4XZUG

Crystal structure of the human factor viii c2 domain in complex with murine 3e6 inhibitory antibody
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
154
structure length
154
Chain Sequence
CSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 3E6 antibody Fab heavy chain
publication title Structure of the Human Factor VIII C2 Domain in Complex with the 3E6 Inhibitory Antibody.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 154
sequence length 154
chains with identical sequence M
ec nomenclature
pdb deposition date 2015-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4xzuG00
2X10A 3WF2A 3VD3A 2VMDA 1IQDC 2W47A 2VR4A 1H6YA 4QPWA 3CQOA 3W5NA 4LQRA 2Y6HA 3IAQA 4W50A 2VQTA 2WAOA 4XUOA 2Y8KA 1K3IA 3ZM8A 1TVGA 4CU8A 4UAPA 5LA1A 4YPJA 2EIBA 5IFPA 3T2OA 2ZEZA 3CMGA 2X05A 4DUVA 3FHAA 3UETA 1JZ2A 2RJ2A 1KEXA 2W94A 4DUXA 3A7QA 4CU7A 5LCWL 2W1QA 3NJXA 1SG3A 1CIYA 2HLEA 1F4HA 3BGAA 4ET7A 3GM8A 2WO3A 4KMQA 2B9VA 2C26A 2VZQA 4QB2A 4L0PA 3A21A 4QB1A 4DEQA 3I2FA 4QX2A 3WF4A 4UOJA 1T2XA 3FN9A 1JU4A 4HG6B 1OD3A 1GOFA 2LS6A 1DP0A 1UX7A 3VDCA 4ZXEA 4ZY9A 2VZ3A 1XPWA 4D0QA 2B4KA 4A41A 3LEIA 1PX3A 3ETPA 2WAAA 2J22A 1SHWB 1US3A 2DCKA 2R7EB 5JUVA 4LHSA 1KGYA 3MV11 2V5DA 5G04L 4BJ0A 1J83A 1O59A 3PUIA 5IFTA 1JZ7A 2VMFA 3OB8A 2WQ8A 2XONA 1W8NA 3K4DA 1EUTA 3IIIA 3ECQA 3I3DA 1OT5A 3NRUA 2QQKA 2J1SA 3HOBA 1JZ6A 3I2GA 3I3EA 2X09A 2WN3A 4A45A 2E31A 2JE8A 3MV01 4DXTA 2VCCA 4QDSA 2VMEA 5LA2A 4BK5A 4TXWA 1UMHA 3MO4A 3WF1A 4OYUA 4QAWA 2ZEYA 4ZZ8A 5A1AA 2YC4A 3I3BA 2VL4A 3C7FA 3D3AA 5C71A 2QQLA 2YC2A 4P08A 3AC0A 3LE0A 3OEAA 4BDVB 4BK4A 4KWUA 1H6XA 3LPFA 4JHZA 1W8OA 4CUAA 1JYWA 3OEBA 2DDUA 1PMHX 3ABZA 2KD7A 3HN3A 4FI9A 2WUHA 4XUTA 2BGOA 3DYMA 4PF1A 4DEVA 3VDAA 1DLCA 2ORXA 2W95A 2WZEA 3MUY1 2VZSA 3LEGA 3MBWA 4M4PA 5C70A 3HEIA 3K77A 4A42A 3VD4A 3SKJE 4GWJA 2J7MA 3IDAA 1UY4A 2Y6JA 5EJZB 3THCA 1GOHA 3CZJA 5HXMA 3C7HA 3I97A 4BXSV 5F7UA 4LPLA 4ZZ5A 1O8SA 2E32A 4XUPA 3P6BA 1WCQA 2VOTA 1W9WA 5B4XA 1JZ4A 3T0DA 3K4ZA 4TTGA 2BBAA 4GZ9A 1GNYA 1GU3A 1XNTA 1K12A 3I2JA 2W87A 3LPGA 1HN1A 4MGQA 3CZUA 4QX1A 2J1VA 3CIHA 3OGSA 5FUIA 5IHRA 3ACHA 5DMYA 2VCBA 4P5YA 4XVHA 2WBKA 2EIDA 2V4VA 3HPNA 5J1XA 4QDRA 3DYOA 5LA0A 2JKXA 1UXZA 2Y6KA 4CU6A 1L7QA 3BN6A 1BHGA 3J7HA 2VO5A 4JKMA 2WZ8A 2RVAA 2W9XA 2E26A 5B4NA 2YFUA 4RN5A 1UY3A 2JDAA 2W1UA 4PQQA 4E8CA 3WF3A 2J1TA 3FL7A 3ACIA 1CZTA 3T0AA 3E1F1 1UY2A 1J84A 1XNAA 2VJXA 3P1IA 2VC9A 5CZKA 3T08A 4UI9L 2YG0A 3UESA 2VMCA 5JXHA 5IJRA 2QQNA 3HJRA 3IB3A 4P00B 1RYYA 2J1EA 4P02B 3DECA 2QQJA 5DPNA 3T2PA 3SKVA 2Y6GA 2VM9A 4QX0A 4DUWA 1CX1A 5JXGA 3GGLA 1CZVA 3JXSA 4DXRA 1JYVA 1SDDB 4XUNA 1F4AA 3WNNA 3C7OA 3EYPA 4OUEA 2C4XA 3ACGA 1OF4A 5JXJA 2E33A 3OG2A 3OGRA 3WNLA 3WF0A 3DYPA 3I2KA 3VD5A 1GOGA 2W92A 1NKGA 2Y6LA 4MADA 1W9SA 2QQOA 2W5FA 4A3ZA 4OZOA 2Y64A 4QDQA 3A22A 1EUUA 5DQ0A 2ID4A 1P8JA 1CZSA 4RYDA 3VDBA 2JD9A 2DCJA 2J1RA 3T0BA 2LW8A 3A23A 2WABA 2XHNA 1ULPA 3PUHA 5CYYA 3MUZ1 2VZRA 5HPOA 2W1WA 3CKHA 2VCAA 4AG4A 3GXUA 5I0DA 4OMCA 2ZEXA 1PX4A 2VZPA 4Z2AA 1NUKA 2VZ1A 4AAXA 4XUQA 1GQPA 3SEEA 4OMDA 2W3JA 3C7GA 3HNMA 3NJVA 1W99A 4XURA 2BZDA 2Z4FA 1JZ3A 3SEPA 2VQUA 1O8PA 5DN2A 1UYYA 4MGSA 3WNOA 3ACFA 2W46A 4JKLA 3THDA 2XOMA 2CDPA 4KI5M 1PMJX 3UNPA 1JZ5A 3LQCA 1JYXA 5EIYB 3I2IA 4JKKA 2VZVA 3WQBA 1W9TA 2VZOA 2WO2A 2EICA 5JXIA 1OH4A 5JR2A 2BERA 3WEZA 2CDOA 3T09A 3VD9A 1UY0A 1DYOA 3OGVA 1ULOA 2YFZA 1UY1A 1L7RA 2WO1A 2ZXQA 3T2QA 3U37A 1I5PA 4ARXA 4GWIA 4CU9A 1LNSA 1MPXA 1R64A 2EIEA 5EJ1B 2V72A 4IUGA 2WDBA 4JX0A 3VD7A 4D8MA 3WNMA 1K42A 5JMOA 1OF3A 4W4ZA 1US2A 3NQHA 3C7EA 3K46A 4E8DA 1WKYA 2ZEWA 2W1SA 4CUBA 2HYXA 4MOAA 1YQ2A 4CVUA 2VZUA 2L9LA 1JU3A 2WYSA 3K75B 4QB6A 3HNBM 4PT6A 2QQMA 2ORZA 2YB7A 1XC6A 3K4AA 4ARYA 1JI6A 4MO3M 4A44A 1JZ8A 2WN2A 1UYXA 2C9KA 1W0NA 5G05L 3I2HA 3WNPA 2QBXA 1NAEA 3F2ZA 1D7PM 1UXXX 4XZUG 1JYNA 2XQXA 3W5MA 3GDBA 4A4AA 2BGPA 4CUCA 1UMIA 3LEKA 4DXSA 4A6OA 2J1UA 2OKXA 3EB7A 3WNKA 3HNYM 1UWWA 1TG7A 1JHJA 3FHQA 4W8JA 1GMMA 1UYZA 2VZTA 1K45A 3CDZB 3WSOA 1GUIA 1NX9A 2QQIA 3NNGA 2W91A 1UZ0A 5IYYA 3OBAA 2VTFA 4LKSA 2RV9A 4QX3A 3IAPA 3C8XA 4M4RA 5C7GA 2J1AA 2PQSA
chains in the Genus database with same CATH superfamily
1F2NA 1C1LA 2GMMA 2IWGB 1BK0A 4N7IA 4XFGA 4DRRA 1Q56A 1IKQA 1HXS1 1POV1 2VR4A 3POFA 4XJZA 1SPPB 3SCGA 3MLJA 3L9JT 3BKZA 4LQRA 1HB1A 4XF9A 3NNLA 5JPNB 4FPOB 1EP0A 1H1AA 1RUE2 1PIV3 3AP7A 5FY1A 5FYMA 4HVOA 3FBYA 3ZX7A 5FO7B 2WAOA 4XUOA 4CP2A 1RHI1 4IEZA 4EN6B 3ATGA 3Q8EA 3VZMA 5AFEA 1TVGA 3JB8A 1XYPA 2VBBA 1OD5A 2PHXA 3FLTA 2IVIB 1QJX1 5IFPA 2ZEZA 1AXZA 3CMGA 4MGIE 4DUVA 1HIXA 1WLDA 3FHAA 4LOTA 4Q4Y3 5FZKA 2ZHKA 2ZJCA 3UETA 1SFNA 3U78A 3VBSA 1YHFA 3ZVXA 1QJU2 3ZOIA 5L9RA 1KEXA 2R061 3A7QA 4RS5B 4CU7A 2BYVE 4OUSA 3BPZA 1SG3A 1FT9A 4ZU4A 3OJBA 4CTEA 4P9XA 3BGAA 3LDKA 1AR91 4RD7A 4OFGA 3SH3A 3RDIA 1GV9A 2WO3A 1FI2A 4KMQA 3MZHA 4IE5A 2VH9A 4LO8A 2VZQA 5DAWA 3KSCA 4KWLA 2CNAA 2I07B 3O1PA 4UW4A 1BMV2 1X8MA 4AI3A 5CFDB 5GZCA 1O3QA 5K7PA 4XXAA 2DWRA 1HRI2 1F35A 2A3WA 3I2FA 1NA1A 1ZRDA 1C28A 2RDRA 4IW3A 1TZOA 1BBT3 1UIJA 2HWE2 3POWA 3OYWB 4HG6B 2VTXJ 4P9LA 4AFMA 5CFCC 1OD3A 2QQUA 4AAPA 2TBVA 1XJAA 4KU7A 3HT2A 3WQ1A 1ZZBA 1GOFA 3LOBA 2MHFA 2Q8CA 2NP0A 4LA2A 3O14A 4Q1RA 3VDCA 2BEOA 4LIVA 5DAPA 4DO0A 3WDXA 1R1ZA 2DCYA 1G9AA 2NN8A 2OYZA 2VZ3A 1S2BA 2WNUA 1LULA 3DN7A 3TN92 4YZ4A 2XB6C 1VRBA 3FWEA 3JD72 1D4VB 1VBB2 4HVQA 4N8MA 2ZS6B 2AZ5A 1LR5A 3BVCA 3M3CA 4M3CE 4XBLA 3ZFFC 5ISLA 3ETPA 3O5SA 2J22A 5CNAA 3B9IA 2JE7A 5A3PA 2X5IA 5JVVA 4Z8BA 1V6IA 3WW2A 4CCJA 1W6OA 4AEDB 1US3A 2DCKA 2VOKA 2A75A 4XABA 4CCCA 1QOOA 4NIAA 4PBOA 4BJ0A 5C6CA 2FMYA 1NT0A 4XDQA 1LHWA 4J1XA 5I0TA 1W6QB 2VNOA 3NSTA 4JC1A 2RS12 1GNZA 2WINB 4AI0A 2WQ8A 4QX7A 1PGSA 1W8NA 3K4DA 4DPNA 5J09A 1W0OA 4JDNA 1I1EA 3I4IA 4PLMA 4P9GA 4GMP1 1VMHA 1R093 2HH9A 2JDMA 4EZHA 2IFWA 1ZYBA 4QD2A 4YGDA 4IV3C 2W2IA 5FPLA 4NJ4A 2R043 2QQKA 2YZ4A 2WZR3 3I2GA 3ETQA 1ALYA 1S0CA 4NWWA 5FZ3A 2A6XA 5F2WA 4IV1A 3UKNA 4E2SA 4JGZA 2WSVA 4GULA 4TN7A 5EHDA 3Q8FA 1HJFA 1W04A 1OVPA 1YIFA 2VMEA 4CZSA 4BK5A 5DG1A 4BMEA 4S2DA 1HB3A 2NMNA 1W8UA 1UNBA 3ZPOA 1TMF2 3AMNA 1QQP3 2ZEYA 3EXUA 2QQWA 2R071 1DQ0A 1AR83 2BNNA 1PM7A 3OD0A 5APAA 2YC4A 2C6SA 3LSEA 2WFF3 1H8TC 1UOGA 3MICA 3VDDA 4XBQA 1BK1A 3C7FA 3D3AA 4XE9A 5FCCA 2QQLA 4JZRA 5C71A 2LUWA 4PDWA 3H8UA 3LE0A 4GIQA 3MF9A 5A6ZA 1J3RA 3M3OA 4CDUB 5FY4A 4CUAA 1DHKB 1OSGA 4BMBA 3PL0A 1PMHX 1MACA 3ABZA 4D6RA 4X6QB 5LW9A 3AYDA 3HN3A 1R1A2 3RYRA 4FI9A 3J8F3 1D4M2 4BLIA 4EYUA 2D3SA 1QNWA 1RUC2 2HWD3 1MS0A 3VKNA 4NRPA 1W2NA 1XQNA 4GH4B 4I30A 3VDAA 4FPHA 4LK6A 2PAEA 4N53C 5H9RA 2FMDA 2WZEA 1REEA 5FV3A 4WVZA 3MBWA 4XC9A 1W2AX 4KH9A 4Y26A 4Z92B 3N9NA 1JUIA 3S7IA 1KFXL 3HEIA 4Q4X1 4UFIA 1QEXA 4AEMA 4A42A 5A3TA 5C70A 4EV0A 3VD4A 1K5MC 1PVC2 1QGLA 5F3IA 4GWJA 4L11A 4Y1ZA 3WW4A 3CZJA 3BTYA 4C91A 1PGW2 4LTAA 3S30A 1FX5A 3I97A 1WUVA 3POBA 1VBE2 2P3JA 1RUF2 4IE6A 1XE0A 2RM23 3NVCA 1DZRA 1RUJ3 1B35A 2RS31 3LEMA 1PVXA 3P6BA 1HB4A 1WCQA 2DTYA 2VOTA 4LBLA 1V6LA 2ZGQA 2AUYA 3K4ZA 3POJA 4M3CF 4PCRA 4X6RB 3WP6A 5LK5A 5BNPB 3LF7A 3S5AA 1BLZA 3AB0A 2WS92 3E5QA 5FZBA 3JUUA 5FY9A 2OUHA 1XNTA 5JZGA 1K12A 4M00A 5KXDA 2RMU3 4CPBD 3OY8B 1W8WA 2XVLA 2CGNA 5EYYA 3CZUA 5FYCA 4QQPA 1WA6X 2WKKA 1COV3 2J1VA 3ILFA 3DPRC 2OA2A 2ADDA 2GN3A 3IBMA 1WBFA 5LRSA 1RMU3 2ZGTA 3ZYPA 5FUIA 1VBD3 3Q8CA 2RE9A 4YLZA 3X29B 1ZA7A 5A3WA 4A2UA 5ACA3 5IHRA 2VCBA 1ZA4A 3VBOB 1H2KA 1FMD2 1MS8A 1J3QA 2JD4A 4XF0A 3DYOA 4K9SA 1V6MA 3OOXA 1AUYA 1QF3A 4XW3A 2JKXA 4ZU5A 1UXZA 1Y9MA 3MPBA 3D0JA 1LOAA 2VXJA 5FZ9A 2IXKA 4RGKA 1SEFA 2WO7A 3BTAA 3AKTA 1WMEA 2ZAAA 4DXZA 2CY6A 5FYZA 4QPGB 4HBNA 5K0UA 2YBPA 2JWPA 1DZTA 4Q1PA 3VB9A 2VVFA 4C1WA 2QE3A 5CBLA 2GP5A 2E26A 3GJBA 5DUXA 2JENA 5FPZA 3PHMA 1UY3A 4BXFA 2NYYA 1YFUA 4Y3OA 5IK4A 1LODA 3MW2A 4Y24A 1CAUB 3D4KA 2ARBA 3R0RA 3T0AA 1HRV2 1IGOA 1KDMA 1KJLA 2JB8A 3N35A 1UY2A 2VJXA 2ERFA 4UYBA 2VC9A 5L9BA 4LKDA 5CZKA 3VBSC 5K8SA 2PXJA 3PJQA 1S0IA 3UESA 1NE4A 4YFWA 1SLAA 5FZAA 2VMCA 4DRVA 5C33A 4J6GA 1GP4A 5L73A 5JXHA 2NPIA 3E6DA 4JV4A 4OLLA 4CEYA 4BA6A 1C57A 1OUXA 1U12A 3LB9A 5D8AA 2A7AA 4YW3A 1BCXA 2VPVA 1U5XA 1GWLA 2J1EA 2PLV1 2RS51 3LDRA 2VD7A 3DKWA 3ZXFA 2QVSB 1ZRFA 4BQ3A 5CKQA 4Q4V2 1AR62 2PHTA 5A32B 1RUOA 4GB32 5KBFA 1CX1A 1NA1C 1EV11 3I2OA 3AP5A 3GGLA 2RG4A 3B01A 1CZVA 2WSUA 1KQRA 1VR3A 1JYVA 1IKPA 4LMFA 2F4PA 3GHMA 3N7JA 1W3XA 2DUOA 3B02A 3WLUA 2XL7A 3SQOA 3ZXKA 2RDNA 1Y43B 2PHWA 4JRLA 3MIDA 4DOUA 5IVVA 1YO8A 4GALA 2C24A 2FBEA 3UKVA 3VBUB 3T3YA 3ZSJA 1LEDA 1G7YA 2E33A 2WNUC 1A3KA 3I59A 4YW5A 3WNLA 2XQRA 2ZAHA 4J1WA 4KNCA 3ZPYA 1XSQA 3LWCA 2D3RA 1JH5A 5E89A 3QLQA 4IEVA 5HXVA 2Q8OA 1AX0A 2GNDA 3CO2A 5KXBA 2QZ2A 4JHTA 4XZPA 5FZFA 4A3ZA 1OQ1A 1Z7S1 4B4PA 3W21A 5I8SA 5CADA 1HQWA 1WW6A 3OBRA 2EALA 3AVSA 1JBCA 5KHHA 4BIFA 1URXA 1CZSA 4JGYB 4EN9B 3KCCA 2UY8A 1HRI3 5FYUA 2VQAA 5FY7A 2VULA 1ZRRA 3FMGA 4EN8B 5CG9A 3BODA 2DCJA 2J1RA 3PMSA 3T0BA 4CYDA 1XB9A 4HPKB 3A23A 2WABA 4OULA 5LBEA 2HWE3 4NIHA 3PUHA 2HEVF 4FQ4A 5C3RA 1JOPA 1YCIA 5SV5A 5HPOA 1OA4A 1PK6A 3NW4A 4AG4A 1YLLA 4LUMA 3T1MA 5AC93 1OLRA 4WVMA 4GJYA 4RHV3 2VZPA 1UU5A 4GAZA 4M0NA 4XILA 4Y5SA 2VZ1A 5FFOC 4XUQA 3IZOA 3SMHA 2FQPA 2MEV2 3JD73 3ZXLA 3ROUA 2O14A 3L2HA 3C7GA 4IV1C 5FP4A 1WGPA 4JGZC 4XURA 3OSDA 3POGA 3DXTA 3RYKA 1OH3A 2K2SA 2R6QA 2WC2A 3PVOA 3UGFA 1PIV1 3OGJA 1CR7A 3DCQA 4FPJA 4K3UA 2QFEA 3KCYA 3SEPA 5IW0A 3RMXA 1ZBE2 1QJY2 1O8PA 3GZAA 2NLRA 1A8DA 3RPQA 1J3PA 4YZ3A 3UT0A 1WMFA 4FVVA 4JKLA 1JOJA 1TME3 4FPEA 3T4VA 3THDA 1Q8SA 4YVSA 3VDDC 2CDPA 4Z82A 5FY8A 5LEKA 4YSFA 1OLMA 1JZ5A 1DYKA 3FUOA 4PDWC 3LQCA 5K4LA 3NKGA 1QJZA 5FMDA 4BCUA 3NWKA 5IVJA 2WNVB 2P2KA 4E4DX 5EIYB 2Z5WA 2VZVA 4Y1XA 5C4WA 3ES4A 5FYIA 3WQBA 1W9TA 4HKWA 4MSVA 5JXIA 2YGLA 3RZKA 1GICA 1OOPA 3AL5A 1F5FA 3QH7A 4GKXA 1LOGA 1W6PB 5E8AA 1LECA 4KG0A 3T09A 4QKNA 4GQ7A 4Z2WA 1G9CA 2VW0A 3VD9A 3IKWA 2D5HA 5F37A 2YFZA 2Q8DA 2XBO2 3OD4A 5FRAA 4ISRA 2GSYA 2WO1A 4YYOA 1S0BA 4CE8A 3U37A 1O7FA 3O1RA 3BI3A 5F5CA 1KFUL 1AYN2 2JDYA 4GWIA 3VKLA 3PDQA 5JSPA 3BTZA 1CAXB 4CU9A 5I93A 1BBT1 1MPXA 4LBNA 1LU1A 1SLLA 1ACCA 2V72A 4Z07A 2EXJA 2W39A 5TSWA 3JBG2 4K20A 5F5AA 3HAGA 1W2OA 1ND2B 4ZS2A 1GQHA 1EPWA 2QTWB 1WWYA 1NCQA 1SCRA 2AGSA 3ALQA 5JSOA 1ZRCA 1B35C 2FCUA 1DGWX 1C8M3 2YC0A 1LOCA 1W05A 4CUBA 5HV0A 1DGWA 2PHFA 1AR73 3LA3A 4META 2H0VA 3M8LA 4AI8A 4QM9A 3OBTA 3DL3A 1RUC3 2VZUA 3AP4A 3POYA 5EP9A 4YW2A 3WXPA 1RUI3 2WYSA 3LIGA 3M3IA 4PT6A 4QB6A 2OZ6A 2ZACA 1GZCA 4CEWB 5JZGC 5GZFA 3E6CC 2YU1A 4M0HA 4ARYA 4D3WA 1RVF3 1LOBA 4XF1A 4XHXA 4L2NA 5FP3A 1ENQA 5J36A 3BU0A 4Y5Z0 1ULCA 1QH7A 1YFYA 1V70A 2C9KA 2A71A 1W0NA 2VUJA 4N43A 3ZKYA 1FPN2 3I2HA 2D97A 4OQ9A 4IEQA 2ZGLA 3AXEA 1NAEA 3K3OA 3AFGA 3CJIB 4G9SB 5CKMA 1GWMA 4DZGA 1R091 5D1IA 3GDBA 3TNPB 4A4AA 1VBE3 1J58A 1NLQA 1UMIA 3KQ4B 4LE3A 4Z1VA 1VIWB 2E7AA 2D44A 2R041 3LDBA 1C5HA 3N9PA 3VBHB 2WZR1 1UWWA 4KBZA 4W8JA 5K0UC 4WBBA 1UYZA 1VB2A 3V56A 2ZKLA 2TEPA 1K45A 2JDNA 3WSOA 5JI9A 4DNYA 3VLBB 3H1YA 2QQIA 5F6LB 3RZGA 1YWKA 3WP3A 1A78A 1VP6A 3BOWA 2W91A 3NMBA 5EZWA 4LORA 3GZEA 5H9PA 3WDWA 3VBFC 4M3CA 5FPUA 1VBA3 4Y1VA 3U4XA 4LBMA 1QQP1 2VTFA 4S2HA 1DQ4A 4LKSA 5K9YA 1AR81 3IAPA 3C8XA 4NE9A 3TEYA 2J1AA 1CX4A 4QXHA 5L7OB 4Q29A 2FDGA 4A7YA 1OA3A 2RR13 2DCZA 1BVVA 3R4UA 3N9MA 1IHMA 1IQDC 2W47A 1CAVA 1DZQA 2A1XA 2VNVA 3E5XA 4Q4W3 4QPWA 5IK7A 3W5NA 4AWDA 3WQ0A 3EQEA 5FLJA 3RWKX 3IM0A 4ATEA 1DU3D 2NMOA 4LE4A 4GXLA 3VHOA 4CEYC 1YEWA 1W03A 2QDNA 2R0FA 4L99A 4P9YA 5D8AC 5FLIA 4AR2A 3J8F1 2Y8KA 2JICA 4PHZA 5CU1A 4KU8A 1LHVA 1VPHA 4IEWA 2HWD1 1IPJA 1I6XA 3WUDA 2QQPA 4YPJA 4B8EA 1OUSA 1GLHA 1LEMA 2CYFA 1LTEA 5EYXA 3T2OA 1NY71 5EFUA 5D21A 5FZOA 3RZHA 1NXD1 4RQPA 2JB4A 2E63A 1Y7BA 2D6KA 3SC7X 4MGTA 2GH2A 3WDVA 1FNYA 5AVAA 3CNAA 4G4FA 2W94A 4DUXA 2DVAA 3IN9A 3JZVA 1AX2A 3HWJA 4K8FA 4URTA 3RRDA 3ZXAC 1CIYA 1OMIA 4BZ4A 1QOTA 1F4HA 1UKGA 4N9HA 3GM8A 4LXLA 3MFAA 2W08A 5DDJ3 1Y9GA 2DURA 1U5YA 5AFBA 2GMEA 4FFGA 3O0VA 4P9WA 3A21A 4A7KA 1XNKA 2GNMA 2RM21 4QU1A 1RUJ1 4DEQA 4YG0A 4EZ4A 2VG9A 1ONAA 4HN0A 1BZWA 3BOPA 4YW4A 3WF4A 5JAXA 5SV8A 4WM8C 5BY5A 1BVP1 3HMYA 1YC61 2ZGOA 4K21A 1RUG2 1YIPA 1LOEA 1N1VA 1TNRA 5LZ6A 4NWVA 2YBSA 4CCEA 3TEWA 2RMU1 5FDBA 3RI8A 1UX7A 1ZZCA 5IVBA 1T6BX 3KV5A 1COV1 5JSRA 2FDFA 1PK6C 2BQPA 1F8VA 5KHJA 3CJXA 1RMU1 3I54A 3OPZA 4D0QA 1VBD1 5ACA1 1VB4A 1LCLA 1CIWA 4A41A 4BH9A 2KXLA 3N7KA 1YJLA 3LEIA 3WUCA 5E16A 4AQ2A 4AYUA 2WAAA 4ES8A 5JMCA 3PVNA 1O3RA 1ULFA 1HLCA 1GNHA 1RUD2 2YXSA 3HQXA 3R4DB 4NHYA 4N53A 2DYCA 2OW4A 3ZSMA 4YVWC 3AZYA 5FP7A 5JUVA 3KB5A 3NNJA 1KGYA 2A3XA 4CCOA 3MV11 4D6SA 4X8NA 1AF9A 2V5DA 3HVDA 3AZXA 3E5UA 4H55A 5G04L 3SITA 1J83A 1IQAA 2WT2A 3PUIA 4XTMA 3W58A 1XNCA 1O5LA 2XONA 1OFSA 2ZX0A 1AL23 1ZX5A 2JDZA 1EUTA 3IIIA 4IETA 5C5UA 4YVSC 5FTTC 4E4ZA 5T54A 3O1VA 3ECQA 3I3DA 4DMIA 5ERLA 1ND3B 2JG8B 2QJVA 4LLFA 1H1MA 5C4WC 4IGPA 5A7NA 4AHYA 5JDBA 1OBNA 3HQRA 1LHNA 3ZXEA 4NMIA 4HONA 3NAPB 2ZABA 4DY5A 1OOPC 1ZM1A 5FMBA 2E31A 1F31A 3AKQA 4XJUA 3D0SA 3AM2A 4NPLA 3B94A 1CAWA 2VCCA 4RR3A 4XF4A 1O6UA 4QDSA 4UF0B 1G6NA 4XETA 4XIKA 5BNNA 3TAYA 4R4XA 3WF1A 1UOFA 1WW7A 4H3WA 4CCLA 5BNOA 3RI9A 2E9QA 3AXDA 5FZEA 5A1AA 2LTNA 3K2OA 4QGMA 2VL4A 4HFSA 4YM0A 2VXRA 5DUWA 2ILMA 3LCPA 3WT3A 1ZREA 1O91A 2YC2A 2ZTNA 1Q8QA 1FNZA 4NAMA 3AC0A 2Y38A 2ZGNA 4IEOA 4BDVB 2PYTA 5IWFA 4ASLA 5FOJB 1S0GA 5E6HA 3ZN6B 2BPA2 4A3XA 2D6MA 3OTFA 4AGGA 1SLCA 4URAA 2KD7A 3KVBA 4PJYA 4C1XA 4IE0A 2JKBA 2WUHA 3NO8A 1FYUA 1RJ8A 4XUTA 5T3NA 4C90A 4FTBA 3ZFGA 2EXHA 1JYTA 3DYMA 4IE4A 3TOJA 1VAVA 4MYEA 1NCQC 4DEVA 1ASJ2 3PUAA 4IXLA 4E4HA 1MS1A 2A73B 2VOWA 4XQDA 2HWC2 2NQYA 2ORXA 2W95A 1YUDA 5FZ8A 3MUY1 3BALA 3KGLA 4FFHA 5F32A 1PO12 1X82A 1KJRA 4OHYA 1GZWB 2ZHMA 4ZONA 4E4SA 3K77A 2HWF2 2IXCA 1TQ5A 3ZFEC 1BEV3 3INAA 2DBIA 1NCRB 2ET1A 1C4RA 1GWKA 3B9CA 3PNAA 4FOQA 2J7MA 2VMHA 3IDAA 2Y6JA 1SLIA 4H2AA 2YY1A 1YI9A 4EWAA 1LOFA 3M1HA 1LHOA 4IV3B 3VL8A 5KXCA 4N43C 4BXSV 4UBHA 4LPLA 3PU3A 4LA3A 4W65A 4QXBA 4Y20B 1QJFA 2A6VA 4V2VA 3EBRA 1EAH1 3WVJA 5A3OA 4ZZ5A 3J7LA 3J7MA 3ZXDA 4TLGA 5AC91 1W28A 4RHV1 3ST7A 1W8FA 3JU9A 2X53S 1MVEA 2Y6FA 4XTPA 5ABJB 4TTGA 3LIHA 1J1TA 2VOVA 1S2KA 4GZ9A 3OF1A 4FAGA 1GNYA 2O0OA 4PLNA 5A7QA 1HXS2 2G9FA 2W87A 2BGCA 3LPGA 4MGQA 4IE7A 4QX1A 1ODNA 4RL7A 4CP1A 2YDEA 4NO4A 1W9YA 4Q0VA 2V5YA 1V9U3 2BOJA 3USUB 4YZ5A 2G1MA 2HEWF 5FBZA 3PLQA 3P3PA 4FQZA 2XLAA 1RHI2 3ACHA 2AEZA 2P34A 1TME1 2ZA9A 1S0EA 3MW4A 5T5JA 5J1XA 1QJX2 5LA0A 5FZ7A 2DVGA 4LKFA 4H7MA 2TUNA 1WCUA 2VY0A 1L7QA 3BN6A 4AFDA 4QHZA 5BNPA 2D5FA 1HV1A 4LHNA 4YWAA 3J7HA 1HQNA 2PAKA 3H42B 1VLNA 2R062 5LBFA 2AC1A 3ORJA 2G9ZA 2W9XA 4AFBA 5B4NA 2CWMA 4ONUA 4WM7A 1AR92 1OI6A 2PHRA 3FC0A 2JDAA 4PIYA 4C0HA 1K5MB 1RINA 2OIIA 4BM8A 3SNMA 1KITA 4Q8LA 4ZXKA 3T30A 3WF3A 3FL7A 3ACIA 1CZTA 3JCIA 4MHUA 4RQPC 2HWB3 2RJKA 3E1F1 1XXNA 3ACLA 5FYTA 1XNAA 2BVVA 3S5QA 5FZCA 4KL1A 3T08A 1D2SA 5J98B 4INDA 2PN5A 2OS2A 4I3GA 1SCSA 4L97A 3HJRA 4CP9B 4P00B 2XPJA 4QPGA 3UGHA 3WQ7A 1RYYA 3JB4C 4FO9A 1REFA 4IQPA 5KC6A 1LJ7A 3DECA 2V73A 3DXUA 5DPNA 3T2PA 5GALA 3U0ZA 3TYJA 2HEYF 1NXMA 2ARAA 1RXGA 3SKVA 1AXKA 4QX0A 1G9FA 2OVUA 2Y60A 3VKMA 1C8M1 5JXGA 1UU6A 4LOSA 1AR71 4BQWA 1MQTA 2EAKA 3DPRB 3ZYIB 1H4HA 2JXAA 2XG3A 2ZGRA 3I2DA 1NLSA 1SDDB 4LHKA 3PTRB 5HV4A 2EF6A 4UW5A 1F4AA 3POEA 3WNNA 1RUI1 4EJRA 3H8XA 2A5ZA 3H3UA 4A6SA 5LBCA 5D2AA 1D0GA 3TEXA 2Z79A 3TEZA 1QHDA 1RXFA 2R16A 1RVF1 2OT7A 2VW2A 4HLTA 5JXJA 4QX5A 1MZ5A 2DVFA 1ENXA 4R52A 3WF0A 4UWDA 3I2KA 4GKYA 1UOJA 1X36A 1MZFA 5FZDA 4MGYE 3VD5A 4OHWA 2W92A 4JVAA 1BJQA 4PBPA 1UZWA 1VAMA 3A22A 1EUUA 1VBE1 2GAUA 3KLSA 4AHWA 3GBGA 2BNMA 4CCKA 2GU9A 2VAUA 2UWCA 1AYM3 3NNMA 4RFT0 5FP9A 3L2YA 4RYDA 3ZDSA 2XDVA 3M2MA 3NV2A 1VMFA 1SLTA 1JMUB 3J7NA 3LA7A 3T1LA 1VBC3 2VTXA 4BE3A 2VBDA 1ZVFA 1EYBA 3VBSB 2E51A 3WNOA 5CYYA 2PHLA 2VZRA 3MUZ1 4QHOA 1A34A 3ME2A 1HDKA 1C8NA 3FJSA 3GXUA 1VBA1 5F5QA 1PX4A 5FY5A 2VCMA 4Z2AA 2BNOA 4PIZA 4AQSA 2IXJA 4D6QA 4Y22A 2RR11 5HCBA 3WDUA 4GWNA 4Q4W1 1CPMA 2UY9A 4AEDC 2BDRA 2PHDA 1NA1B 4OCTA 3M3EA 4XDPA 4RR3C 1IS3A 1WMDA 2VQUA 4FP3A 5GLWA 1V0AA 5BNNC 5DN2A 1OURA 2XVGA 3PURA 5BNOC 2FZ1A 4D94A 1DQ1A 2AACA 2D6OX 1FOD3 4GWMA 1NLRA 2XOMA 5FLHA 5FQ0B 4YM1A 3MDPA 2ADEA 4KI5M 4ZKTB 3ZYBA 2FDKA 4AQTA 1A6CA 5FZ6A 1JXNA 3C2UA 4N90A 5C3OA 3WD5A 3WOGA 1OFNA 2WNUB 3I2IA 4AXOA 2VZOA 4W6YA 5CVRA 4Q4X2 5JLVA 1VRH1 2BERA 3N4MA 2IFRA 3ZN5A 1I5ZA 4Q0UA 3WDTA 5F3CA 2OPWA 4QQ2A 3ZFGC 5GZGA 4AOCA 2X5IB 3AMHA 1I9RA 2BUKA 5F6KA 2I45A 5A80A 4XDOA 5DDJ1 3ITQA 1W6OB 3ZSEA 1L7RA 1MEC3 1ZBA3 5J7MA 2WNEA 5KHKA 5CAZA 5I91A 4IGOA 2YPJA 5C8CB 2F17A 5FO9B 2WLPA 4RGGA 1R083 3AJYA 3CU7A 4OUMA 1GP5A 1O4TA 2RS32 1K5JA 3H1MA 5FAXA 1GR3A 2WNOA 3VBFA 1R64A 4MXWA 2EIEA 2TNFA 3DKQA 4XMAA 1MZ6A 4LUKA 5EJ1B 3D6EA 2WNVA 2JDHA 2WDBA 5HCHA 4R9BA 4JX0A 1W90A 5GLTA 4D8MA 3AZVA 3WNMA 4NRMA 1LOFC 4MGZE 4P5HA 3NQHA 4QGNA 1RUH3 4ZHNA 2V09A 5LATA 4KG8A 4IV1B 4COZA 3TWIA 1KS5A 1FXZA 3ZLIA 4BIOA 4QPIA 1C1FA 2W52A 3A0NA 3M4FA 2B7YA 4AHXA 3KWVA 1D2QA 3PIGA 2VU9A 1MS3A 4M01A 4BOWA 3K75B 1RUE3 3HNBM 3V0BA 5HBAA 1S0JA 3V0AA 4XJ8A 4CDQA 3ZXGA 2YB7A 4R4ZA 5A6XA 1XC6A 2F4LA 4CUGA 5EJ3A 1DGLA 1XOYA 2JDKA 4QT6A 2NZ9A 2YROA 5FPBA 4PDWB 1DIWA 3SCHA 4B1LA 2HWF3 1G9BA 4LKEA 3O12A 4PLOA 5G05L 5FZLA 2QBXA 5BPXA 1YQCA 1H0BA 4HVRA 3U07A 3APBA 1AL21 1AX1A 5KC5A 1XYNA 3NL1A 3O1SA 4B4QA 2HYKA 1QJU3 3KD4A 3UK9A 5A3MA 3B93A 1UX6A 1V6KA 1PO21 3LEKA 4IESA 3FBMA 4YG6A 4CDWA 4JAAA 3M3QA 5BNPC 2GC0A 1TG7A 1X9PA 3FHQA 3N9QA 2AYHA 4F8AA 1XNDA 5FO8B 3CLPA 4WM8A 1KXGA 4LO6B 1JW6A 2JG9A 3VHNA 1NX9A 4XFIA 1PZ7A 3GCWA 4NHXA 1VAKA 2XJTA 4G3YC 1WLCA 4NPRA 4XAAA 4ASKA 4WM7C 2ZZJA 3N9LA 3NNGA 4UFLA 5C3PA 2N7GA 1W6MA 2PLV2 2RS52 1HXS3 1UZ0A 2YMZA 2PMWB 3ZDVA 3ZMNA 2RV9A 2ET7A 3BUCA 2MNGA 2UYBA 4ZPIA 2X10A 1SZBA 2UWBA 3WW3A 2FDIA 2R49A 1XU1A 4AFCA 3VD3A 1EV12 2BRTA 2VMDA 4LBJA 2XWBB 4BU2A 1O3SA 3CQOA 3MEPA 1DCSA 2OXBA 2XJUA 3RZMA 1OPOA 1W06A 3IAQA 2OQ7A 4LR4A 4IEPA 3H7JA 1LU2A 1CD3G 4QPGC 1UZZA 1XU2A 3TN93 4LO5B 3V65A 1YQ6A 1K3IA 1VBB3 1WCDJ 5FZMA 3RS6A 3VZOA 3ZM8A 4BWOA 3ZYJB 4KGQA 4YVWA 4I02A 5LA1A 5JZGB 3SLIA 3MF6A 4XIOA 3SHRA 3AYAA 1QXRA 1MQTC 4R9DA 2XGXA 3VBRA 3WNXA 2BOIA 2JDPA 1Z7S2 2CU5A 2ZHLA 3FX3A 3OUHA 2RJ2A 3M7AA 4HK9A 1BEV1 1JOBA 3RQ0A 5IK5A 3NNFA 2W1QA 3NJXA 2RHPA 2RS13 3OUJA 2HLEA 4CA9A 4Q4Y1 5CKNA 3VUOA 2GC2A 4FFIA 3VHRA 4XOGA 1PZ8A 2OZJA 5DZGA 2C26A 4QB2A 5DUVA 3RFRA 1KDKA 2D6PA 4L0PA 3KT4A 4EWDA 3ZO0B 3RNSA 2PFWA 3ZR6A 4Q2FA 2EXKA 4U36A 4QX2A 3CL1A 4EROA 1HX6A 4YG3A 3KF5A 3O0XA 1W8TA 2AREA 5FOBB 3T2TA 2O1QA 3P5BA 3BIWE 4I0AA 2SBAA 1CJPA 4XFCA 1UF2C 5DABA 1NQDA 1W6NA 2LS6A 3TB0A 3WZ1A 1TMF3 2CGPA 1OPMA 2EXIA 1Q3EA 2YGMA 4O65A 1WA4A 1PIV2 1ZZ7A 4IEUA 3VBUC 1V9U1 2RJLA 5CISA 1XPWA 3ZN4A 4Y1UA 5HCAA 3KM5A 3QACA 2CHHA 2ZMKA 3F95A 4XJ9A 4XJAA 2B4KA 4CXXA 1DQ2A 4NHKA 2P17A 1CQ9A 3MFCA 5D8AB 3VL9A 2PAMA 1PX3A 3MPPG 2D7FA 1G86A 3IPVA 1CJDA 2FD8A 1SHWB 5C9AA 4YGBA 3AFKA 5C8WA 1R1A3 2GN7A 2LROA 1GZTA 1UIKA 4V2WA 3KZ4C 4HOOA 2ZX2A 2K9ZA 5HCFA 3RMYA 4AZZA 1D4M3 5FBJA 5LWBA 2ENRA 4QXCA 4FP2A 4LBQA 5JOXA 1UPIA 1O59A 4K8RB 2JJ6A 2H6CA 4TSVA 3OB8A 2A6WA 3ZFEA 5IFTA 3SISA 1HQLA 4D7SA 5DUUA 1XBFA 1MR5A 1W2UA 4HZFA 5F1RA 4CCDA 3ZXJA 4NHMA 3MI8A 1OT5A 4MG2A 1W8ZA 1WCKA 2HWB1 1PVC3 4YGEA 4MUVA 1Q8OA 3GBFA 1NQJA 3I59B 3HN1A 2ZGUA 4TWTA 1HB2A 2J1SA 3MW3A 1JZ6A 3AMMA 5EXOA 4HKOA 2X09A 1BBT2 2WN3A 2XHKA 4NIDA 2WIIB 4Q0PA 5DAVA 5JCTA 2JE8A 2PQQA 3MV01 5FZ4A 2JECA 4L8QA 5J3UA 1CWPA 1RUF3 4MZUA 4AQ6A 2DU0A 2XWJB 3IMNA 1LAJA 1E5HA 3AYCA 5CA6A 5I8YA 1UMHA 2ZOEB 5IVEA 4AVVA 1PGL1 4OYUA 4QAWA 1ENSA 4LNVA 1WBLA 5A33A 3RZZA 1F9KA 3K51A 3I3BA 2WS93 3K3NA 5A7WA 3RWNA 3IMMA 4B4RA 3OEAA 4O7XA 1GFF2 1Q43A 3I7DA 1H6XA 3LPFA 4JHZA 4BK4A 5L9VA 1PK6B 1JYWA 2WNVC 4EN0A 2D6NA 2DDUA 4FPGA 2WFF1 1QY4A 2B45X 4WVMB 2Y0OA 4CDXA 3J9SA 3H50A 2WR9A 1RUNA 3NAPA 3HR9A 1LGCA 4BQ2A 4MVTA 5FMOS 4PF1A 1W8HA 1NOVA 4Y33A 5BV6A 1OQEA 3VZNA 4FPYA 1FMD3 4Q4X3 4FBFA 1QDCA 4LHLA 4GD4A 4PIXA 2FCVA 4QPIC 1X33A 2ZMNA 3GJAA 4COVA 4XHBA 1UN1A 5GJ6A 2GC3A 3B3QE 2R1BA 3VKFC 2WA3A 4NHLA 5LBBA 1R092 2IXHA 3OCPA 4CDQC 3BCWA 1AYM1 4RSUA 5H9QA 1OVSA 5IT6A 3PUSA 1YQ8A 2R042 3THCA 3AL6A 5EJZB 1UAIA 2RS33 2WZR2 5JOZA 1GOHA 5HXMA 2XJPA 2SLIA 1VBC1 3N3HA 3N7MA 4R9CA 3GCXA 5F8PA 5C4WB 3B69A 3WINE 4KGGA 2C9AA 1QXPA 1HRV3 1LESA 4P9JA 1SPPA 1H2LA 4DFSA 5BNQA 3PMEA 2C5DA 3CBNA 2E32A 1UL9A 3PJYA 3ZSLA 2X8KA 1QQP2 1W9WA 5B4XA 1JZ4A 3T0DA 1AR82 3WP5A 4N9IA 1XE7A 4CDWC 3WCSA 1IPKA 2XJSA 1Z0HA 3MIFA 4OHVA 5L36A 1GZWA 1POV0 1GU3A 1ULEA 4XMIA 1WW5A 3SXWA 3AK0A 3DV8A 3CEWA 4CEWC 4LK7A 1HN1A 2JG9C 2P37A 2VVDA 1DGRN 1SFYA 5DAXA 4UW6A 1DQ6A 1AR63 4Q4V3 3LOIA 3CIHA 1H2MA 1WCSA 4GB33 5FWEA 1RB8G 1M06G 3J8F2 2BFUS 5IVFA 1UYPA 5DMYA 4RS5A 4XVHA 4FOWA 1FOD1 2HWD2 1FAYA 3THTA 2EIDA 4Q5OA 1IS6A 3NV3A 4GA9A 5J37A 1X9TA 4QDRA 5A6YA 5F5IA 3UKTA 1OQDA 3AKSA 5GM0A 1NY72 3WDYA 2C1FA 2Y6KA 1W2TA 3QOPA 1NCQB 1Y3TA 3FLRA 1GBGA 4YW6A 5CFDA 1BHGA 2YPDA 3VBHC 4JKMA 1PNGA 2E6VA 2Q30A 1BKZA 2RVAA 3NJZA 3THPA 4HSLA 2ETEA 1H9WA 2BTVC 4RN5A 3OYWA 1FV3A 2W1UA 1J59A 1BXHA 4LIUA 2Z69A 4AK3A 1AZDA 1YFXA 1MEC1 1ZBA1 4LT5A 1STMA 3WW1A 2XL9A 3PTYA 1R081 5KXEA 2RM22 1J84A 1RUJ2 1CN1A 3UV9A 3VBRC 4B3NA 3WV6A 2QDRA 3ZYRA 4N43B 4XF3A 5BYNA 2BWAA 2YG0A 2WJSA 4RA0A 3EHKA 3WG1A 4DS0A 2QQNA 3D5OA 1NZCA 4HXCA 1JTZX 4Y5TA 4AVTA 4W6XA 4UFHA 5FXXA 4QX8A 2RMU2 1DLLA 3PIJA 4KWJA 4UFMA 1RUH1 3HT1A 2AR6A 1COV2 2G4IA 4FPFA 4AEDA 4BHPA 4DB5A 1DGRA 2VM9A 3O1TA 2G19A 2LRPA 2MEV3 2VGDA 3R05A 4GJZA 4LJHA 1RMU2 4O9GA 4QM8A 1VBD2 5ACA2 5CFCB 1S4CA 5FR3A 2Q0AA 4HKLA 4DXRA 4AEJA 1W6QA 5J96B 4AVSA 3RZLA 4XUNA 4M3CB 2ARCA 1RUE1 3J4UH 4HK8A 5FKCA 3LA2A 1L3JA 3ON7A 1ZBE3 3EYPA 3IIAA 3VZJA 1LKNA 1QJY3 4XEZA 2C4XA 5FYBA 1OXCA 2HWF1 1OF4A 4Q8KA 4HL0A 4XQWA 1CAVB 3OGRA 3OG2A 1Z78A 3ZFFB 4XAEA 3H3ZA 1NKGA 3VN4A 1XRUA 2QQOA 2W5FA 3QCWA 4GMP0 1U5ZA 4OZOA 4ZS3A 2Y64A 4QDQA 1QJU1 4AE2A 1AHSA 1N1SA 5C9AC 1LB2A 2ATFA 5LK7B 3Q8BA 1APNA 2ID4A 1P8JA 2ZX1A 5CIRA 5IK8A 2KA3A 5T5OA 3K48A 2DTWA 2VQ0A 5CEHA 3MIEA 3QH6A 5FK8A 3KS7A 4NROA 4RQPB 4CXYA 4PQ9A 4E2QA 3LFIA 1BMV1 3VGIA 3PVEA 2XBO3 3AMPA 1SMVA 4UFJA 1E5SA 3FUQA 4OI4A 4QQOA 2OUJA 1HRI1 2W1WA 3AYEA 3CKHA 3NV4A 4CDUA 2CWSA 1AYN3 5I0DA 4JDOA 2V4AA 3GNEA 3G6JB 5F3GA 3LKJA 4I3PA 2HWE1 1POQA 3KHCA 2BJSA 2XLGA 1PMIA 4QHBA 2YU2A 1GQPA 1XE8A 4B7KA 2GC1A 5FZHA 2PTMA 1B09A 1SFPA 2UWAA 2O8OA 3FHIB 3JBG3 3R4SA 2W3JA 1RC6A 4FT8A 4OMDA 3NJVA 4GH4A 5T55A 4AL9A 5EV7A 3BTXA 1O3TA 4D7YA 1M4WA 2WWJA 1UZVA 3B7MA 4QKFA 1JZ3A 5FK7A 3TN91 2GH8A 3JD71 2XH6A 5DXDA 5KWRA 1VBB1 1VMJA 3WHUA 2VOXA 1UYYA 5IVYA 1H8TB 5DG2A 1DQ5A 2ZCWA 4LITA 2UU8A 1PMJX 3VV1A 3UNPA 5DZFA 4AI1A 4C8DA 4L9BA 1AJOA 1LGNA 2Y0IA 5EPAA 4PI2A 1JYXA 1ND3C 1QIQA 2JG8C 4LBOA 4EWEA 3ZYGA 2WO2A 2ES3A 1OH4A 4MXVA 5A6QA 5JR2A 4YGCA 1AVBA 1W3VA 3D8CA 4CDXC 4JDMA 2OX0A 2RS11 1FPN3 3JQWA 2CDOA 3NAPC 3AZZA 5CG8A 2Q1MA 1IS5A 2MPFA 1DYOA 2F6BA 5F2SA 3OGVA 4NAOA 1UY1A 4N53B 4AEKA 3HBKA 1V6NA 4Q27A 2K46A 1EAH2 2KR2A 2ZXQA 3T2QA 3OY8A 1LRHA 1YYNA 3KV9A 1ZRIA 3PU8A 1UZYA 5FQ0A 5AC92 4HSJA 5E1RA 4RHV2 5GZEA 1LNSA 3H8RA 1TNFA 4QWNA 4OVEA 2WL1A 2AENA 3U11A 2E53A 3VD7A 1XSRA 2AH2A 2VNGA 4IEYA 3VBOA 1GZ9A 1K42A 4FOYA 5JMOA 1TMF1 2YUEA 1OF3A 4TLFA 4A7ZA 4LLOA 1US2A 4BQXA 1WW4A 2XKPA 4QU2A 3K46A 4E8DA 3PUQA 3TRSB 2GALA 2XMLA 5M0TA 1UCXA 2HYXA 4MOAA 4LO7A 1YNAA 1CAWB 3D82A 1UOBA 4HANA 4R8HA 4RR3B 4IL7A 4CVUA 3KF3A 5C8CA 3AP9A 1TME2 2WWSA 5FJKA 5BNNB 4MGKE 3Q8AA 3AJZA 5AVPA 1R1A1 2QQMA 5BNOB 1GSLA 2ORZA 3A4UA 3WR0A 3M70A 1D4M1 3K4AA 1CAUA 1NCRC 1AL0G 1RUC1 2A70A 4NPMA 2VW1A 2QZ3A 4A44A 3A0KA 1UYXA 2A3YA 2NM1A 1TEIA 2YHJA 2PA7A 2ZHNA 1GQGA 1OLQA 4RS5C 3LZZA 4CP0A 5IATA 4BLJA 1D7PM 1QMJA 1SDWA 1JYNA 3B5LB 2XQXA 3VZLA 2FDJA 2EA7A 2D3PA 4SBVA 1KD7A 3ZFGB 1IOAA 4CUCA 1N1YA 1PVC1 3ZIXA 5JOWA 1S0FA 4FOVA 5GKAC 4AFAA 5ABJC 1QJEA 2AEYA 3EB7A 3WNKA 2WLQA 3UJOA 4YNIA 1X50A 5CFDC 4FTSA 1DG6A 2XVKA 3S0MA 1CGPA 1PGW1 2ZX4A 4CCNA 3MIHA 1VALA 1GMMA 3HQUA 4IERA 4PI0A 5A32A 3MIGA 2DFCA 4QXKA 3FZ3A 4JCKA 1RUF1 3N7LA 4E9KA 1U5IA 4QPYA 4N7UA 2B46X 2Q1ZB 1PZ9A 1WD3A 1X7NA 3USSA 1KS4A 3OPWA 4OHZA 2WFPA 3OBAA 1CONA 4BISA 4TYSA 3VHPA 5C7GA 1QU0A 1QNYA 2WS91 1RUG3 2PHUA 3S57A 3VBUA 1C8M2 3WF2A 2G9GA 4E2GA 1AR72 4D69A 4DINB 1H8VA 1O4YA 1H6YA 2BU9A 5F9TA 3DEMA 2Y6HA 3ELNA 4W50A 2R072 2IUWA 3FE5A 1RUI2 2VQTA 3GALA 4ATFA 5GLVA 2GNBA 5JIAA 1E57A 4CXWA 1H30A 4YZ1A 5T5PA 2DVBA 2Z2SB 1RVF2 4CU8A 4UAPA 1PHMA 3GBWA 4YARA 4LEJA 1RIRA 1FMD1 1S0DA 2EIBA 2O8QA 4JGYA 4S2GA 5FIXA 2Q8EA 3O7OA 3LAGA 2ZGKA 2ZGMA 2ZPXA 1RUD3 1A8MA 3FLPA 4HPKA 2X05A 2ZMLA 3S6PA 2DU1A 1JZ2A 2IVJA 2R30A 2X29A 4CSWA 4I2OA 3KCXA 4RFRB 2LALA 5LCWL 4O61A 5CB7A 4BQ5A 4F83A 4FSJA 4D7TA 3H1WA 4BB3A 1G8WA 3WHTA 4ET7A 4Q26A 3KVAA 5FMCA 3WP4A 2B9VA 1ZZ8A 2JX9A 3MLKA 1HRV1 3KV6A 2RDSA 1T6GC 4QB1A 4LBQD 2VUAA 5FXVA 4UXAA 2QCSB 1Q8VA 5EWSA 4PF5A 3WG4A 3QBQA 4JQTA 1VBA2 2BW8A 2VBPA 4UOJA 1T2XA 3FN9A 1V00A 1JU4A 4WM7B 4Q0SA 1YFWA 1L7LA 1NZIA 4XACA 3RJ2X 2P3IA 3T4HB 2RR12 4DIQA 4LULA 1WLWA 1DP0A 3BU7A 1LGBA 4Q4W2 3RG0A 1H4GA 5C5TA 5C3SA 5LEJA 1MS9A 1ZNPA 1N3QA 1ZZ6A 5FUNA 4ZXEA 4Q4V1 1AR61 4IGQA 5FUPA 4ZY9A 4COYA 3JQXA 4CDUC 4GB31 4J25A 1KRIA 3U14A 4WZFA 3V64A 3KMHA 2ZGSA 5C3QA 4NIGA 1W6PA 2DV9A 2GNTA 5BXXA 4HMZA 1YJKA 2DFBA 2EVXA 4JGZB 3NV1A 2DVDA 5FJHA 2PELA 4GH4C 1S55A 3ZSKA 3AMQA 1E5RA 2R7EB 5FYSA 1DDLA 4LHSA 2QUOA 3UYJA 2JIJA 4E27A 1UMZA 3URFA 2BBVA 2ZX3A 1MQTB 1ASJ3 5FPVA 2LM3A 4YM2A 4BYYA 2WQZC 1VRH2 5JOYA 1JZ7A 2VMFA 2HWC3 3DUIA 4WVWA 1C5IA 1CAXA 1H2NA 1VJ2A 3VDDB 4SLIA 1PO13 2I2SA 3O1MA 5DDJ2 2VMIA 3H8OA 5I0UA 2JE9A 3LSDA 4XCAA 4NRQA 4O9EA 1ND2A 1YRZA 3NRUA 2CSGA 3WY6A 1MS5A 3ZYHA 3HOBA 3ES1A 4W6WA 2HJIA 1D0HA 4WVVA 3I3EA 1V6JA 5IUQA 3FFZA 1J1LA 1QDOA 3O0WA 5FY0A 1HV0A 2BV4A 1SACA 4A45A 1HN0A 2J42A 4DXTA 4HT1T 1OA2A 1UU4A 5E88A 3I49A 3ZIWA 4ZU7A 5LA2A 2CAVA 1YI7A 4TXWA 4AF9A 1LHUA 4ASMB 4COWA 3MO4A 4Y4RA 3UL2A 5A3NA 2OQ6A 2ARXA 4U2AA 4WZCA 4CEWA 4ZZ8A 1MS4A 2DF7A 5FYVA 2MEV1 1I3HA 5LY1A 3ENRA 1DBNA 1RJ7A 5FPXA 2FCTA 4P08A 2WZPP 4FPLA 4MV2A 2I74A 4KWUA 1POV3 1ST8A 4AW7A 4MLOA 1W8OA 1LENA 1IS4A 3OEBA 4Q0QA 1DFQA 4UFKA 3AZWA 4BQ4A 3KQRA 5A3UA 5BUVA 4K7JA 2EIGA 3VBOC 1ZBE1 3CJIA 2FZ2A 1QJY1 1IG0A 2Q5TA 2BGOA 1RHI3 4Y22B 2BP6A 2P1BA 1JUHA 3J26N 4ES9A 1B35B 2UYAA 4Y1YA 2X5IC 5ANQA 5T5LA 3TBDA 3VBHA 2IXLA 4C0BA 1QJX3 1DLCA 1ULDA 1N3OA 3U1XA 1HJGA 1YXWA 4KBBA 4DQAA 1DF0A 1WMXA 2VZSA 3LEGA 1AL22 1IPSA 4FXKB 5T52A 1S1AA 4M4PA 4XFHA 4AVCA 2QNKA 5FXWA 4JRAA 3MYXA 3C3VA 2R063 2UURA 1PO22 5F3EA 3SKJE 1EAH3 3ZR5A 5ANNA 4MX3A 3RGBA 1CVNA 1UY4A 1AR93 3AKRA 1JN2P 1W0PA 5L7OA 3C7HA 5A70A 5FMOL 5F7UA 2XBO1 5LA9A 1X8EA 5DZEA 1O8SA 1AYN1 4IEXA 1W39A 4X8PA 1PM4A 4NOTA 4XUPA 1H1IA 2D43A 2DUPA 1DYPA 1REDA 3ILRA 2ZKNA 3DGTA 4V1PA 3AP6A 2YBKA 2W0XA 3W20A 2BBAA 3RJRA 5K0UB 2JDUA 2Z42A 3JBG1 2P3KA 1RL3A 3I2JA 4AVAA 1Y4WA 4F7ZA 1F5JA 2VE1A 3AKPA 1IG3A 5FZGA 2B42B 5IAXA 1W9FA 2R1DA 4L92A 4XFFA 1SLBA 5GLZA 4B29A 3VBFB 4NR1A 4MXWB 4XCBA 5KHIA 3OGSA 1WLTA 5I8TA 5HI0A 4EQVA 3I3QA 5FWJA 3CHXA 4UBGA 4AGVA 2ZGPA 4P5YA 4F3JA 5A7PA 2WBKA 3TNQA 2WQ4A 2V4VA 3HPNA 2GMPA 1Q8PA 5EQUA 4JTNA 1ODMA 4B1MA 2HBTA 3EMRA 4P9IA 4CU6A 1EPZA 3KT1A 4DY3A 1O5UA 4CEYB 5A1FA 1G9DA 2IC1A 4QPIB 2VO5A 4FAHA 1BEV2 2JIGA 2WZ8A 3AX4A 1FPN1 1BQPA 2Y34A 3VKOA 4WV8A 1Y9QA 2YFUA 4FFFA 3I3MA 4Q4Y2 1FATA 5A7OA 3V0BB 4QQLA 3V0AB 4XBNA 4CDQB 2BFUL 4JGYC 1RTVA 5T50A 3RVHA 4PQQA 3LFMA 2YYOA 3IDCB 4GMP3 4E8CA 2J1TA 3NJYA 2VUDA 4CPBA 2XJQA 1QH6A 4CRQA 2B9UA 2CAUA 2CV6A 3P1IA 4NIIA 3O1OA 3ILNA 2R32A 2P6HA 4LBKA 4UI9L 4H14A 5F39A 3PVBB 1FV2A 5FREA 3WX5A 5IJRA 1WZXA 3IB3A 4ORFA 3EO6A 1H9PA 2WYFA 3GZTB 5JI7A 5LY2A 3UGGA 5I0SA 3O1UA 2B8MA 1N1TA 4P02B 2Y33A 4CDWB 2QQJA 2FHRA 3E97A 1ZZ9A 2RDQA 4KQ7A 4XFAA 2P6CA 2R073 4HN1A 2Y6GA 5LASA 1WD4A 1V9U2 4DUWA 5I0RA 2WWUA 3H0OA 4WM8B 4XPVA 3RYPA 2JG9B 1S2EA 1CESA 4HETA 4QMAA 2YV8A 3JXSA 4K1YA 4QKBA 1W6MB 3QD6A 4OI2A 4QQHA 1GYKA 4FPKA 4MHRA 2R0HA 2WT1A 4EN7B 2JEMA 5FZ0A 5KHGA 3C7OA 4OUEA 1AXYA 4BQYA 2GP3A 2D98A 5FZ1A 3EJKA 3CF6E 3ACGA 1ND3A 2H0BA 2JG8A 3H7YA 3KHBA 2FDHA 2QQVA 3VZKA 1XNBA 1RITA 3DYPA 1UW8A 3GHNA 1GOGA 4YW1A 3U75A 2WT0A 2Y6LA 3ASIA 4MADA 1W9SA 4AI9A 4P14A 4ISQA 3GZUC 5JR7B 1GKBA 4UW3A 3BB6A 2HBUA 2XLFA 4UF0A 5DQ0A 2W68A 2DCTA 5CFCA 4YVWB 2HWB2 4YFZA 3MLLA 3I8TA 1SBDA 1XYOA 2GDFA 4B7EA 3U10A 3VDBA 3POIA 5IAVA 1OKQA 2P5BA 3Q9OA 2JD9A 5B2GB 3DF0A 1ULGA 2LW8A 4CCMA 4YZ2A 2ZZQA 2XHNA 1ULPA 3VBRB 1UKRA 3BPSA 2OPKA 1JYCA 3ZN6A 4XXPA 5LRRA 2VCAA 4YVSB 3LD8A 4OMCA 1BYHA 4TZDA 4OQ8A 2ZEXA 2BVBA 1PGL2 2GZWA 1NUKA 2VUCA 1OC1A 1TE1B 4I09A 1QOSA 2WA4A 3ZFFA 4AAXA 3E6BA 1ND2C 1RUG1 1SQ4A 3N9OA 2E7TA 3SEEA 4FCAA 1ENRA 1N3PA 1OOPB 3HNMA 4FPCA 4K1ZA 2DBNA 2XUMA 1W99A 2BZDA 3UJQA 2Z4FA 2KM2A 2WFF2 4Y4YA 3MHZA 4FXGB 3BIEA 4JTOA 1UPSA 4XJWA 2E7QA 3WG2A 1O4ZA 1VE0A 3OGGA 3OUIA 5H9SA 4AGRA 5JIUA 4MGSA 5FYHA 3HD8B 1W6NB 1GANA 1NCRA 3ACFA 2W46A 2IZWA 2QKDA 2D6LX 3GYDA 3ZMOA 2BWCA 1VRH3 3FFQA 1RUD1 4OI1A 4AHZA 1Q5OA 4IV3A 5FYYA 4JKKA 3SCFA 2WRAA 1EY2A 3KGZA 3U4SA 2HKXA 4Y20A 4OI0A 4JQRA 3BYWA 2D40A 2EICA 3ZYFA 3IWZA 4NN0A 4I0WB 1NYWA 3CJIC 3WEZA 1AYM2 3IT8A 4IDZA 5J48A 3HBZA 3HIFA 5FXZA 2VMGA 1CPNA 5ABJA 3IPVB 3WCRA 1JHNA 1UY0A 1IZ3A 2D93A 5C9AB 1GP6A 3MIBA 3RSJA 1ULOA 1VBC2 3MGUA 3NKTA 1UO9A 1MVQA 4LBQB 2C0ZA 2A6ZA 3OBZA 1H8TA 1I5PA 2XR4A 4OZXA 4ARXA 4XYXA 1RGSA 4S2FA 3ZFEB 5FP8A 1U0AA 3H9AA 2K0GA 3USUA 1QWRA 2VECA 4IUGA 2A6YA 5FPAA 1JS9A 3B00A 1QXJA 4I01A 2IXIA 2EAAA 2VVEA 5L7OC 2PLV3 2RS53 4RGAA 4AI2A 4W4ZA 1NG0A 5JPMB 3SH5A 5A1LA 3C7EA 1OKOA 4KWKA 5GZDA 3RZJA 2CTVA 1WKYA 2ZEWA 2B39A 1JODA 1NE6A 4QGLA 2P3YA 2W1SA 3P3NA 2Y26A 1EV13 2CL2A 3OPTA 5C8CC 1YQ2A 4QKDA 2XJVA 2Q1FA 5LB6A 1FOD2 2XXZA 3N36A 2L9LA 1JU3A 4BPZA 4H7LA 4XQ4A 5A33B 1YQ5A 1K5MA 3R6SA 3WG3A 4YM3A 3ZKUA 4NVPA 3AVRA 4COUA 5KR7A 3POSA 5A7WB 2CGOA 1JI6A 1ASJ1 4MO3M 1JZ8A 2H6BA 2Q4SA 2WN2A 2DUQA 2P4EA 3H3LA 3KT7A 4YRDA 2HWC1 5JWPA 1UQXA 1PO23 4EE2A 3WNPA 1UD1A 2XJRA 4UT5A 4K40A 3F2ZA 3KV4A 1PO11 4K6BA 1UXXX 4XZUG 4YW7A 4CDXB 4CP9A 1MEC2 1Z7S3 1ZBA2 3W5MA 1V6OA 5GLUA 2BGPA 1MZEA 4BQ1A 5L19A 3G7DA 5DAQA 3W9AA 4DXSA 4A6OA 2B5HA 2J1UA 1QKQA 1R082 1SBFA 1OLME 2OKXA 3HNYM 1JHJA 4XFBA 1N47A 5A7SA 1E5IA 1HKDA 2VNRA 2ZBJA 3LGRA 4MH0E 1HW5A 4FTEA 3W59A 1C3HA 2VZTA 4LO4B 4R9AA 3CDZB 3SH4A 3GF6A 4AVBA 1AJKA 1GUIA 5A3LA 4OHXA 5FKBA 5FZIA 3IDBB 3DPRA 4NUBA 1JYIA 2XUEA 5IVCA 4I0BA 1OHFA 2XKOA 1SBEA 5FZOB 5IYYA 1PNFA 4ITCA 1RUH2 4QX3A 3S7EA 1F15A 3IDEA 4M4RA 2PQSA
chains in the Genus database with same CATH topology
2X10A 3WF2A 3VD3A 2VMDA 1IQDC 2W47A 2VR4A 1H6YA 4QPWA 3CQOA 3W5NA 4LQRA 2Y6HA 3IAQA 4W50A 2VQTA 2WAOA 4XUOA 2Y8KA 1K3IA 3ZM8A 1TVGA 4CU8A 4UAPA 5LA1A 4YPJA 2EIBA 5IFPA 3T2OA 2ZEZA 3CMGA 2X05A 4DUVA 3FHAA 3UETA 1JZ2A 2RJ2A 1KEXA 2W94A 4DUXA 3A7QA 4CU7A 5LCWL 2W1QA 3NJXA 1SG3A 1CIYA 2HLEA 1F4HA 3BGAA 4ET7A 3GM8A 2WO3A 4KMQA 2B9VA 2C26A 2VZQA 4QB2A 4L0PA 3A21A 4QB1A 4DEQA 3I2FA 4QX2A 3WF4A 4UOJA 1T2XA 3FN9A 1JU4A 4HG6B 1OD3A 1GOFA 2LS6A 1DP0A 1UX7A 3VDCA 4ZXEA 4ZY9A 2VZ3A 1XPWA 4D0QA 2B4KA 4A41A 3LEIA 1PX3A 3ETPA 2WAAA 2J22A 1SHWB 1US3A 2DCKA 2R7EB 5JUVA 4LHSA 1KGYA 3MV11 2V5DA 5G04L 4BJ0A 1J83A 1O59A 3PUIA 5IFTA 1JZ7A 2VMFA 3OB8A 2WQ8A 2XONA 1W8NA 3K4DA 1EUTA 3IIIA 3ECQA 3I3DA 1OT5A 3NRUA 2QQKA 2J1SA 3HOBA 1JZ6A 3I2GA 3I3EA 2X09A 2WN3A 4A45A 2E31A 2JE8A 3MV01 4DXTA 2VCCA 4QDSA 2VMEA 5LA2A 4BK5A 4TXWA 1UMHA 3MO4A 3WF1A 4OYUA 4QAWA 2ZEYA 4ZZ8A 5A1AA 2YC4A 3I3BA 2VL4A 3C7FA 3D3AA 5C71A 2QQLA 2YC2A 4P08A 3AC0A 3LE0A 3OEAA 4BDVB 4BK4A 4KWUA 1H6XA 3LPFA 4JHZA 1W8OA 4CUAA 1JYWA 3OEBA 2DDUA 1PMHX 3ABZA 2KD7A 3HN3A 4FI9A 2WUHA 4XUTA 2BGOA 3DYMA 4PF1A 4DEVA 3VDAA 1DLCA 2ORXA 2W95A 2WZEA 3MUY1 2VZSA 3LEGA 3MBWA 4M4PA 5C70A 3HEIA 3K77A 4A42A 3VD4A 3SKJE 4GWJA 2J7MA 3IDAA 1UY4A 2Y6JA 5EJZB 3THCA 1GOHA 3CZJA 5HXMA 3C7HA 3I97A 4BXSV 5F7UA 4LPLA 4ZZ5A 1O8SA 2E32A 4XUPA 3P6BA 1WCQA 2VOTA 1W9WA 5B4XA 1JZ4A 3T0DA 3K4ZA 4TTGA 2BBAA 4GZ9A 1GNYA 1GU3A 1XNTA 1K12A 3I2JA 2W87A 3LPGA 1HN1A 4MGQA 3CZUA 4QX1A 2J1VA 3CIHA 3OGSA 5FUIA 5IHRA 3ACHA 5DMYA 2VCBA 4P5YA 4XVHA 2WBKA 2EIDA 2V4VA 3HPNA 5J1XA 4QDRA 3DYOA 5LA0A 2JKXA 1UXZA 2Y6KA 4CU6A 1L7QA 3BN6A 1BHGA 3J7HA 2VO5A 4JKMA 2WZ8A 2RVAA 2W9XA 2E26A 5B4NA 2YFUA 4RN5A 1UY3A 2JDAA 2W1UA 4PQQA 4E8CA 3WF3A 2J1TA 3FL7A 3ACIA 1CZTA 3T0AA 3E1F1 1UY2A 1J84A 1XNAA 2VJXA 3P1IA 2VC9A 5CZKA 3T08A 4UI9L 2YG0A 3UESA 2VMCA 5JXHA 5IJRA 2QQNA 3HJRA 3IB3A 4P00B 1RYYA 2J1EA 4P02B 3DECA 2QQJA 5DPNA 3T2PA 3SKVA 2Y6GA 2VM9A 4QX0A 4DUWA 1CX1A 5JXGA 3GGLA 1CZVA 3JXSA 4DXRA 1JYVA 1SDDB 4XUNA 1F4AA 3WNNA 3C7OA 3EYPA 4OUEA 2C4XA 3ACGA 1OF4A 5JXJA 2E33A 3OG2A 3OGRA 3WNLA 3WF0A 3DYPA 3I2KA 3VD5A 1GOGA 2W92A 1NKGA 2Y6LA 4MADA 1W9SA 2QQOA 2W5FA 4A3ZA 4OZOA 2Y64A 4QDQA 3A22A 1EUUA 5DQ0A 2ID4A 1P8JA 1CZSA 4RYDA 3VDBA 2JD9A 2DCJA 2J1RA 3T0BA 2LW8A 3A23A 2WABA 2XHNA 1ULPA 3PUHA 5CYYA 3MUZ1 2VZRA 5HPOA 2W1WA 3CKHA 2VCAA 4AG4A 3GXUA 5I0DA 4OMCA 2ZEXA 1PX4A 2VZPA 4Z2AA 1NUKA 2VZ1A 4AAXA 4XUQA 1GQPA 3SEEA 4OMDA 2W3JA 3C7GA 3HNMA 3NJVA 1W99A 4XURA 2BZDA 2Z4FA 1JZ3A 3SEPA 2VQUA 1O8PA 5DN2A 1UYYA 4MGSA 3WNOA 3ACFA 2W46A 4JKLA 3THDA 2XOMA 2CDPA 4KI5M 1PMJX 3UNPA 1JZ5A 3LQCA 1JYXA 5EIYB 3I2IA 4JKKA 2VZVA 3WQBA 1W9TA 2VZOA 2WO2A 2EICA 5JXIA 1OH4A 5JR2A 2BERA 3WEZA 2CDOA 3T09A 3VD9A 1UY0A 1DYOA 3OGVA 1ULOA 2YFZA 1UY1A 1L7RA 2WO1A 2ZXQA 3T2QA 3U37A 1I5PA 4ARXA 4GWIA 4CU9A 1LNSA 1MPXA 1R64A 2EIEA 5EJ1B 2V72A 4IUGA 2WDBA 4JX0A 3VD7A 4D8MA 3WNMA 1K42A 5JMOA 1OF3A 4W4ZA 1US2A 3NQHA 3C7EA 3K46A 4E8DA 1WKYA 2ZEWA 2W1SA 4CUBA 2HYXA 4MOAA 1YQ2A 4CVUA 2VZUA 2L9LA 1JU3A 2WYSA 3K75B 4QB6A 3HNBM 4PT6A 2QQMA 2ORZA 2YB7A 1XC6A 3K4AA 4ARYA 1JI6A 4MO3M 4A44A 1JZ8A 2WN2A 1UYXA 2C9KA 1W0NA 5G05L 3I2HA 3WNPA 2QBXA 1NAEA 3F2ZA 1D7PM 1UXXX 4XZUG 1JYNA 2XQXA 3W5MA 3GDBA 4A4AA 2BGPA 4CUCA 1UMIA 3LEKA 4DXSA 4A6OA 2J1UA 2OKXA 3EB7A 3WNKA 3HNYM 1UWWA 1TG7A 1JHJA 3FHQA 4W8JA 1GMMA 1UYZA 2VZTA 1K45A 3CDZB 3WSOA 1GUIA 1NX9A 2QQIA 3NNGA 2W91A 1UZ0A 5IYYA 3OBAA 2VTFA 4LKSA 2RV9A 4QX3A 3IAPA 3C8XA 4M4RA 5C7GA 2J1AA 2PQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X10 A;  3WF2 A;  3VD3 A;  2VMD A;  1IQD C;  2W47 A;  2VR4 A;  1H6Y A;  4QPW A;  3CQO A;  3W5N A;  4LQR A;  2Y6H A;  3IAQ A;  4W50 A;  2VQT A;  2WAO A;  4XUO A;  2Y8K A;  1K3I A;  3ZM8 A;  1TVG A;  4CU8 A;  4UAP A;  5LA1 A;  4YPJ A;  2EIB A;  5IFP A;  3T2O A;  2ZEZ A;  3CMG A;  2X05 A;  4DUV A;  3FHA A;  3UET A;  1JZ2 A;  2RJ2 A;  1KEX A;  2W94 A;  4DUX A;  3A7Q A;  4CU7 A;  5LCW L;  2W1Q A;  3NJX A;  1SG3 A;  1CIY A;  2HLE A;  1F4H A;  3BGA A;  4ET7 A;  3GM8 A;  2WO3 A;  4KMQ A;  2B9V A;  2C26 A;  2VZQ A;  4QB2 A;  4L0P A;  3A21 A;  4QB1 A;  4DEQ A;  3I2F A;  4QX2 A;  3WF4 A;  4UOJ A;  1T2X A;  3FN9 A;  1JU4 A;  4HG6 B;  1OD3 A;  1GOF A;  2LS6 A;  1DP0 A;  1UX7 A;  3VDC A;  4ZXE A;  4ZY9 A;  2VZ3 A;  1XPW A;  4D0Q A;  2B4K A;  4A41 A;  3LEI A;  1PX3 A;  3ETP A;  2WAA A;  2J22 A;  1SHW B;  1US3 A;  2DCK A;  2R7E B;  5JUV A;  4LHS A;  1KGY A;  3MV1 1;  2V5D A;  5G04 L;  4BJ0 A;  1J83 A;  1O59 A;  3PUI A;  5IFT A;  1JZ7 A;  2VMF A;  3OB8 A;  2WQ8 A;  2XON A;  1W8N A;  3K4D A;  1EUT A;  3III A;  3ECQ A;  3I3D A;  1OT5 A;  3NRU A;  2QQK A;  2J1S A;  3HOB A;  1JZ6 A;  3I2G A;  3I3E A;  2X09 A;  2WN3 A;  4A45 A;  2E31 A;  2JE8 A;  3MV0 1;  4DXT A;  2VCC A;  4QDS A;  2VME A;  5LA2 A;  4BK5 A;  4TXW A;  1UMH A;  3MO4 A;  3WF1 A;  4OYU A;  4QAW A;  2ZEY A;  4ZZ8 A;  5A1A A;  2YC4 A;  3I3B A;  2VL4 A;  3C7F A;  3D3A A;  5C71 A;  2QQL A;  2YC2 A;  4P08 A;  3AC0 A;  3LE0 A;  3OEA A;  4BDV B;  4BK4 A;  4KWU A;  1H6X A;  3LPF A;  4JHZ A;  1W8O A;  4CUA A;  1JYW A;  3OEB A;  2DDU A;  1PMH X;  3ABZ A;  2KD7 A;  3HN3 A;  4FI9 A;  2WUH A;  4XUT A;  2BGO A;  3DYM A;  4PF1 A;  4DEV A;  3VDA A;  1DLC A;  2ORX A;  2W95 A;  2WZE A;  3MUY 1;  2VZS A;  3LEG A;  3MBW A;  4M4P A;  5C70 A;  3HEI A;  3K77 A;  4A42 A;  3VD4 A;  3SKJ E;  4GWJ A;  2J7M A;  3IDA A;  1UY4 A;  2Y6J A;  5EJZ B;  3THC A;  1GOH A;  3CZJ A;  5HXM A;  3C7H A;  3I97 A;  4BXS V;  5F7U A;  4LPL A;  4ZZ5 A;  1O8S A;  2E32 A;  4XUP A;  3P6B A;  1WCQ A;  2VOT A;  1W9W A;  5B4X A;  1JZ4 A;  3T0D A;  3K4Z A;  4TTG A;  2BBA A;  4GZ9 A;  1GNY A;  1GU3 A;  1XNT A;  1K12 A;  3I2J A;  2W87 A;  3LPG A;  1HN1 A;  4MGQ A;  3CZU A;  4QX1 A;  2J1V A;  3CIH A;  3OGS A;  5FUI A;  5IHR A;  3ACH A;  5DMY A;  2VCB A;  4P5Y A;  4XVH A;  2WBK A;  2EID A;  2V4V A;  3HPN A;  5J1X A;  4QDR A;  3DYO A;  5LA0 A;  2JKX A;  1UXZ A;  2Y6K A;  4CU6 A;  1L7Q A;  3BN6 A;  1BHG A;  3J7H A;  2VO5 A;  4JKM A;  2WZ8 A;  2RVA A;  2W9X A;  2E26 A;  5B4N A;  2YFU A;  4RN5 A;  1UY3 A;  2JDA A;  2W1U A;  4PQQ A;  4E8C A;  3WF3 A;  2J1T A;  3FL7 A;  3ACI A;  1CZT A;  3T0A A;  3E1F 1;  1UY2 A;  1J84 A;  1XNA A;  2VJX A;  3P1I A;  2VC9 A;  5CZK A;  3T08 A;  4UI9 L;  2YG0 A;  3UES A;  2VMC A;  5JXH A;  5IJR A;  2QQN A;  3HJR A;  3IB3 A;  4P00 B;  1RYY A;  2J1E A;  4P02 B;  3DEC A;  2QQJ A;  5DPN A;  3T2P A;  3SKV A;  2Y6G A;  2VM9 A;  4QX0 A;  4DUW A;  1CX1 A;  5JXG A;  3GGL A;  1CZV A;  3JXS A;  4DXR A;  1JYV A;  1SDD B;  4XUN A;  1F4A A;  3WNN A;  3C7O A;  3EYP A;  4OUE A;  2C4X A;  3ACG A;  1OF4 A;  5JXJ A;  2E33 A;  3OG2 A;  3OGR A;  3WNL A;  3WF0 A;  3DYP A;  3I2K A;  3VD5 A;  1GOG A;  2W92 A;  1NKG A;  2Y6L A;  4MAD A;  1W9S A;  2QQO A;  2W5F A;  4A3Z A;  4OZO A;  2Y64 A;  4QDQ A;  3A22 A;  1EUU A;  5DQ0 A;  2ID4 A;  1P8J A;  1CZS A;  4RYD A;  3VDB A;  2JD9 A;  2DCJ A;  2J1R A;  3T0B A;  2LW8 A;  3A23 A;  2WAB A;  2XHN A;  1ULP A;  3PUH A;  5CYY A;  3MUZ 1;  2VZR A;  5HPO A;  2W1W A;  3CKH A;  2VCA A;  4AG4 A;  3GXU A;  5I0D A;  4OMC A;  2ZEX A;  1PX4 A;  2VZP A;  4Z2A A;  1NUK A;  2VZ1 A;  4AAX A;  4XUQ A;  1GQP A;  3SEE A;  4OMD A;  2W3J A;  3C7G A;  3HNM A;  3NJV A;  1W99 A;  4XUR A;  2BZD A;  2Z4F A;  1JZ3 A;  3SEP A;  2VQU A;  1O8P A;  5DN2 A;  1UYY A;  4MGS A;  3WNO A;  3ACF A;  2W46 A;  4JKL A;  3THD A;  2XOM A;  2CDP A;  4KI5 M;  1PMJ X;  3UNP A;  1JZ5 A;  3LQC A;  1JYX A;  5EIY B;  3I2I A;  4JKK A;  2VZV A;  3WQB A;  1W9T A;  2VZO A;  2WO2 A;  2EIC A;  5JXI A;  1OH4 A;  5JR2 A;  2BER A;  3WEZ A;  2CDO A;  3T09 A;  3VD9 A;  1UY0 A;  1DYO A;  3OGV A;  1ULO A;  2YFZ A;  1UY1 A;  1L7R A;  2WO1 A;  2ZXQ A;  3T2Q A;  3U37 A;  1I5P A;  4ARX A;  4GWI A;  4CU9 A;  1LNS A;  1MPX A;  1R64 A;  2EIE A;  5EJ1 B;  2V72 A;  4IUG A;  2WDB A;  4JX0 A;  3VD7 A;  4D8M A;  3WNM A;  1K42 A;  5JMO A;  1OF3 A;  4W4Z A;  1US2 A;  3NQH A;  3C7E A;  3K46 A;  4E8D A;  1WKY A;  2ZEW A;  2W1S A;  4CUB A;  2HYX A;  4MOA A;  1YQ2 A;  4CVU A;  2VZU A;  2L9L A;  1JU3 A;  2WYS A;  3K75 B;  4QB6 A;  3HNB M;  4PT6 A;  2QQM A;  2ORZ A;  2YB7 A;  1XC6 A;  3K4A A;  4ARY A;  1JI6 A;  4MO3 M;  4A44 A;  1JZ8 A;  2WN2 A;  1UYX A;  2C9K A;  1W0N A;  5G05 L;  3I2H A;  3WNP A;  2QBX A;  1NAE A;  3F2Z A;  1D7P M;  1UXX X;  4XZU G;  1JYN A;  2XQX A;  3W5M A;  3GDB A;  4A4A A;  2BGP A;  4CUC A;  1UMI A;  3LEK A;  4DXS A;  4A6O A;  2J1U A;  2OKX A;  3EB7 A;  3WNK A;  3HNY M;  1UWW A;  1TG7 A;  1JHJ A;  3FHQ A;  4W8J A;  1GMM A;  1UYZ A;  2VZT A;  1K45 A;  3CDZ B;  3WSO A;  1GUI A;  1NX9 A;  2QQI A;  3NNG A;  2W91 A;  1UZ0 A;  5IYY A;  3OBA A;  2VTF A;  4LKS A;  2RV9 A;  4QX3 A;  3IAP A;  3C8X A;  4M4R A;  5C7G A;  2J1A A;  2PQS A; 
#chains in the Genus database with same CATH topology
 1F2N A;  1C1L A;  2GMM A;  2IWG B;  1BK0 A;  4N7I A;  4XFG A;  4DRR A;  1Q56 A;  1IKQ A;  1HXS 1;  1POV 1;  2VR4 A;  3POF A;  4XJZ A;  1SPP B;  3SCG A;  3MLJ A;  3L9J T;  3BKZ A;  4LQR A;  1HB1 A;  4XF9 A;  3NNL A;  5JPN B;  4FPO B;  1EP0 A;  1H1A A;  1RUE 2;  1PIV 3;  3AP7 A;  5FY1 A;  5FYM A;  4HVO A;  3FBY A;  3ZX7 A;  5FO7 B;  2WAO A;  4XUO A;  4CP2 A;  1RHI 1;  4IEZ A;  4EN6 B;  3ATG A;  3Q8E A;  3VZM A;  5AFE A;  1TVG A;  3JB8 A;  1XYP A;  2VBB A;  1OD5 A;  2PHX A;  3FLT A;  2IVI B;  1QJX 1;  5IFP A;  2ZEZ A;  1AXZ A;  3CMG A;  4MGI E;  4DUV A;  1HIX A;  1WLD A;  3FHA A;  4LOT A;  4Q4Y 3;  5FZK A;  2ZHK A;  2ZJC A;  3UET A;  1SFN A;  3U78 A;  3VBS A;  1YHF A;  3ZVX A;  1QJU 2;  3ZOI A;  5L9R A;  1KEX A;  2R06 1;  3A7Q A;  4RS5 B;  4CU7 A;  2BYV E;  4OUS A;  3BPZ A;  1SG3 A;  1FT9 A;  4ZU4 A;  3OJB A;  4CTE A;  4P9X A;  3BGA A;  3LDK A;  1AR9 1;  4RD7 A;  4OFG A;  3SH3 A;  3RDI A;  1GV9 A;  2WO3 A;  1FI2 A;  4KMQ A;  3MZH A;  4IE5 A;  2VH9 A;  4LO8 A;  2VZQ A;  5DAW A;  3KSC A;  4KWL A;  2CNA A;  2I07 B;  3O1P A;  4UW4 A;  1BMV 2;  1X8M A;  4AI3 A;  5CFD B;  5GZC A;  1O3Q A;  5K7P A;  4XXA A;  2DWR A;  1HRI 2;  1F35 A;  2A3W A;  3I2F A;  1NA1 A;  1ZRD A;  1C28 A;  2RDR A;  4IW3 A;  1TZO A;  1BBT 3;  1UIJ A;  2HWE 2;  3POW A;  3OYW B;  4HG6 B;  2VTX J;  4P9L A;  4AFM A;  5CFC C;  1OD3 A;  2QQU A;  4AAP A;  2TBV A;  1XJA A;  4KU7 A;  3HT2 A;  3WQ1 A;  1ZZB A;  1GOF A;  3LOB A;  2MHF A;  2Q8C A;  2NP0 A;  4LA2 A;  3O14 A;  4Q1R A;  3VDC A;  2BEO A;  4LIV A;  5DAP A;  4DO0 A;  3WDX A;  1R1Z A;  2DCY A;  1G9A A;  2NN8 A;  2OYZ A;  2VZ3 A;  1S2B A;  2WNU A;  1LUL A;  3DN7 A;  3TN9 2;  4YZ4 A;  2XB6 C;  1VRB A;  3FWE A;  3JD7 2;  1D4V B;  1VBB 2;  4HVQ A;  4N8M A;  2ZS6 B;  2AZ5 A;  1LR5 A;  3BVC A;  3M3C A;  4M3C E;  4XBL A;  3ZFF C;  5ISL A;  3ETP A;  3O5S A;  2J22 A;  5CNA A;  3B9I A;  2JE7 A;  5A3P A;  2X5I A;  5JVV A;  4Z8B A;  1V6I A;  3WW2 A;  4CCJ A;  1W6O A;  4AED B;  1US3 A;  2DCK A;  2VOK A;  2A75 A;  4XAB A;  4CCC A;  1QOO A;  4NIA A;  4PBO A;  4BJ0 A;  5C6C A;  2FMY A;  1NT0 A;  4XDQ A;  1LHW A;  4J1X A;  5I0T A;  1W6Q B;  2VNO A;  3NST A;  4JC1 A;  2RS1 2;  1GNZ A;  2WIN B;  4AI0 A;  2WQ8 A;  4QX7 A;  1PGS A;  1W8N A;  3K4D A;  4DPN A;  5J09 A;  1W0O A;  4JDN A;  1I1E A;  3I4I A;  4PLM A;  4P9G A;  4GMP 1;  1VMH A;  1R09 3;  2HH9 A;  2JDM A;  4EZH A;  2IFW A;  1ZYB A;  4QD2 A;  4YGD A;  4IV3 C;  2W2I A;  5FPL A;  4NJ4 A;  2R04 3;  2QQK A;  2YZ4 A;  2WZR 3;  3I2G A;  3ETQ A;  1ALY A;  1S0C A;  4NWW A;  5FZ3 A;  2A6X A;  5F2W A;  4IV1 A;  3UKN A;  4E2S A;  4JGZ A;  2WSV A;  4GUL A;  4TN7 A;  5EHD A;  3Q8F A;  1HJF A;  1W04 A;  1OVP A;  1YIF A;  2VME A;  4CZS A;  4BK5 A;  5DG1 A;  4BME A;  4S2D A;  1HB3 A;  2NMN A;  1W8U A;  1UNB A;  3ZPO A;  1TMF 2;  3AMN A;  1QQP 3;  2ZEY A;  3EXU A;  2QQW A;  2R07 1;  1DQ0 A;  1AR8 3;  2BNN A;  1PM7 A;  3OD0 A;  5APA A;  2YC4 A;  2C6S A;  3LSE A;  2WFF 3;  1H8T C;  1UOG A;  3MIC A;  3VDD A;  4XBQ A;  1BK1 A;  3C7F A;  3D3A A;  4XE9 A;  5FCC A;  2QQL A;  4JZR A;  5C71 A;  2LUW A;  4PDW A;  3H8U A;  3LE0 A;  4GIQ A;  3MF9 A;  5A6Z A;  1J3R A;  3M3O A;  4CDU B;  5FY4 A;  4CUA A;  1DHK B;  1OSG A;  4BMB A;  3PL0 A;  1PMH X;  1MAC A;  3ABZ A;  4D6R A;  4X6Q B;  5LW9 A;  3AYD A;  3HN3 A;  1R1A 2;  3RYR A;  4FI9 A;  3J8F 3;  1D4M 2;  4BLI A;  4EYU A;  2D3S A;  1QNW A;  1RUC 2;  2HWD 3;  1MS0 A;  3VKN A;  4NRP A;  1W2N A;  1XQN A;  4GH4 B;  4I30 A;  3VDA A;  4FPH A;  4LK6 A;  2PAE A;  4N53 C;  5H9R A;  2FMD A;  2WZE A;  1REE A;  5FV3 A;  4WVZ A;  3MBW A;  4XC9 A;  1W2A X;  4KH9 A;  4Y26 A;  4Z92 B;  3N9N A;  1JUI A;  3S7I A;  1KFX L;  3HEI A;  4Q4X 1;  4UFI A;  1QEX A;  4AEM A;  4A42 A;  5A3T A;  5C70 A;  4EV0 A;  3VD4 A;  1K5M C;  1PVC 2;  1QGL A;  5F3I A;  4GWJ A;  4L11 A;  4Y1Z A;  3WW4 A;  3CZJ A;  3BTY A;  4C91 A;  1PGW 2;  4LTA A;  3S30 A;  1FX5 A;  3I97 A;  1WUV A;  3POB A;  1VBE 2;  2P3J A;  1RUF 2;  4IE6 A;  1XE0 A;  2RM2 3;  3NVC A;  1DZR A;  1RUJ 3;  1B35 A;  2RS3 1;  3LEM A;  1PVX A;  3P6B A;  1HB4 A;  1WCQ A;  2DTY A;  2VOT A;  4LBL A;  1V6L A;  2ZGQ A;  2AUY A;  3K4Z A;  3POJ A;  4M3C F;  4PCR A;  4X6R B;  3WP6 A;  5LK5 A;  5BNP B;  3LF7 A;  3S5A A;  1BLZ A;  3AB0 A;  2WS9 2;  3E5Q A;  5FZB A;  3JUU A;  5FY9 A;  2OUH A;  1XNT A;  5JZG A;  1K12 A;  4M00 A;  5KXD A;  2RMU 3;  4CPB D;  3OY8 B;  1W8W A;  2XVL A;  2CGN A;  5EYY A;  3CZU A;  5FYC A;  4QQP A;  1WA6 X;  2WKK A;  1COV 3;  2J1V A;  3ILF A;  3DPR C;  2OA2 A;  2ADD A;  2GN3 A;  3IBM A;  1WBF A;  5LRS A;  1RMU 3;  2ZGT A;  3ZYP A;  5FUI A;  1VBD 3;  3Q8C A;  2RE9 A;  4YLZ A;  3X29 B;  1ZA7 A;  5A3W A;  4A2U A;  5ACA 3;  5IHR A;  2VCB A;  1ZA4 A;  3VBO B;  1H2K A;  1FMD 2;  1MS8 A;  1J3Q A;  2JD4 A;  4XF0 A;  3DYO A;  4K9S A;  1V6M A;  3OOX A;  1AUY A;  1QF3 A;  4XW3 A;  2JKX A;  4ZU5 A;  1UXZ A;  1Y9M A;  3MPB A;  3D0J A;  1LOA A;  2VXJ A;  5FZ9 A;  2IXK A;  4RGK A;  1SEF A;  2WO7 A;  3BTA A;  3AKT A;  1WME A;  2ZAA A;  4DXZ A;  2CY6 A;  5FYZ A;  4QPG B;  4HBN A;  5K0U A;  2YBP A;  2JWP A;  1DZT A;  4Q1P A;  3VB9 A;  2VVF A;  4C1W A;  2QE3 A;  5CBL A;  2GP5 A;  2E26 A;  3GJB A;  5DUX A;  2JEN A;  5FPZ A;  3PHM A;  1UY3 A;  4BXF A;  2NYY A;  1YFU A;  4Y3O A;  5IK4 A;  1LOD A;  3MW2 A;  4Y24 A;  1CAU B;  3D4K A;  2ARB A;  3R0R A;  3T0A A;  1HRV 2;  1IGO A;  1KDM A;  1KJL A;  2JB8 A;  3N35 A;  1UY2 A;  2VJX A;  2ERF A;  4UYB A;  2VC9 A;  5L9B A;  4LKD A;  5CZK A;  3VBS C;  5K8S A;  2PXJ A;  3PJQ A;  1S0I A;  3UES A;  1NE4 A;  4YFW A;  1SLA A;  5FZA A;  2VMC A;  4DRV A;  5C33 A;  4J6G A;  1GP4 A;  5L73 A;  5JXH A;  2NPI A;  3E6D A;  4JV4 A;  4OLL A;  4CEY A;  4BA6 A;  1C57 A;  1OUX A;  1U12 A;  3LB9 A;  5D8A A;  2A7A A;  4YW3 A;  1BCX A;  2VPV A;  1U5X A;  1GWL A;  2J1E A;  2PLV 1;  2RS5 1;  3LDR A;  2VD7 A;  3DKW A;  3ZXF A;  2QVS B;  1ZRF A;  4BQ3 A;  5CKQ A;  4Q4V 2;  1AR6 2;  2PHT A;  5A32 B;  1RUO A;  4GB3 2;  5KBF A;  1CX1 A;  1NA1 C;  1EV1 1;  3I2O A;  3AP5 A;  3GGL A;  2RG4 A;  3B01 A;  1CZV A;  2WSU A;  1KQR A;  1VR3 A;  1JYV A;  1IKP A;  4LMF A;  2F4P A;  3GHM A;  3N7J A;  1W3X A;  2DUO A;  3B02 A;  3WLU A;  2XL7 A;  3SQO A;  3ZXK A;  2RDN A;  1Y43 B;  2PHW A;  4JRL A;  3MID A;  4DOU A;  5IVV A;  1YO8 A;  4GAL A;  2C24 A;  2FBE A;  3UKV A;  3VBU B;  3T3Y A;  3ZSJ A;  1LED A;  1G7Y A;  2E33 A;  2WNU C;  1A3K A;  3I59 A;  4YW5 A;  3WNL A;  2XQR A;  2ZAH A;  4J1W A;  4KNC A;  3ZPY A;  1XSQ A;  3LWC A;  2D3R A;  1JH5 A;  5E89 A;  3QLQ A;  4IEV A;  5HXV A;  2Q8O A;  1AX0 A;  2GND A;  3CO2 A;  5KXB A;  2QZ2 A;  4JHT A;  4XZP A;  5FZF A;  4A3Z A;  1OQ1 A;  1Z7S 1;  4B4P A;  3W21 A;  5I8S A;  5CAD A;  1HQW A;  1WW6 A;  3OBR A;  2EAL A;  3AVS A;  1JBC A;  5KHH A;  4BIF A;  1URX A;  1CZS A;  4JGY B;  4EN9 B;  3KCC A;  2UY8 A;  1HRI 3;  5FYU A;  2VQA A;  5FY7 A;  2VUL A;  1ZRR A;  3FMG A;  4EN8 B;  5CG9 A;  3BOD A;  2DCJ A;  2J1R A;  3PMS A;  3T0B A;  4CYD A;  1XB9 A;  4HPK B;  3A23 A;  2WAB A;  4OUL A;  5LBE A;  2HWE 3;  4NIH A;  3PUH A;  2HEV F;  4FQ4 A;  5C3R A;  1JOP A;  1YCI A;  5SV5 A;  5HPO A;  1OA4 A;  1PK6 A;  3NW4 A;  4AG4 A;  1YLL A;  4LUM A;  3T1M A;  5AC9 3;  1OLR A;  4WVM A;  4GJY A;  4RHV 3;  2VZP A;  1UU5 A;  4GAZ A;  4M0N A;  4XIL A;  4Y5S A;  2VZ1 A;  5FFO C;  4XUQ A;  3IZO A;  3SMH A;  2FQP A;  2MEV 2;  3JD7 3;  3ZXL A;  3ROU A;  2O14 A;  3L2H A;  3C7G A;  4IV1 C;  5FP4 A;  1WGP A;  4JGZ C;  4XUR A;  3OSD A;  3POG A;  3DXT A;  3RYK A;  1OH3 A;  2K2S A;  2R6Q A;  2WC2 A;  3PVO A;  3UGF A;  1PIV 1;  3OGJ A;  1CR7 A;  3DCQ A;  4FPJ A;  4K3U A;  2QFE A;  3KCY A;  3SEP A;  5IW0 A;  3RMX A;  1ZBE 2;  1QJY 2;  1O8P A;  3GZA A;  2NLR A;  1A8D A;  3RPQ A;  1J3P A;  4YZ3 A;  3UT0 A;  1WMF A;  4FVV A;  4JKL A;  1JOJ A;  1TME 3;  4FPE A;  3T4V A;  3THD A;  1Q8S A;  4YVS A;  3VDD C;  2CDP A;  4Z82 A;  5FY8 A;  5LEK A;  4YSF A;  1OLM A;  1JZ5 A;  1DYK A;  3FUO A;  4PDW C;  3LQC A;  5K4L A;  3NKG A;  1QJZ A;  5FMD A;  4BCU A;  3NWK A;  5IVJ A;  2WNV B;  2P2K A;  4E4D X;  5EIY B;  2Z5W A;  2VZV A;  4Y1X A;  5C4W A;  3ES4 A;  5FYI A;  3WQB A;  1W9T A;  4HKW A;  4MSV A;  5JXI A;  2YGL A;  3RZK A;  1GIC A;  1OOP A;  3AL5 A;  1F5F A;  3QH7 A;  4GKX A;  1LOG A;  1W6P B;  5E8A A;  1LEC A;  4KG0 A;  3T09 A;  4QKN A;  4GQ7 A;  4Z2W A;  1G9C A;  2VW0 A;  3VD9 A;  3IKW A;  2D5H A;  5F37 A;  2YFZ A;  2Q8D A;  2XBO 2;  3OD4 A;  5FRA A;  4ISR A;  2GSY A;  2WO1 A;  4YYO A;  1S0B A;  4CE8 A;  3U37 A;  1O7F A;  3O1R A;  3BI3 A;  5F5C A;  1KFU L;  1AYN 2;  2JDY A;  4GWI A;  3VKL A;  3PDQ A;  5JSP A;  3BTZ A;  1CAX B;  4CU9 A;  5I93 A;  1BBT 1;  1MPX A;  4LBN A;  1LU1 A;  1SLL A;  1ACC A;  2V72 A;  4Z07 A;  2EXJ A;  2W39 A;  5TSW A;  3JBG 2;  4K20 A;  5F5A A;  3HAG A;  1W2O A;  1ND2 B;  4ZS2 A;  1GQH A;  1EPW A;  2QTW B;  1WWY A;  1NCQ A;  1SCR A;  2AGS A;  3ALQ A;  5JSO A;  1ZRC A;  1B35 C;  2FCU A;  1DGW X;  1C8M 3;  2YC0 A;  1LOC A;  1W05 A;  4CUB A;  5HV0 A;  1DGW A;  2PHF A;  1AR7 3;  3LA3 A;  4MET A;  2H0V A;  3M8L A;  4AI8 A;  4QM9 A;  3OBT A;  3DL3 A;  1RUC 3;  2VZU A;  3AP4 A;  3POY A;  5EP9 A;  4YW2 A;  3WXP A;  1RUI 3;  2WYS A;  3LIG A;  3M3I A;  4PT6 A;  4QB6 A;  2OZ6 A;  2ZAC A;  1GZC A;  4CEW B;  5JZG C;  5GZF A;  3E6C C;  2YU1 A;  4M0H A;  4ARY A;  4D3W A;  1RVF 3;  1LOB A;  4XF1 A;  4XHX A;  4L2N A;  5FP3 A;  1ENQ A;  5J36 A;  3BU0 A;  4Y5Z 0;  1ULC A;  1QH7 A;  1YFY A;  1V70 A;  2C9K A;  2A71 A;  1W0N A;  2VUJ A;  4N43 A;  3ZKY A;  1FPN 2;  3I2H A;  2D97 A;  4OQ9 A;  4IEQ A;  2ZGL A;  3AXE A;  1NAE A;  3K3O A;  3AFG A;  3CJI B;  4G9S B;  5CKM A;  1GWM A;  4DZG A;  1R09 1;  5D1I A;  3GDB A;  3TNP B;  4A4A A;  1VBE 3;  1J58 A;  1NLQ A;  1UMI A;  3KQ4 B;  4LE3 A;  4Z1V A;  1VIW B;  2E7A A;  2D44 A;  2R04 1;  3LDB A;  1C5H A;  3N9P A;  3VBH B;  2WZR 1;  1UWW A;  4KBZ A;  4W8J A;  5K0U C;  4WBB A;  1UYZ A;  1VB2 A;  3V56 A;  2ZKL A;  2TEP A;  1K45 A;  2JDN A;  3WSO A;  5JI9 A;  4DNY A;  3VLB B;  3H1Y A;  2QQI A;  5F6L B;  3RZG A;  1YWK A;  3WP3 A;  1A78 A;  1VP6 A;  3BOW A;  2W91 A;  3NMB A;  5EZW A;  4LOR A;  3GZE A;  5H9P A;  3WDW A;  3VBF C;  4M3C A;  5FPU A;  1VBA 3;  4Y1V A;  3U4X A;  4LBM A;  1QQP 1;  2VTF A;  4S2H A;  1DQ4 A;  4LKS A;  5K9Y A;  1AR8 1;  3IAP A;  3C8X A;  4NE9 A;  3TEY A;  2J1A A;  1CX4 A;  4QXH A;  5L7O B;  4Q29 A;  2FDG A;  4A7Y A;  1OA3 A;  2RR1 3;  2DCZ A;  1BVV A;  3R4U A;  3N9M A;  1IHM A;  1IQD C;  2W47 A;  1CAV A;  1DZQ A;  2A1X A;  2VNV A;  3E5X A;  4Q4W 3;  4QPW A;  5IK7 A;  3W5N A;  4AWD A;  3WQ0 A;  3EQE A;  5FLJ A;  3RWK X;  3IM0 A;  4ATE A;  1DU3 D;  2NMO A;  4LE4 A;  4GXL A;  3VHO A;  4CEY C;  1YEW A;  1W03 A;  2QDN A;  2R0F A;  4L99 A;  4P9Y A;  5D8A C;  5FLI A;  4AR2 A;  3J8F 1;  2Y8K A;  2JIC A;  4PHZ A;  5CU1 A;  4KU8 A;  1LHV A;  1VPH A;  4IEW A;  2HWD 1;  1IPJ A;  1I6X A;  3WUD A;  2QQP A;  4YPJ A;  4B8E A;  1OUS A;  1GLH A;  1LEM A;  2CYF A;  1LTE A;  5EYX A;  3T2O A;  1NY7 1;  5EFU A;  5D21 A;  5FZO A;  3RZH A;  1NXD 1;  4RQP A;  2JB4 A;  2E63 A;  1Y7B A;  2D6K A;  3SC7 X;  4MGT A;  2GH2 A;  3WDV A;  1FNY A;  5AVA A;  3CNA A;  4G4F A;  2W94 A;  4DUX A;  2DVA A;  3IN9 A;  3JZV A;  1AX2 A;  3HWJ A;  4K8F A;  4URT A;  3RRD A;  3ZXA C;  1CIY A;  1OMI A;  4BZ4 A;  1QOT A;  1F4H A;  1UKG A;  4N9H A;  3GM8 A;  4LXL A;  3MFA A;  2W08 A;  5DDJ 3;  1Y9G A;  2DUR A;  1U5Y A;  5AFB A;  2GME A;  4FFG A;  3O0V A;  4P9W A;  3A21 A;  4A7K A;  1XNK A;  2GNM A;  2RM2 1;  4QU1 A;  1RUJ 1;  4DEQ A;  4YG0 A;  4EZ4 A;  2VG9 A;  1ONA A;  4HN0 A;  1BZW A;  3BOP A;  4YW4 A;  3WF4 A;  5JAX A;  5SV8 A;  4WM8 C;  5BY5 A;  1BVP 1;  3HMY A;  1YC6 1;  2ZGO A;  4K21 A;  1RUG 2;  1YIP A;  1LOE A;  1N1V A;  1TNR A;  5LZ6 A;  4NWV A;  2YBS A;  4CCE A;  3TEW A;  2RMU 1;  5FDB A;  3RI8 A;  1UX7 A;  1ZZC A;  5IVB A;  1T6B X;  3KV5 A;  1COV 1;  5JSR A;  2FDF A;  1PK6 C;  2BQP A;  1F8V A;  5KHJ A;  3CJX A;  1RMU 1;  3I54 A;  3OPZ A;  4D0Q A;  1VBD 1;  5ACA 1;  1VB4 A;  1LCL A;  1CIW A;  4A41 A;  4BH9 A;  2KXL A;  3N7K A;  1YJL A;  3LEI A;  3WUC A;  5E16 A;  4AQ2 A;  4AYU A;  2WAA A;  4ES8 A;  5JMC A;  3PVN A;  1O3R A;  1ULF A;  1HLC A;  1GNH A;  1RUD 2;  2YXS A;  3HQX A;  3R4D B;  4NHY A;  4N53 A;  2DYC A;  2OW4 A;  3ZSM A;  4YVW C;  3AZY A;  5FP7 A;  5JUV A;  3KB5 A;  3NNJ A;  1KGY A;  2A3X A;  4CCO A;  3MV1 1;  4D6S A;  4X8N A;  1AF9 A;  2V5D A;  3HVD A;  3AZX A;  3E5U A;  4H55 A;  5G04 L;  3SIT A;  1J83 A;  1IQA A;  2WT2 A;  3PUI A;  4XTM A;  3W58 A;  1XNC A;  1O5L A;  2XON A;  1OFS A;  2ZX0 A;  1AL2 3;  1ZX5 A;  2JDZ A;  1EUT A;  3III A;  4IET A;  5C5U A;  4YVS C;  5FTT C;  4E4Z A;  5T54 A;  3O1V A;  3ECQ A;  3I3D A;  4DMI A;  5ERL A;  1ND3 B;  2JG8 B;  2QJV A;  4LLF A;  1H1M A;  5C4W C;  4IGP A;  5A7N A;  4AHY A;  5JDB A;  1OBN A;  3HQR A;  1LHN A;  3ZXE A;  4NMI A;  4HON A;  3NAP B;  2ZAB A;  4DY5 A;  1OOP C;  1ZM1 A;  5FMB A;  2E31 A;  1F31 A;  3AKQ A;  4XJU A;  3D0S A;  3AM2 A;  4NPL A;  3B94 A;  1CAW A;  2VCC A;  4RR3 A;  4XF4 A;  1O6U A;  4QDS A;  4UF0 B;  1G6N A;  4XET A;  4XIK A;  5BNN A;  3TAY A;  4R4X A;  3WF1 A;  1UOF A;  1WW7 A;  4H3W A;  4CCL A;  5BNO A;  3RI9 A;  2E9Q A;  3AXD A;  5FZE A;  5A1A A;  2LTN A;  3K2O A;  4QGM A;  2VL4 A;  4HFS A;  4YM0 A;  2VXR A;  5DUW A;  2ILM A;  3LCP A;  3WT3 A;  1ZRE A;  1O91 A;  2YC2 A;  2ZTN A;  1Q8Q A;  1FNZ A;  4NAM A;  3AC0 A;  2Y38 A;  2ZGN A;  4IEO A;  4BDV B;  2PYT A;  5IWF A;  4ASL A;  5FOJ B;  1S0G A;  5E6H A;  3ZN6 B;  2BPA 2;  4A3X A;  2D6M A;  3OTF A;  4AGG A;  1SLC A;  4URA A;  2KD7 A;  3KVB A;  4PJY A;  4C1X A;  4IE0 A;  2JKB A;  2WUH A;  3NO8 A;  1FYU A;  1RJ8 A;  4XUT A;  5T3N A;  4C90 A;  4FTB A;  3ZFG A;  2EXH A;  1JYT A;  3DYM A;  4IE4 A;  3TOJ A;  1VAV A;  4MYE A;  1NCQ C;  4DEV A;  1ASJ 2;  3PUA A;  4IXL A;  4E4H A;  1MS1 A;  2A73 B;  2VOW A;  4XQD A;  2HWC 2;  2NQY A;  2ORX A;  2W95 A;  1YUD A;  5FZ8 A;  3MUY 1;  3BAL A;  3KGL A;  4FFH A;  5F32 A;  1PO1 2;  1X82 A;  1KJR A;  4OHY A;  1GZW B;  2ZHM A;  4ZON A;  4E4S A;  3K77 A;  2HWF 2;  2IXC A;  1TQ5 A;  3ZFE C;  1BEV 3;  3INA A;  2DBI A;  1NCR B;  2ET1 A;  1C4R A;  1GWK A;  3B9C A;  3PNA A;  4FOQ A;  2J7M A;  2VMH A;  3IDA A;  2Y6J A;  1SLI A;  4H2A A;  2YY1 A;  1YI9 A;  4EWA A;  1LOF A;  3M1H A;  1LHO A;  4IV3 B;  3VL8 A;  5KXC A;  4N43 C;  4BXS V;  4UBH A;  4LPL A;  3PU3 A;  4LA3 A;  4W65 A;  4QXB A;  4Y20 B;  1QJF A;  2A6V A;  4V2V A;  3EBR A;  1EAH 1;  3WVJ A;  5A3O A;  4ZZ5 A;  3J7L A;  3J7M A;  3ZXD A;  4TLG A;  5AC9 1;  1W28 A;  4RHV 1;  3ST7 A;  1W8F A;  3JU9 A;  2X53 S;  1MVE A;  2Y6F A;  4XTP A;  5ABJ B;  4TTG A;  3LIH A;  1J1T A;  2VOV A;  1S2K A;  4GZ9 A;  3OF1 A;  4FAG A;  1GNY A;  2O0O A;  4PLN A;  5A7Q A;  1HXS 2;  2G9F A;  2W87 A;  2BGC A;  3LPG A;  4MGQ A;  4IE7 A;  4QX1 A;  1ODN A;  4RL7 A;  4CP1 A;  2YDE A;  4NO4 A;  1W9Y A;  4Q0V A;  2V5Y A;  1V9U 3;  2BOJ A;  3USU B;  4YZ5 A;  2G1M A;  2HEW F;  5FBZ A;  3PLQ A;  3P3P A;  4FQZ A;  2XLA A;  1RHI 2;  3ACH A;  2AEZ A;  2P34 A;  1TME 1;  2ZA9 A;  1S0E A;  3MW4 A;  5T5J A;  5J1X A;  1QJX 2;  5LA0 A;  5FZ7 A;  2DVG A;  4LKF A;  4H7M A;  2TUN A;  1WCU A;  2VY0 A;  1L7Q A;  3BN6 A;  4AFD A;  4QHZ A;  5BNP A;  2D5F A;  1HV1 A;  4LHN A;  4YWA A;  3J7H A;  1HQN A;  2PAK A;  3H42 B;  1VLN A;  2R06 2;  5LBF A;  2AC1 A;  3ORJ A;  2G9Z A;  2W9X A;  4AFB A;  5B4N A;  2CWM A;  4ONU A;  4WM7 A;  1AR9 2;  1OI6 A;  2PHR A;  3FC0 A;  2JDA A;  4PIY A;  4C0H A;  1K5M B;  1RIN A;  2OII A;  4BM8 A;  3SNM A;  1KIT A;  4Q8L A;  4ZXK A;  3T30 A;  3WF3 A;  3FL7 A;  3ACI A;  1CZT A;  3JCI A;  4MHU A;  4RQP C;  2HWB 3;  2RJK A;  3E1F 1;  1XXN A;  3ACL A;  5FYT A;  1XNA A;  2BVV A;  3S5Q A;  5FZC A;  4KL1 A;  3T08 A;  1D2S A;  5J98 B;  4IND A;  2PN5 A;  2OS2 A;  4I3G A;  1SCS A;  4L97 A;  3HJR A;  4CP9 B;  4P00 B;  2XPJ A;  4QPG A;  3UGH A;  3WQ7 A;  1RYY A;  3JB4 C;  4FO9 A;  1REF A;  4IQP A;  5KC6 A;  1LJ7 A;  3DEC A;  2V73 A;  3DXU A;  5DPN A;  3T2P A;  5GAL A;  3U0Z A;  3TYJ A;  2HEY F;  1NXM A;  2ARA A;  1RXG A;  3SKV A;  1AXK A;  4QX0 A;  1G9F A;  2OVU A;  2Y60 A;  3VKM A;  1C8M 1;  5JXG A;  1UU6 A;  4LOS A;  1AR7 1;  4BQW A;  1MQT A;  2EAK A;  3DPR B;  3ZYI B;  1H4H A;  2JXA A;  2XG3 A;  2ZGR A;  3I2D A;  1NLS A;  1SDD B;  4LHK A;  3PTR B;  5HV4 A;  2EF6 A;  4UW5 A;  1F4A A;  3POE A;  3WNN A;  1RUI 1;  4EJR A;  3H8X A;  2A5Z A;  3H3U A;  4A6S A;  5LBC A;  5D2A A;  1D0G A;  3TEX A;  2Z79 A;  3TEZ A;  1QHD A;  1RXF A;  2R16 A;  1RVF 1;  2OT7 A;  2VW2 A;  4HLT A;  5JXJ A;  4QX5 A;  1MZ5 A;  2DVF A;  1ENX A;  4R52 A;  3WF0 A;  4UWD A;  3I2K A;  4GKY A;  1UOJ A;  1X36 A;  1MZF A;  5FZD A;  4MGY E;  3VD5 A;  4OHW A;  2W92 A;  4JVA A;  1BJQ A;  4PBP A;  1UZW A;  1VAM A;  3A22 A;  1EUU A;  1VBE 1;  2GAU A;  3KLS A;  4AHW A;  3GBG A;  2BNM A;  4CCK A;  2GU9 A;  2VAU A;  2UWC A;  1AYM 3;  3NNM A;  4RFT 0;  5FP9 A;  3L2Y A;  4RYD A;  3ZDS A;  2XDV A;  3M2M A;  3NV2 A;  1VMF A;  1SLT A;  1JMU B;  3J7N A;  3LA7 A;  3T1L A;  1VBC 3;  2VTX A;  4BE3 A;  2VBD A;  1ZVF A;  1EYB A;  3VBS B;  2E51 A;  3WNO A;  5CYY A;  2PHL A;  2VZR A;  3MUZ 1;  4QHO A;  1A34 A;  3ME2 A;  1HDK A;  1C8N A;  3FJS A;  3GXU A;  1VBA 1;  5F5Q A;  1PX4 A;  5FY5 A;  2VCM A;  4Z2A A;  2BNO A;  4PIZ A;  4AQS A;  2IXJ A;  4D6Q A;  4Y22 A;  2RR1 1;  5HCB A;  3WDU A;  4GWN A;  4Q4W 1;  1CPM A;  2UY9 A;  4AED C;  2BDR A;  2PHD A;  1NA1 B;  4OCT A;  3M3E A;  4XDP A;  4RR3 C;  1IS3 A;  1WMD A;  2VQU A;  4FP3 A;  5GLW A;  1V0A A;  5BNN C;  5DN2 A;  1OUR A;  2XVG A;  3PUR A;  5BNO C;  2FZ1 A;  4D94 A;  1DQ1 A;  2AAC A;  2D6O X;  1FOD 3;  4GWM A;  1NLR A;  2XOM A;  5FLH A;  5FQ0 B;  4YM1 A;  3MDP A;  2ADE A;  4KI5 M;  4ZKT B;  3ZYB A;  2FDK A;  4AQT A;  1A6C A;  5FZ6 A;  1JXN A;  3C2U A;  4N90 A;  5C3O A;  3WD5 A;  3WOG A;  1OFN A;  2WNU B;  3I2I A;  4AXO A;  2VZO A;  4W6Y A;  5CVR A;  4Q4X 2;  5JLV A;  1VRH 1;  2BER A;  3N4M A;  2IFR A;  3ZN5 A;  1I5Z A;  4Q0U A;  3WDT A;  5F3C A;  2OPW A;  4QQ2 A;  3ZFG C;  5GZG A;  4AOC A;  2X5I B;  3AMH A;  1I9R A;  2BUK A;  5F6K A;  2I45 A;  5A80 A;  4XDO A;  5DDJ 1;  3ITQ A;  1W6O B;  3ZSE A;  1L7R A;  1MEC 3;  1ZBA 3;  5J7M A;  2WNE A;  5KHK A;  5CAZ A;  5I91 A;  4IGO A;  2YPJ A;  5C8C B;  2F17 A;  5FO9 B;  2WLP A;  4RGG A;  1R08 3;  3AJY A;  3CU7 A;  4OUM A;  1GP5 A;  1O4T A;  2RS3 2;  1K5J A;  3H1M A;  5FAX A;  1GR3 A;  2WNO A;  3VBF A;  1R64 A;  4MXW A;  2EIE A;  2TNF A;  3DKQ A;  4XMA A;  1MZ6 A;  4LUK A;  5EJ1 B;  3D6E A;  2WNV A;  2JDH A;  2WDB A;  5HCH A;  4R9B A;  4JX0 A;  1W90 A;  5GLT A;  4D8M A;  3AZV A;  3WNM A;  4NRM A;  1LOF C;  4MGZ E;  4P5H A;  3NQH A;  4QGN A;  1RUH 3;  4ZHN A;  2V09 A;  5LAT A;  4KG8 A;  4IV1 B;  4COZ A;  3TWI A;  1KS5 A;  1FXZ A;  3ZLI A;  4BIO A;  4QPI A;  1C1F A;  2W52 A;  3A0N A;  3M4F A;  2B7Y A;  4AHX A;  3KWV A;  1D2Q A;  3PIG A;  2VU9 A;  1MS3 A;  4M01 A;  4BOW A;  3K75 B;  1RUE 3;  3HNB M;  3V0B A;  5HBA A;  1S0J A;  3V0A A;  4XJ8 A;  4CDQ A;  3ZXG A;  2YB7 A;  4R4Z A;  5A6X A;  1XC6 A;  2F4L A;  4CUG A;  5EJ3 A;  1DGL A;  1XOY A;  2JDK A;  4QT6 A;  2NZ9 A;  2YRO A;  5FPB A;  4PDW B;  1DIW A;  3SCH A;  4B1L A;  2HWF 3;  1G9B A;  4LKE A;  3O12 A;  4PLO A;  5G05 L;  5FZL A;  2QBX A;  5BPX A;  1YQC A;  1H0B A;  4HVR A;  3U07 A;  3APB A;  1AL2 1;  1AX1 A;  5KC5 A;  1XYN A;  3NL1 A;  3O1S A;  4B4Q A;  2HYK A;  1QJU 3;  3KD4 A;  3UK9 A;  5A3M A;  3B93 A;  1UX6 A;  1V6K A;  1PO2 1;  3LEK A;  4IES A;  3FBM A;  4YG6 A;  4CDW A;  4JAA A;  3M3Q A;  5BNP C;  2GC0 A;  1TG7 A;  1X9P A;  3FHQ A;  3N9Q A;  2AYH A;  4F8A A;  1XND A;  5FO8 B;  3CLP A;  4WM8 A;  1KXG A;  4LO6 B;  1JW6 A;  2JG9 A;  3VHN A;  1NX9 A;  4XFI A;  1PZ7 A;  3GCW A;  4NHX A;  1VAK A;  2XJT A;  4G3Y C;  1WLC A;  4NPR A;  4XAA A;  4ASK A;  4WM7 C;  2ZZJ A;  3N9L A;  3NNG A;  4UFL A;  5C3P A;  2N7G A;  1W6M A;  2PLV 2;  2RS5 2;  1HXS 3;  1UZ0 A;  2YMZ A;  2PMW B;  3ZDV A;  3ZMN A;  2RV9 A;  2ET7 A;  3BUC A;  2MNG A;  2UYB A;  4ZPI A;  2X10 A;  1SZB A;  2UWB A;  3WW3 A;  2FDI A;  2R49 A;  1XU1 A;  4AFC A;  3VD3 A;  1EV1 2;  2BRT A;  2VMD A;  4LBJ A;  2XWB B;  4BU2 A;  1O3S A;  3CQO A;  3MEP A;  1DCS A;  2OXB A;  2XJU A;  3RZM A;  1OPO A;  1W06 A;  3IAQ A;  2OQ7 A;  4LR4 A;  4IEP A;  3H7J A;  1LU2 A;  1CD3 G;  4QPG C;  1UZZ A;  1XU2 A;  3TN9 3;  4LO5 B;  3V65 A;  1YQ6 A;  1K3I A;  1VBB 3;  1WCD J;  5FZM A;  3RS6 A;  3VZO A;  3ZM8 A;  4BWO A;  3ZYJ B;  4KGQ A;  4YVW A;  4I02 A;  5LA1 A;  5JZG B;  3SLI A;  3MF6 A;  4XIO A;  3SHR A;  3AYA A;  1QXR A;  1MQT C;  4R9D A;  2XGX A;  3VBR A;  3WNX A;  2BOI A;  2JDP A;  1Z7S 2;  2CU5 A;  2ZHL A;  3FX3 A;  3OUH A;  2RJ2 A;  3M7A A;  4HK9 A;  1BEV 1;  1JOB A;  3RQ0 A;  5IK5 A;  3NNF A;  2W1Q A;  3NJX A;  2RHP A;  2RS1 3;  3OUJ A;  2HLE A;  4CA9 A;  4Q4Y 1;  5CKN A;  3VUO A;  2GC2 A;  4FFI A;  3VHR A;  4XOG A;  1PZ8 A;  2OZJ A;  5DZG A;  2C26 A;  4QB2 A;  5DUV A;  3RFR A;  1KDK A;  2D6P A;  4L0P A;  3KT4 A;  4EWD A;  3ZO0 B;  3RNS A;  2PFW A;  3ZR6 A;  4Q2F A;  2EXK A;  4U36 A;  4QX2 A;  3CL1 A;  4ERO A;  1HX6 A;  4YG3 A;  3KF5 A;  3O0X A;  1W8T A;  2ARE A;  5FOB B;  3T2T A;  2O1Q A;  3P5B A;  3BIW E;  4I0A A;  2SBA A;  1CJP A;  4XFC A;  1UF2 C;  5DAB A;  1NQD A;  1W6N A;  2LS6 A;  3TB0 A;  3WZ1 A;  1TMF 3;  2CGP A;  1OPM A;  2EXI A;  1Q3E A;  2YGM A;  4O65 A;  1WA4 A;  1PIV 2;  1ZZ7 A;  4IEU A;  3VBU C;  1V9U 1;  2RJL A;  5CIS A;  1XPW A;  3ZN4 A;  4Y1U A;  5HCA A;  3KM5 A;  3QAC A;  2CHH A;  2ZMK A;  3F95 A;  4XJ9 A;  4XJA A;  2B4K A;  4CXX A;  1DQ2 A;  4NHK A;  2P17 A;  1CQ9 A;  3MFC A;  5D8A B;  3VL9 A;  2PAM A;  1PX3 A;  3MPP G;  2D7F A;  1G86 A;  3IPV A;  1CJD A;  2FD8 A;  1SHW B;  5C9A A;  4YGB A;  3AFK A;  5C8W A;  1R1A 3;  2GN7 A;  2LRO A;  1GZT A;  1UIK A;  4V2W A;  3KZ4 C;  4HOO A;  2ZX2 A;  2K9Z A;  5HCF A;  3RMY A;  4AZZ A;  1D4M 3;  5FBJ A;  5LWB A;  2ENR A;  4QXC A;  4FP2 A;  4LBQ A;  5JOX A;  1UPI A;  1O59 A;  4K8R B;  2JJ6 A;  2H6C A;  4TSV A;  3OB8 A;  2A6W A;  3ZFE A;  5IFT A;  3SIS A;  1HQL A;  4D7S A;  5DUU A;  1XBF A;  1MR5 A;  1W2U A;  4HZF A;  5F1R A;  4CCD A;  3ZXJ A;  4NHM A;  3MI8 A;  1OT5 A;  4MG2 A;  1W8Z A;  1WCK A;  2HWB 1;  1PVC 3;  4YGE A;  4MUV A;  1Q8O A;  3GBF A;  1NQJ A;  3I59 B;  3HN1 A;  2ZGU A;  4TWT A;  1HB2 A;  2J1S A;  3MW3 A;  1JZ6 A;  3AMM A;  5EXO A;  4HKO A;  2X09 A;  1BBT 2;  2WN3 A;  2XHK A;  4NID A;  2WII B;  4Q0P A;  5DAV A;  5JCT A;  2JE8 A;  2PQQ A;  3MV0 1;  5FZ4 A;  2JEC A;  4L8Q A;  5J3U A;  1CWP A;  1RUF 3;  4MZU A;  4AQ6 A;  2DU0 A;  2XWJ B;  3IMN A;  1LAJ A;  1E5H A;  3AYC A;  5CA6 A;  5I8Y A;  1UMH A;  2ZOE B;  5IVE A;  4AVV A;  1PGL 1;  4OYU A;  4QAW A;  1ENS A;  4LNV A;  1WBL A;  5A33 A;  3RZZ A;  1F9K A;  3K51 A;  3I3B A;  2WS9 3;  3K3N A;  5A7W A;  3RWN A;  3IMM A;  4B4R A;  3OEA A;  4O7X A;  1GFF 2;  1Q43 A;  3I7D A;  1H6X A;  3LPF A;  4JHZ A;  4BK4 A;  5L9V A;  1PK6 B;  1JYW A;  2WNV C;  4EN0 A;  2D6N A;  2DDU A;  4FPG A;  2WFF 1;  1QY4 A;  2B45 X;  4WVM B;  2Y0O A;  4CDX A;  3J9S A;  3H50 A;  2WR9 A;  1RUN A;  3NAP A;  3HR9 A;  1LGC A;  4BQ2 A;  4MVT A;  5FMO S;  4PF1 A;  1W8H A;  1NOV A;  4Y33 A;  5BV6 A;  1OQE A;  3VZN A;  4FPY A;  1FMD 3;  4Q4X 3;  4FBF A;  1QDC A;  4LHL A;  4GD4 A;  4PIX A;  2FCV A;  4QPI C;  1X33 A;  2ZMN A;  3GJA A;  4COV A;  4XHB A;  1UN1 A;  5GJ6 A;  2GC3 A;  3B3Q E;  2R1B A;  3VKF C;  2WA3 A;  4NHL A;  5LBB A;  1R09 2;  2IXH A;  3OCP A;  4CDQ C;  3BCW A;  1AYM 1;  4RSU A;  5H9Q A;  1OVS A;  5IT6 A;  3PUS A;  1YQ8 A;  2R04 2;  3THC A;  3AL6 A;  5EJZ B;  1UAI A;  2RS3 3;  2WZR 2;  5JOZ A;  1GOH A;  5HXM A;  2XJP A;  2SLI A;  1VBC 1;  3N3H A;  3N7M A;  4R9C A;  3GCX A;  5F8P A;  5C4W B;  3B69 A;  3WIN E;  4KGG A;  2C9A A;  1QXP A;  1HRV 3;  1LES A;  4P9J A;  1SPP A;  1H2L A;  4DFS A;  5BNQ A;  3PME A;  2C5D A;  3CBN A;  2E32 A;  1UL9 A;  3PJY A;  3ZSL A;  2X8K A;  1QQP 2;  1W9W A;  5B4X A;  1JZ4 A;  3T0D A;  1AR8 2;  3WP5 A;  4N9I A;  1XE7 A;  4CDW C;  3WCS A;  1IPK A;  2XJS A;  1Z0H A;  3MIF A;  4OHV A;  5L36 A;  1GZW A;  1POV 0;  1GU3 A;  1ULE A;  4XMI A;  1WW5 A;  3SXW A;  3AK0 A;  3DV8 A;  3CEW A;  4CEW C;  4LK7 A;  1HN1 A;  2JG9 C;  2P37 A;  2VVD A;  1DGR N;  1SFY A;  5DAX A;  4UW6 A;  1DQ6 A;  1AR6 3;  4Q4V 3;  3LOI A;  3CIH A;  1H2M A;  1WCS A;  4GB3 3;  5FWE A;  1RB8 G;  1M06 G;  3J8F 2;  2BFU S;  5IVF A;  1UYP A;  5DMY A;  4RS5 A;  4XVH A;  4FOW A;  1FOD 1;  2HWD 2;  1FAY A;  3THT A;  2EID A;  4Q5O A;  1IS6 A;  3NV3 A;  4GA9 A;  5J37 A;  1X9T A;  4QDR A;  5A6Y A;  5F5I A;  3UKT A;  1OQD A;  3AKS A;  5GM0 A;  1NY7 2;  3WDY A;  2C1F A;  2Y6K A;  1W2T A;  3QOP A;  1NCQ B;  1Y3T A;  3FLR A;  1GBG A;  4YW6 A;  5CFD A;  1BHG A;  2YPD A;  3VBH C;  4JKM A;  1PNG A;  2E6V A;  2Q30 A;  1BKZ A;  2RVA A;  3NJZ A;  3THP A;  4HSL A;  2ETE A;  1H9W A;  2BTV C;  4RN5 A;  3OYW A;  1FV3 A;  2W1U A;  1J59 A;  1BXH A;  4LIU A;  2Z69 A;  4AK3 A;  1AZD A;  1YFX A;  1MEC 1;  1ZBA 1;  4LT5 A;  1STM A;  3WW1 A;  2XL9 A;  3PTY A;  1R08 1;  5KXE A;  2RM2 2;  1J84 A;  1RUJ 2;  1CN1 A;  3UV9 A;  3VBR C;  4B3N A;  3WV6 A;  2QDR A;  3ZYR A;  4N43 B;  4XF3 A;  5BYN A;  2BWA A;  2YG0 A;  2WJS A;  4RA0 A;  3EHK A;  3WG1 A;  4DS0 A;  2QQN A;  3D5O A;  1NZC A;  4HXC A;  1JTZ X;  4Y5T A;  4AVT A;  4W6X A;  4UFH A;  5FXX A;  4QX8 A;  2RMU 2;  1DLL A;  3PIJ A;  4KWJ A;  4UFM A;  1RUH 1;  3HT1 A;  2AR6 A;  1COV 2;  2G4I A;  4FPF A;  4AED A;  4BHP A;  4DB5 A;  1DGR A;  2VM9 A;  3O1T A;  2G19 A;  2LRP A;  2MEV 3;  2VGD A;  3R05 A;  4GJZ A;  4LJH A;  1RMU 2;  4O9G A;  4QM8 A;  1VBD 2;  5ACA 2;  5CFC B;  1S4C A;  5FR3 A;  2Q0A A;  4HKL A;  4DXR A;  4AEJ A;  1W6Q A;  5J96 B;  4AVS A;  3RZL A;  4XUN A;  4M3C B;  2ARC A;  1RUE 1;  3J4U H;  4HK8 A;  5FKC A;  3LA2 A;  1L3J A;  3ON7 A;  1ZBE 3;  3EYP A;  3IIA A;  3VZJ A;  1LKN A;  1QJY 3;  4XEZ A;  2C4X A;  5FYB A;  1OXC A;  2HWF 1;  1OF4 A;  4Q8K A;  4HL0 A;  4XQW A;  1CAV B;  3OGR A;  3OG2 A;  1Z78 A;  3ZFF B;  4XAE A;  3H3Z A;  1NKG A;  3VN4 A;  1XRU A;  2QQO A;  2W5F A;  3QCW A;  4GMP 0;  1U5Z A;  4OZO A;  4ZS3 A;  2Y64 A;  4QDQ A;  1QJU 1;  4AE2 A;  1AHS A;  1N1S A;  5C9A C;  1LB2 A;  2ATF A;  5LK7 B;  3Q8B A;  1APN A;  2ID4 A;  1P8J A;  2ZX1 A;  5CIR A;  5IK8 A;  2KA3 A;  5T5O A;  3K48 A;  2DTW A;  2VQ0 A;  5CEH A;  3MIE A;  3QH6 A;  5FK8 A;  3KS7 A;  4NRO A;  4RQP B;  4CXY A;  4PQ9 A;  4E2Q A;  3LFI A;  1BMV 1;  3VGI A;  3PVE A;  2XBO 3;  3AMP A;  1SMV A;  4UFJ A;  1E5S A;  3FUQ A;  4OI4 A;  4QQO A;  2OUJ A;  1HRI 1;  2W1W A;  3AYE A;  3CKH A;  3NV4 A;  4CDU A;  2CWS A;  1AYN 3;  5I0D A;  4JDO A;  2V4A A;  3GNE A;  3G6J B;  5F3G A;  3LKJ A;  4I3P A;  2HWE 1;  1POQ A;  3KHC A;  2BJS A;  2XLG A;  1PMI A;  4QHB A;  2YU2 A;  1GQP A;  1XE8 A;  4B7K A;  2GC1 A;  5FZH A;  2PTM A;  1B09 A;  1SFP A;  2UWA A;  2O8O A;  3FHI B;  3JBG 3;  3R4S A;  2W3J A;  1RC6 A;  4FT8 A;  4OMD A;  3NJV A;  4GH4 A;  5T55 A;  4AL9 A;  5EV7 A;  3BTX A;  1O3T A;  4D7Y A;  1M4W A;  2WWJ A;  1UZV A;  3B7M A;  4QKF A;  1JZ3 A;  5FK7 A;  3TN9 1;  2GH8 A;  3JD7 1;  2XH6 A;  5DXD A;  5KWR A;  1VBB 1;  1VMJ A;  3WHU A;  2VOX A;  1UYY A;  5IVY A;  1H8T B;  5DG2 A;  1DQ5 A;  2ZCW A;  4LIT A;  2UU8 A;  1PMJ X;  3VV1 A;  3UNP A;  5DZF A;  4AI1 A;  4C8D A;  4L9B A;  1AJO A;  1LGN A;  2Y0I A;  5EPA A;  4PI2 A;  1JYX A;  1ND3 C;  1QIQ A;  2JG8 C;  4LBO A;  4EWE A;  3ZYG A;  2WO2 A;  2ES3 A;  1OH4 A;  4MXV A;  5A6Q A;  5JR2 A;  4YGC A;  1AVB A;  1W3V A;  3D8C A;  4CDX C;  4JDM A;  2OX0 A;  2RS1 1;  1FPN 3;  3JQW A;  2CDO A;  3NAP C;  3AZZ A;  5CG8 A;  2Q1M A;  1IS5 A;  2MPF A;  1DYO A;  2F6B A;  5F2S A;  3OGV A;  4NAO A;  1UY1 A;  4N53 B;  4AEK A;  3HBK A;  1V6N A;  4Q27 A;  2K46 A;  1EAH 2;  2KR2 A;  2ZXQ A;  3T2Q A;  3OY8 A;  1LRH A;  1YYN A;  3KV9 A;  1ZRI A;  3PU8 A;  1UZY A;  5FQ0 A;  5AC9 2;  4HSJ A;  5E1R A;  4RHV 2;  5GZE A;  1LNS A;  3H8R A;  1TNF A;  4QWN A;  4OVE A;  2WL1 A;  2AEN A;  3U11 A;  2E53 A;  3VD7 A;  1XSR A;  2AH2 A;  2VNG A;  4IEY A;  3VBO A;  1GZ9 A;  1K42 A;  4FOY A;  5JMO A;  1TMF 1;  2YUE A;  1OF3 A;  4TLF A;  4A7Z A;  4LLO A;  1US2 A;  4BQX A;  1WW4 A;  2XKP A;  4QU2 A;  3K46 A;  4E8D A;  3PUQ A;  3TRS B;  2GAL A;  2XML A;  5M0T A;  1UCX A;  2HYX A;  4MOA A;  4LO7 A;  1YNA A;  1CAW B;  3D82 A;  1UOB A;  4HAN A;  4R8H A;  4RR3 B;  4IL7 A;  4CVU A;  3KF3 A;  5C8C A;  3AP9 A;  1TME 2;  2WWS A;  5FJK A;  5BNN B;  4MGK E;  3Q8A A;  3AJZ A;  5AVP A;  1R1A 1;  2QQM A;  5BNO B;  1GSL A;  2ORZ A;  3A4U A;  3WR0 A;  3M70 A;  1D4M 1;  3K4A A;  1CAU A;  1NCR C;  1AL0 G;  1RUC 1;  2A70 A;  4NPM A;  2VW1 A;  2QZ3 A;  4A44 A;  3A0K A;  1UYX A;  2A3Y A;  2NM1 A;  1TEI A;  2YHJ A;  2PA7 A;  2ZHN A;  1GQG A;  1OLQ A;  4RS5 C;  3LZZ A;  4CP0 A;  5IAT A;  4BLJ A;  1D7P M;  1QMJ A;  1SDW A;  1JYN A;  3B5L B;  2XQX A;  3VZL A;  2FDJ A;  2EA7 A;  2D3P A;  4SBV A;  1KD7 A;  3ZFG B;  1IOA A;  4CUC A;  1N1Y A;  1PVC 1;  3ZIX A;  5JOW A;  1S0F A;  4FOV A;  5GKA C;  4AFA A;  5ABJ C;  1QJE A;  2AEY A;  3EB7 A;  3WNK A;  2WLQ A;  3UJO A;  4YNI A;  1X50 A;  5CFD C;  4FTS A;  1DG6 A;  2XVK A;  3S0M A;  1CGP A;  1PGW 1;  2ZX4 A;  4CCN A;  3MIH A;  1VAL A;  1GMM A;  3HQU A;  4IER A;  4PI0 A;  5A32 A;  3MIG A;  2DFC A;  4QXK A;  3FZ3 A;  4JCK A;  1RUF 1;  3N7L A;  4E9K A;  1U5I A;  4QPY A;  4N7U A;  2B46 X;  2Q1Z B;  1PZ9 A;  1WD3 A;  1X7N A;  3USS A;  1KS4 A;  3OPW A;  4OHZ A;  2WFP A;  3OBA A;  1CON A;  4BIS A;  4TYS A;  3VHP A;  5C7G A;  1QU0 A;  1QNY A;  2WS9 1;  1RUG 3;  2PHU A;  3S57 A;  3VBU A;  1C8M 2;  3WF2 A;  2G9G A;  4E2G A;  1AR7 2;  4D69 A;  4DIN B;  1H8V A;  1O4Y A;  1H6Y A;  2BU9 A;  5F9T A;  3DEM A;  2Y6H A;  3ELN A;  4W50 A;  2R07 2;  2IUW A;  3FE5 A;  1RUI 2;  2VQT A;  3GAL A;  4ATF A;  5GLV A;  2GNB A;  5JIA A;  1E57 A;  4CXW A;  1H30 A;  4YZ1 A;  5T5P A;  2DVB A;  2Z2S B;  1RVF 2;  4CU8 A;  4UAP A;  1PHM A;  3GBW A;  4YAR A;  4LEJ A;  1RIR A;  1FMD 1;  1S0D A;  2EIB A;  2O8Q A;  4JGY A;  4S2G A;  5FIX A;  2Q8E A;  3O7O A;  3LAG A;  2ZGK A;  2ZGM A;  2ZPX A;  1RUD 3;  1A8M A;  3FLP A;  4HPK A;  2X05 A;  2ZML A;  3S6P A;  2DU1 A;  1JZ2 A;  2IVJ A;  2R30 A;  2X29 A;  4CSW A;  4I2O A;  3KCX A;  4RFR B;  2LAL A;  5LCW L;  4O61 A;  5CB7 A;  4BQ5 A;  4F83 A;  4FSJ A;  4D7T A;  3H1W A;  4BB3 A;  1G8W A;  3WHT A;  4ET7 A;  4Q26 A;  3KVA A;  5FMC A;  3WP4 A;  2B9V A;  1ZZ8 A;  2JX9 A;  3MLK A;  1HRV 1;  3KV6 A;  2RDS A;  1T6G C;  4QB1 A;  4LBQ D;  2VUA A;  5FXV A;  4UXA A;  2QCS B;  1Q8V A;  5EWS A;  4PF5 A;  3WG4 A;  3QBQ A;  4JQT A;  1VBA 2;  2BW8 A;  2VBP A;  4UOJ A;  1T2X A;  3FN9 A;  1V00 A;  1JU4 A;  4WM7 B;  4Q0S A;  1YFW A;  1L7L A;  1NZI A;  4XAC A;  3RJ2 X;  2P3I A;  3T4H B;  2RR1 2;  4DIQ A;  4LUL A;  1WLW A;  1DP0 A;  3BU7 A;  1LGB A;  4Q4W 2;  3RG0 A;  1H4G A;  5C5T A;  5C3S A;  5LEJ A;  1MS9 A;  1ZNP A;  1N3Q A;  1ZZ6 A;  5FUN A;  4ZXE A;  4Q4V 1;  1AR6 1;  4IGQ A;  5FUP A;  4ZY9 A;  4COY A;  3JQX A;  4CDU C;  4GB3 1;  4J25 A;  1KRI A;  3U14 A;  4WZF A;  3V64 A;  3KMH A;  2ZGS A;  5C3Q A;  4NIG A;  1W6P A;  2DV9 A;  2GNT A;  5BXX A;  4HMZ A;  1YJK A;  2DFB A;  2EVX A;  4JGZ B;  3NV1 A;  2DVD A;  5FJH A;  2PEL A;  4GH4 C;  1S55 A;  3ZSK A;  3AMQ A;  1E5R A;  2R7E B;  5FYS A;  1DDL A;  4LHS A;  2QUO A;  3UYJ A;  2JIJ A;  4E27 A;  1UMZ A;  3URF A;  2BBV A;  2ZX3 A;  1MQT B;  1ASJ 3;  5FPV A;  2LM3 A;  4YM2 A;  4BYY A;  2WQZ C;  1VRH 2;  5JOY A;  1JZ7 A;  2VMF A;  2HWC 3;  3DUI A;  4WVW A;  1C5I A;  1CAX A;  1H2N A;  1VJ2 A;  3VDD B;  4SLI A;  1PO1 3;  2I2S A;  3O1M A;  5DDJ 2;  2VMI A;  3H8O A;  5I0U A;  2JE9 A;  3LSD A;  4XCA A;  4NRQ A;  4O9E A;  1ND2 A;  1YRZ A;  3NRU A;  2CSG A;  3WY6 A;  1MS5 A;  3ZYH A;  3HOB A;  3ES1 A;  4W6W A;  2HJI A;  1D0H A;  4WVV A;  3I3E A;  1V6J A;  5IUQ A;  3FFZ A;  1J1L A;  1QDO A;  3O0W A;  5FY0 A;  1HV0 A;  2BV4 A;  1SAC A;  4A45 A;  1HN0 A;  2J42 A;  4DXT A;  4HT1 T;  1OA2 A;  1UU4 A;  5E88 A;  3I49 A;  3ZIW A;  4ZU7 A;  5LA2 A;  2CAV A;  1YI7 A;  4TXW A;  4AF9 A;  1LHU A;  4ASM B;  4COW A;  3MO4 A;  4Y4R A;  3UL2 A;  5A3N A;  2OQ6 A;  2ARX A;  4U2A A;  4WZC A;  4CEW A;  4ZZ8 A;  1MS4 A;  2DF7 A;  5FYV A;  2MEV 1;  1I3H A;  5LY1 A;  3ENR A;  1DBN A;  1RJ7 A;  5FPX A;  2FCT A;  4P08 A;  2WZP P;  4FPL A;  4MV2 A;  2I74 A;  4KWU A;  1POV 3;  1ST8 A;  4AW7 A;  4MLO A;  1W8O A;  1LEN A;  1IS4 A;  3OEB A;  4Q0Q A;  1DFQ A;  4UFK A;  3AZW A;  4BQ4 A;  3KQR A;  5A3U A;  5BUV A;  4K7J A;  2EIG A;  3VBO C;  1ZBE 1;  3CJI A;  2FZ2 A;  1QJY 1;  1IG0 A;  2Q5T A;  2BGO A;  1RHI 3;  4Y22 B;  2BP6 A;  2P1B A;  1JUH A;  3J26 N;  4ES9 A;  1B35 B;  2UYA A;  4Y1Y A;  2X5I C;  5ANQ A;  5T5L A;  3TBD A;  3VBH A;  2IXL A;  4C0B A;  1QJX 3;  1DLC A;  1ULD A;  1N3O A;  3U1X A;  1HJG A;  1YXW A;  4KBB A;  4DQA A;  1DF0 A;  1WMX A;  2VZS A;  3LEG A;  1AL2 2;  1IPS A;  4FXK B;  5T52 A;  1S1A A;  4M4P A;  4XFH A;  4AVC A;  2QNK A;  5FXW A;  4JRA A;  3MYX A;  3C3V A;  2R06 3;  2UUR A;  1PO2 2;  5F3E A;  3SKJ E;  1EAH 3;  3ZR5 A;  5ANN A;  4MX3 A;  3RGB A;  1CVN A;  1UY4 A;  1AR9 3;  3AKR A;  1JN2 P;  1W0P A;  5L7O A;  3C7H A;  5A70 A;  5FMO L;  5F7U A;  2XBO 1;  5LA9 A;  1X8E A;  5DZE A;  1O8S A;  1AYN 1;  4IEX A;  1W39 A;  4X8P A;  1PM4 A;  4NOT A;  4XUP A;  1H1I A;  2D43 A;  2DUP A;  1DYP A;  1RED A;  3ILR A;  2ZKN A;  3DGT A;  4V1P A;  3AP6 A;  2YBK A;  2W0X A;  3W20 A;  2BBA A;  3RJR A;  5K0U B;  2JDU A;  2Z42 A;  3JBG 1;  2P3K A;  1RL3 A;  3I2J A;  4AVA A;  1Y4W A;  4F7Z A;  1F5J A;  2VE1 A;  3AKP A;  1IG3 A;  5FZG A;  2B42 B;  5IAX A;  1W9F A;  2R1D A;  4L92 A;  4XFF A;  1SLB A;  5GLZ A;  4B29 A;  3VBF B;  4NR1 A;  4MXW B;  4XCB A;  5KHI A;  3OGS A;  1WLT A;  5I8T A;  5HI0 A;  4EQV A;  3I3Q A;  5FWJ A;  3CHX A;  4UBG A;  4AGV A;  2ZGP A;  4P5Y A;  4F3J A;  5A7P A;  2WBK A;  3TNQ A;  2WQ4 A;  2V4V A;  3HPN A;  2GMP A;  1Q8P A;  5EQU A;  4JTN A;  1ODM A;  4B1M A;  2HBT A;  3EMR A;  4P9I A;  4CU6 A;  1EPZ A;  3KT1 A;  4DY3 A;  1O5U A;  4CEY B;  5A1F A;  1G9D A;  2IC1 A;  4QPI B;  2VO5 A;  4FAH A;  1BEV 2;  2JIG A;  2WZ8 A;  3AX4 A;  1FPN 1;  1BQP A;  2Y34 A;  3VKO A;  4WV8 A;  1Y9Q A;  2YFU A;  4FFF A;  3I3M A;  4Q4Y 2;  1FAT A;  5A7O A;  3V0B B;  4QQL A;  3V0A B;  4XBN A;  4CDQ B;  2BFU L;  4JGY C;  1RTV A;  5T50 A;  3RVH A;  4PQQ A;  3LFM A;  2YYO A;  3IDC B;  4GMP 3;  4E8C A;  2J1T A;  3NJY A;  2VUD A;  4CPB A;  2XJQ A;  1QH6 A;  4CRQ A;  2B9U A;  2CAU A;  2CV6 A;  3P1I A;  4NII A;  3O1O A;  3ILN A;  2R32 A;  2P6H A;  4LBK A;  4UI9 L;  4H14 A;  5F39 A;  3PVB B;  1FV2 A;  5FRE A;  3WX5 A;  5IJR A;  1WZX A;  3IB3 A;  4ORF A;  3EO6 A;  1H9P A;  2WYF A;  3GZT B;  5JI7 A;  5LY2 A;  3UGG A;  5I0S A;  3O1U A;  2B8M A;  1N1T A;  4P02 B;  2Y33 A;  4CDW B;  2QQJ A;  2FHR A;  3E97 A;  1ZZ9 A;  2RDQ A;  4KQ7 A;  4XFA A;  2P6C A;  2R07 3;  4HN1 A;  2Y6G A;  5LAS A;  1WD4 A;  1V9U 2;  4DUW A;  5I0R A;  2WWU A;  3H0O A;  4WM8 B;  4XPV A;  3RYP A;  2JG9 B;  1S2E A;  1CES A;  4HET A;  4QMA A;  2YV8 A;  3JXS A;  4K1Y A;  4QKB A;  1W6M B;  3QD6 A;  4OI2 A;  4QQH A;  1GYK A;  4FPK A;  4MHR A;  2R0H A;  2WT1 A;  4EN7 B;  2JEM A;  5FZ0 A;  5KHG A;  3C7O A;  4OUE A;  1AXY A;  4BQY A;  2GP3 A;  2D98 A;  5FZ1 A;  3EJK A;  3CF6 E;  3ACG A;  1ND3 A;  2H0B A;  2JG8 A;  3H7Y A;  3KHB A;  2FDH A;  2QQV A;  3VZK A;  1XNB A;  1RIT A;  3DYP A;  1UW8 A;  3GHN A;  1GOG A;  4YW1 A;  3U75 A;  2WT0 A;  2Y6L A;  3ASI A;  4MAD A;  1W9S A;  4AI9 A;  4P14 A;  4ISQ A;  3GZU C;  5JR7 B;  1GKB A;  4UW3 A;  3BB6 A;  2HBU A;  2XLF A;  4UF0 A;  5DQ0 A;  2W68 A;  2DCT A;  5CFC A;  4YVW B;  2HWB 2;  4YFZ A;  3MLL A;  3I8T A;  1SBD A;  1XYO A;  2GDF A;  4B7E A;  3U10 A;  3VDB A;  3POI A;  5IAV A;  1OKQ A;  2P5B A;  3Q9O A;  2JD9 A;  5B2G B;  3DF0 A;  1ULG A;  2LW8 A;  4CCM A;  4YZ2 A;  2ZZQ A;  2XHN A;  1ULP A;  3VBR B;  1UKR A;  3BPS A;  2OPK A;  1JYC A;  3ZN6 A;  4XXP A;  5LRR A;  2VCA A;  4YVS B;  3LD8 A;  4OMC A;  1BYH A;  4TZD A;  4OQ8 A;  2ZEX A;  2BVB A;  1PGL 2;  2GZW A;  1NUK A;  2VUC A;  1OC1 A;  1TE1 B;  4I09 A;  1QOS A;  2WA4 A;  3ZFF A;  4AAX A;  3E6B A;  1ND2 C;  1RUG 1;  1SQ4 A;  3N9O A;  2E7T A;  3SEE A;  4FCA A;  1ENR A;  1N3P A;  1OOP B;  3HNM A;  4FPC A;  4K1Z A;  2DBN A;  2XUM A;  1W99 A;  2BZD A;  3UJQ A;  2Z4F A;  2KM2 A;  2WFF 2;  4Y4Y A;  3MHZ A;  4FXG B;  3BIE A;  4JTO A;  1UPS A;  4XJW A;  2E7Q A;  3WG2 A;  1O4Z A;  1VE0 A;  3OGG A;  3OUI A;  5H9S A;  4AGR A;  5JIU A;  4MGS A;  5FYH A;  3HD8 B;  1W6N B;  1GAN A;  1NCR A;  3ACF A;  2W46 A;  2IZW A;  2QKD A;  2D6L X;  3GYD A;  3ZMO A;  2BWC A;  1VRH 3;  3FFQ A;  1RUD 1;  4OI1 A;  4AHZ A;  1Q5O A;  4IV3 A;  5FYY A;  4JKK A;  3SCF A;  2WRA A;  1EY2 A;  3KGZ A;  3U4S A;  2HKX A;  4Y20 A;  4OI0 A;  4JQR A;  3BYW A;  2D40 A;  2EIC A;  3ZYF A;  3IWZ A;  4NN0 A;  4I0W B;  1NYW A;  3CJI C;  3WEZ A;  1AYM 2;  3IT8 A;  4IDZ A;  5J48 A;  3HBZ A;  3HIF A;  5FXZ A;  2VMG A;  1CPN A;  5ABJ A;  3IPV B;  3WCR A;  1JHN A;  1UY0 A;  1IZ3 A;  2D93 A;  5C9A B;  1GP6 A;  3MIB A;  3RSJ A;  1ULO A;  1VBC 2;  3MGU A;  3NKT A;  1UO9 A;  1MVQ A;  4LBQ B;  2C0Z A;  2A6Z A;  3OBZ A;  1H8T A;  1I5P A;  2XR4 A;  4OZX A;  4ARX A;  4XYX A;  1RGS A;  4S2F A;  3ZFE B;  5FP8 A;  1U0A A;  3H9A A;  2K0G A;  3USU A;  1QWR A;  2VEC A;  4IUG A;  2A6Y A;  5FPA A;  1JS9 A;  3B00 A;  1QXJ A;  4I01 A;  2IXI A;  2EAA A;  2VVE A;  5L7O C;  2PLV 3;  2RS5 3;  4RGA A;  4AI2 A;  4W4Z A;  1NG0 A;  5JPM B;  3SH5 A;  5A1L A;  3C7E A;  1OKO A;  4KWK A;  5GZD A;  3RZJ A;  2CTV A;  1WKY A;  2ZEW A;  2B39 A;  1JOD A;  1NE6 A;  4QGL A;  2P3Y A;  2W1S A;  3P3N A;  2Y26 A;  1EV1 3;  2CL2 A;  3OPT A;  5C8C C;  1YQ2 A;  4QKD A;  2XJV A;  2Q1F A;  5LB6 A;  1FOD 2;  2XXZ A;  3N36 A;  2L9L A;  1JU3 A;  4BPZ A;  4H7L A;  4XQ4 A;  5A33 B;  1YQ5 A;  1K5M A;  3R6S A;  3WG3 A;  4YM3 A;  3ZKU A;  4NVP A;  3AVR A;  4COU A;  5KR7 A;  3POS A;  5A7W B;  2CGO A;  1JI6 A;  1ASJ 1;  4MO3 M;  1JZ8 A;  2H6B A;  2Q4S A;  2WN2 A;  2DUQ A;  2P4E A;  3H3L A;  3KT7 A;  4YRD A;  2HWC 1;  5JWP A;  1UQX A;  1PO2 3;  4EE2 A;  3WNP A;  1UD1 A;  2XJR A;  4UT5 A;  4K40 A;  3F2Z A;  3KV4 A;  1PO1 1;  4K6B A;  1UXX X;  4XZU G;  4YW7 A;  4CDX B;  4CP9 A;  1MEC 2;  1Z7S 3;  1ZBA 2;  3W5M A;  1V6O A;  5GLU A;  2BGP A;  1MZE A;  4BQ1 A;  5L19 A;  3G7D A;  5DAQ A;  3W9A A;  4DXS A;  4A6O A;  2B5H A;  2J1U A;  1QKQ A;  1R08 2;  1SBF A;  1OLM E;  2OKX A;  3HNY M;  1JHJ A;  4XFB A;  1N47 A;  5A7S A;  1E5I A;  1HKD A;  2VNR A;  2ZBJ A;  3LGR A;  4MH0 E;  1HW5 A;  4FTE A;  3W59 A;  1C3H A;  2VZT A;  4LO4 B;  4R9A A;  3CDZ B;  3SH4 A;  3GF6 A;  4AVB A;  1AJK A;  1GUI A;  5A3L A;  4OHX A;  5FKB A;  5FZI A;  3IDB B;  3DPR A;  4NUB A;  1JYI A;  2XUE A;  5IVC A;  4I0B A;  1OHF A;  2XKO A;  1SBE A;  5FZO B;  5IYY A;  1PNF A;  4ITC A;  1RUH 2;  4QX3 A;  3S7E A;  1F15 A;  3IDE A;  4M4R A;  2PQS A; 
#chains in the Genus database with same CATH homology
 2X10 A;  3WF2 A;  3VD3 A;  2VMD A;  1IQD C;  2W47 A;  2VR4 A;  1H6Y A;  4QPW A;  3CQO A;  3W5N A;  4LQR A;  2Y6H A;  3IAQ A;  4W50 A;  2VQT A;  2WAO A;  4XUO A;  2Y8K A;  1K3I A;  3ZM8 A;  1TVG A;  4CU8 A;  4UAP A;  5LA1 A;  4YPJ A;  2EIB A;  5IFP A;  3T2O A;  2ZEZ A;  3CMG A;  2X05 A;  4DUV A;  3FHA A;  3UET A;  1JZ2 A;  2RJ2 A;  1KEX A;  2W94 A;  4DUX A;  3A7Q A;  4CU7 A;  5LCW L;  2W1Q A;  3NJX A;  1SG3 A;  1CIY A;  2HLE A;  1F4H A;  3BGA A;  4ET7 A;  3GM8 A;  2WO3 A;  4KMQ A;  2B9V A;  2C26 A;  2VZQ A;  4QB2 A;  4L0P A;  3A21 A;  4QB1 A;  4DEQ A;  3I2F A;  4QX2 A;  3WF4 A;  4UOJ A;  1T2X A;  3FN9 A;  1JU4 A;  4HG6 B;  1OD3 A;  1GOF A;  2LS6 A;  1DP0 A;  1UX7 A;  3VDC A;  4ZXE A;  4ZY9 A;  2VZ3 A;  1XPW A;  4D0Q A;  2B4K A;  4A41 A;  3LEI A;  1PX3 A;  3ETP A;  2WAA A;  2J22 A;  1SHW B;  1US3 A;  2DCK A;  2R7E B;  5JUV A;  4LHS A;  1KGY A;  3MV1 1;  2V5D A;  5G04 L;  4BJ0 A;  1J83 A;  1O59 A;  3PUI A;  5IFT A;  1JZ7 A;  2VMF A;  3OB8 A;  2WQ8 A;  2XON A;  1W8N A;  3K4D A;  1EUT A;  3III A;  3ECQ A;  3I3D A;  1OT5 A;  3NRU A;  2QQK A;  2J1S A;  3HOB A;  1JZ6 A;  3I2G A;  3I3E A;  2X09 A;  2WN3 A;  4A45 A;  2E31 A;  2JE8 A;  3MV0 1;  4DXT A;  2VCC A;  4QDS A;  2VME A;  5LA2 A;  4BK5 A;  4TXW A;  1UMH A;  3MO4 A;  3WF1 A;  4OYU A;  4QAW A;  2ZEY A;  4ZZ8 A;  5A1A A;  2YC4 A;  3I3B A;  2VL4 A;  3C7F A;  3D3A A;  5C71 A;  2QQL A;  2YC2 A;  4P08 A;  3AC0 A;  3LE0 A;  3OEA A;  4BDV B;  4BK4 A;  4KWU A;  1H6X A;  3LPF A;  4JHZ A;  1W8O A;  4CUA A;  1JYW A;  3OEB A;  2DDU A;  1PMH X;  3ABZ A;  2KD7 A;  3HN3 A;  4FI9 A;  2WUH A;  4XUT A;  2BGO A;  3DYM A;  4PF1 A;  4DEV A;  3VDA A;  1DLC A;  2ORX A;  2W95 A;  2WZE A;  3MUY 1;  2VZS A;  3LEG A;  3MBW A;  4M4P A;  5C70 A;  3HEI A;  3K77 A;  4A42 A;  3VD4 A;  3SKJ E;  4GWJ A;  2J7M A;  3IDA A;  1UY4 A;  2Y6J A;  5EJZ B;  3THC A;  1GOH A;  3CZJ A;  5HXM A;  3C7H A;  3I97 A;  4BXS V;  5F7U A;  4LPL A;  4ZZ5 A;  1O8S A;  2E32 A;  4XUP A;  3P6B A;  1WCQ A;  2VOT A;  1W9W A;  5B4X A;  1JZ4 A;  3T0D A;  3K4Z A;  4TTG A;  2BBA A;  4GZ9 A;  1GNY A;  1GU3 A;  1XNT A;  1K12 A;  3I2J A;  2W87 A;  3LPG A;  1HN1 A;  4MGQ A;  3CZU A;  4QX1 A;  2J1V A;  3CIH A;  3OGS A;  5FUI A;  5IHR A;  3ACH A;  5DMY A;  2VCB A;  4P5Y A;  4XVH A;  2WBK A;  2EID A;  2V4V A;  3HPN A;  5J1X A;  4QDR A;  3DYO A;  5LA0 A;  2JKX A;  1UXZ A;  2Y6K A;  4CU6 A;  1L7Q A;  3BN6 A;  1BHG A;  3J7H A;  2VO5 A;  4JKM A;  2WZ8 A;  2RVA A;  2W9X A;  2E26 A;  5B4N A;  2YFU A;  4RN5 A;  1UY3 A;  2JDA A;  2W1U A;  4PQQ A;  4E8C A;  3WF3 A;  2J1T A;  3FL7 A;  3ACI A;  1CZT A;  3T0A A;  3E1F 1;  1UY2 A;  1J84 A;  1XNA A;  2VJX A;  3P1I A;  2VC9 A;  5CZK A;  3T08 A;  4UI9 L;  2YG0 A;  3UES A;  2VMC A;  5JXH A;  5IJR A;  2QQN A;  3HJR A;  3IB3 A;  4P00 B;  1RYY A;  2J1E A;  4P02 B;  3DEC A;  2QQJ A;  5DPN A;  3T2P A;  3SKV A;  2Y6G A;  2VM9 A;  4QX0 A;  4DUW A;  1CX1 A;  5JXG A;  3GGL A;  1CZV A;  3JXS A;  4DXR A;  1JYV A;  1SDD B;  4XUN A;  1F4A A;  3WNN A;  3C7O A;  3EYP A;  4OUE A;  2C4X A;  3ACG A;  1OF4 A;  5JXJ A;  2E33 A;  3OG2 A;  3OGR A;  3WNL A;  3WF0 A;  3DYP A;  3I2K A;  3VD5 A;  1GOG A;  2W92 A;  1NKG A;  2Y6L A;  4MAD A;  1W9S A;  2QQO A;  2W5F A;  4A3Z A;  4OZO A;  2Y64 A;  4QDQ A;  3A22 A;  1EUU A;  5DQ0 A;  2ID4 A;  1P8J A;  1CZS A;  4RYD A;  3VDB A;  2JD9 A;  2DCJ A;  2J1R A;  3T0B A;  2LW8 A;  3A23 A;  2WAB A;  2XHN A;  1ULP A;  3PUH A;  5CYY A;  3MUZ 1;  2VZR A;  5HPO A;  2W1W A;  3CKH A;  2VCA A;  4AG4 A;  3GXU A;  5I0D A;  4OMC A;  2ZEX A;  1PX4 A;  2VZP A;  4Z2A A;  1NUK A;  2VZ1 A;  4AAX A;  4XUQ A;  1GQP A;  3SEE A;  4OMD A;  2W3J A;  3C7G A;  3HNM A;  3NJV A;  1W99 A;  4XUR A;  2BZD A;  2Z4F A;  1JZ3 A;  3SEP A;  2VQU A;  1O8P A;  5DN2 A;  1UYY A;  4MGS A;  3WNO A;  3ACF A;  2W46 A;  4JKL A;  3THD A;  2XOM A;  2CDP A;  4KI5 M;  1PMJ X;  3UNP A;  1JZ5 A;  3LQC A;  1JYX A;  5EIY B;  3I2I A;  4JKK A;  2VZV A;  3WQB A;  1W9T A;  2VZO A;  2WO2 A;  2EIC A;  5JXI A;  1OH4 A;  5JR2 A;  2BER A;  3WEZ A;  2CDO A;  3T09 A;  3VD9 A;  1UY0 A;  1DYO A;  3OGV A;  1ULO A;  2YFZ A;  1UY1 A;  1L7R A;  2WO1 A;  2ZXQ A;  3T2Q A;  3U37 A;  1I5P A;  4ARX A;  4GWI A;  4CU9 A;  1LNS A;  1MPX A;  1R64 A;  2EIE A;  5EJ1 B;  2V72 A;  4IUG A;  2WDB A;  4JX0 A;  3VD7 A;  4D8M A;  3WNM A;  1K42 A;  5JMO A;  1OF3 A;  4W4Z A;  1US2 A;  3NQH A;  3C7E A;  3K46 A;  4E8D A;  1WKY A;  2ZEW A;  2W1S A;  4CUB A;  2HYX A;  4MOA A;  1YQ2 A;  4CVU A;  2VZU A;  2L9L A;  1JU3 A;  2WYS A;  3K75 B;  4QB6 A;  3HNB M;  4PT6 A;  2QQM A;  2ORZ A;  2YB7 A;  1XC6 A;  3K4A A;  4ARY A;  1JI6 A;  4MO3 M;  4A44 A;  1JZ8 A;  2WN2 A;  1UYX A;  2C9K A;  1W0N A;  5G05 L;  3I2H A;  3WNP A;  2QBX A;  1NAE A;  3F2Z A;  1D7P M;  1UXX X;  4XZU G;  1JYN A;  2XQX A;  3W5M A;  3GDB A;  4A4A A;  2BGP A;  4CUC A;  1UMI A;  3LEK A;  4DXS A;  4A6O A;  2J1U A;  2OKX A;  3EB7 A;  3WNK A;  3HNY M;  1UWW A;  1TG7 A;  1JHJ A;  3FHQ A;  4W8J A;  1GMM A;  1UYZ A;  2VZT A;  1K45 A;  3CDZ B;  3WSO A;  1GUI A;  1NX9 A;  2QQI A;  3NNG A;  2W91 A;  1UZ0 A;  5IYY A;  3OBA A;  2VTF A;  4LKS A;  2RV9 A;  4QX3 A;  3IAP A;  3C8X A;  4M4R A;  5C7G A;  2J1A A;  2PQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...