1BJQA

The dolichos biflorus seed lectin in complex with adenine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
253
structure length
251
Chain Sequence
ANIQSFSFKNFNSPSFILQGDATVSSGKLQLTKVKENGIPTPSSLGRAFYSSPIQIYDKSTGAVASWATSFTVKISAPASFADGIAFALVPVGSEPRRNGGYLGVFDSDVYNNSAQTVAVEFDTLSNSGWDPSMKHIGIDVNSIKSIATVSWDLANGENAEILITYNAATSLLVASLVHPSRRTSYILSERVDITNELPEYVSVGFSATTGLSEGYIETHDVLSWSFASKLPDDSTAEPLDLASYLVRNVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Glycoprotein
molecule keywords LECTIN
publication title Carbohydrate binding, quaternary structure and a novel hydrophobic binding site in two legume lectin oligomers from Dolichos biflorus.
pubmed doi rcsb
source organism Vigna unguiculata subsp. cylindrica
total genus 56
structure length 251
sequence length 253
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 1998-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1bjqA00
3AP7A 2XB6C 1WW4A 3ZSMA 5H9SA 4YW2A 1UPSA 1ULEA 1KRIA 1DHKB 4DQAA 1Q8OA 1G9AA 2YV8A 2ZMLA 1SLIA 2A6WA 3AXDA 3SH4A 1GNHA 1WD4A 2E7TA 2ENRA 5T54A 3AZWA 2EAKA 1Z0HA 4XIOA 1W6QA 3SISA 2JECA 4M00A 4YW4A 3VKFC 4LBQB 4AYUA 4YW1A 1C4RA 2NP0A 4U36A 1RIRA 1MACA 4XBNA 4FPGA 1GNZA 1Q8QA 4MYEA 4BLJA 2DVDA 3B69A 1HQLA 1MVEA 4DS0A 1C57A 1QDCA 1WLCA 5JOWA 2ZZJA 2D6NA 1Q8SA 3WDYA 3WLUA 3FUOA 1AX0A 5JOYA 2W68A 4RA0A 1EPWA 3N36A 2EXJA 2ZAAA 4LBMA 2ES3A 4UW6A 2R0FA 1UZZA 4HL0A 1W6OB 1N3PA 2LALA 2NMOA 1LEDA 2VW0A 4U2AA 4AWDA 1WW6A 4AVVA 2AH2A 3WOGA 4KBBA 1HQWA 1CESA 1CN1A 1QOSA 4FPHA 4HANA 3A4UA 3M2MA 4XILA 4YGEA 2VW2A 1WUVA 1YRZA 2YXSA 2AREA 1N1YA 1JOJA 2DVFA 2A5ZA 3AK0A 1CIWA 4CRQA 3VKMA 3WG3A 2C5DA 3NV1A 4GA9A 1FX5A 1V6KA 2NZ9A 4K1ZA 5FREA 2E6VA 1KJRA 2CY6A 1KDKA 1QKQA 5CB7A 4M3CF 2WSUA 1DQ1A 2A6VA 4FP3A 4I30A 4Y26A 3WDWA 3OJBA 3N35A 4Y20A 4CTEA 4ATFA 3ZSLA 1G9DA 2GMEA 5T52A 1CPMA 3USUB 1ULCA 5DZEA 3U4XA 1N1SA 3OBRA 5JLVA 3RRDA 2ZHKA 5F9TA 2ZGNA 1D0HA 2ARBA 1LTEA 4ZXKA 1R1ZA 3R4UA 3AYDA 2PELA 5T5OA 1W6PB 1YYNA 1SLBA 4FQZA 1FV2A 1A3KA 3AYEA 5HCAA 3VUOA 2WNEA 3RSJA 2DUPA 2ZGOA 5AVAA 1PZ9A 5KXEA 3INAA 1CPNA 1S0JA 1DQ5A 1LHWA 4C1XA 3T1MA 1SCRA 4TYSA 2D6PA 2DYCA 1AF9A 4AGGA 2D7FA 1DQ4A 1RITA 2SLIA 3N7KA 5IT6A 2E53A 4DRVA 1MS5A 4NOTA 3UL2A 1GLHA 3B9CA 4R9BA 4WZFA 1HDKA 1S0EA 4ITCA 1FATA 3WDUA 3PJQA 1N3QA 1SLCA 4Q1RA 4Z8BA 2YROA 3QCWA 3W59A 1UZYA 2CWMA 4YGCA 1KQRA 4LBOA 3ZXLA 2ZMKA 3HMYA 4FOYA 2KM2A 5EYXA 3WCSA 1DZQA 3ILRA 1GZWB 4L8QA 2JE7A 4YFWA 3AYAA 4UW4A 1G8WA 5DG2A 3WG1A 4BQ1A 2DVAA 1LODA 1QNYA 1Q8PA 3W58A 2GNTA 3B00A 3D6EA 3N7LA 4Q2FA 4LBLA 2PHTA 4Y22B 1UX6A 4XXPA 1C1FA 3GNEA 2HYKA 4FOVA 4XHBA 1S0GA 2OVUA 2V5YA 2ZGSA 5E89A 1H30A 3ZVXA 2WJSA 5T5PA 4XE9A 3SH3A 2UU8A 4PF5A 4XJ9A 3C2UA 1WW5A 2A6YA 2ZHNA 3IMNA 3HR9A 3WHUA 3BOPA 4XHXA 1SLLA 2ZKNA 1TEIA 4XZPA 1LENA 4GALA 4Q1PA 4XBQA 3N3HA 2GDFA 2D3RA 1J1TA 1BYHA 1MZ6A 3RMYA 3V65A 4LBJA 4M01A 3SITA 1QF3A 1RINA 3AXEA 1ULFA 5GZCA 2V73A 5F5QA 1W6QB 2DUOA 1LULA 1LHUA 2I2SA 4Y1XA 1WBFA 1GKBA 4YZ4A 3UK9A 3V0AA 3AJZA 1SACA 1Q8VA 4FQ4A 1CQ9A 2UURA 5CNAA 3TAYA 2NYYA 2OUHA 2WT1A 1IOAA 3O12A 1W6MA 1MS9A 2E7QA 1ZA4A 3OBTA 3T1LA 1SFYA 1QDOA 1V00A 1IKPA 1ULGA 2G4IA 1NLSA 2DTWA 2CYFA 1D2SA 4IQPA 4XJAA 3V0BA 5T5LA 1MS3A 1WBLA 2OUJA 3M3EA 1FV3A 1GBGA 1F9KA 2PHXA 3AZXA 4YG6A 5E8AA 4GWMA 1G9BA 3LSEA 2VY0A 1JN2P 1AXYA 1ENRA 1AX1A 2CL2A 4RL7A 1ENSA 1QMJA 1W6OA 1BXHA 2ZHMA 3OYWA 1GANA 2VXRA 1G7YA 1LOCA 1OFSA 1WLWA 3NV3A 1BZWA 4LBKA 5IUQA 5JOXA 5IK5A 3OGGA 3POYA 4ASMB 1APNA 2YZ4A 1QGLA 2R16A 1DFQA 2DVBA 3IKWA 3ZXKA 2BQPA 1FNYA 1LEMA 2EALA 5CA6A 1IS4A 1DLLA 2DURA 3R4SA 3VKOA 2H0BA 3WUDA 4Y20B 2ZGQA 2DU0A 1F31A 3WZ1A 2ZGRA 4Y24A 1S0DA 3B3QE 3QLQA 4XYXA 4AGRA 3AP9A 1F5FA 1LJ7A 1V6LA 1A78A 3FLRA 3RMXA 2E51A 1LESA 4DFSA 3L2YA 1Y7BA 1V6OA 1N3OA 4FVVA 4XOGA 1G9CA 1VALA 3AJYA 1LOFA 5GLWA 1LECA 3O0XA 2ARXA 4R9AA 1QU0A 2DUQA 3UJOA 3VV1A 1LOEA 1ZM1A 2A6XA 4YZ1A 2NM1A 4XJ8A 2A7AA 4LBQD 1GV9A 2W39A 3WNXA 2GMMA 3MW3A 1UMZA 3AZZA 1UAIA 2YMZA 2CWSA 1ONAA 1SLAA 3MEPA 2P3JA 1LGCA 5DUVA 5T55A 5DXDA 3VKNA 4W65A 2D6KA 2VW1A 3MPPG 3IPVA 1LOAA 1SLTA 5JDBA 5JOZA 2PHFA 3N7JA 4M3CA 2R1BA 2UWAA 4DRRA 2DV9A 3OPZA 1G86A 3FLTA 2UWCA 5GLZA 3WCRA 3O0VA 5L73A 2FHRA 3WDTA 5GZDA 4BOWA 3AYCA 2AYHA 1SBEA 1S0BA 4FPJA 1Q56A 4YM1A 2D6OX 2ZBJA 1JXNA 2DU1A 1LHVA 3RQ0A 1JHNA 1MVQA 3H0OA 2CTVA 4XXAA 3SNMA 3ZXJA 4CZSA 1SBDA 1SBFA 4YG0A 3JUUA 2ZGPA 3KQRA 4WVWA 1LOBA 1PZ8A 3ASIA 4AVTA 2AUYA 1QOTA 3IN9A 4Y1UA 4PQ9A 2TEPA 1LGBA 5GLUA 1JW6A 3NV4A 3ILFA 1H9WA 1H9PA 1GYKA 1QNWA 3APBA 3OY8B 4FPKA 2EF6A 2ZABA 5KXBA 3Q9OA 1FNZA 3ENRA 1DBNA 4K1YA 1WW7A 4FOWA 1C1LA 3V64A 1GZWA 2GMPA 1GZ9A 2A70A 2D3SA 2P2KA 2GN3A 3PMEA 4YG3A 2ERFA 2JJ6A 4Q26A 2Q5TA 4XMIA 1O4YA 2CNAA 3DGTA 1UN1A 5GZGA 4YW5A 3WVJA 4PBPA 1W6NA 4XTMA 1WD3A 2P37A 3I4IA 1MR5A 1DQ0A 1QOOA 2Z42A 3POSA 1ULDA 4BLIA 1JBCA 2LTNA 5H9QA 5DUUA 1AJOA 4YGDA 3D5OA 1HKDA 4GKYA 4YZ5A 2FMDA 3AZYA 1I1EA 3SH5A 1VAMA 1YI7A 4FP2A 1WCSA 5LK5A 4JRAA 4FPYA 1V6MA 2DWRA 1IKQA 3BTAA 3LSDA 2DVGA 4PCRA 4NO4A 1JYCA 3M3CA 1GICA 2ZA9A 3FFZA 3BIWE 1LOGA 2W08A 1PZ7A 5DG1A 3WDVA 3V0AB 4YFZA 4ATEA 3KM5A 2GNBA 4JCKA 2B7YA 5CBLA 1HLCA 4WV8A 1LGNA 3AX4A 1AVBA 1VIWB 1VLNA 4P9WA 4XDQA 4P9XA 5GZEA 3POWA 3WDXA 4C1WA 1DGLA 4LBQA 1W6MB 1OKQA 1AJKA 3M3OA 2GN7A 1KJLA 4PBOA 3ZYRA 1GSLA 5KXDA 2UWBA 4BMBA 1N1TA 2GNMA 3V0BB 1LCLA 4XTPA 4FPCA 3R05A 3ZSKA 4YLZA 1BJQA 4YZ3A 2D6LX 5EWSA 4FOQA 5FRAA 3ZYPA 1VAVA 2PHUA 4UW3A 5CAZA 3JU9A 4H55A 3M1HA 2AGSA 1DIWA 1JYIA 4ZKTB 3IM0A 1DQ2A 1YXWA 4Q27A 5GM0A 1V6IA 3N7MA 1LOFC 5KXCA 3OYWB 1YO8A 3VKLA 3DUIA 5IK4A 3HN1A 4Y1ZA 3WG4A 4Q8KA 2XG3A 4FPOB 4GKXA 2JDZA 5T5JA 4XBLA 3FBYA 1ENQA 2ZGUA 2ZMNA 3O5SA 2AR6A 2R49A 1MS4A 1X50A 2VH9A 4AVSA 1KITA 5GALA 5JMCA 1I3HA 4YW3A 4FPFA 1UL9A 2AENA 4WVVA 1DYPA 2PHRA 3GALA 4UW5A 3UJQA 2A6ZA 3D4KA 1JUIA 3NV2A 2WKKA 5GZFA 2R1DA 4FPLA 3A0NA 2D44A 1MS0A 3AFKA 2JE9A 1FYUA 2WT2A 1LU1A 2EXIA 1Z78A 2W52A 5DZGA 1BQPA 3USUA 2ZHLA 4GXLA 4FPEA 5E88A 3TB0A 4YM3A 2RHPA 5DUXA 2OW4A 2ZGLA 3RS6A 5EXOA 4Y1YA 2ZACA 1FAYA 4R9DA 3AP4A 1CJPA 1G9FA 2WQZC 4GWNA 1W6PA 4AGVA 4ISRA 1V6JA 2P3KA 3WG2A 2EXKA 5EYYA 1DYKA 2GNDA 4P9YA 5DZFA 1V6NA 2WLQA 3A0KA 5H9PA 3M3QA 2SBAA 1SCSA 3PVEA 4F83A 3IPVB 5JVVA 1LU2A 2EIGA 2NMNA 4XMAA 1URXA 4LBNA 4M3CB 4OZXA 5IK8A 2D3PA 4YZ2A 2ZGTA 4P14A 4XJUA 3WUCA 4JC1A 2YY1A 3LCPA 4YM0A 5HCFA 5GLTA 2JKBA 3WV6A 3CNAA 1WLDA 2A3YA 2PHWA 1B09A 4R9CA 1N47A 5GLVA 2ZGMA 3NWKA 1BKZA 2D43A 1AX2A 5IK7A 4ISQA 5SV8A 1AXKA 1NXD1 3AP5A 4BM8A 3SLIA 4BPZA 1LHNA 3BODA 1MS8A 3ZSJA 1UKGA 5T50A 1CVNA 4K20A 1CONA 3PVNA 2JD4A 4M3CE 4XIKA 1GZCA 2R0HA 1CR7A 2VUAA 1AZDA 4YGBA 3PVOA 1MS1A 1U0AA 5HCBA 4D69A 1W0PA 4DPNA 3MW2A 1LHOA 5DUWA 1IS3A 1S1AA 5H9RA 4Q8LA 2NN8A 3ATGA 3T2TA 1A8DA 3FLPA 5GJ6A 3O0WA 4XJWA 5BYNA 1N1VA 4Y1VA 3OY8A 4BMEA 2DTYA 2WSVA 4YM2A 2A75A 3AZVA 4Y22A 1S0FA 2ZGKA 1O4ZA 1W6NB 1S0CA 2VU9A 2C9AA 2EXHA 2GALA 2A3XA 2P3IA 4XJZA 3WHTA 3RG0A 1AXZA 1KDMA 3FUQA 3ZPYA 3AP6A 1XQNA 2D6MA 3ZXEA 2WT0A 1MZ5A 1S0IA 1DQ6A 2A3WA 1OQ1A 3MW4A 1YIFA 4K21A 2A71A 4TZDA 3ILNA 1IS6A 3I8TA 2P34A 3B01A 1W0OA 3ZXFA 4SLIA 1IS5A
chains in the Genus database with same CATH superfamily
1V9U2 1K5JA 4FFGA 1AR62 1UWWA 1QHDA 4B1MA 2PAMA 3GZEA 4QHZA 5FZAA 4LO5B 1Q8OA 5CVRA 1G9AA 4OUEA 4DUXA 2F4PA 4UT5A 5CKMA 3SCFA 3IDEA 4CXXA 2VZQA 3VBFC 2MEV2 3EBRA 4QKBA 1NCRC 1OF4A 2EAKA 5K7PA 1W6QA 3W5NA 4K3UA 4MGZE 1ZRDA 1OUSA 4BQ5A 5BNOA 5FKBA 2HWF1 1R1A3 3NKTA 5C70A 2FDFA 1Q5OA 2FD8A 4MYEA 1F4HA 4BLJA 2DVDA 3ZN6B 1HQLA 1GNYA 1QDCA 1W39A 4CCOA 3RZKA 3WDYA 3WLUA 2Y6LA 2R073 3PU3A 3RZJA 1AX0A 4RA0A 3MLJA 1J83A 2ES3A 1J3QA 3W9AA 4ZU5A 4H7LA 2VTXJ 5F37A 3A7QA 3K75B 4FO9A 2WA4A 4XZUG 3S7IA 1N3PA 2LALA 4BXFA 3I54A 2Z4FA 5J7MA 2YPJA 1SPPA 4U2AA 1SEFA 2QBXA 5F3IA 3ZYIB 4UF0A 3WP5A 2WA3A 4MGIE 5FLIA 3WOGA 4C0HA 4YARA 1SFNA 3I2FA 4YGEA 4HANA 3A4UA 4LR4A 1RUE1 4Q4X2 4Z2AA 3GGLA 3BU0A 1E5SA 1JOJA 2VZ3A 3AK0A 3LDRA 3URFA 1C8M2 2FCUA 1H4GA 1W8ZA 4GULA 5FREA 2RE9A 3KVAA 2B9VA 4YW6A 5CB7A 1PO22 1QEXA 4EWAA 4I30A 1H0BA 4NUBA 3OJBA 2XL7A 3N35A 5AC93 2CGOA 4CXYA 4MX3A 5FJKA 5IVCA 4PDWA 1G9DA 4LK6A 3USUB 1AYM3 2RG4A 5DZEA 4L99A 1N1SA 2DCYA 3OBRA 4KWJA 5JLVA 3I2OA 2XJSA 5F9TA 2IUWA 1TNFA 1LTEA 4KWKA 1AYN1 3AYDA 3IAPA 2PELA 1F35A 4JKMA 1JUHA 3LAGA 1W6PB 3J7HA 5E6HA 3ZKYA 5FZHA 4CDWB 1SLBA 4FQZA 5BNQA 3HVDA 1A3KA 3B94A 1MZFA 4XFIA 1VE0A 1OI6A 1YJLA 4ZHNA 4XQ4A 4GB32 2VTFA 3DF0A 5LATA 3KGLA 1NE6A 1CPNA 4Q0PA 3LIHA 1LHWA 3LEMA 3VBUB 4AFCA 4C1XA 2WZ8A 3T1MA 1W03A 5FPVA 1UZ0A 2D6PA 5ERLA 4XF3A 2RJLA 1DQ4A 4CYDA 3ACIA 5J1XA 3E1F1 1UY2A 4DRVA 4EE2A 4I0BA 2FZ1A 3GBGA 1GLHA 4R9BA 4WZFA 1CX1A 1HDKA 2ZEXA 3KHCA 3OEAA 4UAPA 1SLCA 3ROUA 4AW7A 2XBO2 2BTVC 3MIDA 3VDDC 4Z8BA 3OF1A 4YVWC 2VNOA 3E5XA 4EWDA 3I3EA 2CWMA 4LHSA 1KQRA 3ZXLA 3S5AA 2ZEWA 3VHOA 4CPBD 3VBSB 5EYXA 3WCSA 2JD9A 1BBT3 1GZWB 4GMP1 4L8QA 4YFWA 4XACA 3VD7A 4QX2A 2XL9A 1K3IA 5A3NA 1QNYA 5FBJA 3DPRA 1FPN3 1UW8A 2WWSA 5JZGA 2QFEA 3BPZA 3D6EA 1VBC1 4KGQA 2PHTA 1I5PA 1QXJA 3IDCB 4XXPA 3I2KA 1QJX1 5FZBA 4OI4A 2LW8A 2V5YA 1BEV2 4XE9A 4DY5A 4XJ9A 2A6YA 4RN5A 1RUD1 2FCVA 3IMNA 4IV1B 5C9AB 3G7DA 2HWC2 4LHNA 2LS6A 4JHZA 5IAXA 1BMV2 5FYCA 2YDEA 1VRH2 4YVSC 3NAPC 2EICA 1W05A 4GALA 2C6SA 3JCIA 3POGA 4XBQA 4AVCA 2GDFA 4UFLA 4COWA 4ZXEA 1J1TA 1HXS3 4OQ8A 3WP3A 1EV13 4Y3OA 1OMIA 3RMYA 3U07A 1Y4WA 4QU1A 4F3JA 2WFF3 2VCCA 1FMD1 4AQ2A 4HETA 4TN7A 2QE3A 3WF2A 2VXJA 5C8CC 3WW4A 2DUOA 3ZPOA 1GQHA 1LULA 4Y1XA 4EN6B 4D94A 5K8SA 1WBFA 2QQLA 5EP9A 1GKBA 4YZ4A 3RNSA 1MEC1 2KD7A 4FQ4A 4IEQA 2OUHA 2RR11 1IOAA 2ET7A 3P5BA 3RFRA 4AEDA 3ZX7A 4E2SA 3N9OA 3SKJE 4JTNA 2XUEA 3CF6E 5FY7A 5IAVA 2G4IA 1IKPA 3DXUA 4G9SB 3V0BA 2DTWA 3MIHA 4IQPA 3X29B 2VZPA 2C1FA 1ALYA 1WBLA 1FV3A 3FHQA 1F9KA 4UFJA 2PHXA 4YYOA 5CKNA 1CZSA 5LB6A 4A41A 3LE0A 3LSEA 3VZLA 1VJ2A 1JN2P 1GWMA 1PO11 3DYPA 1J59A 4QPIC 4OHZA 3M8LA 1R64A 1ENSA 1FOD2 1QMJA 5FV3A 4NIGA 1BXHA 1NA1C 4MG2A 5KC5A 3VDAA 3E6DA 5IUQA 2VVDA 2BV4A 3OGGA 1ZRFA 3IKWA 1QGLA 2R16A 4JDMA 2WQ8A 5D8AB 3VBFA 1UNBA 2Y6JA 3JXSA 1NCRA 1ZYBA 2EALA 3D0JA 5A32A 2FDHA 1RHI2 1J1LA 4QDQA 2Q8DA 2ZGQA 4GH4C 5K4LA 2HWD2 1V9U3 5FIXA 4AHXA 1S0DA 3QLQA 4QXCA 4GIQA 4MZUA 4XYXA 4HOOA 1AR63 5FPZA 3S6PA 4AL9A 2K0GA 1LJ7A 3FLRA 1A78A 1AR82 3C7EA 3H42B 1LESA 3RJ2X 3L2YA 3MGUA 3VBRC 1Y7BA 1V6OA 4HXCA 1G9CA 1AL0G 3T4HB 1VALA 2MEV3 1SHWB 2GC2A 1LECA 3D82A 3O0XA 4FFHA 3MLKA 2OPKA 4I0WB 1W28A 1QU0A 3K51A 5AC91 2DUQA 4P9IA 2DF7A 2VTXA 3FZ3A 4IGQA 2CGNA 4XJ8A 3AL5A 1PMHX 1KFUL 4QB1A 3UGFA 4NIAA 1UOGA 2HWE3 3WNXA 3UKTA 5JXIA 2HWF2 4QKNA 3WEZA 5IVEA 1OQEA 4QM8A 4A45A 4WVZA 1SLAA 4NPRA 1IPKA 2BWCA 2X09A 2Q8CA 4QHOA 5C3RA 5FMBA 5JDBA 5JOZA 1GUIA 2VZTA 3FX3A 5HXVA 4ZZ8A 2DV9A 4QQHA 5I0DA 2CAVA 2CAUA 5GLZA 3WCRA 5C9AC 1POQA 3LEGA 3WDTA 5GZDA 2DBIA 3AYCA 2GH8A 2AYHA 2QQVA 4EN7B 5LW9A 1HRV1 2D97A 2D6OX 1JXNA 5C3PA 1RUE2 3SKVA 3H0OA 3R4DB 3CIHA 5KBFA 4IDZA 1SBFA 1C8M3 3JUUA 1UPIA 4J6GA 4XDOA 1YC61 1LOBA 3AFGA 4GAZA 4P9GA 2AUYA 2XHNA 3W20A 3PIJA 2TEPA 3QH6A 4AAXA 4QDRA 1C5HA 3NW4A 1PO23 2J1VA 2H0VA 1GYKA 1W2UA 4FPKA 4COYA 5KXBA 1DGWA 2V5DA 1FNZA 4CEWB 4AI3A 3NL1A 1K5MC 4FTBA 4Q4Y3 2GMPA 1GZ9A 2VQ0A 4YG3A 2YC2A 2E9QA 3AMNA 3WSOA 2Q5TA 4CP9B 3DGTA 3NQHA 2ZX0A 4OI0A 1JYVA 4A3XA 1NLRA 1AYN2 4QD2A 3OUIA 1WD3A 3P6BA 4AQ6A 4D7TA 1FPN1 3AKQA 4IEUA 3POSA 1NOVA 4SBVA 3ST7A 3K4ZA 4UWDA 1JBCA 3ZIWA 1AJOA 3D5OA 1IPJA 2FMDA 3C7GA 4X8NA 4XFFA 4UOJA 1XE7A 2VMIA 5APAA 4GB33 2XQRA 5LK5A 1LAJA 3VDDA 5IWFA 1GMMA 2ZX3A 1D0GA 3J8F1 4YVWA 2GP5A 2DVGA 3UGHA 3PUAA 1ACCA 1GP5A 4N53C 3I2IA 3BCWA 3FFZA 3D3AA 4HN1A 5A1LA 4CCDA 1GZTA 5DG1A 3WDVA 1ND2B 5A3WA 3KM5A 3JB4C 4IEYA 2Q8EA 2QQNA 3MUY1 4YFZA 5BNPC 4AE2A 4WV8A 1EV11 4P9WA 3K3OA 5GZEA 4N9IA 3WDXA 4Z07A 4XF9A 4AI0A 5B4NA 2WFF1 2XBO3 2CSGA 3QH7A 3KCXA 1YFUA 4AI1A 3ZYRA 1STMA 4N8MA 3ELNA 4NHXA 5FR3A 5KXDA 3NNJA 3ZN6A 4XTPA 2FQPA 3R05A 1PIV3 4UXAA 2C9KA 4ZS2A 4YLZA 2JG9B 2YFZA 5CAZA 4LO6B 4QGLA 4FOQA 1VAVA 3OPWA 1W8UA 4JGYB 4XCAA 4P9LA 3M1HA 2AGSA 3DYMA 4G4FA 4LPLA 4RHV1 1DQ2A 3KT1A 5FPLA 2W2IA 4WBBA 1XBFA 4EV0A 1WKYA 5KXCA 1HX6A 1VBC2 2BGPA 3HNBM 1B35B 2VQAA 3OYWB 5JAXA 5C3OA 3WG4A 4GKXA 3LDBA 5FJHA 4XBLA 3GCWA 1QJX2 2ZMNA 3O5SA 2AR6A 4AVSA 1KITA 5A6XA 3DKWA 3BGAA 1I3HA 2BVBA 2BRTA 1RUOA 1RUD2 4EROA 5LEKA 3K2OA 3Q8AA 4H7MA 4PDWB 4LO7A 2XLFA 1VRH3 1JU3A 4MV2A 2A6ZA 1POV0 1QY4A 2BVVA 3IT8A 4NHLA 5FZ9A 5A7QA 3ZYGA 2EVXA 5CG9A 4QT6A 2WO3A 3GHNA 1W99A 5FZFA 2PXJA 4Q5OA 2VAUA 2WNUB 5C4WB 2EXIA 2W5FA 1OOPB 4N43B 1QH7A 2ZHLA 3USUA 2V4VA 1ASJ3 4CEYC 3O1UA 1LRHA 4I3GA 1FMD2 3AMMA 2OW4A 4D7YA 3RS6A 3TYJA 1NKGA 4QPWA 1FAYA 3MUZ1 2VQTA 4I02A 3I7DA 4HPKB 2P6HA 2WNVC 1EPZA 1W6PA 4ISRA 1PNFA 1MEC2 4CDWA 4AI8A 3PJYA 2RR12 4P9YA 3GM8A 5H9PA 2WR9A 4EZHA 1W8OA 1H1MA 4WM7B 3VHPA 5A1AA 5JVVA 1HB3A 1LU2A 2EIGA 4XMAA 3VD3A 3ON7A 5IK8A 4OZXA 2VO5A 3NO8A 4YZ2A 2ZGTA 3IBMA 4NROA 1VBD1 1JYNA 2VMGA 3WUCA 1R093 3ZSEA 3ZFGC 2HWE1 2XVKA 5F3CA 1JZ2A 1W9FA 1WCDJ 1WLDA 2A3YA 5FY8A 4IV3C 1PO12 3SHRA 5GLVA 4IE5A 2D43A 1AX2A 1FOD3 2ZZQA 4PT6A 4BPZA 3C7FA 3MFAA 1LHNA 2P1BA 1AL21 1MS8A 2WYSA 3J7MA 5IVYA 1D7PM 4NRMA 5FZEA 1Q43A 3FMGA 5JXJA 3O1PA 4NIDA 2QQJA 4LLFA 5JIAA 1OSGA 1WCQA 2R0HA 2J1TA 4RQPB 3VBSA 4YGBA 5FYUA 2RS31 1MS1A 1RHI3 1W0PA 1CX4A 5DAXA 2QNKA 1FI2A 1ND2C 3ALQA 1YFXA 3EJKA 4JTOA 4V2VA 5LBCA 3B93A 1JH5A 1A8DA 2W9XA 4LEJA 5DMYA 2IXHA 1UU4A 2ZX1A 5FZKA 1NUKA 5CFDC 5ABJC 1AR83 1I9RA 3S7EA 2B4KA 3OY8A 2BERA 4BMEA 2D5HA 2WSVA 3VBHB 5FUNA 3AZVA 2VOWA 3SQOA 5A7PA 2ZGKA 1W6NB 4S2GA 4DY3A 1GP6A 2VQUA 5F39A 2C9AA 2EXHA 2GALA 2A3XA 2BP6A 2P3IA 3NMBA 4H14A 4XJZA 3RG0A 1KDMA 4E2GA 1F8VA 3ES4A 1DGRA 3ZXDA 1W9YA 4IV1A 3LKJA 4RFT0 1DQ6A 3VN4A 5AC92 5C9AA 1O3QA 1DDLA 4UBGA 1IS6A 3QD6A 2PHLA 1W0OA 4OUSA 4HFSA 5D1IA 5C5UA 2ZKLA 1I5ZA 5BNNC 3I3MA 3I2JA 3DL3A 4I01A 3B7MA 4CDXB 2VECA 4LHLA 4NRQA 4XAEA 1GWKA 5FMCA 5FZDA 1KRIA 2DFCA 5F5AA 2R043 2DDUA 1HB2A 1SDDB 2QZ3A 4R4ZA 4DQAA 5FO9B 2YV8A 1S2BA 2W95A 2XHKA 1RUI3 2ZMLA 3WF3A 1SLIA 1GNHA 2ENRA 1W2AX 1W9TA 3AZWA 4XIOA 4GB31 4GMP0 3SISA 2JECA 4YW4A 1W3XA 3VKFC 1H2KA 5LRRA 4AVBA 3SCGA 3O1MA 4U36A 1RIRA 1HRV2 3KCCA 3KZ4C 4XBNA 1H2MA 2A73B 3WW2A 2W87A 1O6UA 3JZVA 1C57A 1WLCA 5JOWA 1OLRA 3FUOA 2X5IB 5JSOA 5JOYA 2W68A 3ZIXA 4N7UA 2BGCA 1CGPA 1OOPC 1QQP3 2C24A 1PGSA 4IETA 4N43C 5KHGA 3VZKA 4ZPIA 1XRUA 1KEXA 3PU8A 4HK8A 1UXZA 2ADEA 2WZR1 4Z82A 4ZU4A 4BISA 2WABA 4AWDA 2X29A 1QXPA 5FTTC 2RDRA 3S30A 2B8MA 2OIIA 1CESA 1CN1A 1QOSA 1ZRRA 1HB1A 3M70A 4FPHA 3VLBB 1PIV1 2IC1A 1WUVA 2BJSA 3RZLA 1UU5A 1RL3A 1U12A 4M0NA 1JYWA 3IDAA 1E5IA 4HVRA 1CZVA 5KHKA 3FL7A 4QKDA 4BJ0A 3VKMA 1AYN3 5FLJA 3NV1A 3C7HA 2ET1A 5C71A 1XYNA 1FX5A 1FPN2 3KV4A 3RVHA 2IVJA 5BNPA 1VB4A 5D8AA 2JDUA 2WSUA 1IGOA 1ZZ9A 3JQWA 2CGPA 3BTZA 4CTEA 1IQAA 2OX0A 2G9GA 2OXBA 5FZMA 2GMEA 1J3PA 2WWJA 3J8F2 3KT4A 4HVOA 1F5JA 1EUTA 3T2OA 3U4XA 2VZSA 4FFIA 2WO7A 4A4AA 3RRDA 4EN8B 4PIYA 2ARBA 4XQDA 4B1LA 2P3YA 4AFDA 1VBE3 3WNMA 4S2HA 4RQPC 2W47A 5DAPA 1YYNA 1EV12 1C8NA 2R061 5FYBA 5B2GB 5DAVA 2WNEA 2WFF2 2W1SA 3RSJA 1ASJ1 1XNAA 3ZFFB 5FY9A 1O7FA 3ZDSA 1S0JA 3MF9A 2CDOA 1DGRN 4QX8A 2I07B 3PUHA 4PQQA 1COV3 5HV4A 2DYCA 5HI0A 2I74A 3O14A 1AF9A 1YWKA 5K9YA 5LWBA 5IT6A 4RHV2 4NOTA 2R7EB 2VE1A 3B9CA 4WZCA 4QQ2A 2WINB 5FP3A 1VBC3 1N3QA 1DU3D 3H8OA 1VPHA 3Q8BA 1WMFA 2YROA 2R6QA 3W59A 3LPGA 2VNRA 1R091 2FCTA 2ZMKA 3OB8A 4CUBA 3HMYA 2PTMA 3U37A 3SMHA 5A3PA 2YBSA 2JE7A 3MI8A 3HBZA 1ZZ6A 3WG1A 2VMFA 3LOIA 3MHZA 1M4WA 1UQXA 3GHMA 5HXMA 1LODA 2HH9A 2WFPA 4RR3C 3W58A 4LXLA 5KHHA 4QX5A 3THDA 2W0XA 2WBKA 4CEWA 1ODNA 1WMEA 5F2WA 3U78A 4Y22B 4A44A 5A70A 4A7ZA 2HYKA 5E89A 4QX1A 4IEXA 4B4QA 1H30A 2WJSA 4WM8C 3K4DA 1FMD3 2UU8A 4PF5A 3MO4A 4CP9A 2X5IC 3KF5A 1DCSA 4JQRA 1SLLA 2DCZA 3KCYA 4YVWB 1TEIA 4XZPA 3QOPA 3N9PA 1AR81 5L9RA 1MEC3 4IV3A 4I3PA 4CUCA 2ZCWA 1QWRA 2HEWF 2YGMA 2RR13 3KHBA 3N3HA 3OEBA 4RGGA 5FZIA 3LB9A 4INDA 2IXJA 3KF3A 1QH6A 1ZVFA 2OA2A 3SITA 4YW7A 4K8FA 1QF3A 4FI9A 1WMXA 1ZZBA 3AXEA 1ULFA 2IVIB 1VBD2 5BXXA 1DP0A 1RUH2 2IXLA 2W92A 5F5QA 1U5XA 3ACFA 1K12A 3OBZA 5FP7A 1LHUA 2HWE2 2I2SA 2HEVF 4J25A 3UKVA 4DNYA 2UYBA 2WZEA 3MPBA 1ND2A 1PVXA 1MPXA 1PO13 2KA3A 4CDUC 1H4HA 1Q8VA 4LA3A 4QXKA 3TAYA 4DZGA 2WT1A 3O12A 2W46A 4XUOA 4NIHA 4QPYA 2R041 1H2NA 1MS9A 3THTA 3OBTA 4YVSB 1AL22 1RUI1 1UYPA 2O14A 3NAPB 4XC9A 5F3GA 4BH9A 5IW0A 1SFYA 3TOJA 4MLOA 5LEJA 1OH3A 1YI9A 3D0SA 2F17A 4XJAA 3UETA 3LA7A 1MS3A 1EY2A 2JG9A 5FYSA 5I8YA 2RS32 4Q0QA 4E4SA 1LB2A 4JGYA 1JOBA 4DOUA 1VMHA 5FZCA 5JWPA 2B42B 1AX1A 1AUYA 3LFIA 5C8CB 2FMYA 1GQGA 1HRI3 4FAGA 3OUHA 3CQOA 2ZHMA 3H8RA 1B35A 1T6GC 1QQP1 3MIEA 2JDPA 3OYWA 1LOCA 4K8RB 1OFSA 4QQLA 4LBKA 3ZFFC 5JOXA 2LROA 4CPBA 2XONA 2YZ4A 3OPTA 4XABA 2OPWA 3MFCA 4ARXA 1LEMA 2Q1FA 2DURA 3NNFA 1SG3A 1DZTA 5J37A 2VOVA 1ZZCA 2XLAA 2K2SA 2G9ZA 2DU0A 4Y20B 3WZ1A 4CA9A 1YQ6A 1A6CA 4HZFA 1RVF2 3B3QE 4Y24A 1Y9MA 3VZMA 4AGRA 4DINB 3AP9A 1HIXA 1F5FA 4BQ2A 2E51A 4XUTA 4COZA 4DFSA 4Z2WA 2WNUA 5AVPA 3VBOC 5C4WA 4QPIB 4IEZA 1N3OA 1OOPA 1NY71 4N43A 4QWNA 2ZPXA 5GLWA 1NA1B 1HB4A 1AHSA 3VV1A 1JYXA 2A6XA 1W8TA 2OQ7A 3OSDA 4HPKA 1RTVA 2A7AA 1W2NA 3PNAA 1HJFA 1HRV3 4LBQD 2GMMA 3MW3A 1UMZA 3VZNA 4E4ZA 5C8WA 3BKZA 5EIYB 1XNCA 1UAIA 1ZREA 2YMZA 1YQ5A 2AACA 3J7LA 4OI2A 2PHDA 5F6KA 5J36A 2CU5A 2P3JA 2Q0AA 5T55A 2QJVA 1VBE1 4G3YC 4GH4B 3VKNA 4FT8A 3B5LB 4WM7A 3ACGA 2D6KA 3WF1A 1FXZA 5J98B 1LOAA 1YQ2A 2VUDA 3WNOA 2PHFA 1A34A 1OH4A 4DRRA 1YQ8A 3OPZA 1G86A 4QGMA 4EN9B 2UWCA 2WZR2 1L7LA 2FHRA 3T4VA 3GZTB 5FLHA 3VBRB 1Y9GA 1SBEA 1Z7S3 3HJRA 1Q56A 1YLLA 3JQXA 4BU2A 5L7OC 2D40A 1COV1 1OPMA 2PMWB 1PIV2 3MDPA 4MXWB 4XXAA 4BIFA 2CTVA 3POEA 3ZXJA 1SBDA 1BLZA 2ORXA 3OD4A 1F2NA 2PQQA 1W9SA 1ULPA 2ZGPA 4RD7A 1XXNA 4AFMA 1QOTA 3E5QA 2W3JA 4PQ9A 1LGBA 3H50A 5GLUA 1W8NA 4OI1A 2RMU1 4RQPA 5LA0A 3ILFA 1H9WA 1BHGA 3OY8B 3H3ZA 5FZOB 3OBAA 3BTXA 2JEMA 1OKOA 3NJYA 3Q9OA 1OHFA 1WW7A 3EO6A 2IZWA 2PN5A 2PLV2 2VCAA 3J8F3 2A70A 4CU8A 4HKWA 2JJ6A 4XMIA 5DQ0A 1JS9A 2VC9A 5E1RA 3VBHA 1ZRCA 4YW5A 2OQ6A 2E7AA 4XUQA 5FY4A 3WVJA 1W6NA 5B4XA 3MIGA 3KV5A 3RDIA 4QB6A 4PIZA 1QOOA 4IE6A 3PMSA 2HBTA 1ULDA 4BLIA 2ID4A 4QX0A 2XJVA 2R062 2VZ1A 2LTNA 3FC0A 4XF4A 4YZ5A 1HKDA 1I1EA 3ETPA 3AZYA 3WQ1A 4BDVB 1XE0A 1VAMA 1YI7A 3OGVA 3NNLA 4XDPA 4JRAA 5FWJA 1W9WA 1ASJ2 2W1UA 4FPYA 1V6MA 2P4EA 3LF7A 3BTAA 3LSDA 3OOXA 4CDQC 4OHYA 4PCRA 3PHMA 4CDXA 1JYCA 5A7NA 2ZA9A 1K5MB 1NLQA 2R32A 3BIWE 2VJXA 3N9MA 1Y43B 3L9JT 4ATEA 3ACLA 2WL1A 4RHV3 4JCKA 4OHXA 5CBLA 1QJY3 3IB3A 1VLNA 1VIWB 4BZ4A 4RR3A 3U1XA 4PI2A 3U75A 3POWA 5JXHA 2WYFA 1DGLA 2QQMA 5FAXA 4BQWA 3BIEA 3BI3A 3T2PA 2LUWA 2GN7A 3K46A 3NNMA 2GU9A 1KJLA 3EXUA 4LE3A 4BQ3A 3TEZA 3O1OA 4Y4YA 3VZOA 1GSLA 1R092 1N1TA 2PYTA 1IHMA 4BK5A 4K40A 2QKDA 1UZWA 3MV11 5FXXA 3ZSKA 5FMDA 4YZ3A 3T3YA 2D6LX 4Q0UA 2X5IA 4UW3A 3JU9A 3PUIA 4XFBA 1UY3A 4IE7A 4Q27A 4N53B 1S2EA 4LKFA 5FUPA 5GM0A 4CUAA 2VBPA 1LOFC 3VKLA 2XJRA 1L3JA 3OD0A 4Q8KA 1LKNA 4OVEA 4FPOB 5T5JA 3WX5A 4A2UA 1XNDA 5L9BA 2EAAA 3H1WA 3LWCA 1H8VA 3OGSA 4P02B 3WF0A 4HVQA 2HEYF 2VH9A 3Q8EA 5JSPA 5GALA 1O59A 3A21A 2HJIA 4FPFA 4OMDA 1UL9A 2AENA 4B3NA 4DIQA 1DYPA 2PHRA 3CJXA 4W8JA 1I6XA 2EIBA 4COUA 1XU1A 2WC2A 4UW5A 3UJQA 4QKFA 2DCTA 4TSVA 1XNKA 1HRI1 5T3NA 3D4KA 3PUSA 3AMPA 3WT3A 5FY1A 1W3VA 3WNPA 3HD8B 3WQ7A 3ZDVA 2Q30A 1OQDA 2VUCA 4FPLA 3NJZA 3A0NA 4O65A 3ZKUA 1MS0A 3AFKA 2JWPA 4C0BA 2JE9A 1UMIA 4ZONA 1Z78A 1YJKA 3WW3A 1VMFA 1XPWA 5DUXA 1VBD3 3POJA 2ZGLA 1PK6C 1RUH3 5FZGA 4EJRA 1UKRA 5FXZA 1SDWA 4D7SA 1DZRA 2ZACA 2WWUA 1CJPA 4AGVA 3NKGA 4FBFA 5CFCC 2GC0A 3WR0A 3H7JA 1V6JA 4B29A 3WG2A 1GOHA 2GH2A 4CCNA 2R042 3JD71 1V6NA 2WLQA 1O3TA 1PGL1 1AL23 3M3QA 1RUI2 1JODA 4K9SA 1HJGA 1DG6A 3LQCA 3ZFFA 3IPVB 5EJ3A 5FK7A 3VZJA 1URXA 3TNPB 4L2NA 1RUC1 2B9UA 2J22A 4KU7A 3BUCA 2RS33 5FMOL 1VBB3 4LA2A 4LHKA 3LCPA 5GLTA 2JKBA 3CNAA 4IEOA 4J1XA 2XWJB 4CEYB 3JBG3 1IPSA 4LKEA 5FMOS 3MICA 4IERA 3HIFA 2Z69A 1NXD1 4FCAA 1PX3A 3ZR5A 1SQ4A 1QQP2 3BODA 2WO1A 2E33A 2WNVB 3ITQA 3RI9A 1UKGA 2ETEA 1CVNA 1CONA 1E57A 5LA2A 5C33A 2UYAA 2YB7A 4M3CE 1TME1 4XIKA 1GZCA 1RUG3 1CR7A 1XSRA 4NMIA 1Z7S1 1AZDA 1PX4A 1WA6X 4DPNA 2WAOA 4IXLA 4NPMA 4D69A 3M4FA 4BA6A 2BYVE 2JB4A 1S1AA 2PFWA 2Y33A 3PTRB 1ZRIA 5A6ZA 1TNRA 1RVF3 3ATGA 3BPSA 3T2TA 5IYYA 4OQ9A 3O0WA 4JX0A 5ISLA 1RYYA 3ZFGB 3F95A 3BVCA 4YWAA 1NCQC 4COVA 5LCWL 1WA4A 3BYWA 1IG3A 1BCXA 2HLEA 4Y22A 1S0FA 4IV3B 1S0CA 2WAAA 4Q4W3 5FYHA 1NY72 3S0MA 1MQTC 3ECQA 3LPFA 3LDKA 2FDIA 3AP6A 2D6MA 5F2SA 3ZXEA 3MLLA 4K21A 2A71A 4TZDA 2BBVA 1O8SA 5BY5A 3UGGA 2RS13 3SH5A 2XOMA 4R52A 3ZR6A 3AP7A 2XB6C 4J1WA 3ZSMA 3SC7X 2OZJA 4OUMA 4AEMA 2G9FA 4E8DA 1ZBA3 4YW2A 5FO8B 5FK8A 2Y60A 1VBE2 3GZAA 1GOFA 2ZAHA 4QX7A 2I45A 2VPVA 3O1RA 5IHRA 3GYDA 1JI6A 3RI8A 3ZYHA 5BNPB 3KT7A 2BEOA 1UX7A 5CFDB 5ABJB 1WD4A 2E7TA 1UO9A 5I93A 4QDSA 5T54A 1Z0HA 2WZR3 4M00A 3GBFA 4AYUA 4LBQB 1O5UA 4YW1A 1C4RA 1J3RA 3Q8CA 3TWIA 3AB0A 1PMJX 4TXWA 4AOCA 1MACA 4FPGA 5FQ0B 1GNZA 3IIAA 1COV2 5CADA 4Q0VA 4HLTA 1H2LA 3B69A 1K45A 5A80A 5FYZA 4DS0A 5JCTA 5FYYA 2ZZJA 2D6NA 1Q8SA 2AZ5A 4YVSA 3RYPA 4C8DA 3NAPA 5E16A 1QJY1 3N36A 2EXJA 2D5FA 4LBMA 5BNNB 1RMU3 1UU6A 1UZZA 5EHDA 3ZFEB 4A6SA 2RMU2 1WCUA 5FCCA 5IVVA 3T0DA 2NMOA 3T09A 1K42A 1LEDA 2WIIB 5C7GA 2PLV3 1HQWA 1L7QA 4MGSA 4GJYA 3M2MA 4CE8A 4CDQA 2YXSA 1O4TA 2BGOA 4JHTA 2AREA 2JG8C 5D21A 5C8CA 3U14A 1N1YA 5FZ1A 2A5ZA 3ES1A 1CIWA 3KV9A 1QJFA 2ORZA 3WG3A 2C5DA 5M0TA 2FDJA 4GA9A 5L9VA 4JAAA 4TLFA 1V70A 4K1ZA 4V1PA 4M4RA 4GJZA 1DYOA 1U5YA 1KDKA 1O91A 1QKQA 2CY6A 4A7KA 4M3CF 2R063 5ACA3 3K4AA 4DXTA 1DQ1A 3S57A 3EHKA 4FP3A 5CG8A 1D4VB 3RWNA 1X8MA 1XC6A 4UFHA 4Y20A 3VB9A 3TBDA 2E32A 4ATFA 3VD4A 3VHRA 4Q29A 3ZSLA 3DCQA 5T52A 1CIYA 4ZU7A 4HSLA 2E31A 3H3LA 5CKQA 1D0HA 4KU8A 3CJIB 4ZXKA 5IFTA 4XQWA 4QPIA 2Q4SA 5F6LB 3POBA 2HKXA 2WS93 1AR93 5I0RA 1NA1A 1JMUB 2G19A 2XDVA 1CAUB 3L2HA 4AEKA 2NPIA 5HCAA 3VUOA 1NG0A 3OGJA 4NWVA 4BQYA 2ZGOA 4KWLA 1RUH1 2XR4A 1PZ9A 5KXEA 2GZWA 1DQ5A 2XPJA 1ST8A 3IAQA 4W4ZA 2YPDA 4TYSA 1UF2C 3R0RA 4GH4A 2XJUA 5FZ0A 4JGZC 1PVC3 3N7KA 1RITA 2SLIA 3RPQA 2E53A 1MS5A 5A3OA 2QQKA 3N9QA 5FPUA 1S0EA 4ITCA 4P00B 3WDUA 3PJQA 2VD7A 3ZYJB 4BXSV 3VBRA 4K6BA 4I0AA 1C3HA 3QCWA 4MXWA 1UZYA 1OA3A 4P9JA 5FP4A 4LBOA 3W5MA 1E5RA 1VBB1 4W50A 1WZXA 4FOYA 2XQXA 1DZQA 5GKAC 3JBG1 4D8MA 2PA7A 5FOBB 1X33A 5DG2A 4BQ1A 1HRI2 2DVAA 5CFCA 4B4RA 5FZOA 1TE1B 3NVCA 2CDPA 4CP0A 5AFEA 5J09A 1JHJA 2IXKA 4LK7A 4META 4LKDA 1OPOA 1QJZA 5BV6A 1JTZX 4FOVA 2JKXA 1RUG1 4Y33A 5FFOC 2ZGSA 1MZEA 3ZVXA 1SFPA 1EUUA 3RYKA 4MH0E 3SH3A 1WWYA 3C2UA 1WW5A 3KSCA 4LUKA 3U10A 1BK0A 2BOJA 1UYYA 3VDBA 3BOPA 4NWWA 4XHXA 1RVF1 4D6RA 2FBEA 2ZKNA 1WGPA 4ARYA 5A3TA 3ZFEC 4ES8A 2ZEZA 1LENA 2AEYA 2YFUA 4B8EA 1W0NA 4OMCA 1X36A 3KLSA 2VUJA 1UOJA 2H6CA 2Y8KA 3JD72 4Q4W1 1KS5A 1PGL2 3V65A 5FKCA 4LBJA 5FY5A 2VZRA 4IL7A 4RR3B 5F7UA 1XNTA 1RUC2 1JOPA 2Y6KA 4QXHA 3EQEA 5GZCA 4BE3A 1UZVA 4CU9A 2RS11 1TMF1 5FDBA 1K5MA 2P6CA 3BALA 4IGPA 3VD9A 4JRLA 2VBBA 4XFCA 4IEWA 3AJZA 1SACA 1KXGA 1ZBA1 3K77A 4WM8B 1CQ9A 3ZLIA 3CEWA 2BZDA 4QMAA 3T30A 4L97A 5KWRA 3DECA 1ZA4A 2QQUA 3T1LA 2OS2A 3H8XA 1ND3B 4QB2A 3ACHA 1QDOA 4EQVA 4HSJA 5F1RA 1NLSA 1OD3A 1TME2 1D2SA 4HKOA 4Z92B 1WLTA 2PAKA 4XW3A 4LOSA 5T5LA 5HPOA 1Z7S2 3CJIC 3HNMA 4OZOA 4XFGA 1GBGA 3N9NA 4YG6A 2JDNA 5E8AA 4DB5A 4BHPA 1RUJ3 1U5IA 3OCPA 3HNYM 1G9BA 4NHKA 2QUOA 1AXYA 1OVSA 2J42A 1ENRA 4W6WA 2QTWB 3MIBA 4N53A 4RL7A 4N90A 1OVPA 1W6OA 2VXRA 3HT2A 4P08A 3NJVA 2W1QA 1GU3A 1RMU1 1WLWA 2E26A 4CDUB 5IK5A 2Z5WA 1D4M1 4YRDA 1UYXA 2WN3A 3POYA 4ASMB 1APNA 3ZXKA 4DO0A 3I59A 5FZ7A 1S2KA 1DF0A 1FNYA 2BQPA 5CA6A 3HWJA 4KWUA 5BPXA 1IZ3A 2PLV1 1REDA 3WUDA 1LNSA 3QACA 4OHWA 1QJU3 2MHFA 2X05A 3U0ZA 1F31A 4CCLA 3LEIA 1O5LA 4IEPA 2D93A 2ZX4A 3AKTA 4PI0A 5CZKA 2RS51 2V4AA 2X53S 4CP1A 3MF6A 4P5HA 3RMXA 1PGW1 2O0OA 3OTFA 4QAWA 2F4LA 4RSUA 4TWTA 5ACA1 4XOGA 4D3WA 3TN91 2DFBA 1TG7A 1UCXA 4RS5C 2RDQA 3PDQA 3HAGA 4AXOA 4R9AA 3WXPA 4LOTA 2IFRA 4QX3A 5CISA 3UJOA 1TQ5A 3K3NA 1LOEA 1ZM1A 1LR5A 3A23A 1ZBE1 2NM1A 4CU6A 1X82A 1GV9A 4JDNA 3ZOIA 3ZXGA 2RM21 3ME2A 4OLLA 1ONAA 2HWB3 3WQ0A 4YSFA 2B39A 3DPRC 5JZGC 1LGCA 4AQSA 2BOIA 4QQOA 3VL9A 2JICA 3D8CA 4W65A 3H9AA 1QJY2 2WS91 1AR91 3IPVA 3MPPG 4CU7A 1SLTA 2ILMA 3N7JA 4XVHA 2RMU3 2R1BA 4IGOA 3THCA 2JDHA 3FN9A 3O0VA 1VMJA 5L73A 1OA2A 3FWEA 3VBOB 4AFAA 4BOWA 2GSYA 4CEYA 4ET7A 2ZBJA 4ZZ5A 1ENXA 2DU1A 2JDYA 3VGIA 3RQ0A 1JHNA 5FXVA 2XVLA 3SNMA 4CZSA 4FTSA 4M0HA 4YG0A 2FDGA 1PVC1 4N7IA 4NRPA 1XB9A 2WNVA 4WVWA 3ASIA 4AVTA 4Y1UA 2GP3A 4F7ZA 4Y5Z0 5F8PA 3TRSB 4CSWA 5I8TA 3NV4A 1QNWA 1H9PA 2J1RA 3APBA 5F32A 3W21A 2ZABA 3E97A 5I91A 5FZ4A 1UY1A 5LBFA 2J7MA 1DBNA 4AHYA 5KC6A 3I97A 2ZX2A 4K1YA 4NHMA 1C1LA 5FYIA 4BYYA 1W8HA 2Y6FA 3V64A 1AR73 5A6YA 3J9SA 3PMEA 3ZFGA 1YQCA 5LRSA 5A6QA 1TVGA 1O4YA 1R083 5HCHA 1UN1A 3AL6A 1ND3C 1US2A 4PBPA 2MNGA 4XTMA 2P37A 4QGNA 5L7OB 1Y9QA 1MR5A 2Z42A 1WMDA 4LKSA 2KR2A 4XEZA 2JX9A 1XSQA 4O61A 5EZWA 1PM4A 4YGDA 3GCXA 1VB2A 3GJBA 4FP2A 1WCSA 2L9LA 3ZYFA 1C5IA 2DWRA 1IKQA 1QIQA 4L9BA 2XJTA 4LORA 2YUEA 1CAXB 2P17A 4MGTA 4NO4A 3FBMA 5FYTA 2IXCA 4WVMB 3HOBA 5LZ6A 4IESA 2Z2SB 4HKLA 2W08A 3VD5A 3V0AB 5CFDA 2Y38A 1CAVB 5FXWA 5ABJA 5LY1A 4FSJA 1HLCA 1YNAA 1LGNA 2VCMA 3HT1A 1J84A 4XDQA 4C1WA 2PAEA 3WP4A 2R30A 4LBQA 1W6MB 3IMMA 1POV1 5SV5A 1REFA 1RXFA 4OHVA 3RGBA 3SEEA 4AR2A 3PIGA 4PBOA 2CV6A 4DEVA 4EZ4A 5FQ0A 2UWBA 2QQIA 2JXAA 2RV9A 2GNMA 2VNGA 1LCLA 1VBB2 4FPCA 5TSWA 5LA9A 4GZ9A 4AAPA 1D2QA 5FRAA 2PHUA 3JBG2 1RUNA 4BQ4A 4NHYA 4MO3M 4CDQB 4EYUA 4H55A 4KL1A 4ASKA 5BNNA 1W04A 1YUDA 3P3PA 3ZFEA 1YFYA 1JYIA 2YBPA 3DEMA 4GD4A 2FZ2A 1YXWA 2P5BA 2IFWA 2DCKA 1V6IA 3N7MA 3IDBB 2G1MA 4Q4V1 4AI9A 3DUIA 5IK4A 3HN1A 4PLNA 4R8HA 4Y1ZA 2JDZA 4IW3A 3HPNA 1ENQA 1RUG2 2VZUA 1OA4A 1MS4A 4QPGB 4DUWA 1GP4A 5A33B 4HBNA 3HQXA 3AKRA 3KMHA 1NYWA 4YW3A 5JMCA 1S4CA 1VBA3 2VMHA 5A7WB 1RUJ1 4Z1VA 3DYOA 2XUMA 1CD3G 2EA7A 4KI5M 1E5HA 3GALA 4NE9A 3WY6A 3OUJA 4CCMA 5IJRA 4MSVA 4XUNA 1H8TB 3FHIB 3RZGA 1GQPA 1OD5A 5FZ3A 3JD73 5F3EA 4KG0A 3KQ4B 5GZFA 2R1DA 2EIDA 4Q4W2 1WCKA 1NE4A 1NT0A 5DPNA 3ZMNA 4BB3A 1LU1A 1TZOA 1C28A 1F15A 2W52A 2WLPA 2Q8OA 1RUC3 4GXLA 2CHHA 1OT5A 4FPEA 5E88A 1PMIA 1W06A 4KBZA 3LA2A 4XF0A 1CWPA 1QJU1 1IG0A 2RS12 1TMF2 2AC1A 3CJIA 3HN3A 5J96B 4R9DA 5A3LA 2N7GA 4URTA 2B46X 1G9FA 2WQZC 3EB7A 4GWNA 5I0TA 1PHMA 4LT5A 3IWZA 1ZBA2 2BUKA 1Q3EA 4HMZA 3ZN5A 3FHAA 2YGLA 2VOXA 4ZY9A 2P3KA 1CAUA 1DYKA 2GNDA 3KB5A 2VG9A 5C3SA 1CJDA 1CZTA 1HN1A 4DXZA 5A7SA 2SBAA 1GFF2 1O3SA 1DGWX 4UFKA 1SCSA 5LASA 1UIKA 2ZTNA 3DN7A 4CVUA 4A7YA 1TME3 4M3CB 4XETA 2KXLA 1CAWB 4P14A 4QM9A 1JZ5A 4XJUA 1PM7A 2ADDA 3VDCA 2WRAA 2YY1A 4YM0A 5HCFA 3WV6A 2QQWA 2HWB1 1B09A 4R9CA 1PK6B 1VAKA 2ZGMA 3NRUA 2VOTA 3SCHA 3WINE 4ISQA 5SV8A 4AHZA 3AP5A 4BM8A 1JZ3A 3SLIA 3ZSJA 4ZS3A 1RMU2 5T50A 2TBVA 5CFCB 1D4M2 4XFHA 2XGXA 3RJRA 5FOJB 3BU7A 1UY4A 4FXKB 4RS5A 2DCJA 2VUAA 3GBWA 5FPXA 1T6BX 5FWEA 2OYZA 5HCBA 3P3NA 4O9EA 3JB8A 4MVTA 1IS3A 3TNQA 2ARAA 5H9RA 4NPLA 5FYVA 5GJ6A 2VBDA 3N9LA 1N1VA 5IVFA 1W90A 2RS52 2VOKA 5K0UC 3T2QA 4QXBA 2A75A 1PGW2 2O8OA 1O4ZA 1RUF1 2JB8A 1M06G 5ACA2 3WHTA 3TN92 2O8QA 4X6RB 2FDKA 3ZO0B 5LBEA 3MZHA 4LULA 1NQJA 1O3RA 1OQ1A 5FZ8A 1YIFA 3ILNA 1AR71 1XYOA 1ZBE2 2XH6A 3B01A 3C8XA 3ETQA 3FJSA 3I8TA 4MOAA 4O9GA 2QDRA 2WNOA 3ZXFA 2RM22 5DABA 1WW4A 4XUPA 3T0AA 1R081 1HQNA 3C7OA 5H9SA 1EAH1 1YIPA 2TUNA 3AMQA 5A1FA 1UPSA 1ULEA 4AI2A 4HONA 4LJHA 1DHKB 5C3QA 3WNNA 2WS92 1AR92 3CZUA 4QPGC 5A3UA 3AXDA 1XU2A 2A6WA 3SH4A 2J1UA 3R6SA 1NCQB 1BVVA 5C6CA 2QQOA 1X7NA 3PURA 2NP0A 1W8WA 4WM8A 1MQTB 2GC3A 3I3DA 1H8TC 4Q4Y1 1Q8QA 2BFUL 4H3WA 3AC0A 3LEKA 1MVEA 3E5UA 3WQBA 4QHBA 2XMLA 4GWIA 1PVC2 3LZZA 4LO4B 4ONUA 3A22A 1ND3A 2BFUS 4UBHA 1EPWA 2ZAAA 4UW6A 2R0FA 1OBNA 5D2AA 3LFMA 5FPAA 2Z79A 4HL0A 4LIVA 1W6OB 4HG6B 2BWAA 1UY0A 3DV8A 5EJ1B 2VW0A 3PLQA 3E6CC 1WW6A 1Y3TA 2B45X 4AVVA 2AH2A 5JIUA 3IIIA 4KBBA 5JR7B 3I59B 1R1A1 4XAAA 4XILA 3PL0A 2VW2A 1YRZA 3RYRA 3LOBA 1W2OA 3WP6A 2DVFA 3LGRA 4CDWC 2WDBA 1JZ8A 4MHRA 4Y4RA 2R071 4XCBA 4CRQA 4CDUA 5LY2A 3RWKX 4AVAA 4ES9A 1FT9A 5FZLA 2NZ9A 1V6KA 5ANNA 2Y0IA 2E6VA 1KJRA 4BQXA 3PTYA 3CO2A 4JVAA 3OG2A 2A6VA 3VBUC 5JSRA 3VHNA 4Y26A 3WDWA 3VL8A 3U11A 5DDJ3 3THPA 4DEQA 2VMDA 5J3UA 1VBA1 3PVBB 1CPMA 1ULCA 4OCTA 2ZHKA 2ZGNA 4LMFA 1GR3A 1R1ZA 3R4UA 1L7RA 3MYXA 1EYBA 5T5OA 2BPA2 2Y6HA 2JG8B 4AK3A 4LTAA 3AKSA 3CL1A 2LM3A 1FV2A 2JDAA 3AYEA 5LBBA 2VR4A 2YU2A 2XVGA 3VBSC 2XKOA 4HK9A 1RJ8A 4ORFA 2DUPA 4IEVA 3T08A 1REEA 1ZX5A 5AVAA 4XURA 3O1VA 5CIRA 3KVBA 3INAA 5AFBA 3ZXAC 1AYM1 2O1QA 3CU7A 4MUVA 4NAOA 1SCRA 1GOGA 3I3BA 4AGGA 2BBAA 1HW5A 4FFFA 2WN2A 2D7FA 3GZUC 3UL2A 4MXVA 1OLME 4PJYA 4E8CA 1H6XA 1SMVA 1FATA 2UY9A 4NJ4A 1BK1A 3H7YA 4D6QA 2EIEA 4Q4V2 3VBOA 4CXWA 3BTYA 4IV1C 4Q1RA 1A8MA 2Y64A 3UNPA 4JZRA 3HQRA 4CCKA 1XOYA 4K7JA 4YGCA 3TEXA 1ZNPA 2ZXQA 1OUXA 2K46A 4QQPA 3TEWA 4Q4X3 5G04L 4LUMA 3N4MA 3P1IA 2KM2A 1RUJ2 4OYUA 5CEHA 3ILRA 1OFNA 3AYAA 4O7XA 1G8WA 4UW4A 4A6OA 2VMCA 1US3A 5DAWA 3WW1A 2Q1ZB 1Q8PA 2GNTA 2VCBA 2ZJCA 3B00A 4H2AA 1DLCA 3N7LA 4MGKE 4Q2FA 4JGZB 4LBLA 1JU4A 1XJAA 1UX6A 5BUVA 1C1FA 1X9PA 3GNEA 1XYPA 2XKPA 1S0GA 1YEWA 2OVUA 3EYPA 4JV4A 4XHBA 4HN0A 4IE4A 5T5PA 1XNBA 2ZHNA 2LRPA 3HR9A 4JKLA 1TMF3 5A3MA 1QJU2 3WHUA 5EFUA 1BBT1 5L7OA 4R4XA 5FO7B 3TEYA 2ZOEB 5JPNB 2ARCA 2WZPP 4QU2A 4BWOA 4Q1PA 5IVBA 4CCEA 2D3RA 4E2QA 3I2GA 1BYHA 4GWJA 3SEPA 1UYZA 1MZ6A 2BDRA 3CHXA 3UKNA 1UD1A 4E4HA 4M01A 3S5QA 2F6BA 3MIFA 4URAA 1RJ7A 1RINA 5JMOA 4E27A 1CAXA 2Y26A 1G6NA 2V73A 3DKQA 4LQRA 3SXWA 4AFBA 3POIA 1W6QB 5FZ6A 4WVMA 5G05L 3LIGA 2A1XA 3V0AA 3UK9A 1CAVA 4PHZA 5BNOB 2HWB2 3J26N 2UURA 5CNAA 2NYYA 4L0PA 1HXS1 1W6MA 3J4UH 5D8AC 5F5IA 1NZIA 2E7QA 4DMIA 3E6BA 5K0UA 1RGSA 2C0ZA 4XPVA 1D4M3 1W2TA 2RDNA 4FAHA 2IXIA 4JQTA 1V00A 1ULGA 4LLOA 3NNGA 2CYFA 4PF1A 2YBKA 3M3EA 2OUJA 1ZZ7A 1SPPB 1X8EA 3AZXA 4W6YA 1NAEA 1KD7A 4GWMA 4UF0B 2VY0A 4LE4A 3Q8FA 5FP8A 2CL2A 2RS53 3H3UA 4AZZA 1GANA 4V2WA 1G7YA 3NV3A 3OGRA 1BZWA 1RUF2 1VP6A 3NJXA 4MGYE 4AEJA 5J48A 4Q0SA 4QPGA 3TN93 5A33A 3I2DA 5JR2A 1DFQA 2DVBA 5JXGA 2OT7A 1U5ZA 1T2XA 2VZOA 5IATA 2X10A 4NVPA 5A7WA 2VZVA 1BEV3 3AVSA 1IS4A 5KHIA 1DLLA 1XE8A 3R4SA 5I0UA 1ZBE3 2H0BA 3HEIA 2H6BA 1AR72 2VMEA 3VKOA 3KWVA 2OZ6A 5IVJA 4C90A 2RM23 2HWC3 2ZGRA 2ATFA 2BNNA 1H8TA 5JI7A 1ULOA 1X9TA 2QZ2A 1R082 2MPFA 1EAH2 2J1AA 1V6LA 2HBUA 3ZM8A 1V0AA 3FE5A 1NX9A 2Y0OA 3BN6A 1RXGA 2XWBB 3GF6A 4FVVA 2C4XA 1JYTA 3AJYA 4E4DX 1LOFA 5FUIA 2ARXA 3AMHA 5FBZA 5DDJ1 4YZ1A 3I2HA 3IZOA 4BIOA 1RB8G 3H1YA 2W39A 3AKPA 3UV9A 3B9IA 1V9U1 4BK4A 4Q4Y2 4OULA 3AZZA 1AR61 2CWSA 1KGYA 2JE8A 3MEPA 1OLMA 5DUVA 5DXDA 3AVRA 2VW1A 1OURA 2BNMA 4CEWC 5K0UB 4M3CA 4X8PA 4DXSA 2MEV1 2UWAA 1HV1A 1CAWA 2IWGB 2VM9A 3CDZB 5F5CA 3UT0A 3FLTA 4NAMA 4KG8A 2PQSA 3VBUA 4I2OA 4IE0A 1ODMA 1KFXL 1S0BA 2YYOA 3NSTA 4FPJA 4KQ7A 4RS5B 4YM1A 3CBNA 1R1A2 1PK6A 1LHVA 1UIJA 1MVQA 2OKXA 3O1TA 4MGQA 4AHWA 2W1WA 4NN0A 3O1SA 3HBKA 3KQRA 4JDOA 1PZ8A 4EWEA 2R072 5KR7A 4B4PA 1YFWA 3IN9A 3QBQA 2TNFA 2YHJA 4XF1A 1UXXX 1OXCA 4L11A 1JW6A 1J58A 3DPRB 2ZEYA 3KV6A 5JZGB 5ANQA 2VNVA 2EF6A 5IFPA 1VRBA 2VL4A 3FFQA 2RJKA 3ENRA 4MADA 4FOWA 5BNOC 5KHJA 1GZWA 4B7KA 4Q4X1 2D3SA 1VBA2 1UMHA 2P2KA 2GN3A 3GDBA 2HWD3 4NIIA 2ERFA 4Q26A 5CU1A 2CNAA 1C8M1 5DAQA 3BOWA 3PUQA 2B5HA 4YNIA 5GZGA 4FXGB 4A3ZA 3CMGA 2J1EA 4D0QA 3I4IA 1ZZ8A 3BB6A 1NQDA 1DQ0A 4L92A 4PLMA 4RGKA 4N9HA 3M7AA 3RZHA 1PO21 3UYJA 3POFA 2C26A 5H9QA 5DUUA 4RGAA 2VGDA 1EP0A 4GKYA 1POV3 2GC1A 2JDMA 2JG9C 2BW8A 4ASLA 4A42A 1O8PA 4D6SA 4JGYC 1AYM2 2HWF3 2JIJA 3I49A 3M3CA 5FY0A 1GICA 3KS7A 5I8SA 4X6QB 4Y5SA 1LOGA 5I0SA 1B35C 1PZ7A 1JZ6A 1JZ7A 2GNBA 2B7YA 5EJZB 3AX4A 5DN2A 1AVBA 1NCQA 2QQPA 1H1IA 4P9XA 4Q4V3 5JUVA 1OKQA 2YC0A 1AJKA 2VVEA 4AEDB 5HV0A 3M3OA 3WD5A 1MQTA 2K9ZA 4PDWC 2WQ4A 3CZJA 3ORJA 5FPBA 3UESA 3WNLA 4BMBA 4TLGA 1F4AA 3V0BB 1W8FA 4S2FA 2W94A 3H8UA 1RUE3 1BJQA 5EWSA 3ZYPA 3K48A 2V09A 3ZMOA 4M4PA 3GJAA 3I3QA 4RFRB 3T0BA 2QCSB 1DIWA 2WNUC 4ZKTB 5C5TA 3EMRA 3IM0A 5C4WC 5A7OA 2UY8A 2AEZA 4KGGA 3C3VA 2XJPA 4PIXA 1GWLA 1YO8A 2RJ2A 3J7NA 3MBWA 2XBO1 5L36A 2XG3A 1JZ4A 1QXRA 3FBYA 4P5YA 3LA3A 2ZGUA 2Y6GA 2R49A 1X50A 3M3IA 2JDKA 3O7OA 4UI9L 1HN0A 2W91A 3VBFB 2RDSA 2BNOA 1NCRB 4WVVA 5A32B 4DUVA 1OF3A 4CCJA 4AQTA 1BBT2 3DXTA 1H6YA 2VULA 4KH9A 4LIUA 4RYDA 4HT1T 1KS4A 1OC1A 1UOBA 4IUGA 4WM7C 1H1AA 1JUIA 3NV2A 2WKKA 4BCUA 4DXRA 1YHFA 2D98A 1QJEA 2GAUA 2QVSB 3U4SA 3MV01 2D44A 5FP9A 3ZN4A 1FYUA 2WT2A 2NQYA 2QDNA 2XXZA 5DZGA 5FYMA 1BQPA 4XFAA 2E63A 1BEV1 1IQDC 1UOFA 2YG0A 4LNVA 1S55A 2RHPA 3F2ZA 3TB0A 4AF9A 1HV0A 4YM3A 1OLQA 3CKHA 5EXOA 1NXMA 2NLRA 3H1MA 4Y1YA 3RZZA 2HWC1 1BMV1 1VRH1 3AP4A 2Q1MA 4S2DA 2JG8A 2X8KA 2Y34A 4UYBA 2EXKA 2ZS6B 5EYYA 3V56A 4B7EA 5JPMB 1HXS2 5DZFA 4TTGA 3A0KA 1NZCA 2V72A 2WUHA 2BU9A 5LA1A 3ZYBA 1YCIA 3ABZA 3PVEA 3LD8A 4F83A 4UFIA 5JI9A 2NMNA 4LBNA 2D3PA 4CCCA 2RVAA 4JC1A 5LK7B 4C91A 1BVP1 1ZA7A 2J1SA 4YPJA 2YC4A 3VBHC 5HBAA 4GMP3 2PHWA 4JKKA 1N47A 2XJQA 5EPAA 3NWKA 1BKZA 2JIGA 5IK7A 4E9KA 1AXKA 4F8AA 2HYXA 3RZMA 4EN0A 4NR1A 4MHUA 4UFMA 1RUF3 4K20A 3PVNA 2JD4A 4I09A 4CP2A 1QJX3 3HQUA 4OFGA 2JENA 2VVFA 3GXUA 4FTEA 3B02A 4GQ7A 3WNKA 3PVOA 1U0AA 4CDXC 3MW2A 1LHOA 4LO8A 1RUD3 3G6JB 5DUWA 3USSA 3KD4A 5L19A 4Q8LA 2NN8A 4LITA 3WF4A 1PNGA 3CLPA 3FLPA 4XJWA 5BYNA 1EAH3 1P8JA 4Y1VA 4KNCA 1FOD1 4AEDC 2DBNA 4JGZA 5EQUA 4W6XA 2DTYA 3AM2A 4YM2A 4KMQA 1SZBA 5EV7A 2VU9A 4Y5TA 1RC6A 1VR3A 1AXZA 3FUQA 3ZPYA 2YU1A 1XQNA 4AG4A 2WT0A 1MZ5A 1S0IA 3MW4A 2A3WA 2XLGA 5DDJ2 4CUGA 1RHI1 2WO2A 2P34A 5CYYA 4PLOA 3KGZA 2HWD1 4SLIA 3VDDB 1IS5A
chains in the Genus database with same CATH topology
1V9U2 1AR62 1QHDA 2PAMA 4LO5B 1Q8OA 5CVRA 1G9AA 2F4PA 3SCFA 3IDEA 3VBFC 2MEV2 3EBRA 1NCRC 2EAKA 5K7PA 1W6QA 4K3UA 4MGZE 1ZRDA 5BNOA 1R1A3 2HWF1 3NKTA 1Q5OA 4MYEA 4BLJA 2DVDA 3ZN6B 1HQLA 1QDCA 1W39A 3WDYA 3WLUA 2R073 1AX0A 4RA0A 3MLJA 2ES3A 1J3QA 3W9AA 4ZU5A 4H7LA 4FO9A 2WA4A 3S7IA 1N3PA 2LALA 3I54A 5J7MA 2YPJA 4U2AA 1SEFA 3ZYIB 3WP5A 2WA3A 4MGIE 5FLIA 3WOGA 4C0HA 4YARA 1SFNA 4YGEA 4HANA 3A4UA 4LR4A 1RUE1 4Q4X2 1JOJA 3AK0A 3URFA 1C8M2 1H4GA 4GULA 5FREA 2RE9A 4EWAA 5CB7A 1PO22 4I30A 1H0BA 3OJBA 2XL7A 3N35A 5AC93 2CGOA 4MX3A 4PDWA 1G9DA 3USUB 1AYM3 5DZEA 4L99A 1N1SA 2DCYA 3OBRA 4KWJA 5JLVA 2XJSA 5F9TA 1TNFA 1LTEA 4KWKA 1AYN1 3AYDA 2PELA 1JUHA 3LAGA 1W6PB 4CDWB 1SLBA 4FQZA 5BNQA 1A3KA 3B94A 1MZFA 4XFIA 1OI6A 1YJLA 4XQ4A 4GB32 3DF0A 3KGLA 1NE6A 1CPNA 4Q0PA 3VBUB 1LHWA 4AFCA 4C1XA 3T1MA 2D6PA 4XF3A 2RJLA 1DQ4A 4CYDA 4DRVA 4I0BA 2FZ1A 3GBGA 1GLHA 4R9BA 4WZFA 1HDKA 1SLCA 3ROUA 4AW7A 2XBO2 2BTVC 3MIDA 3VDDC 4Z8BA 3OF1A 4YVWC 2VNOA 3E5XA 4EWDA 2CWMA 3ZXLA 1KQRA 3VHOA 3VBSB 5EYXA 3WCSA 1BBT3 1GZWB 4GMP1 4L8QA 4YFWA 2XL9A 1QNYA 3DPRA 1FPN3 1UW8A 2WWSA 5JZGA 2QFEA 3BPZA 3D6EA 1VBC1 4KGQA 2PHTA 1QXJA 3IDCB 4XXPA 1QJX1 4OI4A 2V5YA 1BEV2 4XE9A 4DY5A 4XJ9A 2A6YA 1RUD1 3IMNA 4IV1B 5C9AB 3G7DA 2HWC2 4LHNA 1BMV2 2YDEA 1VRH2 4YVSC 3NAPC 4GALA 3JCIA 4XBQA 4AVCA 2GDFA 4COWA 1J1TA 1HXS3 3WP3A 1EV13 1OMIA 3RMYA 3U07A 4F3JA 2WFF3 1FMD1 4AQ2A 4HETA 2QE3A 5C8CC 3WW4A 2DUOA 4EN6B 1GQHA 1LULA 4Y1XA 4D94A 5K8SA 1WBFA 1GKBA 4YZ4A 3RNSA 1MEC1 4FQ4A 4IEQA 2OUHA 2RR11 1IOAA 2ET7A 4AEDA 3ZX7A 4E2SA 4JTNA 3CF6E 2G4IA 1IKPA 4G9SB 3V0BA 2DTWA 3MIHA 4IQPA 3X29B 2C1FA 1ALYA 1WBLA 1FV3A 1F9KA 4YYOA 2PHXA 3LSEA 3VZLA 1VJ2A 1JN2P 1PO11 1J59A 4QPIC 4OHZA 3M8LA 1ENSA 1FOD2 1QMJA 1BXHA 1NA1C 5KC5A 3E6DA 5IUQA 2VVDA 3OGGA 1ZRFA 3IKWA 1QGLA 2R16A 4JDMA 3VBFA 5D8AB 1NCRA 1ZYBA 2EALA 3D0JA 5A32A 1RHI2 1J1LA 2ZGQA 4GH4C 2HWD2 1V9U3 4AHXA 1S0DA 3QLQA 4XYXA 4GIQA 4MZUA 3S6PA 5FPZA 1AR63 2K0GA 1LJ7A 3FLRA 1A78A 1AR82 1LESA 3RJ2X 3L2YA 3MGUA 3VBRC 1Y7BA 1V6OA 1G9CA 1AL0G 1VALA 2MEV3 2GC2A 3D82A 1LECA 3O0XA 4I0WB 4AHZA 3MLKA 2OPKA 1QU0A 3K51A 5AC91 2DUQA 4P9IA 2DF7A 3FZ3A 2CGNA 4XJ8A 1KFUL 3WNXA 2HWE3 3UKTA 2HWF2 1OQEA 4QM8A 4WVZA 1SLAA 4NPRA 1IPKA 2BWCA 5JDBA 5JOZA 3FX3A 5HXVA 2DV9A 4QQHA 2CAVA 2CAUA 5GLZA 3WCRA 5C9AC 3WDTA 5GZDA 3AYCA 2GH8A 2AYHA 4EN7B 1HRV1 2D97A 2D6OX 1JXNA 1RUE2 3H0OA 3R4DB 5KBFA 1SBFA 1C8M3 3JUUA 1UPIA 4J6GA 1LOBA 3AFGA 4P9GA 2AUYA 2TEPA 3QH6A 1C5HA 3NW4A 1PO23 2H0VA 1GYKA 1W2UA 4FPKA 4COYA 5KXBA 1DGWA 1FNZA 4CEWB 4AI3A 3NL1A 1K5MC 4FTBA 4Q4Y3 2GMPA 1GZ9A 2VQ0A 4YG3A 2E9QA 3AMNA 2Q5TA 3DGTA 2ZX0A 4OI0A 4A3XA 1NLRA 1AYN2 4QD2A 4AQ6A 1WD3A 4D7TA 1FPN1 3AKQA 4IEUA 3POSA 1NOVA 4SBVA 3ST7A 1JBCA 3ZIWA 1AJOA 3D5OA 1IPJA 2FMDA 4X8NA 4XFFA 1XE7A 2VMIA 4GB33 5LK5A 3VDDA 4YVWA 2ZX3A 1D0GA 3J8F1 2DVGA 4N53C 3BCWA 3FFZA 4HN1A 5DG1A 3WDVA 1ND2B 4YFZA 3KM5A 3JB4C 4IEYA 5BNPC 4AE2A 4WV8A 1EV11 4P9WA 5GZEA 4N9IA 3WDXA 4Z07A 4XF9A 4AI0A 2WFF1 2XBO3 3QH7A 3KCXA 1YFUA 4AI1A 3ZYRA 5KXDA 3ELNA 3ZN6A 4XTPA 2FQPA 3R05A 1PIV3 4UXAA 4YLZA 2JG9B 5CAZA 4LO6B 4QGLA 4FOQA 1VAVA 4JGYB 4P9LA 3M1HA 2AGSA 4G4FA 4RHV1 1DQ2A 3KT1A 4WBBA 4EV0A 5KXCA 1HX6A 1VBC2 5JAXA 1B35B 2VQAA 3OYWB 3WG4A 4GKXA 4XBLA 1QJX2 2ZMNA 3O5SA 2AR6A 4AVSA 1KITA 3DKWA 1I3HA 2BVBA 1RUOA 1RUD2 4EROA 5LEKA 4H7MA 4PDWB 4LO7A 2XLFA 1VRH3 4MV2A 2A6ZA 1POV0 1QY4A 2BVVA 3IT8A 4NHLA 3ZYGA 2EVXA 5CG9A 4QT6A 3GHNA 2WNUB 5C4WB 2EXIA 1OOPB 4N43B 1QH7A 2ZHLA 3USUA 4CEYC 1ASJ3 1LRHA 4I3GA 1FMD2 3AMMA 2OW4A 4D7YA 3RS6A 3TYJA 1FAYA 4I02A 3I7DA 4HPKB 2WNVC 1EPZA 1W6PA 4ISRA 1PNFA 1MEC2 4CDWA 4AI8A 3PJYA 2RR12 4P9YA 5H9PA 1H1MA 4WM7B 3VHPA 5JVVA 1LU2A 2EIGA 4XMAA 5IK8A 4OZXA 3NO8A 4YZ2A 2ZGTA 3IBMA 1VBD1 2VMGA 3WUCA 1R093 3ZSEA 3ZFGC 2HWE1 2XVKA 1WCDJ 1WLDA 2A3YA 4IV3C 1PO12 3SHRA 5GLVA 2D43A 1AX2A 1FOD3 2ZZQA 4BPZA 3MFAA 1LHNA 1AL21 1MS8A 1Q43A 3FMGA 5JIAA 4LLFA 1OSGA 2R0HA 4RQPB 3VBSA 4YGBA 2RS31 1MS1A 1RHI3 1W0PA 1CX4A 2QNKA 1FI2A 1ND2C 3ALQA 1YFXA 3EJKA 4JTOA 3B93A 1JH5A 1A8DA 4LEJA 2IXHA 1UU4A 2ZX1A 5CFDC 5ABJC 1AR83 1I9RA 3S7EA 3OY8A 4BMEA 2D5HA 2WSVA 3VBHB 3AZVA 2VOWA 2ZGKA 1W6NB 4S2GA 4DY3A 2C9AA 2EXHA 2GALA 2A3XA 2P3IA 4XJZA 4H14A 3RG0A 4E2GA 1F8VA 1KDMA 3ES4A 1DGRA 3ZXDA 4IV1A 3LKJA 4RFT0 1DQ6A 3VN4A 5AC92 5C9AA 1O3QA 4UBGA 1IS6A 3QD6A 2PHLA 1W0OA 4OUSA 4HFSA 5D1IA 2ZKLA 1I5ZA 5BNNC 3DL3A 4I01A 3B7MA 4CDXB 2VECA 4LHLA 1KRIA 2DFCA 2R043 4R4ZA 4DQAA 2QZ3A 5FO9B 2YV8A 1S2BA 2XHKA 2ZMLA 1RUI3 1SLIA 1GNHA 2ENRA 3AZWA 4XIOA 4GB31 4GMP0 3SISA 2JECA 4YW4A 3VKFC 4AVBA 1H2KA 5LRRA 3SCGA 4U36A 1RIRA 1HRV2 3KCCA 3KZ4C 4XBNA 1H2MA 2A73B 3WW2A 3JZVA 1C57A 1WLCA 5JOWA 1OLRA 3FUOA 2X5IB 5JSOA 5JOYA 2W68A 3ZIXA 4N7UA 2BGCA 1CGPA 1OOPC 1QQP3 4N43C 1PGSA 4IETA 5KHGA 3VZKA 1XRUA 4HK8A 4Z82A 4ZU4A 2WZR1 4AWDA 2X29A 1QXPA 5FTTC 3S30A 2B8MA 2OIIA 1CESA 1CN1A 1QOSA 1ZRRA 3M70A 4FPHA 3VLBB 1PIV1 2IC1A 1WUVA 1UU5A 1RL3A 1U12A 4M0NA 4HVRA 3VKMA 1AYN3 5FLJA 3NV1A 2ET1A 1XYNA 1FX5A 1FPN2 5BNPA 1VB4A 5D8AA 2WSUA 1IGOA 1ZZ9A 3JQWA 2CGPA 4CTEA 1IQAA 2G9GA 2GMEA 1J3PA 3J8F2 3KT4A 4HVOA 1F5JA 3U4XA 4EN8B 3RRDA 4PIYA 2ARBA 4XQDA 4AFDA 1VBE3 4S2HA 4RQPC 1YYNA 1EV12 1C8NA 2R061 5B2GB 2WNEA 2WFF2 3RSJA 1ASJ1 3ZFFB 1O7FA 3ZDSA 1S0JA 3MF9A 1DGRN 2I07B 1COV3 2DYCA 5HI0A 2I74A 3O14A 1AF9A 1YWKA 5K9YA 5IT6A 4RHV2 4NOTA 3B9CA 4WZCA 4QQ2A 2WINB 1VBC3 1N3QA 1DU3D 1WMFA 2YROA 2R6QA 3W59A 2VNRA 1R091 2ZMKA 3HMYA 2PTMA 3SMHA 2JE7A 3MI8A 3HBZA 1ZZ6A 3WG1A 3LOIA 1M4WA 3GHMA 1LODA 2WFPA 4RR3C 3W58A 5KHHA 4QX5A 2W0XA 4CEWA 1WMEA 4Y22B 4A7ZA 2HYKA 5E89A 4B4QA 4IEXA 1H30A 2WJSA 4WM8C 1FMD3 2UU8A 4PF5A 2X5IC 4JQRA 1SLLA 2DCZA 3KCYA 4YVWB 1TEIA 4XZPA 3QOPA 1AR81 1MEC3 4IV3A 4I3PA 2ZCWA 1QWRA 2HEWF 2YGMA 2RR13 3N3HA 4RGGA 3LB9A 4INDA 2IXJA 1QH6A 1ZVFA 2OA2A 3SITA 4K8FA 1QF3A 3AXEA 1ZZBA 1ULFA 1VBD2 5BXXA 2IXLA 1RUH2 5F5QA 1U5XA 1LHUA 2HWE2 2I2SA 2HEVF 4DNYA 3UKVA 2UYBA 3MPBA 1ND2A 1PVXA 2KA3A 1PO13 4CDUC 1H4HA 1Q8VA 4LA3A 4QXKA 3TAYA 4DZGA 2WT1A 3O12A 4QPYA 2R041 1H2NA 1MS9A 3THTA 3OBTA 4YVSB 1AL22 1RUI1 3NAPB 4BH9A 1SFYA 3TOJA 4MLOA 5LEJA 1YI9A 3D0SA 4XJAA 3LA7A 1MS3A 1EY2A 2JG9A 5I8YA 2RS32 4Q0QA 4E4SA 1LB2A 4JGYA 4DOUA 5JWPA 2B42B 1AX1A 1AUYA 5C8CB 2FMYA 1GQGA 1HRI3 4FAGA 2ZHMA 1B35A 1T6GC 1QQP1 3MIEA 3OYWA 1LOCA 1OFSA 4QQLA 4LBKA 3ZFFC 5JOXA 2YZ4A 3MFCA 1LEMA 2DURA 1DZTA 5J37A 2VOVA 2XLAA 1ZZCA 2K2SA 4Y20B 2DU0A 3WZ1A 4Z1VA 5C6CA 1A6CA 4HZFA 1RVF2 3B3QE 4Y24A 3VZMA 4AGRA 4DINB 3AP9A 1HIXA 1F5FA 2E51A 4COZA 4DFSA 4Z2WA 2WNUA 5AVPA 3VBOC 5C4WA 4QPIB 4IEZA 1N3OA 1OOPA 1NY71 4N43A 2ZPXA 5GLWA 1NA1B 1AHSA 3VV1A 2A6XA 4HPKA 1RTVA 2A7AA 3PNAA 4LBQD 4E4ZA 1HRV3 2GMMA 3MW3A 1UMZA 3VZNA 5C8WA 1XNCA 1UAIA 1ZREA 2YMZA 4OI2A 5F6KA 2PHDA 5J36A 2P3JA 2Q0AA 5T55A 2QJVA 1VBE1 4G3YC 4GH4B 3VKNA 4FT8A 3B5LB 4WM7A 2D6KA 1FXZA 5J98B 1LOAA 2PHFA 4DRRA 3OPZA 4QGMA 1G86A 4EN9B 2UWCA 2WZR2 2FHRA 3GZTB 5FLHA 3VBRB 1Z7S3 1SBEA 1Q56A 1YLLA 3JQXA 5L7OC 2D40A 1COV1 1OPMA 3MDPA 1PIV2 4MXWB 4BIFA 4XXAA 2CTVA 3ZXJA 1SBDA 3OD4A 1F2NA 2PQQA 2ZGPA 4RD7A 4AFMA 1XXNA 1QOTA 3E5QA 4PQ9A 1LGBA 3H50A 5GLUA 4OI1A 2RMU1 4RQPA 3ILFA 1H9WA 3OY8B 3H3ZA 2JEMA 3Q9OA 1OHFA 1WW7A 3EO6A 2IZWA 2PN5A 2PLV2 3J8F3 2A70A 4HKWA 2JJ6A 4XMIA 5E1RA 3VBHA 1ZRCA 4YW5A 2E7AA 3WVJA 1W6NA 3RDIA 3MIGA 4PIZA 1QOOA 3PMSA 1ULDA 4BLIA 2XJVA 2R062 2LTNA 3FC0A 4XF4A 4YZ5A 1HKDA 1I1EA 3AZYA 3WQ1A 1VAMA 1YI7A 4JRAA 4FPYA 1ASJ2 1V6MA 3BTAA 3LSDA 4CDQC 4OHYA 4PCRA 3PHMA 4CDXA 1JYCA 2ZA9A 1K5MB 2R32A 3BIWE 1Y43B 3L9JT 4ATEA 3ACLA 2WL1A 4RHV3 4JCKA 4OHXA 5CBLA 1QJY3 1VLNA 1VIWB 4BZ4A 4RR3A 3POWA 5FAXA 1DGLA 2LUWA 2GN7A 4LE3A 2GU9A 1KJLA 3EXUA 4Y4YA 3VZOA 1GSLA 1R092 1N1TA 2PYTA 1IHMA 4K40A