2J1UA

Structure of a streptococcus pneumoniae fucose binding module in complex with the blood group a-tetrasaccharide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
141
structure length
141
Chain Sequence
b'KFNDGNLNIAYAKPTTQSSVDYNGDPNRAVDGNRNGNFNSGSVTHTRADNPSWWEVDLKKMDKVGLVKIYNRTDAETQRLSNFDVILYDNNRNEVAKKHVNNLSGESVSLDFKEKGARYIKVKLLTSGVPLSLAEVEVFRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOLECTIN-RELATED PROTEIN
publication title Blood Group Antigen Recognition by a Streptococcus Pneumoniae Virulence Factor
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Carbohydrate-binding protein
total genus 40
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2j1uA00
4E8DA 5B4XA 2J1TA 3K4DA 3LEIA 2WZ8A 3HNYM 3T2OA 4MGSA 3NRUA 3DYOA 4KMQA 5EJ1B 1CZVA 2VMFA 1KGYA 4QX0A 5I0DA 2J1UA 1W8OA 2KD7A 1XNAA 2W1SA 3I97A 4P08A 4JX0A 5JR2A 2QQNA 3I3EA 4BK5A 2WAOA 2WN3A 3E1F1 4ZXEA 1NX9A 3WF1A 3GGLA 4L0PA 5C7GA 1CZSA 5F7UA 1BHGA 3C7HA 4RYDA 3GXUA 4OYUA 4PQQA 4MO3M 3T0DA 2WABA 2JKXA 1UWWA 2VM9A 2EIBA 2WN2A 3OGSA 3CDZB 3CZUA 1UMHA 1JZ3A 2VMDA 2VZSA 2W3JA 1JYWA 3UETA 2QQLA 3D3AA 2RJ2A 3OGVA 2ORZA 1CIYA 4IUGA 2CDOA 5J1XA 5C70A 4JHZA 2W1UA 3T2QA 4Z2AA 4OMCA 2W92A 3NJXA 2X05A 1T2XA 2LS6A 1US3A 2Y6JA 5C71A 1IQDC 1UY3A 2WZEA 4XUOA 1UXZA 2YC2A 2WDBA 4MADA 1SG3A 3OEAA 3ZM8A 1J83A 3IAQA 3LEKA 2J1EA 5G04L 2W1WA 2PQSA 3ECQA 5A1AA 2J7MA 3SKJE 4DXTA 1R64A 3IIIA 2RV9A 3W5MA 3VDAA 3CZJA 4JKLA 1H6XA 3I2FA 4W50A 3LPGA 4P5YA 4XUTA 3HEIA 4UOJA 3VDCA 1OF4A 1KEXA 3CQOA 3OGRA 1SHWB 1JZ7A 4OMDA 2BZDA 3WNMA 4DUWA 5JMOA 1XNTA 1F4AA 4LKSA 4XUNA 2ZEXA 4A45A 4QDQA 2ZEZA 3ETPA 2WBKA 4DUVA 3MUY1 2CDPA 4A42A 4XUQA 3IDAA 3A7QA 2QQJA 1W9TA 5EJZB 2RVAA 2VCAA 1JYXA 3VD9A 5G05L 5JXHA 4RN5A 3FN9A 4HG6B 4DXRA 2XHNA 1UY0A 1XPWA 5HXMA 1GUIA 5EIYB 1DYOA 2VTFA 2Y64A 2C9KA 3T09A 4DXSA 1ULPA 2VQUA 2J1RA 3I3DA 5DPNA 3UESA 4D8MA 2W94A 1UZ0A 3WF0A 2W1QA 2DCJA 2W47A 1TG7A 3FL7A 3NQHA 3OG2A 4QAWA 4XVHA 3HOBA 3IAPA 2W91A 3PUIA 3OBAA 5IHRA 2X09A 3WF3A 1PX4A 3MV01 4QDRA 2WAAA 2LW8A 5IJRA 5JXGA 1W0NA 2ZEWA 2VZVA 5CZKA 2J22A 3BN6A 5DMYA 5IYYA 2B9VA 5LA2A 2W9XA 4KI5M 2VC9A 3DYPA 2E26A 2Z4FA 2VCCA 4OUEA 4UAPA 4CUAA 4D0QA 2E31A 3K75B 2VO5A 3C7GA 4LQRA 3ACHA 1YQ2A 1P8JA 3VD5A 1EUTA 4JKKA 5IFPA 5HPOA 4GZ9A 3EB7A 1JI6A 3SEEA 2XOMA 4BJ0A 1EUUA 2W95A 3LQCA 3I2IA 4MGQA 1K3IA 5B4NA 2VZRA 1GOHA 4QX1A 3PUHA 4QDSA 3K46A 1F4HA 2WO3A 1W9SA 2QBXA 1OF3A 5LA0A 2E32A 4TXWA 3MO4A 2WUHA 4MOAA 1UXXX 2ZEYA 4QB1A 5IFTA 1H6YA 3WF2A 2J1VA 2E33A 1UX7A 1UYYA 3VDBA 4ZZ5A 2V4VA 2VZQA 3NJVA 3WNLA 1UYZA 5JXIA 2V5DA 2YB7A 2WYSA 2BGPA 2HLEA 3HNBM 4P02B 5JXJA 4CU7A 4ZY9A 3WF4A 1D7PM 2BBAA 3C7EA 3HNMA 3HJRA 2XONA 3J7HA 2JD9A 4CVUA 3WEZA 1UY1A 1JZ4A 1UY2A 2R7EB 1K45A 3T0BA 3VD4A 4AAXA 3WNOA 4A6OA 2X10A 3A23A 3IB3A 4A4AA 2YFZA 3LEGA 4CU8A 3T2PA 2VZOA 2JE8A 3ACIA 3K77A 1GOFA 3K4ZA 1DLCA 1I5PA 1US2A 3ABZA 1OD3A 1UY4A 1W99A 3F2ZA 4XZUG 1HN1A 3I2KA 4W8JA 4AG4A 2QQIA 2VL4A 4PT6A 1JU4A 4BK4A 3THDA 2Y6HA 1K12A 2ID4A 5JUVA 5DQ0A 2QQOA 2Y8KA 2C4XA 2VZUA 1GMMA 3WNNA 3LPFA 2VZ1A 3FHAA 4XUPA 5FUIA 3VD7A 1NUKA 1O59A 3T0AA 3P6BA 1JZ5A 4A41A 2VZPA 4M4RA 1RYYA 1J84A 1JU3A 1NKGA 1PMJX 2C26A 4KWUA 2WO1A 2YG0A 4ET7A 3MV11 1JYVA 3ACGA 4JKMA 3LE0A 1O8PA 1O8SA 2VOTA 3C7OA 2ORXA 3VD3A 3WNPA 4CU9A 3A22A 4PF1A 3CKHA 3WNKA 4E8CA 4CUCA 3ACFA 1UYXA 1SDDB 2J1SA 3CMGA 3BGAA 2W5FA 4OZOA 2B4KA 2VCBA 2DCKA 2BERA 1K42A 2YFUA 3FHQA 3T08A 1JZ2A 1W9WA 4LPLA 4DUXA 4XURA 4DEVA 2XQXA 4BXSV 2QQKA 4YPJA 3OEBA 1OT5A 4M4PA 2VMCA 3GM8A 4FI9A 2VZ3A 2Y6LA 4DEQA 2JDAA 1CZTA 2DDUA 2W87A 4QX2A 3U37A 4GWIA 3THCA 4CUBA 1XC6A 4CU6A 2V72A 3SKVA 3OB8A 2ZXQA 2QQMA 1LNSA 1UMIA 3DECA 4QB6A 3WSOA 4W4ZA 1GNYA 1JYNA 3SEPA 2BGOA 3UNPA 1OH4A 3AC0A 1JZ6A 2Y6KA 2WQ8A 2VJXA 1MPXA 1L7QA 3P1IA 1W8NA 3W5NA 3K4AA 3DYMA 4ARXA 1JZ8A 2Y6GA 2EICA 4A44A 3MUZ1 4ARYA 4UI9L 4QPWA 1DP0A 2L9LA 4QX3A 5LCWL 2VZTA 2EIEA 3HN3A 3WQBA 4GWJA 3HPNA 3I3BA 1NAEA 2WO2A 3MBWA 4LHSA 1GU3A 3A21A 1CX1A 1PMHX 1PX3A 5CYYA 2VQTA 2YC4A 3GDBA 4BDVB 3JXSA 1L7RA 3NNGA 4QB2A 2OKXA 4TTGA 4A3ZA 1ULOA 3EYPA 3I2JA 4P00B 1JHJA 3C7FA 1WKYA 2EIDA 2HYXA 3CIHA 3I2GA 2W46A 2VR4A 3C8XA 3I2HA 5DN2A 5LA1A 2VMEA 2J1AA 1TVGA 1GQPA 1GOGA 4ZZ8A 1WCQA
chains in the Genus database with same CATH superfamily
4GKYA 4X6RB 5T5LA 4E8DA 1Z7S2 2PLV3 2VPVA 3AKTA 1YO8A 3FUOA 3ZKUA 3LEIA 4Y1ZA 4MGSA 2Q30A 4LBNA 2ARAA 5GLZA 3S6PA 5M0TA 3O1MA 5EJ1B 1CZVA 1DYKA 3HN1A 3K3OA 2VVEA 3G7DA 5I0DA 5CVRA 1AR71 4K1ZA 3JB4C 1AYM1 2JDYA 3V0AB 1HXS1 4LXLA 3ZYIB 5KXEA 4N43C 4NWWA 4TZDA 2H6CA 3I97A 2DURA 4EWAA 2RMU3 3I49A 3RJ2X 2QQNA 4Q5OA 1REEA 3ZR6A 1EV13 5JAXA 1W2UA 2ZHLA 2WAOA 3QOPA 3RYPA 4BK5A 3FUQA 3NO8A 2ARCA 3PHMA 2QJVA 4HVRA 4GA9A 4D3WA 1VMFA 1X33A 1VAMA 2DCTA 3AJZA 5FZ4A 2PHFA 1GZCA 1RUI3 1ZM1A 3W58A 2G1MA 3GGLA 3MLKA 4LO7A 2Q8CA 5J96B 1VBB2 5CFDB 2R30A 1ULCA 2MPFA 2RS32 4YVSA 5F5QA 4RGGA 5FR3A 5A7WB 3VKOA 1UW8A 4YM3A 1BBT2 1BHGA 3J8F1 1W6PB 4H2AA 4KWJA 4FOQA 3UYJA 5K8SA 2XUEA 4OI0A 5FYSA 2VM9A 5J09A 1DF0A 2WN2A 5IVVA 1B09A 3FBYA 3RVHA 4FBFA 4CDXB 1H1MA 4AHWA 2XG3A 4CDWC 1JZ3A 4IL7A 2VMDA 4Y3OA 5F2WA 2W3JA 4HVOA 1JYWA 3DPRA 3UETA 5AC93 1OLMA 4WM8C 4AEMA 2ORZA 1WMDA 1LHUA 4RFT0 3N7KA 4XFIA 2ZKLA 2R071 2WFF3 1NT0A 1W6MB 4QX8A 3DKWA 1Q8OA 1ZZ7A 2HJIA 1FPN2 3JU9A 1COV1 4GULA 4META 3T2QA 3VHNA 2P3IA 1OOPB 3BOWA 3NJXA 3OPWA 1SEFA 2JDZA 5FYYA 3KMHA 1IPKA 3FFQA 1RB8G 1OH3A 5C71A 4Z82A 1F35A 1GANA 1UXZA 4H14A 2YC2A 5CG8A 3U10A 2D6OX 3AP4A 5BNOC 5KBFA 1FATA 3VUOA 2JIGA 5DABA 2WZR2 3N9MA 4WV8A 3P3NA 2JE9A 5KHGA 4GKXA 5K9YA 2A3YA 3OJBA 1O7FA 5FZGA 3ZM8A 1ND2B 2D97A 4CXWA 1DQ0A 1NCRC 3N9PA 1J83A 3LEKA 3AP6A 5FZOA 3U4XA 1RUF2 4MXWA 4E4HA 3S7EA 2SLIA 5K7PA 3HMYA 1BYHA 4GB33 4DXTA 5E8AA 3V0BA 2RV9A 3W5MA 1MR5A 1ZRRA 1GZWA 1AF9A 1K5JA 1QH7A 3CZJA 4JKLA 4YW5A 1QMJA 1DGRN 1W0OA 1VBA1 2ENRA 1K5MB 3I2FA 5CB7A 3K3NA 3LPGA 2FDJA 4Q4W3 4P5YA 3RZJA 4YW6A 4YVWA 4WVWA 4MZUA 2XBO3 5FYUA 1UIJA 4I3PA 1I5ZA 3WP3A 4QPIC 5IVBA 3O1OA 4CTEA 3L2HA 4LBOA 1MQTC 1WLTA 1SHWB 2WS92 1JZ7A 4OMDA 3TBDA 3M4FA 5JMOA 5SV5A 3SLIA 5EZWA 4TYSA 4CSWA 4AL9A 1CAVA 1LHNA 2E7QA 2JG8C 5EV7A 2UU8A 1OA2A 3KF5A 4K7JA 5FPZA 4A45A 5CA6A 4OHXA 1DBNA 1YI9A 2WLQA 2XVKA 4XJZA 2FDFA 2BTVC 3O1TA 4UFKA 4NRMA 4FTSA 1UU6A 3UGFA 2D7FA 2WNEA 1HRV3 1GKBA 1RTVA 1W04A 3NAPA 4UW3A 4IV1C 5FPLA 5HXVA 1VBE1 3ZIWA 1YQCA 3HBZA 4IEXA 1W90A 5FY4A 5I8TA 1PVXA 2XDVA 4B4PA 4BH9A 3ZXLA 3SISA 4J1WA 3JCIA 2Y60A 5FMDA 3RZHA 1S0DA 5ACA2 2IVJA 2DYCA 2RVAA 4RL7A 2G19A 1VRH3 3K51A 4FPCA 3RRDA 3AX4A 3PU8A 4KWKA 5FZHA 3AL6A 1JN2P 1H30A 3E6BA 2TNFA 3OYWB 4LORA 3DXUA 5CEHA 1AR92 2WFPA 3VBFB 3R05A 1S2BA 4FPHA 1R082 4Q1RA 4CDQC 1RVF2 2VTFA 3T09A 3WHTA 4DXSA 1TZOA 4ONUA 5FZ3A 3VHPA 1W8TA 2VW2A 2JE7A 2VQUA 2Y0IA 2J1RA 3ZN6A 1QJX1 1W6QA 2BVVA 5E88A 2EXKA 4YW1A 2NP0A 2PLV2 1QJU3 3SNMA 3J26N 4XIKA 1RUE1 3WR0A 3CL1A 3HD8B 2DCJA 2W47A 3KS7A 4HSJA 4IDZA 4PHZA 4UF0A 3GCWA 3V65A 2FDKA 5FQ0A 1DQ4A 3WDTA 1V6KA 3WLUA 4FPLA 3B02A 5C3QA 2TEPA 1CR7A 5IHRA 4XBNA 2AH2A 2C0ZA 2XKPA 5JIUA 1ZBA1 2WAAA 2A7AA 1OA3A 5IJRA 3U78A 5HBAA 4OHVA 5JXGA 1VB4A 4UW4A 1NXMA 4YYOA 4ZONA 2J22A 1JHNA 3NSTA 3VV1A 3WW4A 4QHZA 2RMU2 2B9VA 3DCQA 5LA2A 1ENRA 4E27A 1EV12 3H8XA 2HWC3 4OUEA 2OQ7A 3JBG1 2GC0A 2P34A 2XLFA 5FYZA 5J48A 4QQOA 2E31A 1LB2A 4N43B 2ZX3A 1RUI2 4I09A 2IVIB 3IKWA 4FTEA 1A78A 1YQ2A 4AHZA 1QOSA 4JKKA 3UJQA 2D43A 4IEWA 3OY8A 4RS5A 4UXAA 4YZ5A 4Q0UA 1F9KA 1W8ZA 5BNPA 3HIFA 2WO7A 5DDJ1 3BU0A 5FIXA 2YY1A 2DVGA 2YDEA 3B7MA 3DKQA 4XEZA 2GMMA 5GKAC 5GLVA 1W3XA 3CLPA 5EPAA 2VZRA 5FYCA 1ZZ8A 1PZ7A 3OF1A 1GOHA 5AC92 1RUOA 4KH9A 4NAOA 1YRZA 4QDSA 1YXWA 4WVMA 2WFF2 4JQTA 1CN1A 4CDWB 5DAQA 2WO3A 4YVSC 2JB8A 4XF1A 5EWSA 3ASIA 1JYTA 2AR6A 3M70A 4ZU4A 4XCAA 1W9FA 1HV1A 5T55A 1DCSA 5SV8A 1YHFA 4AEDA 1AX1A 4LKFA 2OT7A 4MSVA 4IGOA 3RZMA 1C28A 2RDNA 1UYYA 3ZFFA 5HCHA 5A32B 2V4VA 1LCLA 4R4XA 4YW4A 5IAVA 4CCNA 2O1QA 5AFEA 3DPRC 3HQXA 5FREA 1L7LA 2ZABA 4Q4Y3 1VE0A 1BQPA 1Y3TA 2V5DA 2YB7A 4P02B 3HNBM 4UBHA 3RWKX 1MS3A 4ZY9A 3R6SA 4FPOB 5BNOB 3FLTA 1O3SA 1GFF2 1Y9GA 2OA2A 2VTXA 3ZMNA 4AF9A 3EO6A 2JD9A 5A1LA 3WEZA 4GB32 5FZKA 3RQ0A 4KQ7A 5CFDA 1UY2A 4U36A 4JCKA 3PUAA 1NCRB 4QKNA 1ZZ9A 1KFXL 4AAXA 4ZKTB 3RZKA 1W9YA 2GAUA 2OX0A 5FWJA 2X10A 1YWKA 3RWNA 1D4M3 5FJKA 4D6RA 4Q4W2 4XC9A 1QH6A 1LGCA 1PM4A 5BNQA 2YFZA 2XBO2 3IDCB 1QOTA 1UOJA 4CDXA 2DVAA 1C5HA 4G9SB 1OQ1A 1LOCA 3TN91 3ATGA 4IE7A 2PHUA 3K4ZA 2ZX2A 2ZHNA 2RDQA 4LEJA 2D3RA 1DLCA 1AX2A 3MIGA 3O0XA 2Y33A 1T6GC 3VKNA 4QXBA 2XH6A 1UY4A 4R9BA 1S0FA 1MQTB 4WVZA 5LASA 3DL3A 4XZUG 4YG0A 3UK9A 1IG3A 5J3UA 1YQ6A 1ULGA 2ZZJA 3VHRA 2WWUA 1HRV2 2VL4A 4PT6A 5L73A 4BK4A 2JG8B 2XB6C 4NAMA 2DFCA 3MLLA 2WC2A 1LULA 3NVCA 4YVWC 4YFZA 1ODMA 2QQOA 1QDCA 3GBGA 4XJUA 4HANA 2JG9B 4IEPA 3WNNA 4MX3A 5FFOC 1EPZA 1X9TA 1JXNA 4IV1B 1V9U1 2AC1A 2Q0AA 4PIXA 1TMF3 4AFBA 5CKNA 3FHAA 3NNLA 3MFAA 4XJ9A 3VD7A 1CAWB 4UWDA 2RM23 1RUC2 2ZZQA 4LA2A 1V6MA 1UCXA 5T5JA 3BIEA 5FZDA 3V64A 3H9AA 1LRHA 3MF6A 3A0KA 1AR63 3BUCA 2IFWA 2ZKNA 2AENA 1WMEA 3PLQA 5FPBA 3KQ4B 1S4CA 1TME1 3NAPC 1J84A 4GD4A 3UL2A 2C26A 4FO9A 2WO1A 3MV11 3ACGA 1ENSA 3JZVA 5I93A 3UV9A 1O8PA 2JECA 2VGDA 3C7OA 2ORXA 4FPYA 2ZX1A 4GWNA 1QJU2 2D6KA 3I7DA 1C3HA 3R4SA 4CDQB 1CJDA 4LMFA 3WG2A 3CU7A 4CUCA 4I2OA 2FDHA 4MLOA 2O8OA 3WNXA 2B42B 2QFEA 1LESA 4DPNA 1UPIA 4ZXKA 2GH8A 4FXKB 1RUH1 4X8NA 5J7MA 4AFCA 4OZOA 3SQOA 5JLVA 3IPVB 2ERFA 3LGRA 1OVPA 3CBNA 3CJIA 1Q5OA 1ZA4A 1K42A 3FHQA 2O0OA 4D6QA 1JZ2A 1O3TA 1WW5A 4BLJA 1NYWA 1HLCA 5L7OA 2RS31 2ZA9A 2HWC2 3N4MA 1WW6A 4TN7A 4XURA 5HCBA 2HBUA 4ASLA 3FFZA 2JDMA 1VBC2 2QQKA 4G4FA 5KWRA 3OEBA 2BBVA 3LFMA 2RS53 1FNZA 5FPVA 4ATEA 4FI9A 2Y6LA 3ZYGA 2WT0A 1ALYA 1F5FA 3BKZA 1CX4A 1E57A 3QLQA 4A3XA 4UFLA 5FY5A 1BMV2 2A5ZA 2YUEA 4RSUA 4CZSA 4N90A 3POJA 4XETA 1LHOA 1N3QA 2VNVA 3KM5A 1AL23 2I45A 1F8VA 1G9AA 4CU6A 5CADA 3OYWA 3CF6E 4A7YA 1A8DA 1FMD2 4LOSA 5A3UA 1LNSA 3KGLA 3SMHA 5FLIA 3O7OA 3AZXA 1OVSA 5FOBB 4PI2A 4LBQA 1O3QA 3PJQA 3LAGA 3Q8FA 5F37A 5LRSA 2BWAA 1PZ9A 2BGOA 1J1LA 2BQPA 2P17A 5FZ1A 4AR2A 2Y6KA 3NV2A 1XSQA 1QY4A 1MPXA 5IVFA 1QKQA 3P1IA 2VAUA 1W8NA 2OW4A 3W5NA 3ZN4A 4RS5C 1UN1A 1JZ8A 2D6PA 2Y6GA 4MG2A 2EICA 5BNPC 1UZZA 2BFUS 2C24A 5I0SA 2IFRA 4CCOA 3UKVA 3PUSA 2HWE3 4QPWA 1VLNA 3RDIA 3POYA 3WP5A 3ZPOA 4YVSB 1DP0A 2L9LA 4QX3A 5LCWL 3TEYA 1OBNA 3TEZA 2QUOA 1ZRFA 2WIIB 1XYPA 1PIV1 1AUYA 3U11A 4MXVA 4S2FA 2NMNA 1J3QA 1PMHX 1AL0G 4Q4Y2 5IUQA 3ZYBA 1V0AA 2CWSA 1GSLA 1RUJ3 2B39A 3H50A 4E2SA 5FV3A 3L2YA 4N43A 3JXSA 1NCQA 3DPRB 2CV6A 5GLUA 2Z2SB 2OKXA 5F3IA 1W8WA 2WSUA 4MGYE 1ENQA 2GC1A 4A2UA 4HZFA 3U07A 4QQPA 4AEDC 5CG9A 3I2JA 4Q26A 4V2VA 2R061 3C7FA 3ITQA 2JDPA 3D0JA 5C9AA 3ZFFC 2EIDA 3AVSA 4MGZE 2BGCA 1JYIA 2PHDA 1HRI1 2VULA 3LWCA 5FY9A 2VR4A 4BQYA 3AP9A 1W06A 4D6SA 1RUNA 3I2HA 5LA1A 2VMEA 2WINB 1TVGA 4B29A 1DZRA 2F4PA 3MIBA 5FZ8A 2AZ5A 1UF2C 2GDFA 4AK3A 2Y38A 5EJ3A 3MW4A 2BP6A 4FOYA 1X82A 2MEV3 3HNYM 3T2OA 3AP7A 5FZOB 4LHNA 4MXWB 3LOBA 3B9IA 2B5HA 5FXXA 3DYOA 2P3JA 1RXFA 1VBB3 3WY6A 1KGYA 1NXD1 3AMMA 3ZMOA 1CONA 1OURA 4P5HA 5FWEA 3V0BB 1GZWB 3OUJA 1W8OA 1DQ6A 4CDXC 2WRAA 3KB5A 3MIFA 1AR91 4R9DA 2R041 3T2TA 5FLHA 3FLRA 4N9HA 3VKFC 1O6UA 3TOJA 1R081 3J9SA 4AI0A 1RVF1 3KVBA 4CUGA 5JR2A 4YVWB 2HWF1 5C8WA 3I3EA 1UIKA 1OFNA 2RM22 4YG3A 1PVC3 5F3GA 4UYBA 4QM8A 1NX9A 1WGPA 2O14A 4IEUA 2BW8A 3USUA 4EN9B 1AR62 4Y20A 1XE7A 5DAVA 2PLV1 3EHKA 3RZZA 1QU0A 5F39A 1IKPA 5DUVA 5C7GA 1CZSA 3FX3A 5A7NA 1CGPA 1NY72 1MZ6A 4CXXA 1RUG3 2IWGB 5IVJA 2AREA 1FPN3 3C7HA 4OYUA 1ULDA 2VUAA 4RFRB 1CAUA 2IZWA 3NAPB 3MHZA 3OGSA 3WDYA 2QE3A 1M06G 2XJUA 2VZSA 4ZU7A 3DXTA 3KV4A 1UYPA 1JW6A 5IW0A 3T1MA 1PGSA 3BTAA 2CGNA 2QQLA 4XFCA 3ZSEA 1J58A 3OGVA 1X8EA 2WZR3 3RG0A 5ANQA 1LENA 5J1XA 2DUOA 3LD8A 3POIA 4JC1A 3SH5A 5C70A 2XLGA 2JEMA 2W1UA 2WKKA 1VP6A 1IG0A 2DBNA 4M3CF 4NIHA 2VOKA 4YZ4A 1RUF3 1BVVA 2O8QA 1YLLA 3FC0A 3IIAA 1A3KA 2LS6A 4XDQA 1Q8PA 5B2GB 3A4UA 3ES1A 4CPBA 1HB4A 1IQDC 4AQ2A 5H9SA 5K4LA 4AE2A 2ZMNA 4XDPA 1W6QB 2H0BA 2JG9A 3MIHA 4NPRA 4YGCA 4MADA 1NLQA 2D6LX 3PMEA 4B4RA 4BYYA 1AL22 3M3IA 4Q0SA 3CJIC 3AMHA 4UF0B 4CCKA 5AC91 5FQ0B 1U0AA 2J1EA 3WCRA 2G9ZA 2W1WA 3MDPA 2WFF1 5FZBA 5FBZA 2WS93 3ECQA 3GNEA 5L7OC 1RJ7A 1C1LA 1U5ZA 2XJRA 3WXPA 4FCAA 4AQ6A 3A0NA 1OI6A 2A75A 3VDAA 1WW4A 3URFA 2R32A 4LHKA 3GALA 1DHKB 1SCSA 1H6XA 5A7OA 4Z1VA 1OLME 4ITCA 4M00A 1KITA 1MS5A 2XQRA 3BCWA 2JKBA 3HEIA 1SACA 4I30A 3IWZA 1W6NB 2B46X 4B3NA 3VL9A 4KWLA 1GLHA 4HKWA 4UFIA 4D94A 2HWE2 4C8DA 4DUWA 2Q4SA 4Y1VA 1CAXA 1ASJ3 1XNTA 3OY8B 4RS5B 5ACA3 5BV6A 4Y1UA 4ISQA 4N53A 4XACA 5BNPB 2ZEZA 2HWD3 2B7YA 3R0RA 2WBKA 4E2GA 3LB9A 1AYN3 1PNGA 4P9WA 2CDPA 2JENA 1PO11 1RUJ2 3INAA 3M3CA 4SLIA 1ZYBA 2WQZC 1H9PA 3I8TA 1BXHA 1IS6A 3H0OA 3IDAA 4XUQA 3WQ0A 1W9TA 3KWVA 4KGQA 1OUSA 1UOBA 1VPHA 5DG1A 5FZFA 4ES9A 1JH5A 3H42B 4Q4W1 4JTNA 2DUQA 1N1TA 1PO23 3AKSA 3C2UA 4WVMB 2WZPP 1NA1A 1YFYA 3RI8A 2BWCA 1BJQA 2RE9A 3ES4A 4B7KA 5G05L 4URAA 1YFUA 3FN9A 4QHOA 4DXRA 5FO8B 1PGL2 1UY0A 4BZ4A 1XPWA 3UKTA 4AEDB 4JVAA 1Q8VA 5KXDA 4ZHNA 4PQ9A 2HH9A 1DYOA 4XQWA 4PBOA 5CKMA 5LEJA 1BK1A 2AUYA 3ZFFB 1UKGA 5A80A 4NN0A 4K20A 2CTVA 4AVTA 1LECA 3KT1A 4NOTA 1JOJA 4FAGA 1SLIA 2VNRA 1HRV1 1NCQC 3I3DA 1GR3A 3GBWA 3O14A 5FO7B 4D8MA 2UWAA 4CEWA 2W94A 3IN9A 2ZMLA 4UFMA 1DGWX 1VMJA 2MEV2 4GXLA 5IVYA 2W1QA 2VW1A 4QAWA 1AZDA 5LRRA 4XVHA 4YG6A 3HOBA 3VBSA 5C9AC 1VRH1 4V2WA 1AJKA 1LR5A 3B00A 5JIAA 3PJYA 1I1EA 1LOFA 2ZGUA 3M1HA 1PX4A 4QDRA 3JQXA 2LW8A 5D8AA 4MHRA 3AJYA 2YYOA 4OULA 2CGPA 1WCUA 3N9OA 1NQJA 2Z79A 4AHXA 2C1FA 4OVEA 2ZGOA 5BPXA 4AHYA 4NJ4A 3FJSA 3AKRA 5DZFA 1DGWA 3WVJA 5LBEA 2VC9A 1SPPA 3DYPA 4CEYA 2E26A 1PVC2 2Z4FA 1XXNA 2HEVF 3X29B 4AWDA 4O61A 4P9LA 3ILRA 1IPJA 5A3OA 1IZ3A 3C7GA 1RHI3 4XHBA 2DBIA 3ACHA 2D98A 4BXFA 5HPOA 3RMXA 1KXGA 1MS9A 3LIGA 4GZ9A 4FAHA 5A6ZA 1RUG2 3OBZA 2WLPA 4WZFA 3DF0A 3MPBA 4XBLA 3EB7A 3D82A 1JI6A 5FYIA 2W0XA 3VB9A 1OLRA 4BJ0A 1QOOA 4I0AA 2XKOA 4XIOA 5FYTA 3SXWA 5AFBA 5K0UA 1ST8A 1F31A 4AGGA 3LSDA 4I3GA 2DU0A 2YZ4A 4NO4A 4Y24A 5HV4A 3H1WA 4FXGB 4DS0A 5ISLA 3ZFGA 5FKCA 4QX1A 2CHHA 3MZHA 3KQRA 1O91A 1YNAA 3H1MA 3PUHA 3FWEA 4R8HA 2BFUL 2XJTA 1UL9A 5FZIA 5A6QA 1VMHA 3B93A 2OZJA 3ZLIA 5KHKA 4KU8A 4YM2A 2OVUA 1G9CA 5FCCA 1OF3A 2GNMA 2NZ9A 3MO4A 2WUHA 4MOAA 4DY3A 3AVRA 3LCPA 4JRAA 4MV2A 1FNYA 2RR13 2UWBA 4EN6B 3WF2A 5A6YA 3O1SA 1O4TA 2J1VA 4XPVA 2ILMA 4LO8A 4HOOA 1OD5A 3GF6A 1XYNA 2V73A 4XF4A 1RIRA 4DXZA 2XMLA 1QJEA 4ZZ5A 2VZQA 4XAAA 3TEXA 4P14A 3WNLA 4QGMA 4QWNA 5A3MA 1UYZA 4JDMA 3APBA 4BIOA 2X8KA 3KVAA 2WYSA 4YZ1A 2A73B 4XZPA 3LIHA 2GMPA 3MGUA 4Z92B 2JXAA 1D7PM 3C7EA 4HK9A 4R52A 3LDBA 4EJRA 1W39A 1S0GA 2XONA 2ZAHA 3ELNA 2A1XA 5E16A 3WCSA 4E4DX 1UY1A 1LODA 4OI1A 1W03A 2R7EB 3GYDA 4HXCA 3JD73 5FTTC 3ZIXA 3VD4A 3CJIB 1JODA 4BQ1A 3VGIA 3WNOA 5FPUA 3GJBA 1YCIA 1R091 5BY5A 1SLLA 1YIPA 2WWJA 3A23A 5L7OB 1VAKA 2JG9C 5FY1A 4A4AA 1C8M3 3NNMA 2HWB3 5FMCA 3ST7A 5BYNA 2GN7A 2E6VA 1GOFA 1NQDA 2QQWA 4FPEA 4TWTA 1WW7A 3AZYA 5A6XA 3IMMA 1ASJ2 4Q4Y1 5BNNA 1QQP3 1XNBA 4FP3A 4EN7B 3O1RA 2GZWA 4DRVA 2G9GA 3AM2A 4B1MA 5A3TA 3M7AA 2HWD2 1H9WA 4AXOA 2V4AA 1RUC3 3DUIA 5A3PA 3KV6A 4YGBA 1IPSA 1AYN2 1OFSA 1UQXA 2VBPA 2R0HA 1REFA 3KV9A 3N7LA 4NHKA 5FK8A 1HXS3 4CRQA 1CPNA 1JU4A 2QNKA 3ZYFA 1BKZA 5JOXA 2ID4A 1AXYA 4LBQB 4OI2A 5DQ0A 1QJY1 2FDGA 3MW3A 1D4M1 3ZXDA 1H2NA 1PO22 1GMMA 3MICA 5T52A 3OOXA 3LPFA 4BQWA 2JDUA 2VZ1A 1PHMA 2YHJA 4XUPA 3NJYA 2PFWA 4XXPA 4YRDA 5F3EA 5FY8A 2NM1A 3I3QA 3RPQA 5FRAA 1Q3EA 1NUKA 3MYXA 4N53C 1UZYA 1O59A 4L9BA 2DV9A 2EVXA 3T0AA 3LEMA 1SFYA 1URXA 1S55A 4M4RA 1RYYA 3J7LA 2PMWB 4KGGA 5L19A 1PMJX 1MACA 5FUPA 3T4HB 5APAA 4F7ZA 3G6JB 4JKMA 5I8YA 1DDLA 3E6DA 4NPMA 2WA3A 3ZSLA 4W6XA 4EWDA 4GIQA 3N9LA 4H3WA 3DV8A 3CKHA 3LA7A 3VHOA 3WNKA 4E8CA 2LROA 4WBBA 5A1FA 1SDDB 1NA1C 1VBC3 3ZFEA 2R073 4HN1A 3N7MA 1AR81 1NCQB 1CJPA 1W6NA 3AXEA 2MHFA 4IE4A 4L97A 4CPBD 5KHIA 3I4IA 1TMF1 4FT8A 1HIXA 1PGW2 2EIGA 1JUHA 3CMGA 4LA3A 1LU2A 2ZHKA 4UFHA 1XQNA 2DCKA 2BERA 4FVVA 4Q4X2 1POV0 1RMU3 4EZ4A 5C9AB 4LNVA 2V5YA 4AVVA 4IEZA 4TLGA 3VZJA 1LHWA 2Q1MA 2VOWA 1LOEA 1APNA 1FMD3 4CP1A 2XWBB 5IT6A 4CEWC 4Q29A 1HKDA 3USSA 1XNCA 5CIRA 3D4KA 3DEMA 1RHI2 4W6WA 2VMCA 2WNUA 4ZU5A 2R16A 2BV4A 3R4UA 3I2DA 2DDUA 3Q8EA 3KT4A 2XVLA 3VBSC 1OA4A 4QX2A 2JDNA 4HPKA 3AB0A 3Q8CA 3I59A 1J3PA 2CU5A 3U37A 4CCDA 1LOFC 1QXPA 2E7TA 5IK4A 5FMOS 4COWA 5D8AC 1XC6A 2V72A 2YPDA 3OB8A 1GP4A 2D3PA 5HV0A 5LW9A 5F6LB 3E5UA 1ACCA 2IXLA 2P5BA 3DECA 1S2KA 2ZGTA 4K6BA 4CEYC 3AYDA 4MH0E 3N9QA 2EF6A 2RS12 3MEPA 3CEWA 1UMZA 3UNPA 4LR4A 1OH4A 2GU9A 1GWKA 3AC0A 2OUJA 1JZ6A 4GJYA 3POWA 2I2SA 1WD3A 5F2SA 1VR3A 4WM7B 2RS51 4Q0VA 2EAKA 4UFJA 1MS1A 3DYMA 1OQEA 3Q8BA 4FFHA 5I0TA 3USUB 2XVGA 3N3HA 4Y20B 1V6NA 5H9PA 2RR12 1REDA 4PLMA 2G9FA 4LBJA 3I3MA 4BU2A 2PHXA 3QH6A 3H3LA 1AL21 5K0UC 4GWJA 4QD2A 3N7JA 1NAEA 2WO2A 5FZ9A 4LHSA 3DN7A 4RHV1 1Y9MA 2ADDA 3THTA 2WJSA 3ZFGC 3GZAA 1CAUB 1CX1A 2IXKA 3PIJA 3WT3A 4IEOA 1W0PA 2A6ZA 5C4WA 3NKGA 4NIIA 4AVCA 2CAVA 4J25A 3GDBA 5LBFA 2ZGRA 3LOIA 4Y26A 2P2KA 4QB2A 2R49A 4Z8BA 5IK5A 1KQRA 1FXZA 2XJPA 5J98B 3NMBA 3NW4A 3JD72 2PHTA 4RA0A 4FFFA 4FPGA 1QJFA 4DO0A 2V09A 2A3XA 1JHJA 4CYDA 2AEZA 1WKYA 1CQ9A 2YBKA 4D7YA 4M0HA 2P3YA 4OZXA 3CIHA 2ZACA 3AFKA 1C8M2 3I2GA 3WDXA 2CNAA 2HWB2 1JTZX 3WDVA 1J59A 1MZ5A 5DN2A 2J1AA 1NLRA 2X5IA 5GJ6A 1XNKA 1RUE3 2TUNA 4Y33A 1GOGA 1QQP2 1RUJ1 2EALA 4PIZA 3WV6A 1SFNA 1WCQA 4CCMA 2H6BA 5KC5A 3EQEA 2PELA 3O5SA 3EMRA 5B4XA 4AYUA 4XJWA 1W2AX 3GZEA 3RI9A 3ZSMA 2JICA 4ZS2A 1DYPA 5F6KA 4LBLA 4NIGA 1AR72 2GN3A 3POEA 5FZ7A 1ULEA 1AYM2 3TNQA 1HXS2 4AZZA 2K2SA 4AVAA 1SZBA 4FPFA 1LGBA 1Z7S1 4L92A 4KMQA 3S30A 1QEXA 3H3ZA 2R6QA 5FZAA 5FZLA 1RUD3 2ES3A 2J1UA 2KD7A 4N7UA 1ZBE3 1XNAA 2W1SA 4S2GA 1N47A 5A70A 3D6EA 5LBBA 5I91A 4MGTA 4OLLA 4YWAA 3AYAA 2UY8A 1W8UA 1OMIA 4WVVA 1H1IA 5AVAA 1OPOA 4YGDA 3AKQA 2GP3A 3ZDSA 5BNNC 2WA4A 2RJLA 2WN3A 3E1F1 4YZ2A 4ORFA 4Q0PA 2UY9A 4BE3A 1HJFA 5FZEA 4YSFA 4KNCA 4S2DA 4M01A 5KHHA 4LIVA 1CAXB 3HAGA 5FP4A 5JPMB 1LJ7A 3FHIB 4LUMA 2CGOA 5FXVA 4N53B 3OBTA 2K9ZA 4BIFA 2DVFA 4RYDA 3PUQA 4PQQA 4MO3M 4IQPA 3T0DA 1VBB1 3CNAA 2HKXA 1Q8SA 4IV3A 4RR3A 3ZYRA 2JKXA 3ZXKA 4P9IA 2Q5TA 2EIBA 1UZWA 5GZGA 5C3SA 4GAZA 3CDZB 3D0SA 2R072 1BBT1 3CZUA 1UMHA 2X53S 5JI9A 2FMDA 1V6LA 1COV2 2C9AA 1NOVA 2QZ2A 4UT5A 1NZIA 3WW1A 3BYWA 3D3AA 4XTMA 2RJ2A 4BHPA 4X6QB 3E6CC 2XUMA 1V00A 1NA1B 2WQ4A 3P3PA 1RMU2 4QU1A 2XPJA 1VJ2A 5FOJB 2DFBA 2CDOA 4X8PA 4D69A 4H7LA 1KFUL 4NIAA 3GJAA 3VKLA 3ZPYA 2LM3A 4COVA 4Z2AA 1POV3 4OMCA 3FZ3A 4GWMA 4UW5A 1RUG1 2OS2A 2ZAAA 3MPPG 4P9GA 5A7SA 3BU7A 1FPN1 2HBTA 2Y6JA 4O9GA 1RINA 1D2QA 1UY3A 2WZEA 4XUOA 2BVBA 2ZGPA 3CO2A 3ZFEC 2JB4A 3KF3A 3MFCA 3AZZA 5JOZA 1IKQA 2BUKA 5CBLA 5EYXA 1SG3A 1X7NA 4CEWB 3ILNA 3FE5A 4ZS3A 3WW2A 4XF3A 5I8SA 1UPSA 3MIDA 4CXYA 4MHUA 4YW7A 3BTYA 1Z0HA 2VTXJ 3VBRA 1KJRA 1LAJA 4XF0A 2WZR1 2JJ6A 3VBSB 3VZMA 4XFBA 4IEVA 1QIQA 2A6WA 1SLAA 1IS5A 2J7MA 3PTYA 5D8AB 3IIIA 3VBOA 3ZDVA 3ILFA 2FZ2A 4C0HA 1A6CA 1S0EA 3PMSA 3KZ4C 5LZ6A 1H8VA 1RUF1 1C8NA 2WNUC 2DCYA 3CHXA 4W50A 1SPPB 3NKTA 4CEYB 2C6SA 1Y9QA 3RSJA 4M3CE 5CFCA 4QPGA 1BK0A 2VUDA 1PM7A 1KEXA 3ZR5A 1GNZA 4EWEA 4E9KA 1OUXA 4JQRA 1KRIA 1ND3A 2VVDA 5JSPA 4C0BA 2BZDA 3WP4A 2VQAA 5FZ0A 1F4AA 2Y34A 2ZEXA 4FOVA 1VBE2 3H8OA 5FYVA 4GMP1 1KS4A 2D6MA 3PIGA 2WS91 2VUCA 4HKOA 2EAAA 3MUY1 4YW2A 5LB6A 3E5XA 4DUVA 2JX9A 3W59A 3BI3A 2P6CA 5K0UB 2R1DA 4NROA 1LU1A 4QQLA 3A7QA 4AFDA 1WBFA 2CYFA 2B9UA 2QQJA 3PURA 5EJZB 3ZFGB 5ANNA 2YU2A 5L9RA 2W52A 1V6OA 5GLTA 4EN8B 1RGSA 2F4LA 4IGQA 3ENRA 2AEYA 1TME3 2PN5A 4AAPA 4BQ5A 4RN5A 2VMGA 1IS3A 4AEKA 4HG6B 1ASJ1 2XHNA 5DUXA 5ACA1 3ZO0B 5HXMA 1QJX2 4W6YA 4AFMA 1ZZCA 4AI9A 1GUIA 5CNAA 5EIYB 2Y64A 2ZMKA 5C4WC 2HWD1 1YJKA 4A7KA 4IE0A 1RUE2 2HEYF 1SLTA 2LTNA 4HL0A 4BMEA 5F9TA 1ZNPA 5KHJA 4U2AA 3I54A 1PNFA 4L2NA 4A6SA 4YLZA 2XL7A 4K40A 2D5FA 1CVNA 4WM7A 4ZPIA 1W3VA 4O7XA 4AVBA 2NPIA 4JGZA 3WF0A 3IZOA 1TG7A 3FL7A 3NQHA 3KD4A 1DIWA 2W91A 3EBRA 3OBAA 3T4VA 1ZA7A 1Y4WA 1H4HA 1UAIA 4CDUA 1RUD2 1S0IA 1TNFA 5JZGB 1W0NA 1ZBE2 2ZEWA 3B94A 3BVCA 3NNJA 1MS0A 5CZKA 1UOGA 4OHZA 3WINE 2ET7A 3HWJA 5DMYA 1B35A 1OXCA 1ULFA 2X5IC 4FFGA 4OFGA 3VZNA 2WYFA 3VDDA 1CWPA 4KI5M 1FOD3 4N7IA 4UAPA 2VW0A 2YGLA 1AX0A 1W2NA 3K75B 4Q2FA 1ZRCA 2VO5A 1IOAA 4HBNA 3HT2A 4KG0A 5FMOL 4NHLA 1N3PA 1IS4A 2RMU1 4LQRA 5E6HA 3V56A 2VBDA 1P8JA 4O65A 1EV11 1UNBA 5BNNB 1EUTA 2VOVA 3OGGA 3H8UA 5IFPA 5IVCA 2ARXA 1WCSA 4FPJA 4J1XA 3U1XA 1WA6X 4M3CA 1RUI1 1WD4A 1WBLA 4LE4A 4YM0A 2PA7A 2XOMA 4XTPA 3WG4A 3K48A 1EUUA 2W95A 4LLFA 4OCTA 3I2IA 5HCFA 4AI3A 1K3IA 1ZREA 5J36A 3I2OA 4OQ9A 1E5SA 2P37A 1GQHA 3LDKA 4K9SA 4XXAA 1S1AA 1PZ8A 4BWOA 4EQVA 5JR7B 3K46A 4XBQA 3AL5A 4Y1XA 1BVP1 1F4HA 1S0JA 1C57A 3OPZA 1WMFA 1RHI1 1W9SA 1J3RA 1GZTA 2QBXA 5CISA 2E32A 4CA9A 4TXWA 2UURA 1UXXX 1GZ9A 1PIV3 2XXZA 3SH4A 4QB1A 5IFTA 5T54A 3M3OA 5KR7A 4IV3C 4RR3C 5F5CA 2YXSA 1S0CA 3ZYJB 4HK8A 3GZUC 4K8RB 5ABJB 3VDBA 2JDHA 1W6OA 1W2TA 1Z78A 3ZN5A 1ZVFA 2QQUA 4XOGA 5T5PA 1NZCA 5JXIA 5IK7A 3O1PA 1QXJA 5LA9A 3W20A 2HLEA 2WNVA 3ZFEB 1BEV3 1H1AA 5FJHA 3WF4A 2SBAA 2BBAA 2WR9A 3HNMA 1VB2A 3HJRA 2R063 5GZFA 1R1A3 3J7HA 4CVUA 1D0HA 1KDMA 2F6BA 4QHBA 2OQ6A 4B8EA 3ME2A 1K45A 4CCCA 1H2KA 3T0BA 3PVNA 4GH4B 4A6OA 4BA6A 2RR11 3HQRA 5E89A 4GB31 4FP2A 2YROA 4LT5A 3AYCA 3B69A 1QHDA 1HB2A 3LEGA 4CU8A 2DTYA 3T2PA 5ERLA 2VZOA 3P5BA 2JE8A 3H7YA 1SCRA 2K0GA 2R0FA 1DQ2A 1IQAA 1WA4A 2WNUB 1LOAA 1BCXA 2FBEA 1FI2A 3VBRC 1XU1A 4Y5TA 2QVSB 2XBO1 3ZSJA 5DUUA 3KCXA 2WT1A 3KHBA 4HPKB 3I59B 4NPLA 3ABZA 2OIIA 4HN0A 5IAXA 1W99A 3VBOC 1SLCA 3F2ZA 1XYOA 2WT2A 1HN1A 4XJ8A 1KDKA 2JDKA 4W8JA 3GZTB 3KHCA 1UX6A 3JD71 4H7MA 5FZMA 2XLAA 2R043 2QQIA 3WG3A 3S0MA 3PDQA 4P9XA 3THDA 1K12A 1WLWA 5LY1A 4NMIA 2FDIA 3RZLA 1C4RA 2HWF3 3N9NA 5CFCC 2QQVA 4QPGC 3ROUA 4RQPA 2C4XA 2VZUA 1C8M1 3NV4A 3AMPA 2QQPA 4OUMA 1GP6A 2HWB1 1ND3C 1EY2A 1YUDA 3VZKA 1MVEA 3WQ1A 1LOGA 5FUIA 2KM2A 1TME2 1LHVA 1O4ZA 3K2OA 1JS9A 3RYKA 3NNFA 1N1VA 2UYAA 1D0GA 2XWJB 4GALA 1J1TA 1QQP1 3HBKA 4IEQA 2GP5A 4RD7A 4AQSA 4AI2A 1O4YA 1G86A 4IGPA 2BNOA 2HEWF 1QXRA 2OZ6A 1JU3A 1NKGA 1RUC1 4LO4B 4QM9A 4R9CA 4XYXA 3AFGA 5EFUA 3IM0A 4Q4X3 4DFSA 4ET7A 5L36A 1JYVA 3WQ7A 4TLFA 3LE0A 4JDNA 2G4IA 2PHRA 5DZEA 4Q4V3 4OI4A 4CU9A 3ZSKA 1RUH2 2ZGMA 5FZCA 5C4WB 2A6XA 4Q1PA 4I02A 4FSJA 1UYXA 3ZYPA 2WWSA 3TB0A 4EYUA 1RITA 4JV4A 4LBQD 1O3RA 4K8FA 1V6JA 2IC1A 1QJU1 2BNMA 3NV3A 3ZVXA 1EAH3 3BGAA 1LKNA 4R4ZA 4XMIA 2NMOA 3SITA 1HX6A 2B4KA 4G3YC 1XE8A 1OLQA 4BQ2A 1HV0A 1XSRA 3O12A 3POBA 3QACA 3BALA 3T08A 1X50A 4I0WB 5DAXA 2PXJA 4JDOA 4LK7A 4F8AA 1W9WA 4LPLA 4DUXA 1FOD2 4PDWB 4DEVA 1Q56A 1I3HA 1W8HA 5FPXA 3POFA 4WM7C 3FMGA 2ZJCA 2ZGLA 3VBUA 2RS13 4FQZA 2X5IB 1AXKA 2YPJA 3GM8A 4JGZC 4P9JA 1ZRIA 3RJRA 4DEQA 4OHYA 2HWC1 5FP7A 3HVDA 3S7IA 3O0VA 1LGNA 4Z07A 4QGNA 1VBC1 1L3JA 3VKMA 3THCA 2AACA 4CDUC 3AYEA 4HONA 2P6HA 3PU3A 3BB6A 1HQWA 5GALA 3SKVA 3UGHA 5A33A 5C33A 1JOPA 1GICA 4N9IA 4QMAA 4A42A 1B35C 1BMV1 2QQMA 1DGRA 2Q8EA 2DTWA 1RMU1 1Q43A 4QB6A 3H7JA 1MEC3 2LUWA 2YMZA 4W4ZA 3VDDC 3OUHA 3ZXEA 3KGZA 3SEPA 1JYNA 1ZZBA 1E5RA 4YARA 3T30A 2KXLA 2BOJA 1FMD1 2WQ8A 5IVEA 4BQ3A 2FMYA 2VG9A 1CPMA 2EA7A 4LIUA 1VBD3 2VNGA 2ZX4A 4TSVA 3BTZA 3RMYA 1R1ZA 1GV9A 2CL2A 3WUCA 4QXHA 1FYUA 4NVPA 5KXCA 1PIV2 3MUZ1 4UI9L 2ZTNA 2AYHA 1XNDA 1O5LA 2VMHA 1U12A 1GWLA 3GCXA 4QPYA 3PNAA 2YBSA 3UGGA 4NE9A 3MLJA 2GNTA 5IWFA 1PO13 1GYKA 1OKOA 3IMNA 2Y6FA 3M3EA 1SDWA 5LWBA 3I3BA 2R1BA 3AMQA 2EXHA 4EE2A 1G6NA 4JGYA 4XDOA 1I9RA 2XHKA 4RGAA 4EV0A 3A21A 1EP0A 4IV3B 4RR3B 1PX3A 3IBMA 5GLWA 5F32A 5FXZA 1BEV2 1H4GA 1GNHA 4XHXA 3TWIA 4OUSA 2R062 1R1A2 3NNGA 2NN8A 3PTRB 1FT9A 1O5UA 1W2OA 2ZPXA 1TE1B 5D21A 3SC7X 1ULOA 3EYPA 2NQYA 3JUUA 4A3ZA 2ET1A 5CKQA 1YC61 3QCWA 1C5IA 4CCJA 5HCAA 1DZTA 1HRI2 1WLDA 2BDRA 4LUKA 1MVQA 4BLIA 1AR73 1IHMA 2KA3A 3OTFA 2HYXA 1CESA 1AYM3 3RFRA 4DOUA 5L9VA 5A7QA 4DNYA 3NJZA 3RZGA 2CAUA 2ZBJA 4HFSA 3RS6A 3LDRA 5AVPA 3C8XA 3VBHA 2MNGA 2WNVC 4AEJA 2DUPA 3VL8A 2OPWA 3WDUA 1KJLA 4NHYA 4CP9B 2I74A 3VN4A 4COUA 2EXJA 2A6YA 2J1TA 2PAEA 3K4DA 4NWVA 4C1WA 4COZA 3W21A 1AVBA 4QXCA 2QZ3A 2WZ8A 3FBMA 1C1FA 3HT1A 3VBRB 4B7EA 2DVBA 4LOTA 2C5DA 3WX5A 1DZQA 2R042 3NRUA 3J8F3 1G9DA 2RJKA 4LBMA 2VMFA 3VBOB 4QX0A 5FKBA 2HWF2 4XCBA 1XE0A 5C8CA 2A3WA 3GHMA 5T5OA 3M2MA 3UT0A 5ABJA 2W08A 1GBGA 3ZXAC 4IE5A 4P08A 5FY7A 1GQGA 2ARBA 4DB5A 4JX0A 5CFCB 2QCSB 1MZFA 5T3NA 4QPGB 4HMZA 4ZXEA 1Y43B 4MYEA 1KD7A 4ATFA 4IETA 1HJGA 1SLBA 1ND3B 4Z2WA 3LA3A 3WF1A 3HQUA 1COV3 2RM21 1SFPA 1X9PA 1U5YA 3UKNA 1JOBA 4L0PA 5F7UA 3LKJA 1G7YA 2FZ1A 3KT7A 3MI8A 4MGIE 4GH4A 1AR61 1FV2A 1G9FA 1YQ8A 3GXUA 2UYBA 4Q4V2 1XU2A 1YFWA 2PHWA 4RQPC 2BPA2 2WABA 4CP2A 5C3PA 1AJOA 3J7NA 1UWWA 1RUD1 4XQ4A 5FAXA 1ZBE1 4BQ4A 1NY71 3C3VA 1YFXA 4RGKA 4H55A 4I01A 3OCPA 1YJLA 1STMA 1T6BX 1EAH2 4DIQA 1VRBA 1H8TA 2PQQA 2ETEA 1NG0A 4GQ7A 5GZCA 1PK6A 1CIYA 4FOWA 2YC0A 3IDBB 4IUGA 4M0NA 1QNWA 2ZGNA 2N7GA 2ZGSA 3NWKA 4JHZA 3SCFA 4PLOA 2PHLA 4YM1A 2X29A 2GMEA 2W92A 4COYA 2X05A 1T2XA 2IXJA 1US3A 1VBA3 1CD3G 1DGLA 1W05A 5BXXA 2D3SA 1GP5A 5FP8A 1XOYA 2ADEA 4LITA 4WZCA 3J7MA 2Z42A 4QQHA 4BQXA 1U5XA 2WDBA 2VY0A 2VD7A 4F3JA 3LFIA 1BZWA 1OSGA 1NLSA 1PMIA 3OEAA 4JRLA 5JOYA 5JWPA 4C1XA 1WUVA 3OPTA 1POQA 2VQ0A 2ZCWA 2BYVE 4JGZB 4R9AA 3OBRA 4L11A 3LA2A 2B8MA 3ZX7A 2IXIA 4WM8B 3IAQA 5FYMA 2DU1A 4YNIA 5G04L 5FY0A 5A3WA 1R093 4D7SA 2QDNA 1DQ5A 2PQSA 1MEC2 4S2HA 4CDUB 3SKJE 5A1AA 5JI7A 1R64A 2W2IA 4QKBA 1E5IA 4NHXA 2FD8A 3E5QA 1F2NA 2Q1ZB 1VBE3 1POV1 2OXBA 3D8CA 4QU2A 1B35B 3V0AA 3O1VA 2Z5WA 3VBUC 5H9QA 5JPNB 2IUWA 3VDDB 4AW7A 5IK8A 1VBD2 1YYNA 4XFFA 1IGOA 4XUTA 4UOJA 5I0UA 5JVVA 1WCKA 4B4QA 5JZGA 3D5OA 4I0BA 4YZ3A 3VDCA 1CIWA 1OF4A 2D93A 5GZEA 5JDBA 3CQOA 2DVDA 3NL1A 3OGRA 4PJYA 1GWMA 3WNMA 1LEMA 5LY2A 2BOIA 4DRRA 4AGVA 5C3RA 1PO12 4LKSA 4XUNA 2A71A 5A7WA 2VE1A 5JCTA 4E4ZA 4M3CB 4QDQA 3ETPA 1S0BA 3T1LA 2HWE1 2QDRA 1W6PA 3BIWE 1QJY3 4IW3A 1QJZA 2P3KA 2NLRA 4PI0A 4O9EA 4PDWA 1QJX3 5F3CA 2FHRA 2WSVA 2IXCA 4AGRA 1RJ8A 4K3UA 3WUDA 2K46A 4Y1YA 1QDOA 5TSWA 3ZXJA 1UOFA 4FPKA 5DG2A 1D2SA 1RC6A 2VCAA 1JYXA 2FCUA 4HT1T 5A7PA 4QKFA 5A3NA 3VD9A 1W6MA 4QPIB 2PAKA 3OSDA 5JXHA 1UKRA 1SBDA 1ZBA3 3AZWA 1NE6A 4JTOA 3ALQA 3B01A 5GZDA 3T3YA 4JGYC 5EHDA 1RL3A 1OOPA 1TEIA 4L8QA 4B1LA 5C6CA 4EN0A 3WW3A 5DAPA 4CP0A 5D1IA 2C9KA 3WZ1A 4C91A 2P4EA 1PGL1 1FAYA 1W6OB 3JBG3 5A3LA 1ULPA 4YGEA 1AR83 1ENXA 5DPNA 3UESA 2Z69A 2LALA 1VRH2 3WDWA 2DCZA 4PLNA 2WNVB 4YW3A 2D44A 2E63A 1ND2A 1UZ0A 3POGA 4LO5B 4AFAA 3OG2A 5GM0A 4PBPA 1OC1A 3J8F2 1ZX5A 5DDJ3 3IAPA 4ASMB 3PUIA 4IERA 3MF9A 1N1SA 2H0VA 2VH9A 2X09A 4D7TA 2MEV1 3MV01 5LK5A 3B5LB 3WF3A 3O1UA 4DINB 4XFAA 2RDSA 2VZVA 4AVSA 3VBHC 1HQNA 3BN6A 5CAZA 5IYYA 3BTXA 2VNOA 3BOPA 4OQ8A 2W9XA 5J37A 1K5MA 2VCCA 4P9YA 3LF7A 4Y22B 4CUAA 1WCDJ 3ZKYA 4D0QA 3TEWA 2FQPA 1QNYA 2ZOEB 4MGKE 4V1PA 4LJHA 1SMVA 5DUWA 3VD5A 3OUIA 1H2LA 1PVC1 3S5AA 4LE3A 1QWRA 2GC3A 5FDBA 2PAMA 3SCGA 3EJKA 2XR4A 3H3UA 4KBBA 3SEEA 5C8CC 5ABJC 5CU1A 3RNSA 1N3OA 5FXWA 5EYYA 4DY5A 3S57A 3LQCA 3OD4A 5FZ6A 5JSOA 4LK6A 4MGQA 3KCCA 5B4NA 2GH2A 4XE9A 3KSCA 2BU9A 4RQPB 4XJAA 2XJSA 1FOD1 2WL1A 3FLPA 4CP9A 5LBCA 2VUJA 3GHNA 3B3QE 2RG4A 4GMP0 4N8MA 2XJVA 4LTAA 5LA0A 2ZGQA 4XILA 4GH4C 3BODA 5FO9B 3POSA 3QH7A 1ZZ6A 4XFHA 1FV3A 2XGXA 2ZEYA 5F5IA 1VBA2 3VBFA 4BPZA 4FQ4A 4RHV3 1H6YA 2OPKA 1WMXA 1XJAA 2PYTA 3PL0A 5DAWA 1Q8QA 2E33A 1UX7A 1A34A 2LRPA 1I6XA 4Y5SA 3JB8A 3VLBB 3TN93 3LSEA 2BRTA 3NJVA 1QGLA 3IT8A 1H8TC 5C5UA 2YBPA 5LATA 1F15A 2GC2A 1PK6C 2BGPA 5JXJA 4KU7A 4CU7A 4LKEA 3OGJA 4PF5A 3SCHA 3U14A 4E4SA 2YU1A 3ZXFA 1HW5A 1R092 4GJZA 1UU5A 2ZX0A 3LZZA 1YEWA 4PIYA 1JZ4A 4KBZA 2ZGKA 2BEOA 4Q0QA 4BB3A 1A8MA 1Y7BA 3AKPA 4XF9A 5FMBA 2D6NA 2KR2A 4XMAA 1DU3D 3PVOA 1H0BA 1EYBA 3ACLA 2WNOA 3IB3A 3N35A 3ZYHA 5FLJA 1QF3A 4BOWA 4CCLA 3ZOIA 2Q8OA 4DQAA 4XABA 3L9JT 4J6GA 1V9U3 3VBUB 1FX5A 2VMIA 2ATFA 3ACIA 3K77A 4BM8A 2VBBA 2ZS6B 3BPZA 4JZRA 4CE8A 5JOWA 2YV8A 4LLOA 4XFGA 5F8PA 3JQWA 2CWMA 3SH3A 1ODNA 1I5PA 1US2A 3RYRA 1BEV1 3TAYA 3TRSB 1TNRA 3PVBB 1OD3A 1Z7S3 2JD4A 4ISRA 1N1YA 1WWYA 1R1A1 4NR1A 1QJY2 1F5JA 3MW2A 3VZLA 5A33B 3I2KA 1D4M2 3H8RA 4QQ2A 4HSLA 3M3QA 1V6IA 4AG4A 1MZEA 1D4VB 4Y4YA 1BLZA 2Y6HA 4Q27A 1TQ5A 2W68A 5JUVA 2D5HA 3WG1A 4K21A 2E7AA 5JZGC 4XQDA 5H9RA 1HQLA 2OUHA 1AYN1 2Y8KA 4HETA 4F83A 5KXBA 2VCMA 2XJQA 1UD1A 3OD0A 3ETQA 5T50A 1RUH3 4CDWA 5CFDC 1ZBA2 4KL1A 4UBGA 5IATA 1SBEA 1XRUA 3KV5A 4MUVA 4AOCA 1PO21 1XB9A 3AK0A 4WM8A 1DFQA 1ONAA 5FYHA 4BISA 3AMNA 3P6BA 4IE6A 1JZ5A 1U5IA 4A41A 1G8WA 2VZPA 3PVEA 2RS33 2D40A 4PDWC 4XAEA 4W65A 1YI7A 3QBQA 3JBG2 4KWUA 1LOBA 2YG0A 3EXUA 2AGSA 5FP9A 4JGYB 3E97A 5A32A 1BBT3 5HI0A 1AR82 1O8SA 2VOTA 2GSYA 3VD3A 3WNPA 5FP3A 1MS8A 3A22A 1TMF2 5FUNA 3DGTA 5JMCA 4PF1A 4NHMA 1VAVA 3ACFA 3BPSA 4Q8LA 2Q8DA 4AQTA 2ZHMA 2W39A 5BNOA 2B45X 4ASKA 2QTWB 3HR9A 5DDJ2 4LKDA 5BUVA 2F17A 4QGLA 1VIWB 5LK7B 2J1SA 1UU4A 5EP9A 3WP6A 4KG8A 2W5FA 3AZVA 3KCYA 4QX7A 1G9BA 1AHSA 1OOPC 2VECA 2VCBA 3R4DB 1CAVB 1NCRA 2EXIA 1HB3A 4IXLA 4FFIA 2HYKA 4QKDA 2YFUA 5F5AA 3W9AA 3SHRA 3AP5A 2TBVA 2OYZA 4NRQA 1PGW1 4Q8KA 4EROA 1SQ4A 2JWPA 2CSGA 3H1YA 5LEKA 4JHTA 2XQXA 1OHFA 1V70A 4Q4X1 4BXSV 4K1YA 2CY6A 4YPJA 3VBHB 4BCUA 5DXDA 4DMIA 1JUIA 4LHLA 3ON7A 1OT5A 1NE4A 4Q4V1 4M4PA 4MVTA 4LBKA 2UWCA 1ND2C 3Q9OA 2VZ3A 4QT6A 2JDAA 1CZTA 3TNPB 2W87A 1E5HA 3AXDA 1OKQA 2DF7A 3U0ZA 1JMUB 1WLCA 4GWIA 1H2MA 1ZRDA 4QPIA 4CUBA 3VZOA 2XL9A 3U75A 3M8LA 1EAH1 1MQTA 2NYYA 2GNDA 3Q8AA 4A7ZA 5FBJA 1W8FA 2I07B 1S2EA 2ZXQA 1UMIA 2YGMA 2JG8A 3WSOA 4CCEA 1K5MC 1RXGA 4OHWA 4AI1A 4DZGA 1GNYA 2RS52 5C8CB 2Y26A 5JSRA 4JAAA 5DZGA 4IEYA 2E51A 3O0WA 3ZN6B 3CJXA 3WD5A 4IESA 5EXOA 5C5TA 3J4UH 5D2AA 2VJXA 3N36A 4IV1A 2GNBA 1L7QA 2VOXA 1MS4A 1DG6A 2VXRA 2RS11 3IDEA 3K4AA 4PCRA 1CAWA 1UZVA 4ARXA 2Q1FA 3ZXGA 1W28A 3KLSA 2E9QA 4A44A 3THPA 4ARYA 4LO6B 4GMP3 5EQUA 3WOGA 5I0RA 4HLTA 4RHV2 2GALA 4Y5Z0 1UO9A 4URTA 1HB1A 2A6VA 2BNNA 1X36A 1X8MA 2JIJA 2VZTA 3F95A 2EIEA 3HN3A 3WQBA 4E2QA 3HPNA 3MBWA 3TYJA 1HRI3 4INDA 2Y0OA 3TN92 1GU3A 1YIFA 4C90A 5FYBA 4AI8A 1MEC1 4CDQA 1OQDA 4NUBA 5KC6A 5CYYA 1LTEA 1YQ5A 4NIDA 2VQTA 2YC4A 4Y22A 1OPMA 2E53A 2PTMA 5L9BA 2RDRA 4UW6A 4BDVB 3NV1A 1EPWA 5F1RA 1L7RA 1SBFA 1H8TB 1WZXA 3ORJA 5C3OA 1DQ1A 1VBD1 1LEDA 4TTGA 4HVQA 4ES8A 1PK6B 3QD6A 1VALA 4LULA 4QX5A 1JYCA 1M4WA 4Y4RA 3VBFC 3IPVA 4NRPA 1HN0A 4P00B 5FK7A 4BMBA 2FCTA 2A70A 3S5QA 2BJSA 5FPAA 1KS5A 3WHUA 2DWRA 4SBVA 1HDKA 3UJOA 4XW3A 1XBFA 1AR93 2IXHA 4FTBA 2QKDA 2VVFA 2J42A 3U4SA 3GBFA 1V9U2 2W46A 1AXZA 1R083 4HKLA 1RVF3 4L99A 2P1BA 5E1RA 3B9CA 3MIEA 4QXKA 4EZHA 1GQPA 4YFWA 1DLLA 1JBCA 2RHPA 2VXJA 3RGBA 4ZZ8A 2VU9A 2FCVA
chains in the Genus database with same CATH topology
4E8DA 5B4XA 2J1TA 3K4DA 3LEIA 2WZ8A 3HNYM 3T2OA 4MGSA 3NRUA 3DYOA 4KMQA 5EJ1B 1CZVA 2VMFA 1KGYA 4QX0A 5I0DA 2J1UA 1W8OA 2KD7A 1XNAA 2W1SA 3I97A 4P08A 4JX0A 5JR2A 2QQNA 3I3EA 4BK5A 2WAOA 2WN3A 3E1F1 4ZXEA 1NX9A 3WF1A 3GGLA 4L0PA 5C7GA 1CZSA 5F7UA 1BHGA 3C7HA 4RYDA 3GXUA 4OYUA 4PQQA 4MO3M 3T0DA 2WABA 2JKXA 1UWWA 2VM9A 2EIBA 2WN2A 3OGSA 3CDZB 3CZUA 1UMHA 1JZ3A 2VMDA 2VZSA 2W3JA 1JYWA 3UETA 2QQLA 3D3AA 2RJ2A 3OGVA 2ORZA 1CIYA 4IUGA 2CDOA 5J1XA 5C70A 4JHZA 2W1UA 3T2QA 4Z2AA 4OMCA 2W92A 3NJXA 2X05A 1T2XA 2LS6A 1US3A 2Y6JA 5C71A 1IQDC 1UY3A 2WZEA 4XUOA 1UXZA 2YC2A 2WDBA 4MADA 1SG3A 3OEAA 3ZM8A 1J83A 3IAQA 3LEKA 2J1EA 5G04L 2W1WA 2PQSA 3ECQA 5A1AA 2J7MA 3SKJE 4DXTA 1R64A 3IIIA 2RV9A 3W5MA 3VDAA 3CZJA 4JKLA 1H6XA 3I2FA 4W50A 3LPGA 4P5YA 4XUTA 3HEIA 4UOJA 3VDCA 1OF4A 1KEXA 3CQOA 3OGRA 1SHWB 1JZ7A 4OMDA 2BZDA 3WNMA 4DUWA 5JMOA 1XNTA 1F4AA 4LKSA 4XUNA 2ZEXA 4A45A 4QDQA 2ZEZA 3ETPA 2WBKA 4DUVA 3MUY1 2CDPA 4A42A 4XUQA 3IDAA 3A7QA 2QQJA 1W9TA 5EJZB 2RVAA 2VCAA 1JYXA 3VD9A 5G05L 5JXHA 4RN5A 3FN9A 4HG6B 4DXRA 2XHNA 1UY0A 1XPWA 5HXMA 1GUIA 5EIYB 1DYOA 2VTFA 2Y64A 2C9KA 3T09A 4DXSA 1ULPA 2VQUA 2J1RA 3I3DA 5DPNA 3UESA 4D8MA 2W94A 1UZ0A 3WF0A 2W1QA 2DCJA 2W47A 1TG7A 3FL7A 3NQHA 3OG2A 4QAWA 4XVHA 3HOBA 3IAPA 2W91A 3PUIA 3OBAA 5IHRA 2X09A 3WF3A 1PX4A 3MV01 4QDRA 2WAAA 2LW8A 5IJRA 5JXGA 1W0NA 2ZEWA 2VZVA 5CZKA 2J22A 3BN6A 5DMYA 5IYYA 2B9VA 5LA2A 2W9XA 4KI5M 2VC9A 3DYPA 2E26A 2Z4FA 2VCCA 4OUEA 4UAPA 4CUAA 4D0QA 2E31A 3K75B 2VO5A 3C7GA 4LQRA 3ACHA 1YQ2A 1P8JA 3VD5A 1EUTA 4JKKA 5IFPA 5HPOA 4GZ9A 3EB7A 1JI6A 3SEEA 2XOMA 4BJ0A 1EUUA 2W95A 3LQCA 3I2IA 4MGQA 1K3IA 5B4NA 2VZRA 1GOHA 4QX1A 3PUHA 4QDSA 3K46A 1F4HA 2WO3A 1W9SA 2QBXA 1OF3A 5LA0A 2E32A 4TXWA 3MO4A 2WUHA 4MOAA 1UXXX 2ZEYA 4QB1A 5IFTA 1H6YA 3WF2A 2J1VA 2E33A 1UX7A 1UYYA 3VDBA 4ZZ5A 2V4VA 2VZQA 3NJVA 3WNLA 1UYZA 5JXIA 2V5DA 2YB7A 2WYSA 2BGPA 2HLEA 3HNBM 4P02B 5JXJA 4CU7A 4ZY9A 3WF4A 1D7PM 2BBAA 3C7EA 3HNMA 3HJRA 2XONA 3J7HA 2JD9A 4CVUA 3WEZA 1UY1A 1JZ4A 1UY2A 2R7EB 1K45A 3T0BA 3VD4A 4AAXA 3WNOA 4A6OA 2X10A 3A23A 3IB3A 4A4AA 2YFZA 3LEGA 4CU8A 3T2PA 2VZOA 2JE8A 3ACIA 3K77A 1GOFA 3K4ZA 1DLCA 1I5PA 1US2A 3ABZA 1OD3A 1UY4A 1W99A 3F2ZA 4XZUG 1HN1A 3I2KA 4W8JA 4AG4A 2QQIA 2VL4A 4PT6A 1JU4A 4BK4A 3THDA 2Y6HA 1K12A 2ID4A 5JUVA 5DQ0A 2QQOA 2Y8KA 2C4XA 2VZUA 1GMMA 3WNNA 3LPFA 2VZ1A 3FHAA 4XUPA 5FUIA 3VD7A 1NUKA 1O59A 3T0AA 3P6BA 1JZ5A 4A41A 2VZPA 4M4RA 1RYYA 1J84A 1JU3A 1NKGA 1PMJX 2C26A 4KWUA 2WO1A 2YG0A 4ET7A 3MV11 1JYVA 3ACGA 4JKMA 3LE0A 1O8PA 1O8SA 2VOTA 3C7OA 2ORXA 3VD3A 3WNPA 4CU9A 3A22A 4PF1A 3CKHA 3WNKA 4E8CA 4CUCA 3ACFA 1UYXA 1SDDB 2J1SA 3CMGA 3BGAA 2W5FA 4OZOA 2B4KA 2VCBA 2DCKA 2BERA 1K42A 2YFUA 3FHQA 3T08A 1JZ2A 1W9WA 4LPLA 4DUXA 4XURA 4DEVA 2XQXA 4BXSV 2QQKA 4YPJA 3OEBA 1OT5A 4M4PA 2VMCA 3GM8A 4FI9A 2VZ3A 2Y6LA 4DEQA 2JDAA 1CZTA 2DDUA 2W87A 4QX2A 3U37A 4GWIA 3THCA 4CUBA 1XC6A 4CU6A 2V72A 3SKVA 3OB8A 2ZXQA 2QQMA 1LNSA 1UMIA 3DECA 4QB6A 3WSOA 4W4ZA 1GNYA 1JYNA 3SEPA 2BGOA 3UNPA 1OH4A 3AC0A 1JZ6A 2Y6KA 2WQ8A 2VJXA 1MPXA 1L7QA 3P1IA 1W8NA 3W5NA 3K4AA 3DYMA 4ARXA 1JZ8A 2Y6GA 2EICA 4A44A 3MUZ1 4ARYA 4UI9L 4QPWA 1DP0A 2L9LA 4QX3A 5LCWL 2VZTA 2EIEA 3HN3A 3WQBA 4GWJA 3HPNA 3I3BA 1NAEA 2WO2A 3MBWA 4LHSA 1GU3A 3A21A 1CX1A 1PMHX 1PX3A 5CYYA 2VQTA 2YC4A 3GDBA 4BDVB 3JXSA 1L7RA 3NNGA 4QB2A 2OKXA 4TTGA 4A3ZA 1ULOA 3EYPA 3I2JA 4P00B 1JHJA 3C7FA 1WKYA 2EIDA 2HYXA 3CIHA 3I2GA 2W46A 2VR4A 3C8XA 3I2HA 5DN2A 5LA1A 2VMEA 2J1AA 1TVGA 1GQPA 1GOGA 4ZZ8A 1WCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E8D A;  5B4X A;  2J1T A;  3K4D A;  3LEI A;  2WZ8 A;  3HNY M;  3T2O A;  4MGS A;  3NRU A;  3DYO A;  4KMQ A;  5EJ1 B;  1CZV A;  2VMF A;  1KGY A;  4QX0 A;  5I0D A;  2J1U A;  1W8O A;  2KD7 A;  1XNA A;  2W1S A;  3I97 A;  4P08 A;  4JX0 A;  5JR2 A;  2QQN A;  3I3E A;  4BK5 A;  2WAO A;  2WN3 A;  3E1F 1;  4ZXE A;  1NX9 A;  3WF1 A;  3GGL A;  4L0P A;  5C7G A;  1CZS A;  5F7U A;  1BHG A;  3C7H A;  4RYD A;  3GXU A;  4OYU A;  4PQQ A;  4MO3 M;  3T0D A;  2WAB A;  2JKX A;  1UWW A;  2VM9 A;  2EIB A;  2WN2 A;  3OGS A;  3CDZ B;  3CZU A;  1UMH A;  1JZ3 A;  2VMD A;  2VZS A;  2W3J A;  1JYW A;  3UET A;  2QQL A;  3D3A A;  2RJ2 A;  3OGV A;  2ORZ A;  1CIY A;  4IUG A;  2CDO A;  5J1X A;  5C70 A;  4JHZ A;  2W1U A;  3T2Q A;  4Z2A A;  4OMC A;  2W92 A;  3NJX A;  2X05 A;  1T2X A;  2LS6 A;  1US3 A;  2Y6J A;  5C71 A;  1IQD C;  1UY3 A;  2WZE A;  4XUO A;  1UXZ A;  2YC2 A;  2WDB A;  4MAD A;  1SG3 A;  3OEA A;  3ZM8 A;  1J83 A;  3IAQ A;  3LEK A;  2J1E A;  5G04 L;  2W1W A;  2PQS A;  3ECQ A;  5A1A A;  2J7M A;  3SKJ E;  4DXT A;  1R64 A;  3III A;  2RV9 A;  3W5M A;  3VDA A;  3CZJ A;  4JKL A;  1H6X A;  3I2F A;  4W50 A;  3LPG A;  4P5Y A;  4XUT A;  3HEI A;  4UOJ A;  3VDC A;  1OF4 A;  1KEX A;  3CQO A;  3OGR A;  1SHW B;  1JZ7 A;  4OMD A;  2BZD A;  3WNM A;  4DUW A;  5JMO A;  1XNT A;  1F4A A;  4LKS A;  4XUN A;  2ZEX A;  4A45 A;  4QDQ A;  2ZEZ A;  3ETP A;  2WBK A;  4DUV A;  3MUY 1;  2CDP A;  4A42 A;  4XUQ A;  3IDA A;  3A7Q A;  2QQJ A;  1W9T A;  5EJZ B;  2RVA A;  2VCA A;  1JYX A;  3VD9 A;  5G05 L;  5JXH A;  4RN5 A;  3FN9 A;  4HG6 B;  4DXR A;  2XHN A;  1UY0 A;  1XPW A;  5HXM A;  1GUI A;  5EIY B;  1DYO A;  2VTF A;  2Y64 A;  2C9K A;  3T09 A;  4DXS A;  1ULP A;  2VQU A;  2J1R A;  3I3D A;  5DPN A;  3UES A;  4D8M A;  2W94 A;  1UZ0 A;  3WF0 A;  2W1Q A;  2DCJ A;  2W47 A;  1TG7 A;  3FL7 A;  3NQH A;  3OG2 A;  4QAW A;  4XVH A;  3HOB A;  3IAP A;  2W91 A;  3PUI A;  3OBA A;  5IHR A;  2X09 A;  3WF3 A;  1PX4 A;  3MV0 1;  4QDR A;  2WAA A;  2LW8 A;  5IJR A;  5JXG A;  1W0N A;  2ZEW A;  2VZV A;  5CZK A;  2J22 A;  3BN6 A;  5DMY A;  5IYY A;  2B9V A;  5LA2 A;  2W9X A;  4KI5 M;  2VC9 A;  3DYP A;  2E26 A;  2Z4F A;  2VCC A;  4OUE A;  4UAP A;  4CUA A;  4D0Q A;  2E31 A;  3K75 B;  2VO5 A;  3C7G A;  4LQR A;  3ACH A;  1YQ2 A;  1P8J A;  3VD5 A;  1EUT A;  4JKK A;  5IFP A;  5HPO A;  4GZ9 A;  3EB7 A;  1JI6 A;  3SEE A;  2XOM A;  4BJ0 A;  1EUU A;  2W95 A;  3LQC A;  3I2I A;  4MGQ A;  1K3I A;  5B4N A;  2VZR A;  1GOH A;  4QX1 A;  3PUH A;  4QDS A;  3K46 A;  1F4H A;  2WO3 A;  1W9S A;  2QBX A;  1OF3 A;  5LA0 A;  2E32 A;  4TXW A;  3MO4 A;  2WUH A;  4MOA A;  1UXX X;  2ZEY A;  4QB1 A;  5IFT A;  1H6Y A;  3WF2 A;  2J1V A;  2E33 A;  1UX7 A;  1UYY A;  3VDB A;  4ZZ5 A;  2V4V A;  2VZQ A;  3NJV A;  3WNL A;  1UYZ A;  5JXI A;  2V5D A;  2YB7 A;  2WYS A;  2BGP A;  2HLE A;  3HNB M;  4P02 B;  5JXJ A;  4CU7 A;  4ZY9 A;  3WF4 A;  1D7P M;  2BBA A;  3C7E A;  3HNM A;  3HJR A;  2XON A;  3J7H A;  2JD9 A;  4CVU A;  3WEZ A;  1UY1 A;  1JZ4 A;  1UY2 A;  2R7E B;  1K45 A;  3T0B A;  3VD4 A;  4AAX A;  3WNO A;  4A6O A;  2X10 A;  3A23 A;  3IB3 A;  4A4A A;  2YFZ A;  3LEG A;  4CU8 A;  3T2P A;  2VZO A;  2JE8 A;  3ACI A;  3K77 A;  1GOF A;  3K4Z A;  1DLC A;  1I5P A;  1US2 A;  3ABZ A;  1OD3 A;  1UY4 A;  1W99 A;  3F2Z A;  4XZU G;  1HN1 A;  3I2K A;  4W8J A;  4AG4 A;  2QQI A;  2VL4 A;  4PT6 A;  1JU4 A;  4BK4 A;  3THD A;  2Y6H A;  1K12 A;  2ID4 A;  5JUV A;  5DQ0 A;  2QQO A;  2Y8K A;  2C4X A;  2VZU A;  1GMM A;  3WNN A;  3LPF A;  2VZ1 A;  3FHA A;  4XUP A;  5FUI A;  3VD7 A;  1NUK A;  1O59 A;  3T0A A;  3P6B A;  1JZ5 A;  4A41 A;  2VZP A;  4M4R A;  1RYY A;  1J84 A;  1JU3 A;  1NKG A;  1PMJ X;  2C26 A;  4KWU A;  2WO1 A;  2YG0 A;  4ET7 A;  3MV1 1;  1JYV A;  3ACG A;  4JKM A;  3LE0 A;  1O8P A;  1O8S A;  2VOT A;  3C7O A;  2ORX A;  3VD3 A;  3WNP A;  4CU9 A;  3A22 A;  4PF1 A;  3CKH A;  3WNK A;  4E8C A;  4CUC A;  3ACF A;  1UYX A;  1SDD B;  2J1S A;  3CMG A;  3BGA A;  2W5F A;  4OZO A;  2B4K A;  2VCB A;  2DCK A;  2BER A;  1K42 A;  2YFU A;  3FHQ A;  3T08 A;  1JZ2 A;  1W9W A;  4LPL A;  4DUX A;  4XUR A;  4DEV A;  2XQX A;  4BXS V;  2QQK A;  4YPJ A;  3OEB A;  1OT5 A;  4M4P A;  2VMC A;  3GM8 A;  4FI9 A;  2VZ3 A;  2Y6L A;  4DEQ A;  2JDA A;  1CZT A;  2DDU A;  2W87 A;  4QX2 A;  3U37 A;  4GWI A;  3THC A;  4CUB A;  1XC6 A;  4CU6 A;  2V72 A;  3SKV A;  3OB8 A;  2ZXQ A;  2QQM A;  1LNS A;  1UMI A;  3DEC A;  4QB6 A;  3WSO A;  4W4Z A;  1GNY A;  1JYN A;  3SEP A;  2BGO A;  3UNP A;  1OH4 A;  3AC0 A;  1JZ6 A;  2Y6K A;  2WQ8 A;  2VJX A;  1MPX A;  1L7Q A;  3P1I A;  1W8N A;  3W5N A;  3K4A A;  3DYM A;  4ARX A;  1JZ8 A;  2Y6G A;  2EIC A;  4A44 A;  3MUZ 1;  4ARY A;  4UI9 L;  4QPW A;  1DP0 A;  2L9L A;  4QX3 A;  5LCW L;  2VZT A;  2EIE A;  3HN3 A;  3WQB A;  4GWJ A;  3HPN A;  3I3B A;  1NAE A;  2WO2 A;  3MBW A;  4LHS A;  1GU3 A;  3A21 A;  1CX1 A;  1PMH X;  1PX3 A;  5CYY A;  2VQT A;  2YC4 A;  3GDB A;  4BDV B;  3JXS A;  1L7R A;  3NNG A;  4QB2 A;  2OKX A;  4TTG A;  4A3Z A;  1ULO A;  3EYP A;  3I2J A;  4P00 B;  1JHJ A;  3C7F A;  1WKY A;  2EID A;  2HYX A;  3CIH A;  3I2G A;  2W46 A;  2VR4 A;  3C8X A;  3I2H A;  5DN2 A;  5LA1 A;  2VME A;  2J1A A;  1TVG A;  1GQP A;  1GOG A;  4ZZ8 A;  1WCQ A; 
#chains in the Genus database with same CATH topology
 4GKY A;  4X6R B;  5T5L A;  4E8D A;  1Z7S 2;  2PLV 3;  2VPV A;  3AKT A;  1YO8 A;  3FUO A;  3ZKU A;  3LEI A;  4Y1Z A;  4MGS A;  2Q30 A;  4LBN A;  2ARA A;  5GLZ A;  3S6P A;  5M0T A;  3O1M A;  5EJ1 B;  1CZV A;  1DYK A;  3HN1 A;  3K3O A;  2VVE A;  3G7D A;  5I0D A;  5CVR A;  1AR7 1;  4K1Z A;  3JB4 C;  1AYM 1;  2JDY A;  3V0A B;  1HXS 1;  4LXL A;  3ZYI B;  5KXE A;  4N43 C;  4NWW A;  4TZD A;  2H6C A;  3I97 A;  2DUR A;  4EWA A;  2RMU 3;  3I49 A;  3RJ2 X;  2QQN A;  4Q5O A;  1REE A;  3ZR6 A;  1EV1 3;  5JAX A;  1W2U A;  2ZHL A;  2WAO A;  3QOP A;  3RYP A;  4BK5 A;  3FUQ A;  3NO8 A;  2ARC A;  3PHM A;  2QJV A;  4HVR A;  4GA9 A;  4D3W A;  1VMF A;  1X33 A;  1VAM A;  2DCT A;  3AJZ A;  5FZ4 A;  2PHF A;  1GZC A;  1RUI 3;  1ZM1 A;  3W58 A;  2G1M A;  3GGL A;  3MLK A;  4LO7 A;  2Q8C A;  5J96 B;  1VBB 2;  5CFD B;  2R30 A;  1ULC A;  2MPF A;  2RS3 2;  4YVS A;  5F5Q A;  4RGG A;  5FR3 A;  5A7W B;  3VKO A;  1UW8 A;  4YM3 A;  1BBT 2;  1BHG A;  3J8F 1;  1W6P B;  4H2A A;  4KWJ A;  4FOQ A;  3UYJ A;  5K8S A;  2XUE A;  4OI0 A;  5FYS A;  2VM9 A;  5J09 A;  1DF0 A;  2WN2 A;  5IVV A;  1B09 A;  3FBY A;  3RVH A;  4FBF A;  4CDX B;  1H1M A;  4AHW A;  2XG3 A;  4CDW C;  1JZ3 A;  4IL7 A;  2VMD A;  4Y3O A;  5F2W A;  2W3J A;  4HVO A;  1JYW A;  3DPR A;  3UET A;  5AC9 3;  1OLM A;  4WM8 C;  4AEM A;  2ORZ A;  1WMD A;  1LHU A;  4RFT 0;  3N7K A;  4XFI A;  2ZKL A;  2R07 1;  2WFF 3;  1NT0 A;  1W6M B;  4QX8 A;  3DKW A;  1Q8O A;  1ZZ7 A;  2HJI A;  1FPN 2;  3JU9 A;  1COV 1;  4GUL A;  4MET A;  3T2Q A;  3VHN A;  2P3I A;  1OOP B;  3BOW A;  3NJX A;  3OPW A;  1SEF A;  2JDZ A;  5FYY A;  3KMH A;  1IPK A;  3FFQ A;  1RB8 G;  1OH3 A;  5C71 A;  4Z82 A;  1F35 A;  1GAN A;  1UXZ A;  4H14 A;  2YC2 A;  5CG8 A;  3U10 A;  2D6O X;  3AP4 A;  5BNO C;  5KBF A;  1FAT A;  3VUO A;  2JIG A;  5DAB A;  2WZR 2;  3N9M A;  4WV8 A;  3P3N A;  2JE9 A;  5KHG A;  4GKX A;  5K9Y A;  2A3Y A;  3OJB A;  1O7F A;  5FZG A;  3ZM8 A;  1ND2 B;  2D97 A;  4CXW A;  1DQ0 A;  1NCR C;  3N9P A;  1J83 A;  3LEK A;  3AP6 A;  5FZO A;  3U4X A;  1RUF 2;  4MXW A;  4E4H A;  3S7E A;  2SLI A;  5K7P A;  3HMY A;  1BYH A;  4GB3 3;  4DXT A;  5E8A A;  3V0B A;  2RV9 A;  3W5M A;  1MR5 A;  1ZRR A;  1GZW A;  1AF9 A;  1K5J A;  1QH7 A;  3CZJ A;  4JKL A;  4YW5 A;  1QMJ A;  1DGR N;  1W0O A;  1VBA 1;  2ENR A;  1K5M B;  3I2F A;  5CB7 A;  3K3N A;  3LPG A;  2FDJ A;  4Q4W 3;  4P5Y A;  3RZJ A;  4YW6 A;  4YVW A;  4WVW A;  4MZU A;  2XBO 3;  5FYU A;  1UIJ A;  4I3P A;  1I5Z A;  3WP3 A;  4QPI C;  5IVB A;  3O1O A;  4CTE A;  3L2H A;  4LBO A;  1MQT C;  1WLT A;  1SHW B;  2WS9 2;  1JZ7 A;  4OMD A;  3TBD A;  3M4F A;  5JMO A;  5SV5 A;  3SLI A;  5EZW A;  4TYS A;  4CSW A;  4AL9 A;  1CAV A;  1LHN A;  2E7Q A;  2JG8 C;  5EV7 A;  2UU8 A;  1OA2 A;  3KF5 A;  4K7J A;  5FPZ A;  4A45 A;  5CA6 A;  4OHX A;  1DBN A;  1YI9 A;  2WLQ A;  2XVK A;  4XJZ A;  2FDF A;  2BTV C;  3O1T A;  4UFK A;  4NRM A;  4FTS A;  1UU6 A;  3UGF A;  2D7F A;  2WNE A;  1HRV 3;  1GKB A;  1RTV A;  1W04 A;  3NAP A;  4UW3 A;  4IV1 C;  5FPL A;  5HXV A;  1VBE 1;  3ZIW A;  1YQC A;  3HBZ A;  4IEX A;  1W90 A;  5FY4 A;  5I8T A;  1PVX A;  2XDV A;  4B4P A;  4BH9 A;  3ZXL A;  3SIS A;  4J1W A;  3JCI A;  2Y60 A;  5FMD A;  3RZH A;  1S0D A;  5ACA 2;  2IVJ A;  2DYC A;  2RVA A;  4RL7 A;  2G19 A;  1VRH 3;  3K51 A;  4FPC A;  3RRD A;  3AX4 A;  3PU8 A;  4KWK A;  5FZH A;  3AL6 A;  1JN2 P;  1H30 A;  3E6B A;  2TNF A;  3OYW B;  4LOR A;  3DXU A;  5CEH A;  1AR9 2;  2WFP A;  3VBF B;  3R05 A;  1S2B A;  4FPH A;  1R08 2;  4Q1R A;  4CDQ C;  1RVF 2;  2VTF A;  3T09 A;  3WHT A;  4DXS A;  1TZO A;  4ONU A;  5FZ3 A;  3VHP A;  1W8T A;  2VW2 A;  2JE7 A;  2VQU A;  2Y0I A;  2J1R A;  3ZN6 A;  1QJX 1;  1W6Q A;  2BVV A;  5E88 A;  2EXK A;  4YW1 A;  2NP0 A;  2PLV 2;  1QJU 3;  3SNM A;  3J26 N;  4XIK A;  1RUE 1;  3WR0 A;  3CL1 A;  3HD8 B;  2DCJ A;  2W47 A;  3KS7 A;  4HSJ A;  4IDZ A;  4PHZ A;  4UF0 A;  3GCW A;  3V65 A;  2FDK A;  5FQ0 A;  1DQ4 A;  3WDT A;  1V6K A;  3WLU A;  4FPL A;  3B02 A;  5C3Q A;  2TEP A;  1CR7 A;  5IHR A;  4XBN A;  2AH2 A;  2C0Z A;  2XKP A;  5JIU A;  1ZBA 1;  2WAA A;  2A7A A;  1OA3 A;  5IJR A;  3U78 A;  5HBA A;  4OHV A;  5JXG A;  1VB4 A;  4UW4 A;  1NXM A;  4YYO A;  4ZON A;  2J22 A;  1JHN A;  3NST A;  3VV1 A;  3WW4 A;  4QHZ A;  2RMU 2;  2B9V A;  3DCQ A;  5LA2 A;  1ENR A;  4E27 A;  1EV1 2;  3H8X A;  2HWC 3;  4OUE A;  2OQ7 A;  3JBG 1;  2GC0 A;  2P34 A;  2XLF A;  5FYZ A;  5J48 A;  4QQO A;  2E31 A;  1LB2 A;  4N43 B;  2ZX3 A;  1RUI 2;  4I09 A;  2IVI B;  3IKW A;  4FTE A;  1A78 A;  1YQ2 A;  4AHZ A;  1QOS A;  4JKK A;  3UJQ A;  2D43 A;  4IEW A;  3OY8 A;  4RS5 A;  4UXA A;  4YZ5 A;  4Q0U A;  1F9K A;  1W8Z A;  5BNP A;  3HIF A;  2WO7 A;  5DDJ 1;  3BU0 A;  5FIX A;  2YY1 A;  2DVG A;  2YDE A;  3B7M A;  3DKQ A;  4XEZ A;  2GMM A;  5GKA C;  5GLV A;  1W3X A;  3CLP A;  5EPA A;  2VZR A;  5FYC A;  1ZZ8 A;  1PZ7 A;  3OF1 A;  1GOH A;  5AC9 2;  1RUO A;  4KH9 A;  4NAO A;  1YRZ A;  4QDS A;  1YXW A;  4WVM A;  2WFF 2;  4JQT A;  1CN1 A;  4CDW B;  5DAQ A;  2WO3 A;  4YVS C;  2JB8 A;  4XF1 A;  5EWS A;  3ASI A;  1JYT A;  2AR6 A;  3M70 A;  4ZU4 A;  4XCA A;  1W9F A;  1HV1 A;  5T55 A;  1DCS A;  5SV8 A;  1YHF A;  4AED A;  1AX1 A;  4LKF A;  2OT7 A;  4MSV A;  4IGO A;  3RZM A;  1C28 A;  2RDN A;  1UYY A;  3ZFF A;  5HCH A;  5A32 B;  2V4V A;  1LCL A;  4R4X A;  4YW4 A;  5IAV A;  4CCN A;  2O1Q A;  5AFE A;  3DPR C;  3HQX A;  5FRE A;  1L7L A;  2ZAB A;  4Q4Y 3;  1VE0 A;  1BQP A;  1Y3T A;  2V5D A;  2YB7 A;  4P02 B;  3HNB M;  4UBH A;  3RWK X;  1MS3 A;  4ZY9 A;  3R6S A;  4FPO B;  5BNO B;  3FLT A;  1O3S A;  1GFF 2;  1Y9G A;  2OA2 A;  2VTX A;  3ZMN A;  4AF9 A;  3EO6 A;  2JD9 A;  5A1L A;  3WEZ A;  4GB3 2;  5FZK A;  3RQ0 A;  4KQ7 A;  5CFD A;  1UY2 A;  4U36 A;  4JCK A;  3PUA A;  1NCR B;  4QKN A;  1ZZ9 A;  1KFX L;  4AAX A;  4ZKT B;  3RZK A;  1W9Y A;  2GAU A;  2OX0 A;  5FWJ A;  2X10 A;  1YWK A;  3RWN A;  1D4M 3;  5FJK A;  4D6R A;  4Q4W 2;  4XC9 A;  1QH6 A;  1LGC A;  1PM4 A;  5BNQ A;  2YFZ A;  2XBO 2;  3IDC B;  1QOT A;  1UOJ A;  4CDX A;  2DVA A;  1C5H A;  4G9S B;  1OQ1 A;  1LOC A;  3TN9 1;  3ATG A;  4IE7 A;  2PHU A;  3K4Z A;  2ZX2 A;  2ZHN A;  2RDQ A;  4LEJ A;  2D3R A;  1DLC A;  1AX2 A;  3MIG A;  3O0X A;  2Y33 A;  1T6G C;  3VKN A;  4QXB A;  2XH6 A;  1UY4 A;  4R9B A;  1S0F A;  1MQT B;  4WVZ A;  5LAS A;  3DL3 A;  4XZU G;  4YG0 A;  3UK9 A;  1IG3 A;  5J3U A;  1YQ6 A;  1ULG A;  2ZZJ A;  3VHR A;  2WWU A;  1HRV 2;  2VL4 A;  4PT6 A;  5L73 A;  4BK4 A;  2JG8 B;  2XB6 C;  4NAM A;  2DFC A;  3MLL A;  2WC2 A;  1LUL A;  3NVC A;  4YVW C;  4YFZ A;  1ODM A;  2QQO A;  1QDC A;  3GBG A;  4XJU A;  4HAN A;  2JG9 B;  4IEP A;  3WNN A;  4MX3 A;  5FFO C;  1EPZ A;  1X9T A;  1JXN A;  4IV1 B;  1V9U 1;  2AC1 A;  2Q0A A;  4PIX A;  1TMF 3;  4AFB A;  5CKN A;  3FHA A;  3NNL A;  3MFA A;  4XJ9 A;  3VD7 A;  1CAW B;  4UWD A;  2RM2 3;  1RUC 2;  2ZZQ A;  4LA2 A;  1V6M A;  1UCX A;  5T5J A;  3BIE A;  5FZD A;  3V64 A;  3H9A A;  1LRH A;  3MF6 A;  3A0K A;  1AR6 3;  3BUC A;  2IFW A;  2ZKN A;  2AEN A;  1WME A;  3PLQ A;  5FPB A;  3KQ4 B;  1S4C A;  1TME 1;  3NAP C;  1J84 A;  4GD4 A;  3UL2 A;  2C26 A;  4FO9 A;  2WO1 A;  3MV1 1;  3ACG A;  1ENS A;  3JZV A;  5I93 A;  3UV9 A;  1O8P A;  2JEC A;  2VGD A;  3C7O A;  2ORX A;  4FPY A;  2ZX1 A;  4GWN A;  1QJU 2;  2D6K A;  3I7D A;  1C3H A;  3R4S A;  4CDQ B;  1CJD A;  4LMF A;  3WG2 A;  3CU7 A;  4CUC A;  4I2O A;  2FDH A;  4MLO A;  2O8O A;  3WNX A;  2B42 B;  2QFE A;  1LES A;  4DPN A;  1UPI A;  4ZXK A;  2GH8 A;  4FXK B;  1RUH 1;  4X8N A;  5J7M A;  4AFC A;  4OZO A;  3SQO A;  5JLV A;  3IPV B;  2ERF A;  3LGR A;  1OVP A;  3CBN A;  3CJI A;  1Q5O A;  1ZA4 A;  1K42 A;  3FHQ A;  2O0O A;  4D6Q A;  1JZ2 A;  1O3T A;  1WW5 A;  4BLJ A;  1NYW A;  1HLC A;  5L7O A;  2RS3 1;  2ZA9 A;  2HWC 2;  3N4M A;  1WW6 A;  4TN7 A;  4XUR A;  5HCB A;  2HBU A;  4ASL A;  3FFZ A;  2JDM A;  1VBC 2;  2QQK A;  4G4F A;  5KWR A;  3OEB A;  2BBV A;  3LFM A;  2RS5 3;  1FNZ A;  5FPV A;  4ATE A;  4FI9 A;  2Y6L A;  3ZYG A;  2WT0 A;  1ALY A;  1F5F A;  3BKZ A;  1CX4 A;  1E57 A;  3QLQ A;  4A3X A;  4UFL A;  5FY5 A;  1BMV 2;  2A5Z A;  2YUE A;  4RSU A;  4CZS A;  4N90 A;  3POJ A;  4XET A;  1LHO A;  1N3Q A;  2VNV A;  3KM5 A;  1AL2 3;  2I45 A;  1F8V A;  1G9A A;  4CU6 A;  5CAD A;  3OYW A;  3CF6 E;  4A7Y A;  1A8D A;  1FMD 2;  4LOS A;  5A3U A;  1LNS A;  3KGL A;  3SMH A;  5FLI A;  3O7O A;  3AZX A;  1OVS A;  5FOB B;  4PI2 A;  4LBQ A;  1O3Q A;  3PJQ A;  3LAG A;  3Q8F A;  5F37 A;  5LRS A;  2BWA A;  1PZ9 A;  2BGO A;  1J1L A;  2BQP A;  2P17 A;  5FZ1 A;  4AR2 A;  2Y6K A;  3NV2 A;  1XSQ A;  1QY4 A;  1MPX A;  5IVF A;  1QKQ A;  3P1I A;  2VAU A;  1W8N A;  2OW4 A;  3W5N A;  3ZN4 A;  4RS5 C;  1UN1 A;  1JZ8 A;  2D6P A;  2Y6G A;  4MG2 A;  2EIC A;  5BNP C;  1UZZ A;  2BFU S;  2C24 A;  5I0S A;  2IFR A;  4CCO A;  3UKV A;  3PUS A;  2HWE 3;  4QPW A;  1VLN A;  3RDI A;  3POY A;  3WP5 A;  3ZPO A;  4YVS B;  1DP0 A;  2L9L A;  4QX3 A;  5LCW L;  3TEY A;  1OBN A;  3TEZ A;  2QUO A;  1ZRF A;  2WII B;  1XYP A;  1PIV 1;  1AUY A;  3U11 A;  4MXV A;  4S2F A;  2NMN A;  1J3Q A;  1PMH X;  1AL0 G;  4Q4Y 2;  5IUQ A;  3ZYB A;  1V0A A;  2CWS A;  1GSL A;  1RUJ 3;  2B39 A;  3H50 A;  4E2S A;  5FV3 A;  3L2Y A;  4N43 A;  3JXS A;  1NCQ A;  3DPR B;  2CV6 A;  5GLU A;  2Z2S B;  2OKX A;  5F3I A;  1W8W A;  2WSU A;  4MGY E;  1ENQ A;  2GC1 A;  4A2U A;  4HZF A;  3U07 A;  4QQP A;  4AED C;  5CG9 A;  3I2J A;  4Q26 A;  4V2V A;  2R06 1;  3C7F A;  3ITQ A;  2JDP A;  3D0J A;  5C9A A;  3ZFF C;  2EID A;  3AVS A;  4MGZ E;  2BGC A;  1JYI A;  2PHD A;  1HRI 1;  2VUL A;  3LWC A;  5FY9 A;  2VR4 A;  4BQY A;  3AP9 A;  1W06 A;  4D6S A;  1RUN A;  3I2H A;  5LA1 A;  2VME A;  2WIN B;  1TVG A;  4B29 A;  1DZR A;  2F4P A;  3MIB A;  5FZ8 A;  2AZ5 A;  1UF2 C;  2GDF A;  4AK3 A;  2Y38 A;  5EJ3 A;  3MW4 A;  2BP6 A;  4FOY A;  1X82 A;  2MEV 3;  3HNY M;  3T2O A;  3AP7 A;  5FZO B;  4LHN A;  4MXW B;  3LOB A;  3B9I A;  2B5H A;  5FXX A;  3DYO A;  2P3J A;  1RXF A;  1VBB 3;  3WY6 A;  1KGY A;  1NXD 1;  3AMM A;  3ZMO A;  1CON A;  1OUR A;  4P5H A;  5FWE A;  3V0B B;  1GZW B;  3OUJ A;  1W8O A;  1DQ6 A;  4CDX C;  2WRA A;  3KB5 A;  3MIF A;  1AR9 1;  4R9D A;  2R04 1;  3T2T A;  5FLH A;  3FLR A;  4N9H A;  3VKF C;  1O6U A;  3TOJ A;  1R08 1;  3J9S A;  4AI0 A;  1RVF 1;  3KVB A;  4CUG A;  5JR2 A;  4YVW B;  2HWF 1;  5C8W A;  3I3E A;  1UIK A;  1OFN A;  2RM2 2;  4YG3 A;  1PVC 3;  5F3G A;  4UYB A;  4QM8 A;  1NX9 A;  1WGP A;  2O14 A;  4IEU A;  2BW8 A;  3USU A;  4EN9 B;  1AR6 2;  4Y20 A;  1XE7 A;  5DAV A;  2PLV 1;  3EHK A;  3RZZ A;  1QU0 A;  5F39 A;  1IKP A;  5DUV A;  5C7G A;  1CZS A;  3FX3 A;  5A7N A;  1CGP A;  1NY7 2;  1MZ6 A;  4CXX A;  1RUG 3;  2IWG B;  5IVJ A;  2ARE A;  1FPN 3;  3C7H A;  4OYU A;  1ULD A;  2VUA A;  4RFR B;  1CAU A;  2IZW A;  3NAP B;  3MHZ A;  3OGS A;  3WDY A;  2QE3 A;  1M06 G;  2XJU A;  2VZS A;  4ZU7 A;  3DXT A;  3KV4 A;  1UYP A;  1JW6 A;  5IW0 A;  3T1M A;  1PGS A;  3BTA A;  2CGN A;  2QQL A;  4XFC A;  3ZSE A;  1J58 A;  3OGV A;  1X8E A;  2WZR 3;  3RG0 A;  5ANQ A;  1LEN A;  5J1X A;  2DUO A;  3LD8 A;  3POI A;  4JC1 A;  3SH5 A;  5C70 A;  2XLG A;  2JEM A;  2W1U A;  2WKK A;  1VP6 A;  1IG0 A;  2DBN A;  4M3C F;  4NIH A;  2VOK A;  4YZ4 A;  1RUF 3;  1BVV A;  2O8Q A;  1YLL A;  3FC0 A;  3IIA A;  1A3K A;  2LS6 A;  4XDQ A;  1Q8P A;  5B2G B;  3A4U A;  3ES1 A;  4CPB A;  1HB4 A;  1IQD C;  4AQ2 A;  5H9S A;  5K4L A;  4AE2 A;  2ZMN A;  4XDP A;  1W6Q B;  2H0B A;  2JG9 A;  3MIH A;  4NPR A;  4YGC A;  4MAD A;  1NLQ A;  2D6L X;  3PME A;  4B4R A;  4BYY A;  1AL2 2;  3M3I A;  4Q0S A;  3CJI C;  3AMH A;  4UF0 B;  4CCK A;  5AC9 1;  5FQ0 B;  1U0A A;  2J1E A;  3WCR A;  2G9Z A;  2W1W A;  3MDP A;  2WFF 1;  5FZB A;  5FBZ A;  2WS9 3;  3ECQ A;  3GNE A;  5L7O C;  1RJ7 A;  1C1L A;  1U5Z A;  2XJR A;  3WXP A;  4FCA A;  4AQ6 A;  3A0N A;  1OI6 A;  2A75 A;  3VDA A;  1WW4 A;  3URF A;  2R32 A;  4LHK A;  3GAL A;  1DHK B;  1SCS A;  1H6X A;  5A7O A;  4Z1V A;  1OLM E;  4ITC A;  4M00 A;  1KIT A;  1MS5 A;  2XQR A;  3BCW A;  2JKB A;  3HEI A;  1SAC A;  4I30 A;  3IWZ A;  1W6N B;  2B46 X;  4B3N A;  3VL9 A;  4KWL A;  1GLH A;  4HKW A;  4UFI A;  4D94 A;  2HWE 2;  4C8D A;  4DUW A;  2Q4S A;  4Y1V A;  1CAX A;  1ASJ 3;  1XNT A;  3OY8 B;  4RS5 B;  5ACA 3;  5BV6 A;  4Y1U A;  4ISQ A;  4N53 A;  4XAC A;  5BNP B;  2ZEZ A;  2HWD 3;  2B7Y A;  3R0R A;  2WBK A;  4E2G A;  3LB9 A;  1AYN 3;  1PNG A;  4P9W A;  2CDP A;  2JEN A;  1PO1 1;  1RUJ 2;  3INA A;  3M3C A;  4SLI A;  1ZYB A;  2WQZ C;  1H9P A;  3I8T A;  1BXH A;  1IS6 A;  3H0O A;  3IDA A;  4XUQ A;  3WQ0 A;  1W9T A;  3KWV A;  4KGQ A;  1OUS A;  1UOB A;  1VPH A;  5DG1 A;  5FZF A;  4ES9 A;  1JH5 A;  3H42 B;  4Q4W 1;  4JTN A;  2DUQ A;  1N1T A;  1PO2 3;  3AKS A;  3C2U A;  4WVM B;  2WZP P;  1NA1 A;  1YFY A;  3RI8 A;  2BWC A;  1BJQ A;  2RE9 A;  3ES4 A;  4B7K A;  5G05 L;  4URA A;  1YFU A;  3FN9 A;  4QHO A;  4DXR A;  5FO8 B;  1PGL 2;  1UY0 A;  4BZ4 A;  1XPW A;  3UKT A;  4AED B;  4JVA A;  1Q8V A;  5KXD A;  4ZHN A;  4PQ9 A;  2HH9 A;  1DYO A;  4XQW A;  4PBO A;  5CKM A;  5LEJ A;  1BK1 A;  2AUY A;  3ZFF B;  1UKG A;  5A80 A;  4NN0 A;  4K20 A;  2CTV A;  4AVT A;  1LEC A;  3KT1 A;  4NOT A;  1JOJ A;  4FAG A;  1SLI A;  2VNR A;  1HRV 1;  1NCQ C;  3I3D A;  1GR3 A;  3GBW A;  3O14 A;  5FO7 B;  4D8M A;  2UWA A;  4CEW A;  2W94 A;  3IN9 A;  2ZML A;  4UFM A;  1DGW X;  1VMJ A;  2MEV 2;  4GXL A;  5IVY A;  2W1Q A;  2VW1 A;  4QAW A;  1AZD A;  5LRR A;  4XVH A;  4YG6 A;  3HOB A;  3VBS A;  5C9A C;  1VRH 1;  4V2W A;  1AJK A;  1LR5 A;  3B00 A;  5JIA A;  3PJY A;  1I1E A;  1LOF A;  2ZGU A;  3M1H A;  1PX4 A;  4QDR A;  3JQX A;  2LW8 A;  5D8A A;  4MHR A;  3AJY A;  2YYO A;  4OUL A;  2CGP A;  1WCU A;  3N9O A;  1NQJ A;  2Z79 A;  4AHX A;  2C1F A;  4OVE A;  2ZGO A;  5BPX A;  4AHY A;  4NJ4 A;  3FJS A;  3AKR A;  5DZF A;  1DGW A;  3WVJ A;  5LBE A;  2VC9 A;  1SPP A;  3DYP A;  4CEY A;  2E26 A;  1PVC 2;  2Z4F A;  1XXN A;  2HEV F;  3X29 B;  4AWD A;  4O61 A;  4P9L A;  3ILR A;  1IPJ A;  5A3O A;  1IZ3 A;  3C7G A;  1RHI 3;  4XHB A;  2DBI A;  3ACH A;  2D98 A;  4BXF A;  5HPO A;  3RMX A;  1KXG A;  1MS9 A;  3LIG A;  4GZ9 A;  4FAH A;  5A6Z A;  1RUG 2;  3OBZ A;  2WLP A;  4WZF A;  3DF0 A;  3MPB A;  4XBL A;  3EB7 A;  3D82 A;  1JI6 A;  5FYI A;  2W0X A;  3VB9 A;  1OLR A;  4BJ0 A;  1QOO A;  4I0A A;  2XKO A;  4XIO A;  5FYT A;  3SXW A;  5AFB A;  5K0U A;  1ST8 A;  1F31 A;  4AGG A;  3LSD A;  4I3G A;  2DU0 A;  2YZ4 A;  4NO4 A;  4Y24 A;  5HV4 A;  3H1W A;  4FXG B;  4DS0 A;  5ISL A;  3ZFG A;  5FKC A;  4QX1 A;  2CHH A;  3MZH A;  3KQR A;  1O91 A;  1YNA A;  3H1M A;  3PUH A;  3FWE A;  4R8H A;  2BFU L;  2XJT A;  1UL9 A;  5FZI A;  5A6Q A;  1VMH A;  3B93 A;  2OZJ A;  3ZLI A;  5KHK A;  4KU8 A;  4YM2 A;  2OVU A;  1G9C A;  5FCC A;  1OF3 A;  2GNM A;  2NZ9 A;  3MO4 A;  2WUH A;  4MOA A;  4DY3 A;  3AVR A;  3LCP A;  4JRA A;  4MV2 A;  1FNY A;  2RR1 3;  2UWB A;  4EN6 B;  3WF2 A;  5A6Y A;  3O1S A;  1O4T A;  2J1V A;  4XPV A;  2ILM A;  4LO8 A;  4HOO A;  1OD5 A;  3GF6 A;  1XYN A;  2V73 A;  4XF4 A;  1RIR A;  4DXZ A;  2XML A;  1QJE A;  4ZZ5 A;  2VZQ A;  4XAA A;  3TEX A;  4P14 A;  3WNL A;  4QGM A;  4QWN A;  5A3M A;  1UYZ A;  4JDM A;  3APB A;  4BIO A;  2X8K A;  3KVA A;  2WYS A;  4YZ1 A;  2A73 B;  4XZP A;  3LIH A;  2GMP A;  3MGU A;  4Z92 B;  2JXA A;  1D7P M;  3C7E A;  4HK9 A;  4R52 A;  3LDB A;  4EJR A;  1W39 A;  1S0G A;  2XON A;  2ZAH A;  3ELN A;  2A1X A;  5E16 A;  3WCS A;  4E4D X;  1UY1 A;  1LOD A;  4OI1 A;  1W03 A;  2R7E B;  3GYD A;  4HXC A;  3JD7 3;  5FTT C;  3ZIX A;  3VD4 A;  3CJI B;  1JOD A;  4BQ1 A;  3VGI A;  3WNO A;  5FPU A;  3GJB A;  1YCI A;  1R09 1;  5BY5 A;  1SLL A;  1YIP A;  2WWJ A;  3A23 A;  5L7O B;  1VAK A;  2JG9 C;  5FY1 A;  4A4A A;  1C8M 3;  3NNM A;  2HWB 3;  5FMC A;  3ST7 A;  5BYN A;  2GN7 A;  2E6V A;  1GOF A;  1NQD A;  2QQW A;  4FPE A;  4TWT A;  1WW7 A;  3AZY A;  5A6X A;  3IMM A;  1ASJ 2;  4Q4Y 1;  5BNN A;  1QQP 3;  1XNB A;  4FP3 A;  4EN7 B;  3O1R A;  2GZW A;  4DRV A;  2G9G A;  3AM2 A;  4B1M A;  5A3T A;  3M7A A;  2HWD 2;  1H9W A;  4AXO A;  2V4A A;  1RUC 3;  3DUI A;  5A3P A;  3KV6 A;  4YGB A;  1IPS A;  1AYN 2;  1OFS A;  1UQX A;  2VBP A;  2R0H A;  1REF A;  3KV9 A;  3N7L A;  4NHK A;  5FK8 A;  1HXS 3;  4CRQ A;  1CPN A;  1JU4 A;  2QNK A;  3ZYF A;  1BKZ A;  5JOX A;  2ID4 A;  1AXY A;  4LBQ B;  4OI2 A;  5DQ0 A;  1QJY 1;  2FDG A;  3MW3 A;  1D4M 1;  3ZXD A;  1H2N A;  1PO2 2;  1GMM A;  3MIC A;  5T52 A;  3OOX A;  3LPF A;  4BQW A;  2JDU A;  2VZ1 A;  1PHM A;  2YHJ A;  4XUP A;  3NJY A;  2PFW A;  4XXP A;  4YRD A;  5F3E A;  5FY8 A;  2NM1 A;  3I3Q A;  3RPQ A;  5FRA A;  1Q3E A;  1NUK A;  3MYX A;  4N53 C;  1UZY A;  1O59 A;  4L9B A;  2DV9 A;  2EVX A;  3T0A A;  3LEM A;  1SFY A;  1URX A;  1S55 A;  4M4R A;  1RYY A;  3J7L A;  2PMW B;  4KGG A;  5L19 A;  1PMJ X;  1MAC A;  5FUP A;  3T4H B;  5APA A;  4F7Z A;  3G6J B;  4JKM A;  5I8Y A;  1DDL A;  3E6D A;  4NPM A;  2WA3 A;  3ZSL A;  4W6X A;  4EWD A;  4GIQ A;  3N9L A;  4H3W A;  3DV8 A;  3CKH A;  3LA7 A;  3VHO A;  3WNK A;  4E8C A;  2LRO A;  4WBB A;  5A1F A;  1SDD B;  1NA1 C;  1VBC 3;  3ZFE A;  2R07 3;  4HN1 A;  3N7M A;  1AR8 1;  1NCQ B;  1CJP A;  1W6N A;  3AXE A;  2MHF A;  4IE4 A;  4L97 A;  4CPB D;  5KHI A;  3I4I A;  1TMF 1;  4FT8 A;  1HIX A;  1PGW 2;  2EIG A;  1JUH A;  3CMG A;  4LA3 A;  1LU2 A;  2ZHK A;  4UFH A;  1XQN A;  2DCK A;  2BER A;  4FVV A;  4Q4X 2;  1POV 0;  1RMU 3;  4EZ4 A;  5C9A B;  4LNV A;  2V5Y A;  4AVV A;  4IEZ A;  4TLG A;  3VZJ A;  1LHW A;  2Q1M A;  2VOW A;  1LOE A;  1APN A;  1FMD 3;  4CP1 A;  2XWB B;  5IT6 A;  4CEW C;  4Q29 A;  1HKD A;  3USS A;  1XNC A;  5CIR A;  3D4K A;  3DEM A;  1RHI 2;  4W6W A;  2VMC A;  2WNU A;  4ZU5 A;  2R16 A;  2BV4 A;  3R4U A;  3I2D A;  2DDU A;  3Q8E A;  3KT4 A;  2XVL A;  3VBS C;  1OA4 A;  4QX2 A;  2JDN A;  4HPK A;  3AB0 A;  3Q8C A;  3I59 A;  1J3P A;  2CU5 A;  3U37 A;  4CCD A;  1LOF C;  1QXP A;  2E7T A;  5IK4 A;  5FMO S;  4COW A;  5D8A C;  1XC6 A;  2V72 A;  2YPD A;  3OB8 A;  1GP4 A;  2D3P A;  5HV0 A;  5LW9 A;  5F6L B;  3E5U A;  1ACC A;  2IXL A;  2P5B A;  3DEC A;  1S2K A;  2ZGT A;  4K6B A;  4CEY C;  3AYD A;  4MH0 E;  3N9Q A;  2EF6 A;  2RS1 2;  3MEP A;  3CEW A;  1UMZ A;  3UNP A;  4LR4 A;  1OH4 A;  2GU9 A;  1GWK A;  3AC0 A;  2OUJ A;  1JZ6 A;  4GJY A;  3POW A;  2I2S A;  1WD3 A;  5F2S A;  1VR3 A;  4WM7 B;  2RS5 1;  4Q0V A;  2EAK A;  4UFJ A;  1MS1 A;  3DYM A;  1OQE A;  3Q8B A;  4FFH A;  5I0T A;  3USU B;  2XVG A;  3N3H A;  4Y20 B;  1V6N A;  5H9P A;  2RR1 2;  1RED A;  4PLM A;  2G9F A;  4LBJ A;  3I3M A;  4BU2 A;  2PHX A;  3QH6 A;  3H3L A;  1AL2 1;  5K0U C;  4GWJ A;  4QD2 A;  3N7J A;  1NAE A;  2WO2 A;  5FZ9 A;  4LHS A;  3DN7 A;  4RHV 1;  1Y9M A;  2ADD A;  3THT A;  2WJS A;  3ZFG C;  3GZA A;  1CAU B;  1CX1 A;  2IXK A;  3PIJ A;  3WT3 A;  4IEO A;  1W0P A;  2A6Z A;  5C4W A;  3NKG A;  4NII A;  4AVC A;  2CAV A;  4J25 A;  3GDB A;  5LBF A;  2ZGR A;  3LOI A;  4Y26 A;  2P2K A;  4QB2 A;  2R49 A;  4Z8B A;  5IK5 A;  1KQR A;  1FXZ A;  2XJP A;  5J98 B;  3NMB A;  3NW4 A;  3JD7 2;  2PHT A;  4RA0 A;  4FFF A;  4FPG A;  1QJF A;  4DO0 A;  2V09 A;  2A3X A;  1JHJ A;  4CYD A;  2AEZ A;  1WKY A;  1CQ9 A;  2YBK A;  4D7Y A;  4M0H A;  2P3Y A;  4OZX A;  3CIH A;  2ZAC A;  3AFK A;  1C8M 2;  3I2G A;  3WDX A;  2CNA A;  2HWB 2;  1JTZ X;  3WDV A;  1J59 A;  1MZ5 A;  5DN2 A;  2J1A A;  1NLR A;  2X5I A;  5GJ6 A;  1XNK A;  1RUE 3;  2TUN A;  4Y33 A;  1GOG A;  1QQP 2;  1RUJ 1;  2EAL A;  4PIZ A;  3WV6 A;  1SFN A;  1WCQ A;  4CCM A;  2H6B A;  5KC5 A;  3EQE A;  2PEL A;  3O5S A;  3EMR A;  5B4X A;  4AYU A;  4XJW A;  1W2A X;  3GZE A;  3RI9 A;  3ZSM A;  2JIC A;  4ZS2 A;  1DYP A;  5F6K A;  4LBL A;  4NIG A;  1AR7 2;  2GN3 A;  3POE A;  5FZ7 A;  1ULE A;  1AYM 2;  3TNQ A;  1HXS 2;  4AZZ A;  2K2S A;  4AVA A;  1SZB A;  4FPF A;  1LGB A;  1Z7S 1;  4L92 A;  4KMQ A;  3S30 A;  1QEX A;  3H3Z A;  2R6Q A;  5FZA A;  5FZL A;  1RUD 3;  2ES3 A;  2J1U A;  2KD7 A;  4N7U A;  1ZBE 3;  1XNA A;  2W1S A;  4S2G A;  1N47 A;  5A70 A;  3D6E A;  5LBB A;  5I91 A;  4MGT A;  4OLL A;  4YWA A;  3AYA A;  2UY8 A;  1W8U A;  1OMI A;  4WVV A;  1H1I A;  5AVA A;  1OPO A;  4YGD A;  3AKQ A;  2GP3 A;  3ZDS A;  5BNN C;  2WA4 A;  2RJL A;  2WN3 A;  3E1F 1;  4YZ2 A;  4ORF A;  4Q0P A;  2UY9 A;  4BE3 A;  1HJF A;  5FZE A;  4YSF A;  4KNC A;  4S2D A;  4M01 A;  5KHH A;  4LIV A;  1CAX B;  3HAG A;  5FP4 A;  5JPM B;  1LJ7 A;  3FHI B;  4LUM A;  2CGO A;  5FXV A;  4N53 B;  3OBT A;  2K9Z A;  4BIF A;  2DVF A;  4RYD A;  3PUQ A;  4PQQ A;  4MO3 M;  4IQP A;  3T0D A;  1VBB 1;  3CNA A;  2HKX A;  1Q8S A;  4IV3 A;  4RR3 A;  3ZYR A;  2JKX A;  3ZXK A;  4P9I A;  2Q5T A;  2EIB A;  1UZW A;  5GZG A;  5C3S A;  4GAZ A;  3CDZ B;  3D0S A;  2R07 2;  1BBT 1;  3CZU A;  1UMH A;  2X53 S;  5JI9 A;  2FMD A;  1V6L A;  1COV 2;  2C9A A;  1NOV A;  2QZ2 A;  4UT5 A;  1NZI A;  3WW1 A;  3BYW A;  3D3A A;  4XTM A;  2RJ2 A;  4BHP A;  4X6Q B;  3E6C C;  2XUM A;  1V00 A;  1NA1 B;  2WQ4 A;  3P3P A;  1RMU 2;  4QU1 A;  2XPJ A;  1VJ2 A;  5FOJ B;  2DFB A;  2CDO A;  4X8P A;  4D69 A;  4H7L A;  1KFU L;  4NIA A;  3GJA A;  3VKL A;  3ZPY A;  2LM3 A;  4COV A;  4Z2A A;  1POV 3;  4OMC A;  3FZ3 A;  4GWM A;  4UW5 A;  1RUG 1;  2OS2 A;  2ZAA A;  3MPP G;  4P9G A;  5A7S A;  3BU7 A;  1FPN 1;  2HBT A;  2Y6J A;  4O9G A;  1RIN A;  1D2Q A;  1UY3 A;  2WZE A;  4XUO A;  2BVB A;  2ZGP A;  3CO2 A;  3ZFE C;  2JB4 A;  3KF3 A;  3MFC A;  3AZZ A;  5JOZ A;  1IKQ A;  2BUK A;  5CBL A;  5EYX A;  1SG3 A;  1X7N A;  4CEW B;  3ILN A;  3FE5 A;  4ZS3 A;  3WW2 A;  4XF3 A;  5I8S A;  1UPS A;  3MID A;  4CXY A;  4MHU A;  4YW7 A;  3BTY A;  1Z0H A;  2VTX J;  3VBR A;  1KJR A;  1LAJ A;  4XF0 A;  2WZR 1;  2JJ6 A;  3VBS B;  3VZM A;  4XFB A;  4IEV A;  1QIQ A;  2A6W A;  1SLA A;  1IS5 A;  2J7M A;  3PTY A;  5D8A B;  3III A;  3VBO A;  3ZDV A;  3ILF A;  2FZ2 A;  4C0H A;  1A6C A;  1S0E A;  3PMS A;  3KZ4 C;  5LZ6 A;  1H8V A;  1RUF 1;  1C8N A;  2WNU C;  2DCY A;  3CHX A;  4W50 A;  1SPP B;  3NKT A;  4CEY B;  2C6S A;  1Y9Q A;  3RSJ A;  4M3C E;  5CFC A;  4QPG A;  1BK0 A;  2VUD A;  1PM7 A;  1KEX A;  3ZR5 A;  1GNZ A;  4EWE A;  4E9K A;  1OUX A;  4JQR A;  1KRI A;  1ND3 A;  2VVD A;  5JSP A;  4C0B A;  2BZD A;  3WP4 A;  2VQA A;  5FZ0 A;  1F4A A;  2Y34 A;  2ZEX A;  4FOV A;  1VBE 2;  3H8O A;  5FYV A;  4GMP 1;  1KS4 A;  2D6M A;  3PIG A;  2WS9 1;  2VUC A;  4HKO A;  2EAA A;  3MUY 1;  4YW2 A;  5LB6 A;  3E5X A;  4DUV A;  2JX9 A;  3W59 A;  3BI3 A;  2P6C A;  5K0U B;  2R1D A;  4NRO A;  1LU1 A;  4QQL A;  3A7Q A;  4AFD A;  1WBF A;  2CYF A;  2B9U A;  2QQJ A;  3PUR A;  5EJZ B;  3ZFG B;  5ANN A;  2YU2 A;  5L9R A;  2W52 A;  1V6O A;  5GLT A;  4EN8 B;  1RGS A;  2F4L A;  4IGQ A;  3ENR A;  2AEY A;  1TME 3;  2PN5 A;  4AAP A;  4BQ5 A;  4RN5 A;  2VMG A;  1IS3 A;  4AEK A;  4HG6 B;  1ASJ 1;  2XHN A;  5DUX A;  5ACA 1;  3ZO0 B;  5HXM A;  1QJX 2;  4W6Y A;  4AFM A;  1ZZC A;  4AI9 A;  1GUI A;  5CNA A;  5EIY B;  2Y64 A;  2ZMK A;  5C4W C;  2HWD 1;  1YJK A;  4A7K A;  4IE0 A;  1RUE 2;  2HEY F;  1SLT A;  2LTN A;  4HL0 A;  4BME A;  5F9T A;  1ZNP A;  5KHJ A;  4U2A A;  3I54 A;  1PNF A;  4L2N A;  4A6S A;  4YLZ A;  2XL7 A;  4K40 A;  2D5F A;  1CVN A;  4WM7 A;  4ZPI A;  1W3V A;  4O7X A;  4AVB A;  2NPI A;  4JGZ A;  3WF0 A;  3IZO A;  1TG7 A;  3FL7 A;  3NQH A;  3KD4 A;  1DIW A;  2W91 A;  3EBR A;  3OBA A;  3T4V A;  1ZA7 A;  1Y4W A;  1H4H A;  1UAI A;  4CDU A;  1RUD 2;  1S0I A;  1TNF A;  5JZG B;  1W0N A;  1ZBE 2;  2ZEW A;  3B94 A;  3BVC A;  3NNJ A;  1MS0 A;  5CZK A;  1UOG A;  4OHZ A;  3WIN E;  2ET7 A;  3HWJ A;  5DMY A;  1B35 A;  1OXC A;  1ULF A;  2X5I C;  4FFG A;  4OFG A;  3VZN A;  2WYF A;  3VDD A;  1CWP A;  4KI5 M;  1FOD 3;  4N7I A;  4UAP A;  2VW0 A;  2YGL A;  1AX0 A;  1W2N A;  3K75 B;  4Q2F A;  1ZRC A;  2VO5 A;  1IOA A;  4HBN A;  3HT2 A;  4KG0 A;  5FMO L;  4NHL A;  1N3P A;  1IS4 A;  2RMU 1;  4LQR A;  5E6H A;  3V56 A;  2VBD A;  1P8J A;  4O65 A;  1EV1 1;  1UNB A;  5BNN B;  1EUT A;  2VOV A;  3OGG A;  3H8U A;  5IFP A;  5IVC A;  2ARX A;  1WCS A;  4FPJ A;  4J1X A;  3U1X A;  1WA6 X;  4M3C A;  1RUI 1;  1WD4 A;  1WBL A;  4LE4 A;  4YM0 A;  2PA7 A;  2XOM A;  4XTP A;  3WG4 A;  3K48 A;  1EUU A;  2W95 A;  4LLF A;  4OCT A;  3I2I A;  5HCF A;  4AI3 A;  1K3I A;  1ZRE A;  5J36 A;  3I2O A;  4OQ9 A;  1E5S A;  2P37 A;  1GQH A;  3LDK A;  4K9S A;  4XXA A;  1S1A A;  1PZ8 A;  4BWO A;  4EQV A;  5JR7 B;  3K46 A;  4XBQ A;  3AL5 A;  4Y1X A;  1BVP 1;  1F4H A;  1S0J A;  1C57 A;  3OPZ A;  1WMF A;  1RHI 1;  1W9S A;  1J3R A;  1GZT A;  2QBX A;  5CIS A;  2E32 A;  4CA9 A;  4TXW A;  2UUR A;  1UXX X;  1GZ9 A;  1PIV 3;  2XXZ A;  3SH4 A;  4QB1 A;  5IFT A;  5T54 A;  3M3O A;  5KR7 A;  4IV3 C;  4RR3 C;  5F5C A;  2YXS A;  1S0C A;  3ZYJ B;  4HK8 A;  3GZU C;  4K8R B;  5ABJ B;  3VDB A;  2JDH A;  1W6O A;  1W2T A;  1Z78 A;  3ZN5 A;  1ZVF A;  2QQU A;  4XOG A;  5T5P A;  1NZC A;  5JXI A;  5IK7 A;  3O1P A;  1QXJ A;  5LA9 A;  3W20 A;  2HLE A;  2WNV A;  3ZFE B;  1BEV 3;  1H1A A;  5FJH A;  3WF4 A;  2SBA A;  2BBA A;  2WR9 A;  3HNM A;  1VB2 A;  3HJR A;  2R06 3;  5GZF A;  1R1A 3;  3J7H A;  4CVU A;  1D0H A;  1KDM A;  2F6B A;  4QHB A;  2OQ6 A;  4B8E A;  3ME2 A;  1K45 A;  4CCC A;  1H2K A;  3T0B A;  3PVN A;  4GH4 B;  4A6O A;  4BA6 A;  2RR1 1;  3HQR A;  5E89 A;  4GB3 1;  4FP2 A;  2YRO A;  4LT5 A;  3AYC A;  3B69 A;  1QHD A;  1HB2 A;  3LEG A;  4CU8 A;  2DTY A;  3T2P A;  5ERL A;  2VZO A;  3P5B A;  2JE8 A;  3H7Y A;  1SCR A;  2K0G A;  2R0F A;  1DQ2 A;  1IQA A;  1WA4 A;  2WNU B;  1LOA A;  1BCX A;  2FBE A;  1FI2 A;  3VBR C;  1XU1 A;  4Y5T A;  2QVS B;  2XBO 1;  3ZSJ A;  5DUU A;  3KCX A;  2WT1 A;  3KHB A;  4HPK B;  3I59 B;  4NPL A;  3ABZ A;  2OII A;  4HN0 A;  5IAX A;  1W99 A;  3VBO C;  1SLC A;  3F2Z A;  1XYO A;  2WT2 A;  1HN1 A;  4XJ8 A;  1KDK A;  2JDK A;  4W8J A;  3GZT B;  3KHC A;  1UX6 A;  3JD7 1;  4H7M A;  5FZM A;  2XLA A;  2R04 3;  2QQI A;  3WG3 A;  3S0M A;  3PDQ A;  4P9X A;  3THD A;  1K12 A;  1WLW A;  5LY1 A;  4NMI A;  2FDI A;  3RZL A;  1C4R A;  2HWF 3;  3N9N A;  5CFC C;  2QQV A;  4QPG C;  3ROU A;  4RQP A;  2C4X A;  2VZU A;  1C8M 1;  3NV4 A;  3AMP A;  2QQP A;  4OUM A;  1GP6 A;  2HWB 1;  1ND3 C;  1EY2 A;  1YUD A;  3VZK A;  1MVE A;  3WQ1 A;  1LOG A;  5FUI A;  2KM2 A;  1TME 2;  1LHV A;  1O4Z A;  3K2O A;  1JS9 A;  3RYK A;  3NNF A;  1N1V A;  2UYA A;  1D0G A;  2XWJ B;  4GAL A;  1J1T A;  1QQP 1;  3HBK A;  4IEQ A;  2GP5 A;  4RD7 A;  4AQS A;  4AI2 A;  1O4Y A;  1G86 A;  4IGP A;  2BNO A;  2HEW F;  1QXR A;  2OZ6 A;  1JU3 A;  1NKG A;  1RUC 1;  4LO4 B;  4QM9 A;  4R9C A;  4XYX A;  3AFG A;  5EFU A;  3IM0 A;  4Q4X 3;  4DFS A;  4ET7 A;  5L36 A;  1JYV A;  3WQ7 A;  4TLF A;  3LE0 A;  4JDN A;  2G4I A;  2PHR A;  5DZE A;  4Q4V 3;  4OI4 A;  4CU9 A;  3ZSK A;  1RUH 2;  2ZGM A;  5FZC A;  5C4W B;  2A6X A;  4Q1P A;  4I02 A;  4FSJ A;  1UYX A;  3ZYP A;  2WWS A;  3TB0 A;  4EYU A;  1RIT A;  4JV4 A;  4LBQ D;  1O3R A;  4K8F A;  1V6J A;  2IC1 A;  1QJU 1;  2BNM A;  3NV3 A;  3ZVX A;  1EAH 3;  3BGA A;  1LKN A;  4R4Z A;  4XMI A;  2NMO A;  3SIT A;  1HX6 A;  2B4K A;  4G3Y C;  1XE8 A;  1OLQ A;  4BQ2 A;  1HV0 A;  1XSR A;  3O12 A;  3POB A;  3QAC A;  3BAL A;  3T08 A;  1X50 A;  4I0W B;  5DAX A;  2PXJ A;  4JDO A;  4LK7 A;  4F8A A;  1W9W A;  4LPL A;  4DUX A;  1FOD 2;  4PDW B;  4DEV A;  1Q56 A;  1I3H A;  1W8H A;  5FPX A;  3POF A;  4WM7 C;  3FMG A;  2ZJC A;  2ZGL A;  3VBU A;  2RS1 3;  4FQZ A;  2X5I B;  1AXK A;  2YPJ A;  3GM8 A;  4JGZ C;  4P9J A;  1ZRI A;  3RJR A;  4DEQ A;  4OHY A;  2HWC 1;  5FP7 A;  3HVD A;  3S7I A;  3O0V A;  1LGN A;  4Z07 A;  4QGN A;  1VBC 1;  1L3J A;  3VKM A;  3THC A;  2AAC A;  4CDU C;  3AYE A;  4HON A;  2P6H A;  3PU3 A;  3BB6 A;  1HQW A;  5GAL A;  3SKV A;  3UGH A;  5A33 A;  5C33 A;  1JOP A;  1GIC A;  4N9I A;  4QMA A;  4A42 A;  1B35 C;  1BMV 1;  2QQM A;  1DGR A;  2Q8E A;  2DTW A;  1RMU 1;  1Q43 A;  4QB6 A;  3H7J A;  1MEC 3;  2LUW A;  2YMZ A;  4W4Z A;  3VDD C;  3OUH A;  3ZXE A;  3KGZ A;  3SEP A;  1JYN A;  1ZZB A;  1E5R A;  4YAR A;  3T30 A;  2KXL A;  2BOJ A;  1FMD 1;  2WQ8 A;  5IVE A;  4BQ3 A;  2FMY A;  2VG9 A;  1CPM A;  2EA7 A;  4LIU A;  1VBD 3;  2VNG A;  2ZX4 A;  4TSV A;  3BTZ A;  3RMY A;  1R1Z A;  1GV9 A;  2CL2 A;  3WUC A;  4QXH A;  1FYU A;  4NVP A;  5KXC A;  1PIV 2;  3MUZ 1;  4UI9 L;  2ZTN A;  2AYH A;  1XND A;  1O5L A;  2VMH A;  1U12 A;  1GWL A;  3GCX A;  4QPY A;  3PNA A;  2YBS A;  3UGG A;  4NE9 A;  3MLJ A;  2GNT A;  5IWF A;  1PO1 3;  1GYK A;  1OKO A;  3IMN A;  2Y6F A;  3M3E A;  1SDW A;  5LWB A;  3I3B A;  2R1B A;  3AMQ A;  2EXH A;  4EE2 A;  1G6N A;  4JGY A;  4XDO A;  1I9R A;  2XHK A;  4RGA A;  4EV0 A;  3A21 A;  1EP0 A;  4IV3 B;  4RR3 B;  1PX3 A;  3IBM A;  5GLW A;  5F32 A;  5FXZ A;  1BEV 2;  1H4G A;  1GNH A;  4XHX A;  3TWI A;  4OUS A;  2R06 2;  1R1A 2;  3NNG A;  2NN8 A;  3PTR B;  1FT9 A;  1O5U A;  1W2O A;  2ZPX A;  1TE1 B;  5D21 A;  3SC7 X;  1ULO A;  3EYP A;  2NQY A;  3JUU A;  4A3Z A;  2ET1 A;  5CKQ A;  1YC6 1;  3QCW A;  1C5I A;  4CCJ A;  5HCA A;  1DZT A;  1HRI 2;  1WLD A;  2BDR A;  4LUK A;  1MVQ A;  4BLI A;  1AR7 3;  1IHM A;  2KA3 A;  3OTF A;  2HYX A;  1CES A;  1AYM 3;  3RFR A;  4DOU A;  5L9V A;  5A7Q A;  4DNY A;  3NJZ A;  3RZG A;  2CAU A;  2ZBJ A;  4HFS A;  3RS6 A;  3LDR A;  5AVP A;  3C8X A;  3VBH A;  2MNG A;  2WNV C;  4AEJ A;  2DUP A;  3VL8 A;  2OPW A;  3WDU A;  1KJL A;  4NHY A;  4CP9 B;  2I74 A;  3VN4 A;  4COU A;  2EXJ A;  2A6Y A;  2J1T A;  2PAE A;  3K4D A;  4NWV A;  4C1W A;  4COZ A;  3W21 A;  1AVB A;  4QXC A;  2QZ3 A;  2WZ8 A;  3FBM A;  1C1F A;  3HT1 A;  3VBR B;  4B7E A;  2DVB A;  4LOT A;  2C5D A;  3WX5 A;  1DZQ A;  2R04 2;  3NRU A;  3J8F 3;  1G9D A;  2RJK A;  4LBM A;  2VMF A;  3VBO B;  4QX0 A;  5FKB A;  2HWF 2;  4XCB A;  1XE0 A;  5C8C A;  2A3W A;  3GHM A;  5T5O A;  3M2M A;  3UT0 A;  5ABJ A;  2W08 A;  1GBG A;  3ZXA C;  4IE5 A;  4P08 A;  5FY7 A;  1GQG A;  2ARB A;  4DB5 A;  4JX0 A;  5CFC B;  2QCS B;  1MZF A;  5T3N A;  4QPG B;  4HMZ A;  4ZXE A;  1Y43 B;  4MYE A;  1KD7 A;  4ATF A;  4IET A;  1HJG A;  1SLB A;  1ND3 B;  4Z2W A;  3LA3 A;  3WF1 A;  3HQU A;  1COV 3;  2RM2 1;  1SFP A;  1X9P A;  1U5Y A;  3UKN A;  1JOB A;  4L0P A;  5F7U A;  3LKJ A;  1G7Y A;  2FZ1 A;  3KT7 A;  3MI8 A;  4MGI E;  4GH4 A;  1AR6 1;  1FV2 A;  1G9F A;  1YQ8 A;  3GXU A;  2UYB A;  4Q4V 2;  1XU2 A;  1YFW A;  2PHW A;  4RQP C;  2BPA 2;  2WAB A;  4CP2 A;  5C3P A;  1AJO A;  3J7N A;  1UWW A;  1RUD 1;  4XQ4 A;  5FAX A;  1ZBE 1;  4BQ4 A;  1NY7 1;  3C3V A;  1YFX A;  4RGK A;  4H55 A;  4I01 A;  3OCP A;  1YJL A;  1STM A;  1T6B X;  1EAH 2;  4DIQ A;  1VRB A;  1H8T A;  2PQQ A;  2ETE A;  1NG0 A;  4GQ7 A;  5GZC A;  1PK6 A;  1CIY A;  4FOW A;  2YC0 A;  3IDB B;  4IUG A;  4M0N A;  1QNW A;  2ZGN A;  2N7G A;  2ZGS A;  3NWK A;  4JHZ A;  3SCF A;  4PLO A;  2PHL A;  4YM1 A;  2X29 A;  2GME A;  2W92 A;  4COY A;  2X05 A;  1T2X A;  2IXJ A;  1US3 A;  1VBA 3;  1CD3 G;  1DGL A;  1W05 A;  5BXX A;  2D3S A;  1GP5 A;  5FP8 A;  1XOY A;  2ADE A;  4LIT A;  4WZC A;  3J7M A;  2Z42 A;  4QQH A;  4BQX A;  1U5X A;  2WDB A;  2VY0 A;  2VD7 A;  4F3J A;  3LFI A;  1BZW A;  1OSG A;  1NLS A;  1PMI A;  3OEA A;  4JRL A;  5JOY A;  5JWP A;  4C1X A;  1WUV A;  3OPT A;  1POQ A;  2VQ0 A;  2ZCW A;  2BYV E;  4JGZ B;  4R9A A;  3OBR A;  4L11 A;  3LA2 A;  2B8M A;  3ZX7 A;  2IXI A;  4WM8 B;  3IAQ A;  5FYM A;  2DU1 A;  4YNI A;  5G04 L;  5FY0 A;  5A3W A;  1R09 3;  4D7S A;  2QDN A;  1DQ5 A;  2PQS A;  1MEC 2;  4S2H A;  4CDU B;  3SKJ E;  5A1A A;  5JI7 A;  1R64 A;  2W2I A;  4QKB A;  1E5I A;  4NHX A;  2FD8 A;  3E5Q A;  1F2N A;  2Q1Z B;  1VBE 3;  1POV 1;  2OXB A;  3D8C A;  4QU2 A;  1B35 B;  3V0A A;  3O1V A;  2Z5W A;  3VBU C;  5H9Q A;  5JPN B;  2IUW A;  3VDD B;  4AW7 A;  5IK8 A;  1VBD 2;  1YYN A;  4XFF A;  1IGO A;  4XUT A;  4UOJ A;  5I0U A;  5JVV A;  1WCK A;  4B4Q A;  5JZG A;  3D5O A;  4I0B A;  4YZ3 A;  3VDC A;  1CIW A;  1OF4 A;  2D93 A;  5GZE A;  5JDB A;  3CQO A;  2DVD A;  3NL1 A;  3OGR A;  4PJY A;  1GWM A;  3WNM A;  1LEM A;  5LY2 A;  2BOI A;  4DRR A;  4AGV A;  5C3R A;  1PO1 2;  4LKS A;  4XUN A;  2A71 A;  5A7W A;  2VE1 A;  5JCT A;  4E4Z A;  4M3C B;  4QDQ A;  3ETP A;  1S0B A;  3T1L A;  2HWE 1;  2QDR A;  1W6P A;  3BIW E;  1QJY 3;  4IW3 A;  1QJZ A;  2P3K A;  2NLR A;  4PI0 A;  4O9E A;  4PDW A;  1QJX 3;  5F3C A;  2FHR A;  2WSV A;  2IXC A;  4AGR A;  1RJ8 A;  4K3U A;  3WUD A;  2K46 A;  4Y1Y A;  1QDO A;  5TSW A;  3ZXJ A;  1UOF A;  4FPK A;  5DG2 A;  1D2S A;  1RC6 A;  2VCA A;  1JYX A;  2FCU A;  4HT1 T;  5A7P A;  4QKF A;  5A3N A;  3VD9 A;  1W6M A;  4QPI B;  2PAK A;  3OSD A;  5JXH A;  1UKR A;  1SBD A;  1ZBA 3;  3AZW A;  1NE6 A;  4JTO A;  3ALQ A;  3B01 A;  5GZD A;  3T3Y A;  4JGY C;  5EHD A;  1RL3 A;  1OOP A;  1TEI A;  4L8Q A;  4B1L A;  5C6C A;  4EN0 A;  3WW3 A;  5DAP A;  4CP0 A;  5D1I A;  2C9K A;  3WZ1 A;  4C91 A;  2P4E A;  1PGL 1;  1FAY A;  1W6O B;  3JBG 3;  5A3L A;  1ULP A;  4YGE A;  1AR8 3;  1ENX A;  5DPN A;  3UES A;  2Z69 A;  2LAL A;  1VRH 2;  3WDW A;  2DCZ A;  4PLN A;  2WNV B;  4YW3 A;  2D44 A;  2E63 A;  1ND2 A;  1UZ0 A;  3POG A;  4LO5 B;  4AFA A;  3OG2 A;  5GM0 A;  4PBP A;  1OC1 A;  3J8F 2;  1ZX5 A;  5DDJ 3;  3IAP A;  4ASM B;  3PUI A;  4IER A;  3MF9 A;  1N1S A;  2H0V A;  2VH9 A;  2X09 A;  4D7T A;  2MEV 1;  3MV0 1;  5LK5 A;  3B5L B;  3WF3 A;  3O1U A;  4DIN B;  4XFA A;  2RDS A;  2VZV A;  4AVS A;  3VBH C;  1HQN A;  3BN6 A;  5CAZ A;  5IYY A;  3BTX A;  2VNO A;  3BOP A;  4OQ8 A;  2W9X A;  5J37 A;  1K5M A;  2VCC A;  4P9Y A;  3LF7 A;  4Y22 B;  4CUA A;  1WCD J;  3ZKY A;  4D0Q A;  3TEW A;  2FQP A;  1QNY A;  2ZOE B;  4MGK E;  4V1P A;  4LJH A;  1SMV A;  5DUW A;  3VD5 A;  3OUI A;  1H2L A;  1PVC 1;  3S5A A;  4LE3 A;  1QWR A;  2GC3 A;  5FDB A;  2PAM A;  3SCG A;  3EJK A;  2XR4 A;  3H3U A;  4KBB A;  3SEE A;  5C8C C;  5ABJ C;  5CU1 A;  3RNS A;  1N3O A;  5FXW A;  5EYY A;  4DY5 A;  3S57 A;  3LQC A;  3OD4 A;  5FZ6 A;  5JSO A;  4LK6 A;  4MGQ A;  3KCC A;  5B4N A;  2GH2 A;  4XE9 A;  3KSC A;  2BU9 A;  4RQP B;  4XJA A;  2XJS A;  1FOD 1;  2WL1 A;  3FLP A;  4CP9 A;  5LBC A;  2VUJ A;  3GHN A;  3B3Q E;  2RG4 A;  4GMP 0;  4N8M A;  2XJV A;  4LTA A;  5LA0 A;  2ZGQ A;  4XIL A;  4GH4 C;  3BOD A;  5FO9 B;  3POS A;  3QH7 A;  1ZZ6 A;  4XFH A;  1FV3 A;  2XGX A;  2ZEY A;  5F5I A;  1VBA 2;  3VBF A;  4BPZ A;  4FQ4 A;  4RHV 3;  1H6Y A;  2OPK A;  1WMX A;  1XJA A;  2PYT A;  3PL0 A;  5DAW A;  1Q8Q A;  2E33 A;  1UX7 A;  1A34 A;  2LRP A;  1I6X A;  4Y5S A;  3JB8 A;  3VLB B;  3TN9 3;  3LSE A;  2BRT A;  3NJV A;  1QGL A;  3IT8 A;  1H8T C;  5C5U A;  2YBP A;  5LAT A;  1F15 A;  2GC2 A;  1PK6 C;  2BGP A;  5JXJ A;  4KU7 A;  4CU7 A;  4LKE A;  3OGJ A;  4PF5 A;  3SCH A;  3U14 A;  4E4S A;  2YU1 A;  3ZXF A;  1HW5 A;  1R09 2;  4GJZ A;  1UU5 A;  2ZX0 A;  3LZZ A;  1YEW A;  4PIY A;  1JZ4 A;  4KBZ A;  2ZGK A;  2BEO A;  4Q0Q A;  4BB3 A;  1A8M A;  1Y7B A;  3AKP A;  4XF9 A;  5FMB A;  2D6N A;  2KR2 A;  4XMA A;  1DU3 D;  3PVO A;  1H0B A;  1EYB A;  3ACL A;  2WNO A;  3IB3 A;  3N35 A;  3ZYH A;  5FLJ A;  1QF3 A;  4BOW A;  4CCL A;  3ZOI A;  2Q8O A;  4DQA A;  4XAB A;  3L9J T;  4J6G A;  1V9U 3;  3VBU B;  1FX5 A;  2VMI A;  2ATF A;  3ACI A;  3K77 A;  4BM8 A;  2VBB A;  2ZS6 B;  3BPZ A;  4JZR A;  4CE8 A;  5JOW A;  2YV8 A;  4LLO A;  4XFG A;  5F8P A;  3JQW A;  2CWM A;  3SH3 A;  1ODN A;  1I5P A;  1US2 A;  3RYR A;  1BEV 1;  3TAY A;  3TRS B;  1TNR A;  3PVB B;  1OD3 A;  1Z7S 3;  2JD4 A;  4ISR A;  1N1Y A;  1WWY A;  1R1A 1;  4NR1 A;  1QJY 2;  1F5J A;  3MW2 A;  3VZL A;  5A33 B;  3I2K A;  1D4M 2;  3H8R A;  4QQ2 A;  4HSL A;  3M3Q A;  1V6I A;  4AG4 A;  1MZE A;  1D4V B;  4Y4Y A;  1BLZ A;  2Y6H A;  4Q27 A;  1TQ5 A;  2W68 A;  5JUV A;  2D5H A;  3WG1 A;  4K21 A;  2E7A A;  5JZG C;  4XQD A;  5H9R A;  1HQL A;  2OUH A;  1AYN 1;  2Y8K A;  4HET A;  4F83 A;  5KXB A;  2VCM A;  2XJQ A;  1UD1 A;  3OD0 A;  3ETQ A;  5T50 A;  1RUH 3;  4CDW A;  5CFD C;  1ZBA 2;  4KL1 A;  4UBG A;  5IAT A;  1SBE A;  1XRU A;  3KV5 A;  4MUV A;  4AOC A;  1PO2 1;  1XB9 A;  3AK0 A;  4WM8 A;  1DFQ A;  1ONA A;  5FYH A;  4BIS A;  3AMN A;  3P6B A;  4IE6 A;  1JZ5 A;  1U5I A;  4A41 A;  1G8W A;  2VZP A;  3PVE A;  2RS3 3;  2D40 A;  4PDW C;  4XAE A;  4W65 A;  1YI7 A;  3QBQ A;  3JBG 2;  4KWU A;  1LOB A;  2YG0 A;  3EXU A;  2AGS A;  5FP9 A;  4JGY B;  3E97 A;  5A32 A;  1BBT 3;  5HI0 A;  1AR8 2;  1O8S A;  2VOT A;  2GSY A;  3VD3 A;  3WNP A;  5FP3 A;  1MS8 A;  3A22 A;  1TMF 2;  5FUN A;  3DGT A;  5JMC A;  4PF1 A;  4NHM A;  1VAV A;  3ACF A;  3BPS A;  4Q8L A;  2Q8D A;  4AQT A;  2ZHM A;  2W39 A;  5BNO A;  2B45 X;  4ASK A;  2QTW B;  3HR9 A;  5DDJ 2;  4LKD A;  5BUV A;  2F17 A;  4QGL A;  1VIW B;  5LK7 B;  2J1S A;  1UU4 A;  5EP9 A;  3WP6 A;  4KG8 A;  2W5F A;  3AZV A;  3KCY A;  4QX7 A;  1G9B A;  1AHS A;  1OOP C;  2VEC A;  2VCB A;  3R4D B;  1CAV B;  1NCR A;  2EXI A;  1HB3 A;  4IXL A;  4FFI A;  2HYK A;  4QKD A;  2YFU A;  5F5A A;  3W9A A;  3SHR A;  3AP5 A;  2TBV A;  2OYZ A;  4NRQ A;  1PGW 1;  4Q8K A;  4ERO A;  1SQ4 A;  2JWP A;  2CSG A;  3H1Y A;  5LEK A;  4JHT A;  2XQX A;  1OHF A;  1V70 A;  4Q4X 1;  4BXS V;  4K1Y A;  2CY6 A;  4YPJ A;  3VBH B;  4BCU A;  5DXD A;  4DMI A;  1JUI A;  4LHL A;  3ON7 A;  1OT5 A;  1NE4 A;  4Q4V 1;  4M4P A;  4MVT A;  4LBK A;  2UWC A;  1ND2 C;  3Q9O A;  2VZ3 A;  4QT6 A;  2JDA A;  1CZT A;  3TNP B;  2W87 A;  1E5H A;  3AXD A;  1OKQ A;  2DF7 A;  3U0Z A;  1JMU B;  1WLC A;  4GWI A;  1H2M A;  1ZRD A;  4QPI A;  4CUB A;  3VZO A;  2XL9 A;  3U75 A;  3M8L A;  1EAH 1;  1MQT A;  2NYY A;  2GND A;  3Q8A A;  4A7Z A;  5FBJ A;  1W8F A;  2I07 B;  1S2E A;  2ZXQ A;  1UMI A;  2YGM A;  2JG8 A;  3WSO A;  4CCE A;  1K5M C;  1RXG A;  4OHW A;  4AI1 A;  4DZG A;  1GNY A;  2RS5 2;  5C8C B;  2Y26 A;  5JSR A;  4JAA A;  5DZG A;  4IEY A;  2E51 A;  3O0W A;  3ZN6 B;  3CJX A;  3WD5 A;  4IES A;  5EXO A;  5C5T A;  3J4U H;  5D2A A;  2VJX A;  3N36 A;  4IV1 A;  2GNB A;  1L7Q A;  2VOX A;  1MS4 A;  1DG6 A;  2VXR A;  2RS1 1;  3IDE A;  3K4A A;  4PCR A;  1CAW A;  1UZV A;  4ARX A;  2Q1F A;  3ZXG A;  1W28 A;  3KLS A;  2E9Q A;  4A44 A;  3THP A;  4ARY A;  4LO6 B;  4GMP 3;  5EQU A;  3WOG A;  5I0R A;  4HLT A;  4RHV 2;  2GAL A;  4Y5Z 0;  1UO9 A;  4URT A;  1HB1 A;  2A6V A;  2BNN A;  1X36 A;  1X8M A;  2JIJ A;  2VZT A;  3F95 A;  2EIE A;  3HN3 A;  3WQB A;  4E2Q A;  3HPN A;  3MBW A;  3TYJ A;  1HRI 3;  4IND A;  2Y0O A;  3TN9 2;  1GU3 A;  1YIF A;  4C90 A;  5FYB A;  4AI8 A;  1MEC 1;  4CDQ A;  1OQD A;  4NUB A;  5KC6 A;  5CYY A;  1LTE A;  1YQ5 A;  4NID A;  2VQT A;  2YC4 A;  4Y22 A;  1OPM A;  2E53 A;  2PTM A;  5L9B A;  2RDR A;  4UW6 A;  4BDV B;  3NV1 A;  1EPW A;  5F1R A;  1L7R A;  1SBF A;  1H8T B;  1WZX A;  3ORJ A;  5C3O A;  1DQ1 A;  1VBD 1;  1LED A;  4TTG A;  4HVQ A;  4ES8 A;  1PK6 B;  3QD6 A;  1VAL A;  4LUL A;  4QX5 A;  1JYC A;  1M4W A;  4Y4R A;  3VBF C;  3IPV A;  4NRP A;  1HN0 A;  4P00 B;  5FK7 A;  4BMB A;  2FCT A;  2A70 A;  3S5Q A;  2BJS A;  5FPA A;  1KS5 A;  3WHU A;  2DWR A;  4SBV A;  1HDK A;  3UJO A;  4XW3 A;  1XBF A;  1AR9 3;  2IXH A;  4FTB A;  2QKD A;  2VVF A;  2J42 A;  3U4S A;  3GBF A;  1V9U 2;  2W46 A;  1AXZ A;  1R08 3;  4HKL A;  1RVF 3;  4L99 A;  2P1B A;  5E1R A;  3B9C A;  3MIE A;  4QXK A;  4EZH A;  1GQP A;  4YFW A;  1DLL A;  1JBC A;  2RHP A;  2VXJ A;  3RGB A;  4ZZ8 A;  2VU9 A;  2FCV A; 
#chains in the Genus database with same CATH homology
 4E8D A;  5B4X A;  2J1T A;  3K4D A;  3LEI A;  2WZ8 A;  3HNY M;  3T2O A;  4MGS A;  3NRU A;  3DYO A;  4KMQ A;  5EJ1 B;  1CZV A;  2VMF A;  1KGY A;  4QX0 A;  5I0D A;  2J1U A;  1W8O A;  2KD7 A;  1XNA A;  2W1S A;  3I97 A;  4P08 A;  4JX0 A;  5JR2 A;  2QQN A;  3I3E A;  4BK5 A;  2WAO A;  2WN3 A;  3E1F 1;  4ZXE A;  1NX9 A;  3WF1 A;  3GGL A;  4L0P A;  5C7G A;  1CZS A;  5F7U A;  1BHG A;  3C7H A;  4RYD A;  3GXU A;  4OYU A;  4PQQ A;  4MO3 M;  3T0D A;  2WAB A;  2JKX A;  1UWW A;  2VM9 A;  2EIB A;  2WN2 A;  3OGS A;  3CDZ B;  3CZU A;  1UMH A;  1JZ3 A;  2VMD A;  2VZS A;  2W3J A;  1JYW A;  3UET A;  2QQL A;  3D3A A;  2RJ2 A;  3OGV A;  2ORZ A;  1CIY A;  4IUG A;  2CDO A;  5J1X A;  5C70 A;  4JHZ A;  2W1U A;  3T2Q A;  4Z2A A;  4OMC A;  2W92 A;  3NJX A;  2X05 A;  1T2X A;  2LS6 A;  1US3 A;  2Y6J A;  5C71 A;  1IQD C;  1UY3 A;  2WZE A;  4XUO A;  1UXZ A;  2YC2 A;  2WDB A;  4MAD A;  1SG3 A;  3OEA A;  3ZM8 A;  1J83 A;  3IAQ A;  3LEK A;  2J1E A;  5G04 L;  2W1W A;  2PQS A;  3ECQ A;  5A1A A;  2J7M A;  3SKJ E;  4DXT A;  1R64 A;  3III A;  2RV9 A;  3W5M A;  3VDA A;  3CZJ A;  4JKL A;  1H6X A;  3I2F A;  4W50 A;  3LPG A;  4P5Y A;  4XUT A;  3HEI A;  4UOJ A;  3VDC A;  1OF4 A;  1KEX A;  3CQO A;  3OGR A;  1SHW B;  1JZ7 A;  4OMD A;  2BZD A;  3WNM A;  4DUW A;  5JMO A;  1XNT A;  1F4A A;  4LKS A;  4XUN A;  2ZEX A;  4A45 A;  4QDQ A;  2ZEZ A;  3ETP A;  2WBK A;  4DUV A;  3MUY 1;  2CDP A;  4A42 A;  4XUQ A;  3IDA A;  3A7Q A;  2QQJ A;  1W9T A;  5EJZ B;  2RVA A;  2VCA A;  1JYX A;  3VD9 A;  5G05 L;  5JXH A;  4RN5 A;  3FN9 A;  4HG6 B;  4DXR A;  2XHN A;  1UY0 A;  1XPW A;  5HXM A;  1GUI A;  5EIY B;  1DYO A;  2VTF A;  2Y64 A;  2C9K A;  3T09 A;  4DXS A;  1ULP A;  2VQU A;  2J1R A;  3I3D A;  5DPN A;  3UES A;  4D8M A;  2W94 A;  1UZ0 A;  3WF0 A;  2W1Q A;  2DCJ A;  2W47 A;  1TG7 A;  3FL7 A;  3NQH A;  3OG2 A;  4QAW A;  4XVH A;  3HOB A;  3IAP A;  2W91 A;  3PUI A;  3OBA A;  5IHR A;  2X09 A;  3WF3 A;  1PX4 A;  3MV0 1;  4QDR A;  2WAA A;  2LW8 A;  5IJR A;  5JXG A;  1W0N A;  2ZEW A;  2VZV A;  5CZK A;  2J22 A;  3BN6 A;  5DMY A;  5IYY A;  2B9V A;  5LA2 A;  2W9X A;  4KI5 M;  2VC9 A;  3DYP A;  2E26 A;  2Z4F A;  2VCC A;  4OUE A;  4UAP A;  4CUA A;  4D0Q A;  2E31 A;  3K75 B;  2VO5 A;  3C7G A;  4LQR A;  3ACH A;  1YQ2 A;  1P8J A;  3VD5 A;  1EUT A;  4JKK A;  5IFP A;  5HPO A;  4GZ9 A;  3EB7 A;  1JI6 A;  3SEE A;  2XOM A;  4BJ0 A;  1EUU A;  2W95 A;  3LQC A;  3I2I A;  4MGQ A;  1K3I A;  5B4N A;  2VZR A;  1GOH A;  4QX1 A;  3PUH A;  4QDS A;  3K46 A;  1F4H A;  2WO3 A;  1W9S A;  2QBX A;  1OF3 A;  5LA0 A;  2E32 A;  4TXW A;  3MO4 A;  2WUH A;  4MOA A;  1UXX X;  2ZEY A;  4QB1 A;  5IFT A;  1H6Y A;  3WF2 A;  2J1V A;  2E33 A;  1UX7 A;  1UYY A;  3VDB A;  4ZZ5 A;  2V4V A;  2VZQ A;  3NJV A;  3WNL A;  1UYZ A;  5JXI A;  2V5D A;  2YB7 A;  2WYS A;  2BGP A;  2HLE A;  3HNB M;  4P02 B;  5JXJ A;  4CU7 A;  4ZY9 A;  3WF4 A;  1D7P M;  2BBA A;  3C7E A;  3HNM A;  3HJR A;  2XON A;  3J7H A;  2JD9 A;  4CVU A;  3WEZ A;  1UY1 A;  1JZ4 A;  1UY2 A;  2R7E B;  1K45 A;  3T0B A;  3VD4 A;  4AAX A;  3WNO A;  4A6O A;  2X10 A;  3A23 A;  3IB3 A;  4A4A A;  2YFZ A;  3LEG A;  4CU8 A;  3T2P A;  2VZO A;  2JE8 A;  3ACI A;  3K77 A;  1GOF A;  3K4Z A;  1DLC A;  1I5P A;  1US2 A;  3ABZ A;  1OD3 A;  1UY4 A;  1W99 A;  3F2Z A;  4XZU G;  1HN1 A;  3I2K A;  4W8J A;  4AG4 A;  2QQI A;  2VL4 A;  4PT6 A;  1JU4 A;  4BK4 A;  3THD A;  2Y6H A;  1K12 A;  2ID4 A;  5JUV A;  5DQ0 A;  2QQO A;  2Y8K A;  2C4X A;  2VZU A;  1GMM A;  3WNN A;  3LPF A;  2VZ1 A;  3FHA A;  4XUP A;  5FUI A;  3VD7 A;  1NUK A;  1O59 A;  3T0A A;  3P6B A;  1JZ5 A;  4A41 A;  2VZP A;  4M4R A;  1RYY A;  1J84 A;  1JU3 A;  1NKG A;  1PMJ X;  2C26 A;  4KWU A;  2WO1 A;  2YG0 A;  4ET7 A;  3MV1 1;  1JYV A;  3ACG A;  4JKM A;  3LE0 A;  1O8P A;  1O8S A;  2VOT A;  3C7O A;  2ORX A;  3VD3 A;  3WNP A;  4CU9 A;  3A22 A;  4PF1 A;  3CKH A;  3WNK A;  4E8C A;  4CUC A;  3ACF A;  1UYX A;  1SDD B;  2J1S A;  3CMG A;  3BGA A;  2W5F A;  4OZO A;  2B4K A;  2VCB A;  2DCK A;  2BER A;  1K42 A;  2YFU A;  3FHQ A;  3T08 A;  1JZ2 A;  1W9W A;  4LPL A;  4DUX A;  4XUR A;  4DEV A;  2XQX A;  4BXS V;  2QQK A;  4YPJ A;  3OEB A;  1OT5 A;  4M4P A;  2VMC A;  3GM8 A;  4FI9 A;  2VZ3 A;  2Y6L A;  4DEQ A;  2JDA A;  1CZT A;  2DDU A;  2W87 A;  4QX2 A;  3U37 A;  4GWI A;  3THC A;  4CUB A;  1XC6 A;  4CU6 A;  2V72 A;  3SKV A;  3OB8 A;  2ZXQ A;  2QQM A;  1LNS A;  1UMI A;  3DEC A;  4QB6 A;  3WSO A;  4W4Z A;  1GNY A;  1JYN A;  3SEP A;  2BGO A;  3UNP A;  1OH4 A;  3AC0 A;  1JZ6 A;  2Y6K A;  2WQ8 A;  2VJX A;  1MPX A;  1L7Q A;  3P1I A;  1W8N A;  3W5N A;  3K4A A;  3DYM A;  4ARX A;  1JZ8 A;  2Y6G A;  2EIC A;  4A44 A;  3MUZ 1;  4ARY A;  4UI9 L;  4QPW A;  1DP0 A;  2L9L A;  4QX3 A;  5LCW L;  2VZT A;  2EIE A;  3HN3 A;  3WQB A;  4GWJ A;  3HPN A;  3I3B A;  1NAE A;  2WO2 A;  3MBW A;  4LHS A;  1GU3 A;  3A21 A;  1CX1 A;  1PMH X;  1PX3 A;  5CYY A;  2VQT A;  2YC4 A;  3GDB A;  4BDV B;  3JXS A;  1L7R A;  3NNG A;  4QB2 A;  2OKX A;  4TTG A;  4A3Z A;  1ULO A;  3EYP A;  3I2J A;  4P00 B;  1JHJ A;  3C7F A;  1WKY A;  2EID A;  2HYX A;  3CIH A;  3I2G A;  2W46 A;  2VR4 A;  3C8X A;  3I2H A;  5DN2 A;  5LA1 A;  2VME A;  2J1A A;  1TVG A;  1GQP A;  1GOG A;  4ZZ8 A;  1WCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...