1BJQA

The dolichos biflorus seed lectin in complex with adenine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
253
structure length
251
Chain Sequence
ANIQSFSFKNFNSPSFILQGDATVSSGKLQLTKVKENGIPTPSSLGRAFYSSPIQIYDKSTGAVASWATSFTVKISAPASFADGIAFALVPVGSEPRRNGGYLGVFDSDVYNNSAQTVAVEFDTLSNSGWDPSMKHIGIDVNSIKSIATVSWDLANGENAEILITYNAATSLLVASLVHPSRRTSYILSERVDITNELPEYVSVGFSATTGLSEGYIETHDVLSWSFASKLPDDSTAEPLDLASYLVRNVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LECTIN
publication title Carbohydrate binding, quaternary structure and a novel hydrophobic binding site in two legume lectin oligomers from Dolichos biflorus.
pubmed doi rcsb
source organism Vigna unguiculata subsp. cylindrica
molecule tags Glycoprotein
total genus 56
structure length 251
sequence length 253
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 1998-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1bjqA00
1WLWA 2HYKA 2WNEA 1N1VA 1CVNA 2Z42A 2ZGLA 5HCAA 1YIFA 2ZACA 3UJOA 4FP2A 3OY8B 3WLUA 3BIWE 2CNAA 3AX4A 1LTEA 5JOZA 2DURA 1LGCA 4FPGA 1AJOA 2ZGUA 1SLCA 3IPVB 2DU1A 2W08A 3IKWA 1UL9A 1UKGA 4BPZA 3NV2A 5JOYA 3ILFA 1N1SA 1R1ZA 2P34A 4GALA 1YO8A 2A71A 1LHOA 2WT0A 4YW4A 1D2SA 4Q26A 4WZFA 3NV3A 2DYCA 2DWRA 4YLZA 2YY1A 1AXZA 3VKFC 1AX1A 2GALA 3MW2A 1AVBA 1FV2A 2D6MA 1CPMA 5H9QA 4BMEA 2YROA 3AXEA 1BZWA 1LEMA 1ENRA 1EPWA 3PVEA 4FPCA 5JMCA 3VUOA 2FMDA 4XE9A 4Y20B 2W68A 4XZPA 5EYXA 1G7YA 4M3CA 3TAYA 1ULDA 3KM5A 5JLVA 3IMNA 1Y7BA 3OBRA 4LBQB 4CZSA 5T5OA 1G9FA 1FYUA 5CA6A 2H0BA 2ZGOA 3I4IA 1JUIA 3PJQA 4JRAA 1Z0HA 3L2YA 5HCFA 5GZDA 2JDZA 4P9XA 4Y1ZA 3MPPG 5JOWA 2DTYA 3ILRA 4WVWA 4FPEA 5T54A 2EF6A 1YXWA 3M2MA 1JOJA 2GNDA 2GMMA 4P9YA 1DFQA 2AREA 4LBMA 2DU0A 3WDYA 2ZMNA 3I8TA 2I2SA 4XOGA 4LBNA 3V64A 4RL7A 3GALA 1GLHA 2CL2A 5GALA 3WDUA 3V0BA 2ZHMA 1FATA 4JC1A 1S0CA 1JHNA 1W6OA 3B69A 3O0XA 2LTNA 4YG6A 2GNTA 3APBA 1YRZA 4M01A 5JDBA 4WV8A 3AYEA 2EIGA 2R1BA 1GZCA 4FQZA 1U0AA 3T2TA 4CRQA 4LBJA 2BQPA 1LHVA 2NMNA 5GZGA 3ZXFA 1NLSA 2EXHA 1S1AA 5E8AA 2ARBA 2VH9A 3ZYPA 4AVSA 1N3OA 4M00A 1VIWB 2ZGRA 5T55A 3V0AA 3PMEA 1V6LA 1CESA 5JOXA 3FLRA 1A78A 1LOCA 3N7JA 4YW3A 1UMZA 5DUXA 3WVJA 2ZGKA 3MW3A 1CIWA 1WLCA 2A6YA 1N47A 5GJ6A 1IS6A 2ZGSA 3B00A 2DUOA 1BJQA 5CAZA 3WUCA 2AENA 3B9CA 2D6NA 2PHRA 2JE7A 3AFKA 1IS5A 1RITA 4C1XA 2DV9A 4Y1VA 3RS6A 1WD3A 4YZ2A 5HCBA 3SITA 5L73A 4CTEA 1GNZA 2GMPA 3AP9A 1IKPA 1DLLA 2P2KA 1LESA 5CBLA 4XIKA 1AXYA 4LBOA 2EALA 5T52A 1G9CA 1ENSA 2YMZA 3O0WA 1S0JA 2DUQA 3HMYA 2D7FA 3AZWA 4ISRA 1CN1A 5DXDA 4AGVA 1IS4A 3B01A 4AWDA 2WKKA 1V6NA 3WG4A 4TZDA 2XG3A 1UZZA 3V0BB 4BQ1A 2A6XA 1HDKA 2D44A 1AX0A 2ZMLA 5T5LA 1W6OB 2CTVA 1J1TA 1F9KA 2NZ9A 4PF5A 1MS3A 1YI7A 4FPLA 4YGBA 5SV8A 4UW4A 5DG1A 3W59A 1LULA 5EYYA 5F5QA 3OGGA 4FPHA 1KRIA 1S0BA 2A6ZA 3INAA 1N1YA 3D6EA 1Q8SA 2ZHNA 4JCKA 4XHBA 4BMBA 3WHTA 1Q8OA 4AGGA 1BKZA 3WDWA 3UL2A 1LOBA 1GYKA 4XILA 1N1TA 1GZWA 5AVAA 1W6PA 2DVAA 2XB6C 2ZHKA 1LENA 4LBLA 1ONAA 3FBYA 4ASMB 1CJPA 4BLJA 2JKBA 2CWMA 2CWSA 1S0IA 1QOOA 2RHPA 3NWKA 3R4UA 1AXKA 5GZEA 3WHUA 2DUPA 3LCPA 5GLZA 1LOFA 1KQRA 2ZGQA 4FP3A 2LALA 3SISA 3N3HA 4TYSA 1QMJA 3AZXA 2YXSA 3CNAA 4Y26A 4NO4A 4F83A 1QOTA 1BYHA 3D4KA 2D6LX 3POWA 4YW2A 5GLVA 4ZKTB 1N3QA 5F9TA 1H9WA 1LEDA 2E6VA 1MVEA 4FQ4A 3SLIA 4GA9A 1LOAA 4GKXA 3VKNA 4PBPA 1OKQA 1DYPA 2OUHA 3WG3A 2A6WA 3N36A 3SH5A 4YM0A 1DBNA 2JE9A 2PHTA 3DGTA 2UWBA 2D3RA 1LGNA 3W58A 2TEPA 2C9AA 2W52A 4U2AA 1Z78A 2YZ4A 2ZZJA 1CQ9A 3AYDA 1JBCA 3RMXA 4UW6A 3N35A 3KQRA 1DGLA 2ZGMA 2CY6A 2EAKA 1FNZA 2WSVA 5GLTA 1SBDA 1MS0A 3IN9A 3ASIA 1LGBA 5IK8A 2ZGPA 2P37A 5KXBA 1WLDA 2EXIA 2A3WA 4R9BA 2D3PA 4FPFA 4GWNA 1I3HA 5E88A 2GMEA 3BTAA 2ZBJA 2ZGNA 5DUWA 3ZSKA 3WG2A 4HANA 2R1DA 2R0FA 1LJ7A 4XTMA 5BYNA 1ULGA 2D6OX 5T5JA 1Q8QA 1MS1A 5FREA 4R9DA 2AR6A 1G9BA 4LBKA 1GZWB 1SCRA 4PBOA 1W6PB 4Y1UA 1QDCA 2UWAA 4Y1XA 3LSEA 5DZGA 2A5ZA 1IOAA 4H55A 3VKLA 1G86A 2YV8A 1JYCA 2ARXA 1S0FA 1SLIA 5EXOA 3Q9OA 4ZXKA 1C4RA 3ZXJA 4K21A 2NM1A 1MACA 1QF3A 2GN3A 1LHNA 3IM0A 5KXCA 4P9WA 1DYKA 2ZAAA 1DQ0A 1TEIA 4FPYA 4PQ9A 1MS8A 1DQ2A 1QKQA 2ZMKA 3HN1A 4GKYA 2WJSA 4U36A 3ZSMA 1QNYA 3C2UA 1GANA 1X50A 1WD4A 2A6VA 5DUVA 3ZSJA 1GICA 4ATEA 1AX2A 2E7TA 1V00A 5IK4A 2A3YA 2AYHA 4AVTA 3AP6A 2DVGA 1Q56A 3O0VA 4FPOB 5DZEA 4YM3A 3AZYA 4M3CB 5GZCA 1PZ7A 1C57A 1DIWA 1A8DA 1V6OA 3A0KA 1KDKA 1WCSA 3FUQA 1HQLA 4M3CE 3RG0A 1RINA 2SBAA 1SLAA 1CR7A 1NXD1 4OZXA 2WT1A 4P14A 3FUOA 3WDTA 3AZVA 4ITCA 2A75A 3IPVA 1WW4A 2NMOA 2CYFA 1SFYA 1PZ9A 1GNHA 5CNAA 3UK9A 1FX5A 1V6JA 1YYNA 5DG2A 1MR5A 2AUYA 1DQ5A 1VAVA 1MZ6A 5H9RA 3N7LA 3WDXA 1DQ1A 2GN7A 3USUA 1HQWA 4MYEA 4YZ4A 3WUDA 5T50A 2WT2A 3OYWA 2PELA 2FHRA 5E89A 1LHWA 2WLQA 1JYIA 1V6KA 2ENRA 1DQ6A 5EWSA 2W39A 1Q8PA 1XQNA 4XMIA 1G9DA 2NP0A 1ENQA 1VLNA 1AJKA 2ZGTA 2GDFA 4D69A 3AXDA 3B3QE 1HLCA 2A70A 1OFSA 3NV4A 3N7KA 3WV6A 1UX6A 3M1HA 4XDQA 2PHXA 1GZ9A 1LOGA 2GNMA 2Q5TA 1VALA 3AK0A 1RIRA 4Y24A 2DVDA 1BXHA 3V0AB 3ZXEA 4M3CF 4XMAA 1QDOA 3MW4A 1KITA 2D6PA 1I1EA 2JECA 2UWCA 1G8WA 1V6MA 2UURA 1WW7A 3ILNA 3OJBA 2ZABA 3RSJA 1JXNA 1MS9A 4K20A 1DQ4A 1C1LA 1MZ5A 1S0GA 1UN1A 2E53A 1H30A 1C1FA 1LU1A 1QGLA 3AP4A 4XYXA 1O4YA 3AYCA 4YGEA 3JUUA 5KXEA 1WW6A 5KXDA 1AZDA 1G9AA 1LOEA 4DQAA 3ATGA 4YZ1A 1JN2P 1KJLA 2VW0A 3AP7A 1GBGA 2VY0A 3ZSLA 3U4XA 1SACA 4YZ5A 2P3IA 1LCLA 4XJ8A 2ZKNA 2R49A 4Z8BA 1GV9A 1URXA 3V65A 4I30A 1F5FA 4Y22A 4UW3A 1APNA 4K1YA 4YZ3A 3WNXA 1PZ8A 3A4UA 4Q27A 3USUB 4XJ9A 1W6QA 4YGCA 4R9CA 4FOVA 5LK5A 4BM8A 3SNMA 1WUVA 3OYWB 4KBBA 3POSA 1AF9A 1S0DA 2PHWA 4IQPA 4YGDA 3LSDA 1ULFA 3ZXKA 1MS4A 2AH2A 1BQPA 1SLBA 1W6NA 2DVFA 1SBEA 1ULCA 2VUAA 2VXRA 4PCRA 4SLIA 3VKOA 1FNYA 2VW2A 4DS0A 4C1WA 2A3XA 1LOFC 1D0HA 3SH3A 2ERFA 2KM2A 4FPJA 4YM2A 4GXLA 5GLUA 3A0NA 4YFZA 3M3OA 2EXKA 3OPZA 3H0OA 2D43A 1WBLA 2A7AA 2V73A 1WW5A 5CB7A 4W65A 2OW4A 4BLIA 3D5OA 1W6MA 1MVQA 3ENRA 4AYUA 3ZXLA 3WZ1A 3O5SA 4XBQA 2C5DA 2PHFA 4GWMA 4XJWA 3AYAA 3AZZA 1JW6A 4Q1PA 4XBNA 4WVVA 4K1ZA 1LODA 1GSLA 5JVVA 5GZFA 4AVVA 3MEPA 3PVOA 2R0HA 4YW5A 3WG1A 1DZQA 4YG0A 4XBLA 3RRDA 3UJQA 5IT6A 3WCRA 2ZHLA 4XTPA 1W0PA 4DFSA 2GNBA 4FPKA 3T1LA 4FOQA 1LHUA 4FOYA 2ES3A 3ZVXA 2R16A 1V6IA 1S0EA 5GM0A 5T5PA 4DPNA 1QNWA 3RQ0A 2E51A 1LU2A 1GKBA 4YFWA 4FOWA 2G4IA 3M3EA 4L8QA 3BODA 1O4ZA 5GLWA 4XHXA 4Y22B 1IS3A 2WQZC 3R05A 3OY8A 4Q8KA 3AJYA 4Q8LA 4YM1A 4HL0A 2ZA9A 1F31A 2B7YA 2DTWA 3ZPYA 4XJZA 2VU9A 4R9AA 1W6QB 3AP5A 3T1MA 3JU9A 1MS5A 2JD4A 1W0OA 2NYYA 2PHUA 3ZYRA 2VW1A 5IK5A 1SCSA 1KJRA 1CPNA 1SLLA 3NV1A 4LBQD 2AGSA 1WBFA 4RA0A 5IUQA 1UAIA 1H9PA 1W6NB 4YW1A 2NN8A 3PVNA 1FV3A 2P3KA 2OUJA 4NOTA 3QCWA 2P3JA 4FVVA 5H9PA 1DHKB 1UZYA 4Y20A 2EXJA 3R4SA 2UU8A 2WSUA 3VV1A 2JJ6A 4BOWA 1SLTA 5DUUA 3O12A 1QU0A 1OQ1A 2D3SA 4ATFA 1FAYA 3BOPA 2D6KA 2V5YA 2DVBA 3GNEA 4LBQA 4UW5A 5H9SA 3TB0A 1W6MB 4DRRA 3QLQA 3WCSA 3FLPA 4Y1YA 4DRVA 3N7MA 3FFZA 3WDVA 1Q8VA 1ZM1A 2E7QA 1B09A 4Q1RA 3HR9A 4ISQA 1N3PA 4XXPA 1ZA4A 4YG3A 3VKMA 4XJAA 4XXAA 3OBTA 1LECA 3POYA 3M3QA 4AGRA 5FRAA 1QOSA 4Q2FA 2OVUA 1A3KA 3AJZA 2SLIA 1SBFA 3FLTA 1CONA 1KDMA 3M3CA 4XJUA 1ULEA 4XIOA 3WOGA 3RMYA 3SH4A 5DZFA 1UPSA 3DUIA 1IKQA 1HKDA 1VAMA 5IK7A
chains in the Genus database with same CATH superfamily
1WLWA 4AI0A 2WNEA 5KC6A 4LOSA 1N1VA 2F6BA 4AFCA 5JSRA 4DEQA 5C3RA 5FKBA 5FJKA 3AX4A 2DURA 4MOAA 5IYYA 3IPVB 3IKWA 1DDLA 4EWDA 2VMIA 3NV2A 1PGSA 3WP3A 2PQSA 3RWKX 4CEYA 1N1SA 1R1ZA 2E31A 3PHMA 1PMJX 1YO8A 4YW4A 1XYNA 5LATA 2PMWB 1US3A 1XB9A 4MGYE 3VBUC 3WW4A 5FY8A 3D0SA 1JTZX 1AX1A 3MW2A 1NCQC 1PM7A 5ERLA 4A3ZA 5H9QA 4BIFA 4BMEA 4MLOA 1NE4A 1R092 3HD8B 4QPGC 5CKMA 5D21A 5C8CC 1LEMA 3NAPA 1EPWA 2EAAA 1W03A 3PVEA 3VBOA 1TME3 1UYYA 4Y20B 5FPZA 5JMCA 3UT0A 1Q3EA 3IBMA 1DZRA 5F39A 1Z7S2 1I5ZA 5BNPC 1ULDA 3RJRA 1HX6A 3HNBM 2OPKA 3IMNA 3K3OA 1Y7BA 2HEYF 3OBRA 2VVEA 4WM7C 3VBUB 4A45A 3DXTA 4P9GA 5T5OA 5FOBB 1WLTA 1FYUA 2JDYA 5CA6A 2OT7A 1QQP2 1NCQB 4E2GA 4Q4Y1 4ARXA 3LFMA 5GZDA 4P9XA 2W47A 4QPGB 4Y1ZA 3KQ4B 5C8CB 1PK6A 3U14A 1VBE3 3ZYJB 1CAVB 2DTYA 2VZ1A 4WVWA 2VJXA 3DPRC 1YXWA 5CIRA 3VDDA 5JUVA 1JOJA 2O8QA 5BNPB 4IW3A 1AR61 3I8TA 4WM7B 2VQTA 3V64A 2XUMA 5GALA 4HXCA 2DFCA 3V0BA 2ZHMA 4JC1A 1XNKA 1L7RA 1JHNA 3B69A 1ZZCA 2LTNA 4FCAA 4MXWB 4YVWC 1UU5A 2WABA 3DPRB 4DUVA 5BNNA 1PGW2 1UYXA 3NSTA 2PHLA 2GC1A 1K5JA 4CRQA 4LBJA 2VQ0A 3NMBA 4JV4A 1BK1A 4JKMA 2VTXJ 2XJTA 3WF2A 5KWRA 1JYNA 1S1AA 2B9VA 1UWWA 2ARBA 2VH9A 4CDXC 4CU6A 5LY1A 1BBT1 3M7AA 4NIAA 3ZYPA 4DEVA 4NRQA 1PNFA 3V0AA 4N8MA 2VG9A 5IVVA 1CESA 2QQMA 4NHKA 3WQ0A 1UMZA 1EV12 1BVVA 1WMFA 2F4LA 3WVJA 5D2AA 1WMDA 2VBPA 4CDUA 1ND3A 4IEQA 3NJYA 1WLCA 3QH7A 5JI7A 4Q4V3 3B00A 2BTVC 1W39A 1COV3 4CDXB 3K48A 4GH4C 2QUOA 3AFKA 4E4SA 3OBAA 1S2KA 2C26A 4UAPA 1ACCA 2DV9A 2G9ZA 5A7WB 5FXZA 3VDCA 2XLFA 4QU1A 3AKRA 4CTEA 5J96B 5CBLA 4QB6A 1QH7A 1POV3 2VZTA 4F7ZA 5T52A 4LBOA 2EALA 2VQUA 4XUQA 2YMZA 4JGZA 1G9CA 4ISRA 3MUZ1 3AZWA 2A73B 2XQRA 3T4HB 3ZR6A 3B9IA 3OTFA 4LKEA 5FO8B 2BPA2 5FYYA 4HLTA 3BKZA 3E1F1 3ORJA 4O9GA 4D6RA 5IFPA 4YSFA 4JGYB 3NKGA 2L9LA 5T5LA 3KF5A 1F9KA 3NNFA 2NZ9A 4PF5A 4V2WA 4YGBA 1SPPB 3IB3A 3MIDA 1PO12 5EYYA 5CG9A 1UCXA 3FJSA 3NJXA 5F5QA 1S0BA 3WNNA 2A6ZA 2VECA 3FL7A 1ASJ1 1BEV2 1Q8SA 1T2XA 2VZQA 2CGNA 4XHBA 3J8F1 2Y60A 1HJGA 4AGGA 3IIIA 4LULA 4XC9A 1LOBA 2NLRA 1MEC2 2RS32 5AVAA 2DVAA 3I2JA 2XB6C 5LZ6A 1ONAA 2PFWA 3FBYA 3NKTA 3CIHA 1EP0A 4QX7A 4BLJA 2JKBA 2CWMA 3NWKA 1S0IA 2RHPA 3PUHA 3R4UA 4PIXA 1AXKA 4XF4A 4AEDA 4EN0A 2KD7A 1OURA 3POEA 3S7EA 2ZGQA 3H1YA 4NHLA 1C8M2 1NT0A 4TN7A 1ENXA 4NO4A 4CEWB 3D4KA 4P9LA 1IHMA 3EO6A 1I9RA 4YW2A 2WO2A 3N4MA 3PJYA 4ZKTB 1N3QA 1WGPA 1MVEA 2RS12 3SLIA 1LOAA 4GKXA 3PNAA 4LR4A 1DYPA 4MXVA 4S2FA 2RE9A 3PU3A 3U1XA 5DQ0A 4URAA 5LASA 1EAH1 2TEPA 3AM2A 2W52A 4DO0A 4ZZ5A 3E6CC 2ZZJA 3VLBB 2JG9C 3A21A 4BK4A 3RMXA 1XE8A 4BH9A 1YI9A 1XOYA 5EFUA 2EAKA 5D8AA 4CDQA 2JB4A 4AG4A 1ZNPA 4XUOA 3SKVA 3ASIA 5A32B 2BFUS 5K7PA 2P37A 1XNDA 1QQP3 4QHZA 1QY4A 2D3PA 4UYBA 5E88A 1J59A 2HWF1 3BCWA 1H1IA 2O1QA 4NMIA 2RDRA 3O1MA 3ZSKA 1D4M1 2B39A 4K9SA 1LJ7A 4IEXA 3E6DA 4XTMA 4CCMA 2D6OX 4ZU7A 5FREA 2QQOA 4XEZA 4JKKA 1SCRA 4DXRA 4PBOA 1W6PB 4Y1UA 2CAVA 2W1SA 4CU8A 1QJX3 3LPGA 4LOTA 3LSEA 4FO9A 4GB31 2YFZA 1AR93 3PTYA 4MVTA 4XFIA 4D8MA 4DIQA 4S2HA 3VBHA 3JB4C 3NNMA 1FOD2 4IE6A 5EXOA 4QQOA 1YHFA 3Q9OA 5C7GA 4QPWA 4ZXKA 5EIYB 5FZEA 1H2MA 2ZKLA 1H8TA 3ELNA 4PIYA 2OKXA 3IDBB 3WT3A 1MACA 1QF3A 1O3SA 3IM0A 4KGGA 4RGKA 4UFKA 2RDQA 5KHHA 4PQ9A 4Z2WA 1MS8A 5I8YA 3ZSMA 4GKYA 3AKTA 4QXHA 3IDEA 3OSDA 4QAWA 5FK8A 3ZYIB 2BVVA 3G7DA 5DUVA 3VBSA 1OH3A 2IXIA 4AVTA 4FPOB 1W2NA 3AZYA 5GKAC 2XJPA 3ZFGC 1V6OA 1DIWA 1A8DA 1E57A 3A0KA 3JBG2 3J7HA 3M70A 4AI8A 1P8JA 4SBVA 2SBAA 4DB5A 2H0VA 5C6CA 1NXD1 5I8TA 5FZ6A 2WT1A 5FTTC 3ZFFA 3FUOA 4UF0A 1QJFA 1DCSA 4CCEA 5C5UA 5K9YA 1CGPA 5JZGA 1OI6A 4MUVA 3NNGA 1I5PA 2Y34A 1YFWA 1YYNA 1W2AX 1W28A 2MEV3 2RR11 3RWNA 3ZMNA 4AHWA 1ODNA 3ZFGB 3AMMA 5H9RA 3WDXA 2P1BA 2GN7A 2VM9A 3M3IA 2P3YA 5T50A 4E2QA 2FHRA 1LHWA 4WM8C 2WLQA 2ZX3A 4QQPA 2PLV1 4HSJA 1H1AA 4MGZE 4HN0A 1G9DA 2R042 1UXZA 2NP0A 4FFHA 1W9FA 3B02A 4OFGA 3VBRA 2GDFA 4D69A 3CKHA 5HV4A 1O3QA 1MQTA 1W3VA 4W6YA 3NV4A 5F2WA 3H8OA 5FXWA 4XDQA 3AKQA 5JR2A 4I0BA 1PO13 1OLQA 4LO5B 1LOGA 2OPWA 2JXAA 2Q5TA 4N9IA 4WM8B 1VALA 4Y24A 2DVDA 1BEV3 3ZXEA 4M0HA 3F95A 1M4WA 2JECA 4LUKA 5IVYA 1RUNA 3PMSA 3RZLA 5L9VA 2UURA 1WW7A 3JD71 4GJZA 4UFLA 1VJ2A 5L19A 2RS33 4K20A 4UFMA 5DDJ2 2W94A 2ZEZA 1DYOA 1UN1A 2IVIB 4BDVB 1ULOA 2BJSA 3AYCA 4YGEA 2PYTA 1QJZA 1JUHA 2BOIA 1HRV3 1HW5A 3ZFEA 1AUYA 4UFIA 2X29A 4YZ1A 2YU2A 1KJLA 1VPHA 5FPBA 2VY0A 2JDUA 3EBRA 1VMJA 3WF0A 4HMZA 3ZSEA 2VZSA 3W20A 1LCLA 2ZKNA 2R49A 4Z8BA 2VNOA 3GZAA 1CAWB 3PL0A 1TMF3 1PGL1 1FMD3 1GOGA 4CCDA 4UW3A 3TRSB 5HXMA 3OD0A 2RS13 4KU7A 3LPFA 4OHVA 3IZOA 4IEVA 4MHRA 1AYN3 1RVF1 2IUWA 3HBKA 3WNXA 5APAA 5F3IA 4R9CA 5IHRA 5A33A 2QQLA 1H2LA 1HB4A 1VBC1 3RZKA 4B3NA 2CAUA 3SNMA 1V9U2 4KBBA 4AK3A 2YBPA 1S0DA 1RUE2 3LEGA 1HB2A 1J83A 1MS4A 2AH2A 2ZJCA 1SLBA 3RGBA 1SBEA 3VGIA 4DS0A 5L7OC 1F5JA 3O1PA 2KM2A 5GLUA 2IXCA 2JDMA 2IXLA 3M3OA 4EN6B 1H2NA 1K42A 1DLCA 4J1WA 4M4RA 1RUJ1 2D43A 1VBD1 3H0OA 2A7AA 2V73A 5CB7A 3RZZA 4D7YA 5KR7A 2OW4A 1WMXA 3D5OA 2GSYA 1AL21 2WNVA 1PO21 4FFGA 4XCAA 5IAXA 2IC1A 3TEWA 1HB1A 5I93A 1JW6A 4XF9A 2W9XA 4JX0A 4PIZA 4WVVA 1GSLA 1H0BA 1W9WA 4J25A 3GJAA 4X6RB 1X33A 4KU8A 4YW5A 2UY8A 3WG1A 1NE6A 1DZQA 4YG0A 5C4WA 2AC1A 2ZEYA 3HIFA 4IERA 2GC3A 3UJQA 2FQPA 4CP9B 3I3MA 1VAKA 2VO5A 2ZHLA 4E4DX 1FOD3 4CPBD 3T30A 5CKQA 2ARAA 2QQPA 2GNBA 1ODMA 2WZ8A 4FPKA 3T1LA 3ZVXA 2HWB3 5GM0A 4P00B 3RQ0A 1LU2A 1GKBA 5E1RA 1JI6A 2VMFA 2WINB 2G4IA 5EJ3A 4META 2E7AA 1Q5OA 2QFEA 3OF1A 2XHNA 3BODA 3IIAA 2IXHA 1KXGA 3FHQA 4XFGA 1L7LA 4XHXA 3AJYA 4MX3A 1OQEA 3NJZA 3T0DA 2XL7A 2VZUA 4Q4W2 1W6QB 1NLQA 3LAGA 1MS5A 1W9TA 2JD4A 2XPJA 2C4XA 3MFAA 1W0OA 3PDQA 1POQA 1NOVA 1CPNA 2AEYA 1GP5A 3JBG3 5A80A 1SLLA 4B7EA 2VGDA 1ZRCA 1WBFA 5IUQA 3VHPA 1UAIA 1CD3G 1H9PA 5FMDA 1RUI2 1ZBA2 2WFF1 5FOJB 3H3LA 4CDWC 1RUC1 1XNCA 1WCDJ 4KL1A 3BU7A 4L99A 4RSUA 4Z07A 2ORXA 1UMIA 2WSUA 3VV1A 2JJ6A 3TEZA 3UGGA 3KGZA 3OUIA 2UYAA 5CYYA 3BOPA 4DRRA 1W6MB 2HWD2 3WCSA 4BQWA 3FLPA 5DAPA 4FBFA 1JOPA 1QJU1 1Q8VA 1ZM1A 2E7QA 2Q1ZB 4QX5A 4IGQA 4Q1RA 3RI9A 4AEJA 3HPNA 4CDWB 3JXSA 2EVXA 3JQWA 3QACA 4NE9A 5FWEA 4E4HA 4CCOA 3VKMA 2Y6GA 4XJAA 2VTXA 1SDDB 3POYA 4E8CA 3M3QA 2R043 5FBZA 4UFHA 2EIEA 4Q2FA 5FY7A 2XVGA 1UY1A 1CZSA 3VD9A 4HVOA 1SBFA 3X29B 2Q1FA 1KDMA 4KWLA 5FMBA 1B35C 2VBBA 3GHNA 4XIOA 5CEHA 5FQ0B 3RMYA 1UYZA 2VMEA 3I59A 1BCXA 3GF6A 4OI4A 1EPZA 3RYPA 1IKQA 3LEKA 4O65A 1RUD1 5AC91 3O14A 5IK7A 2CDPA 1UY3A 1E5IA 2IXKA 4PQQA 4OHYA 2WNUA 4Q4Y2 2JB8A 2DF7A 3Q8CA 4FP2A 5B2GB 4Z82A 3AMPA 3OEBA 1LGCA 5DDJ3 4LQRA 1B35B 2DCKA 3SXWA 2VMHA 1KS5A 2RVAA 4RS5A 2P34A 4GALA 1W05A 1AR62 2WT0A 1A6CA 1D2SA 2GAUA 2Y33A 2DYCA 2WQ4A 4WBBA 3H7YA 2Y6HA 1AHSA 4COVA 5FZDA 5K4LA 3O1RA 4AHXA 3HT1A 3EJKA 3A7QA 1QH6A 2CGPA 2J1AA 3R6SA 1UKRA 5FKCA 4FPCA 1STMA 5A6QA 5CFCC 4XURA 4HFSA 2FMDA 4LMFA 2W68A 2RMU3 2R061 1OH4A 2VMCA 3HNYM 2RDSA 4M3CA 4A6OA 4MADA 4LBQB 4IE4A 4QGMA 4A44A 3C3VA 4CZSA 2XVLA 4N53B 3NNJA 2ZGOA 3I4IA 4IL7A 2VMDA 1AR73 1V9U3 4HOOA 5FZHA 4IEPA 5HCFA 1R1A3 2JDZA 4QWNA 1BBT2 3N9NA 2X05A 3E6BA 1RUE3 5CFCB 2XBO3 3AVRA 4FPEA 1QWRA 3LDBA 4FXKB 2J1EA 3R4DB 2W2IA 2AREA 4TXWA 4EZ4A 3WDYA 2ZMNA 3KLSA 4XOGA 4AI9A 2QVSB 4LBNA 1GLHA 1O5LA 3WDUA 1H8VA 2B42B 3LFIA 3HNMA 1W6OA 4CEYC 1D7PM 2I07B 2Y8KA 2G9GA 3ZKUA 3TN91 4RHV1 1OLME 3AYEA 2EIGA 1MZEA 4YYOA 2VAUA 2Y0OA 4FQZA 3USSA 1GZTA 4KMQA 2LW8A 1JU3A 1XE0A 3LA2A 1O5UA 1U0AA 3T2TA 2BQPA 2WQ8A 5GZGA 1WCUA 3VBOC 3ZXFA 4Q4X1 5ACA1 4KI5M 2DDUA 3MFCA 4O7XA 4PI0A 3O1UA 3RVHA 3DN7A 4N7UA 4AVBA 1ND2A 3VZJA 2V09A 1LOCA 1W2UA 2Y6KA 1UIKA 2VD7A 3FZ3A 1VP6A 1U5IA 4KGQA 4LORA 4PLMA 4O9EA 1O59A 2DCYA 2WO3A 3P6BA 1RUF1 1WCKA 4QGLA 5FZOB 2QDRA 4IDZA 2C9KA 3VBOB 3TNQA 4RQPA 2JD9A 1A34A 2BWCA 2AENA 5I0DA 2PHRA 1J3QA 3DYOA 1IS5A 1AR83 1E5HA 1HRI1 3J8F2 3PLQA 1UOBA 3CJIA 4HK9A 4IE7A 4Q4W3 5FP4A 4AHYA 4C1XA 2ZS6B 4E27A 3WSOA 4TTGA 3QH6A 3B5LB 5A7QA 3T3YA 1W8OA 5L73A 3T2PA 2GMPA 4BB3A 4KH9A 4BYYA 2P2KA 4XIKA 1H4HA 1AXYA 1QJY1 5FK7A 5J7MA 1FPN3 1ENSA 1NY71 3O0WA 2DUQA 3HMYA 5BNNC 5C9AC 1ZBA3 2P6HA 1CN1A 4ES8A 3FN9A 4AGVA 1IS4A 1US2A 3P3NA 4W50A 2WKKA 5J98B 4AQ2A 3ZX7A 1UZZA 2GH8A 4WVMB 3BIEA 3V0BB 2A6XA 1HDKA 2XVKA 1CIYA 1AX0A 2CTVA 2ZX4A 1C5IA 3CMGA 5SV8A 2PHDA 4P08A 5DG1A 3W59A 5BNNB 5C9AB 3OGGA 4FPHA 4INDA 1UU4A 1WMEA 4IGPA 4YW6A 3INAA 1N1YA 2XHKA 1OFNA 3ME2A 3D6EA 1W0NA 4LHKA 2R6QA 5L9BA 3WHTA 2E63A 4M0NA 5JAXA 4CDUC 3AKPA 1ND3C 3KWVA 1BKZA 3WDWA 3RZGA 2FZ1A 1N1TA 1UD1A 3ALQA 1EAH2 4Q5OA 1EUUA 2ZHKA 1LENA 3B93A 3T09A 4AFDA 1QOOA 3KHBA 4L9BA 2HWD1 4PI2A 4YPJA 1CWPA 1YEWA 3VL9A 2AZ5A 5IVEA 2WC2A 3LCPA 4NROA 1GP4A 1KQRA 1R081 4FP3A 2LALA 2YUEA 4CDUB 3H8XA 1ND3B 1QMJA 2YXSA 4Y26A 4JGZC 1BYHA 1W90A 1J3RA 2WZEA 4Q4Y3 3WINE 4XACA 5GLVA 2HWF2 5FPVA 3M4FA 2UYBA 3U07A 1D4M2 4OVEA 1UU6A 4QDQA 4AEKA 4QX8A 4ZHNA 1WKYA 1SFPA 1AR63 2HYXA 2OZJA 4NRMA 3QBQA 5I0TA 5DMYA 1OUSA 3BTYA 5FYHA 1OKQA 2OUHA 4LKDA 5FZIA 3WG3A 3D0JA 4JGZB 2DFBA 4GB32 4H14A 1DBNA 1RL3A 4NAOA 1ZRRA 3LKJA 5BNOA 3PU8A 1F4AA 4U2AA 1PHMA 1OOPA 1Z78A 2B5HA 3VZLA 3LB9A 4OI1A 5FMOL 5JI9A 4UW6A 4EN8B 2X5IA 3S57A 2YU1A 1DGLA 3O7OA 2CY6A 2WSVA 3B7MA 2BNOA 2XWBB 3MIBA 1NQJA 3IN9A 2Q30A 1LGBA 4QQLA 2ZGPA 5JPMB 4TLGA 5KXBA 3VDAA 2EXIA 1OVPA 2A3WA 4AEDC 5F7UA 2ZCWA 4ZZ8A 2BGCA 2GMEA 1BBT3 1U5XA 2W91A 3AB0A 3MF6A 4MV2A 4Y5Z0 3J9SA 3ACIA 4EYUA 4KWJA 4HANA 5KC5A 5C3SA 1JYVA 1ZBE3 1ULGA 5FYUA 1W2OA 1Q8QA 3OGRA 2AR6A 1G9BA 4LBKA 2E33A 3MLKA 3PIGA 1KD7A 4KNCA 2ET1A 4CCNA 4QKBA 4Y1XA 4DY3A 2GC0A 5KHJA 2YHJA 5A1FA 4D3WA 1G86A 4LA3A 5JIAA 2YV8A 5FZ1A 4HVQA 5JWPA 2RR12 5FYVA 5FO7B 1W8ZA 1RUH1 1U12A 4YVWB 5KXCA 2WZR1 1IGOA 3QD6A 4QMAA 1DQ0A 2LM3A 4FPYA 1QKQA 1DGWX 2I45A 2QQUA 4ZONA 3VHNA 1X50A 2WYSA 1VBE1 3ZSJA 1VBA1 2VOKA 2PLV2 4XUPA 3H9AA 2CV6A 3VD5A 1AX2A 5L9RA 1Y9QA 1NA1C 5D8AC 4YM3A 4QM9A 5DZEA 4CDQC 1BVP1 4MZUA 1PZ7A 1C57A 2LROA 2OXBA 1OT5A 1RINA 5DAXA 4CP2A 2HJIA 4JQRA 3RDIA 1VMFA 2NQYA 2R32A 3AZVA 4CPBA 5KHIA 5E16A 4XAAA 3IPVA 1GNYA 1ASJ3 3I2OA 1NA1B 4NPLA 4CU7A 3LOBA 3UK9A 1Y43B 3J8F3 3IDCB 4GH4B 1QXRA 4ES9A 5ABJC 3MIEA 1DQ5A 4NIGA 4AW7A 1JZ3A 3KCXA 3JD72 4P9JA 2OS2A 1DQ1A 1KGYA 2AACA 3U4SA 3VBHC 3PUQA 4LEJA 4CE8A 3OYWA 4OUMA 3GCXA 4YVSC 1V6KA 3R0RA 3U10A 1W8TA 1XC6A 4PDWA 5EP9A 3ABZA 1W3XA 1DQ6A 1PIV1 2BBAA 1ZVFA 2IWGB 2W39A 2VCBA 2WIIB 4XFBA 3CDZB 3BN6A 5E6HA 5ABJB 3IAPA 1AJKA 2W46A 2FMYA 3HT2A 5FY4A 1SEFA 3VBHB 2GZWA 2C24A 3N7KA 3VBSC 2ZTNA 4Y33A 3M1HA 5DAVA 5C5TA 5JLVA 4FAHA 1PGL2 1UOJA 2GNMA 2ET7A 4YVSB 1CAVA 4CU9A 3AK0A 1UOGA 1RVF2 3AMNA 5FDBA 1BXHA 1EUTA 2RM23 4HPKB 3GDBA 1TNRA 1QDOA 3DEMA 1W9YA 3MW4A 1H1MA 1VBC2 4E2SA 1KITA 3IMMA 5EHDA 5HBAA 3ZFFC 2QBXA 4MGIE 5JZGC 2ZABA 3RSJA 4GZ9A 1DQ4A 3K4DA 2RJLA 5IAVA 4UOJA 1HXS1 2E53A 2XLGA 1IQDC 4K8RB 3AP4A 4XYXA 1CJDA 1O4YA 1RMU2 3DPRA 3AMHA 3N9PA 4D7TA 5A1LA 2JKXA 1WW6A 1AZDA 4XQDA 1E5RA 3AL6A 4NHMA 2JDAA 4LJHA 4DQAA 5J1XA 3ATGA 1G9AA 1RUJ2 2FBEA 1VBD2 2VW0A 3ZFFB 5J3UA 2D98A 3AP7A 4LHNA 4PF1A 4QHBA 1OPOA 1AL22 1PO22 2Q1MA 1NYWA 3OGVA 1EYBA 2IFRA 4XJ8A 3POFA 5LA0A 1URXA 1Y4WA 4I30A 1F5FA 1R093 4Y22A 4XFFA 4K1YA 5FCCA 3T0AA 3N9LA 1PZ8A 4K7JA 4AXOA 2XXZA 4XJ9A 4YGCA 1O8PA 1MQTC 4YWAA 5LK5A 1Z7S3 4TWTA 1XRUA 4W4ZA 5A3WA 4GB33 3HN3A 1PMHX 2YBSA 5F2SA 3RZJA 3N9QA 3THDA 5JXHA 5FUIA 4IQPA 1C5HA 3U75A 4YGDA 2VXRA 1BQPA 4PCRA 4SLIA 3Q8AA 3DV8A 4H7LA 4ZU4A 2JG9B 4GMP1 1LOFC 4DXTA 3LQCA 4XF0A 3MLJA 4Y4RA 4HBNA 4GXLA 1OA4A 3KCCA 1MQTB 4LK7A 1HN1A 2ZX1A 1WA6X 5F32A 1WW5A 4W65A 5FFOC 5JR7B 4AYUA 1SMVA 3H1WA 4IEYA 4XDPA 5F37A 3WZ1A 2BP6A 2C5DA 4GWMA 4AAXA 3ZFEC 2JENA 4Y5SA 2XKPA 3ZYGA 4BQ4A 5A1AA 5JXIA 2YPJA 1LNSA 4K1ZA 3SKJE 1YQ8A 1AYM1 4JGYA 5JVVA 1GWKA 3MEPA 2WFF2 2R0HA 3CL1A 3BPSA 4XBLA 3O1OA 2W87A 4CVUA 5IT6A 1RUC2 1ZZ6A 3A22A 2FDJA 1F2NA 1JHJA 4DFSA 4O61A 1FI2A 3K77A 4BZ4A 3OEAA 2YB7A 5C3OA 4GMP0 4N90A 2VC9A 4FOYA 1LHUA 3ZFEB 2ES3A 4EN7B 4N7IA 4OCTA 1W8UA 3LOIA 3KV6A 3DYMA 4YFWA 5M0TA 1HV0A 2WN2A 4LO4B 1EV13 1O4ZA 1ZREA 1QJU2 3R05A 1UQXA 1J58A 2QQNA 3OY8A 3O1TA 2PLV3 2ZA9A 2Y64A 4R4ZA 1F31A 5T3NA 1GR3A 3KMHA 4XJZA 2Y6JA 1XBFA 1W8NA 5FP7A 5A3OA 5A33B 4D0QA 1QHDA 1YQ6A 4D94A 2NYYA 2PHUA 2B4KA 2VW1A 3HQXA 4IEZA 1KJRA 4E9KA 1RTVA 1QJX1 3NV1A 4L2NA 4LBQD 2AGSA 2E9QA 4L0PA 4RA0A 4XQWA 4CEWA 2WNVC 1AR91 5IVFA 3FBMA 4YW1A 4CUGA 2OUJA 4FTSA 1UX7A 4NOTA 5LEKA 2YYOA 2P3JA 4R52A 5AC92 1RUD2 3HQUA 3R4SA 4IESA 4AQ6A 5ISLA 4BOWA 1HB3A 5DUUA 1HV1A 3SC7X 1OQ1A 1X8EA 1W06A 3C7OA 5C4WC 3W5NA 2D6KA 2DVBA 3GNEA 1BK0A 2J7MA 2WNVB 1JZ8A 3QLQA 5A3NA 5FYZA 3ECQA 1JODA 5FY5A 4MSVA 1K5MA 3CHXA 3WDVA 3KV9A 2CHHA 1ST8A 1B09A 3I97A 2BVBA 1BHGA 4EWAA 4EZHA 4ISQA 1OA2A 4OQ8A 5J09A 1ZA4A 5FPXA 5A7NA 4EV0A 3I3BA 4B8EA 2BGOA 2XR4A 4ZPIA 1S2EA 3WQBA 3K4ZA 5A32A 1QOSA 4NHXA 3RYKA 3AJZA 2R071 4BQYA 1XNAA 2XGXA 3FLTA 4A2UA 4XDOA 4DMIA 3M3CA 4ZS3A 2PXJA 1ULEA 1MEC3 2VZVA 2R062 5FBJA 1OVSA 3SH4A 2VTFA 2MEV1 2WR9A 1UPSA 3DUIA 4DXSA 3ZXLA 4ORFA 2PHFA 2XQXA 1W99A 3KB5A 5A3TA 4BU2A 4C90A 1VBC3 2Z42A 4C0HA 5CZKA 5HCAA 2ZACA 3M8LA 3UJOA 3KHCA 1C8M3 3HOBA 3BIWE 2CNAA 1UOFA 4NRPA 5FP3A 5G05L 4DY5A 3OPWA 5JOZA 1VE0A 1AJOA 4L92A 2PTMA 2W08A 5JXJA 1UKGA 1X82A 5JOYA 3DF0A 3OOXA 2Y38A 3BTXA 3H1MA 3K2OA 3NRUA 4IEWA 1OBNA 1TVGA 3K3NA 1XE7A 1RUJ3 4Q0UA 2GALA 1BMV1 1AVBA 2WNOA 4AI1A 2D6MA 1CPMA 5EJ1B 5IJRA 1X8MA 2YROA 1AL23 3K4AA 1PO23 3MF9A 5A3PA 4JQTA 3VUOA 4K3UA 3TOJA 3TN92 4XE9A 4RHV2 3D8CA 5JCTA 1CAXA 5EYXA 5IWFA 3TAYA 2ADEA 5FZ0A 4CXYA 3BUCA 1ZRIA 3KM5A 4L11A 1H2KA 1LB2A 1RMU1 5FYIA 2H0BA 4Q4X2 4UBHA 1JUIA 5ACA2 5J36A 3OB8A 4JRAA 1Z0HA 2GU9A 3L2YA 3ZMOA 2WS91 5JOWA 4P5YA 5ANNA 5T54A 2EF6A 2BUKA 4B4PA 4QX0A 1HRV1 1DFQA 2WNUC 3NQHA 5FLIA 1GOFA 4A4AA 2Q0AA 3I3EA 3TEYA 2I2SA 3ZFGA 1O6UA 5L7OB 1S2BA 4QT6A 1REDA 2IFWA 1RUF2 4RL7A 2CL2A 1JMUB 2WBKA 1FATA 5CKNA 1YUDA 1VB2A 2BEOA 4RS5C 3O0XA 1TMF1 1FMD1 4YG6A 2JDKA 5A6XA 1J1LA 5FR3A 1HRI2 4FXGB 3ZKYA 2J1TA 3APBA 3C7EA 1YRZA 4M01A 5FZ9A 5LWBA 3GCWA 2Z4FA 1AYN1 1YCIA 5LBBA 2R1BA 1UO9A 2ADDA 2VOWA 2K2SA 4C8DA 2VNGA 5IFTA 5BPXA 1C8NA 2HWE1 1QJY2 2HH9A 4CP0A 3ROUA 3VL8A 4AAPA 1CAUB 1NY72 1LHVA 2K9ZA 2PN5A 2WDBA 2HWC1 2WFF3 3I2HA 5F1RA 3P5BA 2EXHA 2GC2A 4RS5B 1T6BX 5LBEA 1RUC3 4XFAA 4GAZA 5HXVA 3FWEA 4OULA 4WM8A 2MNGA 4AVSA 5BNQA 4M00A 2ZGRA 3WY6A 2D97A 1D2QA 2WRAA 1OF3A 1VRH1 2N7GA 3FLRA 2YGLA 3C7FA 4YW3A 3ZIXA 5F3CA 5DUXA 3C8XA 4OQ9A 2ZGKA 1REFA 4JDOA 4CCKA 2QQJA 5JZGB 2C0ZA 2A6YA 4OMCA 4P02B 3MI8A 1N47A 3SCHA 3I2GA 2XDVA 1MPXA 1QJU3 2ZGSA 3GM8A 3IT8A 3PURA 1BJQA 4P5HA 4KWUA 3UGFA 1PX4A 5CAZA 3WUCA 3ST7A 2LRPA 4JTOA 2D6NA 4X8PA 4LNVA 3RZHA 2CU5A 4LTAA 2VCAA 1Y9GA 4G3YC 5B4XA 2JG8A 4Q0PA 2ZX0A 3WW2A 1XYPA 3T2OA 2F17A 1GFF2 5HCBA 3SITA 4J1XA 1LESA 3WW1A 3H3UA 1NAEA 3I3QA 4QXCA 4RGGA 3ZLIA 3ZN6A 2D7FA 3WEZA 1CZTA 2VVFA 5DXDA 2RJKA 2W0XA 3CZJA 2FDFA 3B01A 4AWDA 1R082 1XXNA 5AC93 1V6NA 1NCRA 4ZS2A 4TLFA 4YRDA 3WG4A 3CBNA 4QD2A 5TSWA 1JZ2A 4TZDA 4DINB 1NKGA 4BQ1A 2D44A 1GWLA 4G4FA 1M06G 4PLOA 1JOBA 2ZMLA 1W6OB 2P6CA 1J1TA 1MS3A 3D3AA 1HJFA 1YI7A 4FPLA 4AVAA 1W9SA 1LULA 4EE2A 2RS51 3EB7A 2HEWF 5BY5A 3JCIA 3ACHA 3CLPA 1UY2A 1ND2C 2FDGA 2DCTA 5CFDA 4DUWA 4HVRA 4BMBA 3VD3A 2CDOA 3RI8A 3KS7A 4I0WB 1Q8OA 5LA9A 4LA2A 2E32A 3UL2A 3WR0A 1GYKA 4RQPC 1GZWA 3S5AA 2X10A 3DXUA 3LDKA 3POBA 5FYBA 4DXZA 4ASMB 4GD4A 1ZZ9A 2BWAA 3CU7A 2CWSA 3CJIC 4QKFA 5GZEA 1ND2B 1DF0A 1H6XA 2DUPA 1ALYA 3S6PA 3ZOIA 4AHZA 1UZVA 2XUEA 1OC1A 4QDRA 3AC0A 4KWKA 4BISA 3SISA 3N3HA 4EWEA 1RUG1 1IG3A 3L2HA 3BI3A 3IDAA 1VB4A 3JB8A 4RQPB 4AE2A 4HONA 4AI3A 2J42A 4CP9A 2QE3A 5F9TA 4MGTA 4XFCA 2XONA 3CJIB 4HG6B 3SCFA 1PX3A 2E6VA 3WP5A 3W21A 4GJYA 4HSLA 1RUOA 4L97A 1DZTA 3I49A 3VKNA 5JIUA 1YIPA 3P3PA 1NLRA 2P4EA 4PBPA 2J1SA 4ONUA 3PUAA 4LO8A 2K0GA 2A6WA 1VMHA 2VZRA 2FZ2A 2V4AA 4YM0A 2IVJA 1O3TA 4J6GA 2PHTA 3LA7A 4GWJA 4YNIA 1LGNA 2YG0A 2C9AA 4QDSA 1CQ9A 3AYDA 3TN93 3ZXAC 4QPYA 3RPQA 4LE3A 1RUH2 2CGOA 3KQRA 2WZR2 2C1FA 1FNZA 4QX1A 3ES1A 4B4QA 5GLTA 1SBDA 1RXGA 3UETA 5F6LB 1MS0A 3UKNA 5IK8A 4A7ZA 1PMIA 1VBE2 5ACA3 3I3DA 1VBA2 4COUA 5FYSA 5JMOA 3SCGA 1JS9A 2C6SA 3UV9A 2LS6A 3BTAA 2ZGNA 4ZXEA 2TUNA 3DL3A 2DBIA 3WG2A 2R0FA 2WWJA 3LA3A 4YW7A 1MS1A 4R9DA 2WYFA 4IV1A 4A3XA 2ZZQA 1QDCA 1RUF3 5F3GA 3WNLA 2FCUA 4OHWA 3IAQA 4QB2A 5EV7A 3WW3A 1IOAA 3EHKA 2VOTA 3NAPC 4H55A 2J1RA 2UY9A 5FUNA 3MBWA 1D0GA 3WP4A 5A6ZA 2RMU1 4CEYB 2OZ6A 1FXZA 1CX4A 3FHIB 4K21A 2IXJA 2NM1A 2GN3A 1LHNA 3ZR5A 2YBKA 4P9WA 1PVC1 3I7DA 2ZAAA 3KSCA 5K0UA 2WFPA 1DQ2A 1QJY3 2BFUL 2ZMKA 3HN1A 2WJSA 5FZKA 2H6CA 1R1A1 4MGQA 1GANA 4LUMA 1WD4A 2A6VA 1YFXA 2XBO1 1GICA 1PK6C 3CJXA 2X5IC 3NAPB 4NJ4A 5FPAA 4DZGA 4ET7A 1V00A 5IK4A 1PIV2 2AYHA 3VDDC 2O0OA 2XKOA 1Q56A 1UY0A 3PUSA 2ZXQA 4DUXA 3FUQA 1ZRDA 1HQLA 4M3CE 5AVPA 2E26A 2P17A 2X8KA 2WWSA 5DAWA 3MICA 1CR7A 1TQ5A 4OZXA 5FXVA 4P14A 4DNYA 1PNGA 2QNKA 4IV3A 4LHSA 4EN9B 4CSWA 1KFUL 1PK6B 2VUDA 2X5IB 3FE5A 1WW4A 3I2DA 2CYFA 1SFYA 3NO8A 1PZ9A 1GNHA 1RUI3 4IE5A 2G9FA 2Q8OA 3VDDB 3PTRB 1QXPA 5DG2A 4JTNA 3OD4A 4HETA 2D40A 4P9IA 1O8SA 4XCBA 3NNLA 1VAVA 1VBB1 1OMIA 2WO7A 1J84A 3I54A 3L9JT 2RDNA 3USUA 1K12A 1GUIA 2QCSB 2Z79A 3P1IA 3PUIA 3T08A 1HXS2 5C3PA 4Y4YA 1SDWA 1WA4A 1XNTA 2JX9A 2PELA 1SZBA 2HWD3 5E89A 3ZIWA 4D7SA 1JYIA 3VB9A 3TNPB 2BW8A 5IVCA 1R083 3ZN5A 1Q8PA 3KT7A 1XQNA 4XMIA 4V1PA 4CYDA 4N53A 4XVHA 4QXKA 3AXDA 1HLCA 1V0AA 2A70A 2JWPA 3LD8A 3WXPA 3WV6A 2EA7A 1UX6A 3MIFA 2PHXA 2VZ3A 4URTA 4ASKA 1GZ9A 4Q0QA 4BHPA 3MHZA 1AR81 1L3JA 1LKNA 5F5CA 5LB6A 4QHOA 5IVJA 3V0AB 1UYPA 1DG6A 2VR4A 4XFHA 1JU4A 1RHI1 1RJ7A 3KCYA 1I1EA 2UWCA 2W3JA 4JHTA 3UKTA 5KHKA 4GULA 3RZMA 3ILNA 1FPN1 2XJQA 1MS9A 2XMLA 4B1MA 3MLLA 2EIBA 1S0GA 3KF3A 1H30A 4A41A 3FC0A 5I91A 3WQ1A 2BZDA 4N43A 4A6SA 1LOEA 2ZAHA 3MIHA 1JZ5A 5DPNA 1F35A 2GP5A 1GBGA 5ANQA 5EPAA 3ZSLA 3OUHA 4QPIA 5AFBA 2QQIA 4IGOA 1SACA 1NQDA 3THPA 5FAXA 4PDWC 1Y3TA 1GV9A 2J22A 3A23A 1OSGA 4Z1VA 4AZZA 2VE1A 4I0AA 4MGSA 5A7OA 3WF4A 1APNA 4YZ3A 3A4UA 3EYPA 1AYM2 2FDIA 3JQXA 4FOVA 4FTEA 5DABA 2QZ3A 5I0RA 4BM8A 2GH2A 2A1XA 3OYWB 3POSA 2QKDA 1AF9A 4KG8A 5FZOA 3ZXDA 2VNVA 5DN2A 2PHWA 4LHLA 4EROA 2X09A 4PDWB 3ZXKA 3RS6A 1W6NA 3S30A 1F8VA 2VUAA 4JDMA 4RR3A 2QZ2A 2BBVA 1FNYA 3E97A 1FT9A 4C1WA 5FZMA 2A3XA 1RUH3 4Z2AA 2WZR3 3SH3A 3FX3A 4UXAA 1PVXA 3GBGA 4YFZA 2EXKA 5C33A 3OPZA 3TYJA 4E4ZA 1WBLA 3DYPA 1ZYBA 1SFNA 3SEEA 4BLIA 1VBA3 5BV6A 2XWJB 1IG0A 1MVQA 2B8MA 3UNPA 1XSQA 3MO4A 5F8PA 4AEDB 1TME1 1JH5A 4XJWA 3W9AA 5FWJA 3AYAA 4Y3OA 1SHWB 4A7YA 5FZAA 1QJX2 2O14A 4WVMA 1E5SA 3T4VA 2JDNA 4B4RA 5K8SA 1AR92 4NN0A 2VPVA 2WL1A 3PVOA 3WP6A 4QU2A 3F2ZA 3RRDA 3VZMA 4A42A 3WCRA 5C9AA 2Z5WA 5FYMA 2Q8EA 2BRTA 4XTPA 1W0PA 3T2QA 5IVBA 4HKWA 2J1UA 3MIGA 4NWWA 3VBFA 4H2AA 3THCA 1U5ZA 1R64A 1NUKA 5LA1A 4FOQA 1RC6A 1V6IA 4DPNA 5T5PA 1QNWA 5G04L 2F4PA 3MDPA 4FOWA 4HKLA 5C70A 3M3EA 3VZKA 4L8QA 4G9SB 3QOPA 5FYTA 4AF9A 1DP0A 4CXWA 1ZZBA 1IS3A 2WQZC 2Z2SB 3ETQA 4Y22B 5FY9A 5FYCA 4Q8KA 4Q8LA 4YM1A 5C71A 4I2OA 2W1WA 2EIDA 4PT6A 3I2IA 3ZPYA 1PIV3 1ZBE1 4R9AA 4XF3A 3T1MA 3JU9A 2BYVE 4Q0SA 4BQ2A 2YFUA 3MYXA 5D8AB 1HN0A 3KVBA 4CDQB 3HJRA 1JZ6A 5FIXA 4F8AA 2R072 3ITQA 1GU3A 4HK8A 5LBCA 1IPSA 1UZWA 2NN8A 2PAEA 3PVNA 2P3KA 4XUTA 4AR2A 1UZ0A 2VL4A 4JZRA 1KS4A 2MEV2 4NHYA 1RXFA 4LLOA 4XW3A 3V56A 1BLZA 4FVVA 3BALA 1UZYA 3C7HA 1H8TC 3KV5A 3SEPA 4Y20A 2EXJA 4WZCA 4XUNA 4JGYC 5A70A 1UW8A 1NX9A 1QU0A 2D3SA 1FAYA 4W8JA 3DKQA 3H3ZA 2VVDA 2JEMA 4UW5A 3S0MA 1JYTA 3OG2A 1UY4A 3VBUA 3WQ7A 2XJVA 4MGKE 4Y1YA 3CQOA 1HXS3 1NCQA 3N7MA 3FFZA 4Q4V1 2ID4A 2Y6LA 1COV1 2HEVF 4QPGA 5C8CA 1MZFA 4R4XA 1H8TB 5FLHA 4XXAA 1GQHA 1LECA 2VMGA 1DGRN 4FI9A 4Y5TA 4AGRA 5BNPA 3OGJA 1BMV2 3ZXGA 1C3HA 4WM7A 1A3KA 2BV4A 2SLIA 1POV1 4AEMA 3EMRA 4HZFA 1UF2C 2OA2A 5FO9B 1EAH3 1UIJA 2QDNA 3VBSB 4K40A 3SQOA 4MXWA 2WUHA 5DZFA 3ETPA 4FTBA 2VXJA 4XXPA 3ZN4A 4CEWC 4F3JA 2HYKA 3FFQA 3WNMA 2V5DA 3TBDA 1CVNA 2ZGLA 3LDRA 4BWOA 1YIFA 3CEWA 2WWUA 1UMHA 5JSOA 4BQXA 3HBZA 3OY8B 3WLUA 2WS92 1LTEA 4UF0B 4FPGA 1O4TA 2ZGUA 1SLCA 4HT1T 4QQHA 2DU1A 4NIIA 4AFAA 1UL9A 1ZZ7A 4TSVA 4B29A 4BPZA 4COZA 1HRV2 2HWF3 3B94A 3ILFA 4GMP3 4I01A 2A71A 1D4M3 1LHOA 3J7NA 4HN1A 4UI9L 4YVWA 4GWIA 4Q26A 4WZFA 1DU3D 3NV3A 2OQ7A 4XZUG 3URFA 2DWRA 4YLZA 2YY1A 3VBRC 1AXZA 1W8FA 3VKFC 3ACFA 4AFMA 3Q8EA 4IE0A 1K5MC 1POV0 1FV2A 3JZVA 1TMF2 5CISA 1FMD2 3AXEA 1BZWA 4BQ3A 3UGHA 1ENRA 1O91A 2VULA 1AYN2 2HLEA 3K51A 2RM21 1YJKA 4XZPA 1ULPA 2DBNA 1G7YA 4CDXA 3VDBA 4NR1A 2ETEA 5I0SA 4QX3A 2HWE2 2XJRA 2W92A 3GJBA 2JDHA 1AYM3 2QTWB 3VBRB 1GQPA 1G9FA 5A7WA 2HWC2 2BOJA 3PJQA 1K5MB 1SG3A 4BXSV 1OD3A 3SHRA 3MPPG 3ILRA 3WF1A 3WF3A 2ZX2A 4AFBA 1NA1A 1QXJA 1VRH2 1OQDA 3M2MA 2GNDA 4QM8A 3S7IA 2GMMA 4P9YA 4GH4A 4LBMA 2DU0A 5FUPA 5FV3A 2V4VA 1O7FA 5LRSA 1H4GA 2MHFA 3AKSA 3GALA 3MGUA 1IZ3A 4IETA 1X9PA 2BNMA 1S0CA 4LIVA 4NVPA 1IPJA 1GOHA 1K3IA 2WA4A 2GNTA 1R091 1SPPA 4WVZA 5F5IA 5D1IA 5JDBA 4IXLA 3OGSA 4WV8A 2P5BA 5ABJA 3MV01 1GZCA 1Z7S1 2RR13 4AQTA 5LBFA 3WD5A 3POGA 2NMNA 4R8HA 1OHFA 2D93A 4UBGA 1NLSA 1QQP1 2YC2A 4NUBA 2WAAA 1YWKA 1K45A 5E8AA 4YVSA 5HV0A 1AL0G 1OUXA 2HWB2 4DOUA 4ASLA 3GYDA 4PLNA 1N3OA 1VIWB 1NZCA 5T55A 4HPKA 3PMEA 1V6LA 5JOXA 1A78A 3N7JA 1YNAA 2Q8CA 5AFEA 3RYRA 1X36A 5HI0A 1TE1B 2CSGA 2XL9A 4LO6B 3MV11 3J7MA 3MW3A 4XF1A 1CIWA 3THTA 2RS52 4AL9A 1YJLA 3T0BA 5GJ6A 4UFJA 1IS6A 2DUOA 2OQ6A 4QKNA 1CAXB 3VN4A 2VZOA 3B9CA 5FZ7A 2JE7A 4LKFA 1CZVA 3I2KA 1RITA 4KBZA 4Y1VA 1WD3A 2BGPA 4YZ2A 4NIDA 4OZOA 3NL1A 1GNZA 1PGW1 3AP9A 1IKPA 1DLLA 2R073 3J7LA 1JZ4A 1RB8G 5C8WA 3JD73 2I74A 4D6SA 2FDHA 1OXCA 5FLJA 5LCWL 1S0JA 5FZ8A 3GBWA 2OYZA 4AI2A 4RD7A 5JSPA 1YLLA 1LRHA 2EICA 1X9TA 1KFXL 4QGNA 1LAJA 1RUG2 4XPVA 2XG3A 1W8HA 3FHAA 1EV11 4UT5A 1YQCA 2KR2A 3ZDVA 3PVBB 3K75B 3OPTA 3VZNA 1YQ2A 5C4WB 4UW4A 5B4NA 1KRIA 2RV9A 4CUAA 1OA3A 4GIQA 4NPRA 2ZHNA 2JG9A 3Q8BA 4JCKA 2FD8A 4NIHA 5FMCA 3RJ2X 1RVF3 2BERA 4BCUA 2RG4A 5JPNB 2KA3A 4XILA 2ILMA 3KV4A 4NPMA 1W6PA 3GZEA 4LBLA 5FZLA 3DCQA 4OHXA 4XETA 5A3LA 2JICA 4A7KA 1CJPA 1OF4A 3O1SA 3BPZA 1DGRA 2JG8C 5FMOS 3WHUA 3HAGA 1REEA 3LE0A 2HBUA 2HKXA 4EQVA 5GLZA 2NPIA 4GQ7A 4K8FA 1LOFA 1TNFA 4CP1A 5A6YA 2VCMA 1RMU3 1S4CA 4TYSA 3H42B 3AZXA 3CNAA 1WZXA 3E5XA 4F83A 1QOTA 2D6LX 4CCCA 3POWA 3ACGA 3HVDA 2WS93 1VBD3 4JDNA 2ZOEB 1NCRC 1H9WA 1PO11 4I3GA 1LEDA 2JG8B 2R30A 4FQ4A 3ZYFA 2R7EB 4GA9A 4BIOA 4LT5A 3KVAA 5DAQA 1IPKA 4RYDA 1BEV1 4V2VA 2LUWA 2W95A 5LA2A 3LEMA 3N36A 2W5FA 3SH5A 2ZEWA 5IATA 2WAOA 3OCPA 3E5UA 4X6QB 3ZN6B 4CUCA 2JE9A 1J3PA 3DGTA 2UWBA 2D3RA 3W58A 4LO7A 1MEC1 2RS31 2RMU2 3NW4A 3LWCA 2ATFA 1RJ8A 2YZ4A 3AFGA 5CFDC 1NCRB 1H6YA 3TWIA 1JBCA 3U78A 3G6JB 3WNPA 3E5QA 3N35A 4QQ2A 1NXMA 1YC61 1PVC2 2ZGMA 3BYWA 5FP8A 2XOMA 3HQRA 3C7GA 5J37A 2HWE3 5CU1A 1AR72 3RFRA 5LK7B 1C8M1 3ON7A 1R1A2 2HWC3 2XBO2 1WLDA 1OPMA 2PA7A 1VRBA 2VCCA 4R9BA 4FPFA 4GWNA 1I3HA 5CVRA 3LEIA 4JKLA 4OUSA 5CFDB 2JDPA 2ZBJA 3I59B 4OLLA 4RGAA 5DUWA 1TG7A 1I6XA 4HKOA 1JYXA 5HPOA 2R1DA 1VRH3 4COWA 2FCTA 5BYNA 2RS11 4BK5A 5T5JA 5IW0A 3LIGA 5FY0A 1GZWB 2WNUB 3BVCA 1C28A 2UWAA 4OHZA 5DZGA 4W6XA 2A5ZA 4I09A 4JHZA 1XU1A 4IEUA 2FCVA 3VKLA 1JYCA 1UNBA 2ARXA 1S0FA 1SLIA 2VOXA 3AMQA 1C4RA 3ZXJA 3Q8FA 1VBB2 3BB6A 5FP9A 3H8RA 1EY2A 3GZTB 1DYKA 1HQNA 1TEIA 3EXUA 4U36A 1W2TA 4LPLA 1S55A 2VNRA 1QNYA 4CUBA 3C2UA 3BU0A 5FY1A 5FZGA 4AOCA 4ATEA 4LLFA 3KT1A 3LF7A 2E7TA 2YPDA 5BXXA 2A3YA 5C3QA 1JYWA 3AP6A 2DVGA 3CO2A 3O0VA 2XH6A 4OI2A 4M3CB 5GZCA 1GWMA 3POJA 3GZUC 2WN3A 1KDKA 1WCSA 5CADA 1G6NA 5FZ3A 2Y6FA 3RG0A 3SMHA 4LK6A 1WWYA 3GGLA 1SLAA 3WNOA 3O1VA 3GXUA 4CCJA 2RS53 3WDTA 4ITCA 5L36A 1OLRA 1AR82 2A75A 5I0UA 2VUCA 5HCHA 2NMOA 3KZ4C 1FOD1 5CNAA 3H7JA 1CAWA 1FX5A 1V6JA 4IV1C 1MR5A 1RHI2 4D6QA 2AUYA 4YARA 1JZ7A 2HWB1 1RUD3 4PHZA 4LITA 5EQUA 3CZUA 1FPN2 3OBZA 1MZ6A 3ZM8A 3N7LA 2AEZA 4BJ0A 1HQWA 4MYEA 3J4UH 2MPFA 1VR3A 4YZ4A 3KD4A 3WUDA 2WT2A 2XLAA 2YDEA 1OKOA 3H50A 3S5QA 1XNBA 2ENRA 3ZYHA 2DCZA 4H7MA 4RFT0 5FJHA 1SQ4A 1QJEA 4IV1B 4COYA 5EWSA 5K0UC 1RUG3 3BGAA 3TEXA 4B7KA 3J26N 1QEXA 1ENQA 1VLNA 5A3UA 1CX1A 1F15A 2ARCA 1UPIA 2ZGTA 4M4PA 2PQQA 3JBG1 4MHUA 5KBFA 2PAKA 3DKWA 3MZHA 2XJSA 3B3QE 1L7QA 1OFSA 4ZU5A 1TZOA 1KEXA 2G1MA 4JAAA 4QX2A 4CXXA 4OYUA 2JE8A 2QJVA 4BQ5A 1RIRA 4OUEA 2R063 4M3CF 4XMAA 5K0UB 2O8OA 2D6PA 5L7OA 3ES4A 1G8WA 1V6MA 4IV3C 1GMMA 2BNNA 1QIQA 4JRLA 3OJBA 3NJVA 2YC0A 5LRRA 1JXNA 3WNKA 1MZ5A 1C1LA 3U37A 4MG2A 4UWDA 1C1FA 1OLMA 1DGWA 1LU1A 1QGLA 2VZPA 2YGMA 4OMDA 2VOVA 3JUUA 4Q29A 1T6GC 4CA9A 5F5AA 5KXEA 1WCQA 5KXDA 1ZA7A 1W8WA 2WA3A 1JN2P 2R041 3UYJA 5FPUA 4IV3B 2B45X 1CAUA 4XAEA 5A7SA 4AQSA 3U4XA 4YZ5A 1YFUA 3WX5A 2P3IA 4I3PA 4FAGA 3W5MA 1GQGA 1TME2 3VHRA 1NZIA 4B1LA 3V65A 2H6BA 4N9HA 3H8UA 4C91A 2WLPA 4N53C 2VQAA 4Q27A 4RHV3 3USUB 1W6QA 1ZRFA 5FPLA 3OUJA 1WUVA 3AL5A 4W6WA 4MO3M 1HIXA 1Y9MA 1ZX5A 4Q4X3 3LSDA 1ULFA 5DDJ1 5LW9A 3PIJA 3VKOA 2DVFA 1ULCA 2GP3A 2YC4A 3D82A 2VW2A 4K6BA 4C0BA 4I02A 1D0HA 4LKSA 4LIUA 4X8NA 1PVC3 2BDRA 2ERFA 4YM2A 4FPJA 5F3EA 4H3WA 1XPWA 3A0NA 3BOWA 2Y26A 5FZCA 4NWVA 5FZ4A 2XJUA 3GHMA 2VBDA 2IZWA 4QXBA 3HEIA 5EZWA 4IEOA 5BUVA 2OX0A 1W6MA 3ENRA 4S2DA 3ZO0B 2QQKA 1ZBE2 3CF6E 3RNSA 2K46A 2KXLA 5JXGA 3O5SA 4XBQA 2X53S 2PAMA 4N43C 4XQ4A 1ZZ8A 3AZZA 4KG0A 3VHOA 4CDWA 1HRI3 5FZFA 3UESA 3ZDSA 4Q1PA 1D4VB 2HBTA 3N9MA 4XBNA 4ARYA 4QPIC 3KGLA 1LODA 1NG0A 5GZFA 4LXLA 4AVVA 4BXFA 4FT8A 3VD4A 1GP6A 1XU2A 2WO1A 4FSJA 5EJZB 1AR71 1V9U1 5BNOC 2Q8DA 1OOPC 4MH0E 4LE4A 2FDKA 1RUE1 2VUJA 4IUGA 1A8MA 3ACLA 4N43B 3KT4A 5FQ0A 2R16A 1S0EA 1VBB3 3EQEA 4AVCA 2E51A 1RYYA 4QPIB 3U0ZA 1XYOA 3MPBA 4KQ7A 1OD5A 3DECA 4Q4V2 4QKDA 4RR3C 1V70A 2JIJA 4RN5A 5GLWA 5BNOB 2J1VA 1OOPB 1COV2 2OIIA 4HL0A 4PJYA 2B7YA 4CCLA 2DTWA 1B35A 2ZPXA 2VU9A 3AP5A 4FFIA 3GBFA 1O3RA 2DCJA 4Q0VA 3ZYRA 1UXXX 5I8SA 5IK5A 1SCSA 2Z69A 2D5FA 2W1QA 2JIGA 2ORZA 1YFYA 2TNFA 1LR5A 3VD7A 4FFFA 1Q43A 1W6NB 2QQVA 1ASJ2 3ZYBA 2Y0IA 4RR3B 4RFRB 1FV3A 5J48A 1RGSA 5FXXA 3QCWA 3UKVA 3I2FA 5H9PA 1XSRA 1DHKB 1PM4A 5A7PA 4JVAA 2UU8A 1RHI3 1SLTA 3ZPOA 3LGRA 3O12A 1U5YA 4ATFA 2RJ2A 4EJRA 5F6KA 2V5YA 3BTZA 4LBQA 3TB0A 5H9SA 3VZOA 3U11A 1XJAA 1YQ5A 2B46X 1IQAA 3K46A 4DRVA 2D5HA 3VBFC 2WZPP 3HR9A 4OI0A 4Z92B 1N3PA 5CFCA 2QQWA 2W1UA 4YG3A 3FMGA 5LEJA 1F4HA 4Q4W1 4QB1A 5KHGA 3OBTA 4XABA 2BU9A 3IWZA 5A3MA 1W04A 5FRAA 3HWJA 5LY2A 2OVUA 3NVCA 1X7NA 3POIA 2Q4SA 2V72A 3LIHA 1CONA 2TBVA 3N9OA 2G19A 4XJUA 3VBFB 4BE3A 1RUI1 2RM22 5SV5A 1ZBA1 3WOGA 4S2GA 4ZY9A 4BA6A 5CG8A 4NAMA 5FZBA 3LZZA 2B9UA 4E8DA 2ZEXA 3AVSA 1HKDA 1VAMA 3MUY1
chains in the Genus database with same CATH topology
1WLWA 4AI0A 2WNEA 5KC6A 1N1VA 2F6BA 4AFCA 5JSRA 3AX4A 2DURA 3IPVB 3IKWA 1DDLA 4EWDA 2VMIA 3NV2A 1PGSA 3WP3A 4CEYA 1N1SA 1R1ZA 3PHMA 1YO8A 4YW4A 1XYNA 4MGYE 3VBUC 3WW4A 3D0SA 1JTZX 1AX1A 3MW2A 1NCQC 1PM7A 4BIFA 5H9QA 4BMEA 4MLOA 1NE4A 1R092 3HD8B 4QPGC 5C8CC 1LEMA 3NAPA 1EPWA 2EAAA 3PVEA 3VBOA 5JMCA 1TME3 4Y20B 5FPZA 1Q3EA 3IBMA 1DZRA 5BNPC 1Z7S2 1I5ZA 1ULDA 3RJRA 1HX6A 2OPKA 3IMNA 4WM7C 1Y7BA 2HEYF 3OBRA 2VVEA 3VBUB 5JLVA 4P9GA 5T5OA 5FOBB 1WLTA 1FYUA 5CA6A 1QQP2 1NCQB 4E2GA 4Q4Y1 5GZDA 4P9XA 4Y1ZA 4QPGB 5C8CB 1PK6A 3ZYJB 1VBE3 1CAVB 2DTYA 4WVWA 3DPRC 1YXWA 5CIRA 3VDDA 1JOJA 2O8QA 5BNPB 1AR61 3I8TA 4WM7B 3V64A 2XUMA 5GALA 2DFCA 3V0BA 2ZHMA 4JC1A 1XNKA 1JHNA 3B69A 1ZZCA 2LTNA 4FCAA 4MXWB 4YVWC 1UU5A 3DPRB 5BNNA 1PGW2 3NSTA 2PHLA 2GC1A 4CRQA 4LBJA 2VQ0A 4JV4A 1BK1A 2XJTA 5KWRA 1S1AA 2ARBA 2VH9A 4CDXC 1BBT1 3M7AA 3ZYPA 1PNFA 3V0AA 2VG9A 1CESA 4NHKA 3WQ0A 1UMZA 1EV12 1BVVA 1WMFA 3WVJA 1WMDA 4CDUA 1ND3A 4IEQA 5JI7A 1WLCA 3QH7A 4Q4V3 3B00A 2BTVC 1W39A 1COV3 4CDXB 3K48A 4GH4C 2QUOA 3AFKA 4E4SA 1S2KA 2DV9A 5J96B 2XLFA 3AKRA 4CTEA 5CBLA 1QH7A 1POV3 4F7ZA 5T52A 4LBOA 2EALA 1G9CA 2YMZA 4JGZA 4ISRA 3AZWA 2A73B 3B9IA 3OTFA 2BPA2 5FO8B 4HLTA 4O9GA 4YSFA 4JGYB 3NKGA 5T5LA 1F9KA 4PF5A 2NZ9A 4YGBA 3MIDA 1PO12 5EYYA 5CG9A 1UCXA 3FJSA 5F5QA 1S0BA 2A6ZA 2VECA 1ASJ1 1BEV2 1Q8SA 2CGNA 4XHBA 3J8F1 4AGGA 4LULA 1LOBA 2NLRA 1MEC2 2RS32 5AVAA 2DVAA 2XB6C 1ONAA 2PFWA 3FBYA 3NKTA 1EP0A 4BLJA 2JKBA 2CWMA 3NWKA 1S0IA 2RHPA 3R4UA 4PIXA 4XF4A 1AXKA 4AEDA 4EN0A 3S7EA 2ZGQA 3H1YA 4NHLA 1C8M2 1ENXA 4NO4A 4CEWB 3D4KA 4P9LA 1IHMA 3EO6A 1I9RA 4YW2A 3N4MA 3PJYA 4ZKTB 1N3QA 1WGPA 1MVEA 2RS12 3SLIA 1LOAA 4GKXA 3PNAA 4LR4A 1DYPA 4MXVA 4S2FA 2RE9A 1EAH1 2TEPA 3AM2A 2W52A 3E6CC 2ZZJA 3VLBB 2JG9C 3RMXA 1XE8A 4BH9A 1YI9A 5EFUA 2EAKA 5D8AA 4CDQA 4AG4A 1ZNPA 3ASIA 5A32B 2BFUS 5K7PA 2P37A 1XNDA 1QQP3 1QY4A 2D3PA 5E88A 1J59A 2HWF1 3BCWA 1H1IA 2O1QA 3ZSKA 1D4M1 2B39A 4K9SA 1LJ7A 4IEXA 3E6DA 4XTMA 2D6OX 4ZU7A 5FREA 4XEZA 1SCRA 4PBOA 1W6PB 4Y1UA 2CAVA 1QJX3 3LSEA 4FO9A 4GB31 1AR93 3PTYA 4MVTA 4XFIA 4S2HA 3VBHA 3JB4C 1FOD2 5EXOA 4QQOA 1YHFA 3Q9OA 4ZXKA 1H2MA 2ZKLA 1H8TA 3ELNA 4PIYA 3IDBB 3WT3A 1MACA 1QF3A 1O3SA 3IM0A 4KGGA 5KHHA 4PQ9A 4Z2WA 1MS8A 5I8YA 3ZSMA 4GKYA 3AKTA 3IDEA 3ZYIB 2BVVA 3G7DA 5DUVA 3VBSA 2IXIA 4AVTA 4FPOB 3AZYA 5GKAC 2XJPA 3ZFGC 1V6OA 1DIWA 1A8DA 1E57A 3A0KA 3JBG2 3M70A 4AI8A 4SBVA 2SBAA 4DB5A 2H0VA 5C6CA 1NXD1 5I8TA 2WT1A 5FTTC 3ZFFA 3FUOA 5K9YA 1CGPA 5JZGA 1OI6A 4MUVA 1YFWA 1YYNA 2MEV3 2RR11 3RWNA 3ZMNA 4AHWA 3ZFGB 3AMMA 5H9RA 3WDXA 2GN7A 3M3IA 5T50A 4E2QA 2FHRA 1LHWA 4WM8C 2WLQA 2ZX3A 4QQPA 2PLV1 4HSJA 1H1AA 4MGZE 4HN0A 1G9DA 2R042 2NP0A 4OFGA 3B02A 3VBRA 2GDFA 4D69A 1O3QA 1MQTA 4W6YA 3NV4A 4XDQA 3AKQA 4I0BA 1PO13 1OLQA 4LO5B 1LOGA 2Q5TA 2JXAA 4N9IA 4WM8B 1VALA 4Y24A 2DVDA 1BEV3 3ZXEA 4M0HA 1M4WA 2JECA 4LUKA 1RUNA 3PMSA 2UURA 1WW7A 3JD71 1VJ2A 5L19A 2RS33 4K20A 5DDJ2 1UN1A 3AYCA 4YGEA 2PYTA 1QJZA 1JUHA 1HRV3 1HW5A 3ZFEA 1AUYA 2X29A 4YZ1A 1KJLA 2VY0A 3EBRA 3ZSEA 4HMZA 1LCLA 2ZKNA 2R49A 4Z8BA 2VNOA 3GZAA 1CAWB 1TMF3 1PGL1 1FMD3 4UW3A 3TRSB 3OD0A 2RS13 4KU7A 4OHVA 4IEVA 3WNXA 1AYN3 1RVF1 4R9CA 5A33A 1H2LA 1VBC1 4B3NA 2CAUA 3SNMA 1V9U2 4KBBA 4AK3A 1S0DA 1RUE2 2ZJCA 1MS4A 2AH2A 1SLBA 1SBEA 3VGIA 4DS0A 5L7OC 1F5JA 2KM2A 5GLUA 2IXCA 3M3OA 2IXLA 4EN6B 1H2NA 4J1WA 1RUJ1 2D43A 1VBD1 3H0OA 2A7AA 2V73A 5CB7A 3RZZA 4D7YA 2OW4A 3D5OA 2GSYA 1AL21 2WNVA 1PO21 2IC1A 5I93A 1JW6A 4XF9A 4PIZA 4WVVA 1GSLA 1H0BA 4X6RB 1X33A 4KU8A 4YW5A 2UY8A 3WG1A 1NE6A 1DZQA 4YG0A 5C4WA 3UJQA 4IERA 3HIFA 2GC3A 2FQPA 1VAKA 2ZHLA 4E4DX 2QQPA 1FOD3 2GNBA 4FPKA 3T1LA 3ZVXA 2HWB3 5GM0A 3RQ0A 1LU2A 1GKBA 5E1RA 5EJ3A 2WINB 2G4IA 4META 2E7AA 1Q5OA 2QFEA 3OF1A 4XFGA 3BODA 3IIAA 2IXHA 1KXGA 4XHXA 3AJYA 4MX3A 1OQEA 3NJZA 2XL7A 4Q4W2 1W6QB 3LAGA 1MS5A 2XPJA 2JD4A 3MFAA 1W0OA 1NOVA 1CPNA 3JBG3 4B7EA 1ZRCA 1SLLA 2VGDA 1WBFA 5IUQA 3VHPA 1UAIA 1CD3G 1H9PA 1RUI2 1ZBA2 2WFF1 5FOJB 4CDWC 1RUC1 1XNCA 1WCDJ 4KL1A 3BU7A 4L99A 4RSUA 4Z07A 2WSUA 3VV1A 2JJ6A 3KGZA 2UYAA 3BOPA 4DRRA 1W6MB 2HWD2 3WCSA 3FLPA 4FBFA 1QJU1 4QX5A 1Q8VA 1ZM1A 2E7QA 2Q1ZB 3RI9A 4Q1RA 4AEJA 4CDWB 2EVXA 3JQWA 3QACA 3VKMA 4XJAA 3POYA 3M3QA 2R043 5FBZA 4Q2FA 2XVGA 4HVOA 1SBFA 3X29B 4KWLA 1KDMA 1B35C 3GHNA 4XIOA 5FQ0B 3RMYA 3I59A 1BCXA 3GF6A 4OI4A 1EPZA 3RYPA 1IKQA 5AC91 1RUD1 4OHYA 3O14A 5IK7A 2IXKA 2WNUA 4Q4Y2 2DF7A 4FP2A 5B2GB 4Z82A 3AMPA 1LGCA 5DDJ3 1B35B 2DCKA 3SXWA 2VMHA 1KS5A 4RS5A 2P34A 4GALA 1AR62 2WT0A 1A6CA 1D2SA 2GAUA 4WBBA 2DYCA 2WQ4A 3H7YA 1AHSA 4COVA 4AHXA 3HT1A 3EJKA 1QH6A 2CGPA 3R6SA 1UKRA 5CFCC 4FPCA 4HFSA 2FMDA 2W68A 2RMU3 2R061 4M3CA 4LBQB 4QGMA 3C3VA 4CZSA 2XVLA 4N53B 2ZGOA 3I4IA 4IL7A 1AR73 1V9U3 4IEPA 5HCFA 1R1A3 2JDZA 1BBT2 3E6BA 1RUE3 5CFCB 2XBO3 4FPEA 1QWRA 4FXKB 3R4DB 2AREA 3WDYA 2ZMNA 3KLSA 4XOGA 2QVSB 4LBNA 1GLHA 1O5LA 3WDUA 1H8VA 2B42B 1W6OA 4CEYC 2I07B 2G9GA 3TN91 4RHV1 3AYEA 2EIGA 1MZEA 4YYOA 2Y0OA 4FQZA 3USSA 3LA2A 1O5UA 1U0AA 3T2TA 2BQPA 5GZGA 3VBOC 3ZXFA 4Q4X1 5ACA1 3MFCA 3DN7A 4N7UA 4AVBA 1ND2A 3VZJA 2V09A 1LOCA 1W2UA 1UIKA 4PLMA 3FZ3A 1VP6A 1U5IA 4KGQA 4O9EA 2DCYA 1RUF1 1WCKA 4QGLA 2QDRA 3VBOB 3TNQA 4RQPA 2BWCA 2AENA 2PHRA 1J3QA 1IS5A 1AR83 3J8F2 1HRI1 3PLQA 4HK9A 4Q4W3 3CJIA 4AHYA 4C1XA 2ZS6B 4E27A 3QH6A 3B5LB 5L73A 2GMPA 4BYYA 4KH9A 2P2KA 4XIKA 1H4HA 1AXYA 1QJY1 5J7MA 1FPN3 1ENSA 1NY71 3O0WA 2DUQA 3HMYA 5BNNC 5C9AC 1ZBA3 1CN1A 4ES8A 4AGVA 1IS4A 3P3NA 2WKKA 5J98B 4AQ2A 3ZX7A 1UZZA 2GH8A 4WVMB 3V0BB 2A6XA 1HDKA 2XVKA 1AX0A 2CTVA 2ZX4A 1C5IA 5SV8A 2PHDA 5DG1A 3W59A 5BNNB 5C9AB 3OGGA 4FPHA 4INDA 1UU4A 1WMEA 3INAA 1N1YA 2XHKA 1OFNA 3ME2A 3D6EA 4LHKA 2R6QA 3WHTA 2E63A 4M0NA 5JAXA 4CDUC 3AKPA 1ND3C 1BKZA 3WDWA 2FZ1A 1N1TA 1UD1A 3ALQA 1EAH2 2ZHKA 1LENA 3B93A 4AFDA 1QOOA 4L9BA 2HWD1 3VL9A 2AZ5A 2WC2A 3LCPA 1KQRA 1R081 4FP3A 2LALA 2YUEA 4CDUB 1ND3B 1QMJA 2YXSA 4Y26A 4JGZC 1BYHA 4Q4Y3 1J3RA 3WINE 5GLVA 2HWF2 3M4FA 2UYBA 3U07A 1D4M2 4OVEA 1UU6A 4AEKA 1AR63 2OZJA 5I0TA 3QBQA 1OKQA 2OUHA 3WG3A 3D0JA 4JGZB 2DFBA 4GB32 4H14A 1DBNA 1RL3A 1ZRRA 3LKJA 5BNOA 4U2AA 1PHMA 1OOPA 1Z78A 2B5HA 3VZLA 3LB9A 4OI1A 5FMOL 5JI9A 4UW6A 4EN8B 2X5IA 3O7OA 1DGLA 2CY6A 2WSVA 3B7MA 2BNOA 2XWBB 3MIBA 1NQJA 3IN9A 2Q30A 1LGBA 4QQLA 2ZGPA 5JPMB 5KXBA 2EXIA 2A3WA 4AEDC 2ZCWA 2BGCA 2GMEA 1BBT3 1U5XA 3AB0A 3MF6A 4MV2A 4Y5Z0 3J9SA 4KWJA 4HANA 5KC5A 1ZBE3 1ULGA 1Q8QA 2AR6A 1G9BA 4LBKA 3MLKA 4KNCA 1KD7A 2ET1A 4Y1XA 4DY3A 2GC0A 5KHJA 2YHJA 4D3WA 1G86A 4LA3A 5JIAA 2YV8A 4HVQA 5JWPA 2RR12 5FO7B 4YVWB 1RUH1 1U12A 5KXCA 2WZR1 1IGOA 3QD6A 4QMAA 1DQ0A 2LM3A 4FPYA 1QKQA 1DGWX 2I45A 3VHNA 1X50A 1VBE1 3ZSJA 1VBA1 2VOKA 2PLV2 3H9AA 2CV6A 1AX2A 1Y9QA 1NA1C 5D8AC 4YM3A 4QM9A 5DZEA 4CDQC 1BVP1 4MZUA 1PZ7A 1C57A 1RINA 4CP2A 2HJIA 4JQRA 3RDIA 2NQYA 2R32A 3AZVA 5KHIA 5E16A 3IPVA 1ASJ3 1NA1B 3LOBA 3UK9A 1Y43B 3J8F3 3IDCB 4GH4B 1QXRA 4ES9A 5ABJC 3MIEA 1DQ5A 4AW7A 3KCXA 3JD72 4P9JA 1DQ1A 3VBHC 4LEJA 3OYWA 4OUMA 4YVSC 1V6KA 3R0RA 3U10A 4PDWA 1DQ6A 1PIV1 2IWGB 1ZVFA 2W39A 2WIIB 5ABJB 4XFBA 1AJKA 2FMYA 3HT2A 1SEFA 3VBHB 2GZWA 3N7KA 3VBSC 2ZTNA 3M1HA 4FAHA 1PGL2 4YVSB 2GNMA 2ET7A 1CAVA 3AK0A 1RVF2 3AMNA 5FDBA 1BXHA 2RM23 4HPKB 1TNRA 1QDOA 3MW4A 4E2SA 1H1MA 1VBC2 1KITA 5HBAA 3ZFFC 4MGIE 5JZGC 2ZABA 3RSJA 1DQ4A 2RJLA 1HXS1 2E53A 2XLGA 3AP4A 4XYXA 1CJDA 1O4YA 1RMU2 3DPRA 3AMHA 4D7TA 1WW6A 1AZDA 4XQDA 4NHMA 1G9AA 4DQAA 3ATGA 1RUJ2 2FBEA 1VBD2 2VW0A 3ZFFB 5J3UA 2D98A 3AP7A 4LHNA 4QHBA 1OPOA 1AL22 1PO22 2Q1MA 1NYWA 4XJ8A 1EYBA 2IFRA 1URXA 4I30A 1F5FA 1R093 4Y22A 4XFFA 4K1YA 5FCCA 1PZ8A 4K7JA 4AXOA 4XJ9A 4YGCA 1MQTC 5LK5A 1Z7S3 4TWTA 1XRUA 4GB33 4IQPA 1C5HA 4YGDA 2VXRA 1BQPA 4PCRA 4SLIA 3DV8A 4H7LA 4ZU4A 2JG9B 4GMP1 1LOFC 4XF0