2J1EA

High resolution crystal structure of cbm32 from a n-acetyl-beta- hexosaminidase in complex with lacnac
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
142
Chain Sequence
PRTVKITASSEETSGENAPASFASDGDMNTFWHSKWSSPAHEGPHHLTLELDNVYEINKVKYAPRQDSKNGRITGYKVSVSLDGENFTEVKTGTLEDNAAIKFIEFDSVDAKYVRLDVTDSVSDQANGRGKFATAAEVNVHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HYALURONIDASE
publication title The Interaction of a Carbohydrate-Binding Module from a Clostridium Perfringens N-Acetyl-Beta-Hexosaminidase with its Carbohydrate Receptor
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
total genus 31
structure length 142
sequence length 142
ec nomenclature ec 3.2.1.169: Protein O-GlcNAcase.
pdb deposition date 2006-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2j1eA00
4GZ9A 2V72A 2J1TA 2VZTA 2VZ1A 2Y6KA 3GM8A 2W5FA 1D7PM 1H6YA 3CQOA 2QQMA 4BXSV 1DP0A 4TXWA 2BZDA 4FI9A 3OEAA 2W87A 3WF3A 2QQIA 1GQPA 2R7EB 2KD7A 2QQJA 4ARXA 3J7HA 4QX2A 2XOMA 4A45A 5IJRA 2W1SA 4TTGA 3C7FA 1UY2A 2CDPA 3A22A 3ACIA 4CU7A 1CZVA 1SHWB 2XQXA 1W0NA 3CDZB 3PUIA 3NJVA 1US2A 2Y6LA 3VD7A 3MBWA 4QDQA 2JE8A 2WZ8A 4GWIA 4P00B 4CUCA 4QDRA 1UY4A 2B9VA 1EUUA 2X10A 4XUNA 3HJRA 3MUZ1 4JKLA 2WN3A 4XVHA 4KWUA 4UOJA 3LPGA 3LPFA 3EYPA 5EIYB 3UETA 2HYXA 3E1F1 5CYYA 1JYWA 2J1SA 2VQUA 4QPWA 1CZTA 5C70A 2W1WA 1P8JA 2OKXA 1CX1A 1KGYA 1OD3A 5DPNA 4ARYA 3OGVA 4CU9A 5B4NA 2WO2A 3I2FA 3OBAA 3HNMA 1YQ2A 4W4ZA 1JI6A 1JZ6A 2VMFA 3WF0A 2YC4A 1NKGA 3CKHA 1GOFA 1R64A 5C71A 2J1AA 4IUGA 3A21A 4MOAA 1JHJA 1JZ8A 1PX4A 3IDAA 4JX0A 4E8DA 4LQRA 3VDBA 2BBAA 3LEKA 1TG7A 1WCQA 2B4KA 2V5DA 4MADA 1W99A 4A44A 1UMHA 4DXRA 2C26A 2BERA 3DYOA 4QX3A 1OF4A 2VM9A 5JMOA 3BGAA 4QAWA 3K4ZA 4DUWA 1W9SA 1NX9A 3ETPA 1JZ5A 4D8MA 2J7MA 2LW8A 5LA2A 3T0AA 4DUXA 3P6BA 3HNYM 3IIIA 1I5PA 2W1UA 1UYZA 4ZZ5A 4BK4A 5G04L 3FN9A 5EJ1B 4DXTA 1NUKA 2DCJA 2V4VA 2VMEA 1O8PA 3K77A 5IFPA 4CUBA 2E31A 4BDVB 3ECQA 5J1XA 2VMDA 2QQOA 5IFTA 4OYUA 2RVAA 2EIBA 1US3A 2LS6A 3WNOA 3VDCA 1UX7A 2QQKA 3A23A 4QDSA 5HXMA 4W50A 4MGSA 1BHGA 1PX3A 2J1VA 2WABA 3K4DA 3OEBA 4LPLA 3WNMA 3T0DA 3SEEA 2YFZA 3FL7A 5EJZB 2VCBA 2WAOA 2Y6JA 1F4HA 3A7QA 4M4RA 3NNGA 3NQHA 2VR4A 5C7GA 3C7GA 4XUOA 3HN3A 1TVGA 5FUIA 4P5YA 4P08A 3W5MA 4XURA 3WF4A 4HG6B 3JXSA 2VO5A 4MGQA 3T0BA 3SKVA 2JDAA 4YPJA 5IHRA 5JUVA 1SG3A 4A6OA 2YG0A 3K46A 1XNAA 2VZVA 1L7QA 4QX1A 1PMJX 3HNBM 2HLEA 1J83A 3GGLA 5JXJA 3C8XA 3WNLA 1JYVA 1PMHX 2W92A 4Z2AA 3T2OA 4A4AA 4ZZ8A 2VC9A 4BJ0A 3MV01 1GOHA 2ORXA 3T08A 3EB7A 3I2JA 3K4AA 3AC0A 5LCWL 1UY3A 4UAPA 3SKJE 2WN2A 3I2GA 3WF2A 2W1QA 3ACGA 4LKSA 3HOBA 4CVUA 2DCKA 2VCAA 2ID4A 1JZ4A 1UWWA 3WF1A 3C7HA 1JYNA 2J1UA 2X09A 4W8JA 1K12A 1MPXA 3I2KA 3I3BA 2Z4FA 2W46A 1JU3A 4AG4A 3CZJA 4OMDA 3OGSA 1JZ3A 3VD3A 2E32A 4CU8A 2C9KA 1UYXA 1HN1A 1GMMA 4QB1A 3ACFA 4E8CA 1K3IA 4DXSA 5LA0A 1UXZA 3CMGA 4M4PA 3WQBA 1UXXX 1DLCA 3IB3A 2WUHA 4CU6A 2VOTA 4XUTA 3VD9A 4A41A 4GWJA 1W9TA 3FHQA 1OH4A 3IAQA 4KMQA 4D0QA 5B4XA 4XUQA 5DMYA 4CUAA 3WSOA 3W5NA 2DDUA 3OGRA 4JHZA 3SEPA 2WO1A 3IAPA 4JKKA 2W3JA 3DYPA 2ZEXA 1T2XA 5DN2A 3C7OA 4ET7A 2VZUA 5JXHA 3GXUA 3P1IA 3U37A 3WNKA 4OZOA 2L9LA 1UY1A 2WAAA 1JZ2A 3K75B 2VZ3A 3DYMA 3C7EA 1GUIA 1L7RA 2J1RA 1JYXA 4XUPA 4PF1A 4DEVA 2VCCA 1NAEA 2CDOA 3I97A 3NJXA 2W94A 2EIDA 1O59A 3LE0A 1W8NA 5JR2A 2J22A 2E33A 3UESA 3T2PA 4PQQA 2W47A 2WQ8A 2VZPA 1DYOA 4OUEA 1W9WA 1OF3A 3NRUA 1ULOA 2EICA 2QBXA 1RYYA 4ZY9A 2XONA 5DQ0A 2VZSA 2WO3A 2Y64A 3VD4A 1W8OA 4BK5A 3ABZA 1J84A 3THDA 1IQDC 1LNSA 3I3EA 2ORZA 3WNNA 3HEIA 3VDAA 4P02B 1K42A 2QQNA 1F4AA 5LA1A 3LQCA 4QB6A 3ACHA 4RN5A 3DECA 1CIYA 2W9XA 2W95A 3VD5A 3I2HA 2BGPA 5A1AA 2YB7A 2XHNA 2ZEYA 1JU4A 2VQTA 2WBKA 3CZUA 3T2QA 3HPNA 2VTFA 1H6XA 2JD9A 4JKMA 4DUVA 5JXGA 3I3DA 1OT5A 1CZSA 1XPWA 3T09A 4UI9L 2Y6HA 1WKYA 2VMCA 5IYYA 3WEZA 2WDBA 2EIEA 2PQSA 2WYSA 4QB2A 4QX0A 2ZXQA 3CIHA 3UNPA 1UYYA 1UY0A 4A42A 3WNPA 2Y6GA 3OG2A 1UZ0A 2VZOA 4L0PA 4RYDA 3D3AA 4MO3M 1XNTA 1GNYA 1UMIA 2J1EA 1GU3A 1XC6A 2VJXA 2JKXA 3I2IA 4DEQA 5G05L 3MO4A 1JZ7A 2VZRA 5CZKA 2Y8KA 3PUHA 2VZQA 2BGOA 1SDDB 2E26A 2WZEA 5HPOA 1ULPA 4AAXA 3ZM8A 2X05A 2RJ2A 3THCA 1K45A 4XZUG 3GDBA 1GOGA 2ZEZA 2RV9A 5I0DA 3LEIA 2ZEWA 3BN6A 2YFUA 4PT6A 4A3ZA 3FHAA 4KI5M 4ZXEA 5F7UA 2VL4A 3LEGA 2W91A 3MV11 4OMCA 2QQLA 3OB8A 3MUY1 5JXIA 1O8SA 1KEXA 3F2ZA 4LHSA 2C4XA 2YC2A 1EUTA
chains in the Genus database with same CATH superfamily
3JZVA 1Y4WA 2VZTA 3LIGA 2WZR1 4N53B 3NL1A 2WT2A 5DUXA 4RS5B 3U1XA 3WUDA 1IHMA 4YM0A 5C5UA 5JDBA 5T52A 4UFMA 1YJKA 1QJFA 1IPSA 4NRPA 1DP0A 1JN2P 2WWUA 2GNDA 1SLBA 4CDQB 4FI9A 4RSUA 2W87A 3WF3A 5M0TA 1O3QA 2FDHA 1GQPA 1H4HA 4Q0VA 3W21A 2VNGA 3RG0A 2QQJA 3A0KA 2R32A 1ENRA 3H3LA 5FZ7A 4QX2A 2XUMA 1ND3C 5D1IA 1EY2A 2XOMA 3DEMA 2W1SA 2FZ2A 2WNUC 2ETEA 4BIOA 1I9RA 5KHIA 1RIRA 5FYTA 1RL3A 2GC3A 2O8QA 1N1TA 3ACIA 4X8PA 4CXXA 2ZX4A 2DWRA 2XQXA 5A7OA 2K9ZA 1H8TA 2GN7A 1C5HA 3PUIA 3LGRA 3ZN6A 2ZKNA 5FAXA 4D6SA 4COWA 1EP0A 2RR11 4JGZB 1H1IA 1PGSA 4XETA 1U5IA 4NPRA 4QKNA 4XBLA 3ELNA 1X50A 2VULA 4AI8A 5A3TA 4E2QA 3FFZA 3ZPYA 3AP5A 1J1TA 4EROA 1YO8A 2IZWA 2R1BA 4ATFA 2X10A 2YUEA 5FP7A 1AZDA 4FAHA 5LATA 3U4XA 1PIV3 4XXPA 3LPFA 1PK6A 3EYPA 2BU9A 5I8TA 1RUF1 4IV1B 3ILNA 3UETA 3WD5A 3E1F1 1YQ5A 4AFDA 2W08A 5H9PA 3VBRB 2V09A 5C4WC 4Y20B 1W8TA 2J1SA 2JECA 3ZO0B 1CIWA 4QPWA 3S7EA 2JDMA 3FLPA 3PUSA 1DBNA 4ZHNA 2CGOA 1S0EA 2HWE1 3LCPA 2VVFA 3VKLA 1P8JA 1CX4A 5CKQA 2OKXA 2VCMA 3SMHA 1KGYA 4CTEA 5FXXA 5DPNA 5FO7B 4NIGA 3NV4A 4CCLA 5CFDB 2BWAA 1W8HA 4AEDB 3I2FA 4FPGA 2KXLA 1J3PA 3ZIXA 4URAA 2B39A 3RSJA 2WT0A 3B02A 1UNBA 4EJRA 2RS51 3VBSC 5FMDA 2PELA 3FBMA 2GMMA 3WF0A 2YC4A 1R64A 3K2OA 1YFYA 4NRQA 2JG9A 2YBSA 5GLVA 1PVXA 1JHJA 4Q29A 1PX4A 3KQRA 5FPZA 5FZ8A 4R9AA 3VBUC 1E5RA 4CCNA 4META 2Q30A 2P3KA 4LQRA 1XYNA 2OX0A 5DAVA 4BWOA 3VDBA 4AXOA 1D2QA 2FCTA 3E5XA 4XF0A 3JD73 4G3YC 5EP9A 4AHZA 2PMWB 2VG9A 1VBE3 3VZLA 2WQZC 4LKEA 3LOBA 4WVWA 1POV3 2VW1A 4XTPA 2YPDA 4QX3A 1GWMA 4LNVA 1GP4A 5L36A 3I8TA 4ZS2A 4JRAA 4OQ9A 2QCSB 3JB4C 1HQWA 3BGAA 4QAWA 2B8MA 5FRAA 1XOYA 1XXNA 4FPJA 4DUWA 4FSJA 1Z7S1 4KWLA 4NE9A 1YNAA 5I0TA 1N3OA 4D8MA 3M3EA 5T5PA 3ZDSA 4EWEA 1RVF1 2J7MA 3ZXGA 2TNFA 3PJYA 5K0UA 3T0AA 2BV4A 2D7FA 4DUXA 3P6BA 4XACA 1DG6A 2QNKA 5DZGA 4QXHA 1H8TB 3PIGA 4ITCA 3WT3A 1WZXA 2RS11 2W1UA 1SMVA 3IZOA 3MLLA 4UW6A 2VOXA 2YMZA 5ANNA 4ZZ5A 5JPNB 5CKMA 1NUKA 2V4VA 1O8PA 4OLLA 1POQA 5LBCA 4XFAA 4BDVB 1WMXA 5FZ6A 2PLV2 3N9NA 1YFXA 1DYKA 4UT5A 4AW7A 2R063 3PVBB 4Y22A 3N9MA 1G9CA 2NN8A 1OHFA 1PMIA 2BTVC 2C1FA 4WVVA 1GZCA 4LLFA 3W9AA 1FOD1 1BVP1 3O1TA 4CP0A 3PLQA 1HJGA 3ILFA 1RJ7A 4QDSA 1QEXA 2WNUA 2Y6FA 3OY8A 4W50A 4BQYA 1RTVA 1BHGA 1O4YA 3MIGA 1PX3A 1F5FA 4XDOA 1YJLA 3P5BA 5FMCA 2NYYA 3ZXJA 1T6GC 4YARA 1N3PA 2ZAHA 4BB3A 2I45A 3SEEA 4BLJA 3VGIA 3FL7A 2D40A 4QPYA 3VBHB 2P6HA 2VCBA 3SNMA 4LHNA 3WQ1A 5KHGA 1OFNA 1V6LA 3OPTA 3OSDA 3ZYGA 3C3VA 3KZ4C 3GNEA 3PIJA 5HCFA 4FOVA 4DRRA 1H2MA 3MEPA 3S6PA 4RHV2 3HN3A 3KV6A 3JQXA 1PVC3 1ONAA 4P5YA 4SBVA 3WF4A 4AAPA 3BPSA 1BEV1 5EFUA 3TEXA 5F3GA 4TSVA 5F3EA 5CFCC 5GZGA 1LR5A 3EQEA 4HPKA 4A2UA 4GXLA 3E5UA 4FOWA 2GC0A 3RFRA 5IHRA 2JJ6A 3RJRA 3RWKX 2WNEA 3GHNA 4A6OA 4NHLA 4CDXC 1C3HA 2ENRA 4RR3C 1AJKA 2HWC1 3MW3A 4QX1A 1I1EA 4CP1A 4RFRB 3U4SA 2W2IA 3RS6A 2ZMNA 1CWPA 4OCTA 3ZLIA 5JXJA 4XBNA 4CP2A 3BOPA 4DY3A 5EHDA 3WNLA 1JYVA 1XE0A 1RHI3 3EHKA 5I93A 1FNZA 1MZFA 5HCBA 1XNDA 4FOYA 3T2OA 2YDEA 3ZOIA 1YEWA 1AX1A 1RXFA 1VBB2 1MZ5A 2ORXA 5T3NA 2ZGPA 3JUUA 3MI8A 4Y3OA 1S0FA 1OLQA 3FFQA 2MEV2 1SCRA 2PQQA 3M4FA 1RUH2 3B9IA 3PUQA 3FZ3A 2CYFA 4IEOA 5FZ4A 3NSTA 1HDKA 3PNAA 1W03A 5K0UB 5DAWA 3SKJE 3VBUA 4Y4RA 2WN2A 4D7TA 4QQOA 1X9PA 1X9TA 5C5TA 3HOBA 4H2AA 2EXKA 3GBFA 1O6UA 2C9AA 3J9SA 3TYJA 4CCMA 1J59A 1W05A 4WVZA 2ZMLA 2PYTA 3TAYA 3C7HA 4K40A 2WLQA 2J1UA 1C28A 1R1A3 4PLMA 1APNA 1D2SA 3ZN4A 5F1RA 4S2HA 1GLHA 4HK8A 2VUJA 3WDVA 4PIZA 4AI3A 2FDIA 2W46A 2D43A 1AX2A 1JU3A 1W6OA 3AYEA 4IE4A 1QH6A 3AKSA 4AG4A 2G9ZA 1AX0A 2A73B 3HBZA 1TQ5A 2GP5A 3ILRA 2GNTA 1ND3B 1AHSA 2VUDA 3THTA 2VY0A 3AMQA 5LY1A 2WNUB 5A80A 2PAMA 2WKKA 1BMV2 4H14A 1ASJ3 2E32A 3VBOB 4ATEA 2C9KA 1EPWA 4NUBA 4UYBA 4P9GA 1QXRA 1SLLA 1PO12 4DIQA 1HN0A 4PLNA 3HAGA 3O1PA 1NT0A 1TME2 4GMP0 3K3NA 3WQBA 3KHBA 3ZYFA 3IMNA 3LEMA 5TSWA 4CCEA 1Y7BA 2WUHA 5FZMA 1TZOA 1R083 2VQ0A 5FZOA 3FHIB 1QQP2 2HWD2 4A41A 1CESA 4HN1A 4YZ3A 1PO23 4YG6A 1VIWB 4YZ1A 2YZ4A 1OH4A 1JOJA 1R092 2WFPA 3ES1A 3J7LA 4QU2A 4IV3C 2BVVA 5HXVA 4Z1VA 5BV6A 1W06A 4XUQA 5DMYA 1PZ8A 4UW3A 4BOWA 1W8WA 3RMXA 3WSOA 3PDQA 4TZDA 2E9QA 3OGRA 3TRSB 3AYAA 2BFUS 4JHZA 3SEPA 3TEWA 2WO1A 5C4WB 1RC6A 1U5XA 4IL7A 3DYPA 2KR2A 2ZGLA 5DN2A 5A7NA 5KHHA 4AEJA 4ZS3A 5C9AC 3OUJA 2IXHA 2P2KA 2XVKA 2H6CA 5BUVA 4IDZA 2NQYA 1HV1A 4PIYA 5JCTA 1RUI3 3DPRC 5C8WA 2IXLA 1XU2A 2QDRA 3HVDA 3ZDVA 4RQPC 4ZU4A 4EWAA 1MS4A 2L9LA 3ZVXA 1RUG3 3E97A 3MIEA 3ZIWA 1LAJA 1EYBA 2WAAA 5EXOA 5FK8A 1JOPA 3JBG2 3Q8BA 2B7YA 1OVSA 2A6YA 4INDA 2VZ3A 5A7WB 1NE6A 2VBPA 3POSA 4Y1ZA 4O9EA 4H7MA 5A3OA 5FWJA 3VBSB 2ZTNA 5F32A 5FY7A 4AVBA 1LEDA 1W3VA 4MHRA 4ZKTB 1HXS3 2AEZA 2CDOA 3OOXA 1YFUA 1C8M2 5AFBA 2ARCA 4EN0A 1GZWA 4YGCA 1O59A 2BDRA 3AXDA 5A7QA 5T54A 1KFUL 3CJIC 4DRVA 2ZX2A 3LE0A 1W8NA 1MR5A 5IUQA 4EN8B 5CFCA 2GH8A 3VBUB 1AYM2 4QHOA 4NIDA 1Y9GA 3WDXA 3EJKA 1E5IA 3PU8A 4LTAA 1AR73 4Q4Y2 3Q8FA 1NYWA 1JHNA 2EALA 2VW0A 2CGNA 1QMJA 1DYOA 2WSVA 1W9WA 1OF3A 3OBRA 1ULOA 2QBXA 2FDJA 3AMHA 1V9U2 2VW2A 2BEOA 4I02A 4ES9A 2VECA 4C0HA 2DURA 5E16A 1W6OB 1AL0G 3M7AA 5EYYA 2WZPP 4MG2A 5LBEA 2Y64A 4CUGA 1AL23 4C1XA 4J1XA 4IEYA 1J84A 1AR62 2D44A 2UWBA 5FV3A 2VE1A 4LIUA 1S0BA 1FX5A 4YG3A 5ERLA 5GZEA 4KWKA 1L7LA 4BXFA 4P02B 2QQNA 1F4AA 2XMLA 4MX3A 2WIIB 1YWKA 4Y5Z0 1GZTA 4G4FA 4BQ5A 5ISLA 1MS8A 3IWZA 4LE3A 5FZ9A 4CRQA 1OA2A 4MZUA 1WUVA 3LOIA 4RN5A 4B4PA 2ZPXA 2W95A 3VD5A 1ALYA 2A6WA 5DZFA 1RGSA 4M3CE 3CLPA 2RMU2 3DGTA 3UKTA 4CCJA 5FZOB 4N53C 2BGPA 2ZGMA 4M3CF 5A1AA 1WW5A 2I74A 2OA2A 2QZ3A 4W6WA 2YB7A 3H7YA 3MFAA 2DUQA 2CTVA 3ZYPA 3T2QA 3HPNA 1H6XA 2JD9A 4JKMA 4QPIC 3LSDA 4DUVA 3I2DA 2PHRA 5JR7B 5F5AA 2QVSB 1GQHA 1BJQA 2DVFA 3DKWA 3ZYJB 4COZA 2Q8OA 5FZCA 1NOVA 1Q43A 2WDBA 3S7IA 1TNFA 2VOWA 3D0JA 2GSYA 1W6NA 2Y33A 3RI8A 5CKNA 2JDUA 2ZXQA 4V1PA 3ZXLA 4RL7A 1UYYA 3TNQA 1S55A 1BBT2 1W39A 2A6VA 2PHTA 2YGLA 5AVAA 5LWBA 4FPCA 2NZ9A 4KL1A 3WDTA 1H2NA 5A32A 1M4WA 5F5CA 1G9DA 1QJY2 3MW4A 5E89A 3J8F3 2Z69A 2UWCA 1UZ0A 4L0PA 1WBLA 3D3AA 1D4M2 1YQ8A 3WZ1A 2RDQA 1OQDA 2C6SA 2UU8A 2BOJA 3POYA 4IV3A 4RHV1 1XC6A 3CBNA 1ZX5A 3I2IA 4UFLA 1HX6A 1X8EA 3KB5A 2WZR3 5AC92 2Z42A 3ZFFB 1GP6A 1GZWB 1VBD2 3HR9A 4NVPA 2Y8KA 3JB8A 3PJQA 5CFCB 1V6MA 5GALA 2BGOA 2FMDA 3UKNA 2XWBB 3O14A 4FCAA 3TNPB 1ULPA 4AAXA 2D3RA 3DPRA 4CDXB 4RR3B 2RJ2A 3THCA 1K45A 4UBGA 4RQPA 4DFSA 4NHMA 2ZEZA 5I0DA 2ZEWA 4PT6A 3U11A 1ZNPA 3FHAA 3HMYA 1VB2A 3NAPA 4ZXEA 3WDUA 4LT5A 3LEGA 2ZZJA 1Y3TA 2YYOA 5LASA 3BB6A 2CHHA 1VBB1 1RITA 1UIJA 3POFA 4N43B 1J1LA 2XL7A 3OB8A 3MUY1 5C6CA 2MEV1 5I0RA 1RUH1 2RR13 1KEXA 1MS5A 2RS32 4Z07A 2RE9A 2ET7A 2ZA9A 5JIAA 1WMEA 3CJIA 1SFPA 2J1TA 2X8KA 2Y6KA 4P9XA 5GZFA 3GM8A 3FMGA 3R4DB 1JODA 4KG0A 4YZ5A 1A34A 4YGEA 4YM1A 2HEYF 2OT7A 2QQMA 3H1YA 2X5IC 4YLZA 3URFA 2DV9A 4TXWA 1ZREA 2BZDA 1RUF3 1LGCA 3OYWA 2VMIA 5C3RA 4MYEA 3VHNA 2QQUA 5LA9A 1VAKA 3AL6A 3K48A 2KD7A 3MIFA 4YYOA 4AFAA 4IGPA 4CP9A 1FMD2 1QKQA 3VBFC 5FFOC 2VQAA 1QXJA 1F31A 4CXWA 4OVEA 2DVBA 4EZHA 2HWE3 2E51A 1ZRIA 4HZFA 1POV0 2P3JA 2YGMA 3AMMA 1BMV1 3AZWA 3T4VA 3S0MA 4CU7A 5FZEA 1CZVA 1N1SA 1IGOA 2A7AA 3ZSKA 1W6NB 1W0NA 3CDZB 1PO11 3D82A 1US2A 3NJVA 4YW5A 3VD7A 3MFCA 1TME1 4PI0A 2JE8A 2Q1ZB 3D0SA 4I0AA 4QDQA 3N7JA 1WLWA 1RUJ2 2WZ8A 4GWIA 2MHFA 3KT4A 1UPSA 1S0GA 2RS53 4JRLA 4P00B 5LK5A 3WDYA 4Q8KA 4ZU7A 5IVVA 1W28A 3ZX7A 1QQP1 2HWD1 3MPBA 5EZWA 3HJRA 4I01A 4N53A 3MUZ1 2WN3A 5ANQA 1SDWA 4KWUA 2XUEA 2NMNA 1R091 3U0ZA 4K21A 4QPGC 4QPIA 5CYYA 1XSRA 5C8CB 4JDOA 4PLOA 4CYDA 5KXCA 5A6ZA 2ZGNA 4XF9A 5GKAC 2PFWA 3M3OA 3RZKA 2GNMA 2Y26A 2R6QA 1I5ZA 5C70A 1MZEA 5JSPA 3U75A 1CX1A 5C9AB 4K9SA 2BRTA 4BQ2A 1RUNA 3KGZA 4BM8A 4QQHA 1ULGA 5A3NA 2F4LA 1PNGA 3DPRB 4XJ8A 2WO2A 3B9CA 1LOFC 4RQPB 5BNPB 2AYHA 3R4SA 4XAAA 1ZVFA 3JBG1 3M2MA 1Z7S3 4AVSA 1C8NA 3B7MA 1JI6A 2VMFA 3RWNA 1DGWA 4AEKA 4CCOA 1RVF3 3E6DA 4GAZA 4HK9A 2YBPA 1GOFA 3VBHC 3ES4A 2Q5TA 3A21A 3O1UA 5BNOC 2RS13 2B46X 2QZ2A 2GN3A 3AZZA 4LO4B 2BFUL 3M70A 4NJ4A 3IDAA 2WWJA 2KM2A 2R0FA 1U0AA 1KJLA 2FHRA 4RA0A 1AYM1 4MLOA 3OGJA 3KD4A 2G4IA 1QJEA 3JQWA 2LM3A 2XLFA 2R49A 1VLNA 2BBAA 5A1FA 1XJAA 4AHWA 5C3PA 4Q4Y1 1TG7A 3SCHA 1AXKA 4AGGA 1GNZA 1W99A 1UMHA 3NKGA 1C4RA 4LUMA 5E6HA 1FOD3 3DUIA 1COV2 2VNVA 1CPNA 4UW4A 3DYOA 3OYWB 4PJYA 3NKTA 1V9U1 3USUA 1JUHA 4I0WB 5T5JA 1Q3EA 2ZHKA 4S2DA 5FKBA 4CP9B 5FIXA 1Q5OA 4Q26A 1EPZA 3D4KA 4M3CA 4IQPA 3NMBA 5A3UA 3DXUA 2D6MA 4XBQA 4HVOA 1Y9MA 2UY8A 4RD7A 4CZSA 1NX9A 1AR61 1QOOA 2WA4A 2NMOA 3ETPA 3KT1A 4JDNA 5KC5A 2IUWA 2LW8A 4KWJA 2EAAA 4JQRA 3HNYM 2D6KA 2DCTA 3IIIA 3ZXKA 2UURA 4EN7B 2CWMA 4LO8A 4BK4A 4ZONA 1GBGA 5EJ1B 4XYXA 1YQ6A 2VVEA 2XJVA 4V2WA 4AGRA 2G19A 4BE3A 3I2OA 2X5IA 4LBLA 2RMU1 3SC7X 2XJTA 3AVRA 4YVSC 3G7DA 5HV0A 2FDGA 2QQOA 2CSGA 5GJ6A 1DGWX 1BEV3 2ADEA 3POGA 4OQ8A 5BPXA 2EIBA 1DZQA 1US3A 3WNOA 4QPIB 1K5MB 3RYPA 4FPLA 3NNLA 3R0RA 1OPOA 1DFQA 1RB8G 1VRH2 4GA9A 4LHLA 4CXYA 1ZRFA 3BVCA 4MGSA 2R042 3MF6A 5J48A 3K4DA 3RZJA 4XF1A 2FD8A 2LUWA 5FDBA 1OOPC 4YZ4A 1VPHA 1W2NA 3OF1A 3WLUA 5FPXA 2WYFA 3OEBA 2ES3A 4L8QA 1QF3A 3LZZA 5FXWA 3MZHA 1BBT1 2JX9A 3TWIA 5HCAA 1MVQA 4NIIA 1GWKA 3VBOC 5C3SA 4JAAA 5EJZB 2OS2A 1QJY1 1VP6A 4Y1XA 3WP5A 1ZBE2 2Y6JA 5LW9A 1F4HA 1LU2A 5DDJ2 3ZSMA 2BPA2 4QM8A 2RG4A 1D4M1 1WD3A 4M4RA 3E5QA 3NNGA 4UFKA 2VR4A 3N36A 5C7GA 1W6QA 3C7GA 2DFCA 3AZVA 1E5HA 1N47A 1NLSA 5HI0A 1HLCA 1FV3A 4NN0A 4A7ZA 3Q8EA 4FFIA 2ZABA 4XURA 2VGDA 3WP3A 5AC91 5FP3A 1DLLA 3KM5A 2SLIA 4XILA 3D5OA 1VBD1 3SITA 1ST8A 4CCKA 4N90A 5D21A 3M3IA 3VZMA 2XL9A 1NY72 2JDAA 4C1WA 1SEFA 2D5FA 5JUVA 1SG3A 2EAKA 1WCUA 3U10A 3FUQA 3HT1A 4QXCA 4JDMA 4H55A 1RUD2 5J3UA 3UKVA 1H8VA 2HLEA 3H8RA 4DMIA 2Q1MA 3ZR5A 1LECA 1LOFA 3QH6A 5APAA 2WWSA 3C8XA 2DYCA 3ROUA 3AXEA 1QOTA 2XLGA 3USUB 1HRV2 1JS9A 5FOJB 5FTTC 2OIIA 3VHPA 1HV0A 4WZFA 4XABA 4AK3A 4ZZ8A 3CF6E 3K3OA 4FTEA 1MEC2 4BJ0A 3H3ZA 3KV4A 3HBKA 1OUSA 3MV01 4M3CB 1GOHA 2WSUA 3T08A 3EB7A 4UFIA 3VBHA 3K4AA 1OXCA 3GHMA 5BNOA 4JTOA 1NZIA 4OUMA 2RS31 3J7NA 1F8VA 1STMA 3I2GA 1CJPA 3FE5A 3ENRA 4IE7A 5E1RA 3WF2A 4BQXA 3BIEA 1OLME 1GP5A 2DCKA 3FUOA 2VCAA 2EXJA 2JEMA 1CJDA 2OUJA 3GZUC 2O8OA 4W8JA 2X5IB 2ZAAA 4R52A 1N3QA 1WMFA 3M3CA 3V0AA 1AYN2 2A3WA 3J7MA 5IVCA 3O1SA 2VXJA 1H1MA 5FZKA 1FMD1 2B42B 1XYOA 2DUOA 4HN0A 1HRI2 3FLTA 3UYJA 3VBFB 4O65A 4R4XA 1X33A 5JWPA 3RZMA 2VNRA 5CBLA 3BU0A 4PI2A 1V6JA 1W6PA 4R9DA 3D8CA 3OGSA 4LITA 5CA6A 5K7PA 1DQ4A 1DGRA 1JZ3A 4YW1A 2HEVF 4CU8A 1UPIA 1WA4A 2RJLA 4WVMB 1HN1A 1UIKA 3MF9A 3AMNA 5HV4A 1B35C 1RUJ1 4EE2A 3IB3A 4EN9B 4YM3A 2VOTA 1G7YA 4XUTA 1Y43B 1OVPA 1LHWA 4QXKA 4GWJA 1KDMA 1QU0A 4L99A 3KCYA 4YW3A 1QDOA 1LESA 4ZU5A 5FYUA 3GZAA 3LFIA 1W6QB 2R072 3IAQA 4MGZE 4IEUA 4S2FA 5FPAA 1SLCA 3APBA 5B4XA 4D0QA 4E9KA 3VZNA 4K8FA 5A3LA 4QPGB 4YSFA 5KXDA 5C3QA 4FAGA 3IAPA 2W3JA 4MGKE 1AF9A 3QACA 3C7OA 1OOPA 3TB0A 2VZUA 5IVEA 1LOBA 3GXUA 1G9AA 1QJU2 1BK1A 3OUHA 1KS4A 2UYBA 3CL1A 4FPYA 1ND3A 4YM2A 1W04A 5GLZA 3N9PA 3QCWA 2VAUA 4EYUA 3AYDA 1V00A 3DCQA 4X6QB 3VBOA 5IK8A 5FY8A 1UY1A 5FMBA 3B93A 3M8LA 1JZ2A 3V0BA 2DU1A 3Q8CA 4LIVA 4EQVA 3DYMA 2AEYA 2GC1A 2CNAA 2XJQA 1L7RA 4E27A 4P9LA 4MGYE 4R8HA 2J1RA 3AKPA 1JYXA 1OD5A 1O7FA 1NCQB 1UOGA 2Z5WA 3N35A 4PF1A 3WP4A 1NAEA 3WW3A 4QD2A 2WO7A 2ZGSA 1OUXA 3RZHA 2DCYA 3AFGA 5BNOB 1W9YA 1L3JA 4YNIA 1FATA 4KBBA 3PMEA 4OUSA 4AR2A 3UESA 5FLIA 3H1MA 5JPMB 2FCUA 3NWKA 1UZVA 3ZFFC 5C4WA 1CQ9A 3U14A 5F9TA 3E6BA 3AJYA 2D97A 2NPIA 1EAH2 4OUEA 3RI9A 1YIFA 1COV1 3NRUA 1H30A 5E8AA 2Z2SB 4DQAA 1UOBA 1ACCA 5JLVA 5JOZA 3V0AB 2OXBA 4BU2A 2XKPA 2YV8A 3H9AA 3OD0A 2D3PA 3OBZA 2NLRA 3LDBA 4AYUA 5IT6A 4YW6A 1IS5A 5H9QA 3THDA 1IQDC 1LNSA 1W6PB 3AMPA 2JDZA 5A7WA 3I7DA 3I3EA 3WNNA 4ASKA 1S2KA 4JTNA 1K42A 3OBTA 5LA1A 3VBSA 1DZRA 1ZBA2 3OPZA 4XF4A 4IE5A 4N43C 3RYRA 1F35A 3LQCA 1SBEA 4YGBA 4QB6A 2P37A 1D0HA 4XFIA 2W0XA 3BTAA 5FYBA 3DECA 2W9XA 4K1ZA 2WR9A 4JHTA 1W0OA 5LBFA 3I2HA 3TN92 1ZRDA 2D6OX 4Y1YA 4RHV3 2JXAA 3CEWA 1GWLA 1OSGA 2CWSA 4YVSB 2XJRA 4FP2A 4IW3A 2XHNA 3O1OA 1JU4A 2WBKA 1U12A 1VMFA 4AQSA 2VTFA 1A8MA 1DQ1A 4XJ9A 5JI7A 5F37A 1G8WA 4E4HA 4WZCA 4COUA 5C33A 1DQ5A 4NHXA 3ZXDA 2YROA 1VRH1 1VBC2 2VMCA 4I30A 4QQPA 1LOEA 5IYYA 4LKFA 1YIPA 1MQTC 2R041 2SBAA 1WA6X 2TBVA 3Q9OA 2ET1A 5FYMA 4GWNA 4IEVA 4DB5A 1OOPB 3L2HA 1TMF2 1LODA 2DBNA 3N9OA 4QM9A 1QGLA 5IVFA 4O61A 3PUAA 3FC0A 2P1BA 4A42A 2W39A 3WNPA 1B35A 2HYKA 3O5SA 1CN1A 2Y6GA 2EXHA 1Q8SA 1VBB3 1ZBE1 2VBBA 3LFMA 1NE4A 5DDJ1 1UU6A 2P34A 3V0BB 2CAUA 2O1QA 2FDFA 1GNYA 3BYWA 1YI7A 2MEV3 3MYXA 3X29B 5L7OC 1RUH3 5IK4A 2XPJA 4DO0A 1NCRC 4P9YA 3VKOA 2OQ6A 1IG0A 1VAMA 2JKXA 3CNAA 4LO6B 5FBJA 5FUNA 1QHDA 1WW6A 2YBKA 3V64A 5G05L 2LRPA 3DKQA 3MO4A 3RMYA 4D69A 1JZ7A 3BCWA 4EWDA 5JSOA 1OURA 2YY1A 4XJUA 2FMYA 2ZKLA 1LOGA 4GKXA 2FCVA 1NY71 2AR6A 3I3QA 3FJSA 1OLRA 2DVAA 5C8CC 1QIQA 1QH7A 5FPLA 1SDDB 2H0VA 3ZYHA 2WZEA 3HQXA 5HPOA 2XDVA 1RUD1 2UYAA 4FP3A 3ZM8A 4XHBA 1DIWA 2X05A 3ZPOA 3TOJA 1CAWA 4XZUG 1KITA 4XFGA 5J98B 4D3WA 2RV9A 2B45X 3LEIA 2F6BA 5C3OA 4MVTA 2UWAA 4A3ZA 1HIXA 2ERFA 1OLMA 4N7UA 2YU1A 1QNYA 1BK0A 1HRV1 1O5UA 5IAXA 5I8YA 4Y24A 1DYPA 4LKDA 4QGNA 1E5SA 4K6BA 1MEC1 2W68A 3MV11 5BNPC 4HONA 2RDRA 3MIDA 5LY2A 1YLLA 1PO13 4ISQA 1MZ6A 1O8SA 3O7OA 4WM8C 4HVQA 1AR82 3WCRA 1QNWA 1TME3 3OCPA 4LHSA 1ZZCA 2CL2A 2YC2A 5KHJA 2WNOA 2WA3A 4JVAA 1CR7A 2V72A 5FYSA 4FQZA 2QDNA 3IPVA 4QHZA 2E7TA 1QQP3 4NWVA 1NA1C 5KXEA 2ZGRA 5FMOS 1H6YA 1V6IA 1GANA 3LIHA 3ZFFA 1R093 4BXSV 5A3MA 5A70A 4XF3A 3MHZA 2C24A 2DCZA 1KJRA 3OEAA 5F39A 5E88A 1HQLA 1AYN1 1DU3D 3H8UA 5DABA 2VU9A 3ZYBA 3ASIA 1BKZA 1UOFA 1AL22 4L97A 4CDXA 2XJSA 1HRI1 4MXVA 1OKOA 2ZOEB 4RR3A 4A45A 1PM7A 1S4CA 3VKNA 5FR3A 4TTGA 5CISA 4BZ4A 4YGDA 2VVDA 1W8ZA 3BU7A 1ULCA 3DXTA 4YWAA 2ZBJA 2PHUA 1SHWB 1X82A 3IDEA 2KA3A 3VZOA 2AC1A 2BOIA 4N7IA 1W2TA 3HWJA 3IMMA 1V70A 1YUDA 4N43A 3JBG3 1XB9A 3C2UA 2I2SA 4J25A 3RQ0A 3T30A 4AZZA 3NNMA 3R05A 4OHXA 1B35B 1S0DA 4XZPA 2BNNA 1UY4A 3KCXA 2K0GA 1EUUA 3N9QA 1ENQA 5FZ1A 2C5DA 2JDPA 4QX7A 4JKLA 4Y5TA 1UN1A 4UOJA 5BNNC 2BJSA 4GWMA 4QX8A 4R4ZA 5EIYB 4QQLA 2R071 2WQ4A 3A0NA 2HYXA 1VALA 2YU2A 4QWNA 5F5QA 1RMU2 2GZWA 2HWB2 2VOVA 4AF9A 1AYM3 1A8DA 1JTZX 1KDKA 2A6ZA 2HWF2 3GJBA 1JYWA 2VQUA 1EV13 2PLV1 4PDWC 2Z79A 3ZMOA 2ZGQA 1W8UA 1CZTA 3SH4A 1MQTA 5GLUA 1ZA7A 1SFYA 4Q4Y3 4B1MA 3KQ4B 1QJU1 4QKFA 1DGLA 1K5MC 5IW0A 4Q4W2 5KXBA 5ABJB 4P9IA 4B8EA 1W8FA 4ARYA 1V9U3 4CU9A 5FYVA 5B4NA 1FXZA 1NXD1 3DF0A 1XRUA 4MGIE 4P14A 1CAWB 1WWYA 2WLPA 5I8SA 2VXRA 4HSJA 4YW2A 1LGBA 4LA3A 3O1MA 4Q4X2 3VZKA 3VKFC 1NZCA 2EF6A 4P9JA 1AR63 1NLRA 3GBWA 1MS9A 3R6SA 4BPZA 1NCRA 3CKHA 5C71A 2J1AA 4IUGA 5EWSA 2PHLA 1IPKA 1XNKA 3IDCB 4GB32 1JZ8A 1Q56A 1MS0A 1GYKA 2F17A 4LEJA 3PVEA 2HBTA 4JX0A 1YYNA 4M00A 4NOTA 1HQNA 5C8CA 2HEWF 4V2VA 2RMU3 3IPVB 3RZZA 1S0JA 2BNMA 3WR0A 4E4ZA 3H8XA 4DZGA 3LEKA 5DUVA 2JE7A 3WP6A 2ZHMA 1WD4A 1WCQA 2B4KA 2V5DA 4MHUA 4MADA 4A44A 3ZKUA 1W2UA 1AXYA 1EAH1 1WCDJ 4IEPA 2VTXJ 2YXSA 4XCBA 5FZIA 4DXRA 5JOYA 3NJZA 4DXZA 2PTMA 4W6XA 5JOXA 4Y33A 3ORJA 4AVVA 5C9AA 1OF4A 4M0NA 5FZHA 4XQ4A 2WC2A 3B69A 1IPJA 2A3YA 2C0ZA 2VM9A 1QY4A 3HQRA 3N7LA 5LB6A 1DDLA 2BYVE 2BNOA 3NV1A 5BNPA 1SACA 1W9SA 1G9BA 3KVBA 2MNGA 2PHWA 1JW6A 4FPOB 4XFCA 4WM8A 1BBT3 2IXKA 4GALA 1SFNA 4XFBA 1RUE2 5LA2A 4HMZA 4UFJA 3ON7A 1XSQA 4FFGA 4AFBA 1ZBA1 2GNBA 1CAVA 1QJY3 2GH2A 2Y34A 4LO7A 4EV0A 2VOKA 2PHDA 4BLIA 3ZFEC 4IETA 2J42A 2W52A 2WL1A 1I3HA 3UGHA 1NA1A 2CAVA 4ZXKA 5F3CA 1D4M3 4XHXA 3TN91 5FYYA 5J96B 1JBCA 4XJAA 2E31A 1VBA2 3ECQA 5J1XA 2VMDA 3ACLA 2BVBA 5AC93 5EJ3A 5IFTA 4E2SA 4DY5A 2RHPA 3POJA 1VBD3 2RVAA 2LS6A 3PHMA 4IE0A 3VDCA 3AP4A 2PAEA 5L19A 3JU9A 3PU3A 4BQ4A 5KHKA 1MACA 1VBC1 1ZRRA 4PF5A 1H2KA 3ETQA 1W6MA 2ZS6B 2WABA 1IKPA 1CAUB 2ARAA 4XDPA 4U2AA 1LB2A 3GZTB 4A7KA 3ZFGC 1MQTB 2OUHA 2XGXA 1TMF1 3OPWA 5FO8B 1YQCA 3CJXA 4LORA 1KD7A 5CVRA 3WNMA 3ZXFA 3T0DA 1YXWA 1H0BA 1UOJA 2YFZA 4PCRA 1F5JA 2G9GA 4LBOA 5FP8A 5FZGA 1IZ3A 4Q4V2 5D2AA 2XBO2 5A7SA 3IN9A 3WG2A 4FPHA 4RGAA 5EPAA 5A3WA 2Q1FA 3H8OA 5IK7A 2IFWA 4OI4A 3AVSA 3GYDA 3FLRA 3J4UH 4AVTA 1DQ2A 2WT1A 3IDBB 4FPKA 2R30A 3GJAA 3WVJA 1JOBA 1VB4A 5BNNA 3CU7A 1A3KA 2RS33 1Q8VA 5L7OB 4NMIA 1TVGA 4LULA 5FZAA 1NCRB 1G9FA 1MS3A 2P4EA 1QJX2 3W5MA 1IG3A 1VMJA 3KVAA 3LWCA 4M01A 3NJYA 4UBHA 1PGL2 3JXSA 1W2AX 4DPNA 3PURA 1ZZ7A 4PDWA 4U36A 4N9IA 2JG8C 3SKVA 2ZACA 3KV9A 4UWDA 4XW3A 3IT8A 1TE1B 2A6XA 3KWVA 1K5MA 4HVRA 1QJZA 3LD8A 4LHKA 5IVJA 3K46A 1NG0A 5FXVA 5FQ0A 1K5JA 4DNYA 1XNAA 2VZVA 4QT6A 3VHRA 5FOBB 1KXGA 2XQRA 1FMD3 1J83A 2WS92 3BIWE 1FPN2 3GGLA 1XNBA 5BYNA 3AZYA 2RM22 5K4LA 4AEMA 2DUPA 1PMHX 5HBAA 5JMCA 4Z2AA 5KR7A 1VR3A 1ULFA 5ACA2 3TEZA 1LKNA 1RUC2 2E53A 3GZEA 5FZFA 2RJKA 5LCWL 5DG1A 1AR81 1AR92 2IVJA 4IEWA 4A6SA 4AQ2A 4LBMA 4WM8B 3AKTA 1RUJ3 1UY3A 2JENA 2QFEA 3QOPA 4XTMA 2Q8DA 1UKRA 5FJHA 4AQ6A 4Q1PA 4CCDA 5JI9A 1NCQC 1CAVB 3ACGA 2ZGTA 2JKBA 1AJOA 3POBA 4LKSA 4CVUA 3I3MA 1FV2A 4LMFA 5A33B 5K8SA 1NA1B 3LKJA 1SQ4A 2HH9A 1C8M1 2ID4A 1UWWA 5J7MA 4AHYA 4PBOA 2AREA 3SCGA 1WMDA 3B01A 1K12A 3PVOA 1MPXA 3R4UA 4LR4A 3UGGA 3I2KA 3I3BA 4AL9A 2Z4FA 3RGBA 1AL21 3VDDB 4COYA 1UMZA 1JH5A 2FBEA 2DVGA 4LOTA 4LLOA 4OFGA 4URTA 3WG1A 3WV6A 4BA6A 4CEWC 1YI9A 3EMRA 1UQXA 1D4VB 4NIHA 1ZZBA 3VD3A 1W6MB 2LTNA 2X53S 4P9WA 4D7YA 1ZZ8A 1GMMA 5T50A 4QB1A 1TEIA 1G6NA 4DXSA 1BVVA 2CV6A 1UXZA 4B3NA 1FNYA 2WFF2 1DGRN 3ZFEA 3T4HB 5FMOL 4CU6A 3USSA 1MVEA 1UO9A 2D93A 4FO9A 4NIAA 3VD9A 4PHZA 2FQPA 3BUCA 3GF6A 2JE9A 4Q0UA 4LXLA 2HJIA 3SHRA 4CEYC 5DAQA 4IESA 5BNNB 4L9BA 3MDPA 1RMU1 5CG8A 2HWB1 4CUAA 2DDUA 1LULA 5LZ6A 2HWF1 2P3YA 3ST7A 2ATFA 3W59A 1Q8QA 4LBJA 5EQUA 3WQ7A 5IK5A 2DTYA 3AJZA 4JKKA 3JCIA 4KNCA 2ZEXA 1REFA 1T2XA 4PDWB 5FP4A 5JAXA 3MPPG 4FVVA 4CSWA 1H2LA 2XHKA 2AH2A 2UY9A 3B3QE 5J36A 3VBFA 4Q4W1 4GIQA 5GM0A 2G1MA 3B94A 1COV3 2ZMKA 3I59A 2JD4A 3RYKA 3QD6A 5FQ0B 1LJ7A 3H1WA 3WUCA 4KGQA 4ZPIA 3WNKA 4B7EA 1PM4A 4HBNA 2XR4A 2HWC3 4WVMA 1O5LA 5FUPA 2I07B 4Q4X1 2GMPA 2AUYA 2OZJA 4HKOA 4K7JA 5DUUA 4B7KA 3ATGA 1GUIA 1HB4A 3H3UA 4QU1A 4Q8LA 4IGQA 1PZ9A 2GALA 4XUPA 2V73A 1UX6A 3QBQA 1PIV2 3GCXA 4XMAA 1KFXL 2VCCA 4DEVA 5CAZA 4GB31 4NHYA 3I97A 1YFWA 3F95A 4JZRA 1XU1A 5T5OA 4E4DX 4W6YA 1SPPA 2JG8A 5JR2A 3VV1A 5IVYA 3WDWA 2E33A 3LA7A 5LRSA 3RNSA 4IEZA 5FY9A 1HJFA 4JV4A 2ZZQA 4QPGA 2OPKA 4HSLA 5F6KA 4F7ZA 3L9JT 1BLZA 3T2PA 1U5ZA 4UF0B 4NR1A 1MS1A 2VZPA 5FLHA 4Y26A 2DVDA 3LB9A 4XJZA 4GH4B 4IERA 5FKCA 3WW1A 1GSLA 3BTXA 4YRDA 1VRH3 3A4UA 2DU0A 3M1HA 5FYCA 5A1LA 1NXMA 2R043 5DAXA 5FY0A 4QHBA 1GKBA 4D7SA 5T55A 1W8OA 4BK5A 4YG0A 3ABZA 4L2NA 3RDIA 5FY1A 3QH7A 1RUE1 1RXGA 4DOUA 3BI3A 4OHYA 2ORZA 1X7NA 3I54A 3CHXA 3ITQA 1REDA 2R0HA 5FPUA 2DBIA 1NCQA 1ZBE3 3H50A 4GJZA 5DDJ3 4RGKA 3V56A 2VMGA 3POEA 3ZFEB 3D6EA 2E7QA 1SCSA 1S0CA 1H9PA 4ASLA 3N4MA 1VBA1 3MW2A 3RVHA 3JD72 4ES8A 2GP3A 4LK6A 5FCCA 4QQ2A 2ZEYA 4YW4A 1VBE2 2GC2A 4HKWA 1SLIA 1ODNA 2IXJA 2LALA 4CDWC 4I2OA 3I3DA 5F6LB 1O4TA 1QXPA 1XPWA 3T09A 2Y6HA 2VBDA 4CEWA 5L9VA 1M06G 3NVCA 1ZRCA 2NM1A 2XH6A 3AL5A 3WEZA 4Z8BA 3O1VA 4Q0QA 4AI0A 1RUD3 2EIEA 2PQSA 2WYSA 4FXKB 4QB2A 4GMP1 4OI1A 2JICA 4FOQA 3ZFGB 5CG9A 1UU5A 4AVCA 1SBFA 3CIHA 3WQ0A 2EXIA 3I59B 4KH9A 3PL0A 4WM7C 3RJ2X 3AFKA 1HRV3 4Q4V1 2XBO1 4EN6B 3WOGA 4QMAA 5F8PA 5SV8A 4FQ4A 1MEC3 1C5IA 3KMHA 1XNTA 5A6YA 1UAIA 3EBRA 1UMIA 1WBFA 2J1EA 4Q0PA 3THPA 1ZM1A 2HKXA 4CEYA 5DZEA 4FFFA 5FYZA 3VB9A 3NNJA 1NQJA 3DN7A 4CDUC 4C90A 1QJX1 2ZGOA 4ISRA 4MH0E 2R062 4NROA 1PGL1 4OHVA 2VZRA 4OULA 4YVSA 2EVXA 4IEXA 5CZKA 1UW8A 1I6XA 3KLSA 1QOSA 3POWA 4C91A 1SPPB 3PUHA 2JG8B 4C8DA 1QWRA 3AP6A 5LRRA 1OPMA 1N1VA 3LDKA 4LBQD 2GU9A 3HQUA 4F83A 3LF7A 1AYN3 2TUNA 5FJKA 4MSVA 2WS91 4ASMB 1FT9A 1FPN1 4P5HA 1HRI3 4YZ2A 1UZWA 2RM21 3BN6A 4M0HA 4AI9A 3VKMA 4X8NA 5ABJC 4KI5M 1GFF2 5D8AC 4Y5SA 2B5HA 2ZJCA 2WJSA 4CPBD 2W91A 5LK7B 4BHPA 1V6OA 1HB3A 1PNFA 1O3RA 1RUOA 3ZN6B 5ACA1 2JIJA 1IS6A 5GZDA 1RUC1 4H3WA 1KQRA 2QQLA 1BCXA 1AR91 3WHTA 3I4IA 4NAMA 2D98A 3F2ZA 1ND2C 3M3QA 2G9FA 1EUTA 1PVC2 2CGPA 4GZ9A 4XEZA 3FX3A 5I0SA 2E6VA 2VZ1A 3W58A 1UF2C 2PHFA 1OMIA 2W5FA 4I3PA 1D7PM 1IOAA 1PK6B 4BQWA 4Y4YA 1A78A 1JYIA 3MLJA 3CQOA 5L9RA 2XVGA 1AXZA 1BXHA 1OA3A 2R073 1ULDA 4FPEA 4XOGA 2QQIA 3LDRA 4HXCA 1PGW2 2R7EB 3RZLA 1UCXA 3WW4A 3SCFA 4ARXA 3RRDA 1Z78A 2PLV3 2QQPA 1F9KA 3J7HA 4HKLA 4SLIA 1A6CA 2PA7A 1ULEA 4NAOA 5IJRA 3C7FA 4C0BA 1QJU3 4CCCA 1RHI2 5F2SA 1UY2A 2CDPA 2OVUA 3A22A 4CEWB 2O0OA 1AVBA 1JYTA 1NQDA 4AHXA 3AP9A 3PTYA 1WLTA 2A5ZA 2X29A 1FAYA 1JYCA 1JXNA 4KU7A 4LUKA 3WCSA 2Y6LA 4GQ7A 2YPJA 3MBWA 2E7AA 3OTFA 1O91A 2WFF1 3KV5A 4N9HA 1CD3G 1WCKA 2OZ6A 1UU4A 5KBFA 2DTWA 3FWEA 5BXXA 3L2YA 4CUCA 1YC61 4QDRA 2JG9B 4FXGB 1IS3A 1GQGA 1B09A 2B9VA 2IWGB 2P6CA 4XUNA 2D5HA 3HD8B 3WXPA 4B4QA 4XVHA 3LPGA 2DF7A 4FFHA 3WG3A 1SBDA 2JDHA 2XG3A 3S57A 1R1A2 2HBUA 4CEYB 3MIHA 4XXAA 4BYYA 4S2GA 4CDWA 3WW2A 4EZ4A 3K51A 3S5QA 2D3SA 3IIAA 5FYIA 2PN5A 1VMHA 4QGMA 4AOCA 1DZTA 1WLDA 2H0BA 2W1WA 3AM2A 3BTYA 3UT0A 1EAH3 3P3PA 4G9SB 3O0XA 2NP0A 1OD3A 4TN7A 1ASJ2 4AWDA 1BZWA 1PHMA 2WNVC 3OGVA 4WM7A 1LCLA 1X36A 3PMSA 1IKQA 2Y0IA 4AVAA 3OBAA 4B4RA 3HNMA 4AQTA 3IBMA 3ZSLA 1YQ2A 5J09A 5FY4A 4W4ZA 3BKZA 2XVLA 2BBVA 1JZ6A 3PVNA 2P17A 4YFWA 3V65A 4COVA 4KQ7A 1NKGA 1R082 2D6NA 4W65A 4D6QA 5JSRA 1PIV1 1GV9A 1PO22 1ZBA3 4MOAA 4CDUA 2H6BA 5KC6A 1S1AA 3VN4A 2AACA 4XIKA 2OPWA 4AI2A 4E4SA 4E8DA 2ILMA 2DFBA 3TN93 3ZSJA 4MGTA 4Y22B 5L73A 4AFMA 4OHWA 1SLAA 2Q8CA 3TBDA 1JMUB 3AZXA 1T6BX 2C26A 1XQNA 4XIOA 2B9UA 2VPVA 5H9SA 2BERA 3OY8B 1RUI2 1SLTA 4XPVA 2ZX0A 2Q0AA 1LHOA 4MV2A 5ABJA 1S2EA 1VBC3 5D8AA 5GLTA 1UZYA 5JMOA 5FO9B 3IKWA 2XJUA 1RUG2 3NV3A 5FZLA 3K4ZA 1Q8PA 4HOOA 1TMF3 1N1YA 2JB8A 5IATA 1JZ5A 3OJBA 3ZKYA 4BIFA 2K2SA 1UYPA 3I49A 1ND2A 1RJ8A 2K46A 4D94A 3NV2A 3UJOA 4XDQA 1UZZA 3ZMNA 1HXS2 1I5PA 2XKOA 1UYZA 4QX5A 3NNFA 1VAVA 4Q5OA 3TEYA 1DQ6A 4PIXA 5G04L 4Z82A 3FN9A 4DXTA 1AUYA 1NLQA 1YCIA 4ORFA 2DCJA 2TEPA 4HFSA 5BY5A 4K3UA 4JC1A 1LEMA 2VMEA 2BW8A 3MICA 3K77A 4Q0SA 5IWFA 1DQ0A 4YVWC 4A7YA 4CUBA 5A6QA 5IFPA 5BNQA 5A6XA 3JD71 4KU8A 1LGNA 1AR72 1OQ1A 2HWD3 4FT8A 5EV7A 1VBE1 2JIGA 3OUIA 4HPKB 3BODA 4WBBA 2IXCA 1S0IA 1POV1 1XE7A 4OYUA 3EO6A 4H7LA 3SQOA 2A75A 4TLGA 5JZGC 1UX7A 2QQKA 3A23A 4NPLA 4CDWB 2Q4SA 5HXMA 2GDFA 2Y60A 5GLWA 4GULA 2J1VA 1ZZ6A 4L92A 1C1FA 2ARBA 3VDDC 2XXZA 5FXZA 1WGPA 2O14A 3AP7A 3J26N 4NHKA 5AVPA 3NAPC 4LPLA 5DAPA 5FYHA 1GICA 2JDKA 4NO4A 2VTXA 1S2BA 2CY6A 3GBGA 4XQDA 4J6GA 3KCCA 1WCSA 3VUOA 1W9FA 1YHFA 2ZGUA 4HETA 1OBNA 4WM7B 1FI2A 1LHNA 4BCUA 3INAA 2WAOA 4LBQA 4GJYA 5FBZA 3KF3A 3A7QA 2OYZA 4DINB 4TLFA 3NQHA 4YW7A 1D0GA 1AR83 4XUOA 1DCSA 4UW5A 1DHKB 1EV12 3WX5A 3O0VA 5EYXA 1G86A 5FUIA 4P08A 3ZSEA 2R061 4HG6B 4CDUB 4F3JA 5IVBA 1QDCA 4WV8A 4CPBA 3VZJA 1XBFA 2VO5A 1Y9QA 2CU5A 3AX4A 4MGQA 3T0BA 4XC9A 4HT1T 1C8M3 3U78A 2WRAA 4HL0A 4YPJA 1BQPA 2VUCA 3N7KA 4DS0A 4OZXA 4XCAA 2YG0A 1SZBA 1LOCA 4UXAA 5FZ3A 1L7QA 5IAVA 1PMJX 3BOWA 2WNVA 1CAUA 3HNBM 4CE8A 1JUIA 1DF0A 1OQEA 3UGFA 1HKDA 3AK0A 4B29A 3ME2A 3O0WA 4K8RB 3E6CC 1H9WA 4MUVA 2W92A 3H0OA 3WHUA 2IC1A 5D8AB 5FREA 4IEQA 4CA9A 4A4AA 2VC9A 1OFSA 2OQ7A 3J8F2 1HB2A 4R9BA 3T2TA 3IM0A 3I2JA 3T1MA 1ZYBA 3AC0A 3HN1A 1UL9A 4KG8A 4TWTA 1VJ2A 2P3IA 3DV8A 2R16A 2IVIB 3G6JB 2WINB 3HIFA 4JGYC 3N9LA 4X6RB 3BTZA 3WINE 2ARXA 1PVC1 5DG2A 5CIRA 1ND2B 4UAPA 1VRBA 3U07A 2VUAA 3UL2A 1E57A 5L7OA 4RS5C 2WZR2 2AGSA 2W1QA 5F2WA 2XB6C 1XNCA 1JZ4A 4CDQC 3P3NA 3WF1A 4Q27A 1JYNA 1OKQA 2X09A 1WW7A 2QKDA 4E2GA 1YRZA 5JIUA 1RMU3 2HWB3 5DUWA 4FTSA 1PGW1 3S5AA 5HCHA 5CB7A 5FLJA 5FWEA 2HWF3 4GD4A 3CZJA 4LA2A 4KBZA 2XJPA 1RINA 3KSCA 4OMDA 3SXWA 2P5BA 4AE2A 1RHI1 4PQ9A 4GH4C 1UKGA 4Q4W3 1CVNA 5CU1A 3UK9A 2JB4A 1UYXA 4MXWA 2VH9A 2FZ1A 2JWPA 1LU1A 4Z2WA 3ACFA 4JGZC 1K3IA 4E8CA 4Y1VA 2PXJA 5LA0A 2RR12 5JOWA 3CMGA 4M4PA 2EA7A 4Q4X3 2FDKA 1UXXX 3AKRA 1DLCA 2A70A 3H42B 1FYUA 2Y38A 4L11A 1PZ7A 4I3GA 4YVWA 1W9TA 3OD4A 3N3HA 4LBQB 5T5LA 2V4AA 3FHQA 4GB33 4IV1C 2F4PA 2BUKA 5A33A 1CGPA 1LRHA 1R1A1 3GCWA 4KMQA 1RUF2 4QXBA 3VBRC 1V0AA 5JZGA 1VE0A 3W5NA 1C57A 3N7MA 4O7XA 4XFFA 1GR3A 3DL3A 3PTRB 1U5YA 2A71A 3MGUA 3SISA 3VDDA 4ET7A 5LBBA 2HWE2 3B00A 5JXHA 3AB0A 1KS5A 4PBPA 3P1IA 4LOSA 5L9BA 1ASJ1 3U37A 5CFDC 3ZR6A 4AEDC 4GKYA 2QQWA 3KGLA 5A3PA 4OZOA 2WNVB 4JQTA 4XMIA 1Q8OA 1F2NA 3RZGA 2OW4A 1TNRA 2ZX3A 5FZ0A 3K75B 3WG4A 4Q2FA 2PHXA 3C7EA 2RS52 3BALA 1O3TA 1IS4A 4NRMA 1R081 1RUE3 2IXIA 4IE6A 5J37A 2JDYA 3CO2A 4Z92B 3O1RA 1PO21 3B5LB 4RGGA 3NJXA 1HW5A 4IGOA 2W94A 4YFZA 1LTEA 2EIDA 2V5YA 1ENXA 2ZHNA 3POIA 1OH3A 4NWWA 3UJQA 3KHCA 2AENA 2J22A 2QTWB 1XYPA 5FK7A 5LEJA 3ZYRA 1VBA3 4FPFA 3BPZA 2EIGA 1J3RA 2GMEA 4PQQA 1BYHA 2W47A 3FBYA 2WQ8A 1CAXA 4XE9A 4LBNA 3LSEA 3T3YA 1GNHA 3MIBA 2EICA 1RUI1 2N7GA 2AZ5A 1W2OA 2XWJB 3ZXAC 1RYYA 4ZY9A 4D6RA 1RUG1 2XONA 4LO5B 4UFHA 3O12A 5DQ0A 2VZSA 2WO3A 3KT7A 3VD4A 2YC0A 5FZDA 4GMP3 1Z7S2 4BQ1A 4AGVA 2E63A 5SV5A 4AI1A 1RVF2 2GAUA 4HLTA 4JGYA 5A32B 1O3SA 1H8TC 4LE4A 5F3IA 5FZBA 1HB1A 3HEIA 3LA2A 1LENA 2XBO3 4Q4V3 4K20A 4MXWB 2Q8EA 3VDAA 1HXS1 3W20A 2RS12 4RS5A 1W3XA 1LOAA 4OI2A 4RFT0 3ACHA 1V6NA 1CIYA 4IV3B 4LBKA 1X8MA 5FY5A 4CDQA 3AKQA 5B2GB 5KWRA 4XQWA 4BMEA 3ZXEA 3VL9A 1REEA 4YVWB 1H1AA 1QJX3 3NW4A 1ENSA 1AR71 1WLCA 3Q8AA 1PK6C 4BH9A 1C1LA 2VQTA 2A1XA 3CZUA 4FBFA 5JVVA 1OI6A 2ADDA 1Z0HA 4F8AA 5JXGA 1FOD2 4UF0A 3SH5A 1OT5A 1CZSA 3LAGA 4BISA 5JZGB 1W90A 4UI9L 4QKDA 1WKYA 2BWCA 4BMBA 4GH4A 3ALQA 3ZN5A 2BGCA 2PAKA 4QX0A 2Y0OA 3S30A 2WS93 1O4ZA 2QQVA 1FPN3 3RPQA 4R9CA 3NAPB 2RM23 4J1WA 3QLQA 4JGZA 4LK7A 5CNAA 3UNPA 3VLBB 3VL8A 1UY0A 5GZCA 3OGGA 5K9YA 2BP6A 2R1DA 2RDSA 2ZHLA 5F5IA 5FPBA 1CPMA 1R1ZA 4QKBA 1IQAA 3SLIA 3VHOA 1ZA4A 2VNOA 4OHZA 2XLAA 3OG2A 1GZ9A 5ACA3 1LHVA 2VZOA 3EXUA 3HT2A 1H4GA 1RUC3 4MO3M 4ONUA 4RYDA 4QGLA 5I0UA 3WY6A 1AR93 1GU3A 3CJIB 4IV1A 1W0PA 2QE3A 1EV11 2JG9C 2VJXA 3VBRA 1URXA 2D6LX 3LA3A 4Y20A 4DEQA 1F15A 3WNXA 4FTBA 1BEV2 2IFRA 4LJHA 1J58A 4JCKA 2MPFA 4BQ3A 2VZQA 3KS7A 2ZCWA 4KGGA 4O9GA 2E26A 1OA4A 2BQPA 1KRIA 2VMHA 5CADA 5CFDA 2HWC2 3H7JA 1V6KA 4XFHA 3ZYIB 2D6PA 2ZX1A 2A3XA 4I09A 4XAEA 4AEDA 2QJVA 3GDBA 4OI0A 1GOGA 2YHJA 1CAXB 2YFUA 3ZFGA 3SH3A 3GALA 4AFCA 2ZGKA 5FPVA 4IXLA 5H9RA 4A3XA 5F7UA 4XJWA 2QUOA 2VD7A 1OC1A 1ODMA 2VL4A 5I91A 1XE8A 1CONA 3MLKA 4N8MA 3J8F1 5AFEA 4Q1RA 3NO8A 1ZZ9A 2RDNA 4TYSA 5FP9A 4I0BA 4OMCA 3T1LA 1WW4A 1UD1A 5JXIA 5DXDA 3UV9A 5CEHA 4NPMA 1LHUA 4K1YA 2JDNA 2WFF3 5A7PA 4Y1UA 5K0UC 1J3QA 4B1LA 2C4XA 5LEKA 4HANA 2LROA 4JGYB 3AYCA 3KF5A
chains in the Genus database with same CATH topology
4GZ9A 2V72A 2J1TA 2VZTA 2VZ1A 2Y6KA 3GM8A 2W5FA 1D7PM 1H6YA 3CQOA 2QQMA 4BXSV 1DP0A 4TXWA 2BZDA 4FI9A 3OEAA 2W87A 3WF3A 2QQIA 1GQPA 2R7EB 2KD7A 2QQJA 4ARXA 3J7HA 4QX2A 2XOMA 4A45A 5IJRA 2W1SA 4TTGA 3C7FA 1UY2A 2CDPA 3A22A 3ACIA 4CU7A 1CZVA 1SHWB 2XQXA 1W0NA 3CDZB 3PUIA 3NJVA 1US2A 2Y6LA 3VD7A 3MBWA 4QDQA 2JE8A 2WZ8A 4GWIA 4P00B 4CUCA 4QDRA 1UY4A 2B9VA 1EUUA 2X10A 4XUNA 3HJRA 3MUZ1 4JKLA 2WN3A 4XVHA 4KWUA 4UOJA 3LPGA 3LPFA 3EYPA 5EIYB 3UETA 2HYXA 3E1F1 5CYYA 1JYWA 2J1SA 2VQUA 4QPWA 1CZTA 5C70A 2W1WA 1P8JA 2OKXA 1CX1A 1KGYA 1OD3A 5DPNA 4ARYA 3OGVA 4CU9A 5B4NA 2WO2A 3I2FA 3OBAA 3HNMA 1YQ2A 4W4ZA 1JI6A 1JZ6A 2VMFA 3WF0A 2YC4A 1NKGA 3CKHA 1GOFA 1R64A 5C71A 2J1AA 4IUGA 3A21A 4MOAA 1JHJA 1JZ8A 1PX4A 3IDAA 4JX0A 4E8DA 4LQRA 3VDBA 2BBAA 3LEKA 1TG7A 1WCQA 2B4KA 2V5DA 4MADA 1W99A 4A44A 1UMHA 4DXRA 2C26A 2BERA 3DYOA 4QX3A 1OF4A 2VM9A 5JMOA 3BGAA 4QAWA 3K4ZA 4DUWA 1W9SA 1NX9A 3ETPA 1JZ5A 4D8MA 2J7MA 2LW8A 5LA2A 3T0AA 4DUXA 3P6BA 3HNYM 3IIIA 1I5PA 2W1UA 1UYZA 4ZZ5A 4BK4A 5G04L 3FN9A 5EJ1B 4DXTA 1NUKA 2DCJA 2V4VA 2VMEA 1O8PA 3K77A 5IFPA 4CUBA 2E31A 4BDVB 3ECQA 5J1XA 2VMDA 2QQOA 5IFTA 4OYUA 2RVAA 2EIBA 1US3A 2LS6A 3WNOA 3VDCA 1UX7A 2QQKA 3A23A 4QDSA 5HXMA 4W50A 4MGSA 1BHGA 1PX3A 2J1VA 2WABA 3K4DA 3OEBA 4LPLA 3WNMA 3T0DA 3SEEA 2YFZA 3FL7A 5EJZB 2VCBA 2WAOA 2Y6JA 1F4HA 3A7QA 4M4RA 3NNGA 3NQHA 2VR4A 5C7GA 3C7GA 4XUOA 3HN3A 1TVGA 5FUIA 4P5YA 4P08A 3W5MA 4XURA 3WF4A 4HG6B 3JXSA 2VO5A 4MGQA 3T0BA 3SKVA 2JDAA 4YPJA 5IHRA 5JUVA 1SG3A 4A6OA 2YG0A 3K46A 1XNAA 2VZVA 1L7QA 4QX1A 1PMJX 3HNBM 2HLEA 1J83A 3GGLA 5JXJA 3C8XA 3WNLA 1JYVA 1PMHX 2W92A 4Z2AA 3T2OA 4A4AA 4ZZ8A 2VC9A 4BJ0A 3MV01 1GOHA 2ORXA 3T08A 3EB7A 3I2JA 3K4AA 3AC0A 5LCWL 1UY3A 4UAPA 3SKJE 2WN2A 3I2GA 3WF2A 2W1QA 3ACGA 4LKSA 3HOBA 4CVUA 2DCKA 2VCAA 2ID4A 1JZ4A 1UWWA 3WF1A 3C7HA 1JYNA 2J1UA 2X09A 4W8JA 1K12A 1MPXA 3I2KA 3I3BA 2Z4FA 2W46A 1JU3A 4AG4A 3CZJA 4OMDA 3OGSA 1JZ3A 3VD3A 2E32A 4CU8A 2C9KA 1UYXA 1HN1A 1GMMA 4QB1A 3ACFA 4E8CA 1K3IA 4DXSA 5LA0A 1UXZA 3CMGA 4M4PA 3WQBA 1UXXX 1DLCA 3IB3A 2WUHA 4CU6A 2VOTA 4XUTA 3VD9A 4A41A 4GWJA 1W9TA 3FHQA 1OH4A 3IAQA 4KMQA 4D0QA 5B4XA 4XUQA 5DMYA 4CUAA 3WSOA 3W5NA 2DDUA 3OGRA 4JHZA 3SEPA 2WO1A 3IAPA 4JKKA 2W3JA 3DYPA 2ZEXA 1T2XA 5DN2A 3C7OA 4ET7A 2VZUA 5JXHA 3GXUA 3P1IA 3U37A 3WNKA 4OZOA 2L9LA 1UY1A 2WAAA 1JZ2A 3K75B 2VZ3A 3DYMA 3C7EA 1GUIA 1L7RA 2J1RA 1JYXA 4XUPA 4PF1A 4DEVA 2VCCA 1NAEA 2CDOA 3I97A 3NJXA 2W94A 2EIDA 1O59A 3LE0A 1W8NA 5JR2A 2J22A 2E33A 3UESA 3T2PA 4PQQA 2W47A 2WQ8A 2VZPA 1DYOA 4OUEA 1W9WA 1OF3A 3NRUA 1ULOA 2EICA 2QBXA 1RYYA 4ZY9A 2XONA 5DQ0A 2VZSA 2WO3A 2Y64A 3VD4A 1W8OA 4BK5A 3ABZA 1J84A 3THDA 1IQDC 1LNSA 3I3EA 2ORZA 3WNNA 3HEIA 3VDAA 4P02B 1K42A 2QQNA 1F4AA 5LA1A 3LQCA 4QB6A 3ACHA 4RN5A 3DECA 1CIYA 2W9XA 2W95A 3VD5A 3I2HA 2BGPA 5A1AA 2YB7A 2XHNA 2ZEYA 1JU4A 2VQTA 2WBKA 3CZUA 3T2QA 3HPNA 2VTFA 1H6XA 2JD9A 4JKMA 4DUVA 5JXGA 3I3DA 1OT5A 1CZSA 1XPWA 3T09A 4UI9L 2Y6HA 1WKYA 2VMCA 5IYYA 3WEZA 2WDBA 2EIEA 2PQSA 2WYSA 4QB2A 4QX0A 2ZXQA 3CIHA 3UNPA 1UYYA 1UY0A 4A42A 3WNPA 2Y6GA 3OG2A 1UZ0A 2VZOA 4L0PA 4RYDA 3D3AA 4MO3M 1XNTA 1GNYA 1UMIA 2J1EA 1GU3A 1XC6A 2VJXA 2JKXA 3I2IA 4DEQA 5G05L 3MO4A 1JZ7A 2VZRA 5CZKA 2Y8KA 3PUHA 2VZQA 2BGOA 1SDDB 2E26A 2WZEA 5HPOA 1ULPA 4AAXA 3ZM8A 2X05A 2RJ2A 3THCA 1K45A 4XZUG 3GDBA 1GOGA 2ZEZA 2RV9A 5I0DA 3LEIA 2ZEWA 3BN6A 2YFUA 4PT6A 4A3ZA 3FHAA 4KI5M 4ZXEA 5F7UA 2VL4A 3LEGA 2W91A 3MV11 4OMCA 2QQLA 3OB8A 3MUY1 5JXIA 1O8SA 1KEXA 3F2ZA 4LHSA 2C4XA 2YC2A 1EUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GZ9 A;  2V72 A;  2J1T A;  2VZT A;  2VZ1 A;  2Y6K A;  3GM8 A;  2W5F A;  1D7P M;  1H6Y A;  3CQO A;  2QQM A;  4BXS V;  1DP0 A;  4TXW A;  2BZD A;  4FI9 A;  3OEA A;  2W87 A;  3WF3 A;  2QQI A;  1GQP A;  2R7E B;  2KD7 A;  2QQJ A;  4ARX A;  3J7H A;  4QX2 A;  2XOM A;  4A45 A;  5IJR A;  2W1S A;  4TTG A;  3C7F A;  1UY2 A;  2CDP A;  3A22 A;  3ACI A;  4CU7 A;  1CZV A;  1SHW B;  2XQX A;  1W0N A;  3CDZ B;  3PUI A;  3NJV A;  1US2 A;  2Y6L A;  3VD7 A;  3MBW A;  4QDQ A;  2JE8 A;  2WZ8 A;  4GWI A;  4P00 B;  4CUC A;  4QDR A;  1UY4 A;  2B9V A;  1EUU A;  2X10 A;  4XUN A;  3HJR A;  3MUZ 1;  4JKL A;  2WN3 A;  4XVH A;  4KWU A;  4UOJ A;  3LPG A;  3LPF A;  3EYP A;  5EIY B;  3UET A;  2HYX A;  3E1F 1;  5CYY A;  1JYW A;  2J1S A;  2VQU A;  4QPW A;  1CZT A;  5C70 A;  2W1W A;  1P8J A;  2OKX A;  1CX1 A;  1KGY A;  1OD3 A;  5DPN A;  4ARY A;  3OGV A;  4CU9 A;  5B4N A;  2WO2 A;  3I2F A;  3OBA A;  3HNM A;  1YQ2 A;  4W4Z A;  1JI6 A;  1JZ6 A;  2VMF A;  3WF0 A;  2YC4 A;  1NKG A;  3CKH A;  1GOF A;  1R64 A;  5C71 A;  2J1A A;  4IUG A;  3A21 A;  4MOA A;  1JHJ A;  1JZ8 A;  1PX4 A;  3IDA A;  4JX0 A;  4E8D A;  4LQR A;  3VDB A;  2BBA A;  3LEK A;  1TG7 A;  1WCQ A;  2B4K A;  2V5D A;  4MAD A;  1W99 A;  4A44 A;  1UMH A;  4DXR A;  2C26 A;  2BER A;  3DYO A;  4QX3 A;  1OF4 A;  2VM9 A;  5JMO A;  3BGA A;  4QAW A;  3K4Z A;  4DUW A;  1W9S A;  1NX9 A;  3ETP A;  1JZ5 A;  4D8M A;  2J7M A;  2LW8 A;  5LA2 A;  3T0A A;  4DUX A;  3P6B A;  3HNY M;  3III A;  1I5P A;  2W1U A;  1UYZ A;  4ZZ5 A;  4BK4 A;  5G04 L;  3FN9 A;  5EJ1 B;  4DXT A;  1NUK A;  2DCJ A;  2V4V A;  2VME A;  1O8P A;  3K77 A;  5IFP A;  4CUB A;  2E31 A;  4BDV B;  3ECQ A;  5J1X A;  2VMD A;  2QQO A;  5IFT A;  4OYU A;  2RVA A;  2EIB A;  1US3 A;  2LS6 A;  3WNO A;  3VDC A;  1UX7 A;  2QQK A;  3A23 A;  4QDS A;  5HXM A;  4W50 A;  4MGS A;  1BHG A;  1PX3 A;  2J1V A;  2WAB A;  3K4D A;  3OEB A;  4LPL A;  3WNM A;  3T0D A;  3SEE A;  2YFZ A;  3FL7 A;  5EJZ B;  2VCB A;  2WAO A;  2Y6J A;  1F4H A;  3A7Q A;  4M4R A;  3NNG A;  3NQH A;  2VR4 A;  5C7G A;  3C7G A;  4XUO A;  3HN3 A;  1TVG A;  5FUI A;  4P5Y A;  4P08 A;  3W5M A;  4XUR A;  3WF4 A;  4HG6 B;  3JXS A;  2VO5 A;  4MGQ A;  3T0B A;  3SKV A;  2JDA A;  4YPJ A;  5IHR A;  5JUV A;  1SG3 A;  4A6O A;  2YG0 A;  3K46 A;  1XNA A;  2VZV A;  1L7Q A;  4QX1 A;  1PMJ X;  3HNB M;  2HLE A;  1J83 A;  3GGL A;  5JXJ A;  3C8X A;  3WNL A;  1JYV A;  1PMH X;  2W92 A;  4Z2A A;  3T2O A;  4A4A A;  4ZZ8 A;  2VC9 A;  4BJ0 A;  3MV0 1;  1GOH A;  2ORX A;  3T08 A;  3EB7 A;  3I2J A;  3K4A A;  3AC0 A;  5LCW L;  1UY3 A;  4UAP A;  3SKJ E;  2WN2 A;  3I2G A;  3WF2 A;  2W1Q A;  3ACG A;  4LKS A;  3HOB A;  4CVU A;  2DCK A;  2VCA A;  2ID4 A;  1JZ4 A;  1UWW A;  3WF1 A;  3C7H A;  1JYN A;  2J1U A;  2X09 A;  4W8J A;  1K12 A;  1MPX A;  3I2K A;  3I3B A;  2Z4F A;  2W46 A;  1JU3 A;  4AG4 A;  3CZJ A;  4OMD A;  3OGS A;  1JZ3 A;  3VD3 A;  2E32 A;  4CU8 A;  2C9K A;  1UYX A;  1HN1 A;  1GMM A;  4QB1 A;  3ACF A;  4E8C A;  1K3I A;  4DXS A;  5LA0 A;  1UXZ A;  3CMG A;  4M4P A;  3WQB A;  1UXX X;  1DLC A;  3IB3 A;  2WUH A;  4CU6 A;  2VOT A;  4XUT A;  3VD9 A;  4A41 A;  4GWJ A;  1W9T A;  3FHQ A;  1OH4 A;  3IAQ A;  4KMQ A;  4D0Q A;  5B4X A;  4XUQ A;  5DMY A;  4CUA A;  3WSO A;  3W5N A;  2DDU A;  3OGR A;  4JHZ A;  3SEP A;  2WO1 A;  3IAP A;  4JKK A;  2W3J A;  3DYP A;  2ZEX A;  1T2X A;  5DN2 A;  3C7O A;  4ET7 A;  2VZU A;  5JXH A;  3GXU A;  3P1I A;  3U37 A;  3WNK A;  4OZO A;  2L9L A;  1UY1 A;  2WAA A;  1JZ2 A;  3K75 B;  2VZ3 A;  3DYM A;  3C7E A;  1GUI A;  1L7R A;  2J1R A;  1JYX A;  4XUP A;  4PF1 A;  4DEV A;  2VCC A;  1NAE A;  2CDO A;  3I97 A;  3NJX A;  2W94 A;  2EID A;  1O59 A;  3LE0 A;  1W8N A;  5JR2 A;  2J22 A;  2E33 A;  3UES A;  3T2P A;  4PQQ A;  2W47 A;  2WQ8 A;  2VZP A;  1DYO A;  4OUE A;  1W9W A;  1OF3 A;  3NRU A;  1ULO A;  2EIC A;  2QBX A;  1RYY A;  4ZY9 A;  2XON A;  5DQ0 A;  2VZS A;  2WO3 A;  2Y64 A;  3VD4 A;  1W8O A;  4BK5 A;  3ABZ A;  1J84 A;  3THD A;  1IQD C;  1LNS A;  3I3E A;  2ORZ A;  3WNN A;  3HEI A;  3VDA A;  4P02 B;  1K42 A;  2QQN A;  1F4A A;  5LA1 A;  3LQC A;  4QB6 A;  3ACH A;  4RN5 A;  3DEC A;  1CIY A;  2W9X A;  2W95 A;  3VD5 A;  3I2H A;  2BGP A;  5A1A A;  2YB7 A;  2XHN A;  2ZEY A;  1JU4 A;  2VQT A;  2WBK A;  3CZU A;  3T2Q A;  3HPN A;  2VTF A;  1H6X A;  2JD9 A;  4JKM A;  4DUV A;  5JXG A;  3I3D A;  1OT5 A;  1CZS A;  1XPW A;  3T09 A;  4UI9 L;  2Y6H A;  1WKY A;  2VMC A;  5IYY A;  3WEZ A;  2WDB A;  2EIE A;  2PQS A;  2WYS A;  4QB2 A;  4QX0 A;  2ZXQ A;  3CIH A;  3UNP A;  1UYY A;  1UY0 A;  4A42 A;  3WNP A;  2Y6G A;  3OG2 A;  1UZ0 A;  2VZO A;  4L0P A;  4RYD A;  3D3A A;  4MO3 M;  1XNT A;  1GNY A;  1UMI A;  2J1E A;  1GU3 A;  1XC6 A;  2VJX A;  2JKX A;  3I2I A;  4DEQ A;  5G05 L;  3MO4 A;  1JZ7 A;  2VZR A;  5CZK A;  2Y8K A;  3PUH A;  2VZQ A;  2BGO A;  1SDD B;  2E26 A;  2WZE A;  5HPO A;  1ULP A;  4AAX A;  3ZM8 A;  2X05 A;  2RJ2 A;  3THC A;  1K45 A;  4XZU G;  3GDB A;  1GOG A;  2ZEZ A;  2RV9 A;  5I0D A;  3LEI A;  2ZEW A;  3BN6 A;  2YFU A;  4PT6 A;  4A3Z A;  3FHA A;  4KI5 M;  4ZXE A;  5F7U A;  2VL4 A;  3LEG A;  2W91 A;  3MV1 1;  4OMC A;  2QQL A;  3OB8 A;  3MUY 1;  5JXI A;  1O8S A;  1KEX A;  3F2Z A;  4LHS A;  2C4X A;  2YC2 A;  1EUT A; 
#chains in the Genus database with same CATH topology
 3JZV A;  1Y4W A;  2VZT A;  3LIG A;  2WZR 1;  4N53 B;  3NL1 A;  2WT2 A;  5DUX A;  4RS5 B;  3U1X A;  3WUD A;  1IHM A;  4YM0 A;  5C5U A;  5JDB A;  5T52 A;  4UFM A;  1YJK A;  1QJF A;  1IPS A;  4NRP A;  1DP0 A;  1JN2 P;  2WWU A;  2GND A;  1SLB A;  4CDQ B;  4FI9 A;  4RSU A;  2W87 A;  3WF3 A;  5M0T A;  1O3Q A;  2FDH A;  1GQP A;  1H4H A;  4Q0V A;  3W21 A;  2VNG A;  3RG0 A;  2QQJ A;  3A0K A;  2R32 A;  1ENR A;  3H3L A;  5FZ7 A;  4QX2 A;  2XUM A;  1ND3 C;  5D1I A;  1EY2 A;  2XOM A;  3DEM A;  2W1S A;  2FZ2 A;  2WNU C;  2ETE A;  4BIO A;  1I9R A;  5KHI A;  1RIR A;  5FYT A;  1RL3 A;  2GC3 A;  2O8Q A;  1N1T A;  3ACI A;  4X8P A;  4CXX A;  2ZX4 A;  2DWR A;  2XQX A;  5A7O A;  2K9Z A;  1H8T A;  2GN7 A;  1C5H A;  3PUI A;  3LGR A;  3ZN6 A;  2ZKN A;  5FAX A;  4D6S A;  4COW A;  1EP0 A;  2RR1 1;  4JGZ B;  1H1I A;  1PGS A;  4XET A;  1U5I A;  4NPR A;  4QKN A;  4XBL A;  3ELN A;  1X50 A;  2VUL A;  4AI8 A;  5A3T A;  4E2Q A;  3FFZ A;  3ZPY A;  3AP5 A;  1J1T A;  4ERO A;  1YO8 A;  2IZW A;  2R1B A;  4ATF A;  2X10 A;  2YUE A;  5FP7 A;  1AZD A;  4FAH A;  5LAT A;  3U4X A;  1PIV 3;  4XXP A;  3LPF A;  1PK6 A;  3EYP A;  2BU9 A;  5I8T A;  1RUF 1;  4IV1 B;  3ILN A;  3UET A;  3WD5 A;  3E1F 1;  1YQ5 A;  4AFD A;  2W08 A;  5H9P A;  3VBR B;  2V09 A;  5C4W C;  4Y20 B;  1W8T A;  2J1S A;  2JEC A;  3ZO0 B;  1CIW A;  4QPW A;  3S7E A;  2JDM A;  3FLP A;  3PUS A;  1DBN A;  4ZHN A;  2CGO A;  1S0E A;  2HWE 1;  3LCP A;  2VVF A;  3VKL A;  1P8J A;  1CX4 A;  5CKQ A;  2OKX A;  2VCM A;  3SMH A;  1KGY A;  4CTE A;  5FXX A;  5DPN A;  5FO7 B;  4NIG A;  3NV4 A;  4CCL A;  5CFD B;  2BWA A;  1W8H A;  4AED B;  3I2F A;  4FPG A;  2KXL A;  1J3P A;  3ZIX A;  4URA A;  2B39 A;  3RSJ A;  2WT0 A;  3B02 A;  1UNB A;  4EJR A;  2RS5 1;  3VBS C;  5FMD A;  2PEL A;  3FBM A;  2GMM A;  3WF0 A;  2YC4 A;  1R64 A;  3K2O A;  1YFY A;  4NRQ A;  2JG9 A;  2YBS A;  5GLV A;  1PVX A;  1JHJ A;  4Q29 A;  1PX4 A;  3KQR A;  5FPZ A;  5FZ8 A;  4R9A A;  3VBU C;  1E5R A;  4CCN A;  4MET A;  2Q30 A;  2P3K A;  4LQR A;  1XYN A;  2OX0 A;  5DAV A;  4BWO A;  3VDB A;  4AXO A;  1D2Q A;  2FCT A;  3E5X A;  4XF0 A;  3JD7 3;  4G3Y C;  5EP9 A;  4AHZ A;  2PMW B;  2VG9 A;  1VBE 3;  3VZL A;  2WQZ C;  4LKE A;  3LOB A;  4WVW A;  1POV 3;  2VW1 A;  4XTP A;  2YPD A;  4QX3 A;  1GWM A;  4LNV A;  1GP4 A;  5L36 A;  3I8T A;  4ZS2 A;  4JRA A;  4OQ9 A;  2QCS B;  3JB4 C;  1HQW A;  3BGA A;  4QAW A;  2B8M A;  5FRA A;  1XOY A;  1XXN A;  4FPJ A;  4DUW A;  4FSJ A;  1Z7S 1;  4KWL A;  4NE9 A;  1YNA A;  5I0T A;  1N3O A;  4D8M A;  3M3E A;  5T5P A;  3ZDS A;  4EWE A;  1RVF 1;  2J7M A;  3ZXG A;  2TNF A;  3PJY A;  5K0U A;  3T0A A;  2BV4 A;  2D7F A;  4DUX A;  3P6B A;  4XAC A;  1DG6 A;  2QNK A;  5DZG A;  4QXH A;  1H8T B;  3PIG A;  4ITC A;  3WT3 A;  1WZX A;  2RS1 1;  2W1U A;  1SMV A;  3IZO A;  3MLL A;  4UW6 A;  2VOX A;  2YMZ A;  5ANN A;  4ZZ5 A;  5JPN B;  5CKM A;  1NUK A;  2V4V A;  1O8P A;  4OLL A;  1POQ A;  5LBC A;  4XFA A;  4BDV B;  1WMX A;  5FZ6 A;  2PLV 2;  3N9N A;  1YFX A;  1DYK A;  4UT5 A;  4AW7 A;  2R06 3;  3PVB B;  4Y22 A;  3N9M A;  1G9C A;  2NN8 A;  1OHF A;  1PMI A;  2BTV C;  2C1F A;  4WVV A;  1GZC A;  4LLF A;  3W9A A;  1FOD 1;  1BVP 1;  3O1T A;  4CP0 A;  3PLQ A;  1HJG A;  3ILF A;  1RJ7 A;  4QDS A;  1QEX A;  2WNU A;  2Y6F A;  3OY8 A;  4W50 A;  4BQY A;  1RTV A;  1BHG A;  1O4Y A;  3MIG A;  1PX3 A;  1F5F A;  4XDO A;  1YJL A;  3P5B A;  5FMC A;  2NYY A;  3ZXJ A;  1T6G C;  4YAR A;  1N3P A;  2ZAH A;  4BB3 A;  2I45 A;  3SEE A;  4BLJ A;  3VGI A;  3FL7 A;  2D40 A;  4QPY A;  3VBH B;  2P6H A;  2VCB A;  3SNM A;  4LHN A;  3WQ1 A;  5KHG A;  1OFN A;  1V6L A;  3OPT A;  3OSD A;  3ZYG A;  3C3V A;  3KZ4 C;  3GNE A;  3PIJ A;  5HCF A;  4FOV A;  4DRR A;  1H2M A;  3MEP A;  3S6P A;  4RHV 2;  3HN3 A;  3KV6 A;  3JQX A;  1PVC 3;  1ONA A;  4P5Y A;  4SBV A;  3WF4 A;  4AAP A;  3BPS A;  1BEV 1;  5EFU A;  3TEX A;  5F3G A;  4TSV A;  5F3E A;  5CFC C;  5GZG A;  1LR5 A;  3EQE A;  4HPK A;  4A2U A;  4GXL A;  3E5U A;  4FOW A;  2GC0 A;  3RFR A;  5IHR A;  2JJ6 A;  3RJR A;  3RWK X;  2WNE A;  3GHN A;  4A6O A;  4NHL A;  4CDX C;  1C3H A;  2ENR A;  4RR3 C;  1AJK A;  2HWC 1;  3MW3 A;  4QX1 A;  1I1E A;  4CP1 A;  4RFR B;  3U4S A;  2W2I A;  3RS6 A;  2ZMN A;  1CWP A;  4OCT A;  3ZLI A;  5JXJ A;  4XBN A;  4CP2 A;  3BOP A;  4DY3 A;  5EHD A;  3WNL A;  1JYV A;  1XE0 A;  1RHI 3;  3EHK A;  5I93 A;  1FNZ A;  1MZF A;  5HCB A;  1XND A;  4FOY A;  3T2O A;  2YDE A;  3ZOI A;  1YEW A;  1AX1 A;  1RXF A;  1VBB 2;  1MZ5 A;  2ORX A;  5T3N A;  2ZGP A;  3JUU A;  3MI8 A;  4Y3O A;  1S0F A;  1OLQ A;  3FFQ A;  2MEV 2;  1SCR A;  2PQQ A;  3M4F A;  1RUH 2;  3B9I A;  3PUQ A;  3FZ3 A;  2CYF A;  4IEO A;  5FZ4 A;  3NST A;  1HDK A;  3PNA A;  1W03 A;  5K0U B;  5DAW A;  3SKJ E;  3VBU A;  4Y4R A;  2WN2 A;  4D7T A;  4QQO A;  1X9P A;  1X9T A;  5C5T A;  3HOB A;  4H2A A;  2EXK A;  3GBF A;  1O6U A;  2C9A A;  3J9S A;  3TYJ A;  4CCM A;  1J59 A;  1W05 A;  4WVZ A;  2ZML A;  2PYT A;  3TAY A;  3C7H A;  4K40 A;  2WLQ A;  2J1U A;  1C28 A;  1R1A 3;  4PLM A;  1APN A;  1D2S A;  3ZN4 A;  5F1R A;  4S2H A;  1GLH A;  4HK8 A;  2VUJ A;  3WDV A;  4PIZ A;  4AI3 A;  2FDI A;  2W46 A;  2D43 A;  1AX2 A;  1JU3 A;  1W6O A;  3AYE A;  4IE4 A;  1QH6 A;  3AKS A;  4AG4 A;  2G9Z A;  1AX0 A;  2A73 B;  3HBZ A;  1TQ5 A;  2GP5 A;  3ILR A;  2GNT A;  1ND3 B;  1AHS A;  2VUD A;  3THT A;  2VY0 A;  3AMQ A;  5LY1 A;  2WNU B;  5A80 A;  2PAM A;  2WKK A;  1BMV 2;  4H14 A;  1ASJ 3;  2E32 A;  3VBO B;  4ATE A;  2C9K A;  1EPW A;  4NUB A;  4UYB A;  4P9G A;  1QXR A;  1SLL A;  1PO1 2;  4DIQ A;  1HN0 A;  4PLN A;  3HAG A;  3O1P A;  1NT0 A;  1TME 2;  4GMP 0;  3K3N A;  3WQB A;  3KHB A;  3ZYF A;  3IMN A;  3LEM A;  5TSW A;  4CCE A;  1Y7B A;  2WUH A;  5FZM A;  1TZO A;  1R08 3;  2VQ0 A;  5FZO A;  3FHI B;  1QQP 2;  2HWD 2;  4A41 A;  1CES A;  4HN1 A;  4YZ3 A;  1PO2 3;  4YG6 A;  1VIW B;  4YZ1 A;  2YZ4 A;  1OH4 A;  1JOJ A;  1R09 2;  2WFP A;  3ES1 A;  3J7L A;  4QU2 A;  4IV3 C;  2BVV A;  5HXV A;  4Z1V A;  5BV6 A;  1W06 A;  4XUQ A;  5DMY A;  1PZ8 A;  4UW3 A;  4BOW A;  1W8W A;  3RMX A;  3WSO A;  3PDQ A;  4TZD A;  2E9Q A;  3OGR A;  3TRS B;  3AYA A;  2BFU S;  4JHZ A;  3SEP A;  3TEW A;  2WO1 A;  5C4W B;  1RC6 A;  1U5X A;  4IL7 A;  3DYP A;  2KR2 A;  2ZGL A;  5DN2 A;  5A7N A;  5KHH A;  4AEJ A;  4ZS3 A;  5C9A C;  3OUJ A;  2IXH A;  2P2K A;  2XVK A;  2H6C A;  5BUV A;  4IDZ A;  2NQY A;  1HV1 A;  4PIY A;  5JCT A;  1RUI 3;  3DPR C;  5C8W A;  2IXL A;  1XU2 A;  2QDR A;  3HVD A;  3ZDV A;  4RQP C;  4ZU4 A;  4EWA A;  1MS4 A;  2L9L A;  3ZVX A;  1RUG 3;  3E97 A;  3MIE A;  3ZIW A;  1LAJ A;  1EYB A;  2WAA A;  5EXO A;  5FK8 A;  1JOP A;  3JBG 2;  3Q8B A;  2B7Y A;  1OVS A;  2A6Y A;  4IND A;  2VZ3 A;  5A7W B;  1NE6 A;  2VBP A;  3POS A;  4Y1Z A;  4O9E A;  4H7M A;  5A3O A;  5FWJ A;  3VBS B;  2ZTN A;  5F32 A;  5FY7 A;  4AVB A;  1LED A;  1W3V A;  4MHR A;  4ZKT B;  1HXS 3;  2AEZ A;  2CDO A;  3OOX A;  1YFU A;  1C8M 2;  5AFB A;  2ARC A;  4EN0 A;  1GZW A;  4YGC A;  1O59 A;  2BDR A;  3AXD A;  5A7Q A;  5T54 A;  1KFU L;  3CJI C;  4DRV A;  2ZX2 A;  3LE0 A;  1W8N A;  1MR5 A;  5IUQ A;  4EN8 B;  5CFC A;  2GH8 A;  3VBU B;  1AYM 2;  4QHO A;  4NID A;  1Y9G A;  3WDX A;  3EJK A;  1E5I A;  3PU8 A;  4LTA A;  1AR7 3;  4Q4Y 2;  3Q8F A;  1NYW A;  1JHN A;  2EAL A;  2VW0 A;  2CGN A;  1QMJ A;  1DYO A;  2WSV A;  1W9W A;  1OF3 A;  3OBR A;  1ULO A;  2QBX A;  2FDJ A;  3AMH A;  1V9U 2;  2VW2 A;  2BEO A;  4I02 A;  4ES9 A;  2VEC A;  4C0H A;  2DUR A;  5E16 A;  1W6O B;  1AL0 G;  3M7A A;  5EYY A;  2WZP P;  4MG2 A;  5LBE A;  2Y64 A;  4CUG A;  1AL2 3;  4C1X A;  4J1X A;  4IEY A;  1J84 A;  1AR6 2;  2D44 A;  2UWB A;  5FV3 A;  2VE1 A;  4LIU A;  1S0B A;  1FX5 A;  4YG3 A;  5ERL A;  5GZE A;  4KWK A;  1L7L A;  4BXF A;  4P02 B;  2QQN A;  1F4A A;  2XML A;  4MX3 A;  2WII B;  1YWK A;  4Y5Z 0;  1GZT A;  4G4F A;  4BQ5 A;  5ISL A;  1MS8 A;  3IWZ A;  4LE3 A;  5FZ9 A;  4CRQ A;  1OA2 A;  4MZU A;  1WUV A;  3LOI A;  4RN5 A;  4B4P A;  2ZPX A;  2W95 A;  3VD5 A;  1ALY A;  2A6W A;  5DZF A;  1RGS A;  4M3C E;  3CLP A;  2RMU 2;  3DGT A;  3UKT A;  4CCJ A;  5FZO B;  4N53 C;  2BGP A;  2ZGM A;  4M3C F;  5A1A A;  1WW5 A;  2I74 A;  2OA2 A;  2QZ3 A;  4W6W A;  2YB7 A;  3H7Y A;  3MFA A;  2DUQ A;  2CTV A;  3ZYP A;  3T2Q A;  3HPN A;  1H6X A;  2JD9 A;  4JKM A;  4QPI C;  3LSD A;  4DUV A;  3I2D A;  2PHR A;  5JR7 B;  5F5A A;  2QVS B;  1GQH A;  1BJQ A;  2DVF A;  3DKW A;  3ZYJ B;  4COZ A;  2Q8O A;  5FZC A;  1NOV A;  1Q43 A;  2WDB A;  3S7I A;  1TNF A;  2VOW A;  3D0J A;  2GSY A;  1W6N A;  2Y33 A;  3RI8 A;  5CKN A;  2JDU A;  2ZXQ A;  4V1P A;  3ZXL A;  4RL7 A;  1UYY A;  3TNQ A;  1S55 A;  1BBT 2;  1W39 A;  2A6V A;  2PHT A;  2YGL A;  5AVA A;  5LWB A;  4FPC A;  2NZ9 A;  4KL1 A;  3WDT A;  1H2N A;  5A32 A;  1M4W A;  5F5C A;  1G9D A;  1QJY 2;  3MW4 A;  5E89 A;  3J8F 3;  2Z69 A;  2UWC A;  1UZ0 A;  4L0P A;  1WBL A;  3D3A A;  1D4M 2;  1YQ8 A;  3WZ1 A;  2RDQ A;  1OQD A;  2C6S A;  2UU8 A;  2BOJ A;  3POY A;  4IV3 A;  4RHV 1;  1XC6 A;  3CBN A;  1ZX5 A;  3I2I A;  4UFL A;  1HX6 A;  1X8E A;  3KB5 A;  2WZR 3;  5AC9 2;  2Z42 A;  3ZFF B;  1GP6 A;  1GZW B;  1VBD 2;  3HR9 A;  4NVP A;  2Y8K A;  3JB8 A;  3PJQ A;  5CFC B;  1V6M A;  5GAL A;  2BGO A;  2FMD A;  3UKN A;  2XWB B;  3O14 A;  4FCA A;  3TNP B;  1ULP A;  4AAX A;  2D3R A;  3DPR A;  4CDX B;  4RR3 B;  2RJ2 A;  3THC A;  1K45 A;  4UBG A;  4RQP A;  4DFS A;  4NHM A;  2ZEZ A;  5I0D A;  2ZEW A;  4PT6 A;  3U11 A;  1ZNP A;  3FHA A;  3HMY A;  1VB2 A;  3NAP A;  4ZXE A;  3WDU A;  4LT5 A;  3LEG A;  2ZZJ A;  1Y3T A;  2YYO A;  5LAS A;  3BB6 A;  2CHH A;  1VBB 1;  1RIT A;  1UIJ A;  3POF A;  4N43 B;  1J1L A;  2XL7 A;  3OB8 A;  3MUY 1;  5C6C A;  2MEV 1;  5I0R A;  1RUH 1;  2RR1 3;  1KEX A;  1MS5 A;  2RS3 2;  4Z07 A;  2RE9 A;  2ET7 A;  2ZA9 A;  5JIA A;  1WME A;  3CJI A;  1SFP A;  2J1T A;  2X8K A;  2Y6K A;  4P9X A;  5GZF A;  3GM8 A;  3FMG A;  3R4D B;  1JOD A;  4KG0 A;  4YZ5 A;  1A34 A;  4YGE A;  4YM1 A;  2HEY F;  2OT7 A;  2QQM A;  3H1Y A;  2X5I C;  4YLZ A;  3URF A;  2DV9 A;  4TXW A;  1ZRE A;  2BZD A;  1RUF 3;  1LGC A;  3OYW A;  2VMI A;  5C3R A;  4MYE A;  3VHN A;  2QQU A;  5LA9 A;  1VAK A;  3AL6 A;  3K48 A;  2KD7 A;  3MIF A;  4YYO A;  4AFA A;  4IGP A;  4CP9 A;  1FMD 2;  1QKQ A;  3VBF C;  5FFO C;  2VQA A;  1QXJ A;  1F31 A;  4CXW A;  4OVE A;  2DVB A;  4EZH A;  2HWE 3;  2E51 A;  1ZRI A;  4HZF A;  1POV 0;  2P3J A;  2YGM A;  3AMM A;  1BMV 1;  3AZW A;  3T4V A;  3S0M A;  4CU7 A;  5FZE A;  1CZV A;  1N1S A;  1IGO A;  2A7A A;  3ZSK A;  1W6N B;  1W0N A;  3CDZ B;  1PO1 1;  3D82 A;  1US2 A;  3NJV A;  4YW5 A;  3VD7 A;  3MFC A;  1TME 1;  4PI0 A;  2JE8 A;  2Q1Z B;  3D0S A;  4I0A A;  4QDQ A;  3N7J A;  1WLW A;  1RUJ 2;  2WZ8 A;  4GWI A;  2MHF A;  3KT4 A;  1UPS A;  1S0G A;  2RS5 3;  4JRL A;  4P00 B;  5LK5 A;  3WDY A;  4Q8K A;  4ZU7 A;  5IVV A;  1W28 A;  3ZX7 A;  1QQP 1;  2HWD 1;  3MPB A;  5EZW A;  3HJR A;  4I01 A;  4N53 A;  3MUZ 1;  2WN3 A;  5ANQ A;  1SDW A;  4KWU A;  2XUE A;  2NMN A;  1R09 1;  3U0Z A;  4K21 A;  4QPG C;  4QPI A;  5CYY A;  1XSR A;  5C8C B;  4JDO A;  4PLO A;  4CYD A;  5KXC A;  5A6Z A;  2ZGN A;  4XF9 A;  5GKA C;  2PFW A;  3M3O A;  3RZK A;  2GNM A;  2Y26 A;  2R6Q A;  1I5Z A;  5C70 A;  1MZE A;  5JSP A;  3U75 A;  1CX1 A;  5C9A B;  4K9S A;  2BRT A;  4BQ2 A;  1RUN A;  3KGZ A;  4BM8 A;  4QQH A;  1ULG A;  5A3N A;  2F4L A;  1PNG A;  3DPR B;  4XJ8 A;  2WO2 A;  3B9C A;  1LOF C;  4RQP B;  5BNP B;  2AYH A;  3R4S A;  4XAA A;  1ZVF A;  3JBG 1;  3M2M A;  1Z7S 3;  4AVS A;  1C8N A;  3B7M A;  1JI6 A;  2VMF A;  3RWN A;  1DGW A;  4AEK A;  4CCO A;  1RVF 3;  3E6D A;  4GAZ A;  4HK9 A;  2YBP A;  1GOF A;  3VBH C;  3ES4 A;  2Q5T A;  3A21 A;  3O1U A;  5BNO C;  2RS1 3;  2B46 X;  2QZ2 A;  2GN3 A;  3AZZ A;  4LO4 B;  2BFU L;  3M70 A;  4NJ4 A;  3IDA A;  2WWJ A;  2KM2 A;  2R0F A;  1U0A A;  1KJL A;  2FHR A;  4RA0 A;  1AYM 1;  4MLO A;  3OGJ A;  3KD4 A;  2G4I A;  1QJE A;  3JQW A;  2LM3 A;  2XLF A;  2R49 A;  1VLN A;  2BBA A;  5A1F A;  1XJA A;  4AHW A;  5C3P A;  4Q4Y 1;  1TG7 A;  3SCH A;  1AXK A;  4AGG A;  1GNZ A;  1W99 A;  1UMH A;  3NKG A;  1C4R A;  4LUM A;  5E6H A;  1FOD 3;  3DUI A;  1COV 2;  2VNV A;  1CPN A;  4UW4 A;  3DYO A;  3OYW B;  4PJY A;  3NKT A;  1V9U 1;  3USU A;  1JUH A;  4I0W B;  5T5J A;  1Q3E A;  2ZHK A;  4S2D A;  5FKB A;  4CP9 B;  5FIX A;  1Q5O A;  4Q26 A;  1EPZ A;  3D4K A;  4M3C A;  4IQP A;  3NMB A;  5A3U A;  3DXU A;  2D6M A;  4XBQ A;  4HVO A;  1Y9M A;  2UY8 A;  4RD7 A;  4CZS A;  1NX9 A;  1AR6 1;  1QOO A;  2WA4 A;  2NMO A;  3ETP A;  3KT1 A;  4JDN A;  5KC5 A;  2IUW A;  2LW8 A;  4KWJ A;  2EAA A;  4JQR A;  3HNY M;  2D6K A;  2DCT A;  3III A;  3ZXK A;  2UUR A;  4EN7 B;  2CWM A;  4LO8 A;  4BK4 A;  4ZON A;  1GBG A;  5EJ1 B;  4XYX A;  1YQ6 A;  2VVE A;  2XJV A;  4V2W A;  4AGR A;  2G19 A;  4BE3 A;  3I2O A;  2X5I A;  4LBL A;  2RMU 1;  3SC7 X;  2XJT A;  3AVR A;  4YVS C;  3G7D A;  5HV0 A;  2FDG A;  2QQO A;  2CSG A;  5GJ6 A;  1DGW X;  1BEV 3;  2ADE A;  3POG A;  4OQ8 A;  5BPX A;  2EIB A;  1DZQ A;  1US3 A;  3WNO A;  4QPI B;  1K5M B;  3RYP A;  4FPL A;  3NNL A;  3R0R A;  1OPO A;  1DFQ A;  1RB8 G;  1VRH 2;  4GA9 A;  4LHL A;  4CXY A;  1ZRF A;  3BVC A;  4MGS A;  2R04 2;  3MF6 A;  5J48 A;  3K4D A;  3RZJ A;  4XF1 A;  2FD8 A;  2LUW A;  5FDB A;  1OOP C;  4YZ4 A;  1VPH A;  1W2N A;  3OF1 A;  3WLU A;  5FPX A;  2WYF A;  3OEB A;  2ES3 A;  4L8Q A;  1QF3 A;  3LZZ A;  5FXW A;  3MZH A;  1BBT 1;  2JX9 A;  3TWI A;  5HCA A;  1MVQ A;  4NII A;  1GWK A;  3VBO C;  5C3S A;  4JAA A;  5EJZ B;  2OS2 A;  1QJY 1;  1VP6 A;  4Y1X A;  3WP5 A;  1ZBE 2;  2Y6J A;  5LW9 A;  1F4H A;  1LU2 A;  5DDJ 2;  3ZSM A;  2BPA 2;  4QM8 A;  2RG4 A;  1D4M 1;  1WD3 A;  4M4R A;  3E5Q A;  3NNG A;  4UFK A;  2VR4 A;  3N36 A;  5C7G A;  1W6Q A;  3C7G A;  2DFC A;  3AZV A;  1E5H A;  1N47 A;  1NLS A;  5HI0 A;  1HLC A;  1FV3 A;  4NN0 A;  4A7Z A;  3Q8E A;  4FFI A;  2ZAB A;  4XUR A;  2VGD A;  3WP3 A;  5AC9 1;  5FP3 A;  1DLL A;  3KM5 A;  2SLI A;  4XIL A;  3D5O A;  1VBD 1;  3SIT A;  1ST8 A;  4CCK A;  4N90 A;  5D21 A;  3M3I A;  3VZM A;  2XL9 A;  1NY7 2;  2JDA A;  4C1W A;  1SEF A;  2D5F A;  5JUV A;  1SG3 A;  2EAK A;  1WCU A;  3U10 A;  3FUQ A;  3HT1 A;  4QXC A;  4JDM A;  4H55 A;  1RUD 2;  5J3U A;  3UKV A;  1H8V A;  2HLE A;  3H8R A;  4DMI A;  2Q1M A;  3ZR5 A;  1LEC A;  1LOF A;  3QH6 A;  5APA A;  2WWS A;  3C8X A;  2DYC A;  3ROU A;  3AXE A;  1QOT A;  2XLG A;  3USU B;  1HRV 2;  1JS9 A;  5FOJ B;  5FTT C;  2OII A;  3VHP A;  1HV0 A;  4WZF A;  4XAB A;  4AK3 A;  4ZZ8 A;  3CF6 E;  3K3O A;  4FTE A;  1MEC 2;  4BJ0 A;  3H3Z A;  3KV4 A;  3HBK A;  1OUS A;  3MV0 1;  4M3C B;  1GOH A;  2WSU A;  3T08 A;  3EB7 A;  4UFI A;  3VBH A;  3K4A A;  1OXC A;  3GHM A;  5BNO A;  4JTO A;  1NZI A;  4OUM A;  2RS3 1;  3J7N A;  1F8V A;  1STM A;  3I2G A;  1CJP A;  3FE5 A;  3ENR A;  4IE7 A;  5E1R A;  3WF2 A;  4BQX A;  3BIE A;  1OLM E;  1GP5 A;  2DCK A;  3FUO A;  2VCA A;  2EXJ A;  2JEM A;  1CJD A;  2OUJ A;  3GZU C;  2O8O A;  4W8J A;  2X5I B;  2ZAA A;  4R52 A;  1N3Q A;  1WMF A;  3M3C A;  3V0A A;  1AYN 2;  2A3W A;  3J7M A;  5IVC A;  3O1S A;  2VXJ A;  1H1M A;  5FZK A;  1FMD 1;  2B42 B;  1XYO A;  2DUO A;  4HN0 A;  1HRI 2;  3FLT A;  3UYJ A;  3VBF B;  4O65 A;  4R4X A;  1X33 A;  5JWP A;  3RZM A;  2VNR A;  5CBL A;  3BU0 A;  4PI2 A;  1V6J A;  1W6P A;  4R9D A;  3D8C A;  3OGS A;  4LIT A;  5CA6 A;  5K7P A;  1DQ4 A;  1DGR A;  1JZ3 A;  4YW1 A;  2HEV F;  4CU8 A;  1UPI A;  1WA4 A;  2RJL A;  4WVM B;  1HN1 A;  1UIK A;  3MF9 A;  3AMN A;  5HV4 A;  1B35 C;  1RUJ 1;  4EE2 A;  3IB3 A;  4EN9 B;  4YM3 A;  2VOT A;  1G7Y A;  4XUT A;  1Y43 B;  1OVP A;  1LHW A;  4QXK A;  4GWJ A;  1KDM A;  1QU0 A;  4L99 A;  3KCY A;  4YW3 A;  1QDO A;  1LES A;  4ZU5 A;  5FYU A;  3GZA A;  3LFI A;  1W6Q B;  2R07 2;  3IAQ A;  4MGZ E;  4IEU A;  4S2F A;  5FPA A;  1SLC A;  3APB A;  5B4X A;  4D0Q A;  4E9K A;  3VZN A;  4K8F A;  5A3L A;  4QPG B;  4YSF A;  5KXD A;  5C3Q A;  4FAG A;  3IAP A;  2W3J A;  4MGK E;  1AF9 A;  3QAC A;  3C7O A;  1OOP A;  3TB0 A;  2VZU A;  5IVE A;  1LOB A;  3GXU A;  1G9A A;  1QJU 2;  1BK1 A;  3OUH A;  1KS4 A;  2UYB A;  3CL1 A;  4FPY A;  1ND3 A;  4YM2 A;  1W04 A;  5GLZ A;  3N9P A;  3QCW A;  2VAU A;  4EYU A;  3AYD A;  1V00 A;  3DCQ A;  4X6Q B;  3VBO A;  5IK8 A;  5FY8 A;  1UY1 A;  5FMB A;  3B93 A;  3M8L A;  1JZ2 A;  3V0B A;  2DU1 A;  3Q8C A;  4LIV A;  4EQV A;  3DYM A;  2AEY A;  2GC1 A;  2CNA A;  2XJQ A;  1L7R A;  4E27 A;  4P9L A;  4MGY E;  4R8H A;  2J1R A;  3AKP A;  1JYX A;  1OD5 A;  1O7F A;  1NCQ B;  1UOG A;  2Z5W A;  3N35 A;  4PF1 A;  3WP4 A;  1NAE A;  3WW3 A;  4QD2 A;  2WO7 A;  2ZGS A;  1OUX A;  3RZH A;  2DCY A;  3AFG A;  5BNO B;  1W9Y A;  1L3J A;  4YNI A;  1FAT A;  4KBB A;  3PME A;  4OUS A;  4AR2 A;  3UES A;  5FLI A;  3H1M A;  5JPM B;  2FCU A;  3NWK A;  1UZV A;  3ZFF C;  5C4W A;  1CQ9 A;  3U14 A;  5F9T A;  3E6B A;  3AJY A;  2D97 A;  2NPI A;  1EAH 2;  4OUE A;  3RI9 A;  1YIF A;  1COV 1;  3NRU A;  1H30 A;  5E8A A;  2Z2S B;  4DQA A;  1UOB A;  1ACC A;  5JLV A;  5JOZ A;  3V0A B;  2OXB A;  4BU2 A;  2XKP A;  2YV8 A;  3H9A A;  3OD0 A;  2D3P A;  3OBZ A;  2NLR A;  3LDB A;  4AYU A;  5IT6 A;  4YW6 A;  1IS5 A;  5H9Q A;  3THD A;  1IQD C;  1LNS A;  1W6P B;  3AMP A;  2JDZ A;  5A7W A;  3I7D A;  3I3E A;  3WNN A;  4ASK A;  1S2K A;  4JTN A;  1K42 A;  3OBT A;  5LA1 A;  3VBS A;  1DZR A;  1ZBA 2;  3OPZ A;  4XF4 A;  4IE5 A;  4N43 C;  3RYR A;  1F35 A;  3LQC A;  1SBE A;  4YGB A;  4QB6 A;  2P37 A;  1D0H A;  4XFI A;  2W0X A;  3BTA A;  5FYB A;  3DEC A;  2W9X A;  4K1Z A;  2WR9 A;  4JHT A;  1W0O A;  5LBF A;  3I2H A;  3TN9 2;  1ZRD A;  2D6O X;  4Y1Y A;  4RHV 3;  2JXA A;  3CEW A;  1GWL A;  1OSG A;  2CWS A;  4YVS B;  2XJR A;  4FP2 A;  4IW3 A;  2XHN A;  3O1O A;  1JU4 A;  2WBK A;  1U12 A;  1VMF A;  4AQS A;  2VTF A;  1A8M A;  1DQ1 A;  4XJ9 A;  5JI7 A;  5F37 A;  1G8W A;  4E4H A;  4WZC A;  4COU A;  5C33 A;  1DQ5 A;  4NHX A;  3ZXD A;  2YRO A;  1VRH 1;  1VBC 2;  2VMC A;  4I30 A;  4QQP A;  1LOE A;  5IYY A;  4LKF A;  1YIP A;  1MQT C;  2R04 1;  2SBA A;  1WA6 X;  2TBV A;  3Q9O A;  2ET1 A;  5FYM A;  4GWN A;  4IEV A;  4DB5 A;  1OOP B;  3L2H A;  1TMF 2;  1LOD A;  2DBN A;  3N9O A;  4QM9 A;  1QGL A;  5IVF A;  4O61 A;  3PUA A;  3FC0 A;  2P1B A;  4A42 A;  2W39 A;  3WNP A;  1B35 A;  2HYK A;  3O5S A;  1CN1 A;  2Y6G A;  2EXH A;  1Q8S A;  1VBB 3;  1ZBE 1;  2VBB A;  3LFM A;  1NE4 A;  5DDJ 1;  1UU6 A;  2P34 A;  3V0B B;  2CAU A;  2O1Q A;  2FDF A;  1GNY A;  3BYW A;  1YI7 A;  2MEV 3;  3MYX A;  3X29 B;  5L7O C;  1RUH 3;  5IK4 A;  2XPJ A;  4DO0 A;  1NCR C;  4P9Y A;  3VKO A;  2OQ6 A;  1IG0 A;  1VAM A;  2JKX A;  3CNA A;  4LO6 B;  5FBJ A;  5FUN A;  1QHD A;  1WW6 A;  2YBK A;  3V64 A;  5G05 L;  2LRP A;  3DKQ A;  3MO4 A;  3RMY A;  4D69 A;  1JZ7 A;  3BCW A;  4EWD A;  5JSO A;  1OUR A;  2YY1 A;  4XJU A;  2FMY A;  2ZKL A;  1LOG A;  4GKX A;  2FCV A;  1NY7 1;  2AR6 A;  3I3Q A;  3FJS A;  1OLR A;  2DVA A;  5C8C C;  1QIQ A;  1QH7 A;  5FPL A;  1SDD B;  2H0V A;  3ZYH A;  2WZE A;  3HQX A;  5HPO A;  2XDV A;  1RUD 1;  2UYA A;  4FP3 A;  3ZM8 A;  4XHB A;  1DIW A;  2X05 A;  3ZPO A;  3TOJ A;  1CAW A;  4XZU G;  1KIT A;  4XFG A;  5J98 B;  4D3W A;  2RV9 A;  2B45 X;  3LEI A;  2F6B A;  5C3O A;  4MVT A;  2UWA A;  4A3Z A;  1HIX A;  2ERF A;  1OLM A;  4N7U A;  2YU1 A;  1QNY A;  1BK0 A;  1HRV 1;  1O5U A;  5IAX A;  5I8Y A;  4Y24 A;  1DYP A;  4LKD A;  4QGN A;  1E5S A;  4K6B A;  1MEC 1;  2W68 A;  3MV1 1;  5BNP C;  4HON A;  2RDR A;  3MID A;  5LY2 A;  1YLL A;  1PO1 3;  4ISQ A;  1MZ6 A;  1O8S A;  3O7O A;  4WM8 C;  4HVQ A;  1AR8 2;  3WCR A;  1QNW A;  1TME 3;  3OCP A;  4LHS A;  1ZZC A;  2CL2 A;  2YC2 A;  5KHJ A;  2WNO A;  2WA3 A;  4JVA A;  1CR7 A;  2V72 A;  5FYS A;  4FQZ A;  2QDN A;  3IPV A;  4QHZ A;  2E7T A;  1QQP 3;  4NWV A;  1NA1 C;  5KXE A;  2ZGR A;  5FMO S;  1H6Y A;  1V6I A;  1GAN A;  3LIH A;  3ZFF A;  1R09 3;  4BXS V;  5A3M A;  5A70 A;  4XF3 A;  3MHZ A;  2C24 A;  2DCZ A;  1KJR A;  3OEA A;  5F39 A;  5E88 A;  1HQL A;  1AYN 1;  1DU3 D;  3H8U A;  5DAB A;  2VU9 A;  3ZYB A;  3ASI A;  1BKZ A;  1UOF A;  1AL2 2;  4L97 A;  4CDX A;  2XJS A;  1HRI 1;  4MXV A;  1OKO A;  2ZOE B;  4RR3 A;  4A45 A;  1PM7 A;  1S4C A;  3VKN A;  5FR3 A;  4TTG A;  5CIS A;  4BZ4 A;  4YGD A;  2VVD A;  1W8Z A;  3BU7 A;  1ULC A;  3DXT A;  4YWA A;  2ZBJ A;  2PHU A;  1SHW B;  1X82 A;  3IDE A;  2KA3 A;  3VZO A;  2AC1 A;  2BOI A;  4N7I A;  1W2T A;  3HWJ A;  3IMM A;  1V70 A;  1YUD A;  4N43 A;  3JBG 3;  1XB9 A;  3C2U A;  2I2S A;  4J25 A;  3RQ0 A;  3T30 A;  4AZZ A;  3NNM A;  3R05 A;  4OHX A;  1B35 B;  1S0D A;  4XZP A;  2BNN A;  1UY4 A;  3KCX A;  2K0G A;  1EUU A;  3N9Q A;  1ENQ A;  5FZ1 A;  2C5D A;  2JDP A;  4QX7 A;  4JKL A;  4Y5T A;  1UN1 A;  4UOJ A;  5BNN C;  2BJS A;  4GWM A;  4QX8 A;  4R4Z A;  5EIY B;  4QQL A;  2R07 1;  2WQ4 A;  3A0N A;  2HYX A;  1VAL A;  2YU2 A;  4QWN A;  5F5Q A;  1RMU 2;  2GZW A;  2HWB 2;  2VOV A;  4AF9 A;  1AYM 3;  1A8D A;  1JTZ X;  1KDK A;  2A6Z A;  2HWF 2;  3GJB A;  1JYW A;  2VQU A;  1EV1 3;  2PLV 1;  4PDW C;  2Z79 A;  3ZMO A;  2ZGQ A;  1W8U A;  1CZT A;  3SH4 A;  1MQT A;  5GLU A;  1ZA7 A;  1SFY A;  4Q4Y 3;  4B1M A;  3KQ4 B;  1QJU 1;  4QKF A;  1DGL A;  1K5M C;  5IW0 A;  4Q4W 2;  5KXB A;  5ABJ B;  4P9I A;  4B8E A;  1W8F A;  4ARY A;  1V9U 3;  4CU9 A;  5FYV A;  5B4N A;  1FXZ A;  1NXD 1;  3DF0 A;  1XRU A;  4MGI E;  4P14 A;  1CAW B;  1WWY A;  2WLP A;  5I8S A;  2VXR A;  4HSJ A;  4YW2 A;  1LGB A;  4LA3 A;  3O1M A;  4Q4X 2;  3VZK A;  3VKF C;  1NZC A;  2EF6 A;  4P9J A;  1AR6 3;  1NLR A;  3GBW A;  1MS9 A;  3R6S A;  4BPZ A;  1NCR A;  3CKH A;  5C71 A;  2J1A A;  4IUG A;  5EWS A;  2PHL A;  1IPK A;  1XNK A;  3IDC B;  4GB3 2;  1JZ8 A;  1Q56 A;  1MS0 A;  1GYK A;  2F17 A;  4LEJ A;  3PVE A;  2HBT A;  4JX0 A;  1YYN A;  4M00 A;  4NOT A;  1HQN A;  5C8C A;  2HEW F;  4V2V A;  2RMU 3;  3IPV B;  3RZZ A;  1S0J A;  2BNM A;  3WR0 A;  4E4Z A;  3H8X A;  4DZG A;  3LEK A;  5DUV A;  2JE7 A;  3WP6 A;  2ZHM A;  1WD4 A;  1WCQ A;  2B4K A;  2V5D A;  4MHU A;  4MAD A;  4A44 A;  3ZKU A;  1W2U A;  1AXY A;  1EAH 1;  1WCD J;  4IEP A;  2VTX J;  2YXS A;  4XCB A;  5FZI A;  4DXR A;  5JOY A;  3NJZ A;  4DXZ A;  2PTM A;  4W6X A;  5JOX A;  4Y33 A;  3ORJ A;  4AVV A;  5C9A A;  1OF4 A;  4M0N A;  5FZH A;  4XQ4 A;  2WC2 A;  3B69 A;  1IPJ A;  2A3Y A;  2C0Z A;  2VM9 A;  1QY4 A;  3HQR A;  3N7L A;  5LB6 A;  1DDL A;  2BYV E;  2BNO A;  3NV1 A;  5BNP A;  1SAC A;  1W9S A;  1G9B A;  3KVB A;  2MNG A;  2PHW A;  1JW6 A;  4FPO B;  4XFC A;  4WM8 A;  1BBT 3;  2IXK A;  4GAL A;  1SFN A;  4XFB A;  1RUE 2;  5LA2 A;  4HMZ A;  4UFJ A;  3ON7 A;  1XSQ A;  4FFG A;  4AFB A;  1ZBA 1;  2GNB A;  1CAV A;  1QJY 3;  2GH2 A;  2Y34 A;  4LO7 A;  4EV0 A;  2VOK A;  2PHD A;  4BLI A;  3ZFE C;  4IET A;  2J42 A;  2W52 A;  2WL1 A;  1I3H A;  3UGH A;  1NA1 A;  2CAV A;  4ZXK A;  5F3C A;  1D4M 3;  4XHX A;  3TN9 1;  5FYY A;  5J96 B;  1JBC A;  4XJA A;  2E31 A;  1VBA 2;  3ECQ A;  5J1X A;  2VMD A;  3ACL A;  2BVB A;  5AC9 3;  5EJ3 A;  5IFT A;  4E2S A;  4DY5 A;  2RHP A;  3POJ A;  1VBD 3;  2RVA A;  2LS6 A;  3PHM A;  4IE0 A;  3VDC A;  3AP4 A;  2PAE A;  5L19 A;  3JU9 A;  3PU3 A;  4BQ4 A;  5KHK A;  1MAC A;  1VBC 1;  1ZRR A;  4PF5 A;  1H2K A;  3ETQ A;  1W6M A;  2ZS6 B;  2WAB A;  1IKP A;  1CAU B;  2ARA A;  4XDP A;  4U2A A;  1LB2 A;  3GZT B;  4A7K A;  3ZFG C;  1MQT B;  2OUH A;  2XGX A;  1TMF 1;  3OPW A;  5FO8 B;  1YQC A;  3CJX A;  4LOR A;  1KD7 A;  5CVR A;  3WNM A;  3ZXF A;  3T0D A;  1YXW A;  1H0B A;  1UOJ A;  2YFZ A;  4PCR A;  1F5J A;  2G9G A;  4LBO A;  5FP8 A;  5FZG A;  1IZ3 A;  4Q4V 2;  5D2A A;  2XBO 2;  5A7S A;  3IN9 A;  3WG2 A;  4FPH A;  4RGA A;  5EPA A;  5A3W A;  2Q1F A;  3H8O A;  5IK7 A;  2IFW A;  4OI4 A;  3AVS A;  3GYD A;  3FLR A;  3J4U H;  4AVT A;  1DQ2 A;  2WT1 A;  3IDB B;  4FPK A;  2R30 A;  3GJA A;  3WVJ A;  1JOB A;  1VB4 A;  5BNN A;  3CU7 A;  1A3K A;  2RS3 3;  1Q8V A;  5L7O B;  4NMI A;  1TVG A;  4LUL A;  5FZA A;  1NCR B;  1G9F A;  1MS3 A;  2P4E A;  1QJX 2;  3W5M A;  1IG3 A;  1VMJ A;  3KVA A;  3LWC A;  4M01 A;  3NJY A;  4UBH A;  1PGL 2;  3JXS A;  1W2A X;  4DPN A;  3PUR A;  1ZZ7 A;  4PDW A;  4U36 A;  4N9I A;  2JG8 C;  3SKV A;  2ZAC A;  3KV9 A;  4UWD A;  4XW3 A;  3IT8 A;  1TE1 B;  2A6X A;  3KWV A;  1K5M A;  4HVR A;  1QJZ A;  3LD8 A;  4LHK A;  5IVJ A;  3K46 A;  1NG0 A;  5FXV A;  5FQ0 A;  1K5J A;  4DNY A;  1XNA A;  2VZV A;  4QT6 A;  3VHR A;  5FOB B;  1KXG A;  2XQR A;  1FMD 3;  1J83 A;  2WS9 2;  3BIW E;  1FPN 2;  3GGL A;  1XNB A;  5BYN A;  3AZY A;  2RM2 2;  5K4L A;  4AEM A;  2DUP A;  1PMH X;  5HBA A;  5JMC A;  4Z2A A;  5KR7 A;  1VR3 A;  1ULF A;  5ACA 2;  3TEZ A;  1LKN A;  1RUC 2;  2E53 A;  3GZE A;  5FZF A;  2RJK A;  5LCW L;  5DG1 A;  1AR8 1;  1AR9 2;  2IVJ A;  4IEW A;  4A6S A;  4AQ2 A;  4LBM A;  4WM8 B;  3AKT A;  1RUJ 3;  1UY3 A;  2JEN A;  2QFE A;  3QOP A;  4XTM A;  2Q8D A;  1UKR A;  5FJH A;  4AQ6 A;  4Q1P A;  4CCD A;  5JI9 A;  1NCQ C;  1CAV B;  3ACG A;  2ZGT A;  2JKB A;  1AJO A;  3POB A;  4LKS A;  4CVU A;  3I3M A;  1FV2 A;  4LMF A;  5A33 B;  5K8S A;  1NA1 B;  3LKJ A;  1SQ4 A;  2HH9 A;  1C8M 1;  2ID4 A;  1UWW A;  5J7M A;  4AHY A;  4PBO A;  2ARE A;  3SCG A;  1WMD A;  3B01 A;  1K12 A;  3PVO A;  1MPX A;  3R4U A;  4LR4 A;  3UGG A;  3I2K A;  3I3B A;  4AL9 A;  2Z4F A;  3RGB A;  1AL2 1;  3VDD B;  4COY A;  1UMZ A;  1JH5 A;  2FBE A;  2DVG A;  4LOT A;  4LLO A;  4OFG A;  4URT A;  3WG1 A;  3WV6 A;  4BA6 A;  4CEW C;  1YI9 A;  3EMR A;  1UQX A;  1D4V B;  4NIH A;  1ZZB A;  3VD3 A;  1W6M B;  2LTN A;  2X53 S;  4P9W A;  4D7Y A;  1ZZ8 A;  1GMM A;  5T50 A;  4QB1 A;  1TEI A;  1G6N A;  4DXS A;  1BVV A;  2CV6 A;  1UXZ A;  4B3N A;  1FNY A;  2WFF 2;  1DGR N;  3ZFE A;  3T4H B;  5FMO L;  4CU6 A;  3USS A;  1MVE A;  1UO9 A;  2D93 A;  4FO9 A;  4NIA A;  3VD9 A;  4PHZ A;  2FQP A;  3BUC A;  3GF6 A;  2JE9 A;  4Q0U A;  4LXL A;  2HJI A;  3SHR A;  4CEY C;  5DAQ A;  4IES A;  5BNN B;  4L9B A;  3MDP A;  1RMU 1;  5CG8 A;  2HWB 1;  4CUA A;  2DDU A;  1LUL A;  5LZ6 A;  2HWF 1;  2P3Y A;  3ST7 A;  2ATF A;  3W59 A;  1Q8Q A;  4LBJ A;  5EQU A;  3WQ7 A;  5IK5 A;  2DTY A;  3AJZ A;  4JKK A;  3JCI A;  4KNC A;  2ZEX A;  1REF A;  1T2X A;  4PDW B;  5FP4 A;  5JAX A;  3MPP G;  4FVV A;  4CSW A;  1H2L A;  2XHK A;  2AH2 A;  2UY9 A;  3B3Q E;  5J36 A;  3VBF A;  4Q4W 1;  4GIQ A;  5GM0 A;  2G1M A;  3B94 A;  1COV 3;  2ZMK A;  3I59 A;  2JD4 A;  3RYK A;  3QD6 A;  5FQ0 B;  1LJ7 A;  3H1W A;  3WUC A;  4KGQ A;  4ZPI A;  3WNK A;  4B7E A;  1PM4 A;  4HBN A;  2XR4 A;  2HWC 3;  4WVM A;  1O5L A;  5FUP A;  2I07 B;  4Q4X 1;  2GMP A;  2AUY A;  2OZJ A;  4HKO A;  4K7J A;  5DUU A;  4B7K A;  3ATG A;  1GUI A;  1HB4 A;  3H3U A;  4QU1 A;  4Q8L A;  4IGQ A;  1PZ9 A;  2GAL A;  4XUP A;  2V73 A;  1UX6 A;  3QBQ A;  1PIV 2;  3GCX A;  4XMA A;  1KFX L;  2VCC A;  4DEV A;  5CAZ A;  4GB3 1;  4NHY A;  3I97 A;  1YFW A;  3F95 A;  4JZR A;  1XU1 A;  5T5O A;  4E4D X;  4W6Y A;  1SPP A;  2JG8 A;  5JR2 A;  3VV1 A;  5IVY A;  3WDW A;  2E33 A;  3LA7 A;  5LRS A;  3RNS A;  4IEZ A;  5FY9 A;  1HJF A;  4JV4 A;  2ZZQ A;  4QPG A;  2OPK A;  4HSL A;  5F6K A;  4F7Z A;  3L9J T;  1BLZ A;  3T2P A;  1U5Z A;  4UF0 B;  4NR1 A;  1MS1 A;  2VZP A;  5FLH A;  4Y26 A;  2DVD A;  3LB9 A;  4XJZ A;  4GH4 B;  4IER A;  5FKC A;  3WW1 A;  1GSL A;  3BTX A;  4YRD A;  1VRH 3;  3A4U A;  2DU0 A;  3M1H A;  5FYC A;  5A1L A;  1NXM A;  2R04 3;  5DAX A;  5FY0 A;  4QHB A;  1GKB A;  4D7S A;  5T55 A;  1W8O A;  4BK5 A;  4YG0 A;  3ABZ A;  4L2N A;  3RDI A;  5FY1 A;  3QH7 A;  1RUE 1;  1RXG A;  4DOU A;  3BI3 A;  4OHY A;  2ORZ A;  1X7N A;  3I54 A;  3CHX A;  3ITQ A;  1RED A;  2R0H A;  5FPU A;  2DBI A;  1NCQ A;  1ZBE 3;  3H50 A;  4GJZ A;  5DDJ 3;  4RGK A;  3V56 A;  2VMG A;  3POE A;  3ZFE B;  3D6E A;  2E7Q A;  1SCS A;  1S0C A;  1H9P A;  4ASL A;  3N4M A;  1VBA 1;  3MW2 A;  3RVH A;  3JD7 2;  4ES8 A;  2GP3 A;  4LK6 A;  5FCC A;  4QQ2 A;  2ZEY A;  4YW4 A;  1VBE 2;  2GC2 A;  4HKW A;  1SLI A;  1ODN A;  2IXJ A;  2LAL A;  4CDW C;  4I2O A;  3I3D A;  5F6L B;  1O4T A;  1QXP A;  1XPW A;  3T09 A;  2Y6H A;  2VBD A;  4CEW A;  5L9V A;  1M06 G;  3NVC A;  1ZRC A;  2NM1 A;  2XH6 A;  3AL5 A;  3WEZ A;  4Z8B A;  3O1V A;  4Q0Q A;  4AI0 A;  1RUD 3;  2EIE A;  2PQS A;  2WYS A;  4FXK B;  4QB2 A;  4GMP 1;  4OI1 A;  2JIC A;  4FOQ A;  3ZFG B;  5CG9 A;  1UU5 A;  4AVC A;  1SBF A;  3CIH A;  3WQ0 A;  2EXI A;  3I59 B;  4KH9 A;  3PL0 A;  4WM7 C;  3RJ2 X;  3AFK A;  1HRV 3;  4Q4V 1;  2XBO 1;  4EN6 B;  3WOG A;  4QMA A;  5F8P A;  5SV8 A;  4FQ4 A;  1MEC 3;  1C5I A;  3KMH A;  1XNT A;  5A6Y A;  1UAI A;  3EBR A;  1UMI A;  1WBF A;  2J1E A;  4Q0P A;  3THP A;  1ZM1 A;  2HKX A;  4CEY A;  5DZE A;  4FFF A;  5FYZ A;  3VB9 A;  3NNJ A;  1NQJ A;  3DN7 A;  4CDU C;  4C90 A;  1QJX 1;  2ZGO A;  4ISR A;  4MH0 E;  2R06 2;  4NRO A;  1PGL 1;  4OHV A;  2VZR A;  4OUL A;  4YVS A;  2EVX A;  4IEX A;  5CZK A;  1UW8 A;  1I6X A;  3KLS A;  1QOS A;  3POW A;  4C91 A;  1SPP B;  3PUH A;  2JG8 B;  4C8D A;  1QWR A;  3AP6 A;  5LRR A;  1OPM A;  1N1V A;  3LDK A;  4LBQ D;  2GU9 A;  3HQU A;  4F83 A;  3LF7 A;  1AYN 3;  2TUN A;  5FJK A;  4MSV A;  2WS9 1;  4ASM B;  1FT9 A;  1FPN 1;  4P5H A;  1HRI 3;  4YZ2 A;  1UZW A;  2RM2 1;  3BN6 A;  4M0H A;  4AI9 A;  3VKM A;  4X8N A;  5ABJ C;  4KI5 M;  1GFF 2;  5D8A C;  4Y5S A;  2B5H A;  2ZJC A;  2WJS A;  4CPB D;  2W91 A;  5LK7 B;  4BHP A;  1V6O A;  1HB3 A;  1PNF A;  1O3R A;  1RUO A;  3ZN6 B;  5ACA 1;  2JIJ A;  1IS6 A;  5GZD A;  1RUC 1;  4H3W A;  1KQR A;  2QQL A;  1BCX A;  1AR9 1;  3WHT A;  3I4I A;  4NAM A;  2D98 A;  3F2Z A;  1ND2 C;  3M3Q A;  2G9F A;  1EUT A;  1PVC 2;  2CGP A;  4GZ9 A;  4XEZ A;  3FX3 A;  5I0S A;  2E6V A;  2VZ1 A;  3W58 A;  1UF2 C;  2PHF A;  1OMI A;  2W5F A;  4I3P A;  1D7P M;  1IOA A;  1PK6 B;  4BQW A;  4Y4Y A;  1A78 A;  1JYI A;  3MLJ A;  3CQO A;  5L9R A;  2XVG A;  1AXZ A;  1BXH A;  1OA3 A;  2R07 3;  1ULD A;  4FPE A;  4XOG A;  2QQI A;  3LDR A;  4HXC A;  1PGW 2;  2R7E B;  3RZL A;  1UCX A;  3WW4 A;  3SCF A;  4ARX A;  3RRD A;  1Z78 A;  2PLV 3;  2QQP A;  1F9K A;  3J7H A;  4HKL A;  4SLI A;  1A6C A;  2PA7 A;  1ULE A;  4NAO A;  5IJR A;  3C7F A;  4C0B A;  1QJU 3;  4CCC A;  1RHI 2;  5F2S A;  1UY2 A;  2CDP A;  2OVU A;  3A22 A;  4CEW B;  2O0O A;  1AVB A;  1JYT A;  1NQD A;  4AHX A;  3AP9 A;  3PTY A;  1WLT A;  2A5Z A;  2X29 A;  1FAY A;  1JYC A;  1JXN A;  4KU7 A;  4LUK A;  3WCS A;  2Y6L A;  4GQ7 A;  2YPJ A;  3MBW A;  2E7A A;  3OTF A;  1O91 A;  2WFF 1;  3KV5 A;  4N9H A;  1CD3 G;  1WCK A;  2OZ6 A;  1UU4 A;  5KBF A;  2DTW A;  3FWE A;  5BXX A;  3L2Y A;  4CUC A;  1YC6 1;  4QDR A;  2JG9 B;  4FXG B;  1IS3 A;  1GQG A;  1B09 A;  2B9V A;  2IWG B;  2P6C A;  4XUN A;  2D5H A;  3HD8 B;  3WXP A;  4B4Q A;  4XVH A;  3LPG A;  2DF7 A;  4FFH A;  3WG3 A;  1SBD A;  2JDH A;  2XG3 A;  3S57 A;  1R1A 2;  2HBU A;  4CEY B;  3MIH A;  4XXA A;  4BYY A;  4S2G A;  4CDW A;  3WW2 A;  4EZ4 A;  3K51 A;  3S5Q A;  2D3S A;  3IIA A;  5FYI A;  2PN5 A;  1VMH A;  4QGM A;  4AOC A;  1DZT A;  1WLD A;  2H0B A;  2W1W A;  3AM2 A;  3BTY A;  3UT0 A;  1EAH 3;  3P3P A;  4G9S B;  3O0X A;  2NP0 A;  1OD3 A;  4TN7 A;  1ASJ 2;  4AWD A;  1BZW A;  1PHM A;  2WNV C;  3OGV A;  4WM7 A;  1LCL A;  1X36 A;  3PMS A;  1IKQ A;  2Y0I A;  4AVA A;  3OBA A;  4B4R A;  3HNM A;  4AQT A;  3IBM A;  3ZSL A;  1YQ2 A;  5J09 A;  5FY4 A;  4W4Z A;  3BKZ A;  2XVL A;  2BBV A;  1JZ6 A;  3PVN A;  2P17 A;  4YFW A;  3V65 A;  4COV A;  4KQ7 A;  1NKG A;  1R08 2;  2D6N A;  4W65 A;  4D6Q A;  5JSR A;  1PIV 1;  1GV9 A;  1PO2 2;  1ZBA 3;  4MOA A;  4CDU A;  2H6B A;  5KC6 A;  1S1A A;  3VN4 A;  2AAC A;  4XIK A;  2OPW A;  4AI2 A;  4E4S A;  4E8D A;  2ILM A;  2DFB A;  3TN9 3;  3ZSJ A;  4MGT A;  4Y22 B;  5L73 A;  4AFM A;  4OHW A;  1SLA A;  2Q8C A;  3TBD A;  1JMU B;  3AZX A;  1T6B X;  2C26 A;  1XQN A;  4XIO A;  2B9U A;  2VPV A;  5H9S A;  2BER A;  3OY8 B;  1RUI 2;  1SLT A;  4XPV A;  2ZX0 A;  2Q0A A;  1LHO A;  4MV2 A;  5ABJ A;  1S2E A;  1VBC 3;  5D8A A;  5GLT A;  1UZY A;  5JMO A;  5FO9 B;  3IKW A;  2XJU A;  1RUG 2;  3NV3 A;  5FZL A;  3K4Z A;  1Q8P A;  4HOO A;  1TMF 3;  1N1Y A;  2JB8 A;  5IAT A;  1JZ5 A;  3OJB A;  3ZKY A;  4BIF A;  2K2S A;  1UYP A;  3I49 A;  1ND2 A;  1RJ8 A;  2K46 A;  4D94 A;  3NV2 A;  3UJO A;  4XDQ A;  1UZZ A;  3ZMN A;  1HXS 2;  1I5P A;  2XKO A;  1UYZ A;  4QX5 A;  3NNF A;  1VAV A;  4Q5O A;  3TEY A;  1DQ6 A;  4PIX A;  5G04 L;  4Z82 A;  3FN9 A;  4DXT A;  1AUY A;  1NLQ A;  1YCI A;  4ORF A;  2DCJ A;  2TEP A;  4HFS A;  5BY5 A;  4K3U A;  4JC1 A;  1LEM A;  2VME A;  2BW8 A;  3MIC A;  3K77 A;  4Q0S A;  5IWF A;  1DQ0 A;  4YVW C;  4A7Y A;  4CUB A;  5A6Q A;  5IFP A;  5BNQ A;  5A6X A;  3JD7 1;  4KU8 A;  1LGN A;  1AR7 2;  1OQ1 A;  2HWD 3;  4FT8 A;  5EV7 A;  1VBE 1;  2JIG A;  3OUI A;  4HPK B;  3BOD A;  4WBB A;  2IXC A;  1S0I A;  1POV 1;  1XE7 A;  4OYU A;  3EO6 A;  4H7L A;  3SQO A;  2A75 A;  4TLG A;  5JZG C;  1UX7 A;  2QQK A;  3A23 A;  4NPL A;  4CDW B;  2Q4S A;  5HXM A;  2GDF A;  2Y60 A;  5GLW A;  4GUL A;  2J1V A;  1ZZ6 A;  4L92 A;  1C1F A;  2ARB A;  3VDD C;  2XXZ A;  5FXZ A;  1WGP A;  2O14 A;  3AP7 A;  3J26 N;  4NHK A;  5AVP A;  3NAP C;  4LPL A;  5DAP A;  5FYH A;  1GIC A;  2JDK A;  4NO4 A;  2VTX A;  1S2B A;  2CY6 A;  3GBG A;  4XQD A;  4J6G A;  3KCC A;  1WCS A;  3VUO A;  1W9F A;  1YHF A;  2ZGU A;  4HET A;  1OBN A;  4WM7 B;  1FI2 A;  1LHN A;  4BCU A;  3INA A;  2WAO A;  4LBQ A;  4GJY A;  5FBZ A;  3KF3 A;  3A7Q A;  2OYZ A;  4DIN B;  4TLF A;  3NQH A;  4YW7 A;  1D0G A;  1AR8 3;  4XUO A;  1DCS A;  4UW5 A;  1DHK B;  1EV1 2;  3WX5 A;  3O0V A;  5EYX A;  1G86 A;  5FUI A;  4P08 A;  3ZSE A;  2R06 1;  4HG6 B;  4CDU B;  4F3J A;  5IVB A;  1QDC A;  4WV8 A;  4CPB A;  3VZJ A;  1XBF A;  2VO5 A;  1Y9Q A;  2CU5 A;  3AX4 A;  4MGQ A;  3T0B A;  4XC9 A;  4HT1 T;  1C8M 3;  3U78 A;  2WRA A;  4HL0 A;  4YPJ A;  1BQP A;  2VUC A;  3N7K A;  4DS0 A;  4OZX A;  4XCA A;  2YG0 A;  1SZB A;  1LOC A;  4UXA A;  5FZ3 A;  1L7Q A;  5IAV A;  1PMJ X;  3BOW A;  2WNV A;  1CAU A;  3HNB M;  4CE8 A;  1JUI A;  1DF0 A;  1OQE A;  3UGF A;  1HKD A;  3AK0 A;  4B29 A;  3ME2 A;  3O0W A;  4K8R B;  3E6C C;  1H9W A;  4MUV A;  2W92 A;  3H0O A;  3WHU A;  2IC1 A;  5D8A B;  5FRE A;  4IEQ A;  4CA9 A;  4A4A A;  2VC9 A;  1OFS A;  2OQ7 A;  3J8F 2;  1HB2 A;  4R9B A;  3T2T A;  3IM0 A;  3I2J A;  3T1M A;  1ZYB A;  3AC0 A;  3HN1 A;  1UL9 A;  4KG8 A;  4TWT A;  1VJ2 A;  2P3I A;  3DV8 A;  2R16 A;  2IVI B;  3G6J B;  2WIN B;  3HIF A;  4JGY C;  3N9L A;  4X6R B;  3BTZ A;  3WIN E;  2ARX A;  1PVC 1;  5DG2 A;  5CIR A;  1ND2 B;  4UAP A;  1VRB A;  3U07 A;  2VUA A;  3UL2 A;  1E57 A;  5L7O A;  4RS5 C;  2WZR 2;  2AGS A;  2W1Q A;  5F2W A;  2XB6 C;  1XNC A;  1JZ4 A;  4CDQ C;  3P3N A;  3WF1 A;  4Q27 A;  1JYN A;  1OKQ A;  2X09 A;  1WW7 A;  2QKD A;  4E2G A;  1YRZ A;  5JIU A;  1RMU 3;  2HWB 3;  5DUW A;  4FTS A;  1PGW 1;  3S5A A;  5HCH A;  5CB7 A;  5FLJ A;  5FWE A;  2HWF 3;  4GD4 A;  3CZJ A;  4LA2 A;  4KBZ A;  2XJP A;  1RIN A;  3KSC A;  4OMD A;  3SXW A;  2P5B A;  4AE2 A;  1RHI 1;  4PQ9 A;  4GH4 C;  1UKG A;  4Q4W 3;  1CVN A;  5CU1 A;  3UK9 A;  2JB4 A;  1UYX A;  4MXW A;  2VH9 A;  2FZ1 A;  2JWP A;  1LU1 A;  4Z2W A;  3ACF A;  4JGZ C;  1K3I A;  4E8C A;  4Y1V A;  2PXJ A;  5LA0 A;  2RR1 2;  5JOW A;  3CMG A;  4M4P A;  2EA7 A;  4Q4X 3;  2FDK A;  1UXX X;  3AKR A;  1DLC A;  2A70 A;  3H42 B;  1FYU A;  2Y38 A;  4L11 A;  1PZ7 A;  4I3G A;  4YVW A;  1W9T A;  3OD4 A;  3N3H A;  4LBQ B;  5T5L A;  2V4A A;  3FHQ A;  4GB3 3;  4IV1 C;  2F4P A;  2BUK A;  5A33 A;  1CGP A;  1LRH A;  1R1A 1;  3GCW A;  4KMQ A;  1RUF 2;  4QXB A;  3VBR C;  1V0A A;  5JZG A;  1VE0 A;  3W5N A;  1C57 A;  3N7M A;  4O7X A;  4XFF A;  1GR3 A;  3DL3 A;  3PTR B;  1U5Y A;  2A71 A;  3MGU A;  3SIS A;  3VDD A;  4ET7 A;  5LBB A;  2HWE 2;  3B00 A;  5JXH A;  3AB0 A;  1KS5 A;  4PBP A;  3P1I A;  4LOS A;  5L9B A;  1ASJ 1;  3U37 A;  5CFD C;  3ZR6 A;  4AED C;  4GKY A;  2QQW A;  3KGL A;  5A3P A;  4OZO A;  2WNV B;  4JQT A;  4XMI A;  1Q8O A;  1F2N A;  3RZG A;  2OW4 A;  1TNR A;  2ZX3 A;  5FZ0 A;  3K75 B;  3WG4 A;  4Q2F A;  2PHX A;  3C7E A;  2RS5 2;  3BAL A;  1O3T A;  1IS4 A;  4NRM A;  1R08 1;  1RUE 3;  2IXI A;  4IE6 A;  5J37 A;  2JDY A;  3CO2 A;  4Z92 B;  3O1R A;  1PO2 1;  3B5L B;  4RGG A;  3NJX A;  1HW5 A;  4IGO A;  2W94 A;  4YFZ A;  1LTE A;  2EID A;  2V5Y A;  1ENX A;  2ZHN A;  3POI A;  1OH3 A;  4NWW A;  3UJQ A;  3KHC A;  2AEN A;  2J22 A;  2QTW B;  1XYP A;  5FK7 A;  5LEJ A;  3ZYR A;  1VBA 3;  4FPF A;  3BPZ A;  2EIG A;  1J3R A;  2GME A;  4PQQ A;  1BYH A;  2W47 A;  3FBY A;  2WQ8 A;  1CAX A;  4XE9 A;  4LBN A;  3LSE A;  3T3Y A;  1GNH A;  3MIB A;  2EIC A;  1RUI 1;  2N7G A;  2AZ5 A;  1W2O A;  2XWJ B;  3ZXA C;  1RYY A;  4ZY9 A;  4D6R A;  1RUG 1;  2XON A;  4LO5 B;  4UFH A;  3O12 A;  5DQ0 A;  2VZS A;  2WO3 A;  3KT7 A;  3VD4 A;  2YC0 A;  5FZD A;  4GMP 3;  1Z7S 2;  4BQ1 A;  4AGV A;  2E63 A;  5SV5 A;  4AI1 A;  1RVF 2;  2GAU A;  4HLT A;  4JGY A;  5A32 B;  1O3S A;  1H8T C;  4LE4 A;  5F3I A;  5FZB A;  1HB1 A;  3HEI A;  3LA2 A;  1LEN A;  2XBO 3;  4Q4V 3;  4K20 A;  4MXW B;  2Q8E A;  3VDA A;  1HXS 1;  3W20 A;  2RS1 2;  4RS5 A;  1W3X A;  1LOA A;  4OI2 A;  4RFT 0;  3ACH A;  1V6N A;  1CIY A;  4IV3 B;  4LBK A;  1X8M A;  5FY5 A;  4CDQ A;  3AKQ A;  5B2G B;  5KWR A;  4XQW A;  4BME A;  3ZXE A;  3VL9 A;  1REE A;  4YVW B;  1H1A A;  1QJX 3;  3NW4 A;  1ENS A;  1AR7 1;  1WLC A;  3Q8A A;  1PK6 C;  4BH9 A;  1C1L A;  2VQT A;  2A1X A;  3CZU A;  4FBF A;  5JVV A;  1OI6 A;  2ADD A;  1Z0H A;  4F8A A;  5JXG A;  1FOD 2;  4UF0 A;  3SH5 A;  1OT5 A;  1CZS A;  3LAG A;  4BIS A;  5JZG B;  1W90 A;  4UI9 L;  4QKD A;  1WKY A;  2BWC A;  4BMB A;  4GH4 A;  3ALQ A;  3ZN5 A;  2BGC A;  2PAK A;  4QX0 A;  2Y0O A;  3S30 A;  2WS9 3;  1O4Z A;  2QQV A;  1FPN 3;  3RPQ A;  4R9C A;  3NAP B;  2RM2 3;  4J1W A;  3QLQ A;  4JGZ A;  4LK7 A;  5CNA A;  3UNP A;  3VLB B;  3VL8 A;  1UY0 A;  5GZC A;  3OGG A;  5K9Y A;  2BP6 A;  2R1D A;  2RDS A;  2ZHL A;  5F5I A;  5FPB A;  1CPM A;  1R1Z A;  4QKB A;  1IQA A;  3SLI A;  3VHO A;  1ZA4 A;  2VNO A;  4OHZ A;  2XLA A;  3OG2 A;  1GZ9 A;  5ACA 3;  1LHV A;  2VZO A;  3EXU A;  3HT2 A;  1H4G A;  1RUC 3;  4MO3 M;  4ONU A;  4RYD A;  4QGL A;  5I0U A;  3WY6 A;  1AR9 3;  1GU3 A;  3CJI B;  4IV1 A;  1W0P A;  2QE3 A;  1EV1 1;  2JG9 C;  2VJX A;  3VBR A;  1URX A;  2D6L X;  3LA3 A;  4Y20 A;  4DEQ A;  1F15 A;  3WNX A;  4FTB A;  1BEV 2;  2IFR A;  4LJH A;  1J58 A;  4JCK A;  2MPF A;  4BQ3 A;  2VZQ A;  3KS7 A;  2ZCW A;  4KGG A;  4O9G A;  2E26 A;  1OA4 A;  2BQP A;  1KRI A;  2VMH A;  5CAD A;  5CFD A;  2HWC 2;  3H7J A;  1V6K A;  4XFH A;  3ZYI B;  2D6P A;  2ZX1 A;  2A3X A;  4I09 A;  4XAE A;  4AED A;  2QJV A;  3GDB A;  4OI0 A;  1GOG A;  2YHJ A;  1CAX B;  2YFU A;  3ZFG A;  3SH3 A;  3GAL A;  4AFC A;  2ZGK A;  5FPV A;  4IXL A;  5H9R A;  4A3X A;  5F7U A;  4XJW A;  2QUO A;  2VD7 A;  1OC1 A;  1ODM A;  2VL4 A;  5I91 A;  1XE8 A;  1CON A;  3MLK A;  4N8M A;  3J8F 1;  5AFE A;  4Q1R A;  3NO8 A;  1ZZ9 A;  2RDN A;  4TYS A;  5FP9 A;  4I0B A;  4OMC A;  3T1L A;  1WW4 A;  1UD1 A;  5JXI A;  5DXD A;  3UV9 A;  5CEH A;  4NPM A;  1LHU A;  4K1Y A;  2JDN A;  2WFF 3;  5A7P A;  4Y1U A;  5K0U C;  1J3Q A;  4B1L A;  2C4X A;  5LEK A;  4HAN A;  2LRO A;  4JGY B;  3AYC A;  3KF5 A; 
#chains in the Genus database with same CATH homology
 4GZ9 A;  2V72 A;  2J1T A;  2VZT A;  2VZ1 A;  2Y6K A;  3GM8 A;  2W5F A;  1D7P M;  1H6Y A;  3CQO A;  2QQM A;  4BXS V;  1DP0 A;  4TXW A;  2BZD A;  4FI9 A;  3OEA A;  2W87 A;  3WF3 A;  2QQI A;  1GQP A;  2R7E B;  2KD7 A;  2QQJ A;  4ARX A;  3J7H A;  4QX2 A;  2XOM A;  4A45 A;  5IJR A;  2W1S A;  4TTG A;  3C7F A;  1UY2 A;  2CDP A;  3A22 A;  3ACI A;  4CU7 A;  1CZV A;  1SHW B;  2XQX A;  1W0N A;  3CDZ B;  3PUI A;  3NJV A;  1US2 A;  2Y6L A;  3VD7 A;  3MBW A;  4QDQ A;  2JE8 A;  2WZ8 A;  4GWI A;  4P00 B;  4CUC A;  4QDR A;  1UY4 A;  2B9V A;  1EUU A;  2X10 A;  4XUN A;  3HJR A;  3MUZ 1;  4JKL A;  2WN3 A;  4XVH A;  4KWU A;  4UOJ A;  3LPG A;  3LPF A;  3EYP A;  5EIY B;  3UET A;  2HYX A;  3E1F 1;  5CYY A;  1JYW A;  2J1S A;  2VQU A;  4QPW A;  1CZT A;  5C70 A;  2W1W A;  1P8J A;  2OKX A;  1CX1 A;  1KGY A;  1OD3 A;  5DPN A;  4ARY A;  3OGV A;  4CU9 A;  5B4N A;  2WO2 A;  3I2F A;  3OBA A;  3HNM A;  1YQ2 A;  4W4Z A;  1JI6 A;  1JZ6 A;  2VMF A;  3WF0 A;  2YC4 A;  1NKG A;  3CKH A;  1GOF A;  1R64 A;  5C71 A;  2J1A A;  4IUG A;  3A21 A;  4MOA A;  1JHJ A;  1JZ8 A;  1PX4 A;  3IDA A;  4JX0 A;  4E8D A;  4LQR A;  3VDB A;  2BBA A;  3LEK A;  1TG7 A;  1WCQ A;  2B4K A;  2V5D A;  4MAD A;  1W99 A;  4A44 A;  1UMH A;  4DXR A;  2C26 A;  2BER A;  3DYO A;  4QX3 A;  1OF4 A;  2VM9 A;  5JMO A;  3BGA A;  4QAW A;  3K4Z A;  4DUW A;  1W9S A;  1NX9 A;  3ETP A;  1JZ5 A;  4D8M A;  2J7M A;  2LW8 A;  5LA2 A;  3T0A A;  4DUX A;  3P6B A;  3HNY M;  3III A;  1I5P A;  2W1U A;  1UYZ A;  4ZZ5 A;  4BK4 A;  5G04 L;  3FN9 A;  5EJ1 B;  4DXT A;  1NUK A;  2DCJ A;  2V4V A;  2VME A;  1O8P A;  3K77 A;  5IFP A;  4CUB A;  2E31 A;  4BDV B;  3ECQ A;  5J1X A;  2VMD A;  2QQO A;  5IFT A;  4OYU A;  2RVA A;  2EIB A;  1US3 A;  2LS6 A;  3WNO A;  3VDC A;  1UX7 A;  2QQK A;  3A23 A;  4QDS A;  5HXM A;  4W50 A;  4MGS A;  1BHG A;  1PX3 A;  2J1V A;  2WAB A;  3K4D A;  3OEB A;  4LPL A;  3WNM A;  3T0D A;  3SEE A;  2YFZ A;  3FL7 A;  5EJZ B;  2VCB A;  2WAO A;  2Y6J A;  1F4H A;  3A7Q A;  4M4R A;  3NNG A;  3NQH A;  2VR4 A;  5C7G A;  3C7G A;  4XUO A;  3HN3 A;  1TVG A;  5FUI A;  4P5Y A;  4P08 A;  3W5M A;  4XUR A;  3WF4 A;  4HG6 B;  3JXS A;  2VO5 A;  4MGQ A;  3T0B A;  3SKV A;  2JDA A;  4YPJ A;  5IHR A;  5JUV A;  1SG3 A;  4A6O A;  2YG0 A;  3K46 A;  1XNA A;  2VZV A;  1L7Q A;  4QX1 A;  1PMJ X;  3HNB M;  2HLE A;  1J83 A;  3GGL A;  5JXJ A;  3C8X A;  3WNL A;  1JYV A;  1PMH X;  2W92 A;  4Z2A A;  3T2O A;  4A4A A;  4ZZ8 A;  2VC9 A;  4BJ0 A;  3MV0 1;  1GOH A;  2ORX A;  3T08 A;  3EB7 A;  3I2J A;  3K4A A;  3AC0 A;  5LCW L;  1UY3 A;  4UAP A;  3SKJ E;  2WN2 A;  3I2G A;  3WF2 A;  2W1Q A;  3ACG A;  4LKS A;  3HOB A;  4CVU A;  2DCK A;  2VCA A;  2ID4 A;  1JZ4 A;  1UWW A;  3WF1 A;  3C7H A;  1JYN A;  2J1U A;  2X09 A;  4W8J A;  1K12 A;  1MPX A;  3I2K A;  3I3B A;  2Z4F A;  2W46 A;  1JU3 A;  4AG4 A;  3CZJ A;  4OMD A;  3OGS A;  1JZ3 A;  3VD3 A;  2E32 A;  4CU8 A;  2C9K A;  1UYX A;  1HN1 A;  1GMM A;  4QB1 A;  3ACF A;  4E8C A;  1K3I A;  4DXS A;  5LA0 A;  1UXZ A;  3CMG A;  4M4P A;  3WQB A;  1UXX X;  1DLC A;  3IB3 A;  2WUH A;  4CU6 A;  2VOT A;  4XUT A;  3VD9 A;  4A41 A;  4GWJ A;  1W9T A;  3FHQ A;  1OH4 A;  3IAQ A;  4KMQ A;  4D0Q A;  5B4X A;  4XUQ A;  5DMY A;  4CUA A;  3WSO A;  3W5N A;  2DDU A;  3OGR A;  4JHZ A;  3SEP A;  2WO1 A;  3IAP A;  4JKK A;  2W3J A;  3DYP A;  2ZEX A;  1T2X A;  5DN2 A;  3C7O A;  4ET7 A;  2VZU A;  5JXH A;  3GXU A;  3P1I A;  3U37 A;  3WNK A;  4OZO A;  2L9L A;  1UY1 A;  2WAA A;  1JZ2 A;  3K75 B;  2VZ3 A;  3DYM A;  3C7E A;  1GUI A;  1L7R A;  2J1R A;  1JYX A;  4XUP A;  4PF1 A;  4DEV A;  2VCC A;  1NAE A;  2CDO A;  3I97 A;  3NJX A;  2W94 A;  2EID A;  1O59 A;  3LE0 A;  1W8N A;  5JR2 A;  2J22 A;  2E33 A;  3UES A;  3T2P A;  4PQQ A;  2W47 A;  2WQ8 A;  2VZP A;  1DYO A;  4OUE A;  1W9W A;  1OF3 A;  3NRU A;  1ULO A;  2EIC A;  2QBX A;  1RYY A;  4ZY9 A;  2XON A;  5DQ0 A;  2VZS A;  2WO3 A;  2Y64 A;  3VD4 A;  1W8O A;  4BK5 A;  3ABZ A;  1J84 A;  3THD A;  1IQD C;  1LNS A;  3I3E A;  2ORZ A;  3WNN A;  3HEI A;  3VDA A;  4P02 B;  1K42 A;  2QQN A;  1F4A A;  5LA1 A;  3LQC A;  4QB6 A;  3ACH A;  4RN5 A;  3DEC A;  1CIY A;  2W9X A;  2W95 A;  3VD5 A;  3I2H A;  2BGP A;  5A1A A;  2YB7 A;  2XHN A;  2ZEY A;  1JU4 A;  2VQT A;  2WBK A;  3CZU A;  3T2Q A;  3HPN A;  2VTF A;  1H6X A;  2JD9 A;  4JKM A;  4DUV A;  5JXG A;  3I3D A;  1OT5 A;  1CZS A;  1XPW A;  3T09 A;  4UI9 L;  2Y6H A;  1WKY A;  2VMC A;  5IYY A;  3WEZ A;  2WDB A;  2EIE A;  2PQS A;  2WYS A;  4QB2 A;  4QX0 A;  2ZXQ A;  3CIH A;  3UNP A;  1UYY A;  1UY0 A;  4A42 A;  3WNP A;  2Y6G A;  3OG2 A;  1UZ0 A;  2VZO A;  4L0P A;  4RYD A;  3D3A A;  4MO3 M;  1XNT A;  1GNY A;  1UMI A;  2J1E A;  1GU3 A;  1XC6 A;  2VJX A;  2JKX A;  3I2I A;  4DEQ A;  5G05 L;  3MO4 A;  1JZ7 A;  2VZR A;  5CZK A;  2Y8K A;  3PUH A;  2VZQ A;  2BGO A;  1SDD B;  2E26 A;  2WZE A;  5HPO A;  1ULP A;  4AAX A;  3ZM8 A;  2X05 A;  2RJ2 A;  3THC A;  1K45 A;  4XZU G;  3GDB A;  1GOG A;  2ZEZ A;  2RV9 A;  5I0D A;  3LEI A;  2ZEW A;  3BN6 A;  2YFU A;  4PT6 A;  4A3Z A;  3FHA A;  4KI5 M;  4ZXE A;  5F7U A;  2VL4 A;  3LEG A;  2W91 A;  3MV1 1;  4OMC A;  2QQL A;  3OB8 A;  3MUY 1;  5JXI A;  1O8S A;  1KEX A;  3F2Z A;  4LHS A;  2C4X A;  2YC2 A;  1EUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...