2VULA

Thermostable mutant of environmentally isolated gh11 xylanase
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
193
Chain Sequence
AQTCLTSPQTGFHNGFFYSFWKDSPGTVNFCLLEGGRYTSNWSGINNWVGGKGWQTGSRRNITYSGSFNTPGNGYLALYGWTTNPLVEYYVVDSWGSWRPPGSDGTFLGTVNSDGGTYDIYRAQRVNAPSIIGNATFYQYWSVRQSKRVGGTITTGNHFDAWASVGLNLGTHNYQIMATEGYQSSGSSDITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GH11 XYLANASE
publication title Engineering Hyperthermostability Into a Gh11 Xylanase is Mediated by Subtle Changes to Protein Structure.
pubmed doi rcsb
source organism Escherichia coli
total genus 55
structure length 193
sequence length 193
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vulA00
1REEA 1BCXA 3WP4A 2QZ2A 1KS4A 3AKQA 4XQDA 2QZ3A 1TE1B 3VL8A 5HXVA 2D98A 4S2DA 1F5JA 3B5LB 3WQ7A 5K9YA 2JENA 1W2UA 3MF9A 4S2HA 2DFCA 3B7MA 3AMNA 3RI8A 3WXPA 3WP5A 1XNCA 3O7OA 4HK9A 1OA2A 1IGOA 3VZOA 4XQ4A 3WR0A 1QH7A 3VHPA 3WQ0A 3VHOA 2VULA 3VLBB 4IXLA 1OLQA 3EXUA 3AMMA 4S2GA 2B46X 2BW8A 3ZSEA 1UKRA 1PVXA 2B42B 2JICA 2C1FA 3MFCA 4NPRA 1H1AA 1H0BA 1C5HA 3WP3A 3AKPA 3AMPA 3WQ1A 1OA4A 3VZNA 3LB9A 3WT3A 1M4WA 1XNDA 1H4GA 1OLRA 2F6BA 1AXKA 2B45X 2VG9A 1H4HA 4S2FA 2NLRA 5K7PA 1ENXA 1XYOA 4XPVA 3VZMA 2D97A 3AKSA 3MFAA 1HIXA 1C5IA 3VZJA 3VL9A 1NLRA 4HKOA 3VZLA 3LGRA 2VUJA 1UU4A 1T6GC 1UU6A 3M4FA 1QH6A 1XNKA 2DCKA 2DCJA 1BVVA 3AKRA 3RI9A 2DCYA 3VGIA 1HV0A 2VGDA 3WX5A 1XYNA 2BVVA 1UU5A 3HD8B 1HV1A 3AMQA 3VZKA 1YNAA 3AMHA 5EJ3A 1XYPA 1KS5A 2DCZA 3WY6A 3MF6A 1XXNA 2JEMA 2BWAA 3WP6A 1OA3A 4HK8A 2BWCA 1XNBA 4XQWA 1REFA 1BK1A 4HKLA 4HKWA 2DFBA 2NQYA 3VHNA 2Z79A 1REDA 4H7MA 3AKTA 1H8VA
chains in the Genus database with same CATH superfamily
1D7PM 2OS2A 1ZBE1 2RS33 5DAXA 1XOYA 3IPVA 2GMEA 4LK7A 2ZKLA 3IAQA 3H1MA 3P3PA 1UY4A 3ORJA 4N9IA 3RFRA 4AQTA 1Y43B 3T30A 3WV6A 4ATEA 3UL2A 4YM0A 1S0CA 1VRH1 1BXHA 3JD71 4M0NA 4P9WA 1GMMA 2VUCA 1SDWA 3NV1A 3WQ7A 5G05L 2PTMA 2BUKA 4XACA 1LU1A 1V9U1 3ZXFA 5IK7A 2W95A 3HBZA 4UBGA 3LE0A 2Q1MA 1K5JA 3AJZA 1FOD1 1NG0A 1RUJ3 5B4NA 2PHRA 4XDQA 3UNPA 1GP6A 2QJVA 4DQAA 5LA0A 4CPBA 5FZAA 1W8HA 1GZCA 1ZNPA 3AP7A 1NCQB 3WZ1A 4FBFA 4XXAA 4XOGA 2YBSA 3WQBA 2Q5TA 4FPHA 1AVBA 1MEC3 1H1AA 5LK7B 3I2JA 5F6LB 4ONUA 3POJA 1VAMA 3N9QA 5CYYA 2CL2A 1A8MA 1YQ6A 3MEPA 3EYPA 1COV1 3T2QA 5IVEA 2JWPA 4BXFA 1PGW2 1YQ2A 2ZEZA 1AX1A 1UXXX 3LOIA 2JXAA 4PF5A 1J1TA 3KCCA 3KB5A 5A33A 4R4XA 1DGRN 5EPAA 2DWRA 5FQ0B 3OGSA 2QQJA 1XYOA 2O8QA 2OQ7A 2ZGOA 4XFIA 1IG3A 1WZXA 2ZTNA 3JBG3 4RGGA 2ETEA 1QXRA 1C1FA 2WA3A 3VZJA 1ZZ8A 4LKEA 5HV4A 1OBNA 4HFSA 3BPZA 4JTNA 1NLRA 5F2SA 1Y9MA 3S7IA 3PTRB 1UYXA 2WYSA 1R093 3CJXA 4K7JA 1TMF3 5DAQA 4AOCA 2X05A 5DDJ3 3IN9A 2BVBA 2W39A 5AVPA 4UFHA 4PF1A 2QBXA 2G4IA 4JX0A 4LEJA 5CKMA 1LHUA 2WZ8A 4LBQA 4Q0VA 4A44A 4QB6A 4AAPA 1R1A3 4KG8A 4CP9A 2OUJA 4CUBA 3MUY1 1W39A 4COUA 2YU1A 3D6EA 4DXRA 3GNEA 4GH4A 1Z7S2 1AR73 1RUC3 2ID4A 2XJQA 4JGYC 4OQ9A 3CJIA 1GLHA 2HWC2 2WRAA 5APAA 1SFPA 4BQ5A 2VNGA 2V73A 5A80A 1S0GA 2VQTA 4LUKA 4NOTA 5FY4A 3ZSLA 3H7JA 2LM3A 2Z79A 1X9PA 4FPYA 2QKDA 3SQOA 4YZ5A 4Q4W1 2PHXA 2WIIB 2WNVA 3THTA 4JQTA 3O1RA 3CJIC 2LW8A 1V6NA 2VZOA 3VBRA 1HRI1 4XQDA 5E1RA 3VDCA 4CTEA 4Z2WA 5FR3A 4CU9A 4JAAA 5BNNA 4QWNA 5IHRA 2WINB 5GLUA 4C1XA 1WW4A 4E4SA 4YGDA 3J8F2 4NIIA 4AI1A 1SFNA 5CKQA 2J22A 5FBZA 3GGLA 5IK8A 2CDPA 4HSJA 5FCCA 3P3NA 2Z69A 2JX9A 1QNWA 1JOJA 1GOFA 3OBRA 3O0WA 4W50A 5C8CA 2DFCA 2X10A 2R16A 3AMNA 5FZBA 3TAYA 1S0EA 1UQXA 2WNVC 1FAYA 1VBB2 2QQNA 4DUVA 3RPQA 3KCXA 3C7OA 4AVAA 3OBZA 1QJX1 3VBRC 3VKMA 4BOWA 3IPVB 4B1LA 3WD5A 4KBBA 4MOAA 4O9GA 3VD3A 3WQ0A 1NT0A 1LODA 2OUHA 2GH8A 4YW5A 4IXLA 3RGBA 2YC0A 3ZXLA 3ACFA 1ENRA 2G1MA 1BBT2 1E57A 4Q8LA 5FY9A 2ILMA 1YFWA 4MH0E 3WDTA 2XUEA 4NPRA 4XYXA 1FV2A 2XH6A 4MGQA 5E16A 5IJRA 3AKPA 4Q0UA 1MZEA 4GIQA 3POGA 5T5PA 2WN2A 4BPZA 1FPN3 2BTVC 2F17A 3BTYA 2RR12 4XBQA 5GZFA 1OLRA 5BYNA 2G9ZA 4GXLA 1QQP1 2JJ6A 2OVUA 2YU2A 4PIZA 3LCPA 5AFBA 1ENXA 3BB6A 2WO7A 4I0BA 2GP5A 3AM2A 4HG6B 5FWEA 4J25A 3RYRA 3AKSA 3JU9A 2Q8CA 1ENQA 1ULOA 1ZZ6A 4M00A 4QX3A 1LNSA 1WCUA 4ZU5A 2FQPA 2YMZA 4YG0A 3VD7A 3ZKYA 4K8RB 1JZ6A 4ZZ8A 1PM7A 2VOWA 3HQRA 3PHMA 1F8VA 5FZMA 4A7KA 2WFPA 1GP4A 1RUI3 4Y5TA 5JVVA 4D6RA 4YZ1A 5M0TA 3I59A 2BGCA 3GJAA 4QQLA 2J1SA 1IHMA 2HWB2 4J1WA 2RS32 3BU7A 3AKRA 5FMOL 1YQCA 3PVBB 5FMCA 1HV0A 4XF3A 3WHUA 4DMIA 1JI6A 1LEMA 1QWRA 1RUG2 2E32A 2VGDA 3BOPA 4HETA 2B7YA 3WNPA 1PX4A 2GH2A 5I8YA 1KRIA 5FUIA 2XBO1 2ZMKA 3OUHA 5LA1A 2XL9A 2VVFA 4HN0A 1POV3 2VO5A 2AACA 3SCHA 4IEUA 1SLAA 2WQZC 4RHV1 3WDVA 1RJ7A 1S0BA 1O3RA 5BY5A 4SBVA 1W0NA 2RS52 4JGYB 1K12A 3OTFA 4EN0A 3WLUA 2HWE3 1CX4A 2HWF1 3AZZA 3UYJA 3MV01 1GNZA 2RDSA 3WP6A 4GB32 1RUJ2 2A6VA 1IS5A 4J1XA 1H8TB 3WW4A 4AG4A 2CY6A 5CA6A 4LBQB 4IV1A 2H6CA 5FYHA 2RG4A 2PMWB 2JG9A 3AYDA 3A0NA 4Y26A 1KFXL 4ES8A 5DQ0A 4B4QA 3BI3A 3RZJA 5FMDA 1M06G 5A7PA 4RS5A 5EZWA 1XNAA 3ILFA 1QF3A 3LKJA 1LHWA 1F2NA 1MZFA 2DBIA 4WVMB 3IKWA 3FBYA 2DDUA 2JIGA 2VQUA 2ZZQA 3WP4A 3CHXA 4K21A 3JCIA 1UY0A 4OLLA 1V0AA 2WUHA 3CJIB 3AKQA 3BN6A 4Q1RA 4DB5A 4XBLA 3VKFC 4L0PA 4OMCA 2WZR1 1W8NA 2XDVA 1VBC3 1RVF2 5FLIA 5DABA 1O8SA 1UCXA 1EUUA 2C24A 4IV1C 3WF1A 2E9QA 1W8WA 2JG9C 4FPFA 1O3QA 1JZ7A 3OGJA 1WKYA 4AFMA 3WNKA 3BU0A 4K3UA 2ZHNA 3DKQA 3JBG2 1W2AX 1LOEA 5A3TA 2E26A 4RSUA 4MGSA 2WNVB 1CAXA 1D0HA 5LA2A 1RJ8A 4JVAA 4P5YA 2BBAA 4LE4A 3VBRB 4OHXA 3NV2A 4LA3A 1R092 1JUHA 1TMF2 2VULA 4IEWA 1UN1A 1UZVA 3B9IA 1QJY3 4N8MA 3RVHA 2ES3A 3SITA 1B35B 4ASLA 2VVDA 1K42A 5FKBA 3OBAA 4B1MA 2J1AA 2L9LA 3LFIA 1EAH1 2XMLA 1UKGA 2JB8A 2LTNA 2Q1ZB 2Y33A 3CL1A 3WNLA 2R0HA 2WYFA 1CQ9A 4LTAA 4LJHA 4I2OA 1CZSA 2FHRA 3POWA 4LUMA 4NIGA 1FV3A 1RUF1 1W0OA 3GBWA 3VD9A 1M4WA 4YW3A 1NUKA 2D43A 2K9ZA 4QX1A 3BTZA 3OF1A 1KDKA 3JQWA 1AR72 3C7EA 1AXKA 4X8PA 3H8XA 3K2OA 1QMJA 4CSWA 2C9AA 2ZGMA 1LECA 3DYOA 4QGLA 5J7MA 1PHMA 5EP9A 4XPVA 3AXDA 3DXUA 2VZUA 4P00B 4XJUA 3T0AA 2GP3A 5IYYA 4B4PA 5FY1A 1RHI3 5F37A 1UPIA 3BKZA 1YI9A 1IQAA 5GLTA 5CBLA 3J4UH 4COYA 4W6YA 3TOJA 3NL1A 4Q4Y3 2FDGA 3DF0A 2ZGRA 3NNGA 2GN3A 1ZM1A 4N7UA 1V6OA 4UBHA 3UESA 4COVA 3PURA 4EZHA 2XWJB 1O4YA 1KGYA 3OGRA 4FXGB 1XNKA 1DQ1A 2WAAA 3G6JB 4HANA 4AHYA 4B3NA 5JOYA 2PAKA 2YROA 5GZEA 4RYDA 4N43C 4LIVA 5CISA 5L7OA 1H9PA 2XR4A 1JU3A 1VRBA 3MPBA 4NE9A 4A6SA 3U75A 4CU8A 2ARXA 4Z82A 2BFUS 4F3JA 3FHQA 4XFAA 4LHKA 3G7DA 1OPOA 1UU5A 2YGMA 4CEYA 1N1SA 4XF1A 3DEMA 5FBJA 5AFEA 1PGL2 1F9KA 5JCTA 3J7MA 2XJUA 1EPZA 4P9JA 3RYKA 4CCEA 4L9BA 2FCTA 4OI1A 3T1LA 5L7OC 1W6QB 3FLRA 3WVJA 3WF2A 1RMU3 3O1TA 1PO12 2X09A 4A2UA 4TTGA 1PGW1 1PMJX 1MS4A 1W6MA 3SC7X 2W1SA 2E7QA 4ITCA 2QQLA 4UYBA 2IWGB 4Q4X2 3BTXA 3N9PA 1JZ3A 3C2UA 4YM3A 2Z2SB 1Q56A 4XF9A 1VBD3 4LNVA 3ECQA 5FPLA 4D6QA 4LHLA 4AFAA 3OGVA 2WSVA 4S2DA 1Y7BA 2WO1A 1JU4A 3I2IA 1AR83 5KXDA 4IV1B 1LHOA 3GZTB 2IVIB 2JG9B 2K46A 1ZBA3 2IFRA 2QVSB 4NR1A 4O9EA 4QQHA 5A6QA 3U78A 3ZYRA 1K5MC 1LRHA 5FP4A 2ZHKA 2PLV2 4CPBD 1O3SA 2VZTA 1RL3A 2XJPA 3IDAA 1S55A 3Q8AA 4WZCA 1JOBA 3IBMA 4YVSC 5FXZA 2IXKA 1UYZA 1ULPA 1YO8A 2BU9A 2WFF3 5A3NA 5FPAA 2ZA9A 2Y6KA 3LQCA 1OKQA 2UY9A 2JDYA 1WW6A 3PJYA 3QH7A 4GWJA 4JGZA 1AR63 2GC1A 3D0SA 1HB2A 4C1WA 4C90A 4YFWA 5KXBA 2HWD2 2Y0IA 1UKRA 4K6BA 3TN92 2VTXJ 5FPUA 2JDZA 3MLKA 1Z7S1 3ILNA 1L7QA 5F3EA 3DYMA 2HWC1 4P9IA 1MZ6A 2VW1A 4LBMA 4CDQA 4YGCA 3HNMA 3ZM8A 1TNRA 2VC9A 4FP3A 1CR7A 3ZN6A 4W4ZA 5F8PA 4XFGA 2XJVA 2DBNA 2FDFA 4XZPA 3KM5A 3OYWA 4CCCA 3NO8A 2W1QA 2NLRA 3IMMA 2HWE2 4JDOA 3B02A 4BU2A 1N47A 3UJQA 4BQ3A 4NHXA 3FC0A 3JXSA 1EUTA 1TQ5A 1SZBA 4DPNA 1JYWA 4CDQC 1F31A 2J1EA 4NPLA 3RNSA 1CAVB 2A6WA 4Q2FA 5EYXA 3OGGA 3J8F1 3PMSA 2J1RA 2ET1A 4LBQD 3T4HB 1U0AA 4EN8B 1T2XA 2D6LX 3B3QE 2PA7A 4XEZA 3W9AA 1MS3A 2ADEA 1AL23 5FMBA 5FZGA 2DCTA 3BGAA 3E6DA 2DCYA 4XJAA 2RV9A 4N43B 5HCAA 4XUPA 3NSTA 2H6BA 2IXJA 4BHPA 1VBB1 2YDEA 3HAGA 3NNFA 3S7EA 1VBC2 1JXNA 2HEYF 2FDHA 5ERLA 3HD8B 4TWTA 2GSYA 3MIFA 2B39A 4E8CA 1OUXA 1YJLA 3L9JT 1E5HA 3M3QA 4XUNA 3RG0A 2A5ZA 1BBT1 1XC6A 3QOPA 3C7FA 4XFCA 3A21A 2XVKA 1KJLA 1SDDB 2OW4A 2QQMA 3C7GA 3N4MA 4QPWA 3I2HA 1CJPA 2VBPA 4FPOB 5FIXA 1ZVFA 1RUH3 4XJZA 3ZXAC 1QOSA 1SQ4A 5L7OB 2MNGA 4NVPA 4W6WA 3THPA 3ZIXA 4IV3A 2RR11 1S2BA 2ZXQA 1JYTA 3FZ3A 3WOGA 4ZZ5A 1IPSA 4XMIA 3O0VA 3GBGA 4FXKB 4XURA 4BE3A 1UO9A 4ZU4A 1CAWA 1JH5A 1I5ZA 3ZVXA 4GMP3 3SCFA 3LEKA 5KHKA 5I0SA 3SKVA 3WF3A 2W1WA 3GZEA 3BVCA 4YZ3A 5ABJA 1GOHA 1FXZA 2RJKA 3O0XA 1FT9A 4DRRA 1F5JA 3ZN5A 5FO8B 5JOWA 2VUDA 2IXIA 3RJ2X 2NP0A 4IV3C 4DUWA 3WG3A 5GKAC 4OUEA 3WUCA 3IDBB 4QM9A 2EIDA 1K5MB 1WD4A 2HWB1 4CCOA 2RS31 4WM7C 1RHI2 2R062 3N7JA 4Q29A 4YVSB 3WP5A 1GZTA 3DV8A 1OA2A 1H2KA 1RUG1 2TEPA 1A78A 3OG2A 4Q4Y2 5D1IA 4AL9A 5ABJC 2FCUA 2CV6A 5A1AA 2WWSA 4K40A 4L97A 3ZXDA 2GNDA 3EXUA 4Q0PA 5FP8A 2WC2A 2YPDA 4UW3A 3ZKUA 2RS51 4Y1ZA 5J1XA 1QDOA 4BLJA 5A3PA 1QGLA 1JHJA 3GJBA 4KI5M 1QJU2 4QU1A 3POSA 1OA4A 2DUPA 1RUJ1 5GZDA 4D7YA 2IFWA 2P3YA 2BGPA 1ULFA 1WA6X 4QDQA 3AP5A 4Y1XA 2F6BA 1RUE3 4Z07A 1ZREA 2BGOA 3UV9A 4QDRA 3N7MA 3I3EA 5FZFA 5C9AC 1OKOA 3HN1A 1DYPA 3FLPA 2Q30A 3IMNA 3FX3A 3IZOA 3JB4C 4I3PA 5DUVA 3VBFC 1AXYA 3VZMA 3U0ZA 2GAUA 4MGYE 5FAXA 2I74A 4HMZA 1DF0A 5K4LA 2CSGA 4YZ2A 4AQ2A 5JPMB 4EV0A 1FI2A 1R1ZA 3H50A 2ORZA 4CDQB 1QNYA 2HLEA 3ROUA 4BQ1A 1RVF1 4AVTA 5EJZB 2VUJA 3LF7A 1UU4A 4WV8A 2O14A 1MR5A 1UX6A 1FX5A 3ZN6B 3PTYA 3KF5A 3POFA 5C3OA 4LO5B 2XJTA 4YW4A 3ELNA 4GA9A 2VZQA 3O12A 3T3YA 1N1VA 2NYYA 2CWSA 4KH9A 2EXKA 3JBG1 4LQRA 4N90A 3VGIA 2Y26A 5FTTC 2CWMA 4A41A 4F8AA 3WNMA 3OUIA 1XYNA 3WW2A 3BTAA 4CEWA 4KWUA 4DOUA 2EAKA 2Z42A 1AR82 3AP4A 3HT2A 2AR6A 4RD7A 4CE8A 4DY5A 3LEMA 1R091 4QKDA 1TMF1 3JQXA 2OXBA 3WUDA 4CUCA 4NRPA 1RC6A 2JDUA 3S57A 4OZXA 3M1HA 1XYPA 4KWKA 1ULCA 1BLZA 5T50A 1HXS2 3ZLIA 1OUSA 2Y34A 5FYUA 1G9FA 1IPKA 2ZGLA 5F5AA 3UKTA 5L9RA 3QLQA 5JI7A 3M3IA 4YZ4A 1J3QA 4DUXA 4NN0A 5GJ6A 1RINA 1AR62 1SCRA 1C57A 4CEWC 5D21A 1QIQA 4AI3A 2BNNA 4L2NA 1CZVA 3RYPA 1AR71 5FYMA 3RRDA 1HJGA 3PJQA 4IEXA 4LO4B 1BCXA 3I2KA 5GALA 3LDRA 1AYN3 2I45A 3VBHC 3W5NA 4JV4A 1O6UA 4IE4A 5CIRA 1PNGA 2XHKA 3B94A 2WDBA 3A0KA 4H55A 1W9YA 4KG0A 2FMDA 1HQLA 2E6VA 2AYHA 4W6XA 2VAUA 2DVBA 3W58A 1W2UA 2PAMA 3O5SA 3NV3A 3ACLA 3ZXGA 1EPWA 3RI8A 1SBDA 3T0BA 5BNPC 4O61A 1O4TA 3WXPA 4WM7B 5JSRA 2RMU2 1XNCA 1AYM3 5JMOA 5DMYA 1O3TA 1IGOA 3UKVA 3O14A 5AC93 3WR0A 1HW5A 2GNMA 1RB8G 4EN6B 1ULDA 4GWIA 1RITA 3H7YA 3PIJA 2KM2A 3ZDVA 5ABJB 1R083 5JXJA 2W08A 1C3HA 1VP6A 2VNVA 1FMD3 5KXEA 4UW5A 2W0XA 5F3IA 1PGL1 1WLTA 2Z4FA 1TME2 3H3UA 1MZ5A 4XDPA 1H0BA 3N3HA 4XABA 3S0MA 3WP3A 4CP2A 2EIBA 1EP0A 1R64A 2ZHMA 4XCBA 2OZ6A 2F4LA 5C8WA 1S0DA 1HLCA 4P9LA 3AZXA 1IKQA 2WN3A 3PMEA 3MIEA 1O59A 1ZRRA 4LBOA 2V5YA 4K20A 3USUB 1PO11 3EHKA 2ZEXA 4JC1A 3GM8A 2WT2A 3VD5A 3D0JA 3NKGA 1KDMA 4COZA 4Z2AA 5C9AB 3MBWA 3NRUA 4AAXA 2W68A 2VZPA 3VBFB 1ZA7A 5FYYA 1Q8PA 1V6IA 5KBFA 5KHJA 2Y38A 2WBKA 3MFAA 4Q4X1 3UKNA 2V4AA 1YFXA 1GQPA 4PJYA 3VL9A 3VUOA 2R49A 1WBLA 2WJSA 1N3QA 4H3WA 4O65A 3R0RA 2RM22 3FN9A 4IDZA 4RFRB 5K8SA 1J83A 1X50A 5FZ0A 1YWKA 1OH4A 4PQQA 2CGOA 1QJZA 1AX0A 2AENA 1BYHA 5DZFA 1MS0A 1W2TA 4MGIE 3KHCA 2PYTA 1D2SA 2JE7A 2VCMA 5ACA3 3KSCA 5A70A 2GDFA 2PLV1 5I0TA 4AVSA 2UWAA 4PDWC 1X33A 2E7AA 5CG9A 5J98B 4EWAA 3AZYA 1HRV3 2VQAA 4BQXA 3HR9A 5FUNA 3GCXA 4FPCA 3MZHA 5CB7A 3I8TA 3NNJA 1D2QA 2HWD1 3PUHA 3DKWA 3TN91 1DQ4A 2A6XA 2R7EB 4DY3A 4B7EA 1YFYA 3RZZA 3MF6A 2EXIA 2ZMLA 3M3CA 4JZRA 1QDCA 2JDNA 4JGYA 2P3JA 4FAHA 2HYXA 1Q5OA 1W9TA 2E33A 5EYYA 5L9BA 4INDA 1BHGA 4BK4A 3IIAA 3OOXA 3S5AA 1BK1A 5C3RA 2RDQA 4AQ6A 1H8TA 1POV1 2A3XA 2BDRA 2YXSA 3B00A 5FREA 4CEWB 1XB9A 2G9FA 4I09A 4BIFA 3VDAA 3KVBA 2Y6JA 3TEYA 4A42A 1GANA 2Y8KA 3F95A 3KLSA 2O1QA 2ZEYA 4U36A 4AFDA 2HWE1 3T09A 2IXLA 2QZ2A 4QQOA 3BIWE 3VBHB 4WVMA 3W5MA 4MVTA 4P9GA 5LBBA 4ES9A 5KXCA 3CIHA 5HPOA 2D98A 1UOBA 1NXD1 4C91A 4M4PA 5FYVA 1NX9A 2KD7A 2OQ6A 4FTSA 2WZEA 1H8TC 3MF9A 4EQVA 4Q0SA 5A3WA 5BNPB 3LEIA 2W3JA 2W5FA 5C7GA 1HJFA 4LKDA 4Y33A 4M3CB 3V64A 4QU2A 5I8SA 4OYUA 1VBC1 4IW3A 4XUQA 3VHPA 4XMAA 1QJEA 1OH3A 3NNLA 4F83A 1XE8A 2VR4A 2BW8A 4QXHA 1G7YA 2ARBA 1CN1A 3L2HA 2MEV3 2JKXA 2QQUA 4FPGA 4TLFA 2IUWA 1J84A 2WT0A 1B35A 1PVC2 3CEWA 1ZA4A 4E27A 1VJ2A 5HCBA 2Q1FA 2VMCA 1LR5A 3MIHA 2EVXA 2A3WA 4NAMA 3EO6A 1AR92 1BEV3 1YEWA 4QAWA 5F5CA 5FV3A 2XKOA 4BQ2A 5JZGA 4SLIA 4XBNA 5L9VA 1I5PA 2VMIA 1MS1A 2JD4A 3CQOA 4XFHA 4A4AA 4UI9L 2XVLA 2AZ5A 2JG8C 4KMQA 2WAOA 1ULGA 1D4M3 5ANNA 4DXTA 2XQRA 1B35C 2RS13 1BQPA 3ALQA 4QKFA 5LA9A 3FHAA 2QQPA 2RHPA 1ZBE3 3AJYA 4JKMA 4BMBA 2A7AA 2PN5A 3O1PA 2HEWF 5A32A 2ZCWA 1UU6A 1QH6A 3RZKA 2WWJA 4UF0B 1IKPA 4HVOA 3T4VA 4BQYA 5A3UA 2X53S 2ZGQA 3JD73 4FP2A 3FUOA 5C4WB 1HB4A 4P9YA 5JZGC 4FSJA 4Q8KA 3ZYIB 2HYKA 2FMYA 3M8LA 4P02B 1S0IA 3HT1A 1NE6A 1RHI1 2R061 4BA6A 2YHJA 1V9U3 4K9SA 4LMFA 4PDWB 2EXHA 1SLLA 2VOKA 1ASJ2 1C8M2 2ZAHA 1MVQA 2VXRA 4Q4Y1 5FYCA 4E2SA 2VZ1A 5GLWA 3RDIA 2VBDA 4IEQA 1NLSA 1J3PA 4MSVA 5BNQA 1N1TA 4BWOA 1FOD3 1RUOA 5IAVA 2VQ0A 4M01A 3UGHA 3AZWA 2XGXA 1L3JA 2QE3A 4UFIA 2WQ8A 1SLCA 1AYM2 2MPFA 2WR9A 4CDUC 1OA3A 3PUQA 5AC92 5DAWA 2VVEA 1UMIA 5KC6A 3NKTA 1QJU1 1VMJA 4FQ4A 4BIOA 1S1AA 1SHWB 5KHHA 4ZS2A 5FK8A 2R1DA 4HKWA 5FY7A 2NQYA 4GAZA 1ZRFA 1W6QA 1OFNA 4FPLA 1W90A 2XLAA 2HBUA 3OY8B 1NQJA 4H7MA 4FT8A 4NIDA 1REEA 2FCVA 4LBNA 3N9NA 4FFIA 4MGTA 4HXCA 4P14A 4MO3M 1OHFA 1TE1B 3CZUA 3OJBA 3M3OA 4GJYA 1PNFA 4IEYA 2C0ZA 2DF7A 4M4RA 5FZDA 1VBA3 2D93A 3T0DA 5IWFA 3W21A 4G4FA 3U11A 5LRSA 1NKGA 2ERFA 2WA4A 3M7AA 4GALA 1ONAA 4MXVA 5EIYB 1GP5A 2EIGA 1BKZA 3SEPA 2JDPA 1CAUA 1GKBA 3ZR6A 5IFPA 4XQ4A 4TN7A 1MEC2 5FPXA 1KFUL 5EHDA 3CNAA 3CLPA 2BRTA 1PIV3 1AR81 4JRAA 5F5IA 4Q27A 3DUIA 4RGAA 3M2MA 2VZ3A 2LRPA 1DFQA 1BMV2 1N1YA 1W9SA 1OQEA 2BNOA 2C1FA 3MFCA 4PBPA 1LOGA 1J58A 4URTA 4Y4YA 3TRSB 3ES4A 4OHZA 2A1XA 2VCBA 1SG3A 5EQUA 1HXS1 3SH3A 3WNNA 1WLCA 3LDBA 4Y1UA 5FXWA 4A45A 4HSLA 1YYNA 4LHNA 5GLZA 4ZKTB 1NY72 3WNOA 4LXLA 2WFF1 3K51A 2NMNA 1IQDC 3LA7A 3PU3A 4BZ4A 2DYCA 2PAEA 2YZ4A 3SHRA 4BLIA 4D8MA 1AR61 3Q8EA 3MW4A 2WZPP 3RSJA 4YARA 2A6ZA 1AJOA 4HZFA 4N9HA 5DG1A 5A3OA 1OOPA 4IL7A 2ZABA 1KD7A 3UGGA 1V6MA 1DZRA 3ZFEC 3CKHA 5LBFA 2JG8B 2I07B 1UOFA 2VE1A 4G9SB 4HONA 3O1SA 4Q4W3 1C5IA 5DDJ2 2ZGKA 2AEZA 4NUBA 4FPKA 5FK7A 4AGRA 2GU9A 1ZZ7A 1YLLA 4XTMA 4IQPA 1Q3EA 1HRI3 3VZLA 2R073 3EMRA 1VAKA 2A70A 4XZUG 1R1A2 5FRAA 5H9PA 4HLTA 4AEDA 3JZVA 1MS9A 1CAVA 2DCKA 3MIDA 2DCJA 5EJ1B 1OT5A 1X8EA 1YXWA 1OOPC 4CDWA 1OPMA 4BXSV 5JZGB 2HH9A 1WW7A 3BCWA 2TNFA 2XOMA 3IB3A 2RMU1 1GQGA 1RUC2 4JDNA 4LO6B 3WINE 4E4DX 4LLFA 5C5TA 2DVAA 4N43A 5FMOS 3VKLA 3ZYHA 3RZHA 2Y0OA 1N3PA 2ZX4A 4FOVA 2VMGA 4NHKA 2ARCA 3K48A 2R043 3N36A 4FAGA 1PO23 3OBTA 3ASIA 3ILRA 3VBOC 2UU8A 3WF0A 1TME1 4AEDC 5JPNB 5C33A 2ZZJA 5F39A 5FPBA 3V65A 1OQDA 1LOCA 3K4DA 1T6BX 1W06A 4ISQA 2FDJA 2OA2A 4CDWC 4CDUB 4Z8BA 4MADA 1CPMA 3TB0A 4FPJA 4XETA 2EAAA 5BUVA 5LEKA 1JMUB 2VNRA 2ZKNA 2J1TA 3AL6A 4Y1YA 1REDA 3RMXA 1S4CA 4JQRA 4EJRA 2PHDA 3OCPA 4MHRA 2YPJA 3M70A 1GBGA 2ZACA 3MGUA 2VTFA 5FYSA 2B9UA 2VMDA 1JN2P 1UF2C 3D4KA 5FYZA 4ATFA 3T2TA 4Q5OA 4I3GA 2JD9A 4ARYA 1GZWB 1UYYA 3B5LB 3N9OA 1X9TA 3R4SA 1OQ1A 1GV9A 2RM21 3ACIA 5JMCA 1JZ4A 1HKDA 1GNHA 4XE9A 4NWVA 1F35A 1H1IA 1URXA 4O7XA 1RIRA 4MZUA 5IATA 1WCKA 2ZPXA 3KS7A 5FJHA 2DUQA 1W3VA 2NMOA 2RS12 3J26N 2JDHA 1K5MA 2VW0A 5LRRA 3O1OA 1FNYA 2TUNA 5DXDA 2OPWA 5K0UA 4YVSA 3LSEA 4YNIA 1UY2A 3E97A 2ZX1A 1B09A 4S2GA 2WNEA 4IE0A 1FPN2 2JICA 4XCAA 4BQ4A 2WO3A 1WCDJ 1RUD3 3VN4A 1GYKA 3BODA 3CDZB 3E6BA 4IGQA 5L73A 4AW7A 3NW4A 3AMPA 1UY3A 4RHV3 5FOJB 1OD5A 1YJKA 3ETPA 5DAVA 1XBFA 1CAUB 3A7QA 4BK5A 1PM4A 1PX3A 2ZBJA 2Q8EA 3C8XA 5FOBB 4JHTA 2PHWA 5IVFA 5K0UC 1UMZA 1GWKA 3NWKA 4ZS3A 4U2AA 4N7IA 3K46A 3ZMNA 3ZFFA 3A4UA 3ZFEB 4D6SA 1RUI2 1UW8A 4FCAA 4IE7A 2WNUB 4BCUA 4AFBA 3ZYFA 4A3XA 3VV1A 3H8RA 3AC0A 3K3NA 4Y20B 1TZOA 4HKOA 3RWKX 1IS3A 3KT7A 2VTXA 1UZZA 1NZCA 1Y9GA 4JCKA 3JUUA 4DNYA 1OF4A 1S0FA 3IWZA 2WZR3 1ZZCA 3VKNA 4PLMA 4XF4A 1JYCA 4AI0A 2C4XA 1OMIA 3RI9A 4K8FA 3ZSMA 1OOPB 5A3MA 2UURA 3MPPG 3ZFFC 2BP6A 4RR3A 3O1MA 2CGNA 1RTVA 2V5DA 2RE9A 2WSUA 1RXFA 4BISA 5HCHA 1VBA2 4QXKA 1WMDA 1CIYA 3VZKA 1YNAA 3VHRA 4DXZA 3AMHA 3TEZA 3U37A 3IDEA 2WO2A 2OPKA 1HN0A 2VMEA 2R6QA 2XWBB 4AEDB 2JEMA 3GBFA 5FO7B 4I02A 1L7RA 1UIJA 3AYCA 1PVC1 4CDWB 2ZJCA 4EYUA 5F3CA 1LESA 1EAH3 4JHZA 5JSOA 4RR3C 1PIV2 1DQ0A 4RGKA 4YW2A 3DPRC 1LULA 1NCRC 4META 5F3GA 1AR91 1RUF3 4LO7A 5FZOB 1VBE3 3MIGA 1NXMA 4XFBA 1DLCA 2WS93 3GXUA 4CUGA 2N7GA 4H14A 3PIGA 4B4RA 1KS4A 2VOVA 2D3SA 3MO4A 1LGCA 4ISRA 2VOTA 4XXPA 3CBNA 1XE7A 4YW1A 3NAPC 2TBVA 1UYPA 4I30A 4XIKA 3ITQA 3B7MA 1QOOA 4AYUA 3I54A 3AVRA 1QJY2 4QDSA 2P6CA 1XU2A 1G9AA 1QHDA 2YC2A 1UZWA 2YBPA 1G8WA 3O7OA 3NJZA 4IUGA 4XUTA 3ZFGA 3HOBA 3TEXA 1SACA 3W20A 1VR3A 3HNYM 4TLGA 4WM7A 1V6KA 2R072 1ASJ1 1C8M1 2D5FA 3BOWA 4J6GA 1MS5A 4NAOA 4P5HA 3WCRA 1OLQA 1U5YA 2AEYA 5JR7B 2OKXA 4CRQA 2YC4A 3I3MA 3WF4A 4AI9A 3ZSEA 2FDKA 2B42B 1OVPA 1V00A 2QQWA 4Y4RA 3KD4A 4QT6A 3ZX7A 1AXZA 2ZOEB 4OULA 3PNAA 1DGRA 1BK0A 4NO4A 4GD4A 1AYM1 1E5IA 2PELA 4NPMA 2XLFA 5AC91 1JYNA 3N35A 1CJDA 1C28A 1UL9A 1US3A 2ZGNA 5A6ZA 3ZFGC 2W94A 1VAVA 4L99A 4L92A 3ZMOA 3ZXKA 2R042 4KNCA 5GZCA 2ADDA 5K0UB 3BIEA 1PO22 1O7FA 2A71A 3FBMA 5K7PA 3USUA 3O1VA 5L36A 2XPJA 1GUIA 5C9AA 1HX6A 2P5BA 3VBFA 5CAZA 2QQIA 4OMDA 2W92A 4WBBA 1NQDA 3EB7A 4NMIA 4BYYA 2XJSA 1JYXA 3M4FA 3ZPYA 1IOAA 1VALA 2R0FA 2YFZA 2Z5WA 4HVRA 4RQPC 4Y1VA 1XJAA 2HBTA 4NIAA 2WQ4A 3D8CA 3SMHA 3J7NA 2E63A 2VL4A 3D82A 3HIFA 3SNMA 5C5UA 3OSDA 5T54A 4YW6A 2A3YA 4R4ZA 5FZLA 3ZFFB 1ST8A 3MLJA 1SLBA 1W6OA 5HBAA 1MEC1 1U5IA 5F9TA 4A3ZA 2NZ9A 4LOSA 4XILA 4NHYA 4I01A 5FZIA 2WLQA 3KV4A 1KQRA 2UY8A 5FZHA 4QX0A 3A22A 1AHSA 3T2OA 1RMU2 1XU1A 4LKSA 2D40A 5JXIA 1ZZBA 2EIEA 3ME2A 4ZXEA 4YPJA 2W47A 1JS9A 3O1UA 2Q4SA 3ZXJA 1W9WA 3R05A 1ENSA 3N7KA 1Z7S3 5E6HA 2P37A 2QCSB 3HPNA 3PUAA 3U4XA 1POQA 4TZDA 3GZAA 3EQEA 3WNXA 1WGPA 1NY71 4YLZA 2HWC3 1W05A 5A3LA 4RR3B 1DYKA 3DPRB 5FYIA 3ZO0B 3USSA 1NCRB 3VHNA 4YFZA 4LPLA 3ACHA 3ZXEA 1VBD2 4PCRA 3UT0A 1RUD2 3WW3A 5FDBA 1W28A 2Y6LA 1XSRA 2Y6HA 3KGZA 5DZEA 2G19A 3PUSA 2WT1A 1W6NB 3FHIB 2W2IA 3C3VA 4QXBA 2NM1A 4W65A 1O4ZA 4NROA 1ZBA2 1WBFA 2B4KA 5DDJ1 5JIUA 4OHYA 1MS8A 3CZJA 1ZRIA 3Q8BA 2ZHLA 2ZX3A 4PI0A 4YG6A 3VBHA 5DUXA 4CP1A 5KR7A 5LW9A 2EA7A 5FLJA 5LY1A 3IT8A 3MYXA 1DBNA 4WM8A 2Y60A 3NAPB 2JENA 3MHZA 3LSDA 4BDVB 4MG2A 2WFF2 3ETQA 1R1A1 1GWLA 2Y6FA 3GYDA 1IZ3A 1CESA 5SV5A 2ARAA 1K3IA 2VW2A 4IE5A 2GC3A 3KGLA 4EROA 2EXJA 4AZZA 2RJ2A 4HK9A 2BOIA 2ZEWA 2X8KA 4PLNA 1RUC1 3VZOA 5BNPA 1WLWA 5F32A 2FZ2A 1OXCA 2D6OX 4QPIC 1JBCA 3DECA 3POYA 4M3CA 1VBB3 3LZZA 4AEJA 5IVYA 4M3CE 4CCLA 4QB2A 5I0UA 5IUQA 4LLOA 2O0OA 4WM8C 3MICA 4Y22B 4B8EA 4EN9B 1C5HA 5JXGA 4YRDA 1YRZA 1UMHA 2W1UA 1DP0A 3WQ1A 1BBT3 2RDNA 4MX3A 2VJXA 4ARXA 1RUNA 5FZ8A 3LA3A 4NHMA 2E7TA 1VMHA 5JIAA 3ZFGB 2YBKA 2BQPA 3B93A 2LS6A 1BJQA 5A7WB 1ND3A 4IEZA 1MPXA 1EV13 1LTEA 3HEIA 2RR13 1Q43A 4PQ9A 1FNZA 3HN3A 3AL5A 1OURA 3PVNA 4XJ8A 4YM1A 4LKFA 3RZMA 2VECA 5FO9B 1XSQA 2BNMA 1NA1A 4HL0A 3C7HA 2PQQA 4FOYA 4KL1A 5FLHA 1S0JA 5FZ7A 1DDLA 1AL22 1ND2A 1DG6A 3P5BA 4N53A 4DRVA 5LEJA 3S5QA 4JKLA 5BNOA 2FDIA 2DV9A 1NOVA 3LGRA 1T6GC 3FE5A 3T2PA 1UAIA 1VBE2 5IVVA 4RQPB 1DQ5A 1EYBA 2WS92 2ZAAA 2ATFA 4LORA 4TYSA 1ND3C 3E5XA 1PMIA 4OHVA 3WDUA 1UZYA 4UF0A 2Q0AA 3NVCA 3S6PA 3TEWA 2XXZA 4XHBA 2RS11 4XDOA 5C4WA 2BVVA 2P2KA 2HWB3 4ZXKA 1NA1C 2IVJA 4IEVA 4KGQA 3AB0A 4EN7B 2WWUA 1ND2C 3UGFA 1HV1A 2DVFA 2GALA 3H1WA 4N53C 2C6SA 4NJ4A 4PDWA 5BNOC 1UXZA 4KU8A 1SBEA 5HCFA 1RUH2 1RUG3 1ACCA 1UWWA 4AVBA 5EJ3A 5T3NA 3FWEA 1KS5A 2GN7A 3LDKA 1FPN1 4FPEA 4ZONA 3R6SA 1GNYA 3IM0A 1JZ8A 1AUYA 1WCSA 1DQ6A 2CAVA 1C1LA 3CMGA 3U1XA 4X8NA 4EZ4A 1XNBA 3WG2A 2AH2A 2RS53 3VBUC 4JDMA 4AGGA 5C4WC 3I2DA 4HOOA 4OI2A 2XQXA 4OI4A 5AVAA 2DFBA 3VB9A 2K2SA 5I91A 4GB33 1W6OB 2GC2A 5DN2A 5EWSA 5FZCA 1ULEA 4UFKA 1W04A 1A6CA 5FJKA 3SEEA 4BH9A 2LROA 4LT5A 1W9FA 4KGGA 2B8MA 2KXLA 5CFDA 3OY8A 5HV0A 2D6PA 1U5ZA 1RUI1 4GZ9A 4QQPA 4QQ2A 3HMYA 1WLDA 4XHXA 4IGPA 5A7NA 1G9CA 3U10A 4D69A 3U4SA 2D6KA 5I0DA 2P6HA 2BOJA 1LB2A 2A6YA 3BALA 4QX7A 1KXGA 1I3HA 5K9YA 3AP6A 4JTOA 1YFUA 4QHZA 1WUVA 3HNBM 4Q4V3 3V0BB 1ALYA 1Q8QA 1RVF3 4TSVA 2Q8OA 3DYPA 3J7HA 3VDBA 2VH9A 2O8OA 3KT1A 4WVVA 5CFDC 5FYTA 1JUIA 1F5FA 2VZVA 3KV6A 3SXWA 3FFQA 4XIOA 4OI0A 1SPPA 1VBA1 2ENRA 4QPIB 4LR4A 4H2AA 1QJFA 2B5HA 4LOTA 4QHOA 4CXXA 3SISA 5LB6A 1Y3TA 3AVSA 3ES1A 3OEBA 1LEDA 4UAPA 4WM8B 5CFCA 1RUE2 1W6PA 2V4VA 1STMA 1D0GA 1A8DA 5E88A 5JWPA 1O5UA 3LB9A 5T52A 1XNDA 1LJ7A 1H4GA 3Q8CA 1NLQA 4FQZA 2VXJA 1PIV1 2QNKA 3FFZA 1YUDA 2VZSA 3R4DB 4UT5A 3T1MA 3UJOA 4BM8A 2B45X 2IC1A 1F15A 2CAUA 4YM2A 4HT1T 3SCGA 5J36A 1N3OA 1CD3G 1X7NA 2FZ1A 2W9XA 3GHMA 3WCSA 4PBOA 3OPZA 2D97A 5LBCA 4EWDA 2QFEA 2VPVA 5CFCC 2H0BA 3IDCB 3NMBA 5FZ6A 5H9SA 2ZGSA 3H1YA 1ODMA 4RN5A 2JG8A 1PK6A 1DHKB 4IE6A 4KWLA 3VBOA 3WDYA 4FVVA 4IEOA 1UOJA 1ZX5A 4UOJA 1X8MA 3LWCA 4M3CF 1H6XA 2PXJA 3FLTA 2JB4A 4DXSA 2VCAA 5A1LA 3WDXA 1Q8VA 1ND3B 5FZKA 2PQSA 3ZSKA 5HI0A 1J3RA 2EALA 1Q8SA 1QXPA 1QJY1 4OQ8A 1SFYA 4GH4C 1SLTA 5IVCA 1UNBA 4AHXA 2LALA 3D5OA 5JAXA 1NA1B 1W3XA 1ODNA 4YGBA 1ND2B 2QDNA 1WWYA 2R071 3PDQA 4N53B 1PK6C 1CONA 1OD3A 1W0PA 2CHHA 1H2MA 3PVEA 4IEPA 4QPGA 1C8NA 3SH4A 3ZOIA 5BNOB 1CPNA 1X82A 5CG8A 4QX5A 2RDRA 4PT6A 4C0BA 1XXNA 5FZ9A 3FMGA 4E4ZA 2Y64A 5LBEA 5T55A 2CNAA 3GALA 5BPXA 4YSFA 4XTPA 5GLVA 1I1EA 3I3DA 1NE4A 3MLLA 1LOBA 4MYEA 4CCMA 1AYN2 1VRH3 2D6NA 3RQ0A 3TNQA 3VBUB 4HKLA 4CDUA 2XJRA 4COWA 5CEHA 2X29A 4JKKA 3UK9A 4OFGA 5B4XA 4Z1VA 3H8OA 2R041 4QPGC 2D3RA 3H3ZA 1PO21 5BNNC 1V6JA 4H7LA 4Y5Z0 1PO13 3LAGA 2VY0A 3AFKA 1NZIA 2GC0A 2QZ3A 4E9KA 2ORXA 3RS6A 2NN8A 5C8CC 1Q8OA 1OF3A 1U12A 2A73B 4Q4X3 1XQNA 5IT6A 1DGWA 1EV12 1O5LA 4D7SA 1GZWA 2CYFA 2E31A 1GQHA 1CVNA 2BV4A 2V72A 4Q1PA 4IGOA 3KF3A 3PL0A 2K0GA 4R9BA 4UW4A 1R082 5FP7A 2SBAA 1YIPA 2X5IA 1PMHX 3H9AA 3PUIA 1FMD2 1LU2A 4IERA 3ZR5A 1VB2A 2R1BA 3LEGA 1JHNA 4OZOA 5J3UA 1COV3 5CFDB 1UY1A 3D3AA 3I3QA 1AL0G 1QH7A 4UW6A 5CVRA 3LPFA 5C3QA 1BVP1 2JIJA 2PLV3 4ASMB 5F6KA 1LAJA 2QQKA 3ZYPA 3WHTA 3J7LA 3EBRA 4FFFA 1DU3D 1KEXA 2LUWA 5KC5A 1RMU1 3RWNA 2BJSA 4GKYA 4HBNA 2HWD3 2P17A 2X5IC 3TN93 4LITA 5A33B 3WW1A 2B9VA 1DCSA 2IXCA 2ZX2A 3PU8A 4R9AA 4GKXA 5E8AA 5FUPA 1LKNA 1HDKA 3KT4A 4CDXA 1SPPB 4CCNA 2QTWB 5JOZA 3AP9A 1QY4A 1VBD1 1RUD1 1IS6A 2WKKA 4CCDA 4LE3A 4AWDA 4BJ0A 1WMFA 3LPGA 2XL7A 3PVOA 1BZWA 5C3SA 3VD4A 4XAAA 5FPVA 5CFCB 1W6PB 3I2FA 3ZFEA 1ZBA1 3NQHA 2UWBA 5LATA 1GR3A 2ET7A 5ACA2 2WNUA 3K3OA 5L19A 4CZSA 5JOXA 3GF6A 1TEIA 4Y20A 4QPYA 3IIIA 2CDOA 4MGZE 5TSWA 3QBQA 1CZTA 4WVZA 1HRV2 1BVVA 2BFUL 4ORFA 5DZGA 4CDXC 4CCJA 4MLOA 3H8UA 4CP9B 4HVQA 3V0AA 5FY8A 1ZYBA 3OPTA 4XJWA 3WX5A 1HQNA 2PHUA 4QKNA 4QD2A 3ATGA 3E5UA 5LK5A 3APBA 1V6LA 1IS4A 1LOAA 1P8JA 3MW2A 4GH4B 4QHBA 1SCSA 3LIHA 1LCLA 1PZ7A 3AK0A 4KBZA 5A1FA 1GZ9A 2E51A 5A7SA 2D5HA 2RJLA 2WNUC 1PK6B 3VBOB 4F7ZA 1JOPA 4Q4V2 2YYOA 1DIWA 4EWEA 3HVDA 1MACA 4XW3A 4GWNA 3WY6A 5B2GB 2QUOA 3PLQA 5FY5A 5FKCA 3QACA 4HK8A 1WW5A 1MVEA 1WCQA 5IK4A 4RS5C 5FYBA 4YYOA 1DYOA 3JB8A 3OB8A 3GCWA 4QX2A 5C70A 2DUOA 2YV8A 4HN1A 4L8QA 5GZGA 2YUEA 3B69A 4FTBA 3I97A 2DTWA 5T5JA 2DU1A 1DGLA 4QPGB 1W8TA 2EF6A 5BNNB 4OHWA 4AR2A 4G3YC 5H9RA 2DTYA 1POV0 5D8AA 3H3LA 2P3KA 3KV5A 5FZOA 2V09A 4UFJA 3VL8A 4LK6A 1WA4A 1S2KA 4FOWA 1QJX3 4NRQA 4OVEA 5HXVA 4YG3A 3VBSA 3AYEA 1A34A 3ST7A 1AL21 2HKXA 1G6NA 4LIUA 4LHSA 3X29B 4QM8A 1HB1A 1HQWA 4AEKA 5C8CB 1JYIA 1H6YA 1MQTA 2G9GA 2CGPA 2OT7A 4XAEA 4LBKA 1APNA 1E5SA 1VBE1 4S2HA 5F2WA 3ZYJB 1F4HA 1TVGA 2WS91 3TNPB 3AX4A 1HN1A 1QKQA 4AI2A 3BYWA 1OC1A 1UPSA 2J42A 2UYAA 5D8AC 5JSPA 2BPA2 2MEV2 2QDRA 1NAEA 3NJYA 2QQVA 4UFMA 1J59A 1QQP3 2ZGUA 3VBSC 2R30A 2R063 4ZY9A 1RYYA 3VLBB 2CU5A 3QH6A 4TXWA 2UYBA 3E5QA 2P1BA 1PVXA 1RUH1 3CO2A 1MQTC 3POEA 2VMHA 1LHNA 5LASA 1W8FA 3AYAA 4UXAA 1BEV2 2RVAA 2XKPA 3KQ4B 3ZSJA 3ON7A 5JR2A 1O91A 4AHZA 5KHGA 3VZNA 1W2OA 2X5IB 4GWMA 4LBJA 4BQWA 4MUVA 1DQ2A 3WG1A 3FUQA 1YQ5A 4GMP1 2AREA 1ZZ9A 1D4M2 3CU7A 4DFSA 4NRMA 4C0HA 2WLPA 5KWRA 1QJU3 1JTZX 2JDAA 2VG9A 3DXTA 4YVWA 1RGSA 1ZBE2 3NJXA 4NIHA 5F5QA 3WDWA 5ANQA 4D94A 1PZ9A 1OFSA 4BMEA 3BUCA 2H0VA 5IW0A 2P34A 3I59B 1VRH2 3HQUA 1LHVA 3JD72 2XBO3 2JECA 2BBVA 3EJKA 3OD4A 3DCQA 5LWBA 3DL3A 1V9U2 4WVWA 5E89A 1K45A 5D2AA 3I3BA 5FZ3A 3P1IA 2HWF3 1RXGA 2OIIA 2WL1A 1VIWB 4YVWC 4CDXB 5C6CA 2YG0A 4QGNA 4YWAA 5EV7A 4CEYC 2VM9A 2OX0A 1FOD2 5I8TA 2NPIA 5JLVA 4E2GA 2P4EA 2ZMNA 2VCCA 4A6OA 1FYUA 2UWCA 1O8PA 3OD0A 2D7FA 4CCKA 1E5RA 3NV4A 4QKBA 4AI8A 5DAPA 1LGBA 4AE2A 2DCZA 4KWJA 5SV8A 1SLIA 2I2SA 3L2YA 1U5XA 3GDBA 1I6XA 2SLIA 1RUE1 2BWAA 4XVHA 5FZ1A 1JW6A 2ZS6B 4DEQA 1COV2 3ABZA 3V0AB 4E4HA 4RS5B 3IAPA 2PHFA 1J1LA 2D6MA 5FFOC 1CX1A 1REFA 3NJVA 1HXS3 3I2GA 4FFGA 3RZLA 1QEXA 2D44A 2VNOA 4LA2A 4PIXA 4FI9A 1IG0A 2BERA 3MUZ1 3AKTA 1H8VA 2C5DA 5FZ4A 1OVSA 2VMFA 1FATA 3DPRA 1NCRA 2R32A 2VZRA 4K1YA 4XC9A 3VDDA 4FOQA 3K4AA 2PHTA 3GZUC 4X6QB 5G04L 4AF9A 1GSLA 1VE0A 1JYVA 1A3KA 1W6NA 2GMMA 4RA0A 3WSOA 1H1MA 4R8HA 3V56A 2XONA 2IXHA 2J1VA 1AF9A 3U14A 4B7KA 3HBKA 5BXXA 3ZIWA 4I0AA 4WZFA 4UFLA 1CAXB 3CF6E 1VMFA 3HWJA 1DZQA 1XRUA 3NAPA 1EY2A 4QX8A 3POBA 2J7MA 3MI8A 1GFF2 1SMVA 4JGZC 2JDMA 2A75A 4GULA 4RFT0 5DUUA 1C4RA 2Y6GA 4PI2A 5IFTA 3VDDC 2DVGA 3MDPA 5IAXA 1JZ2A 4PHZA 4R9DA 5D8AB 1VLNA 2E53A 3UETA 3VHOA 3B9CA 2RMU3 2JKBA 3KV9A 4W8JA 3RMYA 3VBSB 2B46X 5DPNA 5FZEA 2F4PA 4DEVA 4DZGA 1MQTB 4XUOA 5LZ6A 1AX2A 3TYJA 4QB1A 3FL7A 3ZN4A 5F7UA 2MHFA 3F2ZA 4Y3OA 4Y22A 2GZWA 3P6BA 3WT3A 1TME3 3LA2A 4OCTA 3THDA 5GM0A 4GJZA 1G9BA 2P3IA 5FXVA 4A7YA 3HJRA 3QD6A 1AYN1 3HQXA 3K77A 4MGKE 4Q4W2 4Y24A 5J48A 1YIFA 2GNTA 3OUJA 3MW3A 5T5OA 1ZRCA 3LD8A 1H4HA 4S2FA 2CTVA 3FJSA 5I93A 5T5LA 1AZDA 4MXWA 2WNOA 5DG2A 1HRI2 5A7WA 1PGSA 4R52A 2W46A 4AEMA 1HIXA 3KQRA 4P08A 2KR2A 1H30A 4KU7A 4XF0A 3MV11 4KQ7A 4ZU7A 5FPZA 4XJ9A 3H42B 1KJRA 1W99A 2DU0A 1OI6A 1W8OA 4MHUA 5A6XA 1US2A 2J1UA 4IETA 2C9KA 5ISLA 1EV11 3OEAA 4YW7A 1CIWA 4HPKA 4M0HA 3I2OA 1VB4A 2RM23 3J9SA 3LFMA 4L11A 4YVWB 4E8DA 2OYZA 4RQPA 1YQ8A 1R081 5FXXA 1QJX2 2QQOA 4CEYB 4A7ZA 3WG4A 1FMD1 3AFGA 3RZGA 2FBEA 3SKJE 1LENA 3AZVA 3S30A 3WEZA 4AFCA 4CXYA 4FO9A 4NHLA 4LBLA 2AC1A 4QGMA 2VU9A 1YI7A 2W52A 4I0WB 4NWWA 4LULA 2HEVF 3B01A 4D3WA 2PHLA 1GOGA 2BZDA 4R9CA 2D3PA 4AGVA 3LIGA 1OLMA 2YFUA 4AVCA 1OLME 1YC61 3ENRA 5DUWA 1UIKA 3ZYGA 3KCYA 4XQWA 1W6MB 1JZ5A 1QQP2 5IVBA 4IESA 4RL7A 5LCWL 2XLGA 5EFUA 3KMHA 1TG7A 3DN7A 1BMV1 1QOTA 4GQ7A 5JDBA 4AQSA 5EXOA 3U07A 3R4UA 4FFHA 1OSGA 2ZGPA 4PLOA 1G86A 2Q8DA 1UX7A 4AHWA 4B29A 4Q0QA 3ZYBA 4CXWA 1TNFA 1Y4WA 4ZPIA 3K4ZA 4OUMA 4CUAA 3GHNA 4CP0A 5I0RA 4ZHNA 1I9RA 1NCQA 2W91A 1F4AA 1GWMA 2JE9A 4UWDA 1W8ZA 5ACA1 5C3PA 5CZKA 3KWVA 1WMXA 4GB31 1LGNA 1S2EA 5A7OA 4C8DA 1UOGA 5FY0A 4P9XA 2BYVE 2ZX0A 3Q9OA 5FP9A 2JDKA 3K75B 5CKNA 5BV6A 5JUVA 3URFA 1HRV1 5A7QA 1LOFA 5F1RA 4E2QA 4JGZB 5LY2A 3V0BA 3VDDB 2XBO2 2W87A 4XFFA 3ACGA 4CVUA 4K1ZA 4GMP0 2VOXA 1PZ8A 2XVGA 5C71A 1SEFA 1GICA 3AXEA 4RHV2 5FQ0A 1NCQC 3SH5A 1UZ0A 1XE0A 3AMMA 1Z78A 1DGWX 3I7DA 1L7LA 2C26A 4AK3A 4BB3A 3QCWA 2VD7A 1KITA 2HWF2 3SLIA 3A23A 4Q4V1 2XHNA 4ASKA 1H9WA 4QPIA 1W03A 1YCIA 3KZ4C 4CU6A 5JI9A 1LOFC 5A6YA 5J37A 1ZRDA 2AGSA 1QU0A 3E1F1 1CGPA 3OYWB 5CADA 2FD8A 3LOBA 3Q8FA 3J8F3 3N9MA 2BEOA 1PVC3 4FTEA 3N9LA 3VKOA 5IVJA 1H2LA 4D7TA 3POIA 2GMPA 3DGTA 1G9DA 2IZWA 3MIBA 4Q26A 3ZPOA 3M3EA 2DVDA 4AVVA 4Z92B 2VBBA 3TBDA 1AR93 5A32B 4PIYA 2WZR2 5J09A 1W2NA 1JODA 3INAA 4DIQA 2XB6C 4Y5SA 1NYWA 3NNMA 4DO0A 3KHBA 5H9QA 4CA9A 1CWPA 3T08A 1D4VB 1XNTA 5JXHA 4OUSA 1Y9QA 1AJKA 2YGLA 4YGEA 3OPWA 1WD3A 3W59A 5FWJA 3N7LA 1X36A 4JRLA 1VPHA 1V70A 1UD1A 2JE8A 2WABA 4URAA 4MXWB 2YY1A 1HB3A 3ZDSA 1Z0HA 3RJRA 3BPSA 2XG3A 4LO8A 4V2WA 1W8UA 2HJIA 4QMAA 4V2VA 2MEV1 2DURA 4X6RB 1WMEA 3TWIA 4D0QA 3AMQA 3THCA 4ET7A 2ZGTA 5CU1A 4DS0A 4AXOA 3KVAA 1DZTA 2EICA 1EAH2 1QXJA 1ASJ3 1C8M3 2AUYA 2PFWA 4CU7A 3E6CC 4MV2A 4V1PA 2GNBA 4QXCA 4DINB 1SBFA 4CYDA 4IV3B 1BEV1 1GU3A 4HPKB 5IK5A 1RUF2 5FP3A 4EE2A 2BWCA 2VUAA 2KA3A 2XUMA 5KHIA 2YB7A 1IPJA 3H0OA 5J96B 1CAWB 5HXMA 5CNAA 1H2NA 1XPWA 3I49A 1D4M1 3I4IA 1DLLA 3VBUA 1YHFA 2OZJA
chains in the Genus database with same CATH topology
1ZBE1 2RS33 3IPVA 2GMEA 2ZKLA 3H1MA 3P3PA 4N9IA 4ATEA 4AQTA 1Y43B 3WV6A 3UL2A 4YM0A 1S0CA 1VRH1 1BXHA 3JD71 4M0NA 4P9WA 1SDWA 3NV1A 3WQ7A 2PTMA 2BUKA 1LU1A 1V9U1 3ZXFA 5IK7A 3HBZA 4UBGA 2Q1MA 3AJZA 1FOD1 1NG0A 1RUJ3 2PHRA 4XDQA 2QJVA 4DQAA 1GZCA 1ZNPA 3AP7A 1NCQB 3WZ1A 4FBFA 4XXAA 4XOGA 2Q5TA 4FPHA 1AVBA 1MEC3 1H1AA 5LK7B 5F6LB 4ONUA 1VAMA 2CL2A 1A8MA 3MEPA 1COV1 1PGW2 1AX1A 3LOIA 2JXAA 4PF5A 1J1TA 3KCCA 3KB5A 5A33A 4R4XA 1DGRN 2DWRA 5FQ0B 1XYOA 2O8QA 2ZGOA 4XFIA 3JBG3 2ZTNA 4RGGA 2ETEA 1QXRA 1C1FA 2WA3A 3VZJA 1ZZ8A 3S7IA 4HFSA 3BPZA 4JTNA 1NLRA 1R093 3CJXA 4K7JA 1TMF3 5DDJ3 3IN9A 2BVBA 2W39A 5AVPA 2G4IA 4LEJA 1LHUA 4LBQA 4Q0VA 1R1A3 4KG8A 2OUJA 1W39A 4COUA 3D6EA 3GNEA 4GH4A 1Z7S2 1AR73 1RUC3 2XJQA 4JGYC 3CJIA 1GLHA 2HWC2 2VNGA 2V73A 1S0GA 4LUKA 4NOTA 3ZSLA 3H7JA 2LM3A 2Z79A 4FPYA 2QKDA 4YZ5A 4Q4W1 2PHXA 2WIIB 2WNVA 3THTA 3CJIC 1V6NA 3VBRA 1HRI1 4XQDA 5E1RA 4Z2WA 4CTEA 4JAAA 5BNNA 2WINB 5GLUA 4C1XA 1WW4A 4E4SA 4YGDA 3J8F2 4AI1A 1SFNA 5FBZA 5IK8A 4HSJA 5FCCA 3P3NA 2Z69A 2JX9A 1QNWA 1JOJA 3OBRA 3O0WA 5C8CA 2DFCA 3AMNA 2R16A 3TAYA 1S0EA 2WNVC 1FAYA 1VBB2 3RPQA 3KCXA 4AVAA 1QJX1 3VBRC 3VKMA 4BOWA 3IPVB 3WD5A 4KBBA 4O9GA 3WQ0A 2OUHA 1LODA 4YW5A 2GH8A 4IXLA 2YC0A 3ZXLA 1ENRA 1BBT2 1E57A 4Q8LA 2ILMA 1YFWA 4MH0E 3WDTA 4NPRA 4XYXA 1FV2A 2XH6A 5E16A 3AKPA 4Q0UA 1MZEA 4GIQA 5T5PA 4BPZA 1FPN3 2BTVC 2RR12 4XBQA 5GZFA 1OLRA 5BYNA 4GXLA 1QQP1 2JJ6A 2OVUA 4PIZA 3LCPA 5AFBA 1ENXA 3BB6A 4I0BA 3AM2A 3RYRA 3AKSA 3JU9A 1ENQA 1ZZ6A 4M00A 4ZU5A 2FQPA 2YMZA 4YG0A 1PM7A 2VOWA 1F8VA 3PHMA 4A7KA 2WFPA 1RUI3 4YZ1A 5JVVA 3I59A 2BGCA 4QQLA 1IHMA 2HWB2 4J1WA 2RS32 3BU7A 3AKRA 5FMOL 3PVBB 1HV0A 4XF3A 3WHUA 4DMIA 1LEMA 1QWRA 1RUG2 2VGDA 3BOPA 4HETA 2B7YA 2GH2A 5I8YA 1KRIA 2XBO1 2ZMKA 2XL9A 2VVFA 4HN0A 1POV3 3SCHA 4IEUA 1SLAA 2WQZC 4RHV1 3WDVA 1RJ7A 1S0BA 1O3RA 5BY5A 4SBVA 4JGYB 2RS52 3OTFA 4EN0A 3WLUA 2HWE3 1CX4A 2HWF1 3AZZA 1GNZA 3WP6A 4GB32 1RUJ2 2A6VA 1IS5A 4J1XA 1H8TB 3WW4A 4AG4A 2CY6A 5CA6A 4LBQB 4IV1A 2H6CA 3AYDA 4Y26A 2JG9A 3A0NA 4ES8A 1KFXL 4B4QA 1M06G 4RS5A 5EZWA 3LKJA 3ILFA 1QF3A 1LHWA 1F2NA 1MZFA 4WVMB 3IKWA 3FBYA 3WP4A 2ZZQA 4K21A 3JCIA 4OLLA 4Q1RA 4DB5A 3CJIB 1O3TA 3AKQA 4XBLA 3VKFC 2WZR1 1VBC3 1RVF2 5FLIA 1UCXA 4IV1C 2E9QA 2JG9C 4FPFA 1O3QA 3OGJA 4AFMA 4K3UA 2ZHNA 3JBG2 1LOEA 4RSUA 2WNVB 1CAXA 1D0HA 1RJ8A 4JVAA 4LE4A 3VBRB 4OHXA 3NV2A 4LA3A 1R092 1JUHA 1TMF2 2VULA 4IEWA 1UN1A 3B9IA 1QJY3 2ES3A 3SITA 1B35B 4ASLA 2VVDA 1EAH1 1UKGA 2LTNA 2Q1ZB 3CL1A 2R0HA 1CQ9A 4LTAA 4I2OA 2FHRA 3POWA 4LUMA 1FV3A 1RUF1 1W0OA 3GBWA 1M4WA 4YW3A 2D43A 2K9ZA 3OF1A 1KDKA 3JQWA 1AR72 1AXKA 4X8PA 1QMJA 2C9AA 2ZGMA 1LECA 5J7MA 4QGLA 1PHMA 4XPVA 3AXDA 4XJUA 4B4PA 1RHI3 1UPIA 1YI9A 1IQAA 5GLTA 5CBLA 3J4UH 4COYA 4W6YA 3TOJA 3NL1A 4Q4Y3 3DF0A 2ZGRA 2GN3A 1ZM1A 4N7UA 1V6OA 4UBHA 4COVA 2XWJB 1O4YA 4FXGB 1XNKA 1DQ1A 3G6JB 4HANA 4AHYA 4B3NA 5JOYA 2PAKA 2YROA 5GZEA 4N43C 5L7OA 1H9PA 3MPBA 2ARXA 4Z82A 2BFUS 4F3JA 4XFAA 4LHKA 3G7DA 1OPOA 1UU5A 2YGMA 4CEYA 1N1SA 4XF1A 5AFEA 1PGL2 1F9KA 5JCTA 2XJUA 1EPZA 4P9JA 3RYKA 4L9BA 4OI1A 3T1LA 5L7OC 1W6QB 3FLRA 3WVJA 1RMU3 1PO12 4A2UA 1PGW1 1MS4A 1W6MA 2E7QA 4ITCA 2IWGB 4Q4X2 3C2UA 4YM3A 2Z2SB 1Q56A 4XF9A 1VBD3 4LNVA 3ECQA 4LHLA 4AFAA 2WSVA 4S2DA 1Y7BA 1AR83 5KXDA 4IV1B 1LHOA 3GZTB 2JG9B 2QVSB 1ZBA3 2IFRA 4NR1A 4O9EA 4QQHA 3ZYRA 1K5MC 1LRHA 2ZHKA 2PLV2 1O3SA 1RL3A 2XJPA 4WZCA 1S55A 4YVSC 3IBMA 2IXKA 1YO8A 2WFF3 2ZA9A 1OKQA 2UY9A 3PJYA 1WW6A 3QH7A 4JGZA 1AR63 2GC1A 3D0SA 4C1WA 4C90A 4YFWA 5KXBA 2HWD2 2Y0IA 1UKRA 4K6BA 3TN92 2JDZA 3MLKA 1Z7S1 3ILNA 2HWC1 4P9IA 1MZ6A 2VW1A 4LBMA 4CDQA 4YGCA 1TNRA 4FP3A 1CR7A 3ZN6A 4XFGA 2XJVA 4XZPA 3KM5A 3OYWA 3NO8A 2NLRA 2HWE2 4JDOA 3B02A 1N47A 3UJQA 3FC0A 1TQ5A 4DPNA 4CDQC 1F31A 3RNSA 5A32A 1CAVB 2A6WA 4Q2FA 5EYXA 3OGGA 3J8F1 3PMSA 4LBQD 2ET1A 1U0AA 4EN8B 2D6LX 3B3QE 2PA7A 4XEZA 3W9AA 1MS3A 1AL23 2DCTA 4XJAA 3E6DA 2DCYA 4N43B 5HCAA 3NSTA 2H6BA 2IXJA 4BHPA 1VBB1 2YDEA 3HAGA 3S7EA 1VBC2 1JXNA 2HEYF 3HD8B 4TWTA 2GSYA 3MIFA 2B39A 1YJLA 3L9JT 3M3QA 3RG0A 2A5ZA 1BBT1 3QOPA 4XFCA 2XVKA 1KJLA 2OW4A 3N4MA 1CJPA 4FPOB 1ZVFA 1RUH3 4XJZA 3ZXAC 1QOSA 1SQ4A 5L7OB 4NVPA 4W6WA 3THPA 3ZIXA 4IV3A 2RR11 1S2BA 3FZ3A 3WOGA 4XMIA 3O0VA 3GBGA 4FXKB 4BE3A 4ZU4A 1CAWA 1JH5A 1I5ZA 3ZVXA 4GMP3 3SCFA 5KHKA 5I0SA 4YZ3A 5ABJA 1FXZA 2RJKA 3O0XA 1FT9A 4DRRA 1F5JA 3ZN5A 5FO8B 5JOWA 2IXIA 3RJ2X 2NP0A 4IV3C 3WG3A 5GKAC 3WUCA 3IDBB 4QM9A 1K5MB 1WD4A 2HWB1 2RS31 4WM7C 1RHI2 2R062 3N7JA 4Q29A 4YVSB 3WP5A 3DV8A 1OA2A 1H2KA 1RUG1 2TEPA 1A78A 4Q4Y2 5D1IA 5ABJC 2CV6A 2WWSA 4K40A 4L97A 3ZXDA 2GNDA 3EXUA 4Q0PA 2WC2A 4UW3A 2RS51 4Y1ZA 1QDOA 4BLJA 1QGLA 1QJU2 3POSA 1OA4A 2DUPA 1RUJ1 5GZDA 4D7YA 2IFWA 1ULFA 3AP5A 4Y1XA 2F6BA 1RUE3 4Z07A 1ZREA 3UV9A 3N7MA 5C9AC 3HN1A 1DYPA 3FLPA 2Q30A 3IMNA 3FX3A 3JB4C 4I3PA 5DUVA 3VBFC 1AXYA 3VZMA 3U0ZA 2GAUA 4MGYE 5FAXA 2I74A 4HMZA 1DF0A 4YZ2A 4AQ2A 5JPMB 4EV0A 1FI2A 1R1ZA 3H50A 4CDQB 1QNYA 3ROUA 4BQ1A 1RVF1 4AVTA 2VUJA 1UU4A 4WV8A 1MR5A 1UX6A 1FX5A 3ZN6B 3PTYA 4LO5B 2XJTA 4YW4A 3ELNA 4GA9A 3O12A 1N1VA 2NYYA 2CWSA 4KH9A 2EXKA 3JBG1 4N90A 3VGIA 4F8AA 2Y26A 5FTTC 2CWMA 1LB2A 1XYNA 3WW2A 3BTAA 4CEWA 4DOUA 2EAKA 2Z42A 1AR82 3AP4A 3HT2A 2AR6A 4RD7A 4DY5A 1R091 1TMF1 3JQXA 3WUDA 1RC6A 4OZXA 3M1HA 1XYPA 4KWKA 1ULCA 5T50A 1HXS2 1G9FA 1IPKA 2ZGLA 3UKTA 3QLQA 5JI7A 3M3IA 4YZ4A 1J3QA 4NN0A 5GJ6A 1RINA 1AR62 1SCRA 1C57A 4CEWC 4AI3A 2BNNA 4L2NA 3RYPA 1AR71 3RRDA 3PJQA 4IEXA 5GALA 4LO4B 1BCXA 1AYN3 2I45A 3VBHC 4JV4A 5CIRA 1PNGA 2XHKA 3B94A 3A0KA 4H55A 4KG0A 2FMDA 1HQLA 2E6VA 2AYHA 4W6XA 2DVBA 3W58A 1W2UA 2PAMA 3O5SA 3NV3A 3ACLA 3ZXGA 1EPWA 3RI8A 1SBDA 5BNPC 1O4TA 3WXPA 4WM7B 5JSRA 2RMU2 1XNCA 1AYM3 1IGOA 3UKVA 3O14A 5AC93 3WR0A 1HW5A 2GNMA 1RB8G 4EN6B 1ULDA 5ABJB 1RITA 3H7YA 2KM2A 1R083 2W08A 1C3HA 1VP6A 5KXEA 1FMD3 4UW5A 2W0XA 1PGL1 1WLTA 1TME2 3H3UA 1MZ5A 1H0BA 3N3HA 3S0MA 3WP3A 4CP2A 1EP0A 2ZHMA 2OZ6A 5C8WA 1S0DA 1HLCA 4P9LA 3AZXA 1IKQA 3PMEA 3MIEA 1ZRRA 4LBOA 2V5YA 4K20A 3USUB 1PO11 3EHKA 4JC1A 2WT2A 3D0JA 3NKGA 1KDMA 4COZA 5C9AB 2W68A 3VBFB 1Q8PA 1V6IA 5KBFA 5KHJA 2Y38A 3MFAA 4Q4X1 3UKNA 1YFXA 4PJYA 3VL9A 3VUOA 2R49A 1WBLA 2WJSA 1N3QA 4H3WA 3R0RA 2RM22 5K8SA 1X50A 1YWKA 2CGOA 1QJZA 1AX0A 2AENA 1BYHA 5DZFA 1MS0A 4MGIE 2PYTA 1D2SA 2JE7A 5ACA3 3KSCA 2GDFA 2PLV1 5I0TA 4AVSA 2UWAA 4PDWC 1X33A 2E7AA 5CG9A 5J98B 4EWAA 3AZYA 1HRV3 2VQAA 3HR9A 4FPCA 3MZHA 5CB7A 3I8TA 1D2QA 2HWD1 3DKWA 3TN91 1DQ4A 2A6XA 4DY3A 4B7EA 1YFYA 3RZZA 3MF6A 2EXIA 2ZMLA 3M3CA 1QDCA 4JGYA 2P3JA 4FAHA 1Q5OA 5EYYA 4INDA 3IIAA 1BK1A 4CEWB 4AQ6A 1H8TA 1POV1 2A3XA 2YXSA 3B00A 5FREA 4I09A 2G9FA 4BIFA 1GANA 4U36A 3KLSA 2O1QA 4AFDA 2HWE1 2IXLA 2QZ2A 4QQOA 3BIWE 3VBHB 4WVMA 4MVTA 4P9GA 4ES9A 5KXCA 2D98A 1NXD1 4C91A 1H8TC 3MF9A 4Q0SA 5BNPB 4M3CB 3V64A 4QU2A 5I8SA 1VBC1 3VHPA 4XMAA 4F83A 1XE8A 2BW8A 1G7YA 2ARBA 1CN1A 3L2HA 2MEV3 4TLFA 4FPGA 2WT0A 1B35A 1PVC2 3CEWA 1ZA4A 4E27A 1VJ2A 5HCBA 1LR5A 3MIHA 2EVXA 2A3WA 3EO6A 1AR92 1BEV3 2XKOA 5JZGA 4SLIA 4XBNA 2VMIA 1MS1A 2JD4A 4XFHA 2XVLA 2AZ5A 2JG8C 1ULGA 1D4M3 1B35C 2RS13 1BQPA 3ALQA 2QQPA 2RHPA 1ZBE3 3AJYA 4BMBA 2A7AA 2PN5A 2HEWF 2ZCWA 1UU6A 1QH6A 1IKPA 4HVOA 2X53S 2ZGQA 3JD73 4FP2A 3FUOA 5C4WB 4P9YA 5JZGC 4FSJA 4Q8KA 3ZYIB 2HYKA 2FMYA 3M8LA 1S0IA 3HT1A 1NE6A 1RHI1 2R061 4BA6A 2YHJA 1V9U3 4K9SA 4PDWB 2EXHA 1SLLA 2VOKA 1ASJ2 1C8M2 2ZAHA 1MVQA 2VXRA 4Q4Y1 4E2SA 5GLWA 3RDIA 4IEQA 1NLSA 1J3PA 4MSVA 5BNQA 1N1TA 4BWOA 1FOD3 1RUOA 2VQ0A 4M01A 3AZWA 2XGXA 1L3JA 2QE3A 1SLCA 1AYM2 2MPFA 4CDUC 1OA3A 5AC92 2VVEA 5KC6A 3NKTA 1QJU1 4FQ4A 4BIOA 1S1AA 5KHHA 2R1DA 4HKWA 2NQYA 1W6QA 1OFNA 4FPLA 2XLAA 3OY8B 4H7MA 1NQJA 4FT8A 1REEA 4LBNA 4P14A 1OHFA 1TE1B 3OJBA 3M3OA 1PNFA 4IEYA 2C0ZA 2DF7A 1VBA3 2D93A 4G4FA 3U11A 5LRSA 2ERFA 2WA4A 3M7AA 4GALA 1ONAA 4MXVA 2EIGA 1BKZA 1CAUA 1GKBA 4XQ4A 5FPXA 1MEC2 1KFUL 3CNAA 3CLPA 1PIV3 1AR81 4JRAA 4Q27A 3DUIA 4RGAA 3M2MA 1DFQA 1BMV2 1N1YA 1OQEA 2BNOA 2C1FA 3MFCA 4PBPA 1LOGA 1J58A 4URTA 4Y4YA 3TRSB 3ES4A 4OHZA 3SH3A 1HXS1 1WLCA 4Y1UA 4HSLA 1YYNA 4LHNA 5GLZA 4ZKTB 1NY72 2WFF1 3K51A 2NMNA 3LA7A 4BZ4A 2DYCA 2PAEA 2YZ4A 3SHRA 4BLIA 1AR61 3MW4A 2WZPP 3RSJA 4YARA 2A6ZA 1AJOA 4HZFA 4N9HA 5DG1A 1OOPA 4IL7A 2ZABA 1KD7A 1V6MA 1DZRA 3ZFEC 2JG8B 2I07B 4G9SB 4Q4W3 1C5IA 5DDJ2 2ZGKA 4FPKA 4AGRA 2GU9A 1ZZ7A 1YLLA 4XTMA 4IQPA 1Q3EA 1HRI3 3VZLA 2R073 1VAKA 2A70A 1R1A2 5FRAA 5H9PA 4HLTA 4AEDA 3JZVA 1MS9A 1CAVA 2DCKA 3MIDA 2DCJA 1X8EA 1YXWA 1OOPC 4CDWA 1OPMA 5JZGB 1WW7A 3BCWA 2TNFA 4E4DX 2RMU1 1GQGA 1RUC2 4JDNA 4LO6B 3WINE 4LLFA 2DVAA 4N43A 5FMOS 3VKLA 2Y0OA 1N3PA 2ZX4A 4FOVA 2VMGA 4NHKA 3K48A 2R043 3N36A 4FAGA 1PO23 3OBTA 3ASIA 3ILRA 2UU8A 4AEDC 1TME1 5JPNB 5C33A 2ZZJA 3V65A 1OQDA 1LOCA 4ISQA 4CDWC 4CDUB 2OA2A 4Z8BA 3TB0A 1CPMA 4FPJA 1DLLA 4XETA 2EAAA 5BUVA 5LEKA 2VNRA 2ZKNA 4Y1YA 1REDA 3RMXA 4JQRA 4EJRA 2PHDA 3OCPA 2YPJA 3M70A 1GBGA 2ZACA 3MGUA 2B9UA 1JN2P 1UF2C 3D4KA 4ATFA 3T2TA 4I3GA 1GZWB 3B5LB 3R4SA 1OQ1A 1GV9A 2RM21 5JMCA 1HKDA 1GNHA 4XE9A 4NWVA 1H1IA 1URXA 1RIRA 4MZUA 1WCKA 2ZPXA 3KS7A 2DUQA 2NMOA 2RS12 3J26N 1K5MA 2VW0A 5LRRA 1FNYA 2TUNA 5DXDA 5K0UA 4YVSA 3LSEA 4YNIA 3E97A 2ZX1A 1B09A 4S2GA 2WNEA 1FPN2 2JICA 1WCDJ 1RUD3 3VN4A 1GYKA 3BODA 5L73A 3E6BA 4AW7A 3NW4A 3AMPA 4RHV3 5FOJB 1OD5A 1YJKA 1CAUB 5FOBB 2ZBJA 2PHWA 5K0UC 1UMZA 3NWKA 4U2AA 4N7IA 3ZMNA 3ZFFA 3A4UA 3ZFEB 1RUI2 1UW8A 4FCAA 2WNUB 4BCUA 4AFBA 4A3XA 3VV1A 4Y20B 4HKOA 1IS3A 3KT7A 1UZZA 1NZCA 4JCKA 3JUUA 4DNYA 1S0FA 3IWZA 2WZR3 1ZZCA 3VKNA 4PLMA 4XF4A 1JYCA 4AI0A 1OMIA 3RI9A 4K8FA 3ZSMA 1OOPB 5A3MA 2UURA 3MPPG 3ZFFC 4RR3A 2CGNA 1RTVA 2RE9A 2WSUA 1VBA2 4QXKA 1WMDA 3VZKA 1YNAA 3VHRA 4DXZA 3AMHA 3IDEA 2OPKA 2R6QA 2XWBB 4AEDB 2JEMA 3GBFA 5FO7B 4I02A 1UIJA 3AYCA 1PVC1 4CDWB 2ZJCA 1LESA 1EAH3 5JSOA 4RR3C 1PIV2 1DQ0A 4YW2A 3DPRC 1LULA 1NCRC 4META 1AR91 1RUF3 4LO7A 1VBE3 3MIGA 1NXMA 4XFBA 2WS93 2N7GA 4H14A 4B4RA 1KS4A 2VOVA 2D3SA 1LGCA 4ISRA 4XXPA 1XE7A 4YW1A 3NAPC 2TBVA 4XIKA 4I30A 3B7MA 1QOOA 4AYUA 3I54A 1QJY2 1G9AA 1XU2A 1QHDA 1G8WA 3O7OA 3NJZA 3ZFGA 1SACA 1VR3A 4WM7A 1V6KA 2R072 1ASJ1 1C8M1 2D5FA 3BOWA 4J6GA 1MS5A 4P5HA 3WCRA 1OLQA 1U5YA 5JR7B 4CRQA 3ZSEA 2B42B 1V00A 3KD4A 4QT6A 3ZX7A 1AXZA 2ZOEB 4OULA 3PNAA 1DGRA 4NO4A 1AYM1 2PELA 2XLFA 5AC91 3N35A 1CJDA 1C28A 1UL9A 2ZGNA 3ZFGC 4L99A 1VAVA 4L92A 3ZXKA 3ZMOA 5GZCA 2R042 4KNCA 5K0UB 1PO22 1O7FA 2A71A 3FBMA 5K7PA 3USUA 2XPJA 5L36A 5C9AA 1HX6A 3VBFA 5CAZA 4WBBA 1NQDA 4BYYA 2XJSA 3M4FA 3ZPYA 1IOAA 1VALA 2R0FA 2Z5WA 4HVRA 4RQPC 4Y1VA 5JOZA 3SMHA 2WQ4A 3D8CA 2E63A 3D82A 3HIFA 3SNMA 5T54A 2A3YA 4R4ZA 3ZFFB 3MLJA 1SLBA 1W6OA 5HBAA 1MEC1 1U5IA 5F9TA 2NZ9A 4XILA 4I01A 2WLQA 1KQRA 2UY8A 1BMV1 1AHSA 1RMU2 1XU1A 2D40A 1ZZBA 3ME2A 2Q4SA 3ZXJA 3R05A 1ENSA 3N7KA 1Z7S3 2P37A 2QCSB 3U4XA 4TZDA 3GZAA 3EQEA 3WNXA 1WGPA 1NY71 4YLZA 2HWC3 5A3LA 4RR3B 1DYKA 3DPRB 3ZO0B 3USSA 1NCRB 3VHNA 4YFZA 3ZXEA 1VBD2 4PCRA 1RUD2 3WW3A 5FDBA 3KGZA 5DZEA 2WT1A 1W6NB 3FHIB 3C3VA 2NM1A 4W65A 1O4ZA 1ZBA2 1WBFA 5DDJ1 5JIUA 4OHYA 1MS8A 2ZHLA 2ZX3A 4YG6A 3VBHA 5DUXA 4CP1A 2EA7A 5FLJA 3IT8A 3MYXA 1DBNA 4WM8A 3NAPB 2JENA 3LSDA 2WFF2 3ETQA 1R1A1 3GYDA 1IZ3A 1CESA 5SV5A 2VW2A 2GC3A 3KGLA 4EROA 2EXJA 4HK9A 2X8KA 4PLNA 1RUC1 3VZOA 5BNPA 1WLWA 2FZ2A 2D6OX 4QPIC 1JBCA 3POYA 4M3CA 1VBB3 3LZZA 4AEJA 4M3CE 5I0UA 5IUQA 4LLOA 2O0OA 4WM8C 3MICA 4Y22B 4B8EA 4EN9B 1C5HA 4YRDA 1YRZA 3WQ1A 1BBT3 4MX3A 1RUNA 3LA3A 4NHMA 2E7TA 5JIAA 3ZFGB 2BQPA 3B93A 1BJQA 1ND3A 4IEZA 1EV13 1LTEA 2RR13 1Q43A 4PQ9A 1FNZA 3PVNA 4XJ8A 4YM1A 2VECA 5FO9B 4HL0A 2BNMA 1NA1A 4KL1A 5FLHA 2PQQA 4FOYA 4FTSA 1DDLA 1S0JA 1AL22 1ND2A 1DG6A 4N53A 4DRVA 5LEJA 5BNOA 2DV9A 1NOVA 3LGRA 1T6GC 3FE5A 1UAIA 1VBE2 4RQPB 1DQ5A 1EYBA 2WS92 2ZAAA 2ATFA 4TYSA 1ND3C 3E5XA 1PMIA 4OHVA 3WDUA 1UZYA 2Q0AA 3NVCA 3S6PA 4XHBA 2RS11 5C4WA 2BVVA 2P2KA 2HWB3 4ZXKA 1NA1C 4IEVA 4KGQA 3AB0A 4EN7B 1ND2C 1HV1A 2DVFA 2GALA 3H1WA 4N53C 4PDWA 5BNOC 4KU8A 1SBEA 5HCFA 1RUH2 1RUG3 4AVBA 5EJ3A 5T3NA 3FWEA 1KS5A 2GN7A 1FPN1 4FPEA 3R6SA 3IM0A 1AUYA 1WCSA 1DQ6A 2CAVA 1C1LA 4X8NA 1XNBA 3WG2A 2AH2A 2RS53 3VBUC 4JDMA 4AGGA 5C4WC 3I2DA 4OI2A 4OI4A 5AVAA 2DFBA 2K2SA 5I91A 4GB33 1W6OB 2GC2A 5EWSA 1ULEA 1A6CA 4BH9A 4LT5A 4KGGA 2B8MA 2KXLA 5CFDA 3OY8A 2D6PA 1U5ZA 1RUI1 4QQPA 4QQ2A 3HMYA 1WLDA 4XHXA 1G9CA 3U10A 4D69A 2D6KA 2A6YA 3BALA 1KXGA 1I3HA 5K9YA 3AP6A 4JTOA 1YFUA 1WUVA 4Q4V3 3V0BB 1ALYA 1Q8QA 1RVF3 4TSVA 2Q8OA 2VH9A 2O8OA 3KT1A 4WVVA 5CFDC 1JUIA 1F5FA 3SXWA 3FFQA 4XIOA 4OI0A 1VBA1 2ENRA 4QPIB 4LR4A 2B5HA 3SISA 1Y3TA 3ES1A 1LEDA 4WM8B 5CFCA 1RUE2 1W6PA 1D0GA 1A8DA 5E88A 5JWPA 1O5UA 3LB9A 5T52A 1XNDA 1LJ7A 1H4GA 4FQZA 3FFZA 1PIV1 2QNKA 3T1MA 1YUDA 3UJOA 3R4DB 4BM8A 2B45X 2IC1A 2CAUA 4YM2A 3SCGA 4HT1T 5J36A 1N3OA 1CD3G 1X7NA 2FZ1A 3GHMA 3WCSA 4PBOA 3OPZA 2D97A 4EWDA 2QFEA 2VPVA 5CFCC 2H0BA 3IDCB 5H9SA 2ZGSA 3H1YA 2JG8A 1PK6A 1DHKB 4KWLA 3VBOA 3WDYA 4FVVA 4IEOA 1ZX5A 1X8MA 3LWCA 4M3CF 3FLTA 3WDXA 1Q8VA 1ND3B 3ZSKA 5HI0A 1J3RA 2EALA 1Q8SA 1QXPA 1QJY1 1SFYA