5FBZA

Structure of subtilase subhal from bacillus halmapalus - complex with chymotrypsin inhibitor ci2a
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
432
structure length
432
Chain Sequence
DVARGIVKADVAQNNFGLYGQGQIVAVADTGLDTGRNDSSMHEAFRGKITALYALGRTNNANDPNGHGTHVAGSVLGNATNKGMAPQANLVFQSIMDSGGGLGGLPANLQTLFSQAYSAGARIHTNSWGAPVNGAYTTDSRNVDDYVRKNDMTILFAAGNEGPGSGTISAPGTAKNAITVGATENLRPSFGSYADNINHVAQFSSRGPTRDGRIKPDVMAPGTYILSARSSLAPDSSFWANHDSKYAYMGGTSMATPIVAGNVAQLREHFVKNRGVTPKPSLLKAALIAGAADVGLGFPNGNQGWGRVTLDKSLNVAFVNETSPLSTSQKATYSFTAQAGKPLKISLVWSDAPGSTTASLTLVNDLDLVITAPNGTKYVGNDFTAPYDNNWDGRNNVENVFINAPQSGTYTVEVQAYNVPVGPQTFSLAIVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Stabilization of Enzymes by Metal Binding: Structures of Two Alkalophilic Bacillus Subtilases and Analysis of the Second Metal-Binding Site of the Subtilase Family
doi rcsb
source organism Bacillus halmapalus
molecule tags Hydrolase
molecule keywords Enzyme subtilase SubHal from Bacillus halmapalus
total genus 154
structure length 432
sequence length 432
chains with identical sequence C
ec nomenclature ec 3.4.21.14: Transferred entry: 3.4.21.62, 3.4.21.63, 3.4.21.64, 3.4.21.65 and
pdb deposition date 2015-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
A PF04151 PPC Bacterial pre-peptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5fbzA02
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5fbzA01
1SIUA 4G9SB 1SIOA 4JP8A 4WOBA 3EE6A 4WOCA 4C3UA 1KE1A 3CNQS 4C3VA 1SH7A 1GA6A 3DE2X 4OV6B 2W2PA 1KDYA 1GTL1 2G4VA 2XVGA 3SICE 1BFKA 2ST1A 4H6XA 2Z2XA 1SELA 1IC6A 4H6VA 4M1ZA 3DE4X 1SUEA 2W2QA 1T1IA 2PRKA 3SQOA 2X8JB 1YJAA 3GCWA 2W2OA 3VYVA 2P4EA 3D9QX 1GA1A 1SVNA 5JXGA 1NLUA 4HX2A 1TM1E 3GT3A 4DY5A 1KFXL 1SBIA 1AF4A 4DXZA 2SBTA 1C9JA 1V5IA 3DE1X 4HPKA 3F7OA 3QMPA 1SUAA 2O8OA 3F49S 1R64A 3LXUX 2HPZA 3EIFA 2Z56A 3DE0X 4J94A 4K8RB 4BWGA 3I30X 5JXIA 2E1PA 1TECE 1SCDA 1TM4E 1THMA 2Z30A 5I9SA 5FBZA 3A3OA 2LUWA 2ID8A 5ARCA 4DY3A 1SCAA 1NDQA 1SBNE 1GTJ1 4ZOQI 1GNVA 1JEAA 5FAXA 4KG7A 2Z2ZA 4HPKB 1MPTA 1SCJA 1ZVKA 4NE7A 3H42B 4Z2AA 1PTKA 3DWEX 3BPSA 3Q40A 2WUWE 1OT5A 4KPGA 1NDUA 2Z2YA 1SIBE 3AJ9A 2B6NA 2QTWB 4B5LA 1AQNA 2PMWB 1OYOA 4DWWA 1Y3CE 1KE2A 3P5BA 3I34X 2DQKA 1P8JA 1T1EA 3TECE 5CW1A 1A2QA 3TI9A 1YU6A 4H6WA 3DW1X 1KFUL 1SPBS 1PEKE 3VTAA 2DP4E 1GA4A 1WVMA 1SBTA 1Y48E 1AU9A 3CO0S 3WHIA 1CNMA 4DZTA 1C9MA 5AVJA 1T1GA 2W2NA 5SV5A 1PFGA 1SBCA 1AV7A 5ARDA 1SCNE 2XVKA 1AK9A 1KDVA 1XF1A 1TO1E 3DVSX 1LW6E 5JMOA 1Y4DE 1U5IA 1VSBA 1V6CA 1SUCA 2ZWOA 3PTLA 4I3GA 1Y4AE 1Y34E 3JQWA 4DZGA 3DE3X 2QFEA 3DDZX 4AKSA 1R6VA 1P7WA 3BX1A 3BGOS 3DF0A 2V8BA 1TM5E 4YN3A 4HVLA 1BFUA 1TM3E 1AH2A 1SCBA 4GI3A 1DUIA 3OSZA 1NQJA 2WV7A 3AJ8A 1GTG1 4NE9A 1Q5PA 3DYBA 1YJBA 4MZDA 1GNSA 3I2YX 5SICE 3GCXA 2PKCA 3DE5X 1SUPA 3I37X 1IAVA 1WSDA 4LVNA 3T41A 3UNXA 1DF0A 3ZXYA 4FONA 1CSEE 1KDZA 4CFZA 1TO2E 1Y9ZA 3DVQX 4DJ5X 1PJ8A 3VHQA 1Y1KE 5FFNA 3ZXXA 3A3NA 1WMDA 4OMCA 1C9NA 3GT4A 2WWTA 3DE6X 2PWBA 4LVOA 4CG0A 4OMDA 2SICE 3EDYA 3LPAA 1Y33E 5B1DA 2IXTA 3PRKE 1MEEA 1EGQA 2W2MA 1EA7A 3L1KA 3BOWA 1YJCA 3DVRX 4CFYA 2X8JA 4I0WB 2ZRQA 3Q5GA 1S01A 2SNIE 1ST2A 1UBNA 3VV2A 3DW3X 3QFHA 1NQDA 2XVLA 1Y3DE 2HD4A 5AMXA 4NMXB 1BE8A 2XRMA 1C3LA 3LPDA 1ST3A 1WMEA 1TK2A 2IY9A 1HT3A 3LPCA 1GCIA 5K7SA 1SN7A 5ARBA 5AQEA 5B1EA 5JXJA 3HJRA 4KB5A 1Y3BE 1AVTA 3WIVA 5AVKA 2XTJA 2PQ2A 3WQBA 3F7MA 3AFGA 2TECE 3VV3A 1S02A 1DBIA 2GKOA 3QTLA 1BJRE 1S2NA 1GT91 3VSBA 1Y3FE 4AKTA 2ZWPA 1P7VA 2PYZA 2ID4A 2SECE 2Z57A 1ZVJA 3DE7X 1SBHA 3A3PA 1BE6A 1WMFA 3WIUA 1SUBA 4ZARA 2PWAA 3TI7A 2Z58A 1R0RE 1BH6A 5JXHA 4RYDA 2WUVA 3JQXA 1SUDA 1OYVA 1QXPA 1TM7E 1TMGE 3D43A 2DUJA
chains in the Genus database with same CATH superfamily
4U3JB 3WJAA 5BMVA 4ACBA 3ZCPA 2FN9A 1QS0B 3QPCA 3WY9A 2VNHA 1EG7A 4NRMA 3DEYX 2HH9A 1E96A 1Y9GA 1IVYA 4MYUA 3TEZA 2VP0A 2OXEA 1BVP1 5IAJA 1Z35A 2YN2A 2Z2XA 3AVRA 1CPMA 3WHKA 1OFNA 1A9ZA 4XVCA 4I4TB 3DE4X 2RC6A 1IXZA 2ZJBA 2A0XA 2CWWA 1NY5A 3HA5A 5E1BA 1DKUA 1Q0TA 2AIRA 5GJCA 4B7UA 2OUKA 1N7GA 2R5WA 2DHRA 4C6TB 5FZCA 3NVCA 2EYUA 5FPSA 1U2RA 1HZZA 1CR4A 3TLMA 2WFLA 5GLWA 1HR0B 1P75A 3Q3GE 1E62A 5DNEA 1DBPA 4BVBA 3KE9A 4MTCA 3PGJA 2EA7A 1H66A 4N5DA 4B84A 4TYWA 4EPTA 2YIJA 3RZJA 1RLTA 4QXQA 1OE0A 1SK8A 5BY2A 1T1RA 5AHXA 4TV9B 5DTJA 2DUQA 2IH2A 5B55A 1FS5A 1FAYA 1ADBA 4E12A 4LHNA 2E85A 4LEIA 4G1BA 1MPXA 3TVTA 4BCDA 5JD6A 3QXHA 2ODBA 1E2PA 1A8IA 1SXJA 1AO0A 4CTOA 3LPLA 4GBED 1NVGA 2F1HA 4HVAA 3GUZA 2VK1A 1A6CA 1L9XA 3D64A 4BIIA 5CUQA 2O2JA 1Y3CE 1FVXA 5JCOA 1KIFA 3UUEA 4QPNA 4MOWA 2Z3VA 5YASA 2A9RA 1HV8A 1SVSA 1VZ2A 1GIAA 3EIQA 3KAQA 2H8GA 5HKBA 1DXQA 1BVYF 4AP9A 1UEIA 2V5AA 1ID8A 2HWF1 3BWYA 1M0WA 2DP4E 4JMLA 3I39X 3A4NA 3ZY4A 2WS91 2NV2B 3MW2A 3AOEA 1BXKA 4F8EA 3CMMA 4KSYA 2GNTA 4HS9A 1NE2A 1QHSA 2DTDA 3L4KA 4KI7A 3C8HA 1XWIA 5SY4A 4KCGA 3H8WA 5KTYA 2P6RA 1ZL0A 2CL2A 4HXYA 1OZAA 2NTJA 4Q34A 3EASA 5HK8A 2J48A 3MFQA 5EJIA 4PQ9A 3KQUA 1SEVA 4BYGA 2H16A 3POIA 2GARA 2FE4A 1EINA 1P7CA 4UCFA 3AERA 3BMNA 1P31A 2PSJA 3ETEA 4I3HA 4Z2WA 3CW2A 1I2MA 2ISQA 1NXSA 3A2NA 4LTMA 2QYTA 1SU7A 3VH4A 4N7MA 4HG6B 2G4CA 3QPWA 1NY6A 2PV0A 1XQ9A 4ZGWA 5C7OO 2HU7A 5HVNA 5DISB 3R7NA 2GNMA 4LPKA 5I51A 1JJVA 4LVNA 3MZHA 2E55A 4GZ3A 5IVFA 4IJWA 2B4QA 1L7NA 5F8PA 3IR5A 1OVSA 3LK7A 4YUWA 4GH5A 2AOTB 1NXMA 3D0QA 3SK0A 2EWMA 1N9GB 4CM7A 2GFQA 2C3MA 4F2PA 2V5UA 2O1WA 3GD7A 1SZPA 1NC1A 3B85A 2JS7A 4M8SA 1JAZA 3QUBA 1XC6A 4L4XA 3FNHA 4A2CA 3WV5A 1RRFA 2PGOA 1BMQA 3LUKA 2ZS8A 5FI0B 3FWPA 5FZ0A 2Q1XA 3KK0A 2Y0CA 1NPDA 3UJNA 4EYUA 2W6JA 3DLIA 2WAYA 4QQHA 1ZRSA 4FN4A 5J37A 3OKCA 4JEUA 3L1IA 2XVYA 1UIRA 3N2KA 2O59A 4BL5A 4V03A 4LY9A 4RZUA 4B4DA 1PBNA 1PFQA 3CLRC 3BF7A 3RSQA 3ZWDA 2DCUA 5TMDA 3U4HA 3AV0B 1PTJC 4BJ3A 4BBJA 2YN4A 1OI4A 1U2TA 3IALA 1QVWA 4HWKA 1N0VC 3CLVA 1RHMA 1CF4A 3ILSA 3DBHA 1BJRE 3O95A 3PUIA 3SHVA 1PZHA 3J7AC 2F3QA 1JHAA 4C76A 1A69A 4AKTA 3LCCA 4RK1A 1BS9A 1UBCA 4Y9TA 4LXUA 5LC1A 1VJ2A 2Q9CA 3K8YA 1CBUA 2FJUA 1CZSA 3FKQA 5CLJA 3GJ4A 3MXTA 2DKOA 1NN0A 1NVVR 1UMBB 1YRBA 3O8QB 3C43A 3OFVA 5FBHA 3FZQA 4B4VA 3ZK8A 3ZU4A 1PKEA 1OC4A 1UOJA 3L6CA 4EJ6A 3U9SA 2F1JA 2BPA2 3AP5A 3RFXA 4GM1A 3S5JA 4MI9A 1ZZBA 5A71A 1ZD9A 1CP3A 3AKEA 2AI1A 2J8ZA 4H6XA 4MNTA 2CL0X 3LU1A 4MVYA 5IHPA 5MN4A 1DDOA 2J59A 3KZCA 3EWSA 2DT5A 2PMCA 4HYEA 3ZWBA 4F4HA 2YFQA 1FNSA 4LA3A 2PCLA 2FUEA 1X3SA 3RVKA 3OD1A 3TRJA 2YIMA 4URHA 3UM9A 1GNZA 1CDDA 5KNBH 4QXKA 1UC5B 2XQIA 1X74A 2GZMA 3H99A 1OTHA 5CDUA 5FK8A 1MO4A 1TT5B 5DZEA 2FJ0A 1CYEA 3NVAA 1XZNA 4I8IA 4M9UA 1GQYA 3OUUA 1AUVA 2X8KA 3R6DA 4TYSA 5GZFA 3WF4A 4EB6B 4M1MA 3TKYA 1X7GA 1M34E 1OOEA 2OYSA 4XVHA 4ZXFA 2WIIB 5CT8A 2C29D 3KSUA 4RTRA 3H2GA 2ZRJA 4IQ0A 3V2GA 4F56A 2BUAA 4WJLA 3OD5A 1EJ2A 4WNIA 3HFSA 3SJBA 4KKXB 3I8OA 2VPPA 4ZCQA 4M3CA 4RH3A 5JR2A 3HB7A 2QNIA 3J80A 1ECGA 2MOKA 2GYYA 4PN3A 1AJEA 1CP2A 4O2RA 3UC5A 2Y6LA 2JZCA 4R05A 4B3MB 5F5CA 5KJ6A 3L07A 1T3GA 1N5OX 3MICA 3ASVA 5E6RB 3G49A 1EHCA 1KFBB 3C3BA 5CB6A 3UOGA 1H85A 2OO5A 3TINA 1RAIA 3BI3A 2D00A 5K5EA 2Y6JA 2JCXA 2RE9A 1JH9A 1U0FA 3QE2A 5CA1A 3FDZB 3OIWA 5J48A 1S0JA 2Q99A 2IDJA 3KWLA 5EJEA 1JZ3A 3NJZA 5JS7A 4CRWB 2ALJA 2ZAYA 3EJKA 5FMDA 5CYGA 1Y3AA 2VMGA 2FSHA 1Y4UA 2XMDA 2EZUA 1GOTA 1XNBA 2RS52 4G9EA 3F5MA 1JMUB 2FI1A 2ZETA 3RJMA 1Y8ZA 4HVLA 3UJ6A 1TTHA 4KUGA 1R3UA 2IXIA 4B3BA 1C9YA 1W9MA 1BQ3A 4M1KA 1C28A 3BL6A 5FYVA 4DVGA 3ZQKA 3UT0A 3G6KA 4FLFA 1MS1A 4PG6A 5FTWA 4BFWA 2PA0A 1HMYA 2DOKA 1MF7A 4YAWA 4IIVA 2CDPA 2WN3A 4L2IB 2YRXA 2BEKA 2VYQA 5LA9A 1UH5A 3UO8B 2ZFUA 3IP8A 1OH5A 3QM1A 4MHRA 2K87A 5CKQA 1UXKA 3ZXXA 1HXS3 1YFWA 5L73A 3ZWQA 1EGMB 1VJTA 3E1F1 4HEA6 5SYAA 3POJA 1GYRA 3AW8A 2DBYA 3WK8A 4ZKTB 4WFIA 2WD7B 1GRVA 4M86A 3SH3A 4B2IA 2IXTA 5IC4A 2WK1A 3NG1A 1FATA 1JPNA 4XB1A 2IPAB 4FGJA 3DOUA 3OT1A 1L7QA 3LRTA 2JCBA 3AL0C 3OEED 4QQFA 3H6HA 4CF6A 4GYKA 3BSYA 2Z5VA 2PZJA 3AT1A 4W63A 1PR0A 2XRMA 2YY6A 1U7TA 5TX7A 4MQMA 2H6CA 1XB2A 4IFTA 2W6JD 2JD1A 3WVJA 5JXJA 1EE2A 4BVJA 1DEAA 3SQWA 1OH6A 1FX5A 4JBGA 4GGOA 3I59A 1GRRA 1SVWA 4R9NA 5J23A 5DTQA 2QP3A 3B51X 1DDIA 2I91A 1ZNZA 3U7QB 2NW6A 3ZV7A 2D7FA 2ZULA 1CJTC 4NBNA 3KKLA 3RHZA 4Q4X2 4HWRA 4Q66C 4NONA 1F3LA 1ENZA 4QTUB 1BIFA 4W9NA 2QRVA 3AERB 1PW5A 3VTKA 1Z9BA 3L5KA 3SMQA 5HG0A 2RJOA 5TS3A 2D2XA 4QOJA 3IKJA 3AKYA 4IXWA 3LECA 4LYAA 3WRWA 5LZ4A 3QKIA 2WM9B 5AP9A 2OS2A 4R9AA 5EN4A 3KSMA 3HJCA 4LE0A 1DAHA 2QPAA 3P2JA 3ZGOA 4CMEA 4IIEA 1ZKDA 4XOIA 1EWYA 5AUNB 1C50A 1E9VA 3PQ3A 5CFLA 3P8ZA 3BH0A 4KL8S 3R3JA 1YACA 3ZHXA 1F60A 4C1BA 2ZYHA 2YHUA 4QX0A 4KPYA 2CVOA 2R5NA 3LAWA 1N3IA 1MH9A 5ITZA 5JOZA 5J1TB 3C6KA 1ZOIA 4IE4A 3JB8A 3EFOB 4EF4A 3NV2A 4GVXA 1Y6QA 3OB8A 4KR3A 4JASB 2NYAA 5FR2A 5A3PA 3JUUA 3D9QX 2Q21A 4XEHA 1X1EA 2ZBEA 4FI3F 3HBMA 3ZFGA 3IQDB 2YWHA 3RBXA 4XUGB 1JTZX 3M6WA 4RABA 3QVGA 5DB4A 3UAWA 1W88B 2VI5A 3NBFA 1DL5A 1ZMOA 1K7SN 3HL4A 1ELOA 4I4NA 2AR7A 1G6OA 5KMGA 5I4IA 1UZNA 1LF5A 3GEDA 3WX0A 1VSTA 4HKWA 4LKSA 2B8TA 4PQGA 3ERCA 2ATCA 4BUJA 1P77A 2QAGB 4TPKA 2HA5A 1RC8A 5COBA 2PLWA 1UFQA 2WSMA 4PNEA 3OE4A 4NFHA 1JDVA 5DYWA 2Q3CA 2WM3A 4BMCA 1TMYA 1UWKA 1ZO8A 3RMXA 4EPXA 2VCYA 1KYTA 2PLV3 2XDAA 1P2FA 1QJY1 1O87A 1CZHA 2WPNA 5D1IA 3UTDA 2PS9A 3HZOA 1FT9A 1UOEA 4KPGA 2R042 4BQPA 3N7AA 3BMQB 5BUVA 1SXJE 3E2PA 3O8CA 2YIVX 5I8PA 3TB6A 3JD3A 4XFJA 2RARA 2ZUVA 5JIAA 2H07A 2V3WA 1W8UA 1T2DA 2Z8ZA 3HCRA 1XD2A 4D6SA 1C5HA 3JZDA 1HDCA 5KOJA 1YRHA 5CA1B 2A1IA 3NP7A 3LHDA 2E9QA 1QG6A 4MGYR 3R2JA 1JIUA 2B94A 4CKYA 3AF3A 4YK7A 1E3SA 4PQEA 1SFNA 1HRI1 5FOQA 1RIIA 1EEHA 4QKBA 4JCCA 4XZPA 2J1AA 3G2MA 2QTRA 1QDUA 2JDMA 1UMCA 1O6UA 4YQZA 3FOWA 4ZDIA 3SYKA 3QE4A 3UOAB 3ROUA 1Z0DA 1B16A 3HVJA 3DE3X 2VF5X 1TF7A 4E14A 4QHOA 2DDUA 3H7AA 4AVAA 1B6RA 1KYYA 1VBA2 1CULC 5EV7A 1VLVA 2EXKA 3QACA 4R1UA 5EYXA 2E26A 2ENWA 4LRQA 2IYPA 2WIJA 4Z51A 4YH1A 5ALEA 1LS1A 3NM5A 4LBNA 1AHPA 2JCVA 1T2UA 3RASA 4YO8A 4ZU6X 3KJFA 4BFTA 3EMVA 3MK31 4Q48A 1M8GA 4HNAB 4IEZA 1LOAA 2IH5A 3IKVA 5A0TA 4KQKA 1W8HA 1T9DA 1D2SA 1VB2A 4KYUA 4EJRA 1PFKA 3VHQA 3SZMA 4H7JA 4OUEA 4WY2A 2P11A 4D1YA 5C4IA 4OUMA 1Z34A 3IVXA 2VRCA 4IIDA 2CJYA 1OA2A 1SLBA 1CIJA 1N9GA 3U2QA 3KJEA 2CNBA 2SICE 4LK6A 4OKIA 1F5JA 3RRZA 3ZDZB 3JXSA 2A6WA 4IWNA 3KJGA 1NASA 2H2WA 3T7CA 3USCS 2M1XA 1RP1A 3KG2A 4NIHA 2G28A 4AZ0A 2GGSA 4DQVA 4RLFA 2TUNA 2RKBA 3DHWC 3HC7A 3ZSMA 2YHSA 3ZSKA 1X86B 4XX1A 1H9CA 4MRNA 3BZWA 2WHRA 2OZ6A 3Q6IA 2J07A 1XZAA 2B99A 3FMPB 4Q2FA 4UUNA 4Q3AA 5K8VA 3AP6A 1P1BA 4PFQA 3WQBA 2EARA 5GAJA 2VPQA 1HF3A 2Y0BA 1ULTA 2XTMA 1ZUNB 4R7ZA 2VL7A 1A3KA 1R1A1 1E1QA 4BNDB 1ECCA 4RQPA 3ES9A 2RAVA 1VKOA 1SDWA 4UT5A 4DUZB 1M0SA 2HHCA 2C03A 1IDOA 2AX4A 5JXWA 2CHUA 2Z58A 5F3EA 2E7ZA 1MDBA 1TGYA 4UVIA 4ATNA 1AYN2 5C1DA 4IWYA 4EJ2A 2CCKA 2DR2A 4Q4JB 2VH5R 5LB4A 4H55A 3UH0A 1J3PA 4IGAA 4G2NA 1G6HA 5BYNA 2YMMA 3EFOA 3INGA 4QEZA 3L7IA 4XPIB 3JSAA 3NHJA 4CDWB 5BPFA 1WZUA 2WWUA 3HN3A 3A9VA 3TBKA 1NQXA 4XX0B 5JAXA 5LY1A 3IMFA 4L8YA 3N5KA 3I01A 5C3QA 3BGIA 5HIIA 4O63O 3O3MB 1JEQA 1A9SA 2R1ZA 2PL3A 4UFPA 2A5JA 2PT6A 3EDOA 5TY0A 1K9VF 3JSXA 1U8CB 4AP5A 3L7NA 4UW9A 3B9IA 1FRQA 1VGVA 1E2QA 3CW8X 1IN6A 5DP1A 3UGFA 3AP4A 1MJGM 3GW8A 1VFNA 4N9WA 4CIBA 1KETA 3NBXX 1Z5VA 4HQNA 3LT1A 4GOOD 2HSWA 2VSQA 1JG3A 1KY3A 1Q1BA 4NYIR 1SU4A 2C3YA 1JWLA 2LUWA 2J6CA 1LBIA 3KPJA 1A1SA 3AP9A 3AB8A 1US8B 2RONA 1XDGA 5HCFA 3WDWA 3WLAA 2J7PA 3N8DA 4YJ2B 1IZ9A 2M6KA 3MQFA 2XNDD 2Z98A 1U28C 3W06A 5LXTF 1C80A 4AJPA 4OB6A 3ZX4A 1C7JA 3X2SA 1E7QA 2VUTA 3W2GA 1JAHA 3B2QA 3KOYA 2NVUB 4CCOA 3VI3B 5U4QA 2HY7A 3S7EA 4DWWA 4ZO9A 1KE2A 2DRIA 3A1EA 4E6PA 5KSYA 1W85A 1L5KA 3A3KA 1G60A 5TGTA 4FSHA 2W1QA 1UOPA 3NCTA 1Q3HA 3A6ZA 2NTYC 4O2AB 2WU3A 4GMP0 2BKUA 4KFCA 3R05A 3AFMA 4F71A 4GRAA 2BFUL 1SCNE 2PWPA 4K26A 1AQIA 2AOXA 3K5HA 3CCFA 5DKFA 4X1YB 2ATIA 1U9YA 3EUAA 3ZNPA 2PZGA 3DXUA 4NPRA 1CT9A 4X66B 2VYVD 1UBGA 4JKIA 2VP4A 1BW9A 3HNBM 5LCWL 1Y8RB 5IKEA 1ZOPA 4YRAA 3IQEA 4DDUA 4YAEA 4EABA 3K72B 4YM1A 5LQKA 4Q3NA 4OQFA 3I0ZA 3O7WA 1DB3A 3GNQA 2CSXA 3HWWA 5DCLA 4GM4A 2IKSA 2VZLA 4KZPA 1OBNA 5CB4F 5K3FA 3K46A 1YRAA 1AUXA 2E4VA 3VZQA 3OF3A 3NHBA 3IAUA 4KLAA 4ZI2A 1S0EA 4GICA 5FYYA 1GNSA 4JB8A 1Z5WA 4YWHA 3TN91 3OKAA 4K0KB 2PGDA 3V7FA 1OPXA 4YW5A 2HGSA 2X6RA 2WUHA 4KE7A 2XCQA 4F9EA 5IAXA 4XJ9A 5J58A 5DX0A 3I9FA 3TAYA 1NYLA 4IDBA 3NAPB 1TCVA 3A3NA 1ONOA 1H69A 1MOPA 2DR3A 1PT7A 3NWOA 4AI6A 1ENRA 4LS3A 3DB1A 2WG1A 3VC7A 2X14A 4JGYC 1GQFA 5A6QA 1P6UA 1IULA 2O48X 1GAQA 2W0SA 3AVQA 1AKMA 1YVPA 1TW2A 3HDTA 2UVDA 4C6TA 4KXUA 4F96A 2ZE6A 3VBSA 3UJPA 4PBTA 3O1RA 3GJRA 5A3JA 4E27A 4K9KA 3K1AA 3LCJA 2BFWA 1YNOA 1UBEA 3A37A 2H4WA 3QPDA 4HVOA 4I4LA 4ES9A 1SHLA 5C1PA 3Q8XB 4ODIA 2AJCA 3TIVA 5G53C 9GPBA 2V7GA 3T9BA 1Z5UA 3NYQA 1UFOA 3MN1A 2PBZA 5DNCA 3N76A 3EG9A 1E3QA 1TYCA 5A7WB 5BR8B 4Q3LA 1ZESA 3BE4A 4LBQB 5IJXA 1LU1A 2AN5A 1WAMA 1QH9A 3AHFA 1JQJC 5HM8A 3NEPX 4YM0A 3HIFA 3C15C 4Y5Z0 2R47A 1P44A 4L9BA 3K9GA 2EVXA 1ZA7A 3KU1A 5H83A 2P2CA 3ZHSA 3P2YA 4LDQA 4NARA 3VZKA 2OK7A 1LDBA 4HOYA 4B4PA 5BN5B 2PX6A 1KYXA 1PZ9A 2GI4A 1JAXA 2EP7A 2PO5A 2X5IA 1WUYA 2IYOA 2HX1A 4F3NA 4XABA 3GMTA 1IQRA 1H1IA 4LDNA 4YGDA 2HADA 3CR8A 3OQIA 3TVYA 3DF7A 1Z8FA 1I2CA 4XSVA 3IAPA 4M1QA 2BGLA 4UBJA 4M1ZA 1DBVO 2VNVA 1KDPA 1OXMA 4HQOA 4BX0A 4GI7A 1BYHA 2RJ2A 1IQDC 4DSOA 3RR2A 4PZ0A 4HKLA 3T2OA 2E53A 4Q1DA 2AOUA 3VKUA 1NMSA 2F59A 1V8OA 4G67A 4GR4A 4RF4A 5H7XA 4A2PA 2D2VA 1GYKA 1EM8B 1QV9A 2J1LA 4JCOA 4WM7B 3EWIA 5FZOA 3P26A 3EIFA 4BATA 3NFYA 5BQ5A 3AWDA 4RVDA 3LZDA 4CWAA 3TQQA 1Y7IA 2P3JA 2JAXA 1ODSA 1IPKA 3IDFA 4DV6B 2QZ4A 3CVXA 3W5HA 4FXKB 3GDFA 3LQRA 3SC3A 3RVJA 3CRRA 2XPJA 3CR7A 4FFBB 4KOAA 5JE8A 3R6LA 2Z6QA 1YQWA 3UQZA 3M3DA 4IV0A 1MQ9A 4LC9A 1MOZA 3EDQA 2YOGA 3DOEA 1NSFA 2LCIA 3Q40A 3KQVA 2CL5A 3BJIC 4EHKA 4IWXA 2QTWB 2RAPA 1Z45A 2R4QA 4NESA 3PHMA 3AXTA 3PUXA 2C92A 2X9NA 2H18A 2VM9A 2YL2A 1Z2AA 1E61A 4CCSA 1YBVA 4M6WB 3D7RA 1B2LA 1Y81A 3W34A 3GHNA 3BICA 4UVDA 4Y33A 5D2CA 5FLXA 1NA1B 2NVWA 1RWKA 2XH8A 2O3SA 5FWXB 3CBQA 4YVSC 1BMDA 4V3BA 1W0JA 1S5PA 5JJ5A 1KP9A 4ANFA 3UEOA 1CAXB 1DO0A 4LJ9A 1FS6A 1QH1B 4ZICA 4MXWB 1IBCA 4LYYA 2WWGA 4HZGA 2AJDA 3R41A 1AUOA 4BK4A 1T5SA 4MRPA 5FNZA 4BAUA 2J5RA 2RV9A 2OM2A 1PNOA 5JRDS 5A9RA 1GUBA 3L4SO 3KB2A 4AQTA 1TE1B 3JPYA 3WLEA 1G7TA 4I1YA 2D3PA 3L46A 1O97D 2MSNA 1HI9A 2DBVO 1IOZA 3EB9A 4FW8A 2GA9A 1H4SA 1R88A 4LOSA 1GEGA 1HNWB 2R1TB 5J2TA 3AVUA 1TD9A 1U7PA 3KWJA 3NEAA 5FQNA 1B1CA 3F90A 2IOHA 2WBKA 1JNYA 5JAHA 1EK0A 1LB2A 5BP7A 4L50A 5BWBA 3QHQA 2X4IA 1RC6A 1W8WA 1SUPA 4J2TA 2V5YA 1C2TA 5FKCA 1OA3A 4F4IA 3KHUA 3TRSB 4G0YA 2VEDA 3EXG2 1RLOA 2CHQA 1YO8A 1IS4A 4X8MA 3PPWA 1NUUA 3OZXA 2AFHB 5KYYB 1ZZCA 4E21A 2ZIFA 3K09A 3GK3A 4DLUA 3OCXA 1DRWA 3CVWA 4DC0A 1JH5A 1E2EA 3I3DA 4OAQA 2IODA 4M2LA 3AHGA 2VDPB 3ET4A 4CDUB 4L4ZA 1SK9A 2P7IA 4OF4A 5AKYA 3EGCA 1O94A 4P0TA 3B7WA 3EVEA 3KEMA 5EP9A 2WD7A 1EUYA 5GGYA 4CI0B 1QAQA 1NP6A 3JYNA 2B8JA 4PNPA 1GCIA 2QUHA 3FUTA 4Y2PA 2VDVE 5AK4A 4D8VA 2QENA 3NHWA 4JQCA 3TOJA 3C7KA 2A78A 4HDNA 1CY6A 4ASUD 5K4HA 2HU5A 4PHGA 1S02A 4TV9A 1EZZA 4ARZB 4AS1A 5HUQA 3JVUA 3SEPA 5MHTA 2P37A 1LH0A 1MB9A 2IYEA 3PG5A 5J5AA 1IZ7A 3OU6A 4IV1B 4ASMB 4OJYA 1Z4NA 3DL0A 3LUJA 1IBRA 1SG9A 4Z9BA 4H15A 2QW8A 4CCKA 3AY0A 1LRLA 2FZKA 4PZ9A 3C14C 2C82A 4OQMA 2VCHA 3T5TA 4MV0A 5EESA 1DFHA 2VWHA 5C8YB 3ZU5A 4CVNA 2XUGA 1T3HA 1NV8A 5T5QA 2DLDA 2BFDA 3NALA 5LPNA 2IGTA 1F6BA 1L7BA 3AFOA 3LFIA 4M9XA 4WZAE 4JWKA 2XUQA 3WLQA 1Q95A 4CKZA 3AV3A 1HFEL 4BQXA 3KXIA 1INLA 4AZ3B 5JAZA 1MT3A 5A3TA 4DUGA 1OF4A 1CAVA 1Z08A 4TQGA 2OW4A 1S3FA 1T1IA 2MMGA 4ASLA 3N2GA 2AYYA 2WE7A 2R8RA 4BIFA 1GU3A 2PHDA 1C81A 3SJUA 1E6MA 1HH4A 2J87A 4PIPA 4BKPA 3AL3A 5K0LA 1DI0A 1MQAA 4QU9A 3S2UA 2P9JA 3STUA 4M0CA 2EHDA 2Q5HA 3R3YA 3ROXA 3VNQA 2NP0A 1T2AA 1YB2A 5C1BA 4EN6B 1WQ4A 1F8YA 5F5IA 2J22A 3BU7A 2H08A 4JUCA 1X8KA 3QEMB 3I30X 1TI7A 3KT3A 3THYB 3TCKA 5EKTA 5EJFA 2BRUA 4Y6QA 3M3EA 4H3VA 1NLFA 4HS4A 4II7A 3TRKA 2QR3A 1TEHA 1CEXA 4L11A 4AVSA 2UYAA 1H8EA 2JLSA 4IIBA 1UMDB 2E6VA 4QYTA 1KJLA 5IJRA 1OQEA 4LJYA 3UJ7A 1WHSA 4NRDA 3BF8A 2EJCA 5FPZA 2QIOA 5FLHA 2BHLA 3ES1A 2OCLA 2LRHA 3NT4A 2JB4A 1D5WA 1H2KA 5DMYA 4MV4A 4PAGA 4WVZA 1SBZA 2B34A 5A3MA 1LV7A 4L75A 2WS93 2XRZA 2I8CA 3QKSB 3GRVA 3LL4A 1RJ9A 1RHUA 3J7HA 3NIDB 1UJ4A 3Q0TA 4CVUA 3M1IA 1Z7BA 5C70A 3ZU3A 4F85A 4X8OA 2HMSA 5GQSA 4OA5A 2Y6VA 4J25A 2QROA 1K7XB 4MKXA 3GV0A 1MV8A 3RS2A 1Y6ZA 4DLNA 1QVVA 4BO9A 4DGSA 2X5NA 3GJ8A 2ZAIA 5E7JA 3PU6A 4IUDS 4K20A 5B37A 2X13A 1HYBA 1FJ2A 4PC1A 2UXBB 3LIGA 1V71A 2C5SA 2BJVA 2BI7A 3PWKA 4CP2A 3POEA 4XMAA 1HQYE 4MVCA 3PDUA 5AW2A 2IBSA 5A4DA 1MB4A 3U75A 2JG9B 1JZQA 3ZGYA 5LOVF 3AFHA 1MW8X 4YPOA 4DDHA 1JHVA 1MNAA 3EZ2A 4NBUA 5IJWA 5CXUA 1RVV1 3GMSA 3DBLA 4DIKA 9LDBA 3VR2D 1XJ0A 4KMRA 1RL3A 4UTOA 3L0IB 4MQBA 1UAAA 2QKYA 3KHSA 3NEYA 1RKVA 3FZNA 4UHHA 3K0AA 4EPVA 2PKCA 1L5HB 3P4XA 3VOTA 2RHPA 4AKEA 3UOWA 5KHOC 3L4BA 1VJ1A 1RUJ2 4R9BA 3SCFA 2XUKA 5JWHA 4DQUA 2IZ0A 3AL5A 3OCUA 4E9KA 4YV1A 4MJ3A 1XAHA 4TMVA 2I6TA 4QQNA 2G63A 1SQ4A 2R7KA 4DPMA 1JEQB 2FFAA 4N9QA 4OBWA 1U02A 2B20A 1BMFD 3ZU2A 3QF4B 5L3SB 5CU1A 3K70D 1GZ9A 2EERA 3QNMA 4KPEC 2HUNA 1EVKA 4D0RA 1XZPA 4K6MA 2WKSA 4NMIA 4J6GA 3PX7A 4JYCA 1J22A 2GALA 1NSYA 2W2VA 4EIWA 4BN5A 3PWTA 3KR9A 4UKDA 2X4GA 3NRCA 2HN9A 1GGFA 3AZZA 2YDEA 3RKUA 2UYHA 3GHMA 1PE0A 4CPBA 1ST3A 2GPJA 3F3SA 3T5CA 3LPCA 10MHA 4DM4A 4BYMA 3VBEA 5CJPA 5JADA 3O1IC 4L0QA 4D9EA 3VBFB 4OBXA 1TYAE 5KC5A 4N6NA 4ARSA 1JDPA 3V33A 2V3VA 3V4RA 5A4MS 1Y5MA 2I29A 2C31A 4W82A 4FMDB 4M53A 3JAWA 3B9PA 3HS3A 5EINA 3TFWA 2ABWA 4R6XA 2RHWA 4WADA 2V7EA 5KSWB 5KC8A 4X8HA 1HEIA 4DMCA 5FY5A 1ULAA 3NXKA 1QO0A 5T6BA 5AKIA 3BDAA 2X0IA 5FI1B 5JFTA 5A03A 3PV0A 4BWYA 6REQA 1ZJ4A 5F5QA 4XGQA 1PD1A 1QHIA 5JAUA 3M7IA 3GEBA 1F38A 4OP3A 3IE1A 4E2XA 2XUPA 2LXNA 4ZVSA 3WG3A 3SYRA 3ROQA 5L7WA 5L4NA 2LGJA 4G5XA 5KNDD 4A0FA 1GD1O 5AVZA 1R3DA 5LUBA 3DCYA 5EJ1B 5AW1A 4F4UA 2NU9A 2CY0A 3HXQA 1OXXK 5EUBA 4DLAA 3GBFA 3N3HA 1RYDA 1DLLA 5KYYA 1Q0HA 4OXXA 4LQDA 3TTYA 1PI3A 1LLUA 1NMYA 4K86A 4DUGD 4E2QA 4LUMA 5KWRA 4BPZA 1XRJA 2QOEA 2QN6A 4XB2A 4WVVA 1PIV3 1C1XB 5F51A 1RKQA 1IYZA 3LBHA 3GUHA 4ZEMA 1ZH0A 4TS1A 2XSZD 1EZ4A 3QKRA 1DGRN 3OGRA 5B7QA 5C8YF 2B8NA 4EELA 1FNBA 1V1MA 4UHCA 3LXUX 3UJ9A 3FTDA 5KVCA 1B4DA 2I6SA 4BZZA 1FFGA 5K0UA 2J6HA 1QGAA 3IGFA 4HNAA 3JZIA 2WJ6A 2IXLA 3J7NA 2FMTA 2JGFA 2WMOB 4MVJH 3POBA 2OV6A 2FSVC 2ZQYA 4OOFA 2WN2A 3JQAB 2W94A 4YXFA 3C3CA 2VCBA 4FPYA 4UFOA 3LM8A 2WIDA 2QXUA 1WCXA 5JISA 5HKLA 2JFPA 5L7OA 1MAWA 1YI0A 4I14A 4XIIA 3X1XA 4QX1A 1WXIA 4Y98A 3J7MA 1QWSA 1UL9A 4A7ZA 2Z2YA 3OQ6A 5B12A 2ZABA 5DOZA 2YY1A 3I2FA 4JC1A 2I80A 4LISA 2ZSHA 4U7JA 2XONA 4U8GA 1XIVA 3CPEA 4FQ7A 2ARBA 5JEDA 3TSZA 2ZIUB 3AXEA 4ZZIA 5C8CC 2B30A 2G07A 5E2IA 1ESCA 5LLTA 2E89A 4OHPA 4HMZA 5I93A 3CX3A 4RZQA 4KAJA 4TT8A 2W2NA 3FGNA 5ITVA 3VHXA 4JLOA 4L16A 3ZJUA 1GCUA 3WL7A 1LHNA 3T4UA 3QYAA 1RHI2 5HCAA 3ANMA 1C4RA 2CE7A 3LDAA 3J81A 3ZE8A 2QTTA 4RQPB 4IJKA 5B3JA 1O5TA 1BSVA 3IURA 4Q0MA 5HFJA 5T55A 3JALB 1WQ1R 4MRMA 3OQJA 4RTKA 1X9GA 2ENRA 2O6HA 2IUFA 5HTOA 4I6GA 2PZMA 4FLMA 3WUCA 1WW6A 4KG0A 3JQFC 4Q1AA 1LQUA 1W75A 4Z07A 2R66A 4B34A 3HV2A 3MJRA 2JAQA 1MAHA 3JQ7A 1ZQ9A 3C3YA 2WOJA 5L6LB 5F9FA 3C8DA 4N01A 5BN3B 1DCFA 4GMP1 4K40A 4YQFA 2R751 3N35A 1I2AA 2ONJA 4RIEA 1M3SA 4ZT3A 2BM8A 3O0WA 3GT0A 1W90A 2PYIA 4HGQA 3ED5A 5FT9A 5KAPA 4X60A 4RLQA 1JHNA 1W28A 3C85A 4YJ3F 5CM2Z 4JHXA 1L8XA 3WBBA 2X5IC 2W6OA 3GLFE 2P9HA 3I2OA 1SFRA 1EGQA 4KN9S 1ZI8A 3K9CA 3PK0A 4YLEA 1BX1A 2KSQA 1KYWA 5AI8A 1S01A 2A5FA 2PXJA 3LQ4A 4M0FA 4IDHA 3EF0A 3M5WA 2DHEA 4E1AA 1LK0A 1Z06A 3W8NA 2J9GA 4JEIA 1ZVMA 2F8LA 1DC7A 3H2SA 1RBMA 1LKNA 2WG0A 4LRYA 1Z6XA 4QXOA 2GUGA 3IO3A 4MIOA 4HDCA 3WIVA 3IRVA 4DPLA 2BBSA 1G86A 2H54A 4BWVA 1N2JA 3RF7A 5A6VA 2BGPA 1YK0A 4UVEA 4G9BA 2YWFA 5ADUS 3A7DA 2ZWPA 3BWXA 1N78A 4OP1A 2FPIB 1LBQA 1GWKA 3ODPA 3E22B 5FL7A 3GVXA 2JIMA 1I5RA 3PUJA 1SZBA 1SLCA 1LR5A 2WDZA 2ZYWX 1SXQA 5JALA 2H06A 3FZEA 1YBAA 4R1LA 3P9CA 4QD3A 5K3EA 3PVNA 3HPQA 1DOAA 3ZHTA 4Y2RA 3QJYA 4PVDA 1X6VA 4CTKA 3GELA 2IXKA 1N4AA 5LBFA 1E5LA 1RUOA 2SKCA 2BIFA 3BRSA 1K9SA 4GYWA 1XMPA 2D4AA 1DARA 5GJ6A 3E6AA 4NDAA 3MT9A 2Q3MA 2VVDA 1RWMA 3F95A 2BGGA 5B5SA 2KA3A 2OORA 4G5FA 1QJZA 4JQYA 3KYDB 1VE0A 3MW4A 2KBEA 1JG2A 1P9LA 3MHZA 2FH5B 1ONNA 4KLZA 4RQUA 2C0QA 1EIWA 3FCOA 4KIJA 2A1UA 2ZX2A 2IZOA 3N7JA 2R00A 5HM6A 1U7WA 3G2HA 2QDRA 5E7QA 1RMU3 4BIMA 4RAOA 4A2UA 1GM5A 1BDHA 4AJHA 2JAUA 2XSZA 2QVSB 3STVA 2JFNA 3HB9A 3C8UA 1IH8A 1NW6A 1VL6A 4RIIA 2I7XA 4CDQB 2Y0EA 2D1SA 3TKAA 4NCXA 2R00C 2Z30A 5KVSA 1NJ5A 5A7NA 1R16A 3PHJA 2WC2A 2EJVA 4NZMA 1O6CA 2ZBVA 3IP6A 3TTUA 4CQLB 1N2OA 2WRZA 3AZYA 1Z4LA 4GEKA 4R68A 1GP2A 3WWZA 2GN0A 4RSRA 2DCMA 5E1DA 1AUYA 2HSDA 1DEXA 2BE9A 3T5BA 3TPZA 4K2HA 4FOLA 4EGCB 4RJLA 4O2BF 2H11A 3BERA 1SURA 3R8FA 1DRJA 2C88A 1ARZA 1PNGA 1NDUA 1G7SA 1XWFA 4CEIA 1Q1NA 2AYXA 4TKVA 1S8OA 4E3ZA 2O1XA 4KBBA 4ID9A 1DXOA 3HU5A 1QXSA 3U4GA 1KEXA 2BY4A 5A7GA 3EGXA 4CKCA 2DHCA 3K9QO 2D93A 1KVTA 2V9CA 4FX2A 5HIJA 1NR1A 5CIWA 2ZRAA 2VTBB 1AV7A 2FZEA 1U0GA 1AKWA 1C7FA 3P1JA 2BW8A 4YRSA 3H5IA 5U1PA 1QV6A 1XJAA 4PZAA 2FZCA 4JODA 4MRSA 1A8HA 2HSEA 1S2IA 1RJFA 5JCTA 2C61A 1W6UA 1QGED 3RUCA 1M2FA 4MQUA 1WEHA 2DTYA 1X50A 5G3YA 4KDEA 3ZX7A 4IQPA 3JQ8B 3OEYA 1K2VN 3BCRA 4YN3A 2XKJE 4MUHA 2WJWA 3EGWA 1ESZA 1WCSA 2F9FA 5M2QA 3U5ZB 1ECJA 5JS2A 1QYRA 4MQ5A 2G82A 5BNPA 4G01B 2O57A 3P9SA 5ED4A 4M8KA 1LXCA 1UPCA 2EC5A 2HJRA 2ZROA 3RZKA 4OYHA 3LJKA 1SOMA 4W5WA 3CO2A 2ODWA 1DAGA 1ZXBA 3X1KA 5K8JB 1LSOA 4ZVVA 2VDLB 1N8KA 4QRHA 3DAPA 1ATIA 1U8XX 3OC0A 3OY8B 3DVQX 4P3PA 2FF5A 3P27A 2MR5A 3R7DA 3WW4A 1UC8A 3AOGA 2NQ2C 3IBTA 4YZ5A 1AR82 5CFZA 3NANA 3KYDA 1F8GA 3WL8A 4F9FA 1MIHA 5IVEA 2Q46A 5IVKA 1JR2A 5C7IO 3GFOA 1C3XA 2PX8A 4HFSA 2ILTA 1C7IA 3HUTA 3N7TA 2NWQA 3MG9A 4BMVA 1K6IA 2H1OA 5M04A 3A4LA 3UC9A 5IVDA 2JLVA 3PEFA 2FDHA 4RKYA 3BULA 4Y0AA 2HWF3 1YHZA 4DMKA 2R1UA 2XUDA 1W4CA 3T4VA 1FMLA 3ZFFC 1GVNB 1P61B 4P54A 4KACA 4YRGA 4DADA 4FFWA 2NXEA 3VPGA 4A92A 1EY2A 4KBZA 2HFKA 4KQFA 4HH0A 3G79A 1WDMA 3RPQA 2JDPA 4PN7A 5LASA 3RS6A 2ZPTX 2R60A 5FUMA 2O23A 4H7PA 1YQ6A 3LKJA 4D9MA 2FHRA 3TEYA 1NXPA 1IJBA 5JRJA 2R0QC 5DCYA 5WRFA 2EATA 3QV2A 1TIKA 6ADHA 1UKCA 5AKLA 2GK6A 3PJDA 2X40A 5BNOA 4DWJA 1N77A 3FWNA 2A5YB 3TM5A 3L8ZA 2GEBA 5L6MB 1W36D 4Q19A 5FLYA 3G5MA 3LZCA 2ZBRA 2OCKA 2O8FA 4KTTE 4HLNA 3IAS1 5KKNB 1N0HA 1U8UA 4YG6A 1KOGA 1YIAA 2Z5GA 4Q05A 3ZFEA 4PHFA 4GDMA 5IW8A 4W9MC 4U7DA 3NRBA 4Q4Y2 5FTTC 4CT0A 3ACLA 4E13A 5TSWA 1CD3G 3OZUA 2O20A 4MXWA 1ODFA 1K92A 3NBZC 4PLFA 2KI5A 3HEMA 4NVRA 1VI5A 5EJ2A 5LIRA 2ZGSA 5FYBA 4Q3BA 1E0SA 3D02A 3Q3HA 1Y42X 4H7EA 3NV3A 5FUIA 1XYVA 2K0GA 4NBVA 1DGQA 2NT3A 5IYYA 3WQRA 2VEOA 1WSAA 1YJLA 2GC0A 3VR5H 2C1EA 1I80A 1IQUA 1N7HA 3Q3VA 2BCGY 3BDVA 4RY2A 3F49S 2JHPA 3AF5A 5ERYA 2HIHA 2Z56A 1UU4A 4P5DA 5F32A 1RUH2 4PO1A 3WJ1A 1PR9A 4JUDX 1JECA 2ZG6A 4B83A 4C0KA 2OAEA 2JEMA 1L1EA 1ZGHA 4IYJA 1G55A 2WINB 3GRCA 1H3EA 1O5OA 4L92A 1X7WB 1TUBA 3E9ZA 1OZHA 5DNAA 2JIQA 3EIOA 1UCFA 1VCNA 2ZJZA 4CMBA 1KJZA 3U9LA 5JH7B 4XUOA 1C1FA 2AK2A 2P2NA 4OMFG 5JCPA 1E20A 2ECOA 1V95A 4B6GA 5FYUA 4RVNA 1OYOA 3QQ5A 3SCHA 3GJ0A 4DLBA 1C4XA 5KHAA 4ZAFA 1EWTA 3HDGA 5BT8A 2AZ4A 4QDRA 2BT4A 4FXOA 3WP6A 3WGHA 4MHSA 4F3YA 3V1NA 3U1XA 4UZEA 4FCCA 1CY2A 2LE0A 1TPYA 5AVJA 3LNTA 5JSUA 1AHNA 4WZBA 4YNIA 3H97A 5LMCA 3GROA 1EPZA 4YI5A 3DTVB 2XQXA 1GUDA 3ZHBA 1MH1A 1WCV1 3WMEA 1N6OA 2H2IA 3BOPA 1DC3A 3I92A 1RTVA 2NYVA 2WIGA 4YA6A 1RXSA 5C8CA 1NLSA 4EQZA 5BWOA 2R041 3RJ9A 1F8VA 2NYYA 1QFZA 3BQMB 1GLNA 4LJRA 1VQ1A 5JI9A 5L4LA 3FBGA 1UJ6A 4PTLA 1CZRA 1W6NB 1ILWA 1PMJX 4D69A 2GF9A 2JX9A 3OPWA 2I67A 3DNFA 5JEEA 1L1RA 2J9RA 4GWKA 4CLRB 3OJ0A 3LDBA 1E1YA 5KBFA 4BQEA 3IQIX 4REQB 1O7FA 2QMYA 2FEPA 4P08A 4P3XA 1N4DA 1F2NA 1RZRD 3NC0C 4YAGA 1PT5A 1H9BA 3PVOA 2EZ9A 1CJKC 5TT0A 4G56A 3FCXA 1CRWG 1YHNA 5EMHA 1Y6GA 5E89A 3VL8A 1E4EB 2KB0A 2CK3A 2BISA 4R9DA 4TXLA 4XZ3A 1EDBA 4A8PA 3CUVA 1JFLA 2JHAA 3ROKA 1UXHA 4R7TA 1J24A 3VR0A 3GBGA 4ITVA 1WMEA 5HA5A 2WD8A 4DM7A 3PQ4A 1Z0HA 3NAGA 5BWCA 3P5SA 2J7PD 1HQLA 1E9DA 3TYJA 4IEVA 3L9WA 2JFBA 5EWJB 2G40A 3AQ4A 1GGKA 4WCFB 5DU2A 3LDUA 3HN1A 4NHLA 1O0SA 5JR7B 2PZEA 3U81A 4C4OA 1NVUQ 1Y9AA 2JGDB 4QM6A 5JC1A 2X15A 3I9V1 1W2OA 3SLRA 4YUVA 3K5WA 4FVVA 4XDGA 3DPIA 1J3QA 4XW2A 4A8JA 3W5CA 3FB4A 2F6BA 4RFLA 2BTQA 2QE3A 1RWOA 2BKXA 2A14A 3TCNA 1RC0A 1MNQA 5I7VA 1AZSC 4Y18A 1IVSA 1ZISA 1SAYA 2ZOEB 3VPXA 5FOWA 5IK8A 2QJVA 3D6EA 4JB3A 4NHEA 4D6YA 3FNIA 1GQHA 3HXMA 3NNSA 2HKXA 2QS9A 4OVEA 1FCJA 3C3WA 2BDEA 2JGLA 4MR7A 2WOOA 1UWVA 2IOYA 4G0QA 1P4SA 5I6DA 3C2QA 3UKTA 4MG2A 2QL6A 2XUAA 3IVRA 3RRXA 2UVQA 1WETA 2D1FA 5JPDA 3B6JA 3AMPA 3GGDA 4IXDA 4L5IA 4PF1A 1H0HA 2GPNA 3C3XA 2JK0A 5C1OA 2Y9PB 3JWPA 4NOTA 3C7EA 5G04L 1I3OA 4Z9YA 2J0QA 3QVUA 1NF3A 5CTAA 2QVXX 2FN3A 4DILA 2NO0A 7ABPA 1I5PA 5BRAA 5FLJA 5FBZA 5IWAB 4OUKX 5CNIA 2NU7A 3DB2A 4C43A 5K8UA 1MU0A 3ORFA 3RW9A 3E2IA 5DSZA 4M46A 3VMFA 4RSUA 2JPDA 2NU7B 4UFNA 2OP0A 1LBSA 4MW4A 1UO9A 1RUF2 1DCSA 1SUSA 5FBLB 5EJ7A 3NJ8A 1AQUA 3IKLA 2BNMA 1P5FA 4NMMA 3WD5A 2TYSB 4GI1A 4FDTA 1HK7A 1DQ4A 4LX8A 2H1LA 3O0DA 3KOUA 5DHUA 1WMAA 4YJ3A 3AJEA 3PNMA 5AOCA 1ONSA 1J59A 4Q24A 4MX8A 2R043 4D8YA 1H2AS 3TUJC 3LTNC 1TOAA 3OOEA 3IMNA 1BYIA 3LF1A 1ADCA 2XL7A 2H2AA 1QZXA 1XB9A 3RUEA 4ZONA 3ILFA 1GN9A 4R7GA 2QVBA 3ST7A 1QPZA 2XQKA 2R85A 5T64A 5ELMA 2J3DA 3E8SA 4DT1B 2HCRA 1WB5A 4TLMB 3IHTA 3OYWB 1SBCA 3F3MA 5FK7A 1CUHA 1JJIA 3CN9A 2PHWA 3GBSA 1PEAA 2G71A 4CCWA 1D8TA 1G9BA 2I55A 1W34A 2GD6A 1XMXA 1A34A 2G9VA 1T2VA 4LY0A 2PZBA 3RUHA 4Z86A 4BV3A 3RCBA 1RWBA 3KCCA 4RS5A 3BA6A 4QUBA 4QHSA 1SVOA 5FJIA 1JOJA 5FKJA 3VOBA 5T5PA 1Z0AA 3ZZ0A 3TSCA 4MB2A 5IMBA 3WC4A 3CH4B 1QGUA 3OE7D 3PFFA 3BU0A 4A8JB 1UIKA 4Z2YA 3GC6A 3NTOA 1EFKA 1UIMA 1GTG1 1RWPA 4HMOA 4JLBA 5CRIA 3NIBA 2Z5FA 4TLGA 3PC3A 4DRXB 2IX9A 2ETEA 4TZ6A 2QM7A 4IHJF 1VXOA 3LHFA 3RIGA 4XF0A 2BCJQ 5KTPA 4LMFA 2VJOA 2O8EA 1QO0D 4LRXA 3ZJTA 3LY8A 4DJ5X 1VPHA 2WHEA 4JDPA 5E95A 1WBDA 3OOSA 2ZRMA 1QH8A 1IG0A 2QQMA 2EL7A 4KO8A 5B3AA 1N1YA 4LMPA 4EG6A 3FCSB 2OV3A 5AJTA 1B76A 2OP1A 1JJFA 5SYMA 1WG8A 3KP1A 2BFBA 2ZSUA 3H16A 1R8JA 1VSQA 2OENG 1G2PA 4C0JA 4JZKA 4R1PA 2FX5A 3V1MA 3OO0A 3DL3A 1UR5A 4D8TA 3JRXA 2SKEA 2QRUA 4D2IA 3DKIA 3I83A 4YVWB 3K53A 3C6QA 1FS4A 1WL8A 2WAXA 5E6UA 2V98A 2W6ID 4J1TC 4ZT5A 1G8KA 4L27A 1ZK1A 2PAMA 2WIFA 2D3SA 1HQDA 5IT5A 3PDJA 4BX2A 1HDEA 2PSDA 4RFVA 1E6UA 2JIDA 4DIQA 2GK3A 3TYXA 2XTJA 4AW7A 2A86A 5HR5A 1H2LA 3C6MA 8OHMA 1E9AA 3F46A 1PMIA 3FL7A 3ROZA 4PSUA 2OLKA 2UZIR 1O3QA 1GXSA 2P9TA 4YUYA 1PGNA 2OC4A 4KBYA 2XOEA 3DMPA 4YRTA 5FOTA 4LQCA 4ZKDA 1CY0A 1YDHA 4BOWA 3C7CB 4MCJA 4MWZA 1V7QA 3WDUA 4A44A 2R0HA 4UFHA 1EX7A 2B4RO 2WIBA 1CRPA 3B1WA 2Y93A 3IUPA 2JKYA 1MORA 4E4TA 5HWSA 3C8MA 5GV8A 4BB6A 1XJWA 2HV8A 2OB1A 1HTWA 3AEUA 4FCVA 2CJFA 2VHQA 4IDFA 5G1NA 1VLZA 5I5GA 3ZNOA 1AXKA 4HN2A 3LX5A 2C9YA 4P80A 2ATXA 3A10A 1O6ZA 3ZXSA 4BVEA 1V5GA 1POV1 1V8FA 3AI7A 4OIMA 2MHFA 1QOTA 1O4TA 4YFWA 1JA9A 2YS7A 1ZJJA 4HGPA 1SUFA 2CFRA 4BWOA 4C03A 3ZWKA 2AOWA 4TLCA 3GARA 4GFDA 1MJ5A 2FPUA 4IKOA 4RPHA 4TT3D 4OQ9A 5FZ1A 4LBQA 5JXGA 4CUKA 4AJJA 3DV2A 2WWRA 4V02A 5FOVA 2B1IA 3U09A 5LCXA 2F7SA 4WXYB 1L6IA 1HG1A 4EAQA 1N5KA 3FBWA 2PUAA 2NNWB 1A04A 3OX2A 5ITWA 4LTNA 3ZCTA 3JQBA 4ZU3A 3C7GA 4Y7CA 1XSQA 1LBEA 2O8FB 1S7CA 1BEUB 3PI6A 3G68A 1PZFA 1QJEA 2HSGA 1DHRA 5KTTA 2R8BA 2XGOA 3OBIA 1GNVA 4WJZA 5AJHA 1SRQA 2CNWA 4NE7A 3FGZA 3AJYA 4JENA 2QMZA 1ZZ8A 3GZUC 3G7UA 3LLUA 1H6BA 4C4ZA 2J30A 4II2A 1W2TA 2Z08A 3EXIB 5FP4A 3HXLA 1ORVA 4Y1RA 2WPDD 3IQGX 5P8WA 3QUQA 1AYN1 1L1FA 2ZEZA 1K98A 4CMAA 1NQTA 4WNAA 5F5LA 1FX1A 3QLVA 4V0LA 4O1HA 1WDTA 1DVRA 2GHRA 1IY0A 2DVAA 2ZRGA 3E0XA 3ZJYA 1YU6A 4S2DA 2FVYA 1SLAA 1KEEB 1V9SA 2O8DB 3KT0A 2CNAA 4LSMA 5UKDA 2QTBA 5ISLA 4G89A 1XU2A 4EJSB 2ZRDA 4GJYA 3PF9A 1FA9A 2YZNA 3FOEC 2D43A 1T43A 3L0PA 1UXOA 2G76A 5JOWA 5FLKA 4RKRA 3L1UA 1QFYA 1T91A 4P0QB 3ICEA 2IXFA 4NYIQ 1OCEA 3MO4A 5K3CA 3ZMOA 5JPNB 4AN0A 2YXSA 3V4LA 3B5LB 1BHO1 3ZCRA 1VSBA 3N6VA 4RD2A 1E9BA 3B6KA 2YICA 3AHEA 2OBMA 1BC5A 2W2KA 4DAEA 2IIPA 3WIDA 2NU8B 1L5OA 3ACIA 3V1YA 1IKQA 2QVCA 2A30A 3C3JA 1YRLA 5LOVB 1TM5E 2RHLA 1GRCA 4L95C 3MILA 1O9GA 4R8RA 3RSFA 3I8TA 1AKTA 1RSZA 4C0SA 2VJLA 1F48A 1NXOA 5D8AA 5A70A 3CN7A 2DFPA 1NI4B 3MJCA 3ICPA 4MGHA 5EPOA 3LSDA 2O0MA 5EQUA 5FWAA 4ENWA 1QQ5A 1I1HA 1NCQC 1XLTC 1VP9A 2WYUA 1KI2A 4UOQA 3MA0A 5LYJA 1NTRA 1JHOA 4Z53A 1LOGA 5KHIA 3Q2IA 3ADOA 1CC1S 1GQGA 4Y9RA 4YUXA 1E7MA 1D2GA 3IMKA 5FMCA 4BMSA 1DQRA 4IJ6A 1U9IA 4Q4DA 1Z5GA 2PHLA 2J46A 4L73A 1VBNA 1N8NA 2LP4Y 1O57A 2EKZA 1OD5A 3L9XA 4K9LA 3ZPYA 4N5NA 1OMOA 1XZGA 4I8XA 3N1UA 4YCSA 3I72A 1WW5A 4HVTA 4LLOA 1F2VA 2GBFA 3CVYA 3A6KA 3WL4A 5JQGF 3NAPA 5IATA 4AWDA 3TE6A 3EN0A 1IXSB 5DW0A 3FOAA 1BH2A 1RPZA 3T9AA 3FNEA 1ZOOA 1R6TA 4DXHA 5F76A 4YRQA 5AHWA 3TOZA 2WUGA 3LEIA 3MMXA 5DGIA 3H5TA 2JVJA 1GG8A 1OR8A 4MR9B 1NZCA 3S57A 1O95A 3ZLVA 2IYZA 4IDQA 3PRJA 2XKBA 3CV3A 1JZ5A 1RJDA 4MGIE 2G1JA 3VDXA 2Q1WA 1M6VB 2CYBA 1RBZA 4PSCA 2A6XA 4UFIA 4CV2A 3K05A 4YP7A 3X1DA 4CCNA 2WB2A 3LL7A 3COYA 1XNHA 2CMHA 1X9HA 5B1SA 3F4BA 1H8TA 3IP9A 3GYDA 4CDQA 2BTOA 1UPSA 4YMVA 4PZEA 3C4JA 2CLKB 4ZDJA 1NBOA 1KYQA 2NMNA 2P67A 4O2AF 4XUCA 2CFOA 3QU5A 4Z9AA 4LYFA 3KIPA 3WLPA 1FW6A 5CIQA 3OZVA 4V1CB 3Q8FA 4LV6A 4YARA 2Z8YM 4NHKA 5IWFA 4NV3A 4OHYA 4A0QA 4LI3X 4E2WA 4UBLA 1E1CA 1VCOA 2ZDQA 2K46A 1BFKA 1ZBDA 1UT5A 1YUMA 1Z7GA 3I09A 2XMCA 2EIDA 4C5CA 4I4TF 3PEVA 1B8PA 3B1ZA 3EG5A 2XX3A 3U3DA 1JLSA 3DLPX 4LNVA 2RHHA 4MGQA 3E5RA 4J1TA 4L99A 3VYSB 1V16B 1XVVA 1D5CA 3NNJA 4UTXA 4NOMA 1E6KA 1HTBA 4X8NA 3CINA 1YDGA 3A4YA 3L7MA 2Z5WA 1B6SA 3KSRA 3W9BA 4IVRA 1V5IA 3T0FA 1EH5A 2ZP1A 1CUAA 1KS4A 2FN8A 5CAEA 1XCJA 4BV8A 2DT8A 5KQMA 4D97A 1VYHA 3JRWA 4TGLA 4QZVA 4P9JA 4WVMA 2WSVA 2VTFA 1R5JA 4AZ0B 3IHKA 1AN0A 4YROA 2WQ4A 1G21B 4ENTA 1ST8A 2DVGA 4HK9A 1V3TA 4KEAA 2BP6A 4O0MA 2XJUA 4ZHQF 1AK2A 2IYXA 3FY4A 3U3KA 5K0NA 1E9RA 5EZYA 2R84A 1OX6A 1YFKA 4FGWA 3QOYA 1E2GA 1CFZA 2TSYB 3NO4A 5D3QA 2PSEA 4PINA 2YUTA 4PCAA 3ZKUA 3IUYA 3U7JA 3OQ1A 2FR8C 1V39A 1H94A 5IULC 1HQCA 5KZMB 4K3VA 2FA9A 1VALA 3QKTA 4ZVMA 4P22A 4BFSA 3W8EA 3W5JA 1GPH1 4DRZA 4MH0E 2Y6KA 2FMFA 1Y48E 5DT9A 1LNQA 3K9LA 3CNAA 4FW9A 3BXEA 1JS1X 4LXXA 3AUFA 4RE6A 4XDZA 1FVFA 3NC4A 5E6UB 3K0CC 4POOA 3KSBC 2AZTA 1KH3A 1QP0A 2XH6A 4UZSA 3A6DA 1LCLA 1VZ3A 5C4WC 1E5XA 1T4MA 1TZKA 1VE6A 3N9OA 5GP1A 2YOHA 5IUNC 1DIHA 1VJGA 4X1IA 3W2TA 3PFGA 2ZI4A 1JVSA 1JYVA 4G4JA 4GR5A 3LX8A 4ZYYA 3V9PA 1Y3TA 1NT4A 2WFF3 2B98A 3JBG2 1PUXA 1U1DA 4WVWA 1RD4A 4ND7A 4FS3A 3TUZC 2C2GA 2JLZA 3UHFA 3E9RA 4JP1A 3OOWA 5LWHA 1H2ZA 2JATA 4ER0A 1XYYA 4NJMB 4OQEA 1H30A 1NJFA 3HO8A 1ZD1A 4L5AA 3SJAA 4MYTA 3OHMA 4IHQA 2ZBPA 3IDEA 2Z2IA 3GZJA 3EK2A 1Y1KE 1WB4A 5JYEA 3ESYA 4OMCA 1KFJB 3L7CA 3R3HA 2HQRA 1LOEA 4GNKA 3NTLA 2CLHB 3E3NA 2RM21 3MEPA 1TMF1 1H4GA 2UZ3A 3QFFA 4CLXA 3NO8A 1QX3A 1J7KA 2B5WA 5DH9A 5K3OA 3MPOA 5CA0A 2GTPA 2GEDA 3AKRA 2I4IA 4D4KA 2VUUA 3Q5GA 1F2TB 1D2RA 2XYRA 2VP5A 3BS4A 1AKUA 4UQLA 1F4AA 5GLUA 1LB1B 4J1QA 2HC9A 1N9KA 4EQ6B 1R0ZA 3JQEA 3PXCX 4CNQA 1XTKA 1QOOA 4KU7A 3CSUA 4KN6A 1XTRA 5JSZA 3UJQA 3EQ9A 3DOIA 1UX7A 4OAPA 1KO8A 4MUJA 2YC0A 2IYWA 5CFQA 1HRV3 4FCTA 3RS8A 1V9U1 2N9UA 3HVRA 1GGEA 5IS2A 3T30A 3SIPA 4EVIA 3VKFA 4A73A 5BN3A 1ZUIA 1U8ZA 3UK9A 3RVRA 2GAOA 3EFBA 1WHTA 2YC2C 2QJWA 3F3KA 1BGXT 2H3HA 3COZA 2VMFA 1Y89A 2PYZA 2XJ9A 4WZ6A 2QMUA 3VXKA 3GCDA 1WCWA 5DAQA 2JLAA 3HQRA 4Q7KA 2C2ZA 3SCZA 1M54A 4B7CA 2MNGA 5FLIA 3B78A 2QVZX 3MTGA 3R0QA 3MCTA 1HDYA 3CNNA 1R8QA 3KUDA 4RC9A 5B6PA 2A9PA 4MUKA 4DLKA 1L5LA 2IYQA 3U0VA 5K6RA 1Q7BA 2J0UB 1X9IA 5A33A 5LDHA 1KQ3A 4BNLA 3ZR5A 3VHLB 3RIYA 1JHQA 2VL4A 4ZZ8A 3ZYBA 1MC8A 3ZS9A 1HXS1 3EDCA 4CEYB 5E9WA 1RM5A 4IE0A 3UATA 4DNPA 4GNRA 3QVLA 1CAWB 2ZR7A 1XRPA 2HK9A 1EE1A 2AHRA 4PG4A 5LQDA 4DTIA 3L05A 4NUBA 3EGVA 2EG5A 1HSOA 4X62B 1SQFA 1M06G 4ZVKA 1WW2A 3CLTC 4EW3A 3JZAA 1LX7A 1ZUWA 5TEVA 2UZ4A 4FWBA 4N3BA 1XEFA 4U7PB 2WTEA 5CBKA 3L18A 1VYTA 4V0RA 4FYIA 3VBCA 4JZRA 4YS6A 1PFUA 4UOZA 3VZJA 3E3OA 2BEVA 2ZBQA 5D01A 5IT4A 1E3LA 1SCAA 4K6KA 1VBC2 1UBTS 2BZ0A 1G20E 4G0PA 1PTKA 3QH6A 2ZI5A 2E4WA 1AK1A 4GP6A 1G0OA 3EVDA 4BGEA 1FDSA 4GEGA 2DPLA 5F64A 2ZOSA 4A3XA 4ARIA 4COVA 1R5OA 3TN7A 4JI5B 5IARA 3SSOA 4ER3A 1YB7A 4PW0A 4Y5SA 3SHTA 5BYKA 3UN1A 3L6DA 4ZDWA 1W2UA 4DMLA 2OT7A 2MHCA 1CUGA 5F2WA 3CJTA 3PL0A 1QTIA 4KV9A 3S55A 5BPXA 2IV3A 5HPOA 3DOFA 1GA4A 3VKLA 4PPYA 4XBQA 1Z73A 4FOOA 3ZIDA 4J03A 2P8SA 2YY7A 2W8ZA 1EE9A 2NP6A 1NQOA 5BQ3A 2WTAA 4DT1A 2FUCA 4PAMA 1XLWA 1QV7A 2REBA 3ON5A 4ZYZA 1OD6A 1XYNA 2WT8A 4GLJA 5JZVA 5CLLA 3EGDB 4B85A 3NB0A 4K9MA 1XXHB 1ZG3A 2YCLA 3ECAA 3LO8A 3VD3A 1F5NA 4E70A 3LPFA 1QNLA 4DCVA 1GPUA 1PO12 1FXZA 1FX0B 2X7XA 3NOVA 3PA6A 2GMMA 2ZEJA 4QO7A 1BFUA 3K96A 3CNHA 4XTMA 3NIFB 1K3IA 3QVOA 1W2AX 3LFHA 5LMUB 1T4CB 3WK9A 3T09A 3NEJA 3B6MA 4QODA 1QJCA 4ZVUA 4WM7A 1Y82A 3JQ9A 3OOJA 2FHSA 4GGPA 1WBJB 2UXCB 3EA0A 1EXWA 1YQQA 3CNLA 1YZVA 3M49A 1YVEI 1LEMA 3TRDA 3ESRA 4B1LA 5A3UA 4LI0A 4IKPA 2BMAA 4AMGA 4WKNA 1E1KA 2M6RA 2DB3A 4FGSA 4OQXA 1JHUA 2ZRHA 3VC1A 1Z12A 1OKKA 2Y60A 3QOFA 2VK8A 3L04A 4BFUA 2I76A 1JFRA 4C7MA 4CUZA 2G09A 2PWBA 3LLSA 3JXEA 2EIGA 4HDNB 4ZYVA 2AG0A 5IAOA 2EBHX 5SV8A 3KUKA 5C3RA 3AUTA 4AQ7A 4B4WA 2B7BA 4PQRA 6YASA 1YCDA 3BYZA 5LZ2A 4OHXA 4KP7A 4I0WB 3CMGA 2AQ8A 4UYBA 1RZVA 1K97A 3DL2A 3OURA 2PLRA 1LHOA 3TH5A 2HHJA 4ED9A 3P0JA 5EMNA 3QVKA 2C2OA 1V6OA 1VJRA 2B5OA 4FBMA 2M6LA 1PL6A 1VIAA 3L40A 4KQXA 5ARBA 1C8KA 4F9TA 3AYEA 1C1HA 2OBXA 4HMQA 1Y3BE 1AL21 4IH4A 3SZOA 4YYEA 3D3QA 3DH0A 1MIOA 1QAOA 3ADPA 2WINI 1Y1LA 3AI1A 1XQWA 2B4TO 5KYXA 5BRJA 3OHPA 3TBHA 2FXIA 4Y30A 4MYRA 1NQAO 4ZRDA 4PDWA 1BU5A 2GYWA 1U0OC 4XVUA 2C2XA 2A0FA 1VL0A 1RDFA 5JVDF 3ZZTA 3SXJA 2QLTA 4Y6OA 1VRBA 5FPAA 3UY4A 2OFPA 3DE7X 4NECA 3IPYA 5LBIA 3WLHA 2AW5A 5BMVB 2LIVA 2IHBA 1K4MA 5EE3A 3KHKA 4CCCA 1QYVA 3AZOA 3TMKA 1AR93 1Y6FA 3ZXAC 2PK3A 3Q88A 7YASA 1F9EA 2O6LA 5J5CA 2WMYA 4HFMA 2DTEA 4DMFA 4CDWC 1W9SA 1TJNA 1ZX5A 2YMPA 3BKXA 2A73B 8ADHA 4PPGA 1RKUA 1JSCA 3USUA 2E31A 1U2DC 5HHTA 2CAUA 4Q0QA 2XAAA 2BWAA 2P1RA 4TSVA 5IAKA 3GJ3A 5IN4A 3IUMA 4DCSA 2FPPB 3GRRA 2OV1A 4LE4A 5JMPA 1OT3A 1S0IA 1GNQA 4ZALA 1NX9A 4UBIA 5CP8A 4AI3A 3ZVLA 1ZN2A 3HI4A 3F7OA 4DN6A 3W5DA 1E98A 1RJ9B 4CKWA 3WWYA 5F9TA 2GWHA 1B41A 4DEVA 3P4YA 3DF9A 3NKFA 3TTVA 2HA6A 4MDFA 1KPGA 2W39A 2B9UA 3D0KA 4NEQA 3FCEA 2ONZA 1JZ6A 2UWAA 5FMOS 1UWLA 1GTSA 1MHPA 2IDZA 4FE7A 1J8QA 3J7LA 2GCNA 1JKMA 4I7EA 1M8FA 2GERA 3MF6A 3E5XA 1KI7A 5FL7D 1F8UA 3GZNA 2HDHA 1GG5A 2CDCA 4IUGA 1OXKB 2GNPA 1J8MF 2O5VA 1J5XA 4QQ2A 2IPNA 4L78A 2ZGMA 1SBYA 2I03A 3RANA 4AUEA 5IVBA 3K6KA 2XR1A 5A3NA 4BO5A 3DBOB 4AFDA 4MLZA 4QTYA 4ETMA 2GN4A 4P4TA 3I0MA 3Q5DA 1JILA 1U6IA 1T36B 2DCKA 1XTQA 1E63A 2C78A 2IF2A 2OCXA 4RO0A 4R31A 1DZ3A 2FQYA 1RJWA 1GL9B 2ZSDA 3MQ4A 2VMDA 4XPZA 2ODNA 3NHYA 4DEXA 2CNDA 1HA3A 4CEWA 5KDOA 2ZIXB 1L5GB 3H8OA 3W0LB 1PFGA 2HQBA 1IUOA 1EUTA 3THWA 1FL9A 4GSLA 2F8TA 2OXTA 1W30A 3DULA 3CJIB 3ZWAA 1T3ZA 4FDLA 4QDSA 3QU2A 3EBOA 1MVEA 4D8WA 1GAJA 3HJTA 3RVMA 4WLUA 1DPFA 1T8RA 4O4HB 1R18A 2PUCA 4BVGA 2Q29A 4F04A 2KWIA 1A9PA 1RPTA 1BRMA 2VXRA 3R5KA 3QVTA 5CFNA 1FNDA 1TXGA 2WJJA 2IKQA 1SHJA 3U60B 4KQJA 1IPEA 3WYBA 3E15A 4XQGA 4Q3DA 5TLSA 4XILA 4N18A 3K6JA 4FT2A 4AKHA 3C87A 3HY3A 1PGL2 4WMLA 3H83A 4B6OA 4C1XA 2PGJA 4WK6A 4N8SA 3G9XA 2B5HA 4XC9A 1OQDA 1P4GA 1M2NA 5DBGA 4BVLA 2IXJA 3U11A 1AKQA 3CU5A 3SR0A 1MZEA 4ESEA 3NH9A 1A88A 3G5LA 3JD1A 4BNFA 3THSA 2QD5A 1OMIA 2V55B 1GL7A 3LD9A 4YI3A 2Z4RA 2VYVA 4N7IA 4QARA 5ALZA 3NP9A 5I7FA 4AROA 2IVIB 3KHCA 2PZAA 3SF8B 1SVKA 4K9OA 4YB8A 2QQ0A 3TKLA 3SNHA 5CBPB 3X2FA 3I28A 3V2HA 1FPN2 1KFCB 3RYRA 3K5PA 3ZWVA 3WQQA 1VHTA 1LY1A 1O8CA 1A2OA 4KHZA 1K75A 2JAWA 3RWNA 3NMUF 5LA2A 3IPCA 5FZ4A 3NM6B 3RKSA 4LPSA 4A15A 1DS6A 5C9AA 3IHLA 2B2XA 1AVTA 3TLEA 3VI4B 4CV3A 1ZCJA 3UV3A 5DDIP 3GGPA 1IHDA 1MVOA 3VPHA 3SC7X 2H4HA 4M9SA 1I4WA 4R01A 3WDMA 4WXMA 5AK5A 1QBGA 5AM2A 2A0YA 1BGWA 2YR0A 2X77A 2HZ7A 3PNOA 1D2QA 4YDQA 3CX7A 3E9EA 1GZ4A 2GJ8A 4EWEA 2WZ8A 1JR3A 1REFA 4AXXA 3PEEA 1WD7A 2O8VA 2D1TA 3FRJA 3HVHA 2YDXA 2JBWA 2XMGA 3JTMA 3PTRB 3G0OA 1EP3B 5G0VA 3OWOA 1W29A 3HKEB 3PDWA 3IOMA 3VO2A 3FD8A 4C1NA 4Z49A 4E46A 2GN1A 4ZO8A 4TWZA 4ND6A 3R7BA 1COWA 3CNQS 5FCDA 3I3OA 4FSDA 1OWNA 4G8JA 3MV01 3C1UA 3BH7A 3CJRA 3GLFB 2QGFA 3GBWA 2HL6A 2VCMA 5JNVA 2C7QA 2XE7A 3R8XA 2DUWA 5KX5B 3W3AD 4G85A 2GKGA 1JHMA 4Y6GB 2QTGA 2ZXUA 1RACA 1UN1A 2A1XA 4FFFA 1QF9A 2CLMB 5IZCA 3N2YA 1D4M1 3GCZA 1TNDA 1CS4C 1MB3A 4TL7A 3NWBA 1GEEA 1XZDA 1VPTA 4GMFA 3VBHC 4PXYA 3QUAA 3ZN6A 2R87A 3AVYA 4IJUA 4ND8A 4WLNA 1WNFA 1Z37A 3OJLA 4G5QA 1DQ1A 4Y4YA 4AHZA 2PGNA 2NSYA 4U2FA 4PLGA 1W36C 4AEDA 3GT7A 2NUPB 3CVJA 2WVJA 4M7WA 1G19A 2VNGA 4YDHB 4R8LA 3ZJVA 4WW0A 1W9FA 4YJDA 1IHUA 1AQLA 1V47A 1NRJB 3R0RA 2ORXA 3LVRE 3AFNA 1TT7A 2ZRNA 3M2TA 3S5UA 4JY7A 3HA7A 4M0HA 3EG9B 4UUPA 5FCCA 1YF3A 3PMEA 2ZM5A 1CNEA 3N8GA 1PZMA 2I2FA 2EEZA 3BKZA 1Q6YA 2B6NA 1AQNA 3G0DA 2IFRA 3JWEA 5HCIA 3U7IA 3Q8EA 4XFDA 2VP3A 3INRA 2QRKA 1C3EA 3OMLA 1Q20A 3I3BA 3GLGA 2MDTA 3R0ZA 4P9XA 1X38A 4R0MA 5FZ7A 4MB6A 2VT2A 3SXUB 3SBXA 2AI2A 2CK3D 4YCMA 5K01A 3RVDA 4D45A 3FE2A 3PUYA 3B9QA 3SX0A 1Z3IX 4OI2A 4CODB 1UPXA 1EJBA 2DR0A 2WKPA 4IHJA 2HWXA 3IC5A 2X1VA 5D3MA 8ATCA 3QE0A 1YHYA 1ZGCA 3FFWA 4S2FA 4RF3A 4JI3B 5T57A 4NCKA 2BF4A 4N4AA 2GYVA 5IBCA 4JLJA 4WDRA 2PUVA 3WGJA 1A4IA 2YDYA 3I6IA 2Q1FA 3RD5A 2Z2SB 4F86A 4MUBA 3UJHA 4QC2A 5EXOA 2O8DA 5BN1A 1J1TA 2WKQA 3VZLA 2GCEA 3O7OA 3I52A 1IQPA 2Q6IA 2J0SA 5IM4F 5FPVA 3E58A 2WNUB 1B3BA 4P83A 2ZWAA 1UJNA 2YZKA 2HOQA 4LGYA 5LDDC 4UD6A 2BONA 3KQNA 4LVUA 2YXLA 4MCIA 2YVLA 4B2YA 2FUG1 3OOYA 4OYLA 3CNBA 1VIMA 4BQQA 4CA9A 4J3JA 1DBSA 3V3KA 2ZE5A 3SQLA 1DV1A 5FFNA 2AS0A 3FMFA 1BZYA 3V80A 1L4UA 2C3PA 1RWNA 3GAMA 4B6RA 1E2DA 5E8RA 4MGIR 3LY5A 4Y0NA 2JKVA 4QKDA 3GOHA 3A1CA 2PMDA 3DLTA 2JICA 2WTXA 3S7TA 1SIWA 4QYSA 4HAYA 4GC5A 2EAUA 2C1FA 3OICA 1OWLA 2W2LA 3R3SA 2NU9B 4A6OA 2ACVA 4AICA 2G0AA 2QF7A 4Q4V1 1FPN3 3R24A 1AV6A 1RAGA 4BP3A 1Y1QA 2EYQA 3CMCO 1UKEA 1MV5A 1RUI1 4Z1MD 2RK4A 1HT3A 1CEYA 4YRZA 1A9YA 3HXKA 4ALLA 4JBIA 4LRUA 2IPMA 4FYHA 1A2BA 3MCVA 4PE5B 5KNCA 2ARAA 3GN2A 5KNLA 4BFZA 1TB4A 2GF2A 2PRJA 3CJXA 3M6VA 3F96A 4PRKA 2J3HA 5I7WA 4F2HA 3OZTA 4TX1A 2WYFA 1EVLA 1R0YA 4OYRA 3R7AA 4CXYA 5ULLA 4AE2A 4FYKA 3AIOA 4FO9A 4K87A 3QFSA 3TQSA 3PXUA 1T9KA 4J7UA 1UPFA 1UQTA 3ANNA 3FRIA 4HAWA 4NFYA 3HKBB 4UEJA 1CEQA 1KU0A 3NMBA 1EAMA 1K06A 4EJFA 3N2EA 2FCUA 2AZ5A 5G05L 4ZQCB 4W5RA 1PQ4A 4Y2YA 4AWXA 3V1KA 2QA5A 5F2SA 3NOQA 3ZHCA 3HACA 1JEEA 1KSFX 4L4SA 4ISRA 3QEOA 4TLFA 5HMLA 1LDYA 2YH2A 1RLIA 1UIJA 4LF9B 1S96A 2P2GA 1ZU4A 4OXKA 5ELXA 5EP2A 4V0QA 4ZAYA 4R8KA 4KVFA 4WZBB 1QGYA 2G5PA 3UA4A 1VRVA 4DINB 2UUCB 4OYUA 1YVRA 4JUAA 3JQGA 4QBGB 2MTBA 1UY0A 4HPKA 2X3YA 3ENQA 2DFNA 2GS9A 1K8ZB 1UM9B 1F9KA 2XDYA 4BNKA 1W03A 3R74A 4BDTA 1NUHA 3R4UA 2DX7A 1GYPA 2R9VA 2WZR1 1CG6A 2WZEA 3M6IA 2MSWA 1LQ2A 2VTXJ 3QMMA 3WGLA 4IRXA 5GJVC 3R0XA 1M34B 1JDTA 2VW1A 4Y2TA 2WDPA 5EZ5A 3MUFA 4FWIB 1V8ZA 5D5QA 2PT9A 1ULFA 3G0HA 2GJAA 1KDKA 5EJGA 3AKDA 5C7LO 2D40A 3GNSA 2EIEA 1PT9A 2ENUA 2C07A 4QWMA 2G1KA 4Q29A 2ZQ5A 1QVRA 4MW1A 2V96A 1G8SA 1RI2A 3LI2A 1UC4B 1U8FO 1YMUA 4J1WA 4LT5A 4NMWA 3RWBA 2HIMA 2ADOA 1PEYA 2DBZA 4EYGA 2HA0A 3O4HA 1PU2A 3I4CA 1OUXA 3SAJA 2R0FA 1Z16A 1ZM1A 2IIVA 2RD2A 4HAVA 2ZW9A 2R6R1 3LY7A 1VCMA 2COKA 1EUZA 2Z6VA 3AHJA 4XWKA 2JGJA 5JSZB 5B7NA 1RAAA 2XKPA 2AWOA 3C5VA 4LZNA 1L8OA 1RM0A 1U5IA 5HQTA 3IPRA 3K2IA 3SBOA 4I3GA 4J2OA 3HKBA 2HWC2 1JW6A 2YU1A 5CH8A 1H9WA 3KDPA 2QNRA 3MUEA 4IIJF 4YVWC 1KJYA 2ZGTA 1WRBA 1E5IA 2QTVB 2ECPA 4HUQA 4N7JA 1H8VA 2II6A 4OHRA 1XTVA 1S7GA 3WDXA 2FK7A 2BJWA 1VLQA 1DRVA 4QT4A 3MPBA 1O1YA 3GEGA 1DZQA 2CJWA 2GM9A 2P77A 3RS9A 4GU5A 4MKRA 2O05A 2HLEA 2IZWA 1Z36A 5BNOB 4D81A 4FTSA 4LTDA 3N2ZB 2F8MA 4H2DA 1FUIA 1VL5A 4IEFB 3NHKA 4ENVA 2JJ2D 4CGYA 5FEUA 4TT3A 5EPEA 1QIHA 2PPLA 1JPJA 4WV3A 3RT7A 2XE4A 4X63A 2BV4A 3SSAA 2PA7A 3EEFA 5IJ9B 5IJ0A 1ZOSA 4IUCS 2P9EA 2B5VA 1XAIA 5CTJA 3WFIA 4B17A 5JZGB 1OXSC 1XDZA 2EKPA 2O1EA 1XJCA 1TTTA 1CN1A 3PU3A 2QQGA 5ICFA 4J0HA 4HNHA 2J4FA 3N70A 3BG5A 4GMGA 4K1LA 1GPYA 3H3FA 4EENA 3R6SA 4LK2A 4WACA 1ABFA 4HQKA 4IEPA 1HQKA 1ICEA 3Q8MA 4OZXA 3U6BA 3BE6A 3IP5A 2GF0A 1T9CA 3F7MA 5J1XA 5IKPA 4D74A 2IVZA 5ALOA 3F6RA 1XE0A 3H0EA 4BZWA 2PJUA 2E37A 1ZRRA 3KVNA 2WNSA 3UMCA 1ODIA 2C4NA 5B58T 3S1SA 2IY8A 2RAUA 2VTEA 4CDXA 2VP9A 1YBHA 5L53A 2YWCA 1M66A 3QBJA 2W46A 1EWKA 4I50A 3CSSA 1SIOA 2I7DA 5HJEA 1XC7A 1UBLS 4PO3X 4O2BA 2RJLA 2PUFA 2HJIA 5LP6C 4IJVA 4AXOA 3LO5A 4LCBA 3UAOA 4M7OA 4QFMA 5I0DA 4KZKA 1ZYUA 3HY6A 1PG0A 2CNNA 2W58A 4EA9A 1Z0JA 3HP4A 3AYXB 2RS33 3T7IA 3ITEA 1XZ8A 3RS7A 3T1VA 3KEGA 3Q11A 1NLUA 3GP3A 2YWRA 2CLSA 2OWEA 2WHQA 4EY6A 3C3DA 3F67A 4HNTA 2CV1A 1RB8G 3PRYA 5DGDA 1PCXA 4ZK6A 2FWBA 2OZPA 4AF7A 3DXZA 2QW0X 2Z1NA 1SC6A 2GT1A 5JXIA 2UYQA 3UG7A 1XNQB 2D2FA 5LLDA 2YIDA 5JT1A 5FRDA 5E6SA 3DZIA 4FGUA 2GK7A 4DCJA 2VHZA 4Y2VA 1FYDA 1UKRA 1W39A 1IWOA 4HRVA 4HPKB 3PQ2A 2OCYC 5DVZA 2D06A 1UQXA 5DLPA 4K6CA 4S24A 4X92A 3DEFA 1KP3A 1DQ6A 1J5EB 3E7WA 1HDZA 1O08A 1TADA 4LXLA 3CX6A 3I59B 3RNOA 3WNDA 3YASA 4JXKA 3UAYA 1XV5A 4NO4A 1LPAB 2O0JA 5H16A 1W6MA 1M1NB 3EGEA 1X80A 4MR7B 3DLCA 4YJGA 1D4M2 4XCQA 1WUKS 1JN2P 4MI1A 4OATA 3DVLA 4HAZA 2AUNA 2MCFA 1MFZA 2JIRA 4TZKA 2PLNA 1R74A 3TTWA 1FV2A 4QAQA 1U12A 2EKQA 2YVAA 3ROPA 1BOFA 3CO0S 3G2OA 2Z09A 1Y6JA 2V97A 3JD4A 4B9AA 4N49A 3UK6A 1PGW2 4FILA 3K6SA 3ZK9A 4ESHA 2QDKA 9ABPA 4EHJA 5A32B 2RK3A 4CM1A 2E4YA 1OQ1A 1JSLA 3LEGA 4UNNA 3QXJA 5J4YA 3OJOA 5LIPA 3KQOA 2ZWOA 4B3CA 4O59O 4CEJA 4JFAA 2IYTA 4HPWA 3ILVA 2X1LA 1TAGA 5J1SB 3ZXDA 2QN7A 3WLIA 1R50A 4AY3A 1O6BA 4DZRA 4LBKA 1X9TA 2NYRA 2BFMA 6LDHA 1DO8A 4GZ5A 4GXQA 4LWPA 4ZN6A 4QBKA 5C18A 1HE4A 3RQIA 5JROA 1AXZA 4ZEOA 4FZVA 1GFZA 3BMCB 2PKQP 4JVNA