5FBZA

Structure of subtilase subhal from bacillus halmapalus - complex with chymotrypsin inhibitor ci2a
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
432
structure length
432
Chain Sequence
DVARGIVKADVAQNNFGLYGQGQIVAVADTGLDTGRNDSSMHEAFRGKITALYALGRTNNANDPNGHGTHVAGSVLGNATNKGMAPQANLVFQSIMDSGGGLGGLPANLQTLFSQAYSAGARIHTNSWGAPVNGAYTTDSRNVDDYVRKNDMTILFAAGNEGPGSGTISAPGTAKNAITVGATENLRPSFGSYADNINHVAQFSSRGPTRDGRIKPDVMAPGTYILSARSSLAPDSSFWANHDSKYAYMGGTSMATPIVAGNVAQLREHFVKNRGVTPKPSLLKAALIAGAADVGLGFPNGNQGWGRVTLDKSLNVAFVNETSPLSTSQKATYSFTAQAGKPLKISLVWSDAPGSTTASLTLVNDLDLVITAPNGTKYVGNDFTAPYDNNWDGRNNVENVFINAPQSGTYTVEVQAYNVPVGPQTFSLAIVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Stabilization of Enzymes by Metal Binding: Structures of Two Alkalophilic Bacillus Subtilases and Analysis of the Second Metal-Binding Site of the Subtilase Family
doi rcsb
source organism Bacillus halmapalus
molecule tags Hydrolase
molecule keywords Enzyme subtilase SubHal from Bacillus halmapalus
total genus 154
structure length 432
sequence length 432
chains with identical sequence C
ec nomenclature ec 3.4.21.14: Transferred entry: 3.4.21.62, 3.4.21.63, 3.4.21.64, 3.4.21.65 and
pdb deposition date 2015-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
A PF04151 PPC Bacterial pre-peptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5fbzA02
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5fbzA01
1S01A 1GA1A 1ZVJA 4M1ZA 1SUEA 1XF1A 2LUWA 5JXJA 3SQOA 2WUWE 3WIUA 1V5IA 1GTL1 3UNXA 1TMGE 3DE1X 4NMXB 1R64A 2HPZA 3DW3X 4FONA 3PRKE 4BWGA 3LPDA 1Y9ZA 4C3VA 1TO2E 2P4EA 1NQDA 3QTLA 1Q5PA 5SICE 4NE7A 2PWBA 5JXHA 2ID4A 2WUVA 2Z2XA 4DJ5X 2WV7A 1JEAA 3DVRX 1CNMA 1GT91 1SCNE 3QFHA 4RYDA 1NDUA 3F49S 1BE8A 2Z56A 4HPKB 5FBZA 3JQXA 4DY5A 3DE3X 1KFUL 1KFXL 1SIBE 2ZRQA 4I0WB 5SV5A 2W2NA 3F7OA 4K8RB 4DZGA 4WOBA 2PRKA 2Z57A 3VSBA 1THMA 4AKSA 5ARBA 3A3PA 1SIUA 5B1EA 1TM5E 3HJRA 4I3GA 1Y34E 1C9MA 3TI7A 3DE0X 3AJ8A 3Q5GA 2GKOA 2W2MA 1SH7A 4Z2AA 2DUJA 3D43A 1CSEE 5AQEA 1ST3A 1TO1E 4ZARA 2HD4A 2ZWOA 3VV3A 1AV7A 1KE2A 1DUIA 1SUPA 4J94A 1GNVA 1SBNE 4MZDA 1KDVA 1Y3DE 5I9SA 3ZXXA 2X8JB 1AQNA 3H42B 1SBIA 4HPKA 3DVSX 1YJCA 3BX1A 5JXIA 3GT3A 1SUAA 1P7VA 1PEKE 3PTLA 4NE9A 1Y3CE 1KDZA 4DWWA 1HT3A 1SCBA 1Y3FE 1Y4DE 2XVGA 1IAVA 3I34X 3DWEX 1C3LA 4CFYA 3VV2A 1AVTA 4DZTA 3EE6A 2PWAA 3DE5X 1P7WA 1TK2A 1WMFA 2ZWPA 1WMEA 3QMPA 4CG0A 1MEEA 3OSZA 4GI3A 2W2PA 1MPTA 3L1KA 4YN3A 1GA6A 2ST1A 2X8JA 1T1EA 2G4VA 2W2QA 2ID8A 3GT4A 3EIFA 1Y4AE 5K7SA 3WQBA 3WIVA 1QXPA 2SBTA 2V8BA 2XRMA 4C3UA 2Z30A 1KDYA 1SCDA 3F7MA 3DYBA 1Y1KE 1YJBA 1BFKA 3CNQS 3AFGA 1GTJ1 4CFZA 2E1PA 1EGQA 2SICE 1SIOA 1GA4A 2B6NA 5AVJA 3DE7X 3I2YX 3A3NA 3DDZX 1VSBA 1SVNA 4ZOQI 4JP8A 5FAXA 1V6CA 3DF0A 2PYZA 1BFUA 1BE6A 1NQJA 1T1IA 1NDQA 1DF0A 3EDYA 4B5LA 5JMOA 1R0RE 1AU9A 1A2QA 3WHIA 1GTG1 2XVLA 1U5IA 1C9JA 1TM7E 3P5BA 1UBNA 3AJ9A 1TECE 2TECE 1AF4A 1SELA 2QTWB 3GCXA 2W2OA 2PMWB 3DE2X 2O8OA 3DW1X 3GCWA 2IY9A 1PJ8A 1GNSA 1YU6A 4H6VA 3BGOS 4H6XA 4DXZA 1BH6A 4AKTA 4H6WA 1TM1E 3TI9A 1WSDA 3BPSA 1WMDA 3I37X 3I30X 2Z2ZA 2PKCA 4HVLA 1YJAA 1OYVA 1S02A 1TM4E 4KG7A 1SCAA 5ARDA 1ZVKA 1SUBA 3TECE 4KB5A 2DQKA 3D9QX 5B1DA 3DVQX 5CW1A 1GCIA 1SBTA 1OT5A 5JXGA 1BJRE 5AMXA 1OYOA 1C9NA 1SCJA 2XVKA 3VTAA 3VYVA 2XTJA 1WVMA 4HX2A 5ARCA 1SUCA 2Z58A 3VHQA 3LPCA 3ZXYA 1SN7A 1Y48E 3CO0S 2IXTA 1T1GA 2QFEA 1PFGA 3A3OA 3Q40A 3LPAA 1DBIA 4DY3A 1Y33E 1SUDA 1P8JA 4LVNA 1AK9A 1TM3E 4G9SB 4OMDA 4LVOA 1PTKA 1SBHA 2PQ2A 1EA7A 3JQWA 1LW6E 1R6VA 3T41A 4OMCA 2SNIE 1Y3BE 2WWTA 1AH2A 1NLUA 3DE6X 3BOWA 4WOCA 1ST2A 1KE1A 4KPGA 1S2NA 3LXUX 1SPBS 2DP4E 2Z2YA 2SECE 1IC6A 3SICE 4OV6B 5AVKA 3DE4X 5FFNA 1SBCA
chains in the Genus database with same CATH superfamily
4P3KA 2QE6A 3E61A 8OHMA 3EEYA 2P6UA 1CAXA 2JGFA 2PL1A 2OCIA 1MEC2 1ESEA 3SFZA 4B1MA 4XYEA 4ZKTB 1SMKA 3TZ6A 2DHCA 5KNDH 3U1XA 3H83A 3ZCXA 3CSSA 4M7PA 1ZK3A 5IF3A 3E5XA 4C88A 3T1VA 4B6SA 3DFMA 4RVSA 1I7LA 4FD2A 4ZI7B 5FWEA 1UBFA 2RJKA 1KQFA 3QLTA 2DWCA 3TL6A 1SXJD 4RESA 3ZCRA 2NVUB 3LKVA 4I4TF 4IFTA 4Q02A 1SIBE 5KC8A 3EA4A 5I9IA 1SC6A 4RIEA 5IYZA 1LTEA 2PO7A 4J3NA 3JBG2 4RSHA 1ZM3A 3A6KA 4UBKA 1PTJC 1C9MA 3K70C 3BKWA 3KXKA 1UOFA 1FRQA 4BX0A 1UFVA 3T4UA 3SVTA 1PQ4A 3O2QB 4D8UA 5GVSA 5CG2A 4FSDA 2DKOA 3RC8A 2QN8A 4IMJB 5I7HA 4BWFB 3E2PA 4UW3A 4W5WA 1JJAA 1MZ6A 5ILGA 3BGVA 4OB8A 2PNFA 3V34A 2GD2A 3MEPA 2Z1NA 2QNBA 1KZ9A 4DN6A 3BSWA 1PGW1 5E6UB 4X24A 4CDMA 3FMFA 4IYRA 1Q3HA 2OP0A 1NG9A 2QQKA 4W1PA 1SBEA 2R1ZA 1O6FA 1VL1A 3ER6A 2PXXA 1CD5A 5AK3A 4LZWA 3BN6A 3F67A 1N5DA 4AXOA 4QQRA 3RSOA 1HB2A 2E4AA 3EZ2A 2J4CA 3SK0A 3AFNA 4ZDJA 2ZBQA 4QX2A 2ZXQA 1FP4B 2IUFA 2JFBA 1GYRA 2J3IA 4B2LA 3QH7A 4R8RA 2C42A 1Z45A 4R2WA 5FY5A 4KXYA 2GN6A 3ESCA 1NW4A 3AEUA 1NRXA 5DYYA 1LWNA 1Y7BA 1IOVA 5EUCA 6LDHA 1N3QA 1FP1D 4OXYA 2QTTA 3S99A 1OKKD 2ZGNA 2QZSA 2ALJA 1BYIA 5L9BA 2VJDA 5JASA 1J1IA 4QAJA 4TKUA 4LFAB 1O3QA 1JR6A 2BMFA 3RTEA 3A6JA 3C5CA 3LYLA 3R76A 1RQGA 3OHPA 3SE7A 1XU2A 4ZOCA 1O8SA 3JQQA 4YRPA 3NJZA 5J5AA 3OU7A 4C90A 2AKYA 4R54A 4UMFA 1IE3A 3EHDA 4D44A 1SCUA 2VPVA 3P20A 4IDQA 5BV7A 3T9CA 4EENA 5EJZB 2NZ2A 1RMYA 4ZOEA 2QMHA 5LDDC 1GAJA 2V7QA 2QJTA 3N35A 3VD9A 3LI2A 1N47A 4KV9A 3WNXA 1K8QA 4XQDA 4TXWA 1RUOA 3BPSA 1Z63A 2FMUA 4BZQA 2GNTA 4PIMA 3PNMA 2FCUA 2YZNA 4QXCA 1EFPB 4S1VA 1E6KA 4CQNA 5CISA 3I3QA 1UMHA 4FZJA 1QHHB 2BFCB 1CWUA 2CSUA 4BMOB 3PP8A 4BO1A 1LHNA 4DRVA 5TT0A 3W5AA 1GDTA 3ZHOA 3FWPA 1NW6A 3R6WA 1AVBA 4ZVRA 3NBMA 5LP6F 1L8XA 1T6NA 5BO5A 3NT2A 1ZREA 1REDA 1CX9B 4XRRA 4KN6A 4XQWA 2WOJA 5I4KA 1FYUA 1RQPA 3QITA 3RK4A 2PL9A 4DSNA 2FQYA 1GPJA 1VLHA 3ZO0B 3CZ9A 3RYIA 5DLDA 3OD4A 2ZKIA 4AWBA 5I45A 1S0IA 4A9AA 4XBLA 2WSMA 2Y26A 1RMU1 2BIFA 1AK9A 3AUJB 1YQ6A 1D5CA 3E7FA 4M4PA 1L4NA 3HYLA 4JLMA 2CKDA 2CDAA 4LJLA 3KSZO 1PVOA 2YY5A 3DVLA 3OEED 2CYAA 3OLWA 3L40A 3UCFA 3KALA 3M4JA 4HFRA 1V6MA 2CTVA 3RTBA 3OMLA 1DZTA 3QELB 2HUPA 4FYWA 2OCKA 5ALNA 4I1VA 1OGYA 4NENB 4B6PA 5K3BA 3IAEA 1DZ3A 3HJCA 4UTPA 4N7BA 4ALMA 3CX7A 3QWHA 2VUAA 4NBUA 2FSIA 3C70A 4U7FA 2ZGQA 2QIOA 4A1FA 3T94A 2W87A 1DLCA 5CU7A 4OMFG 1ZJ6A 2DUUA 3GRFA 1U0LA 4QRHA 1RM3A 4A7PA 1V6OA 5DLEA 3UGHA 2PWBA 1QIHA 1ND3B 3OQ1A 3BI3A 4HAYA 3RZGA 3CLSC 1O3SA 4D4KA 1E2QA 2QSJA 2PV7A 3QUQA 2QL9A 4GB32 1H4QA 2W70A 5DU2A 5E9JA 1IPJA 1UF2C 4NCNA 4YGDA 3N87A 2VOEA 4D0NA 4KQJA 3HBJA 3UPUA 2CNKA 3GC6A 3RHFA 1QYRA 1KJ9A 3M6VA 3SJCA 1TCVA 2QN9A 1YBAA 3PQFA 5KCMA 4YACA 4TTVA 4HLDA 3GA5A 4LTNA 4HDMA 4DAEA 4FXKB 1GYPA 2O57A 1EE2A 1Z0SA 4B6JA 4BFZA 3SR3A 2F3SA 4YALA 5CVJA 2O8VA 3DTVB 3TOSA 3K1ZA 4LHXA 5LBBA 1UBKS 3UTCA 3QKIA 3R0VA 4OLJA 1ZM4A 1JIJA 2ZI5A 2ZSKA 1NF9A 4XLZA 4MKRA 4BVEA 5KC9A 1XKTA 5K45A 1F31A 2ETXA 4KX5A 1OLRA 2A84A 4L78A 5CNJA 2FPGA 4YAWA 2D44A 3RI9A 4LXGA 1OSNA 4YPFA 4A8JB 1PO7A 1YQTA 3HWSA 3HN7A 5FWJA 1UOJA 2DC1A 4W1QA 1XZEA 3K32A 4DEXA 1EJBA 2VNRA 5FZLA 4RVCA 1VIWB 4FXGB 1HRV3 5DDJ3 4PCAA 4ILEA 3ZUPA 2EL7A 2JL1A 1P81A 1U5AA 3ZXGA 4W7HA 4JL6A 4MQFB 1MPTA 3BWYA 2HV9A 2Q6KA 1OLUA 1RTTA 1EXDA 4XWTA 1PT6A 5SZKB 4RFSA 1P0FA 4RGVA 3FVQA 2ZEWA 2ORXA 1DKMA 5B2GB 1SQ6A 3UMRA 1EUTA 4JUBA 2XMPA 5IZCA 2R6JA 4CEJB 1JSCA 4F4UA 1T4GA 4FTBA 4OLLA 3WG9A 3UV7A 3AU9A 4K1XA 3QKRB 2QKDA 3ZD6A 2QRPA 4XD7A 3SIWA 3I52A 2ZOSA 2LW8A 3PHGA 1V41E 3WMRA 2DPYA 2G1UA 1L1FA 1KJNA 2C5GA 1TUIA 1NWCA 5FWYB 4OQLA 1AL21 4JSYA 4S2HA 4BYMA 3IH5A 2PQ6A 2QL5A 1U3VA 4ZT7A 1ZPDA 1W04A 4BPZA 1ILWA 4J1XA 2XR4A 4OLHA 2PAKA 2FVYA 2H1WA 4JJIA 2XUZA 1QHXA 3H13A 3EAQA 1QVVA 5K3FB 5FUXA 5I9LA 1Y1PA 1R9MA 2FDGA 3GX1A 1GAXA 3MRVA 2HI0A 4I3HA 5EMMA 5KNCA 1KWKA 4L7VA 3OOSA 4OTZA 3OPYB 3T8YA 1RAEA 4R6XA 4IDCA 1CQJA 2W0MA 1OAAA 3QFTA 2KBEA 5HRUA 3FCUB 4L8GA 1HDGO 1ZK0A 1I7PA 3LGAA 4YGYA 3L2HA 5HQJA 3RVMA 4PS1A 1PZGA 3BRSA 2OKXA 4NS1A 1ASJ2 3BWDD 1YQEA 2XOKA 1S5PA 5I7UA 3FX2A 3IPAA 4EVRA 3QU9A 1UBRS 1V35A 4D3DA 5DYIA 4C4YA 1TD1A 1Z73A 2C3PA 3O7MA 3ZXYA 2APJA 4UU1A 5I7VA 5FAKA 3Q3IA 4JI0B 2F43A 2AZ5A 5LWHA 1GPMA 1A9PA 3ETEA 3A3OA 4IGIA 2X0IA 3K0CA 2ZSBA 4N90A 2ES3A 4UDYX 1UU6A 3SSOA 2YRWA 4PYNA 3GGSA 3K2QA 4TSFA 2FUG6 3G0GA 3H04A 3VBFB 5CB4A 1J3QA 3QVUA 1QYVA 4N53C 1WA5A 5TVKA 4XDHA 2X23A 1PM7A 3JQWA 3T5PA 3G5AA 2QVBA 5TPZA 2HJ9A 4X5OA 3DXZA 3MGUA 1YQ5A 1W52X 5A03A 4MV2A 1NVAA 1N6LA 5KWRA 4RXUA 1PK6A 5LOVF 2DP4E 1YDWA 3GN1A 3CZ4A 5KTRA 1OWMA 4IDDA 4LDAA 5A6XA 1PR3A 2BYVE 1QO7A 2W48A 2EV9A 4V2VA 1QUEA 1NYRA 1YD7A 2ZBPA 3KGZA 1VE1A 1CY4A 2HRCA 5AKKA 1FZQA 1ADYA 4PPNA 3WP5A 3JBG1 3E05A 3TMKA 4NU5A 5I47A 1TU3A 1BJQA 3R9WA 4KQCA 5INTA 3TYXA 3TLGA 1NXTA 2ZBGA 4FUTA 2JJMA 3VBRA 5IJZA 4GX1A 4BY9E 2YASA 5K0UB 3JWEA 3SCGA 3UYJA 5HSGA 4YVWA 2VJMA 3EBOA 5LN1A 1GNHA 4I2VA 3SXUA 2ZWIA 3KT3A 3KNZA 3GLGB 2H63A 1VE9A 1GQRA 1E7SA 3L8EA 3DTTA 1QHIA 2Y34A 4FX2A 4YW6A 4JKOA 2IIBA 2VBDA 1YXWA 3HJRA 3DDHA 3ON7A 3BU0A 3ZDRA 4UULA 1O87A 5IK2A 3IUEA 2YXPX 2R7EB 1W0PA 1R8SA 2HREA 3A1EA 4F85A 2NGRA 4RLHA 3HVKA 1ZSYA 4DJJA 2Q7DA 2CU5A 4WASA 5F2SA 3CEPB 3EN0A 3V48A 2D2IA 3W8FA 4V0LA 3QHAA 2H4YA 5IW8A 4C91A 1E79A 2HM7A 1IL0A 4LKOA 3RFTA 2I7CA 2JCGA 3NIGB 5L95A 3CUEF 2B1JA 1WEHA 3NYWA 1CDOA 3FOWA 1N9GB 4JC8A 2VNOA 3UAYA 2AGVA 1NVMB 1R9GA 1GQQA 1OOEA 2QM7A 5I93A 2P41A 3SVZA 2Y6LA 1VJTA 1D0GA 3NG1A 5EKDA 3DWFA 4QJ4A 3E9RA 2RIPA 2ZMKA 3MUEA 3H7AA 3TTYA 3P4UA 4KREA 4Y1YA 2PANA 2BFUL 3V8RA 4K6BA 2C77A 4FK8A 3DZKA 4LZZA 2Y99A 1ZJZA 2JAHA 1CEQA 1AL23 3B5EA 1E4EB 3KD2A 3AERA 3QLEA 4ZC8A 3VD5A 2ODBA 5HDBB 3GZ4A 1XQWA 2ADOA 3TXAA 4XYMA 1AHPA 2ODPA 4ZT2A 1N5IA 3RUHA 2VXCA 1E3MA 4BP3A 3GXBA 3I1JA 2O52A 5FYBA 4YG3A 1H2RS 3GHNA 4K9SA 4MW5A 3QSYA 3ZE7A 5F1YA 3DF0A 4CR7A 4LWQA 4QBGB 1W73A 3ETDA 2EKPA 1Q1ZA 2XA2A 1TVKB 3RE1A 1H6AA 2QT9A 4MWDA 3ELWA 2B7CA 4GL4A 2EJUA 3AMPA 1PBTA 4AYWA 3SDSA 4YMVA 5E4TA 1RI3A 3JATB 2P6RA 3LP5A 4XCAA 4PAOA 1RADA 1T0HB 1BHGA 1QVAA 2HK7A 1X7GA 1CR6A 2ZJ3A 3IALA 4H6VA 3N2GA 4JN6B 4YZ1A 3HCDA 3AOEC 3EG5A 3ITQA 3KJHA 3VNSA 4AECA 2J42A 1LHUA 5F32A 4B31A 2BHLA 4DQXA 2WD8A 3EH1A 1DCFA 3G2IA 3KJEA 3IJRA 4BJ6A 3M70A 2OHHA 4YJ2B 2H9AA 2FZKA 4Q1AA 2REQB 4AS2A 1JZQA 3V2UA 1YB2A 4B44A 1CQXA 1SXQA 1NUTA 4QX7A 3WRXC 3EYAA 2FE1A 4FCTA 4I3FA 2FZ4A 2ZIXA 2D3PA 1FV2A 4ZEVA 3I1FA 3TQIA 3KDSE 2N1MA 4E3ZA 4YSFA 3VHQA 5FXWA 2UXCB 1P2SA 2IYSA 2HWB3 1NNUA 4B6EA 3QTTA 4IWXA 4KFTA 4DNFA 5JG7A 3WG1A 3EK2A 2QP3A 3PJRA 3JD1A 1CQIA 2OD7A 4DA9A 2OT3B 2OB2A 4L97A 3RBZA 4H7HA 5I8WA 1YQCA 2IZ5A 2QE7D 1E4OA 4LK2A 3P2EA 1GHTA 5I4CA 5EE9A 3JD73 3JSAA 2EKBA 3VKLA 1SBHA 1TMYA 4H1HA 4BNJA 3W4JA 1C3OB 2J6IA 3N5KA 1VTKA 3S68A 1ATZA 4NCJA 2WILA 3P3PA 1YQDA 4OHFA 3I5UA 4IQ8A 1YS6A 2B30A 3K1AB 1H2FA 1ST2A 5GJBA 1UFOA 1DBPA 1L7AA 4P9WA 2CGOA 2A1IA 4B3TB 4JBGA 2QEQA 4I7EA 2F4VB 5JRJA 3I2HA 1GKBA 4ZV7A 1QF9A 3DHNA 4BM8A 1N5MA 3MHTA 2I3AA 1GVHA 1V43A 1SXIA 2B1IA 2J67A 1GZUA 4FPFA 3LBYA 1TMOA 4IV1A 4S2EA 1M33A 5KC6A 2WDBA 2ZGSA 1TMKA 2LUOA 1VMKA 3ER8A 5DCWA 4IIEA 5IT9A 2H0QA 4XIOA 1ELOA 1ZU4A 3VL8A 3ET5A 5F5XA 5TQ2B 3K51A 1PU2A 1MAAA 3ZCSA 2FR8A 3RARA 4FE3A 5KYWB 4LR4A 1P1KA 1ZXBA 1UMDB 3SXWA 1QV6A 3PGXA 1KS4A 2LRHA 2X0JA 4OQEA 1VKJA 2O3TA 4R2MA 1HPLA 4M1SA 4OA5A 3PJDA 2QTGA 3MW8A 2Z2SB 2A7QA 2VDWB 3DTYA 1Z0KA 1RUE3 5NULA 3GROA 3HNRA 4CCCA 3GAAA 3V4VB 1GGMA 5LLSA 2Q5JA 3JQFC 2GNMA 4UM5A 3GGGA 1NIJA 2F3TA 4FINA 4DIQA 2PJRA 3PSHA 2HNAA 1W0KD 1NP6A 2Z4FA 3A21A 1UWVA 4I1SA 1C0EA 1FQWA 3FR7A 3S29A 2YFZA 3LWZA 3OTHA 1DINA 1TVGA 1POXA 2W5FA 1XZ8A 1JYVA 5ALUA 3GU3A 1YCHA 1VHQA 4LXLA 4F8YA 4QPIB 4L8QA 3ZWKA 2BTEA 3BIWE 3EGEA 3UK1A 4MXWA 4FFIA 4AIIA 4DB5A 1KC3A 5FNVB 5B55A 2AB0A 1J97A 1G6NA 3IOYA 3VZRA 4OEHA 5F51A 4V1CA 4ARCA 4RM3A 3DCYA 4M76B 2A5GA 2IU0A 1ZQ1A 4TV8B 2WA3A 4GI3A 4Y24A 1PZ9A 3WK5A 3E6CC 2CGNA 3ECCA 1RYZA 1WKVA 5BNTA 2IDMA 4RIGA 4XF3A 1BVVA 1HX7A 1A5SB 4HWRA 1CC1S 2WC2A 3PTYA 1BKSB 2HRQA 3A2KA 5LIPA 2PZEA 3KR9A 3LLUA 1XOYA 1BS2A 2EZ4A 5I7EA 2E1PA 1BMTA 5IVJA 3TZKA 4BU1A 4JVAA 3SCHA 2P78A 2IUUA 3DDZX 3UUGA 4ZZ8A 2JJ1D 2AD1A 4C2TA 5HXMA 4DA8A 5ENDA 1NX6A 2QG9A 1GKUB 4OXIA 5L7TA 1UYPA 3CH5A 3EXG2 3CRNA 4P7GA 4NHOA 2NTVA 5G02A 4UF0B 5K8SA 2EP5A 4XQ0A 2XBUA 5LP6C 1QDLB 2CJWB 1QOPB 3VD7A 1VB5A 5JZGB 4RD2A 1VBE3 1URPA 5TF4A 3EWAA 3IC5A 5EJ5A 1G0NA 3ZBTA 3CR8A 4MRAA 2WZBA 2V0GA 2PH3A 3SBDA 3WGNA 4YRNA 2YCLA 3AI7A 2XZLA 2XRFA 2UZ4A 1IHDA 3LCPA 4CLDA 5FLKA 3LQFA 5B3JC 4B2YA 2XR1A 4LZLA 1T0UA 1H9BA 1AQYA 4EN7B 3OPVA 1MS4A 4XF0A 1YUDA 4HF7A 1JI3A 1JVSA 4U2EA 4Q8LA 4GLLA 4ZA2A 2O1XA 3ETGA 1AKTA 3G17A 2JA2A 1TB4A 3GGJA 3NEPX 3N39C 1TLTA 5FCDA 5F5AA 1R6BX 5DLQC 2D62A 5FPAA 3PFKA 2HRRA 1UAGA 4KFRA 4RK0A 1Z15A 1GV1A 1OIVA 1B6GA 1R2QA 3W6ZA 4COVA 5ALRA 1EFVA 4Z0HO 4IVPA 5C9AB 1XAGA 2Y0PA 1FS6A 3W5MA 3M3CA 3FWZA 4B7UA 2HXYA 3VR4H 3OTIA 2XYVA 4A73A 1FFYA 3ZCQA 4EWEA 1ZOIA 1MS5A 1L4BA 4X8PA 1VJ5A 2JDMA 2XQKA 4WPGA 1D8AA 3ZWCA 5CW2A 3GLFB 4XQGA 2VYNA 4MRPA 1M2OA 1UX6A 4V0OA 1SQSA 2RBGA 2RHLA 2E87A 4BKUA 2OLEA 5CA0F 4D0SA 4ATNA 1EVJA 3TN93 4WJLA 4BIMA 1SR8A 4IJMA 4CKWB 5LBIA 4K8FA 5ALXA 3BODA 1HF3A 3AIMA 4OHVA 3PRKE 5KNCD 1V8ZA 2PBRA 1X39A 2VAUA 3C3XA 1EJ0A 1M4WA 2PTHA 1UD1A 1AHIA 1XE0A 1JQAA 3NJXA 2R7NA 3JATA 4Y6GB 4GB33 4CCKA 2BI7A 1REQA 2X7XA 2IJGX 3FFAA 4FBGA 3O1IC 4AXBA 1NU6A 1CS0B 1CRQA 2XCSB 5JBIA 1I2CA 1D0VA 4KVAA 3HYRA 4U7GA 5BV8A 2BYTA 1SFYA 4XSGA 3N7UA 3O4HA 4QU0A 5BOSB 4YFYA 1QTQA 3OA2A 5CBLA 1PYDA 5A6ZA 2VZEA 1SXPA 5FV4A 2IIPA 4U8GA 2CT8A 3JD0A 5CFQA 2ZATA 2XTMA 1D1SA 4FYIA 5KVQA 3GQBB 4ZONA 4JJ8A 3LEKA 1EK0A 5ALPA 3JYLA 4B7AA 4GOOD 1CR1A 4JDMA 4Y2UA 3N05A 3N8HA 3SJAA 1E2LA 3GCGA 2EL9A 1JTZX 1JDSA 4LNUB 5KJFA 2A73B 1UAAA 4LN1A 2XITA 4X94A 3TTXA 4JBWA 5HE8A 4Q16A 1G21A 4HZUA 2PKQO 1KEWA 3HEBA 1O77A 4FHDA 2B2CA 1UYYA 4CF3A 2TBVA 1WW4A 5C7GA 4RLQA 1GAEO 1W5TA 5AHWA 4JLKA 4CCLA 2ZJ2A 2HH9A 1RWWA 4CP9A 2RC5A 4GWKA 5JV5A 4CL0A 1HLFA 2DUPA 1TUGA 4AJPA 1WBFA 1XZLA 1ZMBA 4M1KA 2JE8A 4OXRA 4PG6A 2N0SA 2OXRA 5CCDA 2DQ4A 5CYGA 3O03A 3WIVA 1UCXA 1QYXA 2P2GA 4TOIA 4YT5A 1WLWA 2VP2A 1XD2B 1U5BA 1KQGA 2PUTA 4EFMA 4N48A 3GALA 2VVTA 4YMIA 4QGGA 3EBRA 4GBJA 1WA4A 3MHPA 1JIIA 4E08A 5E7MA 1RI4A 3TQHA 4PW0A 2RJNA 5GIOE 1LK5A 1UPUA 2DBRA 3R4CA 2AOTA 4C43A 3RTAA 2IEBA 4QBKA 2ZWVA 3JTMA 3U4IA 3P9IA 1TEZA 2YJZA 3C3VA 5F2NA 4J25A 1R1A3 2XOKD 3S30A 1XZDA 3CZCA 3QNWA 5G4KA 3PQ6A 3FMOB 1TM7E 2JIBA 3V0BB 2IYEA 2WT9A 5IWFA 2DX7A 1TNDA 2XMLA 3UHPA 4UJ5A 3DZIA 3FLPA 4X6RB 2ETVA 5UKDA 3AY6A 1P39A 5F33A 1SHJA 1A2KC 2Q6LA 1XXNA 5FH9A 5EUBA 4AL4A 4RNCA 4PC7A 1OQEA 4LHKA 3TR6A 4BPBA 2RKOA 3QOYA 3PD1A 3LVRE 2F6BA 2VPPA 1IONA 3JQ7A 4X41A 3UHFA 2ZBDA 1CY1A 4UM9D 5A06A 1BJKA 2KM1A 4OP3A 4NOMA 4LITA 5C5CA 1TJYA 4HWPA 4EZBA 2PLAA 3FN9A 2MPFA 4QOGA 1FW8A 4XSVA 5JI3E 3HADA 4MO3M 5SZIA 3ZWOA 5L51A 2Z5VA 4B7XA 4QUBA 1RWQA 1XQ6A 4IQPA 3ORFA 5JNSA 2R7AA 5TMBA 4TYWA 3HM2A 4K6CA 1DBIA 4V0NA 3JU3A 1Y33E 2OEPA 5EI5A 4HS4A 1ZM1A 3SBOA 3G2OA 3AZOA 4ISRA 3QF4B 1GLHA 4AHXA 2ORIA 4KTVE 5AKYA 3OZEA 3ICQB 1YJKA 3VBHB 3RS5A 2AOWA 1MIHA 1PF7E 4P8RA 3W3ZB 3QVMA 2SNIE 4R41A 1JFTA 3ND5A 4Z82A 2LROA 2JIRA 3ZFFB 1JGTA 4KQWA 2MHCA 2E4XA 4YWAA 3EA0A 2B1GA 1E1LA 4LRSB 4DSZA 3MJHA 1M6WA 1X19A 4AAPA 1QJU3 2EWMA 4H77A 1G9TA 1CJCA 5BQFA 3R44A 1RFGE 1UAIA 3KQHA 4JHZA 1XEXA 5AT1A 5A33A 4NARA 3W5HA 1X80B 3TBFA 2IYRA 1JBKA 4H7EA 3WW3A 4BWGA 3F47A 3NPAA 1EUZA 1K08A 4TGLA 3O0WA 1AHHA 4PU0A 5M0TA 1EUDA 1XVIA 3H17A 3HU3A 4RFLA 3OOHA 3R7AA 3M4YA 2DBIA 4HKTA 2XG3A 1NMZA 1VALA 1D7OA 3DBIA 5FFMA 3ZKUA 1ZZGA 3HJNA 1GDHA 2HA3A 2XKJE 3ZV4A 1WAMA 3D3AA 1QYIA 4DG5A 1K7SN 3O8LA 3A9VA 1O4WA 3UKDA 5DULA 1UOGA 1EQAA 2ENUA 3DLPX 1FX5A 2X3UA 4XJXA 1E94E 4RTOA 4MQ4A 4URAA 5KOIA 2GEBA 4FT8A 4GMFA 1ZA2A 5AVVA 1E61A 5B64A 1T5TA 1TD9A 4EUKA 3CFYA 4BOWA 2CBGA 1ND2C 3A36A 1EDDA 4QOHA 3ZYPA 4RZSA 4YP7A 3S8EA 2FSPA 1SKYB 2I6UA 2GEDA 2YVLA 3A0UA 2GOYA 5JUVA 3K4QA 4BLPA 1JI6A 1XRUA 4N5LA 2D1RA 2R9VA 1JHOA 3ZVKA 4FIDA 1L7MA 4FAHA 3D8UA 4WXHA 5CEHA 2ZFUA 2VQSA 3SM9A 821PA 4HT1T 3VPBA 3PUAA 1JHRA 4QECA 2JGNA 2C1ZA 2VTEA 4U2KA 4F2PA 5JVDF 4Q7KA 4Y22A 4J1NA 3WE7A 3KUXA 3HPQA 5BSRA 1UPAA 2Q8DA 1Z2AA 4NSNA 2XBO3 4W6ZA 3W79A 5T6MA 4HHEA 4KXQA 4OAOA 4MTCA 2V65A 1XC7A 2PAEA 3IOBA 3K2EA 3H1GA 5JPNB 1HXHA 2QGZA 1GAQA 5GPBA 4KQGA 2YDEA 4RADA 4EK9A 3FZNA 2FZWA 4CM5A 4XPIA 1ISSA 2HNBA 1L4UA 5IKEA 2A7XA 3RIYA 3HFJA 2JANA 1ZC3A 4YN3A 3FCXA 3T7DA 3DGEC 1E6UA 1SUFA 1P9OA 3EDRA 1J23A 4PYQA 1E5HA 2AW5A 4IEFB 5H8WA 2CMFA 5PGMA 1QWRA 1ECJA 3VU8A 1V11B 3VKMA 1I13A 1NUSA 2WSSA 1GM5A 1W1UA 3AR5A 4JRAA 1XJ5A 4C6HA 3RFXA 4PX5A 1E9EA 3GLSA 4RVNA 1JDNA 4Y9UA 4LXIA 3PDJA 1QNWA 5T8KA 1D2CA 3CNAA 1UBMS 1CT9A 4YNBA 4DMRA 1RRMA 2W2KA 1JH5A 2RK6A 2P8JA 3UK9A 3H3LA 3NRJA 4HD8A 2OHFA 4PM4A 3VBHC 2VTFA 1UBNA 3H2ZA 4CRQA 1DQRA 5DHTA 3HXTA 1OI7A 4K21A 3KX2A 2CGPA 1D07A 4QUDA 1DQ2A 1NRWA 2GPWA 1Z4NA 4IEWA 3MF9A 4RJ2A 3SSAA 4E2XA 3ZVNA 5FNVA 3S2FA 4QLBA 2I1VB 3TQOA 4EX7A 1CLEA 2HBQA 3KTOA 4GMP0 4IF6A 3A4YA 2HL6A 3KTDA 2KXLA 3EG9A 4HYQA 4BQPA 1WTAA 1G20E 3RLFA 3O73A 1Q1EA 1TT7A 1A1VA 5BWNA 1AB6A 3JARB 1DYPA 4B82A 3ZM8A 2L18A 3PVOA 2O05A 4TWIA 4U2GA 4DR2B 3L8MA 4IIJF 3SNHA 3OQJA 2WU8A 2J3KA 5JS6A 2IS2A 5FZOA 3B1WA 5CXUA 5KYGA 4TL7A 5AVOA 2PVPA 2MEV3 4MYRA 1ADGA 3ROZA 1YHZA 3KYDB 4BYGA 2EVWX 2XB4A 4G9SB 4E0BA 4E7OA 1CX4A 3FZYA 3N58A 1NG1A 2ZE6A 5DHFA 1K8XB 1BXZA 5CG9A 3HO8A 4FT2A 2VNHA 1XTUA 1E60A 5GIPE 1FFSA 4PDWB 3LUGA 1G98A 3I9LA 3AEUB 4LUCA 2WT0A 1RQ2A 4TZKA 4NN0A 3R9XB 1B73A 4G4GA 3THRA 4QA9A 1JECA 4YDHB 1WG8A 4LXQA 2QQNA 4XUPA 3WMWA 5KSPA 1Y1QA 1NOVA 4B75A 1DO8A 1ZCZA 1PR4A 3KB2A 3GNQA 1OOPB 1JYNA 2EC5A 4BBPA 4N5NA 2E31A 1RBYA 4J43A 1SZPA 5FOWA 3PJFA 8GPBA 4F7WA 2GC0A 2ZVJA 2IUSA 4JV5B 3GELA 2DFCA 3ZWNA 1G18A 3KSBC 3TSOA 2HCBA 1P1FA 3KSDO 3A1CA 3E84A 1X7XA 2VHQA 3VU9B 2AEZA 4KWHA 1MO6A 1HG1A 1WCIB 5KWEA 5FKJA 4LRUA 2WV7A 2DBVO 3RK1A 4E7PA 1XELA 3NV9A 3Q0IA 3GFRA 4Z3KA 4YXWA 4NWIA 4JHXA 3K9CA 4LECA 3D0JA 1DQNA 3NORA 1WPGA 5SV5A 2E9SA 4GQBA 2OGSA 4WCFC 2Z57A 2ZRDA 2FGKA 3AM5A 3UBTA 1JYCA 2A3RA 2C54A 4HPJB 3FPFA 1W34A 4PINA 5CVRA 2P3OA 2CL2A 2RGCA 4X60A 1I1OA 3NTUA 2WTNA 1EAYA 3T3GA 1DEKA 4DL9A 1TQ6A 2XE8A 2DJ5A 1PR1A 1GL6A 3T52A 4RDCA 2IYVA 3QEKA 1Z34A 4L7QA 5EKSA 5KHIA 3SHFA 5DDJ1 3A58B 4RM2A 4UTRA 4YMTA 1Y3DE 2H7VA 3WLKX 4HDCA 1NVDA 2EIGA 1PGSA 3S5JA 2NTNA 4META 4DDMA 5ITWA 4ZK6A 3ECSA 1CZOA 1RUC3 3V8PA 1MS3A 1BQEA 2XJQA 1Z5OA 3LVFO 5JYBA 4JS0A 2D0OB 1EWYA 2BFWA 3D0KA 5A1AA 5AI5A 1T9ZA 3GG9A 3FTEA 4ZYLA 2W8ZA 2QTMA 3VV2A 1G4UR 1OWNA 3H8SA 2Q46A 3OE1A 4E2SA 3UV6A 5D7BA 4ZVOA 3OPWA 3DZHA 3ECQA 2VCAA 5ISMA 1ISHA 3W1VA 4R2JA 2WO2A 4ESHA 5DX0A 3SLKA 3DZJA 3IHKA 1JEDA 3A14A 3L8FA 2I3GA 4IM7A 2ZWMA 4G1FA 3AKQA 2ST1A 1X7YA 5DZSA 1AA9A 2O19A 3BWVA 4JJAA 1UM8A 3ZNOA 1CF4A 4ET7A 3VBEA 2BZ1A 1EGMB 1COWD 3DAOA 4FOLA 2J1RA 2Q0HA 4DXDA 4MB6A 5AXDA 4QBFA 2XUJA 1VC2A 4MWEA 2PGNA 1O4YA 4KG8A 4I0BA 3STYA 2YGMA 4A44A 4X6UA 2ILTA 3OZSA 2L42A 1GTSA 2P9BA 1PGW2 3QOXA 3I45A 2D1QA 1OY1A 4TZTA 1JHMA 1UBGA 4IS3A 1JXNA 2AFRA 4L85A 5DNYB 4F4JA 1BE6A 5JWPA 1KI4A 1RM0A 1CRLA 4NJEA 4JASB 3WQSB 2X6TA 4MGZE 4D8XA 3P5BA 2PZGA 2VTXJ 2IX3A 3L43A 3PQ8A 2ZQZA 3PA8A 1SELA 3JQDA 1WOYA 3BK2A 3RWBA 4ZOBA 5FADA 2CNOA 4RZIA 2J9YB 1PJ8A 3SBXA 2YY7A 2VL4A 4DXZA 1Y6ZA 5JAHA 1FC0A 3KOOA 4GWNA 3IVXA 2XPCA 3Q9UA 1QJX2 4LQDA 5K1ZA 1W94A 3O0DA 4JMLA 1YUNA 2QHXA 2RH5A 5AXAA 3MOIA 2AUYA 3ADPA 4DDWA 1OAOC 3IIMA 3WBJA 1EPWA 1EVIA 1FYXA 4F5DA 1IOLA 4KWJA 2DQKA 1ONSA 1L5KA 1T5LA 2G77B 4AG4A 4MVJD 4F4FA 2G71A 1NFQA 4PO1A 4PIZA 5JSZA 4GXTA 3AF2A 2GZSA 2GCOB 1P9LA 3W6NA 3VJLA 2R49A 4N5DA 1X7WB 1JB1A 3FBGA 4DNQA 5F39A 3H7JA 4L50A 4LO8A 1EWKA 1NI4A 2BBVA 4I9UA 4BN5A 4BBJA 4OK5A 1I1QB 3ESBA 2K0GA 1QHSA 5GM2A 3BXXA 1JHQA 2QL6A 1RRPA 3STXA 4ACAA 4CRWB 2G9VA 1RMQA 4MV5A 3G9UA 3ZV3A 1FJGB 1F4AA 2QX7A 1REQB 8LDHA 3SH4A 2ZDQA 2OQIA 3T0IA 4AY2A 4ITVA 3SYLA 1B1CA 5AIBA 5JZGC 2R6FA 4ASKA 3LBIA 3DECA 2C0CA 4EL5A 3IVGA 4ITUA 3TYJA 3TS1A 1K6EA 3HI4A 4ND1A 5REQB 4Q05A 3FOEC 2V6JA 2QTCA 2QW0X 3A37A 5DWDA 1FFXA 1ZIOA 3DEYX 5AVKA 5LQDA 4LUKA 2DGDA 4J03A 1J25A 4K86A 1AR61 4RLFA 3E22B 1N57A 3AVXA 1ZCJA 2FPSA 4LHYA 1YQUA 4WLVA 1NBEA 3O94A 3BCSA 5E0OA 4QFCA 1Y9ZA 1QQTA 3TSCA 3ABSB 3HCBA 1TO2E 1G5QA 3O93A 1C3XA 2WZPP 3QVGB 3OWHA 2O5CA 1CF2O 2HGSA 3K9LA 5KYKA 3W8NA 3SFTA 1PD0A 3PDWA 3KQMA 1WXQA 3WYAA 3K09C 3CO2A 4US1R 4O02B 4QKNA 2XNDD 4EGAA 3NBUA 2CE7A 4FB5A 5AVAA 4TUYB 3I9V1 2YV1A 1EFTA 4CJXA 1LFAA 3COSA 3T4HB 3CY6A 1J00A 4NJMB 2A6YA 2I65A 3EOAI 5ALSA 5FLJA 3RT9A 1QTNA 3HRHA 4X20B 3POEA 3IDAA 3PU3A 4Y2TA 3ZK9A 1B43A 4F5YA 3MICA 3MJRA 4CF4A 2DERA 1BEZA 2BELA 3VR3A 4FZRA 3WCRA 2AQHA 3EIWA 3HNBM 3W7AA 5L40A 1Y80A 5FZ9A 5ALOA 1ULAA 1Z83A 3CL1A 3LHSA 4G0WA 2OQ6A 3F9RA 1YQWA 4P00B 3QBVA 5B58C 1LUAA 1CR0A 1XN1A 1VMIA 2VUTA 3GD5A 2J4DA 2CDNA 3P2KA 3QV2A 3QX9A 1E2PA 3HJTA 1ZGBA 2V3WA 1PO11 5BNNB 1H30A 3WDKA 3WGMA 4HPKA 2NMNA 1XQVA 4JLAA 4ZVPA 1VPDA 4H0CA 5JRZA 2Z5GA 3RRYA 1GPDG 1RYMA 3SZOA 2JDZA 4PIPA 1Z6ZA 5GM1A 3ETNA 1C14A 2JATA 3BTOA 2YWJA 4DLBA 3V7NA 1IDOA 1ODTC 1PR2A 1QQBA 1K6IA 4COZA 3N74A 1ULPA 4WLNA 3VN4A 4NOKA 2XQJA 1L4HA 3OZ7A 3EXIA 3PDUA 4E14A 2VUSA 1G5FA 5CIRA 4WM7B 1UZMA 1AXKA 4B85A 1XHFA 5MHTA 2V8BA 3D7MA 5C3OA 2JIMA 3ZE1B 2E1RA 4IO1A 1MO3A 4LO6B 4D4MA 5EJ9A 2C57A 1N6RA 3MRSA 1FFDA 1CEXA 5EHDA 4ND8A 4ED9A 5JSUA 1LGCA 2D3SA 2OZEA 2XYQA 3E1GA 1AR73 1SY7A 3TL3A 4JP8A 4OLFA 4WEOA 4QTZA 1JJFA 5BXYA 4X63A 3V1KA 3JQAA 4Z86A 5K0GA 4RHYA 2DVBA 2YN2A 2VZ8A 1KWGA 1S4MA 4CDWA 4P4UA 4IILA 1I2AA 2ZROA 4FZVA 2CGEA 4LV6A 4OCZA 2Q4RA 4NHKA 1MAUA 3RUEA 2TECE 5H3HA 2CMKA 2YS7A 4YUWA 1N4AA 1DT3A 4U02A 1VKZA 3MUY1 1GZ9A 2I78A 4B73A 1DKOA 3KSRA 1J2EA 1C1XA 3AK0A 4I1UA 2DECA 5EVJA 5EZYB 1CUZA 3X1WA 3PHIA 4X44A 1Q17A 4GDFA 4LRXA 1RRCA 2WYHA 2IF2A 2QM8A 2GN3A 4X8OA 5CUQA 1PS0A 1C8M2 2QA5A 2Y3IA 4QX1A 4AY3A 5GLUA 5FTLA 2WF7A 3AJEA 4HLUA 1OZFA 2LPMA 2FCRA 5J1SB 5AW2A 4KRGA 2MSWA 4ROTA 4L5YA 1JFLA 2IBTA 1W90A 4LIVA 1TZCA 3UQZA 4IFIA 1QV9A 3MCVA 2D3WA 1QYWA 4HN2A 5CFCA 2QFEA 4YDRA 1ECGA 1YXMA 1Z5GA 1WZ2A 2X7JA 1T4CA 3DLAA 2WIIB 2VMCA 3CKKA 2WI8A 1EPZA 5A7SA 3K9WA 4WGGA 3PXDA 1R5OA 2QQUA 3N53A 3BIWA 4QIHA 4OBWA 4EY6A 1K5MB 1KVUA 2AQIA 2AZTA 4F3NA 1C81A 4XOGA 2D97A 1U9JA 5CLLA 1YKSA 3BWXA 3R23A 2PH1A 1CDEA 1G16A 2NV0A 3O8CA 2PBFA 5HIJA 1S2NA 3TW0A 1PZFA 2ZJ7A 2ZUFA 1MUUA 3MZ0A 1GGFA 3ES9A 5DTQA 4LZPA 4O4LA 3ZG6A 2BV4A 5FA8A 5EP1A 2JXAA 1ZVQA 5J40A 1EHYA 1M1XB 2OHGA 4CV1A 5JXJA 3VC7A 4MJ7A 1HLPA 4EYSA 3TEMA 2B5OA 2DT8A 1DUVG 4XCQA 1R4ZA 1Z4OA 3KTAA 2LIVA 4BXOB 2VH2A 4OFWA 1ZNYA 2BR4A 2NXEA 2XUQA 3KB6A 2QE3A 1J09A 1SFNA 2JJ2D 3N9OA 4KV7A 2FY8A 2A0UA 5HKKD 2P3IA 1NONA 1KHHA 4YJ2F 2Q45A 3QUBA 2QU7A 2P69A 3VR6D 1LSJA 4GI1A 4JT8A 4MUGA 1ZH4A 3CDZB 2Q2VA 4E2FA 2OFFA 5JAPA 2LRPA 1GGHA 4GEGA 3L1IA 2OTCA 1D6MA 3II6X 3LH5A 3IP6A 2VQDA 3IT0A 3KL4A 2WFLA 5JWRA 1IPHA 2VJBA 2I7VA 4S1PA 2Z95A 1GQGA 2VEDA 3MUFA 2EIBA 1FPN2 3D6HA 1MRZA 2ZPTX 3PYXA 4MQLA 3IAS6 4QD3A 1E7QA 1SBNE 1OIWA 1J9EA 2NM1A 2C31A 4G4SO 4B48A 1QG0A 1ZA4A 3QKSB 1M67A 4M0KA 3QA9A 5FI0B 4I5GA 3IVAA 3I0MA 4PGMA 5G41A 2VNKA 5JXIA 2MYPA 1I3NA 1PNRA 3C5WP 5T52A 3AL5A 1QRAA 3E9DA 3OH8A 4EY3A 1AD2A 4YP6A 4OIMA 4C7VA 4IICA 3HJHA 4AZZA 3Q1KA 4UUQA 5ELLA 2NADA 3VBRC 5A6QA 4KFUA 2Y38A 1KAHA 1MEEA 3OBTA 1EGVB 5FUIA 1CBUA 3LLMA 2R7KA 4QEKA 3KF5A 2J5QA 1WIWA 2PQMA 5IKXA 2Z8XA 2W6QA 3REGA 4NIGA 2IHBA 1RS0A 4AI3A 4QUKA 2IE0A 4BCUA 5IUKC 1W9WA 1A4RA 1KDYA 1RBQA 4OUEA 3TVYA 2VZPA 1YE3A 3AFGA 4LE4A 4ES6A 3ODGA 4L0PA 4YZ5A 2XX3A 3NLLA 5HW0A 3U49A 2O8NA 3ONVA 1VI6A 1NVVQ 4DRXB 3QKRA 4MYDA 3MINB 1FB5A 2YXNA 3IO5A 5DKFA 3WF1A 1U94A 2PWZA 5DCUA 3FGNA 5C3MA 3FTFA 1CEYA 1U0EA 4L9WA 1IQRA 3U13A 1NJ1A 3LX5A 3PPWA 2P4UA 1MMFB 2VUCA 1M6VB 4H7LA 4I3PA 3M4XA 5GZGA 1FP4A 2QQIA 2HYXA 3ZBUA 2NO4A 3T3IA 4AN0A 4RDHA 5IATA 2AL7A 4BE4A 1ID1A 1IK6A 4IPTA 2EX0A 4ONUA 2XMZA 3DD5A 2VXRA 4WV3A 2RI6A 4Z7QB 3B5IA 2P3LA 1JX6A 2P5SA 5ARDA 2A1XA 2WU0A 5FO0A 1QHNA 5FJHA 2G5PA 4P5DA 1EJ2A 4AZ3A 3AHDA 5LMZA 2C5FA 1TE2A 2EYUA 4DIDA 2P90A 4P7BA 4KLCA 4H18A 3KQYA 1M8KA 3R2JA 5DWQA 2XTJA 1T3SA 1L5NA 2CL5A 2FJUA 2WQ6A 1MTOA 4DCPA 2G25A 3C0KA 3SZGA 1KETA 2Y77A 2CNDA 1BWSA 4DNOA 3FFBA 4DXTA 1RYFA 1QH8B 2DG2A 3V4OA 1CUWA 2FUCA 1GSIA 3CLRD 2JX9A 5G2OA 1XDUA 4QB2A 2QGFA 4X84A 3L6EA 1YOBA 3WL4A 3GLHB 5BV2P 1AQJA 3SC2B 1R0YA 3CUTA 1VL8A 4LF5B 1Z3CA 5K3CA 4A0GA 4L22A 3BU7A 3HDHA 2E5LB 1KMHA 2HWC1 4J7UA 4JJGA 4FSXA 1EWVA 1E3WA 1PI3A 4PLZA 4WKCA 3E3MA 4ENVA 4N7RA 3TAUA 3E5QA 4HTAA 2AN3A 4IZ6A 1RYDA 2ZZKA 3AHCA 1RHI2 5IUNC 4D6RA 2Y66A 3TCXB 4GQAA 1L8AA 3GNTA 2JI9A 5EV7A 2GEKA 4J3FA 3I8OA 4LO4B 2BE9A 4QRIA 3PGA1 2I2FA 3LVBA 4GW3A 5JBNA 1QVRA 3FHIB 1YGPA 3CXUA 4PHFA 3QJYA 4RAOA 3A1FA 4D42A 4Z4FA 3HVRA 4AKHA 5BUCA 2XHNA 3HWWA 5K8LA 3UG7A 2D3RA 1JLSA 2E55A 2ZEJA 3OWOA 5JALA 4Q2FA 4EROA 1GRRA 4YAOA 2G0TA 5C8CA 1SKBA 2X1LA 4XDPA 1IU9A 2KI5A 3DBHB 1EFCA 4AEKA 3DONA 2C2GA 4ZQCB 1PV1A 4RV4A 3PDIA 3B5JA 3D6EA 1SEPA 4B3IA 3LWBA 1T4CB 4YIHA 1RIIA 4PDWA 4BNGA 4V02A 2O3UA 5JQGF 4YYZA 3IBTA 1VPHA 2JG8A 1K12A 1V8DA 3IEIA 4XOIA 1ZLYA 4K1ZA 1L4KA 2FZGA 1RRFA 1HRDA 3ZGVA 2R1UA 2DWPA 2A59A 2MSLA 3HXPA 4DLAA 4LMBA 2IEDA 2JAWA 2W94A 4QHTA 2V7BA 3NHYA 2IHVA 4QREA 3G5MA 2QN6A 2A5YB 2UYOA 2OV6A 1AC5A 2OL4A 2YN4A 3P9SA 3IS3A 4FT4A 4V0RA 1H9AA 3ASYA 2Y68A 1LENA 5BYNA 1BWRA 1L5GB 3J7TA 2IE8A 4Q3BA 4IIVA 4D8YA 1NXMA 4YH1A 4DQUA 1SCRA 4OQPA 1F9KA 1UL9A 2WWSA 3MFCA 2FUKA 3EG9B 3LX4A 2OC9A 5AO9A 2EG9A 2I8CA 2PN5A 5ENZA 4ENQA 4EB3A 1D1QA 5H4HA 2ZTSA 1NVTA 1E3DA 3BJEA 5IWCA 1YCFA 4DMIA 3E7WA 4AURA 2JDUA 1XAJA 2C4WA 1S2GA 3G49A 1U7OA 2OBYA 3RRFA 2P9QA 2W22A 2WT2A 2VGDA 4F3KA 1A4IA 1CE8A 2G6TA 1K9VF 4EFLA 4EMBA 3ZN4A 4D57A 2Q1UA 3PXGA 2MEV1 3GT4A 2IVIB 2FPMA 3PFCA 2DURA 4G01B 5LATA 3H86A 4W50A 4XXAA 4ABTA 4DA6A 1WCV1 4JYPA 4KI5M 1O96A 3PQDA 2P6NA 3CNQS 2JFUA 4COOA 2X4LA 2ETEA 2WSIA 1HZJA 5K8JB 3EODA 5T50A 3O1OA 3IFSA 1ONBA 4WUTA 3M3DA 1P45A 3DL7A 1XMVA 5M5BA 2LKDA 3QUTA 4OSEA 3AUAA 5LQJA 1QRSA 3AP2A 1RKUA 4D80A 1K7CA 2MYTA 3CUSA 3RKUA 2AX4A 3I0ZA 3I01M 1EPUA 1ORRA 1UMDA 2YJ5A 2NTEA 3TLAA 2GYYA 1LGYA 3DP7A 1FLNA 4WNIA 4EJSA 1O91A 3H9JA 2ZPUA 6ADHA 3D64A 4IEYA 2VW1A 2D4HA 1W6MB 3LTEA 1ZESA 5FP9A 1E59A 1OX5A 3VR0A 4G9EA 5LQKA 1W96A 3QVWA 3MTDA 1B35A 2Z2ZA 1XMOB 2Y05A 5E9QA 4UCXA 1OYVA 4KMMA 4QVGA 3WGLA 4BGUA 2C29D 4FYPA 2RHMA 3LY5A 2DBQA 4ZU3A 3WB2A 1J20A 2GZ1A 3OIUA 5J98B 4AK9A 1AR81 2GJSA 4UU8A 1Q44A 1OXXK 4UOZA 2O6HA 4CGZA 4CCOA 3ETPA 1NVEA 5FLXA 4IHJA 1ZH0A 2Q3LA 4CG1A 1IXRC 3CQOA 1SN7A 3QH6A 1T10A 2H2DA 2AFIA 4WN3A 1EZ4A 1Q3KA 3EGXA 1KBQA 1HB1A 1OPXA 3BXGA 5AUQA 1V7QA 1S2IA 1TME2 5CHEA 1H2WA 3TW8B 1JSXA 1P0PA 3R6SA 3DOOA 3NHZA 3KAJA 3AUXA 1C50A 4IIUA 1HV1A 4MR9B 5B3LA 2ERCA 2HEIA 1YR1A 3NRCA 4N7UA 2B8WA 3PU6A 4FDAA 3LHFA 2OXCA 2D7DA 1GU3A 1CNEA 3ZGOA 3WL6A 2XHZA 2YDXA 3BWBA 2PDAA 2C4HA 3VZPA 1IHXA 2PX3A 3IJ5A 4ZHSA 2XQRA 2W4IA 4OV6B 5D3KA 1C9YA 3WQQA 3J8F2 3EEQA 1V8BA 2WHPA 1K5PA 2HRDA 5IAAA 1ZI6A 5I0RA 3E9CA 2XUGA 3OIDA 4JNKA 4AEDB 4QU2A 3NGMA 5MDHA 4G0MA 4JGYB 4QOEA 2R071 2MSNA 1U1DA 4J1TC 5DF1A 2ZTUA 5E8RA 5IKPA 1U8CB 1WW6A 1Q8VA 4ALJA 1MOSA 4CF5A 4YGCA 5NLLA 2X8BA 4HKOA 3D8TA 3S0JA 1M2VA 1G3UA 3QBEA 3DC7A 3WF4A 1BVP1 1HE4A 1ZEMA 2W6NA 5BXXA 4UHCA 3F7TA 3PTRB 1Z5PA 3PNBA 4XJUA 4RAQA 4I5IA 1DU4A 3GUYA 3EUFA 3N6RA 3QW4B 3WCSA 4L5CA 1OVMA 2P9ZA 1Z2PX 1Z0FA 3WOHA 3NNDA 5EJIA 1G8GA 3E9ZA 1PZXA 2VZVA 2ECFA 2AC2A 3T4VA 1XNGA 1H9CA 1E2MA 3VISA 3INGA 3IT3A 1N6OA 3ZXDA 3UJ7A 1E9CA 2ZGKA 1LLQA 3QF4A 4KWEA 2MJLA 3TLGB 3EEIA 5CB8A 3PLRA 1DARA 4LE2A 3MWKA 5BSWA 1XTJA 3VDXA 1HR0B 1HI9A 3TBHA 2HT1A 1OASA 2P11A 4CVUA 4L3VA 5JDIA 3MIBA 8AT1A 1XNQB 5FLHA 4LHVA 3R4DB 3TTWA 1IY8A 2AZXA 3UJPA 4WHMA 2QX4A 1T26A 3VHNA 4GEKA 3KQPA 5K99A 1ABEA 2WNEA 4CF6A 1X8XA 3UIEA 1CR2A 3BQNB 4LHNA 1QOOA 3NHUA 1NXQA 3TE6A 4CEIA 1Y8CA 2VA9A 1UEXC 3AY3A 3G8DA 5LP6A 2CMHA 4DJDC 3FUCA 4PXAA 4YY3B 3O92A 3WVNA 2FWNA 1PR0A 5GOZA 5IVPA 1P7WA 4N3CA 4DWOA 3KM0A 4NBTA 1WB6A 3DXTA 1I2ZA 4L9AA 1Z2EA 1WNFA 3FLEA 1T3TA 5ABJC 2O8FA 2VF4X 3RU3A 4G1MB 4HDKA 2BKAA 5G04L 2RKWA 5G0WA 4BMXA 3Q8WA 2DT5A 2R0FA 5ALLA 2H16A 1GTJ1 4OI4A 5A3TA 3GLIA 1CAXB 3WLLA 4KVGA 3T9EA 4PZYA 1GA4A 1W2NA 3IV7A 1I7QB 1U1FA 1GNQA 2BFEB 2W47A 1JWAB 2RHJA 4CPBD 4JLUA 5AKEA 1TJPB 5HJ5A 4NOTA 4XFBA 2CJWA 1JFSA 3OJFA 4UAPA 1JE0A 4N7IA 5JBQA 3WLQA 5LRSA 5FPBA 4TLLB 4Y1GA 1Y9GA 1T3GA 2R4TA 1ZD4A 4N8SA 3KUDA 3KDAA 5C71A 3VZLA 4TUYF 3TB6A 5A02A 3AJ9A 2V4MA 2HPHA 3GLVA 4WCVA 1MS0A 3ZW8A 1DAGA 1CEEA 3HKBA 3O3CA 4C78A 3LFMA 2VSOA 3H5AA 4UDOA 2X8LA 2DZDA 5DZFA 2KB0A 3B9BA 3OMWA 2BFOA 4PZZA 4CXYA 2X42A 3FFXA 3ZJTA 2M1ZA 4DLXA 1S02A 3IMEA 1DAOA 2XDVA 1VHTA 3DKPA 3ZYBA 1PG5A 5KHJA 3A9WA 4O4IB 4GZ9A 3MLJA 5A5EA 5E9AA 5JANA 4GAZA 3USES 3O0TA 1BRTA 1HQLA 4GC5A 5LNK1 2WJAA 4L95C 3OB8A 5ALVA 2WWVD 2EXJA 4D79A 1PFUA 2CD9A 2NO7A 3F74A 4HO1X 1A7UA 1OC2A 2C4VA 3A8TA 3K5HA 5EYPB 2YBPA 1VRH3 4XJWA 2FZ1A 4IDEA 4UTZA 1T4DA 4HRAA 1CFZA 3SHQA 2AEEA 5G1PA 5LMUB 4MA0A 4DT1B 4G0ZA 3AEKA 4JJEA 3BXFA 1YIFA 1DIOB 4FNGA 3E8SA 4OMDA 5FYHA 3NH9A 2G9ZA 3IVMA 3RJZA 1MC1A 5HX7A 1L5MA 5EMJA 3QEAZ 2NU6A 4WKPA 4HYEA 4EQVA 5D5HA 4D8MA 1OBNA 2DH5A 4IRMA 1IUNA 4LRYA 1Z8HA 3PF8A 1UZZA 4UNQA 3NNJA 2QJWA 2ZK7A 4FFWA 2B5HA 1MX1A 2OLKA 1GTVA 2NSYA 1L7EA 2VHZA 1QH0A 5DASA 5E4FA 4XYXA 1LQ2A 2H1SA 2FOXA 1S1CA 3QOWA 3CLKA 4HVTA 4P80A 1CIVA 3AR6A 4YMHA 4MUVA 2CMGA 4UFHA 5BSEA 2EFJA 4IEVA 5FBKA 1YI9A 2RS52 2X3FA 3DHEA 1Q7BA 1NW8A 1GY8A 3EFOA 4NCHA 1U2SA 4HATA 1DLLA 3VBUB 4WLUA 2WVAA 4M0EA 5DHPA 2PD4A 1KI6A 1FMD3 4MMXB 3AB3A 2ZM6B 3AFMA 1WY5A 1NLRA 5KHKA 1NYWA 1KXJA 3DAFA 1Y7PA 3FLRA 2R62A 4FMCF 4MV8A 5HWSA 2XE6A 4YC7A 4NYIR 3ZEAA 3ZIWA 3TZHA 1NNSA 2X9NA 4IKEA 5IASA 1N1SA 5LNK6 1TO6A 1SLLA 4FDTA 2VVDA 3PUKA 4WJKB 1T36B 1Y34E 1A50B 1SLTA 1J3PA 3F90A 5DN9A 5EIBD 1JZSA 2GR9A 2V4UA 3AZZA 1Y5RA 2JPDA 4J4HA 3WIBA 4GKKB 4ASLA 1LK0A 3OPYI 2PD6A 1FI2A 4IHJB 5D1HA 2C24A 3IL2A 4KPFC 3FDZA 3WAJA 1Z5ZA 4OOEA 3O4RA 2M6RA 3S1SA 1UIMA 4NDAA 1AQNA 4P81A 3K4HA 4NPMA 2ZYVX 3P8ZA 4GE3A 4A0QA 1ZINA 3U11A 2PGOA 4B4WA 1SD5A 2ZB3A 5THKA 3BXZA 4ZU5A 4B6OA 3RWOA 3VJRA 1RITA 1KIMA 2OECA 1PIV2 2NUBA 1L5FA 5FY1A 1DMRA 4HDNA 3UKOA 3GG2A 2GAAA 2QY9A 4S24A 3J4UH 2QG6A 3LY7A 4CZ2A 1UKRA 1DIWA 1NLZA 2IS4A 4ZJPA 1WY7A 3N5CA 1L5OA 2DVMA 4GIQA 5EIAA 3N3BC 4Z8XA 4NAHA 1DQ5A 2MHFA 3A9UA 3LRXA 5F6LB 4D8VA 2DLDA 2O54A 4LBOA 1BSVA 3ZE2B 2Q5OA 4EARA 5KC5A 1P3JA 1U3WA 2CJYA 2RGNC 2QX8A 2CNNA 1E8NA 3WOGA 4QU5A 4Y2XA 3D3WB 2O0LA 1NPYA 1F2TB 3U4DA 1F5JA 3VSEA 5D2AA 3OOWA 2YQZA 3WXMA 3IP9A 2WG0A 1VBD3 3BTXA 2PSDA 2QXTA 4BEBA 5JC1A 3SR0A 4EUFA 4OHWA 5A7HA 5DNAA 2PWPA 5C81A 2QUHA 3EHKA 3L77A 1DGLA 1XKXA 2H9IA 3Q7PA 1NDQA 3GJ7A 5C3UA 4WZAB 1OTXA 4KH0A 2G9QA 4MPDA 1IOZA 2FZEA 3UKTA 4KJXA 2CBXA 2D5IA 5BVHA 1XTRA 5BN4B 3AP6A 1ISJA 4IIYA 3U4GA 1XWWA 3WYCA 1Y1TA 3NI2A 3RU7A 1VZ2A 2O8OA 4QPDA 2F17A 3RFUA 4BRSA 4KR6A 2CDBA 4AKTA 4NJEB 2LCIA 3VKGA 4W99A 3VNBA 4X91A 3N9NA 2PMEA 1NE2A 1L6RA 3LC2O 2RB4A 1X1EA 3ZHVA 1XT6A 5A3MA 2QORA 2VOTA 4YWHA 2CXRA 1BG6A 4HNRA 1WPXA 3CF4G 4LIPD 4OF4A 1VKHA 4YW1A 4XFHA 1AKYA 3A05A 1RHQA 1AY0A 1KS5A 1XJ0A 2CJPA 3O91A 4PGGA 2VK2A 3OUJA 3CA8A 1P3DA 2XWQA 1YZFA 4M3CB 5LZ4A 1TJ5A 1BVUA 3OPMA 1T5DX 1FT9A 2IUYA 2F90A 2PKYX 1M2NA 3HYCA 1BEUB 1Y6QA 2R87A 4XFCA 4C03A 2BGTA 2WF5A 4JXKA 1QAQA 1N2CA 4IDFA 5EG5A 1PJTA 3LUPA 2HSWA 5EP2A 5FBQB 4MARA 2H3HA 1VMEA 2OQ7A 2XL7A 4C5BA 4PYOA 1YC5A 1DWOA 3GJTA 1TM2A 4MDFA 1XKLA 5D86A 3PK0A 1Y8RB 4EFKA 1JKIA 1Z4QA 4NK5A 3G9ZA 1KJLA 3GP8A 4NMWA 2H7YA 2W2IA 4PNZA 2JG8B 3LAGA 4AMZA 4D74A 2FCTA 2WLQA 3B1KA 4L9BA 3GWGA 3KGLA 4YRCA 3T7AA 4XEHA 3W59A 2ZIGA 3TAXA 3HKEA 3NC4A 3UBMA 4RVOA 3DQPA 3R3UA 1P29A 4KSCA 1QRDA 3EZ9A 3RRJA 1NKGA 5AW5A 3K5WA 1YS9A 4EW3A 2CZGA 1LDMA 4M9XA 3UETA 4NCBA 5CVTA 3GJYA 4DCUA 3FC0A 3Q12A 4MEAA 1VRVA 5FYMA 4FMPA 1EE1A 5I9BA 5JD6A 3A11A 3TX6A 3F5MA 3H65A 5BNOB 1NJ5A 4Q12A 2G36A 4KO4S 3V46A 4R1SA 3E58A 1ISFA 4UW4A 4A6EA 4LCEA 4NF2A 4WSOA 1ICEA 4IO0A 2KE5A 4NHEA 3E3OA 4WZ6A 2JF0A 3NBKA 3K1AA 3LD9A 3FDFA 2VQ6A 1GOTA 2JG9C 3POWA 4DEQA 1KA9H 2J0EA 1Y7TA 3ZWMA 3WVJA 3K6SB 2FP3A 1THMA 3GDHA 1D4M3 3KFXA 3UL2A 2FMHA 4IQGA 2HKIA 4P3XA 3RSFA 5B1EA 2AZDA 5IHRA 3AVYA 1AL0G 1N8TA 3KHKA 2D40A 5M04A 4FIZA 4I99A 4X9XA 4GYKA 4QATA 2JNWA 3DQQA 1KJIA 5F1PA 2AH2A 1TO1E 4BISA 4OFBA 1ZN8A 4N9HA 4PC3A 1TZ2A 3GH3A 3CV3A 5BYKA 2ASEA 1UCFA 1X70A 1KO1A 1NZDA 1RKVA 4JWTA 4GP6A 1LVHA 1DKQA 3U44B 2WT1A 1JNYA 2QVCA 4CCMA 1ZXXA 3KQ4B 2PVSA 4TLDA 1JR3A 4WADA 1DQ6A 4EVQA 4BJ3A 1SUAA 2DQZA 3G7NA 2RR13 3NV2A 2I9PA 3AFIA 3LCVB 4B3DA 1X82A 3B00A 4RKQA 2ERXA 1DFQA 1TA4A 3HBLA 5DYGA 4ARZB 3PKJA 1N9KA 4RQAA 3VX4A 4CL3A 1DC3A 3O7OA 3VDBA 2BR3A 3IB6A 1CUXA 1ZLXA 3P0IA 4WKNA 1QS0A 3NBYC 2NWQA 1EHIA 1N2OA 3POYA 3R74A 1GKKA 2MDTA 2JFQA 5SYAA 1N92A 3IOEA 1X1SA 3PR2B 3JALA 1XEWX 3F8TA 4XZ3A 2EFDB 1X9HA 1UZYA 4DJTA 4QGHA 5TGDA 4OHOA 4YBRA 3UMFA 4E11A 1UC5B 1HC7A 1HSOA 3EO6A 1Q0UA 2C5SA 3T30A 2FMTA 4UW9A 3H8XA 4UNIA 3ACIA 1OI6A 2VG8A 3NO8A 3PWSA 2FHSA 2BFBB 4PYRA 4N5IX 2CDCA 1BJTA 1KMQA 1E1RD 1J8MF 2R0HA 5KOYA 5JFTA 1JFFB 2J9RA 4I55F 4A15A 2OVUA 3CSUA 4G2NA 4P7KA 4XB6B 4P38A 3WL8A 3QEMA 1HDXA 3IE0A 4RV5A 4NHLA 4G37A 1LR5A 2FUG1 2YFYA 4AVCA 1NBMA 2XVLA 4O61A 3A04A 4D9NA 2P2ZA 4OIFA 1GUFA 2Q30A 3GLHA 5CFPA 1SKMA 3H3XA 4LZAA 1XZNA 1SA0B 4UW6A 5A7QA 1G4AE 3WJAA 3OHSX 5GALA 2XBMA 2ACEA 3WW4A 4MLCA 3NJRA 2IEYA 2ZGMA 5EP3A 2ZABA 1GITA 4Y7DA 3BL8A 3NAMA 4OU4A 4TQUS 1GZVA 4NNJA 4L27A 2VJKA 1SRRA 4BFSA 5BQ5A 5G0SA 4EKGA 3WMGA 4OQMA 4UEWA 4IGKA 1GFIA 3D9QX 1C5KA 4U7DA 1CJVC 2G72A 2CKMA 1GR3A 1E20A 2Q99A 4S04A 3NIFB 1OREA 4BTEA 1WETA 2AQ8A 4INJA 3OGRA 3VMMA 3CUUA 4YECA 4LDJA 1G9CA 1KJWA 1OZAA 1SCIA 3LRPA 2LV8A 3KR1A 2WF6A 4BNDA 3A0KA 4DARA 3RYTC 1KPIA 3RZJA 3BORA 3KVRA 1T8YA 3NCHA 1HEIA 2D43A 3SSMA 5F3RA 4C14A 1YSCA 1P4AA 2Z4RA 3GRVA 3NCTA 4HDOB 3K1TA 1G8HA 5HRAA 4OBEA 2B3DA 2C5LA 2G7MC 4GO1A 4QHZA 4XASA 1Z5NA 5T5LA 1G9BA 2CXXA 5HCNA 3AFHA 4TTPA 1WCWA 1BVYF 1M8FA 4X7BA 2ZQYA 2O1QA 3D7KA 2WNSA 4YQEA 1GZDA 3KZ1E 1Q91A 2G9GA 4NC9A 4D9CA 3F4BA 2G40A 2ZRPA 3ZDDA 3GY0A 4D5GA 3HDVA 3Q5EA 1A04A 3MWEA 3SYKA 1JDJA 4CCEA 2QPLA 2ZRKA 1GWMA 2KLBA 1OFUX 1V6NA 1PJ2A 4IHKA 4ZOLB 2HV8A 5I0TA 3K6SA 4HQLA 1QX4A 3R0QA 1UPXA 3WKEA 1HKDA 3A1TA 1QCDA 1SOWA 4B17A 1UUFA 1VXOA 1DRKA 1P7CA 5KU1A 4L73A 2H5IA 4Z0NA 1P75A 3L4EA 1ULZA 2HLHA 1ZRIA 1E1QA 1U8UA 5A3RA 3L2YA 1VLMA 5T55A 5K3DA 3FZEA 3OPZA 5C8ZA 1Y6GA 2IZ6A 4PJYA 4B09A 5KCZA 4WZAE 2COEA 1RTKA 4DCMA 2BVBA 1A4XA 4UVIA 4D2IA 3J81A 4Q9NA 2ARCA 4I0WB 1L7RA 2DBZA 2WD7B 4YCCA 4KQXA 3N70A 4JYCA 4EB6A 3N0WA 2CVPA 3KVAA 4DILA 5APAA 1YR2A 1GICA 1NURA 2XDQA 1HQWA 1P0IA 2J3HA 2OG1A 5TQ0A 3PHBE 1EP0A 1RKXA 1OC1A 2DUJA 1DG9A 2X0RA 1X80A 1JFVA 4HNAA 1NI3A 2ONJA 3AHFA 3E18A 3H3JA 5D5QA 4UPVA 4U9UA 4E2YA 1FPN3 5FUYA 4Y26A 5FYUA 4G23A 1GR0A 1DTEA 3EOZA 1RMU3 3GJQA 5FV7A 1W5BA 1X33A 1Z0ZA 4NIAA 1YR6A 3RSQA 5DG2A 3WYGA 3LK7A 2PCJA 1YYNA 1BDIA 3VDDB 4QQ2A 5LZ9A 1LBSA 4O2BF 2NNWB 1NXOA 1G5RA 1UJ5A 5EQTA 1Y98A 2PH5A 2YH2A 3IM0A 1CB7A 1W48A 4DV1B 3B8HA 4L08A 1JZ2A 5C1BA 3C97A 4P98A 1QHDA 1I4DD 2VTBB 4RMIA 3DKKA 3QPWA 2PS3A 1F06A 2D1YA 5AVRA 4DTCA 1M1ZA 1H2YA 3L01A 3ADOA 3JZVA 3RSJA 1V3TA 1B6RA 1ACMA 2CLEB 4KL1A 1WM1A 3A9RA 3PWKA 5K7SA 3T3HA 3ZVLA 4M22A 2KSQA 2HWC2 3K30A 4F56A 4P9NA 3AG5A 1JVBA 3VYWA 3G3EA 5FWDA 5DI3A 4A91A 1IKQA 5EVCA 2WQ8A 4IE5A 2BDUA 3THXA 3CBGA 4X62B 4GOMD 5K8VA 3KK0A 4K9LA 4M9QA 5GY7A 1H2KA 3QGMA 4RF3A 1T1IA 4HRVA 4UW5A 4DCCA 3QWFA 3SQDA 1NVBA 4KL8S 2YTZA 2GTPA 2V03A 1O58A 1BNCA 4N18A 2C9KA 1YDHA 1WXGA 5KSZA 4KJZA 3EXG1 1KQOA 2CAVA 5KXEA 1GSAA 2QAGA 3FVVA 3HVJA 4F6RA 2W2OA 4POAA 5E1OA 4D4HA 2BL4A 3GGCA 1AN9A 1YU6A 4JP2A 3OZXA 1VMAA 2NLRA 4H6WA 1UMCB 3M83A 4J07A 3IQFA 3KHBA 2PGDA 1P5FA 3IPRA 1LFDB 4MGKE 5J58A 4H1VA 4ZK2A 3LLVA 6REQA 1KHTA 3AW9A 3JALB 5FTMA 4G5FA 4CIDA 2BFEA 3OUUA 3ZXIA 3RVQA 1RUG2 2HU8A 1CHNA 2QMUA 3X44A 2P9JA 1PR6A 4WBSA 1E2DA 5FTNA 5K0JA 3K0BA 4YJFB 5H59A 5JXGA 5CFOA 5AMXA 1YRAA 1MOQA 2HIGA 4CA9A 1W9HA 1QQAA 5JT1A 3CGGA 1H1TA 1WMXA 3F6CA 4AZSA 4FOQA 3P9YA 5ITVA 3DDSA 2RHGB 1R9JA 1N2XA 4O3FA 4J1SA 3U3RA 4BKMA 3H0KA 2IX9A 1Y9QA 1ZGAA 2XJ9A 1T1GA 4DBZA 3VZSA 3KP1A 1SG0A 5ACA2 2ZVDA 4R81A 3NQ41 3X2FA 4NO4A 2VHEA 2JHFA 1XAHA 3L4SO 3W78A 2YBKA 3AIIA 5K51A 3LS2A 1H2MA 4YJ3A 1JEJA 5F73A 4H3VA 3LHKA 4DQLA 3ZPOA 4PE5B 4RIFA 4ALNA 4H7KA 4BNUA 5FK7A 4ZCLA 1Z4IA 5EHQA 4GH4A 2XJVA 4D0GA 2XMQA 5AHRA 1JYFA 3ZI4A 2WFF2 4BRWA 2CF6A 4JGIA 3BDVA 3SXPA 2AXEA 5LA2A 1UF9A 4JSTA 3W4IA 5JJLA 1SXJB 2GF0A 4UOJA 3K2IA 1ZN2A 2J9GA 5IC5A 4IUGA 5A2GA 3HG7A 1XTPA 5EHIA 5TPWB 2QRLA 5JRDS 1Z26A 1BDJA 3SF8A 1XN4A 1BU5A 1MFZA 1XTTA 2P0YA 3MOSA 3UB3A 4EHLA 4L4XA 2AN1A 3GJ4A 1ZVFA 1E6MA 3U5ZB 3AF4A 3OIFA 4RS4A 1W49A 1KDRA 3AKEA 1T29A 1QGUB 4YJFA 2VULA 1D9XA 4AQSA 1FDIA 1WZEA 3FD8A 1PS9A 2VK1A 1K8ZB 1A9ZA 1DBRA 4XQ4A 3P4YA 1W6PB 2WKQA 4KYTA 1RLOA 3HUEA 4CM4A 2B35A 3ZH9B 5DJ5A 4DYHA 5KPDA 4DFSA 3OT5A 2E6UX 4B9AA 4B40A 3RFRA 3N0VA 4B5KA 3UHOA 2PLFA 1DT5A 1VL0A 4ZYTA 1KFJB 2CFTA 2FG6C 4IE6A 1G5HA 1VE6A 3ML1A 4KBYA 3KOMA 4LISA 2RH9B 3GWZA 3OEHD 2XLFA 4HX5A 1BHJA 2ZCVA 3VOBA 4FEGA 4K5QA 1KZ6A 1FX1A 2IS1A 3VPFA 2PU5A 2VYQA 3UCXA 1ZU5A 1RUE2 4AZ3B 1U8YA 3CIFA 1YAHA 1HDIA 3CCBA 2GCNA 2ZBUA 3TKYA 1V9U1 3QX3A 4I0AA 4RY0A 3OEBA 5BMOA 2J0SA 1U5BB 2BFDA 3OOJA 3OBBA 1VSTA 4UEOA 2NU8A 4AMYA 2CVOA 2VQ3A 1W0KA 2RG4A 5BV0A 4FVVA 1RQXA 3THYA 2UUCB 2JIZA 1JG2A 5F12A 3PPYA 1PNFA 3E7XA 1NMXA 2DTDA 1LU1A 2BJVA 4H7IA 4RXTA 3AHJA 4BVJA 1JDPA 4MVCA 3I6BA 5L3ZA 3KC2A 1NMYA 1I51A 1QF6A 1WULS 1SU8A 1Y9EA 4I8XA 5BNPB 5JWHA 2TEPA 3OTWA 4O1IA 2WD7A 5CTJA 1Y4WA 1UZWA 1NZCA 1II9A 4QPZA 2JGRA 3JZMA 5FOQA 4A7KA 4W8GA 3ZSKA 2CVHA 1D2GA 4LXYA 5JY1A 4Q9IA 2JAOA 3HGTA 5HOEA 1H5NA 4YUXA 3L9JT 1PNQA 1VPVA 4KU7A 1KJZA 3QLQA 1O7FA 4AZ0A 3CVXA 2XMSA 3UXHA 5LPNA 5H5JA 4NFYA 5J2TB 1OGJA 2ZE5A 2NTYC 2K7ZA 3GFTA 1H2EA 1QK5A 2H06A 2I54A 2B6NA 5J48A 1SWVA 2BFBA 3NYQA 1KP2A 1R00A 2GSYA 3G2PA 3V97A 1UY1A 1O5LA 3WQ7A 4ABYA 5JZOA 3H4VA 1UJNA 4RKWA 4CIVA 2C58A 4XM1A 1R0RE 4RR3A 2IV3A 4CDQB 4DEYA 1HV0A 4X00A 2AS0A 2WWIA 4X8NA 4DYDA 1GARA 2PMDA 3U3DA 1CVLA 3WKCA 1R27A 2FSVC 3PQ7A 3MRTA 3N7JA 2WIJA 3T4PA 2TMGA 1OD6A 2AEJA 1TZMA 4LHEA 4I30A 2BEVB 4PANA 3ZGXA 2FGJA 3OJBA 2A0FA 4DLNA 3FZQA 3RC9A 4FGKA 5CYYA 1D09A 2EF6A 1PDVA 3QVVA 1WPRA 5IBQA 2Q8EA 5JLAA 3B3FA 1RYBA 2C61A 2AN5A 1XJAA 3G0OA 3KYIB 4K6FA 3EDQA 5EIYB 4PBRA 3WW1A 1OYWA 1K2WA 1YNOA 2QTBA 1MX3A 4EV0A 2O3SA 4MLPA 4U39A 5DMYA 3FB4A 1DHKB 1XL1A 4E2QA 2OHJA 4DG9A 1A8DA 3KJNA 4K6OA 2XMRA 4QDXA 5E7QA 3TLMA 3G2JA 3IIEA 1Q0TA 3UJDA 4E5SA 2DRIA 3PGLA 1PSDA 3NIDB 2FYTA 2YGLA 1QYCA 4J6EA 3RAGA 1G21B 4Q1FA 1CRZA 2HT6A 3IO3A 3IKJA 3LCCA 4EYOA 2Q4SA 1BFDA 5KNCH 1IXSB 3ST7A 2WUEA 4PZDA 3P0FA 4BO0A 4G67A 4XW3A 3L4BA 1D4ZA 2Z8YA 3N2NA 2W0SA 1AH2A 1XA3A 3CF4A 1P4RA 2LKCA 4LWOA 4EI8A 2WNUA 2GT1A 3DKQA 3PNPA 3BEOA 4LGYA 4IDGA 1NT2A 3LOBA 1Z7WA 4E4SA 4G8JA 1LI5A 3BTSA 4OHPA 1GYKA 2JGKA 3I49A 3UJHA 2XT6A 1TF7A 2VCHA 3RG0A 1XTKA 4YRZA 3WLSA 1GZTA 4Z51A 4WZZA 4QOSA 1G6KA 4A92A 4MHRA 1F3LA 1R092 1QG4A 4CDNA 4X45A 4J16A 3POSA 2BCGY 3HDJA 1R16A 3NUZA 2FDRA 2CFRA 3DKWA 3IEUA 3LT5A 5K0BA 2IBSA 1GP6A 3UO8B 5A4KA 3A0NA 3KVBA 3USUA 2ZBRA 1OGIA 5C1IA 1CY7A 1BQ3A 4QARA 1II8B 3PENA 3ESZA 3ZLUA 5IH3A 3ROGA 4DLRA 3RU2A 5A33B 2YROA 3OPQA 5FJKA 1E69A 2RGAA 4XFKA 5TEVA 2D6MA 1DOZA 2W43A 4UNPA 5DTJA 4P9IA 2NV2B 4B3HA 2WHEA 4GM0A 3NTRA 3U7RA 4TV8F 3HH8A 3AOGA 3PV0A 4Q1EA 2YC4C 4XUTA 1CG6A 1PIV1 1MDFA 4BBAA 5E3IA 2PUJA 1BMFA 3BOPA 4GBED 3AYCA 2O1EA 2NYRA 3C39A 4XVCA 5FNVF 3EMDA 2I2CA 3QW2A 3FBTA 1O95D 1FBTA 1KD7A 4MR7A 2Y9MB 2ZIZA 1MACA 4AQ6A 5GLWA 5HZMA 5F9FA 1JPJA 4NDNE 3KQKA 3WHLA 2YY1A 5KOHB 2Q3FA 4OCTA 4K26A 5FIUA 2OZKA 1SACA 2XJSA 1NASA 1V1JA 3OZWA 3MJCA 2ZB4A 2XVMA 1ZGGA 5BORA 4ZREA 1JQ5A 1R50A 3CZRA 3LXRA 5IJ0B 1T0BA 1BKYA 3MPPG 1OX6A 3K9FC 3B1YA 5CLHA 2XTZA 3NEYA 1M5TA 5LUBA 4JXJA 2X0DA 4DV7B 2PL3A 3ONDA 4J49A 2R6CA 4YP1A 1A9RA 3KU4A 1DEXA 2VHCA 1O8PA 1XE8A 3V3TA 2IITA 3V56A 3OBAA 3EPJA 4AS3A 1XD9A 1OH4A 4QDTA 4G25A 4W6YA 1X7XB 2P6PA 3C6QA 1Y7IA 4KE7A 4O1HA 1QONA 1GNZA 3VBSA 1ITZA 1P74A 1ADCA 2VJOA 5BR1A 4M7RA 2V45A 4QYIA 3RJ2X 3W5NA 4TLFA 2P91A 1T8WA 1G2IA 4MJLA 1Q74A 4LXXA 1ZRHA 3GJ3A 1DU3D 4FD3A 1E92A 3DF9A 2LP4Y 5P21A 1FL9A 3OKCA 4ND7A 3A10A 1TGYA 5HEKA 5I01A 3OSUA 2HTEA 1MO2A 2DUMA 4X7PA 3GZTB 3OHMA 4NRQA 2PGJA 2YQ4A 4P9XA 2DWRA 3GK3A 3PNSA 5FZFA 1UT6A 3ZD9A 3EGDB 5H9SA 4EJSC 1NFRA 2IYPA 4E1BA 4I2OA 5JSKA 2QAGB 3P7MA 3OT1B 1N36B 1O6CA 2JKBA 4NZPA 3VAZA 5I9NA 1Y9MA 1QB7A 2VM9A 1QX3A 3INTA 3LXMA 5BUSA 1KI9A 4TWAA 1Z4LA 1J99A 3ZY5A 4E4ZA 1GQ2A 2ID9A 3UEOA 3MLEA 4OK6A 1GP5A 5HQTA 2PHWA 4PBTA 1KDMA 2JJ1A 3MT7A 3V2GA 3V32A 4C2BA 1FVOA 1E32A 1J70A 1THGA 1XQXA 4EKNB 5KDDA 4PSDA 4M49A 3BERA 1P1HA 1TFUA 2PHFA 1NQUA 1FW6A 4KIUA 2GJ8A 1ZK4A 3CH4B 3WGTA 1OFSA 3RIMA 4UEQA 4NXMB 2Z6VA 2EXIA 4FP2A 1Z74A 3DMTA 3JUUA 5K0LA 4YRGA 5FKCA 2GHRA 3RF7A 3ROKA 5U1PA 2I55A 1JN2P 5H70A 3CEHA 4F93B 2W42A 3NKFA 1YWKA 4HUTA 1R8YA 3LX8A 2FXVA 1Y37A 4QDKA 2HWE3 3BGWA 3I7DA 5COBA 1ND3A 2ZGLA 4BNZA 2PX4A 2DUNA 5IJ9A 4Y6OA 1IOWA 3RBVA 2VT7A 4Y2GA 3WDTA 3EGWA 4D46A 4IZIA 2Y0EA 4I4NA 2ZE8A 2RGGA 4N0MA 4DRZA 3LT1A 1BCSB 1EDOA 5D85A 4GQIA 2FUEA 1T1JA 1NV9A 1O3RA 4EYKA 4OUDA 5BSTA 4F21A 2GX6A 2X6QA 4B2PA 2VZ0A 3Q3GE 3H2YA 3U81A 2C1EA 4JVSB 1KK0A 1DYOA 3FTNA 1KTVA 4IMPA 4FCVA 3A4VA 4R0NA 1CUGA 4HNAB 2HJVA 4NMXB 1DZIA 4QXMA 2BUAA 2BTVC 1YQQA 1E5VA 3IDOA 1B0AA 4BLWA 1JG3A 1XTQA 4QUGA 1XEFA 3RLIA 2WWHA 4U1RA 1JTEA 3N2GB 1J84A 1PUJA 3I04M 4EYGA 3SSNA 1CS4C 2BR5A 4G24A 4ZPXA 5TARA 4BQEA 4E27A 3MTEA 4HQRA 1JQBA 4GH4C 4BATA 4DUVA 1Q0HA 1KEZA 2FBEA 3TEFA 3K8QA 4Z1VA 3X0DA 3UMYA 4RJJA 1BW9A 3N1UA 3UW1A 2GYWA 1K2VN 4DPLA 1UWWA 1AQIA 5CURA 3LZCA 1AUYA 2UZ3A 3O8QA 1SBYA 1N1DA 2AACA 5IDYA 5CT6A 4PYJA 2HWF3 1V9SA 3HA2A 3E3AA 1NVXQ 2WC1A 4AY4A 3K46A 2DFBA 3VI4B 5FL3A 2J5XA 3DXXA 2H11A 2VUUA 5AR1A 2XUMA 2RSLA 4N8DA 3BCWA 5AQEA