1BJQA

The dolichos biflorus seed lectin in complex with adenine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
253
structure length
251
Chain Sequence
b'ANIQSFSFKNFNSPSFILQGDATVSSGKLQLTKVKENGIPTPSSLGRAFYSSPIQIYDKSTGAVASWATSFTVKISAPASFADGIAFALVPVGSEPRRNGGYLGVFDSDVYNNSAQTVAVEFDTLSNSGWDPSMKHIGIDVNSIKSIATVSWDLANGENAEILITYNAATSLLVASLVHPSRRTSYILSERVDITNELPEYVSVGFSATTGLSEGYIETHDVLSWSFASKLPDDSTAEPLDLASYLVRNVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LECTIN
publication title Carbohydrate binding, quaternary structure and a novel hydrophobic binding site in two legume lectin oligomers from Dolichos biflorus.
pubmed doi rcsb
source organism Vigna unguiculata subsp. cylindrica
molecule tags Glycoprotein
total genus 56
structure length 251
sequence length 253
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 1998-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1bjqA00
1QGLA 2ARXA 3BIWE 5DZFA 1UZZA 3OBTA 4YW4A 4YM1A 3R4SA 1V6NA 2ZHNA 3WDYA 3WUCA 1YO8A 3ZYRA 4XJWA 1X50A 3DUIA 1IS6A 3SISA 4W65A 4FOVA 4P9WA 1V6IA 1WBLA 5GLTA 1UMZA 2GALA 2AGSA 3N3HA 5EXOA 2P3KA 2AREA 1EPWA 5T5JA 1WUVA 1YRZA 3WDWA 4CTEA 1DZQA 2EXKA 4Q27A 4SLIA 1WD4A 4C1XA 2DV9A 1AXKA 4ASMB 5JLVA 4JCKA 1OKQA 3D4KA 2D44A 1AX0A 2AH2A 1UKGA 2NM1A 3AYCA 3M1HA 4GKXA 1MS0A 1PZ9A 1GYKA 1V6MA 1QNYA 4M3CA 1ENQA 2ES3A 1D2SA 5GALA 5EYYA 1S1AA 3T1MA 5AVAA 3V65A 2DUPA 1NLSA 4XJ8A 3WG1A 3B01A 3ILNA 1MZ6A 4R9CA 3TB0A 3W58A 1SBFA 3T2TA 3WDUA 3FLPA 1FNZA 1KJRA 4LBQA 2B7YA 2D6MA 2ZGSA 3WHUA 4Y26A 2EXHA 2G4IA 3N35A 2PHFA 2GMPA 1KQRA 4FOYA 5E89A 4BM8A 3NV3A 1DQ2A 2GMMA 3B3QE 2R16A 1LODA 2R0FA 1G9CA 4P9YA 1GV9A 2AUYA 3PVOA 4Y1VA 1CJPA 3WZ1A 1S0FA 1MS5A 4FPFA 2W52A 1QMJA 1R1ZA 4H55A 5HCBA 5GJ6A 3USUB 3ILRA 4AGRA 1QOOA 3HR9A 2PELA 4GA9A 1ULCA 3NWKA 4TYSA 4XMIA 1KDMA 4GXLA 4FOWA 3B00A 4Y1XA 2C5DA 2ZMLA 3FUQA 4XOGA 5DXDA 5IK7A 2CYFA 1YIFA 2ZMNA 4FPOB 5T5PA 2GDFA 1LOEA 5DZGA 2XB6C 1BZWA 4FPCA 3T1LA 1QKQA 2D3SA 4AVVA 3AK0A 5CBLA 3M2MA 3PVNA 3WVJA 4M3CE 4Y24A 2W08A 2R1DA 4MYEA 4ISRA 2XG3A 2SBAA 1CVNA 1UN1A 1I1EA 1Q8VA 3ZXFA 2ZGQA 1UX6A 1CPNA 1W6OA 4BMBA 1KITA 4P14A 2YY1A 1Q8SA 2A6ZA 3WDXA 1W0OA 1WW7A 1LEMA 2ZGOA 1LENA 4PQ9A 1N1SA 4YG6A 2ZABA 1LHNA 1ENRA 3OPZA 2DWRA 4RL7A 1OQ1A 3WCSA 1LOBA 5CNAA 2A75A 1Q8OA 1JUIA 4AWDA 2VW1A 3A0NA 3OYWA 1IOAA 4R9BA 4XJUA 3NV2A 4XIKA 5DZEA 3RMXA 1LESA 4XJ9A 5H9PA 5CAZA 1CONA 3WDVA 1W6PA 2A6YA 1LULA 4FP2A 2YZ4A 2TEPA 2ZHKA 4PBPA 2GN3A 2DVAA 4PCRA 4XTMA 2W39A 2FHRA 4YLZA 4UW4A 1MS1A 3LSDA 1BKZA 1IS5A 3WG2A 3WOGA 5KXCA 1G8WA 1HQLA 5CA6A 1LCLA 3A4UA 3AP6A 2JJ6A 3VKMA 5GM0A 1GSLA 4PF5A 3SH4A 1G7YA 1IS3A 3IMNA 1BYHA 1ULFA 2ZACA 2A3WA 2C9AA 4I30A 5H9SA 1DHKB 4D69A 4XTPA 2VW0A 3ZXEA 1VAVA 1W0PA 5JOZA 5H9RA 2DTYA 3PJQA 3MW4A 2WT0A 4DS0A 1UZYA 4M3CB 3OJBA 4XZPA 5L73A 2ZGTA 5GZGA 3FLTA 2D3PA 2VH9A 3WCRA 5T5OA 3AP7A 2WLQA 1J1TA 2UURA 2OUJA 4XBQA 4FPHA 2PHXA 1DFQA 1C1FA 4U36A 1Q8QA 4ATEA 3SH5A 1IKQA 4FPKA 1N1TA 2YMZA 2CL2A 3AX4A 4LBQB 4DRRA 1DQ4A 2CWMA 2YXSA 1G9DA 4FVVA 1WLDA 1S0CA 2ZGLA 4BLJA 5F5QA 2DVFA 4Y1YA 1DIWA 1G9FA 4K20A 1LOGA 1GZ9A 3MPPG 1XQNA 3SITA 2ARBA 2PHWA 3SNMA 3VUOA 1DQ5A 2A5ZA 2EF6A 1N1YA 1PZ8A 4AYUA 1WD3A 3FUOA 5T54A 1WLCA 3WUDA 1YXWA 2NMNA 2DUQA 5LK5A 1AX2A 1RITA 2A3YA 1QOSA 3NV1A 4R9DA 3W59A 3V0BA 1ULDA 2OW4A 2NP0A 4CZSA 4WZFA 1SLTA 2E7QA 4RA0A 5F9TA 1WW5A 1WLWA 4XBNA 2DVDA 2ERFA 3JUUA 2JDZA 3AXEA 1QU0A 1I3HA 2WJSA 3VKFC 1SLBA 2DU0A 2DURA 5DG1A 5H9QA 3RSJA 1FYUA 2ZGRA 4GWNA 1PZ7A 1LOCA 2D7FA 3SLIA 3UJOA 4Y20A 1LHOA 2ZMKA 1KDKA 4XBLA 5JMCA 2AYHA 2WQZC 4K1ZA 4YM3A 4FPYA 1FAYA 2DYCA 3ZXJA 4AVTA 4YZ1A 3MW3A 1IKPA 4XJZA 4K1YA 5GZFA 3WG3A 1RINA 3KQRA 1UPSA 4FPEA 1N3OA 3PMEA 2WT1A 4YGBA 2VUAA 2WT2A 1MACA 1V6KA 2D3RA 3ASIA 4GALA 1W6OB 4Q2FA 1V6OA 1GLHA 1LECA 2WNEA 3RQ0A 4FPLA 3VKOA 3ILFA 5KXBA 1S0GA 3ZSKA 4HANA 3B69A 5DG2A 3BODA 1MR5A 1HDKA 2GNMA 2UU8A 1A3KA 1APNA 3ATGA 3GALA 3BOPA 1O4YA 1MS9A 1ZA4A 2ZGPA 4XYXA 3UJQA 2NYYA 3HMYA 3O12A 3POYA 2OVUA 2GNBA 4XDQA 2P34A 2P37A 1GBGA 5DUXA 1H9WA 5GLUA 3AYAA 2CTVA 3OYWB 3POWA 2OUHA 1QDOA 1UL9A 2ZAAA 1AF9A 2WSVA 4FP3A 4YZ2A 3TAYA 2ENRA 1W6QA 2PHTA 2GNTA 3ZSJA 1V6JA 1W6PB 1F9KA 2ZHMA 3VV1A 4Q8KA 1MVEA 4BMEA 1V00A 2EIGA 3AYDA 4YW5A 3V0AA 1LTEA 5T52A 2A71A 2JECA 2ZGUA 2ZGNA 1GNHA 1JOJA 3WHTA 1SFYA 5IK5A 1H30A 2JD4A 3RMYA 1VALA 2I2SA 2V73A 1W6MA 3QCWA 4YW1A 3POSA 2R0HA 1Q8PA 1MVQA 4HL0A 4XMAA 1F31A 2NMOA 1QOTA 4YZ4A 5T50A 1ENSA 2HYKA 5KXDA 1N47A 2E6VA 1AXZA 5DUUA 5EYXA 1URXA 4YGDA 1FX5A 3N7LA 3O0VA 4FPGA 5IT6A 3D5OA 4ZKTB 1DBNA 2D43A 1JYIA 1SLLA 1C57A 2VXRA 3R4UA 3DGTA 5GLVA 1VIWB 2H0BA 5GLZA 3B9CA 4LBOA 2ZGMA 1Y7BA 4Y1UA 4C1WA 4WVWA 1YI7A 3AZVA 2EAKA 1ULEA 1NXD1 4FQ4A 4XJAA 4FPJA 3LSEA 5IK4A 1WW6A 3N36A 1LGBA 3SH3A 3WLUA 1OFSA 1ULGA 3AZWA 3ZXKA 1WW4A 4XILA 4LBQD 4YG3A 2KM2A 4YW3A 4LBJA 1S0BA 4Y1ZA 1D0HA 4AGGA 3FFZA 3GNEA 1QDCA 1AZDA 1GZWA 1MZ5A 3ZPYA 3ZXLA 4YZ5A 1GKBA 4YFWA 2DUOA 4Q1PA 3IN9A 3VKNA 5JOXA 1HLCA 1LGCA 2P3IA 3V0BB 4F83A 3M3OA 4DFSA 2P3JA 5GZDA 3AJYA 2D6KA 3APBA 4FQZA 5FRAA 4CRQA 1ONAA 5GZEA 1W6NA 3KM5A 2D6OX 1Q56A 2Z42A 1BXHA 3U4XA 1DYPA 1JYCA 4ISQA 4Y20B 1CESA 3OY8A 2UWBA 1H9PA 2R1BA 4Z8BA 1SCSA 1DGLA 1YYNA 1N3PA 3IM0A 1DQ1A 3ZSLA 4LBLA 3AXDA 3N7MA 2PHRA 1GNZA 1AXYA 2DVGA 1LOFC 5GZCA 1LHUA 2AR6A 2FMDA 5DUVA 2EXJA 4GWMA 3I4IA 4DPNA 4IQPA 2PHUA 5HCAA 5JOWA 1SACA 2RHPA 4UW6A 4XXAA 1JW6A 4Y22A 3L2YA 5SV8A 3M3EA 4BPZA 2JKBA 3IPVA 2P2KA 4BOWA 3ENRA 2UWAA 2D6NA 5T55A 5GLWA 4DRVA 5BYNA 1QF3A 2E7TA 5EWSA 3HN1A 4UW3A 5HCFA 2VW2A 4KBBA 2A70A 2DTWA 4ZXKA 3ZYPA 3R05A 1CR7A 1MS3A 3INAA 2D6LX 1MS8A 3UK9A 3AP9A 4Q8LA 4YGEA 2D6PA 2YV8A 2WKKA 3C2UA 2GN7A 4XIOA 1AX1A 1JHNA 1ZM1A 3WDTA 1N3QA 5E88A 4OZXA 1FATA 1GZCA 1W6QB 3JU9A 1FV3A 3AZZA 3N7JA 4JRAA 2ZGKA 3MEPA 2SLIA 3AYEA 1LHWA 3AZXA 4Q26A 4XXPA 1SBDA 3V0AB 2E51A 4M01A 4M00A 2ZZJA 3MW2A 4XE9A 1BQPA 2GNDA 4UW5A 2GMEA 4JC1A 3OBRA 1A78A 1W6MB 2A6XA 2ZKNA 4L8QA 1JXNA 2VY0A 1JBCA 1RIRA 2YROA 2LTNA 3AZYA 1N1VA 4LBKA 3WG4A 1F5FA 1G9AA 3AP4A 3WV6A 3FLRA 1C1LA 4BQ1A 1S0EA 4LBNA 1G9BA 5IK8A 2CWSA 2CY6A 4XHXA 4DQAA 1KRIA 1CN1A 4YM0A 1LHVA 4XHBA 4GKYA 1SBEA 5FREA 3M3CA 5JOYA 4R9AA 2LALA 3PVEA 3I8TA 1U0AA 2NZ9A 1GICA 3O0WA 3V64A 1S0DA 1S0JA 5JVVA 3OGGA 4YFZA 3USUA 3QLQA 4K21A 2V5YA 4AGVA 2DU1A 1SLAA 3O0XA 5JDBA 4PBOA 2JE7A 3RG0A 1VAMA 4WVVA 4YG0A 1DQ0A 2A7AA 3H0OA 3Q9OA 3AFKA 4LBMA 3RRDA 3ZSMA 2Q5TA 4ATFA 2DVBA 1GZWB 4BLIA 1VLNA 3LCPA 1AJOA 1DLLA 1FNYA 2W68A 2CNAA 1Z78A 4P9XA 1HQWA 1JN2P 2EALA 1CIWA 4M3CF 5IUQA 1LOAA 1LU1A 2EXIA 5CB7A 1LGNA 4NOTA 4U2AA 1V6LA 1O4ZA 1S0IA 1LU2A 1DYKA 1LEDA 3IKWA 1UAIA 5T5LA 2UWCA 3N7KA 4YM2A 1AJKA 3M3QA 2BQPA 2ZA9A 3CNAA 1KJLA 5DUWA 2A3XA 3FBYA 2A6VA 3RS6A 4NO4A 2VU9A 1WCSA 1W6NB 1B09A 1Z0HA 1AVBA 1BJQA 1QNWA 4YGCA 1C4RA 3WNXA 1SLIA 1LJ7A 1MS4A 2R49A 3NV4A 4ITCA 4FOQA 5E8AA 1FV2A 3D6EA 3OY8B 4WV8A 1WBFA 2NN8A 2AENA 3BTAA 1DQ6A 1IS4A 1LOFA 3AP5A 4YW2A 3VKLA 5KXEA 3AJZA 3UL2A 3ZVXA 2ZBJA 1SCRA 2E53A 3A0KA 1SLCA 4Q1RA 4YZ3A 1A8DA 4AVSA 1CPMA 1CQ9A 2JE9A 4TZDA 2ZHLA 1G86A 3O5SA 4Y22B 1GANA 2WSUA 2A6WA 1TEIA 3IPVB 1HKDA
chains in the Genus database with same CATH superfamily
4XEZA 3ORJA 1XBFA 2Z4FA 5A3MA 2KXLA 1H8VA 3WUCA 2OS2A 2ZHNA 4CPBD 1RUC3 1ASJ2 1W8WA 4LLFA 5TSWA 4NIDA 1I5PA 3VDDC 5LB6A 5SV5A 3SISA 4P9WA 1WBLA 1UMZA 1AYN2 1MQTB 2AGSA 3BOWA 5EXOA 3ZMNA 3ZDSA 1EPWA 3OBAA 3WQ7A 3IMMA 1GOFA 2R30A 1DZQA 1I9RA 1Z7S1 2YUEA 5JAXA 5BNNB 5J37A 4BQWA 1WD4A 2XVLA 2FDGA 2XGXA 4GULA 4IV3B 5JLVA 4JCKA 2QVSB 5FAXA 4QGMA 3D4KA 2D44A 1AX0A 2AH2A 2CSGA 1RGSA 4B1MA 4DIQA 3BKZA 1DZTA 1DDLA 4INDA 4RS5A 4GZ9A 4BQ4A 1UY1A 3IIAA 4M3CA 3V56A 3P5BA 1D2SA 4XC9A 4QU2A 2DUPA 4EJRA 2PMWB 1RUJ1 2VTFA 1NLSA 2H0VA 3HT1A 1OF4A 3LEGA 4BCUA 2ADEA 3W58A 4M4PA 1SBFA 4UYBA 1QJX1 2VZ3A 4LO6B 2B7YA 1QJZA 4XFBA 1HRI2 2EXHA 3KT1A 3JCIA 2RS11 4V2VA 3VBUA 4CDXB 4HK8A 4CCNA 2RM22 1KQRA 1UOGA 5E89A 1RVF1 3R0RA 4AI8A 3BUCA 4NIHA 1BVP1 1AR71 4CCLA 1LR5A 3T2QA 3NAPA 3DF0A 2R16A 1UYPA 4GMP1 4JAAA 4P9YA 1O59A 1GP6A 2WZPP 3WF1A 5J09A 4ONUA 4TTGA 2AUYA 4J1WA 3J7LA 4L9BA 1CJPA 1NXMA 1S0FA 3MIFA 5FY9A 3GBFA 3THPA 5DAQA 4W8JA 1GFF2 3ILRA 1OOPA 1NX9A 3H7JA 3I3EA 5FZMA 1HN0A 1QOOA 2X8KA 2Y6LA 3HR9A 4GA9A 1FPN2 4YVSC 1ENXA 3FJSA 1RUF1 5L7OB 2VZRA 3FN9A 2YU2A 1GP4A 3ROUA 1XE0A 1ODMA 3C8XA 3HIFA 5B4NA 2O0OA 4D7YA 2VOKA 4LOTA 5F3CA 1EV13 4UAPA 4AFAA 4IEXA 1BZWA 1VPHA 4RGAA 2MEV2 3AK0A 5CBLA 3PVNA 4M3CE 4AAPA 3VBHB 1VBE1 4WM7C 4ISRA 4XABA 1YFWA 5IVEA 1PIV3 2WO2A 4K8FA 4KNCA 3LEKA 3LOBA 1OVPA 2WS91 1Q8SA 2W5FA 3TN92 2WDBA 1PGW1 4CP9B 3ABZA 1LENA 1N1SA 2XKOA 4LO7A 2D5HA 2ZABA 4YG6A 2JG8A 1ENRA 4LT5A 5FK8A 2DWRA 4QPIA 5A6YA 4PI0A 2WL1A 1OQ1A 2B9UA 2K9ZA 4FFHA 2HWF1 4IE0A 1RHI2 1VMJA 1RUD2 4WBBA 4OMDA 3NW4A 3CDZB 3GZEA 4COWA 1NAEA 2C4XA 1Q8OA 1JUIA 1TMF3 2TNFA 5CISA 1SQ4A 2VW1A 4RR3A 2PLV3 1IOAA 3OYWA 1Q43A 2Y6FA 4NUBA 1IZ3A 4COUA 4XJ9A 2VMEA 4IW3A 3IDEA 5IVFA 2YZ4A 2TEPA 1HRV3 3TOJA 2GN3A 2ZX0A 4CDWB 3MZHA 3KHBA 4IEVA 3U1XA 2V5DA 4YLZA 2VD7A 5FO8B 1IG3A 3WG2A 3J7NA 4DXTA 2L9LA 1HQLA 5M0TA 1QH7A 3O1RA 1GWKA 1WCQA 1C28A 1G7YA 2VVEA 3KT7A 1JHJA 3C7FA 2BDRA 3VBFA 2ZACA 3AC0A 2C9AA 2LW8A 2OQ7A 3NNMA 3GF6A 2XVGA 4D0QA 1WGPA 1DHKB 3I2FA 4HXCA 4UBHA 3ZYIB 3PJQA 4EZHA 3RI8A 4HN0A 3TEXA 4HPKA 2RDNA 4XZPA 1YQ8A 5LBFA 3CKHA 2I07B 2WLQA 1Q3EA 1J1TA 4XBQA 1MEC3 3H1YA 4MZUA 3K46A 5JSOA 1X33A 1U12A 1X8EA 2XL7A 3SH5A 1IKQA 1F4HA 4FPKA 4AFCA 4TWTA 4LOSA 2CWMA 2YXSA 4NMIA 1VBB3 2BW8A 5L9VA 2ILMA 5LY1A 5BPXA 1G9DA 1UMIA 5A3OA 3VBRB 2GZWA 3LZZA 4HSJA 5CG8A 1DIWA 4QKDA 5FJHA 5FMOL 2Q4SA 3LF7A 3HPNA 1T6GC 3SMHA 3ZFGB 2RMU1 3P1IA 1Q5OA 5A7SA 1R1A1 1UO9A 1BBT3 5JZGB 2NMNA 1REDA 5IFPA 3MIGA 2OW4A 5FY7A 3T0BA 4MG2A 1WA4A 1RUC1 1JZ4A 3EYPA 4CUBA 4GQ7A 2XQRA 4Q4W2 4N43A 2WJSA 4A6SA 5L9RA 1SLBA 2DURA 4HVRA 5C4WB 4AVCA 1FYUA 1PX3A 1PZ7A 1NCQA 2EVXA 3DEMA 4IEWA 3SLIA 3VGIA 3UJOA 3K4DA 2Y6HA 3WEZA 3Q8BA 4XBLA 2IXHA 5JMCA 1UMHA 3POJA 4JZRA 1FT9A 3MW3A 4XJZA 4A4AA 3WG3A 2DDUA 4OFGA 2WRAA 4BIOA 1VBA3 1LAJA 3CHXA 4LIVA 2Q0AA 3VBOA 1QJEA 1UXZA 3I7DA 4IEUA 2OYZA 1OA3A 4OQ8A 4Q2FA 4QX7A 1V6OA 1CJDA 3RQ0A 4GMP0 4FPLA 3ZR6A 3PTYA 3WW4A 5AC92 5BNOB 3S5AA 5FLIA 2E26A 1VB2A 1X7NA 2P6CA 3U10A 2GNMA 2ZOEB 1QQP3 1O4YA 2ZX2A 5LW9A 4XYXA 3UJQA 1XE7A 1DG6A 1O5UA 2VJXA 3HNMA 4RD7A 4KWJA 4AOCA 2GNBA 3IT8A 4IE6A 2JIGA 3WW3A 5JIAA 5KC6A 3AYAA 3MIBA 4BB3A 5L19A 5F5IA 3HQUA 3VL9A 1RUH3 1AF9A 1K12A 2XHKA 3TAYA 2ENRA 2QQMA 3GBWA 5EHDA 4OQ9A 1PX4A 3T0AA 4BQYA 4ET7A 1F9KA 4O7XA 1UF2C 4Q0VA 3BI3A 3OTFA 2ATFA 1V00A 1JTZX 4JGYB 3VD5A 1K5MA 4F8AA 2W1QA 3KV6A 4R8HA 3VDDB 2F17A 1GNHA 1JOJA 1SFYA 2HWB3 3AKQA 2B39A 3A22A 2I2SA 3ZYBA 3O1OA 2RS52 1QOTA 2RG4A 3DXTA 1EV11 1ENSA 1X36A 2QQUA 2XMLA 1N47A 4G4FA 4KBZA 5EYXA 1W8FA 1XU2A 4E2QA 1W90A 4LHSA 5F3EA 3R6SA 3VZMA 3TEYA 1PIV1 3LIHA 1U5YA 4LUKA 2IZWA 5FP3A 2VXRA 3DGTA 4RSUA 5I0DA 2FZ2A 1J3QA 2HWC2 1VIWB 3H50A 2H0BA 1Y7BA 1ZZBA 4HOOA 2JDPA 1RUNA 1NYWA 1YI7A 2WBKA 3AZVA 2ARCA 2C9KA 3EBRA 4X6RB 4UFJA 5C3SA 1U5IA 4K8RB 3KCYA 1WW6A 3N36A 2W46A 4XDOA 1HXS2 1ULGA 2K2SA 1ZBA3 4YG3A 5FPBA 4D7TA 1COV2 1HJFA 1TMF1 1S0BA 2UY9A 2XJPA 2XBO3 2CAVA 4PIYA 4TN7A 2PLV1 3ZXLA 4QQPA 1GKBA 5A32B 1YLLA 5CU1A 2W87A 4YFWA 5FZ3A 3VKNA 1HRV1 5JOXA 4I2OA 2ADDA 4QXBA 1LGCA 2P17A 3DYMA 1U5XA 2BNMA 4DFSA 2FDHA 3AJYA 3RGBA 4OULA 1F8VA 4EWDA 3WXPA 4YVSB 1CWPA 2XJVA 1B35A 4FXGB 1H2LA 1LRHA 2BWAA 3OPTA 5CKMA 1CX4A 3JZVA 2VZOA 3KM5A 2D6OX 1JZ8A 2Z42A 1BXHA 2AZ5A 4ISQA 3S5QA 1CESA 3OY8A 4QX2A 1DGLA 4RN5A 1YYNA 2WQ8A 3IM0A 4JX0A 1Y4WA 2QJVA 4AW7A 2F6BA 2PHRA 5FLHA 1AXYA 4NJ4A 4WM7B 2DVGA 2WYSA 3KV9A 2G9FA 4IV1C 5CFCC 1LHUA 1RUG3 5DUVA 4YVWC 3J8F3 3I4IA 4CEYA 4DPNA 5FWJA 4P02B 3CZJA 5HCAA 2JDNA 4Y22A 2RS32 2JKBA 4BOWA 1XNDA 2VG9A 4XAAA 2D6NA 5BYNA 1O7FA 1SEFA 1W2AX 3Q8AA 4K6BA 4LA3A 2WA4A 4EN6B 1NE6A 2BJSA 1EPZA 5ABJC 4KU7A 3FFQA 3OUJA 2QQNA 2TBVA 4LPLA 3ZR5A 1VBB1 2BGOA 2A70A 4I01A 3ZX7A 5FZCA 1NKGA 5FPZA 1W3VA 1HB2A 3GCWA 4EV0A 3TEZA 2GP5A 3AKTA 3UK9A 5KC5A 1ZX5A 3AP9A 4LKSA 3SKVA 5FIXA 2BZDA 2N7GA 3ETQA 1BBT1 1JHNA 4NWWA 1DP0A 1JYTA 5E88A 4CP0A 1Y3TA 3I97A 3JU9A 3NJVA 1UOBA 4TXWA 1KFXL 2I45A 2ZJCA 1FXZA 3BPZA 1YHFA 3N7JA 5A7OA 3ZN4A 4AF9A 2JG9C 4CSWA 2SLIA 3AYEA 1LHWA 3AZXA 4Q26A 2X5IA 4FI9A 4MGQA 1AR83 5FZ0A 4AL9A 2YPJA 1ZRRA 2JWPA 2ZZJA 4QHBA 4CCEA 5E16A 1VR3A 1Z7S2 4Z2WA 4NHYA 3BTXA 4NHLA 4D8MA 1JBCA 1RIRA 2EA7A 2V4AA 2YROA 1N1VA 2CAUA 3FC0A 4LBKA 3BN6A 4RGKA 2VVFA 3GXUA 4W50A 3HBZA 2QQLA 1AR63 2RDRA 1F5FA 5FJKA 5BNNC 2QQVA 4DUXA 2KA3A 1H1MA 3D0JA 3WV6A 4LK7A 1G9BA 2QE3A 2ZX1A 1VBA1 1H1IA 1CN1A 4YM0A 5D8AA 4XHBA 2HWE3 2BU9A 1RUJ2 2G1MA 3KT4A 3LDBA 5C8CC 3AVSA 1IGOA 3DKWA 3PVEA 4HONA 1QJX2 3I8TA 3VBSA 1EY2A 2NZ9A 5I0UA 5JUVA 5FCCA 4HFSA 5JVVA 2J1UA 4XFAA 1OXCA 3OGGA 2RS12 5F32A 3QLQA 4UFMA 3POGA 1BK1A 4K21A 1W05A 2QQOA 4P9GA 3VB9A 1QQP1 1RVF2 3FMGA 2DCYA 3UGGA 4AGVA 5A3PA 5JDBA 1AR72 4PBOA 1SPPA 5F3GA 1C8M3 4PF1A 1VAMA 1SFNA 5CKQA 4YG0A 3H0OA 3WNPA 3Q9OA 4I0AA 1OT5A 4QXCA 4W6YA 3RRDA 3T4HB 3I3MA 2QTWB 2F4PA 1K5JA 2W68A 1RUH1 5F6LB 2CNAA 1E5SA 1JN2P 1W8HA 3H1MA 2EALA 1CIWA 3IBMA 1R083 3PNAA 4GIQA 5FO7B 5F5AA 2PAEA 5IUQA 1LGNA 4NOTA 4H7LA 4N53A 5ISLA 1ND2A 1OUSA 3E6CC 1LEDA 2AEZA 1HB3A 2HKXA 2YDEA 4O9GA 5T5LA 3VN4A 4KG8A 4DO0A 1RUF2 3M3QA 2W1WA 4IGPA 5DUWA 4QGNA 1ZZ8A 2VCBA 3LDRA 4NO4A 5CZKA 2HWB1 4O61A 3ZSEA 5A70A 1Z0HA 1W6NB 4YGCA 4S2HA 3WNXA 4AVBA 1SLIA 1KD7A 1LJ7A 1VBC3 1W9WA 2O1QA 3NV4A 4ITCA 1C3HA 4AHZA 1JU4A 5E8AA 5CIRA 3LE0A 3U07A 3WT3A 1PGL1 1UOFA 4AG4A 1PO13 1VBE2 1H1AA 3BTAA 1DQ6A 1LOFA 3VKLA 3CJXA 5G05L 3PUAA 3UL2A 1HJGA 5EJ1B 2RV9A 1PMIA 4Y5Z0 2WS92 3VBHC 4HETA 1JYNA 4FTBA 1PGW2 1YJKA 2BYVE 4YZ3A 4MX3A 3SEPA 5I0SA 1G86A 5D1IA 5FPXA 1GANA 4PI2A 3CEWA 1ZZ6A 3ZYFA 3T2OA 2A6WA 1UQXA 3IPVB 1HKDA 2B45X 2HWF2 3KV5A 5DZFA 2HLEA 3VL8A 2WNVA 4D94A 3ZYRA 4M4RA 1ZBA1 4Q5OA 3ZLIA 1X50A 3BGAA 3P3PA 4ZY9A 3MYXA 1IS6A 2VC9A 3UKVA 1O5LA 3UKNA 3PURA 3AFGA 4URAA 4FOVA 3BIEA 1V6IA 4YPJA 5GLTA 2Y38A 2J7MA 2P3KA 3DPRC 5F2WA 5T5JA 1WUVA 1YRZA 4B4RA 2IFWA 2EXKA 1OQDA 2VNVA 1AXKA 4ASMB 3C7HA 4WZCA 4Q0PA 1QEXA 3VHPA 3BTYA 1UKGA 2NM1A 3HN3A 4ES9A 3CZUA 1OPOA 3GJAA 4F3JA 2WZEA 5CEHA 5BNPA 3WNOA 3KV4A 4R4ZA 4CDWC 4COYA 1S1AA 3T1MA 4ORFA 3KVAA 5HXMA 4MADA 4GWIA 1VB4A 4TSVA 1GU3A 4XJ8A 3THTA 3VD4A 1TNRA 3LFMA 5LA0A 2WO7A 4QX5A 3E6BA 3H9AA 2E33A 5C7GA 3FLPA 1FNZA 3S7IA 2ZGSA 2D6MA 4META 3ME2A 3WHUA 2VQUA 1ND3C 2HBUA 1UYXA 2OZJA 2W91A 4W4ZA 3N35A 4BM8A 1HN1A 1RUG1 2YYOA 4JGZA 1IPKA 2D5FA 1OURA 2J1AA 3J8F1 4I02A 3ZOIA 1RYYA 2BNOA 1K42A 4OI0A 3N9PA 1K45A 4XUNA 1JYVA 2JB4A 3N9QA 4LO5B 3RYRA 4CU6A 1MS5A 5GKAC 3RZHA 2W52A 1XOYA 1ZREA 1RJ8A 3ZFEC 4NIIA 1XYNA 4ZU4A 4B8EA 1OH3A 4O9EA 4I3GA 3U37A 4UWDA 4TYSA 5FTTC 2ID4A 2CGOA 2E31A 3FHIB 3B00A 4FOWA 4BYYA 1RXFA 1VRBA 2ZMLA 2RMU2 1J3RA 2XUEA 3FUQA 1R1A2 2ORXA 3E5UA 3M3IA 4MO3M 5A1AA 4MXWA 1J84A 3ZN6B 1H8TC 1OD5A 2B8MA 2CYFA 1NCRA 2BNNA 3H1WA 2ZMNA 2VZUA 3KVBA 2DFCA 5DZGA 1US3A 2BERA 3T1LA 1QKQA 4AVVA 1RUC2 4CXWA 4LQRA 2GC1A 5LATA 3M2MA 3WVJA 1PHMA 4Q29A 1RTVA 4UF0A 4Y24A 1GMMA 4QPGC 3ITQA 1XE8A 1AR81 4LMFA 2SBAA 4QKFA 1CVNA 4BJ0A 1Q8VA 2FMYA 2ZGQA 4NPMA 5ERLA 3ZXFA 1CPNA 3ZXAC 1W6OA 3S30A 4BMBA 5FYZA 4P14A 2ZXQA 4QQHA 3WDXA 5IJRA 3AB0A 2BFUL 4AXOA 2ZGOA 1W8TA 4PQ9A 5C4WC 5C9AC 3WQ1A 1LHNA 2WINB 2BV4A 1AR61 3OPZA 3TYJA 4NVPA 4L97A 1VJ2A 2NQYA 1YQ5A 3WCSA 2VBPA 2IUWA 4XAEA 3U11A 5KHKA 5FP8A 5CFCB 2VMHA 4WVMA 3TEWA 3QH6A 2PHDA 4YVWB 2VTXJ 1XU1A 5DAXA 5DDJ2 4PLOA 5CFDC 2XLGA 4N7UA 2V09A 1UZ0A 5A6ZA 3LQCA 1CONA 1W6PA 4FP2A 4AEJA 1KGYA 2DF7A 1POQA 3BYWA 5FOBB 5ABJB 4AQ2A 2P5BA 4PCRA 3OPWA 2OKXA 4D3WA 5A6QA 2LS6A 1OSGA 4QXKA 1HB4A 5BNOC 1W0NA 2FHRA 4UW4A 1UCXA 2P4EA 2YC4A 1CAWA 1C8M1 1BKZA 1XYPA 3FWEA 3LSDA 1IS5A 2IVIB 3WOGA 5KXCA 1G8WA 1LCLA 1RUE1 2PAKA 4A7KA 3VKMA 2JB8A 2MHFA 5DPNA 5GM0A 5A7NA 2UYAA 5AVPA 1TVGA 1ULFA 5FY8A 3ACIA 2A3WA 4I30A 2J1SA 3HBKA 5H9SA 1AYM1 4D69A 5JI9A 4EQVA 1WMDA 1CAXA 5KHGA 2JG9B 2QQKA 4NIAA 3LA3A 4KG0A 5FFOC 2R041 4BQXA 3OJBA 5L73A 1L7RA 3WCRA 1RUI1 4JGYC 1W04A 1XSRA 4XF3A 5T5OA 1UPIA 1XXNA 2WFF1 4QPWA 4EWEA 5I91A 1EV12 1VBC1 1XNCA 2UURA 4XF9A 4E9KA 2VOWA 2PHXA 4U36A 1GOHA 1Q8QA 4EN7B 4DB5A 4HSLA 2GH2A 1PO11 1N1TA 2X53S 4LBQB 3GDBA 4BISA 4ZZ5A 2X09A 1VBD3 1AL23 1PIV2 1GQHA 2WA3A 3DL3A 3NSTA 1D4M3 3CJIB 4FVVA 3ZYHA 1S0CA 2J1TA 3BU7A 1ZZ9A 4Y1YA 4CCCA 1G9FA 4K20A 3OGJA 1LOGA 4E27A 4ZU7A 3GYDA 3MPPG 5C5TA 2B46X 1QXRA 1ZBE3 3SITA 2PHWA 5C8CB 3KSCA 3VUOA 1DQ5A 2A5ZA 2IXCA 4GAZA 2GAUA 3FUOA 3GBGA 5EFUA 1FOD1 1PM4A 4YARA 3WG4A 3VZOA 5KHJA 1YXWA 1O8PA 3K77A 1QXPA 4R9DA 3W59A 4FCAA 4RGGA 1UW8A 4EYUA 3V0BA 2C0ZA 4MVTA 2W47A 4WZFA 4CDUA 2PXJA 2H6CA 1TMF2 3I2HA 4XBNA 2DVDA 2ERFA 1DLCA 3JUUA 2JDZA 3OB8A 4ASKA 5FQ0A 1QU0A 1I3HA 2PLV2 4UOJA 3VKFC 5A3UA 1UIKA 5H9QA 5DG1A 2CU5A 1PMJX 4V1PA 3RSJA 2D7FA 3ON7A 4Y20A 2ZMKA 5K4LA 1CAUB 3SXWA 1NG0A 1YFXA 1HRV2 1W9YA 2AYHA 3EJKA 4RFT0 2QQIA 3AMNA 4W6XA 1OLMA 5FUNA 1JUHA 2DCZA 3BCWA 3KQRA 1UPSA 4PIZA 1N3OA 3PMEA 4CEWC 1WMFA 2VUJA 1PO23 2IVJA 3P6BA 3ZFFA 4JDNA 4IUGA 4AI0A 3HWJA 4PDWC 2F4LA 3SKJE 4WM8C 1JYWA 2ZX3A 5A7WA 3UKTA 3FHQA 1U5ZA 5A3WA 4FAHA 5KXBA 3ZSKA 4HANA 3B69A 4URTA 4I0BA 2VOXA 2YC0A 4XFGA 1A3KA 2RJ2A 3BOPA 2JD9A 1IPSA 5FP4A 1NLRA 3HMYA 5C3QA 1NA1A 4RHV3 5FPVA 3BALA 2P34A 4LULA 3U75A 5FYYA 1GBGA 2ZEXA 1GR3A 4S2DA 5GLUA 3WR0A 5BUVA 3LB9A 3MGUA 1V9U3 4LHLA 4NWVA 1D2QA 2RDSA 2IWGB 1MZEA 2VUDA 2ZAAA 3J7HA 4FP3A 5EQUA 4YZ2A 1LB2A 3DKQA 4E8DA 1WMXA 3ZSJA 1V6JA 1BCXA 1VBB2 5JXHA 2ZHMA 4Q8KA 2W9XA 3DV8A 1ASJ3 2XJQA 5APAA 4A45A 4BMEA 3AYDA 1DGWX 4KH9A 4AI1A 2ZGUA 2ZGNA 1G6NA 4UI9L 4AK3A 4CCOA 5IK5A 1H30A 4OHZA 2BOIA 5FO9B 3DPRB 2WNUB 1BBT2 1DGWA 2P6HA 2VQ0A 4JHTA 4XMAA 3I3BA 3WX5A 2NMOA 2HYKA 3CQOA 5KXDA 4JQRA 3EXUA 3U0ZA 2R063 1AXZA 1OLME 1URXA 1WCKA 1JMUB 1FX5A 1LNSA 3O0VA 4YSFA 4FPGA 3VD7A 4CCKA 5J1XA 5IT6A 4OUMA 2R6QA 1C57A 1PK6C 3R4UA 2JDUA 1LKNA 4FFFA 5GLVA 1UYZA 1UZVA 3D3AA 3ZIWA 5GLZA 4LBOA 4TLGA 5FDBA 2Q8OA 4C1WA 4XF4A 1CD3G 1OFNA 4CU9A 1UYYA 3URFA 3E1F1 4XJAA 3LSEA 1ND3B 4CUAA 1BMV1 3H8OA 1VBA2 3AZWA 3S6PA 1WW4A 1JZ7A 3JQWA 4LBQD 4B4PA 4YW3A 1HV1A 3FZ3A 3M70A 4XURA 4LBJA 3W21A 3LD8A 1D0HA 3RZMA 5FZGA 3VHNA 1AZDA 3IZOA 1GZWA 4I3PA 3TNQA 2JDAA 4Z1VA 1S55A 3IDBB 2B9VA 4P5YA 2FBEA 4BK5A 3CF6E 4IV1A 4Q1PA 1QQP2 3Q8EA 4TLFA 4LXLA 1BEV1 5J98B 3WNKA 2VZQA 3ZFEB 4LEJA 4E4HA 3KZ4C 2P3IA 1UY3A 2AC1A 3THCA 3M3OA 2P3JA 4Q0UA 3OGRA 2IXKA 2ZKLA 3APBA 3NQHA 3ZDVA 5BV6A 4LR4A 4IESA 4CRQA 5GZEA 4KGQA 3NKTA 4XFHA 1ACCA 1RUH2 1RXGA 3THDA 3PUIA 3LA7A 1DYPA 1H8TB 1O3SA 4GD4A 4QB2A 3IDAA 4DUWA 2UWBA 2MEV3 5I8SA 1F2NA 1SCSA 4GH4C 1N3PA 1DQ1A 3CMGA 3F95A 3OEAA 2A73B 4Y5TA 3J26N 3N7MA 3ZSLA 4CDQA 5ANNA 1GNZA 4QPGB 4QQLA 5LBCA 4Y5SA 5K0UC 2HWB2 4QHOA 5F2SA 2AR6A 4B29A 2EXJA 1PVXA 2HJIA 2JKXA 2R073 4LK6A 3NMBA 1CAVB 4IQPA 1X9TA 5JOWA 2RHPA 4UW6A 4XXAA 4A44A 1JW6A 5SV8A 1PGL2 5IVCA 1L7LA 5C9AB 1QJY3 5T55A 5GLWA 3KCXA 5FYMA 1QF3A 2E7TA 2VOTA 4X6QB 5ACA3 3HN1A 4CP1A 4IEYA 1ZRDA 2Y6JA 1VBD1 3POEA 5C8WA 1AL21 2QZ3A 2GSYA 1D4M1 5CKNA 4XQ4A 1YNAA 3INAA 4E4DX 1C5HA 1MQTA 3I59B 2W92A 3MIHA 1ZBE1 3IAPA 4Q8LA 4R4XA 5FY1A 4XVHA 2X10A 3QBQA 5CFDB 2ZX4A 3RVHA 4AAXA 5BNNA 2WKKA 3C2UA 3ECQA 1NUKA 4IV3A 4QB6A 1AX1A 1NE4A 1PNGA 5DAVA 3WDTA 4B7EA 1W6QB 2O14A 1FV3A 1XPWA 1ZBA2 4LE4A 1VMHA 3AZZA 3MV01 1AUYA 4YW7A 1ZVFA 1UU4A 3V0AB 4EZ4A 4M01A 1IQDC 4M00A 4XE9A 5CVRA 1BQPA 3OOXA 2GNDA 3ACHA 3LIGA 2KR2A 4I0WB 3VBSB 3MF6A 3OBRA 1A78A 1W6MB 1W8OA 4L8QA 2VY0A 3MO4A 2LTNA 2XH6A 3LWCA 1VE0A 3SQOA 2Z5WA 1XNKA 2VCMA 3NVCA 4CDXA 1NLQA 2RR13 4CYDA 4L2NA 4XUTA 3VBUC 3T3YA 5K9YA 1J59A 1PO21 5K8SA 5I8TA 1LHVA 3VZNA 2W94A 1R093 5FREA 2XUMA 2RJKA 3NAPC 2JDMA 4DXSA 4QKNA 2VPVA 1UU5A 5HCHA 1S0DA 4OZOA 4KQ7A 4YFZA 3WF2A 2PAMA 3HEIA 4BU2A 4X8NA 1RUG2 1E5IA 1OOPC 3J8F2 4COVA 4RQPB 2Y0IA 5LA9A 3JB8A 4CCDA 4FBFA 4RHV1 5L7OA 4AE2A 4WVVA 2P1BA 2WWSA 4NIGA 1GQPA 3PL0A 4LBMA 1PNFA 4BQ2A 3HJRA 3AKPA 2QCSB 1V9U1 1VLNA 2OPWA 1AJOA 1FNYA 1ZZCA 3B7MA 3LFIA 4P9XA 5F3IA 2JE8A 2OXBA 3ALQA 4OVEA 4U2AA 1UKRA 1O4ZA 3VBHA 1DYKA 3S57A 3CNAA 3KF3A 4CCMA 2A3XA 3FBYA 1RB8G 2A6VA 2XOMA 3ES4A 5KWRA 2EIEA 2VU9A 4UT5A 1BJQA 5LA2A 4EN9B 4CP9A 1POV0 1RC6A 3O1UA 3LPFA 3ACLA 4ZONA 1Y9GA 2R061 2VQAA 2VO5A 1FV2A 1S2BA 1US2A 3BPSA 4PQQA 1WBFA 4WV8A 4PLMA 4A2UA 1AL0G 1T2XA 2AENA 2PFWA 5EIYB 2PN5A 1AR82 2PQSA 5JR7B 3DXUA 4UFKA 4YW2A 2BBAA 4HVOA 4CEWB 2FDIA 4Q4Y3 1SCRA 1NZIA 2E7AA 2E53A 4PDWB 4KGGA 4XF1A 5FZOB 4Q1RA 1W2OA 4AVSA 4QAWA 4WM8B 3O5SA 1H2KA 4AI3A 3CBNA 3TRSB 2WSUA 5JIUA 3AMQA 3MV11 1AR62 3O1TA 3WP5A 4Q4X3 4AEMA 3BIWE 1OLRA 4CDWA 3CO2A 4QX8A 4YW6A 4YW4A 4LKFA 3PU8A 4PJYA 3JBG3 4G9SB 1YO8A 4OI4A 3DECA 3WDYA 4XJWA 3DUIA 5JXIA 3KWVA 4Y3OA 4CA9A 3U14A 5LRRA 2TUNA 2HEWF 4JQTA 1XC6A 4LITA 2AREA 3WDWA 4QX3A 5IAXA 2HEVF 4CTEA 4P9JA 1DGRA 5DABA 4SLIA 3EB7A 3OCPA 4LJHA 3USSA 3ZMOA 3FBMA 4KWUA 3O1PA 3VBFC 4OLLA 1MEC1 4ES8A 1H0BA 4H3WA 2WWUA 3AYCA 3M1HA 3K75B 5HV0A 1C8M2 1MS0A 3QH7A 4S2FA 3KMHA 3KCCA 3AM2A 1ENQA 3ZXGA 1RUE2 2ES3A 5GALA 2E9QA 5LEJA 4IE4A 3ZXDA 1ZRCA 5FXXA 4JKKA 4P00B 1XB9A 4J25A 2VULA 4E4SA 3WG1A 3ILNA 5IWFA 3TB0A 3C7OA 1AR93 3T2TA 1AYM2 1HX6A 2VZ1A 5FZ6A 4AFBA 1RMU3 2FCTA 4Y26A 5C3OA 3VHOA 4NHXA 4HZFA 2R042 4CXXA 2GMPA 3VBRA 4FOYA 2XLFA 3MICA 3ZM8A 1RUI2 1A6CA 1DU3D 1FI2A 1GOGA 1JOBA 2ET7A 1VRH3 2R071 2WFF2 1PK6B 2WN2A 3B3QE 1VBC2 1G9CA 2RJLA 3ZFGA 4OI1A 4LUMA 5JZGA 1PO12 2WABA 2B5HA 1QJY1 5ACA1 4FPFA 1KS5A 4NPLA 2XHNA 1R1ZA 4H55A 3ZKYA 5GJ6A 3USUB 5D2AA 4XW3A 4AGRA 4XACA 1ST8A 2PELA 5FBJA 4DOUA 3HOBA 1ULCA 3NWKA 4XMIA 5C4WA 4N43C 2UYBA 4Y1XA 1PGSA 1C8NA 3CJIC 4C0BA 3PMSA 1FOD2 4W6WA 4XOGA 1NCQC 5I0RA 1NT0A 1YIFA 1QHDA 5FZ7A 5T5PA 1RJ7A 1LOEA 2LROA 2XB6C 4MXVA 4AQTA 4BXFA 2VCCA 5A33B 2D3SA 1Y43B 5LRSA 5KHIA 2Y6KA 3MPBA 2VZVA 4MYEA 2R1DA 3NNJA 2BFUS 3GHMA 1ZZ7A 4N8MA 2BTVC 2J1RA 2BEOA 4K7JA 5FZBA 4BDVB 1KITA 3VBOC 2P3YA 3ZN5A 3ZYGA 3D82A 1W0OA 1WW7A 1LEMA 2NLRA 3WP4A 4DMIA 5BNOA 4AEDB 5FUIA 3JD73 1HW5A 4GH4B 4QDSA 3E6DA 4P9LA 2RR11 1JI6A 4MLOA 4MH0E 5J7MA 1REFA 5EV7A 3H3LA 4P9IA 1AHSA 5FZ1A 5K0UB 5L36A 4K3UA 1BK0A 1LOBA 2ORZA 5CNAA 4AFMA 1R091 4AWDA 3GCXA 3A0NA 4XIKA 4R9BA 3NNFA 3NV2A 3RMXA 1YCIA 3WF0A 4ZS3A 4SBVA 3RDIA 2Z69A 3N9LA 4IGOA 3CLPA 3W9AA 3UT0A 4PBPA 5CADA 4JGYA 1PVC3 4E2GA 4BIFA 2C26A 1YQCA 3MLLA 1EUUA 3O1MA 3EQEA 3VDDA 1MS1A 4EE2A 3PUHA 2XONA 1CZSA 2Y0OA 3A4UA 2JJ6A 3AP6A 1GSLA 4PF5A 5LA1A 2BGPA 1IS3A 3ZKUA 2WAOA 3CU7A 2C1FA 1JS9A 2W0XA 3UESA 4IERA 2BVBA 3MUZ1 4FTEA 4PIXA 1W0PA 3I2KA 5JOZA 2BP6A 5H9RA 2X05A 4NROA 4RS5B 2WT0A 4DS0A 5FY5A 2WUHA 4M3CB 1DYOA 5GZGA 2ZGTA 1Y9QA 1UWWA 1Z7S3 2D3PA 2VH9A 2YG0A 5JPMB 4CXYA 4BK4A 3AP7A 1WWYA 4KU8A 4L11A 5FPUA 4Q4V3 2VR4A 2OUJA 5A7PA 2XBO1 3H8RA 3LPGA 3B94A 3LAGA 1DFQA 2VMDA 3W5NA 2VBBA 5FZ4A 4GWJA 2WNUC 5HI0A 2YGLA 2VVDA 3AX4A 2CL2A 4XDPA 2GU9A 1DQ4A 4DRRA 5FYHA 3F2ZA 3VBUB 2RVAA 4L0PA 2JIJA 2XXZA 4Q4Y1 2ZGLA 3WQ0A 5F5QA 4BLJA 1CX1A 2DVFA 4N9HA 5AFBA 3D0SA 1P8JA 4B3NA 1GZ9A 4QU1A 2FD8A 3VD3A 3NAPB 4E4ZA 1OD3A 5C3RA 1QJX3 5FP9A 2EF6A 1N1YA 1PZ8A 2XQXA 3GZTB 4MV2A 1UNBA 3K3OA 4YNIA 4AHXA 4B4QA 5A32A 1F15A 1WLCA 2XLAA 4Q4X1 1RITA 3NV1A 1BMV2 1SDDB 1YC61 2XJRA 1OKOA 4JTOA 1ULDA 4Z07A 4QD2A 3L9JT 4CZSA 1SLTA 2E7QA 3JBG1 4RA0A 4HBNA 5F9TA 1WW5A 3MLKA 1CIYA 1OOPB 4B7KA 4ARXA 4YVSA 2W95A 3AXEA 5HBAA 4EN8B 2DU0A 2VMGA 5FY4A 1B35C 4IXLA 5I8YA 3G6JB 4RYDA 1LOCA 3C3VA 5FMCA 3H7YA 5LCWL 1KDKA 2J42A 1ALYA 1BEV2 3AL6A 5IAVA 1UY4A 4JTNA 1FAYA 2DYCA 2DCJA 4OHWA 3ZXJA 3VHRA 4BQ3A 4WM7A 5JCTA 4IE5A 5GZFA 2FCUA 1RINA 1GQGA 2EAAA 1OHFA 3ETPA 1V6KA 2WZ8A 5FZIA 3NJXA 3H8XA 1W9TA 3RZLA 2H6BA 3WP3A 3ZPOA 1LECA 2OZ6A 3AVRA 1W8NA 4E8CA 1QJU3 1AR91 1QJFA 3ILFA 3N4MA 2ZEWA 4GB33 5DG2A 3N9MA 4Q0QA 1RMU1 1T6BX 1MR5A 2JG8B 3BODA 4MGSA 4NN0A 4QPIB 2UU8A 3T0DA 1W3XA 3GALA 3ATGA 5LASA 2G9ZA 1ZA4A 2ZGPA 3O12A 3POYA 2HWD3 3R4DB 5JI7A 2WS93 1VRH1 5AFEA 1H6XA 3EMRA 4ASLA 1QWRA 2B42B 2E32A 2P37A 3K3NA 1H9WA 5DUXA 3SHRA 3O1SA 2ARAA 4RR3B 4MGZE 3VD9A 3OYWB 3POWA 1QDOA 1POV3 3RZGA 2PYTA 4ZZ8A 2XR4A 1VBD2 5KHHA 1IQAA 1AL22 2QQWA 1D4M2 3ACGA 4IGQA 4QWNA 1W28A 1OPMA 2EIGA 2OQ6A 2WLPA 3KS7A 1LTEA 3QOPA 4BZ4A 2A71A 5C5UA 1ZBE2 2JECA 2VE1A 3T08A 2JXAA 2X5IC 4HKLA 3WHTA 2JD4A 1YFYA 2YC2A 3B93A 2BUKA 1Q8PA 2E63A 2HWE1 3H8UA 4C90A 4HL0A 1F31A 4YZ1A 5EP9A 1GZTA 1QH6A 4YZ4A 4PHZA 1O3RA 2RDQA 3VBFB 2GH8A 3X29B 4CE8A 4YGDA 4XQDA 4D7SA 2VCAA 1DBNA 4ZKTB 2BRTA 1UIJA 2HH9A 4CVUA 1SLLA 4BXSV 5D8AC 4HPKB 1JYIA 1FMD3 3B9CA 2ZGMA 3RYKA 4Y1UA 3VLBB 3IAQA 4WVWA 3NJZA 1VMFA 2R7EB 4ZXEA 3VBSC 4AHYA 2EAKA 1ULEA 2HYXA 2ZCWA 3JD71 1M06G 3TNPB 4X8PA 5FXWA 4NE9A 4DEVA 1ZRFA 1WLTA 3WSOA 3WLUA 1PO22 1R081 1OFSA 3WD5A 3ZXKA 4XILA 3K4AA 2KM2A 3RZZA 4LIUA 4AGGA 1MPXA 4NRQA 3FFZA 4QPYA 1QDCA 4QQOA 3MHZA 3WINE 1MZ5A 3OD4A 5BY5A 5JPNB 3NJYA 4YZ5A 2LUWA 5F5CA 4A42A 3WW2A 5C70A 2DUOA 1SDWA 3AMMA 3GHNA 1HLCA 1YWKA 4F83A 1PVC1 3LKJA 4RHV2 5GZDA 3ACFA 3S7EA 2D6KA 4XUPA 2G19A 5FMOS 5FRAA 4N43B 1GP5A 4OMCA 1V9U2 1W6NA 4CP2A 2JDKA 4RQPC 5FPLA 2GP3A 3CL1A 2XJUA 1NCQB 1JYCA 1BLZA 2CHHA 2WN3A 1UY2A 3MUY1 3U4SA 1UD1A 5LEKA 4Z8BA 4O65A 4CU8A 2D93A 1D4VB 3AXDA 3QD6A 5FZFA 4FTSA 2YPDA 3T2PA 1LOFC 1NOVA 5L9BA 1RL3A 1YIPA 3VBOB 4Q4V1 4BPZA 3C7EA 5FY0A 3L2YA 3POFA 2DBNA 5A80A 3IPVA 4HT1T 2R062 1X82A 5KBFA 2CGPA 4DRVA 4R52A 5HCFA 5F1RA 3OSDA 2VW2A 4V2WA 4H14A 4CUGA 2ZZQA 1EAH3 5HPOA 3RZKA 3K51A 4C8DA 4KBBA 2A1XA 2WNVC 4YWAA 4BQ5A 2WZR3 5E1RA 3ZYPA 1CR7A 1MS3A 2YBSA 2VZTA 5DDJ3 2D6LX 1MS8A 4AR2A 3PJYA 5A6XA 1NY71 4AZZA 2QFEA 4YGEA 1TME3 2YV8A 2XKPA 4HK9A 5FPAA 1SZBA 5A3LA 3BTZA 2WNOA 5FYTA 1XJAA 4XIOA 2QQJA 1ZM1A 4AEKA 1UXXX 3KQ4B 4OZXA 1FATA 1GZCA 1XNBA 1O8SA 1D0GA 3WP6A 2HBTA 2W1SA 4CPBA 2IFRA 2IXIA 3LDKA 2V4VA 3FX3A 5IFTA 1W2UA 2ZGKA 4XXPA 1K5MB 1SBDA 4Y4YA 2E51A 5BNPC 5A7QA 1I5ZA 2JICA 3O7OA 2K46A 4JC1A 2A6XA 4OCTA 5FYVA 3VZKA 1JXNA 3BB6A 1JZ5A 1MEC2 5FUPA 1JOPA 5DMYA 4OUSA 4K40A 5HXVA 2QBXA 3VDBA 2UY8A 3I2GA 3JB4C 4Z82A 5FK7A 5IK8A 2CWSA 4XHXA 4DQAA 2I74A 4IEQA 4JGZC 4B1LA 2QKDA 3ES1A 2BVVA 4BH9A 2LALA 2J22A 3ELNA 1AYN3 1KXGA 1U0AA 1GICA 2J1EA 1OQEA 4XF0A 1QJU1 4NR1A 1ZYBA 4KWKA 1S0JA 3OUIA 4GB31 5FZHA 3UGFA 3W5MA 3WNMA 2V5YA 3VZLA 3ZYJB 2VUCA 3O0XA 4LTAA 2HWD1 3HAGA 2R072 4JVAA 3HNBM 1OUXA 4AQSA 3HVDA 1UX7A 2A7AA 3H3UA 1F4AA 2Q5TA 4P08A 2Z2SB 2DVBA 3ZN6A 1ZRIA 4ATFA 1QJY2 1YEWA 5ACA2 4BLIA 3KLSA 3LCPA 2Q8EA 3KB5A 1POV1 4M0NA 1Z78A 3I2JA 4MGIE 5EJZB 1NCRC 3SCGA 2Y34A 2YBKA 1LU1A 2EXIA 5CB7A 2GC0A 3VDAA 5LWBA 3N9OA 1V6LA 2JX9A 3IKWA 1UAIA 1HRI3 2UWCA 3N7KA 1ULPA 1JH5A 2ZA9A 4HN1A 2RM23 3RS6A 5IVYA 5JWPA 2W3JA 1OH4A 1B35B 4QHZA 1QIQA 1OC1A 1C4RA 1S2KA 1UU6A 3GJBA 1C5IA 4IE7A 5EZWA 3OY8B 3D6EA 1XSQA 2FDJA 2NN8A 5FBZA 1VAKA 4QGLA 3HQRA 3U78A 5CFCA 4YVWA 3AJZA 2LRPA 1WCDJ 5B2GB 4LHNA 3A0KA 4NHMA 1FMD1 1FPN3 4CEYB 1CPMA 1JU3A 4Y22B 4PLNA 3HD8B 3POBA 1HIXA 1O6UA 4PT6A 1TEIA 2RR12 4DINB 4ZU5A 1QGLA 4UFIA 2ARXA 5FZ9A 5ABJA 1BVVA 1GWMA 1E57A 1UZZA 3OBTA 3OUHA 4JV4A 3R4SA 1V6NA 4YM1A 4AEDC 1OF3A 3WQBA 1R092 3PLQA 3PIJA 3UGHA 2BWCA 3PHMA 4W65A 5C3PA 2GALA 3N3HA 3CIHA 3WF4A 2EIBA 5FV3A 2BOJA 4QX0A 4Q27A 4J6GA 2EICA 3TN93 4C1XA 2DV9A 1CZTA 2K0GA 4DY5A 5FYIA 1F5JA 4OHYA 3RFRA 1OKQA 1W9FA 3DYPA 1I6XA 5FZ8A 5F37A 2JG9A 3B02A 4GKXA 4IDZA 1PZ9A 1GYKA 1V6MA 1QNYA 1YI9A 1TQ5A 1RHI3 1O4TA 5EYYA 1RUD3 5FXVA 2X5IB 4LKEA 1XNAA 3JQXA 3DYOA 1OVSA 5AVAA 5FKBA 3V65A 4BE3A 1O3TA 4IEOA 5J48A 3B01A 3FE5A 1MZ6A 1XRUA 5F7UA 1MZFA 4R9CA 4A7YA 4UBGA 3WDUA 1KJRA 4JHZA 4LBQA 5T3NA 2YU1A 4N9IA 3NNGA 4DZGA 2G4IA 3CJIA 2PHFA 5HV4A 2OPKA 4CUCA 3FL7A 4ZPIA 5JMOA 3NV3A 2XPJA 1DQ2A 1WCUA 5I0TA 5FWEA 2DBIA 2GMMA 3PVBB 5D8AB 5C8CA 3LGRA 1LODA 2R0FA 2XBO2 4RS5C 5IVBA 5A3TA 5DN2A 1GV9A 3PVOA 1GNYA 4Y1VA 3WZ1A 3AMPA 4QB1A 1QMJA 3AL5A 5HCBA 3I49A 4JKMA 4RFRB 2WR9A 1EAH1 4Q4Y2 4XUQA 4CDUC 2WZR1 2V72A 1W99A 1EUTA 1SPPB 5DDJ1 1KDMA 4GXLA 4LA2A 1DGRN 1ULOA 1J58A 2C5DA 3Q8FA 1V70A 5FMDA 1VP6A 3RYPA 1TME1 4MGTA 1CAUA 5DXDA 2OIIA 5IK7A 4Q4X2 4FPOB 2VAUA 1REEA 2GDFA 2OA2A 4FPCA 2ZAHA 5DAPA 2XVKA 3JBG2 4FXKB 3JXSA 4N53B 4F7ZA 1ND2B 2W08A 2YFZA 3MLJA 1KS4A 3GM8A 2XG3A 1UN1A 1I1EA 2FQPA 2OT7A 3LEMA 1XNTA 3AKSA 3ZFFC 1UX6A 2GC2A 2JDYA 3HQXA 1OI6A 2YY1A 2A6ZA 4LNVA 2C6SA 4Z2AA 3GZUC 1J1LA 4DY3A 2DFBA 4N90A 3ZIXA 1HB1A 4RL7A 4JDMA 3G7DA 2YGMA 4H2AA 4KI5M 5FZEA 3Q8CA 1JZ6A 3WF3A 1NA1C 1ASJ1 1KEXA 1E5RA 4ARYA 4Q4W3 4NPRA 5DZEA 4XJUA 5F8PA 5K7PA 1AR92 1AYN1 4LKDA 1LESA 1RMU2 5H9PA 1QXJA 2X29A 3WDVA 2A6YA 5CAZA 3SC7X 1LULA 3PTRB 4C91A 4LO4B 2ZHKA 3C7GA 4J1XA 4UFLA 1JZ3A 1EYBA 2DVAA 2Q30A 2D97A 1NQJA 2B4KA 4XTMA 4LE3A 1VRH2 2W39A 2WNVB 2JG8C 3HNYM 4A7ZA 4QPIC 4FAGA 1BHGA 2WWJA 2ZEZA 3O1VA 4A41A 2Q8CA 5BNQA 4QDQA 3DPRA 5CA6A 3D8CA 2WNUA 3SH4A 4AI2A 4E2SA 1OA2A 2VL4A 3IMNA 5IATA 4KL1A 1BYHA 1OMIA 3KGZA 2JEMA 2PHLA 4S2GA 2GC3A 3UV9A 1OA4A 4IEPA 2Y60A 2IC1A 4RR3C 5EJ3A 3RJRA 4A3XA 5AC93 4XETA 4XTPA 2VW0A 5FZKA 3ZXEA 1VAVA 2DTYA 3K2OA 1HRI1 3NRUA 3MW4A 3POIA 1UZWA 3OG2A 1UZYA 5FYSA 5BNPB 2RM21 3B9IA 4KWLA 1PMHX 2WO1A 3GGLA 3FLTA 2VMCA 1J3PA 2HWE2 2NPIA 2Y64A 4C0HA 1HQNA 2VTXA 3MFAA 3A21A 4K9SA 4FPHA 4DXZA 3T4VA 5LZ6A 1C1FA 4ATEA 1W2NA 2WO3A 1DZRA 1ND3A 1CZVA 2VNGA 2YB7A 2YMZA 4OI2A 4AVAA 3TBDA 3I3QA 4EN0A 3NNLA 2W1UA 1H4HA 3M7AA 3PDQA 4FFGA 5LY2A 1WLDA 4XUOA 5J36A 2DCTA 1V0AA 3A23A 4EROA 5D21A 1O91A 4JGZB 1FPN1 1XQNA 3OGSA 2ARBA 3SNMA 1IPJA 2XWBB 2VQTA 2EIDA 5EPAA 1WD3A 5T54A 1H2MA 3JD72 1UOJA 4AYUA 3WUDA 3LOIA 3S0MA 2DUQA 1KFUL 1AX2A 5LK5A 3ZFEA 2A3YA 2RS53 1QOSA 2Y33A 1R082 1CGPA 4QQ2A 4JRLA 3SCFA 5CG9A 4LO8A 2NP0A 2PA7A 2MEV1 3MBWA 5A1FA 4XFFA 2WFPA 1WLWA 3K4ZA 4I09A 3UNPA 2Y8KA 4HVQA 2ZGRA 4GWNA 4QXHA 1H8TA 4NRMA 2WYFA 4FSJA 4OYUA 5F6KA 1LHOA 5A3NA 4ZS2A 1DF0A 4MXWB 2HWC3 3TN91 4L92A 4Z92B 1NCRB 4MUVA 1PVC2 2WQZC 3AKRA 2FZ1A 4K1ZA 4FPYA 4XFCA 1PM7A 4JKLA 3BVCA 4AVTA 5FXZA 4QPGA 4YM3A 1IKPA 3IB3A 3A7QA 4K1YA 2IXLA 1TE1B 3QACA 4UF0B 4CDQC 2BBVA 4FPEA 4QT6A 4DUVA 1RHI1 2WT1A 2VUAA 1HXS3 2WT2A 4YGBA 1RUD1 5E6HA 2VECA 1CAVA 1MACA 1SHWB 1L3JA 3I2IA 3VDCA 5A1LA 2D3RA 2ZPXA 3ZO0B 2CV6A 3ASIA 1COV3 3WNLA 4GALA 1W6OB 1DCSA 2JDHA 2VZPA 5C9AA 1GLHA 2WNEA 2RE9A 2YFUA 5FR3A 3VKOA 1S0GA 3E5XA 3H3ZA 2CDOA 1HDKA 1APNA 2VM9A 3KGLA 1MS9A 3J9SA 4EWAA 2NYYA 5JXGA 2OVUA 3PUSA 4LORA 3SEEA 2WAAA 4WVMB 3I59A 3NKGA 4XDQA 4Q4V2 1TG7A 5CFDA 2BGCA 1MQTC 3O14A 2WIIB 3L2HA 2CTVA 4LHKA 1R64A 4IL7A 2OUHA 4P5HA 1UL9A 2WSVA 1W6QA 3NO8A 2PHTA 4IV3C 2GNTA 2VNOA 5IVJA 3MIDA 1W6PB 5JSRA 4FFIA 4HKOA 4NRPA 2Z79A 3VV1A 1MVEA 3KF5A 1NZCA 4JDOA 4NAMA 4YW5A 2ZEYA 3V0AA 1WMEA 2Q1FA 5T52A 4BHPA 1NY72 2VXJA 2J1VA 1F35A 1CAWB 2XL9A 5IHRA 1OLQA 2MPFA 1YJLA 3IIIA 1VALA 2V73A 4YW1A 1W6MA 3QCWA 3RMYA 3POSA 2R0HA 1MVQA 4QM8A 3RI9A 3AMHA 5T50A 3MIEA 1ODNA 2RS33 2WQ4A 2E6VA 5DUUA 1JODA 1TZOA 1JZ2A 2ZS6B 4CDXC 3N7LA 3MI8A 4MSVA 5B4XA 1RUE3 2FDFA 1CAXB 4OHXA 3D5OA 5JR2A 4OUEA 3RPQA 1H4GA 1UY0A 1SG3A 1W06A 2D43A 4H7MA 1SFPA 5FZAA 4BWOA 5C33A 1K5MC 4D6RA 3SCHA 1QY4A 2XWJB 1OBNA 4N7IA 1AYM3 5FP7A 1NXD1 4FQ4A 4FPJA 3UYJA 5FYBA 5FZDA 1WA6X 5IK4A 1EP0A 2R043 1LGBA 5LBBA 3SH3A 2QDNA 4RQPA 2O8QA 4YYOA 1RUI3 2PTMA 5IVVA 3J4UH 1GWLA 2Q1MA 2WFF3 3RNSA 4AI9A 4Y1ZA 5DQ0A 5L7OC 1H6YA 4Q4W1 3GNEA 3ZPYA 3I3DA 2QQPA 1QJU2 3IDCB 1JYXA 4GB32 4XQWA 1ZNPA 2G9GA 3IN9A 2MNGA 4Y33A 1IHMA 2HWD2 3V0BB 4MHUA 4CDUB 1Y9MA 2WC2A 3DN7A 4FQZA 3WNNA 1ONAA 5FQ0B 2AACA 2VMIA 4XCBA 4XZUG 5LBEA 1FOD3 1YFUA 3OBZA 1RUJ3 1Q56A 2FCVA 3OEBA 4UXAA 3U4XA 4DNYA 3UETA 2XJSA 3PIGA 4Y20B 2VNRA 5IW0A 5BXXA 1H9PA 2R1BA 4OHVA 5AC91 2KD7A 4LBLA 2RS13 2ZTNA 4CEWA 1W9SA 1W8UA 2Y6GA 1RVF3 5GZCA 2FMDA 3T30A 4PDWA 1AR73 4GWMA 5FZOA 3ZFFB 4D6QA 2PHUA 5G04L 4WM8A 1WZXA 1O3QA 3I2DA 4GMP3 1W2TA 1SACA 3TWIA 4CCJA 2LM3A 3M3EA 1M4WA 2P2KA 5CYYA 5A7WB 3ENRA 2UWAA 2BPA2 4QX1A 5DAWA 5EWSA 4QKBA 2O8OA 4QDRA 3P3NA 3PUQA 1YQ2A 1A34A 2R32A 2Q1ZB 1HV0A 1X8MA 4FO9A 4XFIA 2DTWA 3EHKA 4ZXKA 3R05A 3MDPA 1WKYA 1FMD2 1NA1B 1L7QA 2VBDA 1RUF3 2QNKA 4WVZA 3OD0A 5JXJA 4IETA 2D6PA 3BU0A 1YQ6A 3DCQA 2QZ2A 3K48A 5KR7A 2GN7A 4CEYC 2JENA 3GZAA 1N3QA 2RS51 5JSPA 3E5QA 2DCKA 5FZLA 2VZSA 4JRAA 3MEPA 1VBE3 3RWKX 5FYUA 2VMFA 4AHWA 5F39A 3MW2A 5C6CA 4UW5A 3RZJA 2GMEA 2YHJA 3HT2A 4NAOA 4KMQA 4DXRA 4MGYE 3IWZA 2YBPA 2ZKNA 2HWC1 1S2EA 3AZYA 4MHRA 5FKCA 5I93A 1W03A 1X9PA 2CDPA 1J83A 5J3UA 3N9NA 5ANQA 1G9AA 3AP4A 4XCAA 4A6OA 1STMA 4IEZA 2HWF3 3W20A 2HEYF 1C1LA 3FLRA 1S0EA 4LBNA 4GJZA 4QMAA 4BQ1A 2CY6A 3MFCA 5FMBA 3ST7A 1HXS1 3VBRC 3VZJA 4CU7A 1E5HA 1PK6A 3OF1A 1KRIA 4G3YC 4GKYA 1SBEA 4BA6A 1K3IA 1YUDA 2VOVA 3M3CA 4R9AA 5JOYA 1COV1 2CGNA 5J96B 2Q8DA 3ZFGC 1TNFA 2QDRA 3RJ2X 4AFDA 2PQQA 4MGKE 3O0WA 5FOJB 2OX0A 3V64A 5JZGC 3H42B 3FHAA 4MOAA 1S4CA 3USUA 2XDVA 4COZA 2D40A 4DEQA 4YRDA 2DU1A 1SLAA 2JE7A 4ZHNA 3RG0A 4AQ6A 3M8LA 5IYYA 1ZA7A 1DQ0A 3AFKA 3ZSMA 1W8ZA 3KHCA 2Y26A 1GZWB 1DLLA 5C71A 2ETEA 4XPVA 1RUOA 1HQWA 4Q0SA 5A33A 4UFHA 4M3CF 1LOAA 3NL1A 3T09A 1A8MA 1EAH2 4HG6B 4IV1B 5LK7B 1S0IA 2AEYA 1LU2A 2WZR2 3PU3A 3RWNA 3M4FA 1XYOA 1GUIA 3J7MA 4YM2A 1AJKA 2BQPA 4HMZA 1SMVA 2ET1A 1KJLA 4M0HA 3LA2A 4FT8A 1TME2 4L99A 4D6SA 2IXJA 1WCSA 1D7PM 1B09A 1AVBA 1QNWA 4HLTA 4LLOA 5FLJA 2C24A 1W39A 3MF9A 1MS4A 2R49A 5FYCA 3WW1A 1H2NA 1BEV3 3EO6A 4FOQA 4AEDA 4QM9A 1IG0A 2RS31 4GH4A 4NHKA 2FDKA 3KD4A 2W2IA 3I2OA 3I54A 5K0UA 1IS4A 3AP5A 4CDQB 3B5LB 5KXEA 3ZVXA 2VGDA 2ZBJA 4N53C 2QUOA 1ND2C 2D98A 3OGVA 4HKWA 1NQDA 1SLCA 4TZDA 1A8DA 4A3ZA 2JE9A 1CQ9A 4GJYA 3WY6A 2XJTA 2ZHLA 3E97A 2RMU3 1R1A3 3LEIA 2A75A 4UW3A 4Y4RA
chains in the Genus database with same CATH topology
4XEZA 5A3MA 2KXLA 1H8VA 3WUCA 2ZHNA 1RUC3 1ASJ2 5TSWA 4LLFA 3VDDC 5SV5A 3SISA 4P9WA 1WBLA 1UMZA 1AYN2 1MQTB 2AGSA 3BOWA 5EXOA 3ZMNA 3ZDSA 1EPWA 3WQ7A 2R30A 1DZQA 1I9RA 1Z7S1 2YUEA 5JAXA 5BNNB 5J37A 1WD4A 2XVLA 2XGXA 4GULA 4IV3B 5JLVA 4JCKA 2QVSB 5FAXA 4QGMA 3D4KA 2D44A 1AX0A 2AH2A 1DDLA 1RGSA 1DZTA 4INDA 4RS5A 3IIAA 4M3CA 3V56A 1D2SA 4QU2A 2DUPA 4EJRA 1RUJ1 1NLSA 2H0VA 3HT1A 4BCUA 3W58A 1SBFA 1QJX1 4LO6B 2B7YA 1QJZA 4XFBA 1HRI2 2EXHA 3KT1A 3JCIA 2RS11 3VBUA 4CDXB 4HK8A 2RM22 1KQRA 5E89A 1RVF1 3R0RA 4AI8A 1BVP1 1AR71 1LR5A 3NAPA 3DF0A 2R16A 4GMP1 4JAAA 4P9YA 2WZPP 5J09A 4ONUA 2AUYA 4J1WA 4L9BA 1CJPA 1NXMA 1S0FA 3MIFA 3GBFA 3THPA 1GFF2 3ILRA 1OOPA 3H7JA 1QOOA 2X8KA 3HR9A 4GA9A 1FPN2 4YVSC 1ENXA 3FJSA 1RUF1 5L7OB 3ROUA 3HIFA 2O0OA 4D7YA 2VOKA 1EV13 4AFAA 4IEXA 1BZWA 4RGAA 2MEV2 3AK0A 5CBLA 3PVNA 4M3CE 3VBHB 1VBE1 4WM7C 4ISRA 1YFWA 1PIV3 4K8FA 4KNCA 3LOBA 2WS91 1Q8SA 3TN92 1PGW1 1LENA 1N1SA 2XKOA 4LO7A 2D5HA 2ZABA 4YG6A 2JG8A 1ENRA 4LT5A 2DWRA 4QPIA 2WL1A 1OQ1A 2B9UA 2K9ZA 2HWF1 1RHI2 1RUD2 4WBBA 3NW4A 4COWA 1Q8OA 1JUIA 1TMF3 2TNFA 1SQ4A 2VW1A 4RR3A 2PLV3 1IOAA 3OYWA 1Q43A 1IZ3A 4COUA 4XJ9A 3IDEA 2YZ4A 2TEPA 1HRV3 3TOJA 2GN3A 2ZX0A 4CDWB 3MZHA 4IEVA 4YLZA 5FO8B 3WG2A 1HQLA 1QH7A 1C28A 1G7YA 2VVEA 3KT7A 3VBFA 2ZACA 2C9AA 3GF6A 2XVGA 1WGPA 1DHKB 4UBHA 3ZYIB 3PJQA 3RI8A 4HN0A 4HPKA 4XZPA 2I07B 2WLQA 1Q3EA 1J1TA 4XBQA 1MEC3 3H1YA 4MZUA 5JSOA 1X33A 1U12A 1X8EA 2XL7A 3SH5A 1IKQA 4FPKA 4AFCA 4TWTA 2CWMA 2YXSA 1VBB3 2BW8A 1G9DA 2ILMA 5BPXA 3VBRB 2GZWA 3LZZA 4HSJA 5CG8A 1DIWA 5FMOL 2Q4SA 1T6GC 3SMHA 3ZFGB 2RMU1 1Q5OA 1R1A1 1BBT3 5JZGB 2NMNA 1REDA 3MIGA 2OW4A 1WA4A 1RUC1 4GQ7A 4Q4W2 4N43A 2WJSA 1SLBA 2DURA 4HVRA 5C4WB 4AVCA 1FYUA 3VGIA 1PZ7A 1NCQA 2EVXA 3SLIA 4IEWA 3UJOA 4XBLA 2IXHA 5JMCA 1FT9A 3MW3A 4XJZA 3WG3A 4OFGA 4BIOA 1VBA3 2Q0AA 3VBOA 3I7DA 4IEUA 2OYZA 1OA3A 4Q2FA 1V6OA 1CJDA 3RQ0A 4GMP0 4FPLA 3PTYA 3WW4A 5AC92 5BNOB 5FLIA 1VB2A 1X7NA 3U10A 2GNMA 2ZOEB 1QQP3 1O4YA 2ZX2A 4XYXA 3UJQA 1XE7A 1DG6A 1O5UA 4RD7A 4KWJA 2GNBA 3IT8A 3WW3A 5JIAA 5KC6A 3AYAA 3MIBA 5L19A 3VL9A 1RUH3 1AF9A 2XHKA 3TAYA 2ENRA 3GBWA 1F9KA 1UF2C 4Q0VA 3OTFA 2ATFA 1V00A 1JTZX 4JGYB 1K5MA 4F8AA 4R8HA 3VDDB 1GNHA 1JOJA 1SFYA 2HWB3 3AKQA 2B39A 2I2SA 2RS52 1QOTA 1EV11 1ENSA 1X36A 1N47A 4G4FA 5EYXA 1XU2A 4E2QA 3R6SA 3VZMA 1PIV1 1U5YA 4LUKA 2IZWA 2VXRA 3DGTA 4RSUA 2FZ2A 1J3QA 2HWC2 1VIWB 3H50A 2H0BA 1Y7BA 1ZZBA 1RUNA 1NYWA 1YI7A 3AZVA 3EBRA 4X6RB 1U5IA 3KCYA 1WW6A 3N36A 1HXS2 1ULGA 2K2SA 1ZBA3 4YG3A 4D7TA 1COV2 2XJPA 1TMF1 1S0BA 2UY9A 4PIYA 2XBO3 2CAVA 2PLV1 3ZXLA 4QQPA 1GKBA 5A32B 1YLLA 5CU1A 4YFWA 3VKNA 1HRV1 5JOXA 4I2OA 1LGCA 2P17A 1U5XA 2BNMA 4DFSA 3AJYA 1F8VA 4OULA 4EWDA 3WXPA 4YVSB 2XJVA 1B35A 4FXGB 1H2LA 1LRHA 2BWAA 1CX4A 3JZVA 3KM5A 2D6OX 2Z42A 1BXHA 2AZ5A 4ISQA 1CESA 3OY8A 1DGLA 1YYNA 3IM0A 2QJVA 4AW7A 2F6BA 2PHRA 5FLHA 1AXYA 4WM7B 5CFCC 2DVGA 4IV1C 2G9FA 1LHUA 1RUG3 5DUVA 4YVWC 3J8F3 3I4IA 4CEYA 4DPNA 5HCAA 4Y22A 2RS32 2JKBA 4BOWA 1XNDA 2VG9A 2D6NA 5BYNA 1O7FA 1SEFA 4K6BA 4LA3A 2WA4A 4EN6B 1NE6A 5ABJC 1EPZA 4KU7A 3FFQA 2TBVA 1VBB1 4I01A 2A70A 3ZX7A 5FPZA 4EV0A 3UK9A 3AKTA 5KC5A 1ZX5A 3AP9A 2N7GA 3ETQA 1BBT1 1JHNA 4NWWA 5E88A 4CP0A 1Y3TA 3JU9A 1KFXL 2I45A 2ZJCA 1FXZA 3BPZA 1YHFA 3N7JA 3ZN4A 4AF9A 2JG9C 2SLIA 3AYEA 1LHWA 3AZXA 4Q26A 2X5IA 1AR83 2YPJA 1ZRRA 2ZZJA 4QHBA 5E16A 1VR3A 1Z7S2 4Z2WA 4NHLA 1JBCA 1RIRA 2EA7A 2YROA 3WG4A 1N1VA 2CAUA 3FC0A 4LBKA 2VVFA 3HBZA 1AR63 1F5FA 5BNNC 2KA3A 1H1MA 3D0JA 3WV6A 1G9BA 2QE3A 2ZX1A 1VBA1 1H1IA 1CN1A 4YM0A 5D8AA 4XHBA 2HWE3 1RUJ2 3KT4A 5C8CC 1IGOA 3DKWA 3PVEA 1QJX2 3I8TA 3VBSA 2NZ9A 1EY2A 5I0UA 5FCCA 4HFSA 5JVVA 4XFAA 3OGGA 2RS12 3QLQA 4K21A 1BK1A 4P9GA 1QQP1 1RVF2 3FMGA 2DCYA 4AGVA 5JDBA 1AR72 4PBOA 1C8M3 1VAMA 1SFNA 4YG0A 3H0OA 3Q9OA 4I0AA 3RRDA 4W6YA 2F4PA 2W68A 1RUH1 5F6LB 2CNAA 1JN2P 3IBMA 3H1MA 2EALA 1CIWA 3PNAA 1R083 4GIQA 5FO7B 5IUQA 2PAEA 1LGNA 4NOTA 4H7LA 4N53A 1ND2A 3E6CC 1LEDA 2YDEA 2HKXA 4O9GA 5T5LA 3VN4A 4KG8A 1RUF2 3M3QA 5DUWA 4QGNA 1ZZ8A 4NO4A 2HWB1 3ZSEA 1W6NB 1Z0HA 4YGCA 4S2HA 3WNXA 4AVBA 1SLIA 1KD7A 1LJ7A 1VBC3 2O1QA 3NV4A 4ITCA 1C3HA 4AHZA 5E8AA 5CIRA 3U07A 3WT3A 1PGL1 4AG4A 1PO13 1VBE2 1H1AA 3BTAA 1DQ6A 1LOFA 3VKLA 3CJXA 3UL2A 1PMIA 4Y5Z0 2WS92 3VBHC 4HETA 4FTBA 1PGW2 1YJKA 2BYVE 4YZ3A 4MX3A 5I0SA 1G86A 5D1IA 5FPXA 1GANA 3CEWA 1ZZ6A 2A6WA 3IPVB 1HKDA 2B45X 2HWF2 5DZFA 3VL8A 2WNVA 4D94A 3ZYRA 1ZBA1 1X50A 3P3PA 3UKVA 3MYXA 1IS6A 3UKNA 1O5LA 3AFGA 4FOVA 1V6IA 5GLTA 2Y38A 2P3KA 3DPRC 5T5JA 1WUVA 1YRZA 4B4RA 2IFWA 2EXKA 1OQDA 1AXKA 4ASMB 4WZCA 4Q0PA 3VHPA 1UKGA 2NM1A 4ES9A 1OPOA 4F3JA 5BNPA 4R4ZA 4CDWC 4COYA 1S1AA 3T1MA 4ORFA 1VB4A 4TSVA 4XJ8A 3THTA 1TNRA 4QX5A 3E6BA 3H9AA 3FLPA 1FNZA 3S7IA 2ZGSA 2D6MA 4META 3ME2A 3WHUA 1ND3C 2OZJA 3N35A 4BM8A 1RUG1 4JGZA 2YYOA 1IPKA 2D5FA 4I02A 3J8F1 2BNOA 4OI0A 4LO5B 3RYRA 1MS5A 5GKAC 2W52A 1ZREA 1RJ8A 3ZFEC 1XYNA 4ZU4A 4B8EA 4O9EA 4I3GA 4TYSA 5FTTC 2CGOA 4BYYA 3FHIB 3B00A 4FOWA 2ZMLA 3FUQA 2RMU2 1J3RA 1R1A2 3E5UA 3M3IA 4MXWA 3ZN6B 1H8TC 1OD5A 2B8MA 2CYFA 1NCRA 2BNNA 3H1WA 2ZMNA 2DFCA 5DZGA 3T1LA 1QKQA 4AVVA 1RUC2 2GC1A 3M2MA 3WVJA 1PHMA 4Q29A 1RTVA 4Y24A 4QPGC 1XE8A 1AR81 2SBAA 1CVNA 1Q8VA 2FMYA 2ZGQA 3ZXFA 3ZXAC 1CPNA 1W6OA 3S30A 4BMBA 4P14A 4QQHA 3WDXA 3AB0A 2BFUL 4AXOA 2ZGOA 4PQ9A 5C4WC 5C9AC 3WQ1A 1LHNA 2WINB 3OPZA 1AR61 3TYJA 4NVPA 4L97A 1VJ2A 2NQYA 3WCSA 3U11A 5KHKA 5CFCB 2VMHA 4WVMA 3QH6A 2PHDA 4YVWB 1XU1A 5DDJ2 4PLOA 5CFDC 2XLGA 4N7UA 2V09A 1CONA 1W6PA 4FP2A 4AEJA 2DF7A 5FOBB 5ABJB 4AQ2A 4D3WA 4PCRA 5BNOC 4QXKA 1OSGA 2FHRA 4UW4A 1UCXA 1CAWA 1C8M1 1BKZA 1XYPA 3FWEA 3LSDA 1IS5A 3WOGA 5KXCA 1G8WA 1LCLA 1RUE1 2PAKA 4A7KA 3VKMA 2MHFA 5GM0A 2UYAA 5AVPA 1ULFA 2A3WA 4I30A 5H9SA 1AYM1 4D69A 5JI9A 1WMDA 1CAXA 5KHGA 2JG9B 3LA3A 4KG0A 5FFOC 2R041 3OJBA 5L73A 3WCRA 1RUI1 4JGYC 4XF3A 5T5OA 4EWEA 1UPIA 1XXNA 2WFF1 5I91A 1EV12 1VBC1 1XNCA 2UURA 4XF9A 4E9KA 2VOWA 2PHXA 4U36A 1Q8QA 4EN7B 4DB5A 4HSLA 2GH2A 1PO11 1N1TA 2X53S 4LBQB 1VBD3 1AL23 1PIV2 1GQHA 2WA3A 3DL3A 3NSTA 1D4M3 3CJIB 4FVVA 1S0CA 3BU7A 1ZZ9A 4Y1YA 4E27A 1G9FA 4K20A 3OGJA 1LOGA 4ZU7A 3GYDA 3MPPG 2B46X 1QXRA 1ZBE3 3SITA 2PHWA 5C8CB 3KSCA 3VUOA 1DQ5A 2A5ZA 2IXCA 2GAUA 3FUOA 3GBGA 5EFUA 1FOD1 4YARA 5KHJA 3VZOA 1YXWA 1QXPA 4R9DA 3W59A 4FCAA 4RGGA 1UW8A 3V0BA 2C0ZA 4MVTA 4CDUA 4WZFA 2H6CA 1TMF2 4XBNA 2DVDA 2ERFA 5FQ0A 3JUUA 2JDZA 1QU0A 1I3HA 2PLV2 3VKFC 1UIKA 5H9QA 5DG1A 4V1PA 3RSJA 2D7FA 4Y20A 2ZMKA 1CAUB 3SXWA 1NG0A 1YFXA 1HRV2 2AYHA 3EJKA 4RFT0 3AMNA 4W6XA 1JUHA 2DCZA 3BCWA 3KQRA 1UPSA 4PIZA 1N3OA 3PMEA 4CEWC 1WMFA 2VUJA 1PO23 3ZFFA 4JDNA 4AI0A 3HWJA 4PDWC 4WM8C 2ZX3A 3UKTA 1U5ZA 4FAHA 5KXBA 3ZSKA 4HANA 3B69A 4URTA 4I0BA 2VOXA 2YC0A 4XFGA 1A3KA 3BOPA 1NLRA 3HMYA 1NA1A 4RHV3 3BALA 2P34A 4LULA 1GBGA 5GLUA 1GR3A 4S2DA 5BUVA 3WR0A 3LB9A 3MGUA 1V9U3 4LHLA 4NWVA 1D2QA 2IWGB 1MZEA 2ZAAA 4FP3A 4YZ2A 1LB2A 3ZSJA 1V6JA 1BCXA 1VBB2 2ZHMA 4Q8KA 3DV8A 1ASJ3 2XJQA 4BMEA 3AYDA 1DGWX 4KH9A 4AI1A 2ZGUA 2ZGNA 1G6NA 4AK3A 5IK5A 2QQPA 1H30A 4OHZA 5FO9B 3DPRB 2WNUB 1BBT2 1DGWA 2VQ0A 3WX5A 4XMAA 2NMOA 2HYKA 5KXDA 4JQRA 3EXUA 3U0ZA 2R063 1AXZA 1URXA 1WCKA 1FX5A 3O0VA 4YSFA 4FPGA 5IT6A 4OUMA 2R6QA 1C57A 1PK6C 3R4UA 1LKNA 5GLVA 3ZIWA 5GLZA 4LBOA 5FDBA 2Q8OA 4C1WA 4XF4A 1CD3G 1OFNA 3URFA 4XJAA 3LSEA 1ND3B 1BMV1 1VBA2 3AZWA 3S6PA 1WW4A 3JQWA 4LBQD 4B4PA 4YW3A 1HV1A 3FZ3A 3M70A 4LBJA 1D0HA 3VHNA 1AZDA 1GZWA 4I3PA 3TNQA 4Z1VA 1S55A 3IDBB 2FBEA 3CF6E 4IV1A 4Q1PA 1QQP2 4TLFA 3ZFEB 1BEV1 5J98B 4LEJA 3KZ4C 2P3IA 3M3OA 2P3JA 4Q0UA 2IXKA 2ZKLA 3APBA 5BV6A 4LR4A 4IESA 4CRQA 5GZEA 4KGQA 3NKTA 4XFHA 1RUH2 3LA7A 1DYPA 1H8TB 1O3SA 2UWBA 2MEV3 5I8SA 1F2NA 1SCSA 4GH4C 1N3PA 1DQ1A 3ZSLA 2A73B 3J26N </