4XFAA

Cysteine dioxygenase variant - y157f at ph 8.0 in complex with homocysteine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
186
structure length
186
Chain Sequence
b'ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLFSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Structures of Mammalian Cysteine Dioxygenase Variants Missing the Cys-Tyr Crosslink
rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 56
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xfaA00
3NSTA 4HVQA 4ORFA 3R6SA 2PFWA 4FAHA 5I93A 1CAXB 3ROUA 5BUVA 2PHDA 4MUVA 3LA2A 1IPKA 4I0AA 4FT8A 2IXKA 1DGRA 5T3NA 2MNGA 4MGYE 1RGSA 2GAUA 2D40A 3ETQA 1CAXA 3H8UA 3H3UA 1DGWA 3BU7A 3B02A 1ZZ8A 2HJIA 1X7NA 4HMZA 3S7IA 3CJXA 1O5LA 4KWKA 3D0JA 3HIFA 2OPKA 2FMYA 2IC1A 5LRRA 4J1XA 1XRUA 4X6RB 1QWRA 4Q0PA 2XLAA 4UBHA 4XF3A 5I8YA 3M3IA 4LULA 4D7TA 4LTAA 3OD0A 3SCGA 2QVSB 1OD5A 4YRDA 2B5HA 3KMHA 1NYWA 5I8SA 5J48A 3S0MA 2GC3A 2OZJA 5FLJA 1UW8A 4X6QB 4KU7A 1QXRA 1I5ZA 5E16A 4IEVA 2P17A 4Q0VA 5EZWA 3CF6E 2GH2A 3S7EA 3HQXA 1Y9QA 1IPJA 3FHIB 4KWJA 1TQ5A 1CAUB 4XFHA 3LWCA 4IEXA 1ZZ6A 3U0ZA 4E2GA 2ET1A 4IEWA 1J3PA 4EWAA 4YNIA 3NL1A 4XFFA 4JTOA 3ACLA 4BIFA 3E6CC 4EROA 1WGPA 3TNQA 4FAGA 1CAUA 3M70A 1CAVB 2O1QA 3H7JA 2Q4SA 2GZWA 3CEWA 4I0BA 4MV2A 2D5HA 4YARA 1WLTA 4XF0A 2K9ZA 3IBMA 1V70A 2CGPA 2ZKLA 2ZCWA 4LA2A 1EY2A 4I2OA 3OF1A 5FQ0B 3UKVA 1YFXA 1UIKA 4R8HA 4EV0A 1CAVA 4XFCA 1VR3A 5HI0A 5I91A 3KGLA 3UKTA 3MZHA 3E6BA 4OLLA 3IDCB 1O5UA 5FQ0A 2FQPA 2CAVA 3GBFA 3MDPA 4XFBA 3RDIA 2BGCA 5EFUA 2GC1A 4JV4A 5I0SA 2K0GA 5K8SA 1CGPA 3MPBA 4XFAA 1ZZBA 4Q0UA 4WZCA 2IXIA 3FZ3A 2CAUA 3FFQA 4HSLA 2VECA 3FJSA 4IESA 4QGNA 4QM9A 2VQAA 4MGKE 1I6XA 4HZFA 4Q29A 2BNOA 1VJ2A 2EAAA 1GQHA 3BALA 1SEFA 5KHJA 4YSFA 2B9UA 4LUMA 5FDBA 3H50A 3CL1A 2OZ6A 4AQ6A 4AVCA 3E5QA 1PMIA 1VP6A 4AVAA 1NZCA 2XL7A 3RPQA 3LAGA 1ZRFA 2D93A 2IXJA 3SCFA 2PHLA 1G6NA 1O3TA 4E2QA 1NXMA 3IWZA 5KHKA 3NVCA 1O3RA 4MZUA 3E5UA 2WC2A 2Q0AA 2BNMA 1JUHA 1SQ4A 1NE6A 2UY8A 3FWEA 2XLFA 1O7FA 4UXAA 2XKOA 4QM8A 1FXZA 3E97A 3H1YA 1UIJA 1HW5A 1LKNA 4IEQA 5C6CA 5KHGA 4HVOA 2Q30A 2IXLA 4H7LA 4TLFA 5F1RA 3NKTA 3QOPA 1ZVFA 1O3QA 5FPZA 1H1IA 2ETEA 1QY4A 4MX3A 2GC0A 2VPVA 4DINB 4WVZA 5CU1A 2IXHA 3LA3A 2EA7A 2F4PA 1UD1A 2XKPA 3SHRA 2ATFA 2E9QA 2GU9A 1CX4A 1LR5A 4F8AA 3H7YA 3EJKA 3ES1A 3BPZA 4I01A 2QCSB 3RNSA 2IXCA 3HT1A 4PJYA 4IERA 1J59A 2QNKA 4O9GA 4Z07A 2C0ZA 2Z2SB 3HT2A 4Q0SA 3FE5A 1O4TA 3BCWA 1DZTA 3LOIA 5CADA 1YFWA 1QXJA 4Z82A 5LEJA 1RL3A 3WW1A 3NJZA 3PVBB 2Z69A 3CLPA 1CAWB 1WA4A 2PTMA 2PAEA 4PIZA 4ZU7A 2MHFA 3DKWA 4ZU4A 1YFYA 2B8MA 4YYOA 5AVPA 5D1IA 4GULA 5FCCA 2XHKA 4META 4HVRA 4QMAA 3U11A 1J3RA 4ONUA 2D5FA 2CV6A 4E2SA 1CAWA 3QACA 5I0RA 3DN7A 3RYKA 2WFPA 4I02A 1J58A 4D7SA 4OFGA 2XL9A 5CVRA 4IETA 4UBGA 2GC2A 3H9AA 2BNNA 1OI6A 1OFNA 3KSCA 5C8WA 1ZZCA 4FBFA 5BY5A 1YUDA 3I59B 3MYXA 1O3SA 1RTVA 3DL3A 4KL1A 3I54A 4LUKA 5KHIA 3SMHA 2HKXA 1Y3TA 2PA7A 3L2HA 3U10A 4P9GA 3H1MA 2OYZA 2PAKA 3LA7A 3FX3A 3I59A 2QDRA 2H6CA 1ZX5A 1Q43A 1YFUA 1U12A 4IEOA 4K8FA 4XFIA 2PQQA 3WW2A 1EP0A 4HN1A 2ET7A 1YHFA 2N7GA 3E6DA 2UYBA 3KGZA 3IDBB 3G7DA 3JZVA 1X8EA 4Q0QA 4J1WA 3RYPA 4IEUA 5KHHA 1Q3EA 4KU8A 4XF1A 3ELNA 4HSJA 5E1RA 1FI2A 5BXXA 5FLHA 2KXLA 4B29A 2DCTA 1GQGA 4A2UA 1ZRRA 3ST7A 4BYYA 2BYVE 1XE8A 4MH0E 5BPXA 3D82A 1LB2A 4LA3A 1RUOA 2XLGA 2I45A 5BV6A 3N4MA 3PNAA 4HLTA 3SXWA 5J3UA 3O14A 1L3JA 3RZZA 1J1LA 1FT9A 4XETA 4XF9A 3UKNA 5J7MA 3I7DA 4QX5A 4HN0A 3EO6A 5KBFA 2UY9A 4L2NA 3WW4A 2BEOA 1OMIA 1UPIA 4RD7A 1XE7A 1PM7A 1J3QA 3EQEA 1LRHA 4N9HA 4XF4A 3SCHA 3DV8A 3ZDSA 1ZNPA 5JSPA 3H1WA 3KCCA 3LZZA 4IEZA 4MGIE 1ZRCA 4QXKA 4HBNA 3BB6A 4AQ2A 3WW3A 1UCXA 4L11A 1X8MA 1YWKA 4NVPA 4CYDA 2EVXA 2MPFA 4XFGA 2PAMA 3PLQA 3C3VA 2Q1ZB 3H3ZA 1ZZ9A 1RUNA 4LEJA 4AXOA 1H1MA 4IEPA 1X82A 4IEYA 4I09A 3USSA 4F7ZA 1NE4A 1RC6A 3VHRA 1ZRDA 1DZRA 3D0SA 3EBRA 4PIYA 4QGLA 2UYAA 3TNPB 1EPZA 4R52A 4O9EA 4JTNA 5JSOA 5I8TA 2H0VA 5JAXA 4MGZE 1Q5OA 1EYBA 5JCTA 1YLLA 4EWDA 4I3PA 5I0UA 3GYDA 5JSRA 2QJVA 5LRSA 3OCPA 2V09A 4N9IA 5I0TA 4QGMA 2PYTA 4EWEA 4KWLA 4WBBA 5FPXA 3NW4A 2H6BA 4LLOA 5JR7B 3OTFA 1ZZ7A 3EHKA 4BHPA 3RYRA 2Y0OA 3IIAA 2OA2A 3ES4A 4XEZA 1ZREA 4JVAA 4AVBA 4ZU5A 5LEKA 2O8QA 1SFNA 4PIXA 3OGJA 4BH9A 2XGXA 3E5XA 3CO2A 5FLIA
chains in the Genus database with same CATH superfamily
4DXZA 3NSTA 3O5SA 1FATA 4JGYC 5FXWA 4CXYA 4DUWA 1HB1A 2E7TA 1PX4A 5LATA 5BUVA 2PHDA 1VB4A 3ZDVA 4NR1A 1JS9A 2VVEA 2WAOA 4QHZA 5HCAA 3RFRA 1PVC3 4AHWA 4CCKA 1W9WA 5CG9A 2AEYA 4FT8A 4CXWA 4R4ZA 2QQVA 1VBD3 4DQAA 3B5LB 1VBA3 3JQXA 3WEZA 1W6OA 1HN0A 4W4ZA 3H8UA 1DGWA 3B02A 2QQOA 2HJIA 3C7EA 4E4HA 5D8AC 4YWAA 5FP3A 5CA6A 1OVPA 4Q4V1 3AP9A 3B7MA 5FFOC 1BVP1 1TNFA 1XC6A 1QOSA 2C1FA 2V5YA 2IC1A 1GP6A 2A5ZA 2X8KA 5L36A 2RVAA 3BN6A 3MIEA 4LBOA 1OD3A 4FFGA 3K48A 4PCRA 1MS4A 1XXNA 2J7MA 1H9PA 1IOAA 2YU1A 2HWD2 1QIQA 2LW8A 3AP4A 3I2DA 4L0PA 4OCTA 5FYUA 5A3NA 4BPZA 1PM4A 5I8YA 3GM8A 2BBVA 4LULA 4L92A 1APNA 3N9MA 4NHKA 5FY0A 4KMQA 4BA6A 4ES8A 2ZGLA 2VMIA 3MEPA 5SV8A 4QD2A 3K77A 4QQHA 3W21A 4HK9A 3K3OA 1ULCA 2E32A 2ZGNA 3KMHA 2ZEWA 3S30A 2EICA 4Y1ZA 2OIIA 1U5YA 4QKDA 5C3SA 2BU9A 1L7RA 2WJSA 5JPNB 3S0MA 3Q8BA 3CIHA 3M3OA 4S2FA 4DEVA 1F4AA 1UW8A 2VZRA 2WKKA 2B42B 2WQZC 3OY8B 4HT1T 4WM7C 4X6QB 5IWFA 1ULDA 1TMF2 1AR92 5FZ6A 2JG9A 1PO23 1S0EA 3LKJA 3CKHA 3POYA 5FKBA 1HRV1 3N9OA 1PGW2 3NAPA 3ILRA 1GOGA 2FHRA 1GUIA 1Y9QA 2YROA 2VXJA 1VPHA 3Q9OA 1A6CA 4O65A 3HMYA 4YVSA 1UYYA 4V2WA 1V6IA 5IVCA 3I3MA 1EUUA 2VNGA 3AP6A 1N47A 3AVSA 3WUDA 4A44A 1XYNA 1H8TC 4HK8A 4A7ZA 3U0ZA 1E5HA 1J3PA 5AC93 5C8CB 2F6BA 4SLIA 4K1YA 3S5QA 3S6PA 5CFCC 1W9YA 1AR83 4JTOA 2WAAA 4OYUA 2DU1A 1LULA 5FZ0A 1H9WA 1WW5A 1Q8OA 4EROA 2ZAAA 1UZYA 1CAUA 1NY71 2NZ9A 3ZIXA 5DQ0A 4MXVA 2XONA 4M3CE 2O1QA 2BVVA 2XR4A 1S2EA 1WWYA 2Q4SA 4IV3A 5D8AA 4B1MA 4I0BA 4DO0A 5A3TA 5LA9A 4MV2A 2D5HA 4YARA 1GQPA 1NAEA 3U4XA 1H30A 4XF0A 4DEQA 1POV3 1FMD2 4QX2A 1ND3C 2KA3A 4OQ9A 3ZR5A 3OF1A 3ZR6A 1POV0 4XDOA 3O1MA 5FZHA 1YFXA 1JBCA 1PZ8A 2Y26A 3AZYA 1QJY3 1UMIA 4COVA 4Q27A 5CEHA 3GHMA 5KC6A 2XJQA 4N8MA 1QJX2 3MZHA 1S0IA 5C4WB 1E5SA 4OLLA 4QT6A 4KBZA 2KM2A 4RFT0 5FQ0A 4W50A 4YZ3A 1G9CA 1X33A 3UJQA 1NKGA 2IFWA 1XOYA 4XFBA 5CKMA 5DXDA 3ZYIB 3ECQA 2BBAA 1UXXX 2EIBA 2JD9A 4KGGA 5DZEA 4FFIA 2LM3A 2K0GA 5K8SA 4XXAA 2WNVC 4WM7A 3MPBA 2JG8B 5L9RA 1TZOA 3DEMA 4N53B 3JUUA 1ZBE3 3FZ3A 1F8VA 3CJIB 1G9BA 2CAUA 2A75A 1J84A 1IGOA 2VECA 1YQ5A 2D98A 3M3EA 4IE7A 1RB8G 4MGKE 1I6XA 4G3YC 3MW4A 3P1IA 1XNKA 1VJ2A 3JXSA 3RMXA 1PVXA 4RR3B 4A6OA 2VQTA 2VAUA 2GALA 5FZEA 4CCOA 3WQ1A 4YW6A 1WLCA 1LENA 1FX5A 1GICA 3DYPA 4OHYA 2ORZA 4ASLA 3C7OA 5A3OA 4AVCA 3WG3A 5FK7A 3RZGA 1PMIA 1GU3A 1WCQA 3VBOB 5KXDA 1KEXA 3UT0A 1EV11 3PJQA 3LAGA 1IPSA 5GJ6A 3LEIA 1GWMA 1S55A 1Z7S3 5EYXA 2WQ4A 5L7OC 1RVF2 2XXZA 2RJKA 1MZEA 2HBTA 2X5IC 3SCFA 1G6NA 5LA2A 1AXZA 3HNBM 4EN6B 1AR63 2DTYA 1LOBA 4CEWB 1CIYA 2WO7A 3PVEA 5C3RA 5KHKA 3BTYA 1ND3A 1ZBA2 3THTA 5EJZB 4YW4A 3ZKYA 1U5ZA 5GM0A 1NCQA 2WC2A 5J98B 2P1BA 5JMCA 4LBNA 1NE6A 3FWEA 5IJRA 3ZVXA 2ZEZA 1JOPA 1W8FA 1O7FA 3ZFEC 4BQ3A 2JKBA 5A1LA 3AP7A 2BDRA 2VU9A 2WO3A 3H1YA 4MLOA 1V9U3 3RMYA 1BBT1 1QDOA 2D3PA 1LKNA 2GH8A 2JB4A 3I2FA 5F5CA 5LK5A 2CDOA 2R0FA 4XHXA 4N43C 5C6CA 1LHOA 4LK7A 2JDHA 4CDWC 3QBQA 4BQYA 2ZHMA 5FXXA 1SCSA 4MHRA 2VW1A 4LO4B 5EV7A 2VUDA 1VBE2 2WNVA 1OLME 4AHXA 4UW3A 3RGBA 3QOPA 3GZEA 1BZWA 1MS3A 4ET7A 3K2OA 2AEZA 2OQ6A 3WHUA 4ARXA 4IGPA 1DFQA 5FZDA 1NA1C 2EF6A 1C8M1 1QY4A 2CYFA 1KRIA 3IPVB 1GNYA 3SKJE 4FFHA 4RGKA 2EA7A 2F4PA 3MICA 4QPIC 3VBRB 1LOFC 1UD1A 3AX4A 2C26A 2JICA 3SHRA 4A7KA 4ZS2A 2E9QA 2VMHA 4H7MA 3VBUB 1R093 2HYXA 1CX4A 1LR5A 2JXAA 5F6KA 2QCSB 3RNSA 2W92A 1RJ8A 4IERA 4NHLA 1C5HA 1J59A 2QNKA 4TZDA 2VCBA 2Z79A 3AM2A 4XZUG 3FE5A 1O4YA 3C2UA 4YW1A 4HKLA 4D3WA 3ACGA 3MGUA 3NJXA 4RL7A 2GMEA 2HEWF 3KV4A 4M01A 4AYUA 1J1TA 4Z82A 5C9AC 4JZRA 4BDVB 1UKGA 3N7LA 4DOUA 2Z69A 2JB8A 1HB2A 3OUIA 4YVWB 3TOJA 4FO9A 5C3PA 2MHFA 4XIOA 4Z2AA 4PLOA 3DKWA 2A1XA 2VCCA 2ZAHA 3O0VA 4Y20A 4EJRA 5BNOB 1W6QA 3G6JB 2J1VA 3ZFEA 3B93A 3AKSA 5AVPA 3NJYA 5A7QA 5F37A 1ULEA 2RDQA 3OBTA 2RR12 1RUJ3 4QQOA 1J3RA 4CXXA 1DCSA 4N90A 1S0DA 4IE6A 4AFMA 2ZX1A 2YFUA 3QACA 4LHSA 4AFCA 2WFPA 1JYIA 4OFGA 4COWA 4CDWA 5C33A 1DP0A 1YQ8A 4B4PA 4FXGB 2VY0A 4NAOA 4UBGA 2VVDA 2OQ7A 5FZFA 3IZOA 1KJRA 2BGPA 4XOGA 3H9AA 2JDKA 1PGL1 1JOBA 1NLQA 4CUBA 1AJKA 1NA1A 2Y6HA 3LIHA 5IK7A 1YUDA 3H42B 4DNYA 4G4FA 1O3SA 2JDAA 2WS93 3JD73 2W47A 3J7MA 4YW3A 2D6KA 5H9RA 3V0AB 4CDXB 1LGCA 5L9BA 4LUKA 4PDWB 5KHIA 3PTRB 4QHOA 5FY4A 3AL5A 1Y3TA 1XE0A 1NXD1 1JU4A 1GWLA 1D4M3 1MQTB 3KB5A 4KNCA 4P9GA 5FPUA 3PL0A 1WMEA 4NWWA 4WM8C 1IZ3A 3GDBA 4YG3A 1WW6A 1KFXL 4YZ1A 2QDRA 2X09A 1OURA 2H6CA 1RUF1 2K2SA 3WP4A 4OUEA 3GCXA 3BKZA 1DLCA 1U12A 4IEOA 4K8FA 4XFIA 2DBNA 1PVC2 4XPVA 2ZGMA 2ZGOA 4ATFA 3WW2A 1OC1A 4QB2A 1W3XA 4Z1VA 3WDTA 2NMNA 5JIUA 1VBD2 2P6HA 2B7YA 2Q1FA 5DN2A 3OPWA 5EXOA 1VBA2 2RMU3 1RMU3 1KS5A 2N7GA 4XIKA 3E6DA 3DPRC 2CHHA 3AMMA 1Q8VA 2RG4A 1V6JA 2BW8A 5FZ3A 4EZ4A 5HBAA 1LOCA 1OT5A 3RYPA 3VV1A 1X50A 2EXJA 5KHHA 4FTSA 1RUD3 1OOPB 3T2TA 2HWF3 4RQPB 3ITQA 2Y6JA 1NT0A 2VMGA 4JCKA 4B29A 2R073 5FOBB 4EYUA 1OKOA 2XDVA 1ND2C 1DGLA 4Y24A 5DUUA 1LTEA 5LBEA 4A2UA 1ZRRA 4BYYA 4CSWA 2WR9A 1GOFA 1XE8A 1ZA4A 3I2GA 1BEV3 2A3XA 5FYVA 1H2NA 4CP9A 3U78A 4QWNA 1LB2A 1VRH3 1ZM1A 4JKLA 4V2VA 5FY1A 2XLGA 5BV6A 5DDJ3 3N4MA 2D7FA 2ZEYA 5J3UA 1QDCA 1WCSA 3O14A 5GALA 5AFEA 3V0BB 5FTTC 2GNTA 4XF9A 5J7MA 3SEEA 3WSOA 3RJRA 4CP2A 2XVLA 1PK6C 2OX0A 3OGSA 4R9CA 3OGGA 1RUC3 3WNPA 1OA4A 1AL21 1PO22 3UGGA 3WD5A 2JE9A 3BOWA 1MPXA 4RS5C 1QQP1 4DIQA 4YFZA 1XE7A 4N9HA 1J3QA 2ZHNA 4NIAA 3U4SA 1ONAA 4D6SA 4IEZA 4AZZA 4QXKA 1AR91 1OLQA 3M8LA 1H2MA 3MF9A 2PHTA 3ZYFA 2ZX3A 4AEDA 3VKFC 4E8DA 2ZZJA 1G9FA 1AXKA 4L11A 1X8MA 5E88A 4NMIA 1AR82 4NVPA 1AYN3 1I3HA 2EVXA 2PAMA 3C3VA 2Q1ZB 4UF0B 2HWC1 2DUPA 4K20A 5A7SA 5A70A 4MHUA 5J09A 2JECA 4FPCA 1ZZ9A 4W65A 1VBB1 3T1LA 1AXYA 4Q4Y3 2Z4FA 3WXPA 3ZSLA 3KCXA 5A33A 4GXLA 4LEJA 4J6GA 3WCSA 5ABJC 1I1EA 3VBSC 4QHBA 1ULFA 4IEPA 2DFBA 4AFAA 4JGZC 5FMCA 3MFAA 4O61A 2VMEA 3M2MA 1PIV1 5EP9A 1N3PA 2DF7A 1S4CA 1ZRDA 1VBC2 1W2UA 1DZRA 1M4WA 1QJY2 3BIEA 2UWAA 1NLSA 2Y0IA 4Q4W2 1V0AA 1UY3A 1EPZA 3WNKA 1XU2A 2J42A 2JE8A 1L7QA 3LDBA 3VKMA 2LUWA 5JAXA 2G9FA 3V56A 2E7AA 2RS13 3PUHA 3PUAA 3AL6A 3R4SA 3VHOA 4DRVA 1Q5OA 1BQPA 3VDAA 3FUQA 2AC1A 2VZ1A 2JIJA 2EXIA 4I3PA 2RS32 5JPMB 4UFMA 4FOVA 4R4XA 5FZ8A 3VDDA 1YO8A 5IVEA 1TG7A 2A71A 3ZN6A 1LEDA 2FDGA 1UYZA 2HWE2 1ZBE2 3ZYHA 4EQVA 5LRSA 4HFSA 2CU5A 4Q1PA 4UW4A 4LJHA 3K46A 1ZA7A 3K4DA 3OCPA 2DVAA 3IMNA 3NNGA 1ULPA 4JKKA 1RUG3 3DF0A 5J96B 4XJ9A 4A3XA 3N36A 5I0TA 3ZXLA 2AZ5A 3W5NA 3NW4A 1YIPA 5ANQA 3HN3A 1GP4A 2X29A 3OGRA 5JR7B 2R062 1UY0A 4FFFA 4CDQC 5DAQA 4XUPA 3B3QE 5IK4A 4YM2A 3WY6A 5GZGA 3IIAA 4AEJA 5ACA3 1ZREA 4AVBA 4UFJA 1US2A 1FPN1 2WSUA 2O8QA 4K8RB 3SLIA 4C8DA 1OLMA 1UZWA 3GALA 4M00A 4YZ4A 5CG8A 4LBQA 2MEV1 5FZIA 3E5XA 3AMQA 3MLJA 3N7JA 4AR2A 1XSRA 4AI1A 3R6SA 2PFWA 3W9AA 3W5MA 1W6OB 3KT1A 2ZMKA 2DCYA 2ZZQA 3R4DB 4MUVA 1LEMA 4YPJA 2ZGRA 4Q4X1 2R041 5FZOB 3LA2A 3CQOA 1IPKA 1HQWA 1AR62 4XUQA 3URFA 4BM8A 2IXKA 2AENA 5H9QA 4BK5A 1CESA 1RGSA 1LU2A 4NRMA 4OUSA 3ZSKA 1Y9MA 1HV1A 3OSDA 1N1VA 4MXWA 1ZZ8A 3LDKA 4XHBA 1VAMA 5FKCA 3T30A 1X7NA 1DG6A 1DGRN 3TYJA 3WNNA 1JYWA 3QH6A 2VW2A 3S7IA 1V9U2 2BZDA 2DVGA 3AKQA 5L9VA 2BVBA 3H3LA 3ZFGC 5FWEA 3Q8FA 1C8NA 5JI7A 5JOYA 2J1UA 1W8WA 4J1XA 1RUH3 3HJRA 4X6RB 5FJHA 2SLIA 5A7NA 1GZTA 2ZX0A 3MHZA 5A6YA 4AI8A 3MPPG 4DRRA 1XPWA 1H8VA 3Q8EA 4UBHA 1VLNA 3POIA 1XNBA 3IAPA 4Q2FA 2J1AA 4OI4A 4YM1A 4D7YA 1G8WA 4D7TA 4LTAA 1WW4A 4Y1UA 2DWRA 1TVGA 5A7PA 4CDUA 2QVSB 2RDSA 1STMA 4NPMA 1YI9A 2JG9B 3QD6A 2VZPA 1SACA 5CFDA 5JLVA 4URTA 1GMMA 1E5IA 2FCUA 5CIRA 2VTXA 3NAPB 4CP0A 1YCIA 1AJOA 1R092 2W52A 1BCXA 1GSLA 2ZTNA 4YVSB 1QXRA 5FZ7A 3MW3A 3NV4A 4EE2A 1YJKA 2QE3A 1GR3A 3ZXKA 2P17A 4Q0VA 4RN5A 1R1A3 2HWB3 2GH2A 4NWVA 5T5LA 1EPWA 4HG6B 1FYUA 3HQXA 4RHV1 2VZTA 4KWJA 3T1MA 4QPGB 1CAUB 1HRI3 4FPLA 2A6YA 1ZZ6A 4K3UA 1K12A 1VIWB 3LDRA 4IV3B 5J37A 4RFRB 5BNNC 4IEWA 3O1VA 2G9ZA 4QX3A 4YNIA 4EWAA 3OBZA 3WHTA 5EPAA 1JU3A 1W8TA 2VBPA 3ACLA 2ZS6B 4XFFA 3WF4A 3X29B 1WGPA 3R4UA 3AXEA 4DY5A 2E26A 1Z0HA 2B39A 4DS0A 3JBG1 3CDZB 2R32A 4RGGA 2ENRA 3WP3A 1RUJ2 3CEWA 4FI9A 3AJYA 3WF2A 1OA3A 1UN1A 3ZFGA 1WLTA 1QJU1 1RINA 3AYDA 1UPSA 1V70A 2ZCWA 4LA2A 1Q8QA 1EY2A 2PLV3 3UJOA 2HEYF 3M1HA 5FQ0B 3UKVA 4Q1RA 1IS4A 3BGAA 3POWA 5KXCA 1UIKA 3AP5A 3NV2A 4R8HA 3NNMA 4IV1B 2VMFA 1OFSA 1CAVA 3I3DA 1HXS3 1WBFA 1VR3A 1W2AX 3LIGA 4XFCA 5A80A 4D0QA 3KGLA 3LE0A 4JKMA 4YW2A 2EXHA 5FUIA 3UKTA 4WM7B 4GAZA 1IKPA 2ZPXA 1EAH3 1UAIA 3O12A 3QLQA 3M4FA 3FL7A 3L2YA 3E6BA 3FFZA 1WMFA 3IDCB 2WS92 4YGCA 3JD72 2YU2A 2WN3A 2FQPA 3TRSB 4Y1XA 4Y3OA 5DAVA 3VHPA 2DU0A 1OF4A 3NNFA 2FDJA 2YBSA 5JXHA 1QJEA 3LEKA 2BFUL 1D4M2 4I0WB 5EFUA 1ACCA 1CQ9A 2GC1A 4JDOA 2QZ3A 2XBO3 4QU1A 1ZZBA 2NM1A 4IW3A 3LB9A 2W46A 3RI8A 4IL7A 3J7NA 3FJSA 4IESA 2CY6A 4LO6B 4K9SA 4QGNA 3ZN4A 4OQ8A 2A73B 3E1F1 4HZFA 2BNOA 1PNFA 1QH6A 2CGOA 2WZR3 3IAQA 4TYSA 4UWDA 5K0UA 1HLCA 2CDPA 2HBUA 4AI9A 1SEFA 2QTWB 1S1AA 3KT7A 2E51A 3PJYA 2ERFA 2R30A 2NQYA 2CNAA 2VUCA 5A32A 5FDBA 1LHVA 1MEC1 3WCRA 5BNNA 3DGTA 4GMP1 2VBBA 4B4QA 2VD7A 2JE7A 3PTYA 4QQPA 1TME3 4BXFA 2B45X 1ND3B 1RUD2 2WT0A 4GIQA 1YQ6A 3RPQA 3PVNA 4P9YA 1AYM2 3ON7A 2HWF2 2Y6GA 1NCQB 1ZRFA 2W9XA 3RI9A 4AFDA 1W06A 3OPZA 1XNCA 2R072 3NV1A 2IXJA 1DYPA 2DVFA 2FCTA 3T0AA 2R0HA 4NROA 2D6NA 1BEV2 4XCBA 4AQTA 3IWZA 4GB31 3IIIA 1O3RA 3MIDA 4UFKA 1VRH2 2JDUA 2P3YA 3E5UA 4UW6A 5LB6A 3WLUA 5FMDA 1LCLA 5DDJ2 2AACA 2AREA 2BNMA 1JUHA 1SQ4A 1HX6A 1RYYA 2E33A 2G19A 2Q0AA 2TBVA 2UY8A 5IFPA 1K42A 1W9TA 3HBKA 2WSVA 4B7EA 1LAJA 5FYZA 4P9XA 1T6GC 4QM8A 1HQLA 1UX7A 2WNVB 1WLWA 1MS9A 5JOXA 5JWPA 2J22A 3ACHA 4JAAA 1HW5A 5J36A 2ZGTA 2PHRA 3MI8A 3BU0A 2ARAA 4H7LA 2C9KA 4Q4V3 1MZFA 1KD7A 2R16A 1GYKA 1RUC2 1MS8A 2XJVA 5FXZA 4LKEA 2FDIA 5JIAA 1F9KA 3MLLA 5KXBA 2XH6A 3NKTA 5F5AA 5FYSA 2QQLA 3WNOA 5DUVA 1H1IA 4MX3A 1K5MA 1W0PA 2VPVA 3HOBA 4DINB 5HV4A 3WZ1A 4P9LA 2VE1A 5FO9B 5JZGA 3P6BA 4CE8A 2DYCA 4A41A 4BCUA 3LA3A 3WDXA 1G7YA 4JGYA 3LOBA 2XKPA 1MS1A 2JDMA 4FOWA 1YQ2A 1AYN2 4GH4C 3T0DA 5FZKA 1O6UA 1SBEA 4A42A 1SPPA 4AI3A 4SBVA 4QQLA 2XJPA 1KQRA 2WZEA 3RRDA 4E8CA 4Q4Y2 4TLGA 4CEYC 3ZSEA 1MS0A 2IXCA 4A7YA 4FSJA 1C4RA 3ENRA 4LITA 2C0ZA 2IFRA 1HRV3 1C28A 1RUI2 5APAA 5EQUA 1DZTA 4Y20B 1YFWA 1W6QB 1XBFA 4CUGA 4YW5A 4L99A 1AUYA 3W59A 3BUCA 3J8F2 5L73A 4EN8B 2NN8A 3P3PA 2TUNA 1H6YA 4HKOA 1N3QA 1WCKA 2PTMA 1MVEA 4M0NA 4PIZA 4AWDA 3NJVA 3LEMA 4XC9A 4CDWB 2ARCA 1OLRA 2RS12 1YFYA 2WNOA 4Y5Z0 5M0TA 1VBC1 3P5BA 4YYOA 5FR3A 4Q4W1 1H0BA 5D1IA 3ZMOA 4JQRA 3U11A 4HVRA 4XE9A 5F6LB 2IUWA 2VMDA 4ONUA 1HJFA 3ZYPA 4ZZ8A 2D3RA 4E2SA 3A23A 5JR2A 1CAWA 4UYBA 1NA1B 4AI0A 3H8XA 5FYHA 2VGDA 1JI6A 1S0FA 4XUTA 4I02A 4GJYA 5A7WA 3ZX7A 2XL9A 5CVRA 1W39A 3I2IA 1UQXA 5FREA 2A7AA 4M4RA 1RUG2 2GC2A 1SLAA 1AX2A 3GCWA 1F31A 4FPFA 2RS31 3WG2A 4LT5A 4NJ4A 2BNNA 2DV9A 5E8AA 5FPVA 4IE5A 5C8WA 1W6NA 1JZ8A 3WQ7A 2HWE1 1TE1B 1DIWA 4M3CF 1SBDA 3HBZA 1S2KA 4IE4A 1QOTA 3MYXA 3OBRA 4A3ZA 4Q8LA 4UFIA 4M4PA 4WZFA 3DL3A 5ACA2 1BJQA 2YPJA 5FMOS 5BYNA 2HKXA 2XWBB 5IAVA 5FYMA 2YPDA 3F2ZA 5F7UA 2JDNA 1OQDA 3H1MA 4XXPA 2R061 4CA9A 1LGBA 4GH4A 3GZTB 3UGHA 2PAKA 1RHI1 3TEYA 3FX3A 4QDRA 1B35B 4KWUA 1H8TA 3THDA 4EN7B 4ZZ5A 1O91A 3VLBB 4CEYA 4FOYA 5HCFA 5E89A 4BLIA 3PIJA 5CFCA 1C3HA 1JODA 3HR9A 4Q8KA 4P5HA 4AOCA 5LK7B 3BVCA 2ID4A 5A3UA 3Q8CA 1R081 5FY7A 3SH5A 1PNGA 4PBOA 2WWSA 4HN1A 1BK1A 2ET7A 2FDHA 4TSVA 1BMV1 1YHFA 1W99A 5FIXA 2ARXA 2UYBA 4GA9A 1NQDA 5BNPC 3IDBB 1D0HA 1GZWA 1Q8PA 1URXA 2ZA9A 1CJPA 1X8EA 3JZVA 4CP9B 5FY8A 1EUTA 3RWKX 1YYNA 3MV11 3ELNA 3MW2A 4HSJA 4XF1A 4YGBA 4U36A 5LA0A 1FI2A 3OUJA 4OZXA 4K7JA 2KXLA 5LW9A 4UI9L 1EV13 4H3WA 4UW5A 4XILA 2LROA 3CNAA 5JXJA 1AR71 2QQPA 1V6KA 5IVJA 5JDBA 3B9IA 4GWIA 4CU7A 3SQOA 3NQHA 4I30A 2O8OA 1KDKA 2Z42A 1UNBA 2D44A 5CNAA 4MYEA 5BPXA 1X36A 4WV8A 5C8CC 1OQEA 3PNAA 3DYOA 1C1FA 4HLTA 5A3WA 4B4RA 4P9WA 3VD9A 3BI3A 4W6YA 5GZDA 1TNRA 2WNUC 3RZZA 4CCMA 1OSGA 4ASKA 2C9AA 1DQ4A 5T5OA 3EYPA 4PLNA 3OD4A 2ZABA 1GWKA 2W39A 4HN0A 4KGQA 3B01A 1G86A 2VNVA 3C7GA 1BBT3 1J83A 4KQ7A 2Q8EA 4BQ5A 2R1DA 1SCRA 3O1TA 4LBKA 4AEDB 1ENRA 3I3BA 4N7UA 4E9KA 1PM7A 4XF4A 5FPAA 1LRHA 1R1A2 2HWB2 4OHVA 4MG2A 2XQRA 2OT7A 3ZDSA 2A6XA 3VZMA 3VZNA 1JOJA 2VMCA 1UZZA 4QB1A 3R05A 1ZRCA 3ATGA 2YGLA 1HRI2 5F3IA 3AYEA 5F32A 3WW3A 4CCEA 5C4WC 2R7EB 2VZUA 5A33B 1C8M3 1JHNA 2BWCA 1LHUA 3TWIA 2XJSA 4L9BA 3TN91 1I9RA 4XVHA 4HXCA 5L7OA 1JYNA 1COV2 4CYDA 2MPFA 2VG9A 2X5IA 2YZ4A 1RUE1 4XUOA 1RXFA 4LOSA 2JG8C 1HN1A 1WKYA 5JZGC 1LHNA 3TBDA 3THCA 4Y26A 4HETA 3CJIC 4XJUA 5FYIA 4AXOA 3KF5A 1H1MA 2XVGA 4L97A 4Y1VA 4ZS3A 2ZEXA 4K6BA 2PLV2 1YQCA 3K51A 3ZFFB 3SNMA 5A1FA 4RR3C 2W0XA 3USUB 1WW7A 1W9FA 1O59A 3PDQA 3EBRA 4PIYA 1JW6A 2B4KA 4AVSA 1MS5A 2RM21 2UYAA 4QX7A 3KF3A 3WDVA 1FNYA 1UZVA 3CBNA 1XJAA 4N43A 3TNPB 3VDDB 4O9EA 5HXMA 3ZN6B 1EAH2 4NPLA 2VTFA 2W68A 3VBOC 4PT6A 3T2PA 5GLZA 2D43A 4GZ9A 3JQWA 2WNUA 3UV9A 1NOVA 1EYBA 1VAKA 3Q8AA 3DXTA 3KD4A 2DCKA 1JYTA 2RS52 4COUA 3WV6A 4QDSA 4CUCA 4JQTA 2XBO2 2E53A 5CKNA 5B4XA 1ASJ1 1ODMA 4ES9A 1V6NA 4QPIA 3WDYA 3VDBA 5D21A 1LOFA 1QKQA 4XMIA 3IDEA 4BLJA 1GNZA 1BLZA 1GFF2 3UNPA 2VOWA 1IQAA 1SDDB 3MIBA 4QGMA 5GLWA 5T5JA 3WQBA 4LBQB 4EWEA 3N7KA 4WBBA 3DUIA 4DY3A 1T6BX 1OKQA 5F39A 5JXIA 3AJZA 5JOZA 2JDYA 3J4UH 4AVVA 1FOD1 2WFF1 2Y0OA 5IUQA 5DAXA 1NUKA 1A8DA 1PO11 2BRTA 4GWJA 4CTEA 3AZXA 3OGJA 4BH9A 1SLBA 3AB0A 1TME2 2HLEA 1WMDA 3CO2A 4JHTA 5FLIA 5F5IA 4PI2A 4HVQA 2SBAA 4ORFA 2VCMA 3O1PA 1HDKA 4B3NA 4FP3A 4FAHA 1UU5A 5C9AA 3NKGA 2JG8A 5I93A 4INDA 3O1OA 1W2OA 2VVFA 1QGLA 3CU7A 2RE9A 3HEIA 1WUVA 1RUF3 2QQKA 4PI0A 2LALA 1UOFA 4FPHA 4DMIA 1JZ3A 3AKTA 1AYM1 4L8QA 4QPWA 3D8CA 4A45A 4QXHA 4MGYE 3GBWA 2GAUA 4RR3A 4XBLA 4AFBA 2W1QA 3ETQA 4XBQA 1CAXA 5LBFA 1UY2A 3H3UA 1ENQA 1CZTA 3APBA 3VBUC 3IMMA 1G9AA 3U37A 1W2NA 1LHWA 5A3PA 4HMZA 4CP1A 3VBHC 1W03A 4ZHNA 3CJXA 1GLHA 1N1YA 3D0JA 2VNRA 4XAAA 2OPKA 5A6QA 5LRRA 4CDUB 4M3CA 4Q4V2 2HWD1 4G9SB 4B7KA 5CFDB 1REFA 1QWRA 1W8HA 2DUQA 4P08A 1CPMA 3LFIA 4Q0PA 1RXGA 3LGRA 4DFSA 5AFBA 3M3IA 1IS5A 1UOBA 5IT6A 4S2HA 3OD0A 1QU0A 3SCGA 1OD5A 4YVWC 4YRDA 1WLDA 2GMPA 4LBJA 4WM8A 1KS4A 5I8SA 1W8OA 3B94A 4YG0A 5BNOC 5J48A 5F8PA 2OZJA 1TMF1 1PX3A 5FLJA 1Z78A 4OMCA 4QKFA 1OQ1A 2RV9A 1L7LA 4UFHA 4AG4A 1I5ZA 1PGW1 2F4LA 5A6XA 5AC92 1SLTA 2WYFA 1C57A 2Q5TA 2FCVA 3TEWA 4OI2A 1VMFA 5EZWA 5ERLA 3CF6E 2ZACA 3O1RA 3MUZ1 1AL23 1G9DA 4O7XA 2ADEA 3DPRA 1DHKB 1QQP3 1HRV2 2VQUA 3OBAA 1XB9A 2A3YA 4RSUA 2YC4A 5CB7A 3FHIB 2E6VA 3N9PA 1TQ5A 4GQ7A 4QX8A 4CRQA 1CX1A 4Y4YA 1LECA 3O0WA 5CYYA 3RS6A 2V4AA 1AR93 1JYCA 4FPJA 4E2GA 2ET1A 3IPVA 4OI0A 3JCIA 4CDXC 2WINB 1OUSA 2VH9A 2WNEA 4NRPA 3FBMA 4PDWC 1I5PA 1RUI1 1W6PB 4BIFA 2DBIA 2YBPA 1ND2A 2ZX2A 4QB6A 4XAEA 5FK8A 3TNQA 4ZKTB 3E6CC 3LPGA 3AYCA 3VBUA 3ZLIA 3M70A 5CISA 3RZHA 5DABA 3J8F1 2QQJA 1CAVB 3ORJA 3QCWA 3VBHA 2BERA 3GHNA 1KITA 2HWC3 1FMD1 2XHNA 1NY72 4IGQA 3WF1A 1AF9A 5KR7A 2Y60A 1VBB3 1SZBA 2CGNA 3IDAA 5HV0A 5K4LA 2CGPA 2ZKLA 2FZ2A 1Y7BA 3FHAA 4I2OA 4XZPA 4D94A 4UT5A 4DXTA 2X10A 2ZGSA 3N7MA 4U2AA 3SC7X 2V72A 1QJX1 3NRUA 4HPKB 3KHBA 5H9PA 2ZGPA 1PIV3 1PK6A 2A6WA 3DCQA 2FZ1A 5JI9A 2R49A 3I2KA 2JDZA 2NLRA 2W94A 4ISQA 1ODNA 2D6PA 4DUXA 4RS5A 1O5UA 3DECA 1HIXA 3VZKA 2IZWA 2F17A 4K1ZA 2K46A 4YW7A 4LPLA 4LOTA 1OOPC 3INAA 4CPBD 4DUVA 3AMNA 4RQPC 2YFZA 4CU8A 3RDIA 4YGDA 5K0UB 5KC5A 1XSQA 4JV4A 3VD5A 5I0SA 1CGPA 3BTXA 1BYHA 4XFAA 3MFCA 3HPNA 2DFCA 4Q0UA 4WZCA 3WP6A 5DG2A 3RZLA 5A32B 4AHYA 3D6EA 4UOJA 1WMXA 3PHMA 4HSLA 2VOXA 2FDKA 2GP3A 2VQAA 4Q29A 2P2KA 1CIWA 4WVMA 3O1UA 1DDLA 1DQ6A 4JRLA 3BALA 5HXVA 2CWSA 2PMWB 1XYPA 1Z7S2 3VB9A 2TNFA 2V4VA 2W87A 1W2TA 4RA0A 3GBGA 4AAPA 5G04L 4CCNA 1O4ZA 3T0BA 1LGNA 2ES3A 4H2AA 4AQ6A 5ABJA 2YBKA 3UL2A 1W3VA 3VBSA 1CD3G 3SH3A 3E5QA 4JGZA 1OH4A 1AX0A 4YG6A 1S0GA 1NCRC 2Y33A 1ZYBA 2AYHA 1FPN3 4MADA 4AVAA 1RVF1 1UXZA 1NZCA 3FUOA 1K45A 1QXPA 4FCAA 4IXLA 4TTGA 2MEV3 4OHZA 4R9BA 1Y43B 1DQ2A 2J1TA 4COZA 2RHPA 5FOJB 1EV12 2UU8A 3AYAA 1BXHA 4LE3A 2PHLA 1ZBA1 1V6OA 3KZ4C 4E2QA 5HCBA 2BV4A 2B46X 3AZVA 4FTBA 3KV5A 2NPIA 2YV8A 4Q4X3 3NVCA 3VBFC 2P4EA 2R043 4MZUA 3HN1A 1D2SA 2EALA 4JDMA 1ST8A 1ZRIA 2XLFA 4QX0A 3T2OA 4UXAA 2VOVA 3SISA 3N9NA 2XKOA 1FXZA 3OPTA 2GMMA 2D6OX 2EAKA 3E97A 2YXSA 2WLQA 4FXKB 4ISRA 4V1PA 1UIJA 2LRPA 3KVAA 2J1SA 5FMBA 4PF5A 1RITA 4IEQA 1JZ4A 2XB6C 3ILFA 3THPA 3UESA 3UETA 5LA1A 1K5MB 2DUOA 1BBT2 4MVTA 2X05A 5IFTA 4GD4A 2IXLA 5IYYA 5JUVA 4FTEA 1VBE1 4JC1A 5F1RA 5JZGB 4UFLA 3ZXEA 1GOHA 4XCAA 4JGYB 4CDQA 2OPWA 4AQSA 4A4AA 2P34A 4XQWA 2YGMA 2QDNA 1UO9A 1W28A 3WF3A 1SPPB 2ETEA 2QZ2A 3KM5A 4DZGA 2VR4A 4AGVA 3VL8A 4WVZA 2ORXA 5CU1A 1C8M2 4DXSA 3T3YA 5IVFA 5GLVA 5FPLA 4D6QA 4Y22A 5C5TA 3LD8A 4Y33A 4FPGA 4RGAA 4GWNA 5D8AB 5JXGA 1W0OA 1KDMA 2WO2A 3BPZA 4DB5A 1PMHX 3RJ2X 4K40A 1NCRA 3HT1A 1YC61 1MR5A 3A21A 4PJYA 5F9TA 4KI5M 1COV1 1H1AA 2P3KA 2QQIA 4TXWA 3RG0A 3GGLA 4O9GA 4Z07A 4X8PA 4Q0SA 3BCWA 3O0XA 1JZ6A 5FZGA 3W58A 1CWPA 4CUAA 2ZHLA 3GXUA 4RHV3 4D6RA 1BVVA 5C70A 5LEJA 2VULA 4AHZA 3NNLA 1U5XA 3ALQA 2QQMA 3VBFA 3WW1A 2FDFA 3DYMA 3CLPA 1CAWB 1WA4A 3K75B 1SG3A 4NHMA 1SLLA 3FHQA 4FQZA 4ZU7A 4ZU4A 1JUIA 2B8MA 4PQ9A 3VKOA 2RR11 1NZIA 4ZXEA 4UF0A 3VD7A 1SFPA 3O1SA 2XHKA 4META 4IDZA 1DQ1A 2L9LA 1W6NB 2D5FA 3JBG3 3RZMA 3RYKA 5FBJA 1UZ0A 3J7HA 4D7SA 1SHWB 4LIUA 5EIYB 4NIHA 4BMBA 1QJU3 3I2JA 4BE3A 3I3EA 4IETA 1NG0A 2RS51 3VN4A 4GALA 4GKXA 1V6MA 3POEA 1OFNA 3KSCA 1ALYA 2W2IA 2D6MA 4LHLA 1ZZCA 5FZ1A 4YM3A 1JYVA 3OJBA 5D2AA 1PGL2 4Z92B 2V73A 4XTMA 1H8TB 1WA6X 4AGRA 1RTVA 1H2KA 4NUBA 4KL1A 3I54A 5FZ4A 1W6MA 5CFCB 3U10A 4KG8A 4YZ5A 1HQNA 1QHDA 1RJ7A 2WL1A 5FYCA 2RMU2 2OYZA 1RMU2 1JZ7A 4XABA 2Y38A 3I59A 3ZXGA 1SBFA 3ZYRA 1ENSA 1PVC1 2VUJA 4ZY9A 1Q43A 1YFUA 2E31A 5F5QA 1D0GA 2PN5A 3D3AA 5GZFA 1X9TA 1RUF2 1GZWB 1HB4A 2QKDA 1MZ5A 1VBD1 2XOMA 4C1WA 1VMJA 2PQQA 2PHUA 2PHXA 1VBA1 2OXBA 2A70A 2JG9C 2W3JA 3PMEA 4XTPA 5IAXA 3RWNA 1U5IA 4FPYA 2Y64A 3NAPC 4GWMA 3M7AA 4MGQA 4OULA 1E5RA 2ZX4A 3WP5A 3LSEA 4YVSC 3G7DA 2ZKNA 4Q0QA 1MEC3 2DURA 2QUOA 2XG3A 4J1WA 5G05L 4KU8A 4GMP3 2ZGKA 3PURA 4OUMA 3V64A 2B9VA 1UYXA 4BU2A 2Q8OA 4XJAA 4GMP0 5BXXA 1UF2C 1IS6A 5FLHA 3ZOIA 5FY5A 1RIRA 2DCTA 5FJKA 1FAYA 1UX6A 4LKFA 1DZQA 3ST7A 3N9QA 4QPGC 1VB2A 2BYVE 1R64A 4LXLA 4P9IA 5FZOA 4MH0E 2XUMA 4XJ8A 1IKQA 3D82A 4IV3C 1OA2A 1XQNA 3EXUA 1RUOA 3LPFA 1WZXA 4LBMA 4LNVA 4GB33 2Z5WA 3SXWA 4CCJA 1REEA 3ZXAC 1L3JA 2Y6LA 3TEZA 2LTNA 3VGIA 3I2OA 1FT9A 4QQ2A 2E7QA 4XETA 3UKNA 3VHNA 5IVBA 2LS6A 2Y34A 3I7DA 2P3JA 3EO6A 1YI7A 4BISA 4J25A 3WQ0A 1PO21 3UYJA 3WW4A 4BQXA 4FPOB 3OYWA 2BEOA 1OMIA 4LMFA 1QF3A 1MVQA 4RD7A 5FXVA 3EQEA 1AX1A 1AVBA 1REDA 1W9SA 2JDPA 3FC0A 3HNYM 5LY2A 1UU6A 1AL22 3LF7A 3DV8A 5L7OB 1ZNPA 1W8NA 3H1WA 4IV1C 1QQP2 4ZONA 2BJSA 2X5IB 3BIWE 1UOJA 4HBNA 2IVJA 3J9SA 2GSYA 5AC91 5H9SA 3BB6A 2GDFA 4AQ2A 1JN2P 3ETPA 5K9YA 1UCXA 3OEAA 1AR81 4BQ1A 2VUAA 2QQNA 1LOAA 1JH5A 2RJ2A 2ZXQA 1C5IA 5B4NA 3H8RA 1YWKA 4ATEA 1K3IA 3ZFEB 5FP9A 1W04A 3H3ZA 3RZKA 4W6XA 2VQ0A 2IWGB 1RUNA 2VTXJ 3NWKA 2ILMA 2ZGQA 1POV1 2DTWA 2HWC2 5IK5A 1A78A 4N43B 3CZJA 2NP0A 3MO4A 1VBB2 1CZSA 1WCUA 1SLIA 4QXCA 3TB0A 1Y9GA 2VJXA 3R0RA 1H2LA 1X82A 1SDWA 3DKQA 2HH9A 4I09A 2ZMNA 1FNZA 2VOTA 1QJY1 4F7ZA 1RC6A 3VHRA 1YRZA 2WNUB 1AHSA 1M06G 2Y6FA 4QU2A 4QPGA 3WVJA 3HVDA 3MIHA 3ZPYA 3C8XA 3D0SA 5CBLA 4QGLA 2Q8CA 5FO8B 1PIV2 4R52A 1KJLA 2DVBA 1JMUB 5LASA 4F3JA 2X53S 2OUJA 5FBZA 2H0VA 5FYBA 4PBPA 3ZYJB 3K4ZA 4QPIB 2VXRA 2PQSA 4MGZE 4AGGA 2DCZA 1DLLA 1XU1A 4TWTA 3SEPA 3ZPOA 3FMGA 1NCQC 2CL2A 1HV0A 2YMZA 3WNLA 1R1ZA 4EWDA 1VBC3 1ZBE1 3CHXA 3OEBA 5F2WA 3GYDA 4Q4W3 1GKBA 5FZLA 2BTVC 1W05A 1Q56A 2ZHKA 1N1SA 5JOWA 5J1XA 1W8UA 2OUHA 2QJVA 4NHYA 3WUCA 2WN2A 2A6VA 1T2XA 1MZ6A 1OVSA 2UURA 4N9IA 1JHJA 3I8TA 5LCWL 4BIOA 3QH7A 1VMHA 2O14A 2PYTA 3ZSMA 4IV1A 5FPXA 1QNYA 4LLOA 1IS3A 4IE0A 3AXDA 2EIEA 1SMVA 2RS33 3OTFA 4BHPA 3RYRA 4AVTA 5C9AB 4XYXA 4X8NA 5T50A 2OA2A 2HWE3 3VD4A 3KWVA 3A4UA 5GLUA 2WA3A 4Y5TA 1KFUL 1SFNA 4PIXA 5ISLA 2AUYA 3PUSA 3PIGA 2GNDA 2TEPA 1Z7S1 1FPN2 3AMPA 4LLFA 2Y8KA 5CKQA 3OG2A 5FZAA 3T4HB 2MEV2 2R063 1CAXB 3ROUA 4NPRA 3KQ4B 1AR61 4FVVA 1DYKA 1RHI3 3BTAA 1LODA 2RJLA 3TEXA 3A7QA 1DBNA 4I0AA 4Q4X2 1OUXA 2R042 3WT3A 1DGRA 5IATA 5T3NA 3AZZA 2MNGA 1RUH2 4YM0A 2R1BA 4Y5SA 5FYYA 2D40A 4M3CB 2PHFA 2YY1A 1R083 4KG0A 4BOWA 3ME2A 5B2GB 3BU7A 1V9U1 5A3MA 1UMHA 4MGTA 1DGWX 2QQUA 3KCYA 4ZPIA 2NYYA 3O7OA 4XQ4A 2JWPA 1O5LA 5EJ3A 4KWKA 4CCCA 3HIFA 4HL0A 2JKXA 2FMYA 2VO5A 1F2NA 4LO5B 4LO7A 1OXCA 1UY4A 1X9PA 2AR6A 1XRUA 5FMOL 4WM8B 4LHNA 4FP2A 4P14A 4S2GA 2XLAA 4XF3A 3A0KA 3DXUA 5GZCA 1AR73 3B69A 1QJFA 2O0OA 3IN9A 3CZUA 3IKWA 4AAXA 2HYKA 3ASIA 3KT4A 2WYSA 3FLTA 2B5HA 1A3KA 4NN0A 1S0BA 4NIIA 1CONA 3VZOA 1CJDA 1NYWA 4AF9A 4HONA 2A6ZA 2G4IA 1U0AA 2JEMA 1O8PA 5FZCA 5SV5A 4A6SA 1R091 2GC3A 3DPRB 1UMZA 1W8ZA 3WG1A 3T2QA 2AH2A 4LQRA 1C1LA 4KU7A 2YC0A 1B09A 4CVUA 1LESA 5E16A 5C71A 3AKRA 2XJTA 4PHZA 3M3CA 4IEVA 5CAZA 2GNBA 4N7IA 3S7EA 1UWWA 2WT1A 4LO8A 1NX9A 1ND2B 2WBKA 1IPJA 3OY8A 5BNPA 4N53C 1XNDA 1QEXA 3BYWA 3WX5A 4XFHA 4ZXKA 3LWCA 5DZGA 4IEXA 3I2HA 4RHV2 3MV01 3VBHB 1VRBA 2WWUA 3ZXFA 4F83A 3JB8A 5TSWA 2YDEA 2BPA2 3NL1A 3V65A 4H14A 4WVVA 4LE4A 4IUGA 3OOXA 1XNAA 2C6SA 3TN93 2W5FA 4PQQA 2C24A 1RUJ1 4FAGA 1HXS2 4BQ4A 4AI2A 1TEIA 3U14A 3NMBA 4ARYA 1B35C 1KXGA 1RUE3 3H7JA 2GZWA 4QPYA 3N3HA 3OGVA 3POGA 1PK6B 5C8CA 3JBG2 2K9ZA 3IBMA 3KV6A 3ZO0B 3AK0A 4BJ0A 2OW4A 4RS5B 2GN3A 3PMSA 4XDPA 4ASMB 1QJU2 4BMEA 1CVNA 1YNAA 2VL4A 3POJA 4YZ2A 4EV0A 1GZCA 3LCPA 3A0NA 4KBBA 4OVEA 2Y6KA 5HI0A 5I91A 3HQUA 2WS91 2Q8DA 3JD71 3PUQA 3LQCA 5E6HA 3ABZA 4CEWC 5F3GA 2RM23 2IVIB 3WR0A 1D4M1 2CAVA 2WZR2 5CZKA 3U07A 3GBFA 3MDPA 3VZLA 3LFMA 1GP5A 4JX0A 5LWBA 4WVMB 2BGCA 2G9GA 2H0BA 2C5DA 2GN7A 3H8OA 4FOQA 2IXIA 4OHXA 5C4WA 5F2SA 1A8MA 3FFQA 4MSVA 1HKDA 3U75A 3WG4A 5ABJB 3VBSB 4QM9A 1ASJ3 5K7PA 4NIDA 2XVKA 4JGZB 5C3OA 1QH7A 3HWJA 2EAAA 1GQHA 3GZUC 2RMU1 1RMU1 1JTZX 1LOEA 3J26N 2BP6A 4D8MA 4W6WA 1QMJA 5KHJA 4EN9B 4N53A 3WDUA 2BUKA 4YSFA 2B9UA 4LUMA 2OVUA 4AE2A 2WT2A 3CJIA 4MXWB 5F3EA 1LU1A 2YHJA 3H50A 3SH4A 4C0BA 1US3A 3CL1A 3KHCA 2OZ6A 2WABA 3ACIA 4E27A 1FOD3 1RUD1 2WFF3 1QNWA 3I97A 2DDUA 1OBNA 2HWF1 1MEC2 4QKBA 1P8JA 1VP6A 1PO13 2W1WA 3VBRC 5FWJA 2R071 3JU9A 4AEDC 3PU3A 2JENA 2XL7A 5FP4A 2FD8A 1LOGA 2VC9A 2R6QA 2WIIB 4NHXA 2D93A 4QKNA 2VCAA 4AW7A 1B35A 1BEV1 4XW3A 2XJRA 2YB7A 2WUHA 2WLPA 5DG1A 2D97A 1VRH1 3IM0A 1O3TA 1NXMA 1S2BA 3P3NA 5DDJ1 3VBOA 3C7HA 3MUY1 1YJLA 2W1UA 1OPOA 4BK4A 3ZXDA 2XQXA 3AFGA 1ULGA 1ENXA 3GNEA 4GB32 4HKWA 1AYM3 1JZ5A 3SKVA 3WNXA 1CR7A 5C5UA 4Q5OA 4CDQB 1GANA 1SLCA 1V6LA 1WCDJ 3K4AA 5FO7B 4CEWA 1GBGA 5LZ6A 2UWCA 1RUC1 3HAGA 1F4HA 3MBWA 2VBDA 5KHGA 4OHWA 4HVOA 2Q30A 4TLFA 3OB8A 4NIGA 3ZFFC 5T5PA 5DZFA 3ZXJA 2HWD3 4Y22B 1IG3A 4P5YA 4XBNA 1ZVFA 5FZBA 1O3QA 5FPZA 4IQPA 4EN0A 3KVBA 3VDDC 2GC0A 2WWJA 3AZWA 4JHZA 5LBBA 5FAXA 3AKPA 2IXHA 1AYN1 3FLPA 1NCRB 1OPMA 3LSDA 1IG0A 4XACA 1HB3A 4P00B 3HQRA 2BOJA 1QJZA 4HOOA 1BK0A 1PHMA 2W91A 4RYDA 2ARBA 2ATFA 2ZMLA 4XJZA 5T52A 2BGOA 4Q4Y1 4COYA 2GU9A 1TMF3 2ZOEB 4F8AA 3H7YA 2QQWA 2RDNA 3EJKA 3RQ0A 3ES1A 5FPBA 4I01A 3ZFGB 3VBFB 3VBRA 2EIGA 3MIFA 3T08A 1GV9A 5KWRA 4EZHA 1MQTC 3NNJA 5FY9A 2Z2SB 3HT2A 1D7PM 2D3SA 4CCLA 4CU9A 1LNSA 1O4TA 4XJWA 2WA4A 4AEMA 4XURA 3LOIA 5CADA 4DXRA 2ADDA 4NOTA 2P6CA 4B8EA 1PZ9A 2VZVA 1S0JA 1QXJA 3VKLA 1XNTA 1BKZA 2CWMA 1RL3A 3N9LA 4IGOA 1D4VB 3RSJA 5IHRA 1DF0A 2RS11 3NJZA 3PVBB 4XUNA 2PAEA 3WOGA 4LBQD 3WNMA 4B1LA 2KD7A 2VNOA 3LEGA 4H55A 3BODA 1RUI3 4Z8BA 4AK3A 3AFKA 4LK6A 1GNHA 5FP8A 4HANA 4GULA 5FCCA 4QMAA 3NO8A 1UOGA 4MO3M 2CV6A 3J8F3 5HCHA 4E4DX 4YVWA 2WZ8A 2ZJCA 5I0RA 1Q8SA 3DN7A 1RUG1 3IB3A 5A7OA 1J58A 1FMD3 1DQ0A 1Y4WA 4C91A 5GKAC 1IQDC 2P3IA 4UAPA 5BNOA 3MLKA 4QAWA 3ZFFA 4E4ZA 1W6MB 3KV9A 3MIGA 4Q26A 5T55A 4NRQA 3USUA 3WINE 1UU4A 1VALA 2YYOA 4WVWA 1OI6A 4BXSV 4M0HA 1UYPA 4FBFA 5ACA1 1QOOA 4C90A 1QJX3 3BTZA 4Z2WA 3A22A 2YUEA 1DQ5A 1W0NA 5BY5A 3I59B 4FPKA 1F5JA 5BNNB 2WQ8A 1KGYA 1NLRA 2JIGA 2JJ6A 3TAYA 3ZMNA 1BHGA 4BQWA 3SMHA 2I2SA 5DUWA 4CDUC 3L2HA 2PA7A 4E4SA 3HNMA 2DVDA 1E57A 3OUHA 2KR2A 4C1XA 1D2QA 3FBYA 5CFDC 1YIFA 4C0HA 5BNQA 3N35A 2JX9A 4LR4A 4CZSA 2G1MA 3K3NA 3LA7A 3F95A 4URAA 2WO1A 1DYOA 1ZX5A 2VZQA 5FV3A 3V0AA 4CDXA 2VW0A 4YLZA 3VKNA 5FYTA 1RHI2 4PDWA 2UWBA 4MGSA 1POQA 3VUOA 2J1RA 1MQTA 4BWOA 5A3LA 1AL0G 5LBCA 3ZSJA 4CU6A 3S5AA 4LKDA 1UKRA 3FLRA 3L9JT 4FQ4A 1EP0A 3EB7A 2FBEA 3RZJA 1JZ2A 2YC2A 1R082 3RVHA 2XMLA 5ANNA 2BQPA 3ILNA 5EYYA 3D5OA 2VZ3A 1BMV2 3ZYBA 3KGZA 4NE9A 5IW0A 2P5BA 1YXWA 2W1SA 3KS7A 3MF6A 2I07B 2WZPP 3VD3A 1N1TA 3U1XA 4P9JA 4IEUA 1JYXA 1Q3EA 1RUH1 2RDRA 3GZAA 3PU8A 2NMOA 4K21A 4Y1YA 5EWSA 2W08A 3T4VA 3W20A 3NV3A 5E1RA 2D6LX 4CPBA 5JMOA 1AZDA 1RVF3 3BOPA 4FPEA 4AEKA 5LY1A 5C3QA 1GQGA 3POBA 5DUXA 1H4HA 2YG0A 5KXEA 1A34A 1AR72 1CPNA 2ZBJA 1FV3A 3VDCA 1LJ7A 1ZBA3 5FP7A 4BB3A 1S0CA 4LA3A 1OOPA 5DMYA 4XDQA 4RQPA 2I45A 1O8SA 3OYWB 3S57A 4NO4A 3AC0A 4OZOA 5T54A 1J1LA 2QFEA 2BOIA 2HEVF 2BWAA 4AL9A 5C7GA 5L19A 4XMAA 3ZYGA 3GJAA 4MOAA 3I3QA 4QX5A 4P02B 4LKSA 1HJGA 4DPNA 2E63A 5F3CA 5KBFA 4KH9A 2DCJA 2UY9A 4L2NA 3B00A 2GP5A 2CTVA 1F5FA 1WD4A 2CSGA 1OHFA 1PZ7A 1R1A1 2HWB1 2JD4A 5HPOA 1UPIA 5GLTA 3T09A 3V0BA 4D69A 1IHMA 4YGEA 1WD3A 3D4KA 2C4XA 2Q1MA 4ITCA 1VBE3 5FRAA 2XPJA 3SCHA 1HRI1 2I74A 5JSPA 1CZVA 3KCCA 2WRAA 3LZZA 4PLMA 5BNPB 4MGIE 3ZIWA 4I3GA 3ZKUA 5DAPA 3C7FA 4BQ2A 1F15A 2OS2A 4JDNA 2VZOA 2BFUS 2W95A 1GZ9A 1MACA 4Y4RA 4TN7A 1NQJA 2XWJB 1H4GA 2EXKA 3FN9A 1F35A 3UK9A 2ZGUA 3BPSA 4XFGA 4OMDA 5EJ1B 3PLQA 1CN1A 3TN92 4LHKA 4LORA 5K0UC 4CCDA 4XQDA 1W90A 1WBLA 3WDWA 1UL9A 3VZJA 2VM9A 1OF3A 1RUE2 3M3QA 4NAMA 2PLV1 5DAWA 2GNMA 1V00A 5IVVA 5A7WB 2J1EA 3POSA 4IEYA 2VOKA 3WF0A 3USSA 2WDBA 3AMHA 1COV3 2EIDA 1HXS1 1NE4A 2V5DA 1K5JA 3HD8B 2AGSA 3POFA 4JRAA 4GJZA 1EAH1 3H0OA 4R9AA 4BZ4A 3ZM8A 1JXNA 1PMJX 3PUIA 5FUNA 3J7LA 2PHWA 4JTNA 5JSOA 5I8TA 2RM22 2FMDA 4R9DA 1DU3D 3GJBA 1W6PA 1N3OA 2VZSA 3SITA 5A6ZA 3KQRA 2XBO1 2XUEA 3KLSA 5JCTA 2QBXA 1YLLA 3I49A 4GH4B 2RR13 4GKYA 5I0UA 5FZ9A 5DPNA 3I4IA 3IT8A 2A3WA 1ULOA 2XJUA 5IK8A 1YEWA 5JSRA 3JB4C 4CEYB 1H6XA 3CMGA 4QXBA 5FUPA 2WZR1 5IVYA 1OH3A 2V09A 4S2DA 4LBLA 4YFWA 4LIVA 4QDQA 1ASJ2 3GF6A 5GZEA 3AVRA 1PGSA 3VL9A 5A1AA 3ACFA 4KWLA 3ZN5A 2H6BA 4PF1A 4HPKA 1XYOA 2RS53 2PXJA 1VE0A 3EMRA 5JVVA 1ZZ7A 3EHKA 5FZMA 4OI1A 3ES4A 3B9CA 3PVOA 4XEZA 4JVAA 5EHDA 4ZU5A 5LEKA 1UY1A 1TME1 2P37A 5I0DA 1FOD2 5AVAA 2WFF2 2PELA 1K5MC 4QX1A 4W8JA 3UGFA 2OKXA 1FV2A 1VAVA 2XGXA 1PO12 1SFYA
chains in the Genus database with same CATH topology
4DXZA 3NSTA 3O5SA 1FATA 4JGYC 2E7TA 5BUVA 2PHDA 1VB4A 4NR1A 2VVEA 5HCAA 1PVC3 4AHWA 5CG9A 4FT8A 4R4ZA 1VBD3 4DQAA 3B5LB 1VBA3 3JQXA 1W6OA 3H8UA 1DGWA 3B02A 2HJIA 5D8AC 5CA6A 4Q4V1 3AP9A 3B7MA 5FFOC 1BVP1 1TNFA 1QOSA 2C1FA 2V5YA 2IC1A 2A5ZA 2X8KA 5L36A 3MIEA 4LBOA 3K48A 4PCRA 1MS4A 1XXNA 3AP4A 1H9PA 1IOAA 3I2DA 2HWD2 5I8YA 2BBVA 4BPZA 4LULA 4L92A 1APNA 4NHKA 4ES8A 4BA6A 2ZGLA 2VMIA 3MEPA 5SV8A 4QD2A 4QQHA 4HK9A 1ULCA 2ZGNA 3KMHA 3S30A 4Y1ZA 2OIIA 1U5YA 5JPNB 2WJSA 3S0MA 3M3OA 4S2FA 1UW8A 4HT1T 2WKKA 2B42B 2WQZC 3OY8B 4WM7C 4X6QB 5BNPB 1ULDA 1TMF2 1AR92 2JG9A 1PO23 1S0EA 3LKJA 3POYA 1HRV1 1PGW2 3NAPA 3ILRA 2FHRA 1Y9QA 2YROA 3Q9OA 1A6CA 4YVSA 3HMYA 1V6IA 2VNGA 3AP6A 1N47A 3WUDA 1XYNA 1H8TC 4HK8A 4A7ZA 3U0ZA 1J3PA 5AC93 5C8CB 2F6BA 4SLIA 4K1YA 5CFCC 3S6PA 1AR83 4JTOA 2DU1A 1LULA 4EROA 1H9WA 1WW5A 1Q8OA 2ZAAA 1UZYA 1CAUA 1NY71 2NZ9A 3ZIXA 4MXVA 4M3CE 2O1QA 2BVVA 4IV3A 5D8AA 2Q4SA 4I0BA 4MV2A 2D5HA 4YARA 3U4XA 1H30A 4XF0A 1POV3 1FMD2 1ND3C 2KA3A 3OF1A 1POV0 1YFXA 1JBCA 1PZ8A 2Y26A 3AZYA 1QJY3 4COVA 4Q27A 3GHMA 5KC6A 2XJQA 1QJX2 3MZHA 1S0IA 5C4WB 4OLLA 4QT6A 2KM2A 4RFT0 5FQ0A 4YZ3A 1G9CA 1X33A 3UJQA 2IFWA 4XFBA 5DXDA 3ZYIB 3ECQA 5DZEA 4KGGA 2LM3A 2K0GA 5K8SA 4XXAA 2WNVC 4WM7A 3MPBA 2JG8B 4N53B 3JUUA 1ZBE3 3FZ3A 1F8VA 3CJIB 1G9BA 2CAUA 2A75A 1IGOA 2VECA 2D98A 3M3EA 1RB8G 4MGKE 1I6XA 4G3YC 3MW4A 1XNKA 1VJ2A 3RMXA 1PVXA 4RR3B 2GALA 3WQ1A 1WLCA 1LENA 1FX5A 1GICA 4OHYA 4ASLA 4AVCA 3WG3A 1PMIA 3VBOB 5KXDA 1EV11 3PJQA 3LAGA 5GJ6A 5L7OC 1S55A 5EYXA 1Z7S3 2WQ4A 1RVF2 2RJKA 1MZEA 3SCFA 2X5IC 1G6NA 1AXZA 4EN6B 1AR63 2DTYA 1LOBA 4CEWB 3PVEA 5KHKA 1ND3A 1ZBA2 3THTA 4YW4A 1U5ZA 5GM0A 1NCQA 2WC2A 5J98B 5JMCA 4LBNA 1NE6A 3FWEA 3ZVXA 1O7FA 3ZFEC 2JKBA 3AP7A 2VU9A 3H1YA 4MLOA 1V9U3 3RMYA 1BBT1 1QDOA 2D3PA 1LKNA 2GH8A 5LK5A 2R0FA 4XHXA 4N43C 5C6CA 1LHOA 4CDWC 3QBQA 2ZHMA 1SCSA 2VW1A 4LO4B 5EV7A 1VBE2 2WNVA 4AHXA 4UW3A 3QOPA 1BZWA 1MS3A 3WHUA 1DFQA 1NA1C 2EF6A 1C8M1 1QY4A 2CYFA 1KRIA 3IPVB 2EA7A 2F4PA 3MICA 4QPIC 3VBRB 1LOFC 1UD1A 3AX4A 4A7KA 2JICA 3SHRA 2E9QA 2VMHA 4H7MA 3VBUB 1R093 1CX4A 1LR5A 2JXAA 5F6KA 2QCSB 3RNSA 1RJ8A 4IERA 4NHLA 1C5HA 1J59A 2QNKA 4TZDA 2Z79A 3AM2A 3FE5A 1O4YA 3C2UA 4YW1A 4HKLA 4D3WA 3MGUA 4RL7A 2GMEA 2HEWF 4M01A 4AYUA 1J1TA 4Z82A 5C9AC 1UKGA 3N7LA 4DOUA 2Z69A 3TOJA 4YVWB 4FO9A 2MHFA 4XIOA 4PLOA 3DKWA 2ZAHA 3O0VA 4Y20A 5BNOB 4EJRA 1W6QA 3G6JB 3ZFEA 3B93A 3AKSA 5AVPA 1ULEA 3OBTA 2RR12 1RUJ3 4QQOA 1J3RA 4N90A 1S0DA 4AFMA 2ZX1A 3QACA 4AFCA 2WFPA 1JYIA 4OFGA 4COWA 4CDWA 5C33A 4B4PA 4FXGB 2VY0A 4UBGA 2VVDA 1KJRA 4XOGA 3H9AA 1PGL1 1AJKA 1NA1A 5IK7A 1YUDA 4DNYA 4G4FA 1O3SA 2WS93 3JD73 4YW3A 3V0AB 2D6KA 5H9RA 4CDXB 1LGCA 4LUKA 4PDWB 5KHIA 1Y3TA 3KB5A 1NXD1 4KNCA 1D4M3 1MQTB 4P9GA 1WMEA 4NWWA 4WM8C 1IZ3A 4YG3A 1WW6A 1KFXL 4YZ1A 2QDRA 1RUF1 2H6CA 2K2SA 3WP4A 1U12A 4IEOA 4K8FA 4XFIA 1PVC2 4XPVA 2ZGMA 2ZGOA 4ATFA 3WW2A 4Z1VA 3WDTA 2NMNA 5JIUA 1VBD2 2B7YA 5EXOA 1VBA2 2RMU3 1RMU3 1KS5A 2N7GA 4XIKA 3E6DA 3DPRC 3AMMA 1Q8VA 1V6JA 2BW8A 5HBAA 1LOCA 3RYPA 3VV1A 1X50A 2EXJA 5KHHA 4FTSA 1RUD3 1OOPB 3T2TA 2HWF3 4RQPB 4JCKA 2VMGA 4B29A 2R073 5FOBB 4Y24A 1ND2C 1DGLA 5DUUA 1LTEA 4A2UA 1ZRRA 4BYYA 1XE8A 1ZA4A 1BEV3 2A3XA 1H2NA 1LB2A 1VRH3 1ZM1A 2XLGA 5BV6A 5DDJ3 3N4MA 2D7FA 5J3UA 1QDCA 1WCSA 3O14A 5GALA 5AFEA 3V0BB 5FTTC 2GNTA 4XF9A 5J7MA 3RJRA 4CP2A 2XVLA 1PK6C 4R9CA 3OGGA 1RUC3 1OA4A 1AL21 1PO22 3WD5A 2JE9A 3BOWA 4RS5C 4YFZA 1QQP1 1XE7A 4N9HA 1J3QA 2ZHNA 1ONAA 4IEZA 4QXKA 1AR91 1OLQA 3M8LA 1H2MA 3MF9A 2PHTA 2ZX3A 4AEDA 3VKFC 2ZZJA 1G9FA 1AXKA 4L11A 1X8MA 5E88A 1AR82 4NVPA 1AYN3 1I3HA 2EVXA 2PAMA 3C3VA 2Q1ZB 2HWC1 2DUPA 4K20A 5J09A 2JECA 4FPCA 1ZZ9A 4W65A 1VBB1 3T1LA 1AXYA 4Q4Y3 3WXPA 3ZSLA 3KCXA 5A33A 4GXLA 4LEJA 4J6GA 3WCSA 5ABJC 1I1EA 3VBSC 4QHBA 1ULFA 4IEPA 2DFBA 4AFAA 4JGZC 3MFAA 3M2MA 1PIV1 1N3PA 2DF7A 1ZRDA 1VBC2 1W2UA 1DZRA 1M4WA 1QJY2 2UWAA 1NLSA 2Y0IA 4Q4W2 1EPZA 1XU2A 3VKMA 2LUWA 5JAXA 2G9FA 3V56A 2E7AA 2RS13 3R4SA 3VHOA 4DRVA 1Q5OA 1BQPA 3FUQA 2EXIA 4I3PA 2RS32 5JPMB 4FOVA 4R4XA 3VDDA 1YO8A 2A71A 3ZN6A 1LEDA 2HWE2 1ZBE2 5LRSA 4HFSA 4UW4A 4Q1PA 3OCPA 2DVAA 3IMNA 1RUG3 3DF0A 5J96B 4XJ9A 4A3XA 3N36A 5I0TA 3ZXLA 2AZ5A 3NW4A 1YIPA 2X29A 5JR7B 2R062 4CDQC 3B3QE 5IK4A 4YM2A 3WY6A 5GZGA 3IIAA 4AEJA 5ACA3 1ZREA 4AVBA 1FPN1 2WSUA 2O8QA 3SLIA 5CG8A 3GALA 4M00A 4YZ4A 4LBQA 2MEV1 3E5XA 3AMQA 3MLJA 3N7JA 4AI1A 3R6SA 2PFWA 3W9AA 1W6OB 3KT1A 2ZMKA 2DCYA 2ZZQA 3R4DB 4MUVA 1LEMA 2ZGRA 4Q4X1 2R041 3LA2A 1IPKA 1HQWA 1AR62 3URFA 4BM8A 2IXKA 2AENA 5H9QA 1CESA 1RGSA 1LU2A 4OUSA 3ZSKA 1HV1A 1N1VA 4MXWA 1ZZ8A 4XHBA 1VAMA 3TYJA 1X7NA 1DG6A 1DGRN 3QH6A 2VW2A 3S7IA 1V9U2 2DVGA 3AKQA 2BVBA 3ZFGC 1C8NA 5JI7A 5JOYA 4J1XA 1RUH3 4X6RB 2SLIA 2ZX0A 4AI8A 3MPPG 4DRRA 1H8VA 4UBHA 1VLNA 1XNBA 4Q2FA 4OI4A 4YM1A 4D7YA 1G8WA 4D7TA 4LTAA 1WW4A 4Y1UA 2DWRA 4CDUA 2QVSB 1YI9A 2JG9B 3QD6A 5CFDA 1SACA 5JLVA 4URTA 5CIRA 3NAPB 4CP0A 1YCIA 1AJOA 1R092 2W52A 1BCXA 1GSLA 2ZTNA 4YVSB 1QXRA 3MW3A 3NV4A 1YJKA 2QE3A 1GR3A 3ZXKA 2P17A 4Q0VA 1R1A3 2HWB3 2GH2A 4NWVA 5T5LA 1EPWA 1FYUA 3HQXA 4RHV1 4KWJA 3T1MA 4QPGB 1CAUB 1HRI3 4FPLA 2A6YA 1ZZ6A 4K3UA 5J37A 1VIWB 4IV3B 5BNNC 4IEWA 4EWAA 4YNIA 3WHTA 4XFFA 3ACLA 3X29B 2ZS6B 1WGPA 3R4UA 3AXEA 4DY5A 1Z0HA 2B39A 4DS0A 3JBG1 2R32A 4RGGA 2ENRA 3WP3A 1RUJ2 3CEWA 3AJYA 1OA3A 1UN1A 3ZFGA 1WLTA 1QJU1 1RINA 3AYDA 1UPSA 1V70A 2ZCWA 4LA2A 1Q8QA 1EY2A 2PLV3 3UJOA 2HEYF 3M1HA 5FQ0B 3UKVA 4Q1RA 1IS4A 3POWA 5KXCA 1UIKA 3AP5A 3NV2A 4R8HA 4IV1B 1OFSA 1CAVA 1HXS3 1WBFA 1VR3A 4XFCA 3KGLA 3UKTA 4YW2A 2EXHA 4WM7B 1IKPA 2ZPXA 1EAH3 1UAIA 3O12A 3QLQA 3M4FA 4YGCA 3L2YA 3E6BA 3FFZA 1WMFA 3IDCB 2WS92 3JD72 2FQPA 3TRSB 4Y1XA 3VHPA 2DU0A 2BFUL 1D4M2 4I0WB 5EFUA 1CQ9A 2GC1A 4JDOA 2QZ3A 2XBO3 1ZZBA 2NM1A 3LB9A 3RI8A 4IL7A 3FJSA 4IESA 2CY6A 4LO6B 4K9SA 4QGNA 3ZN4A 2A73B 4HZFA 4TYSA 2BNOA 1PNFA 1QH6A 2CGOA 2WZR3 5K0UA 1HLCA 1SEFA 1S1AA 3KT7A 2E51A 3PJYA 2ERFA 2R30A 2NQYA 2CNAA 5A32A 5FDBA 1LHVA 1MEC1 3WCRA 5BNNA 3DGTA 4GMP1 4B4QA 2JE7A 3PTYA 4QQPA 1TME3 2B45X 1ND3B 1RUD2 2WT0A 4GIQA 3RPQA 3PVNA 4P9YA 1AYM2 2HWF2 1NCQB 1ZRFA 3RI9A 4AFDA 3OPZA 1XNCA 2R072 3NV1A 2IXJA 1DYPA 2DVFA 2R0HA 2D6NA 1BEV2 4AQTA 3IWZA 4GB31 1O3RA 3MIDA 1VRH2 4UW6A 3E5UA 3WLUA 1LCLA 5DDJ2 2AREA 2Q0AA 2BNMA 1JUHA 1SQ4A 1HX6A 2VOVA 2UY8A 2TBVA 2WSVA 4B7EA 4P9XA 1T6GC 4QM8A 1HQLA 2WNVB 1WLWA 1MS9A 5JOXA 5JWPA 4JAAA 1HW5A 5J36A 2ZGTA 2PHRA 3MI8A 4Q4V3 4H7LA 1MZFA 1KD7A 2R16A 1GYKA 1RUC2 1MS8A 2XJVA 5JIAA 1F9KA 3MLLA 5KXBA 2XH6A 3NKTA 5DUVA 1H1IA 4MX3A 1K5MA 1W0PA 2VPVA 4DINB 3WZ1A 4P9LA 5FO9B 5JZGA 2DYCA 4BCUA 3LA3A 3WDXA 1G7YA 4JGYA 3LOBA 2XKPA 1MS1A 4FOWA 1AYN2 4GH4C 1SBEA 4AI3A 4SBVA 4QQLA 2XJPA 1KQRA 3RRDA 4Q4Y2 4CEYC 3ZSEA 1MS0A 2IXCA 4A7YA 4FSJA 1C4RA 3ENRA 2C0ZA 2IFRA 1HRV3 1C28A 1RUI2 1DZTA 4Y20B 1YFWA 1W6QB 4YW5A 4L99A 1AUYA 3W59A 3J8F2 5L73A 4EN8B 2NN8A 3P3PA 2TUNA 4HKOA 1N3QA 1WCKA 2PTMA 1MVEA 4M0NA 4PIZA 4AWDA 4CDWB 1OLRA 2RS12 1YFYA 4Y5Z0 1VBC1 4YYOA 4Q4W1 1H0BA 5D1IA 3ZMOA 4JQRA 3U11A 4HVRA 4XE9A 5F6LB 4ONUA 3ZYPA 2D3RA 4E2SA 1CAWA 4AI0A 1NA1B 2VGDA 1S0FA 4I02A 3ZX7A 2XL9A 5CVRA 1W39A 5FREA 2A7AA 1RUG2 2GC2A 1SLAA 1AX2A 4FPFA 1F31A 2RS31 3WG2A 4LT5A 2BNNA 2DV9A 5E8AA 5C8WA 1W6NA 3WQ7A 2HWE1 1TE1B 1DIWA 4M3CF 1SBDA 3HBZA 1S2KA 1QOTA 3MYXA 3OBRA 4Q8LA 4WZFA 3DL3A 5ACA2 1BJQA 2YPJA 5FMOS 5BYNA 2HKXA 2XWBB 1OQDA 3H1MA 4XXPA 2R061 1LGBA 4GH4A 3GZTB 2PAKA 1RHI1 3FX3A 1B35B 4EN7B 1H8TA 1O91A 3VLBB 4CEYA 4FOYA 5HCFA 5E89A 4BLIA 5CFCA 1C3HA 3HR9A 4Q8KA 4P5HA 5LK7B 1R081 3SH5A 1PNGA 4PBOA 2WWSA 4HN1A 1BK1A 2ET7A 4TSVA 1BMV1 1YHFA 2ARXA 2UYBA 4GA9A 1NQDA 5BNPC 3IDBB 1D0HA 1GZWA 1Q8PA 1URXA 2ZA9A 1CJPA 1X8EA 3JZVA 1YYNA 4XF1A 3ELNA 3MW2A 4HSJA 4YGBA 4U36A 1FI2A 4OZXA 4K7JA 2KXLA 1EV13 4H3WA 4UW5A 4XILA 3CNAA 1AR71 2QQPA 1V6KA 5JDBA 3B9IA 4I30A 2O8OA 1KDKA 2Z42A 2D44A 5CNAA 5BPXA 4MYEA 1X36A 4WV8A 5C8CC 1OQEA 3PNAA 4HLTA 1C1FA 4B4RA 4P9WA 4W6YA 5GZDA 1TNRA 2WNUC 3RZZA 1OSGA 2C9AA 1DQ4A 4PLNA 3OD4A 2ZABA 2W39A 4HN0A 4KGQA 3B01A 1G86A 1BBT3 4KQ7A 2R1DA 1SCRA 4LBKA 4AEDB 1ENRA 4E9KA 4N7UA 1PM7A 4XF4A 1LRHA 1R1A2 2HWB2 4OHVA 3ZDSA 2A6XA 3VZMA 3VZNA 1JOJA 1UZZA 3R05A 1ZRCA 3ATGA 2YGLA 1HRI2 3AYEA 3WW3A 5C4WC 5A33B 1C8M3 1JHNA 2BWCA 1LHUA 3TWIA 2XJSA 4L9BA 3TN91 1I9RA 5L7OA 1COV2 4CYDA 2MPFA 2VG9A 2X5IA 2YZ4A 1RUE1 2JG8C 5JZGC 1LHNA 3TBDA 4Y26A 4HETA 3CJIC 4XJUA 4AXOA 1H1MA 2XVGA 4L97A 4Y1VA 4K6BA 2PLV2 3K51A 3ZFFB 3SNMA 4RR3C 2W0XA 3USUB 1WW7A 3EBRA 4PIYA 1JW6A 4AVSA 1MS5A 2RM21 2UYAA 3WDVA 1FNYA 4N43A 3TNPB 3VDDB 4O9EA 3ZN6B 1EAH2 2W68A 3VBOC 5GLZA 2D43A 3JQWA 2WNUA 3UV9A 1NOVA 1EYBA 1VAKA 3KD4A 2DCKA 2RS52 4COUA 3WV6A 2XBO2 2E53A 1ASJ1 4ES9A 1V6NA 4QPIA 3WDYA 1LOFA 1QKQA 4XMIA 3IDEA 4BLJA 1GNZA 1GFF2 2VOWA 1IQAA 3MIBA 4QGMA 5T5JA 5GLWA 4LBQB 4EWEA 3N7KA 4WBBA 3DUIA 4DY3A 1OKQA 3AJZA 5JOZA 3J4UH 4AVVA 1FOD1 2WFF1 2Y0OA 5IUQA 1PO11 1A8DA 4CTEA 3AZXA 3OGJA 4BH9A 1SLBA 3AB0A 1TME2 1WMDA 3CO2A 5FLIA 4HVQA 2SBAA 4ORFA 1HDKA 4B3NA 4FP3A 4FAHA 1UU5A 5C9AA 3NKGA 2JG8A 5I93A 4INDA 2VVFA 1QGLA 3CU7A 2RE9A 1WUVA 1RUF3 2LALA 4FPHA 4DMIA 3AKTA 1AYM1 4L8QA 3D8CA 4MGYE 3GBWA 2GAUA 4RR3A 4XBLA 4AFBA 3ETQA 4XBQA 1CAXA 3H3UA 1ENQA 3APBA 3VBUC 1G9AA 1LHWA 4HMZA 4CP1A 3VBHC 3CJXA 1GLHA 1N1YA 3D0JA 2VNRA 2OPKA 5LRRA 4CDUB 4M3CA 4Q4V2 2HWD1 4G9SB 4B7KA 5CFDB 1REFA 1QWRA 2DUQA 1CPMA 4Q0PA 3LGRA 4DFSA 5AFBA 3M3IA 1IS5A 5IT6A 4S2HA 3OD0A 1QU0A 3SCGA 1OD5A 4YVWC 4YRDA 1WLDA 2GMPA 4LBJA 4WM8A 1KS4A 5I8SA 3B94A 4YG0A 5BNOC 5J48A 2OZJA 1TMF1 5FLJA 1Z78A 4AG4A 1OQ1A 1I5ZA 1PGW1 5AC92 1SLTA 1C57A 2Q5TA 4OI2A 5EZWA 3CF6E 2ZACA 1AL23 1G9DA 3DPRA 1DHKB 1QQP3 1HRV2 4RSUA 2A3YA 5CB7A 3FHIB 2E6VA 1TQ5A 4GQ7A 4CRQA 4Y4YA 1LECA 3O0WA 3RS6A 1AR93 1JYCA 4FPJA 4E2GA 2ET1A 3IPVA 4OI0A 3JCIA 4CDXC 2WINB 2VH9A 2WNEA 4PDWC 3FBMA 1RUI1 1W6PB 4BIFA 3E6CC 2ZX2A 1ND2A 3TNQA 4ZKTB 3AYCA 3VBUA 3M70A 3J8F1 1CAVB 3QCWA 3VBHA 3GHNA 1KITA 2HWC3 1FMD1 1NY72 1AF9A 1VBB3 2CGNA 2CGPA 2ZKLA 2FZ2A 1Y7BA 4I2OA 4XZPA 4D94A 2ZGSA 3N7MA 4U2AA 1QJX1 4HPKB 5H9PA 2ZGPA 1PIV3 1PK6A 2A6WA 2FZ1A 5JI9A 2R49A 2JDZA 2NLRA 4ISQA 2D6PA 4RS5A 1O5UA 1HIXA 3VZKA 2IZWA 4K1ZA 1OOPC 3INAA 3AMNA 4RQPC