4XZUG

Crystal structure of the human factor viii c2 domain in complex with murine 3e6 inhibitory antibody
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
154
structure length
154
Chain Sequence
CSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Human Factor VIII C2 Domain in Complex with the 3E6 Inhibitory Antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords 3E6 antibody Fab heavy chain
total genus 31
structure length 154
sequence length 154
chains with identical sequence M
ec nomenclature
pdb deposition date 2015-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4xzuG00
5DMYA 3IB3A 2Z4FA 3IAQA 4OZOA 1NKGA 4DUXA 2RVAA 4CU9A 4QDRA 2W9XA 4A44A 2HYXA 2ZEWA 3ECQA 2W1SA 1TG7A 3LEIA 4W8JA 2ORZA 4UI9L 1J84A 4JKMA 5HPOA 2VOTA 5IFPA 3I3BA 2QBXA 2J1RA 5DPNA 3AC0A 2WO2A 4ARXA 2ZEYA 2WQ8A 2YFUA 3VD5A 1XNTA 2DCJA 4XUOA 3T0DA 2HLEA 1UMIA 3FL7A 5I0DA 1F4HA 3VDCA 1O8SA 4FI9A 1WKYA 2Y8KA 5HXMA 2XHNA 3GGLA 1EUUA 1W8NA 3DECA 2XQXA 3C7FA 4BJ0A 4DUWA 4M4PA 4A6OA 1JYVA 1BHGA 1F4AA 3LPGA 1JYNA 3A22A 2C4XA 4P00B 1JZ2A 2QQLA 1UYYA 2WN2A 3WNLA 3HJRA 3THCA 1DP0A 4P08A 2VMCA 2VZQA 2J1EA 4TTGA 3JXSA 3ETPA 5LCWL 4ZY9A 3WNMA 5A1AA 5IFTA 4QX0A 5JMOA 4A41A 3DYOA 1W9SA 3WF2A 3WNNA 1PX3A 2V5DA 2VZ3A 4BXSV 1CIYA 2W1QA 2YC4A 2JKXA 2VO5A 4L0PA 3WQBA 5JXGA 3MO4A 1L7RA 1JU3A 4DEVA 3VD4A 3GDBA 1ULPA 4AG4A 2Y6JA 3OB8A 4RYDA 2R7EB 1L7QA 4CVUA 3W5MA 3OEBA 3THDA 2LW8A 3SEPA 1P8JA 3I2HA 2QQMA 1K42A 3I3DA 3I2FA 1PMJX 3I2JA 4UAPA 3OBAA 3ACHA 4CUBA 2E32A 4LKSA 1UY3A 1I5PA 4XUNA 3A23A 2WYSA 2QQJA 1OF4A 2VQTA 2ZEZA 4BK4A 2J1TA 3I2IA 2Y6LA 2KD7A 4JX0A 2WZ8A 1K12A 4BDVB 3CKHA 2W91A 2VMEA 1PMHX 4XUPA 5LA1A 3LPFA 3HN3A 1UXXX 1HN1A 3U37A 2YG0A 4PQQA 4OMCA 1UYXA 2J22A 1NAEA 2WN3A 3C7GA 3K77A 5CZKA 1UWWA 2OKXA 2BGOA 1H6YA 4M4RA 3BGAA 1DYOA 2W92A 1CZTA 3P6BA 3K75B 4Z2AA 4QDSA 2V72A 4UOJA 4P02B 3VDAA 4E8DA 1D7PM 1UMHA 1US3A 2CDOA 3BN6A 2W3JA 3T09A 2W5FA 1YQ2A 3NJXA 1K45A 1XC6A 2XOMA 3A21A 2ID4A 4A45A 1TVGA 1GOHA 2WBKA 1UY2A 5JXHA 4AAXA 2VCCA 4W50A 2Y6HA 3I2GA 3MUY1 3WNPA 5B4XA 3HOBA 1GOFA 3K4DA 4QPWA 1H6XA 4JHZA 3WF4A 5DN2A 5C71A 3OGVA 1XPWA 1UY0A 4XZUG 4KI5M 3T0AA 2JD9A 2BBAA 4QB1A 1PX4A 1GNYA 2XONA 2BZDA 2V4VA 1JZ5A 2BGPA 5B4NA 2VZ1A 4CUAA 2X05A 4MGQA 2E31A 4XUQA 1CZVA 3T08A 2DDUA 1OF3A 4JKKA 4QX3A 4MO3M 5IYYA 1GMMA 3CQOA 3EB7A 3VDBA 1J83A 4QAWA 1SDDB 3LEKA 3WSOA 2QQNA 3VD9A 3IDAA 4KMQA 5CYYA 2WUHA 3T2QA 3ZM8A 3HEIA 4PT6A 1CX1A 4DUVA 1MPXA 3E1F1 5EJ1B 4MGSA 1GU3A 3UETA 4MOAA 4IUGA 2W47A 3OGRA 2B4KA 5JR2A 3CIHA 3C7EA 4XUTA 2E33A 3I97A 2JDAA 5IJRA 2WDBA 2DCKA 2EIEA 1W9TA 1O59A 3C7OA 3K4AA 4QDQA 2YC2A 3P1IA 2ZEXA 4A4AA 3CMGA 3WF1A 3J7HA 3SKJE 4RN5A 1JHJA 3WF0A 2YB7A 3ACFA 3K4ZA 2WAOA 1US2A 1JZ3A 3MUZ1 4ZZ8A 3I3EA 5JUVA 4DXRA 3FHQA 3I2KA 4ET7A 5G04L 4HG6B 4DEQA 4LQRA 2W87A 3DYPA 4QB6A 1GOGA 1W8OA 4DXSA 2Y6GA 2J1UA 2C26A 3NNGA 4XURA 2X10A 4GWJA 2W46A 5JXJA 3IAPA 4LPLA 1OH4A 4QX1A 3CDZB 3EYPA 4QB2A 3OGSA 2RV9A 1JI6A 3CZJA 2W1WA 4ZXEA 2VZOA 3NJVA 4PF1A 3F2ZA 4ARYA 3HPNA 5DQ0A 5F7UA 2QQIA 1NUKA 3OG2A 4ZZ5A 4LHSA 2PQSA 3LEGA 3VD7A 3UNPA 2ZXQA 1XNAA 4A3ZA 3GXUA 1JZ8A 4W4ZA 2W1UA 1SG3A 1T2XA 3C8XA 2EIDA 1O8PA 2VQUA 4E8CA 2QQOA 2X09A 2VTFA 3LQCA 3D3AA 5FUIA 3OEAA 3LE0A 2VJXA 2J1VA 4JKLA 5J1XA 2LS6A 1JU4A 5G05L 2VZVA 1OT5A 5IHRA 1JYXA 2Y64A 4D8MA 3VD3A 2VZUA 1EUTA 1GUIA 4CU6A 1DLCA 4P5YA 4MADA 4DXTA 1WCQA 2VC9A 5C7GA 3IIIA 5C70A 1W0NA 3NQHA 3C7HA 3HNYM 2RJ2A 4YPJA 2VZPA 1SHWB 2YFZA 5EJZB 3UESA 3GM8A 1UZ0A 3T2PA 3T2OA 4OYUA 2EIBA 2W94A 1JZ6A 3FN9A 3WNOA 1UY4A 3WF3A 3HNMA 1UXZA 5EIYB 2Y6KA 3SEEA 1JYWA 3PUIA 2BERA 1OD3A 3CZUA 3WNKA 3ABZA 2WZEA 3WEZA 2J7MA 4D0QA 2QQKA 3T0BA 2WO3A 5LA2A 3ACIA 2E26A 4KWUA 4TXWA 2VZTA 4A42A 2EICA 2CDPA 1UYZA 1R64A 3MBWA 2W95A 2ORXA 2L9LA 3ACGA 2WAAA 2VMFA 1KEXA 1KGYA 2J1AA 5LA0A 4QX2A 2WABA 3K46A 4CUCA 3MV11 4XVHA 3SKVA 1JZ7A 2WO1A 2B9VA 2VZRA 4GZ9A 3DYMA 1ULOA 1LNSA 1NX9A 4CU7A 3MV01 2J1SA 1W9WA 4OMDA 3NRUA 1CZSA 1IQDC 3HNBM 2VMDA 2C9KA 4CU8A 2VL4A 3W5NA 2VCAA 4OUEA 1GQPA 3A7QA 2JE8A 1UX7A 2VZSA 2VCBA 4BK5A 2VM9A 5JXIA 4GWIA 3PUHA 1UY1A 1K3IA 1W99A 1JZ4A 2VR4A 3FHAA 1RYYA
chains in the Genus database with same CATH superfamily
3AK0A 3HQRA 4EJRA 5F2SA 1JOPA 4W6YA 2IXHA 3SCHA 2VW0A 1AL21 5CAZA 5EYXA 2JJ6A 4XBNA 1PO21 5E1RA 2XG3A 2ZCWA 3ZO0B 5C5UA 1A34A 1ZRIA 1K5MB 1OLMA 4XAEA 1SLCA 5A3OA 3R05A 3ECQA 4X8PA 5ANQA 4ISQA 5EYYA 1TG7A 5FZ4A 3AP4A 5A3NA 3RZZA 3GBWA 4CCEA 3VBSB 1V9U3 3ME2A 1W2NA 5JWPA 3JCIA 4NROA 4JKMA 1D2SA 4P9WA 3ZR6A 4GALA 3RZJA 4X8NA 1YNAA 2EF6A 4OCTA 5IFPA 1COV3 2YU2A 1DQ6A 4BHPA 2WO2A 2IWGB 2GC2A 4RHV3 4ARXA 2GNTA 5EV7A 4NIHA 5C8CB 2XUEA 3T0DA 1O6UA 1AYM2 2HLEA 2JENA 1LECA 3P5BA 4LO8A 1YFUA 5B2GB 1GV9A 3GZEA 1IKQA 2C0ZA 4NPRA 3N4MA 1CQ9A 4UBGA 1AXZA 2XHNA 3AMMA 1EUUA 2P6CA 2BGCA 4BM8A 5C3QA 5DZEA 1VRH1 1W8NA 2D6KA 3I3MA 4AVSA 4HMZA 1CX4A 4DUWA 4M4PA 4YVSC 4A6OA 4DMIA 1GNHA 5LASA 1OQ1A 2ZKLA 2PHWA 1X82A 3ZYFA 4L97A 2VECA 4Y1ZA 2HYKA 1GICA 3LPGA 2C4XA 2XBO1 4PDWA 1EV11 1ZREA 4B3NA 1C8M2 1JZ2A 5F8PA 1VRH2 2QQLA 1UYYA 3M3QA 2WN2A 3WNLA 4TZDA 4YG3A 1TMF2 5J3UA 5BNPC 2D6OX 4P08A 1X33A 4PI0A 2VZQA 4DINB 4RHV2 4S2HA 1LOBA 2TBVA 3C2UA 3GYDA 3ETPA 3FBMA 2GNMA 4M00A 4GWMA 4ZY9A 4HN1A 5E8AA 3ZKYA 1JN2P 4R9CA 4X6RB 5CKQA 4RGAA 4I0BA 2WT1A 5IFTA 4QX0A 1RUD3 5BYNA 2UY8A 2CTVA 3IKWA 2A6XA 2PHTA 2Y0OA 1CIYA 4FTSA 4L0PA 5E6HA 1LHOA 5JXGA 1L7RA 3I2DA 1NA1A 4YW7A 2ADDA 3OB8A 3AMHA 1ST8A 4BB3A 1UQXA 5FMOS 1AHSA 1P8JA 1UOGA 1APNA 3I2HA 1K42A 1NG0A 1UOJA 4XQ4A 4HOOA 4NHYA 4YNIA 5LWBA 1G9AA 4GD4A 3VBHC 3VKNA 5FY7A 1DLLA 4XHBA 4CUBA 2P3IA 5K0UB 4NHKA 2DWRA 2VUJA 1S2BA 3ZXEA 2B45X 1I5PA 4LKSA 3IT8A 4O9GA 1IPSA 3TBDA 5L36A 5A70A 2OX0A 3THTA 2ZEZA 1PGL2 3RZLA 3KGZA 1IS3A 3I2IA 1O5LA 3LIGA 4XC9A 1AR63 2BPA2 2WZ8A 2Q1MA 5I93A 1VBD3 3U75A 5AC91 3PJYA 5FYIA 2CL2A 4LXLA 1CVNA 2RM21 2WA4A 2QFEA 2VMEA 1WBFA 5FZ3A 5I8TA 1ZZBA 4QX7A 3G7DA 2R063 1G9CA 3LPFA 3PVEA 2D97A 1KFXL 2SLIA 2BNOA 2ARXA 2YG0A 4YVSA 4OMCA 2JXAA 1UYXA 2PAMA 3LEMA 1VJ2A 2CU5A 4CP9B 2O14A 1OFSA 1EV12 1UWWA 3NAPA 5AFEA 3U10A 2YY1A 1CZTA 2DVBA 3P6BA 2B8MA 1RUNA 4HLTA 5LY2A 1KDMA 5FZCA 3M70A 1QJY3 1EPWA 1H8TB 4OI1A 1S0JA 1LEDA 2MPFA 1UIKA 2RS11 4RR3C 1RUJ2 2HWC3 4QDSA 5GLUA 1JH5A 2WNUC 3TEZA 1RUC3 4QGMA 3N3HA 4FP3A 3ZFFB 1BEV1 2RR13 4LNVA 4WM8A 1UKGA 5KC6A 2WNVA 4WVWA 5TSWA 1CAWA 4KGGA 3OD0A 4AVCA 5DDJ3 5L7OA 3WD5A 1DZRA 5JZGA 1VBE2 1YQ2A 2O1QA 4G9SB 2IFRA 2GN7A 1VBD2 4QKFA 1H2LA 4BMEA 2GDFA 4NO4A 1TVGA 3O5SA 2D93A 1WD4A 5BY5A 5JXHA 2Y6HA 1YI7A 5J36A 1DQ1A 1EPZA 1OHFA 4I2OA 5A7WA 4LHKA 5CVRA 1GOFA 1FATA 5FAXA 2V09A 4NPLA 4RD7A 3H3LA 1LESA 1TQ5A 1Q56A 3H8RA 3TWIA 4HXCA 3NWKA 4Z2WA 4DQAA 3NNLA 4Y5SA 5L7OB 4Q4Y2 4IEQA 3RYPA 5IK4A 2K2SA 5F3CA 3ZSKA 2XL7A 2AR6A 1NE4A 2WWJA 2JD9A 4XIOA 2RG4A 2PHUA 1MEC3 4PQ9A 3ZFFA 3V64A 4K21A 1AR83 1DHKB 1ZA4A 3KT7A 4QT6A 1GNYA 1MZFA 3KHBA 2XONA 3RZMA 1YFXA 2D6PA 3LZZA 3VZMA 3WUCA 3BIWE 2FDIA 2BGPA 5B4NA 2HWE3 4CUAA 4AYUA 5C3RA 4AI9A 3FFQA 4MGQA 4K1YA 4HSJA 1SCSA 4BISA 1QF3A 3AJZA 3WP5A 1OLQA 2XWBB 3ZYBA 4Q4X3 4QX3A 4OFGA 4AXOA 1Y4WA 2D7FA 1W2OA 5FUPA 2Z79A 3E5UA 5DUUA 3TYJA 1TME1 4KL1A 1A6CA 1G6NA 1RUE2 2O0OA 1UU4A 3KVAA 5FZ8A 5FYYA 3O1VA 2A5ZA 1RB8G 3AL5A 3PTYA 5BXXA 3EB7A 4EROA 4MYEA 5J96B 5A80A 2I07B 3N7LA 2VQAA 3RPQA 4YSFA 2UWBA 1S55A 5HV0A 1PGL1 1JBCA 4KBBA 1ACCA 4QXBA 4COVA 1D4M3 2WLPA 2RHPA 4CRQA 2JDNA 1QQP1 4KMQA 3ZX7A 4MXWB 1JYTA 5CYYA 3I54A 4PT6A 1CX1A 1UYPA 2AEYA 3J7MA 1WUVA 1DGRA 1OURA 2ZGTA 3LD8A 3ZFEA 3MIGA 1XNBA 1WA4A 2LALA 5D8AA 2R071 1ODNA 3PU8A 2E9QA 2Q30A 3AP5A 4YW6A 3ZXDA 3UK9A 1PIV3 4CP1A 3QLQA 2CAUA 1CAVA 1WMXA 3CIHA 5FYUA 5JR2A 1S0DA 4FXGB 1OQDA 3UL2A 1HRI3 3WQ0A 3MEPA 3VBFA 3GBGA 4J25A 4UXAA 3WW3A 2E33A 2IVJA 1W6PB 2E53A 1N3QA 2WDBA 4NWVA 1Q8PA 2G19A 1UD1A 1LTEA 5FV3A 3ZVXA 1D4VB 1SMVA 4GAZA 2ZHLA 2D3RA 1V6JA 2WZR2 2DURA 1ZM1A 4QPIB 4DY3A 3C7OA 4P9GA 4K3UA 1YEWA 2VH9A 2EA7A 2I2SA 3K4AA 4GJYA 5DAWA 4C1XA 1ZRFA 1ASJ1 2BUKA 3P1IA 4HPKB 4MV2A 4PBOA 2XPJA 4JQTA 3UKTA 1UOFA 3BTXA 2JECA 1GANA 4JQRA 3RMYA 4IDZA 2WT0A 2X8KA 2YXSA 4PBPA 1LOCA 4RN5A 3VB9A 2GN3A 4IE0A 2HWB2 1MZ5A 2B39A 4Y3OA 4ZU4A 3WF0A 3K4ZA 3U0ZA 1UZYA 4Q5OA 1JMUB 3MIEA 3JQXA 3MYXA 1SPPA 2TNFA 1UIJA 2A6YA 5T5PA 5JUVA 4ZXKA 4ET7A 4F8AA 4WV8A 5GLVA 1L7LA 4DEQA 5IAVA 1GZWA 1MS4A 2P3YA 3DYPA 4J6GA 4Q4X2 4CUGA 1W8OA 2BTVC 3NL1A 2NP0A 5JOWA 1POV1 1POQA 2BFUS 3LFMA 5JI9A 2XQRA 1JS9A 4NRPA 3BI3A 2PAKA 1LOEA 1SFPA 4XURA 1STMA 4CXXA 4A7ZA 3UGFA 1TEIA 4R4ZA 3RWNA 1S2EA 3V0AB 3IAPA 3SHRA 4LPLA 5AC92 1UMZA 1MQTC 1IG0A 2JDYA 4HK8A 4PLOA 1UCXA 1S0BA 4QX1A 5L9BA 1W04A 3D82A 4Q4V3 4QB2A 4PIXA 3BB6A 4ES9A 4E4DX 5T55A 3SMHA 1RHI1 2IFWA 2Z69A 5GZCA 4GWNA 5GLZA 3RSJA 2XR4A 3KV6A 2QJVA 1QJU2 3OCPA 1CAUB 2XL9A 1CJPA 2FHRA 4OVEA 4A3XA 5F7UA 3BALA 1RMU1 3OG2A 2GH8A 4ZZ5A 4LKDA 4R9AA 5FYBA 1AR62 4LUMA 3S5QA 5FMOL 2EALA 2QQWA 1GWMA 3E97A 4E2SA 3UNPA 3QH6A 2ZXQA 4K7JA 5GM0A 1JZ8A 1G86A 1H0BA 2KR2A 3DPRB 3GXUA 4MGTA 4FFHA 1SG3A 1RUG3 3N9PA 5CFCC 1YQ5A 2ZX3A 3I3QA 5FZIA 4DRVA 3AMNA 3Q8AA 2BVBA 3TN91 1TE1B 1S0FA 2E7AA 2VQUA 3HD8B 3KV5A 5KXCA 1XE7A 1OBNA 2QQOA 4E8CA 3U11A 3WG4A 4NPMA 4NIDA 3NV1A 1ZBE1 3AB0A 5CIRA 3LE0A 4JKLA 3MLJA 5J1XA 4Q0VA 4CPBD 3OF1A 1VBE3 1MVQA 1LU2A 2OVUA 1HQWA 3E6DA 3APBA 1SLAA 1JYXA 2P37A 2Y64A 4XACA 2WNUA 3NV2A 1UF2C 2A1XA 5GLWA 2VW2A 1DLCA 4RR3A 5EJ3A 4HN0A 2SBAA 2RM22 2XJPA 5EFUA 1LCLA 1WCQA 2DV9A 2VBDA 3MGUA 5A6QA 2E51A 4IEXA 2CV6A 3WDWA 3TOJA 4QPIA 3BIEA 1SBDA 1HV1A 3NAPC 3NQHA 1Q8OA 5DDJ2 4OHZA 4XTMA 3ZDVA 2RJ2A 1HB3A 5FZLA 2YFZA 4XXAA 1W6NB 3UESA 1QY4A 1QGLA 3DL3A 5FXXA 1C1LA 3ZXKA 1OUXA 1Y3TA 1HDKA 1VBC2 1YFYA 3RZKA 1IPJA 4DS0A 4XJWA 2AH2A 2W94A 2VY0A 3WW2A 3AX4A 4GMP3 3RWKX 2ZGPA 4A6SA 1F9KA 2D6NA 3ACLA 1AR73 3WNOA 5IWFA 2AACA 5T5JA 5A7PA 2ILMA 4PF5A 4LIUA 4QQ2A 1GZTA 1RUE1 3HNMA 5CG8A 3OY8B 5FPBA 5CFDB 5T52A 5CFDA 2WNOA 4XF4A 1AL0G 3OJBA 4YZ1A 5EIYB 2GMEA 5FBZA 5JOXA 3HQUA 2CYFA 1CR7A 1DBNA 4C91A 1UL9A 4E2GA 1W05A 1G7YA 2D43A 3CZUA 1U5YA 2WZEA 4B1LA 2J7MA 1WMEA 4EYUA 1FV3A 5LK7B 1A8DA 2QQUA 4Z8BA 2A73B 2ZGUA 4KWUA 4UW5A 1DZTA 2IC1A 2JDMA 4A42A 4CCOA 1GFF2 3NKGA 1FAYA 2X53S 4BQ3A 1YHFA 5A33A 3MBWA 5FLHA 4AHYA 2ORXA 2VUCA 3O1RA 5DG2A 4WVMB 2XUMA 1KDKA 3HN1A 3HR9A 2VMFA 3JD72 4CSWA 4EZ4A 1OA4A 1FXZA 3FLRA 4HONA 3OYWA 4LULA 1H1MA 3GNEA 4UBHA 4TYSA 2WABA 1OOPC 3SCGA 4S2GA 1RVF3 4IV1C 5BV6A 2RDSA 1OMIA 5IATA 1VBA3 2VZRA 5C4WA 3IPVB 4JTNA 3KLSA 5FWEA 3T4HB 4IE4A 4EN9B 3H0OA 3ZKUA 4QD2A 4TSVA 2OZ6A 4WVVA 2W52A 5FZBA 5FZOB 3FHIB 5A7QA 3MV01 4TLGA 5M0TA 3GF6A 1QXRA 2CAVA 5FZ9A 4LLOA 4Q4W3 2JIGA 1CZSA 2E63A 3KGLA 4U2AA 1V0AA 4AI3A 3WNXA 1OKOA 3URFA 3J9SA 4CU8A 5K9YA 4IW3A 2VCAA 4YZ3A 4RQPB 1GQPA 2A75A 4GMP0 1E57A 1ONAA 1AYM1 1ND2A 4RA0A 2VZSA 3MIDA 3ZFGC 4BK5A 2DCTA 2WWSA 4O7XA 1ZBE3 1CPNA 3PUHA 1K3IA 4R52A 3ZSEA 1JZ4A 5CFCB 2IXIA 4CDUA 1O7FA 1HRV1 1RYYA 4FFGA 4RGGA 4NMIA 4UW3A 3IDEA 1GQHA 1YLLA 1XU1A 3WQ1A 4ZU5A 3VZOA 1X50A 1ZRCA 4Z82A 1NKGA 4NAMA 1O3TA 1TNRA 4BQWA 1RUH1 4XJAA 4YVWB 2OPWA 1CAWB 4QDRA 2W9XA 5DAPA 1ASJ2 3ZR5A 4A44A 4LHNA 2WQZC 2HYXA 1J3RA 3W9AA 2QKDA 4O9EA 2GC0A 3USSA 1LULA 4W8JA 2ORZA 1IS4A 3BODA 1S0CA 4UI9L 5JIAA 4NHXA 2XLGA 1X9TA 1EYBA 1XRUA 5FPVA 4WM7B 3IPVA 5JZGC 2VOTA 2XXZA 4CTEA 4RR3B 2QBXA 1HLCA 3N9OA 4AEDC 2R49A 1CJDA 5FOJB 3SH4A 2N7GA 4YGCA 4OI0A 1UX6A 3JZVA 2IZWA 1H30A 2WQ8A 2YFUA 3VD5A 1XNTA 3FLPA 3SLIA 2DCJA 3AXEA 3AYDA 1UMIA 1ZBA1 4CEYC 5I0DA 2LRPA 4YLZA 4WVMA 3MFAA 3R4DB 4UF0B 1O8SA 4M3CF 2BQPA 3CJIA 1EAH1 1YXWA 5HXMA 4QWNA 5CU1A 1OVPA 1POV0 3DF0A 4N43B 1GR3A 2ES3A 3MDPA 5DAVA 1IG3A 3SQOA 5I0RA 3NO8A 2PA7A 1W8TA 3DECA 3VKOA 2XQXA 4KU8A 3BYWA 2YMZA 4BJ0A 1U5XA 4NOTA 1W8FA 5T5LA 1JYVA 1BHGA 4AE2A 3KWVA 1JOBA 5LATA 3H1YA 5E89A 4Z1VA 1HXS2 3J4UH 2BOIA 3RQ0A 4PIYA 5HBAA 4P00B 5FYMA 1FOD3 1ZVFA 2HWF2 5FYTA 4S2FA 5FO9B 1RUC2 3JBG1 3BCWA 1GYKA 4OLLA 3VHNA 3B94A 1UOBA 4XMAA 5C3OA 3HVDA 1PNFA 5IAXA 1AXYA 2J1EA 1MVEA 1X8EA 4TTGA 5DZFA 3MHZA 3T30A 5LK5A 1NOVA 3T1MA 2AREA 2O8OA 4ISRA 3O12A 4FVVA 2BNNA 3W59A 4A41A 4CDWA 3LA3A 3K48A 3B7MA 4N9HA 2A6ZA 1V6LA 2DCYA 3WF2A 3ZSJA 4YARA 1ENXA 4LOSA 1VAVA 1K5MA 4P9JA 1GP6A 3WQBA 2JKXA 4E27A 3WG3A 2AEZA 3MO4A 2VU9A 3R0RA 4DEVA 4LIVA 2DUPA 1JW6A 3B00A 4HBNA 1ULPA 4FOWA 3U1XA 3WG2A 4RYDA 1FMD3 2R7EB 5SV5A 4M3CB 2OYZA 4KGQA 1LOAA 4BQYA 3THDA 2VMIA 5F3IA 3DV8A 4MGYE 4GJZA 1ALYA 3MZHA 3SH5A 2R072 2D98A 3I2FA 1PMJX 4A3ZA 1AYN2 1C1FA 3B5LB 4Q4Y3 4DB5A 1W90A 2WZPP 5LRSA 4B7KA 5KHKA 3ACHA 4UYBA 4YW5A 3ZYRA 3FC0A 2O8QA 2E32A 4KWLA 4BQXA 1ODMA 4M3CA 1VBC1 1UY3A 5FMDA 1B09A 1HRV3 3MI8A 4BOWA 4L92A 2GU9A 1WW7A 4XFFA 3I49A 1XE8A 4GA9A 5GKAC 1VAMA 1I9RA 4AGGA 2NN8A 3Q8BA 4FTEA 1VBD1 5AVPA 1AZDA 3AMPA 1AL23 4RS5B 2GAUA 4Z07A 3S7EA 1PO23 1PHMA 3S0MA 2BDRA 2G9ZA 1Q5OA 4YVWA 5LA1A 4D3WA 3HN3A 3VKFC 1UXXX 4FBFA 4N7UA 3D0SA 1CAVB 2J22A 5FY0A 5FYVA 4HVRA 2OKXA 1H6YA 1QOOA 3BGAA 1DYOA 2W92A 2ZGQA 4KWJA 1IHMA 1HB2A 4K6BA 2OIIA 5L9RA 4XIKA 1UPSA 5GZEA 3VHPA 4IEZA 4JHTA 4AVTA 1ND2B 1AR93 1Z7S3 2XGXA 3A4UA 4QHBA 3VDAA 5IVYA 1RVF2 1SQ4A 4LBLA 4E8DA 5IW0A 3LGRA 3G6JB 1HQNA 4PI2A 5FK7A 3W20A 5JI7A 3HT2A 2Q5TA 3KB5A 3BN6A 1OLRA 4CEYB 4FPEA 4QKNA 3T09A 1R092 2W5FA 4I3PA 4I09A 4XTPA 1XC6A 2CY6A 2XOMA 3BPSA 4LE4A 2ID4A 5KC5A 1G8WA 1J59A 4XBLA 2HH9A 2HWD3 2WBKA 3UKVA 1NCQA 5A3PA 1AF9A 3JUUA 2PHXA 3LDBA 3M7AA 5F5CA 2YC0A 3I2GA 3KV9A 3MUY1 2JG8A 1FOD1 3NVCA 4QQLA 3VZJA 5B4XA 3HOBA 4DOUA 1QKQA 5FY5A 2DUOA 3OOXA 1F5JA 4G4FA 2RS52 3KHCA 4CCLA 3WF4A 1WWYA 1GWLA 2QVSB 1WZXA 2GMMA 1XBFA 1PO22 2BW8A 2EXHA 2W08A 3B9CA 3OGVA 5DN2A 3WOGA 1VPHA 2Z5WA 3NW4A 3HIFA 1ZZ7A 3DXTA 2R16A 4Z92B 3ZXAC 1H9PA 3M3OA 5LBBA 2ZX0A 4MSVA 4BH9A 4GKYA 3U14A 4URAA 4HVOA 3ATGA 3L2YA 2RR12 3H50A 2R041 1HRV2 1UU6A 2ZGMA 3VBFB 4ATEA 1J3QA 4XFIA 2HWE1 2VBBA 1QWRA 1B35A 3VLBB 2WT2A 2VOVA 4I0AA 1V9U1 4UW6A 1C8NA 4XUQA 3USUB 5CG9A 5K0UA 1T6BX 5FYCA 2ET7A 4HKWA 3ZFEB 3I59B 4RHV1 5JR7B 4MO3M 4GH4C 1LR5A 4QPGC 3FUOA 4L99A 5IYYA 1B35B 2IXJA 4CDQC 2WZR1 1PNGA 4FAGA 2WR9A 4U36A 1HQLA 3AP6A 5ANNA 4RFT0 1LOFA 5FMBA 2PHDA 1WBLA 3JU9A 2VW1A 2VUDA 1URXA 1W6OA 2ZMNA 4QAWA 3RFRA 3AM2A 5LBCA 1RUI1 4JTOA 2XJSA 1HXS1 1W6NA 3J8F3 5AFBA 1QNWA 1YQCA 2EAKA 2Y33A 1VRH3 4B4QA 3VD9A 3BKZA 1WGPA 3IDAA 4QU2A 4H14A 4X6QB 5FZMA 4FQ4A 4MVTA 4BXFA 3BUCA 3ZXFA 4DUVA 2OZJA 4LUKA 1MPXA 3E1F1 4I0WB 1SLLA 2V73A 3CNAA 3ELNA 3H1WA 5C4WB 4XAAA 3UETA 2C9AA 3T1LA 4DRRA 1BMV1 4BQ2A 2W47A 5DABA 1OLME 1PIV1 1R093 3VKMA 3WR0A 3VL9A 3KZ4C 4QGNA 3N9QA 5FLJA 1PO11 2B4KA 4WM7C 5ABJC 3FWEA 5GALA 2XMLA 4B8EA 4AEMA 4IGOA 3GHNA 5FP8A 1W3VA 4FPYA 1HJFA 3MIFA 1TMF3 3OUHA 4K40A 3WG1A 5CFDC 2VVEA 3EMRA 5FYSA 1F5FA 2ZABA 3DEMA 3WDTA 4HT1T 2FCUA 3DUIA 4W6WA 3SC7X 3TN92 4QM8A 4AZZA 3LFIA 3IIAA 4AFAA 1VBB3 3U07A 2UURA 3LF7A 3MIHA 1XXNA 3ALQA 1WCDJ 3MW2A 4FPCA 5L73A 2VQ0A 5CBLA 2YYOA 1HIXA 5FXVA 2EXIA 4ASKA 3RZGA 3UJOA 5DAQA 2HWD1 1KXGA 1RUF3 5JCTA 3TEWA 3WDXA 2HKXA 1AUYA 1V6IA 1QXPA 2WAOA 2VOXA 1FV2A 2ZGOA 3IMMA 3I3EA 3MUZ1 4MZUA 4ORFA 1KJRA 2WS93 4DXRA 3ETQA 1QNYA 4TN7A 3TEYA 1E5RA 4IL7A 5F6LB 1NA1B 1QJEA 4MLOA 1U12A 3EBRA 3DXUA 4XF3A 5FP9A 3VBSA 2ARCA 3FJSA 3POIA 1W2AX 1N3PA 4XJUA 2VULA 2Y0IA 2Y6GA 2J1UA 1R1A2 3S6PA 4CCKA 4OUMA 3VHRA 5FDBA 1ZNPA 5FO8B 4TLFA 2HWB3 1G9BA 2X10A 1NLQA 5FYHA 4P9IA 3VZNA 5JXJA 2XVLA 4IXLA 3IMNA 3NKTA 3VZLA 2XLAA 3CDZB 3EYPA 1HKDA 3WP6A 3WDVA 4BPZA 3O1UA 2RV9A 1W06A 3N7KA 3ZLIA 3CZJA 3AVSA 2MEV3 2FZ1A 2VZOA 3GZAA 2GMPA 1GSLA 2ADEA 5ISLA 3OUJA 5FZ0A 2PMWB 5J98B 4LR4A 4NR1A 3AFGA 3HPNA 5H9RA 2A7AA 2Y26A 2PHFA 2XLFA 2QNKA 4AR2A 1HW5A 1OXCA 1MZEA 4FT8A 1JYCA 2ZGRA 1MZ6A 4LHSA 3VBHB 2PQSA 4HPKA 2CWSA 4ZS3A 2NM1A 4D94A 1VBB2 2KXLA 4HZFA 3JD73 2A71A 5KHJA 4XJZA 1O3SA 1N1YA 1VMHA 4AW7A 2R1BA 4PIZA 4B7EA 1W9YA 1PGW2 2QUOA 1PVC3 4BA6A 3C8XA 4CDWB 3S5AA 2PLV3 5JAXA 3MF6A 3ZPOA 1RUF2 2ZX1A 3F95A 5GZFA 5DG1A 2BWAA 4PJYA 2ZPXA 2K46A 2VAUA 3LA7A 2Y60A 2LS6A 4MXVA 4HK9A 2Z42A 4CP2A 4N90A 4OQ8A 5G05L 1E5IA 1SBFA 2VZVA 3IDCB 1OT5A 2J42A 4D8MA 5A32B 3VD3A 1R091 5D8AB 1GUIA 4NWWA 1YO8A 4P5YA 1ZX5A 1VBA1 4DXTA 4IE5A 1S1AA 3UJQA 2AYHA 5C7GA 3V0AA 3OTFA 2WNEA 2LROA 3I8TA 2YDEA 1W3XA 1NXMA 2WFPA 3KD4A 2QCSB 1XNKA 5FUNA 4YPJA 2VZPA 1SHWB 2HWE2 4XE9A 5EJZB 2FMYA 1RUD2 2PHRA 4UFHA 1W03A 5FZHA 3ROUA 2QQPA 3DKQA 1DGLA 3N7MA 2EIBA 1Q43A 1AR71 2HWD2 2JE7A 3FN9A 5I0TA 1GZ9A 3WP3A 4ES8A 4YZ2A 3IBMA 4Y4YA 2KM2A 5JPNB 2WJSA 2XDVA 1XSRA 4JCKA 3WF3A 1RJ8A 5FCCA 3ZFFC 2EXKA 2RS31 3EQEA 3FLTA 4EZHA 4TWTA 4LA2A 1PZ8A 3SEEA 3AYAA 3VBRB 1JYWA 1UW8A 2BERA 4UFIA 5F5AA 5IVJA 5CISA 1DGRN 4PLMA 1UN1A 4K8RB 3CJIC 1PVC2 2EVXA 4D0QA 2QQKA 1WW6A 2WO3A 3QBQA 4MHUA 2YUEA 5HV4A 3ACIA 4TXWA 2VZTA 4Y33A 5BPXA 4CCCA 5BNPB 2Q1ZB 1SLIA 3LKJA 1X7NA 1VMJA 5F5IA 3VBRC 1D4M1 1HX6A 1R64A 1W6OB 4BQ1A 1C5HA 2L9LA 5BNNC 5C3SA 1YRZA 3ORJA 2G1MA 3ACGA 1A78A 3ZPYA 4Y4RA 1HJGA 3P3NA 1CAXA 1KEXA 5FPXA 2VNGA 3GBFA 3NV4A 2I74A 4QX2A 1RVF1 5C8CA 2TEPA 3K46A 1DF0A 3WDYA 4CUCA 1COV1 1RUJ1 3SKVA 3WZ1A 3OSDA 2VPVA 2WO1A 3QH7A 3SISA 4CDXC 5DUVA 1WMDA 1DZQA 2HEYF 5FZEA 4YW2A 4AAPA 4L9BA 2EIGA 4RQPA 1SZBA 3B3QE 4XJ9A 4CU7A 4K8FA 5DDJ1 5K0UC 4OMDA 1DQ2A 5AVAA 5ERLA 1YYNA 1IQDC 2ET1A 3HNBM 4KBZA 3KVBA 1B35C 4CDQB 2WNVB 4M3CE 5FQ0A 2PHLA 2ZMLA 3VDDA 1BBT1 4OUEA 5FZOA 4LBMA 2A3XA 3A7QA 1RUG1 2JE8A 4NAOA 5ACA1 2B5HA 3LSDA 3TNPB 1UU5A 2VCBA 4IE7A 2BYVE 1DCSA 1BVP1 4YZ4A 4YVWC 1I1EA 4CZSA 2ZMKA 1V70A 4ZONA 1W99A 4Y20A 2FDHA 1XYPA 2WFF2 4LBNA 5DMYA 3HQXA 3IB3A 2R32A 2Z4FA 3IAQA 2Q8CA 3WHUA 2XJVA 5D1IA 1HV0A 4MGZE 1W9FA 2ARBA 3N7JA 4DUXA 1MEC1 1IS5A 2RVAA 4CU9A 3CO2A 3M1HA 5FQ0B 1H8TC 4HETA 5C4WC 4KU7A 4NHMA 3I2OA 2ZEWA 1PMIA 5FO7B 2W1SA 4LBJA 2GH2A 1JXNA 2JDPA 3UKNA 3N9NA 1J84A 1YIPA 1XB9A 1A3KA 3E6BA 1AX0A 2OT7A 2WFF1 4QU1A 1SFYA 5FP7A 5HPOA 2W39A 4LO6B 3BTAA 5SV8A 3I3BA 2WIIB 2J1RA 4QHZA 5DPNA 4CDUB 2E7TA 3FBYA 3B02A 3VBUB 4AF9A 3H3UA 1BYHA 1N3OA 4QQHA 2WQ4A 2ZEYA 3RVHA 1RITA 4UFMA 1ZBA3 4L8QA 4NRMA 1VE0A 3VGIA 4XUOA 5FOBB 2VCMA 2WA3A 2DFBA 1RC6A 1NXD1 1EY2A 1WLDA 3VDCA 1WKYA 4ZKTB 1XNDA 2P3JA 3X29B 1QJX2 4XILA 1Q8QA 1DQ4A 3GGLA 4CDUC 1BK1A 3PMEA 3Q8EA 4QHOA 4XXPA 5C8CC 3GCXA 1QQP3 3CHXA 3D8CA 4AVBA 5HI0A 3RGBA 5IK5A 2ERFA 2ZA9A 2NYYA 1J3PA 1FI2A 1V6KA 1AXKA 4HANA 1PM4A 5AC93 4D7YA 2BWCA 1JYNA 2ZOEB 1OKQA 2EXJA 2P4EA 1IGOA 4QB6A 4AVVA 2FZ2A 1Q3EA 4XF0A 2ZX4A 1R082 3GALA 2BP6A 3HJRA 4IEYA 4Q27A 3WV6A 1RUG2 1DP0A 3VBOA 3ZOIA 4AFDA 3FX3A 3OGJA 1LOGA 2XJUA 1LHNA 4URTA 2VMCA 3ES1A 3UGGA 5KHGA 3M4FA 3LWCA 4K1ZA 1S4CA 1ND3A 3S7IA 4D6SA 2YPJA 1WCKA 4UFKA 3WNMA 4FAHA 2JD4A 3WCSA 4H7MA 3POGA 1BQPA 3CEWA 2CGNA 2C1FA 4Q0UA 3DYOA 3Q8CA 4COYA 1BCXA 3N36A 1OC1A 3D6EA 1W9SA 3QOPA 4M0NA 2XBO2 3LOIA 4IETA 4CDQA 5I8YA 5KXBA 1Z78A 2V5DA 3B9IA 2VZ3A 4CEYA 4BXSV 4FPOB 4LBQB 2R042 3SXWA 4FSJA 3S30A 2V5YA 3VD4A 5FIXA 1N1SA 3KF3A 4AG4A 1OH3A 4QPGB 3FMGA 4CVUA 3W5MA 4XYXA 1W6QA 3OEBA 5C6CA 4CE8A 5FPZA 4CEWB 2QQMA 1QMJA 3I3DA 1BMV2 4BQ5A 1D0HA 1WLTA 4UAPA 3RYKA 3OBAA 1YUDA 2FDJA 3USUA 5LBEA 4F3JA 4LO5B 5KBFA 4XFHA 5IK8A 1XE0A 3QACA 3O0XA 3U4XA 5GZDA 3RRDA 5C9AA 2QQJA 4Y1XA 1XQNA 4KQ7A 1POV3 4FPJA 3ZDSA 4E4HA 4YFZA 2J1TA 4OQ9A 3K3NA 4CCJA 1FYUA 2KD7A 3JB4C 5ACA2 1Q8VA 4C0HA 4BDVB 2YHJA 1NY72 2XBO3 4S2DA 4AFMA 2ZHNA 2GSYA 1QH7A 1LAJA 1YCIA 1WW4A 4LO4B 1H9WA 1FT9A 2H0VA 1YJKA 5A6XA 4PQQA 1VB2A 4BU2A 1NAEA 5HCAA 3C7GA 4M4RA 1QH6A 3BOWA 4BLJA 3EJKA 3KCCA 3O0VA 1HN0A 3AYEA 1AYN3 1Y9QA 4Z2AA 1W2TA 2RDNA 1TME3 4WM8C 5FY4A 4NIAA 1G9FA 1V6OA 1ENSA 1BEV3 1GP4A 1O91A 2RR11 2YBKA 3AZZA 4P02B 4UOJA 5KHHA 5FK8A 1D2QA 2HWC1 4AEJA 5KHIA 4BYYA 1D7PM 2AZ5A 1QJX1 3ENRA 3H9AA 1H2NA 4AI0A 1XYOA 2H6CA 1AJOA 1BBT2 1IKPA 2W3JA 2PTMA 3BPZA 4C0BA 4IV1A 3IDBB 2YGMA 1D0GA 1VR3A 1ZRDA 2IXCA 3M3EA 5FWJA 4ZPIA 4CPBA 1K45A 3O14A 1ZZ6A 1N1TA 4GKXA 4R9DA 1I6XA 2A70A 1UY2A 1W8ZA 2ZGSA 4AAXA 2VCCA 3ES4A 4IV3B 1VIWB 4W50A 2Q8DA 1LHWA 1V6MA 2XKOA 3WW1A 5HCFA 3WNPA 1YWKA 4N53C 3K4DA 1X9PA 4LITA 5BNQA 4N9IA 3ZYJB 4QPWA 1H6XA 4FPLA 3MPPG 2DU1A 4XCAA 2UWCA 1PO13 1W6QB 4CP0A 4YGDA 1AR61 1BKZA 4IV1B 2NPIA 1XPWA 1UY0A 2Y6FA 1ZRRA 4KI5M 3T0AA 4SLIA 1BEV2 1ULCA 3QCWA 2YBSA 4KG0A 3PJQA 3CL1A 3ZYPA 4YFWA 4QB1A 5H9QA 4UFLA 4YM3A 3IN9A 1PX4A 3ZYIB 5L19A 5CEHA 3VBHA 2XB6C 2ZX2A 3VDDC 4A7KA 3D5OA 2V4VA 2OUHA 4XFCA 5E88A 2NMNA 1JZ5A 5BNOB 1ASJ3 2VZ1A 1NT0A 5F37A 4FP2A 1H8VA 2X05A 5A1LA 3NNJA 2E31A 4IESA 1CZVA 3POJA 3T08A 3ZIXA 5LEJA 2X29A 3POFA 5F3GA 3EO6A 2R0FA 4NIIA 5FLIA 4JKKA 3GJBA 5GZGA 3VBOB 4RQPC 2RS13 4XFBA 4YM0A 4Y5Z0 1WLCA 3DGTA 3PU3A 3B93A 2JICA 4Q26A 3H42B 5A3WA 4HSLA 4CDWC 5LB6A 1C8M1 1RINA 1HXS3 3J8F1 1J83A 5GLTA 4Q29A 1RXFA 2F4PA 3POYA 3WSOA 3ZMOA 1JYIA 2QQNA 2DTYA 3AKRA 5EZWA 5ABJB 4NUBA 5LEKA 3T2QA 4FPHA 1XYNA 3M3CA 5FKCA 2QZ2A 5DUWA 1QXJA 3HAGA 5EJ1B 3AKTA 4MGSA 1GU3A 2RS53 2VD7A 2W0XA 3H7YA 3PIJA 4P9LA 4XPVA 2VOWA 5CFCA 1NCRA 2DBNA 1LOFC 2R073 5A7WB 2JG9C 1W8HA 4AQSA 5JPMB 2WO7A 4AFBA 1HRI1 1HB4A 4MUVA 3SH3A 5JLVA 3BU7A 1U5IA 4QPGA 2WL1A 4AHZA 1ND3C 1R083 1Z0HA 2Z2SB 3C7EA 4XUTA 1W2UA 4D7SA 5C8WA 5C33A 2JDAA 4C1WA 5JZGB 1AR91 2JEMA 1H4HA 1DFQA 1Z7S1 3A0NA 5FZFA 1LU1A 1W9TA 4HKOA 3RYRA 1PK6B 5K7PA 2BV4A 1K5JA 2GP5A 4AOCA 3AKPA 2P5BA 1PO12 1ZYBA 2A6WA 4WM8B 4QDQA 4FFFA 2YC2A 3POWA 3TEXA 4UF0A 3DCQA 2JWPA 3ITQA 3V0BA 4XFGA 3ZN6A 1NZIA 3DN7A 3TRSB 3J26N 2AUYA 2RDQA 5FY1A 3J7HA 3SKJE 2GP3A 4EN0A 1DYKA 3KCYA 4N43C 2HWF1 4YYOA 5DZGA 2YGLA 4NN0A 3MFCA 5K8SA 1JHJA 3MPBA 3NSTA 1OFNA 4FO9A 4AI8A 4BMBA 3ACFA 1ULGA 1FMD2 2ZGLA 4H7LA 4Y1YA 4ZZ8A 4GIQA 5JIUA 3SCFA 3U78A 4DFSA 4HL0A 4FPKA 1PZ7A 3AMQA 4EWAA 5HCBA 3K3OA 4HG6B 5G04L 3QD6A 1SEFA 1SCRA 4IV3C 5T3NA 1VALA 1ZZCA 2W87A 5JOZA 4QQPA 4E9KA 1NLSA 2IUWA 4ZU7A 3WP4A 1LHUA 3M3IA 2NLRA 3N9LA 1GOGA 4JGZC 4JRAA 4FPFA 2R062 3L9JT 4WVZA 4DXSA 5FY9A 3AFKA 1UPIA 1JOJA 3W21A 3H7JA 1SLTA 2C26A 3NNGA 4JGYA 4GWJA 4Q2FA 1FNYA 3ON7A 4Y22B 1LJ7A 2P17A 4MX3A 1FNZA 3ZFGA 4BE3A 1OH4A 3PUAA 4H55A 3MICA 3PIGA 1PGSA 1UKRA 1QDCA 4YRDA 1JI6A 3RG0A 3I59A 2MHFA 2HEWF 1N47A 1IOAA 3AP9A 3OY8A 4PF1A 1OVSA 4LHLA 3F2ZA 1XSQA 3VV1A 4ARYA 2UY9A 1COV2 3ZFGB 5DQ0A 3ZSMA 1MQTB 4NE9A 1S2KA 5I0UA 1QJY1 1WCSA 3JD71 2GALA 3BTZA 1RMU2 1ZZ8A 4XF9A 2FCVA 1C8M3 3CF6E 1QOTA 3OBZA 5DAXA 4Y5TA 5H9PA 2JG9A 4W4ZA 1BK0A 2W1UA 4RS5A 3RI8A 1T2XA 1R1A3 4EWDA 3O1SA 2OS2A 1RHI2 3RDIA 2E7QA 5FJKA 4DNYA 2X09A 2VTFA 5JSOA 3D3AA 1RUI2 4GH4B 5FUIA 4LT5A 5FZDA 3ZN4A 5HXVA 3BTYA 3KQ4B 1M06G 4COUA 4R8HA 2F17A 4Q1RA 1OPOA 4C8DA 2DFCA 2WS92 4EQVA 3ILNA 3BOPA 1O5UA 1AJKA 2JIJA 4XQDA 4F7ZA 1SDWA 1NCQB 1C4RA 3ZYGA 2VZUA 4CU6A 1TME2 4XDOA 3V0BB 2JDZA 1BZWA 2B7YA 1DGWX 2ZAAA 2ZS6B 2BFUL 3HBZA 5BNOA 2VC9A 3POEA 2VXJA 3AVRA 1PZ9A 2JDHA 3V65A 2A3WA 4COZA 1LGNA 1O3QA 1W0NA 1DQ0A 3C7HA 1IQAA 2Y34A 3R4SA 5T54A 2NZ9A 1Y9GA 3GM8A 2VTXJ 1UZ0A 5KWRA 3T2PA 3AZXA 3R6SA 1S0GA 3AXDA 4IQPA 4WZCA 2MEV2 1JZ6A 3WY6A 4B4RA 1AR81 1W6MA 4UW4A 2DVFA 1CAUA 2GC1A 1Y9MA 4Q4Y1 4IEVA 1RUE3 5F3EA 1KJLA 4GMP1 3WVJA 5A32A 3PUSA 2FDGA 5FZ1A 1GWKA 1C5IA 3NJZA 1IZ3A 3S57A 1UXZA 1WD3A 1NYWA 1WMFA 1FPN1 3KV4A 3ZSLA 1OQEA 3PUIA 2RMU3 3PNAA 2QZ3A 2FMDA 4NHLA 4QPIC 4YW4A 1OD3A 2X5IB 3RNSA 3WNKA 3ABZA 2VXRA 2XJRA 2XVGA 3Q8FA 1NCRC 5A3UA 1OSGA 2WYFA 3MLLA 1HB1A 4AL9A 1W28A 2BRTA 2P34A 4MXWA 5LA2A 1KS5A 3CLPA 2E26A 3LB9A 2EICA 2UYAA 1RUI3 3TN93 2CDPA 1EV13 2VVDA 1EP0A 1GZWB 3T4VA 4K9SA 4QKDA 2W95A 3EHKA 1M4WA 3NJYA 4FPGA 2R0HA 4OUSA 4XMIA 5CKMA 4CDXB 2CNAA 1LB2A 2WAAA 4P5HA 3CJIB 1UZVA 1KGYA 2DVDA 4ASLA 3LDKA 5LA0A 1RUJ3 2HWC2 2XH6A 4LMFA 1PVXA 4CCDA 4YZ5A 3MV11 4RGKA 5L7OC 3ILFA 3FE5A 1NQJA 2MEV1 5A3MA 1CPMA 3DYMA 5EXOA 1ULOA 5BNOC 5BNNB 3E6CC 2XWJB 3FUQA 5DXDA 1RUD1 2P1BA 1DYPA 1LNSA 2DCZA 4HKLA 4GH4A 2IXKA 1BVVA 3ASIA 5CADA 2JX9A 3THPA 4H2AA 2J1SA 4XF1A 1YQ6A 3PVBB 1W8WA 5FBJA 5IVBA 1LEMA 1EAH2 4LKFA 1SBEA 5A7NA 4AQTA 5JSPA 4PDWC 1W6PA 2LM3A 3NV3A 2VL4A 1MS3A 2OW4A 4JRLA 5IVFA 3BVCA 5C3PA 4CXYA 5D21A 2UU8A 4LK6A 4YGEA 2VMHA 1MQTA 1GLHA 2VM9A 4KNCA 4D7TA 2R1DA 2VNRA 2W2IA 1C57A 2ZZJA 4GWIA 1UY1A 4ITCA 4JAAA 4JGYC 1YJLA 4FTBA 3HT1A 5FFOC 4ZS2A 1RUF1 3D0JA 4JZRA 1JHNA 4IGPA 2DU0A 4QX5A 1DDLA 3NMBA 3VBSC 1LKNA 4INDA 4OZOA 1IPKA 4XCBA 1RXGA 2E6VA 2BOJA 3C3VA 4D6QA 1VAKA 2CGOA 4I30A 1RUH2 1KQRA 3KF5A 4JGYB 4LBQA 4AK3A 3OPTA 1NCQC 3FZ3A 1R1ZA 2RJLA 1ND2C 2BEOA 4Q1PA 3LEIA 2PELA 1D4M2 4XJ8A 2WFF3 3IWZA 2FQPA 2TUNA 2DUQA 4AHXA 1QJU1 1WLWA 2D6LX 2YV8A 2YZ4A 4CA9A 3PLQA 5FTTC 3PVOA 4P9YA 5JMCA 1CWPA 5LA9A 3AC0A 1ND3B 5IVCA 2OXBA 5F32A 1H8TA 5FREA 1XOYA 2R30A 2LTNA 4OI2A 4RL7A 4XDQA 3R4UA 4Q4V1 4OZXA 1E5SA 5F2WA 3RJRA 2B9UA 3JQWA 3LCPA 4O65A 4XFAA 2RDRA 1OA3A 4EN8B 3FL7A 3NAPB 3KT1A 2MNGA 2AGSA 3LDRA 2ZGNA 2JB4A 5T5OA 3H1MA 4CDXA 2HBUA 1F4HA 4H3WA 4FI9A 2Y8KA 4UFJA 3ZN6B 1JTZX 1DGWA 2XVKA 1EAH3 4DPNA 4WZFA 3VHOA 2VG9A 5CA6A 4RFRB 1U5ZA 2ZACA 1KITA 2C24A 1AR82 3C7FA 1GQGA 2FCTA 4A7YA 4OHYA 5C9AB 1F4AA 1F15A 1YIFA 4FFIA 5J37A 3A22A 2X5IC 4I3GA 2FDKA 1X8MA 1NE6A 3J8F2 3E5QA 4AEKA 3GCWA 4QXCA 2C5DA 4XOGA 4MGKE 5FXWA 5IVEA 2ZAHA 3THCA 1ENQA 4QM9A 1RTVA 3E5XA 1NA1C 4FQZA 4LE3A 4YGBA 5IT6A 1FX5A 3PURA 5F9TA 4FOYA 1XJAA 4Q0QA 2CGPA 1NCRB 2ETEA 3AZYA 3VBUA 3JXSA 1CN1A 4AQ6A 1ZBA2 5LCWL 1TMF1 4KWKA 1OPMA 1RUH3 4Y22A 4ZHNA 2ENRA 5A1AA 2Q8EA 5L9VA 4E4SA 1UAIA 2G9FA 2LUWA 3VL8A 4R4XA 5JMOA 3KS7A 1U0AA 4P9XA 1J1TA 2HBTA 4QXKA 2OPKA 1MACA 3WNNA 1PX3A 1S0IA 3OBRA 3NNFA 1C3HA 1X36A 1DIWA 2W1QA 2VO5A 2YC4A 3O1TA 2GC3A 3Q9OA 1JU3A 3SITA 1PM7A 3VBOC 3GDBA 1PGW1 3O0WA 2Y6JA 4MGIE 4C90A 1L7QA 3ZXGA 3CJXA 2NMOA 2CSGA 2LW8A 3SEPA 4MHRA 5IVVA 1RIRA 3N35A 1AL22 4GQ7A 3I2JA 2ZHKA 1W8UA 3OUIA 4EV0A 4CXWA 4HVQA 4B4PA 4RS5C 4XZPA 4LOTA 3LSEA 4CCMA 4ASMB 4CP9A 4KH9A 4XDPA 5JDBA 3DPRC 1WW5A 4XUNA 2PYTA 3A23A 2XJTA 2WYSA 1QQP2 2PAEA 5EWSA 4LEJA 3RI9A 1OF4A 3DKWA 2VQTA 2A6VA 4PDWB 5DUXA 2H0BA 4BK4A 3AZWA 5FR3A 5FP4A 3ZXLA 2Y6LA 4XQWA 2D6MA 3WW4A 1A8MA 2BJSA 2KA3A 4JV4A 3BU0A 4JX0A 2D44A 1K12A 4Q4W2 3HWJA 2RMU2 4N53A 4BIOA 5C5TA 3CKHA 2W91A 4JDNA 1QHDA 4R9BA 3LIHA 1PMHX 1J1LA 4XUPA 3WHTA 1H4GA 2F6BA 2NQYA 2R043 5FRAA 1MEC2 3N9MA 5LY1A 1HN1A 3U37A 2ZHMA 1RUOA 3JBG3 1QJU3 2R061 5JVVA 3B01A 2WN3A 3K77A 5CZKA 1CESA 2DVAA 2BGOA 2QDNA 4AWDA 2VTXA 1MS9A 2C6SA 2DTWA 1YQ8A 3AKSA 4G3YC 5FPLA 4DZGA 2B42B 1O3RA 3K75B 4XEZA 1CD3G 3H3ZA 4Y26A 2V72A 3T2TA 3L2HA 1MS8A 4O61A 1QIQA 1H1AA 1UMHA 1US3A 3CU7A 3PL0A 1YC61 2JG8C 2CDOA 3J7LA 4BIFA 4DY5A 4BWOA 3GZTB 5HCHA 2UYBA 4AGVA 2BBVA 4Q4W1 5FJHA 3FFZA 3NJXA 3A21A 3MIBA 4Q0SA 4Q4V2 4A45A 3GJAA 4EE2A 1GOHA 4V2VA 1AR92 1Z7S2 2A3YA 2WSUA 4NRQA 5BNNA 1SPPB 1UO9A 1XU2A 4W6XA 5J48A 1UZZA 1F31A 3VKLA 3WLUA 1FPN2 2FD8A 4Y1UA 4IGQA 4JHZA 4E2QA 4QKBA 1Y7BA 3RS6A 4MH0E 1CONA 1PIV2 2OQ7A 5C71A 5C9AC 3H8UA 3ZYHA 5FZ6A 4XZUG 4IE6A 4EN7B 2BNMA 1GP5A 2EAAA 2YBPA 3DPRA 1LRHA 4YW1A 2RM23 2GNDA 2ATFA 1AR72 2PXJA 2BBAA 3SNMA 4FCAA 2PLV2 5GJ6A 3KM5A 2Q1FA 4LO7A 1OOPB 1REEA 3WINE 2WWUA 2FDFA 2BZDA 3TB0A 3ZN5A 1N1VA 1SLBA 3JB8A 3HMYA 3K2OA 4Q8LA 3MLKA 4OHVA 1W39A 5IK7A 4DO0A 5KR7A 2Y38A 4YG6A 4AQ2A 2DDUA 1OF3A 4JGZA 4YW3A 3A0KA 1KFUL 2CHHA 1QOSA 2P2KA 1F8VA 3WUDA 4IV3A 1MS5A 1I3HA 2D40A 2VNVA 3T3YA 4JDMA 5CB7A 1GMMA 1QDOA 1RUC1 2D3PA 3CQOA 3JBG2 4LBOA 4QPYA 5ABJA 4CEWC 1W6MB 2JDKA 2WS91 1GZCA 5F1RA 5I91A 3VDBA 4JVAA 2HJIA 1VMFA 2WZR3 3VN4A 4FOVA 1OOPA 4GB33 5KXDA 2PN5A 1SDDB 2RJKA 4YM2A 3ZFEC 1VLNA 3LEKA 4KG8A 4IERA 4EN6B 4L11A 4BZ4A 1OUSA 1SFNA 2WUHA 4RSUA 3TNQA 1HRI2 2HWB1 3UT0A 3ZM8A 3HEIA 3VBRA 4LK7A 1AVBA 5FZ7A 4Y24A 4M01A 1J58A 4IUGA 4MOAA 3ZXJA 4NIGA 2WINB 2WSVA 2WC2A 3PTRB 2BU9A 2G4IA 5J7MA 1PK6C 2CWMA 2RE9A 1WA6X 3P3PA 3OGRA 5D2AA 1MS1A 4AHWA 4FOQA 5E16A 4LTAA 4XABA 1LENA 2Q4SA 3VBUC 2QDRA 4WM7A 2GNBA 5FPUA 4FXKB 3I97A 5IJRA 1QJFA 2DCKA 4PCRA 2EIEA 4E4ZA 3POBA 2JG9B 1O59A 2JE9A 3W58A 5CNAA 2D5HA 3VZKA 4BLIA 2V4AA 4OULA 4GB32 5ACA3 4YM1A 1F35A 2AC1A 2X5IA 1BJQA 4I02A 4J1WA 4META 3OPZA 4CCNA 4Q8KA 3VUOA 2ZEXA 1MR5A 3CBNA 1VBB1 5LW9A 1R1A1 1QEXA 1WCUA 1S0EA 3O1OA 4A4AA 5F39A 1XNCA 4IEUA 1AX1A 3CMGA 4BCUA 2JDUA 4Q4X1 3WF1A 3ZIWA 4W65A 5H9SA 1O4ZA 1QJZA 5FZGA 2OA2A 1JUIA 4L2NA 3H8XA 1CGPA 3UV9A 3AYCA 4MG2A 2P3KA 2QQVA 2YB7A 4YWAA 1US2A 1JZ3A 4CEWA 3K51A 1OD5A 4A2UA 4AGRA 3LOBA 3FHQA 3I2KA 4PLNA 2AENA 2ZTNA 5K4LA 1LGCA 4LQRA 2XHKA 3WT3A 1UNBA 3KQRA 1F2NA 1ULFA 3B69A 2FBEA 4N53B 3ZMNA 3AL6A 1JUHA 1VB4A 4AI2A 5BUVA 1RJ7A 4D69A 1ZA7A 1V6NA 2P6HA 1C28A 3PDQA 4N43A 2WRAA 1VP6A 4HFSA 4OHXA 1REFA 1UZWA 2W46A 4GULA 1KRIA 1QU0A 1Y43B 1YFWA 1FOD2 1ZBE2 3OGSA 2WNVC 3GHMA 2HEVF 2VUAA 2W1WA 1RGSA 3MW3A 4JDOA 4ZXEA 3NJVA 2JKBA 3M2MA 4IEOA 1O4YA 4IEWA 5A3TA 1REDA 4P14A 1V00A 4ONUA 3UGHA 4AI1A 4CYDA 2QTWB 2VOKA 2QQIA 1NUKA 3PHMA 2XJQA 4UT5A 2H6BA 1AYN1 3NNMA 3VBFC 2ZKNA 3LEGA 4J1XA 3PMSA 3VD7A 5FYZA 3AP7A 3VDDB 3OGGA 4SBVA 4V2WA 1ZZ9A 2B46X 1XNAA 2R6QA 2VBPA 2VMGA 4UWDA 1I5ZA 1PK6A 1QJX3 4GB31 3IZOA 4N8MA 3D4KA 5EHDA 4AVAA 2EIDA 5D8AC 1O8PA 1PVC1 3RJ2X 3WQ7A 2VGDA 5CKNA 2K9ZA 3LQCA 2K0GA 2QE3A 4ATFA 3OEAA 2VJXA 2J1VA 1ULEA 4JC1A 2IVIB 4V1PA 4B1MA 1LODA 1GNZA 1JU4A 3PVNA 4OHWA 5APAA 1YI9A 3AKQA 3LAGA 4LBQD 3KSCA 4F83A 5IHRA 1O4TA 1K5MC 1VBE1 3KT4A 3I7DA 1DG6A 3I4IA 1EUTA 4AEDB 2DBIA 4XW3A 1KS4A 2DF7A 4MADA 1CAXB 1Q8SA 2ARAA 2YPDA 3ILRA 3POSA 4QMAA 4QXHA 5I8SA 4EWEA 3IIIA 5C70A 1R081 2DYCA 3AZVA 4QX8A 5FPAA 3HNYM 5F5QA 5I0SA 4NJ4A 1ENRA 1W0OA 3MW4A 1FMD1 1TNFA 3OD4A 4PHZA 3T2OA 4OYUA 4I01A 1H1IA 2JB8A 5IUQA 4M0HA 1CIWA 3O1PA 5FMCA 3LA2A 1NZCA 2D5FA 3M8LA 4LJHA 1RHI3 4N7IA 3WXPA 1UY4A 1VBA2 2WNUB 4IEPA 4Y20B 4DIQA 1LGBA 3WX5A 1FPN3 1GBGA 2BVVA 2JG8B 3OYWB 4YG0A 1NQDA 1NY71 4XHXA 2RMU1 1BLZA 2Y6KA 4YVSB 1RMU3 4Y1VA 4COWA 4NVPA 5FP3A 5T50A 2IXLA 3OPWA 5A33B 1AX2A 1JODA 5EQUA 4WBBA 5A3LA 1OA2A 1OI6A 1V9U2 3IM0A 4K20A 5JOYA 2WLQA 3WEZA 1MS0A 4GXLA 2G9GA 1RL3A 3T0BA 3UYJA 5LZ6A 4LORA 1TZOA 4DXZA 5JSRA 2PLV1 2VNOA 2D3SA 1NLRA 1UYZA 4XBQA 5F6KA 5LBFA 2VE1A 2F4LA 4XETA 4BQ4A 2YROA 1H2KA 2WKKA 4AEDA 3GZUC 2RS32 3AJYA 1GKBA 5FXZA 1QJY2 2J1AA 1L3JA 5FY8A 2Q8OA 5LRRA 2YU1A 2PFWA 4QGLA 5FKBA 5FZAA 3RMXA 5J09A 3HBKA 4XVHA 3TAYA 2ZGKA 2RS51 3U4SA 2RS12 1JZ7A 3EXUA 1IS6A 2PQQA 1H2MA 2B9VA 4JGZB 3WCRA 4GZ9A 2OUJA 4Q0PA 5A6YA 2UWAA 2ZBJA 1G9DA 3PUQA 2Q0AA 1DU3D 1NX9A 4AFCA 4QQOA 5BNPA 5A1FA 2W68A 3RZHA 2XKPA 1W9WA 4LLFA 3WDUA 5A7SA 5A7OA 5KXEA 2OQ6A 3NRUA 4LBKA 1E5HA 4D6RA 3H8OA 2VMDA 2ZZQA 3MF9A 4LKEA 2C9KA 3W5NA 3V56A 2GZWA 4B29A 1VRBA 4LA3A 3KMHA 1ULDA 1BBT3 1KD7A 1T6GC 1UX7A 4OI4A 2VVFA 3ST7A 5A6ZA 2I45A 1LHVA 3J7NA 1BXHA 1AYM3 3KCXA 5JXIA 3OBTA 3O1MA 2RS33 1DQ5A 2DVGA 3INAA 5EP9A 5EPAA 1SACA 2ZJCA 1VBC3 2VR4A 5FZKA 3FHAA 2HWF3 3O7OA 1W0PA
chains in the Genus database with same CATH topology
5DMYA 3IB3A 2Z4FA 3IAQA 4OZOA 1NKGA 4DUXA 2RVAA 4CU9A 4QDRA 2W9XA 4A44A 2HYXA 2ZEWA 3ECQA 2W1SA 1TG7A 3LEIA 4W8JA 2ORZA 4UI9L 1J84A 4JKMA 5HPOA 2VOTA 5IFPA 3I3BA 2QBXA 2J1RA 5DPNA 3AC0A 2WO2A 4ARXA 2ZEYA 2WQ8A 2YFUA 3VD5A 1XNTA 2DCJA 4XUOA 3T0DA 2HLEA 1UMIA 3FL7A 5I0DA 1F4HA 3VDCA 1O8SA 4FI9A 1WKYA 2Y8KA 5HXMA 2XHNA 3GGLA 1EUUA 1W8NA 3DECA 2XQXA 3C7FA 4BJ0A 4DUWA 4M4PA 4A6OA 1JYVA 1BHGA 1F4AA 3LPGA 1JYNA 3A22A 2C4XA 4P00B 1JZ2A 2QQLA 1UYYA 2WN2A 3WNLA 3HJRA 3THCA 1DP0A 4P08A 2VMCA 2VZQA 2J1EA 4TTGA 3JXSA 3ETPA 5LCWL 4ZY9A 3WNMA 5A1AA 5IFTA 4QX0A 5JMOA 4A41A 3DYOA 1W9SA 3WF2A 3WNNA 1PX3A 2V5DA 2VZ3A 4BXSV 1CIYA 2W1QA 2YC4A 2JKXA 2VO5A 4L0PA 3WQBA 5JXGA 3MO4A 1L7RA 1JU3A 4DEVA 3VD4A 3GDBA 1ULPA 4AG4A 2Y6JA 3OB8A 4RYDA 2R7EB 1L7QA 4CVUA 3W5MA 3OEBA 3THDA 2LW8A 3SEPA 1P8JA 3I2HA 2QQMA 1K42A 3I3DA 3I2FA 1PMJX 3I2JA 4UAPA 3OBAA 3ACHA 4CUBA 2E32A 4LKSA 1UY3A 1I5PA 4XUNA 3A23A 2WYSA 2QQJA 1OF4A 2VQTA 2ZEZA 4BK4A 2J1TA 3I2IA 2Y6LA 2KD7A 4JX0A 2WZ8A 1K12A 4BDVB 3CKHA 2W91A 2VMEA 1PMHX 4XUPA 5LA1A 3LPFA 3HN3A 1UXXX 1HN1A 3U37A 2YG0A 4PQQA 4OMCA 1UYXA 2J22A 1NAEA 2WN3A 3C7GA 3K77A 5CZKA 1UWWA 2OKXA 2BGOA 1H6YA 4M4RA 3BGAA 1DYOA 2W92A 1CZTA 3P6BA 3K75B 4Z2AA 4QDSA 2V72A 4UOJA 4P02B 3VDAA 4E8DA 1D7PM 1UMHA 1US3A 2CDOA 3BN6A 2W3JA 3T09A 2W5FA 1YQ2A 3NJXA 1K45A 1XC6A 2XOMA 3A21A 2ID4A 4A45A 1TVGA 1GOHA 2WBKA 1UY2A 5JXHA 4AAXA 2VCCA 4W50A 2Y6HA 3I2GA 3MUY1 3WNPA 5B4XA 3HOBA 1GOFA 3K4DA 4QPWA 1H6XA 4JHZA 3WF4A 5DN2A 5C71A 3OGVA 1XPWA 1UY0A 4XZUG 4KI5M 3T0AA 2JD9A 2BBAA 4QB1A 1PX4A 1GNYA 2XONA 2BZDA 2V4VA 1JZ5A 2BGPA 5B4NA 2VZ1A 4CUAA 2X05A 4MGQA 2E31A 4XUQA 1CZVA 3T08A 2DDUA 1OF3A 4JKKA 4QX3A 4MO3M 5IYYA 1GMMA 3CQOA 3EB7A 3VDBA 1J83A 4QAWA 1SDDB 3LEKA 3WSOA 2QQNA 3VD9A 3IDAA 4KMQA 5CYYA 2WUHA 3T2QA 3ZM8A 3HEIA 4PT6A 1CX1A 4DUVA 1MPXA 3E1F1 5EJ1B 4MGSA 1GU3A 3UETA 4MOAA 4IUGA 2W47A 3OGRA 2B4KA 5JR2A 3CIHA 3C7EA 4XUTA 2E33A 3I97A 2JDAA 5IJRA 2WDBA 2DCKA 2EIEA 1W9TA 1O59A 3C7OA 3K4AA 4QDQA 2YC2A 3P1IA 2ZEXA 4A4AA 3CMGA 3WF1A 3J7HA 3SKJE 4RN5A 1JHJA 3WF0A 2YB7A 3ACFA 3K4ZA 2WAOA 1US2A 1JZ3A 3MUZ1 4ZZ8A 3I3EA 5JUVA 4DXRA 3FHQA 3I2KA 4ET7A 5G04L 4HG6B 4DEQA 4LQRA 2W87A 3DYPA 4QB6A 1GOGA 1W8OA 4DXSA 2Y6GA 2J1UA 2C26A 3NNGA 4XURA 2X10A 4GWJA 2W46A 5JXJA 3IAPA 4LPLA 1OH4A 4QX1A 3CDZB 3EYPA 4QB2A 3OGSA 2RV9A 1JI6A 3CZJA 2W1WA 4ZXEA 2VZOA 3NJVA 4PF1A 3F2ZA 4ARYA 3HPNA 5DQ0A 5F7UA 2QQIA 1NUKA 3OG2A 4ZZ5A 4LHSA 2PQSA 3LEGA 3VD7A 3UNPA 2ZXQA 1XNAA 4A3ZA 3GXUA 1JZ8A 4W4ZA 2W1UA 1SG3A 1T2XA 3C8XA 2EIDA 1O8PA 2VQUA 4E8CA 2QQOA 2X09A 2VTFA 3LQCA 3D3AA 5FUIA 3OEAA 3LE0A 2VJXA 2J1VA 4JKLA 5J1XA 2LS6A 1JU4A 5G05L 2VZVA 1OT5A 5IHRA 1JYXA 2Y64A 4D8MA 3VD3A 2VZUA 1EUTA 1GUIA 4CU6A 1DLCA 4P5YA 4MADA 4DXTA 1WCQA 2VC9A 5C7GA 3IIIA 5C70A 1W0NA 3NQHA 3C7HA 3HNYM 2RJ2A 4YPJA 2VZPA 1SHWB 2YFZA 5EJZB 3UESA 3GM8A 1UZ0A 3T2PA 3T2OA 4OYUA 2EIBA 2W94A 1JZ6A 3FN9A 3WNOA 1UY4A 3WF3A 3HNMA 1UXZA 5EIYB 2Y6KA 3SEEA 1JYWA 3PUIA 2BERA 1OD3A 3CZUA 3WNKA 3ABZA 2WZEA 3WEZA 2J7MA 4D0QA 2QQKA 3T0BA 2WO3A 5LA2A 3ACIA 2E26A 4KWUA 4TXWA 2VZTA 4A42A 2EICA 2CDPA 1UYZA 1R64A 3MBWA 2W95A 2ORXA 2L9LA 3ACGA 2WAAA 2VMFA 1KEXA 1KGYA 2J1AA 5LA0A 4QX2A 2WABA 3K46A 4CUCA 3MV11 4XVHA 3SKVA 1JZ7A 2WO1A 2B9VA 2VZRA 4GZ9A 3DYMA 1ULOA 1LNSA 1NX9A 4CU7A 3MV01 2J1SA 1W9WA 4OMDA 3NRUA 1CZSA 1IQDC 3HNBM 2VMDA 2C9KA 4CU8A 2VL4A 3W5NA 2VCAA 4OUEA 1GQPA 3A7QA 2JE8A 1UX7A 2VZSA 2VCBA 4BK5A 2VM9A 5JXIA 4GWIA 3PUHA 1UY1A 1K3IA 1W99A 1JZ4A 2VR4A 3FHAA 1RYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DMY A;  3IB3 A;  2Z4F A;  3IAQ A;  4OZO A;  1NKG A;  4DUX A;  2RVA A;  4CU9 A;  4QDR A;  2W9X A;  4A44 A;  2HYX A;  2ZEW A;  3ECQ A;  2W1S A;  1TG7 A;  3LEI A;  4W8J A;  2ORZ A;  4UI9 L;  1J84 A;  4JKM A;  5HPO A;  2VOT A;  5IFP A;  3I3B A;  2QBX A;  2J1R A;  5DPN A;  3AC0 A;  2WO2 A;  4ARX A;  2ZEY A;  2WQ8 A;  2YFU A;  3VD5 A;  1XNT A;  2DCJ A;  4XUO A;  3T0D A;  2HLE A;  1UMI A;  3FL7 A;  5I0D A;  1F4H A;  3VDC A;  1O8S A;  4FI9 A;  1WKY A;  2Y8K A;  5HXM A;  2XHN A;  3GGL A;  1EUU A;  1W8N A;  3DEC A;  2XQX A;  3C7F A;  4BJ0 A;  4DUW A;  4M4P A;  4A6O A;  1JYV A;  1BHG A;  1F4A A;  3LPG A;  1JYN A;  3A22 A;  2C4X A;  4P00 B;  1JZ2 A;  2QQL A;  1UYY A;  2WN2 A;  3WNL A;  3HJR A;  3THC A;  1DP0 A;  4P08 A;  2VMC A;  2VZQ A;  2J1E A;  4TTG A;  3JXS A;  3ETP A;  5LCW L;  4ZY9 A;  3WNM A;  5A1A A;  5IFT A;  4QX0 A;  5JMO A;  4A41 A;  3DYO A;  1W9S A;  3WF2 A;  3WNN A;  1PX3 A;  2V5D A;  2VZ3 A;  4BXS V;  1CIY A;  2W1Q A;  2YC4 A;  2JKX A;  2VO5 A;  4L0P A;  3WQB A;  5JXG A;  3MO4 A;  1L7R A;  1JU3 A;  4DEV A;  3VD4 A;  3GDB A;  1ULP A;  4AG4 A;  2Y6J A;  3OB8 A;  4RYD A;  2R7E B;  1L7Q A;  4CVU A;  3W5M A;  3OEB A;  3THD A;  2LW8 A;  3SEP A;  1P8J A;  3I2H A;  2QQM A;  1K42 A;  3I3D A;  3I2F A;  1PMJ X;  3I2J A;  4UAP A;  3OBA A;  3ACH A;  4CUB A;  2E32 A;  4LKS A;  1UY3 A;  1I5P A;  4XUN A;  3A23 A;  2WYS A;  2QQJ A;  1OF4 A;  2VQT A;  2ZEZ A;  4BK4 A;  2J1T A;  3I2I A;  2Y6L A;  2KD7 A;  4JX0 A;  2WZ8 A;  1K12 A;  4BDV B;  3CKH A;  2W91 A;  2VME A;  1PMH X;  4XUP A;  5LA1 A;  3LPF A;  3HN3 A;  1UXX X;  1HN1 A;  3U37 A;  2YG0 A;  4PQQ A;  4OMC A;  1UYX A;  2J22 A;  1NAE A;  2WN3 A;  3C7G A;  3K77 A;  5CZK A;  1UWW A;  2OKX A;  2BGO A;  1H6Y A;  4M4R A;  3BGA A;  1DYO A;  2W92 A;  1CZT A;  3P6B A;  3K75 B;  4Z2A A;  4QDS A;  2V72 A;  4UOJ A;  4P02 B;  3VDA A;  4E8D A;  1D7P M;  1UMH A;  1US3 A;  2CDO A;  3BN6 A;  2W3J A;  3T09 A;  2W5F A;  1YQ2 A;  3NJX A;  1K45 A;  1XC6 A;  2XOM A;  3A21 A;  2ID4 A;  4A45 A;  1TVG A;  1GOH A;  2WBK A;  1UY2 A;  5JXH A;  4AAX A;  2VCC A;  4W50 A;  2Y6H A;  3I2G A;  3MUY 1;  3WNP A;  5B4X A;  3HOB A;  1GOF A;  3K4D A;  4QPW A;  1H6X A;  4JHZ A;  3WF4 A;  5DN2 A;  5C71 A;  3OGV A;  1XPW A;  1UY0 A;  4XZU G;  4KI5 M;  3T0A A;  2JD9 A;  2BBA A;  4QB1 A;  1PX4 A;  1GNY A;  2XON A;  2BZD A;  2V4V A;  1JZ5 A;  2BGP A;  5B4N A;  2VZ1 A;  4CUA A;  2X05 A;  4MGQ A;  2E31 A;  4XUQ A;  1CZV A;  3T08 A;  2DDU A;  1OF3 A;  4JKK A;  4QX3 A;  4MO3 M;  5IYY A;  1GMM A;  3CQO A;  3EB7 A;  3VDB A;  1J83 A;  4QAW A;  1SDD B;  3LEK A;  3WSO A;  2QQN A;  3VD9 A;  3IDA A;  4KMQ A;  5CYY A;  2WUH A;  3T2Q A;  3ZM8 A;  3HEI A;  4PT6 A;  1CX1 A;  4DUV A;  1MPX A;  3E1F 1;  5EJ1 B;  4MGS A;  1GU3 A;  3UET A;  4MOA A;  4IUG A;  2W47 A;  3OGR A;  2B4K A;  5JR2 A;  3CIH A;  3C7E A;  4XUT A;  2E33 A;  3I97 A;  2JDA A;  5IJR A;  2WDB A;  2DCK A;  2EIE A;  1W9T A;  1O59 A;  3C7O A;  3K4A A;  4QDQ A;  2YC2 A;  3P1I A;  2ZEX A;  4A4A A;  3CMG A;  3WF1 A;  3J7H A;  3SKJ E;  4RN5 A;  1JHJ A;  3WF0 A;  2YB7 A;  3ACF A;  3K4Z A;  2WAO A;  1US2 A;  1JZ3 A;  3MUZ 1;  4ZZ8 A;  3I3E A;  5JUV A;  4DXR A;  3FHQ A;  3I2K A;  4ET7 A;  5G04 L;  4HG6 B;  4DEQ A;  4LQR A;  2W87 A;  3DYP A;  4QB6 A;  1GOG A;  1W8O A;  4DXS A;  2Y6G A;  2J1U A;  2C26 A;  3NNG A;  4XUR A;  2X10 A;  4GWJ A;  2W46 A;  5JXJ A;  3IAP A;  4LPL A;  1OH4 A;  4QX1 A;  3CDZ B;  3EYP A;  4QB2 A;  3OGS A;  2RV9 A;  1JI6 A;  3CZJ A;  2W1W A;  4ZXE A;  2VZO A;  3NJV A;  4PF1 A;  3F2Z A;  4ARY A;  3HPN A;  5DQ0 A;  5F7U A;  2QQI A;  1NUK A;  3OG2 A;  4ZZ5 A;  4LHS A;  2PQS A;  3LEG A;  3VD7 A;  3UNP A;  2ZXQ A;  1XNA A;  4A3Z A;  3GXU A;  1JZ8 A;  4W4Z A;  2W1U A;  1SG3 A;  1T2X A;  3C8X A;  2EID A;  1O8P A;  2VQU A;  4E8C A;  2QQO A;  2X09 A;  2VTF A;  3LQC A;  3D3A A;  5FUI A;  3OEA A;  3LE0 A;  2VJX A;  2J1V A;  4JKL A;  5J1X A;  2LS6 A;  1JU4 A;  5G05 L;  2VZV A;  1OT5 A;  5IHR A;  1JYX A;  2Y64 A;  4D8M A;  3VD3 A;  2VZU A;  1EUT A;  1GUI A;  4CU6 A;  1DLC A;  4P5Y A;  4MAD A;  4DXT A;  1WCQ A;  2VC9 A;  5C7G A;  3III A;  5C70 A;  1W0N A;  3NQH A;  3C7H A;  3HNY M;  2RJ2 A;  4YPJ A;  2VZP A;  1SHW B;  2YFZ A;  5EJZ B;  3UES A;  3GM8 A;  1UZ0 A;  3T2P A;  3T2O A;  4OYU A;  2EIB A;  2W94 A;  1JZ6 A;  3FN9 A;  3WNO A;  1UY4 A;  3WF3 A;  3HNM A;  1UXZ A;  5EIY B;  2Y6K A;  3SEE A;  1JYW A;  3PUI A;  2BER A;  1OD3 A;  3CZU A;  3WNK A;  3ABZ A;  2WZE A;  3WEZ A;  2J7M A;  4D0Q A;  2QQK A;  3T0B A;  2WO3 A;  5LA2 A;  3ACI A;  2E26 A;  4KWU A;  4TXW A;  2VZT A;  4A42 A;  2EIC A;  2CDP A;  1UYZ A;  1R64 A;  3MBW A;  2W95 A;  2ORX A;  2L9L A;  3ACG A;  2WAA A;  2VMF A;  1KEX A;  1KGY A;  2J1A A;  5LA0 A;  4QX2 A;  2WAB A;  3K46 A;  4CUC A;  3MV1 1;  4XVH A;  3SKV A;  1JZ7 A;  2WO1 A;  2B9V A;  2VZR A;  4GZ9 A;  3DYM A;  1ULO A;  1LNS A;  1NX9 A;  4CU7 A;  3MV0 1;  2J1S A;  1W9W A;  4OMD A;  3NRU A;  1CZS A;  1IQD C;  3HNB M;  2VMD A;  2C9K A;  4CU8 A;  2VL4 A;  3W5N A;  2VCA A;  4OUE A;  1GQP A;  3A7Q A;  2JE8 A;  1UX7 A;  2VZS A;  2VCB A;  4BK5 A;  2VM9 A;  5JXI A;  4GWI A;  3PUH A;  1UY1 A;  1K3I A;  1W99 A;  1JZ4 A;  2VR4 A;  3FHA A;  1RYY A; 
#chains in the Genus database with same CATH topology
 3AK0 A;  3HQR A;  4EJR A;  5F2S A;  1JOP A;  4W6Y A;  2IXH A;  3SCH A;  2VW0 A;  1AL2 1;  5CAZ A;  5EYX A;  2JJ6 A;  4XBN A;  1PO2 1;  5E1R A;  2XG3 A;  2ZCW A;  3ZO0 B;  5C5U A;  1A34 A;  1ZRI A;  1K5M B;  1OLM A;  4XAE A;  1SLC A;  5A3O A;  3R05 A;  3ECQ A;  4X8P A;  5ANQ A;  4ISQ A;  5EYY A;  1TG7 A;  5FZ4 A;  3AP4 A;  5A3N A;  3RZZ A;  3GBW A;  4CCE A;  3VBS B;  1V9U 3;  3ME2 A;  1W2N A;  5JWP A;  3JCI A;  4NRO A;  4JKM A;  1D2S A;  4P9W A;  3ZR6 A;  4GAL A;  3RZJ A;  4X8N A;  1YNA A;  2EF6 A;  4OCT A;  5IFP A;  1COV 3;  2YU2 A;  1DQ6 A;  4BHP A;  2WO2 A;  2IWG B;  2GC2 A;  4RHV 3;  4ARX A;  2GNT A;  5EV7 A;  4NIH A;  5C8C B;  2XUE A;  3T0D A;  1O6U A;  1AYM 2;  2HLE A;  2JEN A;  1LEC A;  3P5B A;  4LO8 A;  1YFU A;  5B2G B;  1GV9 A;  3GZE A;  1IKQ A;  2C0Z A;  4NPR A;  3N4M A;  1CQ9 A;  4UBG A;  1AXZ A;  2XHN A;  3AMM A;  1EUU A;  2P6C A;  2BGC A;  4BM8 A;  5C3Q A;  5DZE A;  1VRH 1;  1W8N A;  2D6K A;  3I3M A;  4AVS A;  4HMZ A;  1CX4 A;  4DUW A;  4M4P A;  4YVS C;  4A6O A;  4DMI A;  1GNH A;  5LAS A;  1OQ1 A;  2ZKL A;  2PHW A;  1X82 A;  3ZYF A;  4L97 A;  2VEC A;  4Y1Z A;  2HYK A;  1GIC A;  3LPG A;  2C4X A;  2XBO 1;  4PDW A;  1EV1 1;  1ZRE A;  4B3N A;  1C8M 2;  1JZ2 A;  5F8P A;  1VRH 2;  2QQL A;  1UYY A;  3M3Q A;  2WN2 A;  3WNL A;  4TZD A;  4YG3 A;  1TMF 2;  5J3U A;  5BNP C;  2D6O X;  4P08 A;  1X33 A;  4PI0 A;  2VZQ A;  4DIN B;  4RHV 2;  4S2H A;  1LOB A;  2TBV A;  3C2U A;  3GYD A;  3ETP A;  3FBM A;  2GNM A;  4M00 A;  4GWM A;  4ZY9 A;  4HN1 A;  5E8A A;  3ZKY A;  1JN2 P;  4R9C A;  4X6R B;  5CKQ A;  4RGA A;  4I0B A;  2WT1 A;  5IFT A;  4QX0 A;  1RUD 3;  5BYN A;  2UY8 A;  2CTV A;  3IKW A;  2A6X A;  2PHT A;  2Y0O A;  1CIY A;  4FTS A;  4L0P A;  5E6H A;  1LHO A;  5JXG A;  1L7R A;  3I2D A;  1NA1 A;  4YW7 A;  2ADD A;  3OB8 A;  3AMH A;  1ST8 A;  4BB3 A;  1UQX A;  5FMO S;  1AHS A;  1P8J A;  1UOG A;  1APN A;  3I2H A;  1K42 A;  1NG0 A;  1UOJ A;  4XQ4 A;  4HOO A;  4NHY A;  4YNI A;  5LWB A;  1G9A A;  4GD4 A;  3VBH C;  3VKN A;  5FY7 A;  1DLL A;  4XHB A;  4CUB A;  2P3I A;  5K0U B;  4NHK A;  2DWR A;  2VUJ A;  1S2B A;  3ZXE A;  2B45 X;  1I5P A;  4LKS A;  3IT8 A;  4O9G A;  1IPS A;  3TBD A;  5L36 A;  5A70 A;  2OX0 A;  3THT A;  2ZEZ A;  1PGL 2;  3RZL A;  3KGZ A;  1IS3 A;  3I2I A;  1O5L A;  3LIG A;  4XC9 A;  1AR6 3;  2BPA 2;  2WZ8 A;  2Q1M A;  5I93 A;  1VBD 3;  3U75 A;  5AC9 1;  3PJY A;  5FYI A;  2CL2 A;  4LXL A;  1CVN A;  2RM2 1;  2WA4 A;  2QFE A;  2VME A;  1WBF A;  5FZ3 A;  5I8T A;  1ZZB A;  4QX7 A;  3G7D A;  2R06 3;  1G9C A;  3LPF A;  3PVE A;  2D97 A;  1KFX L;  2SLI A;  2BNO A;  2ARX A;  2YG0 A;  4YVS A;  4OMC A;  2JXA A;  1UYX A;  2PAM A;  3LEM A;  1VJ2 A;  2CU5 A;  4CP9 B;  2O14 A;  1OFS A;  1EV1 2;  1UWW A;  3NAP A;  5AFE A;  3U10 A;  2YY1 A;  1CZT A;  2DVB A;  3P6B A;  2B8M A;  1RUN A;  4HLT A;  5LY2 A;  1KDM A;  5FZC A;  3M70 A;  1QJY 3;  1EPW A;  1H8T B;  4OI1 A;  1S0J A;  1LED A;  2MPF A;  1UIK A;  2RS1 1;  4RR3 C;  1RUJ 2;  2HWC 3;  4QDS A;  5GLU A;  1JH5 A;  2WNU C;  3TEZ A;  1RUC 3;  4QGM A;  3N3H A;  4FP3 A;  3ZFF B;  1BEV 1;  2RR1 3;  4LNV A;  4WM8 A;  1UKG A;  5KC6 A;  2WNV A;  4WVW A;  5TSW A;  1CAW A;  4KGG A;  3OD0 A;  4AVC A;  5DDJ 3;  5L7O A;  3WD5 A;  1DZR A;  5JZG A;  1VBE 2;  1YQ2 A;  2O1Q A;  4G9S B;  2IFR A;  2GN7 A;  1VBD 2;  4QKF A;  1H2L A;  4BME A;  2GDF A;  4NO4 A;  1TVG A;  3O5S A;  2D93 A;  1WD4 A;  5BY5 A;  5JXH A;  2Y6H A;  1YI7 A;  5J36 A;  1DQ1 A;  1EPZ A;  1OHF A;  4I2O A;  5A7W A;  4LHK A;  5CVR A;  1GOF A;  1FAT A;  5FAX A;  2V09 A;  4NPL A;  4RD7 A;  3H3L A;  1LES A;  1TQ5 A;  1Q56 A;  3H8R A;  3TWI A;  4HXC A;  3NWK A;  4Z2W A;  4DQA A;  3NNL A;  4Y5S A;  5L7O B;  4Q4Y 2;  4IEQ A;  3RYP A;  5IK4 A;  2K2S A;  5F3C A;  3ZSK A;  2XL7 A;  2AR6 A;  1NE4 A;  2WWJ A;  2JD9 A;  4XIO A;  2RG4 A;  2PHU A;  1MEC 3;  4PQ9 A;  3ZFF A;  3V64 A;  4K21 A;  1AR8 3;  1DHK B;  1ZA4 A;  3KT7 A;  4QT6 A;  1GNY A;  1MZF A;  3KHB A;  2XON A;  3RZM A;  1YFX A;  2D6P A;  3LZZ A;  3VZM A;  3WUC A;  3BIW E;  2FDI A;  2BGP A;  5B4N A;  2HWE 3;  4CUA A;  4AYU A;  5C3R A;  4AI9 A;  3FFQ A;  4MGQ A;  4K1Y A;  4HSJ A;  1SCS A;  4BIS A;  1QF3 A;  3AJZ A;  3WP5 A;  1OLQ A;  2XWB B;  3ZYB A;  4Q4X 3;  4QX3 A;  4OFG A;  4AXO A;  1Y4W A;  2D7F A;  1W2O A;  5FUP A;  2Z79 A;  3E5U A;  5DUU A;  3TYJ A;  1TME 1;  4KL1 A;  1A6C A;  1G6N A;  1RUE 2;  2O0O A;  1UU4 A;  3KVA A;  5FZ8 A;  5FYY A;  3O1V A;  2A5Z A;  1RB8 G;  3AL5 A;  3PTY A;  5BXX A;  3EB7 A;  4ERO A;  4MYE A;  5J96 B;  5A80 A;  2I07 B;  3N7L A;  2VQA A;  3RPQ A;  4YSF A;  2UWB A;  1S55 A;  5HV0 A;  1PGL 1;  1JBC A;  4KBB A;  1ACC A;  4QXB A;  4COV A;  1D4M 3;  2WLP A;  2RHP A;  4CRQ A;  2JDN A;  1QQP 1;  4KMQ A;  3ZX7 A;  4MXW B;  1JYT A;  5CYY A;  3I54 A;  4PT6 A;  1CX1 A;  1UYP A;  2AEY A;  3J7M A;  1WUV A;  1DGR A;  1OUR A;  2ZGT A;  3LD8 A;  3ZFE A;  3MIG A;  1XNB A;  1WA4 A;  2LAL A;  5D8A A;  2R07 1;  1ODN A;  3PU8 A;  2E9Q A;  2Q30 A;  3AP5 A;  4YW6 A;  3ZXD A;  3UK9 A;  1PIV 3;  4CP1 A;  3QLQ A;  2CAU A;  1CAV A;  1WMX A;  3CIH A;  5FYU A;  5JR2 A;  1S0D A;  4FXG B;  1OQD A;  3UL2 A;  1HRI 3;  3WQ0 A;  3MEP A;  3VBF A;  3GBG A;  4J25 A;  4UXA A;  3WW3 A;  2E33 A;  2IVJ A;  1W6P B;  2E53 A;  1N3Q A;  2WDB A;  4NWV A;  1Q8P A;  2G19 A;  1UD1 A;  1LTE A;  5FV3 A;  3ZVX A;  1D4V B;  1SMV A;  4GAZ A;  2ZHL A;  2D3R A;  1V6J A;  2WZR 2;  2DUR A;  1ZM1 A;  4QPI B;  4DY3 A;  3C7O A;  4P9G A;  4K3U A;  1YEW A;  2VH9 A;  2EA7 A;  2I2S A;  3K4A A;  4GJY A;  5DAW A;  4C1X A;  1ZRF A;  1ASJ 1;  2BUK A;  3P1I A;  4HPK B;  4MV2 A;  4PBO A;  2XPJ A;  4JQT A;  3UKT A;  1UOF A;  3BTX A;  2JEC A;  1GAN A;  4JQR A;  3RMY A;  4IDZ A;  2WT0 A;  2X8K A;  2YXS A;  4PBP A;  1LOC A;  4RN5 A;  3VB9 A;  2GN3 A;  4IE0 A;  2HWB 2;  1MZ5 A;  2B39 A;  4Y3O A;  4ZU4 A;  3WF0 A;  3K4Z A;  3U0Z A;  1UZY A;  4Q5O A;  1JMU B;  3MIE A;  3JQX A;  3MYX A;  1SPP A;  2TNF A;  1UIJ A;  2A6Y A;  5T5P A;  5JUV A;  4ZXK A;  4ET7 A;  4F8A A;  4WV8 A;  5GLV A;  1L7L A;  4DEQ A;  5IAV A;  1GZW A;  1MS4 A;  2P3Y A;  3DYP A;  4J6G A;  4Q4X 2;  4CUG A;  1W8O A;  2BTV C;  3NL1 A;  2NP0 A;  5JOW A;  1POV 1;  1POQ A;  2BFU S;  3LFM A;  5JI9 A;  2XQR A;  1JS9 A;  4NRP A;  3BI3 A;  2PAK A;  1LOE A;  1SFP A;  4XUR A;  1STM A;  4CXX A;  4A7Z A;  3UGF A;  1TEI A;  4R4Z A;  3RWN A;  1S2E A;  3V0A B;  3IAP A;  3SHR A;  4LPL A;  5AC9 2;  1UMZ A;  1MQT C;  1IG0 A;  2JDY A;  4HK8 A;  4PLO A;  1UCX A;  1S0B A;  4QX1 A;  5L9B A;  1W04 A;  3D82 A;  4Q4V 3;  4QB2 A;  4PIX A;  3BB6 A;  4ES9 A;  4E4D X;  5T55 A;  3SMH A;  1RHI 1;  2IFW A;  2Z69 A;  5GZC A;  4GWN A;  5GLZ A;  3RSJ A;  2XR4 A;  3KV6 A;  2QJV A;  1QJU 2;  3OCP A;  1CAU B;  2XL9 A;  1CJP A;  2FHR A;  4OVE A;  4A3X A;  5F7U A;  3BAL A;  1RMU 1;  3OG2 A;  2GH8 A;  4ZZ5 A;  4LKD A;  4R9A A;  5FYB A;  1AR6 2;  4LUM A;  3S5Q A;  5FMO L;  2EAL A;  2QQW A;  1GWM A;  3E97 A;  4E2S A;  3UNP A;  3QH6 A;  2ZXQ A;  4K7J A;  5GM0 A;  1JZ8 A;  1G86 A;  1H0B A;  2KR2 A;  3DPR B;  3GXU A;  4MGT A;  4FFH A;  1SG3 A;  1RUG 3;  3N9P A;  5CFC C;  1YQ5 A;  2ZX3 A;  3I3Q A;  5FZI A;  4DRV A;  3AMN A;  3Q8A A;  2BVB A;  3TN9 1;  1TE1 B;  1S0F A;  2E7A A;  2VQU A;  3HD8 B;  3KV5 A;  5KXC A;  1XE7 A;  1OBN A;  2QQO A;  4E8C A;  3U11 A;  3WG4 A;  4NPM A;  4NID A;  3NV1 A;  1ZBE 1;  3AB0 A;  5CIR A;  3LE0 A;  4JKL A;  3MLJ A;  5J1X A;  4Q0V A;  4CPB D;  3OF1 A;  1VBE 3;  1MVQ A;  1LU2 A;  2OVU A;  1HQW A;  3E6D A;  3APB A;  1SLA A;  1JYX A;  2P37 A;  2Y64 A;  4XAC A;  2WNU A;  3NV2 A;  1UF2 C;  2A1X A;  5GLW A;  2VW2 A;  1DLC A;  4RR3 A;  5EJ3 A;  4HN0 A;  2SBA A;  2RM2 2;  2XJP A;  5EFU A;  1LCL A;  1WCQ A;  2DV9 A;  2VBD A;  3MGU A;  5A6Q A;  2E51 A;  4IEX A;  2CV6 A;  3WDW A;  3TOJ A;  4QPI A;  3BIE A;  1SBD A;  1HV1 A;  3NAP C;  3NQH A;  1Q8O A;  5DDJ 2;  4OHZ A;  4XTM A;  3ZDV A;  2RJ2 A;  1HB3 A;  5FZL A;  2YFZ A;  4XXA A;  1W6N B;  3UES A;  1QY4 A;  1QGL A;  3DL3 A;  5FXX A;  1C1L A;  3ZXK A;  1OUX A;  1Y3T A;  1HDK A;  1VBC 2;  1YFY A;  3RZK A;  1IPJ A;  4DS0 A;  4XJW A;  2AH2 A;  2W94 A;  2VY0 A;  3WW2 A;  3AX4 A;  4GMP 3;  3RWK X;  2ZGP A;  4A6S A;  1F9K A;  2D6N A;  3ACL A;  1AR7 3;  3WNO A;  5IWF A;  2AAC A;  5T5J A;  5A7P A;  2ILM A;  4PF5 A;  4LIU A;  4QQ2 A;  1GZT A;  1RUE 1;  3HNM A;  5CG8 A;  3OY8 B;  5FPB A;  5CFD B;  5T52 A;  5CFD A;  2WNO A;  4XF4 A;  1AL0 G;  3OJB A;  4YZ1 A;  5EIY B;  2GME A;  5FBZ A;  5JOX A;  3HQU A;  2CYF A;  1CR7 A;  1DBN A;  4C91 A;  1UL9 A;  4E2G A;  1W05 A;  1G7Y A;  2D43 A;  3CZU A;  1U5Y A;  2WZE A;  4B1L A;  2J7M A;  1WME A;  4EYU A;  1FV3 A;  5LK7 B;  1A8D A;  2QQU A;  4Z8B A;  2A73 B;  2ZGU A;  4KWU A;  4UW5 A;  1DZT A;  2IC1 A;  2JDM A;  4A42 A;  4CCO A;  1GFF 2;  3NKG A;  1FAY A;  2X53 S;  4BQ3 A;  1YHF A;  5A33 A;  3MBW A;  5FLH A;  4AHY A;  2ORX A;  2VUC A;  3O1R A;  5DG2 A;  4WVM B;  2XUM A;  1KDK A;  3HN1 A;  3HR9 A;  2VMF A;  3JD7 2;  4CSW A;  4EZ4 A;  1OA4 A;  1FXZ A;  3FLR A;  4HON A;  3OYW A;  4LUL A;  1H1M A;  3GNE A;  4UBH A;  4TYS A;  2WAB A;  1OOP C;  3SCG A;  4S2G A;  1RVF 3;  4IV1 C;  5BV6 A;  2RDS A;  1OMI A;  5IAT A;  1VBA 3;  2VZR A;  5C4W A;  3IPV B;  4JTN A;  3KLS A;  5FWE A;  3T4H B;  4IE4 A;  4EN9 B;  3H0O A;  3ZKU A;  4QD2 A;  4TSV A;  2OZ6 A;  4WVV A;  2W52 A;  5FZB A;  5FZO B;  3FHI B;  5A7Q A;  3MV0 1;  4TLG A;  5M0T A;  3GF6 A;  1QXR A;  2CAV A;  5FZ9 A;  4LLO A;  4Q4W 3;  2JIG A;  1CZS A;  2E63 A;  3KGL A;  4U2A A;  1V0A A;  4AI3 A;  3WNX A;  1OKO A;  3URF A;  3J9S A;  4CU8 A;  5K9Y A;  4IW3 A;  2VCA A;  4YZ3 A;  4RQP B;  1GQP A;  2A75 A;  4GMP 0;  1E57 A;  1ONA A;  1AYM 1;  1ND2 A;  4RA0 A;  2VZS A;  3MID A;  3ZFG C;  4BK5 A;  2DCT A;  2WWS A;  4O7X A;  1ZBE 3;  1CPN A;  3PUH A;  1K3I A;  4R52 A;  3ZSE A;  1JZ4 A;  5CFC B;  2IXI A;  4CDU A;  1O7F A;  1HRV 1;  1RYY A;  4FFG A;  4RGG A;  4NMI A;  4UW3 A;  3IDE A;  1GQH A;  1YLL A;  1XU1 A;  3WQ1 A;  4ZU5 A;  3VZO A;  1X50 A;  1ZRC A;  4Z82 A;  1NKG A;  4NAM A;  1O3T A;  1TNR A;  4BQW A;  1RUH 1;  4XJA A;  4YVW B;  2OPW A;  1CAW B;  4QDR A;  2W9X A;  5DAP A;  1ASJ 2;  3ZR5 A;  4A44 A;  4LHN A;  2WQZ C;  2HYX A;  1J3R A;  3W9A A;  2QKD A;  4O9E A;  2GC0 A;  3USS A;  1LUL A;  4W8J A;  2ORZ A;  1IS4 A;  3BOD A;  1S0C A;  4UI9 L;  5JIA A;  4NHX A;  2XLG A;  1X9T A;  1EYB A;  1XRU A;  5FPV A;  4WM7 B;  3IPV A;  5JZG C;  2VOT A;  2XXZ A;  4CTE A;  4RR3 B;  2QBX A;  1HLC A;  3N9O A;  4AED C;  2R49 A;  1CJD A;  5FOJ B;  3SH4 A;  2N7G A;  4YGC A;  4OI0 A;  1UX6 A;  3JZV A;  2IZW A;  1H30 A;  2WQ8 A;  2YFU A;  3VD5 A;  1XNT A;  3FLP A;  3SLI A;  2DCJ A;  3AXE A;  3AYD A;  1UMI A;  1ZBA 1;  4CEY C;  5I0D A;  2LRP A;  4YLZ A;  4WVM A;  3MFA A;  3R4D B;  4UF0 B;  1O8S A;  4M3C F;  2BQP A;  3CJI A;  1EAH 1;  1YXW A;  5HXM A;  4QWN A;  5CU1 A;  1OVP A;  1POV 0;  3DF0 A;  4N43 B;  1GR3 A;  2ES3 A;  3MDP A;  5DAV A;  1IG3 A;  3SQO A;  5I0R A;  3NO8 A;  2PA7 A;  1W8T A;  3DEC A;  3VKO A;  2XQX A;  4KU8 A;  3BYW A;  2YMZ A;  4BJ0 A;  1U5X A;  4NOT A;  1W8F A;  5T5L A;  1JYV A;  1BHG A;  4AE2 A;  3KWV A;  1JOB A;  5LAT A;  3H1Y A;  5E89 A;  4Z1V A;  1HXS 2;  3J4U H;  2BOI A;  3RQ0 A;  4PIY A;  5HBA A;  4P00 B;  5FYM A;  1FOD 3;  1ZVF A;  2HWF 2;  5FYT A;  4S2F A;  5FO9 B;  1RUC 2;  3JBG 1;  3BCW A;  1GYK A;  4OLL A;  3VHN A;  3B94 A;  1UOB A;  4XMA A;  5C3O A;  3HVD A;  1PNF A;  5IAX A;  1AXY A;  2J1E A;  1MVE A;  1X8E A;  4TTG A;  5DZF A;  3MHZ A;  3T30 A;  5LK5 A;  1NOV A;  3T1M A;  2ARE A;  2O8O A;  4ISR A;  3O12 A;  4FVV A;  2BNN A;  3W59 A;  4A41 A;  4CDW A;  3LA3 A;  3K48 A;  3B7M A;  4N9H A;  2A6Z A;  1V6L A;  2DCY A;  3WF2 A;  3ZSJ A;  4YAR A;  1ENX A;  4LOS A;  1VAV A;  1K5M A;  4P9J A;  1GP6 A;  3WQB A;  2JKX A;  4E27 A;  3WG3 A;  2AEZ A;  3MO4 A;  2VU9 A;  3R0R A;  4DEV A;  4LIV A;  2DUP A;  1JW6 A;  3B00 A;  4HBN A;  1ULP A;  4FOW A;  3U1X A;  3WG2 A;  4RYD A;  1FMD 3;  2R7E B;  5SV5 A;  4M3C B;  2OYZ A;  4KGQ A;  1LOA A;  4BQY A;  3THD A;  2VMI A;  5F3I A;  3DV8 A;  4MGY E;  4GJZ A;  1ALY A;  3MZH A;  3SH5 A;  2R07 2;  2D98 A;  3I2F A;  1PMJ X;  4A3Z A;  1AYN 2;  1C1F A;  3B5L B;  4Q4Y 3;  4DB5 A;  1W90 A;  2WZP P;  5LRS A;  4B7K A;  5KHK A;  3ACH A;  4UYB A;  4YW5 A;  3ZYR A;  3FC0 A;  2O8Q A;  2E32 A;  4KWL A;  4BQX A;  1ODM A;  4M3C A;  1VBC 1;  1UY3 A;  5FMD A;  1B09 A;  1HRV 3;  3MI8 A;  4BOW A;  4L92 A;  2GU9 A;  1WW7 A;  4XFF A;  3I49 A;  1XE8 A;  4GA9 A;  5GKA C;  1VAM A;  1I9R A;  4AGG A;  2NN8 A;  3Q8B A;  4FTE A;  1VBD 1;  5AVP A;  1AZD A;  3AMP A;  1AL2 3;  4RS5 B;  2GAU A;  4Z07 A;  3S7E A;  1PO2 3;  1PHM A;  3S0M A;  2BDR A;  2G9Z A;  1Q5O A;  4YVW A;  5LA1 A;  4D3W A;  3HN3 A;  3VKF C;  1UXX X;  4FBF A;  4N7U A;  3D0S A;  1CAV B;  2J22 A;  5FY0 A;  5FYV A;  4HVR A;  2OKX A;  1H6Y A;  1QOO A;  3BGA A;  1DYO A;  2W92 A;  2ZGQ A;  4KWJ A;  1IHM A;  1HB2 A;  4K6B A;  2OII A;  5L9R A;  4XIK A;  1UPS A;  5GZE A;  3VHP A;  4IEZ A;  4JHT A;  4AVT A;  1ND2 B;  1AR9 3;  1Z7S 3;  2XGX A;  3A4U A;  4QHB A;  3VDA A;  5IVY A;  1RVF 2;  1SQ4 A;  4LBL A;  4E8D A;  5IW0 A;  3LGR A;  3G6J B;  1HQN A;  4PI2 A;  5FK7 A;  3W20 A;  5JI7 A;  3HT2 A;  2Q5T A;  3KB5 A;  3BN6 A;  1OLR A;  4CEY B;  4FPE A;  4QKN A;  3T09 A;  1R09 2;  2W5F A;  4I3P A;  4I09 A;  4XTP A;  1XC6 A;  2CY6 A;  2XOM A;  3BPS A;  4LE4 A;  2ID4 A;  5KC5 A;  1G8W A;  1J59 A;  4XBL A;  2HH9 A;  2HWD 3;  2WBK A;  3UKV A;  1NCQ A;  5A3P A;  1AF9 A;  3JUU A;  2PHX A;  3LDB A;  3M7A A;  5F5C A;  2YC0 A;  3I2G A;  3KV9 A;  3MUY 1;  2JG8 A;  1FOD 1;  3NVC A;  4QQL A;  3VZJ A;  5B4X A;  3HOB A;  4DOU A;  1QKQ A;  5FY5 A;  2DUO A;  3OOX A;  1F5J A;  4G4F A;  2RS5 2;  3KHC A;  4CCL A;  3WF4 A;  1WWY A;  1GWL A;  2QVS B;  1WZX A;  2GMM A;  1XBF A;  1PO2 2;  2BW8 A;  2EXH A;  2W08 A;  3B9C A;  3OGV A;  5DN2 A;  3WOG A;  1VPH A;  2Z5W A;  3NW4 A;  3HIF A;  1ZZ7 A;  3DXT A;  2R16 A;  4Z92 B;  3ZXA C;  1H9P A;  3M3O A;  5LBB A;  2ZX0 A;  4MSV A;  4BH9 A;  4GKY A;  3U14 A;  4URA A;  4HVO A;  3ATG A;  3L2Y A;  2RR1 2;  3H50 A;  2R04 1;  1HRV 2;  1UU6 A;  2ZGM A;  3VBF B;  4ATE A;  1J3Q A;  4XFI A;  2HWE 1;  2VBB A;  1QWR A;  1B35 A;  3VLB B;  2WT2 A;  2VOV A;  4I0A A;  1V9U 1;  4UW6 A;  1C8N A;  4XUQ A;  3USU B;  5CG9 A;  5K0U A;  1T6B X;  5FYC A;  2ET7 A;  4HKW A;  3ZFE B;  3I59 B;  4RHV 1;  5JR7 B;  4MO3 M;  4GH4 C;  1LR5 A;  4QPG C;  3FUO A;  4L99 A;  5IYY A;  1B35 B;  2IXJ A;  4CDQ C;  2WZR 1;  1PNG A;  4FAG A;  2WR9 A;  4U36 A;  1HQL A;  3AP6 A;  5ANN A;  4RFT 0;  1LOF A;  5FMB A;  2PHD A;  1WBL A;  3JU9 A;  2VW1 A;  2VUD A;  1URX A;  1W6O A;  2ZMN A;  4QAW A;  3RFR A;  3AM2 A;  5LBC A;  1RUI 1;  4JTO A;  2XJS A;  1HXS 1;  1W6N A;  3J8F 3;  5AFB A;  1QNW A;  1YQC A;  2EAK A;  2Y33 A;  1VRH 3;  4B4Q A;  3VD9 A;  3BKZ A;  1WGP A;  3IDA A;  4QU2 A;  4H14 A;  4X6Q B;  5FZM A;  4FQ4 A;  4MVT A;  4BXF A;  3BUC A;  3ZXF A;  4DUV A;  2OZJ A;  4LUK A;  1MPX A;  3E1F 1;  4I0W B;  1SLL A;  2V73 A;  3CNA A;  3ELN A;  3H1W A;  5C4W B;  4XAA A;  3UET A;  2C9A A;  3T1L A;  4DRR A;  1BMV 1;  4BQ2 A;  2W47 A;  5DAB A;  1OLM E;  1PIV 1;  1R09 3;  3VKM A;  3WR0 A;  3VL9 A;  3KZ4 C;  4QGN A;  3N9Q A;  5FLJ A;  1PO1 1;  2B4K A;  4WM7 C;  5ABJ C;  3FWE A;  5GAL A;  2XML A;  4B8E A;  4AEM A;  4IGO A;  3GHN A;  5FP8 A;  1W3V A;  4FPY A;  1HJF A;  3MIF A;  1TMF 3;  3OUH A;  4K40 A;  3WG1 A;  5CFD C;  2VVE A;  3EMR A;  5FYS A;  1F5F A;  2ZAB A;  3DEM A;  3WDT A;  4HT1 T;  2FCU A;  3DUI A;  4W6W A;  3SC7 X;  3TN9 2;  4QM8 A;  4AZZ A;  3LFI A;  3IIA A;  4AFA A;  1VBB 3;  3U07 A;  2UUR A;  3LF7 A;  3MIH A;  1XXN A;  3ALQ A;  1WCD J;  3MW2 A;  4FPC A;  5L73 A;  2VQ0 A;  5CBL A;  2YYO A;  1HIX A;  5FXV A;  2EXI A;  4ASK A;  3RZG A;  3UJO A;  5DAQ A;  2HWD 1;  1KXG A;  1RUF 3;  5JCT A;  3TEW A;  3WDX A;  2HKX A;  1AUY A;  1V6I A;  1QXP A;  2WAO A;  2VOX A;  1FV2 A;  2ZGO A;  3IMM A;  3I3E A;  3MUZ 1;  4MZU A;  4ORF A;  1KJR A;  2WS9 3;  4DXR A;  3ETQ A;  1QNY A;  4TN7 A;  3TEY A;  1E5R A;  4IL7 A;  5F6L B;  1NA1 B;  1QJE A;  4MLO A;  1U12 A;  3EBR A;  3DXU A;  4XF3 A;  5FP9 A;  3VBS A;  2ARC A;  3FJS A;  3POI A;  1W2A X;  1N3P A;  4XJU A;  2VUL A;  2Y0I A;  2Y6G A;  2J1U A;  1R1A 2;  3S6P A;  4CCK A;  4OUM A;  3VHR A;  5FDB A;  1ZNP A;  5FO8 B;  4TLF A;  2HWB 3;  1G9B A;  2X10 A;  1NLQ A;  5FYH A;  4P9I A;  3VZN A;  5JXJ A;  2XVL A;  4IXL A;  3IMN A;  3NKT A;  3VZL A;  2XLA A;  3CDZ B;  3EYP A;  1HKD A;  3WP6 A;  3WDV A;  4BPZ A;  3O1U A;  2RV9 A;  1W06 A;  3N7K A;  3ZLI A;  3CZJ A;  3AVS A;  2MEV 3;  2FZ1 A;  2VZO A;  3GZA A;  2GMP A;  1GSL A;  2ADE A;  5ISL A;  3OUJ A;  5FZ0 A;  2PMW B;  5J98 B;  4LR4 A;  4NR1 A;  3AFG A;  3HPN A;  5H9R A;  2A7A A;  2Y26 A;  2PHF A;  2XLF A;  2QNK A;  4AR2 A;  1HW5 A;  1OXC A;  1MZE A;  4FT8 A;  1JYC A;  2ZGR A;  1MZ6 A;  4LHS A;  3VBH B;  2PQS A;  4HPK A;  2CWS A;  4ZS3 A;  2NM1 A;  4D94 A;  1VBB 2;  2KXL A;  4HZF A;  3JD7 3;  2A71 A;  5KHJ A;  4XJZ A;  1O3S A;  1N1Y A;  1VMH A;  4AW7 A;  2R1B A;  4PIZ A;  4B7E A;  1W9Y A;  1PGW 2;  2QUO A;  1PVC 3;  4BA6 A;  3C8X A;  4CDW B;  3S5A A;  2PLV 3;  5JAX A;  3MF6 A;  3ZPO A;  1RUF 2;  2ZX1 A;  3F95 A;  5GZF A;  5DG1 A;  2BWA A;  4PJY A;  2ZPX A;  2K46 A;  2VAU A;  3LA7 A;  2Y60 A;  2LS6 A;  4MXV A;  4HK9 A;  2Z42 A;  4CP2 A;  4N90 A;  4OQ8 A;  5G05 L;  1E5I A;  1SBF A;  2VZV A;  3IDC B;  1OT5 A;  2J42 A;  4D8M A;  5A32 B;  3VD3 A;  1R09 1;  5D8A B;  1GUI A;  4NWW A;  1YO8 A;  4P5Y A;  1ZX5 A;  1VBA 1;  4DXT A;  4IE5 A;  1S1A A;  3UJQ A;  2AYH A;  5C7G A;  3V0A A;  3OTF A;  2WNE A;  2LRO A;  3I8T A;  2YDE A;  1W3X A;  1NXM A;  2WFP A;  3KD4 A;  2QCS B;  1XNK A;  5FUN A;  4YPJ A;  2VZP A;  1SHW B;  2HWE 2;  4XE9 A;  5EJZ B;  2FMY A;  1RUD 2;  2PHR A;  4UFH A;  1W03 A;  5FZH A;  3ROU A;  2QQP A;  3DKQ A;  1DGL A;  3N7M A;  2EIB A;  1Q43 A;  1AR7 1;  2HWD 2;  2JE7 A;  3FN9 A;  5I0T A;  1GZ9 A;  3WP3 A;  4ES8 A;  4YZ2 A;  3IBM A;  4Y4Y A;  2KM2 A;  5JPN B;  2WJS A;  2XDV A;  1XSR A;  4JCK A;  3WF3 A;  1RJ8 A;  5FCC A;  3ZFF C;  2EXK A;  2RS3 1;  3EQE A;  3FLT A;  4EZH A;  4TWT A;  4LA2 A;  1PZ8 A;  3SEE A;  3AYA A;  3VBR B;  1JYW A;  1UW8 A;  2BER A;  4UFI A;  5F5A A;  5IVJ A;  5CIS A;  1DGR N;  4PLM A;  1UN1 A;  4K8R B;  3CJI C;  1PVC 2;  2EVX A;  4D0Q A;  2QQK A;  1WW6 A;  2WO3 A;  3QBQ A;  4MHU A;  2YUE A;  5HV4 A;  3ACI A;  4TXW A;  2VZT A;  4Y33 A;  5BPX A;  4CCC A;  5BNP B;  2Q1Z B;  1SLI A;  3LKJ A;  1X7N A;  1VMJ A;  5F5I A;  3VBR C;  1D4M 1;  1HX6 A;  1R64 A;  1W6O B;  4BQ1 A;  1C5H A;  2L9L A;  5BNN C;  5C3S A;  1YRZ A;  3ORJ A;  2G1M A;  3ACG A;  1A78 A;  3ZPY A;  4Y4R A;  1HJG A;  3P3N A;  1CAX A;  1KEX A;  5FPX A;  2VNG A;  3GBF A;  3NV4 A;  2I74 A;  4QX2 A;  1RVF 1;  5C8C A;  2TEP A;  3K46 A;  1DF0 A;  3WDY A;  4CUC A;  1COV 1;  1RUJ 1;  3SKV A;  3WZ1 A;  3OSD A;  2VPV A;  2WO1 A;  3QH7 A;  3SIS A;  4CDX C;  5DUV A;  1WMD A;  1DZQ A;  2HEY F;  5FZE A;  4YW2 A;  4AAP A;  4L9B A;  2EIG A;  4RQP A;  1SZB A;  3B3Q E;  4XJ9 A;  4CU7 A;  4K8F A;  5DDJ 1;  5K0U C;  4OMD A;  1DQ2 A;  5AVA A;  5ERL A;  1YYN A;  1IQD C;  2ET1 A;  3HNB M;  4KBZ A;  3KVB A;  1B35 C;  4CDQ B;  2WNV B;  4M3C E;  5FQ0 A;  2PHL A;  2ZML A;  3VDD A;  1BBT 1;  4OUE A;  5FZO A;  4LBM A;  2A3X A;  3A7Q A;  1RUG 1;  2JE8 A;  4NAO A;  5ACA 1;  2B5H A;  3LSD A;  3TNP B;  1UU5 A;  2VCB A;  4IE7 A;  2BYV E;  1DCS A;  1BVP 1;  4YZ4 A;  4YVW C;  1I1E A;  4CZS A;  2ZMK A;  1V70 A;  4ZON A;  1W99 A;  4Y20 A;  2FDH A;  1XYP A;  2WFF 2;  4LBN A;  5DMY A;  3HQX A;  3IB3 A;  2R32 A;  2Z4F A;  3IAQ A;  2Q8C A;  3WHU A;  2XJV A;  5D1I A;  1HV0 A;  4MGZ E;  1W9F A;  2ARB A;  3N7J A;  4DUX A;  1MEC 1;  1IS5 A;  2RVA A;  4CU9 A;  3CO2 A;  3M1H A;  5FQ0 B;  1H8T C;  4HET A;  5C4W C;  4KU7 A;  4NHM A;  3I2O A;  2ZEW A;  1PMI A;  5FO7 B;  2W1S A;  4LBJ A;  2GH2 A;  1JXN A;  2JDP A;  3UKN A;  3N9N A;  1J84 A;  1YIP A;  1XB9 A;  1A3K A;  3E6B A;  1AX0 A;  2OT7 A;  2WFF 1;  4QU1 A;  1SFY A;  5FP7 A;  5HPO A;  2W39 A;  4LO6 B;  3BTA A;  5SV8 A;  3I3B A;  2WII B;  2J1R A;  4QHZ A;  5DPN A;  4CDU B;  2E7T A;  3FBY A;  3B02 A;  3VBU B;  4AF9 A;  3H3U A;  1BYH A;  1N3O A;  4QQH A;  2WQ4 A;  2ZEY A;  3RVH A;  1RIT A;  4UFM A;  1ZBA 3;  4L8Q A;  4NRM A;  1VE0 A;  3VGI A;  4XUO A;  5FOB B;  2VCM A;  2WA3 A;  2DFB A;  1RC6 A;  1NXD 1;  1EY2 A;  1WLD A;  3VDC A;  1WKY A;  4ZKT B;  1XND A;  2P3J A;  3X29 B;  1QJX 2;  4XIL A;  1Q8Q A;  1DQ4 A;  3GGL A;  4CDU C;  1BK1 A;  3PME A;  3Q8E A;  4QHO A;  4XXP A;  5C8C C;  3GCX A;  1QQP 3;  3CHX A;  3D8C A;  4AVB A;  5HI0 A;  3RGB A;  5IK5 A;  2ERF A;  2ZA9 A;  2NYY A;  1J3P A;  1FI2 A;  1V6K A;  1AXK A;  4HAN A;  1PM4 A;  5AC9 3;  4D7Y A;  2BWC A;  1JYN A;  2ZOE B;  1OKQ A;  2EXJ A;  2P4E A;  1IGO A;  4QB6 A;  4AVV A;  2FZ2 A;  1Q3E A;  4XF0 A;  2ZX4 A;  1R08 2;  3GAL A;  2BP6 A;  3HJR A;  4IEY A;  4Q27 A;  3WV6 A;  1RUG 2;  1DP0 A;  3VBO A;  3ZOI A;  4AFD A;  3FX3 A;  3OGJ A;  1LOG A;  2XJU A;  1LHN A;  4URT A;  2VMC A;  3ES1 A;  3UGG A;  5KHG A;  3M4F A;  3LWC A;  4K1Z A;  1S4C A;  1ND3 A;  3S7I A;  4D6S A;  2YPJ A;  1WCK A;  4UFK A;  3WNM A;  4FAH A;  2JD4 A;  3WCS A;  4H7M A;  3POG A;  1BQP A;  3CEW A;  2CGN A;  2C1F A;  4Q0U A;  3DYO A;  3Q8C A;  4COY A;  1BCX A;  3N36 A;  1OC1 A;  3D6E A;  1W9S A;  3QOP A;  4M0N A;  2XBO 2;  3LOI A;  4IET A;  4CDQ A;  5I8Y A;  5KXB A;  1Z78 A;  2V5D A;  3B9I A;  2VZ3 A;  4CEY A;  4BXS V;  4FPO B;  4LBQ B;  2R04 2;  3SXW A;  4FSJ A;  3S30 A;  2V5Y A;  3VD4 A;  5FIX A;  1N1S A;  3KF3 A;  4AG4 A;  1OH3 A;  4QPG B;  3FMG A;  4CVU A;  3W5M A;  4XYX A;  1W6Q A;  3OEB A;  5C6C A;  4CE8 A;  5FPZ A;  4CEW B;  2QQM A;  1QMJ A;  3I3D A;  1BMV 2;  4BQ5 A;  1D0H A;  1WLT A;  4UAP A;  3RYK A;  3OBA A;  1YUD A;  2FDJ A;  3USU A;  5LBE A;  4F3J A;  4LO5 B;  5KBF A;  4XFH A;  5IK8 A;  1XE0 A;  3QAC A;  3O0X A;  3U4X A;  5GZD A;  3RRD A;  5C9A A;  2QQJ A;  4Y1X A;  1XQN A;  4KQ7 A;  1POV 3;  4FPJ A;  3ZDS A;  4E4H A;  4YFZ A;  2J1T A;  4OQ9 A;  3K3N A;  4CCJ A;  1FYU A;  2KD7 A;  3JB4 C;  5ACA 2;  1Q8V A;  4C0H A;  4BDV B;  2YHJ A;  1NY7 2;  2XBO 3;  4S2D A;  4AFM A;  2ZHN A;  2GSY A;  1QH7 A;  1LAJ A;  1YCI A;  1WW4 A;  4LO4 B;  1H9W A;  1FT9 A;  2H0V A;  1YJK A;  5A6X A;  4PQQ A;  1VB2 A;  4BU2 A;  1NAE A;  5HCA A;  3C7G A;  4M4R A;  1QH6 A;  3BOW A;  4BLJ A;  3EJK A;  3KCC A;  3O0V A;  1HN0 A;  3AYE A;  1AYN 3;  1Y9Q A;  4Z2A A;  1W2T A;  2RDN A;  1TME 3;  4WM8 C;  5FY4 A;  4NIA A;  1G9F A;  1V6O A;  1ENS A;  1BEV 3;  1GP4 A;  1O91 A;  2RR1 1;  2YBK A;  3AZZ A;  4P02 B;  4UOJ A;  5KHH A;  5FK8 A;  1D2Q A;  2HWC 1;  4AEJ A;  5KHI A;  4BYY A;  1D7P M;  2AZ5 A;  1QJX 1;  3ENR A;  3H9A A;  1H2N A;  4AI0 A;  1XYO A;  2H6C A;  1AJO A;  1BBT 2;  1IKP A;  2W3J A;  2PTM A;  3BPZ A;  4C0B A;  4IV1 A;  3IDB B;  2YGM A;  1D0G A;  1VR3 A;  1ZRD A;  2IXC A;  3M3E A;  5FWJ A;  4ZPI A;  4CPB A;  1K45 A;  3O14 A;  1ZZ6 A;  1N1T A;  4GKX A;  4R9D A;  1I6X A;  2A70 A;  1UY2 A;  1W8Z A;  2ZGS A;  4AAX A;  2VCC A;  3ES4 A;  4IV3 B;  1VIW B;  4W50 A;  2Q8D A;  1LHW A;  1V6M A;  2XKO A;  3WW1 A;  5HCF A;  3WNP A;  1YWK A;  4N53 C;  3K4D A;  1X9P A;  4LIT A;  5BNQ A;  4N9I A;  3ZYJ B;  4QPW A;  1H6X A;  4FPL A;  3MPP G;  2DU1 A;  4XCA A;  2UWC A;  1PO1 3;  1W6Q B;  4CP0 A;  4YGD A;  1AR6 1;  1BKZ A;  4IV1 B;  2NPI A;  1XPW A;  1UY0 A;  2Y6F A;  1ZRR A;  4KI5 M;  3T0A A;  4SLI A;  1BEV 2;  1ULC A;  3QCW A;  2YBS A;  4KG0 A;  3PJQ A;  3CL1 A;  3ZYP A;  4YFW A;  4QB1 A;  5H9Q A;  4UFL A;  4YM3 A;  3IN9 A;  1PX4 A;  3ZYI B;  5L19 A;  5CEH A;  3VBH A;  2XB6 C;  2ZX2 A;  3VDD C;  4A7K A;  3D5O A;  2V4V A;  2OUH A;  4XFC A;  5E88 A;  2NMN A;  1JZ5 A;  5BNO B;  1ASJ 3;  2VZ1 A;  1NT0 A;  5F37 A;  4FP2 A;  1H8V A;  2X05 A;  5A1L A;  3NNJ A;  2E31 A;  4IES A;  1CZV A;  3POJ A;  3T08 A;  3ZIX A;  5LEJ A;  2X29 A;  3POF A;  5F3G A;  3EO6 A;  2R0F A;  4NII A;  5FLI A;  4JKK A;  3GJB A;  5GZG A;  3VBO B;  4RQP C;  2RS1 3;  4XFB A;  4YM0 A;  4Y5Z 0;  1WLC A;  3DGT A;  3PU3 A;  3B93 A;  2JIC A;  4Q26 A;  3H42 B;  5A3W A;  4HSL A;  4CDW C;  5LB6 A;  1C8M 1;  1RIN A;  1HXS 3;  3J8F 1;  1J83 A;  5GLT A;  4Q29 A;  1RXF A;  2F4P A;  3POY A;  3WSO A;  3ZMO A;  1JYI A;  2QQN A;  2DTY A;  3AKR A;  5EZW A;  5ABJ B;  4NUB A;  5LEK A;  3T2Q A;  4FPH A;  1XYN A;  3M3C A;  5FKC A;  2QZ2 A;  5DUW A;  1QXJ A;  3HAG A;  5EJ1 B;  3AKT A;  4MGS A;  1GU3 A;  2RS5 3;  2VD7 A;  2W0X A;  3H7Y A;  3PIJ A;  4P9L A;  4XPV A;  2VOW A;  5CFC A;  1NCR A;  2DBN A;  1LOF C;  2R07 3;  5A7W B;  2JG9 C;  1W8H A;  4AQS A;  5JPM B;  2WO7 A;  4AFB A;  1HRI 1;  1HB4 A;  4MUV A;  3SH3 A;  5JLV A;  3BU7 A;  1U5I A;  4QPG A;  2WL1 A;  4AHZ A;  1ND3 C;  1R08 3;  1Z0H A;  2Z2S B;  3C7E A;  4XUT A;  1W2U A;  4D7S A;  5C8W A;  5C33 A;  2JDA A;  4C1W A;  5JZG B;  1AR9 1;  2JEM A;  1H4H A;  1DFQ A;  1Z7S 1;  3A0N A;  5FZF A;  1LU1 A;  1W9T A;  4HKO A;  3RYR A;  1PK6 B;  5K7P A;  2BV4 A;  1K5J A;  2GP5 A;  4AOC A;  3AKP A;  2P5B A;  1PO1 2;  1ZYB A;  2A6W A;  4WM8 B;  4QDQ A;  4FFF A;  2YC2 A;  3POW A;  3TEX A;  4UF0 A;  3DCQ A;  2JWP A;  3ITQ A;  3V0B A;  4XFG A;  3ZN6 A;  1NZI A;  3DN7 A;  3TRS B;  3J26 N;  2AUY A;  2RDQ A;  5FY1 A;  3J7H A;  3SKJ E;  2GP3 A;  4EN0 A;  1DYK A;  3KCY A;  4N43 C;  2HWF 1;  4YYO A;  5DZG A;  2YGL A;  4NN0 A;  3MFC A;  5K8S A;  1JHJ A;  3MPB A;  3NST A;  1OFN A;  4FO9 A;  4AI8 A;  4BMB A;  3ACF A;  1ULG A;  1FMD 2;  2ZGL A;  4H7L A;  4Y1Y A;  4ZZ8 A;  4GIQ A;  5JIU A;  3SCF A;  3U78 A;  4DFS A;  4HL0 A;  4FPK A;  1PZ7 A;  3AMQ A;  4EWA A;  5HCB A;  3K3O A;  4HG6 B;  5G04 L;  3QD6 A;  1SEF A;  1SCR A;  4IV3 C;  5T3N A;  1VAL A;  1ZZC A;  2W87 A;  5JOZ A;  4QQP A;  4E9K A;  1NLS A;  2IUW A;  4ZU7 A;  3WP4 A;  1LHU A;  3M3I A;  2NLR A;  3N9L A;  1GOG A;  4JGZ C;  4JRA A;  4FPF A;  2R06 2;  3L9J T;  4WVZ A;  4DXS A;  5FY9 A;  3AFK A;  1UPI A;  1JOJ A;  3W21 A;  3H7J A;  1SLT A;  2C26 A;  3NNG A;  4JGY A;  4GWJ A;  4Q2F A;  1FNY A;  3ON7 A;  4Y22 B;  1LJ7 A;  2P17 A;  4MX3 A;  1FNZ A;  3ZFG A;  4BE3 A;  1OH4 A;  3PUA A;  4H55 A;  3MIC A;  3PIG A;  1PGS A;  1UKR A;  1QDC A;  4YRD A;  1JI6 A;  3RG0 A;  3I59 A;  2MHF A;  2HEW F;  1N47 A;  1IOA A;  3AP9 A;  3OY8 A;  4PF1 A;  1OVS A;  4LHL A;  3F2Z A;  1XSQ A;  3VV1 A;  4ARY A;  2UY9 A;  1COV 2;  3ZFG B;  5DQ0 A;  3ZSM A;  1MQT B;  4NE9 A;  1S2K A;  5I0U A;  1QJY 1;  1WCS A;  3JD7 1;  2GAL A;  3BTZ A;  1RMU 2;  1ZZ8 A;  4XF9 A;  2FCV A;  1C8M 3;  3CF6 E;  1QOT A;  3OBZ A;  5DAX A;  4Y5T A;  5H9P A;  2JG9 A;  4W4Z A;  1BK0 A;  2W1U A;  4RS5 A;  3RI8 A;  1T2X A;  1R1A 3;  4EWD A;  3O1S A;  2OS2 A;  1RHI 2;  3RDI A;  2E7Q A;  5FJK A;  4DNY A;  2X09 A;  2VTF A;  5JSO A;  3D3A A;  1RUI 2;  4GH4 B;  5FUI A;  4LT5 A;  5FZD A;  3ZN4 A;  5HXV A;  3BTY A;  3KQ4 B;  1M06 G;  4COU A;  4R8H A;  2F17 A;  4Q1R A;  1OPO A;  4C8D A;  2DFC A;  2WS9 2;  4EQV A;  3ILN A;  3BOP A;  1O5U A;  1AJK A;  2JIJ A;  4XQD A;  4F7Z A;  1SDW A;  1NCQ B;  1C4R A;  3ZYG A;  2VZU A;  4CU6 A;  1TME 2;  4XDO A;  3V0B B;  2JDZ A;  1BZW A;  2B7Y A;  1DGW X;  2ZAA A;  2ZS6 B;  2BFU L;  3HBZ A;  5BNO A;  2VC9 A;  3POE A;  2VXJ A;  3AVR A;  1PZ9 A;  2JDH A;  3V65 A;  2A3W A;  4COZ A;  1LGN A;  1O3Q A;  1W0N A;  1DQ0 A;  3C7H A;  1IQA A;  2Y34 A;  3R4S A;  5T54 A;  2NZ9 A;  1Y9G A;  3GM8 A;  2VTX J;  1UZ0 A;  5KWR A;  3T2P A;  3AZX A;  3R6S A;  1S0G A;  3AXD A;  4IQP A;  4WZC A;  2MEV 2;  1JZ6 A;  3WY6 A;  4B4R A;  1AR8 1;  1W6M A;  4UW4 A;  2DVF A;  1CAU A;  2GC1 A;  1Y9M A;  4Q4Y 1;  4IEV A;  1RUE 3;  5F3E A;  1KJL A;  4GMP 1;  3WVJ A;  5A32 A;  3PUS A;  2FDG A;  5FZ1 A;  1GWK A;  1C5I A;  3NJZ A;  1IZ3 A;  3S57 A;  1UXZ A;  1WD3 A;  1NYW A;  1WMF A;  1FPN 1;  3KV4 A;  3ZSL A;  1OQE A;  3PUI A;  2RMU 3;  3PNA A;  2QZ3 A;  2FMD A;  4NHL A;  4QPI C;  4YW4 A;  1OD3 A;  2X5I B;  3RNS A;  3WNK A;  3ABZ A;  2VXR A;  2XJR A;  2XVG A;  3Q8F A;  1NCR C;  5A3U A;  1OSG A;  2WYF A;  3MLL A;  1HB1 A;  4AL9 A;  1W28 A;  2BRT A;  2P34 A;  4MXW A;  5LA2 A;  1KS5 A;  3CLP A;  2E26 A;  3LB9 A;  2EIC A;  2UYA A;  1RUI 3;  3TN9 3;  2CDP A;  1EV1 3;  2VVD A;  1EP0 A;  1GZW B;  3T4V A;  4K9S A;  4QKD A;  2W95 A;  3EHK A;  1M4W A;  3NJY A;  4FPG A;  2R0H A;  4OUS A;  4XMI A;  5CKM A;  4CDX B;  2CNA A;  1LB2 A;  2WAA A;  4P5H A;  3CJI B;  1UZV A;  1KGY A;  2DVD A;  4ASL A;  3LDK A;  5LA0 A;  1RUJ 3;  2HWC 2;  2XH6 A;  4LMF A;  1PVX A;  4CCD A;  4YZ5 A;  3MV1 1;  4RGK A;  5L7O C;  3ILF A;  3FE5 A;  1NQJ A;  2MEV 1;  5A3M A;  1CPM A;  3DYM A;  5EXO A;  1ULO A;  5BNO C;  5BNN B;  3E6C C;  2XWJ B;  3FUQ A;  5DXD A;  1RUD 1;  2P1B A;  1DYP A;  1LNS A;  2DCZ A;  4HKL A;  4GH4 A;  2IXK A;  1BVV A;  3ASI A;  5CAD A;  2JX9 A;  3THP A;  4H2A A;  2J1S A;  4XF1 A;  1YQ6 A;  3PVB B;  1W8W A;  5FBJ A;  5IVB A;  1LEM A;  1EAH 2;  4LKF A;  1SBE A;  5A7N A;  4AQT A;  5JSP A;  4PDW C;  1W6P A;  2LM3 A;  3NV3 A;  2VL4 A;  1MS3 A;  2OW4 A;  4JRL A;  5IVF A;  3BVC A;  5C3P A;  4CXY A;  5D21 A;  2UU8 A;  4LK6 A;  4YGE A;  2VMH A;  1MQT A;  1GLH A;  2VM9 A;  4KNC A;  4D7T A;  2R1D A;  2VNR A;  2W2I A;  1C57 A;  2ZZJ A;  4GWI A;  1UY1 A;  4ITC A;  4JAA A;  4JGY C;  1YJL A;  4FTB A;  3HT1 A;  5FFO C;  4ZS2 A;  1RUF 1;  3D0J A;  4JZR A;  1JHN A;  4IGP A;  2DU0 A;  4QX5 A;  1DDL A;  3NMB A;  3VBS C;  1LKN A;  4IND A;  4OZO A;  1IPK A;  4XCB A;  1RXG A;  2E6V A;  2BOJ A;  3C3V A;  4D6Q A;  1VAK A;  2CGO A;  4I30 A;  1RUH 2;  1KQR A;  3KF5 A;  4JGY B;  4LBQ A;  4AK3 A;  3OPT A;  1NCQ C;  3FZ3 A;  1R1Z A;  2RJL A;  1ND2 C;  2BEO A;  4Q1P A;  3LEI A;  2PEL A;  1D4M 2;  4XJ8 A;  2WFF 3;  3IWZ A;  2FQP A;  2TUN A;  2DUQ A;  4AHX A;  1QJU 1;  1WLW A;  2D6L X;  2YV8 A;  2YZ4 A;  4CA9 A;  3PLQ A;  5FTT C;  3PVO A;  4P9Y A;  5JMC A;  1CWP A;  5LA9 A;  3AC0 A;  1ND3 B;  5IVC A;  2OXB A;  5F32 A;  1H8T A;  5FRE A;  1XOY A;  2R30 A;  2LTN A;  4OI2 A;  4RL7 A;  4XDQ A;  3R4U A;  4Q4V 1;  4OZX A;  1E5S A;  5F2W A;  3RJR A;  2B9U A;  3JQW A;  3LCP A;  4O65 A;  4XFA A;  2RDR A;  1OA3 A;  4EN8 B;  3FL7 A;  3NAP B;  3KT1 A;  2MNG A;  2AGS A;  3LDR A;  2ZGN A;  2JB4 A;  5T5O A;  3H1M A;  4CDX A;  2HBU A;  1F4H A;  4H3W A;  4FI9 A;  2Y8K A;  4UFJ A;  3ZN6 B;  1JTZ X;  1DGW A;  2XVK A;  1EAH 3;  4DPN A;  4WZF A;  3VHO A;  2VG9 A;  5CA6 A;  4RFR B;  1U5Z A;  2ZAC A;  1KIT A;  2C24 A;  1AR8 2;  3C7F A;  1GQG A;  2FCT A;  4A7Y A;  4OHY A;  5C9A B;  1F4A A;  1F15 A;  1YIF A;  4FFI A;  5J37 A;  3A22 A;  2X5I C;  4I3G A;  2FDK A;  1X8M A;  1NE6 A;  3J8F 2;  3E5Q A;  4AEK A;  3GCW A;  4QXC A;  2C5D A;  4XOG A;  4MGK E;  5FXW A;  5IVE A;  2ZAH A;  3THC A;  1ENQ A;  4QM9 A;  1RTV A;  3E5X A;  1NA1 C;  4FQZ A;  4LE3 A;  4YGB A;  5IT6 A;  1FX5 A;  3PUR A;  5F9T A;  4FOY A;  1XJA A;  4Q0Q A;  2CGP A;  1NCR B;  2ETE A;  3AZY A;  3VBU A;  3JXS A;  1CN1 A;  4AQ6 A;  1ZBA 2;  5LCW L;  1TMF 1;  4KWK A;  1OPM A;  1RUH 3;  4Y22 A;  4ZHN A;  2ENR A;  5A1A A;  2Q8E A;  5L9V A;  4E4S A;  1UAI A;  2G9F A;  2LUW A;  3VL8 A;  4R4X A;  5JMO A;  3KS7 A;  1U0A A;  4P9X A;  1J1T A;  2HBT A;  4QXK A;  2OPK A;  1MAC A;  3WNN A;  1PX3 A;  1S0I A;  3OBR A;  3NNF A;  1C3H A;  1X36 A;  1DIW A;  2W1Q A;  2VO5 A;  2YC4 A;  3O1T A;  2GC3 A;  3Q9O A;  1JU3 A;  3SIT A;  1PM7 A;  3VBO C;  3GDB A;  1PGW 1;  3O0W A;  2Y6J A;  4MGI E;  4C90 A;  1L7Q A;  3ZXG A;  3CJX A;  2NMO A;  2CSG A;  2LW8 A;  3SEP A;  4MHR A;  5IVV A;  1RIR A;  3N35 A;  1AL2 2;  4GQ7 A;  3I2J A;  2ZHK A;  1W8U A;  3OUI A;  4EV0 A;  4CXW A;  4HVQ A;  4B4P A;  4RS5 C;  4XZP A;  4LOT A;  3LSE A;  4CCM A;  4ASM B;  4CP9 A;  4KH9 A;  4XDP A;  5JDB A;  3DPR C;  1WW5 A;  4XUN A;  2PYT A;  3A23 A;  2XJT A;  2WYS A;  1QQP 2;  2PAE A;  5EWS A;  4LEJ A;  3RI9 A;  1OF4 A;  3DKW A;  2VQT A;  2A6V A;  4PDW B;  5DUX A;  2H0B A;  4BK4 A;  3AZW A;  5FR3 A;  5FP4 A;  3ZXL A;  2Y6L A;  4XQW A;  2D6M A;  3WW4 A;  1A8M A;  2BJS A;  2KA3 A;  4JV4 A;  3BU0 A;  4JX0 A;  2D44 A;  1K12 A;  4Q4W 2;  3HWJ A;  2RMU 2;  4N53 A;  4BIO A;  5C5T A;  3CKH A;  2W91 A;  4JDN A;  1QHD A;  4R9B A;  3LIH A;  1PMH X;  1J1L A;  4XUP A;  3WHT A;  1H4G A;  2F6B A;  2NQY A;  2R04 3;  5FRA A;  1MEC 2;  3N9M A;  5LY1 A;  1HN1 A;  3U37 A;  2ZHM A;  1RUO A;  3JBG 3;  1QJU 3;  2R06 1;  5JVV A;  3B01 A;  2WN3 A;  3K77 A;  5CZK A;  1CES A;  2DVA A;  2BGO A;  2QDN A;  4AWD A;  2VTX A;  1MS9 A;  2C6S A;  2DTW A;  1YQ8 A;  3AKS A;  4G3Y C;  5FPL A;  4DZG A;  2B42 B;  1O3R A;  3K75 B;  4XEZ A;  1CD3 G;  3H3Z A;  4Y26 A;  2V72 A;  3T2T A;  3L2H A;  1MS8 A;  4O61 A;  1QIQ A;  1H1A A;  1UMH A;  1US3 A;  3CU7 A;  3PL0 A;  1YC6 1;  2JG8 C;  2CDO A;  3J7L A;  4BIF A;  4DY5 A;  4BWO A;  3GZT B;  5HCH A;  2UYB A;  4AGV A;  2BBV A;  4Q4W 1;  5FJH A;  3FFZ A;  3NJX A;  3A21 A;  3MIB A;  4Q0S A;  4Q4V 2;  4A45 A;  3GJA A;  4EE2 A;  1GOH A;  4V2V A;  1AR9 2;  1Z7S 2;  2A3Y A;  2WSU A;  4NRQ A;  5BNN A;  1SPP B;  1UO9 A;  1XU2 A;  4W6X A;  5J48 A;  1UZZ A;  1F31 A;  3VKL A;  3WLU A;  1FPN 2;  2FD8 A;  4Y1U A;  4IGQ A;  4JHZ A;  4E2Q A;  4QKB A;  1Y7B A;  3RS6 A;  4MH0 E;  1CON A;  1PIV 2;  2OQ7 A;  5C71 A;  5C9A C;  3H8U A;  3ZYH A;  5FZ6 A;  4XZU G;  4IE6 A;  4EN7 B;  2BNM A;  1GP5 A;  2EAA A;  2YBP A;  3DPR A;  1LRH A;  4YW1 A;  2RM2 3;  2GND A;  2ATF A;  1AR7 2;  2PXJ A;  2BBA A;  3SNM A;  4FCA A;  2PLV 2;  5GJ6 A;  3KM5 A;  2Q1F A;  4LO7 A;  1OOP B;  1REE A;  3WIN E;  2WWU A;  2FDF A;  2BZD A;  3TB0 A;  3ZN5 A;  1N1V A;  1SLB A;  3JB8 A;  3HMY A;  3K2O A;  4Q8L A;  3MLK A;  4OHV A;  1W39 A;  5IK7 A;  4DO0 A;  5KR7 A;  2Y38 A;  4YG6 A;  4AQ2 A;  2DDU A;  1OF3 A;  4JGZ A;  4YW3 A;  3A0K A;  1KFU L;  2CHH A;  1QOS A;  2P2K A;  1F8V A;  3WUD A;  4IV3 A;  1MS5 A;  1I3H A;  2D40 A;  2VNV A;  3T3Y A;  4JDM A;  5CB7 A;  1GMM A;  1QDO A;  1RUC 1;  2D3P A;  3CQO A;  3JBG 2;  4LBO A;  4QPY A;  5ABJ A;  4CEW C;  1W6M B;  2JDK A;  2WS9 1;  1GZC A;  5F1R A;  5I91 A;  3VDB A;  4JVA A;  2HJI A;  1VMF A;  2WZR 3;  3VN4 A;  4FOV A;  1OOP A;  4GB3 3;  5KXD A;  2PN5 A;  1SDD B;  2RJK A;  4YM2 A;  3ZFE C;  1VLN A;  3LEK A;  4KG8 A;  4IER A;  4EN6 B;  4L11 A;  4BZ4 A;  1OUS A;  1SFN A;  2WUH A;  4RSU A;  3TNQ A;  1HRI 2;  2HWB 1;  3UT0 A;  3ZM8 A;  3HEI A;  3VBR A;  4LK7 A;  1AVB A;  5FZ7 A;  4Y24 A;  4M01 A;  1J58 A;  4IUG A;  4MOA A;  3ZXJ A;  4NIG A;  2WIN B;  2WSV A;  2WC2 A;  3PTR B;  2BU9 A;  2G4I A;  5J7M A;  1PK6 C;  2CWM A;  2RE9 A;  1WA6 X;  3P3P A;  3OGR A;  5D2A A;  1MS1 A;  4AHW A;  4FOQ A;  5E16 A;  4LTA A;  4XAB A;  1LEN A;  2Q4S A;  3VBU C;  2QDR A;  4WM7 A;  2GNB A;  5FPU A;  4FXK B;  3I97 A;  5IJR A;  1QJF A;  2DCK A;  4PCR A;  2EIE A;  4E4Z A;  3POB A;  2JG9 B;  1O59 A;  2JE9 A;  3W58 A;  5CNA A;  2D5H A;  3VZK A;  4BLI A;  2V4A A;  4OUL A;  4GB3 2;  5ACA 3;  4YM1 A;  1F35 A;  2AC1 A;  2X5I A;  1BJQ A;  4I02 A;  4J1W A;  4MET A;  3OPZ A;  4CCN A;  4Q8K A;  3VUO A;  2ZEX A;  1MR5 A;  3CBN A;  1VBB 1;  5LW9 A;  1R1A 1;  1QEX A;  1WCU A;  1S0E A;  3O1O A;  4A4A A;  5F39 A;  1XNC A;  4IEU A;  1AX1 A;  3CMG A;  4BCU A;  2JDU A;  4Q4X 1;  3WF1 A;  3ZIW A;  4W65 A;  5H9S A;  1O4Z A;  1QJZ A;  5FZG A;  2OA2 A;  1JUI A;  4L2N A;  3H8X A;  1CGP A;  3UV9 A;  3AYC A;  4MG2 A;  2P3K A;  2QQV A;  2YB7 A;  4YWA A;  1US2 A;  1JZ3 A;  4CEW A;  3K51 A;  1OD5 A;  4A2U A;  4AGR A;  3LOB A;  3FHQ A;  3I2K A;  4PLN A;  2AEN A;  2ZTN A;  5K4L A;  1LGC A;  4LQR A;  2XHK A;  3WT3 A;  1UNB A;  3KQR A;  1F2N A;  1ULF A;  3B69 A;  2FBE A;  4N53 B;  3ZMN A;  3AL6 A;  1JUH A;  1VB4 A;  4AI2 A;  5BUV A;  1RJ7 A;  4D69 A;  1ZA7 A;  1V6N A;  2P6H A;  1C28 A;  3PDQ A;  4N43 A;  2WRA A;  1VP6 A;  4HFS A;  4OHX A;  1REF A;  1UZW A;  2W46 A;  4GUL A;  1KRI A;  1QU0 A;  1Y43 B;  1YFW A;  1FOD 2;  1ZBE 2;  3OGS A;  2WNV C;  3GHM A;  2HEV F;  2VUA A;  2W1W A;  1RGS A;  3MW3 A;  4JDO A;  4ZXE A;  3NJV A;  2JKB A;  3M2M A;  4IEO A;  1O4Y A;  4IEW A;  5A3T A;  1RED A;  4P14 A;  1V00 A;  4ONU A;  3UGH A;  4AI1 A;  4CYD A;  2QTW B;  2VOK A;  2QQI A;  1NUK A;  3PHM A;  2XJQ A;  4UT5 A;  2H6B A;  1AYN 1;  3NNM A;  3VBF C;  2ZKN A;  3LEG A;  4J1X A;  3PMS A;  3VD7 A;  5FYZ A;  3AP7 A;  3VDD B;  3OGG A;  4SBV A;  4V2W A;  1ZZ9 A;  2B46 X;  1XNA A;  2R6Q A;  2VBP A;  2VMG A;  4UWD A;  1I5Z A;  1PK6 A;  1QJX 3;  4GB3 1;  3IZO A;  4N8M A;  3D4K A;  5EHD A;  4AVA A;  2EID A;  5D8A C;  1O8P A;  1PVC 1;  3RJ2 X;  3WQ7 A;  2VGD A;  5CKN A;  2K9Z A;  3LQC A;  2K0G A;  2QE3 A;  4ATF A;  3OEA A;  2VJX A;  2J1V A;  1ULE A;  4JC1 A;  2IVI B;  4V1P A;  4B1M A;  1LOD A;  1GNZ A;  1JU4 A;  3PVN A;  4OHW A;  5APA A;  1YI9 A;  3AKQ A;  3LAG A;  4LBQ D;  3KSC A;  4F83 A;  5IHR A;  1O4T A;  1K5M C;  1VBE 1;  3KT4 A;  3I7D A;  1DG6 A;  3I4I A;  1EUT A;  4AED B;  2DBI A;  4XW3 A;  1KS4 A;  2DF7 A;  4MAD A;  1CAX B;  1Q8S A;  2ARA A;  2YPD A;  3ILR A;  3POS A;  4QMA A;  4QXH A;  5I8S A;  4EWE A;  3III A;  5C70 A;  1R08 1;  2DYC A;  3AZV A;  4QX8 A;  5FPA A;  3HNY M;  5F5Q A;  5I0S A;  4NJ4 A;  1ENR A;  1W0O A;  3MW4 A;  1FMD 1;  1TNF A;  3OD4 A;  4PHZ A;  3T2O A;  4OYU A;  4I01 A;  1H1I A;  2JB8 A;  5IUQ A;  4M0H A;  1CIW A;  3O1P A;  5FMC A;  3LA2 A;  1NZC A;  2D5F A;  3M8L A;  4LJH A;  1RHI 3;  4N7I A;  3WXP A;  1UY4 A;  1VBA 2;  2WNU B;  4IEP A;  4Y20 B;  4DIQ A;  1LGB A;  3WX5 A;  1FPN 3;  1GBG A;  2BVV A;  2JG8 B;  3OYW B;  4YG0 A;  1NQD A;  1NY7 1;  4XHX A;  2RMU 1;  1BLZ A;  2Y6K A;  4YVS B;  1RMU 3;  4Y1V A;  4COW A;  4NVP A;  5FP3 A;  5T50 A;  2IXL A;  3OPW A;  5A33 B;  1AX2 A;  1JOD A;  5EQU A;  4WBB A;  5A3L A;  1OA2 A;  1OI6 A;  1V9U 2;  3IM0 A;  4K20 A;  5JOY A;  2WLQ A;  3WEZ A;  1MS0 A;  4GXL A;  2G9G A;  1RL3 A;  3T0B A;  3UYJ A;  5LZ6 A;  4LOR A;  1TZO A;  4DXZ A;  5JSR A;  2PLV 1;  2VNO A;  2D3S A;  1NLR A;  1UYZ A;  4XBQ A;  5F6K A;  5LBF A;  2VE1 A;  2F4L A;  4XET A;  4BQ4 A;  2YRO A;  1H2K A;  2WKK A;  4AED A;  3GZU C;  2RS3 2;  3AJY A;  1GKB A;  5FXZ A;  1QJY 2;  2J1A A;  1L3J A;  5FY8 A;  2Q8O A;  5LRR A;  2YU1 A;  2PFW A;  4QGL A;  5FKB A;  5FZA A;  3RMX A;  5J09 A;  3HBK A;  4XVH A;  3TAY A;  2ZGK A;  2RS5 1;  3U4S A;  2RS1 2;  1JZ7 A;  3EXU A;  1IS6 A;  2PQQ A;  1H2M A;  2B9V A;  4JGZ B;  3WCR A;  4GZ9 A;  2OUJ A;  4Q0P A;  5A6Y A;  2UWA A;  2ZBJ A;  1G9D A;  3PUQ A;  2Q0A A;  1DU3 D;  1NX9 A;  4AFC A;  4QQO A;  5BNP A;  5A1F A;  2W68 A;  3RZH A;  2XKP A;  1W9W A;  4LLF A;  3WDU A;  5A7S A;  5A7O A;  5KXE A;  2OQ6 A;  3NRU A;  4LBK A;  1E5H A;  4D6R A;  3H8O A;  2VMD A;  2ZZQ A;  3MF9 A;  4LKE A;  2C9K A;  3W5N A;  3V56 A;  2GZW A;  4B29 A;  1VRB A;  4LA3 A;  3KMH A;  1ULD A;  1BBT 3;  1KD7 A;  1T6G C;  1UX7 A;  4OI4 A;  2VVF A;  3ST7 A;  5A6Z A;  2I45 A;  1LHV A;  3J7N A;  1BXH A;  1AYM 3;  3KCX A;  5JXI A;  3OBT A;  3O1M A;  2RS3 3;  1DQ5 A;  2DVG A;  3INA A;  5EP9 A;  5EPA A;  1SAC A;  2ZJC A;  1VBC 3;  2VR4 A;  5FZK A;  3FHA A;  2HWF 3;  3O7O A;  1W0P A; 
#chains in the Genus database with same CATH homology
 5DMY A;  3IB3 A;  2Z4F A;  3IAQ A;  4OZO A;  1NKG A;  4DUX A;  2RVA A;  4CU9 A;  4QDR A;  2W9X A;  4A44 A;  2HYX A;  2ZEW A;  3ECQ A;  2W1S A;  1TG7 A;  3LEI A;  4W8J A;  2ORZ A;  4UI9 L;  1J84 A;  4JKM A;  5HPO A;  2VOT A;  5IFP A;  3I3B A;  2QBX A;  2J1R A;  5DPN A;  3AC0 A;  2WO2 A;  4ARX A;  2ZEY A;  2WQ8 A;  2YFU A;  3VD5 A;  1XNT A;  2DCJ A;  4XUO A;  3T0D A;  2HLE A;  1UMI A;  3FL7 A;  5I0D A;  1F4H A;  3VDC A;  1O8S A;  4FI9 A;  1WKY A;  2Y8K A;  5HXM A;  2XHN A;  3GGL A;  1EUU A;  1W8N A;  3DEC A;  2XQX A;  3C7F A;  4BJ0 A;  4DUW A;  4M4P A;  4A6O A;  1JYV A;  1BHG A;  1F4A A;  3LPG A;  1JYN A;  3A22 A;  2C4X A;  4P00 B;  1JZ2 A;  2QQL A;  1UYY A;  2WN2 A;  3WNL A;  3HJR A;  3THC A;  1DP0 A;  4P08 A;  2VMC A;  2VZQ A;  2J1E A;  4TTG A;  3JXS A;  3ETP A;  5LCW L;  4ZY9 A;  3WNM A;  5A1A A;  5IFT A;  4QX0 A;  5JMO A;  4A41 A;  3DYO A;  1W9S A;  3WF2 A;  3WNN A;  1PX3 A;  2V5D A;  2VZ3 A;  4BXS V;  1CIY A;  2W1Q A;  2YC4 A;  2JKX A;  2VO5 A;  4L0P A;  3WQB A;  5JXG A;  3MO4 A;  1L7R A;  1JU3 A;  4DEV A;  3VD4 A;  3GDB A;  1ULP A;  4AG4 A;  2Y6J A;  3OB8 A;  4RYD A;  2R7E B;  1L7Q A;  4CVU A;  3W5M A;  3OEB A;  3THD A;  2LW8 A;  3SEP A;  1P8J A;  3I2H A;  2QQM A;  1K42 A;  3I3D A;  3I2F A;  1PMJ X;  3I2J A;  4UAP A;  3OBA A;  3ACH A;  4CUB A;  2E32 A;  4LKS A;  1UY3 A;  1I5P A;  4XUN A;  3A23 A;  2WYS A;  2QQJ A;  1OF4 A;  2VQT A;  2ZEZ A;  4BK4 A;  2J1T A;  3I2I A;  2Y6L A;  2KD7 A;  4JX0 A;  2WZ8 A;  1K12 A;  4BDV B;  3CKH A;  2W91 A;  2VME A;  1PMH X;  4XUP A;  5LA1 A;  3LPF A;  3HN3 A;  1UXX X;  1HN1 A;  3U37 A;  2YG0 A;  4PQQ A;  4OMC A;  1UYX A;  2J22 A;  1NAE A;  2WN3 A;  3C7G A;  3K77 A;  5CZK A;  1UWW A;  2OKX A;  2BGO A;  1H6Y A;  4M4R A;  3BGA A;  1DYO A;  2W92 A;  1CZT A;  3P6B A;  3K75 B;  4Z2A A;  4QDS A;  2V72 A;  4UOJ A;  4P02 B;  3VDA A;  4E8D A;  1D7P M;  1UMH A;  1US3 A;  2CDO A;  3BN6 A;  2W3J A;  3T09 A;  2W5F A;  1YQ2 A;  3NJX A;  1K45 A;  1XC6 A;  2XOM A;  3A21 A;  2ID4 A;  4A45 A;  1TVG A;  1GOH A;  2WBK A;  1UY2 A;  5JXH A;  4AAX A;  2VCC A;  4W50 A;  2Y6H A;  3I2G A;  3MUY 1;  3WNP A;  5B4X A;  3HOB A;  1GOF A;  3K4D A;  4QPW A;  1H6X A;  4JHZ A;  3WF4 A;  5DN2 A;  5C71 A;  3OGV A;  1XPW A;  1UY0 A;  4XZU G;  4KI5 M;  3T0A A;  2JD9 A;  2BBA A;  4QB1 A;  1PX4 A;  1GNY A;  2XON A;  2BZD A;  2V4V A;  1JZ5 A;  2BGP A;  5B4N A;  2VZ1 A;  4CUA A;  2X05 A;  4MGQ A;  2E31 A;  4XUQ A;  1CZV A;  3T08 A;  2DDU A;  1OF3 A;  4JKK A;  4QX3 A;  4MO3 M;  5IYY A;  1GMM A;  3CQO A;  3EB7 A;  3VDB A;  1J83 A;  4QAW A;  1SDD B;  3LEK A;  3WSO A;  2QQN A;  3VD9 A;  3IDA A;  4KMQ A;  5CYY A;  2WUH A;  3T2Q A;  3ZM8 A;  3HEI A;  4PT6 A;  1CX1 A;  4DUV A;  1MPX A;  3E1F 1;  5EJ1 B;  4MGS A;  1GU3 A;  3UET A;  4MOA A;  4IUG A;  2W47 A;  3OGR A;  2B4K A;  5JR2 A;  3CIH A;  3C7E A;  4XUT A;  2E33 A;  3I97 A;  2JDA A;  5IJR A;  2WDB A;  2DCK A;  2EIE A;  1W9T A;  1O59 A;  3C7O A;  3K4A A;  4QDQ A;  2YC2 A;  3P1I A;  2ZEX A;  4A4A A;  3CMG A;  3WF1 A;  3J7H A;  3SKJ E;  4RN5 A;  1JHJ A;  3WF0 A;  2YB7 A;  3ACF A;  3K4Z A;  2WAO A;  1US2 A;  1JZ3 A;  3MUZ 1;  4ZZ8 A;  3I3E A;  5JUV A;  4DXR A;  3FHQ A;  3I2K A;  4ET7 A;  5G04 L;  4HG6 B;  4DEQ A;  4LQR A;  2W87 A;  3DYP A;  4QB6 A;  1GOG A;  1W8O A;  4DXS A;  2Y6G A;  2J1U A;  2C26 A;  3NNG A;  4XUR A;  2X10 A;  4GWJ A;  2W46 A;  5JXJ A;  3IAP A;  4LPL A;  1OH4 A;  4QX1 A;  3CDZ B;  3EYP A;  4QB2 A;  3OGS A;  2RV9 A;  1JI6 A;  3CZJ A;  2W1W A;  4ZXE A;  2VZO A;  3NJV A;  4PF1 A;  3F2Z A;  4ARY A;  3HPN A;  5DQ0 A;  5F7U A;  2QQI A;  1NUK A;  3OG2 A;  4ZZ5 A;  4LHS A;  2PQS A;  3LEG A;  3VD7 A;  3UNP A;  2ZXQ A;  1XNA A;  4A3Z A;  3GXU A;  1JZ8 A;  4W4Z A;  2W1U A;  1SG3 A;  1T2X A;  3C8X A;  2EID A;  1O8P A;  2VQU A;  4E8C A;  2QQO A;  2X09 A;  2VTF A;  3LQC A;  3D3A A;  5FUI A;  3OEA A;  3LE0 A;  2VJX A;  2J1V A;  4JKL A;  5J1X A;  2LS6 A;  1JU4 A;  5G05 L;  2VZV A;  1OT5 A;  5IHR A;  1JYX A;  2Y64 A;  4D8M A;  3VD3 A;  2VZU A;  1EUT A;  1GUI A;  4CU6 A;  1DLC A;  4P5Y A;  4MAD A;  4DXT A;  1WCQ A;  2VC9 A;  5C7G A;  3III A;  5C70 A;  1W0N A;  3NQH A;  3C7H A;  3HNY M;  2RJ2 A;  4YPJ A;  2VZP A;  1SHW B;  2YFZ A;  5EJZ B;  3UES A;  3GM8 A;  1UZ0 A;  3T2P A;  3T2O A;  4OYU A;  2EIB A;  2W94 A;  1JZ6 A;  3FN9 A;  3WNO A;  1UY4 A;  3WF3 A;  3HNM A;  1UXZ A;  5EIY B;  2Y6K A;  3SEE A;  1JYW A;  3PUI A;  2BER A;  1OD3 A;  3CZU A;  3WNK A;  3ABZ A;  2WZE A;  3WEZ A;  2J7M A;  4D0Q A;  2QQK A;  3T0B A;  2WO3 A;  5LA2 A;  3ACI A;  2E26 A;  4KWU A;  4TXW A;  2VZT A;  4A42 A;  2EIC A;  2CDP A;  1UYZ A;  1R64 A;  3MBW A;  2W95 A;  2ORX A;  2L9L A;  3ACG A;  2WAA A;  2VMF A;  1KEX A;  1KGY A;  2J1A A;  5LA0 A;  4QX2 A;  2WAB A;  3K46 A;  4CUC A;  3MV1 1;  4XVH A;  3SKV A;  1JZ7 A;  2WO1 A;  2B9V A;  2VZR A;  4GZ9 A;  3DYM A;  1ULO A;  1LNS A;  1NX9 A;  4CU7 A;  3MV0 1;  2J1S A;  1W9W A;  4OMD A;  3NRU A;  1CZS A;  1IQD C;  3HNB M;  2VMD A;  2C9K A;  4CU8 A;  2VL4 A;  3W5N A;  2VCA A;  4OUE A;  1GQP A;  3A7Q A;  2JE8 A;  1UX7 A;  2VZS A;  2VCB A;  4BK5 A;  2VM9 A;  5JXI A;  4GWI A;  3PUH A;  1UY1 A;  1K3I A;  1W99 A;  1JZ4 A;  2VR4 A;  3FHA A;  1RYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...