5FBZA

Structure of subtilase subhal from bacillus halmapalus - complex with chymotrypsin inhibitor ci2a
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
432
structure length
432
Chain Sequence
DVARGIVKADVAQNNFGLYGQGQIVAVADTGLDTGRNDSSMHEAFRGKITALYALGRTNNANDPNGHGTHVAGSVLGNATNKGMAPQANLVFQSIMDSGGGLGGLPANLQTLFSQAYSAGARIHTNSWGAPVNGAYTTDSRNVDDYVRKNDMTILFAAGNEGPGSGTISAPGTAKNAITVGATENLRPSFGSYADNINHVAQFSSRGPTRDGRIKPDVMAPGTYILSARSSLAPDSSFWANHDSKYAYMGGTSMATPIVAGNVAQLREHFVKNRGVTPKPSLLKAALIAGAADVGLGFPNGNQGWGRVTLDKSLNVAFVNETSPLSTSQKATYSFTAQAGKPLKISLVWSDAPGSTTASLTLVNDLDLVITAPNGTKYVGNDFTAPYDNNWDGRNNVENVFINAPQSGTYTVEVQAYNVPVGPQTFSLAIVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Enzyme subtilase SubHal from Bacillus halmapalus
publication title Stabilization of Enzymes by Metal Binding: Structures of Two Alkalophilic Bacillus Subtilases and Analysis of the Second Metal-Binding Site of the Subtilase Family
doi rcsb
source organism Bacillus halmapalus
molecule tags Hydrolase
total genus 154
structure length 432
sequence length 432
chains with identical sequence C
ec nomenclature ec 3.4.21.14: Transferred entry: 3.4.21.62, 3.4.21.63, 3.4.21.64, 3.4.21.65 and
pdb deposition date 2015-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
A PF04151 PPC Bacterial pre-peptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5fbzA02
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5fbzA01
1DBIA 1TM4E 2IY9A 4HPKB 4KB5A 1R6VA 3EE6A 3CO0S 3BPSA 3VYVA 5K7SA 4WOBA 5B1DA 1OT5A 2B6NA 2WV7A 3EDYA 3LPDA 4LVNA 5FFNA 1SIOA 1P7VA 4NE7A 1GCIA 4DY3A 1UBNA 5JXIA 1QXPA 2IXTA 2PWBA 4FONA 1GNVA 1SBIA 3PTLA 4GI3A 5AVKA 4RYDA 1SCAA 2TECE 2WWTA 1WMEA 3DE5X 2ST1A 3GCXA 4DWWA 1MPTA 1WSDA 4DY5A 1NDUA 1WMFA 1OYOA 1GA1A 3D43A 4H6WA 1CSEE 1C9MA 1Y4AE 4I3GA 5CW1A 4DZTA 4K8RB 3DVRX 1S2NA 2XVKA 1AV7A 1TM7E 1WVMA 4J94A 1KFUL 2Z2YA 1AU9A 1P8JA 3JQXA 1Q5PA 4Z2AA 1ST2A 1SELA 2PWAA 4I0WB 2PQ2A 1AVTA 3D9QX 1SN7A 2ZWOA 5B1EA 1KDYA 2QTWB 3TI9A 5AMXA 4CG0A 4CFYA 1DUIA 2QFEA 1LW6E 3A3PA 1DF0A 3WIVA 1SUPA 1V5IA 1Y9ZA 1TK2A 2P4EA 3DE3X 3QMPA 2SECE 1YU6A 1TO1E 3LPAA 4AKSA 1C9NA 1BH6A 1NLUA 1Y3CE 4NE9A 2XRMA 2GKOA 4DZGA 2PYZA 2W2NA 3AJ9A 3I30X 3AFGA 1Y4DE 3A3NA 2Z30A 4LVOA 2PMWB 1T1EA 1PEKE 5ARBA 3Q40A 1KFXL 1P7WA 3PRKE 1AH2A 1PTKA 3DE6X 1SVNA 2W2MA 1Y3FE 1GA4A 2XVGA 5AQEA 4M1ZA 3AJ8A 5I9SA 1HT3A 3F7MA 2SBTA 4WOCA 2LUWA 4AKTA 1OYVA 3BX1A 5FAXA 2Z58A 3LPCA 3DWEX 1SUDA 3EIFA 4OMCA 3LXUX 1Y3BE 3GCWA 1AK9A 1VSBA 1TM3E 1R64A 3DE0X 1T1GA 4B5LA 4H6VA 1C3LA 5JXGA 2SNIE 1BE6A 3DYBA 4ZARA 1NQJA 4OMDA 4OV6B 4ZOQI 1GA6A 4H6XA 5ARDA 1Y33E 1BJRE 3WQBA 4HPKA 1AF4A 1YJAA 3DE1X 1SUCA 1XF1A 3DDZX 4C3UA 1Y1KE 1A2QA 1TMGE 2DQKA 2DP4E 3BOWA 1NDQA 3H42B 1GT91 5JXHA 3I2YX 2ZRQA 3GT4A 1SCNE 5ARCA 4CFZA 4KG7A 3T41A 1EA7A 1R0RE 3DE4X 1THMA 2O8OA 1PJ8A 2E1PA 3WHIA 3DE7X 1KDVA 1BFUA 2W2QA 3L1KA 1SBNE 2DUJA 4JP8A 1SUEA 1PFGA 5SV5A 2Z56A 3GT3A 1SBHA 3ZXXA 3A3OA 2X8JB 1C9JA 1T1IA 3WIUA 1TO2E 4BWGA 1ST3A 3JQWA 2W2OA 3VSBA 4HX2A 2PKCA 1SBTA 1U5IA 3DE2X 3VV2A 3DVSX 2Z2XA 2HPZA 1TECE 1TM1E 1IAVA 5SICE 1GTG1 1GTJ1 3F49S 5FBZA 1SCJA 3DW1X 2PRKA 3TECE 3DW3X 3TI7A 2Z2ZA 2SICE 3ZXYA 3OSZA 4HVLA 3VHQA 1SH7A 3VTAA 1Y48E 1SUAA 1MEEA 1IC6A 1SPBS 4MZDA 3I34X 1KE2A 2ID4A 5AVJA 4NMXB 1EGQA 2X8JA 2Z57A 1BE8A 1NQDA 1SIUA 3QTLA 1BFKA 2WUVA 4DJ5X 1GTL1 3HJRA 1KE1A 1S01A 2XVLA 1SUBA 4C3VA 5JXJA 3I37X 5JMOA 1SCBA 2V8BA 3BGOS 3F7OA 1CNMA 1JEAA 4DXZA 1GNSA 1Y34E 1SBCA 3QFHA 1Y3DE 3Q5GA 4YN3A 1YJBA 3SICE 2W2PA 1S02A 2ZWPA 1TM5E 1KDZA 1ZVKA 3CNQS 1V6CA 1WMDA 2HD4A 3SQOA 3VV3A 1SIBE 2WUWE 1AQNA 3UNXA 4G9SB 2XTJA 3DF0A 3DVQX 2ID8A 2G4VA 3P5BA 1ZVJA 1SCDA 4KPGA 1YJCA
chains in the Genus database with same CATH superfamily
1WETA 3LGXA 1BYHA 3APBA 5IJXA 3WNZA 1VAVA 4XPZA 4EOGA 3QE2A 3AZPA 3O94A 4E9KA 3T3MB 4EW2A 2DMRA 2ZTUA 4RU1A 4JC8A 2J6IA 1J07A 1Z39A 5E88A 3FVTA 4FILA 1TI7A 3MLLA 3ZWWA 3LL7A 3BZWA 2VDQB 1O4YA 3GHNA 2BI8A 1SBEA 5D7NA 3PTZA 1QDEA 1DKQA 2VEOA 1B6SA 1DQ2A 3FKJA 3PTAA 2JS7A 5I7HA 2NP7A 3GW8A 3TAHA 1ZBA1 4MCJA 2JE7A 3KT8A 4ESEA 1FMCA 3AVUA 3IIIA 1E3SA 2PX8A 4D9MA 2XXAB 1XWWA 4FPOB 2W46A 1XZAA 1G18A 1L4EA 4LUKA 2RGUA 2PAAA 4ZKDA 5CCBA 3V1UA 2R86A 2A0KA 1L8OA 1X2EA 1KDPA 1QXSA 4XJUA 1XSRA 4OXQA 1S2EA 4BLQA 3FRHA 4O2AF 4GLFA 1H8TC 4M2LA 3D2AA 4KREA 5ITSA 2OV8A 3J7MA 3SQXA 5AFBA 1PR6A 1W0KA 5CJ2A 2PE5A 2DPXA 2RM23 3RYKA 1V48A 2OCBA 2OO5A 4EYQA 5FZEA 2H08A 5JJIA 4GD4A 2Q1YA 3UHFA 4YM2A 1U3FA 3M6FA 4G8CA 1OFHA 1GKUB 1JN2P 1H6XA 3I28A 1TU0A 3MIEA 3TN93 4P3PA 3V4VB 2ZZMA 2ZUBA 1TMF2 3QX3A 5D3QA 3NM5A 1U2GC 1MW9X 2BIFA 1QGZA 2Y6KA 1OA4A 2P65A 2UXBB 3THXB 1TLTA 3TX2A 1OJLA 2YXSA 3RVPA 1WULS 3LOIA 2C24A 2CHHA 2O8NA 1UBKS 1NY5A 1GITA 2G36A 5A3NA 4Y1RB 3E22B 2HRBA 2QR5A 4EJSA 3MTQA 2OO5C 1FOEB 1DINA 1W7AA 5FIXA 1VCIA 2Y34A 3B7MA 2WT9A 3OOHA 4JOBA 3I45A 3WNPA 3VHPA 3WP4A 1NUSA 1KY2A 3R3XA 4QXKA 2ZAGA 4DLPA 4P38A 5I7WA 4N3BA 4Q4X3 4Q3LA 4W99A 1F6WA 2WF6A 4RXTA 1AB6A 4JUDX 3WOHA 4J0IA 4G25A 4P3OA 4AZ3A 3JQRA 3SQNA 3WD5A 2IW3A 3R3SA 3UK2A 1GXSA 3FNRA 2D1RA 1LDYA 4PM4A 3R1IA 1Z7S2 1N2IA 4KBGA 3I3DA 1HQCA 3TR5A 1BXRA 1KXJA 5BORA 1L4FA 4W9RA 1IJBA 2PO7A 2X2OA 4OA8A 4G1EB 1GR1A 1CFZA 1HORA 2BM0A 2GC1A 2PBFA 4EJSC 2C88A 4WZ6A 2F17A 3PITA 1ZLYA 4P22A 1N6RA 1NSFA 1GRCA 5JCOA 4BZZA 3RIEA 3QPDA 3AG5A 2WWHA 1NE6A 3AMMA 1VSTA 3UUEA 3ZKAA 1SHZA 2QB5A 1SKYE 5BRNA 2HEYF 1RUD1 3TECE 2R6GA 2P2NA 5F2EA 1IBLB 3KWLA 3G68A 4KBFA 5HQ3B 1CIJA 1J2EA 1UL1X 1LPBB 1W6UA 3EEIA 4WA7A 1Q2UA 2NV2B 1QLWA 5IJ0B 4XW2A 2HK9A 3PPWA 2VRWA 4MOWA 2PR2A 4BNKA 1NULA 4D6RA 2VK2A 1UXJA 2ZYAA 1I9RA 4EJ2A 4FS3A 1MGOA 1ZOIA 5AXCA 4Q4LA 2Z57A 2DJ5A 5IVEA 5K0JA 4BWOA 3N6XA 5I5GA 1COV1 2P27A 4O8CA 4PZPA 4UEQA 2HA5A 5JCOC 1X8LA 3AKZA 3WIEA 1TZOA 3T1TA 1AXZA 2ZJFA 1XLWA 1TE1B 4IJ6A 1SG3A 1QQAA 1FX1A 2YVUA 3ETGA 3V8VA 3HK2A 4B4WA 4OAQA 1JIQA 3FH0A 3IT8A 5T3UA 3EIEA 2O05A 3UNPA 1V35A 2H4ZA 2ZWPA 3AYEA 4MWCA 4ICIA 1DZTA 4OEHA 4IESA 1IATA 1F9EA 3V7FA 3PNAA 1IXRC 2UYHA 3V7WA 4DL9A 1O0CA 4U5QA 2PH7A 4G0QA 5LYJA 4QB6A 2ZGSA 3RU9A 4AWDA 4HNAB 4JZYA 3OD1A 1WCKA 5M2QA 4AAXA 2FOXA 5EWLB 4XH9B 2OWDA 4LN1A 3R6DA 3R5HA 3ER8A 2QN3A 2ZQZA 2EEZA 5IRCD 4DDVA 3AR3A 3KLOA 4RA6B 4JP2A 2WU3A 1UDXA 1OZ0A 2X53S 5AI5A 4CM5A 3VYWA 2J32A 4RANA 3C6BA 2ZX0A 5AJVB 1ZJ5A 5JW6A 5E0KB 5HA5A 4ZPIA 4RPGA 3NU1A 3FA2A 4QVIA 2Q1UA 4AZVA 5IANA 1C9MA 3C2QA 4XPIA 2JIBA 4O4IB 2OOSA 3HGMA 4CM8A 1GLHA 3SCZA 3PQEA 2GAFA 1X3LA 5CCDA 3Q4GA 2PYDA 1DUSA 3IV6A 4Q1RA 1C4OA 1TKAA 3LSYA 3HY6A 5EFOA 5GOTA 3LQ1A 4ARAA 3UYLA 2HBYA 3LM8A 3O03A 4L1KA 1DF0A 1CVRA 5FI5A 4D3FA 5A5EA 2BEVB 1NJ8A 3IO3A 4C6SA 3FD8A 4OHXA 2PRSA 1N3IA 1G8YA 4HEHA 3RZMA 4QEDA 5BSFA 2IF2A 4MQEA 4C06A 2QZZA 3KT4A 2JKBA 1XSQA 3QF7A 1PDOA 1PGQA 1PTKA 2ORXA 1Y3FE 5CLIA 5FPVA 3THDA 5JADA 4YCSA 1AHSA 3CCBA 2DWOA 5EAIA 4GD3Q 4RHYA 3BFXA 1X8JA 4IV3B 1IBKB 2FWPA 2GHIA 2GJSA 4ZIRA 3W4IA 3L0IB 5EXEA 1U7TA 3FM9A 3HIFA 1X7NA 1ZUHA 5KHJA 1W0JD 3H1WA 5A5GA 4CKCA 2GARA 3OTFA 1SZPA 3D0KA 4LYDA 3H8XA 5C6CA 1PIV1 3WGGA 1HQYE 4DB2A 1GG5A 4Q0UA 3BG5A 4PLOA 2BFFB 2HWE2 1H8HD 4TYYA 1KJIA 3OF2A 5LZ5A 3WNNA 5ALZA 4H1HA 3QWIA 1SHLA 4C3UA 5GLWA 1P5ZB 3T7JA 1IAQA 2Q4OA 1JBCA 3R0RA 3M2MA 4LE1A 4P7BA 1V6MA 5BURA 9MHTA 3NFRA 3NDJA 3ZWKA 1O2DA 2ZKIA 2PMFA 4S3MA 1YS7A 3D2CA 5F5XA 1RUF2 3CLSD 3P2YA 3LWCA 1BFUA 4YTEA 4TN5A 2CD9A 1XG5A 2NVWA 2YBDA 3UXEA 2ERXA 5AD1A 1OAOA 3OQIA 2J6HA 4DY6A 2CCKA 1G17A 1QRUA 3D4BA 1ECBA 3U7HB 1VLHA 3KKKA 3EB9A 1E20A 1QE0A 2O2HA 1EJ6A 5CA0B 4CMEA 5DUWA 1ZH2A 2NQ2C 1O7JA 1W8HA 4B83A 3M4XA 1M10A 3TZLA 4M86A 2VNHA 2JGAA 3JZDA 2B46X 5JWOA 4OUSA 5CEFA 1S0DA 1LHNA 4KW7A 5DMYA 3ZVRA 4LIPD 3I3BA 3K2QA 1UBRS 3H9BA 5H9PA 1QG4A 3UAOA 4CQMA 2VUUA 1H2KA 1RYBA 1O3YA 1DQPA 2JI7A 5GZ6A 3SX0A 2E5LB 2MR6A 1Q43A 3EN0A 3EBPA 3Q7SA 4C4OA 2ZZNA 1TT5A 1OAOC 3OZRA 2O8DB 2VVEA 1V7PC 1EFCA 1K2VN 3A6EA 3U7FB 2VF7A 4K9PA 4CMEC 4J7AA 4RK0A 5I7RA 1F7VA 3PWSA 1RYEA 1V6OA 3FIUA 2BMAA 3RYTC 5K8VA 1JYCA 2ARAA 5H02A 3KQKA 1FDSA 3PX2A 3FFZA 2W68A 1UWLA 4HKOA 5HR5A 5LNK1 1BH2A 4TYMA 1GAEO 4XLZA 2OKGA 3OHSX 5B30A 4BUCA 2ZBEA 1ULGA 2CSXA 2XA1A 4PBOA 4WMLA 1QFZA 5AESA 4FSHA 4CIXA 4XAAA 4RPCA 3KUKA 3GDOA 4YLEA 1W44A 2ZR7A 2VNOA 4MV8A 4NJEB 4IJMA 2GCOB 3IIEA 4BB5A 3NHZA 2IEZA 3LEGA 3IUMA 3N28A 4FONA 1J8QA 4CN9A 4MS1A 1H3FA 4PTYA 1KORA 1IY2A 2PD6A 3DE5X 4NMWA 2P9EA 1N5OX 4IXTA 2W70A 1FSFA 3HD8B 2FPIB 3RSHA 1Y5IA 1JXMA 5CLJA 1TRHA 1ZMTA 1ORWA 3W2HA 7AT1A 1ZRIA 3ZSKA 5KWEA 4KE6A 2WO3A 5C31A 3N5KA 1KMNA 4IIUA 3NJVA 4CLOB 1KI7A 2Q3CA 3VISA 2GF9A 4MH0R 3FDXA 1N2EA 1XPOA 2H9YA 3LI2A 4BAUA 3H7IA 3P0FA 1YRLA 1MVLA 4LBWA 3N4MA 2BFCA 3OBIA 3KO8A 4K28A 1XEFA 1PEYA 3JXSA 3ET5A 4YW7A 3B3FA 2IXBA 1MP0A 1RWKA 4HQKA 1T35A 1KEWA 2XVZA 1QS0A 2X3UA 1LBHA 3N1UA 3PVZA 2QRHA 2RHJA 4CF3A 4ZT5A 4EHJA 2O50A 4P00B 2IHVA 1LHWA 1NXD1 3LMKA 1PX3A 1EZ1A 1AQIA 2GCNA 5EJ3A 2JGJA 4R41A 5JSHA 4TKLA 4GS5A 3IOMA 4Q4JA 1AX2A 3Q7PA 3L0ZA 2C4WA 3UT6A 3K0FA 4IEPA 2IDZA 3MT7A 2CSUA 2BSXA 2ECQA 3H2BA 2ZW9A 2JFFA 4ND8B 2G9VA 4R1NA 4V2IA 1LTHR 4W6WA 3ZXFA 3C2UA 1JMKC 3UO8B 1WW3A 4RJIA 1J83A 2H92A 4E4YA 2WIBA 1AS2A 4KGXA 4AKHA 4COOA 5GADl 3CEWA 1NXSA 4QKDA 1PVVA 1CJCA 1YDMA 5EIBD 3G85A 3FDFA 3CQ9A 2VO5A 1L4NA 1GU3A 2CLHB 1TK9A 5HMLA 2ZB4A 3DKQA 3P0RA 1F5NA 4D41A 5I4BA 1T6GC 5JZ9A 5COQA 3HWJA 4QX2A 4B7ZA 2DZDA 3MBKA 1F2NA 3N8HA 1ODNA 3ETQA 1DAOA 4MHSA 3L7CA 4YWJA 5AVTA 2RG7A 3I2YX 1TVKA 1W90A 3IUEA 1BQ3A 2PKEA 4LDJA 2DVMA 3SZOA 3CXRA 4LYAA 3KSDO 4CCSA 3F0TA 3WB0A 4HDKA 4UXJA 3UFBA 1GL7A 2LWIA 5A2QA 2W2XA 4M9UA 5ALHA 4UVGA 1CUJA 2FV8A 2IL1A 2A5DA 1E3MA 3BRCA 4EJRA 1GUZA 1NM5A 1UH5A 2K2WA 5IUJC 4JOSA 3HRIA 4HVTA 4I1PA 4FGWA 1OLME 1GP2A 1JV2B 1Z2NX 5DHAA 1GPMA 3MAGA 3B1FA 1YOBA 5ICFA 3UJ3X 3OCVA 3WNLA 1CR4A 3O1VA 1SVLA 2UYQA 2B82A 4Y3OA 5JVDA 1PKEA 4AI1A 4NYMR 2WILA 5CA6A 4B73A 3DCYA 3LIPA 2VD7A 5A0VA 4OGKA 2OW4A 1I6LA 4BVEA 1ZWLA 2RAFA 4DUYB 4L57A 3FMGA 4MPRA 4URVR 1ZBE2 4Y22A 3FSEA 3FFTA 2OECA 1HDYA 2N46A 4YUYA 2CEAA 3R6TA 3V48A 2W11A 5JISA 3U1BA 4N5HX 4BKOA 4HN2A 1AYN1 2GNAA 2NO5A 2W6MA 3QIVA 1NM5C 2EF1A 3PPVA 3B1VA 4PCVA 5FTNA 2JCGA 5JXJA 3UMYA 1XRLA 3IN9A 4L72A 3BYWA 2ZYSA 3JQ7B 4UASA 3KKQA 1FUUA 1YJBA 1Q19A 4QUAA 3QXXA 1Z08A 1P17A 4P7KA 2NOAA 2A86A 3DB1A 4QBHA 4K03A 1F4HA 3JZFA 1Y8ZA 3L7MA 4M49A 4C0HA 2PELA 2CDBA 2BELA 1JXOA 3TLXA 3CEAA 2M6RA 4QYTA 5B4UA 1H8EA 4B6PA 3L5OA 5IC5A 4G0VA 3KB2A 1PS0A 3O1IC 4ERNA 3C24A 3Q85A 5KNBH 4B35A 3NOXA 2O6LA 3U4MA 1NR5A 2YYYA 5TVKA 3ZUGA 2FWMX 4IUGA 3DMDA 4LY9A 5H4GA 1U8FO 3FCCA 3TLYA 2OLEA 2FFRA 4RA0A 3RS5A 4HVQA 2QAIA 5I7AA 4MVJA 3I2HA 2O2YA 3L01A 3MBIA 5CIWA 4HJXA 1A9QA 3LGSA 1Z0FA 2HA0A 4QUHA 1XKQA 2XL9A 5KYXA 3PVNA 4RL7A 3NP7A 5EZ5A 4HDSA 3TCXB 1TG7A 2JLQA 3FR8A 4DQKA 1EV13 1MAWA 1OURA 4JP3A 4AQ2A 3LDBA 4GKJB 1V4VA 3TWIA 3ZNPA 2JDUA 4YP6A 1UY1A 2W48A 2V6GA 2ZACA 2CF6A 3EXUA 2NU6B 5C9ZA 1E1KA 2JH3A 5AFEA 4AS2A 2VJKA 3KJIA 2PUTA 1JHAA 3FC0A 2O5VA 4PBSA 3ICPA 3ZWXA 4JVAA 3LWNA 2AG0A 3KV3O 1RVF3 2GC3A 4FFHA 2KWIA 3IMNA 5T4BA 1ZK1A 3GFSA 5E8AA 3MS2A 3WW1A 5AVWA 2N42A 2XAAA 1DIGA 4IEQA 4NZZA 1MORA 3CU5A 4CP0A 4A7PA 4ARZA 1P1CA 4X7MA 4Y0AA 2XRMA 1BMQA 3I59A 5BN4B 4URAA 1JHYA 4Q4W2 4O4JF 4WLUA 3TRJA 5CEJA 2ETXA 5FXMA 2RMKA 1NA1B 4IDZA 4RKFA 3AMNA 3WGLA 3RBAA 1U0HC 4Y2JA 3EEYA 3PD7A 1KSJA 1FSPA 2ZGTA 5C4GB 1C3HA 4AHYA 3RAGA 4CUBA 2WFF3 1X8XA 3JCIA 5FXWA 1DQRA 3GX1A 1RXUA 1LBEA 2B8NA 3TKLA 1O3TA 3HS3A 1OKKA 2ZI4A 2GN2A 2RGCA 3SBDA 1K88A 3LE8A 3IMGA 2A1TR 1XNGA 3TAXA 5HZGA 2FR0A 3OLZA 1HZZA 3BE6A 1NY72 2V58A 2X22A 3O83A 3BN6A 3D0RA 4DCVA 4DRYA 3REFA 4TZDA 3DZBA 4F6LA 1KJJA 1LLFA 3FN4A 2PVPA 1E64A 4MVJG 3BOWA 3N2LA 4JD5A 5DHUA 4PNZA 2JCXA 3WF3A 4INOA 4POOA 4J1SA 3UJBA 3E53A 3NONA 3REQA 1VLVA 3KQVA 3RFTA 1OZAA 2K4MA 4KPUA 3BA6A 1B43A 4TZKA 1EM6A 3K31A 3O9VA 2IZWA 3CLRD 1KJYA 4HK8A 3Q8MA 1PFGA 3ON7A 1W88A 1MEC3 5D8AA 2ADOA 4KXNA 1TZBA 5T5LA 3CUKA 3T38A 4AYWA 3V4ZA 2WSMA 4WKNA 4PGFA 3IMFA 1HZZC 5H9WA 2VNAA 4YHBA 1UFQA 2CJYA 3UJCA 4DN6A 4W8GA 3O8LA 3RTAA 3P2KA 1JDVA 5B4VA 3NHMA 1RFGE 5ESXA 4EAAA 4JGYB 1ZH4A 5TMEA 4DSZA 3MIHA 4HDQB 1II8A 3UK9A 2E0IA 2TRSB 2CCJA 4YROA 3OIFA 3M6MD 4U00A 4CIYA 4K1YA 4D8WA 4N9HA 4XDHA 4KAXA 3ZE8A 4DA4A 1V5GA 1Z2EA 2VT3A 1K7XB 3NWKA 1NATA 3HXLA 4HEJA 4MKZA 4RFSA 2QVLA 3PVEA 4FIZA 3DXZA 1WZ2A 3T5BA 2C4TA 3K0AB 4JJKA 5DBOA 5D8AC 1VECA 2WM2A 4IW3B 2EHDA 2GESA 3W5SA 4NIIA 1SIUA 1RHQA 4WV8A 4OHPA 1JBQA 3WICA 3T06B 2QMUA 3NV3A 5GV7A 5C8YF 3LY5A 1FF9A 2OV4A 3FTDA 3AV0B 4HJRA 3QUSA 3Q8CA 1E2UA 3OJFA 3LNTA 4LF5B 5DUVA 4PPYA 1G20B 4M60A 3VPBA 1T8PA 2FSVA 3AXTA 1C7FA 3KOUA 4AP6A 1OFSA 4HB2A 4M83A 2G4VA 1CAVB 3LT5A 1S3SA 1KK2A 3AZWA 3K8OE 2B7BA 1M54A 1R5OA 2Q5TA 2XTAA 4Y6SA 1W9WA 3EASA 1KP9A 4G0OA 4HDRA 5LRRA 4OUMA 3KHSA 4Q3BA 2ZXEA 3MYXA 3GFFA 4KFCA 3HU1A 1PGSA 3H18A 3H5IA 2HLHA 3W8NA 1K0UA 2XWSA 4FPGA 1ZN8A 4JVLA 5E8RA 1KEPA 2W7TA 2XMGA 3PCTA 4JI6B 4DSUA 3ILXA 2FSVC 1Q1ZA 4XF9A 2X58A 4X91A 4PFSA 1F1JA 4JL6A 2JIRA 3P3PA 3BI3A 1Y4AE 2VRNA 2ONKA 5GM2A 1GUDA 4LRTB 3ZU5A 5GPBA 3GPBA 1AYM3 1WXHA 1X87A 2NO1A 1BMFA 1ZA4A 5JSKA 3VI4B 5TQ0A 2PJZA 2WQZA 4UBHA 1B1CA 3WGKA 1DX6A 4B2LA 3A2MA 2WDBA 1WABA 4IJUA 3VM6A 3KETA 1U0AA 5DXFA 4F3TA 4XJXA 4BAZA 4W63A 4Z0TA 2Z2KA 4JQRA 5FDBA 3QMPA 1AMNA 4IZ6A 1BH6A 3S2YA 4FFPA 3T5GA 4EKYA 4P34A 2PJRA 2GD0A 2HDWA 3IAEA 4Y5Z0 3LCMA 4WOJA 1BU8A 1JTEA 1NR7A 4QX8A 1YRBA 4OH7A 4NJOA 2PVSA 5JSZB 1U5XA 4YW6A 4IEUA 3S55A 1CRZA 1KJ9A 5AW9A 1J0CA 1FW8A 5KNDD 2GEBA 2W37A 4M00A 3N76A 3V0BB 1YASA 3ETHA 2V1UA 5ADHA 2FMXA 2AIRA 4DJJA 4WRRA 5CYYA 4TUYF 2WQZC 3FWZA 1BXGB 1FRQA 3AVXA 8ATCA 1IRXA 2XCQA 3WDKA 1VE3A 2PSEA 3KOMA 5I47A 4MV4A 2XZOA 2P6OA 1TM3E 1XAGA 3MK31 3AHCA 4QYIB 3QD6A 4UBKA 3GLTA 2GD6A 1B6TA 2B9UA 1MO4A 2H1IA 2OGWA 3T1NA 3CZMA 2C95A 5TEVA 3SC7X 4ZVMA 4R0MA 5T4FA 3LXXA 5D85A 3FSGA 1VLLA 3ABSB 2FEPA 3OT1A 2WJZB 5ULLA 1VL6A 2PT7A 4QRDA 1J3PA 2H5JA 3RPEA 4QG7A 3AM1A 5IFLA 3JVDA 4J3NA 3CINA 2QL6A 3S7TA 4JKYA 4UD6A 2LKCA 5CFNA 2FPLA 1LKNA 2Q1FA 3O7MA 1RVF1 4XGQA 2J45A 3QENA 1G7SA 4KNWA 4UM7A 4G36A 4DB4A 3B1ZA 4MADA 4H60A 4YPJA 1VALA 2RV9A 3RJMA 3L3BA 3Q72A 1D4AA 3UMVA 2A3NA 5TC4A 4WY5A 3BCHA 3RQSA 2JPDA 4NPCA 3ELNA 4Q19A 5AJHA 4M1KA 1E5RA 2EAKA 4FEYA 1XDBA 3NW9A 4Y9RA 3NHLA 1OROA 2HRQA 3LVQE 3FCEA 4KGDA 3PI6A 2EP8A 2P3YA 2VBDA 1IJEA 3LX8A 4F8YA 3E9EA 5BNPB 5F78A 2BT4A 1FMTA 1VBC3 3AP4A 1OLMA 1AUPA 3P4XA 5EUQB 1VKJA 4MNTA 2QHXA 4FOQA 4LOIA 1Z0SA 1RKQA 1UC9A 5EWMA 1MX9A 2G06A 4MXVA 4IVRA 1JUHA 3ISVA 3KDPA 2PPLA 1L5MA 1H4HA 1MV5A 1XO1A 2ADMA 1HTTA 3FPFA 4A42A 3GYBA 5ANQA 4M53A 4DT1A 5CLLA 1SCBA 1NI5A 1PG0A 2QGZA 1QH0A 4OK6A 4FZRA 2WNUA 4YCCA 1F2UA 3PHBE 3K2IA 1ZHHA 4MI1A 4BX3A 3QACA 3ORQA 3TEWA 1TZJA 2JB9A 3MELA 3UMJA 5C8CB 1WUJS 3H0KA 4TOIA 1MX3A 3IA2A 1JG3A 2D7FA 1Z6QA 5H9SA 5F64A 4EY3A 2V59A 4XDPA 4M89A 5IUQA 1NAIA 1MEC1 2D6PA 1CEEA 2EKZA 1QGUA 1CLUA 1E3JA 3PQ7A 1UBUS 3N53A 2Y1DA 1QWOA 3HPQA 3I1FA 1W9SA 4K40A 3G0GA 3FMPB 3CWCA 5K3FB 3FNIA 3KFXA 3B9QA 1W6NB 2AR6A 4QDQA 3FLEA 3BXEA 2OCDA 4ZWNA 1JTVA 4GIQA 3EDMA 1SKMA 4H4CA 4HETA 3UENA 2WNUC 4BP9A 2ST1A 2JLXA 4QFMA 4P4TA 2D0OB 3JZVA 5A32B 3MM4A 1W8OA 4HATA 4FHDA 2I8AA 4LBKA 3KXKA 3ZD8A 4K6BA 3EXEB 2QVBA 3W4JA 4AMYA 3V7UA 1KY5A 4UBIA 2AOTB 1D0HA 5DNDA 2W9XA 4DJFC 3W8RA 4BQOA 1YZGA 4CLRB 2IVIB 4WVMA 2LD4A 3V1LA 2WO1A 4FAGA 3JALA 4R98A 2HWF1 1Q12A 4FFLA 2AKEA 1Z33A 1T6BX 4QUGA 1LI7A 3UCXA 5KXEA 3KLSA 1V9CA 3KAJA 3OZWA 4YUVA 2GAUA 2R8PA 4Y67A 3ZDZB 1I33A 3F6RA 4E94A 2FFAA 5THKA 4R2MA 1D4FA 3EVFA 2E89A 1GFWA 3LQKA 2GYYA 1TZKA 1MNAA 5F4ZA 3PQDA 1KYZA 4XDZA 4R1OA 4MUVA 4YARA 1F9KA 4Q5OA 4DAOA 5LQKA 2KD7A 1DARA 3I4IA 1DLCA 1RUI2 3F98A 4WZAE 5JNVA 1K8YB 3C16C 3DYMA 5HXAA 5LDDC 4NP6A 1OH3A 3MUY1 1Z0HA 4C87A 2AJLI 2HADA 1YFJA 1TQDA 2AXNA 2QJTA 1A88A 4HSLA 3H2ZA 1IHMA 3OE5A 1YIDA 3E6CC 2UZ3A 4RVOA 4GGPA 4R1UA 3T3GA 5I7OA 1IHPA 2Y0EA 3LPCA 1Y1LA 4N3NA 3LIIA 2JHGA 1BOOA 5A7PA 3EG9B 2IGTA 3BZBA 5A33B 5D2AA 2AUNA 2X8AA 4EQVA 2VUTA 1BCRB 3RVNA 2WKWA 2OFPA 3FKSA 4INPA 3TPCA 2DU0A 1W8ZA 2ZRIA 3NAGA 3GRRA 5F3GA 2NP0A 3AO0B 2WKQA 4GVLA 2GWHA 2OD9A 1XDZA 2F43A 1AB5A 1JIKA 4PLWA 3E0XA 3T9FA 1GTMA 2B0CA 3ZX7A 4FDUA 4D9EA 4QU1A 1YC5A 3AJAA 3I92A 2ZCVA 2ZSBA 3EFOB 1FFCA 3NKFA 1UF2C 2MSLA 4CDUA 4FGSA 3L8HA 5H70A 5DWVA 1AYM1 3SH4A 1JMYA 2A70A 1ULSA 1PMJX 2PM8A 4CM3A 4IJ5A 5LA1A 2RH5A 2NIPA 3DNPA 1OH7A 4K9QA 5LMUB 1MDBA 3MUOA 1QAQA 3G82C 2HLDA 3DZFA 2OBXA 4Q01A 2QG4A 5CH8A 2YRXA 3VO9A 4WADA 1O5UA 2GBCA 1R0CA 4P4UA 1BCSB 3H4IA 2AX3A 4B7EA 1VKZA 3L9WA 1EY2A 5FP4A 2CJWB 2PU7A 4ND1A 3R23A 2XXZA 4D9JA 4R2JA 1A5AB 2FZKA 1SUIA 4DNQA 4BMYA 3QEMB 2Z1MA 1PTJA 3QG1A 1GAWA 3BYZA 4CDUC 2BEWA 2WF8A 5GZFA 5DX8A 5EP1A 3J8F2 4Q39A 5LNK6 2VQEB 1IG0A 1DAEA 2IXCA 3N0RA 1D9XA 3AL0C 4DRXA 2P2CA 3N8GA 1UDBA 2BTQB 1KAOA 3I6QA 3IHKA 5B4NA 1LJUA 3D4NA 3FYHA 5EZ6B 5ALDA 1XXHB 3GH1A 2X4DA 2PUCA 4LF7B 3BMOA 2RK3A 1EVZA 3PVCA 1NZFA 4BU1A 2ABWA 2GRUA 4UDOA 2GMWA 5B58C 3T4XA 1FFEA 4XSHA 5KWRA 1CPMA 4PFQA 4DOUA 2X0KA 2QVCA 5L6LB 3MPOA 3R77A 2WM8A 4QA9A 1L7BA 2FUCA 1P5JA 2XOMA 1Z5UA 3G5TA 2CLSA 3O12A 3IJEB 4Q1DA 3KTFA 2C2KA 3RU7A 4M38A 4ZZ1A 4AF9A 421PA 1ZZEA 1HE2A 2QLFA 3ADKA 4X3OA 2V5VA 2VOJA 5FAKA 4H3HB 2X0NA 2YFUA 3DDSA 4I9FA 3BHNA 4DLZA 4CLEA 5LC1A 1UC5B 4YM1A 4BJ5A 4YMUA 3C6KA 2FP3A 2HDNB 5IMSA 3LT1A 4TRJA 1JHVA 5LLSA 2PCLA 4ZVKA 3EULA 2BUBA 3T95A 3JS5A 3GUHA 1LNQA 3AL6A 4RS5A 5H82A 3R7BA 1UIJA 4IXDA 1VYVA 2HA3A 2HU7A 2FJ0A 1XEWX 2CHVA 2I4MA 3ZKWA 3MPBA 4UHHA 4BNJA 2FQXA 5B1DA 4OHUA 2JAXA 4CUCA 3LYLA 4WXPA 4MQMA 1UT6A 1B8UA 3G8DA 4BNYA 4PI2A 1DBWA 4LBLA 2OR3A 4X54A 3OURA 2JH8A 1RUD3 5LASA 1OQAA 3T9CA 3CX3A 1ZD8A 4QWWA 1EMDA 1ZPDA 2C3YA 5FI3A 1ZZ6A 1PD0A 5EMLA 3S4YA 5M3BA 1PWXA 1VBC1 2H0BA 3ZYPA 1Y98A 2O1EA 2QUJA 3H9GA 1NQ5A 1XZGA 3WLPA 4RS5C 4UAVA 3T9BA 3CMGA 4Y6QA 2GNBA 2P1RA 1COV3 1FDOA 4WBNF 1U9IA 3Q3HA 1G5TA 4XFIA 1AGPA 5EHXA 5DXDA 5ETJA 4QRIA 4I5IA 2ZTVA 3TI9A 2Z6QA 4FMCF 4WHMA 3OCCA 3LCRA 2GYVA 3P20A 2V9CA 3WEZA 3MGGA 1D2QA 4ZO9A 3WX5A 3EC2A 1XNKA 4DZGA 3H2JA 2FWAA 1ZM1A 2R0QC 1L8LA 4JYAB 3SVLA 3I5XA 4Q03A 3U81A 1NBME 3PL5A 1T8RA 4KH9A 4FPYA 1SVNA 3F8WA 2HNBA 1U9IC 5DHTA 4TYSA 3F7MA 4JLSA 3WXMA 2Z9CA 3RG0A 3WJ7A 2GKSA 2F3RA 3IEUA 2HRRA 1CS0A 4FFOA 4A73A 3BMCB 1SB8A 5A7QA 3SOPA 5CFRA 3BTUA 4RMGA 3ZI4A 2AN5A 3ZU2A 1F31A 3NSTA 2H5LA 2AYXA 1REEA 4JDOA 1EFDN 5T50A 4Z1MD 3SBEA 3HV2A 4Q37A 4JQCA 2ZLBA 1Y9GA 3IBYA 6YASA 1AKQA 3FGPA 3CVVA 1AIPA 4EAQA 1R8SA 1KVQA 1M5UA 2F1IA 4A1OA 2DP4E 2X42A 2WA3A 2YS7A 5FY9A 4ZO7A 2R66A 4I55A 2WVGA 2NO7A 4RFLA 4F85A 5E7IA 3USES 5BWNA 4JEMA 2CXQA 3NLLA 5TVGA 1XTIA 4QQRA 4QDXA 3RFVA 4LEJA 1POWA 4MYHA 4IEIA 3O4FA 1ST8A 3QPVA 4OSPA 4LGMA 1KYIA 4L3VA 4E2ZA 5HVNA 3X1MA 2LDBA 2FEWB 1KFKB 1KD7A 3LDAA 1F3OA 2PJDA 3ZW9A 5J58A 4NR1A 1Q92A 3QVGB 2P4QA 3JQWA 4HGOA 1NRWA 3IKVA 3ZY5A 2EHJA 1I4LD 5KIAA 1ORHA 3SLGA 1ZMRA 2QE3A 4ENRA 1D6NA 3TOCA 4FWIB 2P4SA 1XCOA 1K8XB 1A6CA 3B8HA 2X0EA 4ARCA 3IT1A 4UQPA 3BJZA 3AFIA 4GL4A 4ZDKA 1PIV3 2C5LA 4FR2A 3C85A 1ACMA 1Q8PA 5DAXA 2EZ4A 3OESA 4E32A 1T9GR 5FBQB 2DV9A 1WB9A 4BNGA 3A3YA 4CV3A 4HNRA 3VDNB 4MO3M 1IPSA 2FPOA 3F3SA 1PCXA 3RVDA 3AVPA 1CE8B 1EHCA 2J3IA 2NO4A 5C1PA 2W47A 1YMVA 2WZBA 3U3OA 1MVQA 1VMFA 2OWEA 4QU9A 4BNTA 3ZD6A 5DNCA 4L3WA 4HTAA 4QICA 4Q3NA 4DG5A 1ESZA 1F2TB 1L7MA 4YN3A 2FPUA 3TQQA 5C51B 3UUGA 3GG2A 3EAFA 4LOTA 3BB3A 3GDGA 2GXUA 4JR2A 4CF7A 5CFZA 2XRZA 3O47A 5C81A 4UTRA 1J21A 2D3WA 3IP6A 1R6UA 1TVMA 1KMMA 2FETA 2OHXA 1WQ1R 4TLEA 1RBMA 3H05A 5DK4A 4U7JA 2WD8A 4D7YA 1WV0A 1KJWA 3AUKA 2ORIA 4C1WA 2C3PA 1N75A 4WLOA 2HZBA 4CM4A 2KR2A 1NVTA 4XB2A 2GO1A 1WPRA 4RV9A 3BTZA 5ADUS 2IZ0A 5JAIA 1IPHA 5ESRA 4H3SA 1FATA 1V1MA 2Z43A 1WWKA 3V4RA 2PGXA 2ZG6A 4WKPA 1KRXA 1WZIA 4ZXKA 4KK4A 3VDMA 3G2HA 5THQA 3CZUA 4YZ1A 4P9LA 3DMYA 4MW5A 2GN4A 1YU9A 1NIPA 1UKVY 3USUB 4LRUA 1POV1 4J7UA 1C1XA 3R6WA 5HCUA 4FP2A 1JU9A 3OGRA 4ZDWA 4I50B 1PNQA 2BKAA 3L0CA 3SSMA 1DFQA 1VE1A 4JI2B 4BKRA 2A1UB 3RS0A 3U75A 3T8YA 2Y92A 3CSUA 3P9SA 1PUIA 2Q6IA 4IIJA 3LRTA 2AGVA 1QH7A 4X1YB 4YZ4A 4FT2A 4OHZA 1JJFA 3NAQA 1O8CA 4EROA 4BNWA 1UEXC 3NMBA 2WLPA 1AR82 2Z30A 3COVA 3G0CA 4O08A 3GGLA 1M1NA 3ZLUA 3DBHB 3WJ1A 4PNEA 2DCYA 1V4BA 4DCMA 2NQYA 2HO5A 4KWUA 2HCBA 1M9NA 3ZCSA 1YXWA 4WZAA 1LQUA 3RGGA 2GEDA 2YV8A 5DNWA 3GQVA 2W6NA 2IEDA 2PBRA 1MB2A 2F7SA 3K1JA 2NU8A 2Q6LA 2XODA 2PT9A 2EKLA 3B7PA 2YU1A 3P2OA 4YCJA 1WDLA 2GASA 1X7WB 4MJ7A 4FT4A 1KZHA 1S8OA 5F5AA 2A84A 1U1IA 1YJQA 5LA2A 3UMMA 1P5HA 2QZ9A 2DEUA 3D64A 1FXSA 3HCWA 1SQGA 1IWBB 5K0UA 3B9RA 4L4RA 3EIXA 2G1KA 3I9NA 3RUFA 3TMYA 5K3CA 4XUQA 2D5AA 4J07A 4E09A 3U4QB 3HV0A 2OB2A 3F9IA 3UKVA 1T2DA 2PUWA 4EA8A 5JLVA 521PA 1C0LA 1VBB2 1R3DA 1Z7WA 5DCUA 3WL8A 5GZ1A 4Y20A 4KNCA 1SEPA 4HL6A 3I2GA 1KO8A 3LKBA 3ZK8A 4GC9A 3CLTD 1U5AA 1BDHA 4LZWA 4FFRA 3EDQA 3MGKA 3FPKA 1H2FA 2ECKA 3GLIE 4HGYA 5FUVA 2GXSA 3ZZTA 4KKVA 4C7KA 2QT0A 1FS5A 1N5IA 3ESDA 5K0UC 1P2SA 3PJEA 5ISLA 2ET7A 4MVJE 3MGUA 4J8PA 3AW9A 3AEUB 4D1YA 4G63A 2WUGA 1GGFA 3TPZA 4FUQA 4U7DA 1WEKA 1JOPA 3G2MA 2JEOA 1HB1A 3GAFA 4XUCA 4BV2A 4CF5A 3F71A 3K77A 4MGZR 5AICA 3PUAA 5KNCA 3KZOA 2VL4A 1U2QA 2YYAA 3WLJA 2IP2A 2VJXA 4XDOA 5F5NA 2BQPA 1JJIA 4LTDA 2GBLA 2QTZA 5L3SA 2YWBA 3NS7A 2JJ2A 4B33A 5HPYB 3B82A 1NUPA 3I9MA 4FDAA 3QSYA 3PGVA 1YBHA 2Y8KA 4MOAA 1EJ0A 4WT7A 1KE1A 4ZVLA 3V5NA 1JJ7A 1HRI3 1MX5A 4XAQA 2PN5A 1U2PA 1EGHA 4ATEA 4ZOLA 4D4JA 5JWRA 2GP5A 3TQFA 4CPBD 2WU1A 1PO7A 4J0KA 3UPDA 3WI7A 2AA3A 5DOZA 3O1JC 4NBNA 1PVOA 3KL4A 5JYEA 3O14A 4RA9A 4KE9A 2LIVA 4I4IA 5ICMA 1JLMA 4FM9A 2D98A 3JYOA 4A8HA 4PLGA 5C1BA 3ZDQA 1UFKA 2GBLC 1GRQA 4OHRA 2W2TA 3I7DA 1XTBA 2LALA 1HKHA 2QJRA 4MGIR 3SHWA 2XZTA 4Z2WA 5I5EA 1VJCA 3ZVNA 2QZ3A 4LQCA 1LTEA 1HMPA 2OG2A 4EV0A 3GCDA 4RC9A 3OCJA 4I36A 4LJ7A 2CUKA 2J9YB 1THTA 3HU5A 2CMHA 3L77A 3OOEA 4CG2A 1ZI8A 3WB1A 1FYVA 3GARA 5IXJA 4JS0A 4LORA 2EFJA 3OGGA 4TS4A 1P1IA 3QI2A 4Q16A 5LCXA 2OP1A 1SZCA 3RC9A 3NBXX 3AKPA 4YAIA 1OZFA 1IB0A 3HXMA 4Q4Y3 3K72B 4MUHA 2VMEA 3ZNQA 3K1YA 1ZCAA 2YNMD 3UGJA 1QUFA 2NPOA 4Z7OB 4MP3A 1BGVA 4C0WA 5HMMA 1J5EB 2PT6A 1RUC2 2KI5A 4OHCA 1KAQA 3WP1B 1AYN3 3I4CA 3HNPA 5AXDA 1O0SA 3FF4A 1XALA 5ECWA 1JYFA 1ST2A 1D2EA 1RI2A 4HQLA 4U63A 1B0PA 1OLUA 5ABJB 3OTWA 2CMFA 4XUDA 3HYLA 1AKNA 1VIWB 3ILHA 1JHNA 1JR3E 1LPSA 3KB8A 4WN9B 1WZCA 3JASB 1A2KC 2EZ8A 3MF6A 4RTQA 2CV6A 4FPFA 1Q8VA 1FA9A 3VBUB 2SECE 4B3MB 3MOGA 4X94A 4Y6LA 3KQTA 3D6AA 1M67A 2L19A 1CUDA 4IVPA 1FBNA 3ZWAA 5LZ8A 3H1GA 4U9IS 4YIKA 3LK7A 4RENA 3E2MA 5H3CA 3RIGA 1LFDB 3VR2A 1Y5RA 2QVZX 2H7VA 3MYYA 3LVRE 4UPEA 4YC7A 1FXWA 3F2IA 5MF6A 4PC7A 3AZVA 3VAAA 4ZU4A 3B9BA 2IDJA 2Q4BA 1PZXA 1H93A 5FQ0A 1NBMA 3QWAA 4YJGA 4N82A 4ZZ2A 2Q7OE 5LLDA 4I8DA 1W04A 5DI3A 3WNDA 3QH4A 3WNQA 5T5OA 1VSBA 3NVDA 1G2IA 1EX6A 2C5GA 3Q2KA 3KBOA 4ALNA 4TWAA 4JJFA 2B4YA 2ZUSA 1XHLA 1Y7TA 3KYIB 5JRZA 3VR0A 4IICA 3IP9A 3C3MA 2FMYA 3KYCA 1DXOA 3VZNA 3MLKA 4KWJA 4Z82A 5GIOE 3TTVA 2JFUA 4LXUA 5KDLA 3A1VA 2XT6A 3B00A 3VD7A 1EE9A 1E3IA 3FPGA 4DG8A 3MTBA 5TGZA 1XMJA 1UPUA 1I4EB 3GRCA 3JU9A 1D4ZA 3N86A 2WNOA 3B6JA 1JZ2A 2ZVDA 4E13A 4QZVA 3DTVA 1TW3A 4W6ZA 2A3YA 2XDVA 2FAXA 4M3NA 4F71A 3NEJA 1VI5A 5HDQA 2FK7A 1E59A 3DMHA 2XH6A 2O4CA 3EDOA 3H2KA 3KVNA 5JWPA 2TS1A 5IJRA 2Z2JA 3QF4B 4XHXA 1YKFA 4LY3A 3OZBA 1GDHA 1FTSA 1V5WA 4MJXA 2EDCA 1E62A 2AK3A 3DKVA 1USWA 2D6NA 1ZUD1 5LXTF 3EYWA 5C2JB 1CIPA 4OQNA 3WRWA 5L4SA 5AKYA 5IAAA 1ENRA 1RQLA 2D59A 3WNXA 4O29A 5CDYA 1GTG1 5DM70 2RR12 4UM5A 2XONA 3WRXA 1HKUA 4I4TF 3W05A 4IJQA 3IMCA 3AERA 2YMMA 2O8FA 4CUZA 1W0CA 4UM8B 2QY6A 2VKQA 2FW0A 5BSGA 4C5AA 1SD1A 3W06A 4D25A 2PWPA 3L9JT 3UJNA 5FIUA 4D0SA 3H3ZA 2XVXA 2FZVA 1OFVA 2EX4A 3ZD7A 4FOOA 1JS9A 4FYKA 2ID4A 1N5RA 2IIQA 4FXPA 4Y2HA 3THTA 3O1SA 1SG9A 1E2LA 3RABA 2CNWD 1DLJA 1CV2A 2Z5LA 4R9NA 2UWCA 3ZWVA 4ENQA 5FZIA 1GPJA 3TOVA 2DHEA 1I3OA 5A70A 4OXKA 5JSYA 4E08A 1GRNA 2AYYA 3SSOA 2W58A 1FMD3 4LJSA 4MW6A 3QYAA 2PMKA 1QNLA 2DQ4A 3OFKA 2PZAA 3KVOA 3OIGA 1MAVA 2GFIA 2WUWE 3OETA 4EARA 1H30A 1W2NA 1O5OA 1HH4A 4X8HA 3OPTA 3GALA 5LOVF 3IVMA 2PU5A 3HR4A 2NZVG 4XSVA 1L5SA 3A1WA 2HSWA 1U6KA 4D94A 4LHNA 2YWHA 1BMV1 1QO7A 3RUEA 4NOLA 1U6JA 1QP7A 4FYHA 1V2GA 1M2EA 3VU9A 3SLKA 2VXYA 4DABA 4XTRA 4OQMA 2N75A 1YDEA 5AKJA 1RE1A 1N5LA 1HRV1 4TTGA 5HTOA 4JSRA 3AQIA 5CA1B 2V4VA 4Z6KA 5IVHA 2FN7A 4A7KA 2CK3A 2JGIA 4MV1A 4NROA 3LA6A 3GDHA 3TJMA 2ZI9A 3HUUA 2FXVA 3IT3A 4AW7A 4C0AC 2Q3FA 3EQ2A 3ANLA 4QVGA 2WHEA 1XMQB 1T9AA 5BOVA 2ZIUB 1S2NA 2X23A 2GBGA 1ALYA 3JQFA 4QL3A 4YRKA 4IOJA 2PAMA 3V80A 1KF0A 1HRI1 3TBFA 1PNFA 3FPLA 1XZDA 4CFYA 1YS4A 2D3PA 4IZHA 1G9TA 4RLHA 3A3PA 3GQBB 2ZBQA 2YN0A 5KQGA 5F4BA 4PLMA 1AC5A 3OPVA 5F7XA 1OA2A 2ODEA 1TA0A 2RGEA 1WXFA 4QX1A 3GPCA 3WLTA 1SC9A 4LKDA 4GB33 2DUOA 5J98B 4JFRA 3AKRA 1ATZA 2H5EA 4WUTA 3R3HA 2WJYA 3ZLVA 1U7WA 4G8BA 1UY0A 2J3KA 3OJ0A 5DYTA 3Q87B 4K9MA 1E4VA 1NMSA 4L16A 1PGW1 2PHLA 5KAMA 2ORYA 1RINA 5JU6A 3M3OA 2BCGY 4HUQB 3JQFC 5CW2A 4LQDA 1EAH3 4G01B 4V0SA 1GQ2A 2PY6A 1W8WA 5JPDA 4Z86A 3VBOB 3ZCQA 3C3WA 1KA9H 2WZ8A 1FFAA 3M82A 3VBFB 2VXJA 3N2YA 4F9EA 4CR6A 4RSRA 2PWYA 1U5BA 5T5QA 1WDTA 5ALJA 3ICQB 4GZ6A 1E1RA 5F1YA 1B6GA 2W52A 2TMKA 3Q5EA 1O89A 2YVAA 1QKIA 2FZCA 3PXXA 2F2TA 4M7PA 2WSLA 3RS2A 3T9AA 4G4IA 1H94A 1TADA 1HGXA 2C20A 4Q4Y1 3WF1A 3OFSA 5EE0A 4K7JA 4GJYA 3PC4A 5J5VA 1BG6A 3UK0A 4Q1PA 3HNOA 4OJMX 3A4IA 4CW7A 3WLRA 5IT6A 4CCYA 4Q18A 1BKDR 2WINI 3PC8A 3S6JA 3ZJYA 2OK7A 3WQ1A 4LHZA 4FCAA 4M36A 1OTXA 1T4DA 2J5RA 4IEVA 4OHOA 4FX5A 2W8BB 4UHJA 5JVVA 3A7QA 4BV9A 5JCTA 4L8QA 5KVCA 5CFPA 1RYDA 4G0WA 3M1HA 2E32A 3OQJA 4ALKA 3MCWA 4UNIA 4OLHA 4MKHA 4QELA 1XZQA 3JZIA 1QP0A 3EHEA 1YA6A 1LF5A 1PUXA 2R1VA 2VFAA 1IG3A 3BEOA 4AMVA 1LGYA 4QULA 1NCQA 3PSHA 4IPTA 1ZH0A 2EA7A 1NLYA 1UMDB 2RH8A 3AF3A 5EJIA 3GLIA 4M9ZA 1WP4A 1TM1E 4LWQA 2PHRA 5FOVA 3CJTA 4PO1A 3PC8C 3OUTA 2QN8A 4ROTA 4D0GA 2ILVA 4QM7A 2ZPUA 4OQZA 4A1FA 1R0KA 4URFA 3VO8A 3HSSA 3CW9A 2EX1A 4GW3A 1GIAA 4NZYA 1KQGA 2Q0QA 3WGVA 1ZICA 3ZD9A 3D7RA 5KTPA 1FLAA 5A4FS 1YL6A 2HK7A 3H11A 3WWOA 2H0AA 2PFGA 3HJTA 4LKOA 3CBNA 5L4NA 3OJCA 4XASA 2RJNA 1U99A 2CEKA 4AS3A 1W35A 2YIMA 5KKCA 5F2NA 4GX5A 1ENSA 1YIPA 1QMPA 3ESRA 4LI0A 1H3NA 4RMIA 5C7GA 4KI7A 5C5TA 4JY7A 1NCQC 4ZCIA 3GRUA 1T5DX 1QMJA 1LOEA 2WABA 4AMZA 1VG9B 2V7EA 4O4LF 1ODMA 3EMKA 3OU2A 2CDAA 2V8BA 4FOSA 2X7HA 2PGNA 4MV6A 3CW2A 1SC1A 1XV5A 2OE2A 1AKTA 1QHNA 1YBMA 3ZJVA 1SQ4A 1E3WA 4K6HA 3WDTA 5GONA 1OH4A 1NN1A 2O20A 2VO1A 4B31A 1QDCA 3QSGA 3GFGA 5EIYB 1JZ7A 4WCFA 3NOVA 1ZVJA 2KW5A 4LC1A 1YBFA 1T2CA 3O91A 3QOXA 3R74A 4YALA 4BMXA 3KC2A 1P5RA 2K2QB 3WG1A 3SXUA 2ZAOA 2LBPA 4DA0A 3JARB 2GS9A 1S8FA 4MV7A 5BNTA 1GDDA 4IS2A 3SEQA 2XYVA 3PUSA 1DQNA 3B2NA 4US0R 3ROGA 1U2ZA 5F1OA 3PC2A 2CUZA 1YCIA 1Q77A 4OHMA 3WT3A 5CB4A 1BNCA 1NJ6A 3W58A 3WWDA 4LRQA 1Y6ZA 4Y8VA 3ZHCA 3NM4A 2IHUA 1XTZA 2Y1EA 2H31A 1V7CA 3QFFA 1DEKA 2TECE 4YGYA 5LDHA 3KKMA 3D8SA 1GSLA 4CM6A 1IZ9A 1GANA 2W83A 3RUIA 3TE7A 1CHNA 2ZYIA 1Z3CA 2VJMA 1PNRA 5NLLA 4UUBA 2GEKA 5HKKD 1VJ1A 3HY4A 2RE9A 4K6FA 5A3UA 2Z2YA 2VCHA 3IELA 4ZHQF 5BYAA 3SPXA 2CWWA 4KGVA 2HA6A 1C3OB 1UZVA 5KZMB 1ULFA 4MINA 4I0WB 1JHXA 5H3LA 4BY9E 4RTLA 1VSUA 5KXBA 1Q7BA 2WIFA 5C7IO 5KYYB 4E46A 1DUIA 1ESCA 3HBNA 2CXTA 1C3EA 2XHKA 4MIOA 1QJX1 1G9CA 4ZOCA 5C7OO 1FMD1 1J8FA 2BHSA 4LHXA 1QHSA 4EGQA 3ANYB 1FX0A 1L5HA 5E7JA 1E1QA 4XWTA 2VF2A 2GH1A 4J3FA 5DGHA 1WDWB 4ZQBA 3JWPA 1GU7A 3L6UA 2OGTA 3L4JA 1JR3A 3B13B 2P7HA 3VD4A 1ACJA 1ZI9A 4L6AA 4JVMA 3GBVA 1ZY2A 2A0XA 3E2IA 3TD6A 2OYSA 4C6TB 1I7PA 4CJXA 5FRDA 2IY8A 3WL6A 1I6WA 5AIBA 2C83A 1G6KA 3C8MA 2Y76A 1OI6A 4CODB 4NV3A 3L2YA 5J40A 5CTAA 1XNHA 2NUAB 1QAOA 3LXRA 4UKDA 4RO0A 1MJGA 2ZRFA 2AR9A 4PEVA 1R0WA 2FPWA 1XCPA 3NX4A 1Q8QA 1W94A 4X1KB 1OC1A 4Z8XA 2P30A 2GB4A 3HYNA 3Q7TA 2W1WA 2HWF3 1QY4A 4C2UA 1QIEA 2X9QA 3AZZA 3WFZA 3O21A 4UEOA 2DYKA 2W4QA 3RRBA 2G0NA 3HA5A 1XDUA 1JHRA 5C3UA 1KZYC 1N3YA 1ODLA 2GMPA 4IIVA 4WEOA 4Q34A 4AJEA 4B6SA 3MIIA 4MIEA 1BEV2 1EA7A 1W5TA 5DTRA 1WS6A 5J5CA 3IP1A 2XEXA 4LHLA 4LJRA 4CEWA 1IPKA 1I1NA 5E6HA 3UMGA 5JO9A 1ECCA 5EMJA 2CE2X 2DB3A 3G59A 2AOUB 5HFAA 1PNOA 4RY0A 3CRW1 5SV5A 5H83A 2HWB1 4GB31 4CR8A 2J1UA 1POXA 2W2OA 2D74A 3X1ZA 2A1IA 1XTTA 2CUTA 5LP6F 1ZSNA 1BBT1 3C6ZA 3THWA 4FDLA 1EAH1 3RE1A 4MW1A 4KYIB 2AZ4A 1EDDA 4NLLA 3A6DA 3F5FA 3TLGA 1NU6A 1LBQA 1AO3A 3R2JA 2IITA 3UWDA 2E33A 2DKNA 4EJMA 4XQCA 3CQOA 4S2UA 2QTVA 1KC3A 4QUJA 4QBFA 3ZV4A 3DZIA 2JDKA 1NVMB 5FYYA 2C96A 5JOXA 1EI9A 5A02A 1D6JA 4YMVA 3Q7QA 1M6HA 1KERA 4OFGA 1G8KA 5NULA 2QKDA 3FOWA 1QK4A 1WPXA 4MV2A 1QTNA 3T4HB 3E5MA 5L8VA 3IJPA 4D8MA 4OGGA 4LO4B 4B6OA 2HYIC 3DMGA 3OTGA 4CTEA 2ZPTX 1I3CA 4AHWA 3FCXA 3ZDXB 4O6VA 4JBLA 4UCXA 3OC6A 4DIMA 4V1CB 1LI4A 1YNSA 3X2SA 2ZIFA 3LU1A 3DR3A 3T0GA 4ND7A 4DY4A 2UWAA 3SQOA 1E6LA 1JHMA 3U4AA 1VBKA 2RS32 3IESA 2V4MA 1B0ZA 2WO2A 2WO7A 1E61A 2HH9A 2CBGA 2G1JA 1ZM3A 4I4NA 1YR9A 4CE6A 2O5EA 4QDSA 2QN2A 5C34B 5CXXA 1MS9A 2BFWA 3A6GA 4DDMA 1EEXB 3DBLA 4DSAA 1F8FA 3V7YA 1JIIA 2J9XB 2HWD3 1GTVA 1GZSA 1O59A 4R3NA 5U4QA 5DQ0A 5K6AA 3OEEA 5JXIA 2ODTX 5GVSA 3GBGA 2ORVA 4F5YA 4QKBA 3JV7A 4C9BA 4IWYA 3KS7A 4PLZA 4E7PA 2I2AA 1TYBE 1G41A 3V1KA 4IIXA 4J6GA 4H1VA 2VNRA 3ZR5A 4N8EA 4JTOA 4JGZB 3VHRA 3V4PB 1XJ5A 3S3TA 2OZ6A 5HRAA 4BBJA 3S8YA 5FO0A 3SHOA 3V8PA 5EJ5A 5I4CA 1W5FA 3EGCA 2WNIA 5B2FA 4OLLA 4UFJA 2BWAA 3E5RA 1X70A 5CVTA 4L0QA 3AMHA 4NXMB 3U7EB 5DO9A 3NGXA 2O8BA 1L5ZA 3UMCA 4F2PA 5K6AC 2O8QA 4FE3A 1NN0A 4B7CA 3OE7A 1TJ3A 4BXOA 3GLGA 1M2VB 3ETJA 1XI2A 3P26A 3ZM8A 4NIHA 3KR1A 2F8TA 1DIOB 1N4AA 1JEYB 1KS9A 1ZIYA 4CR7A 2HDOA 1B8VA 4L5JA 5BN5B 5IN4A 3HKDA 3UA4A 2JLUA 4Q4AB 1G6NA 1QGAA 1W73A 4HSJA 1MS8A 1JQEA 2GK6A 1CAXA 3OOSA 4WVVA 3PFGA 2VBCA 3PX3A 4GR5A 5DNUA 5J2UF 1R50A 4N0DA 1GP5A 3T1HB 2AL7A 3DWEX 1JRLA 1ONPA 5E2BA 3AW8A 4F4DA 3SI7A 4TWZA 4E31A 1D9ZA 5J09A 1I1HA 1XQYA 3NUGA 1CDEA 2E9SA 1GQYA 2DGDA 3WYAA 2F8MA 4HMPA 4EVIA 1T3HA 4LG1A 3RZKA 1XCBA 4S1WA 2RGAA 4I0AA 4LO6B 1EUCB 1UU4A 4XBLA 1N2HA 2BJHA 5ARDA 3PXGA 4CIVA 4ZMBA 2FFQA 1SWWA 2FUNB 5JD3A 4COZA 2H9AA 5IH7A 4KHPB 2QI9F 3T99A 1Z15A 3NBKA 1UY4A 2YJZA 3OPYB 3AFMA 3H0EA 2CZGA 1J1LA 3H4VA 3DBOB 2XDAA 3WYNA 4PGHA 2O8OA 1DPFA 3D6TB 3IDOA 3PEUA 4BB0A 4FGLA 4ZAYA 4BPBA 3ZGYA 3FOFC 4WASA 3HVRA 2DU1A 2D7CA 4Z07A 3UYKA 4MZUA 4PZDA 3I2KA 3I9JA 1UOBA 3ACBA 1L1QA 3BGVA 4AEDB 1WG8A 3DUFB 1GGEA 1SOWA 3MRVA 1KH1A 2B98A 1DFGA 1DELA 4TMZA 4J75A 2QTRA 1XU4A 4PXSA 3AWIA 3DXYA 1RXWA 2P6CA 3F7NA 3VOSA 2R65A 3NCHA 2I65A 4GXRA 5JNWA 1TTPB 5TX7A 4PSAA 4XWOA 1G19A 2GAAA 1GSIA 1QCYA 1SPPA 3GZJA 3QXHA 2HF7A 2G1MA 4E5YA 4DJTA 1SHKA 3B9IA 5EJ1B 2FWJA 3WYDA 1IMOA 4AUNA 4FNAA 3QQPA 3I01M 2VEDA 1KQ3A 4IUYA 1QIHA 3IDQA 2Q1MA 3TEYA 3VPFA 2YPJA 2IS2A 5JCJD 1P2UA 5ENZA 4W1PA 4AG5A 3NKGA 4TLMB 2P5UA 3VKHA 1Z07A 1GYQA 2JHAA 4XIIA 2V4UA 1HETA 5B55A 4QTTB 5E1OA 4J2TA 1GFIA 4FOVA 2PH1A 2H3EA 5LQDA 4PSUA 5T54A 4FMBB 1HV0A 3WHLA 4OIFA 5B7NA 3NP9A 4XWGA 4Z0HO 2UVPB 4GRAA 2FE1A 1VBD2 4LMFA 4UZFA 1TEVA 4LJ9A 5CB6A 4YP7A 4MPTA 4MSVA 1JSCA 1K5MB 3PGA1 1KEVA 2O0KA 1RQRA 1SIBE 2PAEA 2R8ZA 3GFPA 4B3CA 2X41A 1GSHA 1ZAKA 1RC1A 3RSGA 4PG5A 5HW0A 2GPJA 2QW0X 3PUXA 4D3SA 4IKPA 2J1VA 3V33A 3TVTA 1U81A 2CL2A 1GCGA 4EY5A 4WOBA 1TJNA 3ZY2A 4R81A 3ER9A 3CA8A 4DMHA 2Q6OA 1ZOLA 2QKYA 4B80A 4N8DA 3HXQA 2Q8PA 3POGA 3DG9A 1K89A 2WBKA 3T0DA 3ZDAA 1SBIA 4RKEA 5B2ZA 3BE4A 5JXWA 3QLQA 2DC1A 3UQZA 1R10A 1NXMA 1CUXA 2IWGB 3NEAA 5D3MA 5AC93 1F38A 1W6QA 1JT2A 1NOIA 2QV7A 4OM8A 2A5GA 4ILEA 4IHKA 1SJ9A 4Z8YA 4A41A 1RUE3 2L69A 4Q9JA 1YR1A 2OY0A 3U26A 3GJ8A 4GH5A 1ND2A 4UNQA 1JYIA 4JCOA 5AKLA 2GN9A 2P3OA 4JXXA 1PSZA 3VKOA 4KO4S 4G4GA 4LNUA 2YQ4A 3P7MA 3K9GA 2GSYA 1RL3A 3D9QX 1WBFA 3P0EA 3UJ9A 3TSCA 4LBQB 2RKOA 5IFPA 4DV0B 2OZLB 3T1OA 4LJLA 2HY7A 1N6PA 2YZMA 4QU0A 3NWOA 4DVJA 5JPMB 3R7AA 2Q5OA 5BNIA 3FSRA 2PZKA 5T5JA 3QCWA 1D4OA 1HKDA 1CLEA 1WGPA 2IXKA 1ILEA 5FKCA 1S2BA 4IDBA 4DWVA 3N7LA 1E66A 4UOJA 4O2BB 1ZGGA 3C7EA 3BK7A 2C77A 1W4BA 3ND8A 2FQYA 3HCPA 4EFKA 1PGOA 1HT3A 2NTVA 3SWWA 1FFDA 2PGLA 3GP8A 2HWD1 4LO8A 3IHTA 4MYDA 3KCYA 1MJFA 4O02B 4JT8A 3W7AA 2X5OA 2Y2VA 4D6SA 3WF4A 3ROEA 5AVPA 3AHJA 1H05A 4IX1A 3N2NA 1WV1A 1E4OA 2VBFA 4HI0E 4YVWB 2NNWB 3UV3A 2YIVX 3CHYA 1KS5A 4IXNA 4B5LA 3WIDA 2QYSA 3CONA 4KH1A 2HHLA 1WXDA 5IEJA 4XE9A 1A9OA 1ZD1A 4OG2A 4U3JA 4E12A 2DLNA 3FPAA 5B2EA 1XAJA 4QREA 3VPCA 3WQBA 2C5FA 4K9LA 1POV3 1A77A 3AT1A 3IURA 1N5JA 3LDHA 5E6RB 3BMXA 5F2OA 3DOFA 4IHJF 1I4OA 1L7QA 1X80A 2JA2A 3EPKA 3T3NA 1ZK2A 1GT91 4DQVA 4OXXA 2WC1A 1PTJC 1Z2AA 3ZEIA 4B1MA 3HUTA 1V11B 3VZDA 4NAVA 4BJ0A 3LK6A 5EEHA 5JJLA 5BQFA 4HNTA 3MMPA 4FYMA 4BLWA 3VC2A 3QWFA 1ZYBA 3H7AA 4CRWB 5FUPA 1A4XA 2WLTA 4WL0A 2RS12 1QIIA 1U7OA 2ETVA 2VLIA 1CIVA 5CK5A 2C8LA 1HDXA 1IOZA 4FGKA 3CF6R 1P80A 3WYCA 4OHBA 1D6SA 2I66A 4C89A 5FL3A 2VOKA 1W0JA 3RYCA 5DPNA 3AXEA 4F4FA 2HTFA 4YRAA 3FNFA 2VXRA 4JLBA 5FBZA 1S0GA 3EOAI 3OC0A 1UBCA 4M0PA 5E1RA 2C9BA 3PYXA 1WM1A 3QU4A 1D2HA 2X0JA 2HJIA 4JV4A 1E0JA 2D5FA 3WRVA 3LQFA 1LK7A 4RWZA 1S5PA 2AFIE 2EP7A 3G0BA 3CKMA 3TH5A 4EY4A 2V0GA 4FOWA 1G0OA 1DX9A 2JD1A 4MJLA 2IU0A 2X76A 1ZGCA 1MUUA 4OJQA 1WHTA 1RJ9B 1NW4A 4GP9A 2IEYA 3WLHA 4JMLA 5EYPA 1BS1A 3R5SA 3L6BA 4B4UA 4L6IA 2WWWA 5FY4A 2XWJB 3NRCA 1E79A 2EJWA 4NXNB 3D81A 1LCIA 2YZKA 1LX7A 5AW8A 1ESEA 5JZOA 4J90A 3R5KA 2YHJA 5K0EA 4M55A 3WF2A 5JIAA 3DWFA 4JELA 1QFXA 3SVTA 5F21A 2JBAA 3GGCA 3HMYA 4NTZA 3MQ2A 3AKTA 4YUWA 4GQAA 1VP9A 3RZHA 1QHHA 3IPYA 4G3XA 3A2NA 2WD9A 4P58A 3WR0A 2FN9A 2ZRAA 1BOFA 2D8MA 3P45A 5CYFA 3CPEA 3MF4A 2NM0A 1JB9A 3IUQA 4KMSA 4F2HA 3H17A 4WVLA 4O1MA 4EGJA 1V6IA 4B3BA 4D02A 4IJKA 2VULA 1DQ5A 2JG8B 3D4IA 4XFHA 4XB6B 2ZJ8A 1W1IA 1KI9A 1I3HA 2DQYA 1AGYA 4N7BA 2DWCA 3LQYA 4KFUA 4RFVA 1RHI2 4QASA 2H2HA 1RHUA 3HNBM 3EZ7A 1SXGA 4DIFA 2DVBA 2BY4A 4IVNA 4FP9A 2I7CA 1R1DA 3C7AA 1AUXA 1DQSA 1E3LA 1A27A 3WGMA 2ATEA 5L19A 1PE0A 3UWMA 4DZTA 2GEVA 4DV6B 4TQ9A 1D4M3 4C14A 2R6QA 2QQ0A 2GPAA 4L8WB 4B43A 3RQIA 1K7SN 5T4EA 3W1WA 1VBE2 3WNKA 5K0GA 2ZTLA 1UPFA 1GPH1 5DLYA 4IH4A 4NDAA 3NL1A 2PFKA 3CZ4A 1FEZA 3HDHA 2NMNA 2PG3A 3PXUA 1YBAA 4JMPA 3H1EA 1Y1QA 3IPVA 4ZVUA 2H06A 3KWJA 2X3FA 1YUMA 3PDIB 1MG0A 5AOVA 1OR8A 3M6LA 4YP1A 3P27A 2PYZA 2NSHA 4XE5A 4A2CA 3V1NA 2I4IA 4O9GA 5CX1A 2XJVA 1T1EA 1PMHX 1LPMA 2JI9A 2BKVA 3RW9A 5DTEA 4DUGA 5LQAA 5DE3A 4PE5B 4Y1UA 1G64A 4DOMA 4KG8A 5AQEA 4INJA 4C4XA 4TROA 1GNRA 2IOQA 1I2CA 2R85A 2C7GA 3PHIA 6Q21A 4HNQA 4NENB 2BE9A 1Z73A 5C52B 3FHIB 2ZFUA 4LNHA 1P0MA 4TMXA 5L7WA 2R7EB 2QDRA 2R49A 4RQPB 1NLSA 1RLTA 5REQB 1QH9A 3P4YA 3EOZA 5DZGA 1C80A 3GHMA 2R9VA 1LDNA 4J4TA 1X3SA 3ZPXA 3E3AA 1BE6A 1R093 1FU4A 4LHYA 3EA4A 4DMRA 5ALQA 4C4AA 1N8TA 5AC91 2YCBA 4D0NA 5DG1A 2J5QA 1VKHA 4IRMA 3CY6A 2EFEB 4UC0A 1PV1A 2X5IA 1YJAA 1T43A 3DE1X 2ZCUA 1RUE1 2N1MA 1I3MA 3M2TA 2FSGA 1H9AA 5CFLA 3HTXA 4HDNB 1VMHA 5HIIA 4ZT3A 1O6BA 2GJKA 2FFJA 2OX0A 4LYYA 3E18A 2QA5A 2P5YA 2LUOA 1C81A 1Y7LA 1XRRA 5JSPA 2JFVA 4MV9A 4E2GA 2QRNA 1Z6XA 2VZ9A 3HFGA 1MN6A 4LOLA 3QEOA 3HQXA 1HO3A 5A9SA 3FZNA 2VYVD 3QOWA 1LPAB 4FQ7A 1ADYA 4I6EA 4CIWA 3KKEA 4L27A 3K53A 3MFYA 2P69A 4G09A 3AQ4A 1X39A 1P9WA 1RQPA 2WZEA 1OUXA 3ESQA 3DOJA 4OFZA 3IUPA 2O8EA 4FMPA 5JR3A 4PQEA 5PNTA 2Y1GA 4C3OB 1HM5A 4CN8A 3FLMA 1KMQA 1R0XA 4P7GA 4HT3B 3TX6A 4LXXA 4W4TA 3WYGA 1JX6A 5ELMA 1VMJA 5GZEA 3M1LA 3CUSA 2UY9A 3OZEA 3FG9A 1W52X 4MYUA 4DR2B 4C8DA 1W85B 2VNIA 4JNCA 4GBJA 4D0QA 4MUEA 4ANFA 3AJRA 3KXPA 1N6HA 2GHRA 4RD3A 1X1AA 1MO3A 3NC4A 1J59A 4LBMA 3CRVA 5JS8A 4S2DA 1E3DA 2R30A 3U7QB 4NCHA 1X9GA 2VUIB 1WQ3A 4C0KA 1VFNA 2MEV2 3W90A 2W1UA 4HG6B 3QPBA 5F9TA 1JJVA 4ND4A 1PR0A 2XHNA 3OQHA 4YRGA 1GR0A 1S8AA 3VVCA 1GLNA 5KYVA 4R71A 1TU3A 5FI1B 1VRH3 2J85A 4BFCA 1P62B 2HO4A 2TSYB 2W98A 2NACA 2YC2A 3T3YA 4R9AA 3THOA 1E2HA 4CEHB 1V6KA 3B1YA 5IPFA 4NUBA 3CZRA 4EHBA 4MLOA 2XTJA 1DKLA 2N7GA 1VAKA 1SFYA 4XUEA 2QTLA 4HZUB 2R062 1PW5A 2FHPA 3MW2A 2NSJA 3TJZA 1SLLA 2EKBA 2KB0A 3SYNA 2JRCA 1PGJA 3WRYA 2VDPB 1M3SA 5EHDA 3B3QE 1TYAE 2X14A 2OFWA 2RDRA 2GOYA 1OT5A 3PUVA 5DGTA 3G9QA 5IF3A 2FWNA 1PDWA 1Q0TA 1T29A 1Z2DA 3T7KA 5I8PA 4LLFA 2XPCA 3G0OA 3AEQB 2RGRA 2H4XA 4FW9A 1JKFA 1XPWA 1QRDA 5DYWA 3PTLA 5LYJF 1RPAA 3ZE9A 2YC2C 1ISGA 2Q5EA 4MAMA 3TZCA 4S24A 2FZEA 4AJIA 4AULA 2FRXA 3NO8A 3P6BA 2AVDA 1JHQA 4KWKA 3INNA 3U3RA 4DMGA 1DG1G 2VMIA 1I5ZA 4ECEA 5KBYA 1W39A 4D97A 1QQ5A 3OEAA 2OCIA 3EXG2 2B45X 2DUWA 2B30A 3WRYC 1G16A 1B3RA 2FHRA 3U37A 3RJZA 1T3TA 1E1DA 4LCEA 1EHYA 1CXZA 3H8JA 3TLEA 3O93A 4GOLD 4DNOA 1O95D 1UBHS 3T1YB 1N6IA 4CU2A 4RZIA 4ILKA 4FXGB 4EKEA 4GM1A 4B8YA 5BWCA 4BTLA 1Y7IA 3NIBA 1OVSA 5I7FA 1V5IA 4NDZA 1XD8A 3GZNB 1TO1E 2QCSB 3LB9A 4EKIA 4UJ3A 1B35B 3RNLA 1VC2A 3IPAA 3FHQA 3WGOA 2IJGX 2VJOA 2R1TA 4F1KA 1JA0A 3UT0A 1M8FA 4PYLA 1FOD3 1K45A 2B5OA 5JS2A 3VYTB 3OX4A 2FPRA 5EKUA 2JFOA 5DMXA 3DKWA 4UARA 3L4EA 1HRV3 2P40A 3ZDFA 3ZE0B 2CL5A 3H0CA 2R96A 4XIJA 4PX2A 2W2KA 3PFHA 1P7YA 1AMUA 4N48A 4QPCA 5E6UA 4NN0A 3LFUA 1UC4B 2SNIE 4YJFA 2IDMA 3G2NA 2VU9A 1YXMA 4B48A 1W29A 1J24A 3EO6A 3LLUA 4F5DA 1CPNA 3TM5A 4B7XA 1LODA 2OLKA 3DBRA 4YG3A 3MXTA 3K9FC 1AVBA 4HPKA 5C3QA 1P39A 4UNNA 1XTVA 4A10A 2BL4A 3RO7A 1IJFA 1CUIA 2P67A 3PQ3A 5DXJA 1D4M1 1NDQA 3VRHA 3ROUA 1E5LA 1VJTA 5TPZA 1SCNE 1M7HA 1FU8A 2FW9A 1RJDA 4DYVA 4QNNA 1WD7A 3E5NA 3PLRA 1EDOA 4PG6A 2RJKA 1DG6A 2Q3BA 4AIIA 5C1DA 4CCMA 3HXOA 2XDQA 1S2KA 1K5JA 2V4ZA 3G13A 1E2PA 2BSQA 3LO8A 2P3LA 4LJ5A 1DOZA 1PHRA 2NADA 4WUVA 4FCWA 5GGYA 3WGIA 4JBNA 3VD5A 3WSWA 5L7OA 5GGXA 5FEUA 4A8TA 4P9WA 3GBSA 1GQSA 4JC4A 4M98A 1LK5A 2B7CA 4I09A 3ZYGA 1CUVA 3OBRA 4Q3EA 2H11A 3PJFA 3ZLIA 3K2BA 1X94A 1Q0RA 1GTJ1 3QOYA 2FPSA 1ISHA 5DGCA 2QW8A 3IAHA 4EHAA 1Q84A 3TIVA 1AUVA 3ILFA 5HIKA 1NA5A 3PKJA 4MG2A 3RROA 4IWXA 4XQ4A 5CLHA 2G4IA 1YDWA 4CF4A 5A3LA 3ZHUA 1S9DA 2VDLB 2I4TA 3GXBA 2AZTA 1P7ZA 4AUKA 4I3HA 4B3GA 4PV7A 1IU9A 4BDSA 1RIFA 1R091 2P6HA 1JLLA 5AI8A 1EFLA 5L7OC 1XP8A 4ACAA 3LA7A 1SKAA 2B4RO 2C84A 3KHCA 1RXCA 3AJZA 2AFIA 5TF0A 5SV8A 2PTHA 2AREA 2WW8A 2Z4FA 1NXTA 4QRHA 4KO8A 2PT5A 1XBTA 3K32A 1EAMA 4TV9B 3ZSJA 3MW8A 4YYZA 2HSJA 2WYWA 4H7PA 1TVCA 1ZMOA 4P5PA 4QPNA 2GVNA 2C3MA 2AZXA 4M0MA 1NVVQ 2QR2A 5FMBA 5LQNA 4BRZA 2XB9A 2WNVB 4M8NE 1WBJB 3OLVA 4N4AA 2WAXA 2EFDB 3TUIC 1HE4A 1YOVB 1TF7A 1DLLA 1E9CA 1Y42X 4C6HA 3POFA 4QATA 3FPJA 1J1UA 1O91A 2GMMA 4D0LB 1XTRA 5CFQA 4GGOA 2PVCA 4TWRA 2G9FA 3OIYA 2QK4A 4RSMA 1FYUA 5CFMA 4MRSA 2QMZA 3F5QA 5T55A 3RHSA 2CDRA 4UUPA 3X44A 2AJBA 3EA5A 4A91A 4AGGA 2WRAA 4AU1A 2PLV3 3JQCA 2R62A 2JG9A 3GJRA 1AJEA 1VBA1 2XSZD 3QKSA 3L82B 4K05A 4X6QB 2BHTA 4A2UA 1U0JA 1X7XB 2PHTA 5DN6D 2Z98A 2R6ZA 5FT9A 5CKQA 1XJ0A 5IT4A 4KRXA 2ERYA 2JVIA 3G79A 4RJJA 1M2OB 3BMNB 4PYKA 1QYVA 1DGWX 4C2BA 1L4LA 4BQWA 3DMPA 1WF6A 4QYSA 3DL3A 1PFKA 3TNLA 3H6KA 5FP0A 4GAZA 1UP4A 3JSAA 3D3WA 1NT0A 2XF2A 4LRWA 2ZJAA 5K20A 3LCPA 2ZB3A 4IE4A 1I6XA 3X1YA 5ALEA 4FYJA 1VRH1 1X1BA 3V8MA 1X1TA 2AJ8A 1VGRA 2JG9C 5IG2A 3KJFA 1DZQA 1GO2A 1O97D 3BGWA 1M0EA 3IVXA 1P2GA 4XYXA 4FZJA 3WHKA 2WKSA 1U1FA 1I1QB 1LDEA 1PQPA 1T0HB 5ESWA 1US3A 4GZ5A 1UKCA 5CYOA 3S44A 3CR7A 5CRIA 3GMDA 3UCFA 2NV0A 3RC2A 2ECFA 3VO2A 5JASA 1IUKA 3O6VA 4WDRA 2FWIA 1QVAA 4R5MA 3VDDB 3TB4A 2CKMA 4QPGB 3TR6A 1OLXB 4C4TA 1P2BA 1WPQA 4XEUA 4R84A 3PQ5A 1NOVA 4QJIA 4DXDA 3DQPA 1OB5A 3JXEA 1Z63A 1I3NA 4EGAA 1D04A 1HE1C 2AS0A 2ISCA 3FMOB 2IYAA 3PUYA 2XMLA 1G8JA 3KHBA 3WXPA 1KJLA 1L8AA 3OX1A 4TTRA 1JHDA 4U7WA 2ZSJA 2EGHA 3S28A 1LLDA 4WQMA 4JL5A 2QQJA 5KX5B 2LR0A 3GVHA 4AMGA 2B61A 3GXUA 5FUXA 4R5HA 1PL6A 4DGQA 4YPOA 2AI1A 3ZDBA 3PVBB 4F9FA 4XEZA 4X71A 2O6HA 1V0JA 4K2AA 4G65A 4II3A 1NBEA 2A78A 1R7RA 4MGHA 3OCXA 3O2QB 1KP2A 2ZIVB 1E9BA 5L9RA 3MQ4A 3TG2A 2X05A 5BNFA 1G3QA 3U4HA 3WRXC 1QJX3 2BEUA 4HVCA 1W34A 1J7JA 2DTWA 2EQ5A 3C6YA 3CTMA 3S5AA 1N4DA 4GR9A 2OYZA 5J9FA 1RMQA 5EV7A 1SO8A 3BXZA 1GAXA 3ZXUB 4GC5A 4LJYA 5BYBA 4YR9A 3O1PA 5ICSA 1YGYA 4C7XA 1XOIA 3L7NA 2ZI5A 5KSPA 3IQGX 4RGAA 1MB0A 5G4KB 5D01A 4QQ2A 4HX9A 4MQLA 5IK7A 1QH1A 4B75A 4UVEA 4LF4B 2NXWA 4P9JA 1FOD1 1CDZA 1NCRA 1P2DA 1DTSA 3SFVA 2GNOA 2WJJA 4RD7A 2D1YA 3MFAA 4XQWA 4UE6A 2OVFA 5AVUA 2R6AA 3GBPA 1F17A 1GZ6A 4OX9B 2VHQA 3AF1A 4FMDB 2ERFA 4AFNA 3RRZA 1R0LA 1SH7A 2G09A 3UJ6A 4PYMA 5LB4A 3VAZA 1O5TA 3VFDA 1HW5A 3SISA 3ILRA 3LLVA 3LY9A 2TYSB 3DECA 4ZV4A 2WS91 3HCRA 5JVDF 3WK6A 4L6CA 3LRPA 3OF1A 4PLVA 2D40A 2PQ0A 1ILWA 1IWOA 4HAOA 5C8WA 3D0JA 3FBTA 3UN1A 1EFPB 1PAUA 4JLDA 1AS3A 1E1CB 1RQ2A 4MV3A 4OFWA 2DBNA 4NBSA 3GLGE 1NCRC 5CDTA 3PNBA 3G0HA 2XZDA 1ND5A 1LXCA 1IBSA 3E3MA 4EVSA 3OBZA 1ZN7A 1W06A 4KTTE 4NWIA 2HD4A 1YQ9A 1JI6A 1QH8A 3BBLA 1XEXA 4ZY9A 2VHWA 2NYYA 3ZYZA 2VBGA 2HWB3 4Q8KA 3AETB 1LSJA 4XIKA 4Z9BA 3OT4A 3C87A 2EG5A 4KB5A 2C4KA 4C76A 1BDMA 4OXNA 4E5MA 9ABPA 2EXIA 1GWKA 1LZKA 4G37A 3OZIA 2XVMA 3OZ7A 4GI5A 4F46A 4JUCA 1BBT3 4LI3X 3ETLA 1LLUA 3QVUA 2GFHA 3FVVA 3HWSA 1N78A 4CXXA 4GG1A 5ANRB 2C1EA 2PDAA 4LZJA 1JLSA 4D4MA 1GNVA 3ANNA 5CVVA 3B3QA 3O8OA 3R0VA 4B6FA 2QZJA 4I6JA 3T7AA 1NOJA 1O58A 2WWUA 1S2GA 4WV3A 4A8JA 2PHXA 3CEJA 2VAWA 4ZEVA 1W5SA 5F51A 4MVJF 3DYVA 1HDEA 5DTJA 1BXHA 4IQ8A 1UD1A 3ATGA 1VDZA 1Q44A 2QNIA 3FUOA 4CTMA 3KK0A 3B7WA 4EUKA 1OI2A 5AHWA 1N36B 3ORJA 3STTA 1KDYA 3FUQA 1LRHA 3W8DA 3ZSLA 3PFIA 2CLLB 4IL5A 1GGHA 4ZVRA 3K6SB 3N05A 4QSHA 3NHKA 2PUHA 4S35A 3HBLA 3PRYA 4A8JC 2WZR2 1PWYE 4A0SA 1JOJA 5KR7A 2AFRA 3SCGA 3DO8A 3F67A 5CVUA 2QW1A 4NPAA 2VN8A 1O4VA 4FI3C 1IKPA 4U1RA 1E9FA 2BDTA 5TT0A 2J5XA 1U0EA 1SQSA 3JQGA 2OFXA 4EMTA 1E6CA 1Z6TA 2TBVA 1DQ1A 3N70A 1BGXT 3LDRA 2GMEA 1NTOA 5C4WB 5EC8A 3Q8BA 4IGEA 1ZNYA 2BI7A 4OMCA 2RDQA 3M81A 2WZCA 2I8LA 2OHJA 3DV0B 2W95A 1OQEA 2PZEA 2XQXA 3RS6A 4PDWA 3CXUA 4R16A 4PYOA 2PLV1 2BBTA 5JCXA 2CCGA 4KV7A 5EQJB 1YZ3A 1MQTB 2BKUA 3MIZA 3UIEA 1C4XA 3QE9Y 4I30A 3OCYA 5KTRA 5I4KA 3U40A 1Y33E 2NSLA 3LXMA 3MA0A 2ZIGA 2AUYA 2D1FA 1IHXA 1A2QA 2RAPA 1O6ZA 3W5AA 4K21A 1XZCA 4UJ5A 1XAHA 3IIKA 1UR5A 4G89A 1ODCA 4R9DA 3DEKA 2I80A 2H4YA 4YRPA 5IVKA 5GMOA 4DM4A 5A7FA 3IRUA 4DKJA 4XR4A 1HJFA 3GROA