2VULA

Thermostable mutant of environmentally isolated gh11 xylanase
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
193
Chain Sequence
b'AQTCLTSPQTGFHNGFFYSFWKDSPGTVNFCLLEGGRYTSNWSGINNWVGGKGWQTGSRRNITYSGSFNTPGNGYLALYGWTTNPLVEYYVVDSWGSWRPPGSDGTFLGTVNSDGGTYDIYRAQRVNAPSIIGNATFYQYWSVRQSKRVGGTITTGNHFDAWASVGLNLGTHNYQIMATEGYQSSGSSDITVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GH11 XYLANASE
publication title Engineering Hyperthermostability Into a Gh11 Xylanase is Mediated by Subtle Changes to Protein Structure.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 55
structure length 193
sequence length 193
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vulA00
2B45X 3LB9A 4XQ4A 1UU5A 4S2DA 2DFCA 5K9YA 2DCYA 1BVVA 3AMQA 3WX5A 1UU4A 3MFCA 4HK9A 3VZLA 3AMMA 1OA2A 4S2GA 3VHOA 3VL9A 2DCJA 1XNCA 4HKWA 3B5LB 4S2HA 1F5JA 2JEMA 3VZKA 1T6GC 2B46X 3VZOA 3WY6A 3AKSA 3WP6A 2BWCA 3B7MA 1UKRA 5K7PA 3WQ1A 1OA4A 2JENA 1W2UA 1OLRA 3MFAA 3WR0A 4NPRA 3AKQA 2QZ3A 1XXNA 2BWAA 1ENXA 1HIXA 1QH6A 2QZ2A 3RI9A 5HXVA 1H4GA 3VLBB 3RI8A 3WQ0A 4XQWA 3WT3A 3VZJA 2C1FA 1C5IA 1H8VA 1OA3A 1KS5A 2DFBA 4IXLA 3VL8A 3VZNA 1XYPA 2DCKA 2F6BA 1XYNA 1TE1B 1REDA 2BW8A 1H0BA 3MF6A 1YNAA 4S2FA 1XNBA 1HV1A 2Z79A 4HK8A 1XNDA 3WP3A 2NLRA 1QH7A 3VHNA 1OLQA 1XNKA 3LGRA 2BVVA 4H7MA 1H4HA 3AKTA 1REFA 3WP5A 3M4FA 2VGDA 5EJ3A 3AMNA 3O7OA 3ZSEA 1XYOA 2NQYA 4XPVA 1M4WA 1C5HA 1UU6A 2D98A 3WP4A 3EXUA 3VGIA 1HV0A 1KS4A 2VG9A 3AKPA 3AMPA 3AKRA 2JICA 2VULA 2B42B 1H1AA 1REEA 1BCXA 3HD8B 3VHPA 1AXKA 1NLRA 1PVXA 2DCZA 1BK1A 3VZMA 2VUJA 1IGOA 4XQDA 2D97A 3MF9A 4HKLA 4HKOA 3WXPA 3AMHA 3WQ7A
chains in the Genus database with same CATH superfamily
3WHTA 2ZX1A 4KU7A 1VBC1 2OZ6A 3AL5A 1CAWA 3IAPA 4LPLA 2A6XA 1COV3 1PK6A 2WT0A 4LKSA 5A1FA 2ZGLA 3MFCA 3CBNA 3RGBA 3ST7A 2WKKA 4AHXA 3AMMA 3PVEA 1GU3A 2GC2A 3SHRA 4YPJA 5M0TA 2GZWA 5K8SA 3U11A 4MGQA 1S0JA 1FT9A 2ZGOA 3TN93 4CP9A 5A3UA 2NMOA 2R061 5HPOA 2FDGA 3N7KA 4GQ7A 4BQ4A 5ACA2 4RFT0 1T6GC 4B7KA 1NCRC 3J8F2 4C8DA 5LW9A 1VPHA 5FKBA 2WFF2 2RMU1 4CEYB 5DZEA 4OI2A 2QKDA 4QPGC 3NNJA 3WQ1A 4N53C 3N4MA 4NIDA 1QJX1 1U5XA 2KD7A 5DUXA 5BNQA 5L7OA 3NVCA 1GR3A 1UPIA 2A5ZA 3N36A 4QPIA 5C9AC 5DAPA 2ERFA 2F4LA 5CG8A 2WNVA 1ENQA 2X29A 1RUF1 1TNRA 4L8QA 1S0BA 3IMNA 3MLLA 4UI9L 5AVPA 4C90A 3CIHA 4XDPA 4XEZA 4Z2AA 3OEAA 4COYA 3RZGA 4QX3A 3IT8A 3HQXA 2YMZA 2OT7A 1U12A 3ZPYA 4Q4W3 2RS11 4TLFA 2WYFA 3F95A 4XVHA 4JGZC 1HRV2 1LU1A 5JXGA 1W9WA 1XYPA 2D6OX 2F6BA 4RR3B 3AFGA 3U78A 2PHLA 1TE1B 1VBC3 4R4XA 2P1BA 3MF6A 1GBGA 4PIZA 5JI9A 1CZVA 1HJGA 1VP6A 5FMOS 3U0ZA 4MGTA 1YHFA 3LA7A 1DYKA 3G7DA 3JB8A 4Z8BA 3DF0A 1WA4A 4RGAA 3APBA 3TYJA 1ZA4A 3VBRC 2BVVA 3H50A 3WDVA 2BU9A 2WSUA 2WWJA 3OGSA 4LA3A 3H7YA 4ZU4A 2Q8EA 4URAA 4A4AA 2GNMA 2R063 5FLHA 5FXZA 2D3SA 5FPUA 5HBAA 4XFCA 2DUOA 5FRAA 3O0WA 4HPKA 3T08A 1ALYA 4BZ4A 1UY4A 2Y6HA 1QJX2 2A3YA 1QJU2 2RMU3 2W92A 4O65A 4ZHNA 2JXAA 3UK9A 1IQDC 1QJX3 5FUIA 3VDDC 1JZ6A 2R16A 2CNAA 2VMEA 2YDEA 2O1QA 5IVCA 3OPTA 3BTZA 4KG0A 2JDMA 3AK0A 2B39A 2YBPA 5JIUA 1WLDA 4A3XA 4FPOB 2GNTA 2DTWA 2CWSA 1Y43B 3PVBB 4JQRA 1RUF3 4RQPC 2RS12 3VD3A 4IV3B 1Q43A 3S5QA 5A3OA 5CEHA 3WDWA 4DNYA 3Q8AA 4I01A 5CA6A 4Q4V1 4MXVA 3Q8FA 3RDIA 3NJVA 5IW0A 3FMGA 1YWKA 1PVC2 2CHHA 2ZX0A 4GMP1 1F35A 5DUUA 1RHI2 3VBFA 5HCHA 4AI1A 1JYCA 4FQZA 2VOXA 5DAXA 5EPAA 4B4PA 4C1XA 1VBA1 3DYPA 4MSVA 1XSRA 4XDQA 5I0TA 1RC6A 5FK7A 5J36A 4OQ9A 1CAXB 1WCDJ 1PMHX 3AM2A 3ENRA 4GB32 1A8DA 4PDWC 2OIIA 4HK9A 4PI0A 4CPBA 5L36A 5IFPA 1A78A 1CESA 1ZBA1 2PQSA 3SC7X 1SFYA 4IUGA 4HANA 4CU6A 3MI8A 2BJSA 2LALA 1ZRCA 1CN1A 2JEMA 5FY5A 4AF9A 1JYIA 5FXWA 4CEWB 4P5HA 1CJPA 5I0SA 3MGUA 1LODA 4AXOA 2XJQA 3INAA 3OF1A 3GHNA 4W4ZA 2LRPA 5C3SA 1PM4A 3NRUA 3N9OA 2DF7A 3KGLA 1AHSA 1LEMA 3E97A 1ND3B 3ILFA 2A71A 5CKNA 4WVMB 4NPRA 2P34A 2Q8DA 1NA1C 2WYSA 1HN1A 4LE3A 2VNOA 3O1PA 4QHBA 3AKQA 1FV3A 2AR6A 4LORA 4CCMA 4Q4V3 1PIV1 3RVHA 4BIFA 1B35B 2Q1FA 3P6BA 2VVEA 3IPVA 4HFSA 3RI9A 3AFKA 4JRLA 1A34A 1VBA2 2XKPA 4LO8A 1YQCA 4ZS3A 1I6XA 2VNRA 4GMP3 1VIWB 2BZDA 1XE0A 1OT5A 1VALA 2CSGA 4HOOA 4O61A 3RQ0A 4GZ9A 4JGYB 3VZNA 1VBA3 1K12A 3IMMA 5E8AA 2C5DA 3HMYA 4GMP0 4AVSA 4DXRA 1N3PA 3WV6A 1C28A 3SCHA 1OQEA 4I02A 5ABJC 3M7AA 1UY0A 1SLAA 3VBHC 4EZ4A 1XOYA 1ZBA3 3ZYPA 3ETQA 5F5CA 4H7MA 2R073 2GALA 2BGPA 1E5SA 4IGOA 1R1A1 1WMDA 1WKYA 1HQLA 5EYXA 1S2KA 2WZPP 4I2OA 2YUEA 2PHFA 3EO6A 2VW1A 3LA3A 1JTZX 4TLGA 1STMA 2XPJA 2Y6GA 4UFMA 3AZVA 1AR92 1DQ1A 2DBIA 4CCLA 2E7TA 2NM1A 1IPJA 3JD73 4MGYE 3PUIA 5GM0A 3VKNA 1GOGA 3VGIA 4YVWC 3NO8A 1QHDA 4LBQD 3S57A 3EYPA 5LEJA 3BB6A 1PIV3 2PAKA 2XB6C 4ATFA 2YY1A 5IK8A 3J26N 1QDOA 4YGBA 1HRI1 2GH8A 2UU8A 5C3OA 1IKQA 3FZ3A 4YLZA 5LY2A 3UT0A 4PJYA 2OS2A 2YGMA 1GANA 3N7LA 4E4HA 5IVVA 5JDBA 4GXLA 1JZ3A 2W1WA 5I0DA 5FZMA 5K0UA 5IK7A 5LA1A 1F31A 1DLLA 1ND2C 1RXFA 3H1YA 4Q8KA 4HG6B 2RDRA 4W8JA 3EMRA 4P9XA 5FZ6A 3TNQA 1MS9A 5FYCA 2JKBA 4KG8A 3WEZA 1X8MA 4UFKA 2OX0A 1K5MB 2W1SA 4Y33A 4BA6A 3WNMA 1RUD1 3OGRA 4V2VA 4WVMA 1J3QA 5KHHA 4E8CA 3AP9A 4PBOA 1SLIA 2PXJA 1QWRA 1UYPA 1R1A3 2JDNA 2L9LA 2VCMA 4E4ZA 4F7ZA 4P9JA 2GMMA 1A8MA 4FI9A 3URFA 3IIAA 4HVQA 1RMU2 1KDKA 4D69A 2D5HA 1NCRB 1UO9A 4NE9A 3WLUA 4Y1YA 1J58A 1RUI1 4YVSC 3D8CA 1TMF1 3WNPA 1UZYA 5A3WA 1HDKA 3KWVA 4JGYA 4S2HA 3VBOA 2WNEA 4A7ZA 1VAVA 3H8RA 4QXBA 1WZXA 3SH4A 4UFJA 1J1TA 2WUHA 5FYBA 4BDVB 2BNMA 3ON7A 2QCSB 4QU1A 2RV9A 1NE4A 1OVSA 2QFEA 4FPKA 5LATA 2P2KA 2QQMA 1HRI3 2ZMLA 3LQCA 2VQAA 4GWMA 1K42A 2XWJB 2R7EB 3NV1A 3RJ2X 3VKMA 1ZZBA 1O4ZA 2OZJA 3B94A 4HVRA 4EYUA 1UQXA 2YG0A 5FY7A 2UWBA 5F2WA 3ACHA 1UYZA 2XQXA 3JB4C 5FXXA 5LA0A 3NNFA 1W2AX 1RUD2 3VLBB 4YW4A 1NOVA 4AVTA 1SG3A 2YU2A 1DCSA 2OYZA 5ERLA 2I2SA 3FFZA 1ZZCA 3ILRA 1VE0A 4OI4A 1MPXA 4XTPA 1RUD3 3H42B 1R1ZA 1V9U2 4BLJA 3ZYJB 5CB7A 2G4IA 4XDOA 1XYNA 4YFZA 5F5QA 1F9KA 3K75B 3SMHA 1R64A 4XFIA 3WG1A 3NJXA 2WT1A 4I30A 1S1AA 4IGPA 4MYEA 4AHYA 1RUI3 4QX8A 4N7UA 3THCA 1S4CA 5EYYA 1TMF3 2E7QA 4B4RA 1NUKA 1ULPA 1IPKA 3LPGA 1WW4A 1EV11 5A3TA 2F4PA 2GC0A 1W6QB 3CDZB 4XC9A 1GZCA 1ZVFA 2UWAA 1PGL1 4M4RA 2O0OA 2WO7A 4M3CF 2QQPA 3O14A 5FZ4A 1K5MA 1NZCA 2QDNA 3GZEA 3V64A 4K20A 4XETA 4CDWA 1NLSA 1KRIA 3HJRA 1N47A 2IVJA 4P5YA 1IKPA 2EICA 1H30A 3NJYA 5E6HA 3CL1A 4D6QA 1G6NA 5C7GA 3S5AA 3K3NA 2B5HA 3AMPA 1ZBE1 4QD2A 1NCQB 3PNAA 4XUNA 4CTEA 2TEPA 4YZ2A 4GA9A 4YG3A 1CR7A 2NPIA 4Q0UA 4GALA 1IS5A 3ZR6A 2B9UA 4ZS2A 1Z0HA 1NY72 3B00A 3WF2A 5A6YA 4OZOA 1PK6C 2R0HA 1FNYA 1SLTA 3WG4A 2D97A 4AWDA 2VE1A 4P02B 3AZWA 2ZEZA 1BJQA 1GP6A 1AYM1 2JG8A 5BNNB 2VH9A 3V0AB 4V2WA 4ZKTB 1EV12 2EAKA 1GYKA 4ISQA 2VUCA 3P1IA 2VUAA 2PELA 4Y1XA 2GAUA 2EIEA 2QQNA 1C4RA 2WZR1 4Z1VA 2OXBA 4PIYA 4EN9B 1AZDA 4B1LA 4Y4YA 5L9BA 4MG2A 1AR61 2QJVA 3BCWA 4OHXA 3USSA 4NPLA 4AVAA 2CYFA 4S2GA 4QWNA 3ZFFA 3ZYGA 4BISA 1JOPA 5CG9A 2WS93 3POJA 1U5ZA 5CIRA 4CYDA 2VBBA 2J42A 3K4DA 2JD4A 3LDBA 2UY8A 2VMHA 4M0NA 2WNVC 4IEQA 1C8NA 2BWCA 2FQPA 1NA1B 1Q3EA 1RUJ1 1SBEA 3FHQA 1T6BX 4H3WA 1ZREA 1EUUA 5FBJA 1TNFA 1ZBE3 2BFUS 4QDSA 4MXWB 3SCFA 4DFSA 1TVGA 2D43A 1OLRA 4EROA 3WVJA 4HXCA 4FP2A 1ZRDA 1DGWX 1PO12 2XL9A 5EJ1B 3FL7A 3WNKA 1YQ5A 2R1BA 1CGPA 1AYM2 4XILA 5A7PA 3ZDVA 3TOJA 2Y8KA 2W08A 3KHCA 5FUPA 1W6PB 2IFRA 1W05A 4XW3A 3GZAA 4LO5B 2BDRA 1UOGA 1SLLA 4AI0A 3I49A 3IWZA 3UGFA 2RM22 3VBHB 2Q0AA 3M3OA 2HLEA 5FZGA 1AR62 1ZRFA 3BN6A 1XPWA 3NAPA 2WZR3 5CFDC 2ORXA 2YB7A 3RS6A 4YZ4A 4NHXA 2JDPA 1AR63 5I0UA 2JDYA 4Y24A 1OC1A 5C5UA 3WNOA 1Y9QA 4LUKA 5D21A 1DQ5A 2V4VA 1ZZ8A 3PUQA 2JDZA 3PU3A 4M3CA 5IFTA 1CPNA 3VBSB 1XE7A 2FHRA 4YNIA 2RG4A 2RDNA 3RG0A 3THPA 5GLUA 1RUJ3 1VJ2A 2KM2A 1NYWA 4XUQA 2Y6FA 1Y9MA 3I7DA 4ZZ5A 3ATGA 3KMHA 4JRAA 1VBD1 3K46A 3JUUA 3OJBA 2XQRA 3WG2A 2CY6A 4NWVA 3OUIA 4LE4A 4K1ZA 5IVJA 1X9PA 4BHPA 5FP7A 5CKQA 5FQ0A 1O4TA 2YXSA 4RS5B 5F9TA 2CV6A 5FZDA 1NAEA 1OFSA 4F8AA 5C4WB 5LA2A 1ND2B 2SBAA 2AREA 4K9SA 2G19A 2JKXA 3CLPA 3ZXDA 4TYSA 1H2KA 4QDQA 3VHPA 4BK4A 3DPRC 4CP2A 4J6GA 1GV9A 2W87A 4NR1A 1RVF2 3T09A 2HWB3 4HN0A 3MYXA 3R0RA 4Y5SA 4MXWA 4E27A 5C33A 2VTFA 3WW1A 4CRQA 5JUVA 4FOYA 3H3LA 1CVNA 2V5DA 5AC92 2VCBA 3GZTB 3POFA 3R05A 2X53S 1KEXA 4ES9A 1BVVA 3LWCA 2DU0A 2CGPA 4Q1PA 3U10A 5L9RA 2ZA9A 5GZGA 1GZWA 2WABA 4QMAA 1J59A 2ZTNA 4LBQB 4TSVA 3KCYA 1F15A 3O1SA 5J1XA 4XJWA 4UT5A 3WW2A 4DPNA 4OMCA 2PLV2 3TRSB 4FFHA 4XIOA 1VBD3 2D44A 2W68A 2N7GA 1OLME 3HNYM 1XSQA 2ZOEB 4KWKA 1V70A 4CCKA 2CAVA 3VZOA 4DRRA 2CAUA 2RR11 4E2SA 1ULFA 1XU2A 4E2QA 4N43A 1D4M3 3RWKX 3THTA 5IHRA 4AQTA 1UKRA 3LKJA 3B9IA 4AEKA 3TEWA 4Y5Z0 2VQTA 2CDOA 1GNZA 1AR71 1D2SA 1W2UA 2D3RA 3AXEA 1HB2A 1K45A 2P6HA 4ES8A 4DUWA 1HQNA 4W6WA 4XIKA 4XFGA 1K3IA 4OUSA 3ZN4A 1DGRN 1QH6A 1UOFA 4W6XA 1SFNA 2IXLA 3N9MA 4Q4X1 4BPZA 3DYOA 1DFQA 4CUBA 4B1MA 3W9AA 1BBT1 3EQEA 3IDCB 1BMV2 3I2FA 4FP3A 3KSCA 2C0ZA 3ME2A 4UFHA 1OA3A 3MPBA 1WLCA 2W2IA 2XXZA 3AVSA 1H9WA 3LEGA 2A3WA 1D7PM 1RUG2 5DPNA 4AI2A 2VZUA 2J1TA 2BW8A 1HXS1 1E5RA 1Y9GA 3QACA 4S2FA 5C4WA 1LHVA 1NT0A 2VC9A 1ONAA 1QH7A 1QXJA 1OLQA 2XLFA 4EWEA 5FR3A 3WD5A 5KHIA 3D5OA 3P3PA 1H4HA 2RR12 1EP0A 3B69A 2JE9A 3VN4A 2DWRA 3MLKA 4CDUC 3HVDA 1J83A 2PHRA 2XONA 3CNAA 1BK0A 4DXSA 5JPNB 3SH3A 2Y0OA 3GCXA 2DCTA 4QQOA 4G4FA 5A70A 4TWTA 1WA6X 4Z82A 4FPJA 4ARXA 3GJAA 1RUC1 5GLWA 1N1YA 3J7HA 4EWAA 1PGSA 1AR73 3A0KA 4IE0A 1US3A 3PIGA 5K0UC 3LDKA 5DQ0A 4Q4X2 1UYYA 2WRAA 3VUOA 2I74A 4LLFA 4MV2A 3AKPA 5BNPB 2ORZA 2K46A 3CKHA 4LBQA 5H9SA 3V56A 2E26A 1OOPB 3RWNA 1AYN1 4QB1A 2ARAA 2WDBA 2XJSA 3PUHA 4FFFA 4LOSA 5JOYA 3FC0A 2YFUA 2QQIA 2P3KA 1BBT3 2VZ3A 1HXS2 5EWSA 2DTYA 1O8PA 1Z7S2 4YW2A 1A6CA 5CFCB 2VUJA 3E6CC 3AZXA 2CU5A 4NWWA 2HWD1 1PGW2 4K1YA 4QX1A 3GALA 5A1AA 1ENRA 2Y6KA 1JN2P 3RYPA 3BIWE 1GZTA 1XC6A 1QEXA 2OQ7A 2YYOA 2W5FA 3J7NA 5DG1A 5SV5A 4Y1VA 5T5LA 1DP0A 2XJVA 2QVSB 3IZOA 3LPFA 4LULA 1RGSA 3HT2A 3THDA 1LECA 2A6ZA 4FPCA 2Q5TA 2C4XA 1VBB2 4IERA 3ZSJA 1S0DA 2ZS6B 4WVVA 4HKWA 5ISLA 2JG9C 4P08A 3GDBA 1LHOA 2WZ8A 4D6RA 4YGCA 4IEOA 2OPWA 4JQTA 2NZ9A 2XVLA 1RUC3 5FWJA 4QKNA 3E1F1 5BV6A 4PCRA 4DO0A 5C6CA 1VB2A 3WP6A 4WM8C 1FMD1 3B7MA 4AFMA 3LZZA 4P9LA 3DKWA 4Q2FA 3VBUB 4PLOA 3MUZ1 4AVVA 1COV2 1OH4A 1IQAA 1AL0G 2Y34A 2EALA 3ZO0B 1UIKA 4OQ8A 2FDKA 1AYN3 1V6LA 4MHUA 1EYBA 4IGQA 5T3NA 4QQPA 5DN2A 2ZACA 1G9AA 2Q8CA 3MDPA 2Y6JA 4K40A 4PI2A 3U37A 4XJAA 5DDJ1 4W65A 2D7FA 3TN92 4LEJA 4YRDA 3D6EA 3I2IA 4ZXKA 1VRH1 2EIBA 2LTNA 4YWAA 5A33A 1HJFA 4XF9A 1ODNA 5FZHA 1W6MB 4JZRA 2HWD3 2ZX4A 3VV1A 3WHUA 3NSTA 2GMEA 5FKCA 2OW4A 4KBBA 1I5ZA 1IG0A 5KHJA 2DVBA 5BNPA 4KL1A 1O3SA 3RZLA 3TEZA 4ZPIA 3K4ZA 1HV1A 4UWDA 4HK8A 3POIA 4XZUG 4R52A 1GNHA 1FNZA 3POSA 4IETA 2X5IB 4CDWC 5AFBA 2YBSA 3Q8CA 4UW5A 5FJKA 5AFEA 2JD9A 1REFA 1FPN1 4IV1B 3UKNA 4YSFA 5CFCA 3VDAA 1FYUA 4B29A 3FE5A 4Q4W2 2XVGA 1OFNA 2LW8A 5A7WA 5GZCA 5KC6A 3E5UA 2Z42A 1QJZA 3GM8A 5D8AA 2FDJA 1FMD3 4XUTA 5T54A 1D0HA 4YGEA 1VBC2 2W94A 2XH6A 5BY5A 2VAUA 4LLOA 5T5PA 1GOFA 4E8DA 5JOZA 4FSJA 3N35A 4GH4B 1R081 4CDQC 5KHGA 3A0NA 2W95A 5GZDA 3T2OA 3I3BA 1VRH2 3J4UH 5CADA 2VMIA 3PVNA 5DDJ3 4BMBA 3KHBA 2VZQA 4AZZA 4ET7A 4ZZ8A 2R062 5IUQA 2RVAA 4YARA 1VRH3 1WMEA 3KV5A 5F1RA 5FLJA 5FZ3A 5FZOB 3V0BA 5BNOA 2EIDA 3WF3A 4FAHA 2W91A 1TEIA 1LB2A 4HETA 1DZQA 2JB8A 2RMU2 4WM7C 1MR5A 5A32B 3VKOA 2VCCA 3NKTA 4AG4A 3N9LA 1W8HA 2ZCWA 3HAGA 4QKFA 1QOOA 4XAAA 4ORFA 3VBUA 5T50A 2A70A 5LRSA 4LHNA 2QBXA 4HKLA 3VD9A 1O4YA 3ZFFC 1JYTA 4MGZE 5D1IA 4GAZA 5JWPA 3I2OA 3NQHA 4QB2A 4LOTA 1RUF2 2FDIA 3BKZA 3TAYA 4LT5A 2WO2A 1VMFA 3LB9A 4XQ4A 2VCAA 5GZFA 1XNTA 4R9CA 5KWRA 1LOFA 3UL2A 1FPN3 3KD4A 4LBMA 2VBPA 2VW0A 2R041 1W6MA 2ZGSA 1CJDA 3FUQA 4JTNA 4K8RB 1QJFA 2X10A 4C1WA 4Z92B 1CX4A 3ACLA 3RZHA 4M4PA 4CXXA 4I09A 4XUPA 3HIFA 4FAGA 1CAVB 1GWKA 4TZDA 2XVKA 5DAVA 1R083 1O5LA 1UXZA 1F5JA 3J7MA 1UMHA 4NAOA 3U1XA 4LR4A 1UKGA 4JHTA 4CEYA 4XJ8A 4E4DX 2VM9A 1O91A 4Q27A 2ZHKA 3PUAA 2YGLA 2XUMA 5LA9A 3B02A 4NAMA 5JR7B 4DMIA 1SBDA 2X5IA 3IKWA 3RFRA 1ODMA 2XR4A 3KVAA 1W99A 3KT7A 4Y26A 1H2MA 5AVAA 2ZZQA 2WNUB 1LHNA 4EN0A 3PVOA 4XE9A 2AACA 2QQWA 4F83A 3MV01 3IDAA 3ILNA 1QOSA 3K48A 3C2UA 3KM5A 1ASJ1 1RUE1 1W39A 3NAPC 4BQ3A 3RNSA 4C0HA 3JU9A 4UF0B 2R071 3SEPA 1W8WA 1YEWA 4GH4A 3M70A 1POV3 2XOMA 3S6PA 3N3HA 5CU1A 4RR3A 5APAA 3PJQA 4B7EA 1H8VA 1VMHA 2RHPA 4O9GA 1HB4A 5GLVA 4PLNA 2R042 1DHKB 5EFUA 1UF2C 4BLIA 4NJ4A 4INDA 3JD71 4MGSA 4Q4V2 5FZOA 5JOWA 2R043 3W21A 2DVDA 4RA0A 5DZFA 1MVQA 2IXIA 3NNLA 1UY1A 4KBZA 2WQ8A 3I2DA 3VB9A 3DV8A 4IEPA 1I5PA 1O3TA 1IS6A 5JZGC 1UZWA 1UMZA 4OHZA 1PZ9A 3MIFA 3ZN6B 2HBUA 3AJZA 5T5JA 3VHRA 2J7MA 2IC1A 3MPPG 5F3GA 3A23A 3I97A 4MO3M 3ZYHA 2NMNA 1WMXA 3ZXGA 2LUWA 2ADEA 1AXYA 4GWNA 4OZXA 1M4WA 4XHBA 1DGWA 3HBZA 1JBCA 4CUCA 1OF3A 2W1QA 1RUE2 1SLBA 1UNBA 1ZBA2 1GFF2 2XDVA 2XJTA 4UW6A 3EXUA 5FMOL 1UN1A 5FZLA 5A1LA 1JMUB 2I45A 2QTWB 2Q4SA 2R072 4IV3A 1D0GA 5C3RA 2BTVC 5CNAA 4R4ZA 1ASJ3 1RUE3 3G6JB 4H55A 5FFOC 3M3EA 5FPLA 3BODA 5JI7A 1DG6A 1UY3A 3T0DA 4YW6A 1RUNA 2O14A 4BQXA 1YRZA 3HD8B 2VZOA 4QGMA 1WUVA 1X7NA 2C9AA 5FZIA 1O5UA 1OSGA 3JD72 3R4DB 2VZPA 2EXHA 3DL3A 2D6PA 2G9GA 2HWE3 4OI1A 3H1WA 1KDMA 3LD8A 3HNBM 2YV8A 4D7TA 1YQ2A 1PIV2 1CAXA 2WNUA 3GCWA 4U36A 4AAXA 2VXJA 3CJIC 2ZEYA 3ZFEB 1BEV3 3MBWA 1TME3 1AJKA 3LEIA 3P3NA 5K9YA 4LBLA 1JZ8A 2DDUA 2XJUA 2HBTA 4N43C 2WL1A 3J9SA 5F3IA 2PHDA 1LRHA 4FTSA 3BI3A 1HX6A 5A3PA 2VOTA 1LTEA 3KVBA 2G1MA 4BXSV 1PHMA 4FO9A 2XJRA 3KT1A 3JCIA 1O59A 4CEWA 3M1HA 1W9TA 4OYUA 1JU3A 4NIAA 3WCSA 3FX3A 4WVZA 5F32A 4IEXA 1QDCA 2YU1A 5HXMA 1FOD1 2FCTA 4P9IA 4QXCA 3O0VA 4Y22B 1XJAA 2FMYA 4BB3A 5C8CC 5JLVA 1R1A2 1ND3A 2A73B 3FLTA 3JQXA 5FCCA 1JYVA 1Z78A 2QUOA 2ZJCA 1YXWA 3SITA 2DUQA 2ZAHA 4CCOA 1PO21 1URXA 3ZFGC 4IESA 4YM0A 2ATFA 2E31A 4LKDA 1YCIA 1B35A 1ULCA 1XXNA 2BOJA 3RMYA 3AP6A 1GQPA 3D0SA 3ZN6A 1X8EA 2P4EA 3POGA 1V6OA 2K9ZA 3S0MA 1KITA 2B9VA 3UETA 1SACA 3LFIA 5FP4A 3FFQA 5J98B 4FOVA 2LM3A 3ZMOA 3PMEA 1QMJA 2P6CA 4QPGB 4YGDA 5IAXA 3A4UA 1C5IA 4N53B 3SKVA 1KS5A 3BU7A 4R9AA 2DURA 5DAWA 4CDXC 1PNGA 1R091 4AQ6A 1HRI2 1GWMA 1OPOA 4P9WA 4XJ9A 5FP3A 3TWIA 1UAIA 5C9AB 1FV2A 2H0BA 5FZ8A 1OUXA 1OVPA 1RUH1 1W8TA 1AX0A 1YQ8A 1RL3A 2MHFA 2Z79A 4QPYA 2AYHA 1W9YA 3OG2A 2NLRA 4X6QB 4AFAA 3VDBA 4RYDA 1OMIA 1ZZ9A 2FBEA 1VMJA 2XKOA 4DY3A 1WD3A 2SLIA 2P37A 1W2OA 3O1RA 2D3PA 2JDUA 4I3PA 1DYPA 2VD7A 4IEVA 4JGZB 1W6NB 4CDQB 1AL21 4QX7A 5KR7A 3GBFA 1LCLA 5LWBA 1FOD3 1J1LA 1W0OA 4EN7B 5FPVA 3M8LA 2HEVF 1MZ6A 3NV4A 5ANNA 1N1TA 2NQYA 1N3QA 2OUJA 3KLSA 4PHZA 3ZFEA 3TBDA 4U2AA 5BNNC 1C1LA 2PHTA 1OURA 1DGLA 3VBRB 3WP4A 1PO23 4ZONA 5A7NA 1W06A 1RUI2 1RINA 4FOQA 2VG9A 1TMF2 4WM7B 1H8TC 3S7EA 1BKZA 1W8OA 4QKDA 2CL2A 5I91A 3RYKA 3GYDA 1H6YA 3I3EA 4OFGA 1MQTC 4JX0A 3AX4A 1F8VA 1U0AA 4AEJA 4DINB 3DN7A 4YG0A 5A80A 1NLRA 2GP5A 2MNGA 1ZRIA 3AYEA 3T3YA 2VO5A 3VDDB 2A7AA 1R093 3AXDA 3ECQA 3MF9A 4Q26A 4LHSA 5FJHA 4XCBA 1W0PA 4D8MA 3WSOA 3ZKUA 2AEZA 2WS91 1RUH3 1HN0A 3GJBA 3D3AA 1JU4A 1QGLA 2ARCA 2Y64A 3I2GA 5F8PA 3LOBA 1W8ZA 4RQPB 2E53A 3AMHA 4MGIE 4OHWA 2FDHA 1C8M1 3WOGA 1O7FA 1AL22 3PTRB 5EHDA 3ZKYA 2A3XA 3AYAA 3H8OA 4JC1A 2BVBA 1NCRA 2BQPA 4AEDC 1AL23 2OVUA 5F3CA 1FATA 1G8WA 1OA2A 1JS9A 2ZMKA 3RZZA 1RB8G 1G9DA 1GNYA 1LNSA 3B01A 3PHMA 1S2EA 4N53A 3A7QA 4LBKA 3ZOIA 4L9BA 2BRTA 3T1LA 5LEKA 5C9AA 3SXWA 3ASIA 1BVP1 1J3RA 3SNMA 2EA7A 5LZ6A 1OKQA 2HWC3 2IXCA 3AKSA 5LBFA 4FTBA 5T5OA 2XL7A 3EB7A 4PDWB 2C26A 5FV3A 4XF1A 1HW5A 1PGL2 1KGYA 2Y60A 4NIHA 4FPYA 4D7SA 2HWF3 3AL6A 5GALA 2YC2A 2WR9A 1OLMA 5FY9A 3O5SA 2WQ4A 2WS92 5KXEA 5J48A 3DYMA 2UYBA 2D40A 3AYDA 4ITCA 3R6SA 3WQBA 3HQUA 1B09A 4QT6A 3UGGA 4DOUA 3L2YA 5FYUA 5L7OC 2HJIA 4HLTA 1PX3A 2RDQA 1JZ2A 3HR9A 4QPIC 5H9QA 2VPVA 1ZBE2 3VBRA 3VKLA 1I1EA 2VZVA 1C8M3 1YFUA 4NPMA 2ILMA 5DABA 4NHMA 3WDYA 2ZHMA 5GJ6A 1RIRA 3ACFA 5D8AC 5JMCA 2R49A 3B93A 5A7OA 1F2NA 2DUPA 4QB6A 1H9PA 2D6KA 5FTTC 3BUCA 2LS6A 4FPEA 4AAPA 1O3QA 4Q1RA 3ZYRA 3ZXAC 3C7HA 2PHXA 2WNOA 3EJKA 5FMBA 3T0AA 1W6QA 3O0XA 4IDZA 3ZMNA 1V6JA 2HEYF 3VDDA 5FYMA 5LBBA 4AFBA 3DCQA 3MHZA 4CA9A 1UZ0A 3ZPOA 5ABJB 1LESA 1OBNA 2ZEWA 4RQPA 2WZR2 3ZIWA 1W0NA 2E6VA 4FXKB 4B8EA 4Y20B 2YFZA 3ZSLA 2E33A 1RJ7A 2HWB1 1JZ7A 4LK7A 4A7YA 1NCQA 1Q8VA 1UX6A 2D93A 3PIJA 4HVOA 3SH5A 1WBFA 4MGKE 3GF6A 2GC1A 1ZX5A 2BOIA 3OBTA 5FPZA 5FREA 5T55A 3IDEA 2ZGUA 5JR2A 1REEA 1YLLA 1RUJ2 1JHJA 4AGRA 1L7RA 2FCVA 5F7UA 2ZZJA 4FOWA 4K7JA 4SLIA 5IVBA 4AI9A 5LY1A 2Q1MA 3DGTA 4NRQA 4PDWA 4YW7A 2RE9A 4YVWB 4BQ5A 3V0AA 1BXHA 3OB8A 1WW7A 5HCFA 3Q9OA 4XF0A 2ZX2A 1QKQA 4FVVA 1AUYA 4BK5A 1N1SA 2EXJA 3I2KA 5A6XA 3IDBB 1RXGA 1UXXX 1W6OB 5IJRA 1D4M1 3LFMA 4QHZA 2E7AA 2P3YA 2OPKA 5FZBA 2FDFA 4OI0A 1NXMA 4YW1A 4AQSA 3VBFC 3NJZA 1O3RA 2EAAA 5FMDA 4LKFA 1DQ6A 5HV4A 1C1FA 1XNCA 1GUIA 4COUA 3WNXA 2HWB2 2KR2A 2R6QA 3CEWA 5FY4A 1Q8QA 2VQUA 4HBNA 4Y1UA 1NA1A 1XNAA 2DYCA 5CVRA 1FX5A 5JXJA 5FMCA 2J1SA 3MW2A 2P17A 4OHYA 1YFWA 2GN3A 3JBG1 1QXPA 2EF6A 2JE7A 2ZPXA 4AQ2A 5K7PA 1LU2A 1VBE1 2ETEA 1XQNA 4XUOA 1AR83 4G3YC 1XU1A 1CIWA 1WLWA 3C7FA 3ZYFA 2UWCA 1DIWA 4YVSB 1WCQA 5EV7A 5LASA 3O1MA 1JZ4A 2FMDA 3OBAA 2PAEA 4K21A 1W6PA 2ZBJA 4QXKA 1VBD2 3CU7A 2RS31 1JH5A 1H6XA 2XBO1 2I07B 3OD4A 4I0WB 4JDOA 3ZX7A 3WT3A 5KC5A 1D4M2 3VBHA 3VZJA 2J1UA 3VL8A 2YZ4A 1VLNA 2Q1ZB 2YPJA 3WUCA 3LA2A 2BFUL 1EPZA 4EJRA 2AZ5A 2Y0IA 4LO6B 4AHWA 1KFUL 1UYXA 2A6VA 1EPWA 1C57A 3PTYA 3ZVXA 2VBDA 1CZSA 3IN9A 5KXBA 4QGLA 3VBSA 3PUSA 2OA2A 4XYXA 4KH9A 1LOAA 1ST8A 1G7YA 1HB1A 3JBG2 4XACA 4NO4A 4XJUA 1DDLA 4IV3C 2EXIA 5FO9B 4META 5EP9A 1GP5A 2EXKA 5J3UA 3HOBA 3POEA 3JBG3 1LHWA 1NX9A 3ZYBA 4CP0A 4QQ2A 1VBE3 3K77A 1N3OA 2DVFA 4I0AA 4L99A 4JCKA 4A42A 5HCAA 3FHAA 4OVEA 1MQTB 2AENA 3NMBA 4RS5A 5LK7B 4QM8A 5FZAA 3KCCA 5KXDA 2JICA 2W46A 3P5BA 1ND2A 4RSUA 3LCPA 2OQ6A 2ZGMA 2RS33 5F6LB 2XBO3 3VD7A 4A3ZA 2AEYA 1V6NA 3RRDA 4FFIA 2VOVA 2PFWA 3OYWB 2B42B 5EQUA 1Q8OA 2D5FA 2ID4A 1AX1A 1NZIA 2YC4A 4YG6A 3HBKA 1KJLA 2DCZA 2QQUA 2ZKNA 3VZMA 3SKJE 1IGOA 1AR72 1JOBA 5IVEA 3O12A 4P00B 4AGVA 3C7OA 3IB3A 5DAQA 2NN8A 2DU1A 3E5XA 2WT2A 4L2NA 4JVAA 3KB5A 4I3GA 4KGQA 4CEWC 2W47A 3GBGA 3MIGA 1OKOA 1PZ8A 3X29B 5FK8A 3T4HB 2VZRA 3WX5A 1BBT2 1CAWB 4J25A 1WCUA 2V72A 1QQP3 1PK6B 2C9KA 3PDQA 4EWDA 1T2XA 1UX7A 3N9PA 4IEZA 4NRPA 1W2TA 4XF3A 3VHOA 2TBVA 3ZSMA 3HN1A 4UW4A 1JI6A 1KXGA 1LOCA 3V65A 4AEMA 5FZ7A 2G9FA 2F17A 4X8PA 2JDKA 1AJOA 3LSDA 1OD5A 4MADA 4ONUA 2NP0A 1RUOA 4CXWA 1LEDA 1MEC1 1X82A 2B46X 2GN7A 5J96B 1UL9A 5K4LA 2CTVA 4E9KA 4A45A 1MS5A 2ADDA 4DZGA 4XJZA 5DZGA 2IXHA 5JSPA 1RJ8A 5BPXA 1XBFA 2XUEA 1OA4A 3RMXA 1QJY1 2E32A 4JGYC 3VBOC 3BTXA 1EY2A 4Q0VA 4Y3OA 4LIVA 2DVAA 5JIAA 3ITQA 1GQGA 5FAXA 1LJ7A 5L7OB 3OSDA 4LBJA 3ZXFA 4AI8A 4QPIB 3PL0A 1W8UA 1RUC2 2W52A 5FOBB 5HXVA 5DUWA 2WNVB 2BP6A 3C7EA 5A6QA 1ULDA 3O1VA 2KXLA 1KD7A 3BALA 2WA4A 1YJLA 4PLMA 4HSLA 3CJXA 3LDRA 1FI2A 4LHLA 5FZCA 2JECA 4OLLA 2VZTA 4AK3A 2DBNA 4IXLA 5KBFA 1AYN2 1AF9A 2IZWA 4KQ7A 1ZM1A 4MHRA 2FZ2A 3OUHA 3I59B 2BUKA 3SLIA 1WGPA 2E51A 1BLZA 4DXTA 3PMSA 1AXZA 3HPNA 3ES4A 3WP3A 3J8F1 3OYWA 3VHNA 1QF3A 3B3QE 5LCWL 2WFF1 3LGRA 3CHXA 4XHXA 5DMYA 4BYYA 3BOWA 3QBQA 2HH9A 3PJYA 4XXAA 2HWD2 3WP5A 3LIGA 5IK5A 4W50A 3E5QA 1MEC3 1GKBA 3OTFA 4CZSA 4Y4RA 1MZEA 1QJY2 1BQPA 3O1UA 3ZSEA 4IE6A 5CFDB 2GC3A 1XYOA 2UY9A 1YO8A 2NYYA 2WWUA 4Y1ZA 5FYHA 2GMPA 4BWOA 4V1PA 1QJY3 1ZZ6A 3BPSA 5A3MA 5EJZB 3IAQA 1IS3A 1YC61 2C6SA 4NIIA 2ARBA 3K51A 5FO8B 5I93A 1OOPA 2R32A 3MLJA 4QDRA 4DY5A 4UBHA 1TG7A 4MUVA 1HRV1 4PF1A 4BU2A 1K5MC 1LGNA 3L9JT 1C3HA 1I3HA 3OGGA 1YFYA 1CIYA 4IL7A 4QX5A 4LIUA 5ANQA 1S0CA 3NKGA 4L11A 1FMD2 2XMLA 2ZHNA 3WDTA 2WJSA 4BMEA 4Q5OA 3ZDSA 1BK1A 4DS0A 3JQWA 2PTMA 1GMMA 4P9GA 1PZ7A 3ETPA 4IE7A 1M06G 1SLCA 3N9QA 4QPWA 4GIQA 4R9BA 4BQWA 4PBPA 1LOEA 4L0PA 5DDJ2 5ACA3 3TEYA 2QDRA 1NXD1 2YROA 3PURA 3J8F3 4XXPA 2K0GA 5TSWA 3VBFB 5L19A 2ES3A 1MS0A 2WFF3 3H0OA 1XE8A 1QJU1 1E5IA 4FPGA 4OULA 5J37A 3NNGA 4DUVA 1PMJX 4LTAA 2DCYA 2VR4A 3BVCA 3T1MA 3QCWA 3DPRB 3NNMA 1JUIA 4UBGA 1OD3A 2JG8C 2UURA 1PM7A 3LEMA 2J1VA 5I8YA 5CKMA 4QHOA 1GSLA 1UY2A 2Y38A 2O8QA 3CO2A 3CZUA 3MUY1 2ZAAA 5FP8A 3HT1A 4M0HA 1MS1A 3ZXJA 1BZWA 2JDHA 2Y6LA 1MS3A 3BOPA 3VZKA 3TEXA 4H7LA 1XRUA 2XG3A 3WNNA 3WY6A 3I59A 1YUDA 1MVEA 3ZXEA 3N9NA 3KS7A 1POV1 1U5IA 1G9CA 1HRV3 3M3CA 1FPN2 1LHUA 1EAH1 4ZY9A 4JDNA 2VNVA 3KT4A 2WBKA 1PVC1 4XOGA 4NN0A 4O9EA 1RHI1 2AC1A 1SCRA 2GP3A 2VOKA 3CMGA 3I3QA 3QH6A 4IEUA 3MEPA 3GNEA 1ENXA 5FIXA 3HNMA 1SZBA 5IVYA 2VJXA 1R082 5CFDA 5C3QA 3K4AA 5JSRA 3GGLA 4GB31 1OQ1A 3IPVB 4M01A 2X09A 3I2HA 1SCSA 4TN7A 1X33A 3EBRA 5HV0A 1GOHA 1F5FA 2VU9A 2QQLA 1RITA 1QJU3 1CONA 2BGCA 1Y7BA 1W9SA 2CGOA 2ZXQA 4XFHA 1YNAA 1G86A 4OUEA 2AUYA 3PLQA 2B7YA 1D2QA 4HL0A 4XF4A 4CU8A 4CUGA 3KQ4B 4GWJA 2D6LX 4KGGA 5GZEA 3KV6A 4IV1A 4FCAA 1JZ5A 1GICA 3DECA 1SHWB 2EVXA 2JIJA 3C3VA 4MZUA 3UGHA 3WF0A 1NCQC 2RS13 5FY1A 2VMFA 3M4FA 3ZXLA 3H7JA 5JVVA 2VGDA 1W3XA 1EAH2 2A6WA 4GKYA 2YPDA 4LMFA 4UYBA 3WCRA 1V6KA 4N90A 4WBBA 4YW3A 3POYA 4FPFA 2VMCA 1DQ0A 4D94A 1EAH3 2VVFA 2A1XA 3AP7A 2CWMA 1POV0 2D98A 1IPSA 5BXXA 4CCEA 4YZ3A 1PVC3 2HWE1 4FBFA 3DPRA 3GHMA 1RHI3 1UW8A 3HN3A 3UKTA 5BYNA 1V6MA 1CAUB 1S55A 3AKRA 3AVRA 1FAYA 1DF0A 4MOAA 4CDUB 2PYTA 4NHKA 1BEV1 5A32A 1TME1 2IXJA 2O8OA 2R0FA 4GB33 4YZ5A 1QIQA 1H1AA 2AGSA 3I2JA 4QKBA 5FPBA 5H9RA 3BU0A 4UFLA 1PVXA 3ZYIB 2HYXA 3ZM8A 1IZ3A 2QQOA 2XHNA 2G9ZA 5K0UB 1RTVA 4GD4A 5I8SA 1G9BA 1H1MA 3H1MA 1L7LA 3U4XA 2QQVA 1DBNA 5FZKA 4IE4A 3FLRA 4DB5A 5F5IA 1ASJ2 2B45X 3FJSA 4CCJA 3ZXKA 4K3UA 2PQQA 4NUBA 1AR91 3W59A 1CX1A 1UMIA 4AYUA 4COZA 5IK4A 4CXYA 4N7IA 3BPZA 4FFGA 4QU2A 4ZXEA 2TNFA 1VR3A 1AVBA 1CAVA 1F4HA 2IFWA 5DXDA 3OUJA 3VL9A 5C70A 1XB9A 3QOPA 4N8MA 4XBQA 3SEEA 4CE8A 1SBFA 2RS51 2HWE2 5LB6A 2RJKA 2CGNA 5I0RA 1DZRA 4PQ9A 4ASMB 4NVPA 3KV4A 1QY4A 3OGVA 4GJZA 3VBOB 2ZX3A 4W6YA 1V00A 5JPMB 1BEV2 3POBA 1TME2 3L2HA 4YW5A 5F37A 3ZR5A 1MS8A 3LSEA 1WW5A 2HYKA 4HT1T 4IEWA 3K3OA 2X05A 2JENA 3UJQA 4A6SA 4AW7A 5FDBA 5KHKA 4A41A 4UXAA 4RGKA 2XLAA 2JG9B 5HCBA 4DUXA 4EZHA 4QQHA 1ACCA 4OCTA 4UF0A 1HB3A 5IYYA 1ZZ7A 2W0XA 3NV3A 5FYSA 5LK5A 2VMDA 3W20A 5HI0A 4WM8B 1HLCA 3KZ4C 4JHZA 4QX0A 3WQ0A 4EE2A 4XQWA 5DG2A 5C3PA 3RZJA 2VTXJ 3WZ1A 4BJ0A 5JSOA 3WINE 2KA3A 1JOJA 1ULOA 5A3NA 1RMU1 4LBOA 3Q8EA 3VBSC 2DCKA 1W8NA 2H6CA 5FYTA 3E6DA 4XBLA 5JOXA 3TNPB 3USUB 1CAUA 1GQHA 1AR93 1YI7A 2BNNA 4CDUA 2ZEXA 4MX3A 5LRRA 1VAKA 3AJYA 1XNDA 2RS52 1LULA 4ZU7A 2PA7A 2ZGKA 4RFRB 2GU9A 2V73A 4YM3A 4KNCA 3T0BA 2VZSA 5FPXA 2RS53 1W04A 1AX2A 1OPMA 3D82A 3D0JA 1ZNPA 5JCTA 4RS5C 3POWA 1BYHA 2VECA 4WV8A 4AVCA 5C4WC 3DUIA 5GLZA 4COWA 1NQDA 1I9RA 2V5YA 4EQVA 1J84A 2GNDA 3ORJA 4A2UA 3OY8B 2WAAA 4A6OA 2CDPA 3LOIA 4CVUA 3LIHA 1UOBA 4I0BA 4XPVA 4BOWA 3BIEA 2GSYA 4AGGA 4CDWB 1PX4A 4AL9A 2RJLA 2D6MA 3CQOA 3ZSKA 5A7QA 2Q8OA 2GNBA 4JTOA 4D3WA 3MZHA 3E6BA 3DKQA 3WW3A 1V9U1 2XGXA 5CISA 1GLHA 2WWSA 4GKXA 4CCDA 1OH3A 2W3JA 4R9DA 2ZGQA 3LF7A 2WFPA 1FOD2 1F4AA 2WA3A 1NG0A 1UZVA 1GWLA 1BCXA 2P5BA 2Z2SB 3MW3A 1U5YA 5FZFA 4KMQA 3FHIB 3QH7A 3H8XA 2A6YA 4N9HA 4OHVA 1RMU3 2E63A 2BPA2 2BNOA 2V09A 2ARXA 2YHJA 5L73A 1IOAA 4Q0SA 2VTXA 2OUHA 4QXHA 5E1RA 1PO22 1YI9A 3U75A 1V6IA 3H3UA 3SISA 1QNYA 4COVA 3OEBA 1IS4A 2H0VA 3MO4A 2XJPA 4HMZA 5FYYA 3BYWA 2JG8B 1P8JA 2JG9A 2HWC1 2LROA 3T2QA 5FWEA 3RYRA 2BEOA 1N1VA 3JZVA 2ZMNA 1UOJA 1UU5A 3ES1A 3FBYA 2DFCA 3AMQA 1HQWA 1SPPB 1OXCA 4XTMA 5FYIA 2DVGA 5GLTA 3RJRA 2QNKA 5FO7B 2E9QA 2WO3A 4H2AA 4GULA 4WM8A 2GH2A 1SDDB 1SEFA 5FZ0A 1R092 2DCJA 4PF5A 2HWF1 2PN5A 3UKVA 2HKXA 5A7SA 3EHKA 1WBLA 4GJYA 3B5LB 3ZFFB 2WLQA 1RUH2 1Q5OA 3C7GA 4AHZA 3USUA 1A3KA 5B2GB 1MZFA 4Y22A 4QGNA 1L7QA 2TUNA 1NY71 4XMIA 2H6BA 1W2NA 2R30A 3H9AA 4WVWA 5LBCA 1TZOA 1V9U3 4Q29A 5JXIA 4ZU5A 2JWPA 1VAMA 3WR0A 5FYZA 3WW4A 1OUSA 1LKNA 4L97A 1YIPA 3UNPA 3JXSA 1UZZA 1X50A 2QZ2A 4BQ2A 2IVIB 4IE5A 1DYOA 1ULEA 2ZABA 1UCXA 5IATA 4QPGA 3OY8A 4FT8A 5FXVA 1JUHA 3NW4A 2Z69A 3W58A 2HWC2 4R8HA 2C1FA 4RGGA 4RD7A 2BV4A 2B8MA 3H3ZA 3KV9A 1OHFA 2BBVA 3WNLA 2Y26A 4Q0QA 3AP5A 4YM2A 2A75A 3WG3A 3VD4A 3NWKA 5FUNA 2WZEA 1LOBA 1CD3G 1IHMA 3KF5A 3PU8A 1VRBA 4BM8A 2HWF2 1NLQA 1XNBA 3NAPB 5SV8A 4BQYA 3ZLIA 1XNKA 4ARYA 4D0QA 1W90A 4JGZA 1W6NA 3AKTA 4CDQA 1US2A 1WW6A 3OBRA 2J1AA 4JDMA 5BNPC 1J3PA 4UW3A 3ZN5A 4MH0E 3U4SA 1ENSA 1OOPC 5EJ3A 3R4UA 3WUDA 4M3CB 3O7OA 1C8M2 3O1TA 1PO11 3J7LA 4UOJA 4XCAA 4G9SB 4B3NA 4D6SA 1LGCA 4RN5A 4XURA 2IUWA 1PMIA 4DRVA 1JYWA 5FYVA 5CFCC 4NIGA 1C5HA 4XBNA 3S7IA 5B4XA 2HEWF 3GXUA 4D7YA 5IVFA 3MIBA 1APNA 1SPPA 1NKGA 2VY0A 4WM7A 5FZ9A 4XZPA 3DXUA 1LR5A 1HV0A 4E2GA 2VMGA 3U14A 5JZGB 2RJ2A 2RM21 4LHKA 1EV13 4B4QA 1QXRA 3KCXA 5FQ0B 1L3JA 1WWYA 4MLOA 2QE3A 1UD1A 5FY8A 1Q8SA 1POQA 5FY0A 5D2AA 5J09A 2WAOA 2YBKA 3UV9A 3AZZA 1YQ6A 3SCGA 1AXKA 2R1DA 4HONA 4PT6A 2PMWB 4A44A 2JX9A 4UAPA 3KGZA 5JMOA 5G05L 2XHKA 3D4KA 2AH2A 3LAGA 4XQDA 4DQAA 3ALQA 3I3MA 4BQ1A 4AFCA 3RZKA 1V0AA 3OGJA 5BNOC 1SDWA 3QD6A 2UYAA 3S30A 4NHLA 3WXPA 2WN2A 4LA2A 3WQ7A 1JYNA 5JAXA 4NOTA 5IWFA 3KF3A 2ET7A 1LENA 3VBUC 3MIEA 4C91A 4CPBD 2J1RA 1E5HA 1OI6A 1AR81 2WC2A 3HQRA 2OKXA 3LE0A 1GZWB 4DIQA 2MEV1 3H8UA 2IXKA 3OPWA 4JV4A 1PO13 3LEKA 3Q8BA 5LBEA 2VL4A 4CCCA 4YZ1A 4LK6A 1AYM3 3W5MA 2VXRA 3OBZA 2XWBB 1H2LA 4XABA 1LOFC 5F39A 3CJIB 1GP4A 2WQZC 4QM9A 3B9CA 2J1EA 1ULGA 3I3DA 4CU7A 5FBZA 4NRMA 4JKLA 2RM23 4N43B 1H2NA 3GZUC 4FPHA 3GBWA 4NHYA 1Y4WA 4XFFA 1RVF1 3O1OA 1KQRA 3MFAA 4CEYC 1UPSA 2QZ3A 5KXCA 2BWAA 4AR2A 2B4KA 4KI5M 4YFWA 4FQ4A 4ASLA 2QQKA 4FXGB 2X5IC 2PAMA 4Q4Y1 1LOGA 3OD0A 2WN3A 5CAZA 5CZKA 1WD4A 5H9PA 5C8CB 4IV1C 2VW2A 4WZFA 1OQDA 4FTEA 4EV0A 1AR82 3ZFGB 1REDA 1UIJA 1Y3TA 2PLV1 2DV9A 4F3JA 5JZGA 2MEV2 4GH4C 2D6NA 3QLQA 4XMAA 3T2TA 4MVTA 5EXOA 4RR3C 1CQ9A 1DQ2A 2QQJA 2X8KA 4NROA 2MEV3 4OUMA 3WDUA 4DXZA 2GDFA 1TQ5A 3FBMA 4EN8B 4Z2WA 1X36A 1D4VB 5AC91 5ABJA 1FXZA 4CDXB 3AYCA 3I54A 4Y20A 3R4SA 1CPMA 4HZFA 1JW6A 4E4SA 2ZGTA 2Z4FA 2Z5WA 4HN1A 4K6BA 4JKMA 1RVF3 1ZA7A 4WZCA 3W5NA 1QNWA 4PIXA 1UU6A 3SQOA 2FCUA 1O8SA 4RL7A 1WMFA 5E88A 5IT6A 1BMV1 3AB0A 4KWJA 2VZ1A 4Q4Y2 4LBNA 1KS4A 2IWGB 5C71A 5FZ1A 3MV11 4ISRA 4LKEA 5G04L 3IIIA 1RUG1 2VULA 4Q4Y3 4UFIA 2YC0A 2VNGA 5FP9A 4JAAA 2EIGA 5EZWA 4M00A 1DZTA 3CZJA 2FZ1A 4RHV1 1MZ5A 1YYNA 1OF4A 1QQP1 2VQ0A 3CJIA 3OCPA 5BUVA 3I8TA 2ZKLA 1BHGA 4YM1A 2ZGRA 1QOTA 2PHUA 3HWJA 4YVWA 1VBE2 1ZYBA 4AOCA 1X9TA 2WSVA 3CF6E 4LO7A 1YJKA 3FLPA 2PLV3 5T52A 4Y5TA 4SBVA 4JKKA 4ASKA 1H8TB 1W6OA 1DLCA 2WINB 3FN9A 4AE2A 4PQQA 2Y33A 2BYVE 4LITA 4X8NA 4C0BA 3AC0A 1JYXA 2RS32 4GWIA 2XBO2 3F2ZA 4S2DA 2JB4A 3MIDA 3FUOA 5A3LA 1W9FA 2ET1A 1O6UA 3M3QA 3T30A 2ZGPA 4J1XA 1UU4A 4N9IA 5E16A 3VKFC 1JODA 1EUTA 3VZLA 4H14A 1K5JA 1WCKA 5AC93 1SFPA 1E57A 1JXNA 2ENRA 3AZYA 4P9YA 3A21A 4X6RB 2WNUC 5F3EA 5C8CA 1WCSA 2RDSA 3IBMA 3UESA 4ATEA 4BCUA 2V4AA 1S0IA 4Q0PA 5JXHA 3ZFGA 2XLGA 2W9XA 1G9FA 2VUDA 2W1UA 2VOWA 1DQ4A 1S0GA 2W39A 5DUVA 3UYJA 5FOJB 4CUAA 1QU0A 1S0EA 1LGBA 1Z7S1 4O7XA 5FPAA 3NV2A 4RHV2 2JJ6A 4LO4B 4XAEA 3VD5A 4AEDB 5A6ZA 1RUG3 2Q30A 3IM0A 4YVSA 1QQP2 4Q8LA 4P14A 3C8XA 1YFXA 4OMDA 4QAWA 1S0FA 1H1IA 1PGW1 2PHWA 3ZIXA 4RHV3 1VB4A 3ELNA 1SMVA 4NMIA 1WLTA 5FLIA 4CDXA 4TTGA 4URTA 1HIXA 4CU9A 1HKDA 4KWLA 4BH9A 1ND3C 1H4GA 4CP1A 3RI8A 2RR13 2ZHLA 4K8FA 2P3JA 4QX2A 4CSWA 1S2BA 4AVBA 5L9VA 3K2OA 1SQ4A 1YIFA 5A33B 3OPZA 4J1WA 3FWEA 1VBB1 2K2SA 2DFBA 1B35C 2JIGA 4CP9B 1CWPA 4M3CE 3VDCA 2BERA 4LQRA 3ACGA 3RSJA 3U07A 4AFDA 3RZMA 1H0BA 5GKAC 1KJRA 4A7KA 1MACA 1JHNA 1PNFA 5I8TA 3MIHA 4LUMA 5B4NA 1Q56A 1CZTA 4KWUA 4Q4X3 5FZEA 2JDAA 3ROUA 4AI3A 4EN6B 3HEIA 2WO1A 3MW4A 2JE8A 4L92A 1COV1 5E89A 5BNNA 1Q8PA 5CYYA 4LNVA 1W03A 2WLPA 3A22A 5J7MA 1QJEA 3ACIA 4IQPA 3OOXA 3ABZA 2C24A 1UWWA 1MS4A 3AMNA 5A7WB 3M2MA 3N7JA 2P3IA 1W8FA 1H8TA 1DU3D 3NL1A 4YYOA 1HXS3 5D8AB 3WF1A 2BBAA 1RYYA 1Z7S3 3TN91 5C5TA 2FD8A 4QQLA 3BGAA 4XFAA 1MQTA 1W3VA 3T2PA 4DEVA 5CBLA 3I4IA 3TB0A 3AP4A 3DXTA 2VVDA 4BIOA 1NE6A 3MICA 3BTAA 3M3IA 1NQJA 3WF4A 4KU8A 5ACA1 4HSJA 2J22A 2WIIB 5EIYB 4BE3A 4Z07A 3KQRA 3WDXA 4IW3A 1MEC2 3ZFEC 4CCNA 3T4VA 5IAVA 1KFXL 1IG3A 3N7MA 4DEQA 1W28A 3V0BB 1GZ9A 5F2SA 3RPQA 1VBB3 5BNOB 4LJHA 3DEMA 1LAJA 4FPLA 4XFBA 2MPFA 5F5AA 1ZRRA 4HPKB 3BTYA 4AEDA 4BXFA 4TXWA 4Q4W1 5F6KA 4HKOA 3UJOA 2BGOA 2ZGNA 4LXLA 4IEYA 5C8WA 1DGRA
chains in the Genus database with same CATH topology
3WHTA 2ZX1A 4KU7A 1VBC1 2OZ6A 1CAWA 2A6XA 1COV3 1PK6A 2WT0A 2ZGLA 3MFCA 3ST7A 2WKKA 4AHXA 3AMMA 3PVEA 2GC2A 3SHRA 2GZWA 5K8SA 3U11A 1S0JA 1FT9A 2ZGOA 3TN93 2NMOA 2R061 3N7KA 4GQ7A 5ACA2 4RFT0 1T6GC 4B7KA 1NCRC 3J8F2 2WFF2 2RMU1 4CEYB 5DZEA 4OI2A 2QKDA 4QPGC 3WQ1A 4N53C 3N4MA 1QJX1 1U5XA 5DUXA 5BNQA 5L7OA 3NVCA 1GR3A 1UPIA 2A5ZA 3N36A 4QPIA 5C9AC 2ERFA 5CG8A 2WNVA 1ENQA 2X29A 1RUF1 1TNRA 4L8QA 1S0BA 3IMNA 3MLLA 5AVPA 4C90A 4XEZA 4COYA 3IT8A 3HQXA 2YMZA 1U12A 3ZPYA 4Q4W3 2RS11 4TLFA 4JGZC 1HRV2 1LU1A 1XYPA 2F6BA 2D6OX 4RR3B 3AFGA 2PHLA 1TE1B 1VBC3 4R4XA 3MF6A 1GBGA 4PIZA 5JI9A 1VP6A 5FMOS 3U0ZA 1YHFA 3LA7A 1DYKA 3G7DA 3JB8A 4Z8BA 3DF0A 1WA4A 4RGAA 3APBA 3TYJA 1ZA4A 3VBRC 2BVVA 3H50A 3WDVA 2WSUA 4LA3A 4ZU4A 3H7YA 2GNMA 2R063 5FLHA 2D3SA 5HBAA 4XFCA 2DUOA 5FRAA 3O0WA 4HPKA 1ALYA 4BZ4A 1QJX2 2A3YA 1QJU2 2RMU3 2JXAA 3UK9A 1QJX3 3VDDC 2R16A 2CNAA 2YDEA 2O1QA 4KG0A 3AK0A 2B39A 5JIUA 1WLDA 4A3XA 4FPOB 2DTWA 2GNTA 2CWSA 1Y43B 3PVBB 4JQRA 1RUF3 4RQPC 2RS12 4IV3B 1Q43A 3WDWA 4DNYA 4I01A 5CA6A 4Q4V1 4MXVA 3RDIA 3FMGA 1YWKA 1PVC2 2ZX0A 4GMP1 3VBFA 5DUUA 1RHI2 4AI1A 1JYCA 4FQZA 2VOXA 4B4PA 4C1XA 1VBA1 4MSVA 4XDQA 5I0TA 1RC6A 5J36A 1CAXB 1WCDJ 3AM2A 3ENRA 4GB32 1A8DA 4PDWC 2OIIA 4HK9A 5L36A 1A78A 1CESA 1ZBA1 1SFYA 4HANA 3MI8A 2LALA 1ZRCA 1CN1A 2JEMA 4AF9A 1JYIA 4CEWB 4P5HA 1CJPA 5I0SA 3MGUA 1LODA 4AXOA 2XJQA 3INAA 3OF1A 3GHNA 2DF7A 3KGLA 1AHSA 1LEMA 3E97A 1ND3B 3ILFA 2A71A 4WVMB 4NPRA 2P34A 1NA1C 4LE3A 2VNOA 4QHBA 3AKQA 1FV3A 2AR6A 4Q4V3 1PIV1 4BIFA 1B35B 3RI9A 2VVEA 3IPVA 4HFSA 3AFKA 4JRLA 1VBA2 2XKPA 4LO8A 1I6XA 2VNRA 4GMP3 1VIWB 1VALA 3RQ0A 4JGYB 3VZNA 1VBA3 5E8AA 2C5DA 3HMYA 4GMP0 4AVSA 1N3PA 3WV6A 1C28A 3SCHA 1OQEA 4I02A 5ABJC 3M7AA 1SLAA 3VBHC 1ZBA3 3ZYPA 3ETQA 4H7MA 2R073 2GALA 1R1A1 1WMDA 1HQLA 5EYXA 1S2KA 2WZPP 4I2OA 2YUEA 2PHFA 3EO6A 2VW1A 3LA3A 1JTZX 2XPJA 3AZVA 1AR92 1DQ1A 2E7TA 2NM1A 1IPJA 3JD73 4MGYE 5GM0A 3VKNA 3VGIA 4YVWC 3NO8A 1QHDA 4LBQD 5LEJA 3BB6A 1PIV3 2PAKA 2XB6C 4ATFA 2YY1A 5IK8A 3J26N 1QDOA 4YGBA 1HRI1 2GH8A 2UU8A 1IKQA 3FZ3A 4YLZA 4PJYA 2YGMA 1GANA 3N7LA 5JDBA 4GXLA 5K0UA 5IK7A 1F31A 1DLLA 1ND2C 3H1YA 4Q8KA 3TNQA 4P9XA 1MS9A 2JKBA 4KG8A 1X8MA 4BA6A 1K5MB 1RUD1 4WVMA 5KHHA 1J3QA 3AP9A 4PBOA 1SLIA 1QWRA 1R1A3 4E4ZA 4F7ZA 4P9JA 2GMMA 1A8MA 3URFA 3IIAA 4HVQA 1RMU2 1KDKA 4D69A 2D5HA 1NCRB 3WLUA 4Y1YA 1J58A 1RUI1 4YVSC 3D8CA 1TMF1 1UZYA 1HDKA 4JGYA 3VBOA 4S2HA 4A7ZA 2WNEA 1VAVA 3SH4A 1J1TA 2BNMA 2QCSB 1NE4A 2QFEA 4FPKA 2P2KA 1HRI3 2ZMLA 4GWMA 2VQAA 2XWJB 3NV1A 3RJ2X 3VKMA 1ZZBA 1O4ZA 2OZJA 3B94A 4HVRA 2UWBA 3JB4C 1RUD2 3VLBB 4YW4A 1NOVA 4AVTA 2OYZA 2I2SA 3FFZA 1ZZCA 3ILRA 4OI4A 4AFMA 4XTPA 1RUD3 4BLJA 1R1ZA 1V9U2 3ZYJB 5CB7A 2G4IA 1XYNA 4YFZA 5F5QA 1F9KA 3SMHA 4XFIA 3WG1A 2WT1A 4I30A 1S1AA 4MYEA 4AHYA 1RUI3 4N7UA 4B4RA 5EYYA 1TMF3 2E7QA 1IPKA 1WW4A 1EV11 2F4PA 2GC0A 1W6QB 1PGL1 1GZCA 1ZVFA 2UWAA 2O0OA 4M3CF 2QQPA 3O14A 3V64A 1K5MA 1NZCA 2QDNA 4K20A 4XETA 4CDWA 1NLSA 1KRIA 1N47A 1IKPA 1H30A 3CL1A 1G6NA 2B5HA 3AMPA 1ZBE1 4QD2A 1NCQB 3PNAA 4CTEA 2TEPA 4YZ2A 4GA9A 4YG3A 1CR7A 2NPIA 4Q0UA 4GALA 1IS5A 2B9UA 1Z0HA 1NY72 3B00A 1PK6C 2R0HA 1FNYA 1SLTA 3WG4A 2D97A 4AWDA 3AZWA 1BJQA 1AYM1 2JG8A 2VH9A 3V0AB 4ZKTB 1EV12 2EAKA 1GYKA 4ISQA 2VUAA 2PELA 4Y1XA 2GAUA 1C4RA 2WZR1 4Z1VA 4PIYA 4EN9B 1AZDA 4Y4YA 1AR61 2QJVA 3BCWA 4OHXA 3USSA 4AVAA 2CYFA 4S2GA 3ZFFA 3ZYGA 5CG9A 2WS93 1U5ZA 5CIRA 4CYDA 2JD4A 2UY8A 2VMHA 4M0NA 2WNVC 4IEQA 1C8NA 2BWCA 2FQPA 1NA1B 1Q3EA 1RUJ1 1SBEA 4H3WA 1ZREA 1TNFA 1ZBE3 2BFUS 4MXWB 3SCFA 4DFSA 2D43A 1OLRA 4EROA 3WVJA 4FP2A 1ZRDA 1DGWX 1PO12 2XL9A 2R1BA 1CGPA 1AYM2 4XILA 3TOJA 2W08A 1W6PB 2IFRA 4XW3A 3GZAA 4LO5B 1SLLA 4AI0A 3IWZA 2RM22 3VBHB 2Q0AA 3M3OA 1AR62 1ZRFA 3NAPA 2WZR3 5CFDC 3RS6A 4YZ4A 1AR63 5I0UA 4Y24A 1Y9QA 4LUKA 1DQ5A 1ZZ8A 2JDZA 4M3CA 1CPNA 3VBSB 1XE7A 2FHRA 4YNIA 3THPA 3RG0A 5GLUA 1RUJ3 1VJ2A 2KM2A 1NYWA 3I7DA 3ATGA 3KMHA 4JRAA 1VBD1 3JUUA 3OJBA 3WG2A 2CY6A 4NWVA 4LE4A 4K1ZA 4BHPA 5FQ0A 1O4TA 2YXSA 4RS5B 5F9TA 2CV6A 4F8AA 1OFSA 5C4WB 1ND2B 2SBAA 2AREA 4K9SA 3CLPA 3ZXDA 4TYSA 1H2KA 3VHPA 3DPRC 4CP2A 4J6GA 1GV9A 4NR1A 1RVF2 2HWB3 4HN0A 3MYXA 3R0RA 4MXWA 4E27A 5C33A 3WW1A 4CRQA 4FOYA 1CVNA 3GZTB 3R05A 2X53S 4ES9A 1BVVA 3LWCA 2DU0A 2CGPA 4Q1PA 3U10A 2ZA9A 5GZGA 1GZWA 4QMAA 1J59A 2ZTNA 4LBQB 4TSVA 3KCYA 4XJWA 4DPNA 3WW2A 2PLV2 3TRSB 4XIOA 1VBD3 2D44A 2W68A 2N7GA 2ZOEB 4KWKA 1V70A 2CAVA 3VZOA 4DRRA 2CAUA 2RR11 4E2SA 1ULFA 1XU2A 4E2QA 4N43A 1D4M3 3THTA 4AQTA 1UKRA 3LKJA 3B9IA 4AEKA 4Y5Z0 1GNZA 1AR71 1D2SA 1W2UA 2D3RA 3AXEA 4ES8A 5AC92 1HQNA 4W6WA 4XIKA 4XFGA 4OUSA 3ZN4A 1DGRN 1QH6A 4W6XA 1SFNA 2IXLA 4Q4X1 4BPZA 1DFQA 3W9AA 1BBT1 3EQEA 3IDCB 1BMV2 4FP3A 3KSCA 2C0ZA 3ME2A 1OA3A 3MPBA 1WLCA 1H9WA 2A3WA 1RUG2 4AI2A 2BW8A 1HXS1 3QACA 4S2FA 5C4WA 1LHVA 1ONAA 1QH7A 1QXJA 1OLQA 2XLFA 4EWEA 3WD5A 5KHIA 3D5OA 3P3PA 1H4HA 2RR12 1EP0A 3B69A 2JE9A 3VN4A 2DWRA 3MLKA 4CDUC 2PHRA 3CNAA 5JPNB 3SH3A 2Y0OA 4QQOA 2DCTA 4G4FA 4TWTA 4Z82A 4FPJA 1RUC1 5GLWA 1N1YA 4EWAA 1PGSA 1AR73 3A0KA 5K0UC 4Q4X2 3VUOA 2I74A 4LLFA 4MV2A 3AKPA 5BNPB 4LBQA 5H9SA 3V56A 1OOPB 3RWNA 1AYN1 2XJSA 5JOYA 3FC0A 2P3KA 1BBT3 1HXS2 5EWSA 2DTYA 1Z7S2 4YW2A 1A6CA 5CFCB 2VUJA 3E6CC 3AZXA 4NWWA 2HWD1 1PGW2 4K1YA 3GALA 1ENRA 3RYPA 1JN2P 3BIWE 2YYOA 5DG1A 5SV5A 4Y1VA 5T5LA 2XJVA 2QVSB 4LULA 1RGSA 3HT2A 1LECA 2A6ZA 4FPCA 2Q5TA 1VBB2 4IERA 3ZSJA 1S0DA 2ZS6B 4WVVA 4HKWA 2JG9C 1LHOA 4YGCA 4IEOA 2NZ9A 2XVLA 1RUC3 5BV6A 4PCRA 5C6CA 1VB2A 3WP6A 4WM8C 1FMD1 3B7MA 3LZZA 4P9LA 3DKWA 4Q2FA 3VBUB 4PLOA 4AVVA 1COV2 1IQAA 1AL0G 2EALA 3ZO0B 1UIKA 1AYN3 1V6LA 1EYBA 5T3NA 4QQPA 1G9AA 2ZACA 3MDPA 4K40A 4XJAA 5DDJ1 4W65A 2D7FA 3TN92 4LEJA 4YRDA 3D6EA 4ZXKA 1VRH1 2LTNA 5A33A 4XF9A 1W6MB 2HWD3 2ZX4A 3VV1A 3WHUA 3NSTA 2GMEA 2OW4A 4KBBA 1I5ZA 5KHJA 2DVBA 5BNPA 4KL1A 1O3SA 1HV1A 4HK8A 4R52A 1GNHA 1FNZA 3POSA 4IETA 2X5IB 4CDWC 5AFBA 5AFEA 4UW5A 1REFA 1FPN1 4IV1B 3UKNA 4YSFA 5CFCA 4B29A 1FYUA 3FE5A 4Q4W2 2XVGA 1OFNA 5GZCA 5KC6A 3E5UA 2Z42A 1QJZA 5D8AA 5T54A 1FMD3 1D0HA 4YGEA 1VBC2 2XH6A 5BY5A 4LLOA 5T5PA 5JOZA 3N35A 4GH4B 1R081 4CDQC 5KHGA 3A0NA 5GZDA 1VRH2 3J4UH 5CADA 2VMIA 3PVNA 5DDJ3 4BMBA 2R062 5IUQA 4YARA 1VRH3 1WMEA 5F1RA 5FLJA 3V0BA 5BNOA 4FAHA 3LOBA 1TEIA 1LB2A 4HETA 1DZQA 2RMU2 5A32B 4WM7C 1MR5A 3VKOA 3NKTA 4AG4A 2ZCWA 3HAGA 1QOOA 4ORFA 3VBUA 5T50A 2A70A 5LRSA 4LHNA 4HKLA 1O4YA 3ZFFC 4MGZE 5D1IA 5JWPA 1RUF2 3TAYA 4LT5A 5GZFA 3LB9A 4XQ4A 5KWRA 4R9CA 1LOFA 3UL2A 1FPN3 3KD4A 4LBMA 2VW0A 2R041 1W6MA 2ZGSA 1CJDA 3FUQA 4JTNA 4C1WA 4Z92B 1CX4A 3ACLA 4I09A 3HIFA 4FAGA 1CAVB 4TZDA 2XVKA 1R083 1O5LA 1F5JA 4CEYA 4LR4A 1UKGA 4XJ8A 4E4DX 1O91A 4Q27A 2ZHKA 2YGLA 2XUMA 3B02A 5JR7B 4DMIA 1SBDA 2X5IA 3IKWA 3KT7A 4Y26A 1H2MA 5AVAA 2ZZQA 2WNUB 1LHNA 4EN0A 3PVOA 4XE9A 4F83A 3KM5A 3ILNA 1QOSA 3K48A 3C2UA 3NAPC 1ASJ1 1RUE1 1W39A 3RNSA 4C0HA 3JU9A 2R071 4GH4A 3M70A 1POV3 3S6PA 3N3HA 5CU1A 4RR3A 3PJQA 4B7EA 1H8VA 2RHPA 4O9GA 5GLVA 4PLNA 2R042 1DHKB 5EFUA 1UF2C 4BLIA 4INDA 3JD71 4Q4V2 5JOWA 2R043 2DVDA 4RA0A 5DZFA 1MVQA 2IXIA 3I2DA 3DV8A 4IEPA 1O3TA 1IS6A 5JZGC 1UMZA 4OHZA 1PZ9A 3MIFA 3ZN6B 3AJZA 5T5JA 3VHRA 2IC1A 3MPPG 3ZXGA 2NMNA 2LUWA 1AXYA 4GWNA 4OZXA 1M4WA 4XHBA 1DGWA 3HBZA 1JBCA 2XJTA 1RUE2 1SLBA 5FMOL 1ZBA2 1GFF2 4UW6A 3EXUA 1UN1A 2I45A 2R072 2Q4SA 4IV3A 1D0GA 2BTVC 5CNAA 4R4ZA 1ASJ3 1RUE3 3G6JB 4H55A 5FFOC 3M3EA 3BODA 5JI7A 1DG6A 1RUNA 1YRZA 3HD8B 4QGMA 1WUVA 1X7NA 2C9AA 1O5UA 1OSGA 3JD72 3R4DB 2EXHA 3DL3A 2D6PA 2G9GA 2HWE3 4OI1A 3H1WA 1KDMA 2YV8A 4D7TA 1PIV2 1CAXA 2WNUA 4U36A 3CJIC 3ZFEB 1BEV3 1TME3 1AJKA 3P3NA 5K9YA 4LBLA 2XJUA 4N43C 2WL1A 3J9SA 2PHDA 1LRHA 4FTSA 1HX6A 1LTEA 1PHMA 4FO9A 2XJRA 3KT1A 3JCIA 4CEWA 3M1HA 3WCSA 3FX3A 4WVZA 4IEXA 1QDCA 1FOD1 4P9IA 3O0VA 4Y22B 2FMYA 5C8CC 5JLVA 1R1A2 1ND3A 2A73B 3FLTA 3JQXA 5FCCA 1Z78A 2QUOA 2ZJCA 1YXWA 3SITA 2DUQA 2ZAHA 1PO21 1URXA 3ZFGC 4IESA 4YM0A 2ATFA 1YCIA 1B35A 1ULCA 1XXNA 3RMYA 3AP6A 3D0SA 3ZN6A 1X8EA 1V6OA 2K9ZA 3S0MA 1KITA 1SACA 5J98B 3FFQA 4FOVA 2LM3A 3ZMOA 3PMEA 1QMJA 4YGDA 4QPGB 3A4UA 1C5IA 4N53B 1KS5A 3BU7A 4R9AA 2DURA 4CDXC 1PNGA 1R091 4AQ6A 1HRI2 1OPOA 4P9WA 4XJ9A 3TWIA 5C9AB 1UAIA 1FV2A 2H0BA 1RUH1 1AX0A 1RL3A 2MHFA 2Z79A 4QPYA 2AYHA 2NLRA 4X6QB 4AFAA 1OMIA 1ZZ9A 2FBEA 2XKOA 4DY3A 1WD3A 2SLIA 2P37A 2D3PA 4I3PA 1DYPA 4IEVA 4JGZB 1W6NB 4CDQB 1AL21 3GBFA 1LCLA 1FOD3 1J1LA 1W0OA 4EN7B 3M8LA 2HEVF 1MZ6A 3NV4A 1N1TA 2NQYA 1N3QA 2OUJA 3KLSA 3ZFEA 3TBDA 4U2AA 5BNNC 1C1LA 2PHTA 1DGLA 3VBRB 3WP4A 1PO23 1RUI2 1RINA 4FOQA 2VG9A 1TMF2 4WM7B 1H8TC 3S7EA 1BKZA 5I91A 2CL2A 3RYKA 3GYDA 4OFGA 1MQTC 3AX4A 1F8VA 1U0AA 4AEJA 4DINB 3DN7A 4YG0A 1NLRA 3AYEA 2MNGA 3VDDB 2A7AA 1R093 3AXDA 3ECQA 3MF9A 4Q26A 1W0PA 2WS91 1RUH3 1QGLA 4RQPB 2E53A 3AMHA 4MGIE 4OHWA 1C8M1 3WOGA 1O7FA 1AL22 2A3XA 3AYAA 4JC1A 2BVBA 1NCRA 2BQPA 4AEDC 1AL23 2OVUA 1FATA 1G8WA 1OA2A 2ZMKA 3RZZA 1RB8G 1G9DA 3B01A 3PHMA 4N53A 4LBKA 4L9BA 5LEKA 3T1LA 5C9AA 3SXWA 3ASIA 1BVP1 1J3RA 3SNMA 2EA7A 1OKQA 2HWC3 2IXCA 3AKSA 4FTBA 5T5OA 2XL7A 4PDWB 4XF1A 1HW5A 1PGL2 4FPYA 4D7SA 2HWF3 5GALA 3O5SA 2WQ4A 2WS92 5KXEA 5J48A 2UYBA 2D40A 3AYDA 4ITCA 3R6SA 4DOUA 1B09A 4QT6A 3L2YA 5L7OC 2HJIA 4HLTA 3HR9A 4QPIC 5H9QA 2VPVA 1ZBE2 3VBRA 3VKLA 1I1EA 1C8M3 1YFUA 2ILMA 4NHMA 3WDYA 2ZHMA 5GJ6A 1RIRA 5D8AC 5JMCA 2R49A 3B93A 1F2NA 2DUPA 1H9PA 2D6KA 5FTTC 4FPEA 1O3QA 4Q1RA 3ZYRA 3ZXAC 2PHXA 3EJKA 1W6QA 3O0XA 3ZMNA 1V6JA 2HEYF 3VDDA 4AFBA 5ABJB 1LESA 4RQPA 2WZR2 3ZIWA 4B8EA 2E6VA 4FXKB 4Y20B 3ZSLA 1RJ7A 2HWB1 4A7YA 1NCQA 1Q8VA 1UX6A 2D93A 4HVOA 3SH5A 1WBFA 4MGKE 3GF6A 2GC1A 1ZX5A 3OBTA 5FPZA 5FREA 5T55A 3IDEA 2ZGUA 1REEA 1YLLA 1RUJ2 4AGRA 2ZZJA 4FOWA 4K7JA 4SLIA 2Q1MA 3DGTA 4PDWA 2RE9A 4YVWB 3V0AA 1BXHA 1WW7A 5HCFA 3Q9OA 4XF0A 2ZX2A 1QKQA 4FVVA 1AUYA 1N1SA 2EXJA 3IDBB 1W6OB 1D4M1 2E7AA 2OPKA 4OI0A 1NXMA 4YW1A 4AQSA 3VBFC 3NJZA 1O3RA 2EAAA 1DQ6A 1C1FA 1XNCA 4COUA 3WNXA 2HWB2 2R6QA 3CEWA 1Q8QA 4HBNA 4Y1UA 1NA1A 2DYCA 5CVRA 1FX5A 3MW2A 2P17A 4OHYA 1YFWA 2GN3A 3JBG1 1QXPA 2EF6A 2JE7A 2ZPXA 4AQ2A 5K7PA 1LU2A 1VBE1 2ETEA 1XQNA 1AR83 4G3YC 1XU1A 1CIWA 1WLWA 2UWCA 1DIWA 4YVSB 5EV7A 2FMDA 2PAEA 4K21A 1W6PA 2ZBJA 4QXKA 1VBD2 3CU7A 2RS31 1JH5A 2XBO1 2I07B 3OD4A 4I0WB 4JDOA 3ZX7A 3WT3A 5KC5A 1D4M2 3VBHA 3VZJA 3VL8A 2YZ4A 1VLNA 2Q1ZB 2YPJA 3WUCA 3LA2A 2BFUL 1EPZA 4EJRA 2AZ5A 2Y0IA 4LO6B 4AHWA 1KFUL 2A6VA 1EPWA 1C57A 3PTYA 3ZVXA 3IN9A 5KXBA 4QGLA 3VBSA 2OA2A 4XYXA 4KH9A 1LOAA 1G7YA 3JBG2 4XJUA 4NO4A 1DDLA 4IV3C 2EXIA 5FO9B 4META 2EXKA 5J3UA 3JBG3 1LHWA 4CP0A 4QQ2A 1VBE3 4I0AA 1N3OA 2DVFA 4L99A 4JCKA 5HCAA 4OVEA 1MQTB 2AENA 4RS5A 5LK7B 4QM8A 3KCCA 5KXDA 2JICA 4RSUA 1ND2A 3LCPA 2ZGMA 2RS33 5F6LB 2XBO3 1V6NA 3RRDA 2VOVA 2PFWA 3OYWB 2B42B 1Q8OA 2D5FA 4YG6A 1AX1A 1KJLA 2DCZA 2ZKNA 3VZMA 1IGOA 1AR72 3O12A 4AGVA 2NN8A 2DU1A 3E5XA 2WT2A 4L2NA 4JVAA 3KB5A 4I3GA 4KGQA 4CEWC 3MIGA 3GBGA 1PZ8A 3X29B 3WX5A 1BBT2 1CAWB 1QQP3 1PK6B 4EWDA 4IEZA 3VHOA 4XF3A 3ZSMA 2TBVA 3HN1A 4UW4A 1KXGA 1LOCA 3V65A 4AEMA 2G9FA 4X8PA 1AJOA 3LSDA 1OD5A 4ONUA 2NP0A 1RUOA 1LEDA 1MEC1 1X82A 2B46X 2GN7A 5J96B 1UL9A 4E9KA 2CTVA 1MS5A 4DZGA 4XJZA 5DZGA 2IXHA 5JSPA 1RJ8A 5BPXA 1OA4A 3RMXA 1QJY1 4JGYC 3VBOC 1EY2A 4Q0VA 2DVAA 5JIAA 1GQGA 5FAXA 1LJ7A 5L7OB 4LBJA 3ZXFA 4AI8A 4QPIB 1RUC2 2W52A 5FOBB 5HXVA 5DUWA 2WNVB 1ULDA 2KXLA 1KD7A 3BALA 2WA4A 1YJLA 4PLMA 4HSLA 3CJXA 4LHLA 1FI2A 2JECA 4OLLA 4AK3A 4IXLA 5KBFA 1AYN2 1AF9A 2IZWA 4KQ7A 1ZM1A 2FZ2A 3I59B 2BUKA 3SLIA 1WGPA 2E51A 3PMSA 1AXZA 3ES4A 3WP3A 3J8F1 3OYWA 3VHNA 1QF3A 3B3QE 2WFF1 3LGRA 4XHXA 4BYYA 3BOWA 3QBQA 4XXAA 3PJYA 2HWD2 3WP5A 5IK5A 3E5QA 1MEC3 1GKBA 3OTFA 4CZSA 1MZEA 1QJY2 1BQPA 3ZSEA 5CFDB 2GC3A 1XYOA 2UY9A 1YO8A 2NYYA 4Y1ZA 2GMPA 4BWOA 4V1PA 1QJY3 1ZZ6A 5A3MA 1IS3A 2ARBA 3K51A 5FO8B 5I93A 1OOPA 2R32A 3MLJA 4DY5A 4UBHA 4MUVA 1HRV1 1K5MC 1LGNA 3L9JT 1C3HA 1I3HA 3OGGA 1YFYA 4IL7A 4QX5A 1S0CA 3NKGA 4L11A 1FMD2 2ZHNA 3WDTA 2WJSA 4BMEA 3ZDSA 1BK1A 4DS0A 3JQWA 2PTMA 1PZ7A 1M06G 1SLCA 4GIQA 4R9BA 4PBPA 1LOEA 5DDJ2 5ACA3 2QDRA 1NXD1 2YROA 3J8F3 4XXPA 2K0GA 5TSWA 3VBFB 5L19A 2ES3A 1MS0A 2WFF3 3H0OA 1XE8A 1QJU1 4FPGA 4OULA 5J37A 4LTAA 2DCYA 3T1MA 3QCWA 3DPRB 4UBGA 1JUIA 2JG8C 2UURA 1PM7A 5I8YA 1GSLA 2Y38A 2O8QA 3CO2A 2ZAAA 3HT1A 4M0HA 1MS1A 3ZXJA 1BZWA 1MS3A 3BOPA 3VZKA 4H7LA 1XRUA 2XG3A 3WY6A 3I59A 1YUDA 1MVEA 3ZXEA 3KS7A 1POV1 1U5IA 1G9CA 1HRV3 3M3CA 1FPN2 1LHUA 1EAH1 4JDNA 3KT4A 1PVC1 4XOGA 4NN0A 4O9EA 2VOKA 1RHI1 1SCRA 4IEUA 3QH6A 3MEPA 3GNEA 1ENXA 1R082 5CFDA 5JSRA 4GB31 1OQ1A 3IPVB 4M01A 1SCSA 1X33A 3EBRA 1F5FA 2VU9A 4FSJA 1RITA 1QJU3 1CONA 2BGCA 1Y7BA 2CGOA 4XFHA 1YNAA 1G86A 2AUYA 3PLQA 2B7YA 1D2QA 4HL0A 4XF4A 2D6LX 4KGGA 5GZEA 4IV1A 4FCAA 1GICA 2EVXA 4MZUA 3C3VA 1NCQC 2RS13 3M4FA 3ZXLA 3H7JA 5JVVA 2VGDA 1EAH2 2A6WA 4GKYA 3WCRA 1V6KA 4N90A 4WBBA 4YW3A 3POYA 4FPFA 1DQ0A 4D94A 1EAH3 2VVFA 3AP7A 2CWMA 1POV0 2D98A 5BXXA 4YZ3A 1PVC3 2HWE1 4FBFA 3DPRA 3GHMA 1RHI3 1UW8A 3UKTA 5BYNA 1V6MA 1CAUB 1S55A 3AKRA 1FAYA 1DF0A 4CDUB