4XZUG

Crystal structure of the human factor viii c2 domain in complex with murine 3e6 inhibitory antibody
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
154
structure length
154
Chain Sequence
CSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3E6 antibody Fab heavy chain
publication title Structure of the Human Factor VIII C2 Domain in Complex with the 3E6 Inhibitory Antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 154
sequence length 154
chains with identical sequence M
ec nomenclature
pdb deposition date 2015-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4xzuG00
2V72A 4A42A 1UY0A 2WYSA 2ZEXA 2ORXA 3HOBA 2J1AA 3NRUA 1K42A 1W8NA 2VQUA 5EJ1B 3HNMA 5G04L 4JKKA 3NQHA 2W5FA 5I0DA 3VD4A 3NJXA 2VZQA 2CDOA 3I2IA 2YC4A 1PMJX 3GXUA 2VO5A 1GU3A 1GOHA 3F2ZA 3WQBA 3PUHA 1HN1A 3LEGA 1JZ6A 1JYNA 2EIEA 3D3AA 3VDAA 1W9TA 3IDAA 4QX0A 3T09A 4CVUA 2RV9A 2WBKA 2YG0A 1CIYA 3GM8A 3JXSA 2C4XA 3HPNA 4A45A 4BXSV 4ZY9A 1UXXX 1NKGA 2QQKA 5IJRA 2XONA 3K46A 1K3IA 2EIDA 2J1EA 2VMFA 4DUVA 5EIYB 5LA1A 3CDZB 1IQDC 4P5YA 2VJXA 4OMCA 1UWWA 1NX9A 5IHRA 2DCJA 3K75B 3IIIA 3FL7A 3I2JA 2Y64A 2DCKA 3IAQA 2LS6A 2Y6JA 3EYPA 3ABZA 3A22A 1XNAA 4XUPA 3VD7A 2WABA 3T2QA 2W1UA 1JZ2A 3OGRA 3NNGA 1CZTA 1DYOA 4E8DA 3LE0A 4UI9L 2BZDA 3P1IA 1JZ4A 3W5MA 4TXWA 3CZJA 2JE8A 1CZSA 3I2FA 4XUOA 4XZUG 1CX1A 2E33A 2VR4A 2VMEA 1W0NA 1BHGA 2WO1A 2BGPA 3HEIA 3I3EA 3GDBA 4QPWA 5EJZB 4BK5A 1SHWB 2B4KA 1DP0A 3T0BA 1UYXA 3WNNA 2HLEA 5F7UA 3MO4A 4CU9A 2WZ8A 4ZZ5A 4ZZ8A 4OYUA 3SEPA 1KEXA 1UXZA 4QDRA 1JU3A 3UESA 5HXMA 2BGOA 3OEAA 5JXHA 2VZ1A 2X09A 1PX4A 1OF3A 3K4AA 4DXRA 4CU7A 4CUCA 3ECQA 1JZ5A 4DEQA 4AG4A 2W1QA 2QQMA 1I5PA 4JHZA 3HJRA 3ACIA 3C7FA 4QX2A 3IB3A 5HPOA 3WNMA 1UZ0A 2C9KA 4GWJA 2VZTA 1JYWA 4BK4A 1O59A 3IAPA 3OGSA 1ULPA 3CZUA 4P08A 2Y6LA 2J1UA 5B4XA 3T08A 2VCCA 3C7HA 2J1RA 2X05A 1NAEA 1UX7A 2QQOA 4GZ9A 1GNYA 4LKSA 5C71A 1NUKA 5DMYA 2Y6GA 2VZPA 1UY4A 2VCBA 3CIHA 2WN2A 4Z2AA 4RN5A 3MV01 5C7GA 1UYZA 1XPWA 3HNYM 4MGQA 4A44A 2QQJA 5IFTA 2JD9A 3I3DA 1WKYA 2C26A 2V4VA 4P02B 4DEVA 3AC0A 2DDUA 3VD3A 3WNKA 2WN3A 2W95A 1JZ7A 1O8PA 2J1SA 1SDDB 4UAPA 2R7EB 3OBAA 3ACGA 1EUUA 4M4PA 2QBXA 1D7PM 3MBWA 5LA2A 2WAAA 3K77A 1UMIA 2OKXA 3K4DA 1JZ8A 3C8XA 1OH4A 2VM9A 4DXTA 2VL4A 3THDA 1K12A 4QX1A 3ACHA 3U37A 1GMMA 4CUBA 2W87A 2RVAA 3P6BA 2WDBA 4PF1A 4W50A 1WCQA 3FHAA 3BGAA 3OEBA 4CUAA 4ET7A 2XOMA 4HG6B 3A7QA 1H6YA 2LW8A 1EUTA 4BJ0A 2ZEYA 2WO2A 4BDVB 1T2XA 2W91A 1H6XA 5CZKA 2YFZA 4XUNA 1US3A 3OB8A 1UY1A 4QB1A 5DQ0A 3THCA 3K4ZA 3VDCA 3MV11 1ULOA 3UNPA 3LEIA 1DLCA 1LNSA 2VZSA 2ZEWA 1JU4A 3WF0A 3VDBA 2W47A 3PUIA 1J84A 4GWIA 4KI5M 2Y8KA 2L9LA 3T2PA 3I2KA 3DYMA 3ETPA 1KGYA 2W94A 1O8SA 4ZXEA 4MADA 4OUEA 1F4AA 3I2GA 4W4ZA 4QB6A 4XVHA 2VZOA 5FUIA 1GUIA 4D8MA 1XC6A 2XQXA 2CDPA 2YB7A 2QQNA 2XHNA 3EB7A 2JDAA 1JZ3A 3I2HA 4XUTA 1R64A 1PMHX 3CKHA 1SG3A 3C7OA 3LPFA 2BERA 3C7EA 3GGLA 3WEZA 5DN2A 1YQ2A 4XURA 4QDQA 3SEEA 5DPNA 4QX3A 5LA0A 4L0PA 4CU6A 1W9WA 2BBAA 3OG2A 4JX0A 1UY2A 4UOJA 4TTGA 3OGVA 2J1VA 1PX3A 3BN6A 4YPJA 5JXIA 5J1XA 2VCAA 3WF2A 1OT5A 3W5NA 5JXGA 5C70A 1UYYA 3I3BA 1L7RA 3SKJE 3WNPA 2J22A 3T0DA 1W8OA 3LPGA 2X10A 2VZ3A 3J7HA 4KWUA 4LQRA 1OF4A 5G05L 4A3ZA 1UMHA 1GOFA 2VOTA 5A1AA 1JHJA 1W9SA 4FI9A 4QAWA 4P00B 2HYXA 4JKLA 1UY3A 2VZRA 2WZEA 4M4RA 3HNBM 1CZVA 3VD5A 5IYYA 4OZOA 2EIBA 3WNLA 2PQSA 1K45A 3CMGA 1J83A 1GOGA 4MOAA 3T2OA 1MPXA 3WF4A 3LQCA 1GQPA 4ARYA 4ARXA 3FHQA 3HN3A 3DYOA 2WO3A 3DECA 5IFPA 3E1F1 4MGSA 4OMDA 4DUWA 2B9VA 4KMQA 2QQLA 4E8CA 2JKXA 5JXJA 4DXSA 4AAXA 4QDSA 2VMCA 3CQOA 2J7MA 2E31A 2ZXQA 3UETA 3MUY1 2YC2A 1TG7A 2E26A 1W99A 3WF3A 5JR2A 4A6OA 3C7GA 1JI6A 4LHSA 4RYDA 5JMOA 4A4AA 2J1TA 1TVGA 2W1SA 3FN9A 3A23A 4PT6A 4LPLA 1JYXA 2W1WA 2W9XA 3WF1A 4A41A 2E32A 2VZVA 2QQIA 1L7QA 2Y6HA 3ZM8A 2VQTA 3MUZ1 4XUQA 2W92A 4IUGA 2VTFA 2RJ2A 3LEKA 3ACFA 1OD3A 4PQQA 2YFUA 2V5DA 3SKVA 3WSOA 5JUVA 1P8JA 1US2A 1F4HA 2ORZA 4CU8A 2VZUA 2W46A 2WAOA 2EICA 3NJVA 2ZEZA 2ID4A 2WUHA 4D0QA 4JKMA 2Y6KA 2W3JA 2Z4FA 3I97A 4W8JA 4MO3M 1JYVA 3VD9A 4DUXA 1RYYA 5CYYA 3WNOA 5LCWL 1XNTA 3DYPA 3T0AA 2VC9A 3A21A 2KD7A 2WQ8A 4QB2A 5B4NA 2VMDA
chains in the Genus database with same CATH superfamily
2H0BA 4HKOA 2W68A 3H8RA 4KH9A 1A8DA 1RUJ2 4MHRA 1W6QB 1ZZBA 5FQ0B 4GA9A 2XH6A 4K1ZA 3H1MA 1D4M1 1XB9A 3NRUA 4NIDA 3VBFB 3D6EA 3SXWA 2R6QA 5A3MA 5FY8A 2B5HA 1VRH2 2W5FA 2JDKA 2YC4A 1PMJX 1ASJ1 4XJ9A 2VO5A 5DDJ1 4E4ZA 3WQBA 5A7WA 3IDBB 2VVDA 1OLMA 4WM7B 4HETA 2Z69A 2HWE1 2VG9A 2HWD2 1MQTC 5DAXA 4YW5A 3WZ1A 4IV3B 5GZEA 5D2AA 4CCOA 2EIEA 5LRSA 2CWSA 1S0EA 3D3AA 3VDAA 2IXKA 1W9TA 5DUVA 5J3UA 2IVJA 4QX0A 3I59A 5BNPC 1UOJA 4CEWC 5CG9A 2CTVA 3HR9A 1VRBA 3MI8A 4QXHA 2Y0IA 1MS4A 1QWRA 1S0IA 1S2BA 1IS4A 3PUQA 4EWEA 1WMXA 4DFSA 4GD4A 1MQTA 4O65A 5FLIA 4A6SA 3LDBA 3HPNA 5FYSA 4FBFA 5EHDA 2FZ1A 1UIJA 3VB9A 2PTMA 4CEWA 5BNPA 1SPPA 2JD4A 4XC9A 1UXXX 1NKGA 2QQKA 1XE8A 2XONA 3ZSJA 5L19A 5FY4A 2E7AA 4YG6A 4CDXB 3N7KA 4HBNA 1N3PA 2YMZA 2ZGKA 2E7QA 3JZVA 2VMFA 5FY9A 1KS5A 1VMJA 3B3QE 5ANQA 3VBUC 4EJRA 1ONAA 3ZFGA 2ZA9A 4XABA 3RMYA 4FPLA 1UWWA 2P34A 4LBMA 4Q29A 5C9AC 4YZ4A 1N1YA 4NO4A 3MLJA 5IHRA 3FL7A 4BA6A 3S5QA 1Z0HA 2Y64A 5T3NA 4UW6A 3KV9A 4YLZA 3S7IA 2DCKA 1W8FA 4COVA 1JODA 5LW9A 3S57A 4CTEA 1UW8A 4XAEA 3T2QA 5FZOB 3LOIA 5A6XA 3VBUA 3OGRA 1JZ2A 1A8MA 2JJ6A 1DYOA 1YQ8A 3ROUA 4IDZA 1EPZA 1UOBA 3I49A 2D5FA 5C9AA 5FUNA 3H9AA 3P1IA 2VAUA 5BNQA 4C0BA 1H8TC 5FREA 3CZJA 3W9AA 1AR73 1VAMA 5LBFA 5JMCA 1CD3G 1QJX3 1YFXA 3O5SA 5DG2A 2ZCWA 5EYYA 2P6HA 2ADEA 2E33A 1QQP3 3LSDA 4JGZB 3B9IA 4D7SA 3ENRA 5LBCA 2PA7A 1EP0A 2VNGA 4I09A 4LO7A 3WCSA 5EJZB 1Z7S2 1DP0A 2NMOA 4FFFA 4FAHA 2Q8EA 3FJSA 1OQEA 2DVDA 5AC93 5JR7B 4C8DA 5JPNB 3OUJA 2WZ8A 4Y1YA 4B8EA 1H8VA 1NA1C 3FLTA 1OFNA 3PTRB 1F35A 1EY2A 1LOEA 3WUCA 2PMWB 4FPFA 1BMV2 3PNAA 1HB4A 5JXHA 3K2OA 4LBJA 2OZ6A 3J4UH 3PIJA 2X09A 2FCUA 1KD7A 4QMAA 2R073 4IQPA 3B9CA 3ZN6A 1WMEA 2RE9A 1O3QA 4HXCA 4DEQA 2W1QA 1NA1A 4XF4A 1U12A 5H9SA 3VBOB 1I5PA 4LKDA 1ST8A 2A3WA 2VUDA 2X5IC 4N8MA 1V6MA 2O0OA 3HN1A 4HANA 4IXLA 4WVMA 5FK8A 4FPYA 1DYPA 3KV4A 4NIGA 1WW7A 4RD7A 5F9TA 2C9KA 3HQXA 4Q4W1 2G19A 3AYEA 2VZTA 3VZJA 3POSA 4OFGA 4PBOA 4C90A 2IWGB 3VBFC 4YSFA 4OQ9A 4F83A 1XE0A 2ET1A 3LEMA 2P3YA 3CJIB 3CZUA 3EQEA 5L7OA 2UWBA 1V6NA 5EQUA 4EE2A 4BIFA 5IVVA 3T08A 2I45A 3K51A 4I30A 2ZX3A 3TN93 4WM7C 1MS8A 1TMF1 1W6QA 2J1RA 4JC1A 5FPBA 5FQ0A 3FUQA 4GKXA 4L8QA 4QX5A 3MIGA 4IV3C 4G3YC 1UX7A 3VBFA 1VAKA 4LKSA 4YW3A 2JB8A 1VMFA 5C71A 4LBQB 4NRQA 2ZGTA 2VZPA 1UY4A 3DV8A 1KS4A 2VH9A 4XBNA 2YBSA 3OTFA 2HJIA 5HV0A 4EQVA 4QM9A 4BZ4A 1GP6A 4D94A 4WM7A 2WN2A 1PNFA 2HEVF 3MF9A 3QLQA 4HOOA 4RN5A 3RZZA 4Z2AA 5C7GA 1RXGA 1UYZA 4IV3A 2R071 2R16A 4MGQA 3H3UA 5FMOS 2WNUA 4EN7B 2QQJA 5IFTA 3I3DA 2D93A 3BIEA 4WVVA 2VECA 4P02B 4DEVA 4M01A 3USSA 3H1WA 1Q8VA 2IXJA 4EN6B 1ZA4A 4CDXC 3NJYA 3PVBB 2B45X 3VD3A 5BUVA 1ULGA 4Y20B 3LOBA 4AHXA 5FO8B 3S0MA 1BBT3 5CB7A 3H0OA 4AFBA 2J1SA 2WT1A 1SLLA 2NLRA 4UAPA 2R7EB 1HQWA 3OBAA 2WWUA 4YGBA 5EP9A 1F31A 1EUUA 3WP3A 5LA2A 3EXUA 2AREA 5A1LA 1YWKA 4NWWA 4XFCA 5FWJA 2DVBA 1ZBE1 2BNOA 5K0UB 4HZFA 1G9FA 1BEV3 5F2WA 2B9UA 4CDXA 1ZBA3 2NQYA 2QDNA 1ZRCA 2WT2A 4QX8A 1OKOA 3ZSMA 5FZLA 2VM9A 4DXTA 2R1BA 2OX0A 1MS5A 2BQPA 4DXZA 1NZCA 5LATA 3SH3A 3KT7A 4Q4Y2 1G86A 3E6CC 4IL7A 4YGDA 3LZZA 5IWFA 4FVVA 4CUAA 4HFSA 4CSWA 5FCCA 1MACA 4C0HA 4HG6B 1C1LA 1OVSA 1EUTA 2HBTA 3RYKA 3SCGA 4KU7A 2ZEYA 5FZOA 3THTA 3I2OA 4LHLA 4JGZC 1HKDA 4K7JA 3GJBA 2DBNA 4CCCA 4QKNA 3AZVA 1W6NB 4W6XA 1H2NA 3ILRA 2VD7A 3POBA 4PIXA 3WG3A 1A78A 1D2QA 1UY1A 2D6LX 2R042 3UKVA 1NG0A 3AKPA 3K4ZA 4M3CE 3VDCA 1SLBA 3OGJA 5A3LA 5C3SA 3QD6A 3BUCA 1YJLA 3LFMA 3E6BA 2YV8A 4JGZA 3LEIA 3N36A 4LK7A 4AVTA 5FYUA 4E4HA 1O3SA 2IFWA 4B4PA 1BBT1 4IE5A 5A7OA 4XE9A 2VTXJ 4XETA 2NPIA 1URXA 4XDOA 1CIWA 2Z79A 3AB0A 3WW2A 4D6QA 2AR6A 1PK6B 3GCXA 4HT1T 3JCIA 4XJUA 4OVEA 1CJPA 1BEV1 1KGYA 1VBB3 2W94A 3M7AA 3U14A 4CDUB 4MX3A 3JB4C 3VBOC 4ZXEA 5KC5A 4Z82A 4K8FA 4W4ZA 5FWEA 1S0JA 1XQNA 1DQ6A 1DGWA 4NMIA 4BYYA 1GUIA 1QXJA 3APBA 3WHTA 1XC6A 1CN1A 3CLPA 1SBFA 5TSWA 3KHCA 2JXAA 1GFF2 4PQ9A 4FPKA 5FXVA 5FZIA 2CGPA 1JZ3A 2G1MA 2QVSB 3WHUA 3VBOA 2DVAA 5A7NA 1MS1A 1PMHX 3CJIC 1RUE3 4QQLA 2DU1A 4QPIB 2VE1A 3C7OA 3LPFA 3X29B 3N9MA 4B7KA 3OBRA 1SFNA 5KHIA 1XNKA 1XBFA 2RM22 2XKOA 3C7EA 3GGLA 2O8QA 3AP4A 3P3NA 5I8TA 2OS2A 1DCSA 3J7LA 4DY5A 1YQ2A 3DKQA 1RUD3 2XL7A 3KQRA 2DV9A 3SEEA 1LGBA 4AXOA 4Q0SA 3GZUC 1AX1A 1YFWA 4QHOA 2JEMA 4QX3A 3FHIB 3RI9A 4CU6A 1W9WA 1S2EA 1UY2A 4B4RA 2BFUS 2RR13 4UOJA 4TTGA 2R49A 3NVCA 3BB6A 3K48A 3BN6A 2MPFA 1W05A 3KVBA 1TE1B 2BNNA 1OPMA 3B7MA 5FK7A 2PLV1 4XOGA 2ZPXA 5AFEA 5JSPA 3N7JA 5A33B 4LBLA 2ZKNA 5C6CA 4TLGA 5AVPA 2XHKA 4ZONA 1VBB1 1JN2P 4MGKE 4RR3A 1KITA 2XBO3 3FC0A 2PELA 4H7MA 2VZ3A 3ZFFB 3H1YA 2QCSB 2CL2A 3VLBB 4EN8B 3DUIA 4DZGA 4XF3A 3VHRA 5CU1A 3I3MA 5F2SA 2RJLA 1W9SA 5LRRA 2VBDA 2XWJB 4QXCA 5T5OA 1O3TA 4Q0QA 4ISRA 4NOTA 4DB5A 4JKLA 4NAOA 3VN4A 2VMIA 3W21A 4RA0A 1RVF1 1O91A 2WZEA 4Y5SA 5DZEA 3RG0A 3VZNA 3I4IA 1WA4A 5K0UC 4K9SA 2Z2SB 3NNLA 4Y20A 5A3TA 1HXS1 3S30A 2HWB1 1N1SA 5I93A 1CAXB 1J3PA 4QGMA 5EXOA 3FFQA 1RUG2 4FXKB 3RYRA 3WNLA 1J1TA 1FMD2 1Q56A 4IETA 4EWDA 5F32A 3VUOA 4W65A 1G8WA 1W90A 3WDWA 4HMZA 1WCKA 5M0TA 1GANA 1U5XA 2YC0A 1IKPA 5K0UA 4XYXA 5FOBB 4YM2A 3ZIXA 1H2KA 1TNFA 2BEOA 4XJ8A 4Y22B 3JUUA 2O1QA 1U5ZA 4FP2A 2HWF1 3IPVA 3LQCA 4ARXA 3ORJA 2WLPA 1W9FA 3ZDVA 2WO3A 3GBGA 5IFPA 4MGSA 3V64A 4NE9A 1FOD2 2B9VA 3L9JT 4NROA 4KMQA 4AFDA 1RUOA 5JXJA 1G9DA 2IXLA 3NJZA 1PO23 2VMCA 4QDSA 4YARA 1COV2 1YHFA 4TWTA 2DUOA 1LB2A 1O4ZA 3AYCA 2CHHA 4LKFA 2CSGA 4LA2A 2PHXA 1RHI1 2YC2A 5T54A 3O1VA 3BYWA 1JHNA 4RGGA 4CCJA 2NN8A 5GALA 3HVDA 1PK6C 3HT1A 3MEPA 5KHKA 4H55A 1RUI2 4LHSA 3AMQA 1OMIA 3OSDA 3TEZA 4PBPA 1RUJ1 4CDUC 1PO13 1Q5OA 3M3EA 3WDYA 2NM1A 2EAAA 4JDMA 1YQ5A 2AC1A 5JOWA 3MHZA 1VRH1 5E88A 3MIHA 5FYYA 4LPLA 2W9XA 2YU2A 1UZYA 5IK5A 1PK6A 2E32A 4K6BA 5FZ7A 5FJKA 5IK4A 2WIIB 1QHDA 4CDUA 1BYHA 2DUPA 3UKNA 4UT5A 3C2UA 3ZXJA 4M0HA 1KDKA 4TSVA 2HWD1 4HK8A 3N9OA 4XUQA 2OUJA 4XFGA 3POEA 5DZGA 1APNA 5CEHA 5KXEA 5KXDA 4UXAA 3DEMA 1QH6A 4QPIC 4PQQA 5K9YA 1Y9GA 1QDCA 2YFUA 1Y9MA 3ZXKA 5KXCA 1AUYA 2HWC2 2Q5TA 4XFFA 1H4HA 1MZFA 2JDMA 5K4LA 1YNAA 4B4QA 5C8WA 2K2SA 4QHBA 4AGVA 2ZHKA 3NJVA 3S5AA 1SQ4A 1QXRA 3ASIA 5FYIA 2VVEA 3PIGA 1AYM3 1QJU2 4GXLA 1T6GC 1OSGA 4HSLA 2ZGSA 4QPIA 3FFZA 3HMYA 2P2KA 1DLLA 3I97A 5ISLA 4PI2A 1GLHA 4Y1VA 3I3QA 4W8JA 2RJKA 4HPKB 1C57A 5T50A 2ZHLA 1RYYA 1YI7A 1NLQA 5CYYA 1AR93 4XTMA 3N7MA 2XLAA 1XNTA 4MUVA 4FP3A 5HV4A 3RWKX 2VC9A 3PURA 4QKDA 1UO9A 5IK8A 3ZFFC 5FKCA 1PIV2 1R1A2 1PHMA 3ILNA 2KD7A 1KJLA 2IXHA 2VQ0A 3AP9A 1ZM1A 5I91A 2I07B 5AVAA 1AL22 3VKNA 3ME2A 2J1AA 1K42A 4QPGB 2VQUA 3ZR5A 4HL0A 3NQHA 5I0DA 3VD4A 5A7WB 1TME3 2CDOA 3ZFFA 3VZMA 5FY7A 2G9GA 1ULFA 1GOHA 3JQXA 3VHPA 3RZMA 4MHUA 4R4XA 1OD5A 4FTBA 3PUHA 1HN1A 3U75A 1A6CA 4K1YA 2JENA 2VUCA 1JZ6A 4IEOA 1VBE3 1YQCA 1LGNA 3I59B 4UW3A 1JYNA 1JS9A 5GJ6A 2OYZA 5L9VA 3LAGA 2ES3A 5L9BA 2DFCA 1E57A 1Z7S1 1XNDA 2RV9A 4IGPA 2JDZA 3HQUA 3O0VA 4A7YA 2GC0A 2VUJA 5JOZA 1CIYA 1CAXA 2GP5A 4KG8A 2R062 1F5JA 3EHKA 3VBRB 5LZ6A 2XQRA 3GM8A 1YFUA 2EXIA 5BNPB 3RJ2X 1W3VA 3JXSA 2C4XA 1MVEA 4ASKA 1YXWA 1V9U2 4AL9A 4MV2A 2OIIA 2ZGQA 2WFF2 1PZ9A 1Q43A 2XKPA 4Y1XA 3R0RA 5FOJB 4ZY9A 1BMV1 2QKDA 1XXNA 5IJRA 3SH4A 1NXMA 1OA3A 1IS3A 4Y22A 3CBNA 2EXHA 2GNDA 2ZGUA 2ZX4A 3WQ1A 3ZFGB 5DABA 2J1EA 5DAWA 1CAWA 5H9QA 5DUXA 2RS32 3BVCA 5EIYB 4I2OA 3Q9OA 5K8SA 1C8M2 4OMCA 2I74A 5I8SA 3VKOA 5KHGA 1OHFA 3O7OA 5KC6A 4Y3OA 3K75B 1W0OA 3I2JA 1Q8QA 2EALA 1OA2A 2LM3A 3UKTA 2LS6A 2Y6JA 1WZXA 4E2QA 3EYPA 5F6KA 4Q1PA 4XUPA 4XPVA 1ENRA 4AQSA 3OBTA 2NMNA 3TOJA 3BTYA 1VBC3 1CZTA 4E8DA 4Y5TA 2OQ6A 3POYA 1W8HA 2JKBA 4JVAA 4JHTA 2YDEA 4NHXA 2BZDA 3TWIA 1X50A 4GALA 1XYNA 3PHMA 4TXWA 4INDA 3AKSA 2WZR2 4DPNA 2JE8A 1STMA 2DYCA 4I01A 1S2KA 1LAJA 1LULA 5FP9A 1ULDA 1FATA 1ACCA 2PAEA 2A6VA 2RMU2 2FCVA 4GULA 1W0NA 3ZO0B 4GB32 1UZWA 2WO1A 1DQ2A 2BGPA 1UMZA 3I3EA 4N9IA 4XQDA 4XQWA 5JSOA 5C5TA 4BK5A 1GP4A 4L97A 5ANNA 2GN3A 2B4KA 4LR4A 3T0BA 1UZZA 3WNNA 4IERA 4AEDB 4RHV2 1UD1A 2XVLA 2C9AA 1DF0A 1VP6A 5DDJ3 4AFCA 3CJXA 4BM8A 3IT8A 1AXYA 4ZZ8A 4KBBA 3QCWA 1KEXA 1OFSA 2BOJA 2CAVA 3AYAA 3LGRA 1LTEA 3SLIA 4HONA 3MIBA 2ARBA 2BGOA 4KBZA 4R8HA 3AZWA 1FXZA 1M06G 1GZTA 3KT1A 4NPMA 1OF3A 5FMDA 5IVJA 4OLLA 3LCPA 1UOFA 5E16A 4CU7A 5A7QA 1JZ5A 2WWSA 3H8OA 2E63A 3P5BA 5FIXA 1W9YA 2P4EA 1QGLA 3ZYPA 3HJRA 2D5HA 3GZAA 4ASLA 4IGOA 2AGSA 1UZ0A 5JPMB 4HLTA 1OLRA 1RUF2 3NV1A 4AZZA 5L7OB 2ZAAA 1HB1A 2GZWA 1FI2A 2NZ9A 4QPGC 4Q5OA 5E89A 2ATFA 4Q4Y1 3HBZA 3OGSA 5FZAA 1DQ1A 2DBIA 1HN0A 4N53B 5FPVA 3KT4A 2X53S 5C8CA 3N4MA 3RNSA 5E8AA 1FV2A 2XGXA 2JWPA 2J1UA 1POV1 1SCSA 4OQ8A 3F95A 1C3HA 3C7HA 5IAVA 1ZZ6A 1UU6A 1V6OA 1JUIA 5CA6A 1ND3C 4QPGA 5A7PA 3UL2A 3U07A 1SEFA 1NUKA 1ALYA 5DMYA 1KFXL 4Q0VA 4AF9A 3BOWA 1EAH2 4C91A 2PXJA 2Q8DA 4AWDA 2VQAA 4XZPA 2WNUB 1G9BA 2IC1A 3VBRC 2PHWA 1XPWA 1ZZ9A 1ND3A 1QXPA 4UFHA 2XJPA 2JD9A 3H8XA 4FFHA 3MLKA 1WKYA 2ZKLA 2CGNA 4LMFA 3J26N 1JYCA 1OLME 1F2NA 4XXPA 4K21A 3AC0A 4E4DX 2DDUA 4IE7A 4AK3A 1N1VA 3WNKA 2WN3A 3MF6A 3ZFGC 4DY3A 1GICA 1RUH2 3WXPA 2Y33A 1IS6A 2BGCA 3NAPB 1YRZA 3VBRA 5A1FA 1LENA 2A71A 5H9RA 3ZVXA 3VBSB 4UWDA 2ADDA 1VR3A 1OBNA 2F4LA 3ACGA 3H7YA 4KU8A 3SCFA 4R9DA 1NLSA 2FBEA 4M4PA 3MBWA 1DDLA 1C1FA 4CCDA 1BK1A 1WW5A 3POGA 2ZAHA 1REFA 1ZRRA 2OKXA 2GU9A 2WNOA 1WLCA 3K4DA 4N9HA 4LLFA 4BQ1A 5A6QA 1OH4A 2B39A 3WDTA 2WC2A 4RFT0 3WD5A 3TEXA 3U37A 4M3CF 2RVAA 3P6BA 4PF1A 4DINB 4NJ4A 2GH8A 3UGFA 2WS92 3ZYFA 2XUEA 4ET7A 1OQDA 2OUHA 2RM21 3A7QA 3V0BB 5LK7B 1H6YA 5JWPA 1QOOA 5C33A 1W0PA 1CR7A 2WO2A 1U5YA 4BISA 4YW1A 4Q4W3 2W39A 3N3HA 4BIOA 1AHSA 1LOCA 4AW7A 3MIDA 3ZDSA 3BALA 3AL6A 2YFZA 4LOTA 4XUNA 2Y0OA 3WQ0A 4AEDC 2QJVA 5K7PA 4LA3A 4QB1A 4GMP0 4LBQD 2H6CA 5CADA 3THCA 3IN9A 4L92A 2WLQA 1HB3A 2YXSA 3UNPA 2VOVA 2XJSA 3KV6A 4GWNA 4ES9A 1TMF3 1ZREA 5FZHA 1QJY2 3TNQA 4FO9A 3ZX7A 3IKWA 3M1HA 1W6PB 2TEPA 3KZ4C 5JOYA 1VIWB 4AEDA 1CGPA 2XVGA 5C3PA 3PUIA 4IEYA 4KI5M 5FYCA 1S0BA 1POV0 2BP6A 2MEV2 1X33A 5FZ8A 4MVTA 3QH7A 3AFGA 3ZSEA 4D7TA 1I9RA 2LROA 1WD4A 1O8SA 3KSCA 2DTYA 1F4AA 4COUA 1VBA2 3AYDA 4YW2A 5ACA2 5KBFA 2TUNA 2XJUA 2P17A 1PVC2 3H42B 4X6QB 1OC1A 5DZFA 5LB6A 3GALA 3TB0A 4ATFA 5GZCA 4CP1A 2PHRA 3O14A 2CNAA 3AZZA 2D7FA 2XQXA 2CDPA 3AXDA 1AJOA 1XSQA 2QQNA 2XHNA 3EB7A 5L7OC 3KB5A 3R6SA 5F1RA 4QQHA 1RUG1 3Q8FA 4XUTA 1FMD1 1H1MA 2PHDA 4FOQA 5HCBA 5LBBA 3ZYHA 4N53C 3CKHA 2PN5A 1W3XA 4UYBA 4IEQA 4NPLA 4ORFA 1EV12 1W2OA 1OQ1A 2VPVA 2VVFA 1WW4A 4NPRA 5HBAA 5F37A 3HWJA 1MEC2 4BQYA 1VALA 4M00A 4PI0A 4LBOA 1G9CA 1ZBE3 2ZGPA 4N7UA 4CPBA 1WA6X 4XURA 2WNEA 2ZHNA 4E4SA 2VOKA 4KWLA 4N53A 2FD8A 1ULEA 1W6MB 2BBAA 3OG2A 3CL1A 4JX0A 1QU0A 3VZKA 1FOD1 5JXIA 1W39A 1XYOA 2WNUC 4NR1A 4XMAA 3AX4A 4RR3B 1GBGA 1I5ZA 1UYYA 3RZKA 2H6BA 3O1SA 1J3RA 4D3WA 1ZZCA 2SLIA 1GZWB 3JBG2 3JD72 1M4WA 4QKBA 1W8OA 1AYN2 2BUKA 3T4VA 1RUC2 5A70A 1QF3A 3AJZA 4FPOB 3RDIA 1OF4A 1O5LA 1RUI1 2GN7A 3NV4A 5FP8A 1X9PA 5G05L 3ZXLA 3ZYIB 3NAPC 4A3ZA 4EV0A 1DU3D 4BWOA 2VOTA 2ZGNA 3NO8A 4XDQA 3VBSC 1NXD1 3E5QA 2UY9A 1G9AA 4FI9A 1YYNA 4P9GA 4QAWA 1IGOA 3ZSKA 2G9ZA 4YNIA 4NRPA 4BHPA 1MS3A 1GQHA 3POFA 3UGGA 3AP5A 3VHOA 4DRRA 5HCHA 3WNXA 2FZ2A 2WNVC 2GMPA 2UWAA 2YPJA 3C3VA 2XL9A 3AK0A 3USUA 3ZN5A 3NAPA 1CZVA 3T4HB 3O1RA 3VBSA 5FYMA 1FT9A 3VD5A 5KR7A 3ZKUA 2EIBA 4XBLA 5I0TA 1QEXA 3ATGA 5LY2A 2ZGLA 1ZRIA 4N90A 2WZPP 1K45A 3S7EA 4CRQA 1MS9A 5CBLA 3INAA 2WNVA 2HWC1 4Y5Z0 3AXEA 3IPVB 1GOGA 2BNMA 1AVBA 2GNBA 3LWCA 4MOAA 4HVQA 5EWSA 4BCUA 1GV9A 4GIQA 4IEWA 4OHZA 3PMEA 1QJU1 3DYOA 3DECA 5FMBA 3ZN4A 4OMDA 2UY8A 4XCBA 1C4RA 5GLTA 3WINE 1ENQA 1PNGA 5A80A 4XJZA 5IK7A 3V0BA 1FPN2 2QQLA 2JKXA 2QQUA 2ZGRA 1R092 1YEWA 2VW1A 1FYUA 3NWKA 2WQ4A 3D0SA 1W6OA 3RYPA 4ZXKA 2AACA 1JMUB 3KS7A 3PVNA 5A3PA 1HRV2 2QNKA 1WLTA 3UETA 3LA2A 2D6MA 1AX2A 3OPWA 2UYAA 1CQ9A 1MS0A 2KA3A 4Q4V2 3ZYGA 2DWRA 1PIV1 1R1A1 5CFCB 1AJKA 2E26A 3AP7A 3WG4A 3VDDB 1C8NA 3C7GA 1EYBA 1X8EA 5JMOA 2RS52 2VOXA 3U4XA 3M3CA 1QIQA 1ZX5A 2Y6FA 2J1TA 1AL21 5FY1A 2HH9A 2W1SA 1UN1A 1U5IA 1W6PA 1ULCA 2PLV3 5A32A 4AHYA 3K3NA 3V56A 4AI3A 4Q27A 4DRVA 1AR82 4L2NA 1JYXA 2VGDA 4MLOA 1W2AX 1X36A 4A41A 2YGLA 3PTYA 2QQIA 4O7XA 4IE0A 2WJSA 2EIGA 3O1PA 2WKKA 2ZGMA 3JB8A 2BWCA 2QQWA 4Q4X2 2YGMA 4U2AA 5F8PA 2AEZA 4IUGA 5DAQA 5FV3A 2RS12 1W8TA 2Q30A 1AR62 3LEKA 1OOPB 3LA3A 4XFBA 2FMDA 3AZYA 5GZGA 5FZDA 1UKRA 3SKVA 3WSOA 1RC6A 1US2A 2VCMA 4LO4B 1F4HA 1C5IA 1QJFA 3OYWB 4OCTA 3POWA 4WV8A 5IUQA 1RVF3 1KRIA 2VZUA 3H7JA 2ZTNA 4Q1RA 2WAOA 1W8WA 2R061 2FDGA 2VMGA 3WG1A 2EICA 2WSUA 3K3OA 2ZEZA 1HXS3 5F3GA 5FZ3A 2HWB3 2JECA 4KL1A 3RZGA 4QM8A 2OA2A 1V9U1 5LY1A 4RHV3 3FLRA 1L3JA 1YC61 2WFF1 4L11A 4O9GA 4OUMA 2W3JA 2VY0A 2Z4FA 1J1LA 1VBD2 1BCXA 2PHUA 2I2SA 4D7YA 4MO3M 1GWKA 5FJHA 1JYVA 1DZTA 4RR3C 3M70A 1UU4A 1B35A 1HV0A 1PMIA 4IW3A 1IQAA 4HK9A 2B8MA 2D6OX 2RS31 5LA9A 2VOWA 2CY6A 2P3IA 1W6MA 1C8M1 2QDRA 2HWF3 4F7ZA 2FDHA 3Q8AA 5HXVA 1FNZA 1UNBA 1RXFA 4OZXA 3RQ0A 4XILA 1QNWA 1XU1A 1DQ5A 3CF6E 3P3PA 1POQA 4YVWA 1AXZA 4QD2A 3WW4A 3FX3A 3MW3A 2YU1A 1PZ8A 3WDVA 2W08A 2TBVA 2F17A 4A42A 5FUPA 3O1MA 2WYSA 1GZWA 2ORXA 2WT0A 3HOBA 4FOWA 1H1AA 1W8NA 2VBPA 4MH0E 3E5XA 4RL7A 5EJ1B 5G04L 2YBKA 4UW4A 2ARAA 1MZEA 3I2IA 1W2TA 1H1IA 3MFCA 2DVFA 3GXUA 3OPTA 5I0UA 5JOXA 1GU3A 1RHI3 2WZR1 4OI2A 5FP7A 3AVSA 3LDRA 5CKQA 4NHMA 3LEGA 1CWPA 2RMU1 4B1MA 4COYA 1RUJ3 4GB31 4HKLA 5IVEA 1UU5A 3OD4A 1IOAA 3HD8B 4CA9A 1LCLA 4D69A 3IDAA 4AFAA 5CISA 3T09A 1ENSA 3HBKA 1HRI2 2DURA 2BOIA 4CVUA 2WBKA 1VRH3 1GQGA 4RHV1 1ZVFA 3RS6A 4LOSA 3MW4A 3THPA 3LFIA 5FO9B 5JAXA 1BQPA 2Y38A 2GMMA 3T1LA 1PGW2 1WLDA 2IXCA 3FBYA 3U1XA 4LT5A 1GR3A 1KDMA 1S0GA 2RDQA 4LHKA 3PVOA 2HWD3 2AEYA 2WFPA 4RS5B 1IHMA 4HVOA 4K8RB 3UYJA 4BXSV 1S4CA 1XRUA 1CPMA 5A3WA 1N3QA 4TN7A 4NIIA 3OPZA 1CAWB 3E5UA 5JI9A 4YYOA 2EA7A 3KGZA 2K9ZA 2JG8B 5BXXA 4Z1VA 4NRMA 5EYXA 2KM2A 2PHTA 4IEPA 3B94A 4P5YA 2A3YA 3OD0A 2VJXA 4EROA 2E53A 4AQ6A 5CFCC 2IUWA 3U10A 4Z07A 2DCJA 1AR72 2WSVA 2Q1FA 4Q2FA 4YM1A 2HKXA 1QJX2 2ZBJA 3VDDC 4PLNA 3ILFA 1KJRA 5GKAC 4DMIA 2HBUA 5BYNA 2BBVA 1IG0A 2TNFA 1QQP2 4DOUA 4AEMA 1CESA 3CU7A 1RUF1 2XJQA 3ABZA 3A22A 1UIKA 1OI6A 3VD7A 4XEZA 4WZFA 4UFKA 3PLQA 2DCTA 1DYKA 3NNGA 1JTZX 5JLVA 4CDWB 3WT3A 5CFCA 5F5CA 4BLIA 1HLCA 1JZ4A 2JIGA 3W5MA 3URFA 3VDDA 1GNHA 1ND2B 5AC92 2D98A 4PIZA 1CZSA 2X29A 5DXDA 4XZUG 1DZRA 5I8YA 1RITA 2JDNA 2JDHA 1LOFC 1NLRA 3AVRA 1W2NA 2LALA 4LBKA 2VR4A 2VMEA 4AVVA 4D6SA 2OT7A 3B00A 1X8MA 1BHGA 1OOPC 4UBGA 3NV3A 4R9CA 3IWZA 4UFIA 4QPWA 4ZS2A 4Q0PA 1EAH1 1GZ9A 5F7UA 2BWAA 4WM8B 3MO4A 5FZ6A 2A6XA 3OUIA 4CU9A 1A34A 3WP6A 1LOFA 1NQJA 3DGTA 3DPRB 4FPCA 2R0FA 3WOGA 4OYUA 1OOPA 4I02A 5D8AB 1JU3A 3V0AB 5HXMA 1O6UA 4FPJA 5LEJA 3OYWA 3WLUA 1G7YA 2VZ1A 4CP0A 5DAVA 4XIOA 1PX4A 1Z7S3 5DUWA 3LDKA 1QJY3 2O14A 4DXRA 5A7SA 3ECQA 4CP2A 4BQXA 1G6NA 1XOYA 4CUCA 1NT0A 4AG4A 1SACA 4BQ2A 4ZKTB 4GQ7A 1XU2A 3KWVA 1OA4A 4TZDA 1OUXA 5IAXA 4JHZA 2V5YA 4H14A 3TN92 4XFAA 4QX2A 3IB3A 1I1EA 1QMJA 1Q3EA 5B2GB 2Q1ZB 1QOTA 3HAGA 4PJYA 1JYWA 5FZ1A 5ACA3 5C8CB 2R32A 1I3HA 3EBRA 1ULPA 3M3OA 1GWLA 2JDUA 2WS91 3AZXA 5FPLA 2OXBA 3MIEA 4P08A 2Y6LA 2BYVE 2BVVA 4YZ1A 2IZWA 2VCCA 4Z92B 3ZYRA 2A6ZA 1VB2A 2ZS6B 5EZWA 1ENXA 1NAEA 1UOGA 4FPGA 4ISQA 4V2VA 1RTVA 2QQOA 5DUUA 1EV13 3ZPOA 2WR9A 4SLIA 4CYDA 3TRSB 1X7NA 2Y6GA 4B1LA 1HQNA 4EZHA 3BU0A 5FMOL 1W28A 1AZDA 2VCBA 2BDRA 3U4SA 1HW5A 1ND3B 4OUSA 2XLFA 1S0DA 3CIHA 4Y4YA 5C5UA 1PM7A 5FFOC 3MV01 3UGHA 4ZS3A 3GYDA 3HNYM 3A0KA 4FT8A 4IE4A 5IW0A 1QJY1 4XACA 5T55A 1BVP1 1Z78A 4QXBA 2JG9C 2A6YA 4RS5C 1ZRDA 2PFWA 2V4VA 2KR2A 4CCLA 3IMMA 4JTOA 1BEV2 4Y24A 1ZBA2 1ZZ8A 2BJSA 1D4VB 2YHJA 3DCQA 1TEIA 4NWVA 4TYSA 2DCYA 2JG8C 4CP9A 2MEV1 1OKQA 1W8ZA 1PGL2 2UWCA 5C4WB 2W95A 2ZX1A 1O8PA 2UURA 1LKNA 3PMSA 2ETEA 1YUDA 1SDDB 4UBHA 2GH2A 1F8VA 2ZZQA 4RS5A 1UQXA 2JG9A 1VBA1 5ACA1 2QBXA 1D7PM 2GSYA 3ELNA 4QHZA 4U36A 1HIXA 3POIA 2WAAA 2DCZA 1UMIA 3K77A 2JG8A 3ZXEA 1CPNA 4AGGA 2A70A 2EXKA 1CAVA 4XJAA 4JGYB 4Z2WA 3AKRA 3RSJA 3L2HA 4CDQB 4E9KA 4CUBA 1OPOA 2W87A 4RQPB 3ZFEB 3RJRA 3IM0A 2WDBA 4CDWC 4W50A 4W6WA 2Z42A 5JI7A 1WCQA 5F39A 1EV11 3OEBA 1ND2C 3MIFA 4LKEA 4MZUA 5GLZA 3W59A 5KHJA 3J7NA 3PU8A 2XOMA 3J8F2 3N9QA 2LW8A 2XR4A 4GMP3 2GC3A 1GKBA 2CU5A 5T5LA 4BDVB 2XUMA 1SDWA 2W91A 3BTAA 3ETQA 4GKYA 3WVJA 4I3PA 4JZRA 2VW0A 3B93A 3R05A 1H6XA 1K5JA 4CDWA 5CZKA 3M3QA 2QTWB 5I0RA 1US3A 2PYTA 1KXGA 3IZOA 1ND2A 2A75A 3AKTA 3OB8A 1XJAA 2DU0A 4Q4Y3 2WO7A 4OHVA 5EJ3A 4WM8C 5DQ0A 4BMBA 2GP3A 4DQAA 2K46A 5KHHA 2A5ZA 1WWYA 1R1ZA 3MV11 3NNJA 1POV3 3DPRC 1Y7BA 1DLCA 3R4DB 3GZTB 1GWMA 2GMEA 5D8AC 1JU4A 3JBG1 3JD71 4XF0A 3SH5A 5JZGB 1W06A 3GBFA 3G6JB 1EPWA 4P9IA 4FCAA 4X8PA 1RUC1 3VDBA 2W47A 4WM8A 2JX9A 1J84A 3FWEA 4GWIA 3T2PA 4XDPA 2R043 4QWNA 2GNTA 1ODMA 2JDYA 2XMLA 3DPRA 3ETPA 3DYMA 2OPKA 3I2KA 1QH7A 4YWAA 3SISA 1RB8G 1NY72 4QU1A 4XBQA 3O1UA 3RI8A 3VKFC 1RUE2 5CNAA 3VKMA 4Q4V3 5D8AA 1ZRFA 4MADA 4OUEA 3VBHB 5L73A 3V0AA 1NQDA 2NP0A 1JW6A 5FRAA 2D43A 4QB6A 1J59A 3W20A 4C1WA 4X8NA 2VZOA 3GHMA 5FUIA 3QBQA 2GC1A 2A1XA 2YB7A 1RINA 1RUD2 1WGPA 1PGSA 1QKQA 1OH3A 2YZ4A 4FPHA 5C8CC 1NE4A 2VTXA 1U0AA 3I2HA 4GMP1 1NOVA 1PZ7A 1AR83 4NHKA 1H30A 3WX5A 4O61A 1S55A 2BTVC 2RR12 2WINB 3MLLA 3TNPB 5HCAA 3OY8B 3R4SA 5FBZA 1GP5A 5FZKA 1SG3A 4JV4A 3NV2A 2Q1MA 3UT0A 5E6HA 2CV6A 4AVCA 1I6XA 4DS0A 4MSVA 3Q8CA 5FKBA 2D40A 4BQ3A 1BZWA 4NIAA 3WEZA 4AI0A 1HDKA 2XG3A 3ZYBA 2BFUL 5DN2A 3NL1A 1SMVA 1TNRA 2ZOEB 4ONUA 4AGRA 4YW6A 1H9WA 2XBO2 4H7LA 1XNBA 4P9XA 2DUQA 5LA0A 4XFIA 1V6KA 2A7AA 5FXXA 3TEWA 2WQZC 2XXZA 5CFDA 4YPJA 3ST7A 1FPN1 3ES4A 5J1XA 3ZXFA 1LU1A 1R091 2XLGA 3AJYA 3BPZA 4XF9A 2RM23 4Q8LA 5C70A 1JYTA 2OVUA 1H2LA 4YVWB 2R041 4D6RA 5F3CA 1HRV1 2GC2A 4LLOA 5IVBA 2QQPA 1RIRA 3WNPA 1IKQA 1VBD3 1WW6A 4Q4V1 4N43A 4BE3A 1Q8OA 3J7HA 4KWUA 4UFLA 3MPPG 4Y1UA 4LQRA 5FZ0A 5C4WC 4NHLA 1GOFA 1X82A 2RS51 4P9JA 1LOAA 3T30A 2EAKA 1JHJA 3VL9A 1QNYA 4LHNA 2VNVA 2ZX0A 5FPZA 4O9EA 1HX6A 3MW2A 4M0NA 3ZXGA 2HYXA 3KCYA 4J1WA 4UW5A 4COZA 2C5DA 3USUB 1AR81 4AVAA 2VZRA 2W2IA 4ITCA 4YGCA 2OZJA 3LSEA 2WL1A 4P9LA 5GLUA 3UJOA 2V73A 4J25A 2JE9A 3LKJA 4IEZA 5C4WA 2AUYA 4JGYC 1LEMA 1Y9QA 4Q4X1 4AAPA 4AVSA 4UFJA 4CDQC 5FR3A 1CAUB 4BU2A 3RZHA 4RQPC 1CVNA 2BRTA 5FYTA 1V6JA 3ZFEC 5J37A 2RS11 2ZACA 3BI3A 2WNVB 3KF3A 1AR61 2RDSA 2ZABA 2MHFA 1LR5A 2MNGA 3RRDA 1VE0A 3KD4A 2ILMA 5JVVA 1JYIA 2WA4A 4OI1A 3TEYA 4IEUA 4FTEA 1J83A 1PO22 2HEYF 2C6SA 4LULA 3W58A 3T2OA 2YBPA 4JGYA 5IVFA 2W52A 1LGCA 2XWBB 4ATEA 1RMU2 4CDQA 5FP4A 1DBNA 4NAMA 4RQPA 3ZFEA 2YROA 3HN3A 1HRI3 1DQ4A 1MR5A 4FXGB 1RUG3 3WW1A 1XNCA 1FMD3 5GLWA 1SCRA 3NKGA 4R4ZA 1W04A 4UFMA 3RMXA 1C28A 1VBD1 3NNMA 4JRLA 4NUBA 4R9AA 1W6OB 2Q8OA 4DXSA 1PO12 1OLQA 2Q0AA 2XDVA 3CQOA 4YVSB 5GZDA 1RGSA 3GHNA 3IDEA 5IVCA 2DF7A 2FCTA 2E31A 4AQTA 4YFZA 2ZXQA 3VV1A 1XE7A 5JZGC 1AX0A 5BPXA 1H4GA 3AMPA 4M3CB 1TG7A 1IPKA 3OF1A 4MXWB 2KXLA 4CCKA 2LTNA 4YZ5A 4FAGA 1O3RA 5GZFA 2ZZJA 1YJKA 1LJ7A 1FOD3 4RYDA 1VJ2A 1AF9A 5A32B 1NCQB 4A4AA 4CZSA 4Q0UA 1TVGA 2D3PA 3RPQA 3VBHC 1J3QA 2VUAA 3FN9A 1COV3 3KF5A 3KHBA 3DL3A 4PDWC 3VHNA 5JZGA 2IFRA 4YW4A 5BNOB 3OCPA 4OI4A 3MGUA 5LWBA 2RHPA 3WF1A 3MPBA 2VZVA 5T5JA 3BTZA 2D97A 3ZIWA 1R082 2Y6HA 3ES1A 2VU9A 1WCDJ 4QXKA 2A3XA 1RUI3 2UYBA 3CO2A 4KWKA 1AYM2 1NE6A 2IXIA 1H8TA 4JRAA 2RJ2A 3VBHA 3ZSLA 4JDOA 4PDWA 1HJGA 3GBWA 1OD3A 3FMGA 3N7LA 2VXJA 1HRI1 2V5DA 1IPSA 4LIVA 1GNZA 1O5UA 1DHKB 1AR92 3OUHA 5FYHA 5T52A 2BVBA 4BH9A 2OW4A 3JU9A 2FDKA 1VB4A 2C24A 4QQ2A 4Y4RA 4YZ3A 1PGW1 3N9NA 1N1TA 4I3GA 4UF0B 1OVPA 4ZU4A 2ID4A 1VPHA 1REEA 1ZZ7A 2B7YA 2QQVA 2WUHA 3OY8A 3KMHA 3PU3A 5F3IA 5FZBA 3WP5A 3KQ4B 4BQ4A 2Y6KA 1DG6A 3RZJA 3PVEA 1B35B 4MXVA 2AYHA 2FDFA 5HI0A 5J7MA 3H3ZA 3BKZA 4AQ2A 2HWC3 4DUXA 3VD9A 3GZEA 4ASMB 4YVWC 3WG2A 1SLIA 4I0BA 4GJZA 1D0GA 1LHUA 1TME2 3DYPA 1KFUL 3T0AA 2SBAA 1UCXA 2VNRA 3A21A 4AHWA 4KGQA 4OULA 1AR71 2DTWA 1COV1 1QJU3 1REDA 4YG3A 1QJX1 5FLJA 5IATA 2DVGA 1OURA 1ZYBA 2WQ8A 3O0XA 4QB2A 5D1IA 3N9PA 4K20A 5B4NA 3IBMA 2V72A 1QQP1 4BXFA 5IT6A 1VBE2 2B42B 2E7TA 1MZ5A 2OQ7A 2X5IA 2E51A 2F4PA 1UY0A 3BIWE 4H3WA 1VAVA 5BY5A 5ABJB 2ZEXA 1BVVA 3QH6A 3M3IA 4L9BA 3O12A 3N35A 4B29A 3HNMA 2PHLA 3Q8BA 4JKKA 3BCWA 2WYFA 2Q8CA 3NJXA 2VZQA 1B09A 3AM2A 3ACLA 3B02A 5AC91 3AP6A 1WD3A 2XB6C 5A3NA 2FDJA 3F2ZA 3GF6A 1D0HA 1PIV3 1R1A3 3HIFA 2ZX2A 1RUNA 1SLAA 2YY1A 2OPWA 2JE7A 5FMCA 4OHYA 4OHWA 2QZ3A 4EYUA 3PUSA 1AXKA 1S1AA 1AL23 3AMNA 4CXYA 4YM3A 5BNOC 3NSTA 2YUEA 2E6VA 4Q26A 1F15A 2YG0A 3DKWA 4YFWA 1FAYA 3PUAA 1CAUA 5FPXA 2XJVA 3PDQA 2F6BA 2ZMNA 4J6GA 2EVXA 4PCRA 4R52A 3U0ZA 1L7LA 2CAUA 3M4FA 4BLJA 4EWAA 2D3RA 4IESA 1DZQA 4HN1A 1BKZA 4A45A 5J48A 1LHOA 2CGOA 1OUSA 3IDCB 4MGZE 1ZA7A 4OHXA 5EPAA 1PVXA 3TAYA 3CNAA 3D4KA 4GAZA 1RJ8A 4FQZA 3M2MA 4JTNA 3K46A 1K3IA 2EIDA 2AZ5A 4YVSC 5A6ZA 1VBC2 2GALA 1S0FA 1HQLA 4FOVA 3KCCA 4DUVA 5LA1A 3WV6A 3CDZB 1IQDC 3MFAA 2R063 4IGQA 4URTA 4BB3A 4Y26A 2XJTA 1NX9A 3IIIA 4FTSA 3TN91 1V9U3 1C5HA 4DNYA 4XHBA 5L36A 2WFF3 3AKQA 2V09A 1NCQC 5FXWA 3IAQA 5FDBA 4YVSA 4AHZA 4QT6A 4QGLA 2QFEA 1XNAA 2PHFA 2PQQA 2WABA 5FYVA 4XXAA 4HN0A 4AI8A 3I54A 1D4M2 2W1UA 2FDIA 3RVHA 5D21A 2WWJA 2G4IA 4M3CA 5E1RA 4FQ4A 5F5AA 2RS33 4IEXA 4MXWA 5FYZA 5LBEA 3LE0A 2D6PA 3SQOA 3T1MA 4UI9L 3VZOA 1C8M3 5T5PA 4LO8A 3QACA 1ASJ2 3MICA 5DDJ2 1FX5A 2YYOA 3I2FA 1WMFA 1NCQA 4WBBA 4XUOA 4CCEA 4Y1ZA 2Y26A 3I8TA 1CX1A 2JICA 3I2DA 2HWE2 5JIUA 5J98B 1MZ6A 4LEJA 4AVBA 4P9WA 3HEIA 2NYYA 5BNOA 2O8OA 5DG1A 3GDBA 1UPSA 2D6KA 3J8F3 1SHWB 2XJRA 1QY4A 2VBBA 1UYXA 4GH4B 2HLEA 4G4FA 3T3YA 1GSLA 3B69A 4IE6A 1O7FA 1Q8PA 1SFYA 2WZR3 3KM5A 4LE4A 3WCRA 4ZZ5A 5J36A 4HSJA 4JAAA 4H2AA 4V1PA 3SEPA 1CJDA 2GAUA 1H9PA 3H3LA 1UXZA 3BU7A 4LK6A 4XF1A 4BQWA 1GYKA 1D2SA 2RMU3 3DXTA 4QDRA 3SCHA 4GB33 3UESA 2VXRA 1B35C 1ZBA1 4YZ2A 3OEAA 4QKFA 2LUWA 1VLNA 2C0ZA 3POJA 3EMRA 4B7EA 2BPA2 2ET7A 4V2WA 1PGL1 5FYBA 5J96B 3K4AA 4UF0A 1H2MA 4BOWA 4L99A 2Y34A 2ZHMA 5A3OA 1FNYA 1V00A 2QQMA 2Q4SA 4RGAA 3O1TA 3A4UA 4XTPA 1YLLA 4R9BA 3ACIA 1DGWX 4S2FA 4CUGA 4META 4ZU7A 3C7FA 1AL0G 1XYPA 2R0HA 5HPOA 3WNMA 3IMNA 3L2YA 4JQTA 5FY5A 5ABJC 4QPYA 4GWJA 4CCMA 1DQ0A 3FE5A 4LITA 3WW3A 3LB9A 4BK4A 4OI0A 1O59A 1Y43B 3IAPA 4P14A 1ZNPA 3ZYJB 2J42A 3BTXA 3PJYA 3N9LA 2WA3A 4GJYA 2P1BA 3LIHA 2XPJA 5FZFA 2A73B 1DIWA 2ERFA 1UKGA 3AMHA 5B4XA 3J8F1 1QOSA 1JOJA 3CJIA 5LK5A 4NIHA 5ABJA 2X05A 3ON7A 3ZXAC 3MZHA 5SV8A 4GZ9A 1BXHA 1LOGA 1RUF3 1GNYA 4LO5B 4CEYB 5FZCA 4QQOA 4N7IA 2ENRA 4XMIA 2D3SA 4LXLA 4YGEA 3WP4A 5LASA 4Z8BA 4CXXA 1WBLA 4MGIE 3MDPA 4LBQA 5I0SA 3QOPA 1YIPA 4P9YA 3D0JA 2B46X 3D5OA 1ODNA 4A44A 3DF0A 1W2UA 5CAZA 4S2HA 2C26A 2P37A 3ZOIA 4CP9B 1QJEA 1UPIA 5FBJA 3NMBA 2FMYA 5FXZA 3VL8A 1UX6A 1HV1A 3E6DA 3FUOA 5CG8A 2GDFA 1SLCA 3FZ3A 4KG0A 4GWMA 5FZGA 3D8CA 5A3UA 1YFYA 1EAH3 5JCTA 2AH2A 1JZ7A 4I0AA 2JG9B 5F6LB 1NY71 1CONA 5BNNB 3R4UA 1RUE1 1VMHA 3HT2A 4LTAA 4WVWA 1JUHA 3ZPYA 4BPZA 2K0GA 5ERLA 4DO0A 3WDXA 4EN9B 1S0CA 2P5BA 1CAVB 4PLOA 4E27A 2RG4A 1O4YA 3LA7A 3T2TA 4A3XA 2D44A 2CWMA 3O0WA 4XAAA 1NCRB 1RUD1 4LO6B 1WCSA 4Q4W2 3C8XA 3GNEA 4W6YA 4KQ7A 4AFMA 2IVIB 1JZ8A 2VL4A 1LEDA 3THDA 5H9PA 4XW3A 1K12A 1X9TA 2RDRA 3ACHA 1RUH3 4NVPA 4QX1A 1GMMA 1K5MB 3B5LB 2RR11 4ZPIA 2WRAA 3WR0A 3FHAA 5KWRA 3BGAA 1DGRA 4SBVA 3OJBA 4JCKA 2W0XA 2QZ2A 4BJ0A 1TMF2 4DIQA 3PJQA 4F3JA 1BK0A 4YW7A 1T2XA 2BU9A 2XBO1 1YI9A 2Z5WA 5FTTC 3E97A 5L9RA 3CHXA 2CYFA 4PLMA 3VGIA 1N3OA 3UV9A 3MYXA 4GH4C 4URAA 3FLPA 3ZKYA 1RMU3 1W6NA 2WS93 1YCIA 4IV1B 4PHZA 2JB4A 3AL5A 1ULOA 2FQPA 3KLSA 2QUOA 3NW4A 4LUMA 5C3RA 1LNSA 3TYJA 2R072 3H8UA 2VZSA 2ZEWA 2R1DA 1NYWA 2HEWF 1SFPA 5EV7A 1IS5A 4E2GA 1LU2A 4GH4A 3U78A 3WF0A 1E5IA 4MGTA 1HJFA 1WMDA 4QGNA 4AI1A 2Y8KA 2L9LA 4CCNA 5IVYA 4AE2A 4ZHNA 1SBEA 4CE8A 2BV4A 5JSRA 5KXBA 1QDOA 4QU2A 1FV3A 3BOPA 4PIYA 3I2GA 4XHXA 1O4TA 1RUH1 4K40A 5CKMA 5A6YA 5F3EA 3RFRA 3H50A 4FSJA 4XVHA 2LRPA 3G7DA 4AR2A 2P3KA 1ZBE2 4D8MA 4KGGA 4LE3A 3FBMA 4FFGA 2PAMA 3GJAA 4JQRA 4TLFA 4NHYA 2C1FA 2ZMLA 3ZLIA 2JDAA 4WZCA 2MEV3 3V65A 4P5HA 3BPSA 3IIAA 3ITQA 3UK9A 1R64A 1UF2C 5DAPA 5FAXA 1R083 1Y3TA 2JIJA 4KWJA 1VBA3 4Y33A 2JDPA 1PO21 4XIKA 4AEJA 1DFQA 1PVC3 2BERA 4E2SA 4YG0A 2EF6A 4EZ4A 1RMU1 4QDQA 1UAIA 3LD8A 5FPUA 1YQ6A 5DPNA 4F8AA 5FP3A 4CEYC 1W03A 5CFDB 4ES8A 4LNVA 4L0PA 1V6IA 3J7MA 2AENA 3O1OA 1IZ3A 4HKWA 5JDBA 1JOBA 3OGVA 1LECA 1LESA 1PX3A 2J1VA 5FZMA 4S2GA 1QJZA 3SITA 1PO11 2VCAA 1MEC3 5FZ9A 1OT5A 1OXCA 3WF2A 4WVZA 5CKNA 3W5NA 3ZR6A 5JXGA 3U11A 2GNMA 4RGKA 1LHVA 3I3BA 1L7RA 3SKJE 4PF5A 4CEYA 2DFBA 4N43B 5J09A 1V0AA 1BBT2 4AI9A 3T0DA 2J22A 5JIAA 5A33A 3LPGA 2X10A 4LUKA 1UMHA 4FOYA 5CIRA 3SNMA 1SLTA 3VZLA 5BNNC 5A1AA 2UU8A 1BLZA 2E9QA 1WBFA 4LORA 1WUVA 1W8UA 3WY6A 4P00B 4CXWA 4I0WB 1H0BA 2Y60A 4MG2A 4QQPA 1UY3A 1LOBA 3JBG3 3JD73 3M8LA 4C1XA 4M4RA 1AYN3 1NCRC 2ZGOA 3HNBM 1R081 1NZIA 1RL3A 1RUC3 5C3OA 1CX4A 2ARCA 5BNNA 4G9SB 3RGBA 4KNCA 1PVC1 1AYM1 5IYYA 1K5MC 3LIGA 4OZOA 5LEKA 4XFHA 1MQTB 4XCAA 1BJQA 3B01A 3DXUA 1UL9A 2PQSA 1MVQA 4X6RB 1JH5A 2D6NA 4XQ4A 3AFKA 2G9FA 3CMGA 4CEWB 1NCRA 1IPJA 1SPPB 1AR91 1DGRN 1KQRA 3LF7A 3NNFA 3ALQA 4CPBD 5FO7B 1MPXA 5APAA 5CVRA 5F5IA 1V6LA 4LIUA 5GLVA 3WF4A 3RZLA 1K5MA 4ZU5A 1GQPA 4FPEA 1MEC1 4ARYA 2VNOA 3FHQA 4NN0A 3ZMOA 4LJHA 3E1F1 4DUWA 3NKTA 3WUDA 3Q8EA 3SHRA 3KCXA 4E8CA 4IV1C 1DGLA 2VULA 3EO6A 5EFUA 4AAXA 3UJQA 4RSUA 2HYKA 1LHWA 2PLV2 4Q8KA 1TQ5A 2J7MA 1E5HA 3KGLA 5FLHA 5HCFA 5FY0A 3AMMA 1LHNA 1TME1 3VBUB 1VBB2 4J1XA 3MUY1 3ZXDA 4HVRA 1A3KA 5C9AB 1E5SA 1W99A 2BW8A 3EJKA 3WF3A 5JR2A 4K3UA 4IV1A 4A6OA 4MYEA 1JI6A 3CEWA 1VBE1 1FPN3 1UZVA 1AYN1 3VKLA 4RFRB 1R093 1YIFA 2YPDA 1LRHA 1JBCA 3HQRA 3A0NA 3OBZA 1SZBA 1V70A 2PAKA 3DN7A 4BQ5A 5F5QA 3A23A 1XSRA 2V4AA 2XVKA 1HRV3 4PT6A 3RWNA 4AYUA 1YO8A 2W1WA 4JDNA 1RVF2 2ZMKA 4MGYE 4LBNA 4A7KA 2X8KA 3S6PA 4BMEA 3I7DA 1JXNA 1H8TB 1L7QA 3BODA 3OOXA 2ARXA 1RJ7A 2EXJA 1D4M3 1HXS2 2VQTA 4PDWB 3ZM8A 4AEKA 2HWB2 3MUZ1 4COWA 1TZOA 2RS53 2W92A 1F5FA 2VTFA 4AOCA 1E5RA 5C3QA 5FZ4A 1PM4A 2VW2A 3ACFA 1ASJ3 2ZJCA 2A6WA 2N7GA 1JOPA 1HB2A 5JUVA 4QX7A 1P8JA 3WQ7A 2ORZA 4AI2A 3WDUA 1J58A 1SBDA 2HWE3 5AFBA 4CU8A 2W46A 3KV5A 5FZEA 3ZN6B 2FHRA 2HWF2 5GM0A 2QE3A 3D82A 3SC7X 5CFDC 4Q4X3 3PL0A 4D0QA 1NA1B 3SMHA 3ZMNA 4JKMA 3TBDA 1Q8SA 4XJWA 4YRDA 2H0VA 2P3JA 4A7ZA 2RS13 4YM0A 1AR63 4EN0A 2P6CA 3GCWA 4S2DA 4WVMB 1GZCA 4B3NA 1VBC1 4N43C 4A2UA 3WNOA 1Y4WA 4HPKA 5LCWL 1UYPA 4IEVA 2VMHA 3JQWA 3OGGA 2R30A 1T6BX 1LODA 5SV5A 1N47A 1WLWA 3J9SA 3KVAA 2RDNA 1RHI2 5FPAA 5BV6A 1IG3A 2X5IB 1F9KA 4FFIA 2VMDA 1WCUA
chains in the Genus database with same CATH topology
2V72A 4A42A 1UY0A 2WYSA 2ZEXA 2ORXA 3HOBA 2J1AA 3NRUA 1K42A 1W8NA 2VQUA 5EJ1B 3HNMA 5G04L 4JKKA 3NQHA 2W5FA 5I0DA 3VD4A 3NJXA 2VZQA 2CDOA 3I2IA 2YC4A 1PMJX 3GXUA 2VO5A 1GU3A 1GOHA 3F2ZA 3WQBA 3PUHA 1HN1A 3LEGA 1JZ6A 1JYNA 2EIEA 3D3AA 3VDAA 1W9TA 3IDAA 4QX0A 3T09A 4CVUA 2RV9A 2WBKA 2YG0A 1CIYA 3GM8A 3JXSA 2C4XA 3HPNA 4A45A 4BXSV 4ZY9A 1UXXX 1NKGA 2QQKA 5IJRA 2XONA 3K46A 1K3IA 2EIDA 2J1EA 2VMFA 4DUVA 5EIYB 5LA1A 3CDZB 1IQDC 4P5YA 2VJXA 4OMCA 1UWWA 1NX9A 5IHRA 2DCJA 3K75B 3IIIA 3FL7A 3I2JA 2Y64A 2DCKA 3IAQA 2LS6A 2Y6JA 3EYPA 3ABZA 3A22A 1XNAA 4XUPA 3VD7A 2WABA 3T2QA 2W1UA 1JZ2A 3OGRA 3NNGA 1CZTA 1DYOA 4E8DA 3LE0A 4UI9L 2BZDA 3P1IA 1JZ4A 3W5MA 4TXWA 3CZJA 2JE8A 1CZSA 3I2FA 4XUOA 4XZUG 1CX1A 2E33A 2VR4A 2VMEA 1W0NA 1BHGA 2WO1A 2BGPA 3HEIA 3I3EA 3GDBA 4QPWA 5EJZB 4BK5A 1SHWB 2B4KA 1DP0A 3T0BA 1UYXA 3WNNA 2HLEA 5F7UA 3MO4A 4CU9A 2WZ8A 4ZZ5A 4ZZ8A 4OYUA 3SEPA 1KEXA 1UXZA 4QDRA 1JU3A 3UESA 5HXMA 2BGOA 3OEAA 5JXHA 2VZ1A 2X09A 1PX4A 1OF3A 3K4AA 4DXRA 4CU7A 4CUCA 3ECQA 1JZ5A 4DEQA 4AG4A 2W1QA 2QQMA 1I5PA 4JHZA 3HJRA 3ACIA 3C7FA 4QX2A 3IB3A 5HPOA 3WNMA 1UZ0A 2C9KA 4GWJA 2VZTA 1JYWA 4BK4A 1O59A 3IAPA 3OGSA 1ULPA 3CZUA 4P08A 2Y6LA 2J1UA 5B4XA 3T08A 2VCCA 3C7HA 2J1RA 2X05A 1NAEA 1UX7A 2QQOA 4GZ9A 1GNYA 4LKSA 5C71A 1NUKA 5DMYA 2Y6GA 2VZPA 1UY4A 2VCBA 3CIHA 2WN2A 4Z2AA 4RN5A 3MV01 5C7GA 1UYZA 1XPWA 3HNYM 4MGQA 4A44A 2QQJA 5IFTA 2JD9A 3I3DA 1WKYA 2C26A 2V4VA 4P02B 4DEVA 3AC0A 2DDUA 3VD3A 3WNKA 2WN3A 2W95A 1JZ7A 1O8PA 2J1SA 1SDDB 4UAPA 2R7EB 3OBAA 3ACGA 1EUUA 4M4PA 2QBXA 1D7PM 3MBWA 5LA2A 2WAAA 3K77A 1UMIA 2OKXA 3K4DA 1JZ8A 3C8XA 1OH4A 2VM9A 4DXTA 2VL4A 3THDA 1K12A 4QX1A 3ACHA 3U37A 1GMMA 4CUBA 2W87A 2RVAA 3P6BA 2WDBA 4PF1A 4W50A 1WCQA 3FHAA 3BGAA 3OEBA 4CUAA 4ET7A 2XOMA 4HG6B 3A7QA 1H6YA 2LW8A 1EUTA 4BJ0A 2ZEYA 2WO2A 4BDVB 1T2XA 2W91A 1H6XA 5CZKA 2YFZA 4XUNA 1US3A 3OB8A 1UY1A 4QB1A 5DQ0A 3THCA 3K4ZA 3VDCA 3MV11 1ULOA 3UNPA 3LEIA 1DLCA 1LNSA 2VZSA 2ZEWA 1JU4A 3WF0A 3VDBA 2W47A 3PUIA 1J84A 4GWIA 4KI5M 2Y8KA 2L9LA 3T2PA 3I2KA 3DYMA 3ETPA 1KGYA 2W94A 1O8SA 4ZXEA 4MADA 4OUEA 1F4AA 3I2GA 4W4ZA 4QB6A 4XVHA 2VZOA 5FUIA 1GUIA 4D8MA 1XC6A 2XQXA 2CDPA 2YB7A 2QQNA 2XHNA 3EB7A 2JDAA 1JZ3A 3I2HA 4XUTA 1R64A 1PMHX 3CKHA 1SG3A 3C7OA 3LPFA 2BERA 3C7EA 3GGLA 3WEZA 5DN2A 1YQ2A 4XURA 4QDQA 3SEEA 5DPNA 4QX3A 5LA0A 4L0PA 4CU6A 1W9WA 2BBAA 3OG2A 4JX0A 1UY2A 4UOJA 4TTGA 3OGVA 2J1VA 1PX3A 3BN6A 4YPJA 5JXIA 5J1XA 2VCAA 3WF2A 1OT5A 3W5NA 5JXGA 5C70A 1UYYA 3I3BA 1L7RA 3SKJE 3WNPA 2J22A 3T0DA 1W8OA 3LPGA 2X10A 2VZ3A 3J7HA 4KWUA 4LQRA 1OF4A 5G05L 4A3ZA 1UMHA 1GOFA 2VOTA 5A1AA 1JHJA 1W9SA 4FI9A 4QAWA 4P00B 2HYXA 4JKLA 1UY3A 2VZRA 2WZEA 4M4RA 3HNBM 1CZVA 3VD5A 5IYYA 4OZOA 2EIBA 3WNLA 2PQSA 1K45A 3CMGA 1J83A 1GOGA 4MOAA 3T2OA 1MPXA 3WF4A 3LQCA 1GQPA 4ARYA 4ARXA 3FHQA 3HN3A 3DYOA 2WO3A 3DECA 5IFPA 3E1F1 4MGSA 4OMDA 4DUWA 2B9VA 4KMQA 2QQLA 4E8CA 2JKXA 5JXJA 4DXSA 4AAXA 4QDSA 2VMCA 3CQOA 2J7MA 2E31A 2ZXQA 3UETA 3MUY1 2YC2A 1TG7A 2E26A 1W99A 3WF3A 5JR2A 4A6OA 3C7GA 1JI6A 4LHSA 4RYDA 5JMOA 4A4AA 2J1TA 1TVGA 2W1SA 3FN9A 3A23A 4PT6A 4LPLA 1JYXA 2W1WA 2W9XA 3WF1A 4A41A 2E32A 2VZVA 2QQIA 1L7QA 2Y6HA 3ZM8A 2VQTA 3MUZ1 4XUQA 2W92A 4IUGA 2VTFA 2RJ2A 3LEKA 3ACFA 1OD3A 4PQQA 2YFUA 2V5DA 3SKVA 3WSOA 5JUVA 1P8JA 1US2A 1F4HA 2ORZA 4CU8A 2VZUA 2W46A 2WAOA 2EICA 3NJVA 2ZEZA 2ID4A 2WUHA 4D0QA 4JKMA 2Y6KA 2W3JA 2Z4FA 3I97A 4W8JA 4MO3M 1JYVA 3VD9A 4DUXA 1RYYA 5CYYA 3WNOA 5LCWL 1XNTA 3DYPA 3T0AA 2VC9A 3A21A 2KD7A 2WQ8A 4QB2A 5B4NA 2VMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V72 A;  4A42 A;  1UY0 A;  2WYS A;  2ZEX A;  2ORX A;  3HOB A;  2J1A A;  3NRU A;  1K42 A;  1W8N A;  2VQU A;  5EJ1 B;  3HNM A;  5G04 L;  4JKK A;  3NQH A;  2W5F A;  5I0D A;  3VD4 A;  3NJX A;  2VZQ A;  2CDO A;  3I2I A;  2YC4 A;  1PMJ X;  3GXU A;  2VO5 A;  1GU3 A;  1GOH A;  3F2Z A;  3WQB A;  3PUH A;  1HN1 A;  3LEG A;  1JZ6 A;  1JYN A;  2EIE A;  3D3A A;  3VDA A;  1W9T A;  3IDA A;  4QX0 A;  3T09 A;  4CVU A;  2RV9 A;  2WBK A;  2YG0 A;  1CIY A;  3GM8 A;  3JXS A;  2C4X A;  3HPN A;  4A45 A;  4BXS V;  4ZY9 A;  1UXX X;  1NKG A;  2QQK A;  5IJR A;  2XON A;  3K46 A;  1K3I A;  2EID A;  2J1E A;  2VMF A;  4DUV A;  5EIY B;  5LA1 A;  3CDZ B;  1IQD C;  4P5Y A;  2VJX A;  4OMC A;  1UWW A;  1NX9 A;  5IHR A;  2DCJ A;  3K75 B;  3III A;  3FL7 A;  3I2J A;  2Y64 A;  2DCK A;  3IAQ A;  2LS6 A;  2Y6J A;  3EYP A;  3ABZ A;  3A22 A;  1XNA A;  4XUP A;  3VD7 A;  2WAB A;  3T2Q A;  2W1U A;  1JZ2 A;  3OGR A;  3NNG A;  1CZT A;  1DYO A;  4E8D A;  3LE0 A;  4UI9 L;  2BZD A;  3P1I A;  1JZ4 A;  3W5M A;  4TXW A;  3CZJ A;  2JE8 A;  1CZS A;  3I2F A;  4XUO A;  4XZU G;  1CX1 A;  2E33 A;  2VR4 A;  2VME A;  1W0N A;  1BHG A;  2WO1 A;  2BGP A;  3HEI A;  3I3E A;  3GDB A;  4QPW A;  5EJZ B;  4BK5 A;  1SHW B;  2B4K A;  1DP0 A;  3T0B A;  1UYX A;  3WNN A;  2HLE A;  5F7U A;  3MO4 A;  4CU9 A;  2WZ8 A;  4ZZ5 A;  4ZZ8 A;  4OYU A;  3SEP A;  1KEX A;  1UXZ A;  4QDR A;  1JU3 A;  3UES A;  5HXM A;  2BGO A;  3OEA A;  5JXH A;  2VZ1 A;  2X09 A;  1PX4 A;  1OF3 A;  3K4A A;  4DXR A;  4CU7 A;  4CUC A;  3ECQ A;  1JZ5 A;  4DEQ A;  4AG4 A;  2W1Q A;  2QQM A;  1I5P A;  4JHZ A;  3HJR A;  3ACI A;  3C7F A;  4QX2 A;  3IB3 A;  5HPO A;  3WNM A;  1UZ0 A;  2C9K A;  4GWJ A;  2VZT A;  1JYW A;  4BK4 A;  1O59 A;  3IAP A;  3OGS A;  1ULP A;  3CZU A;  4P08 A;  2Y6L A;  2J1U A;  5B4X A;  3T08 A;  2VCC A;  3C7H A;  2J1R A;  2X05 A;  1NAE A;  1UX7 A;  2QQO A;  4GZ9 A;  1GNY A;  4LKS A;  5C71 A;  1NUK A;  5DMY A;  2Y6G A;  2VZP A;  1UY4 A;  2VCB A;  3CIH A;  2WN2 A;  4Z2A A;  4RN5 A;  3MV0 1;  5C7G A;  1UYZ A;  1XPW A;  3HNY M;  4MGQ A;  4A44 A;  2QQJ A;  5IFT A;  2JD9 A;  3I3D A;  1WKY A;  2C26 A;  2V4V A;  4P02 B;  4DEV A;  3AC0 A;  2DDU A;  3VD3 A;  3WNK A;  2WN3 A;  2W95 A;  1JZ7 A;  1O8P A;  2J1S A;  1SDD B;  4UAP A;  2R7E B;  3OBA A;  3ACG A;  1EUU A;  4M4P A;  2QBX A;  1D7P M;  3MBW A;  5LA2 A;  2WAA A;  3K77 A;  1UMI A;  2OKX A;  3K4D A;  1JZ8 A;  3C8X A;  1OH4 A;  2VM9 A;  4DXT A;  2VL4 A;  3THD A;  1K12 A;  4QX1 A;  3ACH A;  3U37 A;  1GMM A;  4CUB A;  2W87 A;  2RVA A;  3P6B A;  2WDB A;  4PF1 A;  4W50 A;  1WCQ A;  3FHA A;  3BGA A;  3OEB A;  4CUA A;  4ET7 A;  2XOM A;  4HG6 B;  3A7Q A;  1H6Y A;  2LW8 A;  1EUT A;  4BJ0 A;  2ZEY A;  2WO2 A;  4BDV B;  1T2X A;  2W91 A;  1H6X A;  5CZK A;  2YFZ A;  4XUN A;  1US3 A;  3OB8 A;  1UY1 A;  4QB1 A;  5DQ0 A;  3THC A;  3K4Z A;  3VDC A;  3MV1 1;  1ULO A;  3UNP A;  3LEI A;  1DLC A;  1LNS A;  2VZS A;  2ZEW A;  1JU4 A;  3WF0 A;  3VDB A;  2W47 A;  3PUI A;  1J84 A;  4GWI A;  4KI5 M;  2Y8K A;  2L9L A;  3T2P A;  3I2K A;  3DYM A;  3ETP A;  1KGY A;  2W94 A;  1O8S A;  4ZXE A;  4MAD A;  4OUE A;  1F4A A;  3I2G A;  4W4Z A;  4QB6 A;  4XVH A;  2VZO A;  5FUI A;  1GUI A;  4D8M A;  1XC6 A;  2XQX A;  2CDP A;  2YB7 A;  2QQN A;  2XHN A;  3EB7 A;  2JDA A;  1JZ3 A;  3I2H A;  4XUT A;  1R64 A;  1PMH X;  3CKH A;  1SG3 A;  3C7O A;  3LPF A;  2BER A;  3C7E A;  3GGL A;  3WEZ A;  5DN2 A;  1YQ2 A;  4XUR A;  4QDQ A;  3SEE A;  5DPN A;  4QX3 A;  5LA0 A;  4L0P A;  4CU6 A;  1W9W A;  2BBA A;  3OG2 A;  4JX0 A;  1UY2 A;  4UOJ A;  4TTG A;  3OGV A;  2J1V A;  1PX3 A;  3BN6 A;  4YPJ A;  5JXI A;  5J1X A;  2VCA A;  3WF2 A;  1OT5 A;  3W5N A;  5JXG A;  5C70 A;  1UYY A;  3I3B A;  1L7R A;  3SKJ E;  3WNP A;  2J22 A;  3T0D A;  1W8O A;  3LPG A;  2X10 A;  2VZ3 A;  3J7H A;  4KWU A;  4LQR A;  1OF4 A;  5G05 L;  4A3Z A;  1UMH A;  1GOF A;  2VOT A;  5A1A A;  1JHJ A;  1W9S A;  4FI9 A;  4QAW A;  4P00 B;  2HYX A;  4JKL A;  1UY3 A;  2VZR A;  2WZE A;  4M4R A;  3HNB M;  1CZV A;  3VD5 A;  5IYY A;  4OZO A;  2EIB A;  3WNL A;  2PQS A;  1K45 A;  3CMG A;  1J83 A;  1GOG A;  4MOA A;  3T2O A;  1MPX A;  3WF4 A;  3LQC A;  1GQP A;  4ARY A;  4ARX A;  3FHQ A;  3HN3 A;  3DYO A;  2WO3 A;  3DEC A;  5IFP A;  3E1F 1;  4MGS A;  4OMD A;  4DUW A;  2B9V A;  4KMQ A;  2QQL A;  4E8C A;  2JKX A;  5JXJ A;  4DXS A;  4AAX A;  4QDS A;  2VMC A;  3CQO A;  2J7M A;  2E31 A;  2ZXQ A;  3UET A;  3MUY 1;  2YC2 A;  1TG7 A;  2E26 A;  1W99 A;  3WF3 A;  5JR2 A;  4A6O A;  3C7G A;  1JI6 A;  4LHS A;  4RYD A;  5JMO A;  4A4A A;  2J1T A;  1TVG A;  2W1S A;  3FN9 A;  3A23 A;  4PT6 A;  4LPL A;  1JYX A;  2W1W A;  2W9X A;  3WF1 A;  4A41 A;  2E32 A;  2VZV A;  2QQI A;  1L7Q A;  2Y6H A;  3ZM8 A;  2VQT A;  3MUZ 1;  4XUQ A;  2W92 A;  4IUG A;  2VTF A;  2RJ2 A;  3LEK A;  3ACF A;  1OD3 A;  4PQQ A;  2YFU A;  2V5D A;  3SKV A;  3WSO A;  5JUV A;  1P8J A;  1US2 A;  1F4H A;  2ORZ A;  4CU8 A;  2VZU A;  2W46 A;  2WAO A;  2EIC A;  3NJV A;  2ZEZ A;  2ID4 A;  2WUH A;  4D0Q A;  4JKM A;  2Y6K A;  2W3J A;  2Z4F A;  3I97 A;  4W8J A;  4MO3 M;  1JYV A;  3VD9 A;  4DUX A;  1RYY A;  5CYY A;  3WNO A;  5LCW L;  1XNT A;  3DYP A;  3T0A A;  2VC9 A;  3A21 A;  2KD7 A;  2WQ8 A;  4QB2 A;  5B4N A;  2VMD A; 
#chains in the Genus database with same CATH topology
 2H0B A;  4HKO A;  2W68 A;  3H8R A;  4KH9 A;  1A8D A;  1RUJ 2;  4MHR A;  1W6Q B;  1ZZB A;  5FQ0 B;  4GA9 A;  2XH6 A;  4K1Z A;  3H1M A;  1D4M 1;  1XB9 A;  3NRU A;  4NID A;  3VBF B;  3D6E A;  3SXW A;  2R6Q A;  5A3M A;  5FY8 A;  2B5H A;  1VRH 2;  2W5F A;  2JDK A;  2YC4 A;  1PMJ X;  1ASJ 1;  4XJ9 A;  2VO5 A;  5DDJ 1;  4E4Z A;  3WQB A;  5A7W A;  3IDB B;  2VVD A;  1OLM A;  4WM7 B;  4HET A;  2Z69 A;  2HWE 1;  2VG9 A;  2HWD 2;  1MQT C;  5DAX A;  4YW5 A;  3WZ1 A;  4IV3 B;  5GZE A;  5D2A A;  4CCO A;  2EIE A;  5LRS A;  2CWS A;  1S0E A;  3D3A A;  3VDA A;  2IXK A;  1W9T A;  5DUV A;  5J3U A;  2IVJ A;  4QX0 A;  3I59 A;  5BNP C;  1UOJ A;  4CEW C;  5CG9 A;  2CTV A;  3HR9 A;  1VRB A;  3MI8 A;  4QXH A;  2Y0I A;  1MS4 A;  1QWR A;  1S0I A;  1S2B A;  1IS4 A;  3PUQ A;  4EWE A;  1WMX A;  4DFS A;  4GD4 A;  1MQT A;  4O65 A;  5FLI A;  4A6S A;  3LDB A;  3HPN A;  5FYS A;  4FBF A;  5EHD A;  2FZ1 A;  1UIJ A;  3VB9 A;  2PTM A;  4CEW A;  5BNP A;  1SPP A;  2JD4 A;  4XC9 A;  1UXX X;  1NKG A;  2QQK A;  1XE8 A;  2XON A;  3ZSJ A;  5L19 A;  5FY4 A;  2E7A A;  4YG6 A;  4CDX B;  3N7K A;  4HBN A;  1N3P A;  2YMZ A;  2ZGK A;  2E7Q A;  3JZV A;  2VMF A;  5FY9 A;  1KS5 A;  1VMJ A;  3B3Q E;  5ANQ A;  3VBU C;  4EJR A;  1ONA A;  3ZFG A;  2ZA9 A;  4XAB A;  3RMY A;  4FPL A;  1UWW A;  2P34 A;  4LBM A;  4Q29 A;  5C9A C;  4YZ4 A;  1N1Y A;  4NO4 A;  3MLJ A;  5IHR A;  3FL7 A;  4BA6 A;  3S5Q A;  1Z0H A;  2Y64 A;  5T3N A;  4UW6 A;  3KV9 A;  4YLZ A;  3S7I A;  2DCK A;  1W8F A;  4COV A;  1JOD A;  5LW9 A;  3S57 A;  4CTE A;  1UW8 A;  4XAE A;  3T2Q A;  5FZO B;  3LOI A;  5A6X A;  3VBU A;  3OGR A;  1JZ2 A;  1A8M A;  2JJ6 A;  1DYO A;  1YQ8 A;  3ROU A;  4IDZ A;  1EPZ A;  1UOB A;  3I49 A;  2D5F A;  5C9A A;  5FUN A;  3H9A A;  3P1I A;  2VAU A;  5BNQ A;  4C0B A;  1H8T C;  5FRE A;  3CZJ A;  3W9A A;  1AR7 3;  1VAM A;  5LBF A;  5JMC A;  1CD3 G;  1QJX 3;  1YFX A;  3O5S A;  5DG2 A;  2ZCW A;  5EYY A;  2P6H A;  2ADE A;  2E33 A;  1QQP 3;  3LSD A;  4JGZ B;  3B9I A;  4D7S A;  3ENR A;  5LBC A;  2PA7 A;  1EP0 A;  2VNG A;  4I09 A;  4LO7 A;  3WCS A;  5EJZ B;  1Z7S 2;  1DP0 A;  2NMO A;  4FFF A;  4FAH A;  2Q8E A;  3FJS A;  1OQE A;  2DVD A;  5AC9 3;  5JR7 B;  4C8D A;  5JPN B;  3OUJ A;  2WZ8 A;  4Y1Y A;  4B8E A;  1H8V A;  1NA1 C;  3FLT A;  1OFN A;  3PTR B;  1F35 A;  1EY2 A;  1LOE A;  3WUC A;  2PMW B;  4FPF A;  1BMV 2;  3PNA A;  1HB4 A;  5JXH A;  3K2O A;  4LBJ A;  2OZ6 A;  3J4U H;  3PIJ A;  2X09 A;  2FCU A;  1KD7 A;  4QMA A;  2R07 3;  4IQP A;  3B9C A;  3ZN6 A;  1WME A;  2RE9 A;  1O3Q A;  4HXC A;  4DEQ A;  2W1Q A;  1NA1 A;  4XF4 A;  1U12 A;  5H9S A;  3VBO B;  1I5P A;  4LKD A;  1ST8 A;  2A3W A;  2VUD A;  2X5I C;  4N8M A;  1V6M A;  2O0O A;  3HN1 A;  4HAN A;  4IXL A;  4WVM A;  5FK8 A;  4FPY A;  1DYP A;  3KV4 A;  4NIG A;  1WW7 A;  4RD7 A;  5F9T A;  2C9K A;  3HQX A;  4Q4W 1;  2G19 A;  3AYE A;  2VZT A;  3VZJ A;  3POS A;  4OFG A;  4PBO A;  4C90 A;  2IWG B;  3VBF C;  4YSF A;  4OQ9 A;  4F83 A;  1XE0 A;  2ET1 A;  3LEM A;  2P3Y A;  3CJI B;  3CZU A;  3EQE A;  5L7O A;  2UWB A;  1V6N A;  5EQU A;  4EE2 A;  4BIF A;  5IVV A;  3T08 A;  2I45 A;  3K51 A;  4I30 A;  2ZX3 A;  3TN9 3;  4WM7 C;  1MS8 A;  1TMF 1;  1W6Q A;  2J1R A;  4JC1 A;  5FPB A;  5FQ0 A;  3FUQ A;  4GKX A;  4L8Q A;  4QX5 A;  3MIG A;  4IV3 C;  4G3Y C;  1UX7 A;  3VBF A;  1VAK A;  4LKS A;  4YW3 A;  2JB8 A;  1VMF A;  5C71 A;  4LBQ B;  4NRQ A;  2ZGT A;  2VZP A;  1UY4 A;  3DV8 A;  1KS4 A;  2VH9 A;  4XBN A;  2YBS A;  3OTF A;  2HJI A;  5HV0 A;  4EQV A;  4QM9 A;  4BZ4 A;  1GP6 A;  4D94 A;  4WM7 A;  2WN2 A;  1PNF A;  2HEV F;  3MF9 A;  3QLQ A;  4HOO A;  4RN5 A;  3RZZ A;  4Z2A A;  5C7G A;  1RXG A;  1UYZ A;  4IV3 A;  2R07 1;  2R16 A;  4MGQ A;  3H3U A;  5FMO S;  2WNU A;  4EN7 B;  2QQJ A;  5IFT A;  3I3D A;  2D93 A;  3BIE A;  4WVV A;  2VEC A;  4P02 B;  4DEV A;  4M01 A;  3USS A;  3H1W A;  1Q8V A;  2IXJ A;  4EN6 B;  1ZA4 A;  4CDX C;  3NJY A;  3PVB B;  2B45 X;  3VD3 A;  5BUV A;  1ULG A;  4Y20 B;  3LOB A;  4AHX A;  5FO8 B;  3S0M A;  1BBT 3;  5CB7 A;  3H0O A;  4AFB A;  2J1S A;  2WT1 A;  1SLL A;  2NLR A;  4UAP A;  2R7E B;  1HQW A;  3OBA A;  2WWU A;  4YGB A;  5EP9 A;  1F31 A;  1EUU A;  3WP3 A;  5LA2 A;  3EXU A;  2ARE A;  5A1L A;  1YWK A;  4NWW A;  4XFC A;  5FWJ A;  2DVB A;  1ZBE 1;  2BNO A;  5K0U B;  4HZF A;  1G9F A;  1BEV 3;  5F2W A;  2B9U A;  4CDX A;  1ZBA 3;  2NQY A;  2QDN A;  1ZRC A;  2WT2 A;  4QX8 A;  1OKO A;  3ZSM A;  5FZL A;  2VM9 A;  4DXT A;  2R1B A;  2OX0 A;  1MS5 A;  2BQP A;  4DXZ A;  1NZC A;  5LAT A;  3SH3 A;  3KT7 A;  4Q4Y 2;  1G86 A;  3E6C C;  4IL7 A;  4YGD A;  3LZZ A;  5IWF A;  4FVV A;  4CUA A;  4HFS A;  4CSW A;  5FCC A;  1MAC A;  4C0H A;  4HG6 B;  1C1L A;  1OVS A;  1EUT A;  2HBT A;  3RYK A;  3SCG A;  4KU7 A;  2ZEY A;  5FZO A;  3THT A;  3I2O A;  4LHL A;  4JGZ C;  1HKD A;  4K7J A;  3GJB A;  2DBN A;  4CCC A;  4QKN A;  3AZV A;  1W6N B;  4W6X A;  1H2N A;  3ILR A;  2VD7 A;  3POB A;  4PIX A;  3WG3 A;  1A78 A;  1D2Q A;  1UY1 A;  2D6L X;  2R04 2;  3UKV A;  1NG0 A;  3AKP A;  3K4Z A;  4M3C E;  3VDC A;  1SLB A;  3OGJ A;  5A3L A;  5C3S A;  3QD6 A;  3BUC A;  1YJL A;  3LFM A;  3E6B A;  2YV8 A;  4JGZ A;  3LEI A;  3N36 A;  4LK7 A;  4AVT A;  5FYU A;  4E4H A;  1O3S A;  2IFW A;  4B4P A;  1BBT 1;  4IE5 A;  5A7O A;  4XE9 A;  2VTX J;  4XET A;  2NPI A;  1URX A;  4XDO A;  1CIW A;  2Z79 A;  3AB0 A;  3WW2 A;  4D6Q A;  2AR6 A;  1PK6 B;  3GCX A;  4HT1 T;  3JCI A;  4XJU A;  4OVE A;  1CJP A;  1BEV 1;  1KGY A;  1VBB 3;  2W94 A;  3M7A A;  3U14 A;  4CDU B;  4MX3 A;  3JB4 C;  3VBO C;  4ZXE A;  5KC5 A;  4Z82 A;  4K8F A;  4W4Z A;  5FWE A;  1S0J A;  1XQN A;  1DQ6 A;  1DGW A;  4NMI A;  4BYY A;  1GUI A;  1QXJ A;  3APB A;  3WHT A;  1XC6 A;  1CN1 A;  3CLP A;  1SBF A;  5TSW A;  3KHC A;  2JXA A;  1GFF 2;  4PQ9 A;  4FPK A;  5FXV A;  5FZI A;  2CGP A;  1JZ3 A;  2G1M A;  2QVS B;  3WHU A;  3VBO A;  2DVA A;  5A7N A;  1MS1 A;  1PMH X;  3CJI C;  1RUE 3;  4QQL A;  2DU1 A;  4QPI B;  2VE1 A;  3C7O A;  3LPF A;  3X29 B;  3N9M A;  4B7K A;  3OBR A;  1SFN A;  5KHI A;  1XNK A;  1XBF A;  2RM2 2;  2XKO A;  3C7E A;  3GGL A;  2O8Q A;  3AP4 A;  3P3N A;  5I8T A;  2OS2 A;  1DCS A;  3J7L A;  4DY5 A;  1YQ2 A;  3DKQ A;  1RUD 3;  2XL7 A;  3KQR A;  2DV9 A;  3SEE A;  1LGB A;  4AXO A;  4Q0S A;  3GZU C;  1AX1 A;  1YFW A;  4QHO A;  2JEM A;  4QX3 A;  3FHI B;  3RI9 A;  4CU6 A;  1W9W A;  1S2E A;  1UY2 A;  4B4R A;  2BFU S;  2RR1 3;  4UOJ A;  4TTG A;  2R49 A;  3NVC A;  3BB6 A;  3K48 A;  3BN6 A;  2MPF A;  1W05 A;  3KVB A;  1TE1 B;  2BNN A;  1OPM A;  3B7M A;  5FK7 A;  2PLV 1;  4XOG A;  2ZPX A;  5AFE A;  5JSP A;  3N7J A;  5A33 B;  4LBL A;  2ZKN A;  5C6C A;  4TLG A;  5AVP A;  2XHK A;  4ZON A;  1VBB 1;  1JN2 P;  4MGK E;  4RR3 A;  1KIT A;  2XBO 3;  3FC0 A;  2PEL A;  4H7M A;  2VZ3 A;  3ZFF B;  3H1Y A;  2QCS B;  2CL2 A;  3VLB B;  4EN8 B;  3DUI A;  4DZG A;  4XF3 A;  3VHR A;  5CU1 A;  3I3M A;  5F2S A;  2RJL A;  1W9S A;  5LRR A;  2VBD A;  2XWJ B;  4QXC A;  5T5O A;  1O3T A;  4Q0Q A;  4ISR A;  4NOT A;  4DB5 A;  4JKL A;  4NAO A;  3VN4 A;  2VMI A;  3W21 A;  4RA0 A;  1RVF 1;  1O91 A;  2WZE A;  4Y5S A;  5DZE A;  3RG0 A;  3VZN A;  3I4I A;  1WA4 A;  5K0U C;  4K9S A;  2Z2S B;  3NNL A;  4Y20 A;  5A3T A;  1HXS 1;  3S30 A;  2HWB 1;  1N1S A;  5I93 A;  1CAX B;  1J3P A;  4QGM A;  5EXO A;  3FFQ A;  1RUG 2;  4FXK B;  3RYR A;  3WNL A;  1J1T A;  1FMD 2;  1Q56 A;  4IET A;  4EWD A;  5F32 A;  3VUO A;  4W65 A;  1G8W A;  1W90 A;  3WDW A;  4HMZ A;  1WCK A;  5M0T A;  1GAN A;  1U5X A;  2YC0 A;  1IKP A;  5K0U A;  4XYX A;  5FOB B;  4YM2 A;  3ZIX A;  1H2K A;  1TNF A;  2BEO A;  4XJ8 A;  4Y22 B;  3JUU A;  2O1Q A;  1U5Z A;  4FP2 A;  2HWF 1;  3IPV A;  3LQC A;  4ARX A;  3ORJ A;  2WLP A;  1W9F A;  3ZDV A;  2WO3 A;  3GBG A;  5IFP A;  4MGS A;  3V64 A;  4NE9 A;  1FOD 2;  2B9V A;  3L9J T;  4NRO A;  4KMQ A;  4AFD A;  1RUO A;  5JXJ A;  1G9D A;  2IXL A;  3NJZ A;  1PO2 3;  2VMC A;  4QDS A;  4YAR A;  1COV 2;  1YHF A;  4TWT A;  2DUO A;  1LB2 A;  1O4Z A;  3AYC A;  2CHH A;  4LKF A;  2CSG A;  4LA2 A;  2PHX A;  1RHI 1;  2YC2 A;  5T54 A;  3O1V A;  3BYW A;  1JHN A;  4RGG A;  4CCJ A;  2NN8 A;  5GAL A;  3HVD A;  1PK6 C;  3HT1 A;  3MEP A;  5KHK A;  4H55 A;  1RUI 2;  4LHS A;  3AMQ A;  1OMI A;  3OSD A;  3TEZ A;  4PBP A;  1RUJ 1;  4CDU C;  1PO1 3;  1Q5O A;  3M3E A;  3WDY A;  2NM1 A;  2EAA A;  4JDM A;  1YQ5 A;  2AC1 A;  5JOW A;  3MHZ A;  1VRH 1;  5E88 A;  3MIH A;  5FYY A;  4LPL A;  2W9X A;  2YU2 A;  1UZY A;  5IK5 A;  1PK6 A;  2E32 A;  4K6B A;  5FZ7 A;  5FJK A;  5IK4 A;  2WII B;  1QHD A;  4CDU A;  1BYH A;  2DUP A;  3UKN A;  4UT5 A;  3C2U A;  3ZXJ A;  4M0H A;  1KDK A;  4TSV A;  2HWD 1;  4HK8 A;  3N9O A;  4XUQ A;  2OUJ A;  4XFG A;  3POE A;  5DZG A;  1APN A;  5CEH A;  5KXE A;  5KXD A;  4UXA A;  3DEM A;  1QH6 A;  4QPI C;  4PQQ A;  5K9Y A;  1Y9G A;  1QDC A;  2YFU A;  1Y9M A;  3ZXK A;  5KXC A;  1AUY A;  2HWC 2;  2Q5T A;  4XFF A;  1H4H A;  1MZF A;  2JDM A;  5K4L A;  1YNA A;  4B4Q A;  5C8W A;  2K2S A;  4QHB A;  4AGV A;  2ZHK A;  3NJV A;  3S5A A;  1SQ4 A;  1QXR A;  3ASI A;  5FYI A;  2VVE A;  3PIG A;  1AYM 3;  1QJU 2;  4GXL A;  1T6G C;  1OSG A;  4HSL A;  2ZGS A;  4QPI A;  3FFZ A;  3HMY A;  2P2K A;  1DLL A;  3I97 A;  5ISL A;  4PI2 A;  1GLH A;  4Y1V A;  3I3Q A;  4W8J A;  2RJK A;  4HPK B;  1C57 A;  5T50 A;  2ZHL A;  1RYY A;  1YI7 A;  1NLQ A;  5CYY A;  1AR9 3;  4XTM A;  3N7M A;  2XLA A;  1XNT A;  4MUV A;  4FP3 A;  5HV4 A;  3RWK X;  2VC9 A;  3PUR A;  4QKD A;  1UO9 A;  5IK8 A;  3ZFF C;  5FKC A;  1PIV 2;  1R1A 2;  1PHM A;  3ILN A;  2KD7 A;  1KJL A;  2IXH A;  2VQ0 A;  3AP9 A;  1ZM1 A;  5I91 A;  2I07 B;  5AVA A;  1AL2 2;  3VKN A;  3ME2 A;  2J1A A;  1K42 A;  4QPG B;  2VQU A;  3ZR5 A;  4HL0 A;  3NQH A;  5I0D A;  3VD4 A;  5A7W B;  1TME 3;  2CDO A;  3ZFF A;  3VZM A;  5FY7 A;  2G9G A;  1ULF A;  1GOH A;  3JQX A;  3VHP A;  3RZM A;  4MHU A;  4R4X A;  1OD5 A;  4FTB A;  3PUH A;  1HN1 A;  3U75 A;  1A6C A;  4K1Y A;  2JEN A;  2VUC A;  1JZ6 A;  4IEO A;  1VBE 3;  1YQC A;  1LGN A;  3I59 B;  4UW3 A;  1JYN A;  1JS9 A;  5GJ6 A;  2OYZ A;  5L9V A;  3LAG A;  2ES3 A;  5L9B A;  2DFC A;  1E57 A;  1Z7S 1;  1XND A;  2RV9 A;  4IGP A;  2JDZ A;  3HQU A;  3O0V A;  4A7Y A;  2GC0 A;  2VUJ A;  5JOZ A;  1CIY A;  1CAX A;  2GP5 A;  4KG8 A;  2R06 2;  1F5J A;  3EHK A;  3VBR B;  5LZ6 A;  2XQR A;  3GM8 A;  1YFU A;  2EXI A;  5BNP B;  3RJ2 X;  1W3V A;  3JXS A;  2C4X A;  1MVE A;  4ASK A;  1YXW A;  1V9U 2;  4AL9 A;  4MV2 A;  2OII A;  2ZGQ A;  2WFF 2;  1PZ9 A;  1Q43 A;  2XKP A;  4Y1X A;  3R0R A;  5FOJ B;  4ZY9 A;  1BMV 1;  2QKD A;  1XXN A;  5IJR A;  3SH4 A;  1NXM A;  1OA3 A;  1IS3 A;  4Y22 A;  3CBN A;  2EXH A;  2GND A;  2ZGU A;  2ZX4 A;  3WQ1 A;  3ZFG B;  5DAB A;  2J1E A;  5DAW A;  1CAW A;  5H9Q A;  5DUX A;  2RS3 2;  3BVC A;  5EIY B;  4I2O A;  3Q9O A;  5K8S A;  1C8M 2;  4OMC A;  2I74 A;  5I8S A;  3VKO A;  5KHG A;  1OHF A;  3O7O A;  5KC6 A;  4Y3O A;  3K75 B;  1W0O A;  3I2J A;  1Q8Q A;  2EAL A;  1OA2 A;  2LM3 A;  3UKT A;  2LS6 A;  2Y6J A;  1WZX A;  4E2Q A;  3EYP A;  5F6K A;  4Q1P A;  4XUP A;  4XPV A;  1ENR A;  4AQS A;  3OBT A;  2NMN A;  3TOJ A;  3BTY A;  1VBC 3;  1CZT A;  4E8D A;  4Y5T A;  2OQ6 A;  3POY A;  1W8H A;  2JKB A;  4JVA A;  4JHT A;  2YDE A;  4NHX A;  2BZD A;  3TWI A;  1X50 A;  4GAL A;  1XYN A;  3PHM A;  4TXW A;  4IND A;  3AKS A;  2WZR 2;  4DPN A;  2JE8 A;  1STM A;  2DYC A;  4I01 A;  1S2K A;  1LAJ A;  1LUL A;  5FP9 A;  1ULD A;  1FAT A;  1ACC A;  2PAE A;  2A6V A;  2RMU 2;  2FCV A;  4GUL A;  1W0N A;  3ZO0 B;  4GB3 2;  1UZW A;  2WO1 A;  1DQ2 A;  2BGP A;  1UMZ A;  3I3E A;  4N9I A;  4XQD A;  4XQW A;  5JSO A;  5C5T A;  4BK5 A;  1GP4 A;  4L97 A;  5ANN A;  2GN3 A;  2B4K A;  4LR4 A;  3T0B A;  1UZZ A;  3WNN A;  4IER A;  4AED B;  4RHV 2;  1UD1 A;  2XVL A;  2C9A A;  1DF0 A;  1VP6 A;  5DDJ 3;  4AFC A;  3CJX A;  4BM8 A;  3IT8 A;  1AXY A;  4ZZ8 A;  4KBB A;  3QCW A;  1KEX A;  1OFS A;  2BOJ A;  2CAV A;  3AYA A;  3LGR A;  1LTE A;  3SLI A;  4HON A;  3MIB A;  2ARB A;  2BGO A;  4KBZ A;  4R8H A;  3AZW A;  1FXZ A;  1M06 G;  1GZT A;  3KT1 A;  4NPM A;  1OF3 A;  5FMD A;  5IVJ A;  4OLL A;  3LCP A;  1UOF A;  5E16 A;  4CU7 A;  5A7Q A;  1JZ5 A;  2WWS A;  3H8O A;  2E63 A;  3P5B A;  5FIX A;  1W9Y A;  2P4E A;  1QGL A;  3ZYP A;  3HJR A;  2D5H A;  3GZA A;  4ASL A;  4IGO A;  2AGS A;  1UZ0 A;  5JPM B;  4HLT A;  1OLR A;  1RUF 2;  3NV1 A;  4AZZ A;  5L7O B;  2ZAA A;  1HB1 A;  2GZW A;  1FI2 A;  2NZ9 A;  4QPG C;  4Q5O A;  5E89 A;  2ATF A;  4Q4Y 1;  3HBZ A;  3OGS A;  5FZA A;  1DQ1 A;  2DBI A;  1HN0 A;  4N53 B;  5FPV A;  3KT4 A;  2X53 S;  5C8C A;  3N4M A;  3RNS A;  5E8A A;  1FV2 A;  2XGX A;  2JWP A;  2J1U A;  1POV 1;  1SCS A;  4OQ8 A;  3F95 A;  1C3H A;  3C7H A;  5IAV A;  1ZZ6 A;  1UU6 A;  1V6O A;  1JUI A;  5CA6 A;  1ND3 C;  4QPG A;  5A7P A;  3UL2 A;  3U07 A;  1SEF A;  1NUK A;  1ALY A;  5DMY A;  1KFX L;  4Q0V A;  4AF9 A;  3BOW A;  1EAH 2;  4C91 A;  2PXJ A;  2Q8D A;  4AWD A;  2VQA A;  4XZP A;  2WNU B;  1G9B A;  2IC1 A;  3VBR C;  2PHW A;  1XPW A;  1ZZ9 A;  1ND3 A;  1QXP A;  4UFH A;  2XJP A;  2JD9 A;  3H8X A;  4FFH A;  3MLK A;  1WKY A;  2ZKL A;  2CGN A;  4LMF A;  3J26 N;  1JYC A;  1OLM E;  1F2N A;  4XXP A;  4K21 A;  3AC0 A;  4E4D X;  2DDU A;  4IE7 A;  4AK3 A;  1N1V A;  3WNK A;  2WN3 A;  3MF6 A;  3ZFG C;  4DY3 A;  1GIC A;  1RUH 2;  3WXP A;  2Y33 A;  1IS6 A;  2BGC A;  3NAP B;  1YRZ A;  3VBR A;  5A1F A;  1LEN A;  2A71 A;  5H9R A;  3ZVX A;  3VBS B;  4UWD A;  2ADD A;  1VR3 A;  1OBN A;  2F4L A;  3ACG A;  3H7Y A;  4KU8 A;  3SCF A;  4R9D A;  1NLS A;  2FBE A;  4M4P A;  3MBW A;  1DDL A;  1C1F A;  4CCD A;  1BK1 A;  1WW5 A;  3POG A;  2ZAH A;  1REF A;  1ZRR A;  2OKX A;  2GU9 A;  2WNO A;  1WLC A;  3K4D A;  4N9H A;  4LLF A;  4BQ1 A;  5A6Q A;  1OH4 A;  2B39 A;  3WDT A;  2WC2 A;  4RFT 0;  3WD5 A;  3TEX A;  3U37 A;  4M3C F;  2RVA A;  3P6B A;  4PF1 A;  4DIN B;  4NJ4 A;  2GH8 A;  3UGF A;  2WS9 2;  3ZYF A;  2XUE A;  4ET7 A;  1OQD A;  2OUH A;  2RM2 1;  3A7Q A;  3V0B B;  5LK7 B;  1H6Y A;  5JWP A;  1QOO A;  5C33 A;  1W0P A;  1CR7 A;  2WO2 A;  1U5Y A;  4BIS A;  4YW1 A;  4Q4W 3;  2W39 A;  3N3H A;  4BIO A;  1AHS A;  1LOC A;  4AW7 A;  3MID A;  3ZDS A;  3BAL A;  3AL6 A;  2YFZ A;  4LOT A;  4XUN A;  2Y0O A;  3WQ0 A;  4AED C;  2QJV A;  5K7P A;  4LA3 A;  4QB1 A;  4GMP 0;  4LBQ D;  2H6C A;  5CAD A;  3THC A;  3IN9 A;  4L92 A;  2WLQ A;  1HB3 A;  2YXS A;  3UNP A;  2VOV A;  2XJS A;  3KV6 A;  4GWN A;  4ES9 A;  1TMF 3;  1ZRE A;  5FZH A;  1QJY 2;  3TNQ A;  4FO9 A;  3ZX7 A;  3IKW A;  3M1H A;  1W6P B;  2TEP A;  3KZ4 C;  5JOY A;  1VIW B;  4AED A;  1CGP A;  2XVG A;  5C3P A;  3PUI A;  4IEY A;  4KI5 M;  5FYC A;  1S0B A;  1POV 0;  2BP6 A;  2MEV 2;  1X33 A;  5FZ8 A;  4MVT A;  3QH7 A;  3AFG A;  3ZSE A;  4D7T A;  1I9R A;  2LRO A;  1WD4 A;  1O8S A;  3KSC A;  2DTY A;  1F4A A;  4COU A;  1VBA 2;  3AYD A;  4YW2 A;  5ACA 2;  5KBF A;  2TUN A;  2XJU A;  2P17 A;  1PVC 2;  3H42 B;  4X6Q B;  1OC1 A;  5DZF A;  5LB6 A;  3GAL A;  3TB0 A;  4ATF A;  5GZC A;  4CP1 A;  2PHR A;  3O14 A;  2CNA A;  3AZZ A;  2D7F A;  2XQX A;  2CDP A;  3AXD A;  1AJO A;  1XSQ A;  2QQN A;  2XHN A;  3EB7 A;  5L7O C;  3KB5 A;  3R6S A;  5F1R A;  4QQH A;  1RUG 1;  3Q8F A;  4XUT A;  1FMD 1;  1H1M A;  2PHD A;  4FOQ A;  5HCB A;  5LBB A;  3ZYH A;  4N53 C;  3CKH A;  2PN5 A;  1W3X A;  4UYB A;  4IEQ A;  4NPL A;  4ORF A;  1EV1 2;  1W2O A;  1OQ1 A;  2VPV A;  2VVF A;  1WW4 A;  4NPR A;  5HBA A;  5F37 A;  3HWJ A;  1MEC 2;  4BQY A;  1VAL A;  4M00 A;  4PI0 A;  4LBO A;  1G9C A;  1ZBE 3;  2ZGP A;  4N7U A;  4CPB A;  1WA6 X;  4XUR A;  2WNE A;  2ZHN A;  4E4S A;  2VOK A;  4KWL A;  4N53 A;  2FD8 A;  1ULE A;  1W6M B;  2BBA A;  3OG2 A;  3CL1 A;  4JX0 A;  1QU0 A;  3VZK A;  1FOD 1;  5JXI A;  1W39 A;  1XYO A;  2WNU C;  4NR1 A;  4XMA A;  3AX4 A;  4RR3 B;  1GBG A;  1I5Z A;  1UYY A;  3RZK A;  2H6B A;  3O1S A;  1J3R A;  4D3W A;  1ZZC A;  2SLI A;  1GZW B;  3JBG 2;  3JD7 2;  1M4W A;  4QKB A;  1W8O A;  1AYN 2;  2BUK A;  3T4V A;  1RUC 2;  5A70 A;  1QF3 A;  3AJZ A;  4FPO B;  3RDI A;  1OF4 A;  1O5L A;  1RUI 1;  2GN7 A;  3NV4 A;  5FP8 A;  1X9P A;  5G05 L;  3ZXL A;  3ZYI B;  3NAP C;  4A3Z A;  4EV0 A;  1DU3 D;  4BWO A;  2VOT A;  2ZGN A;  3NO8 A;  4XDQ A;  3VBS C;  1NXD 1;  3E5Q A;  2UY9 A;  1G9A A;  4FI9 A;  1YYN A;  4P9G A;  4QAW A;  1IGO A;  3ZSK A;  2G9Z A;  4YNI A;  4NRP A;  4BHP A;  1MS3 A;  1GQH A;  3POF A;  3UGG A;  3AP5 A;  3VHO A;  4DRR A;  5HCH A;  3WNX A;  2FZ2 A;  2WNV C;  2GMP A;  2UWA A;  2YPJ A;  3C3V A;  2XL9 A;  3AK0 A;  3USU A;  3ZN5 A;  3NAP A;  1CZV A;  3T4H B;  3O1R A;  3VBS A;  5FYM A;  1FT9 A;  3VD5 A;  5KR7 A;  3ZKU A;  2EIB A;  4XBL A;  5I0T A;  1QEX A;  3ATG A;  5LY2 A;  2ZGL A;  1ZRI A;  4N90 A;  2WZP P;  1K45 A;  3S7E A;  4CRQ A;  1MS9 A;  5CBL A;  3INA A;  2WNV A;  2HWC 1;  4Y5Z 0;  3AXE A;  3IPV B;  1GOG A;  2BNM A;  1AVB A;  2GNB A;  3LWC A;  4MOA A;  4HVQ A;  5EWS A;  4BCU A;  1GV9 A;  4GIQ A;  4IEW A;  4OHZ A;  3PME A;  1QJU 1;  3DYO A;  3DEC A;  5FMB A;  3ZN4 A;  4OMD A;  2UY8 A;  4XCB A;  1C4R A;  5GLT A;  3WIN E;  1ENQ A;  1PNG A;  5A80 A;  4XJZ A;  5IK7 A;  3V0B A;  1FPN 2;  2QQL A;  2JKX A;  2QQU A;  2ZGR A;  1R09 2;  1YEW A;  2VW1 A;  1FYU A;  3NWK A;  2WQ4 A;  3D0S A;  1W6O A;  3RYP A;  4ZXK A;  2AAC A;  1JMU B;  3KS7 A;  3PVN A;  5A3P A;  1HRV 2;  2QNK A;  1WLT A;  3UET A;  3LA2 A;  2D6M A;  1AX2 A;  3OPW A;  2UYA A;  1CQ9 A;  1MS0 A;  2KA3 A;  4Q4V 2;  3ZYG A;  2DWR A;  1PIV 1;  1R1A 1;  5CFC B;  1AJK A;  2E26 A;  3AP7 A;  3WG4 A;  3VDD B;  1C8N A;  3C7G A;  1EYB A;  1X8E A;  5JMO A;  2RS5 2;  2VOX A;  3U4X A;  3M3C A;  1QIQ A;  1ZX5 A;  2Y6F A;  2J1T A;  1AL2 1;  5FY1 A;  2HH9 A;  2W1S A;  1UN1 A;  1U5I A;  1W6P A;  1ULC A;  2PLV 3;  5A32 A;  4AHY A;  3K3N A;  3V56 A;  4AI3 A;  4Q27 A;  4DRV A;  1AR8 2;  4L2N A;  1JYX A;  2VGD A;  4MLO A;  1W2A X;  1X36 A;  4A41 A;  2YGL A;  3PTY A;  2QQI A;  4O7X A;  4IE0 A;  2WJS A;  2EIG A;  3O1P A;  2WKK A;  2ZGM A;  3JB8 A;  2BWC A;  2QQW A;  4Q4X 2;  2YGM A;  4U2A A;  5F8P A;  2AEZ A;  4IUG A;  5DAQ A;  5FV3 A;  2RS1 2;  1W8T A;  2Q30 A;  1AR6 2;  3LEK A;  1OOP B;  3LA3 A;  4XFB A;  2FMD A;  3AZY A;  5GZG A;  5FZD A;  1UKR A;  3SKV A;  3WSO A;  1RC6 A;  1US2 A;  2VCM A;  4LO4 B;  1F4H A;  1C5I A;  1QJF A;  3OYW B;  4OCT A;  3POW A;  4WV8 A;  5IUQ A;  1RVF 3;  1KRI A;  2VZU A;  3H7J A;  2ZTN A;  4Q1R A;  2WAO A;  1W8W A;  2R06 1;  2FDG A;  2VMG A;  3WG1 A;  2EIC A;  2WSU A;  3K3O A;  2ZEZ A;  1HXS 3;  5F3G A;  5FZ3 A;  2HWB 3;  2JEC A;  4KL1 A;  3RZG A;  4QM8 A;  2OA2 A;  1V9U 1;  5LY1 A;  4RHV 3;  3FLR A;  1L3J A;  1YC6 1;  2WFF 1;  4L11 A;  4O9G A;  4OUM A;  2W3J A;  2VY0 A;  2Z4F A;  1J1L A;  1VBD 2;  1BCX A;  2PHU A;  2I2S A;  4D7Y A;  4MO3 M;  1GWK A;  5FJH A;  1JYV A;  1DZT A;  4RR3 C;  3M70 A;  1UU4 A;  1B35 A;  1HV0 A;  1PMI A;  4IW3 A;  1IQA A;  4HK9 A;  2B8M A;  2D6O X;  2RS3 1;  5LA9 A;  2VOW A;  2CY6 A;  2P3I A;  1W6M A;  1C8M 1;  2QDR A;  2HWF 3;  4F7Z A;  2FDH A;  3Q8A A;  5HXV A;  1FNZ A;  1UNB A;  1RXF A;  4OZX A;  3RQ0 A;  4XIL A;  1QNW A;  1XU1 A;  1DQ5 A;  3CF6 E;  3P3P A;  1POQ A;  4YVW A;  1AXZ A;  4QD2 A;  3WW4 A;  3FX3 A;  3MW3 A;  2YU1 A;  1PZ8 A;  3WDV A;  2W08 A;  2TBV A;  2F17 A;  4A42 A;  5FUP A;  3O1M A;  2WYS A;  1GZW A;  2ORX A;  2WT0 A;  3HOB A;  4FOW A;  1H1A A;  1W8N A;  2VBP A;  4MH0 E;  3E5X A;  4RL7 A;  5EJ1 B;  5G04 L;  2YBK A;  4UW4 A;  2ARA A;  1MZE A;  3I2I A;  1W2T A;  1H1I A;  3MFC A;  2DVF A;  3GXU A;  3OPT A;  5I0U A;  5JOX A;  1GU3 A;  1RHI 3;  2WZR 1;  4OI2 A;  5FP7 A;  3AVS A;  3LDR A;  5CKQ A;  4NHM A;  3LEG A;  1CWP A;  2RMU 1;  4B1M A;  4COY A;  1RUJ 3;  4GB3 1;  4HKL A;  5IVE A;  1UU5 A;  3OD4 A;  1IOA A;  3HD8 B;  4CA9 A;  1LCL A;  4D69 A;  3IDA A;  4AFA A;  5CIS A;  3T09 A;  1ENS A;  3HBK A;  1HRI 2;  2DUR A;  2BOI A;  4CVU A;  2WBK A;  1VRH 3;  1GQG A;  4RHV 1;  1ZVF A;  3RS6 A;  4LOS A;  3MW4 A;  3THP A;  3LFI A;  5FO9 B;  5JAX A;  1BQP A;  2Y38 A;  2GMM A;  3T1L A;  1PGW 2;  1WLD A;  2IXC A;  3FBY A;  3U1X A;  4LT5 A;  1GR3 A;  1KDM A;  1S0G A;  2RDQ A;  4LHK A;  3PVO A;  2HWD 3;  2AEY A;  2WFP A;  4RS5 B;  1IHM A;  4HVO A;  4K8R B;  3UYJ A;  4BXS V;  1S4C A;  1XRU A;  1CPM A;  5A3W A;  1N3Q A;  4TN7 A;  4NII A;  3OPZ A;  1CAW B;  3E5U A;  5JI9 A;  4YYO A;  2EA7 A;  3KGZ A;  2K9Z A;  2JG8 B;  5BXX A;  4Z1V A;  4NRM A;  5EYX A;  2KM2 A;  2PHT A;  4IEP A;  3B94 A;  4P5Y A;  2A3Y A;  3OD0 A;  2VJX A;  4ERO A;  2E53 A;  4AQ6 A;  5CFC C;  2IUW A;  3U10 A;  4Z07 A;  2DCJ A;  1AR7 2;  2WSV A;  2Q1F A;  4Q2F A;  4YM1 A;  2HKX A;  1QJX 2;  2ZBJ A;  3VDD C;  4PLN A;  3ILF A;  1KJR A;  5GKA C;  4DMI A;  2HBU A;  5BYN A;  2BBV A;  1IG0 A;  2TNF A;  1QQP 2;  4DOU A;  4AEM A;  1CES A;  3CU7 A;  1RUF 1;  2XJQ A;  3ABZ A;  3A22 A;  1UIK A;  1OI6 A;  3VD7 A;  4XEZ A;  4WZF A;  4UFK A;  3PLQ A;  2DCT A;  1DYK A;  3NNG A;  1JTZ X;  5JLV A;  4CDW B;  3WT3 A;  5CFC A;  5F5C A;  4BLI A;  1HLC A;  1JZ4 A;  2JIG A;  3W5M A;  3URF A;  3VDD A;  1GNH A;  1ND2 B;  5AC9 2;  2D98 A;  4PIZ A;  1CZS A;  2X29 A;  5DXD A;  4XZU G;  1DZR A;  5I8Y A;  1RIT A;  2JDN A;  2JDH A;  1LOF C;  1NLR A;  3AVR A;  1W2N A;  2LAL A;  4LBK A;  2VR4 A;  2VME A;  4AVV A;  4D6S A;  2OT7 A;  3B00 A;  1X8M A;  1BHG A;  1OOP C;  4UBG A;  3NV3 A;  4R9C A;  3IWZ A;  4UFI A;  4QPW A;  4ZS2 A;  4Q0P A;  1EAH 1;  1GZ9 A;  5F7U A;  2BWA A;  4WM8 B;  3MO4 A;  5FZ6 A;  2A6X A;  3OUI A;  4CU9 A;  1A34 A;  3WP6 A;  1LOF A;  1NQJ A;  3DGT A;  3DPR B;  4FPC A;  2R0F A;  3WOG A;  4OYU A;  1OOP A;  4I02 A;  5D8A B;  1JU3 A;  3V0A B;  5HXM A;  1O6U A;  4FPJ A;  5LEJ A;  3OYW A;  3WLU A;  1G7Y A;  2VZ1 A;  4CP0 A;  5DAV A;  4XIO A;  1PX4 A;  1Z7S 3;  5DUW A;  3LDK A;  1QJY 3;  2O14 A;  4DXR A;  5A7S A;  3ECQ A;  4CP2 A;  4BQX A;  1G6N A;  1XOY A;  4CUC A;  1NT0 A;  4AG4 A;  1SAC A;  4BQ2 A;  4ZKT B;  4GQ7 A;  1XU2 A;  3KWV A;  1OA4 A;  4TZD A;  1OUX A;  5IAX A;  4JHZ A;  2V5Y A;  4H14 A;  3TN9 2;  4XFA A;  4QX2 A;  3IB3 A;  1I1E A;  1QMJ A;  1Q3E A;  5B2G B;  2Q1Z B;  1QOT A;  3HAG A;  4PJY A;  1JYW A;  5FZ1 A;  5ACA 3;  5C8C B;  2R32 A;  1I3H A;  3EBR A;  1ULP A;  3M3O A;  1GWL A;  2JDU A;  2WS9 1;  3AZX A;  5FPL A;  2OXB A;  3MIE A;  4P08 A;  2Y6L A;  2BYV E;  2BVV A;  4YZ1 A;  2IZW A;  2VCC A;  4Z92 B;  3ZYR A;  2A6Z A;  1VB2 A;  2ZS6 B;  5EZW A;  1ENX A;  1NAE A;  1UOG A;  4FPG A;  4ISQ A;  4V2V A;  1RTV A;  2QQO A;  5DUU A;  1EV1 3;  3ZPO A;  2WR9 A;  4SLI A;  4CYD A;  3TRS B;  1X7N A;  2Y6G A;  4B1L A;  1HQN A;  4EZH A;  3BU0 A;  5FMO L;  1W28 A;  1AZD A;  2VCB A;  2BDR A;  3U4S A;  1HW5 A;  1ND3 B;  4OUS A;  2XLF A;  1S0D A;  3CIH A;  4Y4Y A;  5C5U A;  1PM7 A;  5FFO C;  3MV0 1;  3UGH A;  4ZS3 A;  3GYD A;  3HNY M;  3A0K A;  4FT8 A;  4IE4 A;  5IW0 A;  1QJY 1;  4XAC A;  5T55 A;  1BVP 1;  1Z78 A;  4QXB A;  2JG9 C;  2A6Y A;  4RS5 C;  1ZRD A;  2PFW A;  2V4V A;  2KR2 A;  4CCL A;  3IMM A;  4JTO A;  1BEV 2;  4Y24 A;  1ZBA 2;  1ZZ8 A;  2BJS A;  1D4V B;  2YHJ A;  3DCQ A;  1TEI A;  4NWV A;  4TYS A;  2DCY A;  2JG8 C;  4CP9 A;  2MEV 1;  1OKQ A;  1W8Z A;  1PGL 2;  2UWC A;  5C4W B;  2W95 A;  2ZX1 A;  1O8P A;  2UUR A;  1LKN A;  3PMS A;  2ETE A;  1YUD A;  1SDD B;  4UBH A;  2GH2 A;  1F8V A;  2ZZQ A;  4RS5 A;  1UQX A;  2JG9 A;  1VBA 1;  5ACA 1;  2QBX A;  1D7P M;  2GSY A;  3ELN A;  4QHZ A;  4U36 A;  1HIX A;  3POI A;  2WAA A;  2DCZ A;  1UMI A;  3K77 A;  2JG8 A;  3ZXE A;  1CPN A;  4AGG A;  2A70 A;  2EXK A;  1CAV A;  4XJA A;  4JGY B;  4Z2W A;  3AKR A;  3RSJ A;  3L2H A;  4CDQ B;  4E9K A;  4CUB A;  1OPO A;  2W87 A;  4RQP B;  3ZFE B;  3RJR A;  3IM0 A;  2WDB A;  4CDW C;  4W50 A;  4W6W A;  2Z42 A;  5JI7 A;  1WCQ A;  5F39 A;  1EV1 1;  3OEB A;  1ND2 C;  3MIF A;  4LKE A;  4MZU A;  5GLZ A;  3W59 A;  5KHJ A;  3J7N A;  3PU8 A;  2XOM A;  3J8F 2;  3N9Q A;  2LW8 A;  2XR4 A;  4GMP 3;  2GC3 A;  1GKB A;  2CU5 A;  5T5L A;  4BDV B;  2XUM A;  1SDW A;  2W91 A;  3BTA A;  3ETQ A;  4GKY A;  3WVJ A;  4I3P A;  4JZR A;  2VW0 A;  3B93 A;  3R05 A;  1H6X A;  1K5J A;  4CDW A;  5CZK A;  3M3Q A;  2QTW B;  5I0R A;  1US3 A;  2PYT A;  1KXG A;  3IZO A;  1ND2 A;  2A75 A;  3AKT A;  3OB8 A;  1XJA A;  2DU0 A;  4Q4Y 3;  2WO7 A;  4OHV A;  5EJ3 A;  4WM8 C;  5DQ0 A;  4BMB A;  2GP3 A;  4DQA A;  2K46 A;  5KHH A;  2A5Z A;  1WWY A;  1R1Z A;  3MV1 1;  3NNJ A;  1POV 3;  3DPR C;  1Y7B A;  1DLC A;  3R4D B;  3GZT B;  1GWM A;  2GME A;  5D8A C;  1JU4 A;  3JBG 1;  3JD7 1;  4XF0 A;  3SH5 A;  5JZG B;  1W06 A;  3GBF A;  3G6J B;  1EPW A;  4P9I A;  4FCA A;  4X8P A;  1RUC 1;  3VDB A;  2W47 A;  4WM8 A;  2JX9 A;  1J84 A;  3FWE A;  4GWI A;  3T2P A;  4XDP A;  2R04 3;  4QWN A;  2GNT A;  1ODM A;  2JDY A;  2XML A;  3DPR A;  3ETP A;  3DYM A;  2OPK A;  3I2K A;  1QH7 A;  4YWA A;  3SIS A;  1RB8 G;  1NY7 2;  4QU1 A;  4XBQ A;  3O1U A;  3RI8 A;  3VKF C;  1RUE 2;  5CNA A;  3VKM A;  4Q4V 3;  5D8A A;  1ZRF A;  4MAD A;  4OUE A;  3VBH B;  5L73 A;  3V0A A;  1NQD A;  2NP0 A;  1JW6 A;  5FRA A;  2D43 A;  4QB6 A;  1J59 A;  3W20 A;  4C1W A;  4X8N A;  2VZO A;  3GHM A;  5FUI A;  3QBQ A;  2GC1 A;  2A1X A;  2YB7 A;  1RIN A;  1RUD 2;  1WGP A;  1PGS A;  1QKQ A;  1OH3 A;  2YZ4 A;  4FPH A;  5C8C C;  1NE4 A;  2VTX A;  1U0A A;  3I2H A;  4GMP 1;  1NOV A;  1PZ7 A;  1AR8 3;  4NHK A;  1H30 A;  3WX5 A;  4O61 A;  1S55 A;  2BTV C;  2RR1 2;  2WIN B;  3MLL A;  3TNP B;  5HCA A;  3OY8 B;  3R4S A;  5FBZ A;  1GP5 A;  5FZK A;  1SG3 A;  4JV4 A;  3NV2 A;  2Q1M A;  3UT0 A;  5E6H A;  2CV6 A;  4AVC A;  1I6X A;  4DS0 A;  4MSV A;  3Q8C A;  5FKB A;  2D40 A;  4BQ3 A;  1BZW A;  4NIA A;  3WEZ A;  4AI0 A;  1HDK A;  2XG3 A;  3ZYB A;  2BFU L;  5DN2 A;  3NL1 A;  1SMV A;  1TNR A;  2ZOE B;  4ONU A;  4AGR A;  4YW6 A;  1H9W A;  2XBO 2;  4H7L A;  1XNB A;  4P9X A;  2DUQ A;  5LA0 A;  4XFI A;  1V6K A;  2A7A A;  5FXX A;  3TEW A;  2WQZ C;  2XXZ A;  5CFD A;  4YPJ A;  3ST7 A;  1FPN 1;  3ES4 A;  5J1X A;  3ZXF A;  1LU1 A;  1R09 1;  2XLG A;  3AJY A;  3BPZ A;  4XF9 A;  2RM2 3;  4Q8L A;  5C70 A;  1JYT A;  2OVU A;  1H2L A;  4YVW B;  2R04 1;  4D6R A;  5F3C A;  1HRV 1;  2GC2 A;  4LLO A;  5IVB A;  2QQP A;  1RIR A;  3WNP A;  1IKQ A;  1VBD 3;  1WW6 A;  4Q4V 1;  4N43 A;  4BE3 A;  1Q8O A;  3J7H A;  4KWU A;  4UFL A;  3MPP G;  4Y1U A;  4LQR A;  5FZ0 A;  5C4W C;  4NHL A;  1GOF A;  1X82 A;  2RS5 1;  4P9J A;  1LOA A;  3T30 A;  2EAK A;  1JHJ A;  3VL9 A;  1QNY A;  4LHN A;  2VNV A;  2ZX0 A;  5FPZ A;  4O9E A;  1HX6 A;  3MW2 A;  4M0N A;  3ZXG A;  2HYX A;  3KCY A;  4J1W A;  4UW5 A;  4COZ A;  2C5D A;  3USU B;  1AR8 1;  4AVA A;  2VZR A;  2W2I A;  4ITC A;  4YGC A;  2OZJ A;  3LSE A;  2WL1 A;  4P9L A;  5GLU A;  3UJO A;  2V73 A;  4J25 A;  2JE9 A;  3LKJ A;  4IEZ A;  5C4W A;  2AUY A;  4JGY C;  1LEM A;  1Y9Q A;  4Q4X 1;  4AAP A;  4AVS A;  4UFJ A;  4CDQ C;  5FR3 A;  1CAU B;  4BU2 A;  3RZH A;  4RQP C;  1CVN A;  2BRT A;  5FYT A;  1V6J A;  3ZFE C;  5J37 A;  2RS1 1;  2ZAC A;  3BI3 A;  2WNV B;  3KF3 A;  1AR6 1;  2RDS A;  2ZAB A;  2MHF A;  1LR5 A;  2MNG A;  3RRD A;  1VE0 A;  3KD4 A;  2ILM A;  5JVV A;  1JYI A;  2WA4 A;  4OI1 A;  3TEY A;  4IEU A;  4FTE A;  1J83 A;  1PO2 2;  2HEY F;  2C6S A;  4LUL A;  3W58 A;  3T2O A;  2YBP A;  4JGY A;  5IVF A;  2W52 A;  1LGC A;  2XWB B;  4ATE A;  1RMU 2;  4CDQ A;  5FP4 A;  1DBN A;  4NAM A;  4RQP A;  3ZFE A;  2YRO A;  3HN3 A;  1HRI 3;  1DQ4 A;  1MR5 A;  4FXG B;  1RUG 3;  3WW1 A;  1XNC A;  1FMD 3;  5GLW A;  1SCR A;  3NKG A;  4R4Z A;  1W04 A;  4UFM A;  3RMX A;  1C28 A;  1VBD 1;  3NNM A;  4JRL A;  4NUB A;  4R9A A;  1W6O B;  2Q8O A;  4DXS A;  1PO1 2;  1OLQ A;  2Q0A A;  2XDV A;  3CQO A;  4YVS B;  5GZD A;  1RGS A;  3GHN A;  3IDE A;  5IVC A;  2DF7 A;  2FCT A;  2E31 A;  4AQT A;  4YFZ A;  2ZXQ A;  3VV1 A;  1XE7 A;  5JZG C;  1AX0 A;  5BPX A;  1H4G A;  3AMP A;  4M3C B;  1TG7 A;  1IPK A;  3OF1 A;  4MXW B;  2KXL A;  4CCK A;  2LTN A;  4YZ5 A;  4FAG A;  1O3R A;  5GZF A;  2ZZJ A;  1YJK A;  1LJ7 A;  1FOD 3;  4RYD A;  1VJ2 A;  1AF9 A;  5A32 B;  1NCQ B;  4A4A A;  4CZS A;  4Q0U A;  1TVG A;  2D3P A;  3RPQ A;  3VBH C;  1J3Q A;  2VUA A;  3FN9 A;  1COV 3;  3KF5 A;  3KHB A;  3DL3 A;  4PDW C;  3VHN A;  5JZG A;  2IFR A;  4YW4 A;  5BNO B;  3OCP A;  4OI4 A;  3MGU A;  5LWB A;  2RHP A;  3WF1 A;  3MPB A;  2VZV A;  5T5J A;  3BTZ A;  2D97 A;  3ZIW A;  1R08 2;  2Y6H A;  3ES1 A;  2VU9 A;  1WCD J;  4QXK A;  2A3X A;  1RUI 3;  2UYB A;  3CO2 A;  4KWK A;  1AYM 2;  1NE6 A;  2IXI A;  1H8T A;  4JRA A;  2RJ2 A;  3VBH A;  3ZSL A;  4JDO A;  4PDW A;  1HJG A;  3GBW A;  1OD3 A;  3FMG A;  3N7L A;  2VXJ A;  1HRI 1;  2V5D A;  1IPS A;  4LIV A;  1GNZ A;  1O5U A;  1DHK B;  1AR9 2;  3OUH A;  5FYH A;  5T52 A;  2BVB A;  4BH9 A;  2OW4 A;  3JU9 A;  2FDK A;  1VB4 A;  2C24 A;  4QQ2 A;  4Y4R A;  4YZ3 A;  1PGW 1;  3N9N A;  1N1T A;  4I3G A;  4UF0 B;  1OVP A;  4ZU4 A;  2ID4 A;  1VPH A;  1REE A;  1ZZ7 A;  2B7Y A;  2QQV A;  2WUH A;  3OY8 A;  3KMH A;  3PU3 A;  5F3I A;  5FZB A;  3WP5 A;  3KQ4 B;  4BQ4 A;  2Y6K A;  1DG6 A;  3RZJ A;  3PVE A;  1B35 B;  4MXV A;  2AYH A;  2FDF A;  5HI0 A;  5J7M A;  3H3Z A;  3BKZ A;  4AQ2 A;  2HWC 3;  4DUX A;  3VD9 A;  3GZE A;  4ASM B;  4YVW C;  3WG2 A;  1SLI A;  4I0B A;  4GJZ A;  1D0G A;  1LHU A;  1TME 2;  3DYP A;  1KFU L;  3T0A A;  2SBA A;  1UCX A;  2VNR A;  3A21 A;  4AHW A;  4KGQ A;  4OUL A;  1AR7 1;  2DTW A;  1COV 1;  1QJU 3;  1RED A;  4YG3 A;  1QJX 1;  5FLJ A;  5IAT A;  2DVG A;  1OUR A;  1ZYB A;  2WQ8 A;  3O0X A;  4QB2 A;  5D1I A;  3N9P A;  4K20 A;  5B4N A;  3IBM A;  2V72 A;  1QQP 1;  4BXF A;  5IT6 A;  1VBE 2;  2B42 B;  2E7T A;  1MZ5 A;  2OQ7 A;  2X5I A;  2E51 A;  2F4P A;  1UY0 A;  3BIW E;  4H3W A;  1VAV A;  5BY5 A;  5ABJ B;  2ZEX A;  1BVV A;  3QH6 A;  3M3I A;  4L9B A;  3O12 A;  3N35 A;  4B29 A;  3HNM A;  2PHL A;  3Q8B A;  4JKK A;  3BCW A;  2WYF A;  2Q8C A;  3NJX A;  2VZQ A;  1B09 A;  3AM2 A;  3ACL A;  3B02 A;  5AC9 1;  3AP6 A;  1WD3 A;  2XB6 C;  5A3N A;  2FDJ A;  3F2Z A;  3GF6 A;  1D0H A;  1PIV 3;  1R1A 3;  3HIF A;  2ZX2 A;  1RUN A;  1SLA A;  2YY1 A;  2OPW A;  2JE7 A;  5FMC A;  4OHY A;  4OHW A;  2QZ3 A;  4EYU A;  3PUS A;  1AXK A;  1S1A A;  1AL2 3;  3AMN A;  4CXY A;  4YM3 A;  5BNO C;  3NST A;  2YUE A;  2E6V A;  4Q26 A;  1F15 A;  2YG0 A;  3DKW A;  4YFW A;  1FAY A;  3PUA A;  1CAU A;  5FPX A;  2XJV A;  3PDQ A;  2F6B A;  2ZMN A;  4J6G A;  2EVX A;  4PCR A;  4R52 A;  3U0Z A;  1L7L A;  2CAU A;  3M4F A;  4BLJ A;  4EWA A;  2D3R A;  4IES A;  1DZQ A;  4HN1 A;  1BKZ A;  4A45 A;  5J48 A;  1LHO A;  2CGO A;  1OUS A;  3IDC B;  4MGZ E;  1ZA7 A;  4OHX A;  5EPA A;  1PVX A;  3TAY A;  3CNA A;  3D4K A;  4GAZ A;  1RJ8 A;  4FQZ A;  3M2M A;  4JTN A;  3K46 A;  1K3I A;  2EID A;  2AZ5 A;  4YVS C;  5A6Z A;  1VBC 2;  2GAL A;  1S0F A;  1HQL A;  4FOV A;  3KCC A;  4DUV A;  5LA1 A;  3WV6 A;  3CDZ B;  1IQD C;  3MFA A;  2R06 3;  4IGQ A;  4URT A;  4BB3 A;  4Y26 A;  2XJT A;  1NX9 A;  3III A;  4FTS A;  3TN9 1;  1V9U 3;  1C5H A;  4DNY A;  4XHB A;  5L36 A;  2WFF 3;  3AKQ A;  2V09 A;  1NCQ C;  5FXW A;  3IAQ A;  5FDB A;  4YVS A;  4AHZ A;  4QT6 A;  4QGL A;  2QFE A;  1XNA A;  2PHF A;  2PQQ A;  2WAB A;  5FYV A;  4XXA A;  4HN0 A;  4AI8 A;  3I54 A;  1D4M 2;  2W1U A;  2FDI A;  3RVH A;  5D21 A;  2WWJ A;  2G4I A;  4M3C A;  5E1R A;  4FQ4 A;  5F5A A;  2RS3 3;  4IEX A;  4MXW A;  5FYZ A;  5LBE A;  3LE0 A;  2D6P A;  3SQO A;  3T1M A;  4UI9 L;  3VZO A;  1C8M 3;  5T5P A;  4LO8 A;  3QAC A;  1ASJ 2;  3MIC A;  5DDJ 2;  1FX5 A;  2YYO A;  3I2F A;  1WMF A;  1NCQ A;  4WBB A;  4XUO A;  4CCE A;  4Y1Z A;  2Y26 A;  3I8T A;  1CX1 A;  2JIC A;  3I2D A;  2HWE 2;  5JIU A;  5J98 B;  1MZ6 A;  4LEJ A;  4AVB A;  4P9W A;  3HEI A;  2NYY A;  5BNO A;  2O8O A;  5DG1 A;  3GDB A;  1UPS A;  2D6K A;  3J8F 3;  1SHW B;  2XJR A;  1QY4 A;  2VBB A;  1UYX A;  4GH4 B;  2HLE A;  4G4F A;  3T3Y A;  1GSL A;  3B69 A;  4IE6 A;  1O7F A;  1Q8P A;  1SFY A;  2WZR 3;  3KM5 A;  4LE4 A;  3WCR A;  4ZZ5 A;  5J36 A;  4HSJ A;  4JAA A;  4H2A A;  4V1P A;  3SEP A;  1CJD A;  2GAU A;  1H9P A;  3H3L A;  1UXZ A;  3BU7 A;  4LK6 A;  4XF1 A;  4BQW A;  1GYK A;  1D2S A;  2RMU 3;  3DXT A;  4QDR A;  3SCH A;  4GB3 3;  3UES A;  2VXR A;  1B35 C;  1ZBA 1;  4YZ2 A;  3OEA A;  4QKF A;  2LUW A;  1VLN A;  2C0Z A;  3POJ A;  3EMR A;  4B7E A;  2BPA 2;  2ET7 A;  4V2W A;  1PGL 1;  5FYB A;  5J96 B;  3K4A A;  4UF0 A;  1H2M A;  4BOW A;  4L99 A;  2Y34 A;  2ZHM A;  5A3O A;  1FNY A;  1V00 A;  2QQM A;  2Q4S A;  4RGA A;  3O1T A;  3A4U A;  4XTP A;  1YLL A;  4R9B A;  3ACI A;  1DGW X;  4S2F A;  4CUG A;  4MET A;  4ZU7 A;  3C7F A;  1AL0 G;  1XYP A;  2R0H A;  5HPO A;  3WNM A;  3IMN A;  3L2Y A;  4JQT A;  5FY5 A;  5ABJ C;  4QPY A;  4GWJ A;  4CCM A;  1DQ0 A;  3FE5 A;  4LIT A;  3WW3 A;  3LB9 A;  4BK4 A;  4OI0 A;  1O59 A;  1Y43 B;  3IAP A;  4P14 A;  1ZNP A;  3ZYJ B;  2J42 A;  3BTX A;  3PJY A;  3N9L A;  2WA3 A;  4GJY A;  2P1B A;  3LIH A;  2XPJ A;  5FZF A;  2A73 B;  1DIW A;  2ERF A;  1UKG A;  3AMH A;  5B4X A;  3J8F 1;  1QOS A;  1JOJ A;  3CJI A;  5LK5 A;  4NIH A;  5ABJ A;  2X05 A;  3ON7 A;  3ZXA C;  3MZH A;  5SV8 A;  4GZ9 A;  1BXH A;  1LOG A;  1RUF 3;  1GNY A;  4LO5 B;  4CEY B;  5FZC A;  4QQO A;  4N7I A;  2ENR A;  4XMI A;  2D3S A;  4LXL A;  4YGE A;  3WP4 A;  5LAS A;  4Z8B A;  4CXX A;  1WBL A;  4MGI E;  3MDP A;  4LBQ A;  5I0S A;  3QOP A;  1YIP A;  4P9Y A;  3D0J A;  2B46 X;  3D5O A;  1ODN A;  4A44 A;  3DF0 A;  1W2U A;  5CAZ A;  4S2H A;  2C26 A;  2P37 A;  3ZOI A;  4CP9 B;  1QJE A;  1UPI A;  5FBJ A;  3NMB A;  2FMY A;  5FXZ A;  3VL8 A;  1UX6 A;  1HV1 A;  3E6D A;  3FUO A;  5CG8 A;  2GDF A;  1SLC A;  3FZ3 A;  4KG0 A;  4GWM A;  5FZG A;  3D8C A;  5A3U A;  1YFY A;  1EAH 3;  5JCT A;  2AH2 A;  1JZ7 A;  4I0A A;  2JG9 B;  5F6L B;  1NY7 1;  1CON A;  5BNN B;  3R4U A;  1RUE 1;  1VMH A;  3HT2 A;  4LTA A;  4WVW A;  1JUH A;  3ZPY A;  4BPZ A;  2K0G A;  5ERL A;  4DO0 A;  3WDX A;  4EN9 B;  1S0C A;  2P5B A;  1CAV B;  4PLO A;  4E27 A;  2RG4 A;  1O4Y A;  3LA7 A;  3T2T A;  4A3X A;  2D44 A;  2CWM A;  3O0W A;  4XAA A;  1NCR B;  1RUD 1;  4LO6 B;  1WCS A;  4Q4W 2;  3C8X A;  3GNE A;  4W6Y A;  4KQ7 A;  4AFM A;  2IVI B;  1JZ8 A;  2VL4 A;  1LED A;  3THD A;  5H9P A;  4XW3 A;  1K12 A;  1X9T A;  2RDR A;  3ACH A;  1RUH 3;  4NVP A;  4QX1 A;  1GMM A;  1K5M B;  3B5L B;  2RR1 1;  4ZPI A;  2WRA A;  3WR0 A;  3FHA A;  5KWR A;  3BGA A;  1DGR A;  4SBV A;  3OJB A;  4JCK A;  2W0X A;  2QZ2 A;  4BJ0 A;  1TMF 2;  4DIQ A;  3PJQ A;  4F3J A;  1BK0 A;  4YW7 A;  1T2X A;  2BU9 A;  2XBO 1;  1YI9 A;  2Z5W A;  5FTT C;  3E97 A;  5L9R A;  3CHX A;  2CYF A;  4PLM A;  3VGI A;  1N3O A;  3UV9 A;  3MYX A;  4GH4 C;  4URA A;  3FLP A;  3ZKY A;  1RMU 3;  1W6N A;  2WS9 3;  1YCI A;  4IV1 B;  4PHZ A;  2JB4 A;  3AL5 A;  1ULO A;  2FQP A;  3KLS A;  2QUO A;  3NW4 A;  4LUM A;  5C3R A;  1LNS A;  3TYJ A;  2R07 2;  3H8U A;  2VZS A;  2ZEW A;  2R1D A;  1NYW A;  2HEW F;  1SFP A;  5EV7 A;  1IS5 A;  4E2G A;  1LU2 A;  4GH4 A;  3U78 A;  3WF0 A;  1E5I A;  4MGT A;  1HJF A;  1WMD A;  4QGN A;  4AI1 A;  2Y8K A;  2L9L A;  4CCN A;  5IVY A;  4AE2 A;  4ZHN A;  1SBE A;  4CE8 A;  2BV4 A;  5JSR A;  5KXB A;  1QDO A;  4QU2 A;  1FV3 A;  3BOP A;  4PIY A;  3I2G A;  4XHX A;  1O4T A;  1RUH 1;  4K40 A;  5CKM A;  5A6Y A;  5F3E A;  3RFR A;  3H50 A;  4FSJ A;  4XVH A;  2LRP A;  3G7D A;  4AR2 A;  2P3K A;  1ZBE 2;  4D8M A;  4KGG A;  4LE3 A;  3FBM A;  4FFG A;  2PAM A;  3GJA A;  4JQR A;  4TLF A;  4NHY A;  2C1F A;  2ZML A;  3ZLI A;  2JDA A;  4WZC A;  2MEV 3;  3V65 A;  4P5H A;  3BPS A;  3IIA A;  3ITQ A;  3UK9 A;  1R64 A;  1UF2 C;  5DAP A;  5FAX A;  1R08 3;  1Y3T A;  2JIJ A;  4KWJ A;  1VBA 3;  4Y33 A;  2JDP A;  1PO2 1;  4XIK A;  4AEJ A;  1DFQ A;  1PVC 3;  2BER A;  4E2S A;  4YG0 A;  2EF6 A;  4EZ4 A;  1RMU 1;  4QDQ A;  1UAI A;  3LD8 A;  5FPU A;  1YQ6 A;  5DPN A;  4F8A A;  5FP3 A;  4CEY C;  1W03 A;  5CFD B;  4ES8 A;  4LNV A;  4L0P A;  1V6I A;  3J7M A;  2AEN A;  3O1O A;  1IZ3 A;  4HKW A;  5JDB A;  1JOB A;  3OGV A;  1LEC A;  1LES A;  1PX3 A;  2J1V A;  5FZM A;  4S2G A;  1QJZ A;  3SIT A;  1PO1 1;  2VCA A;  1MEC 3;  5FZ9 A;  1OT5 A;  1OXC A;  3WF2 A;  4WVZ A;  5CKN A;  3W5N A;  3ZR6 A;  5JXG A;  3U11 A;  2GNM A;  4RGK A;  1LHV A;  3I3B A;  1L7R A;  3SKJ E;  4PF5 A;  4CEY A;  2DFB A;  4N43 B;  5J09 A;  1V0A A;  1BBT 2;  4AI9 A;  3T0D A;  2J22 A;  5JIA A;  5A33 A;  3LPG A;  2X10 A;  4LUK A;  1UMH A;  4FOY A;  5CIR A;  3SNM A;  1SLT A;  3VZL A;  5BNN C;  5A1A A;  2UU8 A;  1BLZ A;  2E9Q A;  1WBF A;  4LOR A;  1WUV A;  1W8U A;  3WY6 A;  4P00 B;  4CXW A;  4I0W B;  1H0B A;  2Y60 A;  4MG2 A;  4QQP A;  1UY3 A;  1LOB A;  3JBG 3;  3JD7 3;  3M8L A;  4C1X A;  4M4R A;  1AYN 3;  1NCR C;  2ZGO A;  3HNB M;  1R08 1;  1NZI A;  1RL3 A;  1RUC 3;  5C3O A;  1CX4 A;  2ARC A;  5BNN A;  4G9S B;  3RGB A;  4KNC A;  1PVC 1;  1AYM 1;  5IYY A;  1K5M C;  3LIG A;  4OZO A;  5LEK A;  4XFH A;  1MQT B;  4XCA A;  1BJQ A;  3B01 A;  3DXU A;  1UL9 A;  2PQS A;  1MVQ A;  4X6R B;  1JH5 A;  2D6N A;  4XQ4 A;  3AFK A;  2G9F A;  3CMG A;  4CEW B;  1NCR A;  1IPJ A;  1SPP B;  1AR9 1;  1DGR N;  1KQR A;  3LF7 A;  3NNF A;  3ALQ A;  4CPB D;  5FO7 B;  1MPX A;  5APA A;  5CVR A;  5F5I A;  1V6L A;  4LIU A;  5GLV A;  3WF4 A;  3RZL A;  1K5M A;  4ZU5 A;  1GQP A;  4FPE A;  1MEC 1;  4ARY A;  2VNO A;  3FHQ A;  4NN0 A;  3ZMO A;  4LJH A;  3E1F 1;  4DUW A;  3NKT A;  3WUD A;  3Q8E A;  3SHR A;  3KCX A;  4E8C A;  4IV1 C;  1DGL A;  2VUL A;  3EO6 A;  5EFU A;  4AAX A;  3UJQ A;  4RSU A;  2HYK A;  1LHW A;  2PLV 2;  4Q8K A;  1TQ5 A;  2J7M A;  1E5H A;  3KGL A;  5FLH A;  5HCF A;  5FY0 A;  3AMM A;  1LHN A;  1TME 1;  3VBU B;  1VBB 2;  4J1X A;  3MUY 1;  3ZXD A;  4HVR A;  1A3K A;  5C9A B;  1E5S A;  1W99 A;  2BW8 A;  3EJK A;  3WF3 A;  5JR2 A;  4K3U A;  4IV1 A;  4A6O A;  4MYE A;  1JI6 A;  3CEW A;  1VBE 1;  1FPN 3;  1UZV A;  1AYN 1;  3VKL A;  4RFR B;  1R09 3;  1YIF A;  2YPD A;  1LRH A;  1JBC A;  3HQR A;  3A0N A;  3OBZ A;  1SZB A;  1V70 A;  2PAK A;  3DN7 A;  4BQ5 A;  5F5Q A;  3A23 A;  1XSR A;  2V4A A;  2XVK A;  1HRV 3;  4PT6 A;  3RWN A;  4AYU A;  1YO8 A;  2W1W A;  4JDN A;  1RVF 2;  2ZMK A;  4MGY E;  4LBN A;  4A7K A;  2X8K A;  3S6P A;  4BME A;  3I7D A;  1JXN A;  1H8T B;  1L7Q A;  3BOD A;  3OOX A;  2ARX A;  1RJ7 A;  2EXJ A;  1D4M 3;  1HXS 2;  2VQT A;  4PDW B;  3ZM8 A;  4AEK A;  2HWB 2;  3MUZ 1;  4COW A;  1TZO A;  2RS5 3;  2W92 A;  1F5F A;  2VTF A;  4AOC A;  1E5R A;  5C3Q A;  5FZ4 A;  1PM4 A;  2VW2 A;  3ACF A;  1ASJ 3;  2ZJC A;  2A6W A;  2N7G A;  1JOP A;  1HB2 A;  5JUV A;  4QX7 A;  1P8J A;  3WQ7 A;  2ORZ A;  4AI2 A;  3WDU A;  1J58 A;  1SBD A;  2HWE 3;  5AFB A;  4CU8 A;  2W46 A;  3KV5 A;  5FZE A;  3ZN6 B;  2FHR A;  2HWF 2;  5GM0 A;  2QE3 A;  3D82 A;  3SC7 X;  5CFD C;  4Q4X 3;  3PL0 A;  4D0Q A;  1NA1 B;  3SMH A;  3ZMN A;  4JKM A;  3TBD A;  1Q8S A;  4XJW A;  4YRD A;  2H0V A;  2P3J A;  4A7Z A;  2RS1 3;  4YM0 A;  1AR6 3;  4EN0 A;  2P6C A;  3GCW A;  4S2D A;  4WVM B;  1GZC A;  4B3N A;  1VBC 1;  4N43 C;  4A2U A;  3WNO A;  1Y4W A;  4HPK A;  5LCW L;  1UYP A;  4IEV A;  2VMH A;  3JQW A;  3OGG A;  2R30 A;  1T6B X;  1LOD A;  5SV5 A;  1N47 A;  1WLW A;  3J9S A;  3KVA A;  2RDN A;  1RHI 2;  5FPA A;  5BV6 A;  1IG3 A;  2X5I B;  1F9K A;  4FFI A;  2VMD A;  1WCU A; 
#chains in the Genus database with same CATH homology
 2V72 A;  4A42 A;  1UY0 A;  2WYS A;  2ZEX A;  2ORX A;  3HOB A;  2J1A A;  3NRU A;  1K42 A;  1W8N A;  2VQU A;  5EJ1 B;  3HNM A;  5G04 L;  4JKK A;  3NQH A;  2W5F A;  5I0D A;  3VD4 A;  3NJX A;  2VZQ A;  2CDO A;  3I2I A;  2YC4 A;  1PMJ X;  3GXU A;  2VO5 A;  1GU3 A;  1GOH A;  3F2Z A;  3WQB A;  3PUH A;  1HN1 A;  3LEG A;  1JZ6 A;  1JYN A;  2EIE A;  3D3A A;  3VDA A;  1W9T A;  3IDA A;  4QX0 A;  3T09 A;  4CVU A;  2RV9 A;  2WBK A;  2YG0 A;  1CIY A;  3GM8 A;  3JXS A;  2C4X A;  3HPN A;  4A45 A;  4BXS V;  4ZY9 A;  1UXX X;  1NKG A;  2QQK A;  5IJR A;  2XON A;  3K46 A;  1K3I A;  2EID A;  2J1E A;  2VMF A;  4DUV A;  5EIY B;  5LA1 A;  3CDZ B;  1IQD C;  4P5Y A;  2VJX A;  4OMC A;  1UWW A;  1NX9 A;  5IHR A;  2DCJ A;  3K75 B;  3III A;  3FL7 A;  3I2J A;  2Y64 A;  2DCK A;  3IAQ A;  2LS6 A;  2Y6J A;  3EYP A;  3ABZ A;  3A22 A;  1XNA A;  4XUP A;  3VD7 A;  2WAB A;  3T2Q A;  2W1U A;  1JZ2 A;  3OGR A;  3NNG A;  1CZT A;  1DYO A;  4E8D A;  3LE0 A;  4UI9 L;  2BZD A;  3P1I A;  1JZ4 A;  3W5M A;  4TXW A;  3CZJ A;  2JE8 A;  1CZS A;  3I2F A;  4XUO A;  4XZU G;  1CX1 A;  2E33 A;  2VR4 A;  2VME A;  1W0N A;  1BHG A;  2WO1 A;  2BGP A;  3HEI A;  3I3E A;  3GDB A;  4QPW A;  5EJZ B;  4BK5 A;  1SHW B;  2B4K A;  1DP0 A;  3T0B A;  1UYX A;  3WNN A;  2HLE A;  5F7U A;  3MO4 A;  4CU9 A;  2WZ8 A;  4ZZ5 A;  4ZZ8 A;  4OYU A;  3SEP A;  1KEX A;  1UXZ A;  4QDR A;  1JU3 A;  3UES A;  5HXM A;  2BGO A;  3OEA A;  5JXH A;  2VZ1 A;  2X09 A;  1PX4 A;  1OF3 A;  3K4A A;  4DXR A;  4CU7 A;  4CUC A;  3ECQ A;  1JZ5 A;  4DEQ A;  4AG4 A;  2W1Q A;  2QQM A;  1I5P A;  4JHZ A;  3HJR A;  3ACI A;  3C7F A;  4QX2 A;  3IB3 A;  5HPO A;  3WNM A;  1UZ0 A;  2C9K A;  4GWJ A;  2VZT A;  1JYW A;  4BK4 A;  1O59 A;  3IAP A;  3OGS A;  1ULP A;  3CZU A;  4P08 A;  2Y6L A;  2J1U A;  5B4X A;  3T08 A;  2VCC A;  3C7H A;  2J1R A;  2X05 A;  1NAE A;  1UX7 A;  2QQO A;  4GZ9 A;  1GNY A;  4LKS A;  5C71 A;  1NUK A;  5DMY A;  2Y6G A;  2VZP A;  1UY4 A;  2VCB A;  3CIH A;  2WN2 A;  4Z2A A;  4RN5 A;  3MV0 1;  5C7G A;  1UYZ A;  1XPW A;  3HNY M;  4MGQ A;  4A44 A;  2QQJ A;  5IFT A;  2JD9 A;  3I3D A;  1WKY A;  2C26 A;  2V4V A;  4P02 B;  4DEV A;  3AC0 A;  2DDU A;  3VD3 A;  3WNK A;  2WN3 A;  2W95 A;  1JZ7 A;  1O8P A;  2J1S A;  1SDD B;  4UAP A;  2R7E B;  3OBA A;  3ACG A;  1EUU A;  4M4P A;  2QBX A;  1D7P M;  3MBW A;  5LA2 A;  2WAA A;  3K77 A;  1UMI A;  2OKX A;  3K4D A;  1JZ8 A;  3C8X A;  1OH4 A;  2VM9 A;  4DXT A;  2VL4 A;  3THD A;  1K12 A;  4QX1 A;  3ACH A;  3U37 A;  1GMM A;  4CUB A;  2W87 A;  2RVA A;  3P6B A;  2WDB A;  4PF1 A;  4W50 A;  1WCQ A;  3FHA A;  3BGA A;  3OEB A;  4CUA A;  4ET7 A;  2XOM A;  4HG6 B;  3A7Q A;  1H6Y A;  2LW8 A;  1EUT A;  4BJ0 A;  2ZEY A;  2WO2 A;  4BDV B;  1T2X A;  2W91 A;  1H6X A;  5CZK A;  2YFZ A;  4XUN A;  1US3 A;  3OB8 A;  1UY1 A;  4QB1 A;  5DQ0 A;  3THC A;  3K4Z A;  3VDC A;  3MV1 1;  1ULO A;  3UNP A;  3LEI A;  1DLC A;  1LNS A;  2VZS A;  2ZEW A;  1JU4 A;  3WF0 A;  3VDB A;  2W47 A;  3PUI A;  1J84 A;  4GWI A;  4KI5 M;  2Y8K A;  2L9L A;  3T2P A;  3I2K A;  3DYM A;  3ETP A;  1KGY A;  2W94 A;  1O8S A;  4ZXE A;  4MAD A;  4OUE A;  1F4A A;  3I2G A;  4W4Z A;  4QB6 A;  4XVH A;  2VZO A;  5FUI A;  1GUI A;  4D8M A;  1XC6 A;  2XQX A;  2CDP A;  2YB7 A;  2QQN A;  2XHN A;  3EB7 A;  2JDA A;  1JZ3 A;  3I2H A;  4XUT A;  1R64 A;  1PMH X;  3CKH A;  1SG3 A;  3C7O A;  3LPF A;  2BER A;  3C7E A;  3GGL A;  3WEZ A;  5DN2 A;  1YQ2 A;  4XUR A;  4QDQ A;  3SEE A;  5DPN A;  4QX3 A;  5LA0 A;  4L0P A;  4CU6 A;  1W9W A;  2BBA A;  3OG2 A;  4JX0 A;  1UY2 A;  4UOJ A;  4TTG A;  3OGV A;  2J1V A;  1PX3 A;  3BN6 A;  4YPJ A;  5JXI A;  5J1X A;  2VCA A;  3WF2 A;  1OT5 A;  3W5N A;  5JXG A;  5C70 A;  1UYY A;  3I3B A;  1L7R A;  3SKJ E;  3WNP A;  2J22 A;  3T0D A;  1W8O A;  3LPG A;  2X10 A;  2VZ3 A;  3J7H A;  4KWU A;  4LQR A;  1OF4 A;  5G05 L;  4A3Z A;  1UMH A;  1GOF A;  2VOT A;  5A1A A;  1JHJ A;  1W9S A;  4FI9 A;  4QAW A;  4P00 B;  2HYX A;  4JKL A;  1UY3 A;  2VZR A;  2WZE A;  4M4R A;  3HNB M;  1CZV A;  3VD5 A;  5IYY A;  4OZO A;  2EIB A;  3WNL A;  2PQS A;  1K45 A;  3CMG A;  1J83 A;  1GOG A;  4MOA A;  3T2O A;  1MPX A;  3WF4 A;  3LQC A;  1GQP A;  4ARY A;  4ARX A;  3FHQ A;  3HN3 A;  3DYO A;  2WO3 A;  3DEC A;  5IFP A;  3E1F 1;  4MGS A;  4OMD A;  4DUW A;  2B9V A;  4KMQ A;  2QQL A;  4E8C A;  2JKX A;  5JXJ A;  4DXS A;  4AAX A;  4QDS A;  2VMC A;  3CQO A;  2J7M A;  2E31 A;  2ZXQ A;  3UET A;  3MUY 1;  2YC2 A;  1TG7 A;  2E26 A;  1W99 A;  3WF3 A;  5JR2 A;  4A6O A;  3C7G A;  1JI6 A;  4LHS A;  4RYD A;  5JMO A;  4A4A A;  2J1T A;  1TVG A;  2W1S A;  3FN9 A;  3A23 A;  4PT6 A;  4LPL A;  1JYX A;  2W1W A;  2W9X A;  3WF1 A;  4A41 A;  2E32 A;  2VZV A;  2QQI A;  1L7Q A;  2Y6H A;  3ZM8 A;  2VQT A;  3MUZ 1;  4XUQ A;  2W92 A;  4IUG A;  2VTF A;  2RJ2 A;  3LEK A;  3ACF A;  1OD3 A;  4PQQ A;  2YFU A;  2V5D A;  3SKV A;  3WSO A;  5JUV A;  1P8J A;  1US2 A;  1F4H A;  2ORZ A;  4CU8 A;  2VZU A;  2W46 A;  2WAO A;  2EIC A;  3NJV A;  2ZEZ A;  2ID4 A;  2WUH A;  4D0Q A;  4JKM A;  2Y6K A;  2W3J A;  2Z4F A;  3I97 A;  4W8J A;  4MO3 M;  1JYV A;  3VD9 A;  4DUX A;  1RYY A;  5CYY A;  3WNO A;  5LCW L;  1XNT A;  3DYP A;  3T0A A;  2VC9 A;  3A21 A;  2KD7 A;  2WQ8 A;  4QB2 A;  5B4N A;  2VMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...