5FBZA

Structure of subtilase subhal from bacillus halmapalus - complex with chymotrypsin inhibitor ci2a
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
432
structure length
432
Chain Sequence
DVARGIVKADVAQNNFGLYGQGQIVAVADTGLDTGRNDSSMHEAFRGKITALYALGRTNNANDPNGHGTHVAGSVLGNATNKGMAPQANLVFQSIMDSGGGLGGLPANLQTLFSQAYSAGARIHTNSWGAPVNGAYTTDSRNVDDYVRKNDMTILFAAGNEGPGSGTISAPGTAKNAITVGATENLRPSFGSYADNINHVAQFSSRGPTRDGRIKPDVMAPGTYILSARSSLAPDSSFWANHDSKYAYMGGTSMATPIVAGNVAQLREHFVKNRGVTPKPSLLKAALIAGAADVGLGFPNGNQGWGRVTLDKSLNVAFVNETSPLSTSQKATYSFTAQAGKPLKISLVWSDAPGSTTASLTLVNDLDLVITAPNGTKYVGNDFTAPYDNNWDGRNNVENVFINAPQSGTYTVEVQAYNVPVGPQTFSLAIVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Enzyme subtilase SubHal from Bacillus halmapalus
publication title Stabilization of Enzymes by Metal Binding: Structures of Two Alkalophilic Bacillus Subtilases and Analysis of the Second Metal-Binding Site of the Subtilase Family
doi rcsb
source organism Bacillus halmapalus
total genus 154
structure length 432
sequence length 432
chains with identical sequence C
ec nomenclature ec 3.4.21.14: Transferred entry: 3.4.21.62, 3.4.21.63, 3.4.21.64, 3.4.21.65 and
pdb deposition date 2015-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
A PF04151 PPC Bacterial pre-peptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5fbzA02
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5fbzA01
4B5LA 3A3NA 1KE1A 1AV7A 3DDZX 3P5BA 2WWTA 5I9SA 1QXPA 1BH6A 1WMEA 5JXGA 4Z2AA 3BX1A 1Y3CE 3T41A 1BE8A 1SCAA 4DZGA 1TO2E 1PJ8A 2SNIE 5AMXA 3EE6A 5JMOA 1C9JA 1SBIA 3DE3X 3GT3A 4OV6B 1CSEE 1NQDA 3DVQX 1SBNE 1WVMA 4I0WB 3GCXA 1WSDA 1NQJA 2ST1A 4BWGA 1NDUA 3PRKE 1OYVA 1YJCA 1Y33E 1T1IA 3QFHA 3AFGA 5JXIA 2ID8A 1KDVA 2W2QA 1KFXL 4KPGA 1NDQA 3AJ8A 1SBHA 3F49S 1TM7E 1A2QA 5JXJA 1YJBA 4FONA 3DF0A 3VV2A 1Y1KE 1TM1E 1ST2A 3F7OA 4J94A 4HPKA 1Y3DE 1S01A 2DP4E 2W2NA 2GKOA 4NMXB 1Y4AE 1KDZA 3DWEX 4DY3A 3JQXA 3CNQS 1EA7A 2WUVA 1SPBS 3A3OA 4ZOQI 2QFEA 1Y34E 4C3VA 4DZTA 1U5IA 3JQWA 1ZVKA 3GCWA 1SIBE 5ARDA 1ST3A 2Z58A 4DWWA 1BFKA 3F7MA 1V6CA 1YU6A 3Q40A 1S2NA 3D9QX 1KFUL 1C9NA 1C3LA 3CO0S 1YJAA 3GT4A 5ARCA 4AKTA 1SCJA 1TO1E 1AH2A 4RYDA 3I34X 2XVGA 4OMCA 5B1EA 1IC6A 1LW6E 3DVRX 1AU9A 1ZVJA 5SICE 3VHQA 3LXUX 1T1EA 1SIUA 3WIUA 1WMDA 4CFZA 1EGQA 1SN7A 4I3GA 2IY9A 1SELA 3I37X 2IXTA 1GA6A 3EIFA 2W2MA 3D43A 1OT5A 1Y48E 3DW3X 4WOBA 3I2YX 5JXHA 3DE1X 1GT91 1TMGE 1TM5E 1KDYA 1PFGA 4YN3A 3ZXYA 2ZWOA 2Z30A 1SUDA 5B1DA 4HVLA 2WV7A 4KB5A 2PRKA 1VSBA 1TECE 2Z56A 3TI7A 1SCDA 5FFNA 1SCNE 3PTLA 1MEEA 2XRMA 4H6WA 1GNSA 3EDYA 2Z2ZA 4H6XA 2SBTA 4AKSA 2PMWB 3DE7X 4HPKB 2E1PA 1SUPA 1P7WA 1OYOA 2Z57A 5AQEA 3SQOA 2PYZA 1TM4E 4MZDA 1R64A 4CG0A 1BJRE 1IAVA 1GTJ1 1AVTA 3LPAA 1TK2A 2X8JA 2ID4A 1R6VA 1SUBA 3BOWA 3WIVA 2Z2YA 3L1KA 1AF4A 3TI9A 3OSZA 5CW1A 2X8JB 3TECE 3VYVA 1THMA 1C9MA 1GTG1 2B6NA 4K8RB 2PKCA 1AK9A 1Y3FE 2HD4A 3ZXXA 3UNXA 3DYBA 2O8OA 2ZRQA 2V8BA 1SCBA 5FAXA 4M1ZA 2TECE 2WUWE 4GI3A 3SICE 1SUEA 4ZARA 3AJ9A 4KG7A 1Q5PA 3A3PA 1Y3BE 1AQNA 1PTKA 1Y4DE 3DE5X 4DJ5X 1BE6A 4LVOA 2XTJA 4WOCA 1GA1A 1SUAA 2SECE 1SIOA 4HX2A 2ZWPA 4DY5A 1GA4A 1SUCA 2PWBA 3WHIA 1DBIA 1TM3E 2W2OA 1GTL1 1UBNA 1Y9ZA 3I30X 5ARBA 3HJRA 3LPCA 1XF1A 4LVNA 1KE2A 1JEAA 1SBTA 3Q5GA 3QMPA 3VSBA 2QTWB 1NLUA 3DE6X 4DXZA 1DF0A 1WMFA 3H42B 3VV3A 4H6VA 1P8JA 4OMDA 1GNVA 4G9SB 2G4VA 5AVKA 1T1GA 3QTLA 2Z2XA 4CFYA 1BFUA 3DE2X 1SH7A 1S02A 1SVNA 1V5IA 2PWAA 1MPTA 2W2PA 2SICE 4NE7A 4C3UA 1R0RE 3LPDA 5AVJA 3BGOS 2XVLA 1PEKE 1DUIA 2P4EA 1CNMA 3DW1X 1P7VA 4NE9A 5SV5A 2XVKA 3BPSA 5FBZA 1HT3A 3DE0X 3DVSX 3WQBA 1GCIA 2LUWA 3VTAA 5K7SA 3DE4X 4JP8A 2DUJA 2PQ2A 2HPZA 1SBCA 2DQKA
chains in the Genus database with same CATH superfamily
1TEXA 5FOXA 3M3PA 3SHOA 3M6IA 1FNZA 1WKBA 4X44A 3RUEA 4ZZ5A 4JRAA 3AX4A 4D56A 3RABA 3KDPA 1RUJ3 4UZFA 2FE1A 1I7NA 3BGWA 2R8YA 2P7IA 3ZWBA 1NZDA 5ACA2 2Y6VA 1XTUA 3BPZA 4WESB 4C1BA 3T4EA 2PZEA 1UMIA 1QIGA 4JL8A 2EHDA 1MLDA 4E3ZA 1ESCA 3QHAA 4AZ3A 4Q3KA 3BQMB 5IAOA 4ZAVA 3WGVA 9ATCA 1W36D 1NBMA 3WWEA 4BXSV 1ULCA 4DREA 1RWOA 1EZ4A 2HCRA 3ZYGA 3R9KA 3DL7A 2NMNA 4R3WA 2KB0A 4ZGWA 3HDTA 4X62B 3I9V6 1WOMA 4Q12A 2RS32 1S0CA 2VHZA 5KHOC 1UU6A 2XVMA 3VL8A 2CHFA 2PJUA 2CNKA 4U2FA 3E3AA 1U9IA 1E1LA 4DQAA 4JCOA 3NBQA 2WM8A 1WBFA 3KUDA 2QVBA 1A0OA 2FEXA 5BPXA 2BISA 2EX0A 2HRCA 4GOXA 4JSTA 2P1DA 3I0ZA 3KQVA 3HA7A 2J09A 3F6CA 5T5QA 1XTQA 1BBT1 5FXMA 4Q0MA 4R8RA 3ATGA 1HSZA 5ECWA 2YYYA 5K03A 3NANA 3AVWA 3JZVA 4QPPA 4Z3OA 1DT3A 1PMJX 2OKXA 1D4VB 2RCYA 1UZWA 3ZSKA 2E6KA 2Y05A 1AU9A 4TTRA 1DO2A 1IQAA 5CNJA 1EPWA 4EBBA 3KB6A 3HYTA 1SLAA 3WCSA 4GBMA 1NUPA 1DQ6A 4ZZIA 4LJ8A 3TR6A 4DMCA 1N9KA 1RC0A 4DLPA 4JDOA 1USIA 4N18A 5L6MB 1P2VA 3IKTA 5DN6D 3SQMA 4DW8A 1MC5A 5JZVA 3FPJA 1QJY3 5CGQB 4IUBS 4OQFA 2P62A 1NAEA 1GQHA 2C9DA 1FZTA 1ZS9A 4DSZA 3T7TA 1XMXA 1CIVA 4PSVA 4TZ0A 2A5YB 1CXZA 2P40A 3WYAA 4Z99A 1MR5A 1D6JA 2HLDD 2JG9C 3KTDA 1XQXA 4QB2A 2CL0X 3PTLA 2BI8A 2VJQA 1ONOA 3AZZA 4UBHA 3NHPA 3I9FA 3HYLA 1U7OA 2GUWA 1MENA 1JQBA 3V65A 1GFIA 2XZOA 2QM3A 1W4CA 2HPAA 1WWKA 2Y68A 3PE6A 2R7AA 3NV2A 3FRHA 2Q0SA 5J5AA 3U0BA 1G8MA 1ZGJA 4DOMA 3RJMA 3LP6A 2FR1A 3AF4A 2HJVA 4EFMA 8ATCA 1SVIA 5PNTA 3A4YA 4UKDA 3B9BA 4G4JA 4CBVA 1NJ6A 3PHGA 2WFAA 3VC7A 3UATA 3MJFA 4XACA 2ZKIA 3LHIA 4NN0A 3P9XA 1HDYA 1I2AA 3T7RA 1G9TA 1TO6A 1L5NA 4B71A 4MHTA 1AKNA 2BHRA 4IEOA 1ABEA 4MGQA 1BN7A 4TWJA 4RK1A 1TJPB 5J2TF 4DM4A 1Z7BA 3LQKA 1AR63 4E2WA 1Q43A 1W99A 4I9FA 1FYUA 4RWEA 3T0BA 5EKTA 2Z2JA 1UBRS 3IUPA 2E4XA 5FZKA 3KYDA 3FOCA 4IDOA 1TTHA 2JASA 4I5IA 2ZTSA 3AEYA 3HQUA 1CS0A 2R7NA 4Y6GB 5CK4A 5DB4A 3HK2A 5FPLA 2VZOA 1KMHB 4QAJA 1GSLA 4P3PA 2BH2A 2H51A 3HCCA 2O57A 2PRIA 3RUCA 1TJ4A 3T3EA 3HKDA 1NXQA 1S7CA 4YPOA 1E94E 4U00A 2Q2NA 1KEEA 1Y7LA 2JIDA 4D99A 2MIIA 3S2YA 3SX4A 2MTBA 4P7BA 1Z88A 1DTWA 4B4KA 5JO0A 3RIHA 3W1EA 2W11A 2G9UA 3TLZA 3MRSA 4B3JA 2B0JA 5GZDA 1NIJA 4RUKA 5GGXA 5LB4A 3TVTA 2V4ZA 1SHUX 3S55A 5U1PA 2Z3ZA 4GA9A 2JH8A 3RO7A 1TU4A 2VQSA 3TOCA 5DM1A 1N0VC 3RHFA 3O4HA 1UBEA 4YBRA 1KE1A 2RV9A 3CIFA 3SHQA 4F6RB 1ZNPA 2I3BA 5EJMA 2I07B 1RUOA 4NBTA 3LH5A 1O97C 1KKLA 3U56A 2VPTA 1LU9A 1ADJA 3RAJA 3B20A 3R9XA 3E9DA 3H13A 3M6VA 2Y0CA 4KU4A 4FN5A 3OHMA 1P17A 3KZMA 3HRKA 1ATZA 5FO9B 4CKBB 2EALA 4PJYA 3EAQA 1CAVA 3QACA 4HRXA 2QZ2A 2GALA 1CRQA 1OYVA 2PUVA 4OSOA 5FRAA 2GYWA 1LQTA 3L0SA 1ZVMA 3HCDA 4OFZA 3MT0A 4HN0A 3WMRA 3H4VA 1HNXB 1RBYA 1GP2A 4CFSA 3PLRA 2V9PA 4FLFA 2E4AA 3CF4G 3LDAA 4MUKA 1EE2A 5JSFA 3LT0A 4JR1A 1W8HA 2R0FA 4IL7A 2Z5VA 1FMD1 1YCHA 4MAMA 2JGIA 3N59A 2XGGA 3T2OA 2R00A 3PXAA 1WRBA 4YV7A 4Y18A 3AOEA 5J2TA 5FY8A 4G97A 1WA4A 5F37A 2QLTA 4LHLA 1UDAA 2VTXJ 4B8YA 1HDXA 1L4NA 3T15A 3OCVA 1EAYA 3IQDB 4F5WA 3T2QA 1NWCA 4BRWA 4HGNA 5EFUA 3DCJA 1MZVA 3UA4A 4GVPA 5D6NA 1S2MA 4FEAA 3ZCVA 4JLDA 1SVSA 3L1IA 3OF2A 1TF7A 3AFHA 4LKOA 721PA 4QREA 1KTIA 821PA 3OZAA 3K9FC 3VR3D 4D6QA 4DR7B 3HJTA 3WZLA 1U8TA 4JXZA 5L40A 1OFUA 3JZIA 3GWGA 3PNMA 3T08A 1MO3A 1L7BA 1J1TA 2G0NA 4H1UA 5D3ZA 2HDNB 5KOJB 3FVWA 2Q5EA 4D81A 1JXQA 2FDRA 1MX3A 2X23A 4V0KA 4EATA 1VMHA 1WMSA 4AI0A 1RJFA 3NYIA 2OY0A 4QKQA 1PKXA 4GWGA 1T6BX 4N01A 1EG2A 2PSFA 3DOIA 1DCMA 2J6CA 5FOSA 3R5KA 3W6UA 4DHEA 2HF9A 1W94A 1E5QA 3BHMA 3DKKA 3IODA 1CKEA 4I5GA 1DP0A 1JHQA 1HRV3 3ZHUA 4WIAA 4XF4A 4PU0A 2YOHA 1VHWA 4WINA 2BVVA 3AXDA 1Z63A 2KLBA 3U40A 4F5ZA 3VPFA 1NATA 2O59A 3COYA 4UC0A 4W5RA 4OD0A 4K1XA 1YWGO 4XYLA 3RV4A 4W6QA 5K20A 4QT0A 3TE7A 3PE3A 1OREA 2W71A 2OXIA 4GD4A 3OZXA 3ASIA 5GAJA 3BREA 1DQYA 4YUYA 2FZLA 5FAXA 1L4EA 4LC9A 3M5DA 4JRLA 5I7RA 3N2GA 2BRUA 1WTCA 2FBEA 2VZ1A 4BFZA 4GF5A 1JNYA 1Z5PA 2YGLA 4KQ7A 2QZPA 4IFIA 3ZW7A 3JQBC 4WACA 2X5IB 2RBEA 1I5ZA 4CDMA 2OZLB 2AQKA 3LM8A 4L51A 2FMXA 4OHMA 3OKFA 4QKBA 4BA6A 4O5OA 4EW6A 1NVKA 2HBZA 1AQJA 4EEXA 5DTEA 1M34A 1BYHA 5GGYA 1X15A 1LX7A 3QBEA 2JC3A 5AI5A 4B75A 1GYRA 1ZSVA 1ULEA 1SHZA 3D8UA 2Z95A 2HXSA 4DQUA 4HONA 3CCCA 4ZS3A 1R8JA 1G5HA 2C9KA 1K86A 1X8XA 4W6WA 3RFRA 1UK8A 4C7MA 1O5OA 1KK1A 3V1MA 3KRTA 4D25A 1ORTA 2ZULA 1EIWA 3P3NA 2ZIUB 3ZHQA 2OBBA 4BOWA 1H8VA 1GUYA 2FMFA 2WL1A 5I3ZA 2MSNA 5JQGF 3HJBA 4DXAA 3DAYA 2YZ7A 3QJYA 5JD5A 1KVRA 1VBB1 3JD2A 2REQB 3RU7A 1WW5A 3VKOA 1ZAKA 1P0FA 4PG8A 5JBNA 1N8SA 2G7ZA 4C6HA 2TEPA 3WIBA 2RHBA 3ORQA 5EXDA 1DZ3A 3TR5A 1DZRA 3C8HA 2XBMA 2IEGA 2O2IA 5DWVA 1LDBA 4HY3A 3LBFA 3N8DA 3FX3A 2WNSA 1W5EA 5KC5A 2AJ8A 2WDPA 4BQIA 4TMFA 3VDDC 2G71A 4V1PA 1XJCA 3DLIA 3PHCA 1RZ3A 1DO0A 4M8SA 2J9GA 1JZQA 2VH1A 4PCUA 2ZSDA 1L8AA 3P2MA 3C1UA 5AKJA 1I6KA 2P75A 2CEAA 4JP1A 1ONNA 4HQNA 4B6RA 1HLCA 1C9JA 3HL4A 3IXMA 3CUKA 4BDVB 5ALPA 4OGFA 1QRTA 2ANCA 4ETWA 4PG5A 4N49A 2QR3A 4ND8B 2W9XA 2PRJA 1JG7A 3KFXA 1YFJA 1L7AA 2LZ0A 3EZ2A 1UODA 1G8JA 4L8VA 3BAFA 5C1OA 3BXFA 3AR2A 3A9WA 4PGGA 1CX1A 1JWBB 4QT6A 1NVAA 3OZSA 4OMUA 2WW8A 3ADCA 3PIDA 2I87A 2ZGVA 3NFYA 4LO8A 4GWLA 1PO23 1CG6A 1XHEA 5CEHA 1KYYA 3FNGA 3R7SA 5ITZB 4DM7A 3JSXA 1EFRA 1HDRA 1UY3A 3EEIA 4G65A 1PK9A 4FMDF 4P3YA 5BYBA 1JYTA 1H8TC 4NULA 3UV3A 1H1MA 2Y6LA 1CJTC 3FFXA 1EM8A 2GDZA 3V48A 4KHPB 2LBPA 4WFJA 3W5UA 2WNIA 2NPFA 1QWRA 3L1JA 4D9IA 4MEBA 1R082 3RGBA 4YGCA 1P77A 1Z73A 3P0EA 7ADHA 5LKAA 3QKWA 4YJ3F 5LP6B 1AYN3 1YDEA 4Q4Y3 3OO1A 3RS5A 4TQGA 3AHCA 5EI5A 3NNJA 3ILNA 4B09A 4X63A 5DAWA 5DSZA 2VBCA 3CF6E 4BCDA 1W34A 3A7DA 4DMHA 3FD8A 3SSAA 4ZV4A 1M74A 1VBA2 3A3KA 4HNSA 1MW8X 9LDBA 2DU1A 2VDKB 3A58B 4BWVA 3KXLA 3JR7A 1DRJA 3WJ2A 2ET1A 1YQ8A 2WMDA 4JDNA 1HLPA 3A2LA 5EJGA 4L8FA 4YQZA 1WCV1 5JUWA 3EXUA 1LSOA 2F67A 3SM9A 4B3NA 2QTMA 2DPLA 4LUMA 5D7NA 2WWJA 3O4JA 5AI6A 4BQSA 5FBVB 2Q5TA 5CFCC 5FZBA 3OFND 2RHPA 2M1ZA 4IHAA 3IUMA 5AYVA 4YRAA 4IJ6A 3UFBA 1E79A 1HZZA 3TIGA 3IPVB 1Q8SA 5FY9A 3ENKA 3NORA 3BXGA 5FYIA 3AR3A 1BE1A 4RNCA 4KV7A 4PS0A 3DHEA 4IOMA 1MS4A 1V47A 3PS9A 2H29A 2GMEA 4WY5A 3U39A 1GTG1 5C8CA 3TM5A 5AW0A 3B6ZA 1PJSA 4ZQCB 3RVHA 1AHSA 2WINB 3ZJ5A 5JDIA 5CVEA 4QSHA 4COWA 4EYSA 3VOTA 1KNQA 1IY1A 4Y1RA 4Y1VA 1SUEA 3OQBA 1GVNB 1CFJA 4DQ0A 4IH9A 4WM8B 3EXG2 3TIXB 5J47A 1EX9A 3GVXA 3K9BA 1MC1A 1NCRC 2HIAA 3BHJA 4LPKA 3NHFA 3NHYA 2DKOA 2ANBA 1YDWA 3IKMB 2WQ8A 3GJQA 4UE6A 1GWLA 5IHRA 4ETIA 4XTPA 2ZITA 4MQEB 3F95A 2D1FA 3U3MA 2I4LA 2IYVA 2WQ4A 5BUZA 2JI7A 4YCSA 4Q4W2 1SKYE 5MN4A 4TVBA 1OU4A 1NPYA 1M1YA 3UTCA 3WWYA 3K48A 2L2QA 4QL3A 4DJJA 2RM23 1J7KA 4MXWA 3MG9A 4TXNA 4MARA 5IX8A 3UWPA 5EKDA 1AXKA 2P91A 5I48A 4DLLA 5KC9A 2Z2KA 1V5IA 1DEXA 1NCQB 4CZ2A 4Y20B 4YJ3A 5IULC 2R063 4DCGA 1IPHA 3THRA 2QR5A 1HR0B 2HWB2 1BJQA 2Q29A 4QDOA 1XE8A 1G5PA 2NYUA 4OJTA 4X7BA 1IHOA 3ADDA 1LQUA 2IYTA 3WLOA 3BPSA 4MRMB 4UAJA 3CT4A 4B17A 3BZBA 1HTWA 5A4JA 1TLLA 2PSEA 1JN2P 2BP7A 2O2JA 4FMCB 2ZJ3A 3VR5H 3WG1A 2TRSB 2X5NA 1WD5A 1H69A 5I4CA 3UMRA 5ITSA 2FPGA 3V4LA 2VQ3A 3NMUF 2JIZA 3FPSA 4N8DA 4RORA 3KAJA 1RADA 4QPDA 3V8PA 4NYIQ 3RUHA 1ZGGA 1EB8A 1WS6A 5AOVA 3DCNA 3VKFA 4BFUA 4E07A 3DDWA 3OQOA 1SHTX 5FZAA 1W35A 1RUJ1 2GLUA 5HQ3B 1MVNA 3VYUB 3GGGA 1UMBA 4MHOA 4BAZA 2IPXA 2IVFA 2E32A 2G1UA 1GPMA 1MG0A 5FI3A 3ZXIA 3W8EA 4IZIA 4J16A 3TSZA 3FYSA 2WSSA 2CKDA 2VL7A 2QMHA 4KUHA 3PNQA 1OQEA 4OLLA 3RVPA 2D06A 2EGGA 1CUWA 2ETXA 2F1KA 4W9MC 2O6HA 3TEFA 3K5HA 3KU1A 1EQ2A 4FYPA 3M1AA 4A7KA 2XUIA 2Y0PA 1SD5A 1OMOA 3MRXA 1RAIA 4QDJA 1UAYA 4DDTA 1D6MA 5LA1A 2Q5IA 2XQRA 1X3LA 1DJQA 2JG8B 1BEZA 1E0AA 1GTVA 3PNSA 1MJ5A 3I58A 4MDEA 4GZ5A 3GZEA 1O3YA 1YUMA 2Q4EA 1Q21A 5KWVA 3ROUA 4PIYA 2R7MA 2J4CA 1NVEA 2PQMA 2HJWA 5CADA 5DMHA 1RMTA 4TSFD 3E9QA 1V6OA 2RS52 1TVGA 1GRNA 2HWD2 2G88A 5KQMA 1OUSA 3RHTA 5THXA 3NBAA 2EF0A 1K8QA 1T4MA 1HX7A 2Y1CA 3UN1A 3EN0A 2AK2A 4A6EA 1XHFA 2EEPA 2QEQA 5KHAA 3NIWA 1N2HA 4QLAA 1YNAA 1UZMA 1XCGB 4BMBA 1QB7A 1SUDA 1JBCA 2PBLA 4Q1BA 3EUAA 4Q4V1 1J42A 3ZGZA 2HWC2 1FFYA 2Y6JA 4ZVQA 4H3SA 3OZFA 1DEAA 4F9EA 3NL1A 3MJRA 3QBJA 3KLOA 4MQFB 4YJFB 1YJXA 3L79A 2XMZA 3K77A 3AU8A 3D5OA 5D8DA 4NEGA 3DMTC 5CW2A 1E6WA 3K70C 3ES4A 4EHDA 3NPMA 5GWXA 1D7OA 3SJCA 1ORWA 3OEWA 1SGWA 4DJAA 1R6AA 5FXXA 2GK3A 1X9HA 4CT0A 2E7QA 4WXYB 3DTYA 2P8JA 1OGIA 5IG2A 1ZK4A 1K7YA 1RXFA 3O7OA 4CDUB 5FX2A 1U2SA 2AW3A 3CVUA 1B6SA 3KB1A 1GUFA 3OT4A 4IDBA 4ID9A 3ON7A 4TMKA 4BHPA 3W77A 1W29A 1X14A 2HJSA 3NJRA 3C1AA 1SEFA 2AYHA 1Z3IX 3E53A 1RTTA 1SOWA 4FP3A 3PLAE 4QOFA 1KRIA 4WEOA 3P4YA 4DUVA 2GCGA 3RYFA 2VZ0A 2OPKA 3J26N 3QKSB 3ULKA 2QUAA 2QTGA 1ISMA 4NAVA 2DHEA 3HM9A 4JFAA 4F8AA 3EZ9A 4WXEA 1W2WB 3KSUA 3L9JT 3WYFA 2RAPA 1UDRA 2M6RA 1PNTA 4JC4A 2Z8XA 3KSZO 2O0JA 2AG0A 5JJBA 5BT9A 3WUDA 4X8MA 1ZXBA 4P4UA 1VC2A 1WZIA 5CA1F 2XB6C 3GOQA 2MSEB 3OEED 1DCKA 3EFOB 4GI7A 2RC6A 2QUIA 3K4DA 1MQTA 1AR61 3LT4A 3TN7A 4DFSA 4XEHA 3MPOA 4OKNA 2C2GA 1KO8A 4QEZA 4LBQA 2PQ6A 1USWA 2ZBJA 5A32B 3L41A 1MIHA 3C7KA 1HQKA 1QFSA 3E9YA 3POWA 2XYQA 4FKZA 2L0XA 1T9AA 2AGVA 1VJ1A 3SQLA 1GWMA 1VJ2A 3M7AA 1N2SA 1IJFA 1CF9A 1HV8A 1ZXXA 1R12A 1NV8A 5M7EA 3SEAA 2YJ5A 5BMVB 1AE1A 3A1VA 1PEKE 1H05A 1QHXA 4F12A 1SHLA 3OZIA 4A8HA 2IX9A 4HI0E 1O3QA 4H77A 2GZWA 4HG6B 3R24A 4GBED 1VSUA 4CEYC 5GONB 1A8HA 4LXYA 3O8NA 1JQEA 3KAKA 2ZSAA 2WQZA 4M0CA 5HJ2A 4R2IA 4BQYA 5INTA 1UMHA 5CLQA 2ZRMA 3TG2A 1BWSA 2YBKA 1T4BA 2AG6A 1JSLA 4E8CA 4OCTA 1F9AA 1O95D 1KI4A 2XHNA 1AR82 4LE1A 4AF6A 4BGEA 1IPJA 2VG9A 3GBFA 2E55A 1Q7CA 1EVQA 2GB4A 1ODLA 2RKWA 5FY1A 5T3YA 4GQAA 4Q1AA 2SNIE 2QGZA 5DLEA 3QEAZ 4RDHA 1THTA 5AK5A 3L4EA 3BE5A 3HV0A 4TT3A 3A25A 3T1OA 1QZUA 2QP3A 1X1CA 3APBA 2ZGKA 3H0OA 4FE4A 2I22A 1YJCA 2WWIA 4URTA 5BXQC 2ZX3A 1OF4A 3OZDA 4N7UA 1NI3A 4Q3CA 2JKBA 1V6IA 1J3QA 4K21A 2ZUCA 4L8GA 3AQ4A 2GN6A 4CA9A 4PBPA 1DQ0A 3B93A 1JG4A 3C2QA 1X0VA 1YZKA 4CLRB 3ZHVA 1JR3A 3GARA 1KAGA 3THTA 2CGPA 4CM9D 2LP4Y 3PDWA 5FI0B 1SKMA 1KI7A 4AEDA 2JFOA 4CUBA 3JQQA 1PZGA 3D0KA 1A9RA 4X41A 2ACKA 4CYDA 4WASA 1JFFB 1PJLA 1XAIA 2XRZA 3JARB 5ARDA 1QQP2 4PHHA 1GCAA 4KSYA 4IE6A 3K9WA 1DHTA 3AONB 4XFDA 3Q8CA 2QVCA 1WDKA 1QFJA 4Y6QA 3FKSD 1G66A 3N9QA 2VSNA 4W50A 4AW9A 2XUOA 4FOSA 4OEHA 3KLBA 5DCLA 3K0AB 2XEDA 5CA1A 1LRJA 1Z2DA 5M29A 3LDFA 3OECA 4RGBA 1GAQA 2B7LA 3S1AA 2HMVA 1T9BA 3F8SA 4UU7A 1ZBQA 3V8VA 2IC1A 5C4IA 3OGVA 2GFQA 5CYGA 1KR5A 1AR72 1OQDA 1F5FA 5LCWL 1JYIA 2YZKA 1RITA 3ZN4A 4H7DA 4RAQA 2QAGA 2BWJA 1YULA 2C1XA 4BQXA 1TAGA 4OG2A 2QL9A 2ZSKA 3FPKA 1EWYA 1RNLA 2VZ8A 5CH5A 3QGMA 4D80A 4LAFA 1JDTA 2FPSA 1CUXA 1DLLA 5IT9A 10MHA 1DNPA 1V8FA 4PIPA 2BEWB 4EWAA 4FOWA 3QMWA 1ZGAA 4TQ9A 4LOAA 4L16A 2ZXQA 2K87A 2RG4A 1ZVVA 1U8EA 3PRHA 5CYYA 3O2JA 3ZYJB 2SKCA 4WL0A 5DM70 5HCBA 3X2FA 2PU5A 4WX2B 4MZDA 3LWDA 4N5LA 5A3UA 1TK2A 3OLCX 1T2EA 4DPLA 2DPGA 1Y7HA 1HRV1 2X8JB 2DF7A 1E2UA 1LH0A 2FDFA 5HCUA 1CIJA 4J4HA 1G59A 4GPBA 4WZBB 1RLTA 3TEXA 1JI0A 1L4MA 3GGJA 4BFCA 1WOYA 3A4TA 2PZ8A 1LLFA 3URFA 2VUDA 4ZZ1A 3L0PA 4G5SA 2GF9A 4DT1A 3S28A 3CPJB 4CIDA 5KDDA 3RC1A 1NG0A 2PLRA 3UC9A 5AK3A 5K8JB 1ZMTA 2I71A 3GO4A 3MWJA 5KNBA 3HRIA 2R1VB 5CB6A 3JWJA 3CKLA 3K9HA 3LX5A 4YW3A 2XAAA 5KYUB 2DT8A 1JFVA 4J7UA 3IO5A 4QUJA 4WPGA 3GT7A 4KPUB 5HPOA 4POOA 4ENVA 3TQCA 4YZ4A 1MB3A 3DT6A 2FJ0A 5SZHB 1Z36A 4AMZA 3NHRA 3R44A 3O5SA 3Q9OA 3O9VA 3LUGA 4U8GA 5KXEA 4H16A 5L7WA 2G9QA 5BY2A 2VYVD 2E7ZA 4NF2A 3QUSA 2BCEA 3FYUB 1TOAA 1FMTA 1SXJE 3PMSA 2YQ5A 3QENA 2O0LA 3CZPA 3LA2A 1YK1A 4UAUA 4EKNB 1T4DA 2GYUA 4AB1A 3THCA 3CPHA 4BH9A 5AR1A 1SVNA 1ZD2P 2W2PA 5TMPA 2Q9AA 4B4QA 3QSYA 3E1KA 3EQZA 3HGTA 4XARA 5K4GA 1W1WA 4N43C 1GZ4A 1CDZA 2DQZA 1WXIA 2X3FA 4D74A 4CCYB 4MLZA 1Q83A 4NZNA 4PC3A 1IWBB 5BNZA 2TSYB 3EXHA 5E1MA 1IH8A 4QYIB 3ZGYA 3LZZA 4KQJA 4ZY9A 5EJ4A 2WD8A 3IAAA 1Z7S3 1ZNQO 5LN1A 1EPUA 1S8OA 5FMCA 2XXAB 1MB4A 4UI9L 5FR1A 2IWGB 4DLTA 2FKNA 3KJQA 3ZE6A 1MMFB 2ZSIA 2XKPA 4B40A 3VPHA 3DLBA 3NTVA 1EFPB 1L1QA 2AFHB 4XGNA 1QYWA 3NDIA 1C4WA 3DHNA 3TTVA 2ECFA 4FOLA 1D3AA 1E3TA 2NTYC 5AHOA 1FY2A 3ZS9A 4ETNA 1DEHA 4P7JA 3JPYA 5CM9C 5JXIA 2DFTA 3V0BA 2JFVA 1XRLA 1PGW2 3TD6A 5APAA 4Q27A 3K6SA 3DCIA 4BNIA 3KZCA 4FQ7A 3CVVA 3R2JA 4PIMA 1KO4A 4FHDA 4Q0UA 1GL7A 5IFPA 2QVLA 4D9CA 5FH9A 2B7CA 2FXIA 3MW2A 2VMFA 2WJHA 4Z1OA 3LT1A 5BW6B 2JJ2A 3RTGA 1EV12 2HK8A 4MUJA 1XELA 1I3CA 1A3CA 4IMRA 3NKLA 1NOIA 2MU1A 3GWZA 2CWDA 3P2OA 1U6KA 1A9XB 2VQEB 2EXJA 1WCUA 4U3JB 2CGEA 1YNSA 1MH1A 5F7OA 2GJKA 4B2YA 5HM8A 1VSTA 5KSYA 5I7VA 2ZUEA 4KGGA 5FI5A 1P8AA 1CEQA 2OHXA 4Q7JB 2VW0A 3MPPG 4YUAA 4REMA 2Q07A 2QT0A 4EY7A 2QDNA 4QE3A 2GILA 1E7WA 1XCPA 1K7FB 3EMVA 2O3RA 1GU1A 4QQKA 3O31A 1F31A 4Q4Y1 1AL0G 3I2YX 5EERA 1ZK3A 5ALQA 3CX8A 4B80A 2ZZNA 2REXB 4LJSA 4D0LB 3UKTA 4RDIA 5JVVA 3DZCA 3CH7A 3JBG2 4Z3DA 2PKYX 3JCZA 3M6MD 1EUQA 2Q1UA 3AF3A 2WKPA 5M04A 3ZLIA 4YT5A 1ZINA 1QIQA 3TLXA 2QNRA 1O94C 3COPA 2Q49A 1NBHA 1A27A 3WF2A 1L5OA 4M3CF 1NX9A 4CT5A 3J8F1 3RR2A 3KR2A 4HPKB 3TNQA 3ZX5A 2EARA 5LWHA 1KMIY 4ZU3A 3HQXA 2IY8A 4HEJA 2WIIB 1Q7GA 1PBNA 5BSKA 3IEKA 1D7PM 3RB8A 1B35C 1O57A 3M1IA 2O8DA 1WBBA 1N32B 5JIAA 4IWXA 1W9HA 1X7ZA 3VYVA 5GOZA 3I2HA 1UT8A 4AICA 4PZPA 3DBLA 5KI6A 3I9OA 4ENRA 4EQZA 1GN9A 4ARBA 3S2UA 3V9AA 3CQ9A 2EQBA 3TLMA 4MWCA 4DYVA 1NW6A 5LM3A 3K1JA 2L69A 4UHEA 4EJSB 2GOYA 5EJFA 1ZRDA 3RS3A 1RYFA 5CEEA 1VBC2 2WDZA 5CA0B 2XJVA 5F9FA 1XKXA 3BDAA 5EWJA 1DKLA 2FP4A 4RJIA 2G08A 2CVZA 4L5IA 5D1NA 1P80A 1GFF2 1SBTA 2YNMA 3O4GA 4NK5A 3ICEA 4P02B 4BHTA 2VHJA 2A7AA 2VH2A 3R3YA 4X9XA 4ASUD 4LMRA 5HOEA 1Z25A 1VPDA 4D69A 4ZO4A 4V0RA 4E4SA 1AY0A 4ZYXA 3ZM8A 1XCBA 3SAJA 2J5XA 4M54A 4KFTA 2FOLA 4MW2A 3CUYA 3OQHA 4Z5XA 4ONEA 2YXSA 4RTNA 1R4ZA 1UU5A 2Y1OA 4AI3A 1G63A 4O4HB 4F93B 4JOSA 4DMRA 5T54A 3H3ZA 4WJZA 5T55A 4CMCA 2IY7A 4QJBA 5LFAA 1LLQA 2Q5HA 5A6VA 1JDBC 4A0GA 4D4JA 4QNMA 5CDFA 4EJ2A 2RM21 1FDIA 5ALOA 4C0BA 1BHO1 1NE7A 5DTJA 2BW8A 3NT5A 1LZKA 4O3FA 1CAWA 1TEZA 2R061 4D46A 1GP6A 1HT3A 5E8AA 2ZGNA 2GPNA 3WUCA 3N28A 3SHFA 1DZQA 2W6JA 1KH2A 3STVA 4KC0A 4L76A 1CZHA 4F4DA 5KBYA 5E3HA 2RGNA 1OWLA 1U5CA 4HAZA 1YI7A 1RWXA 3COWA 1VJRA 2WKWA 1ZBA2 3V2HA 3FE5A 3KALA 4CG1A 1XPRA 3LK7A 3VU0A 3B51X 3FZQA 5KTKA 1ES9A 1N3OA 4KN6A 3CDZB 5BNFA 4N0PA 1CJBA 5M5BA 4RPHA 4P0PB 1NYLA 4M3CA 1WA6X 1ZGCA 4JUCA 1D03A 4HDSA 3LFUA 4OYYA 3PFKA 5BPFA 4Q0VA 1JVSA 1V3VA 3FFAA 3AM5A 1O5UA 4NJEA 1M2WA 4QPGC 2YW9A 4K6GA 1X7HA 4M0PA 2VA8A 3Q7QA 4U7PB 4CUGA 3FMPB 2ZI3A 3CEJA 2ZFUA 8GPBA 4U2DA 3ZNNA 4DV1B 5LQKA 4UNNA 4EIWA 4G5GA 2J1LA 1JQLB 3TOZA 2F9FA 4IJMA 4P6VF 3GRUA 1VCIA 1OVPA 1BXZA 2ZMLA 2KSQA 4JP5A 1FFHA 3T4XA 1KEKA 2J22A 4LA3A 1IU9A 1Y34E 3H8VA 3CZJA 2CC2A 4IGKA 1OB2A 3RD5A 2DVBA 1PS0A 1E0DA 5DGTA 3SIPA 3MGUA 1RJ9B 1YD7A 1GQYA 3I6ZA 2JW5A 1RM0A 2PANA 3UJPA 4JJAA 5PGMA 3TNPB 1TO1E 2Y27A 3GFRA 5LA6B 4NPMA 1IC6A 3UQZA 1S3SA 4EECA 2M98A 3RU3A 3T5TA 4CFZA 2ZBVA 1S3IA 1SRRA 1C8KA 4FTWA 1N7HA 2BR4A 4ZYTA 2JGDA 1U12A 4F9FA 1OZGA 5AKEA 1PNOA 2F6BA 4J0FA 4DANA 3PL0A 3ZDVA 3V4VB 3O1TA 2CDOA 4D6RA 1JEOA 4EOGA 4F4FA 2IEAA 5TVGA 3H9UA 1RM4A 4MGKR 2VMGA 2ZWOA 4N6NA 1T26A 1YAJA 2DQSA 4QGAA 4QBFA 1ZHFA 4Q4JB 4MO9A 3EGDB 3UT6A 2Q2WA 3LVFO 5J96B 3AVQA 1QO0A 4XDGA 1BKSB 2C7VA 2VYCA 5FFNA 3LK6A 3OY2A 5FLKA 1NM5C 3HN3A 1UBGA 2E4UA 5B3JC 2AC1A 5KINB 3PUJA 5MN6A 4PN3A 1X70A 2QJRA 2BUKA 2W6IA 5FYVA 4BMZA 1X38A 3B70A 1IPKA 3C3YA 3FWYA 3BJRA 2ZTHA 6REQB 1KXGA 4FNOA 1YR9A 4MYRA 3TEMA 4PLGA 4C4AA 2XQKA 3BN3A 3RVBA 3WB2A 3ZKAA 3NQ41 3Q3IA 5CURA 3TSYA 1MOPA 3T3GA 1E3EA 2Q5JA 1ITZA 1THMA 4LHNA 1YS7A 4AFDA 1HOTA 1W76A 3PV0A 2PSHA 3F8WA 3LP5A 4F92B 1T24A 4E13A 3OG9A 4FYIA 5JOWA 2XV1A 3H87A 4EA8A 2V8BA 4HNQA 4LGMA 3WX0A 3ZZNA 1P18A 5D3QA 1OYWA 3H1BA 2GPJA 1QFZA 1JE1A 5ETJA 4PYIA 3P26A 3WTBA 3RMXA 3MA0A 4C90A 5JSRA 2PWBA 2BMFA 2BEVA 1YO6A 2IUTA 2DCJA 3FLTA 3II6X 1H2RS 2FFJA 4BGUA 4UVEA 3OQMA 5M0TA 3K0SA 2C1ZA 2NO6A 4WKGA 1GLVA 5DTQA 3MF9A 3USUB 1JKXA 1Z68A 5BSVA 1J83A 1JTEA 2XEXA 2WEKA 4ZJPA 1GTRA 4OKSA 5FBLB 1CTQA 4IVRA 1QXJA 5K0LA 1YBAA 4LI3X 2ZEWA 4ZVOA 3FFZA 2YJGA 3EF3A 1TYCA 5HDBB 2GN8A 1LSSA 3R5JA 4KFCA 3E81A 5BV6A 1QHEA 4U7HA 2XB9A 1K5HA 3ZKWB 3KQKA 4MLOA 2WJWA 4LXLA 1DHRA 1EP9A 1VE6A 2JIQA 5BQ3A 4AZ0A 5BW5A 5J59A 5BUVA 5BYAA 4H1WA 2ZRHA 5IFLA 4IS3A 2G1KA 5B6JA 1FTSA 3GD7A 4IXNA 6AT1A 5AJXA 5EEGA 1H0KA 3QVJA 3IUBA 4UVDA 2ZWIA 4EZEA 3LFTA 3NBYC 4KMMA 4NOJA 5LB6A 3C3VA 3BIXA 3IAM1 5E9JA 1LKNA 1GPNA 1ZNWA 2IIBA 2R6ZA 1EA5A 1SG0A 2NXWA 3ZVKA 1FOD3 1RL3A 5DNYB 3FG9A 1WL8A 4PFQA 3QFSA 5AMXA 3PC8A 2A7QA 4QDXA 1I32A 1G2OA 3KO8A 2FCTA 1KSJA 3H8RA 3F5SA 3L8YA 3ABRB 3LVRE 2WYWA 5AJWA 5F51A 1CPMA 4WXMA 3N7MA 3WFIA 1LLDA 1G0OA 3OZEA 1RTVA 4Y1EA 3GLUA 4CQNA 2DHRA 4KQHA 1TD1A 3AJDA 2VOEA 5FHRA 3DUFA 2DFBA 1VECA 4CEJA 2C7PA 1ZL0A 1ILEA 5TARA 4G5RA 1O08A 1VAMA 3M5PA 5B2ZA 2WKQA 5TMBA 2ZIXA 3PUAA 2ZTVA 2AI2A 5HCFA 1KH3A 3AZWA 4QB6A 3QPWA 5JD3A 3PQ8A 2DETA 1NTRA 4NJOA 1RIFA 2X77A 1NI4B 5CT9A 4CDQB 3IIAA 4QRDA 1E98A 1M2VB 1JZ8A 1XROA 1G6HA 5JZSA 1JH9A 2AZMA 2WFPA 2VAPA 2I2WA 1ZRCA 2H2DA 1FUYB 3T9CA 2ECOA 3DVRX 4Q3DA 1TYBE 3KK0A 3ZWPA 4LXUA 4KUEA 4BVHA 4L0DA 3BIWA 5KB3A 1PLKA 4LXXA 1WV1A 1MDBA 1NE6A 2JA1A 1BD3A 3M1HA 4IQFA 4MEJA 5DGDA 2RGDA 3KFVA 4OI0A 4Q4HB 1IATA 4L75A 3S2IA 1V45E 4E30A 5A33A 1OT5A 3CVXA 1ZBE2 4NU5A 4Q4X2 3QY0A 5B1HA 2AOUA 2BTQA 3BMCB 3K3NA 3C43A 3OJLA 4G8CA 1R3UA 4XHBA 3R41A 4YJGB 4MDFA 2R043 2IW1A 3WF0A 4PIVA 3KT7A 5SYMA 3KUKA 3WK4A 3E2IA 4FFBB 1ZJ6A 1JPUA 1Z0AA 2OZ6A 4G5YA 2DQYA 1M9NA 1APNA 2Z6UA 3RJZA 3R7LA 4TQAA 3R8XA 1NYTA 5KYYA 1N2CE 5AW7A 3CMMA 1ALYA 4Y9SA 4I2VA 1NVXQ 1S2OA 2VYFA 4JUAA 1T10A 3CUUA 4NMHA 3ZFGC 1RUD2 4YP7A 2NZJA 4MGEA 4DR6B 1N2IA 3A7EA 2GN3A 3VJKA 4QJ4A 3PJQA 5KNCD 4IIGA 3A0KA 1C3XA 2XCIA 2O5VA 3N75A 2YN4A 1EKXA 2OO5A 3ZCUA 3LO8A 4MR8A 3TW8A 2RHDA 2J48A 4CUCA 3WO0A 1RBQA 2YICA 4FZJA 1UDBA 2M1XA 3OAAD 3FPLA 4LGVA 3AMVA 2V5YA 1AMNA 1PGSA 3PX7A 2HV9A 3H17A 2PHTA 2AZTA 4COYA 1ZD3A 1ONSA 4QUEA 1J09A 3JYLA 5ESDA 1MR3F 5KUTA 3NJ4A 4DFDA 1F4LA 1U2RA 1JJFA 4KQXA 3WTCA 1ACJA 3P94A 4JLOA 1QE5A 1K12A 5DHQA 2Z3WA 3QH4A 3GNLA 1MVLA 4YCBA 2CLSA 2D5LA 4QKFA 3CF2A 1QQBA 3ROKA 2XI4A 1YQXA 1CUEA 1E63A 3ND5A 3DEIA 4CDWB 3RRJA 3AVOA 2F8LA 1T1GA 1O6CA 4BTEA 3BT7A 1V7CA 3U7HB 4YMLA 3T94A 4V0LA 4YO7A 4D6SA 4LBMA 3KDSE 3S0MA 1E2QA 4CR6A 2QPLA 3QWFA 5L3VA 4C2AA 1IS5A 3AVUA 5F5AA 1DS6A 1RJ8A 4E03A 2FR8C 2VKTA 4ZT2A 2Y1XA 1ST8A 1QAOA 1CUAA 1NMYA 5I7SA 4UTOA 2OK7A 2GAAA 1VBE1 1HURA 1LEHA 5B1SA 3BRCA 3KT0A 5J58A 5FV3A 4LN1A 2AOXA 1Z7WA 2YBEA 1O0SA 3UJ3X 2NYRA 3KL2A 2I1QA 4X92A 2O8EB 3WFJA 3TEWA 3O1SA 1G8PA 3FNHA 4GMKA 2RI0A 1BH6A 4IRUB 2H1CA 1QIDA 3EOBI 3C3XA 3V00A 3ZY6A 3BX1A 5BSTA 4BB9A 1D2CA 5A3MA 1JVBA 3TXYA 3WQSB 1NKGA 4JGYC 2V72A 4N5HX 3IIJA 1UKCA 4KQ2A 5H02A 4PANA 3G8AA 5HRCA 4FFHA 3FMIA 4TXHA 1Q57A 4HKOA 4Q9JA 4AP9A 5C7LO 3I83A 2HUNA 3K5IA 2O19A 3EEFA 4NDZA 1RACA 2Z09A 1VTKA 4UDOA 1S7GA 1GQSA 2O0KA 1TJ5A 2IS6A 3J7HA 2IQIA 4IVQA 1R8QA 4NJMB 4FFRA 5HKLA 4P5HA 4JENA 4LX0A 2BMDA 1BHQ1 2X4GA 4FDTA 5JJLA 3TQQA 4HDNA 3B6IA 3MIGA 1E5IA 1QJFA 1T9ZA 4B7AA 4JHLA 2C61A 3GJRA 2GN0A 1W25A 4FYMA 4XI9A 1KP9A 4KEAA 3ETPA 4UD6A 1NLSA 2F4PA 1IQPA 4CEHA 1HV0A 1BS9A 1E5XA 3SEEA 3BMQA 4WM7C 4HK8A 3SE0A 4R5HA 1FPQA 3Q40A 1EWRA 1ZUD1 1E59A 2WOOA 2P9TA 3K8YA 2B92A 3GRVA 3MUZ1 3JALA 4EDHA 3WLMA 4R2WA 3C15C 3TNLA 3DFUA 1PS9A 1RVF2 4II3A 3WFZA 2BL4A 5CVVA 1XC7A 5ALDA 2FCUA 2PVPA 1E3JA 5NULA 2QDKA 3WDTA 1WLWA 4ZZ8A 5AJZA 2VJXA 4BUCA 2ZKLA 3GLHE 3ENQA 3BWMA 2K2QB 2Q46A 3CEPB 1C8BA 3H6GA 1GA6A 1H8EA 3I8XA 4JASB 1IM2A 3CLSC 1QOPB 2RJ2A 4PQFA 4DUGD 3GDBA 3FUXA 1KS4A 4OI4A 5H3LA 1E2LA 4G2TA 4JCCA 4DN6A 4XIOA 4UWDA 3K35A 1VSBA 1YAHA 3CMCO 2ZAAA 3NKFA 4WDQA 4TXMA 2NNLD 4CNBA 8AT1A 3L6BA 4COZA 4HGOA 5GLUA 1GBGA 4B2LA 3E5HA 4LYFA 2XGSA 4BEVA 5THQA 3EA4A 4MVJP 3D6UA 1U0JA 2OCPA 1W73A 1VKNA 1EMDA 3ZW8A 3UPTA 1KBQA 4W5HA 4HKWA 4MR9A 3U78A 1WGPA 4I2NA 3Q87B 1GG5A 1TF5A 4F3RA 3GBWA 2QTBA 5IBQA 4KR9A 1G19A 4DCVA 1POV0 2H65A 3ETDA 1IAVA 1X7YA 5A7NA 1QJ4A 3W7BA 3POSA 5FYUA 1QHFA 1RXIA 2C5GA 4K6KA 1M0SA 3JX9A 5KMGB 1HDKA 3OCYA 2NUAB 3VDCA 5CGZA 1CESA 4DB4A 3ZIXA 3G7UA 3LZCA 3GA0A 1DADA 4Q9HA 3OTWA 4Q26A 4JJ8A 5F5CA 5IF9A 2GJSA 1NC3A 1YHYA 3VL9A 4WE3A 4BXOA 2AFIA 3AEKB 5HXMA 1VL6A 4ZCLA 2A3YA 5JPIA 1AGPA 1E32A 2XTJA 4R8LA 5D8AA 4F84A 4L57A 3FCYA 4RABA 4PPFA 2H2FA 4AQSA 4TV9F 1L5HB 2C3MA 3FPBA 3FHAA 3UXMA 5FZ7A 1DEKA 1JZ7A 3PYMA 3PUYA 2NT3A 1RTKA 1ENZA 1S8NA 3KLNA 2I6SA 3GB9A 5EPAA 3IQHX 4CQMB 4GXTA 1LPAB 2CDCA 4Z7OB 3OCUA 4BMXA 1NSYA 5IKPA 2E33A 5HKOA 1AX1A 1MN6A 2VW1A 2VS1A 2HEVF 1B3RA 2VN8A 5KNDA 2PNFA 3CV3A 4YB8A 3VFDA 3TDKA 4XFFA 3NT2A 4BMOB 3BFVA 3JZDA 4NOLA 2J45A 5H9QA 3HDHA 2WR9A 1S02A 1J3RA 4L74A 2JE8A 4H7PA 2XGOA 4C05A 3U3XA 2VAVA 4LQRA 3HWWA 1ND5A 1V11B 1FUUA 4TXJA 4PY2A 5B55A 3KJNA 1FTYA 5TIIA 2XJPA 5L3RA 5I0TA 1PFVA 4QYWA 3NU1A 4ZQFA 4J3FA 4O5AA 2CXXA 2GI4A 1YRAA 3SISA 1VLJA 1XLTC 3S5AA 1NMXA 4HVCA 3C7GA 1OFSA 2H4XA 2YDYA 3ZO0B 1CR7A 2ZIFA 1BMFD 3B82A 1KORA 5DCWA 4M00A 1A1VA 1G9BA 5JOYA 2JPDA 2C3OA 1E58A 1B7GO 4FOVA 3DBRA 5L53A 3RHSA 3HAGA 1HE8B 1QTNA 4D7AA 1AHPA 1XSQA 4IYJA 3LEMA 3EG9A 1RJWA 2GPBA 3EBOA 4LDPA 5H3HA 4NNPA 1GQRA 5JQGA 5F5XA 3RWNA 3AFNA 4A8JC 1RUC2 5T7BA 4PSUA 1HBJA 5FWXB 5ELLA 3HXOA 2P5SA 2UXBB 5JH7B 1J23A 4PAWA 1NX6A 1K66A 3K0BA 4E5NA 1T6GC 2A9FA 4WERA 4GVLA 3JQDA 1GAEO 3PGVA 1G9FA 1PGJA 4P2BA 1L9KA 4B7XA 2XZDA 1T8TA 1ST2A 4E8DA 4I6GA 3VHNA 2WTUA 1FLNA 4GOJA 4OVKA 4RSMA 4G6ZA 4GLLA 4YDHB 2PHDA 5FBKA 3VR6H 1YC2A 4X1OA 1I1EA 3A3OA 4EZHA 4C3ZA 4MSVA 5JCJA 1PVC2 2HSEA 3JQAD 2EBWA 4KYTA 5IWCA 3UUWA 1NLMA 1SZBA 4U0JA 1IEVA 2GCNA 2BFDA 5A6XA 2ZE5A 4R71A 4A6OA 4FWTA 3UT0A 3L7KA 2ATVA 1SCKA 2PMDA 4UCFA 3P9CA 3G2KA 1Q14A 3I45A 2WS91 2P4SA 5LQUA 3MIIA 4CYMA 3HKBB 1VM6A 3ORRA 1W04A 4UFIA 1XQVA 1P5RA 3ASVA 4D3ZA 3LXUX 4E5MA 5GZ1A 2UZAA 4W9RA 3WG9A 2VDWA 3ZFFA 4C6TB 4G23A 5DOVA 1DXHA 4U2BA 2C99A 4K46A 2GTHA 5FTWA 3OPXA 2V9CA 1FU4A 2EFGA 1YHFA 1M8FA 5CFQA 1R27A 2HEIA 1Q3TA 3Q9UA 4HBGA 2E5WA 1S1AA 4AIRA 2ZJ1A 1V37A 1Z26A 1O3TA 2ZAYA 1IZ9A 3LKBA 5FUNA 3PR1A 3E70C 2R25B 1EZ1A 4XFCA 1G21A 2EP7A 2CFOA 4LBLA 1P4AA 3L8EA 2PQQA 3E5MA 1Z0JA 1DSSG 3AJYA 1NRIA 3QBDA 4OPMA 5EJ8A 3T9FA 4RHYA 3HCBA 2WSVA 3BMOB 4MW5A 2ODTX 1P7WA 2ILVA 1H2EA 3K0HA 3LPLA 2WF6A 1C0PA 4KCGA 4I50B 1P81A 4E22A 2C29D 3UKDA 3KZ4C 1UT5A 4KRGA 3EVTA 4RQPC 2PMKA 2AC7A 1L8OA 1QMGA 1JSRA 3U0VA 4QVKA 2OZJA 2VPQA 1TA9A 3OEAA 3T0DA 1CNEA 5LPNA 3WL3A 2LIVA 3QUCA 5ALKA 3SIWA 2WIDA 3OFKA 4WN9A 2WB4A 5L8VA 1Z12A 4LF6B 2B1JA 1FUIA 3F90A 1IN6A 5CYFA 1A96A 1FBNA 1OHHA 5IZCC 2IH2A 1QKKA 1DYKA 2YC4C 3SXUB 5FY0A 3OH8A 4XFKA 3DTVB 2HQBA 3FKJA 4DJ5X 5EP2A 3WNZA 3DAGA 1IXYA 2QW1A 1J00A 4JJFA 3I9MA 2B0CA 3FDZB 3UK0A 4MX3A 1RXGA 1HI9A 1JEAA 1PJ4A 4ZYWA 1Y4WA 4AJ2A 1I0LA 1E2FA 3R40A 5IYZF 3HU3A 2H1FA 4KZPA 5H68A 2ZS8A 1DC7A 3TVDA 2EBHX 3ZHTA 5E4FA 5DN2A 1Q1BA 1T9HA 4UDXX 3M6LA 5KYGA 2HN9A 1NZFA 1YI1A 4KDCA 4ZICA 4ZEVA 1TIKA 1FS6A 4XDQA 3LDRA 4IFBA 2YHJA 2CJWB 2FRVA 2XNCA 2XRYA 3G2JA 4Z4EA 1ODFA 1DJOA 1GGVA 5C4WB 3MUNA 3MJCA 4RZUA 1X82A 2CTVA 4JGZA 4OATA 2P6MA 2AB0A 4HGPA 3VPSA 2W6ZA 5EE3A 4ZOLB 3EXEB 3SHRA 4TS1A 1C7ZA 2H4HA 5SV5A 4BWFB 3SXWA 3KKOA 1B1AA 3OZCA 2YUEA 3C1OA 2XNDD 1ZONA 1OI2A 2PQ2A 4RTLA 4QNNA 1SNYA 2GCIA 3RM3A 2I67A 2X41A 5H9WA 3NV7A 2YZGA 5FREA 4UFHA 1N6PA 4HUQB 3W5JA 3OMWA 3TTWA 2RDRA 4B7EA 4L7VA 3TUZC 1PFWA 4XEUA 1BFDA 4P38A 1PJQA 3HZRA 3RRFA 4JLPA 2CMKA 2O8BA 1WUHS 3H84A 4BBAA 3KOZA 4NS1A 3MELA 3GLFB 4TGLA 5CM8B 4Y98A 2XIJA 4QXHA 1U1DA 2QRGA 2ZETA 2FLVA 5FV7A 3UC5A 2NQTA 4YG3A 3NLLA 4QO8A 1UF9A 3EC1A 4KBBA 2G40A 3WLAA 1G6OA 4LBJA 5C2JB 1ZZCA 1XMPA 3H1GA 4YREA 4IJVA 3K2BA 2DHCA 3HBZA 1QJY1 1P45A 1CQXA 2RGUA 2OXBA 5KHJA 2NU6A 4P86A 1ZGZA 2FX3A 4BK5A 4JI7B 1TPZA 2GEDA 2HOQA 2WWVD 4YYEA 4YIKA 1Z4MA 2AZ5A 1K4YA 4UE3S 3LC7O 5LEKA 1W05A 1CUSA 2D4HA 3REQB 1W6PB 3G0HA 4YR7A 4AYTA 1DJPA 2E6VA 3NRJA 1X7XA 2BKUA 3VBFB 2CWSA 2W1UA 3DXXA 1OXBB 1KQOA 1A4IA 1ZDMA 3OUTA 3U44B 1T36A 3ISVA 1L8XA 3VBSA 1CEEA 5IAVA 2ZYSA 5LWQA 3V4ZA 5IYZA 2QL6A 1Z07A 5FK7A 3D1VA 4YALA 4EK9A 1OB5A 5CAZA 1X1DA 5IVFA 1EX6A 2AR7A 2PR2A 2JXAA 4YRBA 3O0DA 1QJU2 3DVAA 2VCAA 5A2GA 2I55A 3HOBA 2I4NA 1I80A 2MYPA 1IHMA 3OGJA 1S8FA 1T4CA 1PR4A 3R20A 1K5GA 3ZGNA 1GNZA 1QTRA 2NYVA 3RIXA 4D3YA 4AZ3B 3GFPA 2C7QA 3MC1A 1E3SA 1D0GA 3IS3A 3WQ7A 5FF9A 5CVCA 2QKYA 2VW2A 3L04A 2ZAIA 3O95A 5KYXA 4F3JA 1MZPA 1LDMA 3I6QA 2VMEA 3FCEA 1XMJA 3QVGA 3UJCA 5LQCA 5BR7A 1MHPA 2FPUA 1RAHA 4UNSA 2Y92A 4BFSA 3HJHA 5CLGA 4HZGA 1UOBA 1N6HA 1IOAA 2GTPA 1SMKA 2Y66A 1PIV3 3L0CA 4KGXA 4M1TA 1WY7A 2PMCA 1DQNA 3DEJA 2AOTB 2FD8A 4JC1A 1NJSA 2JFPA 2G76A 3ZK7A 4D57A 2DVGA 1R6VA 1U1CA 4OXKA 2VDNB 1RQNA 5DXFA 1Z0HA 1JHOA 1NJ5A 5CW1A 4X3OA 3RSQA 3K0FA 1C9MA 1UR5A 4BZWA 1VYTA 4PTYA 5JY1A 1DAEA 3L0BA 3WV6A 4F9TA 1RWQA 1UQTA 2R8EA 4TMXA 2DT5A 5EZYB 3GNTA 4KQWA 4J03A 3OOHA 1XXHA 2OILA 3A1DA 3GOHA 5H70A 3RZHA 1X3SA 4ZQIA 3KSDO 1XZCA 1QGUA 1OT3A 1KWKA 1PGOA 1X33A 3PPIA 4PYKA 4CCWA 4ZVUA 4IJ5A 3QEBZ 1CY0A 4OHCA 4EHHA 4RLSA 1TQ2A 2Q8NA 3OFSA 3MD9A 3GZJA 1YXMA 4FGSA 3ZY3A 2RHRA 4LHWA 2QZ3A 1R9MA 1SZJG 1F8GA 2ARAA 4RH0A 1TCVA 1I1HA 2Q0QA 4QOEA 2IXDA 3CJIC 1WMFA 3AKZA 3EFHA 3UHOA 2JLRA 3E3MA 2R60A 3VV3A 2PRZA 3A8TA 3WD5A 4DBVO 3FFTA 3HNOA 2ZS6B 3HH8A 2PA3A 3KQUA 3FTEA 2JJMA 4NBLA 3K15A 1LY1A 2QTVA 3MD0A 1PK8A 2II6A 4F72A 4YBZA 1J2JA 4B81A 3GJXC 3MW8A 3G0IA 4JV4A 3TBHA 3LPDA 3DTTA 4F06A 4RTOA 4NIMA 3OQVA 3G79A 1KZ1A 3ILRA 2Z9DA 1UMDB 3QM1A 3A9VA 1MEJA 3ZKUA 4KQEA 2C9BA 4IEQA 4Z53A 2OXCA 2FMYA 1TQ5A 4AFMA 5BNWA 4CPBA 3OOWA 1K1EA 1CRPA 2PL1A 3KT1A 1GIAA 5FZHA 4X8HA 5JS1A 4N9HA 4LKFA 1E7SA 1EAH2 1XTPA 1XTVA 2G0AA 2NZ8A 4O4LF 3ZC3A 3ZU2A 1I2MA 5D1HA 2ZG6A 4YQYA 3IT8A 4PICA 1NBWB 4J49A 2XWBF 2RS12 1B2LA 3DEAA 1YI9A 5HVNA 4ACAA 4SLIA 2J46A 1KRXA 2CGNA 1N3QA 1XRUA 3KT4A 1BA3A 5COBA 1KS2A 4HAWA 4XX0A 3KQPA 4UDNA 1NVGA 4WI1A 4P22A 1ZSNA 1BEV2 1O7FA 2E63A 4RVFA 2IEBA 3ZDYB 3KYDB 3KGLA 4WBBA 3M4ZA 2IXLA 1FP6A 1RFLA 4JKYA 3VXKA 2C31A 2ZBDA 2QQKA 3KCCA 4H7KA 1NDQA 3D3KA 4MVJD 1KQPA 5BWNA 3QJ5A 3EIHA 3L8MA 4CV3A 1E2DA 3A70A 1V8OA 3HKDB 4AF7A 3KSRA 4FDAA 5D21A 4D0QA 1KEEB 3TEYA 3NJ8A 1JIVA 4ZQEA 4UCQA 1DTWB 3E82A 1I6XA 1W9FA 5BVGA 2HLHA 4W9NA 3JTMA 3IEUA 2C9AA 4OL9A 4QPWA 1R5JA 3V64A 5AOAA 4M0EA 3W34A 3PDQA 2JIMA 2NZWA 3C3PA 4O29A 4PG6A 2N7GA 3OIFA 4CMIA 1UU4A 4EHBA 2DWOA 4ICIA 3POEA 4KMOA 1G2PA 5D2CA 1I10A 1LCIA 1GL3A 1HE5A 2P3YA 1OXMA 1ZD9A 4OMCA 1Z4IA 2JCGA 2Q4DA 1P1IA 4B9EA 2NZUG 3QUAA 1XZBA 1SN7A 2WFZA 3R0JA 5HIJA 3RASA 4I3GA 3H05A 4FT2A 2GMWA 2UYYA 1WW7A 3R9XB 2A3RA 1IUKA 4DDVA 3HB7A 1WUIS 3DW3X 3MWYW 2A73B 2Q6VA 1E9FA 5IBCA 1PV1A 4JIMA 3IJ5A 3HCRA 1CAVB 3D5QA 3T1MA 2QUKA 3RT7A 2EGHA 2XMGA 1VE1A 5J48A 3POGA 3G5LA 3LFMA 4N4AA 3T7JA 2BHSA 3MHPA 1EZZA 3WINE 4OQEA 3I1IA 2V7VA 1UBMS 3L92A 3WNPA 3HE3A 5JWPA 2ZPAA 2QQJA 4OXRA 4HEHA 1JJAA 4KN5A 4V3CA 3IL2A 3LY9A 1IMJA 2ZGRA 1FMCA 4EAQA 4DLSA 3AUFA 1QK5A 3G5AA 3GP5A 3LUPA 4QGLA 3L8DA 4R2JA 4JJEA 3SHWA 5CKMA 1PMHX 2XDYA 1RUG2 3ESZA 3A1FA 4XDOA 4C1XA 2XR1A 1H9PA 2VCCA 3HU5A 1OA2A 4UPVA 4BYGA 2GNAA 3U14A 4V2WA 4W1QA 3HUFA 3ZLJA 5K8IA 4QX1A 1W44A 1X7WA 2MJLA 3UV7A 2GC1A 4MH0R 1XKLA 2Q0AA 4BIOA 3HZOA 3B6JA 1TZOA 1BNCA 2C4UA 3SWWA 1FQKA 2XBUA 4E5SA 3I2JA 2HLNA 1U5ZA 1ACCA 3ENVA 3NHSA 4MUXA 4OP2A 5LJIA 3H2ZA 3IUSA 2WJPA 5FOJB 1SD2A 4J7XA 3SS7X 3EAFA 2BBOA 3GCGA 4QHZA 4IDEA 1W49A 3KSBC 5KJ1A 2FWBA 3L49A 1YQTA 1YFUA 2PG3A 1WY5A 4XUCA 3O9ZA 2ZRNA 2PZAA 2Q4SA 1YVUA 3D8TA 5EJ9A 3ZV3A 1Q50A 4OA8A 5LD2C 2XQFA 3OM8A 2Z6AA 1OBHA 4NRDA 5CVTA 4U6QA 4YJ2F 1TK3A 3G59A 3G7SA 4RQAA 4JB3A 3UK7A 1RGSA 1IZ0A 1LDYA 1QJCA 5EJ6A 4M0LA 5TS3A 5KOHA 1J84A 4JOQA 1A4RA 3INAA 4I1RA 1PO21 1A9SA 3B9PA 3ZDEA 1RHI3 5GJ6A 1DQZA 4D9JA 4X45A 1C8LA 1WQ3A 1GCIA 1NVDA 4X7RA 4CIYA 3Q7RA 4XYMA 3U17A 2V7QA 2HBQA 2A6XA 3J81k 5DW3A 1L1EA 1P5FA 3BTXA 4U7GA 4DCTA 3BGAA 4C0HA 1Z2PX 2OA0A 3N2GB 3THOA 1Y98A 2NZVG 1LTHR 4UOZA 3E7DA 4QECA 4EHIA 4Y6RA 1ZK0A 3R5SA 1PV4A 4Q7KA 3HB9A 1AYN1 3C3JA 4BLIA 2O20A 4I4LA 2VNSA 4AVSA 2NUTA 2YZ2A 4ALLA 1M34B 1G5RA 5DHRA 5JJIA 5HJ5A 4RHTA 1JHDA 1BMV2 4BVKA 2IIPA 4AKGA 3MF4A 4OQNA 2A3WA 3KEMA 2YY1A 3OLYA 3GMIA 4MKRA 5KYTA 5K0UA 3OT5A 5FTTC 4YVWC 2XJQA 3T9EA 3VU3A 4AF9A 3WNCA 3HWJA 4QKNA 1U5IA 2ZTLA 3DF7A 3V7NA 4EB3A 4JGIA 1UXZA 1TUIA 2WDBA 4XUDA 1EVIA 3ZI7A 1LC3A 3VDXA 3MHZA 3R3ZA 1F60A 2DLDA 4FMBB 3WB0A 1L4KA 4HLQB 3P71T 1LOFC 3IP7A 1SQ0A 2ZOSA 3P96A 2GR9A 2XVGA 2ENWA 4XCQA 5AK6A 2FOIA 4P34A 3DB1A 3ZVNA 3IPLA 1LSJA 5CVRA 3P45A 3MLLA 3BGDA 4JOBA 4QOHA 4AEMA 3QBQA 2B20A 1DGRN 1CNFA 1ZI9A 4TWIA 4KPEC 1A5BB 4YJ2A 4M22A 1H22A 4NVPA 4JOCA 2YIDA 1PFGA 3EXIA 3GNQA 1JH5A 3D31A 3HUDA 4MKGA 4KB5A 3FTPA 3GJ6A 4J6GA 2H7CA 2GD2A 4YR9A 3WWDA 1JJVA 1WXDA 4GOLD 1L4LA 1UW8A 2YWHA 3NW9A 3D3JA 2IUFA 2Z2ZA 5BRAA 1ZM2A 3F46A 2ID7A 4FEGA 1UK6A 2LW7A 2FH5B 4YW2A 5A9SA 5L7OC 2ZATA 4B3TB 4DLNA 3C3AA 3TOJA 3P9IA 2DR2A 1P73A 5E6SB 2B1RA 1PR3A 5LY1A 1A9ZA 4DL9A 1Q12A 4EPXA 1HWYA 1MC8A 4MGYR 4FM9A 2JEZA 4DEXA 5E4TA 4L6AA 5CB7A 4QDZA 1W52X 1P9WA 4LJAA 4WKCA 3BXZA 1CD5A 4F8EA 3BTAA 1RUF3 3RROA 1HF3A 2J9XB 1QORA 4DQXA 1EM8B 1AYM3 3EHEA 2QL7A 2Z9BA 2C7OA 3LX6A 4GH4C 1Y43B 2VNJA 5D5QA 4HQ6A 4PHZA 1US3A 3HKCA 4AUMA 1SACA 2YFUA 4KXVA 1DCTA 4IV1C 2PHWA 1KI8A 2IYEA 2GN9A 1UKYA 3W5AA 4YVSA 3LQ1A 4NBWA 1SVLA 1KEPA 1L6RA 1BS2A 3S8EA 5LLSA 1Y9ZA 3NEJA 2ZQZA 2VH5R 4KVAA 2HI0A 3OZVA 1HDGO 3VBOA 3AVPA 4EUSA 5DI3A 1ZMXA 4EW1A 2ZJ4A 2Y60A 2YASA 2J1SA 4I9GA 2NVUA 1SLCA 2XADA 1BMDA 1FCJA 2P78A 4AVBA 1TNDA 1BSVA 3B9RA 2ZTNA 3GLRA 3VR4A 2ZSFA 1NXD1 2W90A 5DGHA 1G1AA 1KEUA 4UHKA 1UKRA 1HEIA 2W58A 1O4WA 5ECGC 1NN5A 3VGJA 1EE1A 2ZE6A 5BNPC 3OKCA 2OBNA 1IULA 1M3SA 3QPAA 2VA9A 4GAEA 5AI8A 1G7TA 1A98A 1JALA 2KJQA 3SLRA 4ITRC 1J8FA 3HP4A 5IS2A 2OPWA 1AHHA 2XMRA 2QZJA 5C8CB 3JD73 2O05A 4IXLA 1UPAA 5E1BA 2ZSJA 4MDYA 5I01A 1P4RA 3WDLA 1A76A 2P0AA 2YWGA 4HYTA 1KP3A 2BKAA 3OTGA 2ZBEA 5KPDA 4V2UA 1XNAA 4TS3A 3Q12A 1ADBA 3KJGA 1C1DA 5K51A 1G5IA 3C3DA 3AMMA 1J1ZA 1R66A 2Q28A 5JDBA 4MGTA 1SFYA 4DTIA 5LK7B 4R5MA 2VSOA 3LQCA 3ITEA 4BNDA 1OIVA 3IPXA 1GKYA 3FCXA 2CHQA 1F4PA 3LBNA 4BWGA 2ONZA 4BLJA 3CWZA 4FMDB 2HEGA 1ZGBA 5DISB 1BVHA 4DNQA 1GKBA 3NOOA 4WVFA 3W20A 5EHQA 1S3GA 4TV8F 2Q3HA 4MXWB 2ZI9A 1S4MA 2RAFA 5F1KA 3RK4A 4NMXB 5DUVA 3B89A 5LJLA 3AUYA 4YJ3B 1JW6A 1O6GA 4HWOA 4OBEA 5H7XA 2H4JA 1A8UA 1V8PA 2IU3A 4X1IA 2P9ZA 1VI2A 3FUUA 5E3IA 3OICA 4MP8A 2HTFA 1I4TD 2OENG 3IB3A 1HDZA 4EDFA 2ONKA 4B4PA 1QOQB 5ESRA 2P2SA 2C5BA 2XD4A 3W5VA 5ICGA 3L6CA 1EFLA 6LDHA 2BP7B 1ZVJA 4X6UA 1I6LA 3TD2A 4FGKA 5FBJA 1Y9AA 3KSAC 2BGTA 3HVHA 3KE9A 3CNNA 5AW1A 1CJPA 5F5LA 2BC9A 4HNRA 4YM3A 1TPYA 2VJCA 3ASUA 2BFMA 1EP2B 3DDUA 5EP9A 3B6EA 3UAGA 2CVPA 3TPFA 1BBT2 1KI9A 3ECSA 1TZ2A 3ZXUB 2F6RA 3PGMA 4TYWA 1M1XB 3WK6A 1EHCA 3ZQUA 2Q21A 3AM3A 4Z8XA 3U1XA 1QGOA 5EQUA 1M2HA 2GZMA 3ZU4A 2O54A 1RD4A 1UMBB 5K3EA 2PRKA 4LYDA 1NHGA 4LDAA 1T2DA 5AHRA 3HI6A 2D6OX 1A7JA 3FJ1A 3CO2A 4XF0A 4NY1A 3B3FA 1TLTA 4LDRA 4ZWNA 3UMYA 4L5YA 1L8QA 1YGYA 3T34A 3CONA 4AURA 4TWRA 5HFNA 5DNEA 1CY8A 3CNEA 4ALKA 4A3XA 3FAZA 2GD6A 4IGIA 1VPWA 2DH5A 3AVXA 7AT1A 2NZ2A 1P44A 3EISA 4GWNA 4OXIA 4YO8A 4JBLA 2ZUDA 1ORVA 2C4NA 4K9PA 2BP6A 1ACMA 5AVOA 2HMSA 4WHMA 1F8FA 2ZJCA 4DCSA 3N87A 1XN4A 1UBJS 3CH5A 1JLMA 3K96A 1RJ7A 1U7XA 4BO1A 4QBGB 1JAIA 1ZA4A 1ZI8A 3W9BA 2BFWA 4W1PA 1QFMA 3BKZA 2Q3FA 1H4TA 4I9NA 5GOTA 3V0AA 4AI2A 5LSAA 3Q2IA 3P3PA 3ROMA 3OPQA 5F2OA 2GM5A 1WABA 5JJCA 3EGOA 3QVVA 4TV8A 2PYIA 2OGWA 3LUCA 5LMNB 3CN9A 1F48A 4YRLA 4GRDA 4W6ZA 2YB7A 3C8UA 3O5AA 1P3DA 5LA9A 2IZZA 2PH1A 5DYIA 2JBWA 2W22A 1QF3A 5K6TA 4P00B 4CR8A 2GHQA 1NJ1A 1NZCA 4FSXA 2MT9A 2VF2A 1CY2A 1SC1A 2OMEA 1UYZA 4UTRA 4IHKA 3TGPA 2MYUA 1QYDA 1FRQA 1T9DA 1MS8A 3SC4A 3QLVC 1GQQA 5HUJA 4QQFA 3S2EA 1DIBA 4A42A 5ALWA 3T54A 2XF8A 1YZTA 2QGNA 1XYGA 4PQQA 5A06A 3TLEA 3GUUA 4C5AA 3GGLA 4AKEA 3JQEA 3FWPA 3QD6A 2CFRA 3VKUA 4PO1A 1FTWA 1RR6A 5I6DA 4PV7A 2RBGA 4MZXA 4QXBA 4ID3A 4P8RA 1QK3A 3IIEA 4G07A 4JL5A 1JDNA 3WLPA 4FK8A 4O9EA 1Q44A 1AGYA 1X9TA 3LIHA 1X87A 2I6GA 3ELYA 3RYFB 4KMSA 1O5LA 3I09A 2XBO3 5E95A 3ISTA 3KTFA 1I5OA 1G16A 2OX0A 4IV5A 2ZROA 2A9KA 2J59A 3SXPA 4MGIE 2PUJA 1UKAA 5ITVA 3IKVA 3O0WA 3DPSA 2WWHA 2C54A 4BLWA 3JQBA 2FCAA 1G1MA 4ZO8A 1JHYA 2H7YA 4PYMA 1DZIA 1YZFA 2F64A 5FYQA 1MQTB 4Y30A 3IP8A 1OZ0A 4XLTA 4A73A 2WE7A 2W2QA 2OD2A 2JJ1A 3OD0A 1NA5A 2JBHA 1Q0QA 5JD6A 2VM9A 1UC9A 3AKPA 4A36A 1JYNA 1RMU3 2QXTA 3N2LA 2HIHA 1SC9A 4TX1A 4C30A 1F6BA 2ORWA 3V8MA 5KJ6A 1BDBA 4BP1A 3CNHA 2W39A 1RINA 1RZVA 1SAYA 4GC9A 1FJHA 1LX6A 3K9CA 4LKRA 5IT0A 3NVCA 3L6OO 4O1IA 1NDHA 3ZYCA 1UM9A 3NAPA 3D2AA 4Q48A 3LUHA 1LDGA 2QYOA 2JLZA 4A41A 2VJNA 3RJ9A 1YRWA 1DKPA 2CHVA 1BYUA 2C3PA 1K75A 3D4LA 4KVFA 2A30A 5ANQA 3VBHA 2I4TA 4BEBA 4UM9B 4AP6A 3RSSA 3I2DA 3F6EX 1FMD2 5FDBA 3I37X 3OJFA 3PK0A 5K6AC 4LBZA 1D0VA 2W6MA 4BDSA 2JBAA 1KIAA 1Y48E 4WFQA 3SEFA 1KEWA 3NT4A 3QF7A 4WOBA 3EHKA 3VBCA 4W5QA 4WBXC 4FR2A 1XTJA 3I9V1 2DWQA 1HYGA 1QV9A 5K4HA 4TYQA 2ZPTX 3HNBM 2GD0A 4N39A 4YAIA 4DSUA 1HY3A 2CN1A 1FVOA 1XZ8A 1XDDA 4RLFA 4XC9A 5JZ9A 3G17A 5HI0A 2I3ZA 2ZBPA 3W4KA 1FDTA 4ZONA 3GV0A 4AT1A 2E1PA 1ZJZA 2V7TA 3SC3A 3OP1A 5CIYA 4AEDB 1ESDA 2JGJA 2HAEA 2GZDA 4WA7A 1TM2A 3H7AA 1XA0A 3RYTC 4X6XA 3KEQA 4FFVA 3N5CA 4JU8A 1JSZA 4NH0A 2NMOA 4BFVA 2Y1EA 1DBQA 1N0UA 3LQRA 2Z1NA 3M70A 2GSDA 3QVKA 3SNHA 4LPLA 1NNLA 1U04A 5CA1B 3CVWA 3QVLA 5JCPA 1L3BA 1QVZA 2HA0A 3DYOA 2C2OA 3JXEA 4J43A 4RY8A 4Y9UA 3S1AB 1XZPA 4EKGA 2XMDA 4OK5A 5HIIA 3C5VA 4DHWA 4YMVA 1ZR2A 1Z7S1 1R093 1KSFX 1J07A 4AC9A 3CBGA 1QBGA 2JKXA 2ADDA 5F98A 2JIJA 5U4XA 3GR6A 5KEIA 4QHYA 4CF7A 2HA2A 2QAGB 4P0TA 1QRUA 3DLAA 3O9MA 4RC9A 2HK7A 2J7PD 3ETGA 4FFPA 4Y1YA 4FPFA 4TWZA 1COWA 3HA3A 1ZH6A 3WLFA 3U11A 2IZ6A 3NB0A 5AUOB 4M36A 3ME5A 3AR5A 1YVEI 3L84A 3KSMA 3KWJA 1GNVA 1XDUA 2ZACA 3KZ1E 4HLDA 4ZRDA 2ZUTA 1EBFA 1XNCA 4IIYA 4YH1A 1Z8NA 1EDDA 1HXHA 4RSGA 1WXGA 3RVRA 3JWGA 5JSOA 1IYZA 2XSZA 2O4CA 2VT2A 2OFPA 2PGIA 3U37A 3VKWA 1CNMA 2C2XA 2AKAB 4M8LA 4LPSA 4WNCA 2AMLA 4GH5A 1G4HA 1M1UA 2JG3A 4F1JA 4S0XA 1TJNA 3TF5A 1SC6A 1E7RA 1PHRA 3JU9A 3GA7A 2ZJ2A 4PX5A 1RMYA 3M34A 1VYHA 1SG6A 1N1VA 3A36A 2RDQA 1GARA 4DO0A 3T1YB 3MWDA 1MABA 1FE8A 2FCRA 2GPWA 3KYIB 4DT1B 4KU7A 3WMFA 5EMMA 1PVVA 3R3SA 4LBOA 2BM9A 4CP9A 4GX2A 5KAMA 3NEYA 4TLFA 3JVIA 4PRZA 3ZIAD 1EFVA 1VHTA 4FS3A 2B7BA 1KIMA 2EZTA 2JRCA 3SQWA 1FRNA 2Z04A 2BRTA 1RRVA 2HHAA 1B0ZA 3ZDQA 3UG7A 3KOOA 1NCRA 2A9OA 4HGQA 1IUNA 3CGGA 3FHOA 1MIOB 4JLVA 4OGGA 5IASA 5JSHA 4RE6A 2VQDA 1IBCA 2V5AA 2B8NA 4W5NA 1SXGA 1NQJA 4CF5A 2P2CA 2D5FA 3EF0A 4L4XA 3NBUA 4RJ2A 1EQUA 2VZRA 2WNOA 2ISCA 1QTIA 3N7UA 4GXNA 2J3IA 4RL7A 2W6CX 5EJAA 2ET7A 2VYND 2BHNA 3A05A 1R50A 5FOBB 4CF4A 5BW8A 5E7IA 2V55B 4Y2PA 4UOEA 4DPNA 3CC8A 3IEMA 4KFRA 1B3BA 4DXTA 1TMKA 1ZVKA 3KXKA 1NWHA 1CUGA 5JSZA 1Q1ZA 2VRWA 4HVAA 2VQFB 4PXSA 4GWJA 1QRDA 2BZGA 5EE0A 3SYKA 3RUIA 3EXHB 2A84A 2WT8A 2RKBA 3O7WA 4F96A 3DMDA 5DM4A 3AI3A 3BOPA 1OOPA 2W5UA 4MG2A 1UXGA 3U4CA 3I34X 4QAQA 4EMTA 4XVCA 3ZOKA 3ELDA 1GP5A 4KE7A 2IS4A 3QWIA 4JUFA 3RWOA 5I9NA 2R2GA 5K09A 1GUAA 4XB6B 3FCCA 3LEIA 3TLYA 1K8RA 1JU4A 4XQ9A 1UKGA 4GZLA 1F0NA 3UMBA 4OGLA 4NEQA 1R9JA 3GUYA 4E08A 2Q41A 3QE9Y 3D8NA 4TM8A 4XFGA 1ZBDA 5JXHA 5AK0A 3WSTA 3AZYA 1EFHA 3PI7A 3RPQA 4YWJA 5CFPA 1ZD8A 3K20A 3D3NA 3DL2A 3BEOA 3RBVA 2RGGA 1DRKA 5IK2A 2PXJA 9ABPA 2PJZA 4TRRA 1TT7A 3SR0A 4SBVA 1FUKA 3VR0A 3I8TA 4JX8A 3V0BB 1GQ2A 1T5BA 1L5VA 5LMZA 1LBHA 1GNSA 3VB9A 3MYRA 3K6SB 3OQIA 4KXQA 4QTUB 4IIUA 1D1TA 4R01A 5JT1A 4JJ7A 3CKKA 1HOXA 3HABA 4LWOA 3FROA 4MYHA 3M3QA 5KKCA 4HSJA 4AVVA 4H7LA 3L93A 1D0SA 3GVHA 5A1TA 1W85A 3TMAA 1WPGA 4M76B 5MGBA 3GP3A 3S81A 4OQZA 2AYXA 1V5GA 3AR4A 1HRDA 4KNCA 1Q1AA 2FNAA 3V8EA 3GRKA 2K46A 2ZHNA 2WT2A 4RS5A 4YDQA 5BURA 2PD4A 3P1IA 2RGCA 2JLVA 4DXHA 1KQRA 2DE0X 2ODWA 4HDKA 4LHVA 4R9UC 3AYAA 3SYRA 4I81A 4N65A 4XUGB 2ADMA 1X2EA 3W4JA 1J56A 1FPMA 5EHNA 3RYPA 4B9AA 4S3MA 3WYBA 3ZIDA 4ZU5A 2Q4BA 1ZCAA 1X1TA 4O2RA 1M2JA 3QVOA 1W8DA 1MVEA 1O4TA 1KE2A 2I4OA 3G5MA 1XZMA 3S27A 5JXWA 1UKVY 3L8FA 5B6IA 2NPIA 3KD4A 3UH1A 1DQ1A 2Y9MB 4L7QA 3I4FA 5F52A 4MA0A 3MVEA 2B2CA 3AW9A 1Q8OA 1STOA 3B3QE 1DKMA 5K0CA 1Y89A 4OMDA 4PFSA 3L18A 2IK8A 1YMVA 3U4MA 1E0KA 1KDMA 4TZTA 1JHMA 3OOYA 4MXVA 2Q5LA 1NKSA 1JYWA 3MOGA 3DWGA 3O0TA 3WIEA 3QW4B 3DMTA 4Q7MB 2CLFB 2RH9B 5FB3A 5JECA 1KZGB 1AZSC 2G8LA 1VLNA 3ACIA 4QVIA 3E5XA 1KFCB 3BM5A 4MA4A 1TME3 1GYPA 2FG7C 2R4QA 3LHFA 4IDQA 2AFRA 2O8DB 3CNAA 1IVSA 4EKYA 3RRXA 1X7ZB 3SQDA 5ANNA 5AC92 4EGAA 3AB0A 4OB8A 2L17A 4TV9A 4NNJA 2G06A 3DBLB 1XRPA 5I8YA 2DUWA 1Y7BA 4WGFA 1W8WA 4FGUA 2ZYAA 4HDOB 2WAYA 1GICA 2VECA 4C29A 5FZGA 4PZAA 8MHTA 4NQZA 1COV3 3LDBA 5I93A 1TMF3 1QAMA 4YWHA 1K8XB 4PLVA 4OCZA 4NXMB 1BE0A 4Q1RA 1HETA 2OGZA 3F6PA 4P9YA 3E7WA 2R48A 3MB8A 2FP4B 4EX6A 3YASA 4KYUA 4X54A 3ZR4B 1BRMA 1Y9GA 3LVBA 4QM6A 1KRWA 4ERNA 3I9KA 1POV3 5KXCA 3GQVA 2OUHA 4QRHA 3ORSA 2NO1A 2GLTA 1U1GA 1KU0A 3JATB 2XZTA 3KNZA 3KWMA 2NTNA 4J1QA 5T6MA 2DBZA 2RE8A 1WXHA 5TSDA 4WVWA 2QJVA 2Z6VA 3EGCA 1Z37A 3RFVA 4BEJA 4ZI7F 1TE2A 4DY3A 4JC0A 4FKBA 1NJGA 4Q1DA 3RRNA 3VI3B 4EA9A 3EGEA 3W05A 4Z9FA 3GRYA 3DXUA 1TYDE 1CAWB 4X7PA 4GGPA 3BWVA 3B2EA 4MV2A 3SKJE 4MWOA 5CPFA 1YGPA 1GANA 4WUVA 3F7TA 3AYDA 5U9CA 4J1TC 4D3FA 4V38A 3S1SA 5B1EA 5JCZA 3AWDA 3PENA 4M7WA 1RWPA 1P1CA 2E3JA 1Z39A 3PEYA 5A7QA 1YZGA 2CWWA 4WCFB 2JENA 2PSSA 2UVPA 2GT1A 3PXEA 5DPMA 4EM6A 3DKRA 4M3CB 5JPDA 1MDFA 1XK6A 2G5GX 4HDSB 1EEXB 2FMDA 2WAAA 1QGLA 1JBKA 1JXMA 2OUIA 1R1A3 2ZP1A 1DKUA 3IUNA 3E0QA 3CZMA 4W8OA 5DAVA 3DZIA 1U2DC 2Z8YA 3VZSA 5EP4A 1YC5A 4ZKEA 3DH0A 4G1VA 1OTHA 2JKVA 2ECPA 1RI3A 3AFMA 5EA2A 3PHLA 1IK6A 5LVAA 1TVCA 4WFKA 5AHWA 1VG9B 2PX4A 4WY8A 1G20A 2AL7A 1AJEA 4ROSA 4R7GA 3CTMA 3FLMA 2JLWA 1N9GA 3CHYA 4H31A 3LC1O 3F3SA 2NZ9A 3G9ZA 3KYJB 3R4UA 1ZPDA 4WWHA 3MPUA 2TMGA 5HF5A 4Q4V2 5FEMA 3N05A 2UYOA 4XFAA 2IHNA 2ORVA 3N0RA 4CODB 4MITA 2FPRA 1OLXA 4MLCA 1AB5A 4BMPB 4H0FA 4CM1A 4FINA 2QQEA 1M06G 2R6JA 1H2YA 1NULA 3C8XA 4KWIA 3LLCA 4ND2A 3KJFA 4OAQA 2BR3A 4LF7B 3P4XA 1W30A 3GJ8A 2QN6A 5JVDB 1H9BA 1Y1SA 2JGDB 4FTEA 4EMSA 3PFWO 1I3HA 1GA4A 4JT2A 3KOXA 4RZIA 1JN0A 3PXGA 2IP1A 4C1WA 4JT8A 2UVDA 5E0KB 2JE9A 3UA3A 4ZI7A 3TRHA 3MBOA 1POWA 3TRFA 4BXFA 4NYIR 1I9GA