3ES4A

Crystal structure of protein of unknown function (duf861) with a rmlc-like cupin fold (17741406) from agrobacterium tumefaciens str. c58 (dupont) at 1.64 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
116
structure length
116
Chain Sequence
GMTMPIFNISDDVDLVPAMPAEGRDGGSYRRQIWQDDVENGTIVAVWMAEPGIYNYAGRDLEETFVVVEGEALYSQADADPVKIGPGSIVSIAKGVPSRLEILSSFRKLATVIPKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein DUF861 with a RmlC-like cupin fold
publication title Crystal structure of Protein of unknown function (DUF861) with a RmlC-like cupin fold (17741406) from AGROBACTERIUM TUMEFACIENS str. C58 (Dupont) at 1.64 A resolution
rcsb
source organism Agrobacterium tumefaciens str. c58
total genus 22
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05899 Cupin_3 Protein of unknown function (DUF861)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3es4A00
3CJXA 3E6DA 2UY9A 3NVCA 3VHRA 4J1WA 2I45A 5I93A 1IPJA 3BCWA 1JUHA 1Q5OA 1LRHA 3NL1A 4FT8A 4BIFA 3KMHA 4J1XA 1O5UA 3H8UA 1YFYA 1J1LA 1ZZ6A 2MNGA 3DKWA 1TQ5A 3OGJA 1PMIA 4META 4PIYA 1CAXB 1RL3A 4IEVA 5T3NA 4IESA 2E9QA 3MDPA 3RDIA 1O7FA 3HT1A 4P9GA 4IEPA 4QM8A 3ETQA 1ZVFA 3RZZA 2VECA 3M70A 4YYOA 3UKNA 3EHKA 5KHJA 3QACA 1J3RA 3WW4A 3H7YA 4R52A 3HT2A 2Y0OA 2EA7A 2QNKA 4R8HA 3IWZA 2PQQA 4Q29A 4XFIA 4Q0UA 1RUNA 3RYKA 4IEXA 2BNOA 4CYDA 2IXIA 3DL3A 3PVBB 2DCTA 2HJIA 4YRDA 5JSOA 4JV4A 1Y3TA 1QXRA 1I5ZA 4Q0SA 2EAAA 4E2SA 3FHIB 4F8AA 2PFWA 1ZZCA 1NYWA 3CL1A 1J58A 1CAVA 3MZHA 2OPKA 4ZU4A 1CAXA 2D5HA 4KU7A 3USSA 1CAUB 5BXXA 4L2NA 4HSJA 4LTAA 2QCSB 1ZRCA 4H7LA 3BU7A 1QWRA 3UKTA 4F7ZA 5FQ0A 4MGIE 1EY2A 3WW2A 4MUVA 1ZZ8A 4EWDA 5I0TA 4OLLA 3IDBB 2H6CA 5FLJA 5KHKA 1DZTA 4MV2A 4I0AA 2BEOA 3S7EA 1RGSA 2CAVA 4BH9A 4MH0E 2GH2A 1WA4A 5J3UA 3BPZA 3N4MA 5C6CA 3PNAA 4UBHA 2CAUA 1O5LA 2PTMA 3O14A 4HN1A 2XLFA 1CGPA 4HSLA 1VJ2A 2D93A 2GAUA 4KL1A 5CVRA 3H9AA 1VP6A 2QVSB 3E5UA 3H50A 1GQHA 4A2UA 3E97A 5I0RA 1UIJA 1OMIA 4JVAA 3E6CC 3ST7A 1NE4A 3GYDA 3HQXA 2K9ZA 5E16A 2ATFA 1DGWA 1FI2A 2UYBA 1NZCA 4EV0A 3SCFA 3EQEA 3OTFA 4XFAA 4QGLA 3WW1A 5LEKA 4AQ6A 3SCHA 1CAUA 4XF3A 3ES1A 4TLFA 1NE6A 5BPXA 5LRRA 4HVRA 3SCGA 2QJVA 4YARA 3C3VA 3SHRA 3FJSA 1UW8A 4X6QB 3LA2A 1VR3A 2B8MA 5I8YA 4O9EA 1CAVB 5CU1A 2Q0AA 4IERA 4MGZE 5E1RA 4NVPA 2GC3A 2D40A 2UYAA 3H1YA 2OZ6A 5I0UA 1ZRRA 2N7GA 4HN0A 5FQ0B 2XHKA 4EROA 4FBFA 4LA3A 2PYTA 5JSRA 5FLHA 3OD0A 2D5FA 4I2OA 2MPFA 4QGNA 4LUMA 4LLOA 2GC0A 3U11A 5KHHA 2PAMA 4B29A 3TNPB 3BALA 3MPBA 5D1IA 2XL9A 3OF1A 4XFGA 1V70A 4O9GA 4XFBA 4I02A 2V09A 3H1MA 3UKVA 1ZNPA 2PHDA 3NSTA 5JAXA 4BHPA 1J59A 1RC6A 1SQ4A 1XRUA 5JSPA 1QY4A 5BV6A 3BB6A 5JCTA 4WZCA 4D7SA 4E2GA 3R6SA 2ETEA 4JTNA 5K8SA 1NXMA 2MHFA 3PLQA 3QOPA 1XE7A 2Q30A 4OFGA 1DZRA 3KGZA 3NJZA 3SXWA 2UY8A 4QGMA 1O4TA 1SEFA 2GZWA 1DGRA 1ZZBA 1OI6A 4IEQA 1X7NA 3U10A 5J48A 4XF4A 4XFFA 3G7DA 2IXHA 3RYRA 5EZWA 4K8FA 4ZU5A 1H1MA 4KWKA 1J3PA 4MGYE 4XF0A 4EWAA 1U12A 1GQGA 3NW4A 3LA3A 1FT9A 2O8QA 4XETA 3KSCA 2PHLA 4QMAA 2F4PA 4LUKA 1ZZ9A 1HW5A 3EJKA 4D7TA 1XE8A 4YNIA 1OFNA 4HZFA 4X6RB 2VPVA 4I3PA 3RNSA 3MYXA 2GC1A 3H7JA 2XLGA 1SFNA 5AVPA 2GC2A 2OYZA 4JTOA 2P17A 4QXKA 3IDCB 2XKOA 4AQ2A 4KWJA 1O3RA 4XF1A 2IXKA 4PIXA 4QM9A 1YLLA 4N9IA 1H1IA 4Q0QA 4EWEA 3SMHA 4Q0PA 1YHFA 2XGXA 1ZZ7A 2K0GA 4WVZA 1X82A 4IEWA 1EP0A 2PAEA 4IEYA 5F1RA 2Q4SA 3LOIA 5I0SA 3ES4A 4IEUA 3E5QA 4XFHA 1RTVA 2Q1ZB 3CO2A 2OA2A 1UCXA 3LWCA 3FFQA 3L2HA 3D82A 2H0VA 1X8EA 4XFCA 3FE5A 1FXZA 2XKPA 3DV8A 3I7DA 4AVAA 4LEJA 5CADA 2WC2A 3U0ZA 3EO6A 4HVOA 2BGCA 1WGPA 2ZKLA 4UXAA 5BY5A 4QX5A 2Z69A 4XEZA 1ZREA 5FPXA 3JZVA 4KWLA 4YSFA 2B5HA 3H3ZA 5FCCA 1I6XA 1X8MA 2HKXA 2ET7A 4HVQA 4HLTA 4XF9A 2KXLA 1YFXA 3I59A 5BUVA 5EFUA 1OD5A 3ELNA 4IEZA 2IXCA 2C0ZA 3ROUA 1UPIA 4GULA 4IEOA 5FPZA 3IBMA 3I54A 1Y9QA 5I91A 2O1QA 5FLIA 1CX4A 1UIKA 1WLTA 2PA7A 4LA2A 5C8WA 5KBFA 2GU9A 2CV6A 3TNQA 4E2QA 4PIZA 4ONUA 4FAHA 3M3IA 3HIFA 2IC1A 3KCCA 5I8SA 3H3UA 1EYBA 1LKNA 3D0JA 4I09A 1Q43A 2IXJA 3NKTA 1YFUA 5LEJA 3WW3A 2EVXA 2CGPA 4HMZA 5JR7B 4MZUA 1ZRDA 3KGLA 3CLPA 5LRSA 4BYYA 1L3JA 4Z82A 3S0MA 2IXLA 1LR5A 1CAWB 2WFPA 5FDBA 1RUOA 4AVCA 3EBRA 5I8TA 5J7MA 4AVBA 3H1WA 2OZJA 4N9HA 4WBBA 1IPKA 5KHGA 2BNNA 5HI0A 2VQAA 2XL7A 2QDRA 1O3TA 4DINB 4L11A 3RYPA 3ZDSA 1O3SA 4UBGA 1J3QA 2ET1A 2BYVE 1YWKA 4LULA 3FWEA 2FQPA 4I0BA 4Z07A 1UD1A 1G6NA 4FAGA 3CF6E 2FMYA 5KHIA 1ZX5A 4HBNA 3LA7A 3B02A 4IETA 4KU8A 3D0SA 1EPZA 4AXOA 2Z2SB 3LAGA 3CEWA 3LZZA 3RPQA 1QXJA 2PAKA 3FX3A 3I59B 3ACLA 3E5XA 1PM7A 3OCPA 4I01A 4ORFA 2H6BA 1ZRFA 1YFWA 1Q3EA 2B9UA 3FZ3A 4MX3A 1YUDA 4Q0VA 1O3QA 3IIAA 1LB2A 4ZU7A 3E6BA 2ZCWA 3S7IA 4MGKE 3GBFA 3DN7A 4PJYA 1CAWA 2BNMA 2XLAA 4RD7A
chains in the Genus database with same CATH superfamily
1UNBA 1NY72 4H3WA 4RQPA 1D7PM 1H8TB 1E5SA 3WLUA 4IXLA 4WM7C 4CCOA 3RZKA 4MGQA 4KQ7A 3SQOA 3VKLA 3ITQA 3I2GA 4CCDA 2C24A 3UJOA 1DBNA 3AYDA 3T3YA 4E27A 3OB8A 4CXYA 2WQZC 5FWEA 1FV3A 1UL9A 4LHKA 1ASJ1 3VKNA 4FOVA 4XUNA 4XILA 3OYWB 1PK6C 4AAPA 1ALYA 2WSUA 1YFYA 1MVEA 2HBTA 4AEMA 2ZGMA 2YY1A 5JPNB 3DKWA 1RXGA 1PMIA 4META 4NRMA 2XJUA 1CAXB 3FHQA 1AXYA 4PIYA 3B69A 4TSVA 5FYTA 5FAXA 1YI9A 1W05A 3URFA 2QUOA 2ES3A 1ZM1A 1QOOA 2GNTA 4CUGA 3WR0A 2R0HA 3RVHA 4QB6A 2XH6A 1DDLA 5A7PA 5JXIA 4PHZA 2YHJA 4L8QA 2AREA 1OQDA 3ETQA 1PVXA 3J9SA 3R0RA 5C9AC 3RZZA 1BK0A 1UOBA 4QDQA 1O4ZA 4CCNA 4QKFA 4YYOA 3M70A 1Q8SA 2W39A 1HLCA 2R6QA 2D6PA 3PIJA 2XJRA 3QACA 4JDOA 4XUOA 3H7YA 3Q9OA 5FJHA 1DZQA 2EA7A 4QPIC 4R8HA 4OMCA 5GM0A 2PQQA 1ODNA 4OHXA 5FZ6A 3VBRB 4TZDA 1PVC3 1BK1A 2B4KA 1VBE1 4FPEA 1PX4A 1WW6A 1DQ0A 5F2WA 1W6PA 3U37A 3WSOA 1H8TA 4EQVA 3LSDA 1OLME 5EYYA 4M00A 4Y26A 2ZBJA 1LHVA 3FN9A 2BNOA 2G19A 2R16A 2DCTA 3OBTA 1PO23 5KXCA 2ZEZA 2VTXJ 4FO9A 2NMNA 1WD4A 2VM9A 4Q0SA 2D3SA 1MS3A 1QGLA 3FUQA 3JUUA 4QB2A 4YGCA 3MICA 3VKFC 1ZZCA 4V2VA 2X53S 3I2IA 5FYCA 4QD2A 1AR92 3B93A 2ZGRA 5FRAA 1J58A 3VD5A 3N7KA 4CUBA 1EV13 2OPKA 4YZ1A 1AF9A 2ZX3A 3N9PA 1CAXA 3TEYA 2D5HA 4YW2A 4RS5B 5BXXA 1AZDA 2R042 1A34A 4L2NA 4HSJA 5T5PA 2QQOA 1ZRIA 2XBO2 3A0KA 4PDWC 5M0TA 2NPIA 3HQRA 3FFZA 3JBG1 4ZY9A 1OVSA 1OA3A 1RINA 3BTAA 2Z42A 1BLZA 3AXDA 1VRH3 4DOUA 1XC6A 1NLSA 1F4AA 1A8DA 1UXXX 3AXEA 4RFRB 4JKMA 5DDJ1 2VUAA 2WIIB 1EY2A 5FK8A 1OSGA 4EWDA 4LBLA 3Q8CA 3RWNA 3KV6A 1LAJA 4OLLA 3DF0A 2W1WA 3KM5A 5FLJA 4MXWB 1W6MA 2WLQA 4I0AA 3HWJA 4ZONA 5A3WA 3DEMA 4BH9A 4AI1A 4MG2A 1PM4A 1WA4A 3VDAA 3N4MA 1LHWA 2NMOA 3J8F1 2HWD2 2WJSA 5F3GA 1Y7BA 2JB4A 2R49A 3O1PA 2PTMA 3TN91 1PGW1 4IV3C 3AP4A 1D2QA 1OLQA 2XLFA 1QDCA 1I3HA 2Y60A 2YG0A 1NUKA 2W52A 3B94A 1RITA 2VY0A 2P4EA 1AR93 4MOAA 5FZGA 2AZ5A 3H9AA 5LASA 4CDXC 5FV3A 3E5UA 3ZFGB 4A2UA 3E97A 3OPWA 2FCVA 4BMEA 4W4ZA 1UIJA 3BPSA 1VE0A 1RJ7A 1WMFA 2QKDA 2WWUA 1JODA 3C7HA 4BPZA 5FUIA 3GYDA 1JZ7A 3HQXA 3WDWA 1V6NA 2K9ZA 4CA9A 1C8NA 4M3CB 1FI2A 5L7OB 3AFKA 3NJVA 1JYIA 5G04L 2XWBB 3EQEA 3OBRA 1US2A 3BODA 4QGLA 1UZVA 1NA1C 2VZVA 3WW1A 5LEKA 1JYTA 3WP5A 5GZCA 3SH5A 2DCZA 2DVAA 5IVCA 3I97A 2XQXA 1ENSA 1POV3 3ES1A 4A41A 1NE6A 2YC0A 5FZIA 4HVRA 1G8WA 4EN0A 1SBEA 3I8TA 5JXJA 2QJVA 5IK4A 5CYYA 2VXJA 4Q4X3 5E6HA 1RUJ3 3K75B 4XDOA 1PGSA 2HWD3 2ZHMA 1AL21 3LA2A 3LPFA 4C91A 5CU1A 2AUYA 1RMU1 2Q0AA 4IERA 4MSVA 3W59A 2LALA 5E1RA 1W9WA 2A73B 2IVIB 4FPLA 4RHV3 1L7QA 2WNUB 2UYAA 2RM23 2WZR2 3PIGA 3MI8A 5IT6A 4YG6A 5TSWA 4PI0A 1SHWB 1N1VA 1PHMA 1E5RA 2CGNA 1RUG2 2DBIA 1N3PA 2XHKA 3HMYA 3SC7X 4CCLA 1W9FA 4FOWA 5EQUA 4EROA 4FBFA 1HQWA 2LRPA 4SBVA 5F2SA 5IVEA 1J1TA 1Y43B 2ARBA 2D6MA 2XVLA 2RHPA 2ZOEB 3ZFGA 3I49A 4XJ8A 5FLHA 2FHRA 5BNNB 1HV1A 1LULA 5EHDA 2B39A 3FBYA 2K2SA 4QGNA 4LUMA 2D97A 1ND3C 1GZWA 3WNLA 1FV2A 4P9YA 3W20A 5KHHA 5FZ3A 1MS9A 4B29A 3BALA 4M3CA 1WMDA 3MLLA 5KWRA 3D4KA 2HEWF 2QQMA 4YG3A 2GMPA 2VZRA 2XL9A 3PVEA 2EICA 2EXIA 1V70A 2RDSA 4UFJA 4UFHA 4G4FA 1YIPA 4O9GA 4RN5A 2QQWA 1UN1A 3TWIA 2DVGA 4XACA 3H1MA 3UKVA 1OUSA 3ZYRA 1G9BA 4RQPC 2Q8CA 5A7QA 3U14A 2D3RA 3MIEA 4QQPA 4JGYC 4EN9B 3M4FA 1XRUA 2BGOA 2WZR3 3JB4C 3WF0A 3FL7A 1W0PA 4L92A 5JCTA 4D7SA 4JQTA 3WNNA 1NXMA 2PELA 2ZAAA 1UMHA 2X5IB 1GMMA 1XE7A 2ZABA 3SH4A 1YQ2A 3ZX7A 1ODMA 2VZUA 3OEAA 2GNBA 4HPKB 4RFT0 5AC92 1OH4A 1HXS2 2WNUA 4IQPA 4XQ4A 4OFGA 1SBDA 3AVSA 3NJZA 2RJLA 4COYA 1HV0A 1ZBE3 1UU4A 4PBOA 3VZKA 2W0XA 3KV9A 1JMUB 1AVBA 1MS8A 1UMIA 1UKGA 3WOGA 5L9BA 2WNVB 1R082 4AHZA 2E53A 1OI6A 2JD9A 4GJYA 4OMDA 2RS53 1XNDA 4XF4A 1Q56A 3G7DA 2WT0A 4MGSA 3VDBA 1C28A 2VNOA 2WN3A 3W5NA 1O59A 1OHFA 2R072 4L97A 4ZU5A 3CZJA 3J4UH 1S4CA 1YO8A 2ENRA 4MGYE 1O4YA 2WO2A 1W8ZA 2O8QA 4N90A 1NXD1 2DUOA 1ZBA2 2ZMLA 3KSCA 3OUIA 4NIGA 1RUD3 2RDRA 5L9VA 4XJAA 5A6ZA 1AL0G 3KF3A 1D4M1 3POYA 3WF4A 4ISQA 1JS9A 2ZEWA 2WZEA 4AFCA 4CXWA 1V9U3 4XC9A 1WA6X 1H8TC 1SFNA 2XLGA 5AC93 4K7JA 3AZZA 3KQRA 2OYZA 1HXS3 4NAMA 4BQ1A 4QXKA 4ASLA 4Q4V3 1O3RA 2V5YA 4KH9A 4QM9A 1YLLA 1KJLA 1H1IA 1UZYA 1QNWA 3KHBA 3VV1A 3J26N 1EAH2 3KQ4B 3SMHA 3GHMA 4Q0PA 5HXMA 4HPKA 1UYPA 3M1HA 1ZZ7A 4GB32 2K0GA 2QQLA 3L2YA 1H6YA 1EP0A 4IEWA 1QH6A 5F1RA 1PIV2 1UY2A 4RGAA 5A1AA 2RS31 5I0SA 4ES8A 5FMOS 2WNVA 2QTWB 4BWOA 2PHFA 4HKOA 2Q1ZB 3CO2A 3NJXA 1ZBA3 3HBZA 4OI4A 4AI2A 1RUF2 2V4VA 5HXVA 4HK9A 2H0VA 2GMEA 4HKWA 1X8EA 4LO7A 2AH2A 3IDAA 1FXZA 3DV8A 1R1A1 1RVF1 4RR3B 4AR2A 1G9DA 2G1MA 4M4RA 1AYM3 3WT3A 5KXBA 4QX3A 3TAYA 4Y33A 5F5IA 1DFQA 5ACA3 5C3RA 5L19A 1NCRA 4HVOA 1GP6A 1WGPA 2DWRA 4JDMA 4UXAA 3FHAA 4UW5A 4QX5A 4TXWA 1AJKA 1MS5A 5L36A 1HX6A 4GALA 3VHNA 3QCWA 4BZ4A 5FPXA 3DYOA 4KWLA 2D6KA 1CONA 3WDYA 3U1XA 3ACHA 5DMYA 3AZVA 1VBB1 4Q4W2 2ET7A 4YW7A 5FP4A 3WF1A 3HNBM 3JQWA 4GIQA 4BLJA 4DS0A 2HWB3 3OUHA 4Y5SA 1VMHA 4GWNA 4P08A 4DIQA 2NYYA 3TYJA 3ZYFA 4XBQA 5C8CB 1FX5A 1MZ5A 3PUHA 5DAVA 5FXVA 5EFUA 5C70A 2V5DA 2JDPA 4D6RA 1VAKA 5DUVA 2HH9A 2QE3A 3JQXA 4P5HA 3IB3A 3KLSA 5FPZA 4CUCA 5A33B 3IBMA 5I91A 4GZ9A 2BWAA 3DCQA 4AHXA 5FYSA 4RS5C 1CN1A 1US3A 4TN7A 2HWE2 2B42B 3WVJA 1SCRA 4BCUA 3IT8A 1IPSA 2R32A 1F5FA 3PVNA 2W87A 4NE9A 2WZ8A 4QDRA 1OKQA 3P3NA 3KV5A 4RR3A 1DF0A 2A6XA 1EYBA 3J7MA 2O14A 2CDOA 4QXBA 4OHZA 4E8CA 3H0OA 5KXDA 2HWC1 2W46A 4XDPA 4ATEA 2EVXA 3MV11 4HMZA 3THDA 3WP6A 2DCKA 5LY1A 4OHVA 2CGPA 1F9KA 3N9NA 2CHHA 1ZRDA 1VB4A 5FZOA 1QJX1 4SLIA 4HL0A 3ZN4A 4PCRA 1DGLA 1C1FA 1ENXA 1T6GC 4GKXA 4BLIA 3ILNA 3ZN6B 1L3JA 1W8OA 2D3PA 2NP0A 4GWIA 2Q8DA 2WFPA 1LOEA 2ZX2A 4XIKA 2A7AA 5J7MA 2W92A 1K12A 3Q8AA 4N9HA 3ZFGC 1CPNA 4LT5A 4XUPA 1V6OA 5SV5A 5HI0A 4QT6A 2NZ9A 1WLDA 4DINB 2XJVA 5C8CA 3MV01 1VALA 3KF5A 1FMD2 4JGZB 3ZDSA 4UW4A 4BXSV 3KZ4C 4LITA 1J3QA 2DBNA 3VHPA 4XJ9A 2EIEA 5DZGA 1ULOA 1AJOA 5FOBB 4INDA 3N36A 5L7OC 3H8OA 3CQOA 5A33A 1G6NA 1GUIA 1LHNA 4AI3A 2BRTA 4FOYA 3CF6E 1GZTA 3TEWA 2RMU1 3B02A 3BTYA 1EPZA 2HBUA 2OW4A 2Z2SB 3LZZA 3FC0A 1RUC3 1GU3A 4K20A 4UAPA 1PO12 5T52A 1W2NA 2WL1A 3GZAA 3K3OA 3GNEA 4COVA 3Q8BA 3W58A 5F5CA 4EZHA 3OCPA 4LO6B 4DXSA 3ZYBA 1FOD2 4A3ZA 4ORFA 3CBNA 3K2OA 3MGUA 4CCKA 4LO5B 5FBZA 4NR1A 1Q3EA 3OG2A 4YGEA 5FMCA 5LBBA 3T2PA 5CFCA 3KT1A 4O65A 3WCRA 4W6YA 5A1FA 1H8VA 2C1FA 1W6OB 3N7JA 3FZ3A 2WNUC 4AVVA 1W28A 1OBNA 5FYZA 2BJSA 5FY8A 4ZU7A 3E6BA 2ZPXA 2JIGA 3FLTA 4LOTA 4U36A 4FQ4A 4B4QA 1TVGA 1WBFA 2R1DA 3ZN6A 5LK7B 3B9IA 4ES9A 4PJYA 3VUOA 5CFDB 2BNMA 2HWF2 4LLFA 1AYN3 5H9QA 1S0FA 1SDWA 1C8M1 2WS91 3ZIWA 3ZOIA 2UY9A 5JLVA 1W9TA 1DHKB 5FIXA 3WG4A 2R062 3RQ0A 2VVEA 1HB4A 2AEYA 1QJY1 3UL2A 5I93A 3O1SA 4BDVB 4QQHA 5ANQA 3WXPA 1NCQB 3I4IA 4HONA 4NOTA 1IPJA 5GZGA 2FDHA 1JUHA 1UOJA 3QBQA 1Q5OA 3ZFEA 3AFGA 4KG0A 2AYHA 3NL1A 4R9DA 2VO5A 4A44A 3A23A 1DU3D 3KMHA 5T55A 1JYNA 1PO13 2RS11 3QD6A 5LB6A 4XBNA 4O61A 1J1LA 1W3VA 5IVYA 3ECQA 4CU9A 5FZFA 5FXXA 3VZLA 5IVVA 5FYVA 4CU7A 1SZBA 4UW3A 3MW3A 2UWBA 5A7NA 1GKBA 1OQ1A 2I74A 3KS7A 1RUI3 4N7IA 2J1SA 4AGRA 5K9YA 5A7SA 4ZHNA 3MFCA 4XMIA 3RDIA 1SMVA 1JU3A 1AR83 1Z0HA 3P6BA 4P9GA 4XTMA 5JIAA 1B09A 5JDBA 5GLTA 1DLLA 5JMCA 2RR12 1JUIA 2XB6C 1HRV3 3KWVA 1QJU3 4QM8A 4CCMA 1HN0A 1GZ9A 3AZWA 2YGLA 3RZLA 4CXXA 1AR62 1G9AA 2VECA 2X5IC 4LO8A 3JCIA 5JMOA 3WDUA 5IVFA 1CESA 2LTNA 3EHKA 3IAPA 1ULCA 1J3RA 3N9MA 5FY7A 3WQ0A 5C3QA 5KHJA 1DQ5A 2XQRA 1IQAA 1NKGA 4P00B 4R52A 1WW4A 2WFF3 1CQ9A 3HT2A 3INAA 4LR4A 5DXDA 3ZFFB 4Q8KA 2QNKA 3WF2A 2WNVC 3F2ZA 2ZXQA 4RYDA 4P5YA 5EPAA 5CFDA 1WBLA 1COV2 3POBA 2JDZA 4ET7A 3W5MA 4HANA 1UYYA 3MFAA 1VBD3 1RUNA 1S2KA 2JWPA 2L9LA 1F8VA 2RJ2A 2J7MA 3RYKA 5DUUA 4D8MA 2YV8A 2IXIA 3PVBB 1TMF3 5DABA 2P5BA 1NCQA 5FPLA 4FPOB 5JSOA 1H2MA 3ENRA 1Y3TA 3K4ZA 5GKAC 2VZ1A 3O1UA 1FNZA 5A80A 2JDMA 2C9KA 4MHRA 2EAAA 1B35B 4R9CA 2DU0A 2QDNA 5DUXA 4E2SA 1FYUA 1TME1 1JTZX 1R091 2YPJA 3GZEA 3GJBA 1WWYA 5FUNA 1IS5A 2RDNA 4M3CF 3GDBA 4IE4A 1APNA 3AKSA 3MZHA 2CNAA 3NNLA 5A3NA 4RQPB 1RUH2 3WG1A 1DQ2A 1GOHA 3I3EA 1AR63 4FFIA 4QX8A 5DUWA 1H30A 1QF3A 2VMHA 4B4PA 2ARXA 2QCSB 4HXCA 1MQTB 5D8AB 4DB5A 4DRVA 1ZRCA 1LU1A 4ISRA 3UKTA 3DXTA 4XABA 2C26A 2YFUA 5FZ4A 4GMP1 2VW2A 4YM2A 1H6XA 1YJKA 4Z2WA 5C7GA 5FY5A 3BOWA 3K46A 3IDBB 4AFMA 1FPN2 1DZTA 5KHKA 5FP3A 5F5QA 3Q8FA 4YZ2A 3S7EA 2CAVA 2JICA 2MEV1 4BE3A 4BQWA 5F9TA 2VOVA 2EXHA 5EV7A 3TB0A 3ZFFA 1XNAA 2BOJA 1H2NA 3GBGA 4PQQA 3M8LA 2CAUA 2EXJA 2ZS6B 2VULA 2PN5A 4HK8A 2WO3A 4CDUA 5FMBA 3HVDA 4HN1A 4S2GA 3VL8A 3AYCA 3H3LA 4NHYA 3HN1A 2ID4A 4R4XA 1VJ2A 2D93A 2Q1FA 2A3WA 2JKBA 2VMIA 2JECA 2XHNA 3ABZA 4KL1A 5FZ0A 4UT5A 1S0JA 1XQNA 1RHI1 1HQLA 1UKRA 2NM1A 4RR3C 3RMYA 3WF3A 1LHOA 4JVAA 1GWLA 3ALQA 3E6CC 1B35A 1ASJ2 1BHGA 1NE4A 2YYOA 1XSQA 3D8CA 4LQRA 3ST7A 3TRSB 1MR5A 1SLAA 4Z8BA 2QQPA 3K48A 3PUAA 4Y1YA 4CE8A 5FTTC 4XCBA 3BTXA 3WQ7A 1DGWX 5C4WB 4O7XA 2Y6FA 4XFAA 2X29A 3N3HA 1PZ9A 1P8JA 5A7OA 4BK4A 1W6PB 1S0BA 4XJWA 3UNPA 1AR73 3WP4A 5C3OA 5JOWA 2O0OA 4TLFA 2JB8A 4A6OA 3EB7A 1HQNA 1FPN3 1JN2P 4XURA 5FKBA 4XE9A 1MQTA 5D8AA 3OSDA 4AEDA 1JW6A 1PVC2 1VAVA 2YBSA 4FI9A 2Y8KA 4UYBA 3AKRA 2ZGKA 4N8MA 4R4ZA 5FFOC 1LNSA 2W9XA 3NNGA 5FZLA 4YARA 3C3VA 5C8CC 3AJYA 4X6QB 3MIFA 5DAXA 4B1MA 1S1AA 3NV4A 1VR3A 2B8MA 2VMCA 2E6VA 4FPHA 4O9EA 1BZWA 1PO22 4XHBA 3VZJA 1BBT3 4MGZE 4N53A 2Y0IA 5L73A 3OBZA 3TOJA 1CX1A 3OEBA 1POV0 3ZN5A 2BOIA 3M2MA 1S0IA 5A70A 2OZ6A 2F4LA 3JD72 5C71A 2VNRA 4QX7A 3O1RA 2TBVA 1LODA 1ZRRA 1QH7A 2N7GA 3O5SA 1ASJ3 4HN0A 2VMEA 5GLVA 1EV12 1UU6A 4LBQD 1MEC1 2C6SA 4XQDA 2VOKA 1SLBA 2WYFA 4LA3A 4LHSA 5LW9A 2WA3A 3RZHA 2GALA 3BGAA 2ILMA 4DQAA 1W6MB 4RGGA 1UOFA 2D5FA 4I2OA 1XU2A 3PMEA 5A3LA 4R9AA 3RFRA 4LLOA 1VRH2 2VCMA 1TZOA 1W2OA 1MZ6A 2JXAA 3U11A 4M0NA 3ZXLA 3HAGA 3TNPB 1M06G 5KR7A 5C4WA 4FVVA 4IE6A 1IG0A 2PLV2 4XFBA 3BI3A 2WRAA 5BYNA 5IYYA 1GP5A 2V09A 2WKKA 3KB5A 4JZRA 2PHDA 2WAOA 4OQ8A 3OY8A 5ABJA 3NSTA 3SEEA 1R64A 1GWMA 3IDEA 5FZEA 4CZSA 5JAXA 1J59A 2W1QA 2G4IA 1QY4A 1GWKA 5BV6A 1YNAA 3JD73 4WZCA 3VLBB 4JGZC 3UK9A 3V65A 5K8SA 4EYUA 1UQXA 3QOPA 5AFEA 1CIYA 4PBPA 5IK8A 3KGZA 2ZAHA 1Z7S1 3FLPA 1UX7A 2HEYF 4IV1B 4XYXA 1G7YA 1HIXA 3ZPYA 3MBWA 1DGRA 1ZZBA 2JEMA 1XNKA 4FP2A 4IEQA 1X7NA 3U10A 3ZMNA 5J48A 4YW5A 4XFFA 2IXHA 5EZWA 3ZPOA 2XUEA 4MXVA 4CRQA 3ZXGA 4DRRA 1H1MA 4KWKA 5FZCA 2PLV3 1VLNA 2W94A 4LNVA 5GLUA 2GP5A 5F39A 1JZ8A 4KMQA 3GGLA 2ZGLA 2PHWA 4Q4X2 1RUJ2 3LA3A 3NW4A 2VNGA 2XVGA 4NN0A 1IKPA 3PU8A 3JBG3 3OOXA 4DUVA 4HOOA 5C5UA 4CEYB 2PHLA 5JIUA 3U75A 4LUKA 1SACA 1ZZ9A 5DDJ3 2OX0A 2XJSA 4YNIA 2YGMA 5CFDC 4RHV2 1AR91 3WP3A 1AXKA 1O6UA 2RM22 4I3PA 2E32A 1KDMA 2GC1A 4OZOA 5FY9A 4GXLA 3HPNA 3KVAA 4OVEA 2XXZA 2J1EA 3MHZA 1GZWB 1NCQC 2R041 3C7OA 3UYJA 1JH5A 2XKOA 2XBO1 1KJRA 2IXKA 4Q4Y1 2EF6A 4BXFA 3TEZA 4YW4A 2VUJA 5A3MA 4RL7A 3TN93 4DEVA 3HJRA 1C1LA 1JHJA 4Q1PA 3LSEA 3RJRA 1QOSA 5FZKA 4IGQA 2JDYA 4WM8A 5J96B 1JYXA 2QQVA 1X82A 4WVZA 4PLMA 2Q4SA 4IV1A 4LPLA 5LBFA 4M4PA 3LOIA 3ILRA 3M3OA 1V6LA 4IEUA 3E5QA 3SNMA 4MVTA 2YZ4A 5JPMB 5T5OA 3BIWE 3VD3A 3A4UA 1QQP2 1CJPA 2G9GA 3J7LA 2HWD1 4JAAA 3L2HA 2WUHA 4LBQB 1T2XA 4CUAA 2Y6LA 1UYXA 2V4AA 1WUVA 5F3EA 1QIQA 1U5YA 2VQUA 1VBC2 2PQSA 5T54A 5CADA 1BVP1 1UWWA 2VTFA 2BBVA 3U0ZA 2D98A 3AKTA 2W1SA 2J1UA 5EXOA 4CEYA 3B01A 3ZFFC 2H0BA 4YVWA 2E26A 4YZ3A 3RJ2X 2OUJA 2A3YA 5SV8A 1BMV2 4NPMA 4RSUA 3ILFA 5CB7A 3WY6A 4XEZA 2UWCA 5LY2A 3JB8A 1HRI2 5A3OA 1AL23 4NUBA 2GDFA 2B5HA 3H3ZA 5FCCA 4U2AA 1I6XA 1RB8G 1ZBE2 4W6WA 2B46X 3VBSB 1RMU3 2HKXA 4HVQA 2QQUA 5FY1A 3VL9A 2AGSA 5IWFA 4CTEA 1ULPA 5IHRA 2JG9A 3F95A 4HLTA 1LOCA 1OURA 2LROA 4QKBA 1GV9A 4XF9A 3ZR5A 4CDWB 2YPDA 3MUY1 1YFXA 2RS52 4UFMA 1B35C 3ATGA 4CDQA 1W2TA 1OD5A 3VB9A 5AVAA 1QQP3 1WLWA 2OXBA 2IXCA 3ROUA 3SH3A 1IG3A 2P6HA 3IPVB 2TNFA 4ARXA 1FAYA 4Y1XA 5DN2A 4AW7A 2IFWA 3LOBA 1F35A 4OUEA 1WMEA 1CX4A 1RUD2 1VBC3 2XJQA 3ZSLA 5C8WA 3NRUA 1MQTC 5D8AC 4XZUG 2FD8A 4RGKA 2JDAA 2CV6A 2WLPA 4AEDC 1JXNA 4UW6A 5DAWA 4LBQA 1LU2A 3WNOA 2W68A 4NMIA 1L7RA 3OPTA 4OI1A 3VDDA 1RUG1 1V9U2 1JZ2A 2IC1A 3KCCA 4H7MA 4Q1RA 2Y6GA 1HRI3 2Z5WA 1V6KA 1LKNA 2VNVA 5FKCA 3WHTA 2GSYA 4LHNA 3APBA 3WDTA 3NKTA 1DQ4A 1MZEA 3HQUA 1MS1A 4Q4V2 3VBOB 4AE2A 1GZCA 2VL4A 3V0AB 4JKLA 3WW3A 1WZXA 1UMZA 4GWMA 2VZOA 3LDRA 4WZFA 5IFPA 5FYBA 3AMHA 4M0HA 5CNAA 2VBDA 4L99A 4UFIA 1SFYA 2EIBA 4HT1T 1YIFA 1NX9A 4AVCA 5FYYA 3VBSA 3CIHA 2CYFA 4FQZA 3LE0A 2AR6A 4QXCA 4CDWA 5A6QA 1GICA 4IL7A 2VCBA 1NCRB 5KXEA 1QNYA 1RIRA 4L11A 3RYPA 1O3SA 4FXGB 4YZ5A 5A3TA 2ZHNA 4UBGA 2ET1A 3KT4A 4EN6B 1YI7A 1W3XA 4G3YC 4LULA 4E4SA 3QH7A 5B2GB 5FO9B 4I0BA 4QHZA 5C4WC 2OKXA 3IPVA 2D44A 1AYM2 5HCBA 4AI8A 3O1VA 4NIAA 4FP3A 4FAGA 1ZX5A 2W47A 3VKMA 2A70A 5ACA2 3K4AA 1G86A 4QU2A 3RSJA 3ZIXA 4AXOA 4DNYA 5J09A 1HXS1 3AMPA 1AX1A 2DUQA 4NHMA 1SPPB 5GZEA 5ISLA 2JE9A 3T4HB 4ATFA 3VKOA 1R081 3AP6A 3ACIA 4S2FA 5LCWL 1D4M3 2F17A 1SCSA 1ZRFA 4UFKA 4BQ2A 1RVF2 2HWB2 1XYOA 2R071 1OPMA 2XWJB 3N9OA 2YU2A 4M3CE 3VBOA 5H9RA 3V0AA 1XNBA 3N35A 3DPRA 4J25A 1WCUA 2KA3A 5FP7A 4Q0VA 1WD3A 2J1AA 4E4HA 3UGFA 1LB2A 3LKJA 1JZ5A 2ZEYA 5HBAA 1S55A 4MGKE 4A7YA 4FOQA 5IJRA 4B4RA 4CU8A 3CHXA 3DN7A 4XAAA 3A22A 1JU4A 1WW5A 3NV2A 3CJXA 2WABA 5A6XA 4GJZA 2YDEA 2GH8A 2W5FA 4J1WA 3V56A 3VHRA 2I45A 2XJPA 1W8WA 3WQ1A 2Y6JA 4G9SB 4QU1A 2BFUL 4Q5OA 3VBUB 1STMA 3BUCA 2JKXA 2RS33 2Z4FA 3FUOA 4I30A 3ZM8A 3BOPA 1U5XA 4J1XA 4UFLA 3LIGA 2HYKA 5FZOB 5B4NA 4ARYA 3H8UA 2KR2A 1W9YA 1JZ3A 1EAH1 2DURA 4NAOA 3C2UA 1ZZ6A 1GR3A 1LOBA 3VBFB 4JDNA 3MLJA 4QPGB 3SEPA 1H4HA 1R1A3 1LESA 1RVF3 4B7EA 1RL3A 2WA4A 4GB31 4IEVA 5EJ1B 2ADEA 4LK7A 2VQ0A 1DCSA 2BWCA 1SPPA 4CPBD 1PIV1 3MDPA 3KD4A 4KNCA 1F4HA 3HT1A 4ASKA 5EYXA 2WQ8A 4EN7B 3JXSA 3NAPA 4B7KA 2FDKA 3WV6A 2D6LX 1LEDA 1HJGA 2WDBA 4GH4A 1GOGA 4NPLA 4XDQA 1ZVFA 4Y4RA 4YVSB 4NIDA 1RUF1 3AKQA 2PHUA 3UKNA 4XW3A 2YBPA 3QH6A 1GFF2 2GP3A 5CIRA 1LHUA 1VBA2 2BP6A 4Y1UA 3O0WA 1VBB3 4WV8A 4K3UA 3T2TA 3DECA 3MLKA 4IV1C 2VU9A 4Q2FA 2CWSA 4BMBA 5DAPA 3THPA 3BN6A 2E63A 4P9JA 1AXZA 3OGRA 4XFIA 4ZXEA 3CMGA 1ZA7A 2GN7A 1DG6A 1BEV1 2Y6HA 2YFZA 3GXUA 4Q0UA 2VH9A 5D2AA 2UURA 3ZR6A 1MACA 3PTRB 3JU9A 1YQCA 2VVFA 4CYDA 5CFCB 1RUC2 2BDRA 4TWTA 1N3OA 4Q4W1 1V0AA 3VBUA 4JRLA 4PT6A 1I5ZA 3T2QA 2PMWB 1BYHA 4A6SA 3FHIB 4F8AA 1MVQA 1W39A 2B7YA 4CEYC 3H42B 4AF9A 4Z1VA 4FPGA 2B9VA 2OT7A 3D5OA 2VZ3A 4H55A 3VBFA 1CAVA 1KDKA 2FZ2A 4B8EA 4GD4A 4ZU4A 2CGOA 4QPGA 2J1TA 3PTYA 1JYVA 1CAUB 3LCPA 4OQ9A 1ENRA 4K8RB 1Q8OA 4KBBA 2P37A 1VBA3 3AC0A 3C7GA 3T2OA 5K0UB 4BU2A 2XPJA 4H7LA 5FO7B 4IGPA 3BU7A 1QWRA 3W21A 1XSRA 4NIIA 3WNPA 3ZFEB 5FQ0A 1AYN2 2HWE1 3LDBA 4BQYA 2VUCA 3RI8A 1QJX3 5F8PA 3WW2A 4MUVA 1ZZ8A 4YVSA 1C57A 3GCXA 3T1MA 5LA1A 4E9KA 2H6CA 2ZJCA 3FMGA 4WM7A 4EZ4A 1CR7A 3RMXA 3AMMA 2BERA 1CIWA 1V00A 1RGSA 3WCSA 5IK7A 2GH2A 5J3UA 1KFXL 3B7MA 5C6CA 1IS3A 1NG0A 1SFPA 4MGTA 4BJ0A 1O5LA 3LGRA 3O14A 3AB0A 3J7HA 3FLRA 1CGPA 2X09A 2JE8A 4XXAA 4OZXA 5JVVA 2GAUA 1HN1A 3N9QA 4M01A 5HPOA 2QVSB 3IN9A 1GQHA 1EPWA 1RUI2 2WYSA 3VDCA 4URTA 4GAZA 1IZ3A 5BNOA 1G9FA 1OMIA 2RMU3 1AR82 2ZGUA 4ASMB 4BOWA 1KEXA 3PURA 2VZSA 3CU7A 1HRV2 1QJU2 3ZXDA 4CSWA 1YC61 5H9SA 3TBDA 1CZTA 1FMD1 2UYBA 1NZCA 5CZKA 3ZLIA 2VW0A 3SCFA 4EV0A 2YXSA 1W8TA 3A21A 3SCHA 1WLCA 1CAUA 2TEPA 1HB1A 3AJZA 4QX1A 1JZ6A 3VBSC 2WFF2 5K0UA 4A42A 5LRRA 1W0OA 5IK5A 4YG0A 3SCGA 2R1BA 2W08A 4QPIA 2C4XA 4CDWC 5F32A 1POQA 3PJYA 2JDNA 4LORA 1VBD2 2EIDA 3LPGA 3SHRA 3RGBA 3O7OA 4MYEA 4QPWA 1H2KA 4NWVA 4AWDA 5CEHA 1RUE2 1XU1A 1TMF2 1FOD1 5I8YA 2ARCA 1CWPA 3THCA 1C8M3 1NQDA 2CY6A 1GLHA 1WW7A 2WS93 2XUMA 3GZTB 5LBEA 4A4AA 1PGL2 2GC3A 2D40A 1EUTA 1QJY3 2XVKA 3H1YA 3M7AA 1R1ZA 4K1ZA 3LIHA 4IE7A 5A3PA 3P1IA 1I1EA 1REDA 1XJAA 2Q8EA 4UF0B 5FMOL 1X50A 4PLOA 3LB9A 5HV4A 3IAQA 3O12A 1L7LA 3HBKA 2GNDA 2QQIA 2PYTA 4R9BA 3N7LA 2HWF1 3ZSJA 3L9JT 1BXHA 3MF6A 2OS2A 4PDWA 3X29B 2HEVF 2R061 2DCYA 4K1YA 5FYUA 3VBOC 1DYKA 4XJZA 3IM0A 3I2OA 1LOGA 2A71A 2VOTA 4Q27A 1IHMA 1R092 3S30A 3USUA 4CDUB 2VAUA 4H2AA 2EALA 1Q8VA 3MIGA 5FZMA 4DPNA 3OF1A 4XFGA 3PUIA 1GOFA 2A75A 5GLWA 4UOJA 1X33A 3M3EA 3ORJA 2W95A 4I02A 1E5IA 5LK5A 3HEIA 2JD4A 4DY5A 2VC9A 4WVVA 2JDKA 1RUE3 2W91A 4FTBA 3NMBA 1OA4A 2VGDA 1NZIA 2X8KA 4OULA 4MLOA 3VGIA 1W9SA 2VMDA 1W04A 3AZYA 3MIHA 2FDIA 2QZ3A 3IMNA 3NO8A 1RC6A 1SQ4A 1NQJA 3PDQA 5JSPA 1XPWA 2DVFA 3UJQA 4FFGA 4Y22B 1NCRC 3BB6A 3OBAA 1YCIA 4LBJA 3MW4A 4YWAA 2BVVA 2NN8A 2XOMA 5DZEA 5I0DA 1XNCA 2RR11 1NT0A 1VRBA 3PLQA 1QHDA 5JR2A 1UY0A 4LBOA 1OXCA 1N3QA 1PX3A 3DYMA 4UWDA 3LEMA 1JHNA 1TNRA 3BIEA 1W2UA 3RS6A 2UY8A 1RYYA 1O4TA 4K40A 4AEDB 5JOYA 2J42A 1K45A 2GZWA 5JXHA 4UF0A 3AM2A 3T30A 5KC5A 3T09A 4MO3M 1TME3 1R093 1AR72 2IUWA 4YZ4A 1LGBA 4K8FA 1COV1 1RXFA 1OT5A 3M3CA 4YW3A 4GH4C 2EIGA 3AL6A 5CAZA 1J3PA 3HN3A 4YPJA 1V6JA 4JHTA 4N53B 1C5IA 3WG2A 5L9RA 4Z2AA 4EWAA 2CL2A 1DQ6A 1GQGA 2ZMKA 1BJQA 2D6NA 4LBKA 2BGPA 2DF7A 1FT9A 4XETA 1W06A 5JXGA 1O8SA 3POJA 1OUXA 4K9SA 4XUTA 2G9FA 3POGA 3ZMOA 2F4PA 1H0BA 3IZOA 1BBT2 4QKDA 1VMJA 2DVBA 2E7TA 4NPRA 3I3QA 3R4DB 3KCYA 4XPVA 4X6RB 2A3XA 2VPVA 3RNSA 5LZ6A 3MO4A 3MYXA 3H7JA 1QXPA 3VHOA 2ZMNA 2P3KA 3GALA 5HCFA 2EAKA 4E4ZA 1RUH1 2A6WA 1GNZA 3S5AA 4LE4A 2MEV3 4JTOA 1SBFA 4KGGA 4FCAA 1OLMA 4Y22A 4KWJA 3VBUC 4XF1A 4AQ2A 3H8RA 3AMQA 4CP1A 4GKYA 1CJDA 4Q0QA 4N9IA 4XTPA 4AVTA 4QAWA 2OIIA 1H1AA 1SLIA 3DXUA 2E51A 4N7UA 1YHFA 5D21A 5JWPA 2R7EB 2XGXA 4XJUA 3VBFC 5C3SA 1ND3A 4K21A 1X9TA 4QPGC 3OY8B 2PXJA 5ABJB 1RHI3 4I0WB 4AQTA 2WBKA 3ES4A 4LKFA 2O8OA 4XFHA 5DPNA 4A3XA 1IGOA 2BUKA 4W50A 1F15A 3R4UA 2OA2A 5JI9A 1TG7A 3KT7A 2OUHA 3FFQA 3SKVA 4CP9A 1K5JA 3LDKA 4D3WA 2AEZA 3PHMA 2GMMA 3AYAA 4FPFA 2WQ4A 1YRZA 1OF3A 4YVSC 3FE5A 2FBEA 2XKPA 4AVAA 3I7DA 1Y4WA 3A7QA 3ETPA 5J1XA 1JYCA 3HD8B 4JGYA 5GZFA 1VMFA 1JI6A 4L9BA 2GN3A 1IKQA 1HJFA 1XBFA 1HB2A 4NHKA 2SLIA 4YFWA 1VBE2 4AHYA 1OVPA 3GCWA 5A7WA 3WNMA 2VR4A 4JQRA 1ZREA 4P02B 2AACA 2DU1A 2JDHA 4XOGA 5DZFA 5FPAA 4AYUA 1LGNA 3KHCA 1X9PA 4S2HA 4ZZ8A 5EP9A 4QQOA 1UY1A 3WHUA 1QU0A 1NY71 1X8MA 5FZHA 2W1UA 1ONAA 5CFCC 2JIJA 1GBGA 4FPYA 1KQRA 4P9WA 5FK7A 1C5HA 3PUSA 5F3IA 5BNOC 3NNJA 2KXLA 2JDUA 5LATA 2Q8OA 5CKMA 3SKJE 3I59A 1C3HA 1OPOA 1PVC1 2ZKNA 4Y5TA 3VZNA 5APAA 4FXKB 5BUVA 1E57A 5C5TA 2HLEA 4AQSA 4DUWA 3DUIA 2VJXA 3ELNA 4IEZA 1OA2A 1MEC3 4CP0A 2QBXA 4BK5A 1UPIA 4FPJA 4GULA 4C1XA 1CZSA 3I54A 4P14A 1LCLA 1J84A 1PO21 2O1QA 5FLIA 4IDZA 4DO0A 1Z7S2 1W0NA 3JBG2 4QKNA 1UIKA 2CWMA 2VMGA 4JHZA 5LA9A 1WLTA 4LA2A 3U78A 4B3NA 3ZKYA 5KBFA 3UV9A 1O91A 5K0UC 1JOJA 3OD4A 3N7MA 2YC4A 1A6CA 5DDJ2 1YYNA 1AUYA 3JD71 4PIZA 3WD5A 3ZFEC 2FDJA 4KBZA 4W65A 4E8DA 2QZ2A 4ONUA 1VBE3 3S6PA 2CU5A 4FAHA 2VBBA 3AP9A 1EV11 1DIWA 1GNHA 1PNFA 4UI9L 3HIFA 4AFAA 1Q8PA 1I5PA 3H3UA 3I2HA 5I8SA 1MPXA 1CPMA 4WM8B 3D0JA 1ND2B 2IXJA 3J8F2 5LEJA 3QLQA 1YJLA 2A1XA 4K6BA 5JR7B 1VRH1 4ZS3A 1PGW2 2F6BA 3TN92 5JUVA 1PMJX 2LM3A 5FZAA 3KGLA 3CLPA 3OYWA 4AVSA 5A6YA 4COZA 3LQCA 4BYYA 4BQ4A 1UZWA 4IE5A 2IXLA 2XR4A 1RUOA 2OQ6A 2PLV1 2K46A 3EBRA 3I2DA 4YW6A 2OZJA 3AVRA 4WBBA 5FR3A 2UWAA 1IQDC 5KHGA 1O8PA 2BNNA 1U5IA 1Z7S3 2P34A 2QDRA 2VQAA 1W99A 4NRQA 4LK6A 4Q4Y2 1XYPA 2RV9A 5FJKA 4YVWB 3OUJA 5H9PA 2VMFA 3O1TA 3OGGA 2WINB 3FWEA 5CISA 4LXLA 2FQPA 4AL9A 5FPBA 5EJ3A 3GBWA 4Z07A 2W2IA 3UGHA 3CDZB 4AGGA 1OOPB 1DLCA 3AX4A 4HFSA 5KHIA 4BIOA 2VZPA 4J6GA 3LA7A 3TEXA 5IFTA 3D0SA 5HCHA 2XMLA 1REFA 3AMNA 1U5ZA 2WAAA 3AKPA 2JG9B 3ZSEA 5C3PA 2PAKA 2VCAA 4JRAA 1IS6A 3J8F3 3VBRA 2ZGQA 3ACLA 3UESA 4CDQB 1AL22 1LECA 3WG3A 2A6VA 4QDSA 4I01A 4XAEA 1RMU2 3AZXA 3U07A 1CD3G 1YFWA 3LEGA 4DFSA 1A8MA 5CG9A 3EXUA 1POV1 1ST8A 5FP9A 1ND2A 4Y1ZA 2VZTA 3ACGA 1V6MA 2BFUS 2IFRA 4NIHA 2ZX1A 3U4SA 4URAA 3C7FA 2QQKA 2E31A 1A78A 4Q4X1 1SLLA 3WUCA 1MZFA 2R043 1RUJ1 2J1RA 3WZ1A 1O3QA 4FFFA 4AI9A 1VAMA 2XBO3 4Q4Y3 1W03A 1VIWB 1AX2A 1XNTA 4N43B 4AG4A 4OI2A 4LO4B 3V64A 3UETA 3MEPA 3VDDB 5DG1A 2VUDA 4OI0A 1N1SA 3NWKA 1W8HA 5FY0A 4XQWA 3E6DA 3N9LA 3NVCA 4RHV1 3V0BB 4RS5A 1W2AX 1S0DA 2RM21 3K3NA 2FZ1A 2P3IA 3BCWA 4BM8A 2W3JA 3SLIA 3POSA 3KV4A 5IVBA 1LRHA 3DYPA 3KCXA 5EIYB 4FT8A 1PNGA 1D2SA 3WDXA 4BIFA 3IMMA 4DEQA 4CDUC 4YM3A 5BNPB 1KS5A 1O5UA 2A6ZA 1OH3A 4HETA 4LKEA 2A5ZA 3B5LB 5BNQA 1OOPA 3GJAA 2VXRA 1DYOA 2MNGA 1TQ5A 3OGJA 4MXWA 5E89A 4C1WA 3EYPA 2XONA 3H8XA 2RVAA 1F31A 5T3NA 4AFDA 1Z78A 4IESA 5F5AA 3PJQA 2E9QA 5J98B 3ZYJB 4LIUA 1O7FA 4FPCA 1G9CA 1UZ0A 2YROA 5F3CA 4IEPA 1QQP1 2EXKA 1MS4A 3POIA 1M4WA 1VB2A 1DQ1A 1ENQA 2Y64A 2YU1A 1QDOA 3MIBA 4QB1A 4WVMB 4D6QA 2FDGA 2BZDA 3NV3A 3VBHB 1HKDA 4XIOA 3MIDA 4GA9A 1OKOA 1VBC1 1UF2C 3WW4A 1PMHX 2WZR1 4DUXA 1D4VB 2DTYA 2LS6A 2Y0OA 3BYWA 5GLZA 2OQ7A 3IWZA 4N43A 4Y20B 2ZGNA 2PHRA 4AK3A 3ASIA 4Q29A 5JZGB 1H2LA 5L7OA 1QKQA 1FNYA 1BMV1 4CCEA 4DXZA 4QX2A 4QQLA 1ULFA 3V0BA 3K77A 5GALA 1HRI1 3PU3A 2ZA9A 3ACFA 4V1PA 4IEXA 3BTZA 3DL3A 3P5BA 4FPKA 1ZBE1 2HJIA 4N53C 4YRDA 4JV4A 3DPRB 5F7UA 4OUSA 3MUZ1 4D0QA 1QXRA 2ORXA 1QOTA 3M3QA 2DFBA 3S57A 1QJZA 1HDKA 2QQJA 5BNPA 1QEXA 2PFWA 2RS51 1D4M2 2WZPP 3VZOA 2RG4A 4DZGA 1NYWA 3CL1A 2Z79A 1RUG3 3T1LA 3J7NA 5EJZB 2DUPA 4P9LA 5HV0A 2ZGOA 2ZGPA 4KU7A 3USSA 1NAEA 3VD7A 4ZZ5A 1WCQA 2ORZA 4BB3A 2GNMA 4LTAA 3R05A 2XJTA 2P3YA 4Y4YA 1RUD1 4F7ZA 1E5HA 1N47A 1TNFA 2X10A 3WQBA 2WN2A 3ZDVA 4CEWB 2P2KA 4MGIE 3CJIB 3I3BA 2Y26A 4WVMA 3RZMA 4AFBA 1UAIA 1UO9A 5I0TA 1K42A 1V9U1 1EUUA 3OJBA 3VBHA 5FYMA 3ZYIB 1FATA 5BNNA 1UYZA 5FZ7A 4MV2A 2JG8B 5AC91 2PHTA 1D0GA 2BEOA 3G6JB 4HG6B 1OF4A 3ZXAC 3HR9A 3OGVA 2RS32 3THTA 3DGTA 4MH0E 4QXHA 2WSVA 5ABJC 5CA6A 2FDFA 2XDVA 4Q4V1 3BPZA 3IKWA 2ZTNA 1WCKA 3PNAA 4UBHA 4Y20A 1X36A 4D69A 5JZGA 4B1LA 3C8XA 3AYEA 5F6LB 4P9XA 3NAPB 4LJHA 4HSLA 2R30A 1PZ8A 3GM8A 4GH4B 1R1A2 1NLRA 5K4LA 4YM0A 2LW8A 2I07B 1VP6A 1CZVA 5CVRA 1LTEA 2DTWA 1Q8QA 3H50A 5I0RA 2R0FA 5FZ9A 5IVJA 4AI0A 5FYHA 1W8FA 3LD8A 1D0HA 4AHWA 1SG3A 4JC1A 1KD7A 2XG3A 1IOAA 2WNEA 1ULDA 1S0EA 1OFSA 3ZXKA 4XBLA 5FYIA 1ZBA1 5E16A 3P3PA 2DDUA 1UY4A 4ZPIA 2ATFA 3T4VA 1DGWA 3T08A 4PLNA 4PF5A 1H4GA 1R083 3OTFA 2X5IA 1LEMA 4ZS2A 5K7PA 3LEKA 3NV1A 1VBB2 2JX9A 4AQ6A 3FBMA 4XF3A 1AYM1 4LE3A 2X05A 2R073 1F2NA 1HB3A 3RZJA 2JE7A 5BPXA 3GHNA 5ACA1 1GQPA 2VD7A 5IUQA 2ZHKA 4C8DA 4DY3A 3AP5A 4QQ2A 4CEWA 1K5MB 4BQ3A 2E7QA 2VVDA 5DQ0A 2BBAA 3CJIA 4V2WA 3RZGA 3FJSA 3PVOA 1UW8A 3O0XA 1AHSA 4NO4A 4LHLA 1KXGA 2CTVA 4CCJA 2G9ZA 3DKQA 3O0VA 4QHOA 4W6XA 1CAVB 3I3MA 2JG8A 5E8AA 2P3JA 5AFBA 4LKSA 4XUQA 4NVPA 2HWB1 5FUPA 5FOJB 1PZ7A 3NNFA 2YMZA 4XXPA 1GNYA 2Q1MA 4S2DA 2BW8A 1WMXA 2OPWA 4IW3A 3ZSMA 4BQ5A 5I0UA 4E4DX 3B9CA 5FQ0B 1TEIA 2ADDA 4Q8LA 3VBRC 1AX0A 1LENA 1BEV2 2E7AA 3SISA 2Y38A 4Q26A 1JZ4A 1BKZA 5T5LA 5JSRA 1ZA4A 5CKQA 1EAH3 1XYNA 2D6OX 4PI2A 3OD0A 4WM7B 4NJ4A 4YM1A 3WX5A 1BVVA 4QHBA 5HCAA 4OHYA 2HWC2 2MPFA 4WM8C 3O1OA 3BVCA 1ND2C 1URXA 2BVBA 3WNKA 4GB33 4COWA 3GF6A 1DP0A 2GC0A 5LA0A 5CBLA 1S2EA 4NHLA 1QJX2 3O1MA 2RE9A 1PIV3 2PAMA 2JJ6A 3MPBA 5D1IA 1PK6B 1OD3A 2V73A 2YBKA 1VPHA 2Y33A 3ZKUA 2NQYA 2TUNA 2P6CA 2DCJA 3I2FA 2ERFA 5KC6A 4X8NA 4AGVA 1GYKA 1RUF3 3ZYGA 1W8NA 4KGQA 1ZNPA 2ZEXA 1W90A 4HKLA 2FMDA 3ZVXA 1T6BX 1U0AA 5BNOB 4BHPA 2P1BA 1K5MA 4XHXA 1BCXA 3UT0A 3AK0A 2I2SA 3T0DA 4E2GA 3R6SA 3ON7A 4YVWC 2ETEA 4JTNA 2BU9A 3LFMA 5C9AB 3GZUC 2MHFA 5FREA 2JENA 2B45X 1W6NB 2WWJA 1BEV3 1LOFA 5ANNA 2RMU2 1OOPC 2DVDA 1SLCA 2Q30A 1OQEA 1JOPA 1I9RA 1DZRA 5FBJA 3SXWA 2WT1A 1VBA1 1KS4A 4QGMA 4FSJA 5GJ6A 2ZX4A 2HWC3 4Q4W3 4XZPA 4IE0A 4AZZA 4QPIB 4A7ZA 2JG9C 1SEFA 3ZXJA 1ZYBA 2PHXA 5G05L 2SBAA 1H9WA 1H9PA 2A6YA 4YFZA 2RJKA 4CDQC 1GP4A 1F5JA 2YC2A 3RYRA 3ZYPA 5CKNA 2D7FA 2WO7A 3POEA 4F3JA 1YEWA 3ZYHA 4XF0A 3S5QA 4LBNA 5A32B 2NLRA 4LOSA 2Y34A 1RUC1 4KG8A 1U12A 2VE1A 3I2KA 3MW2A 4YLZA 2D43A 4CP2A 2UU8A 2VCCA 1PK6A 1SDDB 5IW0A 2QFEA 3HNYM 2DV9A 4QMAA 3D3AA 2HWE3 4F83A 4N43C 1C8M2 1HW5A 2WS92 3EJKA 4OYUA 1XE8A 5T5JA 4D7TA 2DFCA 4H14A 1YQ5A 3VDDC 1OFNA 2Q5TA 4NRPA 4HZFA 3WUDA 4C90A 1QJY2 2OVUA 5FZ8A 4GWJA 4COUA 5AVPA 3ZXEA 1J83A 1LJ7A 2BQPA 2AC1A 4PDWB 2GC2A 4CU6A 2P17A 1DGRN 3IDCB 4QPYA 3I2JA 4LKDA 1NLQA 2RS12 3USUB 3POWA 4PIXA 4Y1VA 3BU0A 3OPZA 5GZDA 3ZO0B 5F6KA 4EWEA 5C9AA 1DYPA 3VD9A 1OC1A 3MF9A 5BNPC 1AYN1 4QWNA 1W6NA 4A7KA 4GMP0 4NWWA 4NHXA 5B4XA 2E33A 2VZQA 4BA6A 1JBCA 5FZBA 4KI5M 1MS0A 1ULEA 2ZX0A 1BQPA 1SLTA 1C4RA 2PAEA 4IEYA 4OCTA 1QJFA 4TTGA 2V72A 5FMDA 5IAXA 2BTVC 1UX6A 1RTVA 2VTXA 1ACCA 1PO11 2ZZJA 3K4DA 4IV3B 2ZZQA 5FY4A 5LWBA 2LUWA 1UCXA 4A45A 3LWCA 1KGYA 3B00A 1FMD3 3D82A 5ERLA 3CZUA 4JX0A 1UZZA 3RRDA 2VQTA 2YUEA 1WCDJ 4CDXB 1S0CA 2WNOA 3Q8EA 4XFCA 5LBCA 2DYCA 3AP7A 3T0BA 3PL0A 3WDVA 1JYWA 1LGCA 4X8PA 4LEJA 4YGBA 5A32A 3VBHC 2WC2A 4IGOA 5BNNC 1RUI1 4LBMA 5FPVA 1V6IA 3EO6A 4PF1A 2BPA2 4AOCA 1AR81 2BGCA 4CVUA 1YQ8A 2ZKLA 3NJYA 4JGZA 5BY5A 1S0GA 4EN8B 5DG2A 2Z69A 3E1F1 4D94A 1HRV1 1QJU1 4D7YA 1YQ6A 4XVHA 4GQ7A 5JZGC 2RS13 3ZSKA 4P9IA 3PMSA 1NA1B 3JZVA 4D6SA 3ZXFA 4YSFA 5IATA 1UOGA 3RWKX 2ZGTA 1FOD3 1KITA 1TE1B 4AEJA 5FXZA 1ULGA 2KM2A 2WFF1 3DPRC 3ME2A 4W8JA 4DMIA 4EE2A 1QMJA 1TME2 1XOYA 2WO1A 4LIVA 2BV4A 2AENA 4LMFA 4JKKA 4ZKTB 3I3DA 2FCTA 3LEIA 3NNMA 1Y9MA 3BKZA 1VBD1 2KD7A 2WR9A 1N1YA 1WCSA 3D6EA 1KFUL 5CG8A 2QQNA 2C0ZA 5FPUA 4IEOA 1RUE1 3W9AA 2HWF3 1TMF1 1Y9QA 4ITCA 3MPPG 3OGSA 1W6OA 1GANA 4CPBA 1PGL1 2PA7A 2IWGB 3KVBA 1REEA 2FCUA 2R063 3U4XA 1JOBA 4AAXA 5F37A 2HYXA 2VOXA 5DAQA 2GU9A 2YB7A 2ZACA 4IV3A 3TNQA 3CNAA 4E2QA 1QJEA 4L0PA 4KWUA 3WEZA 4OHWA 4CEWC 2CDPA 1CVNA 4CDXA 3M3IA 3CJIC 1YXWA 1UY3A 4TYSA 5FXWA 1KRIA 2C9AA 5FO8B 4EJRA 5E88A 1AR61 2MEV2 4I09A 1Q43A 2JG8C 1ND3B 1YFUA 5EWSA 4C0HA 3HNMA 1UU5A 1OLRA 4MZUA 4RA0A 1W6QB 5FZDA 5T50A 4I3GA 5LRSA 4QX0A 1NA1A 3NAPC 2RDQA 3VN4A 4CP9B 4IUGA 3AL5A 5A1LA 4Z82A 5J36A 3S0MA 1LR5A 1LOAA 1CAWB 2RR13 2J1VA 3WNXA 5FDBA 4YW1A 2VBPA 3VD4A 1RHI2 5I8TA 4AVBA 4Y5Z0 5FWJA 3H1WA 4WVWA 1IPKA 1S2BA 2VW1A 4JGYB 1UPSA 3IIIA 2C5DA 4MHUA 5IAVA 2ARAA 2XL7A 1XB9A 1O3TA 1XXNA 3WINE 5FZ1A 1UXZA 3NQHA 4Z92B 4Y24A 4FFHA 2ZHLA 2BYVE 4GMP3 2WWSA 3R4SA 5A7WB 4C0BA 1YWKA 5J37A 4FTEA 3LF7A 3VZMA 3C7EA 3EMRA 1NOVA 1UD1A 5JOZA 3K51A 1COV3 4CCCA 2FMYA 1RJ8A 4HBNA 4TLGA 3A0NA 5JI7A 4IETA 2J22A 4KU8A 5LA2A 1GSLA 3LAGA 3RG0A 3SITA 3CEWA 3PUQA 3RPQA 1K3IA 1QXJA 4BISA 4AEKA 1A3KA 2WT2A 3FX3A 2IVJA 3I59B 4DXTA 1N1TA 3T0AA 3UGGA 1K5MC 4YGDA 3E5XA 1PM7A 4XMAA 3B3QE 4OUMA 4BQXA 2H6BA 4XCAA 2Y6KA 1AR71 1Y9GA 3CKHA 4MADA 4Y3OA 1W8UA 3RI9A 1IS4A 2VG9A 3NKGA 1FPN1 4FTSA 3LFIA 1LOFC 4ZXKA 2B9UA 4NROA 5JOXA 1WKYA 2ZGSA 4MX3A 1RUH3 1YUDA 4PQ9A 1W6QA 1XE0A 3IIAA 2IZWA 2VOWA 3POFA 2CSGA 2ZCWA 4DXRA 3S7IA 1MEC2 3HOBA 5A3UA 3GBFA 1CAWA 2XLAA 4RD7A 5C33A 4JCKA 1BBT1 5FP8A
chains in the Genus database with same CATH topology
1NY72 4H3WA 4RQPA 1H8TB 3WLUA 4IXLA 4WM7C 4KQ7A 3VKLA 3UJOA 1DBNA 3AYDA 4E27A 2WQZC 1FV3A 1UL9A 4LHKA 1ASJ1 3VKNA 4FOVA 4XILA 3OYWB 1PK6C 1ALYA 2WSUA 1YFYA 1MVEA 4AEMA 2ZGMA 2YY1A 5JPNB 3DKWA 1PMIA 4META 4PIYA 2XJUA 1CAXB 1AXYA 3B69A 4TSVA 5FAXA 1YI9A 3URFA 2QUOA 2ES3A 1ZM1A 1QOOA 2GNTA 3WR0A 2R0HA 2XH6A 1DDLA 2YHJA 4L8QA 2AREA 1OQDA 3ETQA 1PVXA 3J9SA 3R0RA 5C9AC 3RZZA 1O4ZA 4YYOA 3M70A 1Q8SA 2W39A 1HLCA 2R6QA 2D6PA 3QACA 2XJRA 4JDOA 3H7YA 3Q9OA 1DZQA 2EA7A 4QPIC 4R8HA 5GM0A 3VBRB 2PQQA 4OHXA 4TZDA 1PVC3 1BK1A 1VBE1 4FPEA 1WW6A 1DQ0A 1W6PA 1H8TA 3LSDA 5EYYA 4M00A 4Y26A 2ZBJA 1LHVA 2BNOA 2R16A 2DCTA 3OBTA 1PO23 5KXCA 4FO9A 2NMNA 1WD4A 4Q0SA 2D3SA 1MS3A 1QGLA 3FUQA 3JUUA 4YGCA 3MICA 3VKFC 1ZZCA 2X53S 4QD2A 1AR92 3B93A 2ZGRA 5FRAA 1J58A 3N7KA 1EV13 2OPKA 4YZ1A 1AF9A 2ZX3A 1CAXA 2D5HA 4YW2A 4RS5B 5BXXA 1AZDA 2R042 4L2NA 4HSJA 5T5PA 3A0KA 2XBO2 4PDWC 2NPIA 3FFZA 3JBG1 1OA3A 1RINA 3BTAA 2Z42A 3AXDA 4DOUA 1VRH3 1NLSA 1A8DA 3AXEA 5DDJ1 2VUAA 2WIIB 1EY2A 4EWDA 1OSGA 4LBLA 3RWNA 4OLLA 3DF0A 3KM5A 5FLJA 4MXWB 1W6MA 2WLQA 4I0AA 3HWJA 4BH9A 4AI1A 1WA4A 3N4MA 1LHWA 2NMOA 3J8F1 2HWD2 2WJSA 1Y7BA 2R49A 2PTMA 3TN91 1PGW1 4IV3C 3AP4A 1D2QA 1OLQA 2XLFA 1QDCA 1I3HA 2W52A 3B94A 1RITA 2VY0A 1AR93 4CDXC 2AZ5A 3H9AA 3E5UA 3ZFGB 4A2UA 3E97A 4BMEA 1UIJA 1WMFA 1RJ7A 2QKDA 4BPZA 3GYDA 3HQXA 3WDWA 1V6NA 2K9ZA 1C8NA 4M3CB 1FI2A 5L7OB 3AFKA 1JYIA 2XWBB 3EQEA 3OBRA 3BODA 4QGLA 3WW1A 1NA1C 5LEKA 3WP5A 5GZCA 3SH5A 2DCZA 2DVAA 1ENSA 1POV3 3ES1A 1NE6A 2YC0A 4HVRA 1G8WA 4EN0A 1SBEA 3I8TA 2QJVA 5IK4A 4Q4X3 1RUJ3 1PGSA 2HWD3 2ZHMA 1AL21 3LA2A 4C91A 5CU1A 2AUYA 1RMU1 2Q0AA 4IERA 4MSVA 2LALA 5E1RA 2A73B 4RHV3 4FPLA 2WNUB 2UYAA 2RM23 2WZR2 3MI8A 5IT6A 4YG6A 5TSWA 1N1VA 1PHMA 2CGNA 1RUG2 2XHKA 1N3PA 3HMYA 4FOWA 4EROA 4FBFA 1HQWA 4SBVA 1J1TA 1Y43B 2ARBA 2D6MA 2XVLA 2RHPA 2ZOEB 3ZFGA 4XJ8A 5FLHA 2FHRA 5BNNB 1HV1A 1LULA 2B39A 3FBYA 2K2SA 4QGNA 4LUMA 2D97A 1ND3C 1GZWA 1FV2A 4P9YA 5KHHA 1MS9A 4B29A 3BALA 4M3CA 1WMDA 3MLLA 5KWRA 3D4KA 2HEWF 4YG3A 2GMPA 2XL9A 3PVEA 2EXIA 1V70A 4G4FA 1YIPA 4O9GA 1UN1A 3TWIA 2DVGA 3H1MA 3UKVA 3ZYRA 1G9BA 4RQPC 2D3RA 3MIEA 4QQPA 4JGYC 4EN9B 3M4FA 1XRUA 2WZR3 3JB4C 1W0PA 4L92A 5JCTA 4D7SA 1NXMA 2PELA 2ZAAA 2X5IB 3ZX7A 1XE7A 2ZABA 3SH4A 5AC92 4HPKB 2GNBA 4RFT0 4XQ4A 1HXS2 2WNUA 4IQPA 4OFGA 1SBDA 3NJZA 2RJLA 4COYA 1HV0A 1ZBE3 1UU4A 4PBOA 3VZKA 2W0XA 1AVBA 1MS8A 1UKGA 3WOGA 2WNVB 1R082 4AHZA 2E53A 1OI6A 2RS53 1XNDA 4XF4A 1Q56A 3G7DA 2WT0A 1C28A 2VNOA 1OHFA 2R072 4L97A 4ZU5A 3J4UH 1YO8A 2ENRA 4MGYE 1O4YA 2O8QA 4N90A 1NXD1 2DUOA 1ZBA2 2ZMLA 3KSCA 1RUD3 4XJAA 1AL0G 1D4M1 3POYA 4ISQA 4AFCA 1V9U3 1H8TC 1SFNA 2XLGA 5AC93 4K7JA 3AZZA 3KQRA 2OYZA 1HXS3 4BQ1A 4QXKA 4ASLA 4Q4V3 1O3RA 2V5YA 4KH9A 4QM9A 1YLLA 1KJLA 1H1IA 1UZYA 1QNWA 3VV1A 3J26N 1EAH2 3SMHA 3GHMA 4Q0PA 4HPKA 3M1HA 1ZZ7A 4GB32 2K0GA 3L2YA 4IEWA 1EP0A 1QH6A 5F1RA 1PIV2 4RGAA 2RS31 5I0SA 4ES8A 5FMOS 2WNVA 4BWOA 2PHFA 4HKOA 2Q1ZB 3CO2A 1ZBA3 3HBZA 4OI4A 4AI2A 1RUF2 5HXVA 4HK9A 2H0VA 2GMEA 4HKWA 1X8EA 4LO7A 2AH2A 1FXZA 3DV8A 1R1A1 1RVF1 4RR3B 1G9DA 3WT3A 1AYM3 5KXBA 3TAYA 1DFQA 5ACA3 5L19A 1NCRA 4HVOA 1WGPA 2DWRA 4JDMA 4UXAA 4UW5A 4QX5A 1AJKA 1MS5A 5L36A 1HX6A 4GALA 3VHNA 3QCWA 4BZ4A 5FPXA 4KWLA 2D6KA 1CONA 3WDYA 3AZVA 1VBB1 4Q4W2 2ET7A 3JQWA 4GIQA 4BLJA 4DS0A 2HWB3 4GWNA 2NYYA 3TYJA 4XBQA 5C8CB 1FX5A 1MZ5A 5EFUA 1VAKA 5DUVA 2QE3A 3JQXA 4P5HA 3KLSA 5FPZA 5A33B 3IBMA 5I91A 2BWAA 4AHXA 4RS5C 1CN1A 2HWE2 2B42B 3WVJA 1SCRA 4BCUA 3IT8A 2R32A 1F5FA 3PVNA 3W59A 1OKQA 3P3NA 4RR3A 1DF0A 2A6XA 1EYBA 4OHZA 3H0OA 5KXDA 2HWC1 4ATEA 2EVXA 3WP6A 4HMZA 2CGPA 2DCKA 4OHVA 1F9KA 1ZRDA 1VB4A 1QJX1 4SLIA 4HL0A 3ZN4A 4PCRA 1DGLA 1C1FA 1ENXA 1T6GC 4GKXA 4BLIA 3ILNA 3ZN6B 1L3JA 2NP0A 2D3PA 2WFPA 1LOEA 2ZX2A 4XIKA 2A7AA 5J7MA 4N9HA 3ZFGC 1CPNA 4LT5A 1V6OA 5SV5A 5HI0A 4QT6A 2NZ9A 1WLDA 4DINB 2XJVA 5C8CA 1VALA 1FMD2 4JGZB 3ZDSA 4UW4A 3KZ4C 1J3QA 3VHPA 4XJ9A 5DZGA 5FOBB 1AJOA 4INDA 3N36A 5L7OC 5A33A 1G6NA 1LHNA 4AI3A 4FOYA 3CF6E 2RMU1 3B02A 1EPZA 2OW4A 2Z2SB 3LZZA 3FC0A 1RUC3 4K20A 1PO12 5T52A 2WL1A 3GZAA 3GNEA 4COVA 3W58A 3OCPA 4LO6B 1FOD2 4ORFA 3MGUA 4LO5B 5FBZA 4NR1A 1Q3EA 4YGEA 5CFCA 3KT1A 3WCRA 4W6YA 1H8VA 2C1FA 1W6OB 3N7JA 3FZ3A 2WNUC 4AVVA 4ZU7A 3E6BA 2ZPXA 4U36A 3FLTA 4B4QA 4FQ4A 1WBFA 2R1DA 3ZN6A 5LK7B 3B9IA 4ES9A 4PJYA 3VUOA 5CFDB 2BNMA 2HWF2 4LLFA 1AYN3 5H9QA 1S0FA 1SDWA 1C8M1 2WS91 3ZIWA 2UY9A 5JLVA 1DHKB 3WG4A 2R062 3RQ0A 2VVEA 3UL2A 1QJY1 5I93A 4QQHA 3WXPA 1NCQB 3I4IA 4NOTA 1IPJA 5GZGA 1JUHA 3QBQA 1Q5OA 3ZFEA 3AFGA 4KG0A 2AYHA 3NL1A 4R9DA 5T55A 1DU3D 3KMHA 1PO13 2RS11 3QD6A 4XBNA 1J1LA 3ECQA 3VZLA 4UW3A 3MW3A 2UWBA 1GKBA 1OQ1A 2I74A 3KS7A 1RUI3 4N7IA 4AGRA 5K9YA 3MFCA 4XMIA 3RDIA 1SMVA 1AR83 1Z0HA 4XTMA 4P9GA 5JIAA 1B09A 5JDBA 5GLTA 1DLLA 5JMCA 2RR12 1JUIA 2XB6C 1HRV3 4QM8A 1QJU3 3AZWA 1GZ9A 2YGLA 1AR62 1G9AA 2VECA 2X5IC 4LO8A 3JCIA 3WDUA 1CESA 2LTNA 3EHKA 5KHJA 1ULCA 1J3RA 3WQ0A 1DQ5A 1IQAA 4R52A 1WW4A 2WFF3 1CQ9A 3HT2A 3INAA 4LR4A 5DXDA 3ZFFB 4Q8KA 2QNKA 2WNVC 5CFDA 1WBLA 1COV2 2JDZA 4HANA 3MFAA 1VBD3 1RUNA 1S2KA 1F8VA 3RYKA 5DUUA 2YV8A 2IXIA 3PVBB 1TMF3 1NCQA 4FPOB 5JSOA 1H2MA 3ENRA 1Y3TA 5GKAC 1FNZA 2EAAA 1B35B 4R9CA 2DU0A 2QDNA 5DUXA 4E2SA 1FYUA 1TME1 1JTZX 1R091 2YPJA 1IS5A 4M3CF 3MZHA 1APNA 3AKSA 2CNAA 4RQPB 1RUH2 3WG1A 1DQ2A 1AR63 5DUWA 1H30A 1QF3A 2VMHA 4B4PA 2ARXA 2QCSB 4DB5A 1MQTB 5D8AB 4DRVA 1ZRCA 1LU1A 4ISRA 3UKTA 4GMP1 2VW2A 4YM2A 1YJKA 4Z2WA 3BOWA 3IDBB 4AFMA 1FPN2 1DZTA 5KHKA 5F5QA 4YZ2A 3S7EA 2CAVA 2JICA 2MEV1 4BE3A 5F9TA 2VOVA 2EXHA 5EV7A 3TB0A 3ZFFA 1H2NA 3GBGA 3M8LA 2CAUA 2EXJA 2ZS6B 2VULA 2PN5A 4HK8A 4CDUA 4HN1A 4S2GA 3VL8A 3AYCA 3HN1A 4R4XA 1VJ2A 2D93A 2VMIA 2A3WA 2JKBA 4KL1A 2JECA 4FSJA 1S0JA 1XQNA 1RHI1 1HQLA 1UKRA 2NM1A 4RR3C 3RMYA 1LHOA 4JVAA 3ALQA 3E6CC 1B35A 1ASJ2 2YYOA 1NE4A 3ST7A 3TRSB 3D8CA 2QQPA 4Z8BA 1MR5A 1SLAA 3K48A 4Y1YA 5FTTC 3WQ7A 1DGWX 5C4WB 4XFAA 2X29A 3N3HA 1PZ9A 1W6PB 1S0BA 4XJWA 1AR73 3WP4A 5JOWA 2O0OA 4TLFA 1HQNA 1FPN3 1JN2P 4XE9A 1MQTA 5D8AA 4AEDA 1JW6A 1PVC2 1VAVA 3AKRA 2ZGKA 4R4ZA 5FFOC 4YARA 3C3VA 5C8CC 3AJYA 4X6QB 3MIFA 1S1AA 3NV4A 1VR3A 2B8MA 4FPHA 2E6VA 4O9EA 4XHBA 1BZWA 1PO22 3VZJA 1BBT3 4MGZE 4N53A 2Y0IA 5L73A 3TOJA 1POV0 3ZN5A 3M2MA 1S0IA 2OZ6A 3JD72 2VNRA 2TBVA 1LODA 1ZRRA 1QH7A 2N7GA 3O5SA 1ASJ3 4HN0A 5GLVA 1EV12 1UU6A 4LBQD 1MEC1 4XQDA 2VOKA 1SLBA 4LA3A 2WA3A 2GALA 2ILMA 4DQAA 1W6MB 4RGGA 2D5FA 4I2OA 1XU2A 3PMEA 5A3LA 4R9AA 4LLOA 1VRH2 1MZ6A 2JXAA 3U11A 4M0NA 3ZXLA 3HAGA 3TNPB 1M06G 5C4WA 4FVVA 2PLV2 4XFBA 5BYNA 2V09A 2WKKA 3KB5A 2PHDA 3OY8A 5ABJA 3NSTA 5JAXA 3IDEA 4CZSA 1J59A 2G4IA 1QY4A 5BV6A 1YNAA 3JD73 4WZCA 3VLBB 4JGZC 3UK9A 3V65A 5K8SA 3QOPA 5AFEA 4PBPA 5IK8A 3KGZA 2ZAHA 1Z7S1 3FLPA 2HEYF 4IV1B 4XYXA 1G7YA 1HIXA 3ZPYA 1DGRA 1ZZBA 2JEMA 1XNKA 4FP2A 4IEQA 1X7NA 3U10A 3ZMNA 5J48A 4YW5A 4XFFA 2IXHA 5EZWA 4MXVA 4CRQA 3ZXGA 4DRRA 1H1MA 4KWKA 5GLUA 2PLV3 1VLNA 4LNVA 2ZGLA 2PHWA 4Q4X2 1RUJ2 3LA3A 3NW4A 2VNGA 2XVGA 4NN0A 1IKPA 3JBG3 4CEYB 2PHLA 5JIUA 4LUKA 1SACA 1ZZ9A 5DDJ3 2XJSA 4YNIA 2YGMA 5CFDC 4RHV2 1AR91 3WP3A 1AXKA 2RM22 4I3PA 1KDMA 2GC1A 4GXLA 4OVEA 1GZWB 1NCQC 2R041 1JH5A 2XKOA 2XBO1 1KJRA 2IXKA 4Q4Y1 2EF6A 4YW4A 2VUJA 5A3MA 4RL7A 3TN93 1C1LA 4Q1PA 3LSEA 3RJRA 1QOSA 4WM8A 5J96B 4WVZA 1X82A 4PLMA 2Q4SA 4IV1A 3LOIA 3ILRA 3M3OA 1V6LA 4IEUA 3E5QA 3SNMA 4MVTA 2YZ4A 5JPMB 5T5OA 3BIWE 3A4UA 1QQP2 1CJPA 2G9GA 4JAAA 2HWD1 3L2HA 4LBQB 1WUVA 1U5YA 1VBC2 5T54A 5CADA 1BVP1 2BBVA 3U0ZA 2D98A 3AKTA 5EXOA 4CEYA 3B01A 3ZFFC 2H0BA 4YVWA 3RJ2X 4YZ3A 2OUJA 2A3YA 5SV8A 1BMV2 4RSUA 5CB7A 3ILFA 3WY6A 4XEZA 2UWCA 3JB8A 1HRI2 1AL23 2GDFA 2B5HA 3H3ZA 5FCCA 4U2AA 1I6XA 1RB8G 1ZBE2 4W6WA 2B46X 3VBSB 1RMU3 2HKXA 4HVQA 3VL9A 2AGSA 4CTEA 2JG9A 4HLTA 1LOCA 4XF9A 4CDWB 1GV9A 1YFXA 2RS52 1B35C 3ATGA 4CDQA 1OD5A 5AVAA 1QQP3 1WLWA 2IXCA 3ROUA 3SH3A 3IPVB 2TNFA 1FAYA 4Y1XA 4AW7A 2IFWA 3LOBA 1WMEA 1CX4A 1RUD2 1VBC3 2XJQA 3ZSLA 5C8WA 1MQTC 5D8AC 2CV6A 2WLPA 4AEDC 1JXNA 4UW6A 4LBQA 1LU2A 2W68A 4OI1A 3VDDA 1RUG1 1V9U2 2IC1A 3KCCA 4H7MA 4Q1RA 3WHTA 1HRI3 2Z5WA 1V6KA 1LKNA 2GSYA 4LHNA 3APBA 3WDTA 3NKTA 1DQ4A 1MZEA 4Q4V2 1MS1A 3VBOB 4AE2A 3V0AB 1GZCA 3WW3A 1UMZA 4GWMA 4WZFA 3AMHA 4M0HA 5CNAA 4L99A 1SFYA 4HT1T 1YIFA 4AVCA 3VBSA 2CYFA 4FQZA 2AR6A 4CDWA 1GICA 4IL7A 1NCRB 5KXEA 1QNYA 1RIRA 4L11A 3RYPA 1O3SA 4FXGB 4YZ5A 2ZHNA 4UBGA 2ET1A 3KT4A 4EN6B 1YI7A 4G3YC 4LULA 4E4SA 5B2GB 3QH7A 5FO9B 4I0BA 5C4WC 3IPVA 2D44A 1AYM2 5HCBA 4AI8A 4FP3A 4FAGA 1ZX5A 3VKMA 2A70A 5ACA2 4QU2A 1G86A 3RSJA 3ZIXA 4AXOA 4DNYA 5J09A 1HXS1 3AMPA 1AX1A 2DUQA 4NHMA 5GZEA 2JE9A 4ATFA 3VKOA 1R081 3AP6A 4S2FA 1D4M3 1ZRFA 1SCSA 1RVF2 2XWJB 1XYOA 2HWB2 1OPMA 2R071 4M3CE 3VBOA 3V0AA 5H9RA 1XNBA 3N35A 3DPRA 2KA3A 4Q0VA 1WD3A 1LB2A 3LKJA 5HBAA 1S55A 4MGKE 4A7YA 4FOQA 4B4RA 3DN7A 1WW5A 3NV2A 3CJXA 3VHRA 2YDEA 2GH8A 4J1WA 3V56A 2I45A 2XJPA 3WQ1A 4G9SB 2BFUL 3VBUB 2RS33 3FUOA 4I30A 3BOPA 1U5XA 4J1XA 2HYKA 3H8UA 1EAH1 2DURA 3C2UA 1ZZ6A 1GR3A 1LOBA 3VBFB 4JDNA 3MLJA 4QPGB 1H4HA 1R1A3 1LESA 1RVF3 4B7EA 1RL3A 2WA4A 4GB31 4IEVA 2VQ0A 2BWCA 1PIV1 3MDPA 3KD4A 4KNCA 3HT1A 5EYXA 4EN7B 3NAPA 4B7KA 3WV6A 2D6LX 1LEDA 4GH4A 4XDQA 1ZVFA 4YVSB 1RUF1 3AKQA 2PHUA 3UKNA 4XW3A 3QH6A 1GFF2 5CIRA 1LHUA 1VBA2 4Y1UA 3O0WA 1VBB3 4WV8A 4K3UA 3T2TA 3MLKA 4IV1C 2VU9A 4Q2FA 2CWSA 4BMBA 3THPA 2E63A 4P9JA 1AXZA 4XFIA 2GN7A 1DG6A 1BEV1 4Q0UA 2VH9A 2UURA 1MACA 3JU9A 2VVFA 4CYDA 5CFCB 1RUC2 4TWTA 1N3OA 4Q4W1 3VBUA 4JRLA 1I5ZA 1BYHA 3FHIB 4F8AA 1MVQA 1W39A 2B7YA 4CEYC 4AF9A 4Z1VA 4FPGA 3D5OA 2FZ2A 4H55A 3VBFA 1CAVA 1KDKA 4B8EA 4ZU4A 2CGOA 4QPGA 3PTYA 1CAUB 3LCPA 1ENRA 1Q8OA 4KBBA 2P37A 1VBA3 5K0UB 2XPJA 4H7LA 5FO7B 3BU7A 1QWRA 3ZFEB 5FQ0A 1AYN2 2HWE1 3RI8A 1QJX3 3WW2A 4MUVA 1ZZ8A 4YVSA 1C57A 3T1MA 4E9KA 2H6CA 2ZJCA 3FMGA 4WM7A 1CR7A 3RMXA 3AMMA 1CIWA 1V00A 1RGSA 3WCSA 5IK7A 2GH2A 5J3UA 1KFXL 3B7MA 5C6CA 1IS3A 1NG0A 1O5LA 3LGRA 3O14A 3AB0A 3FLRA 1CGPA 4XXAA 4OZXA 5JVVA 2GAUA 4M01A 2QVSB 3IN9A 1GQHA 1EPWA 1RUI2 4URTA 1IZ3A 5BNOA 1G9FA 1OMIA 2RMU3 1AR82 2ZGUA 4ASMB 4BOWA 3CU7A 1HRV2 1QJU2 3ZXDA 5H9SA 3TBDA 1FMD1 2UYBA 1NZCA 2VW0A 3SCFA 4EV0A 2YXSA 3SCHA 1WLCA