4XFAA

Cysteine dioxygenase variant - y157f at ph 8.0 in complex with homocysteine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLFSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Structures of Mammalian Cysteine Dioxygenase Variants Missing the Cys-Tyr Crosslink
rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 56
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xfaA00
5JAXA 4HN0A 4CYDA 3KSCA 4ONUA 4KU7A 4XFBA 5I8SA 3R6SA 1YFXA 3FZ3A 3E5QA 1UD1A 1SEFA 2MHFA 1J58A 4MGYE 5T3NA 1ZZ8A 5FQ0B 5KHHA 4E2GA 3HT2A 3S0MA 1CGPA 2XHKA 4KU8A 1CAXA 2OZJA 4XF1A 4MX3A 4Q0UA 3ZDSA 2H0VA 2WC2A 1Y9QA 3QOPA 2OYZA 3NKTA 3TNPB 1RL3A 3H8UA 1UCXA 3CF6E 3UKVA 4MH0E 1U12A 4QX5A 3I59B 1ZRFA 4UBHA 1X7NA 3BPZA 3RZZA 3DN7A 4K8FA 3H9AA 5JR7B 3IDCB 1I6XA 5FPZA 1H1MA 3H50A 1H1IA 1VR3A 2I45A 1J3RA 1FT9A 1QY4A 3U0ZA 1YLLA 4JV4A 4AQ2A 2XLAA 1X8EA 5BV6A 3IBMA 4LUKA 4IETA 1LR5A 1RUOA 5J48A 2XLFA 1EY2A 4FAGA 4B29A 1G6NA 2QDRA 1CAWB 4OLLA 5CVRA 3S7IA 1O3RA 4I0BA 3FE5A 4HVQA 2KXLA 5I8TA 2GC2A 5C8WA 2IXCA 4QGLA 3ROUA 2Y0OA 5FLIA 4XF9A 3KMHA 4I01A 3SCGA 3UKNA 1CAVA 4WVZA 2PAKA 1ZREA 3CL1A 1J1LA 2GU9A 1LB2A 1OMIA 2GAUA 4Q29A 1SQ4A 4IEOA 2O1QA 2H6BA 1PMIA 4MGKE 4HLTA 2XGXA 1EYBA 4TLFA 5KHJA 3TNQA 1DZTA 1NZCA 2ATFA 3SMHA 1FI2A 2C0ZA 3IDBB 3LOIA 3DV8A 4J1WA 1XRUA 2PHDA 3IWZA 5LRSA 2VECA 1CAUB 2VPVA 3I7DA 1EP0A 4KWKA 3WW4A 1X82A 1TQ5A 3M70A 4Z07A 4HVOA 4KWJA 4GULA 3PLQA 4PIYA 2P17A 3N4MA 3EO6A 2VQAA 2WFPA 1OFNA 1UIJA 4YSFA 3D0JA 4LA2A 5LEKA 1ZVFA 2FMYA 5FLHA 2Z2SB 3H7JA 4RD7A 5J3UA 3D0SA 5KBFA 4MV2A 2PA7A 5K8SA 3FJSA 1VJ2A 4XFHA 4KWLA 4F7ZA 4PJYA 4MGIE 3HT1A 3NL1A 3H1YA 2BGCA 3MDPA 1J59A 4IEPA 3WW2A 2D5FA 5FQ0A 4OFGA 4IEXA 4META 4J1XA 5I0TA 4EWEA 4E2QA 5JSOA 4I3PA 3M3IA 3BB6A 1ZZ9A 2HKXA 3H1WA 2MPFA 5FCCA 5I93A 3BALA 3NW4A 1YFYA 5FDBA 4BIFA 1NXMA 5I0RA 3DKWA 4IEWA 3PNAA 4MZUA 2IXIA 2Q30A 4JVAA 4AXOA 1WA4A 3I59A 1O3SA 1O7FA 1O5LA 1X8MA 4X6RB 3OD0A 3CLPA 4I09A 5KHKA 1WGPA 2BNMA 4LA3A 4LTAA 1Q3EA 4XF3A 4ORFA 4XEZA 1ZX5A 1UIKA 3ES4A 3E97A 3DL3A 5E1RA 2UY9A 3L2HA 2QJVA 2GC0A 2ETEA 3OF1A 4YYOA 1XE7A 1O4TA 4IEQA 2FQPA 1DZRA 1ZZCA 1CAWA 5I0SA 3LA3A 4YNIA 3H3ZA 4HZFA 1YUDA 4ZU7A 2V09A 2BYVE 3B02A 2Z69A 1IPKA 3LAGA 3UKTA 4JTNA 1QXJA 1YHFA 4XF0A 2CV6A 4BHPA 4D7TA 4QGNA 3LA2A 1HW5A 1O3TA 5D1IA 2OPKA 4QMAA 3NSTA 2CAVA 3OGJA 4XFAA 4ZU5A 1UW8A 2PFWA 1ZRCA 3EQEA 1RUNA 5E16A 2HJIA 3FFQA 5EZWA 4PIXA 3ST7A 4R52A 4D7SA 5BY5A 4HN1A 2GZWA 3RYKA 4NVPA 4ZU4A 5FLJA 4Q0QA 2D93A 2CAUA 3E6DA 3SCFA 2B8MA 2PHLA 4N9HA 3EHKA 1YFWA 1YFUA 2PQQA 1CAUA 1YWKA 3FWEA 3HQXA 4XFCA 4YRDA 3S7EA 5JSRA 4F8AA 4BYYA 4I02A 2ZCWA 3CJXA 3O14A 2PAEA 4I2OA 3ES1A 3NJZA 1ZZ7A 4LLOA 3GBFA 4HMZA 3MPBA 4JTOA 4IEUA 1I5ZA 4I0AA 2QNKA 1JUHA 3BU7A 2B9UA 2QVSB 2PYTA 3MYXA 3C3VA 1PM7A 4UBGA 3I54A 4XETA 4A2UA 1WLTA 1XE8A 1J3QA 4AVBA 4LEJA 2K9ZA 1RTVA 4EWAA 3CO2A 5FPXA 4WZCA 5BXXA 4HBNA 1GQHA 1DGWA 3NVCA 3G7DA 1L3JA 4FAHA 1ZZ6A 3WW1A 3JZVA 2H6CA 3RYRA 1QXRA 4IEZA 2UYBA 2D40A 1DGRA 4WBBA 3KCCA 3E6CC 3RNSA 1ZRDA 2XL7A 5I8YA 1ZRRA 4EWDA 4L11A 4N9IA 3SXWA 3ETQA 3WW3A 5BUVA 1O3QA 2UYAA 2EVXA 3H3UA 4Z82A 2IXHA 3SCHA 1CAXB 2ET1A 3OCPA 4IESA 4Q0VA 2XKPA 4UXAA 2Q4SA 5LRRA 3ACLA 4DINB 5AVPA 4AVCA 4IEVA 3H1MA 4HSJA 5KHGA 2Q1ZB 1LRHA 3H7YA 3SHRA 2OA2A 2XLGA 1V70A 4O9EA 1CX4A 4AVAA 3U10A 3U11A 5C6CA 4BH9A 1ZZBA 5F1RA 2Q0AA 1NE4A 4EROA 3MZHA 3IIAA 3EJKA 2GC3A 3RYPA 3E6BA 4E2SA 4MGZE 2EAAA 2D5HA 4XFIA 2ZKLA 1LKNA 4KL1A 2N7GA 4QM8A 3USSA 1FXZA 3RPQA 4Q0PA 3E5UA 1OI6A 1QWRA 4QGMA 2EA7A 5KHIA 1J3PA 5HI0A 2GH2A 4PIZA 2BEOA 3ELNA 3QACA 5I0UA 4EV0A 1UPIA 2OZ6A 4H7LA 4XF4A 2E9QA 2PTMA 2F4PA 1ZNPA 2DCTA 2XL9A 4YARA 1CAVB 5EFUA 2XKOA 3D82A 4HSLA 5I91A 2IXKA 2CGPA 1GQGA 2O8QA 4QM9A 1EPZA 3LA7A 4Q0SA 1Q43A 2BNOA 5CU1A 1OD5A 4O9GA 3FX3A 4MUVA 1VP6A 4L2NA 4LULA 3LZZA 4R8HA 3RDIA 4LUMA 4X6QB 3PVBB 4IERA 4AQ6A 1NYWA 2IXLA 5LEJA 1RGSA 2ET7A 4HVRA 3KGZA 3BCWA 2BNNA 1Q5OA 3HIFA 4XFFA 2QCSB 3FHIB 1Y3TA 2UY8A 3E5XA 5J7MA 5BPXA 1IPJA 3EBRA 2K0GA 3LWCA 4IEYA 2PAMA 5JCTA 4XFGA 2MNGA 1NE6A 5JSPA 1RC6A 3CEWA 2IC1A 3GYDA 4QXKA 3VHRA 1O5UA 2GC1A 2IXJA 4P9GA 5CADA 1SFNA 4FBFA 2B5HA 4FT8A 3OTFA 3KGLA
chains in the Genus database with same CATH superfamily
5CFDB 5JAXA 1R092 2G9GA 3D4KA 3KSCA 4ONUA 1C8M3 1HQWA 2RJLA 1LEMA 2GN3A 5GLUA 1PHMA 3PJQA 2WLQA 3PURA 1SEFA 1ZZ8A 1IGOA 1MS8A 4AWDA 5A3TA 4OHYA 3S0MA 4XUQA 1V6NA 3DPRA 3ZFEB 5FIXA 5GJ6A 4Z8BA 1IKQA 2BTVC 4FPYA 4KU8A 4QXCA 1CGPA 1CAXA 2ZGUA 4Z92B 3RMXA 3LDBA 4Q0UA 1VBC1 4NRQA 4N43B 4OI4A 2ZHMA 2Y6LA 1AR71 1UCXA 1KD7A 3AP6A 3JQXA 3AMNA 2D3SA 3RRDA 3THCA 1S0FA 3OBAA 1DFQA 3T4VA 1RUJ2 2A75A 5FZCA 1N3QA 1MACA 2A6ZA 1GLHA 1PM4A 4O61A 5FXWA 4FOVA 4QXBA 3ZKUA 2ARCA 1VBA1 4K8FA 3I2IA 5J98B 3BPSA 3PTYA 4JKMA 3RJ2X 4FOQA 1I6XA 4QQPA 1PVC1 2JB4A 1POV1 3H50A 1RVF3 2WQ8A 5FK7A 4BQXA 4JQTA 3AVRA 2HWF1 2GSYA 5A3WA 2ZXQA 1VR3A 2I45A 1M4WA 2FZ1A 5CZKA 4XE9A 4FPKA 4NAMA 3D5OA 4XDOA 1IG0A 1FT9A 3VBSC 1WMDA 3N36A 2W3JA 3N9MA 1YLLA 2VULA 4JV4A 4TZDA 2MEV3 4LBNA 1A6CA 5FO9B 2LTNA 4LUKA 3U07A 1Y4WA 1PK6B 4AFBA 1QQP1 1PGW2 1G6NA 1HRI3 3U4XA 4FP2A 2HWE2 3EB7A 3P6BA 5CVRA 3KT7A 2BVVA 3KCYA 1CQ9A 1H8TB 1WCKA 2WUHA 1K3IA 1J83A 3NNLA 2PHXA 1W6PB 1AL23 1VBB3 4QGLA 3B93A 4Y33A 1G9DA 1FOD1 2NPIA 3ZYHA 4A41A 3KHCA 4ATEA 4COZA 3BTYA 1JUIA 4XF9A 3WV6A 4CDXC 4Y5SA 3W20A 1C8M2 3IN9A 4CU6A 3SISA 2ZX0A 1QJX2 1PX3A 1HQNA 2KR2A 2QUOA 1J1LA 1CWPA 1STMA 3VZJA 1RHI2 5C8CC 3HQRA 4MXWB 3B9IA 1XNAA 4IEOA 4Q29A 4YGDA 3JUUA 3LEGA 2PHFA 4MO3M 3O1SA 1IS5A 2WKKA 3B01A 1PMIA 4MOAA 3ZYRA 3BTZA 5A7QA 1SDWA 4NE9A 3HOBA 4Y22A 3ZFFC 3JCIA 5JXGA 4XDPA 2JDUA 3MV01 2JDAA 2RS51 1H6YA 1V6OA 2WFF1 3OYWB 5EXOA 2FDGA 2VCMA 3R4UA 1NZCA 2WN2A 1GOGA 1WW7A 3AKSA 3C7OA 4A3XA 1S0CA 3SMHA 1FI2A 2UU8A 3OD4A 1R1ZA 2DCKA 2JG8B 1RUJ1 3UGFA 2WT0A 3LOIA 4P5YA 2WSVA 3PHMA 3PTRB 2DUQA 4ISQA 1PZ9A 1XRUA 2PHDA 2RM23 2AZ5A 4PI0A 1NCQB 2ADDA 5LRSA 4XABA 4XQ4A 1OH4A 5LATA 4NRMA 1B35C 2VPVA 3DYPA 3I7DA 3LEIA 3J26N 5GZGA 3T09A 1BJQA 4ZHNA 2ZOEB 3BYWA 4MVTA 4LBLA 1UU6A 4Z07A 4HVOA 4AE2A 1QDCA 4SLIA 1AR83 4COWA 3WDYA 1U5ZA 1X50A 4ASMB 2NMOA 1OF4A 1R081 1OFNA 3VKMA 2P6HA 3D0JA 2FMYA 5IVYA 2OPWA 3W58A 3BU0A 5J3UA 5KBFA 3D0SA 4PBPA 5JXHA 4MADA 3GXUA 2E7QA 4K3UA 3POSA 2MEV2 3FJSA 2VZ1A 2FHRA 4XHBA 4PJYA 3VBRB 3NL1A 1AYN2 1RUC3 3HBZA 5DDJ1 4FPLA 4CP0A 1MS9A 4Y1UA 4XC9A 3NV4A 5F3GA 3WD5A 5FPUA 5FQ0A 4IEXA 4JCKA 1UY3A 1V6LA 2JDKA 1AL22 2WAAA 4J1XA 4YM0A 3ZO0B 1AVBA 5A3NA 3FFZA 5LA2A 2J1VA 4YW3A 5JOXA 4QPIB 4C1XA 1QKQA 1ZZ9A 2I2SA 3O1OA 4LKFA 3ILFA 5DUVA 3ZSMA 3J9SA 1JS9A 4YG3A 2MPFA 3LSEA 2GMEA 5FCCA 3JB4C 3ZXFA 2SLIA 1YFYA 2ORXA 5F3EA 5IK5A 4BIFA 1YJKA 1ENXA 4GAZA 4QT6A 5I0RA 3SKJE 4WM7B 2E31A 5LB6A 1HXS1 2C1FA 5H9RA 5K4LA 4AVTA 3RWNA 1LHWA 1GKBA 1MS4A 3VHNA 2HBUA 4X6RB 1C57A 1ULGA 1BCXA 1H4HA 4CDXA 1W05A 4NUBA 4DFSA 1Q8QA 1LESA 4ASLA 2EIEA 4W50A 2W1UA 1Z7S3 3AYAA 3KVAA 1I5PA 4BQ3A 2ZPXA 3VKOA 2RE9A 1DYKA 4OMDA 5C71A 4XF3A 4ORFA 1ZX5A 1O8PA 3ES4A 3E97A 3O1TA 5BNOB 2ZHLA 4X8PA 3ZIXA 3GJAA 1RVF1 2XVLA 3ZFFA 3OEAA 1A8DA 3TRSB 1BVP1 2XONA 2GNBA 3W5NA 3OUJA 2DVBA 5BNNB 1QJU3 4Q5OA 1UZYA 2MEV1 5I0SA 2Y6KA 4YNIA 2P5BA 1JOJA 2DU1A 4ZU7A 3B02A 1B35A 1HRI1 5DUXA 1YHFA 3OGRA 1NX9A 4AEMA 2CV6A 1SPPB 2A6WA 3ZFGB 1RUC2 3DF0A 4CCEA 2ZGLA 5HCBA 3SNMA 1VBB1 3A7QA 5BNPB 4ZU5A 2HWB3 3AP4A 3MUZ1 3ZLIA 3HEIA 1OLMA 2HBTA 5FK8A 3B7MA 2EIDA 4CEWC 5L7OB 3S5AA 2WS91 4UF0A 4W6XA 3C8XA 1W2TA 4A4AA 1BMV1 4IQPA 1I1EA 3AC0A 2IZWA 1RUI1 3K51A 3MFAA 3PIGA 4DO0A 5IK4A 4HN1A 1XSRA 2AENA 4H2AA 1GWKA 5FUPA 4J6GA 2XWBB 5K9YA 4JGZC 4XHXA 4MHRA 3KCXA 4TN7A 2XQXA 3NRUA 5FZDA 1UYZA 2E33A 4FPEA 2D93A 3ETPA 4AI3A 2QQLA 5G05L 5A1LA 2B46X 1AXYA 5FXXA 2WT2A 4A3ZA 4N9HA 2ZEZA 5CADA 1RUG3 3CZUA 3VD9A 3RZKA 1BBT3 3S7EA 5LY1A 4NOTA 1K5MC 5F6LB 2KA3A 2RM21 2VGDA 3ZPOA 1AR61 1R1A1 1AR91 2YPDA 4H3WA 4E4ZA 4E8DA 2XBO1 1D4VB 3V0AB 3CBNA 1W0OA 2FDKA 1V6IA 4IDZA 1PGL1 3QLQA 2XJTA 1K42A 3VBOC 1NXD1 1ZZ7A 4LLOA 4OYUA 4LBOA 2XHNA 4QQOA 3GBFA 3M3EA 3V64A 2YFZA 4XVHA 3THDA 3MPBA 1AR81 4JTOA 4P9WA 3KZ4C 5T50A 2ZEXA 3DUIA 4YW4A 3N35A 4CDQB 3IB3A 2OVUA 5FXZA 2E51A 5GLWA 1C1LA 2AEYA 3ZDVA 1TZOA 3I54A 4A2UA 2VNVA 4GWNA 3B94A 1G7YA 1QJU2 1WLTA 3WUCA 1J3QA 2SBAA 4AVBA 4LEJA 4XJ8A 4FO9A 1LU2A 3GZEA 4RS5C 1RTVA 4Y5TA 4AHWA 4EWAA 4KGGA 4M01A 3WG3A 1REEA 2XJVA 4XTPA 1RJ7A 4MGSA 5IFPA 2VZVA 1JXNA 1GQHA 1NCRC 1RUC1 4YVSB 5FY4A 5IVJA 4BQ5A 2QTWB 3F2ZA 2YB7A 1QJEA 4FP3A 5H9SA 1H2LA 3KF5A 4ARYA 1PVXA 1RINA 3HJRA 4D94A 2VCCA 4AK3A 3MI8A 5DZGA 4CCKA 4P14A 2OQ6A 1SLAA 4NRPA 1SFYA 2HWB2 2TEPA 4LKDA 1MVEA 4LHNA 3URFA 5A80A 5FYBA 1K45A 5I8YA 2DFCA 3I2HA 1ZRRA 4I0WB 3ILNA 4NHKA 1DP0A 2HYXA 5FZFA 2QQNA 5IVBA 2VW2A 3ETQA 3I4IA 4TYSA 4GALA 4NN0A 3OGGA 4BXSV 5BUVA 3ACFA 1BZWA 1DF0A 2UYAA 5A33B 3K4AA 4CRQA 2GALA 3LOBA 4DIQA 1IOAA 2GDFA 3LB9A 1GP6A 1ENRA 5FP3A 3VZNA 2ET1A 1W9TA 3OCPA 2XMLA 1T2XA 2ZGQA 2LW8A 4Q0VA 4RQPB 3P3PA 4DMIA 3AP7A 3IPVA 4CEWA 2JG9B 3GF6A 3OSDA 2Q4SA 4CXWA 1Z7S1 3JBG3 3VV1A 5FMDA 4WZFA 5EYYA 4XBQA 3VKFC 1HB4A 1OURA 3WXPA 4AGGA 2AYHA 4AGVA 1V9U3 3PVOA 4IEVA 3HN1A 2VL4A 4HSJA 1LOFC 1NLQA 1YIFA 4IE0A 4JGZA 4QD2A 1WMXA 1JI6A 5LBCA 4JX0A 4XUOA 4L0PA 4O9EA 1CX4A 3HNMA 3PIJA 4M0HA 4AVAA 3LQCA 4NMIA 4PDWB 4BH9A 2RS33 1ZZBA 2Q0AA 2R1BA 4YLZA 4KG8A 5G04L 1JN2P 4EROA 3ZN6A 1TME1 1K5MA 1RUF3 3ZXKA 4ISRA 1E5RA 1BVVA 1GZWA 2GC3A 3KVBA 3RYPA 2ZMLA 1XU1A 3E6BA 2Z79A 2D6PA 1JU4A 3POFA 1UKGA 4E2SA 4EYUA 3LDKA 2D5HA 4V2WA 4XFIA 5F5AA 5J09A 3VBOA 1LKNA 2W94A 4Q1PA 2N7GA 4QM8A 5FYSA 1N3PA 1W8WA 1OA2A 3SH3A 3USSA 1T6GC 3DKQA 4QKNA 4XAEA 4XTMA 3E5UA 1QU0A 1R64A 1QWRA 1W6QA 2DCYA 4QGMA 3LE0A 1VB2A 5C3SA 3RZJA 2BGPA 1DGLA 3UJOA 3RZGA 4R9DA 1W6MB 4PIZA 2BEOA 2A71A 3QACA 1ENSA 3V56A 1OUSA 3ZVXA 5IK7A 5F3IA 1IQDC 4K20A 2X10A 4XIOA 1RUH1 1US2A 2HWC3 5F2SA 4GB33 5KC6A 2PTMA 2F4PA 4N53C 2D97A 1ZNPA 2DCTA 1G86A 1VB4A 2XL9A 1ODNA 4NROA 4KMQA 3SQOA 3ZOIA 1NCRA 5EFUA 4AAPA 4PHZA 3RI8A 2P3IA 4EQVA 2IXKA 3LKJA 5BYNA 2CGPA 2DUOA 2O8QA 4XYXA 4YW7A 5LA0A 3VB9A 3PL0A 4AFCA 5DABA 2ARXA 5CU1A 1MQTC 1OD5A 4NIHA 1TG7A 5CKNA 1RUG1 4L99A 1YXWA 1BBT1 5AC93 3FX3A 3WINE 1V00A 4L2NA 3PJYA 3LZZA 4EN6B 5KXDA 1QF3A 4CCCA 5KXBA 1LOGA 2WYSA 4TXWA 1N1VA 1NYWA 2VD7A 4BE3A 1XNDA 1RGSA 5TSWA 4CEYB 1S0DA 1AX2A 1V6KA 4BQWA 2R7EB 5FAXA 1DHKB 2CL2A 3KT4A 4K6BA 3ZYIB 1V9U2 4XBNA 4PLOA 1B09A 2QCSB 1Y3TA 3WNMA 4CTEA 4LJHA 5J7MA 5BPXA 1BHGA 1WMFA 3I97A 4ZY9A 2K0GA 2HEYF 4GXLA 2XDVA 4U2AA 2RS32 1GSLA 1ZBA3 2O0OA 3AXDA 1OKQA 2EICA 3SH5A 2Z5WA 4OI2A 3WHUA 1RUF2 4Q27A 1O5UA 5FZLA 2R043 2A6VA 5A7PA 3I2OA 2RS12 3UJQA 3O1VA 3OGSA 4OULA 2B5HA 2VQUA 1A3KA 5JMCA 1LOFA 3OTFA 4AI9A 2BW8A 1ND3C 4N7IA 1W9SA 4FTSA 3CKHA 1WA6X 3HN3A 4CP1A 2UWAA 1UAIA 1W6NA 2RJKA 2VG9A 2VZSA 4TWTA 2YYOA 4Q4V3 5I8SA 1YFXA 2R073 3WNXA 4CCOA 2A5ZA 2MHFA 3HR9A 3UL2A 1MPXA 5T5JA 5KHHA 3WG4A 1DZQA 2X05A 2Y33A 3PUQA 5GKAC 3WY6A 4RSUA 4H55A 1DG6A 5HCAA 3PUIA 5LASA 4AEDB 4OQ9A 1OPOA 3Q8AA 2W91A 1NAEA 1GMMA 4QWNA 1OA4A 4OUSA 1SDDB 1X36A 1UPSA 4QDSA 2WC2A 3A0KA 4DY5A 3S57A 3MV11 3FHQA 1JYNA 2GNTA 5DG2A 5IFTA 2OYZA 1DQ6A 1S2EA 3PDQA 4QB6A 1YJLA 4D8MA 4BPZA 1NY71 1UMIA 4QX5A 4K1YA 4K8RB 3JBG1 1X7NA 3NNJA 3DCQA 5L36A 2WWUA 3FN9A 2BFUS 2W08A 5C4WC 4N53A 5F8PA 5ACA2 3DN7A 4HK8A 3ENRA 1A34A 4YPJA 1LHNA 1YO8A 5JXJA 2ZABA 3H9AA 3MW3A 3IDCB 1YQ8A 3OEBA 2QQOA 1OF3A 3CJIB 4Y1ZA 1ND2B 4LKEA 1POV0 4OZOA 3POWA 3FMGA 3VL9A 5FMOS 4CP2A 1JU3A 2A70A 2QQIA 1MQTA 4RR3C 1J3RA 1RUD1 1YCIA 4QPIC 5FYZA 1UYYA 4Q4W2 4YG6A 4AQ2A 2XLAA 3ILRA 5HV0A 4Q4Y3 1X8EA 3AP9A 1W9YA 1UU4A 1F4AA 1QIQA 3IBMA 2ARAA 4RA0A 4ZZ5A 2HH9A 2XLFA 4FAGA 3FLPA 4OMCA 4B8EA 2QDRA 2XUMA 1CAWB 1UMZA 3GZAA 2PELA 1KJLA 2DBIA 1PIV3 2VBBA 4N90A 4OHWA 3LFIA 3R05A 3BODA 3HBKA 1OUXA 4IV3B 2ARBA 3SLIA 4HETA 4AI8A 3S6PA 2GNDA 5C9AC 1PX4A 2X5IC 4XQDA 5EPAA 1BEV2 4OI1A 1ENQA 5FZOB 3KMHA 2LM3A 2WO1A 3UKNA 4XXAA 1UXXX 4Q4V2 2VOWA 2BOJA 3KS7A 1LULA 3W9AA 1FMD1 2R072 1JYTA 2GU9A 1LB2A 2HWC1 4YW6A 5GALA 4GB31 2ZAAA 4HFSA 4PQQA 3KV9A 4FOWA 3AMMA 3VZOA 4DY3A 4MGKE 1OD3A 2XGXA 1EYBA 5JXIA 5FPAA 3GALA 1ULPA 1ND3A 5GM0A 4ZS3A 4BMBA 2ATFA 4QX1A 1COV2 3VLBB 5IATA 4BQ4A 3T0AA 1GZTA 4K1ZA 1TNRA 4QB2A 4BJ0A 3U1XA 1I9RA 5AC91 2F6BA 3DV8A 1QH7A 5FYTA 4UW4A 4CDUC 1ACCA 3IWZA 3QH6A 4D6RA 4KH9A 4CP9A 3R0RA 1DCSA 3NO8A 2W1SA 2D6LX 1D2SA 2BV4A 3W21A 1OXCA 2RDNA 4RGGA 1X82A 4Y1XA 3L9JT 5H9PA 1UX6A 4IE7A 4C0BA 4ET7A 3NNMA 2Y26A 4FXGB 2CHHA 4O7XA 3P5BA 2P17A 5D8AB 1SBDA 3EO6A 2WFPA 5C7GA 4YSFA 2K2SA 1PGSA 1ZVFA 3IIIA 2HWE3 3I2JA 4CUBA 3M7AA 1ZBA1 1VLNA 3H7JA 4KG0A 4QHBA 3HPNA 4RD7A 3B69A 4GMP3 4MV2A 3RJRA 3T1MA 2FDIA 5K8SA 1XNCA 4LOSA 1S2KA 1EUTA 2J1EA 3GNEA 3N7JA 2R041 2YGMA 4Q4Y2 5FY9A 3RVHA 2XH6A 3DECA 5C4WA 2CWMA 2V72A 3HT1A 3AZZA 2CGOA 1XBFA 4FTBA 2BGCA 1JZ6A 2VZ3A 1Q56A 5DUWA 1S55A 1GANA 1QJX3 1PIV2 1Q8VA 1OA3A 2YY1A 1UL9A 4IGPA 2WZR3 3USUA 3WW2A 5J1XA 1RHI3 3MHZA 4META 3LCPA 2VOVA 2LRPA 2YC0A 4S2FA 4RR3A 1AXKA 5I0TA 1SLIA 4YZ5A 3RZHA 1QH6A 3AJZA 4XAAA 5M0TA 4E2QA 2IVIB 2WNOA 5A32A 1BQPA 4FFGA 3M3IA 3BB6A 4XMIA 1WCDJ 5FBZA 4CA9A 3ZN4A 2WAOA 4LLFA 2IFWA 4CDWC 4FOYA 3PUSA 2Y38A 4CU7A 1AF9A 5LK7B 1C5IA 1VBD1 3J7NA 3NW4A 4MLOA 2EXKA 2JX9A 2ZKNA 1F5JA 4IEWA 3WDUA 3ACIA 5J37A 4MZUA 1JYWA 1VIWB 2CTVA 5FY8A 3I59A 2WDBA 1QJZA 1UKRA 4BIOA 2YV8A 1OVSA 5FZHA 1DQ2A 5C9AA 1O7FA 1DBNA 2X5IA 3H3LA 3I3QA 3KLSA 1UY0A 4QHOA 1UWWA 3QBQA 4LNVA 1XNKA 2XOMA 4UT5A 1JMUB 5DN2A 5DUUA 4XCBA 3I3EA 4LK6A 1WGPA 3K4DA 5FP4A 2YC4A 3I3BA 3M4FA 2PLV1 1H6XA 3VBFC 3AP5A 4LE4A 3MLKA 1FPN3 2D98A 5JWPA 3DL3A 4AF9A 2UY9A 3EYPA 5FZKA 2ETEA 2WSUA 1QHDA 3AFGA 3B9CA 5FZ0A 4YZ1A 5ABJB 4E4DX 3WCRA 4UYBA 1W8NA 4UW5A 4NPRA 1WCSA 5IAVA 5EIYB 3V0BB 3FLTA 4YM2A 2C26A 2QZ3A 1ZZCA 1AYN3 1AYM3 4MYEA 3GBGA 1RUE3 2VUDA 4JRAA 4CDUA 4URAA 2NM1A 2R0FA 1YUDA 3WP3A 4CE8A 2V09A 2BYVE 3OPWA 4QQHA 2GMPA 1R091 2DBNA 2Z69A 3AZWA 1S4CA 3LAGA 3VBUB 4YGEA 1W8TA 5LZ6A 4MXVA 4YFWA 4Y20A 5E89A 4RHV2 5E88A 1HW5A 4LO5B 2CDPA 4QPWA 2J1SA 1H9PA 2VQTA 2ZHNA 1AJOA 2K46A 4CZSA 1MZ5A 4LO7A 3DYOA 3OGJA 1LOAA 3TAYA 1MVQA 1AL0G 1UQXA 1UW8A 2WZR2 5IW0A 5A6QA 4AR2A 5FZ9A 5T5OA 5FMCA 1BKZA 3QH7A 1QJY3 4PQ9A 3J7LA 2WNUC 5FTTC 1A78A 1F2NA 3BTAA 3RI9A 3DXTA 3WNPA 4Z2AA 5L9VA 2JDHA 3FFQA 5EZWA 5IHRA 4PIXA 1ULCA 2E53A 5BY5A 1OLME 2WQ4A 4EN0A 3GDBA 3RYKA 2CSGA 3TBDA 1LTEA 5FP7A 4M3CA 5A3OA 1BXHA 1UU5A 1J1TA 1LHOA 1PO22 4HPKB 2W68A 4V1PA 3E6DA 1C5HA 3ATGA 1UZZA 1NA1B 2PHLA 2FDJA 3FWEA 2ZZQA 1CAUA 1YWKA 3MBWA 2WN3A 4YRDA 5FZ1A 3PVEA 4AHZA 2RDSA 4XACA 4BK4A 3ZXEA 1NKGA 2JIGA 3CJXA 4BXFA 4AFMA 3WNOA 3LEKA 5T5LA 4CDWA 1WZXA 4B4QA 1PZ8A 2PAEA 2AREA 3ES1A 4BU2A 3TEYA 5FZ3A 3TYJA 4HK9A 1W3VA 3U75A 3B00A 4WVMB 5LCWL 4E4HA 4EZHA 3I3MA 1FPN2 1F9KA 4HMZA 2DCJA 1DLLA 3NAPB 1OLRA 2RDQA 3ZKYA 1ULFA 4LOTA 4E2GA 2VNRA 1JUHA 4YVWB 1RIRA 4YWAA 4LBQB 1PGW1 2QVSB 3MYXA 1ULEA 2HWE1 2VMDA 2YPJA 3OGVA 4DOUA 1XE8A 3ZYBA 5EWSA 4UW6A 1AYM2 4AW7A 2OXBA 1ZA4A 2Z42A 3CO2A 2ZJCA 1G8WA 5DZFA 1MEC3 1UOFA 1RUE2 5FR3A 3AFKA 4WZCA 1IS3A 2BQPA 3VBFA 3R4SA 4HBNA 4UFIA 2I74A 2GP3A 1ZA7A 5GZEA 3B3QE 5JPNB 4Q26A 1C8M1 4L8QA 1QJX1 3VBSA 4NWWA 1ZZ6A 2D3PA 3VDDC 3VN4A 3WW1A 1UF2C 3J8F2 3JZVA 5JZGA 1RHI1 4P5HA 5A3UA 5FYMA 3RYRA 3ZYGA 4LORA 2VZPA 1U5XA 2UYBA 4DZGA 1PMHX 1JZ3A 3CQOA 5A3PA 2WNEA 3FC0A 4WBBA 4WM8B 3E6CC 4XUNA 1ZRDA 4K7JA 1RYYA 3ZM8A 5A7OA 1QJY2 3ZPYA 4DXSA 4N9IA 1SMVA 3WW3A 2WNVC 3HD8B 4AI0A 2BZDA 3RQ0A 4IGQA 5CKMA 1YEWA 3USUB 3BTXA 1HIXA 4AVSA 1DQ4A 4BWOA 3DPRB 4LO6B 2DCZA 3SCHA 1SCRA 2ZX1A 1RJ8A 1CAXB 4IV1C 2VAUA 5JPMB 1HRV3 1HN0A 1SG3A 5C8CA 3O5SA 5F32A 4HT1T 5J36A 4D69A 1VMJA 3P3NA 5FYIA 4JGYC 2WNUA 1DQ0A 5LRRA 2OX0A 5CFCC 4GH4C 2VMHA 4XJZA 5FKBA 2AACA 1O3RA 2LUWA 3HVDA 5AVPA 2ZEWA 2YBKA 4PLNA 3RWKX 5GZFA 4AVCA 1ULOA 3H1MA 4KGQA 4DUVA 5L9RA 2B39A 1V70A 1DGRN 1OOPC 1LODA 2R063 2ZGRA 5DQ0A 4B4RA 2R16A 3ZYPA 5DAQA 5LWBA 2WR9A 1NG0A 2PHTA 1JZ5A 5D21A 2RMU3 1G9BA 5A7SA 1AYN1 1NE4A 4OUMA 2DVFA 1XNBA 2OQ7A 3LF7A 4A7ZA 3MZHA 1RUE1 3IIAA 3WNNA 1APNA 2JIJA 4PI2A 2AC1A 2HEWF 3LFMA 1MS0A 4MGZE 1AL21 1MEC2 1SLCA 4QKBA 2ZKLA 3I2DA 1KXGA 3NJVA 4Y4RA 4NPMA 3UV9A 1GNYA 2P34A 2G19A 1W28A 4UFMA 2G1MA 4XJUA 1QGLA 3WHTA 3RPQA 4Q0PA 3K3OA 1OQDA 1N1TA 1F5FA 5KHIA 4DS0A 5HI0A 3AL5A 3ABZA 5KWRA 4EV0A 1QJY1 2Y8KA 1UXZA 3K75B 4OCTA 1ZBE3 4DNYA 4IW3A 1E5HA 2BRTA 3R4DB 4UFHA 4XMAA 1W6OA 2VXRA 3CIHA 1UY4A 3C2UA 4IL7A 1MS5A 2XKOA 3D82A 4MG2A 1W03A 5CKQA 1C1FA 2G9FA 5I91A 2LS6A 4TSVA 3O12A 1VMHA 1GFF2 2GNMA 3LA7A 3OG2A 4Y1YA 4YGBA 3M3CA 4QPGC 3VDDA 3WP5A 3WQ1A 5A70A 2BNOA 2PXJA 4CXXA 4W65A 3VBHC 3CDZB 4Y26A 4CCMA 4Y22B 2VC9A 3T08A 2JDMA 2VZUA 4R9BA 1HRV2 1VP6A 2EIBA 3AKQA 3NV1A 3WLUA 3ZN5A 3LGRA 1I3HA 4FPCA 4R8HA 5EP9A 2OIIA 4X6QB 5JZGC 4B7EA 3T0DA 2WNVA 2DURA 4QB1A 2ET7A 3MGUA 2VVDA 4NHMA 1LCLA 2F17A 4A45A 3BOWA 3AKPA 2BNNA 3OY8A 3ZSLA 3HIFA 3MIHA 3FUQA 3N7LA 3PUAA 2E7TA 4XFFA 3FHIB 5IJRA 3E5XA 5LA9A 4CUCA 1IPJA 1RMU3 2R062 2WQZC 3IDEA 4IV1A 2DWRA 1NQDA 4WVVA 5DAPA 3LWCA 4IEYA 4LBQD 1HB2A 2PAMA 3AKRA 5JCTA 2JXAA 2DUPA 2RMU2 1CZVA 2WJSA 2ZTNA 4JGYA 4Y4YA 5CFCA 2WA3A 2ZHKA 4GH4A 2F4LA 4QXKA 4JZRA 4OHVA 1MEC1 4P9GA 4BLJA 2ZX2A 4FBFA 1YIPA 4R4ZA 3MLLA 2YBSA 2OS2A 5FJHA 3WSOA 2ES3A 1F35A 1X9PA 4FT8A 4IGOA 3WDVA 1UZWA 5F37A 2D6NA 2QQVA 3POYA 4QPYA 3KGLA 1OOPA 4MGQA 1PNGA 2VBDA 5FY5A 3VGIA 2ERFA 4UOJA 4FPHA 4HN0A 1PO12 4P9YA 4FPFA 4M3CF 5H9QA 4C91A 3AMPA 1WLWA 4KU7A 4XFBA 3R6SA 2YDEA 1XQNA 3FZ3A 1O91A 3E5QA 1KFXL 2AH2A 4XPVA 5CBLA 4S2DA 1J58A 2QZ2A 5T3NA 5K0UC 2VUJA 1GP5A 5FQ0B 5FPBA 5CYYA 5FMBA 2ID4A 2VZTA 1GYKA 1OLQA 3Q9OA 4J25A 4ARXA 1AX0A 4COUA 1UOGA 1ZBE2 2XHKA 1CN1A 4V2VA 4XF1A 4BA6A 3WDWA 2BWCA 1TMF2 4W6YA 2J1AA 1O8SA 1GBGA 3IZOA 3ZDSA 2QBXA 2H0VA 3NV2A 2X09A 1D4M3 1Y9QA 4HG6B 3QOPA 1H9WA 2JECA 3NKTA 2JENA 3TNPB 5F3CA 3UKVA 1LHUA 2EXHA 3TN92 3MUY1 1U12A 1JZ8A 1CJPA 5EJ3A 3FBYA 4P9LA 1ZRFA 3BI3A 2OT7A 5T52A 5A3LA 3BPZA 5CFDC 5E8AA 5APAA 5FXVA 4CDXB 3AZXA 4QX7A 2VMCA 2VTXJ 4A6OA 5FPZA 4MGTA 1DDLA 1H1MA 1QJU1 2VVFA 1H1IA 2ZGOA 1SBEA 1HKDA 5C8CB 4AI1A 1W2NA 1DYOA 5IWFA 3MW2A 2XPJA 4QPGA 2EXIA 1EV12 3ZFEC 1F31A 3DEMA 3SEPA 3VBHA 2RS13 1RMU2 1QY4A 3WNKA 3ZFFB 1AUYA 1W90A 2Y60A 3IKWA 4BISA 2NLRA 4LXLA 3ASIA 3WG1A 3WNLA 5A1FA 3O1MA 1ZRIA 4N43C 3OB8A 1LR5A 4IETA 1E5IA 3RGBA 5J48A 3J7MA 2QQKA 1QOTA 3KM5A 1HDKA 4LHKA 4R4XA 4A7YA 5FWJA 4B29A 2G9ZA 2WO7A 3TOJA 4OZXA 3TEZA 2HWB1 3NNFA 1JW6A 5LBEA 2E63A 5A7WA 1NT0A 3FE5A 3OJBA 2P3KA 2KXLA 2YXSA 3IMMA 4XJ9A 3S5QA 4AQSA 3FBMA 5C8WA 1FNYA 1Q8OA 1B35B 1YQ5A 5JVVA 3FHAA 1ST8A 2Y0OA 3CNAA 3B5LB 4NAOA 5FLIA 1M06G 1CJDA 4RS5A 3GGLA 5IT6A 3ZSJA 3AXEA 4W8JA 5DPNA 1LNSA 3SCGA 4AGRA 1CAVA 1W99A 2A6YA 4L92A 4WVZA 2PAKA 3ECQA 1WBFA 1ZREA 2BOIA 2TUNA 3CL1A 3LPFA 3WF0A 1W04A 1HB1A 2WBKA 1OMIA 1W8ZA 1CESA 3BVCA 2Y6HA 5CIRA 5FREA 1SQ4A 4QDQA 5C3OA 1CVNA 1TNFA 2O1QA 1ASJ2 1AJKA 5DZEA 4UF0B 3ON7A 4LQRA 4FSJA 2NN8A 3ZR5A 2W47A 4CUGA 4EN7B 5KHJA 3HQUA 4LIVA 1DZTA 1QOSA 4SBVA 4CU9A 5ACA3 1D4M2 4Q4X3 1X9TA 1PK6C 4P00B 4COVA 4TLGA 4INDA 2WA4A 3PVNA 5ANNA 3N9LA 2YFUA 4J1WA 5A6XA 3ZXGA 5K0UA 1H8TC 3DXUA 4ZS2A 5KC5A 1UOBA 2VECA 4CCLA 1TE1B 4ES8A 4LBJA 3AVSA 1NLRA 3AYCA 4QAWA 4KWKA 1TQ5A 2B7YA 2XVGA 2ZGMA 4Q4W3 1KITA 1GZCA 4KWJA 3IMNA 4GULA 2ORZA 3PLQA 4P9IA 4PIYA 1XXNA 4LKSA 5CAZA 2D6OX 3ZXLA 3N4MA 2IVJA 4QX0A 1PZ7A 2XVKA 2FDFA 1UIJA 4UFKA 1S0GA 5LEKA 1OQEA 3ZXAC 4QXHA 5I0DA 1ODMA 3T2QA 3RZMA 1C3HA 2EALA 1V0AA 3P1IA 2BWAA 3ZMOA 1WUVA 4ZXKA 3HNYM 5CISA 1VJ2A 1VMFA 1HV0A 5CFDA 4F7ZA 2FZ2A 4MGIE 1LGCA 1BEV3 3H1YA 1CX1A 2JG8C 4K40A 3JXSA 1J59A 2D6MA 4FQ4A 2VMGA 1GP4A 2D5FA 2G4IA 5F9TA 1OC1A 4OFGA 4MSVA 1NCQC 3AYEA 3GZTB 1VAMA 3ZFEA 5A3MA 4YZ2A 3LEMA 4QX8A 5FO8B 3JD72 3RZLA 2TBVA 3S30A 4BQ1A 2BGOA 4I3PA 4BQ2A 1WD4A 4ZKTB 3F95A 2HKXA 4LHLA 1W2UA 3NV3A 4GJZA 4YG0A 4N43A 3A4UA 3WF2A 2Q5TA 1COV3 1GOHA 3H1WA 3CZJA 3WP6A 5FDBA 2PHRA 4E8CA 4C90A 3TEWA 4NIIA 3PNAA 2JDZA 1WMEA 1ZM1A 2IXIA 2DVDA 2Q30A 3UYJA 1IZ3A 1WA4A 1D0GA 3JU9A 5FPLA 4LMFA 1O4ZA 3TB0A 1O5LA 4IXLA 4D3WA 2V73A 1X8MA 3GCWA 3L2YA 3VBRC 4Q4X2 5DMYA 3G6JB 1REFA 1V6JA 1V9U1 3PU3A 4DXRA 3OD0A 1AR73 4PBOA 3MIFA 2BNMA 2WZPP 4LA3A 1JH5A 3WQ7A 1YI9A 3PUHA 2WWJA 3NMBA 4XEZA 2A1XA 3IPVB 4P9XA 4XILA 3T4HB 4AL9A 4CEWB 3O1UA 2XJSA 3OPZA 2RS31 1X33A 2HLEA 1W0PA 2QJVA 3AL6A 3L2HA 4WVWA 1CPMA 1VBA3 1S1AA 3ZYFA 4Z2WA 2VXJA 5IVFA 2B9VA 1ONAA 3OF1A 4FVVA 4YYOA 3MLJA 1RUF1 1WLCA 2D7FA 3DGTA 1PVC3 2RS11 1PK6A 2C5DA 1O4TA 2J7MA 2VR4A 4JGZB 4DUWA 3MIDA 2HWD3 2HWF3 3ZMNA 1G9CA 4CXYA 4A6SA 1GUIA 5JLVA 3LA3A 1S0IA 3H3ZA 4DB5A 3VUOA 1O6UA 4D6QA 1OVPA 1H8TA 4WM7C 1YYNA 4HZFA 3BN6A 4PLMA 5FFOC 2WYFA 3ZXJA 5JOWA 1W6PA 5C5TA 1IPKA 4JTNA 1QXJA 4Y24A 2CDOA 3UGGA 3ZN6B 1K5MB 3H8RA 1HLCA 2UWBA 1UYXA 1GZWB 3LA2A 3RFRA 3MPPG 1DIWA 3ZSEA 1O3TA 1QQP3 2OPKA 4QMAA 2EXJA 3NSTA 1ALYA 3PMEA 2VTXA 1XNTA 3VDBA 1SLTA 1NLSA 3ACGA 3C7FA 3VBOB 3O7OA 1C28A 3K3NA 2NMNA 1MZ6A 1JYVA 2JICA 5BNOC 1RUNA 3MFCA 4HOOA 1FOD3 5FP8A 1FV2A 1JBCA 1W6QB 1WD3A 2DFBA 3KD4A 4BCUA 5C5UA 4CCDA 3OYWA 4R52A 1DQ1A 2ZBJA 2WL1A 2GZWA 2R49A 5AFBA 5BNNC 5FZGA 2JG8A 2FD8A 4E4SA 1CR7A 4YZ4A 3H8XA 3PU8A 4UAPA 5ANQA 4RS5B 4Q0QA 1D7PM 1L7RA 3O1RA 2WT1A 1XOYA 2VY0A 4G4FA 3SCFA 2B8MA 5FWEA 1GWLA 1NCQA 4XZPA 1NCRB 2ZGNA 4Y3OA 4B7KA 5ACA1 3EHKA 1W2AX 3HQXA 2PQQA 5EYXA 1LU1A 4M3CE 2RS53 2WFF3 1TEIA 1VBC2 1XPWA 4BQYA 2Q1FA 4BYYA 2ZCWA 3ZFGC 2WABA 3O14A 3OPTA 5EJ1B 4HXCA 1AR72 1GV9A 5LA1A 4KBBA 3IT8A 4I2OA 5BNPC 3INAA 1SACA 2YHJA 1N1YA 2WO2A 3ACHA 2RG4A 4Q4W1 5L7OC 3AK0A 4UFLA 2W39A 2X53S 3WVJA 1I5ZA 1VBA2 2O14A 3GCXA 1OHFA 2HYKA 2R32A 2FBEA 1PM7A 5DAVA 3VBRA 1PVC2 5JR2A 3MF6A 2VUAA 2B45X 2RVAA 1CZSA 4RHV3 2HWD2 2HWF2 5GZCA 1R083 4Z1VA 2YGLA 2Q8CA 1KS4A 5FPXA 1IQAA 1UY1A 1YNAA 2PHUA 5FZIA 4BLIA 4NIGA 2ENRA 1BEV1 2C9KA 3ORJA 1W8FA 4L97A 1DGWA 1GR3A 2RDRA 3G7DA 4AVVA 1WWYA 4Q4V1 2WRAA 2UURA 3ME2A 4QPIA 4FAHA 2R071 2BVBA 4CPBA 2PMWB 2H6CA 2JDPA 3BOPA 2E6VA 1QQP2 2J1TA 1WW4A 1U0AA 5DDJ3 2D40A 3AZYA 3K48A 4H14A 1SCSA 2P1BA 4S2GA 3KCCA 5FYYA 3RNSA 1CIYA 2VO5A 2XL7A 2JD4A 4AEKA 2ZMKA 2ZGKA 1W6NB 1H2NA 1PO23 4WM7A 4OVEA 4EWDA 4L11A 1EAH3 1GICA 3SXWA 1FOD2 1OBNA 2VOTA 1COV1 2UWCA 4HL0A 4QQ2A 4ZPIA 4CDQC 1LHVA 1WW5A 1O3QA 4LR4A 2LALA 1JYCA 2PQSA 4ZONA 5FRAA 3U37A 3UESA 2EVXA 2W87A 1FX5A 4BDVB 3N3HA 2X8KA 2YMZA 5AVAA 4Z82A 3AX4A 3WF1A 1W8UA 1MZEA 5CA6A 5IYYA 3WZ1A 3UT0A 2DDUA 2DTWA 4IESA 2R6QA 5JIAA 1WW6A 4HANA 4AG4A 1IS4A 2KD7A 1HXS3 3VD7A 3A0NA 4DPNA 2XKPA 3I2FA 4UXAA 4YVSC 1F15A 1YC61 2RS52 1HB3A 4KI5M 4W6WA 2WFF2 5BNOA 5IVCA 2CY6A 1UO9A 3A23A 3C7HA 4XJWA 4OHZA 3ACLA 5FP9A 4DINB 4U36A 4AHXA 3W59A 3AB0A 5DAWA 5BNNA 5KHGA 3SHRA 3H7YA 2XLGA 1XSQA 2C6SA 2JDNA 2JE8A 2YC2A 3VKLA 5FZBA 3U11A 4N53B 1N3OA 3LIHA 1DU3D 1FAYA 5E6HA 5EQUA 3UGHA 2JD9A 4Q4Y1 3T30A 2ZS6B 5F1RA 4Q8KA 5JI7A 3I8TA 4FPJA 2HWD1 2CGNA 3ZYJB 4LT5A 1SPPA 2W95A 3GM8A 3U4SA 1KFUL 4IE4A 4COYA 1PIV1 5L73A 2W2IA 3Q8BA 4XOGA 5L9BA 3ZFGA 2XWJB 1MQTB 3J8F3 4F3JA 2VM9A 1R082 4UWDA 1Q8PA 4GA9A 1L7QA 5BNPA 2EAAA 3CU7A 4IE6A 1G9FA 4HKOA 4RQPC 4AFDA 4PF1A 2JG9C 5L7OA 1H30A 2Y6FA 3ZXDA 1OI6A 1MS3A 2VTFA 3NKGA 4JDOA 4R9CA 3BIWE 5JI9A 3SC7X 1D0HA 1J3PA 2A6XA 1Z0HA 2WZ8A 3HNBM 3D8CA 4I30A 4P08A 5DDJ2 3ELNA 4XQWA 2YROA 3Q8CA 1AHSA 1CONA 1UPIA 2OZ6A 2VU9A 4H7LA 1F8VA 3AM2A 1UNBA 1VAVA 1Y7BA 1NZIA 4FPOB 3VZLA 5JUVA 4PDWC 2WS93 1EAH2 1LENA 2OKXA 1JZ2A 5LK5A 5LW9A 1W8HA 4HSLA 1QJFA 4N8MA 4R9AA 1JZ4A 3N9PA 1UN1A 1GQGA 2X29A 1RUI3 2WZEA 4A42A 4Q0SA 2BP6A 4C1WA 2EIGA 2XG3A 3MIBA 3JQWA 5FOBB 1QNWA 1V6MA 1QOOA 5T54A 3V0AA 4MUVA 1ND3B 1BLZA 1LEDA 1LOCA 1S2BA 4UFJA 1HXS2 1H1AA 4GKYA 2BDRA 1T6BX 2VW1A 4AQ6A 4I3GA 4CDQA 5F5IA 5IK8A 1VAKA 2WLPA 2VW0A 1AR63 1R1A3 1AR93 3BCWA 3OBRA 5HCFA 4DRRA 2XBO3 1LECA 4Q1RA 4CP9B 3BGAA 4NR1A 2UY8A 2YBPA 4GKXA 4GMP1 2WIIB 1OT5A 3WQBA 4DRVA 5SV8A 4GZ9A 4EN8B 1JYXA 1RVF2 4Y1VA 2VCAA 4YVSA 1NE6A 4RHV1 5DG1A 5JSPA 1RC6A 3RS6A 2IC1A 1JOBA 5F39A 5FO7B 3VHRA 2GC1A 4GWJA 2L9LA 1SFNA 1PNFA 1IHMA 2VH9A 2WZR1 1O59A 1GU3A 3OBTA 3T2TA 2WO3A 4ES9A 5CG8A 4LHSA 3VZKA 1Q8SA 2CYFA 5C4WB 4S2HA 5JOYA 1H8VA 3VHPA 5GLTA 4CYDA 4NHXA 3FLRA 4IE5A 1HRI2 4DQAA 1POQA 1N47A 4C8DA 1RXFA 1EPWA 4CEYC 4KQ7A 4OI0A 5A33A 1UD1A 1ZYBA 4MGYE 5B2GB 1KJRA 3N9NA 1PO21 1HJFA 1KGYA 1VBB2 1EAH1 2B4KA 2VBPA 3HT2A 4GQ7A 4IUGA 4RR3B 5FJKA 1NQJA 2DF7A 3K4ZA 5FKCA 2OZJA 5CG9A 4D7YA 5A32B 2GN7A 4LPLA 2J42A 2QFEA 5FUNA 2Q8OA 3LSDA 2WS92 4MX3A 4RQPA 3APBA 2JG9A 1BMV2 2Q8DA 4M0NA 2FDHA 1D2QA 1VBE3 1RUI2 4NO4A 5JDBA 3NWKA 3HAGA 1RL3A 3H8UA 2FCUA 4YGCA 2A73B 3CF6E 3KQ4B 1YQ2A 1SLLA 4FPGA 2VZOA 1GOFA 1LJ7A 1Y9GA 4MH0E 5D2AA 2P37A 3I59B 1FPN1 3AMHA 4UBHA 1W8OA 5FY1A 5C9AB 5GLVA 3O0WA 4K9SA 4XJAA 2X5IB 4ITCA 3RZZA 4TTGA 5HXVA 4KWUA 4AOCA 4CCNA 5AFEA 4PDWA 2J22A 5DAXA 5JR7B 4B1LA 4CU8A 3Q8FA 2RM22 3IAQA 4GWIA 1JZ7A 1AR62 1R1A2 1AR92 1K12A 4JC1A 1AYM1 4ZXEA 4JQRA 2XBO2 2E7AA 1CD3G 3A21A 4K21A 5A6ZA 1PGL2 2ILMA 4M4PA 3NJYA 4AEDC 3X29B 4B1MA 3U0ZA 1QDOA 2XJRA 2YG0A 3CHXA 3JB8A 5C70A 4FXKB 1AR82 4FCAA 3VL8A 3LPGA 4GIQA 5A1AA 5BV6A 3ZIWA 5LBFA 2NZ9A 3J8F1 1RUOA 1EY2A 1UYPA 4ASKA 1PO13 4BOWA 1TME3 4OLLA 5FYCA 1FATA 4AHYA 2YZ4A 2BFUL 2C9AA 2DTYA 1W6MA 3MO4A 4Y5Z0 4M4RA 3O0VA 2QQJA 5F5CA 3S7IA 4I0BA 1VRH3 4CDUB 4D0QA 4HVQA 1WBLA 5I8TA 2GC2A 1RB8G 2BBVA 2IXCA 3SITA 4LO8A 3ROUA 4EE2A 3FL7A 3N7KA 5B4NA 5KR7A 3FUOA 1WCQA 3OBZA 2C24A 1A8MA 1UMHA 4UI9L 4P9JA 4Y20B 4I01A 4O65A 5FMOL 1TMF3 4CUAA 2BPA2 1HJGA 5CNAA 4GWMA 4AI2A 3POEA 3CJIC 3KWVA 5FYVA 3I2GA 5B4XA 1ND2C 4XURA 5ISLA 2GAUA 3KF3A 5F5QA 1Y9MA 1LOEA 4RFRB 4AAXA 2VOXA 2NQYA 2H6BA 5T5PA 2W92A 3M3QA 4HLTA 2RR13 1RUH3 4RFT0 1JHNA 3TN93 2ZGSA 4TLFA 3D6EA 4B4PA 1QNYA 2QQWA 1JODA 3TNQA 3IAPA 4RL7A 5LY2A 2PHWA 2VMIA 1VBE2 3POJA 2VUCA 3H0OA 4JHZA 2C0ZA 1H0BA 3IDBB 3OUIA 3Q8EA 4M3CB 4CEYA 5JMOA 5IUQA 3MW4A 4JDNA 5A7NA 2VMEA 4IV3C 3DYMA 2B42B 3WF4A 2PN5A 5KXCA 4UW3A 4XUTA 1CAUB 1VE0A 2JKBA 1EV13 4H7MA 4D6SA 1NUKA 2R1DA 1EP0A 2VQ0A 3HMYA 3WW4A 1UZVA 1XYNA 3A22A 1JOPA 1Z7S2 2FMDA 3K77A 3M70A 4G9SB 3RMYA 4CDWB 3I3DA 2VZRA 4KBZA 4E27A 2IWGB 3K46A 4QHZA 4RGKA 2VQAA 1L7LA 5C3PA 2JKXA 4LA2A 1YRZA 2ADEA 5FLHA 1UX7A 2BERA 2Z2SB 4JKKA 2ZZJA 3POIA 1RITA 4C0HA 4A44A 2PA7A 3K2OA 2VNOA 5GLZA 1XU2A 3IM0A 4XFHA 4KWLA 3AYDA 1KS5A 3TEXA 1HQLA 4BZ4A 1U5YA 1H4GA 2V5YA 4BK5A 2IUWA 3MDPA 4N7UA 1TME2 3VDAA 2FCVA 2OW4A 1OH3A 2VOKA 2ZX4A 4IEPA 5HXMA 2QQMA 1UZ0A 2Q1MA 2D43A 1VRH2 3VBFB 2XXZA 3MIGA 2H0BA 4EWEA 1ASJ3 2A3YA 5IVVA 4AEDA 5JSOA 2GH8A 2R30A 4OHXA 3VBSB 4EN9B 2QE3A 4XUPA 5K7PA 5EJZB 4NIDA 1YQ6A 4OUEA 5HV4A 1VALA 1FV3A 1JTZX 1CIWA 3N9QA 5D8AC 4LITA 2JJ6A 5I93A 3BALA 1MZFA 2VCBA 1H2KA 4HKLA 1NXMA 3AMQA 3WQ0A 4AYUA 3RG0A 1HRV1 4CPBD 2DYCA 3DKWA 5FZ8A 1E5SA 2ZAHA 3H42B 4JVAA 3THTA 2R0HA 1RUH2 1VBE1 2RR12 2WINB 3OOXA 5FZ7A 4AXOA 5FY7A 1O3SA 4LBMA 1IS6A 4GJYA 5HPOA 2KM2A 5FBJA 2D44A 3WF3A 2LROA 1HX6A 3CLPA 3CJIA 4HONA 2QQUA 1ND2A 3O0XA 4I09A 5KHKA 5KXEA 3UK9A 2R061 5JOZA 4LTAA 1Q3EA 1RUG2 1UY2A 3PMSA 5C3RA 1BBT2 1UIKA 3I49A 2WNUB 4QX3A 5E1RA 1US3A 4DUXA 3OUHA 2GC0A 2RMU1 3WEZA 2RJ2A 1HN1A 1CZTA 1EUUA 2C4XA 5EHDA 1W2OA 3SKVA 3ZR6A 1XE7A 3D3AA 3E1F1 2VJXA 3T0BA 2CNAA 3U14A 1IKPA 2JB8A 4XIKA 2J1RA 2XQRA 3LIGA 2ZEYA 4IEQA 5HBAA 2FQPA 4CCJA 1DZRA 4ZZ8A 1CAWA 1AZDA 4XXPA 1KEXA 1HV1A 1GQPA 2V5DA 4IV3A 5C3QA 1RUD3 5FOJB 4PF5A 1P8JA 1PO11 5IAXA 3UKTA 4LO4B 3ITQA 4XF0A 2GMMA 1UOJA 3RSJA 4BHPA 4D7TA 2A7AA 3JD73 4QGNA 5FZOA 3VD3A 3MIEA 1VRH1 1QMJA 2BUKA 5D1IA 2I07B 2XR4A 3M8LA 2W0XA 3T2PA 1OFSA 2CAVA 4OQ8A 2QKDA 4XFAA 3NJXA 1IG3A 1ZBE1 2P3YA 2PFWA 3M1HA 4PCRA 4XZUG 3VHOA 4F83A 4P02B 1REDA 1TMF1 3EMRA 3U78A 2Y64A 4AZZA 3EQEA 1ZRCA 5FZMA 5E16A 2HJIA 4WV8A 4YM1A 2VVEA 4QKFA 4XCAA 4YW5A 4ATFA 4FI9A 5ABJC 3LD8A 3ST7A 1E57A 4D7SA 1LGNA 4PT6A 3BUCA 2JDYA 2NYYA 2RHPA 1FMD3 5L19A 1O4YA 4NVPA 4ZU4A 2RR11 5FLJA 3TN91 5JIUA 1G9AA 2JE7A 4LBKA 2OUJA 4CVUA 2IFRA 2CAUA 3NNGA 4RGAA 4JRLA 1W6OB 2OUHA 5FY0A 1YFWA 1YFUA 4XFCA 3VBUC 5JSRA 4F8AA 3IDAA 3LDRA 4I02A 1DYPA 3MEPA 3VDDB 3VD5A 3AJYA 1MR5A 2YU1A 1N1SA 5A6YA 2P2KA 1JYIA 2EF6A 1EV11 2W46A 5D8AA 1VRBA 3ZX7A 3NJZA 1RMU1 1NY72 2P4EA 2AR6A 2BBAA 3WOGA 3JBG2 4LK7A 1OPMA 1TVGA 4IEUA 1GWMA 5SV5A 2WNVB 1QEXA 4I0AA 2Q8EA 2QNKA 2V4VA 2YU2A 5FPVA 3BU7A 2B9UA 3HWJA 2PYTA 3C3VA 4UBGA 1CPNA 4JKLA 1BYHA 2ZGTA 4XETA 3OY8B 2W5FA 2Z4FA 4NIAA 2TNFA 2P6CA 2K9ZA 1SZBA 4QU1A 1RXGA 3GHNA 4IV1B 3ALQA 4M00A 5FZ4A 5F6KA 5FZEA 3WG2A 2ZACA 4FFFA 1K5JA 2JWPA 1BK0A 1RUD2 2AGSA 1NA1C 5BXXA 3N9OA 2BJSA 2BU9A 3NVCA 4JGYB 3SEEA 3VD4A 4NPLA 5CFCB 3O1PA 1KRIA 1GZ9A 1L3JA 4GH4B 4BB3A 4QX2A 3H8OA 4JHTA 1JHJA 4EZ4A 1DGWX 4G3YC 3WCSA 3I2KA 2CU5A 1QXRA 1S0BA 3GZUC 2W1WA 4IEZA 3WDTA 1ASJ1 3KV6A 1DGRA 4DXZA 1XJAA 5T55A 1AXZA 1OOPB 5HCHA 3KV5A 3NAPC 1WLDA 1WCUA 5CEHA 2A3WA 2E32A 4FQZA 2EAKA 4W4ZA 1D4M1 1AX1A 1NOVA 4YVWC 3T3YA 3WP4A 1Z78A 3H3UA 5FYUA 2XUEA 1XYOA 1VBC3 2A3XA 3M3OA 4HKWA 2IXHA 1FMD2 1U5IA 2JEMA 2HWC2 2P3JA 4GB32 1VBD3 4QKDA 4YW2A 3N7MA 1F4HA 5F7UA 4URTA 3KB5A 5F2WA 4CSWA 2QQPA 1XYPA 2V4AA 2VE1A 4DEVA 4BMEA 5EV7A 1URXA 1W39A 2XB6C 4MHUA 3T1LA 4JAAA 4KNCA 1SLBA 2XJPA 3KT1A 5ABJA 1FNZA 1XE0A 1KDMA 1W3XA 4DXTA 3GJBA 1YI7A 3M2MA 5AC92 2W52A 1KQRA 2Q1ZB 1LRHA 3W5MA 3V0BA 2OA2A 4WM8C 1POV3 2J1UA 3MF9A 3KQRA 4Q8LA 2PLV3 3C7GA 3U10A 3AZVA 3CMGA 1OSGA 5FZAA 1ULDA 5C6CA 1FYUA 4QU2A 1OKOA 3VBUA 3BIEA 3J7HA 1DQ5A 1PMJX 3T2OA 3WUDA 5FZ6A 4E9KA 2ZMNA 3WT3A 2D3RA 3EJKA 2JE9A 3QD6A 4QPGB 3DPRC 2W1QA 1SBFA 4YZ3A 3VBHB 3SH4A 1BK1A 4RN5A 3AKTA 1OQ1A 1ZBA2 1LOBA 3JD71 4B3NA 4KL1A 4YW1A 4MXWA 3J4UH 4LE3A 1FXZA 4XDQA 4Q2FA 4XBLA 1R093 5JZGB 3MICA 1DLCA 2R042 5FV3A 3TWIA 2Y6JA 2FCTA 4L9BA 2EA7A 3UETA 3ZSKA 2NP0A 3GHMA 1W06A 2GH2A 5A7WB 2Y6GA 2CWSA 5I0UA 2DV9A 1H2MA 4XF4A 3VZMA 3NQHA 2DU0A 2RV9A 2DVAA 4HPKA 3QCWA 2E9QA 4EJRA 1YQCA 5FUIA 1VPHA 4NJ4A 4BM8A 2Y0IA 1XC6A 4YARA 4FFIA 1NA1A 1CAVB 4NWVA 4XW3A 1QXPA 1C8NA 3POBA 4Q4X1 5GZDA 4DEQA 1SFPA 4AFAA 1GNHA 3EXUA 4QM9A 5LBBA 1EPZA 2ZX3A 5CB7A 1S0EA 4FTEA 4YFZA 1Q43A 3C7EA 2D6KA 2XJQA 4QDRA 1LAJA 5IVEA 1VBD2 4O9GA 1S0JA 1C4RA 1RUJ3 4A7KA 1Y43B 2AEZA 4LULA 3THPA 1IPSA 4WVMA 2VZQA 3RDIA 4LUMA 5BNQA 2WWSA 3NAPA 3PVBB 4IERA 3WX5A 2IXLA 1XB9A 2YUEA 3WDXA 5LEJA 4HVRA 4YVWA 5J96B 1SHWB 1GNZA 3VKNA 4LBQA 3KGZA 1LGBA 5K0UB 2E26A 3VDCA 1Q5OA 3POGA 1WKYA 2QDNA 4RYDA 2VNGA 3EBRA 4GMP0 2PLV2 3KV4A 3KHBA 4JDMA 5ERLA 4AEJA 3BKZA 2Y34A 2AUYA 2ZGPA 3UNPA 1W9FA 1W9WA 2MNGA 4XFGA 3V65A 5DXDA 1MS1A 4FFHA 3WR0A 2VMFA 3CEWA 3GYDA 4GD4A 1J84A 2O8OA 4X8NA 4YM3A 2IXJA 5FYHA 2XJUA 4LIUA 4NHYA 2DVGA 4AQTA 5C33A 1KDKA 1W0NA 2W9XA 2ZA9A 2HEVF 4QQLA 3GBWA 4NHLA 2GP5A 4WM8A
chains in the Genus database with same CATH topology
5CFDB 5JAXA 1R092 2G9GA 3D4KA 3KSCA 4ONUA 1C8M3 1HQWA 2RJLA 1LEMA 2GN3A 5GLUA 1PHMA 3PJQA 2WLQA 1SEFA 1ZZ8A 1IGOA 1MS8A 4AWDA 4OHYA 3S0MA 4Z8BA 1V6NA 3DPRA 3ZFEB 5GJ6A 1IKQA 2BTVC 4FPYA 4KU8A 1CGPA 1CAXA 2ZGUA 4Z92B 3RMXA 4Q0UA 1VBC1 4N43B 4OI4A 2ZHMA 1AR71 1UCXA 1KD7A 3AP6A 3JQXA 3AMNA 2D3SA 3RRDA 1S0FA 1DFQA 1RUJ2 2A75A 1N3QA 1MACA 2A6ZA 1GLHA 4FOVA 1VBA1 4K8FA 5J98B 3PTYA 3RJ2X 4FOQA 1I6XA 4QQPA 1PVC1 3H50A 1POV1 1RVF3 2HWF1 2GSYA 1VR3A 2I45A 1M4WA 2FZ1A 4XE9A 4FPKA 3D5OA 1FT9A 3VBSC 1WMDA 3N36A 1YLLA 2VULA 4JV4A 4TZDA 2MEV3 4LBNA 1A6CA 2LTNA 4LUKA 3U07A 1PK6B 4AFBA 1QQP1 1PGW2 1G6NA 1HRI3 3U4XA 4FP2A 2HWE2 5CVRA 3KT7A 2BVVA 3KCYA 1CQ9A 1H8TB 1WCKA 2PHXA 1W6PB 1AL23 1VBB3 4QGLA 3B93A 1G9DA 1FOD1 2NPIA 4ATEA 4COZA 1JUIA 4XF9A 3WV6A 4CDXC 1C8M2 3IN9A 3SISA 2ZX0A 1QJX2 1HQNA 2QUOA 1J1LA 3VZJA 5C8CC 1RHI2 4Q29A 4MXWB 3B9IA 4IEOA 4YGDA 3JUUA 2PHFA 1IS5A 2WKKA 3B01A 1PMIA 3ZYRA 1SDWA 4Y22A 3ZFFC 3JCIA 2RS51 1V6OA 2WFF1 3OYWB 5EXOA 3R4UA 1NZCA 4A3XA 1WW7A 3AKSA 1S0CA 3SMHA 1FI2A 2UU8A 3OD4A 1R1ZA 2DCKA 2JG8B 1RUJ1 2WT0A 3LOIA 2WSVA 3PHMA 4ISQA 2DUQA 1PZ9A 1XRUA 2PHDA 2RM23 2AZ5A 1NCQB 5LRSA 4XQ4A 1B35C 2VPVA 3I7DA 3J26N 5GZGA 1BJQA 2ZOEB 4MVTA 4LBLA 1UU6A 4Z07A 4HVOA 4AE2A 1QDCA 4SLIA 1AR83 4COWA 3WDYA 1U5ZA 1X50A 4ASMB 2NMOA 1R081 1OFNA 3VKMA 3D0JA 2FMYA 3W58A 5J3UA 5KBFA 3D0SA 4PBPA 2E7QA 4K3UA 3POSA 2MEV2 3FJSA 2FHRA 4XHBA 4PJYA 3VBRB 3NL1A 1AYN2 1RUC3 3HBZA 5DDJ1 4FPLA 4CP0A 1MS9A 4Y1UA 3NV4A 3WD5A 5FQ0A 4IEXA 4JCKA 1V6LA 1AL22 4J1XA 4YM0A 3ZO0B 1AVBA 3FFZA 4YW3A 5JOXA 4QPIB 4C1XA 1QKQA 1ZZ9A 2I2SA 3ILFA 5DUVA 3ZSMA 3J9SA 4YG3A 2MPFA 3LSEA 2GMEA 5FCCA 3JB4C 3ZXFA 2SLIA 1YFYA 5IK5A 4BIFA 1YJKA 1ENXA 4QT6A 5I0RA 4WM7B 1HXS1 2C1FA 5H9RA 4AVTA 3RWNA 1LHWA 1GKBA 1MS4A 3VHNA 4X6RB 1C57A 1ULGA 1BCXA 1H4HA 4CDXA 4DFSA 1Q8QA 1LESA 4ASLA 3AYAA 1Z7S3 2ZPXA 3VKOA 2RE9A 1DYKA 4XF3A 4ORFA 1ZX5A 3ES4A 3E97A 5BNOB 2ZHLA 4X8PA 3ZIXA 1RVF1 2XVLA 3ZFFA 1A8DA 3TRSB 1BVP1 2GNBA 2DVBA 5BNNB 1QJU3 1UZYA 2MEV1 5I0SA 4YNIA 1JOJA 2DU1A 4ZU7A 3B02A 1B35A 1HRI1 5DUXA 1YHFA 4AEMA 2CV6A 2A6WA 3ZFGB 1RUC2 3DF0A 2ZGLA 5HCBA 3SNMA 1VBB1 5BNPB 4ZU5A 2HWB3 3AP4A 3B7MA 4CEWC 5L7OB 2WS91 4W6XA 1BMV1 4IQPA 1I1EA 2IZWA 1RUI1 3K51A 3MFAA 5IK4A 4HN1A 2AENA 4J6GA 2XWBB 5K9YA 4JGZC 4XHXA 3KCXA 4FPEA 2D93A 4AI3A 2B46X 1AXYA 2WT2A 4N9HA 5CADA 1RUG3 1BBT3 3S7EA 4NOTA 1K5MC 5F6LB 2KA3A 2RM21 2VGDA 1AR61 1R1A1 1AR91 4H3WA 4E4ZA 2XBO1 1D4VB 3V0AB 1W0OA 1V6IA 1PGL1 3QLQA 2XJTA 3VBOC 1NXD1 1ZZ7A 4LLOA 4LBOA 4QQOA 3GBFA 3M3EA 3V64A 3MPBA 1AR81 4JTOA 4P9WA 3KZ4C 5T50A 3DUIA 4YW4A 4CDQB 3N35A 2OVUA 2E51A 5GLWA 1C1LA 3I54A 4A2UA 4GWNA 3B94A 1G7YA 1QJU2 1WLTA 3WUCA 1J3QA 2SBAA 4AVBA 4LEJA 4XJ8A 4FO9A 1LU2A 4RS5C 1RTVA 4AHWA 4EWAA 4KGGA 4M01A 3WG3A 1REEA 2XJVA 4XTPA 1RJ7A 1JXNA 1GQHA 1NCRC 1RUC1 4YVSB 4FP3A 5H9SA 1H2LA 1PVXA 1RINA 4D94A 4AK3A 3MI8A 5DZGA 4P14A 1SLAA 1SFYA 2HWB2 2TEPA 1MVEA 4LHNA 3URFA 5I8YA 2DFCA 1ZRRA 4I0WB 3ILNA 4NHKA 2VW2A 3ETQA 3I4IA 4TYSA 4GALA 4NN0A 3OGGA 5BUVA 1BZWA 1DF0A 2UYAA 5A33B 4CRQA 2GALA 3LOBA 1IOAA 2GDFA 3LB9A 1ENRA 3VZNA 2ET1A 3OCPA 2ZGQA 4Q0VA 4RQPB 3P3PA 4DMIA 3AP7A 3IPVA 4CEWA 2JG9B 3GF6A 2Q4SA 1Z7S1 3JBG3 3VV1A 4WZFA 5EYYA 4XBQA 3VKFC 3WXPA 4AGGA 2AYHA 4AGVA 1V9U3 3PVOA 4IEVA 3HN1A 4HSJA 1LOFC 1YIFA 4JGZA 4QD2A 4O9EA 1CX4A 4M0HA 4AVAA 4PDWB 4BH9A 2RS33 1ZZBA 2Q0AA 2R1BA 4YLZA 4KG8A 1JN2P 4EROA 3ZN6A 1TME1 1K5MA 1RUF3 3ZXKA 4ISRA 1BVVA 1GZWA 2GC3A 3RYPA 2ZMLA 1XU1A 3E6BA 2Z79A 2D6PA 4E2SA 1UKGA 2D5HA 4XFIA 5J09A 3VBOA 1LKNA 4Q1PA 2N7GA 4QM8A 1N3PA 3USSA 1OA2A 3SH3A 1T6GC 4XTMA 3E5UA 1QU0A 1QWRA 1W6QA 2DCYA 4QGMA 1VB2A 1DGLA 3UJOA 4R9DA 1W6MB 4PIZA 2BEOA 2A71A 3QACA 1ENSA 3V56A 3ZVXA 5IK7A 4K20A 4XIOA 1RUH1 2HWC3 4GB33 5KC6A 2PTMA 2F4PA 4N53C 2D97A 1ZNPA 2DCTA 1G86A 1VB4A 2XL9A 1NCRA 5EFUA 3RI8A 2P3IA 2IXKA 3LKJA 5BYNA 2CGPA 2DUOA 2O8QA 4XYXA 4AFCA 2ARXA 5CU1A 1MQTC 1OD5A 1RUG1 4L99A 1YXWA 1BBT1 5AC93 3FX3A 3WINE 1V00A 4L2NA 3PJYA 3LZZA 4EN6B 5KXDA 1QF3A 5KXBA 1LOGA 1N1VA 1NYWA 4BE3A 1XNDA 1RGSA 5TSWA 4CEYB 1S0DA 1AX2A 1V6KA 5FAXA 1DHKB 2CL2A 3KT4A 4K6BA 3ZYIB 1V9U2 4XBNA 4PLOA 1B09A 2QCSB 1Y3TA 4CTEA 5J7MA 5BPXA 1WMFA 2K0GA 2HEYF 4GXLA 4U2AA 2RS32 1GSLA 1ZBA3 2O0OA 3AXDA 1OKQA 3SH5A 2Z5WA 4OI2A 3WHUA 1RUF2 4Q27A 1O5UA 2R043 2A6VA 2RS12 3UJQA 4OULA 2B5HA 1A3KA 5JMCA 1LOFA 3OTFA 2BW8A 1ND3C 4N7IA 4FTSA 4CP1A 2UWAA 1UAIA 1W6NA 2RJKA 2VG9A 4TWTA 2YYOA 4Q4V3 5I8SA 1YFXA 2R073 3WNXA 2A5ZA 2MHFA 3HR9A 3UL2A 5T5JA 3WG4A 5KHHA 3WY6A 1DZQA 5GKAC 4RSUA 4H55A 1DG6A 5HCAA 4AEDB 1OPOA 1OA4A 4OUSA 1X36A 1UPSA 2WC2A 3A0KA 4DY5A 2GNTA 5DG2A 2OYZA 1DQ6A 1YJLA 4BPZA 1NY71 4QX5A 4K1YA 3JBG1 1X7NA 5L36A 2BFUS 2W08A 5C4WC 4N53A 5ACA2 3DN7A 4HK8A 3ENRA 1LHNA 1YO8A 2ZABA 3H9AA 3MW3A 3IDCB 3CJIB 4Y1ZA 1ND2B 1POV0 3POWA 3FMGA 3VL9A 5FMOS 4CP2A 2A70A 1MQTA 4RR3C 1J3RA 1RUD1 1YCIA 4QPIC 4Q4W2 4YG6A 4AQ2A 2XLAA 3ILRA 4Q4Y3 1X8EA 3AP9A 1UU4A 3IBMA 4RA0A 2XLFA 4FAGA 3FLPA 4B8EA 2QDRA 2XUMA 1CAWB 1UMZA 3GZAA 2PELA 1KJLA 4N90A 1PIV3 4YW1A 4OHWA 3R05A 3BODA 3SLIA 4IV3B 2ARBA 4HETA 4AI8A 3S6PA 2GNDA 5C9AC 2X5IC 4XQDA 1BEV2 4OI1A 1ENQA 3KMHA 2LM3A 3UKNA 4XXAA 4Q4V2 2VOWA 3KS7A 1LULA 3W9AA 1FMD1 2R072 2GU9A 1LB2A 2HWC1 5GALA 4GB31 2ZAAA 4HFSA 4FOWA 3AMMA 3VZOA 4DY3A 4MGKE 2XGXA 1EYBA 3GALA 1ND3A 5GM0A 4BMBA 2ATFA 3VLBB 1COV2 4K1ZA 1TNRA 1I9RA 5AC91 2F6BA 3DV8A 1QH7A 4UW4A 4CDUC 3IWZA 3QH6A 4KH9A 3R0RA 3NO8A 2D6LX 1D2SA 4RGGA 1X82A 4Y1XA 3L9JT 5H9PA 1UX6A 4C0BA 2Y26A 4FXGB 2P17A 5D8AB 1SBDA 3EO6A 2WFPA 4YSFA 2K2SA 1PGSA 1ZVFA 2HWE3 3M7AA 1ZBA1 1VLNA 3H7JA 4KG0A 4QHBA 4RD7A 3RJRA 3B69A 4GMP3 4MV2A 3T1MA 5K8SA 1XNCA 1S2KA 3GNEA 3N7JA 2R041 2YGMA 4Q4Y2 2XH6A 5C4WA 2CWMA 3HT1A 3AZZA 2CGOA 4FTBA 2BGCA 1Q56A 5DUWA 1S55A 1GANA 1QJX3 1PIV2 1Q8VA 1OA3A 2YY1A 1UL9A 3USUA 2WZR3 3WW2A 1RHI3 4META 3LCPA 2VOVA 2YC0A 4S2FA 4RR3A 5I0TA 1AXKA 4YZ5A 1SLIA 1QH6A 3AJZA 4E2QA 5A32A 1BQPA 4XMIA 3M3IA 3BB6A 1WCDJ 5FBZA 3ZN4A 4CDWC 4LLFA 2IFWA 4FOYA 2Y38A 1AF9A 5LK7B 1C5IA 1VBD1 3NW4A 4MLOA 2EXKA 2JX9A 2ZKNA 1F5JA 4IEWA 3WDUA 5J37A 4MZUA 1VIWB 2CTVA 3I59A 4BIOA 1QJZA 1UKRA 2YV8A 1DQ2A 5C9AA 1O7FA 1DBNA 2X5IA 3KLSA 3QBQA 4LNVA 1XNKA 5DUUA 1WGPA 3M4FA 2PLV1 3VBFC 3AP5A 4LE4A 3MLKA 1FPN3 2D98A 5JWPA 3DL3A 4AF9A 2UY9A 2ETEA 2WSUA 1QHDA 3AFGA 3B9CA 4YZ1A 5ABJB 4E4DX 3WCRA 4UW5A 4NPRA 1WCSA 3V0BB 3FLTA 4YM2A 2QZ3A 1ZZCA 1AYN3 1AYM3 4MYEA 3GBGA 1RUE3 4JRAA 4CDUA 2NM1A 2R0FA 1YUDA 3WP3A 2V09A 2BYVE 4QQHA 2GMPA 1R091 2Z69A 3AZWA 3LAGA 3VBUB 4YGEA 4MXVA 4YFWA 4Y20A 5E89A 4RHV2 5E88A 1HW5A 4LO5B 1H9PA 2ZHNA 1AJOA 4CZSA 1MZ5A 4LO7A 3OGJA 1LOAA 3TAYA 1MVQA 1AL0G 1UW8A 2WZR2 5T5OA 1BKZA 3QH7A 1QJY3 4PQ9A 5FTTC 2WNUC 5CAZA 1A78A 1F2NA 3BTAA 3RI9A 3FFQA 5EZWA 4PIXA 1ULCA 2E53A 5BY5A 2WQ4A 4EN0A 3RYKA 3TBDA 1LTEA 4M3CA 1BXHA 1UU5A 1J1TA 1LHOA 1PO22 4HPKB 2W68A 4V1PA 3E6DA 1C5HA 3ATGA 1UZZA 1NA1B 2PHLA 3FWEA 2ZZQA 1CAUA 1YWKA 4AHZA 4YRDA 3PVEA 3ZXEA 3CJXA 4AFMA 5T5LA 4CDWA 4B4QA 1PZ8A 2PAEA 2AREA 3ES1A 3TYJA 4HK9A 3B00A 4WVMB 1FPN2 1F9KA 4HMZA 2DCJA 1DLLA 3NAPB 1OLRA 1ULFA 2VNRA 1JUHA 4YVWB 1RIRA 4LBQB 1PGW1 2QVSB 3MYXA 1ULEA 2HWE1 2YPJA 4DOUA 1XE8A 5EWSA 4UW6A 1AYM2 4AW7A 1ZA4A 2Z42A 3CO2A 2ZJCA 1G8WA 5DZFA 1MEC3 1RUE2 3AFKA 4WZCA 1IS3A 2BQPA 3VBFA 3R4SA 4HBNA 2I74A 5GZEA 3B3QE 5JPNB 4Q26A 1C8M1 4L8QA 1QJX1 3VBSA 4NWWA 1ZZ6A 2D3PA 3VDDC 3VN4A 3WW1A 1UF2C 3J8F2 3JZVA 1RHI1 4P5HA 3RYRA 3ZYGA 1U5XA 2UYBA 4DZGA 2WNEA 3FC0A 4WBBA 4WM8B 3E6CC 1ZRDA 4K7JA 1QJY2 3ZPYA 4N9IA 1SMVA 3WW3A 2WNVC 3HD8B 4AI0A 3RQ0A 3USUB 1HIXA 4AVSA 1DQ4A 4BWOA 3DPRB 4LO6B 2DCZA 3SCHA 1SCRA 2ZX1A 1RJ8A 1CAXB 4IV1C 5JPMB 1HRV3 5C8CA 3O5SA 4HT1T 5J36A 4D69A 3P3NA 4JGYC 2WNUA 1DQ0A 5LRRA 5CFCC 4GH4C 2VMHA 4XJZA 2LUWA 5AVPA 4PLNA 4AVCA 5GZFA 3H1MA 4KGQA 2B39A 1V70A 1DGRN 1OOPC 1LODA 2R063 2ZGRA 4B4RA 2R16A 3ZYPA 1NG0A 2PHTA 2RMU3 1G9BA 1AYN1 1NE4A 4OUMA 2DVFA 1XNBA 4A7ZA 3MZHA 1RUE1 3IIAA 1APNA 2HEWF 1MS0A 4MGZE 1AL21 1MEC2 1SLCA 3UV9A 2ZKLA 3I2DA 1KXGA 2P34A 4XJUA 1QGLA 3WHTA 3RPQA 4Q0PA 1OQDA 1N1TA 1F5FA 5KHIA 4DS0A 5HI0A 5KWRA 4EV0A 1QJY1 1ZBE3 4DNYA 3R4DB 4XMAA 1W6OA 2VXRA 3C2UA 4IL7A 1MS5A 2XKOA 3D82A 1C1FA 2G9FA 5I91A 4TSVA 3O12A 1GFF2 2GNMA 3LA7A 4Y1YA 4YGBA 3VDDA 3M3CA 4QPGC 3WP5A 3WQ1A 5FO9B 2BNOA 4W65A 3VBHC 4Y26A 4Y22B 4R9BA 1HRV2 1VP6A 3AKQA 3NV1A 3WLUA 3ZN5A 3LGRA 1I3HA 4FPCA 4R8HA 2OIIA 4X6QB 5JZGC 4B7EA 2WNVA 2DURA 2ET7A 3MGUA 2VVDA 4NHMA 1LCLA 3BOWA 3AKPA 2BNNA 3OY8A 3ZSLA 3HIFA 3MIHA 3FUQA 3N7LA 4XFFA 2E7TA 4A7YA 3FHIB 3E5XA 1IPJA 1RMU3 2R062 2WQZC 3IDEA 4IV1A 2DWRA 1NQDA 4WVVA 3LWCA 4IEYA 4LBQD 2PAMA 5JCTA 3AKRA 2JXAA 2DUPA 2RMU2 2WJSA 2ZTNA 4JGYA 4Y4YA 5CFCA 2WA3A 2ZHKA 4GH4A 4QXKA 4OHVA 1MEC1 4P9GA 4BLJA 2ZX2A 4FBFA 1YIPA 4R4ZA 3MLLA 2ES3A 4FT8A 3WDVA 2D6NA 3POYA 4QPYA 3KGLA 1OOPA 1PNGA 3VGIA 2ERFA 4FPHA 4HN0A 1PO12 4P9YA 4FPFA 4M3CF 5H9QA 4C91A 3AMPA 1WLWA 4KU7A 4XFBA 3R6SA 2YDEA 1XQNA 3FZ3A 1O91A 3E5QA 1KFXL 2AH2A 4XPVA 5CBLA 4S2DA 1J58A 2QZ2A 5T3NA 5K0UC 2VUJA 5FQ0B 3Q9OA 1GYKA 1OLQA 1AX0A 4COUA 1ZBE2 2XHKA 1CN1A 4XF1A 4BA6A 3WDWA 2BWCA 1TMF2 4W6YA 3ZDSA 1GBGA 2H0VA 3NV2A 1D4M3 1Y9QA 3QOPA 1H9WA 2JECA 3NKTA 2JENA 3TNPB 3UKVA 1LHUA 2EXHA 3TN92 1U12A 1CJPA 5EJ3A 3FBYA 4P9LA 1ZRFA 5T52A 5A3LA 3BPZA 5CFDC 5E8AA 4CDXB 3AZXA 5FPZA 1DDLA 1H1MA 1QJU1 2VVFA 1H1IA 2ZGOA 1SBEA 1HKDA 5C8CB 4AI1A 3MW2A 2XPJA 4QPGA 2EXIA 1EV12 3ZFEC 1F31A 3VBHA 2RS13 1RMU2 1QY4A 3ZFFB 1AUYA 3IKWA 2NLRA 3WG1A 3ASIA 4N43C 4IETA 1LR5A 5J48A 5JZGA 4LHKA 1QOTA 3KM5A 1HDKA 4R4XA 4B29A 3TOJA 4OZXA 2HWB1 1JW6A 2E63A 1O3RA 3OJBA 3FE5A 2P3KA 2KXLA 2YXSA 4XJ9A 4AQSA 3FBMA 5C8WA 1FNYA 1Q8OA 1B35B 5JVVA 2Y0OA 3CNAA 3B5LB 5FLIA 1M06G 1CJDA 4RS5A 5IT6A 3ZSJA 3AXEA 3SCGA 4AGRA 1CAVA 4L92A 2A6YA 4WVZA 2PAKA 3ECQA 1WBFA 1ZREA 2TUNA 3CL1A 1OMIA 1CESA 5FREA 5CIRA 1SQ4A 1CVNA 1TNFA 2O1QA 1ASJ2 1AJKA 5DZEA 4FSJA 2NN8A 5KHJA 4EN7B 1DZTA 1QOSA 4SBVA 5ACA3 1D4M2 4Q4X3 4COVA 1PK6C 4INDA 2WA4A 3PVNA 4J1WA 3ZXGA 5K0UA 1H8TC 5KC5A 2VECA 1TE1B 4ES8A 4LBJA 1NLRA 3AYCA 4KWKA 1TQ5A 2B7YA 2XVGA 2ZGMA 4Q4W3 1KITA 1GZCA 4KWJA 3IMNA 4GULA 3PLQA 4P9IA 4PIYA 1XXNA 2D6OX 3ZXLA 3N4MA 1PZ7A 2XVKA 1UIJA