2J1EA

High resolution crystal structure of cbm32 from a n-acetyl-beta- hexosaminidase in complex with lacnac
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
142
Chain Sequence
PRTVKITASSEETSGENAPASFASDGDMNTFWHSKWSSPAHEGPHHLTLELDNVYEINKVKYAPRQDSKNGRITGYKVSVSLDGENFTEVKTGTLEDNAAIKFIEFDSVDAKYVRLDVTDSVSDQANGRGKFATAAEVNVHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Interaction of a Carbohydrate-Binding Module from a Clostridium Perfringens N-Acetyl-Beta-Hexosaminidase with its Carbohydrate Receptor
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
molecule keywords HYALURONIDASE
total genus 31
structure length 142
sequence length 142
ec nomenclature ec 3.2.1.169: Protein O-GlcNAcase.
pdb deposition date 2006-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2j1eA00
4ZXEA 3HNMA 4DEVA 1NX9A 3LPFA 3A22A 2YG0A 4QDSA 5HPOA 2E33A 3MO4A 4DUWA 3K75B 1O8SA 3A23A 4Z2AA 1XC6A 2VTFA 4L0PA 2Z4FA 4XUTA 4CU8A 4LHSA 4A4AA 2HYXA 1EUUA 2WUHA 2ZEXA 3ACFA 2J1UA 4W4ZA 2VCBA 2Y8KA 2Y6LA 1UXZA 3NNGA 3MUZ1 2VO5A 3WQBA 2W3JA 3I2HA 2E31A 2YB7A 2QQIA 4CUBA 1OD3A 2YC2A 4XZUG 2LS6A 4CU7A 3CIHA 4HG6B 2WAAA 4XUPA 1CZVA 1W8OA 2DCJA 3WNNA 3LEGA 3P6BA 3CDZB 1CZSA 2ZXQA 1UXXX 1LNSA 3C7OA 3I3EA 3I3BA 3J7HA 4BK5A 3NRUA 4CU9A 3HN3A 3IB3A 5DPNA 2XHNA 3PUIA 4QB6A 2XOMA 3LE0A 3VDAA 3VD5A 3T09A 2E32A 1JZ8A 2B4KA 2EIBA 2DCKA 3HPNA 5EJZB 5FUIA 3OGVA 1K3IA 2OKXA 1GUIA 5CYYA 3DECA 1SDDB 1JZ2A 1L7RA 2BGPA 3THDA 2WO2A 3LQCA 3MV11 3OGRA 1JYVA 2E26A 2VZUA 3OG2A 3FHQA 3MUY1 3A7QA 4PF1A 1NUKA 4D8MA 1JU3A 2VC9A 3T0AA 3LEKA 3BN6A 2WAOA 3WF2A 2W91A 2VZQA 4DXSA 3IIIA 2JD9A 1GOFA 3GGLA 1I5PA 3C8XA 4QB1A 4W50A 5JR2A 3VD3A 3U37A 2BGOA 4E8DA 2ID4A 2QQJA 4ZY9A 4DEQA 3P1IA 4A45A 3WF4A 2EIDA 1UX7A 2PQSA 2EIEA 1OF4A 2YC4A 2KD7A 4A42A 1MPXA 3WNMA 3AC0A 4P5YA 4QX1A 2RVAA 3ECQA 4P08A 1W9SA 4ET7A 1OH4A 1JYWA 2VM9A 5C70A 3SEEA 1EUTA 5JUVA 4QX3A 5G05L 2XONA 4CVUA 2WBKA 3DYOA 4A6OA 1P8JA 4GZ9A 2WO1A 1JYNA 4TXWA 3D3AA 2BBAA 2V4VA 3C7FA 3WF1A 3UESA 3IAPA 1W99A 4BK4A 2WN3A 3C7GA 5IFPA 1F4HA 2LW8A 2W87A 3K46A 2J1AA 1NKGA 1KEXA 4MADA 3NQHA 2C4XA 1GOHA 2WQ8A 2W1WA 3PUHA 2QQLA 4TTGA 3HJRA 3UNPA 3OEBA 5JMOA 4P00B 4BXSV 4QX0A 4CUAA 2W94A 3LEIA 1PX3A 4RN5A 2BZDA 1WCQA 1TG7A 3T2PA 4KWUA 2J22A 2VZOA 3T0DA 3A21A 2Y6JA 1JZ3A 1GQPA 3WF3A 4UI9L 5A1AA 1UMHA 3DYPA 3FHAA 3SKVA 3T2QA 1WKYA 4BDVB 3OEAA 3K77A 3WF0A 2WABA 4LKSA 1RYYA 4XVHA 1GNYA 5DN2A 3GXUA 1XPWA 3I97A 2J7MA 1R64A 3I2FA 3W5MA 3E1F1 1W9TA 4XUOA 2Y6GA 2BERA 4OMCA 1OT5A 3CZJA 4W8JA 4QDRA 1GMMA 3BGAA 4JHZA 5B4XA 1KGYA 2R7EB 2XQXA 3I3DA 3MBWA 4PT6A 5IHRA 5EIYB 1UYYA 1O8PA 4QX2A 2W1QA 3JXSA 3K4DA 2WDBA 4CUCA 1D7PM 3WSOA 4IUGA 2L9LA 1OF3A 4QDQA 2VOTA 4OYUA 5C71A 2VCAA 5JXIA 2V5DA 2C9KA 4QPWA 2W1SA 5EJ1B 4JKKA 1JHJA 1IQDC 4ZZ5A 3I2KA 1JZ4A 1UZ0A 4DXTA 2WZEA 1DP0A 2EICA 2VR4A 5B4NA 2VMEA 4UAPA 2X05A 1GOGA 1NAEA 1UMIA 3HOBA 5DMYA 3FN9A 4M4PA 5IYYA 3C7HA 4MGQA 4ARXA 2VZRA 1UY2A 4MO3M 1UY0A 2W1UA 3DYMA 2HLEA 3CQOA 4MOAA 2ZEZA 3LPGA 3ETPA 2CDOA 3ABZA 3WEZA 2WYSA 5JXHA 1K45A 3ACHA 2J1SA 2JDAA 3OB8A 1UWWA 3THCA 2VJXA 3F2ZA 1YQ2A 4GWJA 4A44A 4YPJA 4JKMA 2VZ3A 1PX4A 5IJRA 2J1TA 4XURA 2RV9A 4QB2A 3I2JA 4RYDA 4ARYA 3VD9A 2VCCA 5J1XA 1T2XA 4M4RA 3HNBM 1UY3A 4KI5M 3FL7A 3ZM8A 2DDUA 5DQ0A 2W92A 3GDBA 3VDBA 5G04L 1PMHX 3CZUA 2Y6HA 3EB7A 4JX0A 4UOJA 1DYOA 2J1VA 3EYPA 4A3ZA 3IDAA 1JZ7A 2Y6KA 2YFZA 2ZEYA 4LQRA 4QAWA 5HXMA 3NJXA 1CIYA 2QQMA 1J83A 5LA0A 1L7QA 5LCWL 2WO3A 3WNOA 2W47A 4GWIA 1XNTA 2W9XA 2J1EA 4LPLA 1F4AA 4P02B 2ORZA 3VD4A 1UYZA 1DLCA 3SEPA 2VQUA 3OGSA 3WNKA 4OUEA 2X10A 2W95A 4E8CA 4ZZ8A 3K4ZA 2B9VA 4DUXA 2VMDA 4OZOA 3OBAA 1US3A 4BJ0A 4PQQA 1W9WA 2W5FA 1UY4A 2V72A 3NJVA 3UETA 2QBXA 3WNLA 4AG4A 2VZPA 4DUVA 2RJ2A 2JE8A 5JXJA 1US2A 3VD7A 4FI9A 1GU3A 1K42A 3WNPA 2QQNA 1CZTA 3GM8A 1HN1A 3T0BA 2VZTA 2JKXA 1JZ5A 4CU6A 3CKHA 2WN2A 5CZKA 1J84A 1SHWB 5C7GA 1H6XA 3K4AA 4XUNA 5IFTA 3MV01 5LA1A 1W0NA 2VZSA 2Y64A 3W5NA 3T08A 3I2IA 2X09A 4AAXA 1ULPA 2QQOA 1UYXA 4XUQA 2ORXA 4OMDA 1PMJX 2VL4A 1JU4A 1UY1A 1TVGA 2C26A 2VMCA 2W46A 5I0DA 3SKJE 2CDPA 2VZ1A 3T2OA 1SG3A 3ACGA 3ACIA 4A41A 3CMGA 2WZ8A 4JKLA 2YFUA 3I2GA 1H6YA 1W8NA 2J1RA 3HNYM 1CX1A 1BHGA 3VDCA 1JZ6A 3C7EA 3IAQA 4MGSA 4D0QA 1JYXA 1XNAA 2ZEWA 2VMFA 1K12A 2VQTA 2VZVA 1O59A 1JI6A 1ULOA 3HEIA 5JXGA 4DXRA 4KMQA 2QQKA 5LA2A 5F7UA
chains in the Genus database with same CATH superfamily
1UU6A 1OI6A 3CJIA 5AC92 3M3CA 3AK0A 5F6LB 3ZO0B 4XF4A 4AFAA 1E5RA 2YG0A 5DUXA 2PELA 1EYBA 2DVFA 2P34A 2WWUA 3JB8A 1U5XA 3K48A 3POWA 4LE4A 3U75A 5HPOA 1O3RA 4MXWB 4CP9B 3Q8EA 4LULA 4ZKTB 3POIA 3WCSA 3OUJA 3QBQA 1EV13 5DAPA 3MYXA 4QPGB 4COUA 2WL1A 3GZAA 3T2TA 1PO11 1RUD1 3M70A 5ISLA 3OSDA 2YPJA 1F31A 4BMEA 4YW6A 4Q5OA 2Y6LA 3ZLIA 1U0AA 5LRSA 4I0BA 2QJVA 4COZA 2HWB2 1S0CA 3OPZA 1G8WA 4E4HA 1F35A 5EYXA 1QOTA 2JG9B 1YCIA 3J4UH 3ZMOA 5GZDA 4SBVA 4XJZA 4XZUG 2A6YA 4B8EA 2AYHA 3CIHA 5LBBA 1ZBE3 3ZN5A 4HG6B 3U78A 3LF7A 1OVSA 4UF0B 4RFT0 2EXHA 4CEWC 1QDOA 4RA0A 2EVXA 3W59A 2MEV1 2OIIA 1AR93 4Q8LA 4NRPA 3FBYA 4IEYA 2GMPA 4HSLA 1ODMA 5DXDA 1S1AA 3Q8BA 1VBB1 3VV1A 3I3EA 5FPZA 1AL22 1IPJA 3I3BA 4BK5A 3NRUA 4ORFA 4K8RB 2VBBA 2BGCA 1Q8QA 3LZZA 2GN7A 3Q8CA 3B69A 5GLZA 3O1VA 3VD5A 1AR72 4IE7A 3UGHA 1SFPA 5HCAA 2ZKNA 1LHOA 1JZ8A 3KHBA 4Q4V3 5BNPB 1O3TA 2JB4A 1GFF2 5IK7A 3HPNA 3QH7A 4CPBA 1RL3A 3AX4A 4JV4A 4B7KA 5A3NA 2WS93 3VHNA 4BQ5A 4X8NA 1EAH1 1HB4A 4QM8A 4Y1YA 4AGRA 1B35B 1NA1B 5CYYA 5HV0A 2XJPA 1CIWA 1XYOA 2JDUA 1XNDA 4P9LA 3G6JB 1I5ZA 3LDBA 3N7MA 2BGPA 4RQPB 5CFDC 4CSWA 4EZ4A 2WO2A 3LQCA 3Q8FA 2BEOA 3O1PA 1PZ7A 4IDZA 4QD2A 3O1MA 4NIHA 2E63A 1QKQA 1RUD3 2WRAA 5GLTA 2O0OA 4YM0A 2Y6FA 5JPNB 4GMP0 4G9SB 3LD8A 4PF1A 1X8MA 3V0AA 1EY2A 5CIRA 4HN1A 3T0AA 3LEKA 1HW5A 5CKNA 5FPVA 2Y0IA 4XFBA 3C2UA 1Q43A 2X5IA 3IIIA 1V6JA 4EQVA 4MGZE 3KHCA 5FO7B 3JU9A 3BUCA 1ND3C 1YUDA 2HWC3 1RVF2 1QQP1 5FP7A 4W50A 4B4QA 4Y4YA 4AI1A 1SACA 1ULGA 1W06A 1QXRA 2ARAA 3ORJA 4ZY9A 4LO4B 4DEQA 3P1IA 4XBQA 5DZFA 3M4FA 4YW2A 5ABJB 5IVJA 3WF4A 3VBFA 1LHNA 1QOOA 2EIDA 1JYIA 2B8MA 1PO13 3D8CA 4XBNA 1C8NA 4RHV3 4WVZA 2CNAA 3O1RA 4BCUA 2ZAAA 4FPKA 1IS5A 3B3QE 4N53B 5EP9A 2IZWA 3NNLA 1LAJA 4FTSA 1IQAA 4XILA 2YYOA 1H2NA 1K5MC 2D5FA 4H2AA 4PLMA 4JDMA 1ZBA1 3S5QA 4QX1A 3GNEA 2PTMA 1FV3A 4X6QB 1TNRA 3ECQA 2C9AA 4FCAA 1PGW2 1Q8VA 1RTVA 2X5IC 2ZHLA 1D0HA 3S0MA 2Q0AA 5JUVA 2PHRA 3U0ZA 2PLV3 4JTNA 1PO23 2Q1FA 3WG4A 3DYOA 5C4WA 1LOGA 3WDVA 2BV4A 3IMMA 5EV7A 5J7MA 4LO6B 1D0GA 3ME2A 5L7OC 1GWMA 2WO1A 2VUDA 3RRDA 1OKOA 2GNBA 3ZYRA 2PYTA 2BBAA 2V4VA 5BPXA 4PIYA 1KDKA 1CPMA 3UESA 2E6VA 3UJOA 4AW7A 3CF6E 1W99A 4ES8A 1DFQA 3HWJA 3E5UA 1VAKA 5GM0A 5EJ3A 1F4HA 2W87A 2ZGMA 4FFHA 4NHLA 3K46A 1SFNA 2D93A 1NKGA 2CV6A 2J1AA 4HETA 1FT9A 1Z0HA 4K1ZA 3NQHA 3ZIXA 1V6OA 4Y33A 1S0BA 3GCWA 1UZYA 2HWB1 5FY9A 1ZA4A 4J6GA 3VBFB 3GJBA 3O1TA 1GOHA 1F5FA 1UIJA 1TME2 5FXWA 2P6CA 1GP4A 2LM3A 1NT0A 3HN1A 4FFFA 5FYHA 4MG2A 3DKWA 3HJRA 4Q4V2 5BXXA 3FE5A 5FWEA 1FXZA 3OEBA 2RG4A 4M3CE 3BTAA 1QJZA 3N9LA 4Z82A 4BXSV 4XMIA 1BEV1 5KBFA 3GZUC 1D2QA 1YQCA 1O4TA 2VVDA 2W94A 2RS51 5FZLA 4RN5A 3WVJA 4DINB 3KQ4B 2XJSA 1WCQA 1DBNA 1N1SA 4XC9A 3M3IA 1OVPA 1O3QA 1IS6A 2QDRA 3PDQA 3NV2A 3WG1A 1FPN3 1W6MB 5CBLA 4GH4C 1REEA 1YC61 4BPZA 5A1AA 5BNPC 1GICA 4BH9A 3NMBA 1N1YA 2OW4A 4PIZA 5LK5A 3GYDA 2I45A 5FUNA 4NHMA 3DYPA 2P3IA 3OTFA 3WG3A 2YU2A 1ZRIA 4Q29A 3WQ7A 3RI9A 3TBDA 3WF0A 1RUJ1 4JAAA 4B1LA 1ACCA 3B94A 5JOZA 1C5HA 2WABA 2YY1A 3WW2A 1DGLA 5LW9A 2Q8DA 3KVBA 3MW3A 1FI2A 3RJ2X 2G9ZA 3I97A 4CUGA 1SCRA 5SV5A 1R64A 5C5TA 1NCRC 2XG3A 2ET1A 4TN7A 4NHXA 4M3CA 3E1F1 2D3PA 2CY6A 5C3QA 4BHPA 4EV0A 3ZYJB 2D6NA 5LBFA 5CEHA 3TNQA 4CEYC 3O1UA 1W03A 4LKEA 4A7YA 4AVAA 4CXWA 1W28A 3ZFEA 4AI8A 1UO9A 1ZZ6A 3EBRA 2WO7A 2V5YA 4ISRA 5FPAA 2XGXA 5FP3A 2A73B 2R7EB 4I2OA 3I3DA 3VBSB 5CADA 5FYCA 1MS0A 1XU2A 5CVRA 4CCEA 1QQP2 4AFCA 2PN5A 4AEDB 4CDUA 4YVSC 4CUCA 3E6CC 1ZZCA 2Q8OA 2R0FA 3WSOA 1W6OB 3MIHA 3H8RA 2VVFA 3PIJA 3KT4A 1PNGA 2HWF1 1ASJ3 5T55A 1D4M2 1VLNA 1ZNPA 2L9LA 5A7NA 1OF3A 4L92A 3DUIA 5FIXA 1CAUA 4BE3A 4QHBA 4JC1A 3DEMA 4CDXB 4ZU7A 4NIDA 2DVAA 2IXJA 4O65A 2JIJA 2VCAA 2XJUA 2XJQA 4CXXA 2VGDA 5J96B 4IW3A 1Q3EA 1QIQA 1VRBA 4UF0A 3PHMA 4JGZA 1R1A1 4ZZ5A 2VW1A 2W08A 2UY9A 1X8EA 3BIWE 5L9RA 3WQ1A 2EA7A 3I2KA 2GU9A 1JZ4A 1RUF3 2WZR2 1UZ0A 4QPIA 2XR4A 3M3QA 4OUSA 1DZTA 2HJIA 1BCXA 2R6QA 2WR9A 3N9QA 2YBSA 3PTYA 4IEPA 5BUVA 5M0TA 2BWAA 2PMWB 2EICA 2R073 5B4NA 3VBRC 1QJX2 3ASIA 2VMEA 5LA9A 1VMHA 4N43C 1S2KA 5FQ0B 1AF9A 1GOGA 5FZEA 3AZZA 1NAEA 2R16A 2XWBB 3LSEA 1ZVFA 5FR3A 4H3WA 4J1WA 4FOYA 1MR5A 3HBZA 2BPA2 1WMDA 2A6ZA 4YRDA 1LU2A 3MPPG 3UKVA 4GH4B 5C9AC 1LOBA 1M4WA 1PVC3 2B9UA 3JQXA 3SH5A 2V09A 3E5QA 4MO3M 2B39A 1KXGA 3U4SA 2VECA 1WMEA 2IXKA 1V9U3 3Q9OA 5F8PA 3MFAA 3DYMA 1DGRA 4Y20A 3CQOA 2HEWF 2ZEZA 1XQNA 3LPGA 3ZFFA 1AR82 2CDOA 3ETPA 4R4ZA 4LOSA 3CJIB 4P9JA 4UBHA 3I59B 2P2KA 1GWKA 1Z7S3 2FDJA 4NHYA 4AHYA 1C4RA 2FD8A 4LK6A 3AMHA 3P3NA 2VJXA 1YQ5A 3N3HA 3PJQA 4ZS3A 4YPJA 4WM7B 4MSVA 4QPIC 1X9TA 2JG9C 1DQ2A 2P17A 2RE9A 5IJRA 4HK9A 2IFWA 2ES3A 5L36A 4QQOA 2MEV2 3IDCB 5F32A 3VD9A 2EXKA 4LLOA 3UKTA 5C9AA 2ZGPA 5LY1A 1APNA 4PCRA 3RYKA 2PAKA 1UY3A 4CXYA 2RS11 1RUE2 4JQRA 1AL0G 2PHWA 4S2HA 1WLCA 4IXLA 2YPDA 1HDKA 1HQNA 2JIGA 5H9PA 2DURA 3BPSA 3Q8AA 5L7OB 3GDBA 3ZFGB 1PMHX 1X82A 3CZUA 2FBEA 2F4LA 1STMA 2H0VA 2Y6HA 2VOWA 5IAVA 4BQ2A 4JX0A 3M2MA 3N36A 1DYOA 5FMDA 4IEUA 4B7EA 3PJYA 1X9PA 1QMJA 1QY4A 3PU3A 5TSWA 5DZEA 3ZX7A 1O5UA 1TMF3 1HRI3 1AR62 5FZGA 1H4HA 2JE9A 1WA4A 2QUOA 3KD4A 4FXKB 1OSGA 1S55A 4GH4A 2QQMA 3VBHB 1J83A 4CCOA 4TSVA 3ZSLA 2FDKA 4YYOA 4I02A 2R1DA 4MHRA 1MQTA 2RS52 4WV8A 4HVRA 1UOGA 4QWNA 5T52A 4YVWB 4CDWB 4S2GA 2J1EA 4GKXA 2NQYA 4LPLA 1F4AA 3N9OA 2QCSB 5FYVA 2ZGRA 2K0GA 1QJFA 1UYZA 1A6CA 4IGOA 1NCRA 1R092 1ENRA 3OGSA 4E8CA 4TYSA 2X10A 2W95A 5IK8A 1NQJA 3E6BA 4QGNA 3AZXA 3BI3A 1CX4A 1RUF2 2PHDA 2VMDA 3IDEA 5IUQA 4IEQA 3LSDA 3WX5A 2AR6A 1KD7A 5LK7B 3MGUA 4Y5SA 2HWC2 4CCMA 3NO8A 1TE1B 5FYMA 3TEZA 5LBEA 1POV3 3FLRA 3J7NA 4COYA 2P3KA 2QBXA 4AG4A 5L73A 5FCCA 4GWMA 2A3XA 5A3WA 4KWJA 2KR2A 2ETEA 5CA6A 4P9XA 5AVAA 1K42A 1W9FA 4FTBA 4YZ1A 4XAAA 1C8M3 1CZTA 2JDZA 4PBPA 4QMAA 2BNMA 4XJ9A 1VMFA 1G86A 3S7EA 5BNNA 5I93A 3CKHA 3LIHA 4L99A 1J84A 1PVC2 1MVQA 1TNFA 1C3HA 1H6XA 3A4UA 4GULA 4IEXA 5D2AA 3SISA 1AYM2 2X5IB 3NKGA 5IFTA 4NROA 1HJFA 1OKQA 4DOUA 1PO21 2R1BA 4Q1PA 1W2AX 3A0NA 1W8HA 2BVVA 2CU5A 5GZFA 1GP5A 1AR83 3W5NA 3U11A 1UPSA 3I2IA 4F3JA 3OBZA 1S0IA 1XYPA 4B4PA 4AAXA 3MF9A 1ULPA 2D6MA 1DQ6A 1OLQA 2ORXA 4EROA 4OMDA 2JEMA 4IV3C 2AREA 4XQ4A 3ZFGA 4WVVA 3M8LA 4CA9A 3VDDC 1UU4A 3KV9A 1JU4A 1UY1A 2WSVA 3JD71 2VMCA 1RHI1 2VZ1A 5F39A 4D7SA 1SG3A 3ZDSA 2DU1A 3CMGA 2WZ8A 2UYBA 3I2GA 4M00A 1LGCA 5CFCC 2WJSA 1BHGA 1RUI1 3FLPA 1JZ6A 3IAQA 5FZKA 1YLLA 1K12A 2VQTA 3HT2A 2VZVA 4LBNA 5FZ9A 5IK5A 5C33A 1ALYA 1XB9A 4NAMA 1O7FA 5ACA1 1ZM1A 3HEIA 4XF9A 5FZ8A 5JXGA 5CKQA 1XBFA 1X7NA 5HI0A 2QQKA 1RUH2 5IT6A 1CAXB 5AC93 4NRQA 4X6RB 5A7WB 4UFMA 2BBVA 1GZCA 3ZDVA 5J98B 4DXZA 5FO8B 2RJLA 4NO4A 4ZXEA 1VBB2 1W8FA 4BQ4A 1AZDA 3I54A 3VZOA 4YWAA 4DEVA 1EV12 3I8TA 2ZMNA 3LPFA 3QCWA 3KCXA 4Q4W1 4IV1A 4QDSA 3RMYA 2E33A 1AX0A 4DUWA 5H9SA 4GQ7A 1VE0A 1RUE1 4Z2AA 4K1YA 2VTFA 3USUB 5FZFA 1NXMA 2UURA 3ILFA 3M3OA 3NV4A 5D8AA 1EUUA 3ZN4A 2X53S 1G9AA 3TN92 2WA3A 4MZUA 1UAIA 2J1UA 1YIFA 5EHDA 2VCBA 5I8SA 1UXZA 4YGDA 1RUJ2 1AR81 5FZOB 5C4WC 1G9CA 1RINA 3VZNA 5HXVA 3N9MA 3WQBA 4P5HA 2CGOA 5FZHA 3I2HA 1DZRA 4XXAA 4LA2A 1AR91 3ZFFC 5EPAA 5C3SA 3V0BA 4N9HA 4IE5A 3ALQA 4QU1A 5DG2A 2IXHA 3NAPC 2LS6A 2E7TA 4YW4A 1U12A 2XL9A 2ZS6B 3D0JA 1LR5A 4R4XA 4OFGA 3BTZA 2RDNA 2FMDA 4LBQA 2VQ0A 1HV0A 2NPIA 3WNNA 4B4RA 1WLDA 4URTA 3HAGA 3CDZB 1CZSA 4ZPIA 4QU2A 1UXXX 3PMEA 1SBEA 2WIIB 2FZ1A 2P1BA 2XVGA 3RQ0A 4GMP3 3VBRA 2ET7A 4YGBA 4QB6A 3K51A 1NE4A 4YVSA 1FNYA 5J3UA 3GZTB 4MXVA 4A3XA 3T09A 1A8MA 5FY1A 4AEMA 3KGLA 2EIBA 1BBT2 2HWF3 2XLFA 4G4FA 3MEPA 1J58A 3WG2A 4OHXA 2AACA 1Y9GA 4HANA 4QT6A 3JD73 1ZZ8A 1AXKA 4I0WB 4DB5A 2XBO3 4CP2A 1WLTA 2BRTA 2RS33 1ZZ9A 4O7XA 2QZ3A 4WBBA 4TZDA 2OKXA 4Q4W3 4YARA 2WINB 4QXHA 4K20A 4YVWC 5A7WA 3N9NA 1SDDB 3I3QA 4CDWC 1I1EA 3QOPA 1RUI3 2DV9A 3PVEA 4LO7A 4QKFA 1L7RA 3THDA 3H7JA 3HVDA 3OGRA 2PHUA 2EAAA 4DNYA 1JYVA 2E26A 3LB9A 1FMD1 1GYKA 1UD1A 1NY71 4AQSA 5C9AB 2WFF1 1AYN3 5FP8A 3AXEA 1UMZA 2WZR1 1BXHA 2CGNA 2HWB3 5AC91 1H1IA 5AFEA 1NUKA 4D8MA 3CO2A 2DFCA 3J26N 5E1RA 4LO5B 4KG8A 1UKGA 1DYPA 1RJ7A 2W91A 3POEA 1H1AA 1H8VA 1GOFA 2UWAA 2VH9A 3IMNA 2A70A 4HKWA 4RQPA 2BVBA 4LOTA 5FYTA 3C8XA 4GJYA 4YZ2A 4NE9A 1MZFA 3VD3A 2ZABA 4QQPA 3U37A 4JQTA 2BGOA 1PO12 1RUC1 5DDJ2 4AI2A 4RHV2 4HN0A 2QQJA 2VTXJ 5JIAA 2VTXA 4MGIE 5J37A 2GC2A 1LHWA 2FHRA 2VNGA 3GHNA 3ZYHA 1VR3A 2RDSA 4COWA 3NSTA 2ZX4A 3RI8A 5C8WA 3SNMA 1ZZ7A 4M3CF 2YC4A 3PUSA 3I2DA 1KJRA 1QJY3 2ATFA 2KD7A 4XE9A 5A32B 4GWNA 3WUCA 3RVHA 4GMP1 3BODA 3WCRA 3VHOA 5FBZA 2A6XA 4FT8A 1PGSA 4Q4Y2 4CDQA 4ET7A 3AKRA 1OH4A 1RUJ3 3OBTA 3I4IA 3SC7X 1OA4A 5C70A 2CTVA 2ZHKA 2HKXA 3VBOB 4GKYA 4QX3A 5JSOA 5CG8A 5F5CA 1PHMA 1P8JA 3DPRB 2ZHNA 1CWPA 1ST8A 1VBA1 5E6HA 1CAVB 1JOBA 2A5ZA 2ARXA 2OS2A 5A70A 2MEV3 5FKBA 1JYNA 3H8XA 5F3GA 3D3AA 4Z1VA 1MACA 1SZBA 3EO6A 4HKOA 3RZHA 3C7FA 4GALA 1R083 4FPOB 4QGLA 4JDOA 1RUD2 5C6CA 3DKQA 1D2SA 2Y38A 2WN3A 3C7GA 3BALA 5JZGA 1PM4A 3KF5A 1W6PB 3JBG2 1LOCA 2MHFA 2WLPA 3S30A 2R30A 4IEVA 4QM9A 5A1FA 1TME3 2PAMA 1KEXA 5DAQA 4LUKA 3ZFEB 5FTTC 3VKFC 1NCQC 4XBLA 1NLQA 1SLBA 2GMEA 1NLSA 2HYKA 3VHRA 4EWEA 3KCCA 2WQ8A 1OHFA 1ENQA 1XRUA 2BUKA 4LBOA 3CEWA 1RVF3 3PL0A 5LB6A 4XJAA 3B93A 2QNKA 3LIGA 4N90A 4H55A 3UNPA 1WBLA 3RMXA 1FPN1 1U5YA 4GAZA 4NPRA 2OQ7A 4P00B 4Q2FA 4AF9A 2XL7A 4D94A 5EWSA 3I49A 2D44A 2RMU3 4JZRA 1DF0A 4CCLA 3WDUA 1PX3A 4AVVA 4LBLA 3I7DA 4D0QA 5DG1A 3T2PA 2WNVB 1DG6A 1W04A 1AJOA 3WDWA 3WF3A 4UI9L 3ST7A 1QJY1 1Q56A 4BM8A 4XFHA 1LHUA 4EN8B 2R062 3JCIA 3PLQA 4AEDC 4LORA 4CYDA 3B01A 1OLMA 3KSCA 4C8DA 4DPNA 4BDVB 1VBC3 3OEAA 4LMFA 3K77A 4Q27A 4W65A 4AWDA 5K9YA 2HWC1 5A32A 4LKSA 1S0DA 3AP5A 1NCQA 4XVHA 2R071 1RUC3 5FO9B 2ENRA 5C5UA 3GXUA 1XPWA 2WYFA 1SFYA 4AI3A 3VGIA 2VVEA 2O14A 4M01A 1M06G 2TNFA 5FAXA 2LRPA 1C8M2 2X8KA 4L2NA 4BQ3A 2VPVA 1IG3A 4KQ7A 1S0GA 3VBFC 1XYNA 4Y22B 2DVGA 5FWJA 1G9FA 1W6NB 3H8OA 4OMCA 1PVC1 4FFIA 3WINE 3KV5A 3CZJA 1UL9A 4D3WA 2F17A 2G9FA 3H1YA 1W6MA 4HMZA 3ZOIA 1QJX1 1WLWA 1NZIA 1NCQB 2DCTA 1W2OA 4C1WA 1KGYA 1LB2A 2DYCA 4IV3A 3IIAA 1Z7S1 3MBWA 4Q0VA 4XMAA 1ASJ1 1DU3D 4PT6A 5FMCA 3SMHA 4Q0QA 1BK0A 5EIYB 2E9QA 5IHRA 5F3CA 2DBNA 2W1QA 3K4DA 4EN9B 3OUHA 4JHTA 5FZ6A 4UFLA 5GLVA 3QACA 4OVEA 1GANA 2AENA 3PNAA 3BOPA 3PTRB 2OZJA 1CGPA 1PZ9A 3NNJA 4FQZA 4IUGA 2VUAA 5FZ0A 3ZYPA 1IKQA 1O4YA 4BB3A 1BVVA 3VN4A 2OZ6A 4WZCA 2EIGA 5BNQA 5LRRA 3SCHA 4S2DA 1WMXA 4LA3A 4NVPA 3DPRC 1H0BA 3J7MA 3T4VA 4BLIA 1KDMA 4M0NA 5A3OA 3WW1A 5KHKA 3OY8B 1WZXA 4XPVA 2Z42A 2JDMA 3DGTA 2D3SA 2C9KA 5F5QA 2BW8A 1CPNA 3VBOC 3KT7A 4QPWA 2W1SA 4E4DX 1MEC3 4CDUB 5EJ1B 3KCYA 1IQDC 3IWZA 4DY5A 4XW3A 1IGOA 1CVNA 1YO8A 3KLSA 5KXEA 2ZMLA 3L2HA 1JS9A 3UGGA 3LOIA 5ABJC 4TLGA 4CCKA 3VBUB 1CQ9A 2I2SA 4J1XA 4K8FA 1DP0A 2D3RA 3GZEA 1GZWA 5GALA 3WDXA 1TMF1 4INDA 5FY7A 5ANQA 4WVMA 2GSYA 2XUMA 3CU7A 4PIXA 5FZOA 4JGYC 5KC5A 4ISQA 3VKOA 3U10A 2X05A 1JBCA 2CWMA 4D6QA 5FV3A 3D5OA 1HIXA 2AUYA 1XSRA 2BYVE 4PI2A 2WSUA 3VBHA 1VBD2 1UX6A 1EPWA 2D98A 3GBGA 4M4PA 4QPGC 4UT5A 2V4AA 2A3YA 3C7HA 4L9BA 1ZRRA 3D6EA 4CE8A 3R4SA 1MZEA 4YZ5A 5FYZA 4AFBA 4CP9A 1UY2A 1XSQA 2RM22 4IV3B 2DF7A 3GF6A 2BTVC 2W52A 4QQ2A 3H8UA 4RQPC 5CFDB 2VNRA 4PLNA 3WEZA 3NKTA 3MFCA 2Q30A 3B5LB 4OHWA 2WYSA 2IXIA 3VL8A 2JDAA 3HT1A 3OB8A 1JN2P 1YXWA 5FZMA 4HXCA 1QF3A 2IUWA 4GWJA 3BPZA 3KGZA 1PZ8A 4KU8A 2DUOA 2PHTA 3ETQA 3N7LA 5A80A 5T5LA 1DDLA 3UJQA 3J8F1 1PX4A 5E16A 1BLZA 4NWWA 4P9WA 3ZXEA 4QB2A 4NMIA 1LULA 2ZBJA 5J1XA 5CU1A 3AL5A 2Q1MA 2X29A 3AYEA 1MS9A 5EQUA 1YQ6A 3PMSA 5FZ1A 4GD4A 3FL7A 1LU1A 1T6GC 2PFWA 3HMYA 3ZM8A 5BNOC 5HCHA 1MEC1 1D4VB 3POGA 2DDUA 4A7ZA 2BDRA 2DVDA 4UWDA 2W92A 3AP6A 2PAEA 2ZX2A 1NXD1 5GLUA 2GP5A 4ATFA 3LCPA 3FJSA 5BNOB 5DAXA 3FMGA 2R072 1W2TA 4IETA 4LK7A 4UOJA 1ENSA 4MLOA 4AZZA 1HN0A 4XF0A 1JZ7A 4QPIB 4HL0A 4Y24A 1SQ4A 4PQ9A 4XFGA 2ZEYA 2BNOA 3OCPA 4QAWA 4RGAA 3VHPA 4BXFA 2FQPA 1CIYA 1V00A 3R0RA 2JG8C 5F5IA 1PIV2 5LA0A 5CG9A 1L7QA 2FCVA 2WO3A 4IEWA 1J3RA 2W47A 3WNOA 1CD3G 2FCTA 2WFF3 1F8VA 4GWIA 4AOCA 5FQ0A 1XNTA 2ZGTA 4WVMB 1ZRCA 4E9KA 3N35A 4RGKA 4U36A 4P02B 2ORZA 2WZPP 3LWCA 3VD4A 2CYFA 2OUHA 4Q4X2 3OYWB 2GAUA 2JWPA 4F7ZA 1LKNA 1C5IA 4JDNA 1SMVA 2WQ4A 1YFWA 1QOSA 1H4GA 3K4ZA 3O7OA 4AQ2A 4FPYA 4ZZ8A 5FY8A 5JZGB 3PURA 4AQTA 2H6BA 1VAVA 3O0XA 5CAZA 4PDWA 5K0UA 1UU5A 5IWFA 4AVSA 5K0UC 4ZU4A 2PHFA 1W9WA 2GH2A 3ES1A 5IAXA 3KT1A 5IVYA 4Z07A 2ZKLA 2HWE3 3UETA 3O0WA 3WNLA 2UWCA 1TEIA 5D8AC 1SEFA 2RJ2A 2OYZA 5JXJA 2XVKA 5A7QA 1NZCA 2OUJA 3VD7A 4HK8A 4YGEA 4K6BA 4ONUA 3RZLA 1POQA 1F15A 2VBDA 2BQPA 2QQNA 4ATEA 3DCQA 4NJ4A 4CEWB 4LO8A 2JKXA 4IV1C 3K2OA 2NZ9A 1O5LA 1OUSA 3VBUC 3KV6A 4AK3A 2YUEA 3AL6A 5C7GA 4OQ9A 1G6NA 4OI1A 1E57A 2VXJA 5GZCA 4XUNA 5D1IA 4GB33 2PLV1 3D0SA 3DV8A 5FREA 4N53A 5HCFA 4V2WA 5JOYA 1V6LA 1ZRFA 4AVCA 1OOPA 3BIEA 3ZMNA 1RHI3 3OD4A 1TMF2 5J36A 4CPBD 1AR63 1ULDA 4CCDA 2QQOA 3O1OA 4N8MA 5DZGA 3WHTA 4Y22A 1PMJX 2QDNA 4AVBA 4BIFA 3NJZA 4H7LA 1R081 3HQUA 1K5JA 2YGMA 1FATA 1HQLA 1WUVA 2HEYF 4WVWA 5I0DA 1BVP1 2C26A 3KWVA 3MHZA 1W8WA 5ACA3 4OULA 3E97A 4RD7A 4A41A 3ACGA 3ACIA 1O6UA 3FUOA 4JKLA 1X36A 4P9GA 5DAWA 1H6YA 4YGCA 2ZZJA 1HX6A 4FAHA 1CX1A 2YV8A 3H42B 3WP3A 4LBKA 1PVXA 3JBG3 5GLWA 3VDCA 5C8CC 3AZVA 1OOPB 1WMFA 1XNAA 5JMCA 3V0AB 2EAKA 4NRMA 5FZCA 1O59A 2WQZC 3ZXJA 5JWPA 2VOKA 3SH4A 1Y9MA 1YFXA 2K9ZA 4QQHA 4JGYA 4DXRA 1W6QB 1FV2A 1QEXA 4UW6A 4DMIA 1BEV3 2TBVA 3H3UA 2V73A 3OPTA 1URXA 1QJEA 3LA7A 2WNUA 2WNOA 1O4ZA 1OQDA 4SLIA 3HBKA 1VRH3 3EMRA 4L11A 3WZ1A 5JI9A 4OLLA 2ZZQA 3JB4C 2D6LX 3HNMA 3ZFEC 5E89A 2JE7A 4O61A 4YG3A 1REFA 3RZKA 2GN3A 1V9U2 1LTEA 3MO4A 4AR2A 3K75B 1VBD1 3I3MA 1QDCA 4WM7A 1GKBA 1XC6A 5F2WA 2HWD1 3O5SA 5LEKA 2A6VA 3VZLA 1IOAA 1H2MA 3CNAA 4LHSA 3MLKA 4FPEA 4CU8A 2FZ2A 2JX9A 2DCYA 1AYN1 4QKBA 1G9DA 5FK7A 5L19A 3OYWA 4W4ZA 1EAH2 1IPKA 1HB1A 4QXBA 1L3JA 2Y8KA 3NNGA 3MIFA 1GZTA 2A1XA 2VMHA 3MUZ1 1COV2 3LFIA 2YB7A 3ATGA 4IEOA 2XVLA 1IS3A 2QQIA 1N3PA 1ZBA2 2VW2A 5FPUA 2YC2A 5A7PA 1QJU3 5FY4A 4C0BA 4BZ4A 4CU7A 3CHXA 3R05A 1DQ1A 2WAAA 1SBDA 1H8TC 2ADDA 1ZA7A 2GDFA 4KH9A 3VUOA 1F2NA 1SCSA 1W8OA 1BJQA 3BTXA 3LGRA 1MQTC 3LEGA 1RXFA 4FPHA 5JSRA 2ZXQA 3RGBA 4AQ6A 4NOTA 4CP1A 3MIBA 2VUJA 1W8UA 3J7HA 4XQWA 4CU9A 2RR13 5DPNA 1A78A 5ANNA 2ZX0A 3MW4A 4DO0A 2E32A 4XZPA 2VMGA 4RFRB 5LEJA 5FMBA 1VBB3 5GKAC 2D40A 4F83A 5FOBB 1T6BX 4A7KA 4K40A 4Z2WA 1Q8SA 3AYCA 3UV9A 1LOAA 3IBMA 4R9CA 3VZMA 3WQ0A 1RUI2 2ARBA 1BQPA 1K3IA 2YROA 3POSA 4HSJA 2I07B 2VOXA 1ZZBA 5ACA2 4RR3C 3OOXA 1R1A3 2H0BA 4META 3RYPA 4ASMB 1VB4A 1JZ2A 1H2KA 4QKDA 1OD5A 1UZVA 2NMNA 1WD4A 3MV11 4CDXC 3KZ4C 4XETA 2QFEA 2VZUA 4HBNA 3FHQA 4NHKA 1NYWA 3AJZA 2ZACA 3ZYIB 1XNBA 5FY0A 2RHPA 1JU3A 3ES4A 3BVCA 4PLOA 4NIIA 1ND3A 1Y43B 2QE3A 2XLAA 3BN6A 5ERLA 4OI2A 1H1MA 2XLGA 2JB8A 5F3IA 3E5XA 3AFGA 3WP4A 3WW3A 2BJSA 1WCSA 2JD9A 4EJRA 1JOPA 3GGLA 1I5PA 4DFSA 5I0RA 4UFJA 3SCFA 5JR2A 2K2SA 1UPIA 2Z79A 2MPFA 3MW2A 1OLRA 1ND2A 1RB8G 4E8DA 3GCXA 5GJ6A 1VBD3 1IHMA 5FZ4A 1HXS3 5I0TA 3ZSMA 1UCXA 4CRQA 4A45A 4CCCA 4UYBA 3RYRA 2O8OA 3THTA 1UX7A 4QX5A 2I74A 3B9IA 3T30A 3HIFA 2Y33A 2R041 4HVOA 3MI8A 3TNPB 4C0HA 4MV2A 5B2GB 3KVAA 1LECA 2GC1A 4P5YA 3AMMA 2VG9A 2Q8CA 5I8YA 4S2FA 2RVAA 3BOWA 4P08A 3TEWA 1LODA 5I91A 1I9RA 1W9SA 1JMUB 5C3RA 2ADEA 3J8F3 1JYWA 1B35C 1NA1C 4EE2A 2VM9A 3SEEA 2PHLA 1QJU1 1UN1A 2VMIA 2XONA 3OD0A 5G05L 5KHHA 2VNVA 3ILNA 2WBKA 5EFUA 4CVUA 3AMQA 1ZBA3 3PU8A 5C4WB 4PBOA 4CCNA 1CJPA 4Y4RA 4XYXA 2D97A 1JXNA 5EZWA 5JZGC 4E2QA 2BWCA 3WF1A 5F5AA 5FYUA 4FPLA 5FLJA 4HOOA 5T50A 3WR0A 4BK4A 5IFPA 1RVF1 5BNNB 4XACA 2ZGKA 4FOQA 3RWKX 4CEWA 4AHXA 5FLHA 1RXGA 4MADA 2XH6A 2ILMA 3RJRA 3UT0A 4HKLA 3LOBA 3N4MA 3PUHA 2A3WA 3NV3A 4AAPA 2QQLA 4CEYB 4M0HA 1OUXA 4RGGA 2QQWA 1NLRA 1WWYA 2RS31 5IVVA 5JMOA 2NMOA 1PM7A 4BA6A 3WP5A 4MXWA 1GSLA 4QX0A 4CUAA 1EPZA 4IV1B 5D21A 1W0OA 4YG0A 1V6NA 2WFF2 2BZDA 1TG7A 3AMPA 3GBWA 4FSJA 4KWUA 2J22A 3DPRA 1ULCA 4JRLA 2CAVA 4C91A 4E2GA 1VBC1 3T0DA 1UQXA 1FMD3 1POV0 2Y6JA 1RMU3 1OA2A 3AMNA 1ND2B 1QXPA 1UMHA 1LESA 2AZ5A 4KGQA 4Y1ZA 4YVWA 4CDWA 4D69A 4P9YA 2CL2A 3CJXA 4P14A 3BKZA 3WUDA 3FHAA 4NPLA 3T2QA 3W20A 5CKMA 2WWSA 4QHZA 3ZXFA 1POV1 1BBT1 4ZHNA 1XE8A 4FPGA 3RG0A 2ZAHA 5FMOL 5FXZA 3QD6A 5KR7A 2WC2A 3R4UA 1RYYA 4FOWA 3WLUA 2YMZA 1VJ2A 3AJYA 2JENA 3DL3A 2JDYA 2J7MA 4YNIA 5BNPA 4RS5C 3QLQA 1WCUA 2G4IA 3RFRA 2VU9A 4UFHA 1SLIA 1W2NA 3HR9A 5FXVA 3VZKA 2R043 5FYBA 1ZYBA 3GHMA 4BWOA 3RNSA 1CONA 4XUOA 3H3LA 2YXSA 5FJHA 1XJAA 2OVUA 3NW4A 4W8JA 1GMMA 5FYIA 4XJUA 3TYJA 4UW5A 2WNVA 1IZ3A 3BGAA 2XXZA 1XE0A 3INAA 3IKWA 4MYEA 2WNUC 1C1FA 4Q8KA 3O12A 4QQLA 1RJ8A 2XQXA 4Y1XA 4BQXA 1VAMA 2YC0A 1KS4A 3AKSA 1UYYA 2O8QA 4NPMA 4QKNA 4QX2A 3RDIA 4JGZB 4FXGB 5IK4A 1MS5A 1DLLA 4OI4A 4XTMA 1PK6B 4EWAA 1D7PM 2RM21 1YJKA 3PVNA 3UYJA 2FMYA 4AE2A 3VDDB 1KJLA 3P5BA 1YQ8A 1JUIA 1Y7BA 1YJLA 3KB5A 1RMU1 4B3NA 1WGPA 3AFKA 1JYCA 1ONAA 1V6MA 3MF6A 3HQXA 4K9SA 2DWRA 4XDQA 4ZONA 3SHRA 2GZWA 2OT7A 1GBGA 1J3QA 1U5ZA 3CL1A 4LUMA 4YZ4A 4OI0A 1XXNA 2R32A 5JPMB 1K5MB 2C1FA 4OZXA 2RJKA 2Q8EA 5DDJ3 3ZKUA 1GQGA 1OOPC 1S2BA 2VUCA 1ODNA 5FY5A 4F8AA 1YFUA 2P37A 1W2UA 4AGVA 2RS12 4E4SA 5DUVA 5A33A 4UAPA 2B46X 1RITA 4OHZA 3SCGA 4CDQB 2GH8A 4LXLA 1FOD2 1KQRA 3ILRA 5A6ZA 1LENA 1V9U1 2QTWB 4LEJA 1YI9A 3E6DA 4JRAA 1UMIA 3HOBA 5DMYA 3FN9A 2GNTA 2NM1A 2HWD2 3IPVA 3NWKA 3UGFA 4ASKA 3U07A 4CCJA 3CLPA 4XAEA 5BYNA 1W05A 2GP3A 1HRV3 4YFWA 4RSUA 2GALA 2SBAA 5LY2A 1CAWA 4EN0A 2C5DA 1BBT3 2HWF2 1SLTA 4ASLA 4R8HA 1KFUL 2HLEA 1MZ5A 4MOAA 2WNUB 4N9IA 2JD4A 2EF6A 3FWEA 2EXIA 4BU2A 4LKFA 2LUWA 2XHKA 3ZR5A 2BFUS 2J1SA 4PDWC 2UY8A 2RS32 2WA4A 1LOEA 2DTWA 3IT8A 4V2VA 4XXPA 5A3PA 3AYAA 3F2ZA 1YQ2A 1AYM1 4Y26A 1DQ4A 4A44A 3ZN6B 4FPCA 4XDPA 2HWE1 2OQ6A 1SBFA 3FLTA 1BKZA 2VZ3A 5JR7B 4I09A 1AJKA 2NYYA 3FUQA 4YW5A 1QWRA 1R093 4CZSA 4RYDA 4ARYA 5F9TA 3MIGA 2VCCA 1T2XA 3ROUA 5T5OA 5FFOC 1UZZA 4M4RA 1YFYA 5BNNC 3EJKA 3HNBM 1PMIA 2AEZA 4KI5M 5F2SA 3H1MA 1RUG1 4Y1UA 2VY0A 4RL7A 2ZHMA 3DXUA 4XCAA 5DQ0A 3ZFGC 1RC6A 4BQWA 3IZOA 4PI0A 2AEYA 3VDBA 5BY5A 4LT5A 3I59A 1TZOA 3WV6A 4PJYA 1GZWB 2JDNA 3C3VA 1I3HA 1JOJA 3EYPA 1C28A 4MGYE 4LQRA 3UK9A 4XF1A 3NJXA 4KNCA 5JDBA 5FXXA 2JG8B 4EN6B 1X33A 3MZHA 1R1A2 4FPFA 4GXLA 4LBQD 3VKMA 3V0BB 1WD3A 2Z5WA 3EXUA 3RPQA 4Y1VA 4WM7C 1N1VA 3AKQA 2W9XA 2Q4SA 2WS92 1VP6A 1BMV1 1VBE3 1KFXL 2PQQA 2W68A 3P3PA 4LIVA 5LASA 1EV11 2BP6A 5C8CB 4AI9A 1SLAA 1QH7A 2DFBA 3CJIC 5F6KA 1ASJ2 2VQUA 4FP2A 3WOGA 3AKTA 4GIQA 5JI7A 3WNKA 1ZRDA 1Y4WA 3BU7A 2B9VA 3IN9A 3J9SA 5FPLA 5JOWA 4DUXA 4OZOA 4BJ0A 1US3A 1FNZA 4PQQA 5KHGA 3W21A 2B7YA 5LATA 3TN91 1YHFA 1VRH1 2V72A 2YDEA 3NJVA 5FZAA 3W9AA 4E4ZA 4HPKB 4NIGA 2VZPA 2JE8A 2ZGUA 2HBTA 1CAUB 1F9KA 1LOFC 3V56A 1AUYA 4IE6A 5C8CA 3U1XA 1DHKB 1N1TA 3FFZA 1IG0A 2VCMA 2VXRA 5T3NA 1HN1A 3T0BA 1F5JA 1NOVA 2VZTA 2IWGB 3AP9A 3AVRA 5DUUA 5T5PA 3VBHC 4CU6A 1AR61 1MS1A 2D6KA 2WN2A 3AM2A 2Y0OA 4H14A 1MVEA 1HRV2 1SHWB 3WDTA 4XFCA 3TEXA 5FKCA 1NE6A 4HZFA 3SXWA 1G7YA 1OPMA 1W0NA 3H7YA 3J8F2 3NJYA 4Q4W2 2K46A 2JDPA 1W9YA 2ZX3A 2OA2A 1MS3A 1VBA3 2F4PA 2X09A 4LE3A 4AEKA 3OPWA 5ABJA 3L2YA 4R52A 2QQPA 1UYXA 1HB2A 4FP3A 4FOVA 1LCLA 2BNNA 1WCDJ 2Y34A 2ZTNA 3KS7A 4IE0A 2B5HA 4QX7A 4AFMA 4FBFA 1AR71 2MNGA 2GC0A 3ZXAC 1AYN2 2VOVA 5GZEA 2CDPA 2JICA 4BISA 1YRZA 2PHXA 5FUPA 3ZXKA 4A2UA 4AHWA 1J3PA 1QH6A 1ZBE2 4LHLA 1RUG3 2J1RA 5F3EA 4Y20B 3HNYM 1OFSA 3ON7A 2ZJCA 1AR92 5SV8A 1H30A 2C6SA 2RDQA 2VMFA 2WLQA 1ULEA 2LTNA 5CB7A 5KHJA 1UOFA 1W8TA 3VKNA 1IKPA 4AFDA 4KL1A 4NIAA 4K7JA 5A3TA 4KMQA 1CAXA 1OMIA 3PIGA 1WW5A 1N47A 1YI7A 2RMU1 3OUIA 2HWE2 5LA2A 1PGW1 5F7UA 3PVBB 4AHZA 1RUE3 1NY72 2KXLA 3BYWA 3MICA 4LITA 4QXCA 1AXZA 1HQWA 4TLFA 3WW4A 5I0SA 3NV1A 4LR4A 4LNVA 1QNWA 5LBCA 1GR3A 1NX9A 4TWTA 3A22A 5A6QA 3S57A 3ITQA 4Z92B 1Q5OA 2WT1A 1ENXA 4CTEA 4LBQB 4Q4Y3 5CFCA 1W6PA 1JODA 1VBE1 3KM5A 3N7JA 1O8SA 1W39A 3A23A 1DGWA 4L0PA 4W6WA 4DQAA 2Z4FA 5JVVA 2VW0A 4XTPA 4XUTA 3U4XA 4A4AA 2UU8A 2ZX1A 2DUQA 2HYXA 2WUHA 4RHV1 1QU0A 4W6XA 3FX3A 4XQDA 2ZEXA 1IPSA 3JD72 2XMLA 3VBRB 5L9VA 5A3MA 3ACFA 1OURA 1RHI2 3LDKA 3ZVXA 4C90A 5HV4A 5IVEA 1N3QA 4IEZA 4XFAA 1BK1A 2ZOEB 3TAYA 2VO5A 2W3JA 3WNXA 2E31A 5IVBA 1EP0A 3IDBB 2N7GA 2QQVA 4V1PA 4LHNA 4FQ4A 4LIUA 2LALA 4KGGA 2ZGNA 3OJBA 4G3YC 1MQTB 4BOWA 4CUBA 4DRRA 1W3XA 1OD3A 1XNKA 2AC1A 2IXLA 2PA7A 5FZDA 3USUA 2JDKA 1Q8OA 2E51A 3O0VA 4NUBA 1H8TB 1C57A 1HXS1 1QHDA 1Z78A 2RR11 3AVSA 4XUPA 1UIKA 5FZIA 3RSJA 2DUPA 4AVTA 2E7QA 3H9AA 4QHOA 1CZVA 4WZFA 2CAUA 2DCJA 3P6BA 1QJX3 1OA3A 4XF3A 1LNSA 3RZJA 4MGKE 1PGL2 1B09A 2DVBA 3C7OA 2FDGA 4L97A 4UBGA 1A8DA 3VDDA 4OCTA 1UF2C 4R9DA 2QQUA 1UKRA 4WM8C 2ZGSA 1TQ5A 3HN3A 3IB3A 2XHNA 1UOJA 2PXJA 3ACLA 3FFQA 3PUIA 5L9BA 3ZXDA 2XOMA 3LE0A 3VDAA 2C0ZA 2JDHA 1PK6C 2ZGQA 4YW1A 2H6CA 3VBSA 5J48A 2B4KA 1VRH2 2DCKA 5KXDA 5EJZB 4JTOA 3AP7A 1H9WA 4XOGA 5FUIA 2WNVC 3OGVA 2DU0A 4O9GA 3FHIB 4AXOA 2NP0A 5FMOS 1Y3TA 5FRAA 4OHYA 1GUIA 1W6NA 2IXCA 3POJA 1HLCA 3DECA 2G9GA 3ZN6A 4D7YA 1SPPA 5K8SA 3POYA 2OXBA 2BOJA 4QPGA 1HB3A 1O91A 4JVAA 2WS91 3ZPYA 1UNBA 4RR3A 3VKLA 3HQRA 2J42A 3OG2A 4XJ8A 3MUY1 2E7AA 1RGSA 4RS5B 2O1QA 3A7QA 5CFCB 3V65A 1Y9QA 2WT0A 4KU7A 2XDVA 3WD5A 3HD8B 3K3NA 4YG6A 2VC9A 1VALA 1CR7A 2W0XA 2WAOA 3WF2A 4ES9A 4DXSA 2VZQA 3DN7A 4CDQC 1ZX5A 4CP0A 4EN7B 2EALA 4QB1A 2WZR3 2EXJA 4YW7A 2FDIA 1GNHA 4YFZA 2A75A 4LLFA 1ZBE1 2ID4A 5IW0A 4OQ8A 3B7MA 3TWIA 1GP6A 4ZS2A 2CWSA 4GB32 2AGSA 5HCBA 4HFSA 1ND3B 2PQSA 1VPHA 2EIEA 1KS5A 1OF4A 4IL7A 4A42A 1GV9A 3MPBA 1FPN2 1MPXA 1X50A 1C8M1 4UFKA 3AC0A 3WNMA 4DS0A 2WKKA 3TB0A 2P4EA 2YGLA 2RMU2 1L7LA 2YZ4A 1MS4A 4ZU5A 4Q1RA 4IE4A 3CBNA 3JQWA 1EUTA 1NG0A 2Y60A 2W2IA 4IGQA 2OX0A 1AVBA 3POFA 1LHVA 5FZ3A 4A6OA 4BYYA 4GZ9A 4Q0PA 1YYNA 4ZXKA 5A6YA 2GC3A 3BTYA 1Z7S2 3VBUA 2BFUL 2P5BA 4XHXA 5EXOA 3SH3A 5CISA 1K5MA 4HT1T 2R061 3IM0A 3D4KA 4TXWA 4XFFA 4UFIA 4Q4X3 5D8AB 4EZHA 2RDRA 3S7IA 2HH9A 2Q5TA 3LDRA 3AYDA 3KQRA 3IAPA 4COVA 4WM8B 3BCWA 3N9PA 1KITA 2LW8A 2UYAA 3WXPA 2JG9A 1RUC2 5F37A 4Y5Z0 1D4M1 1H9PA 5K7PA 3URFA 1COV1 1G9BA 2C4XA 5E8AA 2W1WA 1QXJA 2A71A 3LA3A 4KBZA 3U14A 4TTGA 1OBNA 5KC6A 3S6PA 1OC1A 3RZMA 3DXTA 4UW4A 1QQP3 4AEDA 3SQOA 1LGNA 2FCUA 3SITA 4N53C 4B29A 5FOJB 3QH6A 1FMD2 3LEIA 4N7UA 4XFIA 2YBKA 1H2LA 1J1LA 4DY3A 1AXYA 2VZOA 5K4LA 1HRI2 1VB2A 3A21A 1VBE2 2WT2A 5CNAA 4D6RA 1BMV2 4HLTA 1JZ3A 4IGPA 2B42B 1GQPA 3D82A 2FDHA 3K3OA 3O14A 1ND2C 5A3UA 1XNCA 2YHJA 2ERFA 5H9QA 2RS53 3GALA 5KXBA 2GMMA 1GWLA 5JAXA 1WW6A 2UWBA 3SKVA 4O9EA 5F1RA 1JYTA 3RZGA 1WKYA 4M3CB 4R9AA 3H1WA 4JGYB 5GZGA 5DDJ1 1B35A 1NA1A 4I0AA 5AFBA 3H0OA 2BU9A 3RWNA 3BU0A 2HBUA 1FAYA 2ZCWA 1IS4A 1GNYA 4MUVA 5DN2A 4YZ3A 3EHKA 2WWJA 5BNOA 2D6OX 2R042 3ENRA 4LKDA 3X29B 3I2FA 4XIOA 3VLBB 4IERA 2JKBA 3LA2A 4LHKA 4A6SA 4MVTA 3GBFA 5AVPA 4K3UA 2RR12 4BQYA 3W5MA 2XQRA 5LA1A 5KXCA 1W90A 1W9TA 2B45X 1YIPA 4XJWA 2VD7A 3B02A 2Y6GA 4NAOA 2TEPA 4H7MA 2BERA 1HRV1 3B9CA 3V64A 1A3KA 3ZFFB 4Q0UA 1OT5A 4EYUA 4QDRA 1V6KA 4MX3A 3KV4A 1BEV2 3KMHA 2LROA 4NR1A 4YM3A 5FP4A 4JHZA 4LTAA 4N43A 4P9IA 5EYYA 5B4XA 3F95A 1VBA2 1LGBA 5A6XA 2JJ6A 5DABA 1CJDA 4Y5TA 5JOXA 1AR73 3AKPA 4KWLA 1O8PA 2SLIA 3JXSA 2XJRA 1QJY2 4BLJA 1AYM3 2KA3A 2WFPA 3KF3A 4FTEA 4X8PA 1S4CA 2WDBA 3APBA 3B00A 1DGWX 2VQAA 1HKDA 3LFMA 4CEYA 5A7SA 4CDXA 3JBG1 3ZPOA 2AH2A 3JZVA 4I30A 5FBJA 2IC1A 3M7AA 3OBRA 4OHVA 4QDQA 2VOTA 2QVSB 4OYUA 5C71A 3H3ZA 2ZA9A 1GNZA 1OPOA 5JXIA 2V5DA 1SDWA 3AXDA 1H8TA 3R6SA 2VNOA 3JUUA 4D6SA 3FC0A 4AYUA 1COV3 4DRVA 2P3JA 2JG8A 4JKKA 4YSFA 1JHJA 3VL9A 4YM2A 3ZR6A 2D5HA 2BOIA 4FFGA 3TOJA 5A1LA 2CGPA 1QJU2 2Y26A 1V6IA 4CDUC 1S0EA 5KWRA 1RUNA 4DXTA 1NQDA 1CAVA 1DGRN 1HJGA 2WZEA 2XB6C 1WW4A 1XU1A 1W0PA 4EWDA 4Q26A 1XE7A 2VR4A 1DZQA 4HPKA 1E5HA 1QGLA 1S2EA 3I2OA 3T3YA 1RUOA 3USSA 2HWD3 3VBOA 4MGTA 4GA9A 1RUF1 2ZPXA 3ZYBA 1UW8A 3ELNA 5A7OA 1REDA 1HV1A 5JCTA 3MIEA 1JTZX 4XDOA 3ZSKA 5IYYA 4KBBA 1VMJA 4MGQA 2XBO2 4XHBA 3ZSJA 4ARXA 1O3SA 3OY8A 2VZRA 4AI0A 4N43B 2Z69A 3L9JT 2QKDA 3LKJA 4I3GA 4R9BA 4K21A 5FPXA 1DCSA 1LOFA 2XJVA 3MLLA 4W6YA 1LRHA 3AB0A 5FZBA 1OFNA 1UY0A 2W1UA 4YW3A 3T1MA 1OQ1A 3TEYA 3ABZA 1S0FA 4XCBA 4DIQA 5JXHA 1K45A 1PIV3 2F6BA 4MHUA 4NWVA 4RR3B 3ACHA 5FPBA 3ZSEA 1U5IA 1PK6A 1UWWA 3THCA 1DQ5A 3TN93 5IVFA 1GLHA 1RUH1 3M3EA 2PLV2 4BMBA 4JKMA 4BIOA 4DZGA 1PO22 4QPYA 2ARCA 2IFRA 1W8ZA 2GNDA 2J1TA 2ZGOA 4XURA 5DAVA 2RV9A 4XEZA 2VAUA 1VBC2 2JXAA 2D43A 1JW6A 1MS8A 3AZWA 3I2JA 3THPA 2IVJA 1YNAA 2ZGLA 1LEDA 3OGGA 4HVQA 1PGL1 3PUAA 2QZ2A 3S5AA 1AL21 1YEWA 5BV6A 4LJHA 1I6XA 3OF1A 5L7OA 1UOBA 5DUWA 1OXCA 3WT3A 2JECA 2DTYA 1SPPB 5FK8A 1N3OA 4YVSB 4C1XA 5LZ6A 3PUQA 2WNEA 1OQEA 2CSGA 3NAPA 4YLZA 4B1MA 1JHNA 5G04L 1JUHA 2G19A 3VBSC 1QNYA 2VULA 3EB7A 1CAWB 1ZREA 3ZKYA 1SLCA 2RS13 2YBPA 1TME1 2J1VA 1J1TA 1E5SA 2RM23 4A3ZA 1CN1A 3IDAA 3UKNA 1DIWA 2Y6KA 5JIUA 3UL2A 4L8QA 1RIRA 3LEMA 4WM8A 2YFZA 4FO9A 5HXMA 2P3YA 1E5IA 4JCKA 1RMU2 3AP4A 3WY6A 4PDWB 1JH5A 3AZYA 1FYUA 3M1HA 1AX1A 3MDPA 5LCWL 5JSPA 5A33B 4KWKA 4OUMA 4PHZA 1AX2A 4QX8A 2D6PA 3A0KA 4BQ1A 3ZIWA 1NCRB 5A3LA 3VZJA 2Z2SB 1HRI1 2R0HA 5I0UA 3RS6A 5JLVA 3OGJA 1DLCA 4NN0A 3NNMA 5FP9A 1C1LA 3G7DA 1R082 3SEPA 3W58A 1KRIA 4OUEA 4HONA 4MH0E 4QGMA 4IQPA 4FAGA 1WCKA 2ZMKA 1DQ0A 2TUNA 1FOD1 5FYSA 4AL9A 4URAA 2FDFA 1GZ9A 1XOYA 2OPWA 3OBAA 4QXKA 4IESA 3H50A 5K0UB 5FJKA 2W5FA 1V0AA 3MIDA 5IVCA 3BB6A 2A6WA 4FVVA 1MEC2 1RUH3 1UY4A 4UXAA 3POBA 5APAA 4DUVA 1US2A 4AGGA 4GB31 4FI9A 3EQEA 4PF5A 4LBMA 3WHUA 1GU3A 3T1LA 2XKOA 3T4HB 3WNPA 3R4DB 5T5JA 1V70A 5FZ7A 3FZ3A 4Q0SA 3GM8A 2P6HA 1OH3A 2DCZA 4XIKA 1UZWA 1ULFA 1W6OA 1JZ5A 4E27A 1YWKA 1AL23 5CZKA 1BZWA 1R1ZA 4XABA 2KM2A 3K4AA 3J7LA 1PIV1 3MV01 5E88A 2DBIA 2NN8A 2VE1A 4N7IA 3VB9A 4AEJA 2VZSA 3SLIA 2NLRA 1MZ6A 2Y64A 1LEMA 2XUEA 3T08A 3FBMA 1S0JA 2XWJB 4YM1A 5T54A 4I01A 3DF0A 5I8TA 1A34A 5IATA 2HEVF 1WA6X 1DYKA 3GJAA 1Q8PA 2R063 4ITCA 1WBFA 2D7FA 2YU1A 4Q4X1 4XUQA 3PVOA 5C3OA 5FLIA 1LJ7A 1R091 1FX5A 4GJZA 4JGZC 4Z8BA 1W6QA 2VL4A 3RZZA 3ZYGA 1OLME 1WW7A 1RUG2 1TVGA 2W39A 3O1SA 2W46A 3WP6A 5FDBA 2IVIB 3SKJE 3NNFA 2Q1ZB 2OPKA 2XBO1 3NVCA 3T2OA 5FYYA 1EAH3 1BYHA 5KHIA 3N7KA 3ZYFA 5J09A 1D4M3 2YFUA 2CHHA 2E53A 2G1MA 1W3VA 1W8NA 5LWBA 1J59A 5CFDA 4LBJA 3MLJA 5C3PA 4D7TA 5HBAA 3ZXLA 2XPJA 3C7EA 4MGSA 1JYXA 1PNFA 2ZEWA 4KG0A 4FPJA 1JI6A 1VIWB 4I3PA 3NL1A 1CESA 3LAGA 1UYPA 4RS5A 1ULOA 1SLLA 2A7AA 2XJTA 4J25A 4Y3OA 5H9RA 2VBPA 3IPVB 3NAPB 4E2SA 1HXS2 2XKPA 1FOD3 2C24A 4Q4Y1 4Q4V1 4U2AA 3ZXGA 1AHSA 1GQHA 2GNMA 3WDYA 3TRSB 2R49A 4UW3A
chains in the Genus database with same CATH topology
4ZXEA 3HNMA 4DEVA 1NX9A 3LPFA 3A22A 2YG0A 4QDSA 5HPOA 2E33A 3MO4A 4DUWA 3K75B 1O8SA 3A23A 4Z2AA 1XC6A 2VTFA 4L0PA 2Z4FA 4XUTA 4CU8A 4LHSA 4A4AA 2HYXA 1EUUA 2WUHA 2ZEXA 3ACFA 2J1UA 4W4ZA 2VCBA 2Y8KA 2Y6LA 1UXZA 3NNGA 3MUZ1 2VO5A 3WQBA 2W3JA 3I2HA 2E31A 2YB7A 2QQIA 4CUBA 1OD3A 2YC2A 4XZUG 2LS6A 4CU7A 3CIHA 4HG6B 2WAAA 4XUPA 1CZVA 1W8OA 2DCJA 3WNNA 3LEGA 3P6BA 3CDZB 1CZSA 2ZXQA 1UXXX 1LNSA 3C7OA 3I3EA 3I3BA 3J7HA 4BK5A 3NRUA 4CU9A 3HN3A 3IB3A 5DPNA 2XHNA 3PUIA 4QB6A 2XOMA 3LE0A 3VDAA 3VD5A 3T09A 2E32A 1JZ8A 2B4KA 2EIBA 2DCKA 3HPNA 5EJZB 5FUIA 3OGVA 1K3IA 2OKXA 1GUIA 5CYYA 3DECA 1SDDB 1JZ2A 1L7RA 2BGPA 3THDA 2WO2A 3LQCA 3MV11 3OGRA 1JYVA 2E26A 2VZUA 3OG2A 3FHQA 3MUY1 3A7QA 4PF1A 1NUKA 4D8MA 1JU3A 2VC9A 3T0AA 3LEKA 3BN6A 2WAOA 3WF2A 2W91A 2VZQA 4DXSA 3IIIA 2JD9A 1GOFA 3GGLA 1I5PA 3C8XA 4QB1A 4W50A 5JR2A 3VD3A 3U37A 2BGOA 4E8DA 2ID4A 2QQJA 4ZY9A 4DEQA 3P1IA 4A45A 3WF4A 2EIDA 1UX7A 2PQSA 2EIEA 1OF4A 2YC4A 2KD7A 4A42A 1MPXA 3WNMA 3AC0A 4P5YA 4QX1A 2RVAA 3ECQA 4P08A 1W9SA 4ET7A 1OH4A 1JYWA 2VM9A 5C70A 3SEEA 1EUTA 5JUVA 4QX3A 5G05L 2XONA 4CVUA 2WBKA 3DYOA 4A6OA 1P8JA 4GZ9A 2WO1A 1JYNA 4TXWA 3D3AA 2BBAA 2V4VA 3C7FA 3WF1A 3UESA 3IAPA 1W99A 4BK4A 2WN3A 3C7GA 5IFPA 1F4HA 2LW8A 2W87A 3K46A 2J1AA 1NKGA 1KEXA 4MADA 3NQHA 2C4XA 1GOHA 2WQ8A 2W1WA 3PUHA 2QQLA 4TTGA 3HJRA 3UNPA 3OEBA 5JMOA 4P00B 4BXSV 4QX0A 4CUAA 2W94A 3LEIA 1PX3A 4RN5A 2BZDA 1WCQA 1TG7A 3T2PA 4KWUA 2J22A 2VZOA 3T0DA 3A21A 2Y6JA 1JZ3A 1GQPA 3WF3A 4UI9L 5A1AA 1UMHA 3DYPA 3FHAA 3SKVA 3T2QA 1WKYA 4BDVB 3OEAA 3K77A 3WF0A 2WABA 4LKSA 1RYYA 4XVHA 1GNYA 5DN2A 3GXUA 1XPWA 3I97A 2J7MA 1R64A 3I2FA 3W5MA 3E1F1 1W9TA 4XUOA 2Y6GA 2BERA 4OMCA 1OT5A 3CZJA 4W8JA 4QDRA 1GMMA 3BGAA 4JHZA 5B4XA 1KGYA 2R7EB 2XQXA 3I3DA 3MBWA 4PT6A 5IHRA 5EIYB 1UYYA 1O8PA 4QX2A 2W1QA 3JXSA 3K4DA 2WDBA 4CUCA 1D7PM 3WSOA 4IUGA 2L9LA 1OF3A 4QDQA 2VOTA 4OYUA 5C71A 2VCAA 5JXIA 2V5DA 2C9KA 4QPWA 2W1SA 5EJ1B 4JKKA 1JHJA 1IQDC 4ZZ5A 3I2KA 1JZ4A 1UZ0A 4DXTA 2WZEA 1DP0A 2EICA 2VR4A 5B4NA 2VMEA 4UAPA 2X05A 1GOGA 1NAEA 1UMIA 3HOBA 5DMYA 3FN9A 4M4PA 5IYYA 3C7HA 4MGQA 4ARXA 2VZRA 1UY2A 4MO3M 1UY0A 2W1UA 3DYMA 2HLEA 3CQOA 4MOAA 2ZEZA 3LPGA 3ETPA 2CDOA 3ABZA 3WEZA 2WYSA 5JXHA 1K45A 3ACHA 2J1SA 2JDAA 3OB8A 1UWWA 3THCA 2VJXA 3F2ZA 1YQ2A 4GWJA 4A44A 4YPJA 4JKMA 2VZ3A 1PX4A 5IJRA 2J1TA 4XURA 2RV9A 4QB2A 3I2JA 4RYDA 4ARYA 3VD9A 2VCCA 5J1XA 1T2XA 4M4RA 3HNBM 1UY3A 4KI5M 3FL7A 3ZM8A 2DDUA 5DQ0A 2W92A 3GDBA 3VDBA 5G04L 1PMHX 3CZUA 2Y6HA 3EB7A 4JX0A 4UOJA 1DYOA 2J1VA 3EYPA 4A3ZA 3IDAA 1JZ7A 2Y6KA 2YFZA 2ZEYA 4LQRA 4QAWA 5HXMA 3NJXA 1CIYA 2QQMA 1J83A 5LA0A 1L7QA 5LCWL 2WO3A 3WNOA 2W47A 4GWIA 1XNTA 2W9XA 2J1EA 4LPLA 1F4AA 4P02B 2ORZA 3VD4A 1UYZA 1DLCA 3SEPA 2VQUA 3OGSA 3WNKA 4OUEA 2X10A 2W95A 4E8CA 4ZZ8A 3K4ZA 2B9VA 4DUXA 2VMDA 4OZOA 3OBAA 1US3A 4BJ0A 4PQQA 1W9WA 2W5FA 1UY4A 2V72A 3NJVA 3UETA 2QBXA 3WNLA 4AG4A 2VZPA 4DUVA 2RJ2A 2JE8A 5JXJA 1US2A 3VD7A 4FI9A 1GU3A 1K42A 3WNPA 2QQNA 1CZTA 3GM8A 1HN1A 3T0BA 2VZTA 2JKXA 1JZ5A 4CU6A 3CKHA 2WN2A 5CZKA 1J84A 1SHWB 5C7GA 1H6XA 3K4AA 4XUNA 5IFTA 3MV01 5LA1A 1W0NA 2VZSA 2Y64A 3W5NA 3T08A 3I2IA 2X09A 4AAXA 1ULPA 2QQOA 1UYXA 4XUQA 2ORXA 4OMDA 1PMJX 2VL4A 1JU4A 1UY1A 1TVGA 2C26A 2VMCA 2W46A 5I0DA 3SKJE 2CDPA 2VZ1A 3T2OA 1SG3A 3ACGA 3ACIA 4A41A 3CMGA 2WZ8A 4JKLA 2YFUA 3I2GA 1H6YA 1W8NA 2J1RA 3HNYM 1CX1A 1BHGA 3VDCA 1JZ6A 3C7EA 3IAQA 4MGSA 4D0QA 1JYXA 1XNAA 2ZEWA 2VMFA 1K12A 2VQTA 2VZVA 1O59A 1JI6A 1ULOA 3HEIA 5JXGA 4DXRA 4KMQA 2QQKA 5LA2A 5F7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZXE A;  3HNM A;  4DEV A;  1NX9 A;  3LPF A;  3A22 A;  2YG0 A;  4QDS A;  5HPO A;  2E33 A;  3MO4 A;  4DUW A;  3K75 B;  1O8S A;  3A23 A;  4Z2A A;  1XC6 A;  2VTF A;  4L0P A;  2Z4F A;  4XUT A;  4CU8 A;  4LHS A;  4A4A A;  2HYX A;  1EUU A;  2WUH A;  2ZEX A;  3ACF A;  2J1U A;  4W4Z A;  2VCB A;  2Y8K A;  2Y6L A;  1UXZ A;  3NNG A;  3MUZ 1;  2VO5 A;  3WQB A;  2W3J A;  3I2H A;  2E31 A;  2YB7 A;  2QQI A;  4CUB A;  1OD3 A;  2YC2 A;  4XZU G;  2LS6 A;  4CU7 A;  3CIH A;  4HG6 B;  2WAA A;  4XUP A;  1CZV A;  1W8O A;  2DCJ A;  3WNN A;  3LEG A;  3P6B A;  3CDZ B;  1CZS A;  2ZXQ A;  1UXX X;  1LNS A;  3C7O A;  3I3E A;  3I3B A;  3J7H A;  4BK5 A;  3NRU A;  4CU9 A;  3HN3 A;  3IB3 A;  5DPN A;  2XHN A;  3PUI A;  4QB6 A;  2XOM A;  3LE0 A;  3VDA A;  3VD5 A;  3T09 A;  2E32 A;  1JZ8 A;  2B4K A;  2EIB A;  2DCK A;  3HPN A;  5EJZ B;  5FUI A;  3OGV A;  1K3I A;  2OKX A;  1GUI A;  5CYY A;  3DEC A;  1SDD B;  1JZ2 A;  1L7R A;  2BGP A;  3THD A;  2WO2 A;  3LQC A;  3MV1 1;  3OGR A;  1JYV A;  2E26 A;  2VZU A;  3OG2 A;  3FHQ A;  3MUY 1;  3A7Q A;  4PF1 A;  1NUK A;  4D8M A;  1JU3 A;  2VC9 A;  3T0A A;  3LEK A;  3BN6 A;  2WAO A;  3WF2 A;  2W91 A;  2VZQ A;  4DXS A;  3III A;  2JD9 A;  1GOF A;  3GGL A;  1I5P A;  3C8X A;  4QB1 A;  4W50 A;  5JR2 A;  3VD3 A;  3U37 A;  2BGO A;  4E8D A;  2ID4 A;  2QQJ A;  4ZY9 A;  4DEQ A;  3P1I A;  4A45 A;  3WF4 A;  2EID A;  1UX7 A;  2PQS A;  2EIE A;  1OF4 A;  2YC4 A;  2KD7 A;  4A42 A;  1MPX A;  3WNM A;  3AC0 A;  4P5Y A;  4QX1 A;  2RVA A;  3ECQ A;  4P08 A;  1W9S A;  4ET7 A;  1OH4 A;  1JYW A;  2VM9 A;  5C70 A;  3SEE A;  1EUT A;  5JUV A;  4QX3 A;  5G05 L;  2XON A;  4CVU A;  2WBK A;  3DYO A;  4A6O A;  1P8J A;  4GZ9 A;  2WO1 A;  1JYN A;  4TXW A;  3D3A A;  2BBA A;  2V4V A;  3C7F A;  3WF1 A;  3UES A;  3IAP A;  1W99 A;  4BK4 A;  2WN3 A;  3C7G A;  5IFP A;  1F4H A;  2LW8 A;  2W87 A;  3K46 A;  2J1A A;  1NKG A;  1KEX A;  4MAD A;  3NQH A;  2C4X A;  1GOH A;  2WQ8 A;  2W1W A;  3PUH A;  2QQL A;  4TTG A;  3HJR A;  3UNP A;  3OEB A;  5JMO A;  4P00 B;  4BXS V;  4QX0 A;  4CUA A;  2W94 A;  3LEI A;  1PX3 A;  4RN5 A;  2BZD A;  1WCQ A;  1TG7 A;  3T2P A;  4KWU A;  2J22 A;  2VZO A;  3T0D A;  3A21 A;  2Y6J A;  1JZ3 A;  1GQP A;  3WF3 A;  4UI9 L;  5A1A A;  1UMH A;  3DYP A;  3FHA A;  3SKV A;  3T2Q A;  1WKY A;  4BDV B;  3OEA A;  3K77 A;  3WF0 A;  2WAB A;  4LKS A;  1RYY A;  4XVH A;  1GNY A;  5DN2 A;  3GXU A;  1XPW A;  3I97 A;  2J7M A;  1R64 A;  3I2F A;  3W5M A;  3E1F 1;  1W9T A;  4XUO A;  2Y6G A;  2BER A;  4OMC A;  1OT5 A;  3CZJ A;  4W8J A;  4QDR A;  1GMM A;  3BGA A;  4JHZ A;  5B4X A;  1KGY A;  2R7E B;  2XQX A;  3I3D A;  3MBW A;  4PT6 A;  5IHR A;  5EIY B;  1UYY A;  1O8P A;  4QX2 A;  2W1Q A;  3JXS A;  3K4D A;  2WDB A;  4CUC A;  1D7P M;  3WSO A;  4IUG A;  2L9L A;  1OF3 A;  4QDQ A;  2VOT A;  4OYU A;  5C71 A;  2VCA A;  5JXI A;  2V5D A;  2C9K A;  4QPW A;  2W1S A;  5EJ1 B;  4JKK A;  1JHJ A;  1IQD C;  4ZZ5 A;  3I2K A;  1JZ4 A;  1UZ0 A;  4DXT A;  2WZE A;  1DP0 A;  2EIC A;  2VR4 A;  5B4N A;  2VME A;  4UAP A;  2X05 A;  1GOG A;  1NAE A;  1UMI A;  3HOB A;  5DMY A;  3FN9 A;  4M4P A;  5IYY A;  3C7H A;  4MGQ A;  4ARX A;  2VZR A;  1UY2 A;  4MO3 M;  1UY0 A;  2W1U A;  3DYM A;  2HLE A;  3CQO A;  4MOA A;  2ZEZ A;  3LPG A;  3ETP A;  2CDO A;  3ABZ A;  3WEZ A;  2WYS A;  5JXH A;  1K45 A;  3ACH A;  2J1S A;  2JDA A;  3OB8 A;  1UWW A;  3THC A;  2VJX A;  3F2Z A;  1YQ2 A;  4GWJ A;  4A44 A;  4YPJ A;  4JKM A;  2VZ3 A;  1PX4 A;  5IJR A;  2J1T A;  4XUR A;  2RV9 A;  4QB2 A;  3I2J A;  4RYD A;  4ARY A;  3VD9 A;  2VCC A;  5J1X A;  1T2X A;  4M4R A;  3HNB M;  1UY3 A;  4KI5 M;  3FL7 A;  3ZM8 A;  2DDU A;  5DQ0 A;  2W92 A;  3GDB A;  3VDB A;  5G04 L;  1PMH X;  3CZU A;  2Y6H A;  3EB7 A;  4JX0 A;  4UOJ A;  1DYO A;  2J1V A;  3EYP A;  4A3Z A;  3IDA A;  1JZ7 A;  2Y6K A;  2YFZ A;  2ZEY A;  4LQR A;  4QAW A;  5HXM A;  3NJX A;  1CIY A;  2QQM A;  1J83 A;  5LA0 A;  1L7Q A;  5LCW L;  2WO3 A;  3WNO A;  2W47 A;  4GWI A;  1XNT A;  2W9X A;  2J1E A;  4LPL A;  1F4A A;  4P02 B;  2ORZ A;  3VD4 A;  1UYZ A;  1DLC A;  3SEP A;  2VQU A;  3OGS A;  3WNK A;  4OUE A;  2X10 A;  2W95 A;  4E8C A;  4ZZ8 A;  3K4Z A;  2B9V A;  4DUX A;  2VMD A;  4OZO A;  3OBA A;  1US3 A;  4BJ0 A;  4PQQ A;  1W9W A;  2W5F A;  1UY4 A;  2V72 A;  3NJV A;  3UET A;  2QBX A;  3WNL A;  4AG4 A;  2VZP A;  4DUV A;  2RJ2 A;  2JE8 A;  5JXJ A;  1US2 A;  3VD7 A;  4FI9 A;  1GU3 A;  1K42 A;  3WNP A;  2QQN A;  1CZT A;  3GM8 A;  1HN1 A;  3T0B A;  2VZT A;  2JKX A;  1JZ5 A;  4CU6 A;  3CKH A;  2WN2 A;  5CZK A;  1J84 A;  1SHW B;  5C7G A;  1H6X A;  3K4A A;  4XUN A;  5IFT A;  3MV0 1;  5LA1 A;  1W0N A;  2VZS A;  2Y64 A;  3W5N A;  3T08 A;  3I2I A;  2X09 A;  4AAX A;  1ULP A;  2QQO A;  1UYX A;  4XUQ A;  2ORX A;  4OMD A;  1PMJ X;  2VL4 A;  1JU4 A;  1UY1 A;  1TVG A;  2C26 A;  2VMC A;  2W46 A;  5I0D A;  3SKJ E;  2CDP A;  2VZ1 A;  3T2O A;  1SG3 A;  3ACG A;  3ACI A;  4A41 A;  3CMG A;  2WZ8 A;  4JKL A;  2YFU A;  3I2G A;  1H6Y A;  1W8N A;  2J1R A;  3HNY M;  1CX1 A;  1BHG A;  3VDC A;  1JZ6 A;  3C7E A;  3IAQ A;  4MGS A;  4D0Q A;  1JYX A;  1XNA A;  2ZEW A;  2VMF A;  1K12 A;  2VQT A;  2VZV A;  1O59 A;  1JI6 A;  1ULO A;  3HEI A;  5JXG A;  4DXR A;  4KMQ A;  2QQK A;  5LA2 A;  5F7U A; 
#chains in the Genus database with same CATH topology
 1UU6 A;  1OI6 A;  3CJI A;  5AC9 2;  3M3C A;  3AK0 A;  5F6L B;  3ZO0 B;  4XF4 A;  4AFA A;  1E5R A;  2YG0 A;  5DUX A;  2PEL A;  1EYB A;  2DVF A;  2P34 A;  2WWU A;  3JB8 A;  1U5X A;  3K48 A;  3POW A;  4LE4 A;  3U75 A;  5HPO A;  1O3R A;  4MXW B;  4CP9 B;  3Q8E A;  4LUL A;  4ZKT B;  3POI A;  3WCS A;  3OUJ A;  3QBQ A;  1EV1 3;  5DAP A;  3MYX A;  4QPG B;  4COU A;  2WL1 A;  3GZA A;  3T2T A;  1PO1 1;  1RUD 1;  3M70 A;  5ISL A;  3OSD A;  2YPJ A;  1F31 A;  4BME A;  4YW6 A;  4Q5O A;  2Y6L A;  3ZLI A;  1U0A A;  5LRS A;  4I0B A;  2QJV A;  4COZ A;  2HWB 2;  1S0C A;  3OPZ A;  1G8W A;  4E4H A;  1F35 A;  5EYX A;  1QOT A;  2JG9 B;  1YCI A;  3J4U H;  3ZMO A;  5GZD A;  4SBV A;  4XJZ A;  4XZU G;  2A6Y A;  4B8E A;  2AYH A;  3CIH A;  5LBB A;  1ZBE 3;  3ZN5 A;  4HG6 B;  3U78 A;  3LF7 A;  1OVS A;  4UF0 B;  4RFT 0;  2EXH A;  4CEW C;  1QDO A;  4RA0 A;  2EVX A;  3W59 A;  2MEV 1;  2OII A;  1AR9 3;  4Q8L A;  4NRP A;  3FBY A;  4IEY A;  2GMP A;  4HSL A;  1ODM A;  5DXD A;  1S1A A;  3Q8B A;  1VBB 1;  3VV1 A;  3I3E A;  5FPZ A;  1AL2 2;  1IPJ A;  3I3B A;  4BK5 A;  3NRU A;  4ORF A;  4K8R B;  2VBB A;  2BGC A;  1Q8Q A;  3LZZ A;  2GN7 A;  3Q8C A;  3B69 A;  5GLZ A;  3O1V A;  3VD5 A;  1AR7 2;  4IE7 A;  3UGH A;  1SFP A;  5HCA A;  2ZKN A;  1LHO A;  1JZ8 A;  3KHB A;  4Q4V 3;  5BNP B;  1O3T A;  2JB4 A;  1GFF 2;  5IK7 A;  3HPN A;  3QH7 A;  4CPB A;  1RL3 A;  3AX4 A;  4JV4 A;  4B7K A;  5A3N A;  2WS9 3;  3VHN A;  4BQ5 A;  4X8N A;  1EAH 1;  1HB4 A;  4QM8 A;  4Y1Y A;  4AGR A;  1B35 B;  1NA1 B;  5CYY A;  5HV0 A;  2XJP A;  1CIW A;  1XYO A;  2JDU A;  1XND A;  4P9L A;  3G6J B;  1I5Z A;  3LDB A;  3N7M A;  2BGP A;  4RQP B;  5CFD C;  4CSW A;  4EZ4 A;  2WO2 A;  3LQC A;  3Q8F A;  2BEO A;  3O1P A;  1PZ7 A;  4IDZ A;  4QD2 A;  3O1M A;  4NIH A;  2E63 A;  1QKQ A;  1RUD 3;  2WRA A;  5GLT A;  2O0O A;  4YM0 A;  2Y6F A;  5JPN B;  4GMP 0;  4G9S B;  3LD8 A;  4PF1 A;  1X8M A;  3V0A A;  1EY2 A;  5CIR A;  4HN1 A;  3T0A A;  3LEK A;  1HW5 A;  5CKN A;  5FPV A;  2Y0I A;  4XFB A;  3C2U A;  1Q43 A;  2X5I A;  3III A;  1V6J A;  4EQV A;  4MGZ E;  3KHC A;  5FO7 B;  3JU9 A;  3BUC A;  1ND3 C;  1YUD A;  2HWC 3;  1RVF 2;  1QQP 1;  5FP7 A;  4W50 A;  4B4Q A;  4Y4Y A;  4AI1 A;  1SAC A;  1ULG A;  1W06 A;  1QXR A;  2ARA A;  3ORJ A;  4ZY9 A;  4LO4 B;  4DEQ A;  3P1I A;  4XBQ A;  5DZF A;  3M4F A;  4YW2 A;  5ABJ B;  5IVJ A;  3WF4 A;  3VBF A;  1LHN A;  1QOO A;  2EID A;  1JYI A;  2B8M A;  1PO1 3;  3D8C A;  4XBN A;  1C8N A;  4RHV 3;  4WVZ A;  2CNA A;  3O1R A;  4BCU A;  2ZAA A;  4FPK A;  1IS5 A;  3B3Q E;  4N53 B;  5EP9 A;  2IZW A;  3NNL A;  1LAJ A;  4FTS A;  1IQA A;  4XIL A;  2YYO A;  1H2N A;  1K5M C;  2D5F A;  4H2A A;  4PLM A;  4JDM A;  1ZBA 1;  3S5Q A;  4QX1 A;  3GNE A;  2PTM A;  1FV3 A;  4X6Q B;  1TNR A;  3ECQ A;  2C9A A;  4FCA A;  1PGW 2;  1Q8V A;  1RTV A;  2X5I C;  2ZHL A;  1D0H A;  3S0M A;  2Q0A A;  5JUV A;  2PHR A;  3U0Z A;  2PLV 3;  4JTN A;  1PO2 3;  2Q1F A;  3WG4 A;  3DYO A;  5C4W A;  1LOG A;  3WDV A;  2BV4 A;  3IMM A;  5EV7 A;  5J7M A;  4LO6 B;  1D0G A;  3ME2 A;  5L7O C;  1GWM A;  2WO1 A;  2VUD A;  3RRD A;  1OKO A;  2GNB A;  3ZYR A;  2PYT A;  2BBA A;  2V4V A;  5BPX A;  4PIY A;  1KDK A;  1CPM A;  3UES A;  2E6V A;  3UJO A;  4AW7 A;  3CF6 E;  1W99 A;  4ES8 A;  1DFQ A;  3HWJ A;  3E5U A;  1VAK A;  5GM0 A;  5EJ3 A;  1F4H A;  2W87 A;  2ZGM A;  4FFH A;  4NHL A;  3K46 A;  1SFN A;  2D93 A;  1NKG A;  2CV6 A;  2J1A A;  4HET A;  1FT9 A;  1Z0H A;  4K1Z A;  3NQH A;  3ZIX A;  1V6O A;  4Y33 A;  1S0B A;  3GCW A;  1UZY A;  2HWB 1;  5FY9 A;  1ZA4 A;  4J6G A;  3VBF B;  3GJB A;  3O1T A;  1GOH A;  1F5F A;  1UIJ A;  1TME 2;  5FXW A;  2P6C A;  1GP4 A;  2LM3 A;  1NT0 A;  3HN1 A;  4FFF A;  5FYH A;  4MG2 A;  3DKW A;  3HJR A;  4Q4V 2;  5BXX A;  3FE5 A;  5FWE A;  1FXZ A;  3OEB A;  2RG4 A;  4M3C E;  3BTA A;  1QJZ A;  3N9L A;  4Z82 A;  4BXS V;  4XMI A;  1BEV 1;  5KBF A;  3GZU C;  1D2Q A;  1YQC A;  1O4T A;  2VVD A;  2W94 A;  2RS5 1;  5FZL A;  4RN5 A;  3WVJ A;  4DIN B;  3KQ4 B;  2XJS A;  1WCQ A;  1DBN A;  1N1S A;  4XC9 A;  3M3I A;  1OVP A;  1O3Q A;  1IS6 A;  2QDR A;  3PDQ A;  3NV2 A;  3WG1 A;  1FPN 3;  1W6M B;  5CBL A;  4GH4 C;  1REE A;  1YC6 1;  4BPZ A;  5A1A A;  5BNP C;  1GIC A;  4BH9 A;  3NMB A;  1N1Y A;  2OW4 A;  4PIZ A;  5LK5 A;  3GYD A;  2I45 A;  5FUN A;  4NHM A;  3DYP A;  2P3I A;  3OTF A;  3WG3 A;  2YU2 A;  1ZRI A;  4Q29 A;  3WQ7 A;  3RI9 A;  3TBD A;  3WF0 A;  1RUJ 1;  4JAA A;  4B1L A;  1ACC A;  3B94 A;  5JOZ A;  1C5H A;  2WAB A;  2YY1 A;  3WW2 A;  1DGL A;  5LW9 A;  2Q8D A;  3KVB A;  3MW3 A;  1FI2 A;  3RJ2 X;  2G9Z A;  3I97 A;  4CUG A;  1SCR A;  5SV5 A;  1R64 A;  5C5T A;  1NCR C;  2XG3 A;  2ET1 A;  4TN7 A;  4NHX A;  4M3C A;  3E1F 1;  2D3P A;  2CY6 A;  5C3Q A;  4BHP A;  4EV0 A;  3ZYJ B;  2D6N A;  5LBF A;  5CEH A;  3TNQ A;  4CEY C;  3O1U A;  1W03 A;  4LKE A;  4A7Y A;  4AVA A;  4CXW A;  1W28 A;  3ZFE A;  4AI8 A;  1UO9 A;  1ZZ6 A;  3EBR A;  2WO7 A;  2V5Y A;  4ISR A;  5FPA A;  2XGX A;  5FP3 A;  2A73 B;  2R7E B;  4I2O A;  3I3D A;  3VBS B;  5CAD A;  5FYC A;  1MS0 A;  1XU2 A;  5CVR A;  4CCE A;  1QQP 2;  4AFC A;  2PN5 A;  4AED B;  4CDU A;  4YVS C;  4CUC A;  3E6C C;  1ZZC A;  2Q8O A;  2R0F A;  3WSO A;  1W6O B;  3MIH A;  3H8R A;  2VVF A;  3PIJ A;  3KT4 A;  1PNG A;  2HWF 1;  1ASJ 3;  5T55 A;  1D4M 2;  1VLN A;  1ZNP A;  2L9L A;  5A7N A;  1OF3 A;  4L92 A;  3DUI A;  5FIX A;  1CAU A;  4BE3 A;  4QHB A;  4JC1 A;  3DEM A;  4CDX B;  4ZU7 A;  4NID A;  2DVA A;  2IXJ A;  4O65 A;  2JIJ A;  2VCA A;  2XJU A;  2XJQ A;  4CXX A;  2VGD A;  5J96 B;  4IW3 A;  1Q3E A;  1QIQ A;  1VRB A;  4UF0 A;  3PHM A;  4JGZ A;  1R1A 1;  4ZZ5 A;  2VW1 A;  2W08 A;  2UY9 A;  1X8E A;  3BIW E;  5L9R A;  3WQ1 A;  2EA7 A;  3I2K A;  2GU9 A;  1JZ4 A;  1RUF 3;  2WZR 2;  1UZ0 A;  4QPI A;  2XR4 A;  3M3Q A;  4OUS A;  1DZT A;  2HJI A;  1BCX A;  2R6Q A;  2WR9 A;  3N9Q A;  2YBS A;  3PTY A;  4IEP A;  5BUV A;  5M0T A;  2BWA A;  2PMW B;  2EIC A;  2R07 3;  5B4N A;  3VBR C;  1QJX 2;  3ASI A;  2VME A;  5LA9 A;  1VMH A;  4N43 C;  1S2K A;  5FQ0 B;  1AF9 A;  1GOG A;  5FZE A;  3AZZ A;  1NAE A;  2R16 A;  2XWB B;  3LSE A;  1ZVF A;  5FR3 A;  4H3W A;  4J1W A;  4FOY A;  1MR5 A;  3HBZ A;  2BPA 2;  1WMD A;  2A6Z A;  4YRD A;  1LU2 A;  3MPP G;  3UKV A;  4GH4 B;  5C9A C;  1LOB A;  1M4W A;  1PVC 3;  2B9U A;  3JQX A;  3SH5 A;  2V09 A;  3E5Q A;  4MO3 M;  2B39 A;  1KXG A;  3U4S A;  2VEC A;  1WME A;  2IXK A;  1V9U 3;  3Q9O A;  5F8P A;  3MFA A;  3DYM A;  1DGR A;  4Y20 A;  3CQO A;  2HEW F;  2ZEZ A;  1XQN A;  3LPG A;  3ZFF A;  1AR8 2;  2CDO A;  3ETP A;  4R4Z A;  4LOS A;  3CJI B;  4P9J A;  4UBH A;  3I59 B;  2P2K A;  1GWK A;  1Z7S 3;  2FDJ A;  4NHY A;  4AHY A;  1C4R A;  2FD8 A;  4LK6 A;  3AMH A;  3P3N A;  2VJX A;  1YQ5 A;  3N3H A;  3PJQ A;  4ZS3 A;  4YPJ A;  4WM7 B;  4MSV A;  4QPI C;  1X9T A;  2JG9 C;  1DQ2 A;  2P17 A;  2RE9 A;  5IJR A;  4HK9 A;  2IFW A;  2ES3 A;  5L36 A;  4QQO A;  2MEV 2;  3IDC B;  5F32 A;  3VD9 A;  2EXK A;  4LLO A;  3UKT A;  5C9A A;  2ZGP A;  5LY1 A;  1APN A;  4PCR A;  3RYK A;  2PAK A;  1UY3 A;  4CXY A;  2RS1 1;  1RUE 2;  4JQR A;  1AL0 G;  2PHW A;  4S2H A;  1WLC A;  4IXL A;  2YPD A;  1HDK A;  1HQN A;  2JIG A;  5H9P A;  2DUR A;  3BPS A;  3Q8A A;  5L7O B;  3GDB A;  3ZFG B;  1PMH X;  1X82 A;  3CZU A;  2FBE A;  2F4L A;  1STM A;  2H0V A;  2Y6H A;  2VOW A;  5IAV A;  4BQ2 A;  4JX0 A;  3M2M A;  3N36 A;  1DYO A;  5FMD A;  4IEU A;  4B7E A;  3PJY A;  1X9P A;  1QMJ A;  1QY4 A;  3PU3 A;  5TSW A;  5DZE A;  3ZX7 A;  1O5U A;  1TMF 3;  1HRI 3;  1AR6 2;  5FZG A;  1H4H A;  2JE9 A;  1WA4 A;  2QUO A;  3KD4 A;  4FXK B;  1OSG A;  1S55 A;  4GH4 A;  2QQM A;  3VBH B;  1J83 A;  4CCO A;  4TSV A;  3ZSL A;  2FDK A;  4YYO A;  4I02 A;  2R1D A;  4MHR A;  1MQT A;  2RS5 2;  4WV8 A;  4HVR A;  1UOG A;  4QWN A;  5T52 A;  4YVW B;  4CDW B;  4S2G A;  2J1E A;  4GKX A;  2NQY A;  4LPL A;  1F4A A;  3N9O A;  2QCS B;  5FYV A;  2ZGR A;  2K0G A;  1QJF A;  1UYZ A;  1A6C A;  4IGO A;  1NCR A;  1R09 2;  1ENR A;  3OGS A;  4E8C A;  4TYS A;  2X10 A;  2W95 A;  5IK8 A;  1NQJ A;  3E6B A;  4QGN A;  3AZX A;  3BI3 A;  1CX4 A;  1RUF 2;  2PHD A;  2VMD A;  3IDE A;  5IUQ A;  4IEQ A;  3LSD A;  3WX5 A;  2AR6 A;  1KD7 A;  5LK7 B;  3MGU A;  4Y5S A;  2HWC 2;  4CCM A;  3NO8 A;  1TE1 B;  5FYM A;  3TEZ A;  5LBE A;  1POV 3;  3FLR A;  3J7N A;  4COY A;  2P3K A;  2QBX A;  4AG4 A;  5L73 A;  5FCC A;  4GWM A;  2A3X A;  5A3W A;  4KWJ A;  2KR2 A;  2ETE A;  5CA6 A;  4P9X A;  5AVA A;  1K42 A;  1W9F A;  4FTB A;  4YZ1 A;  4XAA A;  1C8M 3;  1CZT A;  2JDZ A;  4PBP A;  4QMA A;  2BNM A;  4XJ9 A;  1VMF A;  1G86 A;  3S7E A;  5BNN A;  5I93 A;  3CKH A;  3LIH A;  4L99 A;  1J84 A;  1PVC 2;  1MVQ A;  1TNF A;  1C3H A;  1H6X A;  3A4U A;  4GUL A;  4IEX A;  5D2A A;  3SIS A;  1AYM 2;  2X5I B;  3NKG A;  5IFT A;  4NRO A;  1HJF A;  1OKQ A;  4DOU A;  1PO2 1;  2R1B A;  4Q1P A;  1W2A X;  3A0N A;  1W8H A;  2BVV A;  2CU5 A;  5GZF A;  1GP5 A;  1AR8 3;  3W5N A;  3U11 A;  1UPS A;  3I2I A;  4F3J A;  3OBZ A;  1S0I A;  1XYP A;  4B4P A;  4AAX A;  3MF9 A;  1ULP A;  2D6M A;  1DQ6 A;  1OLQ A;  2ORX A;  4ERO A;  4OMD A;  2JEM A;  4IV3 C;  2ARE A;  4XQ4 A;  3ZFG A;  4WVV A;  3M8L A;  4CA9 A;  3VDD C;  1UU4 A;  3KV9 A;  1JU4 A;  1UY1 A;  2WSV A;  3JD7 1;  2VMC A;  1RHI 1;  2VZ1 A;  5F39 A;  4D7S A;  1SG3 A;  3ZDS A;  2DU1 A;  3CMG A;  2WZ8 A;  2UYB A;  3I2G A;  4M00 A;  1LGC A;  5CFC C;  2WJS A;  1BHG A;  1RUI 1;  3FLP A;  1JZ6 A;  3IAQ A;  5FZK A;  1YLL A;  1K12 A;  2VQT A;  3HT2 A;  2VZV A;  4LBN A;  5FZ9 A;  5IK5 A;  5C33 A;  1ALY A;  1XB9 A;  4NAM A;  1O7F A;  5ACA 1;  1ZM1 A;  3HEI A;  4XF9 A;  5FZ8 A;  5JXG A;  5CKQ A;  1XBF A;  1X7N A;  5HI0 A;  2QQK A;  1RUH 2;  5IT6 A;  1CAX B;  5AC9 3;  4NRQ A;  4X6R B;  5A7W B;  4UFM A;  2BBV A;  1GZC A;  3ZDV A;  5J98 B;  4DXZ A;  5FO8 B;  2RJL A;  4NO4 A;  4ZXE A;  1VBB 2;  1W8F A;  4BQ4 A;  1AZD A;  3I54 A;  3VZO A;  4YWA A;  4DEV A;  1EV1 2;  3I8T A;  2ZMN A;  3LPF A;  3QCW A;  3KCX A;  4Q4W 1;  4IV1 A;  4QDS A;  3RMY A;  2E33 A;  1AX0 A;  4DUW A;  5H9S A;  4GQ7 A;  1VE0 A;  1RUE 1;  4Z2A A;  4K1Y A;  2VTF A;  3USU B;  5FZF A;  1NXM A;  2UUR A;  3ILF A;  3M3O A;  3NV4 A;  5D8A A;  1EUU A;  3ZN4 A;  2X53 S;  1G9A A;  3TN9 2;  2WA3 A;  4MZU A;  1UAI A;  2J1U A;  1YIF A;  5EHD A;  2VCB A;  5I8S A;  1UXZ A;  4YGD A;  1RUJ 2;  1AR8 1;  5FZO B;  5C4W C;  1G9C A;  1RIN A;  3VZN A;  5HXV A;  3N9M A;  3WQB A;  4P5H A;  2CGO A;  5FZH A;  3I2H A;  1DZR A;  4XXA A;  4LA2 A;  1AR9 1;  3ZFF C;  5EPA A;  5C3S A;  3V0B A;  4N9H A;  4IE5 A;  3ALQ A;  4QU1 A;  5DG2 A;  2IXH A;  3NAP C;  2LS6 A;  2E7T A;  4YW4 A;  1U12 A;  2XL9 A;  2ZS6 B;  3D0J A;  1LR5 A;  4R4X A;  4OFG A;  3BTZ A;  2RDN A;  2FMD A;  4LBQ A;  2VQ0 A;  1HV0 A;  2NPI A;  3WNN A;  4B4R A;  1WLD A;  4URT A;  3HAG A;  3CDZ B;  1CZS A;  4ZPI A;  4QU2 A;  1UXX X;  3PME A;  1SBE A;  2WII B;  2FZ1 A;  2P1B A;  2XVG A;  3RQ0 A;  4GMP 3;  3VBR A;  2ET7 A;  4YGB A;  4QB6 A;  3K51 A;  1NE4 A;  4YVS A;  1FNY A;  5J3U A;  3GZT B;  4MXV A;  4A3X A;  3T09 A;  1A8M A;  5FY1 A;  4AEM A;  3KGL A;  2EIB A;  1BBT 2;  2HWF 3;  2XLF A;  4G4F A;  3MEP A;  1J58 A;  3WG2 A;  4OHX A;  2AAC A;  1Y9G A;  4HAN A;  4QT6 A;  3JD7 3;  1ZZ8 A;  1AXK A;  4I0W B;  4DB5 A;  2XBO 3;  4CP2 A;  1WLT A;  2BRT A;  2RS3 3;  1ZZ9 A;  4O7X A;  2QZ3 A;  4WBB A;  4TZD A;  2OKX A;  4Q4W 3;  4YAR A;  2WIN B;  4QXH A;  4K20 A;  4YVW C;  5A7W A;  3N9N A;  1SDD B;  3I3Q A;  4CDW C;  1I1E A;  3QOP A;  1RUI 3;  2DV9 A;  3PVE A;  4LO7 A;  4QKF A;  1L7R A;  3THD A;  3H7J A;  3HVD A;  3OGR A;  2PHU A;  2EAA A;  4DNY A;  1JYV A;  2E26 A;  3LB9 A;  1FMD 1;  1GYK A;  1UD1 A;  1NY7 1;  4AQS A;  5C9A B;  2WFF 1;  1AYN 3;  5FP8 A;  3AXE A;  1UMZ A;  2WZR 1;  1BXH A;  2CGN A;  2HWB 3;  5AC9 1;  1H1I A;  5AFE A;  1NUK A;  4D8M A;  3CO2 A;  2DFC A;  3J26 N;  5E1R A;  4LO5 B;  4KG8 A;  1UKG A;  1DYP A;  1RJ7 A;  2W91 A;  3POE A;  1H1A A;  1H8V A;  1GOF A;  2UWA A;  2VH9 A;  3IMN A;  2A70 A;  4HKW A;  4RQP A;  2BVB A;  4LOT A;  5FYT A;  3C8X A;  4GJY A;  4YZ2 A;  4NE9 A;  1MZF A;  3VD3 A;  2ZAB A;  4QQP A;  3U37 A;  4JQT A;  2BGO A;  1PO1 2;  1RUC 1;  5DDJ 2;  4AI2 A;  4RHV 2;  4HN0 A;  2QQJ A;  2VTX J;  5JIA A;  2VTX A;  4MGI E;  5J37 A;  2GC2 A;  1LHW A;  2FHR A;  2VNG A;  3GHN A;  3ZYH A;  1VR3 A;  2RDS A;  4COW A;  3NST A;  2ZX4 A;  3RI8 A;  5C8W A;  3SNM A;  1ZZ7 A;  4M3C F;  2YC4 A;  3PUS A;  3I2D A;  1KJR A;  1QJY 3;  2ATF A;  2KD7 A;  4XE9 A;  5A32 B;  4GWN A;  3WUC A;  3RVH A;  4GMP 1;  3BOD A;  3WCR A;  3VHO A;  5FBZ A;  2A6X A;  4FT8 A;  1PGS A;  4Q4Y 2;  4CDQ A;  4ET7 A;  3AKR A;  1OH4 A;  1RUJ 3;  3OBT A;  3I4I A;  3SC7 X;  1OA4 A;  5C70 A;  2CTV A;  2ZHK A;  2HKX A;  3VBO B;  4GKY A;  4QX3 A;  5JSO A;  5CG8 A;  5F5C A;  1PHM A;  1P8J A;  3DPR B;  2ZHN A;  1CWP A;  1ST8 A;  1VBA 1;  5E6H A;  1CAV B;  1JOB A;  2A5Z A;  2ARX A;  2OS2 A;  5A70 A;  2MEV 3;  5FKB A;  1JYN A;  3H8X A;  5F3G A;  3D3A A;  4Z1V A;  1MAC A;  1SZB A;  3EO6 A;  4HKO A;  3RZH A;  3C7F A;  4GAL A;  1R08 3;  4FPO B;  4QGL A;  4JDO A;  1RUD 2;  5C6C A;  3DKQ A;  1D2S A;  2Y38 A;  2WN3 A;  3C7G A;  3BAL A;  5JZG A;  1PM4 A;  3KF5 A;  1W6P B;  3JBG 2;  1LOC A;  2MHF A;  2WLP A;  3S30 A;  2R30 A;  4IEV A;  4QM9 A;  5A1F A;  1TME 3;  2PAM A;  1KEX A;  5DAQ A;  4LUK A;  3ZFE B;  5FTT C;  3VKF C;  1NCQ C;  4XBL A;  1NLQ A;  1SLB A;  2GME A;  1NLS A;  2HYK A;  3VHR A;  4EWE A;  3KCC A;  2WQ8 A;  1OHF A;  1ENQ A;  1XRU A;  2BUK A;  4LBO A;  3CEW A;  1RVF 3;  3PL0 A;  5LB6 A;  4XJA A;  3B93 A;  2QNK A;  3LIG A;  4N90 A;  4H55 A;  3UNP A;  1WBL A;  3RMX A;  1FPN 1;  1U5Y A;  4GAZ A;  4NPR A;  2OQ7 A;  4P00 B;  4Q2F A;  4AF9 A;  2XL7 A;  4D94 A;  5EWS A;  3I49 A;  2D44 A;  2RMU 3;  4JZR A;  1DF0 A;  4CCL A;  3WDU A;  1PX3 A;  4AVV A;  4LBL A;  3I7D A;  4D0Q A;  5DG1 A;  3T2P A;  2WNV B;  1DG6 A;  1W04 A;  1AJO A;  3WDW A;  3WF3 A;  4UI9 L;  3ST7 A;  1QJY 1;  1Q56 A;  4BM8 A;  4XFH A;  1LHU A;  4EN8 B;  2R06 2;  3JCI A;  3PLQ A;  4AED C;  4LOR A;  4CYD A;  3B01 A;  1OLM A;  3KSC A;  4C8D A;  4DPN A;  4BDV B;  1VBC 3;  3OEA A;  4LMF A;  3K77 A;  4Q27 A;  4W65 A;  4AWD A;  5K9Y A;  2HWC 1;  5A32 A;  4LKS A;  1S0D A;  3AP5 A;  1NCQ A;  4XVH A;  2R07 1;  1RUC 3;  5FO9 B;  2ENR A;  5C5U A;  3GXU A;  1XPW A;  2WYF A;  1SFY A;  4AI3 A;  3VGI A;  2VVE A;  2O14 A;  4M01 A;  1M06 G;  2TNF A;  5FAX A;  2LRP A;  1C8M 2;  2X8K A;  4L2N A;  4BQ3 A;  2VPV A;  1IG3 A;  4KQ7 A;  1S0G A;  3VBF C;  1XYN A;  4Y22 B;  2DVG A;  5FWJ A;  1G9F A;  1W6N B;  3H8O A;  4OMC A;  1PVC 1;  4FFI A;  3WIN E;  3KV5 A;  3CZJ A;  1UL9 A;  4D3W A;  2F17 A;  2G9F A;  3H1Y A;  1W6M A;  4HMZ A;  3ZOI A;  1QJX 1;  1WLW A;  1NZI A;  1NCQ B;  2DCT A;  1W2O A;  4C1W A;  1KGY A;  1LB2 A;  2DYC A;  4IV3 A;  3IIA A;  1Z7S 1;  3MBW A;  4Q0V A;  4XMA A;  1ASJ 1;  1DU3 D;  4PT6 A;  5FMC A;  3SMH A;  4Q0Q A;  1BK0 A;  5EIY B;  2E9Q A;  5IHR A;  5F3C A;  2DBN A;  2W1Q A;  3K4D A;  4EN9 B;  3OUH A;  4JHT A;  5FZ6 A;  4UFL A;  5GLV A;  3QAC A;  4OVE A;  1GAN A;  2AEN A;  3PNA A;  3BOP A;  3PTR B;  2OZJ A;  1CGP A;  1PZ9 A;  3NNJ A;  4FQZ A;  4IUG A;  2VUA A;  5FZ0 A;  3ZYP A;  1IKQ A;  1O4Y A;  4BB3 A;  1BVV A;  3VN4 A;  2OZ6 A;  4WZC A;  2EIG A;  5BNQ A;  5LRR A;  3SCH A;  4S2D A;  1WMX A;  4LA3 A;  4NVP A;  3DPR C;  1H0B A;  3J7M A;  3T4V A;  4BLI A;  1KDM A;  4M0N A;  5A3O A;  3WW1 A;  5KHK A;  3OY8 B;  1WZX A;  4XPV A;  2Z42 A;  2JDM A;  3DGT A;  2D3S A;  2C9K A;  5F5Q A;  2BW8 A;  1CPN A;  3VBO C;  3KT7 A;  4QPW A;  2W1S A;  4E4D X;  1MEC 3;  4CDU B;  5EJ1 B;  3KCY A;  1IQD C;  3IWZ A;  4DY5 A;  4XW3 A;  1IGO A;  1CVN A;  1YO8 A;  3KLS A;  5KXE A;  2ZML A;  3L2H A;  1JS9 A;  3UGG A;  3LOI A;  5ABJ C;  4TLG A;  4CCK A;  3VBU B;  1CQ9 A;  2I2S A;  4J1X A;  4K8F A;  1DP0 A;  2D3R A;  3GZE A;  1GZW A;  5GAL A;  3WDX A;  1TMF 1;  4IND A;  5FY7 A;  5ANQ A;  4WVM A;  2GSY A;  2XUM A;  3CU7 A;  4PIX A;  5FZO A;  4JGY C;  5KC5 A;  4ISQ A;  3VKO A;  3U10 A;  2X05 A;  1JBC A;  2CWM A;  4D6Q A;  5FV3 A;  3D5O A;  1HIX A;  2AUY A;  1XSR A;  2BYV E;  4PI2 A;  2WSU A;  3VBH A;  1VBD 2;  1UX6 A;  1EPW A;  2D98 A;  3GBG A;  4M4P A;  4QPG C;  4UT5 A;  2V4A A;  2A3Y A;  3C7H A;  4L9B A;  1ZRR A;  3D6E A;  4CE8 A;  3R4S A;  1MZE A;  4YZ5 A;  5FYZ A;  4AFB A;  4CP9 A;  1UY2 A;  1XSQ A;  2RM2 2;  4IV3 B;  2DF7 A;  3GF6 A;  2BTV C;  2W52 A;  4QQ2 A;  3H8U A;  4RQP C;  5CFD B;  2VNR A;  4PLN A;  3WEZ A;  3NKT A;  3MFC A;  2Q30 A;  3B5L B;  4OHW A;  2WYS A;  2IXI A;  3VL8 A;  2JDA A;  3HT1 A;  3OB8 A;  1JN2 P;  1YXW A;  5FZM A;  4HXC A;  1QF3 A;  2IUW A;  4GWJ A;  3BPZ A;  3KGZ A;  1PZ8 A;  4KU8 A;  2DUO A;  2PHT A;  3ETQ A;  3N7L A;  5A80 A;  5T5L A;  1DDL A;  3UJQ A;  3J8F 1;  1PX4 A;  5E16 A;  1BLZ A;  4NWW A;  4P9W A;  3ZXE A;  4QB2 A;  4NMI A;  1LUL A;  2ZBJ A;  5J1X A;  5CU1 A;  3AL5 A;  2Q1M A;  2X29 A;  3AYE A;  1MS9 A;  5EQU A;  1YQ6 A;  3PMS A;  5FZ1 A;  4GD4 A;  3FL7 A;  1LU1 A;  1T6G C;  2PFW A;  3HMY A;  3ZM8 A;  5BNO C;  5HCH A;  1MEC 1;  1D4V B;  3POG A;  2DDU A;  4A7Z A;  2BDR A;  2DVD A;  4UWD A;  2W92 A;  3AP6 A;  2PAE A;  2ZX2 A;  1NXD 1;  5GLU A;  2GP5 A;  4ATF A;  3LCP A;  3FJS A;  5BNO B;  5DAX A;  3FMG A;  2R07 2;  1W2T A;  4IET A;  4LK7 A;  4UOJ A;  1ENS A;  4MLO A;  4AZZ A;  1HN0 A;  4XF0 A;  1JZ7 A;  4QPI B;  4HL0 A;  4Y24 A;  1SQ4 A;  4PQ9 A;  4XFG A;  2ZEY A;  2BNO A;  3OCP A;  4QAW A;  4RGA A;  3VHP A;  4BXF A;  2FQP A;  1CIY A;  1V00 A;  3R0R A;  2JG8 C;  5F5I A;  1PIV 2;  5LA0 A;  5CG9 A;  1L7Q A;  2FCV A;  2WO3 A;  4IEW A;  1J3R A;  2W47 A;  3WNO A;  1CD3 G;  2FCT A;  2WFF 3;  1F8V A;  4GWI A;  4AOC A;  5FQ0 A;  1XNT A;  2ZGT A;  4WVM B;  1ZRC A;  4E9K A;  3N35 A;  4RGK A;  4U36 A;  4P02 B;  2ORZ A;  2WZP P;  3LWC A;  3VD4 A;  2CYF A;  2OUH A;  4Q4X 2;  3OYW B;  2GAU A;  2JWP A;  4F7Z A;  1LKN A;  1C5I A;  4JDN A;  1SMV A;  2WQ4 A;  1YFW A;  1QOS A;  1H4G A;  3K4Z A;  3O7O A;  4AQ2 A;  4FPY A;  4ZZ8 A;  5FY8 A;  5JZG B;  3PUR A;  4AQT A;  2H6B A;  1VAV A;  3O0X A;  5CAZ A;  4PDW A;  5K0U A;  1UU5 A;  5IWF A;  4AVS A;  5K0U C;  4ZU4 A;  2PHF A;  1W9W A;  2GH2 A;  3ES1 A;  5IAX A;  3KT1 A;  5IVY A;  4Z07 A;  2ZKL A;  2HWE 3;  3UET A;  3O0W A;  3WNL A;  2UWC A;  1TEI A;  5D8A C;  1SEF A;  2RJ2 A;  2OYZ A;  5JXJ A;  2XVK A;  5A7Q A;  1NZC A;  2OUJ A;  3VD7 A;  4HK8 A;  4YGE A;  4K6B A;  4ONU A;  3RZL A;  1POQ A;  1F15 A;  2VBD A;  2BQP A;  2QQN A;  4ATE A;  3DCQ A;  4NJ4 A;  4CEW B;  4LO8 A;  2JKX A;  4IV1 C;  3K2O A;  2NZ9 A;  1O5L A;  1OUS A;  3VBU C;  3KV6 A;  4AK3 A;  2YUE A;  3AL6 A;  5C7G A;  4OQ9 A;  1G6N A;  4OI1 A;  1E57 A;  2VXJ A;  5GZC A;  4XUN A;  5D1I A;  4GB3 3;  2PLV 1;  3D0S A;  3DV8 A;  5FRE A;  4N53 A;  5HCF A;  4V2W A;  5JOY A;  1V6L A;  1ZRF A;  4AVC A;  1OOP A;  3BIE A;  3ZMN A;  1RHI 3;  3OD4 A;  1TMF 2;  5J36 A;  4CPB D;  1AR6 3;  1ULD A;  4CCD A;  2QQO A;  3O1O A;  4N8M A;  5DZG A;  3WHT A;  4Y22 A;  1PMJ X;  2QDN A;  4AVB A;  4BIF A;  3NJZ A;  4H7L A;  1R08 1;  3HQU A;  1K5J A;  2YGM A;  1FAT A;  1HQL A;  1WUV A;  2HEY F;  4WVW A;  5I0D A;  1BVP 1;  2C26 A;  3KWV A;  3MHZ A;  1W8W A;  5ACA 3;  4OUL A;  3E97 A;  4RD7 A;  4A41 A;  3ACG A;  3ACI A;  1O6U A;  3FUO A;  4JKL A;  1X36 A;  4P9G A;  5DAW A;  1H6Y A;  4YGC A;  2ZZJ A;  1HX6 A;  4FAH A;  1CX1 A;  2YV8 A;  3H42 B;  3WP3 A;  4LBK A;  1PVX A;  3JBG 3;  5GLW A;  3VDC A;  5C8C C;  3AZV A;  1OOP B;  1WMF A;  1XNA A;  5JMC A;  3V0A B;  2EAK A;  4NRM A;  5FZC A;  1O59 A;  2WQZ C;  3ZXJ A;  5JWP A;  2VOK A;  3SH4 A;  1Y9M A;  1YFX A;  2K9Z A;  4QQH A;  4JGY A;  4DXR A;  1W6Q B;  1FV2 A;  1QEX A;  4UW6 A;  4DMI A;  1BEV 3;  2TBV A;  3H3U A;  2V73 A;  3OPT A;  1URX A;  1QJE A;  3LA7 A;  2WNU A;  2WNO A;  1O4Z A;  1OQD A;  4SLI A;  3HBK A;  1VRH 3;  3EMR A;  4L11 A;  3WZ1 A;  5JI9 A;  4OLL A;  2ZZQ A;  3JB4 C;  2D6L X;  3HNM A;  3ZFE C;  5E89 A;  2JE7 A;  4O61 A;  4YG3 A;  1REF A;  3RZK A;  2GN3 A;  1V9U 2;  1LTE A;  3MO4 A;  4AR2 A;  3K75 B;  1VBD 1;  3I3M A;  1QDC A;  4WM7 A;  1GKB A;  1XC6 A;  5F2W A;  2HWD 1;  3O5S A;  5LEK A;  2A6V A;  3VZL A;  1IOA A;  1H2M A;  3CNA A;  4LHS A;  3MLK A;  4FPE A;  4CU8 A;  2FZ2 A;  2JX9 A;  2DCY A;  1AYN 1;  4QKB A;  1G9D A;  5FK7 A;  5L19 A;  3OYW A;  4W4Z A;  1EAH 2;  1IPK A;  1HB1 A;  4QXB A;  1L3J A;  2Y8K A;  3NNG A;  3MIF A;  1GZT A;  2A1X A;  2VMH A;  3MUZ 1;  1COV 2;  3LFI A;  2YB7 A;  3ATG A;  4IEO A;  2XVL A;  1IS3 A;  2QQI A;  1N3P A;  1ZBA 2;  2VW2 A;  5FPU A;  2YC2 A;  5A7P A;  1QJU 3;  5FY4 A;  4C0B A;  4BZ4 A;  4CU7 A;  3CHX A;  3R05 A;  1DQ1 A;  2WAA A;  1SBD A;  1H8T C;  2ADD A;  1ZA7 A;  2GDF A;  4KH9 A;  3VUO A;  1F2N A;  1SCS A;  1W8O A;  1BJQ A;  3BTX A;  3LGR A;  1MQT C;  3LEG A;  1RXF A;  4FPH A;  5JSR A;  2ZXQ A;  3RGB A;  4AQ6 A;  4NOT A;  4CP1 A;  3MIB A;  2VUJ A;  1W8U A;  3J7H A;  4XQW A;  4CU9 A;  2RR1 3;  5DPN A;  1A78 A;  5ANN A;  2ZX0 A;  3MW4 A;  4DO0 A;  2E32 A;  4XZP A;  2VMG A;  4RFR B;  5LEJ A;  5FMB A;  1VBB 3;  5GKA C;  2D40 A;  4F83 A;  5FOB B;  1T6B X;  4A7K A;  4K40 A;  4Z2W A;  1Q8S A;  3AYC A;  3UV9 A;  1LOA A;  3IBM A;  4R9C A;  3VZM A;  3WQ0 A;  1RUI 2;  2ARB A;  1BQP A;  1K3I A;  2YRO A;  3POS A;  4HSJ A;  2I07 B;  2VOX A;  1ZZB A;  5ACA 2;  4RR3 C;  3OOX A;  1R1A 3;  2H0B A;  4MET A;  3RYP A;  4ASM B;  1VB4 A;  1JZ2 A;  1H2K A;  4QKD A;  1OD5 A;  1UZV A;  2NMN A;  1WD4 A;  3MV1 1;  4CDX C;  3KZ4 C;  4XET A;  2QFE A;  2VZU A;  4HBN A;  3FHQ A;  4NHK A;  1NYW A;  3AJZ A;  2ZAC A;  3ZYI B;  1XNB A;  5FY0 A;  2RHP A;  1JU3 A;  3ES4 A;  3BVC A;  4PLO A;  4NII A;  1ND3 A;  1Y43 B;  2QE3 A;  2XLA A;  3BN6 A;  5ERL A;  4OI2 A;  1H1M A;  2XLG A;  2JB8 A;  5F3I A;  3E5X A;  3AFG A;  3WP4 A;  3WW3 A;  2BJS A;  1WCS A;  2JD9 A;  4EJR A;  1JOP A;  3GGL A;  1I5P A;  4DFS A;  5I0R A;  4UFJ A;  3SCF A;  5JR2 A;  2K2S A;  1UPI A;  2Z79 A;  2MPF A;  3MW2 A;  1OLR A;  1ND2 A;  1RB8 G;  4E8D A;  3GCX A;  5GJ6 A;  1VBD 3;  1IHM A;  5FZ4 A;  1HXS 3;  5I0T A;  3ZSM A;  1UCX A;  4CRQ A;  4A45 A;  4CCC A;  4UYB A;  3RYR A;  2O8O A;  3THT A;  1UX7 A;  4QX5 A;  2I74 A;  3B9I A;  3T30 A;  3HIF A;  2Y33 A;  2R04 1;  4HVO A;  3MI8 A;  3TNP B;  4C0H A;  4MV2 A;  5B2G B;  3KVA A;  1LEC A;  2GC1 A;  4P5Y A;  3AMM A;  2VG9 A;  2Q8C A;  5I8Y A;  4S2F A;  2RVA A;  3BOW A;  4P08 A;  3TEW A;  1LOD A;  5I91 A;  1I9R A;  1W9S A;  1JMU B;  5C3R A;  2ADE A;  3J8F 3;  1JYW A;  1B35 C;  1NA1 C;  4EE2 A;  2VM9 A;  3SEE A;  2PHL A;  1QJU 1;  1UN1 A;  2VMI A;  2XON A;  3OD0 A;  5G05 L;  5KHH A;  2VNV A;  3ILN A;  2WBK A;  5EFU A;  4CVU A;  3AMQ A;  1ZBA 3;  3PU8 A;  5C4W B;  4PBO A;  4CCN A;  1CJP A;  4Y4R A;  4XYX A;  2D97 A;  1JXN A;  5EZW A;  5JZG C;  4E2Q A;  2BWC A;  3WF1 A;  5F5A A;  5FYU A;  4FPL A;  5FLJ A;  4HOO A;  5T50 A;  3WR0 A;  4BK4 A;  5IFP A;  1RVF 1;  5BNN B;  4XAC A;  2ZGK A;  4FOQ A;  3RWK X;  4CEW A;  4AHX A;  5FLH A;  1RXG A;  4MAD A;  2XH6 A;  2ILM A;  3RJR A;  3UT0 A;  4HKL A;  3LOB A;  3N4M A;  3PUH A;  2A3W A;  3NV3 A;  4AAP A;  2QQL A;  4CEY B;  4M0H A;  1OUX A;  4RGG A;  2QQW A;  1NLR A;  1WWY A;  2RS3 1;  5IVV A;  5JMO A;  2NMO A;  1PM7 A;  4BA6 A;  3WP5 A;  4MXW A;  1GSL A;  4QX0 A;  4CUA A;  1EPZ A;  4IV1 B;  5D21 A;  1W0O A;  4YG0 A;  1V6N A;  2WFF 2;  2BZD A;  1TG7 A;  3AMP A;  3GBW A;  4FSJ A;  4KWU A;  2J22 A;  3DPR A;  1ULC A;  4JRL A;  2CAV A;  4C91 A;  4E2G A;  1VBC 1;  3T0D A;  1UQX A;  1FMD 3;  1POV 0;  2Y6J A;  1RMU 3;  1OA2 A;  3AMN A;  1ND2 B;  1QXP A;  1UMH A;  1LES A;  2AZ5 A;  4KGQ A;  4Y1Z A;  4YVW A;  4CDW A;  4D69 A;  4P9Y A;  2CL2 A;  3CJX A;  4P14 A;  3BKZ A;  3WUD A;  3FHA A;  4NPL A;  3T2Q A;  3W20 A;  5CKM A;  2WWS A;  4QHZ A;  3ZXF A;  1POV 1;  1BBT 1;  4ZHN A;  1XE8 A;  4FPG A;  3RG0 A;  2ZAH A;  5FMO L;  5FXZ A;  3QD6 A;  5KR7 A;  2WC2 A;  3R4U A;  1RYY A;  4FOW A;  3WLU A;  2YMZ A;  1VJ2 A;  3AJY A;  2JEN A;  3DL3 A;  2JDY A;  2J7M A;  4YNI A;  5BNP A;  4RS5 C;  3QLQ A;  1WCU A;  2G4I A;  3RFR A;  2VU9 A;  4UFH A;  1SLI A;  1W2N A;  3HR9 A;  5FXV A;  3VZK A;  2R04 3;  5FYB A;  1ZYB A;  3GHM A;  4BWO A;  3RNS A;  1CON A;  4XUO A;  3H3L A;  2YXS A;  5FJH A;  1XJA A;  2OVU A;  3NW4 A;  4W8J A;  1GMM A;  5FYI A;  4XJU A;  3TYJ A;  4UW5 A;  2WNV A;  1IZ3 A;  3BGA A;  2XXZ A;  1XE0 A;  3INA A;  3IKW A;  4MYE A;  2WNU C;  1C1F A;  4Q8K A;  3O12 A;  4QQL A;  1RJ8 A;  2XQX A;  4Y1X A;  4BQX A;  1VAM A;  2YC0 A;  1KS4 A;  3AKS A;  1UYY A;  2O8Q A;  4NPM A;  4QKN A;  4QX2 A;  3RDI A;  4JGZ B;  4FXG B;  5IK4 A;  1MS5 A;  1DLL A;  4OI4 A;  4XTM A;  1PK6 B;  4EWA A;  1D7P M;  2RM2 1;  1YJK A;  3PVN A;  3UYJ A;  2FMY A;  4AE2 A;  3VDD B;  1KJL A;  3P5B A;  1YQ8 A;  1JUI A;  1Y7B A;  1YJL A;  3KB5 A;  1RMU 1;  4B3N A;  1WGP A;  3AFK A;  1JYC A;  1ONA A;  1V6M A;  3MF6 A;  3HQX A;  4K9S A;  2DWR A;  4XDQ A;  4ZON A;  3SHR A;  2GZW A;  2OT7 A;  1GBG A;  1J3Q A;  1U5Z A;  3CL1 A;  4LUM A;  4YZ4 A;  4OI0 A;  1XXN A;  2R32 A;  5JPM B;  1K5M B;  2C1F A;  4OZX A;  2RJK A;  2Q8E A;  5DDJ 3;  3ZKU A;  1GQG A;  1OOP C;  1S2B A;  2VUC A;  1ODN A;  5FY5 A;  4F8A A;  1YFU A;  2P37 A;  1W2U A;  4AGV A;  2RS1 2;  4E4S A;  5DUV A;  5A33 A;  4UAP A;  2B46 X;  1RIT A;  4OHZ A;  3SCG A;  4CDQ B;  2GH8 A;  4LXL A;  1FOD 2;  1KQR A;  3ILR A;  5A6Z A;  1LEN A;  1V9U 1;  2QTW B;  4LEJ A;  1YI9 A;  3E6D A;  4JRA A;  1UMI A;  3HOB A;  5DMY A;  3FN9 A;  2GNT A;  2NM1 A;  2HWD 2;  3IPV A;  3NWK A;  3UGF A;  4ASK A;  3U07 A;  4CCJ A;  3CLP A;  4XAE A;  5BYN A;  1W05 A;  2GP3 A;  1HRV 3;  4YFW A;  4RSU A;  2GAL A;  2SBA A;  5LY2 A;  1CAW A;  4EN0 A;  2C5D A;  1BBT 3;  2HWF 2;  1SLT A;  4ASL A;  4R8H A;  1KFU L;  2HLE A;  1MZ5 A;  4MOA A;  2WNU B;  4N9I A;  2JD4 A;  2EF6 A;  3FWE A;  2EXI A;  4BU2 A;  4LKF A;  2LUW A;  2XHK A;  3ZR5 A;  2BFU S;  2J1S A;  4PDW C;  2UY8 A;  2RS3 2;  2WA4 A;  1LOE A;  2DTW A;  3IT8 A;  4V2V A;  4XXP A;  5A3P A;  3AYA A;  3F2Z A;  1YQ2 A;  1AYM 1;  4Y26 A;  1DQ4 A;  4A44 A;  3ZN6 B;  4FPC A;  4XDP A;  2HWE 1;  2OQ6 A;  1SBF A;  3FLT A;  1BKZ A;  2VZ3 A;  5JR7 B;  4I09 A;  1AJK A;  2NYY A;  3FUQ A;  4YW5 A;  1QWR A;  1R09 3;  4CZS A;  4RYD A;  4ARY A;  5F9T A;  3MIG A;  2VCC A;  1T2X A;  3ROU A;  5T5O A;  5FFO C;  1UZZ A;  4M4R A;  1YFY A;  5BNN C;  3EJK A;  3HNB M;  1PMI A;  2AEZ A;  4KI5 M;  5F2S A;  3H1M A;  1RUG 1;  4Y1U A;  2VY0 A;  4RL7 A;  2ZHM A;  3DXU A;  4XCA A;  5DQ0 A;  3ZFG C;  1RC6 A;  4BQW A;  3IZO A;  4PI0 A;  2AEY A;  3VDB A;  5BY5 A;  4LT5 A;  3I59 A;  1TZO A;  3WV6 A;  4PJY A;  1GZW B;  2JDN A;  3C3V A;  1I3H A;  1JOJ A;  3EYP A;  1C28 A;  4MGY E;  4LQR A;  3UK9 A;  4XF1 A;  3NJX A;  4KNC A;  5JDB A;  5FXX A;  2JG8 B;  4EN6 B;  1X33 A;  3MZH A;  1R1A 2;  4FPF A;  4GXL A;  4LBQ D;  3VKM A;  3V0B B;  1WD3 A;  2Z5W A;  3EXU A;  3RPQ A;  4Y1V A;  4WM7 C;  1N1V A;  3AKQ A;  2W9X A;  2Q4S A;  2WS9 2;  1VP6 A;  1BMV 1;  1VBE 3;  1KFX L;  2PQQ A;  2W68 A;  3P3P A;  4LIV A;  5LAS A;  1EV1 1;  2BP6 A;  5C8C B;  4AI9 A;  1SLA A;  1QH7 A;  2DFB A;  3CJI C;  5F6K A;  1ASJ 2;  2VQU A;  4FP2 A;  3WOG A;  3AKT A;  4GIQ A;  5JI7 A;  3WNK A;  1ZRD A;  1Y4W A;  3BU7 A;  2B9V A;  3IN9 A;  3J9S A;  5FPL A;  5JOW A;  4DUX A;  4OZO A;  4BJ0 A;  1US3 A;  1FNZ A;  4PQQ A;  5KHG A;  3W21 A;  2B7Y A;  5LAT A;  3TN9 1;  1YHF A;  1VRH 1;  2V72 A;  2YDE A;  3NJV A;  5FZA A;  3W9A A;  4E4Z A;  4HPK B;  4NIG A;  2VZP A;  2JE8 A;  2ZGU A;  2HBT A;  1CAU B;  1F9K A;  1LOF C;  3V56 A;  1AUY A;  4IE6 A;  5C8C A;  3U1X A;  1DHK B;  1N1T A;  3FFZ A;  1IG0 A;  2VCM A;  2VXR A;  5T3N A;  1HN1 A;  3T0B A;  1F5J A;  1NOV A;  2VZT A;  2IWG B;  3AP9 A;  3AVR A;  5DUU A;  5T5P A;  3VBH C;  4CU6 A;  1AR6 1;  1MS1 A;  2D6K A;  2WN2 A;  3AM2 A;  2Y0O A;  4H14 A;  1MVE A;  1HRV 2;  1SHW B;  3WDT A;  4XFC A;  3TEX A;  5FKC A;  1NE6 A;  4HZF A;  3SXW A;  1G7Y A;  1OPM A;  1W0N A;  3H7Y A;  3J8F 2;  3NJY A;  4Q4W 2;  2K46 A;  2JDP A;  1W9Y A;  2ZX3 A;  2OA2 A;  1MS3 A;  1VBA 3;  2F4P A;  2X09 A;  4LE3 A;  4AEK A;  3OPW A;  5ABJ A;  3L2Y A;  4R52 A;  2QQP A;  1UYX A;  1HB2 A;  4FP3 A;  4FOV A;  1LCL A;  2BNN A;  1WCD J;  2Y34 A;  2ZTN A;  3KS7 A;  4IE0 A;  2B5H A;  4QX7 A;  4AFM A;  4FBF A;  1AR7 1;  2MNG A;  2GC0 A;  3ZXA C;  1AYN 2;  2VOV A;  5GZE A;  2CDP A;  2JIC A;  4BIS A;  1YRZ A;  2PHX A;  5FUP A;  3ZXK A;  4A2U A;  4AHW A;  1J3P A;  1QH6 A;  1ZBE 2;  4LHL A;  1RUG 3;  2J1R A;  5F3E A;  4Y20 B;  3HNY M;  1OFS A;  3ON7 A;  2ZJC A;  1AR9 2;  5SV8 A;  1H30 A;  2C6S A;  2RDQ A;  2VMF A;  2WLQ A;  1ULE A;  2LTN A;  5CB7 A;  5KHJ A;  1UOF A;  1W8T A;  3VKN A;  1IKP A;  4AFD A;  4KL1 A;  4NIA A;  4K7J A;  5A3T A;  4KMQ A;  1CAX A;  1OMI A;  3PIG A;  1WW5 A;  1N47 A;  1YI7 A;  2RMU 1;  3OUI A;  2HWE 2;  5LA2 A;  1PGW 1;  5F7U A;  3PVB B;  4AHZ A;  1RUE 3;  1NY7 2;  2KXL A;  3BYW A;  3MIC A;  4LIT A;  4QXC A;  1AXZ A;  1HQW A;  4TLF A;  3WW4 A;  5I0S A;  3NV1 A;  4LR4 A;  4LNV A;  1QNW A;  5LBC A;  1GR3 A;  1NX9 A;  4TWT A;  3A22 A;  5A6Q A;  3S57 A;  3ITQ A;  4Z92 B;  1Q5O A;  2WT1 A;  1ENX A;  4CTE A;  4LBQ B;  4Q4Y 3;  5CFC A;  1W6P A;  1JOD A;  1VBE 1;  3KM5 A;  3N7J A;  1O8S A;  1W39 A;  3A23 A;  1DGW A;  4L0P A;  4W6W A;  4DQA A;  2Z4F A;  5JVV A;  2VW0 A;  4XTP A;  4XUT A;  3U4X A;  4A4A A;  2UU8 A;  2ZX1 A;  2DUQ A;  2HYX A;  2WUH A;  4RHV 1;  1QU0 A;  4W6X A;  3FX3 A;  4XQD A;  2ZEX A;  1IPS A;  3JD7 2;  2XML A;  3VBR B;  5L9V A;  5A3M A;  3ACF A;  1OUR A;  1RHI 2;  3LDK A;  3ZVX A;  4C90 A;  5HV4 A;  5IVE A;  1N3Q A;  4IEZ A;  4XFA A;  1BK1 A;  2ZOE B;  3TAY A;  2VO5 A;  2W3J A;  3WNX A;  2E31 A;  5IVB A;  1EP0 A;  3IDB B;  2N7G A;  2QQV A;  4V1P A;  4LHN A;  4FQ4 A;  4LIU A;  2LAL A;  4KGG A;  2ZGN A;  3OJB A;  4G3Y C;  1MQT B;  4BOW A;  4CUB A;  4DRR A;  1W3X A;  1OD3 A;  1XNK A;  2AC1 A;  2IXL A;  2PA7 A;  5FZD A;  3USU A;  2JDK A;  1Q8O A;  2E51 A;  3O0V A;  4NUB A;  1H8T B;  1C57 A;  1HXS 1;  1QHD A;  1Z78 A;  2RR1 1;  3AVS A;  4XUP A;  1UIK A;  5FZI A;  3RSJ A;  2DUP A;  4AVT A;  2E7Q A;  3H9A A;  4QHO A;  1CZV A;  4WZF A;  2CAU A;  2DCJ A;  3P6B A;  1QJX 3;  1OA3 A;  4XF3 A;  1LNS A;  3RZJ A;  4MGK E;  1PGL 2;  1B09 A;  2DVB A;  3C7O A;  2FDG A;  4L97 A;  4UBG A;  1A8D A;  3VDD A;  4OCT A;  1UF2 C;  4R9D A;  2QQU A;  1UKR A;  4WM8 C;  2ZGS A;  1TQ5 A;  3HN3 A;  3IB3 A;  2XHN A;  1UOJ A;  2PXJ A;  3ACL A;  3FFQ A;  3PUI A;  5L9B A;  3ZXD A;  2XOM A;  3LE0 A;  3VDA A;  2C0Z A;  2JDH A;  1PK6 C;  2ZGQ A;  4YW1 A;  2H6C A;  3VBS A;  5J48 A;  2B4K A;  1VRH 2;  2DCK A;  5KXD A;  5EJZ B;  4JTO A;  3AP7 A;  1H9W A;  4XOG A;  5FUI A;  2WNV C;  3OGV A;  2DU0 A;  4O9G A;  3FHI B;  4AXO A;  2NP0 A;  5FMO S;  1Y3T A;  5FRA A;  4OHY A;  1GUI A;  1W6N A;  2IXC A;  3POJ A;  1HLC A;  3DEC A;  2G9G A;  3ZN6 A;  4D7Y A;  1SPP A;  5K8S A;  3POY A;  2OXB A;  2BOJ A;  4QPG A;  1HB3 A;  1O91 A;  4JVA A;  2WS9 1;  3ZPY A;  1UNB A;  4RR3 A;  3VKL A;  3HQR A;  2J42 A;  3OG2 A;  4XJ8 A;  3MUY 1;  2E7A A;  1RGS A;  4RS5 B;  2O1Q A;  3A7Q A;  5CFC B;  3V65 A;  1Y9Q A;  2WT0 A;  4KU7 A;  2XDV A;  3WD5 A;  3HD8 B;  3K3N A;  4YG6 A;  2VC9 A;  1VAL A;  1CR7 A;  2W0X A;  2WAO A;  3WF2 A;  4ES9 A;  4DXS A;  2VZQ A;  3DN7 A;  4CDQ C;  1ZX5 A;  4CP0 A;  4EN7 B;  2EAL A;  4QB1 A;  2WZR 3;  2EXJ A;  4YW7 A;  2FDI A;  1GNH A;  4YFZ A;  2A75 A;  4LLF A;  1ZBE 1;  2ID4 A;  5IW0 A;  4OQ8 A;  3B7M A;  3TWI A;  1GP6 A;  4ZS2 A;  2CWS A;  4GB3 2;  2AGS A;  5HCB A;  4HFS A;  1ND3 B;  2PQS A;  1VPH A;  2EIE A;  1KS5 A;  1OF4 A;  4IL7 A;  4A42 A;  1GV9 A;  3MPB A;  1FPN 2;  1MPX A;  1X50 A;  1C8M 1;  4UFK A;  3AC0 A;  3WNM A;  4DS0 A;  2WKK A;  3TB0 A;  2P4E A;  2YGL A;  2RMU 2;  1L7L A;  2YZ4 A;  1MS4 A;  4ZU5 A;  4Q1R A;  4IE4 A;  3CBN A;  3JQW A;  1EUT A;  1NG0 A;  2Y60 A;  2W2I A;  4IGQ A;  2OX0 A;  1AVB A;  3POF A;  1LHV A;  5FZ3 A;  4A6O A;  4BYY A;  4GZ9 A;  4Q0P A;  1YYN A;  4ZXK A;  5A6Y A;  2GC3 A;  3BTY A;  1Z7S 2;  3VBU A;  2BFU L;  2P5B A;  4XHX A;  5EXO A;  3SH3 A;  5CIS A;  1K5M A;  4HT1 T;  2R06 1;  3IM0 A;  3D4K A;  4TXW A;  4XFF A;  4UFI A;  4Q4X 3;  5D8A B;  4EZH A;  2RDR A;  3S7I A;  2HH9 A;  2Q5T A;  3LDR A;  3AYD A;  3KQR A;  3IAP A;  4COV A;  4WM8 B;  3BCW A;  3N9P A;  1KIT A;  2LW8 A;  2UYA A;  3WXP A;  2JG9 A;  1RUC 2;  5F37 A;  4Y5Z 0;  1D4M 1;  1H9P A;  5K7P A;  3URF A;  1COV 1;  1G9B A;  2C4X A;  5E8A A;  2W1W A;  1QXJ A;  2A71 A;  3LA3 A;  4KBZ A;  3U14 A;  4TTG A;  1OBN A;  5KC6 A;  3S6P A;  1OC1 A;  3RZM A;  3DXT A;  4UW4 A;  1QQP 3;  4AED A;  3SQO A;  1LGN A;  2FCU A;  3SIT A;  4N53 C;  4B29 A;  5FOJ B;  3QH6 A;  1FMD 2;  3LEI A;  4N7U A;  4XFI A;  2YBK A;  1H2L A;  1J1L A;  4DY3 A;  1AXY A;  2VZO A;  5K4L A;  1HRI 2;  1VB2 A;  3A21 A;  1VBE 2;  2WT2 A;  5CNA A;  4D6R A;  1BMV 2;  4HLT A;  1JZ3 A;  4IGP A;  2B42 B;  1GQP A;  3D82 A;  2FDH A;  3K3O A;  3O14 A;  1ND2 C;  5A3U A;  1XNC A;  2YHJ A;  2ERF A;  5H9Q A;  2RS5 3;  3GAL A;  5KXB A;  2GMM A;  1GWL A;  5JAX A;  1WW6 A;  2UWB A;  3SKV A;  4O9E A;  5F1R A;  1JYT A;  3RZG A;  1WKY A;  4M3C B;  4R9A A;  3H1W A;  4JGY B;  5GZG A;  5DDJ 1;  1B35 A;  1NA1 A;  4I0A A;  5AFB A;  3H0O A;  2BU9 A;  3RWN A;  3BU0 A;  2HBU A;  1FAY A;  2ZCW A;  1IS4 A;  1GNY A;  4MUV A;  5DN2 A;  4YZ3 A;  3EHK A;  2WWJ A;  5BNO A;  2D6O X;  2R04 2;  3ENR A;  4LKD A;  3X29 B;  3I2F A;  4XIO A;  3VLB B;  4IER A;  2JKB A;  3LA2 A;  4LHK A;  4A6S A;  4MVT A;  3GBF A;  5AVP A;  4K3U A;  2RR1 2;  4BQY A;  3W5M A;  2XQR A;  5LA1 A;  5KXC A;  1W90 A;  1W9T A;  2B45 X;  1YIP A;  4XJW A;  2VD7 A;  3B02 A;  2Y6G A;  4NAO A;  2TEP A;  4H7M A;  2BER A;  1HRV 1;  3B9C A;  3V64 A;  1A3K A;  3ZFF B;  4Q0U A;  1OT5 A;  4EYU A;  4QDR A;  1V6K A;  4MX3 A;  3KV4 A;  1BEV 2;  3KMH A;  2LRO A;  4NR1 A;  4YM3 A;  5FP4 A;  4JHZ A;  4LTA A;  4N43 A;  4P9I A;  5EYY A;  5B4X A;  3F95 A;  1VBA 2;  1LGB A;  5A6X A;  2JJ6 A;  5DAB A;  1CJD A;  4Y5T A;  5JOX A;  1AR7 3;  3AKP A;  4KWL A;  1O8P A;  2SLI A;  3JXS A;  2XJR A;  1QJY 2;  4BLJ A;  1AYM 3;  2KA3 A;  2WFP A;  3KF3 A;  4FTE A;  4X8P A;  1S4C A;  2WDB A;  3APB A;  3B00 A;  1DGW X;  2VQA A;  1HKD A;  3LFM A;  4CEY A;  5A7S A;  4CDX A;  3JBG 1;  3ZPO A;  2AH2 A;  3JZV A;  4I30 A;  5FBJ A;  2IC1 A;  3M7A A;  3OBR A;  4OHV A;  4QDQ A;  2VOT A;  2QVS B;  4OYU A;  5C71 A;  3H3Z A;  2ZA9 A;  1GNZ A;  1OPO A;  5JXI A;  2V5D A;  1SDW A;  3AXD A;  1H8T A;  3R6S A;  2VNO A;  3JUU A;  4D6S A;  3FC0 A;  4AYU A;  1COV 3;  4DRV A;  2P3J A;  2JG8 A;  4JKK A;  4YSF A;  1JHJ A;  3VL9 A;  4YM2 A;  3ZR6 A;  2D5H A;  2BOI A;  4FFG A;  3TOJ A;  5A1L A;  2CGP A;  1QJU 2;  2Y26 A;  1V6I A;  4CDU C;  1S0E A;  5KWR A;  1RUN A;  4DXT A;  1NQD A;  1CAV A;  1DGR N;  1HJG A;  2WZE A;  2XB6 C;  1WW4 A;  1XU1 A;  1W0P A;  4EWD A;  4Q26 A;  1XE7 A;  2VR4 A;  1DZQ A;  4HPK A;  1E5H A;  1QGL A;  1S2E A;  3I2O A;  3T3Y A;  1RUO A;  3USS A;  2HWD 3;  3VBO A;  4MGT A;  4GA9 A;  1RUF 1;  2ZPX A;  3ZYB A;  1UW8 A;  3ELN A;  5A7O A;  1RED A;  1HV1 A;  5JCT A;  3MIE A;  1JTZ X;  4XDO A;  3ZSK A;  5IYY A;  4KBB A;  1VMJ A;  4MGQ A;  2XBO 2;  4XHB A;  3ZSJ A;  4ARX A;  1O3S A;  3OY8 A;  2VZR A;  4AI0 A;  4N43 B;  2Z69 A;  3L9J T;  2QKD A;  3LKJ A;  4I3G A;  4R9B A;  4K21 A;  5FPX A;  1DCS A;  1LOF A;  2XJV A;  3MLL A;  4W6Y A;  1LRH A;  3AB0 A;  5FZB A;  1OFN A;  1UY0 A;  2W1U A;  4YW3 A;  3T1M A;  1OQ1 A;  3TEY A;  3ABZ A;  1S0F A;  4XCB A;  4DIQ A;  5JXH A;  1K45 A;  1PIV 3;  2F6B A;  4MHU A;  4NWV A;  4RR3 B;  3ACH A;  5FPB A;  3ZSE A;  1U5I A;  1PK6 A;  1UWW A;  3THC A;  1DQ5 A;  3TN9 3;  5IVF A;  1GLH A;  1RUH 1;  3M3E A;  2PLV 2;  4BMB A;  4JKM A;  4BIO A;  4DZG A;  1PO2 2;  4QPY A;  2ARC A;  2IFR A;  1W8Z A;  2GND A;  2J1T A;  2ZGO A;  4XUR A;  5DAV A;  2RV9 A;  4XEZ A;  2VAU A;  1VBC 2;  2JXA A;  2D43 A;  1JW6 A;  1MS8 A;  3AZW A;  3I2J A;  3THP A;  2IVJ A;  1YNA A;  2ZGL A;  1LED A;  3OGG A;  4HVQ A;  1PGL 1;  3PUA A;  2QZ2 A;  3S5A A;  1AL2 1;  1YEW A;  5BV6 A;  4LJH A;  1I6X A;  3OF1 A;  5L7O A;  1UOB A;  5DUW A;  1OXC A;  3WT3 A;  2JEC A;  2DTY A;  1SPP B;  5FK8 A;  1N3O A;  4YVS B;  4C1X A;  5LZ6 A;  3PUQ A;  2WNE A;  1OQE A;  2CSG A;  3NAP A;  4YLZ A;  4B1M A;  1JHN A;  5G04 L;  1JUH A;  2G19 A;  3VBS C;  1QNY A;  2VUL A;  3EB7 A;  1CAW B;  1ZRE A;  3ZKY A;  1SLC A;  2RS1 3;  2YBP A;  1TME 1;  2J1V A;  1J1T A;  1E5S A;  2RM2 3;  4A3Z A;  1CN1 A;  3IDA A;  3UKN A;  1DIW A;  2Y6K A;  5JIU A;  3UL2 A;  4L8Q A;  1RIR A;  3LEM A;  4WM8 A;  2YFZ A;  4FO9 A;  5HXM A;  2P3Y A;  1E5I A;  4JCK A;  1RMU 2;  3AP4 A;  3WY6 A;  4PDW B;  1JH5 A;  3AZY A;  1FYU A;  3M1H A;  1AX1 A;  3MDP A;  5LCW L;  5JSP A;  5A33 B;  4KWK A;  4OUM A;  4PHZ A;  1AX2 A;  4QX8 A;  2D6P A;  3A0K A;  4BQ1 A;  3ZIW A;  1NCR B;  5A3L A;  3VZJ A;  2Z2S B;  1HRI 1;  2R0H A;  5I0U A;  3RS6 A;  5JLV A;  3OGJ A;  1DLC A;  4NN0 A;  3NNM A;  5FP9 A;  1C1L A;  3G7D A;  1R08 2;  3SEP A;  3W58 A;  1KRI A;  4OUE A;  4HON A;  4MH0 E;  4QGM A;  4IQP A;  4FAG A;  1WCK A;  2ZMK A;  1DQ0 A;  2TUN A;  1FOD 1;  5FYS A;  4AL9 A;  4URA A;  2FDF A;  1GZ9 A;  1XOY A;  2OPW A;  3OBA A;  4QXK A;  4IES A;  3H50 A;  5K0U B;  5FJK A;  2W5F A;  1V0A A;  3MID A;  5IVC A;  3BB6 A;  2A6W A;  4FVV A;  1MEC 2;  1RUH 3;  1UY4 A;  4UXA A;  3POB A;  5APA A;  4DUV A;  1US2 A;  4AGG A;  4GB3 1;  4FI9 A;  3EQE A;  4PF5 A;  4LBM A;  3WHU A;  1GU3 A;  3T1L A;  2XKO A;  3T4H B;  3WNP A;  3R4D B;  5T5J A;  1V70 A;  5FZ7 A;  3FZ3 A;  4Q0S A;  3GM8 A;  2P6H A;  1OH3 A;  2DCZ A;  4XIK A;  1UZW A;  1ULF A;  1W6O A;  1JZ5 A;  4E27 A;  1YWK A;  1AL2 3;  5CZK A;  1BZW A;  1R1Z A;  4XAB A;  2KM2 A;  3K4A A;  3J7L A;  1PIV 1;  3MV0 1;  5E88 A;  2DBI A;  2NN8 A;  2VE1 A;  4N7I A;  3VB9 A;  4AEJ A;  2VZS A;  3SLI A;  2NLR A;  1MZ6 A;  2Y64 A;  1LEM A;  2XUE A;  3T08 A;  3FBM A;  1S0J A;  2XWJ B;  4YM1 A;  5T54 A;  4I01 A;  3DF0 A;  5I8T A;  1A34 A;  5IAT A;  2HEV F;  1WA6 X;  1DYK A;  3GJA A;  1Q8P A;  2R06 3;  4ITC A;  1WBF A;  2D7F A;  2YU1 A;  4Q4X 1;  4XUQ A;  3PVO A;  5C3O A;  5FLI A;  1LJ7 A;  1R09 1;  1FX5 A;  4GJZ A;  4JGZ C;  4Z8B A;  1W6Q A;  2VL4 A;  3RZZ A;  3ZYG A;  1OLM E;  1WW7 A;  1RUG 2;  1TVG A;  2W39 A;  3O1S A;  2W46 A;  3WP6 A;  5FDB A;  2IVI B;  3SKJ E;  3NNF A;  2Q1Z B;  2OPK A;  2XBO 1;  3NVC A;  3T2O A;  5FYY A;  1EAH 3;  1BYH A;  5KHI A;  3N7K A;  3ZYF A;  5J09 A;  1D4M 3;  2YFU A;  2CHH A;  2E53 A;  2G1M A;  1W3V A;  1W8N A;  5LWB A;  1J59 A;  5CFD A;  4LBJ A;  3MLJ A;  5C3P A;  4D7T A;  5HBA A;  3ZXL A;  2XPJ A;  3C7E A;  4MGS A;  1JYX A;  1PNF A;  2ZEW A;  4KG0 A;  4FPJ A;  1JI6 A;  1VIW B;  4I3P A;  3NL1 A;  1CES A;  3LAG A;  1UYP A;  4RS5 A;  1ULO A;  1SLL A;  2A7A A;  2XJT A;  4J25 A;  4Y3O A;  5H9R A;  2VBP A;  3IPV B;  3NAP B;  4E2S A;  1HXS 2;  2XKP A;  1FOD 3;  2C24 A;  4Q4Y 1;  4Q4V 1;  4U2A A;  3ZXG A;  1AHS A;  1GQH A;  2GNM A;  3WDY A;  3TRS B;  2R49 A;  4UW3 A; 
#chains in the Genus database with same CATH homology
 4ZXE A;  3HNM A;  4DEV A;  1NX9 A;  3LPF A;  3A22 A;  2YG0 A;  4QDS A;  5HPO A;  2E33 A;  3MO4 A;  4DUW A;  3K75 B;  1O8S A;  3A23 A;  4Z2A A;  1XC6 A;  2VTF A;  4L0P A;  2Z4F A;  4XUT A;  4CU8 A;  4LHS A;  4A4A A;  2HYX A;  1EUU A;  2WUH A;  2ZEX A;  3ACF A;  2J1U A;  4W4Z A;  2VCB A;  2Y8K A;  2Y6L A;  1UXZ A;  3NNG A;  3MUZ 1;  2VO5 A;  3WQB A;  2W3J A;  3I2H A;  2E31 A;  2YB7 A;  2QQI A;  4CUB A;  1OD3 A;  2YC2 A;  4XZU G;  2LS6 A;  4CU7 A;  3CIH A;  4HG6 B;  2WAA A;  4XUP A;  1CZV A;  1W8O A;  2DCJ A;  3WNN A;  3LEG A;  3P6B A;  3CDZ B;  1CZS A;  2ZXQ A;  1UXX X;  1LNS A;  3C7O A;  3I3E A;  3I3B A;  3J7H A;  4BK5 A;  3NRU A;  4CU9 A;  3HN3 A;  3IB3 A;  5DPN A;  2XHN A;  3PUI A;  4QB6 A;  2XOM A;  3LE0 A;  3VDA A;  3VD5 A;  3T09 A;  2E32 A;  1JZ8 A;  2B4K A;  2EIB A;  2DCK A;  3HPN A;  5EJZ B;  5FUI A;  3OGV A;  1K3I A;  2OKX A;  1GUI A;  5CYY A;  3DEC A;  1SDD B;  1JZ2 A;  1L7R A;  2BGP A;  3THD A;  2WO2 A;  3LQC A;  3MV1 1;  3OGR A;  1JYV A;  2E26 A;  2VZU A;  3OG2 A;  3FHQ A;  3MUY 1;  3A7Q A;  4PF1 A;  1NUK A;  4D8M A;  1JU3 A;  2VC9 A;  3T0A A;  3LEK A;  3BN6 A;  2WAO A;  3WF2 A;  2W91 A;  2VZQ A;  4DXS A;  3III A;  2JD9 A;  1GOF A;  3GGL A;  1I5P A;  3C8X A;  4QB1 A;  4W50 A;  5JR2 A;  3VD3 A;  3U37 A;  2BGO A;  4E8D A;  2ID4 A;  2QQJ A;  4ZY9 A;  4DEQ A;  3P1I A;  4A45 A;  3WF4 A;  2EID A;  1UX7 A;  2PQS A;  2EIE A;  1OF4 A;  2YC4 A;  2KD7 A;  4A42 A;  1MPX A;  3WNM A;  3AC0 A;  4P5Y A;  4QX1 A;  2RVA A;  3ECQ A;  4P08 A;  1W9S A;  4ET7 A;  1OH4 A;  1JYW A;  2VM9 A;  5C70 A;  3SEE A;  1EUT A;  5JUV A;  4QX3 A;  5G05 L;  2XON A;  4CVU A;  2WBK A;  3DYO A;  4A6O A;  1P8J A;  4GZ9 A;  2WO1 A;  1JYN A;  4TXW A;  3D3A A;  2BBA A;  2V4V A;  3C7F A;  3WF1 A;  3UES A;  3IAP A;  1W99 A;  4BK4 A;  2WN3 A;  3C7G A;  5IFP A;  1F4H A;  2LW8 A;  2W87 A;  3K46 A;  2J1A A;  1NKG A;  1KEX A;  4MAD A;  3NQH A;  2C4X A;  1GOH A;  2WQ8 A;  2W1W A;  3PUH A;  2QQL A;  4TTG A;  3HJR A;  3UNP A;  3OEB A;  5JMO A;  4P00 B;  4BXS V;  4QX0 A;  4CUA A;  2W94 A;  3LEI A;  1PX3 A;  4RN5 A;  2BZD A;  1WCQ A;  1TG7 A;  3T2P A;  4KWU A;  2J22 A;  2VZO A;  3T0D A;  3A21 A;  2Y6J A;  1JZ3 A;  1GQP A;  3WF3 A;  4UI9 L;  5A1A A;  1UMH A;  3DYP A;  3FHA A;  3SKV A;  3T2Q A;  1WKY A;  4BDV B;  3OEA A;  3K77 A;  3WF0 A;  2WAB A;  4LKS A;  1RYY A;  4XVH A;  1GNY A;  5DN2 A;  3GXU A;  1XPW A;  3I97 A;  2J7M A;  1R64 A;  3I2F A;  3W5M A;  3E1F 1;  1W9T A;  4XUO A;  2Y6G A;  2BER A;  4OMC A;  1OT5 A;  3CZJ A;  4W8J A;  4QDR A;  1GMM A;  3BGA A;  4JHZ A;  5B4X A;  1KGY A;  2R7E B;  2XQX A;  3I3D A;  3MBW A;  4PT6 A;  5IHR A;  5EIY B;  1UYY A;  1O8P A;  4QX2 A;  2W1Q A;  3JXS A;  3K4D A;  2WDB A;  4CUC A;  1D7P M;  3WSO A;  4IUG A;  2L9L A;  1OF3 A;  4QDQ A;  2VOT A;  4OYU A;  5C71 A;  2VCA A;  5JXI A;  2V5D A;  2C9K A;  4QPW A;  2W1S A;  5EJ1 B;  4JKK A;  1JHJ A;  1IQD C;  4ZZ5 A;  3I2K A;  1JZ4 A;  1UZ0 A;  4DXT A;  2WZE A;  1DP0 A;  2EIC A;  2VR4 A;  5B4N A;  2VME A;  4UAP A;  2X05 A;  1GOG A;  1NAE A;  1UMI A;  3HOB A;  5DMY A;  3FN9 A;  4M4P A;  5IYY A;  3C7H A;  4MGQ A;  4ARX A;  2VZR A;  1UY2 A;  4MO3 M;  1UY0 A;  2W1U A;  3DYM A;  2HLE A;  3CQO A;  4MOA A;  2ZEZ A;  3LPG A;  3ETP A;  2CDO A;  3ABZ A;  3WEZ A;  2WYS A;  5JXH A;  1K45 A;  3ACH A;  2J1S A;  2JDA A;  3OB8 A;  1UWW A;  3THC A;  2VJX A;  3F2Z A;  1YQ2 A;  4GWJ A;  4A44 A;  4YPJ A;  4JKM A;  2VZ3 A;  1PX4 A;  5IJR A;  2J1T A;  4XUR A;  2RV9 A;  4QB2 A;  3I2J A;  4RYD A;  4ARY A;  3VD9 A;  2VCC A;  5J1X A;  1T2X A;  4M4R A;  3HNB M;  1UY3 A;  4KI5 M;  3FL7 A;  3ZM8 A;  2DDU A;  5DQ0 A;  2W92 A;  3GDB A;  3VDB A;  5G04 L;  1PMH X;  3CZU A;  2Y6H A;  3EB7 A;  4JX0 A;  4UOJ A;  1DYO A;  2J1V A;  3EYP A;  4A3Z A;  3IDA A;  1JZ7 A;  2Y6K A;  2YFZ A;  2ZEY A;  4LQR A;  4QAW A;  5HXM A;  3NJX A;  1CIY A;  2QQM A;  1J83 A;  5LA0 A;  1L7Q A;  5LCW L;  2WO3 A;  3WNO A;  2W47 A;  4GWI A;  1XNT A;  2W9X A;  2J1E A;  4LPL A;  1F4A A;  4P02 B;  2ORZ A;  3VD4 A;  1UYZ A;  1DLC A;  3SEP A;  2VQU A;  3OGS A;  3WNK A;  4OUE A;  2X10 A;  2W95 A;  4E8C A;  4ZZ8 A;  3K4Z A;  2B9V A;  4DUX A;  2VMD A;  4OZO A;  3OBA A;  1US3 A;  4BJ0 A;  4PQQ A;  1W9W A;  2W5F A;  1UY4 A;  2V72 A;  3NJV A;  3UET A;  2QBX A;  3WNL A;  4AG4 A;  2VZP A;  4DUV A;  2RJ2 A;  2JE8 A;  5JXJ A;  1US2 A;  3VD7 A;  4FI9 A;  1GU3 A;  1K42 A;  3WNP A;  2QQN A;  1CZT A;  3GM8 A;  1HN1 A;  3T0B A;  2VZT A;  2JKX A;  1JZ5 A;  4CU6 A;  3CKH A;  2WN2 A;  5CZK A;  1J84 A;  1SHW B;  5C7G A;  1H6X A;  3K4A A;  4XUN A;  5IFT A;  3MV0 1;  5LA1 A;  1W0N A;  2VZS A;  2Y64 A;  3W5N A;  3T08 A;  3I2I A;  2X09 A;  4AAX A;  1ULP A;  2QQO A;  1UYX A;  4XUQ A;  2ORX A;  4OMD A;  1PMJ X;  2VL4 A;  1JU4 A;  1UY1 A;  1TVG A;  2C26 A;  2VMC A;  2W46 A;  5I0D A;  3SKJ E;  2CDP A;  2VZ1 A;  3T2O A;  1SG3 A;  3ACG A;  3ACI A;  4A41 A;  3CMG A;  2WZ8 A;  4JKL A;  2YFU A;  3I2G A;  1H6Y A;  1W8N A;  2J1R A;  3HNY M;  1CX1 A;  1BHG A;  3VDC A;  1JZ6 A;  3C7E A;  3IAQ A;  4MGS A;  4D0Q A;  1JYX A;  1XNA A;  2ZEW A;  2VMF A;  1K12 A;  2VQT A;  2VZV A;  1O59 A;  1JI6 A;  1ULO A;  3HEI A;  5JXG A;  4DXR A;  4KMQ A;  2QQK A;  5LA2 A;  5F7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...