2J1EA

High resolution crystal structure of cbm32 from a n-acetyl-beta- hexosaminidase in complex with lacnac
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
142
Chain Sequence
b'PRTVKITASSEETSGENAPASFASDGDMNTFWHSKWSSPAHEGPHHLTLELDNVYEINKVKYAPRQDSKNGRITGYKVSVSLDGENFTEVKTGTLEDNAAIKFIEFDSVDAKYVRLDVTDSVSDQANGRGKFATAAEVNVHG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HYALURONIDASE
molecule tags Hydrolase
source organism Clostridium perfringens
publication title The Interaction of a Carbohydrate-Binding Module from a Clostridium Perfringens N-Acetyl-Beta-Hexosaminidase with its Carbohydrate Receptor
pubmed doi rcsb
total genus 31
structure length 142
sequence length 142
ec nomenclature ec 3.2.1.169: Protein O-GlcNAcase.
pdb deposition date 2006-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2j1eA00
2J1RA 4OUEA 2E26A 4CUAA 2VZRA 1F4HA 1I5PA 2VZQA 3DYOA 5B4XA 3NNGA 1J83A 4QX1A 5LA1A 3C7HA 2EICA 3DYMA 5DQ0A 3WNPA 4RN5A 4OYUA 3T2OA 3SEPA 2J1SA 5J1XA 1W9SA 5C70A 1BHGA 2VC9A 2W5FA 1O8SA 2CDOA 5CZKA 4QB6A 5LA2A 2WO2A 3W5MA 3HNYM 2JD9A 2B4KA 3C7FA 3MO4A 5DPNA 3LE0A 3K4ZA 3A22A 1PX4A 3SKVA 5C71A 2ZEYA 2VMEA 2J22A 2ZEWA 4HG6B 3OEBA 2X09A 3AC0A 3IB3A 2Y64A 2VL4A 5JXIA 1K3IA 4DUVA 3C7EA 1HN1A 4AAXA 2VCAA 1K42A 2W1UA 2WO1A 3VD7A 2L9LA 2BBAA 3OB8A 2W1WA 1W8OA 5IFPA 4UAPA 2VOTA 3WF4A 5DMYA 3OG2A 3A23A 2QBXA 1JZ7A 1CZSA 5G04L 1UY3A 1CZVA 1R64A 2OKXA 1UX7A 4CUCA 2HYXA 4D8MA 3I97A 1K45A 3J7HA 3D3AA 3LEGA 3IAQA 5JXGA 4P02B 3I2FA 2EIDA 1PMJX 4TXWA 1GOGA 5A1AA 2VTFA 1JU4A 4A42A 3A21A 2JKXA 2WDBA 1UY1A 1UMIA 2QQMA 3P1IA 4PT6A 2X10A 4OMCA 4RYDA 1EUUA 1WCQA 2W91A 5FUIA 4E8CA 3VD9A 4CU7A 4JHZA 1ULPA 3MUZ1 2VZPA 3DYPA 5C7GA 5IFTA 4KMQA 2VCCA 5LCWL 1YQ2A 2WYSA 4CVUA 1P8JA 2VZUA 4PF1A 3K46A 4LHSA 3FHQA 4TTGA 1NKGA 3C8XA 4W8JA 2Y8KA 1NX9A 4W50A 3I2KA 3JXSA 3LEIA 4XUOA 1GU3A 3CMGA 2WZEA 1OF4A 5JXHA 1OH4A 2BGOA 1T2XA 3C7OA 2WUHA 2VZ1A 1KEXA 3MV01 4KI5M 5HPOA 1L7RA 4LQRA 2ZEZA 4MADA 2YC2A 2RVAA 3C7GA 4DXRA 3MBWA 1JZ2A 2XOMA 2Y6GA 3ECQA 1L7QA 2W3JA 4P00B 3T09A 5LA0A 1JZ5A 4MOAA 4JKKA 4QB2A 1JHJA 5IHRA 1UY4A 2VCBA 4BK4A 3VDCA 4GWIA 1OD3A 5F7UA 1KGYA 2KD7A 3HEIA 1GNYA 2QQNA 3BN6A 3CDZB 3T2QA 4BK5A 1JZ8A 2W95A 4XUPA 1GOHA 1UY0A 2J7MA 1JYXA 1H6XA 1UYXA 5HXMA 3ETPA 4XUQA 1JZ6A 2VMDA 4QDSA 4QDRA 5DN2A 1UWWA 3HOBA 3UESA 2VO5A 4W4ZA 4DXTA 3WNOA 3WF0A 1TVGA 4OMDA 4ZZ8A 1XNTA 2Y6LA 4DEVA 2QQKA 1UXXX 4GZ9A 3WNNA 2X05A 2YG0A 5EJZB 3VDBA 2J1VA 4XUNA 2WO3A 3OGSA 4P08A 1CX1A 3WF1A 4UI9L 2WBKA 1J84A 1OF3A 2RV9A 4BDVB 2J1AA 3LPGA 2DDUA 1LNSA 1H6YA 1US3A 3WEZA 2WZ8A 2VMFA 1CIYA 3VD3A 2JDAA 1O8PA 3HN3A 4ARXA 4OZOA 2XHNA 3FN9A 3GDBA 4JX0A 2ORZA 3HNMA 4A41A 3A7QA 3F2ZA 3OGVA 3WNMA 4XURA 2YFZA 2WAOA 2W92A 1JZ4A 1UZ0A 2XQXA 3ACHA 2LS6A 3WF2A 3K75B 3I2GA 2JE8A 3IDAA 4LKSA 1W8NA 2QQIA 4ZY9A 4UOJA 3FHAA 4Z2AA 1OT5A 2YFUA 1XPWA 3PUHA 5G05L 1TG7A 1JZ3A 2E33A 2WABA 4P5YA 1W99A 2C4XA 3T0DA 2QQOA 4MO3M 3ACIA 1UY2A 2VJXA 3WQBA 3CZJA 3SEEA 1ULOA 2VZVA 3CZUA 2EIEA 2BZDA 3HJRA 3ACFA 1XNAA 3SKJE 2R7EB 2W9XA 1SG3A 2V5DA 1D7PM 4DUXA 4JKLA 2W47A 2ZEXA 1DLCA 2W46A 4ET7A 2W1QA 3MV11 1W0NA 4FI9A 3EB7A 2W94A 1JU3A 1PMHX 4MGQA 5CYYA 4E8DA 4QDQA 2VQUA 3CIHA 1SDDB 1UMHA 2LW8A 3GGLA 4DUWA 2CDPA 4XUTA 3U37A 1RYYA 4ZZ5A 1GUIA 3T2PA 3GM8A 5B4NA 4A3ZA 1NAEA 3WNLA 2C9KA 2Y6JA 2ORXA 1UYZA 4D0QA 1UXZA 4QX2A 2DCJA 2Y6HA 5I0DA 3THDA 2YC4A 3EYPA 1JYNA 2VZTA 3T0BA 3HPNA 5EIYB 2VM9A 4L0PA 3LQCA 3WF3A 2J1UA 1F4AA 3P6BA 1MPXA 1W9TA 2YB7A 3MUY1 1DYOA 2Y6KA 4BXSV 4JKMA 4XZUG 2WQ8A 3K77A 2DCKA 1WKYA 2B9VA 4ZXEA 2VZSA 3I2JA 4CU8A 2W1SA 3K4DA 3NRUA 3ACGA 2J1TA 2WN3A 2HLEA 3NJVA 1CZTA 5EJ1B 4QX0A 4CU6A 2WAAA 1DP0A 1XC6A 2VR4A 5IJRA 2W87A 4A45A 3W5NA 3THCA 1K12A 3OEAA 1NUKA 3WNKA 4MGSA 3I3DA 4CUBA 5IYYA 3CKHA 3I2IA 2WN2A 3OGRA 4KWUA 1JYWA 3FL7A 5JXJA 3E1F1 4M4RA 2EIBA 3IAPA 2V4VA 2Z4FA 3PUIA 3CQOA 3VD4A 2V72A 3BGAA 1UYYA 3I2HA 3DECA 3LEKA 2BGPA 4GWJA 3OBAA 1GMMA 2VZOA 4IUGA 4ARYA 2VMCA 3VDAA 2BERA 3T0AA 3UETA 2QQJA 3IIIA 1GOFA 3HNBM 2VZ3A 3ZM8A 3I3BA 4XVHA 2E31A 4BJ0A 3T08A 4PQQA 2PQSA 4CU9A 2C26A 4AG4A 1O59A 3WSOA 3I3EA 1W9WA 4YPJA 3LPFA 1EUTA 2QQLA 1PX3A 1JI6A 1SHWB 3UNPA 5JR2A 4DXSA 4LPLA 3GXUA 2E32A 5JMOA 3VD5A 3ABZA 1US2A 2XONA 2VQTA 3NJXA 2ID4A 2J1EA 3K4AA 3NQHA 2RJ2A 4QAWA 4A4AA 4M4PA 4DEQA 2ZXQA 4A44A 1IQDC 1GQPA 1JYVA 4A6OA 4QPWA 4QB1A 5JUVA 4QX3A
chains in the Genus database with same CATH superfamily
4XFAA 2J1RA 4AEJA 1BEV3 1RUG3 4EQVA 1F4HA 5LA9A 4IV1C 2LUWA 1CONA 2HWC3 3POIA 2XVKA 4A7ZA 1OQ1A 1ULGA 3AVSA 1GWMA 5A70A 1QKQA 4COVA 3LDBA 4XF0A 1RHI3 4NWWA 1CJDA 5LA1A 4EN7B 1R1A2 1SLCA 2ARXA 2DURA 3GHNA 4MSVA 5F32A 4CCJA 4OYUA 4Q4X3 3T2OA 1H8TA 5J1XA 4NWVA 3M70A 4OUSA 3JZVA 2BOIA 3N9NA 2VC9A 3VLBB 2RS33 1O8SA 3VBHB 1S2EA 1UD1A 4L11A 4QB6A 5K9YA 5FYHA 4CDUA 4ZS3A 1RUH2 1YI7A 2OZJA 2RS31 3WUCA 1JBCA 2WO2A 3KD4A 4JGZB 4QU1A 3ZDVA 1IKPA 3MPPG 1HJFA 2D44A 2WO7A 1IG3A 1LCLA 2ES3A 2K46A 4C1XA 1LRHA 3K4ZA 4LHKA 4ATFA 1PX4A 5DXDA 2CWSA 4W6XA 1YCIA 2P4EA 3K48A 1VBD1 4UF0B 4QKBA 1JN2P 4PIXA 1MVQA 1VRBA 2VMEA 2J22A 3VV1A 5IT6A 3OEBA 2VQAA 2VTXA 2ZHLA 1RVF1 5FZAA 3ZXGA 1GKBA 3IB3A 5JXIA 1JXNA 3GALA 4DUVA 1IQAA 3TB0A 3ZIWA 1XJAA 4AAXA 1K5MB 1K42A 1YFXA 2MEV1 4ATEA 2FDJA 4H3WA 2Q8EA 4BQYA 3EJKA 1VRH2 2FD8A 2LRPA 4PI2A 3WDTA 3WP6A 4CCDA 5LASA 1V6KA 4BLIA 3PDQA 1TE1B 4YGDA 2ERFA 3JB8A 3WY6A 3KGLA 5AFBA 2VOTA 1QIQA 2EVXA 2VMHA 2X5IA 4OVEA 2QBXA 1G6NA 5APAA 1CZSA 2JE7A 5G04L 4M3CB 1R64A 3O12A 1S0CA 1X36A 1X8EA 2WWJA 4AEDA 2VD7A 2PFWA 4QT6A 5B2GB 5DDJ3 2PAMA 1K45A 4CDQA 3KMHA 4HVQA 3LEGA 1DFQA 3IAQA 5FTTC 2XBO3 2WS92 4R9BA 1YO8A 4WZCA 3I2DA 5T5OA 1N3QA 2FCTA 2ZX1A 5E16A 1ZZ8A 2JDZA 2XBO1 4N8MA 3ZO0B 4COUA 1DQ0A 2EIDA 4XIOA 2WNOA 4MYEA 4CCOA 2ZTNA 1F15A 1JU4A 5EXOA 5HCFA 5IK7A 2C24A 4RHV1 1Z78A 3A21A 4IV3B 3LD8A 4QXCA 5D21A 3ZYJB 2WFF1 2DVBA 3VL9A 1JYCA 1EUUA 5FZHA 3WP3A 2W91A 3ALQA 1UOGA 4AZZA 2UY9A 4Y24A 2ZGPA 5GZCA 1U5YA 3WG3A 2VBPA 3MFAA 5GZFA 1H2NA 2NMNA 4Q4W2 1NE4A 1CAXA 3VD9A 3J7NA 4HBNA 3S6PA 4A2UA 1RITA 1XB9A 4EJRA 4YWAA 3POBA 2GNBA 2VZPA 1H4HA 4V2WA 4DNYA 5IFTA 1WMDA 4L99A 4XETA 1YFYA 2ZGMA 2Q8CA 1I9RA 4QPGB 2A6XA 3GZTB 3RMYA 1HRV2 3AVRA 3MW2A 4Y5SA 1BKZA 1SACA 1JW6A 2AYHA 5LWBA 3RQ0A 4LHSA 1UO9A 4GB33 4HXCA 5KR7A 3WDXA 3L2YA 4TTGA 3CJXA 2IVIB 1VBE1 3C8XA 3HT2A 3VDDB 3N9LA 1NX9A 2XR4A 4Y4RA 1HJGA 4LMFA 4P9IA 4AE2A 2QNKA 3ZMNA 1K5JA 2P1BA 1GNZA 4UFJA 1W8TA 5C8CB 2WT1A 2AACA 1QY4A 1HV1A 2P17A 1FMD1 2YY1A 4LBNA 4CA9A 4D94A 1OF4A 5JXHA 3MF6A 1A3KA 3AMMA 2J42A 1VB4A 2DTWA 3NNJA 4WV8A 4YGEA 1W28A 1VBB2 4FOQA 4QXKA 4WBBA 1D4VB 4BA6A 1GV9A 5HPOA 3JBG1 4IXLA 5KHGA 3OOXA 3VBUA 2O8QA 3R4DB 4HPKA 3WLUA 4UWDA 4KWJA 4MADA 4Y4YA 3WQ1A 3B7MA 2FDFA 1UKRA 2RVAA 3BUCA 1OSGA 3FZ3A 3O1PA 3FE5A 3OYWB 4JRAA 5EZWA 3KT4A 3MBWA 4Y1XA 5J98B 2VNRA 4Q8KA 1JZ2A 1TME1 2XOMA 3NAPC 1AR63 2JKBA 4XCBA 1U0AA 5A7SA 1CAVA 1QMJA 2GH8A 2Q8OA 3Q8AA 1D4M2 3BTYA 1Q8OA 4JGYB 1VMFA 1PIV1 2XUMA 1JZ5A 4JKKA 4Q0QA 4QB2A 1UY4A 4QQPA 1RUI1 3GBFA 2P34A 5F7UA 1OXCA 1QEXA 1S2BA 2ADEA 2XLAA 3U4XA 3HEIA 1YQ5A 1YQCA 2K2SA 3BN6A 1RB8G 5FYVA 1J1LA 3OYWA 3ROUA 1UZZA 3IKWA 4BK5A 1H9PA 5A6YA 1JZ8A 4WVWA 2W95A 4B7EA 3FUQA 3NO8A 4IE7A 4DQAA 1W6OB 2GN7A 4E4SA 3KV5A 2VW0A 1ZBA1 5JZGC 1DQ1A 4OFGA 3S30A 1UYXA 4NUBA 3D0JA 4LBQB 3KQRA 4HN0A 3ETPA 4RGKA 5FY4A 5FKBA 1YIFA 1IZ3A 3AYEA 4HPKB 4QDRA 1SLLA 4ZU5A 2KM2A 1R082 5HV4A 3KS7A 2P3YA 4V1PA 4BZ4A 1RUH3 1POV3 1Y4WA 1AZDA 2QFEA 4OMDA 2V09A 4CXXA 3PUSA 2KXLA 2XXZA 1LHVA 2Y6LA 2QQKA 3VZJA 3ZN6B 1AR82 5I0UA 2J1VA 3IWZA 2D97A 4XUNA 5DZEA 4BISA 1W0PA 2WO3A 2GC0A 3IPVA 2RMU1 2Z79A 4P08A 1AF9A 2WS93 4PCRA 5CNAA 5D2AA 1VP6A 3U78A 5A6XA 2E9QA 2WZR2 1SFPA 3O1MA 4Y1VA 1PVC3 5FMOS 2CGPA 2WS91 2BEOA 2J1AA 3LPGA 2YPDA 4Y5TA 4B4PA 3ZSKA 2ZGSA 3AP5A 1BK1A 2JENA 4S2HA 2WNVB 1US3A 1J3PA 2WZ8A 2D3PA 4YRDA 2VULA 1UNBA 2ET7A 2I2SA 4RFRB 2RM21 2DFBA 3O1RA 3OCPA 5T5LA 5FWEA 2JECA 4FAHA 1C8M1 2A1XA 4ARXA 5JCTA 5JDBA 1LHNA 4YZ5A 1F9KA 1U5XA 4WM8B 2BV4A 1NG0A 4AQTA 1A34A 3FN9A 1CVNA 3GDBA 3JQXA 4XAAA 4LO7A 2ORZA 2XDVA 3ZXLA 3OGVA 3F2ZA 5AVPA 3U4SA 1W6OA 2YFZA 1V6NA 2DU0A 5FIXA 3N9PA 4YLZA 5H9RA 1JZ4A 5CG8A 1EAH2 1UZ0A 2R1BA 3ACHA 4PIYA 5E89A 1R093 2F17A 1B35B 2W08A 2LS6A 3ORJA 3K75B 5FYBA 4NIHA 3I2GA 2EAAA 3IDAA 1F8VA 3LSDA 4PQ9A 1UU6A 1W8NA 3VBSC 2XL9A 3FMGA 4TSVA 1AR92 4QX5A 2RS51 3VHPA 4QPGC 1R081 3W20A 2Q4SA 3CJIA 4HOOA 3ZR5A 4I2OA 1ZRFA 2X5IB 4I0AA 4FFGA 4B7KA 1RUF1 2E33A 4P5YA 3WG1A 4TZDA 2C4XA 5FZ6A 3W9AA 3J8F3 4NIIA 1UY2A 5IK4A 2ZABA 2RR11 5H9SA 3AJZA 4D7TA 2GP3A 3AMHA 4N43B 3ACFA 4D7YA 2NP0A 1ZRRA 3HWJA 4S2FA 2VE1A 1GZ9A 3AXDA 4BIFA 3ZVXA 1QNWA 1EAH1 1D7PM 3PTYA 2R16A 1QWRA 3JD73 5A33B 1DDLA 4JKLA 2ZX0A 2ZEXA 1LHWA 5FPZA 1EAH3 2VOVA 1DLCA 2W46A 2BJSA 1H1MA 2ARAA 2JDMA 4QQLA 4PLNA 3ES4A 5FZFA 3MV11 5LBCA 3WCSA 3I4IA 5J09A 1ZZ7A 1AVBA 2K9ZA 1GYKA 2W94A 3FJSA 1PMHX 4MGQA 4UW6A 4EWDA 4AQ6A 1F5FA 3ZFGA 1WW5A 5A7OA 4CDWB 2R071 3KHCA 1YNAA 2X53S 3HBZA 1BBT2 2PLV2 4Q4X2 3OBTA 4EN9B 1LOBA 5D8AC 5ACA2 5A7QA 5LBBA 3R4UA 4IW3A 3T2PA 3GM8A 2OW4A 3P3PA 3KQ4B 4H55A 5F8PA 2O14A 2WQ4A 3TBDA 3L9JT 5EPAA 5JSPA 2Q1MA 1UYZA 3BTZA 4DIQA 4I01A 4PBOA 4WM7B 3D6EA 2YC4A 4IV3A 3ACLA 3PUQA 3AP9A 5EIYB 1TNFA 2VM9A 2R062 3BIEA 3VKFC 4OQ8A 3RDIA 2R0HA 4LR4A 5FK8A 3LQCA 3BODA 3WF3A 1MZ5A 1XYPA 1A78A 2BP6A 4BOWA 2DUPA 2WA4A 2JB8A 4X6RB 2OVUA 4OI1A 5I0TA 3ILRA 3WVJA 1LAJA 2J1UA 4ZXKA 1QQP3 3LOBA 1KDMA 2BQPA 4NHXA 2IVJA 2QUOA 1QQP1 5CB7A 4LJHA 2A3XA 4NPMA 3MUY1 4XTPA 1BMV2 1GNHA 4FTEA 4JKMA 4BU2A 1W90A 3I59A 3K77A 4ZONA 3VHOA 1WKYA 2B9VA 4YGCA 4HKWA 3VZNA 4MH0E 4LBOA 4LKFA 4AFDA 4FP2A 3CJIC 4MGYE 5J48A 3HD8B 1IPJA 4RR3B 4BCUA 4BPZA 1RUC2 2VVDA 4FP3A 3KB5A 2OA2A 3DPRC 1F2NA 1JUIA 2QQWA 2WNUB 3B69A 3RYPA 4PBPA 5T54A 3WHTA 1NT0A 2IWGB 4INDA 1MQTA 2DUQA 4WM7A 5FZ8A 2RE9A 4IV1B 5DG2A 1Z0HA 1RIRA 1CZTA 1W8HA 3TN91 2XBO2 2HYKA 2EXHA 1MS3A 5ERLA 1D4M1 4QX0A 2HWD3 4K7JA 1DP0A 4UF0A 4XBLA 2W87A 3VUOA 1D4M3 3OUJA 3RGBA 3N3HA 1NUKA 3KM5A 2EAKA 4MGSA 4N43C 1NQDA 2Y26A 1EV13 3VBOB 2WZR1 4FOYA 2AC1A 2W39A 3I2IA 3N7JA 4KWUA 3RWKX 2H6BA 4HVRA 5FZ1A 2PMWB 1HLCA 1CAVB 3E1F1 2WZR3 2Z42A 4M4RA 4M3CE 1WWYA 1ZZCA 5GLUA 3SLIA 2V4VA 2X29A 3CQOA 2QJVA 4XOGA 4PDWB 5FPLA 1UYYA 5FR3A 5JOZA 3ZYRA 3DCQA 1IS3A 2YDEA 5LEJA 2BGPA 2VGDA 3V0BA 1MACA 3D4KA 1C8NA 1GMMA 3N9QA 2BRTA 5FWJA 4C0BA 2DF7A 4ARYA 2WL1A 2VMCA 3U0ZA 2BERA 2RDSA 4XJAA 4XQ4A 4JTOA 3R05A 2VZ3A 1QJEA 3M3OA 3H8OA 3PUAA 2WT2A 1YRZA 1J59A 3T08A 4PQQA 3NL1A 3MIFA 2PQSA 4YW1A 4NIDA 1O59A 5FO7B 1GQGA 4KU7A 1PGSA 2HWB3 1CAWB 1W9WA 2ADDA 1AYN1 3AMQA 3CLPA 1IS5A 4Q4Y2 4A6SA 5GLWA 3DGTA 3IT8A 4XYXA 1NYWA 3UKNA 1UL9A 2ZACA 3FC0A 3H1WA 4YW2A 5FV3A 1I1EA 4IE4A 1X9TA 1R1A3 4YM0A 4DXSA 4LPLA 2YMZA 4ITCA 1FT9A 1RJ7A 4GH4B 5L9BA 3WZ1A 4FVVA 3SH5A 1QU0A 3VN4A 4E4HA 3ABZA 2OYZA 1V6LA 3LFIA 3ZOIA 1C5IA 2IUWA 2VQTA 5A3MA 4P9LA 4QGLA 4CUGA 3VBFC 3B00A 4QX7A 3WT3A 1GQHA 3PU8A 4TLFA 2RJ2A 3VKMA 3MPBA 1PO21 4M4PA 1RGSA 4AVTA 3GZEA 5FQ0A 4S2GA 4Q29A 4A44A 3I2OA 3B9CA 3HT1A 3PJYA 5FY8A 3IDBB 4A6OA 3T1LA 3BU0A 4P9WA 2YPJA 4EWEA 4WZFA 1W9YA 2XJUA 3VBUC 4AI9A 2OX0A 2Q1FA 4LO6B 2JXAA 1RUJ1 3WR0A 1RVF2 4WVMB 2UYBA 4NHLA 3V0AA 5IK5A 1UIJA 1JOJA 2XKOA 1SLIA 4OUEA 5SV5A 1JTZX 4CUAA 2VZRA 2VXRA 5K0UB 1I5PA 1DGLA 2IXIA 5LRSA 3DYOA 5C5UA 4AF9A 1J83A 1RUF2 2HWE1 3I8TA 3O5SA 4Z07A 1Z7S2 3DYMA 3MLKA 4XAEA 5FZOB 1DCSA 3WNPA 1CR7A 1WW7A 4RN5A 3AB0A 3AZWA 3BCWA 5FY1A 5LB6A 2O1QA 2IXLA 2VBDA 3MI8A 5FYZA 3SNMA 2CDOA 5E8AA 1D0GA 1W2TA 2EXJA 4XF3A 5GLTA 5LA2A 3U10A 1H9WA 2D98A 3W5MA 2ZGNA 3VKLA 1QJY3 5LW9A 4KWKA 3C7FA 3M3IA 3MO4A 1XE7A 4HSJA 2OIIA 3ZYIB 3EQEA 4LK6A 5BUVA 2VU9A 1HIXA 4FT8A 5GZDA 3AZVA 2WNEA 1CPNA 1ZZ6A 4N53C 4CDWC 2ZEYA 4CP9A 4YM1A 1AR61 2I07B 3BI3A 2X09A 1N1TA 3B9IA 1FX5A 2Y64A 3AC0A 5JSRA 1CGPA 1Q8SA 3TAYA 1HN1A 3ZFFC 1KDKA 1NZCA 2B39A 2VCAA 5BXXA 5IVEA 1ZM1A 1ZBE3 1VLNA 2WO1A 1QJX1 1SLTA 4Q4Y1 3SCGA 5C3RA 4MG2A 2L9LA 2BBAA 2I45A 4SBVA 4LT5A 1ZBE1 5AC91 5FJKA 2R6QA 3IDCB 4IEYA 5AC93 4FFFA 3GBGA 3OG2A 4AFMA 3A23A 1OBNA 2E7TA 3GYDA 2YHJA 2HH9A 4NJ4A 3PL0A 4LOSA 1CZVA 1O5LA 1SCSA 2WQZC 4XDOA 4BWOA 1UX7A 4UW4A 2HYXA 4Q1RA 3INAA 4ZU7A 2X5IC 1ZBA3 4YSFA 1OHFA 4RFT0 3J7HA 1H2KA 4W65A 4XABA 1TNRA 5EP9A 1S0BA 3E97A 1WA4A 1PM4A 4B1MA 4O9EA 1XE8A 2BVVA 3EXUA 3NNFA 1WBLA 4P02B 4XFGA 3NV2A 4E4ZA 5LY1A 4AR2A 5A1AA 4IEXA 4BQ1A 4UW5A 5A3OA 5BNNB 1XNBA 4A42A 2JKXA 2RHPA 3JUUA 2FDHA 5F3EA 1UY1A 4PT6A 3P1IA 3ZSEA 2CY6A 3RFRA 5A1LA 4OMCA 1OLRA 3FX3A 1REFA 4RYDA 5D8AA 5A80A 2VTXJ 1NZIA 1MEC1 5FCCA 2A6ZA 5T50A 3H50A 2C9AA 3KZ4C 1JODA 4C90A 1PVC1 4CU7A 1KRIA 3LGRA 1RUJ2 4HN1A 5C7GA 2RS11 2R042 3OY8A 2Q5TA 2B46X 4IE5A 1YQ2A 4FO9A 1AJOA 4XZPA 4LXLA 4XPVA 1GP5A 5HCBA 4MGTA 3KHBA 4FPHA 4Q4V2 1NY71 1LEMA 2ZHKA 2WWUA 3N35A 1HB4A 3E5QA 4LBQA 3H8RA 1DGRA 1YHFA 4LA3A 4LUKA 1H1AA 1NKGA 4L2NA 4W8JA 3I3QA 1LR5A 1W8FA 3GJBA 4W50A 4ISQA 2UWCA 4R8HA 3O1UA 3DF0A 3I49A 2Z2SB 1OI6A 3I2KA 5KXEA 5LEKA 4IEPA 4RQPC 4LKEA 2AZ5A 1YFUA 4LORA 4XUOA 2HWC2 1PGL1 4X8NA 1DGWA 2WZEA 1NCQB 1OH4A 1UMZA 2AREA 2Q30A 2WUHA 1KEXA 2FCUA 2VY0A 3MV01 4UT5A 1HQLA 1DGRN 2W0XA 1G9BA 1L7RA 4MV2A 4LHLA 1LB2A 2D6NA 2HWE2 4HKOA 3ZFGB 2O0OA 4BXFA 2D6LX 2VG9A 3RZLA 5JLVA 2PTMA 1XE0A 5A7WB 4XJ8A 4EZHA 3S0MA 2A7AA 1O3SA 3OBZA 1IS6A 2ZHNA 5FZ7A 1RVF3 3VL8A 1HRV3 1ND3C 1RUD1 3PMSA 4QD2A 4ES8A 2W3JA 3WDYA 1QJU1 4AHZA 1HRV1 1JHJA 1V70A 4XC9A 3L2HA 2ZZQA 4XTMA 3VBUB 3KF3A 3VB9A 1ZBE2 1DU3D 1OD3A 2ZGKA 3MF9A 4LOTA 4MHRA 2PHTA 1KGYA 1DF0A 2KD7A 2IZWA 1GNYA 4Y5Z0 3OY8B 2CV6A 3FLTA 2AENA 2HBTA 3T2QA 2HBUA 1ZX5A 2ZBJA 4NPLA 1PM7A 4MHUA 4QU2A 5DUWA 3WOGA 1GOHA 2IFRA 1Q8QA 3EBRA 1JYXA 5DDJ1 4N53B 2NYYA 5FYUA 4CDXB 1W6PA 4M0HA 4META 1XYOA 1OUXA 4NN0A 4R9DA 3ZFFB 1JZ6A 2R49A 2RJKA 5CKQA 1FV2A 4RR3C 5DN2A 3HOBA 4OZXA 4PF5A 5JZGA 2TBVA 2PHWA 3UESA 2VO5A 2HWD2 5FUPA 4W4ZA 2G9FA 2VECA 2YXSA 3WG2A 4DY3A 2ZGRA 4OHWA 3N36A 3VZOA 1WMXA 3CBNA 1HRI3 1DZQA 1UXXX 2Y0IA 4GZ9A 3WNNA 2YG0A 1OQDA 2A75A 2WFF3 3FLPA 3AKQA 3LA3A 4MGZE 5EJZB 3LA2A 1OH3A 4EYUA 3OGSA 3DL3A 1CX1A 4UI9L 3WDVA 1ND3A 5HI0A 1OVSA 4CPBD 4CRQA 3KWVA 4HKLA 3FFQA 1QOTA 3FWEA 1SMVA 1BZWA 3RJRA 5C3SA 4OI0A 2DDUA 2C6SA 1AR91 2HWB2 3AFGA 4MUVA 4BB3A 2CHHA 2XJPA 4UFLA 1VRH1 4NVPA 5FLHA 3HQXA 3LKJA 1GR3A 2P6HA 3AZZA 2CYFA 2JDAA 3QH7A 2WYFA 2XJQA 1RMU3 1QH7A 4E27A 2D5HA 4D3WA 3HN3A 4GMP1 1GZWB 1WMFA 1HN0A 4LA2A 5I8SA 3U1XA 2GDFA 3WX5A 1UPIA 3VBOC 3WNMA 2WSUA 5CFDC 2ZGQA 1JMUB 2W92A 4IEQA 2W52A 3HBKA 1YWKA 1H0BA 4MGKE 1COV3 5HV0A 1LGBA 2XQXA 3Q8BA 5C8WA 4U36A 1EPZA 3WW4A 4AK3A 4OUMA 4GAZA 4GKXA 3H0OA 4E2SA 3K51A 1RXFA 2DUOA 3GCWA 3ZXEA 4LKSA 4LEJA 1NQJA 3SMHA 2UYAA 2XH6A 3KCCA 4ZY9A 3S7IA 2BGCA 1VBC3 1ND2C 2DVGA 3FHAA 4Q26A 4AGGA 1K5MA 1QJX2 1ULFA 2QQUA 1H2LA 4LBMA 5JVVA 2GNDA 1RUG2 5FPVA 4LBKA 1LESA 2C5DA 5G05L 1TG7A 1ZA4A 3KV9A 1GZTA 3CJIB 1AR62 2QQOA 1O4TA 4YVSB 1MS9A 2UURA 2W68A 1L7LA 3ACIA 3NWKA 4XJZA 3H7YA 3H7JA 4AI3A 1W2OA 1WZXA 2K0GA 2HEYF 2BZDA 1IHMA 1KS4A 3HJRA 3ILFA 5BNNC 1XNAA 2R7EB 2WJSA 1RL3A 4N90A 4JGYA 3HR9A 5HXVA 1MQTB 3P3NA 2JIGA 4P5HA 1AX2A 2PXJA 4O65A 5FQ0B 1LENA 2W47A 1ZNPA 4BQXA 4YW4A 5ABJA 3WNXA 1XBFA 2JG8C 1QJU2 4LNVA 5CYYA 1DG6A 2ARBA 2ILMA 5C9AA 5BNPC 3CIHA 3ZYHA 1UMHA 1OA2A 2JG9B 2VW1A 3GGLA 4Q1PA 2BYVE 2UY8A 1Y9GA 2CDPA 4XF9A 3OD4A 3E6DA 5DAQA 1RYYA 4ZZ5A 3RSJA 2F6BA 2R32A 5AC92 1PK6C 3ITQA 1KD7A 4Y20B 4EV0A 2IC1A 2QE3A 4NMIA 5FXVA 2B45X 4E4DX 4XACA 2PELA 3WNLA 5FZOA 3N9OA 4LLFA 3W21A 2ORXA 3CEWA 4Z82A 1XNCA 1UXZA 2R072 1O3QA 2ETEA 2Y6HA 1R1A1 3AZYA 4CP1A 5ABJC 5BNOC 1JYNA 4ISRA 3NKGA 4UW3A 4XQDA 1KFXL 1XSQA 2PYTA 1HB2A 4JAAA 3ZXAC 3MLLA 2BWAA 4DY5A 4L0PA 3ZMOA 4RA0A 3JD72 3AYAA 2OPKA 4YARA 3AL6A 1KJLA 2JB4A 3HAGA 3WD5A 5A6ZA 5BNNA 5JIAA 2WINB 4CDXC 1PO23 1F4AA 3MHZA 2RM22 3P6BA 2OT7A 4KBZA 5KHIA 1AL23 2JDNA 1MPXA 4GD4A 1VBB3 4JC1A 1C8M3 1WLTA 1Y7BA 2YB7A 4H14A 3ZSLA 5L7OC 4YFZA 3IMNA 1FNYA 1DYOA 1N1VA 1RUNA 2R041 2YBKA 2A6WA 1REDA 2DCZA 5KXCA 4KWLA 3S5AA 3HVDA 3JB4C 3LOIA 4XJWA 2VH9A 4AI0A 4ZXEA 4CE8A 2QQVA 5IVJA 5L9VA 4BE3A 4RGAA 3TEWA 2A3YA 1Z7S1 1XQNA 5DZFA 3C3VA 4EN8B 1BCXA 2D6OX 4QX8A 3I2JA 3ZN4A 1SPPB 1YEWA 2A6VA 3K4DA 4YVWB 1Z7S3 4CTEA 3LZZA 4B1LA 4NROA 4D6SA 4CDUB 3PVNA 2XHKA 2DWRA 4R4XA 1VE0A 2RS53 2D43A 3BALA 1ZRCA 3ETQA 3I54A 4CU6A 5F5IA 3A4UA 2BW8A 4A45A 5KXDA 3SHRA 2SBAA 1Q8VA 1DYKA 3NAPA 3ZXKA 3OEAA 2GALA 3RNSA 4LHNA 2VCMA 5FOBB 2ET1A 5K7PA 1W05A 1ZBA2 4IGPA 4NR1A 1FNZA 1AL0G 1U5ZA 1UQXA 3R4SA 5DUVA 4CUBA 1QJY1 3CKHA 4AVAA 3W58A 4AW7A 1V6JA 1NLQA 2WN2A 1UZVA 3LA7A 1S4CA 1VJ2A 1CAUB 5FAXA 3TEYA 3PLQA 5FREA 4JGYC 4D69A 1AXZA 5A7WA 3N9MA 1YQ8A 3O0VA 4EN6B 1OQEA 1QDOA 2V72A 1LULA 3BGAA 4K1YA 4YW3A 3VD4A 3I2HA 3DECA 4NHYA 5F5AA 5IVYA 1ASJ2 3QCWA 3V0BB 3OBAA 3S57A 2VW2A 5FPUA 4MLOA 2VZOA 1V9U2 1ND2B 3CHXA 4IUGA 2CAVA 5ANQA 4TLGA 1CJPA 1XNDA 4AGVA 1MEC2 2QQJA 1Y3TA 3WXPA 4LO5B 3HNBM 4K3UA 4DXZA 5IUQA 2D3SA 4G9SB 1ST8A 4XVHA 1S0JA 5IWFA 4WM8A 3ZKYA 1DQ4A 3RRDA 3T30A 4BJ0A 5HCAA 3K3OA 4AG4A 1KITA 1LOGA 1W6MA 4QQOA 3I3EA 1T6GC 3APBA 3ST7A 4AFBA 3R0RA 4YPJA 1ZA7A 1WD3A 4FFHA 2QQLA 5FZIA 3VDDC 1OLQA 5JI9A 1JHNA 1PX3A 2ZOEB 4IE0A 1SHWB 5I0RA 3MIHA 4L9BA 4QPIC 3RI8A 4CXWA 3UNPA 5JR2A 3VZLA 4NPRA 3VKNA 4OLLA 3MYXA 4Q27A 1BQPA 3GXUA 3KGZA 3DXUA 3VD5A 1MS8A 1US2A 2VMIA 2DYCA 5CA6A 3NJXA 3ELNA 1OVPA 4AFAA 2CGOA 4KGQA 1YJLA 3TOJA 5JMOA 4GH4A 5FP4A 2XLGA 3BYWA 4GULA 1ND2A 3ZR6A 4DEQA 1DQ5A 1GLHA 1QH6A 4IEUA 4FQ4A 2V4AA 5ANNA 5CFCB 4XMIA 2QTWB 1BEV1 4R9AA 4XMAA 3PIGA 4QB1A 3ZFEC 5JUVA 1X50A 2VMGA 1HB3A 4CEWA 2HWC1 1PGL2 4UBGA 5FMCA 1J58A 1OFSA 3AMPA 2TUNA 4HFSA 3MEPA 2E26A 5F37A 4LBQD 4XFFA 2PAEA 3LFMA 5FP9A 4YM3A 2WNVC 2VZQA 4FAGA 5C3PA 4XXAA 5B4XA 1E5RA 3RZZA 3MICA 4Q4X1 3R6SA 4QX1A 4QPIA 1WD4A 2RMU2 3ME2A 5A32A 5C9AC 1FATA 5LBFA 3URFA 1GSLA 4JZRA 1UN1A 4F3JA 3CL1A 5ABJB 4N7UA 5C70A 5IVFA 1BHGA 1YC61 3QOPA 1UCXA 1HX6A 1C57A 4CEYC 2VOXA 5IAXA 2VBBA 3HNYM 3LDKA 3MFCA 4F83A 2GH2A 3RYKA 5FZKA 1Y9MA 1VIWB 3FLRA 3ES1A 5FZEA 4DMIA 2VAUA 4GB32 4DRVA 3LE0A 3CO2A 3A22A 1I3HA 4UFMA 1U5IA 3AL5A 5A3LA 4GA9A 5T5JA 3ZYGA 4BHPA 4Q2FA 3FBYA 3SKVA 4CDWA 5BNPB 1LEDA 2XB6C 3H9AA 4XW3A 4WVVA 4CDUC 2ZEWA 4HG6B 4Q5OA 2QCSB 5C3OA 1NCRB 1VBD3 5FK7A 2VL4A 1K3IA 4RS5B 1H4GA 1SFYA 4CCMA 1QJU3 4QGMA 4LIUA 2W1UA 2BBVA 3CNAA 3H1MA 3UV9A 3VD7A 1RMU2 5FKCA 1PO12 4YVWC 2PAKA 3OB8A 4Z2WA 3AKSA 5GLVA 2W1WA 2MEV3 1W8OA 2XKPA 1CQ9A 3RZJA 4P9XA 5ACA3 5FXWA 2WNVA 3IIAA 4IESA 4QXHA 4DFSA 3NVCA 3PVOA 4XFCA 3WF4A 5DMYA 3VBHC 2JEMA 4QKFA 3H3ZA 3EHKA 5GLZA 4MZUA 5L19A 1UY3A 3PURA 2HWF3 5FXXA 4AI1A 1AYN3 2PHDA 2BOJA 5L7OB 1IOAA 1PZ8A 1PZ7A 2GU9A 1UIKA 2ZMLA 1WCKA 2BNMA 3FBMA 5FOJB 3I97A 1B35A 2FHRA 3WP5A 1J1TA 3D3AA 2ENRA 4DS0A 3WV6A 5KC6A 1ZRIA 2PA7A 5CADA 2YGMA 1MS4A 4YVWA 3HIFA 3E5UA 4RHV3 4XIKA 2XVGA 4BQ5A 1PMJX 4TXWA 2OQ7A 1GOGA 1SFNA 2VTFA 1HB1A 2WDBA 1C1FA 4XCAA 3ZYPA 3ZYBA 1QNYA 1WCUA 2QQMA 2WT0A 4XJ9A 4AHXA 4H7LA 2BDRA 1WCQA 4E8CA 4AQ2A 2W2IA 1W06A 2QZ3A 4HANA 1VBE2 3KT1A 4YW6A 1IPKA 2WLPA 2QKDA 1Y9QA 5FZLA 2WFPA 1XOYA 2MHFA 1ULPA 1WA6X 2RS52 3DYPA 4JHZA 2VPVA 1V6OA 5I8YA 1K5MC 2ZZJA 5LCWL 2D3RA 2DU1A 1QDCA 4HONA 1P8JA 4XJUA 1UZWA 1UOFA 1MZEA 4UXAA 1R092 2JG8B 4I0BA 4PF1A 4F8AA 1EV12 3K46A 4X8PA 4DINB 3M1HA 1N3OA 1IG0A 3ZXFA 4ASMB 3ZN6A 1WW6A 4IDZA 1BYHA 3J26N 4K9SA 3RWNA 1W39A 4YG3A 2G9ZA 4XFHA 4GKYA 5FY7A 1W6NA 4NIAA 4FPYA 4PDWC 3VBRA 4JGZC 4EN0A 2JDYA 1B35C 3VGIA 1NCQC 4Y20A 3WP4A 1W8WA 4QQ2A 4UFHA 3CMGA 4AHWA 2IXCA 2Y6FA 1MZ6A 3PU3A 2BGOA 4LKDA 3C7OA 4YM2A 4N9HA 1FI2A 1NA1A 2D6PA 2E51A 3PTRB 4UFKA 2VOKA 4AYUA 4LQRA 4Q0UA 4LE3A 3NJZA 1F35A 2YC2A 4XEZA 3JBG3 3THPA 3ZPYA 3C7GA 4DXRA 1LGNA 2AEYA 2JDUA 2PLV1 5CEHA 3H8XA 3KCYA 1RUOA 5CG9A 5FPXA 3ECQA 4LLOA 2P37A 1KJRA 3ZLIA 1V6MA 1TME3 3ENRA 4GH4C 4P00B 2JJ6A 5FBJA 1W8UA 1WLDA 1QJY2 2ZMNA 5LA0A 4MOAA 4FPLA 1BMV1 5KBFA 1NCQA 2WKKA 4K1ZA 4SLIA 5I0SA 5KXBA 3RZHA 3VDCA 4FPGA 1AUYA 1EPWA 4GWIA 1RHI2 3POJA 4QHZA 4CP2A 2EA7A 5CFDB 2Q1ZB 3RG0A 2MEV2 5FZ4A 1O6UA 1C5HA 1YFWA 2PHRA 2WC2A 2QQNA 3U14A 4O61A 2WLQA 3AZXA 3SH3A 5BPXA 1S1AA 1OD5A 1H8VA 4CYDA 1OMIA 2HEVF 4FFIA 4XFBA 1FYUA 1LU1A 1UY0A 2J7MA 2BNOA 1BVVA 2WNUA 2WZPP 1ULEA 4XHXA 1X82A 5HXMA 1ZRDA 4QM8A 5FO8B 2G4IA 4FBFA 4BQ2A 2P3KA 4HK8A 1KS5A 3IM0A 4KNCA 4Q4W1 3VBSB 2OQ6A 1UWWA 1OC1A 1G7YA 2R063 3VBRB 4LO8A 4S2DA 2EIGA 1TVGA 4N53A 4ZZ8A 2R061 1XNTA 5EV7A 4DEVA 3NMBA 2XMLA 2X05A 1GP4A 1VBD2 2EXKA 2NLRA 3WDUA 3MZHA 3ZX7A 1WBFA 2ZX4A 4RL7A 3OJBA 3O1VA 2D5FA 3WF1A 1VBA2 2CL2A 2CWMA 2WBKA 1SEFA 5CBLA 4Q0PA 1J84A 1JOBA 4LBJA 4YYOA 2ZMKA 2BU9A 1MS1A 2B9UA 2RS13 3A0NA 1SBEA 3B02A 5EFUA 5FP7A 2RM23 3WEZA 5HCHA 2VMFA 4WVMA 3VD3A 1AL22 4OHYA 2ZPXA 3LAGA 2Y0OA 1O8PA 4QKDA 5DABA 1AL21 1LOFC 1TMF3 4FPCA 4ES9A 3T4VA 4YW5A 1ALYA 5FZ9A 4AXOA 3OTFA 4OZOA 4EWAA 1HQWA 1TZOA 2XHNA 3JQWA 1PK6A 3RJ2X 1TMF1 3V65A 5EYYA 1JOPA 4KG0A 4AEDC 5IVCA 2PQQA 2XJRA 5FO9B 5FZCA 5GZEA 4JDNA 1AR72 4QKNA 4HETA 5J7MA 4YW7A 1MZFA 3POEA 5FY9A 1DQ6A 1UYPA 4JCKA 2MNGA 1LECA 4Z8BA 5C8CC 5FYCA 4L8QA 1AX1A 1I5ZA 2P2KA 2A73B 4YFWA 4UOJA 5A33A 1OUSA 1VPHA 5L7OA 4NHKA 2BUKA 4XF1A 4E9KA 1EYBA 3OPTA 4Y22B 1OT5A 1VB2A 2YFUA 2FDKA 3VBFA 1O7FA 4GXLA 4COZA 3O1OA 4HSLA 2B7YA 4CCKA 4P9YA 4Q8LA 1FXZA 3H1YA 4I0WB 1RUD3 1XYNA 3AP7A 1S0IA 1W99A 4LIVA 3T0DA 2WA3A 2GMMA 2ZGOA 1ZZ9A 1RUF3 4GWMA 4IE6A 1GICA 5DUUA 5FXZA 3BTXA 1GWKA 3NV3A 2VJXA 3WQBA 3PMEA 1UOJA 3CZJA 2XVLA 1ULOA 3IDEA 3ZN5A 5CISA 3CZUA 2XQRA 1H1IA 2EIEA 4IV3C 2RR13 4RS5A 3ZSMA 4XFIA 4A7YA 1C4RA 1DBNA 2DCTA 1V9U1 2V5DA 4XDQA 2AH2A 2B42B 5FY0A 1DZTA 2D93A 3VKOA 4E2GA 1X33A 4DUXA 4R52A 1YIPA 1FPN3 1V9U3 4JDMA 2E7AA 4WM8C 2LROA 1ODMA 1LKNA 2W1QA 5DAVA 1PO22 2WFF2 3WINE 5C8CA 1UU5A 4FI9A 3EB7A 1JU3A 3J7LA 5FYYA 4QDQA 2VQUA 2DVAA 4HMZA 3P5BA 1XSRA 1N1SA 3F95A 4HT1T 5F2SA 3USUB 3AJYA 3VBOA 2YZ4A 4DUWA 2P3IA 1BEV2 4GIQA 5DAXA 4OQ9A 4XUTA 4YZ2A 4X6QB 1QGLA 3VBHA 1QJFA 2JG8A 3ATGA 1FOD1 3DXTA 2FMDA 1GWLA 4ZU4A 2R1DA 4JGZA 3NNMA 5B4NA 4A3ZA 1NAEA 3WUDA 1OOPB 5LY2A 1AJKA 4GJZA 1W6MB 3LIHA 4J1WA 5E1RA 4D0QA 1AR83 2DCJA 3MIGA 4U2AA 5I0DA 1M4WA 1UF2C 4RS5C 2Q8DA 3UYJA 2ZCWA 2RR12 3PIJA 2VZTA 3T0BA 1AR81 3N7MA 3O0WA 5A32B 2R30A 2GMEA 1IPSA 4MVTA 1SLAA 4XBQA 3RMXA 2P5BA 1C1LA 1UW8A 1S0GA 3M4FA 1AR73 2YC0A 3AMNA 3IPVB 2JIJA 4FPFA 5FBZA 1JYIA 3AKRA 3KF5A 5BV6A 5A1FA 2DVDA 4CP0A 2IFWA 1E5IA 4KL1A 4NOTA 4CDQB 3I59B 3LIGA 4MGIE 3IN9A 3USSA 4I02A 4RQPA 5KC5A 1QF3A 4P14A 2P6CA 1CD3G 4ORFA 2Y6KA 3AYDA 2FZ1A 1UAIA 4FPJA 1W2AX 4BXSV 4CZSA 4M3CA 1F5JA 4DB5A 5CAZA 2NMOA 1O4ZA 1W3VA 1W0OA 1QHDA 3UK9A 5CFCA 1LHUA 5AVAA 4K8RB 3U07A 1EP0A 4AEDB 3M8LA 2ATFA 4YZ4A 4COYA 3SCFA 1RUG1 3ZSJA 3ZKUA 4CU8A 4QPYA 5KHHA 2Q0AA 1NY72 3DUIA 2AGSA 2IXHA 3NRUA 4Y1YA 4D6RA 1RHI1 1QXPA 3ACGA 2A6YA 3B94A 2UU8A 1RUI2 3TN93 4CCEA 4Y1UA 5FJHA 3JBG2 2WN3A 3U11A 5J37A 1JH5A 2C1FA 2VNGA 2G1MA 1HW5A 2HWD1 2TEPA 3KVAA 5EJ1B 3RPQA 2QZ2A 1HXS1 5D1IA 2EXIA 2WAAA 1BXHA 3SITA 1G9DA 4Y33A 1CPMA 1PNGA 1PGW1 1XC6A 1ACCA 1E57A 2VR4A 5IJRA 3ZFEB 5BNPA 2RDQA 2XGXA 1HXS3 1TME2 1C28A 5EWSA 3E6BA 3THCA 1K12A 3UGHA 5BNQA 3WHUA 3PNAA 1NCRA 2JD4A 2I74A 5DDJ2 3WNKA 1W3XA 4K8FA 4B4RA 3MW3A 2VUDA 5IYYA 2YU1A 3NV1A 1D0HA 4JVAA 3J8F2 2VXJA 3POSA 3FL7A 1EV11 2E6VA 3B01A 1HV0A 1VMJA 2ZGLA 2GMPA 3BKZA 1W03A 1NOVA 3MIBA 3DKWA 4FPEA 3O14A 3Q8EA 4H2AA 3DN7A 3PUIA 3T3YA 5I8TA 5JI7A 2JE9A 2NPIA 2RDRA 5DAPA 2P3JA 2NN8A 3AK0A 5FUNA 3VZMA 1JS9A 1POQA 2F4PA 3LB9A 1MS0A 4HLTA 4OI2A 4Q0SA 3VDAA 3T0AA 1YJKA 4JHTA 4V2VA 3IIIA 1GOFA 1G9AA 1W04A 3AP4A 5K0UC 2XL7A 1OA3A 2B8MA 3I3BA 1ENXA 2BWCA 1EY2A 4FPOB 3QLQA 4AQSA 4QPIB 1GZWA 2V5YA 1G8WA 3GZUC 2JDKA 3SCHA 1B09A 4CPBA 1R1ZA 1UZYA 5DAWA 5FMOL 3WSOA 5JAXA 3O1SA 2HWF1 2FQPA 4GALA 2BVBA 1X8MA 1QXJA 3LPFA 4HL0A 3ON7A 4RD7A 3TEZA 5JMCA 2CNAA 4PLOA 3VHNA 3Q8CA 3ZXJA 3JCIA 4IGQA 4MXVA 4B29A 3E6CC 5F3GA 2VUJA 5TSWA 2Y34A 3VBSA 1WCDJ 4XHBA 1YUDA 1BK0A 3TEXA 2XONA 1H2MA 1U12A 4JV4A 5F39A 4BH9A 4JQTA 3QACA 4G3YC 3BTAA 1PNFA 3K4AA 3NQHA 1ASJ3 4GQ7A 5JOYA 3AP6A 2BTVC 4A4AA 4XE9A 4XQWA 4Q4V3 1C3HA 2ZXQA 4C8DA 1ASJ1 4CCLA 1IQDC 1QOSA 2EALA 2GC2A 4P9JA 1E5HA 1GQPA 1PO11 2NZ9A 1RUJ3 3AFKA 4BQ4A 3E5XA 5JIUA 1PMIA 2R043 4QPWA 3ILNA 5FDBA 1ZVFA 5FFOC 4PI0A 2CU5A 1PVC2 1FMD2 5JOWA 4PJYA 4QWNA 4F7ZA 4LBLA 4CDQC 2ZA9A 2YGLA 3HN1A 1CWPA 5T3NA 5L9RA 2FDGA 1S55A 3KSCA 1W6PB 3VBRC 1A6CA 1SQ4A 5JSOA 2JWPA 4AOCA 4B3NA 3NNGA 3ZPOA 1E5SA 3Q8FA 3ZYFA 4GB31 4OULA 1DQ2A 2EICA 3C7HA 3DPRA 2WSVA 3NW4A 1VBE3 5CKMA 5DQ0A 4YVSA 3ZFGC 3SEPA 2J1SA 1S0DA 4WM7C 1W9SA 1Q56A 2HKXA 2W5FA 5FYTA 1RC6A 1RTVA 4N43A 5CZKA 4FQZA 2NM1A 1L3JA 3RS6A 5FLIA 5A7PA 4AVVA 1VR3A 4QXBA 5F6KA 1AXYA 3H42B 5EQUA 3KV6A 2IXJA 2JD9A 4YZ3A 2XWJB 5GJ6A 3BOPA 2B4KA 3JU9A 4KU8A 4TN7A 5DPNA 4KGGA 5AFEA 3RZGA 4IETA 2QDNA 1SBFA 3HQUA 2H6CA 3VBFB 1IS4A 5C71A 3HQRA 4Y22A 3RYRA 2PLV3 4NE9A 3SH4A 3UL2A 4IERA 2KR2A 3S7EA 1XU1A 4AFCA 4DPNA 3J9SA 5EHDA 1LOCA 4Q4Y3 1LU2A 3C7EA 3D0SA 1MR5A 2H0BA 1ENSA 1AHSA 2VVEA 1JYTA 1PIV3 2GN3A 2R0FA 1RUC3 5A6QA 3RZKA 1JUHA 1VBA3 4DO0A 3DPRB 5L36A 5J36A 2DCYA 3D5OA 4Z1VA 5J96B 3PVBB 1WGPA 3J4UH 1QJX3 4W6YA 3G7DA 3OGGA 5IFPA 4LE4A 5BNOB 1Y43B 4UAPA 4K21A 1CX4A 1NLSA 2QVSB 1UX6A 3POWA 4CCNA 5JR7B 3T4HB 4BMEA 1H8TB 2Z5WA 2JDPA 1RUD2 3S5QA 1JZ7A 3BOWA 2OKXA 5C4WB 1O4YA 3RVHA 4YG0A 2ZKNA 4CUCA 2AR6A 2YBSA 4LK7A 4K40A 3QBQA 4D8MA 5A3UA 1OOPA 1GANA 1PK6B 1RUE2 2PN5A 2XJTA 3O7OA 3D82A 3WDWA 3AX4A 4CXYA 4IEVA 4IV1A 5SV8A 3H3UA 3GZAA 5F9TA 3KCXA 5JXGA 3BU7A 5F5QA 1XRUA 1NA1B 5LZ6A 1X9PA 4ZHNA 1OFNA 4E2QA 3I2FA 5FPBA 3UGGA 4HZFA 2OXBA 2WIIB 1APNA 4CEYA 1UMIA 1XU2A 4BIOA 1O5UA 1GBGA 2V73A 1W6QA 2X10A 3SQOA 5LK7B 2ZKLA 5FUIA 2HEWF 4I3PA 2ZX3A 2A70A 2ZJCA 1TMF2 4KH9A 2RMU3 5GZGA 1RJ8A 1W6QB 2Y33A 3I7DA 1D2QA 4DZGA 4FTSA 1LGCA 4HVOA 3AKTA 3K3NA 2JDHA 2VVFA 4OHXA 3MUZ1 2RS32 2FZ2A 4COWA 1CAWA 4OHVA 1S0FA 4KMQA 2DFCA 4QPGA 2VCCA 5F3CA 2OUJA 3QH6A 2WYSA 3O0XA 4CVUA 5T5PA 1COV2 3M3CA 5GALA 5C9AB 1T6BX 1DGWX 3LWCA 4AI2A 2VZUA 3OD0A 4NAOA 4Z92B 4AVBA 4H7MA 4IEOA 3DEMA 3FHQA 1LTEA 4KG8A 2Y8KA 4PHZA 3UGFA 1VBC2 1VAVA 1XNKA 4M01A 4MX3A 3NNLA 2DBIA 4JRLA 4FPKA 5I93A 5FPAA 3JXSA 2LALA 1OPMA 1NE6A 4NO4A 3QD6A 3OF1A 1QQP2 3LEIA 1OPOA 1GU3A 1Q5OA 2VQ0A 2JICA 2WWSA 5FZ0A 5FZGA 4YZ1A 4XDPA 3I3MA 1G86A 1T2XA 4NRPA 1OLMA 2VUAA 2VZ1A 4ONUA 3B5LB 3TRSB 4EZ4A 5KHJA 2DTYA 4KI5M 3SISA 4UYBA 3OPWA 4CP9B 1AX0A 2E53A 2D6KA 3UJOA 2ZEZA 1V0AA 2MPFA 3AM2A 4O9GA 3O1TA 4FXKB 2ARCA 1V6IA 2GNMA 2D6MA 4NRQA 3WQ7A 1ULDA 4OCTA 1SBDA 2Y6GA 4R9CA 1XXNA 4G4FA 3ZFEA 1RXGA 1LODA 4NHMA 1STMA 3DV8A 4I30A 4B4QA 1L7QA 3UT0A 4AWDA 3J8F1 1O3RA 3T09A 1AYM2 4C0HA 3EO6A 1ZREA 5IHRA 4HK9A 1G9CA 2VCBA 3OSDA 1H30A 1MQTC 4BK4A 1OOPC 3UJQA 4PLMA 5LATA 2ZAAA 4C1WA 3PHMA 5ACA1 4MXWB 3PVEA 4M0NA 1W6NB 3IBMA 3UKTA 1PZ9A 1HXS2 5CIRA 3HMYA 4RR3A 2AUYA 5D8AB 5H9PA 3JD71 4BMBA 3CDZB 2XLFA 1FPN1 2OPWA 3GF6A 5A3PA 3WW3A 4AVSA 1W2UA 2CGNA 5LK5A 5K8SA 1ENQA 1M06G 4XUPA 3LDRA 2F4LA 3WG4A 4OI4A 4UFIA 4AGRA 5FMDA 3ZXDA 4DOUA 2QQPA 1BJQA 1H6XA 3KVBA 5IAVA 2R073 3T1MA 2GP5A 4QQHA 5FYMA 4XUQA 2D40A 2VMDA 4QDSA 1LOEA 3BIWE 4NIGA 1ONAA 5DUXA 5FY5A 4XXPA 1W2NA 4DXTA 1GP6A 3WF0A 1YLLA 3WNOA 3POFA 3G6JB 4JDOA 5EYXA 4N7IA 3TNPB 1G9FA 3OUHA 5F2WA 3VDBA 1CAXB 4GMP0 3W59A 4AEKA 4EE2A 1ENRA 1HRI1 3A0KA 5JPNB 3GCXA 3B3QE 4LTAA 1ND3B 1AR93 5F1RA 1OF3A 2RV9A 4QM9A 1PVXA 1NXD1 4BDVB 4CCCA 2GZWA 2YUEA 3MLJA 2YROA 4TYSA 3ZDSA 2ZS6B 2C0ZA 1LNSA 4XBNA 3CF6E 3LF7A 1H6YA 1QJZA 2LTNA 2ZHMA 4XF4A 5I91A 1RMU1 2ZGUA 3NKTA 1CIYA 4CEWB 2Y38A 1QOOA 4GMP3 1VRH3 2G19A 3RI9A 5JZGB 1LOFA 4LO4B 5H9QA 3SC7X 4JQRA 3BVCA 2BNNA 3GHMA 2B5HA 5E6HA 3WW1A 3Q9OA 1DLLA 1Q8PA 4LUMA 4J6GA 3LEMA 5F3IA 4JX0A 4OHZA 5ISLA 2FBEA 3HNMA 4A41A 4ASKA 3A7QA 2Y60A 1NXMA 3IZOA 4XURA 4ZKTB 2WAOA 4J25A 4RHV2 1FMD3 5LRRA 1HRI2 1D2SA 1COV1 1J3RA 3WF2A 3FUOA 1BVP1 3FFZA 3IMMA 4PIZA 4FOVA 3ASIA 3GJAA 2JE8A 3NAPB 2FCVA 3ZIXA 2QQIA 3N4MA 1VALA 2YBPA 3AYCA 1DHKB 3NJYA 1FOD2 4FOWA 1LOAA 4Z2AA 1XPWA 1VBC1 4J1XA 2PHLA 3PUHA 4LULA 3C2UA 2BFUS 1NLRA 3M3EA 1JZ3A 2N7GA 2WABA 2DBNA 3M2MA 4MO3M 1S2KA 2A71A 2XWBB 5FZ3A 1PHMA 3SEEA 2HJIA 1DYPA 1RUI3 2VZVA 2CSGA 4L92A 4KBBA 4AHYA 5BNOA 1HDKA 2BFUL 1YI9A 2E7QA 3SKJE 4CSWA 3MDPA 3D8CA 2KA3A 2ZGTA 2W9XA 3GNEA 4NRMA 1SG3A 4RSUA 3DKQA 2YYOA 4QMAA 1AYN2 3TNQA 2O8OA 2AEZA 4GJYA 1DZRA 1SLBA 3MGUA 4B8EA 4ET7A 2RJLA 4IEZA 1NCRC 1W0NA 3V56A 1RINA 3MIEA 4AAPA 5GM0A 3OBRA 4R4ZA 2GC3A 4NAMA 3KLSA 5FZMA 4E8DA 5HBAA 1DIWA 3OUIA 1SDDB 2A5ZA 5JOXA 1NA1C 1FV3A 2LW8A 5IATA 1I6XA 1YYNA 4XILA 2SLIA 4Q4W3 3U37A 2CTVA 1REEA 5FP8A 3X29B 1GUIA 5A7NA 1RUH1 1POV1 2HWB1 3T2TA 2WRAA 1VAKA 2VUCA 1OKQA 4LITA 5C4WC 2PHXA 2C9KA 2GC1A 2Y6JA 5K4LA 3LSEA 4QX2A 1AXKA 4GWNA 1VMHA 5FYSA 3BPSA 3THDA 3EYPA 3LCPA 5IW0A 2OS2A 3CU7A 3HPNA 3UKVA 2XJSA 4DRRA 5IVVA 1SPPA 1CN1A 1J3QA 2RDNA 2ZX2A 4ZS2A 2A3WA 4Y1ZA 2JG9A 4M3CF 4CEYB 5C5TA 1MVEA 1PGW2 2GSYA 4YGBA 5FRAA 1VBB1 3N7LA 1SDWA 4Q4V1 3V0AB 5A3NA 5FZBA 3OPZA 4IQPA 3GBWA 1FAYA 1MS5A 1W9TA 4PDWA 4AVCA 4FTBA 1PO13 3EMRA 3N7KA 4QGNA 2WNUC 5M0TA 4BQ3A 3USUA 4XZUG 1URXA 2WQ8A 4QHOA 2DCKA 3NV4A 5JPMB 2YU2A 3WW2A 1UPSA 4IL7A 5F5CA 3ZFFA 2DVFA 2QDRA 5KHKA 2VZSA 4CDXA 1W9FA 2HWF2 4P9GA 2D7FA 4Y3OA 2BPA2 5C4WA 3AKPA 2W1SA 1POV0 2XG3A 1R091 5CFDA 5T55A 4BLJA 5FP3A 2JG9C 1Q3EA 2VNOA 2CAUA 4D6QA 3U75A 3V64A 2J1TA 1AYM3 2HWE3 2LM3A 2TNFA 4I09A 1UOBA 1ZYBA 3NJVA 2HLEA 1WLCA 4IGOA 3H3LA 1WUVA 3TWIA 1AYM1 1X7NA 3H8UA 5L73A 1R083 2OZ6A 5BYNA 1OURA 1VAMA 2H0VA 5A3TA 4MXWA 3RZMA 1LJ7A 1UU4A 1KQRA 1HKDA 3W5NA 2EF6A 3KV4A 2VOWA 3KT7A 1N1YA 1YQ6A 2PHUA 1CAUA 2YV8A 2ZAHA 3BPZA 4K20A 1KFUL 3I3DA 2OUHA 1PIV2 4JTNA 1BBT1 4WVZA 3OGRA 2NQYA 1H8TC 3MIDA 4ZPIA 4I3GA 1C8M2 1JYWA 3TYJA 5JXJA 3OGJA 3POGA 1WCSA 2EIBA 1BBT3 1O91A 4YVSC 3THTA 3IAPA 2RG4A 2Z4FA 5CU1A 4W6WA 3B93A 1OKOA 3M3QA 3PJQA 2XJVA 2IXKA 4RQPB 4FXGB 5IK8A 4L97A 4IEWA 2E63A 3POYA 1TQ5A 1CESA 2FDIA 5C3QA 3LEKA 3M7AA 4M00A 2GAUA 4GWJA 5LBEA 5J3UA 4D7SA 4BYYA 3AXEA 2PHFA 2WR9A 3NSTA 5F6LB 3VZKA 1RUC1 1VBA1 2UWBA 1ULCA 3UETA 3TN92 5DG1A 1S0EA 3VDDA 1V00A 1W8ZA 5DZGA 4AI8A 5KWRA 2XPJA 1QXRA 3ZM8A 1GZCA 2UWAA 1Q43A 5EJ3A 1ZZBA 4UBHA 1SZBA 1OLME 2XUEA 1IGOA 2E31A 4A3XA 1HQNA 2C26A 4CU9A 1FOD3 1FPN2 3K2OA 1LHOA 2G9GA 4ASLA 5CVRA 2RS12 5K0UA 1SCRA 1N47A 4Q0VA 1EUTA 2FMYA 4FCAA 4YG6A 5GKAC 4EROA 5CFCC 1CIWA 4RGGA 5BY5A 1F31A 5FYIA 5FLJA 1A8MA 1JI6A 4FSJA 2VNVA 1BLZA 4BQWA 1KXGA 5A3WA 3BB6A 4URAA 1YXWA 4BM8A 1WW4A 2E32A 5C33A 4URTA 1WMEA 5FMBA 4N9IA 5FZDA 4AL9A 2X8KA 2Z69A 4A7KA 4K6BA 3VHRA 1AR71 1WLWA 2ID4A 2J1EA 4C91A 4CEWC 4QHBA 1O3TA 1OA4A 3WCRA 4QAWA 5IVBA 2DV9A 4Y26A 1ODNA 3SXWA 1RUE3 1IKQA 1MEC3 3FHIB 4KQ7A 1N3PA 1JYVA 5T52A 3MW4A 2JX9A 1A8DA 5JWPA 1RUE1 1UKGA 3J7MA 4YNIA 4TWTA 4AEMA 5E88A 5C6CA 4O7XA 2GNTA 4QX3A 1TEIA 3WQ0A 1GFF2 5CKNA
chains in the Genus database with same CATH topology
2J1RA 4OUEA 2E26A 4CUAA 2VZRA 1F4HA 1I5PA 2VZQA 3DYOA 5B4XA 3NNGA 1J83A 4QX1A 5LA1A 3C7HA 2EICA 3DYMA 5DQ0A 3WNPA 4RN5A 4OYUA 3T2OA 3SEPA 2J1SA 5J1XA 1W9SA 5C70A 1BHGA 2VC9A 2W5FA 1O8SA 2CDOA 5CZKA 4QB6A 5LA2A 2WO2A 3W5MA 3HNYM 2JD9A 2B4KA 3C7FA 3MO4A 5DPNA 3LE0A 3K4ZA 3A22A 1PX4A 3SKVA 5C71A 2ZEYA 2VMEA 2J22A 2ZEWA 4HG6B 3OEBA 2X09A 3AC0A 3IB3A 2Y64A 2VL4A 5JXIA 1K3IA 4DUVA 3C7EA 1HN1A 4AAXA 2VCAA 1K42A 2W1UA 2WO1A 3VD7A 2L9LA 2BBAA 3OB8A 2W1WA 1W8OA 5IFPA 4UAPA 2VOTA 3WF4A 5DMYA 3OG2A 3A23A 2QBXA 1JZ7A 1CZSA 5G04L 1UY3A 1CZVA 1R64A 2OKXA 1UX7A 4CUCA 2HYXA 4D8MA 3I97A 1K45A 3J7HA 3D3AA 3LEGA 3IAQA 5JXGA 4P02B 3I2FA 2EIDA 1PMJX 4TXWA 1GOGA 5A1AA 2VTFA 1JU4A 4A42A 3A21A 2JKXA 2WDBA 1UY1A 1UMIA 2QQMA 3P1IA 4PT6A 2X10A 4OMCA 4RYDA 1EUUA 1WCQA 2W91A 5FUIA 4E8CA 3VD9A 4CU7A 4JHZA 1ULPA 3MUZ1 2VZPA 3DYPA 5C7GA 5IFTA 4KMQA 2VCCA 5LCWL 1YQ2A 2WYSA 4CVUA 1P8JA 2VZUA 4PF1A 3K46A 4LHSA 3FHQA 4TTGA 1NKGA 3C8XA 4W8JA 2Y8KA 1NX9A 4W50A 3I2KA 3JXSA 3LEIA 4XUOA 1GU3A 3CMGA 2WZEA 1OF4A 5JXHA 1OH4A 2BGOA 1T2XA 3C7OA 2WUHA 2VZ1A 1KEXA 3MV01 4KI5M 5HPOA 1L7RA 4LQRA 2ZEZA 4MADA 2YC2A 2RVAA 3C7GA 4DXRA 3MBWA 1JZ2A 2XOMA 2Y6GA 3ECQA 1L7QA 2W3JA 4P00B 3T09A 5LA0A 1JZ5A 4MOAA 4JKKA 4QB2A 1JHJA 5IHRA 1UY4A 2VCBA 4BK4A 3VDCA 4GWIA 1OD3A 5F7UA 1KGYA 2KD7A 3HEIA 1GNYA 2QQNA 3BN6A 3CDZB 3T2QA 4BK5A 1JZ8A 2W95A 4XUPA 1GOHA 1UY0A 2J7MA 1JYXA 1H6XA 1UYXA 5HXMA 3ETPA 4XUQA 1JZ6A 2VMDA 4QDSA 4QDRA 5DN2A 1UWWA 3HOBA 3UESA 2VO5A 4W4ZA 4DXTA 3WNOA 3WF0A 1TVGA 4OMDA 4ZZ8A 1XNTA 2Y6LA 4DEVA 2QQKA 1UXXX 4GZ9A 3WNNA 2X05A 2YG0A 5EJZB 3VDBA 2J1VA 4XUNA 2WO3A 3OGSA 4P08A 1CX1A 3WF1A 4UI9L 2WBKA 1J84A 1OF3A 2RV9A 4BDVB 2J1AA 3LPGA 2DDUA 1LNSA 1H6YA 1US3A 3WEZA 2WZ8A 2VMFA 1CIYA 3VD3A 2JDAA 1O8PA 3HN3A 4ARXA 4OZOA 2XHNA 3FN9A 3GDBA 4JX0A 2ORZA 3HNMA 4A41A 3A7QA 3F2ZA 3OGVA 3WNMA 4XURA 2YFZA 2WAOA 2W92A 1JZ4A 1UZ0A 2XQXA 3ACHA 2LS6A 3WF2A 3K75B 3I2GA 2JE8A 3IDAA 4LKSA 1W8NA 2QQIA 4ZY9A 4UOJA 3FHAA 4Z2AA 1OT5A 2YFUA 1XPWA 3PUHA 5G05L 1TG7A 1JZ3A 2E33A 2WABA 4P5YA 1W99A 2C4XA 3T0DA 2QQOA 4MO3M 3ACIA 1UY2A 2VJXA 3WQBA 3CZJA 3SEEA 1ULOA 2VZVA 3CZUA 2EIEA 2BZDA 3HJRA 3ACFA 1XNAA 3SKJE 2R7EB 2W9XA 1SG3A 2V5DA 1D7PM 4DUXA 4JKLA 2W47A 2ZEXA 1DLCA 2W46A 4ET7A 2W1QA 3MV11 1W0NA 4FI9A 3EB7A 2W94A 1JU3A 1PMHX 4MGQA 5CYYA 4E8DA 4QDQA 2VQUA 3CIHA 1SDDB 1UMHA 2LW8A 3GGLA 4DUWA 2CDPA 4XUTA 3U37A 1RYYA 4ZZ5A 1GUIA 3T2PA 3GM8A 5B4NA 4A3ZA 1NAEA 3WNLA 2C9KA 2Y6JA 2ORXA 1UYZA 4D0QA 1UXZA 4QX2A 2DCJA 2Y6HA 5I0DA 3THDA 2YC4A 3EYPA 1JYNA 2VZTA 3T0BA 3HPNA 5EIYB 2VM9A 4L0PA 3LQCA 3WF3A 2J1UA 1F4AA 3P6BA 1MPXA 1W9TA 2YB7A 3MUY1 1DYOA 2Y6KA 4BXSV 4JKMA 4XZUG 2WQ8A 3K77A 2DCKA 1WKYA 2B9VA 4ZXEA 2VZSA 3I2JA 4CU8A 2W1SA 3K4DA 3NRUA 3ACGA 2J1TA 2WN3A 2HLEA 3NJVA 1CZTA 5EJ1B 4QX0A 4CU6A 2WAAA 1DP0A 1XC6A 2VR4A 5IJRA 2W87A 4A45A 3W5NA 3THCA 1K12A 3OEAA 1NUKA 3WNKA 4MGSA 3I3DA 4CUBA 5IYYA 3CKHA 3I2IA 2WN2A 3OGRA 4KWUA 1JYWA 3FL7A 5JXJA 3E1F1 4M4RA 2EIBA 3IAPA 2V4VA 2Z4FA 3PUIA 3CQOA 3VD4A 2V72A 3BGAA 1UYYA 3I2HA 3DECA 3LEKA 2BGPA 4GWJA 3OBAA 1GMMA 2VZOA 4IUGA 4ARYA 2VMCA 3VDAA 2BERA 3T0AA 3UETA 2QQJA 3IIIA 1GOFA 3HNBM 2VZ3A 3ZM8A 3I3BA 4XVHA 2E31A 4BJ0A 3T08A 4PQQA 2PQSA 4CU9A 2C26A 4AG4A 1O59A 3WSOA 3I3EA 1W9WA 4YPJA 3LPFA 1EUTA 2QQLA 1PX3A 1JI6A 1SHWB 3UNPA 5JR2A 4DXSA 4LPLA 3GXUA 2E32A 5JMOA 3VD5A 3ABZA 1US2A 2XONA 2VQTA 3NJXA 2ID4A 2J1EA 3K4AA 3NQHA 2RJ2A 4QAWA 4A4AA 4M4PA 4DEQA 2ZXQA 4A44A 1IQDC 1GQPA 1JYVA 4A6OA 4QPWA 4QB1A 5JUVA 4QX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J1R A;  4OUE A;  2E26 A;  4CUA A;  2VZR A;  1F4H A;  1I5P A;  2VZQ A;  3DYO A;  5B4X A;  3NNG A;  1J83 A;  4QX1 A;  5LA1 A;  3C7H A;  2EIC A;  3DYM A;  5DQ0 A;  3WNP A;  4RN5 A;  4OYU A;  3T2O A;  3SEP A;  2J1S A;  5J1X A;  1W9S A;  5C70 A;  1BHG A;  2VC9 A;  2W5F A;  1O8S A;  2CDO A;  5CZK A;  4QB6 A;  5LA2 A;  2WO2 A;  3W5M A;  3HNY M;  2JD9 A;  2B4K A;  3C7F A;  3MO4 A;  5DPN A;  3LE0 A;  3K4Z A;  3A22 A;  1PX4 A;  3SKV A;  5C71 A;  2ZEY A;  2VME A;  2J22 A;  2ZEW A;  4HG6 B;  3OEB A;  2X09 A;  3AC0 A;  3IB3 A;  2Y64 A;  2VL4 A;  5JXI A;  1K3I A;  4DUV A;  3C7E A;  1HN1 A;  4AAX A;  2VCA A;  1K42 A;  2W1U A;  2WO1 A;  3VD7 A;  2L9L A;  2BBA A;  3OB8 A;  2W1W A;  1W8O A;  5IFP A;  4UAP A;  2VOT A;  3WF4 A;  5DMY A;  3OG2 A;  3A23 A;  2QBX A;  1JZ7 A;  1CZS A;  5G04 L;  1UY3 A;  1CZV A;  1R64 A;  2OKX A;  1UX7 A;  4CUC A;  2HYX A;  4D8M A;  3I97 A;  1K45 A;  3J7H A;  3D3A A;  3LEG A;  3IAQ A;  5JXG A;  4P02 B;  3I2F A;  2EID A;  1PMJ X;  4TXW A;  1GOG A;  5A1A A;  2VTF A;  1JU4 A;  4A42 A;  3A21 A;  2JKX A;  2WDB A;  1UY1 A;  1UMI A;  2QQM A;  3P1I A;  4PT6 A;  2X10 A;  4OMC A;  4RYD A;  1EUU A;  1WCQ A;  2W91 A;  5FUI A;  4E8C A;  3VD9 A;  4CU7 A;  4JHZ A;  1ULP A;  3MUZ 1;  2VZP A;  3DYP A;  5C7G A;  5IFT A;  4KMQ A;  2VCC A;  5LCW L;  1YQ2 A;  2WYS A;  4CVU A;  1P8J A;  2VZU A;  4PF1 A;  3K46 A;  4LHS A;  3FHQ A;  4TTG A;  1NKG A;  3C8X A;  4W8J A;  2Y8K A;  1NX9 A;  4W50 A;  3I2K A;  3JXS A;  3LEI A;  4XUO A;  1GU3 A;  3CMG A;  2WZE A;  1OF4 A;  5JXH A;  1OH4 A;  2BGO A;  1T2X A;  3C7O A;  2WUH A;  2VZ1 A;  1KEX A;  3MV0 1;  4KI5 M;  5HPO A;  1L7R A;  4LQR A;  2ZEZ A;  4MAD A;  2YC2 A;  2RVA A;  3C7G A;  4DXR A;  3MBW A;  1JZ2 A;  2XOM A;  2Y6G A;  3ECQ A;  1L7Q A;  2W3J A;  4P00 B;  3T09 A;  5LA0 A;  1JZ5 A;  4MOA A;  4JKK A;  4QB2 A;  1JHJ A;  5IHR A;  1UY4 A;  2VCB A;  4BK4 A;  3VDC A;  4GWI A;  1OD3 A;  5F7U A;  1KGY A;  2KD7 A;  3HEI A;  1GNY A;  2QQN A;  3BN6 A;  3CDZ B;  3T2Q A;  4BK5 A;  1JZ8 A;  2W95 A;  4XUP A;  1GOH A;  1UY0 A;  2J7M A;  1JYX A;  1H6X A;  1UYX A;  5HXM A;  3ETP A;  4XUQ A;  1JZ6 A;  2VMD A;  4QDS A;  4QDR A;  5DN2 A;  1UWW A;  3HOB A;  3UES A;  2VO5 A;  4W4Z A;  4DXT A;  3WNO A;  3WF0 A;  1TVG A;  4OMD A;  4ZZ8 A;  1XNT A;  2Y6L A;  4DEV A;  2QQK A;  1UXX X;  4GZ9 A;  3WNN A;  2X05 A;  2YG0 A;  5EJZ B;  3VDB A;  2J1V A;  4XUN A;  2WO3 A;  3OGS A;  4P08 A;  1CX1 A;  3WF1 A;  4UI9 L;  2WBK A;  1J84 A;  1OF3 A;  2RV9 A;  4BDV B;  2J1A A;  3LPG A;  2DDU A;  1LNS A;  1H6Y A;  1US3 A;  3WEZ A;  2WZ8 A;  2VMF A;  1CIY A;  3VD3 A;  2JDA A;  1O8P A;  3HN3 A;  4ARX A;  4OZO A;  2XHN A;  3FN9 A;  3GDB A;  4JX0 A;  2ORZ A;  3HNM A;  4A41 A;  3A7Q A;  3F2Z A;  3OGV A;  3WNM A;  4XUR A;  2YFZ A;  2WAO A;  2W92 A;  1JZ4 A;  1UZ0 A;  2XQX A;  3ACH A;  2LS6 A;  3WF2 A;  3K75 B;  3I2G A;  2JE8 A;  3IDA A;  4LKS A;  1W8N A;  2QQI A;  4ZY9 A;  4UOJ A;  3FHA A;  4Z2A A;  1OT5 A;  2YFU A;  1XPW A;  3PUH A;  5G05 L;  1TG7 A;  1JZ3 A;  2E33 A;  2WAB A;  4P5Y A;  1W99 A;  2C4X A;  3T0D A;  2QQO A;  4MO3 M;  3ACI A;  1UY2 A;  2VJX A;  3WQB A;  3CZJ A;  3SEE A;  1ULO A;  2VZV A;  3CZU A;  2EIE A;  2BZD A;  3HJR A;  3ACF A;  1XNA A;  3SKJ E;  2R7E B;  2W9X A;  1SG3 A;  2V5D A;  1D7P M;  4DUX A;  4JKL A;  2W47 A;  2ZEX A;  1DLC A;  2W46 A;  4ET7 A;  2W1Q A;  3MV1 1;  1W0N A;  4FI9 A;  3EB7 A;  2W94 A;  1JU3 A;  1PMH X;  4MGQ A;  5CYY A;  4E8D A;  4QDQ A;  2VQU A;  3CIH A;  1SDD B;  1UMH A;  2LW8 A;  3GGL A;  4DUW A;  2CDP A;  4XUT A;  3U37 A;  1RYY A;  4ZZ5 A;  1GUI A;  3T2P A;  3GM8 A;  5B4N A;  4A3Z A;  1NAE A;  3WNL A;  2C9K A;  2Y6J A;  2ORX A;  1UYZ A;  4D0Q A;  1UXZ A;  4QX2 A;  2DCJ A;  2Y6H A;  5I0D A;  3THD A;  2YC4 A;  3EYP A;  1JYN A;  2VZT A;  3T0B A;  3HPN A;  5EIY B;  2VM9 A;  4L0P A;  3LQC A;  3WF3 A;  2J1U A;  1F4A A;  3P6B A;  1MPX A;  1W9T A;  2YB7 A;  3MUY 1;  1DYO A;  2Y6K A;  4BXS V;  4JKM A;  4XZU G;  2WQ8 A;  3K77 A;  2DCK A;  1WKY A;  2B9V A;  4ZXE A;  2VZS A;  3I2J A;  4CU8 A;  2W1S A;  3K4D A;  3NRU A;  3ACG A;  2J1T A;  2WN3 A;  2HLE A;  3NJV A;  1CZT A;  5EJ1 B;  4QX0 A;  4CU6 A;  2WAA A;  1DP0 A;  1XC6 A;  2VR4 A;  5IJR A;  2W87 A;  4A45 A;  3W5N A;  3THC A;  1K12 A;  3OEA A;  1NUK A;  3WNK A;  4MGS A;  3I3D A;  4CUB A;  5IYY A;  3CKH A;  3I2I A;  2WN2 A;  3OGR A;  4KWU A;  1JYW A;  3FL7 A;  5JXJ A;  3E1F 1;  4M4R A;  2EIB A;  3IAP A;  2V4V A;  2Z4F A;  3PUI A;  3CQO A;  3VD4 A;  2V72 A;  3BGA A;  1UYY A;  3I2H A;  3DEC A;  3LEK A;  2BGP A;  4GWJ A;  3OBA A;  1GMM A;  2VZO A;  4IUG A;  4ARY A;  2VMC A;  3VDA A;  2BER A;  3T0A A;  3UET A;  2QQJ A;  3III A;  1GOF A;  3HNB M;  2VZ3 A;  3ZM8 A;  3I3B A;  4XVH A;  2E31 A;  4BJ0 A;  3T08 A;  4PQQ A;  2PQS A;  4CU9 A;  2C26 A;  4AG4 A;  1O59 A;  3WSO A;  3I3E A;  1W9W A;  4YPJ A;  3LPF A;  1EUT A;  2QQL A;  1PX3 A;  1JI6 A;  1SHW B;  3UNP A;  5JR2 A;  4DXS A;  4LPL A;  3GXU A;  2E32 A;  5JMO A;  3VD5 A;  3ABZ A;  1US2 A;  2XON A;  2VQT A;  3NJX A;  2ID4 A;  2J1E A;  3K4A A;  3NQH A;  2RJ2 A;  4QAW A;  4A4A A;  4M4P A;  4DEQ A;  2ZXQ A;  4A44 A;  1IQD C;  1GQP A;  1JYV A;  4A6O A;  4QPW A;  4QB1 A;  5JUV A;  4QX3 A; 
#chains in the Genus database with same CATH topology
 4XFA A;  2J1R A;  4AEJ A;  1BEV 3;  1RUG 3;  4EQV A;  1F4H A;  5LA9 A;  4IV1 C;  2LUW A;  1CON A;  2HWC 3;  3POI A;  2XVK A;  4A7Z A;  1OQ1 A;  1ULG A;  3AVS A;  1GWM A;  5A70 A;  1QKQ A;  4COV A;  3LDB A;  4XF0 A;  1RHI 3;  4NWW A;  1CJD A;  5LA1 A;  4EN7 B;  1R1A 2;  1SLC A;  2ARX A;  2DUR A;  3GHN A;  4MSV A;  5F32 A;  4CCJ A;  4OYU A;  4Q4X 3;  3T2O A;  1H8T A;  5J1X A;  4NWV A;  3M70 A;  4OUS A;  3JZV A;  2BOI A;  3N9N A;  2VC9 A;  3VLB B;  2RS3 3;  1O8S A;  3VBH B;  1S2E A;  1UD1 A;  4L11 A;  4QB6 A;  5K9Y A;  5FYH A;  4CDU A;  4ZS3 A;  1RUH 2;  1YI7 A;  2OZJ A;  2RS3 1;  3WUC A;  1JBC A;  2WO2 A;  3KD4 A;  4JGZ B;  4QU1 A;  3ZDV A;  1IKP A;  3MPP G;  1HJF A;  2D44 A;  2WO7 A;  1IG3 A;  1LCL A;  2ES3 A;  2K46 A;  4C1X A;  1LRH A;  3K4Z A;  4LHK A;  4ATF A;  1PX4 A;  5DXD A;  2CWS A;  4W6X A;  1YCI A;  2P4E A;  3K48 A;  1VBD 1;  4UF0 B;  4QKB A;  1JN2 P;  4PIX A;  1MVQ A;  1VRB A;  2VME A;  2J22 A;  3VV1 A;  5IT6 A;  3OEB A;  2VQA A;  2VTX A;  2ZHL A;  1RVF 1;  5FZA A;  3ZXG A;  1GKB A;  3IB3 A;  5JXI A;  1JXN A;  3GAL A;  4DUV A;  1IQA A;  3TB0 A;  3ZIW A;  1XJA A;  4AAX A;  1K5M B;  1K42 A;  1YFX A;  2MEV 1;  4ATE A;  2FDJ A;  4H3W A;  2Q8E A;  4BQY A;  3EJK A;  1VRH 2;  2FD8 A;  2LRP A;  4PI2 A;  3WDT A;  3WP6 A;  4CCD A;  5LAS A;  1V6K A;  4BLI A;  3PDQ A;  1TE1 B;  4YGD A;  2ERF A;  3JB8 A;  3WY6 A;  3KGL A;  5AFB A;  2VOT A;  1QIQ A;  2EVX A;  2VMH A;  2X5I A;  4OVE A;  2QBX A;  1G6N A;  5APA A;  1CZS A;  2JE7 A;  5G04 L;  4M3C B;  1R64 A;  3O12 A;  1S0C A;  1X36 A;  1X8E A;  2WWJ A;  4AED A;  2VD7 A;  2PFW A;  4QT6 A;  5B2G B;  5DDJ 3;  2PAM A;  1K45 A;  4CDQ A;  3KMH A;  4HVQ A;  3LEG A;  1DFQ A;  3IAQ A;  5FTT C;  2XBO 3;  2WS9 2;  4R9B A;  1YO8 A;  4WZC A;  3I2D A;  5T5O A;  1N3Q A;  2FCT A;  2ZX1 A;  5E16 A;  1ZZ8 A;  2JDZ A;  2XBO 1;  4N8M A;  3ZO0 B;  4COU A;  1DQ0 A;  2EID A;  4XIO A;  2WNO A;  4MYE A;  4CCO A;  2ZTN A;  1F15 A;  1JU4 A;  5EXO A;  5HCF A;  5IK7 A;  2C24 A;  4RHV 1;  1Z78 A;  3A21 A;  4IV3 B;  3LD8 A;  4QXC A;  5D21 A;  3ZYJ B;  2WFF 1;  2DVB A;  3VL9 A;  1JYC A;  1EUU A;  5FZH A;  3WP3 A;  2W91 A;  3ALQ A;  1UOG A;  4AZZ A;  2UY9 A;  4Y24 A;  2ZGP A;  5GZC A;  1U5Y A;  3WG3 A;  2VBP A;  3MFA A;  5GZF A;  1H2N A;  2NMN A;  4Q4W 2;  1NE4 A;  1CAX A;  3VD9 A;  3J7N A;  4HBN A;  3S6P A;  4A2U A;  1RIT A;  1XB9 A;  4EJR A;  4YWA A;  3POB A;  2GNB A;  2VZP A;  1H4H A;  4V2W A;  4DNY A;  5IFT A;  1WMD A;  4L99 A;  4XET A;  1YFY A;  2ZGM A;  2Q8C A;  1I9R A;  4QPG B;  2A6X A;  3GZT B;  3RMY A;  1HRV 2;  3AVR A;  3MW2 A;  4Y5S A;  1BKZ A;  1SAC A;  1JW6 A;  2AYH A;  5LWB A;  3RQ0 A;  4LHS A;  1UO9 A;  4GB3 3;  4HXC A;  5KR7 A;  3WDX A;  3L2Y A;  4TTG A;  3CJX A;  2IVI B;  1VBE 1;  3C8X A;  3HT2 A;  3VDD B;  3N9L A;  1NX9 A;  2XR4 A;  4Y4R A;  1HJG A;  4LMF A;  4P9I A;  4AE2 A;  2QNK A;  3ZMN A;  1K5J A;  2P1B A;  1GNZ A;  4UFJ A;  1W8T A;  5C8C B;  2WT1 A;  2AAC A;  1QY4 A;  1HV1 A;  2P17 A;  1FMD 1;  2YY1 A;  4LBN A;  4CA9 A;  4D94 A;  1OF4 A;  5JXH A;  3MF6 A;  1A3K A;  3AMM A;  2J42 A;  1VB4 A;  2DTW A;  3NNJ A;  4WV8 A;  4YGE A;  1W28 A;  1VBB 2;  4FOQ A;  4QXK A;  4WBB A;  1D4V B;  4BA6 A;  1GV9 A;  5HPO A;  3JBG 1;  4IXL A;  5KHG A;  3OOX A;  3VBU A;  2O8Q A;  3R4D B;  4HPK A;  3WLU A;  4UWD A;  4KWJ A;  4MAD A;  4Y4Y A;  3WQ1 A;  3B7M A;  2FDF A;  1UKR A;  2RVA A;  3BUC A;  1OSG A;  3FZ3 A;  3O1P A;  3FE5 A;  3OYW B;  4JRA A;  5EZW A;  3KT4 A;  3MBW A;  4Y1X A;  5J98 B;  2VNR A;  4Q8K A;  1JZ2 A;  1TME 1;  2XOM A;  3NAP C;  1AR6 3;  2JKB A;  4XCB A;  1U0A A;  5A7S A;  1CAV A;  1QMJ A;  2GH8 A;  2Q8O A;  3Q8A A;  1D4M 2;  3BTY A;  1Q8O A;  4JGY B;  1VMF A;  1PIV 1;  2XUM A;  1JZ5 A;  4JKK A;  4Q0Q A;  4QB2 A;  1UY4 A;  4QQP A;  1RUI 1;  3GBF A;  2P34 A;  5F7U A;  1OXC A;  1QEX A;  1S2B A;  2ADE A;  2XLA A;  3U4X A;  3HEI A;  1YQ5 A;  1YQC A;  2K2S A;  3BN6 A;  1RB8 G;  5FYV A;  1J1L A;  3OYW A;  3ROU A;  1UZZ A;  3IKW A;  4BK5 A;  1H9P A;  5A6Y A;  1JZ8 A;  4WVW A;  2W95 A;  4B7E A;  3FUQ A;  3NO8 A;  4IE7 A;  4DQA A;  1W6O B;  2GN7 A;  4E4S A;  3KV5 A;  2VW0 A;  1ZBA 1;  5JZG C;  1DQ1 A;  4OFG A;  3S30 A;  1UYX A;  4NUB A;  3D0J A;  4LBQ B;  3KQR A;  4HN0 A;  3ETP A;  4RGK A;  5FY4 A;  5FKB A;  1YIF A;  1IZ3 A;  3AYE A;  4HPK B;  4QDR A;  1SLL A;  4ZU5 A;  2KM2 A;  1R08 2;  5HV4 A;  3KS7 A;  2P3Y A;  4V1P A;  4BZ4 A;  1RUH 3;  1POV 3;  1Y4W A;  1AZD A;  2QFE A;  4OMD A;  2V09 A;  4CXX A;  3PUS A;  2KXL A;  2XXZ A;  1LHV A;  2Y6L A;  2QQK A;  3VZJ A;  3ZN6 B;  1AR8 2;  5I0U A;  2J1V A;  3IWZ A;  2D97 A;  4XUN A;  5DZE A;  4BIS A;  1W0P A;  2WO3 A;  2GC0 A;  3IPV A;  2RMU 1;  2Z79 A;  4P08 A;  1AF9 A;  2WS9 3;  4PCR A;  5CNA A;  5D2A A;  1VP6 A;  3U78 A;  5A6X A;  2E9Q A;  2WZR 2;  1SFP A;  3O1M A;  4Y1V A;  1PVC 3;  5FMO S;  2CGP A;  2WS9 1;  2BEO A;  2J1A A;  3LPG A;  2YPD A;  4Y5T A;  4B4P A;  3ZSK A;  2ZGS A;  3AP5 A;  1BK1 A;  2JEN A;  4S2H A;  2WNV B;  1US3 A;  1J3P A;  2WZ8 A;  2D3P A;  4YRD A;  2VUL A;  1UNB A;  2ET7 A;  2I2S A;  4RFR B;  2RM2 1;  2DFB A;  3O1R A;  3OCP A;  5T5L A;  5FWE A;  2JEC A;  4FAH A;  1C8M 1;  2A1X A;  4ARX A;  5JCT A;  5JDB A;  1LHN A;  4YZ5 A;  1F9K A;  1U5X A;  4WM8 B;  2BV4 A;  1NG0 A;  4AQT A;  1A34 A;  3FN9 A;  1CVN A;  3GDB A;  3JQX A;  4XAA A;  4LO7 A;  2ORZ A;  2XDV A;  3ZXL A;  3OGV A;  3F2Z A;  5AVP A;  3U4S A;  1W6O A;  2YFZ A;  1V6N A;  2DU0 A;  5FIX A;  3N9P A;  4YLZ A;  5H9R A;  1JZ4 A;  5CG8 A;  1EAH 2;  1UZ0 A;  2R1B A;  3ACH A;  4PIY A;  5E89 A;  1R09 3;  2F17 A;  1B35 B;  2W08 A;  2LS6 A;  3ORJ A;  3K75 B;  5FYB A;  4NIH A;  3I2G A;  2EAA A;  3IDA A;  1F8V A;  3LSD A;  4PQ9 A;  1UU6 A;  1W8N A;  3VBS C;  2XL9 A;  3FMG A;  4TSV A;  1AR9 2;  4QX5 A;  2RS5 1;  3VHP A;  4QPG C;  1R08 1;  3W20 A;  2Q4S A;  3CJI A;  4HOO A;  3ZR5 A;  4I2O A;  1ZRF A;  2X5I B;  4I0A A;  4FFG A;  4B7K A;  1RUF 1;  2E33 A;  4P5Y A;  3WG1 A;  4TZD A;  2C4X A;  5FZ6 A;  3W9A A;  3J8F 3;  4NII A;  1UY2 A;  5IK4 A;  2ZAB A;  2RR1 1;  5H9S A;  3AJZ A;  4D7T A;  2GP3 A;  3AMH A;  4N43 B;  3ACF A;  4D7Y A;  2NP0 A;  1ZRR A;  3HWJ A;  4S2F A;  2VE1 A;  1GZ9 A;  3AXD A;  4BIF A;  3ZVX A;  1QNW A;  1EAH 1;  1D7P M;  3PTY A;  2R16 A;  1QWR A;  3JD7 3;  5A33 B;  1DDL A;  4JKL A;  2ZX0 A;  2ZEX A;  1LHW A;  5FPZ A;  1EAH 3;  2VOV A;  1DLC A;  2W46 A;  2BJS A;  1H1M A;  2ARA A;  2JDM A;  4QQL A;  4PLN A;  3ES4 A;  5FZF A;  3MV1 1;  5LBC A;  3WCS A;  3I4I A;  5J09 A;  1ZZ7 A;  1AVB A;  2K9Z A;  1GYK A;  2W94 A;  3FJS A;  1PMH X;  4MGQ A;  4UW6 A;  4EWD A;  4AQ6 A;  1F5F A;  3ZFG A;  1WW5 A;  5A7O A;  4CDW B;  2R07 1;  3KHC A;  1YNA A;  2X53 S;  3HBZ A;  1BBT 2;  2PLV 2;  4Q4X 2;  3OBT A;  4EN9 B;  1LOB A;  5D8A C;  5ACA 2;  5A7Q A;  5LBB A;  3R4U A;  4IW3 A;  3T2P A;  3GM8 A;  2OW4 A;  3P3P A;  3KQ4 B;  4H55 A;  5F8P A;  2O14 A;  2WQ4 A;  3TBD A;  3L9J T;  5EPA A;  5JSP A;  2Q1M A;  1UYZ A;  3BTZ A;  4DIQ A;  4I01 A;  4PBO A;  4WM7 B;  3D6E A;  2YC4 A;  4IV3 A;  3ACL A;  3PUQ A;  3AP9 A;  5EIY B;  1TNF A;  2VM9 A;  2R06 2;  3BIE A;  3VKF C;  4OQ8 A;  3RDI A;  2R0H A;  4LR4 A;  5FK8 A;  3LQC A;  3BOD A;  3WF3 A;  1MZ5 A;  1XYP A;  1A78 A;  2BP6 A;  4BOW A;  2DUP A;  2WA4 A;  2JB8 A;  4X6R B;  2OVU A;  4OI1 A;  5I0T A;  3ILR A;  3WVJ A;  1LAJ A;  2J1U A;  4ZXK A;  1QQP 3;  3LOB A;  1KDM A;  2BQP A;  4NHX A;  2IVJ A;  2QUO A;  1QQP 1;  5CB7 A;  4LJH A;  2A3X A;  4NPM A;  3MUY 1;  4XTP A;  1BMV 2;  1GNH A;  4FTE A;  4JKM A;  4BU2 A;  1W90 A;  3I59 A;  3K77 A;  4ZON A;  3VHO A;  1WKY A;  2B9V A;  4YGC A;  4HKW A;  3VZN A;  4MH0 E;  4LBO A;  4LKF A;  4AFD A;  4FP2 A;  3CJI C;  4MGY E;  5J48 A;  3HD8 B;  1IPJ A;  4RR3 B;  4BCU A;  4BPZ A;  1RUC 2;  2VVD A;  4FP3 A;  3KB5 A;  2OA2 A;  3DPR C;  1F2N A;  1JUI A;  2QQW A;  2WNU B;  3B69 A;  3RYP A;  4PBP A;  5T54 A;  3WHT A;  1NT0 A;  2IWG B;  4IND A;  1MQT A;  2DUQ A;  4WM7 A;  5FZ8 A;  2RE9 A;  4IV1 B;  5DG2 A;  1Z0H A;  1RIR A;  1CZT A;  1W8H A;  3TN9 1;  2XBO 2;  2HYK A;  2EXH A;  1MS3 A;  5ERL A;  1D4M 1;  4QX0 A;  2HWD 3;  4K7J A;  1DP0 A;  4UF0 A;  4XBL A;  2W87 A;  3VUO A;  1D4M 3;  3OUJ A;  3RGB A;  3N3H A;  1NUK A;  3KM5 A;  2EAK A;  4MGS A;  4N43 C;  1NQD A;  2Y26 A;  1EV1 3;  3VBO B;  2WZR 1;  4FOY A;  2AC1 A;  2W39 A;  3I2I A;  3N7J A;  4KWU A;  3RWK X;  2H6B A;  4HVR A;  5FZ1 A;  2PMW B;  1HLC A;  1CAV B;  3E1F 1;  2WZR 3;  2Z42 A;  4M4R A;  4M3C E;  1WWY A;  1ZZC A;  5GLU A;  3SLI A;  2V4V A;  2X29 A;  3CQO A;  2QJV A;  4XOG A;  4PDW B;  5FPL A;  1UYY A;  5FR3 A;  5JOZ A;  3ZYR A;  3DCQ A;  1IS3 A;  2YDE A;  5LEJ A;  2BGP A;  2VGD A;  3V0B A;  1MAC A;  3D4K A;  1C8N A;  1GMM A;  3N9Q A;  2BRT A;  5FWJ A;  4C0B A;  2DF7 A;  4ARY A;  2WL1 A;  2VMC A;  3U0Z A;  2BER A;  2RDS A;  4XJA A;  4XQ4 A;  4JTO A;  3R05 A;  2VZ3 A;  1QJE A;  3M3O A;  3H8O A;  3PUA A;  2WT2 A;  1YRZ A;  1J59 A;  3T08 A;  4PQQ A;  3NL1 A;  3MIF A;  2PQS A;  4YW1 A;  4NID A;  1O59 A;  5FO7 B;  1GQG A;  4KU7 A;  1PGS A;  2HWB 3;  1CAW B;  1W9W A;  2ADD A;  1AYN 1;  3AMQ A;  3CLP A;  1IS5 A;  4Q4Y 2;  4A6S A;  5GLW A;  3DGT A;  3IT8 A;  4XYX A;  1NYW A;  3UKN A;  1UL9 A;  2ZAC A;  3FC0 A;  3H1W A;  4YW2 A;  5FV3 A;  1I1E A;  4IE4 A;  1X9T A;  1R1A 3;  4YM0 A;  4DXS A;  4LPL A;  2YMZ A;  4ITC A;  1FT9 A;  1RJ7 A;  4GH4 B;  5L9B A;  3WZ1 A;  4FVV A;  3SH5 A;  1QU0 A;  3VN4 A;  4E4H A;  3ABZ A;  2OYZ A;  1V6L A;  3LFI A;  3ZOI A;  1C5I A;  2IUW A;  2VQT A;  5A3M A;  4P9L A;  4QGL A;  4CUG A;  3VBF C;  3B00 A;  4QX7 A;  3WT3 A;  1GQH A;  3PU8 A;  4TLF A;  2RJ2 A;  3VKM A;  3MPB A;  1PO2 1;  4M4P A;  1RGS A;  4AVT A;  3GZE A;  5FQ0 A;  4S2G A;  4Q29 A;  4A44 A;  3I2O A;  3B9C A;  3HT1 A;  3PJY A;  5FY8 A;  3IDB B;  4A6O A;  3T1L A;  3BU0 A;  4P9W A;  2YPJ A;  4EWE A;  4WZF A;  1W9Y A;  2XJU A;  3VBU C;  4AI9 A;  2OX0 A;  2Q1F A;  4LO6 B;  2JXA A;  1RUJ 1;  3WR0 A;  1RVF 2;  4WVM B;  2UYB A;  4NHL A;  3V0A A;  5IK5 A;  1UIJ A;  1JOJ A;  2XKO A;  1SLI A;  4OUE A;  5SV5 A;  1JTZ X;  4CUA A;  2VZR A;  2VXR A;  5K0U B;  1I5P A;  1DGL A;  2IXI A;  5LRS A;  3DYO A;  5C5U A;  4AF9 A;  1J83 A;  1RUF 2;  2HWE 1;  3I8T A;  3O5S A;  4Z07 A;  1Z7S 2;  3DYM A;  3MLK A;  4XAE A;  5FZO B;  1DCS A;  3WNP A;  1CR7 A;  1WW7 A;  4RN5 A;  3AB0 A;  3AZW A;  3BCW A;  5FY1 A;  5LB6 A;  2O1Q A;  2IXL A;  2VBD A;  3MI8 A;  5FYZ A;  3SNM A;  2CDO A;  5E8A A;  1D0G A;  1W2T A;  2EXJ A;  4XF3 A;  5GLT A;  5LA2 A;  3U10 A;  1H9W A;  2D98 A;  3W5M A;  2ZGN A;  3VKL A;  1QJY 3;  5LW9 A;  4KWK A;  3C7F A;  3M3I A;  3MO4 A;  1XE7 A;  4HSJ A;  2OII A;  3ZYI B;  3EQE A;  4LK6 A;  5BUV A;  2VU9 A;  1HIX A;  4FT8 A;  5GZD A;  3AZV A;  2WNE A;  1CPN A;  1ZZ6 A;  4N53 C;  4CDW C;  2ZEY A;  4CP9 A;  4YM1 A;  1AR6 1;  2I07 B;  3BI3 A;  2X09 A;  1N1T A;  3B9I A;  1FX5 A;  2Y64 A;  3AC0 A;  5JSR A;  1CGP A;  1Q8S A;  3TAY A;  1HN1 A;  3ZFF C;  1KDK A;  1NZC A;  2B39 A;  2VCA A;  5BXX A;  5IVE A;  1ZM1 A;  1ZBE 3;  1VLN A;  2WO1 A;  1QJX 1;  1SLT A;  4Q4Y 1;  3SCG A;  5C3R A;  4MG2 A;  2L9L A;  2BBA A;  2I45 A;  4SBV A;  4LT5 A;  1ZBE 1;  5AC9 1;  5FJK A;  2R6Q A;  3IDC B;  4IEY A;  5AC9 3;  4FFF A;  3GBG A;  3OG2 A;  4AFM A;  3A23 A;  1OBN A;  2E7T A;  3GYD A;  2YHJ A;  2HH9 A;  4NJ4 A;  3PL0 A;  4LOS A;  1CZV A;  1O5L A;  1SCS A;  2WQZ C;  4XDO A;  4BWO A;  1UX7 A;  4UW4 A;  2HYX A;  4Q1R A;  3INA A;  4ZU7 A;  2X5I C;  1ZBA 3;  4YSF A;  1OHF A;  4RFT 0;  3J7H A;  1H2K A;  4W65 A;  4XAB A;  1TNR A;  5EP9 A;  1S0B A;  3E97 A;  1WA4 A;  1PM4 A;  4B1M A;  4O9E A;  1XE8 A;  2BVV A;  3EXU A;  3NNF A;  1WBL A;  4P02 B;  4XFG A;  3NV2 A;  4E4Z A;  5LY1 A;  4AR2 A;  5A1A A;  4IEX A;  4BQ1 A;  4UW5 A;  5A3O A;  5BNN B;  1XNB A;  4A42 A;  2JKX A;  2RHP A;  3JUU A;  2FDH A;  5F3E A;  1UY1 A;  4PT6 A;  3P1I A;  3ZSE A;  2CY6 A;  3RFR A;  5A1L A;  4OMC A;  1OLR A;  3FX3 A;  1REF A;  4RYD A;  5D8A A;  5A80 A;  2VTX J;  1NZI A;  1MEC 1;  5FCC A;  2A6Z A;  5T50 A;  3H50 A;  2C9A A;  3KZ4 C;  1JOD A;  4C90 A;  1PVC 1;  4CU7 A;  1KRI A;  3LGR A;  1RUJ 2;  4HN1 A;  5C7G A;  2RS1 1;  2R04 2;  3OY8 A;  2Q5T A;  2B46 X;  4IE5 A;  1YQ2 A;  4FO9 A;  1AJO A;  4XZP A;  4LXL A;  4XPV A;  1GP5 A;  5HCB A;  4MGT A;  3KHB A;  4FPH A;  4Q4V 2;  1NY7 1;  1LEM A;  2ZHK A;  2WWU A;  3N35 A;  1HB4 A;  3E5Q A;  4LBQ A;  3H8R A;  1DGR A;  1YHF A;  4LA3 A;  4LUK A;  1H1A A;  1NKG A;  4L2N A;  4W8J A;  3I3Q A;  1LR5 A;  1W8F A;  3GJB A;  4W50 A;  4ISQ A;  2UWC A;  4R8H A;  3O1U A;  3DF0 A;  3I49 A;  2Z2S B;  1OI6 A;  3I2K A;  5KXE A;  5LEK A;  4IEP A;  4RQP C;  4LKE A;  2AZ5 A;  1YFU A;  4LOR A;  4XUO A;  2HWC 2;  1PGL 1;  4X8N A;  1DGW A;  2WZE A;  1NCQ B;  1OH4 A;  1UMZ A;  2ARE A;  2Q30 A;  2WUH A;  1KEX A;  2FCU A;  2VY0 A;  3MV0 1;  4UT5 A;  1HQL A;  1DGR N;  2W0X A;  1G9B A;  1L7R A;  4MV2 A;  4LHL A;  1LB2 A;  2D6N A;  2HWE 2;  4HKO A;  3ZFG B;  2O0O A;  4BXF A;  2D6L X;  2VG9 A;  3RZL A;  5JLV A;  2PTM A;  1XE0 A;  5A7W B;  4XJ8 A;  4EZH A;  3S0M A;  2A7A A;  1O3S A;  3OBZ A;  1IS6 A;  2ZHN A;  5FZ7 A;  1RVF 3;  3VL8 A;  1HRV 3;  1ND3 C;  1RUD 1;  3PMS A;  4QD2 A;  4ES8 A;  2W3J A;  3WDY A;  1QJU 1;  4AHZ A;  1HRV 1;  1JHJ A;  1V70 A;  4XC9 A;  3L2H A;  2ZZQ A;  4XTM A;  3VBU B;  3KF3 A;  3VB9 A;  1ZBE 2;  1DU3 D;  1OD3 A;  2ZGK A;  3MF9 A;  4LOT A;  4MHR A;  2PHT A;  1KGY A;  1DF0 A;  2KD7 A;  2IZW A;  1GNY A;  4Y5Z 0;  3OY8 B;  2CV6 A;  3FLT A;  2AEN A;  2HBT A;  3T2Q A;  2HBU A;  1ZX5 A;  2ZBJ A;  4NPL A;  1PM7 A;  4MHU A;  4QU2 A;  5DUW A;  3WOG A;  1GOH A;  2IFR A;  1Q8Q A;  3EBR A;  1JYX A;  5DDJ 1;  4N53 B;  2NYY A;  5FYU A;  4CDX B;  1W6P A;  4M0H A;  4MET A;  1XYO A;  1OUX A;  4NN0 A;  4R9D A;  3ZFF B;  1JZ6 A;  2R49 A;  2RJK A;  5CKQ A;  1FV2 A;  4RR3 C;  5DN2 A;  3HOB A;  4OZX A;  4PF5 A;  5JZG A;  2TBV A;  2PHW A;  3UES A;  2VO5 A;  2HWD 2;  5FUP A;  4W4Z A;  2G9F A;  2VEC A;  2YXS A;  3WG2 A;  4DY3 A;  2ZGR A;  4OHW A;  3N36 A;  3VZO A;  1WMX A;  3CBN A;  1HRI 3;  1DZQ A;  1UXX X;  2Y0I A;  4GZ9 A;  3WNN A;  2YG0 A;  1OQD A;  2A75 A;  2WFF 3;  3FLP A;  3AKQ A;  3LA3 A;  4MGZ E;  5EJZ B;  3LA2 A;  1OH3 A;  4EYU A;  3OGS A;  3DL3 A;  1CX1 A;  4UI9 L;  3WDV A;  1ND3 A;  5HI0 A;  1OVS A;  4CPB D;  4CRQ A;  3KWV A;  4HKL A;  3FFQ A;  1QOT A;  3FWE A;  1SMV A;  1BZW A;  3RJR A;  5C3S A;  4OI0 A;  2DDU A;  2C6S A;  1AR9 1;  2HWB 2;  3AFG A;  4MUV A;  4BB3 A;  2CHH A;  2XJP A;  4UFL A;  1VRH 1;  4NVP A;  5FLH A;  3HQX A;  3LKJ A;  1GR3 A;  2P6H A;  3AZZ A;  2CYF A;  2JDA A;  3QH7 A;  2WYF A;  2XJQ A;  1RMU 3;  1QH7 A;  4E27 A;  2D5H A;  4D3W A;  3HN3 A;  4GMP 1;  1GZW B;  1WMF A;  1HN0 A;  4LA2 A;  5I8S A;  3U1X A;  2GDF A;  3WX5 A;  1UPI A;  3VBO C;  3WNM A;  2WSU A;  5CFD C;  2ZGQ A;  1JMU B;  2W92 A;  4IEQ A;  2W52 A;  3HBK A;  1YWK A;  1H0B A;  4MGK E;  1COV 3;  5HV0 A;  1LGB A;  2XQX A;  3Q8B A;  5C8W A;  4U36 A;  1EPZ A;  3WW4 A;  4AK3 A;  4OUM A;  4GAZ A;  4GKX A;  3H0O A;  4E2S A;  3K51 A;  1RXF A;  2DUO A;  3GCW A;  3ZXE A;  4LKS A;  4LEJ A;  1NQJ A;  3SMH A;  2UYA A;  2XH6 A;  3KCC A;  4ZY9 A;  3S7I A;  2BGC A;  1VBC 3;  1ND2 C;  2DVG A;  3FHA A;  4Q26 A;  4AGG A;  1K5M A;  1QJX 2;  1ULF A;  2QQU A;  1H2L A;  4LBM A;  5JVV A;  2GND A;  1RUG 2;  5FPV A;  4LBK A;  1LES A;  2C5D A;  5G05 L;  1TG7 A;  1ZA4 A;  3KV9 A;  1GZT A;  3CJI B;  1AR6 2;  2QQO A;  1O4T A;  4YVS B;  1MS9 A;  2UUR A;  2W68 A;  1L7L A;  3ACI A;  3NWK A;  4XJZ A;  3H7Y A;  3H7J A;  4AI3 A;  1W2O A;  1WZX A;  2K0G A;  2HEY F;  2BZD A;  1IHM A;  1KS4 A;  3HJR A;  3ILF A;  5BNN C;  1XNA A;  2R7E B;  2WJS A;  1RL3 A;  4N90 A;  4JGY A;  3HR9 A;  5HXV A;  1MQT B;  3P3N A;  2JIG A;  4P5H A;  1AX2 A;  2PXJ A;  4O65 A;  5FQ0 B;  1LEN A;  2W47 A;  1ZNP A;  4BQX A;  4YW4 A;  5ABJ A;  3WNX A;  1XBF A;  2JG8 C;  1QJU 2;  4LNV A;  5CYY A;  1DG6 A;  2ARB A;  2ILM A;  5C9A A;  5BNP C;  3CIH A;  3ZYH A;  1UMH A;  1OA2 A;  2JG9 B;  2VW1 A;  3GGL A;  4Q1P A;  2BYV E;  2UY8 A;  1Y9G A;  2CDP A;  4XF9 A;  3OD4 A;  3E6D A;  5DAQ A;  1RYY A;  4ZZ5 A;  3RSJ A;  2F6B A;  2R32 A;  5AC9 2;  1PK6 C;  3ITQ A;  1KD7 A;  4Y20 B;  4EV0 A;  2IC1 A;  2QE3 A;  4NMI A;  5FXV A;  2B45 X;  4E4D X;  4XAC A;  2PEL A;  3WNL A;  5FZO A;  3N9O A;  4LLF A;  3W21 A;  2ORX A;  3CEW A;  4Z82 A;  1XNC A;  1UXZ A;  2R07 2;  1O3Q A;  2ETE A;  2Y6H A;  1R1A 1;  3AZY A;  4CP1 A;  5ABJ C;  5BNO C;  1JYN A;  4ISR A;  3NKG A;  4UW3 A;  4XQD A;  1KFX L;  1XSQ A;  2PYT A;  1HB2 A;  4JAA A;  3ZXA C;  3MLL A;  2BWA A;  4DY5 A;  4L0P A;  3ZMO A;  4RA0 A;  3JD7 2;  3AYA A;  2OPK A;  4YAR A;  3AL6 A;  1KJL A;  2JB4 A;  3HAG A;  3WD5 A;  5A6Z A;  5BNN A;  5JIA A;  2WIN B;  4CDX C;  1PO2 3;  1F4A A;  3MHZ A;  2RM2 2;  3P6B A;  2OT7 A;  4KBZ A;  5KHI A;  1AL2 3;  2JDN A;  1MPX A;  4GD4 A;  1VBB 3;  4JC1 A;  1C8M 3;  1WLT A;  1Y7B A;  2YB7 A;  4H14 A;  3ZSL A;  5L7O C;  4YFZ A;  3IMN A;  1FNY A;  1DYO A;  1N1V A;  1RUN A;  2R04 1;  2YBK A;  2A6W A;  1RED A;  2DCZ A;  5KXC A;  4KWL A;  3S5A A;  3HVD A;  3JB4 C;  3LOI A;  4XJW A;  2VH9 A;  4AI0 A;  4ZXE A;  4CE8 A;  2QQV A;  5IVJ A;  5L9V A;  4BE3 A;  4RGA A;  3TEW A;  2A3Y A;  1Z7S 1;  1XQN A;  5DZF A;  3C3V A;  4EN8 B;  1BCX A;  2D6O X;  4QX8 A;  3I2J A;  3ZN4 A;  1SPP B;  1YEW A;  2A6V A;  3K4D A;  4YVW B;  1Z7S 3;  4CTE A;  3LZZ A;  4B1L A;  4NRO A;  4D6S A;  4CDU B;  3PVN A;  2XHK A;  2DWR A;  4R4X A;  1VE0 A;  2RS5 3;  2D43 A;  3BAL A;  1ZRC A;  3ETQ A;  3I54 A;  4CU6 A;  5F5I A;  3A4U A;  2BW8 A;  4A45 A;  5KXD A;  3SHR A;  2SBA A;  1Q8V A;  1DYK A;  3NAP A;  3ZXK A;  3OEA A;  2GAL A;  3RNS A;  4LHN A;  2VCM A;  5FOB B;  2ET1 A;  5K7P A;  1W05 A;  1ZBA 2;  4IGP A;  4NR1 A;  1FNZ A;  1AL0 G;  1U5Z A;  1UQX A;  3R4S A;  5DUV A;  4CUB A;  1QJY 1;  3CKH A;  4AVA A;  3W58 A;  4AW7 A;  1V6J A;  1NLQ A;  2WN2 A;  1UZV A;  3LA7 A;  1S4C A;  1VJ2 A;  1CAU B;  5FAX A;  3TEY A;  3PLQ A;  5FRE A;  4JGY C;  4D69 A;  1AXZ A;  5A7W A;  3N9M A;  1YQ8 A;  3O0V A;  4EN6 B;  1OQE A;  1QDO A;  2V72 A;  1LUL A;  3BGA A;  4K1Y A;  4YW3 A;  3VD4 A;  3I2H A;  3DEC A;  4NHY A;  5F5A A;  5IVY A;  1ASJ 2;  3QCW A;  3V0B B;  3OBA A;  3S57 A;  2VW2 A;  5FPU A;  4MLO A;  2VZO A;  1V9U 2;  1ND2 B;  3CHX A;  4IUG A;  2CAV A;  5ANQ A;  4TLG A;  1CJP A;  1XND A;  4AGV A;  1MEC 2;  2QQJ A;  1Y3T A;  3WXP A;  4LO5 B;  3HNB M;  4K3U A;  4DXZ A;  5IUQ A;  2D3S A;  4G9S B;  1ST8 A;  4XVH A;  1S0J A;  5IWF A;  4WM8 A;  3ZKY A;  1DQ4 A;  3RRD A;  3T30 A;  4BJ0 A;  5HCA A;  3K3O A;  4AG4 A;  1KIT A;  1LOG A;  1W6M A;  4QQO A;  3I3E A;  1T6G C;  3APB A;  3ST7 A;  4AFB A;  3R0R A;  4YPJ A;  1ZA7 A;  1WD3 A;  4FFH A;  2QQL A;  5FZI A;  3VDD C;  1OLQ A;  5JI9 A;  1JHN A;  1PX3 A;  2ZOE B;  4IE0 A;  1SHW B;  5I0R A;  3MIH A;  4L9B A;  4QPI C;  3RI8 A;  4CXW A;  3UNP A;  5JR2 A;  3VZL A;  4NPR A;  3VKN A;  4OLL A;  3MYX A;  4Q27 A;  1BQP A;  3GXU A;  3KGZ A;  3DXU A;  3VD5 A;  1MS8 A;  1US2 A;  2VMI A;  2DYC A;  5CA6 A;  3NJX A;  3ELN A;  1OVP A;  4AFA A;  2CGO A;  4KGQ A;  1YJL A;  3TOJ A;  5JMO A;  4GH4 A;  5FP4 A;  2XLG A;  3BYW A;  4GUL A;  1ND2 A;  3ZR6 A;  4DEQ A;  1DQ5 A;  1GLH A;  1QH6 A;  4IEU A;  4FQ4 A;  2V4A A;  5ANN A;  5CFC B;  4XMI A;  2QTW B;  1BEV 1;  4R9A A;  4XMA A;  3PIG A;  4QB1 A;  3ZFE C;  5JUV A;  1X50 A;  2VMG A;  1HB3 A;  4CEW A;  2HWC 1;  1PGL 2;  4UBG A;  5FMC A;  1J58 A;  1OFS A;  3AMP A;  2TUN A;  4HFS A;  3MEP A;  2E26 A;  5F37 A;  4LBQ D;  4XFF A;  2PAE A;  3LFM A;  5FP9 A;  4YM3 A;  2WNV C;  2VZQ A;  4FAG A;  5C3P A;  4XXA A;  5B4X A;  1E5R A;  3RZZ A;  3MIC A;  4Q4X 1;  3R6S A;  4QX1 A;  4QPI A;  1WD4 A;  2RMU 2;  3ME2 A;  5A32 A;  5C9A C;  1FAT A;  5LBF A;  3URF A;  1GSL A;  4JZR A;  1UN1 A;  4F3J A;  3CL1 A;  5ABJ B;  4N7U A;  5C70 A;  5IVF A;  1BHG A;  1YC6 1;  3QOP A;  1UCX A;  1HX6 A;  1C57 A;  4CEY C;  2VOX A;  5IAX A;  2VBB A;  3HNY M;  3LDK A;  3MFC A;  4F83 A;  2GH2 A;  3RYK A;  5FZK A;  1Y9M A;  1VIW B;  3FLR A;  3ES1 A;  5FZE A;  4DMI A;  2VAU A;  4GB3 2;  4DRV A;  3LE0 A;  3CO2 A;  3A22 A;  1I3H A;  4UFM A;  1U5I A;  3AL5 A;  5A3L A;  4GA9 A;  5T5J A;  3ZYG A;  4BHP A;  4Q2F A;  3FBY A;  3SKV A;  4CDW A;  5BNP B;  1LED A;  2XB6 C;  3H9A A;  4XW3 A;  4WVV A;  4CDU C;  2ZEW A;  4HG6 B;  4Q5O A;  2QCS B;  5C3O A;  1NCR B;  1VBD 3;  5FK7 A;  2VL4 A;  1K3I A;  4RS5 B;  1H4G A;  1SFY A;  4CCM A;  1QJU 3;  4QGM A;  4LIU A;  2W1U A;  2BBV A;  3CNA A;  3H1M A;  3UV9 A;  3VD7 A;  1RMU 2;  5FKC A;  1PO1 2;  4YVW C;  2PAK A;  3OB8 A;  4Z2W A;  3AKS A;  5GLV A;  2W1W A;  2MEV 3;  1W8O A;  2XKP A;  1CQ9 A;  3RZJ A;  4P9X A;  5ACA 3;  5FXW A;  2WNV A;  3IIA A;  4IES A;  4QXH A;  4DFS A;  3NVC A;  3PVO A;  4XFC A;  3WF4 A;  5DMY A;  3VBH C;  2JEM A;  4QKF A;  3H3Z A;  3EHK A;  5GLZ A;  4MZU A;  5L19 A;  1UY3 A;  3PUR A;  2HWF 3;  5FXX A;  4AI1 A;  1AYN 3;  2PHD A;  2BOJ A;  5L7O B;  1IOA A;  1PZ8 A;  1PZ7 A;  2GU9 A;  1UIK A;  2ZML A;  1WCK A;  2BNM A;  3FBM A;  5FOJ B;  3I97 A;  1B35 A;  2FHR A;  3WP5 A;  1J1T A;  3D3A A;  2ENR A;  4DS0 A;  3WV6 A;  5KC6 A;  1ZRI A;  2PA7 A;  5CAD A;  2YGM A;  1MS4 A;  4YVW A;  3HIF A;  3E5U A;  4RHV 3;  4XIK A;  2XVG A;  4BQ5 A;  1PMJ X;  4TXW A;  2OQ7 A;  1GOG A;  1SFN A;  2VTF A;  1HB1 A;  2WDB A;  1C1F A;  4XCA A;  3ZYP A;  3ZYB A;  1QNY A;  1WCU A;  2QQM A;  2WT0 A;  4XJ9 A;  4AHX A;  4H7L A;  2BDR A;  1WCQ A;  4E8C A;  4AQ2 A;  2W2I A;  1W06 A;  2QZ3 A;  4HAN A;  1VBE 2;  3KT1 A;  4YW6 A;  1IPK A;  2WLP A;  2QKD A;  1Y9Q A;  5FZL A;  2WFP A;  1XOY A;  2MHF A;  1ULP A;  1WA6 X;  2RS5 2;  3DYP A;  4JHZ A;  2VPV A;  1V6O A;  5I8Y A;  1K5M C;  2ZZJ A;  5LCW L;  2D3R A;  2DU1 A;  1QDC A;  4HON A;  1P8J A;  4XJU A;  1UZW A;  1UOF A;  1MZE A;  4UXA A;  1R09 2;  2JG8 B;  4I0B A;  4PF1 A;  4F8A A;  1EV1 2;  3K46 A;  4X8P A;  4DIN B;  3M1H A;  1N3O A;  1IG0 A;  3ZXF A;  4ASM B;  3ZN6 A;  1WW6 A;  4IDZ A;  1BYH A;  3J26 N;  4K9S A;  3RWN A;  1W39 A;  4YG3 A;  2G9Z A;  4XFH A;  4GKY A;  5FY7 A;  1W6N A;  4NIA A;  4FPY A;  4PDW C;  3VBR A;  4JGZ C;  4EN0 A;  2JDY A;  1B35 C;  3VGI A;  1NCQ C;  4Y20 A;  3WP4 A;  1W8W A;  4QQ2 A;  4UFH A;  3CMG A;  4AHW A;  2IXC A;  2Y6F A;  1MZ6 A;  3PU3 A;  2BGO A;  4LKD A;  3C7O A;  4YM2 A;  4N9H A;  1FI2 A;  1NA1 A;  2D6P A;  2E51 A;  3PTR B;  4UFK A;  2VOK A;  4AYU A;  4LQR A;  4Q0U A;  4LE3 A;  3NJZ A;  1F35 A;  2YC2 A;  4XEZ A;  3JBG 3;  3THP A;  3ZPY A;  3C7G A;  4DXR A;  1LGN A;  2AEY A;  2JDU A;  2PLV 1;  5CEH A;  3H8X A;  3KCY A;  1RUO A;  5CG9 A;  5FPX A;  3ECQ A;  4LLO A;  2P37 A;  1KJR A;  3ZLI A;  1V6M A;  1TME 3;  3ENR A;  4GH4 C;  4P00 B;  2JJ6 A;  5FBJ A;  1W8U A;  1WLD A;  1QJY 2;  2ZMN A;  5LA0 A;  4MOA A;  4FPL A;  1BMV 1;  5KBF A;  1NCQ A;  2WKK A;  4K1Z A;  4SLI A;  5I0S A;  5KXB A;  3RZH A;  3VDC A;  4FPG A;  1AUY A;  1EPW A;  4GWI A;  1RHI 2;  3POJ A;  4QHZ A;  4CP2 A;  2EA7 A;  5CFD B;  2Q1Z B;  3RG0 A;  2MEV 2;  5FZ4 A;  1O6U A;  1C5H A;  1YFW A;  2PHR A;  2WC2 A;  2QQN A;  3U14 A;  4O61 A;  2WLQ A;  3AZX A;  3SH3 A;  5BPX A;  1S1A A;  1OD5 A;  1H8V A;  4CYD A;  1OMI A;  2HEV F;  4FFI A;  4XFB A;  1FYU A;  1LU1 A;  1UY0 A;  2J7M A;  2BNO A;  1BVV A;  2WNU A;  2WZP P;  1ULE A;  4XHX A;  1X82 A;  5HXM A;  1ZRD A;  4QM8 A;  5FO8 B;  2G4I A;  4FBF A;  4BQ2 A;  2P3K A;  4HK8 A;  1KS5 A;  3IM0 A;  4KNC A;  4Q4W 1;  3VBS B;  2OQ6 A;  1UWW A;  1OC1 A;  1G7Y A;  2R06 3;  3VBR B;  4LO8 A;  4S2D A;  2EIG A;  1TVG A;  4N53 A;  4ZZ8 A;  2R06 1;  1XNT A;  5EV7 A;  4DEV A;  3NMB A;  2XML A;  2X05 A;  1GP4 A;  1VBD 2;  2EXK A;  2NLR A;  3WDU A;  3MZH A;  3ZX7 A;  1WBF A;  2ZX4 A;  4RL7 A;  3OJB A;  3O1V A;  2D5F A;  3WF1 A;  1VBA 2;  2CL2 A;  2CWM A;  2WBK A;  1SEF A;  5CBL A;  4Q0P A;  1J84 A;  1JOB A;  4LBJ A;  4YYO A;  2ZMK A;  2BU9 A;  1MS1 A;  2B9U A;  2RS1 3;  3A0N A;  1SBE A;  3B02 A;  5EFU A;  5FP7 A;  2RM2 3;  3WEZ A;  5HCH A;  2VMF A;  4WVM A;  3VD3 A;  1AL2 2;  4OHY A;  2ZPX A;  3LAG A;  2Y0O A;  1O8P A;  4QKD A;  5DAB A;  1AL2 1;  1LOF C;  1TMF 3;  4FPC A;  4ES9 A;  3T4V A;  4YW5 A;  1ALY A;  5FZ9 A;  4AXO A;  3OTF A;  4OZO A;  4EWA A;  1HQW A;  1TZO A;  2XHN A;  3JQW A;  1PK6 A;  3RJ2 X;  1TMF 1;  3V65 A;  5EYY A;  1JOP A;  4KG0 A;  4AED C;  5IVC A;  2PQQ A;  2XJR A;  5FO9 B;  5FZC A;  5GZE A;  4JDN A;  1AR7 2;  4QKN A;  4HET A;  5J7M A;  4YW7 A;  1MZF A;  3POE A;  5FY9 A;  1DQ6 A;  1UYP A;  4JCK A;  2MNG A;  1LEC A;  4Z8B A;  5C8C C;  5FYC A;  4L8Q A;  1AX1 A;  1I5Z A;  2P2K A;  2A73 B;  4YFW A;  4UOJ A;  5A33 A;  1OUS A;  1VPH A;  5L7O A;  4NHK A;  2BUK A;  4XF1 A;  4E9K A;  1EYB A;  3OPT A;  4Y22 B;  1OT5 A;  1VB2 A;  2YFU A;  2FDK A;  3VBF A;  1O7F A;  4GXL A;  4COZ A;  3O1O A;  4HSL A;  2B7Y A;  4CCK A;  4P9Y A;  4Q8L A;  1FXZ A;  3H1Y A;  4I0W B;  1RUD 3;  1XYN A;  3AP7 A;  1S0I A;  1W99 A;  4LIV A;  3T0D A;  2WA3 A;  2GMM A;  2ZGO A;  1ZZ9 A;  1RUF 3;  4GWM A;  4IE6 A;  1GIC A;  5DUU A;  5FXZ A;  3BTX A;  1GWK A;  3NV3 A;  2VJX A;  3WQB A;  3PME A;  1UOJ A;  3CZJ A;  2XVL A;  1ULO A;  3IDE A;  3ZN5 A;  5CIS A;  3CZU A;  2XQR A;  1H1I A;  2EIE A;  4IV3 C;  2RR1 3;  4RS5 A;  3ZSM A;  4XFI A;  4A7Y A;  1C4R A;  1DBN A;  2DCT A;  1V9U 1;  2V5D A;  4XDQ A;  2AH2 A;  2B42 B;  5FY0 A;  1DZT A;  2D93 A;  3VKO A;  4E2G A;  1X33 A;  4DUX A;  4R52 A;  1YIP A;  1FPN 3;  1V9U 3;  4JDM A;  2E7A A;  4WM8 C;  2LRO A;  1ODM A;  1LKN A;  2W1Q A;  5DAV A;  1PO2 2;  2WFF 2;  3WIN E;  5C8C A;  1UU5 A;  4FI9 A;  3EB7 A;  1JU3 A;  3J7L A;  5FYY A;  4QDQ A;  2VQU A;  2DVA A;  4HMZ A;  3P5B A;  1XSR A;  1N1S A;  3F95 A;  4HT1 T;  5F2S A;  3USU B;  3AJY A;  3VBO A;  2YZ4 A;  4DUW A;  2P3I A;  1BEV 2;  4GIQ A;  5DAX A;  4OQ9 A;  4XUT A;  4YZ2 A;  4X6Q B;  1QGL A;  3VBH A;  1QJF A;  2JG8 A;  3ATG A;  1FOD 1;  3DXT A;  2FMD A;  1GWL A;  4ZU4 A;  2R1D A;  4JGZ A;  3NNM A;  5B4N A;  4A3Z A;  1NAE A;  3WUD A;  1OOP B;  5LY2 A;  1AJK A;  4GJZ A;  1W6M B;  3LIH A;  4J1W A;  5E1R A;  4D0Q A;  1AR8 3;  2DCJ A;  3MIG A;  4U2A A;  5I0D A;  1M4W A;  1UF2 C;  4RS5 C;  2Q8D A;  3UYJ A;  2ZCW A;  2RR1 2;  3PIJ A;  2VZT A;  3T0B A;  1AR8 1;  3N7M A;  3O0W A;  5A32 B;  2R30 A;  2GME A;  1IPS A;  4MVT A;  1SLA A;  4XBQ A;  3RMX A;  2P5B A;  1C1L A;  1UW8 A;  1S0G A;  3M4F A;  1AR7 3;  2YC0 A;  3AMN A;  3IPV B;  2JIJ A;  4FPF A;  5FBZ A;  1JYI A;  3AKR A;  3KF5 A;  5BV6 A;  5A1F A;  2DVD A;  4CP0 A;  2IFW A;  1E5I A;  4KL1 A;  4NOT A;  4CDQ B;  3I59 B;  3LIG A;  4MGI E;  3IN9 A;  3USS A;  4I02 A;  4RQP A;  5KC5 A;  1QF3 A;  4P14 A;  2P6C A;  1CD3 G;  4ORF A;  2Y6K A;  3AYD A;  2FZ1 A;  1UAI A;  4FPJ A;  1W2A X;  4BXS V;  4CZS A;  4M3C A;  1F5J A;  4DB5 A;  5CAZ A;  2NMO A;  1O4Z A;  1W3V A;  1W0O A;  1QHD A;  3UK9 A;  5CFC A;  1LHU A;  5AVA A;  4K8R B;  3U07 A;  1EP0 A;  4AED B;  3M8L A;  2ATF A;  4YZ4 A;  4COY A;  3SCF A;  1RUG 1;  3ZSJ A;  3ZKU A;  4CU8 A;  4QPY A;  5KHH A;  2Q0A A;  1NY7 2;  3DUI A;  2AGS A;  2IXH A;  3NRU A;  4Y1Y A;  4D6R A;  1RHI 1;  1QXP A;  3ACG A;  2A6Y A;  3B94 A;  2UU8 A;  1RUI 2;  3TN9 3;  4CCE A;  4Y1U A;  5FJH A;  3JBG 2;  2WN3 A;  3U11 A;  5J37 A;  1JH5 A;  2C1F A;  2VNG A;  2G1M A;  1HW5 A;  2HWD 1;  2TEP A;  3KVA A;  5EJ1 B;  3RPQ A;  2QZ2 A;  1HXS 1;  5D1I A;  2EXI A;  2WAA A;  1BXH A;  3SIT A;  1G9D A;  4Y33 A;  1CPM A;  1PNG A;  1PGW 1;  1XC6 A;  1ACC A;  1E57 A;  2VR4 A;  5IJR A;  3ZFE B;  5BNP A;  2RDQ A;  2XGX A;  1HXS 3;  1TME 2;  1C28 A;  5EWS A;  3E6B A;  3THC A;  1K12 A;  3UGH A;  5BNQ A;  3WHU A;  3PNA A;  1NCR A;  2JD4 A;  2I74 A;  5DDJ 2;  3WNK A;  1W3X A;  4K8F A;  4B4R A;  3MW3 A;  2VUD A;  5IYY A;  2YU1 A;  3NV1 A;  1D0H A;  4JVA A;  3J8F 2;  2VXJ A;  3POS A;  3FL7 A;  1EV1 1;  2E6V A;  3B01 A;  1HV0 A;  1VMJ A;  2ZGL A;  2GMP A;  3BKZ A;  1W03 A;  1NOV A;  3MIB A;  3DKW A;  4FPE A;  3O14 A;  3Q8E A;  4H2A A;  3DN7 A;  3PUI A;  3T3Y A;  5I8T A;  5JI7 A;  2JE9 A;  2NPI A;  2RDR A;  5DAP A;  2P3J A;  2NN8 A;  3AK0 A;  5FUN A;  3VZM A;  1JS9 A;  1POQ A;  2F4P A;  3LB9 A;  1MS0 A;  4HLT A;  4OI2 A;  4Q0S A;  3VDA A;  3T0A A;  1YJK A;  4JHT A;  4V2V A;  3III A;  1GOF A;  1G9A A;  1W04 A;  3AP4 A;  5K0U C;  2XL7 A;  1OA3 A;  2B8M A;  3I3B A;  1ENX A;  2BWC A;  1EY2 A;  4FPO B;  3QLQ A;  4AQS A;  4QPI B;  1GZW A;  2V5Y A;  1G8W A;  3GZU C;  2JDK A;  3SCH A;  1B09 A;  4CPB A;  1R1Z A;  1UZY A;  5DAW A;  5FMO L;  3WSO A;  5JAX A;  3O1S A;  2HWF 1;  2FQP A;  4GAL A;  2BVB A;  1X8M A;  1QXJ A;  3LPF A;  4HL0 A;  3ON7 A;  4RD7 A;  3TEZ A;  5JMC A;  2CNA A;  4PLO A;  3VHN A;  3Q8C A;  3ZXJ A;  3JCI A;  4IGQ A;  4MXV A;  4B29 A;  3E6C C;  5F3G A;  2VUJ A;  5TSW A;  2Y34 A;  3VBS A;  1WCD J;  4XHB A;  1YUD A;  1BK0 A;  3TEX A;  2XON A;  1H2M A;  1U12 A;  4JV4 A;  5F39 A;  4BH9 A;  4JQT A;  3QAC A;  4G3Y C;  3BTA A;  1PNF A;  3K4A A;  3NQH A;  1ASJ 3;  4GQ7 A;  5JOY A;  3AP6 A;  2BTV C;  4A4A A;  4XE9 A;  4XQW A;  4Q4V 3;  1C3H A;  2ZXQ A;  4C8D A;  1ASJ 1;  4CCL A;  1IQD C;  1QOS A;  2EAL A;  2GC2 A;  4P9J A;  1E5H A;  1GQP A;  1PO1 1;  2NZ9 A;  1RUJ 3;  3AFK A;  4BQ4 A;  3E5X A;  5JIU A;  1PMI A;  2R04 3;  4QPW A;  3ILN A;  5FDB A;  1ZVF A;  5FFO C;  4PI0 A;  2CU5 A;  1PVC 2;  1FMD 2;  5JOW A;  4PJY A;  4QWN A;  4F7Z A;  4LBL A;  4CDQ C;  2ZA9 A;  2YGL A;  3HN1 A;  1CWP A;  5T3N A;  5L9R A;  2FDG A;  1S55 A;  3KSC A;  1W6P B;  3VBR C;  1A6C A;  1SQ4 A;  5JSO A;  2JWP A;  4AOC A;  4B3N A;  3NNG A;  3ZPO A;  1E5S A;  3Q8F A;  3ZYF A;  4GB3 1;  4OUL A;  1DQ2 A;  2EIC A;  3C7H A;  3DPR A;  2WSV A;  3NW4 A;  1VBE 3;  5CKM A;  5DQ0 A;  4YVS A;  3ZFG C;  3SEP A;  2J1S A;  1S0D A;  4WM7 C;  1W9S A;  1Q56 A;  2HKX A;  2W5F A;  5FYT A;  1RC6 A;  1RTV A;  4N43 A;  5CZK A;  4FQZ A;  2NM1 A;  1L3J A;  3RS6 A;  5FLI A;  5A7P A;  4AVV A;  1VR3 A;  4QXB A;  5F6K A;  1AXY A;  3H42 B;  5EQU A;  3KV6 A;  2IXJ A;  2JD9 A;  4YZ3 A;  2XWJ B;  5GJ6 A;  3BOP A;  2B4K A;  3JU9 A;  4KU8 A;  4TN7 A;  5DPN A;  4KGG A;  5AFE A;  3RZG A;  4IET A;  2QDN A;  1SBF A;  3HQU A;  2H6C A;  3VBF B;  1IS4 A;  5C71 A;  3HQR A;  4Y22 A;  3RYR A;  2PLV 3;  4NE9 A;  3SH4 A;  3UL2 A;  4IER A;  2KR2 A;  3S7E A;  1XU1 A;  4AFC A;  4DPN A;  3J9S A;  5EHD A;  1LOC A;  4Q4Y 3;  1LU2 A;  3C7E A;  3D0S A;  1MR5 A;  2H0B A;  1ENS A;  1AHS A;  2VVE A;  1JYT A;  1PIV 3;  2GN3 A;  2R0F A;  1RUC 3;  5A6Q A;  3RZK A;  1JUH A;  1VBA 3;  4DO0 A;  3DPR B;  5L36 A;  5J36 A;  2DCY A;  3D5O A;  4Z1V A;  5J96 B;  3PVB B;  1WGP A;  3J4U H;  1QJX 3;  4W6Y A;  3G7D A;  3OGG A;  5IFP A;  4LE4 A;  5BNO B;  1Y43 B;  4UAP A;  4K21 A;  1CX4 A;  1NLS A;  2QVS B;  1UX6 A;  3POW A;  4CCN A;  5JR7 B;  3T4H B;  4BME A;  1H8T B;  2Z5W A;  2JDP A;  1RUD 2;  3S5Q A;  1JZ7 A;  3BOW A;  2OKX A;  5C4W B;  1O4Y A;  3RVH A;  4YG0 A;  2ZKN A;  4CUC A;  2AR6 A;  2YBS A;  4LK7 A;  4K40 A;  3QBQ A;  4D8M A;  5A3U A;  1OOP A;  1GAN A;  1PK6 B;  1RUE 2;  2PN5 A;  2XJT A;  3O7O A;  3D82 A;  3WDW A;  3AX4 A;  4CXY A;  4IEV A;  4IV1 A;  5SV8 A;  3H3U A;  3GZA A;  5F9T A;  3KCX A;  5JXG A;  3BU7 A;  5F5Q A;  1XRU A;  1NA1 B;  5LZ6 A;  1X9P A;  4ZHN A;  1OFN A;  4E2Q A;  3I2F A;  5FPB A;  3UGG A;  4HZF A;  2OXB A;  2WII B;  1APN A;  4CEY A;  1UMI A;  1XU2 A;  4BIO A;  1O5U A;  1GBG A;  2V73 A;  1W6Q A;  2X10 A;  3SQO A;  5LK7 B;  2ZKL A;  5FUI A;  2HEW F;  4I3P A;  2ZX3 A;  2A70 A;  2ZJC A;  1TMF 2;  4KH9 A;  2RMU 3;  5GZG A;  1RJ8 A;  1W6Q B;  2Y33 A;  3I7D A;  1D2Q A;  4DZG A;  4FTS A;  1LGC A;  4HVO A;  3AKT A;  3K3N A;  2JDH A;  2VVF A;  4OHX A;  3MUZ 1;  2RS3 2;  2FZ2 A;  4COW A;  1CAW A;  4OHV A;  1S0F A;  4KMQ A;  2DFC A;  4QPG A;  2VCC A;  5F3C A;  2OUJ A;  3QH6 A;  2WYS A;  3O0X A;  4CVU A;  5T5P A;  1COV 2;  3M3C A;  5GAL A;  5C9A B;  1T6B X;  1DGW X;  3LWC A;  4AI2 A;  2VZU A;  3OD0 A;  4NAO A;  4Z92 B;  4AVB A;  4H7M A;  4IEO A;  3DEM A;  3FHQ A;  1LTE A;  4KG8 A;  2Y8K A;  4PHZ A;  3UGF A;  1VBC 2;  1VAV A;  1XNK A;  4M01 A;  4MX3 A;  3NNL A;  2DBI A;  4JRL A;  4FPK A;  5I93 A;  5FPA A;  3JXS A;  2LAL A;  1OPM A;  1NE6 A;  4NO4 A;  3QD6 A;  3OF1 A;  1QQP 2;  3LEI A;  1OPO A;  1GU3 A;  1Q5O A;  2VQ0 A;  2JIC A;  2WWS A;  5FZ0 A;  5FZG A;  4YZ1 A;  4XDP A;  3I3M A;  1G86 A;  1T2X A;  4NRP A;  1OLM A;  2VUA A;  2VZ1 A;  4ONU A;  3B5L B;  3TRS B;  4EZ4 A;  5KHJ A;  2DTY A;  4KI5 M;  3SIS A;  4UYB A;  3OPW A;  4CP9 B;  1AX0 A;  2E53 A;  2D6K A;  3UJO A;  2ZEZ A;  1V0A A;  2MPF A;  3AM2 A;  4O9G A;  3O1T A;  4FXK B;  2ARC A;  1V6I A;  2GNM A;  2D6M A;  4NRQ A;  3WQ7 A;  1ULD A;  4OCT A;  1SBD A;  2Y6G A;  4R9C A;  1XXN A;  4G4F A;  3ZFE A;  1RXG A;  1LOD A;  4NHM A;  1STM A;  3DV8 A;  4I30 A;  4B4Q A;  1L7Q A;  3UT0 A;  4AWD A;  3J8F 1;  1O3R A;  3T09 A;  1AYM 2;  4C0H A;  3EO6 A;  1ZRE A;  5IHR A;  4HK9 A;  1G9C A;  2VCB A;  3OSD A;  1H30 A;  1MQT C;  4BK4 A;  1OOP C;  3UJQ A;  4PLM A;  5LAT A;  2ZAA A;  4C1W A;  3PHM A;  5ACA 1;  4MXW B;  3PVE A;  4M0N A;  1W6N B;  3IBM A;  3UKT A;  1PZ9 A;  1HXS 2;  5CIR A;  3HMY A;  4RR3 A;  2AUY A;  5D8A B;  5H9P A;  3JD7 1;  4BMB A;  3CDZ B;  2XLF A;  1FPN 1;  2OPW A;  3GF6 A;  5A3P A;  3WW3 A;  4AVS A;  1W2U A;  2CGN A;  5LK5 A;  5K8S A;  1ENQ A;  1M06 G;  4XUP A;  3LDR A;  2F4L A;  3WG4 A;  4OI4 A;  4UFI A;  4AGR A;  5FMD A;  3ZXD A;  4DOU A;  2QQP A;  1BJQ A;  1H6X A;  3KVB A;  5IAV A;  2R07 3;  3T1M A;  2GP5 A;  4QQH A;  5FYM A;  4XUQ A;  2D40 A;  2VMD A;  4QDS A;  1LOE A;  3BIW E;  4NIG A;  1ONA A;  5DUX A;  5FY5 A;  4XXP A;  1W2N A;  4DXT A;  1GP6 A;  3WF0 A;  1YLL A;  3WNO A;  3POF A;  3G6J B;  4JDO A;  5EYX A;  4N7I A;  3TNP B;  1G9F A;  3OUH A;  5F2W A;  3VDB A;  1CAX B;  4GMP 0;  3W59 A;  4AEK A;  4EE2 A;  1ENR A;  1HRI 1;  3A0K A;  5JPN B;  3GCX A;  3B3Q E;  4LTA A;  1ND3 B;  1AR9 3;  5F1R A;  1OF3 A;  2RV9 A;  4QM9 A;  1PVX A;  1NXD 1;  4BDV B;  4CCC A;  2GZW A;  2YUE A;  3MLJ A;  2YRO A;  4TYS A;  3ZDS A;  2ZS6 B;  2C0Z A;  1LNS A;  4XBN A;  3CF6 E;  3LF7 A;  1H6Y A;  1QJZ A;  2LTN A;  2ZHM A;  4XF4 A;  5I91 A;  1RMU 1;  2ZGU A;  3NKT A;  1CIY A;  4CEW B;  2Y38 A;  1QOO A;  4GMP 3;  1VRH 3;  2G19 A;  3RI9 A;  5JZG B;  1LOF A;  4LO4 B;  5H9Q A;  3SC7 X;  4JQR A;  3BVC A;  2BNN A;  3GHM A;  2B5H A;  5E6H A;  3WW1 A;  3Q9O A;  1DLL A;  1Q8P A;  4LUM A;  4J6G A;  3LEM A;  5F3I A;  4JX0 A;  4OHZ A;  5ISL A;  2FBE A;  3HNM A;  4A41 A;  4ASK A;  3A7Q A;  2Y60 A;  1NXM A;  3IZO A;  4XUR A;  4ZKT B;  2WAO A;  4J25 A;  4RHV 2;  1FMD 3;  5LRR A;  1HRI 2;  1D2S A;  1COV 1;  1J3R A;  3WF2 A;  3FUO A;  1BVP 1;  3FFZ A;  3IMM A;  4PIZ A;  4FOV A;  3ASI A;  3GJA A;  2JE8 A;  3NAP B;  2FCV A;  3ZIX A;  2QQI A;  3N4M A;  1VAL A;  2YBP A;  3AYC A;  1DHK B;  3NJY A;  1FOD 2;  4FOW A;  1LOA A;  4Z2A A;  1XPW A;  1VBC 1;  4J1X A;  2PHL A;  3PUH A;  4LUL A;  3C2U A;  2BFU S;  1NLR A;  3M3E A;  1JZ3 A;  2N7G A;  2WAB A;  2DBN A;  3M2M A;  4MO3 M;  1S2K A;  2A71 A;  2XWB B;  5FZ3 A;  1PHM A;  3SEE A;  2HJI A;  1DYP A;  1RUI 3;  2VZV A;  2CSG A;  4L92 A;  4KBB A;  4AHY A;  5BNO A;  1HDK A;  2BFU L;  1YI9 A;  2E7Q A;  3SKJ E;  4CSW A;  3MDP A;  3D8C A;  2KA3 A;  2ZGT A;  2W9X A;  3GNE A;  4NRM A;  1SG3 A;  4RSU A;  3DKQ A;  2YYO A;  4QMA A;  1AYN 2;  3TNQ A;  2O8O A;  2AEZ A;  4GJY A;  1DZR A;  1SLB A;  3MGU A;  4B8E A;  4ET7 A;  2RJL A;  4IEZ A;  1NCR C;  1W0N A;  3V56 A;  1RIN A;  3MIE A;  4AAP A;  5GM0 A;  3OBR A;  4R4Z A;  2GC3 A;  4NAM A;  3KLS A;  5FZM A;  4E8D A;  5HBA A;  1DIW A;  3OUI A;  1SDD B;  2A5Z A;  5JOX A;  1NA1 C;  1FV3 A;  2LW8 A;  5IAT A;  1I6X A;  1YYN A;  4XIL A;  2SLI A;  4Q4W 3;  3U37 A;  2CTV A;  1REE A;  5FP8 A;  3X29 B;  1GUI A;  5A7N A;  1RUH 1;  1POV 1;  2HWB 1;  3T2T A;  2WRA A;  1VAK A;  2VUC A;  1OKQ A;  4LIT A;  5C4W C;  2PHX A;  2C9K A;  2GC1 A;  2Y6J A;  5K4L A;  3LSE A;  4QX2 A;  1AXK A;  4GWN A;  1VMH A;  5FYS A;  3BPS A;  3THD A;  3EYP A;  3LCP A;  5IW0 A;  2OS2 A;  3CU7 A;  3HPN A;  3UKV A;  2XJS A;  4DRR A;  5IVV A;  1SPP A;  1CN1 A;  1J3Q A;  2RDN A;  2ZX2 A;  4ZS2 A;  2A3W A;  4Y1Z A;  2JG9 A;  4M3C F;  4CEY B;  5C5T A;  1MVE A;  1PGW 2;  2GSY A;  4YGB A;  5FRA A;  1VBB 1;  3N7L A;  1SDW A;  4Q4V 1;  3V0A B;  5A3N A;  5FZB A;  3OPZ A;  4IQP A;  3GBW A;  1FAY A;  1MS5 A;  1W9T A;  4PDW A;  4AVC A;  4FTB A;  1PO1 3;  3EMR A;  3N7K A;  4QGN A;  2WNU C;  5M0T A;  4BQ3 A;  3USU A;  4XZU G;  1URX A;  2WQ8 A;  4QHO A;  2DCK A;  3NV4 A;  5JPM B;  2YU2 A;  3WW2 A;  1UPS A;  4IL7 A;  5F5C A;  3ZFF A;  2DVF A;  2QDR A;  5KHK A;  2VZS A;  4CDX A;  1W9F A;  2HWF 2;  4P9G A;  2D7F A;  4Y3O A;  2BPA 2;  5C4W A;  3AKP A;  2W1S A;  1POV 0;  2XG3 A;  1R09 1;  5CFD A;  5T55 A;  4BLJ A;  5FP3 A;  2JG9 C;  1Q3E A;  2VNO A;  2CAU A;  4D6Q A;  3U75 A;  3V64 A;  2J1T A;  1AYM 3;  2HWE 3;  2LM3 A;  2TNF A;  4I09 A;  1UOB A;  1ZYB A;  3NJV A;  2HLE A;  1WLC A;  4IGO A;  3H3L A;  1WUV A;  3TWI A;  1AYM 1;  1X7N A;  3H8U A;  5L73 A;  1R08 3;  2OZ6 A;  5BYN A;  1OUR A;  1VAM A;  2H0V A;  5A3T A;  4MXW A;  3RZM A;  1LJ7 A;  1UU4 A;  1KQR A;  1HKD A;  3W5N A;  2EF6 A;  3KV4 A;  2VOW A;  3KT7 A;  1N1Y A;  1YQ6 A;  2PHU A;  1CAU A;  2YV8 A;  2ZAH A;  3BPZ A;  4K20 A;  1KFU L;  3I3D A;  2OUH A;  1PIV 2;  4JTN A;  1BBT 1;  4WVZ A;  3OGR A;  2NQY A;  1H8T C;  3MID A;  4ZPI A;  4I3G A;  1C8M 2;  1JYW A;  3TYJ A;  5JXJ A;  3OGJ A;  3POG A;  1WCS A;  2EIB A;  1BBT 3;  1O91 A;  4YVS C;  3THT A;  3IAP A;  2RG4 A;  2Z4F A;  5CU1 A;  4W6W A;  3B93 A;  1OKO A;  3M3Q A;  3PJQ A;  2XJV A;  2IXK A;  4RQP B;  4FXG B;  5IK8 A;  4L97 A;  4IEW A;  2E63 A;  3POY A;  1TQ5 A;  1CES A;  2FDI A;  5C3Q A;  3LEK A;  3M7A A;  4M00 A;  2GAU A;  4GWJ A;  5LBE A;  5J3U A;  4D7S A;  4BYY A;  3AXE A;  2PHF A;  2WR9 A;  3NST A;  5F6L B;  3VZK A;  1RUC 1;  1VBA 1;  2UWB A;  1ULC A;  3UET A;  3TN9 2;  5DG1 A;  1S0E A;  3VDD A;  1V00 A;  1W8Z A;  5DZG A;  4AI8 A;  5KWR A;  2XPJ A;  1QXR A;  3ZM8 A;  1GZC A;  2UWA A;  1Q43 A;  5EJ3 A;  1ZZB A;  4UBH A;  1SZB A;  1OLM E;  2XUE A;  1IGO A;  2E31 A;  4A3X A;  1HQN A;  2C26 A;  4CU9 A;  1FOD 3;  1FPN 2;  3K2O A;  1LHO A;  2G9G A;  4ASL A;  5CVR A;  2RS1 2;  5K0U A;  1SCR A;  1N47 A;  4Q0V A;  1EUT A;  2FMY A;  4FCA A;  4YG6 A;  5GKA C;  4ERO A;  5CFC C;  1CIW A;  4RGG A;  5BY5 A;  1F31 A;  5FYI A;  5FLJ A;  1A8M A;  1JI6 A;  4FSJ A;  2VNV A;  1BLZ A;  4BQW A;  1KXG A;  5A3W A;  3BB6 A;  4URA A;  1YXW A;  4BM8 A;  1WW4 A;  2E32 A;  5C33 A;  4URT A;  1WME A;  5FMB A;  4N9I A;  5FZD A;  4AL9 A;  2X8K A;  2Z69 A;  4A7K A;  4K6B A;  3VHR A;  1AR7 1;  1WLW A;  2ID4 A;  2J1E A;  4C91 A;  4CEW C;  4QHB A;  1O3T A;  1OA4 A;  3WCR A;  4QAW A;  5IVB A;  2DV9 A;  4Y26 A;  1ODN A;  3SXW A;  1RUE 3;  1IKQ A;  1MEC 3;  3FHI B;  4KQ7 A;  1N3P A;  1JYV A;  5T52 A;  3MW4 A;  2JX9 A;  1A8D A;  5JWP A;  1RUE 1;  1UKG A;  3J7M A;  4YNI A;  4TWT A;  4AEM A;  5E88 A;  5C6C A;  4O7X A;  2GNT A;  4QX3 A;  1TEI A;  3WQ0 A;  1GFF 2;  5CKN A; 
#chains in the Genus database with same CATH homology
 2J1R A;  4OUE A;  2E26 A;  4CUA A;  2VZR A;  1F4H A;  1I5P A;  2VZQ A;  3DYO A;  5B4X A;  3NNG A;  1J83 A;  4QX1 A;  5LA1 A;  3C7H A;  2EIC A;  3DYM A;  5DQ0 A;  3WNP A;  4RN5 A;  4OYU A;  3T2O A;  3SEP A;  2J1S A;  5J1X A;  1W9S A;  5C70 A;  1BHG A;  2VC9 A;  2W5F A;  1O8S A;  2CDO A;  5CZK A;  4QB6 A;  5LA2 A;  2WO2 A;  3W5M A;  3HNY M;  2JD9 A;  2B4K A;  3C7F A;  3MO4 A;  5DPN A;  3LE0 A;  3K4Z A;  3A22 A;  1PX4 A;  3SKV A;  5C71 A;  2ZEY A;  2VME A;  2J22 A;  2ZEW A;  4HG6 B;  3OEB A;  2X09 A;  3AC0 A;  3IB3 A;  2Y64 A;  2VL4 A;  5JXI A;  1K3I A;  4DUV A;  3C7E A;  1HN1 A;  4AAX A;  2VCA A;  1K42 A;  2W1U A;  2WO1 A;  3VD7 A;  2L9L A;  2BBA A;  3OB8 A;  2W1W A;  1W8O A;  5IFP A;  4UAP A;  2VOT A;  3WF4 A;  5DMY A;  3OG2 A;  3A23 A;  2QBX A;  1JZ7 A;  1CZS A;  5G04 L;  1UY3 A;  1CZV A;  1R64 A;  2OKX A;  1UX7 A;  4CUC A;  2HYX A;  4D8M A;  3I97 A;  1K45 A;  3J7H A;  3D3A A;  3LEG A;  3IAQ A;  5JXG A;  4P02 B;  3I2F A;  2EID A;  1PMJ X;  4TXW A;  1GOG A;  5A1A A;  2VTF A;  1JU4 A;  4A42 A;  3A21 A;  2JKX A;  2WDB A;  1UY1 A;  1UMI A;  2QQM A;  3P1I A;  4PT6 A;  2X10 A;  4OMC A;  4RYD A;  1EUU A;  1WCQ A;  2W91 A;  5FUI A;  4E8C A;  3VD9 A;  4CU7 A;  4JHZ A;  1ULP A;  3MUZ 1;  2VZP A;  3DYP A;  5C7G A;  5IFT A;  4KMQ A;  2VCC A;  5LCW L;  1YQ2 A;  2WYS A;  4CVU A;  1P8J A;  2VZU A;  4PF1 A;  3K46 A;  4LHS A;  3FHQ A;  4TTG A;  1NKG A;  3C8X A;  4W8J A;  2Y8K A;  1NX9 A;  4W50 A;  3I2K A;  3JXS A;  3LEI A;  4XUO A;  1GU3 A;  3CMG A;  2WZE A;  1OF4 A;  5JXH A;  1OH4 A;  2BGO A;  1T2X A;  3C7O A;  2WUH A;  2VZ1 A;  1KEX A;  3MV0 1;  4KI5 M;  5HPO A;  1L7R A;  4LQR A;  2ZEZ A;  4MAD A;  2YC2 A;  2RVA A;  3C7G A;  4DXR A;  3MBW A;  1JZ2 A;  2XOM A;  2Y6G A;  3ECQ A;  1L7Q A;  2W3J A;  4P00 B;  3T09 A;  5LA0 A;  1JZ5 A;  4MOA A;  4JKK A;  4QB2 A;  1JHJ A;  5IHR A;  1UY4 A;  2VCB A;  4BK4 A;  3VDC A;  4GWI A;  1OD3 A;  5F7U A;  1KGY A;  2KD7 A;  3HEI A;  1GNY A;  2QQN A;  3BN6 A;  3CDZ B;  3T2Q A;  4BK5 A;  1JZ8 A;  2W95 A;  4XUP A;  1GOH A;  1UY0 A;  2J7M A;  1JYX A;  1H6X A;  1UYX A;  5HXM A;  3ETP A;  4XUQ A;  1JZ6 A;  2VMD A;  4QDS A;  4QDR A;  5DN2 A;  1UWW A;  3HOB A;  3UES A;  2VO5 A;  4W4Z A;  4DXT A;  3WNO A;  3WF0 A;  1TVG A;  4OMD A;  4ZZ8 A;  1XNT A;  2Y6L A;  4DEV A;  2QQK A;  1UXX X;  4GZ9 A;  3WNN A;  2X05 A;  2YG0 A;  5EJZ B;  3VDB A;  2J1V A;  4XUN A;  2WO3 A;  3OGS A;  4P08 A;  1CX1 A;  3WF1 A;  4UI9 L;  2WBK A;  1J84 A;  1OF3 A;  2RV9 A;  4BDV B;  2J1A A;  3LPG A;  2DDU A;  1LNS A;  1H6Y A;  1US3 A;  3WEZ A;  2WZ8 A;  2VMF A;  1CIY A;  3VD3 A;  2JDA A;  1O8P A;  3HN3 A;  4ARX A;  4OZO A;  2XHN A;  3FN9 A;  3GDB A;  4JX0 A;  2ORZ A;  3HNM A;  4A41 A;  3A7Q A;  3F2Z A;  3OGV A;  3WNM A;  4XUR A;  2YFZ A;  2WAO A;  2W92 A;  1JZ4 A;  1UZ0 A;  2XQX A;  3ACH A;  2LS6 A;  3WF2 A;  3K75 B;  3I2G A;  2JE8 A;  3IDA A;  4LKS A;  1W8N A;  2QQI A;  4ZY9 A;  4UOJ A;  3FHA A;  4Z2A A;  1OT5 A;  2YFU A;  1XPW A;  3PUH A;  5G05 L;  1TG7 A;  1JZ3 A;  2E33 A;  2WAB A;  4P5Y A;  1W99 A;  2C4X A;  3T0D A;  2QQO A;  4MO3 M;  3ACI A;  1UY2 A;  2VJX A;  3WQB A;  3CZJ A;  3SEE A;  1ULO A;  2VZV A;  3CZU A;  2EIE A;  2BZD A;  3HJR A;  3ACF A;  1XNA A;  3SKJ E;  2R7E B;  2W9X A;  1SG3 A;  2V5D A;  1D7P M;  4DUX A;  4JKL A;  2W47 A;  2ZEX A;  1DLC A;  2W46 A;  4ET7 A;  2W1Q A;  3MV1 1;  1W0N A;  4FI9 A;  3EB7 A;  2W94 A;  1JU3 A;  1PMH X;  4MGQ A;  5CYY A;  4E8D A;  4QDQ A;  2VQU A;  3CIH A;  1SDD B;  1UMH A;  2LW8 A;  3GGL A;  4DUW A;  2CDP A;  4XUT A;  3U37 A;  1RYY A;  4ZZ5 A;  1GUI A;  3T2P A;  3GM8 A;  5B4N A;  4A3Z A;  1NAE A;  3WNL A;  2C9K A;  2Y6J A;  2ORX A;  1UYZ A;  4D0Q A;  1UXZ A;  4QX2 A;  2DCJ A;  2Y6H A;  5I0D A;  3THD A;  2YC4 A;  3EYP A;  1JYN A;  2VZT A;  3T0B A;  3HPN A;  5EIY B;  2VM9 A;  4L0P A;  3LQC A;  3WF3 A;  2J1U A;  1F4A A;  3P6B A;  1MPX A;  1W9T A;  2YB7 A;  3MUY 1;  1DYO A;  2Y6K A;  4BXS V;  4JKM A;  4XZU G;  2WQ8 A;  3K77 A;  2DCK A;  1WKY A;  2B9V A;  4ZXE A;  2VZS A;  3I2J A;  4CU8 A;  2W1S A;  3K4D A;  3NRU A;  3ACG A;  2J1T A;  2WN3 A;  2HLE A;  3NJV A;  1CZT A;  5EJ1 B;  4QX0 A;  4CU6 A;  2WAA A;  1DP0 A;  1XC6 A;  2VR4 A;  5IJR A;  2W87 A;  4A45 A;  3W5N A;  3THC A;  1K12 A;  3OEA A;  1NUK A;  3WNK A;  4MGS A;  3I3D A;  4CUB A;  5IYY A;  3CKH A;  3I2I A;  2WN2 A;  3OGR A;  4KWU A;  1JYW A;  3FL7 A;  5JXJ A;  3E1F 1;  4M4R A;  2EIB A;  3IAP A;  2V4V A;  2Z4F A;  3PUI A;  3CQO A;  3VD4 A;  2V72 A;  3BGA A;  1UYY A;  3I2H A;  3DEC A;  3LEK A;  2BGP A;  4GWJ A;  3OBA A;  1GMM A;  2VZO A;  4IUG A;  4ARY A;  2VMC A;  3VDA A;  2BER A;  3T0A A;  3UET A;  2QQJ A;  3III A;  1GOF A;  3HNB M;  2VZ3 A;  3ZM8 A;  3I3B A;  4XVH A;  2E31 A;  4BJ0 A;  3T08 A;  4PQQ A;  2PQS A;  4CU9 A;  2C26 A;  4AG4 A;  1O59 A;  3WSO A;  3I3E A;  1W9W A;  4YPJ A;  3LPF A;  1EUT A;  2QQL A;  1PX3 A;  1JI6 A;  1SHW B;  3UNP A;  5JR2 A;  4DXS A;  4LPL A;  3GXU A;  2E32 A;  5JMO A;  3VD5 A;  3ABZ A;  1US2 A;  2XON A;  2VQT A;  3NJX A;  2ID4 A;  2J1E A;  3K4A A;  3NQH A;  2RJ2 A;  4QAW A;  4A4A A;  4M4P A;  4DEQ A;  2ZXQ A;  4A44 A;  1IQD C;  1GQP A;  1JYV A;  4A6O A;  4QPW A;  4QB1 A;  5JUV A;  4QX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...