2BOJA

Crystal structure of pseudomonas aeruginosa lectin (pa-iil) complexed with methyl-b-d-arabinopyranoside
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords PSEUDOMONAS AERUGINOSA LECTIN II
publication title Binding of Different Monosaccharides by Lectin Pa-Iil from Pseudoman Aeruginosa: Thermodynamics Data Correlated with X-Ray Structures.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 20
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2bojA00
4CE8A 2JDPA 1OVSA 2JDYA 5A6QA 1OURA 2BP6A 2JDUA 5A6XA 4AOCA 3DCQA 5D2AA 2JDHA 1OVPA 1W8HA 2VNVA 5A3OA 5A6ZA 1W8FA 2VUDA 2BOIA 4UT5A 2BOJA 2WR9A 2CHHA 1OUSA 1UQXA 5HCHA 2JDKA 3ZDVA 1UZVA 2WRAA 1OXCA 2JDMA 5A70A 2XR4A 2BV4A 2JDNA 5A6YA 2VUCA 1OUXA 1GZTA
chains in the Genus database with same CATH superfamily
1CZSA 1KD7A 4B1LA 3OPWA 3OTFA 4M0HA 3WG3A 4JKMA 3ST7A 5SV8A 2B42B 5H9SA 1W6PB 5FZ4A 1RUNA 2OKXA 4QX8A 1IPKA 3LSDA 1H4HA 1OT5A 1SEFA 3O14A 1NQJA 1MS3A 3AM2A 1R64A 3KGZA 3HQUA 4ZU4A 1WGPA 2ZHMA 4AI3A 2ATFA 3WP3A 4QQHA 1RUJ1 3OYWB 3UNPA 1E5HA 4BYYA 4FFHA 1MS9A 1RTVA 4HFSA 1KJRA 5T5LA 5FXVA 1IHMA 4H3WA 3NKTA 4RQPC 5CFDA 1PO11 4RHV1 4BA6A 1ZBE3 4E2QA 1UYXA 4YZ4A 1DBNA 4E27A 1QEXA 2R1DA 4IE7A 3THCA 4C91A 1I9RA 2P34A 1J84A 1UW8A 4IE0A 1WLCA 1R1A1 1CONA 2VMHA 1F31A 4PI2A 2GC3A 3DCQA 2Y0OA 5IK5A 2QQPA 2IVJA 3AVRA 2W94A 3ILNA 3VZLA 1T6BX 3PUHA 3ES4A 1PO23 1L3JA 5FREA 3I3MA 3AMNA 5J36A 2XG3A 1W8TA 5DUXA 1NXMA 4FP2A 3PLQA 3PVNA 4Z82A 1V6IA 3AX4A 4R9DA 1S0BA 3VHOA 5L7OB 2XJSA 4QMAA 2RHPA 2BVVA 2OXBA 4ASMB 5IVYA 2AUYA 3NNLA 1AJKA 1CWPA 1HB3A 3NAPB 2DUOA 4I3PA 3VBUC 1WCKA 3OUJA 5CKNA 3VUOA 3PJQA 3QOPA 1VB2A 4SLIA 3S7EA 2VTXJ 4AHWA 2VR4A 2JG9B 1SFNA 5EYYA 2JDZA 1OA4A 1N3QA 1LB2A 2Z42A 1WZXA 2FCUA 4GKXA 4EZ4A 1JUIA 3I7DA 1HB4A 4YZ2A 3WF1A 3T0BA 4QKBA 2ZCWA 1OFSA 2W08A 3S30A 4Y5SA 3JB8A 4AVVA 5JZGA 4K7JA 1HXS3 4QPGA 1HRI2 4K8FA 1C28A 4BM8A 3MLLA 1S0IA 2P5BA 3GDBA 1XSRA 5A3MA 1R1ZA 3ZN4A 1VBD1 5FZ7A 4OI1A 3NNGA 3N7KA 4QQ2A 1V9U2 5EXOA 3VBSA 1SQ4A 5FQ0B 1G9DA 1YJLA 1B35C 4XHBA 2HYKA 5F39A 1UY4A 2JE9A 4XF9A 3PUIA 4LUMA 1SFPA 4XBNA 4BJ0A 4AHYA 3WCRA 2JDYA 1UMIA 2BZDA 4XDPA 1QH6A 4GWJA 1FOD2 1D4M1 5FYUA 3EJKA 1XNCA 3HQXA 2PHUA 2VY0A 2XONA 2XWBB 3OD0A 4IEQA 2D6PA 5IVJA 4M00A 5FPVA 1H1IA 4N43C 2VMCA 5BNPA 3VL9A 3KVBA 4RS5C 2EIGA 2ZJCA 1C5HA 4URTA 4XIOA 1OUSA 3I2IA 5JAXA 1BJQA 3ZFEC 3V64A 1NA1A 4XHXA 2C4XA 2CWSA 3L9JT 4JGYA 1A78A 2WZR1 4JGZC 2XQRA 3OGJA 2C6SA 2Y60A 1YQ8A 3WNOA 4AQSA 4N8MA 4C8DA 2FHRA 4UYBA 5FY5A 3WT3A 4UF0B 4I2OA 4DO0A 4OI2A 3A0NA 1OA3A 4PDWB 1FNYA 1QU0A 3WF2A 5FYSA 1Z7S2 1RUF2 5FUPA 1CPMA 4N9HA 1VP6A 2DVAA 3WQBA 2PLV2 2VZSA 3PTYA 5AVPA 3E1F1 4BQ5A 1RUC1 1QIQA 4H7LA 1UOFA 4E2SA 3EMRA 4WVVA 5KBFA 3W5NA 1DYKA 3AMHA 3FC0A 3AFKA 3ZDSA 3URFA 1D2SA 5FMOL 4PDWC 1ENRA 4ZKTB 2YU2A 5LZ6A 1C3HA 3TEXA 3ZFFB 3R0RA 5E89A 2R16A 4ZPIA 3ZFGA 5EWSA 3N9NA 2QQIA 1NCRB 3VHNA 1Z78A 5JI7A 5FZEA 1VMFA 2EICA 2HWD2 2FDGA 1W04A 2VH9A 2W68A 1DLCA 1RC6A 2RDNA 4BWOA 1RXFA 4ASLA 4IGOA 1VMJA 2B45X 5CU1A 4CCNA 5J48A 2G19A 3T09A 3RPQA 3KT4A 4YW1A 1LHVA 5HCAA 2DCTA 3RRDA 3TEZA 4LK7A 4X8NA 4Y5TA 2EAKA 1LTEA 1OPOA 2PQQA 1PZ9A 3GXUA 3HOBA 3H7YA 3KMHA 3THDA 1JXNA 5L9VA 3BIWE 1QJZA 2D43A 4MGKE 1Y9MA 3LA2A 2RS12 5C3SA 2WNEA 2DCKA 2ZKNA 4HKOA 5JXHA 1XE7A 2YMZA 2DFBA 3E5XA 3ZXKA 5C9AC 4DIQA 5F6KA 1CGPA 1GWMA 1XU2A 2YXSA 3E5QA 4PJYA 4CXWA 3MI8A 1X33A 3HBKA 5JDBA 2VW1A 3LIHA 1RVF2 4XBLA 4HLTA 3BVCA 1XOYA 3VBOA 4KG0A 2ZHNA 5JOWA 1GQPA 2QQNA 3MPBA 2OYZA 2QVSB 1W6QB 1RUD3 4BISA 1HJFA 1LCLA 3CJXA 1RXGA 2BU9A 3MIGA 4XDQA 5I0DA 4FXKB 1PM7A 3BPZA 2XJVA 1QXRA 4CCMA 1JZ6A 1UAIA 2Y6KA 3H3ZA 2PHLA 2B39A 3L2YA 4UOJA 2VGDA 1MEC3 2VOWA 1AR93 2ZEYA 3GZEA 3N7LA 4A3XA 5FXZA 2XHNA 3FL7A 3K75B 2CYFA 1VBB2 1YFUA 4JHTA 4XMIA 1T2XA 3RZGA 4MGTA 5FZMA 3J8F3 4Q1PA 3WEZA 3OSDA 3FBYA 4Q4W3 4AOCA 1OHFA 4OULA 3Q8AA 3ZR6A 4FTSA 2WYFA 1DGWX 4S2DA 3AL6A 2HEWF 4BCUA 1M4WA 3QH6A 5F6LB 5LRRA 3THPA 4E4HA 5J96B 3O1TA 4BQ4A 1DIWA 5KWRA 1O3RA 1HRI1 2A6XA 1UQXA 2ZHKA 5J09A 2CDOA 2VXRA 3UK9A 4Q4V2 2VTXA 3VKNA 3DN7A 4CDWA 1GWKA 3MV01 3SLIA 2WT2A 2EXJA 4P9YA 5F32A 1V9U1 4QX2A 4Z2AA 2XR4A 4YGBA 1OUXA 1CX4A 2C26A 1SBFA 2NYYA 3CL1A 4Q26A 4RFT0 3TWIA 4YW4A 4X8PA 2BFUL 5F7UA 1KS5A 3LEKA 1Q43A 4CCKA 4HG6B 3U4XA 2G9GA 3AXEA 4D69A 1FOD1 2JD4A 1FT9A 2JDHA 3OPTA 1AXZA 1G6NA 5F9TA 1XJAA 2BOIA 1V6JA 3WF0A 4P5HA 5GZFA 2FCVA 1GZWB 1HIXA 1LNSA 1I1EA 4XABA 2VVDA 4OHVA 4RL7A 4QU1A 2RDRA 2X5IA 1CAUA 1W05A 2W52A 3I2DA 1KJLA 4P9LA 4TSVA 1JYXA 1HW5A 3WNNA 2VXJA 3TN93 1OVSA 2BWCA 4LHNA 2V4VA 3T3YA 4Z2WA 4R8HA 3V0AB 4Y4YA 2ZGOA 5AFBA 1N1YA 1Y3TA 4J25A 4OLLA 1PVXA 4B7EA 3VDDB 1ASJ2 4FSJA 1Z7S1 1RUF1 5H9PA 1MZ5A 4PI0A 3PIGA 5FYVA 2YGMA 2FZ1A 3LA7A 4RQPA 4YW5A 2PLV1 3WW2A 4XCAA 3TEWA 5IVCA 4L11A 4ZXKA 1YIPA 3B7MA 2V5YA 4YGCA 2J1UA 4JQTA 2DVGA 3IIAA 3K51A 1LOGA 2ADDA 3WQ1A 2ZGKA 4FFFA 4QQLA 4FPKA 4HONA 4DINB 1RUG1 1YIFA 4F3JA 3PHMA 2NQYA 5EV7A 4Q29A 1RJ7A 4Z92B 5KXEA 3PU8A 3ACFA 2R0FA 1CAWA 3H8UA 5FZOB 1GMMA 5EJ1B 2HWD1 3N7MA 1IPJA 4CDUA 1YI7A 4WZFA 5H9RA 4W8JA 3SMHA 2ZGPA 4DEQA 1DG6A 1RJ8A 2DBNA 3U1XA 3UL2A 1XRUA 4FCAA 3WQ0A 3CF6E 4A7YA 3GZUC 4Q8KA 2AYHA 3HN1A 1AL22 3CJIB 3I97A 2ZA9A 4JKLA 2A73B 5IK8A 1AVBA 2RR13 2F4PA 5CNAA 5DAVA 5GKAC 4BK4A 1Q8PA 3NV2A 4BH9A 1WW7A 5GLWA 4AF9A 1XYPA 2D98A 1RL3A 2BERA 4Q0PA 2RMU2 4XFFA 4LBOA 2PELA 1GZ9A 2YFUA 3M3EA 3VDBA 1A34A 2YPJA 4KL1A 4LMFA 2PTMA 4QHBA 3VBHA 4DXSA 4ZXEA 3MICA 4LIVA 1RVF1 2Q8DA 5CFCC 2R043 1O3TA 2QQMA 1UMHA 4J1WA 2EIEA 3LPGA 2BRTA 4LLFA 4GH4C 3ZYHA 2RJLA 4XQ4A 2UYAA 1SLAA 4LKDA 4CP1A 4NIGA 2GMMA 3WV6A 3ZIXA 3BALA 2YBKA 1W8WA 1V6MA 4IV1C 4ATFA 1AYN2 2Q5TA 1DZTA 2RG4A 2VZTA 3LDKA 4XYXA 2FMYA 3OG2A 5LASA 4CE8A 2ZGSA 4DUWA 2W95A 4RS5A 2A6WA 1VRH1 1VBB1 4ITCA 5EPAA 1H9WA 4NR1A 3J7NA 2EXIA 2JDUA 1ZRCA 1LESA 2G9ZA 3KS7A 3ZFEA 5CISA 1RUJ3 1LOCA 4INDA 1QXPA 4OUMA 4YYOA 4NPRA 4QU2A 2JX9A 1UY3A 2BGOA 4YZ3A 1OQDA 1HQWA 4HVOA 2R1BA 3RI8A 2AENA 3GF6A 3LOIA 4MGIE 3HEIA 5AVAA 2WWJA 3AYDA 3IDAA 5AC92 4IE5A 4Q4V1 1NCQA 1COV3 4Y22B 4D0QA 4QXHA 1IGOA 1KDMA 1OBNA 2A3XA 1R1A3 4B8EA 1STMA 4AR2A 5A80A 2JJ6A 4WM8C 4AI1A 1VPHA 3N3HA 3D0JA 1KDKA 1SDDB 4LITA 4LUKA 5F2WA 2HKXA 1W6OB 4UW3A 5CFDC 3E6CC 1YNAA 3G7DA 4L9BA 4N90A 1KFUL 5D8AA 5B2GB 5GZGA 1KS4A 1JOPA 1GFF2 3BOPA 5FLJA 2FDIA 1RITA 5FZ9A 4JVAA 1LOEA 2XMLA 1VMHA 1WWYA 4D8MA 5IK7A 2VCCA 5FJHA 3O1VA 1PMHX 4I3GA 3TEYA 1JBCA 5IVFA 2XPJA 1OMIA 3R4SA 4HOOA 5J7MA 1WA4A 2QKDA 2H0VA 4Z07A 1OLRA 3SXWA 1PX3A 3AZVA 2HWC2 4OMCA 4WVWA 1CN1A 1LECA 1RUOA 2RVAA 4HPKB 3TYJA 4OHWA 1W2AX 1X82A 2D3RA 3K3OA 3LCPA 1EV12 2R073 4LEJA 3WG1A 4ZZ8A 1WMFA 2C9KA 5JZGB 5DDJ2 1ULFA 5I0TA 5JPMB 1JZ4A 1ASJ1 1VBA2 2J22A 2V4AA 2WWSA 4FPJA 2D93A 3EYPA 1PK6A 1VBD3 4I0BA 5L19A 4ZY9A 5DABA 4JTOA 2P3KA 2WNUB 3VBSB 1GLHA 1BYHA 1ZZCA 5DZEA 4BXFA 1EAH2 3VBFA 4WVMB 2VTFA 5FZAA 1EUTA 1GOGA 1V70A 4QX1A 1ODNA 2VMEA 4N53C 4QPGC 5FR3A 4M0NA 5KHJA 3EXUA 2DTYA 4MADA 2JE7A 4GB32 1GZTA 5FK8A 4D7TA 3IIIA 4AAPA 4CDXB 3VD9A 3PDQA 4G9SB 1NQDA 5E88A 3S6PA 1C5IA 3I2FA 2A6VA 4HT1T 4CCOA 1EPWA 1YLLA 1BKZA 3AZYA 3BI3A 4XUPA 2X05A 1X36A 2YC4A 4W65A 1AR83 1QJX3 1UYYA 2ZABA 3ACIA 5A32B 1L7QA 3BKZA 1XSQA 4YVWB 1NA1B 3GHNA 2NM1A 5F37A 1ALYA 2WZR3 3IKWA 2ZX0A 4JGYB 3C7GA 1ND3B 2D5FA 5BNQA 2WRAA 3MLKA 5F3EA 1ZVFA 1QJU2 4K1ZA 1AL21 5BNPC 2YU1A 1FV3A 2WZPP 4UI9L 1CR7A 3FWEA 4WZCA 3FLRA 1FMD2 5FZ8A 4JX0A 1K5MA 1Q8SA 1CD3G 1ST8A 3NW4A 4IETA 3BIEA 5ACA3 1E5SA 4XFBA 4RGKA 1OF4A 2R6QA 2P17A 4B4RA 1RUC3 2ZEZA 2RMU1 4KBZA 3WLUA 1AUYA 2YYOA 5FCCA 5G05L 2IXJA 1O6UA 4YPJA 1UY2A 1JZ3A 1AYM2 3JQXA 5JOXA 2BGCA 4Y3OA 1H2KA 2O0OA 3KT1A 4BB3A 1LODA 3C2UA 4FVVA 3K4ZA 4IDZA 1TMF2 3WDXA 4NRPA 5JUVA 3ZN6A 3RJ2X 1FPN2 2WT1A 3B01A 1MACA 1UZVA 3NJYA 5C4WC 2RM21 3VDAA 2QCSB 1QQP2 4XACA 3ZFGB 5GZDA 4CDQA 4CYDA 3QD6A 5HCBA 1N1VA 2UWCA 3GCXA 1Q5OA 4QDQA 4D6SA 1LJ7A 1G9AA 3ECQA 5SV5A 4AI9A 5FIXA 2X10A 3AP9A 4XF4A 3RMXA 4CP2A 2A7AA 2BP6A 2CSGA 3LE0A 4Q27A 5HCFA 4NHMA 3T30A 4YM2A 1MPXA 1X50A 5A6ZA 4FPGA 1JZ2A 3VV1A 1YRZA 2YG0A 3FLTA 3WQ7A 4CU7A 5ABJA 5IWFA 2WFF2 1AR72 4CEYB 4MG2A 4BQXA 1W9TA 4QDSA 2WO7A 2WLQA 1AZDA 1O5UA 1WW6A 3PNAA 5AC91 2J42A 3T1LA 2ZGLA 2VBDA 4HK9A 1OFNA 4DUVA 3ELNA 4LBQB 1UOBA 1ULOA 3O0VA 5C70A 1O8SA 1NXD1 1PHMA 2ZGMA 4Y4RA 3PVEA 4LBMA 2XHKA 4W50A 1H0BA 1SPPB 4RN5A 2XJRA 1KRIA 4PHZA 4Q5OA 1AR63 3N9QA 3LEMA 1N47A 1DYOA 1Y43B 1REDA 4GXLA 4CCDA 2W1UA 3THTA 5FZIA 1NX9A 2A5ZA 3OBTA 3W59A 5A3TA 3WNLA 2HEVF 2MEV2 3KCXA 4XAEA 2QE3A 1ZA4A 3VBOC 2JDAA 2VZRA 1OOPB 1XBFA 2P3JA 3AMMA 3DKQA 3RYPA 2BFUS 1PM4A 2K46A 4GWIA 4MO3M 4JDOA 1H2LA 4LIUA 4XAAA 3WSOA 4F8AA 3T2QA 3SITA 2VUCA 1ENXA 1QKQA 5F5AA 5KC5A 4XPVA 2HWC1 2GALA 4XIKA 4B7KA 1OURA 3CU7A 5CKMA 5FMBA 3D4KA 4LT5A 1J3RA 1O8PA 4FAHA 4FQZA 1UXXX 1EV11 1QOSA 1BVVA 1PNGA 2WQZC 3RFRA 5DDJ1 1MR5A 5A7QA 4D3WA 4I01A 4UT5A 1D4VB 2RDSA 2WN3A 3J4UH 4DZGA 5HV0A 1VBA1 4CUBA 3H1MA 3OBRA 4CP0A 3IAQA 3IPVA 1ZYBA 3NSTA 4JHZA 1TNFA 4CU9A 3ZDVA 1JYIA 2OT7A 4XMAA 4DXZA 3H0OA 5FYBA 1S1AA 5A70A 1EAH1 1NOVA 2YUEA 4CEWA 2W9XA 3J7HA 1G9BA 3C7OA 3ZXDA 2ARBA 4KU7A 4EWEA 4PCRA 4GB31 1GOFA 1FOD3 1UN1A 1DZRA 2GH8A 1F9KA 4OFGA 1PIV2 4Y1YA 4CDWC 4CPBD 2Z2SB 1QDOA 4XTMA 1OQEA 2R0HA 4M3CE 1QNWA 2DWRA 1UIJA 3GJAA 3USUA 3MUY1 4NWWA 5FKCA 3AYEA 4NPMA 4CP9A 1BMV2 2OS2A 2GC0A 3MPPG 1HLCA 1IPSA 1UD1A 3W5MA 3O5SA 4YM3A 5KHGA 2DFCA 4MHRA 1MZEA 3ZYRA 2P6HA 1ENQA 2E7AA 1CAUB 2XLAA 3DF0A 1NZCA 1OKQA 1ULEA 1UU4A 1W0NA 3M2MA 2AREA 1QJU1 2EIDA 1GP6A 3IZOA 3B00A 4H14A 5FOBB 3V65A 1WA6X 1WBLA 1OH4A 1WCDJ 2K0GA 3POIA 3OGVA 3UJQA 5GZEA 1FMD1 4J6GA 4AVTA 1ZNPA 2WO3A 3C8XA 5A33B 1Z7S3 5C5TA 2X5IC 1HN1A 3MFCA 2ZMLA 4R9CA 3UESA 4BQYA 4R4XA 1IQDC 4Y24A 2VNVA 2Y6LA 2PLV3 1A8DA 5LBFA 2FDFA 4RQPB 1TVGA 1U0AA 1YQ5A 4AFBA 4COUA 5C3OA 4LO7A 3RMYA 1W90A 2O8QA 3S0MA 4I09A 2XJQA 1AYM1 4P5YA 2HWF3 1QOOA 5AFEA 4WM8A 1LU2A 1RUG3 1QDCA 1TMF1 1JZ7A 2JEMA 1FPN1 2TBVA 5A6YA 2LALA 2VZOA 5A1LA 4BLIA 4DY5A 2DURA 1QQP1 2P4EA 4B3NA 1CAWB 1XE8A 2XUMA 1TME3 2J1VA 1SFYA 4IEUA 5E16A 4LHSA 4CDUB 3C7HA 3WP5A 5JOZA 1OVPA 4PBOA 3ACLA 3VBUB 3GBFA 3GJBA 5FY9A 2XLGA 1UL9A 1RINA 3T08A 3KQRA 4XILA 4J1XA 1S0JA 1FNZA 3MF6A 1BQPA 5DUVA 4AE2A 2Z79A 3EBRA 4BHPA 4RA0A 4CDUC 4GZ9A 2WFF1 1AR71 4LHKA 4NN0A 2WNVA 5L36A 1N1TA 1FATA 4X6QB 4Q4Y2 5FPZA 2E63A 2CAUA 4LOSA 5C5UA 4RYDA 2F4LA 1JMUB 1FXZA 1ND2C 2R063 1RVF3 1SCRA 1Q8OA 4AFMA 5I91A 3I59A 2J7MA 4E9KA 2DU1A 5BV6A 2VQAA 1B35B 2HWE2 2WDBA 4N53A 1G9CA 3TB0A 4BQWA 1BXHA 3NJXA 3SKVA 2ORXA 4RR3C 1RB8G 3LKJA 3DV8A 3UT0A 2VBBA 3ZKUA 4AVSA 5A7NA 4HANA 4O7XA 4CCEA 4XW3A 3V0BB 3VBHC 4P08A 2TUNA 3ZYJB 4A4AA 2MEV1 4XFAA 4QX0A 2KM2A 1WMXA 5DPNA 3NMBA 2OVUA 2VZVA 5FK7A 1PGSA 1YFXA 4N43B 1VRH3 1VBB3 4ZS3A 3VHRA 4RS5B 1DGRN 4EJRA 3WF3A 4A6OA 3PMSA 2XJTA 5L9RA 1WLWA 4AVBA 5IFPA 4QGLA 1PNFA 4ZONA 4NOTA 1AX2A 3ZFEB 4Q0SA 3T4HB 1QMJA 4UXAA 5JIAA 2B9VA 3WNMA 1GP5A 4JGZB 1POV1 2GNTA 5FZLA 3R4UA 5FTTC 1NE6A 5K0UA 1JOJA 1PGL2 1FYUA 2W3JA 4DOUA 4OMDA 1SLBA 3JQWA 3OUHA 5I0UA 2OX0A 4Q4V3 5IFTA 3BTAA 2A70A 2OUHA 4K9SA 4ORFA 4XJWA 1OLQA 1SDWA 4NIAA 4FPHA 1W2UA 5JCTA 2AR6A 1PVC3 3GZAA 4CCCA 4IESA 4ES8A 5FPUA 3JD73 3BYWA 3MIBA 5F3CA 4AI2A 5CIRA 4OHZA 3WUDA 3KV5A 3A0KA 4O9EA 2VMIA 5FYYA 1U5XA 1NCQC 1ZX5A 2EAAA 1MS0A 5D8AB 1LEMA 1PIV1 3FHQA 3K48A 4QPYA 4OHXA 4NIHA 5C4WA 4FFGA 1CPNA 3UGHA 3RG0A 2FZ2A 1VBC2 3B3QE 2G1MA 2RJ2A 2F17A 1REFA 4QWNA 4XF1A 1BMV1 1WUVA 2A3WA 1JUHA 1KGYA 4CZSA 1OPMA 1SZBA 3BB6A 5D8AC 1LGNA 3NNFA 1BBT3 1O4TA 1O4ZA 3QH7A 3DUIA 4L99A 5DUWA 2BBVA 4K1YA 1PMIA 3HNBM 1JI6A 2EVXA 5BNOC 5H9QA 4IQPA 2VE1A 5A3PA 3NV3A 1VR3A 3CQOA 4L97A 5EZWA 2J1SA 4FAGA 4EWAA 3Q8BA 2OQ7A 3VN4A 2PHWA 4Q8LA 1SBEA 3O1UA 4QM8A 2B7YA 3NV4A 4NHYA 3N9OA 3WNPA 1D7PM 4P9GA 5C9AB 2JB4A 2HBTA 4KG8A 5JR2A 4MGZE 3VBFB 4EWDA 3CNAA 4AW7A 1O7FA 3FMGA 2FD8A 4Y20A 3WR0A 4BZ4A 4NAMA 1URXA 4HN1A 1ZBE2 1PK6C 2R32A 4DFSA 3U75A 3FBMA 3NJZA 1W39A 5I8SA 3VBRA 1CAVA 1U5ZA 1FV2A 3VBFC 1K5JA 3UKNA 1POV0 2ARXA 2GH2A 5IJRA 1DFQA 3RGBA 3H8RA 1L7RA 1VLNA 4XE9A 2W87A 5BY5A 1ZZ9A 2ZX4A 3SHRA 1MVEA 4AG4A 2O1QA 4AEMA 1OH3A 4MHUA 4YVSC 4IEOA 1ZBA3 2ZEXA 2GNDA 3NQHA 1AL23 3WNXA 1GBGA 2E31A 4TLFA 5IVBA 1GYKA 3M3CA 4GALA 3ZSJA 5FPAA 5DG2A 1RHI2 1QNYA 3D8CA 4FPYA 2IXLA 1MQTC 2JG8C 3K4AA 4Q4Y1 4B4QA 3WDTA 1CQ9A 3VGIA 2PMWB 1HRV3 5DXDA 5FP7A 2FQPA 2WC2A 2Q8OA 3CHXA 1WCQA 1YJKA 1EYBA 2AC1A 1W6MA 2RMU3 3I4IA 1ZRDA 1Y4WA 2JWPA 5JLVA 4QHZA 4AWDA 1ULDA 4GD4A 4P14A 5A3OA 4LBKA 5FZBA 4UWDA 4AQ6A 3DXTA 5HXVA 1K5MC 3SC7X 2J1TA 5EJ3A 3TOJA 2HWE1 1HJGA 2IFRA 5I8YA 4FFIA 4URAA 4G3YC 3KF5A 1DQ5A 1LKNA 2L9LA 1NY72 2RM23 3ZYBA 1GZCA 4AI0A 4FPCA 2WO1A 4LE3A 3KLSA 4LQRA 4CDQB 3OPZA 1Q8VA 3AMQA 2ARAA 2RDQA 2DTWA 3JBG2 4CVUA 2AZ5A 2X8KA 4Q4X2 2IWGB 3MGUA 2D40A 5CADA 3AKTA 1DGWA 2OPWA 1UU6A 1JYVA 3VLBB 1W0PA 3O0XA 1JOBA 1CAXB 5ISLA 3HT2A 1YWKA 5JXJA 3M3IA 3MW4A 5LY1A 2VCMA 3POSA 4CU8A 4CDQC 4COWA 1W0OA 3QBQA 1GANA 4N7IA 5LY2A 1OLME 3PVBB 4XQDA 3E6BA 5F5CA 3UJOA 3J9SA 5ABJB 3A4UA 1UF2C 5GM0A 1PGL1 1F5FA 3QACA 5AC93 2WAAA 4FPOB 3HT1A 4CCLA 3B9CA 2V09A 2B5HA 1UY1A 1C1LA 4PIYA 1DYPA 3IM0A 1V6NA 4HKWA 1Q3EA 3IDCB 2KR2A 5ABJC 4W6WA 2P1BA 2WZ8A 1JYCA 4PIXA 1APNA 1UNBA 3KT7A 4Y5Z0 4M3CF 1LHNA 4AK3A 4S2FA 1H2NA 2YBPA 4BPZA 2EIBA 3KB5A 3N9PA 3VKLA 1ZZ6A 2XVLA 4DB5A 1CESA 2WQ4A 4KWJA 5FZGA 5LB6A 3GNEA 3PIJA 4DUXA 2X09A 3P6BA 1BVP1 4QPIC 1VBC1 2D44A 5EYXA 3I54A 3AJZA 5FYZA 4KWUA 3KM5A 3O0WA 5EQUA 3O1PA 2HH9A 3GBGA 4OCTA 2JDKA 4GIQA 4UBGA 3WD5A 2PN5A 4TXWA 2JD9A 1IZ3A 2QUOA 4IV3A 3OCPA 3R4DB 1UPIA 4EE2A 1S4CA 5C8CA 2FDJA 2BQPA 1H8TC 4FPFA 4G4FA 1DCSA 2E33A 4R4ZA 5JPNB 2QQWA 2ZS6B 4PLOA 3PUAA 4LO4B 4BQ1A 1ZA7A 4BU2A 2VL4A 5FO9B 3O1OA 3PVOA 3N4MA 4A42A 2W1QA 4OHYA 3MZHA 4ET7A 3VD5A 1VBA3 5F3IA 4L0PA 3WP4A 2WZEA 2WN2A 1JN2P 2ZMKA 3KHBA 5ANNA 3TBDA 3LGRA 3OYWA 3N9LA 3RDIA 1JYTA 3U37A 4P02B 5JSPA 1ND2A 2ZTNA 5LA2A 3WUCA 4XC9A 3CEWA 3WVJA 3SKJE 1VALA 5CFCB 2P2KA 3T2PA 4P9XA 3VD7A 4IGPA 4BDVB 4CUCA 5IYYA 2QQVA 3BTXA 1ZBE1 4XUTA 2WINB 4GH4B 2RS11 1UZZA 2VOXA 1MS4A 3ETPA 4OZXA 3WNKA 4EN0A 5A6XA 1BZWA 1ULPA 4RR3A 3USUB 4QDRA 1GSLA 4CEWC 2FDKA 1QJY2 4IV1B 5ERLA 1S2EA 1O5LA 1US2A 2ADEA 2V73A 2VUDA 3ETQA 3P3PA 4YW3A 4DXRA 5HV4A 3LEGA 4LPLA 4D7YA 3DYOA 4BXSV 4ISQA 1CZTA 1WBFA 2XOMA 4PLMA 4QGNA 1ZREA 4KNCA 5L7OA 1ZRRA 1NLSA 1DGLA 5DQ0A 4FTEA 4HSLA 5FZ1A 1AR92 5F8PA 3M3OA 1N3OA 1OXCA 2W1WA 4M01A 3T0DA 4LKEA 3NAPA 1FMD3 2ZXQA 5IAXA 5B4NA 3ZR5A 1RHI1 3ZX7A 4CCJA 3J8F2 3LA3A 4YRDA 1Y9GA 2CY6A 3M7AA 3ABZA 4EROA 5JXGA 5BPXA 3SH5A 3ZPYA 4Q4W2 2IVIB 3KV4A 3WOGA 2XB6C 4GWNA 1CJDA 1J1TA 3FUQA 3VKFC 4AHZA 2JECA 3AP7A 4HN0A 4AEDC 2JB8A 5T3NA 4XBQA 2NLRA 4P9WA 4A45A 5KHIA 2AACA 1TMF3 4WM8B 4R52A 5LK5A 2C9AA 2RJKA 2UY8A 5APAA 2QDRA 3AP4A 5JSRA 1NY71 1PO13 4RHV3 5CFDB 3A21A 1F4HA 1X7NA 3OY8A 1QQP3 5T5PA 1XPWA 4MXWA 1UKRA 3M4FA 5FBZA 4QGMA 3JBG1 2JKBA 4YG3A 4Q4X1 4Y1ZA 4B29A 3RJRA 4YARA 3JCIA 1J58A 2ZMNA 3UV9A 1VE0A 2DCZA 4H2AA 3S5QA 3H7JA 1XC6A 3POGA 2CHHA 4JTNA 2WFF3 4R9AA 4PT6A 3HBZA 4COYA 2AGSA 2ZGNA 3HQRA 4LXLA 5LATA 1DZQA 3AXDA 3Q8EA 5BNOA 2BW8A 4LOTA 5A7SA 4A2UA 5LW9A 5FV3A 3VKOA 1PMJX 1SACA 5I0SA 5K8SA 3MIHA 5FRAA 1M06G 4YLZA 4IW3A 3I2HA 4KBBA 4ONUA 4OUEA 4TN7A 2VNOA 4X6RB 4XEZA 3TN92 4GULA 1DF0A 3NNJA 3BUCA 5JXIA 2LROA 4OZOA 3P5BA 4UF0A 3SH3A 4AI8A 5A3LA 4XXAA 3B02A 3I59B 4GJZA 2QTWB 3CZJA 2WNVC 1DDLA 1V6LA 3TNPB 4N53B 4QPGB 4RGGA 2E26A 1GOHA 1HQNA 3CLPA 2W5FA 2XWJB 3GGLA 2NZ9A 5FZ0A 2VG9A 2D6OX 4C1XA 4MZUA 4S2HA 3T2OA 3E5UA 3H3LA 2MEV3 3FX3A 4WM7C 1JH5A 3K3NA 3LWCA 4QPWA 3USSA 3OJBA 3SNMA 3WDVA 5A7WA 5BNNC 4DXTA 1DLLA 1SG3A 1J59A 3ZFFA 2H0BA 3NRUA 1UYZA 2V72A 2EF6A 3VHPA 4AAXA 4E4SA 1D4M3 2NMNA 3WW3A 5FP9A 3W20A 1ZM1A 1NCRA 2WJSA 2XKPA 3PMEA 3LFIA 4C1WA 5HBAA 1JHNA 4E4ZA 1POV3 1S2BA 1GU3A 4YVSA 4XUOA 5J1XA 1UO9A 1UU5A 3RS6A 2QQJA 4QX3A 4E8CA 4D6RA 1O4YA 2WLPA 5BNPB 5FMOS 3AKSA 3ZXAC 2VQ0A 4JRLA 2ZAAA 4XFIA 2HWB2 1QWRA 1W99A 3ZSLA 3ZSMA 1CVNA 1DQ2A 1MQTA 2BJSA 2JG8A 4LHLA 2C0ZA 4Q0VA 3ZLIA 3ZPOA 5EHDA 2A1XA 2VOTA 1W6NA 1ENSA 1GP4A 2P3IA 4XJUA 4KMQA 2RR12 3GCWA 5K0UC 4CRQA 2BNNA 4LKSA 1XNKA 1LGCA 2VU9A 1VAVA 4ZHNA 3AYAA 3NO8A 4LK6A 4QT6A 4XOGA 5D1IA 2ZAHA 1XXNA 4EV0A 5CG8A 3KV6A 4QKFA 3BTZA 4OQ8A 2EALA 4OQ9A 4UFKA 4CU6A 5C4WB 2YROA 5T55A 1QHDA 4GWMA 1HV0A 3TNQA 4ATEA 1W28A 4RD7A 2I74A 1QJY1 4MVTA 5CG9A 1MZ6A 2Q1FA 4GKYA 5LEKA 3H9AA 5DUUA 1JW6A 2VAUA 3EHKA 3HVDA 5IAVA 4ZU7A 4DQAA 3MBWA 1BK1A 4NJ4A 1U5IA 4TYSA 1S0EA 1H8VA 1AR91 1L7LA 1D2QA 2Z5WA 5LEJA 4LJHA 5LWBA 4HSJA 4MSVA 2ZX3A 4K20A 3RVHA 4A41A 1AYN1 1NE4A 2EA7A 3ILRA 1XNAA 2NPIA 2XBO2 4LO8A 4M3CA 1VJ2A 2YB7A 3J8F1 1AHSA 2NP0A 2VM9A 5KR7A 1IS6A 4MH0E 1RUJ2 1KFXL 3M3QA 4Q4W1 4QD2A 4QXBA 4JKKA 2UU8A 4L92A 4W4ZA 4IEYA 4A44A 4DEVA 1F35A 2ZGQA 1UOJA 3RZJA 2A71A 3OBZA 4Y20B 3WY6A 4N9IA 1IKQA 5EJZB 3VZNA 4H7MA 1PZ7A 4KQ7A 4LBNA 2ZZQA 2IXHA 2YY1A 5EFUA 4EZHA 1COV2 2QJVA 3GZTB 4DRRA 2OIIA 4B1MA 1QOTA 4JRAA 4AL9A 4K6BA 2VQUA 2PHFA 2D6MA 3O1MA 1US3A 1HB1A 5FYTA 1AL0G 2Y6GA 3HWJA 4QPIA 4FTBA 2ZBJA 2ORZA 3VBOB 1LENA 4Q2FA 1ZZ7A 2YC0A 5CB7A 4AXOA 5DAXA 3WDUA 5A3NA 1IG3A 1WKYA 1R082 4BIOA 1WMEA 3VBRC 4YZ5A 1RUH2 3D3AA 2WS92 1GZWA 4HKLA 5C3QA 3H42B 3N7JA 5HCHA 4DY3A 3GM8A 1H8TA 2BBAA 2GNMA 5FYHA 4TWTA 2BTVC 2HBUA 2XDVA 5FZ6A 1P8JA 4D6QA 4BMBA 4UFHA 1JZ8A 2D6NA 1QJEA 1WD3A 2DU0A 3KCYA 1IQAA 1X9PA 1FAYA 4GMP1 2VW0A 4FPEA 1H2MA 3TN91 3VKMA 4LO5B 4GAZA 2OZ6A 2R072 3DPRA 2Y33A 5KHKA 1REEA 4FT8A 3LQCA 3IWZA 3UGFA 1KEXA 3BU7A 1QF3A 2B9UA 1XE0A 3VDDA 1HV1A 5FAXA 3PUSA 1HRI3 3OEAA 3POFA 3U10A 2BNOA 2OW4A 2WQ8A 1DHKB 3H1WA 5KHHA 3K4DA 1OF3A 2SBAA 2WAOA 1LHWA 1H30A 2WWUA 1RIRA 3M70A 4L2NA 1V9U3 4CDWB 4ARXA 4Y33A 3POBA 1XQNA 2JDMA 2XUEA 4MOAA 2C24A 1AX0A 4DRVA 2ZACA 4F7ZA 3ZXEA 2N7GA 3B5LB 4XXPA 4Y1VA 5FJKA 3DYMA 1YEWA 2PHXA 2WKKA 4IEPA 4NROA 4AVAA 4UFMA 3JZVA 5A3WA 1UX6A 5IVVA 3BTYA 2QQKA 3MFAA 5FZOA 4COZA 1LOFC 2ZGUA 1JS9A 5FZ3A 1AR82 1QJX2 1Z0HA 4WBBA 1MS1A 5A1FA 1W2OA 2W91A 5T5JA 4P9JA 3FFQA 2E6VA 2Z4FA 2XLFA 2HWB1 4LNVA 3SH4A 2VMFA 2CU5A 3K2OA 3U14A 3CJIA 2EXKA 2X5IB 3RQ0A 4LORA 1VB4A 1NLQA 2RS32 4JDNA 1IS4A 3TAYA 1RUE2 2RR11 3KZ4C 4YW7A 5FMCA 2VBPA 4AEDA 3J26N 2DYCA 3AC0A 4AEJA 1TQ5A 3RI9A 5ACA2 5GJ6A 2ARCA 1RUF3 2BVBA 4JC1A 5A7OA 4XFCA 1LU1A 2C5DA 3LF7A 4HVRA 1VBC3 1W8FA 1NKGA 2Y26A 4AGGA 1A8MA 1LULA 5I0RA 1IOAA 2CTVA 3HD8B 3KD4A 4QKDA 4KWKA 1RYYA 5DAWA 3UKTA 3ZYGA 4HBNA 4IE4A 3ON7A 4P00B 4XJAA 2IXIA 1AX1A 2I2SA 2PHRA 4UFLA 4CPBA 3ES1A 4IV3B 3VD3A 3I3BA 4MYEA 1LR5A 1OC1A 3BGAA 4WVZA 4GMP0 3CIHA 1SHWB 2ID4A 3AP5A 1XNTA 1YFYA 2PFWA 3NV1A 4HK8A 1V00A 2HWD3 4KGGA 1K3IA 3JXSA 3Q8CA 2W0XA 4BE3A 4MX3A 3O12A 1GR3A 3POEA 5FYMA 2XBO1 4IV3C 3IDEA 2PA7A 3LFMA 4GJYA 4AHXA 2W1SA 3ZXGA 3MHZA 3QCWA 5C8CC 4PBPA 1ULGA 1ULCA 2CDPA 3NWKA 5DMYA 2R7EB 2BNMA 3ZM8A 1C57A 1ND2B 1N3PA 1VBE2 2Y6JA 1C8M2 5KXBA 5J98B 5BXXA 3KCCA 2QBXA 1TG7A 4MV2A 2IUWA 2RS13 4Y22A 1RUI2 2ZOEB 1COV1 2D6KA 4N7UA 4FPLA 4UW4A 1OA2A 2WT0A 2K9ZA 1UZ0A 3FJSA 2Q1MA 3WCSA 2DVDA 2ET7A 4RR3B 2W2IA 3ZO0B 1H6YA 1ZRIA 1R092 1W6OA 1UX7A 2BUKA 3VBHB 1ODMA 4YSFA 2X53S 4MGQA 4WM7A 1AR62 4YM0A 1CX1A 3BCWA 1H4GA 2BOJA 2ZGTA 1QJFA 4LA2A 3LEIA 4NUBA 4Y1XA 5BNNA 5BYNA 1R081 5J37A 1F15A 1NT0A 1RUH1 3LSEA 2WS91 2Q0AA 3MLJA 1X8EA 5FFOC 3WXPA 3SQOA 1RHI3 2RE9A 4BOWA 4LTAA 5KXDA 2ERFA 5FY7A 3H1YA 4KI5M 4AVCA 1HX6A 1C4RA 2B8MA 4NWVA 2JICA 5LBBA 1YC61 4HPKA 2YHJA 5L7OC 4E2GA 5CEHA 1DU3D 4AQTA 1W8OA 2R071 3NAPC 3I2OA 4EN9B 4F83A 4QQOA 3TRSB 4MGSA 4WV8A 4ZS2A 4EN8B 2VMGA 2C1FA 2JG9C 2YPDA 1W06A 2OA2A 3DECA 1BEV2 4META 4K21A 1DQ1A 1VAMA 1KITA 2YV8A 2Y64A 2WNUA 1K42A 3OY8B 1NCQB 2CNAA 4EQVA 1SLTA 4WVMA 4XETA 4MXWB 2LW8A 3FE5A 3JBG3 2Q8CA 4Q4X3 1FI2A 3K46A 3AVSA 1UMZA 1JU4A 2P37A 3C7FA 5FYCA 3ZKYA 3HNYM 4CDXA 4YNIA 2RS52 3DL3A 2VOKA 2JIJA 2FBEA 3UKVA 3RZKA 1LEDA 1S0CA 2QDNA 2W46A 2WFPA 3ZIWA 1WLTA 4Y26A 5A32A 3NJVA 1AR81 1QJX1 3JU9A 4NPLA 5BNOB 4YVWA 1PZ8A 2J1AA 4KH9A 3DEMA 5T52A 3R6SA 1IG0A 4MUVA 1WW5A 2Y38A 3OF1A 1W9WA 3OBAA 1ND3A 2JENA 5IVEA 5KC6A 2O14A 3IMMA 4OVEA 2TEPA 5HPOA 3P1IA 5LCWL 1RMU2 3HPNA 5FY8A 4CTEA 5FWJA 4YGDA 2RS31 1E57A 1RUE1 3OB8A 1XYNA 2RV9A 3ASIA 4QM9A 3B9IA 5CBLA 3E6DA 1GKBA 3KVAA 3VZKA 3BPSA 2PAEA 5BUVA 1E5RA 3FFZA 3OEBA 5GZCA 2DUPA 1OLMA 4V1PA 1GQHA 1NLRA 1QXJA 5ACA1 1ASJ3 3U0ZA 2BYVE 1I6XA 3VZOA 5F1RA 3FLPA 1PK6B 3DKWA 3WG2A 5KXCA 1TZOA 4LBQD 3ZN5A 1CIYA 1YQCA 3ROUA 3RZZA 4YFZA 2MNGA 1UWWA 1GNHA 1TNRA 2HWF2 5FLHA 1YQ2A 1DP0A 2KA3A 2NN8A 2Q4SA 3ATGA 3GALA 3MIFA 3MUZ1 4JDMA 4ARYA 1RUG2 5A7WB 2LUWA 4XF0A 1O59A 5FP3A 2XVGA 1LGBA 1K12A 1XU1A 4JAAA 1GV9A 1F4AA 1QH7A 4RFRB 5F2SA 3RYRA 2A6YA 3CZUA 5EIYB 5FP4A 4YVSB 3D0SA 2WIIB 4QB6A 1FX5A 3SCHA 2CL2A 1TME2 2F6BA 3GYDA 2CAVA 4RSUA 3MW2A 1UKGA 5FY4A 1NZIA 5A1AA 5D2AA 4U2AA 3HIFA 4JQRA 3ZFFC 1XYOA 2GSYA 3HMYA 3WW1A 3N9MA 4EN6B 2VO5A 1EPZA 1PO22 1MQTB 2JG8B 3BODA 1NCRC 2YDEA 2IZWA 5CVRA 5F3GA 4PIZA 1EY2A 1Q56A 3EB7A 1W6NB 4CEYA 4V2VA 3AKQA 2KD7A 3OD4A 1GUIA 4LLOA 2DVFA 3H50A 3IDBB 1VBE1 4CSWA 4NHKA 5K7PA 1C8M1 1LRHA 1K5MB 1B09A 3IT8A 1RUI1 2WL1A 4LBQA 2G9FA 1LOAA 2YC2A 2VVFA 2WABA 1W2NA 2ZZJA 2R062 1QJY3 1SPPA 3CO2A 5IUQA 4DS0A 2WA3A 3ENRA 1R091 2HEYF 5FZFA 2VC9A 2XKOA 2HLEA 3U11A 4CUAA 1AR61 1HXS2 1S0GA 2A3YA 1V6OA 4IERA 4FBFA 1OSGA 3ZN6B 2VZUA 1BK0A 1YCIA 3DXUA 1ZRFA 4A7KA 3MIDA 1OOPA 3EQEA 1AYN3 1HDKA 4ZZ5A 1SBDA 3CKHA 5LA1A 1LOFA 1VRH2 2I45A 2WA4A 4M3CB 3LPFA 3ZMOA 3IMNA 4BQ3A 2VCBA 5FXXA 4GQ7A 4YW6A 2ENRA 1W03A 2K2SA 2JXAA 4XQWA 2E32A 3NNMA 2AEZA 4XURA 2DV9A 1BLZA 3EO6A 5DN2A 3JUUA 4Z8BA 2IXCA 2VZQA 2VZ1A 2VD7A 1EP0A 1V6KA 1LAJA 1EUUA 4YGEA 2D6LX 1BEV1 2GN7A 1YFWA 4HL0A 5B4XA 3WDWA 5G04L 3ZXJA 1I5ZA 3CDZB 3T1MA 3X29B 4DMIA 3POYA 1PVC2 4TTGA 4QB1A 2JDNA 3JD72 1Q8QA 3BOWA 2VZ3A 3PURA 1UYPA 3ZSKA 2JDPA 4PQQA 3ACHA 4QPIB 5I8TA 1CZVA 1OQ1A 1WD4A 3SISA 5T50A 2OZJA 2GP3A 2R30A 1DQ4A 2RS51 1AXKA 1CJPA 4YG6A 5JVVA 3UETA 3WINE 5HXMA 5FMDA 1WLDA 3AP6A 5FDBA 3S57A 2P3YA 1TEIA 2J1RA 2ZPXA 2ZX1A 3OGGA 1PGW2 4NIDA 2VUJA 2QNKA 3PUQA 4FI9A 1NAEA 1H8TB 4AGVA 5E1RA 4CXYA 2CGPA 3IB3A 3ILFA 2GN3A 3N36A 1D0HA 4ZU5A 1S0DA 3F2ZA 3APBA 1BBT2 4R9BA 4OUSA 3T2TA 4AGRA 3POWA 4GMP3 4BK5A 3RZMA 2W39A 2HWC3 1C8NA 3OUIA 1RMU1 5CZKA 5J3UA 5M0TA 2HJIA 2GNBA 3NKGA 1O91A 3DPRB 4AFAA 5A7PA 3I2KA 1EV13 5FKBA 2O8OA 5A33A 1W6PA 1HKDA 5DDJ3 2AH2A 2WSUA 4FQ4A 5CYYA 5LA9A 5IT6A 3AK0A 2ET1A 2QQOA 2PXJA 2VPVA 3G6JB 1MZFA 1UZYA 2IC1A 2VULA 3HR9A 1D0GA 1NYWA 2XJPA 4V2WA 2ZGRA 4UW6A 3IPVB 3DPRC 4NO4A 5C7GA 4FOQA 1EAH3 2HWF1 2WSVA 1YXWA 1W2TA 1E5IA 1G7YA 3AB0A 5L9BA 3VDDC 2DCJA 1NG0A 3LIGA 4CEWB 1GNZA 4QX7A 4XFHA 4A7ZA 2UURA 2WO2A 4IXLA 2ZEWA 4GB33 3ZVXA 5IATA 1DGRA 2DBIA 5GLZA 2WNOA 4I30A 1GNYA 4NRQA 1G86A 3N35A 2H6BA 5FO8B 5JI9A 2VQTA 3VL8A 2CGOA 2PAMA 3AL5A 1W8NA 4QKNA 1PX4A 3DGTA 3ZXLA 1TME1 1N1SA 2V5DA 3LD8A 4FXGB 3E97A 3ZYIB 4CP9B 2CV6A 1W8ZA 1RUD2 3VBUA 2HWB3 3RNSA 4YM1A 4W6YA 4I0AA 1PO21 1ZBA2 2VZPA 3WHUA 2ZHLA 3A23A 4L8QA 4NVPA 4UBHA 2GMPA 3JB4C 1XB9A 3WZ1A 4Q0UA 3W9AA 1OKOA 1QJU3 4JV4A 3KQ4B 5F5IA 3U78A 5JWPA 1MEC2 5TSWA 2AEYA 3CMGA 3MEPA 3T0AA 5GLVA 4AEDB 3HJRA 1ACCA 2VCAA 4NMIA 4O9GA 4LO6B 3V56A 4FOVA 2E7TA 4A6SA 3KV9A 1H1MA 1HRV2 2R49A 2JG9A 4YFWA 3CJIC 1SLIA 4HMZA 3I2JA 2XXZA 1Y9QA 2OUJA 1WCUA 4PF1A 1WMDA 2R061 4UFIA 1AXYA 1B35A 4QHOA 1AYM3 3U4SA 1ONAA 4CUGA 1OD3A 1POQA 2XQXA 1Y7BA 3I3QA 1HXS1 2RM22 2XL7A 5E6HA 2W47A 4FOYA 5L73A 4D94A 2E7QA 1FPN3 3V0BA 4LR4A 4JZRA 3O1RA 1MVQA 4XCBA 5FBJA 1O3SA 4PF5A 1J3PA 4LBJA 5FQ0A 2QZ3A 4XTPA 2PHDA 1JHJA 2GC1A 4Q1RA 4N43A 3ZXFA 4AQ2A 2BDRA 3D5OA 3KHCA 2XBO3 5JMOA 4LULA 3WDYA 3INAA 5K9YA 1MS8A 1K45A 1AJOA 4ES9A 2ZKLA 3D82A 3AKPA 3WP6A 5K4LA 1F2NA 1J83A 2WUHA 3WW4A 1XNDA 4JGZA 3ZYPA 2XGXA 2CWMA 3LAGA 1MS5A 3ZMNA 5DZGA 4LBLA 3J7MA 4YZ1A 3MW3A 4IGQA 1UIKA 1F5JA 2ZX2A 5CAZA 1O3QA 1WCSA 2JE8A 4CXXA 1AR73 4IEWA 5DG1A 5FPXA 5FZCA 2WNVB 2NMOA 5LA0A 3C7EA 2Y34A 2JKXA 3ALQA 1ZZBA 3I2GA 4XDOA 3P3NA 1TE1B 2BV4A 3OGRA 5DZFA 2Q8EA 4SBVA 5FLIA 1PVC1 1QGLA 1VIWB 2KXLA 3JD71 2VVEA 4CA9A 4E8DA 3PU3A 1UPSA 3BN6A 3IN9A 3Q9OA 5ANQA 3HAGA 3HN3A 4D7SA 5DAQA 4WM7B 2UYBA 3SEPA 4PDWA 1U5YA 1W8HA 2QFEA 2SLIA 3J7LA 3KSCA 1R083 5BNNB 2Q1ZB 1RUH3 2WR9A 2WS93 3I8TA 4O61A 2IFWA 5LRSA 1PGW1 2GC2A 3H8OA 2BEOA 2HYXA 1J3QA 4NHLA 3WX5A 1BBT1 1W9FA 2ES3A 2Y6FA 3C3VA 3ITQA 3VZMA 5A6QA 4AYUA 1LHOA 1H6XA 2GDFA 2IXKA 2W92A 1BCXA 1HN0A 2OPKA 5GALA 5T54A 3RYKA 4DNYA 4I02A 5K0UB 2YZ4A 1GQGA 2BWAA 4IL7A 1YO8A 5C9AA 4YG0A 1W3VA 4FOWA 1ZZ8A 3K77A 3R05A 1VAKA 4QQPA 5JZGC 5T5OA 2VOVA 2B46X 3MO4A 2Y8KA 1JU3A 5GLTA 1KXGA 1SMVA 4B4PA 1AF9A 3MYXA 2DF7A 2PYTA 3Q8FA 3S7IA 4FP3A 3W58A 2WNUC 1HB2A 4UFJA 2YBSA 3VBSC 4C0HA 1G9FA 3VZJA 1PIV3 1W8UA 2FCTA 1YYNA 4XJZA 4HZFA 3ACGA 3AZZA 3RZLA 4KGQA 3AFGA 3SCFA 5FYIA 3LOBA 5C33A 5JIUA 2UWAA 1JODA 3PTRB 2R042 2XJUA 3B69A 1W6QA 4CDXC 4JCKA 5GLUA 1LOBA 2LS6A 1RUD1 3LZZA 3M1HA 4MLOA 4IEVA 1LHUA 2GZWA 3RWNA 5FOJB 2VW2A 3NL1A 2QZ2A 2DDUA 2GU9A 4XJ8A 3O7OA 1IKPA 1S55A 1YHFA 3FHAA 1ZBA1 1I5PA 4LE4A 2VMDA 4BMEA 5I93A 2RS33 4UW5A 1RUE3 4AFCA 5IK4A 1JYNA 3KF3A 2Y6HA 3I3EA 1YI9A 3FUOA 1MEC1 4AZZA 4K8RB 3IBMA 4OI4A 2GP5A 4YVWC 4TZDA 1CIWA 1NA1C 3BU0A 4Z1VA 3KGLA 4BLJA 4JGYC 3HNMA 1DQ6A 1W3XA 4P9IA 1ND3C 1GICA 1HRV1 2ILMA 4XZUG 4C0BA 5FY0A 5IW0A 4MXVA 1RGSA 2PHTA 1SCSA 2UWBA 4AEKA 2ETEA 3AJYA 3SEEA 5JSOA 1HQLA 2E53A 2J1EA 5D21A 5FPBA 2WBKA 2A75A 5FY1A 2FMDA 3ORJA 1UY0A 1JYWA 3SCGA 1VRBA 3H8XA 2DVBA 1UXZA 1PO12 1NUKA 3PL0A 4RHV2 3UYJA 1F8VA 3GHMA 1KQRA 1YUDA 3FN9A 5C3RA 1I3HA 3MF9A 3LDBA 3ME2A 4ISRA 1IS5A 2GAUA 1R1A2 3VBRB 3ZYFA 1CAVB 3O1SA 5FZHA 2VUAA 4QB2A 5DAPA 4S2GA 2OQ6A 3AYCA 3VB9A 2TNFA 2XVKA 3I3DA 1CAXA 2PAKA 2D7FA 4TLGA 5HI0A 5E8AA 1JZ5A 1UOGA 2CGNA 3ZFGC 4AFDA 4C90A 4EYUA 3FZ3A 3MV11 3GBWA 4ASKA 2XH6A 2LM3A 4HVQA 5IHRA 5F5QA 4KWLA 2P6CA 4NIIA 3OOXA 2YGLA 2Y0IA 4XUNA 4OYUA 1VBE3 2Z69A 3D6EA 1C8M3 4QXKA 2LTNA 4QAWA 3LDRA 3VDCA 1BHGA 4NHXA 1SLLA 3U07A 1RUI3 4Q4Y3 2DUQA 4M4RA 4YWAA 1C1FA 1H9PA 1J1LA 3PJYA 4PLNA 4A3ZA 3RWKX 3H3UA 4CEYC 3WG4A 1W6MB 4LA3A 4BQ2A 1R093 3MDPA 4O65A 1GWLA 2MPFA 3V0AA 2VJXA 4BIFA 4XUQA 3MIEA 5LBCA 1JTZX 2HWE3 4YW2A 3DYPA 3LB9A 4EN7B 5C6CA 2VNRA 2H6CA 3AZWA 1VBD2 3POJA 3WHTA 4NAOA 5C3PA 5C8WA 4H55A 4XVHA 4Y1UA 5FP8A 4XFGA 2GMEA 2X29A 2D5HA 4W6XA 4LKFA 4HXCA 5FZDA 2BPA2 2FDHA 2B4KA 4OI0A 1OI6A 2MHFA 3NVCA 2E9QA 4M4PA 1XNBA 1A6CA 3QLQA 1OD5A 5FUNA 2LRPA 1X9TA 4KU8A 1D4M2 1G8WA 4DPNA 2D97A 2Q30A 1S0FA 2UY9A 4Q0QA 1U12A 2I07B 3RZHA 1DQ0A 5JR7B 4UAPA 1UZWA 1OOPC 3IAPA 1SLCA 3AMPA 4IEZA 5LK7B 2PQSA 4IUGA 1YQ6A 3I49A 2JIGA 1IS3A 1WW4A 4MGYE 3A22A 1T6GC 1BEV3 5FXWA 2EXHA 3T4VA 1W9SA 3W21A 5FPLA 3UGGA 4XZPA 4IE6A 1A3KA 3CBNA 5LBEA 5FUIA 5JMCA 4QX5A 2WZR2 3A7QA 3OGSA 2VECA 4FO9A 2VNGA 2D3PA 2G4IA 4HETA 3M8LA 5FZKA 5A3UA 3B94A 3ZOIA 5CFCA 3B93A 4PQ9A 4U36A 2RS53 3L2HA 4XF3A 2QQLA 4GH4A 3KWVA 4RGAA 3WF4A 1X8MA 4I0WB 2DCYA 4NE9A 3AKRA 5EP9A 1H1AA 4QXCA 1RUC2 4XJ9A 1S2KA 3AZXA 3ZSEA 2XL9A 1QY4A 4IV1A 5CA6A 3VD4A 3FHIB 4NRMA 3RSJA 2A6ZA 1UCXA 2WYSA 5FO7B 4COVA 2BGPA 2R041 2D3SA 2YFZA 2E51A 4E4DX 4K3UA 2QQUA 4IEXA 5FWEA 5C71A 3S5AA 3F95A 4GA9A 1RMU3 5JOYA 1W9YA 5CKQA 4K40A 5C8CB 1V0AA
chains in the Genus database with same CATH topology
4CE8A 2JDPA 1OVSA 2JDYA 5A6QA 1OURA 2BP6A 2JDUA 5A6XA 4AOCA 3DCQA 5D2AA 2JDHA 1OVPA 1W8HA 2VNVA 5A3OA 5A6ZA 1W8FA 2VUDA 2BOIA 4UT5A 2BOJA 2WR9A 2CHHA 1OUSA 1UQXA 5HCHA 2JDKA 3ZDVA 1UZVA 2WRAA 1OXCA 2JDMA 5A70A 2XR4A 2BV4A 2JDNA 5A6YA 2VUCA 1OUXA 1GZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CE8 A;  2JDP A;  1OVS A;  2JDY A;  5A6Q A;  1OUR A;  2BP6 A;  2JDU A;  5A6X A;  4AOC A;  3DCQ A;  5D2A A;  2JDH A;  1OVP A;  1W8H A;  2VNV A;  5A3O A;  5A6Z A;  1W8F A;  2VUD A;  2BOI A;  4UT5 A;  2BOJ A;  2WR9 A;  2CHH A;  1OUS A;  1UQX A;  5HCH A;  2JDK A;  3ZDV A;  1UZV A;  2WRA A;  1OXC A;  2JDM A;  5A70 A;  2XR4 A;  2BV4 A;  2JDN A;  5A6Y A;  2VUC A;  1OUX A;  1GZT A; 
#chains in the Genus database with same CATH topology
 1CZS A;  1KD7 A;  4B1L A;  3OPW A;  3OTF A;  4M0H A;  3WG3 A;  4JKM A;  3ST7 A;  5SV8 A;  2B42 B;  5H9S A;  1W6P B;  5FZ4 A;  1RUN A;  2OKX A;  4QX8 A;  1IPK A;  3LSD A;  1H4H A;  1OT5 A;  1SEF A;  3O14 A;  1NQJ A;  1MS3 A;  3AM2 A;  1R64 A;  3KGZ A;  3HQU A;  4ZU4 A;  1WGP A;  2ZHM A;  4AI3 A;  2ATF A;  3WP3 A;  4QQH A;  1RUJ 1;  3OYW B;  3UNP A;  1E5H A;  4BYY A;  4FFH A;  1MS9 A;  1RTV A;  4HFS A;  1KJR A;  5T5L A;  5FXV A;  1IHM A;  4H3W A;  3NKT A;  4RQP C;  5CFD A;  1PO1 1;  4RHV 1;  4BA6 A;  1ZBE 3;  4E2Q A;  1UYX A;  4YZ4 A;  1DBN A;  4E27 A;  1QEX A;  2R1D A;  4IE7 A;  3THC A;  4C91 A;  1I9R A;  2P34 A;  1J84 A;  1UW8 A;  4IE0 A;  1WLC A;  1R1A 1;  1CON A;  2VMH A;  1F31 A;  4PI2 A;  2GC3 A;  3DCQ A;  2Y0O A;  5IK5 A;  2QQP A;  2IVJ A;  3AVR A;  2W94 A;  3ILN A;  3VZL A;  1T6B X;  3PUH A;  3ES4 A;  1PO2 3;  1L3J A;  5FRE A;  3I3M A;  3AMN A;  5J36 A;  2XG3 A;  1W8T A;  5DUX A;  1NXM A;  4FP2 A;  3PLQ A;  3PVN A;  4Z82 A;  1V6I A;  3AX4 A;  4R9D A;  1S0B A;  3VHO A;  5L7O B;  2XJS A;  4QMA A;  2RHP A;  2BVV A;  2OXB A;  4ASM B;  5IVY A;  2AUY A;  3NNL A;  1AJK A;  1CWP A;  1HB3 A;  3NAP B;  2DUO A;  4I3P A;  3VBU C;  1WCK A;  3OUJ A;  5CKN A;  3VUO A;  3PJQ A;  3QOP A;  1VB2 A;  4SLI A;  3S7E A;  2VTX J;  4AHW A;  2VR4 A;  2JG9 B;  1SFN A;  5EYY A;  2JDZ A;  1OA4 A;  1N3Q A;  1LB2 A;  2Z42 A;  1WZX A;  2FCU A;  4GKX A;  4EZ4 A;  1JUI A;  3I7D A;  1HB4 A;  4YZ2 A;  3WF1 A;  3T0B A;  4QKB A;  2ZCW A;  1OFS A;  2W08 A;  3S30 A;  4Y5S A;  3JB8 A;  4AVV A;  5JZG A;  4K7J A;  1HXS 3;  4QPG A;  1HRI 2;  4K8F A;  1C28 A;  4BM8 A;  3MLL A;  1S0I A;  2P5B A;  3GDB A;  1XSR A;  5A3M A;  1R1Z A;  3ZN4 A;  1VBD 1;  5FZ7 A;  4OI1 A;  3NNG A;  3N7K A;  4QQ2 A;  1V9U 2;  5EXO A;  3VBS A;  1SQ4 A;  5FQ0 B;  1G9D A;  1YJL A;  1B35 C;  4XHB A;  2HYK A;  5F39 A;  1UY4 A;  2JE9 A;  4XF9 A;  3PUI A;  4LUM A;  1SFP A;  4XBN A;  4BJ0 A;  4AHY A;  3WCR A;  2JDY A;  1UMI A;  2BZD A;  4XDP A;  1QH6 A;  4GWJ A;  1FOD 2;  1D4M 1;  5FYU A;  3EJK A;  1XNC A;  3HQX A;  2PHU A;  2VY0 A;  2XON A;  2XWB B;  3OD0 A;  4IEQ A;  2D6P A;  5IVJ A;  4M00 A;  5FPV A;  1H1I A;  4N43 C;  2VMC A;  5BNP A;  3VL9 A;  3KVB A;  4RS5 C;  2EIG A;  2ZJC A;  1C5H A;  4URT A;  4XIO A;  1OUS A;  3I2I A;  5JAX A;  1BJQ A;  3ZFE C;  3V64 A;  1NA1 A;  4XHX A;  2C4X A;  2CWS A;  3L9J T;  4JGY A;  1A78 A;  2WZR 1;  4JGZ C;  2XQR A;  3OGJ A;  2C6S A;  2Y60 A;  1YQ8 A;  3WNO A;  4AQS A;  4N8M A;  4C8D A;  2FHR A;  4UYB A;  5FY5 A;  3WT3 A;  4UF0 B;  4I2O A;  4DO0 A;  4OI2 A;  3A0N A;  1OA3 A;  4PDW B;  1FNY A;  1QU0 A;  3WF2 A;  5FYS A;  1Z7S 2;  1RUF 2;  5FUP A;  1CPM A;  4N9H A;  1VP6 A;  2DVA A;  3WQB A;  2PLV 2;  2VZS A;  3PTY A;  5AVP A;  3E1F 1;  4BQ5 A;  1RUC 1;  1QIQ A;  4H7L A;  1UOF A;  4E2S A;  3EMR A;  4WVV A;  5KBF A;  3W5N A;  1DYK A;  3AMH A;  3FC0 A;  3AFK A;  3ZDS A;  3URF A;  1D2S A;  5FMO L;  4PDW C;  1ENR A;  4ZKT B;  2YU2 A;  5LZ6 A;  1C3H A;  3TEX A;  3ZFF B;  3R0R A;  5E89 A;  2R16 A;  4ZPI A;  3ZFG A;  5EWS A;  3N9N A;  2QQI A;  1NCR B;  3VHN A;  1Z78 A;  5JI7 A;  5FZE A;  1VMF A;  2EIC A;  2HWD 2;  2FDG A;  1W04 A;  2VH9 A;  2W68 A;  1DLC A;  1RC6 A;  2RDN A;  4BWO A;  1RXF A;  4ASL A;  4IGO A;  1VMJ A;  2B45 X;  5CU1 A;  4CCN A;  5J48 A;  2G19 A;  3T09 A;  3RPQ A;  3KT4 A;  4YW1 A;  1LHV A;  5HCA A;  2DCT A;  3RRD A;  3TEZ A;  4LK7 A;  4X8N A;  4Y5T A;  2EAK A;  1LTE A;  1OPO A;  2PQQ A;  1PZ9 A;  3GXU A;  3HOB A;  3H7Y A;  3KMH A;  3THD A;  1JXN A;  5L9V A;  3BIW E;  1QJZ A;  2D43 A;  4MGK E;  1Y9M A;  3LA2 A;  2RS1 2;  5C3S A;  2WNE A;  2DCK A;  2ZKN A;  4HKO A;  5JXH A;  1XE7 A;  2YMZ A;  2DFB A;  3E5X A;  3ZXK A;  5C9A C;  4DIQ A;  5F6K A;  1CGP A;  1GWM A;  1XU2 A;  2YXS A;  3E5Q A;  4PJY A;  4CXW A;  3MI8 A;  1X33 A;  3HBK A;  5JDB A;  2VW1 A;  3LIH A;  1RVF 2;  4XBL A;  4HLT A;  3BVC A;  1XOY A;  3VBO A;  4KG0 A;  2ZHN A;  5JOW A;  1GQP A;  2QQN A;  3MPB A;  2OYZ A;  2QVS B;  1W6Q B;  1RUD 3;  4BIS A;  1HJF A;  1LCL A;  3CJX A;  1RXG A;  2BU9 A;  3MIG A;  4XDQ A;  5I0D A;  4FXK B;  1PM7 A;  3BPZ A;  2XJV A;  1QXR A;  4CCM A;  1JZ6 A;  1UAI A;  2Y6K A;  3H3Z A;  2PHL A;  2B39 A;  3L2Y A;  4UOJ A;  2VGD A;  1MEC 3;  2VOW A;  1AR9 3;  2ZEY A;  3GZE A;  3N7L A;  4A3X A;  5FXZ A;  2XHN A;  3FL7 A;  3K75 B;  2CYF A;  1VBB 2;  1YFU A;  4JHT A;  4XMI A;  1T2X A;  3RZG A;  4MGT A;  5FZM A;  3J8F 3;  4Q1P A;  3WEZ A;  3OSD A;  3FBY A;  4Q4W 3;  4AOC A;  1OHF A;  4OUL A;  3Q8A A;  3ZR6 A;  4FTS A;  2WYF A;  1DGW X;  4S2D A;  3AL6 A;  2HEW F;  4BCU A;  1M4W A;  3QH6 A;  5F6L B;  5LRR A;  3THP A;  4E4H A;  5J96 B;  3O1T A;  4BQ4 A;  1DIW A;  5KWR A;  1O3R A;  1HRI 1;  2A6X A;  1UQX A;  2ZHK A;  5J09 A;  2CDO A;  2VXR A;  3UK9 A;  4Q4V 2;  2VTX A;  3VKN A;  3DN7 A;  4CDW A;  1GWK A;  3MV0 1;  3SLI A;  2WT2 A;  2EXJ A;  4P9Y A;  5F32 A;  1V9U 1;  4QX2 A;  4Z2A A;  2XR4 A;  4YGB A;  1OUX A;  1CX4 A;  2C26 A;  1SBF A;  2NYY A;  3CL1 A;  4Q26 A;  4RFT 0;  3TWI A;  4YW4 A;  4X8P A;  2BFU L;  5F7U A;  1KS5 A;  3LEK A;  1Q43 A;  4CCK A;  4HG6 B;  3U4X A;  2G9G A;  3AXE A;  4D69 A;  1FOD 1;  2JD4 A;  1FT9 A;  2JDH A;  3OPT A;  1AXZ A;  1G6N A;  5F9T A;  1XJA A;  2BOI A;  1V6J A;  3WF0 A;  4P5H A;  5GZF A;  2FCV A;  1GZW B;  1HIX A;  1LNS A;  1I1E A;  4XAB A;  2VVD A;  4OHV A;  4RL7 A;  4QU1 A;  2RDR A;  2X5I A;  1CAU A;  1W05 A;  2W52 A;  3I2D A;  1KJL A;  4P9L A;  4TSV A;  1JYX A;  1HW5 A;  3WNN A;  2VXJ A;  3TN9 3;  1OVS A;  2BWC A;  4LHN A;  2V4V A;  3T3Y A;  4Z2W A;  4R8H A;  3V0A B;  4Y4Y A;  2ZGO A;  5AFB A;  1N1Y A;  1Y3T A;  4J25 A;  4OLL A;  1PVX A;  4B7E A;  3VDD B;  1ASJ 2;  4FSJ A;  1Z7S 1;  1RUF 1;  5H9P A;  1MZ5 A;  4PI0 A;  3PIG A;  5FYV A;  2YGM A;  2FZ1 A;  3LA7 A;  4RQP A;  4YW5 A;  2PLV 1;  3WW2 A;  4XCA A;  3TEW A;  5IVC A;  4L11 A;  4ZXK A;  1YIP A;  3B7M A;  2V5Y A;  4YGC A;  2J1U A;  4JQT A;  2DVG A;  3IIA A;  3K51 A;  1LOG A;  2ADD A;  3WQ1 A;  2ZGK A;  4FFF A;  4QQL A;  4FPK A;  4HON A;  4DIN B;  1RUG 1;  1YIF A;  4F3J A;  3PHM A;  2NQY A;  5EV7 A;  4Q29 A;  1RJ7 A;  4Z92 B;  5KXE A;  3PU8 A;  3ACF A;  2R0F A;  1CAW A;  3H8U A;  5FZO B;  1GMM A;  5EJ1 B;  2HWD 1;  3N7M A;  1IPJ A;  4CDU A;  1YI7 A;  4WZF A;  5H9R A;  4W8J A;  3SMH A;  2ZGP A;  4DEQ A;  1DG6 A;  1RJ8 A;  2DBN A;  3U1X A;  3UL2 A;  1XRU A;  4FCA A;  3WQ0 A;  3CF6 E;  4A7Y A;  3GZU C;  4Q8K A;  2AYH A;  3HN1 A;  1AL2 2;  3CJI B;  3I97 A;  2ZA9 A;  4JKL A;  2A73 B;  5IK8 A;  1AVB A;  2RR1 3;  2F4P A;  5CNA A;  5DAV A;  5GKA C;  4BK4 A;  1Q8P A;  3NV2 A;  4BH9 A;  1WW7 A;  5GLW A;  4AF9 A;  1XYP A;  2D98 A;  1RL3 A;  2BER A;  4Q0P A;  2RMU 2;  4XFF A;  4LBO A;  2PEL A;  1GZ9 A;  2YFU A;  3M3E A;  3VDB A;  1A34 A;  2YPJ A;  4KL1 A;  4LMF A;  2PTM A;  4QHB A;  3VBH A;  4DXS A;  4ZXE A;  3MIC A;  4LIV A;  1RVF 1;  2Q8D A;  5CFC C;  2R04 3;  1O3T A;  2QQM A;  1UMH A;  4J1W A;  2EIE A;  3LPG A;  2BRT A;  4LLF A;  4GH4 C;  3ZYH A;  2RJL A;  4XQ4 A;  2UYA A;  1SLA A;  4LKD A;  4CP1 A;  4NIG A;  2GMM A;  3WV6 A;  3ZIX A;  3BAL A;  2YBK A;  1W8W A;  1V6M A;  4IV1 C;  4ATF A;  1AYN 2;  2Q5T A;  1DZT A;  2RG4 A;  2VZT A;  3LDK A;  4XYX A;  2FMY A;  3OG2 A;  5LAS A;  4CE8 A;  2ZGS A;  4DUW A;  2W95 A;  4RS5 A;  2A6W A;  1VRH 1;  1VBB 1;  4ITC A;  5EPA A;  1H9W A;  4NR1 A;  3J7N A;  2EXI A;  2JDU A;  1ZRC A;  1LES A;  2G9Z A;  3KS7 A;  3ZFE A;  5CIS A;  1RUJ 3;  1LOC A;  4IND A;  1QXP A;  4OUM A;  4YYO A;  4NPR A;  4QU2 A;  2JX9 A;  1UY3 A;  2BGO A;  4YZ3 A;  1OQD A;  1HQW A;  4HVO A;  2R1B A;  3RI8 A;  2AEN A;  3GF6 A;  3LOI A;  4MGI E;  3HEI A;  5AVA A;  2WWJ A;  3AYD A;  3IDA A;  5AC9 2;  4IE5 A;  4Q4V 1;  1NCQ A;  1COV 3;  4Y22 B;  4D0Q A;  4QXH A;  1IGO A;  1KDM A;  1OBN A;  2A3X A;  1R1A 3;  4B8E A;  1STM A;  4AR2 A;  5A80 A;  2JJ6 A;  4WM8 C;  4AI1 A;  1VPH A;  3N3H A;  3D0J A;  1KDK A;  1SDD B;  4LIT A;  4LUK A;  5F2W A;  2HKX A;  1W6O B;  4UW3 A;  5CFD C;  3E6C C;  1YNA A;  3G7D A;  4L9B A;  4N90 A;  1KFU L;  5D8A A;  5B2G B;  5GZG A;  1KS4 A;  1JOP A;  1GFF 2;  3BOP A;  5FLJ A;  2FDI A;  1RIT A;  5FZ9 A;  4JVA A;  1LOE A;  2XML A;  1VMH A;  1WWY A;  4D8M A;  5IK7 A;  2VCC A;  5FJH A;  3O1V A;  1PMH X;  4I3G A;  3TEY A;  1JBC A;  5IVF A;  2XPJ A;  1OMI A;  3R4S A;  4HOO A;  5J7M A;  1WA4 A;  2QKD A;  2H0V A;  4Z07 A;  1OLR A;  3SXW A;  1PX3 A;  3AZV A;  2HWC 2;  4OMC A;  4WVW A;  1CN1 A;  1LEC A;  1RUO A;  2RVA A;  4HPK B;  3TYJ A;  4OHW A;  1W2A X;  1X82 A;  2D3R A;  3K3O A;  3LCP A;  1EV1 2;  2R07 3;  4LEJ A;  3WG1 A;  4ZZ8 A;  1WMF A;  2C9K A;  5JZG B;  5DDJ 2;  1ULF A;  5I0T A;  5JPM B;  1JZ4 A;  1ASJ 1;  1VBA 2;  2J22 A;  2V4A A;  2WWS A;  4FPJ A;  2D93 A;  3EYP A;  1PK6 A;  1VBD 3;  4I0B A;  5L19 A;  4ZY9 A;  5DAB A;  4JTO A;  2P3K A;  2WNU B;  3VBS B;  1GLH A;  1BYH A;  1ZZC A;  5DZE A;  4BXF A;  1EAH 2;  3VBF A;  4WVM B;  2VTF A;  5FZA A;  1EUT A;  1GOG A;  1V70 A;  4QX1 A;  1ODN A;  2VME A;  4N53 C;  4QPG C;  5FR3 A;  4M0N A;  5KHJ A;  3EXU A;  2DTY A;  4MAD A;  2JE7 A;  4GB3 2;  1GZT A;  5FK8 A;  4D7T A;  3III A;  4AAP A;  4CDX B;  3VD9 A;  3PDQ A;  4G9S B;  1NQD A;  5E88 A;  3S6P A;  1C5I A;  3I2F A;  2A6V A;  4HT1 T;  4CCO A;  1EPW A;  1YLL A;  1BKZ A;  3AZY A;  3BI3 A;  4XUP A;  2X05 A;  1X36 A;  2YC4 A;  4W65 A;  1AR8 3;  1QJX 3;  1UYY A;  2ZAB A;  3ACI A;  5A32 B;  1L7Q A;  3BKZ A;  1XSQ A;  4YVW B;  1NA1 B;  3GHN A;  2NM1 A;  5F37 A;  1ALY A;  2WZR 3;  3IKW A;  2ZX0 A;  4JGY B;  3C7G A;  1ND3 B;  2D5F A;  5BNQ A;  2WRA A;  3MLK A;  5F3E A;  1ZVF A;  1QJU 2;  4K1Z A;  1AL2 1;  5BNP C;  2YU1 A;  1FV3 A;  2WZP P;  4UI9 L;  1CR7 A;  3FWE A;  4WZC A;  3FLR A;  1FMD 2;  5FZ8 A;  4JX0 A;  1K5M A;  1Q8S A;  1CD3 G;  1ST8 A;  3NW4 A;  4IET A;  3BIE A;  5ACA 3;  1E5S A;  4XFB A;  4RGK A;  1OF4 A;  2R6Q A;  2P17 A;  4B4R A;  1RUC 3;  2ZEZ A;  2RMU 1;  4KBZ A;  3WLU A;  1AUY A;  2YYO A;  5FCC A;  5G05 L;  2IXJ A;  1O6U A;  4YPJ A;  1UY2 A;  1JZ3 A;  1AYM 2;  3JQX A;  5JOX A;  2BGC A;  4Y3O A;  1H2K A;  2O0O A;  3KT1 A;  4BB3 A;  1LOD A;  3C2U A;  4FVV A;  3K4Z A;  4IDZ A;  1TMF 2;  3WDX A;  4NRP A;  5JUV A;  3ZN6 A;  3RJ2 X;  1FPN 2;  2WT1 A;  3B01 A;  1MAC A;  1UZV A;  3NJY A;  5C4W C;  2RM2 1;  3VDA A;  2QCS B;  1QQP 2;  4XAC A;  3ZFG B;  5GZD A;  4CDQ A;  4CYD A;  3QD6 A;  5HCB A;  1N1V A;  2UWC A;  3GCX A;  1Q5O A;  4QDQ A;  4D6S A;  1LJ7 A;  1G9A A;  3ECQ A;  5SV5 A;  4AI9 A;  5FIX A;  2X10 A;  3AP9 A;  4XF4 A;  3RMX A;  4CP2 A;  2A7A A;  2BP6 A;  2CSG A;  3LE0 A;  4Q27 A;  5HCF A;  4NHM A;  3T30 A;  4YM2 A;  1MPX A;  1X50 A;  5A6Z A;  4FPG A;  1JZ2 A;  3VV1 A;  1YRZ A;  2YG0 A;  3FLT A;  3WQ7 A;  4CU7 A;  5ABJ A;  5IWF A;  2WFF 2;  1AR7 2;  4CEY B;  4MG2 A;  4BQX A;  1W9T A;  4QDS A;  2WO7 A;  2WLQ A;  1AZD A;  1O5U A;  1WW6 A;  3PNA A;  5AC9 1;  2J42 A;  3T1L A;  2ZGL A;  2VBD A;  4HK9 A;  1OFN A;  4DUV A;  3ELN A;  4LBQ B;  1UOB A;  1ULO A;  3O0V A;  5C70 A;  1O8S A;  1NXD 1;  1PHM A;  2ZGM A;  4Y4R A;  3PVE A;  4LBM A;  2XHK A;  4W50 A;  1H0B A;  1SPP B;  4RN5 A;  2XJR A;  1KRI A;  4PHZ A;  4Q5O A;  1AR6 3;  3N9Q A;  3LEM A;  1N47 A;  1DYO A;  1Y43 B;  1RED A;  4GXL A;  4CCD A;  2W1U A;  3THT A;  5FZI A;  1NX9 A;  2A5Z A;  3OBT A;  3W59 A;  5A3T A;  3WNL A;  2HEV F;  2MEV 2;  3KCX A;  4XAE A;  2QE3 A;  1ZA4 A;  3VBO C;  2JDA A;  2VZR A;  1OOP B;  1XBF A;  2P3J A;  3AMM A;  3DKQ A;  3RYP A;  2BFU S;  1PM4 A;  2K46 A;  4GWI A;  4MO3 M;  4JDO A;  1H2L A;  4LIU A;  4XAA A;  3WSO A;  4F8A A;  3T2Q A;  3SIT A;  2VUC A;  1ENX A;  1QKQ A;  5F5A A;  5KC5 A;  4XPV A;  2HWC 1;  2GAL A;  4XIK A;  4B7K A;  1OUR A;  3CU7 A;  5CKM A;  5FMB A;  3D4K A;  4LT5 A;  1J3R A;  1O8P A;  4FAH A;  4FQZ A;  1UXX X;  1EV1 1;  1QOS A;  1BVV A;  1PNG A;  2WQZ C;  3RFR A;  5DDJ 1;  1MR5 A;  5A7Q A;  4D3W A;  4I01 A;  4UT5 A;  1D4V B;  2RDS A;  2WN3 A;  3J4U H;  4DZG A;  5HV0 A;  1VBA 1;  4CUB A;  3H1M A;  3OBR A;  4CP0 A;  3IAQ A;  3IPV A;  1ZYB A;  3NST A;  4JHZ A;  1TNF A;  4CU9 A;  3ZDV A;  1JYI A;  2OT7 A;  4XMA A;  4DXZ A;  3H0O A;  5FYB A;  1S1A A;  5A70 A;  1EAH 1;  1NOV A;  2YUE A;  4CEW A;  2W9X A;  3J7H A;  1G9B A;  3C7O A;  3ZXD A;  2ARB A;  4KU7 A;  4EWE A;  4PCR A;  4GB3 1;  1GOF A;  1FOD 3;  1UN1 A;  1DZR A;  2GH8 A;  1F9K A;  4OFG A;  1PIV 2;  4Y1Y A;  4CDW C;  4CPB D;  2Z2S B;  1QDO A;  4XTM A;  1OQE A;  2R0H A;  4M3C E;  1QNW A;  2DWR A;  1UIJ A;  3GJA A;  3USU A;  3MUY 1;  4NWW A;  5FKC A;  3AYE A;  4NPM A;  4CP9 A;  1BMV 2;  2OS2 A;  2GC0 A;  3MPP G;  1HLC A;  1IPS A;  1UD1 A;  3W5M A;  3O5S A;  4YM3 A;  5KHG A;  2DFC A;  4MHR A;  1MZE A;  3ZYR A;  2P6H A;  1ENQ A;  2E7A A;  1CAU B;  2XLA A;  3DF0 A;  1NZC A;  1OKQ A;  1ULE A;  1UU4 A;  1W0N A;  3M2M A;  2ARE A;  1QJU 1;  2EID A;  1GP6 A;  3IZO A;  3B00 A;  4H14 A;  5FOB B;  3V65 A;  1WA6 X;  1WBL A;  1OH4 A;  1WCD J;  2K0G A;  3POI A;  3OGV A;  3UJQ A;  5GZE A;  1FMD 1;  4J6G A;  4AVT A;  1ZNP A;  2WO3 A;  3C8X A;  5A33 B;  1Z7S 3;  5C5T A;  2X5I C;  1HN1 A;  3MFC A;  2ZML A;  4R9C A;  3UES A;  4BQY A;  4R4X A;  1IQD C;  4Y24 A;  2VNV A;  2Y6L A;  2PLV 3;  1A8D A;  5LBF A;  2FDF A;  4RQP B;  1TVG A;  1U0A A;  1YQ5 A;  4AFB A;  4COU A;  5C3O A;  4LO7 A;  3RMY A;  1W90 A;  2O8Q A;  3S0M A;  4I09 A;  2XJQ A;  1AYM 1;  4P5Y A;  2HWF 3;  1QOO A;  5AFE A;  4WM8 A;  1LU2 A;  1RUG 3;  1QDC A;  1TMF 1;  1JZ7 A;  2JEM A;  1FPN 1;  2TBV A;  5A6Y A;  2LAL A;  2VZO A;  5A1L A;  4BLI A;  4DY5 A;  2DUR A;  1QQP 1;  2P4E A;  4B3N A;  1CAW B;  1XE8 A;  2XUM A;  1TME 3;  2J1V A;  1SFY A;  4IEU A;  5E16 A;  4LHS A;  4CDU B;  3C7H A;  3WP5 A;  5JOZ A;  1OVP A;  4PBO A;  3ACL A;  3VBU B;  3GBF A;  3GJB A;  5FY9 A;  2XLG A;  1UL9 A;  1RIN A;  3T08 A;  3KQR A;  4XIL A;  4J1X A;  1S0J A;  1FNZ A;  3MF6 A;  1BQP A;  5DUV A;  4AE2 A;  2Z79 A;  3EBR A;  4BHP A;  4RA0 A;  4CDU C;  4GZ9 A;  2WFF 1;  1AR7 1;  4LHK A;  4NN0 A;  2WNV A;  5L36 A;  1N1T A;  1FAT A;  4X6Q B;  4Q4Y 2;  5FPZ A;  2E63 A;  2CAU A;  4LOS A;  5C5U A;  4RYD A;  2F4L A;  1JMU B;  1FXZ A;  1ND2 C;  2R06 3;  1RVF 3;  1SCR A;  1Q8O A;  4AFM A;  5I91 A;  3I59 A;  2J7M A;  4E9K A;  2DU1 A;  5BV6 A;  2VQA A;  1B35 B;  2HWE 2;  2WDB A;  4N53 A;  1G9C A;  3TB0 A;  4BQW A;  1BXH A;  3NJX A;  3SKV A;  2ORX A;  4RR3 C;  1RB8 G;  3LKJ A;  3DV8 A;  3UT0 A;  2VBB A;  3ZKU A;  4AVS A;  5A7N A;  4HAN A;  4O7X A;  4CCE A;  4XW3 A;  3V0B B;  3VBH C;  4P08 A;  2TUN A;  3ZYJ B;  4A4A A;  2MEV 1;  4XFA A;  4QX0 A;  2KM2 A;  1WMX A;  5DPN A;  3NMB A;  2OVU A;  2VZV A;  5FK7 A;  1PGS A;  1YFX A;  4N43 B;  1VRH 3;  1VBB 3;  4ZS3 A;  3VHR A;  4RS5 B;  1DGR N;  4EJR A;  3WF3 A;  4A6O A;  3PMS A;  2XJT A;  5L9R A;  1WLW A;  4AVB A;  5IFP A;  4QGL A;  1PNF A;  4ZON A;  4NOT A;  1AX2 A;  3ZFE B;  4Q0S A;  3T4H B;  1QMJ A;  4UXA A;  5JIA A;  2B9V A;  3WNM A;  1GP5 A;  4JGZ B;  1POV 1;  2GNT A;  5FZL A;  3R4U A;  5FTT C;  1NE6 A;  5K0U A;  1JOJ A;  1PGL 2;  1FYU A;  2W3J A;  4DOU A;  4OMD A;  1SLB A;  3JQW A;  3OUH A;  5I0U A;  2OX0 A;  4Q4V 3;  5IFT A;  3BTA A;  2A70 A;  2OUH A;  4K9S A;  4ORF A;  4XJW A;  1OLQ A;  1SDW A;  4NIA A;  4FPH A;  1W2U A;  5JCT A;  2AR6 A;  1PVC 3;  3GZA A;  4CCC A;  4IES A;  4ES8 A;  5FPU A;  3JD7 3;  3BYW A;  3MIB A;  5F3C A;  4AI2 A;  5CIR A;  4OHZ A;  3WUD A;  3KV5 A;  3A0K A;  4O9E A;  2VMI A;  5FYY A;  1U5X A;  1NCQ C;  1ZX5 A;  2EAA A;  1MS0 A;  5D8A B;  1LEM A;  1PIV 1;  3FHQ A;  3K48 A;  4QPY A;  4OHX A;  4NIH A;  5C4W A;  4FFG A;  1CPN A;  3UGH A;  3RG0 A;  2FZ2 A;  1VBC 2;  3B3Q E;  2G1M A;  2RJ2 A;  2F17 A;  1REF A;  4QWN A;  4XF1 A;  1BMV 1;  1WUV A;  2A3W A;  1JUH A;  1KGY A;  4CZS A;  1OPM A;  1SZB A;  3BB6 A;  5D8A C;  1LGN A;  3NNF A;  1BBT 3;  1O4T A;  1O4Z A;  3QH7 A;  3DUI A;  4L99 A;  5DUW A;  2BBV A;  4K1Y A;  1PMI A;  3HNB M;  1JI6 A;  2EVX A;  5BNO C;  5H9Q A;  4IQP A;  2VE1 A;  5A3P A;  3NV3 A;  1VR3 A;  3CQO A;  4L97 A;  5EZW A;  2J1S A;  4FAG A;  4EWA A;  3Q8B A;  2OQ7 A;  3VN4 A;  2PHW A;  4Q8L A;  1SBE A;  3O1U A;  4QM8 A;  2B7Y A;  3NV4 A;  4NHY A;  3N9O A;  3WNP A;  1D7P M;  4P9G A;  5C9A B;  2JB4 A;  2HBT A;  4KG8 A;  5JR2 A;  4MGZ E;  3VBF B;  4EWD A;  3CNA A;  4AW7 A;  1O7F A;  3FMG A;  2FD8 A;  4Y20 A;  3WR0 A;  4BZ4 A;  4NAM A;  1URX A;  4HN1 A;  1ZBE 2;  1PK6 C;  2R32 A;  4DFS A;  3U75 A;  3FBM A;  3NJZ A;  1W39 A;  5I8S A;  3VBR A;  1CAV A;  1U5Z A;  1FV2 A;  3VBF C;  1K5J A;  3UKN A;  1POV 0;  2ARX A;  2GH2 A;  5IJR A;  1DFQ A;  3RGB A;  3H8R A;  1L7R A;  1VLN A;  4XE9 A;  2W87 A;  5BY5 A;  1ZZ9 A;  2ZX4 A;  3SHR A;  1MVE A;  4AG4 A;  2O1Q A;  4AEM A;  1OH3 A;  4MHU A;  4YVS C;  4IEO A;  1ZBA 3;  2ZEX A;  2GND A;  3NQH A;  1AL2 3;  3WNX A;  1GBG A;  2E31 A;  4TLF A;  5IVB A;  1GYK A;  3M3C A;  4GAL A;  3ZSJ A;  5FPA A;  5DG2 A;  1RHI 2;  1QNY A;  3D8C A;  4FPY A;  2IXL A;  1MQT C;  2JG8 C;  3K4A A;  4Q4Y 1;  4B4Q A;  3WDT A;  1CQ9 A;  3VGI A;  2PMW B;  1HRV 3;  5DXD A;  5FP7 A;  2FQP A;  2WC2 A;  2Q8O A;  3CHX A;  1WCQ A;  1YJK A;  1EYB A;  2AC1 A;  1W6M A;  2RMU 3;  3I4I A;  1ZRD A;  1Y4W A;  2JWP A;  5JLV A;  4QHZ A;  4AWD A;  1ULD A;  4GD4 A;  4P14 A;  5A3O A;  4LBK A;  5FZB A;  4UWD A;  4AQ6 A;  3DXT A;  5HXV A;  1K5M C;  3SC7 X;  2J1T A;  5EJ3 A;  3TOJ A;  2HWE 1;  1HJG A;  2IFR A;  5I8Y A;  4FFI A;  4URA A;  4G3Y C;  3KF5 A;  1DQ5 A;  1LKN A;  2L9L A;  1NY7 2;  2RM2 3;  3ZYB A;  1GZC A;  4AI0 A;  4FPC A;  2WO1 A;  4LE3 A;  3KLS A;  4LQR A;  4CDQ B;  3OPZ A;  1Q8V A;  3AMQ A;  2ARA A;  2RDQ A;  2DTW A;  3JBG 2;  4CVU A;  2AZ5 A;  2X8K A;  4Q4X 2;  2IWG B;  3MGU A;  2D40 A;  5CAD A;  3AKT A;  1DGW A;  2OPW A;  1UU6 A;  1JYV A;  3VLB B;  1W0P A;  3O0X A;  1JOB A;  1CAX B;  5ISL A;  3HT2 A;  1YWK A;  5JXJ A;  3M3I A;  3MW4 A;  5LY1 A;  2VCM A;  3POS A;  4CU8 A;  4CDQ C;  4COW A;  1W0O A;  3QBQ A;  1GAN A;  4N7I A;  5LY2 A;  1OLM E;  3PVB B;  4XQD A;  3E6B A;  5F5C A;  3UJO A;  3J9S A;  5ABJ B;  3A4U A;  1UF2 C;  5GM0 A;  1PGL 1;  1F5F A;  3QAC A;  5AC9 3;  2WAA A;  4FPO B;  3HT1 A;  4CCL A;  3B9C A;  2V09 A;  2B5H A;  1UY1 A;  1C1L A;  4PIY A;  1DYP A;  3IM0 A;  1V6N A;  4HKW A;  1Q3E A;  3IDC B;  2KR2 A;  5ABJ C;  4W6W A;  2P1B A;  2WZ8 A;  1JYC A;  4PIX A;  1APN A;  1UNB A;  3KT7 A;  4Y5Z 0;  4M3C F;  1LHN A;  4AK3 A;  4S2F A;  1H2N A;  2YBP A;  4BPZ A;  2EIB A;  3KB5 A;  3N9P A;  3VKL A;  1ZZ6 A;  2XVL A;  4DB5 A;  1CES A;  2WQ4 A;  4KWJ A;  5FZG A;  5LB6 A;  3GNE A;  3PIJ A;  4DUX A;  2X09 A;  3P6B A;  1BVP 1;  4QPI C;  1VBC 1;  2D44 A;  5EYX A;  3I54 A;  3AJZ A;  5FYZ A;  4KWU A;  3KM5 A;  3O0W A;  5EQU A;  3O1P A;  2HH9 A;  3GBG A;  4OCT A;  2JDK A;  4GIQ A;  4UBG A;  3WD5 A;  2PN5 A;  4TXW A;  2JD9 A;  1IZ3 A;  2QUO A;  4IV3 A;  3OCP A;  3R4D B;  1UPI A;  4EE2 A;  1S4C A;  5C8C A;  2FDJ A;  2BQP A;  1H8T C;  4FPF A;  4G4F A;  1DCS A;  2E33 A;  4R4Z A;  5JPN B;  2QQW A;  2ZS6 B;  4PLO A;  3PUA A;  4LO4 B;  4BQ1 A;  1ZA7 A;  4BU2 A;  2VL4 A;  5FO9 B;  3O1O A;  3PVO A;  3N4M A;  4A42 A;  2W1Q A;  4OHY A;  3MZH A;  4ET7 A;  3VD5 A;  1VBA 3;  5F3I A;  4L0P A;  3WP4 A;  2WZE A;  2WN2 A;  1JN2 P;  2ZMK A;  3KHB A;  5ANN A;  3TBD A;  3LGR A;  3OYW A;  3N9L A;  3RDI A;  1JYT A;  3U37 A;  4P02 B;  5JSP A;  1ND2 A;  2ZTN A;  5LA2 A;  3WUC A;  4XC9 A;  3CEW A;  3WVJ A;  3SKJ E;  1VAL A;  5CFC B;  2P2K A;  3T2P A;  4P9X A;  3VD7 A;  4IGP A;  4BDV B;  4CUC A;  5IYY A;  2QQV A;  3BTX A;  1ZBE 1;  4XUT A;  2WIN B;  4GH4 B;  2RS1 1;  1UZZ A;  2VOX A;  1MS4 A;  3ETP A;  4OZX A;  3WNK A;  4EN0 A;  5A6X A;  1BZW A;  1ULP A;  4RR3 A;  3USU B;  4QDR A;  1GSL A;  4CEW C;  2FDK A;  1QJY 2;  4IV1 B;  5ERL A;  1S2E A;  1O5L A;  1US2 A;  2ADE A;  2V73 A;  2VUD A;  3ETQ A;  3P3P A;  4YW3 A;  4DXR A;  5HV4 A;  3LEG A;  4LPL A;  4D7Y A;  3DYO A;  4BXS V;  4ISQ A;  1CZT A;  1WBF A;  2XOM A;  4PLM A;  4QGN A;  1ZRE A;  4KNC A;  5L7O A;  1ZRR A;  1NLS A;  1DGL A;  5DQ0 A;  4FTE A;  4HSL A;  5FZ1 A;  1AR9 2;  5F8P A;  3M3O A;  1N3O A;  1OXC A;  2W1W A;  4M01 A;  3T0D A;  4LKE A;  3NAP A;  1FMD 3;  2ZXQ A;  5IAX A;  5B4N A;  3ZR5 A;  1RHI 1;  3ZX7 A;  4CCJ A;  3J8F 2;  3LA3 A;  4YRD A;  1Y9G A;  2CY6 A;  3M7A A;  3ABZ A;  4ERO A;  5JXG A;  5BPX A;  3SH5 A;  3ZPY A;  4Q4W 2;  2IVI B;  3KV4 A;  3WOG A;  2XB6 C;  4GWN A;  1CJD A;  1J1T A;  3FUQ A;  3VKF C;  4AHZ A;  2JEC A;  3AP7 A;  4HN0 A;  4AED C;  2JB8 A;  5T3N A;  4XBQ A;  2NLR A;  4P9W A;  4A45 A;  5KHI A;  2AAC A;  1TMF 3;  4WM8 B;  4R52 A;  5LK5 A;  2C9A A;  2RJK A;  2UY8 A;  5APA A;  2QDR A;  3AP4 A;  5JSR A;  1NY7 1;  1PO1 3;  4RHV 3;  5CFD B;  3A21 A;  1F4H A;  1X7N A;  3OY8 A;  1QQP 3;  5T5P A;  1XPW A;  4MXW A;  1UKR A;  3M4F A;  5FBZ A;  4QGM A;  3JBG 1;  2JKB A;  4YG3 A;  4Q4X 1;  4Y1Z A;  4B29 A;  3RJR A;  4YAR A;  3JCI A;  1J58 A;  2ZMN A;  3UV9 A;  1VE0 A;  2DCZ A;  4H2A A;  3S5Q A;  3H7J A;  1XC6 A;  3POG A;  2CHH A;  4JTN A;  2WFF 3;  4R9A A;  4PT6 A;  3HBZ A;  4COY A;  2AGS A;  2ZGN A;  3HQR A;  4LXL A;  5LAT A;  1DZQ A;  3AXD A;  3Q8E A;  5BNO A;  2BW8 A;  4LOT A;  5A7S A;  4A2U A;  5LW9 A;  5FV3 A;  3VKO A;  1PMJ X;  1SAC A;  5I0S A;  5K8S A;  3MIH A;  5FRA A;  1M06 G;  4YLZ A;  4IW3 A;  3I2H A;  4KBB A;  4ONU A;  4OUE A;  4TN7 A;  2VNO A;  4X6R B;  4XEZ A;  3TN9 2;  4GUL A;  1DF0 A;  3NNJ A;  3BUC A;  5JXI A;  2LRO A;  4OZO A;  3P5B A;  4UF0 A;  3SH3 A;  4AI8 A;  5A3L A;  4XXA A;  3B02 A;  3I59 B;  4GJZ A;  2QTW B;  3CZJ A;  2WNV C;  1DDL A;  1V6L A;  3TNP B;  4N53 B;  4QPG B;  4RGG A;  2E26 A;  1GOH A;  1HQN A;  3CLP A;  2W5F A;  2XWJ B;  3GGL A;  2NZ9 A;  5FZ0 A;  2VG9 A;  2D6O X;  4C1X A;  4MZU A;  4S2H A;  3T2O A;  3E5U A;  3H3L A;  2MEV 3;  3FX3 A;  4WM7 C;  1JH5 A;  3K3N A;  3LWC A;  4QPW A;  3USS A;  3OJB A;  3SNM A;  3WDV A;  5A7W A;  5BNN C;  4DXT A;  1DLL A;  1SG3 A;  1J59 A;  3ZFF A;  2H0B A;  3NRU A;  1UYZ A;  2V72 A;  2EF6 A;  3VHP A;  4AAX A;  4E4S A;  1D4M 3;  2NMN A;  3WW3 A;  5FP9 A;  3W20 A;  1ZM1 A;  1NCR A;  2WJS A;  2XKP A;  3PME A;  3LFI A;  4C1W A;  5HBA A;  1JHN A;  4E4Z A;  1POV 3;  1S2B A;  1GU3 A;  4YVS A;  4XUO A;  5J1X A;  1UO9 A;  1UU5 A;  3RS6 A;  2QQJ A;  4QX3 A;  4E8C A;  4D6R A;  1O4Y A;  2WLP A;  5BNP B;  5FMO S;  3AKS A;  3ZXA C;  2VQ0 A;  4JRL A;  2ZAA A;  4XFI A;  2HWB 2;  1QWR A;  1W99 A;  3ZSL A;  3ZSM A;  1CVN A;  1DQ2 A;  1MQT A;  2BJS A;  2JG8 A;  4LHL A;  2C0Z A;  4Q0V A;  3ZLI A;  3ZPO A;  5EHD A;  2A1X A;  2VOT A;  1W6N A;  1ENS A;  1GP4 A;  2P3I A;  4XJU A;  4KMQ A;  2RR1 2;  3GCW A;  5K0U C;  4CRQ A;  2BNN A;  4LKS A;  1XNK A;  1LGC A;  2VU9 A;  1VAV A;  4ZHN A;  3AYA A;  3NO8 A;  4LK6 A;  4QT6 A;  4XOG A;  5D1I A;  2ZAH A;  1XXN A;  4EV0 A;  5CG8 A;  3KV6 A;  4QKF A;  3BTZ A;  4OQ8 A;  2EAL A;  4OQ9 A;  4UFK A;  4CU6 A;  5C4W B;  2YRO A;  5T55 A;  1QHD A;  4GWM A;  1HV0 A;  3TNQ A;  4ATE A;  1W28 A;  4RD7 A;  2I74 A;  1QJY 1;  4MVT A;  5CG9 A;  1MZ6 A;  2Q1F A;  4GKY A;  5LEK A;  3H9A A;  5DUU A;  1JW6 A;  2VAU A;  3EHK A;  3HVD A;  5IAV A;  4ZU7 A;  4DQA A;  3MBW A;  1BK1 A;  4NJ4 A;  1U5I A;  4TYS A;  1S0E A;  1H8V A;  1AR9 1;  1L7L A;  1D2Q A;  2Z5W A;  5LEJ A;  4LJH A;  5LWB A;  4HSJ A;  4MSV A;  2ZX3 A;  4K20 A;  3RVH A;  4A41 A;  1AYN 1;  1NE4 A;  2EA7 A;  3ILR A;  1XNA A;  2NPI A;  2XBO 2;  4LO8 A;  4M3C A;  1VJ2 A;  2YB7 A;  3J8F 1;  1AHS A;  2NP0 A;  2VM9 A;  5KR7 A;  1IS6 A;  4MH0 E;  1RUJ 2;  1KFX L;  3M3Q A;  4Q4W 1;  4QD2 A;  4QXB A;  4JKK A;  2UU8 A;  4L92 A;  4W4Z A;  4IEY A;  4A44 A;  4DEV A;  1F35 A;  2ZGQ A;  1UOJ A;  3RZJ A;  2A71 A;  3OBZ A;  4Y20 B;  3WY6 A;  4N9I A;  1IKQ A;  5EJZ B;  3VZN A;  4H7M A;  1PZ7 A;  4KQ7 A;  4LBN A;  2ZZQ A;  2IXH A;  2YY1 A;  5EFU A;  4EZH A;  1COV 2;  2QJV A;  3GZT B;  4DRR A;  2OII A;  4B1M A;  1QOT A;  4JRA A;  4AL9 A;  4K6B A;  2VQU A;  2PHF A;  2D6M A;  3O1M A;  1US3 A;  1HB1 A;  5FYT A;  1AL0 G;  2Y6G A;  3HWJ A;  4QPI A;  4FTB A;  2ZBJ A;  2ORZ A;  3VBO B;  1LEN A;  4Q2F A;  1ZZ7 A;  2YC0 A;  5CB7 A;  4AXO A;  5DAX A;  3WDU A;  5A3N A;  1IG3 A;  1WKY A;  1R08 2;  4BIO A;  1WME A;  3VBR C;  4YZ5 A;  1RUH 2;  3D3A A;  2WS9 2;  1GZW A;  4HKL A;  5C3Q A;  3H42 B;  3N7J A;  5HCH A;  4DY3 A;  3GM8 A;  1H8T A;  2BBA A;  2GNM A;  5FYH A;  4TWT A;  2BTV C;  2HBU A;  2XDV A;  5FZ6 A;  1P8J A;  4D6Q A;  4BMB A;  4UFH A;  1JZ8 A;  2D6N A;  1QJE A;  1WD3 A;  2DU0 A;  3KCY A;  1IQA A;  1X9P A;  1FAY A;  4GMP 1;  2VW0 A;  4FPE A;  1H2M A;  3TN9 1;  3VKM A;  4LO5 B;  4GAZ A;  2OZ6 A;  2R07 2;  3DPR A;  2Y33 A;  5KHK A;  1REE A;  4FT8 A;  3LQC A;  3IWZ A;  3UGF A;  1KEX A;  3BU7 A;  1QF3 A;  2B9U A;  1XE0 A;  3VDD A;  1HV1 A;  5FAX A;  3PUS A;  1HRI 3;  3OEA A;  3POF A;  3U10 A;  2BNO A;  2OW4 A;  2WQ8 A;  1DHK B;  3H1W A;  5KHH A;  3K4D A;  1OF3 A;  2SBA A;  2WAO A;  1LHW A;  1H30 A;  2WWU A;  1RIR A;  3M70 A;  4L2N A;  1V9U 3;  4CDW B;  4ARX A;  4Y33 A;  3POB A;  1XQN A;  2JDM A;  2XUE A;  4MOA A;  2C24 A;  1AX0 A;  4DRV A;  2ZAC A;  4F7Z A;  3ZXE A;  2N7G A;  3B5L B;  4XXP A;  4Y1V A;  5FJK A;  3DYM A;  1YEW A;  2PHX A;  2WKK A;  4IEP A;  4NRO A;  4AVA A;  4UFM A;  3JZV A;  5A3W A;  1UX6 A;  5IVV A;  3BTY A;  2QQK A;  3MFA A;  5FZO A;  4COZ A;  1LOF C;  2ZGU A;  1JS9 A;  5FZ3 A;  1AR8 2;  1QJX 2;  1Z0H A;  4WBB A;  1MS1 A;  5A1F A;  1W2O A;  2W91 A;  5T5J A;  4P9J A;  3FFQ A;  2E6V A;  2Z4F A;  2XLF A;  2HWB 1;  4LNV A;  3SH4 A;  2VMF A;  2CU5 A;  3K2O A;  3U14 A;  3CJI A;  2EXK A;  2X5I B;  3RQ0 A;  4LOR A;  1VB4 A;  1NLQ A;  2RS3 2;  4JDN A;  1IS4 A;  3TAY A;  1RUE 2;  2RR1 1;  3KZ4 C;  4YW7 A;  5FMC A;  2VBP A;  4AED A;  3J26 N;  2DYC A;  3AC0 A;  4AEJ A;  1TQ5 A;  3RI9 A;  5ACA 2;  5GJ6 A;  2ARC A;  1RUF 3;  2BVB A;  4JC1 A;  5A7O A;  4XFC A;  1LU1 A;  2C5D A;  3LF7 A;  4HVR A;  1VBC 3;  1W8F A;  1NKG A;  2Y26 A;  4AGG A;  1A8M A;  1LUL A;  5I0R A;  1IOA A;  2CTV A;  3HD8 B;  3KD4 A;  4QKD A;  4KWK A;  1RYY A;  5DAW A;  3UKT A;  3ZYG A;  4HBN A;  4IE4 A;  3ON7 A;  4P00 B;  4XJA A;  2IXI A;  1AX1 A;  2I2S A;  2PHR A;  4UFL A;  4CPB A;  3ES1 A;  4IV3 B;  3VD3 A;  3I3B A;  4MYE A;  1LR5 A;  1OC1 A;  3BGA A;  4WVZ A;  4GMP 0;  3CIH A;  1SHW B;  2ID4 A;  3AP5 A;  1XNT A;  1YFY A;  2PFW A;  3NV1 A;  4HK8 A;  1V00 A;  2HWD 3;  4KGG A;  1K3I A;  3JXS A;  3Q8C A;  2W0X A;  4BE3 A;  4MX3 A;  3O12 A;  1GR3 A;  3POE A;  5FYM A;  2XBO 1;  4IV3 C;  3IDE A;  2PA7 A;  3LFM A;  4GJY A;  4AHX A;  2W1S A;  3ZXG A;  3MHZ A;  3QCW A;  5C8C C;  4PBP A;  1ULG A;  1ULC A;  2CDP A;  3NWK A;  5DMY A;  2R7E B;  2BNM A;  3ZM8 A;  1C57 A;  1ND2 B;  1N3P A;  1VBE 2;  2Y6J A;  1C8M 2;  5KXB A;  5J98 B;  5BXX A;  3KCC A;  2QBX A;  1TG7 A;  4MV2 A;  2IUW A;  2RS1 3;  4Y22 A;  1RUI 2;  2ZOE B;  1COV 1;  2D6K A;  4N7U A;  4FPL A;  4UW4 A;  1OA2 A;  2WT0 A;  2K9Z A;  1UZ0 A;  3FJS A;  2Q1M A;  3WCS A;  2DVD A;  2ET7 A;  4RR3 B;  2W2I A;  3ZO0 B;  1H6Y A;  1ZRI A;  1R09 2;  1W6O A;  1UX7 A;  2BUK A;  3VBH B;  1ODM A;  4YSF A;  2X53 S;  4MGQ A;  4WM7 A;  1AR6 2;  4YM0 A;  1CX1 A;  3BCW A;  1H4G A;  2BOJ A;  2ZGT A;  1QJF A;  4LA2 A;  3LEI A;  4NUB A;  4Y1X A;  5BNN A;  5BYN A;  1R08 1;  5J37 A;  1F15 A;  1NT0 A;  1RUH 1;  3LSE A;  2WS9 1;  2Q0A A;  3MLJ A;  1X8E A;  5FFO C;  3WXP A;  3SQO A;  1RHI 3;  2RE9 A;  4BOW A;  4LTA A;  5KXD A;  2ERF A;  5FY7 A;  3H1Y A;  4KI5 M;  4AVC A;  1HX6 A;  1C4R A;  2B8M A;  4NWV A;  2JIC A;  5LBB A;  1YC6 1;  4HPK A;  2YHJ A;  5L7O C;  4E2G A;  5CEH A;  1DU3 D;  4AQT A;  1W8O A;  2R07 1;  3NAP C;  3I2O A;  4EN9 B;  4F83 A;  4QQO A;  3TRS B;  4MGS A;  4WV8 A;  4ZS2 A;  4EN8 B;  2VMG A;  2C1F A;  2JG9 C;  2YPD A;  1W06 A;  2OA2 A;  3DEC A;  1BEV 2;  4MET A;  4K21 A;  1DQ1 A;  1VAM A;  1KIT A;  2YV8 A;  2Y64 A;  2WNU A;  1K42 A;  3OY8 B;  1NCQ B;  2CNA A;  4EQV A;  1SLT A;  4WVM A;  4XET A;  4MXW B;  2LW8 A;  3FE5 A;  3JBG 3;  2Q8C A;  4Q4X 3;  1FI2 A;  3K46 A;  3AVS A;  1UMZ A;  1JU4 A;  2P37 A;  3C7F A;  5FYC A;  3ZKY A;  3HNY M;  4CDX A;  4YNI A;  2RS5 2;  3DL3 A;  2VOK A;  2JIJ A;  2FBE A;  3UKV A;  3RZK A;  1LED A;  1S0C A;  2QDN A;  2W46 A;  2WFP A;  3ZIW A;  1WLT A;  4Y26 A;  5A32 A;  3NJV A;  1AR8 1;  1QJX 1;  3JU9 A;  4NPL A;  5BNO B;  4YVW A;  1PZ8 A;  2J1A A;  4KH9 A;  3DEM A;  5T52 A;  3R6S A;  1IG0 A;  4MUV A;  1WW5 A;  2Y38 A;  3OF1 A;  1W9W A;  3OBA A;  1ND3 A;  2JEN A;  5IVE A;  5KC6 A;  2O14 A;  3IMM A;  4OVE A;  2TEP A;  5HPO A;  3P1I A;  5LCW L;  1RMU 2;  3HPN A;  5FY8 A;  4CTE A;  5FWJ A;  4YGD A;  2RS3 1;  1E57 A;  1RUE 1;  3OB8 A;  1XYN A;  2RV9 A;  3ASI A;  4QM9 A;  3B9I A;  5CBL A;  3E6D A;  1GKB A;  3KVA A;  3VZK A;  3BPS A;  2PAE A;  5BUV A;  1E5R A;  3FFZ A;  3OEB A;  5GZC A;  2DUP A;  1OLM A;  4V1P A;  1GQH A;  1NLR A;  1QXJ A;  5ACA 1;  1ASJ 3;  3U0Z A;  2BYV E;  1I6X A;  3VZO A;  5F1R A;  3FLP A;  1PK6 B;  3DKW A;  3WG2 A;  5KXC A;  1TZO A;  4LBQ D;  3ZN5 A;  1CIY A;  1YQC A;  3ROU A;  3RZZ A;  4YFZ A;  2MNG A;  1UWW A;  1GNH A;  1TNR A;  2HWF 2;  5FLH A;  1YQ2 A;  1DP0 A;  2KA3 A;  2NN8 A;  2Q4S A;  3ATG A;  3GAL A;  3MIF A;  3MUZ 1;  4JDM A;  4ARY A;  1RUG 2;  5A7W B;  2LUW A;  4XF0 A;  1O59 A;  5FP3 A;  2XVG A;  1LGB A;  1K12 A;  1XU1 A;  4JAA A;  1GV9 A;  1F4A A;  1QH7 A;  4RFR B;  5F2S A;  3RYR A;  2A6Y A;  3CZU A;  5EIY B;  5FP4 A;  4YVS B;  3D0S A;  2WII B;  4QB6 A;  1FX5 A;  3SCH A;  2CL2 A;  1TME 2;  2F6B A;  3GYD A;  2CAV A;  4RSU A;  3MW2 A;  1UKG A;  5FY4 A;  1NZI A;  5A1A A;  5D2A A;  4U2A A;  3HIF A;  4JQR A;  3ZFF C;  1XYO A;  2GSY A;  3HMY A;  3WW1 A;  3N9M A;  4EN6 B;  2VO5 A;  1EPZ A;  1PO2 2;  1MQT B;  2JG8 B;  3BOD A;  1NCR C;  2YDE A;  2IZW A;  5CVR A;  5F3G A;  4PIZ A;  1EY2 A;  1Q56 A;  3EB7 A;  1W6N B;  4CEY A;  4V2V A;  3AKQ A;  2KD7 A;  3OD4 A;  1GUI A;  4LLO A;  2DVF A;  3H50 A;  3IDB B;  1VBE 1;  4CSW A;  4NHK A;  5K7P A;  1C8M 1;  1LRH A;  1K5M B;  1B09 A;  3IT8 A;  1RUI 1;  2WL1 A;  4LBQ A;  2G9F A;  1LOA A;  2YC2 A;  2VVF A;  2WAB A;  1W2N A;  2ZZJ A;  2R06 2;  1QJY 3;  1SPP A;  3CO2 A;  5IUQ A;  4DS0 A;  2WA3 A;  3ENR A;  1R09 1;  2HEY F;  5FZF A;  2VC9 A;  2XKO A;  2HLE A;  3U11 A;  4CUA A;  1AR6 1;  1HXS 2;  1S0G A;  2A3Y A;  1V6O A;  4IER A;  4FBF A;  1OSG A;  3ZN6 B;  2VZU A;  1BK0 A;  1YCI A;  3DXU A;  1ZRF A;  4A7K A;  3MID A;  1OOP A;  3EQE A;  1AYN 3;  1HDK A;  4ZZ5 A;  1SBD A;  3CKH A;  5LA1 A;  1LOF A;  1VRH 2;  2I45 A;  2WA4 A;  4M3C B;  3LPF A;  3ZMO A;  3IMN A;  4BQ3 A;  2VCB A;  5FXX A;  4GQ7 A;  4YW6 A;  2ENR A;  1W03 A;  2K2S A;  2JXA A;  4XQW A;  2E32 A;  3NNM A;  2AEZ A;  4XUR A;  2DV9 A;  1BLZ A;  3EO6 A;  5DN2 A;  3JUU A;  4Z8B A;  2IXC A;  2VZQ A;  2VZ1 A;  2VD7 A;  1EP0 A;  1V6K A;  1LAJ A;  1EUU A;  4YGE A;  2D6L X;  1BEV 1;  2GN7 A;  1YFW A;  4HL0 A;  5B4X A;  3WDW A;  5G04 L;  3ZXJ A;  1I5Z A;  3CDZ B;  3T1M A;  3X29 B;  4DMI A;  3POY A;  1PVC 2;  4TTG A;  4QB1 A;  2JDN A;  3JD7 2;  1Q8Q A;  3BOW A;  2VZ3 A;  3PUR A;  1UYP A;  3ZSK A;  2JDP A;  4PQQ A;  3ACH A;  4QPI B;  5I8T A;  1CZV A;  1OQ1 A;  1WD4 A;  3SIS A;  5T50 A;  2OZJ A;  2GP3 A;  2R30 A;  1DQ4 A;  2RS5 1;  1AXK A;  1CJP A;  4YG6 A;  5JVV A;  3UET A;  3WIN E;  5HXM A;  5FMD A;  1WLD A;  3AP6 A;  5FDB A;  3S57 A;  2P3Y A;  1TEI A;  2J1R A;  2ZPX A;  2ZX1 A;  3OGG A;  1PGW 2;  4NID A;  2VUJ A;  2QNK A;  3PUQ A;  4FI9 A;  1NAE A;  1H8T B;  4AGV A;  5E1R A;  4CXY A;  2CGP A;  3IB3 A;  3ILF A;  2GN3 A;  3N36 A;  1D0H A;  4ZU5 A;  1S0D A;  3F2Z A;  3APB A;  1BBT 2;  4R9B A;  4OUS A;  3T2T A;  4AGR A;  3POW A;  4GMP 3;  4BK5 A;  3RZM A;  2W39 A;  2HWC 3;  1C8N A;  3OUI A;  1RMU 1;  5CZK A;  5J3U A;  5M0T A;  2HJI A;  2GNB A;  3NKG A;  1O91 A;  3DPR B;  4AFA A;  5A7P A;  3I2K A;  1EV1 3;  5FKB A;  2O8O A;  5A33 A;  1W6P A;  1HKD A;  5DDJ 3;  2AH2 A;  2WSU A;  4FQ4 A;  5CYY A;  5LA9 A;  5IT6 A;  3AK0 A;  2ET1 A;  2QQO A;  2PXJ A;  2VPV A;  3G6J B;  1MZF A;  1UZY A;  2IC1 A;  2VUL A;  3HR9 A;  1D0G A;  1NYW A;  2XJP A;  4V2W A;  2ZGR A;  4UW6 A;  3IPV B;  3DPR C;  4NO4 A;  5C7G A;  4FOQ A;  1EAH 3;  2HWF 1;  2WSV A;  1YXW A;  1W2T A;  1E5I A;  1G7Y A;  3AB0 A;  5L9B A;  3VDD C;  2DCJ A;  1NG0 A;  3LIG A;  4CEW B;  1GNZ A;  4QX7 A;  4XFH A;  4A7Z A;  2UUR A;  2WO2 A;  4IXL A;  2ZEW A;  4GB3 3;  3ZVX A;  5IAT A;  1DGR A;  2DBI A;  5GLZ A;  2WNO A;  4I30 A;  1GNY A;  4NRQ A;  1G86 A;  3N35 A;  2H6B A;  5FO8 B;  5JI9 A;  2VQT A;  3VL8 A;  2CGO A;  2PAM A;  3AL5 A;  1W8N A;  4QKN A;  1PX4 A;  3DGT A;  3ZXL A;  1TME 1;  1N1S A;  2V5D A;  3LD8 A;  4FXG B;  3E97 A;  3ZYI B;  4CP9 B;  2CV6 A;  1W8Z A;  1RUD 2;  3VBU A;  2HWB 3;  3RNS A;  4YM1 A;  4W6Y A;  4I0A A;  1PO2 1;  1ZBA 2;  2VZP A;  3WHU A;  2ZHL A;  3A23 A;  4L8Q A;  4NVP A;  4UBH A;  2GMP A;  3JB4 C;  1XB9 A;  3WZ1 A;  4Q0U A;  3W9A A;  1OKO A;  1QJU 3;  4JV4 A;  3KQ4 B;  5F5I A;  3U78 A;  5JWP A;  1MEC 2;  5TSW A;  2AEY A;  3CMG A;  3MEP A;  3T0A A;  5GLV A;  4AED B;  3HJR A;  1ACC A;  2VCA A;  4NMI A;  4O9G A;  4LO6 B;  3V56 A;  4FOV A;  2E7T A;  4A6S A;  3KV9 A;  1H1M A;  1HRV 2;  2R49 A;  2JG9 A;  4YFW A;  3CJI C;  1SLI A;  4HMZ A;  3I2J A;  2XXZ A;  1Y9Q A;  2OUJ A;  1WCU A;  4PF1 A;  1WMD A;  2R06 1;  4UFI A;  1AXY A;  1B35 A;  4QHO A;  1AYM 3;  3U4S A;  1ONA A;  4CUG A;  1OD3 A;  1POQ A;  2XQX A;  1Y7B A;  3I3Q A;  1HXS 1;  2RM2 2;  2XL7 A;  5E6H A;  2W47 A;  4FOY A;  5L73 A;  4D94 A;  2E7Q A;  1FPN 3;  3V0B A;  4LR4 A;  4JZR A;  3O1R A;  1MVQ A;  4XCB A;  5FBJ A;  1O3S A;  4PF5 A;  1J3P A;  4LBJ A;  5FQ0 A;  2QZ3 A;  4XTP A;  2PHD A;  1JHJ A;  2GC1 A;  4Q1R A;  4N43 A;  3ZXF A;  4AQ2 A;  2BDR A;  3D5O A;  3KHC A;  2XBO 3;  5JMO A;  4LUL A;  3WDY A;  3INA A;  5K9Y A;  1MS8 A;  1K45 A;  1AJO A;  4ES9 A;  2ZKL A;  3D82 A;  3AKP A;  3WP6 A;  5K4L A;  1F2N A;  1J83 A;  2WUH A;  3WW4 A;  1XND A;  4JGZ A;  3ZYP A;  2XGX A;  2CWM A;  3LAG A;  1MS5 A;  3ZMN A;  5DZG A;  4LBL A;  3J7M A;  4YZ1 A;  3MW3 A;  4IGQ A;  1UIK A;  1F5J A;  2ZX2 A;  5CAZ A;  1O3Q A;  1WCS A;  2JE8 A;  4CXX A;  1AR7 3;  4IEW A;  5DG1 A;  5FPX A;  5FZC A;  2WNV B;  2NMO A;  5LA0 A;  3C7E A;  2Y34 A;  2JKX A;  3ALQ A;  1ZZB A;  3I2G A;  4XDO A;  3P3N A;  1TE1 B;  2BV4 A;  3OGR A;  5DZF A;  2Q8E A;  4SBV A;  5FLI A;  1PVC 1;  1QGL A;  1VIW B;  2KXL A;  3JD7 1;  2VVE A;  4CA9 A;  4E8D A;  3PU3 A;  1UPS A;  3BN6 A;  3IN9 A;  3Q9O A;  5ANQ A;  3HAG A;  3HN3 A;  4D7S A;  5DAQ A;  4WM7 B;  2UYB A;  3SEP A;  4PDW A;  1U5Y A;  1W8H A;  2QFE A;  2SLI A;  3J7L A;  3KSC A;  1R08 3;  5BNN B;  2Q1Z B;  1RUH 3;  2WR9 A;  2WS9 3;  3I8T A;  4O61 A;  2IFW A;  5LRS A;  1PGW 1;  2GC2 A;  3H8O A;  2BEO A;  2HYX A;  1J3Q A;  4NHL A;  3WX5 A;  1BBT 1;  1W9F A;  2ES3 A;  2Y6F A;  3C3V A;  3ITQ A;  3VZM A;  5A6Q A;  4AYU A;  1LHO A;  1H6X A;  2GDF A;  2IXK A;  2W92 A;  1BCX A;  1HN0 A;  2OPK A;  5GAL A;  5T54 A;  3RYK A;  4DNY A;  4I02 A;  5K0U B;  2YZ4 A;  1GQG A;  2BWA A;  4IL7 A;  1YO8 A;  5C9A A;  4YG0 A;  1W3V A;  4FOW A;  1ZZ8 A;  3K77 A;  3R05 A;  1VAK A;  4QQP A;  5JZG C;  5T5O A;  2VOV A;  2B46 X;  3MO4 A;  2Y8K A;  1JU3 A;  5GLT A;  1KXG A;  1SMV A;  4B4P A;  1AF9 A;  3MYX A;  2DF7 A;  2PYT A;  3Q8F A;  3S7I A;  4FP3 A;  3W58 A;  2WNU C;  1HB2 A;  4UFJ A;  2YBS A;  3VBS C;  4C0H A;  1G9F A;  3VZJ A;  1PIV 3;  1W8U A;  2FCT A;  1YYN A;  4XJZ A;  4HZF A;  3ACG A;  3AZZ A;  3RZL A;  4KGQ A;  3AFG A;  3SCF A;  5FYI A;  3LOB A;  5C33 A;  5JIU A;  2UWA A;  1JOD A;  3PTR B;  2R04 2;  2XJU A;  3B69 A;  1W6Q A;  4CDX C;  4JCK A;  5GLU A;  1LOB A;  2LS6 A;  1RUD 1;  3LZZ A;  3M1H A;  4MLO A;  4IEV A;  1LHU A;  2GZW A;  3RWN A;  5FOJ B;  2VW2 A;  3NL1 A;  2QZ2 A;  2DDU A;  2GU9 A;  4XJ8 A;  3O7O A;  1IKP A;  1S55 A;  1YHF A;  3FHA A;  1ZBA 1;  1I5P A;  4LE4 A;  2VMD A;  4BME A;  5I93 A;  2RS3 3;  4UW5 A;  1RUE 3;  4AFC A;  5IK4 A;  1JYN A;  3KF3 A;  2Y6H A;  3I3E A;  1YI9 A;  3FUO A;  1MEC 1;  4AZZ A;  4K8R B;  3IBM A;  4OI4 A;  2GP5 A;  4YVW C;  4TZD A;  1CIW A;  1NA1 C;  3BU0 A;  4Z1V A;  3KGL A;  4BLJ A;  4JGY C;  3HNM A;  1DQ6 A;  1W3X A;  4P9I A;  1ND3 C;  1GIC A;  1HRV 1;  2ILM A;  4XZU G;  4C0B A;  5FY0 A;  5IW0 A;  4MXV A;  1RGS A;  2PHT A;  1SCS A;  2UWB A;  4AEK A;  2ETE A;  3AJY A;  3SEE A;  5JSO A;  1HQL A;  2E53 A;  2J1E A;  5D21 A;  5FPB A;  2WBK A;  2A75 A;  5FY1 A;  2FMD A;  3ORJ A;  1UY0 A;  1JYW A;  3SCG A;  1VRB A;  3H8X A;  2DVB A;  1UXZ A;  1PO1 2;  1NUK A;  3PL0 A;  4RHV 2;  3UYJ A;  1F8V A;  3GHM A;  1KQR A;  1YUD A;  3FN9 A;  5C3R A;  1I3H A;  3MF9 A;  3LDB A;  3ME2 A;  4ISR A;  1IS5 A;  2GAU A;  1R1A 2;  3VBR B;  3ZYF A;  1CAV B;  3O1S A;  5FZH A;  2VUA A;  4QB2 A;  5DAP A;  4S2G A;  2OQ6 A;  3AYC A;  3VB9 A;  2TNF A;  2XVK A;  3I3D A;  1CAX A;  2PAK A;  2D7F A;  4TLG A;  5HI0 A;  5E8A A;  1JZ5 A;  1UOG A;  2CGN A;  3ZFG C;  4AFD A;  4C90 A;  4EYU A;  3FZ3 A;  3MV1 1;  3GBW A;  4ASK A;  2XH6 A;  2LM3 A;  4HVQ A;  5IHR A;  5F5Q A;  4KWL A;  2P6C A;  4NII A;  3OOX A;  2YGL A;  2Y0I A;  4XUN A;  4OYU A;  1VBE 3;  2Z69 A;  3D6E A;  1C8M 3;  4QXK A;  2LTN A;  4QAW A;  3LDR A;  3VDC A;  1BHG A;  4NHX A;  1SLL A;  3U07 A;  1RUI 3;  4Q4Y 3;  2DUQ A;  4M4R A;  4YWA A;  1C1F A;  1H9P A;  1J1L A;  3PJY A;  4PLN A;  4A3Z A;  3RWK X;  3H3U A;  4CEY C;  3WG4 A;  1W6M B;  4LA3 A;  4BQ2 A;  1R09 3;  3MDP A;  4O65 A;  1GWL A;  2MPF A;  3V0A A;  2VJX A;  4BIF A;  4XUQ A;  3MIE A;  5LBC A;  1JTZ X;  2HWE 3;  4YW2 A;  3DYP A;  3LB9 A;  4EN7 B;  5C6C A;  2VNR A;  2H6C A;  3AZW A;  1VBD 2;  3POJ A;  3WHT A;  4NAO A;  5C3P A;  5C8W A;  4H55 A;  4XVH A;  4Y1U A;  5FP8 A;  4XFG A;  2GME A;  2X29 A;  2D5H A;  4W6X A;  4LKF A;  4HXC A;  5FZD A;  2BPA 2;  2FDH A;  2B4K A;  4OI0 A;  1OI6 A;  2MHF A;  3NVC A;  2E9Q A;  4M4P A;  1XNB A;  1A6C A;  3QLQ A;  1OD5 A;  5FUN A;  2LRP A;  1X9T A;  4KU8 A;  1D4M 2;  1G8W A;  4DPN A;  2D97 A;  2Q30 A;  1S0F A;  2UY9 A;  4Q0Q A;  1U12 A;  2I07 B;  3RZH A;  1DQ0 A;  5JR7 B;  4UAP A;  1UZW A;  1OOP C;  3IAP A;  1SLC A;  3AMP A;  4IEZ A;  5LK7 B;  2PQS A;  4IUG A;  1YQ6 A;  3I49 A;  2JIG A;  1IS3 A;  1WW4 A;  4MGY E;  3A22 A;  1T6G C;  1BEV 3;  5FXW A;  2EXH A;  3T4V A;  1W9S A;  3W21 A;  5FPL A;  3UGG A;  4XZP A;  4IE6 A;  1A3K A;  3CBN A;  5LBE A;  5FUI A;  5JMC A;  4QX5 A;  2WZR 2;  3A7Q A;  3OGS A;  2VEC A;  4FO9 A;  2VNG A;  2D3P A;  2G4I A;  4HET A;  3M8L A;  5FZK A;  5A3U A;  3B94 A;  3ZOI A;  5CFC A;  3B93 A;  4PQ9 A;  4U36 A;  2RS5 3;  3L2H A;  4XF3 A;  2QQL A;  4GH4 A;  3KWV A;  4RGA A;  3WF4 A;  1X8M A;  4I0W B;  2DCY A;  4NE9 A;  3AKR A;  5EP9 A;  1H1A A;  4QXC A;  1RUC 2;  4XJ9 A;  1S2K A;  3AZX A;  3ZSE A;  2XL9 A;  1QY4 A;  4IV1 A;  5CA6 A;  3VD4 A;  3FHI B;  4NRM A;  3RSJ A;  2A6Z A;  1UCX A;  2WYS A;  5FO7 B;  4COV A;  2BGP A;  2R04 1;  2D3S A;  2YFZ A;  2E51 A;  4E4D X;  4K3U A;  2QQU A;  4IEX A;  5FWE A;  5C71 A;  3S5A A;  3F95 A;  4GA9 A;  1RMU 3;  5JOY A;  1W9Y A;  5CKQ A;  4K40 A;  5C8C B;  1V0A A; 
#chains in the Genus database with same CATH homology
 4CE8 A;  2JDP A;  1OVS A;  2JDY A;  5A6Q A;  1OUR A;  2BP6 A;  2JDU A;  5A6X A;  4AOC A;  3DCQ A;  5D2A A;  2JDH A;  1OVP A;  1W8H A;  2VNV A;  5A3O A;  5A6Z A;  1W8F A;  2VUD A;  2BOI A;  4UT5 A;  2BOJ A;  2WR9 A;  2CHH A;  1OUS A;  1UQX A;  5HCH A;  2JDK A;  3ZDV A;  1UZV A;  2WRA A;  1OXC A;  2JDM A;  5A70 A;  2XR4 A;  2BV4 A;  2JDN A;  5A6Y A;  2VUC A;  1OUX A;  1GZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...