2BOJA

Crystal structure of pseudomonas aeruginosa lectin (pa-iil) complexed with methyl-b-d-arabinopyranoside
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of Different Monosaccharides by Lectin Pa-Iil from Pseudoman Aeruginosa: Thermodynamics Data Correlated with X-Ray Structures.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Lectin
molecule keywords PSEUDOMONAS AERUGINOSA LECTIN II
total genus 20
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2bojA00
1OXCA 2JDKA 1GZTA 2VUDA 2BP6A 1W8FA 5A6QA 5A6ZA 2CHHA 1UQXA 2WRAA 5A3OA 1UZVA 2JDHA 2BOIA 2JDMA 5A6XA 1OVPA 2BV4A 5A70A 1OVSA 4AOCA 2JDPA 2JDUA 3DCQA 2JDYA 1OUSA 2BOJA 5D2AA 1OUXA 2VUCA 3ZDVA 4CE8A 5A6YA 5HCHA 2WR9A 2XR4A 4UT5A 2VNVA 1OURA 2JDNA 1W8HA
chains in the Genus database with same CATH superfamily
4MGYE 2W0XA 4BQ1A 5GLWA 1BMV2 5LA2A 1ASJ2 4SLIA 1AZDA 4TN7A 4PCRA 1R1A1 1WCDJ 3DYOA 4QDSA 4UF0A 4ASMB 3HEIA 2CTVA 2OVUA 1LOBA 3D5OA 3LAGA 1AYM3 1GANA 5A6ZA 4FTEA 3MZHA 4QQHA 1W03A 5CIRA 1ND3B 3NL1A 1SLBA 2PQQA 1YIFA 2WBKA 3VD5A 2XLGA 3WHUA 1JYCA 3BTYA 1VJ2A 3KWVA 4GMP3 5C33A 3X29B 1B09A 3IKWA 2ENRA 2WZR2 3PUAA 3Q8BA 4XAEA 2HWD3 3B9IA 5AVPA 1N1VA 1YEWA 4W6XA 4Y1ZA 1VAVA 2VH9A 3KT4A 3H42B 4Y24A 2QZ2A 4C0BA 5FPXA 3A22A 4A42A 2O0OA 4AVBA 5BYNA 1TMF2 1IPKA 1PHMA 1QJY1 4QX2A 2NMNA 2RS51 1C1FA 4Q0SA 2MEV3 2W1SA 1HLCA 1UL9A 2BP6A 2AYHA 2DVGA 3H8XA 2ZAAA 1ENXA 4TTGA 5FBZA 1XSQA 2W3JA 1OOPB 3BB6A 4H2AA 1FV3A 2VZPA 3G6JB 4DXSA 1DQ1A 1QH6A 1CX4A 5IK4A 1MEC2 4O61A 1GUIA 1WZXA 4U2AA 4AL9A 5FJKA 2EIBA 1UY1A 1JZ5A 1CAUA 4Y1UA 5JOZA 2CV6A 1AL21 1QY4A 2XBO1 1OPOA 3MBWA 2FZ2A 1S1AA 2R6QA 1PO12 2E33A 1IZ3A 2W68A 3O5SA 4AZZA 1O8SA 3MO4A 2Q1ZB 1OLQA 2P6CA 4D7YA 1H1MA 4OMDA 4HFSA 1SCSA 3ZFEA 2HBTA 4MOAA 5B4XA 5L7OC 1UU5A 1PGL1 3VKNA 5H9SA 1CJPA 2WQZC 3PTYA 3H9AA 1UX6A 4LJHA 4X6RB 3IM0A 4HVRA 4UFMA 5ACA2 3VDDA 4CUBA 2NP0A 3RWNA 5LCWL 4XUOA 4PF5A 1PIV1 2WABA 3WLUA 1OA4A 3MI8A 4HG6B 5FZ6A 1HW5A 4BISA 3WUCA 5T5OA 2PLV1 2XR4A 3JD72 3VDCA 3VUOA 3FE5A 1JYIA 1EAH2 1ZVFA 5FY4A 4A4AA 5HPOA 1CONA 3POEA 2VZOA 1YHFA 1DQ2A 3PVEA 4RD7A 1BBT1 2QQNA 1AYN2 4JQTA 2K2SA 4I3GA 4BJ0A 1WMEA 3I2KA 2QKDA 3KM5A 3ASIA 3IN9A 3V65A 4AVTA 4NN0A 3ZFEC 1HKDA 4RQPB 2RDQA 1GOGA 4A6OA 4ZXKA 4IE0A 1K45A 3NWKA 2LW8A 4Q0QA 1LHUA 1SEFA 3JXSA 3M3CA 5C5TA 4CP2A 1NQJA 4AQSA 4XAAA 4FFIA 5A70A 3WW1A 3ZFFB 3NAPA 1D0HA 3S5AA 1U5XA 1VBA1 2RG4A 1RUI1 3TEYA 1PO13 2ARXA 3C7FA 3RI9A 4AEDA 1JI6A 4AGGA 3DPRC 4E2SA 3U11A 1LHOA 2BNNA 4PJYA 1RUE1 1YWKA 3K48A 1D4M2 2Y34A 5FZ3A 4OQ8A 2BPA2 2FMYA 2MEV2 3V56A 3AZVA 2JENA 2PHDA 1XPWA 5GLVA 5CAZA 3VBUC 1GZCA 3EQEA 1PVC1 3T3YA 2WIIB 1IS3A 1Z78A 2DFBA 1R091 2DVDA 2GDFA 2Y6FA 4LBQB 1QKQA 5K0UC 1TE1B 4OHWA 3P5BA 4QHOA 4Z2AA 1JZ4A 3OGRA 3WF0A 1Q8QA 5FZCA 1MEC1 1JH5A 1NA1B 4KBZA 3VBHC 5BNNC 4CCJA 4CP9B 5JSPA 4GMP0 2VUCA 2WL1A 3FFZA 4AEMA 1SLIA 3FBYA 4IEYA 4YM3A 4Z92B 1US2A 1RIRA 4R9CA 3H8OA 4EN6B 5J96B 5JCTA 5JOXA 2JG8B 4KGGA 1FNZA 4GXLA 3ZPOA 1GU3A 1XC6A 1XYPA 1B35B 1TMF1 3U4SA 3WQBA 3ETPA 5JIAA 3RS6A 3HD8B 4BA6A 1UQXA 1R082 3AXDA 3U75A 2IWGB 2R49A 2WYSA 4BLIA 2WZR1 1IKQA 1SLCA 1QJFA 4K6BA 4UWDA 3MEPA 3LOIA 4Q8KA 4S2FA 5CZKA 3ZMNA 4IL7A 4XUTA 2BGOA 3A23A 2BTVC 5FZ4A 5FYMA 3K2OA 1FOD2 5FZMA 2PHWA 1PO21 3UGHA 5EFUA 2I45A 3GALA 4MGIE 3J7HA 1DGLA 2HWB3 5C3SA 5LA0A 1R093 1UY4A 1AYN1 1W2UA 3MIEA 1PO22 4J1XA 4RSUA 1KFUL 3OBRA 2VVDA 4P00B 1W05A 1WCSA 3LFMA 2FHRA 1DG6A 1EV13 4XXPA 3H7YA 1G9FA 3WG1A 5FY9A 5KBFA 2WO2A 2VULA 5FMOL 2E26A 3I59A 1GOHA 2R072 1LOCA 1QH7A 2ZS6B 3JB4C 1S2EA 3MLKA 2XL7A 2JD9A 1LODA 5KWRA 4O9GA 1T6BX 1O6UA 1XBFA 3WDUA 5L9VA 2GN7A 4DNYA 1W3XA 4Q4W3 1ODMA 5DAXA 3B01A 3AJZA 5EJ1B 2PELA 3KV6A 3S6PA 2J1AA 3WF4A 4CCEA 2VW0A 5LZ6A 4FPLA 1RUI3 4XFIA 3SEPA 3USUB 4BZ4A 3WNLA 3M3EA 5FMDA 5J98B 3A0NA 5FDBA 4S2HA 1XU1A 1E5IA 1ZBA1 1O3RA 4CDQA 2R7EB 4A41A 2ZGLA 5FXXA 1HB1A 1AR83 1KDMA 2BVBA 3ETQA 3F95A 4QX1A 3UK9A 1HXS3 4L8QA 1JZ7A 4IERA 5JR7B 1QJU3 5EXOA 3VDBA 3QACA 2P2KA 2WO1A 2C9KA 5FYHA 5GZEA 5LA1A 1DHKB 4JRLA 3T0AA 1W6OB 3U10A 5M0TA 4N53A 3TRSB 3GZTB 2PQSA 2AR6A 5FMCA 4FOQA 4YZ1A 1KJRA 4F8AA 2KA3A 1O91A 3N7KA 2MEV1 4NPLA 2WT1A 1OD5A 2DBNA 1KQRA 1F31A 1OXCA 4PQQA 2EA7A 5CU1A 2HWF2 4P9JA 2RDSA 1JHJA 1UMIA 2RS52 1QMJA 1UN1A 3PMSA 1BK1A 4CEYB 3U0ZA 4YLZA 3WQ1A 2Q30A 4BH9A 2GZWA 1BQPA 1RUI2 3GNEA 5FPBA 5A32B 1OQ1A 1XE8A 2NQYA 5F3IA 4DXZA 1OOPC 1X9PA 2P1BA 3SHRA 1MQTA 4GALA 3UYJA 5BNPA 5C4WC 4HONA 2R061 2P37A 4XUNA 5E1RA 1JODA 2QQLA 1SPPA 1VRH1 2UWBA 4UFIA 4QT6A 5IVYA 4AVCA 4FPYA 5AC93 1G9BA 1DLLA 4CXYA 1LEMA 3JD73 4XFHA 2RDNA 2WNVC 5E88A 3AX4A 4LULA 1VR3A 1OA3A 1UOJA 4CUCA 1O4TA 3EO6A 2ZAHA 3KV4A 4FQZA 5FUNA 3JBG2 4YM0A 5FYTA 4IDZA 1LOAA 1LJ7A 4QKNA 5FZIA 5GM0A 3RZGA 1YJLA 5A80A 5KHHA 2IXIA 5FXWA 1J59A 1FXZA 3RZHA 1EPWA 1DGRN 4DEQA 1VBA3 3C8XA 4BHPA 4V1PA 2CL2A 1K5MA 1W6PA 2OXBA 2UU8A 4A44A 5LWBA 2W87A 1QJX1 2OZJA 2VBBA 3C2UA 4JVAA 2EAKA 1UZZA 2FDJA 4QD2A 4IV1C 1OF4A 2QTWB 1VMJA 1W0PA 2ILMA 4A45A 2XLFA 4P9XA 4YG3A 5CFCB 3TEXA 2QVSB 3NJYA 4M4RA 4TLGA 4TXWA 2AENA 1OQEA 1UO9A 1OI6A 2AH2A 4XBLA 1Q5OA 4RHV3 1X36A 1QF3A 5KHGA 4XEZA 2LALA 3LPFA 3M2MA 5C3QA 4NWWA 4FOYA 2DF7A 1IHMA 5SV5A 3RZJA 1YO8A 1RUC3 4GB32 4NJ4A 4OLLA 1XRUA 4F83A 3AB0A 5ABJA 4GH4A 4NRPA 2LS6A 4IEOA 1QOTA 4UXAA 4XURA 4XFFA 5G05L 3QBQA 5H9QA 5IAVA 5C9AC 3KVBA 1GZ9A 1XOYA 3IPVB 5L19A 4DRRA 4PIXA 5BXXA 1RUG2 3ZO0B 1RVF2 4URAA 1GWLA 1AJKA 5HXMA 4NHLA 2E32A 1VPHA 3CJIC 3K3NA 1GWMA 3VBRB 4AI9A 1RC6A 3GHMA 3IWZA 3HQRA 4CTEA 4BB3A 1MVQA 3E97A 1S4CA 4D69A 4GWJA 4IXLA 1RUE2 4R4ZA 2JXAA 1J83A 3POBA 2AC1A 2BDRA 4HT1T 5CB7A 1ND2C 4BE3A 5DG2A 1WW6A 1LTEA 1WCKA 4LIVA 1LKNA 5FZ8A 4OHZA 1NA1A 3ZR5A 1PX3A 4C90A 1UYXA 4E8DA 3N36A 2WN3A 3CLPA 2JDZA 3H0OA 4YW7A 4B8EA 2CGPA 5B4NA 1KITA 3E6DA 2OIIA 1OD3A 4Q4X3 3DUIA 4AVAA 5BNNB 3AXEA 2A6YA 4HSJA 3LF7A 1Z7S3 2GAUA 5IW0A 4LBOA 1Z7S2 2E53A 5LA9A 2GMMA 2V09A 5I0RA 3ROUA 3HNBM 4LXLA 4LO7A 3CZJA 3RVHA 1ND2B 2WA3A 1FOD3 3GZEA 4UI9L 1DQ6A 2FDGA 1ZRRA 1KEXA 2ZEYA 4ZS2A 2GN3A 4ISRA 1AL0G 1Y9QA 2A71A 2V73A 2VMIA 3EXUA 3JD71 3LB9A 4UFHA 1PGSA 5FZKA 2W1QA 2W46A 4XUPA 3CQOA 4QPIA 2D5HA 3U4XA 1NY71 4Y20A 1CAXA 4CDWB 1YXWA 2ZMLA 4YVSA 3ZFFC 5FO9B 3VD7A 3N9OA 4Q0PA 1X82A 2EXIA 2EVXA 4CZSA 5IVBA 3N7JA 2YYOA 2HWB1 1GFF2 1ULFA 2RHPA 3RZMA 4XF1A 1PGL2 4RS5C 2IFRA 2CGNA 4XTMA 1BEV1 2UYAA 4EWDA 2Y6GA 3MIFA 2EIDA 5C70A 3IMMA 1CZSA 1FNYA 1GZTA 4BQ2A 4LBMA 3SKJE 5LBEA 4MHRA 5JPNB 3EB7A 5FZOB 4ZY9A 1HQLA 3I59B 2TUNA 4FPEA 3FHIB 5LASA 5DAVA 3ILRA 3VBSB 5CFDB 2VBDA 3KT7A 5DUUA 4XDQA 1W8TA 3I2JA 4YVSC 2WDBA 2K46A 2A3XA 3G7DA 1FV2A 3DYMA 5A6YA 3IIIA 1RUG1 1O7FA 2BERA 2ZMNA 3HVDA 1D7PM 3P6BA 4M0NA 3UJOA 2EXJA 1S2BA 3M3IA 1DCSA 2VZSA 2VAUA 1LESA 1W8HA 4I02A 5DZEA 1GNZA 5ERLA 2EF6A 5J48A 3OUHA 3USUA 5AFBA 2HWE3 4KNCA 3PMEA 5T5LA 5KXCA 3PU3A 4LBKA 4JQRA 2VQAA 3MIHA 2D3RA 1V6JA 1QDOA 1A8MA 1GNYA 5BUVA 4L92A 1AR71 5GZDA 4XJZA 2QBXA 3ZPYA 1HN1A 3THDA 1GQPA 2XJTA 2XB6C 4JZRA 2X5IC 4G9SB 2OKXA 3RZLA 2H0VA 5JI7A 1W6OA 2R1BA 3CO2A 2JDUA 5GZGA 3LSDA 5C7GA 3WOGA 1Y3TA 4FPHA 5DAQA 5A7WA 4IV1A 3W59A 4Q0UA 1HDKA 4QDQA 4OZXA 4FPOB 5F5IA 1COV3 4NO4A 4DFSA 2JG9A 2RS11 1EAH3 2MPFA 2YPJA 3DYPA 2WFF2 5H9PA 3A21A 4J25A 3E5UA 4HBNA 2W08A 3KD4A 4FI9A 2WC2A 2Q5TA 2BGCA 4RS5B 1PK6A 4Y1VA 5F3CA 3SC7X 1OBNA 5ANNA 5FYUA 5A3LA 3N35A 2CY6A 4PI0A 1AX1A 4Q4Y3 1W9WA 3OBAA 1VMHA 1D0GA 2F17A 3I54A 1W2AX 3SKVA 1SLTA 4CXWA 4ITCA 5J1XA 3D3AA 4HZFA 2WWJA 1IKPA 1H6YA 5DABA 1X7NA 3W20A 1IGOA 1YLLA 1RUJ3 4RFT0 3LEIA 2EAAA 2PFWA 5F8PA 3WDYA 5C5UA 1MZ6A 2UWCA 2Q0AA 1OMIA 4HK8A 2GNBA 1MS8A 1NCRA 1V6KA 2PMWB 4YRDA 2EXKA 1BVVA 4NHMA 4MXWB 4C1XA 2JDAA 2Q8CA 4AK3A 3W9AA 3RYPA 2OQ7A 3O1MA 3K4AA 1AR82 3AKRA 1AR63 3AM2A 4UW3A 5ISLA 1AX0A 3R4DB 4LEJA 4AHXA 4FTBA 5K7PA 1CVNA 4HPKB 4LTAA 4OUEA 4Y26A 2WR9A 4CEYC 3T30A 4UT5A 2A7AA 5FZ0A 5FZ1A 3D8CA 4LKEA 3WNKA 5JZGB 4ARXA 1ULGA 1O3SA 4Q27A 4Z82A 4CCLA 2B39A 3IDEA 2YPDA 4RR3B 5CG8A 2WT2A 5JLVA 4RN5A 2LRPA 5HBAA 4H14A 4MUVA 1WA4A 3OY8B 4O9EA 5F2SA 4MLOA 4L0PA 4M01A 1EV11 4O65A 2RS31 4BQYA 1L7QA 2VMGA 2D98A 4XPVA 4Y5TA 1MS3A 1TME3 4AFDA 3IPVA 3PUHA 4Y33A 1VBB1 1DBNA 3DKQA 2RS32 4Z8BA 2HKXA 3PDQA 5FWJA 1W2OA 1WUVA 3PUQA 4RYDA 4AI1A 4QPGC 4Y5SA 1RUJ2 2NPIA 2VNVA 1OLME 5A33A 3CMGA 3ZMOA 3B93A 4IEVA 2VW2A 3RMYA 2OPWA 3IMNA 2J1RA 5T54A 1ZBE2 5JMCA 5IVCA 1NCQC 1QHDA 1HRV1 4I2OA 4GIQA 1RB8G 3W5MA 1UOGA 1VBE1 4CU8A 3MW3A 1LHVA 1H1IA 3H7JA 2ID4A 4AI2A 1EY2A 4ATEA 1YFYA 1H6XA 1CAVB 2IXLA 1XNKA 3OBTA 2YUEA 1DYOA 2UY8A 1AR93 2RS13 5AVAA 4LITA 2WS93 4UFJA 4OUSA 3SMHA 4Q8LA 5A7SA 1X8EA 5JPMB 4IV3A 3IB3A 1Q8SA 1H8VA 4QDRA 5F5QA 4CCKA 4AHZA 3QOPA 4XF9A 2Z42A 5I0TA 4J1WA 3FJSA 3JU9A 2GMEA 3HAGA 2DU0A 3J9SA 2YXSA 4JDNA 4BQ3A 4IEWA 1LECA 2VR4A 5HXVA 1ZREA 5FK7A 1OH4A 1SQ4A 4I0WB 5GZFA 2FBEA 1H0BA 1LEDA 2EICA 3ZSEA 2VMHA 1V70A 4HSLA 5HCAA 1JYVA 3I2HA 3WCRA 1BKZA 3LIHA 2ZGPA 5F3GA 3MLLA 2QDNA 4IEQA 5BNOA 3AZWA 4INDA 5GZCA 4AFBA 5HCBA 2AACA 4CDUC 2WFF1 3OPTA 4JGZA 1NZCA 1P8JA 4CPBD 5IK7A 2NYYA 2E6VA 3ZM8A 3POSA 3Q8AA 3ZFEB 1WGPA 2RMU2 1PVC2 3RJ2X 4AVVA 4Q4X1 3JB8A 3MIDA 1UNBA 2P5BA 3FLRA 3CHXA 5FY0A 4EQVA 3NW4A 4UFKA 1H2MA 3O0VA 4YM2A 3VZLA 4DB5A 1H2LA 1KDKA 4XDOA 1YNAA 2KD7A 4RGKA 5FLHA 1F4HA 2YC0A 2VUAA 1AR72 4META 1LHNA 3KHBA 1UKRA 3RWKX 2BUKA 2B4KA 1FAYA 2D93A 1W6QB 2RMU1 3BTAA 4MGQA 3UESA 4AEDB 2QDRA 1CD3G 1PVXA 1H9PA 3RFRA 3FX3A 5FP9A 4A2UA 3FUOA 2YG0A 4R4XA 2A6WA 4I0AA 1A6CA 1BJQA 5EV7A 1LOEA 1YUDA 2WUHA 3CJXA 4ES8A 4QX3A 3C7GA 1COV2 1UMHA 4WV8A 4MZUA 4URTA 5EWSA 3ZFFA 5CKNA 1OSGA 3MLJA 1WMDA 4WVVA 3D0SA 4IEUA 3H1WA 4RQPC 1CJDA 4IE7A 4KQ7A 2HEWF 2C1FA 3LA7A 5I8YA 1GZWB 4WVWA 2OS2A 2OUHA 2CYFA 3KT1A 3LZZA 2YV8A 4YARA 4AQTA 1X9TA 2JG9B 3CKHA 5EP9A 4M3CB 2IFWA 1ZRFA 5FO7B 3WDWA 5DG1A 1I3HA 2D3PA 2Q1MA 3KQ4B 1YYNA 2DVAA 4MGZE 4BLJA 1O8PA 3TEWA 5A3OA 2XWJB 4FO9A 5FOJB 4AGVA 1CN1A 1FYUA 1W06A 3AZXA 4L9BA 1L3JA 3ZFGC 1QQP1 1V6OA 1NOVA 1MEC3 2VM9A 4HN0A 4D6SA 1LAJA 1RYYA 3VL8A 1XNTA 4MG2A 3M7AA 2WNUC 2DV9A 1R083 2ZGUA 2VNRA 2IXKA 1AL22 2QFEA 2ZGMA 3DCQA 3KVAA 3OD4A 4JDMA 1C8M3 4L2NA 2VZQA 5D2AA 1SMVA 4XCAA 5GJ6A 1WLDA 1TQ5A 3VGIA 1U12A 4JC1A 2UURA 2D6KA 3UL2A 5FQ0B 4UBHA 3VN4A 3AMQA 2Z5WA 3E5QA 5JDBA 2WINB 1L7LA 3OTFA 2JEMA 3ACHA 4XQ4A 3WF3A 4FP2A 1WA6X 1J58A 1RUF3 4A7ZA 1NLRA 2NZ9A 2WZR3 3DECA 4GKXA 4JKKA 2VE1A 2WLPA 1TME1 1OOPA 1EPZA 3HWJA 3POWA 2PN5A 4Q4V2 2XJSA 4HPKA 2BRTA 4LOTA 4ZHNA 1EV12 1W6MB 4YZ3A 1IG0A 3BI3A 2BOJA 3MFAA 2NMOA 4HL0A 1CZTA 2ES3A 2FCTA 4BXFA 2VOKA 1YC61 1CAUB 1C3HA 4AF9A 2I07B 4XBQA 1QXRA 2DVFA 4CCDA 1W9SA 1S0JA 3UKNA 1Y9MA 3WNMA 4P5HA 5GLZA 4N8MA 1OH3A 2J1VA 2VZ1A 3UKTA 3DXTA 4GJZA 4HETA 4DINB 4OHXA 2XVGA 3ZN6A 1ZBE3 3H8UA 1R1A2 4GD4A 2QCSB 4KG0A 3WY6A 3ATGA 3I3BA 3T0BA 2J1UA 2H6CA 4B7KA 2BWAA 1HQWA 5FZDA 1DGWA 4DMIA 5BNQA 3VDDB 3WX5A 2ERFA 1UCXA 1QJY2 2O14A 1FT9A 3KMHA 1FPN2 2A6VA 1NKGA 4LKSA 1UOFA 3CBNA 4CRQA 2VCCA 2D6PA 4LA2A 4QKFA 1LGCA 1RUF1 2BNOA 4K7JA 3WSOA 5A3NA 1RUF2 2OT7A 1CX1A 1VBD2 1M06G 1XQNA 3ON7A 1WWYA 4QXBA 2WQ4A 1RUE3 4AXOA 5EJZB 4WZCA 4AFAA 4CDXA 4JTNA 1RITA 2G4IA 3ILFA 4N9HA 3TAYA 2ZA9A 4QPGB 4MH0E 3EJKA 2L9LA 1OVSA 1BVP1 3THTA 3S5QA 3D4KA 2W94A 1IS6A 4IV3B 3AP6A 3T2PA 1KJLA 1PGW2 1FOD1 2GC3A 3T2TA 4IEZA 2G9ZA 2AEYA 5LY1A 2OA2A 1V9U3 1XYNA 1NXMA 2R043 4GJYA 4X8PA 4BK5A 1ZBE1 3KCXA 4Y5Z0 4COYA 2VCMA 3R6SA 4PDWC 5DUXA 4XBNA 5BY5A 2RV9A 3SH4A 2V4AA 1HXS1 2XJUA 1C5IA 4K20A 2PAMA 1H9WA 1DIWA 4OUMA 2WKKA 4TLFA 4LBQA 1D4M1 1RUD3 3NO8A 3WDVA 1GP5A 4JRAA 4ZKTB 1CGPA 1LULA 2B42B 1RXFA 2VNOA 1MACA 3UETA 2R32A 4Q4Y1 2IXCA 2ZEWA 4FPJA 2ZPXA 4Q4Y2 5FYYA 3BYWA 5FXVA 1VBA2 2D7FA 3JUUA 3VV1A 3RQ0A 1REFA 3RYRA 5FWEA 5EHDA 5FPVA 5T50A 3OGVA 1RJ7A 2ZBJA 3ACGA 2ARBA 1TNRA 1UOBA 2BNMA 2JG8A 1F5FA 2ZHMA 1LU1A 4PDWA 4FPCA 2WSVA 5ANQA 1UY3A 2X29A 4NAMA 3ZXAC 4YGBA 1OFSA 4LUKA 2VUJA 2YGMA 1EUTA 1DYKA 4AI8A 2B9UA 1NT0A 2A6XA 1K5MB 2ZX3A 5FZ7A 3ILNA 3VZMA 2F6BA 4D0QA 1DF0A 2C4XA 5ABJB 1OT5A 3DN7A 1V0AA 3AP7A 5FKBA 5BV6A 2GP3A 3OOXA 3ZYIB 2NLRA 1WLWA 2DUQA 4RL7A 1VE0A 2W52A 1O5LA 4XJ8A 4MYEA 1C4RA 1G6NA 4MV2A 3N4MA 5B2GB 3C3VA 4YW1A 4Z07A 3KV9A 3B7MA 2CSGA 3AK0A 1J3RA 1SLLA 4XOGA 5FZ9A 1H8TB 1XU2A 4KU7A 4CP1A 2ZGQA 5D8AC 5LBBA 1TEIA 4XETA 5FCCA 4JAAA 3UGGA 1NX9A 4CDUA 5DMYA 4GMP1 3GHNA 2GMPA 5GKAC 4J6GA 2PHLA 3LIGA 2PHRA 3CU7A 4LLOA 4P14A 4UW4A 4YPJA 4COVA 3NSTA 4HKOA 4UW6A 3ZYRA 3HBKA 3FWEA 1SACA 1DGWX 3LDRA 1NXD1 1J1LA 2AEZA 2VW1A 2SBAA 1O3QA 5A6QA 3ZN5A 3AFKA 4CDWC 4FSJA 5ABJC 1S0GA 3PL0A 2XLAA 4JGYC 3S0MA 1JOPA 5FY7A 2P34A 1BCXA 1RTVA 1V9U1 2Q8EA 1POV0 5JXHA 4PT6A 3AP5A 2Y6KA 2J22A 3RNSA 5A1AA 5IUQA 3ACFA 5BNPC 2KXLA 4ET7A 1FMD2 2MNGA 3MUY1 4LBQD 5A7QA 4Y20B 3WP5A 4YVSB 3PIJA 3KQRA 3HJRA 1OQDA 1D4M3 1RUD1 2JE8A 1ND2A 4XFBA 4LO6B 2JD4A 2DCJA 3V0BB 2XONA 1YQ2A 1SFYA 5EYXA 5A3PA 1U5IA 3C7EA 4LPLA 4NMIA 1HJGA 3C7OA 4N43C 4YZ4A 2VQUA 4XFGA 5C3OA 1E57A 4CEYA 4ZONA 4I0BA 5I93A 3J7LA 1REDA 1VLNA 5FOBB 5IHRA 4QPIB 4LNVA 1XJAA 3WP4A 3SEEA 5I0UA 1PM7A 5A7PA 1UD1A 2JX9A 1BMV1 1AR73 1W99A 2Q8OA 3ZYJB 1S0BA 1W6MA 4JHTA 2A75A 4GB31 5FYSA 5H9RA 3RRDA 4AOCA 1RL3A 4XMAA 5IT6A 2W95A 2BBVA 1MQTB 1QGLA 1ZA7A 2VD7A 2YC4A 5BNPB 1YFXA 2X8KA 5JI9A 2HH9A 4QQ2A 5JSOA 3BU7A 3TNPB 2SLIA 5FP7A 1STMA 3MV11 3WNXA 1O59A 2G9GA 5LATA 4EZ4A 4NHXA 1XNCA 5KC5A 2PLV3 4RA0A 3WF1A 5L36A 2WSUA 5FPLA 1QQP3 3OSDA 5FYVA 4KL1A 4E2QA 3IDBB 4MGTA 2UY9A 3GYDA 4NUBA 3SH5A 5GALA 3E6CC 5FZOA 1K12A 2R16A 3WD5A 1GQGA 3H1YA 1LCLA 3K77A 4FVVA 4XQWA 3VKFC 3ACLA 1W2TA 1UXZA 2GC2A 4OI4A 5FUIA 1GNHA 1MS4A 4X6QB 4CU9A 1KD7A 1ZZCA 1V6LA 4HANA 2QE3A 4E4SA 3NQHA 3PTRB 2TNFA 4QU1A 3M8LA 2ZHKA 4A7YA 1RUG3 4OI1A 5IYYA 1BZWA 1CQ9A 5JXGA 2E63A 1VALA 3O12A 2PHXA 4IV1B 4D6QA 4Z2WA 4XYXA 4YM1A 4XUQA 2YBKA 4Q1PA 5G04L 3WT3A 3RZKA 4CSWA 1Z0HA 2BU9A 1QEXA 2P3JA 1LOFA 2C26A 1FATA 4K3UA 3VBOA 3VKLA 1AR91 1RUJ1 2PLV2 4RHV2 1X50A 4WVZA 5F6LB 5K8SA 1PZ9A 3CJIB 4R9BA 1YIPA 2Y0IA 4A3ZA 3TN93 1AL23 3POIA 4S2GA 4D94A 3VZNA 1C57A 1OUSA 1HX6A 2RVAA 2J1TA 5CKQA 4CEWB 1DDLA 1VRBA 1MS5A 4XJWA 4YYOA 1D4VB 2EXHA 4QMAA 1CZVA 4K40A 5KHKA 3ZFGB 3TYJA 1BXHA 4UOJA 3NJZA 4QX0A 3VBRA 4EYUA 2JB8A 4AR2A 4Q4W1 4XACA 1WW7A 3B02A 5T52A 4C8DA 2JECA 2DCYA 3O0WA 3GZAA 3ECQA 1RVF1 4AE2A 3CZUA 2WWSA 4NROA 1ZX5A 4MGSA 4OYUA 3ZYPA 3KF5A 3ZIWA 4Q0VA 1W28A 3MIBA 5D8AA 4AQ6A 5A3TA 2RS33 5C6CA 2JDPA 1UPSA 2VXRA 4GULA 1N1SA 1KS5A 3D6EA 1PGW1 2ZGOA 3N9PA 2ETEA 3KB5A 5K0UA 1G9CA 4IQPA 4NPMA 5A3WA 1A78A 3WQ0A 3I3QA 2WNOA 5F39A 4YGEA 3MV01 3T1LA 1XNAA 3O1VA 2GNTA 2IVJA 2X5IA 2YFZA 2YU1A 3NKTA 1JZ3A 2ZJCA 3THCA 2RJ2A 5IVEA 3IZOA 4IGOA 4FBFA 5LEKA 4LBJA 4QWNA 5IVJA 5HV4A 2R0HA 4WM8A 1G9AA 5KXDA 5D21A 4FFHA 1K5MC 5J37A 3ZR6A 1DQ4A 1WW4A 3LDBA 3GCXA 2HWE2 3B5LB 3ZIXA 1IS5A 3TWIA 2HEYF 4HXCA 2QQWA 2WO7A 2R071 2XHKA 3HQXA 4QQLA 2P17A 2Z4FA 3A7QA 5E89A 5I8SA 4E4HA 3O1OA 4GAZA 1CAXB 4P9YA 3IBMA 2W9XA 1DYPA 5C4WB 1ENSA 2ZHNA 1PMJX 3D82A 3VHOA 5EZWA 2G19A 3WINE 4BXSV 5E8AA 1PK6C 3D0JA 1KFXL 1GWKA 1PVC3 4FPGA 5A33B 1UWWA 5FPAA 3T09A 2VZUA 4XHBA 2K9ZA 3WW3A 5F1RA 3O1TA 2XL9A 3BODA 1WD3A 3HQUA 2A3YA 3NV1A 5FZGA 1VBE2 4M3CE 2X53S 5J7MA 2P6HA 3GBGA 3LE0A 3T0DA 4PI2A 1MZEA 1RMU1 1REEA 4NIDA 3OEBA 4YZ2A 3SITA 4KH9A 4LQRA 1LU2A 2BYVE 3WW4A 1VBD1 4CDUB 2XVKA 1I5ZA 3VDDC 3PHMA 4FXGB 1YRZA 2IUWA 2WA4A 4Q29A 4C1WA 1ULPA 2HWD2 2VMEA 1WCQA 4N7UA 4ASKA 1SBDA 3I8TA 5LBFA 5LW9A 1ONAA 1O3TA 3E6BA 1IOAA 1VBB2 2ZZQA 3PUSA 4OHYA 3BGAA 4LOSA 2FDFA 3KHCA 1K3IA 1HRI1 3TB0A 3JCIA 4DY3A 3ZXLA 1D2SA 3PVBB 2WFF3 3UKVA 2VU9A 3N9QA 2QQJA 5F9TA 2HWF1 1PM4A 2ZCWA 3RSJA 4P02B 4YW3A 1JYNA 4OFGA 5FUPA 4GWIA 3S7IA 1O4YA 2E7TA 3AMMA 1QJEA 3WP3A 5FP4A 1QOOA 2ZHLA 4DO0A 2OYZA 3DV8A 4SBVA 2CDPA 1UXXX 1F5JA 2BBAA 3B00A 2EIEA 2VECA 3NV3A 1N3PA 1V00A 3WW2A 3ZYFA 4LLFA 4UAPA 3DGTA 2J7MA 1NCQA 4KMQA 2Q8DA 2R063 1C1LA 4QXHA 3SCFA 2J42A 2RM23 2FDKA 2RR13 1YQCA 4A7KA 1J3QA 5A7WB 4MADA 5FK8A 1A8DA 4JGZB 4LHLA 2TEPA 4QU2A 3OGSA 5FREA 1J1TA 4CYDA 4Q4V1 3H8RA 4FAGA 1AJOA 3IIAA 4XXAA 4ASLA 4BQ5A 1TME2 2V72A 3BN6A 1APNA 4G3YC 1W39A 3VBOC 2W47A 1YCIA 3WF2A 5FMBA 4R9DA 1X8MA 2EIGA 2JKXA 3POYA 1DLCA 2N7GA 3UT0A 4HK9A 1OFNA 5FZAA 4B1MA 4RS5A 3CEWA 1NY72 2RE9A 3FN9A 4OI0A 4B4RA 4GA9A 5C9AB 1NYWA 2VTFA 4CE8A 4Y1XA 1AHSA 1RMU2 4FFFA 5CISA 1VAKA 1GICA 4C0HA 4EROA 4P5YA 4BU2A 5E16A 4XFAA 1WLTA 4DPNA 4EZHA 4W65A 5HI0A 2ZX2A 4AVSA 4K1ZA 4QHZA 4K9SA 4Q1RA 5GLUA 5FKCA 1HV0A 1COV1 1CWPA 2LUWA 2D5FA 4DZGA 4FP3A 4YFWA 3NV2A 4Q26A 4XF0A 5CFCC 1RJ8A 5FPUA 4IW3A 4XVHA 4ISQA 1JYTA 5BNOC 3TNQA 1YFWA 5IVFA 1UU4A 1VMFA 3ZXEA 3DPRA 1DQ0A 2ADDA 1BHGA 2GNMA 1QXPA 5A7NA 3KGZA 4Y3OA 1RUOA 1UAIA 4XQDA 5IFPA 1ZYBA 1U0AA 4LIUA 5F37A 3ORJA 3VLBB 1C8M2 5JSRA 4CXXA 5DQ0A 4Z1VA 1R081 4GQ7A 4PHZA 4W8JA 4AWDA 5C3RA 4ZU5A 4XIOA 3VBUA 3FL7A 3I7DA 1XE0A 5JR2A 3VKOA 3NVCA 2VQTA 2VMCA 2B5HA 1PZ8A 1IG3A 3UNPA 3ACIA 1PMIA 1NLSA 2VOWA 3NAPC 4M3CA 1RHI1 2QQKA 2GC1A 5IK8A 3MF6A 3BPZA 1HQNA 4TYSA 1NLQA 3LKJA 2QQMA 1AYN3 1W8UA 4QX7A 2J1EA 4V2VA 3SXWA 3OY8A 4BMEA 3OGJA 3VBFB 2BV4A 4BK4A 4F7ZA 3N7MA 4CCOA 1GZWA 4E9KA 2DCTA 4ZXEA 1JXNA 2PTMA 4D8MA 4NIGA 2JG9C 5ACA3 3CF6E 1XNBA 4RR3C 1W8ZA 3WHTA 1XE7A 2MHFA 5CG9A 4YNIA 3LPGA 2JWPA 4F3JA 2C0ZA 3LQCA 3LDKA 5HCFA 4BOWA 1UZ0A 5FAXA 1E5SA 1EYBA 1HRI2 1S55A 4K21A 2VUDA 5FQ0A 1CPNA 1RINA 3H3LA 4WM7B 5C3PA 1FX5A 2V4VA 2XBO3 3OYWA 3MW2A 4AQ2A 5DDJ2 5D8AB 3QCWA 3WV6A 4RGGA 3IDCB 3T4VA 4B1LA 1H8TC 2HEVF 4EWEA 4OQ9A 3J7NA 4ZU7A 1IQAA 1PNGA 4LK7A 4P9WA 1UF2C 1UZYA 3WCSA 1F8VA 1DQ5A 4FOWA 4JCKA 2PYTA 2ET1A 5T55A 5LK7B 3LD8A 4LUMA 3ES1A 4ZS3A 5L9BA 3Q8CA 4KI5M 3I2IA 5DXDA 2X5IB 3KV5A 1POV1 3V0AA 1ZRCA 2XQRA 4FTSA 1ASJ1 5FMOS 3PJYA 4YVWA 1LGNA 3BCWA 1NE4A 4AG4A 2CDOA 1W8FA 5JXJA 1J3PA 2UYBA 2W1WA 4OZOA 2VNGA 4ZPIA 5KHIA 1GMMA 4XABA 5I8TA 2HJIA 4QAWA 4W50A 3PU8A 4PLNA 3VZJA 1ND3C 3AVRA 3ZLIA 2Y38A 3L2YA 2B9VA 1E5RA 1ZM1A 2D3SA 3UV9A 2Z69A 3I3MA 4NR1A 1ZNPA 1LR5A 3NNJA 3GBFA 5ACA1 5L7OA 4D7TA 3S57A 4QGNA 5C4WA 5IFTA 3NRUA 5FLIA 3LA3A 3AKQA 4HOOA 1BEV2 5HCHA 3WZ1A 2E9QA 1OA2A 4XZPA 1BYHA 1SDDB 4ONUA 5F5CA 5BNOB 2G1MA 1HRI3 2JDNA 3SISA 3ZVXA 4YVWC 2QNKA 3T1MA 3ALQA 4Y4RA 2VMFA 5CADA 1LGBA 2VVEA 3K75B 4IESA 2BQPA 3I3EA 3BU0A 3FLPA 1AR61 3VHRA 5C8CC 3OEAA 3BTXA 2BGPA 4Y22B 5AFEA 1ZA4A 4LE4A 1UX7A 4Y4YA 2AREA 1VBD3 2A70A 1CESA 4JKMA 4FXKB 4LORA 1HN0A 1POQA 1F2NA 2XKPA 2W39A 4R8HA 4FCAA 1S2KA 3CIHA 1EP0A 3W58A 5LEJA 4KWJA 4QPGA 1YJKA 5F5AA 4BQXA 2TBVA 3AMHA 3B9CA 2VZRA 1CPMA 4DEVA 2ZGNA 2W1UA 2VG9A 1Y7BA 2ZOEB 4GKYA 3ZSMA 4E2GA 4HVQA 3IT8A 3UJQA 1AX2A 2CWSA 4RFRB 2GALA 4PBPA 2DUOA 2RR12 5FJHA 3RDIA 5E6HA 3RJRA 3T2QA 2I2SA 1WCUA 1ENRA 5APAA 4DXTA 1V6IA 1B35C 2FDIA 1MQTC 2QQIA 5C8CA 4KU8A 1GOFA 3ZOIA 2QQOA 4JGZC 1QJU1 2WRAA 2ZEXA 3SNMA 2VMDA 3NNMA 2BZDA 2FMDA 4AEJA 1T6GC 1Q43A 1PZ7A 4QXCA 4M3CF 2ZKNA 2VOTA 2VL4A 1TNFA 2HWC3 3GBWA 1NCQB 5FBJA 3N9NA 2XDVA 3ST7A 3WUDA 1V9U2 1HXS2 4XF3A 4DUXA 3NJXA 5JUVA 2DUPA 2DU1A 2JE7A 3H3ZA 3LFIA 3VBHA 5J3UA 1YI9A 5FXZA 3J8F2 3KCCA 3OG2A 3DF0A 4K8RB 3K51A 3U07A 3AYDA 2Y8KA 4CUAA 3KLSA 2RDRA 4AAPA 2J1SA 1RUC2 1W0NA 3I2FA 4GB33 5FZLA 2JIJA 4MVTA 3V64A 5FZHA 3Q9OA 5DPNA 4EN8B 2JDHA 1SFNA 1FPN3 2WNVA 4NOTA 1PMHX 3W21A 4XCBA 2GNDA 2ZX1A 4JGYB 2WFPA 3OF1A 1MPXA 4AHWA 1TG7A 1VRH2 2Y33A 2YFUA 4TWTA 2R062 4COZA 4JX0A 2LTNA 4MGKE 1A3KA 3FUQA 2VY0A 2P3YA 4N43A 5JZGC 5F2WA 3OPWA 2WS91 4IE5A 1VBC1 5A7OA 2P4EA 1MR5A 1ENQA 4BDVB 2BFUL 4QKBA 2ET7A 4IEXA 1N1TA 1WLCA 1R1A3 2JICA 4KGQA 1ULOA 1S0IA 1Y4WA 2HWC1 2X09A 2XUEA 3DEMA 4YFZA 2VXJA 1RUH3 3B69A 2RR11 3N9LA 3R05A 1H8TA 4EWAA 3FLTA 4NHKA 3AP4A 3BOWA 3POFA 3IAQA 4Q4V3 1MS9A 2ORXA 5IVVA 1GV9A 1NE6A 3NJVA 1O5UA 1L7RA 3LCPA 3ZYGA 1MS0A 1HB2A 1QIQA 2WAOA 2ZGTA 2VVFA 3P3PA 3Q8FA 4G4FA 3MDPA 3I3DA 4ATFA 1W90A 4B4PA 3BKZA 4LR4A 4QX5A 1ZZBA 3AYEA 4P08A 4BCUA 4NWVA 2QQPA 4AAXA 2WJSA 4UF0B 3R4SA 5DZGA 3LGRA 1SCRA 2A6ZA 3BIWE 1ULEA 5DAWA 3ZN6B 2Q1FA 1FMD1 4KWKA 5I0DA 1ND3A 4NAOA 1LHWA 2CAVA 3EHKA 1CAWA 2W91A 3AP9A 2ADEA 3BUCA 2XJQA 1G9DA 3MGUA 4FAHA 1KGYA 5D1IA 4NIHA 4DS0A 3H1MA 4LK6A 3ITQA 4AHYA 3OJBA 4D7SA 3R4UA 4YZ5A 1V6NA 1S0DA 2DTYA 4LA3A 5J09A 1OKQA 2E31A 5FYZA 1ZZ8A 4WM7A 4N53C 2BEOA 3WEZA 1BBT2 2YZ4A 3K4ZA 4GWMA 3CL1A 2IC1A 4OHVA 3ZXDA 5F6KA 1ALYA 4P9GA 4IE4A 4E4ZA 2AUYA 1W0OA 1UZVA 1ZZ7A 2Y60A 3AJYA 5CBLA 5FY8A 1K42A 2VOVA 3I4IA 5FIXA 5IAXA 4NVPA 1IPSA 4CDXB 3GJBA 3MUZ1 4BIFA 4M00A 5GLTA 1U5ZA 2XJRA 1Z7S1 3KCYA 3K4DA 2O8QA 4JDOA 4FQ4A 4COWA 1YQ6A 5KHJA 1JZ8A 3V0AB 3VBFC 1LENA 1AVBA 4AEKA 1J84A 3FBMA 3V0BA 1DGRA 2VJXA 5LRSA 3I2OA 2ORZA 2RM21 3O0XA 4LE3A 1SBEA 5FV3A 4AYUA 1LOGA 3AKSA 1F4AA 2XGXA 1GKBA 5FY5A 4LO8A 5IATA 2VTXJ 4CPBA 3EYPA 2PHFA 2ZXQA 2R073 2DDUA 3ELNA 3FFQA 3GF6A 4B4QA 3TEZA 4E27A 1Y43B 1JBCA 4XJ9A 2W5FA 3GM8A 1ZZ6A 3EBRA 2JDMA 1N47A 1HB4A 1W9TA 3WXPA 1QDCA 4OCTA 5JIUA 2YHJA 1QJY3 1OHFA 5BPXA 1HRV3 1O4ZA 2HYKA 3I97A 2B7YA 1GP6A 5F3EA 3TOJA 3FHQA 1I5PA 4XZUG 2VQ0A 2R041 2RMU3 2D6NA 4R52A 4CVUA 2VOXA 3OBZA 4CDQB 1R092 4HN1A 2DYCA 1VB4A 1JW6A 1RUD2 3BOPA 3E1F1 4PDWB 4UW5A 1WMFA 4NIIA 1W9YA 3J26N 4QQPA 3INAA 3GGLA 3ENRA 2KM2A 4CCNA 1POV3 2B8MA 4XHXA 1T2XA 1WBFA 1HIXA 3TBDA 1XNDA 3ZSLA 3U14A 4HVOA 1F9KA 2B45X 1VRH3 3E5XA 4IV3C 4DOUA 5AC91 1PX4A 4H7MA 3NAPB 4I09A 5CKMA 5FRAA 3SQOA 1QJX2 2FD8A 1KXGA 1BLZA 2C9AA 2DURA 2EALA 4Q4X2 3UGFA 5FYBA 1RXGA 5JAXA 2R0FA 2DWRA 1SLAA 4GH4C 2YY1A 2WLQA 3HNYM 3W5NA 1CR7A 5FZBA 2R042 5T5PA 5JMOA 5C8CB 4LKFA 5JWPA 2PAKA 3VBOB 4RQPA 1NG0A 1A34A 3L2HA 4QB1A 3T4HB 1QNYA 4DQAA 3JBG1 3QH7A 5DUVA 5J36A 2CHHA 3QLQA 3CJIA 2X05A 2QZ3A 5JOWA 2HWC2 2D6LX 2NM1A 1WKYA 4XJAA 2JG8C 5LRRA 3J8F1 3PURA 4LO5B 2E7QA 1UYPA 2WS92 5DZFA 3SCGA 1YI7A 2PHTA 3WQ7A 4CEWA 1QQP2 2JDYA 1OUXA 2HBUA 4I01A 4QHBA 4CP9A 2VC9A 1NA1C 1UYZA 2V5YA 4I30A 3PVOA 3NNGA 3VBHB 3ZDSA 1JU3A 3ZFGA 4DY5A 3AVSA 2XWBB 4JTOA 1OVPA 2DBIA 2VPVA 2W2IA 4QGMA 5FP3A 4QQOA 3VD3A 3WDXA 1UY2A 1F35A 4LHSA 1UY0A 3NKGA 2D97A 3OD0A 4H3WA 1PO23 3LA2A 2RM22 4BM8A 1TZOA 3AYCA 2XUMA 2FDHA 2WNUB 1W8NA 1FPN1 3B3QE 4KWLA 1UKGA 2BWCA 5T3NA 2P3IA 2WNVB 3THPA 2PHUA 1OC1A 1W2NA 1NUKA 4BYYA 1RUC1 4LT5A 5A6XA 4DRVA 4E8CA 2WZEA 2DVBA 1PO11 1I6XA 4UYBA 1DZRA 4XJUA 1TVGA 3OPZA 4YW4A 2WZ8A 1GLHA 3RPQA 5IK5A 2GP5A 3IDAA 4OVEA 4CDQC 3OUIA 2QJVA 1S0EA 3KZ4C 5CFCA 1HB3A 1XSRA 2XVLA 3O14A 4EN7B 1HRV2 4PLOA 3RMXA 5FO8B 2ZGKA 5F32A 1B35A 3AKTA 2VCAA 4PIZA 3MIGA 1H2KA 5FTTC 5C71A 2KR2A 3A0KA 3OUJA 4WM8B 3BPSA 1GBGA 3PJQA 4WM7C 3N7LA 5FZEA 4BWOA 4ORFA 2A1XA 5KR7A 1DZQA 2IVIB 1X33A 2YB7A 2ZACA 4O7XA 1ZBA2 4WVMA 5A3UA 1IQDC 2ZGSA 2DTWA 4PLMA 3FZ3A 2GC0A 1FMD3 1URXA 5JXIA 4V2WA 1ST8A 4DIQA 3AC0A 1ACCA 1IPJA 2XG3A 3WNNA 4AGRA 4CU6A 4EE2A 4RGAA 1IS4A 1HJFA 4LHKA 1W3VA 5CEHA 1M4WA 3DL3A 3NNLA 2QUOA 4B3NA 2VGDA 2VTXA 2Y64A 2W92A 4AEDC 3H3UA 4PBOA 2WWUA 5FPZA 3AL5A 1LRHA 1Y9GA 2DCKA 2WYFA 3ZSJA 3WVJA 1C5HA 4XIKA 1GP4A 2Z79A 3ABZA 2FCUA 4YW5A 1AYM1 1LOFC 4ZZ8A 1QXJA 3FMGA 2ZX0A 4ZZ5A 1QWRA 1BBT3 4QM8A 2GH8A 2E51A 1AR81 1CAWB 1DU3D 4EN9B 2Z2SB 3U78A 4W6YA 5BNNA 2A5ZA 5C8WA 2AGSA 4KBBA 4BIOA 4P9IA 2R30A 3LSEA 1RGSA 4TSVA 1QU0A 3I49A 3GJAA 2YU2A 4WM8C 5FP8A 1OLMA 3A4UA 3M3QA 1AUYA 2F4LA 3PUIA 1G7YA 1AXKA 4IGQA 4N53B 1W9FA 5IWFA 3J8F3 3U37A 2D40A 3R0RA 3RYKA 1VBC2 3URFA 2JIGA 4E4DX 2O8OA 2QQVA 2H6BA 4EJRA 3MICA 5DDJ1 1SHWB 4TZDA 3VD9A 5L73A 3GXUA 4Y1YA 4YGDA 2ARAA 2FZ1A 2ZX4A 4X8NA 2FQPA 3ZN4A 1WMXA 4A3XA 1SG3A 4QB2A 1SFPA 2OPKA 4C91A 4EV0A 4XC9A 4S2DA 5A32A 4BPZA 3POJA 2P3KA 1JZ6A 1QOSA 3PVNA 5FLJA 3VDAA 2GH2A 1SBFA 2XJPA 1ASJ3 2ZEZA 2XQXA 2YC2A 3J4UH 3ZDVA 4QXKA 4IETA 3RG0A 3BTZA 2BJSA 5I91A 4Q2FA 3K46A 5HV0A 2LROA 2RS12 1AYM2 1GR3A 3LEKA 1JTZX 4N9IA 2G9FA 4MO3M 3AFGA 4YSFA 2YDEA 2WO3A 2WT0A 2YROA 3MFCA 4MX3A 2ZTNA 4YW6A 4U36A 3JQWA 3ES4A 5CVRA 2XMLA 3WG4A 1W6NB 1QNWA 1JOJA 3KF3A 1RHI2 1RUH2 2ZKLA 5CFDA 3VBSA 1QJZA 3DXUA 4I3PA 2DCZA 4CU7A 1Q3EA 3C7HA 1PIV3 3HBZA 1SPPB 1NZIA 1GQHA 2FCVA 4DXRA 3HT2A 3LWCA 2ZABA 1W6PB 3MW4A 1YQ5A 4GZ9A 4XILA 5K0UB 4N7IA 2Y6LA 1SZBA 1FI2A 4M0HA 3KSCA 3HR9A 2XXZA 4CA9A 3VBUB 2YBPA 4W6WA 4DUWA 3BALA 3VKMA 4CCCA 1JU4A 3RI8A 2WZPP 3ZKUA 4CUGA 1MVEA 4RHV1 3MYXA 3GCWA 3P3NA 3PNAA 1OKOA 4FFGA 3M3OA 3AMNA 2ZZJA 1WBLA 5DUWA 3WG2A 3AZYA 3DPRB 3FC0A 1HV1A 4PIYA 3WR0A 4B7EA 1C28A 4XMIA 2YMZA 2I74A 3EMRA 4Q4W2 4CCMA 2RJKA 3LEMA 5FFOC 1H4GA 1Q8OA 2D6OX 2LM3A 2Q4SA 2Y6HA 3VBFA 4ES9A 1RMU3 1H2NA 4OI2A 4QPYA 3POGA 3ZX7A 3Q8EA 4W4ZA 5SV8A 4EN0A 5F7UA 4HMZA 2CWMA 3J7MA 2H0BA 2VCBA 1PIV2 3M4FA 2PAEA 3HN3A 1I1EA 1NCRC 1Q56A 4P9LA 4QPIC 4QB6A 1JOBA 1UW8A 2IXJA 3AMPA 4UFLA 3ZXKA 1JYWA 2OX0A 1JHNA 1RHI3 3O1PA 2A3WA 5T5JA 4AI0A 1S0CA 3N3HA 5DN2A 3RGBA 2CU5A 1PK6B 1U5YA 3WNPA 4YWAA 3N9MA 4QGLA 3OYWB 4GH4B 2XOMA 3APBA 4L99A 3HN1A 2IZWA 3HT1A 4MXVA 3VD4A 1ULDA 1WD4A 5EYYA 1DP0A 4PF1A 2XBO2 2QQUA 3SCHA 4L11A 1BK0A 3MHZA 5KXEA 2OQ6A 1EAH1 1DFQA 3VL9A 2V5DA 1DZTA 4XFCA 4HLTA 3VBRC 4JHZA 2R1DA 4L97A 3VB9A 3PIGA 1LNSA 2JJ6A 1G8WA 2VZTA 2WNUA 1VP6A 4H7LA 1E5HA 4WBBA 5LK5A 4LO4B 4AFCA 5JVVA 1C8NA 1GSLA 4NE9A 1N1YA 1ZRDA 2D6MA 1JMUB 3MPBA 4N90A 4NPRA 4QM9A 1KS4A 2NN8A 3ZKYA 5EJ3A 1AXYA 5AC92 5KXBA 1VBB3 1XYOA 1R64A 2Y26A 3ZXJA 2VO5A 1UU6A 5TSWA 3JZVA 1W8WA 1GYKA 4CDWA 2HWD1 1VBC3 3NMBA 1ODNA 4YGCA 1RVF3 3AZZA 3MF9A 5FY1A 4KG8A 1OURA 1YFUA 4YVWB 1AXZA 2YBSA 3ME2A 3AYAA 1BEV3 2XH6A 1OLRA 2OW4A 4HKWA 2Y0OA 2E7AA 2X10A 5EPAA 4WVMB 4K8FA 2RS53 4K1YA 2HWF3 2CGOA 2A73B 1VBE3 2DFCA 3AKPA 2GU9A 4QPWA 1Q8PA 5CYYA 1JUHA 1H30A 3B94A 1VAMA 3HIFA 3OGGA 4YG0A 4D3WA 1ZRIA 3ZXGA 5A1FA 2VZ3A 2WN2A 3LEGA 4FT8A 5FR3A 1I9RA 2CAUA 4NRMA 2BVVA 4CEWC 5L7OB 3K3OA 1V6MA 4YW2A 3O7OA 1UMZA 1MS1A 2K0GA 1PNFA 1W04A 3O1RA 2WNEA 3O1UA 5C9AA 4FPFA 2YGLA 3SH3A 4CDXC 4HKLA 4LHNA 4QX8A 3BIEA 4D6RA 5LBCA 4DUVA 2CNAA 4LBLA 5IJRA 1JS9A 5DDJ3 3WDTA 4H55A 2OZ6A 4OMCA 4AFMA 2HWE1 2BFUS 1H1AA 2WAAA 4Y22A 3GZUC 1F15A 1ZBA3 4XDPA 2XKOA 1C8M1 4B29A 4M4PA 1CAVA 1R1ZA 3VBSC 5CFDC 1S0FA 1XB9A 2O1QA 4XF4A 1JYXA 1N3QA 5I0SA 3CDZB 2OUJA 2PA7A 5FYCA 1TMF3 2C6SA 4QKDA 4ZU4A 4CP0A 3FHAA 5DAPA 4NIAA 3F2ZA 2ARCA 1VIWB 5FYIA 5KC6A 3OCPA 1OPMA 3BVCA 3USSA 4IE6A 1UIJA 2C24A 1UZWA 3QH6A 1UPIA 3KGLA 3M70A 3WP6A 5EQUA 3T2OA 4FOVA 2XPJA 1H4HA 4OULA 3U1XA 5K4LA 5CNAA 1WW5A 4MSVA 3HPNA 4LBNA 3OB8A 5L9RA 3VHNA 3TN92 3ZXFA 5FZFA 2JB4A 1VB2A 3CNAA 1US3A 3L9JT 4XTPA 4A6SA 1D2QA 2F4PA 1Q8VA 1XXNA 1QJU2 4NRQA 1NQDA 1W8OA 4JKLA 1SDWA 4AI3A 1JN2P 3PLQA 3ZYHA 3HOBA 3S7EA 5A3MA 1YQ8A 3DKWA 3VHPA 1ZZ9A 2JDKA 3KS7A 2B46X 4LMFA 4XE9A 3H50A 2AZ5A 4N43B 1W6NA 2ZMKA 1LB2A 3I2GA 1CIWA 5LY2A 2WQ8A 1NAEA 4IUGA 4ARYA 4GWNA 4AW7A 2JKBA 4WZFA 3HNMA 2XHNA 4KWUA 1NCRB 2D43A 2GSYA 4JGYA 3WNOA 2UWAA 3VZKA 3ZSKA 4UBGA 4MXWA 2Y6JA 3I2DA 3AL6A 1UYYA 3IAPA 4BQWA 2ATFA 4LKDA 4BQ4A 2JE9A 2ZGRA 4PQ9A 3S30A 1AF9A 1QJX3 3NNFA 3LOBA 1W6QA 1CIYA 1MZ5A 2HYXA 1KRIA 4NHYA 3RZZA 3MPPG 3T08A 5K9YA 1MZFA 1AR62 2XJVA 3P1IA 3JQXA 3NV4A 2VBPA 2BW8A 1N3OA 5EIYB 3GDBA 4XW3A 1OF3A 1K5JA 2IXHA 3VZOA 4COUA 3HMYA 4JV4A 4IEPA 4RR3A 3TN91 2HWB2 4FPKA 2HLEA 4Q5OA 5JOYA 2D44A 1G86A 4YG6A 3QD6A 1ULCA 1RUH1 2VZVA 1AR92 1UIKA 3ZYBA 2BOIA 3WG3A 5A1LA 5LB6A 4IGPA 1JZ2A 1RUNA 4R9AA 5CA6A 4MHUA 5JZGA 1EUUA 3O1SA 1JUIA 2RJLA 2C5DA 2PXJA 3SLIA 4BMBA 3M1HA 3JBG3
chains in the Genus database with same CATH topology
1OXCA 2JDKA 1GZTA 2VUDA 2BP6A 1W8FA 5A6QA 5A6ZA 2CHHA 1UQXA 2WRAA 5A3OA 1UZVA 2JDHA 2BOIA 2JDMA 5A6XA 1OVPA 2BV4A 5A70A 1OVSA 4AOCA 2JDPA 2JDUA 3DCQA 2JDYA 1OUSA 2BOJA 5D2AA 1OUXA 2VUCA 3ZDVA 4CE8A 5A6YA 5HCHA 2WR9A 2XR4A 4UT5A 2VNVA 1OURA 2JDNA 1W8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OXC A;  2JDK A;  1GZT A;  2VUD A;  2BP6 A;  1W8F A;  5A6Q A;  5A6Z A;  2CHH A;  1UQX A;  2WRA A;  5A3O A;  1UZV A;  2JDH A;  2BOI A;  2JDM A;  5A6X A;  1OVP A;  2BV4 A;  5A70 A;  1OVS A;  4AOC A;  2JDP A;  2JDU A;  3DCQ A;  2JDY A;  1OUS A;  2BOJ A;  5D2A A;  1OUX A;  2VUC A;  3ZDV A;  4CE8 A;  5A6Y A;  5HCH A;  2WR9 A;  2XR4 A;  4UT5 A;  2VNV A;  1OUR A;  2JDN A;  1W8H A; 
#chains in the Genus database with same CATH topology
 4MGY E;  2W0X A;  4BQ1 A;  5GLW A;  1BMV 2;  5LA2 A;  1ASJ 2;  4SLI A;  1AZD A;  4TN7 A;  4PCR A;  1R1A 1;  1WCD J;  3DYO A;  4QDS A;  4UF0 A;  4ASM B;  3HEI A;  2CTV A;  2OVU A;  1LOB A;  3D5O A;  3LAG A;  1AYM 3;  1GAN A;  5A6Z A;  4FTE A;  3MZH A;  4QQH A;  1W03 A;  5CIR A;  1ND3 B;  3NL1 A;  1SLB A;  2PQQ A;  1YIF A;  2WBK A;  3VD5 A;  2XLG A;  3WHU A;  1JYC A;  3BTY A;  1VJ2 A;  3KWV A;  4GMP 3;  5C33 A;  3X29 B;  1B09 A;  3IKW A;  2ENR A;  2WZR 2;  3PUA A;  3Q8B A;  4XAE A;  2HWD 3;  3B9I A;  5AVP A;  1N1V A;  1YEW A;  4W6X A;  4Y1Z A;  1VAV A;  2VH9 A;  3KT4 A;  3H42 B;  4Y24 A;  2QZ2 A;  4C0B A;  5FPX A;  3A22 A;  4A42 A;  2O0O A;  4AVB A;  5BYN A;  1TMF 2;  1IPK A;  1PHM A;  1QJY 1;  4QX2 A;  2NMN A;  2RS5 1;  1C1F A;  4Q0S A;  2MEV 3;  2W1S A;  1HLC A;  1UL9 A;  2BP6 A;  2AYH A;  2DVG A;  3H8X A;  2ZAA A;  1ENX A;  4TTG A;  5FBZ A;  1XSQ A;  2W3J A;  1OOP B;  3BB6 A;  4H2A A;  1FV3 A;  2VZP A;  3G6J B;  4DXS A;  1DQ1 A;  1QH6 A;  1CX4 A;  5IK4 A;  1MEC 2;  4O61 A;  1GUI A;  1WZX A;  4U2A A;  4AL9 A;  5FJK A;  2EIB A;  1UY1 A;  1JZ5 A;  1CAU A;  4Y1U A;  5JOZ A;  2CV6 A;  1AL2 1;  1QY4 A;  2XBO 1;  1OPO A;  3MBW A;  2FZ2 A;  1S1A A;  2R6Q A;  1PO1 2;  2E33 A;  1IZ3 A;  2W68 A;  3O5S A;  4AZZ A;  1O8S A;  3MO4 A;  2Q1Z B;  1OLQ A;  2P6C A;  4D7Y A;  1H1M A;  4OMD A;  4HFS A;  1SCS A;  3ZFE A;  2HBT A;  4MOA A;  5B4X A;  5L7O C;  1UU5 A;  1PGL 1;  3VKN A;  5H9S A;  1CJP A;  2WQZ C;  3PTY A;  3H9A A;  1UX6 A;  4LJH A;  4X6R B;  3IM0 A;  4HVR A;  4UFM A;  5ACA 2;  3VDD A;  4CUB A;  2NP0 A;  3RWN A;  5LCW L;  4XUO A;  4PF5 A;  1PIV 1;  2WAB A;  3WLU A;  1OA4 A;  3MI8 A;  4HG6 B;  5FZ6 A;  1HW5 A;  4BIS A;  3WUC A;  5T5O A;  2PLV 1;  2XR4 A;  3JD7 2;  3VDC A;  3VUO A;  3FE5 A;  1JYI A;  1EAH 2;  1ZVF A;  5FY4 A;  4A4A A;  5HPO A;  1CON A;  3POE A;  2VZO A;  1YHF A;  1DQ2 A;  3PVE A;  4RD7 A;  1BBT 1;  2QQN A;  1AYN 2;  4JQT A;  2K2S A;  4I3G A;  4BJ0 A;  1WME A;  3I2K A;  2QKD A;  3KM5 A;  3ASI A;  3IN9 A;  3V65 A;  4AVT A;  4NN0 A;  3ZFE C;  1HKD A;  4RQP B;  2RDQ A;  1GOG A;  4A6O A;  4ZXK A;  4IE0 A;  1K45 A;  3NWK A;  2LW8 A;  4Q0Q A;  1LHU A;  1SEF A;  3JXS A;  3M3C A;  5C5T A;  4CP2 A;  1NQJ A;  4AQS A;  4XAA A;  4FFI A;  5A70 A;  3WW1 A;  3ZFF B;  3NAP A;  1D0H A;  3S5A A;  1U5X A;  1VBA 1;  2RG4 A;  1RUI 1;  3TEY A;  1PO1 3;  2ARX A;  3C7F A;  3RI9 A;  4AED A;  1JI6 A;  4AGG A;  3DPR C;  4E2S A;  3U11 A;  1LHO A;  2BNN A;  4PJY A;  1RUE 1;  1YWK A;  3K48 A;  1D4M 2;  2Y34 A;  5FZ3 A;  4OQ8 A;  2BPA 2;  2FMY A;  2MEV 2;  3V56 A;  3AZV A;  2JEN A;  2PHD A;  1XPW A;  5GLV A;  5CAZ A;  3VBU C;  1GZC A;  3EQE A;  1PVC 1;  3T3Y A;  2WII B;  1IS3 A;  1Z78 A;  2DFB A;  1R09 1;  2DVD A;  2GDF A;  2Y6F A;  4LBQ B;  1QKQ A;  5K0U C;  1TE1 B;  4OHW A;  3P5B A;  4QHO A;  4Z2A A;  1JZ4 A;  3OGR A;  3WF0 A;  1Q8Q A;  5FZC A;  1MEC 1;  1JH5 A;  1NA1 B;  4KBZ A;  3VBH C;  5BNN C;  4CCJ A;  4CP9 B;  5JSP A;  4GMP 0;  2VUC A;  2WL1 A;  3FFZ A;  4AEM A;  1SLI A;  3FBY A;  4IEY A;  4YM3 A;  4Z92 B;  1US2 A;  1RIR A;  4R9C A;  3H8O A;  4EN6 B;  5J96 B;  5JCT A;  5JOX A;  2JG8 B;  4KGG A;  1FNZ A;  4GXL A;  3ZPO A;  1GU3 A;  1XC6 A;  1XYP A;  1B35 B;  1TMF 1;  3U4S A;  3WQB A;  3ETP A;  5JIA A;  3RS6 A;  3HD8 B;  4BA6 A;  1UQX A;  1R08 2;  3AXD A;  3U75 A;  2IWG B;  2R49 A;  2WYS A;  4BLI A;  2WZR 1;  1IKQ A;  1SLC A;  1QJF A;  4K6B A;  4UWD A;  3MEP A;  3LOI A;  4Q8K A;  4S2F A;  5CZK A;  3ZMN A;  4IL7 A;  4XUT A;  2BGO A;  3A23 A;  2BTV C;  5FZ4 A;  5FYM A;  3K2O A;  1FOD 2;  5FZM A;  2PHW A;  1PO2 1;  3UGH A;  5EFU A;  2I45 A;  3GAL A;  4MGI E;  3J7H A;  1DGL A;  2HWB 3;  5C3S A;  5LA0 A;  1R09 3;  1UY4 A;  1AYN 1;  1W2U A;  3MIE A;  1PO2 2;  4J1X A;  4RSU A;  1KFU L;  3OBR A;  2VVD A;  4P00 B;  1W05 A;  1WCS A;  3LFM A;  2FHR A;  1DG6 A;  1EV1 3;  4XXP A;  3H7Y A;  1G9F A;  3WG1 A;  5FY9 A;  5KBF A;  2WO2 A;  2VUL A;  5FMO L;  2E26 A;  3I59 A;  1GOH A;  2R07 2;  1LOC A;  1QH7 A;  2ZS6 B;  3JB4 C;  1S2E A;  3MLK A;  2XL7 A;  2JD9 A;  1LOD A;  5KWR A;  4O9G A;  1T6B X;  1O6U A;  1XBF A;  3WDU A;  5L9V A;  2GN7 A;  4DNY A;  1W3X A;  4Q4W 3;  1ODM A;  5DAX A;  3B01 A;  3AJZ A;  5EJ1 B;  2PEL A;  3KV6 A;  3S6P A;  2J1A A;  3WF4 A;  4CCE A;  2VW0 A;  5LZ6 A;  4FPL A;  1RUI 3;  4XFI A;  3SEP A;  3USU B;  4BZ4 A;  3WNL A;  3M3E A;  5FMD A;  5J98 B;  3A0N A;  5FDB A;  4S2H A;  1XU1 A;  1E5I A;  1ZBA 1;  1O3R A;  4CDQ A;  2R7E B;  4A41 A;  2ZGL A;  5FXX A;  1HB1 A;  1AR8 3;  1KDM A;  2BVB A;  3ETQ A;  3F95 A;  4QX1 A;  3UK9 A;  1HXS 3;  4L8Q A;  1JZ7 A;  4IER A;  5JR7 B;  1QJU 3;  5EXO A;  3VDB A;  3QAC A;  2P2K A;  2WO1 A;  2C9K A;  5FYH A;  5GZE A;  5LA1 A;  1DHK B;  4JRL A;  3T0A A;  1W6O B;  3U10 A;  5M0T A;  4N53 A;  3TRS B;  3GZT B;  2PQS A;  2AR6 A;  5FMC A;  4FOQ A;  4YZ1 A;  1KJR A;  4F8A A;  2KA3 A;  1O91 A;  3N7K A;  2MEV 1;  4NPL A;  2WT1 A;  1OD5 A;  2DBN A;  1KQR A;  1F31 A;  1OXC A;  4PQQ A;  2EA7 A;  5CU1 A;  2HWF 2;  4P9J A;  2RDS A;  1JHJ A;  1UMI A;  2RS5 2;  1QMJ A;  1UN1 A;  3PMS A;  1BK1 A;  4CEY B;  3U0Z A;  4YLZ A;  3WQ1 A;  2Q30 A;  4BH9 A;  2GZW A;  1BQP A;  1RUI 2;  3GNE A;  5FPB A;  5A32 B;  1OQ1 A;  1XE8 A;  2NQY A;  5F3I A;  4DXZ A;  1OOP C;  1X9P A;  2P1B A;  3SHR A;  1MQT A;  4GAL A;  3UYJ A;  5BNP A;  5C4W C;  4HON A;  2R06 1;  2P37 A;  4XUN A;  5E1R A;  1JOD A;  2QQL A;  1SPP A;  1VRH 1;  2UWB A;  4UFI A;  4QT6 A;  5IVY A;  4AVC A;  4FPY A;  5AC9 3;  1G9B A;  1DLL A;  4CXY A;  1LEM A;  3JD7 3;  4XFH A;  2RDN A;  2WNV C;  5E88 A;  3AX4 A;  4LUL A;  1VR3 A;  1OA3 A;  1UOJ A;  4CUC A;  1O4T A;  3EO6 A;  2ZAH A;  3KV4 A;  4FQZ A;  5FUN A;  3JBG 2;  4YM0 A;  5FYT A;  4IDZ A;  1LOA A;  1LJ7 A;  4QKN A;  5FZI A;  5GM0 A;  3RZG A;  1YJL A;  5A80 A;  5KHH A;  2IXI A;  5FXW A;  1J59 A;  1FXZ A;  3RZH A;  1EPW A;  1DGR N;  4DEQ A;  1VBA 3;  3C8X A;  4BHP A;  4V1P A;  2CL2 A;  1K5M A;  1W6P A;  2OXB A;  2UU8 A;  4A44 A;  5LWB A;  2W87 A;  1QJX 1;  2OZJ A;  2VBB A;  3C2U A;  4JVA A;  2EAK A;  1UZZ A;  2FDJ A;  4QD2 A;  4IV1 C;  1OF4 A;  2QTW B;  1VMJ A;  1W0P A;  2ILM A;  4A45 A;  2XLF A;  4P9X A;  4YG3 A;  5CFC B;  3TEX A;  2QVS B;  3NJY A;  4M4R A;  4TLG A;  4TXW A;  2AEN A;  1OQE A;  1UO9 A;  1OI6 A;  2AH2 A;  4XBL A;  1Q5O A;  4RHV 3;  1X36 A;  1QF3 A;  5KHG A;  4XEZ A;  2LAL A;  3LPF A;  3M2M A;  5C3Q A;  4NWW A;  4FOY A;  2DF7 A;  1IHM A;  5SV5 A;  3RZJ A;  1YO8 A;  1RUC 3;  4GB3 2;  4NJ4 A;  4OLL A;  1XRU A;  4F83 A;  3AB0 A;  5ABJ A;  4GH4 A;  4NRP A;  2LS6 A;  4IEO A;  1QOT A;  4UXA A;  4XUR A;  4XFF A;  5G05 L;  3QBQ A;  5H9Q A;  5IAV A;  5C9A C;  3KVB A;  1GZ9 A;  1XOY A;  3IPV B;  5L19 A;  4DRR A;  4PIX A;  5BXX A;  1RUG 2;  3ZO0 B;  1RVF 2;  4URA A;  1GWL A;  1AJK A;  5HXM A;  4NHL A;  2E32 A;  1VPH A;  3CJI C;  3K3N A;  1GWM A;  3VBR B;  4AI9 A;  1RC6 A;  3GHM A;  3IWZ A;  3HQR A;  4CTE A;  4BB3 A;  1MVQ A;  3E97 A;  1S4C A;  4D69 A;  4GWJ A;  4IXL A;  1RUE 2;  4R4Z A;  2JXA A;  1J83 A;  3POB A;  2AC1 A;  2BDR A;  4HT1 T;  5CB7 A;  1ND2 C;  4BE3 A;  5DG2 A;  1WW6 A;  1LTE A;  1WCK A;  4LIV A;  1LKN A;  5FZ8 A;  4OHZ A;  1NA1 A;  3ZR5 A;  1PX3 A;  4C90 A;  1UYX A;  4E8D A;  3N36 A;  2WN3 A;  3CLP A;  2JDZ A;  3H0O A;  4YW7 A;  4B8E A;  2CGP A;  5B4N A;  1KIT A;  3E6D A;  2OII A;  1OD3 A;  4Q4X 3;  3DUI A;  4AVA A;  5BNN B;  3AXE A;  2A6Y A;  4HSJ A;  3LF7 A;  1Z7S 3;  2GAU A;  5IW0 A;  4LBO A;  1Z7S 2;  2E53 A;  5LA9 A;  2GMM A;  2V09 A;  5I0R A;  3ROU A;  3HNB M;  4LXL A;  4LO7 A;  3CZJ A;  3RVH A;  1ND2 B;  2WA3 A;  1FOD 3;  3GZE A;  4UI9 L;  1DQ6 A;  2FDG A;  1ZRR A;  1KEX A;  2ZEY A;  4ZS2 A;  2GN3 A;  4ISR A;  1AL0 G;  1Y9Q A;  2A71 A;  2V73 A;  2VMI A;  3EXU A;  3JD7 1;  3LB9 A;  4UFH A;  1PGS A;  5FZK A;  2W1Q A;  2W46 A;  4XUP A;  3CQO A;  4QPI A;  2D5H A;  3U4X A;  1NY7 1;  4Y20 A;  1CAX A;  4CDW B;  1YXW A;  2ZML A;  4YVS A;  3ZFF C;  5FO9 B;  3VD7 A;  3N9O A;  4Q0P A;  1X82 A;  2EXI A;  2EVX A;  4CZS A;  5IVB A;  3N7J A;  2YYO A;  2HWB 1;  1GFF 2;  1ULF A;  2RHP A;  3RZM A;  4XF1 A;  1PGL 2;  4RS5 C;  2IFR A;  2CGN A;  4XTM A;  1BEV 1;  2UYA A;  4EWD A;  2Y6G A;  3MIF A;  2EID A;  5C70 A;  3IMM A;  1CZS A;  1FNY A;  1GZT A;  4BQ2 A;  4LBM A;  3SKJ E;  5LBE A;  4MHR A;  5JPN B;  3EB7 A;  5FZO B;  4ZY9 A;  1HQL A;  3I59 B;  2TUN A;  4FPE A;  3FHI B;  5LAS A;  5DAV A;  3ILR A;  3VBS B;  5CFD B;  2VBD A;  3KT7 A;  5DUU A;  4XDQ A;  1W8T A;  3I2J A;  4YVS C;  2WDB A;  2K46 A;  2A3X A;  3G7D A;  1FV2 A;  3DYM A;  5A6Y A;  3III A;  1RUG 1;  1O7F A;  2BER A;  2ZMN A;  3HVD A;  1D7P M;  3P6B A;  4M0N A;  3UJO A;  2EXJ A;  1S2B A;  3M3I A;  1DCS A;  2VZS A;  2VAU A;  1LES A;  1W8H A;  4I02 A;  5DZE A;  1GNZ A;  5ERL A;  2EF6 A;  5J48 A;  3OUH A;  3USU A;  5AFB A;  2HWE 3;  4KNC A;  3PME A;  5T5L A;  5KXC A;  3PU3 A;  4LBK A;  4JQR A;  2VQA A;  3MIH A;  2D3R A;  1V6J A;  1QDO A;  1A8M A;  1GNY A;  5BUV A;  4L92 A;  1AR7 1;  5GZD A;  4XJZ A;  2QBX A;  3ZPY A;  1HN1 A;  3THD A;  1GQP A;  2XJT A;  2XB6 C;  4JZR A;  2X5I C;  4G9S B;  2OKX A;  3RZL A;  2H0V A;  5JI7 A;  1W6O A;  2R1B A;  3CO2 A;  2JDU A;  5GZG A;  3LSD A;  5C7G A;  3WOG A;  1Y3T A;  4FPH A;  5DAQ A;  5A7W A;  4IV1 A;  3W59 A;  4Q0U A;  1HDK A;  4QDQ A;  4OZX A;  4FPO B;  5F5I A;  1COV 3;  4NO4 A;  4DFS A;  2JG9 A;  2RS1 1;  1EAH 3;  2MPF A;  2YPJ A;  3DYP A;  2WFF 2;  5H9P A;  3A21 A;  4J25 A;  3E5U A;  4HBN A;  2W08 A;  3KD4 A;  4FI9 A;  2WC2 A;  2Q5T A;  2BGC A;  4RS5 B;  1PK6 A;  4Y1V A;  5F3C A;  3SC7 X;  1OBN A;  5ANN A;  5FYU A;  5A3L A;  3N35 A;  2CY6 A;  4PI0 A;  1AX1 A;  4Q4Y 3;  1W9W A;  3OBA A;  1VMH A;  1D0G A;  2F17 A;  3I54 A;  1W2A X;  3SKV A;  1SLT A;  4CXW A;  4ITC A;  5J1X A;  3D3A A;  4HZF A;  2WWJ A;  1IKP A;  1H6Y A;  5DAB A;  1X7N A;  3W20 A;  1IGO A;  1YLL A;  1RUJ 3;  4RFT 0;  3LEI A;  2EAA A;  2PFW A;  5F8P A;  3WDY A;  5C5U A;  1MZ6 A;  2UWC A;  2Q0A A;  1OMI A;  4HK8 A;  2GNB A;  1MS8 A;  1NCR A;  1V6K A;  2PMW B;  4YRD A;  2EXK A;  1BVV A;  4NHM A;  4MXW B;  4C1X A;  2JDA A;  2Q8C A;  4AK3 A;  3W9A A;  3RYP A;  2OQ7 A;  3O1M A;  3K4A A;  1AR8 2;  3AKR A;  1AR6 3;  3AM2 A;  4UW3 A;  5ISL A;  1AX0 A;  3R4D B;  4LEJ A;  4AHX A;  4FTB A;  5K7P A;  1CVN A;  4HPK B;  4LTA A;  4OUE A;  4Y26 A;  2WR9 A;  4CEY C;  3T30 A;  4UT5 A;  2A7A A;  5FZ0 A;  5FZ1 A;  3D8C A;  4LKE A;  3WNK A;  5JZG B;  4ARX A;  1ULG A;  1O3S A;  4Q27 A;  4Z82 A;  4CCL A;  2B39 A;  3IDE A;  2YPD A;  4RR3 B;  5CG8 A;  2WT2 A;  5JLV A;  4RN5 A;  2LRP A;  5HBA A;  4H14 A;  4MUV A;  1WA4 A;  3OY8 B;  4O9E A;  5F2S A;  4MLO A;  4L0P A;  4M01 A;  1EV1 1;  4O65 A;  2RS3 1;  4BQY A;  1L7Q A;  2VMG A;  2D98 A;  4XPV A;  4Y5T A;  1MS3 A;  1TME 3;  4AFD A;  3IPV A;  3PUH A;  4Y33 A;  1VBB 1;  1DBN A;  3DKQ A;  2RS3 2;  4Z8B A;  2HKX A;  3PDQ A;  5FWJ A;  1W2O A;  1WUV A;  3PUQ A;  4RYD A;  4AI1 A;  4QPG C;  4Y5S A;  1RUJ 2;  2NPI A;  2VNV A;  1OLM E;  5A33 A;  3CMG A;  3ZMO A;  3B93 A;  4IEV A;  2VW2 A;  3RMY A;  2OPW A;  3IMN A;  2J1R A;  5T54 A;  1ZBE 2;  5JMC A;  5IVC A;  1NCQ C;  1QHD A;  1HRV 1;  4I2O A;  4GIQ A;  1RB8 G;  3W5M A;  1UOG A;  1VBE 1;  4CU8 A;  3MW3 A;  1LHV A;  1H1I A;  3H7J A;  2ID4 A;  4AI2 A;  1EY2 A;  4ATE A;  1YFY A;  1H6X A;  1CAV B;  2IXL A;  1XNK A;  3OBT A;  2YUE A;  1DYO A;  2UY8 A;  1AR9 3;  2RS1 3;  5AVA A;  4LIT A;  2WS9 3;  4UFJ A;  4OUS A;  3SMH A;  4Q8L A;  5A7S A;  1X8E A;  5JPM B;  4IV3 A;  3IB3 A;  1Q8S A;  1H8V A;  4QDR A;  5F5Q A;  4CCK A;  4AHZ A;  3QOP A;  4XF9 A;  2Z42 A;  5I0T A;  4J1W A;  3FJS A;  3JU9 A;  2GME A;  3HAG A;  2DU0 A;  3J9S A;  2YXS A;  4JDN A;  4BQ3 A;  4IEW A;  1LEC A;  2VR4 A;  5HXV A;  1ZRE A;  5FK7 A;  1OH4 A;  1SQ4 A;  4I0W B;  5GZF A;  2FBE A;  1H0B A;  1LED A;  2EIC A;  3ZSE A;  2VMH A;  1V70 A;  4HSL A;  5HCA A;  1JYV A;  3I2H A;  3WCR A;  1BKZ A;  3LIH A;  2ZGP A;  5F3G A;  3MLL A;  2QDN A;  4IEQ A;  5BNO A;  3AZW A;  4IND A;  5GZC A;  4AFB A;  5HCB A;  2AAC A;  4CDU C;  2WFF 1;  3OPT A;  4JGZ A;  1NZC A;  1P8J A;  4CPB D;  5IK7 A;  2NYY A;  2E6V A;  3ZM8 A;  3POS A;  3Q8A A;  3ZFE B;  1WGP A;  2RMU 2;  1PVC 2;  3RJ2 X;  4AVV A;  4Q4X 1;  3JB8 A;  3MID A;  1UNB A;  2P5B A;  3FLR A;  3CHX A;  5FY0 A;  4EQV A;  3NW4 A;  4UFK A;  1H2M A;  3O0V A;  4YM2 A;  3VZL A;  4DB5 A;  1H2L A;  1KDK A;  4XDO A;  1YNA A;  2KD7 A;  4RGK A;  5FLH A;  1F4H A;  2YC0 A;  2VUA A;  1AR7 2;  4MET A;  1LHN A;  3KHB A;  1UKR A;  3RWK X;  2BUK A;  2B4K A;  1FAY A;  2D93 A;  1W6Q B;  2RMU 1;  3BTA A;  4MGQ A;  3UES A;  4AED B;  2QDR A;  1CD3 G;  1PVX A;  1H9P A;  3RFR A;  3FX3 A;  5FP9 A;  4A2U A;  3FUO A;  2YG0 A;  4R4X A;  2A6W A;  4I0A A;  1A6C A;  1BJQ A;  5EV7 A;  1LOE A;  1YUD A;  2WUH A;  3CJX A;  4ES8 A;  4QX3 A;  3C7G A;  1COV 2;  1UMH A;  4WV8 A;  4MZU A;  4URT A;  5EWS A;  3ZFF A;  5CKN A;  1OSG A;  3MLJ A;  1WMD A;  4WVV A;  3D0S A;  4IEU A;  3H1W A;  4RQP C;  1CJD A;  4IE7 A;  4KQ7 A;  2HEW F;  2C1F A;  3LA7 A;  5I8Y A;  1GZW B;  4WVW A;  2OS2 A;  2OUH A;  2CYF A;  3KT1 A;  3LZZ A;  2YV8 A;  4YAR A;  4AQT A;  1X9T A;  2JG9 B;  3CKH A;  5EP9 A;  4M3C B;  2IFW A;  1ZRF A;  5FO7 B;  3WDW A;  5DG1 A;  1I3H A;  2D3P A;  2Q1M A;  3KQ4 B;  1YYN A;  2DVA A;  4MGZ E;  4BLJ A;  1O8P A;  3TEW A;  5A3O A;  2XWJ B;  4FO9 A;  5FOJ B;  4AGV A;  1CN1 A;  1FYU A;  1W06 A;  3AZX A;  4L9B A;  1L3J A;  3ZFG C;  1QQP 1;  1V6O A;  1NOV A;  1MEC 3;  2VM9 A;  4HN0 A;  4D6S A;  1LAJ A;  1RYY A;  3VL8 A;  1XNT A;  4MG2 A;  3M7A A;  2WNU C;  2DV9 A;  1R08 3;  2ZGU A;  2VNR A;  2IXK A;  1AL2 2;  2QFE A;  2ZGM A;  3DCQ A;  3KVA A;  3OD4 A;  4JDM A;  1C8M 3;  4L2N A;  2VZQ A;  5D2A A;  1SMV A;  4XCA A;  5GJ6 A;  1WLD A;  1TQ5 A;  3VGI A;  1U12 A;  4JC1 A;  2UUR A;  2D6K A;  3UL2 A;  5FQ0 B;  4UBH A;  3VN4 A;  3AMQ A;  2Z5W A;  3E5Q A;  5JDB A;  2WIN B;  1L7L A;  3OTF A;  2JEM A;  3ACH A;  4XQ4 A;  3WF3 A;  4FP2 A;  1WA6 X;  1J58 A;  1RUF 3;  4A7Z A;  1NLR A;  2NZ9 A;  2WZR 3;  3DEC A;  4GKX A;  4JKK A;  2VE1 A;  2WLP A;  1TME 1;  1OOP A;  1EPZ A;  3HWJ A;  3POW A;  2PN5 A;  4Q4V 2;  2XJS A;  4HPK A;  2BRT A;  4LOT A;  4ZHN A;  1EV1 2;  1W6M B;  4YZ3 A;  1IG0 A;  3BI3 A;  2BOJ A;  3MFA A;  2NMO A;  4HL0 A;  1CZT A;  2ES3 A;  2FCT A;  4BXF A;  2VOK A;  1YC6 1;  1CAU B;  1C3H A;  4AF9 A;  2I07 B;  4XBQ A;  1QXR A;  2DVF A;  4CCD A;  1W9S A;  1S0J A;  3UKN A;  1Y9M A;  3WNM A;  4P5H A;  5GLZ A;  4N8M A;  1OH3 A;  2J1V A;  2VZ1 A;  3UKT A;  3DXT A;  4GJZ A;  4HET A;  4DIN B;  4OHX A;  2XVG A;  3ZN6 A;  1ZBE 3;  3H8U A;  1R1A 2;  4GD4 A;  2QCS B;  4KG0 A;  3WY6 A;  3ATG A;  3I3B A;  3T0B A;  2J1U A;  2H6C A;  4B7K A;  2BWA A;  1HQW A;  5FZD A;  1DGW A;  4DMI A;  5BNQ A;  3VDD B;  3WX5 A;  2ERF A;  1UCX A;  1QJY 2;  2O14 A;  1FT9 A;  3KMH A;  1FPN 2;  2A6V A;  1NKG A;  4LKS A;  1UOF A;  3CBN A;  4CRQ A;  2VCC A;  2D6P A;  4LA2 A;  4QKF A;  1LGC A;  1RUF 1;  2BNO A;  4K7J A;  3WSO A;  5A3N A;  1RUF 2;  2OT7 A;  1CX1 A;  1VBD 2;  1M06 G;  1XQN A;  3ON7 A;  1WWY A;  4QXB A;  2WQ4 A;  1RUE 3;  4AXO A;  5EJZ B;  4WZC A;  4AFA A;  4CDX A;  4JTN A;  1RIT A;  2G4I A;  3ILF A;  4N9H A;  3TAY A;  2ZA9 A;  4QPG B;  4MH0 E;  3EJK A;  2L9L A;  1OVS A;  1BVP 1;  3THT A;  3S5Q A;  3D4K A;  2W94 A;  1IS6 A;  4IV3 B;  3AP6 A;  3T2P A;  1KJL A;  1PGW 2;  1FOD 1;  2GC3 A;  3T2T A;  4IEZ A;  2G9Z A;  2AEY A;  5LY1 A;  2OA2 A;  1V9U 3;  1XYN A;  1NXM A;  2R04 3;  4GJY A;  4X8P A;  4BK5 A;  1ZBE 1;  3KCX A;  4Y5Z 0;  4COY A;  2VCM A;  3R6S A;  4PDW C;  5DUX A;  4XBN A;  5BY5 A;  2RV9 A;  3SH4 A;  2V4A A;  1HXS 1;  2XJU A;  1C5I A;  4K20 A;  2PAM A;  1H9W A;  1DIW A;  4OUM A;  2WKK A;  4TLF A;  4LBQ A;  1D4M 1;  1RUD 3;  3NO8 A;  3WDV A;  1GP5 A;  4JRA A;  4ZKT B;  1CGP A;  1LUL A;  2B42 B;  1RXF A;  2VNO A;  1MAC A;  3UET A;  2R32 A;  4Q4Y 1;  2IXC A;  2ZEW A;  4FPJ A;  2ZPX A;  4Q4Y 2;  5FYY A;  3BYW A;  5FXV A;  1VBA 2;  2D7F A;  3JUU A;  3VV1 A;  3RQ0 A;  1REF A;  3RYR A;  5FWE A;  5EHD A;  5FPV A;  5T50 A;  3OGV A;  1RJ7 A;  2ZBJ A;  3ACG A;  2ARB A;  1TNR A;  1UOB A;  2BNM A;  2JG8 A;  1F5F A;  2ZHM A;  1LU1 A;  4PDW A;  4FPC A;  2WSV A;  5ANQ A;  1UY3 A;  2X29 A;  4NAM A;  3ZXA C;  4YGB A;  1OFS A;  4LUK A;  2VUJ A;  2YGM A;  1EUT A;  1DYK A;  4AI8 A;  2B9U A;  1NT0 A;  2A6X A;  1K5M B;  2ZX3 A;  5FZ7 A;  3ILN A;  3VZM A;  2F6B A;  4D0Q A;  1DF0 A;  2C4X A;  5ABJ B;  1OT5 A;  3DN7 A;  1V0A A;  3AP7 A;  5FKB A;  5BV6 A;  2GP3 A;  3OOX A;  3ZYI B;  2NLR A;  1WLW A;  2DUQ A;  4RL7 A;  1VE0 A;  2W52 A;  1O5L A;  4XJ8 A;  4MYE A;  1C4R A;  1G6N A;  4MV2 A;  3N4M A;  5B2G B;  3C3V A;  4YW1 A;  4Z07 A;  3KV9 A;  3B7M A;  2CSG A;  3AK0 A;  1J3R A;  1SLL A;  4XOG A;  5FZ9 A;  1H8T B;  1XU2 A;  4KU7 A;  4CP1 A;  2ZGQ A;  5D8A C;  5LBB A;  1TEI A;  4XET A;  5FCC A;  4JAA A;  3UGG A;  1NX9 A;  4CDU A;  5DMY A;  4GMP 1;  3GHN A;  2GMP A;  5GKA C;  4J6G A;  2PHL A;  3LIG A;  2PHR A;  3CU7 A;  4LLO A;  4P14 A;  4UW4 A;  4YPJ A;  4COV A;  3NST A;  4HKO A;  4UW6 A;  3ZYR A;  3HBK A;  3FWE A;  1SAC A;  1DGW X;  3LDR A;  1NXD 1;  1J1L A;  2AEZ A;  2VW1 A;  2SBA A;  1O3Q A;  5A6Q A;  3ZN5 A;  3AFK A;  4CDW C;  4FSJ A;  5ABJ C;  1S0G A;  3PL0 A;  2XLA A;  4JGY C;  3S0M A;  1JOP A;  5FY7 A;  2P34 A;  1BCX A;  1RTV A;  1V9U 1;  2Q8E A;  1POV 0;  5JXH A;  4PT6 A;  3AP5 A;  2Y6K A;  2J22 A;  3RNS A;  5A1A A;  5IUQ A;  3ACF A;  5BNP C;  2KXL A;  4ET7 A;  1FMD 2;  2MNG A;  3MUY 1;  4LBQ D;  5A7Q A;  4Y20 B;  3WP5 A;  4YVS B;  3PIJ A;  3KQR A;  3HJR A;  1OQD A;  1D4M 3;  1RUD 1;  2JE8 A;  1ND2 A;  4XFB A;  4LO6 B;  2JD4 A;  2DCJ A;  3V0B B;  2XON A;  1YQ2 A;  1SFY A;  5EYX A;  5A3P A;  1U5I A;  3C7E A;  4LPL A;  4NMI A;  1HJG A;  3C7O A;  4N43 C;  4YZ4 A;  2VQU A;  4XFG A;  5C3O A;  1E57 A;  4CEY A;  4ZON A;  4I0B A;  5I93 A;  3J7L A;  1RED A;  1VLN A;  5FOB B;  5IHR A;  4QPI B;  4LNV A;  1XJA A;  3WP4 A;  3SEE A;  5I0U A;  1PM7 A;  5A7P A;  1UD1 A;  2JX9 A;  1BMV 1;  1AR7 3;  1W99 A;  2Q8O A;  3ZYJ B;  1S0B A;  1W6M A;  4JHT A;  2A75 A;  4GB3 1;  5FYS A;  5H9R A;  3RRD A;  4AOC A;  1RL3 A;  4XMA A;  5IT6 A;  2W95 A;  2BBV A;  1MQT B;  1QGL A;  1ZA7 A;  2VD7 A;  2YC4 A;  5BNP B;  1YFX A;  2X8K A;  5JI9 A;  2HH9 A;  4QQ2 A;  5JSO A;  3BU7 A;  3TNP B;  2SLI A;  5FP7 A;  1STM A;  3MV1 1;  3WNX A;  1O59 A;  2G9G A;  5LAT A;  4EZ4 A;  4NHX A;  1XNC A;  5KC5 A;  2PLV 3;  4RA0 A;  3WF1 A;  5L36 A;  2WSU A;  5FPL A;  1QQP 3;  3OSD A;  5FYV A;  4KL1 A;  4E2Q A;  3IDB B;  4MGT A;  2UY9 A;  3GYD A;  4NUB A;  3SH5 A;  5GAL A;  3E6C C;  5FZO A;  1K12 A;  2R16 A;  3WD5 A;  1GQG A;  3H1Y A;  1LCL A;  3K77 A;  4FVV A;  4XQW A;  3VKF C;  3ACL A;  1W2T A;  1UXZ A;  2GC2 A;  4OI4 A;  5FUI A;  1GNH A;  1MS4 A;  4X6Q B;  4CU9 A;  1KD7 A;  1ZZC A;  1V6L A;  4HAN A;  2QE3 A;  4E4S A;  3NQH A;  3PTR B;  2TNF A;  4QU1 A;  3M8L A;  2ZHK A;  4A7Y A;  1RUG 3;  4OI1 A;  5IYY A;  1BZW A;  1CQ9 A;  5JXG A;  2E63 A;  1VAL A;  3O12 A;  2PHX A;  4IV1 B;  4D6Q A;  4Z2W A;  4XYX A;  4YM1 A;  4XUQ A;  2YBK A;  4Q1P A;  5G04 L;  3WT3 A;  3RZK A;  4CSW A;  1Z0H A;  2BU9 A;  1QEX A;  2P3J A;  1LOF A;  2C26 A;  1FAT A;  4K3U A;  3VBO A;  3VKL A;  1AR9 1;  1RUJ 1;  2PLV 2;  4RHV 2;  1X50 A;  4WVZ A;  5F6L B;  5K8S A;  1PZ9 A;  3CJI B;  4R9B A;  1YIP A;  2Y0I A;  4A3Z A;  3TN9 3;  1AL2 3;  3POI A;  4S2G A;  4D94 A;  3VZN A;  1C57 A;  1OUS A;  1HX6 A;  2RVA A;  2J1T A;  5CKQ A;  4CEW B;  1DDL A;  1VRB A;  1MS5 A;  4XJW A;  4YYO A;  1D4V B;  2EXH A;  4QMA A;  1CZV A;  4K40 A;  5KHK A;  3ZFG B;  3TYJ A;  1BXH A;  4UOJ A;  3NJZ A;  4QX0 A;  3VBR A;  4EYU A;  2JB8 A;  4AR2 A;  4Q4W 1;  4XAC A;  1WW7 A;  3B02 A;  5T52 A;  4C8D A;  2JEC A;  2DCY A;  3O0W A;  3GZA A;  3ECQ A;  1RVF 1;  4AE2 A;  3CZU A;  2WWS A;  4NRO A;  1ZX5 A;  4MGS A;  4OYU A;  3ZYP A;  3KF5 A;  3ZIW A;  4Q0V A;  1W28 A;  3MIB A;  5D8A A;  4AQ6 A;  5A3T A;  2RS3 3;  5C6C A;  2JDP A;  1UPS A;  2VXR A;  4GUL A;  1N1S A;  1KS5 A;  3D6E A;  1PGW 1;  2ZGO A;  3N9P A;  2ETE A;  3KB5 A;  5K0U A;  1G9C A;  4IQP A;  4NPM A;  5A3W A;  1A78 A;  3WQ0 A;  3I3Q A;  2WNO A;  5F39 A;  4YGE A;  3MV0 1;  3T1L A;  1XNA A;  3O1V A;  2GNT A;  2IVJ A;  2X5I A;  2YFZ A;  2YU1 A;  3NKT A;  1JZ3 A;  2ZJC A;  3THC A;  2RJ2 A;  5IVE A;  3IZO A;  4IGO A;  4FBF A;  5LEK A;  4LBJ A;  4QWN A;  5IVJ A;  5HV4 A;  2R0H A;  4WM8 A;  1G9A A;  5KXD A;  5D21 A;  4FFH A;  1K5M C;  5J37 A;  3ZR6 A;  1DQ4 A;  1WW4 A;  3LDB A;  3GCX A;  2HWE 2;  3B5L B;  3ZIX A;  1IS5 A;  3TWI A;  2HEY F;  4HXC A;  2QQW A;  2WO7 A;  2R07 1;  2XHK A;  3HQX A;  4QQL A;  2P17 A;  2Z4F A;  3A7Q A;  5E89 A;  5I8S A;  4E4H A;  3O1O A;  4GAZ A;  1CAX B;  4P9Y A;  3IBM A;  2W9X A;  1DYP A;  5C4W B;  1ENS A;  2ZHN A;  1PMJ X;  3D82 A;  3VHO A;  5EZW A;  2G19 A;  3WIN E;  4BXS V;  5E8A A;  1PK6 C;  3D0J A;  1KFX L;  1GWK A;  1PVC 3;  4FPG A;  5A33 B;  1UWW A;  5FPA A;  3T09 A;  2VZU A;  4XHB A;  2K9Z A;  3WW3 A;  5F1R A;  3O1T A;  2XL9 A;  3BOD A;  1WD3 A;  3HQU A;  2A3Y A;  3NV1 A;  5FZG A;  1VBE 2;  4M3C E;  2X53 S;  5J7M A;  2P6H A;  3GBG A;  3LE0 A;  3T0D A;  4PI2 A;  1MZE A;  1RMU 1;  1REE A;  4NID A;  3OEB A;  4YZ2 A;  3SIT A;  4KH9 A;  4LQR A;  1LU2 A;  2BYV E;  3WW4 A;  1VBD 1;  4CDU B;  2XVK A;  1I5Z A;  3VDD C;  3PHM A;  4FXG B;  1YRZ A;  2IUW A;  2WA4 A;  4Q29 A;  4C1W A;  1ULP A;  2HWD 2;  2VME A;  1WCQ A;  4N7U A;  4ASK A;  1SBD A;  3I8T A;  5LBF A;  5LW9 A;  1ONA A;  1O3T A;  3E6B A;  1IOA A;  1VBB 2;  2ZZQ A;  3PUS A;  4OHY A;  3BGA A;  4LOS A;  2FDF A;  3KHC A;  1K3I A;  1HRI 1;  3TB0 A;  3JCI A;  4DY3 A;  3ZXL A;  1D2S A;  3PVB B;  2WFF 3;  3UKV A;  2VU9 A;  3N9Q A;  2QQJ A;  5F9T A;  2HWF 1;  1PM4 A;  2ZCW A;  3RSJ A;  4P02 B;  4YW3 A;  1JYN A;  4OFG A;  5FUP A;  4GWI A;  3S7I A;  1O4Y A;  2E7T A;  3AMM A;  1QJE A;  3WP3 A;  5FP4 A;  1QOO A;  2ZHL A;  4DO0 A;  2OYZ A;  3DV8 A;  4SBV A;  2CDP A;  1UXX X;  1F5J A;  2BBA A;  3B00 A;  2EIE A;  2VEC A;  3NV3 A;  1N3P A;  1V00 A;  3WW2 A;  3ZYF A;  4LLF A;  4UAP A;  3DGT A;  2J7M A;  1NCQ A;  4KMQ A;  2Q8D A;  2R06 3;  1C1L A;  4QXH A;  3SCF A;  2J42 A;  2RM2 3;  2FDK A;  2RR1 3;  1YQC A;  4A7K A;  1J3Q A;  5A7W B;  4MAD A;  5FK8 A;  1A8D A;  4JGZ B;  4LHL A;  2TEP A;  4QU2 A;  3OGS A;  5FRE A;  1J1T A;  4CYD A;  4Q4V 1;  3H8R A;  4FAG A;  1AJO A;  3IIA A;  4XXA A;  4ASL A;  4BQ5 A;  1TME 2;  2V72 A;  3BN6 A;  1APN A;  4G3Y C;  1W39 A;  3VBO C;  2W47 A;  1YCI A;  3WF2 A;  5FMB A;  4R9D A;  1X8M A;  2EIG A;  2JKX A;  3POY A;  1DLC A;  2N7G A;  3UT0 A;  4HK9 A;  1OFN A;  5FZA A;  4B1M A;  4RS5 A;  3CEW A;  1NY7 2;  2RE9 A;  3FN9 A;  4OI0 A;  4B4R A;  4GA9 A;  5C9A B;  1NYW A;  2VTF A;  4CE8 A;  4Y1X A;  1AHS A;  1RMU 2;  4FFF A;  5CIS A;  1VAK A;  1GIC A;  4C0H A;  4ERO A;  4P5Y A;  4BU2 A;  5E16 A;  4XFA A;  1WLT A;  4DPN A;  4EZH A;  4W65 A;  5HI0 A;  2ZX2 A;  4AVS A;  4K1Z A;  4QHZ A;  4K9S A;  4Q1R A;  5GLU A;  5FKC A;  1HV0 A;  1COV 1;  1CWP A;  2LUW A;  2D5F A;  4DZG A;  4FP3 A;  4YFW A;  3NV2 A;  4Q26 A;  4XF0 A;  5CFC C;  1RJ8 A;  5FPU A;  4IW3 A;  4XVH A;  4ISQ A;  1JYT A;  5BNO C;  3TNQ A;  1YFW A;  5IVF A;  1UU4 A;  1VMF A;  3ZXE A;  3DPR A;  1DQ0 A;  2ADD A;  1BHG A;  2GNM A;  1QXP A;  5A7N A;  3KGZ A;  4Y3O A;  1RUO A;  1UAI A;  4XQD A;  5IFP A;  1ZYB A;  1U0A A;  4LIU A;  5F37 A;  3ORJ A;  3VLB B;  1C8M 2;  5JSR A;  4CXX A;  5DQ0 A;  4Z1V A;  1R08 1;  4GQ7 A;  4PHZ A;  4W8J A;  4AWD A;  5C3R A;  4ZU5 A;  4XIO A;  3VBU A;  3FL7 A;  3I7D A;  1XE0 A;  5JR2 A;  3VKO A;  3NVC A;  2VQT A;  2VMC A;  2B5H A;  1PZ8 A;  1IG3 A;  3UNP A;  3ACI A;  1PMI A;  1NLS A;  2VOW A;  3NAP C;  4M3C A;  1RHI 1;  2QQK A;  2GC1 A;  5IK8 A;  3MF6 A;  3BPZ A;  1HQN A;  4TYS A;  1NLQ A;  3LKJ A;  2QQM A;  1AYN 3;  1W8U A;  4QX7 A;  2J1E A;  4V2V A;  3SXW A;  3OY8 A;  4BME A;  3OGJ A;  3VBF B;  2BV4 A;  4BK4 A;  4F7Z A;  3N7M A;  4CCO A;  1GZW A;  4E9K A;  2DCT A;  4ZXE A;  1JXN A;  2PTM A;  4D8M A;  4NIG A;  2JG9 C;  5ACA 3;  3CF6 E;  1XNB A;  4RR3 C;  1W8Z A;  3WHT A;  1XE7 A;  2MHF A;  5CG9 A;  4YNI A;  3LPG A;  2JWP A;  4F3J A;  2C0Z A;  3LQC A;  3LDK A;  5HCF A;  4BOW A;  1UZ0 A;  5FAX A;  1E5S A;  1EYB A;  1HRI 2;  1S55 A;  4K21 A;  2VUD A;  5FQ0 A;  1CPN A;  1RIN A;  3H3L A;  4WM7 B;  5C3P A;  1FX5 A;  2V4V A;  2XBO 3;  3OYW A;  3MW2 A;  4AQ2 A;  5DDJ 2;  5D8A B;  3QCW A;  3WV6 A;  4RGG A;  3IDC B;  3T4V A;  4B1L A;  1H8T C;  2HEV F;  4EWE A;  4OQ9 A;  3J7N A;  4ZU7 A;  1IQA A;  1PNG A;  4LK7 A;  4P9W A;  1UF2 C;  1UZY A;  3WCS A;  1F8V A;  1DQ5 A;  4FOW A;  4JCK A;  2PYT A;  2ET1 A;  5T55 A;  5LK7 B;  3LD8 A;  4LUM A;  3ES1 A;  4ZS3 A;  5L9B A;  3Q8C A;  4KI5 M;  3I2I A;  5DXD A;  2X5I B;  3KV5 A;  1POV 1;  3V0A A;  1ZRC A;  2XQR A;  4FTS A;  1ASJ 1;  5FMO S;  3PJY A;  4YVW A;  1LGN A;  3BCW A;  1NE4 A;  4AG4 A;  2CDO A;  1W8F A;  5JXJ A;  1J3P A;  2UYB A;  2W1W A;  4OZO A;  2VNG A;  4ZPI A;  5KHI A;  1GMM A;  4XAB A;  5I8T A;  2HJI A;  4QAW A;  4W50 A;  3PU8 A;  4PLN A;  3VZJ A;  1ND3 C;  3AVR A;  3ZLI A;  2Y38 A;  3L2Y A;  2B9V A;  1E5R A;  1ZM1 A;  2D3S A;  3UV9 A;  2Z69 A;  3I3M A;  4NR1 A;  1ZNP A;  1LR5 A;  3NNJ A;  3GBF A;  5ACA 1;  5L7O A;  4D7T A;  3S57 A;  4QGN A;  5C4W A;  5IFT A;  3NRU A;  5FLI A;  3LA3 A;  3AKQ A;  4HOO A;  1BEV 2;  5HCH A;  3WZ1 A;  2E9Q A;  1OA2 A;  4XZP A;  1BYH A;  1SDD B;  4ONU A;  5F5C A;  5BNO B;  2G1M A;  1HRI 3;  2JDN A;  3SIS A;  3ZVX A;  4YVW C;  2QNK A;  3T1M A;  3ALQ A;  4Y4R A;  2VMF A;  5CAD A;  1LGB A;  2VVE A;  3K75 B;  4IES A;  2BQP A;  3I3E A;  3BU0 A;  3FLP A;  1AR6 1;  3VHR A;  5C8C C;  3OEA A;  3BTX A;  2BGP A;  4Y22 B;  5AFE A;  1ZA4 A;  4LE4 A;  1UX7 A;  4Y4Y A;  2ARE A;  1VBD 3;  2A70 A;  1CES A;  4JKM A;  4FXK B;  4LOR A;  1HN0 A;  1POQ A;  1F2N A;  2XKP A;  2W39 A;  4R8H A;  4FCA A;  1S2K A;  3CIH A;  1EP0 A;  3W58 A;  5LEJ A;  4KWJ A;  4QPG A;  1YJK A;  5F5A A;  4BQX A;  2TBV A;  3AMH A;  3B9C A;  2VZR A;  1CPM A;  4DEV A;  2ZGN A;  2W1U A;  2VG9 A;  1Y7B A;  2ZOE B;  4GKY A;  3ZSM A;  4E2G A;  4HVQ A;  3IT8 A;  3UJQ A;  1AX2 A;  2CWS A;  4RFR B;  2GAL A;  4PBP A;  2DUO A;  2RR1 2;  5FJH A;  3RDI A;  5E6H A;  3RJR A;  3T2Q A;  2I2S A;  1WCU A;  1ENR A;  5APA A;  4DXT A;  1V6I A;  1B35 C;  2FDI A;  1MQT C;  2QQI A;  5C8C A;  4KU8 A;  1GOF A;  3ZOI A;  2QQO A;  4JGZ C;  1QJU 1;  2WRA A;  2ZEX A;  3SNM A;  2VMD A;  3NNM A;  2BZD A;  2FMD A;  4AEJ A;  1T6G C;  1Q43 A;  1PZ7 A;  4QXC A;  4M3C F;  2ZKN A;  2VOT A;  2VL4 A;  1TNF A;  2HWC 3;  3GBW A;  1NCQ B;  5FBJ A;  3N9N A;  2XDV A;  3ST7 A;  3WUD A;  1V9U 2;  1HXS 2;  4XF3 A;  4DUX A;  3NJX A;  5JUV A;  2DUP A;  2DU1 A;  2JE7 A;  3H3Z A;  3LFI A;  3VBH A;  5J3U A;  1YI9 A;  5FXZ A;  3J8F 2;  3KCC A;  3OG2 A;  3DF0 A;  4K8R B;  3K51 A;  3U07 A;  3AYD A;  2Y8K A;  4CUA A;  3KLS A;  2RDR A;  4AAP A;  2J1S A;  1RUC 2;  1W0N A;  3I2F A;  4GB3 3;  5FZL A;  2JIJ A;  4MVT A;  3V64 A;  5FZH A;  3Q9O A;  5DPN A;  4EN8 B;  2JDH A;  1SFN A;  1FPN 3;  2WNV A;  4NOT A;  1PMH X;  3W21 A;  4XCB A;  2GND A;  2ZX1 A;  4JGY B;  2WFP A;  3OF1 A;  1MPX A;  4AHW A;  1TG7 A;  1VRH 2;  2Y33 A;  2YFU A;  4TWT A;  2R06 2;  4COZ A;  4JX0 A;  2LTN A;  4MGK E;  1A3K A;  3FUQ A;  2VY0 A;  2P3Y A;  4N43 A;  5JZG C;  5F2W A;  3OPW A;  2WS9 1;  4IE5 A;  1VBC 1;  5A7O A;  2P4E A;  1MR5 A;  1ENQ A;  4BDV B;  2BFU L;  4QKB A;  2ET7 A;  4IEX A;  1N1T A;  1WLC A;  1R1A 3;  2JIC A;  4KGQ A;  1ULO A;  1S0I A;  1Y4W A;  2HWC 1;  2X09 A;  2XUE A;  3DEM A;  4YFZ A;  2VXJ A;  1RUH 3;  3B69 A;  2RR1 1;  3N9L A;  3R05 A;  1H8T A;  4EWA A;  3FLT A;  4NHK A;  3AP4 A;  3BOW A;  3POF A;  3IAQ A;  4Q4V 3;  1MS9 A;  2ORX A;  5IVV A;  1GV9 A;  1NE6 A;  3NJV A;  1O5U A;  1L7R A;  3LCP A;  3ZYG A;  1MS0 A;  1HB2 A;  1QIQ A;  2WAO A;  2ZGT A;  2VVF A;  3P3P A;  3Q8F A;  4G4F A;  3MDP A;  3I3D A;  4ATF A;  1W90 A;  4B4P A;  3BKZ A;  4LR4 A;  4QX5 A;  1ZZB A;  3AYE A;  4P08 A;  4BCU A;  4NWV A;  2QQP A;  4AAX A;  2WJS A;  4UF0 B;  3R4S A;  5DZG A;  3LGR A;  1SCR A;  2A6Z A;  3BIW E;  1ULE A;  5DAW A;  3ZN6 B;  2Q1F A;  1FMD 1;  4KWK A;  5I0D A;  1ND3 A;  4NAO A;  1LHW A;  2CAV A;  3EHK A;  1CAW A;  2W91 A;  3AP9 A;  2ADE A;  3BUC A;  2XJQ A;  1G9D A;  3MGU A;  4FAH A;  1KGY A;  5D1I A;  4NIH A;  4DS0 A;  3H1M A;  4LK6 A;  3ITQ A;  4AHY A;  3OJB A;  4D7S A;  3R4U A;  4YZ5 A;  1V6N A;  1S0D A;  2DTY A;  4LA3 A;  5J09 A;  1OKQ A;  2E31 A;  5FYZ A;  1ZZ8 A;  4WM7 A;  4N53 C;  2BEO A;  3WEZ A;  1BBT 2;  2YZ4 A;  3K4Z A;  4GWM A;  3CL1 A;  2IC1 A;  4OHV A;  3ZXD A;  5F6K A;  1ALY A;  4P9G A;  4IE4 A;  4E4Z A;  2AUY A;  1W0O A;  1UZV A;  1ZZ7 A;  2Y60 A;  3AJY A;  5CBL A;  5FY8 A;  1K42 A;  2VOV A;  3I4I A;  5FIX A;  5IAX A;  4NVP A;  1IPS A;  4CDX B;  3GJB A;  3MUZ 1;  4BIF A;  4M00 A;  5GLT A;  1U5Z A;  2XJR A;  1Z7S 1;  3KCY A;  3K4D A;  2O8Q A;  4JDO A;  4FQ4 A;  4COW A;  1YQ6 A;  5KHJ A;  1JZ8 A;  3V0A B;  3VBF C;  1LEN A;  1AVB A;  4AEK A;  1J84 A;  3FBM A;  3V0B A;  1DGR A;  2VJX A;  5LRS A;  3I2O A;  2ORZ A;  2RM2 1;  3O0X A;  4LE3 A;  1SBE A;  5FV3 A;  4AYU A;  1LOG A;  3AKS A;  1F4A A;  2XGX A;  1GKB A;  5FY5 A;  4LO8 A;  5IAT A;  2VTX J;  4CPB A;  3EYP A;  2PHF A;  2ZXQ A;  2R07 3;  2DDU A;  3ELN A;  3FFQ A;  3GF6 A;  4B4Q A;  3TEZ A;  4E27 A;  1Y43 B;  1JBC A;  4XJ9 A;  2W5F A;  3GM8 A;  1ZZ6 A;  3EBR A;  2JDM A;  1N47 A;  1HB4 A;  1W9T A;  3WXP A;  1QDC A;  4OCT A;  5JIU A;  2YHJ A;  1QJY 3;  1OHF A;  5BPX A;  1HRV 3;  1O4Z A;  2HYK A;  3I97 A;  2B7Y A;  1GP6 A;  5F3E A;  3TOJ A;  3FHQ A;  1I5P A;  4XZU G;  2VQ0 A;  2R04 1;  2RMU 3;  2D6N A;  4R52 A;  4CVU A;  2VOX A;  3OBZ A;  4CDQ B;  1R09 2;  4HN1 A;  2DYC A;  1VB4 A;  1JW6 A;  1RUD 2;  3BOP A;  3E1F 1;  4PDW B;  4UW5 A;  1WMF A;  4NII A;  1W9Y A;  3J26 N;  4QQP A;  3INA A;  3GGL A;  3ENR A;  2KM2 A;  4CCN A;  1POV 3;  2B8M A;  4XHX A;  1T2X A;  1WBF A;  1HIX A;  3TBD A;  1XND A;  3ZSL A;  3U14 A;  4HVO A;  1F9K A;  2B45 X;  1VRH 3;  3E5X A;  4IV3 C;  4DOU A;  5AC9 1;  1PX4 A;  4H7M A;  3NAP B;  4I09 A;  5CKM A;  5FRA A;  3SQO A;  1QJX 2;  2FD8 A;  1KXG A;  1BLZ A;  2C9A A;  2DUR A;  2EAL A;  4Q4X 2;  3UGF A;  5FYB A;  1RXG A;  5JAX A;  2R0F A;  2DWR A;  1SLA A;  4GH4 C;  2YY1 A;  2WLQ A;  3HNY M;  3W5N A;  1CR7 A;  5FZB A;  2R04 2;  5T5P A;  5JMO A;  5C8C B;  4LKF A;  5JWP A;  2PAK A;  3VBO B;  4RQP A;  1NG0 A;  1A34 A;  3L2H A;  4QB1 A;  3T4H B;  1QNY A;  4DQA A;  3JBG 1;  3QH7 A;  5DUV A;  5J36 A;  2CHH A;  3QLQ A;  3CJI A;  2X05 A;  2QZ3 A;  5JOW A;  2HWC 2;  2D6L X;  2NM1 A;  1WKY A;  4XJA A;  2JG8 C;  5LRR A;  3J8F 1;  3PUR A;  4LO5 B;  2E7Q A;  1UYP A;  2WS9 2;  5DZF A;  3SCG A;  1YI7 A;  2PHT A;  3WQ7 A;  4CEW A;  1QQP 2;  2JDY A;  1OUX A;  2HBU A;  4I01 A;  4QHB A;  4CP9 A;  2VC9 A;  1NA1 C;  1UYZ A;  2V5Y A;  4I30 A;  3PVO A;  3NNG A;  3VBH B;  3ZDS A;  1JU3 A;  3ZFG A;  4DY5 A;  3AVS A;  2XWB B;  4JTO A;  1OVP A;  2DBI A;  2VPV A;  2W2I A;  4QGM A;  5FP3 A;  4QQO A;  3VD3 A;  3WDX A;  1UY2 A;  1F35 A;  4LHS A;  1UY0 A;  3NKG A;  2D97 A;  3OD0 A;  4H3W A;  1PO2 3;  3LA2 A;  2RM2 2;  4BM8 A;  1TZO A;  3AYC A;  2XUM A;  2FDH A;  2WNU B;  1W8N A;  1FPN 1;  3B3Q E;  4KWL A;  1UKG A;  2BWC A;  5T3N A;  2P3I A;  2WNV B;  3THP A;  2PHU A;  1OC1 A;  1W2N A;  1NUK A;  4BYY A;  1RUC 1;  4LT5 A;  5A6X A;  4DRV A;  4E8C A;  2WZE A;  2DVB A;  1PO1 1;  1I6X A;  4UYB A;  1DZR A;  4XJU A;  1TVG A;  3OPZ A;  4YW4 A;  2WZ8 A;  1GLH A;  3RPQ A;  5IK5 A;  2GP5 A;  3IDA A;  4OVE A;  4CDQ C;  3OUI A;  2QJV A;  1S0E A;  3KZ4 C;  5CFC A;  1HB3 A;  1XSR A;  2XVL A;  3O14 A;  4EN7 B;  1HRV 2;  4PLO A;  3RMX A;  5FO8 B;  2ZGK A;  5F32 A;  1B35 A;  3AKT A;  2VCA A;  4PIZ A;  3MIG A;  1H2K A;  5FTT C;  5C71 A;  2KR2 A;  3A0K A;  3OUJ A;  4WM8 B;  3BPS A;  1GBG A;  3PJQ A;  4WM7 C;  3N7L A;  5FZE A;  4BWO A;  4ORF A;  2A1X A;  5KR7 A;  1DZQ A;  2IVI B;  1X33 A;  2YB7 A;  2ZAC A;  4O7X A;  1ZBA 2;  4WVM A;  5A3U A;  1IQD C;  2ZGS A;  2DTW A;  4PLM A;  3FZ3 A;  2GC0 A;  1FMD 3;  1URX A;  5JXI A;  4V2W A;  1ST8 A;  4DIQ A;  3AC0 A;  1ACC A;  1IPJ A;  2XG3 A;  3WNN A;  4AGR A;  4CU6 A;  4EE2 A;  4RGA A;  1IS4 A;  1HJF A;  4LHK A;  1W3V A;  5CEH A;  1M4W A;  3DL3 A;  3NNL A;  2QUO A;  4B3N A;  2VGD A;  2VTX A;  2Y64 A;  2W92 A;  4AED C;  3H3U A;  4PBO A;  2WWU A;  5FPZ A;  3AL5 A;  1LRH A;  1Y9G A;  2DCK A;  2WYF A;  3ZSJ A;  3WVJ A;  1C5H A;  4XIK A;  1GP4 A;  2Z79 A;  3ABZ A;  2FCU A;  4YW5 A;  1AYM 1;  1LOF C;  4ZZ8 A;  1QXJ A;  3FMG A;  2ZX0 A;  4ZZ5 A;  1QWR A;  1BBT 3;  4QM8 A;  2GH8 A;  2E51 A;  1AR8 1;  1CAW B;  1DU3 D;  4EN9 B;  2Z2S B;  3U78 A;  4W6Y A;  5BNN A;  2A5Z A;  5C8W A;  2AGS A;  4KBB A;  4BIO A;  4P9I A;  2R30 A;  3LSE A;  1RGS A;  4TSV A;  1QU0 A;  3I49 A;  3GJA A;  2YU2 A;  4WM8 C;  5FP8 A;  1OLM A;  3A4U A;  3M3Q A;  1AUY A;  2F4L A;  3PUI A;  1G7Y A;  1AXK A;  4IGQ A;  4N53 B;  1W9F A;  5IWF A;  3J8F 3;  3U37 A;  2D40 A;  3R0R A;  3RYK A;  1VBC 2;  3URF A;  2JIG A;  4E4D X;  2O8O A;  2QQV A;  2H6B A;  4EJR A;  3MIC A;  5DDJ 1;  1SHW B;  4TZD A;  3VD9 A;  5L73 A;  3GXU A;  4Y1Y A;  4YGD A;  2ARA A;  2FZ1 A;  2ZX4 A;  4X8N A;  2FQP A;  3ZN4 A;  1WMX A;  4A3X A;  1SG3 A;  4QB2 A;  1SFP A;  2OPK A;  4C91 A;  4EV0 A;  4XC9 A;  4S2D A;  5A32 A;  4BPZ A;  3POJ A;  2P3K A;  1JZ6 A;  1QOS A;  3PVN A;  5FLJ A;  3VDA A;  2GH2 A;  1SBF A;  2XJP A;  1ASJ 3;  2ZEZ A;  2XQX A;  2YC2 A;  3J4U H;  3ZDV A;  4QXK A;  4IET A;  3RG0 A;  3BTZ A;  2BJS A;  5I91 A;  4Q2F A;  3K46 A;  5HV0 A;  2LRO A;  2RS1 2;  1AYM 2;  1GR3 A;  3LEK A;  1JTZ X;  4N9I A;  2G9F A;  4MO3 M;  3AFG A;  4YSF A;  2YDE A;  2WO3 A;  2WT0 A;  2YRO A;  3MFC A;  4MX3 A;  2ZTN A;  4YW6 A;  4U36 A;  3JQW A;  3ES4 A;  5CVR A;  2XML A;  3WG4 A;  1W6N B;  1QNW A;  1JOJ A;  3KF3 A;  1RHI 2;  1RUH 2;  2ZKL A;  5CFD A;  3VBS A;  1QJZ A;  3DXU A;  4I3P A;  2DCZ A;  4CU7 A;  1Q3E A;  3C7H A;  1PIV 3;  3HBZ A;  1SPP B;  1NZI A;  1GQH A;  2FCV A;  4DXR A;  3HT2 A;  3LWC A;  2ZAB A;  1W6P B;  3MW4 A;  1YQ5 A;  4GZ9 A;  4XIL A;  5K0U B;  4N7I A;  2Y6L A;  1SZB A;  1FI2 A;  4M0H A;  3KSC A;  3HR9 A;  2XXZ A;  4CA9 A;  3VBU B;  2YBP A;  4W6W A;  4DUW A;  3BAL A;  3VKM A;  4CCC A;  1JU4 A;  3RI8 A;  2WZP P;  3ZKU A;  4CUG A;  1MVE A;  4RHV 1;  3MYX A;  3GCW A;  3P3N A;  3PNA A;  1OKO A;  4FFG A;  3M3O A;  3AMN A;  2ZZJ A;  1WBL A;  5DUW A;  3WG2 A;  3AZY A;  3DPR B;  3FC0 A;  1HV1 A;  4PIY A;  3WR0 A;  4B7E A;  1C28 A;  4XMI A;  2YMZ A;  2I74 A;  3EMR A;  4Q4W 2;  4CCM A;  2RJK A;  3LEM A;  5FFO C;  1H4G A;  1Q8O A;  2D6O X;  2LM3 A;  2Q4S A;  2Y6H A;  3VBF A;  4ES9 A;  1RMU 3;  1H2N A;  4OI2 A;  4QPY A;  3POG A;  3ZX7 A;  3Q8E A;  4W4Z A;  5SV8 A;  4EN0 A;  5F7U A;  4HMZ A;  2CWM A;  3J7M A;  2H0B A;  2VCB A;  1PIV 2;  3M4F A;  2PAE A;  3HN3 A;  1I1E A;  1NCR C;  1Q56 A;  4P9L A;  4QPI C;  4QB6 A;  1JOB A;  1UW8 A;  2IXJ A;  3AMP A;  4UFL A;  3ZXK A;  1JYW A;  2OX0 A;  1JHN A;  1RHI 3;  3O1P A;  2A3W A;  5T5J A;  4AI0 A;  1S0C A;  3N3H A;  5DN2 A;  3RGB A;  2CU5 A;  1PK6 B;  1U5Y A;  3WNP A;  4YWA A;  3N9M A;  4QGL A;  3OYW B;  4GH4 B;  2XOM A;  3APB A;  4L99 A;  3HN1 A;  2IZW A;  3HT1 A;  4MXV A;  3VD4 A;  1ULD A;  1WD4 A;  5EYY A;  1DP0 A;  4PF1 A;  2XBO 2;  2QQU A;  3SCH A;  4L11 A;  1BK0 A;  3MHZ A;  5KXE A;  2OQ6 A;  1EAH 1;  1DFQ A;  3VL9 A;  2V5D A;  1DZT A;  4XFC A;  4HLT A;  3VBR C;  4JHZ A;  2R1D A;  4L97 A;  3VB9 A;  3PIG A;  1LNS A;  2JJ6 A;  1G8W A;  2VZT A;  2WNU A;  1VP6 A;  4H7L A;  1E5H A;  4WBB A;  5LK5 A;  4LO4 B;  4AFC A;  5JVV A;  1C8N A;  1GSL A;  4NE9 A;  1N1Y A;  1ZRD A;  2D6M A;  1JMU B;  3MPB A;  4N90 A;  4NPR A;  4QM9 A;  1KS4 A;  2NN8 A;  3ZKY A;  5EJ3 A;  1AXY A;  5AC9 2;  5KXB A;  1VBB 3;  1XYO A;  1R64 A;  2Y26 A;  3ZXJ A;  2VO5 A;  1UU6 A;  5TSW A;  3JZV A;  1W8W A;  1GYK A;  4CDW A;  2HWD 1;  1VBC 3;  3NMB A;  1ODN A;  4YGC A;  1RVF 3;  3AZZ A;  3MF9 A;  5FY1 A;  4KG8 A;  1OUR A;  1YFU A;  4YVW B;  1AXZ A;  2YBS A;  3ME2 A;  3AYA A;  1BEV 3;  2XH6 A;  1OLR A;  2OW4 A;  4HKW A;  2Y0O A;  2E7A A;  2X10 A;  5EPA A;  4WVM B;  4K8F A;  2RS5 3;  4K1Y A;  2HWF 3;  2CGO A;  2A73 B;  1VBE 3;  2DFC A;  3AKP A;  2GU9 A;  4QPW A;  1Q8P A;  5CYY A;  1JUH A;  1H30 A;  3B94 A;  1VAM A;  3HIF A;  3OGG A;  4YG0 A;  4D3W A;  1ZRI A;  3ZXG A;  5A1F A;  2VZ3 A;  2WN2 A;  3LEG A;  4FT8 A;  5FR3 A;  1I9R A;  2CAU A;  4NRM A;  2BVV A;  4CEW C;  5L7O B;  3K3O A;  1V6M A;  4YW2 A;  3O7O A;  1UMZ A;  1MS1 A;  2K0G A;  1PNF A;  1W04 A;  3O1R A;  2WNE A;  3O1U A;  5C9A A;  4FPF A;  2YGL A;  3SH3 A;  4CDX C;  4HKL A;  4LHN A;  4QX8 A;  3BIE A;  4D6R A;  5LBC A;  4DUV A;  2CNA A;  4LBL A;  5IJR A;  1JS9 A;  5DDJ 3;  3WDT A;  4H55 A;  2OZ6 A;  4OMC A;  4AFM A;  2HWE 1;  2BFU S;  1H1A A;  2WAA A;  4Y22 A;  3GZU C;  1F15 A;  1ZBA 3;  4XDP A;  2XKO A;  1C8M 1;  4B29 A;  4M4P A;  1CAV A;  1R1Z A;  3VBS C;  5CFD C;  1S0F A;  1XB9 A;  2O1Q A;  4XF4 A;  1JYX A;  1N3Q A;  5I0S A;  3CDZ B;  2OUJ A;  2PA7 A;  5FYC A;  1TMF 3;  2C6S A;  4QKD A;  4ZU4 A;  4CP0 A;  3FHA A;  5DAP A;  4NIA A;  3F2Z A;  2ARC A;  1VIW B;  5FYI A;  5KC6 A;  3OCP A;  1OPM A;  3BVC A;  3USS A;  4IE6 A;  1UIJ A;  2C24 A;  1UZW A;  3QH6 A;  1UPI A;  3KGL A;  3M70 A;  3WP6 A;  5EQU A;  3T2O A;  4FOV A;  2XPJ A;  1H4H A;  4OUL A;  3U1X A;  5K4L A;  5CNA A;  1WW5 A;  4MSV A;  3HPN A;  4LBN A;  3OB8 A;  5L9R A;  3VHN A;  3TN9 2;  3ZXF A;  5FZF A;  2JB4 A;  1VB2 A;  3CNA A;  1US3 A;  3L9J T;  4XTP A;  4A6S A;  1D2Q A;  2F4P A;  1Q8V A;  1XXN A;  1QJU 2;  4NRQ A;  1NQD A;  1W8O A;  4JKL A;  1SDW A;  4AI3 A;  1JN2 P;  3PLQ A;  3ZYH A;  3HOB A;  3S7E A;  5A3M A;  1YQ8 A;  3DKW A;  3VHP A;  1ZZ9 A;  2JDK A;  3KS7 A;  2B46 X;  4LMF A;  4XE9 A;  3H50 A;  2AZ5 A;  4N43 B;  1W6N A;  2ZMK A;  1LB2 A;  3I2G A;  1CIW A;  5LY2 A;  2WQ8 A;  1NAE A;  4IUG A;  4ARY A;  4GWN A;  4AW7 A;  2JKB A;  4WZF A;  3HNM A;  2XHN A;  4KWU A;  1NCR B;  2D43 A;  2GSY A;  4JGY A;  3WNO A;  2UWA A;  3VZK A;  3ZSK A;  4UBG A;  4MXW A;  2Y6J A;  3I2D A;  3AL6 A;  1UYY A;  3IAP A;  4BQW A;  2ATF A;  4LKD A;  4BQ4 A;  2JE9 A;  2ZGR A;  4PQ9 A;  3S30 A;  1AF9 A;  1QJX 3;  3NNF A;  3LOB A;  1W6Q A;  1CIY A;  1MZ5 A;  2HYX A;  1KRI A;  4NHY A;  3RZZ A;  3MPP G;  3T08 A;  5K9Y A;  1MZF A;  1AR6 2;  2XJV A;  3P1I A;  3JQX A;  3NV4 A;  2VBP A;  2BW8 A;  1N3O A;  5EIY B;  3GDB A;  4XW3 A;  1OF3 A;  1K5J A;  2IXH A;  3VZO A;  4COU A;  3HMY A;  4JV4 A;  4IEP A;  4RR3 A;  3TN9 1;  2HWB 2;  4FPK A;  2HLE A;  4Q5O A;  5JOY A;  2D44 A;  1G86 A;  4YG6 A;  3QD6 A;  1ULC A;  1RUH 1;  2VZV A;  1AR9 2;  1UIK A;  3ZYB A;  2BOI A;  3WG3 A;  5A1L A;  5LB6 A;  4IGP A;  1JZ2 A;  1RUN A;  4R9A A;  5CA6 A;  4MHU A;  5JZG A;  1EUU A;  3O1S A;  1JUI A;  2RJL A;  2C5D A;  2PXJ A;  3SLI A;  4BMB A;  3M1H A;  3JBG 3; 
#chains in the Genus database with same CATH homology
 1OXC A;  2JDK A;  1GZT A;  2VUD A;  2BP6 A;  1W8F A;  5A6Q A;  5A6Z A;  2CHH A;  1UQX A;  2WRA A;  5A3O A;  1UZV A;  2JDH A;  2BOI A;  2JDM A;  5A6X A;  1OVP A;  2BV4 A;  5A70 A;  1OVS A;  4AOC A;  2JDP A;  2JDU A;  3DCQ A;  2JDY A;  1OUS A;  2BOJ A;  5D2A A;  1OUX A;  2VUC A;  3ZDV A;  4CE8 A;  5A6Y A;  5HCH A;  2WR9 A;  2XR4 A;  4UT5 A;  2VNV A;  1OUR A;  2JDN A;  1W8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...