4XFAA

Cysteine dioxygenase variant - y157f at ph 8.0 in complex with homocysteine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLFSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Mammalian Cysteine Dioxygenase Variants Missing the Cys-Tyr Crosslink
rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
total genus 56
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xfaA00
3U0ZA 4K8FA 1ZNPA 1ZRRA 2O8QA 2PHDA 5CU1A 2UY8A 3ES1A 1PMIA 4XF3A 5D1IA 3CLPA 4B29A 1UPIA 4IEPA 4HLTA 4IERA 1G6NA 3HT1A 1O5UA 4D7TA 3NVCA 1JUHA 4AQ2A 2D5HA 1YUDA 3ACLA 3FX3A 3D0SA 1CAWA 1ZZ7A 3OTFA 4KL1A 4BIFA 1CAXA 4XFBA 4PIXA 3CO2A 4J1XA 4A2UA 1YHFA 3QACA 1X8EA 3LA7A 4MGYE 1RUOA 3D0JA 1Q3EA 5JSPA 4HVOA 2GC2A 2QJVA 3CJXA 4XETA 1WA4A 4P9GA 4JV4A 4L11A 2PQQA 3BB6A 5BUVA 1LR5A 1LKNA 2GH2A 4XFCA 1QWRA 5FPZA 4HN0A 4Z82A 4BH9A 3N4MA 1FT9A 4MX3A 3RYRA 3OGJA 2MHFA 2ETEA 3E6DA 2QNKA 2Q30A 3UKVA 1X8MA 1ZX5A 4QGLA 2ZKLA 3PNAA 4HSJA 4HN1A 3OD0A 3E6CC 4XF9A 5EZWA 4YNIA 3G7DA 5E16A 4JTNA 4F7ZA 4KWJA 1H1MA 4X6QB 3CEWA 4PIZA 3KCCA 3KSCA 2XL9A 2I45A 2B8MA 4OFGA 3H7JA 3FZ3A 2UYBA 4F8AA 4I0BA 5J3UA 4N9IA 4O9EA 1WGPA 5I8TA 2XLGA 4UBGA 1QXJA 3BALA 1EPZA 5K8SA 1J59A 5CVRA 2H0VA 2GAUA 3KGZA 3H8UA 2CGPA 1YFXA 3I7DA 2Q4SA 4EWAA 2B5HA 3EHKA 2VQAA 3I59B 2H6CA 3I54A 1UW8A 4KWLA 2QDRA 4I3PA 3S7IA 1U12A 4N9HA 1TQ5A 2IXCA 2MNGA 4I2OA 2MPFA 1CAWB 2D40A 2EAAA 3WW2A 4AVBA 2IXJA 3M70A 2P17A 3IDBB 5C6CA 4XF0A 3M3IA 5E1RA 1J3QA 3EJKA 2PAEA 1OD5A 1NYWA 1RGSA 2XLAA 1UIJA 3BU7A 3JZVA 5J48A 4JTOA 4I01A 3VHRA 3NSTA 1OMIA 3HT2A 4MV2A 4HBNA 3C3VA 4Q29A 4MH0E 3MZHA 4QXKA 2Z2SB 4EROA 1ZZ9A 2Q0AA 1ZVFA 5I0RA 2XLFA 3DL3A 4ZU7A 1VJ2A 1O7FA 3MDPA 2D93A 4QGNA 2IXKA 3IDCB 1J1LA 2GC1A 1CX4A 5KHHA 1RUNA 4HZFA 2E9QA 3U11A 3SXWA 2BEOA 4R8HA 3TNPB 4CYDA 4LUMA 4IEWA 1IPJA 2K0GA 3IBMA 2OZ6A 3RYPA 1DGRA 2BNNA 5LRSA 3OCPA 1O3RA 4BHPA 2VPVA 4FBFA 4LEJA 3CF6E 3HQXA 2V09A 3WW1A 2CAVA 2UYAA 2B9UA 2OZJA 2OPKA 5FLJA 2FMYA 4LA3A 5JSRA 3SMHA 2PTMA 2IXIA 4ZU5A 1EP0A 4EV0A 4TLFA 1HW5A 2C0ZA 5FQ0B 1FI2A 3LAGA 2EVXA 4XFIA 3DKWA 4ZU4A 1Y9QA 2BYVE 2BGCA 1EYBA 2Y0OA 4IETA 3E6BA 1UCXA 4E2SA 4ORFA 1J58A 1NE4A 4XEZA 5FDBA 2GU9A 4KU7A 5J7MA 3LOIA 4R52A 5LEKA 1YLLA 1GQGA 4I0AA 4DINB 1Y3TA 1O3QA 2XL7A 4QMAA 4LULA 2ZCWA 4QM8A 5EFUA 3NL1A 1NZCA 3MPBA 1X7NA 1UD1A 4MZUA 3O14A 4LLOA 2PFWA 4X6RB 4PIYA 4XF1A 2CAUA 3H9AA 2HJIA 3RPQA 2GC3A 4IESA 3ROUA 5I91A 3ETQA 3H7YA 3KMHA 5FLIA 4AXOA 1I6XA 5KHIA 4EWEA 1I5ZA 1YFUA 5BXXA 1X82A 3EO6A 2KXLA 1DZRA 4MGIE 5BV6A 2HKXA 4E2QA 2Q1ZB 4IEXA 1ZZ8A 1CAUB 3E5XA 3U10A 3RYKA 3SCHA 5FLHA 3PLQA 4I09A 5JSOA 3OF1A 4O9GA 2OYZA 3TNQA 5FQ0A 3H3ZA 4META 1Q43A 2QVSB 1PM7A 2OA2A 2WFPA 1SQ4A 1YFYA 5LEJA 4BYYA 1WLTA 3LZZA 5LRRA 4XFGA 4UXAA 4QM9A 3UKNA 2PHLA 1XE7A 3SCFA 3ST7A 5FCCA 4GULA 4J1WA 4Z07A 1XRUA 4XFHA 5BY5A 4IEZA 4QX5A 3H1YA 3IWZA 1RTVA 1RC6A 4IEOA 4YSFA 1LRHA 1L3JA 3HIFA 4Q0PA 4HMZA 3RDIA 3SCGA 5JCTA 5KBFA 2D5FA 1QY4A 2IXLA 3FWEA 3LWCA 3D82A 4WVZA 1Q5OA 1J3RA 1VR3A 5F1RA 1OI6A 1O4TA 4L2NA 2GZWA 1UIKA 3GBFA 3RZZA 5I8YA 5JAXA 4AQ6A 5CADA 4EWDA 3S0MA 4XFAA 3CL1A 3FFQA 3MYXA 3FE5A 1ZRDA 4YARA 4FT8A 1CAUA 5C8WA 3H50A 1H1IA 2VECA 1SEFA 2F4PA 2H6BA 3RNSA 4LTAA 4Q0SA 2BNOA 2PAKA 4HVQA 2IC1A 1CGPA 1ZREA 4IEVA 3R6SA 1CAXB 4FAGA 3QOPA 3NW4A 2N7GA 1NE6A 5T3NA 5I0TA 1LB2A 3WW3A 1XE8A 3I59A 2PAMA 1O3TA 4HVRA 3SHRA 1YWKA 5I0SA 4KU8A 5AVPA 3PVBB 2XGXA 4HSLA 4LA2A 2XKOA 1V70A 3E5QA 3EBRA 5KHGA 1ZZ6A 2XKPA 4UBHA 2EA7A 3BPZA 3LA3A 2XHKA 3KGLA 4MUVA 4Q0VA 1ZRCA 3NKTA 3E5UA 5I8SA 2ATFA 3L2HA 4ONUA 1CAVB 4OLLA 3H1MA 5I0UA 1CAVA 4IEYA 1O5LA 5I93A 1ZZBA 2PA7A 3ELNA 4E2GA 3DN7A 4XF4A 4XFFA 3GYDA 4Q0UA 1J3PA 3BCWA 3H1WA 4FAHA 4H7LA 1VP6A 1QXRA 4PJYA 4QGMA 3LA2A 3FHIB 4Q0QA 1IPKA 2IXHA 2PYTA 1GQHA 2ET1A 2Z69A 5HI0A 1NXMA 2QCSB 3H3UA 3USSA 5KHKA 4WZCA 3FJSA 1YFWA 3NJZA 3IIAA 5FPXA 5KHJA 5BPXA 2GC0A 1OFNA 2K9ZA 4RD7A 5JR7B 2CV6A 2DCTA 4LUKA 4D7SA 1O3SA 1ZRFA 3ES4A 3S7EA 1FXZA 4MGKE 4I02A 1ZZCA 4JVAA 3EQEA 4IEQA 3WW4A 1DZTA 4AVCA 3ZDSA 2FQPA 2UY9A 1RL3A 4MGZE 4WBBA 1EY2A 4YRDA 1SFNA 3DV8A 2BNMA 4NVPA 2O1QA 3B02A 4YYOA 4AVAA 4IEUA 3UKTA 2ET7A 1DGWA 2WC2A 4KWKA 3E97A
chains in the Genus database with same CATH superfamily
1W8OA 5C3QA 2PHRA 2MEV1 4CSWA 2AYHA 3WT3A 4OUEA 1O91A 1X9PA 2ZGRA 2PLV2 4AAXA 4B29A 1G7YA 4GWJA 1F9KA 1LTEA 4IERA 4NHXA 4JX0A 3BPSA 3T2TA 4YZ2A 3CKHA 1O5UA 3CBNA 1JUHA 5LK5A 1A34A 2WT0A 2ZGSA 2Q8CA 1Q8VA 4LXLA 1RUF1 2D5HA 4GB32 5BNNC 1W6NB 2J1TA 3KB5A 2P3JA 1WUVA 5GZEA 2VZPA 5GLWA 4KL1A 1CAWA 4BIFA 4LT5A 3SCHA 4RFRB 1MQTA 3WQ0A 1HQNA 1O8PA 3AXDA 1UZYA 4LE4A 4MHRA 2HEVF 1S2BA 4KBZA 4A2UA 4AFCA 2JENA 3CJIB 3WVJA 4CUBA 1HJFA 1X8EA 5A1AA 3LA7A 4KGQA 3GHMA 4MGYE 5FZ0A 4AL9A 2C9KA 4RR3B 1NCRC 4HVOA 3TBDA 2QJVA 3WUCA 1W6MA 1WA4A 3RZHA 3NMBA 1MS3A 4WVVA 3TN93 3ZIXA 4AFDA 4FPYA 1NQJA 3GBGA 3ZXGA 5KC6A 2RS53 3AKQA 3R0RA 4XXPA 5IK4A 1ND3B 4IV1C 4YZ4A 2ZXQA 2JWPA 3THDA 1D4VB 5FXXA 3PU3A 2OQ7A 4L0PA 2VNRA 4C1XA 3POIA 1OKQA 3C7OA 4MADA 1R1A3 3IPVA 1QOOA 5FPZA 4XBLA 1ZBA3 2RVAA 4Q4Y1 1XYOA 4L9BA 3LIHA 4MX3A 3RYRA 1W06A 4KBBA 1VB4A 2VOVA 4PCRA 3E6DA 4AE2A 2QTWB 5CFDC 4CCJA 2YU1A 2QNKA 3UKVA 5B4NA 1GSLA 1GZCA 1HX6A 4HSJA 3OD0A 1GBGA 2EAKA 4BMEA 4XF9A 2CTVA 4FPFA 3NJVA 1IZ3A 4XAAA 5E16A 2DF7A 1D0GA 4QPIB 5DN2A 4AEDC 2LROA 4A3ZA 4GKYA 1R64A 2DFCA 3KV5A 4AQTA 4A6SA 3HNBM 4CDWC 4Q27A 4OULA 4AEDB 2NM1A 1RUC1 2VO5A 2R1BA 3P1IA 1YQ5A 3IPVB 1QDCA 4X6QB 3VKLA 2W2IA 3JB8A 4PIZA 3AP5A 1V9U3 5L9RA 4BXSV 1APNA 2AEYA 2I45A 2WABA 2B8MA 4OFGA 3T3YA 4GA9A 5ANQA 5LASA 4F8AA 5CG9A 2R073 1DBNA 2OKXA 3JUUA 4DB5A 2QQIA 1NQDA 3MFCA 4UBGA 2Y6GA 1QXJA 3BALA 3MV01 2EXKA 4Y1YA 1J59A 2W1SA 2GAUA 4C0BA 2CGPA 5FZ8A 3I7DA 1TE1B 2VULA 4AI1A 3OGVA 4XCAA 1L7LA 1AXYA 4GAZA 4A45A 2J1SA 1FX5A 5F5QA 1FATA 1LECA 2H6CA 4Q4W3 3UETA 5HCFA 3ME2A 1KFUL 2H0BA 5FXVA 1TME1 3WXPA 3K4AA 1RUH2 4UFHA 3I3QA 2ZZQA 4KWLA 4OHVA 5DUXA 1US3A 5A33A 1FOD3 5DABA 2A6WA 1VAVA 3S7IA 4N9HA 3ZPOA 2MNGA 3VKMA 5L9BA 3MBWA 4XDQA 2ZABA 2A1XA 3ILNA 3NNLA 4PI0A 4ARXA 1C8M3 4B4PA 4ATEA 3B93A 3N9QA 2IXJA 1H1AA 4C91A 3M8LA 3SH3A 5CFCA 3AM2A 3V65A 4R9DA 5T5LA 1Q56A 2XPJA 1UY2A 1EV11 1W9FA 1DYOA 1US2A 3KT4A 4BPZA 1HRV1 4QU1A 2R0HA 1CONA 1RUI2 2XLAA 2Y8KA 3HNYM 3JCIA 2J42A 1NCRA 2D7FA 4V1PA 3BU7A 3WF3A 1B35A 3VHRA 1RUG1 2E33A 3FBYA 1OMIA 3WG3A 5JMCA 1LGBA 3WP3A 2J1UA 1POV3 5D8AA 1KS4A 4QXKA 1Y7BA 4FFFA 5BNQA 5A32A 4RSUA 1HRV2 1JHJA 1ZZ9A 2Q0AA 3VL8A 4BQ1A 2EXIA 2FDHA 2JICA 4DUVA 4M0NA 1RUG2 1BCXA 5FZCA 1XNTA 4NPMA 3K4ZA 1S55A 1VJ2A 4IGPA 1UMIA 3P5BA 3RRDA 4AI0A 2W0XA 2YBKA 2D93A 2VQTA 4QGNA 4AHXA 4MG2A 1OA2A 2RDRA 4GMP1 1JZ7A 3SNMA 2J1AA 2VTFA 1CX4A 1VBE3 1F35A 1PMHX 2WINB 4CDWA 4Q1RA 4HZFA 5C5UA 5BNOB 2E9QA 4LK6A 4J25A 3SXWA 4FPHA 3W58A 3J8F2 3TNPB 5JOXA 1NA1A 5A80A 3PIJA 1RHI2 3Q8EA 4CCKA 1F5FA 4NJ4A 2W5FA 4IV3C 2Y6HA 3SQOA 4IE7A 5JPNB 2R062 2JEMA 2BNNA 2W3JA 4L92A 5CYYA 4AI9A 1Y4WA 2D6NA 4AG4A 4FBFA 1PO13 2XR4A 1UMZA 3HQXA 1NY72 2WDBA 3OUJA 3OEBA 4YG6A 4DXZA 1XNBA 2JDNA 1G8WA 2OPKA 1ACCA 1D0HA 2FMYA 1GP6A 4CP1A 5JSRA 4RYDA 3VBRC 3BGAA 4HT1T 4PBOA 4UF0B 3VDDB 2IXIA 2D3PA 4ZU5A 4A44A 4JGYC 2VCBA 1HXS2 2YFZA 2C0ZA 1H2NA 4GJYA 4ZU4A 3AXEA 4CDUC 1VBD1 1K3IA 2BVBA 2BGCA 2BV4A 3I2JA 3TB0A 1FPN1 3GCXA 3BI3A 2VUAA 2WJSA 4AR2A 3R4UA 4IETA 5C71A 3VD4A 3VKOA 2BW8A 1BK1A 1UCXA 1OUXA 3I2IA 1WW7A 3LIGA 4D6RA 5CIRA 4ORFA 1ZBA1 2J1VA 2VNVA 3KM5A 2DU1A 3EB7A 1ULDA 2X09A 3KCXA 3V0BA 4XEZA 3POJA 2E26A 5JUVA 1W8UA 3PUHA 5BNNA 1YIFA 1UKRA 2G9ZA 1ZBE1 4R52A 1QJU2 1RUE1 1YLLA 3ACHA 4BQ2A 4FOWA 2LUWA 5LCWL 3JXSA 4NROA 5IVCA 1C8NA 5FOBB 4QM8A 4XQDA 3MPBA 2DVAA 4M01A 2ZEWA 1IQDC 2BOJA 3O14A 2RS33 1H8TA 2CL2A 2DUPA 4JQRA 3BTAA 2TBVA 4NE9A 4CEWB 4PIYA 3VDAA 2O8OA 3ZN4A 4P02B 5F2SA 1D4M3 4YW5A 2QQOA 1REFA 4XUQA 2RR13 3D3AA 3RZMA 3WF2A 1V0AA 2VY0A 3KMHA 5DDJ3 1XNKA 4RHV3 2ZEYA 4AXOA 5JOWA 1I6XA 5KHIA 1E57A 5FYSA 4EWEA 1I5ZA 1YFUA 1XC6A 4ZKTB 3ILRA 2JDPA 4XUPA 2KXLA 2Y6KA 3ZKYA 4CEYC 3U4SA 1GOFA 2HKXA 1AL22 4N43B 4Y5Z0 2VCMA 4IEXA 2PLV1 3ZFFB 1ZZ8A 3CZJA 4OHYA 2GSYA 5A3OA 3E5XA 4IE4A 3Q8CA 3GZEA 4L99A 4RQPA 2YBPA 5F5AA 3ZM8A 1YJKA 5JSOA 4WM8B 4LJHA 3CIHA 4C1WA 2E6VA 4ASLA 3OF1A 2OYZA 5IVYA 1W6OA 3H3ZA 5T5OA 2GNTA 4META 4S2FA 1Q43A 4DY5A 1DQ0A 2I2SA 1SQ4A 1YFYA 1N1YA 2VZVA 1WLTA 3LZZA 2D6OX 3VDDC 1JYWA 1QU0A 4QM9A 5BYNA 1XE7A 4IW3A 4Q8KA 1UNBA 3SCFA 3ST7A 3N7LA 4CCNA 1WWYA 1VIWB 1TNRA 3GGLA 1XRUA 4Z07A 5FY7A 3ZR5A 5A6QA 2HWF1 2QKDA 1HN1A 1ST8A 3KT7A 2X8KA 3IWZA 1PVXA 1RTVA 1XQNA 2YPDA 1RC6A 2WN3A 3O0XA 4K1ZA 3WF4A 1LRHA 1L3JA 3HIFA 1FV2A 3GM8A 4Q0PA 3SCGA 4TXWA 2R0FA 4MGTA 1KS5A 1QQP3 2IXLA 3FWEA 3LWCA 1K5JA 1GMMA 2XJSA 4WVZA 4BQ4A 1WCUA 1VR3A 5F1RA 3ZFGC 1UWWA 4LIVA 3ETPA 5L36A 4BMBA 1MEC1 1L7RA 5JOYA 1AX2A 2GZWA 4W6XA 4OI1A 5L9VA 4RHV1 2WZPP 3PJQA 1P8JA 3N9NA 1JYVA 4P9XA 4L97A 4EWDA 4XFAA 4FTEA 2FCTA 1UYXA 1ULFA 2R30A 4YVSA 1QJY1 3BTYA 4GD4A 3NV2A 3WHUA 3V0AB 1OSGA 1UL9A 4QX3A 5LBCA 4YARA 3MLLA 5E6HA 5FK8A 3H50A 5FK7A 1ENSA 2F4PA 5FY0A 3UNPA 4U2AA 1PNGA 2ZPXA 1EPWA 1W99A 3R4DB 3CZUA 1LEDA 1SFYA 4U36A 4UW5A 2VVDA 1CAXB 4HKOA 2JG8B 3GZUC 4QPWA 2R16A 1LULA 2CSGA 2JG8A 3QOPA 3HJRA 4D8MA 1N1SA 2W92A 4FOQA 4GWNA 1NXD1 5T3NA 2K2SA 2YDEA 1ENXA 5I0TA 5LA9A 4LK7A 1XE8A 2VMCA 4FPKA 3A23A 1YWKA 2EIGA 1ZYBA 5I0SA 3HQRA 4RQPB 2BFUS 2XGXA 3PVBB 3JD71 4HSLA 4LA2A 4QD2A 5AVPA 3KV4A 3E5QA 1V70A 4A4AA 1LESA 4GWMA 3EXUA 3KVBA 1ZZ6A 4PQQA 4UBHA 2VZSA 1DLCA 3ZX7A 5K0UB 3S6PA 2GALA 2EA7A 4Q4V3 4I3GA 2WLQA 3VHPA 3TAYA 4EE2A 4X8PA 2K46A 1MACA 3BPZA 3LA3A 3I3MA 3SITA 3DKQA 1S2EA 2HWE2 2WQ8A 2VNGA 5FPAA 1ZRCA 1TZOA 2J7MA 2V5DA 1WW4A 3ZXKA 4NR1A 4ONUA 4FI9A 5CBLA 3I49A 1E5HA 4MSVA 3PVEA 1N3QA 2VMHA 2DWRA 1NLRA 1PK6B 4TWTA 5FYYA 1ZZBA 1O4ZA 4AEJA 2JB4A 2VZQA 3ELNA 1VBC1 1VBC2 1X9TA 5IVEA 3AP6A 4F3JA 1NZIA 2XJQA 2Y33A 4AYUA 3NKGA 3NO8A 1MZFA 3N9MA 1AR91 3LA2A 4EN8B 2BVVA 4K9SA 4B3NA 1DFQA 2HWD1 2ZHMA 2C24A 3C2UA 4PI2A 2W91A 1PZ7A 2LW8A 3HN1A 2JE7A 4CEYA 3WG1A 3WDYA 4BQYA 2JDZA 2QZ2A 2ZMNA 5CKQA 5LATA 5C5TA 5B4XA 1VBB2 5F3GA 1Z7S3 3A7QA 5I0DA 2VZ3A 5FP3A 4ZPIA 4FOYA 4XW3A 4YVWA 3WUDA 2XJPA 3PURA 3IIAA 2VQUA 3I2DA 3OYWB 4XZUG 3P3PA 3SKVA 3VHOA 3Q9OA 4Y1XA 1IPSA 4CXWA 3KV9A 2IZWA 1PNFA 1OFNA 3N7JA 4RD7A 3WX5A 4LUKA 3VHNA 1WCSA 4BIOA 5JZGC 4D7SA 5GZDA 3WEZA 3ES4A 5EP9A 3S7EA 4CU6A 4FPEA 1S0DA 3MIGA 1AL23 3MIFA 5FZAA 4UFMA 3ZPYA 2XVLA 5AFBA 3OPZA 5LWBA 3USUB 4BCUA 3EQEA 4GKXA 1DZTA 2AENA 4N43C 2G9GA 4ET7A 4UYBA 2UY9A 3VDDA 1RL3A 5BNOA 5IJRA 5A3WA 3ZXAC 4RHV2 2VR4A 4P14A 5DDJ2 5D21A 2RHPA 1RUD1 4AEDA 4YRDA 1UY4A 1VALA 3DV8A 3ZVXA 2VD7A 3H8RA 3AC0A 5A1LA 4XILA 1W04A 1MS4A 2VCAA 1NCQA 4SBVA 2DUOA 1D4M2 4M3CE 2IFRA 5FBJA 3O1RA 2VOXA 4IEUA 1S0JA 3AMHA 4OQ9A 1DGWA 3DYOA 3N7MA 4AGGA 1UX6A 1LHUA 2A5ZA 2WC2A 4R4ZA 3SEEA 5AFEA 5FIXA 3J7HA 4OVEA 2D6LX 3ENRA 4KWKA 4K8FA 4Y1VA 3ZR6A 5A3UA 2O8QA 5CU1A 5DUVA 2UY8A 2ZX3A 5IHRA 3RVHA 4XF3A 3WR0A 2EF6A 3CLPA 1QJU1 1RUE2 3FBMA 4IEPA 4QX5A 3N3HA 5LBFA 3I4IA 1LU1A 1G6NA 1W0NA 2ZX0A 3HBZA 4MVTA 1PVC2 3R4SA 4EN0A 4QQHA 3POYA 4ZZ8A 3U1XA 2VW2A 1W90A 3F95A 4CP2A 3GF6A 4AHYA 3MF6A 3RZKA 1MS5A 4AQ2A 1F8VA 2BBVA 3MO4A 2WNVA 1YUDA 1F2NA 2AC1A 2RMU2 3FX3A 3D0SA 4ZZ5A 1LOGA 1RMU1 5FZEA 4YG0A 3A0KA 5A32B 1G9AA 3I2OA 4AQ6A 2ORXA 4XFBA 4PIXA 1ZA4A 1GP5A 5KC5A 4J1XA 1IS6A 1ND2A 3LEGA 3C7FA 1D7PM 5EJ3A 3D0JA 5FO8B 5JSPA 4QQPA 1YNAA 2VZRA 2DCKA 5JXGA 1JOJA 5IVBA 1W2NA 2VCCA 4P9GA 5J1XA 3N9OA 4BA6A 3U4XA 4LKDA 1AYN2 3BB6A 1UO9A 4NMIA 4RGAA 3MV11 1AR62 4S2DA 3D6EA 2R49A 5BUVA 2VBBA 1UMHA 4Z2AA 5HBAA 1LKNA 2W39A 3B3QE 5JDBA 1JZ6A 4KQ7A 4QDSA 4HN0A 5GLVA 4B1LA 4AVSA 4BH9A 1FT9A 3NJXA 1OUSA 3ZYJB 3OGJA 4JGYB 5C9AC 4YW2A 2R041 4IGOA 2ZX4A 4FQZA 1PO12 1W0OA 3O0VA 5BNPA 5IFTA 4ZHNA 1X8MA 4XMIA 5F6KA 2DURA 5FZGA 1XNDA 2IVIB 2R063 3K77A 3H42B 4YNIA 3G7DA 1GR3A 4NAMA 1CN1A 4CDWB 4R9AA 4CDXC 4COYA 5FO9B 3KT1A 1UZZA 4AFBA 4O65A 4EN7B 1GQPA 1ND3C 1H1MA 3CEWA 1I1EA 1H9WA 1VBE2 3KSCA 3KWVA 4HL0A 4ISQA 3U37A 2XL9A 1STMA 3HAGA 2UYBA 5FZDA 3ZYIB 4FFIA 1DZQA 4HPKB 3VBRA 5IFPA 1REEA 1BBT1 4N9IA 1QF3A 1RUD2 1JODA 2ES3A 1AR82 1RUG3 2HBTA 4MYEA 4QB1A 2UU8A 3OG2A 3OGRA 2QQNA 3BYWA 4OI4A 5CVRA 1U5YA 4ZXEA 3V0BB 2ZHNA 4K40A 4PLMA 5FYVA 1HRV3 1GFF2 1YFXA 2JIGA 4LKEA 4P9YA 4CCLA 2YBSA 3BKZA 1JYTA 1JYXA 3C7GA 4NAOA 1N1TA 4QWNA 1ULCA 5F32A 1OA3A 5L7OC 3IN9A 1H0BA 4NRQA 4NO4A 1MVQA 1XB9A 1J84A 2G9FA 2VQAA 4OUMA 3M2MA 5FYTA 3WNNA 4F83A 5IYYA 4MGQA 1CJPA 2BTVC 1UW8A 4A7ZA 5ANNA 1QXPA 2FCUA 4I3PA 3ZSLA 2A6YA 4N7UA 3VZKA 1ASJ3 4QKBA 1AXKA 3NV3A 2BGOA 3DECA 5A3LA 1UXZA 1A8DA 3PTYA 5FYBA 1R091 2WO1A 4GH4B 3AMNA 3OPWA 3M3OA 1C57A 4LR4A 4Q2FA 3N7KA 4URAA 1WMFA 2YC0A 2R6QA 5HV4A 3WW2A 4AVBA 4YVSB 4ITCA 4OHXA 2ZZJA 3ITQA 5FZ1A 4K21A 2CDOA 4XHXA 3VBFB 3WDXA 1NY71 2BWCA 1JYNA 1COV2 1TMF1 2W1UA 4GJZA 1B09A 5DAPA 5E1RA 5T54A 2PAEA 3A4UA 1FOD2 4LHKA 1W6QB 1KGYA 1PX4A 2NP0A 1RUH3 1U5ZA 1FMD3 1W6PB 4LLFA 3O1VA 1ULEA 1PGSA 2ZGUA 3TRSB 3BU0A 4JTOA 1YRZA 4YVWC 3VZJA 3O1OA 1WCDJ 1HQWA 3C3VA 4MV2A 4MXWB 1NUKA 4MH0E 3MZHA 1W39A 2WBKA 2Z2SB 3IT8A 4W4ZA 2FDFA 1YI7A 4FVVA 1NOVA 3QD6A 1GP4A 1XNCA 3ILFA 3NRUA 1LOCA 4FTBA 5FZKA 3VBFA 2WSUA 2XLFA 3WQBA 2W1WA 3ZLIA 1RUC2 3I8TA 2CGOA 2R072 5EJ1B 1IG0A 1UZ0A 2DCJA 5FP9A 5FPBA 4CUAA 1VBD3 4YZ1A 4IL7A 1J1LA 3IDEA 1V6NA 1YXWA 5IUQA 2B42B 2GC1A 5FMCA 1V9U2 5A7WA 5ACA2 2HWB3 1RUNA 3ASIA 2WZR3 1VBA3 5EQUA 2WRAA 2L9LA 3WSOA 5D2AA 1UPSA 3W59A 2K0GA 1VB2A 1JTZX 1OVSA 4OMDA 5CAZA 5L7OB 1AUYA 3RYPA 2VMEA 4BK5A 2DCYA 1DGRA 1PGL2 4XDPA 2FHRA 3OBAA 1JN2P 1O8SA 3CHXA 5JR2A 5LB6A 2VPVA 1V6LA 3CF6E 4HFSA 3WW1A 3SH5A 2UYAA 2BOIA 3POFA 3UESA 3ZFFA 2WS93 2ZBJA 3ZXEA 2SBAA 3DUIA 3AFGA 4LA3A 3L9JT 3KZ4C 1IHMA 1ZBA2 5IAVA 3S5QA 3V56A 1Q8PA 2VW0A 2RS31 1LOFA 1VAMA 2QQWA 2V72A 1HB3A 4CP0A 3NNJA 1RB8G 1TMF3 4XFIA 1TVGA 2RS52 5FYHA 1N47A 2JDMA 4DFSA 3TN92 5J37A 3PHMA 5FZFA 2BZDA 4D94A 2DDUA 2RR11 4QQOA 5JIUA 4JRLA 4Q8LA 3WQ1A 1SPPB 2R1DA 4CDQA 4UT5A 2HYKA 5DAXA 4D69A 2C4XA 5CFDB 1YEWA 1J58A 1H2MA 3M3EA 4GQ7A 1NE4A 4RR3C 4W50A 2RE9A 1S0IA 3O12A 1RUJ2 2JG9B 4XJUA 3FLPA 2WFF1 2WN2A 4QB6A 2Z4FA 3HVDA 1I9RA 4Y1ZA 4DINB 4W8JA 2B39A 2PMWB 3NAPA 5FREA 3J7MA 2BFUL 2HWC1 3NJYA 4DMIA 1O3QA 3AMMA 2UWBA 2XL7A 4JGZA 3VBFC 3JB4C 4WM8A 5AC91 1PO11 2OW4A 1Q8SA 4LULA 2ZAHA 2WQZC 2ZCWA 3KF5A 2PLV3 2GNMA 4GIQA 3I2HA 4YLZA 5IK8A 3AKRA 2CDPA 3RZGA 2G19A 4YVWB 1QJFA 4MZUA 1WCQA 3USUA 3NV4A 2PFWA 2ID4A 2PHFA 2D6MA 2VMFA 4YW3A 3ZXLA 3D8CA 2E7AA 3JQXA 3RWKX 3FUOA 3FFZA 3T0DA 2A3YA 2JECA 3H9AA 5F5CA 4DUXA 3RPQA 2GC3A 2QQKA 4Y33A 5C70A 5HXMA 4WM7B 2VVEA 1W6OB 1AR81 4M0HA 4M3CF 5E8AA 5CKNA 3VZLA 1OQDA 2VNOA 3Q8AA 1BBT2 1OLQA 1XU2A 2DVFA 3VV1A 2PHTA 3HPNA 1DU3D 5DG2A 2VG9A 4FXKB 2XBO1 5FV3A 4AI3A 4AK3A 4MGIE 1AX1A 3NNMA 1RJ8A 1UXXX 4RFT0 5C4WA 1MEC3 4LBNA 1W8HA 2Z42A 2P3IA 3WINE 4RS5A 2Y6JA 4JKKA 2NPIA 1CAUB 4HKLA 4CCCA 4LBMA 1A3KA 3VZOA 2ZA9A 2TEPA 3ZSKA 4DOUA 5C3SA 2Q8EA 4QQLA 1B35B 1KXGA 3TNQA 4CRQA 3FHQA 2E51A 1XXNA 1QDOA 1QJY3 5H9RA 2VH9A 1A78A 1LNSA 2V73A 4N7IA 2C6SA 2OA2A 5DZEA 1WMEA 4W6YA 5LRRA 4BOWA 3LD8A 1FAYA 2HWC3 5FPLA 1EAH1 4UXAA 3UKNA 3AVRA 1JXNA 5FY8A 4R9CA 3I97A 4GULA 5GM0A 1XYPA 2XJVA 4J1WA 3WHTA 4Z92B 2P2KA 4FFGA 4XFHA 1H2LA 1LHVA 5LBEA 1CWPA 4MLOA 3AVSA 3H1YA 2WQ4A 3RWNA 3HR9A 4FPJA 4JDOA 1UY3A 4IEOA 4JGZC 3WZ1A 1OD3A 5APAA 4YSFA 5JPMB 5KR7A 2RDSA 4HMZA 2I74A 1OBNA 3NAPC 1RIRA 5JCTA 2D5FA 2RDNA 5FYIA 2NYYA 4E9KA 3M1HA 1AF9A 1QH6A 2XQXA 2GDFA 3QH6A 4MHUA 3WDVA 1DHKB 1O4TA 2BDRA 2AREA 5C9AB 1BHGA 2FDGA 1R082 2GNBA 4L2NA 1ZBE2 4KGGA 3VZNA 5L73A 3AP4A 5I8YA 1PO22 2EIEA 1SMVA 2ADDA 2YC2A 2CY6A 2YZ4A 3WNXA 1C28A 1S1AA 3BVCA 1DG6A 1V6MA 2VTXA 3J7LA 1LEMA 3OUHA 4CU9A 4EN9B 3VBSA 3VD9A 3FFQA 4BXFA 3ACGA 2C1FA 2B45X 1W9YA 3FE5A 1DGWX 4CU7A 4FT8A 2VOWA 4EQVA 4XYXA 1CAUA 4ZXKA 2LS6A 2VECA 3MUZ1 3RNSA 5A3MA 5C33A 4Q1PA 4LTAA 3KS7A 3UYJA 5K4LA 1W2UA 2W94A 3JU9A 4LKFA 5FUNA 4XCBA 5K0UA 1S0BA 2WAAA 1KJLA 3R6SA 2A73B 1K5MC 2ADEA 1EUUA 3NW4A 3O1UA 3TN91 3BIEA 5JI7A 4Y20B 3ZSMA 4D7YA 1NE6A 2XH6A 3ZFEC 4HANA 1C1LA 1GWKA 1REDA 3OPTA 4JDNA 1LB2A 3ZIWA 4QKFA 4K3UA 3K75B 2EALA 4UW3A 1JZ2A 1O3TA 2F6BA 1XPWA 4CDUA 5FOJB 5FWEA 2HWD3 2XJTA 3EBRA 4PDWA 2XKPA 4QHZA 4JHZA 1RYYA 5JMOA 5FPUA 2DBIA 2WFF3 1H4GA 3GXUA 1PHMA 5K7PA 4QQ2A 4YZ5A 3LF7A 2P6CA 3S5AA 2A3WA 2W87A 4QXHA 1BEV1 1CZTA 3NKTA 4XJWA 3UGHA 2ATFA 2DBNA 1YYNA 4RR3A 1EUTA 3PMSA 2VVFA 5FZIA 1OF4A 3OUIA 4IV3A 4IEYA 3T1LA 1AR61 1SLTA 2VGDA 4YGBA 1GV9A 2HYXA 2PA7A 1RVF2 1MS1A 3ZYRA 1MZEA 2YGLA 3M3QA 4LHSA 3DN7A 4E2GA 4XFFA 4FP3A 3S30A 4Q0UA 1J3PA 1PIV1 1XU1A 3M7AA 4R9BA 5A7OA 3O7OA 2EXHA 1H8VA 1VP6A 4P9IA 4PQ9A 4PJYA 5D8AB 4QGMA 1ALYA 1WW6A 3JD73 1BEV2 4AHWA 2MEV3 1Y9MA 1QJX2 2IXHA 2PYTA 1XJAA 2LTNA 2ZEZA 1GQHA 3AB0A 3KHCA 5HI0A 1VMJA 5AC92 2QCSB 1GUIA 3GDBA 1S0GA 2JE9A 2W08A 4NPRA 3USSA 3ZXJA 3HWJA 5CB7A 3EMRA 4K1YA 1YQ8A 5KHKA 1TME3 5FZ4A 3BUCA 2XBO3 2QQLA 2WWSA 5HCHA 1PGW1 4Y22A 5JLVA 1YFWA 3RS6A 1NT0A 2C9AA 3VBOA 5KHJA 2W9XA 5BPXA 2GC0A 2PQSA 5FZ7A 2WIIB 2XJRA 3T09A 4ES9A 4GB31 3R05A 3JBG3 1AR73 2WA4A 2XBO2 4KI5M 1IG3A 2YB7A 5A33B 1O3SA 1V00A 2RJLA 3HNMA 5BNPB 5J36A 3B94A 4P00B 5A7SA 2RJKA 2XJUA 2Q1MA 2BGPA 4I02A 3TYJA 1ZZCA 3ZYGA 1R1ZA 1SACA 4LQRA 2P1BA 2D3SA 1QJX3 3IMNA 1CQ9A 1O6UA 2RJ2A 3CJIA 1BEV3 2FQPA 4AVCA 2VTXJ 1VMFA 4XABA 1UAIA 3NNFA 3AYDA 4PDWC 4WBBA 4YW1A 4M4RA 2YYOA 1PK6A 1IKPA 1RMU3 1Z0HA 3B00A 3QBQA 1M06G 2A6VA 2GNDA 1NLQA 1FPN2 1LENA 1W05A 1LOAA 3FL7A 5GALA 3LDKA 4FP2A 4YYOA 1KITA 3WF0A 4X8NA 3O0WA 4GMP0 5EYXA 4C0HA 4CP9B 1Z7S1 4EN6B 1H4HA 3PL0A 4CVUA 3U0ZA 3MW2A 4B7EA 4Y4RA 2PHDA 3AP9A 1UU6A 3KLSA 4DS0A 5K0UC 2VUJA 5FYZA 3OB8A 1VBB1 2P6HA 3AK0A 1UPIA 4W65A 3KV6A 1HV1A 4LHLA 2FDIA 2WFF2 4HLTA 2GMPA 5A7NA 4YGCA 1UQXA 3HT1A 1DQ6A 5T5PA 3AJYA 4ES8A 4D7TA 3NVCA 5FY4A 2Z79A 2HWD2 4DXSA 1AL21 2QFEA 2Y64A 3WDWA 3MFAA 4DEVA 3OTFA 1ZZ7A 3VD3A 1CAXA 2JG8C 4FPCA 3RJRA 4DZGA 5EV7A 3OY8B 1X50A 3CO2A 4Y24A 4BWOA 4Y5SA 1WD4A 1L7QA 2WO3A 3APBA 4LNVA 4UFJA 2WNOA 4E4SA 5FFOC 2JDYA 3TEXA 1SLCA 1OT5A 2GC2A 4LBOA 5JIAA 2CHHA 4XETA 3URFA 4JKMA 4JV4A 1OVPA 1JUIA 4ZS3A 5CG8A 3ZO0B 1RXGA 1QJZA 1BQPA 4Q4X1 4HONA 1JHNA 3IMMA 5DQ0A 5LK7B 2QUOA 3RI8A 2GH2A 2ZOEB 4QPIC 1QWRA 3OBZA 3GNEA 4G9SB 2W95A 4Z82A 3N4MA 2VXJA 4NN0A 4COVA 3F2ZA 2FCVA 4QPGC 1PO23 3J9SA 4AFAA 2ETEA 3W9AA 5C8CC 4HPKA 1XSQA 2JIJA 2BU9A 3VBRB 3ZFEA 3ZYBA 2Y34A 1GLHA 2VJXA 3LPGA 3OSDA 4JCKA 3SISA 1ZX5A 5ABJC 1ZBE3 1OC1A 1R083 2ZKLA 1GANA 2ZEXA 1NLSA 2A75A 4HOOA 4URTA 4BQXA 1R093 1CR7A 4H14A 5JWPA 1I5PA 1HRI2 1QOSA 2ILMA 5JXJA 2ARBA 3N36A 4XZPA 3U14A 2JE8A 4JTNA 3VLBB 1I3HA 4QXBA 2EIBA 4CCEA 1XYNA 1KEXA 4OZOA 2WNEA 1UY1A 3P3NA 1G9CA 2HH9A 5DXDA 3OJBA 3RFRA 5ABJB 4CUCA 3H7JA 3C7EA 5C8CB 4FFHA 4I0BA 5J98B 5A70A 5J3UA 5I8TA 5A1FA 5FYCA 5FRAA 3DYPA 1GWLA 4CEYB 5FJKA 5FUIA 2J1RA 1WLDA 2ZGLA 1JI6A 1EPZA 4MXWA 5EWSA 5K8SA 3KCYA 3HMYA 2H0VA 3FUQA 1D4M1 3VBHC 1FMD1 1BVP1 2Q4SA 4EWAA 2GN7A 2A3XA 4NHLA 1QJY2 3V0AA 2ENRA 2B5HA 3S57A 3RQ0A 1U5IA 3I54A 4WVMB 1YJLA 4N90A 5ABJA 4B7KA 2UWAA 2AACA 4LO8A 1PM4A 4COZA 1U12A 4Q4X3 1MEC2 1PK6C 2WZR1 3WV6A 4I2OA 1W03A 3T4HB 2MPFA 3VD5A 1UX7A 2D40A 4IQPA 2KD7A 4QPIA 3B01A 4A41A 5IK7A 2DTYA 4FOVA 4LOTA 5HCAA 1G9FA 1BBT3 2P17A 1VRH2 4FQ4A 2NN8A 5FP4A 4LE3A 4XF0A 3ZOIA 4Z8BA 2J22A 1GZWB 4TYSA 5FPVA 2XUMA 1OD5A 5C3RA 4NIDA 4IE0A 1RGSA 5LA1A 1POQA 2VXRA 1SDWA 2V4VA 5FY1A 2XG3A 4XJ9A 1BZWA 5J48A 4I01A 4S2HA 2HEYF 2ZHLA 1NKGA 4BDVB 5CKMA 4UI9L 4NIHA 4XUNA 2WUHA 3VBOC 3RZLA 4CU8A 2PHXA 4AQSA 3ALQA 4EROA 1GNYA 4EJRA 5CA6A 5HV0A 1ASJ1 2XOMA 3IAPA 2WLPA 2BBAA 4CA9A 2QDNA 4FTSA 3T08A 3DL3A 1AR92 3EYPA 2VOKA 5EYYA 3MIEA 4LBQA 1SLBA 2D6PA 2TUNA 1NX9A 1YO8A 3PUAA 3VD7A 2IXKA 2F4LA 4QX1A 2LALA 3WP4A 1VLNA 2AEZA 5EPAA 2JG9C 4YWAA 5KXEA 5F3EA 4AW7A 2YUEA 2ARCA 1RHI1 3LEMA 3U11A 4BU2A 4D6QA 2BEOA 5C7GA 1WMDA 1W6NA 5FR3A 4CYDA 4LUMA 1RUJ3 1IPJA 4IEWA 3U75A 3IBMA 4Q4W1 1J1TA 1SLLA 2OXBA 2OZ6A 1O4YA 1RUH1 2YMZA 4WVMA 3VGIA 4B1MA 4DXRA 3PJYA 5DUUA 5DUWA 3VBUB 1RUF3 2CGNA 4ASMB 1O3RA 2QE3A 4BHPA 3HN3A 3MGUA 3RSJA 4CDUB 3PDQA 2UWCA 5GZFA 4AGVA 1OPOA 4JAAA 4IV3B 1GYKA 2OZJA 4RS5B 5H9PA 3V64A 4OQ8A 4SLIA 1BLZA 3JQWA 4HKWA 5IATA 4FPOB 4QX2A 3THPA 5IVJA 4MOAA 4XACA 4M3CB 5FZHA 2ZKNA 1COV1 1TMF2 2RM23 3BN6A 4UFLA 3X29B 4BLJA 1E5SA 3SMHA 2PTMA 1OOPA 2Z5WA 4DY3A 3CNAA 4PLOA 4CEWA 1HW5A 3NAPB 1QGLA 3WOGA 3MPPG 3PU8A 2BYVE 1QIQA 2P4EA 1V6JA 1XE0A 4ISRA 2W47A 1BYHA 2WS92 4QT6A 2XXZA 5FMOS 3RMYA 1F4AA 1QHDA 1YIPA 2XDVA 3GALA 3O1TA 4COUA 1DDLA 1VBA1 3A0NA 3E6BA 2GP5A 1MS8A 1G86A 2XB6C 3FLRA 4E2SA 4DIQA 5KWRA 1POV1 2ZMLA 5FJHA 2PXJA 1CPMA 2HWB1 1WLCA 1J83A 2JDUA 2ZTNA 1JMUB 1LU2A 3SLIA 1AVBA 5KXDA 5FDBA 1JZ4A 2GU9A 3WNKA 1VBA2 3HD8B 4QKDA 2WZR2 3LOIA 1OOPB 1S0FA 4JZRA 5A3PA 4V2VA 4E8CA 5LEKA 2HWB2 1HRI1 4RL7A 5ACA3 4I0AA 4JRAA 1N3OA 4AZZA 1JZ8A 1JYIA 4IV1B 1VBD2 5CNAA 1IS4A 1Y3TA 1ODNA 4A6OA 1W9WA 2CNAA 2JJ6A 5FAXA 2OPWA 3T30A 1RUC3 4QMAA 2AZ5A 2J1EA 1BK0A 5FBZA 2DU0A 5EFUA 5LA0A 1NZCA 1V9U1 2Q8DA 3BOWA 4ARYA 1PGW2 3VBSB 1Q8OA 1VRBA 4PLNA 3AKSA 4LLOA 4X6RB 3O1SA 3LSEA 3I3BA 4YPJA 4HXCA 4KG8A 4BZ4A 1C5HA 5FYUA 2E7TA 1W3VA 3PTRB 3BODA 3M3CA 1FMD2 2E32A 3POSA 2YC4A 2HWF2 1U0AA 1C5IA 1UU4A 2D3RA 2RG4A 4IESA 1MPXA 1COV3 3AJZA 2RM21 3ETQA 3ZN6A 3GCWA 3KF3A 1F4HA 4XQ4A 1DGRN 2W68A 1SBEA 2FZ1A 4XMAA 4XTMA 4CEWC 3GZAA 1U5XA 4E4DX 1X82A 5F39A 3EO6A 1F31A 3IM0A 1DZRA 3N9LA 1K12A 3OOXA 5BV6A 3PUQA 2Q1ZB 2B4KA 4Q5OA 3U07A 1TEIA 1SBFA 1XBFA 1ASJ2 1WBFA 5T50A 3U10A 4NHKA 2WAOA 1AYM2 1AYM1 1HB1A 2OUJA 1DP0A 3KHBA 3MUY1 4QB2A 4CDXA 1F5JA 1Y43B 4O9GA 2EIDA 5FQ0A 4P08A 1HQLA 1EV13 3RGBA 2PHUA 1LODA 2QVSB 1PM7A 2WFPA 1ND2B 2NMNA 3C7HA 5F7UA 5LEJA 2Y26A 4BYYA 3TOJA 2ZS6B 2YV8A 1W2OA 3N9PA 3H0OA 5DZFA 3SC7X 2JD4A 2NZ9A 3VUOA 2B7YA 1AR83 5LY1A 4NRPA 3WCSA 1RUD3 2ERFA 4AVTA 3UL2A 1OHFA 2WZEA 1ZRIA 5BY5A 5C4WC 2XQRA 4XHBA 3MLJA 4Q4V1 4CDXB 5GZGA 5FZOA 1K45A 1LCLA 3RDIA 5FZOB 5CFCB 2QQMA 1QY4A 5KXCA 2E53A 4BISA 4B4RA 3D82A 1OH4A 5SV8A 5IAXA 3DXUA 4GMP3 2Y6FA 3WDTA 1VBE1 3I2GA 4GWIA 5FXZA 1ND2C 2XVKA 1W8WA 1OXCA 2VOTA 3ACFA 1UIKA 2RS12 3ON7A 2X29A 1W9SA 4H2AA 1LHWA 2F17A 4QKNA 1RUJ1 4I0WB 1C4RA 5JAXA 2BWAA 2VL4A 2ZGQA 3RG0A 3MIDA 3T0AA 3S0MA 2WO2A 1C3HA 3NV1A 2WNVC 3MYXA 3QH7A 1HDKA 1IKQA 5H9QA 1ZRDA 2D97A 2R042 3GZTB 4P9LA 1YI9A 1AR63 1H1IA 1MZ5A 1AJOA 3IIIA 1AYN3 3OD4A 1ULOA 4Q0SA 4DQAA 2PAKA 2WNUA 2YPJA 3OEAA 4ASKA 4YG3A 1CGPA 4IEVA 3J4UH 5GLUA 3THTA 1CVNA 3ECQA 3N35A 4CP9A 1K42A 1PIV2 2ZGKA 3T2OA 3KVAA 2BRTA 2C5DA 2NMOA 1URXA 2N7GA 2KM2A 2V5YA 2XUEA 3HEIA 4BJ0A 4UW4A 2YXSA 1PIV3 2Y6LA 1YQ2A 3J7NA 1JYCA 2PAMA 2RMU3 4HVRA 2AH2A 3SHRA 3CMGA 2VMDA 1KJRA 1AX0A 2PHWA 2XKOA 3AL5A 4XBNA 5KHGA 3H8XA 2ZGNA 1KRIA 1AJKA 3HBKA 5F5IA 4BM8A 1E5RA 1PVC3 2R043 2WWUA 4KG0A 4WVWA 1DIWA 3VBSC 2D98A 4BE3A 2FMDA 1CJDA 1RUE3 1CZSA 2VMIA 2XHKA 3KGLA 5JVVA 4Y26A 5G05L 1SZBA 3B5LB 5HPOA 2PELA 4QDRA 3E5UA 1H6YA 4S2GA 3IZOA 3L2HA 1Q8QA 5FZBA 2GP3A 4OLLA 1UN1A 4P9WA 2RS13 4BLIA 4YM1A 1O5LA 1ODMA 5FYMA 5JZGB 1VPHA 4L8QA 2GMMA 2VQ0A 1GZTA 2EXJA 4D3WA 3GYDA 4UF0A 3BCWA 3H1WA 5FUPA 1RJ7A 2X10A 1QJX1 4FAHA 3LEIA 1QXRA 1DF0A 3E1F1 1HN0A 2AUYA 2XWBB 1MS9A 4LO7A 4Q0QA 1IPKA 1IOAA 2HWE1 2OVUA 1X33A 5E88A 5LBBA 3WP5A 5CFCC 5FZ9A 2P5BA 5JI9A 1LAJA 3LGRA 3DPRC 1YQCA 2ET1A 4P5HA 1FV3A 3AL6A 2Z69A 2WSVA 1NXMA 1W3XA 1D2QA 2VZUA 1FYUA 3VBUC 4FPGA 5C4WB 3TEZA 2G1MA 2JXAA 4QAWA 1KQRA 3AZVA 4WZCA 4D6SA 4K7JA 3AZWA 2OIIA 3A22A 3K3NA 1EV12 4DEQA 2A6ZA 2Q8OA 3J26N 1MVEA 2Q5TA 2JX9A 3VBHA 4JHTA 2VZTA 4KMQA 4NUBA 4QDQA 1AYM3 5A6YA 2C26A 1Z7S2 1VBB3 2KA3A 4LBQD 1ZRFA 3UJQA 2JKBA 1ONAA 2ZACA 2WKKA 5DAWA 2BJSA 1AXZA 3AZZA 1DQ2A 3DYMA 4XE9A 3WNOA 1ULPA 2ZGTA 4JQTA 4IEQA 4AI8A 5FP8A 5K9YA 3ZDSA 1OA4A 1LOFC 1CPNA 1JOBA 4LOSA 2Y60A 3ZN5A 3NNGA 2QBXA 4YW6A 4LIUA 3W21A 5F9TA 4XJ8A 4OHZA 2VM9A 4XOGA 4A42A 1SFNA 2VC9A 3LSDA 4M4PA 2HWF3 3WNPA 2DVDA 4E4HA 2VW1A 4IE6A 1JU4A 1VBC3 2HLEA 2O1QA 2XMLA 4JC1A 4NVPA 2GMEA 2ET7A 3UGFA 1BVVA 3P6BA 4D0QA 4CCOA 5IVVA 3AZXA 3MF9A 2R061 2LRPA 3LE0A 3E97A 1UOBA 3ABZA 2QQJA 1NA1B 5JXHA 1ZNPA 5FMDA 1ZRRA 1MR5A 3ES1A 5CFDA 5LW9A 3CJIC 2HWE3 1PMIA 1PX3A 3OGGA 5D1IA 5JOZA 2FDKA 1JOPA 3W5NA 3AYCA 4FCAA 1XOYA 4HG6B 3MLKA 4Q4V2 3DGTA 3JBG1 5GJ6A 4COWA 1R081 3DEMA 4IXLA 1GZWA 4LBQB 5CEHA 4RN5A 3ZXDA 4B8EA 4XUOA 2HEWF 4YZ3A 2IFWA 1UF2C 4YVSC 4INDA 4AEMA 2E31A 5F3IA 1GZ9A 3ACLA 4WM7A 2DVGA 4OHWA 3POBA 5GLZA 1OURA 3VBHB 3I2KA 3OY8A 1SLAA 4OZXA 5AVAA 3BIWE 5LY2A 1DQ5A 4LPLA 1BMV2 1UYYA 1YHFA 3QACA 3GJBA 3LDBA 5DAVA 2TNFA 1S0EA 1UKGA 4XC9A 1JS9A 1RUOA 1Q3EA 1ULGA 2R7EB 4RGKA 3ZFGA 4OI2A 2UURA 3ZFGB 3CJXA 3O1MA 4A3XA 3BOPA 4Y1UA 1DQ4A 3KQRA 2VE1A 3NQHA 4JKLA 4L11A 2PQQA 5IW0A 2XONA 4YW7A 4UOJA 2R071 4LBLA 4KWUA 4PT6A 1LR5A 2WO7A 4XFCA 4CPBD 4ZONA 2RM22 5F2WA 4CCDA 4Y20A 3O1PA 3H8OA 2ARXA 4XVHA 2MHFA 3IB3A 3VL9A 1PVC1 1VMHA 2CWSA 2ZGPA 3QCWA 3AFKA 1FOD1 3ATGA 4NWWA 1QEXA 2Q30A 4QHOA 4QGLA 4ZS2A 1GKBA 1OLRA 1RUF2 1Y9GA 3PNAA 4HN1A 1WZXA 2W46A 5FY5A 2R32A 3E6CC 1SG3A 4TN7A 5EZWA 3W20A 2ARAA 2YHJA 1BMV1 2VBPA 1W9TA 2GH8A 1QKQA 3AKPA 4F7ZA 3UT0A 4KWJA 5F37A 1QQP2 1CIYA 1RXFA 1MS0A 4ZY9A 4TTGA 2V4AA 3KCCA 1OPMA 1SCSA 4E27A 3G6JB 3IAQA 3FZ3A 4CE8A 3HOBA 3K2OA 3LCPA 2X5IC 1UOGA 2VU9A 5DG1A 2JD9A 1WGPA 4O9EA 4QPGB 4EYUA 2XLGA 1AR93 3VB9A 3SH4A 3ZMOA 4RGGA 4XIKA 2FD8A 4LORA 3B9IA 2ORZA 3KGZA 4TLGA 3H8UA 4Y5TA 1CIWA 4OUSA 2QQPA 4HK8A 1S0CA 1CX1A 2WA3A 4YFZA 5EHDA 1SBDA 3ZMNA 2JDAA 4Y22B 5T5JA 3EHKA 1ENQA 1NG0A 2YFUA 3I59B 4LO5B 3MHZA 3TEWA 3L2YA 1KFXL 4B4QA 2QDRA 1BKZA 3B7MA 2YROA 1W8TA 3ZSJA 4G3YC 2X53S 4UWDA 1NCQC 3GJAA 4LKSA 2NLRA 3KQ4B 4LBKA 4PF5A 1TQ5A 2IXCA 1MQTB 1VRH3 5J96B 1CAWB 3PMEA 4DXTA 2EAAA 1WD3A 3Q8BA 3IKWA 1LJ7A 1HXS1 4AF9A 4N43A 1ZA7A 3H3LA 3M70A 3IDBB 3VBOB 3UK9A 4Q4X2 5C6CA 3M3IA 4N53C 4E8DA 1J3QA 3EJKA 4WV8A 5HCBA 3VN4A 4NRMA 2RR12 1W6MB 4XIOA 1NYWA 1SCRA 4Z2WA 3K51A 2WNUB 5DPNA 1UIJA 3ZSEA 1O59A 2XVGA 1NCQB 3JZVA 2OT7A 2VZ1A 4AI2A 3NSTA 3HT2A 1W0PA 3A21A 4HBNA 4M00A 4RQPC 4YGEA 4Q29A 5SV5A 3MW3A 4XURA 3O5SA 4QPYA 3AYAA 1T6BX 4YGDA 2RS32 3T1MA 3VBUA 5LZ6A 3KD4A 4YW4A 3I3DA 4XTPA 3WG4A 4OI0A 1N3PA 5C8CA 1ZVFA 4LMFA 3DPRA 5I0RA 3Q8FA 4CPBA 4WZFA 1DYPA 3LFIA 1OF3A 4ZU7A 1UZWA 5DZGA 1BJQA 3MICA 1O7FA 3MDPA 4NHMA 5C3PA 3BTXA 4PDWB 2KR2A 1DGLA 3IDCB 5JXIA 1C8M1 1ND3A 4NPLA 2X5IA 1RVF1 5KHHA 4DO0A 4XQWA 1C1FA 4MGSA 1QJU3 3ZN6B 3LPFA 4R8HA 1IGOA 1LGCA 2WYSA 4ATFA 3VKNA 4GXLA 3K48A 1RITA 3ORJA 3PVOA 1K5MA 5IK5A 1HRI3 4K8RB 4UFIA 4FSJA 5BNPC 1W28A 1R092 4XAEA 1SFPA 5LRSA 1HB4A 2JDKA 4AAPA 1H8TC 3OCPA 4DPNA 5C9AA 2BPA2 4LEJA 5DMYA 1OKOA 1ZM1A 2V09A 2CAVA 2DV9A 2B9UA 4BK4A 3SEPA 3ZDVA 1VRH1 5FLJA 2X5IB 2WL1A 2RDQA 1JH5A 1QH7A 3WY6A 1HXS3 5BNOC 3WCRA 4BQWA 1EP0A 1UU5A 2DCZA 2ZGMA 4UW6A 3UV9A 5IT6A 1JBCA 4EV0A 3T4VA 4NHYA 3VKFC 1LOEA 4TLFA 1MZ6A 5FQ0B 1FI2A 3LAGA 2EVXA 5FMOL 1XSRA 3DKWA 1Y9QA 4P9JA 5IWFA 1QNYA 4BQ5A 5A3NA 2YGMA 3AYEA 4NOTA 1W2TA 1JW6A 3CDZB 1EYBA 5A6XA 2Y0OA 3ZYPA 3FMGA 1D2SA 4Z1VA 5DDJ1 5CISA 3MEPA 5D8AC 4C8DA 2YG0A 1OH3A 3CU7A 3LFMA 1E5IA 1H2KA 1RHI3 2ZMKA 3LDRA 4TZDA 4CZSA 3K4DA 1LHOA 1V6OA 4XDOA 3J8F3 4KU7A 4CXXA 5J7MA 1WKYA 2YU2A 5B2GB 1GQGA 2VBDA 3OBRA 1OQ1A 3AMPA 3ZYFA 2BUKA 1UOJA 1OQEA 2CWMA 1HKDA 2ZX2A 3I2FA 3POEA 4PBPA 4V2WA 4WM8C 5T55A 5GZCA 4YM0A 4LBJA 2NQYA 4GH4A 3FHAA 4AFMA 5T52A 3NL1A 4CUGA 2O14A 1X7NA 2Y38A 1WW5A 1UD1A 2DVBA 1SLIA 3DF0A 3UJOA 1K5MB 2BERA 2QQUA 4XXAA 3T0BA 4E4ZA 4QX7A 1IS3A 5IVFA 3INAA 4O7XA 1UOFA 3AMQA 3K3OA 1DYKA 4N8MA 4XF1A 4EZHA 1X36A 4I30A 1NA1C 2D43A 3CQOA 3AX4A 4N53B 4CDQC 2CAUA 2EICA 3QLQA 4OCTA 3WD5A 4N53A 4Q26A 1RUI3 2AGSA 1FPN3 2WS91 3FN9A 1KD7A 4FPLA 1S2KA 2HJIA 1UZVA 3D5OA 3U78A 2DYCA 1RMU2 3FC0A 3ROUA 4CTEA 5FXWA 5I91A 2WNVB 4NIIA 3H7YA 4CDQB 1YCIA 1YQ6A 1G9BA 1LOBA 4KNCA 5FLIA 1H9PA 4XJZA 2P37A 3B69A 1HIXA 1LHNA 2VUDA 1UYPA 4DRRA 5BXXA 4XPVA 4NIGA 1C8M2 4JDMA 4HK9A 4O61A 3PIGA 2VMGA 1JZ3A 2OQ6A 4E2QA 2AR6A 5JZGA 4QXCA 5ACA1 1H30A 1GNZA 1GOHA 3B9CA 1PZ9A 3D4KA 2ZHKA 1W6PA 2DFBA 5FLHA 3RYKA 1AR71 1AR72 3PLQA 1S4CA 3JBG2 4I09A 1W6QA 1UYZA 4K20A 3RMXA 4Q4W2 3ZXFA 2BQPA 1M4WA 4G4FA 3VDCA 4CXYA 4AGRA 3W5MA 1TNFA 2D6KA 4AVVA 1KDMA 3THCA 1GOGA 5F6LB 1QJEA 4H3WA 5EIYB 3TWIA 5A6ZA 4IE5A 5DAQA 5M0TA 1TME2 3UGGA 4K6BA 1POV0 5L7OA 3ZKUA 4XFGA 5FY9A 1CD3G 5LA2A 4OYUA 5FZ3A 2PHLA 1WLWA 4Y3OA 2G4IA 1WMXA 4IGQA 2X05A 5AC93 3VDBA 3K46A 1A8MA 5FCCA 1DLLA 1UY0A 4PHZA 4H55A 3HQUA 5A7WB 1ENRA 4IEZA 2MEV2 4DUWA 5A3TA 2JB8A 3JD72 3PVNA 5KXBA 4RA0A 4OMCA 3RJ2X 4NIAA 3WG2A 4FO9A 5KBFA 2FBEA 3RI9A 4Y4YA 1Q5OA 1J3RA 1OI6A 1GICA 1VAKA 2B9VA 1RVF3 1RUI1 3SKJE 1NCRB 3OGSA 5HXVA 1PMJX 1SPPA 3PUSA 2D44A 3GBFA 5GLTA 3VZMA 5FMBA 3LEKA 3RZZA 3RZJA 1H8TB 1OLME 2BP6A 3IDAA 5CADA 1T2XA 3CL1A 1QNWA 1R1A2 1WBLA 3WQ7A 1JZ5A 2OS2A 4AHZA 3T2PA 2OUHA 4FXGB 5C8WA 3ZFFC 5ERLA 1IS5A 1SEFA 2H6BA 4P5YA 3WNLA 4W6WA 2BNOA 4HVQA 2DUQA 2IC1A 2A7AA 1CZVA 4PF1A 1GWMA 1HB2A 1W8FA 1Z78A 2W52A 2VZOA 1V6IA 4XJAA 3ZYHA 1ZREA 2WT1A 4A7YA 1H6XA 4FAGA 1F15A 5TSWA 2FZ2A 1AL0G 2E63A 4XBQA 4XUTA 2E7QA 2ZX1A 4M3CA 5BNNB 4QX0A 4WM7C 2WWJA 1OFSA 5FO7B 5G04L 5L19A 3WW3A 2IVJA 3LKJA 3ZFEB 1QQP1 1OLMA 1VE0A 3I59A 1WA6X 5FTTC 1GU3A 2O0OA 5C3OA 5J09A 4GB33 4KU8A 2WZ8A 1R1A1 1HLCA 4IUGA 4GH4C 3LOBA 5A7QA 2QQVA 2ZGOA 1LGNA 2HBUA 1OOPC 1N1VA 2QZ3A 2WNUC 4IV1A 2CYFA 2VUCA 3GBWA 1AZDA 3ACIA 3J8F1 2CU5A 2XWJB 1QOTA 3GHNA 2Q1FA 4MO3M 2IUWA 2WT2A 4YM3A 4MUVA 1JU3A 1PGL1 4A7KA 4JGYA 4Q0VA 1AYN1 2ZAAA 2A6XA 3LB9A 5FZMA 4J6GA 5FKBA 4H7MA 5I8SA 1QMJA 1CAVB 4YM2A 2Y0IA 2OX0A 3H1MA 5E89A 5I0UA 3FLTA 5F8PA 1CAVA 1DQ1A 5EXOA 5I93A 3AKTA 1MQTC 4GZ9A 1CESA 4XF4A 1WCKA 4QU2A 4QHBA 1NAEA 3I3EA 5GKAC 3DXTA 1RINA 4NWVA 2JG9A 4H7LA 4Q4Y2 4YFWA 4UAPA 2B46X 4AWDA 3LQCA 5FZ6A 3T2QA 5A7PA 1EAH2 1W8ZA 3POGA 2VAUA 2W1QA 2FDJA 3FHIB 1V6KA 4RS5C 3POWA 1SHWB 2A71A 3BTZA 1IQAA 1AHSA 2GN3A 3PUIA 2RMU1 1PZ8A 1TG7A 4JGZB 4R4XA 2P3YA 4LO4B 3H3UA 3NWKA 3WNMA 3TEYA 2HWC2 3WF1A 4DRVA 5FP7A 3WLUA 2DTWA 4TSVA 4DNYA 3FJSA 2IWGB 4BQ3A 4MXVA 3MW4A 2LM3A 3NJZA 5FPXA 2RS11 3AP7A 2WR9A 2I07B 1HV0A 3DCQA 4C90A 4GALA 5H9SA 4BB3A 1A6CA 3C8XA 4KH9A 2K9ZA 5ISLA 4CCMA 5JR7B 4HETA 1W2AX 2CV6A 2P34A 5CZKA 1B35C 2DCTA 3MI8A 1W8NA 3DPRB 3M4FA 1YC61 1FXZA 4QPGA 4MGKE 1FNYA 1XNAA 2JKXA 3WDUA 4JVAA 2RS51 4IDZA 4AOCA 1SDDB 2YY1A 4EZ4A 1DCSA 3MIBA 2WYFA 3WW4A 4UFKA 4QX8A 4MGZE 1EAH3 3WP6A 4LHNA 2A70A 2PN5A 3MIHA 5FZLA 4AEKA 2JDHA 3OYWA 1EY2A 5F3CA 4Q4Y3 1T6GC 1BXHA 1KDKA 2XHNA 2BNMA 1GNHA 1G9DA 1PO21 3AZYA 2ZJCA 4LITA 3B02A 2SLIA 4AVAA 2P3KA 1FNZA 5FKCA 3UKTA 1HJGA 5EJZB 4LO6B 5FWJA 3OBTA 2RV9A
chains in the Genus database with same CATH topology
2PHRA 2MEV1 2AYHA 3WT3A 1O91A 2ZGRA 2PLV2 4B29A 1G7YA 1F9KA 1LTEA 4IERA 3T2TA 4YZ2A 1O5UA 5LK5A 1JUHA 2WT0A 2ZGSA 1Q8VA 1RUF1 2D5HA 4GB32 5BNNC 1W6NB 3KB5A 2P3JA 1WUVA 5GZEA 5GLWA 4KL1A 1CAWA 4BIFA 4LT5A 3SCHA 1MQTA 3WQ0A 1HQNA 3AXDA 1UZYA 4LE4A 2HEVF 1S2BA 4A2UA 4AFCA 2JENA 3CJIB 3WVJA 1X8EA 3LA7A 4KGQA 3GHMA 4MGYE 4RR3B 1NCRC 4HVOA 3TBDA 2QJVA 3WUCA 1W6MA 1WA4A 4WVVA 1MS3A 3TN93 3ZIXA 4AFDA 4FPYA 1NQJA 3GBGA 3ZXGA 5KC6A 2RS53 3AKQA 3R0RA 4XXPA 5IK4A 1ND3B 4IV1C 4YZ4A 1D4VB 2VNRA 4C1XA 1OKQA 1R1A3 3IPVA 1QOOA 5FPZA 4XBLA 1ZBA3 4Q4Y1 1XYOA 4L9BA 4MX3A 3RYRA 4KBBA 1VB4A 2VOVA 4PCRA 3E6DA 4AE2A 5CFDC 2QNKA 3UKVA 1GSLA 1GZCA 1HX6A 4HSJA 3OD0A 1GBGA 2EAKA 4BMEA 4XF9A 2CTVA 4FPFA 1IZ3A 5E16A 2DF7A 1D0GA 4QPIB 4AEDC 4GKYA 2DFCA 4AQTA 4CDWC 4Q27A 4OULA 4AEDB 2NM1A 1RUC1 2R1BA 3IPVB 1QDCA 4X6QB 3VKLA 3JB8A 4PIZA 3AP5A 1V9U3 1APNA 2I45A 2B8MA 4OFGA 4GA9A 4F8AA 5CG9A 2R073 1DBNA 4DB5A 3JUUA 1NQDA 3MFCA 4UBGA 1QXJA 3BALA 2EXKA 4Y1YA 1J59A 2GAUA 4C0BA 2CGPA 3I7DA 1TE1B 2VULA 4AI1A 1AXYA 1FX5A 5F5QA 1FATA 1LECA 2H6CA 4Q4W3 5HCFA 3ME2A 1KFUL 2H0BA 3WXPA 1TME1 1RUH2 5DUXA 2ZZQA 4KWLA 4OHVA 5A33A 1FOD3 2A6WA 1VAVA 3S7IA 4N9HA 2MNGA 3VKMA 4XDQA 2ZABA 3ILNA 4B4PA 1C8M3 4ATEA 3B93A 2IXJA 1H1AA 4C91A 3M8LA 3SH3A 5CFCA 3AM2A 3V65A 4R9DA 5T5LA 1Q56A 2XPJA 1EV11 3KT4A 4BPZA 1HRV1 2R0HA 1CONA 1RUI2 2XLAA 3JCIA 4V1PA 1NCRA 2D7FA 3BU7A 1B35A 3VHRA 1RUG1 3FBYA 1OMIA 3WG3A 5JMCA 1LGBA 3WP3A 1POV3 5D8AA 1KS4A 4QXKA 1Y7BA 5BNQA 5A32A 4RSUA 1HRV2 1ZZ9A 2Q0AA 3VL8A 4BQ1A 2EXIA 2JICA 4M0NA 1RUG2 1BCXA 1S55A 1VJ2A 3RRDA 4AI0A 2W0XA 2D93A 4QGNA 4AHXA 1OA2A 4GMP1 3SNMA 1CX4A 1VBE3 2WINB 4CDWA 4Q1RA 4HZFA 5BNOB 2E9QA 3SXWA 3W58A 4FPHA 3J8F2 3TNPB 5JOXA 1NA1A 1RHI2 1F5FA 4IV3C 5JPNB 2R062 2JEMA 2BNNA 4L92A 2D6NA 4AG4A 4FBFA 1PO13 4YG6A 1UMZA 3HQXA 1NY72 4DXZA 1XNBA 1G8WA 2OPKA 2FMYA 1D0HA 4CP1A 5JSRA 3VBRC 4HT1T 4PBOA 3VDDB 2IXIA 2D3PA 4ZU5A 4JGYC 1HXS2 2C0ZA 1H2NA 4ZU4A 3AXEA 4CDUC 1VBD1 2BVBA 2BGCA 3TB0A 1FPN1 2VUAA 2WJSA 3R4UA 4IETA 3VKOA 2BW8A 1BK1A 1UCXA 1WW7A 5CIRA 4ORFA 1ZBA1 3KM5A 2DU1A 1ULDA 3KCXA 3V0BA 4XEZA 5BNNA 1YIFA 1UKRA 1ZBE1 4R52A 1QJU2 1RUE1 1YLLA 4FOWA 2LUWA 1C8NA 5FOBB 4QM8A 4XQDA 3MPBA 2DVAA 4M01A 3O14A 2RS33 1H8TA 2CL2A 2DUPA 4JQRA 3BTAA 2TBVA 4CEWB 4PIYA 2O8OA 3ZN4A 1D4M3 4YW5A 1REFA 2RR13 2VY0A 3KMHA 5DDJ3 1XNKA 4RHV3 4AXOA 5JOWA 1I6XA 5KHIA 1E57A 4EWEA 1I5ZA 1YFUA 3ILRA 2KXLA 4CEYC 2HKXA 1AL22 4N43B 4Y5Z0 4IEXA 2PLV1 3ZFFB 1ZZ8A 4OHYA 2GSYA 3E5XA 4RQPA 4L99A 1YJKA 5JSOA 4WM8B 4C1WA 2E6VA 4ASLA 3OF1A 2OYZA 1W6OA 3H3ZA 5T5OA 2GNTA 4META 4S2FA 1Q43A 4DY5A 1DQ0A 2I2SA 1SQ4A 1YFYA 1N1YA 1WLTA 3LZZA 2D6OX 3VDDC 1QU0A 4QM9A 5BYNA 1XE7A 3SCFA 3ST7A 3N7LA 1VIWB 1TNRA 4Z07A 1XRUA 2HWF1 2QKDA 3KT7A 4QX5A 2X8KA 3IWZA 1PVXA 1RTVA 1XQNA 4K1ZA 1RC6A 3O0XA 4Z8BA 1LRHA 1L3JA 3HIFA 1FV2A 4Q0PA 3SCGA 2R0FA 1KS5A 1QQP3 2IXLA 3FWEA 3LWCA 2XJSA 4WVZA 1VR3A 5F1RA 3ZFGC 5L36A 4BMBA 1MEC1 5JOYA 1AX2A 2GZWA 4W6XA 4OI1A 4RHV1 2WZPP 3PJQA 4P9XA 4L97A 4EWDA 4XFAA 4FTEA 1ULFA 2R30A 4YVSA 1QJY1 3NV2A 3WHUA 3V0AB 1OSGA 1UL9A 4YARA 3MLLA 3H50A 1ENSA 2F4PA 4U2AA 2ZPXA 1PNGA 1EPWA 3R4DB 1LEDA 1SFYA 4U36A 4UW5A 2VVDA 1CAXB 4HKOA 2JG8B 3GZUC 2R16A 1LULA 3QOPA 2JG8A 1N1SA 4FOQA 4GWNA 1NXD1 5T3NA 2K2SA 2YDEA 1ENXA 5I0TA 1XE8A 4FPKA 1YWKA 2EIGA 1ZYBA 5I0SA 4RQPB 2BFUS 2XGXA 3PVBB 3JD71 4HSLA 4LA2A 4QD2A 5AVPA 3E5QA 1V70A 1LESA 4GWMA 3EXUA 1ZZ6A 4UBHA 3ZX7A 5K0UB 3S6PA 2GALA 2EA7A 4Q4V3 4I3GA 2WLQA 3VHPA 3TAYA 4X8PA 3BPZA 1MACA 3LA3A 3SITA 2HWE2 2VNGA 1ZRCA 1WW4A 3ZXKA 4NR1A 4ONUA 5CBLA 4MSVA 3PVEA 2VMHA 1N3QA 1NLRA 2DWRA 1PK6B 4TWTA 1ZZBA 1O4ZA 4AEJA 3ELNA 1VBC1 1VBC2 3AP6A 4F3JA 2XJQA 4AYUA 3NKGA 3NO8A 1MZFA 1AR91 3LA2A 4EN8B 2BVVA 4K9SA 4B3NA 1DFQA 2HWD1 2ZHMA 3C2UA 1PZ7A 3HN1A 2JE7A 4CEYA 3WG1A 3WDYA 2JDZA 2QZ2A 2ZMNA 1VBB2 1Z7S3 4FOYA 4XW3A 4YVWA 3WUDA 2XJPA 3IIAA 3I2DA 3OYWB 3P3PA 3VHOA 3Q9OA 4Y1XA 2IZWA 1PNFA 1OFNA 3N7JA 4RD7A 3WX5A 4LUKA 3VHNA 1WCSA 4BIOA 5JZGC 4D7SA 5GZDA 3ES4A 3S7EA 4FPEA 1S0DA 3MIGA 1AL23 3MIFA 3ZPYA 2XVLA 5AFBA 3OPZA 3USUB 4BCUA 3EQEA 4GKXA 1DZTA 2AENA 4N43C 2G9GA 3VDDA 2UY9A 5BNOA 1RL3A 3ZXAC 4RHV2 4P14A 5DDJ2 2RHPA 1RUD1 4AEDA 4YRDA 1VALA 3DV8A 3ZVXA 4XILA 1MS4A 1NCQA 4SBVA 2DUOA 1D4M2 4M3CE 2IFRA 2VOXA 4IEUA 1S0JA 3AMHA 1DGWA 3N7MA 4AGGA 1UX6A 1LHUA 2A5ZA 2WC2A 4R4ZA 5AFEA 4OVEA 2D6LX 3ENRA 4KWKA 4K8FA 4Y1VA 2O8QA 5CU1A 5DUVA 2UY8A 2ZX3A 4XF3A 3WR0A 2EF6A 3CLPA 1QJU1 1RUE2 3FBMA 4IEPA 3N3HA 3I4IA 1LU1A 1G6NA 3HBZA 2ZX0A 4MVTA 1PVC2 3R4SA 4EN0A 4QQHA 3POYA 2VW2A 4CP2A 3GF6A 4AHYA 3MF6A 1MS5A 4AQ2A 1F8VA 2BBVA 2WNVA 1YUDA 1F2NA 2RMU2 3FX3A 3D0SA 1G9AA 1LOGA 1RMU1 5A32B 4YG0A 3A0KA 4XFBA 4PIXA 1ZA4A 5KC5A 4J1XA 1IS6A 1ND2A 5EJ3A 3D0JA 5FO8B 5JSPA 4QQPA 1YNAA 2DCKA 1JOJA 4P9GA 4BA6A 3U4XA 1AYN2 3BB6A 4RGAA 1AR62 4S2DA 3D6EA 2R49A 5BUVA 5HBAA 1LKNA 2W39A 3B3QE 5JDBA 4KQ7A 4HN0A 5GLVA 4BH9A 4AVSA 1FT9A 3ZYJB 3OGJA 4JGYB 5C9AC 4YW2A 2R041 2ZX4A 4FQZA 1PO12 1W0OA 3O0VA 5BNPA 1X8MA 4XMIA 5F6KA 2DURA 1XNDA 2R063 4YNIA 3G7DA 1GR3A 4CDWB 1CN1A 4R9AA 4CDXC 4COYA 5FO9B 3KT1A 1UZZA 4AFBA 4EN7B 1ND3C 1H1MA 3CEWA 1I1EA 1H9WA 1VBE2 3KSCA 4HL0A 4ISQA 2XL9A 3HAGA 2UYBA 3ZYIB 4HPKB 1DZQA 3VBRA 1REEA 1BBT1 4N9IA 1QF3A 1RUD2 2ES3A 1AR82 1RUG3 4MYEA 2UU8A 4OI4A 5CVRA 1U5YA 3V0BB 2ZHNA 4K40A 4PLMA 1HRV3 1GFF2 1YFXA 4P9YA 1N1TA 1ULCA 5L7OC 1OA3A 3IN9A 1H0BA 4NO4A 1MVQA 4OUMA 2VQAA 2G9FA 3M2MA 4F83A 1CJPA 2BTVC 1UW8A 4A7ZA 1QXPA 4I3PA 3ZSLA 2A6YA 4N7UA 3VZKA 1ASJ3 1AXKA 3NV3A 5A3LA 1A8DA 3PTYA 1R091 4GH4B 3AMNA 3M3OA 1C57A 4LR4A 4Q2FA 3N7KA 1WMFA 2YC0A 2R6QA 3WW2A 4AVBA 4YVSB 4ITCA 4OHXA 2ZZJA 3VBFB 4K21A 3WDXA 1NY71 2BWCA 1COV2 1TMF1 5E1RA 5T54A 1B09A 2PAEA 3A4UA 1FOD2 4LHKA 1W6QB 2NP0A 1RUH3 1U5ZA 1FMD3 1W6PB 4LLFA 1ULEA 1PGSA 2ZGUA 3TRSB 4JTOA 1YRZA 4YVWC 3VZJA 1WCDJ 1HQWA 3C3VA 4MV2A 4MXWB 4MH0E 3MZHA 1W39A 2Z2SB 3IT8A 1YI7A 4FVVA 1NOVA 3QD6A 1XNCA 3ILFA 4FTBA 1LOCA 3VBFA 2WSUA 2XLFA 1RUC2 3I8TA 2CGOA 2R072 2DCJA 1VBD3 4YZ1A 4IL7A 1J1LA 3IDEA 1V6NA 1YXWA 5IUQA 2B42B 2GC1A 5ACA2 1V9U2 2HWB3 1RUNA 3ASIA 2WZR3 1VBA3 3W59A 1UPSA 2K0GA 1VB2A 1JTZX 5CAZA 5L7OB 1AUYA 3RYPA 2DCYA 1DGRA 1PGL2 2FHRA 1JN2P 2VPVA 1V6LA 3CF6E 4HFSA 3WW1A 3SH5A 2UYAA 3ZXEA 3ZFFA 2WS93 2ZBJA 2SBAA 3DUIA 3AFGA 4LA3A 3L9JT 3KZ4C 1IHMA 1ZBA2 3V56A 1Q8PA 2VW0A 2RS31 1LOFA 1VAMA 4CP0A 1RB8G 1TMF3 4XFIA 2RS52 1N47A 4DFSA 3TN92 5J37A 3PHMA 4D94A 2RR11 4QQOA 5JIUA 4JRLA 4Q8LA 3WQ1A 2R1DA 4CDQA 2HYKA 4D69A 5CFDB 1J58A 1H2MA 3M3EA 4GQ7A 1NE4A 4RR3C 2RE9A 1S0IA 3O12A 1RUJ2 2JG9B 4XJUA 3FLPA 2WFF1 1I9RA 4Y1ZA 4DINB 5FREA 2B39A 3NAPA 4DMIA 2BFUL 2HWC1 1O3QA 3AMMA 2UWBA 2XL7A 4JGZA 3VBFC 3JB4C 4WM8A 5AC91 1PO11 2OW4A 1Q8SA 4LULA 2ZAHA 2WQZC 2ZCWA 2PLV3 2GNMA 4GIQA 4YLZA 5IK8A 3AKRA 4YVWB 4MZUA 3USUA 3NV4A 2PFWA 2PHFA 2D6MA 4YW3A 3ZXLA 3D8CA 2E7AA 3JQXA 3FUOA 3FFZA 2A3YA 2JECA 3H9AA 3RPQA 2GC3A 4WM7B 2VVEA 1W6OB 1AR81 4M0HA 4M3CF 5E8AA 1OQDA 2VNOA 1BBT2 1OLQA 1XU2A 2DVFA 3VV1A 2PHTA 4AK3A 1DU3D 5DG2A 2VG9A 4FXKB 2XBO1 4AI3A 4MGIE 1AX1A 1RJ8A 4RFT0 5C4WA 1MEC3 4LBNA 2Z42A 2P3IA 3WINE 4RS5A 2NPIA 1CAUB 4HKLA 4LBMA 1A3KA 3VZOA 2ZA9A 2TEPA 3ZSKA 4DOUA 4QQLA 1B35B 1KXGA 3TNQA 4CRQA 2E51A 1XXNA 1QDOA 1QJY3 5H9RA 2VH9A 1A78A 2V73A 4N7IA 2OA2A 5DZEA 1WMEA 4W6YA 5LRRA 4BOWA 1FAYA 2HWC3 1EAH1 4UXAA 3UKNA 1JXNA 4R9CA 4GULA 5GM0A 1XYPA 2XJVA 4J1WA 3WHTA 4Z92B 2P2KA 4XFHA 1H2LA 1LHVA 4MLOA 3H1YA 2WQ4A 3RWNA 3HR9A 4FPJA 4JDOA 4IEOA 4JGZC 3WZ1A 4YSFA 5JPMB 4HMZA 2I74A 3NAPC 1RIRA 5JCTA 2D5FA 2NYYA 4E9KA 3M1HA 1AF9A 1QH6A 2GDFA 3QH6A 3WDVA 1DHKB 1O4TA 2AREA 5C9AB 1R082 2GNBA 4L2NA 1ZBE2 4KGGA 3VZNA 5L73A 3AP4A 5I8YA 1PO22 1SMVA 3WNXA 2YZ4A 2CY6A 4AQ6A 4ZKTB 1C28A 1S1AA 1DG6A 1V6MA 1LEMA 4EN9B 3VBSA 3FFQA 2C1FA 2B45X 3FE5A 1DGWX 4FT8A 2VOWA 4XYXA 1CAUA 4ZXKA 2VECA 3RNSA 5A3MA 5C33A 4Q1PA 4LTAA 3KS7A 1W2UA 3JU9A 5K0UA 1S0BA 1KJLA 3R6SA 2A73B 1K5MC 3NW4A 3TN91 5JI7A 4Y20B 3ZSMA 4D7YA 1NE6A 2XH6A 3ZFEC 4HANA 1C1LA 1REDA 4JDNA 1LB2A 3ZIWA 4K3UA 4UW3A 2EALA 1O3TA 2F6BA 4CDUA 5FOJB 2HWD3 2XJTA 3EBRA 4PDWA 2XKPA 2WFF3 1H4GA 1PHMA 5K7PA 4QQ2A 4YZ5A 2A3WA 1BEV1 4XJWA 3NKTA 2ATFA 1YYNA 4RR3A 3PMSA 2VVFA 4IV3A 3T1LA 4IEYA 1AR61 1SLTA 2VGDA 4YGBA 1GV9A 2PA7A 1RVF2 1MS1A 3ZYRA 1MZEA 2YGLA 3M3QA 4E2GA 3DN7A 4XFFA 4FP3A 3S30A 4Q0UA 1J3PA 1PIV1 1XU1A 3M7AA 4R9BA 3O7OA 2EXHA 1H8VA 1VP6A 4P9IA 4PQ9A 4PJYA 5D8AB 4QGMA 1ALYA 1WW6A 3JD73 1BEV2 4AHWA 2MEV3 1QJX2 2IXHA 2PYTA 2LTNA 3AB0A 1GQHA 5HI0A 5AC92 2QCSB 1S0GA 2JE9A 2W08A 4NPRA 3USSA 3ZXJA 3HWJA 5CB7A 4K1YA 5KHKA 1TME3 2XBO3 2WWSA 1PGW1 4Y22A 5JLVA 1YFWA 3RS6A 2C9AA 3VBOA 5KHJA 5BPXA 2GC0A 2WIIB 2XJRA 4ES9A 4GB31 3R05A 3JBG3 1AR73 2WA4A 2XBO2 5A33B 1O3SA 1V00A 2RJLA 5J36A 5BNPB 3B94A 2RJKA 2XJUA 2Q1MA 4I02A 3TYJA 1ZZCA 3ZYGA 1R1ZA 1SACA 2D3SA 1QJX3 3IMNA 1CQ9A 4AVCA 3CJIA 1BEV3 2FQPA 1UAIA 4WBBA 3AYDA 4PDWC 4YW1A 2YYOA 1PK6A 3B00A 1IKPA 1RMU3 1Z0HA 3QBQA 1M06G 2A6VA 2GNDA 1FPN2 1LENA 1LOAA 5GALA 4FP2A 4YYOA 1KITA 4X8NA 3O0WA 4GMP0 5EYXA 4C0HA 1Z7S1 4EN6B 1H4HA 3U0ZA 3MW2A 4B7EA 2PHDA 3AP9A 1UU6A 3KLSA 4DS0A 5K0UC 2VUJA 1VBB1 3AK0A 1UPIA 4W65A 4LHLA 1HV1A 2WFF2 4HLTA 2GMPA 4YGCA 3HT1A 4ES8A 1DQ6A 5T5PA 3AJYA 4D7TA 3NVCA 2Z79A 2HWD2 1AL21 2QFEA 3WDWA 3MFAA 3OTFA 1ZZ7A 1CAXA 2JG8C 4FPCA 3RJRA 4DZGA 5EV7A 3OY8B 1X50A 3CO2A 4Y24A 4BWOA 1WD4A 3APBA 4LNVA 4E4SA 5FFOC 1SLCA 2GC2A 4LBOA 5JIAA 4XETA 3URFA 4JV4A 5CG8A 1JUIA 3ZO0B 1QJZA 1BQPA 4Q4X1 1JHNA 5LK7B 2QUOA 3RI8A 2GH2A 2ZOEB 4QPIC 1QWRA 3GNEA 4G9SB 3N4MA 4Z82A 4NN0A 4COVA 4QPGC 1PO23 3J9SA 4AFAA 2ETEA 3W9AA 5C8CC 4HPKA 3VBRB 3ZFEA 1GLHA 4JCKA 3SISA 5ABJC 1ZX5A 1ZBE3 1R083 2ZKLA 1GANA 4URTA 1NLSA 2A75A 1R093 1CR7A 4H14A 5JWPA 1HRI2 1QOSA 2ILMA 2ARBA 3N36A 4XZPA 4JTNA 3VLBB 1I3HA 1XYNA 2WNEA 3P3NA 1G9CA 5DXDA 3OJBA 5ABJB 3H7JA 5C8CB 4I0BA 5J98B 5J3UA 5I8TA 5FRAA 4CEYB 1WLDA 2ZGLA 1EPZA 4MXWA 5EWSA 5K8SA 3KCYA 3HMYA 2H0VA 3FUQA 1D4M1 3VBHC 1FMD1 1BVP1 2Q4SA 4EWAA 2GN7A 2A3XA 4NHLA 1QJY2 3V0AA 2ENRA 2B5HA 3RQ0A 1U5IA 3I54A 4WVMB 1YJLA 4N90A 5ABJA 4B7KA 2UWAA 4LO8A 4COZA 1U12A 4Q4X3 1MEC2 1PK6C 2WZR1 3WV6A 4I2OA 2MPFA 4IQPA 2D40A 4QPIA 3B01A 5IK7A 2DTYA