PFWA 3UJOA 4ISQA 5KC5A 1SLIA 2JE9A 1E57A 2J7MA 4QQLA 5EYXA 3ZSMA 5FZBA 1HXS2 3T3YA 1LB2A 3VZJA 3FX3A 2OVUA 1MVEA 4CU7A 1C4RA 2HJIA 4QXBA 2WNVB 4NIGA 2GZWA 2WZPP 1OSGA 1ZZ7A 3AXEA 2Y6HA 4Q4Y1 4CP0A 1XYPA 5IVFA 3WP3A 4AFCA 2RMU2 1NXD1 4DRRA 4CUCA 1B35A 2JE7A 4BQ2A 3J8F2 5ANNA 4RA0A 3WW1A 1UYPA 4BU2A 1WCQA 1K3IA 4NHLA 2Q8CA 2Z4FA 1CIWA 3BODA 4OZXA 2I74A 5DAVA 4Z1VA 1GZWA 1V70A 1UY0A 4Q0UA 3RRDA 1ZZCA 4R9CA 5IATA 3I59A 1FMD1 1XNAA 4CDXB 4B4QA 5JLVA 3SKVA 2CWMA 1PO11 1FNYA 3TOJA 2CGPA 3AVSA 4EN6B 1FV2A 1ASJ1 4NWVA 4RS5A 1GUIA 3FUQA 3LB9A 4GB33 5C6CA 2MNGA 1XNDA 4H14A 3N35A 4Y1YA 1ZBE2 1DIWA 1IG0A 2RS12 3GNEA 2IXIA 3KCYA 1O4YA 4YVSB 2VUJA 4R8HA 1WBLA 2AH2A 1VBC3 2CV6A 2W1UA 2VZUA 4FQ4A 3VD9A 4META 5H9PA 2PHTA 1C8NA 1POV0 5BV6A 5FZ9A 1RHI3 4N53B 5JPNB 1BBT3 3WF0A 4YW4A 2WLPA 4B7KA 1G7YA 1PO22 2H0VA 1UPIA 2CAUA 4X8PA 3SEPA 1DLCA 2V5YA 2PAEA 3IBMA 5KC6A 3RG0A 4L0PA 2IFRA 2ZKNA 3UT0A 2RHPA 5JOXA 4XUNA 5GKAC 4P9GA 4B3NA 1K5JA 3FMGA 5J36A 3D6EA 4H55A 4TLGA 3SKJE 3K51A 1OVPA 4D0QA 2B42B 3UJQA 3KF5A 1ZVFA 3ZFEB 4UFMA 2WKKA 3POIA 2BNNA 2VBBA 5E6HA 5DZFA 3MV01 2VU9A 5FIXA 1QJY3 5CYYA 2OUJA 2R071 3OUHA 4UFHA 2NLRA 1GQGA 5H9QA 3IZOA 4QXKA 1EUUA 4Y26A 1NT0A 1ZBA3 3JBG1 2C5DA 4A3XA 1MEC1 1SLBA 3I3MA 5A3WA 2WFPA 1ZZBA 4AZZA 4H7MA 1JTZX 1YQ2A 2D7FA 1TE1B 2PYTA 2WC2A 2UURA 2P3KA 4LXLA 2IVIB 1E5IA 1PVC2 3ZN5A 5DXDA 2Y33A 5F3IA 1LJ7A 2JKXA 5M0TA 4GWNA 5IYYA 2R1BA 2AR6A 1XRUA 5FO7B 4CRQA 3MUZ1 4LLOA 3ITQA 2JG8B 1S0EA 4MHUA 4MGZE 3P3NA 2ARAA 5FZDA 3S6PA 2YU1A 1EV11 1SQ4A 1Z0HA 3VBUC 3D8CA 1DQ6A 1VBB1 2D6NA 4FPFA 4HZFA 5FZ4A 5HCBA 4DEQA 1MQTA 1Q8SA 1ENSA 4XJ9A 3WLUA 3WVJA 1RIRA 4P02B 4WVWA 3LPFA 2WO2A 2HWB1 4HVQA 2BWAA 5DAWA 1NCRC 1W9YA 3MFCA 3WQ7A 3NNJA 2C9AA 1ST8A 1JUHA 1W6OB 3VD7A 4N90A 5JZGC 1FAYA 1CZSA 2H6CA 3ES4A 4COVA 3NV3A 1IS6A 1RMU1 4MO3M 1G8WA 2XLAA 4QPWA 5CKMA 2D44A 2WBKA 2ZOEB 4EN8B 3TRSB 3V0BA 3K46A 3R05A 4UOJA 4N9IA 4CDQA 4XQWA 1JZ7A 1JYXA 2WA3A 3BIEA 2QQPA 2VW2A 4AFBA 1AR81 3L2YA 4XFBA 4XCAA 3D3AA 5H9SA 1M06G 4EN7B 5D8AA 5F39A 2WWUA 3HT2A 4UFJA 1VBE2 2JX9A 4KG8A 4RHV2 5E89A 4C8DA 3WUDA 2Z79A 2A5ZA 1QJX2 1IGOA 1X9TA 2P6CA 2MEV2 2E63A 5FZ8A 1KRIA 3VBRB 3WG2A 2Z42A 5APAA 4CUAA 2BW8A 2RJ2A 1ZRFA 2A3YA 1SCSA 3BTYA 4XILA 4DXTA 5C3SA 1HRV2 2W2IA 4YW3A 4NRMA 1UXZA 1BKZA 1DP0A 1PIV1 2WNUB 3MFAA 5FZIA 5LZ6A 2G9ZA 5FY0A 3H8UA 2WQ8A 4AK3A 4XUTA 5AFEA 2QDNA 4L11A 5BNQA 1GR3A 1V6LA 2BFUL 3ILFA 4MLOA 4MXVA 4YGDA 2BEOA 3UETA 1GWKA 2Y6JA 3LPGA 4DMIA 4BQXA 3BTZA 4AEMA 4X6RB 4KL1A 3MW2A 1XE8A 5J98B 5I0RA 2DWRA 1COV2 1DQ2A 1UX7A 1VLNA 2WNVA 4RSUA 2YUEA 2TNFA 1OA4A 2RDSA 1RUC3 3NJYA 3DUIA 4OFGA 1BZWA 3ZXDA 3S7EA 3AMHA 2K46A 2W91A 4LBMA 5IVVA 2HWF2 2XQRA 4BM8A 2YGMA 1AL23 1W6PB 4IV3C 2QQMA 1OD3A 4DUXA 4CP1A 5L7OC 5HV4A 4AYUA 5FZCA 4I0WB 3WSOA 2J1EA 3AKTA 3HBZA 1QF3A 1NE4A 3JB4C 1RUE3 1FATA 3ROUA 4CDXA 5EIYB 3GF6A 4QDQA 2WL1A 5C9AC 1V00A 3VBOC 1IS3A 2VUDA 1GV9A 2GALA 1H9PA 2QQKA 4NIDA 2HBTA 4DUWA 3NAPA 4F83A 5HCAA 4FPOB 5DAXA 2R32A 2YPJA 4N9HA 3NL1A 3VZKA 1AYM2 4YVSA 2D43A 2R16A 1O7FA 4YGCA 5C3RA 1Z7S2 5EZWA 1H9WA 3OB8A 5CG8A 5GLUA 5GLVA 3O12A 3OOXA 4CEYC 1UN1A 5FLIA 2OZ6A 1RJ8A 4LMFA 4FFFA 5BNPB 2DCKA 4O9GA 2PHUA 2P1BA 2VNVA 2ZGPA 4UBHA 5JI7A 3OPTA 1RUD1 3ACFA 4P14A 2GNMA 4Q4Y3 2IZWA 1X7NA 5IUQA 2JJ6A 3RYKA 4QM8A 2XR4A 1JHJA 5A3TA 4BMEA 3NMBA 3SHRA 4M3CE 2W9XA 4CCLA 5JXJA 3WHUA 1LGNA 2ZGSA 2ZGMA 2ZKLA 1OOPC 2RJLA 4K20A 3J7HA 5LATA 3O1OA 2A6XA 2YBKA 3DCQA 5FYIA 1QY4A 3PLQA 1NE6A 1S0JA 1S1AA 4IETA 1QEXA 1SBFA 4Q4V2 1I3HA 5AVAA 4HOOA 4I02A 3AKSA 3DYOA 5L9VA 4GALA 4PT6A 4FOWA 1US2A 2DVAA 2K0GA 1PO13 3TEYA 5LK7B 2QTWB 4Q5OA 4KBBA 1ASJ3 4RQPC 3VDDC 3LSEA 2DVBA 1E5SA 1CVNA 2QNKA 4D69A 1D4VB 3K4ZA 4AFMA 4IEPA 3VD5A 1ENQA 4GZ9A 4YM0A 2LW8A 2RS52 3ST7A 4O61A 3Q8AA 3VDCA 3WV6A 4NMIA 2XJSA 1HN0A 2EAAA 3A7QA 5LA2A 3THTA 3TNQA 1HRI1 5IAXA 4XJZA 1WLWA 4MSVA 4AEKA 1DCSA 3ZXJA 1FPN1 2VTFA 2JG8A 4XOGA 1ND2B 3ACHA 4Q26A 4QD2A 4ZHNA 3KV5A 4K1YA 4Q4W2 4NHXA 2G9FA 1RUJ1 2JG9B 2OZJA 5I0UA 5FZHA 4NIHA 2VG9A 4CEYB 3ZXEA 5A6YA 2DTYA 1F5JA 1QQP3 2DBNA 3LZZA 5L73A 5GM0A 3UKVA 4B4RA 2HWC3 3AP5A 1Y9MA 1OF3A 1S0CA 1FV3A 1W6OA 4JCKA 5L9RA 1D4M2 4JGYB 5IT6A 3VZLA 5JSOA 3IMMA 2R073 1BJQA 2DVDA 2GH8A 3OBZA 2CY6A 2PHLA 4XIOA 4I30A 1H2NA 4WVZA 5AFBA 3CEWA 3VBHC 1DF0A 1BEV3 1UYYA 1ZM1A 2Y60A 5I0SA 1SHWB 3JBG3 2FDJA 2PHFA 1APNA 3OGJA 4IGOA 4KWJA 3B93A 1TQ5A 4I0BA 3E6CC 4CU8A 2ZHKA 4N7IA 2GMPA 3Q8CA 4XFHA 1F15A 3I2JA 2BJSA 4NR1A 1J83A 3QBQA 1YQ5A 2ZGKA 3RI9A 1PHMA 1K45A 1LHWA 2ATFA 2BNOA 2QQWA 3J7NA 3VBRA 1OQDA 2Y0IA 4LBOA 1EAH2 2VMCA 4UW3A 5JR7B 3WNLA 1EV13 3B3QE 2NMOA 1VE0A 5FTTC 2WNUA 5A6XA 4Z8BA 4OI0A 3U14A 4MXWB 5A1FA 1LECA 4Y1XA 2HWB3 4IW3A 2B7YA 4LOTA 1A78A 3E5XA 3LGRA 5GLWA 4NJ4A 1RVF1 3T1MA 4CU6A 2IWGB 1CAUA 3N9NA 2BFUS 1AR71 2WSVA 2G19A 4CA9A 2ILMA 1UF2C 5KXEA 1YCIA 2Y6FA 3OGVA 1W9WA 3O1UA 3ZDVA 2DCTA 4B1LA 5JAXA 3IIAA 4NRQA 5FY8A 2V4VA 1PGW2 2ZEXA 4LBJA 1STMA 1LHOA 1TNFA 2VMFA 5IFTA 4XDQA 1AYN2 5FZ0A 3ZKYA 1AR83 1O8PA 2QUOA 3RZGA 2JECA 1W2UA 4FBFA 1MS4A 1R091 2BERA 4V2VA 1KDKA 2ZZJA 2ZMKA 3T2QA 5BY5A 1W6PA 3RNSA 3S5QA 5DABA 4CCDA 3PUAA 1LHUA 5A3NA 4ZS2A 1OKOA 5A3OA 3C8XA 2ZX1A 3H3UA 4OI2A 3NW4A 3FFZA 4Q2FA 1UZWA 5B4NA 2CYFA 3VZNA 3RMXA 1JYTA 1VBA1 3LSDA 4MVTA 1GZ9A 2BQPA 4F8AA 1W6NB 4BZ4A 3O1TA 1CESA 4LIVA 4UI9L 1PIV3 2GN7A 4PJYA 2WQ4A 3C2UA 1AXKA 3U4SA 4WVMB 1LOAA 4LOSA 3WW4A 3KT1A 3RI8A 3SLIA 4SBVA 1VJ2A 2Z69A 3BN6A 2NQYA 2ARBA 2Y0OA 3FN9A 4R52A 4LO6B 5GZEA 2VBPA 3U75A 4Y33A 4RR3B 4G4FA 4IEWA 2CDPA 5JOYA 5BNPA 5C3OA 2DF7A 3SH4A 4AI9A 4LULA 3ZR6A 4AFDA 3B9IA 2YYOA 4FVVA 1PMIA 4LKEA 4K3UA 3O1VA 1O4ZA 2EALA 5JOZA 1ZYBA 2YU2A 1HXS1 3BTXA 1JZ2A 2ZBJA 2GC0A 4MGKE 3ALQA 1XYOA 2WT0A 2XLFA 3WX5A 4MX3A 4UF0A 4M3CB 3VL8A 1POV1 2VOTA 3AC0A 3OJBA 4KQ7A 5FPAA 3RFRA 1DQ4A 2DCZA 3EHKA 4IV1B 3MI8A 3NJZA 4JGZB 2Y38A 2R30A 4UXAA 5FYHA 3VZOA 2WABA 3N9OA 4FFIA 2RMU1 4EN0A 4IEXA 1KXGA 5FYCA 4XETA 1GFF2 3J8F1 4A7KA 1KDMA 3I3BA 3EXUA 3M70A 3OBAA 1I5PA 4QPGB 3WDTA 3PTRB 2RM23 2VZRA 3HT1A 3KQRA 2VGDA 4J25A 2R6QA 1ULPA 1RXFA 1OFNA 1VB4A 4FQZA 1J58A 3B5LB 4MOAA 3N7KA 3T4VA 1SPPA 5DZGA 2OQ6A 4CUBA 4LHSA 5IVJA 2LROA 3GJAA 1JYNA 4YW6A 4JKLA 1RUG2 3EB7A 1Q43A 4YVWC 4FAGA 4QB1A 5FMDA 3U07A 1X36A 4YFZA 4J6GA 1PMJX 2JE8A 4XPVA 5BYNA 1LHNA 1ZBE1 3GYDA 1UYXA 1W04A 2RS11 1UU6A 1S2EA 5LA1A 1UPSA 1GZCA 1ND2A 2WFF2 3BYWA 4YW1A 2OA2A 2JG9A 1VRH3 3ILNA 3OBTA 3T1LA 1QH6A 2XWJB 1FYUA 3OSDA 5FP9A 1PO21 1NQJA 1UOJA 4YZ3A 2R1DA 1UYZA 1W8UA 4BQYA 3ZO0B 1DQ0A 4XF9A 2A6WA 4AVBA 2X5IC 1KGYA 1AX0A 4JGYA 4RS5B 2ZEYA 5T55A 1LGCA 3OGSA 3VHNA 2YROA 3OD4A 3WR0A 5HI0A 2AENA 2A6VA 4XE9A 1OLRA 4KG0A 5A7WB 5FPLA 5F9TA 1MR5A 3DPRB 4YG0A 3U4XA 3DV8A 3LOBA 4CCKA 2Z5WA 3I2KA 4A7ZA 1IKPA 1U5YA 1X33A 4WM8C 2R043 4FOQA 3IM0A 5BNOC 1V6MA 1UWWA 5F37A 4I3GA 3FJSA 3ZIXA 2HWD2 2DV9A 3N9MA 1HRI3 3C7OA 3X29B 1XNTA 4Y1ZA 4GD4A 1FPN3 2B8MA 2X53S 5F5AA 5FY1A 1PVC1 4XIKA 1JZ6A 1IPKA 1DYKA 2F17A 4XFGA 1UZYA 3SITA 4EQVA 2FDGA 4BDVB 2WRAA 4HXCA 1RUJ3 2CGNA 1IZ3A 5ACA2 3CJIA 3J26N 1PK6C 2UWCA 1FNZA 2QFEA 4MXWA 2C26A 4HANA 2QDRA 3ZMOA 3ZPOA 4GKXA 3GCWA 5K0UA 4AWDA 3V56A 5JIUA 3QACA 2C0ZA 1A6CA 3KLSA 3MBWA 3CQOA 2XJTA 4X6QB 1H6XA 4BMBA 3D0SA 3ZM8A 2W1SA 1CD3G 4FPEA 1DGWX 4AI8A 1R64A 2JB8A 1IG3A 5FAXA 1E5HA 1O5UA 2FCUA 1UMIA 2WYSA 1UKGA 3LIGA 3WQBA 1VMJA 4B8EA 3A21A 2XJRA 1DDLA 2I2SA 2XVLA 3OF1A 2JDNA 1CAXA 2DFCA 1H8VA 3OUJA 3Q8BA 1BVVA 4Q4X2 2RS33 2IVJA 3I2HA 1B35C 3MIFA 5LRRA 4UT5A 2OYZA 1SBDA 5JMCA 5BPXA 1WWYA 4RGKA 3SC7X 4K9SA 4QKBA 1WA6X 2W08A 2BOIA 2VPVA 1Q56A 1UU5A 3WG3A 4CP9B 2ID4A 4IGQA 4FPHA 2VZ1A 1A8MA 1VBE1 4CDWB 4QKFA 4RHV1 3KT4A 1G9DA 4GWJA 4QX5A 1QJX1 1RUI3 1DZTA 3HEIA 3LE0A 2MEV1 3RPQA 3LEKA 5J1XA 5ISLA 1W90A 2VMEA 2WUHA 5LK5A 4WVMA 2VOWA 1VR3A 3POEA 3ZFGC 5K7PA 5LY1A 1HB1A 1HRV1 1MZFA 2HEWF 2W5FA 2VZVA 5CVRA 3ZYRA 1RVF3 4LHKA 5EJ3A 1AR73 1W6QB 3FHIB 5FZ3A 2WDBA 4RR3A 3VKFC 3V0BB 5LEKA 3MYXA 2EAKA 2XQXA 3DF0A 5AC92 3AMPA 2VQAA 1W8WA 3VZMA 5FUNA 2AGSA 1AF9A 2FDKA 3A23A 2XBO2 1REEA 1UY4A 3Q8FA 5C8WA 4XURA 5FPXA 4NHMA 3PUIA 5CKQA 1QOOA 1COV1 2A70A 1GSLA 3VGIA 3ZXKA 2J1TA 1NUKA 2B46X 1CJPA 3NV1A 4RD7A 3ZYFA 2VW0A 1R093 2QQVA 4IV1A 4XTMA 4JGZA 3BKZA 1V9U2 3LFMA 2ET7A 1GOGA 5C5UA 1PNGA 1S4CA 3GBGA 2AUYA 2WS93 2ZHLA 5FYMA 1A3KA 2W95A 1QIQA 5D2AA 5HBAA 2D3RA 2HWF1 4LE4A 2FZ2A 2JICA 2P3JA 3KVAA 4XQDA 2ZX0A 1VBA3 4EWAA 2DUPA 3PMEA 4JDNA 1W05A 3HJRA 1J3RA 2C6SA 4OUSA 4XZUG 5C5TA 4DFSA 5A6QA 5IFPA 1SFPA 2ZHNA 4XHBA 4A6SA 1QJU3 1MZEA 3KCCA 5FZMA 4M0HA 4CUGA 4CYDA 3MZHA 1NA1B 3I4IA 3MEPA 3KV6A 4PLMA 3E5UA 2GC1A 3OBRA 4FO9A 5LA0A 1WMDA 2D93A 2VCBA 1A34A 2VMHA 3RZKA 4QAWA 5EXOA 1EPZA 4XACA 4DRVA 3TBDA 1AYM1 1R1A2 3J7LA 5HV0A 1VIWB 1GQHA 2HKXA 4AI2A 5D1IA 1Z7S1 2JDYA 2XJPA 5FUPA 1BYHA 1HXS3 4MYEA 2GC2A 1SLLA 3OUIA 2JD9A 2UWAA 5CFCC 1X8EA 3I8TA 1CN1A 3KT7A 5KXBA 3WF4A 4FOYA 2E7QA 2Y6GA 4M01A 4QU1A 1OT5A 1MQTC 5LCWL 4IXLA 2DBIA 5C4WC 1I1EA 3LIHA 3J8F3 3OD0A 3L9JT 4WZFA 3M4FA 1NG0A 2WAAA 3NAPB 4FCAA 2J1AA 4H3WA 4NPMA 5LY2A 3USUA 1RUF1 1N47A 5C3PA 4EYUA 2HYKA 2WJSA 1CX1A 1O91A 4P08A 3RMYA 5A7WA 4OUMA 1QXPA 3ABZA 2WINB 3IDEA 4Q4V1 3WT3A 2WN2A 3K4DA 3DPRA 3LOIA 1KJLA 4ZXEA 4QPIB 2LALA 1JU4A 3MIEA 1W39A 3WXPA 1XE7A 3JZVA 3H7YA 4OHVA 1ONAA 2XH6A 1OMIA 4I0AA 4LJHA 1VBC2 2LRPA 3T2OA 4CDQC 4L8QA 4WBBA 5IJRA 1LU2A 3H8RA 2Q1MA 4JX0A 2DVGA 4YLZA 3EMRA 4HMZA 4BQ4A 5D8AC 3IAQA 1J59A 1HB3A 1W8NA 2P34A 2RS51 3HN3A 4I3PA 3R6SA 4PDWB 4YW2A 2YPDA 3SCHA 2ZZQA 4JAAA 4IUGA 4BK5A 1N1SA 3GXUA 3WP5A 2FDIA 1PVXA 4AGGA 3VBSA 4Q0SA 3NRUA 2QCSB 2YHJA 3GJBA 5T5OA 2VE1A 3FBYA 4DY3A 5GJ6A 5HXVA 5I8TA 1F8VA 1XE0A 5CNAA 3FWEA 4LK6A 3AX4A 1W0PA 4OVEA 3BU7A 3BB6A 4E2QA 2DCYA 2I45A 3VB9A 2OS2A 1Y4WA 4XXAA 4Q4W1 2VMDA 3VDAA 3UNPA 3HOBA 2UY9A 4LO8A 2VCCA 1K5MB 4KBZA 4QHZA 1JZ3A 4DEVA 4RN5A 4XF1A 4UBGA 5SV8A 3FE5A 3CJXA 3K48A 4BOWA 2D97A 1GP4A 2LS6A 3LDRA 4AG4A 4PI0A 4TWTA 3NV2A 4BH9A 1DZRA 3WNOA 1OD5A 1D4M1 5HCFA 2A6YA 4BIOA 2WNVC 4R4ZA 2GAUA 2DUOA 2WLQA 3MIDA 5FBJA 4LO4B 1I5ZA 4HVRA 4LPLA 2BGOA 1EUTA 3PU8A 5A33A 2UYAA 3UKTA 1WCKA 1AR92 2PQQA 5FZ6A 3WEZA 4EE2A 2C4XA 1H2LA 2JDHA 3WNMA 2ZA9A 4CTEA 4UWDA 5DUXA 3V65A 3MW4A 2WWSA 4QMAA 2VW1A 5JXIA 4GWIA 2IXJA 5F7UA 2V73A 4XTPA 3T2TA 4XUPA 4CP9A 1S0GA 4H7LA 1Q5OA 5FPBA 1PVC3 3VL9A 3MF9A 1F4AA 1V6IA 3UYJA 4X8NA 4BPZA 4RFT0 4CDWA 4CDXC 5E88A 2XL9A 3HWJA 1PZ8A 4KGGA 1OFSA 1QWRA 5FREA 3CBNA 1LTEA 1ULOA 3NAPC 1EAH1 5L9BA 1WW5A 3JXSA 5JMOA 1RGSA 5D21A 1P8JA 3CF6E 1RYYA 5DUVA 5LEJA 4YVSC 1W6QA 5DG2A 1ULCA 3GDBA 1BVP1 5B2GB 5FQ0A 1NLQA 5TSWA 4WV8A 2JENA 1XPWA 3S57A 1H8TB 1YO8A 3ACLA 4XQ4A 1YHFA 2BDRA 2Q1FA 2B5HA 4N53C 4BJ0A 3D5OA 1Q8QA 4ES9A 1PGL2 2Y26A 3PVNA 3WNKA 3MO4A 4JC1A 3R4UA 1WA4A 1T2XA 3ON7A 3SMHA 2JEMA 1PGW1 2VC9A 5IVYA 3W21A 2WNEA 1AYN1 1FOD3 1VAVA 2G9GA 1PZ9A 3JD73 4LBQA 1HQWA 4WM7B 4XW3A 3UK9A 2XJVA 5I8YA 2XMLA 2E7TA 3ZFEC 4ZXKA 5LBBA 1AXYA 1VBE3 4RHV3 4ASMB 3N36A 1LULA 4QPYA 2FMYA 3RZZA 4HKLA 1CAUB 4QDSA 4FTSA 1WZXA 1GICA 4IL7A 1NA1A 1RUH2 3USSA 1HRV3 2Q30A 4QB2A 4IEUA 3HPNA 4A45A 1F31A 2PLV3 4TYSA 1JXNA 4MZUA 3MPBA 5EHDA 3POSA 1LENA 1Q3EA 4LORA 4XJWA 1VBD2 4AVCA 4ZU7A 3ME2A 2BP6A 4NROA 1RJ7A 2SLIA 3R4DB 5L19A 4EV0A 4MGSA 2E7AA 3JUUA 5KXCA 2UY8A 4S2GA 5FYYA 2BGPA 2FBEA 3BPZA 4W8JA 3P6BA 2ET1A 1DQ1A 2ZGUA 4YGEA 1COV3 2JG8C 5FZGA 3ZXLA 3WNPA 5A70A 3WF3A 3CZUA 4XBNA 4DXZA 1AL22 1U12A 1ULGA 2R062 2QQJA 1ZX5A 2VZQA 2ZABA 4QKNA 4XMAA 4JRAA 2VCMA 1DZQA 3PURA 2YB7A 1VB2A 2MPFA 2WZ8A 4JKKA 2RR12 4FP2A 2ZTNA 2WO7A 4XAAA 1DGLA 4G9SB 5F6KA 5EPAA 2W1WA 1JYCA 1OBNA 3WQ1A 1G9FA 1XSQA 5JI9A 3MPPG 4XFIA 3PDQA 1EP0A 2O0OA 2WO1A 3AK0A 3GHNA 1N1VA 2ZHMA 1LOBA 4Y3OA 4PLOA 5CFDB 1ND3B 3I2FA 1UZVA 3B9CA 4QPIA 3ZOIA 2ES3A 3TB0A 3WZ1A 4CCOA 4FTEA 1W2AX 4BK4A 1N3QA 4LA3A 4HFSA 1XJAA 1NAEA 2E32A 2GP5A
chains in the Genus database with same CATH topology
2VMGA 2MHFA 1CGPA 1QHDA 3N3HA 1RUG1 1V6OA 5J09A 2D3SA 1KJRA 2P17A 5JIAA 4PDWA 1WCDJ 3ZMNA 4EN9B 1LEDA 3VBRC 1W6MB 3CLPA 1JBCA 3ZN4A 2QZ2A 1VP6A 1YIFA 1FMD3 2DURA 1Y9QA 2I07B 2WFF1 1MS9A 2ZX3A 2WNUC 1LODA 5F6LB 1AXZA 3VKMA 1NXMA 2IC1A 5T54A 2OUHA 5E8AA 1K5MA 2VVDA 2NM1A 2P2KA 3P3PA 5DG1A 4YG6A 1RUF3 4MGYE 5C8CB 4FPYA 4XFAA 4EWEA 3AMNA 4Q4V3 3RDIA 3VBFB 4XFCA 1RITA 4ZU5A 4NWWA 3AMMA 3GHMA 5CIRA 3W58A 1QXRA 2ZX2A 5T50A 1F2NA 2C1FA 3H0OA 4LBKA 2ARXA 4Q1PA 1Y7BA 4IEOA 2XHKA 5BXXA 4HK8A 4M00A 1YIPA 2YC0A 2KXLA 3ZDSA 2RS53 1U5IA 1YUDA 4E2GA 1R1ZA 2PHDA 3N7LA 2HWD1 3RYRA 1WW7A 1OHFA 3M3IA 1CONA 4QU2A 1Q8VA 1QQP2 2HWC2 4Y22B 3NO8A 3GZTB 2QVSB 2IXLA 1DQ5A 3TWIA 4Q4W3 1C8M2 2F4PA 3O5SA 5ACA1 2ZAAA 4KU7A 4COUA 5JCTA 1MEC3 4AGVA 1BEV2 5C9AA 3VBOA 1H8TA 2TBVA 4AEDB 4PQ9A 1BK1A 4B29A 3BALA 2WA4A 1D4M3 4D3WA 5BNPC 1KITA 3G6JB 3OY8B 3ZSJA 5J37A 3OPZA 4XJ8A 5K9YA 3JB8A 1AJOA 1O3SA 1C28A 5IK5A 5E1RA 4Y24A 2UU8A 4W65A 3QOPA 3JQXA 5GZFA 2DCJA 1NY72 1CPNA 4CEYA 4AVVA 4WM7A 1VAMA 1VBB3 2A3WA 4Q4X1 5KWRA 5T3NA 3CJIB 3HAGA 3M7AA 1M4WA 5K0UB 3AKRA 2CGOA 3IWZA 3M3CA 2ZMNA 4YM2A 4LBLA 2IXHA 4HKWA 4AVAA 1OOPA 4YM1A 1EAH3 1RMU3 3KM5A 4GMP0 3LA3A 1ZRRA 4IEZA 1DYPA 2X8KA 4WVVA 1Y3TA 5JWPA 4ASLA 2DYCA 4F7ZA 4Q8KA 1CX4A 1C57A 3PTYA 1CAXB 3A0KA 3EQEA 1CR7A 2IFWA 4RQPA 1YXWA 2BWCA 1Q8PA 3VDDA 4Y1VA 3ATGA 3POYA 4R9DA 5L36A 5AC91 5CB7A 1ND2C 3JCIA 3KCXA 4C91A 4S2HA 2EA7A 3APBA 4GA9A 3WG1A 2XBO1 2JG9C 1H4GA 3N7JA 2D5HA 1D0GA 2VNRA 3ZFFB 1U5XA 3MDPA 1QH7A 5J48A 3V64A 3VKNA 1V9U1 2OW4A 4JGYC 5AVPA 2EVXA 4DB5A 1CAWA 5EWSA 1QKQA 3UKNA 5CFDA 1ND3A 4LHNA 4EJRA 3M2MA 5BNNB 4HN1A 4I01A 3RSJA 4RGGA 3WW3A 1IQAA 4HVOA 3WDWA 5ABJA 3WP6A 1LU1A 4AVSA 3UV9A 1UW8A 1C3HA 2ZJCA 1O4TA 1X50A 1R1A1 1W6MA 3SISA 2ZPXA 5I8SA 4XXPA 3AXDA 4PBPA 5I91A 4P9JA 2WZR2 2FZ1A 3UL2A 5JSRA 4XF3A 2XGXA 4QQHA 4C0BA 2B9UA 2D6MA 1S0FA 2RM22 5K0UC 4HPKA 2Q4SA 1R082 4MV2A 3CU7A 4K40A 4DY5A 5C8CA 1YFXA 2GC3A 1TMF2 4Q1RA 2NPIA 4HETA 2XWBB 3VBFA 1HV0A 4Y20A 1LOGA 2IXCA 4Z92B 2E9QA 3JU9A 1TME2 1KFUL 3ZX7A 1JUIA 1LOFA 4JDOA 1MACA 3INAA 1RUD3 3FZ3A 4E2SA 1RUG3 1J1TA 1VBC1 1OLQA 2XG3A 4DNYA 1HQLA 1VRH2 3ASIA 1GLHA 3CO2A 4J1XA 1DGRA 1DHKB 2VOKA 3USUB 4Y22A 2VNGA 3SXWA 2XJUA 4CDUB 2BGCA 3AYAA 4AHYA 2GNTA 3H7JA 2XKPA 4KWKA 1ZNPA 1G6NA 4Z2WA 2E53A 2GN3A 2NYYA 3KMHA 4R9AA 4AF9A 2QKDA 4AEDA 1N3OA 4RR3C 5FDBA 3AYCA 4IEYA 4PF5A 4FAHA 1XNKA 3OY8A 4I09A 1MZ6A 3M3QA 4C1XA 2R042 1DG6A 1KS5A 3FFQA 3NWKA 1XYNA 1IOAA 4P9XA 4ZKTB 1RUOA 2ZGQA 3PJYA 4IV1C 3D4KA 4JGZC 3VBSB 3AYDA 5FRAA 2O1QA 4URTA 2WT2A 4K8FA 1AR91 4D94A 3LA7A 1YFYA 1UZZA 1FX5A 4QPGC 2O8QA 3I54A 2AZ5A 1QJZA 1IKQA 5FMOL 2Q8OA 2ERFA 4IESA 4AQSA 4COZA 4HT1T 4BQ1A 3AZYA 5ACA3 1LKNA 3WW2A 1YI7A 1QMJA 2P3IA 3MIHA 4BCUA 5A33B 4E4ZA 4CEWB 1D2SA 5DUUA 2RS32 4Q0VA 4KNCA 4JRLA 4YVWA 4INDA 4L92A 5FO8B 1AR62 3WY6A 4PIZA 3AP4A 3SCGA 3ZFFA 1PGL1 5A3MA 4SLIA 2EIGA 4XF0A 2A71A 4Q4X3 1WLCA 3D0JA 1SFYA 2AREA 3THPA 3DL3A 4RS5C 5KHHA 1RUI2 1HQNA 3HD8B 3RJRA 4XFFA 5DDJ2 1WD4A 1UIJA 2D5FA 2H0BA 4OULA 1OPMA 1NZCA 4QM9A 2A6ZA 4P9LA 5T5LA 2R49A 2HWE2 4ISRA 4EWDA 5BNNA 2GH2A 1ZZ9A 5CBLA 3DPRC 1AX2A 5FQ0B 2ETEA 2DU0A 4BWOA 3TN92 3HR9A 5EFUA 5I0TA 1LESA 1VAKA 1AL0G 4GKYA 1Y43B 2DU1A 3ZXAC 3V0AB 3TAYA 2B39A 1RUH1 4YZ2A 3MW3A 1QDCA 3J9SA 4HN0A 1ZA4A 4D7TA 4QGMA 1NLRA 1D0HA 1VBD1 3FUOA 5AC93 3OCPA 1J1LA 1GYKA 1H4HA 3E6BA 4LBQB 4LBQD 1QDOA 3FLTA 3DN7A 4WM8A 2WS92 1MS0A 3ZYJB 3VHRA 3B01A 4KU8A 5BNOA 1W0OA 4L9BA 2FMDA 1X82A 4FPJA 4YFWA 2R061 2BNMA 1XNBA 1V9U3 4GH4A 3M1HA 2R0HA 1UKRA 1WLTA 2RR11 1QJU2 2W0XA 3LA2A 4GXLA 4AEJA 2NP0A 1OA2A 2XB6C 4TZDA 3DKWA 2BUKA 2GSYA 4AI0A 4AHXA 1ZZ8A 1D2QA 1NLSA 5GZDA 3ELNA 5K8SA 2KM2A 5GZGA 4JVAA 5KBFA 1CQ9A 3A0NA 2YY1A 3MIBA 1BXHA 4Y5Z0 3GBWA 1HLCA 4AGRA 4ES8A 2RJKA 1AHSA 4XF4A 1POV3 3AP7A 3BTAA 3TYJA 2RMU3 4RL7A 2VVEA 1R1A3 3PHMA 2FQPA 4CDWC 1WLDA 1ENXA 3AKQA 5GALA 4AFMA 2WQZC 2CTVA 2HEYF 4P9IA 1YLLA 1UAIA 4LO5B 2VH9A 4DPNA 2UYBA 4CDUA 2ZMLA 1MS1A 4HLTA 3VBUB 4LUMA 3AFGA 3ETQA 4GB32 4C90A 1S2KA 1BMV2 4JQRA 4ORFA 4N43A 3ZN6B 3E6DA 1NCRB 3ZYGA 4YGBA 1UD1A 3MIGA 5JZGB 3PVBB 1RHI2 1BBT2 1NCQA 1ZBE3 5I93A 2BVVA 2RS13 3KGLA 3SNMA 3ZFGA 2XPJA 4FXKB 1SLAA 4Z82A 3BOWA 4XJAA 3NV4A 1EPWA 1SCRA 2XKOA 2A3XA 3EO6A 2W68A 5T52A 3NKTA 2KA3A 2FHRA 1PO23 3GALA 4OHWA 4QT6A 4LO7A 2GMMA 4ATEA 2D3PA 5C33A 2Q1ZB 4MGIE 1FI2A 1QJY2 3NKGA 1JYIA 1A8DA 4QQPA 2LM3A 5FMOS 3URFA 4KH9A 1ZBA2 3B7MA 3NVCA 4AI1A 1NA1C 1LOEA 1QQP1 2HWC1 4NN0A 3PMSA 2NZ9A 5FFOC 1C8M1 1AX1A 4GMP1 1XXNA 4CEWA 1JOJA 4WZCA 3FBMA 1SACA 3MGUA 1BEV1 2PAKA 4LT5A 1MS8A 1BCXA 4HK9A 4ATFA 2V09A 4R4XA 5FLJA 1HIXA 4FXGB 2JKBA 4AXOA 4PLNA 3ZPYA 4OI4A 1DGWA 3WUCA 2HEVF 1AR93 1ZRDA 2VOVA 3VN4A 1NY71 3AJYA 4COWA 1LCLA 1QOTA 2DUQA 2D98A 4IV3B 2DFBA 5L7OB 4UW5A 5CFCA 2Q5TA 4OHZA 3S7IA 3O0VA 2DTWA 3VKLA 3HQXA 3QLQA 1X8MA 4QPIC 3ZYPA 5CADA 5JSPA 5C9AB 3VBOB 4FT8A 4Q8LA 5C4WA 3WD5A 4LA2A 4JV4A 1ENRA 2JXAA 3V0AA 4AVTA 4R9BA 1NYWA 3S0MA 3MLKA 1ZREA 2YMZA 2VMIA 4F8AA 2PHRA 1IHMA 5JVVA 3FLPA 1HW5A 1GNZA 4NOTA 1H2KA 3AJZA 4PDWC 2YV8A 2XL7A 3PJQA 3U10A 3M3OA 3W9AA 1S2BA 2XLGA 3WG4A 3G7DA 4CEYB 2VXRA 3FLRA 4AHZA 1T6GC 1ULEA 1YRZA 4KGQA 4UW6A 1SEFA 1OA3A 4E27A 3ES1A 1FOD2 3JD72 3WP4A 3H1MA 4UW4A 3R4SA 3LAGA 5KHKA 1QJX3 5FOBB 2ZACA 2MEV3 1YJKA 3QH6A 4LUKA 5JDBA 1YNAA 1OOPB 1K5MC 1RC6A 2GMEA 4OI1A 3MLJA 5E16A 1CAVB 3IDBB 5GLTA 2IXKA 1GKBA 1REFA 1VALA 2D6LX 1YFUA 2PLV2 2PAMA 4DQAA 1ULFA 3A4UA 1RUC2 1N1YA 1OI6A 4Y1UA 4QHBA 4G3YC 4RQPB 3VDDB 4D7YA 1CJDA 2D6OX 1F5FA 1Z78A 4Y4YA 3AMQA 4Z07A 1QU0A 1RUH3 1V6JA 3IDCB 2LUWA 2YZ4A 1QNYA 4HBNA 3WQ0A 2UWBA 5KHGA 4YM3A 1SFNA 5J3UA 3KZ4C 1VBD3 5CA6A 1RUE2 1H30A 4IEQA 2HWF3 1KQRA 1GNHA 3GBFA 3U0ZA 3H9AA 4B7EA 5FO9B 2ZGOA 4LTAA 2VOXA 3VBUA 1KD7A 3H1WA 2R063 4LE3A 1CAWB 4YYOA 4E4DX 2WZR1 3DGTA 2EXKA 1UX6A 4A7YA 2TEPA 2RR13 3ZN6A 1NCRA 4N7UA 4FPLA 2RM21 2Q0AA 3I2DA 1H8TC 3E97A 1HDKA 1R081 1YWKA 4LHLA 4DINB 5JZGA 5ABJB 1AYM3 1TMF1 3B00A 5CU1A 4NO4A 3ZIWA 4Q4Y2 4S2DA 1Z7S3 1MZ5A 1S55A 1CPMA 2PN5A 3VBHB 3IKWA 1JH5A 1RUNA 5EV7A 1TME1 4LR4A 2AYHA 2VUAA 4P5HA 5GZCA 4WM7C 5F1RA 1LR5A 1RTVA 4U2AA 4YRDA 4QGLA 4N53A 3B69A 1DBNA 1U5ZA 3B02A 1I9RA 4GULA 4PIYA 5GLZA 1FMD2 4AW7A 1H1IA 1PO12 4HPKB 2VVFA 5KXDA 3JQWA 5DUWA 1JHNA 1ASJ2 1VRH1 2WIIB 1H2MA 4HSJA 4I2OA 3HIFA 3M8LA 3ENRA 1RUF2 4J1WA 1YYNA 2B45X 4Y20B 3ZFEA 1EYBA 1OQ1A 2G4IA 4XEZA 3ZXGA 5F5QA 5J7MA 3VHOA 2PHWA 4Q29A 2O8OA 3N4MA 4AQTA 2GU9A 5T5JA 1L3JA 1IS5A 1WMEA 4YZ5A 3I7DA 3AZXA 1WUVA 4W6WA 4AHWA 5A32B 3RS6A 1XNCA 1LRHA 2CAVA 2R041 4FPGA 2ZGNA 3GZUC 3QD6A 1LGBA 1IS4A 2W39A 3PNAA 3VV1A 4L97A 1YI9A 4Q27A 3IT8A 4BA6A 3KB5A 4IV3A 5SV5A 1WD3A 1DU3D 5L7OA 4BHPA 2ENRA 2R072 5FOJB 1O3TA 4OLLA 3VHPA 5CFDC 1ND3C 3CL1A 3JBG2 2K9ZA 3NSTA 4LEJA 3HMYA 4GIQA 1MEC2 3PVEA 2X29A 1OQEA 1ZRCA 5ABJC 2E6VA 1C8M3 2ZAHA 3L2HA 1O3RA 4GMP3 1NOVA 2TUNA 4C1WA 4XYXA 1QNWA 3Q9OA 1S0BA 4L99A 1BQPA 4AQ2A 4AE2A 1H0BA 2D40A 3AP9A 3VKOA 1G86A 1EV12 1N3PA 1VBB2 3C3VA 3H1YA 2RS31 3ZVXA 5DZEA 1DGRN 1LOCA 2R0FA 1ULDA 4FPCA 2HWB2 1AR61 3WDVA 2D6PA 4W6YA 4E4SA 1CAVA 2GNBA 5C8CC 4K6BA 3O14A 1RMU2 1H1AA 3SH5A 1DFQA 1YJLA 3O0WA 4GQ7A 3VBFC 4PBOA 3WCSA 1RUI1 5DDJ1 3RQ0A 3RYPA 5JOWA 1G9BA 1S0DA 2HWE1 4LLFA 1AR82 1LOFC 4XJUA 5EYYA 3TN91 1C5IA 1HX6A 2JD4A 1S0IA 2QE3A 4YNIA 4YVWB 4BLIA 1EY2A 2EF6A 3BOPA 2VY0A 4FSJA 2XUMA 3BCWA 1AYN3 2VULA 5KHJA 3AZWA 4JDMA 4FOVA 3SCFA 2K2SA 4QGNA 1PIV2 4PCRA 1MS3A 4BIFA 4F3JA 4K1ZA 3MF6A 2WS91 3AKPA 2VQ0A 1V6KA 2BBVA 4BYYA 3POWA 3AP6A 2BPA2 2VNOA 1AZDA 1WCSA 2PA7A 3B94A 4BE3A 2X5IB 4Q0PA 4XZPA 3WDXA 3D82A 3HN1A 4AEDC 1I6XA 1JN2P 3N7MA 4GWMA 1WBFA 2EXIA 2NMNA 4CZSA 1V6NA 1QJU1 1UL9A 4FP3A 3VBHA 4ITCA 3FC0A 1KS4A 3VLBB 1UIKA 3H50A 3CNAA 2XVKA 1HV1A 4WM8B 2ZS6B 4M0NA 1NQDA 5J96B 1TNRA 3CJIC 2D6KA 5BNOB 2PHXA 4S2FA 4NPRA 4EROA 2WSUA 1XU2A 3OTFA 3PVOA 5JPMB 2OIIA 4V1PA 4GH4B 1PZ7A 3LCPA 4IQPA 1O5LA 3RWNA 1LEMA 1ZZ6A 2WZR3 3AM2A 3OYWB 1PK6B 1URXA 4FPKA 2A7AA 3E5QA 2BTVC 2ZCWA 2Z2SB 4MH0E 3U11A 1DLLA 2YXSA 4GB31 5CAZA 1N1TA 3IN9A 1R083 4NHKA 1FT9A 1SLTA 3IPVB 3M3EA 1BMV1 1TMF3 3AZVA 5FCCA 2GDFA 4XHXA 1RUD2 1KFXL 5A32A 3WNXA 1RHI1 3WDUA 1BBT1 3MLLA 4B4PA 1TME3 1WMFA 4P9WA 3ZFFC 1UMZA 4JTNA 4BLJA 1RB8G 1B35B 2JDZA 1IPJA 2WFF3 2ZGLA 4NVPA 1G9AA 4AQ6A 4LBNA 4QQOA 3KSCA 1QGLA 3AFKA 1F9KA 1GZWB 4XMIA 5BNNC 3WINE 4N43B 3I59B 1C1LA 1MVQA 1QJY1 4YG3A 2YDEA 4AI3A 1SMVA 3KGZA 2QJVA 1SLCA 2PTMA 1TEIA 1NCQB 1ZBA1 1B09A 2N7GA 1GANA 3ZFGB 4DOUA 4IERA 4TLFA 1HRI2 2H6BA 1WGPA 3GZAA 4KWLA 3QCWA 3O7OA 5H9RA 1FPN2 4JTOA 3WCRA 2QZ3A 4D7SA 1XU1A 3J4UH 1XQNA 1OKQA 4CP2A 2EXJA 3RJ2X 1RUJ2 2HWD3 2XJQA 4M3CF 4PIXA 4Q0QA 4XBLA 3IMNA 4YZ1A 1JW6A 4OHXA 3AYEA 1RL3A 1UCXA 4L2NA 4XBQA 4LNVA 4K7JA 1PGSA 4GH4C 4TSVA 1G9CA 2CNAA 3KS7A 3WDYA 3ECQA 2WT1A 4E9KA 5CG9A 1RINA 2E51A 1HKDA 4ZU4A 3OGGA 4HKOA 4YW5A 3W59A 2SBAA 2P37A 3MICA 4IEVA 4COYA 1U0AA 2F6BA 2BYVE 4YARA 3ZSLA 4HL0A 5IK7A 1AJKA 5FBZA 4O9EA 1REDA 5IK4A 2W52A 1AUYA 3EJKA 4A2UA 2YGLA 4CDUC 5CFCB 1Q8OA 4FTBA 1AR63 1WW4A 1FOD1 2XVGA 3ZYIB 3JD71 1RVF2 3ZSKA 2DVFA 1MQTB 1SBEA 2ZX4A 2LTNA 1AR72 3ILRA 2EXHA 2X5IA 5C4WB 4N43C 4W6XA 2ZGRA 2A73B 4HSLA 4P9YA 5FPZA 4U36A 1OPOA 4AFAA 5BUVA 1W6NA 2CWSA 1SDWA 5DDJ3 1PM7A 1NCQC 2CL2A 2OPKA 5T5PA 2RE9A 5IK8A 2HWE3 3LKJA 4MUVA 3LWCA 3SH3A 5FLHA 2PLV1 1J3PA 1R092 1J3QA 1RUC1 3AZZA 4RGAA 3TN93 3WHTA 3VBSC 4CDQB 2XBO3 2A75A 1AVBA 1H1MA 1LHVA 1WW6A 4C0HA 4K21A 1YFWA 4YZ4A 2BVBA 1QOSA 1GBGA 3EBRA 5D8AB 3TNPB 4DS0A 1AL21 3O0XA 1C5HA 1QXJA 1VBA2 3VUOA 4M3CA 3S30A 5LRSA 4OHYA 3QH7A 3ZXFA 5A3LA 3AB0A 1RUE1 1UU4A 3R0RA 2GNDA 1FXZA 2PELA 3H3ZA 2ZGTA 1ALYA 3OYWA 4ONUA 1PK6A 3WOGA 4DZGA 1MS5A 4YSFA 3KD4A 4QQ2A 4QPGA 1C1FA 5KHIA 3ZSEA 1O3QA 3BIWE 1PNFA 3IPVA 2VECA 4CEWC 2NN8A 2PFWA 3UJOA 4ISQA 5KC5A 1SLIA 2JE9A 1E57A 4QQLA 5EYXA 3ZSMA 1HXS2 1LB2A 3VZJA 3FX3A 2OVUA 1MVEA 1C4RA 2HJIA 2WNVB 2GZWA 2WZPP 1OSGA 1ZZ7A 3AXEA 4CP0A 4Q4Y1 1XYPA 3WP3A 4AFCA 2RMU2 1NXD1 4DRRA 1B35A 2JE7A 3J8F2 3WW1A 4RA0A 4NHLA 1CIWA 3BODA 4OZXA 2I74A 4Z1VA 1GZWA 1V70A 4Q0UA 3RRDA 1ZZCA 4R9CA 3I59A 1FMD1 4CDXB 4B4QA 5JLVA 2CWMA 1PO11 1FNYA 3TOJA 2CGPA 4EN6B 1FV2A 1ASJ1 4NWVA 4RS5A 3FUQA 3LB9A 4GB33 5C6CA 2MNGA 1XNDA 4H14A 3N35A 4Y1YA 1ZBE2 1DIWA 2RS12 3GNEA 3KCYA 2IXIA 4YVSB 1O4YA 2VUJA 4R8HA 1WBLA 2AH2A 1VBC3 2CV6A 4FQ4A 4META 5H9PA 2PHTA 1C8NA 1POV0 5BV6A 1RHI3 4N53B 5JPNB 1BBT3 4YW4A 2WLPA 4B7KA 1G7YA 1PO22 2H0VA 1UPIA 2CAUA 4X8PA 2V5YA 2PAEA 3IBMA 5KC6A 3RG0A 2IFRA 2ZKNA 2RHPA 5JOXA 4B3NA 5GKAC 4P9GA 5J36A 3FMGA 3D6EA 4H55A 3K51A 2B42B 3UJQA 1ZVFA 3ZFEB 2WKKA 2BNNA 5DZFA 2VU9A 1QJY3 2OUJA 2R071 2NLRA 1GQGA 5H9QA 4QXKA 4Y26A 1ZBA3 3JBG1 2C5DA 4A3XA 1MEC1 1SLBA 2WFPA 1ZZBA 4H7MA 1JTZX 2D7FA 1TE1B 2PYTA 2WC2A 2UURA 2P3KA 1PVC2 3ZN5A 5DXDA 1LJ7A 4GWNA 2R1BA 2AR6A 1XRUA 5FO7B 4CRQA 4LLOA 2JG8B 1S0EA 4MGZE 3S6PA 3P3NA 1EV11 1SQ4A 1Z0HA 3VBUC 3D8CA 1DQ6A 1VBB1 2D6NA 4FPFA 4HZFA 5HCBA 1MQTA 1Q8SA 1ENSA 4XJ9A 3WLUA 3WVJA 1RIRA 4WVWA 4HVQA 2HWB1 2BWAA 1NCRC 3MFCA 3WQ7A 2C9AA 1JUHA 1W6OB 4N90A 5JZGC 1FAYA 2H6CA 3ES4A 4COVA 3NV3A 1IS6A 1RMU1 1G8WA 2XLAA 2D44A 2ZOEB 4EN8B 3TRSB 3V0BA 3R05A 4CDQA 4N9IA 4XQWA 2WA3A 2QQPA 2VW2A 4AFBA 1AR81 3L2YA 4XFBA 5H9SA 1M06G 4EN7B 5D8AA 3HT2A 1VBE2 2JX9A 4KG8A 4RHV2 5E89A 3WUDA 2Z79A 2A5ZA 1QJX2 1IGOA 2MEV2 2E63A 1KRIA 3VBRB 3WG2A 2Z42A 2BW8A 1ZRFA 2A3YA 1SCSA 4XILA 1HRV2 4YW3A 1BKZA 1PIV1 2WNUB 3MFAA 3H8UA 4AK3A 5AFEA 2QDNA 4L11A 5BNQA 1GR3A 1V6LA 2BFUL 3ILFA 4MLOA 4MXVA 4YGDA 2BEOA 4DMIA 4AEMA 4X6RB 4KL1A 3MW2A 1XE8A 5J98B 5I0RA 2DWRA 1COV2 1DQ2A 1VLNA 2WNVA 4RSUA 2YUEA 2TNFA 1OA4A 1RUC3 3DUIA 4OFGA 1BZWA 3ZXDA 3S7EA 3AMHA 4LBMA 2HWF2 4BM8A 2YGMA 1AL23 1W6PB 4IV3C 4CP1A 5L7OC 4AYUA 4I0WB 3AKTA 3HBZA 1QF3A 1NE4A 3JB4C 1RUE3 1FATA 3ROUA 4CDXA 3GF6A 2WL1A 5C9AC 1V00A 3VBOC 1IS3A 1GV9A 2GALA 1H9PA 3NAPA 4F83A 5HCAA 4FPOB 2R32A 2YPJA 4N9HA 3NL1A 3VZKA 1AYM2 4YVSA 2D43A 2R16A 1O7FA 4YGCA 1Z7S2 5EZWA 1H9WA 5CG8A 5GLUA 5GLVA 3O12A 4CEYC 1UN1A 5FLIA 2OZ6A 1RJ8A 5BNPB 2DCKA 4O9GA 2PHUA 2ZGPA 4UBHA 5JI7A 1RUD1 4P14A 4Q4Y3 2GNMA 5IUQA 2IZWA 1X7NA 2JJ6A 3RYKA 4QM8A 4BMEA 3SHRA 4M3CE 3WHUA 1LGNA 2ZGSA 2ZGMA 2ZKLA 1OOPC 2RJLA 4K20A 2A6XA 1QY4A 3PLQA 1NE6A 1S0JA 1S1AA 4IETA 4Q4V2 1SBFA 1I3HA 5AVAA 4I02A 3AKSA 4GALA 4FOWA 2DVAA 2K0GA 1PO13 5LK7B 4RQPC 4KBBA 1ASJ3 3VDDC 3LSEA 2DVBA 1CVNA 2QNKA 4D69A 1D4VB 4IEPA 1ENQA 4YM0A 2RS52 3ST7A 3WV6A 2XJSA 3TNQA 2EAAA 3THTA 1HRI1 4XJZA 1WLWA 4MSVA 4AEKA 3ZXJA 1FPN1 2JG8A 4XOGA 1ND2B 4Q26A 4QD2A 4K1YA 4Q4W2 2G9FA 1RUJ1 2JG9B 2OZJA 5I0UA 2VG9A 3ZXEA 2DTYA 1F5JA 1QQP3 3UKVA 3LZZA 5L73A 5GM0A 4B4RA 2HWC3 3AP5A 1S0CA 1FV3A 1W6OA 4JCKA 1D4M2 4JGYB 5IT6A 3VZLA 5JSOA 2R073 1BJQA 2DVDA 2GH8A 2CY6A 2PHLA 4XIOA 4I30A 1H2NA 4WVZA 5AFBA 3CEWA 3VBHC 1DF0A 1BEV3 1ZM1A 5I0SA 3JBG3 2PHFA 1APNA 3OGJA 4KWJA 3B93A 1TQ5A 4I0BA 3E6CC 2ZHKA 4N7IA 2GMPA 4XFHA 4NR1A 3QBQA 2ZGKA 3RI9A 1PHMA 1LHWA 2ATFA 2BNOA 3VBRA 1OQDA 2Y0IA 4LBOA 1EAH2 4UW3A