2VULA

Thermostable mutant of environmentally isolated gh11 xylanase
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
193
Chain Sequence
b'AQTCLTSPQTGFHNGFFYSFWKDSPGTVNFCLLEGGRYTSNWSGINNWVGGKGWQTGSRRNITYSGSFNTPGNGYLALYGWTTNPLVEYYVVDSWGSWRPPGSDGTFLGTVNSDGGTYDIYRAQRVNAPSIIGNATFYQYWSVRQSKRVGGTITTGNHFDAWASVGLNLGTHNYQIMATEGYQSSGSSDITVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GH11 XYLANASE
molecule tags Hydrolase
source organism Escherichia coli
publication title Engineering Hyperthermostability Into a Gh11 Xylanase is Mediated by Subtle Changes to Protein Structure.
pubmed doi rcsb
total genus 55
structure length 193
sequence length 193
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vulA00
3M4FA 4HKOA 1OA4A 2DFCA 2B46X 3VHNA 3VL9A 3B7MA 1BK1A 4NPRA 2VG9A 3AKPA 3WY6A 1OLQA 1UU4A 4S2DA 1TE1B 3AKSA 3AKRA 2DCJA 2JEMA 3O7OA 1AXKA 2DFBA 2NLRA 3VHOA 3B5LB 1H4HA 1H4GA 1W2UA 1OLRA 3LB9A 4HKLA 1PVXA 2QZ3A 3LGRA 1KS5A 4XQDA 4H7MA 2VULA 3MF9A 4S2FA 1YNAA 1XYNA 1OA3A 2Z79A 4HKWA 3AKQA 4S2GA 5EJ3A 3RI9A 4HK8A 1XYPA 1UKRA 3HD8B 1REFA 3VZKA 1BVVA 1XNCA 2C1FA 1F5JA 2F6BA 2BVVA 1H0BA 1KS4A 4XPVA 3WP4A 1UU6A 1OA2A 1UU5A 3AMPA 4XQWA 3MFAA 3VGIA 2BW8A 2B45X 2DCZA 3VZLA 3RI8A 1QH7A 2BWCA 1BCXA 3WXPA 1H1AA 5K7PA 3MFCA 2VUJA 1HIXA 1T6GC 1XXNA 2DCYA 3WX5A 1H8VA 3AMMA 2VGDA 3EXUA 4IXLA 1HV1A 3WQ0A 3MF6A 3VZMA 1NLRA 3VHPA 1XYOA 5HXVA 1ENXA 1XNKA 2D97A 3WP6A 2BWAA 4HK9A 1C5HA 3AKTA 3AMHA 3ZSEA 2QZ2A 1REEA 1XNDA 2NQYA 3VZNA 3WQ1A 1C5IA 2JICA 3VL8A 3AMQA 3AMNA 3WP3A 1QH6A 1M4WA 2B42B 2JENA 3WR0A 1HV0A 1XNBA 3WQ7A 4XQ4A 1IGOA 2DCKA 3VZOA 3WT3A 2D98A 3VZJA 3WP5A 4S2HA 1REDA 3VLBB 5K9YA
chains in the Genus database with same CATH superfamily
1Q3EA 4I01A 2PHXA 4ZS2A 1YQ5A 2JDPA 2YBKA 5EP9A 1RUF1 3TWIA 4AEJA 2CSGA 1AR93 4AVSA 1AF9A 1BMV2 5A7WB 5JMCA 1JZ8A 4W8JA 3WUDA 3SC7X 3AKRA 5F3IA 5IHRA 2CDPA 2CYFA 3H3ZA 1IQAA 4JGZA 2Q8CA 4YPJA 3R4UA 2GSYA 4B1MA 5L36A 5E16A 4YW5A 3DUIA 3ZN6A 4LTAA 1QJY1 2WNUA 5D1IA 2ZGNA 4WM7B 1SPPB 4Y33A 1ALYA 1G8WA 3KD4A 3V64A 4W4ZA 4AEKA 5F3GA 1VBD3 4S2FA 5ABJA 5K8SA 3PUAA 4GH4B 4GB33 1XC6A 3PIGA 3NJXA 5DZGA 4META 4HK8A 2VBDA 4N9IA 4DS0A 1YXWA 4OI1A 1QXJA 2DYCA 2VAUA 2DV9A 5DUVA 4IEVA 1NCQC 4AZZA 2XXZA 3I8TA 2WO3A 1H0BA 3WINE 4JDNA 2EXJA 2ET7A 3KQRA 1AJKA 2W1QA 3H0OA 4NHYA 4CEWB 2ADDA 4ZU4A 4EN0A 2BOJA 4GALA 2BWCA 5IT6A 2QQIA 5C8CB 5JZGA 1CESA 4NRPA 4IE5A 4QDSA 4F7ZA 1GZWB 2OXBA 4Z2AA 1ULPA 1G6NA 3MIBA 2GNMA 1FMD3 2YGLA 4RN5A 1W03A 1TG7A 4XBLA 2P34A 1DQ4A 2B9VA 4R4XA 3H7YA 1W9FA 2DCTA 4OFGA 3NV4A 2O8OA 4O9GA 2VMCA 3POWA 1GSLA 2DU1A 2AH2A 5CKNA 4Z8BA 2VCBA 4QPGA 3UK9A 2CWMA 5J98B 5C3SA 3RG0A 1XU2A 1GFF2 2J22A 5J48A 4YZ5A 4UW3A 4XJZA 1HXS2 4TYSA 1E5RA 2PAKA 4FQZA 3WW2A 5GZGA 5A3PA 2QCSB 4AI2A 3C7OA 1OUSA 5JZGB 3VD5A 2VMEA 2VR4A 3IDCB 3DKQA 1BZWA 2XH6A 4WM7A 4GIQA 1PGW1 1MZEA 5FZGA 2VECA 1D4M3 1WCDJ 4TLGA 3RYRA 4JRAA 4YM3A 5ABJC 3LKJA 2JG9A 4QGNA 2WNVC 4FFGA 2A6VA 5D8AC 3DKWA 4UFLA 3ZMNA 3ZFFA 1M4WA 2VXJA 3JBG1 4XF9A 3WQ7A 4P9JA 2GDFA 3H50A 1HRI3 4DIQA 1IGOA 4IEWA 1WCSA 5B2GB 2Y38A 3P1IA 1IS3A 4ZS3A 5F2WA 3GZEA 3PVEA 4LK7A 4LO7A 2QQKA 1ZBE2 4M3CF 4ZONA 3DPRB 2JB8A 5CG9A 5M0TA 1VBA1 4JAAA 5FV3A 2O8QA 4AAXA 2GN7A 2ZGTA 1OF3A 2YGMA 3IDEA 3TB0A 1APNA 5FZBA 4AEMA 2UU8A 2VNVA 1QY4A 2JEMA 4HFSA 2DFBA 1MS5A 4V2WA 4B1LA 3DXTA 3JB4C 5LRRA 3RDIA 4AVBA 5C9AC 2GN3A 1UZYA 1OF4A 1RUC2 2P1BA 5BNPB 1VALA 5L7OA 3N9MA 5FZHA 4BQ4A 2VCCA 2B9UA 5KR7A 1QXRA 4BIOA 1NOVA 3D5OA 4Q27A 4XF4A 1CX4A 1KS5A 5IW0A 2WSVA 3VV1A 3AM2A 1H9WA 3N35A 4H7MA 4M4PA 3D8CA 2VULA 4IEUA 5JI7A 4FO9A 5JMOA 1DHKB 1W2TA 1XNTA 4AFBA 1S1AA 4PIYA 1LGNA 1OA3A 5EV7A 1QNYA 1RUG3 2VVEA 5GLTA 1WW6A 4BWOA 3RI9A 5GZCA 2VZTA 4XBNA 3O1RA 1O4TA 1NE6A 2DVAA 1NE4A 3ILNA 4NHLA 2E51A 5JR7B 2VO5A 4HL0A 1OQ1A 4JRLA 3ACHA 1BBT2 2HWC3 3AL5A 2DVFA 2NZ9A 3AP9A 1W99A 4IV1C 5DN2A 1JODA 1HQNA 3K75B 2JKXA 4AVTA 2ZEWA 3IN9A 4PBPA 2YFZA 4KWJA 2RM22 4YVSA 2W92A 4P9IA 1AR83 1VBB2 1FYUA 4K8RB 4L11A 3MI8A 5HCBA 5DMYA 1OURA 3MFCA 4QHZA 4QHBA 4QPIA 1OUXA 1TMF1 3HIFA 5EZWA 4A2UA 4E4DX 3PUQA 1HIXA 4LKSA 3POSA 2DUQA 4PQQA 3GM8A 1ZBA2 4QQHA 3AZZA 3GZAA 1PMIA 3W21A 4CCEA 5J1XA 3ACFA 3AMMA 2ERFA 2NMNA 4IW3A 2O1QA 2L9LA 1OPOA 1BMV1 4HG6B 2Z69A 4AYUA 2A75A 4X8NA 4Q2FA 4RL7A 4Y1ZA 5JCTA 4LO8A 4J25A 3PNAA 1PVC2 1VP6A 5C4WC 4LHSA 2Y60A 2J1VA 1PGSA 1YYNA 3NMBA 4OZXA 4ARYA 3GZUC 4I02A 1YFXA 5FFOC 4Z07A 1HB1A 4N7IA 3IMMA 4BLIA 4UFJA 1VE0A 2Y6FA 2WQ8A 4JZRA 4FPGA 5KHHA 5JUVA 3QH7A 3TEWA 4JC1A 2EALA 2TEPA 2WZEA 1D7PM 4JGZB 4CDXB 2OQ7A 2WNUC 5IVYA 2KD7A 2RMU1 4LBQB 1AYN3 1FOD1 3CU7A 3LD8A 1K5MC 3VZNA 1BVP1 4KNCA 3IDBB 4Q4W3 4YW3A 4Q26A 2WYFA 2JXAA 4LUKA 3TEXA 5I91A 1GLHA 4B7KA 2PAEA 2OW4A 3J7HA 3FFZA 3I2JA 1PM4A 4Q4Y1 1N1TA 1SLIA 5CIRA 3ENRA 3WP5A 1CR7A 1CIWA 5HV4A 3MUZ1 4IV3A 5FMOL 3BU7A 1RUI3 2WR9A 5LBEA 5T50A 3X29B 1YIPA 4EWEA 3PU8A 1SLLA 4XCBA 5FMCA 4C0HA 3WG1A 2RS12 3B3QE 1GNHA 4W65A 3I3EA 1U5XA 5IK7A 2CU5A 1N1SA 2XGXA 1BEV1 2PA7A 2A6ZA 4N43C 3ELNA 1NX9A 5LA0A 3MIHA 3FMGA 1OBNA 1UY0A 1VBC2 1CX1A 4E4ZA 3KCCA 3ILRA 2QQVA 2XDVA 4A7ZA 3NW4A 1DQ2A 3QACA 3RMYA 4LKFA 2WA4A 4CE8A 1WD4A 3U4XA 1A34A 4GB32 3WSOA 4YFWA 3LQCA 1LOFA 2QNKA 5FY7A 1X9TA 2ZEYA 1PIV2 5BYNA 2FCUA 5A7NA 5LBBA 5FZ8A 3AVSA 3V0BB 4CPBA 2BZDA 5CFDC 1QMJA 2LRPA 3UT0A 4D3WA 3UGGA 2CY6A 1V6LA 3H8UA 1O7FA 4A6SA 2Q30A 4DXSA 3JD71 4DXRA 1QU0A 1A8DA 2MEV3 1W6PA 3KF3A 5A6XA 4D69A 5I8TA 4HVQA 1GR3A 4IETA 5DAPA 3H7JA 2JIGA 3GNEA 2A6YA 5E8AA 1PNGA 2XKPA 4NN0A 3WG3A 2WN3A 2XJPA 3PTRB 3T2TA 1O4ZA 1SMVA 2VXRA 5IJRA 3ES4A 3EMRA 1JZ7A 3VBSC 1LOGA 2GZWA 5FY8A 4PLMA 1FXZA 4MLOA 3ZDSA 5HI0A 4D6RA 4MGQA 4JGYC 4AVVA 1JOBA 1KQRA 4XUOA 1MS1A 3C3VA 4XFBA 4D0QA 1F8VA 1U5IA 2PQQA 5KHIA 5HXMA 2QDNA 4YARA 3D82A 1I3HA 1D4M1 1RUH1 3L9JT 4LOSA 4UFMA 2HWB3 2WQ4A 4YVSB 4OQ8A 1JTZX 3KV4A 5GLUA 3RRDA 4ZZ8A 2W1WA 2VC9A 3AZWA 1PK6B 2IXLA 3VZMA 1PNFA 4TZDA 1PMJX 4C1WA 4QT6A 4YZ4A 1CZVA 4LBMA 2K46A 3OCPA 4I3GA 1S0GA 5JR2A 3HWJA 3ZX7A 2HLEA 1ULOA 4BA6A 3I4IA 3VBOB 5FK8A 2GH2A 1QIQA 1AHSA 3FBMA 1SFNA 4NIAA 2WC2A 3ZFFC 3R0RA 3WG2A 2JE7A 1S0DA 2QZ2A 1CN1A 1WUVA 4COYA 4RA0A 3WQ1A 2DBIA 3USUB 2JICA 4JTOA 1F4HA 4NHXA 2P2KA 1W0NA 4XOGA 3OB8A 1ZBE3 4FPCA 3MIFA 1XE8A 1R081 1DCSA 4YVWC 1H6YA 1H1IA 2UURA 2HBTA 4F8AA 2D98A 1LGBA 1WW7A 2UWCA 2XQRA 4S2HA 3GCXA 4CP0A 1RUOA 4AEDC 3VN4A 2YB7A 1O4YA 1DGRA 2VVFA 3VDCA 4ET7A 4NO4A 1ND2A 1PO23 2VD7A 1OA4A 2VVDA 1IPKA 4QM9A 3VBSB 5IYYA 4QX3A 5HCAA 4XZUG 1NLQA 3TEYA 2KM2A 2H0VA 4H7LA 5A3LA 1DU3D 4AR2A 4TWTA 4FCAA 5F5IA 3GYDA 4CCMA 4LKEA 4LLFA 3ZSKA 2A3YA 1E57A 5BNOC 1RTVA 4RSUA 3BKZA 1RB8G 1ULFA 5FUPA 4CYDA 3O1OA 3H8OA 5FBJA 2YROA 3NL1A 3H9AA 3TNPB 4X6QB 2BJSA 1GU3A 1HRV1 1WBLA 5J3UA 4LQRA 2ADEA 1LHNA 5C3RA 1IHMA 3L2HA 3BU0A 1FV3A 4HKLA 3VBFA 2HWE3 2ZACA 3WDTA 4W6WA 3U1XA 1W39A 1IG0A 2CTVA 2YPDA 5FY0A 1RL3A 3MLLA 5HPOA 1ACCA 3POJA 1LCLA 4YFZA 1GWLA 1TZOA 2Y6KA 3POEA 4HMZA 4LHKA 1GOHA 3OOXA 4CXYA 2ZGLA 3DN7A 3GJAA 2TBVA 1QDOA 1AR82 4Q4X3 1NCRC 1JH5A 1OFNA 4LULA 2V09A 1HQLA 4XF1A 4XEZA 5CFDA 2XJQA 2FCVA 4GMP3 3W9AA 4CCJA 5A3MA 1YHFA 3WP4A 3VGIA 3LDRA 3WUCA 1S0EA 4GKXA 5L9RA 1CAWA 1UYXA 5FYVA 2CAVA 4RHV3 5LRSA 1UMIA 5FQ0B 3T08A 4AE2A 4ASKA 4W50A 4LHLA 3WCRA 1RUG1 4BE3A 1W6PB 2BERA 1ZA7A 2PLV2 2YPJA 3HBZA 1WCKA 1Y43B 3QBQA 1CAXB 3EJKA 1JZ6A 1HRI2 1K3IA 4PDWC 1J3RA 2TUNA 2D6LX 4NPLA 2UWBA 2VTXJ 1NZIA 2Z4FA 3LSDA 4CU7A 3GCWA 4NPMA 4A44A 1W8ZA 5KXBA 1RHI3 1AYM3 4I2OA 2Y8KA 1UD1A 1Z78A 4D7SA 2K9ZA 3GDBA 1QQP1 1VBD2 2ZA9A 3DL3A 5GALA 5KC5A 4FPOB 3N9PA 5LEKA 5JSPA 3IM0A 2BDRA 3VDDC 4CU9A 1KD7A 1O3SA 4K1ZA 5I0RA 3MIGA 4CDXC 1WMXA 4Q4V3 4F3JA 5FPUA 4Q0UA 1ZREA 1F15A 1ZRRA 3GXUA 5LA2A 4CP9B 4DY3A 4EV0A 1O3RA 2GALA 1LOEA 1IOAA 1W9YA 2WZ8A 4HOOA 3ZKUA 4FTEA 3RZMA 4GH4A 2XUMA 3N7LA 4Q8LA 4RHV1 3UL2A 1TNRA 1I5ZA 5FOBB 1UY1A 3B93A 5FYCA 5FY5A 3OUJA 1YQ6A 3DF0A 2ZPXA 2D3PA 4HVRA 5J09A 2NN8A 5LA1A 1O91A 4QPIC 4ORFA 3NRUA 1HX6A 1ZM1A 2XL7A 1AR71 3WP3A 4WVZA 3I97A 3SLIA 2HWD3 1VRH2 4Y5SA 1K5MA 5F9TA 4QB2A 1C1FA 2RR11 3USSA 2GMMA 2WFPA 4LO6B 1RJ8A 5IAVA 3VZOA 4P00B 5CBLA 1LKNA 2YZ4A 2AUYA 5JPMB 3ZN6B 1N3PA 2OZ6A 1W8HA 1RVF1 5EIYB 2P3IA 3WNOA 5A7QA 4B7EA 5AC92 1EAH1 1RYYA 2GAUA 3LPGA 2QQJA 4K21A 4KGQA 4UF0B 5CAZA 4OUSA 4XDOA 1ASJ1 4R52A 4U36A 2BEOA 3GBFA 2VG9A 2PHTA 5A6ZA 3AJYA 2LTNA 3ZXKA 1DP0A 4LHNA 3KHCA 2YV8A 1AR72 1H2NA 3M7AA 4ZU5A 4CP2A 1OQDA 3TEZA 4JGYA 4MZUA 3NNGA 4ASMB 3HVDA 3O7OA 5A70A 1UY4A 1UNBA 2NLRA 2VZ3A 3ALQA 1HXS1 5L73A 5A7OA 1VJ2A 3LE0A 4L8QA 4BQWA 1CD3G 1L7QA 1ZBA3 2ZX2A 1MQTB 1H4GA 1X33A 4H2AA 2CNAA 1KDKA 1SZBA 1FI2A 3BN6A 4XUTA 3K51A 5JLVA 2AZ5A 4LJHA 1D0GA 5B4XA 2Y6GA 1EAH2 3ZVXA 2HEWF 1UIJA 2GU9A 4RQPB 4ZZ5A 3VBHA 3G6JB 4DRRA 4J1XA 3IZOA 5T3NA 1WMDA 5C7GA 1W9TA 1KRIA 1DIWA 3S0MA 5FAXA 1POV3 5DDJ3 1O5UA 2XHNA 4PCRA 2JG8B 4YW6A 3WF1A 3ZLIA 1AL0G 4DY5A 3BI3A 4FPFA 1J83A 4YZ2A 2BPA2 2YUEA 2ORZA 4QXHA 2AC1A 4Y22B 5FLHA 3JQXA 1OMIA 2WN2A 2ORXA 5T55A 3K4ZA 4OMDA 1V6OA 4UW6A 3WNXA 4P5HA 1QH7A 1VAMA 3D6EA 3JZVA 4P5YA 1YCIA 1WLWA 5DAVA 2B39A 2VQAA 2ZABA 2W2IA 1FOD2 4DXTA 4K1YA 2J1UA 2D44A 1B35A 4FAHA 1XXNA 3LFMA 3URFA 4YW4A 2RDQA 1GZCA 5IK5A 2WS91 3ZM8A 3E6DA 3NKTA 3SH5A 2WA3A 4YSFA 3FUQA 3SH4A 1TVGA 4RS5C 1W6QA 2RS13 3WW4A 5FQ0A 5ABJB 3VKOA 4JHZA 4M3CA 3SKVA 1W2NA 1ENXA 4QKNA 2QVSB 4JX0A 4PDWA 1AL22 1EYBA 5JXHA 2WZR3 1F4AA 1JU4A 1JN2P 4JVAA 4QPGC 3S6PA 3D3AA 4LBKA 1S55A 2Q8EA 4XFGA 4E8CA 1VAVA 5C6CA 1SLBA 5I0SA 1IS5A 1POV0 1C57A 1B09A 1V70A 2DTWA 3ZFEB 2VMIA 4X8PA 1DZRA 1AR61 2FDFA 2DUOA 1C8NA 4DRVA 2WJSA 5SV8A 1KGYA 3OD4A 4MVTA 1GZWA 3AMNA 4C90A 2FBEA 5D2AA 2B42B 3IIAA 3AL6A 4ZY9A 3WF4A 1IKPA 4XQ4A 1H2MA 4EJRA 1UYPA 2RS52 1GV9A 3SQOA 1LAJA 3FHAA 3IPVB 3HAGA 4IE6A 3CLPA 3NJVA 1REDA 1JOJA 4DMIA 1PO11 2FDJA 1STMA 3HNMA 5CZKA 2WO7A 4GD4A 1UXXX 2RVAA 1A8MA 1EV13 1XOYA 2XBO3 2DFCA 2P6HA 3NJYA 4UAPA 1PGL1 3OY8B 3MV01 4NPRA 3CBNA 4HVOA 1NT0A 4YGEA 2PMWB 2WUHA 3K48A 4BDVB 1GOGA 1UU4A 2HWD1 4KBZA 1T2XA 2XHKA 4XXAA 5FYHA 3ZFGB 3T4VA 3TRSB 3ZPYA 1JZ3A 1AR63 3HQRA 1UYZA 3HT1A 2IXHA 4H55A 5JXIA 5KHKA 1LB2A 1OOPA 4QWNA 3PHMA 1IQDC 3FBYA 2OKXA 1O8SA 5JXJA 4I3PA 1ZRIA 1F5FA 3F2ZA 2D6MA 2J1RA 4XFIA 4NHKA 5GZDA 1OVPA 4XACA 1LESA 4PQ9A 4XQDA 4BZ4A 4A3ZA 4COWA 5I0UA 2JDZA 4KG0A 1ODMA 1X82A 3Q8BA 3ZIWA 1W8WA 5JOWA 4WBBA 5FXZA 3WDYA 2VOXA 1YO8A 3KMHA 1I6XA 1QOOA 3ZYJB 4QPYA 2Z79A 3ZXLA 2OZJA 2GC2A 3VUOA 4CCNA 4D8MA 2R1BA 1ZRDA 4MGKE 2XWJB 1KEXA 2FDGA 2XQXA 2C1FA 3H1YA 1PGL2 2W0XA 2YG0A 4Y26A 1RITA 5IWFA 5ANNA 3JB8A 2X53S 1U5ZA 1NUKA 1C28A 3DYOA 4HPKB 3H1MA 1HJGA 4L0PA 2BNOA 3OEAA 5LEJA 5A33B 1J1TA 1DGWA 3NO8A 1H1AA 3MW3A 2BGPA 1H9PA 3BTZA 2BOIA 1F2NA 3ECQA 4V1PA 1D2SA 2GC1A 5CFCB 1AYN1 1UY3A 3PUIA 2W39A 3I59B 5FWEA 1PGW2 2JDNA 3ZSMA 4BYYA 4PDWB 1PVC3 2VZOA 4J6GA 4LBQA 1CIYA 3UNPA 5FP3A 2Q8DA 5FY9A 3M1HA 1C4RA 5HCFA 4IXLA 2ES3A 2LALA 3TN93 1NLRA 1RUE1 5FZ7A 3OYWA 4YZ3A 4AFCA 4MHUA 3J4UH 5ACA3 2OPWA 2BVBA 5HV0A 2IVIB 4FOVA 4CUAA 1CAUA 3KV9A 3VKMA 2VJXA 2HEYF 2WSUA 2BWAA 5CNAA 3P3NA 5CA6A 4GKYA 3ZMOA 3KT7A 1W3VA 4BMBA 2ZS6B 1W2OA 4Y1XA 2PN5A 1OQEA 2E31A 1VBB1 5FMOS 3ZXGA 2P3YA 3BTAA 3ORJA 2LM3A 2YYOA 4SLIA 4W6YA 1C5IA 4R8HA 3KQ4B 1OC1A 2A5ZA 1LU1A 1VBC1 2GNBA 1DG6A 4K7JA 4P14A 1EPZA 3VBUA 1FMD2 4XUQA 3SISA 4XVHA 1GP6A 2W3JA 3IT8A 4DXZA 2Q8OA 5I93A 1RUG2 5CADA 3TN91 5EJZB 3MW4A 4TN7A 1GP4A 4QX5A 2R061 3O0WA 3AYDA 1KJLA 2QQUA 4Q0PA 1BLZA 4RFT0 4AG4A 1LGCA 4HT1T 1W3XA 4R9CA 5CISA 1A3KA 1V9U1 2BFUL 4EWAA 1VAKA 1K45A 5GZEA 1ND3C 4BXFA 2D43A 3KT4A 3A21A 1V6JA 4BISA 1IKQA 4HANA 3JBG3 1RINA 2ZHKA 1DLCA 1Y9QA 5JIAA 4D94A 3ZSLA 3AYCA 4AEDB 2ARAA 2DCJA 3NV3A 2PLV3 4CA9A 1AXZA 4UW4A 4LBQD 3U75A 2OA2A 2R071 1D4M2 2PTMA 4EE2A 1PO13 3ETQA 1RVF3 5GLZA 4ZHNA 3OYWB 4XFAA 5FBZA 1LHVA 1LENA 1OLRA 1QF3A 5DAWA 2H0BA 4A45A 1AL21 5FLIA 1RUE2 1HB3A 2VL4A 5AVAA 3ZR5A 5FY1A 3KZ4C 4DFSA 1OKOA 3DYMA 4MGIE 4DUWA 1JZ4A 5LK5A 3MF9A 1NCRA 1RUF2 1V6MA 2VMGA 4XDPA 5FLJA 5FZOB 1H30A 2K2SA 3FWEA 4KU7A 3AXDA 4OHVA 5DUUA 4CDWB 3VDAA 3AKQA 5A1AA 5BNPA 5L7OB 1UKRA 2G19A 3KV6A 2VZQA 1WKYA 3K77A 4Y4YA 3TYJA 1LNSA 4AEDA 2XMLA 3ILFA 1ZNPA 3HJRA 3VBOC 3OGGA 3RWKX 1US2A 3VBRB 4BU2A 1ULCA 3I3BA 5FMBA 2R043 4OI2A 3D0SA 2XG3A 3MEPA 4XQWA 4OVEA 4CEYB 4P02B 4L2NA 5BNQA 2B45X 1QOSA 2HYXA 4MHRA 2YU1A 4BLJA 4FTSA 1Y9MA 1X50A 4D7TA 3DPRA 5FYSA 3SKJE 2MEV2 4QX7A 3LF7A 3A22A 4C8DA 1RIRA 1UO9A 2HWD2 2WWJA 2E7TA 3BIEA 3DECA 2OPKA 2WFF1 1W04A 1UPIA 1PIV1 2W94A 4XW3A 4Y1UA 3WF2A 3WF3A 4B8EA 2NPIA 4EN8B 3AXEA 5FYBA 2PHDA 1B35C 1CPNA 3POBA 5BPXA 4WM8C 1C8M3 4LUMA 3N3HA 3MF6A 5J7MA 3U14A 2Z2SB 4XILA 4ASLA 4OHWA 3RZHA 3RZKA 1D4VB 1XSRA 4O7XA 1GBGA 4EQVA 2BBAA 3ZYBA 1MEC2 2WL1A 4BQ2A 3AZXA 3IDAA 2YMZA 4QHOA 3ZN5A 4CDUA 4Q4X2 2QTWB 3ON7A 4IGOA 5GLVA 1C5HA 2CGNA 4HSLA 1JYTA 1CAVB 1JHNA 5FREA 2A1XA 1UZZA 2EAAA 1CVNA 2VZUA 1JYXA 1DGLA 3ZYGA 4CDWA 2E7AA 5FIXA 1RUH2 2D93A 2VQTA 2Y0OA 4LO5B 2R49A 3VL8A 1PIV3 3GJBA 3PTYA 4A7KA 1A78A 1R1ZA 1UWWA 5A3NA 1Q8QA 1C3HA 5ACA1 3UJQA 1GZ9A 2Q1ZB 1UY2A 1VRBA 1S0CA 3FLPA 4FPKA 3LWCA 2WNOA 4MO3M 2VE1A 4O65A 4A6OA 5DQ0A 4XZPA 1RUJ3 2CDOA 2QQMA 4FP2A 1W9SA 4A3XA 1YFUA 5FZAA 1NA1C 4PBOA 4AI8A 4IESA 3Q8CA 3POIA 5E89A 4Z2WA 2YXSA 3FL7A 2D3SA 2DVGA 4I0BA 5DDJ1 4YG0A 4AGGA 3POFA 1Q5OA 1H8TB 1WCUA 3AP5A 2PFWA 1WA4A 1PM7A 1TE1B 4O9EA 2KXLA 3OGJA 4S2DA 4BPZA 2IFWA 3JD72 4D6SA 5IAXA 5T5LA 1PMHX 4QXBA 4H3WA 1EY2A 4FI9A 2NP0A 4CDQA 3UV9A 3VD9A 3T09A 1BYHA 3OPTA 1SACA 1JUIA 3M3IA 2IZWA 1FMD1 3Q8AA 1PZ7A 1S2EA 1YEWA 1RC6A 3T3YA 3T0AA 1SHWB 2FHRA 2RDNA 3ZYHA 3BUCA 4CDUB 4A7YA 3KT1A 4IUGA 4FBFA 4EROA 1OSGA 3IBMA 4NMIA 1YLLA 3ACIA 5EJ3A 4HBNA 3CL1A 1H8TA 5JPNB 3U78A 2WS92 3ZKYA 2YBSA 4JQTA 1OHFA 3OGVA 2F6BA 4Y24A 2VW1A 5D21A 5FUNA 3OBAA 3NJZA 5IVJA 3V0BA 4P9GA 1OD5A 5DABA 3ZXDA 5BV6A 3B9CA 4JQRA 1DZQA 3LSEA 4IERA 5FYUA 1OVSA 1ZX5A 5FYYA 5C4WB 1JZ2A 3ZFEC 1QHDA 1WWYA 4I30A 3D4KA 1RHI2 4UBHA 1XJAA 2LUWA 2ZGOA 1JHJA 1AUYA 1R083 2D7FA 3TOJA 1OD3A 2HWC2 5EXOA 1XPWA 3CJIC 3EHKA 4FPEA 1I1EA 1QKQA 2ZX4A 1H8VA 2X29A 3ZYPA 3VKLA 2ARCA 2BUKA 4NVPA 1KFUL 1VBB3 4BQ3A 4K6BA 2HEVF 3EXUA 3A0NA 3KSCA 4RS5B 5KHJA 3PDQA 2ETEA 4HN0A 2PXJA 2VZVA 3NAPB 2CL2A 3QH6A 5HBAA 4KU8A 2VOKA 4AGVA 5FDBA 4QQLA 2DWRA 4QAWA 1UOGA 5A7WA 3C8XA 1N47A 3I2IA 2R6QA 3AB0A 1MZFA 4JKKA 2Y33A 4G4FA 2PHRA 4GMP1 4NIIA 4UWDA 3RYPA 4L92A 1WLDA 2HWF1 4ATEA 4GQ7A 1E5IA 2Y6LA 1QJEA 3AFGA 2JKBA 2ZX0A 4UOJA 3AFKA 3ZYRA 2DUPA 4TTGA 1QDCA 2XJRA 4WVWA 2WWUA 1A6CA 3ZR6A 4EN9B 3H1WA 3BGAA 1LR5A 4F83A 1YUDA 2ZGSA 1FAYA 2JG8C 3M3QA 4DO0A 2VUAA 3B00A 1JZ5A 4IL7A 2RMU3 3MIDA 3P6BA 3LFIA 5TSWA 3THPA 4AFAA 1WMFA 5BNPC 1FPN1 1BEV3 1BK0A 2D5HA 5A80A 4MGTA 4ZXEA 4Q4W2 3PJQA 3PVOA 1SCRA 2DBNA 3O14A 5FO9B 4FFFA 3LOIA 1NYWA 2J1TA 4YYOA 2F17A 4Q4Y3 2WWSA 2GC3A 3MUY1 4E2QA 1GQHA 3J7MA 1BBT1 2XUEA 3LDBA 2OQ6A 3AKPA 3S5QA 2WZR2 1CQ9A 4QXCA 1YQCA 4RHV2 3O1TA 2JJ6A 4WVVA 2J7MA 2XOMA 5JI9A 4GMP0 4PLNA 3GBWA 2Y26A 3TBDA 2VM9A 5EQUA 5IK4A 3AX4A 1RMU2 4I0AA 4XBQA 4DB5A 4QKFA 4EZHA 3E1F1 2B4KA 3U07A 2XVKA 1WBFA 1K5JA 1QJX3 4FTBA 1FPN3 1OLME 4MXWB 2WNVB 5D8AB 4DEVA 5FPLA 1VBE2 4IEQA 3E5QA 5IFPA 4Y1YA 2PHFA 4AHZA 3UKVA 2R042 4QQOA 2VPVA 5KBFA 1YI9A 4Q1PA 2EIDA 1GWMA 5FZKA 1G9DA 4MGYE 1NY71 1WZXA 4NE9A 1J59A 3JUUA 4N53A 2BFUS 4MX3A 4EN6B 2QBXA 2XBO2 1IPJA 1O8PA 4L99A 3IPVA 4LBOA 4AL9A 3MZHA 2HWE1 1UQXA 3MLJA 1JU3A 4FOWA 1OH4A 2D6OX 4BK5A 2OVUA 4UBGA 4P9YA 1RJ7A 3CJIA 3G7DA 3GHMA 4RS5A 2DF7A 5DDJ2 2D40A 1Q8OA 2I2SA 2WNVA 4XAAA 5D8AA 1UIKA 2W52A 2W95A 4HXCA 2RE9A 3PLQA 2VY0A 1ASJ2 1YC61 3J26N 1J84A 3N7MA 2R30A 3KLSA 1CJDA 4LK6A 4AAPA 1MEC3 3BPSA 1ZA4A 2LS6A 4YGDA 1W8OA 2XVLA 3LA2A 4LA2A 3VDDB 2RDSA 3USUA 3WDXA 1CAWB 2QKDA 4NUBA 1LOAA 4OQ9A 3WEZA 4CDUC 1OI6A 1HV1A 2RJKA 4FOQA 4YRDA 1WGPA 4R4ZA 5FRAA 2PYTA 3WV6A 3V0AB 2B7YA 3VHPA 4QQPA 3MHZA 3UGFA 2VUDA 2XJSA 1JS9A 4AQ2A 5BNNB 3J8F1 5LBCA 5IATA 1NA1A 1ULDA 3DCQA 4XUPA 4KMQA 3VB9A 4HK9A 4R9DA 3BYWA 3R4DB 5F2SA 5JWPA 1G9FA 1ZBE1 4IEXA 4XAEA 5CG8A 4NIDA 3LAGA 4XJUA 5KWRA 4FVVA 3IAPA 2YBPA 1N1VA 2C5DA 2FMDA 3RVHA 5F37A 1EUTA 2FDHA 3OY8A 3W58A 3EYPA 2OIIA 3O0XA 4WVMB 2QQWA 2WINB 1KFXL 5H9QA 3AK0A 4WV8A 4R9AA 1NY72 5FYTA 3T30A 1VB4A 1GQPA 4YG3A 2ZMNA 1ENSA 2EIEA 2JENA 4WM7C 1TME1 4JCKA 4FXKB 4PI2A 1WMEA 2EA7A 1OLMA 3OF1A 5BNNA 1WD3A 2JDUA 1VBE1 3R05A 4BMEA 2Q0AA 3VD3A 2C26A 3BCWA 2ZEXA 1AR91 1CZTA 3OPZA 3HPNA 5F7UA 2G9GA 2HWF3 1GANA 4YM1A 1JW6A 1OKQA 2HWC1 3FZ3A 5G04L 3OPWA 4IGPA 1ZZ9A 5FPBA 2ZKLA 3CF6E 2XJUA 1MQTA 1BK1A 3A0KA 2MEV1 4OULA 4FAGA 2RS31 4AVAA 4MV2A 1L7LA 2WT1A 3RZLA 5C3PA 1W6OB 5I8YA 4UT5A 2JDAA 5FY4A 1AXKA 1WCQA 1Y3TA 4IV3C 5LASA 2YC2A 1X36A 2J1SA 4XCAA 1OXCA 5E1RA 3U37A 5C8WA 4CVUA 3TAYA 1S4CA 1Y9GA 4GAZA 1BHGA 1W2UA 2MPFA 2JG9B 4Q5OA 3HT2A 1PVXA 1AX0A 4B4PA 4AVCA 3EB7A 2WFF3 1NKGA 2DVDA 1UAIA 5DZEA 1AR62 1PVC1 1O6UA 1NXMA 4WM8B 1HLCA 3I3DA 4MUVA 1O3TA 4E8DA 1AVBA 2CGPA 4B4QA 4OUEA 1AL23 2JD4A 5F6KA 1BKZA 2EICA 4QU1A 3ZIXA 4WZFA 4LMFA 5F5CA 2OT7A 1HW5A 1XBFA 2WRAA 4CZSA 3RZGA 1W0OA 4Z1VA 1HRV2 5FZCA 1OFSA 2R7EB 2ZGRA 3O12A 4CEYC 2XR4A 3CJXA 4TLFA 1SQ4A 3THDA 4AHWA 1G9BA 3VBRC 5A3OA 3MW2A 3N9OA 1QJY3 1YJKA 2EXHA 1LOFC 4KGGA 5CKQA 4KBBA 3CKHA 5K0UB 5LY2A 2EIBA 2VTXA 5FO8B 2ZBJA 1VLNA 5L7OC 1VPHA 4M01A 3KS7A 1RUJ2 2ZGPA 2C4XA 5EPAA 4BHPA 3THCA 1W2AX 4CSWA 1ND3A 3RMXA 3HR9A 2GMEA 1PK6C 1UOBA 5A6YA 2YC4A 2P3KA 4P9WA 2VQ0A 1EV12 1S2BA 2A3WA 3J7NA 4YVSC 4I0WB 1S0BA 2HBUA 2WYSA 2XLGA 3J7LA 1DDLA 3K4AA 2DTYA 1SPPA 4HONA 3AZYA 4DNYA 4E4SA 4AK3A 2IXJA 4AHXA 1OPMA 1RHI1 1JYIA 1UMZA 3N4MA 5CVRA 4OHXA 3RJRA 3JD73 3QD6A 4B4RA 3NKGA 4JGYB 2D6NA 2GH8A 3DEMA 3BB6A 4FPJA 4LXLA 3HN1A 3AKTA 4XYXA 5C70A 1O3QA 1W90A 5A32B 3NVCA 3MV11 5DZFA 2OX0A 4OI4A 1ZZBA 5DUXA 1W0PA 1UZVA 2VCMA 4OUMA 2ID4A 1RUD2 1Z7S2 2VBBA 4GWMA 1BEV2 5FP4A 3UKNA 4AOCA 2UY8A 1ND3B 3KGLA 2B8MA 4XTMA 5DAQA 3WR0A 1VR3A 4PT6A 5L19A 3KWVA 4NJ4A 2C9KA 2VBPA 4URTA 1TMF3 1G9CA 2KR2A 1MS4A 3OTFA 2P17A 1J1LA 2DCKA 1LULA 2X8KA 4K9SA 3O1UA 3WOGA 4GWJA 1QNWA 3ZFGA 1JYVA 4CDQC 4IGQA 2WO2A 1C8M2 3L2YA 1NQJA 3M4FA 2JDKA 1NXD1 4HKOA 3AP7A 3FN9A 4Y22A 4RQPA 2MNGA 3VBHB 3M8LA 1O59A 4G3YC 3N7KA 3GALA 4N9HA 5F6LB 3W59A 1LU2A 1RUJ1 2PHWA 4EYUA 1UXZA 3RJ2X 3WHTA 2VZPA 4E4HA 1W6QB 1NQDA 3JXSA 4YW2A 1K12A 2QFEA 3QLQA 3AKSA 5EYXA 1CJPA 3E6CC 2RR12 2RJLA 3LEKA 3NNMA 4C91A 2VNOA 1RUF3 3VBRA 3VHOA 1Q8VA 2VZRA 2VOWA 3C7GA 3ZYIB 4JTNA 4N43B 4ISQA 2CWSA 2P37A 4UFHA 2JX9A 5F1RA 1RUH3 5DUWA 1QXPA 4NWVA 1K42A 1V0AA 1LEDA 1VMFA 4LR4A 5AVPA 3WNMA 5J36A 3TN92 2CAUA 1KDMA 4LITA 1V6KA 3UESA 5FP8A 2VMFA 4IEYA 1MZ6A 2D5FA 2WLQA 5ACA2 4S2GA 4FFIA 3APBA 1W9WA 1XYPA 2AR6A 4KWLA 4NIGA 1LECA 2R32A 3JQWA 4LO4B 3M3CA 1F5JA 5CB7A 2BVVA 5CFCC 3T2OA 2ZOEB 1YJLA 2AGSA 4Q4V1 3U4SA 4XPVA 4GB31 5BXXA 2Q5TA 1K5MB 1R093 4AI1A 1HB4A 3PUSA 3M2MA 2W87A 5EHDA 1YIFA 5C71A 3ZXAC 3DV8A 2WNUB 3IAQA 4QGLA 5A7PA 1CGPA 5ERLA 3WXPA 3CEWA 2GNDA 5IFTA 4IEOA 3J8F3 4AI0A 4Q8KA 3POYA 1V9U2 1RMU1 4JV4A 2KA3A 4HLTA 2ZCWA 1T6GC 4AQSA 1QGLA 4P08A 4DQAA 2WT0A 1TEIA 1VBA2 1U5YA 4MXVA 3ZFEA 4AW7A 4HPKA 1SLAA 4HETA 1DYOA 4IE0A 2WZR1 1ZRFA 5T5OA 1L3JA 4XJAA 2FD8A 1PO21 2FZ1A 2V4VA 1NG0A 1Q43A 3FE5A 3KCYA 2F4LA 3MGUA 5FYMA 4H14A 5A7SA 3H3LA 2GNTA 2XONA 3LIHA 4OI0A 4RD7A 1LJ7A 2D97A 1IZ3A 1W6MA 4Q4W1 3OEBA 1NCQA 4DPNA 1RUC1 4I09A 1DLLA 3HOBA 4GWIA 5FZ9A 1LTEA 4ONUA 3ZFGC 2A7AA 3AMHA 3AYEA 4CXXA 3VD7A 1Q8PA 3BPZA 3SXWA 4AWDA 1RMU3 4OCTA 1XNDA 3B94A 2VMHA 5C8CA 2ZKNA 4IV1B 3THTA 2RS33 5JAXA 1POQA 4LIUA 5BY5A 4FOYA 3CNAA 1MS0A 5FP7A 5FPXA 2AENA 5JOYA 3MICA 2ZAHA 3LA7A 3MLKA 5CKMA 2W1SA 2OUJA 3CZJA 4V2VA 5LATA 3BTYA 1QJX1 1SDWA 2W91A 3M3OA 2VZSA 3P3PA 2HJIA 5FK7A 5H9PA 3S7EA 4BM8A 4QX1A 3FHQA 1UZWA 4YNIA 3B9IA 4FSJA 4QM8A 2IC1A 2ILMA 2IXCA 4LBJA 3I59A 3FLTA 2HKXA 2Q4SA 4NOTA 4JKMA 1SEFA 1QJZA 1COV2 4QU2A 2CHHA 3UETA 3ZPOA 4NIHA 1RUC3 3B7MA 3O1MA 3I3QA 3KB5A 2FZ2A 2RS53 4YZ1A 3UYJA 4CUCA 3WY6A 4LOTA 2A6XA 5C9AB 4W6XA 3D0JA 4GJYA 3ME2A 4XF0A 1ZRCA 2RM21 3GGLA 4QPGB 3RGBA 1CAVA 4CRQA 2VCAA 5FP9A 3BODA 5A1LA 3SCFA 3KCXA 3OUIA 4KI5M 2AEYA 1SFYA 3B5LB 3PIJA 1MZ5A 2E6VA 3LB9A 2R062 5A6QA 2QZ3A 1VIWB 3WHUA 4D6QA 3EO6A 2BGOA 3FJSA 5B4NA 1UN1A 4FPLA 2JDMA 1MPXA 5FYIA 2G9FA 3GZTB 1J3PA 1SLCA 4N53C 4OYUA 4YM2A 1V6NA 4QX8A 3RPQA 2RMU2 2C9AA 2X5IC 4CEWA 1Y4WA 5KXCA 4CUGA 3U11A 4QD2A 5AFBA 5T5PA 1FATA 4NR1A 5IK8A 2ZJCA 2PAMA 2FCTA 3HD8B 3HEIA 4LBNA 1UKGA 2ZTNA 4Y5TA 1JMUB 2YDEA 4CP9A 2G9ZA 4MG2A 1S0FA 2W1UA 2E63A 4KL1A 4XE9A 2LROA 2R0FA 4BCUA 5C3OA 4NWWA 1P8JA 4PIXA 2JECA 4D7YA 1Q56A 3Q8FA 1UU6A 1N3OA 5FPAA 1DQ5A 2IUWA 3MFAA 4Z92B 3VBHC 5KHGA 1SDDB 2R16A 5BUVA 5ISLA 4IQPA 3O1VA 1ZZ6A 4JKLA 5K7PA 4LKDA 1GMMA 1KITA 1DQ6A 4WZCA 2JIJA 2CGOA 4CDQB 1NZCA 3T2PA 3ZXJA 4PHZA 1X8MA 1FX5A 1PO12 1RVF2 3OG2A 2BQPA 3WX5A 2WAAA 1F31A 2QQNA 2Y64A 2B5HA 1H6XA 1W6MB 5EJ1B 1J58A 3I7DA 5EYYA 4IEZA 1MVEA 4M4RA 5G05L 4RQPC 3LIGA 3VBUB 3IWZA 1BQPA 1HB2A 1VBE3 1WLTA 2UYAA 3INAA 2IFRA 3R4SA 3KHBA 1XYOA 5FYZA 5HXVA 4CCCA 2XJTA 2NYYA 1MQTC 4YM0A 1RUD3 1Z7S3 3RS6A 1JI6A 2BYVE 3BIWE 3BTXA 2YY1A 2P3JA 3N36A 3NV1A 5LB6A 3E97A 3OGRA 2SLIA 5FZOA 1I5PA 1SBFA 3ASIA 3CZUA 1CZSA 2ATFA 5IVVA 5C8CC 1MVQA 2WBKA 3UKTA 4LBLA 1IS4A 1XNAA 5LK7B 2QUOA 1CONA 3WD5A 3PMEA 5FMDA 2ARXA 4X6RB 1F35A 1U12A 2CV6A 5GM0A 2FQPA 1NCQB 3K46A 1GOFA 1HV0A 1ZYBA 4AI3A 4CU6A 2XL9A 2VW0A 4GH4C 4Q4X1 2WS93 3ZO0B 3UJOA 3VLBB 2C6SA 1GUIA 4E2SA 3J9SA 5FKBA 3I54A 2VW2A 3B01A 3HQXA 1W8FA 2B46X 2PLV1 4KQ7A 5F8PA 4QPIB 4COUA 3LEGA 4LPLA 5FKCA 3LDKA 2I74A 4G9SB 4XTPA 2W68A 2GP3A 3H3UA 4ZXKA 4COZA 3LZZA 4AXOA 3M3EA 2ZZQA 5FO7B 1GWKA 1LHUA 5LA9A 3WNKA 2UYBA 1R082 1S0JA 2SBAA 5H9RA 2DDUA 1W05A 1HQWA 4EWDA 4Q4Y2 4ISRA 1DGWX 3O0VA 4LT5A 1AR92 2AYHA 1RGSA 3VDBA 1VB2A 1UZ0A 2VUCA 4RR3C 3JBG2 1LOCA 4OMCA 1AX2A 1UMHA 1XU1A 2X10A 1XSQA 4UI9L 3HMYA 2WIIB 2RS51 3RFRA 2UWAA 1JYNA 4BQYA 3POGA 1UPSA 1YNAA 1XYNA 4WVMA 3PURA 1ZZCA 2BRTA 1D2QA 4IV3B 3ZN4A 4E9KA 2WNEA 3ES1A 1RUE3 3VZKA 1LODA 4XIKA 1QJX2 4XJ9A 2HWF2 5FZFA 3T0BA 1R1A2 2DURA 1UX7A 2YU2A 1KS4A 1QJU2 4UF0A 1XB9A 5FTTC 5FZ4A 4A42A 4GJZA 4XABA 5HCHA 3U0ZA 5JXGA 4MGZE 3VZLA 1TQ5A 5FUIA 3MDPA 3PMSA 4K8FA 3DGTA 3OBTA 2WAOA 2FMYA 4PIZA 5FZIA 2V5DA 1AX1A 1NCRB 1UX6A 2Q1MA 4N8MA 2YFUA 5FXVA 3WW1A 5BNOA 4GZ9A 1KJRA 5KXDA 3SCGA 3I2DA 1GYKA 2EF6A 2IWGB 4OLLA 4BH9A 4IE7A 3FUOA 5GKAC 1W6OA 4FFHA 5FZ3A 1V6IA 2RHPA 4QPWA 3OBZA 2AREA 1G9AA 4BQXA 1AJOA 4NROA 3NNLA 5CU1A 1DBNA 5IUQA 1VRH1 1ZZ7A 1ASJ3 1Q8SA 2EIGA 4FP3A 3GF6A 3LOBA 5JIUA 4QGMA 2C0ZA 3K2OA 3WNLA 1D0HA 2TNFA 3A7QA 1N1YA 1ND2C 4INDA 2RV9A 4JHTA 3SH3A 4AF9A 4E27A 2ZGUA 3RNSA 3CMGA 2RS32 2XLFA 1MS9A 5SV5A 3NNFA 4JDMA 4BIFA 5BNOB 1GNZA 1OOPB 3FX3A 3S57A 3OUHA 1BXHA 5BNNC 3LCPA 3VBFC 2OYZA 1REEA 3JCIA 1OH3A 4FT8A 2NQYA 1YFWA 2ZGKA 3BALA 4L9BA 3TNQA 3AZVA 3OBRA 5C3QA 1AR81 1ZVFA 3NQHA 4XFCA 5F5QA 1QJY2 2QE3A 3I3MA 3MPPG 1ONAA 4YG6A 5EFUA 2LW8A 4RR3B 2J1EA 3DXUA 5L9VA 2NMOA 2XKOA 2XJVA 2ZMLA 4P9LA 3VBOA 5FZDA 4YVWB 4XFHA 2ZGMA 4N7UA 1SLTA 5E88A 5K9YA 3HBKA 3OD0A 4P9XA 5T52A 2JDYA 4Y5Z0 3SEEA 2I07B 3WQBA 3VHNA 4DOUA 1R1A1 5C4WA 1C1LA 1QJU1 1OLQA 1US3A 4NRMA 4TSVA 3WVJA 4HSJA 4L97A 3WNPA 2VNGA 3ZFFB 2WFF2 3J8F2 5FPVA 2DU0A 2J1AA 4Z82A 2EXKA 3I2HA 1QEXA 1V9U3 1W6NB 2W5FA 3C7EA 2E26A 3F95A 4QX0A 4XETA 5FZ6A 2XB6C 4FQ4A 4QB6A 5AFEA 3N9NA 4PJYA 4RGGA 3ROUA 1AYN2 1SBDA 2N7GA 4UYBA 4QMAA 5DXDA 4QQ2A 2A71A 4XIOA 5LBFA 1KXGA 1M06G 2WZPP 3AP4A 2J42A 3WW3A 3I49A 3OGSA 2E32A 1BBT3 4YW1A 4HN1A 5DPNA 3FFQA 2X09A 4HKWA 1C8M1 5DG1A 2D3RA 2JWPA 4O61A 1UOFA 4C1XA 4CCKA 4CCOA 2JE9A 1RUI2 2P4EA 4CTEA 2ZMKA 1XNCA 2W47A 5FWJA 1DF0A 1PZ8A 3E6BA 1JYWA 2PELA 4QXKA 3PVNA 4OHYA 2HWB1 1WA6X 1OA2A 3AMPA 3GHNA 3WDVA 1ENRA 2BW8A 1S0IA 1UOJA 1YWKA 2VMDA 3B02A 3I2FA 4IE4A 4UFIA 2QDRA 3Q9OA 1BCXA 1DYPA 3VBUC 1VBC3 4ARXA 2PHLA 1GP5A 4CU8A 1DGRN 1PK6A 1RUD1 1Z7S1 5T5JA 1TME3 1G7YA 4PF1A 5JSOA 1HDKA 2WT2A 1HN1A 3KGZA 1JXNA 2R041 3E5XA 3FHIB 4AQTA 3MPBA 2MHFA 4ES9A 4A4AA 1T6BX 1SG3A 3SITA 1MS3A 2D6PA 2O0OA 2V73A 3RYKA 1RUI1 2QQLA 3T0DA 2YHJA 1JBCA 1BJQA 5JOXA 2P5BA 5CFDB 5CYYA 4K3UA 2EXIA 3H8XA 3KVAA 3N9QA 3ZXEA 3AYAA 3KV5A 1POV1 2DVBA 3K3NA 3ZDVA 3ZYFA 4R9BA 5GZFA 3ST7A 5IVFA 1H2KA 1XRUA 5C5TA 2EAKA 2VOVA 3ITQA 4KG8A 1LRHA 1RXGA 1PX3A 2VH9A 3IIIA 5GJ6A 5I8SA 2WKKA 4AFMA 1W8UA 5FPZA 4JDOA 3WP6A 1FV2A 4CP1A 3T2QA 5LW9A 1CAXA 3EQEA 2R073 1Y7BA 3W5MA 2WDBA 5FXWA 3S5AA 3ZSEA 1R092 1FT9A 2ENRA 2ZGQA 2X5IB 3AVRA 3OJBA 4AHYA 2BNMA 3NAPC 4K20A 4MOAA 1AZDA 4N53B 4UFKA 4XJWA 2BNNA 2P6CA 4Q0VA 4YVWA 3SEPA 4QDQA 2Z42A 3V65A 4KH9A 1QH6A 2A6WA 2WQZC 3NAPA 2FDKA 3S7IA 3I2KA 5F3CA 3WDWA 4Y20A 5T54A 1W06A 1VBA3 1IPSA 1YQ8A 4XHBA 2G4IA 4N43A 3CJIB 5FZEA 1MR5A 4XUNA 4LE3A 4M00A 1GICA 1XQNA 3FLRA 1VMJA 1WLCA 5FZ0A 1HJFA 3ABZA 3T1MA 4XFFA 1E5HA 1LOBA 4QKDA 4AI9A 3W5NA 4CDXA 2QJVA 1TMF2 3PVBB 4Q0QA 5I0DA 1HXS3 3VDDA 3B69A 3WNNA 1HN0A 4QB1A 1DQ1A 1PX4A 1QQP2 1VBD1 4XJ8A 1X7NA 3DYPA 4JGZC 3WZ1A 1YQ2A 2RG4A 1WW4A 2V72A 2AACA 1G86A 4AFDA 1R091 3IB3A 4UW5A 3C7HA 2VU9A 3SCHA 1GZTA 1IG3A 2NM1A 3CDZB 2HH9A 2A73B 5JSRA 2F4PA 3LA3A 5F5AA 2VOTA 5FZLA 3P5BA 2ZZJA 3EBRA 4M0HA 2R0HA 3R6SA 4SBVA 3UGHA 1EP0A 3NSTA 3PUHA 3I2OA 2WABA 5ANQA 4RGKA 3H8RA 1CWPA 1EPWA 3HNYM 1V00A 2I45A 5JVVA 3HN3A 3RSJA 1QJU3 2VNRA 1J3QA 1W6NA 3MO4A 3KVBA 5LWBA 2D6KA 3AP6A 4BB3A 4GA9A 2XWBB 4RGAA 4COVA 1EV11 1JUHA 2ZAAA 1REFA 1NLSA 1LHWA 4RYDA 2V4AA 4MYEA 5FJKA 1W28A 1BVVA 3ACGA 4A41A 1FPN2 4XHXA 1H8TC 5FZMA 4EZ4A 3BVCA 3V0AA 1AYM1 1XE0A 1Z0HA 2BU9A 1UU5A 1COV1 2ZHMA 2BV4A 4Y20B 1RUNA 1MEC1 3NV2A 3Q8EA 1NA1B 4B29A 4GULA 4LE4A 3BOPA 2E53A 2E9QA 4OHZA 3O5SA 4J1WA 4MH0E 2Y6JA 2OUHA 3AC0A 1FNYA 4IEPA 3MYXA 2RS11 4LORA 3RZZA 1TNFA 4RR3A 5FXXA 4BJ0A 3VKNA 2DCYA 5LZ6A 2ZX1A 2JB4A 2W08A 5F39A 3SHRA 1U0AA 2R063 3K3OA 2ET1A 4ZKTB 3HNBM 2GMPA 4QDRA 2VGDA 3WQ0A 3WLUA 5DG2A 1E5SA 2VQUA 5FR3A 2BGCA 2ZXQA 3HQUA 4M0NA 3VKFC 4RFRB 5J96B 3IMNA 4NAMA 1DQ0A 4QKBA 5AC91 5C33A 1XNKA 1ULEA 3LEMA 3W20A 5L9BA 2PQSA 1ST8A 2XVGA 4LLOA 4OZOA 1ENQA 4HZFA 4DUVA 3M70A 4WM8A 1RXFA 2JG8A 1N3QA 4XF3A 2IVJA 4AQ6A 3N7JA 4YGCA 4BQ5A 4XURA 2JE8A 2ZEZA 2EVXA 4KWUA 3T1LA 5K4LA 1HRV3 2QQPA 2ZHLA 2VZ1A 4CEYA 1NAEA 4GWNA 3RWNA 3WF0A 2RM23 1EUUA 4LIVA 2O14A 1PHMA 1QJFA 3AMQA 5JOZA 1HKDA 1YI7A 2PHUA 3DPRC 5A3WA 2BTVC 5C5UA 3O1PA 4Y1VA 1B35B 2H6BA 1DZTA 5A3TA 2XBO1 1XE7A 2RDRA 3A23A 5A33A 5H9SA 3WT3A 4FXGB 5CEHA 2W46A 1F9KA 4PI0A 4U2AA 3LEIA 1UYYA 1H2LA 2E33A 1ZZ8A 2UY9A 4FPYA 5LY1A 2Y6HA 2V5YA 4DZGA 5CFCA 3VD4A 1ZBA1 1AYM2 2WO1A 1X8EA 2C24A 2R1DA 3GBGA 3KF5A 4Q29A 4YGBA 5A1FA 5E6HA 4Q1RA 5I0TA 3OSDA 3T4HB 3VL9A 4URAA 4MGSA 1PZ9A 2A3XA 1L7RA 4CCLA 5LCWL 3PL0A 4Q4V2 1ODNA 4Y4RA 1CPMA 1W8NA 1MACA 2HYKA 3E5UA 5JDBA 3WCSA 3ZXFA 1ULGA 2E7QA 3FC0A 2XPJA 4FPHA 1UW8A 1LHOA 1W8TA 2GC0A 1HRI1 1FOD3 3ETPA 4LA3A 3VHRA 2K0GA 1URXA 1PO22 3MBWA 3N9LA 4YLZA 2Y34A 2W9XA 4KWKA 1S2KA 2GP5A 3ZOIA 4E2GA 5JZGC 4DUXA 1SFPA 4XXPA 4CDWC 1R64A 1H4HA 2H6CA 3C7FA 2Q1FA 5IVCA 4PF5A 1AXYA 2JDHA 3KM5A 3LGRA 1QOTA 3S30A 5DAXA 3SMHA 4YWAA 4CPBD 4ZU7A 1YFYA 1GNYA 5KC6A 1GKBA 2YC0A 4BXSV 4CUBA 3RZJA 2OS2A 2QQOA 2BBVA 1X9PA 2A70A 1GQGA 3K4DA 4BK4A 2Z5WA 3WDUA 4YW7A 4B3NA 2ARBA 5F3EA 3MIEA 1TME2 1IS6A 2G1MA 3ZSJA 5APAA 5A32A 3PU3A 4GXLA 4XDQA 2AEZA 2IXIA 2X5IA 3IKWA 4LNVA 5FCCA 4CEWC 2DCZA 5IVBA 5J37A 3RI8A 3VBFB 1LEMA 1MS8A 4PLOA 5C9AA 3A4UA 1AR73 1OOPC 1SCSA 3WG4A 4ZPIA 3BOWA 3C2UA 3O1SA 5A3UA 1UCXA 3CQOA 2RR13 4N90A 2VUJA 4NAOA 1OT5A 2XLAA 2VTFA 4DEQA 4LEJA 1I9RA 3LPFA 1ND2B 1WW5A 5F32A 3VBSA 2JD9A 3CIHA 4DINB 4K40A 4MADA 5FOJB 1JOPA 4TXWA 5K0UC 4BQ1A 1DYKA 3NNJA 4M3CE 4ITCA 5FZ1A 1UL9A 3CHXA 1EAH3 5EWSA 4EN7B 2R072 1COV3 3ACLA 3I2GA 2X05A 3SNMA 1UF2C 4AGRA 5KXEA 5GLWA 3ATGA 3AJZA 4XC9A 3NWKA 1VMHA 4IV1A 2Y0IA 1QWRA 4CXWA 4Y3OA 1R1A3 1VRH3 1DFQA 4ES8A 5FJHA 5K0UA 2BP6A 5IVEA 3RQ0A 4MSVA 4Q0SA 1JYCA 4M3CB 1O5LA 3V56A 4BOWA 1FNZA 2ZHNA 2HWE2 4QX2A 3CO2A 3JU9A 2RJ2A 4MXWA 2ZX3A 4XMAA 5AC93 4C0BA 2JG9C 3PJYA 1XNBA 1H1MA 4UXAA 4XMIA 4IDZA 4NRQA 1QQP3 3H42B 3U10A 3VZJA 3QCWA 1CAUB 1SBEA 1YRZA 4NHMA 4CCDA 2WLPA 3QOPA 2FDIA 2HWB2 2IXKA 4ATFA
chains in the Genus database with same CATH topology
1Q3EA 4I01A 2PHXA 1RUF1 3TWIA 4AEJA 1AR93 4AVSA 1AF9A 1BMV2 5JMCA 3WUDA 3AKRA 2CYFA 3H3ZA 1IQAA 4JGZA 3R4UA 2GSYA 5L36A 5E16A 4YW5A 3DUIA 3ZN6A 4LTAA 1QJY1 2WNUA 5D1IA 2ZGNA 4WM7B 1ALYA 1G8WA 3KD4A 3V64A 4AEKA 1VBD3 4S2FA 5ABJA 5K8SA 4GH4B 4GB33 5DZGA 4META 4HK8A 4N9IA 4DS0A 1YXWA 4OI1A 1QXJA 2DYCA 2DV9A 5DUVA 4IEVA 1NCQC 3I8TA 1H0BA 3WINE 4JDNA 2EXJA 2ET7A 3KQRA 1AJKA 3H0OA 4CEWB 4EN0A 4ZU4A 4GALA 2BWCA 5IT6A 5C8CB 5JZGA 1CESA 4F7ZA 1GZWB 3MIBA 1G6NA 2GNMA 1FMD3 2YGLA 4XBLA 1RB8G 2P34A 1DQ4A 4R4XA 3H7YA 4OFGA 2DCTA 3NV4A 2O8OA 4O9GA 3POWA 1GSLA 2DU1A 2AH2A 4Z8BA 4QPGA 3UK9A 2CWMA 5J98B 3RG0A 1XU2A 1GFF2 5J48A 4YZ5A 4UW3A 4XJZA 1HXS2 4TYSA 2PAKA 4FQZA 5GZGA 3WW2A 2QCSB 4AI2A 5JZGB 3IDCB 1BZWA 2XH6A 4WM7A 4GIQA 1PGW1 1MZEA 2VECA 1D4M3 1WCDJ 3RYRA 4JRAA 4YM3A 5ABJC 3LKJA 2JG9A 4QGNA 2WNVC 5D8AC 2A6VA 3DKWA 3ZMNA 3ZFFA 1M4WA 3JBG1 4XF9A 3WQ7A 4P9JA 2GDFA 3H50A 1HRI3 1IGOA 4IEWA 1WCSA 5B2GB 2Y38A 1IS3A 3PVEA 4LO7A 1ZBE2 4M3CF 3DPRB 5CG9A 1VBA1 4JAAA 2O8QA 2GN7A 2ZGTA 2YGMA 3IDEA 3TB0A 1APNA 4AEMA 2UU8A 1QY4A 2JEMA 4HFSA 2DFBA 1MS5A 3JB4C 5LRRA 3RDIA 4AVBA 5C9AC 1UZYA 2GN3A 1RUC2 5BNPB 5L7OA 1VALA 2B9UA 1QXRA 4BIOA 1NOVA 3D5OA 4Q27A 4XF4A 1CX4A 1KS5A 2WSVA 3VV1A 3AM2A 1H9WA 3N35A 4H7MA 3D8CA 2VULA 4IEUA 5JI7A 4FO9A 1DHKB 4AFBA 1S1AA 4PIYA 1LGNA 1OA3A 5EV7A 1QNYA 1RUG3 2VVEA 5GLTA 1WW6A 4BWOA 3RI9A 5GZCA 4XBNA 1O4TA 1NE6A 2DVAA 1NE4A 3ILNA 4NHLA 2E51A 5JR7B 4HL0A 4JRLA 1OQ1A 1BBT2 2HWC3 3AP9A 2DVFA 2NZ9A 4IV1C 1HQNA 4AVTA 3IN9A 4PBPA 4KWJA 2RM22 4YVSA 4P9IA 1AR83 1VBB2 1FYUA 4L11A 3MI8A 5HCBA 3MFCA 4QHBA 4QPIA 1TMF1 3HIFA 5EZWA 4A2UA 4E4DX 1HIXA 3POSA 2DUQA 1ZBA2 4QQHA 3AZZA 3GZAA 1PMIA 3AMMA 2ERFA 2NMNA 2O1QA 1OPOA 2Z69A 4AYUA 2A75A 4X8NA 4Q2FA 4RL7A 4Y1ZA 5JCTA 4LO8A 3PNAA 1PVC2 1VP6A 5C4WC 1PGSA 1YYNA 4OZXA 3GZUC 4I02A 1YFXA 5FFOC 4Z07A 4N7IA 4BLIA 5KHHA 4FPGA 3QH7A 4JC1A 2EALA 2TEPA 4JGZB 4CDXB 2WNUC 2RMU1 4LBQB 1AYN3 1FOD1 3CU7A 1K5MC 3VZNA 1BVP1 4KNCA 3IDBB 4Q4W3 4YW3A 4Q26A 4LUKA 2JXAA 5I91A 1GLHA 4B7KA 2PAEA 2OW4A 3FFZA 4Q4Y1 1N1TA 1SLIA 5CIRA 3ENRA 3WP5A 1CR7A 1CIWA 5FMOL 4IV3A 3X29B 3BU7A 1RUI3 5T50A 1YIPA 4EWEA 1SLLA 4C0HA 3WG1A 2RS12 3B3QE 1GNHA 4W65A 1U5XA 5IK7A 1N1SA 2XGXA 1BEV1 2PA7A 2A6ZA 4N43C 3ELNA 3MIHA 3FMGA 1VBC2 4E4ZA 3KCCA 3ILRA 4A7ZA 3NW4A 1DQ2A 3QACA 3RMYA 2WA4A 1WD4A 3U4XA 4GB32 4YFWA 1LOFA 2QNKA 1PIV2 5BYNA 3V0BB 5CFDC 1QMJA 4D3WA 2CY6A 1V6LA 3H8UA 1O7FA 2Q30A 3JD71 1QU0A 1A8DA 2MEV3 1W6PA 4D69A 5I8TA 4HVQA 1GR3A 4IETA 3H7JA 5E8AA 3GNEA 2A6YA 1PNGA 2XKPA 4NN0A 3WG3A 3T2TA 2XJPA 1O4ZA 1SMVA 2VXRA 3ES4A 3VBSC 1LOGA 2GZWA 4PLMA 1FXZA 4MLOA 3ZDSA 5HI0A 4AVVA 4JGYC 1KQRA 1MS1A 3C3VA 4XFBA 1F8VA 1U5IA 2PQQA 5KHIA 2QDNA 4YARA 3D82A 1I3HA 1D4M1 1RUH1 3L9JT 4YVSB 1BMV1 2HWB3 2WQ4A 1JTZX 3RRDA 5GLUA 3AZWA 1PK6B 2IXLA 3VZMA 1PNFA 4TZDA 4C1WA 4QT6A 4YZ4A 4LBMA 3OCPA 4I3GA 1S0GA 3HWJA 3ZX7A 4BA6A 3I4IA 3VBOB 2GH2A 1AHSA 3FBMA 1SFNA 2WC2A 3ZFFC 3R0RA 3WG2A 2JE7A 1S0DA 2QZ2A 1CN1A 1WUVA 4COYA 4RA0A 3WQ1A 3USUB 2JICA 4JTOA 2P2KA 4XOGA 1ZBE3 4FPCA 3MIFA 1XE8A 1R081 4YVWC 1H1IA 2UURA 4F8AA 2D98A 1LGBA 1WW7A 2UWCA 4S2HA 4CP0A 1RUOA 4AEDC 3VN4A 1O4YA 1DGRA 2VVFA 4NO4A 1ND2A 1PO23 2VVDA 1OA4A 3VBSB 1IPKA 4QM9A 5HCAA 2KM2A 2H0VA 4H7LA 5A3LA 1DU3D 4TWTA 4FCAA 3GYDA 4LLFA 3ZSKA 2A3YA 1E57A 5BNOC 1RTVA 4RSUA 1ULFA 4CYDA 3TNPB 2YROA 3NL1A 3H9AA 4X6QB 1HRV1 1WBLA 5J3UA 1LHNA 1IHMA 3L2HA 1FV3A 4HKLA 3VBFA 2HWE3 2ZACA 3WDTA 4W6WA 1W39A 2CTVA 1RL3A 3MLLA 1LCLA 4YFZA 4HMZA 4LHKA 2ZGLA 3DN7A 2TBVA 1QDOA 1AR82 4Q4X3 1NCRC 1JH5A 1OFNA 4LULA 2V09A 1HQLA 4XF1A 4XEZA 5CFDA 2XJQA 4GMP3 3W9AA 5A3MA 1YHFA 3WP4A 3VGIA 3WUCA 1S0EA 4GKXA 1CAWA 2CAVA 4RHV3 5LRSA 5FQ0B 4AE2A 3WCRA 4LHLA 1RUG1 4BE3A 1W6PB 3HBZA 4XETA 2PLV2 2YPJA 3QBQA 1WCKA 1Y43B 1CAXB 3EJKA 1HRI2 4PDWC 1J3RA 2TUNA 2D6LX 2UWBA 3LSDA 5KXBA 1RHI3 1AYM3 4I2OA 1UD1A 1Z78A 4D7SA 2K9ZA 1QQP1 1VBD2 2ZA9A 3DL3A 5GALA 5KC5A 4FPOB 5LEKA 5JSPA 3IM0A 3VDDC 1O3SA 1KD7A 4K1ZA 5I0RA 3MIGA 4CDXC 4Q4V3 4F3JA 4Q0UA 1ZREA 1ZRRA 4DY3A 4EV0A 1O3RA 2GALA 1LOEA 1IOAA 4FTEA 4GH4A 2XUMA 3N7LA 4Q8LA 4RHV1 3UL2A 1TNRA 1I5ZA 5FOBB 3B93A 3DF0A 2ZPXA 2D3PA 4HVRA 5J09A 2NN8A 1O91A 4QPIC 4ORFA 1HX6A 1ZM1A 2XL7A 1AR71 3WP3A 4WVZA 3SLIA 2HWD3 1VRH2 1K5MA 5F9TA 1C1FA 2RR11 3USSA 2GMMA 2WFPA 4LO6B 1RJ8A 3VZOA 5CBLA 1LKNA 2YZ4A 2AUYA 5JPMB 3ZN6B 1N3PA 2OZ6A 1RVF1 2P3IA 4B7EA 5AC92 1EAH1 2GAUA 4K21A 4KGQA 5CAZA 4OUSA 1ASJ1 4R52A 4U36A 2BEOA 3GBFA 2VG9A 2PHTA 3AJYA 2LTNA 3ZXKA 4LHNA 2YV8A 1AR72 1H2NA 3M7AA 4ZU5A 4CP2A 1OQDA 4JGYA 4MZUA 4ASMB 3O7OA 2NLRA 3ALQA 5L73A 1HXS1 1VJ2A 4L8QA 1CD3G 1ZBA3 2ZX2A 1MQTB 1H4GA 1X33A 2CNAA 1KDKA 1FI2A 3K51A 5JLVA 2AZ5A 1D0GA 1EAH2 3ZVXA 2HEWF 1UIJA 2GU9A 4RQPB 3VBHA 3G6JB 4DRRA 4J1XA 5T3NA 1WMDA 1KRIA 1DIWA 3S0MA 5FAXA 1POV3 5DDJ3 1O5UA 4PCRA 2JG8B 1AL0G 4DY5A 4FPFA 4YZ2A 2BPA2 2YUEA 4Y22B 5FLHA 3JQXA 1OMIA 5T55A 1V6OA 4UW6A 3WNXA 4P5HA 1QH7A 1VAMA 3D6EA 3JZVA 1YCIA 1WLWA 2B39A 2VQAA 2ZABA 1FOD2 4K1YA 2D44A 1B35A 4FAHA 1XXNA 3URFA 4YW4A 5IK5A 1GZCA 2WS91 3E6DA 3NKTA 3SH5A 2WA3A 4YSFA 3FUQA 3SH4A 4RS5C 1W6QA 2RS13 3WW4A 5FQ0A 5ABJB 3VKOA 4M3CA 1ENXA 2QVSB 4PDWA 1AL22 1EYBA 2WZR3 1JN2P 4JVAA 4QPGC 3S6PA 4LBKA 1S55A 4XFGA 1VAVA 5C6CA 1SLBA 5I0SA 1IS5A 1POV0 1C57A 1B09A 1V70A 2DTWA 3ZFEB 2VMIA 4X8PA 1DZRA 1AR61 2DUOA 1C8NA 4DRVA 2WJSA 5SV8A 4MVTA 3OD4A 4C90A 1GZWA 3AMNA 2FBEA 2B42B 3IIAA 1IKPA 4XQ4A 1H2MA 4EJRA 2RS52 1GV9A 3IPVB 3HAGA 3CLPA 1REDA 1JOJA 4DMIA 1PO11 1A8MA 1EV13 2XBO3 2DFCA 1PGL1 3OY8B 4NPRA 4HVOA 4YGEA 3K48A 4FAGA 1UU4A 2HWD1 2XHKA 4XXAA 3ZFGB 3TRSB 3ZPYA 1AR63 3HT1A 5KHKA 4H55A 2IXHA 1LB2A 1OOPA 3PHMA 3FBYA 4I3PA 1F5FA 2D6MA 5GZDA 4XFIA 4NHKA 1LESA 4PQ9A 4XQDA 4BZ4A 4COWA 5I0UA 2JDZA 4KG0A 1X82A 3ZIWA 5JOWA 4WBBA 3WDYA 2VOXA 1YO8A 3KMHA 1I6XA 1QOOA 3ZYJB 4QPYA 2Z79A 3ZXLA 2OZJA 2GC2A 3VUOA 2R1BA 1ZRDA 4MGKE 2XWJB 3H1YA 2C1FA 1PGL2 2W0XA 4Y26A 1RITA 3JB8A 2X53S 1U5ZA 1C28A 4HPKB 3H1MA 2BNOA 5LEJA 5A33B 1J1TA 1DGWA 3NO8A 1H1AA 3MW3A 1H9PA 1F2NA 3ECQA 4V1PA 1D2SA 2GC1A 5CFCB 1AYN1 2W39A 3I59B 4CZSA 1PGW2 3ZSMA 4BYYA 4PDWB 1PVC3 4J6GA 4LBQA 3M1HA 1C4RA 5HCFA 4IXLA 2ES3A 2LALA 3TN93 1NLRA 1RUE1 3OYWA 4YZ3A 4AFCA 3J4UH 5ACA3 2BVBA 4FOVA 1CAUA 3VKMA 2HEYF 2WSUA 2BWAA 5CNAA 3P3NA 5CA6A 4GKYA 3ZMOA 3KT7A 4BMBA 2ZS6B 4Y1XA 2PN5A 1OQEA 1VBB1 5FMOS 3ZXGA 3BTAA 2LM3A 2YYOA 4SLIA 4W6YA 1C5IA 4R8HA 2A5ZA 1LU1A 1VBC1 2GNBA 1DG6A 4K7JA 4P14A 1EPZA 3VBUA 1FMD2 3SISA 3IT8A 4DXZA 2Q8OA 5I93A 1RUG2 5CADA 3TN91 3MW4A 4QX5A 2R061 3O0WA 3AYDA 1KJLA 4Q0PA 4AG4A 4RFT0 1LGCA 4HT1T 4R9CA 1A3KA 1V9U1 2BFUL 4EWAA 1VAKA 5GZEA 1ND3C 2D43A 3KT4A 1V6JA 1IKQA 4HANA 3JBG3 1RINA 2ZHKA 1Y9QA 5JIAA 4D94A 3ZSLA 3AYCA 4AEDB 2DCJA 3NV3A 2PLV3 1AXZA 4UW4A 4LBQD 2OA2A 2R071 1D4M2 2PTMA 1PO13 3ETQA 1RVF3 5GLZA 3OYWB 4XFAA 5FBZA 1LHVA 1LENA 1OLRA 1QF3A 2H0BA 1AL21 5FLIA 1RUE2 5AVAA 4DFSA 3KZ4C 4MGIE 5LK5A 3MF9A 1NCRA 1RUF2 1V6MA 2VMGA 5FLJA 1H30A 2K2SA 3FWEA 4KU7A 3AXDA 4OHVA 5DUUA 4CDWB 5AFEA 3AKQA 5BNPA 5L7OB 1UKRA 4Y4YA 3TYJA 4AEDA 3ILFA 1ZNPA 3VBOC 3OGGA 3VBRB 1ULCA 2R043 4OI2A 3D0SA 2XG3A 3MEPA 4XQWA 4OVEA 4CEYB 4L2NA 5BNQA 2B45X 1QOSA 4FTSA 4BLJA 1X50A 4D7TA 3DPRA 2MEV2 1RIRA 2HWD2 2E7TA 2OPKA 2WFF1 4XW3A 1UPIA 1PIV1 4Y1UA 4B8EA 4EN8B 2NPIA 3AXEA 2PHDA 1B35C 1CPNA 5BPXA 4WM8C 1C8M3 4LUMA 3N3HA 3MF6A 5J7MA 2Z2SB 4XILA 4ASLA 4OHWA 1D4VB 1GBGA 1MEC2 2WL1A 3AZXA 2YMZA 4CDUA 3ZN5A 4Q4X2 5GLVA 1C5HA 2CGNA 4HSLA 1CAVB 1JHNA 5FREA 1UZZA 2EAAA 1CVNA 1DGLA 3ZYGA 4CDWA 2E7AA 1RUH2 2D93A 4LO5B 2Y0OA 2R49A 3VL8A 1PIV3 4A7KA 3PTYA 1A78A 1R1ZA 1Q8QA 1C3HA 5ACA1 3UJQA 1GZ9A 2Q1ZB 1S0CA 3FLPA 4FPKA 3LWCA 4XZPA 1RUJ3 4FP2A 4A3XA 1YFUA 1NA1C 4PBOA 4AI8A 4IESA 5E89A 4Z2WA 2YXSA 2D3SA 2DVGA 4I0BA 5DDJ1 4YG0A 4AGGA 1Q5OA 1H8TB 3AP5A 4S2DA 2PFWA 1WA4A 1PM7A 1TE1B 4O9EA 2KXLA 3OGJA 4BPZA 2IFWA 3JD72 5T5LA 4H3WA 1EY2A 2NP0A 4CDQA 3UV9A 1BYHA 1SACA 1JUIA 3M3IA 2IZWA 1FMD1 1PZ7A 1RC6A 2FHRA 4CDUB 4A7YA 3KT1A 4FBFA 4EROA 1OSGA 3IBMA 1YLLA 5EJ3A 4HBNA 3CL1A 1H8TA 5JPNB 2WS92 1OHFA 4Y24A 2F6BA 2VW1A 3NJZA 3V0BA 4P9GA 1OD5A 3ZXDA 5BV6A 3B9CA 4JQRA 1DZQA 3LSEA 4IERA 1ZX5A 5C4WB 3ZFEC 1QHDA 4I30A 3D4KA 1RHI2 4UBHA 2LUWA 2ZGOA 1AUYA 1R083 2D7FA 3TOJA 2HWC2 5EXOA 3CJIC 3EHKA 4FPEA 1I1EA 1QKQA 2ZX4A 1H8VA 2X29A 3ZYPA 3VKLA 2BUKA 4NVPA 1KFUL 1VBB3 4K6BA 2HEVF 3EXUA 3A0NA 3KSCA 4RS5B 5KHJA 2ETEA 4HN0A 3NAPB 2CL2A 3QH6A 5HBAA 4KU8A 2VOKA 4AGVA 5FDBA 4QQLA 2DWRA 1N47A 2R6QA 3AB0A 1MZFA 4G4FA 2PHRA 4GMP1 3RYPA 4L92A 1WLDA 2HWF1 4ATEA 4GQ7A 3AFGA 2JKBA 2ZX0A 3AFKA 3ZYRA 2DUPA 1QDCA 2XJRA 4WVWA 1A6CA 4EN9B 3H1WA 1LR5A 4F83A 2ZGSA 1YUDA 1FAYA 2JG8C 3M3QA 2VUAA 3B00A 4IL7A 2RMU3 3MIDA 5TSWA 3THPA 4AFAA 1WMFA 5BNPC 1FPN1 1BEV3 2D5HA 4Q4W2 3PJQA 3PVOA 1SCRA 3O14A 5FO9B 3LOIA 1NYWA 4YYOA 4Q4Y3 2WWSA 2GC3A 4E2QA 1GQHA 1BBT1 3AKPA 2WZR2 1CQ9A 4RHV2 2JJ6A 4WVVA 5JI9A 4GMP0 4PLNA 3GBWA 2Y26A 3TBDA 5IK4A 3AX4A 1RMU2 4I0AA 4XBQA 4DB5A 3U07A 2XVKA 1WBFA 1QJX3 4FTBA 1FPN3 4MXWB 2WNVB 5D8AB 1VBE2 4IEQA 3E5QA 4Y1YA 2PHFA 4AHZA 3UKVA 2R042 4QQOA 2VPVA 5KBFA 1YI9A 4Q1PA 1G9DA 4MGYE 1NY71 1J59A 3JUUA 4N53A 2BFUS 4MX3A 4EN6B 2XBO2 1IPJA 4L99A 3IPVA 4LBOA 3MZHA 2HWE1 4FOWA 3MLJA 2D6OX 2OVUA 4UBGA 4P9YA 1RJ7A 3CJIA 3G7DA 3GHMA 4RS5A 2DF7A 5DDJ2 2D40A 1Q8OA 2I2SA 2WNVA 5D8AA 1UIKA 2W52A 2RE9A 3PLQA 2VY0A 1ASJ2 3J26N 3N7MA 2R30A 3KLSA 1CJDA 1MEC3 1ZA4A 4YGDA 2XVLA 4LA2A 3LA2A 3VDDB 3USUA 3WDXA 1CAWB 2QKDA 1LOAA 4CDUC 1OI6A 1HV1A 2RJKA 4FOQA 4YRDA 1WGPA 4R4ZA 5FRAA 2PYTA 3WV6A 3V0AB 2B7YA 3VHPA 4QQPA 4AQ2A 2XJSA 5BNNB 3J8F1 1NA1A 1ULDA 4HK9A 4R9DA 5JWPA 3R4DB 1G9FA 1ZBE1 4IEXA 5CG8A 3LAGA 4XJUA 5KWRA 4FVVA 1N1VA 2C5DA 2FMDA 3OY8A 3W58A 3O0XA 2OIIA 4WVMB 2WINB 5H9QA 1KFXL 3AK0A 4WV8A 4R9AA 1NY72 1VB4A 4YG3A 2ZMNA 1ENSA 2JENA 4WM7C 1TME1 4JCKA 4FXKB 1WMEA 2EA7A 3OF1A 5BNNA 1WD3A 1VBE1 3R05A 4BMEA 2Q0AA 3BCWA 3OPZA 1AR91 2G9GA 2HWF3 1GANA 4YM1A 1JW6A 1OKQA 2HWC1 3FZ3A 1ZZ9A 2ZKLA 3CF6E 2XJUA 1MQTA 1BK1A 3A0KA 2MEV1 4OULA 2RS31 4AVAA 4MV2A 2WT1A 1W6OB 5I8YA 1AXKA 1Y3TA 4IV3C 1X36A 5C8WA 5E1RA 3TAYA 1W2UA 2MPFA 2JG9B 3HT2A 1PVXA 1AX0A 4B4PA 4AVCA 2WFF3 2DVDA 1UAIA 5DZEA 1AR62 1PVC1 1NXMA 4WM8B 1HLCA 4MUVA 1O3TA 1AVBA 2CGPA 4B4QA 1AL23 2JD4A 5F6KA 1BKZA 3ZIXA 4WZFA 1HW5A 1W0OA 4Z1VA 1HRV2 1OFSA 2ZGRA 3O12A 4CEYC 3CJXA 4TLFA 1SQ4A 4AHWA 1G9BA 3VBRC 3MW2A 1QJY3 1YJKA 2EXHA 1LOFC 4KGGA 5K0UB 4KBBA 5FO8B 2ZBJA 1VLNA 5L7OC 4M01A 3KS7A 1RUJ2 2ZGPA 4BHPA 1ND3A 3RMXA 3HR9A 2GMEA 1PK6C 2P3KA 4P9WA 2VQ0A 1EV12 1S2BA 2A3WA 4YVSC 4I0WB 1S0BA 2XLGA 1DDLA 2DTYA 4DNYA 4E4SA 3AZYA 4AK3A 2IXJA 4AHXA 1OPMA 1RHI1 1JYIA 1UMZA 3N4MA 5CVRA 4OHXA 3RJRA 3JD73 3QD6A 4B4RA 3NKGA 4JGYB 2D6NA 2GH8A 4XYXA 3BB6A 4FPJA 1O3QA 3HN1A 3AKTA 5A32B 3NVCA 5DZFA 4OI4A 1ZZBA 5DUXA 1W0PA 4OUMA 1RUD2 1Z7S2 3UKNA 4GWMA 1BEV2 2UY8A 1ND3B 3KGLA 2B8MA 4XTMA 3WR0A 1VR3A 5L19A 4URTA 1TMF3 1G9CA 1MS4A 3OTFA 2P17A 1J1LA 2DCKA 1LULA 2X8KA 4K9SA 3WOGA 1QNWA 3ZFGA 4CDQC 1C8M2 3L2YA 1NQJA 3M4FA 4HKOA 1NXD1 3AP7A 4Y22A 4RQPA 2MNGA 3VBHB 3M8LA 4G3YC 3N7KA 3GALA 4N9HA 5F6LB 3W59A 1LU2A 1RUJ1 2PHWA 3RJ2X 3WHTA 1W6QB 1NQDA 4YW2A 2QFEA 3QLQA 3AKSA 5EYXA 1CJPA 3E6CC 2RR12 2RJLA 4C91A 2VNOA 1RUF3 3VBRA 3VHOA 1Q8VA 2VOWA 3ZYIB 4JTNA 4N43B 4ISQA 2CWSA 2P37A 2JX9A 5F1RA 1RUH3 5DUWA 1QXPA 4NWVA 1LEDA 4LR4A 5AVPA 5J36A 3TN92 2CAUA 1KDMA 1V6KA 4IEYA 1MZ6A 2D5FA 2WLQA 5ACA2 4S2GA 3APBA 1XYPA 2AR6A 4KWLA 1LECA 2R32A 3JQWA 4LO4B 3M3CA 1F5JA 5CB7A 2BVVA 5CFCC 2ZOEB 1YJLA 2AGSA 4Q4V1 4XPVA 4GB31 5BXXA 2Q5TA 1K5MB 1R093 4AI1A 3M2MA 1YIFA 3ZXAC 3DV8A 2WNUB 4QGLA 1CGPA 3WXPA 3CEWA 2GNDA 4IEOA 3J8F3 4AI0A 4Q8KA 3POYA 1V9U2 1RMU1 4JV4A 2KA3A 4HLTA 2ZCWA 1T6GC 4AQSA 1QGLA 4DQAA 2WT0A 1TEIA 1VBA2 1U5YA 4MXVA 3ZFEA 4AW7A 4HPKA 1SLAA 4HETA 2WZR1 1ZRFA 5T5OA 1L3JA 4XJAA 1PO21 2FZ1A 1NG0A 1Q43A 3FE5A 3KCYA 3MGUA 4H14A 2GNTA 4OI0A 4RD7A 1LJ7A 2D97A 1IZ3A 1W6MA 4Q4W1 1NCQA 4DPNA 1RUC1 4I09A 1DLLA 1LTEA 4ONUA 3ZFGC 2A7AA 3AMHA 3AYEA 1Q8PA 3BPZA 3SXWA 4AWDA 1RMU3 1XNDA 3B94A 2VMHA 5C8CA 2ZKNA 4IV1B 3THTA 2RS33 5JAXA 5BY5A 4FOYA 3CNAA 1MS0A 5FPXA 2AENA 5JOYA 3MICA 2ZAHA 3LA7A 3MLKA 2OUJA 1QJX1 1SDWA 3M3OA 3P3PA 2HJIA 4BM8A 5H9PA 3S7EA 4YNIA 3B9IA 4FSJA 4QM8A 2IC1A 2ILMA 2IXCA 4LBJA 3I59A 3FLTA 2HKXA 2Q4SA 4NOTA 4QU2A 1SEFA 1QJZA 1COV2 1RUC3 3B7MA 3KB5A 2FZ2A 2RS53 4YZ1A 3WY6A 2A6XA 5C9AB 4W6XA 3D0JA 3ME2A 4XF0A 1ZRCA 2RM21 4QPGB 1CAVA 4CRQA 3BODA 3SCFA 3KCXA 1SFYA 3B5LB 1MZ5A 2E6VA 3LB9A 2R062 2QZ3A 1VIWB 3WHUA 3EO6A 3FJSA 1UN1A 4FPLA 2G9FA 3GZTB 1J3PA 1SLCA 4N53C 4YM2A 3RPQA 1V6NA 2RMU2 2C9AA 2X5IC 4CEWA 5KXCA 3U11A 4QD2A 5AFBA 5T5PA 1FATA 4NR1A 5IK8A 2ZJCA 2PAMA 4LBNA 3HD8B 1UKGA 2ZTNA 2YDEA 1S0FA 4KL1A 2E63A 4XE9A 4BCUA 2R0FA 4NWWA 4PIXA 2JECA 4D7YA 1Q56A 1UU6A 1N3OA 1DQ5A 3MFAA 4Z92B 3VBHC 5KHGA 2R16A 5BUVA 4IQPA 1ZZ6A 5K7PA 1KITA 1DQ6A 4WZCA 2CGOA 4CDQB 1NZCA 3ZXJA 1X8MA 1FX5A 1PO12 1RVF2 3WX5A 2BQPA 1F31A 2B5HA 1W6MB 1J58A 3I7DA 5EYYA 4IEZA 1MVEA 4RQPC 3VBUB