3ES4A

Crystal structure of protein of unknown function (duf861) with a rmlc-like cupin fold (17741406) from agrobacterium tumefaciens str. c58 (dupont) at 1.64 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
116
structure length
116
Chain Sequence
GMTMPIFNISDDVDLVPAMPAEGRDGGSYRRQIWQDDVENGTIVAVWMAEPGIYNYAGRDLEETFVVVEGEALYSQADADPVKIGPGSIVSIAKGVPSRLEILSSFRKLATVIPKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein DUF861 with a RmlC-like cupin fold
publication title Crystal structure of Protein of unknown function (DUF861) with a RmlC-like cupin fold (17741406) from AGROBACTERIUM TUMEFACIENS str. C58 (Dupont) at 1.64 A resolution
rcsb
source organism Agrobacterium tumefaciens str. c58
molecule tags Structural genomics, unknown function
total genus 22
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05899 Cupin_3 Protein of unknown function (DUF861)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3es4A00
3FE5A 5BXXA 2UYBA 2MPFA 3M3IA 3E5XA 1ZX5A 5J3UA 2B9UA 1NE6A 3QOPA 3USSA 4XFIA 4PIYA 1LB2A 3GYDA 4R8HA 3NSTA 1U12A 2VQAA 1CGPA 1ZVFA 2OPKA 4KWKA 4AVBA 4ZU5A 3DV8A 5JSOA 2ZCWA 1YFXA 4QM8A 3H50A 1EPZA 5CVRA 1RGSA 2CV6A 5KHHA 5T3NA 3U10A 1NYWA 1H1MA 2OZJA 1X8EA 1CAXA 3MYXA 3HIFA 4IEVA 2PAMA 1CX4A 1ZNPA 3VHRA 3PLQA 4JVAA 2DCTA 4CYDA 3TNPB 3JZVA 4UBHA 4JTOA 4N9IA 1SFNA 3DL3A 4IEUA 3L2HA 2VECA 2C0ZA 3EJKA 4PIZA 4XF1A 3H1WA 4AXOA 2WFPA 3KGZA 5JSPA 4N9HA 1QWRA 4MZUA 3U11A 3RPQA 3WW1A 2BEOA 2D5FA 2HKXA 3IWZA 2BGCA 1CAUB 4LTAA 3MPBA 3HT2A 2CAUA 4JV4A 5I0TA 5JCTA 1RL3A 4LLOA 1QY4A 3FX3A 2GU9A 2K0GA 4BHPA 2XKPA 2WC2A 4I0BA 3SHRA 4L2NA 4AVAA 5LEJA 3C3VA 3ST7A 4QMAA 2QJVA 4BH9A 5JAXA 2F4PA 1ZREA 1DGRA 3ES4A 1O5UA 5I8TA 2CGPA 1UPIA 2OA2A 5I91A 3H3UA 2VPVA 2H0VA 2KXLA 1VJ2A 2MHFA 5J48A 1J1LA 1O7FA 2UY8A 5LEKA 3ROUA 1EP0A 2IXKA 2XLGA 2Y0OA 1L3JA 2UYAA 5AVPA 2GC0A 1X8MA 1FT9A 4MGKE 2PQQA 1O3SA 3HQXA 1OMIA 3BPZA 3LAGA 5KHKA 3LA3A 2PAKA 3EQEA 3UKTA 2XGXA 1CAUA 1EY2A 2GH2A 5I0RA 2BYVE 2BNMA 4OLLA 4RD7A 2BNNA 4FAGA 2IC1A 2OYZA 1CAXB 2OZ6A 4EWEA 2XL7A 1YFWA 5I8SA 1LKNA 4DINB 4I2OA 2FMYA 1J3RA 4F8AA 3ETQA 4E2QA 1X82A 4O9EA 3I7DA 4I02A 4GULA 4LA3A 3H1YA 1YWKA 5EFUA 1I5ZA 4XETA 2QCSB 1EYBA 4XEZA 1XE8A 2ATFA 4HN0A 4Z82A 3I54A 4NVPA 4J1XA 2GAUA 4IEQA 3BCWA 4P9GA 1CAVA 4IEOA 3RYKA 4I0AA 1OI6A 4IESA 1RUOA 4MV2A 3FWEA 4QX5A 4Q0VA 1YFUA 4WVZA 4Z07A 2PHLA 4HLTA 1Y3TA 4MH0E 4KU8A 5K8SA 1FXZA 5FPZA 1J3PA 1LR5A 2XHKA 3LA2A 4XFFA 2QDRA 4D7TA 1ZZCA 4YNIA 2ET7A 5KHJA 3H9AA 4XFBA 4QXKA 1DGWA 3OCPA 1J58A 1SQ4A 5FLHA 4H7LA 1YUDA 2Q1ZB 5JSRA 1DZRA 4ONUA 1LRHA 3I59A 5CU1A 4BIFA 4MX3A 2I45A 1WGPA 3H7YA 3LA7A 4HVRA 3RZZA 2PAEA 3BU7A 1YLLA 4KL1A 3OD0A 4YSFA 3NJZA 3WW3A 4HVOA 1QXRA 3M70A 3KGLA 3SMHA 1HW5A 3DN7A 4YYOA 4AQ6A 1YHFA 2K9ZA 1TQ5A 3CJXA 2XKOA 5FPXA 4KWJA 2IXJA 4PJYA 4XFGA 5I8YA 2H6BA 2XLAA 3LWCA 1VP6A 1ZRCA 1RUNA 1H1IA 3D82A 4WZCA 1ZZBA 2ET1A 2Q4SA 3ES1A 2PA7A 4IEXA 4YARA 4IEPA 1ZZ9A 4HVQA 1CAVB 1CAWA 3PNAA 3BALA 5BY5A 3WW4A 4I09A 4UXAA 1NXMA 3S0MA 4UBGA 2N7GA 4EWDA 1SEFA 1O5LA 2PTMA 2Z2SB 5FLJA 4EROA 4JTNA 1RTVA 3HT1A 2IXCA 4IEWA 3IDCB 4IETA 4QGMA 4Q0QA 3GBFA 4AVCA 4ZU4A 5BV6A 4E2GA 1NE4A 1GQHA 3E6DA 2EVXA 3UKVA 3EHKA 4IEYA 5JR7B 1ZRFA 3FHIB 2E9QA 3O14A 1I6XA 4Q0UA 4OFGA 3H8UA 1O3TA 1OD5A 2D40A 3RYRA 1IPKA 4XF4A 3H1MA 3E5UA 1O3RA 5E1RA 2D5HA 2GZWA 3SCHA 1UIJA 3KSCA 2PHDA 4XFCA 1VR3A 4O9GA 1ZZ8A 3RYPA 3H3ZA 1XE7A 3I59B 4L11A 3CEWA 5I93A 4XFAA 2XLFA 3ZDSA 3N4MA 4A2UA 2FQPA 3SXWA 1UIKA 3FFQA 1QXJA 1FI2A 2B8MA 3NL1A 1X7NA 2BNOA 3LZZA 2IXIA 3H7JA 1WLTA 3OGJA 1J59A 4AQ2A 4QM9A 2V09A 3D0SA 4Q0SA 4QGNA 2H6CA 1XRUA 3EO6A 3MZHA 4D7SA 5KHGA 3E97A 5EZWA 5D1IA 4R52A 3B02A 1O4TA 2Q0AA 4HSLA 1Y9QA 2HJIA 4XF3A 2PYTA 3RDIA 5FQ0A 5LRSA 1Q43A 4MGIE 2EA7A 5HI0A 3KCCA 4E2SA 1CAWB 5C6CA 2GC2A 2PFWA 1ZRRA 1NZCA 3OF1A 5KBFA 1O3QA 4XF9A 5I0SA 4EV0A 4K8FA 3RNSA 4XF0A 4WBBA 1OFNA 3CL1A 4B29A 1UW8A 4META 2IXLA 3G7DA 3TNQA 2QVSB 3ELNA 4I3PA 1DZTA 3FJSA 2QNKA 4KWLA 2ETEA 1IPJA 2Q30A 5F1RA 3IIAA 4QGLA 1J3QA 3E5QA 1ZRDA 4PIXA 3D0JA 1PM7A 4BYYA 2P17A 4HSJA 3E6BA 4HN1A 3IBMA 2O8QA 4LUMA 4HMZA 4LULA 3WW2A 3ACLA 4I01A 1ZZ6A 1V70A 5LRRA 2CAVA 1WA4A 3MDPA 2ZKLA 3R6SA 3OTFA 5E16A 3PVBB 4TLFA 4LEJA 5I0UA 5CADA 1GQGA 4Q29A 1PMIA 1RC6A 3EBRA 4X6QB 4IERA 3QACA 4YRDA 3NW4A 4KU7A 4X6RB 5KHIA 2GC1A 4ZU7A 3FZ3A 3CF6E 4FAHA 5FDBA 3IDBB 4HZFA 4EWAA 1Q5OA 3S7EA 1UCXA 2O1QA 4F7ZA 5FQ0B 4LA2A 5C8WA 4HBNA 3NKTA 1G6NA 3U0ZA 3E6CC 3KMHA 4Q0PA 2UY9A 3CLPA 2IXHA 1YFYA 2D93A 5BUVA 3BB6A 1Q3EA 2GC3A 1UD1A 3CO2A 3DKWA 4FT8A 3NVCA 5BPXA 1ZZ7A 2XL9A 4MGZE 5FLIA 3S7IA 2B5HA 4ORFA 5J7MA 2Z69A 4J1WA 4XFHA 3LOIA 4IEZA 4LUKA 2EAAA 4MGYE 3UKNA 5FCCA 3SCGA 4FBFA 3SCFA 1JUHA 2MNGA 4MUVA
chains in the Genus database with same CATH superfamily
1H9PA 3N9MA 4DY3A 4LHKA 5FMOS 2ERFA 4IDZA 1JUIA 3OBRA 4AEDA 5DZGA 5J3UA 2B9UA 3ZMNA 2ADEA 2RS13 3QOPA 5IYYA 4XFIA 4GJYA 4PIYA 3CJIA 1LB2A 1UXXX 2VW1A 3IIIA 1ULOA 3Q8CA 2D3PA 4XJ9A 2VTXJ 1NY71 1W8OA 2YC0A 2VNVA 5JIUA 4AVBA 4ZU5A 2VXRA 1UQXA 3DV8A 3RMYA 4FOQA 1RJ8A 2P3YA 5ACA1 1EPZA 3LQCA 2CV6A 2F17A 3INAA 4QX0A 2YMZA 3APBA 1NA1C 1UU6A 1O8PA 1SFPA 2E7AA 2VUCA 1LJ7A 4ITCA 4LHLA 5F5CA 1S0FA 4S2FA 3J4UH 3LF7A 4XC9A 3UGGA 3ZN4A 1X8EA 5T55A 4AAXA 3TN91 3HIFA 3WEZA 4BMEA 2D3SA 4IV3A 2PAMA 4AYUA 3RZHA 4E9KA 4KNCA 4CDWA 3ZLIA 2J22A 1W9YA 4Q4Y3 1RITA 5LASA 3KHBA 3VBSB 1EAH1 2V4VA 5IT6A 1AL0G 4M4PA 1SFNA 2ZX3A 5FYIA 4BZ4A 3VBFB 1F9KA 3NNLA 3BGAA 3ZIWA 2VECA 4PIZA 3WDYA 4XF1A 5FZ8A 3KQRA 3I4IA 3LGRA 1CPMA 3H1WA 4Q4W2 3RGBA 3UGHA 3T2PA 1SHWB 2D3RA 2DVDA 1RUF3 4ZS3A 1CX1A 1B35B 4PDWC 1UX7A 1BK1A 3ZXGA 1O6UA 5GLTA 4MVTA 1UY0A 2D5FA 5IVEA 4AVSA 1YQCA 3N3HA 1JU3A 5FY0A 3AFGA 2R073 4KH9A 1RVF1 4JKLA 1GR3A 2R1BA 1T6BX 2CWMA 4QB2A 5HXVA 2BGOA 2PHFA 5F3EA 5GKAC 2W87A 1ENRA 2W47A 4AI8A 1UWWA 4OYUA 1OQEA 4NWWA 5DMYA 1I1EA 4Q4X3 3I2HA 1NOVA 2XKPA 4QPYA 2WC2A 4BIOA 3PUSA 1NT0A 2UWCA 3B9IA 3N9LA 4KMQA 2YGLA 4JQTA 1VBB1 1EUTA 1GNZA 1NY72 2OKXA 5JAXA 2W94A 2WKKA 4NRPA 2XOMA 3AVSA 1JBCA 3WCRA 4BU2A 5A3TA 2ZX2A 5ACA2 5AFEA 5C3RA 3J8F1 1UPIA 2AGSA 5LA0A 3T0AA 5I91A 3FHQA 2O0OA 1IGOA 2WQZC 4GKXA 3I2FA 4FOYA 3HN1A 5JR2A 1JW6A 2C9KA 1EV11 1NAEA 2ZJCA 1J1LA 3MHZA 3NMBA 4W4ZA 2JEMA 5F32A 3ROUA 4E8DA 2ZGPA 2OQ6A 4Y1UA 4RGKA 4LMFA 3CJIB 1EAH2 4I0WB 5AVPA 3BTAA 4Q2FA 1UAIA 4Y33A 2PQQA 3MPPG 5EJZB 3W5NA 2Z79A 1O3SA 1OMIA 2ZZQA 3K77A 1ASJ1 1RUE1 3BPZA 3LA3A 4LIVA 4NIIA 3TEXA 4LBJA 1RUI3 4JKMA 4K20A 4NAMA 3W20A 1EY2A 1HB3A 2PHRA 3GZTB 1REEA 3ME2A 4F83A 2ZGLA 2BYVE 5I0RA 1AZDA 3AMNA 2DVBA 3ZFGA 2VUAA 4OLLA 1VALA 2ZAAA 4RD7A 4HK8A 1I5PA 4NHKA 2JE7A 2ZGQA 4GH4C 2OZ6A 1YJLA 4EWEA 3TAYA 1GOHA 1YFWA 1YQ6A 2X09A 5I8SA 1AX1A 4CDWB 1RVF2 2HWC1 1QJX1 1LKNA 5FZKA 4TYSA 4WM8C 3ZYBA 1D0HA 4BJ0A 4CCKA 4CP1A 4DINB 1J3RA 5BNNB 1OURA 4HL0A 4GULA 2WT0A 1LGCA 1NUKA 1XJAA 4LA3A 5FYUA 1CJDA 1DQ1A 5BNPB 3BTYA 1OA4A 1MZ5A 1QOSA 3RG0A 3HBKA 4FTSA 2QQMA 1UZWA 2DCKA 4QU1A 5FZEA 2HBTA 2QCSB 5AVAA 4XEZA 5J96B 2E63A 2RV9A 2ATFA 2WR9A 4QB6A 5L73A 1ZA7A 4E4HA 1R083 3WG3A 2GAUA 3J8F2 2PHXA 4IEOA 4JGZC 4UW5A 4BK4A 4TN7A 4IGPA 5C3PA 3BU0A 3RYKA 1OI6A 5ANNA 4DUXA 1KGYA 3HVDA 5D2AA 1RUOA 4MV2A 1OOPA 1EV12 4XAAA 5FJHA 1O91A 1HV0A 1RUJ3 4MADA 3WDVA 1WMDA 4NROA 1ENQA 3WZ1A 5DXDA 1A8DA 4LNVA 1QJU3 1PGW2 1OC1A 1XE0A 4UOJA 4WVZA 3T2OA 2EIGA 1YRZA 2W1QA 2WFF1 4R9BA 1ASJ2 1RUE2 3U07A 3T4HB 2DF7A 4MH0E 3DYPA 3VD3A 2OT7A 3VBHC 5FOJB 4JRAA 2VY0A 5FPZA 1IS6A 5E8AA 1J3PA 3POEA 2ZPXA 4BXFA 5DZFA 3B93A 1FPN1 4Q8KA 3RS6A 3RZJA 1DYPA 1UZYA 4NIDA 3J7NA 4XFFA 1DU3D 3VZNA 2JENA 3POFA 5A32A 5A3PA 1E5SA 3HAGA 2HWC2 1QJX2 4DIQA 3FLPA 3MF6A 4RHV1 5DAWA 5FRAA 3DEMA 5T52A 1IQDC 2JICA 4P08A 3U14A 4XTMA 5IUQA 3VN4A 5FMOL 5G05L 1J58A 1CWPA 4YM0A 4DUVA 2C1FA 1YUDA 1W06A 1DZRA 3I59A 1SLBA 1JOBA 3ZFGB 3KVAA 1BBT1 2GMPA 4AZZA 1CPNA 3BI3A 2JXAA 3H7YA 1ND2B 2PAEA 1YLLA 2D6MA 2P3JA 1S2KA 4KL1A 5E89A 5FYTA 5M0TA 3M70A 3AL5A 1W2NA 3M2MA 3K4DA 3TOJA 4AGRA 4LBNA 1W0OA 1HW5A 5F6KA 1SDWA 3ZXAC 1BVP1 3V56A 4ZZ8A 5IFTA 1MS1A 1CZTA 2D6PA 2WWJA 2YZ4A 3LB9A 1TQ5A 4XACA 2DV9A 3WDXA 3DYMA 1COV3 3JBG1 1W2UA 2VXJA 4Q4V3 4BA6A 4C0HA 4PJYA 3I8TA 4XFGA 1JHJA 1FATA 2GN7A 1MR5A 4O7XA 5FREA 1W6NA 3AYEA 3JUUA 1H8TC 2PXJA 4H3WA 2DBIA 3NQHA 5A1LA 4CPBD 4NIHA 1RUNA 2UU8A 3K4ZA 1H1IA 1TNRA 4XQWA 2W1SA 3VKOA 2JDNA 3D82A 2Q4SA 1W8UA 2PA7A 3LFIA 3I3BA 4GZ9A 4DNYA 1FPN2 1XPWA 2FZ2A 4FP3A 4H7MA 4QX3A 4ZONA 3BALA 3WW4A 4ARXA 3PTRB 5GLWA 1VRH3 4I09A 5JWPA 1CZSA 1LESA 1NA1B 4UXAA 3W21A 2VCBA 4QX1A 4XUOA 4UBGA 2C26A 3FLRA 3GZUC 4GH4A 5CISA 4JKKA 1LNSA 2QTWB 3UNPA 3LCPA 2XH6A 3AP5A 1S55A 4RHV2 2QQUA 2CGNA 5FLJA 2JG9C 1T6GC 3RJRA 4QB1A 1RINA 1BQPA 2QQVA 4AFCA 1H1AA 4Q8LA 2IXCA 2VOWA 4ZY9A 4B3NA 2PMWB 3WHUA 4QGMA 1UZ0A 1CJPA 3GBFA 1DCSA 3K3NA 4PF1A 1NE4A 4DZGA 4EN9B 3NJVA 1BBT2 4L0PA 4B7EA 2ARCA 4IEYA 1JH5A 2BQPA 1VMFA 2ZXQA 3FHIB 1FOD1 3O14A 3P6BA 4JGYA 1GV9A 4XYXA 3RQ0A 1UX6A 3HNBM 3ZKYA 5FO9B 3U4XA 5A32B 1I9RA 1TME3 5FK7A 4P9XA 1POV0 1AR61 2O8OA 4DY5A 4XF4A 1AR82 3UK9A 2WNOA 1HXS3 2ZABA 2VOXA 1JYTA 1HB4A 5FAXA 3O1OA 4FPGA 2D5HA 2GZWA 4CUBA 1X50A 1L7LA 3JBG2 5BNOA 1GLHA 2FDGA 5JOZA 2A6XA 4XFCA 5SV8A 4J6GA 5CNAA 3D3AA 3RYPA 2E51A 3JQXA 3I59B 1FAYA 3X29B 1WUVA 1GU3A 2GNDA 4YW5A 5A7OA 1PO21 1KJRA 2ZGKA 4MLOA 4XFAA 3ZDSA 1LHUA 3IKWA 2ZBJA 5IW0A 3AKSA 2FQPA 3D6EA 4OQ9A 2YROA 5GZGA 3WNKA 4CCDA 2B8MA 1NCQC 5IJRA 3WNNA 2WDBA 4QPIC 4BPZA 3LZZA 1S0JA 5FP8A 1WLTA 4NR1A 1W8TA 1J59A 3RI9A 1C3HA 3Q8EA 4AQ2A 1B09A 4AVTA 3MEPA 4Q0SA 3VDDC 1Z7S1 4EN0A 4XCAA 4YZ4A 1IS5A 1W6NB 1K5MA 2XJSA 3E97A 5EZWA 5D1IA 1C1FA 1O4TA 2WWUA 1NXD1 3KT7A 1S0EA 4BE3A 1GQPA 1W39A 1JYCA 3LDBA 5JVVA 3THPA 4QX2A 5FQ0A 1Q43A 4MGIE 3THDA 1W8FA 4E4ZA 4RQPC 3U37A 3T2TA 3ZMOA 3C7HA 2VCCA 4C0BA 5FP9A 1FOD2 4WM7C 5AC91 1OBNA 4LKEA 3PUAA 1Q56A 2YHJA 3B5LB 5TSWA 3CDZB 2WAOA 3N7LA 1OT5A 4GH4B 1AR62 3FHAA 3ZOIA 2W0XA 3CBNA 3J7HA 1PNGA 1IQAA 1XB9A 1PK6C 4WM8B 4ES8A 2XG3A 5J37A 3RNSA 4OVEA 4Q4W3 4P14A 4XF0A 4EE2A 1VBD3 4N43C 3HN3A 3RZKA 3CHXA 4CEYC 5A7PA 2YYOA 2DVAA 1JZ6A 3KF5A 4NMIA 5AFBA 1OKQA 2WLPA 4MSVA 1VAKA 2JDMA 5JIAA 1UZZA 4DXZA 4HFSA 4JGYB 1CZVA 4MYEA 1GNYA 2NZ9A 2VG9A 4XMAA 1DZTA 5CKMA 2X8KA 4D69A 1WA6X 4RSUA 3RZGA 2JX9A 1IPJA 4GB31 5FBJA 1LAJA 3VHOA 1HQNA 4P9IA 1WLWA 4HXCA 2AEYA 2UWBA 4N53C 3M3CA 1GUIA 3LIHA 2XJRA 4BYYA 2BGPA 3UGFA 4A42A 1Z7S2 3AMPA 2JIJA 5FZDA 3E6BA 4FPLA 4H14A 3LKJA 3WP3A 1D0GA 1LENA 2GMMA 3VB9A 4PCRA 2AENA 5APAA 2AH2A 2VW2A 2XXZA 2HWB2 2WL1A 3VBUA 1ODMA 5ACA3 4ZHNA 1HRI1 3MDPA 2ZKLA 3R6SA 2WNVC 2B4KA 2Y8KA 1M06G 3I2DA 2X29A 2E7TA 4L92A 4LO6B 5I0UA 1W0NA 3TN93 5AC92 4YZ3A 3AZYA 2HYKA 5FZAA 4AQSA 3RZMA 4QU2A 3SLIA 1RC6A 1EAH3 1W03A 3QACA 3ZXFA 3ETPA 3ZIXA 2DCYA 2OS2A 1YO8A 4WVWA 4K7JA 1HRV2 2A75A 2VCMA 3HR9A 3KCXA 3CF6E 2QQOA 4FAHA 5A7WA 1VAMA 5C33A 4HZFA 5A7NA 5FTTC 3KF3A 5A6YA 5DN2A 3S7EA 3VDBA 5C4WA 5G04L 5FUPA 5FQ0B 1Y9MA 2D43A 3PUIA 2XMLA 3VV1A 5IVCA 4CE8A 1IZ3A 1YFYA 2WBKA 5LY1A 5HBAA 1K5JA 1W8NA 1RVF3 2D93A 4GB32 1MACA 2ZA9A 2P34A 3BB6A 1Q3EA 3GBWA 4JCKA 2Q8OA 5B4XA 2WABA 3FN9A 3FFZA 3SH5A 2XQXA 5KR7A 5BPXA 5LK5A 3SISA 3WDUA 4BQ3A 3ZXLA 5FLIA 3S6PA 3VKFC 2QFEA 3N9QA 2YUEA 4W6YA 2Y6FA 1RUH1 1DQ5A 1YQ2A 2X05A 3W5MA 4J1WA 3ZPYA 1VBB3 1QH6A 1MVQA 1MS3A 1RB8G 1V00A 4Z8BA 1K42A 4MGYE 4D6RA 3M3EA 3U75A 1LU1A 1BMV1 1GKBA 3SCGA 3A23A 3LFMA 4N90A 4Y1YA 2J42A 2WSVA 4UI9L 3ZYGA 3J8F3 4AWDA 1US2A 1JUHA 1HRI2 2RMU1 1IKQA 1PMJX 2MNGA 3ACIA 3FE5A 4UT5A 2WINB 5BXXA 2MPFA 2RR11 4NE9A 2VZRA 3M3IA 3E5XA 2W52A 2CU5A 1EV13 5JZGC 1PGSA 2OX0A 1NE6A 3GNEA 2WZR1 4UFJA 3ACHA 1UYPA 5F3IA 3USSA 3T1LA 2RM21 5EQUA 3NJXA 4X8NA 4Y5Z0 1BYHA 1H6YA 3Q8FA 1KFUL 4YW4A 4CU6A 1U12A 3WQ1A 2VNRA 4UF0A 1H2MA 2OPKA 1ASJ3 1RUE3 3F95A 4ATFA 1PX3A 5EYXA 4AGGA 3V0BA 1YFXA 2XVGA 2FZ1A 2RG4A 3ZPOA 3AZWA 2ZACA 3VBUB 3WP4A 3J9SA 4W6XA 3ZN6A 1V6JA 1AYM1 5KHHA 3H8XA 3T0BA 1NYWA 1LECA 2OZJA 4Y1VA 1US3A 4LBKA 4CEYA 5LATA 2WYSA 3WQ0A 1H4HA 5HPOA 3M3QA 1SZBA 1DBNA 2HWC3 1QJX3 2BW8A 2D6NA 3AKQA 3JD71 1BXHA 4JRLA 3JZVA 4UBHA 4WVMB 1MPXA 1NLQA 2ZAHA 2VQTA 1Z0HA 2Q1FA 5CZKA 1QOTA 3KQ4B 4UW3A 3POBA 1J83A 1LOFA 5FZ7A 3EJKA 5LBFA 2Z5WA 1X9TA 2ZS6B 3C7EA 4AXOA 2WFPA 5CG8A 3KGZA 4EZ4A 4AFBA 1JS9A 2J1UA 5KWRA 1N3OA 1RUH2 2VMHA 3AYAA 3WSOA 4HKWA 1NCRA 4HETA 4QQPA 4CEWA 2J1VA 1W28A 1YCIA 4XW3A 3U11A 5C4WB 5FFOC 4YG3A 3CKHA 4B7KA 3AYCA 2BEOA 4PQQA 3PMSA 2JWPA 1SCRA 1X9PA 3AFKA 4XIKA 3ZFFA 1BMV2 3IWZA 2BGCA 4BCUA 2UURA 3AX4A 4E4SA 4LT5A 2RMU2 3HT2A 2DWRA 3D4KA 4OI0A 4JV4A 4YM3A 2NP0A 4LBLA 2RR12 1XC6A 2RS31 5FZ4A 5K0UA 5L9BA 1RXFA 1ZM1A 2L9LA 2CGOA 2WNVA 4XDPA 2YV8A 1AXYA 1QY4A 3ZX7A 4A3ZA 2SLIA 1S0IA 1RYYA 3AP9A 2WZR2 3FX3A 3BTXA 4Q26A 2EXJA 1NCQB 2RM22 3ZFEA 4QPIB 3SHRA 4A7ZA 4L2NA 4XBLA 4AVAA 1RUD1 1WCUA 5C9AA 2DCJA 4NPMA 3ST7A 4QMAA 5A3WA 4BH9A 5FZ0A 3PU8A 4PHZA 5KXEA 1BVVA 1ZREA 4RL7A 1JN2P 1YYNA 1KITA 1VE0A 1POQA 3AKPA 2NLRA 1A3KA 2P4EA 3USUB 5I8TA 2D6KA 2OA2A 1WLDA 2KD7A 3ON7A 4HKOA 2H0VA 1FPN3 5JXJA 2MHFA 4CCMA 2WZEA 1UYYA 2NMNA 1GZ9A 1O7FA 1W8HA 3OY8A 1XYPA 2UY8A 5JXIA 4LBQD 1VBC1 5LK7B 1F35A 4RQPB 1STMA 3JD72 3O1VA 4XE9A 2B45X 3VGIA 2GC0A 4RHV3 3ZYRA 1FT9A 3P5BA 3RSJA 1HN0A 1B35A 3RVHA 3AL6A 4XVHA 2VZTA 3O1UA 4UF0B 2PAKA 1YI9A 4Y24A 1W9TA 4P5YA 3V0BB 1AYN1 2R1DA 3NV3A 2PHUA 4BM8A 1G9BA 2G4IA 3UL2A 2Y64A 1W6PA 3IDEA 4ZXKA 2BNMA 1KQRA 5FY9A 1PX4A 1BBT3 2IC1A 5JMCA 1YIPA 4YGDA 5FMDA 2YPJA 4N43B 1OPOA 4SLIA 4CEYB 3H8RA 2IVJA 1YC61 3AXEA 4Q1PA 4DMIA 5J09A 4DXRA 1TMF1 3L9JT 4QX8A 4YZ5A 2FMYA 4I2OA 2F4LA 2RS32 4F8AA 1UY1A 4O9EA 5IVBA 1NG0A 5C3SA 1TVGA 3POSA 3H1YA 4OHYA 2ZHLA 4G3YC 3JBG3 5JZGA 1GWKA 5CEHA 3A7QA 4RFRB 3HBZA 4DOUA 1G9CA 1RUD2 1KFXL 1UN1A 1UZVA 1XE8A 3PVNA 4HN0A 3AP7A 3KCYA 1MQTC 2WNUC 3ZFFB 1GP6A 4Z82A 4CUCA 4IEQA 5CFDC 4IQPA 4LKSA 4CVUA 4C90A 3AK0A 1W6QA 2JECA 5K9YA 1SCSA 2GALA 4UWDA 5K0UB 2WNVB 2ZEWA 1F4AA 2BUKA 2BVBA 1VBC2 3WX5A 5FR3A 1UL9A 3T08A 4BK5A 2TBVA 4QX5A 2YFUA 2XJVA 3ZFEB 3ZYFA 3ZDVA 1NQDA 1YFUA 1GNHA 2ZGOA 5C9AB 2V72A 1H8VA 3MI8A 2ZEXA 1WW7A 4LJHA 5K8SA 2XJTA 4JQRA 5L9RA 3MF9A 1FXZA 4GMP0 1AYN2 4NOTA 2DU0A 1N1SA 1VBA1 3FL7A 4Y20B 2HEVF 2YBKA 2NMOA 4NRQA 2BBVA 1QJEA 1Q8PA 4K9SA 3LA2A 3OSDA 3KWVA 2RJLA 2R0HA 5FY4A 5BNNA 5JLVA 1C28A 1FOD3 2YG0A 4O61A 1SMVA 5BNPA 1OH4A 3OY8B 1ZZCA 1PVC1 4YVWC 1C5HA 2A6VA 1JZ5A 4YVSC 1WW5A 2HH9A 1TMF2 1AR63 5JPNB 1JYWA 3O1MA 2JE9A 2EALA 2JB8A 2ZHKA 4AR2A 2FDIA 4CU7A 4OI4A 1CQ9A 3CIHA 3OYWB 2WQ4A 1TZOA 5CFCA 4Y1XA 2DTWA 4WZFA 4CDUC 3BODA 4HT1T 2OUHA 3OUHA 2SBAA 1PZ7A 1G9DA 5CU1A 1W6PB 2A1XA 3MV11 4PBOA 4S2HA 1PO23 2JDHA 2D7FA 5FIXA 2I45A 1WGPA 4XURA 1MEC1 3ZVXA 2IFWA 2XBO1 4D3WA 5EP9A 4L9BA 4SBVA 2X5IA 3CU7A 4FFIA 1QMJA 3WW3A 4YSFA 4TXWA 3C7FA 4GWIA 1WMXA 2JJ6A 3D5OA 1JHNA 5FY5A 5DUUA 1SBFA 4CUAA 1YHFA 3VBRC 2VMCA 3H0OA 2P6CA 2V73A 1S1AA 3IPVB 1AXKA 3ITQA 4INDA 4NAOA 2XKOA 4YW6A 4KGQA 2VVEA 3RWNA 2IXJA 3KB5A 1Z7S3 2VZPA 2XJPA 4FPCA 1RXGA 3RI8A 4AHWA 5C8CC 1XNBA 2A3WA 5JZGB 2EAKA 2XJQA 1SFYA 2XLAA 4P5HA 5IHRA 3PJYA 4MGQA 3OPTA 3T3YA 4ASMB 2RVAA 3HWJA 3F2ZA 2YC4A 2R041 1O4YA 3KV6A 4WZCA 1VBA2 2TEPA 5F5IA 3KM5A 3WY6A 4Y5TA 2CDOA 1ULDA 2R0FA 2Y26A 4R9CA 2ORZA 1QEXA 1UOBA 3E1F1 2ZHNA 2DVFA 4IGOA 1W6QB 5BY5A 1PGW1 3GXUA 3KV4A 3NO8A 5AC93 4OHWA 1S2BA 3Q8AA 3N36A 2QDNA 1PVC2 2VVDA 3PTYA 4EWDA 2PTMA 4M3CA 4ZS2A 3LSDA 5LY2A 2ZHMA 3WF1A 1TEIA 1W2OA 2WN3A 4CPBA 3QCWA 4IEWA 2ZGTA 2HWE1 4XUQA 1ND2A 3CMGA 4AQTA 3O1TA 4QKDA 3ZKUA 5BV6A 2K46A 3A0KA 3WINE 1PMHX 4BQ5A 3BIEA 1G8WA 3JB4C 2E6VA 1Q8OA 1H2NA 5JR7B 4IV1C 1MEC2 1QIQA 3IN9A 2XBO2 4QDSA 4LIUA 2ZMLA 1QJFA 1IOAA 3O12A 5DG1A 2I2SA 2VE1A 4GB33 4QHOA 2RE9A 5FYYA 2D40A 3RYRA 1IPKA 2VOVA 4GJZA 1N1TA 2RDRA 3H1MA 3AB0A 3I97A 4UYBA 1SLIA 2LTNA 4B1LA 4GQ7A 3AVRA 5E1RA 1SDDB 1V6NA 2G19A 4KI5M 4M0HA 3JXSA 4QKFA 2VGDA 1ZA4A 5LBEA 5CFCB 2PHDA 4LBMA 3LPGA 2JKXA 4YWAA 4KGGA 3TEZA 5FOBB 1VR3A 3GCWA 1ZZ8A 4O9GA 3WF4A 1PO11 3H3ZA 1UYXA 1XE7A 4GA9A 4OUMA 3FBYA 4L11A 4PQ9A 3HEIA 1V6LA 4P02B 4EQVA 5F8PA 1H0BA 1NKGA 3HJRA 4OHVA 2IFRA 2VMEA 4XQDA 1ULFA 2XLFA 2R042 3K75B 4YZ2A 5A1AA 1NA1A 1V9U2 2VL4A 4QXCA 1OPMA 1HRI3 1V6MA 4AE2A 3WF0A 3HD8B 2X5IB 4AVVA 2HYXA 1UIKA 5IVFA 5C70A 1G7YA 1QXJA 3GJBA 3NL1A 1X7NA 3SC7X 3ZXEA 2Z42A 1DLLA 2BVVA 2WUHA 5F6LB 1AHSA 3H7JA 3TB0A 5FXVA 1KRIA 4IXLA 4QAWA 1HKDA 1BCXA 2JG8C 2H6CA 4QGNA 2DFCA 3WP6A 4BQYA 1XRUA 5FPVA 5LW9A 1R1ZA 1TNFA 1SG3A 2J1SA 3OBTA 4D7SA 5KHGA 3NAPC 3VZJA 1DP0A 4NO4A 4OMCA 2ENRA 1E5IA 3B02A 4PDWA 2HWE2 2HJIA 4IW3A 2WT2A 4FPHA 2PYTA 3RDIA 3O1PA 1F31A 2IVIB 5HI0A 1JZ8A 2P37A 5FZOA 1X36A 5ANQA 3KLSA 5C6CA 4GWMA 1BZWA 2GC2A 3MV01 4M01A 3ZR5A 4LK7A 3POIA 5KC6A 3C8XA 1S0DA 4LITA 4LKFA 1R091 2GP5A 1HQLA 3OF1A 4AI1A 4M3CB 3N9NA 2EXKA 4LXLA 3UETA 1OLMA 3VL9A 2A6WA 4E8CA 1WD3A 3KZ4C 3VZLA 1ND3C 2BWAA 1RUH3 1RMU1 1A34A 4CUGA 2WS91 4WBBA 1OFNA 3CL1A 5T5LA 1PO12 3WNLA 1DGWX 3L2YA 4R9AA 3LSEA 5DPNA 3G7DA 1QQP1 3ALQA 3H42B 1AR81 3BOWA 3TNQA 2FD8A 4KG0A 2BOIA 1JOJA 4JC1A 3VKNA 5L36A 4Z92B 2OVUA 2VZ1A 2RMU3 4AI9A 4DXSA 2W1WA 5K7PA 2ILMA 3LD8A 2I07B 1MS5A 1PM4A 4RYDA 1MQTB 2A70A 2RR13 1OUSA 4XJZA 3MIDA 3IIAA 5F1RA 5FY7A 1KDKA 2JDPA 4RR3C 4AAPA 1HQWA 3M1HA 4QQLA 5F37A 1KEXA 4PIXA 2ES3A 3ZSKA 2WZR3 3PURA 2R49A 2RM23 4IE4A 3SH4A 3VL8A 4ATEA 1AR91 5FO7B 2BZDA 4KBBA 1F5JA 1QH7A 2DUOA 3B00A 4HN1A 3GZEA 4HMZA 3WW2A 3N7JA 3AXDA 4CXYA 1HJGA 4YGEA 2E7QA 1ZZ6A 2VZSA 3R4UA 1OH3A 2Q8DA 1FYUA 5LRRA 2CAVA 1W04A 1DQ0A 1AYM3 4DRRA 5FZ9A 1KXGA 4MXVA 4BWOA 5FXXA 1AL21 3GCXA 4NJ4A 2W91A 1GQGA 1HJFA 4Q29A 4WM8A 5D8AC 4MXWA 3MICA 1KJLA 3ZSLA 3JD73 2W95A 3HNYM 3UV9A 1R092 4X6QB 4IERA 3LE0A 3O1RA 1Y43B 1Y7BA 2KR2A 5GLVA 1C8M1 1U0AA 4YVSB 1AUYA 4P00B 4J25A 4COUA 4W6WA 4HK9A 1OLQA 3ZO0B 4FPEA 3UJOA 3VBOC 1W3XA 4PLOA 1RMU2 5FY8A 2WS92 2XWJB 4PDWB 4RN5A 2VTXA 2W5FA 4N7IA 2DVGA 2HWF2 2YB7A 4F7ZA 5A3MA 4HBNA 3U0ZA 1G6NA 1QQP2 5FYBA 1LU2A 3KMHA 5FZOB 3CLPA 5C3OA 3NWKA 4JGZA 3I49A 5A3UA 1AJOA 1A78A 5LWBA 2E32A 5BUVA 2YBSA 4XIOA 1DFQA 1UD1A 2Y6JA 3DKWA 2RS33 4CDXC 1HN1A 1OVSA 5DQ0A 2OQ7A 1QOOA 2XL9A 3SEPA 1BK0A 1AR92 2CDPA 5HCBA 1MZEA 2R7EB 2DUPA 1RUD3 1DYKA 2Z69A 4UFKA 4C91A 5J7MA 1L7RA 4Y22A 1J1TA 4IEZA 1OXCA 1D2SA 4FVVA 4LUKA 3VBHA 2EAAA 5C8CB 1F15A 2LM3A 3TWIA 3WD5A 1CONA 4A6OA 3MUZ1 3M7AA 4AHZA 3ZXDA 2UYBA 4P9JA 1AL22 3VD4A 3T0DA 1VBC3 5A6ZA 1WMEA 3GDBA 1GZWA 2LRPA 3OD4A 2HWB1 2XR4A 4R8HA 5CBLA 3MO4A 3NSTA 4CDQC 1CGPA 1W90A 5GJ6A 1ZVFA 5EPAA 1C8M2 4LK6A 1GOFA 2VNGA 1ONAA 2B39A 1A8MA 5E6HA 5L7OC 4DO0A 1AYN3 4QM8A 4FPYA 2XHNA 3PL0A 4W8JA 2VOTA 2HEYF 2Y6LA 2CHHA 4JDNA 5T3NA 1XNKA 5K4LA 1H1MA 3U10A 1OFSA 5FZHA 2EXHA 2NM1A 1LCLA 3B69A 1HDKA 3MYXA 1GP4A 3B7MA 4IEVA 4QQ2A 5DABA 2QKDA 4C1WA 3VHRA 2VR4A 1HRV1 4JVAA 4W65A 2DCTA 4MXWB 2FCUA 4CYDA 1TMF3 3ABZA 1AVBA 2ZGRA 2YU2A 3V64A 3DL3A 3ZYPA 2X10A 1XQNA 3AMMA 2EICA 3L2HA 2QQNA 2VMFA 2C0ZA 2JB4A 5IVYA 5FK8A 5J1XA 5EJ1B 1HLCA 2PQSA 4FCAA 1YIFA 1H8TA 5DDJ1 5ABJC 2VO5A 4N9HA 3WNPA 2NYYA 4K40A 2ZTNA 4BQ1A 1N3PA 3WW1A 2A3XA 3WG2A 5JXGA 2VZVA 1CAUB 2JDYA 3B01A 3C7GA 3NNJA 4FI9A 2OXBA 5J98B 3IAPA 3MPBA 1UF2C 4JGZB 3WF3A 4COVA 5KXDA 4G4FA 3PDQA 3BIWE 3WV6A 1W3VA 4LLOA 5IK5A 3RZLA 1ZRIA 3PUQA 1IKPA 2VTFA 2JE8A 3N9PA 4G9SB 4YW3A 2GU9A 2NN8A 1E5RA 2JDAA 1TE1B 1W2AX 3KS7A 4BHPA 4FPFA 1GWLA 4I0BA 2JG9A 5H9QA 1BJQA 2DYCA 4XDQA 5LEJA 5LA1A 4XDOA 4Q4X2 1NLSA 2QJVA 4Y22B 3VBHB 1V6KA 2ZGNA 3P1IA 5LBCA 3LOBA 3WDTA 1Q8VA 3ZSEA 1O5UA 2C24A 4V2VA 1VBA3 1P8JA 2F6BA 3FUOA 2VPVA 3H3UA 2VVFA 3NNFA 2CTVA 2B7YA 4WVMA 1SLAA 3DF0A 4CA9A 1JZ4A 3FMGA 5F9TA 5J48A 1QDCA 1ZBA1 2D97A 1JODA 2PN5A 1PVC3 4AFAA 2IXKA 4LPLA 3THCA 2Y0OA 3AZXA 1DGRN 1L3JA 1UXZA 3KVBA 5T5JA 1GZWB 1VB4A 3J26N 4GIQA 1O4ZA 2D44A 4NHLA 1X8MA 2CY6A 2CYFA 3LAGA 1XNDA 2VW0A 5KHKA 1SBDA 3EQEA 4BQWA 1C57A 1UMHA 1WKYA 1UYZA 3WF2A 3UKTA 4DFSA 5DDJ2 5LA9A 4UFMA 4B4RA 4LHSA 3WG1A 1KDMA 3WT3A 3WDWA 2VJXA 1DIWA 2J1AA 4JX0A 4S2GA 4CP9A 4FAGA 2OYZA 2WA3A 1MEC3 2ARAA 2XBO3 2XL7A 4FOVA 4LBQA 4XOGA 4A7KA 1HB1A 2VBDA 4ASLA 1NCQA 4WV8A 5T5PA 4QPIA 4BDVB 2BTVC 2X53S 3VBSC 1RUG1 5F2WA 4FQ4A 2VZ3A 1F5FA 3VD7A 5IWFA 3I7DA 1LHVA 1YQ5A 4I02A 5DZEA 3WQ7A 3VBFC 3ASIA 4YM1A 2ZGMA 4LKDA 3VDDA 2WSUA 4Y5SA 3J7MA 2XUMA 3O0WA 3R05A 1WBFA 4YG0A 3WG4A 1H2LA 4RR3B 5HV0A 5EFUA 2VM9A 1I5ZA 4XETA 3USUA 2Q5TA 1H8TB 1EYBA 1Z78A 3GF6A 4M3CF 3WR0A 2QQPA 4QQOA 5FV3A 2TNFA 2R043 4MOAA 2BFUS 3I54A 1SPPA 2XDVA 3I2GA 2VQUA 4RQPA 3BCWA 3RMXA 4HOOA 3RFRA 4GALA 4ZZ5A 4I0AA 4IESA 4WM7A 3RWKX 4Y1ZA 1GYKA 4JDOA 3NV1A 2BV4A 4QKNA 2XQRA 2XWBB 4YG6A 1ZBA2 1XSQA 2NQYA 4PLNA 2P3IA 3MW2A 4PF5A 1D2QA 3JB8A 2QZ3A 5JDBA 1XSRA 3OPWA 3LEKA 3T30A 3I2OA 2BWCA 4QT6A 2JG9B 4GWJA 1H9WA 1O8SA 1PK6A 3MUY1 2WQ8A 1SACA 4QPGC 2PHLA 2QE3A 2W08A 4XBNA 4XJWA 4E2QA 5FXWA 1JOPA 4KU8A 4HPKA 3QLQA 3R4SA 2MEV1 4N43A 5F5AA 1FMD1 2HWE3 3T4VA 2FCTA 3NNGA 2YU1A 1LR5A 2LALA 2XHKA 1WLCA 2HWD1 3K4AA 4LBOA 3T09A 5CKNA 3LEIA 1JU4A 2QQLA 2QDRA 3MLKA 2RS51 4AEDC 4FXKB 5FXZA 2AEZA 3MBWA 1VBE1 2ET7A 5A3NA 3TRSB 5KHJA 1YEWA 1REFA 4N53A 1POV1 2EIEA 3CJIC 4CU9A 1RUG2 2ZEYA 1GZCA 4QXKA 5IK8A 3KHCA 1BEV1 1DGWA 2FDKA 1E57A 2VULA 4QHBA 5FP4A 3OCPA 4CDXB 1VIWB 4H7LA 3OPZA 4QXHA 2Q1ZB 2FMDA 1RJ7A 2VH9A 2WJSA 4L97A 1LRHA 4ZKTB 5C5UA 5JSRA 1DQ6A 1PO13 5EHDA 5C5TA 4QD2A 4OZXA 5FZLA 5LA2A 1RHI1 1APNA 4BIFA 2OPWA 4CP9B 1YNAA 3LA7A 4YM2A 4X8PA 1Q8QA 2YY1A 4HVRA 2OUJA 3BU7A 3RZZA 3OD0A 3C2UA 3NJZA 4IV3C 1UKGA 1QXRA 3J7LA 1RUC1 4LBQB 4CDWC 2ZX4A 1VMHA 5HCFA 2VU9A 5T5OA 3VDAA 4OI2A 4YYOA 4AQ6A 1MVEA 2R30A 2VBPA 4QHZA 2A3YA 1RIRA 3CZUA 3CJXA 4XXAA 3GALA 3VDDB 1WCQA 2VAUA 4FXGB 5FPXA 1NQJA 1G9AA 5I8YA 1JYNA 2C5DA 4Y20A 3V65A 2H6BA 2WO7A 1S2EA 1VLNA 2A5ZA 3OG2A 3LWCA 4AFMA 2PHWA 2QUOA 5JOWA 3BYWA 1R64A 2HEWF 3VLBB 2MEV2 4LE4A 3DXUA 1FMD2 5FBZA 5JPMB 5IK7A 1ZZBA 2ET1A 4IEXA 2ARXA 1W9WA 5IFPA 1OUXA 1SPPB 3GZAA 3Q8BA 2HWD2 3VD5A 1PHMA 5SV5A 3WQBA 2V5YA 1CAWA 3DCQA 5D21A 4WM7B 3NJYA 3I3QA 2DURA 2RS52 5DUVA 1CD3G 3I2IA 1NXMA 2KM2A 3NKGA 3OYWA 1VBE2 1U5XA 2A71A 3PUHA 4HG6B 2N7GA 4A44A 1WCSA 4BOWA 1JYXA 3IB3A 1O5LA 1R093 1G9FA 3P3PA 4DPNA 5I0DA 2C4XA 1DLCA 2O14A 2WZ8A 2Z2SB 4EROA 4JTNA 4LOSA 1BEV2 1PK6B 3OGGA 1W6OA 3HT1A 2Y6HA 1DHKB 1LEDA 4HPKB 1UMZA 3OGSA 3OUJA 1RMU3 1BHGA 2WS93 4Q0QA 4EN6B 4JAAA 3IMMA 3E6DA 2W68A 3UKVA 5C7GA 1RHI2 3EHKA 1QQP3 3RJ2X 1ZRFA 1AR83 3POJA 3ZSJA 1I6XA 3SEEA 4NUBA 4Q0UA 1IPSA 4NIGA 4OFGA 3ZXJA 3IPVA 5DAVA 3ZXKA 3H8UA 1RUC2 2VQ0A 2NPIA 4Q1RA 1BLZA 1NZIA 2Y60A 1LTEA 4N53B 1ULCA 1KD7A 1QXPA 4ISRA 2DDUA 3URFA 3V0AA 3SCHA 3DKQA 5GLUA 2WWSA 2P5BA 1AR93 2ZGSA 3KSCA 1UY4A 4M3CE 1UMIA 2YXSA 4O65A 1HV1A 4L8QA 1XYOA 2ZX0A 3ZFGC 3CEWA 1REDA 2UWAA 4QPGA 5FYSA 2XPJA 4XAEA 4MGSA 3VUOA 5HCHA 1GICA 3SXWA 3FFQA 2H0BA 1FI2A 1JXNA 2DU1A 2BNOA 1AL23 2GDFA 3HPNA 4NHYA 3OGJA 1OF4A 2V09A 3D0SA 1WCDJ 1AJKA 1MS8A 4YW7A 2P6HA 2G1MA 2DUQA 3OBAA 1C8M3 2KA3A 2P2KA 1CESA 4NHXA 3I2JA 4R52A 3POGA 2Q0AA 3BN6A 4FPJA 4HSLA 4TWTA 4U36A 1Y9QA 2LS6A 4YPJA 3GBGA 5IVVA 3QH7A 3I2KA 1L7QA 5F7UA 4LORA 5LZ6A 2BPA2 5LRSA 2E26A 4JHTA 5KC5A 1YI7A 1HB2A 3KCCA 2FDFA 4IGQA 4BQXA 1CAWB 5FZGA 3K51A 2G9GA 2ADDA 2E33A 1OOPC 1W99A 1LODA 2PFWA 1C8NA 2YGMA 5A33A 1LGBA 3ILRA 5FP7A 3WNOA 4UW6A 2Y34A 2A6ZA 5GALA 4NN0A 2V5DA 5KBFA 1O3QA 2BFUL 4XF9A 1AR71 1FX5A 4EV0A 2HBUA 4U2AA 2G9ZA 4XZPA 1ACCA 1W6OB 1X33A 4ARYA 2HLEA 1U5ZA 1JZ2A 3ACGA 3SQOA 4Z2WA 4META 1QGLA 5BYNA 1XOYA 2IXLA 2QZ2A 1VBD2 1UOFA 2QVSB 3WOGA 4I3PA 2VOKA 3FJSA 3ZR6A 2QNKA 3I3DA 1ODNA 5IATA 2ETEA 1UY3A 4C8DA 2VZUA 4MHRA 3KV5A 4P9WA 1UPSA 4QGLA 2WIIB 2ZZJA 1XYNA 4RS5C 1GOGA 3KV9A 1K12A 1R1A1 1W2TA 2VZOA 4XHBA 3WP5A 3V0AB 2A6YA 5FP3A 1F2NA 1D4M1 1FNZA 2HWB3 2R16A 3IBMA 4LUMA 4LULA 1V9U1 4A41A 4CCCA 4CCLA 2LROA 4AHXA 2PLV1 1OLME 1C4RA 3QBQA 4CXXA 1D4VB 3H3LA 4QPGB 3VKLA 1WA4A 1Y4WA 3AC0A 5GZDA 1QU0A 4A45A 1QJY1 1N47A 4LHNA 2RHPA 3DPRC 3FUQA 4YZ1A 4LEJA 1GSLA 4QPWA 4FFHA 2FDHA 5CADA 4B1MA 5H9SA 1S0GA 4XABA 1HRV3 1PMIA 4V2WA 1E5HA 1GANA 3TN92 4Q27A 4AEDB 3S57A 4KU7A 5DAQA 1LOBA 1AR72 4TSVA 2GC1A 5KHIA 5FKBA 3AP6A 3GGLA 4YFWA 1IS3A 2LW8A 5FDBA 3IDBB 4R4XA 2WO1A 3B94A 4EWAA 3ENRA 3OGRA 1XNAA 3ILFA 1UNBA 4I30A 4PI0A 3LDRA 5DDJ3 1VMJA 5FZMA 4L99A 2R061 5FZ6A 4URAA 3WNMA 4B8EA 3W9AA 2O1QA 4XQ4A 1UOGA 5JXHA 1MQTA 2WNUA 5C8WA 3OEBA 5H9RA 3VD9A 3NKTA 4ZXEA 3PHMA 5CFDA 1DGLA 1U5YA 2ZOEB 3VZKA 1QJZA 5B4NA 4N8MA 1CR7A 3CO2A 1OKOA 5A33B 4MGTA 4FT8A 3OGVA 5GZEA 3A22A 3MLLA 1KS4A 4IV3B 4BLJA 4YW1A 2Y0IA 2QQKA 2ORXA 3QH6A 3S5QA 1R1A2 1W6MA 1PZ9A 4JHZA 4XZUG 3WXPA 1I3HA 1T2XA 3M3OA 5CA6A 3AKTA 4AEJA 2B5HA 1D4M2 1OD3A 4ORFA 4P9LA 1O3TA 2B46X 4XFHA 4M0NA 2WO2A 1WW4A 3O5SA 4BB3A 4DQAA 5E88A 2ZGUA 2WLQA 4XUTA 1GP5A 4FPKA 2PLV2 3UKNA 2QQIA 4N7UA 5FCCA 4LE3A 5CG9A 5FY1A 2Z4FA 1VBB2 4Z2AA 4JGYC 2FCVA 1HIXA 2VMDA 3LPFA 4COWA 3O1SA 2WT1A 3I3EA 1AX0A 1MS4A 1QJY2 1S0BA 3TBDA 5ISLA 1ZX5A 2IWGB 4Y4RA 3ZYJB 4CU8A 3HOBA 4YVWA 3SCFA 1ZBA3 4YVSA 1UY2A 4XCBA 4F3JA 3U1XA 2P3KA 1FNYA 2VMGA 3OUIA 3AZZA 2J1TA 3GYDA 5A7SA 4B4PA 3IM0A 5BNOC 1C5IA 2VQAA 5EIYB 3DECA 4KWKA 1LHWA 2ZKNA 3B9CA 1W8ZA 4FOWA 4BQ4A 5JSOA 4CDUA 2ZCWA 2JD4A 4DEQA 5FMBA 3H50A 5CVRA 1RGSA 2R062 4NIAA 3C7OA 3GHNA 1W0PA 2Y6KA 5GZCA 5JUVA 1N3QA 3K48A 2VCAA 1CAXA 2ZEZA 3UYJA 4GXLA 4EN8B 4ISQA 1CX4A 1ZNPA 4NPRA 2ZX1A 4HKLA 4YW2A 3MW4A 3PLQA 4CCEA 3MIGA 4FTEA 1PIV1 2BRTA 3TNPB 2R6QA 4I3GA 3VBRA 5F3CA 1ULGA 1XU1A 1RUG3 1VPHA 2FHRA 3A0NA 1H2KA 3JU9A 4JTOA 4N9IA 4IEUA 5FMCA 3ZYIB 5CIRA 1DDLA 3AP4A 5JI7A 2HWF1 1V0AA 1GWMA 3GM8A 4XMIA 5C8CA 1K5MC 2DCZA 4RS5A 2IZWA 4HANA 4HONA 3WHTA 4CSWA 5JSPA 4RGAA 1MS9A 1QWRA 4MZUA 5T50A 4OUSA 4PBPA 5L19A 3RPQA 3DUIA 3GJAA 4TTGA 2P1BA 2RDNA 2WO3A 2WNUB 2WYFA 2HKXA 3PIJA 3G6JB 1GFF2 3TEYA 5CFDB 4LTAA 4DB5A 3HNMA 3AJZA 4CRQA 3AM2A 3N7KA 2CAUA 3QD6A 1HX6A 4XJ8A 4MG2A 1UKRA 1EPWA 5I0TA 1RL3A 1LOGA 1V6IA 5JCTA 1MS0A 2E53A 1H6XA 1JZ3A 5JOXA 4D94A 2Q8CA 1ZYBA 2XUEA 4QDQA 2D6LX 2R32A 1ZBE1 3DPRA 2K0GA 2JKBA 1CIWA 3BTZA 1W6MB 2WA4A 3JQWA 4AI2A 3C3VA 2RJ2A 4LR4A 4OUEA 1FV2A 4QDRA 5FJKA 1IG3A 2F4PA 4H2AA 2W46A 3PVEA 3W58A 1XBFA 4BISA 2GSYA 4D0QA 4XTPA 1DGRA 3ES4A 2MEV3 1FMD3 4GMP1 2CGPA 1QNWA 4LQRA 4OZOA 2WFF2 1XU2A 1CIYA 4UFLA 3THTA 2HWD3 2BBAA 4LLFA 4AEMA 5DAPA 2KXLA 1VJ2A 3BVCA 3MGUA 1NX9A 3PVOA 4IV1A 4DUWA 4QWNA 2DTYA 2VUDA 2K2SA 1O59A 3MIHA 4PLMA 2RS53 2RS11 5LEKA 4YVWB 3ZSMA 3UT0A 1OA2A 1OF3A 1EP0A 1VBE3 2XLGA 1PIV2 4EZHA 2UYAA 1POV3 1ALYA 4UAPA 4COZA 1OOPB 4MGKE 1BEV3 3HQXA 3OOXA 3WUDA 4CTEA 4ES9A 4CDUB 4YGCA 2YPDA 2XGXA 1CAUA 3O7OA 4BMBA 2GH2A 3ZN5A 3VBUC 4K3UA 2AR6A 2XJUA 2BNNA 1RHI3 1J84A 5C3QA 1W05A 4UFIA 2C9AA 1CAXB 4R4ZA 5FZ3A 4BQ2A 1Y9GA 2JIGA 2EIBA 5FUIA 2C6SA 4FSJA 2LUWA 4Q4Y1 1SBEA 3HMYA 1RUC3 3OBZA 4XILA 2PHTA 1LEMA 3ETQA 1X82A 2B42B 5EJ3A 3VBRB 4Z1VA 3MLJA 3DYOA 5EV7A 3U4SA 3K2OA 1ZBE2 5J36A 1JI6A 1LHOA 2JG8A 1PGL1 3MFAA 2WRAA 1YWKA 1LOEA 2GNMA 1QKQA 4W50A 1RUF1 4CZSA 4RS5B 4URTA 4M4RA 3NAPA 5FPBA 4XJAA 4A7YA 5B2GB 4XJUA 5FPUA 2QQJA 2ZMKA 4YLZA 2GH8A 3K46A 5EYYA 3WCSA 5C4WC 4YFZA 1AXZA 4OULA 4EYUA 1JZ7A 3HQRA 3FLTA 4NVPA 4K8RB 2AREA 4J1XA 2R071 2Y33A 5CKQA 4P9GA 1CAVA 4FP2A 2AYHA 2GP3A 3R4DB 3T2QA 4OI1A 3P3NA 2G9FA 2RS12 5ERLA 3AMHA 4Q4X1 1PZ8A 3FWEA 3DPRB 1AF9A 4Q0VA 1QDOA 1DQ4A 4Z07A 1LGNA 2VBBA 1DG6A 4HLTA 1WW6A 1Y3TA 3ATGA 2CWSA 1ND3A 3SKVA 1ULEA 4LO5B 3S5AA 5FKCA 4CCOA 1H30A 3BUCA 3A4UA 4OHZA 3AYDA 2BJSA 1M4WA 1SLTA 4AOCA 3EXUA 5DG2A 1WD4A 3S30A 4EN7B 4RGGA 3ACFA 4IV1B 2GN3A 5A80A 5FYVA 4D7TA 4YNIA 4Q4Y2 2CSGA 5FZFA 5CAZA 4AHYA 2EIDA 2TUNA 3EYPA 4RR3A 3H9AA 5FZIA 4FFFA 5IVJA 2BU9A 4XFBA 4QKBA 4A3XA 3N35A 2CNAA 4TZDA 4AF9A 4AL9A 3T1MA 5HCAA 1PGL2 1RUI1 2VZQA 5F39A 1SQ4A 5FLHA 1BKZA 4WVVA 2JD9A 5A3OA 1UO9A 1RUF2 3H8OA 2PELA 4ONUA 3PMEA 4D8MA 3LIGA 4UFHA 4D7YA 5FWEA 4MX3A 3WUCA 2JDUA 2R072 1VAVA 4HVOA 4LOTA 1DF0A 1PO22 3GHMA 3KGLA 3PJQA 4Y3OA 5FYMA 3SMHA 3DN7A 5D8AA 1OLRA 4XUNA 3ZM8A 4D6QA 2K9ZA 2FDJA 3OB8A 4IE5A 1XNTA 1LOFC 4DEVA 2JG8B 1VB2A 4KWJA 2CL2A 2W9XA 4GWNA 2JDKA 4ZPIA 2AC1A 3KT1A 3NAPB 1NCRC 3O0XA 1VP6A 3MIEA 4CEWC 1ZRCA 3VBOA 3VZOA 5BNOB 5A7QA 2EXIA 1OVPA 2Y6GA 1R081 3OEAA 3ES1A 5EWSA 3ZFFC 4YARA 4AW7A 3EB7A 3FBMA 4JZRA 4FO9A 4IEPA 1IS4A 1KS5A 1ZZ9A 2ZMNA 4HVQA 3POYA 2Q8EA 1CAVB 5FO8B 2AUYA 3WNXA 5A6QA 3PNAA 5A6XA 3KT4A 2I74A 4V1PA 1EUUA 4B4QA 1MZFA 4CCNA 5K0UC 4S2DA 2WZPP 4CP0A 1RUJ1 3S0MA 3AJYA 4MO3M 1UU5A 3MW3A 4CP2A 3IAQA 3N9OA 4CDXA 1SEFA 1QJU1 1D7PM 1XNCA 3ZFEC 1S0CA 2WN2A 1AR73 1RTVA 3VDCA 5A3LA 5C9AC 5IK4A 4M00A 1JTZX 5BNQA 1RUI2 1ND3B 3IDCB 1DQ2A 1SLLA 1UOJA 4IUGA 3VZMA 4IETA 4AVCA 5HV4A 4XHXA 4ZU4A 4GD4A 4E2GA 5JOYA 1GQHA 3I3MA 2BP6A 1CVNA 1K5MB 2EVXA 5DAXA 3SH3A 3UESA 1U5IA 1S4CA 1V6OA 5FZBA 4E4DX 1PNFA 2E9QA 2XVKA 3LEMA 3ILNA 3ORJA 5T54A 4XXPA 2W1UA 4UW4A 2ID4A 3MIBA 1OD5A 4KWUA 2W2IA 2DBNA 1ST8A 5FZCA 3E5UA 2OW4A 1O3RA 5F3GA 5FWJA 1ENSA 5FZ1A 4QX7A 1B35C 5FUNA 2Q1MA 1MZ6A 1R1A3 3NV4A 4GAZA 3N7MA 1UIJA 1WWYA 4CDQA 1DZQA 1JMUB 4JDMA 4DXTA 1D4M3 2YDEA 4KG8A 1DYOA 1LOAA 4Y26A 5DUWA 1OA3A 2XVLA 4K6BA 1JYVA 1JYIA 1V9U3 5FYCA 5L7OA 3AMQA 3IDAA 5FYZA 1TG7A 4ASKA 2PLV3 5I93A 2VNOA 4QXBA 3N4MA 1WCKA 1R082 3K3OA 1AX2A 1IHMA 4LO8A 4A2UA 2GNTA 4YGBA 2WNEA 5GM0A 2IUWA 3D8CA 4KQ7A 1W9SA 4NWVA 4DS0A 3DGTA 1QJY3 2GNBA 3LEGA 3CNAA 4Q5OA 2W39A 5KXCA 2VMIA 3MIFA 2IXIA 3LDKA 3A21A 5D8AB 3AZVA 3PU3A 1LOCA 4K1YA 4OMDA 1RUJ2 1IG0A 1XXNA 4QM9A 5C71A 1COV1 2YFZA 4Q4V1 1GMMA 4GKYA 1QJU2 4K1ZA 4R9DA 4A4AA 3DXTA 3EO6A 2W92A 3MZHA 3W59A 4FFGA 1YQ8A 4RA0A 4XUPA 4DRVA 4NRMA 4CXWA 3TYJA 5ABJA 3EMRA 3VBOB 4C1XA 3B3QE 4FQZA 1G86A 5H9PA 2RDQA 3FC0A 4XF3A 2R063 1OHFA 3JCIA 3ZYHA 2AACA 2EA7A 3CZJA 4AK3A 1YXWA 4COYA 2XONA 5IAVA 2W3JA 4E2SA 5JI9A 1OQDA 1VRH1 5KXBA 1URXA 2OIIA 4FTBA 5EXOA 3NRUA 1ENXA 4XBQA 2QQWA 3IMNA 3SNMA 4XPVA 1ZRRA 2J1EA 5LCWL 4LO4B 1NZCA 1A6CA 4RFT0 3RRDA 4QQHA 4OCTA 3VHPA 5I0SA 4K8FA 2VC9A 2FBEA 4D6SA 2EF6A 1GBGA 4BLIA 3IT8A 4NHMA 2XB6C 5FPAA 1QNYA 4B29A 4IL7A 5LBBA 5DUXA 2J7MA 1Q8SA 1UW8A 5A7WB 1VRBA 2DFBA 5BNNC 1C1LA 2D98A 3ELNA 2RJKA 5F5QA 5GLZA 4KWLA 1TME1 3BPSA 2AZ5A 5BNPC 4E27A 2Q30A 1HXS1 3SKJE 1J3QA 3E5QA 2D6OX 3SITA 4AI0A 1ZRDA 2BDRA 1WBLA 4OHXA 5F2SA 4AGVA 3D0JA 4IE6A 4AI3A 2QBXA 1GZTA 1PM7A 1COV2 2A7AA 2A73B 4Q4V2 2P17A 3NNMA 4HSJA 5IAXA 1F8VA 4IE0A 4CDQB 5CFCC 1N1YA 2O8QA 3UJQA 4FPOB 2VUJA 3NV2A 5CYYA 3ACLA 1SLCA 4I01A 5L7OB 1ULPA 3PIGA 4AEKA 2GMEA 2RDSA 1WZXA 3MFCA 3TEWA 5HXMA 1V70A 1LHNA 1LULA 2WFF3 1UU4A 2BERA 3AKRA 3BOPA 3OTFA 5L9VA 2X5IC 3PVBB 4PT6A 5E16A 1QHDA 2JDZA 4TLFA 3WVJA 1VRH2 3O0VA 1AYM2 2YC2A 5LB6A 3VBSA 1PIV3 5JMOA 4AFDA 1W8WA 3EBRA 1CN1A 5A1FA 1OSGA 3CQOA 4YRDA 2E31A 3NW4A 5CB7A 3VBFA 3KD4A 4CCJA 4X6RB 2J1RA 4ZU7A 3FZ3A 2HWF3 3R0RA 1PVXA 4ET7A 1W9FA 4IE7A 4P9YA 1Q5OA 1H4GA 3POWA 5ABJB 5FYHA 1UCXA 1NLRA 4LA2A 1FV3A 5A70A 3E6CC 3Q9OA 4Q0PA 2UY9A 4H55A 2IXHA 3M4FA 3ZN6B 1TME2 3IZOA 1WMFA 2BOJA 4MHUA 1QF3A 3U78A 2GC3A 2Y38A 3ECQA 1HXS2 3VKMA 4Y4YA 3NVCA 4PI2A 5GZFA 2ARBA 4OQ8A 2VD7A 1ZZ7A 1ZBE3 4MGZE 4A6SA 4NPLA 4Q4W1 3S7IA 2YBPA 4KBZA 1F4HA 1VBD1 4LO7A 1OQ1A 2V4AA 1N1VA 1K3IA 3HQUA 3LOIA 3OJBA 3BKZA 1ND2C 3WLUA 4BXSV 4AG4A 2B9VA 4TLGA 5FPLA 1YJKA 2WAAA 4GMP3 3M8LA 3VHNA 4FBFA 1NCRB 1K45A 4EJRA 4CEWB 4K21A 4MUVA
chains in the Genus database with same CATH topology
1H9PA 4DY3A 4LHKA 5FMOS 2ERFA 1JUIA 3OBRA 4AEDA 5DZGA 5J3UA 2B9UA 3ZMNA 2RS13 3QOPA 4XFIA 4PIYA 3CJIA 1LB2A 2VW1A 2D3PA 4XJ9A 1NY71 2YC0A 5JIUA 4AVBA 4ZU5A 2VXRA 3RMYA 3DV8A 4FOQA 1RJ8A 5ACA1 1EPZA 2CV6A 3INAA 2YMZA 3APBA 1NA1C 1UU6A 2E7AA 1LJ7A 4ITCA 4LHLA 1S0FA 4S2FA 3J4UH 3ZN4A 4AFCA 4BMEA 1X8EA 5T55A 3TN91 3HIFA 2D3SA 4IV3A 2PAMA 4AYUA 4E9KA 4KNCA 4CDWA 4Q4Y3 1RITA 3VBSB 1EAH1 5IT6A 1AL0G 1SFNA 2ZX3A 4BZ4A 3VBFB 1F9KA 3ZIWA 2VECA 4PIZA 3WDYA 4XF1A 3KQRA 3I4IA 3LGRA 1CPMA 3H1WA 4Q4W2 2D3RA 2DVDA 1RUF3 1B35B 4PDWC 1BK1A 3ZXGA 5GLTA 4MVTA 2D5FA 4AVSA 3N3HA 3AFGA 2R073 4KH9A 1RVF1 1GR3A 2R1BA 5HXVA 2CWMA 2PHFA 5GKAC 1ENRA 4AI8A 1I1EA 1OQEA 4NWWA 4Q4X3 1NOVA 2XKPA 4QPYA 2WC2A 4BIOA 2UWCA 3B9IA 2YGLA 1VBB1 1GNZA 1NY72 5JAXA 2WKKA 1JBCA 3WCRA 2ZX2A 5ACA2 5AFEA 3J8F1 1UPIA 2AGSA 5I91A 2O0OA 1IGOA 2WQZC 4GKXA 4FOYA 3HN1A 1JW6A 2ZJCA 1EV11 1J1LA 2JEMA 3ROUA 2ZGPA 4Y1UA 3CJIB 1EAH2 4I0WB 5AVPA 3BTAA 4Q2FA 1UAIA 2PQQA 3MPPG 2Z79A 1O3SA 1OMIA 2ZZQA 1ASJ1 1RUE1 3BPZA 3LA3A 4LBJA 1RUI3 4K20A 1EY2A 2PHRA 3ME2A 3GZTB 1REEA 4F83A 5I0RA 2ZGLA 2BYVE 1AZDA 3AMNA 2DVBA 3ZFGA 2VUAA 4OLLA 1VALA 2ZAAA 4RD7A 4HK8A 4NHKA 2JE7A 2ZGQA 4GH4C 2OZ6A 1YJLA 4EWEA 3TAYA 1YFWA 5I8SA 1AX1A 4CDWB 1RVF2 2HWC1 1QJX1 1LKNA 5FOBB 4TYSA 4WM8C 4DINB 1D0HA 4CP1A 1J3RA 5BNNB 4HL0A 4GULA 2WT0A 1LGCA 4LA3A 5BNPB 1CJDA 1DQ1A 1OA4A 1MZ5A 1QOSA 3RG0A 4FTSA 2DCKA 2QCSB 5AVAA 4XEZA 5J96B 2E63A 2ATFA 5L73A 1R083 3WG3A 2GAUA 3J8F2 2PHXA 4IEOA 4JGZC 4UW5A 3RYKA 1OI6A 1RUOA 4MV2A 1OOPA 1EV12 1O91A 1HV0A 1RUJ3 3WDVA 1WMDA 1ENQA 3WZ1A 5DXDA 1A8DA 4LNVA 1QJU3 1PGW2 4WVZA 2EIGA 1YRZA 2WFF1 4R9BA 1ASJ2 1RUE2 3U07A 2DF7A 4MH0E 3VBHC 5FOJB 4JRAA 2VY0A 5FPZA 1IS6A 5E8AA 1J3PA 2ZPXA 5DZFA 3B93A 1FPN1 4Q8KA 3RS6A 1DYPA 1UZYA 4XFFA 1DU3D 3VZNA 2JENA 5A32A 3HAGA 2HWC2 1QJX2 3FLPA 3MF6A 4RHV1 5FRAA 5T52A 2JICA 4XTMA 5IUQA 3VN4A 5FMOL 1J58A 4YM0A 2C1FA 1YUDA 1DZRA 3I59A 1SLBA 3ZFGB 1BBT1 2GMPA 1CPNA 2JXAA 3H7YA 1ND2B 2PAEA 1YLLA 2D6MA 2P3JA 1S2KA 4KL1A 5E89A 3M70A 3M2MA 3TOJA 4AGRA 4LBNA 1W0OA 1HW5A 5F6KA 1SDWA 3ZXAC 3V56A 1MS1A 2D6PA 2YZ4A 3LB9A 1TQ5A 2DV9A 3WDXA 1COV3 3JBG1 1W2UA 4Q4V3 4BA6A 4C0HA 4PJYA 3I8TA 4XFGA 1FATA 2GN7A 1MR5A 5FREA 1W6NA 3AYEA 3JUUA 1H8TC 4H3WA 1RUNA 2UU8A 1H1IA 1TNRA 4XQWA 3VKOA 3D82A 2Q4SA 2PA7A 4DNYA 1FPN2 2FZ2A 4FP3A 4H7MA 3BALA 3WW4A 5GLWA 1VRH3 4I09A 5JWPA 1LESA 1NA1B 4UXAA 4UBGA 3FLRA 3GZUC 4GH4A 3LCPA 2XH6A 3AP5A 1S55A 4RHV2 2CGNA 5FLJA 2JG9C 1T6GC 3RJRA 1RINA 1BQPA 1H1AA 4Q8LA 2IXCA 2VOWA 4B3NA 3WHUA 4QGMA 1CJPA 3GBFA 1NE4A 4DZGA 4EN9B 4B7EA 1BBT2 4DY5A 4IEYA 1JH5A 2BQPA 3FHIB 4JGYA 4XYXA 1FOD1 3O14A 3RQ0A 5FO9B 1GV9A 3U4XA 1UX6A 5A32B 1I9RA 1TME3 4P9XA 1POV0 1AR61 2O8OA 4XF4A 1AR82 3UK9A 1HXS3 2ZABA 2VOXA 5FAXA 4FPGA 2D5HA 2GZWA 1X50A 3JBG2 5BNOA 1GLHA 5JOZA 2A6XA 4XFCA 5SV8A 4J6GA 5CNAA 3RYPA 2E51A 3JQXA 3I59B 1FAYA 3X29B 1WUVA 2GNDA 4YW5A 1PO21 1KJRA 2ZGKA 4MLOA 4XFAA 3ZDSA 1LHUA 3IKWA 2ZBJA 3AKSA 2FQPA 3D6EA 2YROA 5GZGA 2B8MA 1NCQC 4QPIC 4BPZA 3LZZA 1S0JA 1WLTA 4NR1A 1J59A 3RI9A 1C3HA 4AQ2A 4AVTA 1B09A 3MEPA 4Q0SA 3VDDC 1Z7S1 4EN0A 4YZ4A 1IS5A 1W6NB 1K5MA 2XJSA 3E97A 5EZWA 5D1IA 1C1FA 1O4TA 1NXD1 3KT7A 1S0EA 4BE3A 1W39A 1JYCA 5JVVA 3THPA 5FQ0A 1Q43A 4MGIE 4E4ZA 4RQPC 3T2TA 3ZMOA 4C0BA 1FOD2 4WM7C 5AC91 1Q56A 2YHJA 3B5LB 5TSWA 3N7LA 4GH4B 1AR62 2W0XA 1PNGA 1IQAA 1PK6C 4WM8B 4ES8A 2XG3A 5J37A 3RNSA 4OVEA 4Q4W3 4P14A 4XF0A 1VBD3 4N43C 4CEYC 2YYOA 2DVAA 5AFBA 1OKQA 2WLPA 4MSVA 1VAKA 5JIAA 1UZZA 4DXZA 4HFSA 4JGYB 4MYEA 2NZ9A 2VG9A 4XMAA 1DZTA 4D69A 2X8KA 4RSUA 2JX9A 1IPJA 4GB31 3VHOA 1HQNA 4P9IA 1WLWA 2UWBA 4N53C 3M3CA 2XJRA 4BYYA 1Z7S2 3AMPA 3E6BA 4FPLA 4H14A 3LKJA 3WP3A 1D0GA 1LENA 2GMMA 4PCRA 2AENA 2AH2A 2VW2A 2HWB2 2WL1A 3VBUA 5ACA3 1HRI1 3MDPA 2ZKLA 3R6SA 2WNVC 1M06G 3I2DA 2X29A 2E7TA 4L92A 4LO6B 5I0UA 3TN93 5AC92 4YZ3A 3AZYA 2HYKA 4AQSA 4QU2A 3SLIA 1RC6A 1EAH3 3QACA 3ZXFA 3ZIXA 2DCYA 1YO8A 4WVWA 4K7JA 1HRV2 2A75A 3HR9A 3KCXA 3CF6E 4FAHA 1VAMA 5C33A 4HZFA 5FTTC 3S7EA 5C4WA 5FQ0B 2D43A 3VV1A 1IZ3A 1YFYA 5HBAA 1RVF3 2D93A 4GB32 1MACA 2ZA9A 2P34A 3BB6A 1Q3EA 3GBWA 4JCKA 2Q8OA 3FFZA 3SH5A 5BPXA 5LK5A 3SISA 3WDUA 3ZXLA 5FLIA 3S6PA 3VKFC 2QFEA 2YUEA 4W6YA 1RUH1 1DQ5A 4J1WA 3ZPYA 1VBB3 1QH6A 1MVQA 1MS3A 1RB8G 1V00A 4Z8BA 4MGYE 3M3EA 1BMV1 1LU1A 1GKBA 3SCGA 4N90A 4Y1YA 3ZYGA 2WSVA 4AWDA 3J8F3 2RMU1 1JUHA 1HRI2 3SCFA 1IKQA 2MNGA 3FE5A 2WINB 5BXXA 2MPFA 2RR11 3M3IA 3E5XA 2W52A 1EV13 5JZGC 1PGSA 1NE6A 3GNEA 2WZR1 3USSA 4EJRA 3T1LA 2RM21 4X8NA 4Y5Z0 1BYHA 4YW4A 1KFUL 1U12A 3WQ1A 2VNRA 1H2MA 2OPKA 1ASJ3 1RUE3 4ATFA 5EYXA 4AGGA 3V0BA 1YFXA 2XVGA 2FZ1A 3AZWA 2ZACA 3VBUB 3WP4A 3J9SA 4W6XA 3ZN6A 1V6JA 1AYM1 5KHHA 1NYWA 1LECA 2OZJA 4Y1VA 4LBKA 4CEYA 3WQ0A 1H4HA 3M3QA 1DBNA 2HWC3 1QJX3 2BW8A 2D6NA 3AKQA 3JD71 1BXHA 4JRLA 3JZVA 4UBHA 4WVMB 2ZAHA 1Z0HA 1QOTA 4UW3A 1LOFA 3EJKA 2Z5WA 2ZS6B 4AXOA 2WFPA 5CG8A 3KGZA 4AFBA 5KWRA 1N3OA 1RUH2 2VMHA 3AYAA 4HKWA 1NCRA 4HETA 4QQPA 4CEWA 1YCIA 4XW3A 3U11A 5C4WB 5FFOC 4YG3A 4B7KA 3AYCA 2BEOA 3PMSA 1BMV2 1SCRA 3AFKA 4XIKA 3ZFFA 3IWZA 2BGCA 4BCUA 2UURA 3AX4A 4E4SA 4LT5A 2RMU2 3HT2A 2DWRA 3D4KA 4OI0A 4JV4A 4YM3A 2NP0A 4LBLA 2RR12 2RS31 5K0UA 1ZM1A 2CGOA 2WNVA 3ZX7A 2YV8A 1AXYA 1QY4A 2SLIA 1S0IA 3AP9A 3FX3A 2WZR2 4Q26A 2EXJA 1NCQB 2RM22 3ZFEA 4QPIB 3SHRA 4A7ZA 4L2NA 4XBLA 4AVAA 1RUD1 5C9AA 2DCJA 3ST7A 5KXEA 4QMAA 4BH9A 1BVVA 1ZREA 4RL7A 1JN2P 1YYNA 1KITA 3AKPA 2NLRA 1A3KA 5I8TA 3USUB 2D6KA 2OA2A 1WLDA 4HKOA 2H0VA 1FPN3 2MHFA 2NMNA 1GZ9A 1O7FA 3OY8A 1XYPA 2UY8A 5LK7B 4LBQD 1VBC1 4RQPB 3JD72 4XE9A 2B45X 3VGIA 2GC0A 4RHV3 3ZYRA 1FT9A 3RSJA 1B35A 2PAKA 1YI9A 4Y24A 3V0BB 1AYN1 2R1DA 3NV3A 2PHUA 4BM8A 1G9BA 2G4IA 3UL2A 1W6PA 3IDEA 4ZXKA 2BNMA 1KQRA 5JMCA 1BBT3 2IC1A 1YIPA 4YGDA 2YPJA 4N43B 1OPOA 4SLIA 4CEYB 3AXEA 4Q1PA 4DMIA 5J09A 1TMF1 3L9JT 4YZ5A 4I2OA 2FMYA 2RS32 4F8AA 4O9EA 1NG0A 3POSA 3H1YA 4OHYA 2ZHLA 4G3YC 3JBG3 5JZGA 3HBZA 4DOUA 1G9CA 1RUD2 1KFXL 1UN1A 1XE8A 3PVNA 4HN0A 3AP7A 3KCYA 1MQTC 2WNUC 3ZFFB 4Z82A 5CFDC 4IEQA 4IQPA 4C90A 3AK0A 1W6QA 2JECA 5K9YA 1SCSA 2GALA 5K0UB 2WNVB 2BUKA 2BVBA 3WX5A 1VBC2 1UL9A 2TBVA 4QX5A 2XJVA 3ZFEB 1NQDA 1YFUA 1GNHA 2ZGOA 5C9AB 1H8VA 3MI8A 1WW7A 5K8SA 2XJTA 4JQRA 3MF9A 1FXZA 4GMP0 1AYN2 4NOTA 2DU0A 1N1SA 1VBA1 4Y20B 2HEVF 2NMOA 2BBVA 1Q8PA 4K9SA 3LA2A 2RJLA 2R0HA 5BNNA 5JLVA 1C28A 1FOD3 1SMVA 5BNPA 3OY8B 1ZZCA 1PVC1 4YVWC 1C5HA 2A6VA 4YVSC 1WW5A 5JPNB 1TMF2 1AR63 2JE9A 2EALA 2ZHKA 4OI4A 1CQ9A 3OYWB 2WQ4A 5CFCA 4Y1XA 2DTWA 4WZFA 4CDUC 3BODA 4HT1T 2OUHA 2SBAA 1PZ7A 1G9DA 5CU1A 1W6PB 4PBOA 4S2HA 1PO23 2D7FA 2I45A 1WGPA 1MEC1 3ZVXA 2IFWA 2XBO1 4D3WA 4L9BA 4SBVA 2X5IA 3CU7A 3WW3A 1QMJA 4YSFA 2JJ6A 3D5OA 1JHNA 5DUUA 1SBFA 1YHFA 3VBRC 3H0OA 2V73A 1S1AA 3IPVB 1AXKA 4INDA 2XKOA 4KGQA 2VVEA 3RWNA 2IXJA 3KB5A 1Z7S3 2XJPA 4FPCA 3RI8A 5JZGB 4AHWA 5C8CC 1XNBA 2A3WA 2EAKA 2XJQA 1SFYA 2XLAA 4P5HA 3PJYA 4ASMB 3HWJA 2R041 1O4YA 4WZCA 1VBA2 2TEPA 3KM5A 3WY6A 2R0FA 1ULDA 2Y26A 4R9CA 2ZHNA 2DVFA 5BY5A 1W6QB 1PGW1 3NO8A 5AC93 4OHWA 1S2BA 3N36A 2QDNA 1PVC2 2VVDA 3PTYA 4EWDA 2PTMA 4M3CA 3LSDA 2ZHMA 1TEIA 3QCWA 4IEWA 2ZGTA 2HWE1 1ND2A 4AQTA 5BV6A 3A0KA 3WINE 1G8WA 3JB4C 2E6VA 1Q8OA 1H2NA 5JR7B 4IV1C 1MEC2 3IN9A 2XBO2 2ZMLA 3O12A 1IOAA 5DG1A 2I2SA 4GB33 1O3TA 2RE9A 2D40A 3RYRA 1IPKA 2VOVA 1N1TA 3H1MA 3AB0A 1SLIA 2LTNA 4GQ7A 5E1RA 1V6NA 4M0HA 2VGDA 1ZA4A 5CFCB 2PHDA 4LBMA 4KGGA 1VR3A 4O9GA 1ZZ8A 1PO11 3H3ZA 4GA9A 1XE7A 4OUMA 4PQ9A 3FBYA 4L11A 1V6LA 1H0BA 4OHVA 2IFRA 4XQDA 1ULFA 2XLFA 2R042 4YZ2A 1NA1A 1V9U2 4AE2A 1OPMA 1HRI3 1V6MA 3HD8B 2X5IB 4AVVA 1UIKA 1G7YA 1QXJA 3NL1A 1X7NA 3ZXEA 2Z42A 1DLLA 2BVVA 5F6LB 1AHSA 3H7JA 3TB0A 1KRIA 4IXLA 1HKDA 1BCXA 2JG8C 2H6CA 4QGNA 2DFCA 3WP6A 1XRUA 1R1ZA 1TNFA 3OBTA 4D7SA 5KHGA 3NAPC 3VZJA 4NO4A 2ENRA 3B02A 4PDWA 2HWE2 2HJIA 2WT2A 4FPHA 2PYTA 3RDIA 1F31A 5HI0A 2P37A 1X36A 3KLSA 5C6CA 4GWMA 1BZWA 2GC2A 4M01A 5KC6A 1S0DA 1R091 1HQLA 3OF1A 4AI1A 4M3CB 2EXKA 3VL9A 2A6WA 1WD3A 3KZ4C 3VZLA 1ND3C 2BWAA 1RUH3 1RMU1 2WS91 4WBBA 1OFNA 3CL1A 5T5LA 1PO12 1DGWX 3L2YA 4R9AA 3LSEA 3G7DA 1QQP1 3ALQA 3TNQA 1AR81 3BOWA 4KG0A 4JC1A 1JOJA 3VKNA 5L36A 4Z92B 2OVUA 2RMU3 5K7PA 2ILMA 2I07B 1MS5A 1MQTB 2A70A 2RR13 4XJZA 3MIDA 3IIAA 5F1RA 1KDKA 4RR3C 1HQWA 3M1HA 4QQLA 4PIXA 2ES3A 3ZSKA 2WZR3 2R49A 2RM23 3SH4A 3VL8A 4ATEA 1AR91 5FO7B 4KBBA 1F5JA 1QH7A 2DUOA 3B00A 4HN1A 4HMZA 3WW2A 3N7JA 3AXDA 4YGEA 2E7QA 1ZZ6A 3R4UA 1FYUA 5LRRA 2CAVA 1DQ0A 1AYM3 4DRRA 1KXGA 4MXVA 1AL21 1GQGA 4Q29A 5D8AC 4WM8A 4MXWA 3MICA 1KJLA 3ZSLA 3JD73 3UV9A 1R092 4X6QB 4IERA 1Y43B 1Y7BA 5GLVA 1C8M1 1U0AA 4YVSB 1AUYA 4COUA 4W6WA 4HK9A 1OLQA 3ZO0B 4FPEA 3UJOA 3VBOC 4PLOA 1RMU2 2WS92 2XWJB 4PDWB 4N7IA 2DVGA 2HWF2 4F7ZA 5A3MA 4HBNA 3U0ZA 1G6NA 1QQP2 1LU2A 3KMHA 3CLPA 3NWKA 4JGZA 1AJOA 1A78A 5BUVA 4XIOA 1DFQA 1UD1A 3DKWA 2RS33 4CDXC 1QOOA 2XL9A 1AR92 5HCBA 1MZEA 2DUPA 1RUD3 1DYKA 2Z69A 4C91A 5J7MA 4Y22A 1J1TA 4IEZA 4LUKA 1D2SA 4FVVA 3VBHA 2EAAA 5C8CB 2LM3A 3TWIA 3WD5A 1CONA 3M7AA 4AHZA 3ZXDA 2UYBA 4P9JA 1AL22 1VBC3 1WMEA 1GZWA 3OD4A 2HWB1 4R8HA 5CBLA 3NSTA 4CDQC 1CGPA 5GJ6A 1ZVFA 1C8M2 2VNGA 1ONAA 2B39A 1A8MA 5L7OC 1AYN3 4QM8A 4FPYA 2HEYF 4JDNA 5T3NA 1XNKA 3U10A 1H1MA 1OFSA 2EXHA 2NM1A 1LCLA 3B69A 1HDKA 3MYXA 3B7MA 4IEVA 4C1WA 4QQ2A 2QKDA 3VHRA 1HRV1 4JVAA 4W65A 2DCTA 4MXWB 4CYDA 1TMF3 3V64A 1AVBA 2ZGRA 3DL3A 3ZYPA 1XQNA 3AMMA 3L2HA 2C0ZA 1HLCA 4FCAA 1YIFA 1H8TA 5DDJ1 5ABJC 4N9HA 2NYYA 4K40A 2ZTNA 4BQ1A 1N3PA 3WW1A 2A3XA 3WG2A 1CAUB 3B01A 5J98B 3MPBA 1UF2C 4JGZB 4COVA 5KXDA 4G4FA 3BIWE 3WV6A 4LLOA 5IK5A 1IKPA 4G9SB 4YW3A 2GU9A 2NN8A 3KS7A 1TE1B 4BHPA 4FPFA 4I0BA 2JG9A 5H9QA 1BJQA 2DYCA 4XDQA 5LEJA 4Q4X2 1NLSA 2QJVA 4Y22B 3VBHB 1V6KA 2ZGNA 3LOBA 3WDTA 1Q8VA 3ZSEA 1O5UA 1VBA3 2F6BA 3FUOA 2VPVA 3H3UA 2VVFA 2CTVA 2B7YA 4WVMA 1SLAA 3DF0A 3FMGA 5F9TA 5J48A 1QDCA 1ZBA1 2D97A 2PN5A 1PVC3 4AFAA 2IXKA 2Y0OA 3AZXA 1DGRN 1L3JA 5T5JA 1GZWB 1VB4A 3J26N 4GIQA 1O4ZA 2D44A 4NHLA 1X8MA 2CY6A 2CYFA 3LAGA 1XNDA 2VW0A 5KHKA 1SBDA 3EQEA 1C57A 3UKTA 4DFSA 5DDJ2 4B4RA 3WG1A 1KDMA 3WT3A 3WDWA 1DIWA 4S2GA 4FAGA 2OYZA 2WA3A 1MEC3 2XBO3 2XL7A 4FOVA 4LBQA 4XOGA 4A7KA 4ASLA