4XZUG

Crystal structure of the human factor viii c2 domain in complex with murine 3e6 inhibitory antibody
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
154
structure length
154
Chain Sequence
b'CSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3E6 antibody Fab heavy chain
molecule tags Immune system
source organism Homo sapiens
publication title Structure of the Human Factor VIII C2 Domain in Complex with the 3E6 Inhibitory Antibody.
pubmed doi rcsb
total genus 31
structure length 154
sequence length 154
chains with identical sequence M
ec nomenclature
pdb deposition date 2015-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4xzuG00
1UZ0A 2W94A 3ETPA 2VZQA 3K77A 3IAPA 5JXGA 2KD7A 2VQUA 4JKMA 1DYOA 4ZZ8A 5C71A 3MUY1 1NUKA 4W50A 3CZUA 1CZVA 3WNOA 4W8JA 3AC0A 2VC9A 3NRUA 1F4HA 1TVGA 2W1UA 3LE0A 4BK5A 1JYNA 5EIYB 1KGYA 2XOMA 1W8OA 2WDBA 3LPFA 2VMEA 5JMOA 1OF4A 2WN2A 5JUVA 3OGSA 2W95A 1WKYA 2EIBA 1OD3A 2WZ8A 1BHGA 2QQMA 3NNGA 1L7RA 4QX2A 4RN5A 3T08A 1JZ8A 2Y6GA 4BK4A 2VCCA 1PX4A 4M4RA 1NX9A 2W1QA 4MGSA 1TG7A 1JI6A 3I2KA 1UMHA 1W8NA 2YFZA 2WZEA 3OB8A 5LCWL 1DLCA 5JXIA 2Y6LA 1JZ6A 4CU6A 3WNKA 2WYSA 1PMJX 4A3ZA 3ABZA 3I2FA 1UMIA 3A22A 1D7PM 4ARYA 1NAEA 3VD5A 2J1VA 3PUHA 1UY4A 2QQOA 2VMDA 5DMYA 4XUTA 3A23A 3MBWA 1L7QA 4KWUA 2Y64A 3I3DA 1UX7A 1JYWA 2E26A 2ZEWA 5A1AA 3DECA 2J1UA 4QPWA 4OYUA 1GQPA 3U37A 1UY3A 3WF1A 1W9TA 1YQ2A 4ET7A 3FHAA 3HEIA 2W47A 4CU7A 4JKLA 2VJXA 2BBAA 2BGOA 3ACHA 4LHSA 4QX0A 3W5MA 2BZDA 3WF0A 2XQXA 2E33A 2VZTA 3NQHA 3DYOA 2YC2A 1UXXX 1UYZA 2WUHA 3E1F1 4XUQA 3IB3A 2VZPA 2WO1A 1ULPA 2VZSA 3I3BA 1GOFA 5JR2A 4IUGA 1GNYA 2V4VA 3VDAA 3OEBA 1O8SA 4XUOA 5DPNA 4BDVB 2W5FA 1LNSA 1EUTA 2JKXA 5LA0A 1GUIA 3FN9A 4KMQA 4A6OA 3SKVA 4MGQA 2W1SA 3IIIA 4LQRA 5IYYA 2ZEZA 1J84A 2J1EA 2EICA 3K75B 3BGAA 4A42A 4DXRA 1PX3A 2YC4A 2J7MA 3C7HA 2WQ8A 3HPNA 1UWWA 2DCJA 2XHNA 2V5DA 2QQKA 4P02B 2QBXA 1HN1A 3C8XA 4W4ZA 4LKSA 1XNTA 4CUBA 2YG0A 2W91A 2X05A 3THDA 4LPLA 3BN6A 4QDSA 1UY0A 2WABA 3T0DA 3CIHA 2B4KA 2HYXA 2VCBA 2X10A 3HN3A 3K4ZA 2PQSA 4QDQA 2RJ2A 3CMGA 1UY1A 4JHZA 2LS6A 4UOJA 2RVAA 3W5NA 3ACFA 3LPGA 2C9KA 2JE8A 4GWIA 2LW8A 4XUPA 3EYPA 4DXTA 2WBKA 2VZ1A 2VR4A 4E8DA 2VZVA 1XNAA 4DXSA 1K42A 2X09A 4CVUA 2E32A 3A21A 1GMMA 4OMDA 3WQBA 1UXZA 3J7HA 1H6YA 2VZUA 1P8JA 5C70A 5J1XA 3GGLA 3MO4A 4QB1A 3WEZA 2YB7A 1UYXA 2JD9A 4PF1A 4E8CA 1W99A 4BJ0A 4KI5M 3FHQA 3K4DA 2CDOA 4MADA 4XUNA 5IFTA 1JYVA 2EIEA 5B4XA 1GOGA 1EUUA 1T2XA 4P00B 2ZXQA 2BERA 2WAAA 1OT5A 1KEXA 4BXSV 2EIDA 3C7GA 4A4AA 3NJVA 1CZTA 4ZY9A 1K45A 1OH4A 2W1WA 2R7EB 2VTFA 3WNLA 3SEEA 5G05L 3WF2A 2QQLA 3LQCA 4DEQA 2YFUA 5F7UA 2XONA 3F2ZA 3SEPA 2QQNA 3NJXA 4ZZ5A 3PUIA 5LA1A 3DYPA 1W9WA 4D0QA 2WN3A 4JX0A 2VL4A 1RYYA 3THCA 1JZ2A 1W0NA 3JXSA 2W46A 3D3AA 2VMFA 3HJRA 2VZ3A 4GZ9A 3T09A 3I97A 2DCKA 3GDBA 2Y6HA 3OBAA 3MUZ1 3VD4A 2J1RA 3EB7A 2ORZA 2VM9A 4CU8A 4TXWA 1JU3A 5IFPA 5IHRA 3T2PA 1CIYA 3CKHA 2OKXA 4MOAA 5LA2A 4TTGA 2VOTA 1PMHX 2ORXA 3P6BA 4QDRA 5CYYA 4PQQA 4XVHA 1NKGA 1ULOA 4P08A 4XURA 3WSOA 2WO3A 3VDCA 5DN2A 5JXHA 1XPWA 3WNMA 1JYXA 3MV11 2J1AA 3A7QA 3K46A 2DDUA 1UYYA 3UETA 1JU4A 2Z4FA 3CZJA 2HLEA 4YPJA 3SKJE 3CDZB 4CUAA 4OZOA 3I2IA 4P5YA 5EJ1B 4M4PA 4QAWA 5CZKA 4MO3M 4OMCA 2W92A 3VD9A 1O59A 4QB6A 3T2OA 1CX1A 2CDPA 3I2JA 3I2HA 3K4AA 2ZEYA 3P1IA 4PT6A 5JXJA 3WNNA 1UY2A 5IJRA 2ZEXA 2VQTA 5B4NA 2WAOA 4Z2AA 3T2QA 2RV9A 2BGPA 1MPXA 1IQDC 3VD3A 3HNYM 4QB2A 1US3A 3CQOA 4AAXA 1I5PA 2ID4A 5FUIA 3WF3A 3C7EA 3GXUA 3ECQA 5C7GA 2B9VA 3MV01 3WF4A 1JZ7A 2VO5A 4QX3A 3C7FA 2QQJA 4DEVA 1W9SA 4ZXEA 4RYDA 2E31A 4DUXA 2W9XA 3I2GA 1JZ4A 3WNPA 2VZRA 2J22A 1R64A 3LEIA 1WCQA 3UESA 4ARXA 1K12A 1K3IA 2W87A 3HOBA 1SHWB 2QQIA 1SG3A 1OF3A 1JZ5A 3ZM8A 4DUWA 3IAQA 1GOHA 2C4XA 1H6XA 1JHJA 3HNBM 2WO2A 3OGRA 3LEKA 2J1TA 4DUVA 5EJZB 2JDAA 5DQ0A 3ACGA 4UI9L 4QX1A 4A44A 3OEAA 1CZSA 2VMCA 3T0AA 4CU9A 4OUEA 2VZOA 1XC6A 2Y8KA 1GU3A 1O8PA 3GM8A 4AG4A 2L9LA 1DP0A 4L0PA 3C7OA 4A41A 4A45A 4HG6B 5I0DA 2W3JA 5HXMA 3FL7A 4D8MA 4GWJA 1JZ3A 2C26A 4UAPA 1F4AA 4CUCA 3I3EA 2V72A 4JKKA 4FI9A 3VDBA 3OGVA 2Y6KA 2Y6JA 3VD7A 3OG2A 3UNPA 5HPOA 2VCAA 3LEGA 3HNMA 2J1SA 3IDAA 3ACIA 1SDDB 1US2A 3DYMA 3T0BA 5G04L 1J83A 4XZUG
chains in the Genus database with same CATH superfamily
3PU8A 3AXEA 2Y0IA 3BU0A 3N7LA 2GALA 3K77A 3N36A 4A6SA 2BVVA 3TB0A 3ES4A 3IAPA 5L7OB 1FI2A 2WS93 3NO8A 4OHXA 2A6WA 4W6YA 5M0TA 2E53A 4WBBA 5FUPA 4Q5OA 1VRH3 1HRV2 1UIKA 1RINA 3MUY1 5D21A 1NUKA 5F5IA 4COWA 4YM0A 1MQTC 4FCAA 5I93A 3O1UA 3CZUA 1N1YA 4XAAA 5A3OA 4XFHA 3AC0A 2VC9A 3NRUA 2O8QA 3LKJA 1YFXA 5BNPA 5LY1A 1XSRA 5A6QA 1OMIA 2WWSA 3GBGA 1CESA 1FX5A 3PVEA 2W1UA 2GN3A 3ZN6A 1JYNA 3O14A 1RUF1 1QJU3 4NWWA 5A33B 4NVPA 5CB7A 1WW7A 3USUA 5KHIA 4LK6A 1VBD1 3RYKA 2DBNA 4LHKA 1CAXB 2PHXA 4N7UA 4B29A 5I91A 4CXYA 2PMWB 1OF4A 5CA6A 2F4PA 3KSCA 4MLOA 3OGSA 3AP4A 2W68A 1YFWA 3QACA 2WT1A 1O4TA 1OD3A 2NZ9A 2WZ8A 1SQ4A 3RS6A 1BHGA 4LXLA 1PIV3 4QMAA 2QQMA 3NJYA 4RN5A 5FZCA 2D93A 4BPZA 1QJEA 2VOWA 1F35A 1VRH1 4HONA 4R9AA 3AKPA 5C9AA 2SLIA 2W1QA 3PJQA 4XZUG 1EPWA 5CG9A 1YQ5A 4CDUB 3J8F3 4D7TA 2F4LA 3JBG3 3NAPB 5A7SA 3I2KA 5FQ0B 4AVVA 5J96B 3AB0A 4LBQB 2JG9C 5IK4A 4U36A 3PVOA 1CIWA 1Y7BA 3KCXA 4FPHA 1DLCA 1FATA 3AKTA 3AZVA 4LOTA 5F2SA 5JXIA 2VCMA 2WYSA 3GJAA 3HBKA 4A3ZA 5F8PA 2D5FA 3A22A 1GZWB 4I09A 4UFLA 2RS12 1FOD3 3AKRA 3IDCB 1OA2A 4GAZA 1YWKA 2J1VA 5CKQA 1E5RA 2XJTA 3MF9A 4K8FA 4HANA 3MBWA 4WM7A 5L9RA 4KWUA 1LEMA 2OZJA 3WP6A 3I59A 3I3DA 4RS5B 4P9XA 4JAAA 1JYWA 1CAVA 3RNSA 1NA1A 1HN0A 1Q43A 1C8M3 3SXWA 4O65A 4R9CA 3WCSA 4XABA 2GN7A 4QPWA 5A3TA 5ACA2 5C8CB 4AHXA 1GQPA 1D2QA 3TEYA 1W90A 3L9JT 1ZREA 1YQ2A 5E88A 3FHAA 2WNUB 2EVXA 2WNVA 2RM21 4ZXKA 3U78A 5C3PA 5JOXA 5SV5A 1DLLA 1MS5A 5IVYA 3ZYPA 2B7YA 2UYAA 4COZA 1COV3 4D6RA 4CU7A 1E57A 2XXZA 4QXHA 3LWCA 2BZDA 1H8TA 2ZA9A 2ZGPA 4J25A 2NYYA 2OPKA 3NQHA 2YC2A 5FWEA 4ES8A 4LOSA 4QXCA 2OT7A 2IVJA 4GH4A 4M01A 1ZZCA 4L92A 4XUQA 3SC7X 1X9TA 4KG0A 4XHBA 3WG3A 4AI8A 4B8EA 1SLCA 1VBE3 1H2LA 2ET1A 1XOYA 5JOWA 2DURA 3UKNA 5I0RA 2FD8A 4NJ4A 4A7ZA 4M3CF 2XLGA 3FMGA 5FZIA 5JLVA 5AC92 5FP4A 1YYNA 1ZNPA 2WNUC 4LHLA 5A70A 3JU9A 1NCQB 4Q4Y2 3VZOA 3HQRA 3WDTA 4XUOA 2OQ6A 3IKWA 5CFDB 2IXLA 1RHI2 3GYDA 3LA2A 3DPRB 1OFNA 1F15A 3MIFA 2JKBA 3TEWA 3KV4A 1CJPA 2DBIA 5FYHA 4JDOA 1OPMA 5GKAC 4C0HA 1VRH2 3CBNA 4QD2A 2E63A 4QPIA 4HXCA 4KMQA 4XFAA 5DDJ3 3T3YA 4A6OA 1D4M2 1QNWA 2J42A 4FPJA 5EZWA 4AFDA 3S6PA 3ZYJB 5LA9A 1Q8OA 1QJY1 5CEHA 1RUG2 4Q4V3 4IETA 5IYYA 3KD4A 4BU2A 2JIJA 2ZEZA 4BH9A 3CEWA 5A3PA 1IS4A 2FMYA 4NHMA 5DUWA 4IESA 1TEIA 1GWKA 2WQ8A 3HPNA 1AR82 5DDJ1 1BBT3 2DCJA 4YG3A 1SLBA 4HKOA 1AF9A 4IEQA 3T2TA 2H6CA 5EP9A 3BTAA 4O9GA 1RUE3 5FYZA 3QOPA 2QQVA 4QQOA 4Y1ZA 4EN9B 1VBA3 1SCSA 3WUDA 5FZDA 4FPCA 2GNDA 4Q1PA 5FMBA 3KS7A 2FDIA 2UYBA 1AXYA 1KXGA 3ZIXA 2A6YA 3C8XA 5A1LA 4LKSA 1XNTA 3H8RA 4AFBA 3S7EA 1QJZA 4CUBA 5EQUA 2BYVE 1AXZA 1BVP1 1V6JA 3V64A 2VBDA 4L99A 3THDA 4B1LA 2HEWF 4GQ7A 1LRHA 3RZLA 1POQA 4NRPA 4AE2A 4QDSA 4RGGA 4GMP1 3IMNA 4RFT0 1OVSA 1DQ0A 4RGKA 3U4SA 5BNNA 4CEYC 4LUKA 5LY2A 1CD3G 4PIYA 5C4WB 1ZRFA 3CIHA 1PZ7A 1FNZA 2X10A 2ZABA 4Y26A 1I6XA 1W2AX 4DFSA 2RJ2A 1PO23 1V9U1 3ILFA 2LS6A 4FOQA 4HN1A 2RM23 3PIJA 4BQ1A 2R073 2JE8A 2DVBA 2XUMA 4L11A 4XUPA 4IV3A 1RUH3 2D3RA 2YGLA 5FZKA 4FTSA 3EYPA 1R082 1VBC1 1XYNA 2KM2A 3AMHA 2WBKA 1XYPA 3ACLA 3FBYA 4K6BA 5CFCA 5JSRA 5L9VA 1PIV2 1AX2A 4XFIA 3JD73 1S1AA 3E6BA 4BLIA 5LW9A 4K1YA 1W8TA 2Z69A 1JYTA 2HWC3 2W52A 4GJYA 5EHDA 3HR9A 5FYCA 1V6LA 3A21A 3GBWA 1GMMA 3E6DA 3W59A 3PUAA 4QQ2A 3L2HA 4YM2A 4CCDA 2ET7A 4PCRA 1AYN3 3EO6A 3ZN5A 4Z07A 1H2NA 4OCTA 5FP3A 4CSWA 3MICA 3K3NA 3WEZA 1UYXA 2JD9A 3NAPA 4Y3OA 2YU2A 4PF1A 1GP6A 4WVVA 2WO7A 2EALA 2RS52 4TN7A 4N90A 2HWB2 1G9BA 4BJ0A 1NCRA 2GH8A 4XCAA 4D3WA 5C9AB 1U5ZA 2DCZA 2P3YA 5L36A 4OI0A 5TSWA 4FTEA 5FXZA 4XUNA 3ZXLA 4HVRA 2EIEA 4E2QA 2AEYA 5A7OA 1GOGA 2A5ZA 1ZBA3 2JICA 3OPTA 1T2XA 4TSVA 2YHJA 3ZR5A 4PDWC 4LLFA 3CJIB 3PHMA 2R30A 1DGLA 1W8WA 3O1VA 4Q4W3 4UXAA 1FPN2 4W6WA 1PHMA 1CZTA 3FX3A 3AMMA 4RHV3 1YC61 3EXUA 3I8TA 3O5SA 1K45A 4RS5A 3HIFA 1CGPA 1OH4A 5J3UA 5BNPB 3RWNA 5BUVA 2VTFA 5FY0A 3SEEA 2NN8A 2VH9A 3ZN6B 2GMMA 4DEQA 1UYPA 3SLIA 3SEPA 4ZU7A 4CDUC 5LBEA 5I8YA 4XFBA 4A7KA 1CWPA 1ND2C 1RVF2 1VLNA 4JRLA 4NPLA 2AH2A 3OBZA 1V6OA 5FP9A 1S0JA 2D6OX 1RYYA 2VAUA 4SBVA 1GANA 2QKDA 1UMZA 2KA3A 4DIQA 1JODA 4RQPB 2ZHLA 1W0NA 4IEPA 2W46A 1MACA 2B42B 3D3AA 2VMFA 3BU7A 3T09A 1BK1A 5KC5A 2Y6HA 3MUZ1 1OFSA 3QH6A 4MGZE 3QCWA 1D0HA 3VD4A 3KF5A 4A2UA 1WA6X 5IK8A 1S0FA 2XKOA 1J3PA 3AX4A 3RGBA 4CP2A 1WW6A 3R6SA 3WR0A 3ZYGA 4XBLA 4BQWA 5C8CC 4CU8A 3IM0A 3VHPA 4QU1A 5EFUA 3WVJA 5AC91 3WOGA 1YIFA 5T5JA 4HPKA 4RHV1 1QWRA 4JDNA 1SEFA 2CHHA 3Q8BA 1SZBA 2OKXA 4MOAA 2N7GA 1Q8SA 4Y22A 3POJA 4KU7A 2R072 1XU2A 4KNCA 1NLRA 1HQLA 3PVNA 1SFPA 2GP5A 3MHZA 1RUD2 2VXRA 2VOTA 1WW5A 3M4FA 3WHUA 1CPMA 3R0RA 1PO22 1XJAA 4P08A 4XURA 5C3OA 5FYVA 4GD4A 2WR9A 3POYA 4UFJA 2PLV3 3KV6A 4FFHA 2QZ3A 3H3ZA 2J1AA 3K46A 4DS0A 5ABJA 2DDUA 3AL6A 4YLZA 2VW1A 3T30A 1OA4A 4Z92B 3KM5A 3UETA 1JU4A 1N3QA 1U0AA 4FAGA 1CAUB 2R071 1OKQA 3SKJE 3UKVA 1RUH1 1QJU2 3MF6A 4CPBD 4CUAA 5CG8A 1N1SA 2B46X 4N9HA 1S0IA 4OZOA 2A3XA 2PELA 1AR62 2CAVA 2XHKA 1YJKA 4QAWA 4YRDA 4N43B 3APBA 1QIQA 2A6ZA 3VD9A 1RXFA 1IQAA 1UD1A 4NR1A 3UV9A 1Q8QA 1GWLA 3WDWA 4OUMA 2KXLA 2DCTA 4JDMA 3I2JA 4URAA 1T6GC 5FPAA 2R061 1YUDA 4UW4A 4PT6A 1WCSA 2JDZA 2AREA 5FBZA 3G7DA 1W2NA 4E4ZA 3CO2A 3GALA 2ZGMA 2XVKA 4OHVA 4Y33A 3VBSC 4LKEA 2AYHA 4PI0A 3OUJA 2D3SA 3T2QA 2RV9A 2BGPA 5SV8A 3KB5A 4NN0A 4YW2A 5KHJA 1IQDC 3TN91 2AR6A 2BUKA 2VY0A 1LOBA 5KHHA 1HJFA 3UGFA 1US3A 1AR91 2WFF3 4Q0SA 1I5PA 1PZ8A 4XQ4A 5FUNA 3AMNA 3C7EA 3ECQA 1VBE1 2P37A 2B9VA 3QH7A 5T55A 2VW0A 2XH6A 3GHMA 1CAVB 2OVUA 3VZJA 1ZZ7A 1HXS1 4FT8A 5BNOC 5FZ4A 1HLCA 4COVA 5A7WB 3UJQA 4AQ6A 3L2YA 4RYDA 5H9PA 5CFCB 1G7YA 1N3PA 1PVC2 5FLHA 4DUXA 1QJX2 1RUI3 3DXUA 4ZHNA 2WSVA 3LSEA 1OVPA 3LD8A 4XYXA 4AWDA 4OVEA 2P6HA 1FPN1 3ZFGA 2UY8A 3AZWA 4YZ2A 2J22A 1KD7A 2X8KA 4N53A 1VMHA 1I3HA 3MIGA 1KDKA 4FOYA 4ZU5A 2OS2A 2V4AA 1FMD2 1K3IA 4IDZA 1F9KA 1W8HA 1X33A 1HXS3 1MR5A 1W6MA 3VBUC 4AZZA 2OYZA 1RB8G 1J58A 4BWOA 3CL1A 1COV2 2ZGSA 4M0NA 2CY6A 2DWRA 2R0HA 1OLRA 4ZS3A 4BM8A 4BCUA 3LOBA 1UZZA 4X8NA 3RI9A 5FFOC 3AP7A 2C0ZA 1GOHA 1NE4A 4O7XA 4Q8LA 2VG9A 4XJ8A 4ORFA 1JBCA 2R0FA 1JHJA 2CWSA 3HNBM 1BBT2 3H0OA 4GMP0 5ANNA 3ELNA 3V65A 2Q8OA 3LGRA 2C24A 1APNA 5DQ0A 4FP3A 3BOWA 4NIDA 3PDQA 4A44A 3S30A 2K9ZA 4AOCA 4OUEA 3AL5A 1S2EA 3BTYA 1F8VA 2QE3A 1VPHA 5CISA 3IWZA 2JG9A 1MS3A 1O8PA 3GM8A 2JD4A 4YGDA 1WMEA 4L97A 3BPSA 4B4QA 4A41A 3U1XA 4HG6B 2QFEA 4CP9A 1KS4A 4TWTA 3HQUA 5HXMA 1AHSA 2PN5A 2AACA 3DL3A 4MGIE 5EYYA 4XACA 1WD3A 3ZDSA 4PHZA 3GBFA 4FPKA 1HB4A 2YBKA 1QH7A 1LEDA 4JKKA 5A6YA 3FUOA 3VHOA 3VDBA 1V6MA 4AGVA 3VD7A 3UNPA 2RM22 4CE8A 2Z42A 5HPOA 2VCAA 4QM9A 1PGW1 3O0WA 4K9SA 5LK7B 4B7KA 4DMIA 5JZGA 1POV3 3FFQA 4UFMA 4E4DX 2VVEA 1PK6A 1US2A 3WV6A 1HRV3 3B3QE 3ETPA 3N9LA 4Y5Z0 2NLRA 2V73A 1R091 1ASJ3 2XB6C 1S0GA 4EN6B 2PHDA 1H8TC 2BEOA 4KBBA 5I8TA 5C3QA 2RE9A 1JHNA 1BXHA 1XBFA 3KZ4C 3NV2A 1LGNA 4BISA 5HI0A 1UKGA 2P5BA 3VLBB 1D4M3 1SLTA 4LITA 1M06G 3W21A 5C71A 2MHFA 2ZMNA 2ZCWA 1V70A 1UU5A 4OQ8A 3BODA 2YPJA 1CZVA 1JYCA 5FYSA 3GCWA 4JCKA 5F3EA 1RMU3 3TNQA 5ISLA 5BNQA 1JYIA 2WS91 2UWCA 4AFAA 2DCYA 1Q3EA 1AR63 1IHMA 1MS9A 4BK5A 2CYFA 1WLCA 5F1RA 3AVSA 1KGYA 4EJRA 2XOMA 5FO9B 2A3YA 3OBRA 1GZ9A 3MIBA 1W8OA 4RD7A 2WDBA 3VBOC 5DZFA 5J48A 2Y26A 1QMJA 1JOPA 5BYNA 5JVVA 2JIGA 2AC1A 5ABJC 2WN2A 1COV1 3VBSA 4YVSC 1TME2 1UO9A 3J7MA 4MGKE 1CR7A 3JD72 4S2HA 1UZVA 1HV0A 1IGOA 4B4RA 5FPBA 1FMD1 3RZKA 5FQ0A 4GJZA 4I0WB 1L7RA 2YY1A 4QX2A 4QKFA 3VKNA 1KRIA 5FXVA 1PM4A 3LB9A 4CDUA 5EXOA 1NX9A 3AP9A 4AHWA 3OCPA 2RJKA 4MGSA 4Y5SA 4CEWC 1R093 2HEVF 2CGNA 2ZACA 3PIGA 2ZGRA 5IAXA 1G86A 2XDVA 4IQPA 3KT1A 5FPUA 2XLFA 3CLPA 2EXKA 3KV5A 2B9UA 5BNOB 1REEA 2XWBB 4IE6A 4Y1XA 3ZXEA 1LESA 2Y6LA 5FZBA 2D98A 2XJQA 4C1XA 4CU6A 4Y1YA 3N9OA 1X50A 1UMIA 1V6KA 1XNBA 1DQ5A 3VBFB 1NAEA 1A6CA 5DZEA 3FLPA 3VD5A 4YVWC 3NL1A 4YFWA 1SFYA 3ZSKA 4YSFA 1CPNA 1IKPA 2GC3A 3FJSA 3O7OA 3A23A 2YDEA 4Q0UA 4HFSA 1L7QA 5DABA 3VBHB 4NIAA 4LO4B 1W8FA 4WM7B 1CAXA 4I0BA 2ZEWA 5A1AA 3PL0A 1ST8A 4HSLA 1FNYA 2A7AA 4XQDA 3DECA 2JX9A 2R062 2VOXA 5FPZA 3WW1A 1DQ1A 3BIEA 1XSQA 3VZLA 1CN1A 4AGGA 3ETQA 4Q4Y3 3U37A 1J1LA 2W2IA 4QHBA 3POGA 1UY3A 3AP5A 4AGRA 1B35B 2VE1A 1GZTA 4KG8A 2ERFA 1OKOA 2VULA 4HOOA 2CGPA 4FFFA 5K0UA 4ZU4A 5LK5A 2DUQA 2Y38A 2WLPA 1EPZA 2BBAA 2BGOA 2VJXA 2VPVA 1K5JA 5IVEA 4L9BA 1F5FA 1D2SA 4CA9A 2ZPXA 5LASA 1O5UA 3DYOA 1GFF2 1QJFA 2HWC1 2RDRA 4RS5C 2QUOA 2OQ7A 1UYZA 1RHI3 1GQGA 1NA1C 2UURA 2ZGNA 2ZX4A 5A7PA 1RMU1 1SACA 5JPMB 3MW3A 2VZPA 4BIFA 5JOZA 2R041 2WO1A 1E5HA 1NY72 3D0SA 1MVQA 1QY4A 4LO8A 3I3BA 4A7YA 5LBBA 1HB3A 4IUGA 3U0ZA 1GNYA 1PO21 1V9U3 2ZTNA 4R9BA 4WVMA 5D8AC 3VKFC 3ZYRA 4BB3A 3UGGA 4FVVA 4YW3A 3I4IA 3O1TA 1RITA 4DNYA 1H9WA 2YYOA 1LNSA 1EUTA 1IG3A 1SBDA 2JKXA 2RR13 3GZAA 4IEVA 4QQLA 3THTA 3FN9A 2CNAA 2LUWA 2R043 3IPVA 3NNMA 4NMIA 5IATA 5IVCA 2EAKA 1YFYA 4QPIB 2OIIA 5FBJA 4WM7C 5T52A 5I0TA 2P3IA 4LBKA 1AYN2 2W1SA 5JDBA 4LQRA 1OOPC 1RL3A 2W08A 3AXDA 3AYCA 4XTPA 1PO13 1DIWA 1H30A 2G4IA 1YIPA 4KGQA 1CJDA 3AMPA 1SMVA 3WY6A 2RR11 3B93A 1AR93 1B35C 2WFF1 3AKQA 3RJ2X 4I01A 5JSOA 2FDGA 3H42B 4YW7A 1BMV1 1W3XA 2P6CA 5CFCC 3WP3A 2XHNA 4HKWA 5IK5A 4BMEA 1ZRDA 3WQ1A 5JMCA 2ARBA 4YNIA 4PQ9A 1HN1A 1YO8A 2WFPA 3FE5A 4JGYB 3U07A 4BQ3A 4F7ZA 5IT6A 1MS4A 4LNVA 4XPVA 3NKTA 2GNTA 4S2GA 2YU1A 3FWEA 2ETEA 5FPLA 2G19A 4GKXA 2RDSA 2YG0A 2EXJA 2W91A 4JRAA 4M3CE 1PGL2 1DGWA 4LBQA 4DY5A 1PVXA 4P9GA 3BN6A 5FZFA 4AEDA 1ND2B 1AR71 4ITCA 1UY0A 3T0DA 2GSYA 5JI9A 3ZOIA 2LTNA 4MXWB 3UT0A 3UJOA 1F31A 1PVC3 1A8DA 1S0EA 3P3PA 2B4KA 2VCBA 3HN3A 2MEV3 2PQSA 1EV11 3J9SA 3M8LA 4IV3C 4NUBA 1C8NA 1SLLA 1UY1A 4HSJA 4JHZA 4UOJA 1BVVA 5HV0A 1O3SA 4H3WA 1QH6A 1LOGA 1XE0A 2C9KA 4GWIA 1W6QA 4QU2A 1NA1B 5GLUA 1B35A 3VUOA 1ULDA 5C9AC 2R063 4FO9A 1URXA 4CEWA 4I0AA 2LM3A 2VNRA 2PHUA 2VZVA 3ORJA 1XNAA 5FYBA 4DXSA 5K9YA 5KHGA 5C3SA 1Z78A 2ZAAA 3OSDA 2GMEA 1W2UA 4AI3A 1YRZA 3USSA 4CVUA 3FBMA 2Z2SB 1G9CA 4BOWA 2WRAA 4OMDA 4RQPA 1UXZA 1ULEA 5HBAA 2KR2A 4LLOA 4XOGA 2FZ2A 4QHZA 1EAH2 1OQDA 5I0SA 4AI9A 1P8JA 3S7IA 2C6SA 3MW4A 1KFXL 5C70A 1VBB2 1VMFA 2VQAA 2WA3A 1R1A1 2YB7A 1S4CA 4CPBA 1J59A 1OXCA 1HQNA 1U12A 1MEC3 3J26N 3MGUA 3THPA 1JTZX 3OOXA 2BNOA 3DN7A 3HMYA 4D7SA 4PLNA 3ME2A 3WW4A 5CADA 5T54A 4MADA 2IFWA 5IFTA 4QX8A 2WIIB 2GC1A 1S2BA 4YM3A 1W6NA 5HXVA 3AYAA 1XRUA 3ON7A 4WV8A 3D0JA 4EWDA 2O0OA 1GNZA 2D6NA 2YPDA 4AR2A 2WAAA 1R081 4NIGA 1OT5A 2ZBJA 3O1PA 4CEYB 4XZPA 4BXSV 1MEC1 2Q1FA 5IVJA 5KBFA 1LHUA 4MVTA 4IEWA 1XXNA 3RQ0A 2D6PA 1W03A 4DRVA 3WNLA 1M4WA 1JMUB 1CQ9A 1PGSA 3K3OA 5G05L 2A6VA 3I59B 3WF2A 3E6CC 1K5MC 1KJLA 3ZPYA 5IVVA 3F2ZA 5FV3A 1QJX3 1RUI2 4AI2A 3DV8A 4YFZA 2JG8C 4CDWC 2BWAA 3NJXA 3I3QA 4PI2A 4XDOA 5ABJB 4UW3A 2PAMA 1RVF1 1W9WA 3KHBA 3ZO0B 1VP6A 3WZ1A 5BY5A 5L7OC 5FYTA 1VR3A 2JDNA 1BKZA 4IEOA 3VBRC 3URFA 4LIVA 3WQ0A 4CTEA 2AENA 1RUNA 1POV0 3KT4A 1SBFA 2F17A 2XJVA 2NM1A 3OYWB 3AJZA 4M3CB 3WDXA 1LU1A 3M7AA 1QXPA 3KLSA 3VZNA 3DUIA 3B00A 4XCBA 1MQTB 2OUJA 2OX0A 2VUJA 3OBAA 2EA7A 2PAKA 2X5IA 2XLAA 2ZAHA 4RR3A 3Q8FA 4J6GA 3EB7A 3IT8A 1WUVA 4CCMA 1RJ8A 1ZBA1 4KGGA 3HD8B 4GB32 4H14A 4Y4RA 1IZ3A 4TXWA 2HH9A 3FLRA 4WM8C 1RUC1 4YYOA 5IFPA 3DKWA 1WWYA 1CIYA 2PYTA 2PHLA 4K20A 4EN7B 1UPSA 2QQUA 3CKHA 2I45A 1D4M1 2DU1A 4PJYA 5FMCA 2HWD2 1C8M2 3C3VA 1YJLA 2Z79A 1R083 2UU8A 4PBPA 1VB4A 1LOCA 1MS8A 3IN9A 4AEMA 4W6XA 4TTGA 1LGCA 5CYYA 2WLQA 1QDOA 4LKFA 4PLMA 2B39A 3HT2A 4QPGA 1ASJ1 1Y9QA 5JXHA 4Q27A 3B5LB 1VMJA 3A7QA 2ZMKA 2LROA 3B9CA 5C33A 2HBUA 1R1A2 4C0BA 4B1MA 1VBB1 1C4RA 3CZJA 2RS31 3VN4A 3E97A 1ENSA 4DO0A 3D4KA 5DG1A 3SCHA 3I2DA 3ZFFC 1IG0A 1J1TA 1UPIA 2ZGOA 4GH4C 5A7WA 3WDUA 3EQEA 2JJ6A 2XL7A 3KMHA 4IL7A 3RYRA 2CV6A 4TLGA 4P5YA 5EJ1B 4M4PA 2DV9A 2QVSB 4FTBA 5J37A 4FPLA 1X36A 1Y9GA 5ACA3 4QGMA 5J98B 4OMCA 2JDYA 4AVSA 3WDVA 1WCUA 3BKZA 4LTAA 3ZSEA 2CDPA 2HWB3 4YG6A 3NNFA 1PK6C 3CNAA 3VL9A 3ZXFA 1DYKA 1OLQA 3WNNA 3IDEA 1UQXA 5KXCA 3LA7A 4HN0A 1PZ9A 2ZEXA 2DUPA 4WVMB 1LOFC 2MEV1 2VGDA 5B4NA 3HBZA 4Q2FA 4K1ZA 2ARAA 4AEDC 3ZMOA 4CDQA 4HVQA 4YZ1A 2RMU1 1X8EA 4MHRA 2FQPA 1AR72 2DF7A 2R16A 3POIA 3HNYM 2JXAA 4W65A 3WLUA 1LHVA 3ZFEB 1X8MA 3CQOA 4XIKA 2A71A 1OBNA 3SQOA 3W58A 1C1LA 3WF3A 4ASMB 4LT5A 1ENQA 4META 4Z8BA 3GXUA 5C7GA 3KQRA 3M3EA 2W39A 5DZGA 5JIAA 4C1WA 5A33A 4BIOA 5KXEA 3RZMA 5HCHA 2WC2A 1Q56A 2D7FA 3N9QA 1LOAA 3C7FA 1MQTA 1QOSA 4Y24A 4DEVA 4XEZA 4ZXEA 1C5IA 4XFGA 2E31A 3ZSLA 3GZEA 4O9EA 5A7NA 1OOPB 3D6EA 4DRRA 1JZ4A 4BE3A 3WNPA 3C2UA 2D3PA 4IEXA 3WG1A 4ES9A 2RR12 1IPKA 1GR3A 2VZRA 3PMEA 4ISQA 4R9DA 3H1YA 1DGRN 3LEIA 3VBHC 1WCQA 1GP5A 5FTTC 4MXVA 1K12A 3UESA 2BP6A 4RR3B 3AFGA 1XE8A 1UCXA 4RSUA 2WS92 2W87A 2JB4A 1SHWB 4AAPA 1UZWA 3WX5A 2K46A 1MS0A 1JZ5A 2GH2A 2ZHNA 2HWF3 5A80A 4DUWA 4HK8A 4I3PA 2G9FA 1NLQA 3LFMA 1ND2A 3DXTA 5A7QA 4OI1A 1AL0G 1AXKA 1NLSA 1H6XA 2UWAA 3SH5A 3WD5A 5LRSA 5L7OA 1VBA2 4YW5A 4GH4B 3J7NA 5EJZB 4KBZA 1GSLA 3NV4A 1REFA 4CXWA 3TN93 2IZWA 1I1EA 1WCKA 2DUOA 3ACGA 4UI9L 5FY4A 4CDQB 1D0GA 3OY8B 4JGZA 1OUXA 4AFMA 3U14A 4EV0A 4I2OA 2VMCA 3T0AA 4G4FA 3VBOA 2YBPA 4Q4X3 5BNPC 1HW5A 2VZOA 3MYXA 1XC6A 4HBNA 1LKNA 2H0VA 1VALA 4QQHA 4IV1B 1L7LA 4AG4A 4L0PA 1UL9A 2Q30A 3C7OA 4RR3C 4DZGA 1PO11 3JQXA 1VAVA 5A3LA 2QZ2A 3TN92 4FPGA 2GC0A 3OTFA 1PGW2 5C8CA 5ACA1 4UAPA 4XFFA 2WL1A 1F4AA 1UOFA 2UWBA 3AK0A 1N1VA 4NAMA 4CUCA 1DGRA 4KQ7A 4XMAA 3WP5A 4EWAA 2I07B 2FMDA 2WNOA 2JDMA 5E89A 1JOJA 1DQ4A 1IS3A 2PHFA 4MV2A 1AYM1 5JZGC 2O1QA 3MW2A 3LOIA 1W2TA 1YI9A 3A0NA 3ZMNA 3LEMA 2CTVA 3OPWA 1BEV3 5G04L 2BQPA 1UZ0A 5DUUA 1HRI1 3CU7A 3GHNA 5C3RA 1ZZBA 1AR61 4O61A 4AL9A 3POWA 2E9QA 2Y34A 5GM0A 1V6IA 1JN2P 2IUWA 1DYOA 3J8F1 5C4WA 1O4ZA 4FAHA 2DFBA 2IWGB 1H1AA 1XU1A 5LZ6A 1JUHA 5FAXA 4HVOA 3K48A 2NQYA 1C3HA 3TWIA 4E2GA 4JQTA 4Q4W1 1S55A 2D44A 4W8JA 1YQ6A 2ATFA 3AFKA 1GZCA 4NROA 2JG8B 4CDWB 3SH4A 1Q8PA 2ZKNA 1TME3 4EYUA 4IE5A 2PXJA 2A1XA 1XE7A 1F4HA 3E5XA 4TZDA 1C28A 1TVGA 3LE0A 2WZPP 3LDRA 5EIYB 2Y33A 3MLLA 3PUQA 4FXKB 4IW3A 4KU8A 1LODA 4AVCA 3LPFA 5IK7A 5FLIA 1EAH3 3OUHA 4BXFA 5FJKA 4L2NA 5FZHA 5JUVA 2W95A 5LWBA 2P1BA 1LAJA 1TME1 3VBSB 5LB6A 4JHTA 2FDKA 1TMF2 4Q4W2 1H1IA 1NY71 5F2WA 2RHPA 3ZIWA 2Y6GA 3UGHA 2GP3A 2VW2A 2LALA 1UOBA 1BZWA 1PX4A 4K3UA 4M4RA 1RVF3 3MIHA 4YZ4A 4HKLA 5HV4A 1HB2A 4HETA 4QKBA 2PHWA 3H7YA 5EJ3A 5FRAA 1W8NA 4DY3A 5BNOA 1TMF3 2ZGTA 3JB4C 2WZEA 5AFBA 4NWVA 4EN0A 3OB8A 2XKPA 4CCNA 3F95A 3H1WA 3KCYA 4AEDB 1RUOA 1PMJX 1QXRA 3CJIC 1PIV1 1X9PA 4QGLA 2QQOA 2K0GA 4COYA 1BQPA 5E1RA 4LBOA 3B69A 1AYM2 2B5HA 1F5JA 2WWUA 3LSDA 4QPYA 5FPXA 4E27A 2Y64A 3N4MA 3A0KA 3KVBA 3MIEA 1NXD1 2ADDA 2D43A 1UX7A 3NMBA 1ZBE2 3O12A 2E26A 4ASKA 4BQXA 5A3UA 2GMPA 2WWJA 4M00A 3RVHA 4Z2WA 3BUCA 1CAWA 1H4GA 3JQWA 3N9NA 3V0BB 3B9IA 2CU5A 1SFNA 1BEV1 2ADEA 1KFUL 5FZ0A 4CCEA 1KS5A 1QDCA 1UAIA 1AZDA 3B94A 2IXIA 3WF1A 1AJKA 1L3JA 1NZIA 2HWF2 2IXJA 1QU0A 2DVDA 4Q26A 1CVNA 3OYWA 4N7IA 3S5AA 5FZEA 1G9FA 4AVBA 5FR3A 2VTXJ 3J4UH 3ACHA 1XQNA 1OOPA 4LHSA 3W5MA 4WZFA 1OQEA 3TAYA 1OC1A 3I2OA 2BTVC 2E33A 1ZVFA 2YROA 4LBQD 2BV4A 4ISRA 2HKXA 1OSGA 1B09A 1UXXX 3KGLA 4LBJA 2I2SA 2VUDA 3HVDA 2Q8DA 2RS11 3E1F1 2AUYA 4H2AA 3TNPB 3IB3A 1SPPB 4IE0A 1VBC3 1WLDA 3ZSMA 3PTRB 1W9YA 4UFIA 1ULPA 2W0XA 2Q1ZB 2WT0A 4CP1A 5JR2A 4D7YA 3USUB 3UL2A 2V4VA 1NT0A 3VDAA 4XF1A 3OEBA 2ZZJA 1O8SA 4K7JA 3DCQA 5DPNA 2Q5TA 3GNEA 1DBNA 1BBT1 2Q1MA 3NNJA 4GMP3 1PMIA 4N43C 1AR83 1RUE1 5IAVA 1W39A 3MDPA 4UF0A 1TZOA 4BMBA 4XC9A 4F3JA 4R52A 4AHYA 1ACCA 2P2KA 3H3UA 3SKVA 2XG3A 4ZONA 2RS33 5FY7A 4MGQA 4Q4Y1 2BVBA 3IIIA 1U5XA 1FXZA 4J1XA 4ATFA 3K51A 4AQ2A 4MH0E 4HMZA 2Q0AA 2WZR2 4B3NA 4CDXB 1IS5A 2WKKA 3MFAA 4XW3A 1J84A 2D40A 2O8OA 2HWE3 4I02A 2EICA 3K75B 1U5YA 2HBTA 3BGAA 5KHKA 2QDRA 1N1TA 2B45X 2YC4A 2J7MA 2GNMA 3C7HA 3R4UA 5I0UA 1UWWA 4AHZA 4R4XA 1O3QA 2QQKA 4P02B 5FYIA 1PVC1 4AEKA 2QBXA 4C90A 2RMU2 5BV6A 2HYKA 3H3LA 3N7JA 1R092 5C8WA 3PNAA 4N9IA 4LORA 4JC1A 4W4ZA 3M1HA 1YFUA 1N47A 3LDBA 4QKDA 2MEV2 4QGNA 1EYBA 3RZZA 3WINE 1K5MB 2CAUA 3D8CA 1HX6A 3AP6A 4YW1A 2RS13 4XILA 4LPLA 4LEJA 3ZX7A 4E9KA 3S0MA 2OXBA 3ZPOA 2P34A 2R32A 3AYEA 3VKMA 1ND3C 1W3VA 2JG8A 4CDWA 1MZ6A 1WBFA 5E8AA 1S0CA 3I54A 1W6NB 1PNGA 3K4ZA 3TRSB 2E7AA 3IPVB 1PM7A 3CMGA 2GDFA 1QJY2 4HT1T 2JDKA 2RVAA 3DPRC 3V0AB 3W5NA 3AZZA 3LPGA 3QBQA 3SHRA 1IKQA 2HWB1 2X53S 2BBVA 4OI4A 2TNFA 1O3TA 2XUEA 2VR4A 4FOWA 2WSUA 3PTYA 3RPQA 1QF3A 1RHI1 4INDA 1K42A 3T1LA 5FWJA 3NNLA 4GALA 2OA2A 2DVFA 1AX1A 2CSGA 5IWFA 4Q8KA 4LBLA 3J7HA 3LIHA 1LENA 3PLQA 4LBMA 2JE9A 1H6YA 2WA4A 1Z7S1 1N3OA 5HCAA 1LHNA 4MGYE 1QGLA 4MG2A 1OHFA 3GGLA 4R8HA 4QB1A 5DUVA 5B2GB 1CONA 1YLLA 1C8M1 4X8PA 4ATEA 1Y4WA 1TMF1 3BVCA 3K4DA 5FOBB 1ALYA 3NV3A 3VDDB 2CDOA 1V9U2 4PDWB 4QXKA 1IOAA 1RUC3 5GALA 3ZYFA 1XNCA 1JYVA 1W05A 4GXLA 3MLJA 4C91A 3U4XA 3S5QA 3NSTA 1EUUA 3IMMA 3VDDC 1VBD2 4AQSA 2BERA 4IEUA 4QM8A 4N8MA 1O5LA 1KEXA 1UOGA 3WW3A 2EIDA 1DGWX 3C7GA 3R4SA 1RUF2 3NJVA 4XF4A 2G9ZA 3WCRA 4CEYA 5GZGA 5IVBA 2XJSA 4ZS2A 5AVAA 4FPEA 4K21A 1RIRA 4XE9A 5JCTA 3QLQA 1SDWA 2W1WA 4CP0A 1Z7S3 5F3IA 2QQLA 1GLHA 2AZ5A 1T6BX 2YFUA 5F7UA 3LIGA 1VBD3 1WMFA 1KITA 4JVAA 1H4HA 2XVGA 3OJBA 1CAUA 3SMHA 5FZLA 1TQ5A 2V09A 3PUIA 5LA1A 4AK3A 3DYPA 5J09A 3J8F2 4D0QA 1A34A 1UZYA 1YI7A 2ZX0A 3N3HA 4LE4A 5F3CA 2WN3A 2D6LX 4JX0A 5JIUA 2QQPA 3S57A 4ZKTB 2XGXA 3PVBB 4BHPA 5ERLA 1HV1A 2EIGA 1QXJA 2CGOA 3G6JB 3JXSA 4GB33 5F3GA 1RUG1 5IUQA 3I97A 2DCKA 2HWE2 3WUCA 4NRMA 5LRRA 2FDHA 2CL2A 1I5ZA 4BQ5A 2J1RA 5GZFA 4QKNA 3ZYHA 2ZX2A 5A6ZA 4EZHA 1VB2A 2IC1A 1KDMA 2ZHMA 2ORZA 1XNKA 1I9RA 4GWMA 4NHKA 4OFGA 4PIXA 3KWVA 5IHRA 3LZZA 3T2PA 1IS6A 1A8MA 5JAXA 3GZTB 3Q8AA 5FZ3A 4QPGB 3VZMA 5D8AB 2ILMA 1IPJA 3M3IA 1AL21 1RUH2 1MVEA 2E51A 5CVRA 5BNNB 3U11A 5K7PA 4CYDA 2XVLA 4DXZA 3TBDA 1UNBA 4FFIA 4HL0A 1PO12 1O7FA 2OW4A 1VE0A 4MSVA 5AC93 1AVBA 1HQWA 4UW6A 1WBLA 3H50A 2ORXA 2GZWA 3VBFC 3MEPA 2ZKLA 4PQQA 3FLTA 3PMSA 1NKGA 3WSOA 1LOFA 3VDCA 3FUQA 1RGSA 3QD6A 5DN2A 3V0BA 3RJRA 1ULFA 1HRV1 5FKCA 3CJXA 4YWAA 3HN1A 4CDXC 2B8MA 3WG4A 1NQJA 1RUD1 1ULCA 2Z4FA 2ES3A 2WNVB 3CF6E 4WM8A 5FZOA 3WDYA 4GA9A 1PNFA 2VU9A 3IDBB 2FDFA 3VL8A 1OUSA 3CDZB 4Y5TA 2X5IB 5A3MA 2JE7A 3LA3A 1W6OB 2BJSA 4I30A 4P9IA 4EN8B 3POBA 2A6XA 2JENA 3DEMA 5CZKA 4CRQA 1RUJ3 4NHXA 1H9PA 4MO3M 5BPXA 4D6SA 4LA2A 2W92A 1O59A 1C5HA 1HDKA 5FZGA 1KQRA 5K4LA 3FC0A 3VHRA 1X7NA 1AR73 3MFCA 4JQRA 2UY9A 4JTNA 2R1DA 3K4AA 1OURA 4HK9A 3VDDA 3P1IA 4LA3A 5GZDA 3VBFA 4DOUA 5JXJA 1JXNA 4AI0A 4V2WA 1HB1A 3M3CA 2FCUA 1EV13 2VQTA 3PJYA 1ZRCA 1FAYA 4CDQC 3ZKYA 4Z2AA 2RDNA 4Q4X1 4BQYA 1W06A 2TBVA 4FQZA 2VTXA 1NCRC 5FCCA 1WA4A 2RDQA 3KQ4B 3VD3A 4UF0B 2TEPA 3E5QA 4QB2A 4I3GA 4AAXA 5F9TA 1JUIA 2ID4A 3MI8A 4KWLA 3MV01 4NE9A 1HKDA 1AJOA 2C9AA 4P9JA 3WF4A 3VHNA 4YGEA 2VO5A 4AXOA 1JZ7A 3ILRA 3PURA 1VBB3 1RUD3 1UU6A 2QQJA 2ENRA 1W9SA 3OD4A 2ZS6B 3T4HB 3EBRA 5DAPA 1O3RA 3INAA 1J3RA 5LBFA 4UT5A 1VBA1 1AR81 5DDJ2 4GKYA 2XJPA 4XAEA 2XBO2 3TYJA 4LO6B 2BOIA 4LUMA 3M70A 3BIWE 4ARXA 4CCCA 2DVGA 5FYYA 3JD71 1DZQA 4UW5A 2NP0A 3AKSA 4BLJA 1SG3A 1F2NA 3ZLIA 5H9RA 1JH5A 4QQPA 2R042 3UK9A 4CXXA 1SPPA 3VB9A 2YV8A 2C4XA 1RUE2 2GU9A 1RMU2 4MUVA 3GZUC 1UIJA 1Z7S2 2JDAA 2VVDA 5GZCA 4ONUA 4BZ4A 1ZBE3 1QQP3 4LHNA 1CZSA 4FBFA 4XMIA 1YCIA 3HQXA 2YBSA 3DGTA 3OY8A 4JGZB 3VBHA 5LBCA 2Y8KA 4RA0A 2PFWA 1GU3A 3N7KA 1FOD2 5L73A 4AI1A 4C8DA 2CWMA 4AW7A 4CCOA 5J7MA 4A45A 2BPA2 1YQ8A 5I0DA 2W3JA 2G9GA 4Y22B 3FL7A 1EAH1 5IW0A 4GWJA 4CCLA 3MIDA 2C26A 2I74A 3I3EA 2R49A 1CAWB 3NAPC 3VGIA 3I3MA 1J3QA 3IBMA 4FI9A 3ZXGA 2WINB 3RZJA 2Y6KA 2Y6JA 3JBG2 4LO7A 3W9AA 3ZFGB 2IXKA 1JS9A 1ZBA2 5E6HA 2WNUA 3ENRA 5FP8A 3LEGA 3ES1A 4SLIA 1X82A 2C1FA 3ACIA 4GULA 5FY8A 3KV9A 2D6KA 3NVCA 3WW2A 1SDDB 2PLV1 4FP2A 4QX5A 3POSA 1XB9A 3Q8CA 2VBBA 4IERA 1FV3A 2W94A 2BFUL 1NZCA 5D1IA 2VZQA 4HLTA 1W8ZA 2JWPA 2VMGA 5JR7B 4Z1VA 5JXGA 1ZZ9A 3ATGA 2KD7A 2JB8A 1DYPA 2VQUA 1ENXA 3B01A 3OGJA 4JKMA 3POFA 5EWSA 1HRI3 1LCLA 4DQAA 5A1FA 5CU1A 2SBAA 5H9QA 4RL7A 1GZWA 5FXXA 4F8AA 2OPWA 3OPZA 2BNMA 4V2VA 3ZFEA 4DINB 3OD0A 4D94A 4ZZ8A 5KR7A 4W50A 5FJHA 5FZ1A 4HPKB 3WNOA 4JGZC 4WZCA 4MXWA 3CHXA 2X29A 4U2AA 3RYPA 3BTZA 3ALQA 3BCWA 2Z5WA 4D6QA 2ZX1A 3VZKA 1LJ7A 2OZ6A 4Q1RA 5GLWA 4DB5A 3UKTA 2ZX3A 4H55A 3ZVXA 4XJZA 2VMEA 1OPOA 4QXBA 5JMOA 1FMD3 4XJUA 4CDXA 1DDLA 1POV1 1GNHA 3UYJA 1WKYA 4S2FA 3RSJA 5BNNC 2GNBA 2BGCA 5DG2A 2EIBA 2RJLA 4CCKA 4EE2A 1WMDA 3P5BA 3JZVA 4FOVA 3NNGA 1JZ8A 4XF9A 4JV4A 3T08A 2P3KA 1S0DA 4N53B 4BK4A 1CX4A 2K2SA 5FMDA 2VCCA 4NO4A 1H2MA 2H6BA 2ZGUA 1H8VA 1TG7A 5KWRA 1JI6A 5A32B 4PDWA 1UMHA 4NHYA 2YFZA 5FDBA 3JUUA 4JGYA 1SBEA 1JW6A 4Q29A 4DPNA 5K8SA 1W6PA 4YVWB 5LCWL 1ULGA 1JZ6A 2D6MA 2V5YA 3WNKA 3LF7A 2PLV2 3ABZA 3I2FA 2X5IC 4CP9B 1D7PM 4ARYA 2FCVA 3ZXDA 3ZYBA 3PUHA 2GC2A 2XR4A 1UY4A 4XXAA 2VMDA 1LGBA 3RI8A 5DMYA 4XUTA 2DYCA 3O1RA 3U10A 2VVFA 3WP4A 1XYOA 4Q4X2 2JECA 5CNAA 3JBG1 2ZGLA 1DHKB 3GCXA 3K2OA 5F32A 2FBEA 4KH9A 4KL1A 5FXWA 2Q8EA 3H8UA 1RTVA 3KT7A 1W28A 5HCFA 5F5AA 5BXXA 4P9LA 3HWJA 5I8SA 4MGTA 2J1UA 4OYUA 4RGAA 1HIXA 4Q4V1 3SNMA 4AVTA 4LMFA 1W9TA 1UW8A 2EXIA 3OF1A 5CKNA 4ET7A 4OHYA 1ONAA 3FFZA 1LB2A 3HEIA 4YVSB 2W47A 1PGL1 3IIAA 2WNVC 1BJQA 4JKLA 5FYMA 5DAVA 5JSPA 4QX0A 3O0VA 4JGYC 3BPZA 3RRDA 5JOYA 5K0UC 4MX3A 1ASJ2 4M3CA 2XQXA 3WF0A 3RZHA 2VZTA 2NMNA 1QJU1 2QTWB 1G8WA 3VKLA 5F6KA 3A4UA 5FZ9A 1W04A 1D4VB 4K40A 4NAOA 4XBQA 2P4EA 2XWJB 2AGSA 1LECA 3MPBA 2WUHA 5GLZA 1BMV2 1TNFA 4H7MA 1W0PA 3DPRA 4PIZA 2A70A 4WVWA 3BALA 4JTOA 1QEXA 3ILNA 2A3WA 2VZSA 4WVZA 2BOJA 3TEXA 3WT3A 1GOFA 1BK0A 4X6RB 5F39A 4IGQA 2XJUA 4BDVB 2FZ1A 2W5FA 2D97A 5AFEA 3TEZA 3VBRA 1LHWA 2DTYA 4QHOA 5LA0A 1GUIA 4E4HA 5FPVA 5IVFA 3BTXA 3OGGA 2Y0OA 4OLLA 3ZXKA 4RHV2 4NRQA 1DZTA 4Y20B 2A75A 3ZSJA 3O1SA 3V0AA 4E2SA 4FPOB 2JG9B 1EV12 2ZHKA 3T4VA 1W8UA 1HXS2 4FFGA 3U75A 5A3NA 1OA3A 2J1EA 1WLWA 2G1MA 4A42A 1ENRA 2DVAA 4DXRA 5C4WC 2DTWA 1PX3A 4Q0VA 5EYXA 4LK7A 3ZFFB 3KF3A 4BQ4A 1GWMA 1ZRIA 2V5DA 2HWE1 2DFCA 4YGBA 2E7QA 2ZGKA 1QOOA 5F6LB 4N43A 1V6NA 1OLMA 1R1ZA 3ZYIB 2PA7A 1ZX5A 1QJY3 2ZMLA 4TLFA 2C5DA 2MPFA 5FYUA 1HRI2 3IZOA 4COUA 5FK8A 5HCBA 2ARCA 3N9PA 5FZAA 3KHCA 1MS1A 5LATA 2X05A 4BA6A 5H9SA 4M0HA 3N35A 4OI2A 2BFUS 2BRTA 1QOTA 1Y3TA 3AM2A 4UWDA 4XTMA 1EY2A 2PQQA 3X29B 4A3XA 3CJIA 2ARXA 4IV3B 2WABA 1KJRA 4QX7A 1DG6A 2TUNA 3LFIA 1RUJ1 1ZYBA 4XHXA 3M3OA 2HYXA 5FOJB 1NCQA 3H8OA 2WQ4A 4QDQA 4IV1C 5A32A 4URTA 4LKDA 3AMQA 2BW8A 2H0BA 3H1MA 5KXBA 4FSJA 3ACFA 3ZFEC 2LW8A 4D69A 1TE1B 1VIWB 3DKQA 4DXTA 3LDKA 1JOBA 1QNYA 1S2KA 2VZ1A 2LRPA 4MHUA 4NPRA 4NPMA 4XDQA 4XQWA 4YM1A 2YZ4A 3SCFA 4E8DA 1FYUA 4NOTA 3VBOB 2X09A 4B7EA 2VUCA 1DU3D 2BNNA 2IVIB 4FXGB 1H1MA 1LTEA 2E32A 5DXDA 1RUF3 4CCJA 3BOPA 3Q8EA 5CFDC 3O1OA 2WYFA 4XJ9A 5GZEA 3WQBA 2RG4A 1NCRB 5FMOS 1ND3A 4ASLA 1V0AA 5D2AA 4AQTA 1RUG3 1XNDA 3VKOA 1VRBA 2RS51 1AX0A 4K8RB 2VZUA 5JWPA 5A6XA 1IPSA 5FMOL 1GP4A 3ZXJA 3VBUA 2RS32 5J1XA 4PLOA 2Y60A 1TNRA 1AL23 3MO4A 4OQ9A 1NQDA 4ZPIA 4QT6A 1FOD1 1UOJA 2HWC2 4IEZA 4AF9A 4GIQA 1W99A 2HWD3 4E8CA 1DQ2A 4KI5M 3FHQA 3BB6A 3MLKA 3NW4A 1WCDJ 1HJGA 3RG0A 1GBGA 2VQ0A 3HAGA 4YGCA 5B4XA 1OD5A 4HZFA 1W2OA 1EP0A 4P00B 3GJBA 3VV1A 2RMU3 2ZXQA 1VBC2 1SLIA 4YZ3A 4RQPC 4UBHA 1ZM1A 3V56A 3ZFGC 3GF6A 5E16A 2HWD1 1YQCA 5FIXA 3B02A 3P3NA 4UBGA 3MPPG 3ZXAC 4Y1UA 4L8QA 4ZY9A 4A4AA 4FPFA 1R1A3 5A3WA 1FT9A 3J7LA 5FK7A 4OHZA 4CZSA 4N53C 3EMRA 2R6QA 3DF0A 2R7EB 1SCRA 4V1PA 2F6BA 4GB31 4NHLA 4AEJA 5JPNB 2VNVA 1OI6A 2O14A 3JCIA 3LQCA 4XDPA 4Y1VA 1WD4A 2XONA 3KCCA 3WHTA 2QQNA 5F5CA 5FREA 4CEWB 2DU0A 2EAAA 2XBO1 5T50A 1WGPA 5FZ7A 4LULA 4ZZ5A 5F37A 3N9MA 3ITQA 1W6QB 1VJ2A 4AYUA 4IV1A 1Y9MA 4WM8B 5FZOB 1QJX1 2WT2A 4IE4A 4EROA 4EWEA 4OHWA 1G6NA 2QDNA 4EZ4A 5CBLA 2VL4A 3THCA 1JZ2A 4LIUA 3KGZA 3RWKX 1ZZ6A 2GAUA 4Y20A 2FDJA 1A78A 2YC0A 4OZXA 3HJRA 2RS53 2VZ3A 1AYN1 2E7TA 4GZ9A 1Q8VA 5K0UB 1GICA 2PHRA 2VD7A 1LOEA 3GDBA 4Y4YA 1S0BA 2WQZC 5CKMA 5APAA 2BDRA 3JB8A 1K5MA 1BCXA 5FZ6A 3H9AA 1H2KA 2QCSB 2WJSA 5C6CA 3OUIA 5JI7A 2IXCA 3D5OA 3EHKA 1O6UA 1QQP2 3O0XA 1G9DA 5CIRA 3SH3A 2VM9A 3OBTA 4EQVA 1JU3A 4IXLA 2P3JA 1DCSA 3BYWA 3RZGA 1SLAA 1ODNA 1LHOA 2BWCA 2XPJA 1NCQC 1MEC2 3I49A 1DQ6A 1W9FA 1ZA4A 5LA2A 4R4ZA 1NE6A 1MZ5A 2QNKA 5LEJA 2QQWA 2EF6A 3AVRA 1OLME 5C5TA 1GYKA 2ZGQA 4OULA 1LULA 1E5SA 1C1FA 1PMHX 1YEWA 1ZA7A 1DFQA 3P6BA 3R4DB 4KWKA 4QDRA 3AJYA 4XF0A 4XVHA 4CUGA 2VMIA 1ULOA 4YW6A 5FZMA 1WMXA 1O4YA 1STMA 2WO3A 3E5UA 2VUAA 4LO5B 4XJWA 3N7MA 1XPWA 1W6OA 3WNMA 1JYXA 5EV7A 1WZXA 3MV11 1O91A 2XBO3 5DAXA 3ST7A 1UYYA 2VXJA 2VBPA 3PUSA 3WG2A 4XBNA 5FO8B 1AYM3 1DF0A 5CAZA 2HLEA 3ROUA 2JDHA 4YZ5A 4YPJA 5T5PA 2BU9A 4E4SA 1ND3B 3M2MA 3ZFFA 3I2IA 1OH3A 4XXPA 5FP7A 4XFCA 5FY1A 4YW4A 1DZRA 1RUC2 2HEYF 4IGPA 2EXHA 4P14A 3WNXA 1W6MB 3ASIA 3R05A 1QQP1 4YG0A 5FKBA 2VNGA 4LE3A 5ANQA 4PBOA 1LR5A 4QB6A 3T2OA 4QPIC 3LCPA 3SCGA 3FHIB 3RMYA 1W0OA 2IFRA 1CX1A 2VMHA 4P9YA 5L9BA 1AL22 1C57A 3I2HA 3VBRB 2ZEYA 1BLZA 4KWJA 4G3YC 1UY2A 1GQHA 1V00A 5IJRA 2VNOA 2ZOEB 1ZBE1 1W6PB 2XJRA 1QKQA 4YVWA 1H0BA 2A73B 2VECA 2WAOA 2YUEA 2OUHA 5GLTA 1U5IA 5FY9A 4IE7A 1UX6A 1ZRRA 4LJHA 5DUXA 3SITA 4MZUA 1MPXA 1ODMA 5DAWA 1NXMA 3TOJA 3W20A 1E5IA 4P9WA 1QHDA 5T3NA 4PF5A 5FUIA 1AR92 1FPN3 4P5HA 5AVPA 3H7JA 4UYBA 4GWNA 2Q8CA 3ZDVA 2E6VA 2FCTA 1RUI1 1Y43B 4QX3A 3LAGA 5DAQA 2PTMA 2WZR1 1NOVA 2NPIA 1RXGA 1ZZ8A 3POEA 5GLVA 1YXWA 3KVAA 2W9XA 5FLJA 4TYSA 3I2GA 1UU4A 2NMOA 1UN1A 3M3QA 1UKRA 5GJ6A 2WFF2 2Y6FA 4YVSA 1YHFA 5F5QA 1R64A 2PAEA 5EPAA 4BYYA 3Q9OA 1RC6A 3PU3A 1OQ1A 4S2DA 4F83A 4RFRB 2WZR3 4IEYA 3T1MA 3ZN4A 2HJIA 3HOBA 2QQIA 2P17A 1OF3A 4BQ2A 3RMXA 2R1BA 5L19A 1GV9A 1YNAA 2D5HA 4FQ4A 3O1MA 1NG0A 3ZM8A 3ZR6A 4IGOA 4QWNA 3IAQA 3SISA 1PK6B 1A3KA 1WLTA 4JZRA 3VBUB 3D82A 2IXHA 3EJKA 2FHRA 3NV1A 2WO2A 5D8AA 3OGRA 5LEKA 3LEKA 2J1TA 5KXDA 3AZXA 4OUSA 1Q5OA 1Z0HA 4XJAA 4DUVA 2MNGA 4UFHA 5CFDA 1MZFA 4Q0PA 2JDPA 4QX1A 5FO7B 1G9AA 3BI3A 3HT1A 2AEZA 2YGMA 3OEAA 4LR4A 4XIOA 3RDIA 4CU9A 2JDUA 2XQRA 3H8XA 4XF3A 1BYHA 1VBE2 1VAKA 2YMZA 5FZ8A 3NJZA 2L9LA 3AYDA 1DP0A 1MZEA 2HWF1 2ZJCA 3B7MA 4UFKA 3I7DA 4NIIA 4LBNA 5C5UA 1GKBA 1AUYA 3WXPA 1VAMA 2ZZQA 4D8MA 1JZ3A 1BEV2 1UF2C 3NKGA 3WQ7A 4J1WA 3MZHA 3RFRA 2V72A 4YARA 1H8TB 1FV2A 4Q0QA 4FPYA 2YXSA 4XETA 1RJ7A 2VOKA 3OGVA 4Z82A 2XL9A 5T5OA 3OG2A 1RUJ2 2Q4SA 4H7LA 3ZKUA 4AFCA 2QJVA 4QPGC 2WNEA 3HNMA 2J1SA 3NWKA 4X6QB 2VOVA 4Q4V2 5KC6A 3IDAA 1REDA 1NYWA 3FZ3A 5FY5A 4AVAA 5J36A 2JEMA 4B4PA 5T5LA 4NIHA 4MYEA 1LU2A 5JZGB 3AZYA 2PHTA 3DYMA 3T0BA 2XMLA 1WW4A 1J83A 4G9SB
chains in the Genus database with same CATH topology
1UZ0A 2W94A 3ETPA 2VZQA 3K77A 3IAPA 5JXGA 2KD7A 2VQUA 4JKMA 1DYOA 4ZZ8A 5C71A 3MUY1 1NUKA 4W50A 3CZUA 1CZVA 3WNOA 4W8JA 3AC0A 2VC9A 3NRUA 1F4HA 1TVGA 2W1UA 3LE0A 4BK5A 1JYNA 5EIYB 1KGYA 2XOMA 1W8OA 2WDBA 3LPFA 2VMEA 5JMOA 1OF4A 2WN2A 5JUVA 3OGSA 2W95A 1WKYA 2EIBA 1OD3A 2WZ8A 1BHGA 2QQMA 3NNGA 1L7RA 4QX2A 4RN5A 3T08A 1JZ8A 2Y6GA 4BK4A 2VCCA 1PX4A 4M4RA 1NX9A 2W1QA 4MGSA 1TG7A 1JI6A 3I2KA 1UMHA 1W8NA 2YFZA 2WZEA 3OB8A 5LCWL 1DLCA 5JXIA 2Y6LA 1JZ6A 4CU6A 3WNKA 2WYSA 1PMJX 4A3ZA 3ABZA 3I2FA 1UMIA 3A22A 1D7PM 4ARYA 1NAEA 3VD5A 2J1VA 3PUHA 1UY4A 2QQOA 2VMDA 5DMYA 4XUTA 3A23A 3MBWA 1L7QA 4KWUA 2Y64A 3I3DA 1UX7A 1JYWA 2E26A 2ZEWA 5A1AA 3DECA 2J1UA 4QPWA 4OYUA 1GQPA 3U37A 1UY3A 3WF1A 1W9TA 1YQ2A 4ET7A 3FHAA 3HEIA 2W47A 4CU7A 4JKLA 2VJXA 2BBAA 2BGOA 3ACHA 4LHSA 4QX0A 3W5MA 2BZDA 3WF0A 2XQXA 2E33A 2VZTA 3NQHA 3DYOA 2YC2A 1UXXX 1UYZA 2WUHA 3E1F1 4XUQA 3IB3A 2VZPA 2WO1A 1ULPA 2VZSA 3I3BA 1GOFA 5JR2A 4IUGA 1GNYA 2V4VA 3VDAA 3OEBA 1O8SA 4XUOA 5DPNA 4BDVB 2W5FA 1LNSA 1EUTA 2JKXA 5LA0A 1GUIA 3FN9A 4KMQA 4A6OA 3SKVA 4MGQA 2W1SA 3IIIA 4LQRA 5IYYA 2ZEZA 1J84A 2J1EA 2EICA 3K75B 3BGAA 4A42A 4DXRA 1PX3A 2YC4A 2J7MA 3C7HA 2WQ8A 3HPNA 1UWWA 2DCJA 2XHNA 2V5DA 2QQKA 4P02B 2QBXA 1HN1A 3C8XA 4W4ZA 4LKSA 1XNTA 4CUBA 2YG0A 2W91A 2X05A 3THDA 4LPLA 3BN6A 4QDSA 1UY0A 2WABA 3T0DA 3CIHA 2B4KA 2HYXA 2VCBA 2X10A 3HN3A 3K4ZA 2PQSA 4QDQA 2RJ2A 3CMGA 1UY1A 4JHZA 2LS6A 4UOJA 2RVAA 3W5NA 3ACFA 3LPGA 2C9KA 2JE8A 4GWIA 2LW8A 4XUPA 3EYPA 4DXTA 2WBKA 2VZ1A 2VR4A 4E8DA 2VZVA 1XNAA 4DXSA 1K42A 2X09A 4CVUA 2E32A 3A21A 1GMMA 4OMDA 3WQBA 1UXZA 3J7HA 1H6YA 2VZUA 1P8JA 5C70A 5J1XA 3GGLA 3MO4A 4QB1A 3WEZA 2YB7A 1UYXA 2JD9A 4PF1A 4E8CA 1W99A 4BJ0A 4KI5M 3FHQA 3K4DA 2CDOA 4MADA 4XUNA 5IFTA 1JYVA 2EIEA 5B4XA 1GOGA 1EUUA 1T2XA 4P00B 2ZXQA 2BERA 2WAAA 1OT5A 1KEXA 4BXSV 2EIDA 3C7GA 4A4AA 3NJVA 1CZTA 4ZY9A 1K45A 1OH4A 2W1WA 2R7EB 2VTFA 3WNLA 3SEEA 5G05L 3WF2A 2QQLA 3LQCA 4DEQA 2YFUA 5F7UA 2XONA 3F2ZA 3SEPA 2QQNA 3NJXA 4ZZ5A 3PUIA 5LA1A 3DYPA 1W9WA 4D0QA 2WN3A 4JX0A 2VL4A 1RYYA 3THCA 1JZ2A 1W0NA 3JXSA 2W46A 3D3AA 2VMFA 3HJRA 2VZ3A 4GZ9A 3T09A 3I97A 2DCKA 3GDBA 2Y6HA 3OBAA 3MUZ1 3VD4A 2J1RA 3EB7A 2ORZA 2VM9A 4CU8A 4TXWA 1JU3A 5IFPA 5IHRA 3T2PA 1CIYA 3CKHA 2OKXA 4MOAA 5LA2A 4TTGA 2VOTA 1PMHX 2ORXA 3P6BA 4QDRA 5CYYA 4PQQA 4XVHA 1NKGA 1ULOA 4P08A 4XURA 3WSOA 2WO3A 3VDCA 5DN2A 5JXHA 1XPWA 3WNMA 1JYXA 3MV11 2J1AA 3A7QA 3K46A 2DDUA 1UYYA 3UETA 1JU4A 2Z4FA 3CZJA 2HLEA 4YPJA 3SKJE 3CDZB 4CUAA 4OZOA 3I2IA 4P5YA 5EJ1B 4M4PA 4QAWA 5CZKA 4MO3M 4OMCA 2W92A 3VD9A 1O59A 4QB6A 3T2OA 1CX1A 2CDPA 3I2JA 3I2HA 3K4AA 2ZEYA 3P1IA 4PT6A 5JXJA 3WNNA 1UY2A 5IJRA 2ZEXA 2VQTA 5B4NA 2WAOA 4Z2AA 3T2QA 2RV9A 2BGPA 1MPXA 1IQDC 3VD3A 3HNYM 4QB2A 1US3A 3CQOA 4AAXA 1I5PA 2ID4A 5FUIA 3WF3A 3C7EA 3GXUA 3ECQA 5C7GA 2B9VA 3MV01 3WF4A 1JZ7A 2VO5A 4QX3A 3C7FA 2QQJA 4DEVA 1W9SA 4ZXEA 4RYDA 2E31A 4DUXA 2W9XA 3I2GA 1JZ4A 3WNPA 2VZRA 2J22A 1R64A 3LEIA 1WCQA 3UESA 4ARXA 1K12A 1K3IA 2W87A 3HOBA 1SHWB 2QQIA 1SG3A 1OF3A 1JZ5A 3ZM8A 4DUWA 3IAQA 1GOHA 2C4XA 1H6XA 1JHJA 3HNBM 2WO2A 3OGRA 3LEKA 2J1TA 4DUVA 5EJZB 2JDAA 5DQ0A 3ACGA 4UI9L 4QX1A 4A44A 3OEAA 1CZSA 2VMCA 3T0AA 4CU9A 4OUEA 2VZOA 1XC6A 2Y8KA 1GU3A 1O8PA 3GM8A 4AG4A 2L9LA 1DP0A 4L0PA 3C7OA 4A41A 4A45A 4HG6B 5I0DA 2W3JA 5HXMA 3FL7A 4D8MA 4GWJA 1JZ3A 2C26A 4UAPA 1F4AA 4CUCA 3I3EA 2V72A 4JKKA 4FI9A 3VDBA 3OGVA 2Y6KA 2Y6JA 3VD7A 3OG2A 3UNPA 5HPOA 2VCAA 3LEGA 3HNMA 2J1SA 3IDAA 3ACIA 1SDDB 1US2A 3DYMA 3T0BA 5G04L 1J83A 4XZUG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UZ0 A;  2W94 A;  3ETP A;  2VZQ A;  3K77 A;  3IAP A;  5JXG A;  2KD7 A;  2VQU A;  4JKM A;  1DYO A;  4ZZ8 A;  5C71 A;  3MUY 1;  1NUK A;  4W50 A;  3CZU A;  1CZV A;  3WNO A;  4W8J A;  3AC0 A;  2VC9 A;  3NRU A;  1F4H A;  1TVG A;  2W1U A;  3LE0 A;  4BK5 A;  1JYN A;  5EIY B;  1KGY A;  2XOM A;  1W8O A;  2WDB A;  3LPF A;  2VME A;  5JMO A;  1OF4 A;  2WN2 A;  5JUV A;  3OGS A;  2W95 A;  1WKY A;  2EIB A;  1OD3 A;  2WZ8 A;  1BHG A;  2QQM A;  3NNG A;  1L7R A;  4QX2 A;  4RN5 A;  3T08 A;  1JZ8 A;  2Y6G A;  4BK4 A;  2VCC A;  1PX4 A;  4M4R A;  1NX9 A;  2W1Q A;  4MGS A;  1TG7 A;  1JI6 A;  3I2K A;  1UMH A;  1W8N A;  2YFZ A;  2WZE A;  3OB8 A;  5LCW L;  1DLC A;  5JXI A;  2Y6L A;  1JZ6 A;  4CU6 A;  3WNK A;  2WYS A;  1PMJ X;  4A3Z A;  3ABZ A;  3I2F A;  1UMI A;  3A22 A;  1D7P M;  4ARY A;  1NAE A;  3VD5 A;  2J1V A;  3PUH A;  1UY4 A;  2QQO A;  2VMD A;  5DMY A;  4XUT A;  3A23 A;  3MBW A;  1L7Q A;  4KWU A;  2Y64 A;  3I3D A;  1UX7 A;  1JYW A;  2E26 A;  2ZEW A;  5A1A A;  3DEC A;  2J1U A;  4QPW A;  4OYU A;  1GQP A;  3U37 A;  1UY3 A;  3WF1 A;  1W9T A;  1YQ2 A;  4ET7 A;  3FHA A;  3HEI A;  2W47 A;  4CU7 A;  4JKL A;  2VJX A;  2BBA A;  2BGO A;  3ACH A;  4LHS A;  4QX0 A;  3W5M A;  2BZD A;  3WF0 A;  2XQX A;  2E33 A;  2VZT A;  3NQH A;  3DYO A;  2YC2 A;  1UXX X;  1UYZ A;  2WUH A;  3E1F 1;  4XUQ A;  3IB3 A;  2VZP A;  2WO1 A;  1ULP A;  2VZS A;  3I3B A;  1GOF A;  5JR2 A;  4IUG A;  1GNY A;  2V4V A;  3VDA A;  3OEB A;  1O8S A;  4XUO A;  5DPN A;  4BDV B;  2W5F A;  1LNS A;  1EUT A;  2JKX A;  5LA0 A;  1GUI A;  3FN9 A;  4KMQ A;  4A6O A;  3SKV A;  4MGQ A;  2W1S A;  3III A;  4LQR A;  5IYY A;  2ZEZ A;  1J84 A;  2J1E A;  2EIC A;  3K75 B;  3BGA A;  4A42 A;  4DXR A;  1PX3 A;  2YC4 A;  2J7M A;  3C7H A;  2WQ8 A;  3HPN A;  1UWW A;  2DCJ A;  2XHN A;  2V5D A;  2QQK A;  4P02 B;  2QBX A;  1HN1 A;  3C8X A;  4W4Z A;  4LKS A;  1XNT A;  4CUB A;  2YG0 A;  2W91 A;  2X05 A;  3THD A;  4LPL A;  3BN6 A;  4QDS A;  1UY0 A;  2WAB A;  3T0D A;  3CIH A;  2B4K A;  2HYX A;  2VCB A;  2X10 A;  3HN3 A;  3K4Z A;  2PQS A;  4QDQ A;  2RJ2 A;  3CMG A;  1UY1 A;  4JHZ A;  2LS6 A;  4UOJ A;  2RVA A;  3W5N A;  3ACF A;  3LPG A;  2C9K A;  2JE8 A;  4GWI A;  2LW8 A;  4XUP A;  3EYP A;  4DXT A;  2WBK A;  2VZ1 A;  2VR4 A;  4E8D A;  2VZV A;  1XNA A;  4DXS A;  1K42 A;  2X09 A;  4CVU A;  2E32 A;  3A21 A;  1GMM A;  4OMD A;  3WQB A;  1UXZ A;  3J7H A;  1H6Y A;  2VZU A;  1P8J A;  5C70 A;  5J1X A;  3GGL A;  3MO4 A;  4QB1 A;  3WEZ A;  2YB7 A;  1UYX A;  2JD9 A;  4PF1 A;  4E8C A;  1W99 A;  4BJ0 A;  4KI5 M;  3FHQ A;  3K4D A;  2CDO A;  4MAD A;  4XUN A;  5IFT A;  1JYV A;  2EIE A;  5B4X A;  1GOG A;  1EUU A;  1T2X A;  4P00 B;  2ZXQ A;  2BER A;  2WAA A;  1OT5 A;  1KEX A;  4BXS V;  2EID A;  3C7G A;  4A4A A;  3NJV A;  1CZT A;  4ZY9 A;  1K45 A;  1OH4 A;  2W1W A;  2R7E B;  2VTF A;  3WNL A;  3SEE A;  5G05 L;  3WF2 A;  2QQL A;  3LQC A;  4DEQ A;  2YFU A;  5F7U A;  2XON A;  3F2Z A;  3SEP A;  2QQN A;  3NJX A;  4ZZ5 A;  3PUI A;  5LA1 A;  3DYP A;  1W9W A;  4D0Q A;  2WN3 A;  4JX0 A;  2VL4 A;  1RYY A;  3THC A;  1JZ2 A;  1W0N A;  3JXS A;  2W46 A;  3D3A A;  2VMF A;  3HJR A;  2VZ3 A;  4GZ9 A;  3T09 A;  3I97 A;  2DCK A;  3GDB A;  2Y6H A;  3OBA A;  3MUZ 1;  3VD4 A;  2J1R A;  3EB7 A;  2ORZ A;  2VM9 A;  4CU8 A;  4TXW A;  1JU3 A;  5IFP A;  5IHR A;  3T2P A;  1CIY A;  3CKH A;  2OKX A;  4MOA A;  5LA2 A;  4TTG A;  2VOT A;  1PMH X;  2ORX A;  3P6B A;  4QDR A;  5CYY A;  4PQQ A;  4XVH A;  1NKG A;  1ULO A;  4P08 A;  4XUR A;  3WSO A;  2WO3 A;  3VDC A;  5DN2 A;  5JXH A;  1XPW A;  3WNM A;  1JYX A;  3MV1 1;  2J1A A;  3A7Q A;  3K46 A;  2DDU A;  1UYY A;  3UET A;  1JU4 A;  2Z4F A;  3CZJ A;  2HLE A;  4YPJ A;  3SKJ E;  3CDZ B;  4CUA A;  4OZO A;  3I2I A;  4P5Y A;  5EJ1 B;  4M4P A;  4QAW A;  5CZK A;  4MO3 M;  4OMC A;  2W92 A;  3VD9 A;  1O59 A;  4QB6 A;  3T2O A;  1CX1 A;  2CDP A;  3I2J A;  3I2H A;  3K4A A;  2ZEY A;  3P1I A;  4PT6 A;  5JXJ A;  3WNN A;  1UY2 A;  5IJR A;  2ZEX A;  2VQT A;  5B4N A;  2WAO A;  4Z2A A;  3T2Q A;  2RV9 A;  2BGP A;  1MPX A;  1IQD C;  3VD3 A;  3HNY M;  4QB2 A;  1US3 A;  3CQO A;  4AAX A;  1I5P A;  2ID4 A;  5FUI A;  3WF3 A;  3C7E A;  3GXU A;  3ECQ A;  5C7G A;  2B9V A;  3MV0 1;  3WF4 A;  1JZ7 A;  2VO5 A;  4QX3 A;  3C7F A;  2QQJ A;  4DEV A;  1W9S A;  4ZXE A;  4RYD A;  2E31 A;  4DUX A;  2W9X A;  3I2G A;  1JZ4 A;  3WNP A;  2VZR A;  2J22 A;  1R64 A;  3LEI A;  1WCQ A;  3UES A;  4ARX A;  1K12 A;  1K3I A;  2W87 A;  3HOB A;  1SHW B;  2QQI A;  1SG3 A;  1OF3 A;  1JZ5 A;  3ZM8 A;  4DUW A;  3IAQ A;  1GOH A;  2C4X A;  1H6X A;  1JHJ A;  3HNB M;  2WO2 A;  3OGR A;  3LEK A;  2J1T A;  4DUV A;  5EJZ B;  2JDA A;  5DQ0 A;  3ACG A;  4UI9 L;  4QX1 A;  4A44 A;  3OEA A;  1CZS A;  2VMC A;  3T0A A;  4CU9 A;  4OUE A;  2VZO A;  1XC6 A;  2Y8K A;  1GU3 A;  1O8P A;  3GM8 A;  4AG4 A;  2L9L A;  1DP0 A;  4L0P A;  3C7O A;  4A41 A;  4A45 A;  4HG6 B;  5I0D A;  2W3J A;  5HXM A;  3FL7 A;  4D8M A;  4GWJ A;  1JZ3 A;  2C26 A;  4UAP A;  1F4A A;  4CUC A;  3I3E A;  2V72 A;  4JKK A;  4FI9 A;  3VDB A;  3OGV A;  2Y6K A;  2Y6J A;  3VD7 A;  3OG2 A;  3UNP A;  5HPO A;  2VCA A;  3LEG A;  3HNM A;  2J1S A;  3IDA A;  3ACI A;  1SDD B;  1US2 A;  3DYM A;  3T0B A;  5G04 L;  1J83 A;  4XZU G; 
#chains in the Genus database with same CATH topology
 3PU8 A;  3AXE A;  2Y0I A;  3BU0 A;  3N7L A;  2GAL A;  3K77 A;  3N36 A;  4A6S A;  2BVV A;  3TB0 A;  3ES4 A;  3IAP A;  5L7O B;  1FI2 A;  2WS9 3;  3NO8 A;  4OHX A;  2A6W A;  4W6Y A;  5M0T A;  2E53 A;  4WBB A;  5FUP A;  4Q5O A;  1VRH 3;  1HRV 2;  1UIK A;  1RIN A;  3MUY 1;  5D21 A;  1NUK A;  5F5I A;  4COW A;  4YM0 A;  1MQT C;  4FCA A;  5I93 A;  3O1U A;  3CZU A;  1N1Y A;  4XAA A;  5A3O A;  4XFH A;  3AC0 A;  2VC9 A;  3NRU A;  2O8Q A;  3LKJ A;  1YFX A;  5BNP A;  5LY1 A;  1XSR A;  5A6Q A;  1OMI A;  2WWS A;  3GBG A;  1CES A;  1FX5 A;  3PVE A;  2W1U A;  2GN3 A;  3ZN6 A;  1JYN A;  3O14 A;  1RUF 1;  1QJU 3;  4NWW A;  5A33 B;  4NVP A;  5CB7 A;  1WW7 A;  3USU A;  5KHI A;  4LK6 A;  1VBD 1;  3RYK A;  2DBN A;  4LHK A;  1CAX B;  2PHX A;  4N7U A;  4B29 A;  5I91 A;  4CXY A;  2PMW B;  1OF4 A;  5CA6 A;  2F4P A;  3KSC A;  4MLO A;  3OGS A;  3AP4 A;  2W68 A;  1YFW A;  3QAC A;  2WT1 A;  1O4T A;  1OD3 A;  2NZ9 A;  2WZ8 A;  1SQ4 A;  3RS6 A;  1BHG A;  4LXL A;  1PIV 3;  4QMA A;  2QQM A;  3NJY A;  4RN5 A;  5FZC A;  2D93 A;  4BPZ A;  1QJE A;  2VOW A;  1F35 A;  1VRH 1;  4HON A;  4R9A A;  3AKP A;  5C9A A;  2SLI A;  2W1Q A;  3PJQ A;  4XZU G;  1EPW A;  5CG9 A;  1YQ5 A;  4CDU B;  3J8F 3;  4D7T A;  2F4L A;  3JBG 3;  3NAP B;  5A7S A;  3I2K A;  5FQ0 B;  4AVV A;  5J96 B;  3AB0 A;  4LBQ B;  2JG9 C;  5IK4 A;  4U36 A;  3PVO A;  1CIW A;  1Y7B A;  3KCX A;  4FPH A;  1DLC A;  1FAT A;  3AKT A;  3AZV A;  4LOT A;  5F2S A;  5JXI A;  2VCM A;  2WYS A;  3GJA A;  3HBK A;  4A3Z A;  5F8P A;  2D5F A;  3A22 A;  1GZW B;  4I09 A;  4UFL A;  2RS1 2;  1FOD 3;  3AKR A;  3IDC B;  1OA2 A;  4GAZ A;  1YWK A;  2J1V A;  5CKQ A;  1E5R A;  2XJT A;  3MF9 A;  4K8F A;  4HAN A;  3MBW A;  4WM7 A;  5L9R A;  4KWU A;  1LEM A;  2OZJ A;  3WP6 A;  3I59 A;  3I3D A;  4RS5 B;  4P9X A;  4JAA A;  1JYW A;  1CAV A;  3RNS A;  1NA1 A;  1HN0 A;  1Q43 A;  1C8M 3;  3SXW A;  4O65 A;  4R9C A;  3WCS A;  4XAB A;  2GN7 A;  4QPW A;  5A3T A;  5ACA 2;  5C8C B;  4AHX A;  1GQP A;  1D2Q A;  3TEY A;  1W90 A;  3L9J T;  1ZRE A;  1YQ2 A;  5E88 A;  3FHA A;  2WNU B;  2EVX A;  2WNV A;  2RM2 1;  4ZXK A;  3U78 A;  5C3P A;  5JOX A;  5SV5 A;  1DLL A;  1MS5 A;  5IVY A;  3ZYP A;  2B7Y A;  2UYA A;  4COZ A;  1COV 3;  4D6R A;  4CU7 A;  1E57 A;  2XXZ A;  4QXH A;  3LWC A;  2BZD A;  1H8T A;  2ZA9 A;  2ZGP A;  4J25 A;  2NYY A;  2OPK A;  3NQH A;  2YC2 A;  5FWE A;  4ES8 A;  4LOS A;  4QXC A;  2OT7 A;  2IVJ A;  4GH4 A;  4M01 A;  1ZZC A;  4L92 A;  4XUQ A;  3SC7 X;  1X9T A;  4KG0 A;  4XHB A;  3WG3 A;  4AI8 A;  4B8E A;  1SLC A;  1VBE 3;  1H2L A;  2ET1 A;  1XOY A;  5JOW A;  2DUR A;  3UKN A;  5I0R A;  2FD8 A;  4NJ4 A;  4A7Z A;  4M3C F;  2XLG A;  3FMG A;  5FZI A;  5JLV A;  5AC9 2;  5FP4 A;  1YYN A;  1ZNP A;  2WNU C;  4LHL A;  5A70 A;  3JU9 A;  1NCQ B;  4Q4Y 2;  3VZO A;  3HQR A;  3WDT A;  4XUO A;  2OQ6 A;  3IKW A;  5CFD B;  2IXL A;  1RHI 2;  3GYD A;  3LA2 A;  3DPR B;  1OFN A;  1F15 A;  3MIF A;  2JKB A;  3TEW A;  3KV4 A;  1CJP A;  2DBI A;  5FYH A;  4JDO A;  1OPM A;  5GKA C;  4C0H A;  1VRH 2;  3CBN A;  4QD2 A;  2E63 A;  4QPI A;  4HXC A;  4KMQ A;  4XFA A;  5DDJ 3;  3T3Y A;  4A6O A;  1D4M 2;  1QNW A;  2J42 A;  4FPJ A;  5EZW A;  4AFD A;  3S6P A;  3ZYJ B;  5LA9 A;  1Q8O A;  1QJY 1;  5CEH A;  1RUG 2;  4Q4V 3;  4IET A;  5IYY A;  3KD4 A;  4BU2 A;  2JIJ A;  2ZEZ A;  4BH9 A;  3CEW A;  5A3P A;  1IS4 A;  2FMY A;  4NHM A;  5DUW A;  4IES A;  1TEI A;  1GWK A;  2WQ8 A;  3HPN A;  1AR8 2;  5DDJ 1;  1BBT 3;  2DCJ A;  4YG3 A;  1SLB A;  4HKO A;  1AF9 A;  4IEQ A;  3T2T A;  2H6C A;  5EP9 A;  3BTA A;  4O9G A;  1RUE 3;  5FYZ A;  3QOP A;  2QQV A;  4QQO A;  4Y1Z A;  4EN9 B;  1VBA 3;  1SCS A;  3WUD A;  5FZD A;  4FPC A;  2GND A;  4Q1P A;  5FMB A;  3KS7 A;  2FDI A;  2UYB A;  1AXY A;  1KXG A;  3ZIX A;  2A6Y A;  3C8X A;  5A1L A;  4LKS A;  1XNT A;  3H8R A;  4AFB A;  3S7E A;  1QJZ A;  4CUB A;  5EQU A;  2BYV E;  1AXZ A;  1BVP 1;  1V6J A;  3V64 A;  2VBD A;  4L99 A;  3THD A;  4B1L A;  2HEW F;  4GQ7 A;  1LRH A;  3RZL A;  1POQ A;  4NRP A;  4AE2 A;  4QDS A;  4RGG A;  4GMP 1;  3IMN A;  4RFT 0;  1OVS A;  1DQ0 A;  4RGK A;  3U4S A;  5BNN A;  4CEY C;  4LUK A;  5LY2 A;  1CD3 G;  4PIY A;  5C4W B;  1ZRF A;  3CIH A;  1PZ7 A;  1FNZ A;  2X10 A;  2ZAB A;  4Y26 A;  1I6X A;  1W2A X;  4DFS A;  2RJ2 A;  1PO2 3;  1V9U 1;  3ILF A;  2LS6 A;  4FOQ A;  4HN1 A;  2RM2 3;  3PIJ A;  4BQ1 A;  2R07 3;  2JE8 A;  2DVB A;  2XUM A;  4L11 A;  4XUP A;  4IV3 A;  1RUH 3;  2D3R A;  2YGL A;  5FZK A;  4FTS A;  3EYP A;  1R08 2;  1VBC 1;  1XYN A;  2KM2 A;  3AMH A;  2WBK A;  1XYP A;  3ACL A;  3FBY A;  4K6B A;  5CFC A;  5JSR A;  5L9V A;  1PIV 2;  1AX2 A;  4XFI A;  3JD7 3;  1S1A A;  3E6B A;  4BLI A;  5LW9 A;  4K1Y A;  1W8T A;  2Z69 A;  1JYT A;  2HWC 3;  2W52 A;  4GJY A;  5EHD A;  3HR9 A;  5FYC A;  1V6L A;  3A21 A;  3GBW A;  1GMM A;  3E6D A;  3W59 A;  3PUA A;  4QQ2 A;  3L2H A;  4YM2 A;  4CCD A;  2ET7 A;  4PCR A;  1AYN 3;  3EO6 A;  3ZN5 A;  4Z07 A;  1H2N A;  4OCT A;  5FP3 A;  4CSW A;  3MIC A;  3K3N A;  3WEZ A;  1UYX A;  2JD9 A;  3NAP A;  4Y3O A;  2YU2 A;  4PF1 A;  1GP6 A;  4WVV A;  2WO7 A;  2EAL A;  2RS5 2;  4TN7 A;  4N90 A;  2HWB 2;  1G9B A;  4BJ0 A;  1NCR A;  2GH8 A;  4XCA A;  4D3W A;  5C9A B;  1U5Z A;  2DCZ A;  2P3Y A;  5L36 A;  4OI0 A;  5TSW A;  4FTE A;  5FXZ A;  4XUN A;  3ZXL A;  4HVR A;  2EIE A;  4E2Q A;  2AEY A;  5A7O A;  1GOG A;  2A5Z A;  1ZBA 3;  2JIC A;  3OPT A;  1T2X A;  4TSV A;  2YHJ A;  3ZR5 A;  4PDW C;  4LLF A;  3CJI B;  3PHM A;  2R30 A;  1DGL A;  1W8W A;  3O1V A;  4Q4W 3;  4UXA A;  1FPN 2;  4W6W A;  1PHM A;  1CZT A;  3FX3 A;  3AMM A;  4RHV 3;  1YC6 1;  3EXU A;  3I8T A;  3O5S A;  1K45 A;  4RS5 A;  3HIF A;  1CGP A;  1OH4 A;  5J3U A;  5BNP B;  3RWN A;  5BUV A;  2VTF A;  5FY0 A;  3SEE A;  2NN8 A;  2VH9 A;  3ZN6 B;  2GMM A;  4DEQ A;  1UYP A;  3SLI A;  3SEP A;  4ZU7 A;  4CDU C;  5LBE A;  5I8Y A;  4XFB A;  4A7K A;  1CWP A;  1ND2 C;  1RVF 2;  1VLN A;  4JRL A;  4NPL A;  2AH2 A;  3OBZ A;  1V6O A;  5FP9 A;  1S0J A;  2D6O X;  1RYY A;  2VAU A;  4SBV A;  1GAN A;  2QKD A;  1UMZ A;  2KA3 A;  4DIQ A;  1JOD A;  4RQP B;  2ZHL A;  1W0N A;  4IEP A;  2W46 A;  1MAC A;  2B42 B;  3D3A A;  2VMF A;  3BU7 A;  3T09 A;  1BK1 A;  5KC5 A;  2Y6H A;  3MUZ 1;  1OFS A;  3QH6 A;  4MGZ E;  3QCW A;  1D0H A;  3VD4 A;  3KF5 A;  4A2U A;  1WA6 X;  5IK8 A;  1S0F A;  2XKO A;  1J3P A;  3AX4 A;  3RGB A;  4CP2 A;  1WW6 A;  3R6S A;  3WR0 A;  3ZYG A;  4XBL A;  4BQW A;  5C8C C;  4CU8 A;  3IM0 A;  3VHP A;  4QU1 A;  5EFU A;  3WVJ A;  5AC9 1;  3WOG A;  1YIF A;  5T5J A;  4HPK A;  4RHV 1;  1QWR A;  4JDN A;  1SEF A;  2CHH A;  3Q8B A;  1SZB A;  2OKX A;  4MOA A;  2N7G A;  1Q8S A;  4Y22 A;  3POJ A;  4KU7 A;  2R07 2;  1XU2 A;  4KNC A;  1NLR A;  1HQL A;  3PVN A;  1SFP A;  2GP5 A;  3MHZ A;  1RUD 2;  2VXR A;  2VOT A;  1WW5 A;  3M4F A;  3WHU A;  1CPM A;  3R0R A;  1PO2 2;  1XJA A;  4P08 A;  4XUR A;  5C3O A;  5FYV A;  4GD4 A;  2WR9 A;  3POY A;  4UFJ A;  2PLV 3;  3KV6 A;  4FFH A;  2QZ3 A;  3H3Z A;  2J1A A;  3K46 A;  4DS0 A;  5ABJ A;  2DDU A;  3AL6 A;  4YLZ A;  2VW1 A;  3T30 A;  1OA4 A;  4Z92 B;  3KM5 A;  3UET A;  1JU4 A;  1N3Q A;  1U0A A;  4FAG A;  1CAU B;  2R07 1;  1OKQ A;  3SKJ E;  3UKV A;  1RUH 1;  1QJU 2;  3MF6 A;  4CPB D;  4CUA A;  5CG8 A;  1N1S A;  2B46 X;  4N9H A;  1S0I A;  4OZO A;  2A3X A;  2PEL A;  1AR6 2;  2CAV A;  2XHK A;  1YJK A;  4QAW A;  4YRD A;  4N43 B;  3APB A;  1QIQ A;  2A6Z A;  3VD9 A;  1RXF A;  1IQA A;  1UD1 A;  4NR1 A;  3UV9 A;  1Q8Q A;  1GWL A;  3WDW A;  4OUM A;  2KXL A;  2DCT A;  4JDM A;  3I2J A;  4URA A;  1T6G C;  5FPA A;  2R06 1;  1YUD A;  4UW4 A;  4PT6 A;  1WCS A;  2JDZ A;  2ARE A;  5FBZ A;  3G7D A;  1W2N A;  4E4Z A;  3CO2 A;  3GAL A;  2ZGM A;  2XVK A;  4OHV A;  4Y33 A;  3VBS C;  4LKE A;  2AYH A;  4PI0 A;  3OUJ A;  2D3S A;  3T2Q A;  2RV9 A;  2BGP A;  5SV8 A;  3KB5 A;  4NN0 A;  4YW2 A;  5KHJ A;  1IQD C;  3TN9 1;  2AR6 A;  2BUK A;  2VY0 A;  1LOB A;  5KHH A;  1HJF A;  3UGF A;  1US3 A;  1AR9 1;  2WFF 3;  4Q0S A;  1I5P A;  1PZ8 A;  4XQ4 A;  5FUN A;  3AMN A;  3C7E A;  3ECQ A;  1VBE 1;  2P37 A;  2B9V A;  3QH7 A;  5T55 A;  2VW0 A;  2XH6 A;  3GHM A;  1CAV B;  2OVU A;  3VZJ A;  1ZZ7 A;  1HXS 1;  4FT8 A;  5BNO C;  5FZ4 A;  1HLC A;  4COV A;  5A7W B;  3UJQ A;  4AQ6 A;  3L2Y A;  4RYD A;  5H9P A;  5CFC B;  1G7Y A;  1N3P A;  1PVC 2;  5FLH A;  4DUX A;  1QJX 2;  1RUI 3;  3DXU A;  4ZHN A;  2WSV A;  3LSE A;  1OVP A;  3LD8 A;  4XYX A;  4AWD A;  4OVE A;  2P6H A;  1FPN 1;  3ZFG A;  2UY8 A;  3AZW A;  4YZ2 A;  2J22 A;  1KD7 A;  2X8K A;  4N53 A;  1VMH A;  1I3H A;  3MIG A;  1KDK A;  4FOY A;  4ZU5 A;  2OS2 A;  2V4A A;  1FMD 2;  1K3I A;  4IDZ A;  1F9K A;  1W8H A;  1X33 A;  1HXS 3;  1MR5 A;  1W6M A;  3VBU C;  4AZZ A;  2OYZ A;  1RB8 G;  1J58 A;  4BWO A;  3CL1 A;  1COV 2;  2ZGS A;  4M0N A;  2CY6 A;  2DWR A;  2R0H A;  1OLR A;  4ZS3 A;  4BM8 A;  4BCU A;  3LOB A;  1UZZ A;  4X8N A;  3RI9 A;  5FFO C;  3AP7 A;  2C0Z A;  1GOH A;  1NE4 A;  4O7X A;  4Q8L A;  2VG9 A;  4XJ8 A;  4ORF A;  1JBC A;  2R0F A;  1JHJ A;  2CWS A;  3HNB M;  1BBT 2;  3H0O A;  4GMP 0;  5ANN A;  3ELN A;  3V65 A;  2Q8O A;  3LGR A;  2C24 A;  1APN A;  5DQ0 A;  4FP3 A;  3BOW A;  4NID A;  3PDQ A;  4A44 A;  3S30 A;  2K9Z A;  4AOC A;  4OUE A;  3AL5 A;  1S2E A;  3BTY A;  1F8V A;  2QE3 A;  1VPH A;  5CIS A;  3IWZ A;  2JG9 A;  1MS3 A;  1O8P A;  3GM8 A;  2JD4 A;  4YGD A;  1WME A;  4L97 A;  3BPS A;  4B4Q A;  4A41 A;  3U1X A;  4HG6 B;  2QFE A;  4CP9 A;  1KS4 A;  4TWT A;  3HQU A;  5HXM A;  1AHS A;  2PN5 A;  2AAC A;  3DL3 A;  4MGI E;  5EYY A;  4XAC A;  1WD3 A;  3ZDS A;  4PHZ A;  3GBF A;  4FPK A;  1HB4 A;  2YBK A;  1QH7 A;  1LED A;  4JKK A;  5A6Y A;  3FUO A;  3VHO A;  3VDB A;  1V6M A;  4AGV A;  3VD7 A;  3UNP A;  2RM2 2;  4CE8 A;  2Z42 A;  5HPO A;  2VCA A;  4QM9 A;  1PGW 1;  3O0W A;  4K9S A;  5LK7 B;  4B7K A;  4DMI A;  5JZG A;  1POV 3;  3FFQ A;  4UFM A;  4E4D X;  2VVE A;  1PK6 A;  1US2 A;  3WV6 A;  1HRV 3;  3B3Q E;  3ETP A;  3N9L A;  4Y5Z 0;  2NLR A;  2V73 A;  1R09 1;  1ASJ 3;  2XB6 C;  1S0G A;  4EN6 B;  2PHD A;  1H8T C;  2BEO A;  4KBB A;  5I8T A;  5C3Q A;  2RE9 A;  1JHN A;  1BXH A;  1XBF A;  3KZ4 C;  3NV2 A;  1LGN A;  4BIS A;  5HI0 A;  1UKG A;  2P5B A;  3VLB B;  1D4M 3;  1SLT A;  4LIT A;  1M06 G;  3W21 A;  5C71 A;  2MHF A;  2ZMN A;  2ZCW A;  1V70 A;  1UU5 A;  4OQ8 A;  3BOD A;  2YPJ A;  1CZV A;  1JYC A;  5FYS A;  3GCW A;  4JCK A;  5F3E A;  1RMU 3;  3TNQ A;  5ISL A;  5BNQ A;  1JYI A;  2WS9 1;  2UWC A;  4AFA A;  2DCY A;  1Q3E A;  1AR6 3;  1IHM A;  1MS9 A;  4BK5 A;  2CYF A;  1WLC A;  5F1R A;  3AVS A;  1KGY A;  4EJR A;  2XOM A;  5FO9 B;  2A3Y A;  3OBR A;  1GZ9 A;  3MIB A;  1W8O A;  4RD7 A;  2WDB A;  3VBO C;  5DZF A;  5J48 A;  2Y26 A;  1QMJ A;  1JOP A;  5BYN A;  5JVV A;  2JIG A;  2AC1 A;  5ABJ C;  2WN2 A;  1COV 1;  3VBS A;  4YVS C;  1TME 2;  1UO9 A;  3J7M A;  4MGK E;  1CR7 A;  3JD7 2;  4S2H A;  1UZV A;  1HV0 A;  1IGO A;  4B4R A;  5FPB A;  1FMD 1;  3RZK A;  5FQ0 A;  4GJZ A;  4I0W B;  1L7R A;  2YY1 A;  4QX2 A;  4QKF A;  3VKN A;  1KRI A;  5FXV A;  1PM4 A;  3LB9 A;  4CDU A;  5EXO A;  1NX9 A;  3AP9 A;  4AHW A;  3OCP A;  2RJK A;  4MGS A;  4Y5S A;  4CEW C;  1R09 3;  2HEV F;  2CGN A;  2ZAC A;  3PIG A;  2ZGR A;  5IAX A;  1G86 A;  2XDV A;  4IQP A;  3KT1 A;  5FPU A;  2XLF A;  3CLP A;  2EXK A;  3KV5 A;  2B9U A;  5BNO B;  1REE A;  2XWB B;  4IE6 A;  4Y1X A;  3ZXE A;  1LES A;  2Y6L A;  5FZB A;  2D98 A;  2XJQ A;  4C1X A;  4CU6 A;  4Y1Y A;  3N9O A;  1X50 A;  1UMI A;  1V6K A;  1XNB A;  1DQ5 A;  3VBF B;  1NAE A;  1A6C A;  5DZE A;  3FLP A;  3VD5 A;  4YVW C;  3NL1 A;  4YFW A;  1SFY A;  3ZSK A;  4YSF A;  1CPN A;  1IKP A;  2GC3 A;  3FJS A;  3O7O A;  3A23 A;  2YDE A;  4Q0U A;  4HFS A;  1L7Q A;  5DAB A;  3VBH B;  4NIA A;  4LO4 B;  1W8F A;  4WM7 B;  1CAX A;  4I0B A;  2ZEW A;  5A1A A;  3PL0 A;  1ST8 A;  4HSL A;  1FNY A;  2A7A A;  4XQD A;  3DEC A;  2JX9 A;  2R06 2;  2VOX A;  5FPZ A;  3WW1 A;  1DQ1 A;  3BIE A;  1XSQ A;  3VZL A;  1CN1 A;  4AGG A;  3ETQ A;  4Q4Y 3;  3U37 A;  1J1L A;  2W2I A;  4QHB A;  3POG A;  1UY3 A;  3AP5 A;  4AGR A;  1B35 B;  2VE1 A;  1GZT A;  4KG8 A;  2ERF A;  1OKO A;  2VUL A;  4HOO A;  2CGP A;  4FFF A;  5K0U A;  4ZU4 A;  5LK5 A;  2DUQ A;  2Y38 A;  2WLP A;  1EPZ A;  2BBA A;  2BGO A;  2VJX A;  2VPV A;  1K5J A;  5IVE A;  4L9B A;  1F5F A;  1D2S A;  4CA9 A;  2ZPX A;  5LAS A;  1O5U A;  3DYO A;  1GFF 2;  1QJF A;  2HWC 1;  2RDR A;  4RS5 C;  2QUO A;  2OQ7 A;  1UYZ A;  1RHI 3;  1GQG A;  1NA1 C;  2UUR A;  2ZGN A;  2ZX4 A;  5A7P A;  1RMU 1;  1SAC A;  5JPM B;  3MW3 A;  2VZP A;  4BIF A;  5JOZ A;  2R04 1;  2WO1 A;  1E5H A;  1NY7 2;  3D0S A;  1MVQ A;  1QY4 A;  4LO8 A;  3I3B A;  4A7Y A;  5LBB A;  1HB3 A;  4IUG A;  3U0Z A;  1GNY A;  1PO2 1;  1V9U 3;  2ZTN A;  4R9B A;  4WVM A;  5D8A C;  3VKF C;  3ZYR A;  4BB3 A;  3UGG A;  4FVV A;  4YW3 A;  3I4I A;  3O1T A;  1RIT A;  4DNY A;  1H9W A;  2YYO A;  1LNS A;  1EUT A;  1IG3 A;  1SBD A;  2JKX A;  2RR1 3;  3GZA A;  4IEV A;  4QQL A;  3THT A;  3FN9 A;  2CNA A;  2LUW A;  2R04 3;  3IPV A;  3NNM A;  4NMI A;  5IAT A;  5IVC A;  2EAK A;  1YFY A;  4QPI B;  2OII A;  5FBJ A;  4WM7 C;  5T52 A;  5I0T A;  2P3I A;  4LBK A;  1AYN 2;  2W1S A;  5JDB A;  4LQR A;  1OOP C;  1RL3 A;  2W08 A;  3AXD A;  3AYC A;  4XTP A;  1PO1 3;  1DIW A;  1H30 A;  2G4I A;  1YIP A;  4KGQ A;  1CJD A;  3AMP A;  1SMV A;  3WY6 A;  2RR1 1;  3B93 A;  1AR9 3;  1B35 C;  2WFF 1;  3AKQ A;  3RJ2 X;  4I01 A;  5JSO A;  2FDG A;  3H42 B;  4YW7 A;  1BMV 1;  1W3X A;  2P6C A;  5CFC C;  3WP3 A;  2XHN A;  4HKW A;  5IK5 A;  4BME A;  1ZRD A;  3WQ1 A;  5JMC A;  2ARB A;  4YNI A;  4PQ9 A;  1HN1 A;  1YO8 A;  2WFP A;  3FE5 A;  4JGY B;  3U07 A;  4BQ3 A;  4F7Z A;  5IT6 A;  1MS4 A;  4LNV A;  4XPV A;  3NKT A;  2GNT A;  4S2G A;  2YU1 A;  3FWE A;  2ETE A;  5FPL A;  2G19 A;  4GKX A;  2RDS A;  2YG0 A;  2EXJ A;  2W91 A;  4JRA A;  4M3C E;  1PGL 2;  1DGW A;  4LBQ A;  4DY5 A;  1PVX A;  4P9G A;  3BN6 A;  5FZF A;  4AED A;  1ND2 B;  1AR7 1;  4ITC A;  1UY0 A;  3T0D A;  2GSY A;  5JI9 A;  3ZOI A;  2LTN A;  4MXW B;  3UT0 A;  3UJO A;  1F31 A;  1PVC 3;  1A8D A;  1S0E A;  3P3P A;  2B4K A;  2VCB A;  3HN3 A;  2MEV 3;  2PQS A;  1EV1 1;  3J9S A;  3M8L A;  4IV3 C;  4NUB A;  1C8N A;  1SLL A;  1UY1 A;  4HSJ A;  4JHZ A;  4UOJ A;  1BVV A;  5HV0 A;  1O3S A;  4H3W A;  1QH6 A;  1LOG A;  1XE0 A;  2C9K A;  4GWI A;  1W6Q A;  4QU2 A;  1NA1 B;  5GLU A;  1B35 A;  3VUO A;  1ULD A;  5C9A C;  2R06 3;  4FO9 A;  1URX A;  4CEW A;  4I0A A;  2LM3 A;  2VNR A;  2PHU A;  2VZV A;  3ORJ A;  1XNA A;  5FYB A;  4DXS A;  5K9Y A;  5KHG A;  5C3S A;  1Z78 A;  2ZAA A;  3OSD A;  2GME A;  1W2U A;  4AI3 A;  1YRZ A;  3USS A;  4CVU A;  3FBM A;  2Z2S B;  1G9C A;  4BOW A;  2WRA A;  4OMD A;  4RQP A;  1UXZ A;  1ULE A;  5HBA A;  2KR2 A;  4LLO A;  4XOG A;  2FZ2 A;  4QHZ A;  1EAH 2;  1OQD A;  5I0S A;  4AI9 A;  1P8J A;  3S7I A;  2C6S A;  3MW4 A;  1KFX L;  5C70 A;  1VBB 2;  1VMF A;  2VQA A;  2WA3 A;  1R1A 1;  2YB7 A;  1S4C A;  4CPB A;  1J59 A;  1OXC A;  1HQN A;  1U12 A;  1MEC 3;  3J26 N;  3MGU A;  3THP A;  1JTZ X;  3OOX A;  2BNO A;  3DN7 A;  3HMY A;  4D7S A;  4PLN A;  3ME2 A;  3WW4 A;  5CAD A;  5T54 A;  4MAD A;  2IFW A;  5IFT A;  4QX8 A;  2WII B;  2GC1 A;  1S2B A;  4YM3 A;  1W6N A;  5HXV A;  3AYA A;  1XRU A;  3ON7 A;  4WV8 A;  3D0J A;  4EWD A;  2O0O A;  1GNZ A;  2D6N A;  2YPD A;  4AR2 A;  2WAA A;  1R08 1;  4NIG A;  1OT5 A;  2ZBJ A;  3O1P A;  4CEY B;  4XZP A;  4BXS V;  1MEC 1;  2Q1F A;  5IVJ A;  5KBF A;  1LHU A;  4MVT A;  4IEW A;  1XXN A;  3RQ0 A;  2D6P A;  1W03 A;  4DRV A;  3WNL A;  1M4W A;  1JMU B;  1CQ9 A;  1PGS A;  3K3O A;  5G05 L;  2A6V A;  3I59 B;  3WF2 A;  3E6C C;  1K5M C;  1KJL A;  3ZPY A;  5IVV A;  3F2Z A;  5FV3 A;  1QJX 3;  1RUI 2;  4AI2 A;  3DV8 A;  4YFZ A;  2JG8 C;  4CDW C;  2BWA A;  3NJX A;  3I3Q A;  4PI2 A;  4XDO A;  5ABJ B;  4UW3 A;  2PAM A;  1RVF 1;  1W9W A;  3KHB A;  3ZO0 B;  1VP6 A;  3WZ1 A;  5BY5 A;  5L7O C;  5FYT A;  1VR3 A;  2JDN A;  1BKZ A;  4IEO A;  3VBR C;  3URF A;  4LIV A;  3WQ0 A;  4CTE A;  2AEN A;  1RUN A;  1POV 0;  3KT4 A;  1SBF A;  2F17 A;  2XJV A;  2NM1 A;  3OYW B;  3AJZ A;  4M3C B;  3WDX A;  1LU1 A;  3M7A A;  1QXP A;  3KLS A;  3VZN A;  3DUI A;  3B00 A;  4XCB A;  1MQT B;  2OUJ A;  2OX0 A;  2VUJ A;  3OBA A;  2EA7 A;  2PAK A;  2X5I A;  2XLA A;  2ZAH A;  4RR3 A;  3Q8F A;  4J6G A;  3EB7 A;  3IT8 A;  1WUV A;  4CCM A;  1RJ8 A;  1ZBA 1;  4KGG A;  3HD8 B;  4GB3 2;  4H14 A;  4Y4R A;  1IZ3 A;  4TXW A;  2HH9 A;  3FLR A;  4WM8 C;  1RUC 1;  4YYO A;  5IFP A;  3DKW A;  1WWY A;  1CIY A;  2PYT A;  2PHL A;  4K20 A;  4EN7 B;  1UPS A;  2QQU A;  3CKH A;  2I45 A;  1D4M 1;  2DU1 A;  4PJY A;  5FMC A;  2HWD 2;  1C8M 2;  3C3V A;  1YJL A;  2Z79 A;  1R08 3;  2UU8 A;  4PBP A;  1VB4 A;  1LOC A;  1MS8 A;  3IN9 A;  4AEM A;  4W6X A;  4TTG A;  1LGC A;  5CYY A;  2WLQ A;  1QDO A;  4LKF A;  4PLM A;  2B39 A;  3HT2 A;  4QPG A;  1ASJ 1;  1Y9Q A;  5JXH A;  4Q27 A;  3B5L B;  1VMJ A;  3A7Q A;  2ZMK A;  2LRO A;  3B9C A;  5C33 A;  2HBU A;  1R1A 2;  4C0B A;  4B1M A;  1VBB 1;  1C4R A;  3CZJ A;  2RS3 1;  3VN4 A;  3E97 A;  1ENS A;  4DO0 A;  3D4K A;  5DG1 A;  3SCH A;  3I2D A;  3ZFF C;  1IG0 A;  1J1T A;  1UPI A;  2ZGO A;  4GH4 C;  5A7W A;  3WDU A;  3EQE A;  2JJ6 A;  2XL7 A;  3KMH A;  4IL7 A;  3RYR A;  2CV6 A;  4TLG A;  4P5Y A;  5EJ1 B;  4M4P A;  2DV9 A;  2QVS B;  4FTB A;  5J37 A;  4FPL A;  1X36 A;  1Y9G A;  5ACA 3;  4QGM A;  5J98 B;  4OMC A;  2JDY A;  4AVS A;  3WDV A;  1WCU A;  3BKZ A;  4LTA A;  3ZSE A;  2CDP A;  2HWB 3;  4YG6 A;  3NNF A;  1PK6 C;  3CNA A;  3VL9 A;  3ZXF A;  1DYK A;  1OLQ A;  3WNN A;  3IDE A;  1UQX A;  5KXC A;  3LA7 A;  4HN0 A;  1PZ9 A;  2ZEX A;  2DUP A;  4WVM B;  1LOF C;  2MEV 1;  2VGD A;  5B4N A;  3HBZ A;  4Q2F A;  4K1Z A;  2ARA A;  4AED C;  3ZMO A;  4CDQ A;  4HVQ A;  4YZ1 A;  2RMU 1;  1X8E A;  4MHR A;  2FQP A;  1AR7 2;  2DF7 A;  2R16 A;  3POI A;  3HNY M;  2JXA A;  4W65 A;  3WLU A;  1LHV A;  3ZFE B;  1X8M A;  3CQO A;  4XIK A;  2A71 A;  1OBN A;  3SQO A;  3W58 A;  1C1L A;  3WF3 A;  4ASM B;  4LT5 A;  1ENQ A;  4MET A;  4Z8B A;  3GXU A;  5C7G A;  3KQR A;  3M3E A;  2W39 A;  5DZG A;  5JIA A;  4C1W A;  5A33 A;  4BIO A;  5KXE A;  3RZM A;  5HCH A;  2WC2 A;  1Q56 A;  2D7F A;  3N9Q A;  1LOA A;  3C7F A;  1MQT A;  1QOS A;  4Y24 A;  4DEV A;  4XEZ A;  4ZXE A;  1C5I A;  4XFG A;  2E31 A;  3ZSL A;  3GZE A;  4O9E A;  5A7N A;  1OOP B;  3D6E A;  4DRR A;  1JZ4 A;  4BE3 A;  3WNP A;  3C2U A;  2D3P A;  4IEX A;  3WG1 A;  4ES9 A;  2RR1 2;  1IPK A;  1GR3 A;  2VZR A;  3PME A;  4ISQ A;  4R9D A;  3H1Y A;  1DGR N;  3LEI A;  3VBH C;  1WCQ A;  1GP5 A;  5FTT C;  4MXV A;  1K12 A;  3UES A;  2BP6 A;  4RR3 B;  3AFG A;  1XE8 A;  1UCX A;  4RSU A;  2WS9 2;  2W87 A;  2JB4 A;  1SHW B;  4AAP A;  1UZW A;  3WX5 A;  2K46 A;  1MS0 A;  1JZ5 A;  2GH2 A;  2ZHN A;  2HWF 3;  5A80 A;  4DUW A;  4HK8 A;  4I3P A;  2G9F A;  1NLQ A;  3LFM A;  1ND2 A;  3DXT A;  5A7Q A;  4OI1 A;  1AL0 G;  1AXK A;  1NLS A;  1H6X A;  2UWA A;  3SH5 A;  3WD5 A;  5LRS A;  5L7O A;  1VBA 2;  4YW5 A;  4GH4 B;  3J7N A;  5EJZ B;  4KBZ A;  1GSL A;  3NV4 A;  1REF A;  4CXW A;  3TN9 3;  2IZW A;  1I1E A;  1WCK A;  2DUO A;  3ACG A;  4UI9 L;  5FY4 A;  4CDQ B;  1D0G A;  3OY8 B;  4JGZ A;  1OUX A;  4AFM A;  3U14 A;  4EV0 A;  4I2O A;  2VMC A;  3T0A A;  4G4F A;  3VBO A;  2YBP A;  4Q4X 3;  5BNP C;  1HW5 A;  2VZO A;  3MYX A;  1XC6 A;  4HBN A;  1LKN A;  2H0V A;  1VAL A;  4QQH A;  4IV1 B;  1L7L A;  4AG4 A;  4L0P A;  1UL9 A;  2Q30 A;  3C7O A;  4RR3 C;  4DZG A;  1PO1 1;  3JQX A;  1VAV A;  5A3L A;  2QZ2 A;  3TN9 2;  4FPG A;  2GC0 A;  3OTF A;  1PGW 2;  5C8C A;  5ACA 1;  4UAP A;  4XFF A;  2WL1 A;  1F4A A;  1UOF A;  2UWB A;  3AK0 A;  1N1V A;  4NAM A;  4CUC A;  1DGR A;  4KQ7 A;  4XMA A;  3WP5 A;  4EWA A;  2I07 B;  2FMD A;  2WNO A;  2JDM A;  5E89 A;  1JOJ A;  1DQ4 A;  1IS3 A;  2PHF A;  4MV2 A;  1AYM 1;  5JZG C;  2O1Q A;  3MW2 A;  3LOI A;  1W2T A;  1YI9 A;  3A0N A;  3ZMN A;  3LEM A;  2CTV A;  3OPW A;  1BEV 3;  5G04 L;  2BQP A;  1UZ0 A;  5DUU A;  1HRI 1;  3CU7 A;  3GHN A;  5C3R A;  1ZZB A;  1AR6 1;  4O61 A;  4AL9 A;  3POW A;  2E9Q A;  2Y34 A;  5GM0 A;  1V6I A;  1JN2 P;  2IUW A;  1DYO A;  3J8F 1;  5C4W A;  1O4Z A;  4FAH A;  2DFB A;  2IWG B;  1H1A A;  1XU1 A;  5LZ6 A;  1JUH A;  5FAX A;  4HVO A;  3K48 A;  2NQY A;  1C3H A;  3TWI A;  4E2G A;  4JQT A;  4Q4W 1;  1S55 A;  2D44 A;  4W8J A;  1YQ6 A;  2ATF A;  3AFK A;  1GZC A;  4NRO A;  2JG8 B;  4CDW B;  3SH4 A;  1Q8P A;  2ZKN A;  1TME 3;  4EYU A;  4IE5 A;  2PXJ A;  2A1X A;  1XE7 A;  1F4H A;  3E5X A;  4TZD A;  1C28 A;  1TVG A;  3LE0 A;  2WZP P;  3LDR A;  5EIY B;  2Y33 A;  3MLL A;  3PUQ A;  4FXK B;  4IW3 A;  4KU8 A;  1LOD A;  4AVC A;  3LPF A;  5IK7 A;  5FLI A;  1EAH 3;  3OUH A;  4BXF A;  5FJK A;  4L2N A;  5FZH A;  5JUV A;  2W95 A;  5LWB A;  2P1B A;  1LAJ A;  1TME 1;  3VBS B;  5LB6 A;  4JHT A;  2FDK A;  1TMF 2;  4Q4W 2;  1H1I A;  1NY7 1;  5F2W A;  2RHP A;  3ZIW A;  2Y6G A;  3UGH A;  2GP3 A;  2VW2 A;  2LAL A;  1UOB A;  1BZW A;  1PX4 A;  4K3U A;  4M4R A;  1RVF 3;  3MIH A;  4YZ4 A;  4HKL A;  5HV4 A;  1HB2 A;  4HET A;  4QKB A;  2PHW A;  3H7Y A;  5EJ3 A;  5FRA A;  1W8N A;  4DY3 A;  5BNO A;  1TMF 3;  2ZGT A;  3JB4 C;  2WZE A;  5AFB A;  4NWV A;  4EN0 A;  3OB8 A;  2XKP A;  4CCN A;  3F95 A;  3H1W A;  3KCY A;  4AED B;  1RUO A;  1PMJ X;  1QXR A;  3CJI C;  1PIV 1;  1X9P A;  4QGL A;  2QQO A;  2K0G A;  4COY A;  1BQP A;  5E1R A;  4LBO A;  3B69 A;  1AYM 2;  2B5H A;  1F5J A;  2WWU A;  3LSD A;  4QPY A;  5FPX A;  4E27 A;  2Y64 A;  3N4M A;  3A0K A;  3KVB A;  3MIE A;  1NXD 1;  2ADD A;  2D43 A;  1UX7 A;  3NMB A;  1ZBE 2;  3O12 A;  2E26 A;  4ASK A;  4BQX A;  5A3U A;  2GMP A;  2WWJ A;  4M00 A;  3RVH A;  4Z2W A;  3BUC A;  1CAW A;  1H4G A;  3JQW A;  3N9N A;  3V0B B;  3B9I A;  2CU5 A;  1SFN A;  1BEV 1;  2ADE A;  1KFU L;  5FZ0 A;  4CCE A;  1KS5 A;  1QDC A;  1UAI A;  1AZD A;  3B94 A;  2IXI A;  3WF1 A;  1AJK A;  1L3J A;  1NZI A;  2HWF 2;  2IXJ A;  1QU0 A;  2DVD A;  4Q26 A;  1CVN A;  3OYW A;  4N7I A;  3S5A A;  5FZE A;  1G9F A;  4AVB A;  5FR3 A;  2VTX J;  3J4U H;  3ACH A;  1XQN A;  1OOP A;  4LHS A;  3W5M A;  4WZF A;  1OQE A;  3TAY A;  1OC1 A;  3I2O A;  2BTV C;  2E33 A;  1ZVF A;  2YRO A;  4LBQ D;  2BV4 A;  4ISR A;  2HKX A;  1OSG A;  1B09 A;  1UXX X;  3KGL A;  4LBJ A;  2I2S A;  2VUD A;  3HVD A;  2Q8D A;  2RS1 1;  3E1F 1;  2AUY A;  4H2A A;  3TNP B;  3IB3 A;  1SPP B;  4IE0 A;  1VBC 3;  1WLD A;  3ZSM A;  3PTR B;  1W9Y A;  4UFI A;  1ULP A;  2W0X A;  2Q1Z B;  2WT0 A;  4CP1 A;  5JR2 A;  4D7Y A;  3USU B;  3UL2 A;  2V4V A;  1NT0 A;  3VDA A;  4XF1 A;  3OEB A;  2ZZJ A;  1O8S A;  4K7J A;  3DCQ A;  5DPN A;  2Q5T A;  3GNE A;  1DBN A;  1BBT 1;  2Q1M A;  3NNJ A;  4GMP 3;  1PMI A;  4N43 C;  1AR8 3;  1RUE 1;  5IAV A;  1W39 A;  3MDP A;  4UF0 A;  1TZO A;  4BMB A;  4XC9 A;  4F3J A;  4R52 A;  4AHY A;  1ACC A;  2P2K A;  3H3U A;  3SKV A;  2XG3 A;  4ZON A;  2RS3 3;  5FY7 A;  4MGQ A;  4Q4Y 1;  2BVB A;  3III A;  1U5X A;  1FXZ A;  4J1X A;  4ATF A;  3K51 A;  4AQ2 A;  4MH0 E;  4HMZ A;  2Q0A A;  2WZR 2;  4B3N A;  4CDX B;  1IS5 A;  2WKK A;  3MFA A;  4XW3 A;  1J84 A;  2D40 A;  2O8O A;  2HWE 3;  4I02 A;  2EIC A;  3K75 B;  1U5Y A;  2HBT A;  3BGA A;  5KHK A;  2QDR A;  1N1T A;  2B45 X;  2YC4 A;  2J7M A;  2GNM A;  3C7H A;  3R4U A;  5I0U A;  1UWW A;  4AHZ A;  4R4X A;  1O3Q A;  2QQK A;  4P02 B;  5FYI A;  1PVC 1;  4AEK A;  2QBX A;  4C90 A;  2RMU 2;  5BV6 A;  2HYK A;  3H3L A;  3N7J A;  1R09 2;  5C8W A;  3PNA A;  4N9I A;  4LOR A;  4JC1 A;  4W4Z A;  3M1H A;  1YFU A;  1N47 A;  3LDB A;  4QKD A;  2MEV 2;  4QGN A;  1EYB A;  3RZZ A;  3WIN E;  1K5M B;  2CAU A;  3D8C A;  1HX6 A;  3AP6 A;  4YW1 A;  2RS1 3;  4XIL A;  4LPL A;  4LEJ A;  3ZX7 A;  4E9K A;  3S0M A;  2OXB A;  3ZPO A;  2P34 A;  2R32 A;  3AYE A;  3VKM A;  1ND3 C;  1W3V A;  2JG8 A;  4CDW A;  1MZ6 A;  1WBF A;  5E8A A;  1S0C A;  3I54 A;  1W6N B;  1PNG A;  3K4Z A;  3TRS B;  2E7A A;  3IPV B;  1PM7 A;  3CMG A;  2GDF A;  1QJY 2;  4HT1 T;  2JDK A;  2RVA A;  3DPR C;  3V0A B;  3W5N A;  3AZZ A;  3LPG A;  3QBQ A;  3SHR A;  1IKQ A;  2HWB 1;  2X53 S;  2BBV A;  4OI4 A;  2TNF A;  1O3T A;  2XUE A;  2VR4 A;  4FOW A;  2WSU A;  3PTY A;  3RPQ A;  1QF3 A;  1RHI 1;  4IND A;  1K42 A;  3T1L A;  5FWJ A;  3NNL A;  4GAL A;  2OA2 A;  2DVF A;  1AX1 A;  2CSG A;  5IWF A;  4Q8K A;  4LBL A;  3J7H A;  3LIH A;  1LEN A;  3PLQ A;  4LBM A;  2JE9 A;  1H6Y A;  2WA4 A;  1Z7S 1;  1N3O A;  5HCA A;  1LHN A;  4MGY E;  1QGL A;  4MG2 A;  1OHF A;  3GGL A;  4R8H A;  4QB1 A;  5DUV A;  5B2G B;  1CON A;  1YLL A;  1C8M 1;  4X8P A;  4ATE A;  1Y4W A;  1TMF 1;  3BVC A;  3K4D A;  5FOB B;  1ALY A;  3NV3 A;  3VDD B;  2CDO A;  1V9U 2;  4PDW B;  4QXK A;  1IOA A;  1RUC 3;  5GAL A;  3ZYF A;  1XNC A;  1JYV A;  1W05 A;  4GXL A;  3MLJ A;  4C91 A;  3U4X A;  3S5Q A;  3NST A;  1EUU A;  3IMM A;  3VDD C;  1VBD 2;  4AQS A;  2BER A;  4IEU A;  4QM8 A;  4N8M A;  1O5L A;  1KEX A;  1UOG A;  3WW3 A;  2EID A;  1DGW X;  3C7G A;  3R4S A;  1RUF 2;  3NJV A;  4XF4 A;  2G9Z A;  3WCR A;  4CEY A;  5GZG A;  5IVB A;  2XJS A;  4ZS2 A;  5AVA A;  4FPE A;  4K21 A;  1RIR A;  4XE9 A;  5JCT A;  3QLQ A;  1SDW A;  2W1W A;  4CP0 A;  1Z7S 3;  5F3I A;  2QQL A;  1GLH A;  2AZ5 A;  1T6B X;  2YFU A;  5F7U A;  3LIG A;  1VBD 3;  1WMF A;  1KIT A;  4JVA A;  1H4H A;  2XVG A;  3OJB A;  1CAU A;  3SMH A;  5FZL A;  1TQ5 A;  2V09 A;  3PUI A;  5LA1 A;  4AK3 A;  3DYP A;  5J09 A;  3J8F 2;  4D0Q A;  1A34 A;  1UZY A;  1YI7 A;  2ZX0 A;  3N3H A;  4LE4 A;  5F3C A;  2WN3 A;  2D6L X;  4JX0 A;  5JIU A;  2QQP A;  3S57 A;  4ZKT B;  2XGX A;  3PVB B;  4BHP A;  5ERL A;  1HV1 A;  2EIG A;  1QXJ A;  2CGO A;  3G6J B;  3JXS A;  4GB3 3;  5F3G A;  1RUG 1;  5IUQ A;  3I97 A;  2DCK A;  2HWE 2;  3WUC A;  4NRM A;  5LRR A;  2FDH A;  2CL2 A;  1I5Z A;  4BQ5 A;  2J1R A;  5GZF A;  4QKN A;  3ZYH A;  2ZX2 A;  5A6Z A;  4EZH A;  1VB2 A;  2IC1 A;  1KDM A;  2ZHM A;  2ORZ A;  1XNK A;  1I9R A;  4GWM A;  4NHK A;  4OFG A;  4PIX A;  3KWV A;  5IHR A;  3LZZ A;  3T2P A;  1IS6 A;  1A8M A;  5JAX A;  3GZT B;  3Q8A A;  5FZ3 A;  4QPG B;  3VZM A;  5D8A B;  2ILM A;  1IPJ A;  3M3I A;  1AL2 1;  1RUH 2;  1MVE A;  2E51 A;  5CVR A;  5BNN B;  3U11 A;  5K7P A;  4CYD A;  2XVL A;  4DXZ A;  3TBD A;  1UNB A;  4FFI A;  4HL0 A;  1PO1 2;  1O7F A;  2OW4 A;  1VE0 A;  4MSV A;  5AC9 3;  1AVB A;  1HQW A;  4UW6 A;  1WBL A;  3H50 A;  2ORX A;  2GZW A;  3VBF C;  3MEP A;  2ZKL A;  4PQQ A;  3FLT A;  3PMS A;  1NKG A;  3WSO A;  1LOF A;  3VDC A;  3FUQ A;  1RGS A;  3QD6 A;  5DN2 A;  3V0B A;  3RJR A;  1ULF A;  1HRV 1;  5FKC A;  3CJX A;  4YWA A;  3HN1 A;  4CDX C;  2B8M A;  3WG4 A;  1NQJ A;  1RUD 1;  1ULC A;  2Z4F A;  2ES3 A;  2WNV B;  3CF6 E;  4WM8 A;  5FZO A;  3WDY A;  4GA9 A;  1PNF A;  2VU9 A;  3IDB B;  2FDF A;  3VL8 A;  1OUS A;  3CDZ B;  4Y5T A;  2X5I B;  5A3M A;  2JE7 A;  3LA3 A;  1W6O B;  2BJS A;  4I30 A;  4P9I A;  4EN8 B;  3POB A;  2A6X A;  2JEN A;  3DEM A;  5CZK A;  4CRQ A;  1RUJ 3;  4NHX A;  1H9P A;  4MO3 M;  5BPX A;  4D6S A;  4LA2 A;  2W92 A;  1O59 A;  1C5H A;  1HDK A;  5FZG A;  1KQR A;  5K4L A;  3FC0 A;  3VHR A;  1X7N A;  1AR7 3;  3MFC A;  4JQR A;  2UY9 A;  4JTN A;  2R1D A;  3K4A A;  1OUR A;  4HK9 A;  3VDD A;  3P1I A;  4LA3 A;  5GZD A;  3VBF A;  4DOU A;  5JXJ A;  1JXN A;  4AI0 A;  4V2W A;  1HB1 A;  3M3C A;  2FCU A;  1EV1 3;  2VQT A;  3PJY A;  1ZRC A;  1FAY A;  4CDQ C;  3ZKY A;  4Z2A A;  2RDN A;  4Q4X 1;  4BQY A;  1W06 A;  2TBV A;  4FQZ A;  2VTX A;  1NCR C;  5FCC A;  1WA4 A;  2RDQ A;  3KQ4 B;  3VD3 A;  4UF0 B;  2TEP A;  3E5Q A;  4QB2 A;  4I3G A;  4AAX A;  5F9T A;  1JUI A;  2ID4 A;  3MI8 A;  4KWL A;  3MV0 1;  4NE9 A;  1HKD A;  1AJO A;  2C9A A;  4P9J A;  3WF4 A;  3VHN A;  4YGE A;  2VO5 A;  4AXO A;  1JZ7 A;  3ILR A;  3PUR A;  1VBB 3;  1RUD 3;  1UU6 A;  2QQJ A;  2ENR A;  1W9S A;  3OD4 A;  2ZS6 B;  3T4H B;  3EBR A;  5DAP A;  1O3R A;  3INA A;  1J3R A;  5LBF A;  4UT5 A;  1VBA 1;  1AR8 1;  5DDJ 2;  4GKY A;  2XJP A;  4XAE A;  2XBO 2;  3TYJ A;  4LO6 B;  2BOI A;  4LUM A;  3M70 A;  3BIW E;  4ARX A;  4CCC A;  2DVG A;  5FYY A;  3JD7 1;  1DZQ A;  4UW5 A;  2NP0 A;  3AKS A;  4BLJ A;  1SG3 A;  1F2N A;  3ZLI A;  5H9R A;  1JH5 A;  4QQP A;  2R04 2;  3UK9 A;  4CXX A;  1SPP A;  3VB9 A;  2YV8 A;  2C4X A;  1RUE 2;  2GU9 A;  1RMU 2;  4MUV A;  3GZU C;  1UIJ A;  1Z7S 2;  2JDA A;  2VVD A;  5GZC A;  4ONU A;  4BZ4 A;  1ZBE 3;  1QQP 3;  4LHN A;  1CZS A;  4FBF A;  4XMI A;  1YCI A;  3HQX A;  2YBS A;  3DGT A;  3OY8 A;  4JGZ B;  3VBH A;  5LBC A;  2Y8K A;  4RA0 A;  2PFW A;  1GU3 A;  3N7K A;  1FOD 2;  5L73 A;  4AI1 A;  4C8D A;  2CWM A;  4AW7 A;  4CCO A;  5J7M A;  4A45 A;  2BPA 2;  1YQ8 A;  5I0D A;  2W3J A;  2G9G A;  4Y22 B;  3FL7 A;  1EAH 1;  5IW0 A;  4GWJ A;  4CCL A;  3MID A;  2C26 A;  2I74 A;  3I3E A;  2R49 A;  1CAW B;  3NAP C;  3VGI A;  3I3M A;  1J3Q A;  3IBM A;  4FI9 A;  3ZXG A;  2WIN B;  3RZJ A;  2Y6K A;  2Y6J A;  3JBG 2;  4LO7 A;  3W9A A;  3ZFG B;  2IXK A;  1JS9 A;  1ZBA 2;  5E6H A;  2WNU A;  3ENR A;  5FP8 A;  3LEG A;  3ES1 A;  4SLI A;  1X82 A;  2C1F A;  3ACI A;  4GUL A;  5FY8 A;  3KV9 A;  2D6K A;  3NVC A;  3WW2 A;  1SDD B;  2PLV 1;  4FP2 A;  4QX5 A;  3POS A;  1XB9 A;  3Q8C A;  2VBB A;  4IER A;  1FV3 A;  2W94 A;  2BFU L;  1NZC A;  5D1I A;  2VZQ A;  4HLT A;  1W8Z A;  2JWP A;  2VMG A;  5JR7 B;  4Z1V A;  5JXG A;  1ZZ9 A;  3ATG A;  2KD7 A;  2JB8 A;  1DYP A;  2VQU A;  1ENX A;  3B01 A;  3OGJ A;  4JKM A;  3POF A;  5EWS A;  1HRI 3;  1LCL A;  4DQA A;  5A1F A;  5CU1 A;  2SBA A;  5H9Q A;  4RL7 A;  1GZW A;  5FXX A;  4F8A A;  2OPW A;  3OPZ A;  2BNM A;  4V2V A;  3ZFE A;  4DIN B;  3OD0 A;  4D94 A;  4ZZ8 A;  5KR7 A;  4W50 A;  5FJH A;  5FZ1 A;  4HPK B;  3WNO A;  4JGZ C;  4WZC A;  4MXW A;  3CHX A;  2X29 A;  4U2A A;  3RYP A;  3BTZ A;  3ALQ A;  3BCW A;  2Z5W A;  4D6Q A;  2ZX1 A;  3VZK A;  1LJ7 A;  2OZ6 A;  4Q1R A;  5GLW A;  4DB5 A;  3UKT A;  2ZX3 A;  4H55 A;  3ZVX A;  4XJZ A;  2VME A;  1OPO A;  4QXB A;  5JMO A;  1FMD 3;  4XJU A;  4CDX A;  1DDL A;  1POV 1;  1GNH A;  3UYJ A;  1WKY A;  4S2F A;  3RSJ A;  5BNN C;  2GNB A;  2BGC A;  5DG2 A;  2EIB A;  2RJL A;  4CCK A;  4EE2 A;  1WMD A;  3P5B A;  3JZV A;  4FOV A;  3NNG A;  1JZ8 A;  4XF9 A;  4JV4 A;  3T08 A;  2P3K A;  1S0D A;  4N53 B;  4BK4 A;  1CX4 A;  2K2S A;  5FMD A;  2VCC A;  4NO4 A;  1H2M A;  2H6B A;  2ZGU A;  1H8V A;  1TG7 A;  5KWR A;  1JI6 A;  5A32 B;  4PDW A;  1UMH A;  4NHY A;  2YFZ A;  5FDB A;  3JUU A;  4JGY A;  1SBE A;  1JW6 A;  4Q29 A;  4DPN A;  5K8S A;  1W6P A;  4YVW B;  5LCW L;  1ULG A;  1JZ6 A;  2D6M A;  2V5Y A;  3WNK A;  3LF7 A;  2PLV 2;  3ABZ A;  3I2F A;  2X5I C;  4CP9 B;  1D7P M;  4ARY A;  2FCV A;  3ZXD A;  3ZYB A;  3PUH A;  2GC2 A;  2XR4 A;  1UY4 A;  4XXA A;  2VMD A;  1LGB A;  3RI8 A;  5DMY A;  4XUT A;  2DYC A;  3O1R A;  3U10 A;  2VVF A;  3WP4 A;  1XYO A;  4Q4X 2;  2JEC A;  5CNA A;  3JBG 1;  2ZGL A;  1DHK B;  3GCX A;  3K2O A;  5F32 A;  2FBE A;  4KH9 A;  4KL1 A;  5FXW A;  2Q8E A;  3H8U A;  1RTV A;  3KT7 A;  1W28 A;  5HCF A;  5F5A A;  5BXX A;  4P9L A;  3HWJ A;  5I8S A;  4MGT A;  2J1U A;  4OYU A;  4RGA A;  1HIX A;  4Q4V 1;  3SNM A;  4AVT A;  4LMF A;  1W9T A;  1UW8 A;  2EXI A;  3OF1 A;  5CKN A;  4ET7 A;  4OHY A;  1ONA A;  3FFZ A;  1LB2 A;  3HEI A;  4YVS B;  2W47 A;  1PGL 1;  3IIA A;  2WNV C;  1BJQ A;  4JKL A;  5FYM A;  5DAV A;  5JSP A;  4QX0 A;  3O0V A;  4JGY C;  3BPZ A;  3RRD A;  5JOY A;  5K0U C;  4MX3 A;  1ASJ 2;  4M3C A;  2XQX A;  3WF0 A;  3RZH A;  2VZT A;  2NMN A;  1QJU 1;  2QTW B;  1G8W A;  3VKL A;  5F6K A;  3A4U A;  5FZ9 A;  1W04 A;  1D4V B;  4K40 A;  4NAO A;  4XBQ A;  2P4E A;  2XWJ B;  2AGS A;  1LEC A;  3MPB A;  2WUH A;  5GLZ A;  1BMV 2;  1TNF A;  4H7M A;  1W0P A;  3DPR A;  4PIZ A;  2A70 A;  4WVW A;  3BAL A;  4JTO A;  1QEX A;  3ILN A;  2A3W A;  2VZS A;  4WVZ A;  2BOJ A;  3TEX A;  3WT3 A;  1GOF A;  1BK0 A;  4X6R B;  5F39 A;  4IGQ A;  2XJU A;  4BDV B;  2FZ1 A;  2W5F A;  2D97 A;  5AFE A;  3TEZ A;  3VBR A;  1LHW A;  2DTY A;  4QHO A;  5LA0 A;  1GUI A;  4E4H A;  5FPV A;  5IVF A;  3BTX A;  3OGG A;  2Y0O A;  4OLL A;  3ZXK A;  4RHV 2;  4NRQ A;  1DZT A;  4Y20 B;  2A75 A;  3ZSJ A;  3O1S A;  3V0A A;  4E2S A;  4FPO B;  2JG9 B;  1EV1 2;  2ZHK A;  3T4V A;  1W8U A;  1HXS 2;  4FFG A;  3U75 A;  5A3N A;  1OA3 A;  2J1E A;  1WLW A;  2G1M A;  4A42 A;  1ENR A;  2DVA A;  4DXR A;  5C4W C;  2DTW A;  1PX3 A;  4Q0V A;  5EYX A;  4LK7 A;  3ZFF B;  3KF3 A;  4BQ4 A;  1GWM A;  1ZRI A;  2V5D A;  2HWE 1;  2DFC A;  4YGB A;  2E7Q A;  2ZGK A;  1QOO A;  5F6L B;  4N43 A;  1V6N A;  1OLM A;  1R1Z A;  3ZYI B;  2PA7 A;  1ZX5 A;  1QJY 3;  2ZML A;  4TLF A;  2C5D A;  2MPF A;  5FYU A;  1HRI 2;  3IZO A;  4COU A;  5FK8 A;  5HCB A;  2ARC A;  3N9P A;  5FZA A;  3KHC A;  1MS1 A;  5LAT A;  2X05 A;  4BA6 A;  5H9S A;  4M0H A;  3N35 A;  4OI2 A;  2BFU S;  2BRT A;  1QOT A;  1Y3T A;  3AM2 A;  4UWD A;  4XTM A;  1EY2 A;  2PQQ A;  3X29 B;  4A3X A;  3CJI A;  2ARX A;  4IV3 B;  2WAB A;  1KJR A;  4QX7 A;  1DG6 A;  2TUN A;  3LFI A;  1RUJ 1;  1ZYB A;  4XHX A;  3M3O A;  2HYX A;  5FOJ B;  1NCQ A;  3H8O A;  2WQ4 A;  4QDQ A;  4IV1 C;  5A32 A;  4URT A;  4LKD A;  3AMQ A;  2BW8 A;  2H0B A;  3H1M A;  5KXB A;  4FSJ A;  3ACF A;  3ZFE C;  2LW8 A;  4D69 A;  1TE1 B;  1VIW B;  3DKQ A;  4DXT A;  3LDK A;  1JOB A;  1QNY A;  1S2K A;  2VZ1 A;  2LRP A;  4MHU A;  4NPR A;  4NPM A;  4XDQ A;  4XQW A;  4YM1 A;  2YZ4 A;  3SCF A;  4E8D A;  1FYU A;  4NOT A;  3VBO B;  2X09 A;  4B7E A;  2VUC A;  1DU3 D;  2BNN A;  2IVI B;  4FXG B;  1H1M A;  1LTE A;  2E32 A;  5DXD A;  1RUF 3;  4CCJ A;  3BOP A;  3Q8E A;  5CFD C;  3O1O A;  2WYF A;  4XJ9 A;  5GZE A;  3WQB A;  2RG4 A;  1NCR B;  5FMO S;  1ND3 A;  4ASL A;  1V0A A;  5D2A A;  4AQT A;  1RUG 3;  1XND A;  3VKO A;  1VRB A;  2RS5 1;  1AX0 A;  4K8R B;  2VZU A;  5JWP A;  5A6X A;  1IPS A;  5FMO L;  1GP4 A;  3ZXJ A;  3VBU A;  2RS3 2;  5J1X A;  4PLO A;  2Y60 A;  1TNR A;  1AL2 3;  3MO4 A;  4OQ9 A;  1NQD A;  4ZPI A;  4QT6 A;  1FOD 1;  1UOJ A;  2HWC 2;  4IEZ A;  4AF9 A;  4GIQ A;  1W99 A;  2HWD 3;  4E8C A;  1DQ2 A;  4KI5 M;  3FHQ A;  3BB6 A;  3MLK A;  3NW4 A;  1WCD J;  1HJG A;  3RG0 A;  1GBG A;  2VQ0 A;  3HAG A;  4YGC A;  5B4X A;  1OD5 A;  4HZF A;  1W2O A;  1EP0 A;  4P00 B;  3GJB A;  3VV1 A;  2RMU 3;  2ZXQ A;  1VBC 2;  1SLI A;  4YZ3 A;  4RQP C;  4UBH A;  1ZM1 A;  3V56 A;  3ZFG C;  3GF6 A;  5E16 A;  2HWD 1;  1YQC A;  5FIX A;  3B02 A;  3P3N A;  4UBG A;  3MPP G;  3ZXA C;  4Y1U A;  4L8Q A;  4ZY9 A;  4A4A A;  4FPF A;  1R1A 3;  5A3W A;  1FT9 A;  3J7L A;  5FK7 A;  4OHZ A;  4CZS A;  4N53 C;  3EMR A;  2R6Q A;  3DF0 A;  2R7E B;  1SCR A;  4V1P A;  2F6B A;  4GB3 1;  4NHL A;  4AEJ A;  5JPN B;  2VNV A;  1OI6 A;  2O14 A;  3JCI A;  3LQC A;  4XDP A;  4Y1V A;  1WD4 A;  2XON A;  3KCC A;  3WHT A;  2QQN A;  5F5C A;  5FRE A;  4CEW B;  2DU0 A;  2EAA A;  2XBO 1;  5T50 A;  1WGP A;  5FZ7 A;  4LUL A;  4ZZ5 A;  5F37 A;  3N9M A;  3ITQ A;  1W6Q B;  1VJ2 A;  4AYU A;  4IV1 A;  1Y9M A;  4WM8 B;  5FZO B;  1QJX 1;  2WT2 A;  4IE4 A;  4ERO A;  4EWE A;  4OHW A;  1G6N A;  2QDN A;  4EZ4 A;  5CBL A;  2VL4 A;  3THC A;  1JZ2 A;  4LIU A;  3KGZ A;  3RWK X;  1ZZ6 A;  2GAU A;  4Y20 A;  2FDJ A;  1A78 A;  2YC0 A;  4OZX A;  3HJR A;  2RS5 3;  2VZ3 A;  1AYN 1;  2E7T A;  4GZ9 A;  1Q8V A;  5K0U B;  1GIC A;  2PHR A;  2VD7 A;  1LOE A;  3GDB A;  4Y4Y A;  1S0B A;  2WQZ C;  5CKM A;  5APA A;  2BDR A;  3JB8 A;  1K5M A;  1BCX A;  5FZ6 A;  3H9A A;  1H2K A;  2QCS B;  2WJS A;  5C6C A;  3OUI A;  5JI7 A;  2IXC A;  3D5O A;  3EHK A;  1O6U A;  1QQP 2;  3O0X A;  1G9D A;  5CIR A;  3SH3 A;  2VM9 A;  3OBT A;  4EQV A;  1JU3 A;  4IXL A;  2P3J A;  1DCS A;  3BYW A;  3RZG A;  1SLA A;  1ODN A;  1LHO A;  2BWC A;  2XPJ A;  1NCQ C;  1MEC 2;  3I49 A;  1DQ6 A;  1W9F A;  1ZA4 A;  5LA2 A;  4R4Z A;  1NE6 A;  1MZ5 A;  2QNK A;  5LEJ A;  2QQW A;  2EF6 A;  3AVR A;  1OLM E;  5C5T A;  1GYK A;  2ZGQ A;  4OUL A;  1LUL A;  1E5S A;  1C1F A;  1PMH X;  1YEW A;  1ZA7 A;  1DFQ A;  3P6B A;  3R4D B;  4KWK A;  4QDR A;  3AJY A;  4XF0 A;  4XVH A;  4CUG A;  2VMI A;  1ULO A;  4YW6 A;  5FZM A;  1WMX A;  1O4Y A;  1STM A;  2WO3 A;  3E5U A;  2VUA A;  4LO5 B;  4XJW A;  3N7M A;  1XPW A;  1W6O A;  3WNM A;  1JYX A;  5EV7 A;  1WZX A;  3MV1 1;  1O91 A;  2XBO 3;  5DAX A;  3ST7 A;  1UYY A;  2VXJ A;  2VBP A;  3PUS A;  3WG2 A;  4XBN A;  5FO8 B;  1AYM 3;  1DF0 A;  5CAZ A;  2HLE A;  3ROU A;  2JDH A;  4YZ5 A;  4YPJ A;  5T5P A;  2BU9 A;  4E4S A;  1ND3 B;  3M2M A;  3ZFF A;  3I2I A;  1OH3 A;  4XXP A;  5FP7 A;  4XFC A;  5FY1 A;  4YW4 A;  1DZR A;  1RUC 2;  2HEY F;  4IGP A;  2EXH A;  4P14 A;  3WNX A;  1W6M B;  3ASI A;  3R05 A;  1QQP 1;  4YG0 A;  5FKB A;  2VNG A;  4LE3 A;  5ANQ A;  4PBO A;  1LR5 A;  4QB6 A;  3T2O A;  4QPI C;  3LCP A;  3SCG A;  3FHI B;  3RMY A;  1W0O A;  2IFR A;  1CX1 A;  2VMH A;  4P9Y A;  5L9B A;  1AL2 2;  1C57 A;  3I2H A;  3VBR B;  2ZEY A;  1BLZ A;  4KWJ A;  4G3Y C;  1UY2 A;  1GQH A;  1V00 A;  5IJR A;  2VNO A;  2ZOE B;  1ZBE 1;  1W6P B;  2XJR A;  1QKQ A;  4YVW A;  1H0B A;  2A73 B;  2VEC A;  2WAO A;  2YUE A;  2OUH A;  5GLT A;  1U5I A;  5FY9 A;  4IE7 A;  1UX6 A;  1ZRR A;  4LJH A;  5DUX A;  3SIT A;  4MZU A;  1MPX A;  1ODM A;  5DAW A;  1NXM A;  3TOJ A;  3W20 A;  1E5I A;  4P9W A;  1QHD A;  5T3N A;  4PF5 A;  5FUI A;  1AR9 2;  1FPN 3;  4P5H A;  5AVP A;  3H7J A;  4UYB A;  4GWN A;  2Q8C A;  3ZDV A;  2E6V A;  2FCT A;  1RUI 1;  1Y43 B;  4QX3 A;  3LAG A;  5DAQ A;  2PTM A;  2WZR 1;  1NOV A;  2NPI A;  1RXG A;  1ZZ8 A;  3POE A;  5GLV A;  1YXW A;  3KVA A;  2W9X A;  5FLJ A;  4TYS A;  3I2G A;  1UU4 A;  2NMO A;  1UN1 A;  3M3Q A;  1UKR A;  5GJ6 A;  2WFF 2;  2Y6F A;  4YVS A;  1YHF A;  5F5Q A;  1R64 A;  2PAE A;  5EPA A;  4BYY A;  3Q9O A;  1RC6 A;  3PU3 A;  1OQ1 A;  4S2D A;  4F83 A;  4RFR B;  2WZR 3;  4IEY A;  3T1M A;  3ZN4 A;  2HJI A;  3HOB A;  2QQI A;  2P17 A;  1OF3 A;  4BQ2 A;  3RMX A;  2R1B A;  5L19 A;  1GV9 A;  1YNA A;  2D5H A;  4FQ4 A;  3O1M A;  1NG0 A;  3ZM8 A;  3ZR6 A;  4IGO A;  4QWN A;  3IAQ A;  3SIS A;  1PK6 B;  1A3K A;  1WLT A;  4JZR A;  3VBU B;  3D82 A;  2IXH A;  3EJK A;  2FHR A;  3NV1 A;  2WO2 A;  5D8A A;  3OGR A;  5LEK A;  3LEK A;  2J1T A;  5KXD A;  3AZX A;  4OUS A;  1Q5O A;  1Z0H A;  4XJA A;  4DUV A;  2MNG A;  4UFH A;  5CFD A;  1MZF A;  4Q0P A;  2JDP A;  4QX1 A;  5FO7 B;  1G9A A;  3BI3 A;  3HT1 A;  2AEZ A;  2YGM A;  3OEA A;  4LR4 A;  4XIO A;  3RDI A;  4CU9 A;  2JDU A;  2XQR A;  3H8X A;  4XF3 A;  1BYH A;  1VBE 2;  1VAK A;  2YMZ A;  5FZ8 A;  3NJZ A;  2L9L A;  3AYD A;  1DP0 A;  1MZE A;  2HWF 1;  2ZJC A;  3B7M A;  4UFK A;  3I7D A;  4NII A;  4LBN A;  5C5U A;  1GKB A;  1AUY A;  3WXP A;  1VAM A;  2ZZQ A;  4D8M A;  1JZ3 A;  1BEV 2;  1UF2 C;  3NKG A;  3WQ7 A;  4J1W A;  3MZH A;  3RFR A;  2V72 A;  4YAR A;  1H8T B;  1FV2 A;  4Q0Q A;  4FPY A;  2YXS A;  4XET A;  1RJ7 A;  2VOK A;  3OGV A;  4Z82 A;  2XL9 A;  5T5O A;  3OG2 A;  1RUJ 2;  2Q4S A;  4H7L A;  3ZKU A;  4AFC A;  2QJV A;  4QPG C;  2WNE A;  3HNM A;  2J1S A;  3NWK A;  4X6Q B;  2VOV A;  4Q4V 2;  5KC6 A;  3IDA A;  1RED A;  1NYW A;  3FZ3 A;  5FY5 A;  4AVA A;  5J36 A;  2JEM A;  4B4P A;  5T5L A;  4NIH A;  4MYE A;  1LU2 A;  5JZG B;  3AZY A;  2PHT A;  3DYM A;  3T0B A;  2XML A;  1WW4 A;  1J83 A;  4G9S B; 
#chains in the Genus database with same CATH homology
 1UZ0 A;  2W94 A;  3ETP A;  2VZQ A;  3K77 A;  3IAP A;  5JXG A;  2KD7 A;  2VQU A;  4JKM A;  1DYO A;  4ZZ8 A;  5C71 A;  3MUY 1;  1NUK A;  4W50 A;  3CZU A;  1CZV A;  3WNO A;  4W8J A;  3AC0 A;  2VC9 A;  3NRU A;  1F4H A;  1TVG A;  2W1U A;  3LE0 A;  4BK5 A;  1JYN A;  5EIY B;  1KGY A;  2XOM A;  1W8O A;  2WDB A;  3LPF A;  2VME A;  5JMO A;  1OF4 A;  2WN2 A;  5JUV A;  3OGS A;  2W95 A;  1WKY A;  2EIB A;  1OD3 A;  2WZ8 A;  1BHG A;  2QQM A;  3NNG A;  1L7R A;  4QX2 A;  4RN5 A;  3T08 A;  1JZ8 A;  2Y6G A;  4BK4 A;  2VCC A;  1PX4 A;  4M4R A;  1NX9 A;  2W1Q A;  4MGS A;  1TG7 A;  1JI6 A;  3I2K A;  1UMH A;  1W8N A;  2YFZ A;  2WZE A;  3OB8 A;  5LCW L;  1DLC A;  5JXI A;  2Y6L A;  1JZ6 A;  4CU6 A;  3WNK A;  2WYS A;  1PMJ X;  4A3Z A;  3ABZ A;  3I2F A;  1UMI A;  3A22 A;  1D7P M;  4ARY A;  1NAE A;  3VD5 A;  2J1V A;  3PUH A;  1UY4 A;  2QQO A;  2VMD A;  5DMY A;  4XUT A;  3A23 A;  3MBW A;  1L7Q A;  4KWU A;  2Y64 A;  3I3D A;  1UX7 A;  1JYW A;  2E26 A;  2ZEW A;  5A1A A;  3DEC A;  2J1U A;  4QPW A;  4OYU A;  1GQP A;  3U37 A;  1UY3 A;  3WF1 A;  1W9T A;  1YQ2 A;  4ET7 A;  3FHA A;  3HEI A;  2W47 A;  4CU7 A;  4JKL A;  2VJX A;  2BBA A;  2BGO A;  3ACH A;  4LHS A;  4QX0 A;  3W5M A;  2BZD A;  3WF0 A;  2XQX A;  2E33 A;  2VZT A;  3NQH A;  3DYO A;  2YC2 A;  1UXX X;  1UYZ A;  2WUH A;  3E1F 1;  4XUQ A;  3IB3 A;  2VZP A;  2WO1 A;  1ULP A;  2VZS A;  3I3B A;  1GOF A;  5JR2 A;  4IUG A;  1GNY A;  2V4V A;  3VDA A;  3OEB A;  1O8S A;  4XUO A;  5DPN A;  4BDV B;  2W5F A;  1LNS A;  1EUT A;  2JKX A;  5LA0 A;  1GUI A;  3FN9 A;  4KMQ A;  4A6O A;  3SKV A;  4MGQ A;  2W1S A;  3III A;  4LQR A;  5IYY A;  2ZEZ A;  1J84 A;  2J1E A;  2EIC A;  3K75 B;  3BGA A;  4A42 A;  4DXR A;  1PX3 A;  2YC4 A;  2J7M A;  3C7H A;  2WQ8 A;  3HPN A;  1UWW A;  2DCJ A;  2XHN A;  2V5D A;  2QQK A;  4P02 B;  2QBX A;  1HN1 A;  3C8X A;  4W4Z A;  4LKS A;  1XNT A;  4CUB A;  2YG0 A;  2W91 A;  2X05 A;  3THD A;  4LPL A;  3BN6 A;  4QDS A;  1UY0 A;  2WAB A;  3T0D A;  3CIH A;  2B4K A;  2HYX A;  2VCB A;  2X10 A;  3HN3 A;  3K4Z A;  2PQS A;  4QDQ A;  2RJ2 A;  3CMG A;  1UY1 A;  4JHZ A;  2LS6 A;  4UOJ A;  2RVA A;  3W5N A;  3ACF A;  3LPG A;  2C9K A;  2JE8 A;  4GWI A;  2LW8 A;  4XUP A;  3EYP A;  4DXT A;  2WBK A;  2VZ1 A;  2VR4 A;  4E8D A;  2VZV A;  1XNA A;  4DXS A;  1K42 A;  2X09 A;  4CVU A;  2E32 A;  3A21 A;  1GMM A;  4OMD A;  3WQB A;  1UXZ A;  3J7H A;  1H6Y A;  2VZU A;  1P8J A;  5C70 A;  5J1X A;  3GGL A;  3MO4 A;  4QB1 A;  3WEZ A;  2YB7 A;  1UYX A;  2JD9 A;  4PF1 A;  4E8C A;  1W99 A;  4BJ0 A;  4KI5 M;  3FHQ A;  3K4D A;  2CDO A;  4MAD A;  4XUN A;  5IFT A;  1JYV A;  2EIE A;  5B4X A;  1GOG A;  1EUU A;  1T2X A;  4P00 B;  2ZXQ A;  2BER A;  2WAA A;  1OT5 A;  1KEX A;  4BXS V;  2EID A;  3C7G A;  4A4A A;  3NJV A;  1CZT A;  4ZY9 A;  1K45 A;  1OH4 A;  2W1W A;  2R7E B;  2VTF A;  3WNL A;  3SEE A;  5G05 L;  3WF2 A;  2QQL A;  3LQC A;  4DEQ A;  2YFU A;  5F7U A;  2XON A;  3F2Z A;  3SEP A;  2QQN A;  3NJX A;  4ZZ5 A;  3PUI A;  5LA1 A;  3DYP A;  1W9W A;  4D0Q A;  2WN3 A;  4JX0 A;  2VL4 A;  1RYY A;  3THC A;  1JZ2 A;  1W0N A;  3JXS A;  2W46 A;  3D3A A;  2VMF A;  3HJR A;  2VZ3 A;  4GZ9 A;  3T09 A;  3I97 A;  2DCK A;  3GDB A;  2Y6H A;  3OBA A;  3MUZ 1;  3VD4 A;  2J1R A;  3EB7 A;  2ORZ A;  2VM9 A;  4CU8 A;  4TXW A;  1JU3 A;  5IFP A;  5IHR A;  3T2P A;  1CIY A;  3CKH A;  2OKX A;  4MOA A;  5LA2 A;  4TTG A;  2VOT A;  1PMH X;  2ORX A;  3P6B A;  4QDR A;  5CYY A;  4PQQ A;  4XVH A;  1NKG A;  1ULO A;  4P08 A;  4XUR A;  3WSO A;  2WO3 A;  3VDC A;  5DN2 A;  5JXH A;  1XPW A;  3WNM A;  1JYX A;  3MV1 1;  2J1A A;  3A7Q A;  3K46 A;  2DDU A;  1UYY A;  3UET A;  1JU4 A;  2Z4F A;  3CZJ A;  2HLE A;  4YPJ A;  3SKJ E;  3CDZ B;  4CUA A;  4OZO A;  3I2I A;  4P5Y A;  5EJ1 B;  4M4P A;  4QAW A;  5CZK A;  4MO3 M;  4OMC A;  2W92 A;  3VD9 A;  1O59 A;  4QB6 A;  3T2O A;  1CX1 A;  2CDP A;  3I2J A;  3I2H A;  3K4A A;  2ZEY A;  3P1I A;  4PT6 A;  5JXJ A;  3WNN A;  1UY2 A;  5IJR A;  2ZEX A;  2VQT A;  5B4N A;  2WAO A;  4Z2A A;  3T2Q A;  2RV9 A;  2BGP A;  1MPX A;  1IQD C;  3VD3 A;  3HNY M;  4QB2 A;  1US3 A;  3CQO A;  4AAX A;  1I5P A;  2ID4 A;  5FUI A;  3WF3 A;  3C7E A;  3GXU A;  3ECQ A;  5C7G A;  2B9V A;  3MV0 1;  3WF4 A;  1JZ7 A;  2VO5 A;  4QX3 A;  3C7F A;  2QQJ A;  4DEV A;  1W9S A;  4ZXE A;  4RYD A;  2E31 A;  4DUX A;  2W9X A;  3I2G A;  1JZ4 A;  3WNP A;  2VZR A;  2J22 A;  1R64 A;  3LEI A;  1WCQ A;  3UES A;  4ARX A;  1K12 A;  1K3I A;  2W87 A;  3HOB A;  1SHW B;  2QQI A;  1SG3 A;  1OF3 A;  1JZ5 A;  3ZM8 A;  4DUW A;  3IAQ A;  1GOH A;  2C4X A;  1H6X A;  1JHJ A;  3HNB M;  2WO2 A;  3OGR A;  3LEK A;  2J1T A;  4DUV A;  5EJZ B;  2JDA A;  5DQ0 A;  3ACG A;  4UI9 L;  4QX1 A;  4A44 A;  3OEA A;  1CZS A;  2VMC A;  3T0A A;  4CU9 A;  4OUE A;  2VZO A;  1XC6 A;  2Y8K A;  1GU3 A;  1O8P A;  3GM8 A;  4AG4 A;  2L9L A;  1DP0 A;  4L0P A;  3C7O A;  4A41 A;  4A45 A;  4HG6 B;  5I0D A;  2W3J A;  5HXM A;  3FL7 A;  4D8M A;  4GWJ A;  1JZ3 A;  2C26 A;  4UAP A;  1F4A A;  4CUC A;  3I3E A;  2V72 A;  4JKK A;  4FI9 A;  3VDB A;  3OGV A;  2Y6K A;  2Y6J A;  3VD7 A;  3OG2 A;  3UNP A;  5HPO A;  2VCA A;  3LEG A;  3HNM A;  2J1S A;  3IDA A;  3ACI A;  1SDD B;  1US2 A;  3DYM A;  3T0B A;  5G04 L;  1J83 A;  4XZU G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...