4HFSA

Crystal structure of an uncharacterized protein (yncm) from bacillus subtilis subsp. subtilis str. 168 at 1.55 a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
203
structure length
203
Chain Sequence
ASELPNGIGGRVYLNSTGAVFTAKIVLPETVKNNDSVSTPYIYSGFRATSGTEADIGLQYSKQYNVWKPLMKVGSKNEETYIEGKDKFTYNKGFRPGSTVQMTIYKNLSGNTRMTLWGTNNDGYTGRIITEIQGTNIGTISKWKTLATAAVSYESQRDAIKATFSTSFNNITIDNKAVTPVVDTQDFAKVSVAGNNVTISVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein YncM
publication title Crystal structure of an uncharacterized protein (yncM) from Bacillus subtilis subsp. subtilis str. 168 at 1.55 A resolution
rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Structural genomics, unknown function
total genus 53
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15493 YrpD Domain of unknown function, YrpD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1270 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hfsA00
4HFSA
chains in the Genus database with same CATH superfamily
1VBE3 4LMFA 5D8AA 1R1A1 1UAIA 1R083 1OOPC 2IVJA 3KWVA 1D0HA 2QBXA 3WNKA 2LS6A 5FP3A 2Q4SA 4GJZA 2JJ6A 4FXKB 1EPWA 4GD4A 4HANA 3UL2A 5L73A 4OQ9A 5CKNA 1LECA 2X53S 2O0OA 2A3WA 5FUIA 4COZA 5LZ6A 1FMD2 1RVF1 2EF6A 2R16A 2V5DA 2JDHA 4OUMA 3VBHB 3VDDC 3VHOA 4BWOA 2WNOA 1RJ7A 1WMEA 2IWGB 1WMFA 5IATA 4NOTA 3AL6A 1Q3EA 3B02A 5FMOS 4UI9L 1OH3A 1GOHA 4I09A 4Y22A 4TWTA 2UWCA 2PYTA 2YMZA 2OZJA 3IDBB 3KVAA 4CCCA 1Z7S2 4YZ5A 1JZ7A 1UY0A 2VMGA 1XXNA 1JN2P 1BJQA 2R061 4QM9A 1YC61 2DVGA 4JAAA 4K1ZA 4M00A 2BU9A 2WDBA 1PIV3 3WEZA 3LOBA 2XB6C 2X5IB 2J1AA 4HOOA 2OYZA 1HRI3 4QDSA 1VJ2A 3C2UA 1D2QA 4CCKA 4HFSA 2X29A 4YRDA 1NUKA 3N3HA 3I7DA 4YW3A 4GB33 3U4XA 3KB5A 3PJYA 3LDRA 4FTEA 2D43A 3KCYA 4QPGB 3RNSA 4YG0A 4WVMA 1LU2A 4ZONA 3U07A 4F83A 1ZBA1 2JXAA 3LEKA 4XQWA 1C4RA 3WUCA 3VGIA 2C0ZA 3AJZA 3V0AB 3IPVB 3WDVA 3ALQA 2DBIA 3H8OA 5AC91 3CNAA 3ZFGC 2BGPA 4XZPA 4V2WA 2ZGRA 5A3LA 3TYJA 1QH6A 1WBFA 2J1EA 3T2OA 4HSJA 1MQTA 3WW4A 4Q0QA 2ZGMA 4LE4A 4BE3A 4JVAA 2B46X 4PBOA 1XE8A 1ND2C 4FQZA 2WL1A 4MGZE 1TQ5A 1FOD1 1OD5A 1QJEA 1RUH3 2BEOA 1OHFA 3VBOB 3ZXFA 1RGSA 1NXD1 2DWRA 2RMU1 5D21A 4Q0VA 1XNCA 2RDNA 1NLRA 5C8CB 2DCZA 2ET7A 5CYYA 1T2XA 4IE6A 1AR73 2D6MA 1PGSA 2E9QA 5DDJ3 5LA1A 1IS5A 5IHRA 1W39A 2GZWA 3QLQA 1CR7A 2XL9A 3FE5A 1W6OA 2BRTA 4CPBD 2XONA 1SMVA 2ZHKA 4S2FA 3TEWA 3RZJA 3NJXA 4WBBA 4LOSA 3POJA 4CDUB 4Q29A 1W05A 1K5MC 5BNOA 3BIEA 5FYTA 3VUOA 3LPGA 1RUOA 1WLDA 4XMIA 5FZGA 2RS11 1M4WA 1TZOA 3OGSA 1YI7A 2PLV1 4MGTA 4YZ4A 3SISA 4FQ4A 1ZBE2 3HPNA 3I3MA 4YVWC 2WFF2 5CEHA 2PTMA 3O7OA 4BQ1A 5KC5A 2W92A 3LD8A 1SCSA 1W6MA 2VOKA 3KM5A 3UKTA 1W90A 2ZKLA 3SEPA 1UO9A 2JEMA 1MS1A 1OF3A 4CCMA 3J7MA 2CL2A 1E5IA 2W91A 3WVJA 3C7OA 4XETA 2Q1FA 2VY0A 4YGCA 2CAUA 4ARXA 4LHLA 1VBB2 4XF4A 2ZABA 1XU2A 3MF6A 2D3RA 2ZX2A 1TE1B 3BOPA 1OLME 4MZUA 4D3WA 3T0BA 1SEFA 5IT6A 4WVVA 1B35C 4MUVA 5FZEA 4QGLA 2GMEA 4B29A 1XE7A 4CEWC 5FLIA 3A7QA 1L7RA 4RHV2 4XBLA 4ATEA 1NQJA 1ULDA 1VBC1 5J3UA 1RTVA 2NM1A 2WO1A 2YC2A 2YBKA 2WSUA 3KSCA 3USSA 1W6PA 1WW6A 4HN1A 4M3CB 4CA9A 1W0PA 3ZFEB 1LHWA 4RQPA 4YNIA 2GN3A 2GU9A 2YG0A 3OGRA 1CAXA 1NLQA 3VBRA 3FX3A 1F9KA 4NR1A 4KWJA 3VKFC 3LSDA 1TMF2 5DXDA 4HVRA 1O91A 4AHXA 3OGJA 3A0KA 2I2SA 4CPBA 1LULA 4IEWA 1A78A 4MLOA 1ASJ3 1BQPA 1RUG3 1YI9A 4GXLA 4PDWC 3ZSEA 1AR91 2WKKA 4NPRA 4Q27A 1LHNA 1COV1 3CO2A 2D6OX 2ZAHA 2X05A 2GNBA 1E5HA 1QJU2 1WA4A 5A70A 1MEC2 1LNSA 1HN0A 2W5FA 3FBMA 1RUJ3 2UWAA 4GKXA 1FATA 2HH9A 3AYDA 4OUEA 4XFCA 5FZ6A 5FZLA 1HXS2 2ARCA 5A7WA 3WQ7A 1PMJX 4CXWA 5KHHA 4DXZA 1ODNA 3QOPA 5DAXA 2Y34A 3ZXEA 4GAZA 4QGNA 4AI9A 1ZVFA 1X7NA 1ZNPA 3NNMA 3OF1A 4ORFA 4E8DA 5IVCA 4CUGA 1S0FA 3NNLA 4OYUA 3SKVA 1C8M3 3O1SA 1AYN2 4M3CE 3UJOA 3B00A 2BPA2 2CAVA 2WJSA 2ZCWA 4FOYA 4ISQA 3RFRA 4URAA 4LITA 3RG0A 2YC0A 4HKWA 2DUPA 2D6LX 3KVBA 3B7MA 4XDPA 4LE3A 5JSPA 1BMV1 3HT1A 3HBZA 1L7LA 1X8EA 2YV8A 4QGMA 4TLFA 1QNWA 5JVVA 1W6OB 4FCAA 1BEV1 2HWC2 3RI9A 2JB8A 1MVQA 3ES4A 4N43C 1POV0 2ADEA 4MHRA 4E8CA 1V9U1 4LBJA 4RA0A 4Y1ZA 4FI9A 1XSQA 1YFWA 1H9WA 1RUC1 4XABA 5FPXA 3AKQA 3CF6E 4AGGA 1UYPA 1O3RA 3JD71 4OMCA 2R072 2WN3A 5D1IA 4AQTA 4QD2A 5FAXA 2WFPA 5B4XA 1LOFC 2OUHA 1C8NA 4LBKA 1J3QA 1RUE3 1OMIA 2GNMA 1LRHA 3BIWE 4QXCA 4M01A 1W6MB 4I3PA 5EJZB 3O1MA 4XAEA 5LY2A 4ISRA 3WP3A 4WZCA 4P08A 2WRAA 5T5PA 4R8HA 4ONUA 2DCYA 4TLGA 4BHPA 1IG3A 5FUNA 5FZIA 2AC1A 2XWJB 3HT2A 3NAPA 4B8EA 1X50A 1RUI1 4H7LA 3E5UA 5EWSA 3NKGA 4FPGA 4NMIA 2W1QA 3D0SA 3QACA 4HSLA 2GMPA 2VQTA 1NG0A 2FCUA 3AZYA 1IPKA 4HKOA 2FMYA 1JMUB 3MW2A 5L7OC 4CCOA 4BYYA 1YXWA 4G4FA 3RJRA 1WLCA 1AYM2 3PIGA 2I74A 2YZ4A 2WZR3 3SCFA 1W8FA 4B1LA 3VZLA 3GHMA 5FLJA 4AQSA 1CD3G 3WV6A 2Z69A 4D0QA 1W6PB 4DQAA 3IWZA 3O0WA 2UYBA 5GZEA 1NCQA 4QPWA 5DPNA 4JCKA 4M0HA 2VH9A 2VQAA 1AR62 4YZ2A 1BKZA 2GC1A 1ZZ9A 2VC9A 5GLZA 2HWD3 2VVFA 1GNYA 2DFBA 4CVUA 3M3IA 4MV2A 1H2KA 5FO9B 4NHXA 5J96B 4Y1UA 2XKPA 1OA3A 3O1OA 4NRMA 3U4SA 4ES8A 2B8MA 1RMU3 2I45A 5FZMA 3GZEA 3WNPA 2UY9A 2ZX4A 4XFBA 4FPJA 4MGIE 3AB0A 2WINB 1SHWB 4ITCA 3BKZA 3H1WA 4RGGA 2FMDA 1BZWA 3S5QA 2P5BA 1TME1 3M3CA 2VJXA 4AI8A 2QKDA 2QQVA 1PO22 1Q56A 3GF6A 2ZMKA 3R4UA 3WDTA 3AX4A 5JCTA 3EO6A 5I0RA 5FRAA 3S0MA 1RUD1 1I5ZA 2OZ6A 3OEBA 4LO7A 4WM7C 3POYA 1V6NA 4YVSC 1V0AA 5BNQA 4Y20A 1QWRA 1J1LA 5FJKA 3D8CA 3Q8CA 1UXZA 5ABJB 4Q4W2 4JQTA 1HDKA 1RXGA 1JOJA 1C57A 1T6GC 3CHXA 4XVHA 3ETPA 3EXUA 1UZYA 3J4UH 2YXSA 3PU3A 4W6WA 1UZWA 1J83A 3AL5A 4Q4X3 2C24A 2PXJA 2XJQA 1VBE2 1EAH1 1PNFA 2VBDA 1BCXA 1DYPA 1R082 3PDQA 3GHNA 1ZYBA 2E53A 4OZOA 4UFLA 5DDJ1 3ACFA 4Q4V1 3ZFFC 4LTAA 4IQPA 4OFGA 3RYKA 5CBLA 1NXMA 5I0TA 3MW3A 3HNYM 5HCFA 4AW7A 5T5JA 1S1AA 4YM1A 1UMIA 3J26N 3ZN6A 4CU7A 3PHMA 3S7IA 3DYOA 4EYUA 4XTPA 1ND3C 5FMOL 1IS4A 5FPZA 4FSJA 1UY3A 5GJ6A 4F8AA 2GC3A 1YQCA 1HJGA 1W8HA 1HJFA 2RS31 3HR9A 1F5FA 3AP5A 1CONA 4M4RA 3ZSJA 4CZSA 1HRV1 4XJ9A 5IAXA 2QJVA 2XG3A 4QDQA 2VBPA 2DDUA 4ZU5A 3ZYGA 4XXPA 4GWNA 1W2TA 3LGRA 3BPZA 4FPOB 3VDBA 1PGW1 4QX2A 4AFCA 1C1LA 1PIV2 1UYZA 1S0BA 3J9SA 3NNFA 4LBLA 1GZWA 4NO4A 4YZ1A 4MYEA 4B4RA 2VUDA 1HRI2 3PMSA 5EPAA 3FL7A 5A3MA 4EN8B 4MXVA 4NIAA 1DG6A 2GMMA 1EYBA 5C70A 1Y7BA 1UY1A 5LK7B 4GB32 5L36A 2VTXJ 3OOXA 1UOGA 3B94A 3WW2A 2EVXA 2XVGA 1UMZA 1SQ4A 1LGCA 2A6ZA 4P9IA 1GLHA 4COYA 5C3SA 5KHGA 2CHHA 5E6HA 3MZHA 5LRRA 2E63A 3ILFA 1VAKA 4XUTA 1N47A 1SFNA 4YG6A 2EIGA 4ZU7A 1SCRA 3I2JA 5JLVA 3ZXKA 5BV6A 5IK5A 1JOPA 4UW4A 4CU8A 3OCPA 2Y6GA 4WVWA 2OQ7A 4K3UA 3NQHA 5LBFA 4BXSV 5SV5A 4ARYA 5HI0A 5K0UB 4DO0A 3INAA 2HEVF 4LR4A 2R0FA 4MGQA 5FZFA 2JICA 3SLIA 1F8VA 4XXAA 1N3OA 4BCUA 1KFXL 1OKQA 2R6QA 3UKNA 2RDSA 4IGOA 3GGLA 2P3KA 3I3EA 4EN6B 3DCQA 3ES1A 1Q8OA 1R1A3 2RG4A 1RC6A 4JGYA 5K8SA 1RUH2 3GBWA 4CDXA 2RR12 4FFHA 3K4DA 2BDRA 2CGOA 5CFDA 2R041 3M8LA 4N53A 4NPLA 5T50A 4JZRA 1UIKA 2P6CA 1ZA4A 3ZFGA 1CIWA 1RVF3 2YU1A 1DFQA 3WDWA 1NA1A 3GNEA 1AR72 1XPWA 4PF5A 4EQVA 4N7UA 1FV2A 2BBVA 1RUJ1 1XYOA 3UGHA 2CDPA 3HMYA 2RHPA 5FYYA 1WBLA 1UX6A 4N90A 1OBNA 1CAWB 2PN5A 5L9VA 1KD7A 1Y4WA 4XE9A 1KGYA 3H3LA 4QXBA 2WR9A 3JB8A 1BLZA 5IYYA 2R063 2RVAA 4GH4C 1O7FA 3S6PA 5CADA 2GN7A 5FY0A 3ZX7A 1OFNA 1C5IA 4FP3A 3NV3A 1JZ6A 1IPSA 4SLIA 3TN91 4H2AA 3MLKA 1IS6A 4JKLA 4W6YA 2VECA 4AVTA 3N9MA 1JYTA 3AFKA 4V2VA 1XNDA 3N36A 4GWJA 1K5MA 5A3OA 1DGWX 3ZN6B 4OHXA 3EYPA 5FYHA 3PU8A 1QJX2 3GBGA 3MPPG 1G9DA 3ASIA 4LT5A 2BUKA 2HWB1 4C8DA 5BY5A 4LA3A 2Y6JA 1ZBA3 1Q43A 1GR3A 4U36A 4PCRA 1OOPB 4LBQA 3OPZA 3IDAA 5AC93 3BVCA 1OXCA 1ULEA 5LCWL 4AQ2A 2VZQA 5A3NA 3E97A 4BQYA 1SZBA 2Y6HA 2IUWA 1SACA 3VDDB 3LZZA 4NWWA 3KZ4C 4KBZA 4C0HA 1X33A 1JS9A 2P3JA 5F1RA 4QWNA 2LRPA 5FPAA 4ES9A 1GZWB 1LENA 2ORZA 3ENRA 5F2WA 3JB4C 3K4AA 4BQ5A 2RMU3 3NVCA 2VMFA 3VD7A 4TTGA 3BUCA 2VTXA 1B35A 4IV1A 4BIFA 4CDQC 4I0WB 1YYNA 5FR3A 1A3KA 4NE9A 2QDRA 3CQOA 1D4M1 2E51A 5FREA 1RJ8A 5DMYA 3E1F1 1U5YA 1S2KA 1F15A 3RQ0A 2DF7A 4MADA 1ASJ2 1H0BA 1LOBA 1J84A 1RUG2 1UWWA 1V6IA 2AZ5A 1Q8PA 4QXHA 2D93A 2W68A 4P9GA 2D5HA 5AFEA 2MEV1 3G6JB 3B9CA 4YW5A 2C9KA 3H7YA 4A6SA 4BA6A 1MS4A 1QGLA 1SLCA 5LWBA 5IVYA 1E57A 1W8UA 2JDNA 2A6YA 3A0NA 1NLSA 1FNYA 4QPIA 1KJLA 3T1MA 2WNEA 4DRVA 5F39A 4FTSA 2ZACA 4F7ZA 2RS13 1F35A 1W99A 2AGSA 2B7YA 4QKFA 2PLV3 1US3A 3E6DA 4PDWA 3O1RA 3VBUA 1AX0A 3EB7A 4DXTA 2D5FA 4CP1A 1N1YA 1OI6A 4KQ7A 1C8M2 2VZPA 4Q4Y1 5A32A 4L99A 3O0VA 5CFDB 1CZSA 5FQ0A 5JZGC 1XNAA 3ZFGB 2QQPA 2YHJA 2VQUA 5BPXA 1UCXA 1CWPA 3H3UA 2JDAA 4Y1XA 3KGLA 4YGBA 4E4ZA 4QB1A 5JWPA 3H8XA 1X9PA 1O59A 4UW3A 1ND2B 1WZXA 1UX7A 2YFUA 4FPHA 1I1EA 4P9XA 2ARAA 4QX3A 4ZU4A 4TXWA 1QXPA 2W2IA 3RMYA 1LGNA 2VU9A 5LATA 3VBHA 2PQQA 4DEVA 2VOXA 2YGLA 2ZEXA 4QT6A 5ANQA 3VBFC 2A7AA 5JIAA 1JH5A 2B42B 1VBC3 3POSA 4Y5TA 3NWKA 2FHRA 3P6BA 1FT9A 3OGVA 5IK8A 1S0DA 5CU1A 2QQOA 3OJBA 2R7EB 2VW1A 2QVSB 2D44A 5FZ7A 2QDNA 1J59A 4OI4A 2PHDA 3OUJA 3W58A 1UN1A 1K5MB 4HK8A 3RPQA 3S57A 3M4FA 1OH4A 4LHSA 1A8DA 5C9AC 3R4SA 3WR0A 1AR93 3PMEA 2E6VA 4K8FA 2Z4FA 4LBNA 4QQ2A 1COV3 2VMEA 4AVCA 4BMBA 3ILRA 4LBQB 3RI8A 3VKMA 1NKGA 3ZXDA 1D4VB 4YVWB 4COUA 4IDZA 4XYXA 2ZAAA 3KQRA 4H14A 1UZVA 4JGZA 4Z82A 3ZDSA 3GALA 4N9IA 3DL3A 1WW4A 2WWSA 4INDA 2XJVA 1GANA 3HNBM 3LF7A 1IQAA 2WZR2 3NMBA 4CTEA 3IPVA 3M7AA 3V0AA 3LFMA 4YGEA 1MACA 3N7JA 1ULPA 5FFOC 1HQWA 3MF9A 2H6BA 3KT7A 3AKSA 5IFTA 3ON7A 5KC6A 1UOJA 1H2NA 2Y8KA 4IEVA 3ZMOA 3MYXA 1LKNA 1PO11 3WF0A 4QX1A 4QQOA 5FCCA 1B35B 2GALA 3N7MA 1UKRA 4K7JA 4PF1A 4W4ZA 3NL1A 5I0SA 4CEWB 4BPZA 2MHFA 5FZ3A 2ZGKA 2WN2A 2VOTA 4H55A 4Q8KA 2X09A 3PTRB 1RHI1 4X8PA 1SPPA 4Y4RA 4KG0A 4CRQA 4R9DA 1BEV3 5C8CA 2WNUC 5FBZA 2AACA 1RMU2 5JOZA 2XH6A 5I8TA 4DUWA 1V9U3 1XOYA 4A7YA 1XB9A 2NYYA 3Q9OA 1S0EA 1RUC3 2GP5A 4FO9A 4GIQA 3VDAA 2VE1A 2BFUS 3DKQA 2Y0IA 1VBA2 1PMHX 1LHOA 1KS4A 3HQRA 4UAPA 3CMGA 1OF4A 2YGMA 4OHVA 4HBNA 5FZ1A 5GLUA 3PVNA 3GM8A 3DECA 2VZSA 5EJ3A 1GZCA 4NPMA 1XC6A 4PDWB 3WF2A 1MPXA 4IEYA 3NSTA 3RJ2X 2ZEYA 2P37A 1CQ9A 1ZZ8A 3WZ1A 4A7KA 5GZFA 4LUKA 3KD4A 1GFF2 5FQ0B 4W8JA 1FXZA 2CYFA 1H6YA 4E2QA 4AI2A 1FPN2 2PHRA 1AJKA 2RV9A 3UKVA 2J1VA 2Z5WA 3HVDA 2TNFA 5JR2A 3DPRC 1E5SA 2IXHA 1RUI3 1FI2A 2QE3A 4Q0PA 4Q4X2 1VIWB 3VHRA 1YHFA 2HJIA 1H8VA 2P2KA 2WWUA 3LPFA 4WM7A 1H2LA 1W2OA 3IIAA 4QM8A 5LBBA 3V56A 4RS5C 1JODA 1LAJA 4I30A 2RM21 3O14A 3JUUA 4LNVA 3ZN5A 4LHKA 5FZ8A 1ENQA 3RZKA 1DQ5A 3VZJA 4E4DX 5FY5A 1S0GA 1YUDA 3B93A 3JBG1 4SBVA 3ACGA 1UY4A 3FWEA 2FDIA 4NHLA 1GMMA 1WMXA 3AXEA 4KI5M 3F95A 3I2HA 1J1TA 4N43B 5FP9A 2JKXA 2J1UA 1XYPA 2ES3A 2VNGA 2VZVA 3ZFFA 1M06G 1VPHA 2ET1A 2ARXA 1AR81 3VD3A 2FDGA 4BQ4A 4IEXA 4IE4A 4HT1T 4RR3C 1OPOA 4M3CA 5E89A 2KR2A 4L0PA 4LULA 3ZFEA 3VKLA 3AYCA 3LEMA 4RSUA 3LOIA 3PVOA 4KWLA 3VV1A 2WNVC 4OVEA 1QDCA 1VAVA 1G6NA 2A71A 3RVHA 4HONA 3ZSMA 3K75B 5BNPC 4PBPA 5F5QA 1SFYA 1SLTA 1V6MA 4J1WA 5I8YA 1YFYA 5IWFA 1DZTA 3IB3A 1U5IA 2QQLA 2ZEWA 1YQ8A 5FPLA 1LGBA 2QTWB 3IDEA 1QJZA 1EP0A 4JGZB 4R4XA 1E5RA 5FXZA 1I6XA 3U78A 1VBD1 2XLGA 4HLTA 4K20A 4URTA 3MBWA 5GALA 1TME3 2CGPA 5FZBA 1ENXA 3VZOA 1ZRDA 4CSWA 1ZM1A 3AK0A 4QQPA 1RUD3 5FYIA 2RS51 2DCTA 4XFIA 1BK0A 1LEMA 4A3XA 4YW1A 2CGNA 2D97A 5KXDA 3RRDA 4OQ8A 2K2SA 3SMHA 2Y26A 5L7OB 4O9GA 1YRZA 1CAUA 5FXWA 4KU7A 3WW1A 2Q1ZB 5H9PA 1YNAA 1QQP1 2JD4A 1UQXA 1DQ6A 1SPPB 2A3YA 4FVVA 4YLZA 2WLPA 5FY7A 1AX1A 4BOWA 1EAH3 4XUQA 1R1A2 2ATFA 3BGAA 1ZZ7A 4XJUA 3WLUA 1CAVA 4CUBA 3JQWA 4IGQA 4Q4V3 1DHKB 2JIJA 3K51A 4P00B 4LO4B 1JTZX 4UYBA 1BBT1 2ORXA 3ITQA 4XUNA 2Q8CA 4FFFA 4TSVA 1AX2A 1RVF2 2A75A 4MG2A 5IJRA 2EIBA 5JPMB 4ZZ8A 2BWAA 1GP5A 2VULA 3AP7A 3T08A 4A42A 5C71A 4QXKA 2RS33 2Y64A 1U5ZA 4QKDA 3FMGA 3MHZA 1VRH1 4IETA 4QKNA 1HRV3 1LCLA 3JQXA 1CPMA 1UMHA 4CDWC 3OPTA 4QAWA 4NJ4A 2WAOA 5JXGA 5DZGA 3W5MA 3WDYA 1S4CA 4KMQA 2QUOA 3I3DA 4HPKA 2R062 2BYVE 4O65A 5LY1A 3M3QA 1CPNA 2WABA 4XJZA 1BYHA 3H0OA 2QQJA 4N9HA 1GWMA 3MDPA 3LA2A 5FKBA 1W06A 4K6BA 1YO8A 1DU3D 1C3HA 2VUAA 4QQHA 4LK6A 4WM7B 4XIKA 4UFKA 4Y1VA 1CZVA 2HWE1 4S2GA 2UY8A 3NW4A 4YVSB 1TVGA 5APAA 3U10A 1D2SA 1WD4A 3OBRA 4IL7A 4AR2A 4CEYC 2W9XA 2BNNA 4PJYA 1W0NA 2YFZA 3WF4A 1NE6A 2UWBA 5JSRA 2SLIA 3CDZB 4GH4A 1PVC3 3ZPYA 2LTNA 1NCRC 1O4ZA 1MS0A 4L8QA 4LOTA 1OUSA 2ZPXA 3TWIA 2BW8A 2DV9A 3H8RA 5FDBA 5DABA 1ZBA2 1CVNA 3USUA 2H0BA 1LESA 4DUVA 5LASA 1G7YA 2OQ6A 2XOMA 2DU0A 3ZFFB 2R1BA 5AC92 1OFSA 1GQGA 2EAAA 4XF0A 3JCIA 1YFXA 5C8WA 4JHZA 2WT2A 4ZHNA 3LFIA 4IEOA 2Y6KA 3R4DB 3QD6A 1ND3B 3R05A 4Z92B 1GWKA 1N1VA 2BJSA 2BTVC 3CZJA 1FOD2 2ADDA 1JOBA 4EZ4A 4BXFA 1FX5A 1AL21 2RMU2 2R043 5ACA3 4JX0A 2A6XA 4JTOA 3FHIB 1UW8A 2P3YA 4B7KA 3FHAA 1AXZA 1WGPA 2JDPA 4J1XA 1H1MA 4HZFA 5FY9A 3W20A 4QX7A 4YW7A 4RD7A 1UYYA 1UZZA 2V4AA 3FFQA 2ENRA 5C6CA 1N3PA 3PUQA 2ERFA 3LKJA 4IEPA 4JRAA 1QJY3 1DLLA 2F6BA 1FAYA 2OS2A 1H4GA 4KGQA 1ZRCA 5CFCC 4NHKA 4YFWA 2OT7A 1J3PA 1W8WA 1WCDJ 2GP3A 2TEPA 4CDQA 2YU2A 4N7IA 5JSOA 1EV12 1GBGA 2QQWA 4IV3A 1JU4A 3TEXA 3ZR6A 4AEJA 4BH9A 1CAUB 5JPNB 2C5DA 2KM2A 2ZX0A 2HEYF 3AKTA 4LEJA 3Q8EA 3VKOA 4COWA 2RS12 2W3JA 5ABJA 1UYXA 1PK6C 2PLV2 5A3UA 1H4HA 1ULCA 4LKDA 3IMMA 3TN93 3WDUA 2WT0A 3ZYJB 1R091 4AXOA 4BJ0A 1CAVB 4RYDA 2JD9A 3MIFA 4NVPA 1FV3A 1VB2A 3C7GA 1VMJA 3CEWA 4UW5A 4P9WA 2VCAA 4DZGA 1MZ6A 1KDKA 3U75A 1QY4A 2HWB3 5FYZA 2Q5TA 1W0OA 2CDOA 1PZ9A 1ZA7A 4YFZA 1HW5A 2MNGA 2HEWF 5LB6A 4LBOA 2A6WA 3V0BA 2J1SA 4AVBA 2VW2A 3OBAA 2D40A 4HPKB 2DTWA 4DY5A 2VM9A 1UZ0A 5EIYB 1ZZBA 4BK4A 3ZIXA 1VBC2 4LK7A 3OYWB 3WP6A 2FCVA 4NROA 5F7UA 3LWCA 5FZKA 3WG3A 3AXDA 3RSJA 4GWMA 4DS0A 4S2HA 2W1UA 1ULFA 2UYAA 2ZMLA 1P8JA 5HCHA 2X5IC 4LORA 3O0XA 5FZDA 5FK8A 1OVSA 5GLVA 4ZKTB 3MUZ1 3WQ1A 4Z2WA 3K77A 4K21A 2WQ4A 4KBBA 5A6YA 1D4M3 1D7PM 4GH4B 4H7MA 2P17A 1JYWA 3BALA 3UJQA 5IK4A 1AR92 4Y1YA 3MFCA 1JW6A 3WNLA 1G9BA 1UU6A 1COV2 2Y0OA 2HWF1 2MEV3 3OUHA 4PIXA 2QQMA 3USUB 5C5TA 4NIDA 1OT5A 3KLSA 3GBFA 4NIIA 4JDMA 2E33A 4K9SA 4DIQA 5HV0A 4EV0A 1OQ1A 5HPOA 1N3QA 4FPFA 5J09A 4MO3M 5F2SA 3C7EA 2ZOEB 5LBCA 1H1IA 1LOGA 3HJRA 2WZPP 1Q8VA 1HV1A 1L3JA 1W9WA 4KGGA 2VNRA 1H8TC 1AHSA 5K0UA 2PA7A 2RDQA 2Y6LA 3BODA 4Q4Y3 4W50A 1OA4A 4MGKE 4YGDA 3ZM8A 4GALA 2EXJA 3WP4A 4EN7B 2JB4A 3I2OA 2JE7A 1H30A 1BMV2 5IVJA 1SBEA 3OTFA 3ZXJA 3SHRA 5I0DA 1GWLA 2WS91 4NWVA 3U14A 1BEV2 5IW0A 3TRSB 3O1VA 2VGDA 3WP5A 1RUF1 5A6XA 4AEDA 1X8MA 5KHIA 1SBFA 1YLLA 1V9U2 1NZCA 2JG8C 4R9AA 5HBAA 3I59A 5GZDA 4PIZA 1HIXA 4CDQB 4IV3B 3E6CC 3O1PA 2WYFA 4FPKA 1BVP1 1CAWA 3JD72 3JXSA 3VD9A 1GZ9A 2NP0A 3GCXA 2A73B 3CJIC 1MZ5A 5IVFA 3VBSC 2D3PA 5GLWA 4XACA 1TNRA 2FDJA 4YW6A 4XJ8A 2WO2A 5D8AC 4MGSA 2B9UA 3WF3A 4UFJA 5J36A 1S2EA 4BLIA 4X6RB 3PJQA 4RFRB 2VW0A 3AZVA 4TN7A 2Q1MA 2XLAA 3ZIWA 5A3PA 2IFRA 1YCIA 3CIHA 3JU9A 3AMNA 4UBGA 3THTA 1RUI2 1T6BX 2WAAA 3MLLA 5LEJA 1F4HA 2FDHA 4IEQA 4ZPIA 1YQ6A 2JENA 3J8F1 3V0BB 3PIJA 3G7DA 1R64A 4ZS3A 5EZWA 2V5YA 3VL9A 5M0TA 4A45A 5T52A 4GQ7A 4QU2A 3I2IA 1WW5A 5JZGB 2WZEA 1REEA 2VUCA 1W8NA 1WLTA 1OOPA 1Q8QA 5FV3A 4EWEA 5H9QA 4KWKA 1RITA 1ULGA 4DRRA 1JYCA 2OKXA 4YSFA 3AZXA 3TEZA 5F5IA 1EUTA 1Y9MA 1PO13 2E26A 2EXHA 3THDA 3SXWA 5JI9A 3VDDA 5JXHA 3ST7A 4LA2A 3UK9A 4MHUA 1HB4A 5CISA 3EQEA 2WA3A 2A3XA 2JG9C 3LB9A 4FOQA 5F3EA 3ZVXA 3N7KA 1Z7S3 1QXJA 1RHI3 4R9CA 5LK5A 3KQ4B 4XDOA 1DP0A 5L9RA 3RZGA 1RYYA 3IZOA 5A7PA 5KXCA 4LKSA 4P02B 3LAGA 1AL0G 1IPJA 4IEZA 5DQ0A 3AM2A 1PVC1 2H6CA 5GLTA 2VMHA 2CU5A 2WO7A 3UGFA 2XMLA 1DBNA 4L92A 5T3NA 3UETA 4RR3A 1TME2 4OHWA 5F5CA 2EICA 4ZS2A 2PAMA 2I07B 1CJPA 1W8ZA 4GMP3 4JTNA 1XE0A 4Y3OA 2AUYA 5C9AB 1MQTC 1RUD2 2N7GA 4LBQD 5FIXA 5BNPA 1QJX1 5C3PA 1GYKA 4Y4YA 2VUJA 2O8OA 3KHBA 4X8NA 3WF1A 2IC1A 2J1TA 1DZRA 4PHZA 1UD1A 5CKQA 5FZCA 2VR4A 2WZ8A 4UFMA 5ANNA 3C3VA 3FUQA 3HWJA 1DF0A 1TEIA 1QDOA 5ACA1 4XMAA 3DKWA 4L11A 1EAH2 4MVTA 4PI2A 5KHJA 3BTYA 3TAYA 4A3ZA 2W87A 5DDJ2 4AEDB 4Q4V2 1QEXA 4D6SA 2RM23 3MFAA 3I59B 2OVUA 5C33A 3VZMA 3MO4A 1ND2A 2XLFA 3RYRA 1XNTA 4B3NA 1MZEA 1QJY1 3JBG3 5EFUA 3SH3A 4AFMA 5HV4A 3UNPA 5BNOC 3ORJA 1DIWA 1QHDA 2NMNA 2W52A 4XPVA 1J58A 1AUYA 4DNYA 5IK7A 4J6GA 2WNUB 3TEYA 4QHZA 3WUDA 5J1XA 1HRV2 5C3RA 2FZ1A 3VLBB 1AR83 1SLBA 4YARA 1IKPA 1AZDA 2E7AA 3NNGA 3NV1A 1CX4A 4O9EA 3H1MA 4XUPA 5LEKA 4BIOA 1QNYA 5IUQA 1PGW2 3W59A 1HB3A 3ABZA 2ZGUA 4XW3A 2FBEA 3BU0A 1XNKA 3M3OA 3ZYFA 3E5XA 4JRLA 4R52A 3A23A 4TZDA 3K3NA 2JWPA 2FQPA 2K46A 3WDXA 1DLCA 3TOJA 4BK5A 4CDWA 3MW4A 1ZRRA 5LA2A 1LOAA 4EROA 3ACIA 1VBD3 5JMOA 3ZKUA 3D6EA 3POIA 4DB5A 4XJAA 5FY8A 2DBNA 3RZLA 2XBO1 4YVWA 1QOSA 3BU7A 1V6LA 2QQNA 1LEDA 3DPRB 2RS53 4XFGA 2W1WA 3MEPA 2XXZA 4BISA 4G3YC 4CUAA 5B2GB 2QNKA 2ZGQA 4RS5B 4KU8A 5HXVA 4P5HA 4RQPC 4FOVA 4BQ2A 1JZ5A 3QH7A 2SBAA 2XGXA 3VBRC 3HBKA 5T5LA 3SQOA 4GA9A 1QQP3 2G19A 4XFAA 2ZX1A 4P9LA 1PGL1 1HQLA 3RZMA 4UBHA 3TNQA 4O61A 4CEWA 5FZ0A 4UFHA 4XAAA 1GOFA 2AR6A 5CB7A 2ZX3A 4XCBA 5DG1A 3BI3A 4XFHA 2YUEA 1C28A 2R042 1CESA 2JDKA 1BBT3 3ACLA 4YM3A 1RL3A 4CP0A 4XFFA 1G9CA 3ILNA 4RR3B 2AENA 4XF3A 3CBNA 2E7QA 1DZQA 5H9RA 5DAQA 1NY71 4C91A 2WNVB 1RXFA 4TYSA 2NQYA 4FAHA 3B5LB 1RUJ2 2E32A 3H3ZA 5BNPB 3HN1A 4WVZA 1VRH3 4AFDA 2C9AA 1APNA 2TBVA 1XQNA 3H42B 1TNFA 3AC0A 3EHKA 2W08A 3HD8B 3K2OA 5FLHA 3DEMA 1ACCA 1VAMA 4AOCA 1V6OA 4LKFA 1MEC3 3NNJA 5GZCA 1W6NB 1CGPA 3NRUA 4UFIA 1WCUA 2Q8EA 1WWYA 1IQDC 4PQ9A 2ZTNA 1DQ4A 3OEAA 5FZOA 4NIGA 2YBPA 5A80A 3TN92 1U12A 4P9YA 2KXLA 3IN9A 2HWE3 4MSVA 3T30A 1CIYA 2O14A 2W47A 3QH6A 2V4VA 3RDIA 2O8QA 3AYAA 4D7SA 2F4PA 4GKYA 3M2MA 2TUNA 5EV7A 1QMJA 1IHMA 2Z2SB 4XBQA 2JDYA 1QJFA 2DCKA 1DCSA 1KRIA 4E9KA 3VZKA 4DUXA 2ID4A 3B3QE 4AI1A 2HWB2 5C4WC 4PT6A 4LLFA 3BTXA 1JYVA 2RJLA 5I8SA 4Y26A 5FZHA 3FBYA 1WW7A 2BBAA 5I91A 1YWKA 1JZ2A 4BQ3A 5FMCA 2BQPA 1O5LA 3LEIA 2BGCA 3T1LA 3WNMA 3HQXA 3B01A 3PLQA 1RUE2 1R1ZA 3PUHA 4DXSA 1QH7A 1I5PA 1MS5A 2CV6A 2BOIA 2OX0A 4N43A 4CCEA 4LIUA 3MI8A 2D6NA 3N9QA 5FZAA 2DUOA 3FJSA 4Z2AA 1URXA 2BVBA 1VBA1 3FHQA 2LUWA 3M3EA 2ZGOA 3NAPC 2DU1A 1W9SA 2CTVA 2XVKA 2JE8A 1AL23 4CDWB 1QF3A 3ZO0B 2BOJA 4PI0A 2B5HA 4ASKA 3R6SA 3H1YA 1LOFA 3ACHA 5CVRA 1X9TA 1D4M2 1YJLA 2QQKA 1FPN1 4P9JA 5FY4A 4BB3A 4XUOA 3PNAA 4F3JA 4E2GA 2MEV2 4LQRA 4K1YA 3V65A 5JXJA 4I01A 5L19A 3B9IA 5DUVA 1U0AA 3D0JA 4CU9A 1FMD1 2XL7A 4CEYB 1NCQC 3KCXA 3LA7A 4E4SA 4JV4A 1O4TA 4AEKA 2VTFA 3MICA 4NAOA 5FP4A 5A33A 4BLJA 1NCRB 1ZZ6A 4RGKA 5L7OA 1GP4A 5FOJB 1LB2A 3K4ZA 1R093 2J1RA 2V72A 4BQWA 2HWD2 2VNOA 1Z7S1 3JZVA 3LA3A 2EALA 4CU6A 3HOBA 2HKXA 4RFT0 3WQBA 5J37A 1VB4A 2XJSA 1RB8G 4MH0E 2NZ9A 3AMQA 1W9YA 4Z1VA 1NT0A 4HN0A 2GDFA 3ZMNA 5FXXA 3VZNA 2LROA 2VCMA 5K4LA 2R32A 1HLCA 2CWSA 2NLRA 2RDRA 4YG3A 5DUXA 5FO7B 5JIUA 3GZUC 1G9FA 2BNOA 1KFUL 4Q1PA 1LOEA 2VVEA 2ZHNA 2NMOA 3BPSA 4XHXA 4QPYA 1ZRIA 1ZRFA 5A6ZA 1PVXA 4GMP1 3FC0A 5DAPA 4EN9B 4JDNA 1UIJA 4XIOA 3SCHA 1WLWA 2XJRA 3KCCA 3PUSA 3DN7A 3PVBB 4DXRA 3URFA 4CP9B 1IS3A 5FZOB 2WUHA 2A5ZA 3WY6A 3LIGA 4AQ6A 1DQ2A 2WO3A 3C7HA 1QOTA 5CFCB 3IKWA 1OA2A 2CSGA 4NAMA 5FWEA 2JG8A 3DGTA 3I54A 1FNZA 4Y24A 3OY8B 1HB2A 1O8SA 4BDVB 1W6QA 5F3IA 4NRPA 1KJRA 4YVSA 2WC2A 5T5OA 3W9AA 2IXLA 4JKKA 2O1QA 1SDDB 2ZHLA 2IXCA 1QXRA 4CCLA 3CJIA 1BXHA 5FOBB 1K45A 1XU1A 2G1MA 2HWF3 5SV8A 3VBSA 5LA0A 4META 4P5YA 1O6UA 2YPDA 5JUVA 3DF0A 2VZ3A 4PLNA 1LOCA 4IUGA 3D4KA 3WHUA 4GMP0 3ZYPA 2X10A 3K48A 3ZR5A 1PMIA 2PHFA 4RL7A 2WQ8A 1SFPA 1W2AX 4W65A 5K7PA 2PHTA 2ZA9A 1LU1A 1OURA 2OIIA 2BWCA 3GJAA 3GDBA 4I3GA 3KF3A 5DAWA 4ZZ5A 4I02A 3M1HA 1PO12 3T4VA 3WINE 4DMIA 4FBFA 1ND3A 4R4ZA 3PTYA 3FLTA 1WKYA 4CXYA 3SKJE 2YDEA 2ETEA 4KG8A 4I0BA 1UPSA 4PQQA 1MS8A 1RHI2 4CCJA 3IMNA 2XUMA 2WS93 2GH8A 3FUOA 1ZBE1 3IT8A 4Y5Z0 4ZXEA 3FZ3A 2C4XA 2WFF1 1RUF3 3QBQA 1XRUA 5HCBA 3V64A 3AVRA 1A8MA 5ERLA 4IESA 5KHKA 3IM0A 3WCRA 2K0GA 2WBKA 3EMRA 4Q0UA 3VD5A 3ZYHA 1HB1A 3NJVA 4C90A 3C8XA 3ZXLA 2JG9A 1HX6A 4AF9A 5A33B 1WCKA 2YB7A 1W28A 3RYPA 1VBB1 1GZTA 3UGGA 5F6KA 2XJUA 4UOJA 3TBDA 1GNHA 3Q8FA 1W03A 2GC2A 4ASLA 3NO8A 3BTZA 2ZKNA 2BNMA 4AL9A 1MVEA 5FP7A 1OUXA 1V70A 4JGYC 1Q5OA 4RHV1 2OA2A 1O3TA 4CDXC 2FDKA 2FDFA 2XVLA 3MLJA 1F5JA 5CFDC 3OBZA 3H7JA 4N53C 1WD3A 1S2BA 3N7LA 1O3SA 4H3WA 1H6XA 1NA1C 5JMCA 5JXIA 1H8TB 1QOOA 3P3PA 3BTAA 3A4UA 5BYNA 1JHNA 5G04L 3J8F3 5C7GA 1GQHA 3VB9A 3OGGA 1NYWA 5A1AA 2RM22 3BYWA 1TMF1 4UW6A 3CZUA 2RR13 2KA3A 3JBG2 3ZN4A 1DQ0A 3OB8A 4AAPA 3L9JT 2G4IA 2PFWA 3I3QA 4LKEA 5GKAC 4AAXA 2XPJA 4CYDA 2EIEA 1QJU1 1NX9A 4YM0A 5A7OA 5BNNC 1MEC1 1W04A 3FLPA 2PHUA 2W95A 3CLPA 2FD8A 2XJTA 3OYWA 2JG8B 4EWAA 1AR82 1JHJA 5TSWA 4AEMA 1HXS1 3AYEA 1PZ7A 2VMDA 2VZTA 5A6QA 1YQ5A 4CCNA 1UU5A 3MIHA 1W6QB 1PZ8A 4D6RA 3HNMA 2EA7A 3DYPA 3SCGA 1EV11 3CU7A 2PHXA 3POGA 2IXKA 2OW4A 2VBBA 3CJIB 1K42A 3LE0A 4PLOA 1AYN1 4FFIA 2VL4A 2DURA 3VBSB 2C26A 4QB2A 5FMDA 3O1UA 2BZDA 3I3BA 1ENRA 2IXIA 5D8AB 1VBD2 2RJ2A 4IEUA 2VMCA 4FOWA 2KD7A 1ENSA 4IE0A 3AKPA 5DZFA 2B4KA 4XF1A 3ECQA 4B4QA 1AXYA 2V09A 1PM7A 1NOVA 2L9LA 5JAXA 2LM3A 5AFBA 2HWC1 1SG3A 1DDLA 1LHVA 1A34A 2HBTA 1W2NA 2RS52 1QJX3 1W9TA 3N35A 1S0CA 2VZRA 3I2KA 5CA6A 1N1TA 1BVVA 5T55A 5F3CA 5LW9A 4HVQA 3GZAA 4CXXA 4P14A 4BMEA 4AG4A 1POQA 5L9BA 4Y22B 4K8RB 5KXEA 4WM8C 1IGOA 4BM8A 2R071 4IV1C 5F9TA 1JXNA 3KV9A 1QQP2 2J42A 2J7MA 2JE9A 5T54A 4AK3A 5C3QA 3RS6A 1Z0HA 4XC9A 4AHZA 2QZ3A 1GU3A 1WUVA 2OPKA 3AZWA 3ZYBA 4EE2A 3NV4A 2C1FA 5F8PA 1UKGA 3HIFA 4JDOA 4LJHA 1HKDA 2ZZQA 1BBT2 2AEYA 2ZEZA 2ZHMA 3ROUA 2JG9B 4FPYA 2DVDA 5E1RA 3NJYA 4QPIC 3E5QA 5IFPA 1UY2A 3K46A 1V6JA 1EPZA 4AI3A 1VRH2 1IKQA 4C0BA 3P1IA 4YM2A 3VBUC 4WVMB 2XQXA 3I8TA 2G9ZA 3J7LA 1POV1 1SLIA 2WQZC 2ZBJA 3A21A 5CG9A 4XJWA 2J22A 5F6LB 1AYM1 4I0AA 2D3SA 1KEXA 1KQRA 1GSLA 4AFBA 4KH9A 2YPJA 1S55A 2JIGA 4S2DA 3U1XA 1I9RA 4K40A 4GWIA 1MQTB 4FT8A 4XEZA 5DAVA 3R0RA 4FFGA 4L97A 5FP8A 1PX3A 5HCAA 3MIGA 4JC1A 2HWE2 5D2AA 1AR61 2VVDA 3EJKA 3W5NA 2AEZA 4E27A 1WMDA 3VBHC 4EN0A 5DZEA 4LO6B 2XBO3 1GUIA 2VO5A 1Y43B 5C3OA 2W46A 2BERA 5JZGA 5K9YA 1SDWA 2D98A 2P6HA 4Z07A 2WA4A 5EQUA 3DXUA 4AGVA 2AH2A 2AREA 2NN8A 2VOVA 1AJOA 1DGRA 1PM4A 1PO21 1W2UA 3S5AA 2DFCA 3WCSA 2ZXQA 5CIRA 5F5AA 1V00A 5BNOB 5IVEA 4J25A 3UESA 4LO8A 3IAQA 4UF0A 3ZDVA 2PHLA 5C4WA 4DY3A 3VBFA 4XDQA 1XYNA 1Y9QA 3D82A 4Q4W1 1YEWA 5I0UA 2VPVA 1AL22 1XJAA 2GSYA 3FN9A 4PLMA 3WT3A 2ARBA 4QPGC 4AGRA 4CCDA 1UPIA 2G9FA 4YW2A 4JGZC 4YPJA 3ZKYA 4AHWA 3ZYIB 5JOXA 5E88A 1STMA 2W1SA 3A22A 2JX9A 4ZY9A 3ZSKA 2BVVA 4LBMA 4D8MA 4OI0A 1VBE1 3POWA 4LPLA 1R081 2LW8A 5EYXA 3U37A 3PUIA 3MPBA 1H9PA 2K9ZA 5B4NA 2HBUA 3GJBA 1DGRN 1EUUA 1KS5A 3DYMA 1JI6A 5A1FA 1VP6A 3F2ZA 5C9AA 4LO5B 3VDCA 4OULA 5A7QA 2PAKA 1OQDA 2VQ0A 3H9AA 5DUUA 5FXVA 5H9SA 3T4HB 4AVAA 4AI0A 4A4AA 2CY6A 5F32A 3ELNA 2FZ2A 2OPWA 4A6OA 3VBOC 3WNNA 4GULA 5KBFA 1R092 1LTEA 2B39A 3PUAA 4LHNA 4QX0A 3T2PA 2RE9A 4D6QA 5F37A 5C8CC 1VMHA 3U11A 1RIRA 1Y9GA 3VD4A 2FCTA 3KV4A 3DV8A 1OQEA 1GICA 3WG1A 4RQPB 2A70A 1DGWA 2D6PA 2YBSA 1CAXB 3VBRB 3AMMA 1PIV1 2BFUL 3VHNA 4Z8BA 3ZXGA 3IDCB 2VMIA 1RUC2 3MIEA 2R49A 4Q8LA 1HRI1 1DYOA 4YZ3A 1REDA 2V73A 5AVAA 4CDUC 5CAZA 4CE8A 3T0DA 3MUY1 5J98B 1C5HA 3ZPOA 2W39A 4GB31 4BQXA 3O1TA 2WNUA 1JUIA 3APBA 4A2UA 5AVPA 4HXCA 5CG8A 5FYBA 4QX5A 4YYOA 1REFA 1VBA3 2P34A 2G9GA 3NKTA 5EXOA 2C6SA 5A7WB 1AF9A 3MGUA 3HEIA 5LBEA 3EBRA 2IVIB 1MS9A 2JDZA 4XZUG 2WWJA 5FJHA 5F3GA 4DFSA 1O3QA 3AFGA 1ULOA 5GZGA 2DVBA 3WNXA 3AMPA 3HN3A 3FLRA 5LA9A 3HQUA 5FPBA 1CZTA 1JZ8A 1NAEA 4ASMB 1FPN3 1RUH1 3SEEA 2RR11 3TNPB 1UU4A 2HWF2 3OG2A 5FKCA 1OC1A 4E4HA 1G8WA 2YY1A 1GNZA 1FMD3 5IAVA 3THPA 4C1XA 3DPRA 3TB0A 1AR71 3T3YA 1G86A 4UXAA 1K12A 4NHMA 1FYUA 5FWJA 4PIYA 3ZXAC 4RS5A 1VE0A 3O12A 2EIDA 2OXBA 3NJZA 4UF0B 3CKHA 3WW3A 3L2YA 2WIIB 4NHYA 3VKNA 3MIDA 5GM0A 3VBFB 3ZFEC 3MIBA 2QFEA 5C4WB 3LDBA 3GCWA 4Q26A 1HN1A 1WCQA 1X82A 2D6KA 2XR4A 2XKOA 5FY1A 4QKBA 1XSRA 5FTTC 4YW4A 1EY2A 2HYXA 4AVVA 4Q0SA 4QMAA 3BOWA 2ZGPA 1JYXA 2VG9A 3UYJA 1JBCA 1US2A 1VRBA 1GKBA 3I49A 4AYUA 5C5UA 4MXWA 4QU1A 3N4MA 2DCJA 3BCWA 3LCPA 3POEA 4FAGA 3N9LA 3LSEA 4Y33A 2WS92 2R1DA 4JHTA 3ZSLA 2VXJA 1S0IA 1RUF2 3K3OA 1UOBA 2B9VA 1AXKA 3AP4A 3NAPB 3I97A 3PL0A 1VR3A 1MS3A 4XQ4A 5FPVA 2WNVA 3O5SA 1CJDA 2QCSB 3J7NA 2XHNA 3LIHA 3VL8A 2GC0A 4HL0A 3OD4A 4OZXA 3VN4A 2MPFA 2IXJA 2VCCA 4A41A 3N9OA 5A1LA 2P1BA 1O5UA 3NV2A 3OBTA 1W6NA 4NRQA 3UT0A 2DUQA 4XOGA 3AZZA 4IGPA 3KGZA 4B4PA 1HV0A 3DUIA 3LQCA 1U5XA 1NCQB 4XQDA 2XHKA 4ZXKA 4EWDA 1ZZCA 2R30A 5JI7A 2Z42A 2QQIA 3KF5A 3GZTB 3I2GA 2BGOA 5FK7A 1BK1A 2JKBA 4XHBA 2Q30A 3C7FA 4JQRA 4WZFA 2VNVA 3J8F2 2P4EA 4LLOA 5FPUA 1GV9A 5CNAA 1RINA 5E8AA 2ZS6B 5FYSA 1KXGA 5EYYA 5JOWA 2RS32 1JYNA 4R9BA 1UF2C 1O4YA 2X8KA 1N1SA 1ASJ1 1RUG1 4IERA 3IIIA 3FFZA 2A1XA 4OHZA 4D7YA 1ONAA 3I2DA 5BUVA 4ET7A 5KWRA 2DTYA 1CX1A 3KS7A 2E31A 1K5JA 2GH2A 1OD3A 1ST8A 1PNGA 3S7EA 4M3CF 3T2TA 3WQ0A 1UXXX 4HVOA 4FPCA 1HQNA 3KV5A 1VLNA 3KT4A 4Y20B 3THCA 3X29B 3U0ZA 1JYIA 4YWAA 1LHUA 4QB6A 4XTMA 3S30A 3WNOA 1S0JA 1ZBE3 1LR5A 2QZ2A 1QIQA 4OUSA 1KITA 2DVAA 5FMBA 2WFF3 2F17A 3AVSA 1C8M1 5BNNA 3AP9A 2ZJCA 4WV8A 1PVC2 4QDRA 1NZIA 4D94A 2Z79A 1B09A 4NN0A 2EXIA 5E16A 3RMXA 3WX5A 2R0HA 1Z78A 1ZX5A 4LXLA 2UU8A 1SBDA 1JZ3A 3N9NA 3M70A 1VBB3 5CKMA 4CEYA 3BB6A 2P3IA 3CJXA 4AZZA 1ZREA 1OPMA 4LUMA 2CNAA 3GXUA 1KDMA 1Y3TA 4IW3A 4HKLA 1ODMA 4UT5A 4RHV3 3UV9A 4HMZA 1NCRA 1H2MA 4AE2A 3WG2A 4AWDA 1NQDA 3POBA 2W0XA 3ZOIA 4MXWB 2CWMA 5EJ1B 2D7FA 1I3HA 2DVFA 3P3NA 1Q8SA 5ACA2 1RUE1 1WA6X 5KR7A 2PQSA 2XDVA 3RWKX 1YIFA 3ZLIA 5FYVA 3OUIA 4FXGB 2ZZJA 4Q5OA 2E7TA 5J48A 1DYKA 4NUBA 4IE5A 3H50A 2YYOA 4FP2A 1NE4A 1SLLA 3I4IA 1TMF3 1LODA 1QU0A 1FOD3 2VAUA 3BN6A 2IZWA 4KWUA 4MOAA 5FZ9A 4D7TA 4Q1RA 4L9BA 4G9SB 1QJY2 1JU3A 3J7HA 4WM8A 2RJKA 4B7EA 4DOUA 1TG7A 4IV3C 3ETQA 2YROA 3POFA 2EXKA 1C1FA 3L2HA 4D69A 4QX8A 1MR5A 2VCBA 5DN2A 5ISLA 1QJU3 5ABJC 2W94A 2EAKA 1UL9A 3LDKA 3PURA 1UNBA 1ALYA 2BP6A 4XCAA 4EJRA 2PMWB 1IOAA 1HXS3 4OI1A 4CP9A 4XBNA 3I2FA 5A3TA 5FBJA 2WZR1 4DINB 4E2SA 4OLLA 5KXBA 3N9PA 3B69A 5CFCA 3ME2A 1EV13 4JKMA 4UWDA 4NIHA 4B1MA 3AP6A 4GJYA 3RWNA 2ZGNA 5LRSA 5HXMA 1AYN3 1D0GA 2WYSA 3H8UA 3OY8A 1H1AA 5IVVA 1W3XA 5J7MA 4OCTA 2VZ1A 3MV11 4JGYB 2Y6FA 3RGBA 1PK6A 4CDXB 2HWD1 5EP9A 3ATGA 3WSOA 4QHBA 1W8OA 4N53B 2XBO2 5FYUA 2XUEA 4AFAA 2HWC3 2DYCA 2BV4A 1W3VA 4KL1A 3Q8BA 4Q2FA 5A7SA 1X36A 1NA1B 1JUHA 3OPWA 1RMU1 2IFWA 2VXRA 4L2NA 3AJYA 2VZUA 3CL1A 4OI2A 4MX3A 3AKRA 2GAUA 3SNMA 1W8TA 2VD7A 1OVPA 4V1PA 3PVEA 5BXXA 4ATFA 4A44A 2R073 4N8MA 4QHOA 1UOFA 2HYKA 2Y60A 2JDMA 3QCWA 2Q8DA 2XQRA 2PHWA 5G05L 4IE7A 3OD0A 1PGL2 4FTBA 4OHYA 4AHYA 2GNTA 3KT1A 5FUPA 3KV6A 4DPNA 5BNNB 2HLEA 1IG0A 1RUNA 1AVBA 1F31A 4KNCA 2JECA 4XILA 3WXPA 2QQUA 5EHDA 3RZHA 1CN1A 4XF9A 2WLQA 2F4LA 3HAGA 2ILMA 2B45X 2Y33A 4M4PA 1YJKA 5A7NA 1BHGA 2UURA 3DXTA 1NY72 4Q4X1 4AVSA 5JOYA 1K3IA 2X5IA 5A3WA 5DG2A 3P5BA 3KHCA 2H0VA 3SH5A 1XBFA 2ZGSA 3T09A 4XURA 3KMHA 1SLAA 1OSGA 3LEGA 5K0UC 1OLQA 2ZGLA 2OUJA 4CUCA 1POV3 1GQPA 1LJ7A 2XJPA 4HETA 1AYM3 1PX4A 1JZ4A 2XWBB 4GZ9A 4HK9A 4QPGA 1VMFA 2PAEA 2YC4A 5JR7B 2GNDA 3E6BA 5FYMA 1L7QA 2VZOA 1PHMA 4Q4Y2 2VOWA 1F4AA 3IAPA 3Q8AA 3W21A 3AMHA 5DUWA 4MGYE 1WCSA 3T0AA 4EZHA 4Y5SA 5IVBA 4W6XA 2Q0AA 4HG6B 3SITA 5CZKA 2AYHA 1AR63 3VHPA 3WD5A 1W9FA 1H8TA 4AEDC 1GOGA 4WM8B 1OKOA 4I2OA 1YIPA 5FO8B 2Q8OA 4IV1B 5JDBA 1IZ3A 3ZYRA 4O7XA 3VBOA 3SH4A 2ZMNA 2ZGTA 4OMDA 3D3AA 4U2AA 4DEQA 1QKQA 1G9AA 1XNBA 4QQLA 3WG4A 1O8PA 4FPLA 1OLRA 3T2QA 1MZFA 2A6VA 3IBMA 1PO23 4C1WA 5I93A 3OSDA 1DQ1A 3GYDA 1DGLA 3MV01 4RN5A 2WSVA 1OLMA 2LALA 5FYCA 1YFUA 4QPIB 4CP2A 1V6KA 2WT1A 4BU2A 2Y38A 3JD73 4IXLA 4M0NA 3WHTA 2PELA 4Q4W3 4CDUA 1J3RA 4COVA 3VBUB 1F2NA 4X6QB 1YQ2A 1GP6A 1A6CA 2JDUA 3D5OA 1PK6B 4FPEA 4RGAA 3RZZA 3SC7X 5FZ4A 5A32B 4A7ZA 4LIVA 3WOGA 2NPIA 1VALA 4BZ4A
chains in the Genus database with same CATH topology
1VBE3 5D8AA 1R1A1 1UAIA 1R083 1OOPC 1D0HA 2Q4SA 2JJ6A 4FXKB 1EPWA 4HANA 3UL2A 5L73A 1LECA 2X53S 2O0OA 2A3WA 4COZA 1FMD2 1RVF1 2EF6A 2R16A 4OUMA 3VBHB 3VDDC 3VHOA 4BWOA 1RJ7A 1WMEA 2IWGB 1WMFA 4NOTA 1Q3EA 3B02A 5FMOS 4I09A 4Y22A 4TWTA 2UWCA 2PYTA 2YMZA 2OZJA 3IDBB 1Z7S2 2VMGA 1XXNA 1JN2P 1BJQA 2R061 4QM9A 2DVGA 4JAAA 4K1ZA 4M00A 1PIV3 3LOBA 2XB6C 2X5IB 2OYZA 1HRI3 1VJ2A 3C2UA 1D2QA 4HFSA 2X29A 4YRDA 3N3HA 3I7DA 4YW3A 4GB33 3U4XA 3KB5A 3PJYA 4FTEA 2D43A 3KCYA 4QPGB 3RNSA 4YG0A 4WVMA 1LU2A 3U07A 4F83A 1ZBA1 2JXAA 4XQWA 1C4RA 3WUCA 3VGIA 2C0ZA 3AJZA 3V0AB 3IPVB 3WDVA 3ALQA 5AC91 3CNAA 3ZFGC 4XZPA 2ZGRA 5A3LA 3TYJA 1QH6A 1WBFA 4HSJA 1MQTA 3WW4A 4Q0QA 2ZGMA 4LE4A 4BE3A 4JVAA 2B46X 4PBOA 1XE8A 1ND2C 4FQZA 2WL1A 4MGZE 1TQ5A 1FOD1 1OD5A 1RUH3 3VBOB 2BEOA 1OHFA 3ZXFA 1RGSA 1NXD1 2DWRA 2RMU1 4Q0VA 1XNCA 1NLRA 5C8CB 2DCZA 2ET7A 1AR73 2D6MA 1PGSA 2E9QA 5DDJ3 1IS5A 1W39A 2GZWA 3QLQA 1CR7A 2XL9A 3FE5A 1W6OA 1SMVA 2ZHKA 4S2FA 4WBBA 4CDUB 4Q29A 1K5MC 5BNOA 3VUOA 1RUOA 1WLDA 4XMIA 2RS11 1M4WA 1YI7A 2PLV1 4YZ4A 3SISA 4FQ4A 1ZBE2 4YVWC 2WFF2 2PTMA 3O7OA 4BQ1A 5KC5A 1SCSA 1W6MA 2VOKA 3KM5A 3UKTA 2ZKLA 2JEMA 1MS1A 2CL2A 3WVJA 4XETA 2VY0A 4YGCA 2CAUA 4LHLA 1VBB2 4XF4A 2ZABA 1XU2A 3MF6A 2D3RA 2ZX2A 1TE1B 3BOPA 4MZUA 4D3WA 5IT6A 1SEFA 4WVVA 1B35C 4MUVA 4B29A 4QGLA 2GMEA 1XE7A 4CEWC 5FLIA 4XBLA 4RHV2 4ATEA 1NQJA 1ULDA 1VBC1 5J3UA 1RTVA 2NM1A 2WSUA 3KSCA 3USSA 1W6PA 1WW6A 4HN1A 4M3CB 1W0PA 3ZFEB 1LHWA 4RQPA 4YNIA 2GN3A 2GU9A 1CAXA 3VBRA 3FX3A 1F9KA 4NR1A 4KWJA 3VKFC 3LSDA 1TMF2 5DXDA 4HVRA 1O91A 4AHXA 3OGJA 3A0KA 2I2SA 1LULA 4IEWA 1A78A 4MLOA 1ASJ3 1BQPA 1RUG3 1YI9A 4GXLA 4PDWC 3ZSEA 1AR91 2WKKA 4NPRA 4Q27A 1LHNA 1COV1 3CO2A 2D6OX 2ZAHA 2GNBA 1QJU2 1WA4A 1MEC2 3FBMA 4XFCA 1RUJ3 2UWAA 4GKXA 1FATA 3AYDA 1HXS2 3WQ7A 5KHHA 4DXZA 3QOPA 3ZXEA 4QGNA 1ZVFA 1X7NA 1ZNPA 3OF1A 4ORFA 1S0FA 1C8M3 1AYN2 4M3CE 3UJOA 3B00A 2BPA2 2CAVA 2WJSA 2ZCWA 4FOYA 4ISQA 3RG0A 2YC0A 4HKWA 2DUPA 2D6LX 3B7MA 4LE3A 5JSPA 1BMV1 3HT1A 3HBZA 1X8EA 2YV8A 4QGMA 1QNWA 5JVVA 1W6OB 4FCAA 1BEV1 2HWC2 3RI9A 1MVQA 3ES4A 4N43C 1POV0 1V9U1 4LBJA 4RA0A 4Y1ZA 1YFWA 1H9WA 1RUC1 5FPXA 3AKQA 3CF6E 4AGGA 1O3RA 3JD71 2R072 5D1IA 4AQTA 4QD2A 5FAXA 2WFPA 1LOFC 2OUHA 1C8NA 4LBKA 1J3QA 1RUE3 1OMIA 2GNMA 1LRHA 3BIWE 4M01A 1W6MB 4I3PA 3WP3A 4ISRA 4WZCA 5T5PA 4R8HA 4ONUA 2DCYA 4BHPA 2XWJB 3HT2A 3NAPA 4B8EA 1X50A 1RUI1 4H7LA 3E5UA 5EWSA 3NKGA 4FPGA 3D0SA 3QACA 4HSLA 2GMPA 1NG0A 3AZYA 1IPKA 4HKOA 2FMYA 3MW2A 5L7OC 4BYYA 1YXWA 4G4FA 3RJRA 1WLCA 1AYM2 3SCFA 2I74A 2YZ4A 2WZR3 3VZLA 3GHMA 5FLJA 4AQSA 1CD3G 3WV6A 2Z69A 4DQAA 1W6PB 3IWZA 3O0WA 2UYBA 5GZEA 1NCQA 4JCKA 4M0HA 2VH9A 2VQAA 1AR62 4YZ2A 1BKZA 2GC1A 1ZZ9A 5GLZA 2HWD3 2VVFA 5FO9B 2DFBA 3M3IA 4MV2A 1H2KA 5J96B 4Y1UA 2XKPA 1OA3A 4ES8A 2B8MA 1RMU3 2I45A 2UY9A 2ZX4A 4XFBA 4FPJA 4MGIE 3AB0A 2WINB 4ITCA 3H1WA 4RGGA 2FMDA 1BZWA 1TME1 3M3CA 4AI8A 2QKDA 1PO22 1Q56A 3GF6A 2ZMKA 3R4UA 3WDTA 3AX4A 5JCTA 3EO6A 5I0RA 5FRAA 3S0MA 1RUD1 1I5ZA 2OZ6A 4WM7C 4LO7A 3POYA 1V6NA 4YVSC 5BNQA 4Y20A 1QWRA 1J1LA 3D8CA 5ABJB 4Q4W2 1HDKA 1JOJA 1C57A 1T6GC 3EXUA 1UZYA 3J4UH 2YXSA 4W6WA 4Q4X3 2XJQA 1EAH1 1PNFA 1VBE2 1BCXA 1DYPA 1R082 3GHNA 1ZYBA 2E53A 5DDJ1 4Q4V1 3ZFFC 4LTAA 4IQPA 4OFGA 3RYKA 5CBLA 1NXMA 5I0TA 3MW3A 4AW7A 5HCFA 5T5JA 1S1AA 4YM1A 3J26N 3ZN6A 3PHMA 3S7IA 4XTPA 1ND3C 5FMOL 1IS4A 5FPZA 4FSJA 4F8AA 5GJ6A 2GC3A 3HR9A 4TLFA 3ZSJA 2RS31 1F5FA 3AP5A 1CONA 4CZSA 1HRV1 4XJ9A 2QJVA 2XG3A 4ZU5A 3ZYGA 4XXPA 4GWNA 3LGRA 3BPZA 4FPOB 1PGW1 4AFCA 1C1LA 1PIV2 1S0BA 3J9SA 4LBLA 4NO4A 1GZWA 4YZ1A 4MYEA 4B4RA 1HRI2 3PMSA 5A3MA 4EN8B 4MXVA 1DG6A 2GMMA 1EYBA 1Y7BA 5LK7B 4GB32 5L36A 3WW2A 3B94A 2EVXA 2XVGA 1UMZA 1SQ4A 1LGCA 2A6ZA 4P9IA 1GLHA 4COYA 5KHGA 3MZHA 5LRRA 2E63A 3ILFA 1VAKA 1N47A 1SFNA 4YG6A 2EIGA 4ZU7A 1SCRA 5JLVA 3ZXKA 5BV6A 5IK5A 4UW4A 3OCPA 4WVWA 4K3UA 5SV5A 5HI0A 5K0UB 3INAA 2HEVF 4LR4A 2R0FA 2JICA 3SLIA 1F8VA 4XXAA 1N3OA 4BCUA 1KFXL 1OKQA 2R6QA 3UKNA 2P3KA 4EN6B 4JGYA 3ES1A 1Q8OA 1R1A3 5K8SA 1RC6A 1RUH2 3GBWA 4CDXA 2RR12 2CGOA 5CFDA 2R041 3M8LA 4N53A 5T50A 1UIKA 1ZA4A 3ZFGA 1CIWA 1RVF3 1DFQA 3WDWA 1NA1A 3GNEA 1AR72 4PF5A 4N7UA 1FV2A 2BBVA 1RUJ1 1XYOA 3HMYA 2RHPA 1WBLA 1UX6A 4N90A 1CAWB 2PN5A 1KD7A 4XE9A 3JB8A 2R063 4GH4C 1O7FA 3S6PA 5CADA 2GN7A 3ZX7A 1OFNA 1C5IA 4FP3A 3NV3A 4SLIA 3TN91 3MLKA 1IS6A 4W6YA 4AVTA 2VECA 3AFKA 1XNDA 3N36A 1K5MA 1DGWX 3ZN6B 4OHXA 1QJX2 3GBGA 3MPPG 1G9DA 3ASIA 4LT5A 2BUKA 2HWB1 5BY5A 4LA3A 1ZBA3 1Q43A 1GR3A 4U36A 4PCRA 1OOPB 4LBQA 3OPZA 5AC93 1ULEA 4AQ2A 3E97A 3VDDB 1SACA 3LZZA 4NWWA 3KZ4C 4C0HA 1X33A 5F1RA 2P3JA 4ES9A 1GZWB 1LENA 3ENRA 3JB4C 2RMU3 3NVCA 4CDQC 1B35A 4IV1A 4BIFA 4I0WB 1YYNA 1A3KA 2QDRA 1D4M1 2E51A 5FREA 1RJ8A 3RQ0A 1U5YA 1S2KA 2DF7A 1ASJ2 1H0BA 1LOBA 1RUG2 1V6IA 2AZ5A 1Q8PA 2D93A 2W68A 4P9GA 2D5HA 5AFEA 2MEV1 3G6JB 3B9CA 4YW5A 3H7YA 4BA6A 1MS4A 1QGLA 1SLCA 1E57A 2A6YA 3A0NA 1NLSA 1FNYA 4QPIA 1KJLA 3T1MA 2WNEA 4DRVA 4FTSA 2ZACA 4F7ZA 2RS13 2AGSA 2B7YA 2PLV3 3E6DA 4PDWA 3VBUA 1AX0A 2D5FA 4CP1A 1N1YA 1OI6A 4KQ7A 1C8M2 4Q4Y1 5A32A 4L99A 3O0VA 5CFDB 5FQ0A 5JZGC 2QQPA 3ZFGB 2YHJA 5BPXA 1UCXA 3H3UA 4Y1XA 3KGLA 4YGBA 4E4ZA 5JWPA 4UW3A 1ND2B 1I1EA 4FPHA 4P9XA 4ZU4A 1QXPA 3RMYA 1LGNA 2VU9A 3VBHA 2PQQA 2VOXA 2YGLA 4QT6A 3VBFC 2A7AA 5JIAA 1JH5A 2B42B 1VBC3 3POSA 3NWKA 2FHRA 1FT9A 5IK8A 1S0DA 5CU1A 3OJBA 2VW1A 2QVSB 2D44A 2QDNA 1J59A 4OI4A 2PHDA 3W58A 1UN1A 1K5MB 4HK8A 3RPQA 3M4FA 1A8DA 5C9AC 3R4SA 3WR0A 1AR93 3PMEA 2E6VA 4K8FA 4LBNA 4QQ2A 4BMBA 1COV3 4AVCA 3ILRA 4LBQB 3RI8A 3VKMA 4COUA 3ZXDA 1D4VB 4YVWB 4XYXA 2ZAAA 3KQRA 4H14A 4JGZA 4Z82A 3ZDSA 3GALA 4N9IA 3DL3A 1WW4A 2WWSA 4INDA 2XJVA 1GANA 1IQAA 2WZR2 4CTEA 3V0AA 3IPVA 3M7AA 4YGEA 1MACA 3N7JA 5FFOC 1HQWA 3MF9A 2H6BA 3KT7A 3AKSA 5KC6A 1H2NA 4IEVA 3ZMOA 3MYXA 1LKNA 1PO11 4QQOA 5FCCA 1B35B 2GALA 3N7MA 1UKRA 4K7JA 3NL1A 5I0SA 4CEWB 4BPZA 2MHFA 2ZGKA 4H55A 4Q8KA 4X8PA 1RHI1 4KG0A 4CRQA 4R9DA 1BEV3 5C8CA 2WNUC 5FBZA 5JOZA 1RMU2 2XH6A 5I8TA 1V9U3 4A7YA 2NYYA 3Q9OA 1S0EA 1RUC3 4FO9A 4GIQA 2BFUS 2Y0IA 1VBA2 1LHOA 1KS4A 2YGMA 4OHVA 4HBNA 5GLUA 3PVNA 5EJ3A 1GZCA 4PDWB 4IEYA 3NSTA 3RJ2X 2P37A 1CQ9A 1ZZ8A 3WZ1A 4A7KA 5GZFA 4LUKA 3KD4A 1GFF2 5FQ0B 1FXZA 2CYFA 4E2QA 4AI2A 1FPN2 2PHRA 1AJKA 3UKVA 2Z5WA 2TNFA 3DPRC 2IXHA 1RUI3 1FI2A 2QE3A 4Q0PA 4Q4X2 1VIWB 3VHRA 1YHFA 2HJIA 1H8VA 2P2KA 4WM7A 1H2LA 4QM8A 3IIAA 3V56A 4RS5C 4I30A 2RM21 3O14A 3JUUA 4LNVA 3ZN5A 4LHKA 1ENQA 1DQ5A 3VZJA 4E4DX 1S0GA 1YUDA 3B93A 3JBG1 4SBVA 3FWEA 4NHLA 3AXEA 1J1TA 4N43B 1XYPA 2ES3A 2VNGA 3ZFFA 1M06G 2ET1A 2ARXA 1AR81 4IEXA 4HT1T 4RR3C 1OPOA 4M3CA 5E89A 4LULA 3ZFEA 3VKLA 3AYCA 4RSUA 3LOIA 3PVOA 4KWLA 3VV1A 2WNVC 4OVEA 1QDCA 1VAVA 1G6NA 2A71A 3ZSMA 5BNPC 4PBPA 5F5QA 1SFYA 1SLTA 1V6MA 4J1WA 5I8YA 1YFYA 1DZTA 1U5IA 1LGBA 4JGZB 3IDEA 1QJZA 1EP0A 4R4XA 1I6XA 1VBD1 2XLGA 4HLTA 4K20A 4URTA 5GALA 1TME3 2CGPA 1ENXA 3VZOA 1ZRDA 1ZM1A 3AK0A 4QQPA 1RUD3 2RS51 2DCTA 4XFIA 1LEMA 4A3XA 4YW1A 2CGNA 2D97A 3RRDA 2K2SA 3SMHA 2Y26A 5L7OB 4O9GA 1YRZA 1CAUA 4KU7A 3WW1A 2Q1ZB 5H9PA 1YNAA 1QQP1 2JD4A 4FVVA 1DQ6A 2A3YA 4YLZA 2WLPA 1AX1A 4BOWA 1EAH3 1R1A2 2ATFA 1ZZ7A 4XJUA 3WLUA 1CAVA 3JQWA 4Q4V3 1DHKB 3K51A 4LO4B 1JTZX 1BBT1 4TSVA 1AX2A 1RVF2 2A75A 5JPMB 2BWAA 2VULA 3AP7A 4QXKA 2RS33 1U5ZA 3FMGA 1VRH1 4IETA 1HRV3 1LCLA 3JQXA 1CPMA 4CDWC 5DZGA 3WDYA 2QUOA 4HPKA 2R062 2BYVE 3M3QA 1CPNA 4XJZA 1BYHA 3H0OA 4N9HA 3MDPA 3LA2A 4K6BA 1YO8A 1DU3D 1C3HA 2VUAA 4QQHA 4WM7B 4XIKA 4Y1VA 4YVSB 4YZ5A 2HWE1 4S2GA 2UY8A 3NW4A 3U10A 1D2SA 1WD4A 3OBRA 4IL7A 4CEYC 2BNNA 4PJYA 1NE6A 2UWBA 5JSRA 2SLIA 4GH4A 3ZPYA 1PVC3 2LTNA 1NCRC 1O4ZA 1MS0A 4L8QA 2ZPXA 3TWIA 2BW8A 2DV9A 5FDBA 1ZBA2 1CVNA 3USUA 2H0BA 1LESA 1G7YA 2DU0A 3ZFFB 2R1BA 5AC92 1OFSA 1GQGA 2EAAA 4XF0A 3JCIA 1YFXA 5C8WA 2WT2A 4IEOA 3R4DB 3QD6A 1ND3B 3R05A 4Z92B 1N1VA 2BTVC 1FOD2 1FX5A 1AL21 2RMU2 2R043 5ACA3 2A6XA 4JTOA 3FHIB 1UW8A 4B7KA 1AXZA 1WGPA 4J1XA 1H1MA 4HZFA 4RD7A 1UZZA 3FFQA 2ENRA 5C6CA 1N3PA 4JRAA 2ERFA 3LKJA 4IEPA 1ZRCA 1QJY3 1DLLA 2F6BA 1FAYA 4KGQA 1H4GA 5CFCC 4NHKA 4YFWA 1J3PA 1WCDJ 2TEPA 4CDQA 4N7IA 5JSOA 5KXDA 1EV12 1GBGA 4IV3A 4AEJA 4BH9A 1CAUB 5JPNB 2C5DA 2KM2A 2ZX0A 2HEYF 3AKTA 4LEJA 3VKOA 4COWA 2RS12 5ABJA 1PK6C 2PLV2 1H4HA 1ULCA 3WDUA 4AXOA 3TN93 3ZYJB 2WT0A 1R091 1CAVB 3MIFA 4NVPA 1FV3A 1VB2A 3CEWA 4UW5A 4P9WA 4DZGA 1MZ6A 1KDKA 1QY4A 2HWB3 2Q5TA 1W0OA 1PZ9A 4YFZA 1HW5A 2MNGA 2HEWF 4LBOA 2A6WA 3V0BA 4AVBA 2VW2A 2D40A 4HPKB 2DTWA 4DY5A 1ZZBA 3ZIXA 1VBC2 3OYWB 3WP6A 3LWCA 3WG3A 3AXDA 3RSJA 4GWMA 4DS0A 4S2HA 1ULFA 2UYAA 2ZMLA 2X5IC 4ZKTB 3O0XA 5GLVA 3WQ1A 4Z2WA 4K21A 2WQ4A 4KBBA 1D4M3 4H7MA 4GH4B 2P17A 3BALA 3UJQA 5IK4A 1AR92 4Y1YA 3MFCA 1JW6A 1G9BA 1UU6A 1COV2 2Y0OA 2HWF1 2MEV3 4PIXA 3USUB 3KLSA 3GBFA 4JDMA 4K9SA 4EV0A 1OQ1A 1N3QA 4FPFA 5J09A 2WZPP 2ZOEB 1H1IA 1LOGA 1Q8VA 1HV1A 1L3JA 4KGGA 2VNRA 1H8TC 1AHSA 5K0UA 2PA7A 3BODA 4Q4Y3 1OA4A 4MGKE 4YGDA 4GALA 2EXJA 3WP4A 4EN7B 2JE7A 1H30A 1BMV2 1SBEA 3OTFA 3ZXJA 3SHRA 2WS91 4NWVA 1BEV2 3TRSB 2VGDA 3WP5A 1RUF1 4AEDA 1X8MA 5KHIA 1SBFA 1YLLA 1V9U2 1NZCA 2JG8C 4R9AA 5HBAA 3I59A 5GZDA 4PIZA 1HIXA 4CDQB 4IV3B 3E6CC 4FPKA 1BVP1 1CAWA 3JD72 1GZ9A 2NP0A 2A73B 3CJIC 1MZ5A 3VBSC 2D3PA 5GLWA 1TNRA 4XJ8A 5D8AC 2B9UA 5J36A 4BLIA 4X6RB 3PJQA 2VW0A 3AZVA 2Q1MA 2XLAA 3ZIWA 2IFRA 1YCIA 3JU9A 4UBGA 3AMNA 3THTA 1RUI2 3MLLA 5LEJA 4IEQA 2JENA 3J8F1 3V0BB 3G7DA 5EZWA 3VL9A 2V5YA 5T52A 4GQ7A 4QU2A 1WW5A 5JZGB 1REEA 1WLTA 1OOPA 1Q8QA 4EWEA 5H9QA 4KWKA 1RITA 1ULGA 4DRRA 1JYCA 4YSFA 3AZXA 1PO13 2EXHA 3SXWA 5JI9A 3VDDA 3ST7A 4LA2A 3UK9A 3EQEA 2WA3A 2A3XA 2JG9C 3LB9A 4FOQA 3ZVXA 3N7KA 1Z7S3 1QXJA 1RHI3 4R9CA 5LK5A 5KXCA 3LAGA 1AL0G 1IPJA 4IEZA 3AM2A 1PVC1 2H6CA 5GLTA 2VMHA 1DBNA 4L92A 5T3NA 4RR3A 1TME2 4OHWA 2PAMA 2I07B 1CJPA 4GMP3 4JTNA 2AUYA 5C9AB 1MQTC 1RUD2 2N7GA 4LBQD 5BNPA 1QJX1 1GYKA 4Y4YA 2VUJA 2O8OA 4X8NA 2IC1A 1DZRA 1UD1A 3C3VA 3FUQA 3HWJA 1DF0A 1TEIA 1QDOA 5ACA1 4XMAA 3DKWA 4L11A 1EAH2 4MVTA 5KHJA 3TAYA 5DDJ2 4AEDB 4Q4V2 2RM23 3MFAA 3I59B 2OVUA 5C33A 3VZMA 1ND2A 2XLFA 3RYRA 4B3NA 1ZRFA 1MZEA 1QJY1 3JBG3 5EFUA 3SH3A 4AFMA 5BNOC 1DIWA 1QHDA 2NMNA 2W52A 4XPVA 1J58A 1AUYA 4DNYA 5IK7A 4J6GA 2WNUB 3WUDA 1HRV2 2FZ1A 3VLBB 1AR83 1SLBA 4YARA 1IKPA 1AZDA 2E7AA 3NV1A 1CX4A 4O9EA 3H1MA 5LEKA 4BIOA 1QNYA 5IUQA 1PGW2 3W59A 2ZGUA 4XW3A 2FBEA 1XNKA 3M3OA 3E5XA 4JRLA 4R52A 4TZDA 2FQPA 3WDXA 3TOJA 4CDWA 3MW4A 1ZRRA 4EROA 1LOAA 1VBD3 3D6EA 4DB5A 4XJAA 2XBO1 4YVWA 1QOSA 3BU7A 1V6LA 1LEDA 3DPRB 2RS53 4XFGA 3MEPA 4G3YC 5B2GB 2QNKA 2ZGQA 4RS5B 4KU8A 5HXVA 4P5HA 4RQPC 4FOVA 3QH7A 2SBAA 2XGXA 3VBRC 5T5LA 4GA9A 1QQP3 4XFAA 2ZX1A 4P9LA 1PGL1 1HQLA 4UBHA 3TNQA 4CEWA 2AR6A 5CB7A 2ZX3A 5DG1A 4XFHA 2YUEA 1C28A 2R042 1CESA 1BBT3 3ACLA 4YM3A 1RL3A 4CP0A 4XFFA 1G9CA 3ILNA 4RR3B 2AENA 4XF3A 2E7QA 1DZQA 5H9RA 4C91A 1NY71 2WNVB 4TYSA 4FAHA 2NQYA 3B5LB 1RUJ2 3H3ZA 5BNPB 3HN1A 4WVZA 1VRH3 4AFDA 2C9AA 1APNA 2TBVA 1XQNA 1TNFA 3EHKA 3HD8B 2W08A 5FLHA 1VAMA 1V6OA 1MEC3 5GZCA 1W6NB 1CGPA 4PQ9A 2ZTNA 1DQ4A 3TN92 1U12A 4P9YA 2KXLA 3IN9A 2HWE3 4MSVA 3QH6A 4D7SA 3RDIA 2O8QA 3AYAA 2F4PA 4GKYA 3M2MA 2TUNA 5EV7A 1QMJA 1IHMA 2Z2SB 4XBQA 2DCKA 1KRIA 4E9KA 3VZKA 3B3QE 4AI1A 2HWB2 5C4WC 4LLFA 2RJLA 5I8SA 4Y26A 3FBYA 1WW7A 5I91A 1YWKA 2BQPA 1O5LA 2BGCA 3T1LA 3HQXA 3B01A 3PLQA 1RUE2 1R1ZA 1QH7A 1MS5A 2CV6A 4N43A 3MI8A 2D6NA 2DUOA 3FJSA 1URXA 2BVBA 1VBA1 2LUWA 3M3EA 2ZGOA 3NAPC 2DU1A 2CTVA 2XVKA 1AL23 4CDWB 1QF3A 3ZO0B 2B5HA 3R6SA 3H1YA 1LOFA 5CVRA 1D4M2 1YJLA 1FPN1 4P9JA 3PNAA 4F3JA 4E2GA 2MEV2 4K1YA 3V65A 5L19A 4I01A 3B9IA 5DUVA 1U0AA 3D0JA 1FMD1 2XL7A 4CEYB 1NCQC 3KCXA 3LA7A 4E4SA 4JV4A 1O4TA 4AEKA 3MICA 5A33A 4BLJA 1NCRB 1ZZ6A 5L7OA 5FOJB 1LB2A 1R093 2HWD2 2VNOA 1Z7S1 3JZVA 3LA3A 2EALA 2HKXA 4RFT0 5J37A 1VB4A 2XJSA 1RB8G 4MH0E 2NZ9A 3AMQA 4Z1VA 4HN0A 2GDFA 3ZMNA 3VZNA 2R32A 1HLCA 2CWSA 2NLRA 4YG3A 5DUXA 5FO7B 5JIUA 3GZUC 1G9FA 2BNOA 1KFUL 4Q1PA 1LOEA 2VVEA 2ZHNA 2NMOA 4XHXA 4QPYA 1PVXA 4GMP1 3FC0A 4EN9B 4JDNA 1UIJA 4XIOA 3SCHA 1WLWA 2XJRA 3KCCA 3DN7A 3PVBB 3URFA 1IS3A 2A5ZA 3WY6A 4AQ6A 1DQ2A 1QOTA 5CFCB 3IKWA 1OA2A 2JG8A 3DGTA 3I54A 1FNZA 4Y24A 3OY8B 1W6QA 1KJRA 4YVSA 2WC2A 5T5OA 3W9AA 2IXLA 2O1QA 2ZHLA 2IXCA 1QXRA 3CJIA 1BXHA 5FOBB 1XU1A 5SV8A 2HWF3 3VBSA 4META 3DF0A 4PLNA 1LOCA 3D4KA 3WHUA 4GMP0 3ZYPA 3K48A 1PMIA 2PHFA 4RL7A 4W65A 5K7PA 2PHTA 2ZA9A 1LU1A 2OIIA 2BWCA 4I3GA 4I02A 3M1HA 1PO12 3WINE 4DMIA 4FBFA 1ND3A 4R4ZA 3PTYA 3FLTA 2YDEA 2ETEA 4KG8A 4I0BA 1UPSA 1MS8A 1RHI2 3IMNA 2XUMA 2WS93 2GH8A 3FUOA 1ZBE1 3IT8A 4Y5Z0 3FZ3A 2WFF1 1RUF3 3QBQA 1XRUA 5HCBA 3V64A 5KHKA 1A8MA 4IESA 3IM0A 3WCRA 2K0GA 4Q0UA 4C90A 3ZXLA 2JG9A 1HX6A 4AF9A 5A33B 1WCKA 3RYPA 1VBB1 5F6KA 2XJUA 3TBDA 1GNHA 4ASLA 2GC2A 3NO8A 2ZKNA 2BNMA 1MVEA 4JGYC 1V70A 1Q5OA 4RHV1 2OA2A 1O3TA 4CDXC 2XVLA 3MLJA 1F5JA 5CFDC 4N53C 3H7JA 1WD3A 1S2BA 3N7LA 1O3SA 4H3WA 1NA1C 5JMCA 1H8TB 1QOOA 3P3PA 3BTAA 3A4UA 5BYNA 1JHNA 3J8F3 1GQHA 3OGGA 1NYWA 2RM22 1TMF1 4UW6A 2RR13 2KA3A 3JBG2 3ZN4A 1DQ0A 3L9JT 2G4IA 2PFWA 5GKAC 2XPJA 4CYDA 1QJU1 4YM0A 5BNNC 1MEC1 3FLPA 2PHUA 3CLPA 2XJTA 3OYWA 2JG8B 4EWAA 1AR82 5TSWA 4AEMA 1HXS1 3AYEA 1PZ7A 1UU5A 3MIHA 1W6QB 1PZ8A 2EA7A 3SCGA 1EV11 3CU7A 2PHXA 2IXKA 2OW4A 3CJIB 4PLOA 1AYN1 3VBSB 2DURA 1ENRA 2IXIA 5D8AB 1VBD2 4IEUA 4FOWA 1ENSA 3AKPA 5DZFA 4XF1A 3ECQA 4B4QA 1AXYA 2V09A 1PM7A 1NOVA 5JAXA 1DDLA 2LM3A 5AFBA 2HWC1 1LHVA 2RS52 1QJX3 3N35A 1S0CA 5CA6A 1N1TA 1BVVA 5T55A 4HVQA 3GZAA 4P14A 4BMEA 4AG4A 4Y22B 5KXEA 4WM8C 1IGOA 4BM8A 2R071 4IV1C 5F9TA 1JXNA 1QQP2 2JE9A 5T54A 4AK3A 3RS6A 1Z0HA 4AHZA 2QZ3A 1WUVA 3AZWA 2OPKA 3NV4A 2C1FA 1UKGA 3HIFA 4JDOA 1HKDA 2ZZQA 1BBT2 2ZHMA 3ROUA 2JG9B 4FPYA 2DVDA 5E1RA 4QPIC 3E5QA 1V6JA 1EPZA 4AI3A 1VRH2 1IKQA 4C0BA 4YM2A 3VBUC 4WVMB 3I8TA 1POV1 1SLIA 2WQZC 2ZBJA 5CG9A 4XJWA 5F6LB 1AYM1 4I0AA 2D3SA 1KQRA 1GSLA 4AFBA 4KH9A 2YPJA 1S55A 4S2DA 1I9RA 4K40A 1MQTB 4FT8A 4XEZA 3R0RA 5HCAA 4L97A