2J1EA

High resolution crystal structure of cbm32 from a n-acetyl-beta- hexosaminidase in complex with lacnac
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
142
Chain Sequence
PRTVKITASSEETSGENAPASFASDGDMNTFWHSKWSSPAHEGPHHLTLELDNVYEINKVKYAPRQDSKNGRITGYKVSVSLDGENFTEVKTGTLEDNAAIKFIEFDSVDAKYVRLDVTDSVSDQANGRGKFATAAEVNVHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Interaction of a Carbohydrate-Binding Module from a Clostridium Perfringens N-Acetyl-Beta-Hexosaminidase with its Carbohydrate Receptor
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
molecule keywords HYALURONIDASE
total genus 31
structure length 142
sequence length 142
ec nomenclature ec 3.2.1.169: Protein O-GlcNAcase.
pdb deposition date 2006-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2j1eA00
5JUVA 3VD5A 5JXGA 4XUNA 1CZTA 5B4XA 3IB3A 4OMDA 4P00B 1US3A 4XUOA 3C7FA 3I2HA 4KMQA 4CUCA 1J83A 1PX3A 2WZEA 3K77A 5CYYA 3MUZ1 3WF2A 5A1AA 1UXXX 1W9SA 3SKJE 1CZSA 1R64A 2J7MA 3OBAA 2Y6LA 2YB7A 4RYDA 2BZDA 4CUBA 3I2FA 4OYUA 3LPFA 2W92A 3A23A 3MBWA 1JYXA 5LA0A 3I2IA 3HEIA 1O8PA 1UYZA 2WN2A 4MGSA 1SHWB 3HNBM 1P8JA 4BJ0A 3U37A 5FUIA 4ZXEA 3I2KA 3MUY1 3DYPA 2JDAA 2ID4A 1UYXA 2RJ2A 1KGYA 3HPNA 2WO2A 5EJZB 1JZ6A 3WSOA 1CIYA 2VMFA 2WYSA 1GUIA 1SG3A 2VO5A 4DUVA 2W91A 3E1F1 5IYYA 3LE0A 2B4KA 2W94A 1W8OA 1W8NA 4OZOA 5J1XA 2PQSA 3C7HA 3NQHA 2ZEXA 2WO1A 2Y6KA 1K12A 2X09A 1GOHA 1JZ8A 4QX1A 2YG0A 4OUEA 1XNAA 1JI6A 2W87A 1JU3A 1H6YA 1XNTA 4XZUG 4ARYA 3A21A 1NUKA 4IUGA 1JYNA 2VCBA 2WO3A 2VZSA 3VD3A 2WAOA 3DYOA 5I0DA 1XPWA 4GZ9A 1PMHX 3C7GA 1PX4A 4E8DA 4ZZ8A 4ET7A 1GU3A 2Y6HA 3ABZA 3THCA 3OB8A 1JYVA 2QQMA 5CZKA 4QX0A 3DYMA 3CZJA 1UMIA 4UAPA 3T08A 4DEVA 3CDZB 3EYPA 5IFPA 2ORZA 1OF4A 1KEXA 4FI9A 2RVAA 1EUUA 2Y8KA 3VD4A 2E31A 4ARXA 1LNSA 2J1RA 2QQJA 4QDQA 1UY1A 2EIDA 4L0PA 3MO4A 2VMCA 2BBAA 1CX1A 2QQKA 1JZ7A 3GM8A 1DYOA 4W4ZA 3ACHA 4DUXA 5C7GA 2QQLA 1NKGA 2HYXA 1K3IA 2VZQA 3CKHA 2BGOA 1NAEA 3ECQA 4PT6A 3WF4A 3OG2A 2WABA 1TG7A 1L7QA 2ORXA 3A7QA 4XUPA 5LA2A 4BDVB 3I3DA 2WZ8A 3MV01 4LKSA 3CZUA 2ZEYA 2WDBA 4HG6B 3SKVA 4PQQA 2ZEWA 1UZ0A 1XC6A 1UX7A 3VD9A 2XQXA 2V5DA 2EIBA 2LW8A 1K42A 1W9WA 4CU8A 2J1VA 4A45A 2J1AA 3T2OA 5IJRA 2X10A 3P1IA 4XUQA 3WF0A 1UYYA 3CMGA 3GGLA 2YC2A 3WNMA 1F4AA 1JZ4A 4TXWA 3WEZA 4DUWA 3I3EA 3LPGA 4BK4A 4TTGA 4XVHA 4LHSA 4BK5A 3FN9A 2L9LA 3NJXA 3WNNA 4A3ZA 3FHAA 2VZUA 2W1SA 4JKLA 4XUTA 4A4AA 3I2GA 3T2QA 2VMEA 2VCAA 2VR4A 4MGQA 3SEEA 4JHZA 4AG4A 2W95A 3JXSA 2HLEA 5EIYB 3OGSA 4YPJA 2DCKA 1US2A 3ACFA 3C7OA 4ZY9A 4QPWA 3WNLA 4PF1A 2Y64A 2WUHA 3AC0A 2VM9A 3OGRA 1UY3A 5B4NA 1NX9A 2JE8A 2VZPA 3T0BA 2VZTA 3ZM8A 2QQNA 2VZRA 2VQUA 4CU6A 5C71A 4MADA 2QBXA 3BN6A 3I2JA 5G05L 3CIHA 3W5MA 4P5YA 1W0NA 1UY2A 4QX3A 3HNMA 1GMMA 1OF3A 1PMJX 1T2XA 4CUAA 1O8SA 3VDAA 4JX0A 3WNPA 4DEQA 3D3AA 5F7UA 4P02B 1K45A 1EUTA 1UY4A 5JXJA 1JHJA 2WAAA 3WNKA 1O59A 3HN3A 2V4VA 2E26A 2J22A 3F2ZA 2ZXQA 3MV11 1GQPA 2XOMA 4P08A 4KWUA 4DXRA 2E33A 2VZ3A 2VCCA 3PUIA 4QB1A 5HXMA 4W8JA 1ULPA 5DN2A 2Y6GA 2C9KA 2J1UA 3FL7A 5JXIA 5LA1A 2J1TA 3VDBA 2RV9A 2XHNA 2Z4FA 2V72A 3IAPA 4LPLA 1JZ3A 4CU9A 4QDRA 2Y6JA 3K4AA 1H6XA 2VZ1A 1JU4A 2VZOA 4E8CA 3LEKA 3WF1A 1OT5A 3IIIA 3K75B 4JKKA 2W1UA 1W99A 2WQ8A 4GWJA 3A22A 4A41A 3IAQA 5IFTA 4Z2AA 3UESA 4D0QA 3VDCA 2VJXA 1WKYA 3ACGA 4DXSA 2DCJA 4LQRA 3W5NA 3CQOA 1YQ2A 3UETA 3UNPA 3WF3A 4M4PA 2YFZA 3T0DA 2BERA 3LEGA 2WN3A 3I97A 4QB2A 4UI9L 3LQCA 2YFUA 1GNYA 5G04L 1WCQA 3PUHA 2YC4A 2W47A 3J7HA 2EIEA 3P6BA 4MO3M 2EICA 1F4HA 1DLCA 1UY0A 2VOTA 2X05A 5LCWL 3K4DA 2VQTA 3ETPA 3GDBA 4QAWA 3NRUA 1MPXA 1ULOA 3EB7A 4OMCA 1J84A 2BGPA 4XURA 2W9XA 3C8XA 3C7EA 3OGVA 5EJ1B 1HN1A 1UWWA 2VMDA 1GOFA 2C26A 1OH4A 4A42A 3T0AA 2J1EA 2WBKA 2QQOA 2VC9A 4QB6A 3WQBA 4RN5A 2C4XA 5DMYA 1I5PA 2LS6A 2QQIA 2XONA 1JZ2A 2W3JA 2W5FA 4GWIA 4KI5M 1BHGA 3HJRA 2J1SA 4W50A 1GOGA 5HPOA 2VTFA 3T09A 4BXSV 1CZVA 4CVUA 1DP0A 5DQ0A 3NJVA 1UMHA 3K4ZA 3OEAA 4QX2A 2ZEZA 4JKMA 5IHRA 1IQDC 1D7PM 3ACIA 3VD7A 4QDSA 3DECA 3LEIA 3SEPA 3WNOA 4DXTA 3THDA 1UXZA 4A6OA 4ZZ5A 3IDAA 3I3BA 2OKXA 5C70A 4D8MA 2R7EB 5JR2A 5JMOA 2JKXA 4AAXA 4UOJA 4M4RA 1TVGA 2W1WA 1OD3A 1W9TA 2JD9A 1JYWA 1JZ5A 1RYYA 3GXUA 2W46A 3HOBA 2VL4A 2KD7A 2E32A 2W1QA 3NNGA 3K46A 5DPNA 5JXHA 3BGAA 4A44A 1L7RA 4MOAA 2DDUA 3FHQA 4CU7A 3T2PA 3HNYM 2B9VA 2CDOA 1SDDB 2VZVA 3OEBA 2CDPA
chains in the Genus database with same CATH superfamily
4NRQA 2CTVA 4EROA 5JOWA 5F32A 3Q8BA 1KFUL 5DUXA 3RRDA 4L2NA 1VMHA 4P00B 1US3A 3MIGA 1POV0 1A3KA 3C7FA 5I8YA 3GZEA 2KR2A 2R073 4KMQA 1WWYA 1RUG1 3NL1A 4CUCA 2EALA 1UF2C 4QHOA 2A7AA 2HWD1 3K77A 1QY4A 1WMDA 3MUZ1 5FPAA 3WF2A 3WQ1A 4YNIA 5TSWA 4ASKA 4ATFA 1CZSA 1LODA 5CEHA 3BI3A 2HWF2 2JX9A 2VVEA 2GP3A 2WQZC 4YVSC 1WMEA 4CUBA 2DFBA 3O1PA 1EPZA 4QXHA 1AL21 1N1YA 1XQNA 3AVSA 3IWZA 3I2IA 1YLLA 1O7FA 4JDMA 3J8F2 4YGDA 3OBRA 1S0IA 1S1AA 3AZVA 5HCFA 5GZEA 4AVBA 4QGLA 4RFRB 3J8F1 3I3QA 3I2KA 5KHJA 1GP6A 5IWFA 1T6GC 3RZKA 3LDRA 2Q1ZB 1WCDJ 3M8LA 4XCAA 1JH5A 5BNNA 5IW0A 3RQ0A 4IGPA 1AF9A 5EJZB 4DINB 4GB32 4AVVA 4AI2A 2OUJA 1QJY2 4DUVA 1ZRDA 5FKBA 3HT1A 3LIGA 2BNOA 4AYUA 1OXCA 1XNKA 5EV7A 3E1F1 5FIXA 2DU1A 4Q4V1 5FYYA 1C57A 5L19A 4CDUA 3PMSA 4EQVA 3CEWA 1SLCA 2XJUA 1NG0A 2PQSA 3ILRA 3I59B 1EV12 1RUC2 3P5BA 2DYCA 3LGRA 5AC92 5FBJA 5FWJA 2QE3A 2ZGOA 2W68A 1GOHA 3JQWA 4LKDA 4M01A 2HEVF 2XWBB 3KCXA 4GXLA 4EYUA 1GV9A 4W6XA 2E6VA 2ZKLA 5DXDA 5GZGA 1XNTA 4ARYA 3A21A 1AXKA 3MLKA 1PO11 4UF0B 5FYTA 1QJU3 4QT6A 1A6CA 2VZSA 2WAOA 4GZ9A 2PLV2 1PMHX 3AP7A 3C7GA 2K9ZA 4FPLA 4QPGB 2RMU1 1CPNA 1W9YA 3DKWA 4DPNA 3NWKA 5CKNA 5J3UA 4C0BA 4LBLA 1IPJA 4QX0A 1W0OA 3K51A 5H9PA 3RZMA 2HWD2 1DQ1A 1RMU2 4CEWC 2RDRA 1DQ6A 1OA3A 3CJIA 4ZS2A 1PGSA 1NCQC 4TLGA 2OYZA 1GZ9A 1UU4A 2Y8KA 1FV3A 4QPIB 3LEMA 4MXWB 2OS2A 2QQJA 4LIUA 2XJPA 1PO22 1S0EA 1ZVFA 3KQRA 3OGGA 4UFLA 4LE3A 4QQPA 4SBVA 1SLAA 1DQ0A 3OD4A 4Q0PA 5A7OA 4AEJA 2P17A 1WW7A 2I07B 1ND2B 1XRUA 2MEV2 2QQKA 1AYN2 3PJQA 3GM8A 1YQ8A 2D98A 4XFHA 4FOWA 1W8WA 1YNAA 3BIWE 4DUXA 4CEYC 2QQWA 4JRLA 1FAYA 3MGUA 5JOYA 1C28A 1PHMA 2VZQA 3OY8B 2A75A 3VZMA 3WDYA 4FXKB 5JSPA 4YFWA 4NRMA 1QOTA 4FBFA 3VZKA 3NW4A 4D3WA 5A6YA 4LMFA 5FZ7A 3R6SA 1ND2A 1TG7A 2R32A 4XFCA 1BQPA 2VUAA 4X6QB 4XUPA 1DGRA 5FYUA 1DZQA 3GALA 4AHZA 1RMU3 5EWSA 3W58A 1FV2A 3ZSLA 4E9KA 1O5UA 1OUXA 3H0OA 3H42B 4TWTA 3SKVA 3N35A 3DPRB 3NAPB 2HWF3 1B35A 5FYHA 5DZFA 2FBEA 3QH7A 3S57A 2V5DA 1UCXA 2EIBA 2LW8A 3M3CA 4AHWA 2D6LX 1LU1A 1RUC1 4WV8A 4WM8C 1R091 4NPRA 2WS91 1RUD2 4GH4A 2QJVA 1ZZ6A 3S5QA 3T2OA 1BCXA 1PNGA 2VOXA 2X10A 3CJIC 4N90A 4AEDC 1NLRA 1OSGA 4U36A 1UYYA 4WVMB 1SDWA 1RVF3 3CL1A 4LORA 4E4DX 2GC3A 5L7OA 1QJX3 4R52A 2P6CA 1O4YA 2ZGTA 3WEZA 4AEDA 1DGWX 3MZHA 4BK4A 3LPGA 3OUIA 4TTGA 4XVHA 4LHSA 2VMIA 2PLV1 5SV5A 4BLIA 3I7DA 4RSUA 3HBKA 4B7EA 1SBFA 2PXJA 3H3LA 5FXWA 4RFT0 3VL8A 3ZFGB 2ZKNA 1HB3A 4A3ZA 4JAAA 5FLIA 4OCTA 1YIFA 2H0BA 1FOD3 2WRAA 4GJZA 4LIVA 1NCRC 1RUH2 2A70A 2W1SA 1CJPA 3M3OA 4JGZB 4LLFA 3VKLA 3ZN6B 2D43A 1SMVA 4TYSA 4LBOA 4SLIA 4AI9A 4L99A 3ALQA 3WG1A 2RM22 2VMEA 3CHXA 3T2QA 1H1IA 2EXJA 3A4UA 4XHXA 3SEEA 4JHZA 3HWJA 1O3RA 1VJ2A 2OT7A 1Q8QA 2Q4SA 1BK1A 2ERFA 3POFA 3OGSA 1UYPA 2CAUA 1AVBA 4R9CA 4YPJA 4YM0A 3B9IA 4LA2A 3ACFA 3ZXLA 4X8NA 1TQ5A 4KGQA 3WNLA 3PJYA 3EJKA 4OHYA 3L2HA 1WA4A 1W0PA 3PNAA 1LEDA 4ZU4A 1UZZA 3OGRA 2RS51 5FO9B 1MZ6A 4Z07A 2R071 1ZZ9A 5B4NA 2D6PA 1BYHA 4NHXA 4AEDB 1VAVA 3CJIB 4L97A 5L9RA 1RUJ2 1X33A 2VZRA 4LBJA 4CDWA 1REDA 3ZN5A 1HQNA 2JJ6A 1H0BA 4Q0SA 4LO8A 2QBXA 5LA9A 1OPMA 3WUDA 4E2SA 2Y6FA 3BU0A 2LUWA 5C3SA 4N7UA 3WW4A 2ADDA 1QXJA 2A3YA 3DL3A 1PMJX 4AGVA 1UZVA 5FYBA 5KR7A 3EXUA 1D4M2 1AJKA 4JX0A 4WVZA 3WP5A 3WNPA 2CL2A 2TNFA 4Q4V3 5F7UA 3ME2A 4P02B 1K45A 5FXVA 1ZBE2 5GLTA 4GMP3 5JR7B 1EUTA 4JTNA 2C9AA 1VRH3 5A80A 3IMMA 4KWJA 2Q1MA 5LK5A 1LAJA 2DTYA 1BVVA 2ZXQA 5F3CA 3V56A 4IE0A 2C5DA 1BK0A 2K0GA 4HANA 1Y9MA 2RS31 2E33A 2E9QA 3JB8A 4JGYB 2B46X 4I01A 5FXXA 3NNFA 4M3CB 5KXCA 1ZM1A 4DRRA 1RXFA 3R4UA 4AI8A 3M7AA 1G8WA 5FZEA 2J1UA 2RM23 3ZFFC 2ENRA 5JXIA 1EPWA 4K7JA 2ZGLA 2HEWF 4JQRA 4AK3A 5HV4A 5FPXA 1WLCA 1BKZA 2OUHA 2RV9A 2XHNA 4YZ4A 4HKWA 5FMCA 3ZFEA 4EN9B 4EE2A 2WS93 5AC93 3WNXA 3D5OA 5CB7A 4LO5B 3VDDA 4BLJA 4JGYA 4CU9A 1EAH1 2VZ1A 1X9PA 5FV3A 2JB4A 3V65A 4D94A 4GQ7A 1BVP1 1DZTA 1V6LA 2RR13 3Q9OA 4RGAA 2X29A 4LUMA 4Q1RA 4ZPIA 4EN6B 1WD4A 1FT9A 2R16A 1BEV3 4MLOA 2XUMA 2Q0AA 3B5LB 2P3JA 1G7YA 1DFQA 4Q4Y1 5LBEA 1Q8VA 4TSVA 4A41A 4BMBA 1OURA 2EF6A 5IFTA 4Z2AA 2WNVB 4K21A 5IT6A 4FXGB 5H9QA 3ACGA 4DXSA 3B93A 4K1YA 1KRIA 2WNUA 4OI1A 5FZ1A 3CQOA 1IQAA 4LOSA 4M3CE 2BVBA 1BZWA 1DCSA 5F6KA 3WF3A 2NMOA 2ZGQA 2AREA 2G19A 2ZGNA 4YW1A 5FDBA 4M4PA 3GBGA 4HETA 3RS6A 4DFSA 4AFCA 1RHI3 5J37A 3FLTA 1AYM3 2VULA 1WCSA 3LQCA 1LGCA 3L9JT 5F3IA 2EXKA 4XILA 1XE7A 4YVSA 4P9JA 5G04L 2WA4A 4QHZA 3VKOA 1BMV1 3GBFA 2F17A 3LFIA 1NZCA 4NO4A 4QKBA 2BVVA 2KM2A 2FDGA 3I59A 3O5SA 4EN8B 4YRDA 1RUH3 1CN1A 3PHMA 5CFCC 3Q8FA 4BQ3A 1W8FA 2FD8A 3HD8B 2D3SA 1VMJA 2WWSA 5CKQA 5EYYA 3OYWA 3NSTA 1AYN3 1OLME 2BBVA 2X05A 4CDQC 4OLLA 3MF9A 2OPWA 4W65A 3VBRA 4AW7A 2TEPA 5L9BA 4QAWA 1ST8A 1JTZX 4B1LA 5D21A 2Y0OA 1XNBA 3AMPA 4QXCA 3VLBB 3EB7A 4OMCA 4WM7A 1LU2A 4NIDA 2VW1A 4QQHA 2I45A 2ZABA 3WW3A 1C3HA 4XJ8A 4YZ2A 1OVSA 3C8XA 4MG2A 2YPJA 3OGVA 4CCLA 1NE6A 1IG0A 2WIIB 3TB0A 4YARA 2WS92 1O3QA 3GHNA 5FZAA 5A33B 3BOWA 1ENSA 3J7NA 3ZPYA 2W08A 4I30A 3T1MA 1IOAA 2RS32 5K7PA 2WBKA 5FLJA 2R042 4BYYA 5DMYA 1D2SA 4QKFA 3POIA 5J09A 1JZ2A 3OBTA 1FNZA 1RUF1 4YYOA 1LESA 4O7XA 4GWIA 2BOIA 1UN1A 3OF1A 1BHGA 4FPOB 3ZKUA 2E7AA 2ZGSA 1RUI3 1IPKA 2D5FA 1WW4A 4WZCA 4YW6A 1GZTA 3KV4A 3N9LA 3SXWA 4K6BA 1CAWB 4LR4A 2CY6A 3AZXA 4LTAA 1Q8SA 3KLSA 1DQ2A 2E63A 4X8PA 2E7QA 3E5XA 3OEAA 4HVOA 4QX2A 3WHUA 1D4VB 3AFKA 2W2IA 5JIAA 5DDJ1 3FBMA 1W2UA 2RJKA 5L7OC 3IPVA 4M0NA 1RHI1 4Q4X3 1FYUA 3KT4A 1IQDC 3UKVA 4NR1A 4BOWA 1D7PM 1RXGA 3OOXA 2R062 3ASIA 1K5MA 3DECA 1SFYA 2DVFA 3LEIA 3SEPA 5H9SA 2KXLA 2C24A 2HBTA 3THDA 2XLFA 1E57A 3AMHA 1TE1B 1BMV2 1MQTB 3I3BA 2QCSB 4D8MA 1S0CA 5JMOA 1NA1B 3LFMA 3B3QE 4G9SB 4AAXA 1XJAA 4ISQA 2WFF3 4CCCA 1R1A2 1SLLA 1OD3A 5D1IA 1F5JA 1NYWA 3N7JA 4PCRA 4NPLA 3WQ0A 4CP9A 2HWE3 2NN8A 1JYWA 2VW0A 1RYYA 3LKJA 4LBKA 1VE0A 1IHMA 4Z2WA 1HRI2 2FCVA 2W46A 1LOFA 2DV9A 2WLQA 2ZJCA 3FX3A 1GZWA 5DAWA 3UL2A 4A6SA 1BJQA 2BFUL 2KD7A 1COV2 4U2AA 1HKDA 3IT8A 4XW3A 2PN5A 4CPBD 2MNGA 2VUDA 1W6NB 1PVC1 4Y1VA 3VUOA 3BGAA 3OD0A 4A44A 5FYCA 2RE9A 3GF6A 3GCXA 3ZMOA 3LAGA 2A3WA 1L7RA 4XHBA 1Y3TA 1BLZA 4Q29A 2JEMA 3AL6A 3LOBA 3B01A 2CDPA 2CNAA 4NOTA 4R9DA 4C90A 5JXGA 2TBVA 3AP4A 3PVOA 4XUNA 1C8M2 4RR3C 1CZTA 5B4XA 3H8XA 3ZYBA 1QGLA 2YDEA 3IB3A 2O1QA 2BPA2 1QMJA 1YJLA 4E4SA 4OI2A 2Y33A 4CCDA 5JIUA 3AKRA 5ACA1 1MZEA 1RUH1 5FP7A 2BU9A 3SCHA 1VALA 1PX3A 3E6DA 1VLNA 1Y43B 2WZEA 3KGZA 1RVF2 4AL9A 4XTPA 5CYYA 2ZX2A 4IE4A 2PMWB 3OJBA 3TN92 1W9SA 5A1AA 5AFEA 3SKJE 5K8SA 2N7GA 4MVTA 2RG4A 3M2MA 5GZDA 3U75A 2ZHNA 3KF3A 2P2KA 4FT8A 2Y6LA 1LOBA 5LWBA 3P3PA 4RS5C 3O0WA 4RYDA 2OZ6A 1Y9QA 4LNVA 5JOZA 2VG9A 1PNFA 1W2NA 2W92A 3FUOA 3N9PA 2XJTA 3VBHB 2RMU2 3A23A 1VBD3 4CDWB 5LA0A 1LGNA 1Q5OA 1QJY1 5CADA 3MLLA 4XF1A 4JTOA 3OPZA 4LHKA 3ZXFA 5A32A 2EAKA 1H30A 2WN2A 2ZX4A 1I1EA 1GR3A 1QOOA 5JPMB 2ZAAA 1P8JA 4QKDA 2PHUA 5BXXA 4B4QA 3N7MA 5FUIA 4ZXEA 3MUY1 5FO7B 5FZ3A 3DYPA 4YG0A 2JDYA 3H8UA 3ACLA 4UBHA 1ENXA 2VBBA 1KGYA 2FCTA 3HPNA 5GJ6A 1FX5A 3ES4A 2HWC2 3NKTA 4OZXA 4XMAA 1W8UA 5BNPB 2VMFA 1D2QA 1CAXA 1DU3D 1GICA 1NLQA 3JZVA 1QU0A 3PIJA 5FZBA 4YSFA 5C3PA 4OHZA 2H6BA 2W91A 5FZIA 1PK6C 1OPOA 4B7KA 1T6BX 1Z7S2 3RJRA 5IYYA 3LE0A 4Y33A 4AFAA 1IKPA 4MYEA 5BY5A 1ASJ2 4HBNA 4RR3A 5GKAC 3E97A 4AR2A 5F6LB 1OHFA 2VNRA 5J1XA 5KXBA 1W6OA 3NQHA 4J1WA 5IAXA 1CR7A 1VBC3 3ZXGA 2CWMA 1H4GA 1YI9A 4AAPA 2B45X 1ZZ7A 5APAA 4GAZA 2QQUA 3I3MA 2NZ9A 4BPZA 4P9YA 2ET7A 4I02A 4QQLA 2P3YA 2XB6C 3USUA 2B5HA 4MGYE 3SCFA 4OUEA 2HWD3 4WM7C 4AEKA 2W87A 4HFSA 4AE2A 1HB2A 1H6YA 3PVNA 4YZ5A 4IUGA 2HJIA 4LHNA 3FMGA 3APBA 4XJUA 3SH5A 1JYNA 3O1TA 3FJSA 4YGEA 5F39A 3RYKA 3ZKYA 2XKOA 3K3NA 3VHOA 1XPWA 5C4WB 5J7MA 5LY1A 1HV1A 1HB4A 2C1FA 4KH9A 4YW7A 5C5UA 3OPWA 3SH3A 1PX4A 4E8DA 1ZA4A 4QX8A 4UW3A 1AL23 1POQA 1TNFA 2Y6HA 4NRPA 3ABZA 1XNDA 4F83A 4N8MA 4V2VA 3THCA 2ZX0A 5FP9A 1JYVA 5ANQA 3DYMA 3CZJA 5LEKA 4N9HA 4QPYA 3LOIA 4S2DA 1KS4A 4PF5A 5BNOB 1H9WA 4Q4X1 1AX1A 2GNMA 3JBG1 4HL0A 3IBMA 3RDIA 4D6RA 4Y4YA 3U0ZA 3VD4A 1CWPA 1MVQA 2VBPA 5DAVA 1EV13 3IDEA 2GU9A 3MPBA 5ABJC 4HLTA 4UFKA 5J36A 4IEUA 5FZDA 2VMHA 3VDDB 1FMD1 5IVJA 1UU6A 5FJHA 3O12A 1PZ8A 1QQP3 4K8FA 3AZZA 5FBZA 4K20A 2P3IA 4Z1VA 1DYOA 4W4ZA 3ACHA 4AFMA 1VBE3 1V6NA 2QQLA 3H7YA 4JGZA 4K8RB 1NKGA 3UJQA 1K3IA 2D6KA 5BNQA 4UW5A 1OOPC 2R1DA 4ATEA 1VBB3 1HRI3 5ERLA 3SH4A 3H1YA 5H9RA 3OG2A 1JODA 2VQ0A 4Y5Z0 1AR82 1UIKA 1F2NA 3BODA 1RC6A 3JQXA 2XJRA 3ZYJB 1OMIA 1RUG3 1G6NA 5FZHA 1EYBA 1AJOA 4LKSA 3MW2A 2O0OA 2HYKA 4I09A 1XC6A 3M4FA 2GNBA 1UX7A 2DBIA 3ENRA 1BEV2 5FYMA 4QPIC 4LA3A 4P9WA 1C8NA 2GMEA 2XBO2 4I0BA 4XBQA 4A45A 5J48A 1PM7A 3FE5A 4XABA 1C5IA 3WDXA 1W90A 4OHXA 1JYCA 2WNVA 4IGOA 4XUQA 1NT0A 1G9DA 2GSYA 2JENA 3GGLA 2YC2A 4FTEA 1GNHA 1AR92 4FPFA 5T5OA 1ZRRA 1G9BA 1JUHA 2UWBA 4KWKA 4LULA 3E5QA 1YEWA 3I3EA 1HQLA 1PO13 2B8MA 2P1BA 4YGBA 2TUNA 5FUPA 4W6YA 5JZGA 2XH6A 2L9LA 2WYFA 4NAMA 4XEZA 3NJXA 3R4SA 3ZXEA 3POBA 3WNNA 4JC1A 3WR0A 4CTEA 3L2YA 4CP2A 4AEMA 3B9CA 1XOYA 2V4AA 2VZUA 4ITCA 1YCIA 2G4IA 1RUG2 2DVAA 2WT0A 2R043 1CONA 1EY2A 1TME2 2R0FA 5FY1A 3U1XA 3NKGA 4J6GA 4MXWA 5JSOA 2RS11 1W04A 3E5UA 4A4AA 3O1UA 3I2GA 3U14A 3TN91 1VBC1 2VCAA 4MGQA 5JOXA 1LHVA 4AG4A 1W6PA 2W95A 3JXSA 4RD7A 4XFAA 5FPVA 5EIYB 5I8TA 3J26N 1S2EA 4QU2A 5ACA2 1F8VA 2DCKA 4AFDA 1TMF3 3ZYFA 3O14A 1RUC3 4LK7A 4CDUB 5EXOA 2A6WA 4E2QA 5I8SA 1CQ9A 1YI7A 3V0AA 2G9GA 1VR3A 3BKZA 2CGPA 5T54A 2VM9A 3HR9A 1C5HA 2CGOA 3NMBA 3BIEA 2R1BA 1DGRN 3JU9A 3WDWA 5HCAA 2DUOA 1MS1A 2JE8A 3MW4A 4N53B 1VRBA 5C9AA 4FPGA 5L36A 4O65A 3ZM8A 2QQNA 3HT2A 2Q1FA 2R061 2W39A 5FTTC 1TMF2 3AP5A 1N3OA 1QNYA 2VQUA 3H9AA 4LHLA 3LIHA 4MADA 4O61A 3S6PA 3WG4A 3I2JA 1S55A 2WT2A 1WZXA 4NWVA 4Q8LA 4DO0A 3CIHA 5K0UA 1PGW1 2OIIA 3TBDA 1MS4A 3VBSA 4JCKA 1UY2A 4QX3A 1OF3A 3GBWA 4NVPA 5AVAA 5F9TA 4NIGA 1O8SA 1JN2P 4UFHA 2NYYA 4ZKTB 5IK5A 5DG1A 1VBE1 1YFYA 2AUYA 2J42A 4WBBA 4UT5A 2PAEA 3VZLA 4AOCA 4HN1A 3AB0A 3M3QA 3HN3A 1DQ5A 3WV6A 1WD3A 2FCUA 1UO9A 4L9BA 3MV11 1GQPA 2XOMA 4Y1ZA 1XU1A 2FZ2A 2A71A 1IS5A 4ORFA 4HPKA 4Q0QA 4KG0A 4DXRA 1Z7S3 2DTWA 4XDOA 3U07A 3MLJA 1D4M1 3RZJA 1GYKA 4QKNA 4Y24A 4YW5A 2LROA 5HXMA 4W8JA 4UBGA 1VRH1 2GNTA 1JS9A 3I2DA 5DN2A 1QNWA 1POV1 3DF0A 3PUAA 4BIFA 4FQ4A 4AQSA 2AACA 3VZOA 4CP0A 2ZGMA 3VDBA 4UFJA 1C8M1 3ZPOA 3POYA 4FTBA 5FAXA 1V9U2 2WL1A 4AF9A 4NE9A 2WC2A 4IXLA 1COV3 1X8EA 4QDRA 2RS52 1NLSA 4V1PA 2VOWA 1R093 4YG3A 5FKCA 2CGNA 3DKQA 3PLQA 4Q1PA 4HN0A 3WCSA 5GLWA 4E8CA 5JCTA 2JB8A 1DGWA 5FUNA 1OT5A 1WGPA 3IIIA 4EWAA 2W1UA 3KHBA 1TME3 4Q27A 3KZ4C 2WQ8A 2ARXA 3PMEA 3WD5A 4GWJA 5A6ZA 1VBB2 1MQTC 3IAQA 4BM8A 4QMAA 3RMYA 1ZREA 2SBAA 4UFIA 2EA7A 1PO21 3B94A 4FPKA 2YGLA 1XXNA 4HPKB 1Q3EA 1WKYA 4LQRA 2VTXA 1UZWA 3ZSKA 3W5NA 3RZLA 3T1LA 4QPGA 1FMD2 3UETA 4XDQA 1UKGA 3N36A 4H7LA 4MH0E 2F4LA 5BNPA 2VNVA 1HW5A 2YFZA 5DUUA 3KHCA 3T0DA 1XBFA 1VBC2 2BERA 4HSJA 1Q8PA 4IV1C 4I3GA 5FXZA 4ARXA 4AGRA 2ZMNA 3LEGA 4BCUA 4NUBA 1O4TA 4ZU7A 5CBLA 3U4XA 1HJGA 4NHLA 4GB31 2YFUA 4WM8B 2Z69A 1GWLA 1QJFA 4UW6A 3WDTA 3HQUA 4YVSB 4IE7A 1O3TA 4CZSA 3UKTA 2WQ4A 3AP6A 4RHV3 2W47A 3WDUA 2OVUA 1QJX2 4XOGA 1CAWA 3KV5A 5LZ6A 2O14A 4N53A 3FFQA 2GN3A 5T3NA 1ZX5A 5CAZA 1MZ5A 2EICA 4FQZA 4WVVA 1X82A 1RUE2 1JOPA 2QKDA 5FZ8A 2HWE2 4P14A 3RWKX 5CFDB 1IS4A 5LCWL 4F8AA 2QZ3A 2ZGUA 4PDWA 2V5YA 3ZFGC 3JD71 1SPPA 3EQEA 4W6WA 4YM1A 3ZXDA 2XPJA 3K4DA 4DOUA 3HBZA 1RUD1 4CXWA 1MPXA 4COVA 5C8CA 1UIJA 1W8TA 2A6VA 1J84A 1VBD2 2BGPA 5JSRA 2R041 4QWNA 1LOEA 1LGBA 2JECA 2A5ZA 4IEOA 1PK6A 4XXAA 1BEV1 3AYEA 3RI8A 1HXS3 2PQQA 3KMHA 2AEZA 3CJXA 2ZMLA 1WW6A 4FPCA 4RGKA 4XF4A 5F5QA 5FZ9A 2FZ1A 3QD6A 2BTVC 2PHRA 1GOFA 2VMDA 3TYJA 3VBRC 1DZRA 4BA6A 3IMNA 1DLLA 4LO7A 3J7LA 1X9TA 1OH4A 2IZWA 2B39A 2FMDA 4CDXC 5KC5A 5LW9A 3H8OA 3ATGA 1DG6A 1DYKA 1O5LA 3HAGA 3NJZA 4A42A 4M00A 2QTWB 3CF6E 3VHNA 1I9RA 2QQOA 4MX3A 4K1ZA 2X8KA 3GCWA 2XUEA 3OUHA 5GZCA 3MIDA 1PIV2 3W21A 5M0TA 5DZGA 2JDMA 2MPFA 1J1TA 1VRH2 1GKBA 2VNGA 4XJWA 2LS6A 1GZCA 2QQIA 2W5FA 1ZBE3 5FY7A 1W6MA 3AVRA 3H50A 2DUQA 1Q8OA 3JCIA 1AYN1 4KI5M 3HJRA 4W50A 2J1SA 1GP5A 4KU8A 4PDWB 2WZPP 1KD7A 1MS0A 2XKPA 1WLWA 4FPJA 4Y1UA 1X8MA 1V9U1 3LD8A 3T09A 1JMUB 2Q8OA 3NO8A 4F3JA 4COWA 1GP4A 1QH7A 4V2WA 1DP0A 3THTA 3LA3A 5A3OA 3TEYA 3NJVA 1UMHA 2PYTA 5F8PA 1IKQA 4YM2A 2NPIA 5C3OA 2BNNA 2ZBJA 4WZFA 4ES9A 1R1A1 1WUVA 3AMQA 3QCWA 3WINE 1OFSA 5A3PA 2AEYA 3VD7A 3RSJA 1S0BA 1YO8A 2NM1A 4Y20A 2MHFA 1K5MB 1KITA 4QM9A 5C4WA 1HRI1 4FOYA 3OUJA 3MIBA 3WNOA 5K9YA 1LB2A 4NN0A 1NE4A 3CNAA 4LLOA 4CE8A 4RGGA 3ZYHA 2XJVA 4LBQD 2IWGB 3IDAA 2IXKA 2NQYA 3OY8A 3VBRB 4AVTA 5LBFA 4C0HA 3GJBA 5JR2A 2OA2A 5FOBB 2JKXA 2ZS6B 4XQWA 1PZ9A 5EJ3A 1KDKA 1W9TA 3ZOIA 3D0JA 2G9ZA 2D97A 4BE3A 5I91A 1U5YA 3QLQA 2JG8C 5E8AA 4A7KA 1UKRA 1RITA 2LTNA 1S0FA 3AMMA 3ELNA 2JG9C 3H3UA 4FAGA 4PI0A 3E6CC 2ZOEB 5LEJA 3UYJA 5C6CA 1UX6A 5A33A 2E32A 5BNOC 4YW3A 5A7WA 2YMZA 3K46A 5FREA 2BWAA 3VKNA 2DCZA 3J4UH 3ST7A 4XFGA 2FMYA 1AR91 2IXHA 4FFGA 5EQUA 3WW1A 4NROA 1CAXB 3KS7A 5IUQA 4EV0A 2D93A 2ES3A 3ZYPA 4XDPA 3T2PA 1NCRA 3HNYM 1OI6A 3IM0A 1QQP1 4DB5A 3I49A 1LOFC 2QFEA 3VBOC 4XFBA 5JUVA 2WWUA 1ASJ1 3D82A 5IAVA 2R49A 5FYSA 2WNOA 3DPRC 3NAPC 1SPPB 1N1VA 3OGJA 3N9MA 5FR3A 3I2HA 5IK8A 1HLCA 2ATFA 3LCPA 3LF7A 1JHNA 2PHWA 4RHV1 1QKQA 2GH8A 3ITQA 5FY4A 4Q2FA 3ZSEA 3CO2A 3UT0A 1UXXX 5T5JA 5CFCA 4IEVA 4ASMB 5KHIA 1YFUA 1R64A 1QDCA 2J7MA 5C8WA 1NXMA 4GH4C 2YB7A 4F7ZA 2BZDA 3RPQA 1XE0A 5A3WA 3I2FA 5JZGB 4OYUA 1W28A 1RUE3 1UNBA 1RUOA 2VVDA 4IDZA 5FLHA 4CCOA 2BOJA 1U5ZA 2ARAA 3S0MA 3MBWA 3N9OA 1FOD2 1RGSA 2WZR1 3KF5A 5DZEA 5IK4A 3HEIA 3IN9A 4MUVA 1XYPA 4A7ZA 1UYZA 3BPZA 1V6KA 3MHZA 2D3PA 1RUJ1 4CCJA 4I0WB 4LBQA 4ZU5A 5CISA 2WNUC 1NCRB 2GAUA 1CD3G 1Y4WA 3CLPA 5GLZA 4BJ0A 4COUA 3N9QA 1NQJA 2JDAA 4H7MA 5I0UA 5KXEA 3AKQA 1UYXA 4DS0A 1UU5A 5A7PA 3VBUC 1B09A 3B02A 1ULGA 5CVRA 3V64A 2WO2A 2Y60A 5K4LA 3T2TA 1LOGA 2YY1A 3FZ3A 3UK9A 4E27A 1AR63 4ZHNA 1CIYA 5ISLA 2ZCWA 4QXBA 4CCMA 2DCYA 1J3QA 1SG3A 1AL0G 1VBA2 1I5ZA 2BEOA 2PHTA 3ZR6A 1ZA7A 4LKEA 2QNKA 2VUCA 3AYCA 3POWA 1W6NA 4Q4W1 5E1RA 5T5LA 4EZ4A 4LT5A 2B4KA 4BQYA 2W94A 1SZBA 1YQ6A 3MPPG 3POEA 4XE9A 2F6BA 5E89A 2RS13 2WKKA 3M1HA 1CX4A 3C7HA 3QBQA 4Y1YA 1W6OB 2QVSB 3ZX7A 2Y6KA 2GDFA 1HRV3 3J9SA 4DRVA 1V70A 4HXCA 2ET1A 1G9FA 2VH9A 5D2AA 4XAEA 4BQWA 1JZ8A 1SBDA 2PAMA 5JZGC 4NMIA 1D4M3 1XNAA 1JI6A 2E7TA 4HZFA 4O9EA 1JU3A 1VBA3 4ZONA 4CEWA 1ZZCA 4XZUG 3WP3A 5FQ0A 1NUKA 4WVMA 4IV1B 2GMPA 4XJAA 2HWE1 3T4HB 1JOJA 1HXS1 1ZRIA 4FO9A 2QUOA 5SV8A 2Q8CA 1PVXA 3VD3A 5I0DA 5BNNB 2ZHKA 3LSDA 3AK0A 5KHHA 1H2MA 2O8QA 1K5JA 2WSVA 1REFA 4XBLA 1QHDA 5AVPA 1EAH2 4ZZ8A 5JPNB 2VPVA 1AZDA 3C2UA 4Q4Y2 4ET7A 1RUD3 1GU3A 2IFWA 1JOBA 5LBCA 4Z82A 5FCCA 3VBSB 4R4ZA 5HCHA 1U12A 3DEMA 5CZKA 5A3LA 1PM4A 1UMIA 3T08A 3CDZB 2OQ6A 2JDZA 5F5CA 5IFPA 2ORZA 3PU3A 4GALA 1U5IA 3IIAA 4FI9A 4N9IA 2RVAA 3RYPA 3VKMA 4CEYA 1EUUA 1QJU1 4EWEA 4I3PA 3B7MA 3ZO0B 4D7YA 2E31A 1DBNA 1H4HA 1LTEA 1RJ7A 2HWF1 3Q8EA 2Y0IA 4LEJA 1LNSA 4XYXA 1QWRA 2J1RA 4IW3A 5FY8A 5HCBA 1XB9A 1AYM2 4GA9A 5ACA3 3ETQA 3BPSA 2K46A 3ZYIB 4G3YC 3WZ1A 1UY1A 2UWCA 3KWVA 3RVHA 4BQ5A 2EIDA 1IZ3A 2VXRA 4L0PA 3MO4A 1S0JA 2ZZQA 4XQDA 3UKNA 4CEWB 1V6JA 2BBAA 2X5IB 4P9GA 4XBNA 1MEC3 5FZKA 1H8TA 2XR4A 1JZ7A 3Q8CA 1ZBE1 1SFPA 1G9CA 1OUSA 3U10A 1B35C 2HYXA 5CA6A 5CNAA 4C1WA 2RS12 4DY5A 3B69A 1HJFA 1UAIA 4IEZA 4OHVA 1NAEA 4ES8A 4PT6A 3WF4A 5CG8A 4XQ4A 5EHDA 2UYBA 5BNNC 1W39A 3BYWA 3MIHA 1W05A 1F15A 4QM8A 4IERA 2ORXA 3A7QA 5LA2A 4Q8KA 4ZS3A 5JMCA 5A3NA 3ILFA 3KD4A 4GD4A 5FFOC 1ONAA 5FYZA 2VE1A 2VXJA 5A1FA 4XFIA 2IVJA 2UY9A 3ZN6A 1LHUA 3ZIWA 3CZUA 2DVBA 1MS3A 2WDBA 4KBZA 4PQQA 2OQ7A 2ZEWA 3DV8A 5CIRA 3VD9A 1SBEA 4JDOA 2WA3A 1RINA 1EAH3 4B1MA 1V6IA 4YW2A 4OI0A 1LHWA 3WQ7A 2G1MA 3FFZA 1VAKA 2CAVA 3BB6A 3EMRA 3PUQA 2ZHLA 3CMGA 2OPKA 4S2HA 2EAAA 3EO6A 4DY3A 5A6QA 3WY6A 2WR9A 2ZTNA 4XMIA 1OD5A 3D6EA 5FPLA 3PTYA 4RQPA 4DNYA 1JZ4A 2YZ4A 3RZHA 3IKWA 4TXWA 1LHOA 4HK8A 2BGCA 3ZFEC 4DUWA 3V0BA 1AHSA 5C33A 5FPBA 3JB4C 4BK5A 4BQ2A 2BP6A 1YC61 3FN9A 4IQPA 5FZ0A 3TAYA 1RUNA 4XIOA 1QEXA 4H14A 1ZNPA 2VU9A 3DPRA 3NAPA 5GALA 4AZZA 2YROA 4E2GA 2JDKA 3ZVXA 3RI9A 1AX2A 4LK6A 3FHAA 1LKNA 1NQDA 3RJ2X 3QACA 1W06A 5FQ0B 4JKLA 1ODMA 2V09A 4ASLA 5DAXA 2VAUA 2AENA 2Q5TA 3BCWA 4XUTA 4GMP1 4CCNA 1UW8A 5JVVA 3DXUA 5KC6A 2VOKA 2Y34A 1QXRA 4IE5A 4G4FA 4BB3A 3WT3A 1IG3A 1ENQA 2VW2A 4AWDA 3I8TA 4XF0A 1HQWA 5BNPC 1WCKA 3C7OA 2ARBA 5CG9A 1XU2A 2R072 4IGQA 4CRQA 2Y64A 5F2SA 1S2KA 2QDNA 2WUHA 3NVCA 2DCTA 2MEV3 5IVBA 3SCGA 3VZNA 2PHLA 4QGMA 2ZX1A 3FBYA 1AXZA 2VZPA 3T0BA 4BMEA 2YV8A 3AKTA 1EP0A 4AVAA 2WINB 4NHMA 5J98B 2DFCA 3NV3A 4CU6A 1V6MA 3NNLA 1H9PA 2DURA 1AL22 2PLV3 4IEXA 4Y5TA 3S7EA 3VBUA 5G05L 3W20A 1CVNA 4URTA 4ISRA 2A6XA 4KNCA 4P5YA 1W0NA 1VBB1 2XMLA 3H7JA 3KB5A 4TLFA 2EXIA 1FPN1 1NCQB 1T2XA 4HK9A 4K3UA 3WUCA 2LRPA 4FAHA 1XYNA 1W6QA 2E53A 1TZOA 3WDVA 3VDAA 3LSEA 3SISA 4DEQA 3KV9A 3OBZA 5LRRA 1LENA 1MQTA 2RDSA 4MHRA 3M3IA 4LBMA 4N43A 1DIWA 1M4WA 2HH9A 4IV3C 1YFWA 3H1MA 1UD1A 2D5HA 5JXJA 3DCQA 1JHJA 1YHFA 3HQXA 3WNKA 1O59A 2V4VA 2J22A 3MIFA 4EN7B 3BTYA 3GNEA 1NCQA 5FY5A 5JI9A 4TN7A 5FP4A 2R30A 4IV3A 3VHPA 1LECA 1VB4A 2ADEA 5FMDA 2VZ3A 1WLDA 4BZ4A 5LK7B 1OLRA 4EWDA 1KDMA 4L11A 1I6XA 2XL7A 4LO6B 4B4PA 2VGDA 2WNUB 1F31A 4PJYA 2WFPA 1A8MA 1ULPA 2Y6GA 1W2AX 2VD7A 3POJA 1QJX1 1S4CA 2A1XA 3VBUB 5AC91 1HXS2 3N4MA 4OFGA 1IGOA 2GC2A 3O1OA 4XCBA 2Z4FA 3WCRA 1AR83 3LZZA 5KHGA 2JIJA 1SLTA 3POGA 1CPMA 1RUE1 2JG8A 2BW8A 2XDVA 1H1AA 1H6XA 1PIV3 2Z79A 4BU2A 4ONUA 5A1LA 1FMD3 1ZYBA 1UOBA 2XQRA 3LEKA 1W6PB 3WF1A 1NOVA 1WW5A 3SITA 4JKKA 4P9LA 5GM0A 1JYIA 3VN4A 4M3CA 3PVEA 2VVFA 5FJKA 4KU7A 1G9AA 3A22A 2PAKA 1JXNA 4DZGA 1QOSA 3ILNA 5T5PA 4DQAA 4IV3B 4D0QA 3VDCA 4C8DA 4OQ8A 4HKLA 3URFA 2DCJA 3AZYA 5DUWA 1SEFA 2D40A 2X53S 3M3EA 2XXZA 3OYWB 2D6OX 2NMNA 3TN93 4DIQA 3KM5A 3UNPA 5FPZA 5A3UA 4Y22B 2AYHA 1AR93 2YBPA 5CFCB 5DUVA 2P3KA 4CUGA 1W8ZA 1PO23 2WN3A 4CDQA 3I97A 3IDCB 4QB2A 4BWOA 1YFXA 4YGCA 1GWKA 1W9FA 1C1LA 1GNYA 5KWRA 1HX6A 4WVWA 2D6NA 2GNDA 1KQRA 4O9GA 1VB2A 5GLVA 3VBFC 5BYNA 2P4EA 2WNEA 2YXSA 1AR61 1WCQA 3LWCA 1PGL2 1Z7S1 3PUHA 1KFXL 3CU7A 4GWNA 3MFCA 2YC4A 4GULA 3S30A 2R0HA 2YU2A 2JG9A 2JIGA 3VBOB 2ZA9A 4MO3M 1WBLA 1HDKA 1RUF3 2P34A 1UY0A 1AX0A 2VOTA 1F5FA 2WSUA 3B00A 3TEZA 2CHHA 2HWB3 1NY72 1NXD1 4HT1T 4JRAA 3AFGA 5HXVA 4DXZA 3KGLA 4AXOA 4QXKA 1ULOA 2OZJA 1R092 4QX7A 1W6QB 1Z78A 2YUEA 3HQRA 1NY71 3KCYA 4Y3OA 4XTMA 4D6QA 4XURA 4KQ7A 2VOVA 1PK6B 5T50A 4KGGA 3C7EA 3IPVB 3N7KA 5EJ1B 1HN1A 1UWWA 1OKQA 1OA4A 1ND3B 2Q30A 2Y26A 4JZRA 4UFMA 4CXYA 3OPTA 2VNOA 1XYOA 3MI8A 4LE4A 3ZLIA 2IVIB 1R1ZA 1IS6A 5LY2A 1N3QA 5F37A 2J1EA 2XBO3 3GZTB 2ZZJA 3LA2A 3W9AA 2XLGA 1YJKA 4YFZA 4BIOA 4FFHA 1UL9A 1OQ1A 4YZ3A 1I5PA 2UY8A 1DDLA 2GN7A 2XONA 2W3JA 3LDKA 3PURA 3ES1A 1DF0A 1UPIA 2RM21 3RMXA 2DUPA 4IE6A 1N3PA 1W03A 3LDBA 4HVQA 5FYIA 2BUKA 4URAA 2JDNA 3U11A 4NIIA 3K2OA 1DGLA 1CZVA 3T30A 1YXWA 4CVUA 2JDHA 1UPSA 4QU1A 1SFNA 5A3TA 2JKBA 1VAMA 4CA9A 3D8CA 3J8F3 3ZXJA 4HOOA 3NNMA 4JKMA 2RR11 3BALA 4GKXA 4YM3A 1O6UA 3ACIA 4OULA 2R6QA 4QDSA 4L8QA 1TNRA 4XJ9A 5C8CB 1Q43A 3KSCA 4IEYA 1UXZA 3AJZA 4YWAA 1XE8A 3WHTA 4A6OA 2WO7A 1YQ5A 4H2AA 4COZA 3SC7X 3QH6A 4GWMA 4CDXB 1PVC3 3GJAA 4YG6A 1AR62 1PGL1 1DYPA 1ND3C 5C70A 2R7EB 3BTAA 2H6CA 4FOQA 5L73A 1WLTA 3ZDSA 4AVCA 4OHWA 3WVJA 2HBUA 1S0GA 4M4RA 3IZOA 3FHIB 4JVAA 3USSA 5FO8B 2JD9A 1WA6X 5FZLA 1RB8G 5A6XA 1LEMA 3FLRA 4PQ9A 5D8AB 1Z0HA 1RUI2 4P5HA 3UJOA 2VL4A 1HV0A 1OFNA 4GB33 2IUWA 3T4VA 1O4ZA 5C9AB 1AR73 1RJ8A 2W1QA 1BBT1 2ZPXA 4HVRA 4JV4A 3VBHA 3ZDVA 5JXHA 4Z92B 1UQXA 4QQOA 4JHTA 1OKOA 4MGIE 4LBNA 4YZ1A 3ORJA 1DQ4A 1RL3A 4TZDA 5A32B 2YU1A 4EZHA 4B3NA 1GANA 3FHQA 4GJYA 1CAUB 5EFUA 2B9VA 5GLUA 4YVWC 1R082 3M70A 3LA7A 1OH3A 4FFIA 4UF0A 1KJRA 1V6OA 1KJLA 2IXJA 3VD5A 2FHRA 5LBBA 2RMU3 3K48A 1NZIA 2G9FA 4M0HA 1WMXA 4HSLA 4OMDA 4XUOA 3FLPA 1MR5A 5IVFA 4E4HA 2I74A 1QJEA 1ZBA1 1OOPB 1J83A 1A8DA 5F2WA 2NP0A 4NPMA 4B8EA 1B35B 3A0NA 4MGKE 5BPXA 2FDFA 3WLUA 1L3JA 2QZ2A 3KCCA 3AL5A 4EJRA 1GBGA 3OTFA 5FZOA 1XNCA 2ETEA 1V00A 4IEWA 1ASJ3 3OBAA 4RQPB 2Q8DA 4D7TA 1PO12 2V73A 4AI3A 3OSDA 2QQVA 3MDPA 1JW6A 4XFFA 3WW2A 4LKFA 1A78A 3LPFA 3H1WA 4CCKA 5FK8A 5FOJB 1C8M3 2UWAA 2XWJB 2BJSA 5EYXA 4A3XA 2EXHA 1CAVA 2ZHMA 1JYXA 4AVSA 3S5AA 4Q4W3 1O8PA 2ZX3A 3ROUA 5FPUA 5DABA 4MGSA 3USUB 2CV6A 3D4KA 2Z42A 1QJZA 1SHWB 3HNBM 2PHFA 4JGZC 4E4ZA 2RR12 4META 2FDKA 4FPYA 2WT1A 4KBBA 2ZGPA 3U37A 4EN0A 5EPAA 5DDJ3 4QHBA 4NAOA 1VBE2 5I93A 2DBNA 4D7SA 4CXXA 2ID4A 3VBHC 2RJ2A 1EV11 3H8RA 3JUUA 4H3WA 4N43B 2GC1A 4BXFA 1ENRA 2E51A 4YVWB 3WSOA 1JZ6A 2WYSA 1FPN2 4S2FA 1OQDA 3W59A 1GUIA 2AC1A 2VO5A 1ZRFA 1OLQA 5I0SA 1OBNA 1X36A 2ZAHA 5I0TA 3ZFEB 5BV6A 4FTSA 1QH6A 3NV4A 3NV2A 5A7WB 3AXEA 5A7SA 3SQOA 1CIWA 5FY9A 1V0AA 3GYDA 1PMIA 1W8NA 1W8OA 2JICA 4OZOA 3VB9A 3AXDA 4R9AA 2X5IA 1SCRA 1LULA 5FY0A 4JQTA 2XJSA 3RGBA 1W2OA 2ZEXA 3DGTA 3R05A 3VZJA 2WO1A 3PVBB 2BNMA 3PTRB 1E5SA 2JXAA 4LO4B 1ZZ8A 1AR71 1CAVB 4RHV2 1K12A 1IS3A 2X09A 3LB9A 3RFRA 1VBA1 1ND2C 4QX1A 1J3PA 2YG0A 3S7IA 2K2SA 3I4IA 5T52A 1W2TA 1RMU1 4MZUA 4Q4V2 5C3QA 1GZWB 2VCBA 4UWDA 4AI1A 2AZ5A 2WO3A 5FP3A 4C91A 5FZ6A 2WFF1 3VKFC 3DYOA 2XJQA 4CSWA 1A34A 1R081 3POSA 4QX5A 4AGGA 3I54A 5FZGA 3TNPB 2KA3A 3VBFB 4D69A 4OUMA 5HI0A 3MFAA 2FQPA 3TNQA 1W3VA 4QQ2A 3TWIA 2PTMA 3RNSA 4PIZA 5ABJB 1QJY3 3OB8A 2HWB1 3O0XA 2QQMA 5L7OB 5FMOS 4GIQA 4XPVA 2CU5A 4UAPA 4CP1A 1MEC1 2XVLA 4DEVA 3EYPA 3N9NA 4FOVA 4X6RB 1OF4A 1KEXA 1LJ7A 2XGXA 3PIGA 5IVVA 1VIWB 1CAUA 3BOPA 1MEC2 1Q56A 1WCUA 3O7OA 3TEXA 4Q0UA 2IC1A 2Z5WA 4PIXA 3V0BB 4NJ4A 1LOCA 2Z2SB 3O1RA 2Y38A 1URXA 4AQ2A 4FVVA 3DUIA 1HN0A 2B9UA 2GP5A 4QDQA 2RS53 1ZBA2 2SLIA 1HIXA 2VMCA 3BTXA 2A6YA 2WZR3 1CX1A 1Y7BA 4C1XA 5FK7A 5LRSA 1M06G 3ZFFA 4GMP0 1J3RA 2IXCA 2HEYF 1GWMA 3Q8AA 3ZN4A 5C7GA 5F3EA 4XXPA 1LHNA 2UYAA 3CKHA 2JG9B 3FWEA 3VBOA 2BGOA 3QOPA 4OI4A 3CBNA 1PGW2 3ECQA 4R4XA 4IEQA 2XHKA 3VDDC 2A3XA 4AFBA 4PHZA 4NIAA 1KS5A 2VY0A 2H0VA 2WNVC 2D6MA 2WABA 2PA7A 2XVGA 1BBT3 4IEPA 2BRTA 1L7QA 4FP2A 1H8TC 4LITA 4NHYA 4UXAA 2YBKA 4BDVB 1UMZA 4BQ4A 5LATA 2EVXA 3I3DA 3INAA 2WZ8A 4RS5B 4CP9B 1DHKB 3NJYA 4YW4A 3MV01 5C5TA 2B7YA 4XC9A 2VCMA 4J1XA 2DU0A 2ZEYA 4HG6B 2DF7A 4CPBA 4FP3A 4FPHA 1STMA 1UZ0A 4CDWC 1F35A 1ULDA 2XQXA 1HRV1 4MSVA 3GZAA 3DN7A 1ZZBA 1W9WA 2NLRA 3TRSB 4D6SA 2J1VA 4CU8A 1K42A 5E6HA 4AI0A 3SLIA 2J1AA 1HRV2 5IJRA 1W3XA 5AFBA 3P1IA 2AR6A 2WWJA 3H3ZA 4IV1A 3WF0A 4BH9A 2XBO1 4Z8BA 3R4DB 2RDQA 3RYRA 1BBT2 1F4AA 3WNMA 1POV3 1KXGA 1XSQA 2IFRA 2P6HA 4Q0VA 2DVDA 2X5IC 5A7QA 1GLHA 2OX0A 2FDIA 4FPEA 4OQ9A 2PHXA 2P37A 2XVKA 1VMFA 5A70A 2ILMA 4Q4Y3 1LR5A 3N7LA 4CDQB 2YHJA 1UZYA 4K9SA 1AR72 1J59A 3BUCA 2BWCA 5FZMA 3I2OA 3KVBA 1UOFA 1C1FA 2MEV1 4H55A 4IESA 1OC1A 2JWPA 5IVYA 4A2UA 4PI2A 1REEA 1U0AA 2BDRA 1VPHA 3WP6A 3UGFA 5FZ4A 2XLAA 4HONA 3MEPA 4MGZE 3O1VA 1RUJ3 3AKPA 3AMNA 2C0ZA 4FSJA 4COYA 3O1SA 1H8TB 2VR4A 2OW4A 4LOTA 1FNYA 1H2NA 3IDBB 5K0UB 2IXIA 3JBG2 1NA1A 2HLEA 3AYDA 3PDQA 1AUYA 5ANNA 3T3YA 3KVAA 4WM7B 3WG3A 1US2A 1PZ7A 1W6MB 4J25A 4AHYA 5F3GA 5FYVA 4ZY9A 1FPN3 2IXLA 4QPWA 3J7MA 2JE7A 3N3HA 4P9IA 4PF1A 4QPGC 4LJHA 4GKYA 3AC0A 3U4SA 5ABJA 3PU8A 1FOD1 2WZR2 5CFDC 3WOGA 5C4WC 5IVCA 3AKSA 4WM8A 1UY3A 1ZBA3 3C3VA 1NX9A 5GZFA 1J58A 4XACA 2VZTA 2GZWA 4CDXA 1N1SA 2P5BA 5FWEA 3O0VA 3NV1A 1S2BA 5C71A 3VGIA 1SCSA 2JE9A 1HB1A 3BN6A 2EIGA 3ZIXA 4Q5OA 3ZR5A 1MZFA 3AZWA 3KV6A 1E5RA 4BQ1A 4XJZA 3W5MA 1H2LA 1TMF1 3AM2A 3HNMA 1GMMA 4R8HA 1N47A 1ULEA 4CUAA 1ULCA 2HWC1 2XG3A 4N53C 2GMMA 4BQXA 3D3AA 1FXZA 4RQPC 2QQPA 3NNJA 2AGSA 2CWSA 3P3NA 4ZXKA 2YYOA 1UY4A 3ZFGA 2WAAA 2R063 4KWLA 4UYBA 1LRHA 2E26A 4INDA 3F2ZA 4DMIA 5JDBA 4CEYB 2Q8EA 5IATA 4P08A 3V0AB 4N7IA 4KWUA 5K0UC 1E5HA 1WBFA 1F9KA 2ZMKA 2VBDA 3FC0A 1PVC2 1UOJA 1UOGA 4XAAA 2VCCA 2AH2A 1H1MA 1GNZA 4NHKA 3PUIA 4QB1A 1J1LA 1ULFA 1NA1C 3MICA 1GFF2 2C9KA 3FL7A 3ON7A 5LA1A 5FRAA 1X50A 4CYDA 2J1TA 3G6JB 4HMZA 2V72A 4A7YA 3FUQA 3IAPA 4LPLA 1JZ3A 2VMGA 2Y6JA 3K4AA 3X29B 2JG8B 5A3MA 1SLIA 1LCLA 1BXHA 2YPDA 5JAXA 2RS33 1JU4A 4PLNA 4Y1XA 2VZOA 5IVEA 1R1A3 2WFF2 5EP9A 5E88A 1MS5A 1TME1 3K75B 5T55A 3U78A 1SQ4A 1W99A 1H2KA 3AX4A 3TOJA 4OVEA 1O91A 1GSLA 4NWWA 1V9U3 3GZUC 5FZCA 1QDOA 2RHPA 5A7NA 4M3CF 3UESA 2YC0A 5D8AA 1AYM1 2CSGA 4RR3B 5FZFA 1GQGA 2ARCA 2VJXA 3ZXKA 4I2OA 5DAPA 1JYTA 1YUDA 5FP8A 5CKMA 4QPIA 2ZACA 4Q4X2 3RZGA 1YQ2A 4BISA 2JD4A 2DVGA 2BQPA 5D8AC 1OQEA 3HIFA 4Y22A 2PHDA 2FDHA 5FZOB 2BYVE 5C3RA 2VUJA 1X7NA 2VTXJ 1JUIA 5FMBA 2PELA 5JI7A 5C9AC 3KT7A 3HN1A 4UI9L 4XETA 1R083 2LALA 3SNMA 2QDRA 3MW3A 3ZSJA 4FFFA 2VECA 2RJLA 1OLMA 1WMFA 4GH4B 4KL1A 4PBOA 4R9BA 1QIQA 3GHMA 2YBSA 4XF3A 5E16A 5C8CC 3BU7A 3BVCA 5HV0A 1VP6A 4RA0A 3J7HA 3MF6A 1G86A 3UGHA 5HBAA 1OOPA 1TEIA 2FDJA 2EIEA 3P6BA 3ZYGA 3ZSMA 4P9XA 2W0XA 4CDUC 4L92A 1D0GA 1F4HA 1DLCA 1OA2A 2GALA 3AJYA 4UW4A 3VV1A 3RG0A 1RTVA 5DDJ2 3A0KA 5KHKA 2O8OA 3JD73 1RHI2 5CU1A 3HVDA 1AR81 2UU8A 4MGTA 5JWPA 1RIRA 4MHUA 4CCEA 3RZZA 1VBD1 1MACA 3G7DA 1FI2A 1CESA 2VQTA 3ETPA 3GDBA 4YVWA 3ZMNA 3NRUA 2VQAA 4PLMA 2ZGRA 4HKOA 2A73B 1E5IA 2C6SA 5F5AA 3WP4A 1MVEA 5LASA 5IK7A 1L7LA 2W9XA 3MIEA 5JLVA 3E6BA 1ODNA 5BUVA 3AYAA 4PBPA 3WXPA 1APNA 1ND3A 2C26A 3HMYA 4KG8A 4OUSA 5DG2A 1SLBA 3EHKA 4PDWC 5KXDA 1PIV1 5F1RA 3KT1A 1RUI1 1U5XA 3MYXA 1QXPA 2D3RA 2HWB2 1C4RA 1ACCA 3T0AA 3D0SA 4PIYA 2VC9A 4QB6A 2BV4A 1COV1 4PLOA 3WQBA 4RN5A 2C4XA 2WJSA 4MXVA 3SHRA 1GQHA 4S2GA 2GH2A 4Y20B 1YQCA 1MS9A 2I2SA 4JGYC 1CGPA 4N43C 4XF9A 4Y4RA 4RL7A 4XZPA 4B4RA 2F4PA 1QF3A 2HKXA 1ALYA 1GOGA 5HPOA 2B42B 2VTFA 4Y26A 3VBFA 3ZFFB 1K5MC 1W8HA 3VL9A 4BXSV 2GC0A 2DWRA 2JDUA 3O1MA 4AQ6A 5J96B 3VHRA 2W52A 5DQ0A 4K40A 3WG2A 2D44A 3K4ZA 4FCAA 3R0RA 4Q4W2 2YGMA 5B2GB 2ZEZA 3TEWA 5I0RA 4B29A 5IHRA 1YRZA 4LXLA 1YYNA 3JBG3 1JBCA 1RUF2 4I0AA 1IPSA 5EZWA 4QGNA 5L9VA 2BFUS 4QD2A 3ZYRA 4RS5A 4IL7A 4MV2A 4LUKA 4DXTA 1XSRA 4XIKA 3RWNA 4ZZ5A 5BNOA 3THPA 4AQTA 1LOAA 2XL9A 1AXYA 2OXBA 3F95A 3SMHA 2HWC3 3EBRA 2OKXA 3DXTA 2A6ZA 4AHXA 1YIPA 3AP9A 1H8VA 4IETA 1ZRCA 3K3OA 4UOJA 1TVGA 1I3HA 2W1WA 2WLPA 5KBFA 3VBSC 1OVPA 1YWKA 3PL0A 1Y9GA 3UGGA 5LB6A 1N1TA 5DAQA 1JZ5A 1FATA 1SACA 3GXUA 3OCPA 3UV9A 3HOBA 2D7FA 3PUSA 4BHPA 5F5IA 1S0DA 3JD72 3KQ4B 2CYFA 4YLZA 2PFWA 5FMOL 1CJDA 1O3SA 3NNGA 5DPNA 3WX5A 4Y5SA 1QQP2 3ZXAC 1RVF1 5CFDA 3BTZA 4NIHA 2UURA 4MOAA 4JDNA 2LM3A 2ZGKA 2DDUA 2RDNA 1D0HA 4CU7A 4Q26A 2CDOA 1QJU2 1SDDB 2VZVA 4LBQB 3OEBA 1MS8A 2JDPA
chains in the Genus database with same CATH topology
5JUVA 3VD5A 5JXGA 4XUNA 1CZTA 5B4XA 3IB3A 4OMDA 4P00B 1US3A 4XUOA 3C7FA 3I2HA 4KMQA 4CUCA 1J83A 1PX3A 2WZEA 3K77A 5CYYA 3MUZ1 3WF2A 5A1AA 1UXXX 1W9SA 3SKJE 1CZSA 1R64A 2J7MA 3OBAA 2Y6LA 2YB7A 4RYDA 2BZDA 4CUBA 3I2FA 4OYUA 3LPFA 2W92A 3A23A 3MBWA 1JYXA 5LA0A 3I2IA 3HEIA 1O8PA 1UYZA 2WN2A 4MGSA 1SHWB 3HNBM 1P8JA 4BJ0A 3U37A 5FUIA 4ZXEA 3I2KA 3MUY1 3DYPA 2JDAA 2ID4A 1UYXA 2RJ2A 1KGYA 3HPNA 2WO2A 5EJZB 1JZ6A 3WSOA 1CIYA 2VMFA 2WYSA 1GUIA 1SG3A 2VO5A 4DUVA 2W91A 3E1F1 5IYYA 3LE0A 2B4KA 2W94A 1W8OA 1W8NA 4OZOA 5J1XA 2PQSA 3C7HA 3NQHA 2ZEXA 2WO1A 2Y6KA 1K12A 2X09A 1GOHA 1JZ8A 4QX1A 2YG0A 4OUEA 1XNAA 1JI6A 2W87A 1JU3A 1H6YA 1XNTA 4XZUG 4ARYA 3A21A 1NUKA 4IUGA 1JYNA 2VCBA 2WO3A 2VZSA 3VD3A 2WAOA 3DYOA 5I0DA 1XPWA 4GZ9A 1PMHX 3C7GA 1PX4A 4E8DA 4ZZ8A 4ET7A 1GU3A 2Y6HA 3ABZA 3THCA 3OB8A 1JYVA 2QQMA 5CZKA 4QX0A 3DYMA 3CZJA 1UMIA 4UAPA 3T08A 4DEVA 3CDZB 3EYPA 5IFPA 2ORZA 1OF4A 1KEXA 4FI9A 2RVAA 1EUUA 2Y8KA 3VD4A 2E31A 4ARXA 1LNSA 2J1RA 2QQJA 4QDQA 1UY1A 2EIDA 4L0PA 3MO4A 2VMCA 2BBAA 1CX1A 2QQKA 1JZ7A 3GM8A 1DYOA 4W4ZA 3ACHA 4DUXA 5C7GA 2QQLA 1NKGA 2HYXA 1K3IA 2VZQA 3CKHA 2BGOA 1NAEA 3ECQA 4PT6A 3WF4A 3OG2A 2WABA 1TG7A 1L7QA 2ORXA 3A7QA 4XUPA 5LA2A 4BDVB 3I3DA 2WZ8A 3MV01 4LKSA 3CZUA 2ZEYA 2WDBA 4HG6B 3SKVA 4PQQA 2ZEWA 1UZ0A 1XC6A 1UX7A 3VD9A 2XQXA 2V5DA 2EIBA 2LW8A 1K42A 1W9WA 4CU8A 2J1VA 4A45A 2J1AA 3T2OA 5IJRA 2X10A 3P1IA 4XUQA 3WF0A 1UYYA 3CMGA 3GGLA 2YC2A 3WNMA 1F4AA 1JZ4A 4TXWA 3WEZA 4DUWA 3I3EA 3LPGA 4BK4A 4TTGA 4XVHA 4LHSA 4BK5A 3FN9A 2L9LA 3NJXA 3WNNA 4A3ZA 3FHAA 2VZUA 2W1SA 4JKLA 4XUTA 4A4AA 3I2GA 3T2QA 2VMEA 2VCAA 2VR4A 4MGQA 3SEEA 4JHZA 4AG4A 2W95A 3JXSA 2HLEA 5EIYB 3OGSA 4YPJA 2DCKA 1US2A 3ACFA 3C7OA 4ZY9A 4QPWA 3WNLA 4PF1A 2Y64A 2WUHA 3AC0A 2VM9A 3OGRA 1UY3A 5B4NA 1NX9A 2JE8A 2VZPA 3T0BA 2VZTA 3ZM8A 2QQNA 2VZRA 2VQUA 4CU6A 5C71A 4MADA 2QBXA 3BN6A 3I2JA 5G05L 3CIHA 3W5MA 4P5YA 1W0NA 1UY2A 4QX3A 3HNMA 1GMMA 1OF3A 1PMJX 1T2XA 4CUAA 1O8SA 3VDAA 4JX0A 3WNPA 4DEQA 3D3AA 5F7UA 4P02B 1K45A 1EUTA 1UY4A 5JXJA 1JHJA 2WAAA 3WNKA 1O59A 3HN3A 2V4VA 2E26A 2J22A 3F2ZA 2ZXQA 3MV11 1GQPA 2XOMA 4P08A 4KWUA 4DXRA 2E33A 2VZ3A 2VCCA 3PUIA 4QB1A 5HXMA 4W8JA 1ULPA 5DN2A 2Y6GA 2C9KA 2J1UA 3FL7A 5JXIA 5LA1A 2J1TA 3VDBA 2RV9A 2XHNA 2Z4FA 2V72A 3IAPA 4LPLA 1JZ3A 4CU9A 4QDRA 2Y6JA 3K4AA 1H6XA 2VZ1A 1JU4A 2VZOA 4E8CA 3LEKA 3WF1A 1OT5A 3IIIA 3K75B 4JKKA 2W1UA 1W99A 2WQ8A 4GWJA 3A22A 4A41A 3IAQA 5IFTA 4Z2AA 3UESA 4D0QA 3VDCA 2VJXA 1WKYA 3ACGA 4DXSA 2DCJA 4LQRA 3W5NA 3CQOA 1YQ2A 3UETA 3UNPA 3WF3A 4M4PA 2YFZA 3T0DA 2BERA 3LEGA 2WN3A 3I97A 4QB2A 4UI9L 3LQCA 2YFUA 1GNYA 5G04L 1WCQA 3PUHA 2YC4A 2W47A 3J7HA 2EIEA 3P6BA 4MO3M 2EICA 1F4HA 1DLCA 1UY0A 2VOTA 2X05A 5LCWL 3K4DA 2VQTA 3ETPA 3GDBA 4QAWA 3NRUA 1MPXA 1ULOA 3EB7A 4OMCA 1J84A 2BGPA 4XURA 2W9XA 3C8XA 3C7EA 3OGVA 5EJ1B 1HN1A 1UWWA 2VMDA 1GOFA 2C26A 1OH4A 4A42A 3T0AA 2J1EA 2WBKA 2QQOA 2VC9A 4QB6A 3WQBA 4RN5A 2C4XA 5DMYA 1I5PA 2LS6A 2QQIA 2XONA 1JZ2A 2W3JA 2W5FA 4GWIA 4KI5M 1BHGA 3HJRA 2J1SA 4W50A 1GOGA 5HPOA 2VTFA 3T09A 4BXSV 1CZVA 4CVUA 1DP0A 5DQ0A 3NJVA 1UMHA 3K4ZA 3OEAA 4QX2A 2ZEZA 4JKMA 5IHRA 1IQDC 1D7PM 3ACIA 3VD7A 4QDSA 3DECA 3LEIA 3SEPA 3WNOA 4DXTA 3THDA 1UXZA 4A6OA 4ZZ5A 3IDAA 3I3BA 2OKXA 5C70A 4D8MA 2R7EB 5JR2A 5JMOA 2JKXA 4AAXA 4UOJA 4M4RA 1TVGA 2W1WA 1OD3A 1W9TA 2JD9A 1JYWA 1JZ5A 1RYYA 3GXUA 2W46A 3HOBA 2VL4A 2KD7A 2E32A 2W1QA 3NNGA 3K46A 5DPNA 5JXHA 3BGAA 4A44A 1L7RA 4MOAA 2DDUA 3FHQA 4CU7A 3T2PA 3HNYM 2B9VA 2CDOA 1SDDB 2VZVA 3OEBA 2CDPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JUV A;  3VD5 A;  5JXG A;  4XUN A;  1CZT A;  5B4X A;  3IB3 A;  4OMD A;  4P00 B;  1US3 A;  4XUO A;  3C7F A;  3I2H A;  4KMQ A;  4CUC A;  1J83 A;  1PX3 A;  2WZE A;  3K77 A;  5CYY A;  3MUZ 1;  3WF2 A;  5A1A A;  1UXX X;  1W9S A;  3SKJ E;  1CZS A;  1R64 A;  2J7M A;  3OBA A;  2Y6L A;  2YB7 A;  4RYD A;  2BZD A;  4CUB A;  3I2F A;  4OYU A;  3LPF A;  2W92 A;  3A23 A;  3MBW A;  1JYX A;  5LA0 A;  3I2I A;  3HEI A;  1O8P A;  1UYZ A;  2WN2 A;  4MGS A;  1SHW B;  3HNB M;  1P8J A;  4BJ0 A;  3U37 A;  5FUI A;  4ZXE A;  3I2K A;  3MUY 1;  3DYP A;  2JDA A;  2ID4 A;  1UYX A;  2RJ2 A;  1KGY A;  3HPN A;  2WO2 A;  5EJZ B;  1JZ6 A;  3WSO A;  1CIY A;  2VMF A;  2WYS A;  1GUI A;  1SG3 A;  2VO5 A;  4DUV A;  2W91 A;  3E1F 1;  5IYY A;  3LE0 A;  2B4K A;  2W94 A;  1W8O A;  1W8N A;  4OZO A;  5J1X A;  2PQS A;  3C7H A;  3NQH A;  2ZEX A;  2WO1 A;  2Y6K A;  1K12 A;  2X09 A;  1GOH A;  1JZ8 A;  4QX1 A;  2YG0 A;  4OUE A;  1XNA A;  1JI6 A;  2W87 A;  1JU3 A;  1H6Y A;  1XNT A;  4XZU G;  4ARY A;  3A21 A;  1NUK A;  4IUG A;  1JYN A;  2VCB A;  2WO3 A;  2VZS A;  3VD3 A;  2WAO A;  3DYO A;  5I0D A;  1XPW A;  4GZ9 A;  1PMH X;  3C7G A;  1PX4 A;  4E8D A;  4ZZ8 A;  4ET7 A;  1GU3 A;  2Y6H A;  3ABZ A;  3THC A;  3OB8 A;  1JYV A;  2QQM A;  5CZK A;  4QX0 A;  3DYM A;  3CZJ A;  1UMI A;  4UAP A;  3T08 A;  4DEV A;  3CDZ B;  3EYP A;  5IFP A;  2ORZ A;  1OF4 A;  1KEX A;  4FI9 A;  2RVA A;  1EUU A;  2Y8K A;  3VD4 A;  2E31 A;  4ARX A;  1LNS A;  2J1R A;  2QQJ A;  4QDQ A;  1UY1 A;  2EID A;  4L0P A;  3MO4 A;  2VMC A;  2BBA A;  1CX1 A;  2QQK A;  1JZ7 A;  3GM8 A;  1DYO A;  4W4Z A;  3ACH A;  4DUX A;  5C7G A;  2QQL A;  1NKG A;  2HYX A;  1K3I A;  2VZQ A;  3CKH A;  2BGO A;  1NAE A;  3ECQ A;  4PT6 A;  3WF4 A;  3OG2 A;  2WAB A;  1TG7 A;  1L7Q A;  2ORX A;  3A7Q A;  4XUP A;  5LA2 A;  4BDV B;  3I3D A;  2WZ8 A;  3MV0 1;  4LKS A;  3CZU A;  2ZEY A;  2WDB A;  4HG6 B;  3SKV A;  4PQQ A;  2ZEW A;  1UZ0 A;  1XC6 A;  1UX7 A;  3VD9 A;  2XQX A;  2V5D A;  2EIB A;  2LW8 A;  1K42 A;  1W9W A;  4CU8 A;  2J1V A;  4A45 A;  2J1A A;  3T2O A;  5IJR A;  2X10 A;  3P1I A;  4XUQ A;  3WF0 A;  1UYY A;  3CMG A;  3GGL A;  2YC2 A;  3WNM A;  1F4A A;  1JZ4 A;  4TXW A;  3WEZ A;  4DUW A;  3I3E A;  3LPG A;  4BK4 A;  4TTG A;  4XVH A;  4LHS A;  4BK5 A;  3FN9 A;  2L9L A;  3NJX A;  3WNN A;  4A3Z A;  3FHA A;  2VZU A;  2W1S A;  4JKL A;  4XUT A;  4A4A A;  3I2G A;  3T2Q A;  2VME A;  2VCA A;  2VR4 A;  4MGQ A;  3SEE A;  4JHZ A;  4AG4 A;  2W95 A;  3JXS A;  2HLE A;  5EIY B;  3OGS A;  4YPJ A;  2DCK A;  1US2 A;  3ACF A;  3C7O A;  4ZY9 A;  4QPW A;  3WNL A;  4PF1 A;  2Y64 A;  2WUH A;  3AC0 A;  2VM9 A;  3OGR A;  1UY3 A;  5B4N A;  1NX9 A;  2JE8 A;  2VZP A;  3T0B A;  2VZT A;  3ZM8 A;  2QQN A;  2VZR A;  2VQU A;  4CU6 A;  5C71 A;  4MAD A;  2QBX A;  3BN6 A;  3I2J A;  5G05 L;  3CIH A;  3W5M A;  4P5Y A;  1W0N A;  1UY2 A;  4QX3 A;  3HNM A;  1GMM A;  1OF3 A;  1PMJ X;  1T2X A;  4CUA A;  1O8S A;  3VDA A;  4JX0 A;  3WNP A;  4DEQ A;  3D3A A;  5F7U A;  4P02 B;  1K45 A;  1EUT A;  1UY4 A;  5JXJ A;  1JHJ A;  2WAA A;  3WNK A;  1O59 A;  3HN3 A;  2V4V A;  2E26 A;  2J22 A;  3F2Z A;  2ZXQ A;  3MV1 1;  1GQP A;  2XOM A;  4P08 A;  4KWU A;  4DXR A;  2E33 A;  2VZ3 A;  2VCC A;  3PUI A;  4QB1 A;  5HXM A;  4W8J A;  1ULP A;  5DN2 A;  2Y6G A;  2C9K A;  2J1U A;  3FL7 A;  5JXI A;  5LA1 A;  2J1T A;  3VDB A;  2RV9 A;  2XHN A;  2Z4F A;  2V72 A;  3IAP A;  4LPL A;  1JZ3 A;  4CU9 A;  4QDR A;  2Y6J A;  3K4A A;  1H6X A;  2VZ1 A;  1JU4 A;  2VZO A;  4E8C A;  3LEK A;  3WF1 A;  1OT5 A;  3III A;  3K75 B;  4JKK A;  2W1U A;  1W99 A;  2WQ8 A;  4GWJ A;  3A22 A;  4A41 A;  3IAQ A;  5IFT A;  4Z2A A;  3UES A;  4D0Q A;  3VDC A;  2VJX A;  1WKY A;  3ACG A;  4DXS A;  2DCJ A;  4LQR A;  3W5N A;  3CQO A;  1YQ2 A;  3UET A;  3UNP A;  3WF3 A;  4M4P A;  2YFZ A;  3T0D A;  2BER A;  3LEG A;  2WN3 A;  3I97 A;  4QB2 A;  4UI9 L;  3LQC A;  2YFU A;  1GNY A;  5G04 L;  1WCQ A;  3PUH A;  2YC4 A;  2W47 A;  3J7H A;  2EIE A;  3P6B A;  4MO3 M;  2EIC A;  1F4H A;  1DLC A;  1UY0 A;  2VOT A;  2X05 A;  5LCW L;  3K4D A;  2VQT A;  3ETP A;  3GDB A;  4QAW A;  3NRU A;  1MPX A;  1ULO A;  3EB7 A;  4OMC A;  1J84 A;  2BGP A;  4XUR A;  2W9X A;  3C8X A;  3C7E A;  3OGV A;  5EJ1 B;  1HN1 A;  1UWW A;  2VMD A;  1GOF A;  2C26 A;  1OH4 A;  4A42 A;  3T0A A;  2J1E A;  2WBK A;  2QQO A;  2VC9 A;  4QB6 A;  3WQB A;  4RN5 A;  2C4X A;  5DMY A;  1I5P A;  2LS6 A;  2QQI A;  2XON A;  1JZ2 A;  2W3J A;  2W5F A;  4GWI A;  4KI5 M;  1BHG A;  3HJR A;  2J1S A;  4W50 A;  1GOG A;  5HPO A;  2VTF A;  3T09 A;  4BXS V;  1CZV A;  4CVU A;  1DP0 A;  5DQ0 A;  3NJV A;  1UMH A;  3K4Z A;  3OEA A;  4QX2 A;  2ZEZ A;  4JKM A;  5IHR A;  1IQD C;  1D7P M;  3ACI A;  3VD7 A;  4QDS A;  3DEC A;  3LEI A;  3SEP A;  3WNO A;  4DXT A;  3THD A;  1UXZ A;  4A6O A;  4ZZ5 A;  3IDA A;  3I3B A;  2OKX A;  5C70 A;  4D8M A;  2R7E B;  5JR2 A;  5JMO A;  2JKX A;  4AAX A;  4UOJ A;  4M4R A;  1TVG A;  2W1W A;  1OD3 A;  1W9T A;  2JD9 A;  1JYW A;  1JZ5 A;  1RYY A;  3GXU A;  2W46 A;  3HOB A;  2VL4 A;  2KD7 A;  2E32 A;  2W1Q A;  3NNG A;  3K46 A;  5DPN A;  5JXH A;  3BGA A;  4A44 A;  1L7R A;  4MOA A;  2DDU A;  3FHQ A;  4CU7 A;  3T2P A;  3HNY M;  2B9V A;  2CDO A;  1SDD B;  2VZV A;  3OEB A;  2CDP A; 
#chains in the Genus database with same CATH topology
 4NRQ A;  2CTV A;  4ERO A;  5JOW A;  5F32 A;  3Q8B A;  1KFU L;  5DUX A;  3RRD A;  4L2N A;  1VMH A;  4P00 B;  1US3 A;  3MIG A;  1POV 0;  1A3K A;  3C7F A;  5I8Y A;  3GZE A;  2KR2 A;  2R07 3;  4KMQ A;  1WWY A;  1RUG 1;  3NL1 A;  4CUC A;  2EAL A;  1UF2 C;  4QHO A;  2A7A A;  2HWD 1;  3K77 A;  1QY4 A;  1WMD A;  3MUZ 1;  5FPA A;  3WF2 A;  3WQ1 A;  4YNI A;  5TSW A;  4ASK A;  4ATF A;  1CZS A;  1LOD A;  5CEH A;  3BI3 A;  2HWF 2;  2JX9 A;  2VVE A;  2GP3 A;  2WQZ C;  4YVS C;  1WME A;  4CUB A;  2DFB A;  3O1P A;  1EPZ A;  4QXH A;  1AL2 1;  1N1Y A;  1XQN A;  3AVS A;  3IWZ A;  3I2I A;  1YLL A;  1O7F A;  4JDM A;  3J8F 2;  4YGD A;  3OBR A;  1S0I A;  1S1A A;  3AZV A;  5HCF A;  5GZE A;  4AVB A;  4QGL A;  4RFR B;  3J8F 1;  3I3Q A;  3I2K A;  5KHJ A;  1GP6 A;  5IWF A;  1T6G C;  3RZK A;  3LDR A;  2Q1Z B;  1WCD J;  3M8L A;  4XCA A;  1JH5 A;  5BNN A;  5IW0 A;  3RQ0 A;  4IGP A;  1AF9 A;  5EJZ B;  4DIN B;  4GB3 2;  4AVV A;  4AI2 A;  2OUJ A;  1QJY 2;  4DUV A;  1ZRD A;  5FKB A;  3HT1 A;  3LIG A;  2BNO A;  4AYU A;  1OXC A;  1XNK A;  5EV7 A;  3E1F 1;  5FIX A;  2DU1 A;  4Q4V 1;  5FYY A;  1C57 A;  5L19 A;  4CDU A;  3PMS A;  4EQV A;  3CEW A;  1SLC A;  2XJU A;  1NG0 A;  2PQS A;  3ILR A;  3I59 B;  1EV1 2;  1RUC 2;  3P5B A;  2DYC A;  3LGR A;  5AC9 2;  5FBJ A;  5FWJ A;  2QE3 A;  2ZGO A;  2W68 A;  1GOH A;  3JQW A;  4LKD A;  4M01 A;  2HEV F;  2XWB B;  3KCX A;  4GXL A;  4EYU A;  1GV9 A;  4W6X A;  2E6V A;  2ZKL A;  5DXD A;  5GZG A;  1XNT A;  4ARY A;  3A21 A;  1AXK A;  3MLK A;  1PO1 1;  4UF0 B;  5FYT A;  1QJU 3;  4QT6 A;  1A6C A;  2VZS A;  2WAO A;  4GZ9 A;  2PLV 2;  1PMH X;  3AP7 A;  3C7G A;  2K9Z A;  4FPL A;  4QPG B;  2RMU 1;  1CPN A;  1W9Y A;  3DKW A;  4DPN A;  3NWK A;  5CKN A;  5J3U A;  4C0B A;  4LBL A;  1IPJ A;  4QX0 A;  1W0O A;  3K51 A;  5H9P A;  3RZM A;  2HWD 2;  1DQ1 A;  1RMU 2;  4CEW C;  2RDR A;  1DQ6 A;  1OA3 A;  3CJI A;  4ZS2 A;  1PGS A;  1NCQ C;  4TLG A;  2OYZ A;  1GZ9 A;  1UU4 A;  2Y8K A;  1FV3 A;  4QPI B;  3LEM A;  4MXW B;  2OS2 A;  2QQJ A;  4LIU A;  2XJP A;  1PO2 2;  1S0E A;  1ZVF A;  3KQR A;  3OGG A;  4UFL A;  4LE3 A;  4QQP A;  4SBV A;  1SLA A;  1DQ0 A;  3OD4 A;  4Q0P A;  5A7O A;  4AEJ A;  2P17 A;  1WW7 A;  2I07 B;  1ND2 B;  1XRU A;  2MEV 2;  2QQK A;  1AYN 2;  3PJQ A;  3GM8 A;  1YQ8 A;  2D98 A;  4XFH A;  4FOW A;  1W8W A;  1YNA A;  3BIW E;  4DUX A;  4CEY C;  2QQW A;  4JRL A;  1FAY A;  3MGU A;  5JOY A;  1C28 A;  1PHM A;  2VZQ A;  3OY8 B;  2A75 A;  3VZM A;  3WDY A;  4FXK B;  5JSP A;  4YFW A;  4NRM A;  1QOT A;  4FBF A;  3VZK A;  3NW4 A;  4D3W A;  5A6Y A;  4LMF A;  5FZ7 A;  3R6S A;  1ND2 A;  1TG7 A;  2R32 A;  4XFC A;  1BQP A;  2VUA A;  4X6Q B;  4XUP A;  1DGR A;  5FYU A;  1DZQ A;  3GAL A;  4AHZ A;  1RMU 3;  5EWS A;  3W58 A;  1FV2 A;  3ZSL A;  4E9K A;  1O5U A;  1OUX A;  3H0O A;  3H42 B;  4TWT A;  3SKV A;  3N35 A;  3DPR B;  3NAP B;  2HWF 3;  1B35 A;  5FYH A;  5DZF A;  2FBE A;  3QH7 A;  3S57 A;  2V5D A;  1UCX A;  2EIB A;  2LW8 A;  3M3C A;  4AHW A;  2D6L X;  1LU1 A;  1RUC 1;  4WV8 A;  4WM8 C;  1R09 1;  4NPR A;  2WS9 1;  1RUD 2;  4GH4 A;  2QJV A;  1ZZ6 A;  3S5Q A;  3T2O A;  1BCX A;  1PNG A;  2VOX A;  2X10 A;  3CJI C;  4N90 A;  4AED C;  1NLR A;  1OSG A;  4U36 A;  1UYY A;  4WVM B;  1SDW A;  1RVF 3;  3CL1 A;  4LOR A;  4E4D X;  2GC3 A;  5L7O A;  1QJX 3;  4R52 A;  2P6C A;  1O4Y A;  2ZGT A;  3WEZ A;  4AED A;  1DGW X;  3MZH A;  4BK4 A;  3LPG A;  3OUI A;  4TTG A;  4XVH A;  4LHS A;  2VMI A;  2PLV 1;  5SV5 A;  4BLI A;  3I7D A;  4RSU A;  3HBK A;  4B7E A;  1SBF A;  2PXJ A;  3H3L A;  5FXW A;  4RFT 0;  3VL8 A;  3ZFG B;  2ZKN A;  1HB3 A;  4A3Z A;  4JAA A;  5FLI A;  4OCT A;  1YIF A;  2H0B A;  1FOD 3;  2WRA A;  4GJZ A;  4LIV A;  1NCR C;  1RUH 2;  2A70 A;  2W1S A;  1CJP A;  3M3O A;  4JGZ B;  4LLF A;  3VKL A;  3ZN6 B;  2D43 A;  1SMV A;  4TYS A;  4LBO A;  4SLI A;  4AI9 A;  4L99 A;  3ALQ A;  3WG1 A;  2RM2 2;  2VME A;  3CHX A;  3T2Q A;  1H1I A;  2EXJ A;  3A4U A;  4XHX A;  3SEE A;  4JHZ A;  3HWJ A;  1O3R A;  1VJ2 A;  2OT7 A;  1Q8Q A;  2Q4S A;  1BK1 A;  2ERF A;  3POF A;  3OGS A;  1UYP A;  2CAU A;  1AVB A;  4R9C A;  4YPJ A;  4YM0 A;  3B9I A;  4LA2 A;  3ACF A;  3ZXL A;  4X8N A;  1TQ5 A;  4KGQ A;  3WNL A;  3PJY A;  3EJK A;  4OHY A;  3L2H A;  1WA4 A;  1W0P A;  3PNA A;  1LED A;  4ZU4 A;  1UZZ A;  3OGR A;  2RS5 1;  5FO9 B;  1MZ6 A;  4Z07 A;  2R07 1;  1ZZ9 A;  5B4N A;  2D6P A;  1BYH A;  4NHX A;  4AED B;  1VAV A;  3CJI B;  4L97 A;  5L9R A;  1RUJ 2;  1X33 A;  2VZR A;  4LBJ A;  4CDW A;  1RED A;  3ZN5 A;  1HQN A;  2JJ6 A;  1H0B A;  4Q0S A;  4LO8 A;  2QBX A;  5LA9 A;  1OPM A;  3WUD A;  4E2S A;  2Y6F A;  3BU0 A;  2LUW A;  5C3S A;  4N7U A;  3WW4 A;  2ADD A;  1QXJ A;  2A3Y A;  3DL3 A;  1PMJ X;  4AGV A;  1UZV A;  5FYB A;  5KR7 A;  3EXU A;  1D4M 2;  1AJK A;  4JX0 A;  4WVZ A;  3WP5 A;  3WNP A;  2CL2 A;  2TNF A;  4Q4V 3;  5F7U A;  3ME2 A;  4P02 B;  1K45 A;  5FXV A;  1ZBE 2;  5GLT A;  4GMP 3;  5JR7 B;  1EUT A;  4JTN A;  2C9A A;  1VRH 3;  5A80 A;  3IMM A;  4KWJ A;  2Q1M A;  5LK5 A;  1LAJ A;  2DTY A;  1BVV A;  2ZXQ A;  5F3C A;  3V56 A;  4IE0 A;  2C5D A;  1BK0 A;  2K0G A;  4HAN A;  1Y9M A;  2RS3 1;  2E33 A;  2E9Q A;  3JB8 A;  4JGY B;  2B46 X;  4I01 A;  5FXX A;  3NNF A;  4M3C B;  5KXC A;  1ZM1 A;  4DRR A;  1RXF A;  3R4U A;  4AI8 A;  3M7A A;  1G8W A;  5FZE A;  2J1U A;  2RM2 3;  3ZFF C;  2ENR A;  5JXI A;  1EPW A;  4K7J A;  2ZGL A;  2HEW F;  4JQR A;  4AK3 A;  5HV4 A;  5FPX A;  1WLC A;  1BKZ A;  2OUH A;  2RV9 A;  2XHN A;  4YZ4 A;  4HKW A;  5FMC A;  3ZFE A;  4EN9 B;  4EE2 A;  2WS9 3;  5AC9 3;  3WNX A;  3D5O A;  5CB7 A;  4LO5 B;  3VDD A;  4BLJ A;  4JGY A;  4CU9 A;  1EAH 1;  2VZ1 A;  1X9P A;  5FV3 A;  2JB4 A;  3V65 A;  4D94 A;  4GQ7 A;  1BVP 1;  1DZT A;  1V6L A;  2RR1 3;  3Q9O A;  4RGA A;  2X29 A;  4LUM A;  4Q1R A;  4ZPI A;  4EN6 B;  1WD4 A;  1FT9 A;  2R16 A;  1BEV 3;  4MLO A;  2XUM A;  2Q0A A;  3B5L B;  2P3J A;  1G7Y A;  1DFQ A;  4Q4Y 1;  5LBE A;  1Q8V A;  4TSV A;  4A41 A;  4BMB A;  1OUR A;  2EF6 A;  5IFT A;  4Z2A A;  2WNV B;  4K21 A;  5IT6 A;  4FXG B;  5H9Q A;  3ACG A;  4DXS A;  3B93 A;  4K1Y A;  1KRI A;  2WNU A;  4OI1 A;  5FZ1 A;  3CQO A;  1IQA A;  4LOS A;  4M3C E;  2BVB A;  1BZW A;  1DCS A;  5F6K A;  3WF3 A;  2NMO A;  2ZGQ A;  2ARE A;  2G19 A;  2ZGN A;  4YW1 A;  5FDB A;  4M4P A;  3GBG A;  4HET A;  3RS6 A;  4DFS A;  4AFC A;  1RHI 3;  5J37 A;  3FLT A;  1AYM 3;  2VUL A;  1WCS A;  3LQC A;  1LGC A;  3L9J T;  5F3I A;  2EXK A;  4XIL A;  1XE7 A;  4YVS A;  4P9J A;  5G04 L;  2WA4 A;  4QHZ A;  3VKO A;  1BMV 1;  3GBF A;  2F17 A;  3LFI A;  1NZC A;  4NO4 A;  4QKB A;  2BVV A;  2KM2 A;  2FDG A;  3I59 A;  3O5S A;  4EN8 B;  4YRD A;  1RUH 3;  1CN1 A;  3PHM A;  5CFC C;  3Q8F A;  4BQ3 A;  1W8F A;  2FD8 A;  3HD8 B;  2D3S A;  1VMJ A;  2WWS A;  5CKQ A;  5EYY A;  3OYW A;  3NST A;  1AYN 3;  1OLM E;  2BBV A;  2X05 A;  4CDQ C;  4OLL A;  3MF9 A;  2OPW A;  4W65 A;  3VBR A;  4AW7 A;  2TEP A;  5L9B A;  4QAW A;  1ST8 A;  1JTZ X;  4B1L A;  5D21 A;  2Y0O A;  1XNB A;  3AMP A;  4QXC A;  3VLB B;  3EB7 A;  4OMC A;  4WM7 A;  1LU2 A;  4NID A;  2VW1 A;  4QQH A;  2I45 A;  2ZAB A;  3WW3 A;  1C3H A;  4XJ8 A;  4YZ2 A;  1OVS A;  3C8X A;  4MG2 A;  2YPJ A;  3OGV A;  4CCL A;  1NE6 A;  1IG0 A;  2WII B;  3TB0 A;  4YAR A;  2WS9 2;  1O3Q A;  3GHN A;  5FZA A;  5A33 B;  3BOW A;  1ENS A;  3J7N A;  3ZPY A;  2W08 A;  4I30 A;  3T1M A;  1IOA A;  2RS3 2;  5K7P A;  2WBK A;  5FLJ A;  2R04 2;  4BYY A;  5DMY A;  1D2S A;  4QKF A;  3POI A;  5J09 A;  1JZ2 A;  3OBT A;  1FNZ A;  1RUF 1;  4YYO A;  1LES A;  4O7X A;  4GWI A;  2BOI A;  1UN1 A;  3OF1 A;  1BHG A;  4FPO B;  3ZKU A;  2E7A A;  2ZGS A;  1RUI 3;  1IPK A;  2D5F A;  1WW4 A;  4WZC A;  4YW6 A;  1GZT A;  3KV4 A;  3N9L A;  3SXW A;  4K6B A;  1CAW B;  4LR4 A;  2CY6 A;  3AZX A;  4LTA A;  1Q8S A;  3KLS A;  1DQ2 A;  2E63 A;  4X8P A;  2E7Q A;  3E5X A;  3OEA A;  4HVO A;  4QX2 A;  3WHU A;  1D4V B;  3AFK A;  2W2I A;  5JIA A;  5DDJ 1;  3FBM A;  1W2U A;  2RJK A;  5L7O C;  3IPV A;  4M0N A;  1RHI 1;  4Q4X 3;  1FYU A;  3KT4 A;  1IQD C;  3UKV A;  4NR1 A;  4BOW A;  1D7P M;  1RXG A;  3OOX A;  2R06 2;  3ASI A;  1K5M A;  3DEC A;  1SFY A;  2DVF A;  3LEI A;  3SEP A;  5H9S A;  2KXL A;  2C24 A;  2HBT A;  3THD A;  2XLF A;  1E57 A;  3AMH A;  1TE1 B;  1BMV 2;  1MQT B;  3I3B A;  2QCS B;  4D8M A;  1S0C A;  5JMO A;  1NA1 B;  3LFM A;  3B3Q E;  4G9S B;  4AAX A;  1XJA A;  4ISQ A;  2WFF 3;  4CCC A;  1R1A 2;  1SLL A;  1OD3 A;  5D1I A;  1F5J A;  1NYW A;  3N7J A;  4PCR A;  4NPL A;  3WQ0 A;  4CP9 A;  2HWE 3;  2NN8 A;  1JYW A;  2VW0 A;  1RYY A;  3LKJ A;  4LBK A;  1VE0 A;  1IHM A;  4Z2W A;  1HRI 2;  2FCV A;  2W46 A;  1LOF A;  2DV9 A;  2WLQ A;  2ZJC A;  3FX3 A;  1GZW A;  5DAW A;  3UL2 A;  4A6S A;  1BJQ A;  2BFU L;  2KD7 A;  1COV 2;  4U2A A;  1HKD A;  3IT8 A;  4XW3 A;  2PN5 A;  4CPB D;  2MNG A;  2VUD A;  1W6N B;  1PVC 1;  4Y1V A;  3VUO A;  3BGA A;  3OD0 A;  4A44 A;  5FYC A;  2RE9 A;  3GF6 A;  3GCX A;  3ZMO A;  3LAG A;  2A3W A;  1L7R A;  4XHB A;  1Y3T A;  1BLZ A;  4Q29 A;  2JEM A;  3AL6 A;  3LOB A;  3B01 A;  2CDP A;  2CNA A;  4NOT A;  4R9D A;  4C90 A;  5JXG A;  2TBV A;  3AP4 A;  3PVO A;  4XUN A;  1C8M 2;  4RR3 C;  1CZT A;  5B4X A;  3H8X A;  3ZYB A;  1QGL A;  2YDE A;  3IB3 A;  2O1Q A;  2BPA 2;  1QMJ A;  1YJL A;  4E4S A;  4OI2 A;  2Y33 A;  4CCD A;  5JIU A;  3AKR A;  5ACA 1;  1MZE A;  1RUH 1;  5FP7 A;  2BU9 A;  3SCH A;  1VAL A;  1PX3 A;  3E6D A;  1VLN A;  1Y43 B;  2WZE A;  3KGZ A;  1RVF 2;  4AL9 A;  4XTP A;  5CYY A;  2ZX2 A;  4IE4 A;  2PMW B;  3OJB A;  3TN9 2;  1W9S A;  5A1A A;  5AFE A;  3SKJ E;  5K8S A;  2N7G A;  4MVT A;  2RG4 A;  3M2M A;  5GZD A;  3U75 A;  2ZHN A;  3KF3 A;  2P2K A;  4FT8 A;  2Y6L A;  1LOB A;  5LWB A;  3P3P A;  4RS5 C;  3O0W A;  4RYD A;  2OZ6 A;  1Y9Q A;  4LNV A;  5JOZ A;  2VG9 A;  1PNF A;  1W2N A;  2W92 A;  3FUO A;  3N9P A;  2XJT A;  3VBH B;  2RMU 2;  3A23 A;  1VBD 3;  4CDW B;  5LA0 A;  1LGN A;  1Q5O A;  1QJY 1;  5CAD A;  3MLL A;  4XF1 A;  4JTO A;  3OPZ A;  4LHK A;  3ZXF A;  5A32 A;  2EAK A;  1H30 A;  2WN2 A;  2ZX4 A;  1I1E A;  1GR3 A;  1QOO A;  5JPM B;  2ZAA A;  1P8J A;  4QKD A;  2PHU A;  5BXX A;  4B4Q A;  3N7M A;  5FUI A;  4ZXE A;  3MUY 1;  5FO7 B;  5FZ3 A;  3DYP A;  4YG0 A;  2JDY A;  3H8U A;  3ACL A;  4UBH A;  1ENX A;  2VBB A;  1KGY A;  2FCT A;  3HPN A;  5GJ6 A;  1FX5 A;  3ES4 A;  2HWC 2;  3NKT A;  4OZX A;  4XMA A;  1W8U A;  5BNP B;  2VMF A;  1D2Q A;  1CAX A;  1DU3 D;  1GIC A;  1NLQ A;  3JZV A;  1QU0 A;  3PIJ A;  5FZB A;  4YSF A;  5C3P A;  4OHZ A;  2H6B A;  2W91 A;  5FZI A;  1PK6 C;  1OPO A;  4B7K A;  1T6B X;  1Z7S 2;  3RJR A;  5IYY A;  3LE0 A;  4Y33 A;  4AFA A;  1IKP A;  4MYE A;  5BY5 A;  1ASJ 2;  4HBN A;  4RR3 A;  5GKA C;  3E97 A;  4AR2 A;  5F6L B;  1OHF A;  2VNR A;  5J1X A;  5KXB A;  1W6O A;  3NQH A;  4J1W A;  5IAX A;  1CR7 A;  1VBC 3;  3ZXG A;  2CWM A;  1H4G A;  1YI9 A;  4AAP A;  2B45 X;  1ZZ7 A;  5APA A;  4GAZ A;  2QQU A;  3I3M A;  2NZ9 A;  4BPZ A;  4P9Y A;  2ET7 A;  4I02 A;  4QQL A;  2P3Y A;  2XB6 C;  3USU A;  2B5H A;  4MGY E;  3SCF A;  4OUE A;  2HWD 3;  4WM7 C;  4AEK A;  2W87 A;  4HFS A;  4AE2 A;  1HB2 A;  1H6Y A;  3PVN A;  4YZ5 A;  4IUG A;  2HJI A;  4LHN A;  3FMG A;  3APB A;  4XJU A;  3SH5 A;  1JYN A;  3O1T A;  3FJS A;  4YGE A;  5F39 A;  3RYK A;  3ZKY A;  2XKO A;  3K3N A;  3VHO A;  1XPW A;  5C4W B;  5J7M A;  5LY1 A;  1HV1 A;  1HB4 A;  2C1F A;  4KH9 A;  4YW7 A;  5C5U A;  3OPW A;  3SH3 A;  1PX4 A;  4E8D A;  1ZA4 A;  4QX8 A;  4UW3 A;  1AL2 3;  1POQ A;  1TNF A;  2Y6H A;  4NRP A;  3ABZ A;  1XND A;  4F83 A;  4N8M A;  4V2V A;  3THC A;  2ZX0 A;  5FP9 A;  1JYV A;  5ANQ A;  3DYM A;  3CZJ A;  5LEK A;  4N9H A;  4QPY A;  3LOI A;  4S2D A;  1KS4 A;  4PF5 A;  5BNO B;  1H9W A;  4Q4X 1;  1AX1 A;  2GNM A;  3JBG 1;  4HL0 A;  3IBM A;  3RDI A;  4D6R A;  4Y4Y A;  3U0Z A;  3VD4 A;  1CWP A;  1MVQ A;  2VBP A;  5DAV A;  1EV1 3;  3IDE A;  2GU9 A;  3MPB A;  5ABJ C;  4HLT A;  4UFK A;  5J36 A;  4IEU A;  5FZD A;  2VMH A;  3VDD B;  1FMD 1;  5IVJ A;  1UU6 A;  5FJH A;  3O12 A;  1PZ8 A;  1QQP 3;  4K8F A;  3AZZ A;  5FBZ A;  4K20 A;  2P3I A;  4Z1V A;  1DYO A;  4W4Z A;  3ACH A;  4AFM A;  1VBE 3;  1V6N A;  2QQL A;  3H7Y A;  4JGZ A;  4K8R B;  1NKG A;  3UJQ A;  1K3I A;  2D6K A;  5BNQ A;  4UW5 A;  1OOP C;  2R1D A;  4ATE A;  1VBB 3;  1HRI 3;  5ERL A;  3SH4 A;  3H1Y A;  5H9R A;  3OG2 A;  1JOD A;  2VQ0 A;  4Y5Z 0;  1AR8 2;  1UIK A;  1F2N A;  3BOD A;  1RC6 A;  3JQX A;  2XJR A;  3ZYJ B;  1OMI A;  1RUG 3;  1G6N A;  5FZH A;  1EYB A;  1AJO A;  4LKS A;  3MW2 A;  2O0O A;  2HYK A;  4I09 A;  1XC6 A;  3M4F A;  2GNB A;  1UX7 A;  2DBI A;  3ENR A;  1BEV 2;  5FYM A;  4QPI C;  4LA3 A;  4P9W A;  1C8N A;  2GME A;  2XBO 2;  4I0B A;  4XBQ A;  4A45 A;  5J48 A;  1PM7 A;  3FE5 A;  4XAB A;  1C5I A;  3WDX A;  1W90 A;  4OHX A;  1JYC A;  2WNV A;  4IGO A;  4XUQ A;  1NT0 A;  1G9D A;  2GSY A;  2JEN A;  3GGL A;  2YC2 A;  4FTE A;  1GNH A;  1AR9 2;  4FPF A;  5T5O A;  1ZRR A;  1G9B A;  1JUH A;  2UWB A;  4KWK A;  4LUL A;  3E5Q A;  1YEW A;  3I3E A;  1HQL A;  1PO1 3;  2B8M A;  2P1B A;  4YGB A;  2TUN A;  5FUP A;  4W6Y A;  5JZG A;  2XH6 A;  2L9L A;  2WYF A;  4NAM A;  4XEZ A;  3NJX A;  3R4S A;  3ZXE A;  3POB A;  3WNN A;  4JC1 A;  3WR0 A;  4CTE A;  3L2Y A;  4CP2 A;  4AEM A;  3B9C A;  1XOY A;  2V4A A;  2VZU A;  4ITC A;  1YCI A;  2G4I A;  1RUG 2;  2DVA A;  2WT0 A;  2R04 3;  1CON A;  1EY2 A;  1TME 2;  2R0F A;  5FY1 A;  3U1X A;  3NKG A;  4J6G A;  4MXW A;  5JSO A;  2RS1 1;  1W04 A;  3E5U A;  4A4A A;  3O1U A;  3I2G A;  3U14 A;  3TN9 1;  1VBC 1;  2VCA A;  4MGQ A;  5JOX A;  1LHV A;  4AG4 A;  1W6P A;  2W95 A;  3JXS A;  4RD7 A;  4XFA A;  5FPV A;  5EIY B;  5I8T A;  3J26 N;  1S2E A;  4QU2 A;  5ACA 2;  1F8V A;  2DCK A;  4AFD A;  1TMF 3;  3ZYF A;  3O14 A;  1RUC 3;  4LK7 A;  4CDU B;  5EXO A;  2A6W A;  4E2Q A;  5I8S A;  1CQ9 A;  1YI7 A;  3V0A A;  2G9G A;  1VR3 A;  3BKZ A;  2CGP A;  5T54 A;  2VM9 A;  3HR9 A;  1C5H A;  2CGO A;  3NMB A;  3BIE A;  2R1B A;  1DGR N;  3JU9 A;  3WDW A;  5HCA A;  2DUO A;  1MS1 A;  2JE8 A;  3MW4 A;  4N53 B;  1VRB A;  5C9A A;  4FPG A;  5L36 A;  4O65 A;  3ZM8 A;  2QQN A;  3HT2 A;  2Q1F A;  2R06 1;  2W39 A;  5FTT C;  1TMF 2;  3AP5 A;  1N3O A;  1QNY A;  2VQU A;  3H9A A;  4LHL A;  3LIH A;  4MAD A;  4O61 A;  3S6P A;  3WG4 A;  3I2J A;  1S55 A;  2WT2 A;  1WZX A;  4NWV A;  4Q8L A;  4DO0 A;  3CIH A;  5K0U A;  1PGW 1;  2OII A;  3TBD A;  1MS4 A;  3VBS A;  4JCK A;  1UY2 A;  4QX3 A;  1OF3 A;  3GBW A;  4NVP A;  5AVA A;  5F9T A;  4NIG A;  1O8S A;  1JN2 P;  4UFH A;  2NYY A;  4ZKT B;  5IK5 A;  5DG1 A;  1VBE 1;  1YFY A;  2AUY A;  2J42 A;  4WBB A;  4UT5 A;  2PAE A;  3VZL A;  4AOC A;  4HN1 A;  3AB0 A;  3M3Q A;  3HN3 A;  1DQ5 A;  3WV6 A;  1WD3 A;  2FCU A;  1UO9 A;  4L9B A;  3MV1 1;  1GQP A;  2XOM A;  4Y1Z A;  1XU1 A;  2FZ2 A;  2A71 A;  1IS5 A;  4ORF A;  4HPK A;  4Q0Q A;  4KG0 A;  4DXR A;  1Z7S 3;  2DTW A;  4XDO A;  3U07 A;  3MLJ A;  1D4M 1;  3RZJ A;  1GYK A;  4QKN A;  4Y24 A;  4YW5 A;  2LRO A;  5HXM A;  4W8J A;  4UBG A;  1VRH 1;  2GNT A;  1JS9 A;  3I2D A;  5DN2 A;  1QNW A;  1POV 1;  3DF0 A;  3PUA A;  4BIF A;  4FQ4 A;  4AQS A;  2AAC A;  3VZO A;  4CP0 A;  2ZGM A;  3VDB A;  4UFJ A;  1C8M 1;  3ZPO A;  3POY A;  4FTB A;  5FAX A;  1V9U 2;  2WL1 A;  4AF9 A;  4NE9 A;  2WC2 A;  4IXL A;  1COV 3;  1X8E A;  4QDR A;  2RS5 2;  1NLS A;  4V1P A;  2VOW A;  1R09 3;  4YG3 A;  5FKC A;  2CGN A;  3DKQ A;  3PLQ A;  4Q1P A;  4HN0 A;  3WCS A;  5GLW A;  4E8C A;  5JCT A;  2JB8 A;  1DGW A;  5FUN A;  1OT5 A;  1WGP A;  3III A;  4EWA A;  2W1U A;  3KHB A;  1TME 3;  4Q27 A;  3KZ4 C;  2WQ8 A;  2ARX A;  3PME A;  3WD5 A;  4GWJ A;  5A6Z A;  1VBB 2;  1MQT C;  3IAQ A;  4BM8 A;  4QMA A;  3RMY A;  1ZRE A;  2SBA A;  4UFI A;  2EA7 A;  1PO2 1;  3B94 A;  4FPK A;  2YGL A;  1XXN A;  4HPK B;  1Q3E A;  1WKY A;  4LQR A;  2VTX A;  1UZW A;  3ZSK A;  3W5N A;  3RZL A;  3T1L A;  4QPG A;  1FMD 2;  3UET A;  4XDQ A;  1UKG A;  3N36 A;  4H7L A;  4MH0 E;  2F4L A;  5BNP A;  2VNV A;  1HW5 A;  2YFZ A;  5DUU A;  3KHC A;  3T0D A;  1XBF A;  1VBC 2;  2BER A;  4HSJ A;  1Q8P A;  4IV1 C;  4I3G A;  5FXZ A;  4ARX A;  4AGR A;  2ZMN A;  3LEG A;  4BCU A;  4NUB A;  1O4T A;  4ZU7 A;  5CBL A;  3U4X A;  1HJG A;  4NHL A;  4GB3 1;  2YFU A;  4WM8 B;  2Z69 A;  1GWL A;  1QJF A;  4UW6 A;  3WDT A;  3HQU A;  4YVS B;  4IE7 A;  1O3T A;  4CZS A;  3UKT A;  2WQ4 A;  3AP6 A;  4RHV 3;  2W47 A;  3WDU A;  2OVU A;  1QJX 2;  4XOG A;  1CAW A;  3KV5 A;  5LZ6 A;  2O14 A;  4N53 A;  3FFQ A;  2GN3 A;  5T3N A;  1ZX5 A;  5CAZ A;  1MZ5 A;  2EIC A;  4FQZ A;  4WVV A;  1X82 A;  1RUE 2;  1JOP A;  2QKD A;  5FZ8 A;  2HWE 2;  4P14 A;  3RWK X;  5CFD B;  1IS4 A;  5LCW L;  4F8A A;  2QZ3 A;  2ZGU A;  4PDW A;  2V5Y A;  3ZFG C;  3JD7 1;  1SPP A;  3EQE A;  4W6W A;  4YM1 A;  3ZXD A;  2XPJ A;  3K4D A;  4DOU A;  3HBZ A;  1RUD 1;  4CXW A;  1MPX A;  4COV A;  5C8C A;  1UIJ A;  1W8T A;  2A6V A;  1J84 A;  1VBD 2;  2BGP A;  5JSR A;  2R04 1;  4QWN A;  1LOE A;  1LGB A;  2JEC A;  2A5Z A;  4IEO A;  1PK6 A;  4XXA A;  1BEV 1;  3AYE A;  3RI8 A;  1HXS 3;  2PQQ A;  3KMH A;  2AEZ A;  3CJX A;  2ZML A;  1WW6 A;  4FPC A;  4RGK A;  4XF4 A;  5F5Q A;  5FZ9 A;  2FZ1 A;  3QD6 A;  2BTV C;  2PHR A;  1GOF A;  2VMD A;  3TYJ A;  3VBR C;  1DZR A;  4BA6 A;  3IMN A;  1DLL A;  4LO7 A;  3J7L A;  1X9T A;  1OH4 A;  2IZW A;  2B39 A;  2FMD A;  4CDX C;  5KC5 A;  5LW9 A;  3H8O A;  3ATG A;  1DG6 A;  1DYK A;  1O5L A;  3HAG A;  3NJZ A;  4A42 A;  4M00 A;  2QTW B;  3CF6 E;  3VHN A;  1I9R A;  2QQO A;  4MX3 A;  4K1Z A;  2X8K A;  3GCW A;  2XUE A;  3OUH A;  5GZC A;  3MID A;  1PIV 2;  3W21 A;  5M0T A;  5DZG A;  2JDM A;  2MPF A;  1J1T A;  1VRH 2;  1GKB A;  2VNG A;  4XJW A;  2LS6 A;  1GZC A;  2QQI A;  2W5F A;  1ZBE 3;  5FY7 A;  1W6M A;  3AVR A;  3H50 A;  2DUQ A;  1Q8O A;  3JCI A;  1AYN 1;  4KI5 M;  3HJR A;  4W50 A;  2J1S A;  1GP5 A;  4KU8 A;  4PDW B;  2WZP P;  1KD7 A;  1MS0 A;  2XKP A;  1WLW A;  4FPJ A;  4Y1U A;  1X8M A;  1V9U 1;  3LD8 A;  3T09 A;  1JMU B;  2Q8O A;  3NO8 A;  4F3J A;  4COW A;  1GP4 A;  1QH7 A;  4V2W A;  1DP0 A;  3THT A;  3LA3 A;  5A3O A;  3TEY A;  3NJV A;  1UMH A;  2PYT A;  5F8P A;  1IKQ A;  4YM2 A;  2NPI A;  5C3O A;  2BNN A;  2ZBJ A;  4WZF A;  4ES9 A;  1R1A 1;  1WUV A;  3AMQ A;  3QCW A;  3WIN E;  1OFS A;  5A3P A;  2AEY A;  3VD7 A;  3RSJ A;  1S0B A;  1YO8 A;  2NM1 A;  4Y20 A;  2MHF A;  1K5M B;  1KIT A;  4QM9 A;  5C4W A;  1HRI 1;  4FOY A;  3OUJ A;  3MIB A;  3WNO A;  5K9Y A;  1LB2 A;  4NN0 A;  1NE4 A;  3CNA A;  4LLO A;  4CE8 A;  4RGG A;  3ZYH A;  2XJV A;  4LBQ D;  2IWG B;  3IDA A;  2IXK A;  2NQY A;  3OY8 A;  3VBR B;  4AVT A;  5LBF A;  4C0H A;  3GJB A;  5JR2 A;  2OA2 A;  5FOB B;  2JKX A;  2ZS6 B;  4XQW A;  1PZ9 A;  5EJ3 A;  1KDK A;  1W9T A;  3ZOI A;  3D0J A;  2G9Z A;  2D97 A;  4BE3 A;  5I91 A;  1U5Y A;  3QLQ A;  2JG8 C;  5E8A A;  4A7K A;  1UKR A;  1RIT A;  2LTN A;  1S0F A;  3AMM A;  3ELN A;  2JG9 C;  3H3U A;  4FAG A;  4PI0 A;  3E6C C;  2ZOE B;  5LEJ A;  3UYJ A;  5C6C A;  1UX6 A;  5A33 A;  2E32 A;  5BNO C;  4YW3 A;  5A7W A;  2YMZ A;  3K46 A;  5FRE A;  2BWA A;  3VKN A;  2DCZ A;  3J4U H;  3ST7 A;  4XFG A;  2FMY A;  1AR9 1;  2IXH A;  4FFG A;  5EQU A;  3WW1 A;  4NRO A;  1CAX B;  3KS7 A;  5IUQ A;  4EV0 A;  2D93 A;  2ES3 A;  3ZYP A;  4XDP A;  3T2P A;  1NCR A;  3HNY M;  1OI6 A;  3IM0 A;  1QQP 1;  4DB5 A;  3I49 A;  1LOF C;  2QFE A;  3VBO C;  4XFB A;  5JUV A;  2WWU A;  1ASJ 1;  3D82 A;  5IAV A;  2R49 A;  5FYS A;  2WNO A;  3DPR C;  3NAP C;  1SPP B;  1N1V A;  3OGJ A;  3N9M A;  5FR3 A;  3I2H A;  5IK8 A;  1HLC A;  2ATF A;  3LCP A;  3LF7 A;  1JHN A;  2PHW A;  4RHV 1;  1QKQ A;  2GH8 A;  3ITQ A;  5FY4 A;  4Q2F A;  3ZSE A;  3CO2 A;  3UT0 A;  1UXX X;  5T5J A;  5CFC A;  4IEV A;  4ASM B;  5KHI A;  1YFU A;  1R64 A;  1QDC A;  2J7M A;  5C8W A;  1NXM A;  4GH4 C;  2YB7 A;  4F7Z A;  2BZD A;  3RPQ A;  1XE0 A;  5A3W A;  3I2F A;  5JZG B;  4OYU A;  1W28 A;  1RUE 3;  1UNB A;  1RUO A;  2VVD A;  4IDZ A;  5FLH A;  4CCO A;  2BOJ A;  1U5Z A;  2ARA A;  3S0M A;  3MBW A;  3N9O A;  1FOD 2;  1RGS A;  2WZR 1;  3KF5 A;  5DZE A;  5IK4 A;  3HEI A;  3IN9 A;  4MUV A;  1XYP A;  4A7Z A;  1UYZ A;  3BPZ A;  1V6K A;  3MHZ A;  2D3P A;  1RUJ 1;  4CCJ A;  4I0W B;  4LBQ A;  4ZU5 A;  5CIS A;  2WNU C;  1NCR B;  2GAU A;  1CD3 G;  1Y4W A;  3CLP A;  5GLZ A;  4BJ0 A;  4COU A;  3N9Q A;  1NQJ A;  2JDA A;  4H7M A;  5I0U A;  5KXE A;  3AKQ A;  1UYX A;  4DS0 A;  1UU5 A;  5A7P A;  3VBU C;  1B09 A;  3B02 A;  1ULG A;  5CVR A;  3V64 A;  2WO2 A;  2Y60 A;  5K4L A;  3T2T A;  1LOG A;  2YY1 A;  3FZ3 A;  3UK9 A;  4E27 A;  1AR6 3;  4ZHN A;  1CIY A;  5ISL A;  2ZCW A;  4QXB A;  4CCM A;  2DCY A;  1J3Q A;  1SG3 A;  1AL0 G;  1VBA 2;  1I5Z A;  2BEO A;  2PHT A;  3ZR6 A;  1ZA7 A;  4LKE A;  2QNK A;  2VUC A;  3AYC A;  3POW A;  1W6N A;  4Q4W 1;  5E1R A;  5T5L A;  4EZ4 A;  4LT5 A;  2B4K A;  4BQY A;  2W94 A;  1SZB A;  1YQ6 A;  3MPP G;  3POE A;  4XE9 A;  2F6B A;  5E89 A;  2RS1 3;  2WKK A;  3M1H A;  1CX4 A;  3C7H A;  3QBQ A;  4Y1Y A;  1W6O B;  2QVS B;  3ZX7 A;  2Y6K A;  2GDF A;  1HRV 3;  3J9S A;  4DRV A;  1V70 A;  4HXC A;  2ET1 A;  1G9F A;  2VH9 A;  5D2A A;  4XAE A;  4BQW A;  1JZ8 A;  1SBD A;  2PAM A;  5JZG C;  4NMI A;  1D4M 3;  1XNA A;  1JI6 A;  2E7T A;  4HZF A;  4O9E A;  1JU3 A;  1VBA 3;  4ZON A;  4CEW A;  1ZZC A;  4XZU G;  3WP3 A;  5FQ0 A;  1NUK A;  4WVM A;  4IV1 B;  2GMP A;  4XJA A;  2HWE 1;  3T4H B;  1JOJ A;  1HXS 1;  1ZRI A;  4FO9 A;  2QUO A;  5SV8 A;  2Q8C A;  1PVX A;  3VD3 A;  5I0D A;  5BNN B;  2ZHK A;  3LSD A;  3AK0 A;  5KHH A;  1H2M A;  2O8Q A;  1K5J A;  2WSV A;  1REF A;  4XBL A;  1QHD A;  5AVP A;  1EAH 2;  4ZZ8 A;  5JPN B;  2VPV A;  1AZD A;  3C2U A;  4Q4Y 2;  4ET7 A;  1RUD 3;  1GU3 A;  2IFW A;  1JOB A;  5LBC A;  4Z82 A;  5FCC A;  3VBS B;  4R4Z A;  5HCH A;  1U12 A;  3DEM A;  5CZK A;  5A3L A;  1PM4 A;  1UMI A;  3T08 A;  3CDZ B;  2OQ6 A;  2JDZ A;  5F5C A;  5IFP A;  2ORZ A;  3PU3 A;  4GAL A;  1U5I A;  3IIA A;  4FI9 A;  4N9I A;  2RVA A;  3RYP A;  3VKM A;  4CEY A;  1EUU A;  1QJU 1;  4EWE A;  4I3P A;  3B7M A;  3ZO0 B;  4D7Y A;  2E31 A;  1DBN A;  1H4H A;  1LTE A;  1RJ7 A;  2HWF 1;  3Q8E A;  2Y0I A;  4LEJ A;  1LNS A;  4XYX A;  1QWR A;  2J1R A;  4IW3 A;  5FY8 A;  5HCB A;  1XB9 A;  1AYM 2;  4GA9 A;  5ACA 3;  3ETQ A;  3BPS A;  2K46 A;  3ZYI B;  4G3Y C;  3WZ1 A;  1UY1 A;  2UWC A;  3KWV A;  3RVH A;  4BQ5 A;  2EID A;  1IZ3 A;  2VXR A;  4L0P A;  3MO4 A;  1S0J A;  2ZZQ A;  4XQD A;  3UKN A;  4CEW B;  1V6J A;  2BBA A;  2X5I B;  4P9G A;  4XBN A;  1MEC 3;  5FZK A;  1H8T A;  2XR4 A;  1JZ7 A;  3Q8C A;  1ZBE 1;  1SFP A;  1G9C A;  1OUS A;  3U10 A;  1B35 C;  2HYX A;  5CA6 A;  5CNA A;  4C1W A;  2RS1 2;  4DY5 A;  3B69 A;  1HJF A;  1UAI A;  4IEZ A;  4OHV A;  1NAE A;  4ES8 A;  4PT6 A;  3WF4 A;  5CG8 A;  4XQ4 A;  5EHD A;  2UYB A;  5BNN C;  1W39 A;  3BYW A;  3MIH A;  1W05 A;  1F15 A;  4QM8 A;  4IER A;  2ORX A;  3A7Q A;  5LA2 A;  4Q8K A;  4ZS3 A;  5JMC A;  5A3N A;  3ILF A;  3KD4 A;  4GD4 A;  5FFO C;  1ONA A;  5FYZ A;  2VE1 A;  2VXJ A;  5A1F A;  4XFI A;  2IVJ A;  2UY9 A;  3ZN6 A;  1LHU A;  3ZIW A;  3CZU A;  2DVB A;  1MS3 A;  2WDB A;  4KBZ A;  4PQQ A;  2OQ7 A;  2ZEW A;  3DV8 A;  5CIR A;  3VD9 A;  1SBE A;  4JDO A;  2WA3 A;  1RIN A;  1EAH 3;  4B1M A;  1V6I A;  4YW2 A;  4OI0 A;  1LHW A;  3WQ7 A;  2G1M A;  3FFZ A;  1VAK A;  2CAV A;  3BB6 A;  3EMR A;  3PUQ A;  2ZHL A;  3CMG A;  2OPK A;  4S2H A;  2EAA A;  3EO6 A;  4DY3 A;  5A6Q A;  3WY6 A;  2WR9 A;  2ZTN A;  4XMI A;  1OD5 A;  3D6E A;  5FPL A;  3PTY A;  4RQP A;  4DNY A;  1JZ4 A;  2YZ4 A;  3RZH A;  3IKW A;  4TXW A;  1LHO A;  4HK8 A;  2BGC A;  3ZFE C;  4DUW A;  3V0B A;  1AHS A;  5C33 A;  5FPB A;  3JB4 C;  4BK5 A;  4BQ2 A;  2BP6 A;  1YC6 1;  3FN9 A;  4IQP A;  5FZ0 A;  3TAY A;  1RUN A;  4XIO A;  1QEX A;  4H14 A;  1ZNP A;  2VU9 A;  3DPR A;  3NAP A;  5GAL A;  4AZZ A;  2YRO A;  4E2G A;  2JDK A;  3ZVX A;  3RI9 A;  1AX2 A;  4LK6 A;  3FHA A;  1LKN A;  1NQD A;  3RJ2 X;  3QAC A;  1W06 A;  5FQ0 B;  4JKL A;  1ODM A;  2V09 A;  4ASL A;  5DAX A;  2VAU A;  2AEN A;  2Q5T A;  3BCW A;  4XUT A;  4GMP 1;  4CCN A;  1UW8 A;  5JVV A;  3DXU A;  5KC6 A;  2VOK A;  2Y34 A;  1QXR A;  4IE5 A;  4G4F A;  4BB3 A;  3WT3 A;  1IG3 A;  1ENQ A;  2VW2 A;  4AWD A;  3I8T A;  4XF0 A;  1HQW A;  5BNP C;  1WCK A;  3C7O A;  2ARB A;  5CG9 A;  1XU2 A;  2R07 2;  4IGQ A;  4CRQ A;  2Y64 A;  5F2S A;  1S2K A;  2QDN A;  2WUH A;  3NVC A;  2DCT A;  2MEV 3;  5IVB A;  3SCG A;  3VZN A;  2PHL A;  4QGM A;  2ZX1 A;  3FBY A;  1AXZ A;  2VZP A;  3T0B A;  4BME A;  2YV8 A;  3AKT A;  1EP0 A;  4AVA A;  2WIN B;  4NHM A;  5J98 B;  2DFC A;  3NV3 A;  4CU6 A;  1V6M A;  3NNL A;  1H9P A;  2DUR A;  1AL2 2;  2PLV 3;  4IEX A;  4Y5T A;  3S7E A;  3VBU A;  5G05 L;  3W20 A;  1CVN A;  4URT A;  4ISR A;  2A6X A;  4KNC A;  4P5Y A;  1W0N A;  1VBB 1;  2XML A;  3H7J A;  3KB5 A;  4TLF A;  2EXI A;  1FPN 1;  1NCQ B;  1T2X A;  4HK9 A;  4K3U A;  3WUC A;  2LRP A;  4FAH A;  1XYN A;  1W6Q A;  2E53 A;  1TZO A;  3WDV A;  3VDA A;  3LSE A;  3SIS A;  4DEQ A;  3KV9 A;  3OBZ A;  5LRR A;  1LEN A;  1MQT A;  2RDS A;  4MHR A;  3M3I A;  4LBM A;  4N43 A;  1DIW A;  1M4W A;  2HH9 A;  4IV3 C;  1YFW A;  3H1M A;  1UD1 A;  2D5H A;  5JXJ A;  3DCQ A;  1JHJ A;  1YHF A;  3HQX A;  3WNK A;  1O59 A;  2V4V A;  2J22 A;  3MIF A;  4EN7 B;  3BTY A;  3GNE A;  1NCQ A;  5FY5 A;  5JI9 A;  4TN7 A;  5FP4 A;  2R30 A;  4IV3 A;  3VHP A;  1LEC A;  1VB4 A;  2ADE A;  5FMD A;  2VZ3 A;  1WLD A;  4BZ4 A;  5LK7 B;  1OLR A;  4EWD A;  1KDM A;  4L11 A;  1I6X A;  2XL7 A;  4LO6 B;  4B4P A;  2VGD A;  2WNU B;  1F31 A;  4PJY A;  2WFP A;  1A8M A;  1ULP A;  2Y6G A;  1W2A X;  2VD7 A;  3POJ A;  1QJX 1;  1S4C A;  2A1X A;  3VBU B;  5AC9 1;  1HXS 2;  3N4M A;  4OFG A;  1IGO A;  2GC2 A;  3O1O A;  4XCB A;  2Z4F A;  3WCR A;  1AR8 3;  3LZZ A;  5KHG A;  2JIJ A;  1SLT A;  3POG A;  1CPM A;  1RUE 1;  2JG8 A;  2BW8 A;  2XDV A;  1H1A A;  1H6X A;  1PIV 3;  2Z79 A;  4BU2 A;  4ONU A;  5A1L A;  1FMD 3;  1ZYB A;  1UOB A;  2XQR A;  3LEK A;  1W6P B;  3WF1 A;  1NOV A;  1WW5 A;  3SIT A;  4JKK A;  4P9L A;  5GM0 A;  1JYI A;  3VN4 A;  4M3C A;  3PVE A;  2VVF A;  5FJK A;  4KU7 A;  1G9A A;  3A22 A;  2PAK A;  1JXN A;  4DZG A;  1QOS A;  3ILN A;  5T5P A;  4DQA A;  4IV3 B;  4D0Q A;  3VDC A;  4C8D A;  4OQ8 A;  4HKL A;  3URF A;  2DCJ A;  3AZY A;  5DUW A;  1SEF A;  2D40 A;  2X53 S;  3M3E A;  2XXZ A;  3OYW B;  2D6O X;  2NMN A;  3TN9 3;  4DIQ A;  3KM5 A;  3UNP A;  5FPZ A;  5A3U A;  4Y22 B;  2AYH A;  1AR9 3;  2YBP A;  5CFC B;  5DUV A;  2P3K A;  4CUG A;  1W8Z A;  1PO2 3;  2WN3 A;  4CDQ A;  3I97 A;  3IDC B;  4QB2 A;  4BWO A;  1YFX A;  4YGC A;  1GWK A;  1W9F A;  1C1L A;  1GNY A;  5KWR A;  1HX6 A;  4WVW A;  2D6N A;  2GND A;  1KQR A;  4O9G A;  1VB2 A;  5GLV A;  3VBF C;  5BYN A;  2P4E A;  2WNE A;  2YXS A;  1AR6 1;  1WCQ A;  3LWC A;  1PGL 2;  1Z7S 1;  3PUH A;  1KFX L;  3CU7 A;  4GWN A;  3MFC A;  2YC4 A;  4GUL A;  3S30 A;  2R0H A;  2YU2 A;  2JG9 A;  2JIG A;  3VBO B;  2ZA9 A;  4MO3 M;  1WBL A;  1HDK A;  1RUF 3;  2P34 A;  1UY0 A;  1AX0 A;  2VOT A;  1F5F A;  2WSU A;  3B00 A;  3TEZ A;  2CHH A;  2HWB 3;  1NY7 2;  1NXD 1;  4HT1 T;  4JRA A;  3AFG A;  5HXV A;  4DXZ A;  3KGL A;  4AXO A;  4QXK A;  1ULO A;  2OZJ A;  1R09 2;  4QX7 A;  1W6Q B;  1Z78 A;  2YUE A;  3HQR A;  1NY7 1;  3KCY A;  4Y3O A;  4XTM A;  4D6Q A;  4XUR A;  4KQ7 A;  2VOV A;  1PK6 B;  5T50 A;  4KGG A;  3C7E A;  3IPV B;  3N7K A;  5EJ1 B;  1HN1 A;  1UWW A;  1OKQ A;  1OA4 A;  1ND3 B;  2Q30 A;  2Y26 A;  4JZR A;  4UFM A;  4CXY A;  3OPT A;  2VNO A;  1XYO A;  3MI8 A;  4LE4 A;  3ZLI A;  2IVI B;  1R1Z A;  1IS6 A;  5LY2 A;  1N3Q A;  5F37 A;  2J1E A;  2XBO 3;  3GZT B;  2ZZJ A;  3LA2 A;  3W9A A;  2XLG A;  1YJK A;  4YFZ A;  4BIO A;  4FFH A;  1UL9 A;  1OQ1 A;  4YZ3 A;  1I5P A;  2UY8 A;  1DDL A;  2GN7 A;  2XON A;  2W3J A;  3LDK A;  3PUR A;  3ES1 A;  1DF0 A;  1UPI A;  2RM2 1;  3RMX A;  2DUP A;  4IE6 A;  1N3P A;  1W03 A;  3LDB A;  4HVQ A;  5FYI A;  2BUK A;  4URA A;  2JDN A;  3U11 A;  4NII A;  3K2O A;  1DGL A;  1CZV A;  3T30 A;  1YXW A;  4CVU A;  2JDH A;  1UPS A;  4QU1 A;  1SFN A;  5A3T A;  2JKB A;  1VAM A;  4CA9 A;  3D8C A;  3J8F 3;  3ZXJ A;  4HOO A;  3NNM A;  4JKM A;  2RR1 1;  3BAL A;  4GKX A;  4YM3 A;  1O6U A;  3ACI A;  4OUL A;  2R6Q A;  4QDS A;  4L8Q A;  1TNR A;  4XJ9 A;  5C8C B;  1Q43 A;  3KSC A;  4IEY A;  1UXZ A;  3AJZ A;  4YWA A;  1XE8 A;  3WHT A;  4A6O A;  2WO7 A;  1YQ5 A;  4H2A A;  4COZ A;  3SC7 X;  3QH6 A;  4GWM A;  4CDX B;  1PVC 3;  3GJA A;  4YG6 A;  1AR6 2;  1PGL 1;  1DYP A;  1ND3 C;  5C70 A;  2R7E B;  3BTA A;  2H6C A;  4FOQ A;  5L73 A;  1WLT A;  3ZDS A;  4AVC A;  4OHW A;  3WVJ A;  2HBU A;  1S0G A;  4M4R A;  3IZO A;  3FHI B;  4JVA A;  3USS A;  5FO8 B;  2JD9 A;  1WA6 X;  5FZL A;  1RB8 G;  5A6X A;  1LEM A;  3FLR A;  4PQ9 A;  5D8A B;  1Z0H A;  1RUI 2;  4P5H A;  3UJO A;  2VL4 A;  1HV0 A;  1OFN A;  4GB3 3;  2IUW A;  3T4V A;  1O4Z A;  5C9A B;  1AR7 3;  1RJ8 A;  2W1Q A;  1BBT 1;  2ZPX A;  4HVR A;  4JV4 A;  3VBH A;  3ZDV A;  5JXH A;  4Z92 B;  1UQX A;  4QQO A;  4JHT A;  1OKO A;  4MGI E;  4LBN A;  4YZ1 A;  3ORJ A;  1DQ4 A;  1RL3 A;  4TZD A;  5A32 B;  2YU1 A;  4EZH A;  4B3N A;  1GAN A;  3FHQ A;  4GJY A;  1CAU B;  5EFU A;  2B9V A;  5GLU A;  4YVW C;  1R08 2;  3M70 A;  3LA7 A;  1OH3 A;  4FFI A;  4UF0 A;  1KJR A;  1V6O A;  1KJL A;  2IXJ A;  3VD5 A;  2FHR A;  5LBB A;  2RMU 3;  3K48 A;  1NZI A;  2G9F A;  4M0H A;  1WMX A;  4HSL A;  4OMD A;  4XUO A;  3FLP A;  1MR5 A;  5IVF A;  4E4H A;  2I74 A;  1QJE A;  1ZBA 1;  1OOP B;  1J83 A;  1A8D A;  5F2W A;  2NP0 A;  4NPM A;  4B8E A;  1B35 B;  3A0N A;  4MGK E;  5BPX A;  2FDF A;  3WLU A;  1L3J A;  2QZ2 A;  3KCC A;  3AL5 A;  4EJR A;  1GBG A;  3OTF A;  5FZO A;  1XNC A;  2ETE A;  1V00 A;  4IEW A;  1ASJ 3;  3OBA A;  4RQP B;  2Q8D A;  4D7T A;  1PO1 2;  2V73 A;  4AI3 A;  3OSD A;  2QQV A;  3MDP A;  1JW6 A;  4XFF A;  3WW2 A;  4LKF A;  1A78 A;  3LPF A;  3H1W A;  4CCK A;  5FK8 A;  5FOJ B;  1C8M 3;  2UWA A;  2XWJ B;  2BJS A;  5EYX A;  4A3X A;  2EXH A;  1CAV A;  2ZHM A;  1JYX A;  4AVS A;  3S5A A;  4Q4W 3;  1O8P A;  2ZX3 A;  3ROU A;  5FPU A;  5DAB A;  4MGS A;  3USU B;  2CV6 A;  3D4K A;  2Z42 A;  1QJZ A;  1SHW B;  3HNB M;  2PHF A;  4JGZ C;  4E4Z A;  2RR1 2;  4MET A;  2FDK A;  4FPY A;  2WT1 A;  4KBB A;  2ZGP A;  3U37 A;  4EN0 A;  5EPA A;  5DDJ 3;  4QHB A;  4NAO A;  1VBE 2;  5I93 A;  2DBN A;  4D7S A;  4CXX A;  2ID4 A;  3VBH C;  2RJ2 A;  1EV1 1;  3H8R A;  3JUU A;  4H3W A;  4N43 B;  2GC1 A;  4BXF A;  1ENR A;  2E51 A;  4YVW B;  3WSO A;  1JZ6 A;  2WYS A;  1FPN 2;  4S2F A;  1OQD A;  3W59 A;  1GUI A;  2AC1 A;  2VO5 A;  1ZRF A;  1OLQ A;  5I0S A;  1OBN A;  1X36 A;  2ZAH A;  5I0T A;  3ZFE B;  5BV6 A;  4FTS A;  1QH6 A;  3NV4 A;  3NV2 A;  5A7W B;  3AXE A;  5A7S A;  3SQO A;  1CIW A;  5FY9 A;  1V0A A;  3GYD A;  1PMI A;  1W8N A;  1W8O A;  2JIC A;  4OZO A;  3VB9 A;  3AXD A;  4R9A A;  2X5I A;  1SCR A;  1LUL A;  5FY0 A;  4JQT A;  2XJS A;  3RGB A;  1W2O A;  2ZEX A;  3DGT A;  3R05 A;  3VZJ A;  2WO1 A;  3PVB B;  2BNM A;  3PTR B;  1E5S A;  2JXA A;  4LO4 B;  1ZZ8 A;  1AR7 1;  1CAV B;  4RHV 2;  1K12 A;  1IS3 A;  2X09 A;  3LB9 A;  3RFR A;  1VBA 1;  1ND2 C;  4QX1 A;  1J3P A;  2YG0 A;  3S7I A;  2K2S A;  3I4I A;  5T52 A;  1W2T A;  1RMU 1;  4MZU A;  4Q4V 2;  5C3Q A;  1GZW B;  2VCB A;  4UWD A;  4AI1 A;  2AZ5 A;  2WO3 A;  5FP3 A;  4C91 A;  5FZ6 A;  2WFF 1;  3VKF C;  3DYO A;  2XJQ A;  4CSW A;  1A34 A;  1R08 1;  3POS A;  4QX5 A;  4AGG A;  3I54 A;  5FZG A;  3TNP B;  2KA3 A;  3VBF B;  4D69 A;  4OUM A;  5HI0 A;  3MFA A;  2FQP A;  3TNQ A;  1W3V A;  4QQ2 A;  3TWI A;  2PTM A;  3RNS A;  4PIZ A;  5ABJ B;  1QJY 3;  3OB8 A;  2HWB 1;  3O0X A;  2QQM A;  5L7O B;  5FMO S;  4GIQ A;  4XPV A;  2CU5 A;  4UAP A;  4CP1 A;  1MEC 1;  2XVL A;  4DEV A;  3EYP A;  3N9N A;  4FOV A;  4X6R B;  1OF4 A;  1KEX A;  1LJ7 A;  2XGX A;  3PIG A;  5IVV A;  1VIW B;  1CAU A;  3BOP A;  1MEC 2;  1Q56 A;  1WCU A;  3O7O A;  3TEX A;  4Q0U A;  2IC1 A;  2Z5W A;  4PIX A;  3V0B B;  4NJ4 A;  1LOC A;  2Z2S B;  3O1R A;  2Y38 A;  1URX A;  4AQ2 A;  4FVV A;  3DUI A;  1HN0 A;  2B9U A;  2GP5 A;  4QDQ A;  2RS5 3;  1ZBA 2;  2SLI A;  1HIX A;  2VMC A;  3BTX A;  2A6Y A;  2WZR 3;  1CX1 A;  1Y7B A;  4C1X A;  5FK7 A;  5LRS A;  1M06 G;  3ZFF A;  4GMP 0;  1J3R A;  2IXC A;  2HEY F;  1GWM A;  3Q8A A;  3ZN4 A;  5C7G A;  5F3E A;  4XXP A;  1LHN A;  2UYA A;  3CKH A;  2JG9 B;  3FWE A;  3VBO A;  2BGO A;  3QOP A;  4OI4 A;  3CBN A;  1PGW 2;  3ECQ A;  4R4X A;  4IEQ A;  2XHK A;  3VDD C;  2A3X A;  4AFB A;  4PHZ A;  4NIA A;  1KS5 A;  2VY0 A;  2H0V A;  2WNV C;  2D6M A;  2WAB A;  2PA7 A;  2XVG A;  1BBT 3;  4IEP A;  2BRT A;  1L7Q A;  4FP2 A;  1H8T C;  4LIT A;  4NHY A;  4UXA A;  2YBK A;  4BDV B;  1UMZ A;  4BQ4 A;  5LAT A;  2EVX A;  3I3D A;  3INA A;  2WZ8 A;  4RS5 B;  4CP9 B;  1DHK B;  3NJY A;  4YW4 A;  3MV0 1;  5C5T A;  2B7Y A;  4XC9 A;  2VCM A;  4J1X A;  2DU0 A;  2ZEY A;  4HG6 B;  2DF7 A;  4CPB A;  4FP3 A;  4FPH A;  1STM A;  1UZ0 A;  4CDW C;  1F35 A;  1ULD A;  2XQX A;  1HRV 1;  4MSV A;  3GZA A;  3DN7 A;  1ZZB A;  1W9W A;  2NLR A;  3TRS B;  4D6S A;  2J1V A;  4CU8 A;  1K42 A;  5E6H A;  4AI0 A;  3SLI A;  2J1A A;  1HRV 2;  5IJR A;  1W3X A;  5AFB A;  3P1I A;  2AR6 A;  2WWJ A;  3H3Z A;  4IV1 A;  3WF0 A;  4BH9 A;  2XBO 1;  4Z8B A;  3R4D B;  2RDQ A;  3RYR A;  1BBT 2;  1F4A A;  3WNM A;  1POV 3;  1KXG A;  1XSQ A;  2IFR A;  2P6H A;  4Q0V A;  2DVD A;  2X5I C;  5A7Q A;  1GLH A;  2OX0 A;  2FDI A;  4FPE A;  4OQ9 A;  2PHX A;  2P37 A;  2XVK A;  1VMF A;  5A70 A;  2ILM A;  4Q4Y 3;  1LR5 A;  3N7L A;  4CDQ B;  2YHJ A;  1UZY A;  4K9S A;  1AR7 2;  1J59 A;  3BUC A;  2BWC A;  5FZM A;  3I2O A;  3KVB A;  1UOF A;  1C1F A;  2MEV 1;  4H55 A;  4IES A;  1OC1 A;  2JWP A;  5IVY A;  4A2U A;  4PI2 A;  1REE A;  1U0A A;  2BDR A;  1VPH A;  3WP6 A;  3UGF A;  5FZ4 A;  2XLA A;  4HON A;  3MEP A;  4MGZ E;  3O1V A;  1RUJ 3;  3AKP A;  3AMN A;  2C0Z A;  4FSJ A;  4COY A;  3O1S A;  1H8T B;  2VR4 A;  2OW4 A;  4LOT A;  1FNY A;  1H2N A;  3IDB B;  5K0U B;  2IXI A;  3JBG 2;  1NA1 A;  2HLE A;  3AYD A;  3PDQ A;  1AUY A;  5ANN A;  3T3Y A;  3KVA A;  4WM7 B;  3WG3 A;  1US2 A;  1PZ7 A;  1W6M B;  4J25 A;  4AHY A;  5F3G A;  5FYV A;  4ZY9 A;  1FPN 3;  2IXL A;  4QPW A;  3J7M A;  2JE7 A;  3N3H A;  4P9I A;  4PF1 A;  4QPG C;  4LJH A;  4GKY A;  3AC0 A;  3U4S A;  5ABJ A;  3PU8 A;  1FOD 1;  2WZR 2;  5CFD C;  3WOG A;  5C4W C;  5IVC A;  3AKS A;  4WM8 A;  1UY3 A;  1ZBA 3;  3C3V A;  1NX9 A;  5GZF A;  1J58 A;  4XAC A;  2VZT A;  2GZW A;  4CDX A;  1N1S A;  2P5B A;  5FWE A;  3O0V A;  3NV1 A;  1S2B A;  5C71 A;  3VGI A;  1SCS A;  2JE9 A;  1HB1 A;  3BN6 A;  2EIG A;  3ZIX A;  4Q5O A;  3ZR5 A;  1MZF A;  3AZW A;  3KV6 A;  1E5R A;  4BQ1 A;  4XJZ A;  3W5M A;  1H2L A;  1TMF 1;  3AM2 A;  3HNM A;  1GMM A;  4R8H A;  1N47 A;  1ULE A;  4CUA A;  1ULC A;  2HWC 1;  2XG3 A;  4N53 C;  2GMM A;  4BQX A;  3D3A A;  1FXZ A;  4RQP C;  2QQP A;  3NNJ A;  2AGS A;  2CWS A;  3P3N A;  4ZXK A;  2YYO A;  1UY4 A;  3ZFG A;  2WAA A;  2R06 3;  4KWL A;  4UYB A;  1LRH A;  2E26 A;  4IND A;  3F2Z A;  4DMI A;  5JDB A;  4CEY B;  2Q8E A;  5IAT A;  4P08 A;  3V0A B;  4N7I A;  4KWU A;  5K0U C;  1E5H A;  1WBF A;  1F9K A;  2ZMK A;  2VBD A;  3FC0 A;  1PVC 2;  1UOJ A;  1UOG A;  4XAA A;  2VCC A;  2AH2 A;  1H1M A;  1GNZ A;  4NHK A;  3PUI A;  4QB1 A;  1J1L A;  1ULF A;  1NA1 C;  3MIC A;  1GFF 2;  2C9K A;  3FL7 A;  3ON7 A;  5LA1 A;  5FRA A;  1X50 A;  4CYD A;  2J1T A;  3G6J B;  4HMZ A;  2V72 A;  4A7Y A;  3FUQ A;  3IAP A;  4LPL A;  1JZ3 A;  2VMG A;  2Y6J A;  3K4A A;  3X29 B;  2JG8 B;  5A3M A;  1SLI A;  1LCL A;  1BXH A;  2YPD A;  5JAX A;  2RS3 3;  1JU4 A;  4PLN A;  4Y1X A;  2VZO A;  5IVE A;  1R1A 3;  2WFF 2;  5EP9 A;  5E88 A;  1MS5 A;  1TME 1;  3K75 B;  5T55 A;  3U78 A;  1SQ4 A;  1W99 A;  1H2K A;  3AX4 A;  3TOJ A;  4OVE A;  1O91 A;  1GSL A;  4NWW A;  1V9U 3;  3GZU C;  5FZC A;  1QDO A;  2RHP A;  5A7N A;  4M3C F;  3UES A;  2YC0 A;  5D8A A;  1AYM 1;  2CSG A;  4RR3 B;  5FZF A;  1GQG A;  2ARC A;  2VJX A;  3ZXK A;  4I2O A;  5DAP A;  1JYT A;  1YUD A;  5FP8 A;  5CKM A;  4QPI A;  2ZAC A;  4Q4X 2;  3RZG A;  1YQ2 A;  4BIS A;  2JD4 A;  2DVG A;  2BQP A;  5D8A C;  1OQE A;  3HIF A;  4Y22 A;  2PHD A;  2FDH A;  5FZO B;  2BYV E;  5C3R A;  2VUJ A;  1X7N A;  2VTX J;  1JUI A;  5FMB A;  2PEL A;  5JI7 A;  5C9A C;  3KT7 A;  3HN1 A;  4UI9 L;  4XET A;  1R08 3;  2LAL A;  3SNM A;  2QDR A;  3MW3 A;  3ZSJ A;  4FFF A;  2VEC A;  2RJL A;  1OLM A;  1WMF A;  4GH4 B;  4KL1 A;  4PBO A;  4R9B A;  1QIQ A;  3GHM A;  2YBS A;  4XF3 A;  5E16 A;  5C8C C;  3BU7 A;  3BVC A;  5HV0 A;  1VP6 A;  4RA0 A;  3J7H A;  3MF6 A;  1G86 A;  3UGH A;  5HBA A;  1OOP A;  1TEI A;  2FDJ A;  2EIE A;  3P6B A;  3ZYG A;  3ZSM A;  4P9X A;  2W0X A;  4CDU C;  4L92 A;  1D0G A;  1F4H A;  1DLC A;  1OA2 A;  2GAL A;  3AJY A;  4UW4 A;  3VV1 A;  3RG0 A;  1RTV A;  5DDJ 2;  3A0K A;  5KHK A;  2O8O A;  3JD7 3;  1RHI 2;  5CU1 A;  3HVD A;  1AR8 1;  2UU8 A;  4MGT A;  5JWP A;  1RIR A;  4MHU A;  4CCE A;  3RZZ A;  1VBD 1;  1MAC A;  3G7D A;  1FI2 A;  1CES A;  2VQT A;  3ETP A;  3GDB A;  4YVW A;  3ZMN A;  3NRU A;  2VQA A;  4PLM A;  2ZGR A;  4HKO A;  2A73 B;  1E5I A;  2C6S A;  5F5A A;  3WP4 A;  1MVE A;  5LAS A;  5IK7 A;  1L7L A;  2W9X A;  3MIE A;  5JLV A;  3E6B A;  1ODN A;  5BUV A;  3AYA A;  4PBP A;  3WXP A;  1APN A;  1ND3 A;  2C26 A;  3HMY A;  4KG8 A;  4OUS A;  5DG2 A;  1SLB A;  3EHK A;  4PDW C;  5KXD A;  1PIV 1;  5F1R A;  3KT1 A;  1RUI 1;  1U5X A;  3MYX A;  1QXP A;  2D3R A;  2HWB 2;  1C4R A;  1ACC A;  3T0A A;  3D0S A;  4PIY A;  2VC9 A;  4QB6 A;  2BV4 A;  1COV 1;  4PLO A;  3WQB A;  4RN5 A;  2C4X A;  2WJS A;  4MXV A;  3SHR A;  1GQH A;  4S2G A;  2GH2 A;  4Y20 B;  1YQC A;  1MS9 A;  2I2S A;  4JGY C;  1CGP A;  4N43 C;  4XF9 A;  4Y4R A;  4RL7 A;  4XZP A;  4B4R A;  2F4P A;  1QF3 A;  2HKX A;  1ALY A;  1GOG A;  5HPO A;  2B42 B;  2VTF A;  4Y26 A;  3VBF A;  3ZFF B;  1K5M C;  1W8H A;  3VL9 A;  4BXS V;  2GC0 A;  2DWR A;  2JDU A;  3O1M A;  4AQ6 A;  5J96 B;  3VHR A;  2W52 A;  5DQ0 A;  4K40 A;  3WG2 A;  2D44 A;  3K4Z A;  4FCA A;  3R0R A;  4Q4W 2;  2YGM A;  5B2G B;  2ZEZ A;  3TEW A;  5I0R A;  4B29 A;  5IHR A;  1YRZ A;  4LXL A;  1YYN A;  3JBG 3;  1JBC A;  1RUF 2;  4I0A A;  1IPS A;  5EZW A;  4QGN A;  5L9V A;  2BFU S;  4QD2 A;  3ZYR A;  4RS5 A;  4IL7 A;  4MV2 A;  4LUK A;  4DXT A;  1XSR A;  4XIK A;  3RWN A;  4ZZ5 A;  5BNO A;  3THP A;  4AQT A;  1LOA A;  2XL9 A;  1AXY A;  2OXB A;  3F95 A;  3SMH A;  2HWC 3;  3EBR A;  2OKX A;  3DXT A;  2A6Z A;  4AHX A;  1YIP A;  3AP9 A;  1H8V A;  4IET A;  1ZRC A;  3K3O A;  4UOJ A;  1TVG A;  1I3H A;  2W1W A;  2WLP A;  5KBF A;  3VBS C;  1OVP A;  1YWK A;  3PL0 A;  1Y9G A;  3UGG A;  5LB6 A;  1N1T A;  5DAQ A;  1JZ5 A;  1FAT A;  1SAC A;  3GXU A;  3OCP A;  3UV9 A;  3HOB A;  2D7F A;  3PUS A;  4BHP A;  5F5I A;  1S0D A;  3JD7 2;  3KQ4 B;  2CYF A;  4YLZ A;  2PFW A;  5FMO L;  1CJD A;  1O3S A;  3NNG A;  5DPN A;  3WX5 A;  4Y5S A;  1QQP 2;  3ZXA C;  1RVF 1;  5CFD A;  3BTZ A;  4NIH A;  2UUR A;  4MOA A;  4JDN A;  2LM3 A;  2ZGK A;  2DDU A;  2RDN A;  1D0H A;  4CU7 A;  4Q26 A;  2CDO A;  1QJU 2;  1SDD B;  2VZV A;  4LBQ B;  3OEB A;  1MS8 A;  2JDP A; 
#chains in the Genus database with same CATH homology
 5JUV A;  3VD5 A;  5JXG A;  4XUN A;  1CZT A;  5B4X A;  3IB3 A;  4OMD A;  4P00 B;  1US3 A;  4XUO A;  3C7F A;  3I2H A;  4KMQ A;  4CUC A;  1J83 A;  1PX3 A;  2WZE A;  3K77 A;  5CYY A;  3MUZ 1;  3WF2 A;  5A1A A;  1UXX X;  1W9S A;  3SKJ E;  1CZS A;  1R64 A;  2J7M A;  3OBA A;  2Y6L A;  2YB7 A;  4RYD A;  2BZD A;  4CUB A;  3I2F A;  4OYU A;  3LPF A;  2W92 A;  3A23 A;  3MBW A;  1JYX A;  5LA0 A;  3I2I A;  3HEI A;  1O8P A;  1UYZ A;  2WN2 A;  4MGS A;  1SHW B;  3HNB M;  1P8J A;  4BJ0 A;  3U37 A;  5FUI A;  4ZXE A;  3I2K A;  3MUY 1;  3DYP A;  2JDA A;  2ID4 A;  1UYX A;  2RJ2 A;  1KGY A;  3HPN A;  2WO2 A;  5EJZ B;  1JZ6 A;  3WSO A;  1CIY A;  2VMF A;  2WYS A;  1GUI A;  1SG3 A;  2VO5 A;  4DUV A;  2W91 A;  3E1F 1;  5IYY A;  3LE0 A;  2B4K A;  2W94 A;  1W8O A;  1W8N A;  4OZO A;  5J1X A;  2PQS A;  3C7H A;  3NQH A;  2ZEX A;  2WO1 A;  2Y6K A;  1K12 A;  2X09 A;  1GOH A;  1JZ8 A;  4QX1 A;  2YG0 A;  4OUE A;  1XNA A;  1JI6 A;  2W87 A;  1JU3 A;  1H6Y A;  1XNT A;  4XZU G;  4ARY A;  3A21 A;  1NUK A;  4IUG A;  1JYN A;  2VCB A;  2WO3 A;  2VZS A;  3VD3 A;  2WAO A;  3DYO A;  5I0D A;  1XPW A;  4GZ9 A;  1PMH X;  3C7G A;  1PX4 A;  4E8D A;  4ZZ8 A;  4ET7 A;  1GU3 A;  2Y6H A;  3ABZ A;  3THC A;  3OB8 A;  1JYV A;  2QQM A;  5CZK A;  4QX0 A;  3DYM A;  3CZJ A;  1UMI A;  4UAP A;  3T08 A;  4DEV A;  3CDZ B;  3EYP A;  5IFP A;  2ORZ A;  1OF4 A;  1KEX A;  4FI9 A;  2RVA A;  1EUU A;  2Y8K A;  3VD4 A;  2E31 A;  4ARX A;  1LNS A;  2J1R A;  2QQJ A;  4QDQ A;  1UY1 A;  2EID A;  4L0P A;  3MO4 A;  2VMC A;  2BBA A;  1CX1 A;  2QQK A;  1JZ7 A;  3GM8 A;  1DYO A;  4W4Z A;  3ACH A;  4DUX A;  5C7G A;  2QQL A;  1NKG A;  2HYX A;  1K3I A;  2VZQ A;  3CKH A;  2BGO A;  1NAE A;  3ECQ A;  4PT6 A;  3WF4 A;  3OG2 A;  2WAB A;  1TG7 A;  1L7Q A;  2ORX A;  3A7Q A;  4XUP A;  5LA2 A;  4BDV B;  3I3D A;  2WZ8 A;  3MV0 1;  4LKS A;  3CZU A;  2ZEY A;  2WDB A;  4HG6 B;  3SKV A;  4PQQ A;  2ZEW A;  1UZ0 A;  1XC6 A;  1UX7 A;  3VD9 A;  2XQX A;  2V5D A;  2EIB A;  2LW8 A;  1K42 A;  1W9W A;  4CU8 A;  2J1V A;  4A45 A;  2J1A A;  3T2O A;  5IJR A;  2X10 A;  3P1I A;  4XUQ A;  3WF0 A;  1UYY A;  3CMG A;  3GGL A;  2YC2 A;  3WNM A;  1F4A A;  1JZ4 A;  4TXW A;  3WEZ A;  4DUW A;  3I3E A;  3LPG A;  4BK4 A;  4TTG A;  4XVH A;  4LHS A;  4BK5 A;  3FN9 A;  2L9L A;  3NJX A;  3WNN A;  4A3Z A;  3FHA A;  2VZU A;  2W1S A;  4JKL A;  4XUT A;  4A4A A;  3I2G A;  3T2Q A;  2VME A;  2VCA A;  2VR4 A;  4MGQ A;  3SEE A;  4JHZ A;  4AG4 A;  2W95 A;  3JXS A;  2HLE A;  5EIY B;  3OGS A;  4YPJ A;  2DCK A;  1US2 A;  3ACF A;  3C7O A;  4ZY9 A;  4QPW A;  3WNL A;  4PF1 A;  2Y64 A;  2WUH A;  3AC0 A;  2VM9 A;  3OGR A;  1UY3 A;  5B4N A;  1NX9 A;  2JE8 A;  2VZP A;  3T0B A;  2VZT A;  3ZM8 A;  2QQN A;  2VZR A;  2VQU A;  4CU6 A;  5C71 A;  4MAD A;  2QBX A;  3BN6 A;  3I2J A;  5G05 L;  3CIH A;  3W5M A;  4P5Y A;  1W0N A;  1UY2 A;  4QX3 A;  3HNM A;  1GMM A;  1OF3 A;  1PMJ X;  1T2X A;  4CUA A;  1O8S A;  3VDA A;  4JX0 A;  3WNP A;  4DEQ A;  3D3A A;  5F7U A;  4P02 B;  1K45 A;  1EUT A;  1UY4 A;  5JXJ A;  1JHJ A;  2WAA A;  3WNK A;  1O59 A;  3HN3 A;  2V4V A;  2E26 A;  2J22 A;  3F2Z A;  2ZXQ A;  3MV1 1;  1GQP A;  2XOM A;  4P08 A;  4KWU A;  4DXR A;  2E33 A;  2VZ3 A;  2VCC A;  3PUI A;  4QB1 A;  5HXM A;  4W8J A;  1ULP A;  5DN2 A;  2Y6G A;  2C9K A;  2J1U A;  3FL7 A;  5JXI A;  5LA1 A;  2J1T A;  3VDB A;  2RV9 A;  2XHN A;  2Z4F A;  2V72 A;  3IAP A;  4LPL A;  1JZ3 A;  4CU9 A;  4QDR A;  2Y6J A;  3K4A A;  1H6X A;  2VZ1 A;  1JU4 A;  2VZO A;  4E8C A;  3LEK A;  3WF1 A;  1OT5 A;  3III A;  3K75 B;  4JKK A;  2W1U A;  1W99 A;  2WQ8 A;  4GWJ A;  3A22 A;  4A41 A;  3IAQ A;  5IFT A;  4Z2A A;  3UES A;  4D0Q A;  3VDC A;  2VJX A;  1WKY A;  3ACG A;  4DXS A;  2DCJ A;  4LQR A;  3W5N A;  3CQO A;  1YQ2 A;  3UET A;  3UNP A;  3WF3 A;  4M4P A;  2YFZ A;  3T0D A;  2BER A;  3LEG A;  2WN3 A;  3I97 A;  4QB2 A;  4UI9 L;  3LQC A;  2YFU A;  1GNY A;  5G04 L;  1WCQ A;  3PUH A;  2YC4 A;  2W47 A;  3J7H A;  2EIE A;  3P6B A;  4MO3 M;  2EIC A;  1F4H A;  1DLC A;  1UY0 A;  2VOT A;  2X05 A;  5LCW L;  3K4D A;  2VQT A;  3ETP A;  3GDB A;  4QAW A;  3NRU A;  1MPX A;  1ULO A;  3EB7 A;  4OMC A;  1J84 A;  2BGP A;  4XUR A;  2W9X A;  3C8X A;  3C7E A;  3OGV A;  5EJ1 B;  1HN1 A;  1UWW A;  2VMD A;  1GOF A;  2C26 A;  1OH4 A;  4A42 A;  3T0A A;  2J1E A;  2WBK A;  2QQO A;  2VC9 A;  4QB6 A;  3WQB A;  4RN5 A;  2C4X A;  5DMY A;  1I5P A;  2LS6 A;  2QQI A;  2XON A;  1JZ2 A;  2W3J A;  2W5F A;  4GWI A;  4KI5 M;  1BHG A;  3HJR A;  2J1S A;  4W50 A;  1GOG A;  5HPO A;  2VTF A;  3T09 A;  4BXS V;  1CZV A;  4CVU A;  1DP0 A;  5DQ0 A;  3NJV A;  1UMH A;  3K4Z A;  3OEA A;  4QX2 A;  2ZEZ A;  4JKM A;  5IHR A;  1IQD C;  1D7P M;  3ACI A;  3VD7 A;  4QDS A;  3DEC A;  3LEI A;  3SEP A;  3WNO A;  4DXT A;  3THD A;  1UXZ A;  4A6O A;  4ZZ5 A;  3IDA A;  3I3B A;  2OKX A;  5C70 A;  4D8M A;  2R7E B;  5JR2 A;  5JMO A;  2JKX A;  4AAX A;  4UOJ A;  4M4R A;  1TVG A;  2W1W A;  1OD3 A;  1W9T A;  2JD9 A;  1JYW A;  1JZ5 A;  1RYY A;  3GXU A;  2W46 A;  3HOB A;  2VL4 A;  2KD7 A;  2E32 A;  2W1Q A;  3NNG A;  3K46 A;  5DPN A;  5JXH A;  3BGA A;  4A44 A;  1L7R A;  4MOA A;  2DDU A;  3FHQ A;  4CU7 A;  3T2P A;  3HNY M;  2B9V A;  2CDO A;  1SDD B;  2VZV A;  3OEB A;  2CDP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...