4XZUG

Crystal structure of the human factor viii c2 domain in complex with murine 3e6 inhibitory antibody
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
154
structure length
154
Chain Sequence
CSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3E6 antibody Fab heavy chain
publication title Structure of the Human Factor VIII C2 Domain in Complex with the 3E6 Inhibitory Antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 154
sequence length 154
chains with identical sequence M
ec nomenclature
pdb deposition date 2015-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4xzuG00
3C7OA 3CMGA 4GZ9A 3VD5A 2C26A 2VCBA 3T2PA 2VZ1A 4JKMA 4BJ0A 5A1AA 4ARXA 4CVUA 2VZOA 1O59A 4JKKA 2WN3A 4DEVA 2YFUA 1ULOA 5JMOA 2DDUA 2W47A 2VC9A 2WQ8A 5DN2A 3VDBA 1K12A 4YPJA 2VZ3A 5JXJA 1JYWA 2RV9A 5DMYA 1D7PM 3LPFA 4ET7A 3T08A 3IAQA 4PF1A 1W8NA 3HN3A 3HOBA 2VR4A 4HG6B 2X09A 1XNTA 2YB7A 2J1SA 4CU7A 2J1VA 2W1WA 2ZEYA 1TG7A 3OB8A 3K4DA 2W1QA 3I2HA 1K42A 3AC0A 3LEGA 4MGSA 1BHGA 2VMCA 3LE0A 3SEPA 3C8XA 1OF3A 4D0QA 2QQLA 1OD3A 3LQCA 3CQOA 1MPXA 4QB6A 4UOJA 1UX7A 1UXZA 3FL7A 2BZDA 4BDVB 3BN6A 5DPNA 2XQXA 3I2JA 1GQPA 2VMEA 2LW8A 2BGOA 2CDOA 3F2ZA 4E8CA 3NJVA 3K77A 4ZY9A 1UWWA 4QPWA 4DXSA 3LEIA 3NJXA 5IFTA 4XUNA 4KMQA 2VM9A 2Y6KA 4ZZ8A 5IJRA 3CKHA 2J1RA 2VMDA 3OEAA 5CZKA 4A3ZA 2C4XA 1SHWB 2DCKA 2VZRA 2W95A 1UMHA 3MUY1 1SDDB 3I2GA 2VZUA 3ACIA 2Y6LA 3MO4A 3HNBM 1WKYA 2ZEXA 2DCJA 2E32A 2Y6GA 5LCWL 3I2IA 1UY4A 1NUKA 2Y6HA 1W9WA 4AG4A 3K75B 2QQOA 2V72A 1JHJA 2J22A 1GMMA 4A4AA 2W94A 5G05L 1CZVA 4UI9L 1O8SA 3K46A 3WNKA 4BXSV 3VD7A 2B9VA 2BERA 2XOMA 2X05A 3UNPA 1UYYA 1UXXX 2W3JA 2W5FA 1CZTA 2JKXA 3WNPA 3JXSA 3BGAA 3WNLA 2VMFA 4L0PA 4M4PA 3HNYM 1YQ2A 3SKVA 4W50A 3D3AA 1GOHA 2WZEA 1OF4A 3VDCA 3THDA 3T2OA 2V5DA 2HYXA 1WCQA 1H6XA 4GWIA 1H6YA 3VD9A 4BK4A 4ZXEA 2VTFA 3VD4A 4CUCA 2WABA 3UETA 1P8JA 4QAWA 4BK5A 2VL4A 3HEIA 2VZQA 2ZXQA 3HJRA 2Y64A 1UY3A 4LPLA 4LQRA 3OEBA 2B4KA 3GDBA 3T0DA 4Z2AA 3CZUA 1L7QA 3WF1A 2W46A 3OBAA 3HPNA 5G04L 4A42A 3I3BA 3WNMA 3WF2A 1J83A 2CDPA 3MUZ1 5JXGA 2WZ8A 5JR2A 2W1UA 3I2KA 4TTGA 3FHQA 3IAPA 4DUVA 1GOFA 4JHZA 4MOAA 2W92A 2WUHA 1W99A 2EIEA 3WSOA 1GUIA 1OH4A 4QX2A 3NQHA 2J1UA 2VCAA 3DECA 4FI9A 3LEKA 1XC6A 1OT5A 1J84A 5JXIA 4JKLA 2YFZA 3WNNA 2WN2A 3SKJE 4D8MA 4MO3M 1XNAA 3NNGA 3U37A 3A23A 4DXRA 5LA1A 3ETPA 3EB7A 4OUEA 1JU3A 1DYOA 1HN1A 4XUQA 3A7QA 4KI5M 4M4RA 2VZPA 1NX9A 3J7HA 2VQUA 2ID4A 1UY0A 4QB2A 1JYXA 1GOGA 2VZSA 4XZUG 2J1EA 5C70A 3SEEA 1SG3A 3WNOA 5IHRA 5LA0A 5C7GA 1CIYA 1IQDC 2L9LA 2JE8A 2EIBA 3CIHA 2WDBA 3T0BA 1EUTA 3EYPA 1UY1A 3ACHA 4W8JA 5I0DA 4PT6A 1ULPA 1PMHX 3ECQA 3A21A 1KEXA 5B4NA 3ABZA 4IUGA 4CU9A 2VJXA 3I97A 1W8OA 3FHAA 5LA2A 1US3A 4XUOA 2VZVA 4CUAA 3MV01 1UY2A 3C7FA 5JXHA 1JYNA 5FUIA 4E8DA 3K4AA 3T2QA 4DEQA 4XVHA 4GWJA 5F7UA 2YC4A 3ACGA 3E1F1 4OMDA 3C7EA 2VO5A 1XPWA 1JZ2A 3HNMA 5B4XA 4ZZ5A 1TVGA 1JZ5A 2W1SA 3C7GA 1LNSA 5DQ0A 4DUXA 3A22A 1KGYA 4QX3A 4TXWA 2QQKA 2J7MA 2ORXA 2OKXA 3WF3A 2WAAA 3T09A 3WQBA 3PUHA 3IDAA 1DP0A 4XURA 1RYYA 2V4VA 4A6OA 4AAXA 2WBKA 3GM8A 2VQTA 3I3DA 5HXMA 4OMCA 2ZEWA 2WYSA 2R7EB 2E33A 5EIYB 1GNYA 1EUUA 1PX3A 1UYXA 1T2XA 4A41A 2Y8KA 3THCA 2W87A 2ZEZA 3MBWA 4DXTA 4RYDA 3W5NA 2QQNA 3P1IA 4P08A 4OZOA 3I2FA 2XHNA 3UESA 2YC2A 3GGLA 5CYYA 2BBAA 1JU4A 4P00B 3VDAA 3FN9A 1CX1A 3VD3A 3ACFA 1GU3A 4JX0A 3C7HA 2JDAA 2EICA 4LHSA 1UZ0A 5EJZB 2EIDA 4MGQA 1JZ3A 1K45A 5EJ1B 1JYVA 2Y6JA 4QDQA 2X10A 4QB1A 3K4ZA 3W5MA 4LKSA 4W4ZA 2QQMA 1DLCA 4MADA 4QDRA 2W91A 4CU6A 3DYMA 1O8PA 2RJ2A 2VCCA 2QQIA 1US2A 1UMIA 4XUPA 3IIIA 2XONA 3DYOA 2VOTA 4UAPA 4A44A 3WF0A 2E26A 4CU8A 2C9KA 4QX1A 1JI6A 4P5YA 1JZ4A 4OYUA 1CZSA 3WEZA 2WO3A 1JZ8A 3DYPA 4CUBA 1R64A 4RN5A 3WF4A 3OGSA 4P02B 3NRUA 4QX0A 1JZ7A 4QDSA 1PX4A 3CDZB 1F4AA 2WO2A 5IYYA 1L7RA 2WO1A 3ZM8A 2Z4FA 3CZJA 4XUTA 2KD7A 3P6BA 3PUIA 3OGRA 1I5PA 1NKGA 5IFPA 3MV11 2E31A 1PMJX 5C71A 3T0AA 2ORZA 1F4HA 2W9XA 1NAEA 1UYZA 3IB3A 1JZ6A 1W0NA 2VZTA 1W9SA 2WAOA 5J1XA 5HPOA 2PQSA 3I3EA 4KWUA 2HLEA 2LS6A 4PQQA 1W9TA 5JUVA 3LPGA 2QBXA 1K3IA 2BGPA 2J1TA 2RVAA 4DUWA 3GXUA 4A45A 2YG0A 3OG2A 2QQJA 2J1AA 3OGVA 4ARYA 2JD9A
chains in the Genus database with same CATH superfamily
4QKFA 3AVRA 4GZ9A 2HWC2 2XKOA 1SCSA 2VZ1A 1W6NB 1PVC2 3AKPA 3ASIA 3IPVB 5DZFA 5EHDA 1QJX3 3WV6A 5LEKA 5FWJA 1NE4A 5A1AA 3AKSA 4WBBA 4DNYA 4XOGA 4UBGA 1O59A 3I4IA 1G9FA 4WM8C 1JH5A 3AP4A 2ADEA 2JG9A 3EJKA 1YQ8A 2R062 2W39A 3RRDA 2VC9A 2WQ8A 4IE6A 3H50A 4XQDA 2WS93 1K12A 1W2AX 1F8VA 4Z82A 2GNDA 2VZ3A 1W3VA 3VBOA 4LORA 4YARA 1ND2A 2Y33A 1FOD1 4Z1VA 1VBB3 1ZM1A 1N1VA 5H9QA 4ET7A 3HQXA 2RS13 5KHHA 2CV6A 2R32A 2R6QA 2WRAA 4XJUA 3HN3A 5FQ0A 2VR4A 4HG6B 4LKDA 5IK7A 2GN7A 1ULGA 4CU7A 5FO9B 3OOXA 1RJ7A 3NAPA 3VL9A 3HQUA 3M70A 4GH4A 3ZYJB 2XJVA 3P5BA 4UFKA 2XPJA 1WLTA 4QPGC 3CU7A 1UYPA 2G19A 4EZ4A 1Q8QA 2VE1A 1RHI2 5A32A 3TEYA 2ZS6B 3ZMNA 5J7MA 3O1TA 1RMU2 1K42A 1D4VB 2VMCA 5F3CA 3VBFA 3LE0A 3VDDC 3U4XA 4OHWA 3C8XA 4D0QA 4YYOA 2WNUC 3ZLIA 4AVCA 2ZX3A 1DLLA 3CQOA 1XBFA 3UL2A 4QB6A 5IW0A 4XXAA 5JOZA 4UOJA 2QKDA 2PFWA 1U5ZA 1UX7A 1UXZA 4O9GA 4BDVB 4CTEA 2JB8A 2VMIA 3Q8CA 1R081 1OD5A 2H6CA 2CYFA 1HJGA 2RM23 3NNMA 3CNAA 1CAUB 5FY7A 1QIQA 4YLZA 1GQPA 2VMEA 4URTA 2CDOA 4EN8B 1S2BA 4E8CA 3K77A 4K7JA 4HPKB 4LKFA 5FZCA 2E51A 2HEVF 4JRAA 5B2GB 4QPWA 2ATFA 5FLHA 3LEIA 3NJXA 4DXSA 2EXKA 4XUNA 2Y6FA 4AEDB 5JLVA 2Y6KA 3POWA 2J1RA 2RDQA 2VMDA 5CZKA 1H9PA 2W95A 5T5LA 4NVPA 4JTOA 5FZ6A 1DU3D 2QTWB 1UCXA 2TNFA 1ENXA 1PK6B 1OOPB 1YYNA 2WT0A 3I2GA 4EE2A 1J58A 1HQNA 1O5LA 4QM9A 4E27A 1YI7A 4N53A 3HNBM 1KFXL 3U1XA 2D3RA 1HW5A 2CY6A 5C8WA 3T4HB 1YC61 1W6MA 2Y6GA 1VBC1 1ZREA 2R1DA 1LOEA 5F6LB 3WX5A 3JD72 4GAZA 1D2QA 1OHFA 1VBA2 4JDOA 3NWKA 4YVWC 4AGVA 2PXJA 1JHJA 1W8FA 2W94A 2YU1A 4IETA 4P9XA 4HONA 1YRZA 4UI9L 3K46A 5A3UA 2GMMA 3AMMA 4C1WA 4LO8A 1C1FA 1W8HA 4YVSC 2B9VA 3RNSA 1HQWA 1QXPA 4A2UA 1UYYA 2VVDA 1HB2A 2W3JA 5K0UB 2W5FA 5C5UA 4BQWA 2OPWA 3BGAA 2VMFA 5FP9A 4DQAA 2CNAA 4CDWC 1WD4A 4OLLA 1LHNA 1AL21 1BK1A 2XG3A 3H1MA 4ATFA 4BLJA 1MEC2 4ES8A 1W6QA 3BIWE 5BNPA 1GNZA 3WQ1A 1QJU3 2XBO2 4FOQA 2HYXA 2WZPP 1H6XA 4GWIA 2RS31 5CG9A 4FO9A 1H6YA 3VD9A 2CAVA 3H8RA 5FDBA 4RS5B 1V6IA 4K21A 1ENSA 2Z69A 3DCQA 3AZVA 4ZXEA 3VBOB 3VKOA 1RVF3 2WABA 3ES4A 1ND2B 1AR81 2ZX4A 4QX8A 3S0MA 4XDOA 1JOPA 1DQ4A 2RS53 2VZQA 2JG8A 2H0VA 2WFF1 4MUVA 5FQ0B 4Y1XA 1H2KA 2DTYA 2B4KA 2YROA 2VMHA 3AMHA 3GDBA 4GWNA 2ZCWA 4XW3A 4CCLA 4HLTA 3CZUA 1L7QA 1KXGA 2KA3A 4UXAA 1MS8A 5T5PA 3U4SA 1SLTA 4Q4Y2 5E1RA 5IAVA 4ASMB 3CO2A 4CCCA 3PMSA 1ZZBA 1F2NA 1LULA 2DCZA 4BIOA 2CDPA 3H8XA 1KQRA 5DDJ2 2ZHMA 4F7ZA 4HKOA 2ZA9A 2BNNA 4FXGB 3B94A 4OULA 5SV8A 2JDMA 4V2WA 1F5JA 2NYYA 4DUVA 4I02A 5BY5A 3WLUA 3RZJA 3WDVA 4XF0A 2JDZA 1WZXA 1UPIA 4IV3A 3FUQA 5DUWA 2VG9A 4YW7A 3UGHA 2DVGA 4L2NA 1DYPA 4LBJA 1W99A 4AI0A 1PIV2 2WNVA 2PLV1 1GUIA 5AC91 3RI8A 2C9AA 3NJZA 1LKNA 2ZMLA 5CU1A 1NY72 3PJQA 4Y1ZA 4NMIA 3J9SA 4QQHA 2SLIA 4LA3A 5FZDA 1GWKA 4FI9A 1WA4A 1OT5A 5KHKA 2YFZA 2WN2A 4UT5A 4Q0SA 5EZWA 2WA3A 3SKJE 4XIOA 4MO3M 1OA2A 2VTXA 3NNGA 4OHVA 1OUXA 4D7SA 1UOFA 1CX4A 2WKKA 3AMQA 3E6DA 5FXZA 1DYOA 5JI9A 1QF3A 3P3NA 4AFBA 4MYEA 4D94A 1IPKA 3DPRA 2Q8OA 3VB9A 3RZHA 1W90A 4KI5M 3GZUC 5GLZA 4UFIA 3IMMA 1PVC3 5CKMA 1DZQA 5C8CC 1ZA7A 2RDNA 1F5FA 5FYIA 2ID4A 1QY4A 1UY0A 4YZ2A 1PHMA 1K5MA 3POBA 4Y33A 5JI7A 5LY2A 5DAPA 3AKQA 3WDWA 4XE9A 2J1EA 5C70A 4NPMA 1H30A 4OQ8A 1SG3A 2BV4A 5IHRA 2BP6A 3VDCA 3OPWA 5C7GA 4Y4RA 1I6XA 3BPSA 1J1TA 1KFUL 2N7GA 4AL9A 4CCKA 1RUH1 2A6ZA 3DL3A 4M3CA 1BLZA 5D2AA 2A73B 4AEKA 3I3MA 3S7EA 4YM0A 4ASKA 5AFEA 3EHKA 1LRHA 5M0TA 2YV8A 1AVBA 1UY1A 3EYPA 2UY8A 4AGGA 5F32A 3S57A 2YBKA 3NMBA 1POQA 3J7NA 4ISQA 4ORFA 1OMIA 1RUD2 5A6QA 2JICA 3R4UA 4TYSA 4XEZA 5A6YA 2H6BA 2QUOA 3VZNA 3ZXGA 3VBSA 4IUGA 1KRIA 1W05A 4YW3A 2VBPA 1JYCA 5FY0A 2NM1A 1R1A1 1US3A 1GR3A 2TUNA 4JGYA 3CL1A 3HT2A 1DQ6A 1POV0 1ZRIA 4XUOA 3AP7A 2OQ6A 3ORJA 4WM7C 3POIA 3ZPOA 4MXWB 2VVFA 2Q30A 1O5UA 5FUIA 4GMP0 4S2HA 4QD2A 4RQPC 2FD8A 2BU9A 4BMEA 2HWF2 4Q4V2 3W59A 5DAXA 5KHIA 3RZMA 4I0AA 1QHDA 4LIVA 1WCUA 2PHLA 4NWWA 3O0VA 2RS33 1ZBE1 1R091 5JOWA 2WIIB 4OMDA 3C7EA 4LIUA 4CXWA 1LOBA 5DZEA 3TNPB 5KR7A 1A8MA 2AENA 5L9BA 2MEV1 5GZCA 5IUQA 3O7OA 3ZSMA 3AYEA 1JZ5A 5FZLA 1UU5A 2Q1MA 1Q8OA 1UZWA 1ZBA1 4XXPA 2EALA 4V2VA 3RG0A 4AI1A 4D6RA 3PUAA 5DQ0A 3H3LA 2WFF3 4BMBA 4FAGA 4WVMA 4OI0A 4MHRA 2WINB 4Y20B 1KGYA 4QX3A 3N7KA 4O9EA 1L3JA 3WG1A 3AYDA 4IE5A 4EN7B 4PDWA 4PIZA 1MVEA 2OS2A 2QQKA 5JSOA 2J7MA 2GDFA 4QKDA 2CWMA 2ORXA 2WWUA 3AXDA 3TAYA 3RSJA 4HVOA 3H7JA 4YFZA 3ST7A 2R042 2X53S 2WQ4A 4LK6A 1VJ2A 3PUHA 2XLFA 3JBG2 3OCPA 2XWJB 2F4PA 1ZYBA 4LEJA 1A78A 1PGL2 2XVKA 2WBKA 1C8M1 3O0WA 2GMEA 4E2GA 1PGW1 4NRMA 1YCIA 4HL0A 3J8F1 2HWD1 4Y5Z0 1RUC1 1SFNA 1WMEA 5ABJA 3USUA 2AACA 4MLOA 3JD73 2RMU3 3N9NA 5IVBA 1W6OA 1VBA3 2E7AA 2WYSA 1Q8VA 4XJAA 4AFMA 4XF1A 4Q4X1 4QXCA 2CGNA 4QM8A 1QWRA 5EIYB 3BVCA 4HFSA 4BQXA 1PX3A 3LA7A 4NAMA 1T2XA 1DGWA 4RSUA 4A41A 4B7KA 4FTEA 4XBLA 3THCA 3MBWA 2FMDA 4Q4W1 5F5CA 1LODA 4IEOA 1J59A 1RUE3 1U0AA 1CGPA 4FT8A 2QQNA 3P1IA 3NKGA 4H2AA 3NL1A 4IV1A 3DPRB 3KCXA 3NNFA 3ZR6A 1DHKB 3TEZA 1M4WA 5FY9A 3UESA 1SDWA 1E5IA 4YW1A 1LHVA 5CAZA 1GP6A 1PM7A 3BCWA 1VRH1 3FFQA 3OY8A 3WHUA 2BBAA 2VCMA 3MGUA 4P00B 3VDAA 3Q8FA 3ACFA 2BPA2 5EFUA 3UK9A 5H9PA 2XBO3 1FX5A 3BOWA 3ES1A 2DUPA 2BFUS 4LHSA 4QPIB 4E4HA 2W2IA 5CG8A 3C3VA 4UBHA 1DZTA 2Y26A 1WMXA 1MS9A 3AMNA 5CFDB 2R16A 1AX1A 4XTPA 3B00A 2WC2A 4PF5A 3D4KA 4QGNA 1CIWA 1C28A 4S2DA 3JQWA 3VHRA 2P4EA 2NP0A 3MW4A 1HDKA 1OQ1A 2ZGUA 3AKRA 5FPBA 3K4ZA 4HZFA 1IKQA 4L9BA 5F3GA 4AHWA 4YG6A 2WSVA 1KS5A 3GALA 5FK7A 3WT3A 2EAAA 4A7YA 4XTMA 2ZGTA 2ZZQA 1S0GA 3B5LB 5DAQA 3J4UH 2AUYA 2YGLA 3JB8A 4L92A 4QDRA 3TB0A 2JDHA 4UW4A 4DMIA 4L99A 5A3WA 3GJBA 1O8PA 4YZ5A 3QBQA 4Q4Y3 1YIFA 4WVZA 2VCCA 1V9U2 4JGYB 4XUPA 1UMIA 4N43C 2WL1A 2ET7A 3ZFGA 5FZ8A 1POV3 2XONA 4BQ2A 1HRI1 1EAH2 5ANNA 3AKTA 3B93A 3RZZA 4A44A 4CE8A 4DOUA 1ULEA 4CDXC 4GMP3 4XC9A 4CZSA 3H3UA 4KG8A 2X5IC 3G7DA 3ITQA 3LDBA 3ZSLA 1ZRCA 1CZSA 4XF9A 1A34A 1LEMA 1XE7A 3M1HA 2I2SA 4MSVA 2EXJA 3DYPA 3RWNA 1OI6A 4JQTA 4CUBA 4DY3A 3OF1A 3INAA 4RN5A 4AFDA 3WR0A 1XE8A 4RR3C 1NLQA 2KR2A 1W0PA 4QX0A 1PIV3 3RI9A 2VBBA 4QDSA 5EYXA 1GQHA 3CDZB 5IATA 1PO12 1PO22 2ZX2A 1RUNA 1NZCA 3EXUA 3ZYIB 5F8PA 1F31A 2BNMA 3S6PA 1WWYA 2JECA 1L7RA 1RUJ1 4JDMA 4BQ4A 3ZM8A 2Z4FA 4WVMB 1H1IA 4XUTA 4GA9A 3ZFEB 3LOBA 3IZOA 4IQPA 1I5PA 5CISA 1I3HA 5T55A 1AR73 3JQXA 3OPZA 4H3WA 1FYUA 2MEV3 2W9XA 4KU7A 1RUI1 1NAEA 1JZ6A 5T3NA 3SH5A 5C9AB 3Q8AA 5FZOA 1HXS1 5H9RA 2OW4A 1XNKA 4FSJA 4HT1T 2PAMA 3I3EA 4KWUA 5FRAA 5L7OA 5LBCA 4FFFA 2OUHA 3D6EA 4PQQA 4IL7A 5ABJB 3USUB 1GKBA 3TBDA 4F83A 3LFMA 4FVVA 5JUVA 4FTSA 1EP0A 1LTEA 1W6OB 4QPGA 4FCAA 5IVFA 2J1TA 1NQDA 1FNZA 3NO8A 1W6PB 4DB5A 2HWE3 2JIJA 1TME2 2A1XA 2YG0A 4FPEA 4EV0A 2JD9A 1FPN1 3AL6A 1QJZA 1W3XA 2IFWA 1ZZ8A 1CAXA 2O14A 2WNUA 4ATEA 1WBLA 3C7OA 5IVEA 4IV1B 3ZXKA 2AH2A 2PAEA 3FFZA 5BXXA 3IT8A 2CU5A 4JQRA 1GZTA 4Q26A 3M4FA 1GZ9A 1MZ6A 3LKJA 5JIAA 1QJX1 2D7FA 1QQP3 4NJ4A 4P14A 4QGMA 5DUXA 4EWDA 1AR91 1VBE2 4LBQA 3SH4A 3V0BB 3I2DA 3PMEA 1RUD3 1S0BA 1LESA 4QWNA 1AL0G 5IK5A 2F6BA 3V65A 5BNNC 3VDBA 5JXJA 2WS91 1HIXA 1HLCA 4FFIA 4MX3A 1D7PM 3H1WA 5FUPA 2E7TA 2K0GA 5FPAA 1H9WA 4PF1A 1W8NA 2RS11 4XMAA 3PUSA 4C0BA 3HOBA 4Q4V3 3I7DA 4X8PA 5GZEA 5FZAA 5GLUA 5JVVA 2YB7A 5J37A 1MS1A 2J1SA 3ZDVA 3KLSA 1OA4A 4IW3A 5FOBB 2AC1A 4RHV2 5LATA 1MZ5A 3S7IA 1AZDA 2ARCA 3LD8A 4GJYA 3OB8A 1LOFA 3K4DA 1ZZ9A 4AZZA 3ZFGB 4PI0A 4FOWA 4C8DA 1HRV1 5L19A 2VXJA 1JW6A 4JCKA 4META 2ZTNA 1SLIA 3BODA 1AR62 1STMA 1TMF2 2QQLA 2I74A 3RYKA 1MPXA 3ZPYA 5C9AA 1JHNA 1DQ1A 1QXJA 1OVPA 5DPNA 1CJDA 3BU7A 4CDWA 4AFCA 3TEWA 2DU0A 4OHYA 1GP5A 2A3XA 3M3CA 4QXHA 5LRRA 2LW8A 2RM21 4NR1A 2WZR1 1GV9A 3OUIA 5C33A 3ZYGA 4D69A 3O1PA 4CXXA 3MPPG 3UGFA 3OUHA 5IFTA 3Q8BA 1N1TA 2VM9A 1XSQA 3GZEA 4F8AA 4ZZ8A 4IGQA 3CKHA 3OEAA 2NLRA 4A3ZA 3RVHA 1X33A 2QQPA 3GCXA 4XQ4A 3EO6A 2KM2A 3MZHA 4I0BA 2JDPA 4P9YA 3AK0A 3KV9A 3ACIA 3KWVA 4LLFA 5FZ3A 5LY1A 5FZ1A 4UWDA 2ZBJA 1H2NA 1AF9A 5KWRA 1G9CA 1VB2A 1HKDA 1XYPA 1X9TA 2XJTA 1F9KA 4Q27A 4SBVA 2HKXA 5DG1A 2IVIB 5LCWL 5FY5A 4Q2FA 3OYWB 1RUJ3 2A6YA 2UYAA 1RITA 1NUKA 4MV2A 4OUSA 2A5ZA 4JGZB 5FZ9A 4NIIA 5FOJB 2JIGA 3K75B 2Q4SA 3JB4C 3IKWA 2RJLA 4LO4B 4AG4A 5D8AA 5FLIA 2DUOA 4RD7A 4YNIA 4IEWA 4MXVA 1JODA 3PHMA 4AVSA 4CDUC 2VECA 3N9OA 1B35C 2ZKLA 3WNKA 4BA6A 2JX9A 5D21A 4M0HA 5CADA 3OBTA 2X05A 5C5TA 1HXS3 4WVWA 3UNPA 4K3UA 4QGLA 1UXXX 1JMUB 3R4DB 1D4M3 5FCCA 1QDOA 1HN0A 3WNLA 1NA1B 5HV4A 1DG6A 3JCIA 4M4PA 3HNYM 4K8RB 3D3AA 4HK8A 1N3QA 1DQ5A 1NCQC 4AK3A 2ZGMA 1OF4A 2CHHA 1JOBA 1OLMA 1YNAA 3B9IA 2ARXA 3D0SA 3OJBA 4L11A 4LBQB 1LHUA 2ZMNA 1ST8A 1WCQA 1ODNA 1QJU1 2XVLA 4KH9A 1GNHA 1Y9MA 1YO8A 3UYJA 4CA9A 4K1YA 3DKWA 1HQLA 1Q8SA 1ND3B 5DAWA 1VAMA 5A7NA 4QQLA 4RGGA 1T6GC 3IIAA 5IVYA 3ZFFB 2RR12 1IOAA 3POEA 1P8JA 1D2SA 1RUG2 1V9U3 2OUJA 1RVF1 1UU6A 2C1FA 2C5DA 3LA3A 4IEYA 4QAWA 2VL4A 3FX3A 5C4WB 1AR93 4QX5A 3AX4A 1BEV3 2RS51 4KGGA 2Y64A 5FMDA 4Y1UA 3BTZA 4LQRA 4AGRA 2QZ2A 2AEYA 3QCWA 4TLGA 4CP1A 1DZRA 5FYMA 4Z2AA 4AR2A 5FWEA 4N9IA 3THTA 2HWB2 5C8CA 4Q0UA 2ARBA 1HB3A 5G04L 3VBRC 4A42A 3CBNA 2A70A 3F95A 3HWJA 3U14A 1TZOA 3WF2A 3WNMA 3BALA 2D40A 1VMFA 1I9RA 5KC5A 2WZ8A 5FZGA 4LBLA 5JR2A 2YUEA 1RIRA 4LITA 5AVAA 4KNCA 5HXVA 2D3PA 4FPLA 3WUDA 3H42B 4CEYC 1Z7S2 1EV12 3VBUC 4TTGA 1RXFA 1CESA 4IEZA 4K1ZA 1GOFA 4XACA 1AX2A 1UU4A 1OURA 2WYFA 2Z2SB 2Z5WA 4P9GA 3WUCA 2X29A 2UY9A 4JHZA 4AQ6A 4F3JA 4MOAA 3AM2A 1PGSA 2DFCA 2W92A 5KHGA 1RTVA 2A71A 2R49A 3ILRA 1WLWA 2ZKNA 1VBC2 2EIEA 4ZHNA 1HRV3 4QX2A 1QU0A 1W8TA 1DQ2A 1QOTA 5CFCC 5FY8A 2BYVE 1MS4A 1XOYA 4LBQD 1C1LA 3DECA 1BBT1 4IERA 3LEKA 3RYRA 5I91A 1D0GA 1J84A 2GNMA 2Y0IA 5FR3A 4JKLA 1C5HA 3WNNA 3EMRA 1IGOA 3KZ4C 4CP9B 1SQ4A 1ONAA 4NHKA 1OKQA 5FKCA 3ZXFA 4A6OA 2P37A 2AREA 2F4LA 2VOXA 3TN93 1LAJA 3R4SA 4DXRA 3DEMA 3L2HA 3ETPA 3GNEA 5LW9A 2WZR3 4FBFA 1G9BA 1JU3A 3SCFA 5BNOC 4YGDA 1QJY2 3QH6A 1H8TB 3WNXA 3M3IA 4AI3A 4UF0A 2XKPA 5FP8A 4AVTA 3VV1A 5FFOC 2VZPA 5CA6A 1XXNA 1NX9A 1PVC1 1AUYA 5D8AB 1E5SA 1PNFA 2XJPA 3APBA 3PVEA 4M3CE 2A6WA 4LHNA 3WD5A 2FDHA 1IQAA 2VZSA 4XZUG 1VBE3 4IEPA 3BPZA 1ENQA 1WLDA 1UZVA 3O1VA 5LA0A 2G9ZA 5TSWA 4Z07A 1IQDC 2JE8A 3NV1A 2P1BA 5GM0A 3PVOA 3ETQA 4HKWA 5JWPA 4OHXA 2WDBA 4LXLA 2YZ4A 3T0BA 2C24A 1ASJ2 3CJIA 3I3QA 2OQ7A 3O1SA 2NMOA 4PT6A 1ULPA 3UJQA 3N7MA 2LTNA 2EVXA 4HSLA 1NYWA 3U10A 4AWDA 3ECQA 1COV2 3A21A 3VKMA 4FPOB 2ZX1A 4QX7A 3FLTA 3SCHA 1XNBA 4E4ZA 3ZXDA 4QHBA 2VJXA 3I97A 3POYA 4OI2A 1BXHA 1RB8G 1AYN2 2B7YA 4LO6B 4SLIA 3MIHA 1ALYA 3C7FA 4Q29A 1ODMA 2R0FA 1S2EA 5HI0A 3K4AA 1RHI1 1WBFA 3T2QA 3VL8A 1AR63 4DEQA 1O4TA 3DN7A 4XVHA 4GWJA 4HK9A 1N1SA 1MVQA 1UL9A 3CLPA 1RUF2 1GLHA 1V6OA 2JG9B 3VKNA 4CDQA 5J3UA 2PLV2 3AZWA 2P17A 2VULA 2BQPA 1C8NA 3MICA 3M8LA 4COUA 2NPIA 3E5QA 3LIGA 3C7GA 3M7AA 2WSUA 3R6SA 1YWKA 4YWAA 2C0ZA 4R4ZA 1LNSA 2D44A 3U07A 2DYCA 1X8MA 1RXGA 3A22A 2Q8EA 1UX6A 4GXLA 4IEQA 3ZIXA 1OA3A 1DGRN 4QXBA 4I2OA 5FYSA 3MHZA 4XBQA 4AE2A 4Q0PA 4AQSA 3MLJA 3FMGA 4CP0A 5FREA 1ZX5A 5FP3A 4GQ7A 3NAPB 3VBHA 4GH4B 4XZPA 3WQBA 1G86A 3J7MA 4AI2A 5FPXA 2GU9A 4E4DX 4AQ2A 2R073 2ZABA 2ZHNA 4XJ8A 4FQZA 5A33A 5A32B 4AAXA 4HVQA 3GM8A 1LENA 5IVVA 2IUWA 3VBFB 1OXCA 3I3DA 4JRLA 5HXMA 2LALA 1V6KA 2VAUA 4FPCA 3N36A 3JD71 2RMU1 3WW4A 1BQPA 4QMAA 4N43A 1VBA1 2PELA 1W8ZA 4COVA 3SMHA 3H9AA 4KU8A 1G9AA 1DCSA 3NNLA 4PQ9A 4XFGA 1GNYA 1EUUA 3ZN4A 1RUH2 1UYXA 2VXRA 4AEDC 5JCTA 5A70A 3O12A 2W87A 2XVGA 1CONA 3KV5A 4MGIE 3PNAA 1SFPA 2DWRA 3NVCA 4XMIA 1RUE1 4UF0B 2SBAA 1BBT3 3AJZA 1PK6C 1OOPC 1VBD3 3PURA 3AZXA 1NE6A 4IE4A 2YC2A 2UYBA 1OQDA 3RDIA 2BOJA 5E16A 1Z78A 3GZTB 3IMNA 2FDFA 5T50A 4NIDA 2GAUA 4RR3A 4K40A 1O7FA 3VZOA 4LBOA 5I8TA 1UAIA 3VZMA 4LKEA 2ZGLA 2JDYA 1GU3A 4N8MA 3GZAA 5FZMA 3VD3A 3HAGA 4QQPA 1R1A2 2A3WA 4P9IA 5L9RA 1FMD2 3ZSJA 2XBO1 2LM3A 2BW8A 1S0DA 3VHNA 1QOSA 1AXKA 4N53B 1LECA 5FYYA 3HR9A 5LB6A 2EIDA 3PVBB 4LHLA 1XSRA 3BI3A 1JTZX 3AP6A 1W6MB 2HWC3 2RR13 3K51A 5DUUA 3RWKX 1RUG3 4LJHA 5EJ1B 1JYVA 2Y6JA 2X10A 3CJIB 4PCRA 1QXRA 1ZBE2 1R092 2GC3A 5K0UC 1YQCA 4LKSA 4W4ZA 4IDZA 3KVAA 3FE5A 1RGSA 5F2SA 1W9YA 1DLCA 1WGPA 2IFRA 4MADA 1WLCA 4QKBA 2R063 2DURA 3IWZA 4LMFA 2HWB3 2WO7A 4DY5A 3NKTA 4K6BA 3WW2A 3IN9A 4Q4Y1 4FPGA 2Q8CA 2VGDA 1QJFA 4G4FA 3DYOA 2GMPA 1POV1 1SLCA 1T6BX 3GBWA 1W2TA 2GZWA 4OI4A 5KC6A 2E26A 3KCYA 3V64A 4RS5C 5JZGB 4CU8A 4GMP1 3B69A 1IG3A 1DDLA 4X6QB 1CAVA 1W6QB 5DDJ1 5BNPB 1JZ4A 2PMWB 1NLSA 4OYUA 1Z7S3 1EV13 1ND2C 1Q56A 4DO0A 3BIEA 1S55A 3KGZA 1NCRA 5BNQA 1JZ8A 2Z79A 4CSWA 2DFBA 1MS3A 4LLOA 3OUJA 4CDQB 1OLQA 1S0CA 4W65A 4CPBA 1SBFA 4KG0A 1F35A 3KGLA 2ZOEB 4MHUA 5BUVA 3J8F2 1V6LA 2HWD2 2XL7A 3WY6A 1JZ7A 4Q0VA 3ZXAC 1F4AA 1RHI3 1PIV1 1RMU3 1UF2C 3E5XA 2D93A 5BNNA 1NY71 2JG8B 3CZJA 1OH3A 3Q8EA 1AYM2 3WP6A 3ZYBA 5CFDC 1V00A 2PHTA 2O1QA 3P6BA 4KGQA 3POGA 2O0OA 2IC1A 1YFXA 3OGRA 4NO4A 2XJRA 4RGAA 4E9KA 5F5AA 2ORZA 3VBHB 2DUQA 3UKVA 4XHBA 1AR71 1UYZA 3IB3A 3MLKA 2PA7A 1W9SA 3I59A 1KJRA 2WAOA 4JHTA 5J09A 2YBPA 2QE3A 2AGSA 1QJY3 2I07B 2PQSA 3MEPA 3M3QA 4IESA 2HLEA 1S0FA 3ZYPA 3O0XA 2QQVA 4FPFA 1W9TA 1UIKA 1U5YA 4KWKA 2QBXA 3H0OA 1K3IA 4XFFA 5JIUA 4D7YA 1IS6A 2PAKA 1O91A 2P5BA 5FXVA 4A45A 1GBGA 4B1LA 4YM1A 5A7QA 2YMZA 2HWE1 4IV3B 4ARYA 4M0NA 2P6HA 1XQNA 1XB9A 2BTVC 3MF6A 3WP4A 3RJRA 3N3HA 2WNVB 3AJYA 3VD5A 1AX0A 1RINA 2C26A 2DBNA 2VCBA 3DXTA 3FJSA 1H2LA 2FDIA 3H8OA 3PU3A 3GHNA 1GYKA 4Y1YA 1Q43A 2B9UA 3KMHA 3LDKA 4BWOA 1MR5A 2JE9A 2FHRA 3AFGA 4DIQA 3CEWA 4BJ0A 1OC1A 3IDEA 3H7YA 1ASJ3 1LOGA 1QQP1 4JKKA 2WN3A 3RQ0A 1JS9A 1Y9GA 1IHMA 4AVAA 1CAWA 1J3RA 4N7UA 4AI9A 5EPAA 1COV3 5D1IA 1RUD1 3KF3A 2GC2A 2DDUA 2W47A 4LTAA 4XAEA 4BH9A 3ZMOA 4S2FA 5IVCA 4UYBA 1G8WA 1Y9QA 1AYN3 1PNGA 4WV8A 4CYDA 1CN1A 2DU1A 4BQ3A 3PIJA 4URAA 5DMYA 5J36A 1APNA 3OGJA 1SBEA 3T08A 3W58A 4NHYA 5A3PA 4MGYE 1CR7A 1K5MB 1VAVA 1MEC3 1E5RA 2E53A 3EQEA 2X09A 1Y43B 2YDEA 1BK0A 2B39A 3KVBA 3HMYA 4FXKB 4ITCA 4M01A 2K2SA 4Q4V1 5CBLA 2W1WA 3QACA 1QH6A 1RUF3 2DBIA 1H2MA 1TG7A 3FLRA 4X8NA 2FMYA 5EP9A 3I2HA 4M3CB 1WW4A 3HBZA 3ZO0B 4M00A 3S30A 1S0IA 1IS5A 3LEGA 5E88A 3LEMA 4CDUA 4FTBA 5JSRA 4M3CF 1V6NA 2QJVA 3SEPA 2JDKA 1OF3A 5CVRA 1MQTA 4FOYA 3I54A 1J3PA 2P3KA 4EWAA 1LOCA 1WCDJ 2DV9A 3KB5A 1OD3A 4B29A 2ET1A 2VW1A 4NE9A 3W20A 1IS3A 2ETEA 1HV1A 2ENRA 3BN6A 3M3EA 1RUI2 5F9TA 1NCRB 3VBSB 1KD7A 2ZGOA 2ES3A 2XQXA 3I2JA 4PI2A 3NV4A 4FAHA 4MG2A 2BGOA 3F2ZA 3FWEA 3N9PA 3NJVA 1H0BA 1PVXA 5BV6A 4HKLA 1SLLA 2XB6C 3JBG1 1KJLA 1VR3A 3POJA 1G7YA 4DPNA 3UGGA 4KMQA 5DDJ3 3VHPA 1U12A 2XMLA 5I0SA 2C4XA 1SHWB 2V4AA 3N4MA 3A4UA 4CRQA 2PN5A 4Q5OA 1QEXA 1WW7A 2VNOA 3Q9OA 5CKQA 4UW3A 2VZUA 5A3LA 1LHOA 2Y6LA 5IK8A 5FZEA 5T5JA 3IDCB 3WDXA 2JEMA 1XE0A 2WJSA 2IZWA 3I59B 4N7IA 4K8FA 2VY0A 2ZEXA 4WM8A 4L97A 3WINE 1SEFA 3I2IA 4XHXA 4UFHA 2ZGQA 1FT9A 3U78A 1W9WA 5A3OA 5FY1A 3D8CA 3KHCA 2RJKA 2VU9A 1VE0A 1W2NA 2YXSA 1LHWA 1ZZCA 5A3NA 2J22A 2WQZC 5C3OA 2NQYA 4PDWB 3TOJA 3MIGA 3MIFA 4BXSV 2WS92 4TZDA 3WQ0A 4IGOA 1NT0A 1XNCA 2GN3A 2BERA 4XCBA 3LSDA 1FMD3 4NUBA 2FCUA 4XYXA 2QCSB 1OLME 4CEYA 3VBUA 5GJ6A 5I8YA 1RJ8A 1VBB2 2BWAA 4W6WA 1FAYA 1UIJA 3WNPA 4B8EA 4ZS3A 1D4M1 1PMIA 1S1AA 4L0PA 4ZU5A 3SKVA 1YQ2A 1PM4A 4MVTA 1MS0A 1V70A 4AEJA 2ZAHA 2FZ2A 4LK7A 2WZEA 5GLVA 1V6JA 5F39A 4E2SA 4CPBD 2CL2A 2NN8A 1YEWA 3DPRC 3N9MA 4UW6A 1J1LA 3E5UA 1CAWB 5CFCA 5IVJA 4N9HA 5FBZA 4BE3A 1LB2A 1BMV2 3G6JB 3LCPA 3VDDA 3N35A 5A6ZA 1UOJA 2BFUL 2XLAA 4BK4A 5A6XA 1ZVFA 1QNWA 4U2AA 3E6CC 2VTFA 3AVSA 1UPSA 3MI8A 3WDTA 3X29B 3BB6A 3VD4A 3UETA 1KDKA 4KBZA 1NQJA 1TQ5A 4YZ4A 1C5IA 1V9U1 1MS5A 3DKQA 3HJRA 2EF6A 2MHFA 4QPIC 4C0HA 1EAH1 4XILA 2TEPA 3OY8B 4D6SA 1UO9A 5A7SA 3ZKYA 4B3NA 5BNOA 3E97A 4BIFA 1BEV1 3GYDA 3OEBA 3BTXA 1LU2A 4JV4A 3T0DA 4LNVA 3BTYA 4XJ9A 3WF1A 4Z92B 1CVNA 3OBAA 1GZWA 4BQ1A 3FHIB 4H7LA 5GLWA 3HPNA 4COYA 3ZN6A 4LUMA 2BRTA 4Z2WA 2ERFA 3WHTA 3K3NA 1J83A 3MUZ1 3V56A 2D6MA 4XFBA 1BKZA 1UZYA 3ZSKA 1YFYA 2JJ6A 2GP3A 3URFA 3MYXA 1MQTB 2W1UA 1DGRA 1ZZ7A 3I8TA 4OHZA 1IZ3A 1PO21 3WCSA 1QDCA 2A3YA 1UQXA 3IAPA 4PLOA 5ACA2 2HWF3 4JGYC 2Z42A 4RA0A 3RGBA 5FZFA 3VKLA 1QOOA 2DVAA 1WD3A 2OXBA 3WOGA 2B5HA 4FFHA 4P9WA 4XQWA 1KITA 3D0JA 1HJFA 1VALA 1VIWB 2HBUA 3H3ZA 3S5QA 4CCDA 3T30A 3SLIA 4YVWA 3WSOA 2VOWA 1OH4A 3LF7A 3L9JT 3V0AA 2ZX0A 4EQVA 3IPVA 2J1UA 5FZ4A 4CP2A 2RE9A 2GH8A 1XC6A 4YVSA 1TNRA 5EV7A 5E8AA 4YG0A 3KF5A 3MW2A 5FZIA 3ROUA 4O65A 3WW3A 4NHLA 2XGXA 4D8MA 2JENA 1XNAA 4CCMA 1N3OA 3AZYA 3A23A 3TN91 4EYUA 1OLRA 3EB7A 4MGZE 4Y5TA 3ZFEC 3QH7A 5AFBA 1IPSA 2R043 2XUEA 4WM8B 3JBG3 3IDBB 5A7WA 4UFJA 1YQ6A 3WP5A 2OT7A 3TNQA 2VQ0A 4HVRA 4M4RA 2XHKA 2GSYA 1N3PA 3LWCA 4GB32 4I09A 1ULFA 4IEXA 5GALA 3LGRA 3THPA 3OSDA 3KQRA 3LDRA 3POSA 1GOGA 3PLQA 5LEJA 1SFYA 5IT6A 2Y0OA 3WXPA 1GICA 2FDGA 1YXWA 1IG0A 2DCYA 1VBE1 4QHZA 5FYCA 5DUVA 3BU0A 3OGGA 5ABJC 4XBNA 1UMZA 4I01A 1VP6A 1RVF2 2W68A 4Z8BA 3CIHA 4I0WB 5FZOB 4B4QA 3LSEA 4HBNA 1U5XA 2ZGSA 3W9AA 4BZ4A 3TEXA 3ZXJA 5FPVA 2RS52 4P5HA 3RZLA 2NZ9A 4HANA 4LBNA 3HBKA 4BYYA 1OSGA 4W8JA 2CWSA 1WMDA 4P9LA 5I0DA 4QPGB 2VNRA 3NV2A 4GWMA 4FPKA 4IV1C 3SCGA 2QVSB 5JR7B 4FP3A 1IPJA 5B4NA 5CFCB 3ABZA 3ZYHA 1LGBA 3E6BA 4O61A 2LRPA 2VQAA 3VDDB 3VHOA 4CU9A 4Q8KA 4YW5A 1W8OA 1DYKA 2YPDA 3FHAA 5LA2A 2WNUB 1CAXB 1FOD2 3SITA 1WCKA 4ONUA 4RHV1 1LJ7A 2WWJA 3ATGA 3WG4A 3ZYFA 4Q0QA 2BNOA 1PZ9A 4Q8LA 3MV01 4HPKA 4XETA 4C1XA 4CUAA 5JXHA 2BBVA 4QQ2A 1JYNA 2OZJA 4E8DA 1SCRA 1S0EA 4AEDA 4AI8A 4HETA 5LRSA 4B1MA 4QKNA 3J26N 1HV0A 5FXWA 3GBFA 1A6CA 1AR61 2YC4A 2XQRA 4QHOA 5JAXA 4TWTA 1PK6A 5DXDA 1R1ZA 4IEVA 1XU2A 4WZCA 2ARAA 3WG2A 1GZWB 1XPWA 4GD4A 3HNMA 5HCAA 3A0NA 3FZ3A 2P6CA 4ZZ5A 4KBBA 1TVGA 2W1SA 5EWSA 1PZ8A 4CEWC 5T52A 3PUQA 1M06G 1EAH3 3C2UA 1O3QA 3AFKA 2BVBA 1HB1A 2IXLA 5I8SA 4B7EA 1R082 2F17A 3ZFGC 2JE7A 2ZHLA 2A6XA 4OCTA 4XF4A 1A8DA 2DVFA 2Y38A 4QT6A 5F3EA 5LA9A 4DRRA 5HBAA 1TE1B 3W21A 2FZ1A 2OKXA 3ZN5A 1UOGA 4XDPA 4ZS2A 4GULA 5FXXA 2ADDA 4YVWB 5K0UA 3LFIA 3RMXA 3ELNA 1RYYA 2ZPXA 1IKPA 3V0AB 2R071 5JZGA 1S2KA 1XYNA 5C3QA 5FPUA 1PO13 1PO23 3CF6E 5J98B 1BZWA 4EN9B 2QZ3A 4YVSB 3OD0A 4OMCA 3HN1A 3KM5A 3GJAA 4LO7A 1FATA 1SBDA 3CHXA 3KS7A 1PGL1 4FPJA 3RYPA 1C3HA 2R7EB 4A7KA 5J96B 2IXHA 3IBMA 3FUOA 3POFA 4CDWB 4Q1PA 1WW6A 1X7NA 2D5HA 3O5SA 2ZEZA 4HXCA 4RS5A 4BCUA 5I0RA 1GP4A 4RYDA 1B09A 1E57A 1YQ5A 3HIFA 2YYOA 4P08A 4PHZA 5DG2A 3CJXA 4OZOA 5HCFA 5A7WB 2ILMA 1O4YA 1X9PA 2QQUA 2XHNA 2Y60A 3ME2A 2G1MA 4I3PA 3R0RA 4Y22A 5F5QA 1VBD1 1H1AA 4YM2A 5CYYA 5FAXA 4XABA 2PQQA 2J42A 2PYTA 1JU4A 5FLJA 1W2UA 2JD4A 4QXKA 4BISA 3HQRA 4WM7A 1WUVA 1CX1A 5L7OC 2OYZA 2AEZA 4XPVA 4H7MA 2OZ6A 1SMVA 1TME3 4JGZC 4LE4A 3C7HA 2VD7A 4RQPA 1CPNA 1CWPA 2EICA 1NOVA 4HN0A 5BYNA 1UZ0A 2MPFA 4N90A 4MGQA 4AVVA 2Y34A 3T2TA 1AL22 2FQPA 3O1OA 4AYUA 1OFSA 3SH3A 4JAAA 1JZ3A 1K45A 3K2OA 2HWC1 2HEYF 1G6NA 2WLQA 2RR11 4MZUA 4QDQA 3ZYRA 1RUG1 2XJQA 4QB1A 1O3TA 1BCXA 2VPVA 5F3IA 3W5MA 4RFT0 4FOVA 4K20A 2RS32 1NA1C 1F15A 1XJAA 2E6VA 1XNDA 1NZIA 1WMFA 2W91A 4AW7A 1AXZA 5A3MA 2RJ2A 1AR82 2IVJA 2AZ5A 2Q0AA 1TEIA 2R061 4FP2A 2QQIA 4INDA 5FJKA 4J6GA 2HWB1 2PHDA 2QNKA 5HCBA 2JXAA 4Q1RA 1QKQA 2WFF2 5JOXA 2WA4A 2FCVA 2LROA 2VUJA 4K9SA 4UAPA 3WF0A 4GALA 1S0JA 1ND3C 2A7AA 2C9KA 2MNGA 1I1EA 1JI6A 3ZFFC 2XR4A 2D98A 3KQ4B 3WEZA 5ACA3 2VOVA 1Z7S1 1EV11 4R4XA 5C4WC 2R0HA 5H9SA 3FBMA 4RHV3 4DFSA 2YHJA 4UFLA 3WF4A 2O8OA 2VUCA 5F2WA 3VN4A 1EPWA 1W06A 3VLBB 4P02B 3BYWA 3LA2A 3NRUA 4FPHA 1PX4A 3P3PA 3S5AA 4HN1A 4Y4YA 2WO2A 3NV3A 4RFRB 4OI1A 3MLLA 5IYYA 1OPMA 4R9DA 2RMU2 2WO1A 3VUOA 1RMU1 3NNJA 1LOFC 2JWPA 4A3XA 5F6KA 1VB4A 4KQ7A 1TMF3 2KD7A 3PUIA 4GIQA 2WLPA 4NWVA 2Q5TA 4TLFA 4B4PA 3UT0A 3OTFA 1NKGA 2BWCA 3K3OA 2E31A 1PMJX 3T0AA 1GSLA 5AC92 1C4RA 3AMPA 5I0TA 1RUE2 2OIIA 5C8CB 3AZZA 4BQYA 1D0HA 2YU2A 3JUUA 3PJYA 3ACLA 3SC7X 3D82A 5C9AC 5A1LA 5J1XA 1LEDA 5HPOA 3AYCA 2VMGA 4EWEA 1W0OA 5LWBA 3B9CA 1QJY1 1FI2A 2LS6A 4HSJA 4IGPA 5DAVA 2DF7A 4GB33 5F37A 1RC6A 3ZX7A 4PBPA 5HCHA 5GZFA 4OUMA 3GXUA 1ENRA 4UW5A 5GZDA 2J1AA 1O3SA 4OFGA 5A1FA 5CKNA 2D6OX 1RL3A 2IWGB 1W9FA 5FV3A 4AHYA 3CMGA 4CCJA 1QNYA 4UFMA 3SQOA 4MXWA 3T2PA 2FDKA 2UWCA 2I45A 3MW3A 5I0UA 1ACCA 2ZAAA 4JKMA 4LOTA 4Y22B 3O1RA 1Y4WA 2XXZA 4YM3A 3BTAA 2OX0A 4ARXA 2VNVA 2D6KA 2LUWA 2VZOA 4GKYA 4XJWA 5FMBA 4BB3A 4CVUA 5JPNB 4DZGA 1H8TC 2P3YA 5C3RA 1ASJ1 3PU8A 4NPLA 5CEHA 4DEVA 4WM7B 1KS4A 1SLAA 1X8EA 2YFUA 1C57A 1ULOA 2D6LX 5FKBA 5JMOA 4CDXA 1COV1 1MACA 4RQPB 5DN2A 3B02A 2XL9A 2RHPA 2ZGKA 3NSTA 2X5IA 1ZRRA 4IE0A 2ZACA 4QQOA 5D8AC 4YPJA 3WDYA 2B46X 4PJYA 3OPTA 2PHFA 1FOD3 5FYZA 2GC0A 3RJ2X 3SXWA 1JYWA 4BXFA 2DTWA 4XAAA 2RV9A 4E4SA 5C3PA 1AYN1 2D6PA 3LPFA 2K9ZA 5GLTA 1YFWA 5KXCA 3IAQA 3ALQA 1X82A 1BVVA 1YJLA 4PIYA 4G9SB 4Y20A 3KV4A 3AB0A 4XF3A 5FBJA 1OUSA 4BPZA 1XNTA 5FZHA 4AFAA 4EZHA 1UD1A 1MEC1 3ENRA 3DGTA 4CXYA 2E9QA 2J1VA 2ZEYA 2VUAA 1ZA4A 2VVEA 3IM0A 5LASA 5FYBA 1RUF1 2OVUA 2W1QA 1WA6X 4LT5A 1H4GA 1DBNA 3AC0A 1DGWX 2P2KA 1BHGA 1BYHA 2RG4A 4MGSA 5FMOS 3RZKA 3TRSB 4MGTA 5FO8B 5KXEA 4XFAA 1TNFA 3UKTA 3LQCA 1FV3A 3N9LA 4Y1VA 5F5IA 3KT1A 3FL7A 2BZDA 1R083 1UZZA 2DCTA 2WT1A 1AR72 3GBGA 2MEV2 4ES9A 3AP9A 3M3OA 4GJZA 4ZXKA 1WW5A 1ZBA2 2P34A 2YGMA 4CUGA 4DRVA 1VRBA 4LE3A 1V6MA 1K5JA 2BEOA 1SPPA 4ZY9A 1UWWA 3O1MA 2JG9C 5JSPA 2R30A 1Q3EA 4WZFA 5IJRA 3R05A 3ZIWA 3VBOC 2HWE2 2DCKA 2VZRA 1VLNA 2W0XA 3NJYA 4Y5SA 1UMHA 2HJIA 2BJSA 3MUY1 1SDDB 4J1XA 3B7MA 1E5HA 4E2QA 2D6NA 2BVVA 1ULCA 4QPIA 1C8M2 3MO4A 3DXUA 1AJOA 3FBYA 4ASLA 1PGW2 5CFDA 3QD6A 1JUIA 1VBC3 1WKYA 1RUC2 2DCJA 1XYOA 2E32A 2YC0A 4NRPA 5FO7B 4JC1A 2B42B 1UY4A 3LOIA 2FBEA 2Y6HA 1QQP2 2IXKA 2VNGA 3NAPC 4GH4C 3VGIA 3ZDSA 3MIDA 2QQOA 2TBVA 4J1WA 4NROA 2V72A 4PBOA 4Q4X2 3ZVXA 1QJEA 4YW2A 2ZHKA 1GMMA 4R9AA 4A4AA 4LA2A 5G05L 2KXLA 2UWBA 3VZLA 3VBFC 1CZVA 2O8QA 1O8SA 3PVNA 4Q4W2 2CGOA 2IXJA 3VD7A 3ZXLA 1JUHA 1O3RA 2XOMA 4CCEA 3HT1A 4FQ4A 5E6HA 2GALA 1FMD1 1CJPA 1CZTA 1H1MA 2JKXA 2DVDA 3ON7A 1W39A 3JXSA 5A33B 3DF0A 4BHPA 2H0BA 3LAGA 1VRH2 2OA2A 4XFIA 4YSFA 1AL23 3A0KA 5FZBA 4NAOA 4W50A 4LBMA 1GOHA 4MGKE 2PHXA 3WDUA 1UN1A 3WG3A 4ZPIA 3THDA 4NOTA 4ZU4A 1IS4A 2V5DA 4N43B 3T2OA 1YI9A 5LK7B 1CQ9A 1ZRFA 2UU8A 1UNBA 3N7LA 5FJHA 3KD4A 1QGLA 4CDXB 3DV8A 4PLMA 2X5IB 4XFCA 1DQ0A 1AR83 4CUCA 5JOYA 5FMOL 3HVDA 2A75A 4RGKA 4BK5A 2EXHA 2PHUA 4AXOA 3HEIA 2ZXQA 5FMCA 2QFEA 1Y7BA 1ZNPA 4N53C 1UY3A 3ZFEA 4LPLA 3UV9A 4RR3B 5E89A 1U5IA 2D5FA 1OVSA 1URXA 2RDRA 5L73A 5J48A 2EA7A 3B3QE 1S4CA 5L9VA 1CD3G 5SV5A 5IAXA 2VW0A 2W46A 1MZEA 3CJIC 3KT4A 1HRI2 4L8QA 4BM8A 5LBBA 3I3BA 5HV0A 1YJKA 5FYVA 4OQ9A 2HYKA 3MDPA 5JXGA 1XRUA 2EAKA 1A3KA 3WZ1A 2VOKA 2BDRA 2VBDA 3I2KA 2WWSA 4XJZA 3AXEA 3FHQA 1GWLA 2JB4A 4H14A 1HX6A 1BJQA 1W6PA 3MIBA 2B8MA 2HWF1 3SNMA 1DF0A 1AYM1 4MH0E 3NW4A 4W6XA 3SISA 1I5ZA 2QQWA 2FCTA 2CAUA 5EXOA 5JZGC 2PHRA 4PIXA 1FXZA 2PLV3 2WUHA 3QLQA 5DZGA 5AC93 5BNPC 1G9DA 3UJOA 1ZZ6A 4D7TA 3NQHA 1RUJ2 2WNOA 1SPPB 4QU2A 4TSVA 2VCAA 1B35A 4CDQC 4IEUA 1VAKA 4CCNA 5JXIA 4XDQA 1EY2A 3VKFC 2DVBA 1CAVB 1N1YA 3M2MA 3V0BA 4AQTA 2VUDA 4HMZA 1KDMA 1JYIA 2G9FA 3T4VA 1JBCA 4D3WA 3K48A 5LBFA 1VPHA 3U37A 5LA1A 1HXS2 2JG8C 2HEWF 5T5OA 4FFGA 1JXNA 5EQUA 4OUEA 4NIAA 1NCQA 1D4M2 1GANA 3U75A 1UKRA 4NIGA 1HN1A 2GNBA 4AAPA 4A7ZA 2D97A 4FPYA 5FZ7A 3B01A 1J3QA 2R041 4XUQA 3VZJA 3A7QA 1JN2P 2W52A 3VBHC 1BVP1 2E7QA 2NMNA 3J7HA 4EJRA 2VQUA 5BNNB 5JPMB 4BLIA 4LUKA 3AL5A 4QB2A 4U36A 4C91A 2YBSA 5KHJA 1JYXA 3KT7A 1LOAA 3FLPA 1FPN2 5F1RA 2P3JA 2VTXJ 4IE7A 3LB9A 2G4IA 3SEEA 4YW4A 3WNOA 4CEWA 2HBTA 3H8UA 1W03A 1CIYA 3N9QA 2L9LA 1RUH3 3PL0A 1WCSA 2EIBA 5DABA 5A7PA 5T54A 3BKZA 3RPQA 3H1YA 1QJX2 2V73A 1FNYA 5JDBA 1SZBA 1AR92 2XJSA 3N7JA 4IV3C 1BEV2 1EUTA 3PIGA 3I2OA 3TYJA 3ACHA 4Y26A 4OZXA 3MFCA 3I49A 2R1BA 2WNVC 1PMHX 3VBRA 4XIKA 3FC0A 4YZ1A 1UOBA 1KEXA 3MFAA 1NXD1 4YZ3A 4YGEA 4IXLA 5K9YA 3ZSEA 1VMHA 1R1A3 1OKOA 2AR6A 2WR9A 4XURA 4XCAA 4LHKA 1HB4A 4ZONA 3SHRA 1VMJA 3O14A 4C90A 1W04A 4KWJA 1W28A 3UKNA 1SLBA 2VZVA 2BGCA 1UY2A 1NLRA 1GWMA 4HOOA 4O7XA 2CSGA 4R9BA 2RS12 4AF9A 2ZGNA 4AHZA 1AJKA 2Q1FA 5L36A 5K8SA 4NPRA 1LU1A 5F7UA 1ZBE3 1R093 3PTYA 1JOJA 3ACGA 5EJ3A 2YPJA 3E1F1 3ILNA 5I93A 2GC1A 2VO5A 2PTMA 2ZGRA 1JZ2A 1HRV2 4OVEA 5B4XA 4LULA 4NHXA 1K5MC 4JDNA 1ZBA3 4YFWA 3WQ7A 3RS6A 4PLNA 3QOPA 3ZKUA 4NIHA 4I3GA 3OYWA 2FDJA 5FY4A 1YFUA 1XU1A 4JGZA 4LOSA 4DUXA 5KXBA 3EBRA 4J25A 3AP5A 1H4HA 3T1MA 5A3TA 4DXZA 1GQGA 4TXWA 3TN92 2G9GA 5FPLA 2EIGA 3U11A 3MIEA 2RM22 2WZR2 1YIPA 5FZ0A 3WF3A 2WAAA 1AXYA 3RFRA 3T09A 1Y3TA 1REDA 2XUMA 2BOIA 1OPOA 4KL1A 2JKBA 4H55A 2V5YA 3IDAA 5FTTC 1C8M3 1DP0A 1OQEA 1DFQA 2ZGPA 3LZZA 2V4VA 3OD4A 4GKXA 1NA1A 2K46A 4I30A 4JZRA 3J8F3 2HWD3 2VQTA 1RUC3 1NCRC 3GF6A 4JTNA 3VBSC 4CDUB 1B35B 5CB7A 2XLGA 1H8VA 5FYTA 3KV6A 2P3IA 4Y3OA 5IK4A 3BUCA 1PO11 5LZ6A 2ZEWA 1V0AA 2QDRA 4Q4X3 4AOCA 1AYM3 1YUDA 2W08A 2WNEA 2E33A 3USSA 5IWFA 4Q4W3 1ND3A 2Y8KA 1RUOA 2WFPA 1Q8PA 4DXTA 3HD8B 1NCQB 3OBRA 4ISRA 4R52A 1X36A 2JDUA 2VH9A 5CNAA 3ZFFA 3W5NA 4W6YA 3KHBA 4EN0A 4YW6A 1W6NA 1GFF2 4XFHA 3I2FA 2WT2A 2V09A 3RZGA 3BOPA 4RL7A 1OFNA 1VBB1 1ULDA 1FV2A 3GGLA 1UW8A 1VRH3 5C4WA 4YG3A 1YHFA 5FP7A 1EPZA 3GHMA 2BUKA 1NG0A 2QDNA 2UWAA 2A6VA 4LO5B 3FN9A 4NN0A 4DINB 5FPZA 5FYUA 4LR4A 1Z0HA 1PZ7A 5KXDA 1MZFA 4CEWB 2X8KA 3JU9A 4JX0A 2JDAA 5APAA 3TWIA 1DIWA 1NXMA 1TME1 4X6RB 3RMYA 1BMV1 1SACA 5EJZB 3KSCA 2PHWA 5JMCA 4PDWC 5FK8A 2D3SA 5EYYA 4KWLA 4COWA 1CPMA 3JZVA 3WW1A 2XJUA 3WVJA 4AVBA 4BU2A 4EN6B 2OPKA 5K4LA 1W2OA 2XH6A 4P9JA 1QJU2 1N47A 4QU1A 1O6UA 4R9CA 2JDNA 3VBRB 2AYHA 2D43A 2ZJCA 2QQMA 4BOWA 5FZKA 2XWBB 4COZA 5ANQA 1ZRDA 4CU6A 4CCOA 3DYMA 2Q8DA 3T3YA 5A80A 3J7LA 1EYBA 1OBNA 5K7PA 2VW2A 4DS0A 4NRQA 4ZKTB 1UKGA 4YRDA 5BPXA 3VBUB 1US2A 1HRI3 2CTVA 4CEYB 3IIIA 1REEA 1LGNA 3U0ZA 2HH9A 3PTRB 4YGCA 2VOTA 3L2YA 3ZXEA 2B45X 4WVVA 1W8UA 1L7LA 2XDVA 1X50A 1JYTA 2IXIA 4QX1A 4Y24A 4YGBA 4P5YA 5LK5A 3ILFA 4CP9A 5KBFA 2WO3A 3OBZA 5ACA1 3KCCA 4AEMA 4TN7A 5FIXA 1CAUA 1DGLA 1R64A 2IXCA 2R072 3AYAA 3OGSA 5ISLA 1H8TA 4LBKA 4A6SA 4V1PA 2GH2A 3VZKA 2GP5A 4G3YC 1GZCA 1QMJA 3D5OA 3MF9A 5A7OA 5L7OB 2C6SA 5CIRA 2UURA 3WCRA 5BNOB 2EXIA 4B4RA 3T1LA 1O4ZA 3ZR5A 1TMF1 5GZGA 5LBEA 5IFPA 4ZU7A 1OOPA 3MV11 4D6QA 5C71A 2CGPA 1RUI3 1MQTC 1F4HA 4NHMA 4EROA 4QPYA 4JVAA 1W0NA 2VZTA 3GCWA 2RDSA 3ZN6B 3ZOIA 4S2GA 1BBT2 4AHXA 1VBD2 1REFA 1LCLA 3O1UA 1W8WA 2E63A 2GNTA 5FUNA 1Q5OA 2ZZJA 1LR5A 3MPBA 5FP4A 1QH7A 5C3SA 3LPGA 4GB31 4R8HA 5FYHA 2BGPA 2Q1ZB 2RVAA 4DUWA 1YLLA 1AHSA 5GKAC 2ZMKA 5AVPA 3WP3A 3LIHA 1FPN3 3PDQA 3DUIA 3OG2A 2QQJA 1LGCA 3OGVA 4BQ5A 2YY1A 5C6CA 5ERLA
chains in the Genus database with same CATH topology
3C7OA 3CMGA 4GZ9A 3VD5A 2C26A 2VCBA 3T2PA 2VZ1A 4JKMA 4BJ0A 5A1AA 4ARXA 4CVUA 2VZOA 1O59A 4JKKA 2WN3A 4DEVA 2YFUA 1ULOA 5JMOA 2DDUA 2W47A 2VC9A 2WQ8A 5DN2A 3VDBA 1K12A 4YPJA 2VZ3A 5JXJA 1JYWA 2RV9A 5DMYA 1D7PM 3LPFA 4ET7A 3T08A 3IAQA 4PF1A 1W8NA 3HN3A 3HOBA 2VR4A 4HG6B 2X09A 1XNTA 2YB7A 2J1SA 4CU7A 2J1VA 2W1WA 2ZEYA 1TG7A 3OB8A 3K4DA 2W1QA 3I2HA 1K42A 3AC0A 3LEGA 4MGSA 1BHGA 2VMCA 3LE0A 3SEPA 3C8XA 1OF3A 4D0QA 2QQLA 1OD3A 3LQCA 3CQOA 1MPXA 4QB6A 4UOJA 1UX7A 1UXZA 3FL7A 2BZDA 4BDVB 3BN6A 5DPNA 2XQXA 3I2JA 1GQPA 2VMEA 2LW8A 2BGOA 2CDOA 3F2ZA 4E8CA 3NJVA 3K77A 4ZY9A 1UWWA 4QPWA 4DXSA 3LEIA 3NJXA 5IFTA 4XUNA 4KMQA 2VM9A 2Y6KA 4ZZ8A 5IJRA 3CKHA 2J1RA 2VMDA 3OEAA 5CZKA 4A3ZA 2C4XA 1SHWB 2DCKA 2VZRA 2W95A 1UMHA 3MUY1 1SDDB 3I2GA 2VZUA 3ACIA 2Y6LA 3MO4A 3HNBM 1WKYA 2ZEXA 2DCJA 2E32A 2Y6GA 5LCWL 3I2IA 1UY4A 1NUKA 2Y6HA 1W9WA 4AG4A 3K75B 2QQOA 2V72A 1JHJA 2J22A 1GMMA 4A4AA 2W94A 5G05L 1CZVA 4UI9L 1O8SA 3K46A 3WNKA 4BXSV 3VD7A 2B9VA 2BERA 2XOMA 2X05A 3UNPA 1UYYA 1UXXX 2W3JA 2W5FA 1CZTA 2JKXA 3WNPA 3JXSA 3BGAA 3WNLA 2VMFA 4L0PA 4M4PA 3HNYM 1YQ2A 3SKVA 4W50A 3D3AA 1GOHA 2WZEA 1OF4A 3VDCA 3THDA 3T2OA 2V5DA 2HYXA 1WCQA 1H6XA 4GWIA 1H6YA 3VD9A 4BK4A 4ZXEA 2VTFA 3VD4A 4CUCA 2WABA 3UETA 1P8JA 4QAWA 4BK5A 2VL4A 3HEIA 2VZQA 2ZXQA 3HJRA 2Y64A 1UY3A 4LPLA 4LQRA 3OEBA 2B4KA 3GDBA 3T0DA 4Z2AA 3CZUA 1L7QA 3WF1A 2W46A 3OBAA 3HPNA 5G04L 4A42A 3I3BA 3WNMA 3WF2A 1J83A 2CDPA 3MUZ1 5JXGA 2WZ8A 5JR2A 2W1UA 3I2KA 4TTGA 3FHQA 3IAPA 4DUVA 1GOFA 4JHZA 4MOAA 2W92A 2WUHA 1W99A 2EIEA 3WSOA 1GUIA 1OH4A 4QX2A 3NQHA 2J1UA 2VCAA 3DECA 4FI9A 3LEKA 1XC6A 1OT5A 1J84A 5JXIA 4JKLA 2YFZA 3WNNA 2WN2A 3SKJE 4D8MA 4MO3M 1XNAA 3NNGA 3U37A 3A23A 4DXRA 5LA1A 3ETPA 3EB7A 4OUEA 1JU3A 1DYOA 1HN1A 4XUQA 3A7QA 4KI5M 4M4RA 2VZPA 1NX9A 3J7HA 2VQUA 2ID4A 1UY0A 4QB2A 1JYXA 1GOGA 2VZSA 4XZUG 2J1EA 5C70A 3SEEA 1SG3A 3WNOA 5IHRA 5LA0A 5C7GA 1CIYA 1IQDC 2L9LA 2JE8A 2EIBA 3CIHA 2WDBA 3T0BA 1EUTA 3EYPA 1UY1A 3ACHA 4W8JA 5I0DA 4PT6A 1ULPA 1PMHX 3ECQA 3A21A 1KEXA 5B4NA 3ABZA 4IUGA 4CU9A 2VJXA 3I97A 1W8OA 3FHAA 5LA2A 1US3A 4XUOA 2VZVA 4CUAA 3MV01 1UY2A 3C7FA 5JXHA 1JYNA 5FUIA 4E8DA 3K4AA 3T2QA 4DEQA 4XVHA 4GWJA 5F7UA 2YC4A 3ACGA 3E1F1 4OMDA 3C7EA 2VO5A 1XPWA 1JZ2A 3HNMA 5B4XA 4ZZ5A 1TVGA 1JZ5A 2W1SA 3C7GA 1LNSA 5DQ0A 4DUXA 3A22A 1KGYA 4QX3A 4TXWA 2QQKA 2J7MA 2ORXA 2OKXA 3WF3A 2WAAA 3T09A 3WQBA 3PUHA 3IDAA 1DP0A 4XURA 1RYYA 2V4VA 4A6OA 4AAXA 2WBKA 3GM8A 2VQTA 3I3DA 5HXMA 4OMCA 2ZEWA 2WYSA 2R7EB 2E33A 5EIYB 1GNYA 1EUUA 1PX3A 1UYXA 1T2XA 4A41A 2Y8KA 3THCA 2W87A 2ZEZA 3MBWA 4DXTA 4RYDA 3W5NA 2QQNA 3P1IA 4P08A 4OZOA 3I2FA 2XHNA 3UESA 2YC2A 3GGLA 5CYYA 2BBAA 1JU4A 4P00B 3VDAA 3FN9A 1CX1A 3VD3A 3ACFA 1GU3A 4JX0A 3C7HA 2JDAA 2EICA 4LHSA 1UZ0A 5EJZB 2EIDA 4MGQA 1JZ3A 1K45A 5EJ1B 1JYVA 2Y6JA 4QDQA 2X10A 4QB1A 3K4ZA 3W5MA 4LKSA 4W4ZA 2QQMA 1DLCA 4MADA 4QDRA 2W91A 4CU6A 3DYMA 1O8PA 2RJ2A 2VCCA 2QQIA 1US2A 1UMIA 4XUPA 3IIIA 2XONA 3DYOA 2VOTA 4UAPA 4A44A 3WF0A 2E26A 4CU8A 2C9KA 4QX1A 1JI6A 4P5YA 1JZ4A 4OYUA 1CZSA 3WEZA 2WO3A 1JZ8A 3DYPA 4CUBA 1R64A 4RN5A 3WF4A 3OGSA 4P02B 3NRUA 4QX0A 1JZ7A 4QDSA 1PX4A 3CDZB 1F4AA 2WO2A 5IYYA 1L7RA 2WO1A 3ZM8A 2Z4FA 3CZJA 4XUTA 2KD7A 3P6BA 3PUIA 3OGRA 1I5PA 1NKGA 5IFPA 3MV11 2E31A 1PMJX 5C71A 3T0AA 2ORZA 1F4HA 2W9XA 1NAEA 1UYZA 3IB3A 1JZ6A 1W0NA 2VZTA 1W9SA 2WAOA 5J1XA 5HPOA 2PQSA 3I3EA 4KWUA 2HLEA 2LS6A 4PQQA 1W9TA 5JUVA 3LPGA 2QBXA 1K3IA 2BGPA 2J1TA 2RVAA 4DUWA 3GXUA 4A45A 2YG0A 3OG2A 2QQJA 2J1AA 3OGVA 4ARYA 2JD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C7O A;  3CMG A;  4GZ9 A;  3VD5 A;  2C26 A;  2VCB A;  3T2P A;  2VZ1 A;  4JKM A;  4BJ0 A;  5A1A A;  4ARX A;  4CVU A;  2VZO A;  1O59 A;  4JKK A;  2WN3 A;  4DEV A;  2YFU A;  1ULO A;  5JMO A;  2DDU A;  2W47 A;  2VC9 A;  2WQ8 A;  5DN2 A;  3VDB A;  1K12 A;  4YPJ A;  2VZ3 A;  5JXJ A;  1JYW A;  2RV9 A;  5DMY A;  1D7P M;  3LPF A;  4ET7 A;  3T08 A;  3IAQ A;  4PF1 A;  1W8N A;  3HN3 A;  3HOB A;  2VR4 A;  4HG6 B;  2X09 A;  1XNT A;  2YB7 A;  2J1S A;  4CU7 A;  2J1V A;  2W1W A;  2ZEY A;  1TG7 A;  3OB8 A;  3K4D A;  2W1Q A;  3I2H A;  1K42 A;  3AC0 A;  3LEG A;  4MGS A;  1BHG A;  2VMC A;  3LE0 A;  3SEP A;  3C8X A;  1OF3 A;  4D0Q A;  2QQL A;  1OD3 A;  3LQC A;  3CQO A;  1MPX A;  4QB6 A;  4UOJ A;  1UX7 A;  1UXZ A;  3FL7 A;  2BZD A;  4BDV B;  3BN6 A;  5DPN A;  2XQX A;  3I2J A;  1GQP A;  2VME A;  2LW8 A;  2BGO A;  2CDO A;  3F2Z A;  4E8C A;  3NJV A;  3K77 A;  4ZY9 A;  1UWW A;  4QPW A;  4DXS A;  3LEI A;  3NJX A;  5IFT A;  4XUN A;  4KMQ A;  2VM9 A;  2Y6K A;  4ZZ8 A;  5IJR A;  3CKH A;  2J1R A;  2VMD A;  3OEA A;  5CZK A;  4A3Z A;  2C4X A;  1SHW B;  2DCK A;  2VZR A;  2W95 A;  1UMH A;  3MUY 1;  1SDD B;  3I2G A;  2VZU A;  3ACI A;  2Y6L A;  3MO4 A;  3HNB M;  1WKY A;  2ZEX A;  2DCJ A;  2E32 A;  2Y6G A;  5LCW L;  3I2I A;  1UY4 A;  1NUK A;  2Y6H A;  1W9W A;  4AG4 A;  3K75 B;  2QQO A;  2V72 A;  1JHJ A;  2J22 A;  1GMM A;  4A4A A;  2W94 A;  5G05 L;  1CZV A;  4UI9 L;  1O8S A;  3K46 A;  3WNK A;  4BXS V;  3VD7 A;  2B9V A;  2BER A;  2XOM A;  2X05 A;  3UNP A;  1UYY A;  1UXX X;  2W3J A;  2W5F A;  1CZT A;  2JKX A;  3WNP A;  3JXS A;  3BGA A;  3WNL A;  2VMF A;  4L0P A;  4M4P A;  3HNY M;  1YQ2 A;  3SKV A;  4W50 A;  3D3A A;  1GOH A;  2WZE A;  1OF4 A;  3VDC A;  3THD A;  3T2O A;  2V5D A;  2HYX A;  1WCQ A;  1H6X A;  4GWI A;  1H6Y A;  3VD9 A;  4BK4 A;  4ZXE A;  2VTF A;  3VD4 A;  4CUC A;  2WAB A;  3UET A;  1P8J A;  4QAW A;  4BK5 A;  2VL4 A;  3HEI A;  2VZQ A;  2ZXQ A;  3HJR A;  2Y64 A;  1UY3 A;  4LPL A;  4LQR A;  3OEB A;  2B4K A;  3GDB A;  3T0D A;  4Z2A A;  3CZU A;  1L7Q A;  3WF1 A;  2W46 A;  3OBA A;  3HPN A;  5G04 L;  4A42 A;  3I3B A;  3WNM A;  3WF2 A;  1J83 A;  2CDP A;  3MUZ 1;  5JXG A;  2WZ8 A;  5JR2 A;  2W1U A;  3I2K A;  4TTG A;  3FHQ A;  3IAP A;  4DUV A;  1GOF A;  4JHZ A;  4MOA A;  2W92 A;  2WUH A;  1W99 A;  2EIE A;  3WSO A;  1GUI A;  1OH4 A;  4QX2 A;  3NQH A;  2J1U A;  2VCA A;  3DEC A;  4FI9 A;  3LEK A;  1XC6 A;  1OT5 A;  1J84 A;  5JXI A;  4JKL A;  2YFZ A;  3WNN A;  2WN2 A;  3SKJ E;  4D8M A;  4MO3 M;  1XNA A;  3NNG A;  3U37 A;  3A23 A;  4DXR A;  5LA1 A;  3ETP A;  3EB7 A;  4OUE A;  1JU3 A;  1DYO A;  1HN1 A;  4XUQ A;  3A7Q A;  4KI5 M;  4M4R A;  2VZP A;  1NX9 A;  3J7H A;  2VQU A;  2ID4 A;  1UY0 A;  4QB2 A;  1JYX A;  1GOG A;  2VZS A;  4XZU G;  2J1E A;  5C70 A;  3SEE A;  1SG3 A;  3WNO A;  5IHR A;  5LA0 A;  5C7G A;  1CIY A;  1IQD C;  2L9L A;  2JE8 A;  2EIB A;  3CIH A;  2WDB A;  3T0B A;  1EUT A;  3EYP A;  1UY1 A;  3ACH A;  4W8J A;  5I0D A;  4PT6 A;  1ULP A;  1PMH X;  3ECQ A;  3A21 A;  1KEX A;  5B4N A;  3ABZ A;  4IUG A;  4CU9 A;  2VJX A;  3I97 A;  1W8O A;  3FHA A;  5LA2 A;  1US3 A;  4XUO A;  2VZV A;  4CUA A;  3MV0 1;  1UY2 A;  3C7F A;  5JXH A;  1JYN A;  5FUI A;  4E8D A;  3K4A A;  3T2Q A;  4DEQ A;  4XVH A;  4GWJ A;  5F7U A;  2YC4 A;  3ACG A;  3E1F 1;  4OMD A;  3C7E A;  2VO5 A;  1XPW A;  1JZ2 A;  3HNM A;  5B4X A;  4ZZ5 A;  1TVG A;  1JZ5 A;  2W1S A;  3C7G A;  1LNS A;  5DQ0 A;  4DUX A;  3A22 A;  1KGY A;  4QX3 A;  4TXW A;  2QQK A;  2J7M A;  2ORX A;  2OKX A;  3WF3 A;  2WAA A;  3T09 A;  3WQB A;  3PUH A;  3IDA A;  1DP0 A;  4XUR A;  1RYY A;  2V4V A;  4A6O A;  4AAX A;  2WBK A;  3GM8 A;  2VQT A;  3I3D A;  5HXM A;  4OMC A;  2ZEW A;  2WYS A;  2R7E B;  2E33 A;  5EIY B;  1GNY A;  1EUU A;  1PX3 A;  1UYX A;  1T2X A;  4A41 A;  2Y8K A;  3THC A;  2W87 A;  2ZEZ A;  3MBW A;  4DXT A;  4RYD A;  3W5N A;  2QQN A;  3P1I A;  4P08 A;  4OZO A;  3I2F A;  2XHN A;  3UES A;  2YC2 A;  3GGL A;  5CYY A;  2BBA A;  1JU4 A;  4P00 B;  3VDA A;  3FN9 A;  1CX1 A;  3VD3 A;  3ACF A;  1GU3 A;  4JX0 A;  3C7H A;  2JDA A;  2EIC A;  4LHS A;  1UZ0 A;  5EJZ B;  2EID A;  4MGQ A;  1JZ3 A;  1K45 A;  5EJ1 B;  1JYV A;  2Y6J A;  4QDQ A;  2X10 A;  4QB1 A;  3K4Z A;  3W5M A;  4LKS A;  4W4Z A;  2QQM A;  1DLC A;  4MAD A;  4QDR A;  2W91 A;  4CU6 A;  3DYM A;  1O8P A;  2RJ2 A;  2VCC A;  2QQI A;  1US2 A;  1UMI A;  4XUP A;  3III A;  2XON A;  3DYO A;  2VOT A;  4UAP A;  4A44 A;  3WF0 A;  2E26 A;  4CU8 A;  2C9K A;  4QX1 A;  1JI6 A;  4P5Y A;  1JZ4 A;  4OYU A;  1CZS A;  3WEZ A;  2WO3 A;  1JZ8 A;  3DYP A;  4CUB A;  1R64 A;  4RN5 A;  3WF4 A;  3OGS A;  4P02 B;  3NRU A;  4QX0 A;  1JZ7 A;  4QDS A;  1PX4 A;  3CDZ B;  1F4A A;  2WO2 A;  5IYY A;  1L7R A;  2WO1 A;  3ZM8 A;  2Z4F A;  3CZJ A;  4XUT A;  2KD7 A;  3P6B A;  3PUI A;  3OGR A;  1I5P A;  1NKG A;  5IFP A;  3MV1 1;  2E31 A;  1PMJ X;  5C71 A;  3T0A A;  2ORZ A;  1F4H A;  2W9X A;  1NAE A;  1UYZ A;  3IB3 A;  1JZ6 A;  1W0N A;  2VZT A;  1W9S A;  2WAO A;  5J1X A;  5HPO A;  2PQS A;  3I3E A;  4KWU A;  2HLE A;  2LS6 A;  4PQQ A;  1W9T A;  5JUV A;  3LPG A;  2QBX A;  1K3I A;  2BGP A;  2J1T A;  2RVA A;  4DUW A;  3GXU A;  4A45 A;  2YG0 A;  3OG2 A;  2QQJ A;  2J1A A;  3OGV A;  4ARY A;  2JD9 A; 
#chains in the Genus database with same CATH topology
 4QKF A;  3AVR A;  4GZ9 A;  2HWC 2;  2XKO A;  1SCS A;  2VZ1 A;  1W6N B;  1PVC 2;  3AKP A;  3ASI A;  3IPV B;  5DZF A;  5EHD A;  1QJX 3;  3WV6 A;  5LEK A;  5FWJ A;  1NE4 A;  5A1A A;  3AKS A;  4WBB A;  4DNY A;  4XOG A;  4UBG A;  1O59 A;  3I4I A;  1G9F A;  4WM8 C;  1JH5 A;  3AP4 A;  2ADE A;  2JG9 A;  3EJK A;  1YQ8 A;  2R06 2;  2W39 A;  3RRD A;  2VC9 A;  2WQ8 A;  4IE6 A;  3H50 A;  4XQD A;  2WS9 3;  1K12 A;  1W2A X;  1F8V A;  4Z82 A;  2GND A;  2VZ3 A;  1W3V A;  3VBO A;  4LOR A;  4YAR A;  1ND2 A;  2Y33 A;  1FOD 1;  4Z1V A;  1VBB 3;  1ZM1 A;  1N1V A;  5H9Q A;  4ET7 A;  3HQX A;  2RS1 3;  5KHH A;  2CV6 A;  2R32 A;  2R6Q A;  2WRA A;  4XJU A;  3HN3 A;  5FQ0 A;  2VR4 A;  4HG6 B;  4LKD A;  5IK7 A;  2GN7 A;  1ULG A;  4CU7 A;  5FO9 B;  3OOX A;  1RJ7 A;  3NAP A;  3VL9 A;  3HQU A;  3M70 A;  4GH4 A;  3ZYJ B;  2XJV A;  3P5B A;  4UFK A;  2XPJ A;  1WLT A;  4QPG C;  3CU7 A;  1UYP A;  2G19 A;  4EZ4 A;  1Q8Q A;  2VE1 A;  1RHI 2;  5A32 A;  3TEY A;  2ZS6 B;  3ZMN A;  5J7M A;  3O1T A;  1RMU 2;  1K42 A;  1D4V B;  2VMC A;  5F3C A;  3VBF A;  3LE0 A;  3VDD C;  3U4X A;  4OHW A;  3C8X A;  4D0Q A;  4YYO A;  2WNU C;  3ZLI A;  4AVC A;  2ZX3 A;  1DLL A;  3CQO A;  1XBF A;  3UL2 A;  4QB6 A;  5IW0 A;  4XXA A;  5JOZ A;  4UOJ A;  2QKD A;  2PFW A;  1U5Z A;  1UX7 A;  1UXZ A;  4O9G A;  4BDV B;  4CTE A;  2JB8 A;  2VMI A;  3Q8C A;  1R08 1;  1OD5 A;  2H6C A;  2CYF A;  1HJG A;  2RM2 3;  3NNM A;  3CNA A;  1CAU B;  5FY7 A;  1QIQ A;  4YLZ A;  1GQP A;  2VME A;  4URT A;  2CDO A;  4EN8 B;  1S2B A;  4E8C A;  3K77 A;  4K7J A;  4HPK B;  4LKF A;  5FZC A;  2E51 A;  2HEV F;  4JRA A;  5B2G B;  4QPW A;  2ATF A;  5FLH A;  3LEI A;  3NJX A;  4DXS A;  2EXK A;  4XUN A;  2Y6F A;  4AED B;  5JLV A;  2Y6K A;  3POW A;  2J1R A;  2RDQ A;  2VMD A;  5CZK A;  1H9P A;  2W95 A;  5T5L A;  4NVP A;  4JTO A;  5FZ6 A;  1DU3 D;  2QTW B;  1UCX A;  2TNF A;  1ENX A;  1PK6 B;  1OOP B;  1YYN A;  2WT0 A;  3I2G A;  4EE2 A;  1J58 A;  1HQN A;  1O5L A;  4QM9 A;  4E27 A;  1YI7 A;  4N53 A;  3HNB M;  1KFX L;  3U1X A;  2D3R A;  1HW5 A;  2CY6 A;  5C8W A;  3T4H B;  1YC6 1;  1W6M A;  2Y6G A;  1VBC 1;  1ZRE A;  2R1D A;  1LOE A;  5F6L B;  3WX5 A;  3JD7 2;  4GAZ A;  1D2Q A;  1OHF A;  1VBA 2;  4JDO A;  3NWK A;  4YVW C;  4AGV A;  2PXJ A;  1JHJ A;  1W8F A;  2W94 A;  2YU1 A;  4IET A;  4P9X A;  4HON A;  1YRZ A;  4UI9 L;  3K46 A;  5A3U A;  2GMM A;  3AMM A;  4C1W A;  4LO8 A;  1C1F A;  1W8H A;  4YVS C;  2B9V A;  3RNS A;  1HQW A;  1QXP A;  4A2U A;  1UYY A;  2VVD A;  1HB2 A;  2W3J A;  5K0U B;  2W5F A;  5C5U A;  4BQW A;  2OPW A;  3BGA A;  2VMF A;  5FP9 A;  4DQA A;  2CNA A;  4CDW C;  1WD4 A;  4OLL A;  1LHN A;  1AL2 1;  1BK1 A;  2XG3 A;  3H1M A;  4ATF A;  4BLJ A;  1MEC 2;  4ES8 A;  1W6Q A;  3BIW E;  5BNP A;  1GNZ A;  3WQ1 A;  1QJU 3;  2XBO 2;  4FOQ A;  2HYX A;  2WZP P;  1H6X A;  4GWI A;  2RS3 1;  5CG9 A;  4FO9 A;  1H6Y A;  3VD9 A;  2CAV A;  3H8R A;  5FDB A;  4RS5 B;  1V6I A;  4K21 A;  1ENS A;  2Z69 A;  3DCQ A;  3AZV A;  4ZXE A;  3VBO B;  3VKO A;  1RVF 3;  2WAB A;  3ES4 A;  1ND2 B;  1AR8 1;  2ZX4 A;  4QX8 A;  3S0M A;  4XDO A;  1JOP A;  1DQ4 A;  2RS5 3;  2VZQ A;  2JG8 A;  2H0V A;  2WFF 1;  4MUV A;  5FQ0 B;  4Y1X A;  1H2K A;  2DTY A;  2B4K A;  2YRO A;  2VMH A;  3AMH A;  3GDB A;  4GWN A;  2ZCW A;  4XW3 A;  4CCL A;  4HLT A;  3CZU A;  1L7Q A;  1KXG A;  2KA3 A;  4UXA A;  1MS8 A;  5T5P A;  3U4S A;  1SLT A;  4Q4Y 2;  5E1R A;  5IAV A;  4ASM B;  3CO2 A;  4CCC A;  3PMS A;  1ZZB A;  1F2N A;  1LUL A;  2DCZ A;  4BIO A;  2CDP A;  3H8X A;  1KQR A;  5DDJ 2;  2ZHM A;  4F7Z A;  4HKO A;  2ZA9 A;  2BNN A;  4FXG B;  3B94 A;  4OUL A;  5SV8 A;  2JDM A;  4V2W A;  1F5J A;  2NYY A;  4DUV A;  4I02 A;  5BY5 A;  3WLU A;  3RZJ A;  3WDV A;  4XF0 A;  2JDZ A;  1WZX A;  1UPI A;  4IV3 A;  3FUQ A;  5DUW A;  2VG9 A;  4YW7 A;  3UGH A;  2DVG A;  4L2N A;  1DYP A;  4LBJ A;  1W99 A;  4AI0 A;  1PIV 2;  2WNV A;  2PLV 1;  1GUI A;  5AC9 1;  3RI8 A;  2C9A A;  3NJZ A;  1LKN A;  2ZML A;  5CU1 A;  1NY7 2;  3PJQ A;  4Y1Z A;  4NMI A;  3J9S A;  4QQH A;  2SLI A;  4LA3 A;  5FZD A;  1GWK A;  4FI9 A;  1WA4 A;  1OT5 A;  5KHK A;  2YFZ A;  2WN2 A;  4UT5 A;  4Q0S A;  5EZW A;  2WA3 A;  3SKJ E;  4XIO A;  4MO3 M;  1OA2 A;  2VTX A;  3NNG A;  4OHV A;  1OUX A;  4D7S A;  1UOF A;  1CX4 A;  2WKK A;  3AMQ A;  3E6D A;  5FXZ A;  1DYO A;  5JI9 A;  1QF3 A;  3P3N A;  4AFB A;  4MYE A;  4D94 A;  1IPK A;  3DPR A;  2Q8O A;  3VB9 A;  3RZH A;  1W90 A;  4KI5 M;  3GZU C;  5GLZ A;  4UFI A;  3IMM A;  1PVC 3;  5CKM A;  1DZQ A;  5C8C C;  1ZA7 A;  2RDN A;  1F5F A;  5FYI A;  2ID4 A;  1QY4 A;  1UY0 A;  4YZ2 A;  1PHM A;  1K5M A;  3POB A;  4Y33 A;  5JI7 A;  5LY2 A;  5DAP A;  3AKQ A;  3WDW A;  4XE9 A;  2J1E A;  5C70 A;  4NPM A;  1H30 A;  4OQ8 A;  1SG3 A;  2BV4 A;  5IHR A;  2BP6 A;  3VDC A;  3OPW A;  5C7G A;  4Y4R A;  1I6X A;  3BPS A;  1J1T A;  1KFU L;  2N7G A;  4AL9 A;  4CCK A;  1RUH 1;  2A6Z A;  3DL3 A;  4M3C A;  1BLZ A;  5D2A A;  2A73 B;  4AEK A;  3I3M A;  3S7E A;  4YM0 A;  4ASK A;  5AFE A;  3EHK A;  1LRH A;  5M0T A;  2YV8 A;  1AVB A;  1UY1 A;  3EYP A;  2UY8 A;  4AGG A;  5F32 A;  3S57 A;  2YBK A;  3NMB A;  1POQ A;  3J7N A;  4ISQ A;  4ORF A;  1OMI A;  1RUD 2;  5A6Q A;  2JIC A;  3R4U A;  4TYS A;  4XEZ A;  5A6Y A;  2H6B A;  2QUO A;  3VZN A;  3ZXG A;  3VBS A;  4IUG A;  1KRI A;  1W05 A;  4YW3 A;  2VBP A;  1JYC A;  5FY0 A;  2NM1 A;  1R1A 1;  1US3 A;  1GR3 A;  2TUN A;  4JGY A;  3CL1 A;  3HT2 A;  1DQ6 A;  1POV 0;  1ZRI A;  4XUO A;  3AP7 A;  2OQ6 A;  3ORJ A;  4WM7 C;  3POI A;  3ZPO A;  4MXW B;  2VVF A;  2Q30 A;  1O5U A;  5FUI A;  4GMP 0;  4S2H A;  4QD2 A;  4RQP C;  2FD8 A;  2BU9 A;  4BME A;  2HWF 2;  4Q4V 2;  3W59 A;  5DAX A;  5KHI A;  3RZM A;  4I0A A;  1QHD A;  4LIV A;  1WCU A;  2PHL A;  4NWW A;  3O0V A;  2RS3 3;  1ZBE 1;  1R09 1;  5JOW A;  2WII B;  4OMD A;  3C7E A;  4LIU A;  4CXW A;  1LOB A;  5DZE A;  3TNP B;  5KR7 A;  1A8M A;  2AEN A;  5L9B A;  2MEV 1;  5GZC A;  5IUQ A;  3O7O A;  3ZSM A;  3AYE A;  1JZ5 A;  5FZL A;  1UU5 A;  2Q1M A;  1Q8O A;  1UZW A;  1ZBA 1;  4XXP A;  2EAL A;  4V2V A;  3RG0 A;  4AI1 A;  4D6R A;  3PUA A;  5DQ0 A;  3H3L A;  2WFF 3;  4BMB A;  4FAG A;  4WVM A;  4OI0 A;  4MHR A;  2WIN B;  4Y20 B;  1KGY A;  4QX3 A;  3N7K A;  4O9E A;  1L3J A;  3WG1 A;  3AYD A;  4IE5 A;  4EN7 B;  4PDW A;  4PIZ A;  1MVE A;  2OS2 A;  2QQK A;  5JSO A;  2J7M A;  2GDF A;  4QKD A;  2CWM A;  2ORX A;  2WWU A;  3AXD A;  3TAY A;  3RSJ A;  4HVO A;  3H7J A;  4YFZ A;  3ST7 A;  2R04 2;  2X53 S;  2WQ4 A;  4LK6 A;  1VJ2 A;  3PUH A;  2XLF A;  3JBG 2;  3OCP A;  2XWJ B;  2F4P A;  1ZYB A;  4LEJ A;  1A78 A;  1PGL 2;  2XVK A;  2WBK A;  1C8M 1;  3O0W A;  2GME A;  4E2G A;  1PGW 1;  4NRM A;  1YCI A;  4HL0 A;  3J8F 1;  2HWD 1;  4Y5Z 0;  1RUC 1;  1SFN A;  1WME A;  5ABJ A;  3USU A;  2AAC A;  4MLO A;  3JD7 3;  2RMU 3;  3N9N A;  5IVB A;  1W6O A;  1VBA 3;  2E7A A;  2WYS A;  1Q8V A;  4XJA A;  4AFM A;  4XF1 A;  4Q4X 1;  4QXC A;  2CGN A;  4QM8 A;  1QWR A;  5EIY B;  3BVC A;  4HFS A;  4BQX A;  1PX3 A;  3LA7 A;  4NAM A;  1T2X A;  1DGW A;  4RSU A;  4A41 A;  4B7K A;  4FTE A;  4XBL A;  3THC A;  3MBW A;  2FMD A;  4Q4W 1;  5F5C A;  1LOD A;  4IEO A;  1J59 A;  1RUE 3;  1U0A A;  1CGP A;  4FT8 A;  2QQN A;  3P1I A;  3NKG A;  4H2A A;  3NL1 A;  4IV1 A;  3DPR B;  3KCX A;  3NNF A;  3ZR6 A;  1DHK B;  3TEZ A;  1M4W A;  5FY9 A;  3UES A;  1SDW A;  1E5I A;  4YW1 A;  1LHV A;  5CAZ A;  1GP6 A;  1PM7 A;  3BCW A;  1VRH 1;  3FFQ A;  3OY8 A;  3WHU A;  2BBA A;  2VCM A;  3MGU A;  4P00 B;  3VDA A;  3Q8F A;  3ACF A;  2BPA 2;  5EFU A;  3UK9 A;  5H9P A;  2XBO 3;  1FX5 A;  3BOW A;  3ES1 A;  2DUP A;  2BFU S;  4LHS A;  4QPI B;  4E4H A;  2W2I A;  5CG8 A;  3C3V A;  4UBH A;  1DZT A;  2Y26 A;  1WMX A;  1MS9 A;  3AMN A;  5CFD B;  2R16 A;  1AX1 A;  4XTP A;  3B00 A;  2WC2 A;  4PF5 A;  3D4K A;  4QGN A;  1CIW A;  1C28 A;  4S2D A;  3JQW A;  3VHR A;  2P4E A;  2NP0 A;  3MW4 A;  1HDK A;  1OQ1 A;  2ZGU A;  3AKR A;  5FPB A;  3K4Z A;  4HZF A;  1IKQ A;  4L9B A;  5F3G A;  4AHW A;  4YG6 A;  2WSV A;  1KS5 A;  3GAL A;  5FK7 A;  3WT3 A;  2EAA A;  4A7Y A;  4XTM A;  2ZGT A;  2ZZQ A;  1S0G A;  3B5L B;  5DAQ A;  3J4U H;  2AUY A;  2YGL A;  3JB8 A;  4L92 A;  4QDR A;  3TB0 A;  2JDH A;  4UW4 A;  4DMI A;  4L99 A;  5A3W A;  3GJB A;  1O8P A;  4YZ5 A;  3QBQ A;  4Q4Y 3;  1YIF A;  4WVZ A;  2VCC A;  1V9U 2;  4JGY B;  4XUP A;  1UMI A;  4N43 C;  2WL1 A;  2ET7 A;  3ZFG A;  5FZ8 A;  1POV 3;  2XON A;  4BQ2 A;  1HRI 1;  1EAH 2;  5ANN A;  3AKT A;  3B93 A;  3RZZ A;  4A44 A;  4CE8 A;  4DOU A;  1ULE A;  4CDX C;  4GMP 3;  4XC9 A;  4CZS A;  3H3U A;  4KG8 A;  2X5I C;  3G7D A;  3ITQ A;  3LDB A;  3ZSL A;  1ZRC A;  1CZS A;  4XF9 A;  1A34 A;  1LEM A;  1XE7 A;  3M1H A;  2I2S A;  4MSV A;  2EXJ A;  3DYP A;  3RWN A;  1OI6 A;  4JQT A;  4CUB A;  4DY3 A;  3OF1 A;  3INA A;  4RN5 A;  4AFD A;  3WR0 A;  1XE8 A;  4RR3 C;  1NLQ A;  2KR2 A;  1W0P A;  4QX0 A;  1PIV 3;  3RI9 A;  2VBB A;  4QDS A;  5EYX A;  1GQH A;  3CDZ B;  5IAT A;  1PO1 2;  1PO2 2;  2ZX2 A;  1RUN A;  1NZC A;  3EXU A;  3ZYI B;  5F8P A;  1F31 A;  2BNM A;  3S6P A;  1WWY A;  2JEC A;  1L7R A;  1RUJ 1;  4JDM A;  4BQ4 A;  3ZM8 A;  2Z4F A;  4WVM B;  1H1I A;  4XUT A;  4GA9 A;  3ZFE B;  3LOB A;  3IZO A;  4IQP A;  1I5P A;  5CIS A;  1I3H A;  5T55 A;  1AR7 3;  3JQX A;  3OPZ A;  4H3W A;  1FYU A;  2MEV 3;  2W9X A;  4KU7 A;  1RUI 1;  1NAE A;  1JZ6 A;  5T3N A;  3SH5 A;  5C9A B;  3Q8A A;  5FZO A;  1HXS 1;  5H9R A;  2OW4 A;  1XNK A;  4FSJ A;  4HT1 T;  2PAM A;  3I3E A;  4KWU A;  5FRA A;  5L7O A;  5LBC A;  4FFF A;  2OUH A;  3D6E A;  4PQQ A;  4IL7 A;  5ABJ B;  3USU B;  1GKB A;  3TBD A;  4F83 A;  3LFM A;  4FVV A;  5JUV A;  4FTS A;  1EP0 A;  1LTE A;  1W6O B;  4QPG A;  4FCA A;  5IVF A;  2J1T A;  1NQD A;  1FNZ A;  3NO8 A;  1W6P B;  4DB5 A;  2HWE 3;  2JIJ A;  1TME 2;  2A1X A;  2YG0 A;  4FPE A;  4EV0 A;  2JD9 A;  1FPN 1;  3AL6 A;  1QJZ A;  1W3X A;  2IFW A;  1ZZ8 A;  1CAX A;  2O14 A;  2WNU A;  4ATE A;  1WBL A;  3C7O A;  5IVE A;  4IV1 B;  3ZXK A;  2AH2 A;  2PAE A;  3FFZ A;  5BXX A;  3IT8 A;  2CU5 A;  4JQR A;  1GZT A;  4Q26 A;  3M4F A;  1GZ9 A;  1MZ6 A;  3LKJ A;  5JIA A;  1QJX 1;  2D7F A;  1QQP 3;  4NJ4 A;  4P14 A;  4QGM A;  5DUX A;  4EWD A;  1AR9 1;  1VBE 2;  4LBQ A;  3SH4 A;  3V0B B;  3I2D A;  3PME A;  1RUD 3;  1S0B A;  1LES A;  4QWN A;  1AL0 G;  5IK5 A;  2F6B A;  3V65 A;  5BNN C;  3VDB A;  5JXJ A;  2WS9 1;  1HIX A;  1HLC A;  4FFI A;  4MX3 A;  1D7P M;  3H1W A;  5FUP A;  2E7T A;  2K0G A;  5FPA A;  1H9W A;  4PF1 A;  1W8N A;  2RS1 1;  4XMA A;  3PUS A;  4C0B A;  3HOB A;  4Q4V 3;  3I7D A;  4X8P A;  5GZE A;  5FZA A;  5GLU A;  5JVV A;  2YB7 A;  5J37 A;  1MS1 A;  2J1S A;  3ZDV A;  3KLS A;  1OA4 A;  4IW3 A;  5FOB B;  2AC1 A;  4RHV 2;  5LAT A;  1MZ5 A;  3S7I A;  1AZD A;  2ARC A;  3LD8 A;  4GJY A;  3OB8 A;  1LOF A;  3K4D A;  1ZZ9 A;  4AZZ A;  3ZFG B;  4PI0 A;  4FOW A;  4C8D A;  1HRV 1;  5L19 A;  2VXJ A;  1JW6 A;  4JCK A;  4MET A;  2ZTN A;  1SLI A;  3BOD A;  1AR6 2;  1STM A;  1TMF 2;  2QQL A;  2I74 A;  3RYK A;  1MPX A;  3ZPY A;  5C9A A;  1JHN A;  1DQ1 A;  1QXJ A;  1OVP A;  5DPN A;  1CJD A;  3BU7 A;  4CDW A;  4AFC A;  3TEW A;  2DU0 A;  4OHY A;  1GP5 A;  2A3X A;  3M3C A;  4QXH A;  5LRR A;  2LW8 A;  2RM2 1;  4NR1 A;  2WZR 1;  1GV9 A;  3OUI A;  5C33 A;  3ZYG A;  4D69 A;  3O1P A;  4CXX A;  3MPP G;  3UGF A;  3OUH A;  5IFT A;  3Q8B A;  1N1T A;  2VM9 A;  1XSQ A;  3GZE A;  4F8A A;  4ZZ8 A;  4IGQ A;  3CKH A;  3OEA A;  2NLR A;  4A3Z A;  3RVH A;  1X33 A;  2QQP A;  3GCX A;  4XQ4 A;  3EO6 A;  2KM2 A;  3MZH A;  4I0B A;  2JDP A;  4P9Y A;  3AK0 A;  3KV9 A;  3ACI A;  3KWV A;  4LLF A;  5FZ3 A;  5LY1 A;  5FZ1 A;  4UWD A;  2ZBJ A;  1H2N A;  1AF9 A;  5KWR A;  1G9C A;  1VB2 A;  1HKD A;  1XYP A;  1X9T A;  2XJT A;  1F9K A;  4Q27 A;  4SBV A;  2HKX A;  5DG1 A;  2IVI B;  5LCW L;  5FY5 A;  4Q2F A;  3OYW B;  1RUJ 3;  2A6Y A;  2UYA A;  1RIT A;  1NUK A;  4MV2 A;  4OUS A;  2A5Z A;  4JGZ B;  5FZ9 A;  4NII A;  5FOJ B;  2JIG A;  3K75 B;  2Q4S A;  3JB4 C;  3IKW A;  2RJL A;  4LO4 B;  4AG4 A;  5D8A A;  5FLI A;  2DUO A;  4RD7 A;  4YNI A;  4IEW A;  4MXV A;  1JOD A;  3PHM A;  4AVS A;  4CDU C;  2VEC A;  3N9O A;  1B35 C;  2ZKL A;  3WNK A;  4BA6 A;  2JX9 A;  5D21 A;  4M0H A;  5CAD A;  3OBT A;  2X05 A;  5C5T A;  1HXS 3;  4WVW A;  3UNP A;  4K3U A;  4QGL A;  1UXX X;  1JMU B;  3R4D B;  1D4M 3;  5FCC A;  1QDO A;  1HN0 A;  3WNL A;  1NA1 B;  5HV4 A;  1DG6 A;  3JCI A;  4M4P A;  3HNY M;  4K8R B;  3D3A A;  4HK8 A;  1N3Q A;  1DQ5 A;  1NCQ C;  4AK3 A;  2ZGM A;  1OF4 A;  2CHH A;  1JOB A;  1OLM A;  1YNA A;  3B9I A;  2ARX A;  3D0S A;  3OJB A;  4L11 A;  4LBQ B;  1LHU A;  2ZMN A;  1ST8 A;  1WCQ A;  1ODN A;  1QJU 1;  2XVL A;  4KH9 A;  1GNH A;  1Y9M A;  1YO8 A;  3UYJ A;  4CA9 A;  4K1Y A;  3DKW A;  1HQL A;  1Q8S A;  1ND3 B;  5DAW A;  1VAM A;  5A7N A;  4QQL A;  4RGG A;  1T6G C;  3IIA A;  5IVY A;  3ZFF B;  2RR1 2;  1IOA A;  3POE A;  1P8J A;  1D2S A;  1RUG 2;  1V9U 3;  2OUJ A;  1RVF 1;  1UU6 A;  2C1F A;  2C5D A;  3LA3 A;  4IEY A;  4QAW A;  2VL4 A;  3FX3 A;  5C4W B;  1AR9 3;  4QX5 A;  3AX4 A;  1BEV 3;  2RS5 1;  4KGG A;  2Y64 A;  5FMD A;  4Y1U A;  3BTZ A;  4LQR A;  4AGR A;  2QZ2 A;  2AEY A;  3QCW A;  4TLG A;  4CP1 A;  1DZR A;  5FYM A;  4Z2A A;  4AR2 A;  5FWE A;  4N9I A;  3THT A;  2HWB 2;  5C8C A;  4Q0U A;  2ARB A;  1HB3 A;  5G04 L;  3VBR C;  4A42 A;  3CBN A;  2A70 A;  3F95 A;  3HWJ A;  3U14 A;  1TZO A;  3WF2 A;  3WNM A;  3BAL A;  2D40 A;  1VMF A;  1I9R A;  5KC5 A;  2WZ8 A;  5FZG A;  4LBL A;  5JR2 A;  2YUE A;  1RIR A;  4LIT A;  5AVA A;  4KNC A;  5HXV A;  2D3P A;  4FPL A;  3WUD A;  3H42 B;  4CEY C;  1Z7S 2;  1EV1 2;  3VBU C;  4TTG A;  1RXF A;  1CES A;  4IEZ A;  4K1Z A;  1GOF A;  4XAC A;  1AX2 A;  1UU4 A;  1OUR A;  2WYF A;  2Z2S B;  2Z5W A;  4P9G A;  3WUC A;  2X29 A;  2UY9 A;  4JHZ A;  4AQ6 A;  4F3J A;  4MOA A;  3AM2 A;  1PGS A;  2DFC A;  2W92 A;  5KHG A;  1RTV A;  2A71 A;  2R49 A;  3ILR A;  1WLW A;  2ZKN A;  1VBC 2;  2EIE A;  4ZHN A;  1HRV 3;  4QX2 A;  1QU0 A;  1W8T A;  1DQ2 A;  1QOT A;  5CFC C;  5FY8 A;  2BYV E;  1MS4 A;  1XOY A;  4LBQ D;  1C1L A;  3DEC A;  1BBT 1;  4IER A;  3LEK A;  3RYR A;  5I91 A;  1D0G A;  1J84 A;  2GNM A;  2Y0I A;  5FR3 A;  4JKL A;  1C5H A;  3WNN A;  3EMR A;  1IGO A;  3KZ4 C;  4CP9 B;  1SQ4 A;  1ONA A;  4NHK A;  1OKQ A;  5FKC A;  3ZXF A;  4A6O A;  2P37 A;  2ARE A;  2F4L A;  2VOX A;  3TN9 3;  1LAJ A;  3R4S A;  4DXR A;  3DEM A;  3L2H A;  3ETP A;  3GNE A;  5LW9 A;  2WZR 3;  4FBF A;  1G9B A;  1JU3 A;  3SCF A;  5BNO C;  4YGD A;  1QJY 2;  3QH6 A;  1H8T B;  3WNX A;  3M3I A;  4AI3 A;  4UF0 A;  2XKP A;  5FP8 A;  4AVT A;  3VV1 A;  5FFO C;  2VZP A;  5CA6 A;  1XXN A;  1NX9 A;  1PVC 1;  1AUY A;  5D8A B;  1E5S A;  1PNF A;  2XJP A;  3APB A;  3PVE A;  4M3C E;  2A6W A;  4LHN A;  3WD5 A;  2FDH A;  1IQA A;  2VZS A;  4XZU G;  1VBE 3;  4IEP A;  3BPZ A;  1ENQ A;  1WLD A;  1UZV A;  3O1V A;  5LA0 A;  2G9Z A;  5TSW A;  4Z07 A;  1IQD C;  2JE8 A;  3NV1 A;  2P1B A;  5GM0 A;  3PVO A;  3ETQ A;  4HKW A;  5JWP A;  4OHX A;  2WDB A;  4LXL A;  2YZ4 A;  3T0B A;  2C24 A;  1ASJ 2;  3CJI A;  3I3Q A;  2OQ7 A;  3O1S A;  2NMO A;  4PT6 A;  1ULP A;  3UJQ A;  3N7M A;  2LTN A;  2EVX A;  4HSL A;  1NYW A;  3U10 A;  4AWD A;  3ECQ A;  1COV 2;  3A21 A;  3VKM A;  4FPO B;  2ZX1 A;  4QX7 A;  3FLT A;  3SCH A;  1XNB A;  4E4Z A;  3ZXD A;  4QHB A;  2VJX A;  3I97 A;  3POY A;  4OI2 A;  1BXH A;  1RB8 G;  1AYN 2;  2B7Y A;  4LO6 B;  4SLI A;  3MIH A;  1ALY A;  3C7F A;  4Q29 A;  1ODM A;  2R0F A;  1S2E A;  5HI0 A;  3K4A A;  1RHI 1;  1WBF A;  3T2Q A;  3VL8 A;  1AR6 3;  4DEQ A;  1O4T A;  3DN7 A;  4XVH A;  4GWJ A;  4HK9 A;  1N1S A;  1MVQ A;  1UL9 A;  3CLP A;  1RUF 2;  1GLH A;  1V6O A;  2JG9 B;  3VKN A;  4CDQ A;  5J3U A;  2PLV 2;  3AZW A;  2P17 A;  2VUL A;  2BQP A;  1C8N A;  3MIC A;  3M8L A;  4COU A;  2NPI A;  3E5Q A;  3LIG A;  3C7G A;  3M7A A;  2WSU A;  3R6S A;  1YWK A;  4YWA A;  2C0Z A;  4R4Z A;  1LNS A;  2D44 A;  3U07 A;  2DYC A;  1X8M A;  1RXG A;  3A22 A;  2Q8E A;  1UX6 A;  4GXL A;  4IEQ A;  3ZIX A;  1OA3 A;  1DGR N;  4QXB A;  4I2O A;  5FYS A;  3MHZ A;  4XBQ A;  4AE2 A;  4Q0P A;  4AQS A;  3MLJ A;  3FMG A;  4CP0 A;  5FRE A;  1ZX5 A;  5FP3 A;  4GQ7 A;  3NAP B;  3VBH A;  4GH4 B;  4XZP A;  3WQB A;  1G86 A;  3J7M A;  4AI2 A;  5FPX A;  2GU9 A;  4E4D X;  4AQ2 A;  2R07 3;  2ZAB A;  2ZHN A;  4XJ8 A;  4FQZ A;  5A33 A;  5A32 B;  4AAX A;  4HVQ A;  3GM8 A;  1LEN A;  5IVV A;  2IUW A;  3VBF B;  1OXC A;  3I3D A;  4JRL A;  5HXM A;  2LAL A;  1V6K A;  2VAU A;  4FPC A;  3N36 A;  3JD7 1;  2RMU 1;  3WW4 A;  1BQP A;  4QMA A;  4N43 A;  1VBA 1;  2PEL A;  1W8Z A;  4COV A;  3SMH A;  3H9A A;  4KU8 A;  1G9A A;  1DCS A;  3NNL A;  4PQ9 A;  4XFG A;  1GNY A;  1EUU A;  3ZN4 A;  1RUH 2;  1UYX A;  2VXR A;  4AED C;  5JCT A;  5A70 A;  3O12 A;  2W87 A;  2XVG A;  1CON A;  3KV5 A;  4MGI E;  3PNA A;  1SFP A;  2DWR A;  3NVC A;  4XMI A;  1RUE 1;  4UF0 B;  2SBA A;  1BBT 3;  3AJZ A;  1PK6 C;  1OOP C;  1VBD 3;  3PUR A;  3AZX A;  1NE6 A;  4IE4 A;  2YC2 A;  2UYB A;  1OQD A;  3RDI A;  2BOJ A;  5E16 A;  1Z78 A;  3GZT B;  3IMN A;  2FDF A;  5T50 A;  4NID A;  2GAU A;  4RR3 A;  4K40 A;  1O7F A;  3VZO A;  4LBO A;  5I8T A;  1UAI A;  3VZM A;  4LKE A;  2ZGL A;  2JDY A;  1GU3 A;  4N8M A;  3GZA A;  5FZM A;  3VD3 A;  3HAG A;  4QQP A;  1R1A 2;  2A3W A;  4P9I A;  5L9R A;  1FMD 2;  3ZSJ A;  2XBO 1;  2LM3 A;  2BW8 A;  1S0D A;  3VHN A;  1QOS A;  1AXK A;  4N53 B;  1LEC A;  5FYY A;  3HR9 A;  5LB6 A;  2EID A;  3PVB B;  4LHL A;  1XSR A;  3BI3 A;  1JTZ X;  3AP6 A;  1W6M B;  2HWC 3;  2RR1 3;  3K51 A;  5DUU A;  3RWK X;  1RUG 3;  4LJH A;  5EJ1 B;  1JYV A;  2Y6J A;  2X10 A;  3CJI B;  4PCR A;  1QXR A;  1ZBE 2;  1R09 2;  2GC3 A;  5K0U C;  1YQC A;  4LKS A;  4W4Z A;  4IDZ A;  3KVA A;  3FE5 A;  1RGS A;  5F2S A;  1W9Y A;  1DLC A;  1WGP A;  2IFR A;  4MAD A;  1WLC A;  4QKB A;  2R06 3;  2DUR A;  3IWZ A;  4LMF A;  2HWB 3;  2WO7 A;  4DY5 A;  3NKT A;  4K6B A;  3WW2 A;  3IN9 A;  4Q4Y 1;  4FPG A;  2Q8C A;  2VGD A;  1QJF A;  4G4F A;  3DYO A;  2GMP A;  1POV 1;  1SLC A;  1T6B X;  3GBW A;  1W2T A;  2GZW A;  4OI4 A;  5KC6 A;  2E26 A;  3KCY A;  3V64 A;  4RS5 C;  5JZG B;  4CU8 A;  4GMP 1;  3B69 A;  1IG3 A;  1DDL A;  4X6Q B;  1CAV A;  1W6Q B;  5DDJ 1;  5BNP B;  1JZ4 A;  2PMW B;  1NLS A;  4OYU A;  1Z7S 3;  1EV1 3;  1ND2 C;  1Q56 A;  4DO0 A;  3BIE A;  1S55 A;  3KGZ A;  1NCR A;  5BNQ A;  1JZ8 A;  2Z79 A;  4CSW A;  2DFB A;  1MS3 A;  4LLO A;  3OUJ A;  4CDQ B;  1OLQ A;  1S0C A;  4W65 A;  4CPB A;  1SBF A;  4KG0 A;  1F35 A;  3KGL A;  2ZOE B;  4MHU A;  5BUV A;  3J8F 2;  1V6L A;  2HWD 2;  2XL7 A;  3WY6 A;  1JZ7 A;  4Q0V A;  3ZXA C;  1F4A A;  1RHI 3;  1PIV 1;  1RMU 3;  1UF2 C;  3E5X A;  2D93 A;  5BNN A;  1NY7 1;  2JG8 B;  3CZJ A;  1OH3 A;  3Q8E A;  1AYM 2;  3WP6 A;  3ZYB A;  5CFD C;  1V00 A;  2PHT A;  2O1Q A;  3P6B A;  4KGQ A;  3POG A;  2O0O A;  2IC1 A;  1YFX A;  3OGR A;  4NO4 A;  2XJR A;  4RGA A;  4E9K A;  5F5A A;  2ORZ A;  3VBH B;  2DUQ A;  3UKV A;  4XHB A;  1AR7 1;  1UYZ A;  3IB3 A;  3MLK A;  2PA7 A;  1W9S A;  3I59 A;  1KJR A;  2WAO A;  4JHT A;  5J09 A;  2YBP A;  2QE3 A;  2AGS A;  1QJY 3;  2I07 B;  2PQS A;  3MEP A;  3M3Q A;  4IES A;  2HLE A;  1S0F A;  3ZYP A;  3O0X A;  2QQV A;  4FPF A;  1W9T A;  1UIK A;  1U5Y A;  4KWK A;  2QBX A;  3H0O A;  1K3I A;  4XFF A;  5JIU A;  4D7Y A;  1IS6 A;  2PAK A;  1O91 A;  2P5B A;  5FXV A;  4A45 A;  1GBG A;  4B1L A;  4YM1 A;  5A7Q A;  2YMZ A;  2HWE 1;  4IV3 B;  4ARY A;  4M0N A;  2P6H A;  1XQN A;  1XB9 A;  2BTV C;  3MF6 A;  3WP4 A;  3RJR A;  3N3H A;  2WNV B;  3AJY A;  3VD5 A;  1AX0 A;  1RIN A;  2C26 A;  2DBN A;  2VCB A;  3DXT A;  3FJS A;  1H2L A;  2FDI A;  3H8O A;  3PU3 A;  3GHN A;  1GYK A;  4Y1Y A;  1Q43 A;  2B9U A;  3KMH A;  3LDK A;  4BWO A;  1MR5 A;  2JE9 A;  2FHR A;  3AFG A;  4DIQ A;  3CEW A;  4BJ0 A;  1OC1 A;  3IDE A;  3H7Y A;  1ASJ 3;  1LOG A;  1QQP 1;  4JKK A;  2WN3 A;  3RQ0 A;  1JS9 A;  1Y9G A;  1IHM A;  4AVA A;  1CAW A;  1J3R A;  4N7U A;  4AI9 A;  5EPA A;  1COV 3;  5D1I A;  1RUD 1;  3KF3 A;  2GC2 A;  2DDU A;  2W47 A;  4LTA A;  4XAE A;  4BH9 A;  3ZMO A;  4S2F A;  5IVC A;  4UYB A;  1G8W A;  1Y9Q A;  1AYN 3;  1PNG A;  4WV8 A;  4CYD A;  1CN1 A;  2DU1 A;  4BQ3 A;  3PIJ A;  4URA A;  5DMY A;  5J36 A;  1APN A;  3OGJ A;  1SBE A;  3T08 A;  3W58 A;  4NHY A;  5A3P A;  4MGY E;  1CR7 A;  1K5M B;  1VAV A;  1MEC 3;  1E5R A;  2E53 A;  3EQE A;  2X09 A;  1Y43 B;  2YDE A;  1BK0 A;  2B39 A;  3KVB A;  3HMY A;  4FXK B;  4ITC A;  4M01 A;  2K2S A;  4Q4V 1;  5CBL A;  2W1W A;  3QAC A;  1QH6 A;  1RUF 3;  2DBI A;  1H2M A;  1TG7 A;  3FLR A;  4X8N A;  2FMY A;  5EP9 A;  3I2H A;  4M3C B;  1WW4 A;  3HBZ A;  3ZO0 B;  4M00 A;  3S30 A;  1S0I A;  1IS5 A;  3LEG A;  5E88 A;  3LEM A;  4CDU A;  4FTB A;  5JSR A;  4M3C F;  1V6N A;  2QJV A;  3SEP A;  2JDK A;  1OF3 A;  5CVR A;  1MQT A;  4FOY A;  3I54 A;  1J3P A;  2P3K A;  4EWA A;  1LOC A;  1WCD J;  2DV9 A;  3KB5 A;  1OD3 A;  4B29 A;  2ET1 A;  2VW1 A;  4NE9 A;  3W20 A;  1IS3 A;  2ETE A;  1HV1 A;  2ENR A;  3BN6 A;  3M3E A;  1RUI 2;  5F9T A;  1NCR B;  3VBS B;  1KD7 A;  2ZGO A;  2ES3 A;  2XQX A;  3I2J A;  4PI2 A;  3NV4 A;  4FAH A;  4MG2 A;  2BGO A;  3F2Z A;  3FWE A;  3N9P A;  3NJV A;  1H0B A;  1PVX A;  5BV6 A;  4HKL A;  1SLL A;  2XB6 C;  3JBG 1;  1KJL A;  1VR3 A;  3POJ A;  1G7Y A;  4DPN A;  3UGG A;  4KMQ A;  5DDJ 3;  3VHP A;  1U12 A;  2XML A;  5I0S A;  2C4X A;  1SHW B;  2V4A A;  3N4M A;  3A4U A;  4CRQ A;  2PN5 A;  4Q5O A;  1QEX A;  1WW7 A;  2VNO A;  3Q9O A;  5CKQ A;  4UW3 A;  2VZU A;  5A3L A;  1LHO A;  2Y6L A;  5IK8 A;  5FZE A;  5T5J A;  3IDC B;  3WDX A;  2JEM A;  1XE0 A;  2WJS A;  2IZW A;  3I59 B;  4N7I A;  4K8F A;  2VY0 A;  2ZEX A;  4WM8 A;  4L97 A;  3WIN E;  1SEF A;  3I2I A;  4XHX A;  4UFH A;  2ZGQ A;  1FT9 A;  3U78 A;  1W9W A;  5A3O A;  5FY1 A;  3D8C A;  3KHC A;  2RJK A;  2VU9 A;  1VE0 A;  1W2N A;  2YXS A;  1LHW A;  1ZZC A;  5A3N A;  2J22 A;  2WQZ C;  5C3O A;  2NQY A;  4PDW B;  3TOJ A;  3MIG A;  3MIF A;  4BXS V;  2WS9 2;  4TZD A;  3WQ0 A;  4IGO A;  1NT0 A;  1XNC A;  2GN3 A;  2BER A;  4XCB A;  3LSD A;  1FMD 3;  4NUB A;  2FCU A;  4XYX A;  2QCS B;  1OLM E;  4CEY A;  3VBU A;  5GJ6 A;  5I8Y A;  1RJ8 A;  1VBB 2;  2BWA A;  4W6W A;  1FAY A;  1UIJ A;  3WNP A;  4B8E A;  4ZS3 A;  1D4M 1;  1PMI A;  1S1A A;  4L0P A;  4ZU5 A;  3SKV A;  1YQ2 A;  1PM4 A;  4MVT A;  1MS0 A;  1V70 A;  4AEJ A;  2ZAH A;  2FZ2 A;  4LK7 A;  2WZE A;  5GLV A;  1V6J A;  5F39 A;  4E2S A;  4CPB D;  2CL2 A;  2NN8 A;  1YEW A;  3DPR C;  3N9M A;  4UW6 A;  1J1L A;  3E5U A;  1CAW B;  5CFC A;  5IVJ A;  4N9H A;  5FBZ A;  4BE3 A;  1LB2 A;  1BMV 2;  3G6J B;  3LCP A;  3VDD A;  3N35 A;  5A6Z A;  1UOJ A;  2BFU L;  2XLA A;  4BK4 A;  5A6X A;  1ZVF A;  1QNW A;  4U2A A;  3E6C C;  2VTF A;  3AVS A;  1UPS A;  3MI8 A;  3WDT A;  3X29 B;  3BB6 A;  3VD4 A;  3UET A;  1KDK A;  4KBZ A;  1NQJ A;  1TQ5 A;  4YZ4 A;  1C5I A;  1V9U 1;  1MS5 A;  3DKQ A;  3HJR A;  2EF6 A;  2MHF A;  4QPI C;  4C0H A;  1EAH 1;  4XIL A;  2TEP A;  3OY8 B;  4D6S A;  1UO9 A;  5A7S A;  3ZKY A;  4B3N A;  5BNO A;  3E97 A;  4BIF A;  1BEV 1;  3GYD A;  3OEB A;  3BTX A;  1LU2 A;  4JV4 A;  3T0D A;  4LNV A;  3BTY A;  4XJ9 A;  3WF1 A;  4Z92 B;  1CVN A;  3OBA A;  1GZW A;  4BQ1 A;  3FHI B;  4H7L A;  5GLW A;  3HPN A;  4COY A;  3ZN6 A;  4LUM A;  2BRT A;  4Z2W A;  2ERF A;  3WHT A;  3K3N A;  1J83 A;  3MUZ 1;  3V56 A;  2D6M A;  4XFB A;  1BKZ A;  1UZY A;  3ZSK A;  1YFY A;  2JJ6 A;  2GP3 A;  3URF A;  3MYX A;  1MQT B;  2W1U A;  1DGR A;  1ZZ7 A;  3I8T A;  4OHZ A;  1IZ3 A;  1PO2 1;  3WCS A;  1QDC A;  2A3Y A;  1UQX A;  3IAP A;  4PLO A;  5ACA 2;  2HWF 3;  4JGY C;  2Z42 A;  4RA0 A;  3RGB A;  5FZF A;  3VKL A;  1QOO A;  2DVA A;  1WD3 A;  2OXB A;  3WOG A;  2B5H A;  4FFH A;  4P9W A;  4XQW A;  1KIT A;  3D0J A;  1HJF A;  1VAL A;  1VIW B;  2HBU A;  3H3Z A;  3S5Q A;  4CCD A;  3T30 A;  3SLI A;  4YVW A;  3WSO A;  2VOW A;  1OH4 A;  3LF7 A;  3L9J T;  3V0A A;  2ZX0 A;  4EQV A;  3IPV A;  2J1U A;  5FZ4 A;  4CP2 A;  2RE9 A;  2GH8 A;  1XC6 A;  4YVS A;  1TNR A;  5EV7 A;  5E8A A;  4YG0 A;  3KF5 A;  3MW2 A;  5FZI A;  3ROU A;  4O65 A;  3WW3 A;  4NHL A;  2XGX A;  4D8M A;  2JEN A;  1XNA A;  4CCM A;  1N3O A;  3AZY A;  3A23 A;  3TN9 1;  4EYU A;  1OLR A;  3EB7 A;  4MGZ E;  4Y5T A;  3ZFE C;  3QH7 A;  5AFB A;  1IPS A;  2R04 3;  2XUE A;  4WM8 B;  3JBG 3;  3IDB B;  5A7W A;  4UFJ A;  1YQ6 A;  3WP5 A;  2OT7 A;  3TNQ A;  2VQ0 A;  4HVR A;  4M4R A;  2XHK A;  2GSY A;  1N3P A;  3LWC A;  4GB3 2;  4I09 A;  1ULF A;  4IEX A;  5GAL A;  3LGR A;  3THP A;  3OSD A;  3KQR A;  3LDR A;  3POS A;  1GOG A;  3PLQ A;  5LEJ A;  1SFY A;  5IT6 A;  2Y0O A;  3WXP A;  1GIC A;  2FDG A;  1YXW A;  1IG0 A;  2DCY A;  1VBE 1;  4QHZ A;  5FYC A;  5DUV A;  3BU0 A;  3OGG A;  5ABJ C;  4XBN A;  1UMZ A;  4I01 A;  1VP6 A;  1RVF 2;  2W68 A;  4Z8B A;  3CIH A;  4I0W B;  5FZO B;  4B4Q A;  3LSE A;  4HBN A;  1U5X A;  2ZGS A;  3W9A A;  4BZ4 A;  3TEX A;  3ZXJ A;  5FPV A;  2RS5 2;  4P5H A;  3RZL A;  2NZ9 A;  4HAN A;  4LBN A;  3HBK A;  4BYY A;  1OSG A;  4W8J A;  2CWS A;  1WMD A;  4P9L A;  5I0D A;  4QPG B;  2VNR A;  3NV2 A;  4GWM A;  4FPK A;  4IV1 C;  3SCG A;  2QVS B;  5JR7 B;  4FP3 A;  1IPJ A;  5B4N A;  5CFC B;  3ABZ A;  3ZYH A;  1LGB A;  3E6B A;  4O61 A;  2LRP A;  2VQA A;  3VDD B;  3VHO A;  4CU9 A;  4Q8K A;  4YW5 A;  1W8O A;  1DYK A;  2YPD A;  3FHA A;  5LA2 A;  2WNU B;  1CAX B;  1FOD 2;  3SIT A;  1WCK A;  4ONU A;  4RHV 1;  1LJ7 A;  2WWJ A;  3ATG A;  3WG4 A;  3ZYF A;  4Q0Q A;  2BNO A;  1PZ9 A;  4Q8L A;  3MV0 1;  4HPK A;  4XET A;  4C1X A;  4CUA A;  5JXH A;  2BBV A;  4QQ2 A;  1JYN A;  2OZJ A;  4E8D A;  1SCR A;  1S0E A;  4AED A;  4AI8 A;  4HET A;  5LRS A;  4B1M A;  4QKN A;  3J26 N;  1HV0 A;  5FXW A;  3GBF A;  1A6C A;  1AR6 1;  2YC4 A;  2XQR A;  4QHO A;  5JAX A;  4TWT A;  1PK6 A;  5DXD A;  1R1Z A;  4IEV A;  1XU2 A;  4WZC A;  2ARA A;  3WG2 A;  1GZW B;  1XPW A;  4GD4 A;  3HNM A;  5HCA A;  3A0N A;  3FZ3 A;  2P6C A;  4ZZ5 A;  4KBB A;  1TVG A;  2W1S A;  5EWS A;  1PZ8 A;  4CEW C;  5T52 A;  3PUQ A;  1M06 G;  1EAH 3;  3C2U A;  1O3Q A;  3AFK A;  2BVB A;  1HB1 A;  2IXL A;  5I8S A;  4B7E A;  1R08 2;  2F17 A;  3ZFG C;  2JE7 A;  2ZHL A;  2A6X A;  4OCT A;  4XF4 A;  1A8D A;  2DVF A;  2Y38 A;  4QT6 A;  5F3E A;  5LA9 A;  4DRR A;  5HBA A;  1TE1 B;  3W21 A;  2FZ1 A;  2OKX A;  3ZN5 A;  1UOG A;  4XDP A;  4ZS2 A;  4GUL A;  5FXX A;  2ADD A;  4YVW B;  5K0U A;  3LFI A;  3RMX A;  3ELN A;  1RYY A;  2ZPX A;  1IKP A;  3V0A B;  2R07 1;  5JZG A;  1S2K A;  1XYN A;  5C3Q A;  5FPU A;  1PO1 3;  1PO2 3;  3CF6 E;  5J98 B;  1BZW A;  4EN9 B;  2QZ3 A;  4YVS B;  3OD0 A;  4OMC A;  3HN1 A;  3KM5 A;  3GJA A;  4LO7 A;  1FAT A;  1SBD A;  3CHX A;  3KS7 A;  1PGL 1;  4FPJ A;  3RYP A;  1C3H A;  2R7E B;  4A7K A;  5J96 B;  2IXH A;  3IBM A;  3FUO A;  3POF A;  4CDW B;  4Q1P A;  1WW6 A;  1X7N A;  2D5H A;  3O5S A;  2ZEZ A;  4HXC A;  4RS5 A;  4BCU A;  5I0R A;  1GP4 A;  4RYD A;  1B09 A;  1E57 A;  1YQ5 A;  3HIF A;  2YYO A;  4P08 A;  4PHZ A;  5DG2 A;  3CJX A;  4OZO A;  5HCF A;  5A7W B;  2ILM A;  1O4Y A;  1X9P A;  2QQU A;  2XHN A;  2Y60 A;  3ME2 A;  2G1M A;  4I3P A;  3R0R A;  4Y22 A;  5F5Q A;  1VBD 1;  1H1A A;  4YM2 A;  5CYY A;  5FAX A;  4XAB A;  2PQQ A;  2J42 A;  2PYT A;  1JU4 A;  5FLJ A;  1W2U A;  2JD4 A;  4QXK A;  4BIS A;  3HQR A;  4WM7 A;  1WUV A;  1CX1 A;  5L7O C;  2OYZ A;  2AEZ A;  4XPV A;  4H7M A;  2OZ6 A;  1SMV A;  1TME 3;  4JGZ C;  4LE4 A;  3C7H A;  2VD7 A;  4RQP A;  1CPN A;  1CWP A;  2EIC A;  1NOV A;  4HN0 A;  5BYN A;  1UZ0 A;  2MPF A;  4N90 A;  4MGQ A;  4AVV A;  2Y34 A;  3T2T A;  1AL2 2;  2FQP A;  3O1O A;  4AYU A;  1OFS A;  3SH3 A;  4JAA A;  1JZ3 A;  1K45 A;  3K2O A;  2HWC 1;  2HEY F;  1G6N A;  2WLQ A;  2RR1 1;  4MZU A;  4QDQ A;  3ZYR A;  1RUG 1;  2XJQ A;  4QB1 A;  1O3T A;  1BCX A;  2VPV A;  5F3I A;  3W5M A;  4RFT 0;  4FOV A;  4K20 A;  2RS3 2;  1NA1 C;  1F15 A;  1XJA A;  2E6V A;  1XND A;  1NZI A;  1WMF A;  2W91 A;  4AW7 A;  1AXZ A;  5A3M A;  2RJ2 A;  1AR8 2;  2IVJ A;  2AZ5 A;  2Q0A A;  1TEI A;  2R06 1;  4FP2 A;  2QQI A;  4IND A;  5FJK A;  4J6G A;  2HWB 1;  2PHD A;  2QNK A;  5HCB A;  2JXA A;  4Q1R A;  1QKQ A;  2WFF 2;  5JOX A;  2WA4 A;  2FCV A;  2LRO A;  2VUJ A;  4K9S A;  4UAP A;  3WF0 A;  4GAL A;  1S0J A;  1ND3 C;  2A7A A;  2C9K A;  2MNG A;  1I1E A;  1JI6 A;  3ZFF C;  2XR4 A;  2D98 A;  3KQ4 B;  3WEZ A;  5ACA 3;  2VOV A;  1Z7S 1;  1EV1 1;  4R4X A;  5C4W C;  2R0H A;  5H9S A;  3FBM A;  4RHV 3;  4DFS A;  2YHJ A;  4UFL A;  3WF4 A;  2O8O A;  2VUC A;  5F2W A;  3VN4 A;  1EPW A;  1W06 A;  3VLB B;  4P02 B;  3BYW A;  3LA2 A;  3NRU A;  4FPH A;  1PX4 A;  3P3P A;  3S5A A;  4HN1 A;  4Y4Y A;  2WO2 A;  3NV3 A;  4RFR B;  4OI1 A;  3MLL A;  5IYY A;  1OPM A;  4R9D A;  2RMU 2;  2WO1 A;  3VUO A;  1RMU 1;  3NNJ A;  1LOF C;  2JWP A;  4A3X A;  5F6K A;  1VB4 A;  4KQ7 A;  1TMF 3;  2KD7 A;  3PUI A;  4GIQ A;  2WLP A;  4NWV A;  2Q5T A;  4TLF A;  4B4P A;  3UT0 A;  3OTF A;  1NKG A;  2BWC A;  3K3O A;  2E31 A;  1PMJ X;  3T0A A;  1GSL A;  5AC9 2;  1C4R A;  3AMP A;  5I0T A;  1RUE 2;  2OII A;  5C8C B;  3AZZ A;  4BQY A;  1D0H A;  2YU2 A;  3JUU A;  3PJY A;  3ACL A;  3SC7 X;  3D82 A;  5C9A C;  5A1L A;  5J1X A;  1LED A;  5HPO A;  3AYC A;  2VMG A;  4EWE A;  1W0O A;  5LWB A;  3B9C A;  1QJY 1;  1FI2 A;  2LS6 A;  4HSJ A;  4IGP A;  5DAV A;  2DF7 A;  4GB3 3;  5F37 A;  1RC6 A;  3ZX7 A;  4PBP A;  5HCH A;  5GZF A;  4OUM A;  3GXU A;  1ENR A;  4UW5 A;  5GZD A;  2J1A A;  1O3S A;  4OFG A;  5A1F A;  5CKN A;  2D6O X;  1RL3 A;  2IWG B;  1W9F A;  5FV3 A;  4AHY A;  3CMG A;  4CCJ A;  1QNY A;  4UFM A;  3SQO A;  4MXW A;  3T2P A;  2FDK A;  2UWC A;  2I45 A;  3MW3 A;  5I0U A;  1ACC A;  2ZAA A;  4JKM A;  4LOT A;  4Y22 B;  3O1R A;  1Y4W A;  2XXZ A;  4YM3 A;  3BTA A;  2OX0 A;  4ARX A;  2VNV A;  2D6K A;  2LUW A;  2VZO A;  4GKY A;  4XJW A;  5FMB A;  4BB3 A;  4CVU A;  5JPN B;  4DZG A;  1H8T C;  2P3Y A;  5C3R A;  1ASJ 1;  3PU8 A;  4NPL A;  5CEH A;  4DEV A;  4WM7 B;  1KS4 A;  1SLA A;  1X8E A;  2YFU A;  1C57 A;  1ULO A;  2D6L X;  5FKB A;  5JMO A;  4CDX A;  1COV 1;  1MAC A;  4RQP B;  5DN2 A;  3B02 A;  2XL9 A;  2RHP A;  2ZGK A;  3NST A;  2X5I A;  1ZRR A;  4IE0 A;  2ZAC A;  4QQO A;  5D8A C;  4YPJ A;  3WDY A;  2B46 X;  4PJY A;  3OPT A;  2PHF A;  1FOD 3;  5FYZ A;  2GC0 A;  3RJ2 X;  3SXW A;  1JYW A;  4BXF A;  2DTW A;  4XAA A;  2RV9 A;  4E4S A;  5C3P A;  1AYN 1;  2D6P A;  3LPF A;  2K9Z A;  5GLT A;  1YFW A;  5KXC A;  3IAQ A;  3ALQ A;  1X82 A;  1BVV A;  1YJL A;  4PIY A;  4G9S B;  4Y20 A;  3KV4 A;  3AB0 A;  4XF3 A;  5FBJ A;  1OUS A;  4BPZ A;  1XNT A;  5FZH A;  4AFA A;  4EZH A;  1UD1 A;  1MEC 1;  3ENR A;  3DGT A;  4CXY A;  2E9Q A;  2J1V A;  2ZEY A;  2VUA A;  1ZA4 A;  2VVE A;  3IM0 A;  5LAS A;  5FYB A;  1RUF 1;  2OVU A;  2W1Q A;  1WA6 X;  4LT5 A;  1H4G A;  1DBN A;  3AC0 A;  1DGW X;  2P2K A;  1BHG A;  1BYH A;  2RG4 A;  4MGS A;  5FMO S;  3RZK A;  3TRS B;  4MGT A;  5FO8 B;  5KXE A;  4XFA A;  1TNF A;  3UKT A;  3LQC A;  1FV3 A;  3N9L A;  4Y1V A;  5F5I A;  3KT1 A;  3FL7 A;  2BZD A;  1R08 3;  1UZZ A;  2DCT A;  2WT1 A;  1AR7 2;  3GBG A;  2MEV 2;  4ES9 A;  3AP9 A;  3M3O A;  4GJZ A;  4ZXK A;  1WW5 A;  1ZBA 2;  2P34 A;  2YGM A;  4CUG A;  4DRV A;  1VRB A;  4LE3 A;  1V6M A;  1K5J A;  2BEO A;  1SPP A;  4ZY9 A;  1UWW A;  3O1M A;  2JG9 C;  5JSP A;  2R30 A;  1Q3E A;  4WZF A;  5IJR A;  3R05 A;  3ZIW A;  3VBO C;  2HWE 2;  2DCK A;  2VZR A;  1VLN A;  2W0X A;  3NJY A;  4Y5S A;  1UMH A;  2HJI A;  2BJS A;  3MUY 1;  1SDD B;  4J1X A;  3B7M A;  1E5H A;  4E2Q A;  2D6N A;  2BVV A;  1ULC A;  4QPI A;  1C8M 2;  3MO4 A;  3DXU A;  1AJO A;  3FBY A;  4ASL A;  1PGW 2;  5CFD A;  3QD6 A;  1JUI A;  1VBC 3;  1WKY A;  1RUC 2;  2DCJ A;  1XYO A;  2E32 A;  2YC0 A;  4NRP A;  5FO7 B;  4JC1 A;  2B42 B;  1UY4 A;  3LOI A;  2FBE A;  2Y6H A;  1QQP 2;  2IXK A;  2VNG A;  3NAP C;  4GH4 C;  3VGI A;  3ZDS A;  3MID A;  2QQO A;  2TBV A;  4J1W A;  4NRO A;  2V72 A;  4PBO A;  4Q4X 2;  3ZVX A;  1QJE A;  4YW2 A;  2ZHK A;  1GMM A;  4R9A A;  4A4A A;  4LA2 A;  5G05 L;  2KXL A;  2UWB A;  3VZL A;  3VBF C;  1CZV A;  2O8Q A;  1O8S A;  3PVN A;  4Q4W 2;  2CGO A;  2IXJ A;  3VD7 A;  3ZXL A;  1JUH A;  1O3R A;  2XOM A;  4CCE A;  3HT1 A;  4FQ4 A;  5E6H A;  2GAL A;  1FMD 1;  1CJP A;  1CZT A;  1H1M A;  2JKX A;  2DVD A;  3ON7 A;  1W39 A;  3JXS A;  5A33 B;  3DF0 A;  4BHP A;  2H0B A;  3LAG A;  1VRH 2;  2OA2 A;  4XFI A;  4YSF A;  1AL2 3;  3A0K A;  5FZB A;  4NAO A;  4W50 A;  4LBM A;  1GOH A;  4MGK E;  2PHX A;  3WDU A;  1UN1 A;  3WG3 A;  4ZPI A;  3THD A;  4NOT A;  4ZU4 A;  1IS4 A;  2V5D A;  4N43 B;  3T2O A;  1YI9 A;  5LK7 B;  1CQ9 A;  1ZRF A;  2UU8 A;  1UNB A;  3N7L A;  5FJH A;  3KD4 A;  1QGL A;  4CDX B;  3DV8 A;  4PLM A;  2X5I B;  4XFC A;  1DQ0 A;  1AR8 3;  4CUC A;  5JOY A;  5FMO L;  3HVD A;  2A75 A;  4RGK A;  4BK5 A;  2EXH A;  2PHU A;  4AXO A;  3HEI A;  2ZXQ A;  5FMC A;  2QFE A;  1Y7B A;  1ZNP A;  4N53 C;  1UY3 A;  3ZFE A;  4LPL A;  3UV9 A;  4RR3 B;  5E89 A;  1U5I A;  2D5F A;  1OVS A;  1URX A;  2RDR A;  5L73 A;  5J48 A;  2EA7 A;  3B3Q E;  1S4C A;  5L9V A;  1CD3 G;  5SV5 A;  5IAX A;  2VW0 A;  2W46 A;  1MZE A;  3CJI C;  3KT4 A;  1HRI 2;  4L8Q A;  4BM8 A;  5LBB A;  3I3B A;  5HV0 A;  1YJK A;  5FYV A;  4OQ9 A;  2HYK A;  3MDP A;  5JXG A;  1XRU A;  2EAK A;  1A3K A;  3WZ1 A;  2VOK A;  2BDR A;  2VBD A;  3I2K A;  2WWS A;  4XJZ A;  3AXE A;  3FHQ A;  1GWL A;  2JB4 A;  4H14 A;  1HX6 A;  1BJQ A;  1W6P A;  3MIB A;  2B8M A;  2HWF 1;  3SNM A;  1DF0 A;  1AYM 1;  4MH0 E;  3NW4 A;  4W6X A;  3SIS A;  1I5Z A;  2QQW A;  2FCT A;  2CAU A;  5EXO A;  5JZG C;  2PHR A;  4PIX A;  1FXZ A;  2PLV 3;  2WUH A;  3QLQ A;  5DZG A;  5AC9 3;  5BNP C;  1G9D A;  3UJO A;  1ZZ6 A;  4D7T A;  3NQH A;  1RUJ 2;  2WNO A;  1SPP B;  4QU2 A;  4TSV A;  2VCA A;  1B35 A;  4CDQ C;  4IEU A;  1VAK A;  4CCN A;  5JXI A;  4XDQ A;  1EY2 A;  3VKF C;  2DVB A;  1CAV B;  1N1Y A;  3M2M A;  3V0B A;  4AQT A;  2VUD A;  4HMZ A;  1KDM A;  1JYI A;  2G9F A;  3T4V A;  1JBC A;  4D3W A;  3K48 A;  5LBF A;  1VPH A;  3U37 A;  5LA1 A;  1HXS 2;  2JG8 C;  2HEW F;  5T5O A;  4FFG A;  1JXN A;  5EQU A;  4OUE A;  4NIA A;  1NCQ A;  1D4M 2;  1GAN A;  3U75 A;  1UKR A;  4NIG A;  1HN1 A;  2GNB A;  4AAP A;  4A7Z A;  2D97 A;  4FPY A;  5FZ7 A;  3B01 A;  1J3Q A;  2R04 1;  4XUQ A;  3VZJ A;  3A7Q A;  1JN2 P;  2W52 A;  3VBH C;  1BVP 1;  2E7Q A;  2NMN A;  3J7H A;  4EJR A;  2VQU A;  5BNN B;  5JPM B;  4BLI A;  4LUK A;  3AL5 A;  4QB2 A;  4U36 A;  4C91 A;  2YBS A;  5KHJ A;  1JYX A;  3KT7 A;  1LOA A;  3FLP A;  1FPN 2;  5F1R A;  2P3J A;  2VTX J;  4IE7 A;  3LB9 A;  2G4I A;  3SEE A;  4YW4 A;  3WNO A;  4CEW A;  2HBT A;  3H8U A;  1W03 A;  1CIY A;  3N9Q A;  2L9L A;  1RUH 3;  3PL0 A;  1WCS A;  2EIB A;  5DAB A;  5A7P A;  5T54 A;  3BKZ A;  3RPQ A;  3H1Y A;  1QJX 2;  2V73 A;  1FNY A;  5JDB A;  1SZB A;  1AR9 2;  2XJS A;  3N7J A;  4IV3 C;  1BEV 2;  1EUT A;  3PIG A;  3I2O A;  3TYJ A;  3ACH A;  4Y26 A;  4OZX A;  3MFC A;  3I49 A;  2R1B A;  2WNV C;  1PMH X;  3VBR A;  4XIK A;  3FC0 A;  4YZ1 A;  1UOB A;  1KEX A;  3MFA A;  1NXD 1;  4YZ3 A;  4YGE A;  4IXL A;  5K9Y A;  3ZSE A;  1VMH A;  1R1A 3;  1OKO A;  2AR6 A;  2WR9 A;  4XUR A;  4XCA A;  4LHK A;  1HB4 A;  4ZON A;  3SHR A;  1VMJ A;  3O14 A;  4C90 A;  1W04 A;  4KWJ A;  1W28 A;  3UKN A;  1SLB A;  2VZV A;  2BGC A;  1UY2 A;  1NLR A;  1GWM A;  4HOO A;  4O7X A;  2CSG A;  4R9B A;  2RS1 2;  4AF9 A;  2ZGN A;  4AHZ A;  1AJK A;  2Q1F A;  5L36 A;  5K8S A;  4NPR A;  1LU1 A;  5F7U A;  1ZBE 3;  1R09 3;  3PTY A;  1JOJ A;  3ACG A;  5EJ3 A;  2YPJ A;  3E1F 1;  3ILN A;  5I93 A;  2GC1 A;  2VO5 A;  2PTM A;  2ZGR A;  1JZ2 A;  1HRV 2;  4OVE A;  5B4X A;  4LUL A;  4NHX A;  1K5M C;  4JDN A;  1ZBA 3;  4YFW A;  3WQ7 A;  3RS6 A;  4PLN A;  3QOP A;  3ZKU A;  4NIH A;  4I3G A;  3OYW A;  2FDJ A;  5FY4 A;  1YFU A;  1XU1 A;  4JGZ A;  4LOS A;  4DUX A;  5KXB A;  3EBR A;  4J25 A;  3AP5 A;  1H4H A;  3T1M A;  5A3T A;  4DXZ A;  1GQG A;  4TXW A;  3TN9 2;  2G9G A;  5FPL A;  2EIG A;  3U11 A;  3MIE A;  2RM2 2;  2WZR 2;  1YIP A;  5FZ0 A;  3WF3 A;  2WAA A;  1AXY A;  3RFR A;  3T09 A;  1Y3T A;  1RED A;  2XUM A;  2BOI A;  1OPO A;  4KL1 A;  2JKB A;  4H55 A;  2V5Y A;  3IDA A;  5FTT C;  1C8M 3;  1DP0 A;  1OQE A;  1DFQ A;  2ZGP A;  3LZZ A;  2V4V A;  3OD4 A;  4GKX A;  1NA1 A;  2K46 A;  4I30 A;  4JZR A;  3J8F 3;  2HWD 3;  2VQT A;  1RUC 3;  1NCR C;  3GF6 A;  4JTN A;  3VBS C;  4CDU B;  1B35 B;  5CB7 A;  2XLG A;  1H8V A;  5FYT A;  3KV6 A;  2P3I A;  4Y3O A;  5IK4 A;  3BUC A;  1PO1 1;  5LZ6 A;  2ZEW A;  1V0A A;  2QDR A;  4Q4X 3;  4AOC A;  1AYM 3;  1YUD A;  2W08 A;  2WNE A;  2E33 A;  3USS A;  5IWF A;  4Q4W 3;  1ND3 A;  2Y8K A;  1RUO A;  2WFP A;  1Q8P A;  4DXT A;  3HD8 B;  1NCQ B;  3OBR A;  4ISR A;  4R52 A;  1X36 A;  2JDU A;  2VH9 A;  5CNA A;  3ZFF A;  3W5N A;  4W6Y A;  3KHB A;  4EN0 A;  4YW6 A;  1W6N A;  1GFF 2;  4XFH A;  3I2F A;  2WT2 A;  2V09 A;  3RZG A;  3BOP A;  4RL7 A;  1OFN A;  1VBB 1;  1ULD A;  1FV2 A;  3GGL A;  1UW8 A;  1VRH 3;  5C4W A;  4YG3 A;  1YHF A;  5FP7 A;  1EPZ A;  3GHM A;  2BUK A;  1NG0 A;  2QDN A;  2UWA A;  2A6V A;  4LO5 B;  3FN9 A;  4NN0 A;  4DIN B;  5FPZ A;  5FYU A;  4LR4 A;  1Z0H A;  1PZ7 A;  5KXD A;  1MZF A;  4CEW B;  2X8K A;  3JU9 A;  4JX0 A;  2JDA A;  5APA A;  3TWI A;  1DIW A;  1NXM A;  1TME 1;  4X6R B;  3RMY A;  1BMV 1;  1SAC A;  5EJZ B;  3KSC A;  2PHW A;  5JMC A;  4PDW C;  5FK8 A;  2D3S A;  5EYY A;  4KWL A;  4COW A;  1CPM A;  3JZV A;  3WW1 A;  2XJU A;  3WVJ A;  4AVB A;  4BU2 A;  4EN6 B;  2OPK A;  5K4L A;  1W2O A;  2XH6 A;  4P9J A;  1QJU 2;  1N47 A;  4QU1 A;  1O6U A;  4R9C A;  2JDN A;  3VBR B;  2AYH A;  2D43 A;  2ZJC A;  2QQM A;  4BOW A;  5FZK A;  2XWB B;  4COZ A;  5ANQ A;  1ZRD A;  4CU6 A;  4CCO A;  3DYM A;  2Q8D A;  3T3Y A;  5A80 A;  3J7L A;  1EYB A;  1OBN A;  5K7P A;  2VW2 A;  4DS0 A;  4NRQ A;  4ZKT B;  1UKG A;  4YRD A;  5BPX A;  3VBU B;  1US2 A;  1HRI 3;  2CTV A;  4CEY B;  3III A;  1REE A;  1LGN A;  3U0Z A;  2HH9 A;  3PTR B;  4YGC A;  2VOT A;  3L2Y A;  3ZXE A;  2B45 X;  4WVV A;  1W8U A;  1L7L A;  2XDV A;  1X50 A;  1JYT A;  2IXI A;  4QX1 A;  4Y24 A;  4YGB A;  4P5Y A;  5LK5 A;  3ILF A;  4CP9 A;  5KBF A;  2WO3 A;  3OBZ A;  5ACA 1;  3KCC A;  4AEM A;  4TN7 A;  5FIX A;  1CAU A;  1DGL A;  1R64 A;  2IXC A;  2R07 2;  3AYA A;  3OGS A;  5ISL A;  1H8T A;  4LBK A;  4A6S A;  4V1P A;  2GH2 A;  3VZK A;  2GP5 A;  4G3Y C;  1GZC A;  1QMJ A;  3D5O A;  3MF9 A;  5A7O A;  5L7O B;  2C6S A;  5CIR A;  2UUR A;  3WCR A;  5BNO B;  2EXI A;  4B4R A;  3T1L A;  1O4Z A;  3ZR5 A;  1TMF 1;  5GZG A;  5LBE A;  5IFP A;  4ZU7 A;  1OOP A;  3MV1 1;  4D6Q A;  5C71 A;  2CGP A;  1RUI 3;  1MQT C;  1F4H A;  4NHM A;  4ERO A;  4QPY A;  4JVA A;  1W0N A;  2VZT A;  3GCW A;  2RDS A;  3ZN6 B;  3ZOI A;  4S2G A;  1BBT 2;  4AHX A;  1VBD 2;  1REF A;  1LCL A;  3O1U A;  1W8W A;  2E63 A;  2GNT A;  5FUN A;  1Q5O A;  2ZZJ A;  1LR5 A;  3MPB A;  5FP4 A;  1QH7 A;  5C3S A;  3LPG A;  4GB3 1;  4R8H A;  5FYH A;  2BGP A;  2Q1Z B;  2RVA A;  4DUW A;  1YLL A;  1AHS A;  5GKA C;  2ZMK A;  5AVP A;  3WP3 A;  3LIH A;  1FPN 3;  3PDQ A;  3DUI A;  3OG2 A;  2QQJ A;  1LGC A;  3OGV A;  4BQ5 A;  2YY1 A;  5C6C A;  5ERL A; 
#chains in the Genus database with same CATH homology
 3C7O A;  3CMG A;  4GZ9 A;  3VD5 A;  2C26 A;  2VCB A;  3T2P A;  2VZ1 A;  4JKM A;  4BJ0 A;  5A1A A;  4ARX A;  4CVU A;  2VZO A;  1O59 A;  4JKK A;  2WN3 A;  4DEV A;  2YFU A;  1ULO A;  5JMO A;  2DDU A;  2W47 A;  2VC9 A;  2WQ8 A;  5DN2 A;  3VDB A;  1K12 A;  4YPJ A;  2VZ3 A;  5JXJ A;  1JYW A;  2RV9 A;  5DMY A;  1D7P M;  3LPF A;  4ET7 A;  3T08 A;  3IAQ A;  4PF1 A;  1W8N A;  3HN3 A;  3HOB A;  2VR4 A;  4HG6 B;  2X09 A;  1XNT A;  2YB7 A;  2J1S A;  4CU7 A;  2J1V A;  2W1W A;  2ZEY A;  1TG7 A;  3OB8 A;  3K4D A;  2W1Q A;  3I2H A;  1K42 A;  3AC0 A;  3LEG A;  4MGS A;  1BHG A;  2VMC A;  3LE0 A;  3SEP A;  3C8X A;  1OF3 A;  4D0Q A;  2QQL A;  1OD3 A;  3LQC A;  3CQO A;  1MPX A;  4QB6 A;  4UOJ A;  1UX7 A;  1UXZ A;  3FL7 A;  2BZD A;  4BDV B;  3BN6 A;  5DPN A;  2XQX A;  3I2J A;  1GQP A;  2VME A;  2LW8 A;  2BGO A;  2CDO A;  3F2Z A;  4E8C A;  3NJV A;  3K77 A;  4ZY9 A;  1UWW A;  4QPW A;  4DXS A;  3LEI A;  3NJX A;  5IFT A;  4XUN A;  4KMQ A;  2VM9 A;  2Y6K A;  4ZZ8 A;  5IJR A;  3CKH A;  2J1R A;  2VMD A;  3OEA A;  5CZK A;  4A3Z A;  2C4X A;  1SHW B;  2DCK A;  2VZR A;  2W95 A;  1UMH A;  3MUY 1;  1SDD B;  3I2G A;  2VZU A;  3ACI A;  2Y6L A;  3MO4 A;  3HNB M;  1WKY A;  2ZEX A;  2DCJ A;  2E32 A;  2Y6G A;  5LCW L;  3I2I A;  1UY4 A;  1NUK A;  2Y6H A;  1W9W A;  4AG4 A;  3K75 B;  2QQO A;  2V72 A;  1JHJ A;  2J22 A;  1GMM A;  4A4A A;  2W94 A;  5G05 L;  1CZV A;  4UI9 L;  1O8S A;  3K46 A;  3WNK A;  4BXS V;  3VD7 A;  2B9V A;  2BER A;  2XOM A;  2X05 A;  3UNP A;  1UYY A;  1UXX X;  2W3J A;  2W5F A;  1CZT A;  2JKX A;  3WNP A;  3JXS A;  3BGA A;  3WNL A;  2VMF A;  4L0P A;  4M4P A;  3HNY M;  1YQ2 A;  3SKV A;  4W50 A;  3D3A A;  1GOH A;  2WZE A;  1OF4 A;  3VDC A;  3THD A;  3T2O A;  2V5D A;  2HYX A;  1WCQ A;  1H6X A;  4GWI A;  1H6Y A;  3VD9 A;  4BK4 A;  4ZXE A;  2VTF A;  3VD4 A;  4CUC A;  2WAB A;  3UET A;  1P8J A;  4QAW A;  4BK5 A;  2VL4 A;  3HEI A;  2VZQ A;  2ZXQ A;  3HJR A;  2Y64 A;  1UY3 A;  4LPL A;  4LQR A;  3OEB A;  2B4K A;  3GDB A;  3T0D A;  4Z2A A;  3CZU A;  1L7Q A;  3WF1 A;  2W46 A;  3OBA A;  3HPN A;  5G04 L;  4A42 A;  3I3B A;  3WNM A;  3WF2 A;  1J83 A;  2CDP A;  3MUZ 1;  5JXG A;  2WZ8 A;  5JR2 A;  2W1U A;  3I2K A;  4TTG A;  3FHQ A;  3IAP A;  4DUV A;  1GOF A;  4JHZ A;  4MOA A;  2W92 A;  2WUH A;  1W99 A;  2EIE A;  3WSO A;  1GUI A;  1OH4 A;  4QX2 A;  3NQH A;  2J1U A;  2VCA A;  3DEC A;  4FI9 A;  3LEK A;  1XC6 A;  1OT5 A;  1J84 A;  5JXI A;  4JKL A;  2YFZ A;  3WNN A;  2WN2 A;  3SKJ E;  4D8M A;  4MO3 M;  1XNA A;  3NNG A;  3U37 A;  3A23 A;  4DXR A;  5LA1 A;  3ETP A;  3EB7 A;  4OUE A;  1JU3 A;  1DYO A;  1HN1 A;  4XUQ A;  3A7Q A;  4KI5 M;  4M4R A;  2VZP A;  1NX9 A;  3J7H A;  2VQU A;  2ID4 A;  1UY0 A;  4QB2 A;  1JYX A;  1GOG A;  2VZS A;  4XZU G;  2J1E A;  5C70 A;  3SEE A;  1SG3 A;  3WNO A;  5IHR A;  5LA0 A;  5C7G A;  1CIY A;  1IQD C;  2L9L A;  2JE8 A;  2EIB A;  3CIH A;  2WDB A;  3T0B A;  1EUT A;  3EYP A;  1UY1 A;  3ACH A;  4W8J A;  5I0D A;  4PT6 A;  1ULP A;  1PMH X;  3ECQ A;  3A21 A;  1KEX A;  5B4N A;  3ABZ A;  4IUG A;  4CU9 A;  2VJX A;  3I97 A;  1W8O A;  3FHA A;  5LA2 A;  1US3 A;  4XUO A;  2VZV A;  4CUA A;  3MV0 1;  1UY2 A;  3C7F A;  5JXH A;  1JYN A;  5FUI A;  4E8D A;  3K4A A;  3T2Q A;  4DEQ A;  4XVH A;  4GWJ A;  5F7U A;  2YC4 A;  3ACG A;  3E1F 1;  4OMD A;  3C7E A;  2VO5 A;  1XPW A;  1JZ2 A;  3HNM A;  5B4X A;  4ZZ5 A;  1TVG A;  1JZ5 A;  2W1S A;  3C7G A;  1LNS A;  5DQ0 A;  4DUX A;  3A22 A;  1KGY A;  4QX3 A;  4TXW A;  2QQK A;  2J7M A;  2ORX A;  2OKX A;  3WF3 A;  2WAA A;  3T09 A;  3WQB A;  3PUH A;  3IDA A;  1DP0 A;  4XUR A;  1RYY A;  2V4V A;  4A6O A;  4AAX A;  2WBK A;  3GM8 A;  2VQT A;  3I3D A;  5HXM A;  4OMC A;  2ZEW A;  2WYS A;  2R7E B;  2E33 A;  5EIY B;  1GNY A;  1EUU A;  1PX3 A;  1UYX A;  1T2X A;  4A41 A;  2Y8K A;  3THC A;  2W87 A;  2ZEZ A;  3MBW A;  4DXT A;  4RYD A;  3W5N A;  2QQN A;  3P1I A;  4P08 A;  4OZO A;  3I2F A;  2XHN A;  3UES A;  2YC2 A;  3GGL A;  5CYY A;  2BBA A;  1JU4 A;  4P00 B;  3VDA A;  3FN9 A;  1CX1 A;  3VD3 A;  3ACF A;  1GU3 A;  4JX0 A;  3C7H A;  2JDA A;  2EIC A;  4LHS A;  1UZ0 A;  5EJZ B;  2EID A;  4MGQ A;  1JZ3 A;  1K45 A;  5EJ1 B;  1JYV A;  2Y6J A;  4QDQ A;  2X10 A;  4QB1 A;  3K4Z A;  3W5M A;  4LKS A;  4W4Z A;  2QQM A;  1DLC A;  4MAD A;  4QDR A;  2W91 A;  4CU6 A;  3DYM A;  1O8P A;  2RJ2 A;  2VCC A;  2QQI A;  1US2 A;  1UMI A;  4XUP A;  3III A;  2XON A;  3DYO A;  2VOT A;  4UAP A;  4A44 A;  3WF0 A;  2E26 A;  4CU8 A;  2C9K A;  4QX1 A;  1JI6 A;  4P5Y A;  1JZ4 A;  4OYU A;  1CZS A;  3WEZ A;  2WO3 A;  1JZ8 A;  3DYP A;  4CUB A;  1R64 A;  4RN5 A;  3WF4 A;  3OGS A;  4P02 B;  3NRU A;  4QX0 A;  1JZ7 A;  4QDS A;  1PX4 A;  3CDZ B;  1F4A A;  2WO2 A;  5IYY A;  1L7R A;  2WO1 A;  3ZM8 A;  2Z4F A;  3CZJ A;  4XUT A;  2KD7 A;  3P6B A;  3PUI A;  3OGR A;  1I5P A;  1NKG A;  5IFP A;  3MV1 1;  2E31 A;  1PMJ X;  5C71 A;  3T0A A;  2ORZ A;  1F4H A;  2W9X A;  1NAE A;  1UYZ A;  3IB3 A;  1JZ6 A;  1W0N A;  2VZT A;  1W9S A;  2WAO A;  5J1X A;  5HPO A;  2PQS A;  3I3E A;  4KWU A;  2HLE A;  2LS6 A;  4PQQ A;  1W9T A;  5JUV A;  3LPG A;  2QBX A;  1K3I A;  2BGP A;  2J1T A;  2RVA A;  4DUW A;  3GXU A;  4A45 A;  2YG0 A;  3OG2 A;  2QQJ A;  2J1A A;  3OGV A;  4ARY A;  2JD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...