4XFAA

Cysteine dioxygenase variant - y157f at ph 8.0 in complex with homocysteine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLFSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
publication title Structures of Mammalian Cysteine Dioxygenase Variants Missing the Cys-Tyr Crosslink
rcsb
source organism Rattus norvegicus
total genus 56
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xfaA00
1ZZ7A 2UY8A 2Z2SB 2DCTA 4IETA 4LA2A 5LRSA 1YFUA 2D5FA 5E1RA 1H1IA 5I8TA 1GQHA 5J3UA 4QM9A 1QXJA 1IPKA 3BB6A 1J3PA 2GU9A 1QWRA 1ZZ6A 2UYAA 1ZZ8A 3NL1A 5JR7B 4HBNA 2WC2A 2D40A 5FQ0A 4XF1A 2QJVA 3NJZA 2O8QA 2GC3A 2IXLA 3WW1A 2C0ZA 4FBFA 5JAXA 2B8MA 2ET1A 2F4PA 5I8SA 1CAVB 4XFBA 4CYDA 4RD7A 4BHPA 2IXJA 2HJIA 3PVBB 1CGPA 4IEOA 4F8AA 4BH9A 2MNGA 2BGCA 2UYBA 3D0SA 3H50A 3CF6E 1ZVFA 1YFYA 3FFQA 3HIFA 1RL3A 3VHRA 1XE7A 4XEZA 1CAWB 1O4TA 2VQAA 3OD0A 2PTMA 4WZCA 2XHKA 3I59B 4XETA 1OFNA 1VR3A 3LWCA 3OGJA 1LB2A 3SCFA 4Q0VA 3RYKA 2QNKA 4HSLA 3PNAA 5I0RA 3BU7A 3R6SA 5EZWA 4EWAA 4WBBA 3TNPB 3CJXA 4GULA 3QACA 4DINB 4XF0A 2K0GA 3FJSA 4IEYA 3EO6A 3ES4A 5T3NA 3H7JA 2ATFA 1CAXB 5I93A 1DGWA 1XE8A 4IEQA 1CAUA 4O9GA 3RDIA 1IPJA 3MZHA 2N7GA 4IEVA 3E6CC 4XF9A 4HVQA 1O7FA 1TQ5A 4NVPA 3MYXA 3E97A 4FAHA 2CAUA 5FQ0B 3E5UA 2E9QA 1YFXA 1DGRA 3N4MA 3DL3A 4Q0PA 1FT9A 3WW2A 4XFGA 3RNSA 4EV0A 5KBFA 1J3RA 4PJYA 4JTNA 4KWJA 1UIJA 1HW5A 3RPQA 3ES1A 4QGNA 2BEOA 2QCSB 5KHKA 1ZRCA 3H8UA 2EVXA 3USSA 5JSRA 1J59A 1ZZ9A 1PMIA 3WW4A 2P17A 2OA2A 1ZRDA 2O1QA 2V09A 5F1RA 1OMIA 4LTAA 3LAGA 4FT8A 2XLGA 3ACLA 3H1YA 1NE4A 3U0ZA 1NXMA 1XRUA 4D7SA 3DN7A 1O5LA 2PHLA 1PM7A 2Q0AA 4H7LA 4MZUA 4Q29A 4KL1A 4HLTA 1WLTA 4XFIA 4AVAA 4HZFA 4FAGA 5I0TA 5BPXA 4IEXA 1RGSA 1L3JA 5CADA 4XFAA 3C3VA 2ZCWA 4QX5A 3L2HA 3ZDSA 2HKXA 2PAKA 4XFCA 4LEJA 4O9EA 4MV2A 3CLPA 4HVRA 4EWEA 5J48A 5D1IA 5JSPA 4YRDA 3SCGA 1SEFA 1CAUB 4LUKA 4L2NA 1X82A 3EBRA 3H1WA 5FDBA 3KSCA 3IDCB 4HMZA 4I2OA 4A2UA 1O3TA 4MUVA 5I8YA 5KHJA 4IESA 4I0AA 5J7MA 1Y9QA 3I7DA 1YUDA 2CAVA 2GC2A 1UIKA 4X6QB 1NYWA 3BCWA 4AVCA 2GC1A 1RUNA 3U10A 3B02A 1UCXA 3H1MA 1U12A 1YWKA 5FCCA 2UY9A 4JV4A 2BNNA 1YLLA 4ORFA 1EYBA 3MPBA 1Q43A 1EPZA 5AVPA 2CGPA 3ST7A 1LRHA 3SXWA 1O3RA 3OF1A 1JUHA 3IDBB 2H0VA 4B29A 3MDPA 4YSFA 1RTVA 3E6BA 4UBGA 4PIXA 2BNMA 2PA7A 1NZCA 2IXIA 3FHIB 3EJKA 4JTOA 3FZ3A 5KHGA 2XLFA 1V70A 3NKTA 2IC1A 3EQEA 1X8EA 3FX3A 5JSOA 4F7ZA 5K8SA 3CEWA 4IEWA 1YFWA 5LEKA 4I02A 4HN0A 3I54A 5I0SA 2VPVA 1GQGA 4ONUA 4XFFA 2EAAA 4UXAA 4LULA 2XKOA 2IXKA 2MHFA 3BPZA 3KGZA 4QGMA 4QM8A 2OYZA 2PAMA 4I3PA 4PIYA 1CAVA 1DZTA 3IWZA 3M3IA 4XF4A 3LA2A 3E5XA 3RZZA 3ETQA 2OZ6A 5LRRA 1QXRA 3S7EA 4I09A 3RYPA 4Q0SA 5KHIA 2H6BA 3GBFA 4MGYE 4MX3A 5FLHA 1CAWA 1SFNA 5FLIA 4IERA 3UKNA 2XL7A 4BYYA 4LUMA 2OZJA 2I45A 4HN1A 3SCHA 2PYTA 4L11A 4AXOA 5BXXA 1ZX5A 1O3SA 2GH2A 4P9GA 1VJ2A 4OFGA 5BV6A 4I01A 4EROA 1I5ZA 1ZNPA 3RYRA 2XKPA 3GYDA 3SMHA 1RUOA 3ELNA 4HVOA 4Q0UA 4E2QA 1WA4A 4UBHA 4IEPA 1EP0A 5FLJA 4AQ6A 2GZWA 3G7DA 1LKNA 3D0JA 3DV8A 1NE6A 5I91A 2B5HA 1ZZBA 3ROUA 1CAXA 5CVRA 4ZU5A 2EA7A 3H3UA 1WGPA 4Z82A 4KU8A 1Y3TA 4R52A 4J1WA 1FI2A 2MPFA 2FMYA 3PLQA 2ZKLA 3CL1A 4PIZA 4MGKE 4JVAA 4ZU7A 4MGZE 3LA7A 4IEUA 2D5HA 4YYOA 3FWEA 4MGIE 4XF3A 2PHDA 4N9IA 3LOIA 1RC6A 3H7YA 4YNIA 3M70A 3WW3A 1O5UA 4Q0QA 2QDRA 4EWDA 3FE5A 2IXCA 3TNQA 1Q3EA 1J58A 2QVSB 2VECA 4QGLA 1H1MA 3NVCA 3KMHA 1DZRA 2XL9A 3E6DA 1FXZA 3CO2A 1Q5OA 3OTFA 3KGLA 3D82A 3H3ZA 3LZZA 4KWKA 5FPZA 3S0MA 4E2GA 2BNOA 4MH0E 3BALA 1VP6A 1X8MA 1ZRFA 2K9ZA 4TLFA 4K8FA 3HT2A 4AVBA 1I6XA 4HSJA 3IIAA 1ZREA 5I0UA 3S7IA 2ETEA 4IEZA 2PQQA 5LEJA 3QOPA 5FPXA 3IBMA 1J1LA 4LA3A 2PFWA 1ZRRA 3JZVA 2B9UA 2D93A 3NSTA 2Q4SA 4YARA 1J3QA 2KXLA 4R8HA 3KCCA 2XLAA 3SHRA 2Q1ZB 4X6RB 3U11A 4KU7A 2FQPA 2WFPA 1UW8A 5C6CA 4ZU4A 4D7TA 1QY4A 4QXKA 3LA3A 5EFUA 5HI0A 2IXHA 2ET7A 2Q30A 2GAUA 5JCTA 1X7NA 3UKVA 5CU1A 4I0BA 2PAEA 1O3QA 2GC0A 5BUVA 4XFHA 4LLOA 2Z69A 3E5QA 4BIFA 5E16A 1EY2A 1UD1A 2Y0OA 3H9AA 5BY5A 1LR5A 1CX4A 3HQXA 1ZZCA 3DKWA 3I59A 4AQ2A 3EHKA 4E2SA 4META 3UKTA 2CV6A 2XGXA 3NW4A 3HT1A 3OCPA 4N9HA 5KHHA 4Z07A 2H6CA 4J1XA 3O14A 1OD5A 1G6NA 4QMAA 4OLLA 1YHFA 4WVZA 1OI6A 2OPKA 1SQ4A 2BYVE 5C8WA 4KWLA 1UPIA
chains in the Genus database with same CATH superfamily
2UY8A 1JOJA 4KI5M 3LPFA 5DG2A 4RR3B 3HD8B 2AUYA 3NNLA 2ZGOA 4JZRA 2ILMA 3C7HA 4I0WB 4CDWC 3B93A 2D5FA 4P9YA 2F17A 2EICA 3VZOA 5C4WA 5FWEA 2G9GA 1VMJA 4LKEA 1JN2P 5FO8B 1W2UA 2P1BA 5GM0A 4ASKA 2J1SA 1IPKA 1CESA 1W6NA 1W8WA 1J3PA 2NM1A 4TXWA 4OHWA 4COWA 5IVBA 2VVFA 1QWRA 3ILRA 4COZA 2WO3A 4XDPA 2E53A 2Y60A 3PVEA 4CUGA 3FUQA 4H55A 1AYM3 3W21A 5B4NA 1SBDA 4DXZA 4GWIA 1QKQA 1K12A 5AC92 3NJZA 5ISLA 3WV6A 1PGL2 4CCOA 2C0ZA 2DV9A 3VKFC 5L7OB 1V6JA 3WQ7A 2F4PA 1CAVB 3HVDA 1J83A 1GNYA 2R7EB 2DVDA 3ZXFA 1GFF2 4C90A 1HXS1 4IL7A 4F8AA 1WA6X 2BGCA 2FDJA 4AK3A 2LROA 2HWC3 3J4UH 1VBC3 3FMGA 2X10A 4Q4Y3 1BMV2 4LT5A 4XJ8A 2VOVA 1CVNA 3Q8CA 1LGBA 4LOSA 1RJ7A 1XE7A 1FAYA 2H0BA 2HYXA 2XJVA 5CG9A 1VMHA 2NLRA 3MLKA 2W92A 2C26A 1F2NA 2HYKA 1MZFA 2VQAA 4WM7A 5FP3A 3O0VA 5IFPA 4OI0A 4AFBA 3I59B 4Q4X3 4FXKB 1OFNA 2QQOA 3LWCA 3OGJA 5HPOA 3NO8A 5JI7A 2F4LA 2Q8DA 3RS6A 4Q0VA 2VMFA 2C24A 5FPVA 4QX7A 1S4CA 1JMUB 2AGSA 4QT6A 2YZ4A 3BPSA 1OQDA 2VCBA 3UK9A 3IM0A 2FBEA 4QB2A 3R05A 3LFIA 1EV11 2CSGA 3POWA 4GB33 2DWRA 1UY3A 4IE5A 1AHSA 1W8UA 2ADEA 3HAGA 2OPWA 5A3OA 4BLIA 2W95A 4NAMA 2XMLA 4S2HA 5T3NA 4QAWA 3WQ1A 2J1TA 3WP4A 1MS1A 1IG0A 1F5JA 5CYYA 1N3QA 1XE8A 4CDWB 1NCRC 2LS6A 2N7GA 1PO23 3WF1A 4QQPA 1URXA 3T2OA 4P9JA 3C7EA 4L92A 5FYMA 2ZGUA 4IGPA 5G04L 4XF9A 3MIBA 1QH6A 1ULPA 4HVQA 4NVPA 2Y6JA 2RM23 1NQDA 4R9BA 1YXWA 5FY0A 5F8PA 2CAUA 4K1ZA 2OKXA 4DRRA 5FQ0B 2WSVA 2ORXA 4MADA 1RINA 3CNAA 3HOBA 4XYXA 5FYSA 1JW6A 4Q0PA 1FT9A 4MGQA 1RUE1 3ACGA 5KBFA 4QHBA 4Q2FA 2ZGPA 2QKDA 4JTNA 4L0PA 2ARAA 1UIJA 4W50A 2DVGA 2VW1A 2IFRA 1HW5A 2R062 5J09A 4Z8BA 2R071 4Z1VA 5A3UA 3N9NA 2I74A 4LE3A 4OUSA 1WCQA 3H8UA 2RG4A 2EVXA 3JD73 3M3EA 4QPWA 4ZS3A 1ZZ9A 5A80A 1LHVA 4FPJA 4KG8A 1S0FA 4NRQA 3V65A 5C8CC 1ZRDA 1TG7A 3URFA 3VBHA 3WUDA 2B4KA 2I2SA 2E51A 5F1RA 5EYYA 2YBKA 5FZGA 1DGLA 1AR63 3LAGA 5CKMA 1DDLA 1NY72 2XJQA 2XLGA 3SISA 3O0XA 3ACLA 2VQ0A 4FOVA 4OHYA 3D5OA 4ZZ5A 1C8M1 1FX5A 2ZX2A 4WVWA 4AFMA 4TZDA 3BTXA 3V64A 3A0NA 5FY4A 2A6ZA 1BBT2 1O91A 1V6OA 3V0BA 4Q29A 4KL1A 2D44A 1OFSA 3MHZA 1B35C 2XHNA 3M3QA 4PCRA 2VNRA 2WLPA 4IEXA 3TBDA 4R4XA 5F6LB 4QKFA 3C3VA 3J8F3 3L2HA 3ZFGB 2XQXA 5A3MA 1RUG2 4XFCA 1XXNA 2AH2A 1AXZA 1GICA 1X9PA 2ZGKA 3Q9OA 4KQ7A 3J26N 2AACA 1D7PM 4MV2A 5FZ8A 1QNWA 4M00A 3LEGA 3Q8BA 2VGDA 5J48A 5JSPA 4XZPA 4YRDA 1QJU2 1K45A 4JDMA 5CFDA 5JDBA 1CAUB 1G9AA 3WF4A 4GIQA 5F2SA 4CP9A 1Y9GA 1MS4A 2BGPA 2VUCA 1NCRB 2DDUA 5GLZA 4I2OA 1PMHX 5I8YA 1NXD1 3GDBA 1EUUA 2R043 4GKYA 1FPN2 4I0AA 2V4AA 4LR4A 4XBLA 5BNNC 1XNKA 1YUDA 2XJUA 5GZEA 1GLHA 3HPNA 4RQPB 2BFUL 4MYEA 4BIOA 1NYWA 3BU0A 4D0QA 5JPMB 1KD7A 1UX7A 2GC1A 4AVCA 1RUNA 5K9YA 5EXOA 3AMNA 3KV4A 1UCXA 1WUVA 5L9VA 2PLV1 1YWKA 1F31A 5FZEA 3RMYA 3GJAA 5FCCA 2UY9A 1RHI1 2RMU2 1HQNA 4QU2A 5L9RA 3ZSKA 1GANA 4G9SB 1NA1C 3DXUA 4AI0A 4AW7A 3N9QA 3M2MA 5AVPA 3BTZA 4Y4RA 1LU2A 3W5MA 1LRHA 1SDDB 4M01A 3OF1A 4MXWA 5A7PA 3SXWA 1EPWA 1UF2C 2CY6A 1PO11 2H0VA 4XOGA 3ZM8A 5A3PA 1RTVA 3VBUC 3ZSLA 5C8CB 3MO4A 1LEMA 2GP3A 1UL9A 4E27A 3C8XA 1PGW2 2ZGTA 2PA7A 4CDQC 1NZCA 2W94A 2ES3A 3ZX7A 2PHTA 3EJKA 5A7WA 4YZ2A 4JTOA 1XYPA 5FZ1A 4V2VA 1LGCA 1S2KA 1V70A 3DPRC 3VBOC 3VZNA 3ZR5A 1N47A 4URAA 3MF6A 1H0BA 1X8EA 2G9FA 5JSOA 3WG2A 4E4HA 1JZ4A 3AL5A 1VBE3 4B1MA 4F7ZA 3P6BA 1PK6C 4PF5A 2VMDA 5LEKA 4LHNA 2RR12 4I02A 1B35B 1O59A 3IN9A 3MGUA 3VV1A 5FOBB 4MG2A 3KT7A 5I0SA 5ACA1 2NN8A 1GQGA 1LESA 4ONUA 2DF7A 2EAAA 4LPLA 4QXBA 4UXAA 4XFFA 5DAWA 5F3GA 1RUC1 3NV2A 2IXKA 4LNVA 1GOGA 2DU1A 4QGMA 4BQ2A 1AR73 1NCQC 2D43A 2YUEA 4WVVA 3VD4A 4FFIA 3PUHA 5L19A 1G9FA 1IQAA 4I3PA 1U0AA 2C9AA 4Y22A 5A6ZA 4R4ZA 3OPZA 5EHDA 3HQUA 4PIYA 1CAVA 1H8TC 3CU7A 4SLIA 1LODA 1VBB2 3E5XA 5FP8A 5FMOS 1SG3A 1BK1A 1H2MA 2KD7A 4QX0A 1Z7S2 1U5YA 5HCHA 3OD4A 2P2KA 2W3JA 5FO9B 5A6YA 2RS11 5JVVA 1KRIA 4H3WA 3CKHA 4UFMA 1MEC3 3ZXKA 4BWOA 3O1TA 1RYYA 5BNNB 3OY8B 3PUIA 3UGFA 4YFZA 1WLWA 3GBFA 4MX3A 3MW3A 3VKNA 2WA4A 2WS93 3R4SA 4KMQA 2A1XA 4CUBA 1GZWB 4Q4X1 1UU5A 4BYYA 3LSEA 3ILFA 1RB8G 1UWWA 4WZFA 2OZJA 1DP0A 4HN1A 3POYA 4YW3A 2JG8C 2PYTA 1W90A 4L11A 2WN3A 4AXOA 1ZX5A 5EPAA 4AF9A 3RJ2X 4XTPA 4ZKTB 3S6PA 2GH2A 4UFKA 3LIGA 5BYNA 2JDKA 4OFGA 3WX5A 3K48A 3J7MA 1AR83 1UYZA 4C0BA 5DUVA 2WNVA 4JGYA 5DUWA 3B9CA 1XU1A 3N3HA 1RUH2 4K7JA 1KEXA 1I5ZA 4GB31 3VBUB 3ELNA 4Q0UA 4NUBA 4XUTA 1RUD1 1W2OA 3NKGA 3POSA 1ENXA 2L9LA 3GNEA 4XUNA 3OGSA 5FLJA 3ASIA 4QX8A 4XAEA 5ANNA 5FMCA 4NMIA 2KR2A 2GZWA 3DV8A 5I91A 1ZZBA 4L9BA 2BZDA 3DPRB 4IUGA 1F5FA 5FXXA 1PO21 4WVMB 3H3UA 2W52A 1YQ6A 5IVJA 1BEV1 1WGPA 3T2QA 3N7LA 4DEVA 2J1RA 3O12A 4FPLA 4QPYA 4LHLA 1PK6B 1R1ZA 1W6QB 5IAVA 4NIGA 2X29A 1KFXL 1AR91 1XOYA 2BERA 1YQ5A 2A3YA 3BYWA 3FLPA 3WF0A 3KZ4C 3PLQA 2XPJA 3JBG2 1QJEA 1S0CA 4CU7A 1BYHA 4XVHA 3A22A 5GZDA 3U14A 4UFJA 4IEUA 5LBFA 3Q8EA 1IS5A 4YYOA 3FWEA 5FIXA 2J22A 5T50A 4E4DX 4FTBA 4NHXA 1FV2A 4ISQA 3CBNA 4Y33A 4IXLA 4XACA 4E8CA 1LOAA 2A6XA 2HWF1 2Y6HA 3IAQA 4PI0A 4Q0QA 3WW3A 2QDRA 5C5TA 4J25A 1GQPA 4QWNA 5LBBA 4AAXA 1VE0A 2IXCA 1Q3EA 2WO7A 2Q1FA 3DUIA 3MW4A 3TNQA 3KHCA 4EZHA 5FYTA 3VD5A 4QGLA 4QDRA 3TN92 1W0NA 3NVCA 2WZ8A 2XL9A 1V6MA 1NX9A 2BUKA 2E6VA 1FXZA 2VZRA 3OTFA 1DHKB 2WABA 2ZZJA 5L73A 4QKDA 4YM1A 3CDZB 1U5IA 2AYHA 3OEAA 4KWKA 5FK8A 1LEDA 3FUOA 5FZOB 4O7XA 3RWKX 4CP2A 2ZHNA 1FOD1 3K77A 2E32A 1VBD3 4Q8KA 1JYXA 1N1SA 1QJY2 4YW4A 1GMMA 3SQOA 1PZ7A 1MZ6A 1ND3A 3J7NA 1OQ1A 1W3XA 2JWPA 1AL23 4FOQA 4NN0A 1QDCA 4QU1A 2DUQA 3RZJA 1QQP3 1A8DA 1JTZX 2JG8B 2RS51 3IIAA 4Q27A 3UL2A 1Z78A 3S7IA 3BODA 1W9SA 2XVLA 3NAPC 4IEZA 1TME2 4YVWA 1YQCA 3LB9A 3NNMA 1F9KA 1QF3A 3QOPA 2G1MA 2DVBA 2RJLA 5LB6A 3ZSEA 1W8OA 1LHNA 2HWB1 1HB4A 1ZRRA 2O0OA 2PFWA 2HEYF 3WZ1A 2Q4SA 4A6OA 2ORZA 1J3QA 5A33A 3OUJA 1E5HA 2K2SA 5EYXA 2VOTA 3NQHA 2R1BA 1UW8A 5C3QA 1VBA3 2OQ7A 2AC1A 5KWRA 2V72A 1RVF2 2CDPA 3I4IA 3K3NA 3PURA 4CCMA 4CP0A 4D7TA 4C91A 3ZMNA 4DXRA 2JJ6A 4CCDA 5A7QA 2LW8A 3USUB 3DYPA 3ZLIA 2ET7A 1ASJ3 4FPHA 4W6XA 3RI9A 2NPIA 4XDQA 1MR5A 2JE7A 1X7NA 4L97A 1WCDJ 2WNUC 4BQXA 2JDUA 2XR4A 3HMYA 4BXFA 3OOXA 5CU1A 4XXAA 4CRQA 1W8TA 3BVCA 2QQMA 1XSRA 2Z69A 4MXVA 4BIFA 4CSWA 1HRV3 2YGLA 3FC0A 1UD1A 4GWMA 2DUPA 1CN1A 5D2AA 1AYM2 1O8SA 2PMWB 4LIVA 4MSVA 1MACA 3ZXDA 3UKTA 4FPCA 3MEPA 1C28A 2ENRA 4AEKA 2XJRA 2G9ZA 1CIWA 1J84A 1H6XA 2A5ZA 3HT1A 3OCPA 4HK9A 4N9HA 4J1XA 4P9LA 3UJQA 3A0KA 3RZLA 1G6NA 1PGL1 4QMAA 4OLLA 1JXNA 3I8TA 1HV1A 3BI3A 4YLZA 1H2LA 1SQ4A 2B39A 2ID4A 2X5IA 3PL0A 3VHOA 4D8MA 5F9TA 3MPPG 2HWC2 4J6GA 1VBC2 2PN5A 4LKSA 1OA2A 1SBFA 2ZS6B 4LJHA 4Q4W3 5JZGC 3CMGA 4HANA 4GMP1 4PBPA 4S2FA 1X50A 2R0FA 4O61A 2DCTA 4XUQA 4DO0A 1VB2A 2V4VA 1QEXA 2XVGA 4IETA 3RJRA 1BMV1 2VBBA 1YO8A 4EYUA 4Y26A 1YFUA 2Z79A 5E1RA 3SNMA 5AVAA 1GNZA 2QBXA 3VDDC 5I8TA 1GQHA 5J3UA 1STMA 4GAZA 3ZYIB 1IKPA 2XVKA 3AP5A 1WMFA 3PDQA 3VHNA 1UNBA 4B4QA 3ENRA 4FQZA 4GWJA 2CWMA 4XABA 1ZZ6A 4JGZA 5IK5A 5H9RA 4DXSA 5BNPA 2A6WA 3NL1A 1BKZA 2ZJCA 5FPLA 4XW3A 3AP4A 2D40A 5IUQA 3HBKA 1QXPA 3ZR6A 4RL7A 3GZUC 2ZX4A 1JZ3A 5FYUA 4FBFA 5IK4A 2B8MA 2ET1A 5I8SA 4MLOA 4XFBA 4RD7A 3SITA 4AHXA 4BHPA 4BM8A 4INDA 3EB7A 4UFLA 4YZ4A 3RFRA 3VBFC 1CGPA 3CIHA 1IS6A 1SLCA 4CDUA 2UYBA 3AMHA 2GNDA 3D0SA 4JHZA 3H50A 4PHZA 5KXBA 4FPYA 4CCKA 1XC6A 2IFWA 3FLRA 3HIFA 2IVJA 3ZYRA 3ZOIA 2R49A 1RL3A 4XBNA 5C7GA 2DCZA 4OI2A 5T54A 1W9YA 2VZSA 4CDXA 2WNUB 3OY8A 4AL9A 5JXHA 2GSYA 2Y6GA 1XB9A 1CAWB 3B00A 4QXCA 4A3XA 2Y6KA 1WBFA 2YC0A 2P4EA 1O4TA 1UZWA 2MEV3 2NMOA 2RS33 4Y4YA 3M7AA 3JCIA 4G3YC 2XHKA 1W3VA 1VR3A 4EZ4A 4Y5SA 3HJRA 4N43C 4QQ2A 4Y1XA 1DQ6A 1W03A 2B45X 2DCYA 4HSLA 2D98A 3RYKA 2Q5TA 4K3UA 3J9SA 2JE8A 5B4XA 4BPZA 1NA1A 1BLZA 3PNAA 1OD3A 2Z4FA 4AZZA 5EZWA 1RITA 2UURA 1L7LA 4P9WA 5FV3A 4ZS2A 3VBUA 2R061 3WNMA 5IK8A 2FDKA 3AZZA 1NKGA 4BJ0A 3JD72 3TNPB 5JXIA 3AP9A 5IFTA 3OGRA 3QACA 4GULA 2QQJA 4CDQA 1XJAA 2XJPA 4NO4A 4NOTA 2GP5A 5FK7A 4MGSA 3F95A 1AR62 2LRPA 4ATFA 5I93A 4NHLA 3WF2A 1UKGA 3TN93 4UF0A 3DPRA 1RIRA 4YM2A 3VBOA 1F4HA 4O9GA 4FPGA 1IPJA 4UWDA 3RDIA 1MVQA 3W20A 3WQBA 4IEVA 1NY71 3VDDB 5F3EA 4BXSV 1AUYA 4Y24A 4BCUA 3E6CC 2ARCA 4ES8A 3I2JA 1PK6A 2IUWA 5FPBA 1SHWB 2W0XA 1DYPA 2E33A 3WDTA 4DMIA 1O7FA 5DUXA 3MYXA 1UZYA 2Y26A 4IDZA 3SEEA 1BBT1 3K4ZA 1AF9A 1QJY3 5FMDA 1WCUA 5FTTC 2WDBA 4A41A 1A78A 1KDMA 1DF0A 1YFXA 2XJTA 3DKQA 4JX0A 3NWKA 3N4MA 3C2UA 1LU1A 2XOMA 5T5OA 4EV0A 5KXDA 3VHPA 2CU5A 1A34A 3ZPOA 1NCQA 1OHFA 3M8LA 3D3AA 5DZEA 3J8F2 3I3EA 4KWJA 1YCIA 5FUPA 5FYIA 2CNAA 3UYJA 3N7MA 2ZPXA 4DY3A 3THDA 3RPQA 2QQPA 1H8TA 1GZTA 1CPMA 1PVC3 2QCSB 3LDKA 4ZXKA 3U4SA 2E7QA 4ES9A 2W1WA 1RUG1 1ZRCA 5JSRA 4YGEA 1JZ5A 2J1VA 4QKNA 3I2OA 1ULCA 3MIFA 2O1QA 2V09A 1OC1A 3C7FA 1W9WA 1QJU1 2QUOA 4LTAA 4LMFA 4RA0A 3M3OA 5FAXA 4KBBA 3H8RA 5LA1A 4P14A 3ZVXA 1NE4A 3U1XA 4LE4A 1Z0HA 2R042 3U0ZA 3AZXA 1IQDC 1NXMA 1XRUA 4WM8C 1PM7A 1FPN1 3ZKYA 5FZ0A 1S0JA 1U5ZA 4AI8A 1JBCA 2VOWA 1S0DA 1WLTA 4N43B 5DABA 4P00B 4AVAA 4CEWC 4HZFA 3GZAA 5DAXA 3ZXLA 4FAGA 3H8XA 3W9AA 4COUA 5A1FA 3AM2A 4XFAA 2JEMA 3PTYA 3MUZ1 4YWAA 4URTA 5F37A 3A4UA 1K5MA 2VM9A 3IT8A 5BNQA 5CG8A 2D6KA 2PAKA 2W46A 4YGBA 1FATA 4A7YA 2DTWA 1Q8VA 2RMU1 3WSOA 1REFA 4LEJA 1SLTA 5F5CA 1COV3 1W6MB 4MHUA 1ALYA 2XJSA 5FYZA 1WD3A 5JMOA 3T2PA 2BQPA 3IIIA 3K4AA 1GWLA 3KM5A 1SLBA 4COYA 3SCGA 1SEFA 4K8RB 3IKWA 3GCXA 4COVA 5IVCA 5FBJA 3K75B 3MV01 1PGW1 3VBSC 5FDBA 3KSCA 4CUCA 4XTMA 5M0TA 4HMZA 5J98B 4A2UA 4CE8A 3PVOA 3USUA 1CZSA 1Y9QA 3I7DA 1DGWX 1VBE2 1ZBE3 3AKPA 1F15A 4DRVA 1JZ2A 1L7QA 1ND2C 1UIKA 1LOCA 1F35A 4XBQA 1MQTA 3BCWA 2BPA2 3RZGA 1MS0A 5LA2A 3U10A 1Q8QA 1ENRA 2DURA 1WW7A 2FZ1A 2RR11 3H1MA 2BWAA 4PLOA 1U12A 2DFCA 3G6JB 4OMCA 4LKFA 2WKKA 4QPIC 5FFOC 4Z92B 1DLCA 3IPVA 2ZOEB 4JV4A 5A6QA 1UZ0A 4E8DA 1AR72 5T55A 3KD4A 3B01A 1Q43A 1AYN3 1OQEA 2A75A 1YC61 2NYYA 4OCTA 2RHPA 1CQ9A 2AEYA 3SLIA 2HWE3 4M3CF 2TNFA 1JI6A 2ZEXA 3ZFGC 4JAAA 4OULA 1ST8A 4HT1T 4UBGA 4BLJA 1GWKA 1VBB1 1FMD3 2RJKA 3V56A 4GJZA 5C9AA 5CFCB 3FHIB 3VL8A 1OKOA 3KQ4B 2WZEA 1Z7S1 1C1FA 1MEC2 3I2HA 5IHRA 3I49A 5KHGA 3TB0A 2JDAA 2HWD3 4Y1YA 2PHXA 3OBTA 3T1LA 2WN2A 3WDVA 1I1EA 1ZBA3 4WM8B 3FLTA 3FX3A 2FDGA 2A6VA 1UZVA 1KS4A 4LORA 2YB7A 1R64A 1H9PA 1TNRA 2WS92 5K8SA 2BW8A 3CEWA 3KV9A 1LULA 3QD6A 4CEWB 1GP6A 1DYKA 2R1DA 5H9SA 3QLQA 4HN0A 3NAPA 1TVGA 2A73B 3M4FA 1R083 2SLIA 4HOOA 3POFA 1A8MA 3I2IA 4LULA 1WMXA 2XKOA 1OVSA 4RQPC 3N9LA 4NHKA 4L8QA 2VC9A 3MIGA 3KGZA 2GN3A 1UY4A 1UX6A 1WW6A 2QTWB 1AR82 2AR6A 2WLQA 2X8KA 3SC7X 3WHTA 1XQNA 5HBAA 1F4AA 1D0GA 3HEIA 5DAPA 3THCA 1DZTA 3D4KA 4Q4V3 4AR2A 5GJ6A 1RUH1 4YW5A 3DCQA 5GKAC 2JIGA 3ETQA 3SKJE 1N1VA 3VBRA 3VZJA 5B2GB 3VBSB 3T09A 3WDUA 5LA0A 4BOWA 1LJ7A 3RYPA 1ENQA 5BNOC 3T30A 1BZWA 1GOHA 4LK6A 2OUHA 5IW0A 4S2DA 1CAWA 5FLHA 4AEJA 3IAPA 4DUWA 4QX3A 1ND2B 4LOTA 2WWSA 3O7OA 3ZN6B 5C70A 2RDNA 3EMRA 5FLIA 3T4VA 1NLQA 3UKNA 3O1UA 4DXTA 2OUJA 2Y64A 3MLLA 4FTEA 3LD8A 3DYOA 4LUMA 1RUI3 1BVP1 4QPIB 2I45A 3SCHA 2ZX0A 3VDCA 3JBG1 1W39A 4IE6A 3KF5A 1HQWA 2NZ9A 5FKBA 3A21A 1UY2A 1NG0A 3GXUA 3ZYJB 4ARYA 1KS5A 4JCKA 4MHRA 4P9GA 4OQ8A 1O3SA 4RS5B 2EXKA 4A6SA 1RUF2 1VRH3 3KQRA 3KVBA 4K20A 5DQ0A 3VN4A 4I01A 4R9AA 2ZGLA 1Q8OA 1M4WA 2VVDA 1ZNPA 5JIAA 2XKPA 3SMHA 1UKRA 2Q1MA 3THTA 1JZ8A 2VO5A 3P3NA 4IEPA 3VZMA 1Y43B 1EP0A 2ARXA 3ZYFA 1WLDA 2YBPA 1APNA 3EYPA 1SLAA 2JG9C 5CA6A 5JZGA 4C8DA 3TN91 3B9IA 2B46X 3ACHA 3WINE 3AJYA 3AMPA 5CVRA 2K46A 1WLCA 2VXJA 4ZU5A 3AYAA 3GHNA 4YVSA 4OI1A 3VB9A 2FDFA 3RZMA 4QPGA 2W08A 1VBD2 4F3JA 4YFWA 1GOFA 4DQAA 3HNMA 2DYCA 1PMJX 4AHYA 1QJY1 2FMYA 4CZSA 2XUEA 1AL22 4IE7A 1JZ6A 1UY1A 1WW5A 1RMU3 1QQP2 1VAVA 3CL1A 4MGKE 4PIZA 5H9QA 4MGZE 2J7MA 5L36A 1OUXA 4JQTA 4ET7A 4Y20B 5E6HA 1JU3A 4Z2AA 2ZX1A 4BISA 2PHDA 1TME1 3HN3A 3H7YA 4YNIA 2ZX3A 3FL7A 5F39A 1V00A 1YIFA 4IV1C 4FP3A 1C4RA 5FREA 4FI9A 4JRAA 1OPMA 1G7YA 2W1SA 1QJZA 3VBFA 1SLLA 1QU0A 2VUAA 2XDVA 2VECA 3I2KA 2E31A 1VBA2 1JH5A 1DZRA 2Y6FA 1I3HA 4ZPIA 1WMDA 3JUUA 3THPA 5FZMA 4EN9B 5BNOB 1Q5OA 3NJVA 4UOJA 1OPOA 1RVF1 3RZKA 4YPJA 1W9TA 1G86A 3OYWB 1J1TA 3TEWA 2BNOA 2KA3A 3VLBB 1ASJ2 1C5HA 4MH0E 4M4RA 3BALA 4PI2A 1VP6A 4IV3C 4MOAA 2R32A 1XNBA 4RR3A 4CXYA 2K9ZA 3KV6A 5JOYA 4K8FA 2GNTA 4NWWA 4AVBA 1T6BX 2CYFA 1MS3A 4MO3M 4HSJA 1HRV2 4TYSA 5D21A 1ZREA 5IVEA 1YI9A 3K4DA 3WNKA 3WG1A 3DF0A 1DQ1A 2VMIA 2PQQA 1GBGA 3KT4A 1CPNA 1YNAA 3H0OA 2JD4A 4PDWB 4RGGA 4XC9A 1MS8A 3RRDA 4M0NA 4QHZA 4OYUA 4ASMB 1AYM1 2WWJA 4DIQA 2B9UA 3NSTA 3ACFA 5AC91 5KXEA 1IZ3A 2KXLA 2JECA 4UW6A 4QXHA 5FP7A 3ZXAC 1W6MA 3U11A 2XWBB 1DQ0A 4B7EA 3O1VA 1YEWA 4ZONA 2ZA9A 2FQPA 4YW1A 1MPXA 4OHZA 3CJIC 3ZIXA 2JG9B 5L7OA 1D4M3 2WFF2 4CXXA 3DYMA 4QD2A 4AEDB 2YC2A 3NV4A 4JKMA 1EAH3 3NMBA 4FXGB 1AXKA 4QXKA 5A32B 3EXUA 4B4RA 2VQUA 1BQPA 4D94A 1W2AX 1LHUA 4Q4W2 4A42A 1PIV3 3BOWA 5HI0A 2HWC1 2R6QA 1VBC1 2IXHA 4Q4Y1 1LGNA 4R9CA 5FZFA 2XG3A 1OOPB 2Q8EA 5JCTA 5FZDA 4NIAA 5FZIA 4NJ4A 2J1UA 3LCPA 5T5PA 5A1LA 5CKQA 1MZEA 1HRI3 4FPOB 2QQVA 4AI1A 1C5IA 4YZ1A 4I0BA 2PAEA 4XXPA 1Q8PA 2EIGA 2NMNA 4LLOA 2VD7A 2WR9A 2DU0A 4FOWA 2OS2A 3O1MA 1QMJA 1EY2A 2TBVA 1PM4A 1LR5A 1UN1A 4K1YA 5FMBA 1CX4A 3I59A 5J96B 2VZ1A 5GLUA 4META 1CZVA 2QQLA 2HH9A 4GH4B 4IV1B 2XGXA 3NW4A 3T1MA 4NE9A 4FOYA 4HKWA 5KHHA 4EQVA 1G9DA 2H6CA 2YY1A 4AFDA 3WNNA 5ERLA 1H4GA 4WVZA 5FY8A 5DZFA 2OPKA 4IGQA 4CU8A 2VXRA 4XE9A 2EF6A 4X8PA 1NLSA 3Q8FA 4HG6B 1VLNA 4P5HA 2LM3A 4KWLA 5FYHA 3UETA 4L99A 2Y6LA 1ZYBA 3PUQA 4CCLA 4LA2A 5IK7A 3S30A 5LRSA 1GWMA 4IV3B 5APAA 2A3XA 1Q8SA 4WM8A 4UFIA 1W2TA 1W04A 1H1IA 4GALA 2QQKA 2QZ3A 1W8ZA 1D2SA 3B3QE 4OZXA 2WNEA 4CDWA 5IVFA 2JDHA 2MEV2 4QM9A 5FZLA 5IWFA 3KV5A 2RS32 3ZPYA 2XBO2 1U5XA 2GU9A 2Y34A 2VTFA 2YU1A 2RM21 2UYAA 3O0WA 1ZZ8A 1Y9MA 1HX6A 4BE3A 1AXYA 4HBNA 2HLEA 5T52A 1R093 2WC2A 3LPGA 1SACA 1W8NA 2QQWA 3AKRA 2D6LX 3NRUA 4XJ9A 5FQ0A 2WSUA 5EJ1B 2GC3A 3GBGA 3WW1A 3LIHA 5F3IA 5JAXA 1JZ7A 3OUHA 2WA3A 1RUF3 3CJIB 1C3HA 3IDEA 5CBLA 1ZM1A 1DQ5A 5LBCA 2IXJA 1KGYA 2HJIA 2VZTA 3PVBB 5K0UB 2QQNA 5C33A 4IEOA 2WINB 4HETA 4BH9A 2MNGA 3JD71 2DVAA 1R1A3 1YQ8A 1ZVFA 3U07A 3FFQA 5F6KA 5FZKA 3VHRA 5A3LA 2D6OX 1AR61 1QOSA 1XNTA 3PJYA 4XEZA 2VTXA 2ZAAA 3AZVA 5FYBA 4CEYC 2P5BA 3WLUA 4EN8B 1JU4A 4I30A 2TEPA 4AFAA 1ND2A 2JX9A 4IE0A 3ABZA 3ZN6A 4BQYA 4Q8LA 4XUOA 2Y8KA 1W2NA 5T5LA 4XETA 4OI4A 3WT3A 4DPNA 1LB2A 2P6HA 4UW4A 2Z5WA 2YPJA 4Z2WA 4XURA 1OVPA 2R30A 5HCFA 1V6IA 2QNKA 3BN6A 4BK4A 3D6EA 2VZVA 1PZ8A 3AB0A 2ZEZA 3POIA 4GZ9A 5FPUA 5JOXA 4LHSA 4C1WA 4M3CE 4HKOA 3R6SA 3VKLA 1QJX3 4FFGA 1RXFA 3J8F1 4E9KA 3H8OA 5JI9A 1D4VB 1PVC2 4WBBA 1GP5A 1AX2A 1XBFA 3LFMA 3ZFGA 1WWYA 2GMEA 3WNOA 4XMIA 3ON7A 3IZOA 5FZ6A 1AL0G 3I2FA 3SEPA 4V2WA 1WBLA 3FJSA 4IEYA 3U75A 1XYOA 1QNYA 3EO6A 2EXJA 1E57A 1DG6A 1LHWA 3PU8A 5FP4A 5G05L 1K42A 4LO5B 4E4ZA 1EUTA 1JOPA 1CAUA 3OSDA 1XE0A 1FNZA 2GN7A 4LBQB 5DAVA 3X29B 3WQ0A 1HIXA 1S0EA 4ZHNA 1NCRA 5FZ3A 5LY2A 3T08A 4DUXA 2R041 3ZMOA 4Y5TA 1TQ5A 3AYDA 1OA4A 2CGNA 2P3IA 2DFBA 2P3KA 3E5UA 1UXXX 3VD7A 2JENA 1O4YA 1W05A 4RQPA 1DGRA 3WHUA 3DL3A 2BBAA 1JYNA 1LHOA 1HKDA 1O8PA 1J3RA 1S2BA 2VNGA 4PJYA 4BU2A 4YM0A 1OURA 2WRAA 1G8WA 2VMHA 5FR3A 1WKYA 1P8JA 2W91A 3ZYGA 5HCBA 3ILNA 5C5UA 1HXS3 2BEOA 4QB1A 5DMYA 5KHKA 1COV2 2WZPP 1W06A 1HLCA 3VZKA 2GMPA 3T0AA 3KF3A 1J59A 2D97A 5EV7A 3WW4A 2BGOA 2P17A 3IMMA 4Q1RA 1X33A 2EALA 5C3SA 1OMIA 2YFZA 5BNOA 4KG0A 2ZHLA 5EJZB 5C8CA 5KR7A 4FT8A 3V0AB 2WFF3 1N1TA 4N90A 4CEYB 4WM7B 1DLLA 3AKTA 3H1YA 5J1XA 2JDPA 2FDIA 4SBVA 3H3LA 4LLFA 1PHMA 2UWBA 3AC0A 4ZY9A 3BIWE 3DN7A 1O5LA 4A4AA 5FPXA 1ZBE2 2Q0AA 5A7OA 4FPEA 4H7LA 4K40A 3HQRA 4MZUA 3AZYA 4OVEA 2CWSA 4HLTA 1VBE1 1HDKA 4XFIA 3QH6A 1CONA 1UO9A 5I0TA 5GZGA 4EN6B 1UYXA 4QDQA 4XHXA 2XQRA 1LOFC 1RGSA 1L3JA 4KGQA 2YV8A 4Y1ZA 2YDEA 4IW3A 1B35A 2QDNA 3ALQA 1C57A 5CADA 1JHJA 2ZCWA 4FFHA 3ATGA 4QX5A 1EV13 2HKXA 3ZDSA 2SBAA 2CL2A 1AYN2 1AR71 3E1F1 3LEKA 1UYYA 5IJRA 2FDHA 3CLPA 5HV0A 2HWE2 4UYBA 1NT0A 1V9U2 2ZGQA 4BZ4A 5D1IA 3I2DA 5LWBA 5F5IA 3LQCA 1OKQA 4LUKA 4XIOA 1FMD2 3HN1A 1GP4A 1REEA 4L2NA 1X82A 5E8AA 2JICA 5A32A 3O1RA 3BTYA 1OLME 2JD9A 4XPVA 1O3TA 4MUVA 5FPAA 1H8VA 2HWD2 4RGKA 4IESA 1O6UA 1KJRA 1ZBA2 3UESA 1MEC1 3JQXA 1UXZA 2YHJA 2VZOA 4QB6A 1HN0A 1VAMA 2JDNA 5DG1A 3GBWA 2CAVA 2RE9A 3OUIA 5FYCA 5BNNA 4FFFA 1AX0A 1PVXA 3HBZA 3WDXA 3PU3A 3ORJA 4X6QB 2XONA 4EN7B 5JUVA 2OVUA 2WS91 2RDQA 4LK7A 1SFPA 1R082 2JE9A 2NP0A 2XBO3 2AZ5A 4ITCA 1GZWA 1H2KA 1DU3D 1YIPA 3TYJA 1YLLA 2VMEA 4JHTA 5GLTA 1VMFA 4IV1A 1YI7A 1H6YA 1UMZA 1EPZA 4PF1A 2V5YA 2CGPA 4IE4A 3ST7A 2ZMKA 3VBHB 1AR81 1BK0A 1JUHA 5CIRA 4Q4V2 4W6YA 4B29A 4YSFA 3T0DA 2VQTA 4PT6A 3E6BA 1S55A 1QHDA 2PELA 2X09A 2BNMA 2R0HA 3I3QA 2D7FA 2WJSA 2QFEA 4N7UA 3K2OA 4HL0A 2HEWF 2QE3A 4LKDA 2XB6C 3TEXA 4IV3A 3WF3A 3KS7A 3ZYBA 3MICA 3O1SA 3MIHA 3I97A 1SDWA 1DGRN 2VUDA 3GHMA 4WVMA 5FY1A 4IEWA 1YFWA 5IT6A 2BDRA 3POJA 3ZN4A 2O8OA 3PIJA 5CKNA 4NIDA 1W6QA 3I54A 4B7KA 3LDRA 1RUI2 3AVSA 4BMEA 1NZIA 4YG0A 1OF4A 2JXAA 4YW6A 4AG4A 1ULDA 2GNMA 3KCXA 1PGSA 1HN1A 3AXDA 2VW0A 1H2NA 2A71A 4DY5A 1VB4A 4YW2A 3LDBA 4QM8A 1VRH2 3TWIA 2BTVC 4AGVA 2PAMA 3WVJA 2UWCA 4EE2A 1XNDA 3TOJA 1RUF1 4LXLA 4FVVA 4CP9B 2VH9A 3B7MA 1QH7A 3M3IA 4XF4A 4DNYA 4QQHA 3RZZA 5DZGA 4XQWA 4XCBA 1QXRA 2GH8A 4AI3A 2CGOA 5HXMA 3S7EA 4BK5A 4I09A 1CR7A 5DDJ2 1PX3A 4QHOA 4Q0SA 3AZWA 5D8AC 4Q1PA 3I2GA 4D6RA 2H6BA 5DN2A 1V6LA 2P6CA 4BQWA 5CFCC 2VR4A 1SFNA 2VBDA 2WZR2 1SPPB 5FZOA 4FPFA 3L9JT 3W58A 1VBD1 1GV9A 1S0IA 1YJLA 3JXSA 4IERA 4CTEA 1US3A 3MV11 3ZIWA 3K3OA 3ZYHA 1RMU2 1SZBA 2ZGNA 5LY1A 1I9RA 1RHI3 1DQ2A 2ARBA 1AL21 4AVTA 4YGCA 2RDSA 1QQP1 3ZFEC 3OGVA 5BXXA 4A45A 2WNVC 4MXWB 1POV3 2JG8A 3MF9A 3O5SA 1GYKA 1S2EA 3KB5A 4QX1A 4BQ4A 2ZGSA 1ODNA 2JDZA 5BV6A 1PO13 3INAA 1SLIA 4AVVA 4HK8A 4ISRA 3GYDA 2BBVA 1V6NA 2YBSA 1DFQA 1WA4A 3I3BA 5A7WB 4E2QA 1N3PA 3QBQA 4LBQD 1UOGA 3OEBA 1UZZA 1W6OB 5FZ9A 4AQ6A 2VW2A 5FXVA 1E5RA 1LKNA 2BRTA 3UJOA 3VD9A 3OBRA 3OB8A 1VBA1 2W39A 2KM2A 2VULA 4XCAA 2EA7A 4XQDA 4LBQA 2V5DA 5FY9A 2Y0IA 2VZUA 2W5FA 1UPSA 3U37A 4Z82A 1Y3TA 4LO8A 5JIUA 4AAPA 1W28A 1ASJ1 4RYDA 1LOGA 2WAAA 4J1WA 3R0RA 2BOJA 1FI2A 4H7MA 5ACA3 5FJKA 3OGGA 1LECA 5FKCA 3HWJA 1Y7BA 2HBTA 4TTGA 4A7ZA 1POQA 1CX1A 1RUC3 2ZKLA 3OG2A 2WQ4A 4JVAA 3AP6A 4ATEA 4JKKA 4ZU7A 1OF3A 5F5AA 3U78A 4LBJA 1HRV1 3DGTA 4Y22B 4LITA 5K7PA 1I5PA 2Q8OA 5LBEA 5EP9A 4DB5A 5LASA 3JB8A 2VU9A 3GZTB 4ASLA 1O5UA 2RVAA 4Y5Z0 4BMBA 4XMAA 3WG3A 5SV5A 4NIHA 4JRLA 2QVSB 1N1YA 1DCSA 4RS5C 2PHFA 2D6MA 2RS13 1H1MA 1D4M2 1MS5A 3KMHA 4TSVA 4B8EA 1UAIA 1V9U3 1EAH2 4N7IA 5D8AB 2WFF1 5CNAA 2XUMA 2VCCA 2WWUA 3MI8A 3V0AA 1JHNA 3LZZA 4AGRA 4CEYA 5FPZA 1PIV2 3S0MA 3MIDA 4Y1UA 2JB4A 1H1AA 4JKLA 4Q4W1 1ND3C 1TMF2 3PIGA 1ZRIA 2VZQA 3MLJA 3PUAA 1HRI2 3AMMA 3VGIA 1IPSA 3NNFA 1JYTA 3OPWA 2VTXJ 5CEHA 4TLFA 4NHMA 2P3YA 5JPNB 2B9VA 1REDA 2BJSA 1I6XA 4K9SA 4YVWC 5I0UA 2ETEA 3ZFEB 2XXZA 2DUOA 2WNVB 4E4SA 4JGYB 3RQ0A 3W59A 2A7AA 2O14A 3OPTA 3QCWA 3IBMA 1J1LA 1DIWA 4QKBA 1FYUA 1UMIA 4QQLA 2D6PA 4FO9A 4YARA 1RUD3 3POGA 1BJQA 3GGLA 4N8MA 3KCCA 3SHRA 1VIWB 2Q1ZB 1GKBA 3RSJA 2D3RA 2WFPA 1TE1B 5C6CA 4ZU4A 4K21A 4QQOA 4CP1A 3AP7A 2WNOA 1AX1A 4B1LA 5LATA 4R9DA 2EIDA 3SH5A 5C3OA 1BEV3 1KJLA 5EFUA 1FNYA 3N9MA 3LKJA 4KBZA 2D3PA 2Q30A 4LBNA 4BQ3A 2GAUA 4CVUA 1AR93 2AENA 3RGBA 5IATA 2W2IA 1KFUL 3UGHA 3PTRB 4CUAA 1O3QA 2GC0A 1NAEA 2WNUA 4XFHA 5AFBA 1T2XA 2QZ2A 5A3NA 1CJDA 5E16A 2MEV1 2RS31 2Y0OA 2XBO1 3H9AA 5ANQA 5FZ7A 3MBWA 1PNGA 1UOJA 2Y33A 3FHQA 1TNFA 3OBZA 1LAJA 1AZDA 1R092 1ZZCA 2HWF3 3DKWA 3CZJA 3LEIA 5C3RA 4E2SA 1ULGA 2VZPA 3VUOA 5FO7B 3NJYA 5DUUA 2ERFA 4AYUA 4Z07A 4B4PA 2XWJB 3ZFFC 5FYVA 2X5IC 1CZTA 4PDWC 4Q26A 4XHBA 1YHFA 2FZ2A 2DCJA 3T0BA 3GALA 3Q8AA 3AK0A 4QX2A 1R1A2 3H42B 1JUIA 1SCRA 1UPIA 3DECA 5ABJC 1FOD3 1ZZ7A 2VAUA 2Z2SB 3WD5A 3RI8A 1H30A 1GZ9A 1ND3B 1KDKA 1A6CA 3PHMA 3PJQA 3NJXA 3POEA 4D7YA 4FSJA 4AEDC 5A3WA 4RGAA 5DDJ3 2WIIB 1ONAA 2J42A 4RFT0 3I3DA 5LK5A 3T2TA 5EJ3A 4AFCA 4F83A 3I3MA 2RS53 3AL6A 2VNVA 3NV1A 4YVWB 1LOBA 1QXJA 4JGZC 3BB6A 3VDDA 1BXHA 2RV9A 2VUJA 4A3ZA 3SH3A 1OOPC 3APBA 4A7KA 5BNPC 2ADDA 4LO6B 2WZR3 3ETPA 1C8NA 1LOFA 1UOBA 4YG3A 4RHV2 5JR7B 1OA3A 4P9XA 2HWB3 2LUWA 5A33B 3TAYA 3R4UA 2WYSA 4NRMA 4XF1A 3TEZA 2QJVA 2JB8A 5FZCA 2O8QA 2IXLA 2W9XA 3LF7A 2WAOA 4DEQA 1M06G 1QJX2 1D0HA 3WXPA 2VBPA 3ZSMA 4CYDA 3AVRA 2Y38A 1JOBA 1JYIA 4UFHA 2ZHMA 4CDUC 1XU2A 2C9KA 4GH4C 1PVC1 3AXEA 4G4FA 3GCWA 2Q8CA 1RUJ2 1TEIA 5FZAA 3CF6E 1YFYA 4CDXC 4NHYA 2YFUA 3WNLA 4RFRB 1JYWA 4PLNA 5H9PA 3S5AA 4LBLA 1W6PB 4OUMA 4YGDA 4YG6A 4RN5A 2QQUA 5F5QA 3SH4A 1W0OA 2V73A 1UYPA 4XILA 4BQ5A 4TLGA 3OD0A 3L2YA 2VY0A 4Y3OA 2ZEYA 2PTMA 2VMGA 1SPPA 3N7JA 4WZCA 4CCCA 2IVIB 4AI2A 2FHRA 5FJHA 1OH4A 5E89A 3SCFA 1CD3G 5FP9A 5HCAA 3GF6A 2VOXA 2W68A 1POV1 4N43A 1LENA 1QJFA 1IG3A 5AC93 2IWGB 3D8CA 4HFSA 5I0RA 3BU7A 3JQWA 1ZA7A 5K4LA 2WBKA 4W6WA 3ZFFB 1XPWA 2X5IB 1KITA 3W5NA 3AFKA 1HXS2 4EWAA 1QDOA 3AFGA 3M3CA 4UAPA 3CJXA 4M3CB 3FBYA 1POV0 1S0GA 4DINB 1COV1 2K0GA 1S0BA 4XF0A 5JR2A 3LE0A 4GMP3 5F2WA 5ABJB 5J37A 2FCUA 1W6OA 3ES4A 3VZLA 2J1EA 3H7JA 4RSUA 2ATFA 5LZ6A 1CAXB 4YZ3A 1DGWA 4IEQA 5K0UC 4GXLA 5DXDA 3MZHA 4M4PA 5JOWA 3AYEA 1ENSA 2OQ6A 4JGZB 3ECQA 3N7KA 4KH9A 5BNPB 1TMF3 3E97A 4FAHA 5EWSA 1PNFA 5GALA 1JYVA 2HEVF 3ZXJA 1ZBE1 2YROA 3MFAA 1HJFA 1NLRA 1NOVA 2E9QA 2PXJA 2GNBA 1X36A 2BV4A 3WW2A 3N35A 2JIJA 4XFGA 3RNSA 1NQJA 3WNPA 5C3PA 4AQTA 4WV8A 4U2AA 2VCAA 2EXHA 2LALA 4LHKA 1EV12 2P34A 3FBMA 1H4HA 4NROA 4NWVA 3ES1A 4PLMA 4QGNA 4CDUB 3T4HB 2CHHA 4OQ9A 1AYN1 3USSA 1H9WA 1UMHA 1PMIA 2OA2A 1GSLA 2HWE1 2J1AA 4NPLA 4AHZA 4ZZ8A 1D2QA 1V9U1 4N53C 4P5YA 5LA9A 3ZSJA 4CDXB 5JXGA 1CWPA 5KXCA 2LTNA 5D8AA 4LO4B 4ARXA 4JDNA 1QGLA 1FMD1 1NUKA 2DCKA 4NPRA 4XUPA 4NR1A 3B94A 2WL1A 1HJGA 4DFSA 5CFCA 4HPKB 1OLRA 2UU8A 5JLVA 1SBEA 2HWD1 3UT0A 4XQ4A 4D7SA 5GLWA 2PHLA 4Y1VA 1ZBA1 3P3PA 5C4WC 5AFEA 1OUSA 5A70A 5JOZA 2JDMA 2OT7A 3BOPA 1UU4A 5EQUA 1BVVA 3SKVA 1NA1B 1RUE2 3WCRA 2IZWA 2VJXA 4LIUA 5BPXA 3ZFEA 2PHUA 3MUY1 2G19A 2VZ3A 1IHMA 1K5MC 2WO1A 4CEWA 1BCXA 2YGMA 1R081 4HKLA 4K6BA 2R072 1OBNA 2WUHA 5SV8A 3BTAA 1C1LA 2R063 2P3JA 4NAOA 2ZMLA 4CDQB 3S57A 2JKBA 4O9EA 1HB1A 4OHVA 1AJKA 4UT5A 3HNBM 4HVRA 4XZUG 4EWEA 1RJ8A 1WCSA 3C7OA 1JS9A 2E26A 3POBA 3P5BA 3WCSA 1XNAA 1PZ9A 1UU6A 1XSQA 3MW2A 4UF0B 5GZFA 2VE1A 3VBOB 3HR9A 4Q4V1 3EBRA 2OW4A 1WCKA 2NQYA 3CZUA 3H1WA 3WP3A 2A70A 4AQSA 4HXCA 2C4XA 1C8M2 2BWCA 2ZAHA 3IDCB 1OT5A 2RJ2A 4UW5A 4CCNA 1DBNA 3VBSA 4NPMA 1W0PA 4CPBD 5KHJA 2GALA 5J7MA 2C5DA 2ZXQA 1WD4A 5GZCA 5DAQA 3K46A 4LQRA 1BBT3 1T6GC 1XYNA 4LO7A 1MQTC 2WT1A 4XJAA 3DEMA 4D6QA 4MGTA 4W65A 1LOEA 2GC2A 3N36A 4WM7C 3O1OA 1YJKA 4CU6A 5A6XA 1NCQB 2BVBA 2OXBA 2VNOA 2ZTNA 2B42B 4QDSA 4CPBA 5CISA 4GKXA 1GR3A 3B02A 3FHAA 2X53S 5JXJA 1H8TB 1RUI1 4DS0A 5HV4A 4BB3A 2BNNA 3ACIA 4ORFA 3CQOA 4D6SA 2Z42A 3VDBA 4QPIA 4RHV3 3TEYA 5FZ4A 2AEZA 1EYBA 3MPBA 1DQ4A 3ZKUA 1RUG3 4H2AA 5I0DA 4FQ4A 2W1UA 5LK7B 1WW4A 1VRH1 3QH7A 4D3WA 1O3RA 2XH6A 2YXSA 2ZEWA 3IDBB 4PBOA 4RS5A 2W47A 3MDPA 4AEMA 1W99A 5C9AC 3WNXA 1PX4A 1QJU3 1VAKA 2OIIA 4N53B 5FWJA 2FD8A 1K5JA 4PIXA 1HB2A 5JWPA 2DBNA 5A3TA 2IXIA 4GA9A 5FXZA 2VMCA 1V0AA 1VPHA 2BOIA 3J7LA 3FZ3A 3ZN5A 1RUJ3 4P08A 4XJUA 4FCAA 2FCVA 2XLFA 4DOUA 4YZ5A 3NKTA 2IC1A 4X8NA 1FPN3 5DDJ1 3EQEA 2WQZC 3RMXA 5C4WB 4OMDA 4FPKA 3N9OA 3OBAA 2YG0A 4AVSA 1W6NB 3RG0A 1SFYA 2PLV2 1E5SA 2WZR1 2ZABA 3BGAA 5FUIA 1K5MB 3WP6A 2VPVA 2D3SA 1LTEA 1RHI2 2W1QA 3R4DB 3AJZA 5IAXA 1OXCA 1RMU1 3AKSA 2BU9A 2MHFA 2VOKA 2RMU3 2WYFA 3BPZA 1IOAA 3DXTA 2DBIA 3AMQA 5KC5A 4YM3A 5J36A 3UNPA 1KQRA 3HNYM 5FY5A 2OYZA 3PMEA 3UV9A 3GZEA 2YPDA 3WOGA 1PO12 3ZDVA 5LCWL 2BVVA 4S2GA 4Y20A 2CDOA 4B3NA 4CCJA 4KGGA 5A7SA 3IWZA 3VBRC 2HBUA 3GJBA 3LA2A 5FZBA 2OZ6A 1TZOA 2GDFA 3WR0A 5LRRA 2F6BA 2WT0A 4AGGA 1JYCA 4P9IA 3KVAA 2VG9A 3VBHC 3VKMA 4H14A 3P1IA 4XJWA 3ZO0B 3NV3A 2W87A 5A7NA 3PVNA 5KHIA 3O1PA 2R16A 1W6PA 2YMZA 2E7TA 1ULEA 1MQTB 4MGYE 3LEMA 4NRPA 4AE2A 4AI9A 2VL4A 2ZBJA 4OHXA 4OZOA 4UW3A 2E63A 5CB7A 3OYWA 5ACA2 1SCSA 2RR13 2XL7A 2DTYA 2I07B 3IPVB 1E5IA 1RUC2 2OX0A 3IB3A 3WDWA 1UY0A 5FUNA 5IYYA 3KWVA 1WMEA 2PQSA 1RXGA 3S5QA 1GZCA 1VJ2A 2JDYA 2ZHKA 4LBMA 4LBKA 4JDOA 2C6SA 3IMNA 4UI9L 4EROA 3ZFFA 4PDWA 5C9AB 3RYRA 3PMSA 1RUOA 1CJPA 3K51A 4HVOA 5FBZA 1QOTA 1VBB3 1ULFA 4Q4Y2 4UBHA 4M3CA 4IGOA 4AHWA 4DZGA 2RS12 5F3CA 1ACCA 1Z7S3 2ZKNA 5CFDC 1DZQA 3D0JA 3G7DA 1S1AA 4JC1A 5ABJA 2CTVA 1NE6A 1UOFA 2B5HA 1D4M1 2UWAA 3M1HA 3KLSA 3ROUA 1K3IA 4YVSC 3UGGA 1CAXA 2JG9A 3KT1A 4GWNA 4CCEA 1GNHA 2PHRA 1EAH1 4QPGC 4AEDA 2EIEA 2EAKA 2ZGMA 3ZYPA 3AYCA 3RVHA 1PIV1 4KU8A 4GMP0 4R52A 3NAPB 1F8VA 4Q4X2 1GU3A 3J7HA 3NNJA 3BKZA 1TMF1 2MPFA 2G4IA 1ZA4A 1OOPA 4AWDA 2PHWA 1X9TA 1HRI1 2BFUS 4XDOA 3KCYA 4O65A 3ZXGA 3WUCA 2A6YA 2RDRA 1W8FA 4TWTA 3FFZA 4NIIA 4IQPA 1MS9A 3LA7A 2TUNA 1LNSA 4GJYA 2D5HA 2EXIA 3ZXEA 1XNCA 1VALA 3CHXA 4MGIE 1RUE3 3ME2A 3OJBA 4N9IA 4XF3A 5F32A 1YRZA 3A23A 2JKXA 4C0HA 5LW9A 2ZGRA 4GB32 2ZMNA 3LOIA 1RC6A 3ITQA 2D6NA 3M70A 2WQ8A 1RUH3 4JQRA 5TSWA 5JMCA 1RUD2 4LBOA 1HV0A 2R073 4XAAA 3VBRB 4AOCA 4EWDA 1GUIA 1IGOA 3FE5A 4GH4A 3LGRA 4OUEA 1J58A 4P02B 2YC4A 5T5JA 3RWNA 3VKOA 3BUCA 4EJRA 3B5LB 4XIKA 3N9PA 3E6DA 4I3GA 4BQ1A 3CO2A 1PO22 3KGLA 2BP6A 3VDAA 5CAZA 1BEV2 3D82A 3H3ZA 3VD3A 1YYNA 1CIYA 4M0HA 1LCLA 5FYYA 4E2GA 1SMVA 5DPNA 3VL9A 3WY6A 1N3OA 4V1PA 4A44A 4YW7A 4RR3C 1AR92 1OH3A 3T3YA 3WEZA 2RM22 2ZACA 1C8M3 4HPKA 2FMDA 1X8MA 1ZRFA 3V0BB 5IVVA 4PQ9A 3A7QA 5A1AA 1JODA 3HT2A 2YU2A 3JBG3 4ZXEA 4FTSA 4KWUA 4DUVA 3GM8A 1IS3A 1L7RA 1V6KA 5LEJA 5EIYB 4FP2A 3F2ZA 5KC6A 1HB3A 2HWF2 3JB4C 1KXGA 4LA3A 1QIQA 3WG4A 3LOBA 1BHGA 3JZVA 5IVYA 1VRBA 1AJOA 2D93A 1R091 1YQ2A 4U36A 4MVTA 4R8HA 2XLAA 2WT2A 5JZGB 3JU9A 5L7OC 4X6RB 2GMMA 2YYOA 2AREA 4KU7A 1IKQA 5CFDB 1OLQA 5FY7A 3U4XA 2P37A 1Y4WA 2VCMA 1MVEA 1QY4A 4YVSB 3CJIA 4W8JA 4BDVB 3AKQA 2ZZQA 4QPGB 4Q5OA 3LA3A 4BA6A 1MZ5A 5K0UA 4CXWA 1FOD2 2E7AA 3MIEA 5FRAA 1HQLA 1AVBA 1R1A1 1ODMA 3MFCA 5F7UA 2EIBA 1FV3A 3AX4A 3B69A 5E88A 5GLVA 5HXVA 1B09A 3UKVA 1OLMA 1W9FA 1Q56A 5BUVA 1G9CA 2RS52 3NNGA 1W8HA 2A3WA 3E5QA 3LSDA 3WDYA 1WZXA 2WO2A 4KNCA 1UQXA 2C1FA 5FZHA 4W4ZA 2X05A 5BY5A 1US2A 1OSGA 1TME3 2VVEA 5L9BA 4GQ7A 2PLV3 2HWB2 4CU9A 1QOOA 3WP5A 3HQXA 4HONA 4AQ2A 5C71A 4XJZA 3EHKA 4RHV1 2B7YA 4D69A 3RZHA 3KHBA 3VBFB 2CV6A 5FMOL 4CA9A 2FCTA 3TRSB 3PUSA 1IS4A 4TN7A 2QQIA 4EN0A 3C7GA 4JGYC 3IDAA 3FN9A 3O14A 3BIEA 1OD5A 1A3KA 1QJX1 4GD4A 1ULOA 1OI6A 2BYVE 4N53A 5FXWA 1RVF3 5CZKA 5C8WA 5FOJB 4C1XA 4PQQA 2DVFA 1DYOA 1G9BA 1O4ZA 1RUJ1
chains in the Genus database with same CATH topology
2UY8A 1JOJA 5DG2A 4RR3B 3HD8B 2AUYA 2ZGOA 2ILMA 4I0WB 4CDWC 3B93A 2D5FA 4P9YA 3VZOA 5C4WA 2G9GA 1JN2P 5FO8B 1W2UA 5GM0A 1IPKA 1CESA 1W6NA 1J3PA 2NM1A 4COWA 4OHWA 2VVFA 1QWRA 3ILRA 4COZA 2E53A 3PVEA 3FUQA 4H55A 1AYM3 1SBDA 4DXZA 1QKQA 5AC92 3NJZA 3WV6A 1PGL2 2C0ZA 2DV9A 3VKFC 5L7OB 1V6JA 3WQ7A 2F4PA 1CAVB 2DVDA 3ZXFA 1GFF2 4C90A 1HXS1 4IL7A 4F8AA 2BGCA 4AK3A 2HWC3 3J4UH 1VBC3 3FMGA 4Q4Y3 1BMV2 4LT5A 4XJ8A 2VOVA 1CVNA 1LGBA 1RJ7A 1XE7A 1FAYA 2H0BA 2XJVA 5CG9A 2NLRA 3MLKA 1F2NA 2HYKA 1MZFA 2VQAA 4WM7A 3O0VA 4OI0A 4AFBA 3I59B 4Q4X3 4FXKB 1OFNA 3LWCA 3OGJA 3NO8A 5JI7A 3RS6A 4Q0VA 2AGSA 4QT6A 2YZ4A 1OQDA 3UK9A 3IM0A 2FBEA 3R05A 3POWA 1EV11 4GB33 2DWRA 1AHSA 3HAGA 4BLIA 4S2HA 5T3NA 3WQ1A 3WP4A 1MS1A 1F5JA 1N3QA 1XE8A 4CDWB 1NCRC 2N7GA 1PO23 4QQPA 1URXA 4P9JA 4L92A 2ZGUA 4XF9A 3MIBA 1QH6A 4HVQA 4NVPA 2RM23 1NQDA 4R9BA 1YXWA 2CAUA 4K1ZA 4DRRA 5FQ0B 2WSVA 1RINA 3CNAA 4XYXA 1JW6A 4Q0PA 1FT9A 1RUE1 5KBFA 4QHBA 4Q2FA 2ZGPA 2QKDA 4JTNA 1UIJA 2DVGA 2VW1A 2IFRA 1HW5A 2R062 5J09A 4Z8BA 2R071 4Z1VA 2I74A 4LE3A 4OUSA 3H8UA 2EVXA 3JD73 3M3EA 1ZZ9A 1LHVA 4FPJA 4KG8A 1S0FA 3V65A 5C8CC 1ZRDA 3WUDA 3URFA 3VBHA 2I2SA 2E51A 5F1RA 5EYYA 1DGLA 1AR63 3LAGA 1DDLA 1NY72 2XJQA 2XLGA 3SISA 3O0XA 3ACLA 2VQ0A 4FOVA 4OHYA 3D5OA 1C8M1 1FX5A 2ZX2A 4WVWA 4AFMA 4TZDA 3V64A 3A0NA 2A6ZA 1BBT2 1O91A 1V6OA 3V0BA 4Q29A 4KL1A 2D44A 1OFSA 1B35C 3M3QA 4PCRA 2VNRA 2WLPA 4IEXA 3TBDA 4R4XA 5F6LB 3C3VA 3J8F3 3L2HA 3ZFGB 5A3MA 1RUG2 4XFCA 1XXNA 2AH2A 1AXZA 1GICA 2ZGKA 3Q9OA 4KQ7A 3J26N 4MV2A 1QNWA 4M00A 2VGDA 5J48A 5JSPA 4XZPA 4YRDA 1QJU2 4JDMA 5CFDA 5JDBA 1CAUB 1G9AA 4GIQA 1MS4A 1NCRB 5GLZA 4I2OA 5I8YA 1NXD1 2R043 4GKYA 1FPN2 4I0AA 4LR4A 4XBLA 5BNNC 2XJUA 1XNKA 1YUDA 5GZEA 1GLHA 4RQPB 2BFUL 4MYEA 4BIOA 1NYWA 5JPMB 1KD7A 4AVCA 2GC1A 1RUNA 5K9YA 5EXOA 3AMNA 1UCXA 1WUVA 2PLV1 1YWKA 1F31A 3RMYA 5FCCA 2UY9A 1RHI1 2RMU2 1HQNA 4QU2A 3ZSKA 1GANA 4G9SB 1NA1C 4AI0A 4AW7A 3M2MA 5AVPA 1LU2A 1LRHA 4MXWA 4M01A 3OF1A 3SXWA 1EPWA 1UF2C 2CY6A 1PO11 2H0VA 4XOGA 5C8CB 1RTVA 3VBUC 3ZSLA 1LEMA 1UL9A 4E27A 1PGW2 2PA7A 4CDQC 1NZCA 2ES3A 3ZX7A 2PHTA 3EJKA 4YZ2A 4JTOA 1XYPA 1LGCA 1S2KA 1V70A 3DPRC 3VBOC 3VZNA 1N47A 3MF6A 1H0BA 1X8EA 2G9FA 5JSOA 1VBE3 4F7ZA 1PK6C 4PF5A 5LEKA 4LHNA 2RR12 4I02A 1B35B 3IN9A 3VV1A 3MGUA 5FOBB 3KT7A 5I0SA 5ACA1 2NN8A 1GQGA 1LESA 4ONUA 2DF7A 2EAAA 4UXAA 4XFFA 1RUC1 3NV2A 2IXKA 4LNVA 2DU1A 4QGMA 1AR73 1NCQC 2D43A 2YUEA 4WVVA 5L19A 1G9FA 1IQAA 4I3PA 1U0AA 2C9AA 4Y22A 4R4ZA 3OPZA 4PIYA 1CAVA 1H8TC 3CU7A 4SLIA 1LODA 1VBB2 3E5XA 5FMOS 1BK1A 1H2MA 1Z7S2 1U5YA 3OD4A 2P2KA 5FO9B 1KRIA 2RS11 5JVVA 4H3WA 1MEC3 3ZXKA 4BWOA 5BNNB 3OY8B 4YFZA 1WLWA 3GBFA 4MX3A 3MW3A 3VKNA 2WA4A 2WS93 3R4SA 1GZWB 4Q4X1 1UU5A 4BYYA 3LSEA 3ILFA 1RB8G 4WZFA 2OZJA 4HN1A 3POYA 4YW3A 2JG8C 2PYTA 4L11A 4AXOA 1ZX5A 4AF9A 4ZKTB 3RJ2X 4XTPA 3S6PA 2GH2A 5BYNA 4OFGA 3WX5A 3K48A 4C0BA 1AR83 5DUVA 2WNVA 4JGYA 5DUWA 3B9CA 1XU1A 3N3HA 1RUH2 4K7JA 1I5ZA 4GB31 3VBUB 3ELNA 4Q0UA 1RUD1 3NKGA 3POSA 1ENXA 3GNEA 5FLJA 3ASIA 2GZWA 3DV8A 5I91A 1ZZBA 4L9BA 3DPRB 1F5FA 1PO21 4WVMB 3H3UA 2W52A 1BEV1 1WGPA 3N7LA 3O12A 4FPLA 4QPYA 4LHLA 1PK6B 1R1ZA 1W6QB 2X29A 1KFXL 1AR91 2A3YA 3FLPA 3KZ4C 3PLQA 2XPJA 3JBG2 1S0CA 1BYHA 5GZDA 4IEUA 1IS5A 4YYOA 3FWEA 5T50A 4FTBA 4E4DX 1FV2A 4ISQA 4IXLA 1LOAA 2A6XA 2HWF1 3WW3A 4Q0QA 2QDRA 2IXCA 3MW4A 1Q3EA 3DUIA 3TNQA 4QGLA 3TN92 3NVCA 2XL9A 1V6MA 2BUKA 2E6VA 1FXZA 3OTFA 5L73A 1DHKB 2ZZJA 4YM1A 1U5IA 2AYHA 4KWKA 1LEDA 3FUOA 4CP2A 2ZHNA 1FOD1 1VBD3 4Q8KA 1N1SA 1QJY2 4YW4A 1PZ7A 1MZ6A 1ND3A 1OQ1A 1AL23 4FOQA 4NN0A 1QDCA 2DUQA 1QQP3 1A8DA 1JTZX 2JG8B 2RS51 3IIAA 4Q27A 3UL2A 1Z78A 3S7IA 3BODA 3NAPC 2XVLA 4IEZA 1TME2 4YVWA 3LB9A 1F9KA 1QF3A 3QOPA 2DVBA 2RJLA 3ZSEA 1LHNA 2HWB1 1ZRRA 2O0OA 2PFWA 3WZ1A 2HEYF 2Q4SA 5A33A 1J3QA 2K2SA 5EYXA 2R1BA 1UW8A 1VBA3 5KWRA 3I4IA 1RVF2 4D7TA 4CP0A 4C91A 3ZMNA 2JJ6A 3USUB 2ET7A 1ASJ3 4FPHA 4W6XA 3RI9A 2NPIA 4XDQA 1MR5A 2JE7A 1X7NA 4L97A 1WCDJ 2WNUC 3HMYA 5CU1A 4XXAA 4CRQA 2Z69A 4MXVA 4BIFA 1HRV3 2YGLA 3FC0A 1UD1A 4GWMA 2DUPA 1CN1A 1AYM2 4MSVA 1MACA 3ZXDA 3UKTA 4FPCA 3MEPA 1C28A 2ENRA 4AEKA 2XJRA 4HK9A 1CIWA 2A5ZA 3HT1A 3OCPA 4N9HA 3UJQA 5AC91 4J1XA 4P9LA 3A0KA 1PGL1 1G6NA 4QMAA 4OLLA 1JXNA 3I8TA 1HV1A 4YLZA 1H2LA 1SQ4A 2B39A 2X5IA 3VHOA 5F9TA 3MPPG 2HWC2 4J6GA 1VBC2 2PN5A 1OA2A 1SBFA 2ZS6B 5JZGC 4Q4W3 4HANA 4PBPA 4GMP1 4S2FA 1X50A 2R0FA 2DCTA 1VB2A 2XVGA 4IETA 1BMV1 3RJRA 1YO8A 4Y26A 1YFUA 2Z79A 5E1RA 3SNMA 5AVAA 1GNZA 3VDDC 5I8TA 1GQHA 5J3UA 3ZYIB 1IKPA 2XVKA 3AP5A 1WMFA 3VHNA 4B4QA 3ENRA 4FQZA 2CWMA 5IK5A 1ZZ6A 4JGZA 5H9RA 5BNPA 2A6WA 3NL1A 1BKZA 2ZJCA 4XW3A 3AP4A 2D40A 5IUQA 1QXPA 4RL7A 3GZUC 2ZX4A 5IK4A 4FBFA 2B8MA 2ET1A 5I8SA 4MLOA 4XFBA 4RD7A 3SITA 4AHXA 4BHPA 4BM8A 4INDA 4YZ4A 3VBFC 1CGPA 1IS6A 1SLCA 4CDUA 2UYBA 3AMHA 2GNDA 3D0SA 5KXBA 3H50A 4FPYA 2IFWA 3FLRA 3ZYRA 3HIFA 2R49A 1RL3A 4XBNA 2DCZA 4OI2A 5T54A 4CDXA 2WNUB 3OY8A 2GSYA 3B00A 4A3XA 1CAWB 1WBFA 2YC0A 1O4TA 2MEV3 2NMOA 2RS33 4Y4YA 3M7AA 3JCIA 4G3YC 2XHKA 1VR3A 4N43C 4QQ2A 4Y1XA 1DQ6A 2B45X 2DCYA 4HSLA 3RYKA 2D98A 2Q5TA 4K3UA 3J9SA 4BPZA 1NA1A 3PNAA 5EZWA 1RITA 2UURA 4P9WA 5IK8A 3VBUA 2R061 3AZZA 3JD72 3TNPB 3AP9A 4GULA 3QACA 4CDQA 2XJPA 4NO4A 4NOTA 1AR62 4ATFA 5I93A 4NHLA 1UKGA 3TN93 3DPRA 1RIRA 4YM2A 3VBOA 4O9GA 4FPGA 1IPJA 3RDIA 1MVQA 4FTSA 4IEVA 1NY71 3VDDB 1AUYA 4Y24A 4BCUA 3E6CC 4ES8A 1PK6A 2W0XA 1DYPA 3WDTA 4DMIA 1O7FA 5DUXA 3MYXA 1UZYA 2Y26A 1BBT1 1AF9A 1QJY3 5FTTC 1A78A 1KDMA 1DF0A 1YFXA 2XJTA 3N4MA 3NWKA 3C2UA 1LU1A 5T5OA 4EV0A 5KXDA 3VHPA 1NCQA 1OHFA 3M8LA 5DZEA 3J8F2 4KWJA 1YCIA 2CNAA 3N7MA 2ZPXA 4DY3A 3RPQA 2QQPA 1H8TA 1CPMA 1PVC3 2QCSB 4ZXKA 2E7QA 4ES9A 1ZRCA 1RUG1 5JSRA 4YGEA 1ULCA 3MIFA 2O1QA 2V09A 1QJU1 2QUOA 4LTAA 4RA0A 3M3OA 5FAXA 4KBBA 4P14A 3ZVXA 1NE4A 4LE4A 1Z0HA 2R042 3U0ZA 3AZXA 1NXMA 1XRUA 4WM8C 1PM7A 1FPN1 1S0JA 1U5ZA 4AI8A 1JBCA 2VOWA 1S0DA 1WLTA 4N43B 4AVAA 4CEWC 4HZFA 3GZAA 3ZXLA 4FAGA 3W9AA 4COUA 3AM2A 4XFAA 2JEMA 3PTYA 4URTA 3A4UA 1K5MA 3IT8A 5BNQA 5CG8A 2D6KA 2PAKA 4YGBA 1FATA 4A7YA 2DTWA 1Q8VA 2RMU1 1REFA 4LEJA 1SLTA 1COV3 1W6MB 1ALYA 2XJSA 1WD3A 2BQPA 3KM5A 1SLBA 4COYA 3SCGA 1SEFA 3IKWA 4COVA 1PGW1 3VBSC 5FDBA 3KSCA 4XTMA 4HMZA 5J98B 4A2UA 3PVOA 3USUA 1Y9QA 3I7DA 1DGWX 1VBE2 1ZBE3 3AKPA 4DRVA 1ND2C 1UIKA 1LOCA 4XBQA 1MQTA 3BCWA 2BPA2 1MS0A 3U10A 1Q8QA 1ENRA 2DURA 1WW7A 2FZ1A 2RR11 3H1MA 2BWAA 4PLOA 1U12A 2DFCA 3G6JB 3WG2A 2WKKA 4QPIC 5FFOC 4Z92B 3IPVA 2ZOEB 4JV4A 1AR72 5T55A 3KD4A 3B01A 1Q43A 1AYN3 1OQEA 2A75A 2NYYA 2RHPA 1CQ9A 3SLIA 2HWE3 4M3CF 2TNFA 3ZFGC 4JAAA 4OULA 4UBGA 4HT1T 4BLJA 5C9AA 1VBB1 1FMD3 2RJKA 3V56A 5CFCB 3FHIB 3VL8A 1Z7S1 1C1FA 1MEC2 5KHGA 3TB0A 4Y1YA 2HWD3 3T1LA 2PHXA 3OBTA 3WDVA 1I1EA 1ZBA3 4WM8B 3FLTA 3FX3A 2A6VA 1KS4A 1H9PA 1TNRA 2WS92 5K8SA 2BW8A 3CEWA 1LULA 3QD6A 4CEWB 1DYKA 2R1DA 5H9SA 3QLQA 4HN0A 3NAPA 2A73B 3M4FA 1R083 2SLIA 1A8MA 4LULA 2XKOA 4RQPC 4NHKA 4L8QA 3MIGA 3KGZA 2GN3A 1UX6A 1WW6A 1AR82 2AR6A 2WLQA 2X8KA 3WHTA 1XQNA 5HBAA 1D0GA 1DZTA 3D4KA 4Q4V3 5GJ6A 1RUH1 4YW5A 5GKAC 3ETQA 1N1VA 3VBRA 3VZJA 5B2GB 3VBSB 3WDUA 4BOWA 1LJ7A 3RYPA 1ENQA 5BNOC 1BZWA 2OUHA 4S2DA 1CAWA 5FLHA 4AEJA 1ND2B 2WWSA 3O7OA 3ZN6B 5FLIA 3UKNA 2OUJA 3MLLA 4FTEA 4LUMA 1RUI3 1BVP1 4QPIB 2I45A 3SCHA 2ZX0A 3JBG1 1W39A 1HQWA 2NZ9A 3ZYJB 1NG0A 1KS5A 4JCKA 1O3SA 4P9GA 4RS5B 2EXKA 1RUF2 1VRH3 3KQRA 4K20A 3VN4A 4I01A 4R9AA 2ZGLA 1Q8OA 1M4WA 2VVDA 1ZNPA 5JIAA 2XKPA 3SMHA 1UKRA 2Q1MA 3THTA 3P3NA 4IEPA 3VZMA 1Y43B 1EP0A 2ARXA 1WLDA 1APNA 5CA6A 1SLAA 2JG9C 5JZGA 3TN91 3B9IA 2B46X 3WINE 3AJYA 3AMPA 5CVRA 1WLCA 4ZU5A 3AYAA 3GHNA 4YVSA 4OI1A 4QPGA 2W08A 1VBD2 4F3JA 4YFWA 4DQAA 2DYCA 4AHYA 1QJY1 2FMYA 4CZSA 1AL22 1WW5A 1RMU3 1QQP2 1VAVA 3CL1A 4MGKE 4PIZA 5H9QA 4MGZE 5L36A 4Y20B 2ZX1A 2PHDA 1TME1 3H7YA 4YNIA 2ZX3A 1V00A 1YIFA 4IV1C 4FP3A 1C4RA 5FREA 4JRAA 1OPMA 1G7YA 1QJZA 3VBFA 1SLLA 1QU0A 2VUAA 2VECA 1VBA2 1JH5A 1DZRA 3THPA 1I3HA 4EN9B 1WMDA 3JUUA 5BNOB 1Q5OA 1OPOA 1RVF1 1G86A 3OYWB 1J1TA 2BNOA 2KA3A 3VLBB 1ASJ2 1C5HA 4MH0E 3BALA 1VP6A 4IV3C 2R32A 1XNBA 4RR3A 2K9ZA 5JOYA 4K8FA 2GNTA 4NWWA 4AVBA 2CYFA 1MS3A 4HSJA 1HRV2 4TYSA 1ZREA 1YI9A 3WG1A 3DF0A 1DQ1A 2VMIA 2PQQA 1GBGA 3KT4A 1CPNA 1YNAA 3H0OA 2JD4A 4PDWB 4RGGA 3RRDA 1MS8A 4ASMB 4M0NA 5FPXA 1AYM1 2B9UA 3NSTA 5KXEA 1IZ3A 2KXLA 2JECA 4UW6A 3ZXAC 1W6MA 3U11A 2XWBB 1DQ0A 4B7EA 2ZA9A 2FQPA 4YW1A 3ZIXA 4OHZA 3CJIC 5L7OA 2JG9B 1D4M3 2WFF2 4QD2A 4AEDB 3NV4A 1EAH3 4FXGB 4QXKA 1AXKA 5A32B 4D94A 3EXUA 4B4RA 1BQPA 1LHUA 4Q4W2 1PIV3 3BOWA 5HI0A 2HWC1 2R6QA 1VBC1 2IXHA 4Q4Y1 1LGNA 4R9CA 2XG3A 1OOPB 5JCTA 3LCPA 5T5PA 1MZEA 1HRI3 4FPOB 4AI1A 1C5IA 4YZ1A 4I0BA 2PAEA 4XXPA 1Q8PA 2EIGA 2NMNA 4LLOA 2DU0A 4FOWA 1QMJA 1EY2A 2TBVA 1LR5A 1UN1A 4K1YA 1CX4A 3I59A 5J96B 5GLUA 4META 4GH4B 4IV1B 2XGXA 3NW4A 3T1MA 4FOYA 4HKWA 5KHHA 1G9DA 2H6CA 2YY1A 4AFDA 1H4GA 4WVZA 5DZFA 2OPKA 2VXRA 4XE9A 2EF6A 4X8PA 1NLSA 1VLNA 4P5HA 2LM3A 4KWLA 4L99A 1ZYBA 4LA2A 5IK7A 3S30A 5LRSA 4IV3B 2A3XA 1Q8SA 4WM8A 1H1IA 4GALA 2QZ3A 1D2SA 3B3QE 4OZXA 2WNEA 4CDWA 4QM9A 2MEV2 3ZPYA 2RS32 2XBO2 1U5XA 2GU9A 2RM21 2UYAA 3O0WA 1ZZ8A 1HX6A 4BE3A 1AXYA 4HBNA 5T52A 1R093 2WC2A 1SACA 5FQ0A 3AKRA 2D6LX 4XJ9A 2WSUA 2GC3A 3GBGA 3WW1A 5JAXA 2WA3A 1RUF3 3CJIB 1C3HA 3IDEA 5CBLA 1ZM1A 1DQ5A 2IXJA 2HJIA 5K0UB 3PVBB 5C33A 4IEOA 2WINB 4HETA 4BH9A 2MNGA 3JD71 2DVAA 1R1A3 1ZVFA 3U07A 3FFQA 5F6KA 3VHRA 5A3LA 2D6OX 1AR61 1QOSA 4XEZA 3PJYA 4CEYC 3AZVA 2ZAAA 4EN8B 3WLUA 4I30A 2TEPA 4AFAA 1ND2A 2JX9A 3ZN6A 4Q8LA 5T5LA 4XETA 4OI4A 3WT3A 4DPNA 1LB2A 4UW4A 2Z5WA 2YPJA 4Z2WA 2R30A 5HCFA 1V6IA 2QNKA 3D6EA 1PZ8A 3AB0A 5JOXA 4C1WA 4M3CE 4HKOA 3R6SA 3VKLA 1QJX3 3J8F1 4E9KA 5JI9A 1D4VB 1PVC2 4WBBA 1AX2A 3ZFGA 2GMEA 4XMIA 1AL0G 1WBLA 3FJSA 4IEYA 1XYOA 1QNYA 3EO6A 2EXJA 1E57A 1DG6A 1LHWA 4LO5B 4E4ZA 1CAUA 4LBQB 1FNZA 2GN7A 3X29B 3WQ0A 1HIXA 1S0EA 1NCRA 2R041 3ZMOA 1TQ5A 3AYDA 1OA4A 2CGNA 2P3IA 2DFBA 2P3KA 3E5UA 2JENA 1O4YA 3WHUA 4RQPA 1DGRA 3DL3A 1LHOA 1HKDA 1J3RA 1S2BA 2VNGA 4PJYA 4YM0A 1G8WA 2VMHA 3ZYGA 5HCBA 3ILNA 1HXS3 2BEOA 5KHKA 1COV2 2WZPP 1HLCA 3VZKA 2GMPA 1J59A 2D97A 5EV7A 3WW4A 2P17A 4Q1RA 1X33A 2EALA 1OMIA 5BNOA 4KG0A</