5FBZA

Structure of subtilase subhal from bacillus halmapalus - complex with chymotrypsin inhibitor ci2a
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
432
structure length
432
Chain Sequence
b'DVARGIVKADVAQNNFGLYGQGQIVAVADTGLDTGRNDSSMHEAFRGKITALYALGRTNNANDPNGHGTHVAGSVLGNATNKGMAPQANLVFQSIMDSGGGLGGLPANLQTLFSQAYSAGARIHTNSWGAPVNGAYTTDSRNVDDYVRKNDMTILFAAGNEGPGSGTISAPGTAKNAITVGATENLRPSFGSYADNINHVAQFSSRGPTRDGRIKPDVMAPGTYILSARSSLAPDSSFWANHDSKYAYMGGTSMATPIVAGNVAQLREHFVKNRGVTPKPSLLKAALIAGAADVGLGFPNGNQGWGRVTLDKSLNVAFVNETSPLSTSQKATYSFTAQAGKPLKISLVWSDAPGSTTASLTLVNDLDLVITAPNGTKYVGNDFTAPYDNNWDGRNNVENVFINAPQSGTYTVEVQAYNVPVGPQTFSLAIVH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Enzyme subtilase SubHal from Bacillus halmapalus
publication title Stabilization of Enzymes by Metal Binding: Structures of Two Alkalophilic Bacillus Subtilases and Analysis of the Second Metal-Binding Site of the Subtilase Family
doi rcsb
source organism Bacillus halmapalus
molecule tags Hydrolase
total genus 154
structure length 432
sequence length 432
chains with identical sequence C
ec nomenclature ec 3.4.21.14: Transferred entry: 3.4.21.62, 3.4.21.63, 3.4.21.64, 3.4.21.65 and
pdb deposition date 2015-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
A PF04151 PPC Bacterial pre-peptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5fbzA02
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5fbzA01
2DP4E 1UBNA 5FAXA 1GA1A 4OMCA 4HX2A 1GTJ1 3D9QX 4AKSA 1KFUL 5JXHA 1Y48E 3F49S 2PRKA 1SIOA 3LPCA 1MEEA 4J94A 3EDYA 2P4EA 1U5IA 1ST2A 1AQNA 2G4VA 1TM4E 1OT5A 1SIUA 1GCIA 3WQBA 2XVLA 1SVNA 4H6WA 1T1IA 1SCJA 3TI9A 5CW1A 1Y3FE 4B5LA 3EE6A 1GNSA 2PMWB 4K8RB 1WVMA 1SPBS 3UNXA 1SUCA 1AF4A 5ARDA 1SUBA 1C3LA 1SBNE 3LPAA 2Z30A 2QTWB 3VHQA 1WMDA 5FFNA 1AH2A 1SUDA 1AK9A 1S01A 1KE2A 4DXZA 1SH7A 4LVNA 4KB5A 2XVKA 4WOCA 3I30X 2W2QA 5ARBA 1SELA 1Y3CE 5JXGA 1Y1KE 4LVOA 1R64A 4DY3A 5SV5A 2PKCA 2SECE 2GKOA 2Z58A 1AU9A 3QFHA 3BGOS 3DVRX 4MZDA 2SNIE 4DJ5X 1KE1A 2XVGA 1JEAA 1C9JA 3DE3X 1NQDA 5B1EA 1SCBA 2HPZA 3CO0S 1P7WA 2IXTA 3CNQS 1DBIA 5B1DA 1Y4AE 3I37X 1OYOA 1WSDA 3I34X 2X8JA 3DVSX 2SICE 3A3PA 2PWAA 2DUJA 2ZRQA 3DF0A 1BJRE 1SN7A 4Z2AA 1SCNE 1YJBA 4FONA 1Y4DE 2Z57A 1SBCA 3QTLA 2XTJA 2WV7A 3VV2A 1SBHA 5I9SA 4C3UA 3ZXYA 3DYBA 1YJCA 2ST1A 1GA6A 1GTG1 5AMXA 1A2QA 3SQOA 1BFUA 3GT4A 4NE7A 4BWGA 4I0WB 1THMA 1PEKE 3DDZX 3AFGA 3WHIA 3GCXA 2DQKA 3H42B 3OSZA 1PTKA 1GT91 1SUAA 1SBTA 2TECE 1T1EA 1TO1E 3TECE 1C9NA 3WIUA 4HPKA 3GCWA 1YU6A 3F7MA 3A3OA 1T1GA 2O8OA 3PTLA 3EIFA 3LPDA 3GT3A 1P7VA 1GTL1 1LW6E 4H6XA 1KDVA 2HD4A 3JQWA 2ZWOA 3DE1X 1XF1A 3L1KA 5JXJA 1SCAA 2ID4A 1S2NA 5ARCA 4YN3A 4DZGA 1SUPA 1NLUA 2B6NA 3DE2X 1V5IA 4RYDA 5AVKA 4OMDA 1Y34E 3T41A 1DUIA 2WUVA 1IAVA 1TK2A 3DE0X 2PWBA 2Z2ZA 4KG7A 1PJ8A 5SICE 1PFGA 4CFZA 1TM1E 4H6VA 1Q5PA 1BFKA 3ZXXA 2E1PA 1NDQA 5FBZA 3I2YX 1AVTA 2WUWE 1TECE 1TM5E 1WMFA 3DVQX 1GA4A 1V6CA 4GI3A 1Y9ZA 3D43A 4CFYA 3BOWA 3VTAA 5JMOA 3DE6X 1DF0A 3P5BA 1C9MA 2W2PA 1WMEA 1TM7E 4ZOQI 1BH6A 1SCDA 3TI7A 1R6VA 1TO2E 4AKTA 4NE9A 1Y33E 1SBIA 3AJ9A 1BE6A 1KDZA 1AV7A 5AQEA 4HPKB 2LUWA 1R0RE 2PYZA 1YJAA 2Z2YA 3DE4X 3WIVA 1KDYA 5AVJA 3LXUX 1EGQA 4NMXB 1IC6A 1OYVA 3PRKE 3DW3X 3VV3A 4OV6B 2PQ2A 3QMPA 4DWWA 4WOBA 2W2OA 2V8BA 3DE5X 4DZTA 1EA7A 1CSEE 2ZWPA 1QXPA 3AJ8A 1SUEA 1NQJA 2ID8A 1P8JA 3Q5GA 3VYVA 3JQXA 2WWTA 1NDUA 2SBTA 3F7OA 4KPGA 1S02A 2QFEA 4JP8A 3BX1A 2XRMA 2Z2XA 1Y3BE 1ST3A 4G9SB 3DWEX 5K7SA 3BPSA 1BE8A 2X8JB 3VSBA 5JXIA 4I3GA 4C3VA 1TMGE 2Z56A 1Y3DE 1MPTA 1ZVKA 2IY9A 4CG0A 3HJRA 1CNMA 2W2MA 4HVLA 1HT3A 3A3NA 3DE7X 4M1ZA 1TM3E 1VSBA 3SICE 1ZVJA 4ZARA 2W2NA 1KFXL 1GNVA 3Q40A 4DY5A 1SIBE 3DW1X
chains in the Genus database with same CATH superfamily
1W6OA 2NQ2C 1Q2UA 2GNOA 3TJZA 3I73A 4ER6A 3OZXA 4GQAA 4KMSA 5DAPA 4CHGA 2GRUA 2R6CA 1U90A 4MP8A 1ESZA 1VRH1 3LUDA 1LPOA 5SV8A 4LJ5A 3ZNNA 3L1VA 2X6TA 3WF4A 2VBGA 5EQJB 4BMYA 1SG0A 1ULAA 1QJZA 1A8HA 1XQNA 3TZEA 1XJCA 1L5KA 4TMWA 1C3LA 1JBKA 1LVUA 3V6LA 2C9YA 4MLPA 1TAGA 2XCOA 5E3JA 1BVHA 4C29A 2HWF2 3A14A 3UXYA 3WRYA 2E33A 4G89A 2R071 2DMRA 1MMFB 2RE9A 1Q84A 3C6XA 3RGBA 5H5JA 1CUIA 3E5RA 1CEEA 3MI8A 1ZOPA 4WVWA 4XCBA 2C4NA 3MOGA 2HWC1 3V65A 1OQ1A 2R16A 5TQ0A 1HFEL 2P90A 2PLV3 1KAMA 5FBVB 5L7WA 4LWZA 1GEGA 1KEVA 5H1YA 5KTTA 4Q4Y2 1V3VA 4YLZA 4PC1A 3MINA 1P4AA 3R4CA 5ALQA 5IUNC 1QDOA 1PGL1 4G3XA 4NFHA 4C30A 3JBG3 2FEKA 1PFQA 3UZUA 1G2QA 4JZRA 1ZYUA 3PK0A 2RHCA 3L7BA 1P73A 3MTJA 3WC4A 2DWOA 4CM8B 3ESRA 3A37A 3E5MA 1A8IA 1F8YA 1Y4UA 2JLQA 4HLUC 4YG6A 3UYJA 1NFQA 1FX0B 2Z8ZA 5FB3A 1VKJA 2P9TA 2ET7A 4QG3A 2OCDA 5FY7A 5JSKA 2RH9B 3EXFA 2GS9A 4OVEA 1JQKA 1JXOA 1EX9A 1I7NA 1UT6A 4Z9BA 3FUVA 4ZGWA 2RE8A 4LZAA 2H6BA 2G4LA 2X8WA 4O61A 2HLEA 1NSFA 3N2KB 4ZYLA 3JD73 1ZN7A 5E8AA 3C5HA 2OAEA 4UXJA 1U5YA 5A3VA 3CPEA 1BO6A 1GSLA 2XHKA 1UXGA 3EZFA 2HH9A 3NBMA 2QU7A 1IDOA 1RUD2 4JK3A 1OH5A 4DJDC 1DQ1A 3GFVA 3CT6A 2WR9A 3U0ZA 4AMZA 5JAMA 2AJBA 4KYUA 1ZI9A 3OMLA 1F1BA 5FX2A 2WD7A 2WIFA 2M9MA 4YAJA 4J3JA 2HU7A 1LU2A 4EAAA 3TQCA 1GAEO 5FOXA 4CI9A 1IXKA 4LJAA 4QGAA 1PUIA 2JHFA 3EF1A 3DOIA 3Q8XB 3GP3A 2GYUA 2NP6A 3ZWNA 4U7GA 2BBOA 1UMCB 3SWWA 1XMVA 3ZE2B 1UBHS 4LTDA 3LFIA 4RA6A 5B1YA 1CX4A 1JN2P 1K5PA 4IAOA 1ZR4A 1PV1A 3O1HB 4QARA 1IHPA 5DM60 2WLPA 1TCVA 3BRSA 4ZI7B 4G01B 3AZVA 5DDIP 4BO3A 5G1PA 4FAGA 3EQ9A 2NN8A 1N1YA 2HXSA 2OHIA 3ZPOA 2TMYA 1UBFA 3IT3A 1QDUA 1RI2A 2QL6A 1F3LA 2NSLA 1J1TA 1F60A 3KOWA 2D0PB 2V5UA 1JFSA 2AR9A 5JCZA 3MQ2A 5KPJA 4GH4B 1P1JA 3WYCA 1S2KA 4DLZA 3QACA 1YZ3A 3POYA 1A8QA 3DDHA 3VOAA 4YRPA 3S1SA 2R6JA 5IEJA 4CCEA 1M7HA 5EL0A 4P9GA 2XXJA 2GNPA 2PT9A 3GMTA 2B98A 1DFHA 3W6UA 5GGXA 1D4VB 4BX0A 1DP4A 2Z56A 3FPSA 5AKYA 5K20A 5KHHA 5JI9A 3DLCA 4BH9A 5JI7A 5TVGA 4HNUA 1BRTA 4ER0A 2DSNA 3TMYA 4CKZA 4HWSA 3KUDA 2H4JA 3V8PA 2QYSA 3AP5A 4ZXPA 1UK7A 1W8ZA 2YC2A 1Z6XA 2OBFA 2WJZB 4XTCS 2FMHA 1R083 2UYQA 3H8JA 1HRI3 5EWJB 5F5LA 2IUWA 2H16A 2J09A 4K0RA 1OTHA 2Z1MA 3QKWA 4WOKA 4D42A 2OQRA 2D2IA 4QPGC 2GEUA 1B3RA 2PEZA 1RUI1 3AGQA 5G0TA 3T94A 3JQGB 2X10A 4E33A 2HYKA 3FGZA 3NVMB 3LPMA 3N39C 4XJAA 2PMWB 3AIIA 3OCXA 4Q3EA 4XASA 4FPKA 1UOEA 4G9GA 1IZ9A 4PGMA 4E4TA 1LVGA 3B52X 3V8BA 4Z92B 1H3EA 1W581 2LDXA 5FFNA 3EZYA 1U4NA 1YRLA 4BMDA 3NDBB 3PJEA 3VYRB 2VAUA 3BXOA 1ZIPA 3LYUA 1IQAA 1UY4A 1RKQA 2QRPA 2DBIA 4MVJD 3UHFA 5LMUB 1KEUA 1BQ3A 1L5WA 2HRBA 3T7KA 2EU8A 5B37A 1YONA 5E7QA 1FATA 2BUBA 2X8BA 1R4NA 4RKEA 5FTNA 3M4JA 2DX7A 4N6OA 5AHRA 1XNHA 1Z47A 5LJLA 2WA1A 3KZ4C 3X1MA 3WINE 1I7SB 3H0KA 3L49A 1SKBA 1EDBA 2C3PA 4V0QA 5EJ2A 4DSUA 3A11A 2AQHA 1EBBA 3TEMA 3KXDA 1B3BA 3NAPC 3WG9A 1OYOA 4PYIA 3Q85A 4JROA 1RXGA 1GAXA 4MA0A 4IEUA 4EJSB 4MX3A 5ERGB 3QTLA 4GP7A 3HDGA 4P34A 4TSFD 1MR5A 4U4AA 4EB6A 3O1PA 2V5VA 3U1VA 3W7AA 5A32A 1V0AA 3MLJA 3AKEA 3N8NA 1GADO 5ALZA 5ADUS 4JKMA 4FKBA 1IZ3A 5REQB 3B8HA 3W1EA 4RPJA 1QQBA 4G5QA 3R7NA 4EWAA 5H7XA 4WADA 4JSTA 1O3TA 1OKOA 4AXOA 1AQIA 1DWPA 2NZVG 3KKZA 2QNBA 5GIOE 3LK6A 2VMFA 4C89A 4F1JA 3E6CC 4E8DA 2I8CA 4PG8A 4HMOA 1JIUA 2XB2A 3RYCB 1AS3A 4EL0A 4RFRB 4XUOA 5AVSA 2YWHA 3WGKA 2PHXA 1W99A 4OB7A 4AFMA 4WPGA 1PZ8A 3A4TA 1N8NA 4L1KA 2QUIA 1T5OA 2NTNA 2XF2A 1IGOA 4QXCA 3ZDBA 2OHFA 3GIWA 3W2HA 5I6DA 1NR1A 4ACBA 1NN3A 3QELA 2A9RA 1DC8A 1XXLA 4P86A 3HWSA 3TOZA 4HDKA 4OULA 3TWOA 3IQFA 2KBFA 3D7SA 5BYAA 4E5SA 2IYNA 5EXXA 1MGOA 4YXWA 3BXEA 1B2LA 1SK9A 2QIOA 4RMIA 5H9WA 5F2WA 1M5TA 3Q15C 2BFCB 5JYBA 2A1XA 2HY7A 1J0XO 3EXIA 2JVKA 4EIWA 3N86A 3F4LA 5JROA 5J9FA 1JHAA 1G8FA 2XQJA 2Z5FA 2QUJA 1M9NA 4IOMA 2IXGA 4HXGA 4CEWC 4D9HA 3OCJA 2XJSA 2CLHB 2NTVA 5B12A 2XMZA 4FK8A 2UXBB 2EEZA 2HDWA 2DSTA 2PN5A 1HWYA 2FPWA 1XC6A 2C1FA 3VBSB 1EM6A 3T06B 3ZH2A 4DWWA 3GPLA 3O4VA 1GPJA 2P0YA 3N58A 5M3BA 3GOHA 2P40A 3UMYA 2BEWA 3LFHA 4KDCA 4MGTA 2X29A 2WJSA 2HRQA 2ZR8A 3I3EA 2JJ6A 1DKNA 4N65A 2WWTA 4RTQA 2PU7A 2AFRA 3NFRA 3FJYA 3TF5A 4PPYA 3SS9X 2HFKA 3OGSA 1W88A 1RUE2 2BT4A 3D7NA 2QUHA 1FMTA 1NXPA 1D9XA 4QX8A 2OK8A 1G20A 3P9QA 4XQCA 3T9CA 3NWPA 4YFWA 1XXHA 4M1ZA 1GU1A 3E6DA 2HYIC 1H2LA 1R74A 1VDZA 2GBIA 1XN1A 4AZZA 2R8BA 4PFJA 2XVZA 4GE0A 3LO8A 3KUUA 3ASUA 3HLYA 4LZZA 1E2UA 2I74A 2X6RA 1WZ2A 4M21A 5TPZA 5I7SA 5F2OA 4Y20B 2RC6A 4Y7CA 4XDHA 3WG3A 2ZMKA 2J4DA 3DPIA 1E3MA 3MZHA 1UMHA 5FZHA 1FSSA 1A34A 4M0LA 3COZA 1CPNA 4J94A 2HMVA 1SMVA 1Q1QA 5CT5A 2H5JA 3O6VA 5DGXA 1AX0A 3AI1A 1JPNA 2FF7A 4LIPD 4PWYA 3FYUB 3AHIA 1BHJA 3RRJA 3LEKA 1L5LA 4DCPA 1LJ7A 1G20E 2YW9A 1ECPA 2PVCA 3OPTA 1N5IA 2X8AA 1HF3A 1HDYA 1ULSA 1KAQA 4KKXB 2ZR9A 4MUVA 1VAVA 3SEEA 4WJLA 3RC7A 1VL5A 1A96A 1TA4A 3IB6A 5FZFA 1GLGA 4BB9A 2W90A 1UZUA 2M1ZA 3JBG1 1TZKA 3CJTA 3P96A 3CQOA 4PDWA 2EIHA 4CDRA 2Q7XA 4RR3B 3CW9A 5ALKA 2WZBA 4KH9A 1E58A 1QHSA 2C2XA 4C20A 4TQGA 5IAAA 1F0NA 5AKXA 4CM6A 4L0DA 5C37A 3CE9A 1FTNA 4ZZ3A 5A2QA 2WHPA 1SGWA 4FX5A 2P6NA 2DURA 3CO0S 4ATEA 3PVZA 1HYGA 3M9WA 1M6EX 1LJUA 4XM1A 3VLBB 2Y6VA 4GMXA 3IDEA 3V1MA 2CXOA 2X4DA 3QMVA 3NCHA 2Y77A 4I6JA 3AP6A 3IEUA 3GCGA 3MPBA 1H8TB 1PNTA 3JD71 1GPWB 3T2PA 4RD4A 3RFCA 2DUMA 3ZE0B 4U2CA 3JWGA 2AYHA 4EY6A 4GHWA 4YM0A 2ZAYA 4N5HX 2IHTA 2VJMB 4UUAA 3IPYA 3VKUA 3IVGA 1AL22 4PGAA 4A16A 1XV5A 5FWYB 3A2MA 1C7EA 2JF0A 2QM7A 4DB4A 2VNKA 1E5VA 4TL6A 3DBLA 1TC1A 1SMKA 5DK4A 4H4CA 2J6IA 3UUFA 4L76A 1X7YB 1EHYA 3BDAA 5THQA 2WKKA 5AHKA 1U5ZA 2FJ0A 5LQUA 1KDOA 3A1TA 4Z51A 4Q00A 1PJ2A 5HG0A 1SUPA 1MNQA 3GIDA 1NVTA 2HMAA 2A7XA 3CF6E 2ZU0C 4JAVC 4J7CA 1QFSA 4WZ6A 4ZRNA 2RB5A 2QPTA 2P6CA 5KB3A 3WSWA 1NZDA 1NVVQ 5KTNA 4NQZA 2F4NA 4M9SA 5IJ9A 2V9PA 2X7HA 3WHKA 2O2GA 1LLCA 1YFXA 3PDWA 2MYPA 2PAAA 4KN9S 1MORA 4UM9B 2IXJA 1Y0BA 5GOZA 4OREX 4MS1A 3IDAA 3ZI7A 4MXWA 1CAWA 4UTRA 2G71A 3H5AA 3LCMA 4NYMQ 1CUVA 2V4AA 1NQXA 2Q7DA 3N9IA 3RTEA 2Q1MA 1V0JA 2VPWA 4RPGA 1HTWA 3UIEA 4WACA 3JQ6A 3G2QA 4D9CA 1Y8CA 1QCCA 5DCLA 1F5SA 5ANRB 3CSDA 1US8B 2B9VA 3PNPA 1FDSA 3EDMA 4KWLA 3FZGA 1A3CA 4BX2A 3EIHA 4KI7A 2DR0A 4W8GA 2CFOA 2RS52 3GHMA 3GUHA 1KFEB 1XALA 3K20A 1W2NA 1XJ5A 2C20A 4B84A 1QWSA 3UB3A 1S2GA 2BKEA 3KQ4B 3MJEA 4PJYA 1LXCA 2DFKB 3RSGA 1SU6A 3EO6A 3DBOB 4JJFA 1M6HA 1SB9A 3QSYA 2AEZA 5HEKA 5JS2A 1R081 4O8CA 5JOYA 1N2GA 1UPAA 3PDUA 4ZCPA 2R25B 1BX1A 3DMDA 5DBIA 3TYXA 4MQEB 1N0VC 4WKGA 2ZWMA 3NWBA 1HE3A 1PO12 2Z6QA 5IKPA 4HYTA 3QE9Y 1T9GS 4B1LA 4IHJA 3O0VA 2C5HA 3VJLA 4R7ZA 3W21A 3JYHA 2R47A 3AP3A 3WA6A 4D4GA 2R7EB 2AXPA 2HNKA 2P9ZA 4GMP3 5KVCA 2CV6A 2MR6A 1ZM3A 5JD3A 1DUSA 5TIIA 1HLDA 4OMFG 3MW8A 3NWJA 2Z2JA 2NTEA 1R12A 3NYIA 2X76A 4UNNA 4FZRA 4DO0A 2OQVA 4Q4DA 5GZFA 3H6KA 3AW9A 5FLXA 5A33A 3T0FA 1P2GA 1ID1A 2IWHA 1MC1A 4D6RA 2JE7A 5E9QA 3FPBA 2GZ2A 4GZ6A 3ETJA 1X42A 5EEHA 2EZTA 4NFLA 4L8QA 4CL0A 1RRVA 2E48A 5JDIC 1SUSA 4YYOA 3U4IA 4D99A 4HWPA 3N0RA 1RZ3A 3ROMA 1T8SA 1XMQB 5A3SA 2CHEA 1OBFO 3R5JA 2E6UX 4MV5A 1JQ5A 3MDPA 2IXCA 1BVYF 2C2KA 1DC3A 1E7WA 2KXLA 4IYRA 3ZXEA 3V0AA 3ACBA 5IWCA 2RAPA 1L6RA 1VPDA 4BKPA 3TFWA 2OTCA 3HBFA 1IS4A 2XQGA 3SKYA 2I3DA 4XURA 5FMDA 3MUFA 3FTPA 1VRVA 2DU8A 2GD6A 1G86A 2ZRPA 2OXRA 3UJ9A 2YIDA 2D0IA 2XE6A 3BRWD 1F2DA 5EGSA 2P6PA 1Q92A 2J4CA 3DEFA 1CUDA 1EPWA 3SYNA 1WCKA 4OYUA 1ZRHA 3EGWA 1XZKA 3RK4A 3WMFA 4AN4A 2A6YA 1WPQA 1JSLA 3N9MA 1X1TA 5JATA 2KD7A 2PG3A 4JNCA 4XCAA 1N5OX 3K9QO 3FW1A 4NFYA 3I8SA 1FMJA 1JZ8A 3H1YA 2G9UA 3H2JA 4MYDA 3A06A 5KPDA 2GZMA 1H4QA 4RVDA 3MFCA 3K94A 4I55B 4DLNA 4NV3A 1Q56A 3Q6NA 1RRFA 3O8QB 1VE7A 2QRHA 3HVUA 1PN3A 1PNVA 3PNVA 4EKGA 2IBSA 3KKOA 3F7MA 4RZ3A 4JYMA 3HABA 4LXHA 4ECEA 1WEHA 2PUWA 1S1AA 1XSQA 1BU5A 4RGQA 5CG2A 9LDBA 1VYTA 3RS0A 4CIDA 4QKDA 3H1GA 2WTXA 3WTBA 5A5DA 2LWIA 3E7WA 1NBWB 4WZCA 4JTOA 4E1VA 2DLNA 1DB3A 2XV1A 2CNAA 4D6XA 4Q9KA 3SCGA 4MV6A 4KG7A 4QXQA 3TXYA 1IULA 3MSCA 1ULZA 2I7CA 3GB9A 4A2UA 1IBKB 3AUTA 3OU2A 4KXLA 5EHGA 2ATFA 2W6JA 4L07A 5DP2A 4EVRA 1PL0A 2ZUEA 2YNMD 1U0EA 2XMBA 2HMUA 4KGXA 2AGVA 3TG2A 2QUBA 4XBLA 1Z2CA 4XH9B 4HXFB 4Q5IA 1RMU2 2QLTA 2NU8B 1NYWA 3MCUA 2ISSD 1M1XB 5DISB 1D04A 3CNNA 2XBMA 4HDNA 1TQ6A 2D93A 3CWCA 5FCDA 4KRXA 4D3XA 1BH6A 2H5EA 2OAGA 4ZZ1A 4JVMA 1PNRA 3BCWA 4BMBA 4WINA 4Q3CA 4YMGA 4WZFA 3GJ3A 3AEUB 4CCSA 4MAAA 2WNUC 2I29A 2WYWA 2Y1LA 5F33A 1QH8A 2XRFA 4AI8A 4LJ6A 3LVBA 2PKWA 5IZCC 5P21A 4NZPA 4MPRA 1Q74A 5HS4A 1HK7A 4SLIA 4ZAXA 3CBGA 3GR6A 3KTAB 4DUPA 1IC6A 4UAGA 4X97A 5JUWA 4XUPA 3NKVA 2ANCA 4HQKA 5K6RA 1RLIA 4JI7B 4QPDA 2WUEA 3GZEA 4X3PA 4UASA 4RFVA 3PT5A 4EAQA 4BKRA 1AVBA 3FPEA 5ED0A 1WW8A 2AFVA 1KZ4A 4AHWA 1L5OA 1P60A 1N5MA 1YKFA 1G38A 1ZSNA 1YE5A 4U7JA 4Q4HB 3AKRA 1ONBA 2E87A 5L3SB 3E97A 1Y6JA 3RFVA 4NZOA 1XA0A 2VRBA 1YQQA 4CLOA 2I9KA 4PTYA 1ZA7A 4ILEA 4HKOA 3T1MA 3VVMA 1HDIA 1UKYA 2JFVA 2D98A 3N7AA 4URXR 3ZBUA 3AHFA 3Q2OA 3NKLA 2CXNA 3IVRA 3ZNOA 1ABFA 4JBIA 3DEHA 4F21A 2QR2A 2GSYA 2D8AA 4JGYA 4WDRA 4NDNE 4RTLA 3QFCA 4M8NE 3UJAA 2D5BA 1VBD3 3K09A 3TGPA 3TZQA 1QRDA 1U81A 1JLKA 4UVDA 4GKVA 2VQ0A 2ACVA 1E99A 4RTOA 1CPYA 3A0RB 4ZODA 1H8EA 5A5GA 3FKJA 4EMSA 4DA8A 3QK7A 5KQMA 3SBDA 4A82A 1EFKA 1YS1X 3EQ6A 2WKSA 1TMKA 4UBKA 2VZ9A 2HTFA 1TIBA 1JYEA 4ZXKA 3VDNB 1NBMA 2O23A 5JADA 4BK4A 5JLAA 3EB7A 3GD5A 3QU4A 1NBAA 3VBEA 3GALA 1CK4A 3UNXA 3NVAA 3V0BB 4F5ZA 4K0KB 2GPWA 2BJWA 3M6IA 2COEA 2CD7A 3HA2A 3I8XA 4EMBA 3KSUA 2AD1A 1XDUA 1U9YA 2JCSA 3QW4B 3RD5A 3IAAA 3V1TC 2X0RA 5A3TA 2XUOA 3EVDA 1L5HA 3ZWDA 3ESAA 3AG6A 2ZAIA 3H8VA 1PP4A 1BCSB 2XA1A 3U9LA 3BZBA 821PA 2ODPA 1X9GA 4CTNA 3ZU3A 3MHPA 3UV9A 2SECE 4UXAA 5ABJB 4TLFA 2WZR3 4ZU5A 3CJIA 4I4CA 2ISQA 2Y26A 4DMFA 4L5BA 4GXTA 2EF1A 4D0LB 1RWKA 3LCRA 3BVPA 1FSGA 2QZJA 3BUCA 1G21E 4OI2A 3S7EA 3ZE7A 2GLUA 4KO3S 4MMZB 4V0RA 2B82A 3BXFA 2X4LA 1A8SA 4YJ2F 3U19A 2QVYX 4Z4IA 2G28A 2FFRA 2X9QA 1HM5A 1JTVA 3Q12A 3JQEA 2XCIA 2PWAA 3BCHA 4CDNA 5EIWA 3MFYA 2P2CA 1V7ZA 3ZHYA 1UT5A 3DAHA 1DTWB 3AR9A 5FY9A 3LF7A 1XK6A 2H1RA 3OCCA 3PDJA 1WCXA 1DXQA 1NQWA 4PX3A 3DC2A 5A3NA 1N1EA 3I3QA 3LOIA 4UQOA 4J75A 2QPOA 3GT4A 5JD5A 2FR1A 2C7RA 3W6ZA 1BEUB 2XEXA 5CCXA 5F3WB 3JYNA 4JITA 4Z5XA 2LGJA 3NBYC 2JFGA 4AX8A 3ECAA 1SBTA 1XQ1A 5GLVA 1JAIA 3NIBA 3WRXA 5CDTA 3R9XB 1UQUA 5IEBA 3MJSA 3A3OA 2CZGA 5D3MB 3DNPA 4RSUA 1R5OA 3SCFA 1ZOLA 3ZQKA 1QE5A 2QNIA 4LFCB 3H05A 2PIDA 5EHNA 3I8TA 5IT5A 1S7CA 3Q1KA 3GPIA 3WYGA 4BBAA 3A25A 3VR2A 1NT4A 3AF1A 4MCAA 4DNPA 4M7WA 3QI2A 2GJ4A 1LC3A 3NJZA 2QMZA 4AZTA 2VBDA 3LLMA 4TSVA 3K6SB 2VDRB 2J33A 5T54A 1AL0G 4ZT4A 1DG6A 2XSZA 3MS7A 1A72A 4N43A 5DHAA 4HVTA 2ATEA 1XDBA 2WWIA 2ONKA 1RUH2 5I0SA 3U7HB 4FZ5A 3JQ7A 2FG5A 2P2YA 5DDJ3 2GN2A 1XRQA 1LDYA 1OREA 2EXXA 4WVFA 4LBJA 2W48A 1KI3A 1WW6A 2QP4A 4AMVA 3PJQA 1TM7E 1O5TA 1YCGA 1KZ1A 1LBIA 1NQTA 2ZJCA 2LIPA 4C0LA 5CKQA 4IIGA 2L2QA 4MLCA 3DLTA 2I3ZA 3DYPA 4CXXA 3DONA 4Z86A 2VP6A 2OA0A 3X2SA 3P9YA 3ZNQA 3SI7A 1R0LA 2RFLA 3LE0A 3CMMA 2OECA 4YRGA 3VR1A 4I09A 2ZWVA 4I1UA 2Q9BA 1L4EA 1R8JA 3Q3IA 1FYUA 1FRFS 2Y1XA 3UUGA 1PG0A 3PENA 3HO8A 1AZTA 1A4RA 3ME5A 1FUIA 4WBXC 1P9OA 4JOBA 5LIRA 4GMP1 1ZUIA 1C9YA 4WM8B 3CH6A 3AYEA 1L4YA 2DJIA 4IETA 2J1LA 2JCGA 2ES4A 3ILHA 5AVZA 4ITCA 2HKIA 1ZEJA 3NT4A 5FXXA 4M3CE 3JCIA 3PFCA 1T15A 1DO8A 1ZBQA 5JAIA 1YB4A 2WU4A 3X29B 3DS8A 2I2DA 2QRNA 3H17A 1UAAA 4BRZA 2HJWA 4CF4A 1Q0TA 1Q91A 5F39A 1B6TA 2DERA 3FC0A 1MAUA 4BVFA 4QM7A 2H92A 1QY4A 4G1BA 3CR3C 2VJBA 5K8TA 1GQHA 4FHDA 3L5KA 5CM8B 2X5OA 2JD9A 1T2EA 2WAYA 5EA2A 2P2KA 2R073 3U1BA 5HTKA 2NU7A 3O94A 2HSJA 5FHRA 1BXZA 1XP5A 4GMGA 1KFUL 4JUFA 3FUOA 1P3Y1 3CN7A 1NUKA 1EP0A 1DAGA 2HWC3 2VDJA 4Y3UA 3U10A 4QOJA 1CF4A 3NHWA 2CN1A 5C4WB 4IZHA 4NXMB 3WV4A 5CFCB 4RJLA 4AE2A 5AVPA 1W6PA 1KERA 5A3QA 3OU7A 2XGXA 3E8MA 2JK0A 4ZVKA 5L95A 3NV1A 2XI4A 3OG2A 3T4HB 3DM5A 4UD2A 1H3NA 4FVTA 1SUDA 1WV1A 2AD5A 2G8NA 4WXRA 4KN8A 2ZDGA 3JQ8B 4X8PA 2FP4A 4RYLA 1C1FA 3KV6A 4UJ5A 2Z6VA 4HN2A 1A76A 2TEPA 4NYIR 3RASA 3DD1A 3AI2A 1LOFA 1D3AA 2I8LA 2V74B 3OY2A 2OGTA 3QPBA 4C0HA 4ZK2A 2D0OB 4QPYA 1ADYA 5LL6P 4YJGB 2WZEA 1NE4A 1TJ5A 4OI1A 4KXMA 1MQAA 5JRZA 3DHVA 4IV3C 2A1IA 2ZRFA 1W2OA 1ODNA 3RVKA 3MWKA 4KWCA 4LJRA 3N6RA 3BK2A 1P2DA 4N3BA 2VF8A 1Y4AE 1GP6A 3I37X 2R061 4OUMA 2JIGA 2CWSA 3WWZA 5K6AC 3HGTA 2X0JA 1S0GA 4WN9A 1CUUA 4LZNA 3RADC 1BBT1 3CZQA 4G5XA 2QVCA 1Q1EA 2G4CA 4HG2A 4P9YA 2M6SA 5FOSA 3HVDA 2MCFA 4K6CA 4BZZA 3O82A 3WDYA 2HW8A 2WO2A 5KU7A 3HWJA 1LHUA 2R6QA 4Q5OA 3NM4A 1COZA 1SPXA 2OMKA 3BM5A 2AFHA 1UXZA 3VYUB 3GNSA 3WGYA 4BFWA 1H2BA 3TSCA 2OCBA 3PNQA 1Y1QA 1K3FA 5A3LA 2ZRGA 3P0HA 4RNCA 1KK0A 4REQA 5H9QA 4PBOA 3E9DA 1GFF2 1TU3A 3ZSJA 3W9AA 4LPKA 1B00A 2GXUA 4TZKA 1W03A 4H77A 2F8SA 5B4TA 1C41A 2HXGA 4NZYA 1NYRA 4OHZA 1SOUA 2ET6A 1SUIA 2XXZA 3IT8A 2KLBA 2HN9A 1I80A 4JFAA 1GOTA 4LN1A 1DAEA 4HLDA 3FWNA 4DYDA 1VXRA 5HIMA 4RS3A 1VKHA 1V5IA 2CFCA 1UMKA 4R1TA 1JKJB 2EX0A 5BQ5A 1UQRA 1PR9A 4L50A 1VOTA 4GKXA 4K26A 3PVNA 3AVTA 1C50A 1M2KA 3K9FC 1EWRA 3R3YA 1H4SA 1D8TA 1NKSA 3B3QA 1NFRA 3IUMA 1CDOA 1TKBA 4DVJA 1VLZA 4HSEA 4XHXA 1NSYA 2OQIA 2C4MA 5FPUA 2WKWA 2FP3A 3AH8A 2VNSA 1FJXA 3U3RA 1XPUA 4G5OA 4IDOA 1CP3A 3LUFA 3U17A 2G1MA 3X1YA 2QQ5A 1Z74A 3O12A 1XMPA 5EE3A 1M6YA 2DQYA 1M6NA 4N53A 4XFAA 1JAHA 2DEUA 1K68A 5BNPA 3R0ZA 1V35A 3IBGA 1G6NA 3AYXB 3WRYC 4ZFNA 5THXA 2X19A 3D3QA 3ZWCA 1L8AA 1RXCA 1YR6A 2VZUA 1YDWA 4M46A 2WIKA 3UGTA 5K05A 3PXGA 4HZIA 5IYYA 4C5CA 4UUBA 1SXHA 4WSOA 5JZSA 1E57A 1M06G 1FEZA 3AHDA 4G1EB 1DARA 2A1UA 1BS9A 4MUKA 3ZVKA 1AGYA 1ONAA 4CKXA 5J2UB 4TYQA 1L5GB 5AKEA 1QPGA 1C80A 3JYOA 1HL3A 1E4OA 1CVLA 3QUAA 4M36A 1HEUA 1XNKA 1U5BB 4WZBB 3HC7A 1ELOA 4FFBA 2H2IA 3WLOA 3LRTA 5FDFA 4LA3A 2GC3A 2XLFA 4GIQA 2XUGA 2O0HA 5BQ3A 5L51A 3TKYA 1Z5VA 4UPVA 4ZT5A 2ZJ5A 1I1NA 4K3UA 5ISMA 3ZTWA 3IAFA 1Z17A 2Y4OA 5A4IS 1JIVA 4EPWA 3WNMA 4CCDA 1R1ZA 1FY2A 4QBTA 4BVKA 3O83A 2F43B 3MV11 3WR5A 1CKEA 2CHQA 2JGIA 1RMTA 4FDLA 4OMCA 4DINB 2YZNA 1X7DA 3E5HA 4D82A 1E6MA 3CM0A 1MEEA 4WUTA 4UTZA 3ELDA 3UMVA 1UNBA 5LZ8A 3FFZA 2O3SA 4YUXA 2OPWA 4D4HA 5B3LA 1XCGB 2XHEA 3D5QA 1V1MB 4V2WA 2OBNA 3NHMA 4ALIA 2EZUA 4B85A 2WZR1 4AZ0B 1HDKA 1OLRA 2R043 5HK9A 3WFZA 3R20A 2GA8A 3HCCA 4F7ZA 2G9FA 2O8VA 4QDZA 4GP9A 5G4LA 3ZN5A 1OIVA 3H9EO 4QYXA 2W4IA 3ZIXA 3JD3A 1PFUA 4UZFA 3SCHA 4PE5B 5HKOA 4H7MA 1XNTA 4IHAA 1JZ5A 2CLLB 3H8UA 1Z0AA 2EVWX 1NP7A 2GJAA 3SZGA 4O1HA 5E1DA 5JXGA 4L8VA 1LK0A 5SV5A 2OUJA 4JGZA 4LA2A 1EVLA 2C4XA 1AHNA 2X8LA 3RAEC 3EEOA 2H2HA 4E2GA 2FPRA 4TS9A 2JGRA 2V72A 3O0DA 4IFBA 3QX8A 2CTVA 3BOPA 3R7WA 3EGXA 5FOJB 5IHRA 4LSGA 3NQHA 1OLSB 4X66B 5GONB 3S40A 1ZZBA 2V6FA 4BQ5A 3DEYX 2Y6GA 4IXDA 1GTVA 3P4XA 4Z9XA 1YR9A 4Z4EA 2HA7A 1YJBA 4FONA 3DULA 3BZUA 3KC2A 3IEMA 4CN9A 1NBEA 4ML3A 5IT9A 3LUHA 4YBRA 3FNHA 4GXLA 4XF0A 1TMF3 1X7ZA 3KTOA 3NGXA 1L9KA 3D4KA 5G53C 4Q47A 3BODA 5JZGA 1PJQA 3IYLW 3QEMB 2K9ZA 4NONA 1KARA 3FXAA 4ND8B 2C97A 2ZULA 3FTDA 3LLSA 4PEVA 1K12A 4YP0A 4YNBA 3MLLA 1N32B 6ABPA 4XDYA 2OWEA 1QG6A 2ZGUA 3PX3A 2F48A 3WL4A 3E2PA 2VHVA 3SF8B 5K8VA 5DGTA 2O8OA 1DLJA 4R4XA 5I9MA 5TJHA 4OH1A 2PKXA 3F7TA 2CF5A 5DDJ1 2JGDB 5IM5A 5IYZA 1JLLA 1DYKA 2MOKA 1C0PA 1U7PA 2AK2A 4HDMB 1Y9MA 5J47A 2ZSFA 2AX4A 4QYTA 3C4JA 5FPKA 5K8JB 3DKQA 2R8ZA 3MW2A 3VZJA 4LZOA 2YC2C 3TAUA 3GU3A 4LRQA 4TL9A 3VDXA 4B6PA 2GR9A 5TS3A 2VC9A 2AG8A 4YT2A 3ZDCA 4FPCA 5KREA 1J8QA 1KMQA 2QXUA 3ELBA 2HWXA 4OXKA 1SU4A 1X39A 1CRPA 3ZIDA 1E3TA 1YOVA 1ODCA 1QFYA 1KPGA 4WESB 3ABQB 3UPTA 1V8ZA 1VP3A 3CZMA 5GMOA 1GYKA 2BVNA 1POV3 2KBEA 3DZHA 4K8OA 3JZVA 1XNBA 3RIHA 1I5RA 2VRCA 4CEJB 5IUKC 2QTZA 4H3VA 4ZI2A 3BIOA 2QMHA 1GGEA 2LNDA 2ZWIA 5EP9A 5K8LA 2H1SA 5F9FA 1ZCBA 1IK6A 3B70A 4BGIA 3VPDA 4GB32 3O4FA 4DIDA 4DWOA 3MWDA 1TA0A 3MFQA 1XJ0A 4I2VA 5B58C 3LWDA 1XJQA 4URVR 1XZCA 5IK2A 1PCXA 2PQ2A 1AUVA 2V9CA 2I87A 2QN3A 1V9U2 4NBLA 4LKFA 3MWEB 3ZV7A 3ZV6A 4LDZA 3SCZA 2YZ7A 4UU1A 1YQ6A 3F0TA 4FE3A 1J3RA 4XD7A 3TTSA 4MS3B 2YWBA 3AJYA 2WIAA 3PGJA 1QEXA 1SOMA 5A5EA 1EV12 1ZGHA 2ACKA 4X6XA 1A9XA 2CK3A 1J2UA 1CAXA 5JC1A 3U9TA 1LJLA 2I1QA 1DG1G 3IKTA 4EGCB 2WWSA 2PV0A 4DRRA 4MVJH 4MGYR 4L11A 5FP0A 1U31A 2M6RA 3HR4A 1VBA3 1GNHA 4EKIA 4MGHA 4QYIB 4ND6A 1VMEA 3VD3A 1W8UA 1ONOA 1ZREA 4ER7A 3C3AA 4GXQA 1V26A 3H4IA 3RO7A 4M9XA 2FLKA 2FQYA 4IRXA 3N07A 1X74A 1CQJA 1CZSA 1CUJA 3GJYA 4Q1BA 5DN9A 3TIXB 1XMOB 1VHWA 4GH5A 5ICMA 2O1WA 2DWCA 3HJHA 5IDWA 3ROKA 2RDSA 4Z2WA 1AGRA 1BSVA 3VI4B 3KVNA 4NMMA 5IAVA 2CL5A 3N2EA 2EKQA 4JCOA 4IESA 2QN8A 2Q0XA 2AUTA 3IKVA 2IQIA 4UQPA 3TCKA 4WN3A 5I7VA 2IEZA 2WN3A 3RIGA 1BMTA 1J2RA 4E09A 1F14A 5BSTA 5E7JA 1S3SA 2YJZA 1XBFA 3PEYA 4MCJA 1J56A 1T3GA 2XUHA 2D1TA 1OLXB 2OP1A 2J85A 2HCBA 1T3SA 1ZX5A 4YM2A 3NHRA 3EEBA 3H5VA 5ALHA 3UG7A 5FAKA 1Q7TA 1DDGA 4YM3A 5KCZA 3FTCA 2A71A 2XVGA 5DIZA 3D6JA 3ND9A 1U2PA 2O05A 3U61B 2HBRA 1JVSA 3ROTA 2RD2A 1KWKA 3AVPA 1O96A 4ENPA 3GLHA 1JWLA 3EUAA 3VBFA 5L19A 4HJXA 2ZX2A 2E4YA 3WWDA 3T1LA 4LC1A 1NE7A 1QJ4A 4DR2B 4RIFA 4XDPA 4HN1A 4IL7A 3A3PA 1E1RD 4HL6A 5FA8A 3CU5A 4ARZA 3IUNA 1SM4A 1C0KA 2YYOA 1CY2A 3RVPA 4QDQA 2PAMA 1MO4A 1R092 4D4JA 3ZKWB 5K0NA 2VYVA 4HN0A 1OZ0A 3NHKA 3F6EX 3RAPR 4J3FA 3K92A 1J5PA 2GZ1A 1QP7A 2Q8EA 3LBYA 4K6GA 4COZA 1ZNYA 2QRQA 1VPTA 2TECE 4IO0A 3L1JA 1WOYA 1QBKC 5APAA 3INGA 2WOJA 1VL8A 5TQVA 2CVPA 4X00A 3A6LA 4LLFA 2BZ1A 4YG3A 4JLVA 3ZXUB 2Z2SB 4QHBA 4XUNA 1W8HA 1OQDA 5A0TA 3ZK8A 4H6XA 4HUTA 1OXKB 2J9FB 2QP9X 5GZ3A 1BZWA 3POIA 5A06A 1JMUB 4PZZA 5IAGA 1ZC4A 3V8NA 4ZCIA 2NXNA 2RDRA 3N6XA 3WWPA 3QPCA 1NW3A 4QPCA 5CB7A 4I19A 3V9PA 3L93A 1JPJA 2IS2A 3O8OB 1YVPA 2VYNA 2VC2B 1OA2A 1V6KA 2ZHMA 3JAWA 2OXCA 3CUEF 2OSBA 3S29A 4KMMA 2EW8A 3U4SA 2H2GA 4XMIA 3QEBZ 3PIIA 4CKWA 1PE0A 3OZDA 4ND5A 2OZVA 4Y2HA 3UFXA 1KOGA 1DAOA 4WK6A 1R0XA 1F4HA 3VTAA 4BFTA 3KQNA 2HYDA 2P65A 1XNJA 2C00A 3NAMA 4ZV4A 5K0EA 2R1VA 3UGJA 1T4GA 4HLCA 4MR9B 3FPHA 4ILKA 2JNWA 3WL5A 1BWPA 3ZUPA 4D3FA 2HF9A 3BJMA 3DA8A 4CF7A 4ZJYA 3OJOA 3C6BA 3E9CA 4DNQA 3IXLA 3SM3A 1DO2A 4EYSA 1FA9A 1LB1B 5FYZA 4CV1A 2O1SA 3B02A 2W00A 1JH8A 4PDWC 3HXOA 1TKAA 3ICEA 4WVMA 3IAS1 4QAJA 2OHOA 1REEA 2AQIA 1ZNPA 3QE4A 2HA5A 2C1XA 1LOEA 4UVEA 2QN7A 1U8AA 2A14A 5BWCA 5TC4A 3CX7A 3P0IA 5A5VA 1XWFA 2P1DA 4KHPB 4AR2A 1WQ1R 2ONJA 4BEWA 4R01A 1PYDA 5FYYA 1C7QA 3SD7A 3STXA 4Q66C 2GHTA 4AAXA 2VDQB 1PO21 4MIKA 4RWZA 4D3YA 3UKJA 2WQ8A 4K9SA 2Y38A 5A1JA 2FW8A 3I01A 5DLEA 1GSAA 1YGYA 1RZRD 2PHZA 4CG0A 2OD7A 4M8KA 3RRMA 3ZGXA 3I6BA 5DHTA 1KQRA 4AG3A 2WAAA 5AVYA 2R041 2BNMA 4MPTA 1VBB2 4GJYA 2YIJA 4GXRA 5FBLB 4MDYA 3H4MA 4EY7A 3SHWA 5FMOS 1ZVMA 1S2BA 3OURA 3EJ6A 5J2TF 2UYCA 2ZGNA 1IN6A 3K70B 2BBAA 1LNZA 3DPRB 2CKDA 2WZ8A 4ZAGA 2BMVA 3EMVA 5FTMA 2A3RA 3AYDA 3D8HA 3HSKA 3FIJA 1F15A 4HWKA 4FBFA 4HFSA 1YB6A 1YI0A 4X7BA 4MB2A 3D3AA 4RTKA 2V98A 1HV1A 4WAUA 4HONA 3ONEA 4CG3A 1IZ7A 1AR83 4CLXA 1GMMA 3FTQA 3GGPA 1PK9A 3PIGA 3LH5A 3K1AB 2RK6A 5CYGA 1HDRA 3IIMA 4YFVA 2H7XA 3DEJA 2XNKA 5A0VA 1NW8A 3WY6A 5JNLA 5FNVF 2A6PA 1QU2A 4RZ2A 5AK6A 1JYNA 2I7DA 4IOJA 4XILA 2HPAA 3BL8A 1K8XB 3BU0A 2ECKA 4MWDA 1TMF1 4NK4A 1RKVA 1FUKA 4IWYA 1VAKA 2EALA 3F47A 1V16A 1VI2A 4FILA 1OXMA 1TMYA 2G0NA 1Y7LA 5I8ZA 2ORYA 4FJ0A 3KELA 2UZ1B 1A7KA 1PDVA 4JC1A 3KVBA 3C3EA 4EPTA 1JYTA 4Y7DA 2R66A 5GY7A 1ORTA 9GPBA 2HU8A 1Y9JA 1YJCA 2BMJA 4LO6B 1HLFA 1C3VA 4Z8BA 3RIYA 3KJFA 4KNCA 5COAA 3K0CA 1SHLA 2IYPA 4PPGA 3MRTA 4U8GA 1KU6A 1TT5A 1DG3A 3ZWXA 4Q1FA 3W5NA 2VE1A 1GT91 1JJFA 4P36A 1KQOA 3NHLA 2FEXA 3MYXA 3OGRA 1E9BA 4G0PA 3G6WA 2QXTA 3T1QA 1D5CA 1G5RA 2E4WA 3UMCA 2OV2A 4YASA 2IGBA 5KHOC 1J39A 3OUJA 3TOCA 4D9GA 5T64A 4FYIA 3N7UA 2EQBA 3ZI0A 5DN2A 1XF1A 2ECFA 2DCUA 1MDBA 4KJZA 4N47A 1QV6A 1KS5A 4KBGA 3B38A 2X13A 1POV1 4PQGA 1QVZA 2P5SA 3R0XA 2WUVA 2L19A 4CWAA 3QBQA 3GWGA 5ALSA 1W6QB 4B6FA 3GBFA 3R4DB 2A67A 5I9TA 4I9HA 4A41A 3NJRA 1OHHD 3VKWA 2XQFA 3IPRA 4EN8B 1RPJA 2B3DA 3LM8A 1WMFA 2W2KB 3SSOA 3VL9A 2VZ0A 1U2GA 2B20A 3UWDA 2ZVQX 1JFVA 4ZY9A 4EYQA 4BWOA 3ZY2A 4OJKA 2QSJA 4D6PA 2AGSA 4G65A 5GVSA 3GJ4A 1RYBA 3KYJB 3OPYA 4NIIA 3AWIA 4PYLA 2JFQA 3I2HA 3I2OA 5B5SA 1IPKA 2NTJA 1A9PA 1URXA 1HX6A 3VHOA 1OKQA 3KYBA 4MRRA 3BSWA 4FR5A 1ZHFA 3I9OA 1MXFA 2HFJA 3HY6A 4NWWA 2XJ4A 3OQHA 4G81A 3A28A 3P9XA 1QH1B 4QTUB 3E35A 3TIVA 1NXQA 3I9NA 2PUEA 4L4RA 1XXHE 1OYVA 3ZVRA 3TN93 2W6PA 4XVRA 1G18A 3QMPA 1STOA 1VBA1 2BEUA 5AI4A 5H8WA 4Z9AA 3PJFA 1DIWA 2W58A 2IXEA 1YR3A 5D3KA 1SXIA 4NU6A 1KJQA 1K6JA 2GOYA 4ZRMA 4E51A 2Y0OA 2J0UB 4IG9A 4WHMA 3B9PA 2GD0A 4MMYB 4MQBA 3T0BA 3VZRA 1PEYA 1Q57A 3QVXA 1UIMA 4IUCS 5BNOB 1LQUA 2O0LA 1KI6B 1YO6A 1UZMA 1ZA2A 4LX0A 1AMNA 3HKBB 3D82A 3LGAA 5CHYA 1FQKA 5CHEA 1NHWA 1DX4A 1WXHA 3EVZA 1HY3A 3AJEA 4FE7A 3DXYA 4N18A 3WT3A 1FF9A 1JOPA 4L8GA 2HKXA 1RT9A 1AR91 2AF3C 1LPSA 1UBNA 4HVRA 2OX0A 4A36A 4MJXA 4BLJA 4MRPA 4D3DA 1YFWA 1L7BA 3F3KA 2P4UA 4QTYA 3RU3A 3E7XA 1RFGE 4R8MA 3B00A 2R6ZA 5BMVB 2C78A 3IP5A 4YUWA 3GEPA 1XO1A 3UKVA 3QQ5A 3RJRA 5I47A 3U31A 3QVUA 3HP4A 4E5VA 4DL9A 4EA8A 2WWWA 5JARA 3EUEA 1UU4A 4LYGA 3LHFA 4BE3A 3PF9A 5DEIA 2GMMA 2NUPA 5CFNA 3GM8A 3T3EA 4IQ8A 4C05A 3GF4A 4PLZA 1XE7A 2CHHA 4TYNA 2VHQA 4V1CB 1FPN2 1IVSA 2IXHA 1R16A 3I6MA 2NOAA 4CM3A 2P1ZA 2GH1A 2ZABA 4RV9A 3ZN2A 4IFTA 2JBAA 1M1YA 3F9RA 5JYDA 4YRCA 2ANBA 3ONDA 2FVYA 5DABA 4MUYA 3FWPA 4UNSA 2P3KA 3KE8A 5TGDA 3GA0A 1WNFA 1GFIA 3U3JA 1SEFA 2GF0A 2SNIE 1D4FA 2IU6A 1MRNA 2H1VA 4HT1T 5CJPA 1F2NA 2IXFA 2PAEA 3UQYS 2GC1A 4TXMA 2H57A 3HY4A 4E13A 2IXLA 3BH0A 4F9EA 1FDUA 2DR2A 2QQKA 3OGVA 1CY1A 4XJWA 1XTSA 3GVXA 3KL2A 4LOIA 2Y8EA 1SWWA 3MUY1 1G66A 1PDWA 4ZALA 4HG6B 1HDOA 5CXSA 3ADOA 2A3YA 2P7HA 4PLMA 1A2QA 3PNAA 1P8AA 3MS4A 4MVJP 1NF2A 3QOPA 1DWQA 1TK3A 4KQMA 4DIMA 1L7VC 3VDDB 9LDTA 1TQ2A 2ZJBA 2OA2A 3TW6A 3Q7PA 1UJ2A 2NLOA 5CX4A 3K05A 4B43A 3M9LA 1JDBB 3KXLA 2FSPA 3BTOA 3THTA 2CLCX 3ZH9B 3QTTA 1QNWA 1PVDA 1ZY2A 4HXEB 4IUGA 4CKYA 2F00A 1V71A 4PQYA 2NUBA 1YLLA 4WBSA 3CNBA 3QWFA 2FKNA 4YT5A 4HVCA 1VA5A 1KDVA 2IVIB 1FAYA 3A1SA 4FEAA 2WJYA 2BUAA 3V4VB 3GUCA 4B7ZA 5AUOB 1OR8A 4FOOA 2HQ1A 1O6ZA 2FWNA 3TLCA 4CVUA 3DT9A 1O3QA 2JKZA 3JU3A 2AWOA 1AF7A 4JGYC 3L6RA 4I1PA 3OZRA 3K09C 3HS3A 3B6IA 2IKQA 1DFQA 3T7TA 1X8EA 3AHCA 3F6CA 3T09A 2RI6A 3T1OA 4B3JA 3OZGA 2HT6A 4DXDA 2XT9A 4BLPA 4LXLA 3PC2A 1PVVA 3MTIA 4P9WA 3JQDA 2P75A 1W2UA 1YZKA 1GUZA 2WJAA 2X40A 4C0AC 4C7KA 3B1FA 3DVAA 2BFPA 1JB9A 1XYNA 3C6MA 5EJ3A 5CX1B 4NU5A 3EFBA 5AW6A 4PN7A 3DOOA 5CIWA 3WFJA 4TWTA 2AH2A 3U7RA 4Q2FA 2BF7A 3AI7A 1W96A 3SBOA 1L4HA 1QDEA 3UO8B 5BPFA 2DRIA 2DPXA 3A9UA 5AQEA 2Z42A 4AO7A 2FV8A 3BE6A 2YS6A 3KLOA 3WLIA 2G25A 1ZBE3 3OBRA 3ZV3A 2VDUE 2PRJA 2Y6UA 4ZHNA 4TXJA 4XFBA 3I42A 2D6PA 2KR2A 3VV3A 5BUCA 3FRHA 3CJIC 4YWAA 1GPH1 2ISCA 1DQSA 2WSLA 2VSYA 1KFKB 1WY5A 5D21A 1CSEE 2Z43A 4ZVLA 4QGSA 1QXPA 4KCGA 4EHFA 1UQTA 4BXOB 2W5FA 4PIVA 3AT1A 3EZLA 2PGIA 1YR7A 2VUTA 2QRMA 3DDSA 3D5OA 2PX2A 1M5UA 3G2OA 2NPIA 1RQGA 1MRZA 1VJ0A 2HPHA 5FI5A 3BBPA 5U4XA 2QE3A 1RAGA 1VE5A 5LA6A 3SZLA 3TD6A 5KJ1A 5HFNA 1JHVA 1WPXA 3UHAA 3WXMA 4YJ3F 2VLIA 3EZ2A 1NQOA 2P3QA 3R40A 2LW8A 4TRRA 2PHFA 4EYKA 1YQWA 2XTMA 2EHDA 1G6HA 3WL8A 3DXUA 4NHKA 3MGAA 1QYXA 4BV3A 1ZO8A 1AR81 3I52A 1ZWLA 1BDIA 1XLWA 2YWDA 2QDKA 4A9AA 4P4SA 4RF2A 3WRXC 2GK3A 2V5YA 2PV7A 3BN3A 3KJQA 3WLAA 1KJNA 3O1TA 4G8BA 2Q5EA 4TVSA 4ISQA 4RQBA 4MS4A 5C1IA 3A9SA 1U3FA 3HBZA 4CUGA 1LOAA 3NHYA 3B6MA 3BWEA 3O1UA 1J22A 5JAXA 1CJPA 1GGHA 2WSYB 2HRCA 3CO5A 3ZU6A 2R063 3PXEA 4AOCA 1M5RA 2UUOA 3H5IA 1H30A 3EXHB 1QIIA 4UE2A 4FVVA 1BBT3 1SVUA 3AI3A 5JDBA 5INTA 2PK3A 5ITZB 4NCJA 4N43C 2OYRA 2XJUA 2GN0A 3PTRB 1XU4A 4W1QA 4INJA 4A91A 2ZSEA 3FB4A 4MUMA 3QEJA 3THXA 5PNTA 2WJIA 4YR7A 3RRYA 1YYNA 5I8PA 1EFVB 3DBRA 4HUJA 1GY8A 2W98A 2O8EB 4EHJA 4ZVUA 2Q4DA 2YMPA 5SZKB 4KR9A 4PQQA 4ET7A 5ALDA 4P9JA 3DBHB 4Z2AA 3AP1A 1EG2A 1O4ZA 1GCUA 2PEYA 4BPZA 1PR5A 5J1XA 2GBLA 3NDIA 4R81A 3LJKA 4ENVA 2Z9DA 1W85A 3DOHA 4AMBA 2PZLA 4GUDA 3ZBTA 3GP8A 5K2MA 4ZDWA 2AOVA 2VPPA 1YFKA 2DXIA 2BR4A 5DHUA 1AKWA 3OD1A 1RJ9B 3D3NA 3RSFA 4Q37A 2EGUA 1PTKA 1EDDA 1GTRA 1GQPA 1CDDA 4LV6A 5HP4A 3DKVA 1W2GA 1DAIA 4Q1CA 1O6UA 1URPA 3H04A 4HPWA 4U6NA 5FLJA 2UVDA 1XAJA 2WFLB 3D8CA 3QNMA 3RZHA 4KFRA 5T8KA 1PVC2 3D4IA 3DFIA 3NH6A 1NP6A 1T3TA 2ZGQA 2I4OA 1CJUC 1UMBB 3G2MA 3GJQA 1XCBA 4IVRA 1QUFA 3OF1A 5DG1A 1FFWA 2PS0A 1N2SA 2IYQA 3TNPB 3ORQA 5J3JA 3RNLA 2OB1A 5IVFA 4CMGA 1TK2A 3ZHOA 4X6UA 1L7OA 3EOAI 2QQUA 4PPFA 4UUQA 4QAQA 1HO3A 1LGBA 3FSGA 5E0OA 4JTNA 2VG8A 3KZVA 4KG0A 5GZ1A 2MHCA 2ZJ2A 3V7WA 1O9BA 3IP9A 3ET4A 1WP4A 1LULA 3GGDA 3WGGA 2DE0X 3LBHA 1X9HA 4UFJA 4LE0A 3OLCX 5LWHA 4CSWA 3LTNC 3TN91 2GDJA 4ZO8A 2F55A 5K99A 4S0ZA 1IHMA 2O54A 1F9AA 1E2EA 3ICWA 1T9GR 4QM9A 1PJZA 3GXUA 1YKGA 3RJ2X 2M2IA 4PLOA 1ZKDA 1BE6A 3T38A 2D3SA 2G9RA 1UXKA 2ZTNA 2R5WA 5AK5A 5G4KA 3V1KA 3BALA 1D1SA 4B34A 4CDUA 1LOFC 3R76A 3L01A 4YQYA 1E9RA 1QAMA 1LPPA 2AZMA 2W4MA 3C7KA 2Q3CA 1OLUB 3DFMA 3NWEA 5I8SA 4R8LA 3H0EA 1UOFA 3S55A 2GCOA 2DYKA 1G7RA 4DAOA 4XVQA 1MIHA 5ACA2 4XWTA 1ULOA 1F12A 1A7AA 5ISLA 1A88A 4IJ5A 4C06A 5TGTA 3L8CA 4GKJB 1Z5PA 1EWTA 3TM4A 4ZOLF 1K4KA 1NJ2A 5HJ2A 3CWQA 2RS13 2YV2A 5CB4F 1QYCA 2YQZA 2WHXA 1NBME 3ESBA 2RMU2 1Q5OA 4EMTA 1YUMA 4OHXA 2AJ8A 1GOGA 2ONZA 1W6MA 3UB2A 1ZHOA 3VBUB 3WYFA 5DUXA 1T29A 3NHJA 4EO4A 2UY8A 2VULA 1D6SA 3ELUA 5B6IA 2RKWA 4R83A 5LXTB 1JFRA 4NVPA 4GGPA 4AEJA 3GUVA 4P81A 2C5SA 1PR2A 5E6RB 5I3ZA 3PFWO 4A73A 1RC1A 1RHQA 3A58B 5K4AA 4N3NA 1ISRA 4H6WA 4RV4A 4G24A 4HCJA 2EFEB 3V4PB 2AUNA 1BGXT 1QQ7A 1SPBS 1PFWA 1J49A 4UNPA 1E7MA 3KDAA 3M82A 5SY4A 1ICIA 1L5VA 2HJRA 1J06A 1PS8A 1X0XA 3HB0A 3AEXA 1MX5A 1EUZA 3E1KA 1NCQA 2VZPA 4Q26A 4ZVSA 1YBMA 2R7AA 2H1LA 2PXCA 3LY7A 1U6KA 1P1RA 5EZYF 2F3PA 1GDHA 3AMQA 1REQA 2X1LA 2GPSA 4NG5A 4ZEXA 1LUAA 3G7DA 4F2GA 4O4HF 5A9SB 3FCSB 5KQGA 2C9OA 4IW3B 1XKLA 5I45A 1TXGA 3K9HA 3OKPA 4QUHA 3N7KA 4JLWA 5LLDA 4OL0A 3HE3A 2AHOA 2H9YA 4W1RA 5BUSA 4PIYA 1DLIA 2NU6A 2YOFA 2FPIB 2D06A 1QHDA 1ZI6A 4WY5A 2NVUB 4N53C 3RUEA 1MA3A 5DULA 2I6TA 4QPIB 5BNPC 4U7PB 3IEIA 4YXWD 2ZW9A 1W75A 1AKYA 4J0DA 2X1HA 1MX9A 4JB2A 5C3QA 3W3AH 3DV9A 4O4LB 3HDTA 3ZFEA 4WFIA 4H17A 1M4WA 2O7VA 3PQCA 1X1RA 4UDNA 2YASA 3NHUA 4UE6A 1YD7A 2ASVA 2Z98A 4AQ2A 4RD2A 1NI4A 3BFVA 4F12A 1RXUA 3QF4B 1C3HA 2XXAA 3HR9A 2H9AA 4XQ9A 2LV8A 1G98A 2EJBA 3ETHA 3ZXFA 5C8VA 4Y1GA 4P00B 4J90A 2ZBDA 1HJFA 1W39A 3G68A 1Q2XA 2H4XA 2C0CA 4P31A 4A8JA 1KI4A 3VC1A 2XMDA 2R30A 1SVIA 2J6BA 5CURA 3AZYA 2P9GA 2YU1A 1AG9A 1G3MA 1H8VA 1II8B 3LDUA 1OXUA 3RFUA 1ORWA 3VYSB 3QKUA 4RIIA 4O3FA 3WBJA 2PT7A 5CVJA 1CQIB 3A6EA 2CEKA 4R8RA 5JC8A 4KO4S 3G82C 4XLLA 3GLGA 4IWNA 1B0UA 5D2CA 1E5LA 3UAWA 3ZR4B 2R8XA 4BZPA 4TLCA 3M3CA 7REQB 3E18A 1JEYA 2HBYA 3H3ZA 1IOWA 3OGGA 4LUCA 1XEWX 3I62A 1YI1A 3MUEA 3V46A 5KC9A 3U37A 1POQA 3OCYA 4EW6A 4GALA 1IXZA 2VJOA 1EH5A 1ZBE1 2C9AA 2P9HA 3QUTA 4IIDA 3MELA 4BBZA 4C1XA 4TS4A 3OJWA 1VJRA 4CQNA 2VXRA 3UWMA 3NJYA 4MQFA 1RQ2A 3N8DA 5TPZD 1VJDA 5KYYA 4AMUA 2A5DA 5DTRA 5JW6A 3GFBA 1WIWA 2C4KA 2YVLA 3ZK9A 3WLUA 1G7YA 3U7FB 1QZTA 3KEGA 2G1UA 4DM7A 1BKDR 1E5RA 4MRMB 2WTMA 1HL7A 5BYBA 4JCKA 1MVLA 5AVTA 1GR3A 2WVAA 4IINA 2YW2A 5EJ8A 3I61A 3P8ZA 2HWB3 2EFDB 4F4FA 1KVSA 1KETA 3EBRA 4TGLA 4JGZC 1W5FA 3U14A 3ND6A 2Q3BA 3LQFA 2ODAA 1G5QA 3O5AA 4BMZA 1I01A 3W7BA 2YFQA 1Q83A 1UT8A 3C7HA 2C96A 2BLNA 1UXHA 3ZYPA 2E4UA 2GBCA 4AD8A 2QAJA 5KYXB 4JKIA 3CGGA 3N3HA 3TVTA 2XWJI 4NV1A 3QWAA 1V45E 4HAIA 3A1EA 2WWUA 3HEIA 2QX9A 5JXIA 2BD0A 2QBYA 4X63A 2C88A 1MGPA 3RVOA 1TKRA 5FR1A 1B1CA 3SPXA 3D64A 4JSYA 3WP4A 3BKZA 3DEKA 4BO2A 2OC9A 3ZHBA 5D5PA 4LFAB 1EEHA 4CDXB 4XF4A 3SQNA 2ZP1A 5JZGC 4H3HB 3ETEA 4PIXA 1D4M2 1A77A 5CG9A 2QQOA 1CE8A 2K5UA 3TEFA 5JLJA 3M6MD 5FPSA 5F37A 1NRJB 2V65A 1ECGA 4X92A 1Q17A 2P4EA 4R2IA 2IV3A 5BOVA 1XCPA 1WL8A 3H8WA 4Z99A 1VTKA 2ZPAA 4HGPA 5ECGC 3DT8A 3QYAA 2BFUS 2K2WA 1OX5A 1KO8A 1HDEA 5DTMA 4MKZA 1Q0ZA 3Q9LA 4PYOA 1JIJA 4FNMA 4PSDA 3LQRA 1J83A 3GRCA 2O59A 2FN3A 1FE8A 3MWLA 3UJNA 2JECA 1MAAA 3L8FA 3OQBA 4OYYA 2A75A 3NR2A 3OCUA 4YGDA 4YRLA 3KD2A 4G1VA 1LEDA 1YQDA 5T6BA 1WKYA 1WHSA 4NMLA 4DIQA 3TXXA 1M6VA 4W7IA 2HEIA 1GQRA 2C2YA 4WNAA 4ZZ8A 2Y66A 4EQ6B 3ZE9A 4K20A 3AFHA 3DJYA 1GLHA 4XYGA 5KKCA 2A6WA 1H85A 2AFHE 5JNRA 1Z4OA 4MYSA 5C5CA 5ADWA 1UBGA 3F73A 5JRDS 2X05A 4N4AA 5BRAA 3W3AD 3SF0A 1C7ZA 2F9FA 1EPZA 4DMGA 1V1RB 4CM4A 4N12A 1BHSA 3DDWA 3AZOA 4Z3OA 4TYPA 1HFWA 1AC5A 1QAOA 3L0OA 4O4JF 2PHWA 3AUSA 1E6KA 3LHSA 3OWOA 1GZ5A 1FNSA 5AJVB 4EGSA 3ZZ1A 5CLQA 3OAAA 1CJDA 3F95A 1UJ4A 5JWHA 3AFGA 4BUCA 3VAZA 2A9PA 3DHEA 5JSZB 4BUZA 1ESDA 3WNPA 3D4NA 2NXWA 1TLFA 5FZMA 1F2UA 3AEKA 2G4IA 1YBAA 2B4YA 3V7FA 2GFIA 4H7FA 4RJIA 5AW4A 1FUEA 3M6VA 3B3QE 3FHJA 2Y6FA 4OY3A 5EWLB 1LW6E 4M0DA 2YUEA 5C3UA 2XB9A 1F2TA 5H3CA 2WG2A 1AQUA 1SCAA 2AYYA 4QAWA 3KETA 4V03A 1TOAA 2E63A 1BTOA 1TTPB 3BOSA 1U1DA 3QFFA 5HQ3B 1QP0A 1SKMA 3GT7A 2Q5QA 4DYVA 4QT4A 1XZGA 4UATA 4CMAA 4D9MA 4LGCA 4F46A 3SSMA 4RFSB 2FXIA 2E7QA 2WFAA 3N8KA 5DEOA 1OVSA 4PRLA 1JI6A 3QFTA 4TSKA 2PWZA 4X91A 1G291 3JD0A 5BWOA 5IJAA 3VBOA 5FTJA 1UWWA 3FKQA 3UAYA 5JSYA 4GX2A 3C97A 4R69A 2OD9A 1PQ4A 3C8DA 5MN5A 3Q2IA 4OLJA 5LW9A 4YFZA 2AF4C 5G1NA 4LF7B 2OHGA 4X95A 4BNGA 3QY0A 4PQRA 5C31A 2VLBA 1FP1D 4X61A 5H02A 4BQ4A 1PO23 4MO3M 1DGLA 3H5WA 4LTNA 1OFUX 2IYFA 1WX1A 2YROA 1XD2A 1KY4A 2RS11 3VH4A 4BV2A 3D0RA 1UP6A 2BRTA 1KVQA 3FD8A 3IAS6 3VU0A 1K8YB 4EN0A 4B4VA 4Z7QB 1DPFA 1UOQA 3RPEA 4F1WA 1P1CA 4JJ7A 5EHIA 2D2XA 3PQ2A 4YVWB 1LH0A 3C5WP 5D01A 4UBJA 3DE5X 1ZVQA 2C29D 2HO5A 2BAGA 5CGZA 4NC9A 4UF0A 8MHTA 1MC4A 1DV2A 1OFIA 3VBFC 5J5CA 1R10A 3U40A 2F1IA 1QRTA 4NBWA 4UHFA 2ETVA 4E30A 1RUJ2 2JFPA 4UARA 4FGWA 2VAXA 3HSSA 2V7UA 1MPTA 4B4WA 3FLPA 5M0TA 1FZTA 5ALIA 3HJRA 4NE2A 2Q0HA 1N3YA 1UM9A 4KN5A 1JU4A 4FOLA 4X94A 5IC4A 3FAZA 3ZYZA 4B40A 3PDIB 2GHQA 5F35A 3T3DA 4PINA 2JGKA 3TAYA 2XNDA 4HGYA 3HWWA 2E7TA 3URFA 1I36A 4ENWA 1OGIA 1CX9B 1ATIA 2DVBA 1F8VA 3DNFA 1RYFA 5F9MA 3LPCA 3I59B 1UR5A 3WOGA 2WA2A 4DG8A 4L99A 3R7BA 1QNLA 1W0JA 2AE2A 1FSFA 3R6WA 3F46A 5BVHA 3PU8A 4QPGB 1CNFA 3E4CA 4O33A 2DYCA 5B53A 4YRAA 4AG6A 5JI2E 4BISA 2EW2A 3WAKA 3WF3A 3N87A 5DYWA 2JFFA 2W6MA 4J91A 1UKZA 4F8YA 1P17A 3A9WA 3DP9A 4I8IA 2WYSA 5E0KB 1F4VA 4LISA 4BL5A 3KTFA 5CK5A 3QU2A 4LTMA 3KYDA 2I33A 1MACA 4BJ0A 3GRZA 3WLEA 4BZXA 4YM1A 1Z08A 3MGGA 3L8DA 5DX1A 1NIPA 5CBKA 1ODLA 3O75A 5I8WA 5I91A 1AZSC 4XB2A 4U5XA 1AHHA 3WNZA 3E3OA 4MINA 4M2LA 3HZZA 5KWIA 1DKRA 1NY71 5FJJA 5CDGA 3VVBA 4YVSB 4LGVA 2I3BA 4MP6A 2AVNA 4I1YA 2OXEA 1W87A 3SFTA 3OZEA 1ND6A 4YDRA 5DGCA 3EYAA 3ZDAA 5T57A 4JIGA 4I4LA 2W6JD 1VMDA 2Q2QA 2B30A 1OOPA 3DKIA 2R0HA 1JUIA 1AXRA 3KNZA 3R4UA 4BQ2A 3Q8EA 5CZKA 1HRKA 4TYMA 2WWXA 2AEMA 1C1HA 3OY8B 4MGYE 2HZBA 3IPXA 4F11A 3DB1A 4TM8A 1VYVA 1OD5A 4R7TA 2R8OA 1UPXA 2R2GA 3UETA 2B94A 1VBNA 3QKIA 1TVCA 4DIEA 5DWDA 4GVLA 5DMHA 5CDSA 5FLKA 2ECOA 1AQ6A 4OHOA 1KJWA 4L7QA 5FY8A 1IBSA 1DAPA 4QUIA 1ZM2A 3DP7A 2VWPA 3OF3A 1P5RA 1DDIA 4DPNA 2FSHA 3OPMA 3TTTA 3VPFA 3RS3A 5C2JB 3ES1A 2I2BA 5LB4A 1FFDA 1OWNA 1ZH6A 3C8HA 3FMOB 1KMHA 5A9RA 4O2RA 3VMMA 3BB3A 3LNCA 3Q3CA 1G7SA 4I9GA 3AM2A 4KG8A 2Q5IA 4C4OA 3GEHA 4MI6A 3GRVA 4J1WA 1XNRB 2RGUA 1YCDA 4ND7A 1PVOA 4A5SA 1RWWA 3GAAA 4UNRA 4BO9A 4KDRA 3D6EA 3KEOA 4E4ZA 2Q6TA 3OPYI 2RG4A 4L73A 3HVJA 1MHPA 1ST8A 3AUJB 2MHFA 3FG9A 2ZVPX 3TOXA 4JMPA 3L06A 3GVHA 4FP2A 3EISA 1EBFA 3DVQX 4RWEA 5E8JA 2HWB1 3ODPA 2JE9A 1NW4A 2GSDA 4CF5A 1WS6A 1SOVA 1FX5A 4AHXA 3QP9A 5CDFA 5EUQB 2W6CX 4ID3A 1BXGB 2Q62A 1MG5A 2DFCA 4EWDA 3P9IA 2WSVA 3M70A 5FORA 4RK5A 3M8KA 1H8ED 4K03A 3QXCA 1XLVA 3I64A 1XEXA 4UD6A 3T99A 2WM8A 2Y1FA 4I02A 1E96A 2PNFA 1CD5A 2H1HA 1UMDA 4CF3A 4CEWB 3BTSA 1NBMD 3SR3A 5CH3A 3VPHA 4MUJA 1ZJ5A 2GYVA 4U7TB 4KTTE 1SXJA 4AFCA 3GLRA 4OV6B 4QU9A 1AR93 5EIBC 3P2MA 2Q0SA 3JVEA 1XLTA 2V4ZA 4MRAA 1V1JA 4XEHA 1XVAA 3SJAA 4RZQA 1I4LD 3A6HA 5T4EA 2H1OA 2SLIA 4O59O 1MHTA 4B5KA 3ONVA 2QVLA 4PCLA 4TTRA 4QIHA 3B60A 2C58A 4O65A 4AAPA 5BMOA 3EVBA 4NENA 1VHDA 4Z7JA 2QD2A 3REQA 3U13A 2PPVA 1BEV2 3KWLA 2Q1SA 2G8LA 3V32A 9ATCA 2A92A 3U4DA 4N5IX 1JQBA 3X1KA 3VU1A 4BQ3A 1RLJA 1A95A 1P4JA 4D79A 2EBHX 4AHYA 3K0CC 4NS4A 3IHWA 3TQRA 1RI1A 4DV2B 2JI4A 3ZHVA 2Q0AA 1ZH8A 1ADFA 1H0HA 3M7IA 5FI1B 3ILFA 3LDAA 3IODA 4KQ2A 1RRMA 1D2HA 3OMWA 4LZPA 1GGVA 4KE8A 3ABSB 2RJ3A 3E1GA 2RGNA 2QA5A 2GASA 3WIEA 4KWIA 3AC0A 3C39A 4JL8A 1KEEA 3T3OA 3GLHE 1IJKA 2NN3C 4A10A 3UK2A 1WCYA 5FOQA 5AJWA 5K6TA 4ABYA 5HCBA 1H6BA 5CISA 2JI8A 2AN9A 3NPMA 1G4UR 1DV1A 3UXEA 4N7IA 4DV5B 3WB2A 4JSRA 3NTXA 1KVUA 3I58A 3CL1A 4XFGA 1G3QA 1NYLA 1JXQA 3VR2D 1NJGA 2QVZX 3MQFA 2CU5A 4XYEA 5KVVA 1U2GC 2VH1A 3OBAA 2OYCA 4Q0QA 2P8JA 3CNEA 5L3RA 2Z1NA 4KHZA 5A7QA 2F1OA 4MV8A 5TB5A 5B1EA 3W5MA 2O8BB 3SQMA 4S2GA 3GQBA 2VPIA 2XSZD 3NDRA 1V3UA 3BXZA 2VEOA 1F51E 2JLVA 5BR7A 4U7FA 3KALA 1KOLA 1QCYA 5AUPB 1TAHA 2ZRQA 3LX6A 3BMOB 3RVJA 3N0TA 1H2ZA 3X1ZA 3E84A 4CKCA 3E6BA 1GRNA 1CDZA 2ZJOA 3G9XA 3A2LA 3N5CA 4HB3A 4BGUA 2WWVD 2AACA 2B45X 2VJPA 4C3UA 4OFXA 1JG6A 1WZCA 1MBZA 4LMFA 5FPLA 4H7HA 1WVIA 2V9ZA 2B1RA 2ZX1A 2A94A 3NNFA 2E2WA 3T1YB 2XDWA 2BKUA 1E1QA 1L8LA 3LX8A 4XE9A 3M4NA 4V2IA 1A6CA 5ALXA 4KVAA 1GWMA 3LPLA 4GSLA 3OA0A 1D2CA 4ODIA 3NGMA 2E5LB 4Y1ZA 4JNKA 3FSJX 3TX6A 3AESB 3B6EA 1NE6A 1QYRA 1GITA 2ZEWA 1TLLA 2DKNA 4BEVA 3LGXA 4ZHQF 5FWNA 4YRTA 1MAVA 5FUQA 2JD0A 3WJ1A 3DV0A 2RJOA 4Q24A 4JZYA 4EKDA 1IAVA 2RIRA 4EPYA 4ED9A 3SEPA 1H6DA 2QE7A 4NK5A 2O07A 2QD3A 3H8XA 3KGZA 5CUQA 2DTXA 4CCWA 4F5EA 2NXEA 1P1FA 4Y2YA 1FNZA 4WV8A 1O58A 1S7GA 1N2JA 4HS9A 4A3SA 4ZZIA 5BW8A 4BQRA 3RS7A 2Z8XA 2P34A 5HIJA 1IJEA 1W9MA 3RU9A 3RJZA 5J63A 2ZB2A 3DXFA 3DZBA 1WDKA 4BKOA 2HR1A 1R15A 2IUSA 2A35A 4P38A 1Q3KA 4RMNA 3C7DB 2CE2X 5LQMA 3MF6A 5JVVA 3L8ZA 4R0NA 2AOUB 4PS0A 3HGMA 3OM8A 3HJGA 1GYRA 2ODTX 4G86A 3FGNA 1HV8A 1LF0A 2IYZA 2VGDA 2FW9A 4O1MA 2J08A 2CMKA 1WJGA 4GDMA 3ODGA 3ML1A 3LQCA 5EIYB 4KWTA 4G0MA 3WX0A 2YRFA 2QORA 3UQZA 2LM3A 3OU6A 4DLPA 2RCYA 3RYRA 5AOVA 2IZ6A 2JCYA 2ILVA 2PUVA 3TBKA 4X20A 4AP5A 4PHFA 1VLVA 3I5AA 4H60A 4FLEA 4R9NA 3JZAA 4C2UA 5EHDA 4RXMA 4UEOA 4GR4A 2WNHA 2B5WA 3LIGA 1F6DA 1V5EA 2PTHA 1EM8A 4KQWA 5I7OA 4DLWA 4QQOA 3AR5A 3DWEX 4YA6A 4GD3Q 3LDFA 3WMWA 2DDUA 1JFFA 5AESA 3K1TA 3EG9A 4YCAA 2PO7A 2BKAA 1U6IA 2GM5A 2XECA 2XZTA 1QJU3 2JHGA 4HVOA 4LPLA 4E32A 2EKZA 4EHNA 5CA1B 2CVOA 4RN5A 4N7BA 2PMCA 3QA9A 2AE1A 4N1AA 5DNUA 3QW2A 3EMRA 1C81A 1RU3A 4FGUA 4B4OA 4LBQA 4A8TA 2Z5GA 2XPJA 4OM8A 1MZEA 1YRYE 1Y8RB 1EJBA 3WDSA 3K8QA 1EAMA 8ADHA 4CM7A 3OBTA 1ZSVA 3KKPA 3ZGYA 2VQAA 1XEFA 5GJBA 3M1LA 1JXAA 1B73A 2RHWA 2VL4A 4ZOLA 2XF8A 5L9RA 1QYVA 1K3UB 3LDRA 3THYB 3UCEA 2BEOA 2A0UA 4XR9A 2QM3A 1N36B 5CB4A 4G5SA 2O8FA 3KGLA 1O54A 2V03A 5T7BA 1XDGA 1B6GA 4GKYA 4JP3A 1SKYE 2ZYUX 3VKMA 1Z7S3 1MTZA 2J7PA 4ISBA 2C4HA 3I7DA 3PE4A 2F3UA 5J4VA 4YJ2A 4BFVA 4B74A 4CMEA 4XIGS 4G0NA 4MKXA 4ES6A 2DF7A 1XU1A 2O52A 2C9KA 2O2IA 3M3PA 4EW2A 4J1XA 2RHDA 4A0SA 5LDDC 4YRMA 4RCZA 3HU1A 3M4XA 2J07A 3D6UA 3MMZA 8GPBA 3AEYA 4CQLA 1Y8QA 3P9ZA 5FL7A 2W87A 2XJ9A 2XCRB 3ZDFA 1V6NA 5HCFA 1Z37A 4TLBA 2PT6A 2GETA 1JEAA 3ZSEA 5KMGA 2QVXX 3TXAA 4URWR 4B1MA 1QQP3 3IPAA 1XDWA 4NROA 1ZD2P 5IJXA 1RAHA 3IDBB 2V7VA 1GFSA 2BGOA 5DBEX 4J16A 5FHQA 3LFTA 1XMXA 4Q4X3 1SCNE 5FMCA 3KLBA 1L5FA 3K2EA 3V1YA 2ZJ1A 2P67A 3SZ3A 5JALA 4XBQA 1R50A 1NNEA 4HLTA 1YKSA 5AKJA 4WXYB 5EZYA 4U2GA 1WXDA 2NZWA 3HMYA 2YXBA 5FEUA 3PNKA 2L0XA 2Q50A 1OU4A 5DOVA 2GXAA 4H3WA 1G9FA 3HEAA 2DFNA 2QW8A 5T5LA 3AFMA 1A4XA 4A7ZA 1H5UA 2CNKA 3CRVA 3ANSA 1WOMA 4NCXA 5ALYA 1BKSB 3MGUA 2XJQA 1DCSA 3UAGA 3MRSA 4MR7B 3JVVA 3QXJA 3T3YA 1HQDA 1DMSA 2ZWOA 3L1KA 4YJHB 4AEDB 3R3SA 2VQSA 3AETA 1XVUA 4EM6A 2BFFA 5ARCA 4U6SA 1NXTA 4MKIA 2Q6OA 4LMAA 5ADHA 1G8GA 3IUBA 5FBJA 3WGMA 2VTBA 1SBYA 4RS4A 2RHHA 3DWIA 1VG9B 2RSLA 3T41A 4XE5A 3PDHA 4YQZA 4DR5B 1OA0A 1JDUA 1AX1A 4ZAWA 1W48A 4FQ4A 5ALEA 4C2AA 5E1MA 3O73A 5F98A 5JYEA 1CZTA 4UM8B 2RBGA 2DBZA 4KIFA 5JXWA 3H1MA 4M3CB 4KQHA 4N5DA 2ZRCA 1JYXA 3C98A 1GR0A 2YY1A 1K92A 1L1RA 3KCNA 1C9MA 1F35A 4XM2A 4DGSA 3BH7A 3CX4A 1V8PA 2W2PA 3ZD7A 2FZEA 1OX4A 1SCDA 3FDFA 4G5RA 4URYR 1R6VA 4IH4A 1DBVO 1ZUD1 5ESXA 2IIPA 5K8UA 2Y05A 2ZWAA 3LA7A 5BSKA 4YT8A 5KR7A 1CRWG 2WNUB 1G2IA 3V00A 5EC8A 4BB6A 3AHEA 1R4AA 4CR8A 4Z8XA 1JIIA 4MV4A 2TSYB 1W35A 3LXUX 4Q1EA 3V2GA 3VBCA 1WBBA 3EFEA 5EPUA 1ZMTA 3OIVA 5ERYA 1BH2A 3UWOA 3W7VA 3WQSB 3ZWWA 1L3IA 1T0PA 5JO9A 4LVUA 1V7CA 3IJRA 2PYIA 3ZE8A 3TBFA 1KH1A 1DRUA 5DNEA 4BE7B 4CNQA 10MHA 4XIFA 1X3SA 4EHHA 3VYVA 2P6MA 1XZDA 3VX3A 2K7FA 3OH8A 4WGFA 2V8OA 3T3PB 5CD1A 1VIWB 1P5FA 3UJQA 1H0KA 3C3MA 4JHZA 5MHTA 4HUQB 2YRXA 5LOVB 3LWCA 1EA5A 4OQQA 3NBAA 3GDFA 5FPZA 4GKBA 3F4BA 3SM9A 3TQQA 4WNCA 3ROPA 2GBLC 4U2BA 3V8VA 3IWZA 1R7RA 3DR3A 4BMSA 3MXTA 4QTXA 1WSBA 1BEEA 3HBAA 1GNVA 4Q39A 5FYVA 4QNNA 3NOQA 3U56A 4FBLA 2JZCA 3FPFA 4Y2VA 1UMZA 4HB0A 3WG4A 4YV1A 2ZMLA 3D3WA 3W2GA 1GEEA 2XHZA 2Q3DA 3O74A 5GM2A 2VXOA 5FNZA 4P35A 1YI7A 1NOIA 1M1YE 1G42A 5JJLA 2UDPA 2RMKA 2ZAOA 1SCJA 5T8KC 4NOJA 3IJPA 1TUBB 3CVOA 1YR2A 3MCTA 5MFZA 5A3UA 1N0HA 1NW9B 4W5RA 1AF4A 4HDOB 4YLEA 3WGTA 3GGOA 3WTCA 4RW0A 5BYKA 3P2YA 3PU6A 3UGKA 5AVRA 2I2WA 2ZIXB 4XGIA 1QWRA 4QEZA 2PUJA 1YZGA 4GGOA 2ZYDA 3CLSC 5EMNA 3EPLA 3CZAA 1OI7A 3IP8A 4ER3A 3JQRA 5BSWA 2VH9A 2COUA 4M54A 4WI1A 1NVUQ 1L5MA 1I5PA 5I51A 5J5AA 4Q01A 1QHFA 1EAYA 4PIPA 4HZUB 5EKSA 4LK6A 3RRBA 4DSZA 4P8RA 4U36A 4K9OA 1OJ7A 5HFJA 4K9DA 5G0VA 1IVYA 1SQGA 2YY7A 3IQEA 3FJSA 2HOQA 2H3HA 3W5VA 4RESA 1SLCA 1HEYA 3E3AA 1EFUA 5FYTA 4B3SB 5E3IA 2E7ZA 3H1TA 2QAGA 4EELA 2ZBVA 3VNRA 3ESZA 2WS93 1B0AA 1C5IA 2FZKA 5JEEA 1LLQA 1KU0A 2NO7A 1G2OA 4KRYA 4PVDA 4IIVA 4LHWA 4HBGA 1ZP6A 1GGMA 1U9IA 1E7SA 3WR0A 4JI1B 4CDUC 5EP2A 5FZAA 3PC3A 2VRCD 4Q4V2 4MV2A 4KH0A 1SCUB 2P3OA 4BQEA 2P68A 1JL3A 1R0BA 5KDLA 1WTAA 4LAFA 5F5CA 5B6JA 2ZYAA 4MVJM 4OFGA 4RVGA 1RB8G 4QU8A 3SVZA 5C8ZA 3OJFA 2O9JA 3CUSA 2YMZA 2VZEA 3ZXLA 3B6JA 1IS5A 2VAVA 3ICCA 4DCGA 4MXVA 1USIA 1KI9A 4GM1A 1NWCA 1T26A 1REFA 1ALYA 2DETA 3G0IA 5IKMA 3B3GA 3PTLA 2VNRA 4RM2A 1TCCA 1YVEI 4EARA 3QSGA 4Y1YA 3TZCA 2ZYRA 4F4CA 5IK2D 1A5AB 3L18A 3H7JA 2HLNA 3IDOA 4TZDA 3BJEA 1NZCA 5LY1A 4LGMA 2YQ4A 5J4KA 4XD7D 3IEVA 5DWVA 3X0DA 4KUHA 4ZAFA 3WKEA 3P2KA 4NNOA 1W9WA 4I36A 5IFTA 3UGFA 3ZX7A 2Y68A 3C8XA 1MX1A 2OYSA 4CCAA 3HEMA 4L16A 3DF7A 2GNMA 1E0KA 3WGUA 1CAUB 4UOJA 4Q9NA 1A9SA 1N8SA 3ST7A 2NMOA 1BX3A