2J1UA

Structure of a streptococcus pneumoniae fucose binding module in complex with the blood group a-tetrasaccharide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
141
structure length
141
Chain Sequence
KFNDGNLNIAYAKPTTQSSVDYNGDPNRAVDGNRNGNFNSGSVTHTRADNPSWWEVDLKKMDKVGLVKIYNRTDAETQRLSNFDVILYDNNRNEVAKKHVNNLSGESVSLDFKEKGARYIKVKLLTSGVPLSLAEVEVFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOLECTIN-RELATED PROTEIN
publication title Blood Group Antigen Recognition by a Streptococcus Pneumoniae Virulence Factor
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Carbohydrate-binding protein
total genus 40
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2j1uA00
3FHAA 1JZ2A 3ACFA 3ECQA 3P1IA 2HLEA 5IJRA 3C8XA 2BBAA 4CU8A 1W8NA 1JYXA 2X05A 4PQQA 1W99A 1L7RA 4A4AA 1F4AA 3LEGA 2XHNA 3OGSA 2R7EB 4CVUA 1EUTA 3A22A 1P8JA 3CIHA 1KGYA 3WNNA 1UMIA 2L9LA 1GMMA 2QQJA 5C70A 2EICA 1GNYA 5DQ0A 3OEBA 3BGAA 4KI5M 2WABA 3MV01 3WF4A 2VTFA 2W1SA 1H6YA 2QQKA 5LA2A 2VQUA 2WZEA 2PQSA 2VQTA 3NJVA 3I2HA 2W46A 4DXSA 3CMGA 3VD4A 5B4NA 1J83A 1H6XA 4QDSA 1JI6A 2WZ8A 3I2IA 3T2OA 2C4XA 5FUIA 3VD7A 2C26A 5IHRA 4RN5A 2VZ3A 5LCWL 3DYOA 1D7PM 4QDQA 1L7QA 2WDBA 2W91A 1UYXA 4MADA 3K4AA 2ZEZA 4W4ZA 4MOAA 3WSOA 2OKXA 4DXRA 2RV9A 2VMCA 2YFUA 2WO3A 3LE0A 2J1SA 1JZ5A 2BERA 4YPJA 1NX9A 4BJ0A 2CDPA 4W50A 1JZ7A 4DEVA 4P02B 2W1WA 1CX1A 1K12A 1T2XA 2W87A 3VD9A 3T2QA 2W3JA 3P6BA 3ACGA 2VZSA 3VDBA 1RYYA 4ET7A 4CUBA 3T08A 4CU9A 1W9WA 1OF4A 2LW8A 2VCBA 4JKLA 3HNYM 3I3EA 3DYPA 3W5NA 3HOBA 1JU4A 3I2FA 5C7GA 3HN3A 4QX0A 2E26A 2QQMA 2J1EA 4A42A 3C7GA 3UESA 2W92A 3NJXA 4OUEA 1O8SA 2VZUA 2ZEXA 1WKYA 5I0DA 1JU3A 1W9SA 3WNKA 1ULPA 2VZVA 3WNLA 2J1UA 4QB6A 3OEAA 4UOJA 3GGLA 2YG0A 4GZ9A 2WQ8A 1JHJA 1CZVA 2JKXA 2ORZA 5DPNA 3WF1A 1ULOA 4BXSV 2YFZA 2DDUA 1YQ2A 3OB8A 3VDAA 1DLCA 2VZRA 5EJZB 2QQOA 4ZZ8A 2VJXA 2W95A 1K45A 4ARXA 4QB2A 3MV11 4MGQA 4MO3M 3I2JA 3T0BA 2X10A 2Y6JA 4DEQA 3ZM8A 3HJRA 2W47A 1PX3A 3DECA 4E8CA 2J7MA 3FN9A 5LA0A 2WUHA 2ZEYA 1UMHA 4A41A 2ZXQA 2Y64A 4IUGA 3WNPA 4QPWA 2XOMA 3LPFA 5C71A 1UY0A 1I5PA 1PMHX 2VMFA 4JHZA 3K77A 2VMDA 1US3A 2WN2A 3LEIA 1JZ3A 3WF2A 4XUTA 5EIYB 4P08A 4A3ZA 2BZDA 2W1UA 4P5YA 4HG6B 1UY4A 4L0PA 3WF0A 3MUY1 3HEIA 2J22A 3T0DA 2JD9A 3ACIA 2VC9A 1GU3A 2YB7A 2WYSA 5HPOA 3A21A 5JXGA 1JYNA 3VD3A 4CU6A 4OZOA 2EIEA 2W9XA 4DUVA 2HYXA 5EJ1B 3K4DA 2W5FA 3CZUA 4D0QA 5IYYA 1K42A 3I2GA 3HPNA 4AG4A 5IFPA 1W8OA 3UNPA 2VCCA 1OD3A 4DXTA 3MBWA 2VZ1A 5JXHA 4TXWA 4A44A 1CZSA 4CUAA 3BN6A 4KMQA 4XURA 3U37A 3VDCA 2V72A 1PX4A 3A7QA 1JYWA 2VZPA 2XQXA 5LA1A 4A45A 4RYDA 4DUWA 2RJ2A 3T0AA 3THCA 2VMEA 4Z2AA 3LPGA 2J1RA 1JZ4A 1O8PA 5B4XA 4LKSA 3DYMA 1GOFA 3WQBA 3OGRA 1CIYA 2J1TA 1JZ8A 3OG2A 3C7EA 1XC6A 3OGVA 3W5MA 3PUIA 2BGPA 2YC4A 5IFTA 3NQHA 2QQNA 3SKJE 5A1AA 4QDRA 4TTGA 2V4VA 1UYZA 3GDBA 3LQCA 1NUKA 4JX0A 1KEXA 1UXZA 2DCKA 1UYYA 2EIBA 3JXSA 4FI9A 3C7OA 3MUZ1 2VM9A 2XONA 1WCQA 2E33A 4M4PA 2E32A 1BHGA 4MGSA 4UAPA 4LQRA 4XZUG 1GUIA 2QQIA 1IQDC 3T09A 3CDZB 4E8DA 2Y6LA 5CYYA 2WAOA 3PUHA 3K75B 1F4HA 3ETPA 4PF1A 1O59A 1R64A 2VZOA 3I3BA 2ZEWA 2YC2A 4M4RA 4ZY9A 5G05L 4DUXA 2Y6HA 3GM8A 4OMDA 1UZ0A 4XUOA 5G04L 4XUPA 3VD5A 1XNAA 3SEEA 5JMOA 2WBKA 3IAPA 3HNBM 3WEZA 1OT5A 1HN1A 2Y6KA 2B9VA 3C7HA 3IIIA 2VCAA 5CZKA 1CZTA 2VZQA 1GQPA 4AAXA 5DN2A 3WF3A 4CU7A 1UWWA 1EUUA 4BDVB 2KD7A 3THDA 4XUQA 2RVAA 1K3IA 5DMYA 1DP0A 5F7UA 2V5DA 3HNMA 1NKGA 2VR4A 2WN3A 3IB3A 2Y8KA 2JDAA 3WNOA 1UY2A 3LEKA 5JR2A 3NNGA 1NAEA 2VL4A 4QB1A 4BK5A 1UY3A 1OH4A 3I3DA 3ABZA 4W8JA 1DYOA 1TG7A 2J1VA 5J1XA 3I97A 4ARYA 1SHWB 4JKKA 3T2PA 1UXXX 2LS6A 3IDAA 2Y6GA 3SEPA 3I2KA 3OBAA 4PT6A 4CUCA 3K46A 4QX3A 4UI9L 1SG3A 2EIDA 2C9KA 1GOGA 1JZ6A 1J84A 5JXJA 1OF3A 2WO1A 4QAWA 3UETA 1SDDB 3FHQA 2WO2A 3AC0A 4LHSA 3E1F1 2Z4FA 3F2ZA 4LPLA 4QX2A 3CQOA 2VOTA 1MPXA 1XPWA 3K4ZA 3GXUA 4BK4A 3CKHA 3IAQA 2ORXA 5JUVA 2X09A 4JKMA 4D8MA 4OMCA 2W94A 3FL7A 5HXMA 3EB7A 1JYVA 2QQLA 1UY1A 3SKVA 5JXIA 4OYUA 4P00B 1W0NA 2WAAA 3WNMA 2QBXA 4ZZ5A 4XVHA 2JE8A 3D3AA 4GWIA 4XUNA 2BGOA 3A23A 4QX1A 2VZTA 4GWJA 2J1AA 3MO4A 1US2A 2W1QA 1W9TA 2E31A 1UX7A 2VO5A 3CZJA 2CDOA 1TVGA 2DCJA 3C7FA 2B4KA 3NRUA 2ID4A 1GOHA 1PMJX 3ACHA 4ZXEA 3EYPA 4A6OA 1LNSA 3J7HA 1XNTA 4KWUA
chains in the Genus database with same CATH superfamily
3THTA 1TME3 1U12A 3FHAA 2GAUA 1U5ZA 2PELA 2D5HA 3ES4A 5CFDC 2GN3A 1AYM2 3VBSA 4R52A 4H14A 2RM23 3ZSLA 1DQ2A 4Y33A 1W8NA 1JYXA 1AR73 3O5SA 5J09A 1QKQA 1UU5A 5FZBA 5KHIA 4NN0A 1H30A 1OC1A 1C5IA 2Q5TA 3JZVA 3S5QA 5FZ7A 3W21A 3HMYA 1JH5A 4OI2A 5FP9A 4RQPB 1D4VB 5FYSA 4EN6B 1EUTA 1V00A 3A22A 2JG8B 2ZS6B 2PAMA 3ASIA 3WNNA 5EP9A 4HPKA 1E57A 2BP6A 5F2WA 4EV0A 2UU8A 4I09A 5EFUA 1VMFA 2XDVA 3IPVA 2HEVF 2GMMA 3CU7A 1VRH2 3NV2A 5CISA 5C70A 4HBNA 2E53A 3AMHA 1WLCA 1GNYA 1MEC3 2WO7A 2BUKA 3BGAA 5FZ8A 2ADEA 1RUH1 2VH9A 3AP6A 4HONA 4NUBA 4P9XA 5BNOA 2W1SA 1DGRA 1GNHA 3LSDA 5T55A 2WWUA 5B2GB 4V1PA 2GNTA 4MGTA 2RS33 2PQSA 3ZKYA 1FAYA 1RHI1 2W46A 3E6BA 1HRV3 1SBEA 1V6JA 2AH2A 4FT8A 3PURA 5LK5A 4DXSA 1ND3C 4QDSA 5FOJB 3UGHA 1AYN1 2ZPXA 2Y26A 2WZ8A 3OBRA 4DY5A 4Y22A 3MIEA 1TEIA 1VBD1 5FYBA 4FTBA 1PO12 3RMYA 2WZR2 4LULA 3VBHA 5IHRA 3AMQA 1ACCA 1QGLA 4FCAA 3DF0A 4AVBA 3ON7A 1XBFA 1QJU3 1S0BA 2OW4A 2PLV2 5C3PA 4YG3A 4IV3A 5I0SA 2VVDA 3EQEA 3KD4A 4JTOA 4L99A 3MLKA 1DQ5A 4CXWA 1RMU3 2DF7A 2WC2A 1DDLA 1SPPB 1BVP1 2YFUA 2YGLA 3H8UA 1LOBA 1RGSA 1NLQA 4UF0A 1XE7A 5FMCA 4AE2A 1QJX1 1JZ5A 5C5UA 1W9YA 3RMXA 1W9FA 5F6KA 3BCWA 4RQPC 3MGUA 1FPN3 2QTWB 4J1XA 4XC9A 4DEVA 1GWKA 2W1WA 2UWCA 1HB2A 3OY8A 2JG8C 3PVBB 4S2GA 4XOGA 5FQ0B 4BLJA 1YFUA 4AHXA 3WG3A 1AL0G 1OVPA 3M7AA 3OJBA 2D97A 1HB3A 3ITQA 5A6YA 1OBNA 2ETEA 3WDVA 4QX5A 2VZSA 2Q30A 1W90A 1RYYA 3KHCA 1OLMA 2QVSB 1KS5A 1KD7A 3DEMA 2NLRA 3VL9A 3ZXEA 4CUBA 2DUPA 4DRVA 3U4XA 2OQ7A 5LA9A 3MIFA 2GP3A 4AHYA 4LHNA 4AK3A 4P14A 3I3EA 3J9SA 3SH3A 3Q8AA 3LEMA 2XUEA 4YLZA 4KL1A 5FAXA 3I2FA 3OBTA 5FV3A 3MHZA 3U1XA 2ZA9A 4AGRA 1CAWA 1OSGA 1R082 2VXJA 1EAH3 1W2OA 5L7OB 4QGMA 5DDJ3 2FCUA 4B29A 2QQMA 4WVZA 2NMOA 4CEYB 3NKGA 4Y20A 3TRSB 1BMV2 2QJVA 2BFUL 1I5ZA 3ZPOA 1IQAA 2EAAA 3I8TA 4XBNA 1NCQB 5ABJB 2JDNA 3SISA 1WKYA 4S2HA 4N8MA 3PVOA 1GZWB 1OKOA 3UK9A 3IT8A 5I0DA 1Y43B 5HCBA 1ULPA 3E5XA 2RHPA 4PLMA 2GC0A 1Y4WA 4DXZA 1VBE2 3RFRA 2XPJA 4RA0A 3OEAA 3UKTA 2JJ6A 3I49A 2YG0A 4OHZA 2WA4A 2ARXA 1KXGA 1NE6A 2JDYA 2OIIA 3IDCB 2I07B 1C5HA 3O1PA 5KR7A 2JKXA 3RZLA 2PA7A 5DPNA 3V64A 3AKSA 2ZCWA 1DLCA 4MV2A 5EJZB 2QCSB 4FPCA 2YROA 2RS52 4Q0VA 4YW6A 3VDDB 1JW6A 4ZZ8A 4L8QA 1NCRB 4GMP1 4HSJA 4QB2A 3FHIB 2PHXA 4MGQA 4QU2A 5FKCA 5FKBA 3OF1A 2HWD1 3SCGA 3USSA 3WP3A 1RUD2 2OYZA 3OTFA 1CJPA 4CCMA 1D0GA 1ZZ9A 2IXIA 2WZR3 2VOVA 3ZM8A 2Z5WA 4E8CA 2J7MA 2VU9A 4FTEA 3NNMA 1YYNA 4C8DA 2PLV3 3JD72 2G1MA 4CCLA 3NNLA 3JU9A 4XABA 2ZXQA 2Y64A 5L73A 4XXAA 2BTVC 2XOMA 3LPFA 1UY0A 2R072 5L7OC 2B9UA 3RYKA 1GQHA 3VBRB 4CEYC 1W2TA 2MHFA 2R0FA 1DG6A 3KGLA 4QPYA 4B8EA 5C3RA 2JG9A 3OSDA 2BZDA 2P3JA 4KWLA 2CTVA 4Q2FA 1W6QB 4HG6B 1QOTA 1NCQC 4NR1A 4UW3A 3WF0A 5ABJC 3W58A 3RYPA 2JENA 3HEIA 2R6QA 3ACIA 5FTTC 3V65A 3QH7A 4JRAA 5FZAA 4X8PA 1LOEA 3KVBA 3ZYHA 2BWCA 2WNVA 3ROUA 1UOGA 3T2TA 3V0BB 2ZX1A 1RUJ1 3M3CA 3VD3A 2ZACA 4QQOA 4RGGA 2PHTA 3KGZA 1V6MA 3RZZA 4N9IA 4DIQA 2D6LX 4YFZA 2DFBA 3IWZA 4DNYA 1H2KA 4NAOA 2QZ2A 4ASLA 4URAA 1Y9GA 3CZUA 2HBTA 1CD3G 2ZGPA 3I2GA 3VDDC 4AG4A 4XMIA 5FYHA 3MFAA 1YO8A 5FP4A 3WG4A 1NCRC 1NXMA 1VBB1 1PIV1 1ND2A 4P9IA 2E63A 2VZ1A 3DPRB 5ACA3 1QXRA 1PO23 5JXHA 2UURA 3NV3A 1XYOA 4HSLA 3WHTA 5IK7A 1WGPA 4KMQA 3UYJA 2VNGA 1FMD3 5FY9A 5CAZA 1WW7A 3S7IA 5M0TA 3KF3A 4YM1A 4UW5A 1PX4A 4GD4A 1X8EA 4DRRA 3PUQA 4XCBA 5BUVA 2VZPA 2XQXA 2RJ2A 1MS9A 2A6WA 1VBE3 2F17A 3MW3A 1RINA 3WW3A 5FYYA 4D6SA 1C57A 2O1QA 4E4ZA 2D98A 3VBRC 2J1RA 3ZXKA 5FPXA 1BEV3 1RUC1 2RS13 3QACA 4FOQA 4ASKA 2C1FA 4FPKA 1ZBA3 3LDRA 3WQBA 1CESA 1R1ZA 3IMMA 2GNBA 1AVBA 4AVAA 5FPVA 1FNZA 5ISLA 4BZ4A 2PFWA 4GXLA 2ARCA 4XFBA 4GKYA 1RUD3 2QQNA 4WVVA 4CDWB 3SITA 3B69A 1EV12 1S0IA 2PAEA 1SDWA 4QDRA 2WLQA 3ZFEA 1VRBA 2AACA 1S2KA 1RHI2 5FO7B 2CHHA 4AFMA 4NRQA 1X33A 1NG0A 1NUKA 4LO8A 4PQ9A 4CP1A 1UYYA 1UQXA 1AYN2 1Q8QA 2JDHA 3VB9A 1SPPA 1RUE3 3G6JB 3ZSMA 3WNXA 1DU3D 1YC61 4QWNA 2EXIA 4Q0PA 2AENA 2XLAA 1YFYA 2H0VA 4LIVA 4UAPA 4DUXA 1RUNA 4XZUG 1TME1 4CP0A 1GUIA 2F4PA 5D2AA 4W6YA 3T09A 3VBFB 3WQ7A 4PIZA 5HCFA 5IVVA 2ZZJA 2VW2A 4GAZA 1DQ6A 4E8DA 4CRQA 2JDPA 3ZN5A 2RM21 5LEKA 3KT1A 1H4HA 1JUIA 2R063 1F4HA 1AR71 2W2IA 3CBNA 3D5OA 1ZX5A 3RZHA 5KHJA 4GWMA 1AR83 2VZOA 4WM8B 1QJX2 2CSGA 3VBOA 1PVC3 2YC2A 1ZRCA 2W08A 2C6SA 1OPMA 2IFWA 4K20A 1TNRA 1YJKA 4AEMA 3KT7A 5G05L 1H9WA 1FT9A 4XF3A 4LLOA 1PVXA 2OUHA 2GC1A 4JZRA 3GM8A 4XQWA 5E8AA 1IKQA 1W8HA 1GWLA 3ILRA 1D2SA 1UZ0A 1Q43A 2SLIA 5G04L 5LY2A 5F39A 2O0OA 3DN7A 1W6PB 1D2QA 1XNAA 2YGMA 4UFIA 2HWC2 4KWKA 5K0UB 1MEC1 1UKRA 2WBKA 3IAPA 4ISQA 2WFPA 3HQUA 3HNBM 1A8DA 2HWB3 2XMLA 3HIFA 3WEZA 4Y24A 3WG2A 4YGCA 4C1XA 4IE5A 1W2NA 1HV1A 4CDWC 5ABJA 2OA2A 2B9VA 3VZKA 5CVRA 1GZWA 5IW0A 4CTEA 3D0SA 3KF5A 2RS31 4R9CA 3TYJA 1TQ5A 5KHGA 2BNNA 2XBO1 3JBG3 1GQPA 1HRV1 4HN0A 4AAXA 2BQPA 3FLPA 1CVNA 5DN2A 3WF3A 3U75A 4CU7A 4BDVB 4FPYA 5FZOB 4AFBA 1RTVA 4LBLA 3H8OA 4CCOA 2OQ6A 1CAVB 2GH2A 4XUQA 3TOJA 4E4DX 2P6CA 5L36A 3K48A 1ULFA 2Q8EA 5FPBA 1PK6A 2VTXJ 3I2DA 4BM8A 3NV4A 2QQUA 5FMDA 3LA2A 1BCXA 2V5DA 5GZCA 3CJXA 1AXZA 1ZRIA 1QJU1 3VDDA 3TEWA 5JSRA 3VBFC 2DCYA 2H6CA 3OUIA 3BU0A 2Y0OA 3I3QA 2EXHA 3J26N 5BYNA 1VAVA 4JGYC 4BQ5A 2VR4A 4Y5SA 4PDWC 2WN3A 4KH9A 5DUWA 2JDZA 4QPGB 3ZN6B 2Y8KA 4A7KA 1APNA 4FPOB 3T1MA 3UT0A 4YSFA 1CR7A 3WHUA 2I45A 3DL3A 4GH4B 4LMFA 3LEKA 5JR2A 1UNBA 1JBCA 3ZFGC 4B1LA 1HQNA 1YXWA 3BYWA 4YG6A 1J1LA 1OH4A 3I3DA 4YM2A 1ZBE3 4W8JA 1FPN1 4K6BA 5I91A 1OOPC 3I97A 5J1XA 4XF9A 1N1TA 1QJFA 2RJLA 3F95A 4FVVA 3SEPA 2I74A 3VKFC 5SV5A 3KMHA 5F3IA 3S30A 3OGJA 1NQJA 4MX3A 4PT6A 3T1LA 3TEXA 2MEV3 1SG3A 4HZFA 4D7YA 5K0UC 1W6MB 4ONUA 3GJBA 1JZ6A 4E4HA 1W6QA 2WO1A 3NL1A 1YQCA 5DZFA 3WQ1A 1AYM1 1SDDB 4FFHA 1QJY3 5C4WC 5FZ3A 1WBLA 5LB6A 4NHXA 1XNKA 2ZOEB 3EBRA 1EAH1 2WO2A 3V0BA 4LHSA 5DDJ1 1F5FA 1F5JA 3PUSA 1AJKA 2EXJA 4L92A 4PLNA 4LPLA 4H2AA 3AZWA 4Y1ZA 3POSA 4ES8A 4M0NA 3RWKX 4N90A 5IK5A 4CYDA 4DZGA 1AXYA 4BK4A 2VBBA 4GQ7A 1QXJA 2R1BA 1RL3A 3VLBB 2VW1A 3CKHA 3AX4A 3IAQA 2ZHMA 1DZRA 1LEMA 5JUVA 1RUJ2 1W28A 5EQUA 3CL1A 4QPGC 3UV9A 4D8MA 3DPRA 4E2QA 3BOPA 3AK0A 2HWC3 1T6BX 2LROA 2RJKA 1FOD3 3AVSA 3LSEA 1PGW1 3NV1A 1DIWA 1LOFC 4HLTA 4URTA 3RPQA 3LGRA 4GH4C 2DVGA 1BZWA 2FDGA 5FXXA 1OLRA 3EB7A 5EYXA 5FJHA 5GLWA 1JYVA 5JXIA 2HH9A 2GDFA 4D6RA 2DBIA 2ZHNA 3BU7A 1XU1A 4HPKB 2X8KA 1J1TA 2DUOA 1UZZA 3S7EA 3WW1A 2Q1ZB 4AVVA 2LALA 3H8RA 2V09A 4TSVA 3IPVB 2OVUA 2Q4SA 2WKKA 2WLPA 4IEWA 1ZRRA 3QLQA 4FP2A 4QX1A 4B7KA 3ZIWA 2VW0A 1W9TA 2G9ZA 3BODA 3M8LA 1PO11 1ODMA 5BNOB 4X8NA 5FY4A 2WZR1 4XFGA 2QKDA 2BNOA 3NWKA 5FLIA 5CB7A 4LO5B 1V6OA 4FAHA 4FFGA 3JUUA 4AEDC 3JQWA 5IVYA 3R6SA 4Q26A 1WD4A 2ID4A 4QHZA 1EP0A 2PLV1 4BMEA 1PMJX 1W8WA 1SFPA 2D6PA 2DU0A 1SLCA 3SC7X 5KHKA 1W2AX 4CDWA 1MZFA 5AFBA 2D6OX 4O7XA 3ECQA 2IXHA 1H1MA 3FWEA 1XYPA 3M4FA 4EWDA 2G9GA 1NLSA 1W3XA 5GLUA 2NN8A 3MIGA 3MIBA 4I0AA 2CGNA 2D7FA 3HR9A 3RZMA 1L7RA 4IV3B 4I0BA 1EPWA 1XSRA 2NQYA 5BNNB 5J7MA 3VBSC 2XHNA 1ZVFA 4RHV2 3RI9A 2AREA 4MG2A 2R7EB 4CVUA 3HQXA 3DXUA 3NMBA 2GALA 3VHNA 4NAMA 3BIWE 4CDUB 1M4WA 4Q8KA 3PNAA 3T4HB 4B4PA 3CIHA 1CPNA 1UMIA 3O1RA 1QOSA 1QH7A 2JDMA 1GLHA 1LTEA 2R16A 1GMMA 2ZGKA 3AM2A 2VUAA 2Y0IA 4O9EA 1GQGA 4H55A 4FPFA 4LA2A 4XJUA 4Q4Y3 3RNSA 5FY7A 1O3QA 4PI2A 4BYYA 2E6VA 1TZOA 2BGCA 4XFAA 2EICA 3E5UA 2X29A 2G4IA 2BYVE 3ST7A 4Z92B 4WM8A 3SXWA 2GP5A 2WABA 5CKQA 3O14A 1GKBA 1F9KA 1TME2 4JV4A 1H6YA 2QQKA 3AXDA 5DUVA 2CWMA 2ZTNA 2XXZA 5LBBA 5LA2A 2XL7A 5ACA1 1NA1B 2K0GA 1RUG3 1PO21 2RM22 3I2HA 5BNOC 1BMV1 4Z07A 1AR72 4IGOA 1J83A 4WM7B 1MS3A 4GB33 1QNYA 1H6XA 3VKOA 4Y3OA 3PDQA 3HBKA 2J42A 2C4XA 4K8RB 2MPFA 4HKWA 4EYUA 5GLTA 3J4UH 3MF6A 4Y1XA 3WVJA 4COYA 1GSLA 2HWE3 1I3HA 2P4EA 5FYIA 1UPIA 2YU2A 2ZGQA 5CKNA 1VBE1 5L9VA 1AL23 3DYOA 1CX4A 2JD4A 1A6CA 2WDBA 2QZ3A 1QF3A 1UIKA 3GZTB 4XETA 4YRDA 3VBHC 2ZMKA 1X8MA 1BEV1 2RS11 1DGWX 3LWCA 3Q8CA 5T5OA 1ZBA1 1XYNA 2OS2A 2VMCA 1EPZA 1NQDA 2BVBA 3N9PA 4TLGA 5E6HA 3BOWA 1MEC2 4IV3C 5E89A 2J1SA 3I54A 1CAVA 5H9QA 2WQ4A 4YPJA 4LK6A 3SH4A 1H8VA 2W39A 4YG0A 4AQ6A 1OKQA 3GF6A 4UYBA 3K3NA 1RUD1 3N36A 3VHRA 3ZDSA 2P2KA 4NROA 3POGA 1UZWA 1O91A 1HRV2 2PAKA 3EXUA 3U10A 4LBQB 3VD9A 5FLHA 4XF1A 3P6BA 5DAVA 4QPGA 3ACGA 3ZN6A 3VDBA 5BV6A 1RUE1 2AEYA 4XJWA 3POFA 3LA3A 1G9CA 1RVF2 2JIGA 4Y5TA 4BQXA 1JYIA 1VR3A 3WP4A 3BUCA 2DURA 1DCSA 2RR13 3FFQA 1QJU2 3HNYM 1N47A 4JQRA 4JKLA 3DYPA 4NPLA 4RGKA 5LBEA 4OI1A 5FYMA 1MZ6A 5B4NA 2G9FA 3W5NA 1B35B 1JU4A 4AVTA 4NOTA 5LRRA 5DUXA 4ZKTB 4IEVA 4Q4X3 3B01A 4UFMA 4J25A 4LIUA 4XFHA 1GP4A 1RMU2 5C7GA 3HN3A 4QX0A 4WM7C 4FQZA 1M06G 2E26A 3J8F3 1C1FA 3UESA 1X82A 4YGBA 3WX5A 4B7EA 5A3TA 1WMFA 1PGL1 2EA7A 3NJXA 1W6OB 1CPMA 1R1A2 2B8MA 4AHZA 4CSWA 1IS6A 1FPN2 1O8SA 4HK9A 4Y5Z0 3NVCA 4YW7A 5FZLA 3LFMA 4ATFA 1REDA 2ZAHA 3WNLA 3JB4C 3O12A 4IEPA 4C1WA 3FMGA 2JKBA 1ENXA 2NMNA 4QB6A 3IKWA 3POJA 4UOJA 5EJ3A 5HI0A 4V2VA 5C8WA 4IV1B 4CCDA 5GJ6A 2XWJB 4LBOA 1VAKA 3PVEA 5KXCA 3WF1A 2WNVB 1S0EA 2YFZA 4XQ4A 2DDUA 2WNUB 1YQ2A 4IL7A 1LOGA 4M3CB 2HWB1 1J3PA 2PHUA 4Y1YA 3I2OA 4MZUA 1BK1A 2VJXA 4EZ4A 2OT7A 5FMOS 5I0TA 3ZX7A 3KWVA 5JSOA 3RZKA 2YXSA 4J1WA 4NIAA 3VKMA 1O4TA 1MVEA 1QEXA 1EAH2 2I2SA 1WW6A 2XQRA 4LOTA 4MO3M 3O0WA 3JBG1 5ANNA 4FXKB 4LK7A 3HT2A 3IN9A 5DDJ2 2Y6JA 3THPA 3H42B 4DEQA 3O1VA 4L2NA 1S4CA 5CFCB 4NHMA 1O5UA 3D8CA 4LE4A 3FN9A 2BNMA 3EHKA 5CKMA 5LA0A 2R0HA 1ND2B 1GP5A 4B4RA 4D3WA 5A3LA 3TEYA 2ZEYA 3E6CC 1W03A 4BB3A 4H7MA 1JOBA 1IZ3A 3ES1A 4XDPA 1T6GC 2O8OA 3WNPA 3GCXA 4QPWA 1I5PA 4YGDA 5C8CB 2DTYA 2KA3A 2VMDA 1LHOA 4ZU7A 4MVTA 1PGW2 1VAMA 4P5HA 1RB8G 4A3ZA 5FRAA 1AF9A 3ETQA 1LGNA 4P5YA 3VZNA 4O9GA 1VJ2A 1GYKA 1EV11 3N7MA 2YPDA 2JD9A 3OD0A 2VC9A 2JG9C 3PU3A 2NZ9A 4FFIA 2GU9A 4I02A 4LNVA 2YB7A 2XHKA 1V0AA 5HPOA 4FPLA 3KV5A 3A21A 3IBMA 1AHSA 3N9MA 2A6YA 1RVF3 3G7DA 4IV1C 2EIEA 2W9XA 1XNBA 4UFHA 2MEV1 1IPKA 2V4AA 2WNVC 2FBEA 2HYXA 2QUOA 3MIHA 2BVVA 2RG4A 5EJ1B 2W5FA 3ZFEB 4D0QA 5IYYA 4Q1PA 1K42A 4IEQA 1A34A 1IPJA 5BNNA 1G9AA 4MHRA 4QX7A 4GIQA 5A3OA 3LDBA 2RDNA 1QJY1 4MUVA 1OD3A 5GZDA 4CDUA 1Q3EA 5JSPA 5CA6A 2Q0AA 2ZGUA 3GBFA 4TXWA 5JZGB 5CEHA 2ES3A 5FYTA 1ENRA 3BN6A 5CFCC 1WWYA 2WS93 5FUNA 1R1A3 3EJKA 5KBFA 1ND2C 5IWFA 1AZDA 3PHMA 2RMU3 4LITA 3GHMA 3AP9A 4IERA 4CP2A 1JYWA 3B94A 3WZ1A 4COWA 3PJQA 2ZGOA 3NJZA 1IS5A 2FDHA 1S2EA 1REEA 4NE9A 2VMEA 1LKNA 1RJ7A 1RXFA 2AYHA 4H3WA 2W52A 5C8CC 4E9KA 5IAVA 3VBOB 2XJRA 4CDQB 1NA1A 2UWAA 2HWC1 4TN7A 1F35A 1FOD1 1Q8PA 4FXGB 4WM7A 1STMA 3H7YA 2PHLA 1IG3A 2J1TA 4MSVA 2VMGA 1JZ8A 5FZ4A 1ZM1A 3D4KA 1X36A 1XC6A 3M3EA 3PUIA 2BGPA 1X50A 2YC4A 3NQHA 1KQRA 4YFWA 5ACA2 1PO22 3NSTA 5A7OA 4MXWB 1UYZA 2ZGLA 3GDBA 3POEA 1O4ZA 3LQCA 4JX0A 3KT4A 4RFT0 3WG1A 1UXZA 3ZYIB 1FMD2 4BWOA 4CCJA 2BBVA 2EIBA 1HV0A 2PXJA 2GMEA 3PTYA 4XMAA 2ZABA 3ZFEC 2VM9A 1DHKB 5C3QA 3MICA 3OPTA 5FP8A 5FLJA 2D6KA 1DYKA 1X9PA 2Z42A 3SMHA 3AKQA 4HMZA 1E5HA 2QQIA 2K46A 2D5FA 1HX6A 5JZGC 2EXKA 5HXVA 1ZZCA 1OXCA 1XRUA 1BEV2 2VQ0A 2RS12 3P5BA 5APAA 5HCAA 2PMWB 4FO9A 1PK6B 2PYTA 4LBQA 1ZBA2 3LZZA 1SLTA 1UCXA 2VQAA 4LLFA 4PF1A 4QGLA 3ENRA 1YUDA 3KVAA 3OUHA 4WZCA 1R64A 1Z7S2 2NYYA 3I3BA 3WR0A 2A73B 1VALA 4G4FA 3BPSA 2B5HA 3TN93 1Q8OA 4Q0SA 4M4RA 5F6LB 1DQ0A 4ZY9A 3KV4A 1N1SA 3CJIB 2OXBA 4XBQA 5GALA 1Y9QA 2Y6HA 3VBOC 1B35A 3ZLIA 4G9SB 4XUOA 2CAVA 1E5SA 1OFNA 3L2YA 5FK7A 3ZYPA 4NWVA 3WCSA 4BMBA 3GHNA 2B46X 1Q8VA 1RUE2 2P17A 3B00A 4Q4Y1 4YVWB 3RSJA 3VD5A 4CPBA 4AHWA 4A2UA 4FOVA 3RS6A 3SEEA 3ZXDA 5JMOA 1OH3A 5E88A 4K21A 5EPAA 5FWJA 1W6OA 1JYTA 1E5IA 1HQLA 2UYAA 3WCRA 3WXPA 2Y6KA 5CG8A 1QDCA 3FJSA 3IIIA 2VCAA 1SLLA 5JIAA 1RUG1 1UAIA 1SLIA 2A6VA 3MIDA 2E7QA 3OPWA 4KGGA 4C91A 4EN8B 1CZTA 4XJ8A 2R062 5L9BA 4OCTA 5HV0A 3AL6A 3KV6A 4GB31 1EUUA 1LGCA 1AR82 4E2SA 3CNAA 4IV1A 3LD8A 1TMF3 1LENA 4GA9A 4DINB 1PGL2 1PVC2 2KR2A 4ES9A 2Q8CA 1W6NA 2RVAA 2WNUA 4M3CA 1WBFA 2HWE1 4QKBA 5GLZA 3S5AA 5F7UA 5JOYA 2VG9A 5DXDA 1R093 1AL21 5F2SA 1REFA 3ZYBA 2WT1A 3U4SA 3ZYFA 1RITA 3WW4A 1GWMA 3GJAA 1TNFA 1YHFA 1PK6C 3WINE 1H1AA 5JI7A 1KDMA 4I3GA 5BY5A 1X7NA 1LAJA 1LULA 3RGBA 5FXZA 5CFCA 3WNOA 1U0AA 4NO4A 2ERFA 3RJRA 2HWB2 2TUNA 2YBSA 4QB1A 4CZSA 4BK5A 4ATEA 3HD8B 1SCRA 3ABZA 3CJIC 1DYOA 4XCAA 4DMIA 1H8TA 3RDIA 4ZS2A 3R4SA 3EMRA 5JLVA 2A6ZA 4ARYA 1SHWB 3T2PA 4LUMA 3JBG2 2XR4A 2H6BA 3AKRA 2Y6GA 3AYAA 3IDAA 1SLAA 5F5IA 3I2KA 3OBAA 4CE8A 3OYWA 5C8CA 2ZMLA 4YVWC 1HXS3 3CF6E 1SBFA 4HOOA 3UKNA 4AF9A 2EIDA 1LRHA 4MH0E 5J36A 1WCUA 1GOGA 2C9KA 3KZ4C 1S55A 5JXJA 2RR11 5FCCA 1G9FA 3L9JT 4QAWA 1UX6A 2CU5A 3MYXA 3OPZA 5C9AB 1BQPA 3ZYJB 4FPHA 1CJDA 4SLIA 5D1IA 3WV6A 4XBLA 5BNQA 5C6CA 1AR63 1MS5A 1OURA 4Q4X1 5IK4A 3BTXA 3RJ2X 1Z7S3 3WW2A 4NRPA 5DZGA 3ZXJA 3J8F1 1V6NA 4QQ2A 1HKDA 4LBJA 3LB9A 2VECA 3MDPA 4RHV1 4IESA 1MQTA 5GKAC 2XH6A 3CQOA 3H1MA 3KV9A 2JICA 3AZXA 5LW9A 3BI3A 1ZBE2 2Z69A 1JYCA 3HAGA 3ACLA 3M2MA 1OA3A 1WW5A 1XPWA 3MLLA 2TNFA 1C28A 2WFF3 3ILFA 4MYEA 2ORXA 1QXPA 2V5YA 3KHBA 4J6GA 4W65A 3SH5A 2Z79A 5FFOC 4JKMA 2WT0A 4OMCA 1S0DA 5JZGA 1AX2A 1VBA3 1ZZ8A 1ASJ2 2MEV2 2WWJA 3D82A 3KLSA 3R0RA 4LE3A 3INAA 4K40A 4BHPA 3FL7A 5HXMA 2Q1FA 3MW2A 3RYRA 4AFAA 1ONAA 2XL9A 5FP7A 1W0NA 3DPRC 2WAAA 4LORA 5FJKA 5A7NA 4Q4W2 4JAAA 5DZEA 2ADDA 3PMSA 4NWWA 1QJY2 3ZIXA 2IUWA 2HWF3 2YYOA 4NPRA 4EN9B 4ZZ5A 1CIWA 1W2UA 2RE9A 3D3AA 3GZAA 4GWIA 1ULCA 3AYDA 5A3PA 4XUNA 2BGOA 3A23A 5JAXA 5JOWA 4AWDA 3LCPA 3M3IA 2W1QA 2E31A 4IE4A 5CU1A 3WDXA 4CDQA 2VO5A 3CZJA 1LB2A 2CDOA 2DFCA 1CAUB 4NIIA 1QJZA 2BJSA 4XFIA 3TAYA 3N9NA 4IW3A 1O6UA 3WOGA 3VBUB 1AR93 3NRUA 2ARBA 5IVEA 5J96B 3O1MA 4IDZA 5IVCA 2A1XA 3ZFFB 4DY3A 2AEZA 4WZFA 4AGGA 4XEZA 1XNTA 1H4GA 2VBPA 2AZ5A 2P3YA 4EZHA 2N7GA 3ACFA 1IG0A 4OUSA 2CNAA 3P1IA 2JWPA 2HLEA 5IJRA 5IVFA 1FOD2 4MXWA 5C3SA 5FBZA 5F5CA 5J98B 2BBAA 5FPZA 1ZZBA 4XFFA 3CO2A 3O1UA 2FDFA 4CCCA 1HW5A 2ET1A 4A4AA 3HN1A 3GZUC 3N9QA 1PNFA 2P3IA 3W20A 3OGSA 1XXNA 2TBVA 4XTMA 4KGQA 1COV3 1KGYA 1IPSA 4L9BA 1UU6A 2OZ6A 5JDBA 1RVF1 4R9DA 5GZFA 3H50A 4LT5A 5GZGA 1QQP2 2QQPA 2ZGRA 3CEWA 1ENSA 3SCHA 3OEBA 4E4SA 3MV01 5FZCA 2TEPA 4OVEA 1K5MB 2VTFA 3ZMNA 2FZ2A 1RMU1 5AFEA 4BE3A 3CJIA 2VQUA 3U0ZA 2WZEA 4WM8C 4CXYA 1XNCA 2ZBJA 5JVVA 3ZYGA 2WWSA 4YVSB 4NPMA 2VVFA 2KM2A 1DF0A 1KJRA 1LEDA 2FCTA 2XB6C 1JI6A 1R1A1 1HLCA 3N35A 3VBUC 4YVWA 1ULEA 3N7LA 2RMU1 2Q8DA 4F8AA 2C26A 2WR9A 3S57A 5C33A 4QPIA 5F8PA 5GM0A 1NZIA 4V2WA 3VGIA 1BBT3 1D7PM 4AI0A 1LESA 1YWKA 4OQ8A 4QXCA 1ALYA 1QH6A 5T50A 3RZJA 1ASJ3 4RFRB 1RUH3 1JN2P 4CEWB 1Q56A 4WVWA 4Y4RA 2VAUA 2RDSA 1UOFA 2ZEZA 3MLJA 2FHRA 2KXLA 1ZZ6A 4W4ZA 3WSOA 2VXRA 4Q4Y2 1KS4A 3B9IA 3KB5A 4WVMB 4XQDA 5T3NA 2F4LA 2LUWA 1D0HA 3V0AB 1CWPA 3O1SA 4Q4W3 1K5JA 1W8TA 4XACA 5HBAA 4HKLA 4OUMA 5CG9A 2VE1A 1NX9A 4KNCA 2PTMA 3X29B 2CDPA 4W50A 5LBCA 4BJ0A 3IZOA 3DUIA 5IAXA 1VBD3 1K12A 1RUG2 2Y6FA 4I2OA 1T2XA 1WUVA 5EXOA 2WT2A 2JECA 4Q5OA 3MFCA 3T2QA 4GB32 4M01A 3VHPA 1UZYA 4CCEA 4Q27A 4S2FA 3BPZA 3DGTA 5A80A 5JI9A 5T5JA 5FZEA 2VOXA 4W6XA 5BNPA 2FDJA 1XSQA 3RRDA 2YC0A 3ZYRA 4ET7A 2YDEA 3T08A 1K5MC 2HWE2 3T4VA 1OQ1A 3TB0A 2VCBA 1HJFA 2LRPA 1AL22 4YGEA 5DAWA 2B42B 3ZR5A 4HVRA 5I93A 4B4QA 2EVXA 2V73A 4LR4A 2BW8A 2RDQA 3WQ0A 2PHDA 5F9TA 4KU8A 2Y38A 4A42A 4BCUA 3C7GA 3NAPB 4RR3A 2W92A 5IT6A 1HN0A 3TN91 1YNAA 1VMJA 3I59A 2VY0A 2JB4A 4YZ5A 4QKDA 3AVRA 5JOZA 4C90A 4YW5A 4JCKA 2VZUA 1F15A 1LECA 2ZEXA 1B09A 1W9SA 3KQRA 3WNKA 3OD4A 2DWRA 5C9AA 2VZVA 4CEWC 3O7OA 5AC93 2GMPA 4MGIE 2ZHLA 2J1UA 5AVPA 4Q29A 1QQP3 3U14A 1YQ5A 3GGLA 1KJLA 2WQ8A 4IE7A 3JQXA 1PZ8A 5HV4A 2Z2SB 2DV9A 5DG1A 5JMCA 5FBJA 3NNFA 1J3RA 4HVOA 5A32B 1ULOA 3TWIA 3POBA 4AI1A 1GANA 3NKTA 2RR12 3OB8A 3POYA 2NM1A 3VDAA 2QQOA 2HEWF 4KBBA 3SHRA 3TNPB 2R042 3H1WA 4KWJA 4Q4X2 4XZPA 4GJYA 2R1DA 5F1RA 1HRI2 3POIA 1WLDA 2ATFA 3I2JA 5FY1A 3J8F2 3QCWA 2X10A 4D69A 1SQ4A 3MF9A 4P9LA 2W68A 1JUHA 3HJRA 1WCSA 1GV9A 3KCCA 4R8HA 1PX3A 5FWEA 3GCWA 1TMF1 1O3TA 3TEZA 5FZFA 1VB4A 2WUHA 3AJYA 3Q8BA 1OHFA 1PM7A 1XB9A 1PNGA 1CONA 1WMEA 5K4LA 4Q0QA 1UOJA 1W8FA 3IIAA 2XUMA 4C0BA 5J48A 2CYFA 4QM8A 1OLME 4COZA 3CHXA 5C71A 4QXKA 5IATA 2VMHA 1MS4A 1PMHX 1POQA 2VMFA 1DLLA 4JHZA 4COUA 1BK0A 3K77A 3VUOA 1UKGA 5J37A 1US3A 2WN2A 2X5IB 4LO6B 3BTAA 2C0ZA 4GMP3 5L9RA 4XUTA 5LEJA 4P08A 1CAUA 2CAUA 1OI6A 3GBWA 4Y4YA 5D8AB 2W1UA 2HWD3 3KCYA 1MS0A 1UU4A 2YHJA 3VBUA 1UY4A 2ZHKA 4BQ4A 1IS4A 1I6XA 4F83A 3MUY1 4P9JA 3PLQA 3ZFFA 4NIGA 3T0DA 2ZMNA 5F3CA 1N1VA 1GU3A 5EHDA 4FOYA 4BA6A 5JCTA 3QBQA 1FMD1 1LR5A 5LATA 2WYSA 4QQLA 2E9QA 4GKXA 3AZYA 5DAXA 2GNDA 4I01A 2ENRA 1A78A 3ZO0B 1HXS1 2UWBA 3MPBA 3OOXA 4OZOA 4EN7B 1GICA 4QQHA 1V9U2 4RL7A 3ZKUA 4AFCA 3H9AA 4BIFA 1XU2A 1WCDJ 5LASA 4QKFA 3HPNA 5F3EA 4AI8A 3E5QA 4Z82A 1QIQA 3K51A 2WSVA 1W8OA 3BB6A 3Q8FA 1AR61 2EAKA 3MI8A 3NO8A 4QHOA 5IUQA 3TNQA 4K1ZA 3GYDA 4N53B 4LKDA 1Z7S1 2Y34A 3ILNA 4I3PA 3VZOA 2BFUS 4A44A 5BNNC 1O4YA 2E7TA 4XJZA 4XURA 3UJQA 3ZXAC 1YLLA 4CDUC 3LKJA 2BOIA 2YZ4A 4PI0A 1HB4A 2ZX4A 2P34A 2V72A 3PMEA 4JHTA 3QH6A 3VDCA 4WV8A 3POWA 2QNKA 2VNVA 3VL8A 4EQVA 5LA1A 5EYYA 2YV8A 4A45A 2ZGTA 4RYDA 5FMBA 2VPVA 4G3YC 3RZGA 1K5MA 1VIWB 5A70A 1ZREA 4M3CF 2WFF1 2X53S 4N43A 1SMVA 2E51A 1H1IA 1VP6A 2GSYA 3LPGA 3N7JA 4NIHA 2YMZA 1JZ4A 4XF4A 2ZX3A 3U11A 1L3JA 1VBA1 1GR3A 4LKSA 3AB0A 1POV3 4NRMA 4PCRA 1GOFA 3LAGA 4YVSA 4AFDA 1OPOA 2AUYA 1CIYA 2WL1A 3OGRA 3PVNA 4K1YA 1QY4A 4IEUA 4K9SA 5CFDB 1NA1C 3OG2A 2R043 1O5LA 1SFYA 3KCXA 1LU1A 4HK8A 5CIRA 3W5MA 1RUI3 3BTZA 1HRI3 4QGNA 1SFNA 3DCQA 1PZ9A 3DXTA 2HJIA 5IFTA 2HWF1 2R061 3SKJE 1JHNA 5A1AA 3LFIA 5KWRA 1Z78A 4I30A 4TTGA 3FE5A 4RS5A 1AR81 5I8YA 5LZ6A 3FBYA 1YQ8A 4CEWA 1KEXA 1PVC1 2G19A 2WS92 2OX0A 3UGFA 3ZXGA 4LO7A 3JXSA 4WVMA 4FI9A 3MEPA 2RMU2 1N3OA 1AR91 3B9CA 3K3OA 3MUZ1 5A33B 3V0AA 1ZA7A 2E32A 1BHGA 1DGWA 2D6MA 2XVLA 3NNJA 4MGSA 5FIXA 4ASMB 3H3UA 4BQ2A 5T54A 5FUPA 4QM9A 3H7JA 1IQDC 1QU0A 3HQRA 5DG2A 4YNIA 1BVVA 4OLLA 4XDOA 5F5QA 4UFKA 1W6NB 2WAOA 3PUHA 2VBDA 1OUSA 5D21A 1Q5OA 1YJLA 2BRTA 3C2UA 1O59A 5TSWA 3W59A 2QQVA 4IGPA 1DQ4A 4Y1UA 2P3KA 2ZEWA 3PIGA 1GZTA 2GZWA 2IFRA 2VUJA 3NW4A 3WUCA 1NY71 1ND3B 2XKOA 4IGQA 2XKPA 2RDRA 2B45X 2WZPP 3LDKA 2AC1A 1W05A 2XJQA 1UD1A 1OVSA 1QMJA 4QMAA 1COV1 4IE6A 3M1HA 2ZKLA 1V9U3 5I8SA 2EALA 1WA4A 2FDKA 1FXZA 2DYCA 2IVIB 4CCKA 5K7PA 1H8TB 1B35C 3NAPA 2GNMA 2ZX0A 1F8VA 2EIGA 4HETA 1J59A 3HT1A 2D6NA 3Q9OA 4Q4V3 3PTRB 3T30A 3D0JA 5E1RA 5K8SA 3OYWB 4H7LA 2GH8A 4IQPA 1HN1A 4META 2ZGMA 3BTYA 1DQ1A 3C7HA 4D7SA 2A71A 2MNGA 2R32A 2WQZC 4LOSA 4NHYA 3FX3A 2VZQA 3B7MA 3U07A 3ME2A 4TLFA 1UN1A 1OD5A 4GWNA 4CP9A 3BVCA 2O8QA 1ZBE1 3J7MA 1S0JA 2KD7A 2HKXA 3ORJA 5I0UA 3THDA 3TN92 2W0XA 4AI3A 4NVPA 4BH9A 2BDRA 1G6NA 1OFSA 1D4M3 4LHLA 4NMIA 4YZ3A 4EE2A 5A32A 5DMYA 1I9RA 1DP0A 3MZHA 4IEXA 4AI9A 5HCHA 2D3RA 3AYEA 3DKQA 1WZXA 3HNMA 3HWJA 3AYCA 1BBT1 1C1LA 2VNRA 1OA2A 1N3PA 1ASJ1 1MQTB 3WDWA 2HBUA 3OUJA 3AP4A 1WLWA 2EF6A 2WNUC 4RGAA 1QOOA 1ZZ7A 4FAGA 2IXCA 5GLVA 2XJVA 1MR5A 5IVBA 4CUGA 2B39A 4TZDA 2JDAA 2Y60A 4Q4W1 5FYUA 1MZ5A 1UY2A 2XGXA 2O14A 5FZ0A 2XBO3 4AZZA 3NNGA 4XW3A 1JOPA 1IGOA 2JX9A 2VL4A 3Q8EA 4FBFA 1UY3A 2D3PA 4W6WA 3V56A 1XOYA 5FZHA 4DO0A 2B7YA 5FYVA 1BKZA 3AJZA 1WA6X 3SNMA 1W0OA 4JKKA 1ZYBA 3H1YA 2NP0A 4JTNA 2LS6A 3VV1A 3ZN4A 2UY9A 3ATGA 4L97A 4LJHA 5FYZA 2CV6A 3K46A 2JIJA 1H8TC 2X5IA 1TMF2 4QX3A 4UI9L 5K9YA 1N1YA 1LHNA 2BWAA 3AFKA 5D8AA 5GZEA 1J84A 3APBA 3O1TA 2ZX2A 5BPXA 4ZU5A 2LM3A 2WNEA 3AMPA 1R092 5DABA 5FO8B 2CGPA 2ZGNA 3UETA 3WLUA 3N9OA 2XJTA 2D44A 3BALA 4FSJA 1G7YA 1NT0A 1W3VA 3WDYA 5LWBA 3AC0A 4JRLA 3HBZA 3ZPYA 1RUF3 2FDIA 4AVSA 3E1F1 5A6XA 3VKNA 4NHKA 4QX2A 1QJEA 2JE9A 1JMUB 4AXOA 4E2GA 3IDBB 2WSUA 3AP5A 1H2NA 1ULGA 1W04A 4UFLA 4XYXA 1YQ6A 3A0NA 1C8M3 2VCMA 1XE8A 1O3SA 3B5LB 4QXBA 1MPXA 1VBC2 1NLRA 3GXUA 4E27A 4AEKA 1MQTC 3KQ4B 5FDBA 3WDTA 5AC91 1VB2A 1Z0HA 3R4DB 1QDOA 1HXS2 1LCLA 1NXD1 1QQP1 2W94A 4N53A 4CA9A 1AYM3 3GNEA 5E16A 2IWGB 4IEOA 3O0VA 1DBNA 4JGZB 3VZLA 1HDKA 2K9ZA 4BQWA 4DFSA 4XHXA 2BEOA 3LIGA 2WYFA 1LGBA 2CWSA 1AR62 2JE8A 4LTAA 1UZVA 3AZZA 2XVKA 2DUQA 4HFSA 4JC1A 3B02A 1C4RA 2NPIA 5A1FA 1UX7A 4LBKA 1HB1A 4UBGA 5DUUA 3ZDVA 2Q1MA 4YYOA 4BOWA 1ZRFA 3C7FA 3EO6A 4FP3A 1VRH3 1E5RA 1UPSA 5ERLA 5CFDA 1GOHA 3ACHA 4CDQC 5FYCA 3EYPA 3U78A 3VZJA 3J7HA 1TE1B 1U5YA 2P5BA 1BXHA 4KWUA 2WFF2 2H0BA 4LEJA 3ZMOA 1JZ2A 3FUOA 4GULA 1PMIA 1S2BA 4DQAA 5I0RA 1LOAA 1S0GA 1YFWA 1VBA2 2ZGSA 3C8XA 3BIEA 2ARAA 4UW4A 1A8MA 1DZQA 4QPIB 4YW3A 4CU8A 2X05A 1MZEA 3T3YA 1NYWA 4PQQA 1WLTA 2OUJA 1W99A 2R30A 5A33A 1A3KA 1F4AA 1GZ9A 1IOAA 1PO13 2IVJA 3LEGA 3PIJA 5LY1A 4F3JA 3AZVA 2VGDA 3KM5A 2WA3A 4FPEA 2HWF2 3H0OA 5FZDA 3VHOA 1XJAA 2K2SA 4ZXKA 4YM0A 4I0WB 1P8JA 1U5XA 2XJPA 3MPPG 2L9LA 1WW4A 2A3YA 4LO4B 3PU8A 2LTNA 3CLPA 3HVDA 2QQJA 4UXAA 1EYBA 1C3HA 1AR92 4JGZC 5FZ6A 5KXEA 5KHHA 4NIDA 5T5LA 5DQ0A 4P9WA 4KI5M 1QHDA 3WF4A 3O1OA 4XJ9A 1ODNA 1SEFA 1X9TA 2JDKA 5FZKA 1ND3A 4LKEA 2F6BA 3SLIA 4PLOA 1ZA4A 5BNPB 5FMOL 2VQTA 2ZJCA 3NJVA 3AKTA 5F3GA 2A6XA 5KXDA 4LUKA 3CMGA 4FPJA 3LA7A 5AVAA 3VD4A 4L11A 1NE4A 1WMDA 2A3XA 2JDUA 4XIOA 4Y1VA 3DKWA 3I2IA 4XHBA 4ZS3A 2DCZA 3O0XA 4ZU4A 3T2OA 3MW4A 4PBPA 5FUIA 1VBC3 5A7PA 3VD7A 4AL9A 4MXVA 5DAQA 4XPVA 4RN5A 2VZ3A 4EWEA 5LCWL 1LHVA 4IEZA 1LU2A 1NY72 3VZMA 1N3QA 3C3VA 4QDQA 3UL2A 1L7QA 2ZAAA 4AQ2A 1COV2 4XAAA 2W91A 1UYXA 4MADA 4RR3B 5A3UA 3K4AA 4P9YA 3I59B 2VMIA 4MOAA 4QPIC 1XE0A 4BXFA 1R083 2VULA 2OKXA 1POV1 1Q8SA 2DCTA 5H9PA 3USUB 4DXRA 1UMZA 2RV9A 4RQPA 4A7YA 4AW7A 4OULA 1WCKA 2JG8A 2WO3A 2C9AA 3VKLA 3LE0A 4XDQA 3ZXLA 5FK8A 3FFZA 2BERA 2R041 3WUDA 3S6PA 1RUI1 1HRI1 2CGOA 1AUYA 5H9SA 1JZ7A 4P02B 3H3ZA 1CX1A 4DS0A 3GBGA 4RSUA 2XLGA 4U2AA 2W87A 5CBLA 3A0KA 4OHXA 1PZ7A 3N3HA 3OBZA 4OFGA 4JQTA 5H9RA 2W3JA 1OQDA 4HXCA 4XTPA 5JOXA 1SZBA 1FYUA 3R05A 4IXLA 5IK8A 4OI0A 4CU9A 1W9WA 1OF4A 2WINB 2LW8A 1DYPA 3FZ3A 2PN5A 2A70A 5SV8A 3I4IA 1BBT2 2RS53 4DOUA 1W8UA 3W9AA 3HOBA 4N9HA 5BNPC 4JDMA 1RUH2 4NJ4A 2R49A 4CCNA 4D6QA 1S0CA 3M3OA 4B1MA 2FCVA 5FXWA 2YUEA 4PIYA 3AKPA 5EV7A 1YRZA 4A3XA 2J1EA 3ZOIA 3FLTA 4MGZE 5C5TA 4PBOA 2FMYA 3N9LA 4BQ1A 5FY0A 3GALA 2BU9A 4DPNA 1ZNPA 4Q1RA 3WDUA 4OUEA 2UY8A 3JD73 5FY5A 1VBD2 2DVDA 3URFA 1JU3A 1Y3TA 4OZXA 1RC6A 5FZIA 4CDXB 4RR3C 3M70A 5L19A 2A5ZA 2AR6A 4R9AA 2R073 1V6LA 2DBNA 3WP6A 3A4UA 1V9U1 2WNOA 4KU7A 4GZ9A 1FX5A 2YU1A 1JHJA 4D7TA 1BJQA 2YY1A 5A7QA 5C9AC 5FQ0A 1CZVA 1ULDA 2ORZA 4JGYB 5FR3A 1W39A 4PDWB 4BXSV 2VOKA 3D6EA 4TYSA 5A7WB 5BXXA 4Q4V1 2VZRA 3E6DA 4M0HA 2QDRA 2PHRA 5FREA 2W95A 1K45A 4ARXA 1DGRN 2BOJA 4PJYA 1OMIA 4MHUA 4QT6A 4KBZA 2P6HA 2VOWA 3MV11 4GJZA 2D3SA 2DU1A 3ZFGB 4YWAA 4O61A 3J7NA 3IDEA 3T0BA 2A7AA 1XNDA 4QXHA 3ZSJA 4AQTA 1OOPB 2W47A 5FXVA 2Q8OA 3DECA 4BPZA 1CQ9A 4HT1T 4JGZA 1D4M1 2WRAA 4P9GA 4RD7A 5L7OA 3OCPA 3P3NA 3AL5A 1PGSA 4JDOA 1UMHA 2VUDA 1AX0A 1MS8A 4XJAA 4A41A 4CEYA 4IUGA 5AC92 2D93A 4R4ZA 1CN1A 4ZPIA 4PIXA 3RWNA 4BLIA 1S0FA 1NCQA 2D40A 3LEIA 1UW8A 2DTWA 1JZ3A 4ZHNA 3WF2A 4YW1A 5EIYB 4BU2A 4YZ1A 2IXJA 4JVAA 5C4WB 1URXA 3I3MA 2ZZQA 4XILA 3LOBA 4KG8A 4N43B 4EROA 1CAXB 1JOJA 4L0PA 1RUOA 1BYHA 3WD5A 3KS7A 2J22A 5KC6A 3WP5A 1Y9MA 4CDXC 1IKPA 1PHMA 1QWRA 4YM3A 1O3RA 2WS91 4COVA 2VTXA 1AX1A 1GFF2 2AGSA 1LODA 2HYKA 4Q0UA 3AMNA 5JXGA 1JYNA 1AJOA 4XXPA 4PHZA 5FZGA 3ZFFC 4CU6A 4EN0A 4INDA 5FY8A 1FI2A 4DUVA 1NCRA 2YPJA 3GZEA 4DB5A 3K4DA 4IEYA 4RS5B 1UIJA 3B93A 1DGLA 1S1AA 4U36A 1MS1A 4MGYE 1UO9A 2WIIB 2A75A 5IFPA 4LA3A 5FPLA 1SBDA 3UNPA 4KQ7A 5FZMA 5I8TA 4XIKA 2VCCA 4DXTA 5KXBA 3MBWA 1KFXL 4TWTA 1FV3A 2DVFA 1EV13 4YARA 1VLNA 4MLOA 1RHI3 1CZSA 4NHLA 2BPA2 3RVHA 4CUAA 5A6QA 1RUF1 3ZXFA 4AEJA 2HWD2 3U37A 1AYN3 2DVAA 3N7KA 5KC5A 4R4XA 3A7QA 3VBRA 3UKVA 1C8M1 1QNWA 5F32A 5A3MA 4DUWA 4QD2A 1CGPA 3T0AA 1C8NA 4PF5A 4Q8LA 3THCA 1H2LA 4XAEA 4AEDB 4Z2AA 5F5AA 2XVGA 2OPKA 4ISRA 2XG3A 2ILMA 4UT5A 1O8PA 5B4XA 4A6SA 5J3UA 3DYMA 2JXAA 1GZCA 4K8FA 1RIRA 3AP7A 3VN4A 1W8ZA 4N43C 2GC2A 3N4MA 2FQPA 1O7FA 3SQOA 2ZKNA 4X6RB 2VVEA 2E7AA 1QJX3 1V70A 3LF7A 2JB8A 1HQWA 2PHFA 3C7EA 3OGVA 1YEWA 4YW4A 4YVSC 5A3NA 4QX8A 4OHYA 4M00A 5FZ1A 1VMHA 4Z8BA 4XFCA 1MVQA 1GP6A 3FC0A 3IMNA 3FBMA 2JE7A 2V4VA 1J58A 4N7IA 3VBSB 1LHUA 2VUCA 3FUQA 2DCKA 3H8XA 2C24A 4R9BA 3USUA 2OPWA 4LBQD 4YW2A 1KRIA 3C7OA 4UBHA 3JCIA 4RS5C 1SCSA 1VRH1 1YIPA 1WCQA 1YFXA 2XONA 4AGVA 4FTSA 2E33A 4M4PA 2P1BA 3ZVXA 2QDNA 1UF2C 2JEMA 4LBMA 5LK7B 2QQWA 2YBKA 5LBFA 4BISA 3R4UA 4LQRA 4CP9B 5FPUA 1G9BA 4WBBA 3I7DA 2WJSA 3RG0A 3CDZB 4AQSA 4X6QB 1WMXA 1VBB2 2Y6LA 5CYYA 5A7SA 1NZCA 1XQNA 1PIV2 3K75B 1L7LA 1G86A 3ETPA 1V6IA 2DVBA 1J3QA 4OHWA 4CPBD 1V6KA 4SBVA 4ITCA 1I1EA 1RUI2 1DFQA 4QQPA 4AI2A 1G8WA 5FZ9A 3SCFA 2XWBB 3B3QE 4BIOA 4OMDA 3WT3A 4XUPA 1UOBA 3L2HA 2XJSA 3UGGA 2FZ1A 2QE3A 2QFEA 4Y22B 1R091 2IC1A 4GMP0 1JTZX 1RXGA 5FP3A 1RUC2 2UYBA 1SACA 4IETA 5A3WA 4LBNA 1H0BA 2FMDA 3LOIA 3QOPA 3VBHB 1ST8A 4AYUA 1OT5A 1BLZA 3K2OA 5JIUA 2ET7A 2XLFA 3NAPC 5CZKA 2XJUA 1EY2A 1H9PA 4QU1A 1ENQA 2D43A 2GC3A 2GN7A 3H3LA 4QHBA 3ZSEA 4CDXA 5JPMB 4OHVA 4B3NA 4AR2A 1RJ8A 1YI9A 1UWWA 3BKZA 5FOBB 4UF0B 3AMMA 1WD3A 3VBFA 4YZ4A 1VBC1 2HEYF 2P37A 4JGYA 3AXEA 4PDWA 5A7WA 5IVJA 1K3IA 4FPGA 3AFGA 4LXLA 4Z1VA 3OY8B 4KG0A 4GALA 4JDNA 3PJYA 5JPNB 1NKGA 5T52A 4AVCA 2IZWA 1IHMA 3ZFGA 1ZRDA 4CXXA 5A1LA 1YI7A 1R081 3M3QA 4QKNA 4F7ZA 5FO9B 3IB3A 4Y26A 4EWAA 1OOPA 4ZONA 1OQEA 2PQQA 5F37A 4Q4V2 4Z2WA 1IS3A 1NAEA 2IXLA 2IXKA 2BV4A 1GBGA 4EJRA 4K3UA 1W6PA 4ORFA 1LOCA 1TG7A 2Y33A 2J1VA 5CNAA 4D94A 4O65A 2CY6A 1F31A 5K0UA 4C0HA 1CAWB 1G9DA 1UXXX 3LIHA 3UJOA 4LKFA 1RUJ3 1Y7BA 2CL2A 4CUCA 4MGKE 4AAPA 5JWPA 4Y20B 4N7UA 1JXNA 4AOCA 3RI8A 1POV0 1LHWA 1SLBA 5C4WA 5T5PA 5EWSA 1KITA 1D4M2 1JODA 4YZ2A 1CAXA 1OF3A 2PHWA 4FOWA 4BQYA 4UFJA 4OQ9A 3JB8A 2X5IC 5FZOA 1YCIA 2RS51 3ALQA 4LHKA 1VBB3 2C5DA 1FNYA 1W0PA 1MACA 5LRSA 1OUXA 5D8AC 1PIV3 1VE0A 4HN1A 3FHQA 4S2DA 4BQ3A 5A6ZA 3PUAA 1KDKA 1GNZA 4FQ4A 1FATA 1F2NA 2RS32 3J7LA 2Z4FA 3F2ZA 3RQ0A 1YIFA 3S0MA 2XBO2 1KFUL 3DV8A 4OI4A 1DZTA 4XE9A 2OZJA 2YBPA 4FFFA 3IM0A 1UL9A 2VOTA 3JD71 4HL0A 3K4ZA 4IE0A 1AXKA 1LOFA 4GH4A 1PM4A 2SBAA 5FPAA 2R071 3WY6A 1VPHA 2X09A 4M3CE 1NOVA 1RUC3 3PL0A 3E97A 3ELNA 3OGGA 3QD6A 2QQLA 1UY1A 2A3WA 3KSCA 4OYUA 4XF0A 4P00B 3P3PA 5EZWA 3SKVA 2FD8A 4N53C 3ZR6A 3WNMA 2QBXA 3ZSKA 4RHV3 1LJ7A 2VNOA 1W6MA 4XVHA 3NJYA 4AEDA 4HVQA 5CADA 2VZTA 1H2MA 2J1AA 4GWJA 3MO4A 1US2A 5ANQA 3FLRA 1RUF2 1OA4A 1TVGA 2JG9B 1OLQA 2DCJA 1UYPA 4UW6A 5JR7B 1HIXA 1U5IA 3TBDA 4K7JA 4A7ZA 1HJGA 2B4KA 1FV2A 4HANA 1W06A 1C8M2 2VD7A 5DAPA 4A6OA 4UWDA 4ZXEA 5C3OA 1LNSA 1JS9A 4HKOA
chains in the Genus database with same CATH topology
3FHAA 1JZ2A 3ACFA 3ECQA 3P1IA 2HLEA 5IJRA 3C8XA 2BBAA 4CU8A 1W8NA 1JYXA 2X05A 4PQQA 1W99A 1L7RA 4A4AA 1F4AA 3LEGA 2XHNA 3OGSA 2R7EB 4CVUA 1EUTA 3A22A 1P8JA 3CIHA 1KGYA 3WNNA 1UMIA 2L9LA 1GMMA 2QQJA 5C70A 2EICA 1GNYA 5DQ0A 3OEBA 3BGAA 4KI5M 2WABA 3MV01 3WF4A 2VTFA 2W1SA 1H6YA 2QQKA 5LA2A 2VQUA 2WZEA 2PQSA 2VQTA 3NJVA 3I2HA 2W46A 4DXSA 3CMGA 3VD4A 5B4NA 1J83A 1H6XA 4QDSA 1JI6A 2WZ8A 3I2IA 3T2OA 2C4XA 5FUIA 3VD7A 2C26A 5IHRA 4RN5A 2VZ3A 5LCWL 3DYOA 1D7PM 4QDQA 1L7QA 2WDBA 2W91A 1UYXA 4MADA 3K4AA 2ZEZA 4W4ZA 4MOAA 3WSOA 2OKXA 4DXRA 2RV9A 2VMCA 2YFUA 2WO3A 3LE0A 2J1SA 1JZ5A 2BERA 4YPJA 1NX9A 4BJ0A 2CDPA 4W50A 1JZ7A 4DEVA 4P02B 2W1WA 1CX1A 1K12A 1T2XA 2W87A 3VD9A 3T2QA 2W3JA 3P6BA 3ACGA 2VZSA 3VDBA 1RYYA 4ET7A 4CUBA 3T08A 4CU9A 1W9WA 1OF4A 2LW8A 2VCBA 4JKLA 3HNYM 3I3EA 3DYPA 3W5NA 3HOBA 1JU4A 3I2FA 5C7GA 3HN3A 4QX0A 2E26A 2QQMA 2J1EA 4A42A 3C7GA 3UESA 2W92A 3NJXA 4OUEA 1O8SA 2VZUA 2ZEXA 1WKYA 5I0DA 1JU3A 1W9SA 3WNKA 1ULPA 2VZVA 3WNLA 2J1UA 4QB6A 3OEAA 4UOJA 3GGLA 2YG0A 4GZ9A 2WQ8A 1JHJA 1CZVA 2JKXA 2ORZA 5DPNA 3WF1A 1ULOA 4BXSV 2YFZA 2DDUA 1YQ2A 3OB8A 3VDAA 1DLCA 2VZRA 5EJZB 2QQOA 4ZZ8A 2VJXA 2W95A 1K45A 4ARXA 4QB2A 3MV11 4MGQA 4MO3M 3I2JA 3T0BA 2X10A 2Y6JA 4DEQA 3ZM8A 3HJRA 2W47A 1PX3A 3DECA 4E8CA 2J7MA 3FN9A 5LA0A 2WUHA 2ZEYA 1UMHA 4A41A 2ZXQA 2Y64A 4IUGA 3WNPA 4QPWA 2XOMA 3LPFA 5C71A 1UY0A 1I5PA 1PMHX 2VMFA 4JHZA 3K77A 2VMDA 1US3A 2WN2A 3LEIA 1JZ3A 3WF2A 4XUTA 5EIYB 4P08A 4A3ZA 2BZDA 2W1UA 4P5YA 4HG6B 1UY4A 4L0PA 3WF0A 3MUY1 3HEIA 2J22A 3T0DA 2JD9A 3ACIA 2VC9A 1GU3A 2YB7A 2WYSA 5HPOA 3A21A 5JXGA 1JYNA 3VD3A 4CU6A 4OZOA 2EIEA 2W9XA 4DUVA 2HYXA 5EJ1B 3K4DA 2W5FA 3CZUA 4D0QA 5IYYA 1K42A 3I2GA 3HPNA 4AG4A 5IFPA 1W8OA 3UNPA 2VCCA 1OD3A 4DXTA 3MBWA 2VZ1A 5JXHA 4TXWA 4A44A 1CZSA 4CUAA 3BN6A 4KMQA 4XURA 3U37A 3VDCA 2V72A 1PX4A 3A7QA 1JYWA 2VZPA 2XQXA 5LA1A 4A45A 4RYDA 4DUWA 2RJ2A 3T0AA 3THCA 2VMEA 4Z2AA 3LPGA 2J1RA 1JZ4A 1O8PA 5B4XA 4LKSA 3DYMA 1GOFA 3WQBA 3OGRA 1CIYA 2J1TA 1JZ8A 3OG2A 3C7EA 1XC6A 3OGVA 3W5MA 3PUIA 2BGPA 2YC4A 5IFTA 3NQHA 2QQNA 3SKJE 5A1AA 4QDRA 4TTGA 2V4VA 1UYZA 3GDBA 3LQCA 1NUKA 4JX0A 1KEXA 1UXZA 2DCKA 1UYYA 2EIBA 3JXSA 4FI9A 3C7OA 3MUZ1 2VM9A 2XONA 1WCQA 2E33A 4M4PA 2E32A 1BHGA 4MGSA 4UAPA 4LQRA 4XZUG 1GUIA 2QQIA 1IQDC 3T09A 3CDZB 4E8DA 2Y6LA 5CYYA 2WAOA 3PUHA 3K75B 1F4HA 3ETPA 4PF1A 1O59A 1R64A 2VZOA 3I3BA 2ZEWA 2YC2A 4M4RA 4ZY9A 5G05L 4DUXA 2Y6HA 3GM8A 4OMDA 1UZ0A 4XUOA 5G04L 4XUPA 3VD5A 1XNAA 3SEEA 5JMOA 2WBKA 3IAPA 3HNBM 3WEZA 1OT5A 1HN1A 2Y6KA 2B9VA 3C7HA 3IIIA 2VCAA 5CZKA 1CZTA 2VZQA 1GQPA 4AAXA 5DN2A 3WF3A 4CU7A 1UWWA 1EUUA 4BDVB 2KD7A 3THDA 4XUQA 2RVAA 1K3IA 5DMYA 1DP0A 5F7UA 2V5DA 3HNMA 1NKGA 2VR4A 2WN3A 3IB3A 2Y8KA 2JDAA 3WNOA 1UY2A 3LEKA 5JR2A 3NNGA 1NAEA 2VL4A 4QB1A 4BK5A 1UY3A 1OH4A 3I3DA 3ABZA 4W8JA 1DYOA 1TG7A 2J1VA 5J1XA 3I97A 4ARYA 1SHWB 4JKKA 3T2PA 1UXXX 2LS6A 3IDAA 2Y6GA 3SEPA 3I2KA 3OBAA 4PT6A 4CUCA 3K46A 4QX3A 4UI9L 1SG3A 2EIDA 2C9KA 1GOGA 1JZ6A 1J84A 5JXJA 1OF3A 2WO1A 4QAWA 3UETA 1SDDB 3FHQA 2WO2A 3AC0A 4LHSA 3E1F1 2Z4FA 3F2ZA 4LPLA 4QX2A 3CQOA 2VOTA 1MPXA 1XPWA 3K4ZA 3GXUA 4BK4A 3CKHA 3IAQA 2ORXA 5JUVA 2X09A 4JKMA 4D8MA 4OMCA 2W94A 3FL7A 5HXMA 3EB7A 1JYVA 2QQLA 1UY1A 3SKVA 5JXIA 4OYUA 4P00B 1W0NA 2WAAA 3WNMA 2QBXA 4ZZ5A 4XVHA 2JE8A 3D3AA 4GWIA 4XUNA 2BGOA 3A23A 4QX1A 2VZTA 4GWJA 2J1AA 3MO4A 1US2A 2W1QA 1W9TA 2E31A 1UX7A 2VO5A 3CZJA 2CDOA 1TVGA 2DCJA 3C7FA 2B4KA 3NRUA 2ID4A 1GOHA 1PMJX 3ACHA 4ZXEA 3EYPA 4A6OA 1LNSA 3J7HA 1XNTA 4KWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FHA A;  1JZ2 A;  3ACF A;  3ECQ A;  3P1I A;  2HLE A;  5IJR A;  3C8X A;  2BBA A;  4CU8 A;  1W8N A;  1JYX A;  2X05 A;  4PQQ A;  1W99 A;  1L7R A;  4A4A A;  1F4A A;  3LEG A;  2XHN A;  3OGS A;  2R7E B;  4CVU A;  1EUT A;  3A22 A;  1P8J A;  3CIH A;  1KGY A;  3WNN A;  1UMI A;  2L9L A;  1GMM A;  2QQJ A;  5C70 A;  2EIC A;  1GNY A;  5DQ0 A;  3OEB A;  3BGA A;  4KI5 M;  2WAB A;  3MV0 1;  3WF4 A;  2VTF A;  2W1S A;  1H6Y A;  2QQK A;  5LA2 A;  2VQU A;  2WZE A;  2PQS A;  2VQT A;  3NJV A;  3I2H A;  2W46 A;  4DXS A;  3CMG A;  3VD4 A;  5B4N A;  1J83 A;  1H6X A;  4QDS A;  1JI6 A;  2WZ8 A;  3I2I A;  3T2O A;  2C4X A;  5FUI A;  3VD7 A;  2C26 A;  5IHR A;  4RN5 A;  2VZ3 A;  5LCW L;  3DYO A;  1D7P M;  4QDQ A;  1L7Q A;  2WDB A;  2W91 A;  1UYX A;  4MAD A;  3K4A A;  2ZEZ A;  4W4Z A;  4MOA A;  3WSO A;  2OKX A;  4DXR A;  2RV9 A;  2VMC A;  2YFU A;  2WO3 A;  3LE0 A;  2J1S A;  1JZ5 A;  2BER A;  4YPJ A;  1NX9 A;  4BJ0 A;  2CDP A;  4W50 A;  1JZ7 A;  4DEV A;  4P02 B;  2W1W A;  1CX1 A;  1K12 A;  1T2X A;  2W87 A;  3VD9 A;  3T2Q A;  2W3J A;  3P6B A;  3ACG A;  2VZS A;  3VDB A;  1RYY A;  4ET7 A;  4CUB A;  3T08 A;  4CU9 A;  1W9W A;  1OF4 A;  2LW8 A;  2VCB A;  4JKL A;  3HNY M;  3I3E A;  3DYP A;  3W5N A;  3HOB A;  1JU4 A;  3I2F A;  5C7G A;  3HN3 A;  4QX0 A;  2E26 A;  2QQM A;  2J1E A;  4A42 A;  3C7G A;  3UES A;  2W92 A;  3NJX A;  4OUE A;  1O8S A;  2VZU A;  2ZEX A;  1WKY A;  5I0D A;  1JU3 A;  1W9S A;  3WNK A;  1ULP A;  2VZV A;  3WNL A;  2J1U A;  4QB6 A;  3OEA A;  4UOJ A;  3GGL A;  2YG0 A;  4GZ9 A;  2WQ8 A;  1JHJ A;  1CZV A;  2JKX A;  2ORZ A;  5DPN A;  3WF1 A;  1ULO A;  4BXS V;  2YFZ A;  2DDU A;  1YQ2 A;  3OB8 A;  3VDA A;  1DLC A;  2VZR A;  5EJZ B;  2QQO A;  4ZZ8 A;  2VJX A;  2W95 A;  1K45 A;  4ARX A;  4QB2 A;  3MV1 1;  4MGQ A;  4MO3 M;  3I2J A;  3T0B A;  2X10 A;  2Y6J A;  4DEQ A;  3ZM8 A;  3HJR A;  2W47 A;  1PX3 A;  3DEC A;  4E8C A;  2J7M A;  3FN9 A;  5LA0 A;  2WUH A;  2ZEY A;  1UMH A;  4A41 A;  2ZXQ A;  2Y64 A;  4IUG A;  3WNP A;  4QPW A;  2XOM A;  3LPF A;  5C71 A;  1UY0 A;  1I5P A;  1PMH X;  2VMF A;  4JHZ A;  3K77 A;  2VMD A;  1US3 A;  2WN2 A;  3LEI A;  1JZ3 A;  3WF2 A;  4XUT A;  5EIY B;  4P08 A;  4A3Z A;  2BZD A;  2W1U A;  4P5Y A;  4HG6 B;  1UY4 A;  4L0P A;  3WF0 A;  3MUY 1;  3HEI A;  2J22 A;  3T0D A;  2JD9 A;  3ACI A;  2VC9 A;  1GU3 A;  2YB7 A;  2WYS A;  5HPO A;  3A21 A;  5JXG A;  1JYN A;  3VD3 A;  4CU6 A;  4OZO A;  2EIE A;  2W9X A;  4DUV A;  2HYX A;  5EJ1 B;  3K4D A;  2W5F A;  3CZU A;  4D0Q A;  5IYY A;  1K42 A;  3I2G A;  3HPN A;  4AG4 A;  5IFP A;  1W8O A;  3UNP A;  2VCC A;  1OD3 A;  4DXT A;  3MBW A;  2VZ1 A;  5JXH A;  4TXW A;  4A44 A;  1CZS A;  4CUA A;  3BN6 A;  4KMQ A;  4XUR A;  3U37 A;  3VDC A;  2V72 A;  1PX4 A;  3A7Q A;  1JYW A;  2VZP A;  2XQX A;  5LA1 A;  4A45 A;  4RYD A;  4DUW A;  2RJ2 A;  3T0A A;  3THC A;  2VME A;  4Z2A A;  3LPG A;  2J1R A;  1JZ4 A;  1O8P A;  5B4X A;  4LKS A;  3DYM A;  1GOF A;  3WQB A;  3OGR A;  1CIY A;  2J1T A;  1JZ8 A;  3OG2 A;  3C7E A;  1XC6 A;  3OGV A;  3W5M A;  3PUI A;  2BGP A;  2YC4 A;  5IFT A;  3NQH A;  2QQN A;  3SKJ E;  5A1A A;  4QDR A;  4TTG A;  2V4V A;  1UYZ A;  3GDB A;  3LQC A;  1NUK A;  4JX0 A;  1KEX A;  1UXZ A;  2DCK A;  1UYY A;  2EIB A;  3JXS A;  4FI9 A;  3C7O A;  3MUZ 1;  2VM9 A;  2XON A;  1WCQ A;  2E33 A;  4M4P A;  2E32 A;  1BHG A;  4MGS A;  4UAP A;  4LQR A;  4XZU G;  1GUI A;  2QQI A;  1IQD C;  3T09 A;  3CDZ B;  4E8D A;  2Y6L A;  5CYY A;  2WAO A;  3PUH A;  3K75 B;  1F4H A;  3ETP A;  4PF1 A;  1O59 A;  1R64 A;  2VZO A;  3I3B A;  2ZEW A;  2YC2 A;  4M4R A;  4ZY9 A;  5G05 L;  4DUX A;  2Y6H A;  3GM8 A;  4OMD A;  1UZ0 A;  4XUO A;  5G04 L;  4XUP A;  3VD5 A;  1XNA A;  3SEE A;  5JMO A;  2WBK A;  3IAP A;  3HNB M;  3WEZ A;  1OT5 A;  1HN1 A;  2Y6K A;  2B9V A;  3C7H A;  3III A;  2VCA A;  5CZK A;  1CZT A;  2VZQ A;  1GQP A;  4AAX A;  5DN2 A;  3WF3 A;  4CU7 A;  1UWW A;  1EUU A;  4BDV B;  2KD7 A;  3THD A;  4XUQ A;  2RVA A;  1K3I A;  5DMY A;  1DP0 A;  5F7U A;  2V5D A;  3HNM A;  1NKG A;  2VR4 A;  2WN3 A;  3IB3 A;  2Y8K A;  2JDA A;  3WNO A;  1UY2 A;  3LEK A;  5JR2 A;  3NNG A;  1NAE A;  2VL4 A;  4QB1 A;  4BK5 A;  1UY3 A;  1OH4 A;  3I3D A;  3ABZ A;  4W8J A;  1DYO A;  1TG7 A;  2J1V A;  5J1X A;  3I97 A;  4ARY A;  1SHW B;  4JKK A;  3T2P A;  1UXX X;  2LS6 A;  3IDA A;  2Y6G A;  3SEP A;  3I2K A;  3OBA A;  4PT6 A;  4CUC A;  3K46 A;  4QX3 A;  4UI9 L;  1SG3 A;  2EID A;  2C9K A;  1GOG A;  1JZ6 A;  1J84 A;  5JXJ A;  1OF3 A;  2WO1 A;  4QAW A;  3UET A;  1SDD B;  3FHQ A;  2WO2 A;  3AC0 A;  4LHS A;  3E1F 1;  2Z4F A;  3F2Z A;  4LPL A;  4QX2 A;  3CQO A;  2VOT A;  1MPX A;  1XPW A;  3K4Z A;  3GXU A;  4BK4 A;  3CKH A;  3IAQ A;  2ORX A;  5JUV A;  2X09 A;  4JKM A;  4D8M A;  4OMC A;  2W94 A;  3FL7 A;  5HXM A;  3EB7 A;  1JYV A;  2QQL A;  1UY1 A;  3SKV A;  5JXI A;  4OYU A;  4P00 B;  1W0N A;  2WAA A;  3WNM A;  2QBX A;  4ZZ5 A;  4XVH A;  2JE8 A;  3D3A A;  4GWI A;  4XUN A;  2BGO A;  3A23 A;  4QX1 A;  2VZT A;  4GWJ A;  2J1A A;  3MO4 A;  1US2 A;  2W1Q A;  1W9T A;  2E31 A;  1UX7 A;  2VO5 A;  3CZJ A;  2CDO A;  1TVG A;  2DCJ A;  3C7F A;  2B4K A;  3NRU A;  2ID4 A;  1GOH A;  1PMJ X;  3ACH A;  4ZXE A;  3EYP A;  4A6O A;  1LNS A;  3J7H A;  1XNT A;  4KWU A; 
#chains in the Genus database with same CATH topology
 3THT A;  1TME 3;  1U12 A;  3FHA A;  2GAU A;  1U5Z A;  2PEL A;  2D5H A;  3ES4 A;  5CFD C;  2GN3 A;  1AYM 2;  3VBS A;  4R52 A;  4H14 A;  2RM2 3;  3ZSL A;  1DQ2 A;  4Y33 A;  1W8N A;  1JYX A;  1AR7 3;  3O5S A;  5J09 A;  1QKQ A;  1UU5 A;  5FZB A;  5KHI A;  4NN0 A;  1H30 A;  1OC1 A;  1C5I A;  2Q5T A;  3JZV A;  3S5Q A;  5FZ7 A;  3W21 A;  3HMY A;  1JH5 A;  4OI2 A;  5FP9 A;  4RQP B;  1D4V B;  5FYS A;  4EN6 B;  1EUT A;  1V00 A;  3A22 A;  2JG8 B;  2ZS6 B;  2PAM A;  3ASI A;  3WNN A;  5EP9 A;  4HPK A;  1E57 A;  2BP6 A;  5F2W A;  4EV0 A;  2UU8 A;  4I09 A;  5EFU A;  1VMF A;  2XDV A;  3IPV A;  2HEV F;  2GMM A;  3CU7 A;  1VRH 2;  3NV2 A;  5CIS A;  5C70 A;  4HBN A;  2E53 A;  3AMH A;  1WLC A;  1GNY A;  1MEC 3;  2WO7 A;  2BUK A;  3BGA A;  5FZ8 A;  2ADE A;  1RUH 1;  2VH9 A;  3AP6 A;  4HON A;  4NUB A;  4P9X A;  5BNO A;  2W1S A;  1DGR A;  1GNH A;  3LSD A;  5T55 A;  2WWU A;  5B2G B;  4V1P A;  2GNT A;  4MGT A;  2RS3 3;  2PQS A;  3ZKY A;  1FAY A;  1RHI 1;  2W46 A;  3E6B A;  1HRV 3;  1SBE A;  1V6J A;  2AH2 A;  4FT8 A;  3PUR A;  5LK5 A;  4DXS A;  1ND3 C;  4QDS A;  5FOJ B;  3UGH A;  1AYN 1;  2ZPX A;  2Y26 A;  2WZ8 A;  3OBR A;  4DY5 A;  4Y22 A;  3MIE A;  1TEI A;  1VBD 1;  5FYB A;  4FTB A;  1PO1 2;  3RMY A;  2WZR 2;  4LUL A;  3VBH A;  5IHR A;  3AMQ A;  1ACC A;  1QGL A;  4FCA A;  3DF0 A;  4AVB A;  3ON7 A;  1XBF A;  1QJU 3;  1S0B A;  2OW4 A;  2PLV 2;  5C3P A;  4YG3 A;  4IV3 A;  5I0S A;  2VVD A;  3EQE A;  3KD4 A;  4JTO A;  4L99 A;  3MLK A;  1DQ5 A;  4CXW A;  1RMU 3;  2DF7 A;  2WC2 A;  1DDL A;  1SPP B;  1BVP 1;  2YFU A;  2YGL A;  3H8U A;  1LOB A;  1RGS A;  1NLQ A;  4UF0 A;  1XE7 A;  5FMC A;  4AE2 A;  1QJX 1;  1JZ5 A;  5C5U A;  1W9Y A;  3RMX A;  1W9F A;  5F6K A;  3BCW A;  4RQP C;  3MGU A;  1FPN 3;  2QTW B;  4J1X A;  4XC9 A;  4DEV A;  1GWK A;  2W1W A;  2UWC A;  1HB2 A;  3OY8 A;  2JG8 C;  3PVB B;  4S2G A;  4XOG A;  5FQ0 B;  4BLJ A;  1YFU A;  4AHX A;  3WG3 A;  1AL0 G;  1OVP A;  3M7A A;  3OJB A;  2D97 A;  1HB3 A;  3ITQ A;  5A6Y A;  1OBN A;  2ETE A;  3WDV A;  4QX5 A;  2VZS A;  2Q30 A;  1W90 A;  1RYY A;  3KHC A;  1OLM A;  2QVS B;  1KS5 A;  1KD7 A;  3DEM A;  2NLR A;  3VL9 A;  3ZXE A;  4CUB A;  2DUP A;  4DRV A;  3U4X A;  2OQ7 A;  5LA9 A;  3MIF A;  2GP3 A;  4AHY A;  4LHN A;  4AK3 A;  4P14 A;  3I3E A;  3J9S A;  3SH3 A;  3Q8A A;  3LEM A;  2XUE A;  4YLZ A;  4KL1 A;  5FAX A;  3I2F A;  3OBT A;  5FV3 A;  3MHZ A;  3U1X A;  2ZA9 A;  4AGR A;  1CAW A;  1OSG A;  1R08 2;  2VXJ A;  1EAH 3;  1W2O A;  5L7O B;  4QGM A;  5DDJ 3;  2FCU A;  4B29 A;  2QQM A;  4WVZ A;  2NMO A;  4CEY B;  3NKG A;  4Y20 A;  3TRS B;  1BMV 2;  2QJV A;  2BFU L;  1I5Z A;  3ZPO A;  1IQA A;  2EAA A;  3I8T A;  4XBN A;  1NCQ B;  5ABJ B;  2JDN A;  3SIS A;  1WKY A;  4S2H A;  4N8M A;  3PVO A;  1GZW B;  1OKO A;  3UK9 A;  3IT8 A;  5I0D A;  1Y43 B;  5HCB A;  1ULP A;  3E5X A;  2RHP A;  4PLM A;  2GC0 A;  1Y4W A;  4DXZ A;  1VBE 2;  3RFR A;  2XPJ A;  4RA0 A;  3OEA A;  3UKT A;  2JJ6 A;  3I49 A;  2YG0 A;  4OHZ A;  2WA4 A;  2ARX A;  1KXG A;  1NE6 A;  2JDY A;  2OII A;  3IDC B;  2I07 B;  1C5H A;  3O1P A;  5KR7 A;  2JKX A;  3RZL A;  2PA7 A;  5DPN A;  3V64 A;  3AKS A;  2ZCW A;  1DLC A;  4MV2 A;  5EJZ B;  2QCS B;  4FPC A;  2YRO A;  2RS5 2;  4Q0V A;  4YW6 A;  3VDD B;  1JW6 A;  4ZZ8 A;  4L8Q A;  1NCR B;  4GMP 1;  4HSJ A;  4QB2 A;  3FHI B;  2PHX A;  4MGQ A;  4QU2 A;  5FKC A;  5FKB A;  3OF1 A;  2HWD 1;  3SCG A;  3USS A;  3WP3 A;  1RUD 2;  2OYZ A;  3OTF A;  1CJP A;  4CCM A;  1D0G A;  1ZZ9 A;  2IXI A;  2WZR 3;  2VOV A;  3ZM8 A;  2Z5W A;  4E8C A;  2J7M A;  2VU9 A;  4FTE A;  3NNM A;  1YYN A;  4C8D A;  2PLV 3;  3JD7 2;  2G1M A;  4CCL A;  3NNL A;  3JU9 A;  4XAB A;  2ZXQ A;  2Y64 A;  5L73 A;  4XXA A;  2BTV C;  2XOM A;  3LPF A;  1UY0 A;  2R07 2;  5L7O C;  2B9U A;  3RYK A;  1GQH A;  3VBR B;  4CEY C;  1W2T A;  2MHF A;  2R0F A;  1DG6 A;  3KGL A;  4QPY A;  4B8E A;  5C3R A;  2JG9 A;  3OSD A;  2BZD A;  2P3J A;  4KWL A;  2CTV A;  4Q2F A;  1W6Q B;  4HG6 B;  1QOT A;  1NCQ C;  4NR1 A;  4UW3 A;  3WF0 A;  5ABJ C;  3W58 A;  3RYP A;  2JEN A;  3HEI A;  2R6Q A;  3ACI A;  5FTT C;  3V65 A;  3QH7 A;  4JRA A;  5FZA A;  4X8P A;  1LOE A;  3KVB A;  3ZYH A;  2BWC A;  2WNV A;  3ROU A;  1UOG A;  3T2T A;  3V0B B;  2ZX1 A;  1RUJ 1;  3M3C A;  3VD3 A;  2ZAC A;  4QQO A;  4RGG A;  2PHT A;  3KGZ A;  1V6M A;  3RZZ A;  4N9I A;  4DIQ A;  2D6L X;  4YFZ A;  2DFB A;  3IWZ A;  4DNY A;  1H2K A;  4NAO A;  2QZ2 A;  4ASL A;  4URA A;  1Y9G A;  3CZU A;  2HBT A;  1CD3 G;  2ZGP A;  3I2G A;  3VDD C;  4AG4 A;  4XMI A;  5FYH A;  3MFA A;  1YO8 A;  5FP4 A;  3WG4 A;  1NCR C;  1NXM A;  1VBB 1;  1PIV 1;  1ND2 A;  4P9I A;  2E63 A;  2VZ1 A;  3DPR B;  5ACA 3;  1QXR A;  1PO2 3;  5JXH A;  2UUR A;  3NV3 A;  1XYO A;  4HSL A;  3WHT A;  5IK7 A;  1WGP A;  4KMQ A;  3UYJ A;  2VNG A;  1FMD 3;  5FY9 A;  5CAZ A;  1WW7 A;  3S7I A;  5M0T A;  3KF3 A;  4YM1 A;  4UW5 A;  1PX4 A;  4GD4 A;  1X8E A;  4DRR A;  3PUQ A;  4XCB A;  5BUV A;  2VZP A;  2XQX A;  2RJ2 A;  1MS9 A;  2A6W A;  1VBE 3;  2F17 A;  3MW3 A;  1RIN A;  3WW3 A;  5FYY A;  4D6S A;  1C57 A;  2O1Q A;  4E4Z A;  2D98 A;  3VBR C;  2J1R A;  3ZXK A;  5FPX A;  1BEV 3;  1RUC 1;  2RS1 3;  3QAC A;  4FOQ A;  4ASK A;  2C1F A;  4FPK A;  1ZBA 3;  3LDR A;  3WQB A;  1CES A;  1R1Z A;  3IMM A;  2GNB A;  1AVB A;  4AVA A;  5FPV A;  1FNZ A;  5ISL A;  4BZ4 A;  2PFW A;  4GXL A;  2ARC A;  4XFB A;  4GKY A;  1RUD 3;  2QQN A;  4WVV A;  4CDW B;  3SIT A;  3B69 A;  1EV1 2;  1S0I A;  2PAE A;  1SDW A;  4QDR A;  2WLQ A;  3ZFE A;  1VRB A;  2AAC A;  1S2K A;  1RHI 2;  5FO7 B;  2CHH A;  4AFM A;  4NRQ A;  1X33 A;  1NG0 A;  1NUK A;  4LO8 A;  4PQ9 A;  4CP1 A;  1UYY A;  1UQX A;  1AYN 2;  1Q8Q A;  2JDH A;  3VB9 A;  1SPP A;  1RUE 3;  3G6J B;  3ZSM A;  3WNX A;  1DU3 D;  1YC6 1;  4QWN A;  2EXI A;  4Q0P A;  2AEN A;  2XLA A;  1YFY A;  2H0V A;  4LIV A;  4UAP A;  4DUX A;  1RUN A;  4XZU G;  1TME 1;  4CP0 A;  1GUI A;  2F4P A;  5D2A A;  4W6Y A;  3T09 A;  3VBF B;  3WQ7 A;  4PIZ A;  5HCF A;  5IVV A;  2ZZJ A;  2VW2 A;  4GAZ A;  1DQ6 A;  4E8D A;  4CRQ A;  2JDP A;  3ZN5 A;  2RM2 1;  5LEK A;  3KT1 A;  1H4H A;  1JUI A;  2R06 3;  1F4H A;  1AR7 1;  2W2I A;  3CBN A;  3D5O A;  1ZX5 A;  3RZH A;  5KHJ A;  4GWM A;  1AR8 3;  2VZO A;  4WM8 B;  1QJX 2;  2CSG A;  3VBO A;  1PVC 3;  2YC2 A;  1ZRC A;  2W08 A;  2C6S A;  1OPM A;  2IFW A;  4K20 A;  1TNR A;  1YJK A;  4AEM A;  3KT7 A;  5G05 L;  1H9W A;  1FT9 A;  4XF3 A;  4LLO A;  1PVX A;  2OUH A;  2GC1 A;  4JZR A;  3GM8 A;  4XQW A;  5E8A A;  1IKQ A;  1W8H A;  1GWL A;  3ILR A;  1D2S A;  1UZ0 A;  1Q43 A;  2SLI A;  5G04 L;  5LY2 A;  5F39 A;  2O0O A;  3DN7 A;  1W6P B;  1D2Q A;  1XNA A;  2YGM A;  4UFI A;  2HWC 2;  4KWK A;  5K0U B;  1MEC 1;  1UKR A;  2WBK A;  3IAP A;  4ISQ A;  2WFP A;  3HQU A;  3HNB M;  1A8D A;  2HWB 3;  2XML A;  3HIF A;  3WEZ A;  4Y24 A;  3WG2 A;  4YGC A;  4C1X A;  4IE5 A;  1W2N A;  1HV1 A;  4CDW C;  5ABJ A;  2OA2 A;  2B9V A;  3VZK A;  5CVR A;  1GZW A;  5IW0 A;  4CTE A;  3D0S A;  3KF5 A;  2RS3 1;  4R9C A;  3TYJ A;  1TQ5 A;  5KHG A;  2BNN A;  2XBO 1;  3JBG 3;  1GQP A;  1HRV 1;  4HN0 A;  4AAX A;  2BQP A;  3FLP A;  1CVN A;  5DN2 A;  3WF3 A;  3U75 A;  4CU7 A;  4BDV B;  4FPY A;  5FZO B;  4AFB A;  1RTV A;  4LBL A;  3H8O A;  4CCO A;  2OQ6 A;  1CAV B;  2GH2 A;  4XUQ A;  3TOJ A;  4E4D X;  2P6C A;  5L36 A;  3K48 A;  1ULF A;  2Q8E A;  5FPB A;  1PK6 A;  2VTX J;  3I2D A;  4BM8 A;  3NV4 A;  2QQU A;  5FMD A;  3LA2 A;  1BCX A;  2V5D A;  5GZC A;  3CJX A;  1AXZ A;  1ZRI A;  1QJU 1;  3VDD A;  3TEW A;  5JSR A;  3VBF C;  2DCY A;  2H6C A;  3OUI A;  3BU0 A;  2Y0O A;  3I3Q A;  2EXH A;  3J26 N;  5BYN A;  1VAV A;  4JGY C;  4BQ5 A;  2VR4 A;  4Y5S A;  4PDW C;  2WN3 A;  4KH9 A;  5DUW A;  2JDZ A;  4QPG B;  3ZN6 B;  2Y8K A;  4A7K A;  1APN A;  4FPO B;  3T1M A;  3UT0 A;  4YSF A;  1CR7 A;  3WHU A;  2I45 A;  3DL3 A;  4GH4 B;  4LMF A;  3LEK A;  5JR2 A;  1UNB A;  1JBC A;  3ZFG C;  4B1L A;  1HQN A;  1YXW A;  3BYW A;  4YG6 A;  1J1L A;  1OH4 A;  3I3D A;  4YM2 A;  1ZBE 3;  4W8J A;  1FPN 1;  4K6B A;  5I91 A;  1OOP C;  3I97 A;  5J1X A;  4XF9 A;  1N1T A;  1QJF A;  2RJL A;  3F95 A;  4FVV A;  3SEP A;  2I74 A;  3VKF C;  5SV5 A;  3KMH A;  5F3I A;  3S30 A;  3OGJ A;  1NQJ A;  4MX3 A;  4PT6 A;  3T1L A;  3TEX A;  2MEV 3;  1SG3 A;  4HZF A;  4D7Y A;  5K0U C;  1W6M B;  4ONU A;  3GJB A;  1JZ6 A;  4E4H A;  1W6Q A;  2WO1 A;  3NL1 A;  1YQC A;  5DZF A;  3WQ1 A;  1AYM 1;  1SDD B;  4FFH A;  1QJY 3;  5C4W C;  5FZ3 A;  1WBL A;  5LB6 A;  4NHX A;  1XNK A;  2ZOE B;  3EBR A;  1EAH 1;  2WO2 A;  3V0B A;  4LHS A;  5DDJ 1;  1F5F A;  1F5J A;  3PUS A;  1AJK A;  2EXJ A;  4L92 A;  4PLN A;  4LPL A;  4H2A A;  3AZW A;  4Y1Z A;  3POS A;  4ES8 A;  4M0N A;  3RWK X;  4N90 A;  5IK5 A;  4CYD A;  4DZG A;  1AXY A;  4BK4 A;  2VBB A;  4GQ7 A;  1QXJ A;  2R1B A;  1RL3 A;  3VLB B;  2VW1 A;  3CKH A;  3AX4 A;  3IAQ A;  2ZHM A;  1DZR A;  1LEM A;  5JUV A;  1RUJ 2;  1W28 A;  5EQU A;  3CL1 A;  4QPG C;  3UV9 A;  4D8M A;  3DPR A;  4E2Q A;  3BOP A;  3AK0 A;  2HWC 3;  1T6B X;  2LRO A;  2RJK A;  1FOD 3;  3AVS A;  3LSE A;  1PGW 1;  3NV1 A;  1DIW A;  1LOF C;  4HLT A;  4URT A;  3RPQ A;  3LGR A;  4GH4 C;  2DVG A;  1BZW A;  2FDG A;  5FXX A;  1OLR A;  3EB7 A;  5EYX A;  5FJH A;  5GLW A;  1JYV A;  5JXI A;  2HH9 A;  2GDF A;  4D6R A;  2DBI A;  2ZHN A;  3BU7 A;  1XU1 A;  4HPK B;  2X8K A;  1J1T A;  2DUO A;  1UZZ A;  3S7E A;  3WW1 A;  2Q1Z B;  4AVV A;  2LAL A;  3H8R A;  2V09 A;  4TSV A;  3IPV B;  2OVU A;  2Q4S A;  2WKK A;  2WLP A;  4IEW A;  1ZRR A;  3QLQ A;  4FP2 A;  4QX1 A;  4B7K A;  3ZIW A;  2VW0 A;  1W9T A;  2G9Z A;  3BOD A;  3M8L A;  1PO1 1;  1ODM A;  5BNO B;  4X8N A;  5FY4 A;  2WZR 1;  4XFG A;  2QKD A;  2BNO A;  3NWK A;  5FLI A;  5CB7 A;  4LO5 B;  1V6O A;  4FAH A;  4FFG A;  3JUU A;  4AED C;  3JQW A;  5IVY A;  3R6S A;  4Q26 A;  1WD4 A;  2ID4 A;  4QHZ A;  1EP0 A;  2PLV 1;  4BME A;  1PMJ X;  1W8W A;  1SFP A;  2D6P A;  2DU0 A;  1SLC A;  3SC7 X;  5KHK A;  1W2A X;  4CDW A;  1MZF A;  5AFB A;  2D6O X;  4O7X A;  3ECQ A;  2IXH A;  1H1M A;  3FWE A;  1XYP A;  3M4F A;  4EWD A;  2G9G A;  1NLS A;  1W3X A;  5GLU A;  2NN8 A;  3MIG A;  3MIB A;  4I0A A;  2CGN A;  2D7F A;  3HR9 A;  3RZM A;  1L7R A;  4IV3 B;  4I0B A;  1EPW A;  1XSR A;  2NQY A;  5BNN B;  5J7M A;  3VBS C;  2XHN A;  1ZVF A;  4RHV 2;  3RI9 A;  2ARE A;  4MG2 A;  2R7E B;  4CVU A;  3HQX A;  3DXU A;  3NMB A;  2GAL A;  3VHN A;  4NAM A;  3BIW E;  4CDU B;  1M4W A;  4Q8K A;  3PNA A;  3T4H B;  4B4P A;  3CIH A;  1CPN A;  1UMI A;  3O1R A;  1QOS A;  1QH7 A;  2JDM A;  1GLH A;  1LTE A;  2R16 A;  1GMM A;  2ZGK A;  3AM2 A;  2VUA A;  2Y0I A;  4O9E A;  1GQG A;  4H55 A;  4FPF A;  4LA2 A;  4XJU A;  4Q4Y 3;  3RNS A;  5FY7 A;  1O3Q A;  4PI2 A;  4BYY A;  2E6V A;  1TZO A;  2BGC A;  4XFA A;  2EIC A;  3E5U A;  2X29 A;  2G4I A;  2BYV E;  3ST7 A;  4Z92 B;  4WM8 A;  3SXW A;  2GP5 A;  2WAB A;  5CKQ A;  3O14 A;  1GKB A;  1F9K A;  1TME 2;  4JV4 A;  1H6Y A;  2QQK A;  3AXD A;  5DUV A;  2CWM A;  2ZTN A;  2XXZ A;  5LBB A;  5LA2 A;  2XL7 A;  5ACA 1;  1NA1 B;  2K0G A;  1RUG 3;  1PO2 1;  2RM2 2;  3I2H A;  5BNO C;  1BMV 1;  4Z07 A;  1AR7 2;  4IGO A;  1J83 A;  4WM7 B;  1MS3 A;  4GB3 3;  1QNY A;  1H6X A;  3VKO A;  4Y3O A;  3PDQ A;  3HBK A;  2J42 A;  2C4X A;  4K8R B;  2MPF A;  4HKW A;  4EYU A;  5GLT A;  3J4U H;  3MF6 A;  4Y1X A;  3WVJ A;  4COY A;  1GSL A;  2HWE 3;  1I3H A;  2P4E A;  5FYI A;  1UPI A;  2YU2 A;  2ZGQ A;  5CKN A;  1VBE 1;  5L9V A;  1AL2 3;  3DYO A;  1CX4 A;  2JD4 A;  1A6C A;  2WDB A;  2QZ3 A;  1QF3 A;  1UIK A;  3GZT B;  4XET A;  4YRD A;  3VBH C;  2ZMK A;  1X8M A;  1BEV 1;  2RS1 1;  1DGW X;  3LWC A;  3Q8C A;  5T5O A;  1ZBA 1;  1XYN A;  2OS2 A;  2VMC A;  1EPZ A;  1NQD A;  2BVB A;  3N9P A;  4TLG A;  5E6H A;  3BOW A;  1MEC 2;  4IV3 C;  5E89 A;  2J1S A;  3I54 A;  1CAV A;  5H9Q A;  2WQ4 A;  4YPJ A;  4LK6 A;  3SH4 A;  1H8V A;  2W39 A;  4YG0 A;  4AQ6 A;  1OKQ A;  3GF6 A;  4UYB A;  3K3N A;  1RUD 1;  3N36 A;  3VHR A;  3ZDS A;  2P2K A;  4NRO A;  3POG A;  1UZW A;  1O91 A;  1HRV 2;  2PAK A;  3EXU A;  3U10 A;  4LBQ B;  3VD9 A;  5FLH A;  4XF1 A;  3P6B A;  5DAV A;  4QPG A;  3ACG A;  3ZN6 A;  3VDB A;  5BV6 A;  1RUE 1;  2AEY A;  4XJW A;  3POF A;  3LA3 A;  1G9C A;  1RVF 2;  2JIG A;  4Y5T A;  4BQX A;  1JYI A;  1VR3 A;  3WP4 A;  3BUC A;  2DUR A;  1DCS A;  2RR1 3;  3FFQ A;  1QJU 2;  3HNY M;  1N47 A;  4JQR A;  4JKL A;  3DYP A;  4NPL A;  4RGK A;  5LBE A;  4OI1 A;  5FYM A;  1MZ6 A;  5B4N A;  2G9F A;  3W5N A;  1B35 B;  1JU4 A;  4AVT A;  4NOT A;  5LRR A;  5DUX A;  4ZKT B;  4IEV A;  4Q4X 3;  3B01 A;  4UFM A;  4J25 A;  4LIU A;  4XFH A;  1GP4 A;  1RMU 2;  5C7G A;  3HN3 A;  4QX0 A;  4WM7 C;  4FQZ A;  1M06 G;  2E26 A;  3J8F 3;  1C1F A;  3UES A;  1X82 A;  4YGB A;  3WX5 A;  4B7E A;  5A3T A;  1WMF A;  1PGL 1;  2EA7 A;  3NJX A;  1W6O B;  1CPM A;  1R1A 2;  2B8M A;  4AHZ A;  4CSW A;  1IS6 A;  1FPN 2;  1O8S A;  4HK9 A;  4Y5Z 0;  3NVC A;  4YW7 A;  5FZL A;  3LFM A;  4ATF A;  1RED A;  2ZAH A;  3WNL A;  3JB4 C;  3O12 A;  4IEP A;  4C1W A;  3FMG A;  2JKB A;  1ENX A;  2NMN A;  4QB6 A;  3IKW A;  3POJ A;  4UOJ A;  5EJ3 A;  5HI0 A;  4V2V A;  5C8W A;  4IV1 B;  4CCD A;  5GJ6 A;  2XWJ B;  4LBO A;  1VAK A;  3PVE A;  5KXC A;  3WF1 A;  2WNV B;  1S0E A;  2YFZ A;  4XQ4 A;  2DDU A;  2WNU B;  1YQ2 A;  4IL7 A;  1LOG A;  4M3C B;  2HWB 1;  1J3P A;  2PHU A;  4Y1Y A;  3I2O A;  4MZU A;  1BK1 A;  2VJX A;  4EZ4 A;  2OT7 A;  5FMO S;  5I0T A;  3ZX7 A;  3KWV A;  5JSO A;  3RZK A;  2YXS A;  4J1W A;  4NIA A;  3VKM A;  1O4T A;  1MVE A;  1QEX A;  1EAH 2;  2I2S A;  1WW6 A;  2XQR A;  4LOT A;  4MO3 M;  3O0W A;  3JBG 1;  5ANN A;  4FXK B;  4LK7 A;  3HT2 A;  3IN9 A;  5DDJ 2;  2Y6J A;  3THP A;  3H42 B;  4DEQ A;  3O1V A;  4L2N A;  1S4C A;  5CFC B;  4NHM A;  1O5U A;  3D8C A;  4LE4 A;  3FN9 A;  2BNM A;  3EHK A;  5CKM A;  5LA0 A;  2R0H A;  1ND2 B;  1GP5 A;  4B4R A;  4D3W A;  5A3L A;  3TEY A;  2ZEY A;  3E6C C;  1W03 A;  4BB3 A;  4H7M A;  1JOB A;  1IZ3 A;  3ES1 A;  4XDP A;  1T6G C;  2O8O A;  3WNP A;  3GCX A;  4QPW A;  1I5P A;  4YGD A;  5C8C B;  2DTY A;  2KA3 A;  2VMD A;  1LHO A;  4ZU7 A;  4MVT A;  1PGW 2;  1VAM A;  4P5H A;  1RB8 G;  4A3Z A;  5FRA A;  1AF9 A;  3ETQ A;  1LGN A;  4P5Y A;  3VZN A;  4O9G A;  1VJ2 A;  1GYK A;  1EV1 1;  3N7M A;  2YPD A;  2JD9 A;  3OD0 A;  2VC9 A;  2JG9 C;  3PU3 A;  2NZ9 A;  4FFI A;  2GU9 A;  4I02 A;  4LNV A;  2YB7 A;  2XHK A;  1V0A A;  5HPO A;  4FPL A;  3KV5 A;  3A21 A;  3IBM A;  1AHS A;  3N9M A;  2A6Y A;  1RVF 3;  3G7D A;  4IV1 C;  2EIE A;  2W9X A;  1XNB A;  4UFH A;  2MEV 1;  1IPK A;  2V4A A;  2WNV C;  2FBE A;  2HYX A;  2QUO A;  3MIH A;  2BVV A;  2RG4 A;  5EJ1 B;  2W5F A;  3ZFE B;  4D0Q A;  5IYY A;  4Q1P A;  1K42 A;  4IEQ A;  1A34 A;  1IPJ A;  5BNN A;  1G9A A;  4MHR A;  4QX7 A;  4GIQ A;  5A3O A;  3LDB A;  2RDN A;  1QJY 1;  4MUV A;  1OD3 A;  5GZD A;  4CDU A;  1Q3E A;  5JSP A;  5CA6 A;  2Q0A A;  2ZGU A;  3GBF A;  4TXW A;  5JZG B;  5CEH A;  2ES3 A;  5FYT A;  1ENR A;  3BN6 A;  5CFC C;  1WWY A;  2WS9 3;  5FUN A;  1R1A 3;  3EJK A;  5KBF A;  1ND2 C;  5IWF A;  1AZD A;  3PHM A;  2RMU 3;  4LIT A;  3GHM A;  3AP9 A;  4IER A;  4CP2 A;  1JYW A;  3B94 A;  3WZ1 A;  4COW A;  3PJQ A;  2ZGO A;  3NJZ A;  1IS5 A;  2FDH A;  1S2E A;  1REE A;  4NE9 A;  2VME A;  1LKN A;  1RJ7 A;  1RXF A;  2AYH A;  4H3W A;  2W52 A;  5C8C C;  4E9K A;  5IAV A;  3VBO B;  2XJR A;  4CDQ B;  1NA1 A;  2UWA A;  2HWC 1;  4TN7 A;  1F35 A;  1FOD 1;  1Q8P A;  4FXG B;  4WM7 A;  1STM A;  3H7Y A;  2PHL A;  1IG3 A;  2J1T A;  4MSV A;  2VMG A;  1JZ8 A;  5FZ4 A;  1ZM1 A;  3D4K A;  1X36 A;  1XC6 A;  3M3E A;  3PUI A;  2BGP A;  1X50 A;  2YC4 A;  3NQH A;  1KQR A;  4YFW A;  5ACA 2;  1PO2 2;  3NST A;  5A7O A;  4MXW B;  1UYZ A;  2ZGL A;  3GDB A;  3POE A;  1O4Z A;  3LQC A;  4JX0 A;  3KT4 A;  4RFT 0;  3WG1 A;  1UXZ A;  3ZYI B;  1FMD 2;  4BWO A;  4CCJ A;  2BBV A;  2EIB A;  1HV0 A;  2PXJ A;  2GME A;  3PTY A;  4XMA A;  2ZAB A;  3ZFE C;  2VM9 A;  1DHK B;  5C3Q A;  3MIC A;  3OPT A;  5FP8 A;  5FLJ A;  2D6K A;  1DYK A;  1X9P A;  2Z42 A;  3SMH A;  3AKQ A;  4HMZ A;  1E5H A;  2QQI A;  2K46 A;  2D5F A;  1HX6 A;  5JZG C;  2EXK A;  5HXV A;  1ZZC A;  1OXC A;  1XRU A;  1BEV 2;  2VQ0 A;  2RS1 2;  3P5B A;  5APA A;  5HCA A;  2PMW B;  4FO9 A;  1PK6 B;  2PYT A;  4LBQ A;  1ZBA 2;  3LZZ A;  1SLT A;  1UCX A;  2VQA A;  4LLF A;  4PF1 A;  4QGL A;  3ENR A;  1YUD A;  3KVA A;  3OUH A;  4WZC A;  1R64 A;  1Z7S 2;  2NYY A;  3I3B A;  3WR0 A;  2A73 B;  1VAL A;  4G4F A;  3BPS A;  2B5H A;  3TN9 3;  1Q8O A;  4Q0S A;  4M4R A;  5F6L B;  1DQ0 A;  4ZY9 A;  3KV4 A;  1N1S A;  3CJI B;  2OXB A;  4XBQ A;  5GAL A;  1Y9Q A;  2Y6H A;  3VBO C;  1B35 A;  3ZLI A;  4G9S B;  4XUO A;  2CAV A;  1E5S A;  1OFN A;  3L2Y A;  5FK7 A;  3ZYP A;  4NWV A;  3WCS A;  4BMB A;  3GHN A;  2B46 X;  1Q8V A;  1RUE 2;  2P17 A;  3B00 A;  4Q4Y 1;  4YVW B;  3RSJ A;  3VD5 A;  4CPB A;  4AHW A;  4A2U A;  4FOV A;  3RS6 A;  3SEE A;  3ZXD A;  5JMO A;  1OH3 A;  5E88 A;  4K21 A;  5EPA A;  5FWJ A;  1W6O A;  1JYT A;  1E5I A;  1HQL A;  2UYA A;  3WCR A;  3WXP A;  2Y6K A;  5CG8 A;  1QDC A;  3FJS A;  3III A;  2VCA A;  1SLL A;  5JIA A;  1RUG 1;  1UAI A;  1SLI A;  2A6V A;  3MID A;  2E7Q A;  3OPW A;  4KGG A;  4C91 A;  4EN8 B;  1CZT A;  4XJ8 A;  2R06 2;  5L9B A;  4OCT A;  5HV0 A;  3AL6 A;  3KV6 A;  4GB3 1;  1EUU A;  1LGC A;  1AR8 2;  4E2S A;  3CNA A;  4IV1 A;  3LD8 A;  1TMF 3;  1LEN A;  4GA9 A;  4DIN B;  1PGL 2;  1PVC 2;  2KR2 A;  4ES9 A;  2Q8C A;  1W6N A;  2RVA A;  2WNU A;  4M3C A;  1WBF A;  2HWE 1;  4QKB A;  5GLZ A;  3S5A A;  5F7U A;  5JOY A;  2VG9 A;  5DXD A;  1R09 3;  1AL2 1;  5F2S A;  1REF A;  3ZYB A;  2WT1 A;  3U4S A;  3ZYF A;  1RIT A;  3WW4 A;  1GWM A;  3GJA A;  1TNF A;  1YHF A;  1PK6 C;  3WIN E;  1H1A A;  5JI7 A;  1KDM A;  4I3G A;  5BY5 A;  1X7N A;  1LAJ A;  1LUL A;  3RGB A;  5FXZ A;  5CFC A;  3WNO A;  1U0A A;  4NO4 A;  2ERF A;  3RJR A;  2HWB 2;  2TUN A;  2YBS A;  4QB1 A;  4CZS A;  4BK5 A;  4ATE A;  3HD8 B;  1SCR A;  3ABZ A;  3CJI C;  1DYO A;  4XCA A;  4DMI A;  1H8T A;  3RDI A;  4ZS2 A;  3R4S A;  3EMR A;  5JLV A;  2A6Z A;  4ARY A;  1SHW B;  3T2P A;  4LUM A;  3JBG 2;  2XR4 A;  2H6B A;  3AKR A;  2Y6G A;  3AYA A;  3IDA A;  1SLA A;  5F5I A;  3I2K A;  3OBA A;  4CE8 A;  3OYW A;  5C8C A;  2ZML A;  4YVW C;  1HXS 3;  3CF6 E;  1SBF A;  4HOO A;  3UKN A;  4AF9 A;  2EID A;  1LRH A;  4MH0 E;  5J36 A;  1WCU A;  1GOG A;  2C9K A;  3KZ4 C;  1S55 A;  5JXJ A;  2RR1 1;  5FCC A;  1G9F A;  3L9J T;  4QAW A;  1UX6 A;  2CU5 A;  3MYX A;  3OPZ A;  5C9A B;  1BQP A;  3ZYJ B;  4FPH A;  1CJD A;  4SLI A;  5D1I A;  3WV6 A;  4XBL A;  5BNQ A;  5C6C A;  1AR6 3;  1MS5 A;  1OUR A;  4Q4X 1;  5IK4 A;  3BTX A;  3RJ2 X;  1Z7S 3;  3WW2 A;  4NRP A;  5DZG A;  3ZXJ A;  3J8F 1;  1V6N A;  4QQ2 A;  1HKD A;  4LBJ A;  3LB9 A;  2VEC A;  3MDP A;  4RHV 1;  4IES A;  1MQT A;  5GKA C;  2XH6 A;  3CQO A;  3H1M A;  3KV9 A;  2JIC A;  3AZX A;  5LW9 A;  3BI3 A;  1ZBE 2;  2Z69 A;  1JYC A;  3HAG A;  3ACL A;  3M2M A;  1OA3 A;  1WW5 A;  1XPW A;  3MLL A;  2TNF A;  1C28 A;  2WFF 3;  3ILF A;  4MYE A;  2ORX A;  1QXP A;  2V5Y A;  3KHB A;  4J6G A;  4W65 A;  3SH5 A;  2Z79 A;  5FFO C;  4JKM A;  2WT0 A;  4OMC A;  1S0D A;  5JZG A;  1AX2 A;  1VBA 3;  1ZZ8 A;  1ASJ 2;  2MEV 2;  2WWJ A;  3D82 A;  3KLS A;  3R0R A;  4LE3 A;  3INA A;  4K40 A;  4BHP A;  3FL7 A;  5HXM A;  2Q1F A;  3MW2 A;  3RYR A;  4AFA A;  1ONA A;  2XL9 A;  5FP7 A;  1W0N A;  3DPR C;  2WAA A;  4LOR A;  5FJK A;  5A7N A;  4Q4W 2;  4JAA A;  5DZE A;  2ADD A;  3PMS A;  4NWW A;  1QJY 2;  3ZIX A;  2IUW A;  2HWF 3;  2YYO A;  4NPR A;  4EN9 B;  4ZZ5 A;  1CIW A;  1W2U A;  2RE9 A;  3D3A A;  3GZA A;  4GWI A;  1ULC A;  3AYD A;  5A3P A;  4XUN A;  2BGO A;  3A23 A;  5JAX A;  5JOW A;  4AWD A;  3LCP A;  3M3I A;  2W1Q A;  2E31 A;  4IE4 A;  5CU1 A;  3WDX A;  4CDQ A;  2VO5 A;  3CZJ A;  1LB2 A;  2CDO A;  2DFC A;  1CAU B;  4NII A;  1QJZ A;  2BJS A;  4XFI A;  3TAY A;  3N9N A;  4IW3 A;  1O6U A;  3WOG A;  3VBU B;  1AR9 3;  3NRU A;  2ARB A;  5IVE A;  5J96 B;  3O1M A;  4IDZ A;  5IVC A;  2A1X A;  3ZFF B;  4DY3 A;  2AEZ A;  4WZF A;  4AGG A;  4XEZ A;  1XNT A;  1H4G A;  2VBP A;  2AZ5 A;  2P3Y A;  4EZH A;  2N7G A;  3ACF A;  1IG0 A;  4OUS A;  2CNA A;  3P1I A;  2JWP A;  2HLE A;  5IJR A;  5IVF A;  1FOD 2;  4MXW A;  5C3S A;  5FBZ A;  5F5C A;  5J98 B;  2BBA A;  5FPZ A;  1ZZB A;  4XFF A;  3CO2 A;  3O1U A;  2FDF A;  4CCC A;  1HW5 A;  2ET1 A;  4A4A A;  3HN1 A;  3GZU C;  3N9Q A;  1PNF A;  2P3I A;  3W20 A;  3OGS A;  1XXN A;  2TBV A;  4XTM A;  4KGQ A;  1COV 3;  1KGY A;  1IPS A;  4L9B A;  1UU6 A;  2OZ6 A;  5JDB A;  1RVF 1;  4R9D A;  5GZF A;  3H50 A;  4LT5 A;  5GZG A;  1QQP 2;  2QQP A;  2ZGR A;  3CEW A;  1ENS A;  3SCH A;  3OEB A;  4E4S A;  3MV0 1;  5FZC A;  2TEP A;  4OVE A;  1K5M B;  2VTF A;  3ZMN A;  2FZ2 A;  1RMU 1;  5AFE A;  4BE3 A;  3CJI A;  2VQU A;  3U0Z A;  2WZE A;  4WM8 C;  4CXY A;  1XNC A;  2ZBJ A;  5JVV A;  3ZYG A;  2WWS A;  4YVS B;  4NPM A;  2VVF A;  2KM2 A;  1DF0 A;  1KJR A;  1LED A;  2FCT A;  2XB6 C;  1JI6 A;  1R1A 1;  1HLC A;  3N35 A;  3VBU C;  4YVW A;  1ULE A;  3N7L A;  2RMU 1;  2Q8D A;  4F8A A;  2C26 A;  2WR9 A;  3S57 A;  5C33 A;  4QPI A;  5F8P A;  5GM0 A;  1NZI A;  4V2W A;  3VGI A;  1BBT 3;  1D7P M;  4AI0 A;  1LES A;  1YWK A;  4OQ8 A;  4QXC A;  1ALY A;  1QH6 A;  5T50 A;  3RZJ A;  1ASJ 3;  4RFR B;  1RUH 3;  1JN2 P;  4CEW B;  1Q56 A;  4WVW A;  4Y4R A;  2VAU A;  2RDS A;  1UOF A;  2ZEZ A;  3MLJ A;  2FHR A;  2KXL A;  1ZZ6 A;  4W4Z A;  3WSO A;  2VXR A;  4Q4Y 2;  1KS4 A;  3B9I A;  3KB5 A;  4WVM B;  4XQD A;  5T3N A;  2F4L A;  2LUW A;  1D0H A;  3V0A B;  1CWP A;  3O1S A;  4Q4W 3;  1K5J A;  1W8T A;  4XAC A;  5HBA A;  4HKL A;  4OUM A;  5CG9 A;  2VE1 A;  1NX9 A;  4KNC A;  2PTM A;  3X29 B;  2CDP A;  4W50 A;  5LBC A;  4BJ0 A;  3IZO A;  3DUI A;  5IAX A;  1VBD 3;  1K12 A;  1RUG 2;  2Y6F A;  4I2O A;  1T2X A;  1WUV A;  5EXO A;  2WT2 A;  2JEC A;  4Q5O A;  3MFC A;  3T2Q A;  4GB3 2;  4M01 A;  3VHP A;  1UZY A;  4CCE A;  4Q27 A;  4S2F A;  3BPZ A;  3DGT A;  5A80 A;  5JI9 A;  5T5J A;  5FZE A;  2VOX A;  4W6X A;  5BNP A;  2FDJ A;  1XSQ A;  3RRD A;  2YC0 A;  3ZYR A;  4ET7 A;  2YDE A;  3T08 A;  1K5M C;  2HWE 2;  3T4V A;  1OQ1 A;  3TB0 A;  2VCB A;  1HJF A;  2LRP A;  1AL2 2;  4YGE A;  5DAW A;  2B42 B;  3ZR5 A;  4HVR A;  5I93 A;  4B4Q A;  2EVX A;  2V73 A;  4LR4 A;  2BW8 A;  2RDQ A;  3WQ0 A;  2PHD A;  5F9T A;  4KU8 A;  2Y38 A;  4A42 A;  4BCU A;  3C7G A;  3NAP B;  4RR3 A;  2W92 A;  5IT6 A;  1HN0 A;  3TN9 1;  1YNA A;  1VMJ A;  3I59 A;  2VY0 A;  2JB4 A;  4YZ5 A;  4QKD A;  3AVR A;  5JOZ A;  4C90 A;  4YW5 A;  4JCK A;  2VZU A;  1F15 A;  1LEC A;  2ZEX A;  1B09 A;  1W9S A;  3KQR A;  3WNK A;  3OD4 A;  2DWR A;  5C9A A;  2VZV A;  4CEW C;  3O7O A;  5AC9 3;  2GMP A;  4MGI E;  2ZHL A;  2J1U A;  5AVP A;  4Q29 A;  1QQP 3;  3U14 A;  1YQ5 A;  3GGL A;  1KJL A;  2WQ8 A;  4IE7 A;  3JQX A;  1PZ8 A;  5HV4 A;  2Z2S B;  2DV9 A;  5DG1 A;  5JMC A;  5FBJ A;  3NNF A;  1J3R A;  4HVO A;  5A32 B;  1ULO A;  3TWI A;  3POB A;  4AI1 A;  1GAN A;  3NKT A;  2RR1 2;  3OB8 A;  3POY A;  2NM1 A;  3VDA A;  2QQO A;  2HEW F;  4KBB A;  3SHR A;  3TNP B;  2R04 2;  3H1W A;  4KWJ A;  4Q4X 2;  4XZP A;  4GJY A;  2R1D A;  5F1R A;  1HRI 2;  3POI A;  1WLD A;  2ATF A;  3I2J A;  5FY1 A;  3J8F 2;  3QCW A;  2X10 A;  4D69 A;  1SQ4 A;  3MF9 A;  4P9L A;  2W68 A;  1JUH A;  3HJR A;  1WCS A;  1GV9 A;  3KCC A;  4R8H A;  1PX3 A;  5FWE A;  3GCW A;  1TMF 1;  1O3T A;  3TEZ A;  5FZF A;  1VB4 A;  2WUH A;  3AJY A;  3Q8B A;  1OHF A;  1PM7 A;  1XB9 A;  1PNG A;  1CON A;  1WME A;  5K4L A;  4Q0Q A;  1UOJ A;  1W8F A;  3IIA A;  2XUM A;  4C0B A;  5J48 A;  2CYF A;  4QM8 A;  1OLM E;  4COZ A;  3CHX A;  5C71 A;  4QXK A;  5IAT A;  2VMH A;  1MS4 A;  1PMH X;  1POQ A;  2VMF A;  1DLL A;  4JHZ A;  4COU A;  1BK0 A;  3K77 A;  3VUO A;  1UKG A;  5J37 A;  1US3 A;  2WN2 A;  2X5I B;  4LO6 B;  3BTA A;  2C0Z A;  4GMP 3;  5L9R A;  4XUT A;  5LEJ A;  4P08 A;  1CAU A;  2CAU A;  1OI6 A;  3GBW A;  4Y4Y A;  5D8A B;  2W1U A;  2HWD 3;  3KCY A;  1MS0 A;  1UU4 A;  2YHJ A;  3VBU A;  1UY4 A;  2ZHK A;  4BQ4 A;  1IS4 A;  1I6X A;  4F83 A;  3MUY 1;  4P9J A;  3PLQ A;  3ZFF A;  4NIG A;  3T0D A;  2ZMN A;  5F3C A;  1N1V A;  1GU3 A;  5EHD A;  4FOY A;  4BA6 A;  5JCT A;  3QBQ A;  1FMD 1;  1LR5 A;  5LAT A;  2WYS A;  4QQL A;  2E9Q A;  4GKX A;  3AZY A;  5DAX A;  2GND A;  4I01 A;  2ENR A;  1A78 A;  3ZO0 B;  1HXS 1;  2UWB A;  3MPB A;  3OOX A;  4OZO A;  4EN7 B;  1GIC A;  4QQH A;  1V9U 2;  4RL7 A;  3ZKU A;  4AFC A;  3H9A A;  4BIF A;  1XU2 A;  1WCD J;  5LAS A;  4QKF A;  3HPN A;  5F3E A;  4AI8 A;  3E5Q A;  4Z82 A;  1QIQ A;  3K51 A;  2WSV A;  1W8O A;  3BB6 A;  3Q8F A;  1AR6 1;  2EAK A;  3MI8 A;  3NO8 A;  4QHO A;  5IUQ A;  3TNQ A;  4K1Z A;  3GYD A;  4N53 B;  4LKD A;  1Z7S 1;  2Y34 A;  3ILN A;  4I3P A;  3VZO A;  2BFU S;  4A44 A;  5BNN C;  1O4Y A;  2E7T A;  4XJZ A;  4XUR A;  3UJQ A;  3ZXA C;  1YLL A;  4CDU C;  3LKJ A;  2BOI A;  2YZ4 A;  4PI0 A;  1HB4 A;  2ZX4 A;  2P34 A;  2V72 A;  3PME A;  4JHT A;  3QH6 A;  3VDC A;  4WV8 A;  3POW A;  2QNK A;  2VNV A;  3VL8 A;  4EQV A;  5LA1 A;  5EYY A;  2YV8 A;  4A45 A;  2ZGT A;  4RYD A;  5FMB A;  2VPV A;  4G3Y C;  3RZG A;  1K5M A;  1VIW B;  5A70 A;  1ZRE A;  4M3C F;  2WFF 1;  2X53 S;  4N43 A;  1SMV A;  2E51 A;  1H1I A;  1VP6 A;  2GSY A;  3LPG A;  3N7J A;  4NIH A;  2YMZ A;  1JZ4 A;  4XF4 A;  2ZX3 A;  3U11 A;  1L3J A;  1VBA 1;  1GR3 A;  4LKS A;  3AB0 A;  1POV 3;  4NRM A;  4PCR A;  1GOF A;  3LAG A;  4YVS A;  4AFD A;  1OPO A;  2AUY A;  1CIY A;  2WL1 A;  3OGR A;  3PVN A;  4K1Y A;  1QY4 A;  4IEU A;  4K9S A;  5CFD B;  1NA1 C;  3OG2 A;  2R04 3;  1O5L A;  1SFY A;  3KCX A;  1LU1 A;  4HK8 A;  5CIR A;  3W5M A;  1RUI 3;  3BTZ A;  1HRI 3;  4QGN A;  1SFN A;  3DCQ A;  1PZ9 A;  3DXT A;  2HJI A;  5IFT A;  2HWF 1;  2R06 1;  3SKJ E;  1JHN A;  5A1A A;  3LFI A;  5KWR A;  1Z78 A;  4I30 A;  4TTG A;  3FE5 A;  4RS5 A;  1AR8 1;  5I8Y A;  5LZ6 A;  3FBY A;  1YQ8 A;  4CEW A;  1KEX A;  1PVC 1;  2G19 A;  2WS9 2;  2OX0 A;  3UGF A;  3ZXG A;  4LO7 A;  3JXS A;  4WVM A;  4FI9 A;  3MEP A;  2RMU 2;  1N3O A;  1AR9 1;  3B9C A;  3K3O A;  3MUZ 1;  5A33 B;  3V0A A;  1ZA7 A;  2E32 A;  1BHG A;  1DGW A;  2D6M A;  2XVL A;  3NNJ A;  4MGS A;  5FIX A;  4ASM B;  3H3U A;  4BQ2 A;  5T54 A;  5FUP A;  4QM9 A;  3H7J A;  1IQD C;  1QU0 A;  3HQR A;  5DG2 A;  4YNI A;  1BVV A;  4OLL A;  4XDO A;  5F5Q A;  4UFK A;  1W6N B;  2WAO A;  3PUH A;  2VBD A;  1OUS A;  5D21 A;  1Q5O A;  1YJL A;  2BRT A;  3C2U A;  1O59 A;  5TSW A;  3W59 A;  2QQV A;  4IGP A;  1DQ4 A;  4Y1U A;  2P3K A;  2ZEW A;  3PIG A;  1GZT A;  2GZW A;  2IFR A;  2VUJ A;  3NW4 A;  3WUC A;  1NY7 1;  1ND3 B;  2XKO A;  4IGQ A;  2XKP A;  2RDR A;  2B45 X;  2WZP P;  3LDK A;  2AC1 A;  1W05 A;  2XJQ A;  1UD1 A;  1OVS A;  1QMJ A;  4QMA A;  1COV 1;  4IE6 A;  3M1H A;  2ZKL A;  1V9U 3;  5I8S A;  2EAL A;  1WA4 A;  2FDK A;  1FXZ A;  2DYC A;  2IVI B;  4CCK A;  5K7P A;  1H8T B;  1B35 C;  3NAP A;  2GNM A;  2ZX0 A;  1F8V A;  2EIG A;  4HET A;  1J59 A;  3HT1 A;  2D6N A;  3Q9O A;  4Q4V 3;  3PTR B;  3T30 A;  3D0J A;  5E1R A;  5K8S A;  3OYW B;  4H7L A;  2GH8 A;  4IQP A;  1HN1 A;  4MET A;  2ZGM A;  3BTY A;  1DQ1 A;  3C7H A;  4D7S A;  2A71 A;  2MNG A;  2R32 A;  2WQZ C;  4LOS A;  4NHY A;  3FX3 A;  2VZQ A;  3B7M A;  3U07 A;  3ME2 A;  4TLF A;  1UN1 A;  1OD5 A;  4GWN A;  4CP9 A;  3BVC A;  2O8Q A;  1ZBE 1;  3J7M A;  1S0J A;  2KD7 A;  2HKX A;  3ORJ A;  5I0U A;  3THD A;  3TN9 2;  2W0X A;  4AI3 A;  4NVP A;  4BH9 A;  2BDR A;  1G6N A;  1OFS A;  1D4M 3;  4LHL A;  4NMI A;  4YZ3 A;  4EE2 A;  5A32 A;  5DMY A;  1I9R A;  1DP0 A;  3MZH A;  4IEX A;  4AI9 A;  5HCH A;  2D3R A;  3AYE A;  3DKQ A;  1WZX A;  3HNM A;  3HWJ A;  3AYC A;  1BBT 1;  1C1L A;  2VNR A;  1OA2 A;  1N3P A;  1ASJ 1;  1MQT B;  3WDW A;  2HBU A;  3OUJ A;  3AP4 A;  1WLW A;  2EF6 A;  2WNU C;  4RGA A;  1QOO A;  1ZZ7 A;  4FAG A;  2IXC A;  5GLV A;  2XJV A;  1MR5 A;  5IVB A;  4CUG A;  2B39 A;  4TZD A;  2JDA A;  2Y60 A;  4Q4W 1;  5FYU A;  1MZ5 A;  1UY2 A;  2XGX A;  2O14 A;  5FZ0 A;  2XBO 3;  4AZZ A;  3NNG A;  4XW3 A;  1JOP A;  1IGO A;  2JX9 A;  2VL4 A;  3Q8E A;  4FBF A;  1UY3 A;  2D3P A;  4W6W A;  3V56 A;  1XOY A;  5FZH A;  4DO0 A;  2B7Y A;  5FYV A;  1BKZ A;  3AJZ A;  1WA6 X;  3SNM A;  1W0O A;  4JKK A;  1ZYB A;  3H1Y A;  2NP0 A;  4JTN A;  2LS6 A;  3VV1 A;  3ZN4 A;  2UY9 A;  3ATG A;  4L97 A;  4LJH A;  5FYZ A;  2CV6 A;  3K46 A;  2JIJ A;  1H8T C;  2X5I A;  1TMF 2;  4QX3 A;  4UI9 L;  5K9Y A;  1N1Y A;  1LHN A;  2BWA A;  3AFK A;  5D8A A;  5GZE A;  1J84 A;  3APB A;  3O1T A;  2ZX2 A;  5BPX A;  4ZU5 A;  2LM3 A;  2WNE A;  3AMP A;  1R09 2;  5DAB A;  5FO8 B;  2CGP A;  2ZGN A;  3UET A;  3WLU A;  3N9O A;  2XJT A;  2D44 A;  3BAL A;  4FSJ A;  1G7Y A;  1NT0 A;  1W3V A;  3WDY A;  5LWB A;  3AC0 A;  4JRL A;  3HBZ A;  3ZPY A;  1RUF 3;  2FDI A;  4AVS A;  3E1F 1;  5A6X A;  3VKN A;  4NHK A;  4QX2 A;  1QJE A;  2JE9 A;  1JMU B;  4AXO A;  4E2G A;  3IDB B;  2WSU A;  3AP5 A;  1H2N A;  1ULG A;  1W04 A;  4UFL A;  4XYX A;  1YQ6 A;  3A0N A;  1C8M 3;  2VCM A;  1XE8 A;  1O3S A;  3B5L B;  4QXB A;  1MPX A;  1VBC 2;  1NLR A;  3GXU A;  4E27 A;  4AEK A;  1MQT C;  3KQ4 B;  5FDB A;  3WDT A;  5AC9 1;  1VB2 A;  1Z0H A;  3R4D B;  1QDO A;  1HXS 2;  1LCL A;  1NXD 1;  1QQP 1;  2W94 A;  4N53 A;  4CA9 A;  1AYM 3;  3GNE A;  5E16 A;  2IWG B;  4IEO A;  3O0V A;  1DBN A;  4JGZ B;  3VZL A;  1HDK A;  2K9Z A;  4BQW A;  4DFS A;  4XHX A;  2BEO A;  3LIG A;  2WYF A;  1LGB A;  2CWS A;  1AR6 2;  2JE8 A;  4LTA A;  1UZV A;  3AZZ A;  2XVK A;  2DUQ A;  4HFS A;  4JC1 A;  3B02 A;  1C4R A;  2NPI A;  5A1F A;  1UX7 A;  4LBK A;  1HB1 A;  4UBG A;  5DUU A;  3ZDV A;  2Q1M A;  4YYO A;  4BOW A;  1ZRF A;  3C7F A;  3EO6 A;  4FP3 A;  1VRH 3;  1E5R A;  1UPS A;  5ERL A;  5CFD A;  1GOH A;  3ACH A;  4CDQ C;  5FYC A;  3EYP A;  3U78 A;  3VZJ A;  3J7H A;  1TE1 B;  1U5Y A;  2P5B A;  1BXH A;  4KWU A;  2WFF 2;  2H0B A;  4LEJ A;  3ZMO A;  1JZ2 A;  3FUO A;  4GUL A;  1PMI A;  1S2B A;  4DQA A;  5I0R A;  1LOA A;  1S0G A;  1YFW A;  1VBA 2;  2ZGS A;  3C8X A;  3BIE A;  2ARA A;  4UW4 A;  1A8M A;  1DZQ A;  4QPI B;  4YW3 A;  4CU8 A;  2X05 A;  1MZE A;  3T3Y A;  1NYW A;  4PQQ A;  1WLT A;  2OUJ A;  1W99 A;  2R30 A;  5A33 A;  1A3K A;  1F4A A;  1GZ9 A;  1IOA A;  1PO1 3;  2IVJ A;  3LEG A;  3PIJ A;  5LY1 A;  4F3J A;  3AZV A;  2VGD A;  3KM5 A;  2WA3 A;  4FPE A;  2HWF 2;  3H0O A;  5FZD A;  3VHO A;  1XJA A;  2K2S A;  4ZXK A;  4YM0 A;  4I0W B;  1P8J A;  1U5X A;  2XJP A;  3MPP G;  2L9L A;  1WW4 A;  2A3Y A;  4LO4 B;  3PU8 A;  2LTN A;  3CLP A;  3HVD A;  2QQJ A;  4UXA A;  1EYB A;  1C3H A;  1AR9 2;  4JGZ C;  5FZ6 A;  5KXE A;  5KHH A;  4NID A;  5T5L A;  5DQ0 A;  4P9W A;  4KI5 M;  1QHD A;  3WF4 A;  3O1O A;  4XJ9 A;  1ODN A;  1SEF A;  1X9T A;  2JDK A;  5FZK A;  1ND3 A;  4LKE A;  2F6B A;  3SLI A;  4PLO A;  1ZA4 A;  5BNP B;  5FMO L;  2VQT A;  2ZJC A;  3NJV A;  3AKT A;  5F3G A;  2A6X A;  5KXD A;  4LUK A;  3CMG A;  4FPJ A;  3LA7 A;  5AVA A;  3VD4 A;  4L11 A;  1NE4 A;  1WMD A;  2A3X A;  2JDU A;  4XIO A;  4Y1V A;  3DKW A;  3I2I A;  4XHB A;  4ZS3 A;  2DCZ A;  3O0X A;  4ZU4 A;  3T2O A;  3MW4 A;  4PBP A;  5FUI A;  1VBC 3;  5A7P A;  3VD7 A;  4AL9 A;  4MXV A;  5DAQ A;  4XPV A;  4RN5 A;  2VZ3 A;  4EWE A;  5LCW L;  1LHV A;  4IEZ A;  1LU2 A;  1NY7 2;  3VZM A;  1N3Q A;  3C3V A;  4QDQ A;  3UL2 A;  1L7Q A;  2ZAA A;  4AQ2 A;  1COV 2;  4XAA A;  2W91 A;  1UYX A;  4MAD A;  4RR3 B;  5A3U A;  3K4A A;  4P9Y A;  3I59 B;  2VMI A;  4MOA A;  4QPI C;  1XE0 A;  4BXF A;  1R08 3;  2VUL A;  2OKX A;  1POV 1;  1Q8S A;  2DCT A;  5H9P A;  3USU B;  4DXR A;  1UMZ A;  2RV9 A;  4RQP A;  4A7Y A;  4AW7 A;  4OUL A;  1WCK A;  2JG8 A;  2WO3 A;  2C9A A;  3VKL A;  3LE0 A;  4XDQ A;  3ZXL A;  5FK8 A;  3FFZ A;  2BER A;  2R04 1;  3WUD A;  3S6P A;  1RUI 1;  1HRI 1;  2CGO A;  1AUY A;  5H9S A;  1JZ7 A;  4P02 B;  3H3Z A;  1CX1 A;  4DS0 A;  3GBG A;  4RSU A;  2XLG A;  4U2A A;  2W87 A;  5CBL A;  3A0K A;  4OHX A;  1PZ7 A;  3N3H A;  3OBZ A;  4OFG A;  4JQT A;  5H9R A;  2W3J A;  1OQD A;  4HXC A;  4XTP A;  5JOX A;  1SZB A;  1FYU A;  3R05 A;  4IXL A;  5IK8 A;  4OI0 A;  4CU9 A;  1W9W A;  1OF4 A;  2WIN B;  2LW8 A;  1DYP A;  3FZ3 A;  2PN5 A;  2A70 A;  5SV8 A;  3I4I A;  1BBT 2;  2RS5 3;  4DOU A;  1W8U A;  3W9A A;  3HOB A;  4N9H A;  5BNP C;  4JDM A;  1RUH 2;  4NJ4 A;  2R49 A;  4CCN A;  4D6Q A;  1S0C A;  3M3O A;  4B1M A;  2FCV A;  5FXW A;  2YUE A;  4PIY A;  3AKP A;  5EV7 A;  1YRZ A;  4A3X A;  2J1E A;  3ZOI A;  3FLT A;  4MGZ E;  5C5T A;  4PBO A;  2FMY A;  3N9L A;  4BQ1 A;  5FY0 A;  3GAL A;  2BU9 A;  4DPN A;  1ZNP A;  4Q1R A;  3WDU A;  4OUE A;  2UY8 A;  3JD7 3;  5FY5 A;  1VBD 2;  2DVD A;  3URF A;  1JU3 A;  1Y3T A;  4OZX A;  1RC6 A;  5FZI A;  4CDX B;  4RR3 C;  3M70 A;  5L19 A;  2A5Z A;  2AR6 A;  4R9A A;  2R07 3;  1V6L A;  2DBN A;  3WP6 A;  3A4U A;  1V9U 1;  2WNO A;  4KU7 A;  4GZ9 A;  1FX5 A;  2YU1 A;  1JHJ A;  4D7T A;  1BJQ A;  2YY1 A;  5A7Q A;  5C9A C;  5FQ0 A;  1CZV A;  1ULD A;  2ORZ A;  4JGY B;  5FR3 A;  1W39 A;  4PDW B;  4BXS V;  2VOK A;  3D6E A;  4TYS A;  5A7W B;  5BXX A;  4Q4V 1;  2VZR A;  3E6D A;  4M0H A;  2QDR A;  2PHR A;  5FRE A;  2W95 A;  1K45 A;  4ARX A;  1DGR N;  2BOJ A;  4PJY A;  1OMI A;  4MHU A;  4QT6 A;  4KBZ A;  2P6H A;  2VOW A;  3MV1 1;  4GJZ A;  2D3S A;  2DU1 A;  3ZFG B;  4YWA A;  4O61 A;  3J7N A;  3IDE A;  3T0B A;  2A7A A;  1XND A;  4QXH A;  3ZSJ A;  4AQT A;  1OOP B;  2W47 A;  5FXV A;  2Q8O A;  3DEC A;  4BPZ A;  1CQ9 A;  4HT1 T;  4JGZ A;  1D4M 1;  2WRA A;  4P9G A;  4RD7 A;  5L7O A;  3OCP A;  3P3N A;  3AL5 A;  1PGS A;  4JDO A;  1UMH A;  2VUD A;  1AX0 A;  1MS8 A;  4XJA A;  4A41 A;  4CEY A;  4IUG A;  5AC9 2;  2D93 A;  4R4Z A;  1CN1 A;  4ZPI A;  4PIX A;  3RWN A;  4BLI A;  1S0F A;  1NCQ A;  2D40 A;  3LEI A;  1UW8 A;  2DTW A;  1JZ3 A;  4ZHN A;  3WF2 A;  4YW1 A;  5EIY B;  4BU2 A;  4YZ1 A;  2IXJ A;  4JVA A;  5C4W B;  1URX A;  3I3M A;  2ZZQ A;  4XIL A;  3LOB A;  4KG8 A;  4N43 B;  4ERO A;  1CAX B;  1JOJ A;  4L0P A;  1RUO A;  1BYH A;  3WD5 A;  3KS7 A;  2J22 A;  5KC6 A;  3WP5 A;  1Y9M A;  4CDX C;  1IKP A;  1PHM A;  1QWR A;  4YM3 A;  1O3R A;  2WS9 1;  4COV A;  2VTX A;  1AX1 A;  1GFF 2;  2AGS A;  1LOD A;  2HYK A;  4Q0U A;  3AMN A;  5JXG A;  1JYN A;  1AJO A;  4XXP A;  4PHZ A;  5FZG A;  3ZFF C;  4CU6 A;  4EN0 A;  4IND A;  5FY8 A;  1FI2 A;  4DUV A;  1NCR A;  2YPJ A;  3GZE A;  4DB5 A;  3K4D A;  4IEY A;  4RS5 B;  1UIJ A;  3B93 A;  1DGL A;  1S1A A;  4U36 A;  1MS1 A;  4MGY E;  1UO9 A;  2WII B;  2A75 A;  5IFP A;  4LA3 A;  5FPL A;  1SBD A;  3UNP A;  4KQ7 A;  5FZM A;  5I8T A;  4XIK A;  2VCC A;  4DXT A;  5KXB A;  3MBW A;  1KFX L;  4TWT A;  1FV3 A;  2DVF A;  1EV1 3;  4YAR A;  1VLN A;  4MLO A;  1RHI 3;  1CZS A;  4NHL A;  2BPA 2;  3RVH A;  4CUA A;  5A6Q A;  1RUF 1;  3ZXF A;  4AEJ A;  2HWD 2;  3U37 A;  1AYN 3;  2DVA A;  3N7K A;  5KC5 A;  4R4X A;  3A7Q A;  3VBR A;  3UKV A;  1C8M 1;  1QNW A;  5F32 A;  5A3M A;  4DUW A;  4QD2 A;  1CGP A;  3T0A A;  1C8N A;  4PF5 A;  4Q8L A;  3THC A;  1H2L A;  4XAE A;  4AED B;  4Z2A A;  5F5A A;  2XVG A;  2OPK A;  4ISR A;  2XG3 A;  2ILM A;  4UT5 A;  1O8P A;  5B4X A;  4A6S A;  5J3U A;  3DYM A;  2JXA A;  1GZC A;  4K8F A;  1RIR A;  3AP7 A;  3VN4 A;  1W8Z A;  4N43 C;  2GC2 A;  3N4M A;  2FQP A;  1O7F A;  3SQO A;  2ZKN A;  4X6R B;  2VVE A;  2E7A A;  1QJX 3;  1V70 A;  3LF7 A;  2JB8 A;  1HQW A;  2PHF A;  3C7E A;  3OGV A;  1YEW A;  4YW4 A;  4YVS C;  5A3N A;  4QX8 A;  4OHY A;  4M00 A;  5FZ1 A;  1VMH A;  4Z8B A;  4XFC A;  1MVQ A;  1GP6 A;  3FC0 A;  3IMN A;  3FBM A;  2JE7 A;  2V4V A;  1J58 A;  4N7I A;  3VBS B;  1LHU A;  2VUC A;  3FUQ A;  2DCK A;  3H8X A;  2C24 A;  4R9B A;  3USU A;  2OPW A;  4LBQ D;  4YW2 A;  1KRI A;  3C7O A;  4UBH A;  3JCI A;  4RS5 C;  1SCS A;  1VRH 1;  1YIP A;  1WCQ A;  1YFX A;  2XON A;  4AGV A;  4FTS A;  2E33 A;  4M4P A;  2P1B A;  3ZVX A;  2QDN A;  1UF2 C;  2JEM A;  4LBM A;  5LK7 B;  2QQW A;  2YBK A;  5LBF A;  4BIS A;  3R4U A;  4LQR A;  4CP9 B;  5FPU A;  1G9B A;  4WBB A;  3I7D A;  2WJS A;  3RG0 A;  3CDZ B;  4AQS A;  4X6Q B;  1WMX A;  1VBB 2;  2Y6L A;  5CYY A;  5A7S A;  1NZC A;  1XQN A;  1PIV 2;  3K75 B;  1L7L A;  1G86 A;  3ETP A;  1V6I A;  2DVB A;  1J3Q A;  4OHW A;  4CPB D;  1V6K A;  4SBV A;  4ITC A;  1I1E A;  1RUI 2;  1DFQ A;  4QQP A;  4AI2 A;  1G8W A;  5FZ9 A;  3SCF A;  2XWB B;  3B3Q E;  4BIO A;  4OMD A;  3WT3 A;  4XUP A;  1UOB A;  3L2H A;  2XJS A;  3UGG A;  2FZ1 A;  2QE3 A;  2QFE A;  4Y22 B;  1R09 1;  2IC1 A;  4GMP 0;  1JTZ X;  1RXG A;  5FP3 A;  1RUC 2;  2UYB A;  1SAC A;  4IET A;  5A3W A;  4LBN A;  1H0B A;  2FMD A;  3LOI A;  3QOP A;  3VBH B;  1ST8 A;  4AYU A;  1OT5 A;  1BLZ A;  3K2O A;  5JIU A;  2ET7 A;  2XLF A;  3NAP C;  5CZK A;  2XJU A;  1EY2 A;  1H9P A;  4QU1 A;  1ENQ A;  2D43 A;  2GC3 A;  2GN7 A;  3H3L A;  4QHB A;  3ZSE A;  4CDX A;  5JPM B;  4OHV A;  4B3N A;  4AR2 A;  1RJ8 A;  1YI9 A;  1UWW A;  3BKZ A;  5FOB B;  4UF0 B;  3AMM A;  1WD3 A;  3VBF A;  4YZ4 A;  1VBC 1;  2HEY F;  2P37 A;  4JGY A;  3AXE A;  4PDW A;  5A7W A;  5IVJ A;  1K3I A;  4FPG A;  3AFG A;  4LXL A;  4Z1V A;  3OY8 B;  4KG0 A;  4GAL A;  4JDN A;  3PJY A;  5JPN B;  1NKG A;  5T52 A;  4AVC A;  2IZW A;  1IHM A;  3ZFG A;  1ZRD A;  4CXX A;  5A1L A;  1YI7 A;  1R08 1;  3M3Q A;  4QKN A;  4F7Z A;  5FO9 B;  3IB3 A;  4Y26 A;  4EWA A;  1OOP A;  4ZON A;  1OQE A;  2PQQ A;  5F37 A;  4Q4V 2;  4Z2W A;  1IS3 A;  1NAE A;  2IXL A;  2IXK A;  2BV4 A;  1GBG A;  4EJR A;  4K3U A;  1W6P A;  4ORF A;  1LOC A;  1TG7 A;  2Y33 A;  2J1V A;  5CNA A;  4D94 A;  4O65 A;  2CY6 A;  1F31 A;  5K0U A;  4C0H A;  1CAW B;  1G9D A;  1UXX X;  3LIH A;  3UJO A;  4LKF A;  1RUJ 3;  1Y7B A;  2CL2 A;  4CUC A;  4MGK E;  4AAP A;  5JWP A;  4Y20 B;  4N7U A;  1JXN A;  4AOC A;  3RI8 A;  1POV 0;  1LHW A;  1SLB A;  5C4W A;  5T5P A;  5EWS A;  1KIT A;  1D4M 2;  1JOD A;  4YZ2 A;  1CAX A;  1OF3 A;  2PHW A;  4FOW A;  4BQY A;  4UFJ A;  4OQ9 A;  3JB8 A;  2X5I C;  5FZO A;  1YCI A;  2RS5 1;  3ALQ A;  4LHK A;  1VBB 3;  2C5D A;  1FNY A;  1W0P A;  1MAC A;  5LRS A;  1OUX A;  5D8A C;  1PIV 3;  1VE0 A;  4HN1 A;  3FHQ A;  4S2D A;  4BQ3 A;  5A6Z A;  3PUA A;  1KDK A;  1GNZ A;  4FQ4 A;  1FAT A;  1F2N A;  2RS3 2;  3J7L A;  2Z4F A;  3F2Z A;  3RQ0 A;  1YIF A;  3S0M A;  2XBO 2;  1KFU L;  3DV8 A;  4OI4 A;  1DZT A;  4XE9 A;  2OZJ A;  2YBP A;  4FFF A;  3IM0 A;  1UL9 A;  2VOT A;  3JD7 1;  4HL0 A;  3K4Z A;  4IE0 A;  1AXK A;  1LOF A;  4GH4 A;  1PM4 A;  2SBA A;  5FPA A;  2R07 1;  3WY6 A;  1VPH A;  2X09 A;  4M3C E;  1NOV A;  1RUC 3;  3PL0 A;  3E97 A;  3ELN A;  3OGG A;  3QD6 A;  2QQL A;  1UY1 A;  2A3W A;  3KSC A;  4OYU A;  4XF0 A;  4P00 B;  3P3P A;  5EZW A;  3SKV A;  2FD8 A;  4N53 C;  3ZR6 A;  3WNM A;  2QBX A;  3ZSK A;  4RHV 3;  1LJ7 A;  2VNO A;  1W6M A;  4XVH A;  3NJY A;  4AED A;  4HVQ A;  5CAD A;  2VZT A;  1H2M A;  2J1A A;  4GWJ A;  3MO4 A;  1US2 A;  5ANQ A;  3FLR A;  1RUF 2;  1OA4 A;  1TVG A;  2JG9 B;  1OLQ A;  2DCJ A;  1UYP A;  4UW6 A;  5JR7 B;  1HIX A;  1U5I A;  3TBD A;  4K7J A;  4A7Z A;  1HJG A;  2B4K A;  1FV2 A;  4HAN A;  1W06 A;  1C8M 2;  2VD7 A;  5DAP A;  4A6O A;  4UWD A;  4ZXE A;  5C3O A;  1LNS A;  1JS9 A;  4HKO A; 
#chains in the Genus database with same CATH homology
 3FHA A;  1JZ2 A;  3ACF A;  3ECQ A;  3P1I A;  2HLE A;  5IJR A;  3C8X A;  2BBA A;  4CU8 A;  1W8N A;  1JYX A;  2X05 A;  4PQQ A;  1W99 A;  1L7R A;  4A4A A;  1F4A A;  3LEG A;  2XHN A;  3OGS A;  2R7E B;  4CVU A;  1EUT A;  3A22 A;  1P8J A;  3CIH A;  1KGY A;  3WNN A;  1UMI A;  2L9L A;  1GMM A;  2QQJ A;  5C70 A;  2EIC A;  1GNY A;  5DQ0 A;  3OEB A;  3BGA A;  4KI5 M;  2WAB A;  3MV0 1;  3WF4 A;  2VTF A;  2W1S A;  1H6Y A;  2QQK A;  5LA2 A;  2VQU A;  2WZE A;  2PQS A;  2VQT A;  3NJV A;  3I2H A;  2W46 A;  4DXS A;  3CMG A;  3VD4 A;  5B4N A;  1J83 A;  1H6X A;  4QDS A;  1JI6 A;  2WZ8 A;  3I2I A;  3T2O A;  2C4X A;  5FUI A;  3VD7 A;  2C26 A;  5IHR A;  4RN5 A;  2VZ3 A;  5LCW L;  3DYO A;  1D7P M;  4QDQ A;  1L7Q A;  2WDB A;  2W91 A;  1UYX A;  4MAD A;  3K4A A;  2ZEZ A;  4W4Z A;  4MOA A;  3WSO A;  2OKX A;  4DXR A;  2RV9 A;  2VMC A;  2YFU A;  2WO3 A;  3LE0 A;  2J1S A;  1JZ5 A;  2BER A;  4YPJ A;  1NX9 A;  4BJ0 A;  2CDP A;  4W50 A;  1JZ7 A;  4DEV A;  4P02 B;  2W1W A;  1CX1 A;  1K12 A;  1T2X A;  2W87 A;  3VD9 A;  3T2Q A;  2W3J A;  3P6B A;  3ACG A;  2VZS A;  3VDB A;  1RYY A;  4ET7 A;  4CUB A;  3T08 A;  4CU9 A;  1W9W A;  1OF4 A;  2LW8 A;  2VCB A;  4JKL A;  3HNY M;  3I3E A;  3DYP A;  3W5N A;  3HOB A;  1JU4 A;  3I2F A;  5C7G A;  3HN3 A;  4QX0 A;  2E26 A;  2QQM A;  2J1E A;  4A42 A;  3C7G A;  3UES A;  2W92 A;  3NJX A;  4OUE A;  1O8S A;  2VZU A;  2ZEX A;  1WKY A;  5I0D A;  1JU3 A;  1W9S A;  3WNK A;  1ULP A;  2VZV A;  3WNL A;  2J1U A;  4QB6 A;  3OEA A;  4UOJ A;  3GGL A;  2YG0 A;  4GZ9 A;  2WQ8 A;  1JHJ A;  1CZV A;  2JKX A;  2ORZ A;  5DPN A;  3WF1 A;  1ULO A;  4BXS V;  2YFZ A;  2DDU A;  1YQ2 A;  3OB8 A;  3VDA A;  1DLC A;  2VZR A;  5EJZ B;  2QQO A;  4ZZ8 A;  2VJX A;  2W95 A;  1K45 A;  4ARX A;  4QB2 A;  3MV1 1;  4MGQ A;  4MO3 M;  3I2J A;  3T0B A;  2X10 A;  2Y6J A;  4DEQ A;  3ZM8 A;  3HJR A;  2W47 A;  1PX3 A;  3DEC A;  4E8C A;  2J7M A;  3FN9 A;  5LA0 A;  2WUH A;  2ZEY A;  1UMH A;  4A41 A;  2ZXQ A;  2Y64 A;  4IUG A;  3WNP A;  4QPW A;  2XOM A;  3LPF A;  5C71 A;  1UY0 A;  1I5P A;  1PMH X;  2VMF A;  4JHZ A;  3K77 A;  2VMD A;  1US3 A;  2WN2 A;  3LEI A;  1JZ3 A;  3WF2 A;  4XUT A;  5EIY B;  4P08 A;  4A3Z A;  2BZD A;  2W1U A;  4P5Y A;  4HG6 B;  1UY4 A;  4L0P A;  3WF0 A;  3MUY 1;  3HEI A;  2J22 A;  3T0D A;  2JD9 A;  3ACI A;  2VC9 A;  1GU3 A;  2YB7 A;  2WYS A;  5HPO A;  3A21 A;  5JXG A;  1JYN A;  3VD3 A;  4CU6 A;  4OZO A;  2EIE A;  2W9X A;  4DUV A;  2HYX A;  5EJ1 B;  3K4D A;  2W5F A;  3CZU A;  4D0Q A;  5IYY A;  1K42 A;  3I2G A;  3HPN A;  4AG4 A;  5IFP A;  1W8O A;  3UNP A;  2VCC A;  1OD3 A;  4DXT A;  3MBW A;  2VZ1 A;  5JXH A;  4TXW A;  4A44 A;  1CZS A;  4CUA A;  3BN6 A;  4KMQ A;  4XUR A;  3U37 A;  3VDC A;  2V72 A;  1PX4 A;  3A7Q A;  1JYW A;  2VZP A;  2XQX A;  5LA1 A;  4A45 A;  4RYD A;  4DUW A;  2RJ2 A;  3T0A A;  3THC A;  2VME A;  4Z2A A;  3LPG A;  2J1R A;  1JZ4 A;  1O8P A;  5B4X A;  4LKS A;  3DYM A;  1GOF A;  3WQB A;  3OGR A;  1CIY A;  2J1T A;  1JZ8 A;  3OG2 A;  3C7E A;  1XC6 A;  3OGV A;  3W5M A;  3PUI A;  2BGP A;  2YC4 A;  5IFT A;  3NQH A;  2QQN A;  3SKJ E;  5A1A A;  4QDR A;  4TTG A;  2V4V A;  1UYZ A;  3GDB A;  3LQC A;  1NUK A;  4JX0 A;  1KEX A;  1UXZ A;  2DCK A;  1UYY A;  2EIB A;  3JXS A;  4FI9 A;  3C7O A;  3MUZ 1;  2VM9 A;  2XON A;  1WCQ A;  2E33 A;  4M4P A;  2E32 A;  1BHG A;  4MGS A;  4UAP A;  4LQR A;  4XZU G;  1GUI A;  2QQI A;  1IQD C;  3T09 A;  3CDZ B;  4E8D A;  2Y6L A;  5CYY A;  2WAO A;  3PUH A;  3K75 B;  1F4H A;  3ETP A;  4PF1 A;  1O59 A;  1R64 A;  2VZO A;  3I3B A;  2ZEW A;  2YC2 A;  4M4R A;  4ZY9 A;  5G05 L;  4DUX A;  2Y6H A;  3GM8 A;  4OMD A;  1UZ0 A;  4XUO A;  5G04 L;  4XUP A;  3VD5 A;  1XNA A;  3SEE A;  5JMO A;  2WBK A;  3IAP A;  3HNB M;  3WEZ A;  1OT5 A;  1HN1 A;  2Y6K A;  2B9V A;  3C7H A;  3III A;  2VCA A;  5CZK A;  1CZT A;  2VZQ A;  1GQP A;  4AAX A;  5DN2 A;  3WF3 A;  4CU7 A;  1UWW A;  1EUU A;  4BDV B;  2KD7 A;  3THD A;  4XUQ A;  2RVA A;  1K3I A;  5DMY A;  1DP0 A;  5F7U A;  2V5D A;  3HNM A;  1NKG A;  2VR4 A;  2WN3 A;  3IB3 A;  2Y8K A;  2JDA A;  3WNO A;  1UY2 A;  3LEK A;  5JR2 A;  3NNG A;  1NAE A;  2VL4 A;  4QB1 A;  4BK5 A;  1UY3 A;  1OH4 A;  3I3D A;  3ABZ A;  4W8J A;  1DYO A;  1TG7 A;  2J1V A;  5J1X A;  3I97 A;  4ARY A;  1SHW B;  4JKK A;  3T2P A;  1UXX X;  2LS6 A;  3IDA A;  2Y6G A;  3SEP A;  3I2K A;  3OBA A;  4PT6 A;  4CUC A;  3K46 A;  4QX3 A;  4UI9 L;  1SG3 A;  2EID A;  2C9K A;  1GOG A;  1JZ6 A;  1J84 A;  5JXJ A;  1OF3 A;  2WO1 A;  4QAW A;  3UET A;  1SDD B;  3FHQ A;  2WO2 A;  3AC0 A;  4LHS A;  3E1F 1;  2Z4F A;  3F2Z A;  4LPL A;  4QX2 A;  3CQO A;  2VOT A;  1MPX A;  1XPW A;  3K4Z A;  3GXU A;  4BK4 A;  3CKH A;  3IAQ A;  2ORX A;  5JUV A;  2X09 A;  4JKM A;  4D8M A;  4OMC A;  2W94 A;  3FL7 A;  5HXM A;  3EB7 A;  1JYV A;  2QQL A;  1UY1 A;  3SKV A;  5JXI A;  4OYU A;  4P00 B;  1W0N A;  2WAA A;  3WNM A;  2QBX A;  4ZZ5 A;  4XVH A;  2JE8 A;  3D3A A;  4GWI A;  4XUN A;  2BGO A;  3A23 A;  4QX1 A;  2VZT A;  4GWJ A;  2J1A A;  3MO4 A;  1US2 A;  2W1Q A;  1W9T A;  2E31 A;  1UX7 A;  2VO5 A;  3CZJ A;  2CDO A;  1TVG A;  2DCJ A;  3C7F A;  2B4K A;  3NRU A;  2ID4 A;  1GOH A;  1PMJ X;  3ACH A;  4ZXE A;  3EYP A;  4A6O A;  1LNS A;  3J7H A;  1XNT A;  4KWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...