2J1EA

High resolution crystal structure of cbm32 from a n-acetyl-beta- hexosaminidase in complex with lacnac
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
142
Chain Sequence
PRTVKITASSEETSGENAPASFASDGDMNTFWHSKWSSPAHEGPHHLTLELDNVYEINKVKYAPRQDSKNGRITGYKVSVSLDGENFTEVKTGTLEDNAAIKFIEFDSVDAKYVRLDVTDSVSDQANGRGKFATAAEVNVHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords HYALURONIDASE
publication title The Interaction of a Carbohydrate-Binding Module from a Clostridium Perfringens N-Acetyl-Beta-Hexosaminidase with its Carbohydrate Receptor
pubmed doi rcsb
source organism Clostridium perfringens
total genus 31
structure length 142
sequence length 142
ec nomenclature ec 3.2.1.169: Protein O-GlcNAcase.
pdb deposition date 2006-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2j1eA00
1XC6A 2WQ8A 4M4PA 2ID4A 1UZ0A 3MBWA 5DMYA 1NX9A 2EIBA 3MUY1 4XUOA 3I2FA 2JKXA 3VD9A 4HG6B 2B4KA 4A4AA 1UYXA 2WABA 3BN6A 2J1TA 5EJ1B 4L0PA 2VZOA 2Y6LA 3K77A 2W91A 1JYNA 1OH4A 3AC0A 4CUBA 2Y8KA 2J1SA 3SEEA 3C7HA 1GQPA 3OBAA 4P5YA 4OZOA 3LPFA 4LHSA 4P08A 2VMFA 2W87A 2QBXA 2WN2A 3JXSA 5G05L 3T0BA 1GUIA 2WAAA 4CVUA 1W99A 4JKMA 4XVHA 2VR4A 4CU7A 3SKVA 3C7FA 3VD5A 1UXZA 1RYYA 1CX1A 2VM9A 3T2PA 2YFUA 3C7GA 2VCCA 4ARXA 3OGRA 1O59A 1H6YA 4QDQA 1CZSA 3A22A 3W5NA 3K46A 3WEZA 2W1UA 3DYOA 1W0NA 4ARYA 2W1WA 4QX1A 1PX3A 2VL4A 1OT5A 2J1EA 4UOJA 2WAOA 4RYDA 1GOFA 2RJ2A 2BGPA 2VMEA 3A7QA 1R64A 2X09A 2XHNA 2VZUA 3C7EA 3ETPA 4MGQA 3WNLA 5JXIA 1CZTA 3FHQA 3UETA 3T2OA 4E8DA 5JXGA 4ZXEA 3SEPA 3DECA 4XURA 3I2KA 1CIYA 4A41A 2VMCA 2W9XA 4PF1A 3BGAA 3HEIA 1GMMA 3IAPA 3LE0A 4QDRA 4PQQA 3WNMA 2QQKA 4QX2A 2WYSA 1JYWA 3ECQA 2W5FA 1J84A 3LEGA 2V72A 5IYYA 1JZ6A 4P00B 1GNYA 1GOGA 4CUAA 1JYXA 4ZY9A 3HJRA 4CU8A 2WO3A 2VZPA 2W47A 5EJZB 3DYPA 4BXSV 1ULPA 2WZEA 3EB7A 1ULOA 1US3A 1H6XA 1US2A 2EIEA 1F4HA 1DP0A 2WO2A 2WZ8A 4IUGA 3WSOA 2VZQA 1UY3A 5LA2A 2CDOA 4CU9A 2JDAA 2W46A 1GOHA 1W8OA 2J1RA 1HN1A 2ORXA 2ORZA 3WNPA 4W4ZA 4BK4A 3WNNA 2X10A 4LQRA 3IDAA 2J7MA 4AG4A 1WCQA 3A23A 1JZ3A 2BGOA 1UX7A 2Y6JA 2ZXQA 3K4DA 4D8MA 3ACIA 4W8JA 4QB1A 2DCKA 4XUTA 4BJ0A 4DEQA 3LPGA 3K75B 4W50A 5C71A 2ZEZA 3IB3A 1JZ4A 2VQUA 3K4ZA 1O8SA 4DUWA 3I97A 1JZ2A 4OMCA 1K42A 4LKSA 2JD9A 4DUVA 3I2IA 2EICA 2L9LA 4A44A 3PUHA 4JKKA 4JHZA 1MPXA 1JHJA 3C8XA 4XUQA 3NRUA 3OGSA 4Z2AA 3I2HA 4AAXA 1W9SA 3LEKA 4RN5A 3WF2A 3T0AA 1UY2A 4DXSA 2VZ1A 3HNBM 3HN3A 2J1UA 4XUNA 5JR2A 2VZVA 3WF1A 5IFTA 2VZRA 1NAEA 2YC4A 1PMJX 3J7HA 2QQMA 4XZUG 4TXWA 4QB6A 3CMGA 3ACFA 1OF3A 5B4XA 3ACGA 4OMDA 1UY0A 5JXHA 1UYZA 3LQCA 3D3AA 4FI9A 3E1F1 1EUTA 4DEVA 3LEIA 2EIDA 3NJVA 5F7UA 5IHRA 1DLCA 1K45A 2E31A 1I5PA 3MUZ1 3HOBA 4PT6A 5G04L 4TTGA 3VD3A 2VMDA 2Y6KA 2VQTA 4YPJA 5C7GA 4MOAA 5CYYA 3CZJA 2VJXA 4D0QA 2V5DA 2YC2A 1PMHX 3NQHA 2W1SA 2Y6GA 3CKHA 1BHGA 1SG3A 5JXJA 1KGYA 2ZEXA 1UY1A 4UAPA 3P6BA 4QB2A 1JZ5A 5DN2A 1WKYA 1JYVA 3VD7A 2Y64A 3GXUA 3T0DA 1NKGA 3W5MA 1O8PA 1D7PM 5CZKA 2QQNA 2X05A 3I3EA 2DCJA 2W95A 4GWIA 1UXXX 2ZEWA 2W92A 2R7EB 3OG2A 3FL7A 4JX0A 3UNPA 4CU6A 3CQOA 2QQJA 3HNMA 3IIIA 1TG7A 2HYXA 1P8JA 3I2GA 5B4NA 1UYYA 4KMQA 1K3IA 2VCAA 3DYMA 3T2QA 2LS6A 3I3DA 3THDA 3THCA 3OEAA 4ZZ5A 1JZ7A 2ZEYA 2XOMA 2Z4FA 2B9VA 5DQ0A 1YQ2A 2JE8A 1W9TA 1JI6A 2QQIA 4QPWA 2W1QA 2RVAA 3WNKA 2E26A 2E32A 2WBKA 2J22A 2C4XA 5EIYB 3WF4A 1UMHA 5LA0A 3OB8A 1LNSA 5JUVA 3I2JA 2LW8A 3FN9A 3U37A 3MV11 2VZTA 5LA1A 1TVGA 3IAQA 2C9KA 2QQOA 3WNOA 5LCWL 1PX4A 3VDBA 2WUHA 3T08A 5DPNA 2Y6HA 2VZSA 4JKLA 2W3JA 4GWJA 2XONA 4XUPA 5J1XA 4KI5M 4OYUA 2BERA 5FUIA 4QDSA 5IFPA 5I0DA 2E33A 4QX3A 5C70A 1SHWB 1W9WA 1NUKA 4CUCA 2KD7A 1EUUA 3MO4A 4LPLA 1W8NA 2YFZA 2WDBA 3EYPA 1OF4A 3GGLA 2WO1A 3ACHA 1L7RA 4OUEA 3A21A 4QAWA 3VDAA 2J1AA 1UWWA 1GU3A 2BBAA 4QX0A 5HXMA 1OD3A 2OKXA 2VOTA 1KEXA 2HLEA 2VTFA 1UMIA 2YG0A 4E8CA 2XQXA 1JU4A 3ABZA 4UI9L 3NNGA 3MV01 2PQSA 1T2XA 1L7QA 4A45A 1JU3A 5HPOA 3GDBA 1IQDC 1XNAA 4KWUA 3P1IA 3PUIA 2VO5A 3SKJE 4MGSA 4DUXA 3HNYM 3CDZB 1XNTA 5JMOA 2YB7A 3WQBA 3HPNA 4BDVB 5A1AA 4M4RA 4DXRA 1J83A 4MO3M 3OGVA 2VCBA 3NJXA 2W94A 3K4AA 1JZ8A 4BK5A 4ET7A 1K12A 3VDCA 3WF3A 2CDPA 3WF0A 4GZ9A 3CZUA 4A3ZA 2VC9A 1CZVA 5IJRA 2BZDA 3C7OA 3F2ZA 3T09A 3GM8A 3VD4A 3FHAA 4A42A 3OEBA 3I3BA 2V4VA 3CIHA 1DYOA 3ZM8A 4A6OA 2QQLA 1SDDB 1XPWA 2VZ3A 2RV9A 3UESA 2C26A 2J1VA 4P02B 2DDUA 1UY4A 4DXTA 4MADA 2WN3A 1F4AA 4ZZ8A
chains in the Genus database with same CATH superfamily
4N53C 4COYA 1H8VA 3RMYA 1ENRA 2EXIA 4AI9A 4Y20A 1MS3A 1NCRC 2GMPA 3NSTA 4SBVA 2ZZQA 2EXKA 3A0NA 4FVVA 1YQ5A 4HANA 4XF1A 4JQTA 3OY8A 2BPA2 1NX9A 1XE8A 1C3HA 4DY5A 1RUOA 5DZGA 1NLQA 2ZHNA 3OBRA 5FPBA 4NWWA 3EHKA 2JKXA 2C9AA 3VD9A 2XQRA 2NP0A 2C24A 4MXVA 3J26N 3OJBA 1MS1A 1D2SA 3MFCA 2CAVA 4AQ6A 4BLJA 1QJEA 1WW7A 1YQCA 2B4KA 4QGLA 2WABA 1AYM1 2VXRA 3PUQA 2VW1A 3U07A 5KC6A 1WA6X 3UGFA 3BOPA 2V4AA 2Z5WA 3KD4A 3POBA 1APNA 1GV9A 1GKBA 1OOPB 1QH7A 2VZOA 3K77A 2W91A 3NV4A 1RUF1 1RVF2 3PUSA 1H30A 4LMFA 1GICA 1PO12 4WM7C 3HWJA 4CCKA 2Y8KA 4H2AA 1SLBA 4DPNA 1YI9A 4BOWA 4OZXA 2W52A 1R082 1RJ7A 4OZOA 4QQ2A 4UFMA 3D0SA 1VBB2 5JMCA 5FUNA 3HD8B 3KSCA 2RM23 5F1RA 1PGL1 1DFQA 4P08A 4RQPB 2VMFA 1AX2A 1ODNA 3LDKA 2QBXA 5BNNA 1J58A 1VMHA 2WAAA 5DABA 1RUD2 1SFYA 1W99A 2WS91 2D43A 3CU7A 3FFZA 2VR4A 2ZX2A 4XVHA 4ZPIA 3U4SA 4CU7A 3C7FA 1PIV1 1KD7A 1UXZA 3IBMA 1KJRA 1TME3 1Y9GA 1X8MA 2ATFA 4MX3A 1Y3TA 4AI8A 1H6YA 4QDQA 1ZX5A 3LIHA 3A22A 2JD4A 1CAVA 3K46A 3RRDA 3SCGA 5L7OB 1OVPA 3W5NA 3DYOA 4W6XA 2RJLA 3L2YA 4URAA 3SH3A 1CD3G 2UY8A 2W1WA 4UW6A 1O5LA 4FP2A 4XBNA 4EN8B 5A3TA 3VDDA 2XLAA 4DIQA 1VBA2 2VW0A 2QVSB 4RGGA 3R05A 4BE3A 3KV9A 1ENXA 2D6OX 5JCTA 1ZBE2 4HFSA 4RYDA 4Z07A 2OW4A 3TAYA 4PIXA 2RJ2A 2ZA9A 1DHKB 4EV0A 3A7QA 5H9RA 2VD7A 1R64A 5DDJ1 2R061 1OQEA 1ND3C 2XHNA 3C7EA 5JXIA 5I93A 1AYM3 1V6NA 2E51A 1QOSA 4Y3OA 1TMF1 1XNDA 1V0AA 5GZFA 2OX0A 4EZHA 4GH4B 3T2OA 4CP2A 5JXGA 1W05A 1DGWA 4XURA 3UL2A 1RB8G 1KJLA 2HWE2 4ISRA 4UF0B 3VZOA 4K20A 3OPWA 1N3OA 3TRSB 3ZOIA 3OF1A 5L19A 3IAPA 2ADEA 4IETA 5ANNA 5A7OA 3VKFC 4HK9A 3WNMA 4TN7A 1EYBA 5I8SA 2Z42A 3ZSKA 1JYWA 2EIGA 4RFT0 1MEC2 1MQTC 1JHNA 1PZ7A 3ECQA 3Q8CA 3RZZA 1W3XA 3FUQA 4LHKA 2ENRA 1LRHA 5C9AB 1PZ8A 2HYKA 3T4VA 2Q1FA 4E9KA 4JQRA 1GNYA 1JYXA 4Y22B 2HWF1 2GH2A 3HJRA 2WO3A 4I09A 3W59A 3KCCA 4CU8A 3H8RA 2W68A 4Q4V1 3POWA 1BLZA 4JTNA 5A32B 4XJAA 3AMHA 3AYCA 5EJZB 4BXSV 5FK7A 4H3WA 2P37A 2AUYA 5FMOS 4I02A 3S5QA 3ZSMA 2WO2A 4O9EA 4IUGA 1QQP1 2NMNA 1QJX1 2R042 4PQ9A 4UBGA 2ZGTA 3BTYA 2JDKA 2ZACA 4XDQA 4AE2A 4C91A 3RZHA 4CU9A 1CQ9A 4Y5Z0 2TBVA 1W8OA 3WNXA 2WC2A 4NIHA 1ALYA 1HN1A 3JQWA 2ORZA 3N35A 2WLPA 4B4PA 1NCRB 5J09A 5FYZA 1WBFA 4FOYA 2BDRA 2Z69A 1L7LA 3IDAA 1WCQA 1ZVFA 2XWJB 2Q0AA 4GMP1 5LBEA 3RZGA 1AL23 2CY6A 3O1MA 1QJU2 1J3PA 2Y6FA 2ZXQA 4XTPA 3ZIWA 3KHCA 4LBNA 3IPVB 1NXMA 4D8MA 3PIJA 4QXBA 4NIAA 2B5HA 2WYFA 3WCRA 1YYNA 1NCQC 3DEMA 4QU1A 3ZN6B 3LGRA 3BPSA 3LB9A 3WY6A 1POV0 4BJ0A 4UW3A 1S0CA 2XJPA 4YVWB 4E2GA 1RXGA 3OTFA 4G4FA 3AJYA 3IB3A 1XQNA 2Z79A 3KT4A 1B35C 4YG3A 2ZMKA 4WM7B 1ACCA 1JZ4A 4DY3A 1O8SA 4GA9A 1RVF1 3I97A 4KGGA 4XFIA 1PO11 4AEDC 2ZAHA 1JZ2A 5CADA 5F9TA 1AYN2 1K42A 3O0XA 5CG9A 4XW3A 3KV4A 4AVBA 1IS3A 4NIGA 1H1AA 3B02A 1R081 2B9UA 5F2WA 2DFCA 2K46A 5LK5A 1VBB1 2P1BA 4Q4W2 2YV8A 2YBPA 3WP5A 3RJ2X 3ZN5A 5H9QA 3PUHA 3RPQA 5LY1A 3LKJA 2H0BA 2XMLA 4N7UA 2HWB2 1JHJA 1OXCA 2P17A 3NRUA 1RUD1 4XUQA 1ONAA 4B4RA 3V0AA 3I2HA 3ZSEA 1GWMA 5A70A 5KHHA 1W9SA 1AR82 3LEKA 3WDVA 4XE9A 4BQWA 1S0DA 4S2GA 4AF9A 5FY4A 3VBHC 2VZ1A 3HNBM 4MUVA 5FPUA 4LHNA 5J7MA 1M4WA 3BPZA 3HQRA 4OHXA 5T5LA 3WG2A 3WDYA 3GCWA 4R8HA 4Q27A 1MZFA 2HJIA 3AP9A 4GB32 2Y38A 3PL0A 4PDWA 3BTXA 3O5SA 1XB9A 3T1MA 4GMP3 3USSA 2VZRA 3N9OA 1UZYA 5E89A 1Z7S3 1VBA1 3NAPC 1YC61 2QNKA 3AMPA 2Z2SB 4P9LA 3J7HA 1IOAA 2ZZJA 3OPZA 5C4WA 4CEYA 1XRUA 2CU5A 3QBQA 4LEJA 1SLAA 4A2UA 2YDEA 3PU8A 4Z92B 1ZBE1 4BIOA 1Q43A 4XJ9A 1O4ZA 2YHJA 4FO9A 3VL9A 4K6BA 3U11A 1UO9A 2PHRA 5FMDA 1UYZA 4Q8LA 4C8DA 1J3QA 3E1F1 2P3JA 1R1ZA 2XKOA 5CFDB 4LBQD 1EUTA 1QOTA 5FZHA 2EIDA 4ITCA 3DPRC 4IGOA 4MYEA 4J1XA 1BQPA 4HSJA 1S0FA 4PJYA 2PAKA 3GZTB 4RQPA 2IXJA 2D6KA 4GQ7A 4QMAA 4OHVA 2JICA 5F8PA 2E31A 1DQ5A 1W2TA 1I5PA 4AZZA 2HWE1 3MUZ1 1GR3A 4R9BA 1YIPA 4TTGA 2GNBA 5SV8A 2VMDA 2Y6KA 3AKPA 3BALA 4M01A 1ZZCA 3RWKX 5JSRA 2XG3A 2BTVC 4YNIA 3NWKA 3GF6A 1MEC1 2ZGSA 1G9AA 3H3ZA 1PMHX 3NQHA 1F5JA 2W1SA 3DN7A 3NJYA 2Y6GA 2ARCA 5L7OA 3BKZA 2GP3A 3VHNA 3E6BA 3A4UA 2VCMA 1Q56A 2G9FA 1WMDA 3H1WA 4FT8A 1JUHA 1OLME 5DN2A 3UK9A 4IGQA 1OH3A 1DQ4A 2LRPA 1AVBA 1SPPA 3HBKA 1YLLA 1O3QA 3H0OA 4QPYA 1LOAA 5BV6A 1RXFA 3WP4A 4FPYA 3GXUA 4Q29A 5EP9A 2WNOA 2R041 4XILA 2GN7A 2QQNA 2Y33A 5FLIA 2DTYA 2W95A 1E5HA 4XMIA 2ZX0A 4EN6B 1AXZA 2OUHA 3H1MA 4YZ3A 3OG2A 3CJIB 3L2HA 4Q4X2 3UNPA 1UOFA 2ZHKA 4ISQA 3BYWA 3VZMA 3HNMA 2HYXA 1I6XA 1WMXA 2VW2A 4OI1A 3PDQA 1A8MA 4OVEA 5BYNA 1UYYA 1QJU1 3U78A 3URFA 5KXDA 1PM7A 2BQPA 1NCQB 3TB0A 5FXVA 5FP7A 1NLSA 3FLRA 2R1BA 2AZ5A 1CR7A 3EMRA 4RFRB 3OEAA 1OD5A 5C9AA 1QXPA 1T6GC 1UW8A 4Y22A 4FAGA 1OPOA 4DFSA 2VNRA 2ERFA 4FPFA 2O8QA 2DCTA 1YQ2A 2R073 1AR93 2JE8A 1RMU2 1UZWA 1W9TA 4JV4A 4AEDB 1JI6A 5IAXA 2EAAA 2QQIA 1K5MC 2D98A 2W1QA 1HRV3 1CAUA 3M3CA 3HQUA 1O5UA 1Z0HA 3ME2A 4R4ZA 1AYN1 4R9CA 5FK8A 1LHUA 4YFZA 2E26A 1JOPA 2E32A 4N8MA 2WBKA 3AB0A 5FZ0A 4XOGA 2Q8DA 3H8XA 4FQ4A 1EY2A 4YW1A 5FY1A 3ZO0B 4TZDA 1QNWA 1QXJA 1TEIA 1OA4A 1RUI2 2MEV3 2VULA 4Q4W1 3BB6A 4E4HA 1GNHA 4N9IA 2WL1A 2HWB1 4RSUA 5DG1A 4AI2A 4E27A 3U37A 5AC92 1NLRA 2WNUA 1EV13 3AKSA 3MV11 3VDDC 5C8CA 3ES4A 3NNLA 1AR81 2D6PA 4BYYA 5FJKA 2VZTA 4JRLA 2IFRA 5LA1A 1QJY3 1S0GA 5LBFA 1QMJA 1AX0A 1HRI2 3ZPOA 5DAVA 3IPVA 5D8AC 5KXCA 4YG6A 3AVRA 2YYOA 2Y6HA 5GZCA 1QDOA 1PGW2 1BVP1 2XONA 3EO6A 4GB31 1KRIA 4EJRA 1RUE3 1GANA 4YVWA 2F4LA 1RUNA 4Y1ZA 3ZYHA 1SLCA 4AYUA 3MF6A 2R49A 4BQYA 1V6MA 4N43A 2CAUA 2Q8EA 4MV2A 4YLZA 3JB8A 3BTZA 1X50A 2HEYF 2C1FA 2KD7A 3VBUA 5FRAA 1EUUA 3DPRB 4I3PA 4AHZA 4OHWA 4YARA 3K3NA 1YFXA 2JG9A 2V5YA 4XYXA 4YGDA 3A21A 3MFAA 3ZSLA 4O7XA 4GJYA 1BK0A 1GZ9A 5FZKA 3O7OA 1VRH2 2YMZA 5F3IA 1SDWA 5K9YA 5FMOL 2J1AA 3ZXKA 4DRVA 3S30A 1NY71 4MVTA 5F6LB 3K51A 4A6SA 1OD3A 3ALQA 2HLEA 1OFNA 1UKRA 4UFLA 4XCBA 1UMIA 2HBUA 2NYYA 3ZN4A 1CIWA 5FO8B 3WVJA 4ASMB 4BB3A 2HWB3 3D8CA 2O0OA 3ZXAC 2PQSA 4WZFA 1POV3 1JN2P 1JU3A 5C5UA 3GDBA 5GLWA 1IQDC 3P5BA 4BZ4A 4XJUA 1XE7A 4XF4A 2V09A 2GNMA 3PJQA 5FZFA 4CPBD 3HNYM 4DUXA 2XJTA 3IN9A 5EPAA 1W6MB 2YB7A 4R4XA 1MR5A 3HPNA 1G86A 4LBKA 4NVPA 5A1AA 4WVMB 1IPKA 3VHOA 1BZWA 1JMUB 3MHZA 3M7AA 4UWDA 2JIGA 3AVSA 5T50A 2PLV3 1YRZA 2WZPP 1JZ8A 2W94A 4E2QA 3RG0A 5CFDA 4BK5A 3OUIA 4ET7A 1K12A 1UQXA 2VOWA 4B7KA 1F35A 3WF3A 2CDPA 3KQRA 1VAVA 3WF0A 1G9DA 4GZ9A 3CZUA 1JH5A 1GZTA 2VOKA 4Q4X1 4AI0A 2ARBA 4IEVA 1C57A 3U14A 2ZAAA 2DYCA 3F2ZA 3JZVA 2RM22 2E63A 5FZAA 3H3LA 5FY9A 1H1IA 3APBA 2RHPA 2A73B 1YFUA 3MLJA 2A70A 1DYOA 1JBCA 2QQPA 3ZM8A 1BMV2 1N3QA 1YHFA 2DU1A 1SLIA 1UF2C 2RV9A 2VBBA 1TME2 4IERA 3UESA 2WT2A 3VKNA 2YZ4A 2DUPA 2BGCA 2VE1A 2Q30A 4QGNA 5J48A 1LB2A 4IESA 3RDIA 3FFQA 3VUOA 1REDA 1UU5A 1K5MB 1RMU1 3O0WA 1XC6A 1SCSA 2XKPA 5FPZA 4LJHA 4ES9A 4M4PA 2ID4A 4QPGC 5EHDA 1DZTA 1X7NA 1IG3A 2VTXA 3KF3A 2PHFA 1DBNA 5EFUA 5DMYA 2VVFA 2ZABA 1C8NA 4YVSC 4CXYA 2A6WA 3AKQA 1ZA4A 3FUOA 4EN0A 1W8UA 3MGUA 1S0EA 1FAYA 4COVA 1LHWA 3WW2A 5F5AA 1CAVB 1CWPA 1QH6A 3N9PA 1RUI1 3OPTA 1R093 3AP6A 2O8OA 3CJIA 4IQPA 3TN93 4PDWC 2JKBA 4XF9A 5I8TA 4LTAA 2AYHA 5AC91 2QQVA 2XJVA 1W8WA 2D93A 2WNVB 3AKRA 3BCWA 2NM1A 5E6HA 4CEYC 5C4WC 3AC0A 5D8AB 1RUG3 1SZBA 4WVVA 5D1IA 2AR6A 1HRI1 1H2MA 2GNTA 2WZR2 1DZRA 5TSWA 3NO8A 1PGW1 2GN3A 5C3SA 3W21A 2CGNA 5F3EA 4YWAA 2W87A 4HN1A 3NV3A 3T0BA 3WDUA 2X5IB 5G05L 2IXIA 4CVUA 4RQPC 4HL0A 2YBSA 3QACA 4AEDA 1IS5A 3MIHA 1OA3A 3VD5A 3MF9A 2WFPA 1JYIA 4M0HA 1RYYA 2XGXA 4D7SA 5EJ3A 2ZGOA 4Q26A 2FHRA 3R4SA 2YFUA 2UU8A 2B8MA 2OA2A 5F3GA 5JOZA 1IS4A 4TLGA 5FO9B 1AJOA 2QCSB 3AMMA 3ZYPA 2W1UA 2ZBJA 3VBRB 1KFXL 2TNFA 4NRQA 1V6KA 5C5TA 2Q5TA 5FYCA 3SC7X 5L7OC 2ZX3A 1ULCA 4XEZA 2P3IA 1VRH1 4W6YA 2RS33 1RUH3 3LDBA 4GJZA 5DAQA 3TNQA 4AEJA 1GP4A 3MI8A 1OT5A 4JAAA 4YGBA 4RS5C 4GKXA 4LK7A 1GOFA 1DIWA 3WOGA 3ZXDA 2RR13 2GC1A 3TWIA 2DURA 4XFBA 2XWBB 2P34A 3ZYIB 3JB4C 4Z2WA 2IC1A 4MGQA 2OVUA 2VZUA 3ETPA 4KU7A 5KXEA 3M3EA 4PIYA 3FHQA 5FYHA 4B1MA 1YWKA 1AL22 3MZHA 3TOJA 4A7ZA 1IKPA 5FQ0B 1WLWA 2Y0OA 4Q2FA 1SMVA 4CP1A 1IPSA 1O7FA 3N7KA 4ZXEA 2VGDA 1NZCA 2P3KA 2YGMA 4LUKA 1JXNA 3WUDA 1LKNA 3ITQA 3IMNA 1CIYA 5T5PA 1HDKA 1OA2A 4EWEA 1DU3D 1ZZ9A 3B00A 4JDOA 2MNGA 3BGAA 5DXDA 2ZCWA 2DBNA 3JBG3 1IHMA 2QQKA 3FWEA 2WYSA 4MGTA 5FYSA 4LKDA 4Y4YA 1LGBA 5BNPA 4PLOA 1J84A 5BPXA 1AF9A 1D4M3 1SFNA 1YIFA 2V72A 3PNAA 3SNMA 3WG1A 4AFBA 4XFCA 5FZ4A 3N4MA 4OI0A 1M06G 5KXBA 1GSLA 1V00A 2UY9A 3IDEA 1ENSA 4UW5A 1CX4A 2YGLA 2WT1A 3ZYGA 1WLDA 3DYPA 2RM21 3FZ3A 4Q0QA 2BBVA 3EB7A 3RQ0A 3CNAA 1TNRA 3TEXA 2ZGNA 5FREA 4PIZA 1BMV1 3N36A 5GM0A 2TUNA 3ZYJB 1HB3A 1UY3A 5FYTA 1TME1 2CDOA 1F8VA 1O4TA 4B1LA 2WQZC 5LZ6A 5JSPA 1A34A 1W2NA 2JDAA 4FSJA 2J1RA 1HXS3 3ZXFA 4QPGB 5FBJA 2A6YA 2X10A 5DUVA 3V0AB 1W6MA 2Y26A 5A3LA 4CXWA 1VMJA 2J7MA 2JDMA 1JZ3A 2PHXA 2WNUC 4YVSB 4I30A 5C8CC 1Z7S2 1UX7A 1ULGA 2Y6JA 2W08A 1UD1A 4NHLA 4WVMA 4DZGA 3K4DA 5JDBA 4AHYA 1X36A 5CG8A 5C3RA 4QB1A 3BU7A 5E16A 3UYJA 1QGLA 2BRTA 1W8TA 3D82A 3J7NA 4MGIE 1AR73 1KS4A 1J1LA 4PDWB 5FOBB 1Q8SA 3KVBA 4QHBA 1O4YA 2JDZA 4W50A 5GLTA 3U4XA 4YFWA 4YVWC 3B7MA 4R9AA 4CEYB 2KA3A 5C4WB 4FBFA 3K4ZA 4QQHA 1LOBA 2WINB 4DUWA 2X29A 2YU2A 1QXRA 4N43C 2FDKA 2E7TA 2JD9A 2JEMA 4DUVA 1WCKA 1H8TC 4OI4A 5JPNB 2WZR1 2EICA 3VBUC 4YGCA 3EJKA 4A44A 5FOJB 5JLVA 1W9YA 2VAUA 4AOCA 4M3CA 2A6ZA 5BY5A 3U10A 2JDYA 4AL9A 3AP4A 4JKKA 1XXNA 5JZGC 2O14A 2BW8A 1EPWA 1MPXA 2JDUA 1OQDA 2JG9C 3POJA 4OHYA 1K5MA 4EZ4A 2GSYA 4U2AA 1C1LA 1YEWA 4RR3A 5HI0A 1AR63 4NMIA 3WF2A 2IXKA 2EALA 3H8UA 3TEZA 3NV2A 2BJSA 2P2KA 2XJUA 4DXSA 3ZLIA 1V6IA 1F15A 4ATFA 4L2NA 4BISA 2E6VA 3E5UA 3ILNA 4JGYA 5FMBA 2J1UA 2QFEA 5FO7B 1CGPA 2RJKA 2NMOA 4AW7A 2ZHMA 3CF6E 4I0AA 2VZVA 4ZKTB 2D97A 2E7AA 3J4UH 5IFTA 4FPEA 5FYIA 3U75A 4U36A 2JENA 3SH5A 1VIWB 4CYDA 1G6NA 1NAEA 4AFDA 1PMJX 4RS5B 4YGEA 2WNVA 3M70A 4XZUG 1SPPB 3FMGA 3CMGA 5D8AA 3E97A 4XAAA 2PAMA 5B4XA 3NV1A 1LU2A 3ACGA 1UY0A 4GWNA 1VBE2 5A3NA 2D7FA 1YCIA 4J25A 1DF0A 4WVWA 3ZXJA 4NN0A 1AL21 4AVVA 5IHRA 2K0GA 2ZKNA 5CFDC 2K2SA 2YU1A 4V1PA 2ZGLA 4FOVA 3GALA 4P9XA 1UCXA 2X5IA 4M3CE 3VBSA 4YZ2A 1JYTA 4A7KA 1W2OA 2QJVA 3G7DA 5CNAA 4YM3A 3HOBA 3I54A 2WZR3 4AQTA 3ZX7A 1UZVA 1F5FA 2VQTA 1H4HA 2R072 4P9YA 1AR92 2A3XA 2PN5A 5FIXA 3AKTA 4B29A 5FPXA 2VQAA 1GBGA 2OPKA 2ET7A 5CYYA 3WW4A 3ZMNA 3VBFA 4XCAA 2R16A 4EN7B 1RTVA 1PZ9A 4YYOA 1HRV2 1UOBA 3N7JA 3H7JA 4QWNA 1NT0A 3TBDA 3KLSA 1W8HA 5CU1A 3VBRA 5KWRA 1QJFA 3CKHA 4LKEA 1SG3A 5LATA 1E5IA 5JXJA 2AEYA 2ZEXA 4IE7A 5IATA 2HWC2 1ND2A 3P6BA 4ZU7A 1I1EA 3ROUA 1JZ5A 4LLOA 1BKZA 4HKLA 5A1FA 2MEV2 4Q0VA 1WKYA 2GC0A 4B7EA 1JYVA 2R0HA 1CAUB 3VD7A 4LBLA 1F9KA 1RL3A 3BI3A 2ZHLA 2Y64A 2JDHA 3LF7A 1EV12 2IVJA 2XVGA 1LOEA 5A1LA 1GZWB 1O8PA 2VECA 5CZKA 1H2NA 3I3EA 3AYDA 5IK4A 1S2EA 1QJY2 4CDWB 2ZEWA 1VPHA 5FQ0A 3AMQA 3H50A 2R7EB 1DDLA 3LOBA 4LO5B 4AGRA 2XH6A 1RHI2 4JX0A 4QM8A 2RS13 1Y9QA 3CJIC 4DINB 2WNUB 3MDPA 4H55A 5D21A 5F32A 2QQJA 3T30A 5C8CB 5K0UC 1TG7A 1P8JA 1RUE2 1W8ZA 4YM0A 3CLPA 5DUXA 1Z7S1 2ZOEB 4C1XA 5FKBA 5EV7A 4GWMA 5DAPA 4IW3A 1Q5OA 3Q9OA 3O1TA 2OXBA 2PHTA 2PTMA 2LS6A 3THDA 1VB2A 1COV3 3THCA 4FPKA 1C4RA 1U12A 3V0BA 3RZMA 4DO0A 2GH8A 3H42B 1NE4A 5FYMA 5CB7A 4DOUA 2AACA 2B9VA 4MH0E 5JOYA 1UYPA 2JWPA 5LB6A 5DQ0A 1SLTA 4FPLA 3LSEA 4BWOA 3ELNA 4UYBA 2BUKA 4N43B 4QPWA 5CKNA 1GYKA 3WP3A 2G1MA 3WNKA 1H8TB 4CDUA 1NQDA 3DKQA 3VBUB 3B5LB 1KQRA 2J22A 2VU9A 4LE4A 3L9JT 3ZFGC 3OUHA 3MLKA 3WF4A 3HT2A 5BNOA 4L97A 2YC0A 3AZYA 1UMHA 5JZGB 4QM9A 1V6OA 4P14A 2JG9B 1LEMA 4OUSA 1UKGA 2I07B 2UWAA 3GBFA 3MIFA 4JTOA 4MG2A 1LNSA 5JUVA 2VPVA 2FCUA 2LW8A 2DUQA 2PQQA 3FN9A 4N7IA 2O1QA 1CONA 2CYFA 4QPGA 5AC93 3OBTA 1H2LA 3N3HA 3ZN6A 1FV2A 4Q0PA 3NVCA 4SLIA 4XFGA 3AJZA 1ULFA 4YVSA 1UL9A 3PU3A 4LITA 3IKWA 4CCNA 1W8FA 1PX4A 2QE3A 3WD5A 4DRRA 1RIRA 2R32A 5DPNA 4DNYA 4YG0A 2PELA 5ACA3 4L9BA 1ZA7A 4XUPA 1Y4WA 3WG4A 4G9SB 4D7YA 2EA7A 4LORA 3TEWA 3ZDVA 5FUIA 4COUA 1O3SA 3KMHA 2PLV2 4QDSA 3JD73 5C8WA 2G4IA 3AX4A 1ZRIA 3VKMA 4XBQA 5FPVA 4P9WA 4QX3A 1OC1A 4CCCA 2NN8A 3JQXA 3VLBB 1SHWB 5LW9A 1W9WA 4CUCA 1HIXA 4ASKA 1NOVA 4JVAA 2GAUA 1AUYA 3VZKA 4AK3A 4CEWC 4YRDA 2CSGA 1VBE1 1FPN3 4HONA 5FXZA 3ZYFA 1W8NA 2WO1A 4INDA 1WLTA 3ACHA 1RUJ3 1CAXA 5BNPC 3OD4A 4IE5A 5KHIA 4OUEA 1ST8A 1LOCA 2DVFA 1JYCA 4IXLA 4QAWA 5K7PA 4HMZA 3O1PA 4H7MA 1A8DA 2VBPA 4JDNA 3VDAA 1H0BA 1U5IA 1ZZBA 2BBAA 2WSVA 3WUCA 3ZDSA 5E8AA 3U1XA 3WCSA 2VOTA 1CVNA 1VBD3 1MS9A 1IKQA 1AR91 2R071 2WSUA 4Y1XA 5AFEA 2V73A 2YG0A 3POYA 1UMZA 5CIRA 4BCUA 4E8CA 4GXLA 4WVZA 3QH7A 1HRV1 2NLRA 4A45A 1H1MA 4XXPA 4F3JA 1UIJA 4L99A 1XNAA 2ZGKA 1I9RA 4CA9A 2B42B 2YPDA 1RINA 2VQ0A 1CAWB 2HWC1 4Q4Y3 3X29B 5JSOA 1C28A 1ASJ3 1POQA 4RS5A 3CDZB 2XL9A 1XNTA 2MEV1 5JMOA 1W6NB 1OUSA 2WLQA 1R092 3HAGA 4Q8KA 3TN92 1NA1B 4L11A 4DXRA 5IVVA 4MO3M 3OGVA 2I45A 5FY7A 2XPJA 1EV11 1VJ2A 5GZGA 3NJXA 3ES1A 3MW3A 2PFWA 1QJY1 5B2GB 1RUG2 4QX8A 4WV8A 5HCFA 3I2OA 3LA7A 4EWAA 1RUC3 1RHI1 4E4DX 5K0UB 3DXUA 2RS53 1N1TA 2D6NA 3C7OA 4XZPA 3PTRB 1VAKA 3T09A 5KHKA 3SITA 1VBE3 2AREA 2BOJA 3LAGA 1YUDA 5FZ9A 3NKGA 1RUE1 2TEPA 5F5QA 5CAZA 2OT7A 1Q8PA 1WMEA 3PVNA 3TEYA 2BWAA 1FNZA 1E57A 2BV4A 4A6OA 4LXLA 2IZWA 2A6VA 2C26A 2R1DA 1LTEA 1ZYBA 3AL6A 2D3RA 5H9PA 3ZXLA 1DGRA 1MS5A 1PK6C 4LO6B 4MADA 5A3OA 1V6LA 4UFHA 4DQAA 4ZZ8A 1VR3A 1QJZA 1UIKA 2JJ6A 2JECA 5FZEA 4XHXA 4ZS2A 1TQ5A 5D2AA 1UZ0A 3MBWA 1PGSA 2W0XA 3FLPA 4Q1RA 1OURA 4RR3C 4XF3A 1C5IA 1RUH2 2RS32 3ZFGB 1OQ1A 1W9FA 2X53S 5HBAA 2VMHA 1XJAA 1GZWA 4HXCA 2DTWA 5JI9A 2HWC3 1PM4A 5GLZA 3W9AA 5JOXA 2GU9A 1S4CA 1WD3A 4JGYC 4CDWA 4OCTA 3I2FA 5I8YA 2RR12 2MPFA 2JB8A 1YQ6A 2X8KA 1YXWA 1AJKA 2LROA 1W03A 5L36A 4QT6A 4BU2A 1UYXA 1LOFA 4ORFA 3GBWA 4C1WA 1LJ7A 2QQUA 3B01A 1POV1 1W6OB 2OIIA 3DUIA 3EQEA 4FOQA 4L0PA 3S57A 1ZZ6A 4NHYA 4AFCA 5E88A 3AMNA 4DB5A 1OH4A 3NMBA 4AVAA 2WNVC 1WW4A 2XL7A 4CUBA 4MSVA 4LUMA 2J1SA 4JZRA 1GQPA 4DMIA 1RHI3 2DFBA 3OBAA 4I01A 1XSRA 2EF6A 2ZKLA 3LPFA 4LHSA 1UU6A 3JBG2 4AEMA 2G9ZA 2XDVA 4GALA 2PLV1 2WN2A 4ZS3A 1GUIA 4JKMA 3ZXEA 1D4M2 5F37A 1J1TA 5LBBA 3SKVA 3VBSC 2X5IC 5AVAA 3ZYRA 3GHMA 5AFBA 3I59B 2VTXJ 4LBJA 5GJ6A 5JVVA 1CX1A 1FNYA 3AYAA 4CEWB 1H8TA 4N9HA 1EPZA 1X9TA 1LEDA 4S2DA 2VCCA 3VZNA 5J36A 1T6BX 2BP6A 1IPJA 1O59A 3OUJA 3OGRA 4F83A 4CCJA 1HV0A 5BNPB 3VBFC 3WEZA 1X8EA 2GC3A 2PMWB 5JZGA 5LEJA 3O1RA 4ARYA 4NIDA 2UWCA 1RC6A 3DGTA 3MIEA 3VBRC 3S5AA 4QX1A 2IFWA 5BNQA 1YNAA 3NNFA 1PX3A 2H0VA 2HEVF 3T2TA 2VL4A 1WMFA 2PHWA 1WWYA 3RGBA 1BBT3 1DQ2A 1ND2C 2W2IA 3BIWE 4K7JA 2FMDA 4XDPA 4UOJA 2VNVA 1UOJA 1FOD3 1HXS2 4Z82A 4IL7A 3SQOA 3MPPG 2BGPA 1X33A 2P4EA 1HN0A 1AHSA 4FP3A 4YW6A 5EZWA 2X09A 3POFA 2MHFA 5FZIA 5IAVA 3USUB 1KS5A 1RITA 4BQXA 2DBIA 4CDQA 1CZTA 3WINE 1IZ3A 3S6PA 5L9RA 4CZSA 4NPLA 3SHRA 3K48A 1IQAA 2D6MA 1WCUA 3EBRA 1YFYA 4E8DA 1I5ZA 2VG9A 3SEPA 2R6QA 4XFHA 5DAWA 1MZ6A 4DS0A 3WDXA 1AR72 4A41A 2VMCA 1R091 3BU0A 1LHNA 4PF1A 3TN91 5FP3A 3LE0A 4PQQA 4IEXA 4AFMA 1OSGA 2H6CA 3M3OA 2JIJA 3FX3A 4JGZA 2PYTA 3I2DA 4QX2A 1LU1A 2DCYA 1NQJA 1N47A 3NJZA 5GZEA 2RDNA 2SLIA 3LEGA 5IYYA 1JZ6A 1RUG1 5T5OA 2B39A 3J9SA 4P00B 1W06A 1URXA 2WA3A 3UT0A 1GOGA 2FDHA 4CUAA 5IT6A 4ZY9A 2XJRA 5J37A 3VV1A 1QOOA 4HN0A 2VZPA 3AM2A 4XETA 1HQWA 2W47A 1FV3A 2HWD3 1ULPA 4HZFA 1AXKA 4QQOA 3AZXA 2WZEA 1ULOA 1US3A 2FQPA 2GMMA 1H6XA 2IUWA 1MVEA 2EIEA 1F4HA 2VMGA 4HVRA 2D5FA 3PUAA 1OKQA 4Z8BA 5ABJA 2WZ8A 1ZRCA 3VKLA 1W6PB 2E7QA 4Y26A 2IWGB 5H9SA 1FMD3 4CDUC 4TSVA 1AR62 3ZYBA 4D7TA 1PK6B 3Q8FA 3J7MA 4UFKA 3WP6A 4K40A 4MXWA 4QHOA 3UKNA 2W46A 1C8M3 1GOHA 4M3CB 4XJWA 5FWEA 5BNOC 1UZZA 1CAWA 1JW6A 2VVDA 3ILFA 4BK4A 3WNNA 1BVVA 3DKWA 3FE5A 4FQZA 4P5HA 4RR3B 5ISLA 1ODMA 1W2AX 1W6NA 5FP4A 4AG4A 3A23A 3RWNA 1ULDA 2R30A 2BGOA 5FY8A 1NA1A 1SBFA 2BVBA 2VMIA 1LGNA 3R0RA 4AXOA 2RS31 1RUH1 4O65A 3RJRA 3KHBA 2DF7A 3PVEA 3ACIA 4JGYB 4W8JA 2KXLA 4AAPA 3AK0A 5FLJA 4AHWA 5FBZA 2DCKA 3VHRA 4X6QB 2RR11 4XUTA 4Z1VA 1GZCA 4QPIC 3FC0A 3SISA 3HVDA 1GNZA 3K75B 5K0UA 4NPRA 3UKTA 2ZEZA 3MLLA 5C71A 5F6KA 2DUOA 3A0KA 5A6ZA 4CUGA 4YZ4A 4EN9B 2G19A 2CNAA 4OMCA 3MW2A 4QX5A 4LKSA 3WHTA 1SBEA 4QKBA 3ZXGA 2D44A 3I2IA 3K3OA 5KHGA 2VUDA 4YM1A 1PMIA 4NRMA 1GP6A 2OS2A 3AL5A 3ZVXA 3AP7A 5EWSA 1OLQA 5EYXA 4IE4A 3VL8A 2WFF3 4PI0A 4XQ4A 1G8WA 3JBG1 4IEPA 4XJ8A 3VBOC 1NXD1 2JX9A 3E5XA 1LR5A 4QKFA 4OQ9A 3INAA 4LULA 4IV1C 3VBSB 4JHZA 4Z2AA 1C5HA 3C8XA 1QIQA 1O3RA 1S1AA 1CJPA 1D4M1 3RI8A 4BQ4A 3F95A 2XBO3 1W0OA 3KS7A 1PNGA 3PHMA 3D6EA 4S2HA 3T0AA 4QXCA 2CGOA 4HVQA 5A7QA 3ZFGA 3HMYA 3HN3A 1XU2A 4UFIA 5FPLA 3VBFB 4FPOB 3KQ4B 5JR2A 4KBZA 1JODA 3CJXA 3NKTA 1D2QA 3SLIA 3WV6A 3WF1A 2WR9A 4E4ZA 4CP9B 2B7YA 5LA9A 1ND2B 2VUJA 5F5IA 2ETEA 3WDTA 1HX6A 1W6OA 2Q1ZB 3ORJA 3PVBB 4BM8A 5F2SA 2Y34A 5K8SA 2BYVE 4I0BA 5A7SA 1HXS1 1V6JA 1STMA 2RS12 1OHFA 3ACFA 3M1HA 5EQUA 1OF3A 4YW5A 3ZFFB 5A6QA 2XVKA 5JXHA 5LBCA 4R9DA 4AVTA 4XFAA 2F6BA 4FI9A 3J7LA 3OYWA 2H6BA 4EE2A 4K1ZA 1W39A 3UV9A 4DEVA 3LEIA 4IEWA 4W6WA 5F39A 5F7UA 2NPIA 4LBOA 2XLFA 4EYUA 4AWDA 3GYDA 5IK5A 1DLCA 1COV2 3AYEA 1SACA 2ILMA 3D5OA 3O14A 1KXGA 2ZMLA 3ASIA 3S7EA 2UYAA 2XHKA 1AR71 2Y0IA 2VUCA 1NZIA 4YZ1A 4PT6A 3I59A 5CFCB 5G04L 4B8EA 4LA2A 1LOGA 1W28A 1VLNA 3B69A 4CEWA 4YPJA 2BU9A 3MPBA 4HPKB 2DCZA 2ZGMA 3KGLA 3MICA 2HEWF 5C7GA 3T1LA 1Q3EA 4D0QA 1BK1A 2V5DA 1WCDJ 5FUPA 5IK7A 3V0BB 4CCMA 4K8FA 5HCHA 1BHGA 5LRSA 1QU0A 4LO7A 3POEA 2B46X 4C0HA 3RI9A 4QB2A 2DVDA 4ASLA 3JCIA 4BIFA 4COZA 4D69A 1DGLA 5I0TA 1S0IA 4W65A 4A7YA 4CDUB 3H9AA 1PVC3 5BXXA 1ZNPA 4J1WA 3USUA 1NKGA 5FR3A 3W5MA 3T0DA 1D7PM 1AR61 4IGPA 3CBNA 5BNOB 2RMU3 4JRAA 4GWIA 4OULA 4ONUA 5FY5A 3N9MA 4CDWC 2Q8CA 4NHXA 2GNDA 4CXXA 2C5DA 4PCRA 3P3PA 5ACA2 1ZBA2 4P9JA 5I0UA 1LOFC 5F5CA 4OLLA 5FZGA 2P6HA 3M4FA 2IXLA 1Y43B 3JD72 5B4NA 4ZU4A 2AC1A 4ZHNA 3FLTA 1K3IA 4Y4RA 1EAH3 1VMFA 4YW4A 2VCAA 5FCCA 4YZ5A 2ZGRA 3I3DA 4NHKA 2BWCA 5A7WA 4ZZ5A 1JZ7A 4QPIB 1O91A 2JG8C 3PURA 1FPN2 3QOPA 1DG6A 3U0ZA 1A3KA 5CBLA 1LESA 2FCTA 2DVGA 4HK8A 1QDCA 4D6SA 4LOSA 2OYZA 3THPA 5FZLA 1RUJ2 4TYSA 5I0RA 1AX1A 4URTA 2RVAA 3WHUA 4AGVA 4LIUA 4AVSA 2A1XA 1W6PA 2XXZA 3KT1A 3VBOB 3GZEA 5M0TA 1PK6A 1U5YA 1VBD2 4K8RB 5LA0A 4IV1B 4RGKA 2GDFA 1CAXB 3DXTA 1CJDA 3ZMOA 4C90A 2XJQA 3I4IA 1QF3A 3SCHA 3I2JA 1FT9A 2WIIB 1WD4A 5J3UA 4D94A 2LUWA 2PHLA 1LECA 4XC9A 5HV4A 1XU1A 3MIDA 2QKDA 1SCRA 4E4SA 3MIBA 4BPZA 1Z78A 1QY4A 1VBC3 4Q4Y2 1ASJ2 1PO22 4PBPA 3VDBA 4WBBA 1O3TA 2WUHA 3J8F3 2GALA 4KGQA 2XVLA 4LO4B 3VKOA 2ZGUA 1A6CA 4Y24A 2A75A 4KWJA 4GWJA 3GHNA 2YPJA 4X6RB 3WW1A 4CDQC 1LULA 2AH2A 2UYBA 1YO8A 3DL3A 3GZUC 4IV3A 5FZBA 1MVQA 5JR7B 5IVJA 3IM0A 5I0DA 4BA6A 5FLHA 5KC5A 4HSLA 2R0FA 3KB5A 2E33A 2BVVA 1WBLA 4QQLA 4XTMA 4AI3A 3N9QA 2HKXA 1MS4A 1RUC2 1BEV3 2OQ6A 5J96B 1UNBA 4NAOA 4WM8B 2A7AA 2RS11 3QCWA 1MZ5A 2RS52 2D6LX 1ZREA 1OUXA 5EXOA 3MO4A 4LPLA 3GZAA 4B4QA 2YFZA 4JGZC 2FMYA 4LIVA 4AFAA 3W20A 1L7RA 3QD6A 1H9PA 1X9PA 2ZGQA 1D0HA 4XIKA 3OCPA 4QU2A 1COV1 3ATGA 3CO2A 3WW3A 3BODA 3E6CC 5BUVA 2GC2A 3QH6A 1ZRDA 1Y9MA 1GU3A 5HXMA 4QX0A 4CCLA 5IVCA 5LRRA 1MZEA 4H14A 2OKXA 2OQ7A 4L92A 3ZKUA 3AXDA 2ZJCA 2J42A 2I74A 3ZPYA 2LTNA 2VVEA 1OLRA 2XQXA 4IDZA 5A7PA 4AQSA 4CDXB 4QKNA 4UI9L 5ABJC 2PA7A 3DF0A 3MV01 1L7QA 4GIQA 2EXHA 4D3WA 3KV5A 4Y5SA 5HPOA 2K9ZA 4AI1A 1RUF3 1MS0A 2DWRA 3P1IA 3PUIA 4CP9A 2VO5A 4JC1A 2GZWA 2A71A 3SKJE 3WZ1A 5FZOA 1A78A 2VOVA 2A6XA 3UGGA 5FJHA 4WZCA 3OOXA 3PMSA 4M4RA 4NHMA 3ZFFA 5T55A 2YY1A 3AFGA 1NA1C 2VCBA 3I3QA 4NPMA 4AR2A 1BYHA 3K4AA 1WGPA 2WS93 2XR4A 5GLVA 3OSDA 4CTEA 1WCSA 1PIV3 3NL1A 2WNEA 1DGRN 3LCPA 2VC9A 1CZVA 5FP9A 5L73A 4A3ZA 4Y33A 2W39A 5ACA1 1ZBA1 2BZDA 1I3HA 2Q8OA 4LKFA 5A3MA 3HQXA 5CFCA 4MGKE 1S2KA 1G9FA 3WLUA 4A42A 3JD71 1VRBA 2A3YA 2V4VA 3I3BA 3LFMA 3OEBA 4ATEA 4HPKA 3ST7A 4XACA 3V65A 2BNOA 2LM3A 2QQLA 4R52A 1XPWA 4Y1UA 5FDBA 4PLNA 2ZMNA 1ULEA 2CHHA 5IVYA 4BMEA 2JG8B 4KL1A 1FI2A 4G3YC 2PAEA 2ZX4A 3POIA 3HT1A 4BHPA 1UY4A 5T54A 4DXTA 5FZ8A 1UPSA 5CKMA 1FPN1 1DQ0A 4K9SA 4N53B 2WN3A 5LEKA 5FYYA 4X8PA 4XMAA 5EIYB 4NIIA 5DDJ3 2R063 2WQ8A 4FXGB 1FATA 1RUJ1 4L8QA 1UOGA 2JXAA 4FPGA 3FBMA 2WA4A 1TMF3 3BUCA 2D3PA 2QUOA 1FYUA 2ARAA 1FX5A 1BBT2 1H9WA 3GNEA 3IT8A 4PLMA 2EIBA 3SH4A 1U5ZA 4LHLA 4FFFA 4PF5A 4XQWA 1VAMA 1FOD2 3THTA 1VBD1 3MUY1 2YUEA 4K3UA 4XUOA 5FAXA 4YW2A 1XYOA 5FZCA 4HG6B 5FV3A 4A4AA 1XYPA 5KBFA 3BN6A 1N1YA 2J1TA 4OFGA 1YFWA 1RJ8A 3KGZA 5EJ1B 4CSWA 4LBQB 1K5JA 2KR2A 3LA3A 3AP5A 3PLQA 3VZLA 3O1UA 2C0ZA 5IK8A 3UKVA 3LD8A 2Y6LA 3PTYA 3ZKYA 1ZRRA 1JYNA 1YI7A 5FY0A 1R1A2 3LZZA 3UJQA 1LENA 3KZ4C 1KFUL 4Q4Y1 1V70A 2ZX1A 4XAEA 1ASJ1 5FYVA 1PO21 1SBDA 1W90A 4QX7A 2HWF3 5ERLA 3C7HA 3SEEA 3VHPA 2C6SA 4CDQB 4Q4V3 1QHDA 4P5YA 1ZBA3 4QPIA 3VN4A 4FTSA 2XUEA 3I49A 5E1RA 3WQ1A 3OBZA 3LA2A 1S55A 3JXSA 3AZZA 4TLFA 4XPVA 4KG8A 2RDSA 1LAJA 1QQP3 4XABA 1MS8A 1QJX3 5FZ3A 2VY0A 1E5SA 3ENRA 1RUC1 1G7YA 2VM9A 3BOWA 3I7DA 2DU0A 2RS51 4FPCA 4HT1T 4JGZB 3C7GA 3T2PA 2HWD2 2BNNA 4ARXA 1XYNA 4XBLA 3TNPB 3VBOA 1CZSA 4XQDA 3R6SA 2P3YA 4RHV2 1XE0A 1W0NA 3FHIB 4IV1A 3WT3A 5A80A 3HN1A 1FMD2 1OLMA 4O61A 1CPNA 1D4VB 4KWLA 2N7GA 3POSA 5JIAA 5IWFA 1G9CA 1QKQA 4F8AA 1HB2A 1XOYA 4MGYE 3BTAA 1OOPA 2CWSA 1C8M2 2J1EA 4KQ7A 5IVBA 2WAOA 1E5RA 1KDKA 3WDWA 1OI6A 1ND3B 2VMEA 3B94A 5ABJB 4BLIA 4Q0UA 2QDRA 3LDRA 3WNLA 5FYBA 3RYPA 4RL7A 1L3JA 4AGGA 3MIGA 1H2KA 4MXWB 1JTZX 1XNBA 5HV0A 2EXJA 3UETA 2OZJA 4S2FA 5HCAA 1RVF3 3RZJA 2RE9A 1PO13 2VNOA 3ZFEC 1W6QB 4QKDA 2NQYA 3RMXA 3DECA 3RZLA 2QTWB 1PO23 3I2KA 2BEOA 3WQ7A 1NY72 2FDIA 3M2MA 4YW3A 2W9XA 5L9VA 1R083 4META 3V56A 4EQVA 3HEIA 1GMMA 4WM8A 1MQTB 1VBB3 1W0PA 2DV9A 4QDRA 3JUUA 1HV1A 1S0JA 4LK6A 4KU8A 1Q8OA 2QQWA 1OVSA 3IMMA 1RUD3 3OD0A 2W5FA 1F31A 3IIAA 3KCYA 4HETA 2WWJA 3B9CA 2GP5A 1DZQA 4KBBA 2A3WA 3H1YA 4CP0A 1SQ4A 3G6JB 4HLTA 4ZXKA 1F2NA 3CL1A 3KV6A 4AEKA 1HB1A 2D40A 2EAKA 3AZVA 3N9LA 3AFKA 2B45X 3PIGA 4P9GA 2WFF2 2WKKA 4NJ4A 4LA3A 1W3VA 3ZSJA 4LOTA 1US2A 1DQ1A 3N9NA 3Q8BA 2PHUA 5LY2A 3KT7A 1DP0A 4FFHA 3IDCB 4EROA 2XBO2 3KM5A 5HCBA 3WSOA 4H7LA 4CDXA 2VZQA 1VBA3 2FDGA 5C6CA 5LA2A 2P5BA 3KCXA 4FCAA 4X8NA 4B3NA 4M3CF 4GH4A 1ZBE3 1CESA 3VGIA 2ORXA 4F7ZA 3WNPA 1HQNA 3H8OA 3O0VA 4W4ZA 2RDQA 1WW6A 4UF0A 1ZZ7A 3SCFA 2ZTNA 2ZS6B 4LQRA 3BIEA 1V9U2 1ZM1A 4MHUA 3D0JA 5T5JA 1BBT1 2BFUS 4MHRA 3S7IA 1GLHA 5FTTC 2F17A 1IG0A 1FOD1 2CV6A 2HWE3 5GALA 1WLCA 4PI2A 3RFRA 3PMEA 4GULA 5FPAA 4LBMA 3LPGA 4DEQA 1B35B 4D6RA 4DXZA 3RZKA 1D0GA 1DGWX 4IV3C 5A32A 5BNNC 2VQUA 4UXAA 1MEC3 5C3OA 1R1A1 1TZOA 2WQ4A 3TYJA 2F4PA 4K21A 1HJFA 4XHBA 4XJZA 4UBHA 4BQ5A 4HVOA 3AXEA 2E53A 3OYWB 4OUMA 2L9LA 4NAMA 1AL0G 4NWVA 3ZIXA 2JG8A 1XSQA 3N7LA 5JOWA 1PVXA 3VZJA 5JPMB 2VXJA 4M0NA 4CCEA 1JOBA 3HR9A 4QD2A 4COWA 5DG2A 4N53A 5DZEA 3OGSA 1NCRA 4FOWA 4AAXA 1G9BA 2R043 2NZ9A 4RN5A 4YW7A 3VBHB 4AQ2A 3WG3A 1H4GA 3C3VA 1UY2A 2EVXA 4NUBA 1RGSA 3ACLA 3S0MA 2YXSA 1U5XA 3ZR6A 2HWD1 5JWPA 1Q8QA 4QGMA 2BNMA 2OPWA 4LNVA 5C33A 5FMCA 4XUNA 5T52A 4LE3A 5FP8A 5CVRA 1TNFA 5A3WA 3P3NA 1GWKA 1PHMA 1PVC2 2PHDA 4HOOA 4RHV1 4LT5A 2JE7A 1WA4A 4V2WA 2G9GA 3NAPB 1GWLA 5A33B 1FMD1 3Q8AA 2YC4A 4J6GA 1QJU3 2RMU2 3RYKA 4LBQA 4O9GA 1QEXA 5LWBA 2IVIB 4WM7A 2QQMA 1AZDA 1C8M1 4TXWA 1VALA 2QZ2A 4QB6A 5F3CA 3RVHA 1REFA 4JDMA 3O1VA 1Y7BA 2WJSA 4ZU5A 2XJSA 1HB4A 4OMDA 3LQCA 5JI7A 3ZFFC 3D3AA 2SBAA 4CCDA 4GKYA 3NJVA 5FYUA 4OHZA 3KVAA 3ZFEB 3ON7A 1OFSA 4PHZA 1EAH2 3M3QA 4ES8A 1K45A 3O12A 1R1A3 4A3XA 1AYN3 3FJSA 1YJLA 4TWTA 4FTEA 1CN1A 3JU9A 2RDRA 2DVBA 3T4HB 1MACA 1UAIA 3MW4A 1BJQA 3VD3A 1SEFA 4K1YA 2UURA 5J98B 3ILRA 5CFCC 2AEZA 4Q4W3 4MOAA 1LHVA 4IEOA 3CZJA 4OQ8A 2VJXA 2YC2A 2A5ZA 4IE0A 1QWRA 3V64A 4NR1A 2VH9A 5A7WB 2UWBA 3ZR5A 2FDFA 1PNFA 1AR83 1KGYA 4P9IA 4KWKA 1UY1A 4UAPA 4Y1YA 1KITA 4RD7A 3R4DB 1IS6A 1O6UA 1VB4A 5KR7A 5FZDA 2WFF1 4Y20B 3CEWA 3WR0A 3UJOA 2ARXA 3B9IA 4GB33 4RHV3 1B09A 1ND3A 5FZ6A 2BOIA 5GZDA 3OY8B 5DAXA 4QQPA 2QDNA 1FXZA 1LHOA 1WZXA 2XBO1 4XF0A 1HKDA 4Y5TA 4CE8A 2X05A 2LALA 2DCJA 1UXXX 1VBC2 2VBDA 2W92A 4JHTA 3RYRA 4LR4A 2ES3A 4FAHA 3J8F2 3NW4A 2DVAA 1BCXA 1UU4A 3FL7A 3FBYA 1W6QA 4IE6A 4Y1VA 3E6DA 4CCOA 1ZZ8A 2FBEA 3LWCA 4CU6A 4RA0A 4XIOA 5DUWA 5FKCA 3CQOA 4IEUA 5EYYA 5LASA 3IIIA 5I0SA 1J59A 2Q4SA 1V9U1 4FFIA 3I2GA 4FPHA 5A7NA 1GFF2 4NE9A 1MQTA 1LCLA 4KMQA 3O1SA 4BQ2A 3MYXA 5FXWA 3DYMA 5GKAC 3GBGA 3T2QA 5JIUA 5FZMA 5DUUA 5L9BA 1BEV2 3SMHA 3LIGA 2WO7A 3LEMA 2ZEYA 4I0WB 5CEHA 5KHJA 2XOMA 2Z4FA 1SFPA 3D4KA 3NNJA 4IV3B 5BNNB 5K4LA 4CRQA 1UPIA 5LK7B 1QNYA 3N7MA 3H7YA 4IEQA 5C3PA 5FWJA 2PXJA 2WWUA 2YROA 2ZPXA 3B93A 1NYWA 3Q8EA 2XB6C 5IVFA 1OPMA 4LLFA 2VOXA 2CTVA 2C4XA 1GQHA 4KNCA 3CHXA 4I3GA 3ETQA 1DCSA 3DV8A 1HQLA 1KDMA 3T3YA 2JDPA 3OB8A 3PJYA 5AVPA 5T3NA 3GJAA 3VDDB 1AYM2 5APAA 5CA6A 2WRAA 4KH9A 4RGAA 4Q0SA 2WT0A 4NRPA 5GLUA 4BH9A 1IGOA 1RUF2 4V2VA 2XUMA 3IDBB 3RNSA 4JCKA 1TVGA 3IAQA 1DLLA 2C9KA 1W04A 1OOPC 2QQOA 3WNOA 5I91A 5LCWL 5C3QA 3VB9A 1NCQA 3T08A 5FFOC 3BVCA 1DYPA 2JDNA 4Q4X3 3W58A 1VP6A 1SLLA 4YSFA 2VZSA 4JKLA 2W3JA 2CGPA 5J1XA 2OZ6A 1JOJA 1PVC1 2D3SA 4KI5M 3WX5A 4OYUA 1OMIA 2BERA 2FDJA 3WXPA 1PGL2 4XFFA 1V9U3 4GD4A 3HBZA 1B35A 5IFPA 2WS92 2RMU1 3MEPA 4MGZE 5ANQA 2KM2A 5FZOB 1PIV2 2FZ2A 1YQ8A 5C70A 4AHXA 1OBNA 2CWMA 4GAZA 3HIFA 3POGA 1S2BA 1NUKA 1XNKA 5FZ1A 1GP5A 1GQGA 1HW5A 4QXKA 2FD8A 1REEA 3KF5A 3I8TA 5A6YA 4WM8C 1LGCA 4HKWA 3R4UA 3O1OA 1DQ6A 2JB4A 1HLCA 3QLQA 3EYPA 2WDBA 3LOIA 1OF4A 1RMU3 3GGLA 3GJBA 4M00A 5SV5A 5A6XA 4Q5OA 1CPMA 2Q1MA 1S0BA 1C1FA 4LO8A 5CKQA 1EAH1 2AENA 4Q1PA 1LODA 2HBTA 1UN1A 1UX6A 4IEZA 1W2UA 3UGHA 3M8LA 2VNGA 1U0AA 1UWWA 3VBHA 5A3UA 4YM2A 3B3QE 5IVEA 3IWZA 4E2SA 1KEXA 1XNCA 4CPBA 1RUI3 1N1VA 2VTFA 2ADDA 5DDJ2 4FFGA 2R062 4FPJA 4BQ1A 1JU4A 1YJKA 3ABZA 3NNGA 5A3PA 1T2XA 1JUIA 1WW5A 1TMF2 1XBFA 4IEYA 3RSJA 2QZ3A 3EXUA 4NROA 4CDXC 5JAXA 4FTBA 4NOTA 3NAPA 4KWUA 2HH9A 1TE1B 5A33A 2CL2A 4C0BA 1NG0A 1N3PA 4MGSA 3RS6A 3GCXA 2WWSA 4GH4C 1HRI3 2FCVA 3KWVA 4AVCA 3WQBA 4BDVB 3I3MA 4FXKB 1J3RA 4EWDA 3C2UA 2BFUL 3LSDA 1HJGA 2YBKA 4BMBA 1J83A 2FZ1A 5CISA 4NO4A 3IZOA 4XXAA 3PVOA 4HKOA 2E9QA 3DPRA 2VUAA 5IW0A 1VBC1 1DYKA 4MLOA 4ZONA 3VDCA 3ZFEA 4UW4A 2I2SA 2RG4A 4KG0A 4I2OA 4D6QA 1X82A 3J8F1 1N1SA 2HWF2 4QHZA 3SXWA 3AZWA 4BXFA 4GMP0 4N90A 4BQ3A 5C9AC 2IXCA 4Q4V2 3DCQA 5IJRA 2IXHA 2OUJA 2JE9A 5FXXA 5DZFA 1AXYA 3GM8A 3M3IA 3VD4A 3FHAA 1BXHA 2D5HA 3E5QA 1OKOA 1VE0A 3OGJA 4UT5A 1NE6A 3NNMA 3K2OA 4UFJA 3WQ0A 3CIHA 4HBNA 5IUQA 1EP0A 4OI2A 1QQP2 2P6CA 1SDDB 1QJX2 1JS9A 4XDOA 3H3UA 1ZRFA 3OGGA 2VZ3A 4PBOA 2XLGA 1VRH3 2Y60A 1BEV1 5FZ7A 3LFIA 2J1VA 4P02B 2DDUA 1WUVA 4MZUA 4QXHA 2ET1A 2AGSA 5HXVA 2ZGPA 1ENQA 1F4AA 1Q8VA 2GMEA
chains in the Genus database with same CATH topology
1XC6A 2WQ8A 4M4PA 2ID4A 1UZ0A 3MBWA 5DMYA 1NX9A 2EIBA 3MUY1 4XUOA 3I2FA 2JKXA 3VD9A 4HG6B 2B4KA 4A4AA 1UYXA 2WABA 3BN6A 2J1TA 5EJ1B 4L0PA 2VZOA 2Y6LA 3K77A 2W91A 1JYNA 1OH4A 3AC0A 4CUBA 2Y8KA 2J1SA 3SEEA 3C7HA 1GQPA 3OBAA 4P5YA 4OZOA 3LPFA 4LHSA 4P08A 2VMFA 2W87A 2QBXA 2WN2A 3JXSA 5G05L 3T0BA 1GUIA 2WAAA 4CVUA 1W99A 4JKMA 4XVHA 2VR4A 4CU7A 3SKVA 3C7FA 3VD5A 1UXZA 1RYYA 1CX1A 2VM9A 3T2PA 2YFUA 3C7GA 2VCCA 4ARXA 3OGRA 1O59A 1H6YA 4QDQA 1CZSA 3A22A 3W5NA 3K46A 3WEZA 2W1UA 3DYOA 1W0NA 4ARYA 2W1WA 4QX1A 1PX3A 2VL4A 1OT5A 2J1EA 4UOJA 2WAOA 4RYDA 1GOFA 2RJ2A 2BGPA 2VMEA 3A7QA 1R64A 2X09A 2XHNA 2VZUA 3C7EA 3ETPA 4MGQA 3WNLA 5JXIA 1CZTA 3FHQA 3UETA 3T2OA 4E8DA 5JXGA 4ZXEA 3SEPA 3DECA 4XURA 3I2KA 1CIYA 4A41A 2VMCA 2W9XA 4PF1A 3BGAA 3HEIA 1GMMA 3IAPA 3LE0A 4QDRA 4PQQA 3WNMA 2QQKA 4QX2A 2WYSA 1JYWA 3ECQA 2W5FA 1J84A 3LEGA 2V72A 5IYYA 1JZ6A 4P00B 1GNYA 1GOGA 4CUAA 1JYXA 4ZY9A 3HJRA 4CU8A 2WO3A 2VZPA 2W47A 5EJZB 3DYPA 4BXSV 1ULPA 2WZEA 3EB7A 1ULOA 1US3A 1H6XA 1US2A 2EIEA 1F4HA 1DP0A 2WO2A 2WZ8A 4IUGA 3WSOA 2VZQA 1UY3A 5LA2A 2CDOA 4CU9A 2JDAA 2W46A 1GOHA 1W8OA 2J1RA 1HN1A 2ORXA 2ORZA 3WNPA 4W4ZA 4BK4A 3WNNA 2X10A 4LQRA 3IDAA 2J7MA 4AG4A 1WCQA 3A23A 1JZ3A 2BGOA 1UX7A 2Y6JA 2ZXQA 3K4DA 4D8MA 3ACIA 4W8JA 4QB1A 2DCKA 4XUTA 4BJ0A 4DEQA 3LPGA 3K75B 4W50A 5C71A 2ZEZA 3IB3A 1JZ4A 2VQUA 3K4ZA 1O8SA 4DUWA 3I97A 1JZ2A 4OMCA 1K42A 4LKSA 2JD9A 4DUVA 3I2IA 2EICA 2L9LA 4A44A 3PUHA 4JKKA 4JHZA 1MPXA 1JHJA 3C8XA 4XUQA 3NRUA 3OGSA 4Z2AA 3I2HA 4AAXA 1W9SA 3LEKA 4RN5A 3WF2A 3T0AA 1UY2A 4DXSA 2VZ1A 3HNBM 3HN3A 2J1UA 4XUNA 5JR2A 2VZVA 3WF1A 5IFTA 2VZRA 1NAEA 2YC4A 1PMJX 3J7HA 2QQMA 4XZUG 4TXWA 4QB6A 3CMGA 3ACFA 1OF3A 5B4XA 3ACGA 4OMDA 1UY0A 5JXHA 1UYZA 3LQCA 3D3AA 4FI9A 3E1F1 1EUTA 4DEVA 3LEIA 2EIDA 3NJVA 5F7UA 5IHRA 1DLCA 1K45A 2E31A 1I5PA 3MUZ1 3HOBA 4PT6A 5G04L 4TTGA 3VD3A 2VMDA 2Y6KA 2VQTA 4YPJA 5C7GA 4MOAA 5CYYA 3CZJA 2VJXA 4D0QA 2V5DA 2YC2A 1PMHX 3NQHA 2W1SA 2Y6GA 3CKHA 1BHGA 1SG3A 5JXJA 1KGYA 2ZEXA 1UY1A 4UAPA 3P6BA 4QB2A 1JZ5A 5DN2A 1WKYA 1JYVA 3VD7A 2Y64A 3GXUA 3T0DA 1NKGA 3W5MA 1O8PA 1D7PM 5CZKA 2QQNA 2X05A 3I3EA 2DCJA 2W95A 4GWIA 1UXXX 2ZEWA 2W92A 2R7EB 3OG2A 3FL7A 4JX0A 3UNPA 4CU6A 3CQOA 2QQJA 3HNMA 3IIIA 1TG7A 2HYXA 1P8JA 3I2GA 5B4NA 1UYYA 4KMQA 1K3IA 2VCAA 3DYMA 3T2QA 2LS6A 3I3DA 3THDA 3THCA 3OEAA 4ZZ5A 1JZ7A 2ZEYA 2XOMA 2Z4FA 2B9VA 5DQ0A 1YQ2A 2JE8A 1W9TA 1JI6A 2QQIA 4QPWA 2W1QA 2RVAA 3WNKA 2E26A 2E32A 2WBKA 2J22A 2C4XA 5EIYB 3WF4A 1UMHA 5LA0A 3OB8A 1LNSA 5JUVA 3I2JA 2LW8A 3FN9A 3U37A 3MV11 2VZTA 5LA1A 1TVGA 3IAQA 2C9KA 2QQOA 3WNOA 5LCWL 1PX4A 3VDBA 2WUHA 3T08A 5DPNA 2Y6HA 2VZSA 4JKLA 2W3JA 4GWJA 2XONA 4XUPA 5J1XA 4KI5M 4OYUA 2BERA 5FUIA 4QDSA 5IFPA 5I0DA 2E33A 4QX3A 5C70A 1SHWB 1W9WA 1NUKA 4CUCA 2KD7A 1EUUA 3MO4A 4LPLA 1W8NA 2YFZA 2WDBA 3EYPA 1OF4A 3GGLA 2WO1A 3ACHA 1L7RA 4OUEA 3A21A 4QAWA 3VDAA 2J1AA 1UWWA 1GU3A 2BBAA 4QX0A 5HXMA 1OD3A 2OKXA 2VOTA 1KEXA 2HLEA 2VTFA 1UMIA 2YG0A 4E8CA 2XQXA 1JU4A 3ABZA 4UI9L 3NNGA 3MV01 2PQSA 1T2XA 1L7QA 4A45A 1JU3A 5HPOA 3GDBA 1IQDC 1XNAA 4KWUA 3P1IA 3PUIA 2VO5A 3SKJE 4MGSA 4DUXA 3HNYM 3CDZB 1XNTA 5JMOA 2YB7A 3WQBA 3HPNA 4BDVB 5A1AA 4M4RA 4DXRA 1J83A 4MO3M 3OGVA 2VCBA 3NJXA 2W94A 3K4AA 1JZ8A 4BK5A 4ET7A 1K12A 3VDCA 3WF3A 2CDPA 3WF0A 4GZ9A 3CZUA 4A3ZA 2VC9A 1CZVA 5IJRA 2BZDA 3C7OA 3F2ZA 3T09A 3GM8A 3VD4A 3FHAA 4A42A 3OEBA 3I3BA 2V4VA 3CIHA 1DYOA 3ZM8A 4A6OA 2QQLA 1SDDB 1XPWA 2VZ3A 2RV9A 3UESA 2C26A 2J1VA 4P02B 2DDUA 1UY4A 4DXTA 4MADA 2WN3A 1F4AA 4ZZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XC6 A;  2WQ8 A;  4M4P A;  2ID4 A;  1UZ0 A;  3MBW A;  5DMY A;  1NX9 A;  2EIB A;  3MUY 1;  4XUO A;  3I2F A;  2JKX A;  3VD9 A;  4HG6 B;  2B4K A;  4A4A A;  1UYX A;  2WAB A;  3BN6 A;  2J1T A;  5EJ1 B;  4L0P A;  2VZO A;  2Y6L A;  3K77 A;  2W91 A;  1JYN A;  1OH4 A;  3AC0 A;  4CUB A;  2Y8K A;  2J1S A;  3SEE A;  3C7H A;  1GQP A;  3OBA A;  4P5Y A;  4OZO A;  3LPF A;  4LHS A;  4P08 A;  2VMF A;  2W87 A;  2QBX A;  2WN2 A;  3JXS A;  5G05 L;  3T0B A;  1GUI A;  2WAA A;  4CVU A;  1W99 A;  4JKM A;  4XVH A;  2VR4 A;  4CU7 A;  3SKV A;  3C7F A;  3VD5 A;  1UXZ A;  1RYY A;  1CX1 A;  2VM9 A;  3T2P A;  2YFU A;  3C7G A;  2VCC A;  4ARX A;  3OGR A;  1O59 A;  1H6Y A;  4QDQ A;  1CZS A;  3A22 A;  3W5N A;  3K46 A;  3WEZ A;  2W1U A;  3DYO A;  1W0N A;  4ARY A;  2W1W A;  4QX1 A;  1PX3 A;  2VL4 A;  1OT5 A;  2J1E A;  4UOJ A;  2WAO A;  4RYD A;  1GOF A;  2RJ2 A;  2BGP A;  2VME A;  3A7Q A;  1R64 A;  2X09 A;  2XHN A;  2VZU A;  3C7E A;  3ETP A;  4MGQ A;  3WNL A;  5JXI A;  1CZT A;  3FHQ A;  3UET A;  3T2O A;  4E8D A;  5JXG A;  4ZXE A;  3SEP A;  3DEC A;  4XUR A;  3I2K A;  1CIY A;  4A41 A;  2VMC A;  2W9X A;  4PF1 A;  3BGA A;  3HEI A;  1GMM A;  3IAP A;  3LE0 A;  4QDR A;  4PQQ A;  3WNM A;  2QQK A;  4QX2 A;  2WYS A;  1JYW A;  3ECQ A;  2W5F A;  1J84 A;  3LEG A;  2V72 A;  5IYY A;  1JZ6 A;  4P00 B;  1GNY A;  1GOG A;  4CUA A;  1JYX A;  4ZY9 A;  3HJR A;  4CU8 A;  2WO3 A;  2VZP A;  2W47 A;  5EJZ B;  3DYP A;  4BXS V;  1ULP A;  2WZE A;  3EB7 A;  1ULO A;  1US3 A;  1H6X A;  1US2 A;  2EIE A;  1F4H A;  1DP0 A;  2WO2 A;  2WZ8 A;  4IUG A;  3WSO A;  2VZQ A;  1UY3 A;  5LA2 A;  2CDO A;  4CU9 A;  2JDA A;  2W46 A;  1GOH A;  1W8O A;  2J1R A;  1HN1 A;  2ORX A;  2ORZ A;  3WNP A;  4W4Z A;  4BK4 A;  3WNN A;  2X10 A;  4LQR A;  3IDA A;  2J7M A;  4AG4 A;  1WCQ A;  3A23 A;  1JZ3 A;  2BGO A;  1UX7 A;  2Y6J A;  2ZXQ A;  3K4D A;  4D8M A;  3ACI A;  4W8J A;  4QB1 A;  2DCK A;  4XUT A;  4BJ0 A;  4DEQ A;  3LPG A;  3K75 B;  4W50 A;  5C71 A;  2ZEZ A;  3IB3 A;  1JZ4 A;  2VQU A;  3K4Z A;  1O8S A;  4DUW A;  3I97 A;  1JZ2 A;  4OMC A;  1K42 A;  4LKS A;  2JD9 A;  4DUV A;  3I2I A;  2EIC A;  2L9L A;  4A44 A;  3PUH A;  4JKK A;  4JHZ A;  1MPX A;  1JHJ A;  3C8X A;  4XUQ A;  3NRU A;  3OGS A;  4Z2A A;  3I2H A;  4AAX A;  1W9S A;  3LEK A;  4RN5 A;  3WF2 A;  3T0A A;  1UY2 A;  4DXS A;  2VZ1 A;  3HNB M;  3HN3 A;  2J1U A;  4XUN A;  5JR2 A;  2VZV A;  3WF1 A;  5IFT A;  2VZR A;  1NAE A;  2YC4 A;  1PMJ X;  3J7H A;  2QQM A;  4XZU G;  4TXW A;  4QB6 A;  3CMG A;  3ACF A;  1OF3 A;  5B4X A;  3ACG A;  4OMD A;  1UY0 A;  5JXH A;  1UYZ A;  3LQC A;  3D3A A;  4FI9 A;  3E1F 1;  1EUT A;  4DEV A;  3LEI A;  2EID A;  3NJV A;  5F7U A;  5IHR A;  1DLC A;  1K45 A;  2E31 A;  1I5P A;  3MUZ 1;  3HOB A;  4PT6 A;  5G04 L;  4TTG A;  3VD3 A;  2VMD A;  2Y6K A;  2VQT A;  4YPJ A;  5C7G A;  4MOA A;  5CYY A;  3CZJ A;  2VJX A;  4D0Q A;  2V5D A;  2YC2 A;  1PMH X;  3NQH A;  2W1S A;  2Y6G A;  3CKH A;  1BHG A;  1SG3 A;  5JXJ A;  1KGY A;  2ZEX A;  1UY1 A;  4UAP A;  3P6B A;  4QB2 A;  1JZ5 A;  5DN2 A;  1WKY A;  1JYV A;  3VD7 A;  2Y64 A;  3GXU A;  3T0D A;  1NKG A;  3W5M A;  1O8P A;  1D7P M;  5CZK A;  2QQN A;  2X05 A;  3I3E A;  2DCJ A;  2W95 A;  4GWI A;  1UXX X;  2ZEW A;  2W92 A;  2R7E B;  3OG2 A;  3FL7 A;  4JX0 A;  3UNP A;  4CU6 A;  3CQO A;  2QQJ A;  3HNM A;  3III A;  1TG7 A;  2HYX A;  1P8J A;  3I2G A;  5B4N A;  1UYY A;  4KMQ A;  1K3I A;  2VCA A;  3DYM A;  3T2Q A;  2LS6 A;  3I3D A;  3THD A;  3THC A;  3OEA A;  4ZZ5 A;  1JZ7 A;  2ZEY A;  2XOM A;  2Z4F A;  2B9V A;  5DQ0 A;  1YQ2 A;  2JE8 A;  1W9T A;  1JI6 A;  2QQI A;  4QPW A;  2W1Q A;  2RVA A;  3WNK A;  2E26 A;  2E32 A;  2WBK A;  2J22 A;  2C4X A;  5EIY B;  3WF4 A;  1UMH A;  5LA0 A;  3OB8 A;  1LNS A;  5JUV A;  3I2J A;  2LW8 A;  3FN9 A;  3U37 A;  3MV1 1;  2VZT A;  5LA1 A;  1TVG A;  3IAQ A;  2C9K A;  2QQO A;  3WNO A;  5LCW L;  1PX4 A;  3VDB A;  2WUH A;  3T08 A;  5DPN A;  2Y6H A;  2VZS A;  4JKL A;  2W3J A;  4GWJ A;  2XON A;  4XUP A;  5J1X A;  4KI5 M;  4OYU A;  2BER A;  5FUI A;  4QDS A;  5IFP A;  5I0D A;  2E33 A;  4QX3 A;  5C70 A;  1SHW B;  1W9W A;  1NUK A;  4CUC A;  2KD7 A;  1EUU A;  3MO4 A;  4LPL A;  1W8N A;  2YFZ A;  2WDB A;  3EYP A;  1OF4 A;  3GGL A;  2WO1 A;  3ACH A;  1L7R A;  4OUE A;  3A21 A;  4QAW A;  3VDA A;  2J1A A;  1UWW A;  1GU3 A;  2BBA A;  4QX0 A;  5HXM A;  1OD3 A;  2OKX A;  2VOT A;  1KEX A;  2HLE A;  2VTF A;  1UMI A;  2YG0 A;  4E8C A;  2XQX A;  1JU4 A;  3ABZ A;  4UI9 L;  3NNG A;  3MV0 1;  2PQS A;  1T2X A;  1L7Q A;  4A45 A;  1JU3 A;  5HPO A;  3GDB A;  1IQD C;  1XNA A;  4KWU A;  3P1I A;  3PUI A;  2VO5 A;  3SKJ E;  4MGS A;  4DUX A;  3HNY M;  3CDZ B;  1XNT A;  5JMO A;  2YB7 A;  3WQB A;  3HPN A;  4BDV B;  5A1A A;  4M4R A;  4DXR A;  1J83 A;  4MO3 M;  3OGV A;  2VCB A;  3NJX A;  2W94 A;  3K4A A;  1JZ8 A;  4BK5 A;  4ET7 A;  1K12 A;  3VDC A;  3WF3 A;  2CDP A;  3WF0 A;  4GZ9 A;  3CZU A;  4A3Z A;  2VC9 A;  1CZV A;  5IJR A;  2BZD A;  3C7O A;  3F2Z A;  3T09 A;  3GM8 A;  3VD4 A;  3FHA A;  4A42 A;  3OEB A;  3I3B A;  2V4V A;  3CIH A;  1DYO A;  3ZM8 A;  4A6O A;  2QQL A;  1SDD B;  1XPW A;  2VZ3 A;  2RV9 A;  3UES A;  2C26 A;  2J1V A;  4P02 B;  2DDU A;  1UY4 A;  4DXT A;  4MAD A;  2WN3 A;  1F4A A;  4ZZ8 A; 
#chains in the Genus database with same CATH topology
 4N53 C;  4COY A;  1H8V A;  3RMY A;  1ENR A;  2EXI A;  4AI9 A;  4Y20 A;  1MS3 A;  1NCR C;  2GMP A;  3NST A;  4SBV A;  2ZZQ A;  2EXK A;  3A0N A;  4FVV A;  1YQ5 A;  4HAN A;  4XF1 A;  4JQT A;  3OY8 A;  2BPA 2;  1NX9 A;  1XE8 A;  1C3H A;  4DY5 A;  1RUO A;  5DZG A;  1NLQ A;  2ZHN A;  3OBR A;  5FPB A;  4NWW A;  3EHK A;  2JKX A;  2C9A A;  3VD9 A;  2XQR A;  2NP0 A;  2C24 A;  4MXV A;  3J26 N;  3OJB A;  1MS1 A;  1D2S A;  3MFC A;  2CAV A;  4AQ6 A;  4BLJ A;  1QJE A;  1WW7 A;  1YQC A;  2B4K A;  4QGL A;  2WAB A;  1AYM 1;  2VXR A;  3PUQ A;  2VW1 A;  3U07 A;  5KC6 A;  1WA6 X;  3UGF A;  3BOP A;  2V4A A;  2Z5W A;  3KD4 A;  3POB A;  1APN A;  1GV9 A;  1GKB A;  1OOP B;  1QH7 A;  2VZO A;  3K77 A;  2W91 A;  3NV4 A;  1RUF 1;  1RVF 2;  3PUS A;  1H30 A;  4LMF A;  1GIC A;  1PO1 2;  4WM7 C;  3HWJ A;  4CCK A;  2Y8K A;  4H2A A;  1SLB A;  4DPN A;  1YI9 A;  4BOW A;  4OZX A;  2W52 A;  1R08 2;  1RJ7 A;  4OZO A;  4QQ2 A;  4UFM A;  3D0S A;  1VBB 2;  5JMC A;  5FUN A;  3HD8 B;  3KSC A;  2RM2 3;  5F1R A;  1PGL 1;  1DFQ A;  4P08 A;  4RQP B;  2VMF A;  1AX2 A;  1ODN A;  3LDK A;  2QBX A;  5BNN A;  1J58 A;  1VMH A;  2WAA A;  5DAB A;  1RUD 2;  1SFY A;  1W99 A;  2WS9 1;  2D43 A;  3CU7 A;  3FFZ A;  2VR4 A;  2ZX2 A;  4XVH A;  4ZPI A;  3U4S A;  4CU7 A;  3C7F A;  1PIV 1;  1KD7 A;  1UXZ A;  3IBM A;  1KJR A;  1TME 3;  1Y9G A;  1X8M A;  2ATF A;  4MX3 A;  1Y3T A;  4AI8 A;  1H6Y A;  4QDQ A;  1ZX5 A;  3LIH A;  3A22 A;  2JD4 A;  1CAV A;  3K46 A;  3RRD A;  3SCG A;  5L7O B;  1OVP A;  3W5N A;  3DYO A;  4W6X A;  2RJL A;  3L2Y A;  4URA A;  3SH3 A;  1CD3 G;  2UY8 A;  2W1W A;  4UW6 A;  1O5L A;  4FP2 A;  4XBN A;  4EN8 B;  5A3T A;  3VDD A;  2XLA A;  4DIQ A;  1VBA 2;  2VW0 A;  2QVS B;  4RGG A;  3R05 A;  4BE3 A;  3KV9 A;  1ENX A;  2D6O X;  5JCT A;  1ZBE 2;  4HFS A;  4RYD A;  4Z07 A;  2OW4 A;  3TAY A;  4PIX A;  2RJ2 A;  2ZA9 A;  1DHK B;  4EV0 A;  3A7Q A;  5H9R A;  2VD7 A;  1R64 A;  5DDJ 1;  2R06 1;  1OQE A;  1ND3 C;  2XHN A;  3C7E A;  5JXI A;  5I93 A;  1AYM 3;  1V6N A;  2E51 A;  1QOS A;  4Y3O A;  1TMF 1;  1XND A;  1V0A A;  5GZF A;  2OX0 A;  4EZH A;  4GH4 B;  3T2O A;  4CP2 A;  5JXG A;  1W05 A;  1DGW A;  4XUR A;  3UL2 A;  1RB8 G;  1KJL A;  2HWE 2;  4ISR A;  4UF0 B;  3VZO A;  4K20 A;  3OPW A;  1N3O A;  3TRS B;  3ZOI A;  3OF1 A;  5L19 A;  3IAP A;  2ADE A;  4IET A;  5ANN A;  5A7O A;  3VKF C;  4HK9 A;  3WNM A;  4TN7 A;  1EYB A;  5I8S A;  2Z42 A;  3ZSK A;  1JYW A;  2EIG A;  4RFT 0;  1MEC 2;  1MQT C;  1JHN A;  1PZ7 A;  3ECQ A;  3Q8C A;  3RZZ A;  1W3X A;  3FUQ A;  4LHK A;  2ENR A;  1LRH A;  5C9A B;  1PZ8 A;  2HYK A;  3T4V A;  2Q1F A;  4E9K A;  4JQR A;  1GNY A;  1JYX A;  4Y22 B;  2HWF 1;  2GH2 A;  3HJR A;  2WO3 A;  4I09 A;  3W59 A;  3KCC A;  4CU8 A;  3H8R A;  2W68 A;  4Q4V 1;  3POW A;  1BLZ A;  4JTN A;  5A32 B;  4XJA A;  3AMH A;  3AYC A;  5EJZ B;  4BXS V;  5FK7 A;  4H3W A;  2P37 A;  2AUY A;  5FMO S;  4I02 A;  3S5Q A;  3ZSM A;  2WO2 A;  4O9E A;  4IUG A;  1QQP 1;  2NMN A;  1QJX 1;  2R04 2;  4PQ9 A;  4UBG A;  2ZGT A;  3BTY A;  2JDK A;  2ZAC A;  4XDQ A;  4AE2 A;  4C91 A;  3RZH A;  4CU9 A;  1CQ9 A;  4Y5Z 0;  2TBV A;  1W8O A;  3WNX A;  2WC2 A;  4NIH A;  1ALY A;  1HN1 A;  3JQW A;  2ORZ A;  3N35 A;  2WLP A;  4B4P A;  1NCR B;  5J09 A;  5FYZ A;  1WBF A;  4FOY A;  2BDR A;  2Z69 A;  1L7L A;  3IDA A;  1WCQ A;  1ZVF A;  2XWJ B;  2Q0A A;  4GMP 1;  5LBE A;  3RZG A;  1AL2 3;  2CY6 A;  3O1M A;  1QJU 2;  1J3P A;  2Y6F A;  2ZXQ A;  4XTP A;  3ZIW A;  3KHC A;  4LBN A;  3IPV B;  1NXM A;  4D8M A;  3PIJ A;  4QXB A;  4NIA A;  2B5H A;  2WYF A;  3WCR A;  1YYN A;  1NCQ C;  3DEM A;  4QU1 A;  3ZN6 B;  3LGR A;  3BPS A;  3LB9 A;  3WY6 A;  1POV 0;  4BJ0 A;  4UW3 A;  1S0C A;  2XJP A;  4YVW B;  4E2G A;  1RXG A;  3OTF A;  4G4F A;  3AJY A;  3IB3 A;  1XQN A;  2Z79 A;  3KT4 A;  1B35 C;  4YG3 A;  2ZMK A;  4WM7 B;  1ACC A;  1JZ4 A;  4DY3 A;  1O8S A;  4GA9 A;  1RVF 1;  3I97 A;  4KGG A;  4XFI A;  1PO1 1;  4AED C;  2ZAH A;  1JZ2 A;  5CAD A;  5F9T A;  1AYN 2;  1K42 A;  3O0X A;  5CG9 A;  4XW3 A;  3KV4 A;  4AVB A;  1IS3 A;  4NIG A;  1H1A A;  3B02 A;  1R08 1;  2B9U A;  5F2W A;  2DFC A;  2K46 A;  5LK5 A;  1VBB 1;  2P1B A;  4Q4W 2;  2YV8 A;  2YBP A;  3WP5 A;  3RJ2 X;  3ZN5 A;  5H9Q A;  3PUH A;  3RPQ A;  5LY1 A;  3LKJ A;  2H0B A;  2XML A;  4N7U A;  2HWB 2;  1JHJ A;  1OXC A;  2P17 A;  3NRU A;  1RUD 1;  4XUQ A;  1ONA A;  4B4R A;  3V0A A;  3I2H A;  3ZSE A;  1GWM A;  5A70 A;  5KHH A;  1W9S A;  1AR8 2;  3LEK A;  3WDV A;  4XE9 A;  4BQW A;  1S0D A;  4S2G A;  4AF9 A;  5FY4 A;  3VBH C;  2VZ1 A;  3HNB M;  4MUV A;  5FPU A;  4LHN A;  5J7M A;  1M4W A;  3BPZ A;  3HQR A;  4OHX A;  5T5L A;  3WG2 A;  3WDY A;  3GCW A;  4R8H A;  4Q27 A;  1MZF A;  2HJI A;  3AP9 A;  4GB3 2;  2Y38 A;  3PL0 A;  4PDW A;  3BTX A;  3O5S A;  1XB9 A;  3T1M A;  4GMP 3;  3USS A;  2VZR A;  3N9O A;  1UZY A;  5E89 A;  1Z7S 3;  1VBA 1;  3NAP C;  1YC6 1;  2QNK A;  3AMP A;  2Z2S B;  4P9L A;  3J7H A;  1IOA A;  2ZZJ A;  3OPZ A;  5C4W A;  4CEY A;  1XRU A;  2CU5 A;  3QBQ A;  4LEJ A;  1SLA A;  4A2U A;  2YDE A;  3PU8 A;  4Z92 B;  1ZBE 1;  4BIO A;  1Q43 A;  4XJ9 A;  1O4Z A;  2YHJ A;  4FO9 A;  3VL9 A;  4K6B A;  3U11 A;  1UO9 A;  2PHR A;  5FMD A;  1UYZ A;  4Q8L A;  4C8D A;  1J3Q A;  3E1F 1;  2P3J A;  1R1Z A;  2XKO A;  5CFD B;  4LBQ D;  1EUT A;  1QOT A;  5FZH A;  2EID A;  4ITC A;  3DPR C;  4IGO A;  4MYE A;  4J1X A;  1BQP A;  4HSJ A;  1S0F A;  4PJY A;  2PAK A;  3GZT B;  4RQP A;  2IXJ A;  2D6K A;  4GQ7 A;  4QMA A;  4OHV A;  2JIC A;  5F8P A;  2E31 A;  1DQ5 A;  1W2T A;  1I5P A;  4AZZ A;  2HWE 1;  3MUZ 1;  1GR3 A;  4R9B A;  1YIP A;  4TTG A;  2GNB A;  5SV8 A;  2VMD A;  2Y6K A;  3AKP A;  3BAL A;  4M01 A;  1ZZC A;  3RWK X;  5JSR A;  2XG3 A;  2BTV C;  4YNI A;  3NWK A;  3GF6 A;  1MEC 1;  2ZGS A;  1G9A A;  3H3Z A;  1PMH X;  3NQH A;  1F5J A;  2W1S A;  3DN7 A;  3NJY A;  2Y6G A;  2ARC A;  5L7O A;  3BKZ A;  2GP3 A;  3VHN A;  3E6B A;  3A4U A;  2VCM A;  1Q56 A;  2G9F A;  1WMD A;  3H1W A;  4FT8 A;  1JUH A;  1OLM E;  5DN2 A;  3UK9 A;  4IGQ A;  1OH3 A;  1DQ4 A;  2LRP A;  1AVB A;  1SPP A;  3HBK A;  1YLL A;  1O3Q A;  3H0O A;  4QPY A;  1LOA A;  5BV6 A;  1RXF A;  3WP4 A;  4FPY A;  3GXU A;  4Q29 A;  5EP9 A;  2WNO A;  2R04 1;  4XIL A;  2GN7 A;  2QQN A;  2Y33 A;  5FLI A;  2DTY A;  2W95 A;  1E5H A;  4XMI A;  2ZX0 A;  4EN6 B;  1AXZ A;  2OUH A;  3H1M A;  4YZ3 A;  3OG2 A;  3CJI B;  3L2H A;  4Q4X 2;  3UNP A;  1UOF A;  2ZHK A;  4ISQ A;  3BYW A;  3VZM A;  3HNM A;  2HYX A;  1I6X A;  1WMX A;  2VW2 A;  4OI1 A;  3PDQ A;  1A8M A;  4OVE A;  5BYN A;  1UYY A;  1QJU 1;  3U78 A;  3URF A;  5KXD A;  1PM7 A;  2BQP A;  1NCQ B;  3TB0 A;  5FXV A;  5FP7 A;  1NLS A;  3FLR A;  2R1B A;  2AZ5 A;  1CR7 A;  3EMR A;  4RFR B;  3OEA A;  1OD5 A;  5C9A A;  1QXP A;  1T6G C;  1UW8 A;  4Y22 A;  4FAG A;  1OPO A;  4DFS A;  2VNR A;  2ERF A;  4FPF A;  2O8Q A;  2DCT A;  1YQ2 A;  2R07 3;  1AR9 3;  2JE8 A;  1RMU 2;  1UZW A;  1W9T A;  4JV4 A;  4AED B;  1JI6 A;  5IAX A;  2EAA A;  2QQI A;  1K5M C;  2D98 A;  2W1Q A;  1HRV 3;  1CAU A;  3M3C A;  3HQU A;  1O5U A;  1Z0H A;  3ME2 A;  4R4Z A;  1AYN 1;  4R9C A;  5FK8 A;  1LHU A;  4YFZ A;  2E26 A;  1JOP A;  2E32 A;  4N8M A;  2WBK A;  3AB0 A;  5FZ0 A;  4XOG A;  2Q8D A;  3H8X A;  4FQ4 A;  1EY2 A;  4YW1 A;  5FY1 A;  3ZO0 B;  4TZD A;  1QNW A;  1QXJ A;  1TEI A;  1OA4 A;  1RUI 2;  2MEV 3;  2VUL A;  4Q4W 1;  3BB6 A;  4E4H A;  1GNH A;  4N9I A;  2WL1 A;  2HWB 1;  4RSU A;  5DG1 A;  4AI2 A;  4E27 A;  3U37 A;  5AC9 2;  1NLR A;  2WNU A;  1EV1 3;  3AKS A;  3MV1 1;  3VDD C;  5C8C A;  3ES4 A;  3NNL A;  1AR8 1;  2D6P A;  4BYY A;  5FJK A;  2VZT A;  4JRL A;  2IFR A;  5LA1 A;  1QJY 3;  1S0G A;  5LBF A;  1QMJ A;  1AX0 A;  1HRI 2;  3ZPO A;  5DAV A;  3IPV A;  5D8A C;  5KXC A;  4YG6 A;  3AVR A;  2YYO A;  2Y6H A;  5GZC A;  1QDO A;  1PGW 2;  1BVP 1;  2XON A;  3EO6 A;  4GB3 1;  1KRI A;  4EJR A;  1RUE 3;  1GAN A;  4YVW A;  2F4L A;  1RUN A;  4Y1Z A;  3ZYH A;  1SLC A;  4AYU A;  3MF6 A;  2R49 A;  4BQY A;  1V6M A;  4N43 A;  2CAU A;  2Q8E A;  4MV2 A;  4YLZ A;  3JB8 A;  3BTZ A;  1X50 A;  2HEY F;  2C1F A;  2KD7 A;  3VBU A;  5FRA A;  1EUU A;  3DPR B;  4I3P A;  4AHZ A;  4OHW A;  4YAR A;  3K3N A;  1YFX A;  2JG9 A;  2V5Y A;  4XYX A;  4YGD A;  3A21 A;  3MFA A;  3ZSL A;  4O7X A;  4GJY A;  1BK0 A;  1GZ9 A;  5FZK A;  3O7O A;  1VRH 2;  2YMZ A;  5F3I A;  1SDW A;  5K9Y A;  5FMO L;  2J1A A;  3ZXK A;  4DRV A;  3S30 A;  1NY7 1;  4MVT A;  5F6L B;  3K51 A;  4A6S A;  1OD3 A;  3ALQ A;  2HLE A;  1OFN A;  1UKR A;  4UFL A;  4XCB A;  1UMI A;  2HBU A;  2NYY A;  3ZN4 A;  1CIW A;  5FO8 B;  3WVJ A;  4ASM B;  4BB3 A;  2HWB 3;  3D8C A;  2O0O A;  3ZXA C;  2PQS A;  4WZF A;  1POV 3;  1JN2 P;  1JU3 A;  5C5U A;  3GDB A;  5GLW A;  1IQD C;  3P5B A;  4BZ4 A;  4XJU A;  1XE7 A;  4XF4 A;  2V09 A;  2GNM A;  3PJQ A;  5FZF A;  4CPB D;  3HNY M;  4DUX A;  2XJT A;  3IN9 A;  5EPA A;  1W6M B;  2YB7 A;  4R4X A;  1MR5 A;  3HPN A;  1G86 A;  4LBK A;  4NVP A;  5A1A A;  4WVM B;  1IPK A;  3VHO A;  1BZW A;  1JMU B;  3MHZ A;  3M7A A;  4UWD A;  2JIG A;  3AVS A;  5T50 A;  2PLV 3;  1YRZ A;  2WZP P;  1JZ8 A;  2W94 A;  4E2Q A;  3RG0 A;  5CFD A;  4BK5 A;  3OUI A;  4ET7 A;  1K12 A;  1UQX A;  2VOW A;  4B7K A;  1F35 A;  3WF3 A;  2CDP A;  3KQR A;  1VAV A;  3WF0 A;  1G9D A;  4GZ9 A;  3CZU A;  1JH5 A;  1GZT A;  2VOK A;  4Q4X 1;  4AI0 A;  2ARB A;  4IEV A;  1C57 A;  3U14 A;  2ZAA A;  2DYC A;  3F2Z A;  3JZV A;  2RM2 2;  2E63 A;  5FZA A;  3H3L A;  5FY9 A;  1H1I A;  3APB A;  2RHP A;  2A73 B;  1YFU A;  3MLJ A;  2A70 A;  1DYO A;  1JBC A;  2QQP A;  3ZM8 A;  1BMV 2;  1N3Q A;  1YHF A;  2DU1 A;  1SLI A;  1UF2 C;  2RV9 A;  2VBB A;  1TME 2;  4IER A;  3UES A;  2WT2 A;  3VKN A;  2YZ4 A;  2DUP A;  2BGC A;  2VE1 A;  2Q30 A;  4QGN A;  5J48 A;  1LB2 A;  4IES A;  3RDI A;  3FFQ A;  3VUO A;  1RED A;  1UU5 A;  1K5M B;  1RMU 1;  3O0W A;  1XC6 A;  1SCS A;  2XKP A;  5FPZ A;  4LJH A;  4ES9 A;  4M4P A;  2ID4 A;  4QPG C;  5EHD A;  1DZT A;  1X7N A;  1IG3 A;  2VTX A;  3KF3 A;  2PHF A;  1DBN A;  5EFU A;  5DMY A;  2VVF A;  2ZAB A;  1C8N A;  4YVS C;  4CXY A;  2A6W A;  3AKQ A;  1ZA4 A;  3FUO A;  4EN0 A;  1W8U A;  3MGU A;  1S0E A;  1FAY A;  4COV A;  1LHW A;  3WW2 A;  5F5A A;  1CAV B;  1CWP A;  1QH6 A;  3N9P A;  1RUI 1;  3OPT A;  1R09 3;  3AP6 A;  2O8O A;  3CJI A;  4IQP A;  3TN9 3;  4PDW C;  2JKB A;  4XF9 A;  5I8T A;  4LTA A;  2AYH A;  5AC9 1;  2QQV A;  2XJV A;  1W8W A;  2D93 A;  2WNV B;  3AKR A;  3BCW A;  2NM1 A;  5E6H A;  4CEY C;  5C4W C;  3AC0 A;  5D8A B;  1RUG 3;  1SZB A;  4WVV A;  5D1I A;  2AR6 A;  1HRI 1;  1H2M A;  2GNT A;  2WZR 2;  1DZR A;  5TSW A;  3NO8 A;  1PGW 1;  2GN3 A;  5C3S A;  3W21 A;  2CGN A;  5F3E A;  4YWA A;  2W87 A;  4HN1 A;  3NV3 A;  3T0B A;  3WDU A;  2X5I B;  5G05 L;  2IXI A;  4CVU A;  4RQP C;  4HL0 A;  2YBS A;  3QAC A;  4AED A;  1IS5 A;  3MIH A;  1OA3 A;  3VD5 A;  3MF9 A;  2WFP A;  1JYI A;  4M0H A;  1RYY A;  2XGX A;  4D7S A;  5EJ3 A;  2ZGO A;  4Q26 A;  2FHR A;  3R4S A;  2YFU A;  2UU8 A;  2B8M A;  2OA2 A;  5F3G A;  5JOZ A;  1IS4 A;  4TLG A;  5FO9 B;  1AJO A;  2QCS B;  3AMM A;  3ZYP A;  2W1U A;  2ZBJ A;  3VBR B;  1KFX L;  2TNF A;  4NRQ A;  1V6K A;  5C5T A;  2Q5T A;  5FYC A;  3SC7 X;  5L7O C;  2ZX3 A;  1ULC A;  4XEZ A;  2P3I A;  1VRH 1;  4W6Y A;  2RS3 3;  1RUH 3;  3LDB A;  4GJZ A;  5DAQ A;  3TNQ A;  4AEJ A;  1GP4 A;  3MI8 A;  1OT5 A;  4JAA A;  4YGB A;  4RS5 C;  4GKX A;  4LK7 A;  1GOF A;  1DIW A;  3WOG A;  3ZXD A;  2RR1 3;  2GC1 A;  3TWI A;  2DUR A;  4XFB A;  2XWB B;  2P34 A;  3ZYI B;  3JB4 C;  4Z2W A;  2IC1 A;  4MGQ A;  2OVU A;  2VZU A;  3ETP A;  4KU7 A;  5KXE A;  3M3E A;  4PIY A;  3FHQ A;  5FYH A;  4B1M A;  1YWK A;  1AL2 2;  3MZH A;  3TOJ A;  4A7Z A;  1IKP A;  5FQ0 B;  1WLW A;  2Y0O A;  4Q2F A;  1SMV A;  4CP1 A;  1IPS A;  1O7F A;  3N7K A;  4ZXE A;  2VGD A;  1NZC A;  2P3K A;  2YGM A;  4LUK A;  1JXN A;  3WUD A;  1LKN A;  3ITQ A;  3IMN A;  1CIY A;  5T5P A;  1HDK A;  1OA2 A;  4EWE A;  1DU3 D;  1ZZ9 A;  3B00 A;  4JDO A;  2MNG A;  3BGA A;  5DXD A;  2ZCW A;  2DBN A;  3JBG 3;  1IHM A;  2QQK A;  3FWE A;  2WYS A;  4MGT A;  5FYS A;  4LKD A;  4Y4Y A;  1LGB A;  5BNP A;  4PLO A;  1J84 A;  5BPX A;  1AF9 A;  1D4M 3;  1SFN A;  1YIF A;  2V72 A;  3PNA A;  3SNM A;  3WG1 A;  4AFB A;  4XFC A;  5FZ4 A;  3N4M A;  4OI0 A;  1M06 G;  5KXB A;  1GSL A;  1V00 A;  2UY9 A;  3IDE A;  1ENS A;  4UW5 A;  1CX4 A;  2YGL A;  2WT1 A;  3ZYG A;  1WLD A;  3DYP A;  2RM2 1;  3FZ3 A;  4Q0Q A;  2BBV A;  3EB7 A;  3RQ0 A;  3CNA A;  1TNR A;  3TEX A;  2ZGN A;  5FRE A;  4PIZ A;  1BMV 1;  3N36 A;  5GM0 A;  2TUN A;  3ZYJ B;  1HB3 A;  1UY3 A;  5FYT A;  1TME 1;  2CDO A;  1F8V A;  1O4T A;  4B1L A;  2WQZ C;  5LZ6 A;  5JSP A;  1A34 A;  1W2N A;  2JDA A;  4FSJ A;  2J1R A;  1HXS 3;  3ZXF A;  4QPG B;  5FBJ A;  2A6Y A;  2X10 A;  5DUV A;  3V0A B;  1W6M A;  2Y26 A;  5A3L A;  4CXW A;  1VMJ A;  2J7M A;  2JDM A;  1JZ3 A;  2PHX A;  2WNU C;  4YVS B;  4I30 A;  5C8C C;  1Z7S 2;  1UX7 A;  1ULG A;  2Y6J A;  2W08 A;  1UD1 A;  4NHL A;  4WVM A;  4DZG A;  3K4D A;  5JDB A;  4AHY A;  1X36 A;  5CG8 A;  5C3R A;  4QB1 A;  3BU7 A;  5E16 A;  3UYJ A;  1QGL A;  2BRT A;  1W8T A;  3D82 A;  3J7N A;  4MGI E;  1AR7 3;  1KS4 A;  1J1L A;  4PDW B;  5FOB B;  1Q8S A;  3KVB A;  4QHB A;  1O4Y A;  2JDZ A;  4W50 A;  5GLT A;  3U4X A;  4YFW A;  4YVW C;  3B7M A;  4R9A A;  4CEY B;  2KA3 A;  5C4W B;  4FBF A;  3K4Z A;  4QQH A;  1LOB A;  2WIN B;  4DUW A;  2X29 A;  2YU2 A;  1QXR A;  4N43 C;  2FDK A;  2E7T A;  2JD9 A;  2JEM A;  4DUV A;  1WCK A;  1H8T C;  4OI4 A;  5JPN B;  2WZR 1;  2EIC A;  3VBU C;  4YGC A;  3EJK A;  4A44 A;  5FOJ B;  5JLV A;  1W9Y A;  2VAU A;  4AOC A;  4M3C A;  2A6Z A;  5BY5 A;  3U10 A;  2JDY A;  4AL9 A;  3AP4 A;  4JKK A;  1XXN A;  5JZG C;  2O14 A;  2BW8 A;  1EPW A;  1MPX A;  2JDU A;  1OQD A;  2JG9 C;  3POJ A;  4OHY A;  1K5M A;  4EZ4 A;  2GSY A;  4U2A A;  1C1L A;  1YEW A;  4RR3 A;  5HI0 A;  1AR6 3;  4NMI A;  3WF2 A;  2IXK A;  2EAL A;  3H8U A;  3TEZ A;  3NV2 A;  2BJS A;  2P2K A;  2XJU A;  4DXS A;  3ZLI A;  1V6I A;  1F15 A;  4ATF A;  4L2N A;  4BIS A;  2E6V A;  3E5U A;  3ILN A;  4JGY A;  5FMB A;  2J1U A;  2QFE A;  5FO7 B;  1CGP A;  2RJK A;  2NMO A;  4AW7 A;  2ZHM A;  3CF6 E;  4I0A A;  2VZV A;  4ZKT B;  2D97 A;  2E7A A;  3J4U H;  5IFT A;  4FPE A;  5FYI A;  3U75 A;  4U36 A;  2JEN A;  3SH5 A;  1VIW B;  4CYD A;  1G6N A;  1NAE A;  4AFD A;  1PMJ X;  4RS5 B;  4YGE A;  2WNV A;  3M70 A;  4XZU G;  1SPP B;  3FMG A;  3CMG A;  5D8A A;  3E97 A;  4XAA A;  2PAM A;  5B4X A;  3NV1 A;  1LU2 A;  3ACG A;  1UY0 A;  4GWN A;  1VBE 2;  5A3N A;  2D7F A;  1YCI A;  4J25 A;  1DF0 A;  4WVW A;  3ZXJ A;  4NN0 A;  1AL2 1;  4AVV A;  5IHR A;  2K0G A;  2ZKN A;  5CFD C;  2K2S A;  2YU1 A;  4V1P A;  2ZGL A;  4FOV A;  3GAL A;  4P9X A;  1UCX A;  2X5I A;  4M3C E;  3VBS A;  4YZ2 A;  1JYT A;  4A7K A;  1W2O A;  2QJV A;  3G7D A;  5CNA A;  4YM3 A;  3HOB A;  3I54 A;  2WZR 3;  4AQT A;  3ZX7 A;  1UZV A;  1F5F A;  2VQT A;  1H4H A;  2R07 2;  4P9Y A;  1AR9 2;  2A3X A;  2PN5 A;  5FIX A;  3AKT A;  4B29 A;  5FPX A;  2VQA A;  1GBG A;  2OPK A;  2ET7 A;  5CYY A;  3WW4 A;  3ZMN A;  3VBF A;  4XCA A;  2R16 A;  4EN7 B;  1RTV A;  1PZ9 A;  4YYO A;  1HRV 2;  1UOB A;  3N7J A;  3H7J A;  4QWN A;  1NT0 A;  3TBD A;  3KLS A;  1W8H A;  5CU1 A;  3VBR A;  5KWR A;  1QJF A;  3CKH A;  4LKE A;  1SG3 A;  5LAT A;  1E5I A;  5JXJ A;  2AEY A;  2ZEX A;  4IE7 A;  5IAT A;  2HWC 2;  1ND2 A;  3P6B A;  4ZU7 A;  1I1E A;  3ROU A;  1JZ5 A;  4LLO A;  1BKZ A;  4HKL A;  5A1F A;  2MEV 2;  4Q0V A;  1WKY A;  2GC0 A;  4B7E A;  1JYV A;  2R0H A;  1CAU B;  3VD7 A;  4LBL A;  1F9K A;  1RL3 A;  3BI3 A;  2ZHL A;  2Y64 A;  2JDH A;  3LF7 A;  1EV1 2;  2IVJ A;  2XVG A;  1LOE A;  5A1L A;  1GZW B;  1O8P A;  2VEC A;  5CZK A;  1H2N A;  3I3E A;  3AYD A;  5IK4 A;  1S2E A;  1QJY 2;  4CDW B;  2ZEW A;  1VPH A;  5FQ0 A;  3AMQ A;  3H50 A;  2R7E B;  1DDL A;  3LOB A;  4LO5 B;  4AGR A;  2XH6 A;  1RHI 2;  4JX0 A;  4QM8 A;  2RS1 3;  1Y9Q A;  3CJI C;  4DIN B;  2WNU B;  3MDP A;  4H55 A;  5D21 A;  5F32 A;  2QQJ A;  3T30 A;  5C8C B;  5K0U C;  1TG7 A;  1P8J A;  1RUE 2;  1W8Z A;  4YM0 A;  3CLP A;  5DUX A;  1Z7S 1;  2ZOE B;  4C1X A;  5FKB A;  5EV7 A;  4GWM A;  5DAP A;  4IW3 A;  1Q5O A;  3Q9O A;  3O1T A;  2OXB A;  2PHT A;  2PTM A;  2LS6 A;  3THD A;  1VB2 A;  1COV 3;  3THC A;  4FPK A;  1C4R A;  1U12 A;  3V0B A;  3RZM A;  4DO0 A;  2GH8 A;  3H42 B;  1NE4 A;  5FYM A;  5CB7 A;  4DOU A;  2AAC A;  2B9V A;  4MH0 E;  5JOY A;  1UYP A;  2JWP A;  5LB6 A;  5DQ0 A;  1SLT A;  4FPL A;  3LSE A;  4BWO A;  3ELN A;  4UYB A;  2BUK A;  4N43 B;  4QPW A;  5CKN A;  1GYK A;  3WP3 A;  2G1M A;  3WNK A;  1H8T B;  4CDU A;  1NQD A;  3DKQ A;  3VBU B;  3B5L B;  1KQR A;  2J22 A;  2VU9 A;  4LE4 A;  3L9J T;  3ZFG C;  3OUH A;  3MLK A;  3WF4 A;  3HT2 A;  5BNO A;  4L97 A;  2YC0 A;  3AZY A;  1UMH A;  5JZG B;  4QM9 A;  1V6O A;  4P14 A;  2JG9 B;  1LEM A;  4OUS A;  1UKG A;  2I07 B;  2UWA A;  3GBF A;  3MIF A;  4JTO A;  4MG2 A;  1LNS A;  5JUV A;  2VPV A;  2FCU A;  2LW8 A;  2DUQ A;  2PQQ A;  3FN9 A;  4N7I A;  2O1Q A;  1CON A;  2CYF A;  4QPG A;  5AC9 3;  3OBT A;  1H2L A;  3N3H A;  3ZN6 A;  1FV2 A;  4Q0P A;  3NVC A;  4SLI A;  4XFG A;  3AJZ A;  1ULF A;  4YVS A;  1UL9 A;  3PU3 A;  4LIT A;  3IKW A;  4CCN A;  1W8F A;  1PX4 A;  2QE3 A;  3WD5 A;  4DRR A;  1RIR A;  2R32 A;  5DPN A;  4DNY A;  4YG0 A;  2PEL A;  5ACA 3;  4L9B A;  1ZA7 A;  4XUP A;  1Y4W A;  3WG4 A;  4G9S B;  4D7Y A;  2EA7 A;  4LOR A;  3TEW A;  3ZDV A;  5FUI A;  4COU A;  1O3S A;  3KMH A;  2PLV 2;  4QDS A;  3JD7 3;  5C8W A;  2G4I A;  3AX4 A;  1ZRI A;  3VKM A;  4XBQ A;  5FPV A;  4P9W A;  4QX3 A;  1OC1 A;  4CCC A;  2NN8 A;  3JQX A;  3VLB B;  1SHW B;  5LW9 A;  1W9W A;  4CUC A;  1HIX A;  4ASK A;  1NOV A;  4JVA A;  2GAU A;  1AUY A;  3VZK A;  4AK3 A;  4CEW C;  4YRD A;  2CSG A;  1VBE 1;  1FPN 3;  4HON A;  5FXZ A;  3ZYF A;  1W8N A;  2WO1 A;  4IND A;  1WLT A;  3ACH A;  1RUJ 3;  1CAX A;  5BNP C;  3OD4 A;  4IE5 A;  5KHI A;  4OUE A;  1ST8 A;  1LOC A;  2DVF A;  1JYC A;  4IXL A;  4QAW A;  5K7P A;  4HMZ A;  3O1P A;  4H7M A;  1A8D A;  2VBP A;  4JDN A;  3VDA A;  1H0B A;  1U5I A;  1ZZB A;  2BBA A;  2WSV A;  3WUC A;  3ZDS A;  5E8A A;  3U1X A;  3WCS A;  2VOT A;  1CVN A;  1VBD 3;  1MS9 A;  1IKQ A;  1AR9 1;  2R07 1;  2WSU A;  4Y1X A;  5AFE A;  2V73 A;  2YG0 A;  3POY A;  1UMZ A;  5CIR A;  4BCU A;  4E8C A;  4GXL A;  4WVZ A;  3QH7 A;  1HRV 1;  2NLR A;  4A45 A;  1H1M A;  4XXP A;  4F3J A;  1UIJ A;  4L99 A;  1XNA A;  2ZGK A;  1I9R A;  4CA9 A;  2B42 B;  2YPD A;  1RIN A;  2VQ0 A;  1CAW B;  2HWC 1;  4Q4Y 3;  3X29 B;  5JSO A;  1C28 A;  1ASJ 3;  1POQ A;  4RS5 A;  3CDZ B;  2XL9 A;  1XNT A;  2MEV 1;  5JMO A;  1W6N B;  1OUS A;  2WLQ A;  1R09 2;  3HAG A;  4Q8K A;  3TN9 2;  1NA1 B;  4L11 A;  4DXR A;  5IVV A;  4MO3 M;  3OGV A;  2I45 A;  5FY7 A;  2XPJ A;  1EV1 1;  1VJ2 A;  5GZG A;  3NJX A;  3ES1 A;  3MW3 A;  2PFW A;  1QJY 1;  5B2G B;  1RUG 2;  4QX8 A;  4WV8 A;  5HCF A;  3I2O A;  3LA7 A;  4EWA A;  1RUC 3;  1RHI 1;  4E4D X;  5K0U B;  3DXU A;  2RS5 3;  1N1T A;  2D6N A;  3C7O A;  4XZP A;  3PTR B;  1VAK A;  3T09 A;  5KHK A;  3SIT A;  1VBE 3;  2ARE A;  2BOJ A;  3LAG A;  1YUD A;  5FZ9 A;  3NKG A;  1RUE 1;  2TEP A;  5F5Q A;  5CAZ A;  2OT7 A;  1Q8P A;  1WME A;  3PVN A;  3TEY A;  2BWA A;  1FNZ A;  1E57 A;  2BV4 A;  4A6O A;  4LXL A;  2IZW A;  2A6V A;  2C26 A;  2R1D A;  1LTE A;  1ZYB A;  3AL6 A;  2D3R A;  5H9P A;  3ZXL A;  1DGR A;  1MS5 A;  1PK6 C;  4LO6 B;  4MAD A;  5A3O A;  1V6L A;  4UFH A;  4DQA A;  4ZZ8 A;  1VR3 A;  1QJZ A;  1UIK A;  2JJ6 A;  2JEC A;  5FZE A;  4XHX A;  4ZS2 A;  1TQ5 A;  5D2A A;  1UZ0 A;  3MBW A;  1PGS A;  2W0X A;  3FLP A;  4Q1R A;  1OUR A;  4RR3 C;  4XF3 A;  1C5I A;  1RUH 2;  2RS3 2;  3ZFG B;  1OQ1 A;  1W9F A;  2X53 S;  5HBA A;  2VMH A;  1XJA A;  1GZW A;  4HXC A;  2DTW A;  5JI9 A;  2HWC 3;  1PM4 A;  5GLZ A;  3W9A A;  5JOX A;  2GU9 A;  1S4C A;  1WD3 A;  4JGY C;  4CDW A;  4OCT A;  3I2F A;  5I8Y A;  2RR1 2;  2MPF A;  2JB8 A;  1YQ6 A;  2X8K A;  1YXW A;  1AJK A;  2LRO A;  1W03 A;  5L36 A;  4QT6 A;  4BU2 A;  1UYX A;  1LOF A;  4ORF A;  3GBW A;  4C1W A;  1LJ7 A;  2QQU A;  3B01 A;  1POV 1;  1W6O B;  2OII A;  3DUI A;  3EQE A;  4FOQ A;  4L0P A;  3S57 A;  1ZZ6 A;  4NHY A;  4AFC A;  5E88 A;  3AMN A;  4DB5 A;  1OH4 A;  3NMB A;  4AVA A;  2WNV C;  1WW4 A;  2XL7 A;  4CUB A;  4MSV A;  4LUM A;  2J1S A;  4JZR A;  1GQP A;  4DMI A;  1RHI 3;  2DFB A;  3OBA A;  4I01 A;  1XSR A;  2EF6 A;  2ZKL A;  3LPF A;  4LHS A;  1UU6 A;  3JBG 2;  4AEM A;  2G9Z A;  2XDV A;  4GAL A;  2PLV 1;  2WN2 A;  4ZS3 A;  1GUI A;  4JKM A;  3ZXE A;  1D4M 2;  5F37 A;  1J1T A;  5LBB A;  3SKV A;  3VBS C;  2X5I C;  5AVA A;  3ZYR A;  3GHM A;  5AFB A;  3I59 B;  2VTX J;  4LBJ A;  5GJ6 A;  5JVV A;  1CX1 A;  1FNY A;  3AYA A;  4CEW B;  1H8T A;  4N9H A;  1EPZ A;  1X9T A;  1LED A;  4S2D A;  2VCC A;  3VZN A;  5J36 A;  1T6B X;  2BP6 A;  1IPJ A;  1O59 A;  3OUJ A;  3OGR A;  4F83 A;  4CCJ A;  1HV0 A;  5BNP B;  3VBF C;  3WEZ A;  1X8E A;  2GC3 A;  2PMW B;  5JZG A;  5LEJ A;  3O1R A;  4ARY A;  4NID A;  2UWC A;  1RC6 A;  3DGT A;  3MIE A;  3VBR C;  3S5A A;  4QX1 A;  2IFW A;  5BNQ A;  1YNA A;  3NNF A;  1PX3 A;  2H0V A;  2HEV F;  3T2T A;  2VL4 A;  1WMF A;  2PHW A;  1WWY A;  3RGB A;  1BBT 3;  1DQ2 A;  1ND2 C;  2W2I A;  3BIW E;  4K7J A;  2FMD A;  4XDP A;  4UOJ A;  2VNV A;  1UOJ A;  1FOD 3;  1HXS 2;  4Z82 A;  4IL7 A;  3SQO A;  3MPP G;  2BGP A;  1X33 A;  2P4E A;  1HN0 A;  1AHS A;  4FP3 A;  4YW6 A;  5EZW A;  2X09 A;  3POF A;  2MHF A;  5FZI A;  5IAV A;  3USU B;  1KS5 A;  1RIT A;  4BQX A;  2DBI A;  4CDQ A;  1CZT A;  3WIN E;  1IZ3 A;  3S6P A;  5L9R A;  4CZS A;  4NPL A;  3SHR A;  3K48 A;  1IQA A;  2D6M A;  1WCU A;  3EBR A;  1YFY A;  4E8D A;  1I5Z A;  2VG9 A;  3SEP A;  2R6Q A;  4XFH A;  5DAW A;  1MZ6 A;  4DS0 A;  3WDX A;  1AR7 2;  4A41 A;  2VMC A;  1R09 1;  3BU0 A;  1LHN A;  4PF1 A;  3TN9 1;  5FP3 A;  3LE0 A;  4PQQ A;  4IEX A;  4AFM A;  1OSG A;  2H6C A;  3M3O A;  2JIJ A;  3FX3 A;  4JGZ A;  2PYT A;  3I2D A;  4QX2 A;  1LU1 A;  2DCY A;  1NQJ A;  1N47 A;  3NJZ A;  5GZE A;  2RDN A;  2SLI A;  3LEG A;  5IYY A;  1JZ6 A;  1RUG 1;  5T5O A;  2B39 A;  3J9S A;  4P00 B;  1W06 A;  1URX A;  2WA3 A;  3UT0 A;  1GOG A;  2FDH A;  4CUA A;  5IT6 A;  4ZY9 A;  2XJR A;  5J37 A;  3VV1 A;  1QOO A;  4HN0 A;  2VZP A;  3AM2 A;  4XET A;  1HQW A;  2W47 A;  1FV3 A;  2HWD 3;  1ULP A;  4HZF A;  1AXK A;  4QQO A;  3AZX A;  2WZE A;  1ULO A;  1US3 A;  2FQP A;  2GMM A;  1H6X A;  2IUW A;  1MVE A;  2EIE A;  1F4H A;  2VMG A;  4HVR A;  2D5F A;  3PUA A;  1OKQ A;  4Z8B A;  5ABJ A;  2WZ8 A;  1ZRC A;  3VKL A;  1W6P B;  2E7Q A;  4Y26 A;  2IWG B;  5H9S A;  1FMD 3;  4CDU C;  4TSV A;  1AR6 2;  3ZYB A;  4D7T A;  1PK6 B;  3Q8F A;  3J7M A;  4UFK A;  3WP6 A;  4K40 A;  4MXW A;  4QHO A;  3UKN A;  2W46 A;  1C8M 3;  1GOH A;  4M3C B;  4XJW A;  5FWE A;  5BNO C;  1UZZ A;  1CAW A;  1JW6 A;  2VVD A;  3ILF A;  4BK4 A;  3WNN A;  1BVV A;  3DKW A;  3FE5 A;  4FQZ A;  4P5H A;  4RR3 B;  5ISL A;  1ODM A;  1W2A X;  1W6N A;  5FP4 A;  4AG4 A;  3A23 A;  3RWN A;  1ULD A;  2R30 A;  2BGO A;  5FY8 A;  1NA1 A;  1SBF A;  2BVB A;  2VMI A;  1LGN A;  3R0R A;  4AXO A;  2RS3 1;  1RUH 1;  4O65 A;  3RJR A;  3KHB A;  2DF7 A;  3PVE A;  3ACI A;  4JGY B;  4W8J A;  2KXL A;  4AAP A;  3AK0 A;  5FLJ A;  4AHW A;  5FBZ A;  2DCK A;  3VHR A;  4X6Q B;  2RR1 1;  4XUT A;  4Z1V A;  1GZC A;  4QPI C;  3FC0 A;  3SIS A;  3HVD A;  1GNZ A;  3K75 B;  5K0U A;  4NPR A;  3UKT A;  2ZEZ A;  3MLL A;  5C71 A;  5F6K A;  2DUO A;  3A0K A;  5A6Z A;  4CUG A;  4YZ4 A;  4EN9 B;  2G19 A;  2CNA A;  4OMC A;  3MW2 A;  4QX5 A;  4LKS A;  3WHT A;  1SBE A;  4QKB A;  3ZXG A;  2D44 A;  3I2I A;  3K3O A;  5KHG A;  2VUD A;  4YM1 A;  1PMI A;  4NRM A;  1GP6 A;  2OS2 A;  3AL5 A;  3ZVX A;  3AP7 A;  5EWS A;  1OLQ A;  5EYX A;  4IE4 A;  3VL8 A;  2WFF 3;  4PI0 A;  4XQ4 A;  1G8W A;  3JBG 1;  4IEP A;  4XJ8 A;  3VBO C;  1NXD 1;  2JX9 A;  3E5X A;  1LR5 A;  4QKF A;  4OQ9 A;  3INA A;  4LUL A;  4IV1 C;  3VBS B;  4JHZ A;  4Z2A A;  1C5H A;  3C8X A;  1QIQ A;  1O3R A;  1S1A A;  1CJP A;  1D4M 1;  3RI8 A;  4BQ4 A;  3F95 A;  2XBO 3;  1W0O A;  3KS7 A;  1PNG A;  3PHM A;  3D6E A;  4S2H A;  3T0A A;  4QXC A;  2CGO A;  4HVQ A;  5A7Q A;  3ZFG A;  3HMY A;  3HN3 A;  1XU2 A;  4UFI A;  5FPL A;  3VBF B;  4FPO B;  3KQ4 B;  5JR2 A;  4KBZ A;  1JOD A;  3CJX A;  3NKT A;  1D2Q A;  3SLI A;  3WV6 A;  3WF1 A;  2WR9 A;  4E4Z A;  4CP9 B;  2B7Y A;  5LA9 A;  1ND2 B;  2VUJ A;  5F5I A;  2ETE A;  3WDT A;  1HX6 A;  1W6O A;  2Q1Z B;  3ORJ A;  3PVB B;  4BM8 A;  5F2S A;  2Y34 A;  5K8S A;  2BYV E;  4I0B A;  5A7S A;  1HXS 1;  1V6J A;  1STM A;  2RS1 2;  1OHF A;  3ACF A;  3M1H A;  5EQU A;  1OF3 A;  4YW5 A;  3ZFF B;  5A6Q A;  2XVK A;  5JXH A;  5LBC A;  4R9D A;  4AVT A;  4XFA A;  2F6B A;  4FI9 A;  3J7L A;  3OYW A;  2H6B A;  4EE2 A;  4K1Z A;  1W39 A;  3UV9 A;  4DEV A;  3LEI A;  4IEW A;  4W6W A;  5F39 A;  5F7U A;  2NPI A;  4LBO A;  2XLF A;  4EYU A;  4AWD A;  3GYD A;  5IK5 A;  1DLC A;  1COV 2;  3AYE A;  1SAC A;  2ILM A;  3D5O A;  3O14 A;  1KXG A;  2ZML A;  3ASI A;  3S7E A;  2UYA A;  2XHK A;  1AR7 1;  2Y0I A;  2VUC A;  1NZI A;  4YZ1 A;  4PT6 A;  3I59 A;  5CFC B;  5G04 L;  4B8E A;  4LA2 A;  1LOG A;  1W28 A;  1VLN A;  3B69 A;  4CEW A;  4YPJ A;  2BU9 A;  3MPB A;  4HPK B;  2DCZ A;  2ZGM A;  3KGL A;  3MIC A;  2HEW F;  5C7G A;  3T1L A;  1Q3E A;  4D0Q A;  1BK1 A;  2V5D A;  1WCD J;  5FUP A;  5IK7 A;  3V0B B;  4CCM A;  4K8F A;  5HCH A;  1BHG A;  5LRS A;  1QU0 A;  4LO7 A;  3POE A;  2B46 X;  4C0H A;  3RI9 A;  4QB2 A;  2DVD A;  4ASL A;  3JCI A;  4BIF A;  4COZ A;  4D69 A;  1DGL A;  5I0T A;  1S0I A;  4W65 A;  4A7Y A;  4CDU B;  3H9A A;  1PVC 3;  5BXX A;  1ZNP A;  4J1W A;  3USU A;  1NKG A;  5FR3 A;  3W5M A;  3T0D A;  1D7P M;  1AR6 1;  4IGP A;  3CBN A;  5BNO B;  2RMU 3;  4JRA A;  4GWI A;  4OUL A;  4ONU A;  5FY5 A;  3N9M A;  4CDW C;  2Q8C A;  4NHX A;  2GND A;  4CXX A;  2C5D A;  4PCR A;  3P3P A;  5ACA 2;  1ZBA 2;  4P9J A;  5I0U A;  1LOF C;  5F5C A;  4OLL A;  5FZG A;  2P6H A;  3M4F A;  2IXL A;  1Y43 B;  3JD7 2;  5B4N A;  4ZU4 A;  2AC1 A;  4ZHN A;  3FLT A;  1K3I A;  4Y4R A;  1EAH 3;  1VMF A;  4YW4 A;  2VCA A;  5FCC A;  4YZ5 A;  2ZGR A;  3I3D A;  4NHK A;  2BWC A;  5A7W A;  4ZZ5 A;  1JZ7 A;  4QPI B;  1O91 A;  2JG8 C;  3PUR A;  1FPN 2;  3QOP A;  1DG6 A;  3U0Z A;  1A3K A;  5CBL A;  1LES A;  2FCT A;  2DVG A;  4HK8 A;  1QDC A;  4D6S A;  4LOS A;  2OYZ A;  3THP A;  5FZL A;  1RUJ 2;  4TYS A;  5I0R A;  1AX1 A;  4URT A;  2RVA A;  3WHU A;  4AGV A;  4LIU A;  4AVS A;  2A1X A;  1W6P A;  2XXZ A;  3KT1 A;  3VBO B;  3GZE A;  5M0T A;  1PK6 A;  1U5Y A;  1VBD 2;  4K8R B;  5LA0 A;  4IV1 B;  4RGK A;  2GDF A;  1CAX B;  3DXT A;  1CJD A;  3ZMO A;  4C90 A;  2XJQ A;  3I4I A;  1QF3 A;  3SCH A;  3I2J A;  1FT9 A;  2WII B;  1WD4 A;  5J3U A;  4D94 A;  2LUW A;  2PHL A;  1LEC A;  4XC9 A;  5HV4 A;  1XU1 A;  3MID A;  2QKD A;  1SCR A;  4E4S A;  3MIB A;  4BPZ A;  1Z78 A;  1QY4 A;  1VBC 3;  4Q4Y 2;  1ASJ 2;  1PO2 2;  4PBP A;  3VDB A;  4WBB A;  1O3T A;  2WUH A;  3J8F 3;  2GAL A;  4KGQ A;  2XVL A;  4LO4 B;  3VKO A;  2ZGU A;  1A6C A;  4Y24 A;  2A75 A;  4KWJ A;  4GWJ A;  3GHN A;  2YPJ A;  4X6R B;  3WW1 A;  4CDQ C;  1LUL A;  2AH2 A;  2UYB A;  1YO8 A;  3DL3 A;  3GZU C;  4IV3 A;  5FZB A;  1MVQ A;  5JR7 B;  5IVJ A;  3IM0 A;  5I0D A;  4BA6 A;  5FLH A;  5KC5 A;  4HSL A;  2R0F A;  3KB5 A;  2E33 A;  2BVV A;  1WBL A;  4QQL A;  4XTM A;  4AI3 A;  3N9Q A;  2HKX A;  1MS4 A;  1RUC 2;  1BEV 3;  2OQ6 A;  5J96 B;  1UNB A;  4NAO A;  4WM8 B;  2A7A A;  2RS1 1;  3QCW A;  1MZ5 A;  2RS5 2;  2D6L X;  1ZRE A;  1OUX A;  5EXO A;  3MO4 A;  4LPL A;  3GZA A;  4B4Q A;  2YFZ A;  4JGZ C;  2FMY A;  4LIV A;  4AFA A;  3W20 A;  1L7R A;  3QD6 A;  1H9P A;  1X9P A;  2ZGQ A;  1D0H A;  4XIK A;  3OCP A;  4QU2 A;  1COV 1;  3ATG A;  3CO2 A;  3WW3 A;  3BOD A;  3E6C C;  5BUV A;  2GC2 A;  3QH6 A;  1ZRD A;  1Y9M A;  1GU3 A;  5HXM A;  4QX0 A;  4CCL A;  5IVC A;  5LRR A;  1MZE A;  4H14 A;  2OKX A;  2OQ7 A;  4L92 A;  3ZKU A;  3AXD A;  2ZJC A;  2J42 A;  2I74 A;  3ZPY A;  2LTN A;  2VVE A;  1OLR A;  2XQX A;  4IDZ A;  5A7P A;  4AQS A;  4CDX B;  4QKN A;  4UI9 L;  5ABJ C;  2PA7 A;  3DF0 A;  3MV0 1;  1L7Q A;  4GIQ A;  2EXH A;  4D3W A;  3KV5 A;  4Y5S A;  5HPO A;  2K9Z A;  4AI1 A;  1RUF 3;  1MS0 A;  2DWR A;  3P1I A;  3PUI A;  4CP9 A;  2VO5 A;  4JC1 A;  2GZW A;  2A71 A;  3SKJ E;  3WZ1 A;  5FZO A;  1A78 A;  2VOV A;  2A6X A;  3UGG A;  5FJH A;  4WZC A;  3OOX A;  3PMS A;  4M4R A;  4NHM A;  3ZFF A;  5T55 A;  2YY1 A;  3AFG A;  1NA1 C;  2VCB A;  3I3Q A;  4NPM A;  4AR2 A;  1BYH A;  3K4A A;  1WGP A;  2WS9 3;  2XR4 A;  5GLV A;  3OSD A;  4CTE A;  1WCS A;  1PIV 3;  3NL1 A;  2WNE A;  1DGR N;  3LCP A;  2VC9 A;  1CZV A;  5FP9 A;  5L73 A;  4A3Z A;  4Y33 A;  2W39 A;  5ACA 1;  1ZBA 1;  2BZD A;  1I3H A;  2Q8O A;  4LKF A;  5A3M A;  3HQX A;  5CFC A;  4MGK E;  1S2K A;  1G9F A;  3WLU A;  4A42 A;  3JD7 1;  1VRB A;  2A3Y A;  2V4V A;  3I3B A;  3LFM A;  3OEB A;  4ATE A;  4HPK A;  3ST7 A;  4XAC A;  3V65 A;  2BNO A;  2LM3 A;  2QQL A;  4R52 A;  1XPW A;  4Y1U A;  5FDB A;  4PLN A;  2ZMN A;  1ULE A;  2CHH A;  5IVY A;  4BME A;  2JG8 B;  4KL1 A;  1FI2 A;  4G3Y C;  2PAE A;  2ZX4 A;  3POI A;  3HT1 A;  4BHP A;  1UY4 A;  5T54 A;  4DXT A;  5FZ8 A;  1UPS A;  5CKM A;  1FPN 1;  1DQ0 A;  4K9S A;  4N53 B;  2WN3 A;  5LEK A;  5FYY A;  4X8P A;  4XMA A;  5EIY B;  4NII A;  5DDJ 3;  2R06 3;  2WQ8 A;  4FXG B;  1FAT A;  1RUJ 1;  4L8Q A;  1UOG A;  2JXA A;  4FPG A;  3FBM A;  2WA4 A;  1TMF 3;  3BUC A;  2D3P A;  2QUO A;  1FYU A;  2ARA A;  1FX5 A;  1BBT 2;  1H9W A;  3GNE A;  3IT8 A;  4PLM A;  2EIB A;  3SH4 A;  1U5Z A;  4LHL A;  4FFF A;  4PF5 A;  4XQW A;  1VAM A;  1FOD 2;  3THT A;  1VBD 1;  3MUY 1;  2YUE A;  4K3U A;  4XUO A;  5FAX A;  4YW2 A;  1XYO A;  5FZC A;  4HG6 B;  5FV3 A;  4A4A A;  1XYP A;  5KBF A;  3BN6 A;  1N1Y A;  2J1T A;  4OFG A;  1YFW A;  1RJ8 A;  3KGZ A;  5EJ1 B;  4CSW A;  4LBQ B;  1K5J A;  2KR2 A;  3LA3 A;  3AP5 A;  3PLQ A;  3VZL A;  3O1U A;  2C0Z A;  5IK8 A;  3UKV A;  3LD8 A;  2Y6L A;  3PTY A;  3ZKY A;  1ZRR A;  1JYN A;  1YI7 A;  5FY0 A;  1R1A 2;  3LZZ A;  3UJQ A;  1LEN A;  3KZ4 C;  1KFU L;  4Q4Y 1;  1V70 A;  2ZX1 A;  4XAE A;  1ASJ 1;  5FYV A;  1PO2 1;  1SBD A;  1W90 A;  4QX7 A;  2HWF 3;  5ERL A;  3C7H A;  3SEE A;  3VHP A;  2C6S A;  4CDQ B;  4Q4V 3;  1QHD A;  4P5Y A;  1ZBA 3;  4QPI A;  3VN4 A;  4FTS A;  2XUE A;  3I49 A;  5E1R A;  3WQ1 A;  3OBZ A;  3LA2 A;  1S55 A;  3JXS A;  3AZZ A;  4TLF A;  4XPV A;  4KG8 A;  2RDS A;  1LAJ A;  1QQP 3;  4XAB A;  1MS8 A;  1QJX 3;  5FZ3 A;  2VY0 A;  1E5S A;  3ENR A;  1RUC 1;  1G7Y A;  2VM9 A;  3BOW A;  3I7D A;  2DU0 A;  2RS5 1;  4FPC A;  4HT1 T;  4JGZ B;  3C7G A;  3T2P A;  2HWD 2;  2BNN A;  4ARX A;  1XYN A;  4XBL A;  3TNP B;  3VBO A;  1CZS A;  4XQD A;  3R6S A;  2P3Y A;  4RHV 2;  1XE0 A;  1W0N A;  3FHI B;  4IV1 A;  3WT3 A;  5A80 A;  3HN1 A;  1FMD 2;  1OLM A;  4O61 A;  1CPN A;  1D4V B;  4KWL A;  2N7G A;  3POS A;  5JIA A;  5IWF A;  1G9C A;  1QKQ A;  4F8A A;  1HB2 A;  1XOY A;  4MGY E;  3BTA A;  1OOP A;  2CWS A;  1C8M 2;  2J1E A;  4KQ7 A;  5IVB A;  2WAO A;  1E5R A;  1KDK A;  3WDW A;  1OI6 A;  1ND3 B;  2VME A;  3B94 A;  5ABJ B;  4BLI A;  4Q0U A;  2QDR A;  3LDR A;  3WNL A;  5FYB A;  3RYP A;  4RL7 A;  1L3J A;  4AGG A;  3MIG A;  1H2K A;  4MXW B;  1JTZ X;  1XNB A;  5HV0 A;  2EXJ A;  3UET A;  2OZJ A;  4S2F A;  5HCA A;  1RVF 3;  3RZJ A;  2RE9 A;  1PO1 3;  2VNO A;  3ZFE C;  1W6Q B;  4QKD A;  2NQY A;  3RMX A;  3DEC A;  3RZL A;  2QTW B;  1PO2 3;  3I2K A;  2BEO A;  3WQ7 A;  1NY7 2;  2FDI A;  3M2M A;  4YW3 A;  2W9X A;  5L9V A;  1R08 3;  4MET A;  3V56 A;  4EQV A;  3HEI A;  1GMM A;  4WM8 A;  1MQT B;  1VBB 3;  1W0P A;  2DV9 A;  4QDR A;  3JUU A;  1HV1 A;  1S0J A;  4LK6 A;  4KU8 A;  1Q8O A;  2QQW A;  1OVS A;  3IMM A;  1RUD 3;  3OD0 A;  2W5F A;  1F31 A;  3IIA A;  3KCY A;  4HET A;  2WWJ A;  3B9C A;  2GP5 A;  1DZQ A;  4KBB A;  2A3W A;  3H1Y A;  4CP0 A;  1SQ4 A;  3G6J B;  4HLT A;  4ZXK A;  1F2N A;  3CL1 A;  3KV6 A;  4AEK A;  1HB1 A;  2D40 A;  2EAK A;  3AZV A;  3N9L A;  3AFK A;  2B45 X;  3PIG A;  4P9G A;  2WFF 2;  2WKK A;  4NJ4 A;  4LA3 A;  1W3V A;  3ZSJ A;  4LOT A;  1US2 A;  1DQ1 A;  3N9N A;  3Q8B A;  2PHU A;  5LY2 A;  3KT7 A;  1DP0 A;  4FFH A;  3IDC B;  4ERO A;  2XBO 2;  3KM5 A;  5HCB A;  3WSO A;  4H7L A;  4CDX A;  2VZQ A;  1VBA 3;  2FDG A;  5C6C A;  5LA2 A;  2P5B A;  3KCX A;  4FCA A;  4X8N A;  4B3N A;  4M3C F;  4GH4 A;  1ZBE 3;  1CES A;  3VGI A;  2ORX A;  4F7Z A;  3WNP A;  1HQN A;  3H8O A;  3O0V A;  4W4Z A;  2RDQ A;  1WW6 A;  4UF0 A;  1ZZ7 A;  3SCF A;  2ZTN A;  2ZS6 B;  4LQR A;  3BIE A;  1V9U 2;  1ZM1 A;  4MHU A;  3D0J A;  5T5J A;  1BBT 1;  2BFU S;  4MHR A;  3S7I A;  1GLH A;  5FTT C;  2F17 A;  1IG0 A;  1FOD 1;  2CV6 A;  2HWE 3;  5GAL A;  1WLC A;  4PI2 A;  3RFR A;  3PME A;  4GUL A;  5FPA A;  4LBM A;  3LPG A;  4DEQ A;  1B35 B;  4D6R A;  4DXZ A;  3RZK A;  1D0G A;  1DGW X;  4IV3 C;  5A32 A;  5BNN C;  2VQU A;  4UXA A;  1MEC 3;  5C3O A;  1R1A 1;  1TZO A;  2WQ4 A;  3TYJ A;  2F4P A;  4K21 A;  1HJF A;  4XHB A;  4XJZ A;  4UBH A;  4BQ5 A;  4HVO A;  3AXE A;  2E53 A;  3OYW B;  4OUM A;  2L9L A;  4NAM A;  1AL0 G;  4NWV A;  3ZIX A;  2JG8 A;  1XSQ A;  3N7L A;  5JOW A;  1PVX A;  3VZJ A;  5JPM B;  2VXJ A;  4M0N A;  4CCE A;  1JOB A;  3HR9 A;  4QD2 A;  4COW A;  5DG2 A;  4N53 A;  5DZE A;  3OGS A;  1NCR A;  4FOW A;  4AAX A;  1G9B A;  2R04 3;  2NZ9 A;  4RN5 A;  4YW7 A;  3VBH B;  4AQ2 A;  3WG3 A;  1H4G A;  3C3V A;  1UY2 A;  2EVX A;  4NUB A;  1RGS A;  3ACL A;  3S0M A;  2YXS A;  1U5X A;  3ZR6 A;  2HWD 1;  5JWP A;  1Q8Q A;  4QGM A;  2BNM A;  2OPW A;  4LNV A;  5C33 A;  5FMC A;  4XUN A;  5T52 A;  4LE3 A;  5FP8 A;  5CVR A;  1TNF A;  5A3W A;  3P3N A;  1GWK A;  1PHM A;  1PVC 2;  2PHD A;  4HOO A;  4RHV 1;  4LT5 A;  2JE7 A;  1WA4 A;  4V2W A;  2G9G A;  3NAP B;  1GWL A;  5A33 B;  1FMD 1;  3Q8A A;  2YC4 A;  4J6G A;  1QJU 3;  2RMU 2;  3RYK A;  4LBQ A;  4O9G A;  1QEX A;  5LWB A;  2IVI B;  4WM7 A;  2QQM A;  1AZD A;  1C8M 1;  4TXW A;  1VAL A;  2QZ2 A;  4QB6 A;  5F3C A;  3RVH A;  1REF A;  4JDM A;  3O1V A;  1Y7B A;  2WJS A;  4ZU5 A;  2XJS A;  1HB4 A;  4OMD A;  3LQC A;  5JI7 A;  3ZFF C;  3D3A A;  2SBA A;  4CCD A;  4GKY A;  3NJV A;  5FYU A;  4OHZ A;  3KVA A;  3ZFE B;  3ON7 A;  1OFS A;  4PHZ A;  1EAH 2;  3M3Q A;  4ES8 A;  1K45 A;  3O12 A;  1R1A 3;  4A3X A;  1AYN 3;  3FJS A;  1YJL A;  4TWT A;  4FTE A;  1CN1 A;  3JU9 A;  2RDR A;  2DVB A;  3T4H B;  1MAC A;  1UAI A;  3MW4 A;  1BJQ A;  3VD3 A;  1SEF A;  4K1Y A;  2UUR A;  5J98 B;  3ILR A;  5CFC C;  2AEZ A;  4Q4W 3;  4MOA A;  1LHV A;  4IEO A;  3CZJ A;  4OQ8 A;  2VJX A;  2YC2 A;  2A5Z A;  4IE0 A;  1QWR A;  3V64 A;  4NR1 A;  2VH9 A;  5A7W B;  2UWB A;  3ZR5 A;  2FDF A;  1PNF A;  1AR8 3;  1KGY A;  4P9I A;  4KWK A;  1UY1 A;  4UAP A;  4Y1Y A;  1KIT A;  4RD7 A;  3R4D B;  1IS6 A;  1O6U A;  1VB4 A;  5KR7 A;  5FZD A;  2WFF 1;  4Y20 B;  3CEW A;  3WR0 A;  3UJO A;  2ARX A;  3B9I A;  4GB3 3;  4RHV 3;  1B09 A;  1ND3 A;  5FZ6 A;  2BOI A;  5GZD A;  3OY8 B;  5DAX A;  4QQP A;  2QDN A;  1FXZ A;  1LHO A;  1WZX A;  2XBO 1;  4XF0 A;  1HKD A;  4Y5T A;  4CE8 A;  2X05 A;  2LAL A;  2DCJ A;  1UXX X;  1VBC 2;  2VBD A;  2W92 A;  4JHT A;  3RYR A;  4LR4 A;  2ES3 A;  4FAH A;  3J8F 2;  3NW4 A;  2DVA A;  1BCX A;  1UU4 A;  3FL7 A;  3FBY A;  1W6Q A;  4IE6 A;  4Y1V A;  3E6D A;  4CCO A;  1ZZ8 A;  2FBE A;  3LWC A;  4CU6 A;  4RA0 A;  4XIO A;  5DUW A;  5FKC A;  3CQO A;  4IEU A;  5EYY A;  5LAS A;  3III A;  5I0S A;  1J59 A;  2Q4S A;  1V9U 1;  4FFI A;  3I2G A;  4FPH A;  5A7N A;  1GFF 2;  4NE9 A;  1MQT A;  1LCL A;  4KMQ A;  3O1S A;  4BQ2 A;  3MYX A;  5FXW A;  3DYM A;  5GKA C;  3GBG A;  3T2Q A;  5JIU A;  5FZM A;  5DUU A;  5L9B A;  1BEV 2;  3SMH A;  3LIG A;  2WO7 A;  3LEM A;  2ZEY A;  4I0W B;  5CEH A;  5KHJ A;  2XOM A;  2Z4F A;  1SFP A;  3D4K A;  3NNJ A;  4IV3 B;  5BNN B;  5K4L A;  4CRQ A;  1UPI A;  5LK7 B;  1QNY A;  3N7M A;  3H7Y A;  4IEQ A;  5C3P A;  5FWJ A;  2PXJ A;  2WWU A;  2YRO A;  2ZPX A;  3B93 A;  1NYW A;  3Q8E A;  2XB6 C;  5IVF A;  1OPM A;  4LLF A;  2VOX A;  2CTV A;  2C4X A;  1GQH A;  4KNC A;  3CHX A;  4I3G A;  3ETQ A;  1DCS A;  3DV8 A;  1HQL A;  1KDM A;  3T3Y A;  2JDP A;  3OB8 A;  3PJY A;  5AVP A;  5T3N A;  3GJA A;  3VDD B;  1AYM 2;  5APA A;  5CA6 A;  2WRA A;  4KH9 A;  4RGA A;  4Q0S A;  2WT0 A;  4NRP A;  5GLU A;  4BH9 A;  1IGO A;  1RUF 2;  4V2V A;  2XUM A;  3IDB B;  3RNS A;  4JCK A;  1TVG A;  3IAQ A;  1DLL A;  2C9K A;  1W04 A;  1OOP C;  2QQO A;  3WNO A;  5I91 A;  5LCW L;  5C3Q A;  3VB9 A;  1NCQ A;  3T08 A;  5FFO C;  3BVC A;  1DYP A;  2JDN A;  4Q4X 3;  3W58 A;  1VP6 A;  1SLL A;  4YSF A;  2VZS A;  4JKL A;  2W3J A;  2CGP A;  5J1X A;  2OZ6 A;  1JOJ A;  1PVC 1;  2D3S A;  4KI5 M;  3WX5 A;  4OYU A;  1OMI A;  2BER A;  2FDJ A;  3WXP A;  1PGL 2;  4XFF A;  1V9U 3;  4GD4 A;  3HBZ A;  1B35 A;  5IFP A;  2WS9 2;  2RMU 1;  3MEP A;  4MGZ E;  5ANQ A;  2KM2 A;  5FZO B;  1PIV 2;  2FZ2 A;  1YQ8 A;  5C70 A;  4AHX A;  1OBN A;  2CWM A;  4GAZ A;  3HIF A;  3POG A;  1S2B A;  1NUK A;  1XNK A;  5FZ1 A;  1GP5 A;  1GQG A;  1HW5 A;  4QXK A;  2FD8 A;  1REE A;  3KF5 A;  3I8T A;  5A6Y A;  4WM8 C;  1LGC A;  4HKW A;  3R4U A;  3O1O A;  1DQ6 A;  2JB4 A;  1HLC A;  3QLQ A;  3EYP A;  2WDB A;  3LOI A;  1OF4 A;  1RMU 3;  3GGL A;  3GJB A;  4M00 A;  5SV5 A;  5A6X A;  4Q5O A;  1CPM A;  2Q1M A;  1S0B A;  1C1F A;  4LO8 A;  5CKQ A;  1EAH 1;  2AEN A;  4Q1P A;  1LOD A;  2HBT A;  1UN1 A;  1UX6 A;  4IEZ A;  1W2U A;  3UGH A;  3M8L A;  2VNG A;  1U0A A;  1UWW A;  3VBH A;  5A3U A;  4YM2 A;  3B3Q E;  5IVE A;  3IWZ A;  4E2S A;  1KEX A;  1XNC A;  4CPB A;  1RUI 3;  1N1V A;  2VTF A;  2ADD A;  5DDJ 2;  4FFG A;  2R06 2;  4FPJ A;  4BQ1 A;  1JU4 A;  1YJK A;  3ABZ A;  3NNG A;  5A3P A;  1T2X A;  1JUI A;  1WW5 A;  1TMF 2;  1XBF A;  4IEY A;  3RSJ A;  2QZ3 A;  3EXU A;  4NRO A;  4CDX C;  5JAX A;  4FTB A;  4NOT A;  3NAP A;  4KWU A;  2HH9 A;  1TE1 B;  5A33 A;  2CL2 A;  4C0B A;  1NG0 A;  1N3P A;  4MGS A;  3RS6 A;  3GCX A;  2WWS A;  4GH4 C;  1HRI 3;  2FCV A;  3KWV A;  4AVC A;  3WQB A;  4BDV B;  3I3M A;  4FXK B;  1J3R A;  4EWD A;  3C2U A;  2BFU L;  3LSD A;  1HJG A;  2YBK A;  4BMB A;  1J83 A;  2FZ1 A;  5CIS A;  4NO4 A;  3IZO A;  4XXA A;  3PVO A;  4HKO A;  2E9Q A;  3DPR A;  2VUA A;  5IW0 A;  1VBC 1;  1DYK A;  4MLO A;  4ZON A;  3VDC A;  3ZFE A;  4UW4 A;  2I2S A;  2RG4 A;  4KG0 A;  4I2O A;  4D6Q A;  1X82 A;  3J8F 1;  1N1S A;  2HWF 2;  4QHZ A;  3SXW A;  3AZW A;  4BXF A;  4GMP 0;  4N90 A;  4BQ3 A;  5C9A C;  2IXC A;  4Q4V 2;  3DCQ A;  5IJR A;  2IXH A;  2OUJ A;  2JE9 A;  5FXX A;  5DZF A;  1AXY A;  3GM8 A;  3M3I A;  3VD4 A;  3FHA A;  1BXH A;  2D5H A;  3E5Q A;  1OKO A;  1VE0 A;  3OGJ A;  4UT5 A;  1NE6 A;  3NNM A;  3K2O A;  4UFJ A;  3WQ0 A;  3CIH A;  4HBN A;  5IUQ A;  1EP0 A;  4OI2 A;  1QQP 2;  2P6C A;  1SDD B;  1QJX 2;  1JS9 A;  4XDO A;  3H3U A;  1ZRF A;  3OGG A;  2VZ3 A;  4PBO A;  2XLG A;  1VRH 3;  2Y60 A;  1BEV 1;  5FZ7 A;  3LFI A;  2J1V A;  4P02 B;  2DDU A;  1WUV A;  4MZU A;  4QXH A;  2ET1 A;  2AGS A;  5HXV A;  2ZGP A;  1ENQ A;  1F4A A;  1Q8V A;  2GME A; 
#chains in the Genus database with same CATH homology
 1XC6 A;  2WQ8 A;  4M4P A;  2ID4 A;  1UZ0 A;  3MBW A;  5DMY A;  1NX9 A;  2EIB A;  3MUY 1;  4XUO A;  3I2F A;  2JKX A;  3VD9 A;  4HG6 B;  2B4K A;  4A4A A;  1UYX A;  2WAB A;  3BN6 A;  2J1T A;  5EJ1 B;  4L0P A;  2VZO A;  2Y6L A;  3K77 A;  2W91 A;  1JYN A;  1OH4 A;  3AC0 A;  4CUB A;  2Y8K A;  2J1S A;  3SEE A;  3C7H A;  1GQP A;  3OBA A;  4P5Y A;  4OZO A;  3LPF A;  4LHS A;  4P08 A;  2VMF A;  2W87 A;  2QBX A;  2WN2 A;  3JXS A;  5G05 L;  3T0B A;  1GUI A;  2WAA A;  4CVU A;  1W99 A;  4JKM A;  4XVH A;  2VR4 A;  4CU7 A;  3SKV A;  3C7F A;  3VD5 A;  1UXZ A;  1RYY A;  1CX1 A;  2VM9 A;  3T2P A;  2YFU A;  3C7G A;  2VCC A;  4ARX A;  3OGR A;  1O59 A;  1H6Y A;  4QDQ A;  1CZS A;  3A22 A;  3W5N A;  3K46 A;  3WEZ A;  2W1U A;  3DYO A;  1W0N A;  4ARY A;  2W1W A;  4QX1 A;  1PX3 A;  2VL4 A;  1OT5 A;  2J1E A;  4UOJ A;  2WAO A;  4RYD A;  1GOF A;  2RJ2 A;  2BGP A;  2VME A;  3A7Q A;  1R64 A;  2X09 A;  2XHN A;  2VZU A;  3C7E A;  3ETP A;  4MGQ A;  3WNL A;  5JXI A;  1CZT A;  3FHQ A;  3UET A;  3T2O A;  4E8D A;  5JXG A;  4ZXE A;  3SEP A;  3DEC A;  4XUR A;  3I2K A;  1CIY A;  4A41 A;  2VMC A;  2W9X A;  4PF1 A;  3BGA A;  3HEI A;  1GMM A;  3IAP A;  3LE0 A;  4QDR A;  4PQQ A;  3WNM A;  2QQK A;  4QX2 A;  2WYS A;  1JYW A;  3ECQ A;  2W5F A;  1J84 A;  3LEG A;  2V72 A;  5IYY A;  1JZ6 A;  4P00 B;  1GNY A;  1GOG A;  4CUA A;  1JYX A;  4ZY9 A;  3HJR A;  4CU8 A;  2WO3 A;  2VZP A;  2W47 A;  5EJZ B;  3DYP A;  4BXS V;  1ULP A;  2WZE A;  3EB7 A;  1ULO A;  1US3 A;  1H6X A;  1US2 A;  2EIE A;  1F4H A;  1DP0 A;  2WO2 A;  2WZ8 A;  4IUG A;  3WSO A;  2VZQ A;  1UY3 A;  5LA2 A;  2CDO A;  4CU9 A;  2JDA A;  2W46 A;  1GOH A;  1W8O A;  2J1R A;  1HN1 A;  2ORX A;  2ORZ A;  3WNP A;  4W4Z A;  4BK4 A;  3WNN A;  2X10 A;  4LQR A;  3IDA A;  2J7M A;  4AG4 A;  1WCQ A;  3A23 A;  1JZ3 A;  2BGO A;  1UX7 A;  2Y6J A;  2ZXQ A;  3K4D A;  4D8M A;  3ACI A;  4W8J A;  4QB1 A;  2DCK A;  4XUT A;  4BJ0 A;  4DEQ A;  3LPG A;  3K75 B;  4W50 A;  5C71 A;  2ZEZ A;  3IB3 A;  1JZ4 A;  2VQU A;  3K4Z A;  1O8S A;  4DUW A;  3I97 A;  1JZ2 A;  4OMC A;  1K42 A;  4LKS A;  2JD9 A;  4DUV A;  3I2I A;  2EIC A;  2L9L A;  4A44 A;  3PUH A;  4JKK A;  4JHZ A;  1MPX A;  1JHJ A;  3C8X A;  4XUQ A;  3NRU A;  3OGS A;  4Z2A A;  3I2H A;  4AAX A;  1W9S A;  3LEK A;  4RN5 A;  3WF2 A;  3T0A A;  1UY2 A;  4DXS A;  2VZ1 A;  3HNB M;  3HN3 A;  2J1U A;  4XUN A;  5JR2 A;  2VZV A;  3WF1 A;  5IFT A;  2VZR A;  1NAE A;  2YC4 A;  1PMJ X;  3J7H A;  2QQM A;  4XZU G;  4TXW A;  4QB6 A;  3CMG A;  3ACF A;  1OF3 A;  5B4X A;  3ACG A;  4OMD A;  1UY0 A;  5JXH A;  1UYZ A;  3LQC A;  3D3A A;  4FI9 A;  3E1F 1;  1EUT A;  4DEV A;  3LEI A;  2EID A;  3NJV A;  5F7U A;  5IHR A;  1DLC A;  1K45 A;  2E31 A;  1I5P A;  3MUZ 1;  3HOB A;  4PT6 A;  5G04 L;  4TTG A;  3VD3 A;  2VMD A;  2Y6K A;  2VQT A;  4YPJ A;  5C7G A;  4MOA A;  5CYY A;  3CZJ A;  2VJX A;  4D0Q A;  2V5D A;  2YC2 A;  1PMH X;  3NQH A;  2W1S A;  2Y6G A;  3CKH A;  1BHG A;  1SG3 A;  5JXJ A;  1KGY A;  2ZEX A;  1UY1 A;  4UAP A;  3P6B A;  4QB2 A;  1JZ5 A;  5DN2 A;  1WKY A;  1JYV A;  3VD7 A;  2Y64 A;  3GXU A;  3T0D A;  1NKG A;  3W5M A;  1O8P A;  1D7P M;  5CZK A;  2QQN A;  2X05 A;  3I3E A;  2DCJ A;  2W95 A;  4GWI A;  1UXX X;  2ZEW A;  2W92 A;  2R7E B;  3OG2 A;  3FL7 A;  4JX0 A;  3UNP A;  4CU6 A;  3CQO A;  2QQJ A;  3HNM A;  3III A;  1TG7 A;  2HYX A;  1P8J A;  3I2G A;  5B4N A;  1UYY A;  4KMQ A;  1K3I A;  2VCA A;  3DYM A;  3T2Q A;  2LS6 A;  3I3D A;  3THD A;  3THC A;  3OEA A;  4ZZ5 A;  1JZ7 A;  2ZEY A;  2XOM A;  2Z4F A;  2B9V A;  5DQ0 A;  1YQ2 A;  2JE8 A;  1W9T A;  1JI6 A;  2QQI A;  4QPW A;  2W1Q A;  2RVA A;  3WNK A;  2E26 A;  2E32 A;  2WBK A;  2J22 A;  2C4X A;  5EIY B;  3WF4 A;  1UMH A;  5LA0 A;  3OB8 A;  1LNS A;  5JUV A;  3I2J A;  2LW8 A;  3FN9 A;  3U37 A;  3MV1 1;  2VZT A;  5LA1 A;  1TVG A;  3IAQ A;  2C9K A;  2QQO A;  3WNO A;  5LCW L;  1PX4 A;  3VDB A;  2WUH A;  3T08 A;  5DPN A;  2Y6H A;  2VZS A;  4JKL A;  2W3J A;  4GWJ A;  2XON A;  4XUP A;  5J1X A;  4KI5 M;  4OYU A;  2BER A;  5FUI A;  4QDS A;  5IFP A;  5I0D A;  2E33 A;  4QX3 A;  5C70 A;  1SHW B;  1W9W A;  1NUK A;  4CUC A;  2KD7 A;  1EUU A;  3MO4 A;  4LPL A;  1W8N A;  2YFZ A;  2WDB A;  3EYP A;  1OF4 A;  3GGL A;  2WO1 A;  3ACH A;  1L7R A;  4OUE A;  3A21 A;  4QAW A;  3VDA A;  2J1A A;  1UWW A;  1GU3 A;  2BBA A;  4QX0 A;  5HXM A;  1OD3 A;  2OKX A;  2VOT A;  1KEX A;  2HLE A;  2VTF A;  1UMI A;  2YG0 A;  4E8C A;  2XQX A;  1JU4 A;  3ABZ A;  4UI9 L;  3NNG A;  3MV0 1;  2PQS A;  1T2X A;  1L7Q A;  4A45 A;  1JU3 A;  5HPO A;  3GDB A;  1IQD C;  1XNA A;  4KWU A;  3P1I A;  3PUI A;  2VO5 A;  3SKJ E;  4MGS A;  4DUX A;  3HNY M;  3CDZ B;  1XNT A;  5JMO A;  2YB7 A;  3WQB A;  3HPN A;  4BDV B;  5A1A A;  4M4R A;  4DXR A;  1J83 A;  4MO3 M;  3OGV A;  2VCB A;  3NJX A;  2W94 A;  3K4A A;  1JZ8 A;  4BK5 A;  4ET7 A;  1K12 A;  3VDC A;  3WF3 A;  2CDP A;  3WF0 A;  4GZ9 A;  3CZU A;  4A3Z A;  2VC9 A;  1CZV A;  5IJR A;  2BZD A;  3C7O A;  3F2Z A;  3T09 A;  3GM8 A;  3VD4 A;  3FHA A;  4A42 A;  3OEB A;  3I3B A;  2V4V A;  3CIH A;  1DYO A;  3ZM8 A;  4A6O A;  2QQL A;  1SDD B;  1XPW A;  2VZ3 A;  2RV9 A;  3UES A;  2C26 A;  2J1V A;  4P02 B;  2DDU A;  1UY4 A;  4DXT A;  4MAD A;  2WN3 A;  1F4A A;  4ZZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...