2BOJA

Crystal structure of pseudomonas aeruginosa lectin (pa-iil) complexed with methyl-b-d-arabinopyranoside
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of Different Monosaccharides by Lectin Pa-Iil from Pseudoman Aeruginosa: Thermodynamics Data Correlated with X-Ray Structures.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Lectin
molecule keywords PSEUDOMONAS AERUGINOSA LECTIN II
total genus 20
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2bojA00
1OVPA 1OXCA 1W8HA 1OVSA 4CE8A 5A6ZA 1OURA 2JDYA 2BP6A 3DCQA 2VUCA 1OUXA 5A6XA 5A6YA 2BV4A 5HCHA 2VUDA 5D2AA 5A6QA 3ZDVA 5A70A 1UZVA 1OUSA 1UQXA 2JDUA 2BOIA 2BOJA 1GZTA 4AOCA 2JDMA 2JDHA 2JDKA 4UT5A 2WRAA 2XR4A 5A3OA 2JDPA 1W8FA 2JDNA 2VNVA 2CHHA 2WR9A
chains in the Genus database with same CATH superfamily
3D0SA 3AYDA 2WWJA 4YPJA 2FDJA 1AL21 1O3SA 2K2SA 3EO6A 4NOTA 5FP4A 5APAA 3B02A 3PVBB 4Q4V3 3HQUA 1IS4A 3CMGA 3SMHA 3KCCA 1FYUA 3HPNA 1JH5A 2ARCA 2D3RA 3AP9A 2FDIA 3LWCA 1HB2A 1MS3A 4DUXA 4IE6A 5CFDC 1GP4A 1REDA 4Q0PA 2WNUB 5FY0A 5KBFA 3BIEA 1L7LA 2AEZA 3FHIB 5FPUA 3WT3A 2A3XA 2D6MA 3SITA 4AHZA 4CEYA 1FATA 2XPJA 2Q1ZB 1S1AA 3THTA 4COVA 4OVEA 1RTVA 1Q56A 3SISA 3VDAA 1O91A 2OUJA 4NIIA 4CDQC 5JCTA 2QKDA 2XQXA 3WY6A 3POSA 4YZ3A 1VRH1 3U78A 1AR73 3BU0A 2EXJA 1G86A 4LE4A 1AR81 3S7IA 3RDIA 4DXRA 2BW8A 1SLBA 2QZ3A 3ZMNA 1HRV3 1ZBE3 2EIGA 3DUIA 5DZEA 3HQRA 1DQ1A 5FZBA 1CIYA 2MPFA 3OGSA 3UGGA 4YVSC 1AX1A 1WW6A 2UURA 4RGAA 1O59A 4DS0A 1FOD1 1NCRA 4ZXKA 1OLRA 1NG0A 1OFSA 2CTVA 3IIAA 1WCDJ 4R4ZA 1I1EA 4AEMA 3KV6A 2G4IA 1N1SA 2RG4A 1QJX3 5FMBA 5E1RA 2R073 1EP0A 1YCIA 2BUKA 1OVPA 3D0JA 2WFF3 1TME1 1MEC3 1HJGA 1CJPA 2JG9C 5DAWA 4JCKA 3CNAA 1COV2 4Q1RA 3WNLA 1DHKB 3CJIC 1P8JA 5FZEA 3NJVA 3RZMA 3PURA 1YFUA 2GN7A 3AVSA 4DPNA 4AI1A 1E5HA 4BIOA 1AXZA 3IB3A 3NW4A 3NWKA 1OHFA 2EF6A 4RD7A 1W6MA 4AGGA 4DY3A 4P08A 1ULDA 4QHOA 1AJOA 4WVVA 4LK6A 4XTPA 3CLPA 5EZWA 2BNMA 4JZRA 1XQNA 3R4UA 2IXIA 4JQRA 2YPJA 1VB2A 1CAXB 1LJ7A 4KI5M 4NHMA 4XHXA 5C33A 4XBQA 4DO0A 3KLSA 1GOHA 1A3KA 1PHMA 1J83A 1WLWA 1VBC3 3K3OA 3NRUA 1JN2P 1CD3G 2WS92 4QPGC 1UAIA 2B45X 4XUOA 1AR82 1KITA 3DKQA 3I3MA 3K4DA 2ZGPA 4DXSA 2QFEA 3B7MA 1LOAA 4FO9A 4G4FA 3W58A 5EWSA 3G7DA 4JDOA 4QWNA 2K9ZA 4Q4V1 5L19A 1SZBA 2GZWA 4CCEA 2W68A 3M3IA 2D43A 1R1A3 2W91A 5A32B 2HBTA 2W1QA 1ZM1A 1AR63 3LEKA 3OY8B 3FFZA 2VZRA 1AR93 4IEYA 2BNOA 1G9FA 4OFGA 2HWB1 2ZCWA 4PIYA 1ZZ7A 2P37A 1H6YA 1NZCA 3IDCB 3OPZA 3Q8EA 1W2AX 3TEZA 4B1MA 4FOYA 4XXPA 1K45A 2DBIA 4AG4A 1OURA 3ORJA 2ZGMA 4RA0A 2P4EA 2R1DA 2B4KA 2QQJA 3T30A 1RUF3 2BVVA 5A1FA 1W8WA 2ATFA 5A6YA 5L7OB 2P2KA 4LKSA 2XKPA 4YLZA 4D94A 1PGL2 1JYTA 1QXPA 1IPJA 2BOJA 3PIJA 4LBKA 2QQVA 3T4HB 4DQAA 2P5BA 2NMOA 5FYHA 4H2AA 4CP0A 1GZ9A 2ZX2A 3PJQA 4DB5A 2RMU3 1OBNA 2ZGTA 4OI2A 1FOD3 3EXUA 4XUTA 3S5AA 1WW7A 3ETPA 4KGQA 3URFA 3TN92 3NO8A 2ZKNA 3W20A 4AWDA 1PVC1 5FZAA 4RYDA 1XOYA 4ZS2A 4CDXC 4EZ4A 2VNOA 4FT8A 3MW2A 3VD5A 4GKYA 4IV3A 4RR3B 2Q8CA 1VRBA 4CXXA 4Y1YA 1I9RA 2PAMA 3U0ZA 1M4WA 3AYAA 4PHZA 3ZXDA 4ASKA 1Q3EA 4RR3A 2R043 2A6VA 2W1SA 5FZIA 2WZPP 4IE7A 3BUCA 1UZWA 2RDRA 2RJKA 2Y6GA 4NHKA 4UW4A 1XU2A 2JDPA 2DVBA 3CEWA 1XBFA 1ACCA 3LEMA 2OS2A 3E6CC 3K77A 4CCNA 3LOIA 1DGLA 3M7AA 4A44A 1TQ5A 1MZ5A 2EXHA 5FZ3A 1RITA 2BGPA 2UY8A 4L11A 1A8MA 3WDWA 1O5UA 2CWMA 4QB6A 1GUIA 3ZFGB 5T5PA 5ISLA 3J7NA 4TSVA 3O1RA 3RFRA 3ZMOA 1T6GC 4BHPA 4COYA 2QUOA 3N7LA 5C8CA 4Y24A 3I2KA 4A6SA 5A3OA 5LRSA 3LSDA 3B00A 1ULOA 2R0FA 3WEZA 3GDBA 4SLIA 1Y3TA 4MXVA 4UFMA 5FZ9A 1D4M1 4OI0A 3PMSA 3I2DA 1JZ4A 3PUIA 1RUE1 1OA4A 5IWFA 2Y6LA 3HT1A 5KXBA 4H7MA 5T54A 3ETQA 3KB5A 4HMZA 1OSGA 2XB6C 3EHKA 4Q4X3 1R1ZA 3NAPC 1QH6A 5A3NA 3O0VA 5BNOB 1D2QA 3K4AA 3TYJA 4FXKB 4QGMA 5F5CA 4K1ZA 5K4LA 2AZ5A 2LALA 5DUWA 2XR4A 4XTMA 5DXDA 4DMIA 1WLTA 1N47A 1N1TA 4UWDA 1ULGA 5K0UA 3I7DA 4ZHNA 5ACA2 1UNBA 4XVHA 4C8DA 1JYIA 2IUWA 1C1FA 5GLWA 3KVAA 5JZGC 2WNEA 4KWLA 1PZ8A 2YBPA 3C7EA 2E31A 2P6HA 5LB6A 1GZWB 3ZX7A 2SLIA 5EJ1B 1RL3A 3BPSA 1NE4A 3SLIA 3AX4A 1UU5A 1GZWA 3MBWA 4IERA 5LRRA 3A0KA 5FZ7A 2KA3A 3ZYRA 4LKDA 2JE9A 5CZKA 1OUSA 2HLEA 4MGZE 4GWNA 1QJU3 2WRAA 1S2BA 5T5JA 1SMVA 4AF9A 4COUA 3SEPA 2J1VA 1WMXA 3KVBA 2PHTA 1OOPA 4CDWA 3J8F1 5FBJA 3UJQA 2OX0A 1JXNA 4BOWA 4M4PA 1VIWB 4NIHA 2GMPA 4CE8A 3GHNA 1WWYA 3GZEA 1W2TA 4N90A 4D7TA 3BU7A 2QTWB 3WDUA 3HEIA 2JICA 3AMHA 4UBHA 1WMEA 2HWC2 1NA1C 2JDAA 4LOSA 2VTXA 1OFNA 4KBZA 4CPBA 2JDUA 1HB3A 5CA6A 3U11A 4I3PA 2DDUA 4B4PA 1DGWX 1GP6A 2ET1A 5T50A 1CX1A 2HH9A 1RUG2 1VALA 4Q8LA 2O8QA 3SKJE 4AHYA 3TWIA 2JG9B 2D6OX 3NVCA 2A7AA 3OBZA 1OLQA 3THPA 2D5FA 1UKRA 2CAUA 2PLV3 1RUI1 1OT5A 1W06A 1XC6A 2Y6HA 2ZEYA 5D21A 1PK6C 1W2NA 3BOPA 4GMP1 5FYUA 4I0WB 4B7KA 3WUDA 1K3IA 2P3IA 3S0MA 1LOFC 3ZPYA 4LULA 3RQ0A 5HPOA 5LA0A 1NKGA 2OZJA 5FLHA 1VMJA 4PLMA 4D7SA 3CU7A 2Y0OA 2X5IA 5A7SA 4CEYB 3VUOA 1V6JA 1QHDA 4Y5SA 4W50A 3UT0A 3U4SA 4CZSA 4OMDA 5FZHA 1QQP2 2MHFA 3M8LA 3BODA 5JLVA 3ZN6B 1MS1A 1PIV3 3JQWA 2C9AA 4KH9A 4P9GA 1KRIA 1AYN2 1GWLA 4HPKB 5FP9A 3TAYA 2GNTA 4DOUA 1V9U1 2XGXA 4YM2A 2WJSA 2CHHA 3KM5A 4PBPA 3RRDA 4YZ1A 1X8MA 4AHXA 3KF3A 1NXD1 1OVSA 2CGNA 1F9KA 1V6KA 5FYZA 1UPSA 1NCRB 2ZMLA 3JQXA 3WF1A 3ZKUA 3T3YA 1WUVA 3OGJA 1SDDB 4FVVA 4S2GA 2YV8A 3IZOA 3NV3A 3E1F1 1EAH3 3BB6A 3BALA 3LPFA 1UY1A 1BEV3 1W2OA 2Y6FA 4TLGA 5LA2A 2CGOA 1EPZA 4LJHA 5FWJA 1YJKA 4HT1T 5JR2A 5FO7B 3R6SA 1GFF2 1FPN3 4NPLA 1BXHA 1NZIA 4HOOA 3EJKA 1KFXL 1TVGA 2RM23 2JG8A 2R061 5D1IA 3O12A 5FUPA 2VAUA 4CEWB 1AYM2 1YFYA 5KHKA 4BLJA 4F3JA 3M3QA 2O14A 4NIGA 1UWWA 2JG8B 1RUG3 1VRH3 4N9IA 1GANA 4JDNA 3HR9A 4ATFA 4MO3M 2YU1A 3C8XA 1AR83 2K46A 4Y20B 1WKYA 4YWAA 4KU7A 1QDCA 1XE7A 2XJQA 5DAXA 4Z2AA 1GNHA 1OPOA 3AKTA 3GF6A 3KGLA 5FCCA 1NLRA 3J7HA 5FZMA 3RJRA 3Q8CA 4GULA 2HWF3 3V0AA 1Z78A 3J8F2 4PQQA 2VBDA 1RUH2 3B3QE 3CO2A 2ZGKA 3HOBA 4E4SA 3UKNA 1VRH2 1MZEA 4OQ8A 1K42A 1G8WA 3JU9A 1LECA 3ILNA 1C57A 5FZ8A 3NNJA 1UOJA 4IW3A 4OMCA 2VUAA 2XH6A 3TEXA 1TME3 3DCQA 5FK8A 3OD4A 2BZDA 4EQVA 2B8MA 2DTWA 2ZAHA 1Y7BA 4XJZA 5FZ4A 4IL7A 1TNFA 4UF0A 2X53S 1MVQA 4E4DX 4JKKA 1POV0 1BK0A 3OJBA 4JV4A 2Q8DA 4AR2A 5C9AB 5JMCA 3T08A 1QJEA 5GLZA 1PM7A 4HETA 2EIBA 3D82A 2AR6A 4AQSA 3SCGA 2DV9A 4N53C 4XETA 2R1BA 2E7QA 3LA7A 3EMRA 4QPIB 1B35C 3QACA 1Y9QA 4XDQA 1W99A 1ZZBA 1K12A 3OTFA 4N7IA 2Q4SA 1RUC1 5BPXA 1OKOA 2JECA 4NPMA 4HSJA 4BM8A 1HRI1 2PHDA 5FYIA 2PLV2 5FYVA 2FMDA 3C7GA 4FPCA 2PYTA 5IFTA 5IVFA 1O5LA 3VBUA 5K7PA 5EV7A 1XPWA 3ZLIA 3IKWA 2OW4A 1U5IA 5BNNC 1ZYBA 2E51A 2XWJB 3UL2A 3VBFB 1Q8OA 1GBGA 1X7NA 2BVBA 1EAH1 3PMEA 2VZQA 3U37A 4DRRA 5LCWL 3MDPA 1BEV1 4CU8A 3N4MA 2J1TA 1OQDA 2K0GA 1EPWA 1RUH1 1LULA 2W0XA 1GKBA 1W9WA 4CCLA 3M4FA 2YGMA 5FYSA 3KV9A 4IE0A 1CZSA 2OUHA 2F6BA 3AP6A 1F35A 3VKFC 1YQ6A 2RDQA 4Q5OA 5HV4A 1QY4A 3OSDA 2JDYA 2RM21 1MS4A 3CZUA 4CP1A 5I0SA 3WHUA 2HEYF 5I91A 4LBLA 4GH4C 2V5YA 2QQUA 1LOBA 2VGDA 1RUG1 4HFSA 4AOCA 3ES1A 2PHUA 5L73A 5FZGA 5GLUA 2O1QA 2AC1A 2E7TA 1NCRC 1H6XA 5C8CC 2VO5A 4ZS3A 1RGSA 5FXVA 4PJYA 5FYYA 3H3LA 4IE5A 1JHNA 1F5JA 5EXOA 1RUD3 3H50A 4NAOA 2OVUA 2J1UA 1PVXA 1SLCA 4AGRA 1GSLA 3JD72 4YZ4A 3V0BB 1VAVA 2D98A 5HCFA 1HRI2 2ZPXA 3ZYFA 4XFHA 5FP3A 4AI2A 4QU2A 4FAGA 3VBFC 4V1PA 5E6HA 2D7FA 5A70A 2ADDA 5GZDA 4F8AA 3O1SA 1SLAA 3ZXFA 3POJA 1A34A 5AFEA 4QX1A 3QH7A 1W8TA 3QD6A 4OCTA 1N1VA 3F2ZA 1UU4A 3UGFA 1NQJA 1W6OA 2W94A 3JD73 4Y1VA 4DEQA 5IYYA 1TMF3 5IVJA 4FPYA 1YIFA 1VLNA 1YI7A 1BK1A 4QXCA 1W6OB 5BNOA 1L3JA 2PQQA 1N3OA 4BJ0A 3AP4A 4W65A 5FBZA 4XF9A 1OC1A 3ES4A 1S0BA 2VW1A 4AZZA 5JDBA 3TB0A 1UN1A 4QX5A 2WL1A 4QD2A 3V64A 3PU3A 4CCJA 4XDOA 3POGA 1MPXA 2VXRA 4LBOA 1ULCA 1LOEA 1SHWB 1NT0A 3WNKA 1I5ZA 3N9OA 4AEJA 3VD4A 4JGZB 3OBTA 3POIA 1JYCA 1SFPA 2UWAA 3O0WA 5CFCC 2V73A 4ZU5A 1VBE1 5IAXA 5F7UA 5DPNA 5F6LB 2R30A 2W1WA 1LKNA 2XWBB 2HYKA 1XE0A 1CX4A 2RR13 3UKTA 5IK4A 3USSA 4BISA 4TN7A 3RVHA 2BBAA 2L9LA 5C70A 5F3EA 1ONAA 4FTEA 5DDJ2 2ZHMA 4CTEA 1RUE3 4MG2A 5FXWA 1DYOA 5F8PA 5EHDA 5A6QA 1DGWA 2BTVC 1W0OA 3POEA 4LNVA 2E33A 3VDCA 2ILMA 2C6SA 1DLLA 1Q5OA 5ANNA 1UD1A 2NN8A 1VB4A 4ZXEA 5IHRA 4PDWC 4JC1A 4V2WA 1O4TA 4NR1A 2J1SA 3MLKA 3NAPB 1HN0A 2GP3A 2ZABA 4Q4W3 1IS3A 2VNVA 3RYPA 5A33A 2E7AA 3K51A 3PLQA 1RHI1 4HK9A 2IC1A 4IEZA 2RS53 3J4UH 2JKBA 1YRZA 2WR9A 4NHYA 4QDQA 3K2OA 3WHTA 3TN93 4HANA 4XFAA 4LBQB 4XMIA 1GWKA 1ND3C 1YQ8A 2B7YA 3GJBA 3P5BA 3KV4A 4QKDA 1UIKA 5FKBA 3BTYA 2JG9A 3V65A 1HX6A 4FPGA 1LESA 2DCJA 3M1HA 4XBLA 4JDMA 3RI8A 2ZHLA 4YW4A 2ZMNA 1YI9A 3NV2A 4XUNA 4EZHA 3ZR6A 2R7EB 5CYYA 5IVVA 4HZFA 4M3CE 3ITQA 1PK6A 1RXFA 4R9DA 4DINB 3FLPA 4MSVA 1VBE2 1ZBA1 2X5IB 1QJU1 3PTYA 5IAVA 1LOFA 4IUGA 4BQ5A 3GBGA 5KXDA 4JKMA 3WP3A 2ORXA 2C9KA 2WINB 4LA3A 3JD71 2D40A 5FFOC 3J8F3 1TMF1 3CJIA 4KWUA 4L8QA 4TWTA 5FQ0B 2D6PA 5LA1A 5D8AC 3KCXA 3VB9A 2NYYA 4BLIA 3OCPA 1OF4A 2W2IA 1W0NA 2WO7A 4I02A 3HD8B 2XJVA 3LOBA 1G7YA 3LIGA 3I2IA 4XUQA 5LK7B 3OPWA 4AGVA 3A7QA 2KM2A 4BQXA 4WM8B 4OUSA 3UKVA 4MZUA 4XFBA 3LCPA 3AMMA 3ZO0B 4ZKTB 3H7YA 4UFLA 2VOWA 2DCTA 2EALA 2YC0A 4IEVA 2VQTA 2ZGNA 3RMXA 2ZGQA 3PHMA 5CVRA 4D69A 1IOAA 3V56A 2P34A 5A3MA 3ZYPA 5GLVA 3TBDA 3F95A 3AC0A 4QM9A 2WC2A 2W95A 4YG3A 3J26N 5A3UA 1S2EA 2RDSA 2X09A 1YQ2A 3VZJA 1MS0A 4MYEA 4QT6A 2PFWA 2X5IC 3I3QA 1AR62 3AP7A 2X29A 1V6LA 2Z2SB 4K1YA 2VMHA 5ANQA 3N9PA 5FY4A 3FN9A 4YW7A 1J3RA 4IV1C 1DQ0A 1ULEA 4YM0A 4XHBA 5C8WA 2WNVC 3EB7A 5F39A 4IEQA 1QKQA 2WLQA 4Y1XA 3ZFEA 3QLQA 2ARAA 3PUAA 3ZFGC 4QXKA 3HBKA 2I2SA 2VOKA 3MICA 3P3NA 4KBBA 3SKVA 1CGPA 1BQPA 4GWMA 4N43B 4YARA 1PO22 2IXJA 4WM8C 5C4WA 4BXSV 4AI3A 2D44A 3OPTA 2ETEA 1UF2C 1DFQA 2P3KA 3R0RA 4B29A 5FMOS 1ZZCA 1X36A 1ZZ6A 4JQTA 2XVKA 1C4RA 1LR5A 2VBBA 4YYOA 4K9SA 2JD9A 4IEWA 4MGQA 2BYVE 1Y4WA 3GNEA 2RS52 4LORA 4AEDC 5FO9B 2MEV3 4WVWA 2CNAA 4H55A 4LUKA 3AL5A 4XIKA 4FTBA 1LOCA 1WD4A 3LA2A 1PGSA 1KJLA 1FAYA 3H8OA 4D7YA 3M3EA 4I01A 5FV3A 4AI9A 4BZ4A 1OMIA 4E8CA 4LPLA 4NIAA 4AW7A 2PAKA 2WABA 3H3UA 1XE8A 2E63A 3LGRA 4PT6A 2O0OA 1W9SA 1W6PA 2VUCA 1XYNA 3MF9A 1OD5A 1JYVA 1FT9A 1W9TA 1V6NA 3ZPOA 5J3UA 2BERA 1W6QA 4XF1A 3VBOB 4URTA 2RR12 3M70A 3AKPA 2JE7A 3B69A 3P1IA 4AFBA 1GZTA 4GB32 1FNZA 1LENA 2DTYA 4DIQA 4Y26A 1I5PA 2ZKLA 3WNXA 1ZRFA 5L7OA 5SV5A 1NCQB 1YQCA 1ND3B 2KD7A 1QOSA 5F2WA 2D3PA 1SDWA 2RJLA 4R8HA 1UX6A 5JZGA 4EROA 5JOXA 5FDBA 2Z69A 2DVGA 3D6EA 1V6MA 5FY9A 2HWF1 2WUHA 3O5SA 4PLOA 1ND3A 4XQDA 4BMBA 1S4CA 3WQ0A 4FCAA 4ORFA 4ET7A 2WN3A 1Q8VA 3IDBB 1Q8PA 2CV6A 1DQ4A 1GQGA 5DAVA 2DU1A 3RSJA 4WZCA 1JU3A 5CFCB 3ROUA 3LQCA 4QDSA 1JZ3A 3SXWA 3ZN5A 1RVF2 3KHCA 2ZXQA 2VBPA 4ZU7A 2H6BA 3U4XA 4M0HA 3WDVA 1H8TB 2JDZA 1NY72 3VBRC 1KQRA 1WCKA 2BWAA 3B94A 2VNGA 1CPNA 3LA3A 1Z0HA 4UW6A 3OYWB 2CSGA 4ASLA 4JHZA 5IJRA 2R32A 3BOWA 2Y26A 2YYOA 4R9BA 5AC93 3ELNA 4CCDA 3CZJA 4BU2A 3OYWA 5FXXA 1Y9GA 1IGOA 2ZEXA 4MGKE 1AF9A 1ENRA 4ZU4A 5C9AC 1JBCA 4FQZA 3I8TA 2CGPA 1DU3D 1U5YA 2WKKA 3LDKA 3BCWA 4BMEA 2G9ZA 3OUJA 3SHRA 2VMCA 1IS5A 1B35B 1GZCA 5L9RA 1HRI3 3UV9A 5I8YA 5IVBA 1PMJX 3K4ZA 3N7JA 2RMU1 4D8MA 4XFFA 2ZGUA 3H7JA 4GB31 2EXKA 1H1MA 2PTMA 2QBXA 4M01A 2RV9A 1ZBA2 3VKOA 1NE6A 2H0BA 4W6WA 4LBQD 3TOJA 1PVC3 5HBAA 1ALYA 5IK8A 2MEV1 4LUMA 1ENQA 4GIQA 3MUZ1 2UWBA 4ZONA 5BV6A 3G6JB 1SLIA 1V70A 3I3DA 1ENXA 4NRMA 4Q0QA 5T5LA 3C2UA 4BDVB 3MW4A 1C3HA 3OB8A 5GZEA 4XURA 1HXS3 5FZ6A 3T0DA 1LHNA 1DZRA 4WM7A 4BQ3A 4EN0A 1RIRA 2DURA 3R4SA 5BYNA 1EAH2 3J9SA 3GYDA 4LO4B 4I09A 4A7ZA 1DGRA 1CZVA 1DQ6A 5JIAA 4WM7B 3WINE 3ZXAC 5BNQA 2WWUA 3ABZA 3FUQA 3OBAA 5DG2A 5FKCA 4CCMA 2J1AA 1YLLA 1RVF3 3UJOA 1BVP1 1FV2A 5CFCA 5IFPA 3T2TA 3AKSA 3ZFFB 3ZYJB 5ABJB 5CKMA 5I0TA 2D6LX 4MADA 1J58A 2IXKA 1WGPA 4J1XA 3H1YA 1ZRDA 4KGGA 2YXSA 2VY0A 4RFT0 5CU1A 5T52A 2DVAA 4A2UA 1PMHX 3O14A 5C3OA 1DG6A 3TEWA 3RZHA 2QJVA 5LBFA 1UY0A 2JKXA 2VJXA 5JVVA 2V72A 2WNOA 2VUDA 3HN1A 4AAXA 1WA4A 4HONA 3HNBM 4G9SB 3WQ7A 5CNAA 5FPXA 5M0TA 4MGTA 1T6BX 2B46X 1RYYA 3JCIA 3ECQA 4RS5A 3VKLA 3MUY1 1PGL1 2A1XA 4QU1A 4HN1A 1ZA7A 1D4M3 3J7LA 1NYWA 2VZVA 3JUUA 1JZ8A 2R16A 3S57A 4YFWA 4N7UA 3UGHA 2VU9A 4GKXA 5KXEA 5IUQA 1H2NA 1KEXA 2VMDA 4YG0A 4ASMB 1R092 2JEMA 2CWSA 3CKHA 2GH2A 4K3UA 1W05A 2ARXA 1ZRRA 4Q0SA 5A7NA 1DBNA 4XIOA 3IM0A 4PDWB 3ENRA 4BH9A 2VH9A 3ZYIB 4S2DA 3SNMA 3RJ2X 3WD5A 1JW6A 1NLQA 4HXCA 4PDWA 1IQDC 2VCMA 3T1MA 4NWWA 5LWBA 5F5IA 3UETA 2YB7A 1D4VB 1REFA 4CDQA 1GV9A 4FOWA 3TEYA 4YW3A 3U75A 1MQTC 3FL7A 4GB33 1AL23 4IEOA 3LZZA 4P02B 5BNNB 5FJHA 4I0AA 2HBUA 2VW0A 4KWJA 4Y5Z0 5KHHA 5T5OA 1VE0A 1VBB1 2GNMA 3POYA 4LT5A 2Q0AA 4GWIA 2DCKA 3JBG3 4OHVA 3MHZA 5C3QA 2XJTA 3B01A 5T3NA 5F3IA 3I49A 2VG9A 4BPZA 3U10A 4D6SA 1JZ7A 2Y8KA 5H9SA 3WNPA 2RR11 4OULA 1WBFA 4LO8A 1QH7A 4NHXA 2QNKA 2C0ZA 3MF6A 3IAPA 3WF2A 5GZGA 3FE5A 4QPIC 2P6CA 2JDMA 2VC9A 1GMMA 1SCSA 5FAXA 3N9MA 5DUUA 5F5QA 3OGRA 2A5ZA 3RZZA 2WFF2 5FP8A 1HQNA 1LTEA 1WD3A 5GALA 4C0HA 3IAQA 1AXYA 2WNUA 1W9YA 4A6OA 1AR71 2VW2A 3AK0A 2WDBA 2ZHNA 3GCXA 3IWZA 2Y38A 4YGCA 1OF3A 5FZ0A 4FFGA 3Q8BA 3ZN6A 4QDRA 3LEIA 2E26A 4Q29A 4FQ4A 1ZBE1 4LBMA 3ME2A 2RS11 4LITA 4RN5A 4YGBA 2AACA 2IVIB 5B4NA 4AAPA 1BLZA 4HPKA 4P9IA 4AFDA 5I0DA 1RMU3 4GA9A 1UZ0A 2WSUA 2XQRA 1LOGA 1S0CA 1OD3A 5IATA 3OBRA 4C1XA 2PHRA 2WYSA 3LDRA 5CKNA 1K5MA 3RZGA 3S30A 1LRHA 4AK3A 2EIDA 2XLFA 2JDHA 3KS7A 4YZ5A 4UT5A 2QQMA 2R071 3FZ3A 5FREA 1H2LA 4GMP3 4DUVA 1UYXA 5I0UA 3ZN4A 5GKAC 2VUJA 4HBNA 3ZXEA 1BCXA 4AI8A 2HKXA 1VBC2 1AYN3 3ON7A 3PVOA 3OD0A 3MGUA 4IETA 3T0BA 3IMMA 4Q4Y1 3ZYBA 3B9CA 4DEVA 2FCTA 3WQBA 5CBLA 3S7EA 2HWC3 2BWCA 2QQOA 2YFUA 1MVEA 1WCUA 3TNQA 4IQPA 1AL22 2WZR3 5HXMA 3GZTB 5K9YA 2ZGOA 2ZMKA 2HWE1 5FJKA 1UKGA 2D6KA 4CU9A 1X50A 2WSVA 3ACHA 2FHRA 2WNVB 4YGDA 2A6WA 3WNNA 4YW5A 5A3TA 2LUWA 4IEXA 3ZFEC 3MV11 2WNVA 4Y4RA 1D2SA 2ZX4A 1UMHA 4N43C 5LBCA 2Q5TA 1ENSA 4HL0A 4LMFA 2A70A 4S2HA 1W6MB 4AXOA 1EUUA 2OPKA 2PMWB 1XNBA 1G9DA 1RJ8A 1YO8A 3KT1A 4BQWA 5FMDA 2A6ZA 3V0AB 1NCQC 1AX0A 1CAXA 2XVLA 2A73B 3VLBB 2XBO1 1SCRA 5IW0A 1VBB3 2VTFA 4AEDB 1HB1A 1IQAA 4LR4A 1Q8QA 4OUEA 2VNRA 1ODMA 2NM1A 2XG3A 1GNYA 2BGOA 1XYOA 3WP4A 4ONUA 5CAZA 4MLOA 2V5DA 1H4HA 2RHPA 4AEDA 1POV1 3S6PA 2HJIA 4Q4V2 2XXZA 1OA2A 3LD8A 3L2YA 4ARYA 3RMYA 1R081 2QQKA 1W8FA 1J59A 1OKQA 4XCAA 4UF0B 5I8TA 5BXXA 5L7OC 1GLHA 1G9BA 3KT4A 3A4UA 1Y9MA 3I3BA 3POFA 5ACA1 4P9YA 4K21A 4YM1A 4BQ2A 4O7XA 1JOBA 1TNRA 3T1LA 5A6ZA 2WIIB 3TNPB 2EICA 1ODNA 1GQHA 4AYUA 3D5OA 2DVDA 3CJXA 2LW8A 3CQOA 4QPIA 1NCQA 2TBVA 3PL0A 1EV11 4DXZA 1UMIA 5FO8B 2G19A 2PHXA 3O1MA 3GBFA 2DCYA 2D97A 3UESA 1J1TA 2HYXA 3BTAA 2B9VA 3EQEA 3MW3A 3X29B 4B8EA 1YWKA 5B4XA 2XHKA 2ZS6B 1QJY3 1W03A 3GXUA 4Q4W2 4QAWA 1HXS2 1RUF2 3LIHA 3WP6A 3RZJA 4E9KA 4JGYA 1SFNA 3VBUB 3UK9A 2VECA 4P14A 3O1VA 1H1IA 3BVCA 4PLNA 1NXMA 5A1LA 5B2GB 1R091 2OXBA 3GCWA 4IV1A 1UZZA 5F6KA 2VZPA 3VN4A 1JS9A 3Q8FA 4I30A 1H1AA 3PU8A 5KWRA 2VMFA 3AYCA 1PVC2 3AZXA 4FBFA 3AXDA 3VBRB 4CP9A 2C24A 1PO23 2XJSA 3IPVB 3POWA 2C5DA 4AQTA 5A1AA 3MIGA 4TXWA 2WZR1 2EA7A 1OQ1A 4IV3B 2YBSA 2ZHKA 1R64A 4YVWA 3IPVA 5EPAA 1DQ2A 3VBRA 4CP9B 1IKQA 1FNYA 3AZZA 4OHXA 1H2MA 2Y0IA 1LODA 1OPMA 2WLPA 2ZJCA 4FTSA 1H8VA 5CG9A 3KF5A 3RWKX 4D0QA 3IBMA 5JI7A 4MVTA 1E57A 3USUA 4HLTA 2R042 1F4HA 4XJ9A 5FZFA 4E2SA 1CJDA 1GOFA 1J3QA 4P5HA 4X8NA 2XJRA 1EY2A 3DXTA 4AHWA 3C7FA 1KGYA 3AFKA 2XLGA 4N9HA 3USUB 1HQWA 5J48A 2FZ2A 5LW9A 3VBHA 4OZXA 2VQAA 2R062 1CZTA 1SBEA 4YW6A 3WLUA 1ST8A 5JOWA 5EJZB 2BPA2 3RWNA 1T2XA 1BBT1 2PHWA 2VOXA 2Z5WA 4FI9A 1EV12 1JOJA 4A3ZA 1SBDA 2RS32 4GJYA 4QPGB 5A7QA 4GXLA 4ARXA 2ZBJA 3H8RA 1TE1B 3BN6A 2B5HA 5J98B 5F37A 4PIXA 2YUEA 2D5HA 1S0DA 4LIVA 1ZZ9A 5JXHA 2VZSA 5IT6A 1LHUA 2W08A 3JB8A 3NJZA 1HLCA 1M06G 4J1WA 2UY9A 2VPVA 3ILFA 3VHOA 4FPJA 2B9UA 1JMUB 1STMA 2YC4A 4ES9A 4YZ2A 3FLTA 3QH6A 5FOBB 4PI0A 3WQ1A 5JR7B 1LHOA 1NQDA 1LCLA 2Z79A 3O1UA 3ZFFC 4AVSA 1OOPC 1EV13 4AL9A 4MHUA 4Y3OA 4IGPA 1DGRN 5J37A 1HDKA 5EQUA 2NQYA 4MX3A 3ZSMA 4FOQA 2MNGA 1S0EA 1KDMA 2CY6A 1JZ6A 4CDXA 1XRUA 3JB4C 3BI3A 3LF7A 3ACGA 3MLJA 1QJX1 1UZYA 3GZUC 4TYSA 3VDDC 3WW3A 2HWE2 2EVXA 2TNFA 4NHLA 4Z2WA 1VPHA 4EN9B 3K75B 4FXGB 2DBNA 2FQPA 4Y4YA 4P9LA 5DMYA 5HCHA 3O7OA 1BYHA 3BGAA 5C6CA 1BBT2 3FX3A 4QPWA 4XQWA 5JXGA 4U2AA 3DYPA 2PXJA 4ISQA 1HXS1 4NO4A 2LS6A 4Z82A 4O61A 1J84A 4NJ4A 4M3CB 4KG0A 1H9PA 4WBBA 2ZX0A 4PQ9A 2FZ1A 2ZACA 4K40A 2XL9A 3BTXA 4ZPIA 1DF0A 4CDWB 1OOPB 3HQXA 1WCQA 2DFCA 1RUE2 3MPBA 2ZX1A 1SPPA 3NAPA 3S5QA 5DDJ3 1ULPA 1W90A 4Y33A 4D3WA 1LGNA 5A33B 2O8OA 1PNGA 4A41A 3MFAA 2CAVA 1SPPB 1UY3A 5JZGB 3WG3A 2WZR2 5FY8A 4GAZA 3HNMA 4H14A 3IMNA 5A32A 5L36A 5A3PA 3K3NA 4LBQA 2E9QA 1BBT3 2D6NA 1QDOA 1RUNA 3MIBA 5LASA 4PF5A 1ZA4A 3H9AA 3VDDB 2HWB2 1GYKA 4WV8A 1MS8A 4EN7B 4X6RB 2CDPA 3AKRA 3WSOA 2W46A 3ZSEA 1QJZA 3W59A 1A8DA 2I07B 3C7OA 1XYPA 3A22A 3GGLA 3VBOC 5FMCA 3HWJA 1FMD3 4TTGA 3WG1A 2R6QA 3ST7A 3AXEA 1CR7A 3A23A 2UU8A 3B93A 1UZVA 3KQRA 1D7PM 1VBD3 3LKJA 4PBOA 3RNSA 2QCSB 1N3QA 4Q4W1 1RUF1 1YHFA 4XDPA 4JRLA 1VP6A 4D6QA 5K8SA 2VL4A 1MS9A 2FCUA 3PUHA 1I3HA 1V00A 1BEV2 1OI6A 3TN91 4QMAA 1VJ2A 2IFWA 4QQPA 1YC61 1UU6A 3K46A 2Z4FA 1H0BA 4WM8A 5C4WC 5JMOA 1O4YA 4GZ9A 4YVSB 2QQLA 1HIXA 3GHMA 2GMMA 4AFCA 1ND2B 5C3RA 2WYFA 5F3CA 1NOVA 2W5FA 4OYUA 1YQ5A 1E5SA 3NNGA 4JHTA 4W4ZA 4YVSA 4CDUB 3WXPA 2XUMA 5FOJB 4NAMA 3GBWA 3QOPA 1CAVA 5A80A 2XKOA 2EIEA 3WCSA 2ENRA 2V4VA 1AX2A 3T2PA 4CPBD 1FMD2 2PN5A 3I2FA 5F5AA 2JB8A 4JTOA 1CAVB 4FFHA 4ZZ8A 4XQ4A 1FPN1 4XACA 4E4HA 5JOZA 4EWEA 2HWD3 2YY1A 4LKEA 1JZ2A 3NNMA 4BA6A 4CEWC 5EYXA 5LBBA 4AE2A 3AB0A 2R041 2FCVA 2R063 4BK5A 4Z92B 1VBB2 2YZ4A 1WZXA 1YIPA 1PX3A 2GU9A 1D0GA 1C5HA 3ZFGA 1XJAA 4P00B 4FPEA 1OQEA 4KWKA 4LHLA 4QQLA 4LQRA 4NN0A 5FLIA 2ZGSA 3ZFEB 4H7LA 1VMHA 3FC0A 5ABJC 5KC6A 2H0VA 3MV01 1LNSA 1HV0A 1KFUL 4ISRA 5DDJ1 5E16A 4XBNA 5LY2A 3ZDVA 5C8CB 1W28A 2R49A 3WOGA 1ND2C 1QQP1 2GC0A 5J09A 1I6XA 4WVMB 2JX9A 3H0OA 1OLME 2WQZC 1XXNA 1YJLA 1ZZ8A 4LXLA 5FPZA 2GNDA 1CAWB 1D4M2 1PIV2 4R4XA 4XCBA 4JGYC 4Z8BA 5HV0A 4Q0VA 5BNPA 1SEFA 1FX5A 3HAGA 5EYYA 5HCAA 1VBA2 3MI8A 4QX3A 4Y22A 1ZNPA 1US2A 4Q0UA 4QQHA 3DPRC 5FZOA 2IXHA 1HW5A 3IDAA 3WV6A 4XMAA 2A6XA 5BNPB 2GAUA 3WDXA 1QEXA 4QB2A 1RC6A 1YEWA 3DL3A 4HVRA 4XXAA 4E8DA 1YXWA 4AEKA 2HWC1 4L97A 2B39A 2YMZA 5DAQA 2WFPA 3LFIA 3T4VA 2BBVA 4L9BA 2ZGLA 3N9LA 1FOD2 4W6YA 1BHGA 3OGVA 1FMD1 1UQXA 5LA9A 1NA1A 3BTZA 2CU5A 4Q26A 3N9QA 2WAAA 3B5LB 2XMLA 4V2VA 2RVAA 2YHJA 4NPRA 5KC5A 1W6PB 4NE9A 1VBD1 1Z7S2 3ZXLA 4BXFA 2V4AA 1F5FA 4A42A 1RUC3 1IPKA 3ACIA 1W3XA 3THCA 4BQ1A 2OPWA 5C9AA 5J1XA 1G9AA 1JUIA 1O3RA 2W92A 1QJX2 2GDFA 1H9WA 1UXXX 1K5JA 3ZSJA 3QBQA 3RYKA 5JXJA 5DG1A 5FYBA 2GP5A 3D8CA 4AFAA 1UX7A 4LLOA 1TMF2 2PQSA 4KG8A 5J7MA 3H8XA 2YBKA 3FWEA 1REEA 1N3PA 5FPBA 3E6BA 4F83A 1KDKA 4JGYB 5KHIA 3MPPG 3SQOA 2ZZQA 2FDHA 1ASJ2 5IK7A 3ASIA 5FP7A 2ZX3A 5E89A 2JIGA 3PDQA 1HJFA 2D93A 3NQHA 4RSUA 1UMZA 1VMFA 1DDLA 4L0PA 4XJWA 5AC92 5T55A 1RUH3 3GJAA 2GN3A 5TSWA 1KD7A 4IESA 2Q30A 3AMQA 4CXYA 2ZGRA 4UOJA 4CA9A 3VZLA 5LEKA 4UFHA 3I2HA 4L92A 1V9U2 3IIIA 3VBFA 2JD4A 5C7GA 2WA3A 2VD7A 1ZREA 2Y60A 4M3CF 3SH4A 2XUEA 1F15A 2DYCA 4YSFA 4ES8A 2VE1A 1DZQA 4RGKA 3VKMA 3BYWA 1C28A 2RS33 2GC2A 2VZ1A 3I2GA 4M4RA 5F9TA 4K20A 2OQ7A 5JAXA 3MO4A 4LTAA 1WLCA 4COZA 1CVNA 2RM22 1A6CA 1W0PA 3VGIA 5JSRA 4AVTA 1CQ9A 1X8EA 3DV8A 1FPN2 4YG6A 1BKZA 4XEZA 1PNFA 2ORZA 2WQ4A 4UBGA 4INDA 1KS4A 4DXTA 2WBKA 5GZCA 2A6YA 2BRTA 1E5RA 3H8UA 3ILRA 4TLFA 4Y5TA 3VBHB 3M3OA 4XYXA 1CWPA 4OHYA 3LEGA 4WZFA 1QJU2 5F1RA 4S2FA 3PUQA 3VZKA 3LSEA 4LO5B 2RDNA 4YW2A 3HIFA 1TG7A 5FPAA 1S55A 1R093 3EYPA 4UXAA 4FPKA 1HV1A 4CCCA 3V0BA 1MEC1 2N7GA 1Z7S3 4OZOA 3ZYHA 5I0RA 2TEPA 4KNCA 2VQ0A 4HKWA 2G9FA 2CL2A 1J1LA 2WZEA 1C8M1 4XAEA 4M0NA 5C3PA 5AC91 1IG0A 3HNYM 4I3GA 3WF4A 2DWRA 1PM4A 2BEOA 4PCRA 2JE8A 5DAPA 2YG0A 3R4DB 4O65A 2OIIA 4KL1A 1PIV1 4DY5A 3H3ZA 2F4LA 3DECA 1UY4A 3OF1A 4UAPA 1UW8A 1CN1A 1VBA1 4AQ6A 3WW1A 4CP2A 4HG6B 4B7EA 1V6OA 4P9JA 2E32A 1U0AA 2VMEA 1Y43B 5E8AA 4QXBA 5FPVA 2Y64A 4XFCA 1LAJA 2OT7A 3KHBA 3HJRA 5G05L 5CISA 2HEVF 5FUIA 2BGCA 4NROA 3ZFFA 5H9QA 3WDTA 4HK8A 5FIXA 4FOVA 2LM3A 5ERLA 3T09A 4C91A 5J36A 3WVJA 3ZR5A 1GP5A 2NZ9A 3ATGA 1U5XA 4CDXB 5K0UC 3UNPA 3ZXKA 2I45A 1RUJ2 3ACFA 4QGNA 5BNPC 1JZ5A 4FPLA 5CEHA 4A4AA 3M2MA 1QNWA 1BJQA 1UCXA 4MGIE 1R1A1 1XSQA 4JGZA 1IG3A 1QGLA 1W2UA 4I2OA 4CEWA 3WF3A 1DYKA 1RMU2 3FLRA 1X9PA 4LEJA 4GALA 4QX0A 3TRSB 3C3VA 3I3EA 2HWB3 2WQ8A 4FFIA 4Y20A 1O4ZA 3JXSA 4FPFA 4QXHA 4W6XA 4QX7A 3WW2A 4NWVA 1ASJ1 1QXRA 2RS31 4HVQA 3AZWA 1TZOA 1OA3A 3MFCA 3D4KA 3HN3A 1C8M2 2QQNA 2XLAA 1RHI3 1JUHA 3KGZA 4P5YA 2RS51 3MYXA 1US3A 5AVPA 1PZ9A 2VCCA 3FUOA 4XFIA 4RHV2 2FDFA 5FY7A 1DP0A 2TUNA 2J1EA 4J6GA 2FD8A 2YFZA 1DZTA 4KMQA 2ZEWA 4X8PA 4KU8A 2YU2A 3DGTA 1RHI2 3T0AA 3OUHA 4XZPA 4Y1UA 4UW3A 4QX8A 3PVEA 1S2KA 2VXJA 1LHWA 2XL7A 4Q27A 1IZ3A 4QQ2A 1RINA 3ZM8A 2NP0A 5GLTA 1AUYA 4W8JA 5BNNA 4FSJA 3VDDA 4B4QA 4HKOA 3RYRA 3H1WA 3WG2A 3AM2A 5FZCA 3WG4A 4ZZ5A 4LBNA 1VBD2 1Z7S1 3CHXA 4J25A 4CDUC 4EWAA 5FMOL 1PX4A 3WR0A 4QQOA 4RGGA 1W39A 5E88A 2IZWA 2Q8OA 4BQYA 2DUQA 4XFGA 4QKFA 1RUI2 1R1A2 1UYZA 2A71A 3VV1A 1RUC2 1APNA 1W8HA 1W8NA 1GQPA 1WCSA 3C7HA 3I4IA 4NVPA 4QKBA 1XNCA 2P3JA 2ZZJA 4IE4A 1COV3 4XABA 2KR2A 3ACLA 5FR3A 3BPZA 4GQ7A 1RJ7A 4WM7C 4B1LA 1Q43A 2W3JA 4CRQA 4JTNA 1MEC2 1OH3A 4XJUA 4XZUG 3T2QA 4FAHA 1F2NA 3DKWA 4YVWC 4Q2FA 1NX9A 1S0JA 4CCKA 4I0BA 1PO12 3NJYA 4HVOA 2BNNA 4DFSA 1ND2A 2GH8A 1NY71 1W8UA 2BU9A 2X8KA 3INAA 2BFUL 3OOXA 5DQ0A 4ATEA 3HMYA 4A3XA 3PJYA 4RHV1 4CDUA 4EYUA 3FBYA 2IWGB 5EIYB 3W5NA 1FI2A 1XU1A 2QE3A 1H8TC 2YC2A 3ZOIA 4Z07A 2VMGA 1WW4A 4MGSA 1QOOA 3NSTA 4AVBA 3RG0A 3E5XA 2AEYA 3IT8A 4AFMA 1W9FA 1W3VA 4LE3A 3ALQA 4N8MA 2OZ6A 5CFDA 5KR7A 1PZ7A 4Q8KA 3DXUA 4Q4X1 3AJZA 3RZKA 3N7MA 2YGLA 3AYEA 1GU3A 4IXLA 5FZKA 3NNFA 5JSOA 3HBZA 4L2NA 4ZY9A 3O0XA 4XF0A 4OLLA 1IPSA 1U12A 1X33A 2JG8C 3SCFA 2BJSA 4PF1A 3ZXJA 1V6IA 1RMU1 5HXVA 1JYWA 2FMYA 3KT7A 2ES3A 4AQ2A 3AFGA 5LK5A 1YFXA 3FHAA 2E53A 1HN1A 4P9XA 2FDGA 4LBJA 2W52A 3VHPA 1DIWA 5GM0A 4IGQA 1BVVA 4WVMA 3SH5A 3WNOA 5C5UA 3O1OA 2VULA 1WW5A 1JHJA 2ET7A 3P6BA 5C4WB 2XHNA 1CAWA 5I93A 1V0AA 2NMNA 4URAA 2BOIA 4DUWA 1O7FA 2WN2A 2JDKA 1ZRIA 1AYN1 1PO11 3PTRB 5CKQA 2KXLA 5JI9A 4Y22B 4Q4Y3 1XNKA 3VZOA 1AVBA 2WT0A 4KQ7A 3WCRA 2A3WA 2C26A 2XJUA 2VOTA 3ZSLA 1UOGA 1J3PA 4SBVA 1N1YA 2HWD1 2VM9A 4QKNA 4CU6A 2IXCA 1HKDA 4MUVA 1QWRA 3A0NA 3DPRA 1ZVFA 5I8SA 2HWE3 4GWJA 3VHRA 2FDKA 1UL9A 1BZWA 2XJPA 3B9IA 1U5ZA 3SC7X 1QJY2 4N53B 1F31A 3M3CA 4OI4A 1JODA 4BYYA 3VBHC 2ZOEB 4U36A 2Y33A 4JX0A 3FFQA 4EWDA 3RZLA 4N53A 4LA2A 1AR92 5G04L 4D6RA 5JSPA 4XOGA 1H4GA 2J1RA 3CL1A 3RI9A 2EAAA 2P1BA 3W5MA 3EBRA 3ZIXA 1QQP3 3WDYA 3ZSKA 1IHMA 4BB3A 4GD4A 1YNAA 1X9TA 2F4PA 1FXZA 3E5UA 2D3SA 3CF6E 1AYM1 5A7PA 1F8VA 4JGZC 2PLV1 1RUI3 1S0GA 4QGLA 4MV2A 2IXLA 2PELA 1GWMA 1POV3 2AGSA 2Q1FA 3A21A 4XF3A 1CESA 1W6NA 2LRPA 1G9CA 2W39A 5A7WA 5IVYA 4QPYA 1JI6A 1R083 3I59B 4F7ZA 5IVCA 2WZ8A 3VKNA 5JUVA 1TEIA 5KHJA 1W6NB 2ZEZA 5FZ1A 4RR3C 5EJ3A 4YNIA 4UFJA 5CIRA 1QXJA 5A7WB 1O6UA 5FYCA 3I59A 4LHKA 1A78A 3KSCA 4OHZA 1W04A 4UYBA 4MH0E 1H8TA 1L7QA 1SLLA 3I2OA 3KCYA 4LIUA 4M00A 4GH4B 1HRV1 1MQTA 3E97A 4DNYA 1JYXA 5FYMA 2GSYA 2VCAA 3Q8AA 1H2KA 1V9U3 4K6BA 4CUCA 3ZIWA 4BE3A 1WBLA 3N9NA 4EJRA 3HVDA 1MQTB 2BP6A 2C4XA 3WZ1A 2ZAAA 3MIDA 4E27A 4MXWB 1QJY1 3VZNA 2WA4A 1UYYA 3WNMA 3LE0A 5FZDA 3LPGA 2W9XA 1PK6B 1DCSA 3P3PA 3FMGA 4XJAA 4MXWA 1AHSA 3J7MA 4XF4A 5FY5A 3QCWA 1POQA 2WFF1 4LOTA 3AMPA 4MOAA 2JDNA 5A3LA 5FY1A 4E4ZA 2IVJA 2VVEA 1PO13 3CJIB 5FQ0A 4CEYC 1UPIA 4RFRB 3DEMA 4HN0A 5CADA 5J96B 3MLLA 4QPGA 4Z1VA 4OI1A 3ZDSA 2YROA 3E6DA 2V09A 5CG8A 5F2SA 1PO21 3H42B 3VL9A 1ZBE2 1ZBA3 3I54A 2RS12 3NKTA 4R52A 1O8PA 3MIHA 4QM8A 1D0HA 4R9CA 2Q8EA 1RUJ3 1PMIA 2B42B 4BCUA 2P17A 2PA7A 1SBFA 2XBO2 5FLJA 5D8AA 5C3SA 1QNYA 2WWSA 2ZA9A 3L9JT 3IDEA 3MIFA 1F4AA 5A3WA 1RVF1 1VAMA 3RPQA 4LO6B 5D8AB 1LU2A 2R072 4XPVA 5CB7A 5BNOC 3APBA 4DRVA 4AVVA 4YM3A 4UFKA 3FHQA 2A3YA 1PGW1 4UW5A 1VBC1 3VD9A 2QQPA 4WVZA 2QVSB 3K48A 2GALA 2IFRA 3AKQA 4Q4Y2 2OQ6A 1IS6A 2ID4A 1UOFA 1NLSA 2C1FA 4ITCA 3RS6A 2DVFA 1CONA 1UXZA 4IEUA 3SCHA 3VL8A 5ABJA 3PIGA 1MACA 2VZUA 1AYM3 3DYOA 4IEPA 1YUDA 4LLFA 3POBA 4XC9A 4B3NA 4QHZA 2ZTNA 2QQIA 1G6NA 1SG3A 4QB1A 4L99A 4AVCA 1AR61 2OYZA 1JTZX 2E6VA 1QIQA 2VZ3A 1AR91 3D3AA 2QDRA 2Z42A 2F17A 4OHWA 1H30A 1ULFA 3MEPA 1AZDA 1C8M3 4A7YA 1OH4A 1ZX5A 4FP3A 4YW1A 4N43A 3ZVXA 2HWF2 1SACA 4JKLA 3Q9OA 4A7KA 1LB2A 2MEV2 4RQPA 2PHLA 4XW3A 5AFBA 5C5TA 2Y6KA 3CDZB 5KHGA 4CVUA 5JPNB 2YDEA 1NUKA 4M3CA 4RQPB 4K7JA 4NMIA 1VBA3 4LHSA 3ZXGA 3PNAA 2QZ2A 4XUPA 5A6XA 2VTXJ 2X05A 3VD7A 4H3WA 1ZRCA 1LGCA 3NKGA 1SLTA 2XOMA 3R05A 4FP2A 3WF0A 2R0HA 5EFUA 2H6CA 4MHRA 1XNAA 3OEAA 3PVNA 1R082 1SQ4A 4RS5C 1E5IA 3JBG1 3U07A 1BMV1 2GMEA 5FK7A 2LROA 3OY8A 1WMDA 2NLRA 2WS93 4Q1PA 1K5MC 4OUMA 1RB8G 2VMIA 1EYBA 2I74A 1W6QB 1XNDA 3KWVA 4META 2J7MA 4XILA 3VBOA 3LDBA 3W21A 3JZVA 4O9EA 2LTNA 5F3GA 3BKZA 2DU0A 1FV3A 1QJFA 1W8ZA 2W1UA 2NPIA 4A45A 5GZFA 3OGGA 2RMU2 5LBEA 5DN2A 4YGEA 5DUXA 1RUJ1 5KXCA 3AMNA 1ASJ3 4E2GA 1QMJA 2DFBA 4CUBA 2JB4A 3N3HA 2BFUS 3AJYA 4UI9L 4CXWA 2J42A 5LATA 2RS13 4RQPC 4BK4A 4Y1ZA 1DLCA 3U14A 1AR72 1KXGA 2VOVA 1CIWA 1LGBA 3GM8A 2RJ2A 4E2QA 1JOPA 2WT1A 4EV0A 1IKPA 2DCZA 2HEWF 2ARBA 2AREA 1RUD1 3LAGA 4FFFA 3VBUC 4G3YC 5DZFA 1AJKA 3CBNA 3CIHA 3H1MA 4JRAA 5LEJA 2CYFA 3SH3A 1L7RA 2OKXA 2AH2A 5C71A 2JJ6A 2VQUA 1O8SA 3LFMA 4CSWA 1W8OA 5JIUA 3O1PA 2VZTA 3VD3A 2XVGA 1K5MB 1MZ6A 5AVAA 4X6QB 5FRAA 3I97A 5DUVA 3VZMA 3ZYGA 4COWA 1O3TA 5FPLA 2GC1A 2W47A 2VCBA 4QX2A 3VHNA 1DQ5A 1QF3A 3N35A 2WT2A 1HRV2 2JWPA 5CFDB 1OXCA 1S0FA 2W87A 2WO1A 2DUOA 4C90A 4DZGA 1BMV2 2PHFA 3BIWE 2J22A 4FPOB 2X10A 1LHVA 3GALA 4IV3C 5LZ6A 1B35A 2ERFA 1DYPA 2GNBA 4K8FA 1GOGA 1C1LA 1X82A 2XONA 5H9PA 2EXIA 3WUCA 3U1XA 1CAUB 1OUXA 1COV1 3E5QA 1WLDA 2Y6JA 4NUBA 1KJRA 2VZOA 4RL7A 1XSRA 2P3YA 2QDNA 3VDBA 3AVRA 3SEEA 4HSLA 1CAUA 4CDWC 5L9VA 3KMHA 1YYNA 5BUVA 1WA6X 4LHNA 3PUSA 5EP9A 3DYMA 3NNLA 4O9GA 5FWEA 4EN8B 5IVEA 2AENA 3VBSB 4EN6B 3GZAA 4AI0A 3DN7A 4NRPA 1VR3A 4CCOA 2GC3A 3NL1A 4K8RB 5DABA 5IK5A 3VBSA 1XNTA 1O3QA 2EAKA 4YRDA 1LEMA 2XBO3 1VBE3 4YFZA 4HKLA 1LEDA 1GICA 3OG2A 4RHV3 1YFWA 5F32A 1UOBA 3WX5A 3N7KA 1EUTA 3AL6A 3NJXA 2VR4A 3KQ4B 1AXKA 1RUD2 2DF7A 4UFIA 1JU4A 2WS91 5FYTA 4OQ9A 4NRQA 2BV4A 5A7OA 5D2AA 2XDVA 5JWPA 4C0BA 1CPMA 3RGBA 3MZHA 3N36A 5FZOB 3DPRB 4GJZA 4P9WA 1C5IA 1NAEA 3WW4A 4BIFA 1GNZA 1XB9A 3DF0A 5ACA3 1PGW2 1UO9A 5BY5A 3LB9A 2UYBA 3AP5A 3AZYA 3FJSA 3KD4A 1NA1B 4JVAA 4XJ8A 5FXZA 1MR5A 2SBAA 2RE9A 4LK7A 2PAEA 2UYAA 4XE9A 4LKFA 3ZKYA 1LU1A 2ADEA 5JOYA 4CYDA 1C8NA 3VBSC 5HI0A 1UYPA 5K0UB 1MZFA 3W9AA 2UWCA 1Q8SA 5L9BA 4Q4X2 3MIEA 2BQPA 4RS5B 4B4RA 4EE2A 3O1TA 2WAOA 1JYNA 1SFYA 1GR3A 2JENA 2DUPA 3WP5A 4R9AA 1MS5A 2YPDA 2A75A 3OUIA 1OLMA 4PIZA 5DZGA 2CDOA 5SV8A 3L2HA 3NV4A 1URXA 4NIDA 4QHBA 4AVAA 2OA2A 2WO3A 1S0IA 2WNUC 1HB4A 3T2OA 4JAAA 5GJ6A 5HCBA 2QQWA 4CU7A 1WMFA 2JXAA 2Q1MA 3IN9A 4CUAA 1UIJA 1VAKA 3KV5A 4XAAA 4IV1B 1UY2A 2VVFA 2VVDA 5LY1A 3KZ4C 3AZVA 2JIJA 2BDRA 2AUYA 3UYJA 1KS5A 2G9GA 4PI2A 3THDA 4FPHA 1RUOA 2WO2A 3OEBA 4IGOA 5FUNA 4CDQB 5H9RA 5FTTC 5FZLA 4CUGA 1RXGA 4LO7A 4BQ4A 2G1MA 1QU0A 2Y34A 2FBEA 4C1WA 3HT2A 4GH4A 5JPMB 3NV1A 4GMP0 3I2JA 4YVWB 3JBG2 1B09A 2AYHA 3NMBA 2HWD2 3FBMA 4IDZA 4BWOA 4MGYE 4TZDA 1HQLA 1QOTA 5JXIA 1AL0G 1TME2
chains in the Genus database with same CATH topology
1OVPA 1OXCA 1W8HA 1OVSA 4CE8A 5A6ZA 1OURA 2JDYA 2BP6A 3DCQA 2VUCA 1OUXA 5A6XA 5A6YA 2BV4A 5HCHA 2VUDA 5D2AA 5A6QA 3ZDVA 5A70A 1UZVA 1OUSA 1UQXA 2JDUA 2BOIA 2BOJA 1GZTA 4AOCA 2JDMA 2JDHA 2JDKA 4UT5A 2WRAA 2XR4A 5A3OA 2JDPA 1W8FA 2JDNA 2VNVA 2CHHA 2WR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OVP A;  1OXC A;  1W8H A;  1OVS A;  4CE8 A;  5A6Z A;  1OUR A;  2JDY A;  2BP6 A;  3DCQ A;  2VUC A;  1OUX A;  5A6X A;  5A6Y A;  2BV4 A;  5HCH A;  2VUD A;  5D2A A;  5A6Q A;  3ZDV A;  5A70 A;  1UZV A;  1OUS A;  1UQX A;  2JDU A;  2BOI A;  2BOJ A;  1GZT A;  4AOC A;  2JDM A;  2JDH A;  2JDK A;  4UT5 A;  2WRA A;  2XR4 A;  5A3O A;  2JDP A;  1W8F A;  2JDN A;  2VNV A;  2CHH A;  2WR9 A; 
#chains in the Genus database with same CATH topology
 3D0S A;  3AYD A;  2WWJ A;  4YPJ A;  2FDJ A;  1AL2 1;  1O3S A;  2K2S A;  3EO6 A;  4NOT A;  5FP4 A;  5APA A;  3B02 A;  3PVB B;  4Q4V 3;  3HQU A;  1IS4 A;  3CMG A;  3SMH A;  3KCC A;  1FYU A;  3HPN A;  1JH5 A;  2ARC A;  2D3R A;  3AP9 A;  2FDI A;  3LWC A;  1HB2 A;  1MS3 A;  4DUX A;  4IE6 A;  5CFD C;  1GP4 A;  1RED A;  4Q0P A;  2WNU B;  5FY0 A;  5KBF A;  3BIE A;  1L7L A;  2AEZ A;  3FHI B;  5FPU A;  3WT3 A;  2A3X A;  2D6M A;  3SIT A;  4AHZ A;  4CEY A;  1FAT A;  2XPJ A;  2Q1Z B;  1S1A A;  3THT A;  4COV A;  4OVE A;  1RTV A;  1Q56 A;  3SIS A;  3VDA A;  1O91 A;  2OUJ A;  4NII A;  4CDQ C;  5JCT A;  2QKD A;  2XQX A;  3WY6 A;  3POS A;  4YZ3 A;  1VRH 1;  3U78 A;  1AR7 3;  3BU0 A;  2EXJ A;  1G86 A;  4LE4 A;  1AR8 1;  3S7I A;  3RDI A;  4DXR A;  2BW8 A;  1SLB A;  2QZ3 A;  3ZMN A;  1HRV 3;  1ZBE 3;  2EIG A;  3DUI A;  5DZE A;  3HQR A;  1DQ1 A;  5FZB A;  1CIY A;  2MPF A;  3OGS A;  3UGG A;  4YVS C;  1AX1 A;  1WW6 A;  2UUR A;  4RGA A;  1O59 A;  4DS0 A;  1FOD 1;  1NCR A;  4ZXK A;  1OLR A;  1NG0 A;  1OFS A;  2CTV A;  3IIA A;  1WCD J;  4R4Z A;  1I1E A;  4AEM A;  3KV6 A;  2G4I A;  1N1S A;  2RG4 A;  1QJX 3;  5FMB A;  5E1R A;  2R07 3;  1EP0 A;  1YCI A;  2BUK A;  1OVP A;  3D0J A;  2WFF 3;  1TME 1;  1MEC 3;  1HJG A;  1CJP A;  2JG9 C;  5DAW A;  4JCK A;  3CNA A;  1COV 2;  4Q1R A;  3WNL A;  1DHK B;  3CJI C;  1P8J A;  5FZE A;  3NJV A;  3RZM A;  3PUR A;  1YFU A;  2GN7 A;  3AVS A;  4DPN A;  4AI1 A;  1E5H A;  4BIO A;  1AXZ A;  3IB3 A;  3NW4 A;  3NWK A;  1OHF A;  2EF6 A;  4RD7 A;  1W6M A;  4AGG A;  4DY3 A;  4P08 A;  1ULD A;  4QHO A;  1AJO A;  4WVV A;  4LK6 A;  4XTP A;  3CLP A;  5EZW A;  2BNM A;  4JZR A;  1XQN A;  3R4U A;  2IXI A;  4JQR A;  2YPJ A;  1VB2 A;  1CAX B;  1LJ7 A;  4KI5 M;  4NHM A;  4XHX A;  5C33 A;  4XBQ A;  4DO0 A;  3KLS A;  1GOH A;  1A3K A;  1PHM A;  1J83 A;  1WLW A;  1VBC 3;  3K3O A;  3NRU A;  1JN2 P;  1CD3 G;  2WS9 2;  4QPG C;  1UAI A;  2B45 X;  4XUO A;  1AR8 2;  1KIT A;  3DKQ A;  3I3M A;  3K4D A;  2ZGP A;  4DXS A;  2QFE A;  3B7M A;  1LOA A;  4FO9 A;  4G4F A;  3W58 A;  5EWS A;  3G7D A;  4JDO A;  4QWN A;  2K9Z A;  4Q4V 1;  5L19 A;  1SZB A;  2GZW A;  4CCE A;  2W68 A;  3M3I A;  2D43 A;  1R1A 3;  2W91 A;  5A32 B;  2HBT A;  2W1Q A;  1ZM1 A;  1AR6 3;  3LEK A;  3OY8 B;  3FFZ A;  2VZR A;  1AR9 3;  4IEY A;  2BNO A;  1G9F A;  4OFG A;  2HWB 1;  2ZCW A;  4PIY A;  1ZZ7 A;  2P37 A;  1H6Y A;  1NZC A;  3IDC B;  3OPZ A;  3Q8E A;  1W2A X;  3TEZ A;  4B1M A;  4FOY A;  4XXP A;  1K45 A;  2DBI A;  4AG4 A;  1OUR A;  3ORJ A;  2ZGM A;  4RA0 A;  2P4E A;  2R1D A;  2B4K A;  2QQJ A;  3T30 A;  1RUF 3;  2BVV A;  5A1F A;  1W8W A;  2ATF A;  5A6Y A;  5L7O B;  2P2K A;  4LKS A;  2XKP A;  4YLZ A;  4D94 A;  1PGL 2;  1JYT A;  1QXP A;  1IPJ A;  2BOJ A;  3PIJ A;  4LBK A;  2QQV A;  3T4H B;  4DQA A;  2P5B A;  2NMO A;  5FYH A;  4H2A A;  4CP0 A;  1GZ9 A;  2ZX2 A;  3PJQ A;  4DB5 A;  2RMU 3;  1OBN A;  2ZGT A;  4OI2 A;  1FOD 3;  3EXU A;  4XUT A;  3S5A A;  1WW7 A;  3ETP A;  4KGQ A;  3URF A;  3TN9 2;  3NO8 A;  2ZKN A;  3W20 A;  4AWD A;  1PVC 1;  5FZA A;  4RYD A;  1XOY A;  4ZS2 A;  4CDX C;  4EZ4 A;  2VNO A;  4FT8 A;  3MW2 A;  3VD5 A;  4GKY A;  4IV3 A;  4RR3 B;  2Q8C A;  1VRB A;  4CXX A;  4Y1Y A;  1I9R A;  2PAM A;  3U0Z A;  1M4W A;  3AYA A;  4PHZ A;  3ZXD A;  4ASK A;  1Q3E A;  4RR3 A;  2R04 3;  2A6V A;  2W1S A;  5FZI A;  2WZP P;  4IE7 A;  3BUC A;  1UZW A;  2RDR A;  2RJK A;  2Y6G A;  4NHK A;  4UW4 A;  1XU2 A;  2JDP A;  2DVB A;  3CEW A;  1XBF A;  1ACC A;  3LEM A;  2OS2 A;  3E6C C;  3K77 A;  4CCN A;  3LOI A;  1DGL A;  3M7A A;  4A44 A;  1TQ5 A;  1MZ5 A;  2EXH A;  5FZ3 A;  1RIT A;  2BGP A;  2UY8 A;  4L11 A;  1A8M A;  3WDW A;  1O5U A;  2CWM A;  4QB6 A;  1GUI A;  3ZFG B;  5T5P A;  5ISL A;  3J7N A;  4TSV A;  3O1R A;  3RFR A;  3ZMO A;  1T6G C;  4BHP A;  4COY A;  2QUO A;  3N7L A;  5C8C A;  4Y24 A;  3I2K A;  4A6S A;  5A3O A;  5LRS A;  3LSD A;  3B00 A;  1ULO A;  2R0F A;  3WEZ A;  3GDB A;  4SLI A;  1Y3T A;  4MXV A;  4UFM A;  5FZ9 A;  1D4M 1;  4OI0 A;  3PMS A;  3I2D A;  1JZ4 A;  3PUI A;  1RUE 1;  1OA4 A;  5IWF A;  2Y6L A;  3HT1 A;  5KXB A;  4H7M A;  5T54 A;  3ETQ A;  3KB5 A;  4HMZ A;  1OSG A;  2XB6 C;  3EHK A;  4Q4X 3;  1R1Z A;  3NAP C;  1QH6 A;  5A3N A;  3O0V A;  5BNO B;  1D2Q A;  3K4A A;  3TYJ A;  4FXK B;  4QGM A;  5F5C A;  4K1Z A;  5K4L A;  2AZ5 A;  2LAL A;  5DUW A;  2XR4 A;  4XTM A;  5DXD A;  4DMI A;  1WLT A;  1N47 A;  1N1T A;  4UWD A;  1ULG A;  5K0U A;  3I7D A;  4ZHN A;  5ACA 2;  1UNB A;  4XVH A;  4C8D A;  1JYI A;  2IUW A;  1C1F A;  5GLW A;  3KVA A;  5JZG C;  2WNE A;  4KWL A;  1PZ8 A;  2YBP A;  3C7E A;  2E31 A;  2P6H A;  5LB6 A;  1GZW B;  3ZX7 A;  2SLI A;  5EJ1 B;  1RL3 A;  3BPS A;  1NE4 A;  3SLI A;  3AX4 A;  1UU5 A;  1GZW A;  3MBW A;  4IER A;  5LRR A;  3A0K A;  5FZ7 A;  2KA3 A;  3ZYR A;  4LKD A;  2JE9 A;  5CZK A;  1OUS A;  2HLE A;  4MGZ E;  4GWN A;  1QJU 3;  2WRA A;  1S2B A;  5T5J A;  1SMV A;  4AF9 A;  4COU A;  3SEP A;  2J1V A;  1WMX A;  3KVB A;  2PHT A;  1OOP A;  4CDW A;  3J8F 1;  5FBJ A;  3UJQ A;  2OX0 A;  1JXN A;  4BOW A;  4M4P A;  1VIW B;  4NIH A;  2GMP A;  4CE8 A;  3GHN A;  1WWY A;  3GZE A;  1W2T A;  4N90 A;  4D7T A;  3BU7 A;  2QTW B;  3WDU A;  3HEI A;  2JIC A;  3AMH A;  4UBH A;  1WME A;  2HWC 2;  1NA1 C;  2JDA A;  4LOS A;  2VTX A;  1OFN A;  4KBZ A;  4CPB A;  2JDU A;  1HB3 A;  5CA6 A;  3U11 A;  4I3P A;  2DDU A;  4B4P A;  1DGW X;  1GP6 A;  2ET1 A;  5T50 A;  1CX1 A;  2HH9 A;  1RUG 2;  1VAL A;  4Q8L A;  2O8Q A;  3SKJ E;  4AHY A;  3TWI A;  2JG9 B;  2D6O X;  3NVC A;  2A7A A;  3OBZ A;  1OLQ A;  3THP A;  2D5F A;  1UKR A;  2CAU A;  2PLV 3;  1RUI 1;  1OT5 A;  1W06 A;  1XC6 A;  2Y6H A;  2ZEY A;  5D21 A;  1PK6 C;  1W2N A;  3BOP A;  4GMP 1;  5FYU A;  4I0W B;  4B7K A;  3WUD A;  1K3I A;  2P3I A;  3S0M A;  1LOF C;  3ZPY A;  4LUL A;  3RQ0 A;  5HPO A;  5LA0 A;  1NKG A;  2OZJ A;  5FLH A;  1VMJ A;  4PLM A;  4D7S A;  3CU7 A;  2Y0O A;  2X5I A;  5A7S A;  4CEY B;  3VUO A;  1V6J A;  1QHD A;  4Y5S A;  4W50 A;  3UT0 A;  3U4S A;  4CZS A;  4OMD A;  5FZH A;  1QQP 2;  2MHF A;  3M8L A;  3BOD A;  5JLV A;  3ZN6 B;  1MS1 A;  1PIV 3;  3JQW A;  2C9A A;  4KH9 A;  4P9G A;  1KRI A;  1AYN 2;  1GWL A;  4HPK B;  5FP9 A;  3TAY A;  2GNT A;  4DOU A;  1V9U 1;  2XGX A;  4YM2 A;  2WJS A;  2CHH A;  3KM5 A;  4PBP A;  3RRD A;  4YZ1 A;  1X8M A;  4AHX A;  3KF3 A;  1NXD 1;  1OVS A;  2CGN A;  1F9K A;  1V6K A;  5FYZ A;  1UPS A;  1NCR B;  2ZML A;  3JQX A;  3WF1 A;  3ZKU A;  3T3Y A;  1WUV A;  3OGJ A;  1SDD B;  4FVV A;  4S2G A;  2YV8 A;  3IZO A;  3NV3 A;  3E1F 1;  1EAH 3;  3BB6 A;  3BAL A;  3LPF A;  1UY1 A;  1BEV 3;  1W2O A;  2Y6F A;  4TLG A;  5LA2 A;  2CGO A;  1EPZ A;  4LJH A;  5FWJ A;  1YJK A;  4HT1 T;  5JR2 A;  5FO7 B;  3R6S A;  1GFF 2;  1FPN 3;  4NPL A;  1BXH A;  1NZI A;  4HOO A;  3EJK A;  1KFX L;  1TVG A;  2RM2 3;  2JG8 A;  2R06 1;  5D1I A;  3O12 A;  5FUP A;  2VAU A;  4CEW B;  1AYM 2;  1YFY A;  5KHK A;  4BLJ A;  4F3J A;  3M3Q A;  2O14 A;  4NIG A;  1UWW A;  2JG8 B;  1RUG 3;  1VRH 3;  4N9I A;  1GAN A;  4JDN A;  3HR9 A;  4ATF A;  4MO3 M;  2YU1 A;  3C8X A;  1AR8 3;  2K46 A;  4Y20 B;  1WKY A;  4YWA A;  4KU7 A;  1QDC A;  1XE7 A;  2XJQ A;  5DAX A;  4Z2A A;  1GNH A;  1OPO A;  3AKT A;  3GF6 A;  3KGL A;  5FCC A;  1NLR A;  3J7H A;  5FZM A;  3RJR A;  3Q8C A;  4GUL A;  2HWF 3;  3V0A A;  1Z78 A;  3J8F 2;  4PQQ A;  2VBD A;  1RUH 2;  3B3Q E;  3CO2 A;  2ZGK A;  3HOB A;  4E4S A;  3UKN A;  1VRH 2;  1MZE A;  4OQ8 A;  1K42 A;  1G8W A;  3JU9 A;  1LEC A;  3ILN A;  1C57 A;  5FZ8 A;  3NNJ A;  1UOJ A;  4IW3 A;  4OMC A;  2VUA A;  2XH6 A;  3TEX A;  1TME 3;  3DCQ A;  5FK8 A;  3OD4 A;  2BZD A;  4EQV A;  2B8M A;  2DTW A;  2ZAH A;  1Y7B A;  4XJZ A;  5FZ4 A;  4IL7 A;  1TNF A;  4UF0 A;  2X53 S;  1MVQ A;  4E4D X;  4JKK A;  1POV 0;  1BK0 A;  3OJB A;  4JV4 A;  2Q8D A;  4AR2 A;  5C9A B;  5JMC A;  3T08 A;  1QJE A;  5GLZ A;  1PM7 A;  4HET A;  2EIB A;  3D82 A;  2AR6 A;  4AQS A;  3SCG A;  2DV9 A;  4N53 C;  4XET A;  2R1B A;  2E7Q A;  3LA7 A;  3EMR A;  4QPI B;  1B35 C;  3QAC A;  1Y9Q A;  4XDQ A;  1W99 A;  1ZZB A;  1K12 A;  3OTF A;  4N7I A;  2Q4S A;  1RUC 1;  5BPX A;  1OKO A;  2JEC A;  4NPM A;  4HSJ A;  4BM8 A;  1HRI 1;  2PHD A;  5FYI A;  2PLV 2;  5FYV A;  2FMD A;  3C7G A;  4FPC A;  2PYT A;  5IFT A;  5IVF A;  1O5L A;  3VBU A;  5K7P A;  5EV7 A;  1XPW A;  3ZLI A;  3IKW A;  2OW4 A;  1U5I A;  5BNN C;  1ZYB A;  2E51 A;  2XWJ B;  3UL2 A;  3VBF B;  1Q8O A;  1GBG A;  1X7N A;  2BVB A;  1EAH 1;  3PME A;  2VZQ A;  3U37 A;  4DRR A;  5LCW L;  3MDP A;  1BEV 1;  4CU8 A;  3N4M A;  2J1T A;  1OQD A;  2K0G A;  1EPW A;  1RUH 1;  1LUL A;  2W0X A;  1GKB A;  1W9W A;  4CCL A;  3M4F A;  2YGM A;  5FYS A;  3KV9 A;  4IE0 A;  1CZS A;  2OUH A;  2F6B A;  3AP6 A;  1F35 A;  3VKF C;  1YQ6 A;  2RDQ A;  4Q5O A;  5HV4 A;  1QY4 A;  3OSD A;  2JDY A;  2RM2 1;  1MS4 A;  3CZU A;  4CP1 A;  5I0S A;  3WHU A;  2HEY F;  5I91 A;  4LBL A;  4GH4 C;  2V5Y A;  2QQU A;  1LOB A;  2VGD A;  1RUG 1;  4HFS A;  4AOC A;  3ES1 A;  2PHU A;  5L73 A;  5FZG A;  5GLU A;  2O1Q A;  2AC1 A;  2E7T A;  1NCR C;  1H6X A;  5C8C C;  2VO5 A;  4ZS3 A;  1RGS A;  5FXV A;  4PJY A;  5FYY A;  3H3L A;  4IE5 A;  1JHN A;  1F5J A;  5EXO A;  1RUD 3;  3H50 A;  4NAO A;  2OVU A;  2J1U A;  1PVX A;  1SLC A;  4AGR A;  1GSL A;  3JD7 2;  4YZ4 A;  3V0B B;  1VAV A;  2D98 A;  5HCF A;  1HRI 2;  2ZPX A;  3ZYF A;  4XFH A;  5FP3 A;  4AI2 A;  4QU2 A;  4FAG A;  3VBF C;  4V1P A;  5E6H A;  2D7F A;  5A70 A;  2ADD A;  5GZD A;  4F8A A;  3O1S A;  1SLA A;  3ZXF A;  3POJ A;  1A34 A;  5AFE A;  4QX1 A;  3QH7 A;  1W8T A;  3QD6 A;  4OCT A;  1N1V A;  3F2Z A;  1UU4 A;  3UGF A;  1NQJ A;  1W6O A;  2W94 A;  3JD7 3;  4Y1V A;  4DEQ A;  5IYY A;  1TMF 3;  5IVJ A;  4FPY A;  1YIF A;  1VLN A;  1YI7 A;  1BK1 A;  4QXC A;  1W6O B;  5BNO A;  1L3J A;  2PQQ A;  1N3O A;  4BJ0 A;  3AP4 A;  4W65 A;  5FBZ A;  4XF9 A;  1OC1 A;  3ES4 A;  1S0B A;  2VW1 A;  4AZZ A;  5JDB A;  3TB0 A;  1UN1 A;  4QX5 A;  2WL1 A;  4QD2 A;  3V64 A;  3PU3 A;  4CCJ A;  4XDO A;  3POG A;  1MPX A;  2VXR A;  4LBO A;  1ULC A;  1LOE A;  1SHW B;  1NT0 A;  3WNK A;  1I5Z A;  3N9O A;  4AEJ A;  3VD4 A;  4JGZ B;  3OBT A;  3POI A;  1JYC A;  1SFP A;  2UWA A;  3O0W A;  5CFC C;  2V73 A;  4ZU5 A;  1VBE 1;  5IAX A;  5F7U A;  5DPN A;  5F6L B;  2R30 A;  2W1W A;  1LKN A;  2XWB B;  2HYK A;  1XE0 A;  1CX4 A;  2RR1 3;  3UKT A;  5IK4 A;  3USS A;  4BIS A;  4TN7 A;  3RVH A;  2BBA A;  2L9L A;  5C70 A;  5F3E A;  1ONA A;  4FTE A;  5DDJ 2;  2ZHM A;  4CTE A;  1RUE 3;  4MG2 A;  5FXW A;  1DYO A;  5F8P A;  5EHD A;  5A6Q A;  1DGW A;  2BTV C;  1W0O A;  3POE A;  4LNV A;  2E33 A;  3VDC A;  2ILM A;  2C6S A;  1DLL A;  1Q5O A;  5ANN A;  1UD1 A;  2NN8 A;  1VB4 A;  4ZXE A;  5IHR A;  4PDW C;  4JC1 A;  4V2W A;  1O4T A;  4NR1 A;  2J1S A;  3MLK A;  3NAP B;  1HN0 A;  2GP3 A;  2ZAB A;  4Q4W 3;  1IS3 A;  2VNV A;  3RYP A;  5A33 A;  2E7A A;  3K51 A;  3PLQ A;  1RHI 1;  4HK9 A;  2IC1 A;  4IEZ A;  2RS5 3;  3J4U H;  2JKB A;  1YRZ A;  2WR9 A;  4NHY A;  4QDQ A;  3K2O A;  3WHT A;  3TN9 3;  4HAN A;  4XFA A;  4LBQ B;  4XMI A;  1GWK A;  1ND3 C;  1YQ8 A;  2B7Y A;  3GJB A;  3P5B A;  3KV4 A;  4QKD A;  1UIK A;  5FKB A;  3BTY A;  2JG9 A;  3V65 A;  1HX6 A;  4FPG A;  1LES A;  2DCJ A;  3M1H A;  4XBL A;  4JDM A;  3RI8 A;  2ZHL A;  4YW4 A;  2ZMN A;  1YI9 A;  3NV2 A;  4XUN A;  4EZH A;  3ZR6 A;  2R7E B;  5CYY A;  5IVV A;  4HZF A;  4M3C E;  3ITQ A;  1PK6 A;  1RXF A;  4R9D A;  4DIN B;  3FLP A;  4MSV A;  1VBE 2;  1ZBA 1;  2X5I B;  1QJU 1;  3PTY A;  5IAV A;  1LOF A;  4IUG A;  4BQ5 A;  3GBG A;  5KXD A;  4JKM A;  3WP3 A;  2ORX A;  2C9K A;  2WIN B;  4LA3 A;  3JD7 1;  2D40 A;  5FFO C;  3J8F 3;  1TMF 1;  3CJI A;  4KWU A;  4L8Q A;  4TWT A;  5FQ0 B;  2D6P A;  5LA1 A;  5D8A C;  3KCX A;  3VB9 A;  2NYY A;  4BLI A;  3OCP A;  1OF4 A;  2W2I A;  1W0N A;  2WO7 A;  4I02 A;  3HD8 B;  2XJV A;  3LOB A;  1G7Y A;  3LIG A;  3I2I A;  4XUQ A;  5LK7 B;  3OPW A;  4AGV A;  3A7Q A;  2KM2 A;  4BQX A;  4WM8 B;  4OUS A;  3UKV A;  4MZU A;  4XFB A;  3LCP A;  3AMM A;  3ZO0 B;  4ZKT B;  3H7Y A;  4UFL A;  2VOW A;  2DCT A;  2EAL A;  2YC0 A;  4IEV A;  2VQT A;  2ZGN A;  3RMX A;  2ZGQ A;  3PHM A;  5CVR A;  4D69 A;  1IOA A;  3V56 A;  2P34 A;  5A3M A;  3ZYP A;  5GLV A;  3TBD A;  3F95 A;  3AC0 A;  4QM9 A;  2WC2 A;  2W95 A;  4YG3 A;  3J26 N;  5A3U A;  1S2E A;  2RDS A;  2X09 A;  1YQ2 A;  3VZJ A;  1MS0 A;  4MYE A;  4QT6 A;  2PFW A;  2X5I C;  3I3Q A;  1AR6 2;  3AP7 A;  2X29 A;  1V6L A;  2Z2S B;  4K1Y A;  2VMH A;  5ANQ A;  3N9P A;  5FY4 A;  3FN9 A;  4YW7 A;  1J3R A;  4IV1 C;  1DQ0 A;  1ULE A;  4YM0 A;  4XHB A;  5C8W A;  2WNV C;  3EB7 A;  5F39 A;  4IEQ A;  1QKQ A;  2WLQ A;  4Y1X A;  3ZFE A;  3QLQ A;  2ARA A;  3PUA A;  3ZFG C;  4QXK A;  3HBK A;  2I2S A;  2VOK A;  3MIC A;  3P3N A;  4KBB A;  3SKV A;  1CGP A;  1BQP A;  4GWM A;  4N43 B;  4YAR A;  1PO2 2;  2IXJ A;  4WM8 C;  5C4W A;  4BXS V;  4AI3 A;  2D44 A;  3OPT A;  2ETE A;  1UF2 C;  1DFQ A;  2P3K A;  3R0R A;  4B29 A;  5FMO S;  1ZZC A;  1X36 A;  1ZZ6 A;  4JQT A;  2XVK A;  1C4R A;  1LR5 A;  2VBB A;  4YYO A;  4K9S A;  2JD9 A;  4IEW A;  4MGQ A;  2BYV E;  1Y4W A;  3GNE A;  2RS5 2;  4LOR A;  4AED C;  5FO9 B;  2MEV 3;  4WVW A;  2CNA A;  4H55 A;  4LUK A;  3AL5 A;  4XIK A;  4FTB A;  1LOC A;  1WD4 A;  3LA2 A;  1PGS A;  1KJL A;  1FAY A;  3H8O A;  4D7Y A;  3M3E A;  4I01 A;  5FV3 A;  4AI9 A;  4BZ4 A;  1OMI A;  4E8C A;  4LPL A;  4NIA A;  4AW7 A;  2PAK A;  2WAB A;  3H3U A;  1XE8 A;  2E63 A;  3LGR A;  4PT6 A;  2O0O A;  1W9S A;  1W6P A;  2VUC A;  1XYN A;  3MF9 A;  1OD5 A;  1JYV A;  1FT9 A;  1W9T A;  1V6N A;  3ZPO A;  5J3U A;  2BER A;  1W6Q A;  4XF1 A;  3VBO B;  4URT A;  2RR1 2;  3M70 A;  3AKP A;  2JE7 A;  3B69 A;  3P1I A;  4AFB A;  1GZT A;  4GB3 2;  1FNZ A;  1LEN A;  2DTY A;  4DIQ A;  4Y26 A;  1I5P A;  2ZKL A;  3WNX A;  1ZRF A;  5L7O A;  5SV5 A;  1NCQ B;  1YQC A;  1ND3 B;  2KD7 A;  1QOS A;  5F2W A;  2D3P A;  1SDW A;  2RJL A;  4R8H A;  1UX6 A;  5JZG A;  4ERO A;  5JOX A;  5FDB A;  2Z69 A;  2DVG A;  3D6E A;  1V6M A;  5FY9 A;  2HWF 1;  2WUH A;  3O5S A;  4PLO A;  1ND3 A;  4XQD A;  4BMB A;  1S4C A;  3WQ0 A;  4FCA A;  4ORF A;  4ET7 A;  2WN3 A;  1Q8V A;  3IDB B;  1Q8P A;  2CV6 A;  1DQ4 A;  1GQG A;  5DAV A;  2DU1 A;  3RSJ A;  4WZC A;  1JU3 A;  5CFC B;  3ROU A;  3LQC A;  4QDS A;  1JZ3 A;  3SXW A;  3ZN5 A;  1RVF 2;  3KHC A;  2ZXQ A;  2VBP A;  4ZU7 A;  2H6B A;  3U4X A;  4M0H A;  3WDV A;  1H8T B;  2JDZ A;  1NY7 2;  3VBR C;  1KQR A;  1WCK A;  2BWA A;  3B94 A;  2VNG A;  1CPN A;  3LA3 A;  1Z0H A;  4UW6 A;  3OYW B;  2CSG A;  4ASL A;  4JHZ A;  5IJR A;  2R32 A;  3BOW A;  2Y26 A;  2YYO A;  4R9B A;  5AC9 3;  3ELN A;  4CCD A;  3CZJ A;  4BU2 A;  3OYW A;  5FXX A;  1Y9G A;  1IGO A;  2ZEX A;  4MGK E;  1AF9 A;  1ENR A;  4ZU4 A;  5C9A C;  1JBC A;  4FQZ A;  3I8T A;  2CGP A;  1DU3 D;  1U5Y A;  2WKK A;  3LDK A;  3BCW A;  4BME A;  2G9Z A;  3OUJ A;  3SHR A;  2VMC A;  1IS5 A;  1B35 B;  1GZC A;  5L9R A;  1HRI 3;  3UV9 A;  5I8Y A;  5IVB A;  1PMJ X;  3K4Z A;  3N7J A;  2RMU 1;  4D8M A;  4XFF A;  2ZGU A;  3H7J A;  4GB3 1;  2EXK A;  1H1M A;  2PTM A;  2QBX A;  4M01 A;  2RV9 A;  1ZBA 2;  3VKO A;  1NE6 A;  2H0B A;  4W6W A;  4LBQ D;  3TOJ A;  1PVC 3;  5HBA A;  1ALY A;  5IK8 A;  2MEV 1;  4LUM A;  1ENQ A;  4GIQ A;  3MUZ 1;  2UWB A;  4ZON A;  5BV6 A;  3G6J B;  1SLI A;  1V70 A;  3I3D A;  1ENX A;  4NRM A;  4Q0Q A;  5T5L A;  3C2U A;  4BDV B;  3MW4 A;  1C3H A;  3OB8 A;  5GZE A;  4XUR A;  1HXS 3;  5FZ6 A;  3T0D A;  1LHN A;  1DZR A;  4WM7 A;  4BQ3 A;  4EN0 A;  1RIR A;  2DUR A;  3R4S A;  5BYN A;  1EAH 2;  3J9S A;  3GYD A;  4LO4 B;  4I09 A;  4A7Z A;  1DGR A;  1CZV A;  1DQ6 A;  5JIA A;  4WM7 B;  3WIN E;  3ZXA C;  5BNQ A;  2WWU A;  3ABZ A;  3FUQ A;  3OBA A;  5DG2 A;  5FKC A;  4CCM A;  2J1A A;  1YLL A;  1RVF 3;  3UJO A;  1BVP 1;  1FV2 A;  5CFC A;  5IFP A;  3T2T A;  3AKS A;  3ZFF B;  3ZYJ B;  5ABJ B;  5CKM A;  5I0T A;  2D6L X;  4MAD A;  1J58 A;  2IXK A;  1WGP A;  4J1X A;  3H1Y A;  1ZRD A;  4KGG A;  2YXS A;  2VY0 A;  4RFT 0;  5CU1 A;  5T52 A;  2DVA A;  4A2U A;  1PMH X;  3O14 A;  5C3O A;  1DG6 A;  3TEW A;  3RZH A;  2QJV A;  5LBF A;  1UY0 A;  2JKX A;  2VJX A;  5JVV A;  2V72 A;  2WNO A;  2VUD A;  3HN1 A;  4AAX A;  1WA4 A;  4HON A;  3HNB M;  4G9S B;  3WQ7 A;  5CNA A;  5FPX A;  5M0T A;  4MGT A;  1T6B X;  2B46 X;  1RYY A;  3JCI A;  3ECQ A;  4RS5 A;  3VKL A;  3MUY 1;  1PGL 1;  2A1X A;  4QU1 A;  4HN1 A;  1ZA7 A;  1D4M 3;  3J7L A;  1NYW A;  2VZV A;  3JUU A;  1JZ8 A;  2R16 A;  3S57 A;  4YFW A;  4N7U A;  3UGH A;  2VU9 A;  4GKX A;  5KXE A;  5IUQ A;  1H2N A;  1KEX A;  2VMD A;  4YG0 A;  4ASM B;  1R09 2;  2JEM A;  2CWS A;  3CKH A;  2GH2 A;  4K3U A;  1W05 A;  2ARX A;  1ZRR A;  4Q0S A;  5A7N A;  1DBN A;  4XIO A;  3IM0 A;  4PDW B;  3ENR A;  4BH9 A;  2VH9 A;  3ZYI B;  4S2D A;  3SNM A;  3RJ2 X;  3WD5 A;  1JW6 A;  1NLQ A;  4HXC A;  4PDW A;  1IQD C;  2VCM A;  3T1M A;  4NWW A;  5LWB A;  5F5I A;  3UET A;  2YB7 A;  1D4V B;  1REF A;  4CDQ A;  1GV9 A;  4FOW A;  3TEY A;  4YW3 A;  3U75 A;  1MQT C;  3FL7 A;  4GB3 3;  1AL2 3;  4IEO A;  3LZZ A;  4P02 B;  5BNN B;  5FJH A;  4I0A A;  2HBU A;  2VW0 A;  4KWJ A;  4Y5Z 0;  5KHH A;  5T5O A;  1VE0 A;  1VBB 1;  2GNM A;  3POY A;  4LT5 A;  2Q0A A;  4GWI A;  2DCK A;  3JBG 3;  4OHV A;  3MHZ A;  5C3Q A;  2XJT A;  3B01 A;  5T3N A;  5F3I A;  3I49 A;  2VG9 A;  4BPZ A;  3U10 A;  4D6S A;  1JZ7 A;  2Y8K A;  5H9S A;  3WNP A;  2RR1 1;  4OUL A;  1WBF A;  4LO8 A;  1QH7 A;  4NHX A;  2QNK A;  2C0Z A;  3MF6 A;  3IAP A;  3WF2 A;  5GZG A;  3FE5 A;  4QPI C;  2P6C A;  2JDM A;  2VC9 A;  1GMM A;  1SCS A;  5FAX A;  3N9M A;  5DUU A;  5F5Q A;  3OGR A;  2A5Z A;  3RZZ A;  2WFF 2;  5FP8 A;  1HQN A;  1LTE A;  1WD3 A;  5GAL A;  4C0H A;  3IAQ A;  1AXY A;  2WNU A;  1W9Y A;  4A6O A;  1AR7 1;  2VW2 A;  3AK0 A;  2WDB A;  2ZHN A;  3GCX A;  3IWZ A;  2Y38 A;  4YGC A;  1OF3 A;  5FZ0 A;  4FFG A;  3Q8B A;  3ZN6 A;  4QDR A;  3LEI A;  2E26 A;  4Q29 A;  4FQ4 A;  1ZBE 1;  4LBM A;  3ME2 A;  2RS1 1;  4LIT A;  4RN5 A;  4YGB A;  2AAC A;  2IVI B;  5B4N A;  4AAP A;  1BLZ A;  4HPK A;  4P9I A;  4AFD A;  5I0D A;  1RMU 3;  4GA9 A;  1UZ0 A;  2WSU A;  2XQR A;  1LOG A;  1S0C A;  1OD3 A;  5IAT A;  3OBR A;  4C1X A;  2PHR A;  2WYS A;  3LDR A;  5CKN A;  1K5M A;  3RZG A;  3S30 A;  1LRH A;  4AK3 A;  2EID A;  2XLF A;  2JDH A;  3KS7 A;  4YZ5 A;  4UT5 A;  2QQM A;  2R07 1;  3FZ3 A;  5FRE A;  1H2L A;  4GMP 3;  4DUV A;  1UYX A;  5I0U A;  3ZN4 A;  5GKA C;  2VUJ A;  4HBN A;  3ZXE A;  1BCX A;  4AI8 A;  2HKX A;  1VBC 2;  1AYN 3;  3ON7 A;  3PVO A;  3OD0 A;  3MGU A;  4IET A;  3T0B A;  3IMM A;  4Q4Y 1;  3ZYB A;  3B9C A;  4DEV A;  2FCT A;  3WQB A;  5CBL A;  3S7E A;  2HWC 3;  2BWC A;  2QQO A;  2YFU A;  1MVE A;  1WCU A;  3TNQ A;  4IQP A;  1AL2 2;  2WZR 3;  5HXM A;  3GZT B;  5K9Y A;  2ZGO A;  2ZMK A;  2HWE 1;  5FJK A;  1UKG A;  2D6K A;  4CU9 A;  1X50 A;  2WSV A;  3ACH A;  2FHR A;  2WNV B;  4YGD A;  2A6W A;  3WNN A;  4YW5 A;  5A3T A;  2LUW A;  4IEX A;  3ZFE C;  3MV1 1;  2WNV A;  4Y4R A;  1D2S A;  2ZX4 A;  1UMH A;  4N43 C;  5LBC A;  2Q5T A;  1ENS A;  4HL0 A;  4LMF A;  2A70 A;  4S2H A;  1W6M B;  4AXO A;  1EUU A;  2OPK A;  2PMW B;  1XNB A;  1G9D A;  1RJ8 A;  1YO8 A;  3KT1 A;  4BQW A;  5FMD A;  2A6Z A;  3V0A B;  1NCQ C;  1AX0 A;  1CAX A;  2XVL A;  2A73 B;  3VLB B;  2XBO 1;  1SCR A;  5IW0 A;  1VBB 3;  2VTF A;  4AED B;  1HB1 A;  1IQA A;  4LR4 A;  1Q8Q A;  4OUE A;  2VNR A;  1ODM A;  2NM1 A;  2XG3 A;  1GNY A;  2BGO A;  1XYO A;  3WP4 A;  4ONU A;  5CAZ A;  4MLO A;  2V5D A;  1H4H A;  2RHP A;  4AED A;  1POV 1;  3S6P A;  2HJI A;  4Q4V 2;  2XXZ A;  1OA2 A;  3LD8 A;  3L2Y A;  4ARY A;  3RMY A;  1R08 1;  2QQK A;  1W8F A;  1J59 A;  1OKQ A;  4XCA A;  4UF0 B;  5I8T A;  5BXX A;  5L7O C;  1GLH A;  1G9B A;  3KT4 A;  3A4U A;  1Y9M A;  3I3B A;  3POF A;  5ACA 1;  4P9Y A;  4K21 A;  4YM1 A;  4BQ2 A;  4O7X A;  1JOB A;  1TNR A;  3T1L A;  5A6Z A;  2WII B;  3TNP B;  2EIC A;  1ODN A;  1GQH A;  4AYU A;  3D5O A;  2DVD A;  3CJX A;  2LW8 A;  3CQO A;  4QPI A;  1NCQ A;  2TBV A;  3PL0 A;  1EV1 1;  4DXZ A;  1UMI A;  5FO8 B;  2G19 A;  2PHX A;  3O1M A;  3GBF A;  2DCY A;  2D97 A;  3UES A;  1J1T A;  2HYX A;  3BTA A;  2B9V A;  3EQE A;  3MW3 A;  3X29 B;  4B8E A;  1YWK A;  5B4X A;  2XHK A;  2ZS6 B;  1QJY 3;  1W03 A;  3GXU A;  4Q4W 2;  4QAW A;  1HXS 2;  1RUF 2;  3LIH A;  3WP6 A;  3RZJ A;  4E9K A;  4JGY A;  1SFN A;  3VBU B;  3UK9 A;  2VEC A;  4P14 A;  3O1V A;  1H1I A;  3BVC A;  4PLN A;  1NXM A;  5A1L A;  5B2G B;  1R09 1;  2OXB A;  3GCW A;  4IV1 A;  1UZZ A;  5F6K A;  2VZP A;  3VN4 A;  1JS9 A;  3Q8F A;  4I30 A;  1H1A A;  3PU8 A;  5KWR A;  2VMF A;  3AYC A;  1PVC 2;  3AZX A;  4FBF A;  3AXD A;  3VBR B;  4CP9 A;  2C24 A;  1PO2 3;  2XJS A;  3IPV B;  3POW A;  2C5D A;  4AQT A;  5A1A A;  3MIG A;  4TXW A;  2WZR 1;  2EA7 A;  1OQ1 A;  4IV3 B;  2YBS A;  2ZHK A;  1R64 A;  4YVW A;  3IPV A;  5EPA A;  1DQ2 A;  3VBR A;  4CP9 B;  1IKQ A;  1FNY A;  3AZZ A;  4OHX A;  1H2M A;  2Y0I A;  1LOD A;  1OPM A;  2WLP A;  2ZJC A;  4FTS A;  1H8V A;  5CG9 A;  3KF5 A;  3RWK X;  4D0Q A;  3IBM A;  5JI7 A;  4MVT A;  1E57 A;  3USU A;  4HLT A;  2R04 2;  1F4H A;  4XJ9 A;  5FZF A;  4E2S A;  1CJD A;  1GOF A;  1J3Q A;  4P5H A;  4X8N A;  2XJR A;  1EY2 A;  3DXT A;  4AHW A;  3C7F A;  1KGY A;  3AFK A;  2XLG A;  4N9H A;  3USU B;  1HQW A;  5J48 A;  2FZ2 A;  5LW9 A;  3VBH A;  4OZX A;  2VQA A;  2R06 2;  1CZT A;  1SBE A;  4YW6 A;  3WLU A;  1ST8 A;  5JOW A;  5EJZ B;  2BPA 2;  3RWN A;  1T2X A;  1BBT 1;  2PHW A;  2VOX A;  2Z5W A;  4FI9 A;  1EV1 2;  1JOJ A;  4A3Z A;  1SBD A;  2RS3 2;  4GJY A;  4QPG B;  5A7Q A;  4GXL A;  4ARX A;  2ZBJ A;  3H8R A;  1TE1 B;  3BN6 A;  2B5H A;  5J98 B;  5F37 A;  4PIX A;  2YUE A;  2D5H A;  1S0D A;  4LIV A;  1ZZ9 A;  5JXH A;  2VZS A;  5IT6 A;  1LHU A;  2W08 A;  3JB8 A;  3NJZ A;  1HLC A;  1M06 G;  4J1W A;  2UY9 A;  2VPV A;  3ILF A;  3VHO A;  4FPJ A;  2B9U A;  1JMU B;  1STM A;  2YC4 A;  4ES9 A;  4YZ2 A;  3FLT A;  3QH6 A;  5FOB B;  4PI0 A;  3WQ1 A;  5JR7 B;  1LHO A;  1NQD A;  1LCL A;  2Z79 A;  3O1U A;  3ZFF C;  4AVS A;  1OOP C;  1EV1 3;  4AL9 A;  4MHU A;  4Y3O A;  4IGP A;  1DGR N;  5J37 A;  1HDK A;  5EQU A;  2NQY A;  4MX3 A;  3ZSM A;  4FOQ A;  2MNG A;  1S0E A;  1KDM A;  2CY6 A;  1JZ6 A;  4CDX A;  1XRU A;  3JB4 C;  3BI3 A;  3LF7 A;  3ACG A;  3MLJ A;  1QJX 1;  1UZY A;  3GZU C;  4TYS A;  3VDD C;  3WW3 A;  2HWE 2;  2EVX A;  2TNF A;  4NHL A;  4Z2W A;  1VPH A;  4EN9 B;  3K75 B;  4FXG B;  2DBN A;  2FQP A;  4Y4Y A;  4P9L A;  5DMY A;  5HCH A;  3O7O A;  1BYH A;  3BGA A;  5C6C A;  1BBT 2;  3FX3 A;  4QPW A;  4XQW A;  5JXG A;  4U2A A;  3DYP A;  2PXJ A;  4ISQ A;  1HXS 1;  4NO4 A;  2LS6 A;  4Z82 A;  4O61 A;  1J84 A;  4NJ4 A;  4M3C B;  4KG0 A;  1H9P A;  4WBB A;  2ZX0 A;  4PQ9 A;  2FZ1 A;  2ZAC A;  4K40 A;  2XL9 A;  3BTX A;  4ZPI A;  1DF0 A;  4CDW B;  1OOP B;  3HQX A;  1WCQ A;  2DFC A;  1RUE 2;  3MPB A;  2ZX1 A;  1SPP A;  3NAP A;  3S5Q A;  5DDJ 3;  1ULP A;  1W90 A;  4Y33 A;  4D3W A;  1LGN A;  5A33 B;  2O8O A;  1PNG A;  4A41 A;  3MFA A;  2CAV A;  1SPP B;  1UY3 A;  5JZG B;  3WG3 A;  2WZR 2;  5FY8 A;  4GAZ A;  3HNM A;  4H14 A;  3IMN A;  5A32 A;  5L36 A;  5A3P A;  3K3N A;  4LBQ A;  2E9Q A;  1BBT 3;  2D6N A;  1QDO A;  1RUN A;  3MIB A;  5LAS A;  4PF5 A;  1ZA4 A;  3H9A A;  3VDD B;  2HWB 2;  1GYK A;  4WV8 A;  1MS8 A;  4EN7 B;  4X6R B;  2CDP A;  3AKR A;  3WSO A;  2W46 A;  3ZSE A;  1QJZ A;  3W59 A;  1A8D A;  2I07 B;  3C7O A;  1XYP A;  3A22 A;  3GGL A;  3VBO C;  5FMC A;  3HWJ A;  1FMD 3;  4TTG A;  3WG1 A;  2R6Q A;  3ST7 A;  3AXE A;  1CR7 A;  3A23 A;  2UU8 A;  3B93 A;  1UZV A;  3KQR A;  1D7P M;  1VBD 3;  3LKJ A;  4PBO A;  3RNS A;  2QCS B;  1N3Q A;  4Q4W 1;  1RUF 1;  1YHF A;  4XDP A;  4JRL A;  1VP6 A;  4D6Q A;  5K8S A;  2VL4 A;  1MS9 A;  2FCU A;  3PUH A;  1I3H A;  1V00 A;  1BEV 2;  1OI6 A;  3TN9 1;  4QMA A;  1VJ2 A;  2IFW A;  4QQP A;  1YC6 1;  1UU6 A;  3K46 A;  2Z4F A;  1H0B A;  4WM8 A;  5C4W C;  5JMO A;  1O4Y A;  4GZ9 A;  4YVS B;  2QQL A;  1HIX A;  3GHM A;  2GMM A;  4AFC A;  1ND2 B;  5C3R A;  2WYF A;  5F3C A;  1NOV A;  2W5F A;  4OYU A;  1YQ5 A;  1E5S A;  3NNG A;  4JHT A;  4W4Z A;  4YVS A;  4CDU B;  3WXP A;  2XUM A;  5FOJ B;  4NAM A;  3GBW A;  3QOP A;  1CAV A;  5A80 A;  2XKO A;  2EIE A;  3WCS A;  2ENR A;  2V4V A;  1AX2 A;  3T2P A;  4CPB D;  1FMD 2;  2PN5 A;  3I2F A;  5F5A A;  2JB8 A;  4JTO A;  1CAV B;  4FFH A;  4ZZ8 A;  4XQ4 A;  1FPN 1;  4XAC A;  4E4H A;  5JOZ A;  4EWE A;  2HWD 3;  2YY1 A;  4LKE A;  1JZ2 A;  3NNM A;  4BA6 A;  4CEW C;  5EYX A;  5LBB A;  4AE2 A;  3AB0 A;  2R04 1;  2FCV A;  2R06 3;  4BK5 A;  4Z92 B;  1VBB 2;  2YZ4 A;  1WZX A;  1YIP A;  1PX3 A;  2GU9 A;  1D0G A;  1C5H A;  3ZFG A;  1XJA A;  4P00 B;  4FPE A;  1OQE A;  4KWK A;  4LHL A;  4QQL A;  4LQR A;  4NN0 A;  5FLI A;  2ZGS A;  3ZFE B;  4H7L A;  1VMH A;  3FC0 A;  5ABJ C;  5KC6 A;  2H0V A;  3MV0 1;  1LNS A;  1HV0 A;  1KFU L;  4ISR A;  5DDJ 1;  5E16 A;  4XBN A;  5LY2 A;  3ZDV A;  5C8C B;  1W28 A;  2R49 A;  3WOG A;  1ND2 C;  1QQP 1;  2GC0 A;  5J09 A;  1I6X A;  4WVM B;  2JX9 A;  3H0O A;  1OLM E;  2WQZ C;  1XXN A;  1YJL A;  1ZZ8 A;  4LXL A;  5FPZ A;  2GND A;  1CAW B;  1D4M 2;  1PIV 2;  4R4X A;  4XCB A;  4JGY C;  4Z8B A;  5HV0 A;  4Q0V A;  5BNP A;  1SEF A;  1FX5 A;  3HAG A;  5EYY A;  5HCA A;  1VBA 2;  3MI8 A;  4QX3 A;  4Y22 A;  1ZNP A;  1US2 A;  4Q0U A;  4QQH A;  3DPR C;  5FZO A;  2IXH A;  1HW5 A;  3IDA A;  3WV6 A;  4XMA A;  2A6X A;  5BNP B;  2GAU A;  3WDX A;  1QEX A;  4QB2 A;  1RC6 A;  1YEW A;  3DL3 A;  4HVR A;  4XXA A;  4E8D A;  1YXW A;  4AEK A;  2HWC 1;  4L97 A;  2B39 A;  2YMZ A;  5DAQ A;  2WFP A;  3LFI A;  3T4V A;  2BBV A;  4L9B A;  2ZGL A;  3N9L A;  1FOD 2;  4W6Y A;  1BHG A;  3OGV A;  1FMD 1;  1UQX A;  5LA9 A;  1NA1 A;  3BTZ A;  2CU5 A;  4Q26 A;  3N9Q A;  2WAA A;  3B5L B;  2XML A;  4V2V A;  2RVA A;  2YHJ A;  4NPR A;  5KC5 A;  1W6P B;  4NE9 A;  1VBD 1;  1Z7S 2;  3ZXL A;  4BXF A;  2V4A A;  1F5F A;  4A42 A;  1RUC 3;  1IPK A;  3ACI A;  1W3X A;  3THC A;  4BQ1 A;  2OPW A;  5C9A A;  5J1X A;  1G9A A;  1JUI A;  1O3R A;  2W92 A;  1QJX 2;  2GDF A;  1H9W A;  1UXX X;  1K5J A;  3ZSJ A;  3QBQ A;  3RYK A;  5JXJ A;  5DG1 A;  5FYB A;  2GP5 A;  3D8C A;  4AFA A;  1UX7 A;  4LLO A;  1TMF 2;  2PQS A;  4KG8 A;  5J7M A;  3H8X A;  2YBK A;  3FWE A;  1REE A;  1N3P A;  5FPB A;  3E6B A;  4F83 A;  1KDK A;  4JGY B;  5KHI A;  3MPP G;  3SQO A;  2ZZQ A;  2FDH A;  1ASJ 2;  5IK7 A;  3ASI A;  5FP7 A;  2ZX3 A;  5E89 A;  2JIG A;  3PDQ A;  1HJF A;  2D93 A;  3NQH A;  4RSU A;  1UMZ A;  1VMF A;  1DDL A;  4L0P A;  4XJW A;  5AC9 2;  5T55 A;  1RUH 3;  3GJA A;  2GN3 A;  5TSW A;  1KD7 A;  4IES A;  2Q30 A;  3AMQ A;  4CXY A;  2ZGR A;  4UOJ A;  4CA9 A;  3VZL A;  5LEK A;  4UFH A;  3I2H A;  4L92 A;  1V9U 2;  3III A;  3VBF A;  2JD4 A;  5C7G A;  2WA3 A;  2VD7 A;  1ZRE A;  2Y60 A;  4M3C F;  3SH4 A;  2XUE A;  1F15 A;  2DYC A;  4YSF A;  4ES8 A;  2VE1 A;  1DZQ A;  4RGK A;  3VKM A;  3BYW A;  1C28 A;  2RS3 3;  2GC2 A;  2VZ1 A;  3I2G A;  4M4R A;  5F9T A;  4K20 A;  2OQ7 A;  5JAX A;  3MO4 A;  4LTA A;  1WLC A;  4COZ A;  1CVN A;  2RM2 2;  1A6C A;  1W0P A;  3VGI A;  5JSR A;  4AVT A;  1CQ9 A;  1X8E A;  3DV8 A;  1FPN 2;  4YG6 A;  1BKZ A;  4XEZ A;  1PNF A;  2ORZ A;  2WQ4 A;  4UBG A;  4IND A;  1KS4 A;  4DXT A;  2WBK A;  5GZC A;  2A6Y A;  2BRT A;  1E5R A;  3H8U A;  3ILR A;  4TLF A;  4Y5T A;  3VBH B;  3M3O A;  4XYX A;  1CWP A;  4OHY A;  3LEG A;  4WZF A;  1QJU 2;  5F1R A;  4S2F A;  3PUQ A;  3VZK A;  3LSE A;  4LO5 B;  2RDN A;  4YW2 A;  3HIF A;  1TG7 A;  5FPA A;  1S55 A;  1R09 3;  3EYP A;  4UXA A;  4FPK A;  1HV1 A;  4CCC A;  3V0B A;  1MEC 1;  2N7G A;  1Z7S 3;  4OZO A;  3ZYH A;  5I0R A;  2TEP A;  4KNC A;  2VQ0 A;  4HKW A;  2G9F A;  2CL2 A;  1J1L A;  2WZE A;  1C8M 1;  4XAE A;  4M0N A;  5C3P A;  5AC9 1;  1IG0 A;  3HNY M;  4I3G A;  3WF4 A;  2DWR A;  1PM4 A;  2BEO A;  4PCR A;  2JE8 A;  5DAP A;  2YG0 A;  3R4D B;  4O65 A;  2OII A;  4KL1 A;  1PIV 1;  4DY5 A;  3H3Z A;  2F4L A;  3DEC A;  1UY4 A;  3OF1 A;  4UAP A;  1UW8 A;  1CN1 A;  1VBA 1;  4AQ6 A;  3WW1 A;  4CP2 A;  4HG6 B;  4B7E A;  1V6O A;  4P9J A;  2E32 A;  1U0A A;  2VME A;  1Y43 B;  5E8A A;  4QXB A;  5FPV A;  2Y64 A;  4XFC A;  1LAJ A;  2OT7 A;  3KHB A;  3HJR A;  5G05 L;  5CIS A;  2HEV F;  5FUI A;  2BGC A;  4NRO A;  3ZFF A;  5H9Q A;  3WDT A;  4HK8 A;  5FIX A;  4FOV A;  2LM3 A;  5ERL A;  3T09 A;  4C91 A;  5J36 A;  3WVJ A;  3ZR5 A;  1GP5 A;  2NZ9 A;  3ATG A;  1U5X A;  4CDX B;  5K0U C;  3UNP A;  3ZXK A;  2I45 A;  1RUJ 2;  3ACF A;  4QGN A;  5BNP C;  1JZ5 A;  4FPL A;  5CEH A;  4A4A A;  3M2M A;  1QNW A;  1BJQ A;  1UCX A;  4MGI E;  1R1A 1;  1XSQ A;  4JGZ A;  1IG3 A;  1QGL A;  1W2U A;  4I2O A;  4CEW A;  3WF3 A;  1DYK A;  1RMU 2;  3FLR A;  1X9P A;  4LEJ A;  4GAL A;  4QX0 A;  3TRS B;  3C3V A;  3I3E A;  2HWB 3;  2WQ8 A;  4FFI A;  4Y20 A;  1O4Z A;  3JXS A;  4FPF A;  4QXH A;  4W6X A;  4QX7 A;  3WW2 A;  4NWV A;  1ASJ 1;  1QXR A;  2RS3 1;  4HVQ A;  3AZW A;  1TZO A;  1OA3 A;  3MFC A;  3D4K A;  3HN3 A;  1C8M 2;  2QQN A;  2XLA A;  1RHI 3;  1JUH A;  3KGZ A;  4P5Y A;  2RS5 1;  3MYX A;  1US3 A;  5AVP A;  1PZ9 A;  2VCC A;  3FUO A;  4XFI A;  4RHV 2;  2FDF A;  5FY7 A;  1DP0 A;  2TUN A;  2J1E A;  4J6G A;  2FD8 A;  2YFZ A;  1DZT A;  4KMQ A;  2ZEW A;  4X8P A;  4KU8 A;  2YU2 A;  3DGT A;  1RHI 2;  3T0A A;  3OUH A;  4XZP A;  4Y1U A;  4UW3 A;  4QX8 A;  3PVE A;  1S2K A;  2VXJ A;  1LHW A;  2XL7 A;  4Q27 A;  1IZ3 A;  4QQ2 A;  1RIN A;  3ZM8 A;  2NP0 A;  5GLT A;  1AUY A;  4W8J A;  5BNN A;  4FSJ A;  3VDD A;  4B4Q A;  4HKO A;  3RYR A;  3H1W A;  3WG2 A;  3AM2 A;  5FZC A;  3WG4 A;  4ZZ5 A;  4LBN A;  1VBD 2;  1Z7S 1;  3CHX A;  4J25 A;  4CDU C;  4EWA A;  5FMO L;  1PX4 A;  3WR0 A;  4QQO A;  4RGG A;  1W39 A;  5E88 A;  2IZW A;  2Q8O A;  4BQY A;  2DUQ A;  4XFG A;  4QKF A;  1RUI 2;  1R1A 2;  1UYZ A;  2A71 A;  3VV1 A;  1RUC 2;  1APN A;  1W8H A;  1W8N A;  1GQP A;  1WCS A;  3C7H A;  3I4I A;  4NVP A;  4QKB A;  1XNC A;  2P3J A;  2ZZJ A;  4IE4 A;  1COV 3;  4XAB A;  2KR2 A;  3ACL A;  5FR3 A;  3BPZ A;  4GQ7 A;  1RJ7 A;  4WM7 C;  4B1L A;  1Q43 A;  2W3J A;  4CRQ A;  4JTN A;  1MEC 2;  1OH3 A;  4XJU A;  4XZU G;  3T2Q A;  4FAH A;  1F2N A;  3DKW A;  4YVW C;  4Q2F A;  1NX9 A;  1S0J A;  4CCK A;  4I0B A;  1PO1 2;  3NJY A;  4HVO A;  2BNN A;  4DFS A;  1ND2 A;  2GH8 A;  1NY7 1;  1W8U A;  2BU9 A;  2X8K A;  3INA A;  2BFU L;  3OOX A;  5DQ0 A;  4ATE A;  3HMY A;  4A3X A;  3PJY A;  4RHV 1;  4CDU A;  4EYU A;  3FBY A;  2IWG B;  5EIY B;  3W5N A;  1FI2 A;  1XU1 A;  2QE3 A;  1H8T C;  2YC2 A;  3ZOI A;  4Z07 A;  2VMG A;  1WW4 A;  4MGS A;  1QOO A;  3NST A;  4AVB A;  3RG0 A;  3E5X A;  2AEY A;  3IT8 A;  4AFM A;  1W9F A;  1W3V A;  4LE3 A;  3ALQ A;  4N8M A;  2OZ6 A;  5CFD A;  5KR7 A;  1PZ7 A;  4Q8K A;  3DXU A;  4Q4X 1;  3AJZ A;  3RZK A;  3N7M A;  2YGL A;  3AYE A;  1GU3 A;  4IXL A;  5FZK A;  3NNF A;  5JSO A;  3HBZ A;  4L2N A;  4ZY9 A;  3O0X A;  4XF0 A;  4OLL A;  1IPS A;  1U12 A;  1X33 A;  2JG8 C;  3SCF A;  2BJS A;  4PF1 A;  3ZXJ A;  1V6I A;  1RMU 1;  5HXV A;  1JYW A;  2FMY A;  3KT7 A;  2ES3 A;  4AQ2 A;  3AFG A;  5LK5 A;  1YFX A;  3FHA A;  2E53 A;  1HN1 A;  4P9X A;  2FDG A;  4LBJ A;  2W52 A;  3VHP A;  1DIW A;  5GM0 A;  4IGQ A;  1BVV A;  4WVM A;  3SH5 A;  3WNO A;  5C5U A;  3O1O A;  2VUL A;  1WW5 A;  1JHJ A;  2ET7 A;  3P6B A;  5C4W B;  2XHN A;  1CAW A;  5I93 A;  1V0A A;  2NMN A;  4URA A;  2BOI A;  4DUW A;  1O7F A;  2WN2 A;  2JDK A;  1ZRI A;  1AYN 1;  1PO1 1;  3PTR B;  5CKQ A;  2KXL A;  5JI9 A;  4Y22 B;  4Q4Y 3;  1XNK A;  3VZO A;  1AVB A;  2WT0 A;  4KQ7 A;  3WCR A;  2A3W A;  2C26 A;  2XJU A;  2VOT A;  3ZSL A;  1UOG A;  1J3P A;  4SBV A;  1N1Y A;  2HWD 1;  2VM9 A;  4QKN A;  4CU6 A;  2IXC A;  1HKD A;  4MUV A;  1QWR A;  3A0N A;  3DPR A;  1ZVF A;  5I8S A;  2HWE 3;  4GWJ A;  3VHR A;  2FDK A;  1UL9 A;  1BZW A;  2XJP A;  3B9I A;  1U5Z A;  3SC7 X;  1QJY 2;  4N53 B;  1F31 A;  3M3C A;  4OI4 A;  1JOD A;  4BYY A;  3VBH C;  2ZOE B;  4U36 A;  2Y33 A;  4JX0 A;  3FFQ A;  4EWD A;  3RZL A;  4N53 A;  4LA2 A;  1AR9 2;  5G04 L;  4D6R A;  5JSP A;  4XOG A;  1H4G A;  2J1R A;  3CL1 A;  3RI9 A;  2EAA A;  2P1B A;  3W5M A;  3EBR A;  3ZIX A;  1QQP 3;  3WDY A;  3ZSK A;  1IHM A;  4BB3 A;  4GD4 A;  1YNA A;  1X9T A;  2F4P A;  1FXZ A;  3E5U A;  2D3S A;  3CF6 E;  1AYM 1;  5A7P A;  1F8V A;  4JGZ C;  2PLV 1;  1RUI 3;  1S0G A;  4QGL A;  4MV2 A;  2IXL A;  2PEL A;  1GWM A;  1POV 3;  2AGS A;  2Q1F A;  3A21 A;  4XF3 A;  1CES A;  1W6N A;  2LRP A;  1G9C A;  2W39 A;  5A7W A;  5IVY A;  4QPY A;  1JI6 A;  1R08 3;  3I59 B;  4F7Z A;  5IVC A;  2WZ8 A;  3VKN A;  5JUV A;  1TEI A;  5KHJ A;  1W6N B;  2ZEZ A;  5FZ1 A;  4RR3 C;  5EJ3 A;  4YNI A;  4UFJ A;  5CIR A;  1QXJ A;  5A7W B;  1O6U A;  5FYC A;  3I59 A;  4LHK A;  1A78 A;  3KSC A;  4OHZ A;  1W04 A;  4UYB A;  4MH0 E;  1H8T A;  1L7Q A;  1SLL A;  3I2O A;  3KCY A;  4LIU A;  4M00 A;  4GH4 B;  1HRV 1;  1MQT A;  3E97 A;  4DNY A;  1JYX A;  5FYM A;  2GSY A;  2VCA A;  3Q8A A;  1H2K A;  1V9U 3;  4K6B A;  4CUC A;  3ZIW A;  4BE3 A;  1WBL A;  3N9N A;  4EJR A;  3HVD A;  1MQT B;  2BP6 A;  2C4X A;  3WZ1 A;  2ZAA A;  3MID A;  4E27 A;  4MXW B;  1QJY 1;  3VZN A;  2WA4 A;  1UYY A;  3WNM A;  3LE0 A;  5FZD A;  3LPG A;  2W9X A;  1PK6 B;  1DCS A;  3P3P A;  3FMG A;  4XJA A;  4MXW A;  1AHS A;  3J7M A;  4XF4 A;  5FY5 A;  3QCW A;  1POQ A;  2WFF 1;  4LOT A;  3AMP A;  4MOA A;  2JDN A;  5A3L A;  5FY1 A;  4E4Z A;  2IVJ A;  2VVE A;  1PO1 3;  3CJI B;  5FQ0 A;  4CEY C;  1UPI A;  4RFR B;  3DEM A;  4HN0 A;  5CAD A;  5J96 B;  3MLL A;  4QPG A;  4Z1V A;  4OI1 A;  3ZDS A;  2YRO A;  3E6D A;  2V09 A;  5CG8 A;  5F2S A;  1PO2 1;  3H42 B;  3VL9 A;  1ZBE 2;  1ZBA 3;  3I54 A;  2RS1 2;  3NKT A;  4R52 A;  1O8P A;  3MIH A;  4QM8 A;  1D0H A;  4R9C A;  2Q8E A;  1RUJ 3;  1PMI A;  2B42 B;  4BCU A;  2P17 A;  2PA7 A;  1SBF A;  2XBO 2;  5FLJ A;  5D8A A;  5C3S A;  1QNY A;  2WWS A;  2ZA9 A;  3L9J T;  3IDE A;  3MIF A;  1F4A A;  5A3W A;  1RVF 1;  1VAM A;  3RPQ A;  4LO6 B;  5D8A B;  1LU2 A;  2R07 2;  4XPV A;  5CB7 A;  5BNO C;  3APB A;  4DRV A;  4AVV A;  4YM3 A;  4UFK A;  3FHQ A;  2A3Y A;  1PGW 1;  4UW5 A;  1VBC 1;  3VD9 A;  2QQP A;  4WVZ A;  2QVS B;  3K48 A;  2GAL A;  2IFR A;  3AKQ A;  4Q4Y 2;  2OQ6 A;  1IS6 A;  2ID4 A;  1UOF A;  1NLS A;  2C1F A;  4ITC A;  3RS6 A;  2DVF A;  1CON A;  1UXZ A;  4IEU A;  3SCH A;  3VL8 A;  5ABJ A;  3PIG A;  1MAC A;  2VZU A;  1AYM 3;  3DYO A;  4IEP A;  1YUD A;  4LLF A;  3POB A;  4XC9 A;  4B3N A;  4QHZ A;  2ZTN A;  2QQI A;  1G6N A;  1SG3 A;  4QB1 A;  4L99 A;  4AVC A;  1AR6 1;  2OYZ A;  1JTZ X;  2E6V A;  1QIQ A;  2VZ3 A;  1AR9 1;  3D3A A;  2QDR A;  2Z42 A;  2F17 A;  4OHW A;  1H30 A;  1ULF A;  3MEP A;  1AZD A;  1C8M 3;  4A7Y A;  1OH4 A;  1ZX5 A;  4FP3 A;  4YW1 A;  4N43 A;  3ZVX A;  2HWF 2;  1SAC A;  4JKL A;  3Q9O A;  4A7K A;  1LB2 A;  2MEV 2;  4RQP A;  2PHL A;  4XW3 A;  5AFB A;  5C5T A;  2Y6K A;  3CDZ B;  5KHG A;  4CVU A;  5JPN B;  2YDE A;  1NUK A;  4M3C A;  4RQP B;  4K7J A;  4NMI A;  1VBA 3;  4LHS A;  3ZXG A;  3PNA A;  2QZ2 A;  4XUP A;  5A6X A;  2VTX J;  2X05 A;  3VD7 A;  4H3W A;  1ZRC A;  1LGC A;  3NKG A;  1SLT A;  2XOM A;  3R05 A;  4FP2 A;  3WF0 A;  2R0H A;  5EFU A;  2H6C A;  4MHR A;  1XNA A;  3OEA A;  3PVN A;  1R08 2;  1SQ4 A;  4RS5 C;  1E5I A;  3JBG 1;  3U07 A;  1BMV 1;  2GME A;  5FK7 A;  2LRO A;  3OY8 A;  1WMD A;  2NLR A;  2WS9 3;  4Q1P A;  1K5M C;  4OUM A;  1RB8 G;  2VMI A;  1EYB A;  2I74 A;  1W6Q B;  1XND A;  3KWV A;  4MET A;  2J7M A;  4XIL A;  3VBO A;  3LDB A;  3W21 A;  3JZV A;  4O9E A;  2LTN A;  5F3G A;  3BKZ A;  2DU0 A;  1FV3 A;  1QJF A;  1W8Z A;  2W1U A;  2NPI A;  4A45 A;  5GZF A;  3OGG A;  2RMU 2;  5LBE A;  5DN2 A;  4YGE A;  5DUX A;  1RUJ 1;  5KXC A;  3AMN A;  1ASJ 3;  4E2G A;  1QMJ A;  2DFB A;  4CUB A;  2JB4 A;  3N3H A;  2BFU S;  3AJY A;  4UI9 L;  4CXW A;  2J42 A;  5LAT A;  2RS1 3;  4RQP C;  4BK4 A;  4Y1Z A;  1DLC A;  3U14 A;  1AR7 2;  1KXG A;  2VOV A;  1CIW A;  1LGB A;  3GM8 A;  2RJ2 A;  4E2Q A;  1JOP A;  2WT1 A;  4EV0 A;  1IKP A;  2DCZ A;  2HEW F;  2ARB A;  2ARE A;  1RUD 1;  3LAG A;  4FFF A;  3VBU C;  4G3Y C;  5DZF A;  1AJK A;  3CBN A;  3CIH A;  3H1M A;  4JRA A;  5LEJ A;  2CYF A;  3SH3 A;  1L7R A;  2OKX A;  2AH2 A;  5C71 A;  2JJ6 A;  2VQU A;  1O8S A;  3LFM A;  4CSW A;  1W8O A;  5JIU A;  3O1P A;  2VZT A;  3VD3 A;  2XVG A;  1K5M B;  1MZ6 A;  5AVA A;  4X6Q B;  5FRA A;  3I97 A;  5DUV A;  3VZM A;  3ZYG A;  4COW A;  1O3T A;  5FPL A;  2GC1 A;  2W47 A;  2VCB A;  4QX2 A;  3VHN A;  1DQ5 A;  1QF3 A;  3N35 A;  2WT2 A;  1HRV 2;  2JWP A;  5CFD B;  1OXC A;  1S0F A;  2W87 A;  2WO1 A;  2DUO A;  4C90 A;  4DZG A;  1BMV 2;  2PHF A;  3BIW E;  2J22 A;  4FPO B;  2X10 A;  1LHV A;  3GAL A;  4IV3 C;  5LZ6 A;  1B35 A;  2ERF A;  1DYP A;  2GNB A;  4K8F A;  1GOG A;  1C1L A;  1X82 A;  2XON A;  5H9P A;  2EXI A;  3WUC A;  3U1X A;  1CAU B;  1OUX A;  1COV 1;  3E5Q A;  1WLD A;  2Y6J A;  4NUB A;  1KJR A;  2VZO A;  4RL7 A;  1XSR A;  2P3Y A;  2QDN A;  3VDB A;  3AVR A;  3SEE A;  4HSL A;  1CAU A;  4CDW C;  5L9V A;  3KMH A;  1YYN A;  5BUV A;  1WA6 X;  4LHN A;  3PUS A;  5EP9 A;  3DYM A;  3NNL A;  4O9G A;  5FWE A;  4EN8 B;  5IVE A;  2AEN A;  3VBS B;  4EN6 B;  3GZA A;  4AI0 A;  3DN7 A;  4NRP A;  1VR3 A;  4CCO A;  2GC3 A;  3NL1 A;  4K8R B;  5DAB A;  5IK5 A;  3VBS A;  1XNT A;  1O3Q A;  2EAK A;  4YRD A;  1LEM A;  2XBO 3;  1VBE 3;  4YFZ A;  4HKL A;  1LED A;  1GIC A;  3OG2 A;  4RHV 3;  1YFW A;  5F32 A;  1UOB A;  3WX5 A;  3N7K A;  1EUT A;  3AL6 A;  3NJX A;  2VR4 A;  3KQ4 B;  1AXK A;  1RUD 2;  2DF7 A;  4UFI A;  1JU4 A;  2WS9 1;  5FYT A;  4OQ9 A;  4NRQ A;  2BV4 A;  5A7O A;  5D2A A;  2XDV A;  5JWP A;  4C0B A;  1CPM A;  3RGB A;  3MZH A;  3N36 A;  5FZO B;  3DPR B;  4GJZ A;  4P9W A;  1C5I A;  1NAE A;  3WW4 A;  4BIF A;  1GNZ A;  1XB9 A;  3DF0 A;  5ACA 3;  1PGW 2;  1UO9 A;  5BY5 A;  3LB9 A;  2UYB A;  3AP5 A;  3AZY A;  3FJS A;  3KD4 A;  1NA1 B;  4JVA A;  4XJ8 A;  5FXZ A;  1MR5 A;  2SBA A;  2RE9 A;  4LK7 A;  2PAE A;  2UYA A;  4XE9 A;  4LKF A;  3ZKY A;  1LU1 A;  2ADE A;  5JOY A;  4CYD A;  1C8N A;  3VBS C;  5HI0 A;  1UYP A;  5K0U B;  1MZF A;  3W9A A;  2UWC A;  1Q8S A;  5L9B A;  4Q4X 2;  3MIE A;  2BQP A;  4RS5 B;  4B4R A;  4EE2 A;  3O1T A;  2WAO A;  1JYN A;  1SFY A;  1GR3 A;  2JEN A;  2DUP A;  3WP5 A;  4R9A A;  1MS5 A;  2YPD A;  2A75 A;  3OUI A;  1OLM A;  4PIZ A;  5DZG A;  2CDO A;  5SV8 A;  3L2H A;  3NV4 A;  1URX A;  4NID A;  4QHB A;  4AVA A;  2OA2 A;  2WO3 A;  1S0I A;  2WNU C;  1HB4 A;  3T2O A;  4JAA A;  5GJ6 A;  5HCB A;  2QQW A;  4CU7 A;  1WMF A;  2JXA A;  2Q1M A;  3IN9 A;  4CUA A;  1UIJ A;  1VAK A;  3KV5 A;  4XAA A;  4IV1 B;  1UY2 A;  2VVF A;  2VVD A;  5LY1 A;  3KZ4 C;  3AZV A;  2JIJ A;  2BDR A;  2AUY A;  3UYJ A;  1KS5 A;  2G9G A;  4PI2 A;  3THD A;  4FPH A;  1RUO A;  2WO2 A;  3OEB A;  4IGO A;  5FUN A;  4CDQ B;  5H9R A;  5FTT C;  5FZL A;  4CUG A;  1RXG A;  4LO7 A;  4BQ4 A;  2G1M A;  1QU0 A;  2Y34 A;  2FBE A;  4C1W A;  3HT2 A;  4GH4 A;  5JPM B;  3NV1 A;  4GMP 0;  3I2J A;  4YVW B;  3JBG 2;  1B09 A;  2AYH A;  3NMB A;  2HWD 2;  3FBM A;  4IDZ A;  4BWO A;  4MGY E;  4TZD A;  1HQL A;  1QOT A;  5JXI A;  1AL0 G;  1TME 2; 
#chains in the Genus database with same CATH homology
 1OVP A;  1OXC A;  1W8H A;  1OVS A;  4CE8 A;  5A6Z A;  1OUR A;  2JDY A;  2BP6 A;  3DCQ A;  2VUC A;  1OUX A;  5A6X A;  5A6Y A;  2BV4 A;  5HCH A;  2VUD A;  5D2A A;  5A6Q A;  3ZDV A;  5A70 A;  1UZV A;  1OUS A;  1UQX A;  2JDU A;  2BOI A;  2BOJ A;  1GZT A;  4AOC A;  2JDM A;  2JDH A;  2JDK A;  4UT5 A;  2WRA A;  2XR4 A;  5A3O A;  2JDP A;  1W8F A;  2JDN A;  2VNV A;  2CHH A;  2WR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...