2VULA

Thermostable mutant of environmentally isolated gh11 xylanase
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
193
Chain Sequence
AQTCLTSPQTGFHNGFFYSFWKDSPGTVNFCLLEGGRYTSNWSGINNWVGGKGWQTGSRRNITYSGSFNTPGNGYLALYGWTTNPLVEYYVVDSWGSWRPPGSDGTFLGTVNSDGGTYDIYRAQRVNAPSIIGNATFYQYWSVRQSKRVGGTITTGNHFDAWASVGLNLGTHNYQIMATEGYQSSGSSDITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering Hyperthermostability Into a Gh11 Xylanase is Mediated by Subtle Changes to Protein Structure.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords GH11 XYLANASE
total genus 55
structure length 193
sequence length 193
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vulA00
2VG9A 4XQDA 1OA4A 4HK8A 4HKOA 2B46X 2JEMA 1H8VA 3EXUA 1XYNA 3LB9A 3MF9A 1HIXA 3VLBB 1UU4A 1XNCA 1OLRA 3B7MA 1XXNA 3VZOA 3WP4A 1XYOA 2DCKA 3VGIA 1H4GA 3VZKA 3M4FA 3RI9A 1F5JA 3AKSA 3VZLA 3WP6A 2VUJA 2DCZA 3AKPA 1TE1B 3AKQA 1XNBA 3ZSEA 3AMMA 2DCJA 3O7OA 1H4HA 2BW8A 4XPVA 1XNKA 2BVVA 2QZ2A 1H0BA 2NQYA 1W2UA 1REDA 1M4WA 1REEA 1XYPA 3AMHA 1KS4A 5K7PA 2B45X 3AMNA 2C1FA 2JICA 3HD8B 1HV1A 1KS5A 2F6BA 2D97A 1BK1A 3B5LB 3WQ7A 1OLQA 1H1AA 3AMPA 3AKRA 3MFAA 1QH7A 1UKRA 3WT3A 4HK9A 2Z79A 1QH6A 4H7MA 4S2GA 3MF6A 3VL8A 3AKTA 3AMQA 2NLRA 4S2FA 4HKWA 2B42B 4IXLA 4XQ4A 5EJ3A 1NLRA 3WQ0A 3WP5A 3WXPA 3VZMA 2JENA 3WY6A 2VULA 1YNAA 1HV0A 1AXKA 1ENXA 2D98A 1T6GC 1BCXA 3WP3A 3MFCA 1OA2A 2BWCA 1REFA 3WQ1A 3VZJA 1UU5A 4XQWA 3VHNA 4NPRA 2DFBA 4S2HA 3VHOA 3RI8A 1C5IA 4S2DA 2DFCA 1PVXA 5K9YA 3LGRA 3WX5A 2DCYA 1IGOA 5HXVA 2VGDA 3VHPA 1UU6A 1BVVA 1OA3A 2BWAA 3WR0A 3VZNA 1C5HA 2QZ3A 3VL9A 1XNDA 4HKLA
chains in the Genus database with same CATH superfamily
3T08A 2VUAA 1FNZA 1IS3A 3ZN5A 2JEMA 4FOYA 2L9LA 3EXUA 2XJTA 2HWE3 4A7YA 4IEVA 3U4SA 4Q0UA 4ISRA 3IKWA 4IUGA 1JTZX 4YVWB 3KCXA 1RUH2 1TMF1 2RR11 2YMZA 3GBGA 3AYCA 5CFCA 2QQVA 3VB9A 1XXNA 3GJAA 4OVEA 5J36A 5SV5A 4TSVA 5BYNA 2XJVA 2R30A 4Q4Y1 1OF4A 5FY4A 4GB33 4BLIA 3VZLA 2D6LX 4CXWA 2VUJA 2WL1A 3PVOA 2RHPA 4OFGA 4XZPA 4P5HA 5BNPA 4PI0A 1TEIA 2OQ7A 3A0NA 1JYWA 3GDBA 2JDPA 1W6QB 3GJBA 2E51A 1DQ6A 4NN0A 2TEPA 2VZ3A 4QDQA 4D3WA 5KR7A 2WQ8A 3N7MA 1GP4A 1MEC3 1SLAA 2BV4A 3IPVB 3H8OA 3WINE 1OOPA 3KHCA 1C4RA 2P34A 3H42B 3GCXA 1S0BA 3S5QA 2BOJA 2Z69A 5GZGA 1OLMA 3POFA 1RVF3 4CSWA 3OOXA 2HWE2 1KEXA 1HV1A 3C2UA 2DUOA 2XB6C 2BERA 1TNRA 1TG7A 1B35C 1COV1 2VOWA 1QJX1 3KM5A 2HWB2 4E4DX 5KWRA 4QKFA 1QXPA 4GH4B 1O7FA 4HANA 1Q8OA 2Z79A 3M2MA 1YYNA 4UOJA 3MF6A 5FZOB 3WG1A 2AEZA 3ZFEA 2QBXA 1F35A 1UZZA 3VD3A 1ENQA 1I1EA 2GP5A 1UIKA 1PNFA 3KS7A 1JMUB 5FYVA 1OFSA 1LJ7A 4AFBA 5C3QA 4Q4W3 4YGDA 3WD5A 4FT8A 4Y1YA 4X8PA 3M3QA 4M01A 3NJXA 3D8CA 2HEYF 4CTEA 5FO8B 4NRMA 2G9FA 2E32A 4PCRA 5GZCA 1J59A 1X33A 1O8SA 2W68A 2D6NA 1RUJ3 1UY3A 1WCDJ 3AZWA 2VMEA 1H2MA 4EZ4A 1J83A 1O4TA 4PIZA 4Q4V1 2EAKA 4YFWA 1Q8SA 1H1IA 1X36A 1N1TA 4Y1UA 3NVCA 4LO6B 3NQHA 1APNA 4YW5A 4MUVA 4JGZB 3B3QE 3RI8A 4FPLA 3E6CC 4B4QA 1WA6X 5J1XA 4AI3A 4ES9A 4AGGA 3UESA 2J1UA 4H3WA 3N7JA 3TBDA 3OG2A 1AZDA 2DWRA 4CDXC 2XL7A 2V5DA 3DECA 4QQPA 3SC7X 1O3SA 3JU9A 1PX4A 1GZWA 2O8OA 1CQ9A 4HETA 1MS0A 4KU8A 3C7EA 4Y5Z0 1D4M2 2XGXA 5FZ4A 2YU2A 4RR3A 1NZCA 1UXZA 2Q5TA 3VKFC 1QF3A 5FZMA 1F31A 1HRV2 2Y6LA 3LPFA 4YLZA 1VBB3 2D93A 4PIYA 3VBRA 1OQEA 2QQKA 3JZVA 1AXZA 3FUQA 4AG4A 3CJIB 3HN1A 1PGSA 2RV9A 4FOWA 2R49A 1LGBA 4BJ0A 1LHUA 4QDRA 3OD0A 5FZCA 1PM7A 2Y6HA 3SEEA 1A34A 1H8TA 2GNBA 4NHLA 1C8NA 3AVRA 1FPN3 3B7MA 1NKGA 4GQ7A 3SITA 4B4RA 5EQUA 1VB4A 2WR9A 3FE5A 1AYM1 1ULDA 1H4GA 2XVLA 3I2FA 4LBOA 3T4VA 3M8LA 5KHKA 3I2OA 2QUOA 3JD71 4LHKA 5FP4A 1MEC1 4BQ4A 4DEVA 1A78A 3B01A 1XNBA 4CXYA 4JKLA 2VNOA 4HL0A 4IL7A 2EIDA 1H4HA 2XOMA 1I3HA 3TN91 1BBT2 4UW4A 1CAUA 1AR63 1W8WA 1QJFA 5LB6A 5T5LA 2WNOA 4HPKB 4D94A 5LZ6A 1ZREA 3MICA 2X5IC 4LBQB 1ZZCA 1W99A 2JIGA 3VKMA 1S2EA 4GXLA 2VMIA 3VBUC 1PHMA 3I2JA 2ZGKA 1PIV2 2I07B 2J22A 2DUQA 2VQTA 1GWLA 2XL9A 5JXHA 1KS5A 2Y38A 5FZ9A 1CAXA 3SNMA 3RFRA 5J37A 2ILMA 1AR62 4YVSA 2VTXJ 2JG9A 3ZPYA 4UW5A 2RDRA 3AL6A 2BJSA 5D21A 1O4YA 5C4WC 4CU8A 4K20A 3WHTA 1CAWB 1WCSA 1RHI1 2Y34A 5T5PA 1LODA 1NY72 4Z82A 5FUIA 5FTTC 1G9DA 4PDWB 3DYMA 2AENA 5GZDA 1OUXA 1W9YA 1C28A 1SHWB 1UCXA 2OT7A 5E89A 4CCMA 3RZGA 2WAAA 3OGVA 4W6YA 2HWB3 1LOCA 2ZX3A 1AVBA 4QX0A 5LK7B 4W65A 2WZEA 2HWF1 5A32A 5FYHA 2HWC3 3J8F2 2A3YA 1J1TA 2CDPA 1MS5A 1V6IA 4BE3A 5C71A 4D7YA 5LA2A 4YZ5A 2YHJA 1RUG1 3VZJA 2ZZQA 3SKJE 2ES3A 3ACLA 3LEIA 2EAAA 3VBHC 4A4AA 5JMOA 1G9CA 1CJPA 4WVZA 4AQ2A 2X29A 3UKVA 1JUIA 3VV1A 1LR5A 4M0HA 4JGZA 3H8XA 1MACA 1F4HA 1VALA 1PVXA 1CD3G 2IXJA 2PTMA 1B35B 1RUI1 2VBPA 4AFMA 4CP9A 4LLFA 1H1MA 1K45A 4YGBA 1Z7S3 5FY7A 1RITA 3ZFFA 2G19A 1RXFA 2ET1A 4RR3C 3RYKA 1XE7A 4RN5A 2GMPA 2J7MA 1FOD3 3E97A 3B94A 4XUQA 4Q27A 3LDKA 2Y33A 3SLIA 2FDIA 3SHRA 5C5TA 4RQPA 4YGEA 3NV4A 3PUAA 4PF1A 5FO7B 1I5PA 3M3IA 3FZ3A 2ID4A 1W39A 4RR3B 4AHWA 4BU2A 1ZM1A 3ILFA 5DUUA 1VBA2 2NN8A 1D0HA 1GZ9A 4L0PA 1LEMA 3NNMA 1UY2A 3DKWA 1RUC2 2H6BA 3ON7A 3OGJA 1QKQA 1UZ0A 4OZOA 1FXZA 2UWAA 3CJIA 4IERA 2BOIA 1C8M2 1IKPA 1BXHA 2Q1MA 5IVJA 1Q8QA 1UYXA 3J4UH 5A3UA 3LQCA 3POYA 3ROUA 3SCFA 4XJ9A 1IS6A 3POWA 3WDVA 3KT7A 2WA3A 4YW2A 3HMYA 1UX7A 5FOJB 2GU9A 1LOBA 3N35A 2WNUB 1DF0A 2AACA 1POV0 1XYOA 2QQNA 1ZRFA 1WW5A 3VGIA 4DXTA 3J7HA 4JCKA 3S7EA 4K40A 2VMCA 2ZHNA 3DYPA 1W6PA 4Y5SA 1EV13 1YLLA 3S57A 5CKMA 2DCJA 3H9AA 1BVP1 2R6QA 1PO11 2IFRA 2WINB 4N43C 4JVAA 4XEZA 5FP8A 4EN9B 3BGAA 1HB1A 1YFYA 1S0DA 2EALA 2XVKA 4PLNA 2D6KA 5JIUA 4U2AA 1KS4A 3HQRA 1LOFA 5ACA2 4YZ1A 1BLZA 2PLV3 3OGRA 4Z07A 1JZ3A 1PVC1 4CEYB 1JS9A 2A1XA 4MZUA 2JD9A 4CYDA 4AAPA 1QNWA 1UOFA 1H2NA 5KHJA 3ILNA 1C8M3 2ZKNA 3LPGA 4MO3M 3LKJA 3KQ4B 3WDUA 1I5ZA 1GICA 3TAYA 4XJZA 5FYSA 1AYM2 1RUF3 3UYJA 2WIIB 4CUGA 5I8YA 4GWIA 2RR12 3NJZA 1H8TB 4BB3A 4BK5A 2VVEA 4D0QA 1GFF2 5KXBA 3LCPA 3WT3A 5FP3A 5BNNA 5CFDB 3CLPA 1MS4A 3LIGA 1V6LA 1XB9A 2ZX4A 4L99A 4UFJA 3ZYRA 4QXBA 3THCA 5CKQA 1RUE2 1O6UA 1TMF3 3BN6A 4N43A 2JDUA 2Y0OA 3POIA 1DGWA 3ZFEC 2PQSA 5FPUA 2NYYA 3EO6A 2YB7A 4URAA 4QX5A 5JLVA 2KA3A 5FAXA 3EQEA 3KV4A 1PMJX 3MFCA 4XBQA 4KL1A 3WQ1A 1KRIA 1RUD2 3MHZA 3KWVA 4Q26A 2OPWA 1IS5A 2AUYA 2J1SA 4LTAA 3ECQA 3J9SA 3ZFFC 4HT1T 4D7TA 3KT1A 5C5UA 5K8SA 3HIFA 1QXJA 5KXCA 1HN1A 4DRRA 1RUNA 4QU1A 4Z8BA 3HAGA 4QX3A 1HDKA 1NOVA 2WLPA 2X05A 3PU8A 2A3XA 2XKOA 5FY9A 2HWD1 2LALA 4AEJA 1CAWA 3P3PA 4FOVA 2DU1A 3C7HA 2XLAA 4XJ8A 4Q5OA 1GQGA 3VDBA 2WN2A 2WO7A 2FCUA 1ENRA 3TRSB 5C3SA 3OBRA 2WO2A 3IPVA 4WVVA 3VHRA 3VKLA 5FXVA 3VL9A 1XU2A 3ZFGA 2VNVA 5JZGB 4GKYA 1OA4A 3MGUA 1MPXA 3NJYA 4K1ZA 1FATA 3MW4A 1OH4A 4M4PA 2XJUA 3RJRA 4LBQD 3LB9A 4C91A 4CUAA 4Z92B 1C1FA 2HYXA 3WDWA 1KJRA 1QEXA 2YBSA 5B4NA 1EV11 4DS0A 3I2KA 2WS93 3VDDC 3POGA 4WVWA 4FAGA 1D2QA 5FZOA 3ZFEB 1PO13 3URFA 2GN3A 4AOCA 4N53B 3WNPA 3FUOA 3RI9A 1QWRA 4CU6A 5DAQA 1TQ5A 4UFKA 2R32A 1OKOA 1IPJA 1LOFC 1UO9A 4UAPA 2GNTA 5FUNA 3Q8AA 2Y6GA 1XNKA 1N1VA 2A6YA 2GN7A 1DQ4A 4BIFA 4CVUA 3ZXLA 4DINB 4MG2A 1YUDA 2C4XA 4MXVA 3VBRB 4EWEA 4G4FA 2JDKA 1PGL2 4A42A 1C8M1 2JKXA 1ND3A 3JCIA 2UY9A 4X6QB 1Y9GA 2F17A 5IWFA 3WNKA 2VPVA 2WFPA 5CNAA 3FWEA 1HRV1 4BOWA 4OUEA 1WA4A 5FZ8A 3W5NA 1W2NA 1K12A 4Y1XA 1D0GA 5J48A 1SCRA 1EP0A 2P3IA 1BK0A 2R041 4GMP3 5HCFA 2CGPA 2P2KA 1JZ7A 1RIRA 1ACCA 3I4IA 5E88A 3D5OA 3FFQA 1BMV1 1VBE3 4TZDA 3OJBA 3H7YA 2WNUA 4AW7A 1Y3TA 4LT5A 1JUHA 3AZZA 3IMMA 5FZBA 3GZEA 2I74A 3ZYGA 1L7LA 2ZHLA 2ZGUA 4NWVA 4HKWA 2D5HA 1K5JA 3JD72 4LLOA 5T5JA 3WQBA 2PLV2 3ZOIA 4CCLA 2ZEZA 2FDHA 4ZS3A 5EV7A 3KV9A 2VULA 3U11A 5C9AC 2WRAA 3E5QA 4O61A 4E4SA 3I49A 3HR9A 2OVUA 3WUDA 5FZHA 4L9BA 5JI9A 1DQ5A 1H2LA 2A71A 2V4AA 4QGLA 1ULEA 1LULA 5FCCA 3RYRA 3OY8A 1CAXB 3W9AA 3C3VA 1AHSA 3TWIA 4EYUA 4K9SA 1UU5A 4XACA 1XU1A 4IV3B 3CEWA 2ZA9A 5DQ0A 2PHUA 4AHZA 4CEYC 1HB4A 2P5BA 4HMZA 4LKFA 3UKNA 3PLQA 3RZZA 4BHPA 5A3LA 2Q0AA 2R1DA 1RUF2 4QPGC 1A6CA 5CG9A 5H9SA 5EXOA 5IAVA 4NMIA 2TNFA 1IGOA 4OUMA 1O3RA 4CU9A 1E5SA 2O14A 1UZVA 3NNFA 4YPJA 1GKBA 3NRUA 3I2DA 1YWKA 3GNEA 3KGLA 4Y24A 1YHFA 2C9KA 4DO0A 4BH9A 5A6ZA 2P3JA 2ZJCA 4WZFA 2BGCA 1WMXA 4BCUA 3NSTA 2BNMA 1XNDA 2BGPA 3PDQA 4XIOA 5EHDA 4UW6A 3AK0A 3AP9A 1W90A 3BIWE 3UL2A 3GYDA 4RQPC 2FDKA 1QDCA 1Z7S1 2XWBB 4CDWA 1AL23 2HWE1 1V6OA 2PHXA 5A3NA 1U0AA 1S0FA 4DUWA 3DXTA 3V0AB 1PIV3 1XNCA 2D5FA 3I2IA 4WM7C 3ZFFB 4XCBA 5DAWA 3RWKX 1COV3 2VMHA 4GJZA 5L73A 4GAZA 4Q4Y3 3SH5A 2E53A 4IE6A 1FX5A 4I30A 3RJ2X 3VKNA 3VZKA 3VBSB 2DVFA 1QDOA 2XR4A 3FFZA 4CRQA 1D4M3 1LHNA 3H3UA 4OHXA 5D2AA 5JOXA 3AMMA 3GGLA 4QU2A 3WVJA 1DDLA 5T50A 5I0UA 5APAA 1QQP3 4HZFA 5FYYA 1VAVA 4Q4X3 1DGWX 3IM0A 1JOBA 4COYA 2XXZA 4C0HA 1RUI3 1FOD1 1Z0HA 4OHVA 5DPNA 1UW8A 1SDWA 2W52A 4XTPA 4AEDC 3ACFA 2D6MA 4GWMA 2PA7A 4TWTA 2D6OX 1R081 4BXSV 4XMIA 3JBG2 3ABZA 1GZTA 2J1EA 2RJKA 2VXJA 3A22A 4XFBA 3KLSA 4OI4A 1DIWA 5L9BA 1QHDA 4FPFA 2XLGA 5JXIA 1HKDA 2ZMLA 5L9VA 1W6PB 2WS92 3ZN6B 3BIEA 1UKRA 2WQZC 3GM8A 2ORXA 2FDGA 4N53A 4PQQA 3HNYM 2JDAA 4Q0SA 4YW3A 5FZKA 2WT2A 3LD8A 3WXPA 1C3HA 4E4HA 1ZRDA 4QHZA 3HBKA 4JRLA 4CCJA 2B39A 3U07A 5JZGC 3SQOA 4CEYA 1OPOA 1XE0A 2IVIB 2D98A 4QQHA 1XC6A 4AZZA 1GP5A 3ES4A 2B5HA 2R042 5EPAA 2BWCA 3K4DA 3BOPA 5IW0A 1REFA 2D3PA 3MW2A 1LECA 2WJSA 1AR82 3BVCA 4CEWC 1OUSA 2MHFA 1PVC2 4CP0A 2Y64A 4FXKB 3GZAA 5FMBA 3F2ZA 3QD6A 5FUPA 1SZBA 1UAIA 1JW6A 2XUMA 4LA2A 4LHSA 2E7AA 3PUSA 3ZKYA 5IVBA 3WNNA 4S2DA 1QGLA 4YVSC 4MYEA 1W9FA 1V9U3 2W5FA 3LGRA 2VOXA 3MIEA 2ZGMA 4EV0A 5DUWA 2XBO3 2PLV1 3VBFA 2Y6KA 1HJFA 2F4PA 3RZJA 4D69A 5CG8A 4CDXB 2ORZA 1GWMA 3AFGA 4K1YA 1WD4A 1NA1A 1S2BA 1ZNPA 2CNAA 3ITQA 4LO7A 3ZIXA 1ULFA 5LRSA 5FPLA 1HLCA 1JHNA 2EF6A 4IGPA 1BVVA 3VDCA 3JD73 2VU9A 3HT2A 4FFHA 2Z42A 4H14A 4LBJA 2HWC2 1S0EA 4HXCA 4Q2FA 4Y4RA 3FC0A 4BQXA 1W06A 4M3CB 1W2OA 5GM0A 4AGVA 1WBLA 2I45A 1SLCA 2OX0A 1OI6A 1IG3A 1O5LA 5HCBA 3W59A 3S5AA 2JKBA 1ND2B 1PIV1 1H8TC 1OFNA 2ZGOA 3K2OA 1N47A 1VRH2 2HWD3 1WLTA 4KI5M 2VD7A 4P14A 2RMU1 4Y3OA 1GSLA 3IT8A 5FLIA 4CUCA 3ZFGC 1NLQA 4UI9L 3LFMA 4K21A 2R16A 1UU4A 5D1IA 5FZDA 1AYN2 2P17A 1PGW1 4FVVA 1DYKA 4LK6A 3IDBB 3IIIA 1ODNA 3BU7A 3FX3A 3IMNA 1AYM3 5FZ3A 2LRPA 2JG8C 2VQAA 4NRPA 3KT4A 1KGYA 1VRH3 2HWD2 3OBTA 4UFIA 4W6WA 1YFUA 3WP6A 2V5YA 3BYWA 1ULOA 2UY8A 4AI0A 4QHBA 5IYYA 1OQ1A 1QXRA 3FLTA 3T2PA 1W6OB 4MHUA 4META 4P9LA 4D6SA 3ENRA 4KG8A 1R64A 2QQWA 1LOAA 1H0BA 2ZGLA 3IBMA 4FFFA 5DG1A 4BISA 4IE4A 4QMAA 3VBSC 3AYDA 2WO3A 1Z7S2 5IVCA 1S0CA 1G8WA 5IVFA 4XXPA 1LOGA 5KC6A 3CU7A 2WT0A 4JHTA 1UY4A 1EPZA 1QOSA 2B45X 3AMNA 4EROA 2Q1FA 4NHYA 3WCSA 5K0UA 2WWUA 2GC3A 1WWYA 2B9UA 2EXHA 3N9MA 3PIJA 3HPNA 3KCCA 3O12A 5DABA 5IT6A 1RUG3 4AHXA 1KQRA 4QPWA 1W9SA 2QNKA 2YFUA 3NW4A 1S0JA 4ZU7A 2VUCA 4XFGA 4FAHA 2QDRA 4YM2A 1SLTA 2OYZA 3DPRB 2G9GA 3N9OA 4E27A 4QX2A 1UOGA 1O3TA 3AMPA 3AKRA 4JTNA 1EV12 1F2NA 1KXGA 5IK4A 3QLQA 2GH2A 1QH6A 1J3RA 1H2KA 3O14A 4S2GA 5DUXA 4HSLA 2DCTA 2NLRA 4AI2A 1CJDA 4IXLA 3RS6A 3WG3A 5EJ3A 3QH7A 2BNNA 3RSJA 4WV8A 5BNOC 1VMJA 3M3CA 4QX7A 4AQSA 5F3EA 1JU3A 3AP7A 2QQIA 1YRZA 4CDUB 1IQAA 4EJRA 1QJY2 5DAXA 1GOFA 5GJ6A 2PAKA 4Q8KA 4AGRA 2D3RA 2CWSA 3MIDA 1W6MB 5C9AA 3GALA 1T2XA 2DFBA 2RS33 1PZ7A 3MW3A 1ZVFA 1UYPA 2PHFA 2XBO1 4FFGA 4AF9A 2CAUA 4A7ZA 2VZQA 2ZGNA 3QBQA 4LNVA 1G9AA 2DYCA 2VOTA 1HRI2 3S7IA 4NUBA 5K9YA 1DQ2A 4XUNA 3LEGA 2JG8B 1Y7BA 5F3CA 1Q8PA 4YARA 5DDJ2 1MS1A 1UIJA 4JQRA 1UMHA 1CZVA 4CXXA 5BNNC 2GMMA 5KXEA 5JXGA 1A8MA 1ENSA 1JH5A 2KM2A 2VZRA 4IDZA 2ZGPA 3ZLIA 2P37A 2R043 2WKKA 2XDVA 3ZYHA 5HV4A 2WN3A 1IS4A 2OUHA 3WR0A 1W03A 4DMIA 4KGGA 5FY8A 4Y1ZA 1FMD2 5F8PA 2AC1A 2WNVB 3ZO0B 5ACA1 2A7AA 1RUD3 4XFFA 4XAAA 3T0BA 4OMCA 2EIBA 2IVJA 5DDJ3 3VD9A 3R0RA 5I91A 3U4XA 2XMLA 5FWJA 4XTMA 3ZSMA 4NVPA 5A70A 4ZHNA 3HNBM 2EXIA 1LENA 4C1XA 1W2AX 4BMBA 1O3QA 5ANQA 4KWJA 4LQRA 5C8CB 4OHWA 2X09A 5L7OC 1VMHA 3GF6A 4UT5A 2Q1ZB 5DG2A 4D6RA 5IFPA 3ELNA 4W6XA 3A23A 2OA2A 5FZAA 2FQPA 3JB8A 1W8HA 2DVDA 3ALQA 1YQCA 4L11A 4HOOA 3MPPG 4KWKA 3VBFB 3ILRA 1XSRA 5D8AA 3AKQA 1KDKA 4X6RB 4ARYA 5IATA 3BU0A 3IAPA 3TEXA 3ZSJA 1CVNA 1OURA 3CF6E 5C33A 1CAUB 3OGSA 3O1UA 2X10A 3H7JA 3LOBA 1URXA 2LROA 4E4ZA 1ONAA 3R4DB 1W2UA 2Q8EA 1EPWA 4K3UA 3ZDSA 4NR1A 1ZBE1 1GNHA 1DZRA 2JDHA 3CKHA 5LY1A 4XW3A 3I54A 4CZSA 2QKDA 4JAAA 4DXZA 1P8JA 2OXBA 1XJAA 4IV3A 2C1FA 5A1LA 3V0AA 3KMHA 5GLZA 3H3LA 4COUA 1LHVA 3LZZA 1FV3A 4Q8LA 2XJQA 2WZR2 5FZ7A 1N1YA 2BU9A 2CY6A 2RE9A 3CL1A 4NE9A 4WBBA 4DXRA 4AQ6A 5JSOA 2YPDA 2XVGA 2ZTNA 2EIEA 1VBC3 1OLQA 2ZGQA 2ARAA 3HT1A 3PHMA 2ZGSA 3PVBB 4FP2A 2JDMA 1NUKA 5BNPB 1OVSA 3WF3A 2B7YA 3VL8A 5IHRA 1AL21 4AI9A 4S2FA 5AVPA 2NP0A 1PK6B 2E26A 3D0JA 4UFHA 5FLHA 1W6NA 4DNYA 4J1WA 3T3YA 3D0SA 5DZGA 3VZMA 5J3UA 2UU8A 3WY6A 3PIGA 2RS12 4LKSA 1UQXA 4MXWB 4WM8A 3KV6A 3OB8A 3H1WA 1J1LA 1ENXA 2VXRA 4CDUC 2DV9A 3AYEA 2GAUA 4JZRA 4LHNA 2XLFA 4ES8A 4AVAA 4AYUA 5KXDA 3RG0A 1W6MA 2ZCWA 3AXEA 3J8F3 4CU7A 5C9AB 4AEDB 1KDMA 1MVQA 1W3VA 3VBOC 1AR71 5FFOC 2E9QA 5JIAA 4R9DA 3POBA 1XSQA 4UFMA 2W08A 3PUQA 1UD1A 3POJA 1Q5OA 5F5CA 5IVYA 1X9PA 4JDNA 4AVTA 2W46A 2NZ9A 1PZ8A 2Y8KA 3WX5A 2WS91 3BTXA 3BI3A 4CUBA 4FPYA 4MGSA 3WF0A 1HXS2 4NIHA 3I3MA 1CZTA 5FZIA 3MIHA 1OQDA 2ZAAA 5KHHA 2ETEA 2W95A 1WLCA 3C7GA 1HJGA 4Y22B 4A41A 2OUJA 3VBUB 4HN0A 3E1F1 2EXJA 1DP0A 2W92A 4QWNA 3WDTA 2V4VA 4KMQA 3T30A 3W5MA 1F8VA 5CU1A 2CGOA 3GZTB 3M3OA 5CAZA 2O1QA 2QZ3A 3LDBA 5LATA 4MGKE 4B4PA 1X9TA 4QGMA 5DUVA 1QQP2 3I8TA 5FZ0A 3WHUA 4XQDA 1V9U1 2VUDA 4OZXA 4CDUA 2CAVA 1GZWB 4XFHA 3O1OA 3FBYA 2I2SA 1H9WA 4FI9A 1JYXA 3N9NA 3PMEA 2YC0A 1O91A 4QM8A 4NIIA 1J58A 2RDSA 1JXNA 1O59A 5BXXA 2XJPA 4H7LA 5A6XA 4AI8A 4OQ9A 1GQHA 1K5MA 1EY2A 2Q8OA 4XZUG 4QT6A 4B3NA 3T1LA 5FRAA 2CWMA 4DB5A 2NM1A 1J84A 5BNPC 2WFF1 2MPFA 4I3PA 5G04L 5A7OA 4B7EA 1I9RA 2VVDA 1QJU1 4Y20B 3U0ZA 4JGYB 2HEWF 1GWKA 3ASIA 4MLOA 3EYPA 2R072 3E5UA 4XURA 3APBA 1YIFA 2DDUA 4CP1A 3TEYA 3H1MA 3POEA 4DPNA 3FJSA 4JGYC 3V65A 1N1SA 2NQYA 5DZFA 3UGGA 1ZA7A 4UF0B 1YFXA 3JQXA 4DIQA 5FK7A 4MSVA 4UBGA 5DN2A 4QGNA 5EWSA 3USUB 3INAA 3BB6A 4YVSB 3TYJA 4LOSA 2BDRA 4PHZA 3J7NA 1HRV3 2WZPP 2QQJA 2XWJB 2R073 1DZQA 1OC1A 2W1QA 5TSWA 4YGCA 4D7SA 4CP2A 5FKCA 2AZ5A 3WW2A 4XUTA 5FZEA 3B5LB 5JPNB 3DKQA 3Q8EA 2ZGTA 4L2NA 4OUSA 4Q4Y2 2VW2A 4J1XA 1G86A 5A3MA 1GOGA 1AYN1 4IEUA 2VNGA 4NRQA 1GOHA 3ES1A 4KWUA 1RVF1 5BNNB 4CDXA 4BQ3A 3BPSA 4E9KA 3C7FA 4N90A 1R1A2 3NMBA 5ABJA 3DXUA 1F4AA 2RDNA 3KF3A 1CX1A 1JHJA 2P6CA 2DURA 4XQ4A 4FPGA 4LBQA 4GA9A 5FREA 1J3PA 1RUOA 3OD4A 4IV1A 4RSUA 4CPBD 3I7DA 2JE9A 1XPWA 2AGSA 3WDXA 4PDWA 1SPPB 4QKDA 2G9ZA 1MR5A 4GWNA 4Q29A 4YZ3A 1ZRIA 2CU5A 1DYPA 4IGOA 2XONA 5LBFA 4FQZA 1TME3 1OA2A 2YY1A 1YO8A 4AEDA 2JG9B 2ARCA 4K8RB 1SMVA 3W21A 3CJXA 3ZN4A 3JXSA 3VBOB 3WDYA 4LK7A 4A44A 4CE8A 4AR2A 1UPSA 4TN7A 3MIGA 1OT5A 5A32B 4FTBA 2VQ0A 3BTYA 3ZYFA 1DHKB 4QB6A 3RWNA 2JG9C 5HXMA 1W8NA 2YDEA 3RGBA 5IUQA 2ZX0A 1ASJ2 1KITA 4FPKA 5A33A 2OKXA 4V2VA 5I0TA 3E6DA 3MBWA 5FP7A 5GZFA 1CAVA 2RS11 5FZGA 1RXGA 3UETA 5L36A 1UU6A 1W8FA 1WGPA 4RFRB 2AEYA 4EWAA 1NCRB 5LBCA 4QB1A 5FV3A 4LIVA 5M0TA 3BTAA 3VZNA 5A3TA 1WCKA 1SG3A 4CDWC 4YZ2A 4Q0PA 1AL0G 4EN8B 3ZVXA 2VR4A 3RQ0A 5JZGA 5LWBA 1OMIA 1K5MC 2KD7A 1W0NA 2VC9A 3MIFA 2B46X 1RUJ2 3MPBA 4YM1A 1XQNA 2JE7A 3DGTA 4LUMA 4U36A 4XFCA 1TME2 3W20A 5J7MA 2VJXA 2X53S 2Y26A 2WFF3 4OCTA 3LIHA 3FHQA 4HONA 4Q1PA 3OYWB 3MF9A 3VD4A 3PTYA 4KQ7A 2J1TA 3KGZA 1OSGA 2XH6A 1OLRA 2XBO2 4NROA 5J96B 1HXS1 4CDQC 3T0DA 2R7EB 1D4VB 1NXD1 2VCBA 2EVXA 2YC2A 3CZUA 3EB7A 3VZOA 4JGYA 4P9IA 3LSEA 4D8MA 5ACA3 2RJLA 2Q8DA 4BM8A 4N9HA 5DDJ1 2FD8A 1BKZA 1DYOA 1OKQA 2Z2SB 3AKSA 3NAPB 2WO1A 1D4M1 1WUVA 2BFUS 2G4IA 4XF3A 5FZFA 3VDAA 1IG0A 2GDFA 5L19A 1JZ2A 1QQP1 1XRUA 4ZY9A 2ZABA 2ZHKA 2C26A 5F32A 3VBUA 1EAH2 1WW6A 2QZ2A 3BODA 4DXSA 5C7GA 2WBKA 2JJ6A 4Q0VA 4GZ9A 1ALYA 1REEA 1M4WA 2UWCA 3MEPA 4P00B 5D8AC 5JPMB 1YXWA 4LPLA 4E2GA 5HBAA 3THTA 1CR7A 1CN1A 1NAEA 5LRRA 2ZMNA 4MHRA 5T55A 2HYKA 3AZVA 3RZLA 3CQOA 4I3GA 2VMDA 4Y4YA 2YBKA 2ET7A 3AL5A 4JGZC 4AVCA 1ZA4A 2RM23 1EAH3 1BK1A 4LE3A 5H9PA 2FDJA 4E2SA 1H1AA 4JDMA 2W1WA 5FZ1A 1MZ6A 5LA0A 3O0XA 2Y6JA 5DZEA 1AR92 1U5IA 2WWSA 3FLPA 3KF5A 5ABJB 4MGQA 4LE4A 4QKNA 5IK5A 5DMYA 1Y9QA 3G7DA 2IZWA 3O0WA 5EYXA 2D6PA 3IB3A 5LY2A 3UKTA 1BYHA 5F5IA 3PJQA 2XQXA 2JENA 1PO22 1RHI3 1UX6A 2RS51 2WNVA 3AZXA 3PTRB 1LGCA 1YNAA 3WSOA 4CEWA 1W3XA 1B09A 1LESA 2TUNA 4Q0QA 1LGNA 1PX3A 4CCEA 3NL1A 4AVSA 1POQA 2JIJA 4QXHA 3VKOA 3RZMA 2XQRA 2RMU2 3CJIC 5FZLA 5GZEA 3RNSA 1VBD3 4N43B 4EWDA 3VBFC 2QDNA 4QQLA 1U5ZA 2DF7A 4R8HA 2MNGA 1DQ1A 4NIAA 1RHI2 2WZR1 3I59B 4BXFA 3ZXGA 4ZU5A 2XUEA 4AE2A 4XHBA 5F3IA 3WG4A 1LNSA 4G3YC 1BZWA 5FPBA 5AC91 1SEFA 3LF7A 1IPKA 4OHZA 3VHPA 1W04A 4FTEA 5BNQA 2CHHA 5ERLA 5CYYA 1V6MA 2A3WA 2HKXA 4MV2A 5DAPA 3THPA 1AL22 5E1RA 3K75B 2FDFA 2HWF2 4M3CE 1W9TA 1WCUA 4BLJA 5BNOA 4TXWA 3TEZA 2WNVC 3K4AA 1LOEA 1JYVA 1DU3D 5GLVA 2VZSA 1SPPA 3DF0A 2VG9A 4F3JA 1ULGA 2QQOA 4RGAA 5I0DA 1S0IA 1JI6A 3ZSKA 4LOTA 1MVEA 3L2HA 3BPZA 4Q1RA 1IZ3A 2ZEXA 4JX0A 1AXYA 2JDNA 3BCWA 1QJX3 2E63A 4FBFA 1I6XA 1RUI2 5IK8A 4RGGA 2A6WA 2BBVA 4DY3A 3BKZA 4XFAA 2J1VA 5L7OB 1PNGA 3IAQA 3ST7A 5HV0A 1AR73 4N7IA 4Y22A 2LTNA 2ZMKA 2QQUA 1YQ6A 4YM3A 1JOJA 2ZX2A 3Q9OA 5JUVA 4B7KA 1ZBA2 1YIPA 3O1SA 3VBSA 2ARBA 3M4FA 2HBUA 3QACA 5F5QA 3T2TA 2DU0A 2FCVA 2YBPA 4CCNA 1UY0A 2C24A 1ODMA 3S6PA 2HLEA 2OIIA 2W1SA 2QQPA 3O1PA 2BVVA 3JBG3 1NCRC 1RUC1 1RUJ1 3D4KA 3ACGA 2WSUA 3NAPC 2P3KA 1E5RA 1RTVA 3WW1A 2VQUA 4FO9A 4W50A 4OI0A 4AFAA 4KWLA 1HN0A 1DLCA 4HG6B 4OI2A 5A3WA 2R061 2V09A 1LCLA 4O9GA 4YRDA 5GLUA 4I0AA 5CEHA 1GU3A 4MX3A 5KC5A 3EJKA 4QKBA 2E33A 4HVOA 2F6BA 2K2SA 1HRI1 3DN7A 2PXJA 4OLLA 4J6GA 2JECA 1DBNA 4Y20A 1CPNA 4Q4V2 3MLKA 1YQ2A 3N9LA 3WQ7A 2DTWA 5F5AA 4YW7A 1JYCA 1QH7A 1F15A 2VBBA 5F2SA 3ZYIB 3PURA 4GD4A 4OULA 2GZWA 4CCDA 1ZBA3 3AMQA 1NQDA 2YUEA 4BQ1A 1EUTA 4GKXA 1VR3A 2R071 1IKQA 5F9TA 2WDBA 3UJQA 5CBLA 4EN6B 5LEKA 1ND3B 4JKMA 5JR2A 1V6NA 2D3SA 2XHNA 4BYYA 3FL7A 3P5BA 1MZEA 4XFIA 1VBD1 4GALA 1JZ6A 5T52A 5JOZA 1LAJA 5FK8A 3UGHA 4NHXA 4DZGA 3BALA 3IZOA 1JZ5A 1N3QA 3ZYPA 1VBB2 5C8WA 5JSRA 4JHZA 3LA7A 1HQLA 4XQWA 1UN1A 3VHNA 4A3ZA 3KQRA 1G9BA 3QH6A 2AR6A 3I59A 1PVC3 2QQLA 1AR91 3P3NA 5FOBB 5A7WB 5IFTA 4AXOA 4Z2WA 5FBZA 1X8MA 5JDBA 1DZTA 2LS6A 4K6BA 4M4RA 1RJ8A 4CCOA 3HEIA 1ZZ7A 1N3OA 2YU1A 4QD2A 3SH3A 2IWGB 3RVHA 3IIAA 2JDZA 1RVF2 2VGDA 1LEDA 1BJQA 1R092 2VZTA 4PI2A 4XIKA 5FYBA 1PO21 1R1A1 2A6VA 3ZYBA 2WNEA 2BQPA 2XJSA 3O1RA 1JU4A 1SFPA 1OA3A 3N9PA 1X82A 4OI1A 1YFWA 1ZBE2 1MEC2 3OY8B 5FBJA 4D6QA 1AYN3 4MGZE 5SV8A 4WM8C 1RUD1 2WC2A 5B4XA 4B1MA 4F83A 3Q8FA 5ANNA 1LHWA 1QNYA 2NMOA 5FPVA 4HK8A 4HKOA 4UW3A 4ZZ8A 1WMDA 1S0GA 1X8EA 5A7PA 2DVBA 3NV2A 1H8VA 4JTOA 1XYNA 2WQ4A 3HQUA 5FXWA 3ZX7A 4EZHA 3U78A 1RB8G 4Z2AA 1MS8A 1KD7A 1S55A 4XOGA 2RS13 5A6QA 2ZACA 1QOTA 2VW1A 3VLBB 3VD7A 3GBFA 1WKYA 1W8UA 5JOYA 4IE5A 5F37A 2YC4A 4XJUA 1HB3A 4WZCA 2WNUC 5CISA 4JDOA 1H6XA 2LM3A 1NCRA 5C8CC 2PAMA 4NWWA 1OPMA 5HI0A 5ISLA 1F5JA 2OS2A 3ZXKA 1OOPB 5I0SA 1SQ4A 2H0BA 1ND3C 2Q30A 4Q4W2 5EYYA 1W9WA 2Y60A 4ATEA 5CFCB 2A6XA 3HQXA 1RUH3 4DOUA 1AUYA 2B8MA 2VZ1A 2ZGRA 5EFUA 2VCAA 4P9WA 1GQPA 4CDWB 1SCSA 4CPBA 1FYUA 1REDA 1HXS3 3AMHA 3MIBA 3N3HA 4HFSA 1QOOA 3TNQA 5F7UA 4FSJA 2E31A 4XUOA 4EE2A 5CKNA 2RJ2A 5B2GB 3Q8BA 4BQ2A 5FY0A 3I3DA 4FP3A 4NJ4A 4Y1VA 4XAEA 3AB0A 3J8F1 5FMOS 3NO8A 4K8FA 2ZS6B 4MGYE 3UK9A 1ZBA1 1DQ0A 1F5FA 5IVEA 1UOJA 3ZKUA 3FHAA 3LOIA 4E8DA 5JMCA 1YCIA 3ATGA 4GH4C 3PJYA 2HEVF 1KFXL 4FPEA 4A6SA 3AP4A 1G7YA 3OGGA 3HWJA 1ST8A 4W8JA 1VE0A 3W58A 4QXCA 5LEJA 3NV3A 5FYTA 3LE0A 3ZN6A 4JRAA 2A6ZA 4QB2A 4HBNA 5FQ0B 2VE1A 3K46A 1M06G 1XE8A 2ADEA 1G9FA 1L3JA 1SLBA 1LU2A 4OQ8A 5FPXA 1MS9A 3CMGA 2HJIA 4AL9A 4QDSA 4QXKA 3QCWA 2P4EA 3O0VA 1FV2A 1QJY3 1VBA1 2G1MA 2YROA 1LKNA 4PIXA 3U1XA 4GWJA 2CTVA 1FMD3 1G6NA 4NPRA 4COVA 1UZWA 1BMV2 2W9XA 1RINA 2IXLA 5A7WA 4COZA 3GHMA 4V1PA 2WFF2 4I2OA 1C5IA 2ZHMA 2DBIA 3FMGA 3WF2A 4NHMA 1RJ7A 4Q4X2 3SISA 2R1BA 2RG4A 3OCPA 1QJU2 3DPRC 4FXGB 1UYYA 4QHOA 3GCWA 1CIYA 3UT0A 2C5DA 1POV3 2P3YA 2A70A 4UWDA 1D7PM 4NHKA 1NX9A 4M3CA 3SMHA 5I0RA 2EXKA 2DTYA 1CX4A 1IPSA 4FCAA 5FP9A 4QM9A 3H1YA 2RM21 3WLUA 1NXMA 2YYOA 2Y6FA 4IV1C 1C1LA 2UYAA 4ITCA 2X5IA 2EIGA 3KCYA 4QPIA 1NA1B 4N8MA 4RFT0 2AH2A 4XHXA 4DY5A 3I97A 5C3OA 5HCHA 4LORA 4WM7A 2F4LA 5C6CA 5E16A 2CYFA 4EN0A 3ZR5A 5AC93 2JWPA 1OD3A 2MEV3 2YGMA 5FY5A 1RUF1 4Z1VA 3DUIA 2PFWA 4K7JA 1YC61 3I2GA 5C8CA 2VOVA 3PNAA 4P9GA 1R093 1K42A 4A3XA 4NIGA 3CZJA 4AEMA 3J7LA 1VMFA 2QCSB 1PZ9A 4ORFA 5C4WA 4YVWA 1UPIA 3AM2A 1DG6A 3DL3A 4L97A 3LEKA 3MZHA 1ULPA 1WBFA 4ZS2A 2V72A 2WZR3 1UYZA 4XILA 4N53C 5AC92 3RZKA 2BUKA 4MVTA 1TE1B 2ZEYA 1NE4A 5FKBA 4YW6A 4SBVA 1JYTA 1DGRN 4H55A 4CEWB 2DBNA 1RUE3 2WYFA 1ZYBA 4XDPA 2BZDA 1CWPA 2VW0A 4LA3A 2PHLA 4O7XA 3R6SA 2VCMA 2IC1A 1NYWA 2W2IA 1J3QA 4RS5C 5A80A 2W87A 1FPN2 3WF1A 1CONA 4LO8A 2KXLA 1W6OA 3T0AA 2PAEA 4QQ2A 1ZZBA 2JICA 3USSA 1BEV1 5LBBA 4DEQA 4LKDA 3ZIWA 2UYBA 3PU3A 4B8EA 2D97A 2WA4A 4GB32 3NV1A 2VAUA 1AX2A 5H9RA 4ZPIA 3TOJA 3NNLA 2E7TA 1U5XA 3K51A 1W2TA 4MOAA 4NPLA 5A7QA 5LCWL 1RUC3 5LW9A 4NIDA 2QVSB 2Z5WA 2ZPXA 4UXAA 3ME2A 3PVNA 4HK9A 1PMHX 3B9IA 1W05A 2JD4A 4PDWC 3K48A 3ZPOA 1KJLA 2VVFA 1VP6A 1MQTA 5A7SA 5FDBA 1SLIA 1NE6A 2WZ8A 4DRVA 3WQ0A 1W8TA 2K9ZA 2RDQA 2W1UA 5BNOB 1VLNA 2YZ4A 1VRBA 3B02A 1VBA3 2BBAA 2C6SA 1HV0A 1NCQB 2O8QA 4KH9A 3CO2A 4XYXA 2PHDA 3HNMA 2A5ZA 5F6LB 3E5XA 2BEOA 4P9XA 2BVBA 4RQPB 4GIQA 4UYBA 3AJYA 1WZXA 1TME1 2QJVA 4RHV1 3JBG1 4JV4A 5IJRA 2XG3A 3CIHA 3NKGA 2FBEA 2VL4A 1ULCA 3DPRA 4FTSA 5JAXA 3JB4C 1SBEA 1WW7A 3PUHA 4I0BA 2ZX1A 5A3OA 3UV9A 4BQYA 4ATFA 4XF1A 2YG0A 3A4UA 1R083 1GLHA 4NO4A 4ASLA 3V0BA 5LBEA 1TVGA 2YPJA 4BDVB 5HXVA 1W0OA 4PLMA 2R063 4OHYA 3C8XA 4XJAA 2WSVA 4QPIC 3ZSLA 2GH8A 3IDAA 2Z4FA 4LULA 2CSGA 3SCHA 5C3PA 2C0ZA 2Q8CA 2PELA 4AWDA 4TTGA 1WMEA 3V56A 3SH4A 2ZXQA 4SLIA 1VAKA 3M7AA 5FYUA 2CDOA 1XNAA 4XABA 1AR93 4Y26A 4FPJA 4YNIA 1VBD2 1KFUL 4IW3A 3RMYA 1DGLA 1JBCA 3S30A 4YVWC 4LO4B 3F95A 4COWA 2EA7A 2WAOA 1FI2A 1ZZ6A 4P02B 2EICA 5LA1A 2JG8A 3I2HA 3PVEA 4XVHA 3EBRA 4FPOB 4R4XA 5FXXA 3PL0A 3NJVA 3HN3A 4LITA 3LSDA 4TYSA 1RGSA 2IXHA 4IEOA 4IEQA 5DAVA 2Y0IA 2R0FA 1UKGA 2RMU3 4QPGB 1VJ2A 4LJHA 2MEV2 4M3CF 4R9CA 5FYZA 3ZDVA 3AXDA 3AKPA 4BIOA 1WW4A 1V00A 4LR4A 1UL9A 1JYIA 3VDDA 5FWEA 1F9KA 2B4KA 2RS52 1GR3A 3ETQA 1QJEA 5GLTA 4IEWA 4IEYA 1GYKA 1NZIA 1DFQA 1RMU2 3BOWA 1VRH1 1ZX5A 2A75A 3KSCA 4QPYA 2J1RA 4XDOA 2X5IB 5FMDA 4ASMB 4PBPA 1UWWA 1XBFA 4NOTA 3BUCA 1OBNA 3GBWA 3AP5A 2N7GA 5CB7A 1R1ZA 2CL2A 3KVBA 3OUJA 4IETA 4AEKA 1Y43B 4RS5B 3WUCA 4R4ZA 3O5SA 1OH3A 3JQWA 1BBT3 4ARXA 2QTWB 2BP6A 2C9AA 3O1VA 4FOQA 4QQOA 1DCSA 2J1AA 2GNDA 1W6NB 4P5YA 2KR2A 1MS3A 1LU1A 1RUH1 3LA3A 4LBMA 3B00A 3MFAA 4Y33A 3THDA 2VMFA 4XCAA 5GKAC 1AJOA 3R4UA 1GNZA 5FMOL 1S4CA 3EHKA 3ZXJA 2VH9A 2SLIA 4IV1B 3TB0A 1BQPA 1NLRA 3G6JB 4LHLA 4Q4W1 2RS53 4YWAA 5T54A 2LW8A 4XF0A 5LK5A 1ASJ3 3NNGA 4R9AA 1NCQC 5EJ1B 3OUIA 1RMU3 2IXKA 1VAMA 2ZOEB 5F2WA 3WZ1A 3ZXAC 1GZCA 1RC6A 2FZ1A 1PK6A 3MUY1 1UMZA 5JR7B 2VTFA 4P08A 2DUPA 4KBBA 3WCRA 3B9CA 4IV3C 5FYCA 4Q4V3 2FZ2A 1UMIA 4MXWA 3WW4A 5LASA 1Q3EA 4CDQB 4ZZ5A 3ZXEA 3HVDA 5IVVA 4BQWA 2W94A 3OPWA 1Q43A 1PM4A 3A7QA 1O8PA 3P6BA 4PJYA 4JQTA 1COV2 3PUIA 4NAMA 1HQWA 3AC0A 2Q4SA 1DLLA 3B93A 4TLFA 5BPXA 2W91A 2QFEA 4IEXA 2D44A 4QX8A 2RS31 2D7FA 3K77A 5C3RA 2XJRA 1FAYA 3TNPB 3KD4A 4A6OA 5E6HA 4WM8B 4BQ5A 1A8DA 1GUIA 5FMCA 3ETPA 1MQTB 3RPQA 1OXCA 4XUPA 4C1WA 3H8RA 2YXSA 2VZVA 4OYUA 1H30A 1YQ5A 4RHV2 2JB8A 1UXXX 3FHIB 3LDRA 5BUVA 3PMSA 1VB2A 3DV8A 3NWKA 4N9IA 5F39A 3T1MA 3OUHA 4DQAA 1H6YA 1L7QA 1NCQA 2R062 1AX0A 2JXAA 4FQ4A 5FR3A 5KHIA 1IOAA 2JB4A 2WABA 1FOD2 2BYVE 3JUUA 4LMFA 1UNBA 4BZ4A 2PQQA 2JDYA 2OPKA 4IE7A 3RMXA 4YYOA 1HIXA 4XMAA 3M1HA 4RA0A 3M70A 2WT1A 3IWZA 1NG0A 3AJZA 4LBNA 4IEPA 4RL7A 3ZMOA 1HRI3 1VBE2 1R082 4QPGA 4IE0A 3V0BB 3N4MA 4Q4X1 5T3NA 3NAPA 2OQ6A 4HSJA 4EQVA 5JWPA 2DCZA 4WVMA 3UGFA 2OZJA 1FMD1 5GALA 3TEWA 1GV9A 1CESA 3J7MA 1IQDC 5FQ0A 4ONUA 4XPVA 3E6BA 2RM22 4YM0A 3OPZA 4YG0A 5FIXA 4R9BA 4KU7A 4AVVA 3LAGA 4LIUA 5FJHA 3GHNA 1XYPA 1VBB1 1MZ5A 1O5UA 4KG0A 1POV1 4AI1A 3L9JT 2XKPA 2VM9A 4W4ZA 1K5MB 1ZZ9A 1OVPA 5I8TA 4FPHA 3R4SA 4M0NA 4KBZA 1LHOA 1T6BX 5C4WB 5I93A 4URTA 4ZONA 1OLME 1L7RA 2YV8A 2X8KA 3MV11 1LRHA 1AR81 4GULA 5C70A 2MEV1 1C57A 5FO9B 1ZRCA 3OBAA 3RZHA 1XNTA 3A21A 1R091 3CHXA 1SBFA 3K4ZA 1SFNA 1GP6A 4H7MA 2CV6A 2GC1A 5EJZB 1JN2P 2ENRA 2BNOA 3GZUC 5CZKA 5E8AA 3ZM8A 2GP3A 1V70A 3MUZ1 4UF0A 5EP9A 1RMU1 3VD5A 1PO23 3BTZA 1PK6C 4AHYA 3USUA 4LEJA 3VDDB 2ZKLA 1TZOA 1V0AA 2CGNA 3TN92 2WYSA 3VBOA 5CA6A 2VZUA 3M3EA 5BV6A 3CBNA 3N7KA 3LFIA 1NLSA 4WM7B 1T6GC 2W39A 4F7ZA 1Z78A 2HWC1 4I01A 3X29B 3AZYA 4UFLA 2W3JA 4S2HA 5A6YA 4L8QA 1O4ZA 1TMF2 1CAVB 4ZKTB 3ZXDA 4XXAA 4GB31 5L9RA 1H9PA 1ZZ8A 4HLTA 3SEPA 1S2KA 1BEV3 1BHGA 1SBDA 1JZ4A 1LB2A 2P6HA 1MZFA 1PGW2 4GH4A 4LXLA 1R1A3 3WNOA 1VBC1 4NAOA 1W28A 3O1MA 1X50A 5CVRA 4LKEA 1HB2A 3KHBA 5FPZA 1SACA 4YFZA 2BWAA 4DUVA 5EIYB 5FYIA 4IESA 2WLQA 1W8ZA 5G05L 3UNPA 3ZFGB 4PLOA 1AR72 4R52A 1AJKA 3B69A 1DGRA 3GXUA 2VECA 4E2QA 2V73A 5AVAA 5KBFA 4MADA 1CPMA 1RUG2 2WUHA 3HJRA 5F1RA 3S0MA 2YFZA 2GC0A 1QJX2 4UBHA 4ZXEA 3WNLA 2H0VA 2AYHA 3QOPA 4FFIA 3MDPA 5A33B 5IK7A 4P9YA 4QX1A 5EZWA 3FBMA 2ATFA 3NNJA 3FN9A 3WP4A 3MLJA 2DCKA 1E57A 2LUWA 2B9VA 4XJWA 3NKTA 1YI9A 4MGIE 3ACHA 4I0WB 3LEMA 1OOPC 3ZSEA 3H8UA 1GNYA 2YGLA 3HBZA 3O7OA 4BWOA 2NPIA 3AFKA 3H50A 3VBHB 2PHTA 2BW8A 5H9QA 1UY1A 4OMDA 1V9U2 3VN4A 2A73B 1FNYA 4X8NA 4L92A 2W0XA 4XETA 3ZXFA 1NT0A 5FZ6A 5J98B 3U10A 2IFWA 2O0OA 2K46A 3OYWA 3N9QA 2AREA 2UURA 2BTVC 1AR83 1NQJA 1Y9MA 3H0OA 3OPTA 2WWJA 1UZYA 3H3ZA 3LA2A 4I09A 3T4HB 4MH0E 3IDCB 4GMP0 1W8OA 5AFBA 4FPCA 1QJY1 4AFDA 2BPA2 1QJZA 5A7NA 3K3OA 3OTFA 4AQTA 5ABJC 4IEZA 3MI8A 4O65A 3AX4A 5FYMA 3U14A 1CGPA 5JXJA 1E5HA 4INDA 5JI7A 2PHRA 4HVRA 4AK3A 4KGQA 3WG2A 1EYBA 5DXDA 2VZPA 5HCAA 1PMIA 1NA1C 1D2SA 2ARXA 3HOBA 2ZBJA 2IXIA 3UJOA 3ACIA 3AKTA 2JE8A 2OW4A 2B42B 1HQNA 2E7QA 1EUUA 2GMEA 3RYPA 1YQ8A 1Q56A 1LTEA 1ZRRA 3WP5A 1GMMA 4HN1A 4PF5A 2DVAA 1AF9A 4YG6A 4RGKA 5CIRA 1AXKA 4JKKA 3WEZA 4RS5A 4C8DA 1YEWA 4EN7B 1US3A 3IN9A 3OBZA 4PBOA 4RD7A 1CIWA 5JSPA 3MLLA 2BGOA 3N7LA 3OF1A 3SXWA 5AFEA 1JODA 4LBKA 5A1FA 4M00A 2TBVA 1Y4WA 4PQ9A 3VHOA 1ND2A 1SDDB 4CA9A 3FLRA 1HX6A 1QU0A 4KNCA 5FY1A 3POSA 3T2OA 3V64A 2VTXA 2DFCA 3Q8CA 5F6KA 1K3IA 3IDEA 2BFUL 4LUKA 1V6JA 1E5IA 2ADDA 3K3NA 5JVVA 3TN93 3WV6A 1UOBA 1S1AA 3MYXA 5A3PA 4DFSA 4ZU4A 1US2A 2GSYA 2VBDA 4O9EA 1VIWB 4XC9A 4HVQA 1MQTC 1ZBE3 3A0KA 1BBT1 1GBGA 4NPMA 2PHWA 3T09A 2RVAA 4YW4A 2GALA 3VBRC 5J09A 2ZEWA 1C5HA 1RUE1 1FPN1 1WMFA 2FHRA 2ZAHA 4I02A 4LBLA 3ZR6A 5CFDC 4BMEA 4HKLA 2BRTA 4ISQA 4YG3A 1A3KA 4BPZA 5FLJA 5K0UC 4XBLA 4HPKA 4CDQA 4CCCA 2IUWA 1BEV2 4J25A 3ZMNA 3RDIA 5JOWA 1OD5A 1N3PA 4ZXKA 1AR61 2ZZJA 3I3BA 4IQPA 3KV5A 5K0UB 5T5OA 1QIQA 3WNXA 1ND2C 1ASJ1 4P9JA 3CNAA 3O1TA 4G9SB 5K4LA 1JYNA 1VBC2 3AYAA 4B29A 4RYDA 1IHMA 1NY71 4CP9B 3EMRA 4IGQA 3KB5A 1CZSA 1V6KA 3R05A 1STMA 1JOPA 2HWB1 2RS32 3CDZB 2QQMA 2RR13 4AAXA 4H2AA 3WF4A 3U37A 5BY5A 5L7OA 5CFCC 3MO4A 1YJLA 4XF4A 3D3AA 2NMNA 3ORJA 1W6QA 4BK4A 5I8SA 4CCKA 4N7UA 5LA9A 5KHGA 3KVAA 4V2WA 2VOKA 1QMJA 4YSFA 3DCQA 2HH9A 4TLGA 3KZ4C 5HPOA 5K7PA 4XDQA 2R0HA 1YI7A 3I3EA 3SKVA 1TNFA 2D40A 2QE3A 3HD8B 3OSDA 3ZYJB 3T2QA 5A1AA 3VUOA 3AVSA 4AFCA 5FXZA 3U75A 2VMGA 2HBTA 2K0GA 1WLWA 2HWF3 3C7OA 1RYYA 1HW5A 1VPHA 5GLWA 3DEMA 4WVMB 4JC1A 2W47A 1AX1A 1VBE1 4ASKA 4Y5TA 5CADA 4A45A 1EAH1 4E8CA 3DYOA 1B35A 4YW1A 2VCCA 4PT6A 2DVGA 3WOGA 2VO5A 1GANA 3D82A 4YZ4A 3OEAA 3VBHA 4XE9A 1YJKA 2PYTA 3SCGA 4A2UA 4AVBA 2J42A 4ET7A 4F8AA 2H6CA 2FMDA 1OF3A 5IAXA 1BCXA 1PGL1 4RHV3 1U5YA 3WP3A 3N36A 3OEBA 2IXCA 2XHKA 1JZ8A 1U12A 1X7NA 4GMP1 4A7KA 4B1LA 1FT9A 1SLLA 2VZOA 2PN5A 2VNRA 2XPJA 2GC2A 2FCTA 5JCTA 1Q8VA 3I3QA 4C90A 1QJU3 1UF2C 1RL3A 1WLDA 3AP6A 4C0BA 2FMYA 1SFYA 1QY4A 1WD3A 5FJKA 5FPAA 3RRDA 1W0PA 2DCYA 2GNMA 3LWCA 3MV01 4QAWA 4XBNA 2D43A 5CFDA 4XF9A 4DUXA 3L2YA 1PO12 5F3GA 2OZ6A 2UWBA 3WW3A 4MGTA 3P1IA 4LO5B 2VY0A 4GJYA 1OHFA 2ERFA 2SBAA 5D8AB 4QPIB 4BA6A 2JX9A 2PMWB 2P1BA 3WNMA 2E6VA 3D6EA 1XOYA 3J26N 1WCQA
chains in the Genus database with same CATH topology
2VUAA 1FNZA 1IS3A 3ZN5A 2JEMA 4FOYA 3EXUA 2XJTA 2HWE3 4A7YA 4IEVA 4Q0UA 4ISRA 3IKWA 1JTZX 4YVWB 3KCXA 1RUH2 1TMF1 2RR11 2YMZA 3GBGA 3AYCA 5CFCA 1XXNA 4OVEA 5J36A 5SV5A 4TSVA 5BYNA 2XJVA 2R30A 4Q4Y1 4GB33 4BLIA 3VZLA 2D6LX 2VUJA 2WL1A 3PVOA 2RHPA 4OFGA 4XZPA 4P5HA 5BNPA 1TEIA 3A0NA 1W6QB 2E51A 1DQ6A 4NN0A 2TEPA 4D3WA 3N7MA 1MEC3 1SLAA 3IPVB 3WINE 1OOPA 1C4RA 2P34A 1S0BA 2Z69A 5GZGA 1RVF3 2HWE2 1HV1A 3C2UA 2DUOA 2XB6C 1TNRA 1B35C 1COV1 2VOWA 1QJX1 3KM5A 2HWB2 4E4DX 5KWRA 1QXPA 4GH4B 1O7FA 4HANA 1Q8OA 2Z79A 3M2MA 1YYNA 3MF6A 3WG1A 3ZFEA 1UZZA 1ENQA 1I1EA 3KS7A 1UIKA 1PNFA 4AFBA 1OFSA 1LJ7A 4Q4W3 4YGDA 3WD5A 4FT8A 4Y1YA 4X8PA 3M3QA 4M01A 3D8CA 2HEYF 4CTEA 5FO8B 4PCRA 2G9FA 5GZCA 1J59A 1X33A 2W68A 2D6NA 1RUJ3 1WCDJ 3AZWA 1H2MA 4PIZA 1O4TA 4Q4V1 2EAKA 4YFWA 1Q8SA 1H1IA 1X36A 1N1TA 4Y1UA 3NVCA 4LO6B 1APNA 4YW5A 4MUVA 4JGZB 3B3QE 3RI8A 4FPLA 3E6CC 4B4QA 4AI3A 4ES9A 4AGGA 4H3WA 3N7JA 3TBDA 1AZDA 2DWRA 4CDXC 2XL7A 4QQPA 1O3SA 3JU9A 1GZWA 2O8OA 1CQ9A 4HETA 1MS0A 4KU8A 4Y5Z0 1D4M2 2XGXA 4RR3A 1NZCA 2Q5TA 3VKFC 1QF3A 1F31A 1HRV2 4YLZA 1VBB3 2D93A 4PIYA 3VBRA 1OQEA 3JZVA 1AXZA 3FUQA 4AG4A 3CJIB 3HN1A 1PGSA 4FOWA 2R49A 1LGBA 1LHUA 3OD0A 1PM7A 1H8TA 2GNBA 4NHLA 1C8NA 4GQ7A 1FPN3 3B7MA 3SITA 4B4RA 1VB4A 3FE5A 1AYM1 1ULDA 1H4GA 2XVLA 4LBOA 5KHKA 3M8LA 2NP0A 2QUOA 3JD71 4LHKA 1MEC1 1A78A 3B01A 1XNBA 2VNOA 4HL0A 4IL7A 1H4HA 1I3HA 3TN91 1BBT2 4UW4A 1CAUA 1AR63 5CAZA 5T5LA 4HPKB 4D94A 1ZREA 3MICA 2X5IC 4LBQB 1ZZCA 3VKMA 4GXLA 2VMIA 3VBUC 1PHMA 2ZGKA 1PIV2 2I07B 2DUQA 2XL9A 1KS5A 2Y38A 3SNMA 1CAXA 5J37A 2ILMA 1AR62 4YVSA 2JG9A 3ZPYA 4UW5A 1O4YA 5C4WC 4K20A 3WHTA 1CAWB 1WCSA 1RHI1 5T5PA 1LODA 1NY72 4Z82A 5FTTC 1G9DA 4PDWB 2AENA 5GZDA 1C28A 1UCXA 5E89A 4W6YA 2HWB3 1LOCA 2ZX3A 1AVBA 5LK7B 4W65A 2HWF1 5A32A 2HWC3 3J8F2 2A3YA 1J1TA 1MS5A 1V6IA 4BE3A 4D7YA 4YZ5A 2YHJA 1RUG1 3VZJA 2ZZQA 3VBHC 2ES3A 3ACLA 1G9CA 2EAAA 1CJPA 4WVZA 4AQ2A 2X29A 3UKVA 1JUIA 3VV1A 1LR5A 4M0HA 4JGZA 1MACA 1VALA 1PVXA 1CD3G 2IXJA 2PTMA 1B35B 1RUI1 4AFMA 4LLFA 1H1MA 4YGBA 1Z7S3 1RITA 3ZFFA 2ET1A 4RR3C 3RYKA 1XE7A 2GMPA 1FOD3 3E97A 3B94A 4Q27A 3SLIA 3SHRA 4RQPA 4YGEA 3NV4A 5FO7B 3M3IA 3FZ3A 4RR3B 1W39A 4AHWA 1ZM1A 3ILFA 5DUUA 1VBA2 2NN8A 1D0HA 1GZ9A 1LEMA 3DKWA 1RUC2 2H6BA 3OGJA 1QKQA 1FXZA 2UWAA 3CJIA 4IERA 2Q1MA 1C8M2 1IKPA 1BXHA 1Q8QA 3J4UH 3POYA 3ROUA 3SCFA 4XJ9A 1IS6A 3POWA 3WDVA 3KT7A 2WA3A 4YW2A 3HMYA 5FOJB 2GU9A 1LOBA 3N35A 2WNUB 1DF0A 1POV0 1XYOA 1ZRFA 1WW5A 3VGIA 3S7EA 4JCKA 4K40A 2ZHNA 1W6PA 1EV13 1YLLA 2DCJA 3H9AA 1BVP1 2R6QA 1PO11 2IFRA 2WINB 4N43C 4JVAA 4XEZA 4EN9B 1YFYA 2EALA 1S0DA 2XVKA 4PLNA 2D6KA 5JIUA 4U2AA 1KS4A 5ACA2 1LOFA 4YZ1A 2PLV3 4Z07A 1PVC1 4CEYB 4CYDA 4MZUA 1QNWA 1H2NA 5KHJA 3ILNA 1C8M3 2ZKNA 3LKJA 3WDUA 1GICA 1I5ZA 3TAYA 4XJZA 1AYM2 1RUF3 2WIIB 5I8YA 2RR12 3NJZA 1H8TB 5KXBA 2VVEA 1GFF2 3LCPA 3WT3A 5BNNA 5CFDB 3CLPA 1MS4A 1V6LA 2ZX4A 4L99A 3ZYRA 1RUE2 1TMF3 4N43A 2Y0OA 1DGWA 3ZFEC 2NYYA 3EO6A 4QX5A 5JLVA 2KA3A 5FAXA 3EQEA 3MFCA 4XBQA 4KL1A 3WQ1A 1KRIA 1RUD2 4Q26A 1IS5A 2AUYA 4LTAA 3ECQA 3J9SA 3ZFFC 4HT1T 4D7TA 3KT1A 5K8SA 3HIFA 1QXJA 5KXCA 4DRRA 1RUNA 4Z8BA 3HAGA 1HDKA 1NOVA 2WLPA 2A3XA 2XKOA 2HWD1 2LALA 4AEJA 1CAWA 3P3PA 4FOVA 2DU1A 2XLAA 4XJ8A 1GQGA 1ENRA 3TRSB 3OBRA 3IPVA 4WVVA 3VHRA 3VKLA 3VL9A 1XU2A 3ZFGA 5JZGB 4GKYA 1OA4A 3MGUA 4K1ZA 1FATA 3MW4A 2XJUA 3RJRA 4LBQD 3LB9A 4C91A 4Z92B 1C1FA 3WDWA 1KJRA 1EV11 4DS0A 2WS93 3VDDC 4WVWA 4FAGA 1D2QA 3ZFEB 1PO13 3URFA 2GN3A 4N53B 3FUOA 3RI9A 1QWRA 1TQ5A 2R32A 1IPJA 1LOFC 2GNTA 1XNKA 1N1VA 2A6YA 2GN7A 1DQ4A 4BIFA 3ZXLA 4DINB 1YUDA 4MXVA 3VBRB 4EWEA 1PGL2 4G4FA 1C8M1 1ND3A 3JCIA 2UY9A 4X6QB 2VPVA 2WFPA 5CNAA 3FWEA 1HRV1 4BOWA 1WA4A 4Y1XA 1D0GA 5J48A 1SCRA 1EP0A 2P3IA 4GMP3 2R041 5HCFA 2CGPA 2P2KA 1RIRA 3I4IA 5E88A 3D5OA 3FFQA 1BMV1 1VBE3 4TZDA 3OJBA 3H7YA 2WNUA 4AW7A 1Y3TA 4LT5A 1JUHA 3AZZA 3ZYGA 2I74A 2ZHLA 2ZGUA 4NWVA 4HKWA 2D5HA 4YFZA 3JD72 4LLOA 5T5JA 2PLV2 5EV7A 2VULA 3U11A 5C9AC 3E5QA 4E4SA 3HR9A 2OVUA 3WUDA 4L9BA 5JI9A 1DQ5A 1H2LA 2A71A 4QGLA 5FCCA 1ULEA 1LULA 3RYRA 3S0MA 3OY8A 1CAXB 3W9AA 3C3VA 1AHSA 3TWIA 4K9SA 1UU5A 1XU1A 4IV3B 3CEWA 2ZA9A 2PHUA 4AHZA 4CEYC 4HMZA 3UKNA 3PLQA 3RZZA 4BHPA 5A3LA 2Q0AA 2R1DA 1RUF2 4QPGC 1A6CA 5CG9A 5H9SA 5EXOA 4OUMA 2TNFA 1IGOA 1O3RA 1GKBA 3I2DA 1YWKA 3GNEA 3KGLA 4Y24A 1YHFA 4BH9A 2P3JA 2ZJCA 4WZFA 2BGCA 4BCUA 3NSTA 2BNMA 1XNDA 4XIOA 4UW6A 3AK0A 3AP9A 3BIWE 3UL2A 3GYDA 4RQPC 1QDCA 1Z7S1 2XWBB 4CDWA 1AL23 2HWE1 1V6OA 2PHXA 1U0AA 1S0FA 3V0AB 1PIV3 1XNCA 2D5FA 3ZFFB 4WM7C 1COV3 2VMHA 5L73A 4Q4Y3 3SH5A 2E53A 3VZKA 1FX5A 4I30A 3RJ2X 3VKNA 3VBSB 2DVFA 1QDOA 4CRQA 3FFZA 1D4M3 1LHNA 3H3UA 4OHXA 5JOXA 3AMMA 4QU2A 3WVJA 5T50A 5I0UA 1QQP3 4HZFA 1VAVA 4Q4X3 1DGWX 3IM0A 4COYA 4C0HA 1RUI3 1FOD1 1Z0HA 4OHVA 1UW8A 1SDWA 2W52A 4XTPA 4AEDC 2D6MA 4GWMA 2PA7A 4TWTA 2D6OX 1R081 4XMIA 3JBG2 2RJKA 4XFBA 3KLSA 4OI4A 1DIWA 1QHDA 4FPFA 2XLGA 1HKDA 2ZMLA 1W6PB 2WS92 3ZN6B 1UKRA 2WQZC 4N53A 4YW3A 4Q0SA 2WT2A 3WXPA 1C3HA 1ZRDA 4JRLA 2B39A 3U07A 5JZGC 4CEYA 1OPOA 2D98A 4QQHA 3ES4A 2B5HA 2R042 2BWCA 3BOPA 1REFA 2D3PA 3MW2A 1LECA 2WJSA 1AR82 4CEWC 2MHFA 1PVC2 4CP0A 4FXKB 3GZAA 3QD6A 1UAIA 4LA2A 1JW6A 2XUMA 2E7AA 4S2DA 1QGLA 4YVSC 4MYEA 1V9U3 3LGRA 2VOXA 3MIEA 2ZGMA 4EV0A 5DUWA 2XBO3 2PLV1 3VBFA 2F4PA 5CG8A 4D69A 4CDXB 3AFGA 4K1YA 1WD4A 1NA1A 1S2BA 1ZNPA 2CNAA 4LO7A 3ZIXA 1ULFA 5LRSA 1HLCA 1JHNA 2EF6A 1BVVA 3JD73 2VU9A 3HT2A 2Z42A 4H14A 4LBJA 2HWC2 1S0EA 4Q2FA 3FC0A 4M3CB 5GM0A 4AGVA 1WBLA 2I45A 1SLCA 1OI6A 1O5LA 5HCBA 3W59A 2JKBA 1ND2B 1PIV1 1H8TC 1OFNA 2ZGOA 1N47A 1VRH2 2HWD3 1WLTA 4P14A 2RMU1 1GSLA 3IT8A 5FLIA 3ZFGC 4K21A 2R16A 1UU4A 5D1IA 1AYN2 2P17A 1PGW1 4FVVA 1DYKA 3IDBB 3BU7A 3FX3A 3IMNA 1AYM3 2JG8C 2VQAA 3KT4A 3OBTA 1VRH3 2HWD2 4W6WA 3WP6A 1YFUA 2V5YA 2UY8A 4AI0A 4QHBA 1OQ1A 1QXRA 3FLTA 1W6OB 4META 4P9LA 3ENRA 4KG8A 1LOAA 1H0BA 2ZGLA 3IBMA 5DG1A 4QMAA 3VBSC 3AYDA 1Z7S2 1S0CA 1G8WA 4XXPA 1LOGA 5KC6A 3CU7A 2WT0A 1EPZA 1QOSA 2B45X 3AMNA 4EROA 3WCSA 5K0UA 2GC3A 2B9UA 2EXHA 3KCCA 3O12A 5IT6A 1RUG3 4AHXA 1KQRA 2QNKA 3NW4A 1S0JA 4ZU7A 4XFGA 4FAHA 2QDRA 4YM2A 1SLTA 2OYZA 3DPRB 2G9GA 4E27A 1O3TA 3AMPA 3AKRA 4JTNA 1EV12 1F2NA 1KXGA 5IK4A 3QLQA 2GH2A 1QH6A 1J3RA 1H2KA 3O14A 4S2GA 5DUXA 4HSLA 2DCTA 2NLRA 4AI2A 1CJDA 4IXLA 3RS6A 3WG3A 5EJ3A 3QH7A 2BNNA 3RSJA 4WV8A 5BNOC 3M3CA 4AQSA 3AP7A 1YRZA 4CDUB 1IQAA 4EJRA 1QJY2 5GJ6A 2PAKA 4Q8KA 4AGRA 2D3RA 2CWSA 3MIDA 1W6MB 5C9AA 3GALA 2DFBA 2RS33 1PZ7A 3MW3A 1ZVFA 2PHFA 2XBO1 4AF9A 2CAUA 4A7ZA 2ZGNA 3QBQA 4LNVA 1G9AA 2DYCA 1HRI2 3S7IA 5K9YA 1DQ2A 2JG8B 1Y7BA 1Q8PA 4YARA 5DDJ2 1MS1A 1UIJA 4JQRA 5BNNC 2GMMA 5KXEA 1A8MA 1ENSA 1JH5A 2KM2A 2ZGPA 2P37A 2R043 2WKKA 1IS4A 2OUHA 3WR0A 4DMIA 4KGGA 4Y1ZA 1FMD2 5ACA1 3ZO0B 2WNVB 2A7AA 1RUD3 4XFFA 5DDJ3 3R0RA 5I91A 3U4XA 4XTMA 3ZSMA 4NVPA 2EXIA 1LENA 4C1XA 4BMBA 1O3QA 4KWJA 5C8CB 4OHWA 5L7OC 3GF6A 2Q1ZB 5DG2A 3ELNA 4W6XA 2OA2A 2FQPA 3JB8A 2DVDA 3ALQA 4L11A 3MPPG 4KWKA 3VBFB 3ILRA 5D8AA 3AKQA 1KDKA 4X6RB 3ZSJA 1CVNA 5C33A 3CF6E 1CAUB 3LOBA 3H7JA 1URXA 4E4ZA 1ONAA 3R4DB 1W2UA 1EPWA 4K3UA 3ZDSA 4NR1A 1ZBE1 1GNHA 1DZRA 4XW3A 3I54A 4CZSA 2QKDA 4JAAA 4DXZA 4IV3A 2C1FA 3V0AA 3KMHA 5GLZA 4COUA 1LHVA 3LZZA 1FV3A 4Q8LA 2XJQA 2WZR2 1N1YA 2CY6A 2RE9A 3CL1A 4WBBA 4AQ6A 5JSOA 2XVGA 2ZTNA 1VBC3 1OLQA 2ZGQA 3HT1A 3PHMA 2ZGSA 3PVBB 4FP2A 5BNPB 2B7YA 3VL8A 1AL21 4S2FA 5AVPA 1PK6B 3D0JA 5FLHA 1W6NA 4DNYA 4J1WA 3D0SA 5DZGA 3VZMA 5J3UA 2UU8A 3WY6A 2RS12 4MXWB 4WM8A 3H1WA 1J1LA 1ENXA 2VXRA 4CDUC 2DV9A 3AYEA 2GAUA 4LHNA 4ES8A 2XLFA 4AVAA 4AYUA 5KXDA 3RG0A 1W6MA 2ZCWA 3AXEA 3J8F3 5C9AB 4AEDB 1KDMA 1MVQA 3VBOC 1AR71 5FFOC 2E9QA 5JIAA 4R9DA 2W08A 1UD1A 1Q5OA 4AVTA 4JDNA 2NZ9A 1PZ8A 3WX5A 2WS91 4FPYA 1HXS2 3MIHA 1OQDA 2ZAAA 5KHHA 2ETEA 1WLCA 4Y22B 2OUJA 3VBUB 4HN0A 2EXJA 3WDTA 1F8VA 5CU1A 2CGOA 3GZTB 3M3OA 2O1QA 2QZ3A 4MGKE 4B4PA 4QGMA 5DUVA 1QQP2 3I8TA 3WHUA 4XQDA 1V9U1 4CDUA 4OZXA 2CAVA 1GZWB 4XFHA 3FBYA 2I2SA 1H9WA 3PMEA 2YC0A 1O91A 4QM8A 1J58A 1JXNA 5BXXA 2XJPA 4H7LA 4AI8A 1GQHA 1K5MA 1EY2A 2Q8OA 4QT6A 4B3NA 3T1LA 5FRAA 2CWMA 4DB5A 2NM1A 5BNPC 2WFF1 2MPFA 4I3PA 4B7EA 1I9RA 2VVDA 1QJU1 4Y20B 3U0ZA 4JGYB 2HEWF 3ASIA 4MLOA 2R072 3E5UA 3APBA 1YIFA 4CP1A 3H1MA 4DPNA 3FJSA 4JGYC 3V65A 1N1SA 2NQYA 5DZFA 1YFXA 3JQXA 4MSVA 4UBGA 4QGNA 5EWSA 3USUB 3INAA 3BB6A 4YVSB 3TYJA 2WZPP 1HRV3 2XWJB 2R073 1DZQA 5TSWA 4YGCA 4D7SA 4CP2A 2AZ5A 3WW2A 3B5LB 5JPNB 2ZGTA 4L2NA 4OUSA 4Q4Y2 2VW2A 4J1XA 1G86A 5A3MA 4IEUA 1AYN1 2VNGA 3ES1A 1RVF1 5BNNB 4CDXA 4E9KA 4N90A 1R1A2 5ABJA 2DURA 4XQ4A 4FPGA 4LBQA 4GA9A 5FREA 1J3PA 1RUOA 3OD4A 4IV1A 4RSUA 3I7DA 2JE9A 2AGSA 3WDXA 4PDWA 4GWNA 1MR5A 4Q29A 4YZ3A 1DYPA 4FQZA 1TME3 1OA2A 2YY1A 1YO8A 4AEDA 2JG9B 3ZN4A 1SMVA 3CJXA 3VBOB 3WDYA 1UPSA 3MIGA 5A32B 4FTBA 2VQ0A 1DHKB 3RWNA 2JG9C 2YDEA 5IUQA 2ZX0A 1ASJ2 1KITA 4FPKA 5A33A 5I0TA 3E6DA 5GZFA 1CAVA 2RS11 5L36A 1UU6A 1WGPA 4EWAA 1NCRB 3BTAA 3VZNA 1WCKA 4CDWC 4YZ2A 4Q0PA 1AL0G 4EN8B 3ZVXA 5JZGA 3RQ0A 1OMIA 1K5MC 3MPBA 3MIFA 2B46X 1RUJ2 4YM1A 1XQNA 2JE7A 3DGTA 4LUMA 4U36A 4XFCA 1TME2 5J7MA 2X53S 2Y26A 2WFF3 4Q1PA 3OYWB 3MF9A 3PTYA 4KQ7A 3KGZA 1OSGA 2XH6A 1OLRA 2XBO2 5J96B 1HXS1 4CDQC 1D4VB 1NXD1 2EVXA 3VZOA 5ACA3 4JGYA 4P9IA 3LSEA 2RJLA 4BM8A 4N9HA 5DDJ1 1BKZA 1OKQA 2Z2SB 3AKSA 3NAPB 1D4M1 1WUVA 2BFUS 2G4IA 4XF3A 2GDFA 5L19A 1QQP1 1XRUA 2ZABA 2ZHKA 3VBUA 1EAH2 1WW6A 2QZ2A 3BODA 2JJ6A 4Q0VA 1ALYA 1REEA 1M4WA 2UWCA 3MEPA 5D8AC 5JPMB 1YXWA 4E2GA 5HBAA 3THTA 1CR7A 1CN1A 5LRRA 2ZMNA 5T55A 2HYKA 3AZVA 4I3GA 4Y4YA 2ET7A 4JGZC 4AVCA 1ZA4A 2RM23 1EAH3 1BK1A 4LE3A 5H9PA 4E2SA 1H1AA 4JDMA 1MZ6A 3O0XA 5DZEA 1AR92 1U5IA 2WWSA 3FLPA 5ABJB 4LE4A 5IK5A 1Y9QA 3G7DA 2IZWA 3O0WA 5EYXA 2D6PA 3UKTA 1BYHA 3PJQA 2JENA 1PO22 1RHI3 1UX6A 2RS51 2WNVA 3AZXA 4CEWA 1LGCA 1YNAA 1B09A 1LESA 2TUNA 4Q0QA 1LGNA 3NL1A 4AVSA 3VKOA 2RMU2 3CJIC 3RNSA 5GZEA 1VBD3 4N43B 4EWDA 3VBFC 2QDNA 4QQLA 1U5ZA 2DF7A 4R8HA 2MNGA 1DQ1A 1RHI2 2WZR1 3I59B 3ZXGA 4ZU5A 4AE2A 4XHBA 3WG4A 4G3YC 1BZWA 5AC91 1SEFA 4OHZA 1IPKA 3VHPA 4FTEA 5BNQA 1V6MA 2A3WA 2HKXA 4MV2A 3THPA 1AL22 5E1RA 2HWF2 4M3CE 5BNOA 4BLJA 2WNVC 1LOEA 1DU3D 5GLVA 4F3JA 3DF0A 2VG9A 1ULGA 4RGAA 1S0IA 3ZSKA 1MVEA 3L2HA 3BPZA 4Q1RA 1IZ3A 4FBFA 1AXYA 3BCWA 1QJX3 2E63A 1I6XA 1RUI2 5IK8A 4RGGA 2A6WA 2BBVA 4DY3A 4XFAA 5L7OB 1PNGA 3ST7A 1AR73 4N7IA 4Y22A 2LTNA 2ZMKA 4YM3A 1JOJA 2ZX2A 3Q9OA 4B7KA 1ZBA2 1YIPA 3VBSA 2ARBA 3M4FA 3QACA 3T2TA 5F5QA 2DU0A 3S6PA 2OIIA 2QQPA 2BVVA 3JBG3 1NCRC 1RUC1 1RUJ1 3D4KA 2WSUA 3NAPC 2P3KA 3WW1A 1RTVA 4FO9A 4OI0A 4AFAA 4KWLA 4OI2A 2R061 2V09A 1LCLA 4O9GA 4YRDA 5GLUA 4I0AA 4MX3A 5KC5A 3EJKA 4HVOA 2F6BA 2K2SA 1HRI1 3DN7A 4OLLA 4J6GA 2JECA 1DBNA 4Y20A 1CPNA 4Q4V2 3MLKA 3WQ7A 2DTWA 1JYCA 1QH7A 3ZYIB 4OULA 2GZWA 1ZBA3 3AMQA 1NQDA 2YUEA 4BQ1A 4GKXA 1VR3A 2R071 1IKQA 5F9TA 3UJQA 5CBLA 5LEKA 4EN6B 1ND3B 1V6NA 2D3SA 4BYYA 1MZEA 4XFIA 1VBD1 4GALA 5T52A 5JOZA 4DZGA 3BALA 1N3QA 3ZYPA 1VBB2 5C8WA 5JSRA 3LA7A 1HQLA 4XQWA 1UN1A 3VHNA 3KQRA 1G9BA 3QH6A 2AR6A 3I59A 1PVC3 3P3NA 1AR91 5FOBB 4AXOA 4Z2WA 5FBZA 1X8MA 5JDBA 1DZTA 4K6BA 1RJ8A 1ZZ7A 1N3OA 4QD2A 3SH3A 2IWGB 3IIAA 2JDZA 1RVF2 2VGDA 1LEDA 1BJQA 1R092 5LK5A 4XIKA 1PO21 1R1A1 2A6VA 2WNEA 2BQPA 2XJSA 1OA3A 1X82A 4OI1A 1YFWA 1ZBE2 1MEC2 3OY8B 1AYN3 4MGZE 5SV8A 4WM8C 1RUD1 2WC2A 4F83A 1LHWA 1QNYA 2NMOA 4HK8A 4HKOA 4UW3A 1WMDA 1S0GA 1X8EA 2DVBA 3NV2A 1H8VA 4JTOA 1XYNA 2WQ4A 3ZX7A 1RB8G 1MS8A 1KD7A 1S55A 4XOGA 2RS13 2ZACA 1QOTA 2VW1A 3VLBB 3GBFA 5JOYA 4XJUA 4WZCA 2WNUC 4JDOA 2LM3A 1NCRA 5C8CC 2PAMA 4NWWA 1OPMA 5HI0A 1F5JA 3ZXKA 1OOPB 5I0SA 1SQ4A 2H0BA 1ND3C 2Q30A 4Q4W2 5EYYA 4ATEA 5CFCB 2A6XA 3HQXA 1RUH3 4DOUA 1AUYA 2B8MA 2ZGRA 5EFUA 4P9WA 4CDWB 1SCSA 1FYUA 1REDA 1HXS3 3AMHA 3MIBA 3N3HA 4HFSA 1QOOA 3TNQA 4FSJA 5B2GB 4FP3A 4Y1VA 5FMOS 3AB0A 3J8F1 3NO8A 4K8FA 2ZS6B 4MGYE 3UK9A 1ZBA1 1DQ0A 1F5FA 3LOIA 5JMCA 1YCIA 3ATGA 4GH4C 3PJYA 2HEVF 1KFXL 4FPEA 3AP4A 1G7YA 3OGGA 3HWJA 5LEJA 3NV3A 3ZN6A 4JRAA 2A6ZA 5FQ0B 4HBNA 1M06G 1XE8A 1G9FA 1L3JA 1SLBA 1LU2A 5FPXA 1MS9A 2HJIA 4QXKA 3QCWA 3O0VA 1FV2A 1QJY3 1VBA1 2YROA 1LKNA 4PIXA 2CTVA 1FMD3 1G6NA 4NPRA 4COVA 1BMV2 1RINA 2IXLA 4COZA 3GHMA 4V1PA 2WFF2 4I2OA 1C5IA 2ZHMA 3FMGA 4NHMA 1RJ7A 4Q4X2 3SISA 2R1BA 3OCPA 4FXGB 1QJU2 3DPRC 2C5DA 1POV3 2A70A 4NHKA 4M3CA 3SMHA 5I0RA 2EXKA 2DTYA 1CX4A 4FCAA 3WLUA 4QM9A 3H1YA 2RM21 1NXMA 2YYOA 4IV1C 1C1LA 2UYAA 4ITCA 2X5IA 2EIGA 3KCYA 4QPIA 1NA1B 4XHXA 4RFT0 2AH2A 4DY5A 4WM7A 5C6CA 5E16A 2CYFA 4EN0A 5AC93 2MEV3 2YGMA 4Z1VA 1RUF1 3DUIA 2PFWA 4K7JA 5C8CA 2VOVA 3PNAA 4P9GA 1R093 4A3XA 4AEMA 4ORFA 2QCSB 1PZ9A 5C4WA 4YVWA 1UPIA 3AM2A 1DG6A 3DL3A 4L97A 3MZHA 1WBFA 2WZR3 4XILA 4N53C 5AC92 2BUKA 4MVTA 1TE1B 1NE4A 4SBVA 1DGRN 4H55A 4CEWB 1RUE3 1ZYBA 2VW0A 4LA3A 2PHLA 3R6SA 2IC1A 1NYWA 4RS5C 1J3QA 1FPN2 1CONA 4LO8A 2KXLA 1W6OA 2PAEA 4QQ2A 1ZZBA 2JICA 3USSA 1BEV1 3ZIWA 2UYBA 4B8EA 2D97A 2WA4A 4GB32 3NV1A 1AX2A 5H9RA 3TOJA 1U5XA 2E7TA 3K51A 1RUC3 2QVSB 2Z5WA 2ZPXA 4UXAA