2J1UA

Structure of a streptococcus pneumoniae fucose binding module in complex with the blood group a-tetrasaccharide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
141
structure length
141
Chain Sequence
KFNDGNLNIAYAKPTTQSSVDYNGDPNRAVDGNRNGNFNSGSVTHTRADNPSWWEVDLKKMDKVGLVKIYNRTDAETQRLSNFDVILYDNNRNEVAKKHVNNLSGESVSLDFKEKGARYIKVKLLTSGVPLSLAEVEVFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOLECTIN-RELATED PROTEIN
publication title Blood Group Antigen Recognition by a Streptococcus Pneumoniae Virulence Factor
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Carbohydrate-binding protein
total genus 40
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2j1uA00
3WNMA 3K4DA 1JZ3A 2WBKA 3FL7A 4IUGA 2QQNA 2YC2A 4UOJA 2JDAA 2J1EA 3JXSA 2ZEYA 2B4KA 4A44A 1L7QA 2Y6GA 3NJVA 2VM9A 4E8DA 2WZ8A 1GNYA 4ARYA 1K42A 3UESA 3E1F1 3LEKA 4L0PA 1SHWB 2VZQA 3IDAA 2QQIA 3C7HA 4CUCA 2DCJA 4A6OA 1UX7A 4YPJA 5LA0A 3A22A 2QQMA 5IFTA 3SKVA 4OMDA 1US3A 3GGLA 2HLEA 2QQLA 2VZPA 1UY0A 4UI9L 5B4XA 5F7UA 2VZVA 3ACHA 3EB7A 4BJ0A 3T2PA 5DQ0A 3FHQA 2XQXA 2EIEA 1T2XA 5IHRA 3ACFA 5C70A 2WO1A 4JKMA 2W1SA 1K45A 2WYSA 5DMYA 4W8JA 2WN3A 5LA1A 1IQDC 2E26A 2BGPA 2VL4A 1W9TA 4DXTA 3I2GA 4A3ZA 4P00B 2ID4A 2ZEZA 4LHSA 1UYYA 2Y64A 1UXZA 3HNYM 2QQOA 1W8OA 3T09A 4MOAA 4PQQA 2HYXA 2ZXQA 1UZ0A 1US2A 2J1VA 3LE0A 1I5PA 2W3JA 1O8SA 2X09A 3J7HA 1W9SA 4LKSA 4W50A 1BHGA 4ZZ8A 3OGVA 1NX9A 1JU3A 4CUAA 2VZOA 1UYZA 3ABZA 4JHZA 3WNKA 3GDBA 2JKXA 2Y6HA 2YFUA 4BDVB 4P08A 1LNSA 4MO3M 1JYXA 3IAQA 2RVAA 2W91A 1JU4A 1W8NA 3LQCA 2J1SA 2JE8A 2V4VA 3K77A 2RV9A 3HJRA 1JHJA 2V72A 4PF1A 5JMOA 4ZXEA 2VZSA 3WNNA 4A41A 2W94A 3VDBA 3WSOA 2W47A 5HPOA 3W5NA 2VCCA 5EIYB 2W9XA 4UAPA 1TG7A 1L7RA 2BERA 4FI9A 3THDA 4ARXA 3K4ZA 3HOBA 3VD5A 3P1IA 4KI5M 2C9KA 2Z4FA 3WF3A 2E32A 3NJXA 3LEIA 4PT6A 3WF4A 5EJZB 1KEXA 1KGYA 2WABA 4HG6B 4BXSV 2VCAA 3LPGA 3UETA 3I2JA 4D0QA 2V5DA 5I0DA 2Y6KA 2VQTA 2BGOA 1SG3A 2CDPA 3BGAA 4W4ZA 3GXUA 1O59A 3W5MA 5JXGA 1K12A 3K75B 2Y8KA 4QDSA 2E31A 2ORXA 5A1AA 2J1RA 3OEAA 4RYDA 4CU9A 3DYMA 5IYYA 3A23A 2YB7A 4A4AA 4CU6A 4JKLA 3WQBA 3I3BA 4MGSA 2J1TA 4ZZ5A 3IB3A 5B4NA 2J1UA 2W1WA 4XUNA 2WN2A 3CIHA 4CU8A 3ETPA 1GOGA 4QX2A 4QAWA 3OEBA 3NRUA 3WF1A 3NQHA 1JYNA 3OG2A 1XNTA 3C7GA 2WDBA 1UY2A 1XNAA 4DEVA 2VC9A 1W99A 2BZDA 4A42A 3CZUA 1UY4A 2DDUA 2KD7A 1XC6A 1W9WA 3IIIA 4QPWA 2W1UA 4M4PA 1CX1A 4DUVA 3F2ZA 1H6XA 4DEQA 1OH4A 4XVHA 3T08A 4M4RA 1NUKA 5JR2A 2YG0A 5FUIA 3WEZA 3IAPA 3VD3A 4QX1A 3VDAA 3VDCA 1NAEA 2VMFA 1F4HA 1UY3A 3PUHA 1SDDB 3ACIA 1R64A 3MUZ1 5LCWL 3I2KA 1JZ8A 2VTFA 3ZM8A 2R7EB 1YQ2A 3OGSA 2YFZA 4JKKA 4GZ9A 1CZSA 1UXXX 3WNLA 5CYYA 1GU3A 3VD4A 1UY1A 3I3EA 3T2OA 1D7PM 2YC4A 4OUEA 5HXMA 3UNPA 4RN5A 3CMGA 3WNOA 1NKGA 2W1QA 4DUWA 1ULPA 2XONA 3GM8A 3T2QA 4QB1A 4XURA 3LEGA 3SEEA 4DUXA 2W46A 2Y6LA 1F4AA 4GWJA 4QDQA 1J84A 2XHNA 2QQKA 1GQPA 3I2FA 2C26A 1GOHA 3HNMA 1OF4A 4CUBA 1O8PA 1RYYA 2EICA 4XUPA 2RJ2A 2E33A 5G04L 1CZTA 1GUIA 4QB6A 3VD7A 2B9VA 1CZVA 3MUY1 3THCA 2VCBA 3CDZB 3NNGA 2VZ1A 4OYUA 3HPNA 3AC0A 2VJXA 4QDRA 3OB8A 1JZ5A 1ULOA 1W0NA 3A7QA 3FN9A 4JX0A 3DYPA 1UYXA 3I97A 1CIYA 5G05L 4TTGA 4XZUG 1EUTA 4LQRA 3K46A 4AAXA 1MPXA 3CQOA 2VZ3A 4OZOA 3C8XA 1XPWA 2QBXA 1WKYA 5JUVA 1P8JA 5IFPA 2J7MA 3ACGA 5JXJA 2WUHA 2WQ8A 3C7FA 2VZUA 2WO3A 3SKJE 2QQJA 4ET7A 1OD3A 1DLCA 1PX3A 4QX0A 2VO5A 2OKXA 2W87A 4D8MA 2X05A 3HNBM 3CZJA 2EIDA 4CU7A 1DP0A 5DPNA 4ZY9A 1HN1A 1PMHX 1UWWA 2W92A 1GOFA 3T0BA 5LA2A 1J83A 4P02B 1TVGA 2X10A 3D3AA 1JI6A 3K4AA 2WO2A 4TXWA 5C7GA 2VR4A 2XOMA 2JD9A 3HN3A 3DYOA 3FHAA 4DXSA 3MV11 3SEPA 2WAAA 1OF3A 4P5YA 1UMHA 4MADA 4XUQA 3WF0A 4GWIA 2VMEA 3T0DA 1GMMA 5JXIA 4LPLA 2CDOA 2Y6JA 1PMJX 2W5FA 4QX3A 3WNPA 3T0AA 3MBWA 3U37A 4XUOA 3HEIA 1DYOA 4Z2AA 1JZ7A 1UMIA 2EIBA 2VOTA 3DECA 3I2HA 2C4XA 3LPFA 3P6BA 2VZRA 2WAOA 5CZKA 4AG4A 3WF2A 4KMQA 3A21A 2ZEWA 1PX4A 2W95A 2VMDA 1K3IA 3C7EA 2J22A 4BK5A 5IJRA 1OT5A 3C7OA 2BBAA 4XUTA 2PQSA 4OMCA 1EUUA 3MO4A 3PUIA 1JYVA 2VMCA 5C71A 3CKHA 5EJ1B 3VD9A 2VZTA 1JZ2A 4KWUA 4MGQA 2LW8A 3EYPA 4A45A 2J1AA 5JXHA 2VQUA 4DXRA 3BN6A 4CVUA 4QB2A 1JZ4A 4BK4A 3OBAA 2ZEXA 1H6YA 2L9LA 4E8CA 2LS6A 2ORZA 3I2IA 1WCQA 3OGRA 1JZ6A 1JYWA 5J1XA 2DCKA 3I3DA 2WZEA 3ECQA 3MV01 5DN2A
chains in the Genus database with same CATH superfamily
2H0BA 4TYSA 4IV3A 4OI4A 3K4DA 3S0MA 1JZ3A 1HX6A 5FP8A 1NCRA 3ZYFA 1EPZA 4FFIA 2FDGA 4XFFA 4FPYA 4AWDA 1XOYA 5FZGA 2ZEYA 3ZSMA 3MW4A 4XF3A 3J9SA 4NPRA 4IESA 1XXNA 4FPOB 1N3QA 4E8DA 1W6PA 4WM8A 1SZBA 3LEKA 3ZR6A 2ZBJA 4IQPA 3ZYBA 1SHWB 1ENRA 2WSUA 1COV2 4XQ4A 5LA9A 4CUCA 1H8TA 2OYZA 2FHRA 1RUE3 1QHDA 2KM2A 2XUMA 1ULGA 4YPJA 1NXMA 1AYM3 1WBLA 5IFTA 2EAAA 4Y3OA 3R4DB 2BOJA 1OLRA 3KVBA 4HXCA 2QQUA 2VZPA 5HV4A 3H0OA 5F7UA 1GP5A 2YHJA 4KG8A 4GALA 2HWB1 5FZ6A 5L9BA 5CFCB 3FBMA 3HR9A 1GSLA 4ZHNA 1APNA 3MHZA 5EWSA 4FAGA 1RUH1 3N7LA 4JKMA 4R4ZA 3ZX7A 2WYSA 5GLUA 2XVKA 5JR7B 4YZ3A 5CADA 1RUC1 5FMOS 2MHFA 5JSPA 1AZDA 1HJGA 4LULA 2E26A 5FJHA 3P5BA 4QHZA 3FHIB 1UO9A 2UU8A 4U2AA 4UW4A 3PDQA 2V5YA 3VBHA 2D6NA 1C8M2 4LHSA 4XAEA 4IE5A 1PO12 1QU0A 2ZGOA 1UXZA 4XE9A 3HNYM 1W6NA 4AR2A 5CAZA 1COV3 4L2NA 1Q8QA 4MOAA 4GQ7A 1V6JA 3S5QA 1CWPA 5EPAA 5FZBA 5E16A 1UZ0A 1YQCA 3WDVA 5FBJA 3TYJA 1S1AA 5KR7A 4NAOA 2B39A 4HZFA 1EAH1 1IG0A 2HWC1 5KHIA 2JE9A 2X09A 4R9AA 3WOGA 5FDBA 2DVBA 1KDKA 4W50A 2IXCA 3O1UA 5CISA 2I2SA 2VBBA 3VBRC 3E97A 2ZGUA 4HT1T 1IPJA 4AI0A 3V0BA 4AEKA 4K3UA 4IEXA 3PU8A 4RR3B 3OSDA 1NT0A 4D7SA 2P17A 3I8TA 3HQUA 4JHZA 4MVTA 1OQDA 1E5IA 3AZXA 1LULA 3WDWA 4DFSA 3NAPA 4MO3M 2OUHA 2AR6A 2ZX2A 5JZGA 4JQRA 2K2SA 1C8M3 1D0HA 3LAGA 2RVAA 2NN8A 3USUB 2H6BA 1JU4A 1AYN1 3ZSLA 4LHKA 4IEUA 4EZ4A 4LT5A 5A3TA 1R1A2 1CAUA 4QPGB 3LQCA 5JOZA 5FZ3A 2JE8A 2FDHA 4TSVA 2NYYA 3K48A 2YDEA 3K77A 1BBT2 3NV2A 5GZGA 1C8NA 3HJRA 2XG3A 1QJY1 4AVTA 4PF1A 1MR5A 1VAMA 4SBVA 1VRH1 2VZSA 3IIAA 3ZFGA 4E2SA 5A3NA 3GALA 3TNQA 1HRV1 2CWSA 3WDYA 4NPLA 4Q26A 5BV6A 1V6KA 3RJ2X 3IPVA 2CHHA 1G9CA 3QD6A 1HJFA 3TEWA 1ZVFA 3OPWA 5CVRA 4ATEA 1V6MA 3M3CA 3FFQA 1TG7A 1W6PB 1L7RA 1ZBE2 4FI9A 1X33A 3HOBA 2ADEA 3WUDA 4KI5M 2C9KA 2YBPA 2BQPA 3WP4A 3AYDA 1ZZ7A 3PL0A 2CAUA 3ZXLA 4BMBA 5AFEA 5BNNC 3WF3A 5CFDC 3NJXA 4MXVA 3I2DA 3IDCB 5I93A 2IWGB 5EJZB 5FLHA 1FATA 3Q8AA 1R1A3 2VCAA 2VUCA 1S2EA 3I2JA 4GJZA 4QX5A 1RC6A 4C1XA 1HDKA 1PVXA 1AHSA 4O65A 1NE4A 5I0DA 1G86A 4YZ4A 3POYA 1Q56A 5DUWA 2Y60A 5HXVA 4QQOA 2DFCA 1DQ5A 2NP0A 1DYPA 2GH2A 4FSJA 4Q4Y2 3MEPA 4YVWC 4AEJA 3BTAA 1WMDA 3GXUA 4AI2A 3J8F2 4JTNA 3CF6E 5DAWA 5JXGA 5FPVA 3I3MA 1S0CA 2ORXA 1R1ZA 3MIDA 5H9RA 2QCSB 4QD2A 1UKGA 3WP6A 1WW4A 2ZKNA 4CU9A 2V4AA 5IVEA 1WA6X 2YB7A 4A4AA 1ZBE3 2VG9A 4NRQA 1LESA 2WT0A 5LY2A 3AVRA 1QMJA 2ARBA 4DB5A 3PIGA 2P3KA 5H9PA 5B4NA 5DZFA 1IS5A 1E57A 1LENA 4NIIA 1XRUA 2W1WA 4AL9A 4CCDA 4XUNA 2WQ4A 2WN2A 3CIHA 3P3PA 1C57A 5C8CA 1X8MA 1PO22 3WDXA 4CU8A 3DPRB 3RS6A 3I2OA 5C4WC 4UBGA 1VBB1 4MG2A 3WF1A 1RINA 3NJZA 3H1YA 2HYKA 2UWCA 4P9JA 2HWE3 3SH3A 3M7AA 1QJFA 4ORFA 5FYMA 4DEVA 3J8F3 1RUD1 5FY7A 1JYTA 1UY4A 3H7JA 4X6QB 2DDUA 2O8QA 4Q1RA 3IIIA 4IDZA 4G3YC 4UFIA 5HI0A 2O8OA 2R042 3AFGA 4BISA 2NQYA 1NA1A 2OQ7A 2R061 1VPHA 3F2ZA 3TN92 3VHOA 1JYIA 4OI0A 4Q4X2 5L7OC 2B8MA 1OH4A 3T08A 4WM7A 1GV9A 4M4RA 3KF5A 3LDKA 2JIGA 2YG0A 5FUIA 3URFA 3WEZA 4CXYA 3VDAA 4GB32 1SQ4A 4YGDA 4AHYA 1NAEA 2VMFA 1PO23 3AP5A 1F4HA 1PVC1 1JXNA 3M8LA 3ZFGB 3VZLA 1GP4A 1XU1A 4ES9A 1XNBA 4YZ5A 2RHPA 2YU2A 2TBVA 3D6EA 1VIWB 4IEVA 1QOSA 4IE6A 3I2KA 1PNGA 1GLHA 3UGHA 3IPVB 2WZR2 3MF9A 4S2FA 1AR72 1YQ2A 1Y4WA 2AGSA 2YFZA 1VP6A 3B02A 1VBE1 4CCKA 1YYNA 1Y9QA 2RJKA 1CZSA 1UXXX 5FYUA 3AZYA 1VBC1 5CYYA 3RVHA 4Q4W1 2VAUA 3O1PA 1LU1A 3VD4A 1GWKA 2HWD1 3ZYRA 2R043 1T6GC 3H50A 3U78A 1WMEA 5HXMA 1ZZ6A 3PIJA 3TN93 4RN5A 3CMGA 3U07A 2PAEA 4YM3A 5C5UA 1NKGA 4Q4X3 2HBUA 1TME1 4Y5Z0 5LEKA 3ZFFC 1B35C 4DUWA 2VMGA 2XONA 2K46A 4KG0A 4XURA 2JB4A 1PIV2 2K9ZA 4EE2A 4LBQD 4GB33 2P4EA 5BNOA 1C5HA 1YFXA 2W46A 2Y6LA 5KXCA 3VBOA 5A32B 2QE3A 4GWNA 5F8PA 5FWJA 2P3JA 2X5IA 1J84A 2XHNA 1GQPA 1MZFA 3AKQA 1OXCA 3JBG1 4IERA 4QX8A 4EWDA 1ODNA 1HIXA 3SCHA 3OTFA 1GOHA 4GKXA 4XETA 3UT0A 1HXS2 1GNHA 1VBD2 3FBYA 2ZPXA 4CEWA 2ADDA 3MV01 3RWKX 2ZS6B 1EV11 1POV0 2XJPA 4XTMA 1WBFA 1BK1A 2RS31 5GALA 3CO2A 3VD7A 4FPFA 1CZVA 2ZA9A 5GLTA 3MUY1 2A7AA 2ZGRA 1F9KA 2C0ZA 3NNGA 4HN1A 2IXKA 4HPKA 3WX5A 2PYTA 3LFMA 3U4SA 3POEA 2RS53 1YWKA 1JZ5A 1MQTB 1CD3G 5LW9A 4AI9A 3FN9A 3H3LA 1OUSA 4AGGA 1LRHA 4AFDA 4DQAA 5J09A 3SH5A 3KHCA 1CIYA 1D4M2 5C3OA 1S0IA 1UNBA 3OBTA 2OPKA 2XWBB 4FPGA 1CJPA 3AL5A 5FLJA 3VDDA 3RZLA 3KHBA 3OBRA 2HEWF 3CQOA 4OI1A 1LGNA 4KWKA 5GLWA 1HXS3 1VBD3 4PI0A 5FREA 1B09A 2ZGKA 1X7NA 5DDJ1 2XLGA 4LLFA 3LB9A 1AVBA 2VMHA 4MXWA 5BY5A 4XABA 5IFPA 3PTYA 2A6YA 1NY72 2ET1A 2JX9A 5GM0A 4GULA 2WUHA 1AXYA 2R6QA 5HCBA 1RTVA 4WV8A 2VZUA 2WO3A 3AKRA 2WNOA 2QQJA 3WCRA 4FTSA 1GANA 1LOEA 3ES1A 4ET7A 1W39A 2WYFA 2Y0OA 3RMYA 1PX3A 4D8MA 2X05A 1JUHA 5FY9A 3HNBM 3CZJA 4IL7A 3MI8A 3ZFEA 1RVF1 2F6BA 5I8YA 5IAXA 3T1MA 1LODA 2WIIB 5DPNA 1NLRA 2XBO1 4TLGA 1S0GA 3CEWA 3ZO0B 1UWWA 1WW6A 1D4M3 3ENRA 5F5CA 5FY5A 3AXDA 3WDTA 1Q8OA 4PDWB 4XBLA 3IMNA 4YG6A 5IW0A 1RUJ2 3MYXA 1E5HA 3Q9OA 4XF9A 3VHRA 4UF0B 3ZMOA 4B4PA 4YFZA 2YBKA 4K9SA 1JHNA 2JECA 3AYAA 4AVCA 3WQ1A 4CRQA 5C7GA 3FMGA 1R082 1QQP2 4BWOA 4NIGA 5DZEA 4IGOA 2XOMA 4QKDA 2WLPA 4CPBD 2ZGQA 3DYOA 4V2VA 1IQAA 4FO9A 5FXVA 3ZOIA 2WAAA 1S0EA 3CBNA 1W0PA 2RJLA 3VBFB 3IKWA 2JJ6A 1N1SA 4XUQA 3WF0A 3DXUA 1SLAA 1ASJ3 3R4SA 4E4SA 4CP1A 3T0DA 3ZLIA 1GMMA 2RM23 1QXJA 1J1LA 1I9RA 2A6XA 2CDOA 3MFAA 4PLNA 4AVAA 3BODA 3S5AA 2CSGA 3PLQA 2A6ZA 1Y9GA 5L9RA 3ZXDA 2W5FA 4D7YA 3T0AA 2X5IB 1DQ1A 2R0HA 1OBNA 4L11A 2MEV2 3N9QA 4CCLA 3WG4A 5F37A 5A7WA 1DYOA 4CDQB 3VBUB 2EALA 5T5LA 1GQGA 2EIBA 3E6BA 4YW5A 1LB2A 2C4XA 1FYUA 1G7YA 2YBSA 3LPFA 1RUJ3 4MZUA 3VUOA 4N90A 1QJU1 2XXZA 3B9CA 3N9PA 5CZKA 4JRAA 1OFNA 1J3QA 1W2NA 3EO6A 4KMQA 4LBKA 1SLCA 1R092 3HVDA 2FZ2A 1VMJA 2ZEWA 3OUHA 4XIOA 5FZFA 4L92A 1RUF1 4HSLA 4N9IA 1UZWA 1F31A 2E51A 2JDMA 4DNYA 4CDXA 1AUYA 1CAWB 2W95A 4COZA 4HPKB 2EAKA 5JIUA 1K3IA 2BU9A 2EVXA 3U75A 5J7MA 4MGIE 2J22A 4BIOA 4BK5A 3IBMA 2QNKA 2C24A 4UFKA 4LHNA 2BBAA 3QLQA 3SISA 1ZYBA 4CEYA 2PQSA 3AFKA 5FRAA 2KXLA 4HSJA 4ES8A 4RQPA 4NROA 4H14A 4JGYB 2QQPA 3LSDA 5C71A 5EJ1B 1SLTA 3CJIC 4QXBA 3KVAA 4K6BA 3Q8CA 2PHLA 4AEDB 1HQNA 2PAMA 1ND2A 3M1HA 2OA2A 2R1BA 3EYPA 4HKLA 3JUUA 1OURA 2VQUA 1YI9A 1KFXL 2VOKA 3BN6A 3Q8BA 5FZKA 5LBFA 2D98A 5KHJA 4FTEA 4RS5B 3KLSA 5C3SA 1WLDA 1MS1A 3ZVXA 4ATFA 4W6YA 4L97A 3R0RA 4E8CA 1R093 1VALA 2JD4A 2LS6A 2XJRA 3T4HB 1LECA 1WCQA 3MLLA 3OGRA 5A3MA 1XJAA 3TBDA 1RIRA 3SLIA 4O9EA 1G9AA 1GQHA 2E6VA 1A3KA 1H1AA 4PCRA 2Q5TA 1PGW1 4WBBA 1PK6A 2DCKA 2WFF1 3LD8A 3ZR5A 5FPAA 5ABJC 2D44A 4Q1PA 4XF1A 1RUI2 2QDNA 4G9SB 5FYCA 3VZMA 4AXOA 1K5MC 1HB3A 4K7JA 4IV1C 3WNMA 1KDMA 1KITA 3LIGA 3UJOA 3GZTB 3ZFEB 5C9AB 2Q8EA 3APBA 2E63A 3KCXA 1F8VA 2YC2A 3OBZA 4JQTA 1ULEA 2ZGNA 3QCWA 3WXPA 1EP0A 3OY8A 2B4KA 4A44A 2Y6GA 4HLTA 1OOPC 1HV1A 2EXKA 1QJX3 4M01A 4X6RB 1K42A 2O1QA 4YLZA 5K0UC 4NN0A 1AX2A 4L0PA 3ORJA 2BPA2 4Q0QA 2RDSA 1OKQA 4UYBA 5EZWA 4A6OA 1H4GA 5AC91 1ZBA1 1WCKA 3A22A 3SMHA 4EN6B 1AR81 4H3WA 3PHMA 4XF0A 4RFT0 3ZXFA 1US3A 3GGLA 4DY5A 4JZRA 5BNPA 5FK8A 4B7EA 3ACHA 3EB7A 4P14A 1ACCA 3WD5A 3T2PA 4HETA 2E9QA 3FHQA 4YW6A 2VW2A 5IHRA 2PLV1 3ACFA 3BB6A 2HWF3 4PI2A 1AL21 2Y26A 4FP3A 2WNUA 5BPXA 1RUI3 2R072 3MIFA 2W1SA 3AMNA 1Z7S3 4M3CB 1RITA 3SCGA 1H2KA 1UQXA 2YC0A 4IW3A 4BE3A 1IS6A 1JH5A 4UBHA 1V9U1 3UKTA 5LA1A 5A7WB 2JG9C 1IQDC 2XJSA 2YU1A 4PBOA 3VZKA 3LDRA 3GZAA 1W9TA 2FD8A 4LBMA 3I2GA 4HANA 3O7OA 3ZMNA 4P00B 2ID4A 2ZEZA 2E53A 4LBOA 5FIXA 2TNFA 3AMHA 1UYYA 2LTNA 1ZZ9A 2Y64A 5HCFA 3KT4A 1U0AA 4NO4A 2QQOA 1KD7A 4HMZA 3WG1A 1D2QA 2ZXQA 1GYKA 1V0AA 4LKFA 4B29A 3LGRA 2J1VA 1UD1A 1V6NA 1I5PA 1MZ6A 2GC3A 3LE0A 5FZDA 2FMYA 4XJWA 1AR91 4B1MA 4NHLA 1FAYA 1N1YA 1HW5A 3J7HA 5SV8A 1BLZA 3DGTA 3MIBA 1YUDA 1JUIA 4AI3A 1PMIA 2CGOA 5A1LA 1BHGA 2JB8A 2YXSA 1S0FA 3O1OA 5JAXA 1ND3B 1X8EA 1XB9A 1IGOA 2GALA 3OGVA 4GH4B 3VBSB 4ZZ8A 5FQ0A 4TZDA 2QVSB 4E9KA 3B00A 4CUAA 1QNWA 3N9LA 1O6UA 2GNTA 1W2UA 5FTTC 3O1RA 3V0AB 2XGXA 3ABZA 3HWJA 4LBNA 3NW4A 4BIFA 3POJA 4ZKTB 4OLLA 4JGZC 1UZZA 1DGLA 2XJVA 1W8UA 4H7MA 4BCUA 1JYXA 1ZM1A 3UJQA 1NE6A 2C9AA 1QEXA 4I0WB 4S2GA 1FOD2 1QGLA 3S57A 1AR61 4AOCA 4D94A 3SQOA 3AJZA 1YHFA 1GZCA 3AYEA 2BGCA 4N53C 2MNGA 2NZ9A 1YJLA 2CGNA 4P5HA 1PZ9A 1LEDA 1CAVA 1W8TA 2RS11 3JQXA 3Q8EA 2D6LX 1MS8A 2TEPA 4QQPA 1PK6B 2ZZJA 4IE7A 1FMD3 4A41A 2RR13 2A75A 2OVUA 5AVPA 3RJRA 4XYXA 2JWPA 3FE5A 4BQ2A 2ARXA 4Y1UA 1MEC1 2VBDA 4YYOA 5F3EA 4IEZA 2GMPA 4HL0A 5HPOA 5FZCA 1BEV1 1OHFA 4W65A 3TOJA 3KD4A 5CG8A 4QQLA 5I8SA 4A7YA 3VHNA 5EIYB 1REEA 2WWSA 1XNDA 2W9XA 3NMBA 3OY8B 1H2LA 5A1FA 4GMP1 4LIUA 1S2KA 1AF9A 1OPMA 4QHOA 2YROA 5AVAA 2BERA 2ZMNA 5D1IA 5FPLA 5ANNA 4ARXA 1HB1A 1PGSA 3VD5A 4NPMA 4I01A 2Z4FA 1H2NA 1ZRFA 4AVVA 4MSVA 1DG6A 4PT6A 5FZAA 3RFRA 1A6CA 1QXPA 3WF4A 4U36A 2RDNA 1RUH2 3K51A 4Q0VA 2WABA 5F6KA 3W20A 4HG6B 4DRRA 1SLLA 1XNCA 2D93A 3LPGA 3FZ3A 4DMIA 3M70A 3DKWA 3N7JA 2ARAA 4B1LA 1BKZA 4MUVA 2Q1MA 5BNPB 4C1WA 1DIWA 2WA3A 2VQTA 4GIQA 2LUWA 3JD71 3MZHA 3PMEA 3BGAA 3H8OA 2WNUB 2ZAHA 4Q0UA 3HQRA 4LXLA 1O59A 2D6KA 3TWIA 3LDBA 5FYHA 5DUVA 4D6QA 3W58A 4FPCA 1V6LA 3K75B 3GZUC 4L9BA 2J1RA 4QPIC 4R52A 2KA3A 4RR3C 4RYDA 3BI3A 2WC2A 5FP7A 1W8FA 2PMWB 3A23A 3A0NA 5F2WA 3WQBA 4OHWA 4FOWA 2CYFA 2ZHLA 5FY4A 4MGSA 5A7PA 2ZACA 4MGKE 2BNNA 2BFUL 2PHRA 3AB0A 1JN2P 1QY4A 1W9FA 1C1LA 1RUH3 5DAXA 5FR3A 4YW7A 2G19A 5EQUA 5C6CA 1Z0HA 4CP9A 4JDOA 3ETPA 4QX2A 4QXKA 1X82A 5IAVA 3POSA 2OS2A 2GC1A 3NKGA 2UYBA 4AQTA 3VBRA 3AXEA 5IVJA 2W52A 3C3VA 5FMCA 1W6MA 1RUE1 1W0OA 4JHTA 3C7GA 5DG2A 1AYM1 2UURA 4MGTA 1DQ6A 1UY2A 3VKFC 2ZZQA 5A3UA 3CZUA 1W06A 2VOVA 5IVVA 4KWLA 2IZWA 4KGGA 3RZMA 1RHI1 4AW7A 3U0ZA 1C4RA 1U5ZA 3ILRA 4FPLA 2HWC3 5A80A 4DUVA 1CX1A 5F3IA 1H6XA 2A3XA 4YM0A 5FOBB 4FTBA 4Z8BA 3WV6A 4URTA 1TE1B 3VLBB 4XVHA 1W8HA 1HRV2 1Q3EA 3GBGA 1NUKA 4CUGA 5JR2A 4CTEA 2A3WA 1XYOA 4FFHA 4P9XA 4QX1A 3BU7A 5J3UA 5A7OA 3QBQA 2RDQA 3VDCA 3ASIA 1YCIA 4LNVA 5L36A 1ULCA 1YRZA 1QJZA 2K0GA 1QDOA 3NNJA 2I74A 3ACIA 3LCPA 1UCXA 4Y22A 2WA4A 4XDOA 2WS92 1COV1 1OD5A 2JIJA 1UIJA 1WLCA 2DTWA 2VTFA 4OUSA 3ZM8A 3E6CC 2Q30A 3FLTA 4GZ9A 4DY3A 1O3SA 1AYN3 1BZWA 1ZREA 5FP3A 4Y1ZA 1YI7A 3RZGA 5IUQA 1XSQA 2G1MA 1UY1A 3OJBA 1STMA 4RSUA 3VGIA 3W59A 1RUNA 4EWEA 1D7PM 2XMLA 5CIRA 1MVQA 5CFDA 1VE0A 3DV8A 1W2OA 3GBWA 4YVSB 1QJY3 4AAPA 5BNNA 2AYHA 2W0XA 5FO9B 3B3QE 3WNOA 4AK3A 2GNBA 4X8NA 1UU6A 1LHOA 1VMFA 1HRV3 3EXUA 5FUPA 1E5RA 2Y34A 4FCAA 2XJUA 5FJKA 5F32A 1UU5A 4IV3B 4QB1A 4J1WA 3ZPYA 1QIQA 4LBLA 4MH0E 1NCRB 5B2GB 1H1MA 5IT6A 4O61A 5I0TA 4W6XA 1UL9A 1RUOA 3LA3A 5T5JA 1F4AA 1C8M1 4GWJA 5A7NA 4DRVA 3DPRC 5HBAA 1SACA 1PO11 4YVWA 2QZ2A 4F7ZA 4YZ1A 2QQKA 2WS93 4F83A 4PIYA 4WM8B 4BLJA 3AP7A 5F2SA 2AACA 1G6NA 2P3IA 1OF4A 2FDJA 1O5LA 3M4FA 3KB5A 2EICA 3E5UA 1H8TB 1KQRA 2RJ2A 2GSYA 4OHYA 3NNFA 1NQJA 2VVDA 3AMPA 4OHZA 1RGSA 1D4VB 1TMF1 3KMHA 4GD4A 4I09A 5FMDA 1PM4A 4OHXA 2PFWA 4QB6A 2ZGMA 4LE4A 5LEJA 1CVNA 2VGDA 1VBB2 5ACA1 5T5OA 1HN0A 4XCBA 3UGGA 2D5HA 4M0HA 4LK6A 4TLFA 2P6HA 4ZXKA 3O1TA 1W03A 2V09A 4OYUA 3BTXA 3AC0A 1VB4A 1ZA7A 3KQ4B 4QDRA 4YRDA 3LZZA 3WW3A 4CP9B 1W0NA 1RUD2 2HWE2 5C4WA 1GR3A 2Q4SA 4Y1VA 1YLLA 2Z42A 1QOOA 3MFCA 1O4TA 4CCCA 3BIWE 4FFFA 3DYPA 5K7PA 2B45X 1UYXA 4UW6A 4R9CA 3WR0A 1IKQA 4LQRA 2SBAA 4LOTA 1S0JA 5I91A 4XFBA 3VBHB 1MPXA 1ZZBA 1UPIA 2XHKA 5IVYA 2UWBA 5IK4A 2QBXA 1JOBA 1W6NB 1WKYA 1WMFA 1BBT1 1C3HA 2PHWA 5FKBA 3AYCA 3QH6A 4PF5A 1HRI1 1PVC2 2LRPA 5L7OA 2VXJA 3N7MA 1VBB3 2VQAA 3ES4A 1W04A 2ZMKA 4QGMA 2JDHA 3ALQA 4AQSA 5J98B 3CLPA 3AZZA 1AX0A 1RL3A 4N43C 5D8AC 3KQRA 1YQ8A 4NE9A 3I3QA 4M00A 2OKXA 3WHUA 2W87A 2XKOA 1VBC2 2ZX1A 3LSEA 1RUD3 3V0BB 1GBGA 2XR4A 1ZBE1 1CIWA 4A7ZA 4CU7A 4IEYA 2ZHKA 5FYIA 1BMV2 2HWD2 1DP0A 2FCVA 2V73A 1U5YA 3DEMA 3H1MA 4KBZA 1HN1A 3WNXA 1KRIA 2ZHMA 1DGRA 2R063 5KBFA 4MYEA 3T0BA 1JS9A 3NAPB 5LA2A 4YGBA 1J83A 5JZGB 1TME2 1TVGA 4XCAA 5EYYA 3THTA 2C1FA 2X10A 1J3PA 4K40A 4QXHA 4YFWA 1ZZ8A 4K21A 2VVEA 3EBRA 1NCQC 1NZCA 5ANQA 1YJKA 2B5HA 4FXGB 5FZ8A 3R6SA 5FBZA 5F5IA 1CAUB 4FT8A 1I6XA 4DOUA 4Q4Y1 1UF2C 2CV6A 1PVC3 2XUEA 1SDWA 3WG3A 3SEPA 4NOTA 3R4UA 3ZFFA 4HVQA 1B35A 3GCWA 4P5YA 4LTAA 4O7XA 5T50A 1UMZA 3JBG2 4V2WA 5FO7B 4FPJA 2ZGSA 2FDFA 1POV3 5JI9A 1VBC3 2OT7A 1EV12 1MQTC 1A8DA 1Q43A 4YVWB 4CZSA 2HWD3 4BHPA 4AVBA 2VU9A 2RS32 4XUOA 5C8WA 1LAJA 1PHMA 3FLPA 4FOQA 4F3JA 1UMIA 5FZMA 2HEYF 4NRMA 1BYHA 3THPA 1AL0G 4MV2A 1TME3 3P6BA 1F5FA 1HLCA 3POIA 1IPKA 4XHXA 3KSCA 2WFPA 4XQDA 3MIHA 2RS52 3NKTA 5IVFA 1D2SA 2CNAA 3PJYA 4LJHA 3ZYHA 4AGRA 5JMCA 3P3NA 5JOYA 1G9FA 1UOFA 2RE9A 3NNMA 4CCOA 3TEXA 1PX4A 1LTEA 1N47A 2GN3A 4JCKA 4C91A 1UKRA 1A8MA 4RHV2 5A6ZA 5CA6A 3ZN4A 3C7EA 3JBG3 4OI2A 4LORA 1RXFA 1OVSA 4NMIA 5SV5A 1YNAA 5C4WB 1OT5A 4XUTA 5FZ0A 3ZYPA 1NOVA 1EUUA 4OMCA 3PUIA 5JSRA 1WD4A 2VOWA 1CONA 3IMMA 1KFUL 3TN91 1WW5A 2P34A 1EV13 2VMCA 1MZ5A 3CKHA 5FZ9A 2RS33 2X8KA 3TRSB 2WO7A 5FY1A 2VZTA 4COUA 1JZ2A 2ZX4A 3RPQA 2PHDA 3I54A 4MGQA 2LW8A 4M3CF 1W8ZA 4PDWC 2WR9A 3MGUA 4GB31 4NWWA 4Y5SA 2BOIA 1BXHA 4DXRA 1JZ4A 1SPPA 4DPNA 3KV9A 5D2AA 3ZXJA 1U5XA 1TEIA 4ZPIA 5A7QA 1CX4A 4UXAA 4R4XA 1NXD1 5KWRA 1H6YA 3B69A 4N8MA 3LOBA 2DFBA 5C8CB 1RVF2 5FYBA 1VRBA 5E89A 5FYVA 1TQ5A 5F5QA 2WZR1 4UFJA 1AR71 5JOXA 2FDKA 1Q5OA 4EZHA 1JOJA 1UYPA 4RHV3 5J1XA 2HEVF 1Q8PA 3GHMA 5FY0A 2WZEA 5LRRA 3VBFC 1OA3A 3J7NA 3BKZA 4LKEA 4YW3A 5DN2A 5LRSA 2Q8CA 2JG8C 5TSWA 1RMU1 1CR7A 1FI2A 2RG4A 3FL7A 1E5SA 4XXPA 4IUGA 4FQ4A 1LCLA 2QQNA 1VB2A 4JAAA 2Q0AA 4UOJA 5DDJ3 1GICA 2VNRA 1LHNA 3JXSA 3PVBB 2DCZA 1SCSA 1L7QA 1EY2A 1NA1B 2NPIA 5E6HA 2WZ8A 4IXLA 1JBCA 4I30A 5EJ3A 5APAA 5FZIA 5LASA 3ROUA 1VBA1 1PGL1 3HT2A 4CDQC 2VZQA 3IDAA 4WM7B 3VBUC 5LZ6A 2QQIA 1PIV1 5DUXA 4LO5B 2DCJA 1JMUB 2YY1A 1ASJ2 2ZX0A 5LBEA 4Q0SA 5J36A 5LA0A 2RM22 1O91A 3GZEA 1RVF3 3EHKA 4OMDA 1GKBA 3D4KA 3OD0A 3SKVA 3ZIWA 5JPMB 3ZFFB 2HLEA 1B35B 1U5IA 4HBNA 4UW5A 1VLNA 3VKLA 2XBO3 2VZVA 4JRLA 4QX7A 1SBDA 2B46X 1HXS1 2ILMA 1M4WA 3Q8FA 4BJ0A 5FZOA 2XQXA 2CU5A 2EIEA 1GWMA 3INAA 3IZOA 4JTOA 3ZSEA 2WO1A 4NVPA 5DAVA 2VNOA 2HJIA 3DXTA 2XVLA 1QOTA 3ACLA 4LHLA 1WA4A 2Y0IA 1RUG1 5DMYA 1MVEA 4W8JA 1QKQA 2BNMA 2BGPA 3VBSC 5F9TA 2VL4A 3PURA 3KT1A 1ZZCA 4JGYC 4A3ZA 5FLIA 4DXTA 1FT9A 2A6WA 1QJEA 2VUJA 1ULDA 3NVCA 4AEDC 4O9GA 4YNIA 2WJSA 3KV6A 1FNZA 4AF9A 3ZYIB 3WW4A 4PQQA 2JE7A 2UY8A 4QU2A 4RS5C 5KXBA 2BNOA 1US2A 5DABA 1DF0A 3LA2A 5BNOB 4PJYA 5EYXA 1MS4A 3VBOB 2BFUS 2IC1A 3O0WA 4LR4A 4XTPA 1ZRCA 1W9SA 3M3IA 1PZ8A 2DBIA 4LKSA 1LGBA 3ZKYA 1O3TA 2WWJA 5FKCA 5A3LA 3SH4A 2JDUA 5FZHA 1LOBA 1KXGA 2W68A 3O12A 4CEWB 1JU3A 5HCAA 4Q4V2 2VZOA 4Y33A 4AEMA 4IEWA 3VKNA 5C9AC 2NLRA 3AKSA 3CJIA 3QH7A 4LOSA 3B93A 3IT8A 1UYZA 2GAUA 1H30A 4XFIA 4PHZA 3WNKA 4ASKA 3GDBA 2JKXA 2X53S 2Y6HA 1RUF3 1FV2A 1OPOA 4TN7A 1LNSA 4BDVB 4MGZE 4C90A 4M3CE 1PGW2 2VCMA 1SLIA 2ES3A 3POBA 5FYTA 3DN7A 3BPSA 3KCCA 4QGLA 4NR1A 5LK7B 5JWPA 4B4QA 1CAXA 4B3NA 3AVSA 2YGLA 2J1SA 1SBFA 3KS7A 5I8TA 2V4VA 4KU8A 5F6LB 1CESA 1H4HA 1JHJA 3OYWA 2V72A 4HN0A 1KJRA 5JMOA 4CP0A 5LB6A 4ZXEA 5ABJA 5FXXA 2W94A 1W6OA 3VV1A 1K5MA 3VDDB 4IV1A 4BQYA 1R081 1QQP1 1QJX2 1YO8A 2GNDA 1UZVA 2PHUA 3A4UA 4CA9A 4EWAA 1I5ZA 3KZ4C 3SXWA 1JTZX 3W5NA 1ZBA2 5FYYA 4YSFA 3JB4C 4WVMA 4Q4V3 4Z92B 1OOPA 4NIDA 4E27A 4MXWB 4MX3A 3RG0A 5GZEA 2VMIA 5K0UA 3THDA 4XEZA 4QU1A 3WZ1A 1J59A 3P1IA 3KV5A 4BPZA 4D3WA 3H42B 2E32A 3NWKA 2PLV2 1ODMA 3LEIA 1AL22 1N1VA 1U12A 4M0NA 4BXFA 1KEXA 1KGYA 2HWF2 4BXSV 4E2QA 2DV9A 3UETA 2MEV1 1Z7S2 2XL9A 4JC1A 4D0QA 1WMXA 2WSVA 2BTVC 3BU0A 4CDWC 2B7YA 1XYPA 2EXHA 4BQ1A 3SC7X 2R16A 3TEYA 1DU3D 2JDNA 2DCYA 4H7LA 2CDPA 4W4ZA 4OCTA 1V00A 2P6CA 3NV4A 5DG1A 3RNSA 4QM9A 4FXKB 4EROA 3PUQA 3W5MA 1ONAA 4B8EA 1HQWA 1J58A 3JU9A 1K12A 4Z07A 1ND3C 1FPN1 2JG9A 4GH4C 1ZBA3 5J37A 5A1AA 3I4IA 4QDSA 1IKPA 4H2AA 4KH9A 5GZCA 3OEAA 2XQRA 4I02A 4CDUC 3DYMA 3OF1A 5IYYA 5FUNA 4XAAA 4HONA 3B01A 4JKLA 1S4CA 4XDQA 2OXBA 2WLQA 4YG0A 2RMU1 3IN9A 3VL8A 2WINB 4AHWA 4Z2WA 2J1TA 3UL2A 2XLFA 1ZRDA 3U14A 4AI1A 2PLV3 4IGQA 4K1YA 1AL23 2IXHA 2J1UA 2PTMA 3KF3A 4YM2A 2HH9A 3V65A 4BB3A 3GYDA 2DU1A 4LA3A 2R49A 3ILNA 3FUQA 5A6YA 2WNVC 2XB6C 4QAWA 3OEBA 1V9U3 4D6RA 1H9WA 5CKMA 5FK7A 5A33A 5FV3A 2XKPA 1JYNA 3O1MA 4NJ4A 2Q1FA 3ZKUA 3OG2A 2X29A 2WDBA 4GJYA 3AMMA 2GNMA 1UAIA 4SLIA 2HKXA 1XNAA 1AR62 1W99A 4A42A 1UU4A 2CAVA 4FOYA 3GJAA 3OOXA 1OI6A 4K1ZA 1WLWA 1OQ1A 4AFBA 1BQPA 2PHTA 4BQWA 5A3PA 2KD7A 1XC6A 1W9WA 4BOWA 1JODA 2VTXJ 1DGRN 2W1UA 4JGZA 4M4PA 1CPNA 1OVPA 5CNAA 4XFCA 2GP3A 1RUI1 3H3ZA 4YW4A 1XQNA 4CDXB 1L3JA 5F39A 4I3PA 1FMD2 2B9UA 2RR12 4CE8A 4JDMA 4N53A 1CAXB 3TB0A 1IZ3A 3VD3A 2JICA 2GDFA 3ON7A 2Q8DA 4CCJA 1W3VA 4CEYB 1OA2A 2PN5A 3HN1A 2GMEA 4YW2A 1MS3A 3HD8B 4D69A 1BJQA 4XFAA 1UY3A 4YM1A 4RQPB 1SDDB 1DFQA 1W6OB 1AXKA 2AC1A 2PA7A 1R64A 2G9FA 2D6OX 4NUBA 1J3RA 1DQ4A 3C2UA 3MUZ1 1JZ8A 1ND2B 1AX1A 3H1WA 4YGCA 4JKKA 3KWVA 2OQ6A 3IDEA 4AI8A 1KS5A 4WVMB 3VN4A 1AR63 1GU3A 2UYAA 2FDIA 4R9BA 1ENQA 5DZGA 4CCMA 5K0UB 2A6VA 4D7TA 4WVZA 3T2OA 2XJTA 4KL1A 4I0BA 2PQQA 1CJDA 1IS4A 1YQ6A 4ASLA 3DKQA 3UNPA 3FC0A 2R071 3FLRA 1ZX5A 3QACA 2W1QA 1NYWA 5IK8A 1MEC3 1ALYA 4BZ4A 5CFCC 1N1TA 1BEV3 3JQWA 1KJLA 4ASMB 5I0RA 1IG3A 1A34A 2D40A 3WW1A 4GMP3 3BTZA 5D21A 3AX4A 4E4HA 2AZ5A 5CG9A 4QDQA 1G8WA 4Y1YA 1AJOA 2DVDA 3ZDSA 2A3YA 3I2FA 3FJSA 1DYKA 2C26A 1REDA 2HWB2 4UWDA 1OLME 5LY1A 3I49A 4CUBA 3HT1A 1RYYA 1RJ7A 1W2AX 4QPIA 4RR3A 2Y33A 4Y24A 5K4LA 3O1SA 3OGJA 4LIVA 3LF7A 1BCXA 1XE0A 2E33A 4ITCA 4G4FA 5G04L 1GUIA 3V56A 5BUVA 4MHUA 2B9VA 2R30A 1RUC2 4P9GA 3THCA 3WP3A 2W2IA 2VCBA 3S7EA 3CDZB 3RZJA 2XWJB 1H8VA 2PELA 3NJYA 1W05A 4QQ2A 3VHPA 4Y4YA 3OB8A 4NHMA 1O4ZA 3O1VA 1S55A 4Q0PA 2GU9A 2IFWA 5A33B 3N4MA 3A7QA 2ATFA 1POQA 3B94A 1RHI2 4Z82A 4N9HA 3USSA 1O3RA 4HK8A 3VL9A 4QKBA 1LOGA 2W08A 1EUTA 3V64A 4LUMA 3B7MA 1FOD1 4AQ6A 1DLLA 1GWLA 2DURA 1EAH2 4UW3A 4AAXA 1XE8A 2HWC2 4RD7A 2IVJA 3ILFA 2VZ3A 3WP5A 1Y3TA 4GMP0 1VJ2A 1H2MA 2HWB3 3S6PA 4NIHA 4I2OA 1I3HA 5JUVA 3H9AA 1P8JA 4JGZB 2B42B 4HVOA 2JDPA 4E4DX 4XZPA 2H0VA 2J7MA 3ACGA 4EV0A 3GF6A 4S2DA 3AP4A 4D6SA 3D0SA 2WRAA 2N7GA 2FQPA 1G9DA 4QPGC 1RUC3 3BCWA 4YVSC 3LA7A 4N53B 4IE4A 1GZWA 4LBQA 4XJ8A 2FBEA 4FAHA 5K8SA 3K3NA 1DLCA 1NG0A 3BOPA 3WT3A 3AKTA 1F35A 1MS5A 2VO5A 5FQ0B 1W6QA 4YWAA 1LOFC 2JXAA 5GZFA 3BTYA 5K9YA 2EIDA 4IV3C 1OH3A 4XACA 4F8AA 1AYN2 4IEOA 2FCTA 1NCRC 2BDRA 1LR5A 2D6MA 2Z5WA 3U1XA 2HBTA 1OUXA 3AZWA 1RHI3 1PMHX 1ZNPA 4BQ5A 2W92A 1GOFA 2GC0A 2BEOA 3UKNA 2Y6FA 1QDCA 2D43A 1EAH3 4K8FA 1QJY2 4P02B 2O14A 5IWFA 2QQVA 1VRH2 5L73A 2YYOA 4WM8C 5GZDA 1FNYA 4A3XA 4BM8A 1JI6A 2WO2A 1AXZA 5DXDA 1VAKA 1WLTA 3N35A 4Y1XA 3WLUA 2VR4A 1YIFA 1H8TC 2JD9A 4Q29A 4XBQA 1T6BX 1CAVB 4HOOA 3MV11 3J26N 2OZ6A 1YFYA 4FOVA 1WZXA 1MACA 1VMHA 4MADA 3SCFA 5F3GA 3R05A 2R1DA 2ZGTA 2VTXA 3D82A 4GAZA 4DZGA 5M0TA 1XU2A 4LPLA 4RA0A 1Y43B 4NIAA 3ZDVA 2J42A 1F15A 1Z78A 3VZNA 2VOXA 4OQ8A 1PMJX 3DPRA 3HAGA 2ZTNA 3WY6A 1REFA 4J25A 2ETEA 3EJKA 3BPZA 1TMF2 3MBWA 4NHYA 4QX3A 4FBFA 4BYYA 3E5QA 5F1RA 1CN1A 5ACA2 3IM0A 3UYJA 2GH8A 3HEIA 3PVOA 3RSJA 4EN9B 1JZ7A 2A5ZA 2H6CA 2JDKA 2OZJA 4R8HA 3DECA 5JIAA 5FXZA 4XJ9A 4CXWA 4QPIB 3TAYA 2GZWA 4HK9A 2VZRA 1VRH3 3VBHC 1QXRA 1Q8SA 3WF2A 1LGCA 5GKAC 3WQ0A 3ATGA 4UFLA 2D6PA 1BVP1 3A21A 1DHKB 2BBVA 2DU0A 1DZQA 3WG2A 4BA6A 4PBPA 4EN8B 2IVIB 3WCSA 2CL2A 1PO13 1UOJA 4AVSA 3BYWA 4QMAA 3MDPA 5ERLA 3K2OA 2Y38A 3NO8A 2LROA 1UN1A 2BVVA 3OPTA 5IJRA 3C7OA 1XYNA 2GN7A 3BVCA 2ENRA 4PIXA 1L7LA 4BMEA 5KC5A 1W2TA 2XVGA 3N9MA 1TMF3 1HRI2 1N3OA 3D5OA 4LO4B 2Z2SB 4PIZA 3VD9A 5IVCA 1DQ2A 3PMSA 5ACA3 4CXXA 4EJRA 2NMOA 5HCHA 2W39A 4KWUA 4BQXA 1GFF2 4X8PA 2IXLA 1TNFA 3NAPC 4A45A 4Q8KA 4CPBA 5JXHA 4B7KA 5JZGC 4BK4A 2LALA 4QPYA 1HB2A 3OBAA 1YFWA 5T55A 3HBKA 3WQ7A 3MIEA 1EYBA 2L9LA 1DBNA 3RGBA 2ORZA 2WS91 3MPPG 3N36A 4K8RB 3SNMA 3T30A 1UX6A 3RDIA 2VECA 4ZU5A 1GZWB 5D8AA 4N43A 4LBQB 3VBRB 3IDBB 3J7LA 1W6MB 2UWAA 1MZEA 3ECQA 4LO6B 2R062 3ZFGC 2SLIA 1W6QB 3H8UA 4WZCA 5LBBA 2IUWA 1SMVA 1O5UA 3AKPA 4OZXA 5C3QA 1M06G 1S2BA 1R1A1 1S0DA 1LHWA 2YZ4A 2WBKA 3ZXKA 4RL7A 2QFEA 1LJ7A 1BBT3 3DL3A 2WWUA 3ELNA 3K3OA 5CKQA 1UOBA 2JDAA 2J1EA 5DUUA 2PHFA 3H7YA 5FP4A 2AREA 5A32A 5JSOA 4KU7A 1HRI3 3RQ0A 2A71A 3NJVA 2VM9A 4RFRB 1GNYA 4WZFA 5FAXA 3UESA 4YG3A 2MPFA 3DUIA 2CY6A 3E1F1 3N7KA 1H1IA 2D7FA 3ZXGA 1NCQA 3C7HA 2EA7A 1QH7A 5EV7A 5C33A 1PZ7A 2WKKA 1FX5A 4NHKA 4NAMA 2EF6A 1OMIA 1UX7A 3DF0A 1VBE2 2QQMA 4CVUA 1X9TA 3I59A 2YV8A 2DVGA 4Q4W2 4UI9L 2QQLA 5EFUA 1UY0A 3WDUA 4MLOA 3OUJA 4J1XA 2XJQA 5B4XA 4BU2A 4C0HA 1O7FA 4Y22B 4IGPA 4AYUA 5DQ0A 1W28A 3EMRA 4MGYE 1T2XA 3D0JA 4XDPA 3VZOA 5C70A 4ZONA 4YZ2A 4XW3A 1LEMA 1MQTA 1Q8VA 1K45A 2JDZA 5T5PA 1G9BA 2YPJA 5FMBA 2EIGA 5GJ6A 1X9PA 5CEHA 2IFRA 3POWA 3MF6A 1LHVA 3X29B 5J96B 2WN3A 3BALA 3RRDA 2VXRA 2DTYA 4Q4Y3 3RWNA 1N3PA 1SCRA 5CFDB 1GNZA 5BNNB 2WT2A 3OCPA 2VNVA 2JDYA 2VW0A 3RMXA 2HWE1 5FY8A 4ZU7A 1GZTA 1SFPA 1LHUA 3WHTA 3J8F1 1O3QA 3CNAA 1W8OA 3T09A 3KM5A 5CBLA 4OHVA 2HYXA 2XDVA 5C5TA 1TNRA 1QH6A 1VBE3 3AK0A 1LU2A 3FWEA 4LO8A 4DXZA 2W3JA 4LUKA 2OUJA 1O8SA 5C8CC 4Q4W3 4KGQA 4C0BA 4AHXA 3PTRB 1FXZA 3NL1A 1LOAA 4IEPA 3U10A 1YC61 2DWRA 4XJZA 1LKNA 3PNAA 5CU1A 5KXEA 4ONUA 3HQXA 1HV0A 1WGPA 1UIKA 2ZKLA 1NX9A 5L19A 2FZ1A 2D5FA 3ME2A 2VW1A 1IHMA 1O4YA 1PO21 5LK5A 3L2HA 2P3YA 4I3GA 3AP9A 2YFUA 2XL7A 4UFHA 4P08A 1SEFA 2VUDA 1IS3A 1POV1 3M3OA 3NSTA 3PVEA 4LITA 4PDWA 5E8AA 3IAQA 3L9JT 1NA1C 5CB7A 2JENA 2W91A 4UF0A 4ARYA 3T4VA 4PLOA 1BMV1 1W8NA 5FPXA 4ISRA 4WM7C 2VUAA 1FV3A 3JZVA 2F17A 1RMU2 2OW4A 2VBPA 2TUNA 3UKVA 3W9AA 2QJVA 2DBNA 5FWEA 2A1XA 4XC9A 2R041 2RV9A 2FCUA 4N43B 5D8AB 5LATA 5DDJ2 1UPSA 4Y26A 5FCCA 3VBFA 5KHHA 3WNNA 4Q4X1 2ZGLA 3WW2A 2ZOEB 4P9YA 3VDBA 1VBA2 2JG8A 4A2UA 3WSOA 5A3WA 4CCEA 2GMMA 2RDRA 2BV4A 4COVA 3RI9A 2I07B 2BWAA 1YXWA 2W47A 4Y20A 3NV1A 4GKYA 2VCCA 1V70A 3RZHA 1DGWX 3MICA 2XPJA 1NZIA 4UAPA 4QT6A 4LKDA 4GXLA 4YGEA 3TNPB 4OQ9A 3GNEA 5L7OB 4CDQA 3K4ZA 2WZR3 4Q2FA 4XBNA 1AR73 1UW8A 3VBUA 4AFCA 2Z79A 3AJYA 1NCQB 3LWCA 2XBO2 1QNYA 4EN7B 3MW3A 3MPBA 3AP6A 5C3RA 4XOGA 4XPVA 3POGA 1PM7A 1SFYA 1ZRRA 4QXCA 4B4RA 4YW1A 1OSGA 1RMU3 1YEWA 2D3RA 3I59B 4HKWA 1RUG2 1IPSA 2OPWA 4JV4A 3O0VA 2V5DA 1IOAA 3E5XA 4LLOA 4XF4A 1WCSA 2Y6KA 1CAWA 5BNOC 1SLBA 5FZ4A 5FMOL 5FXWA 2BGOA 5BXXA 4HFSA 1SG3A 2AUYA 3VBOC 2VNGA 3W21A 4AGVA 1H9PA 1VBA3 2X5IC 4HVRA 1Y9MA 4Q5OA 3VKMA 2RS51 4ISQA 1DZTA 1GZ9A 1JYCA 3AM2A 2YGMA 4XILA 1PIV3 4KQ7A 4KNCA 3NNLA 3POFA 2VQ0A 2AEYA 5T52A 3U4XA 3H8XA 5IK7A 2R32A 2Y8KA 2GC2A 2E31A 2QZ3A 3VBSA 4CEWC 4Y5TA 2YPDA 4L99A 1XBFA 3LKJA 4RHV1 2P37A 4JGYA 3SHRA 3VKOA 3FFZA 2Q1ZB 3O14A 2KR2A 4CU6A 3PU3A 4AEDA 2F4LA 1YQ5A 3I3BA 3DCQA 4AHZA 4ZZ5A 5C3PA 4XIKA 4XMAA 3RYKA 2ZCWA 3IB3A 2ZMLA 1VBD1 2ZABA 4RS5A 4EQVA 5JDBA 5KXDA 5EXOA 3M2MA 3MIGA 1QJU2 2BP6A 3AZVA 3L2YA 3MLKA 1GOGA 1RUG3 3A0KA 3JCIA 1DGWA 5FYSA 3KGLA 4FQZA 4QWNA 4QHBA 4NWVA 3NRUA 1F2NA 5ISLA 1OC1A 3NQHA 3ZSKA 1C1FA 1RUF2 2VPVA 5FZEA 2OX0A 1JW6A 4DO0A 1XNTA 3E6DA 4QQHA 5FYZA 3VDDC 2PHXA 5C9AA 5A70A 2VC9A 3O5SA 3ZIXA 1ZRIA 2DUPA 2BZDA 5IVBA 4DINB 2DVAA 1CPMA 3T3YA 2OIIA 2Z69A 5EHDA 3CL1A 4XFGA 3T1LA 1LOCA 2ZGPA 2GP5A 4S2HA 4QPWA 1CQ9A 1D4M1 1V6IA 5LBCA 1BVVA 2ERFA 2CGPA 3GBFA 5JOWA 4DEQA 2AH2A 2WT1A 3F95A 4BQ4A 1UOGA 1NLQA 1URXA 2VVFA 3IAPA 5LWBA 3CJXA 3ST7A 2G9ZA 2PAKA 3ZYGA 5KC6A 1CGPA 1QJU3 5FPBA 1W8WA 2C6SA 3PUHA 1NY71 2BRTA 2IXJA 1WD3A 3KT7A 1QWRA 3ZFEC 4IETA 2JG8B 1NLSA 4IEQA 4A6SA 2C5DA 3N9NA 3HBZA 5LCWL 3N9OA 1ASJ1 2R7EB 2WQZC 3OGSA 3PUAA 4Y20B 2RM21 3S30A 4A7KA 5IK5A 4M3CA 1WW7A 3WNLA 2WFF2 1SPPB 3LOIA 2QQWA 5F3CA 3PVNA 2DUQA 2DCTA 5GLVA 4P9WA 4RGGA 5IATA 4XHBA 4E2GA 4XJUA 4N7UA 2AEZA 3I3EA 4LMFA 2YC4A 1WCUA 5KHKA 3BOWA 4OUEA 1HQLA 2E7TA 3IWZA 4GA9A 5F5AA 3FUOA 3H3UA 1RUJ1 4FPKA 4AZZA 1DDLA 1D0GA 1HKDA 1ULPA 1R083 1QQP3 3GM8A 4OVEA 5FP9A 3T2QA 4XQWA 5CKNA 3SITA 4CDWA 3LEGA 1FPN2 3SEEA 2BW8A 2DUOA 4K20A 1OFSA 2EXIA 4I0AA 4DUXA 5AC92 2DYCA 4RGAA 3RZKA 5BYNA 2NMNA 2ZAAA 1AR82 3M3QA 1A78A 5A7SA 2RMU2 3PJQA 2I45A 3M3EA 2P1BA 1ST8A 3HNMA 1ND3A 4GH4A 5T3NA 2O0OA 3TEZA 3J4UH 3UV9A 4BQ3A 2P5BA 1O8PA 4LBJA 4PLMA 1W9YA 2FMDA 2WFF3 4P9LA 4JVAA 4XUPA 4NHXA 5GLZA 3ZN6A 4CDUA 1YIPA 3V0AA 2MEV3 3OUIA 1CZTA 2VD7A 3QOPA 3BUCA 1RB8G 2BUKA 4IE0A 5H9SA 1ENXA 4W6WA 4H55A 1MS9A 1RJ8A 1V9U2 2YUEA 3AMQA 4QM8A 4J6GA 4CSWA 3WINE 1DZRA 5FZOB 4COWA 4Q4V1 4C8DA 2CWMA 2VZ1A 3HPNA 3HIFA 2VJXA 3PUSA 1UZYA 4CDXC 2VY0A 2E7AA 2WNVA 1ULOA 3OPZA 2WNEA 1JOPA 1KS4A 3GHNA 3VZJA 1R091 2D3PA 1FPN3 3H8RA 4Q27A 4CEYC 4JX0A 4LO7A 5AFBA 1DCSA 1ENSA 3HMYA 5AC93 3I97A 5G05L 4TTGA 1NQDA 4XZUG 5FZ7A 4RQPC 1AR83 3S7IA 2VULA 3K46A 4COYA 4MHRA 4NRPA 4CYDA 2VE1A 1AR92 2RMU3 4RGKA 2BYVE 4LK7A 3VB9A 1VR3A 2QKDA 4FFGA 1HB4A 3LEMA 1ND2C 1XPWA 3C8XA 4OZOA 4QKFA 1Y7BA 2LM3A 5I0UA 1MS0A 3CHXA 4Y4RA 2BVBA 3ZXAC 4CCNA 5JXJA 2EXJA 4DIQA 1W90A 2WQ8A 3OD4A 5FFOC 1QJX1 3FX3A 3C7FA 2AENA 2CTVA 2R0FA 1XSRA 3SKJE 4BH9A 1C5IA 2Q8OA 4FP2A 5H9QA 5JPNB 4L8QA 1OD3A 2G9GA 1PK6C 1SBEA 4QX0A 4P9IA 1W3XA 2QTWB 3T2TA 5DAPA 2A70A 2UY9A 1VAVA 4AE2A 4PQ9A 1RXGA 3ETQA 3CJIB 2ZX3A 2ET7A 1GP6A 4ZY9A 4XMIA 5FO8B 3ZSJA 2RS12 3MLJA 1PNFA 4AQ2A 3J7MA 1AR93 2HWF1 3B5LB 3RI8A 4URAA 1Z7S1 5DAQA 3RYRA 3D3AA 2P2KA 3K4AA 3RYPA 4DS0A 4TXWA 1MEC2 5FOJB 5BNQA 1QF3A 3CU7A 4KBBA 3I7DA 5E1RA 1PGL2 5FZLA 3HN3A 5JVVA 1BEV2 4CP2A 2ZHNA 3MW2A 1EPWA 2JEMA 4QKNA 2DVFA 4UT5A 3FHAA 1OLQA 3KCYA 4DXSA 3ZXEA 3OYWB 2WZPP 5T54A 1OF3A 5A6XA 4KWJA 5ABJB 3NV3A 1UMHA 1S0BA 5BNPC 1K5MB 4IV1B 5CFCA 4GWIA 2G4IA 2VMEA 4JDNA 4XJAA 4CDWB 1X36A 3G7DA 5JXIA 4WVVA 5KHGA 2PXJA 4LEJA 4TWTA 2Y6JA 5FPUA 2WNUC 4UFMA 4GWMA 1F5JA 4XXAA 3WNPA 4OULA 1I1EA 5E88A 3UGFA 1OOPB 4META 3LFIA 1C28A 3U37A 5A6QA 4R9DA 1ZA4A 5FPZA 4EN0A 4Z2AA 1OQEA 4FPEA 2RS13 2VOTA 2R073 4INDA 3I2HA 1V6OA 3JD72 3ZN6B 2WAOA 1WUVA 4CDUB 4YARA 4FVVA 4AG4A 3ZYJB 2WL1A 4E4ZA 2XLAA 2E7QA 2QDRA 1YFUA 5I0SA 4ZS3A 5L9VA 3G6JB 4OUMA 5A3OA 4AFAA 4Q8LA 3JB8A 4WVWA 3U11A 3B9IA 3AL6A 4QGNA 2IXIA 2VMDA 1AJKA 2WNVB 3WUCA 5JLVA 4ZS2A 2QUOA 2YMZA 4OFGA 3UK9A 3GJBA 3KV4A 3MO4A 3OGGA 1XE7A 4V1PA 3LIHA 2JG9B 4N7IA 1JYVA 4EYUA 2BWCA 1OLMA 2VH9A 4BLIA 4AFMA 3RZZA 1FMD1 4ZU4A 3BIEA 2RR11 2NM1A 1J1TA 2D97A 2D3SA 2JKBA 2J1AA 1WCDJ 1OKOA 1SFNA 2ZJCA 3JD73 4FPHA 4QB2A 1X50A 4LA2A 4Z1VA 1RUE2 1H0BA 3ITQA 3N3HA 3USUA 3ZN5A 1AYM2 1XNKA 3WVJA 1ULFA 2ZEXA 5EP9A 2DF7A 1WWYA 1TZOA 1BK0A 2BJSA 3I2IA 3KGZA 1DQ0A 3ZPOA 1K5JA 4QPGA 4XFHA 5HV0A 5FZ1A 4HKOA 3EQEA 5JI7A 4YVSA 1JZ6A 2ARCA 2XH6A 4LE3A 1JYWA 3O0XA 3GCXA 1FOD3 3D8CA 3I3DA 5JCTA 1OA4A 2A73B 1LOFA 5J48A 2F4PA
chains in the Genus database with same CATH topology
3WNMA 3K4DA 1JZ3A 2WBKA 3FL7A 4IUGA 2QQNA 2YC2A 4UOJA 2JDAA 2J1EA 3JXSA 2ZEYA 2B4KA 4A44A 1L7QA 2Y6GA 3NJVA 2VM9A 4E8DA 2WZ8A 1GNYA 4ARYA 1K42A 3UESA 3E1F1 3LEKA 4L0PA 1SHWB 2VZQA 3IDAA 2QQIA 3C7HA 4CUCA 2DCJA 4A6OA 1UX7A 4YPJA 5LA0A 3A22A 2QQMA 5IFTA 3SKVA 4OMDA 1US3A 3GGLA 2HLEA 2QQLA 2VZPA 1UY0A 4UI9L 5B4XA 5F7UA 2VZVA 3ACHA 3EB7A 4BJ0A 3T2PA 5DQ0A 3FHQA 2XQXA 2EIEA 1T2XA 5IHRA 3ACFA 5C70A 2WO1A 4JKMA 2W1SA 1K45A 2WYSA 5DMYA 4W8JA 2WN3A 5LA1A 1IQDC 2E26A 2BGPA 2VL4A 1W9TA 4DXTA 3I2GA 4A3ZA 4P00B 2ID4A 2ZEZA 4LHSA 1UYYA 2Y64A 1UXZA 3HNYM 2QQOA 1W8OA 3T09A 4MOAA 4PQQA 2HYXA 2ZXQA 1UZ0A 1US2A 2J1VA 3LE0A 1I5PA 2W3JA 1O8SA 2X09A 3J7HA 1W9SA 4LKSA 4W50A 1BHGA 4ZZ8A 3OGVA 1NX9A 1JU3A 4CUAA 2VZOA 1UYZA 3ABZA 4JHZA 3WNKA 3GDBA 2JKXA 2Y6HA 2YFUA 4BDVB 4P08A 1LNSA 4MO3M 1JYXA 3IAQA 2RVAA 2W91A 1JU4A 1W8NA 3LQCA 2J1SA 2JE8A 2V4VA 3K77A 2RV9A 3HJRA 1JHJA 2V72A 4PF1A 5JMOA 4ZXEA 2VZSA 3WNNA 4A41A 2W94A 3VDBA 3WSOA 2W47A 5HPOA 3W5NA 2VCCA 5EIYB 2W9XA 4UAPA 1TG7A 1L7RA 2BERA 4FI9A 3THDA 4ARXA 3K4ZA 3HOBA 3VD5A 3P1IA 4KI5M 2C9KA 2Z4FA 3WF3A 2E32A 3NJXA 3LEIA 4PT6A 3WF4A 5EJZB 1KEXA 1KGYA 2WABA 4HG6B 4BXSV 2VCAA 3LPGA 3UETA 3I2JA 4D0QA 2V5DA 5I0DA 2Y6KA 2VQTA 2BGOA 1SG3A 2CDPA 3BGAA 4W4ZA 3GXUA 1O59A 3W5MA 5JXGA 1K12A 3K75B 2Y8KA 4QDSA 2E31A 2ORXA 5A1AA 2J1RA 3OEAA 4RYDA 4CU9A 3DYMA 5IYYA 3A23A 2YB7A 4A4AA 4CU6A 4JKLA 3WQBA 3I3BA 4MGSA 2J1TA 4ZZ5A 3IB3A 5B4NA 2J1UA 2W1WA 4XUNA 2WN2A 3CIHA 4CU8A 3ETPA 1GOGA 4QX2A 4QAWA 3OEBA 3NRUA 3WF1A 3NQHA 1JYNA 3OG2A 1XNTA 3C7GA 2WDBA 1UY2A 1XNAA 4DEVA 2VC9A 1W99A 2BZDA 4A42A 3CZUA 1UY4A 2DDUA 2KD7A 1XC6A 1W9WA 3IIIA 4QPWA 2W1UA 4M4PA 1CX1A 4DUVA 3F2ZA 1H6XA 4DEQA 1OH4A 4XVHA 3T08A 4M4RA 1NUKA 5JR2A 2YG0A 5FUIA 3WEZA 3IAPA 3VD3A 4QX1A 3VDAA 3VDCA 1NAEA 2VMFA 1F4HA 1UY3A 3PUHA 1SDDB 3ACIA 1R64A 3MUZ1 5LCWL 3I2KA 1JZ8A 2VTFA 3ZM8A 2R7EB 1YQ2A 3OGSA 2YFZA 4JKKA 4GZ9A 1CZSA 1UXXX 3WNLA 5CYYA 1GU3A 3VD4A 1UY1A 3I3EA 3T2OA 1D7PM 2YC4A 4OUEA 5HXMA 3UNPA 4RN5A 3CMGA 3WNOA 1NKGA 2W1QA 4DUWA 1ULPA 2XONA 3GM8A 3T2QA 4QB1A 4XURA 3LEGA 3SEEA 4DUXA 2W46A 2Y6LA 1F4AA 4GWJA 4QDQA 1J84A 2XHNA 2QQKA 1GQPA 3I2FA 2C26A 1GOHA 3HNMA 1OF4A 4CUBA 1O8PA 1RYYA 2EICA 4XUPA 2RJ2A 2E33A 5G04L 1CZTA 1GUIA 4QB6A 3VD7A 2B9VA 1CZVA 3MUY1 3THCA 2VCBA 3CDZB 3NNGA 2VZ1A 4OYUA 3HPNA 3AC0A 2VJXA 4QDRA 3OB8A 1JZ5A 1ULOA 1W0NA 3A7QA 3FN9A 4JX0A 3DYPA 1UYXA 3I97A 1CIYA 5G05L 4TTGA 4XZUG 1EUTA 4LQRA 3K46A 4AAXA 1MPXA 3CQOA 2VZ3A 4OZOA 3C8XA 1XPWA 2QBXA 1WKYA 5JUVA 1P8JA 5IFPA 2J7MA 3ACGA 5JXJA 2WUHA 2WQ8A 3C7FA 2VZUA 2WO3A 3SKJE 2QQJA 4ET7A 1OD3A 1DLCA 1PX3A 4QX0A 2VO5A 2OKXA 2W87A 4D8MA 2X05A 3HNBM 3CZJA 2EIDA 4CU7A 1DP0A 5DPNA 4ZY9A 1HN1A 1PMHX 1UWWA 2W92A 1GOFA 3T0BA 5LA2A 1J83A 4P02B 1TVGA 2X10A 3D3AA 1JI6A 3K4AA 2WO2A 4TXWA 5C7GA 2VR4A 2XOMA 2JD9A 3HN3A 3DYOA 3FHAA 4DXSA 3MV11 3SEPA 2WAAA 1OF3A 4P5YA 1UMHA 4MADA 4XUQA 3WF0A 4GWIA 2VMEA 3T0DA 1GMMA 5JXIA 4LPLA 2CDOA 2Y6JA 1PMJX 2W5FA 4QX3A 3WNPA 3T0AA 3MBWA 3U37A 4XUOA 3HEIA 1DYOA 4Z2AA 1JZ7A 1UMIA 2EIBA 2VOTA 3DECA 3I2HA 2C4XA 3LPFA 3P6BA 2VZRA 2WAOA 5CZKA 4AG4A 3WF2A 4KMQA 3A21A 2ZEWA 1PX4A 2W95A 2VMDA 1K3IA 3C7EA 2J22A 4BK5A 5IJRA 1OT5A 3C7OA 2BBAA 4XUTA 2PQSA 4OMCA 1EUUA 3MO4A 3PUIA 1JYVA 2VMCA 5C71A 3CKHA 5EJ1B 3VD9A 2VZTA 1JZ2A 4KWUA 4MGQA 2LW8A 3EYPA 4A45A 2J1AA 5JXHA 2VQUA 4DXRA 3BN6A 4CVUA 4QB2A 1JZ4A 4BK4A 3OBAA 2ZEXA 1H6YA 2L9LA 4E8CA 2LS6A 2ORZA 3I2IA 1WCQA 3OGRA 1JZ6A 1JYWA 5J1XA 2DCKA 3I3DA 2WZEA 3ECQA 3MV01 5DN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WNM A;  3K4D A;  1JZ3 A;  2WBK A;  3FL7 A;  4IUG A;  2QQN A;  2YC2 A;  4UOJ A;  2JDA A;  2J1E A;  3JXS A;  2ZEY A;  2B4K A;  4A44 A;  1L7Q A;  2Y6G A;  3NJV A;  2VM9 A;  4E8D A;  2WZ8 A;  1GNY A;  4ARY A;  1K42 A;  3UES A;  3E1F 1;  3LEK A;  4L0P A;  1SHW B;  2VZQ A;  3IDA A;  2QQI A;  3C7H A;  4CUC A;  2DCJ A;  4A6O A;  1UX7 A;  4YPJ A;  5LA0 A;  3A22 A;  2QQM A;  5IFT A;  3SKV A;  4OMD A;  1US3 A;  3GGL A;  2HLE A;  2QQL A;  2VZP A;  1UY0 A;  4UI9 L;  5B4X A;  5F7U A;  2VZV A;  3ACH A;  3EB7 A;  4BJ0 A;  3T2P A;  5DQ0 A;  3FHQ A;  2XQX A;  2EIE A;  1T2X A;  5IHR A;  3ACF A;  5C70 A;  2WO1 A;  4JKM A;  2W1S A;  1K45 A;  2WYS A;  5DMY A;  4W8J A;  2WN3 A;  5LA1 A;  1IQD C;  2E26 A;  2BGP A;  2VL4 A;  1W9T A;  4DXT A;  3I2G A;  4A3Z A;  4P00 B;  2ID4 A;  2ZEZ A;  4LHS A;  1UYY A;  2Y64 A;  1UXZ A;  3HNY M;  2QQO A;  1W8O A;  3T09 A;  4MOA A;  4PQQ A;  2HYX A;  2ZXQ A;  1UZ0 A;  1US2 A;  2J1V A;  3LE0 A;  1I5P A;  2W3J A;  1O8S A;  2X09 A;  3J7H A;  1W9S A;  4LKS A;  4W50 A;  1BHG A;  4ZZ8 A;  3OGV A;  1NX9 A;  1JU3 A;  4CUA A;  2VZO A;  1UYZ A;  3ABZ A;  4JHZ A;  3WNK A;  3GDB A;  2JKX A;  2Y6H A;  2YFU A;  4BDV B;  4P08 A;  1LNS A;  4MO3 M;  1JYX A;  3IAQ A;  2RVA A;  2W91 A;  1JU4 A;  1W8N A;  3LQC A;  2J1S A;  2JE8 A;  2V4V A;  3K77 A;  2RV9 A;  3HJR A;  1JHJ A;  2V72 A;  4PF1 A;  5JMO A;  4ZXE A;  2VZS A;  3WNN A;  4A41 A;  2W94 A;  3VDB A;  3WSO A;  2W47 A;  5HPO A;  3W5N A;  2VCC A;  5EIY B;  2W9X A;  4UAP A;  1TG7 A;  1L7R A;  2BER A;  4FI9 A;  3THD A;  4ARX A;  3K4Z A;  3HOB A;  3VD5 A;  3P1I A;  4KI5 M;  2C9K A;  2Z4F A;  3WF3 A;  2E32 A;  3NJX A;  3LEI A;  4PT6 A;  3WF4 A;  5EJZ B;  1KEX A;  1KGY A;  2WAB A;  4HG6 B;  4BXS V;  2VCA A;  3LPG A;  3UET A;  3I2J A;  4D0Q A;  2V5D A;  5I0D A;  2Y6K A;  2VQT A;  2BGO A;  1SG3 A;  2CDP A;  3BGA A;  4W4Z A;  3GXU A;  1O59 A;  3W5M A;  5JXG A;  1K12 A;  3K75 B;  2Y8K A;  4QDS A;  2E31 A;  2ORX A;  5A1A A;  2J1R A;  3OEA A;  4RYD A;  4CU9 A;  3DYM A;  5IYY A;  3A23 A;  2YB7 A;  4A4A A;  4CU6 A;  4JKL A;  3WQB A;  3I3B A;  4MGS A;  2J1T A;  4ZZ5 A;  3IB3 A;  5B4N A;  2J1U A;  2W1W A;  4XUN A;  2WN2 A;  3CIH A;  4CU8 A;  3ETP A;  1GOG A;  4QX2 A;  4QAW A;  3OEB A;  3NRU A;  3WF1 A;  3NQH A;  1JYN A;  3OG2 A;  1XNT A;  3C7G A;  2WDB A;  1UY2 A;  1XNA A;  4DEV A;  2VC9 A;  1W99 A;  2BZD A;  4A42 A;  3CZU A;  1UY4 A;  2DDU A;  2KD7 A;  1XC6 A;  1W9W A;  3III A;  4QPW A;  2W1U A;  4M4P A;  1CX1 A;  4DUV A;  3F2Z A;  1H6X A;  4DEQ A;  1OH4 A;  4XVH A;  3T08 A;  4M4R A;  1NUK A;  5JR2 A;  2YG0 A;  5FUI A;  3WEZ A;  3IAP A;  3VD3 A;  4QX1 A;  3VDA A;  3VDC A;  1NAE A;  2VMF A;  1F4H A;  1UY3 A;  3PUH A;  1SDD B;  3ACI A;  1R64 A;  3MUZ 1;  5LCW L;  3I2K A;  1JZ8 A;  2VTF A;  3ZM8 A;  2R7E B;  1YQ2 A;  3OGS A;  2YFZ A;  4JKK A;  4GZ9 A;  1CZS A;  1UXX X;  3WNL A;  5CYY A;  1GU3 A;  3VD4 A;  1UY1 A;  3I3E A;  3T2O A;  1D7P M;  2YC4 A;  4OUE A;  5HXM A;  3UNP A;  4RN5 A;  3CMG A;  3WNO A;  1NKG A;  2W1Q A;  4DUW A;  1ULP A;  2XON A;  3GM8 A;  3T2Q A;  4QB1 A;  4XUR A;  3LEG A;  3SEE A;  4DUX A;  2W46 A;  2Y6L A;  1F4A A;  4GWJ A;  4QDQ A;  1J84 A;  2XHN A;  2QQK A;  1GQP A;  3I2F A;  2C26 A;  1GOH A;  3HNM A;  1OF4 A;  4CUB A;  1O8P A;  1RYY A;  2EIC A;  4XUP A;  2RJ2 A;  2E33 A;  5G04 L;  1CZT A;  1GUI A;  4QB6 A;  3VD7 A;  2B9V A;  1CZV A;  3MUY 1;  3THC A;  2VCB A;  3CDZ B;  3NNG A;  2VZ1 A;  4OYU A;  3HPN A;  3AC0 A;  2VJX A;  4QDR A;  3OB8 A;  1JZ5 A;  1ULO A;  1W0N A;  3A7Q A;  3FN9 A;  4JX0 A;  3DYP A;  1UYX A;  3I97 A;  1CIY A;  5G05 L;  4TTG A;  4XZU G;  1EUT A;  4LQR A;  3K46 A;  4AAX A;  1MPX A;  3CQO A;  2VZ3 A;  4OZO A;  3C8X A;  1XPW A;  2QBX A;  1WKY A;  5JUV A;  1P8J A;  5IFP A;  2J7M A;  3ACG A;  5JXJ A;  2WUH A;  2WQ8 A;  3C7F A;  2VZU A;  2WO3 A;  3SKJ E;  2QQJ A;  4ET7 A;  1OD3 A;  1DLC A;  1PX3 A;  4QX0 A;  2VO5 A;  2OKX A;  2W87 A;  4D8M A;  2X05 A;  3HNB M;  3CZJ A;  2EID A;  4CU7 A;  1DP0 A;  5DPN A;  4ZY9 A;  1HN1 A;  1PMH X;  1UWW A;  2W92 A;  1GOF A;  3T0B A;  5LA2 A;  1J83 A;  4P02 B;  1TVG A;  2X10 A;  3D3A A;  1JI6 A;  3K4A A;  2WO2 A;  4TXW A;  5C7G A;  2VR4 A;  2XOM A;  2JD9 A;  3HN3 A;  3DYO A;  3FHA A;  4DXS A;  3MV1 1;  3SEP A;  2WAA A;  1OF3 A;  4P5Y A;  1UMH A;  4MAD A;  4XUQ A;  3WF0 A;  4GWI A;  2VME A;  3T0D A;  1GMM A;  5JXI A;  4LPL A;  2CDO A;  2Y6J A;  1PMJ X;  2W5F A;  4QX3 A;  3WNP A;  3T0A A;  3MBW A;  3U37 A;  4XUO A;  3HEI A;  1DYO A;  4Z2A A;  1JZ7 A;  1UMI A;  2EIB A;  2VOT A;  3DEC A;  3I2H A;  2C4X A;  3LPF A;  3P6B A;  2VZR A;  2WAO A;  5CZK A;  4AG4 A;  3WF2 A;  4KMQ A;  3A21 A;  2ZEW A;  1PX4 A;  2W95 A;  2VMD A;  1K3I A;  3C7E A;  2J22 A;  4BK5 A;  5IJR A;  1OT5 A;  3C7O A;  2BBA A;  4XUT A;  2PQS A;  4OMC A;  1EUU A;  3MO4 A;  3PUI A;  1JYV A;  2VMC A;  5C71 A;  3CKH A;  5EJ1 B;  3VD9 A;  2VZT A;  1JZ2 A;  4KWU A;  4MGQ A;  2LW8 A;  3EYP A;  4A45 A;  2J1A A;  5JXH A;  2VQU A;  4DXR A;  3BN6 A;  4CVU A;  4QB2 A;  1JZ4 A;  4BK4 A;  3OBA A;  2ZEX A;  1H6Y A;  2L9L A;  4E8C A;  2LS6 A;  2ORZ A;  3I2I A;  1WCQ A;  3OGR A;  1JZ6 A;  1JYW A;  5J1X A;  2DCK A;  3I3D A;  2WZE A;  3ECQ A;  3MV0 1;  5DN2 A; 
#chains in the Genus database with same CATH topology
 2H0B A;  4TYS A;  4IV3 A;  4OI4 A;  3K4D A;  3S0M A;  1JZ3 A;  1HX6 A;  5FP8 A;  1NCR A;  3ZYF A;  1EPZ A;  4FFI A;  2FDG A;  4XFF A;  4FPY A;  4AWD A;  1XOY A;  5FZG A;  2ZEY A;  3ZSM A;  3MW4 A;  4XF3 A;  3J9S A;  4NPR A;  4IES A;  1XXN A;  4FPO B;  1N3Q A;  4E8D A;  1W6P A;  4WM8 A;  1SZB A;  3LEK A;  3ZR6 A;  2ZBJ A;  4IQP A;  3ZYB A;  1SHW B;  1ENR A;  2WSU A;  1COV 2;  4XQ4 A;  5LA9 A;  4CUC A;  1H8T A;  2OYZ A;  2FHR A;  1RUE 3;  1QHD A;  2KM2 A;  2XUM A;  1ULG A;  4YPJ A;  1NXM A;  1AYM 3;  1WBL A;  5IFT A;  2EAA A;  4Y3O A;  3R4D B;  2BOJ A;  1OLR A;  3KVB A;  4HXC A;  2QQU A;  2VZP A;  5HV4 A;  3H0O A;  5F7U A;  1GP5 A;  2YHJ A;  4KG8 A;  4GAL A;  2HWB 1;  5FZ6 A;  5L9B A;  5CFC B;  3FBM A;  3HR9 A;  1GSL A;  4ZHN A;  1APN A;  3MHZ A;  5EWS A;  4FAG A;  1RUH 1;  3N7L A;  4JKM A;  4R4Z A;  3ZX7 A;  2WYS A;  5GLU A;  2XVK A;  5JR7 B;  4YZ3 A;  5CAD A;  1RUC 1;  5FMO S;  2MHF A;  5JSP A;  1AZD A;  1HJG A;  4LUL A;  2E26 A;  5FJH A;  3P5B A;  4QHZ A;  3FHI B;  1UO9 A;  2UU8 A;  4U2A A;  4UW4 A;  3PDQ A;  2V5Y A;  3VBH A;  2D6N A;  1C8M 2;  4LHS A;  4XAE A;  4IE5 A;  1PO1 2;  1QU0 A;  2ZGO A;  1UXZ A;  4XE9 A;  3HNY M;  1W6N A;  4AR2 A;  5CAZ A;  1COV 3;  4L2N A;  1Q8Q A;  4MOA A;  4GQ7 A;  1V6J A;  3S5Q A;  1CWP A;  5EPA A;  5FZB A;  5E16 A;  1UZ0 A;  1YQC A;  3WDV A;  5FBJ A;  3TYJ A;  1S1A A;  5KR7 A;  4NAO A;  2B39 A;  4HZF A;  1EAH 1;  1IG0 A;  2HWC 1;  5KHI A;  2JE9 A;  2X09 A;  4R9A A;  3WOG A;  5FDB A;  2DVB A;  1KDK A;  4W50 A;  2IXC A;  3O1U A;  5CIS A;  2I2S A;  2VBB A;  3VBR C;  3E97 A;  2ZGU A;  4HT1 T;  1IPJ A;  4AI0 A;  3V0B A;  4AEK A;  4K3U A;  4IEX A;  3PU8 A;  4RR3 B;  3OSD A;  1NT0 A;  4D7S A;  2P17 A;  3I8T A;  3HQU A;  4JHZ A;  4MVT A;  1OQD A;  1E5I A;  3AZX A;  1LUL A;  3WDW A;  4DFS A;  3NAP A;  4MO3 M;  2OUH A;  2AR6 A;  2ZX2 A;  5JZG A;  4JQR A;  2K2S A;  1C8M 3;  1D0H A;  3LAG A;  2RVA A;  2NN8 A;  3USU B;  2H6B A;  1JU4 A;  1AYN 1;  3ZSL A;  4LHK A;  4IEU A;  4EZ4 A;  4LT5 A;  5A3T A;  1R1A 2;  1CAU A;  4QPG B;  3LQC A;  5JOZ A;  5FZ3 A;  2JE8 A;  2FDH A;  4TSV A;  2NYY A;  3K48 A;  2YDE A;  3K77 A;  1BBT 2;  3NV2 A;  5GZG A;  1C8N A;  3HJR A;  2XG3 A;  1QJY 1;  4AVT A;  4PF1 A;  1MR5 A;  1VAM A;  4SBV A;  1VRH 1;  2VZS A;  3IIA A;  3ZFG A;  4E2S A;  5A3N A;  3GAL A;  3TNQ A;  1HRV 1;  2CWS A;  3WDY A;  4NPL A;  4Q26 A;  5BV6 A;  1V6K A;  3RJ2 X;  3IPV A;  2CHH A;  1G9C A;  3QD6 A;  1HJF A;  3TEW A;  1ZVF A;  3OPW A;  5CVR A;  4ATE A;  1V6M A;  3M3C A;  3FFQ A;  1TG7 A;  1W6P B;  1L7R A;  1ZBE 2;  4FI9 A;  1X33 A;  3HOB A;  2ADE A;  3WUD A;  4KI5 M;  2C9K A;  2YBP A;  2BQP A;  3WP4 A;  3AYD A;  1ZZ7 A;  3PL0 A;  2CAU A;  3ZXL A;  4BMB A;  5AFE A;  5BNN C;  3WF3 A;  5CFD C;  3NJX A;  4MXV A;  3I2D A;  3IDC B;  5I93 A;  2IWG B;  5EJZ B;  5FLH A;  1FAT A;  3Q8A A;  1R1A 3;  2VCA A;  2VUC A;  1S2E A;  3I2J A;  4GJZ A;  4QX5 A;  1RC6 A;  4C1X A;  1HDK A;  1PVX A;  1AHS A;  4O65 A;  1NE4 A;  5I0D A;  1G86 A;  4YZ4 A;  3POY A;  1Q56 A;  5DUW A;  2Y60 A;  5HXV A;  4QQO A;  2DFC A;  1DQ5 A;  2NP0 A;  1DYP A;  2GH2 A;  4FSJ A;  4Q4Y 2;  3MEP A;  4YVW C;  4AEJ A;  3BTA A;  1WMD A;  3GXU A;  4AI2 A;  3J8F 2;  4JTN A;  3CF6 E;  5DAW A;  5JXG A;  5FPV A;  3I3M A;  1S0C A;  2ORX A;  1R1Z A;  3MID A;  5H9R A;  2QCS B;  4QD2 A;  1UKG A;  3WP6 A;  1WW4 A;  2ZKN A;  4CU9 A;  2V4A A;  5IVE A;  1WA6 X;  2YB7 A;  4A4A A;  1ZBE 3;  2VG9 A;  4NRQ A;  1LES A;  2WT0 A;  5LY2 A;  3AVR A;  1QMJ A;  2ARB A;  4DB5 A;  3PIG A;  2P3K A;  5H9P A;  5B4N A;  5DZF A;  1IS5 A;  1E57 A;  1LEN A;  4NII A;  1XRU A;  2W1W A;  4AL9 A;  4CCD A;  4XUN A;  2WQ4 A;  2WN2 A;  3CIH A;  3P3P A;  1C57 A;  5C8C A;  1X8M A;  1PO2 2;  3WDX A;  4CU8 A;  3DPR B;  3RS6 A;  3I2O A;  5C4W C;  4UBG A;  1VBB 1;  4MG2 A;  3WF1 A;  1RIN A;  3NJZ A;  3H1Y A;  2HYK A;  2UWC A;  4P9J A;  2HWE 3;  3SH3 A;  3M7A A;  1QJF A;  4ORF A;  5FYM A;  4DEV A;  3J8F 3;  1RUD 1;  5FY7 A;  1JYT A;  1UY4 A;  3H7J A;  4X6Q B;  2DDU A;  2O8Q A;  4Q1R A;  3III A;  4IDZ A;  4G3Y C;  4UFI A;  5HI0 A;  2O8O A;  2R04 2;  3AFG A;  4BIS A;  2NQY A;  1NA1 A;  2OQ7 A;  2R06 1;  1VPH A;  3F2Z A;  3TN9 2;  3VHO A;  1JYI A;  4OI0 A;  4Q4X 2;  5L7O C;  2B8M A;  1OH4 A;  3T08 A;  4WM7 A;  1GV9 A;  4M4R A;  3KF5 A;  3LDK A;  2JIG A;  2YG0 A;  5FUI A;  3URF A;  3WEZ A;  4CXY A;  3VDA A;  4GB3 2;  1SQ4 A;  4YGD A;  4AHY A;  1NAE A;  2VMF A;  1PO2 3;  3AP5 A;  1F4H A;  1PVC 1;  1JXN A;  3M8L A;  3ZFG B;  3VZL A;  1GP4 A;  1XU1 A;  4ES9 A;  1XNB A;  4YZ5 A;  2RHP A;  2YU2 A;  2TBV A;  3D6E A;  1VIW B;  4IEV A;  1QOS A;  4IE6 A;  3I2K A;  1PNG A;  1GLH A;  3UGH A;  3IPV B;  2WZR 2;  3MF9 A;  4S2F A;  1AR7 2;  1YQ2 A;  1Y4W A;  2AGS A;  2YFZ A;  1VP6 A;  3B02 A;  1VBE 1;  4CCK A;  1YYN A;  1Y9Q A;  2RJK A;  1CZS A;  1UXX X;  5FYU A;  3AZY A;  1VBC 1;  5CYY A;  3RVH A;  4Q4W 1;  2VAU A;  3O1P A;  1LU1 A;  3VD4 A;  1GWK A;  2HWD 1;  3ZYR A;  2R04 3;  1T6G C;  3H50 A;  3U78 A;  1WME A;  5HXM A;  1ZZ6 A;  3PIJ A;  3TN9 3;  4RN5 A;  3CMG A;  3U07 A;  2PAE A;  4YM3 A;  5C5U A;  1NKG A;  4Q4X 3;  2HBU A;  1TME 1;  4Y5Z 0;  5LEK A;  3ZFF C;  1B35 C;  4DUW A;  2VMG A;  2XON A;  2K46 A;  4KG0 A;  4XUR A;  2JB4 A;  1PIV 2;  2K9Z A;  4EE2 A;  4LBQ D;  4GB3 3;  2P4E A;  5BNO A;  1C5H A;  1YFX A;  2W46 A;  2Y6L A;  5KXC A;  3VBO A;  5A32 B;  2QE3 A;  4GWN A;  5F8P A;  5FWJ A;  2P3J A;  2X5I A;  1J84 A;  2XHN A;  1GQP A;  1MZF A;  3AKQ A;  1OXC A;  3JBG 1;  4IER A;  4QX8 A;  4EWD A;  1ODN A;  1HIX A;  3SCH A;  3OTF A;  1GOH A;  4GKX A;  4XET A;  3UT0 A;  1HXS 2;  1GNH A;  1VBD 2;  3FBY A;  2ZPX A;  4CEW A;  2ADD A;  3MV0 1;  3RWK X;  2ZS6 B;  1EV1 1;  1POV 0;  2XJP A;  4XTM A;  1WBF A;  1BK1 A;  2RS3 1;  5GAL A;  3CO2 A;  3VD7 A;  4FPF A;  1CZV A;  2ZA9 A;  5GLT A;  3MUY 1;  2A7A A;  2ZGR A;  1F9K A;  2C0Z A;  3NNG A;  4HN1 A;  2IXK A;  4HPK A;  3WX5 A;  2PYT A;  3LFM A;  3U4S A;  3POE A;  2RS5 3;  1YWK A;  1JZ5 A;  1MQT B;  1CD3 G;  5LW9 A;  4AI9 A;  3FN9 A;  3H3L A;  1OUS A;  4AGG A;  1LRH A;  4AFD A;  4DQA A;  5J09 A;  3SH5 A;  3KHC A;  1CIY A;  1D4M 2;  5C3O A;  1S0I A;  1UNB A;  3OBT A;  2OPK A;  2XWB B;  4FPG A;  1CJP A;  3AL5 A;  5FLJ A;  3VDD A;  3RZL A;  3KHB A;  3OBR A;  2HEW F;  3CQO A;  4OI1 A;  1LGN A;  4KWK A;  5GLW A;  1HXS 3;  1VBD 3;  4PI0 A;  5FRE A;  1B09 A;  2ZGK A;  1X7N A;  5DDJ 1;  2XLG A;  4LLF A;  3LB9 A;  1AVB A;  2VMH A;  4MXW A;  5BY5 A;  4XAB A;  5IFP A;  3PTY A;  2A6Y A;  1NY7 2;  2ET1 A;  2JX9 A;  5GM0 A;  4GUL A;  2WUH A;  1AXY A;  2R6Q A;  5HCB A;  1RTV A;  4WV8 A;  2VZU A;  2WO3 A;  3AKR A;  2WNO A;  2QQJ A;  3WCR A;  4FTS A;  1GAN A;  1LOE A;  3ES1 A;  4ET7 A;  1W39 A;  2WYF A;  2Y0O A;  3RMY A;  1PX3 A;  4D8M A;  2X05 A;  1JUH A;  5FY9 A;  3HNB M;  3CZJ A;  4IL7 A;  3MI8 A;  3ZFE A;  1RVF 1;  2F6B A;  5I8Y A;  5IAX A;  3T1M A;  1LOD A;  2WII B;  5DPN A;  1NLR A;  2XBO 1;  4TLG A;  1S0G A;  3CEW A;  3ZO0 B;  1UWW A;  1WW6 A;  1D4M 3;  3ENR A;  5F5C A;  5FY5 A;  3AXD A;  3WDT A;  1Q8O A;  4PDW B;  4XBL A;  3IMN A;  4YG6 A;  5IW0 A;  1RUJ 2;  3MYX A;  1E5H A;  3Q9O A;  4XF9 A;  3VHR A;  4UF0 B;  3ZMO A;  4B4P A;  4YFZ A;  2YBK A;  4K9S A;  1JHN A;  2JEC A;  3AYA A;  4AVC A;  3WQ1 A;  4CRQ A;  5C7G A;  3FMG A;  1R08 2;  1QQP 2;  4BWO A;  4NIG A;  5DZE A;  4IGO A;  2XOM A;  4QKD A;  2WLP A;  4CPB D;  2ZGQ A;  3DYO A;  4V2V A;  1IQA A;  4FO9 A;  5FXV A;  3ZOI A;  2WAA A;  1S0E A;  3CBN A;  1W0P A;  2RJL A;  3VBF B;  3IKW A;  2JJ6 A;  1N1S A;  4XUQ A;  3WF0 A;  3DXU A;  1SLA A;  1ASJ 3;  3R4S A;  4E4S A;  4CP1 A;  3T0D A;  3ZLI A;  1GMM A;  2RM2 3;  1QXJ A;  1J1L A;  1I9R A;  2A6X A;  2CDO A;  3MFA A;  4PLN A;  4AVA A;  3BOD A;  3S5A A;  2CSG A;  3PLQ A;  2A6Z A;  1Y9G A;  5L9R A;  3ZXD A;  2W5F A;  4D7Y A;  3T0A A;  2X5I B;  1DQ1 A;  2R0H A;  1OBN A;  4L11 A;  2MEV 2;  3N9Q A;  4CCL A;  3WG4 A;  5F37 A;  5A7W A;  1DYO A;  4CDQ B;  3VBU B;  2EAL A;  5T5L A;  1GQG A;  2EIB A;  3E6B A;  4YW5 A;  1LB2 A;  2C4X A;  1FYU A;  1G7Y A;  2YBS A;  3LPF A;  1RUJ 3;  4MZU A;  3VUO A;  4N90 A;  1QJU 1;  2XXZ A;  3B9C A;  3N9P A;  5CZK A;  4JRA A;  1OFN A;  1J3Q A;  1W2N A;  3EO6 A;  4KMQ A;  4LBK A;  1SLC A;  1R09 2;  3HVD A;  2FZ2 A;  1VMJ A;  2ZEW A;  3OUH A;  4XIO A;  5FZF A;  4L92 A;  1RUF 1;  4HSL A;  4N9I A;  1UZW A;  1F31 A;  2E51 A;  2JDM A;  4DNY A;  4CDX A;  1AUY A;  1CAW B;  2W95 A;  4COZ A;  4HPK B;  2EAK A;  5JIU A;  1K3I A;  2BU9 A;  2EVX A;  3U75 A;  5J7M A;  4MGI E;  2J22 A;  4BIO A;  4BK5 A;  3IBM A;  2QNK A;  2C24 A;  4UFK A;  4LHN A;  2BBA A;  3QLQ A;  3SIS A;  1ZYB A;  4CEY A;  2PQS A;  3AFK A;  5FRA A;  2KXL A;  4HSJ A;  4ES8 A;  4RQP A;  4NRO A;  4H14 A;  4JGY B;  2QQP A;  3LSD A;  5C71 A;  5EJ1 B;  1SLT A;  3CJI C;  4QXB A;  3KVA A;  4K6B A;  3Q8C A;  2PHL A;  4AED B;  1HQN A;  2PAM A;  1ND2 A;  3M1H A;  2OA2 A;  2R1B A;  3EYP A;  4HKL A;  3JUU A;  1OUR A;  2VQU A;  1YI9 A;  1KFX L;  2VOK A;  3BN6 A;  3Q8B A;  5FZK A;  5LBF A;  2D98 A;  5KHJ A;  4FTE A;  4RS5 B;  3KLS A;  5C3S A;  1WLD A;  1MS1 A;  3ZVX A;  4ATF A;  4W6Y A;  4L97 A;  3R0R A;  4E8C A;  1R09 3;  1VAL A;  2JD4 A;  2LS6 A;  2XJR A;  3T4H B;  1LEC A;  1WCQ A;  3MLL A;  3OGR A;  5A3M A;  1XJA A;  3TBD A;  1RIR A;  3SLI A;  4O9E A;  1G9A A;  1GQH A;  2E6V A;  1A3K A;  1H1A A;  4PCR A;  2Q5T A;  1PGW 1;  4WBB A;  1PK6 A;  2DCK A;  2WFF 1;  3LD8 A;  3ZR5 A;  5FPA A;  5ABJ C;  2D44 A;  4Q1P A;  4XF1 A;  1RUI 2;  2QDN A;  4G9S B;  5FYC A;  3VZM A;  4AXO A;  1K5M C;  1HB3 A;  4K7J A;  4IV1 C;  3WNM A;  1KDM A;  1KIT A;  3LIG A;  3UJO A;  3GZT B;  3ZFE B;  5C9A B;  2Q8E A;  3APB A;  2E63 A;  3KCX A;  1F8V A;  2YC2 A;  3OBZ A;  4JQT A;  1ULE A;  2ZGN A;  3QCW A;  3WXP A;  1EP0 A;  3OY8 A;  2B4K A;  4A44 A;  2Y6G A;  4HLT A;  1OOP C;  1HV1 A;  2EXK A;  1QJX 3;  4M01 A;  4X6R B;  1K42 A;  2O1Q A;  4YLZ A;  5K0U C;  4NN0 A;  1AX2 A;  4L0P A;  3ORJ A;  2BPA 2;  4Q0Q A;  2RDS A;  1OKQ A;  4UYB A;  5EZW A;  4A6O A;  1H4G A;  5AC9 1;  1ZBA 1;  1WCK A;  3A22 A;  3SMH A;  4EN6 B;  1AR8 1;  4H3W A;  3PHM A;  4XF0 A;  4RFT 0;  3ZXF A;  1US3 A;  3GGL A;  4DY5 A;  4JZR A;  5BNP A;  5FK8 A;  4B7E A;  3ACH A;  3EB7 A;  4P14 A;  1ACC A;  3WD5 A;  3T2P A;  4HET A;  2E9Q A;  3FHQ A;  4YW6 A;  2VW2 A;  5IHR A;  2PLV 1;  3ACF A;  3BB6 A;  2HWF 3;  4PI2 A;  1AL2 1;  2Y26 A;  4FP3 A;  2WNU A;  5BPX A;  1RUI 3;  2R07 2;  3MIF A;  2W1S A;  3AMN A;  1Z7S 3;  4M3C B;  1RIT A;  3SCG A;  1H2K A;  1UQX A;  2YC0 A;  4IW3 A;  4BE3 A;  1IS6 A;  1JH5 A;  4UBH A;  1V9U 1;  3UKT A;  5LA1 A;  5A7W B;  2JG9 C;  1IQD C;  2XJS A;  2YU1 A;  4PBO A;  3VZK A;  3LDR A;  3GZA A;  1W9T A;  2FD8 A;  4LBM A;  3I2G A;  4HAN A;  3O7O A;  3ZMN A;  4P00 B;  2ID4 A;  2ZEZ A;  2E53 A;  4LBO A;  5FIX A;  2TNF A;  3AMH A;  1UYY A;  2LTN A;  1ZZ9 A;  2Y64 A;  5HCF A;  3KT4 A;  1U0A A;  4NO4 A;  2QQO A;  1KD7 A;  4HMZ A;  3WG1 A;  1D2Q A;  2ZXQ A;  1GYK A;  1V0A A;  4LKF A;  4B29 A;  3LGR A;  2J1V A;  1UD1 A;  1V6N A;  1I5P A;  1MZ6 A;  2GC3 A;  3LE0 A;  5FZD A;  2FMY A;  4XJW A;  1AR9 1;  4B1M A;  4NHL A;  1FAY A;  1N1Y A;  1HW5 A;  3J7H A;  5SV8 A;  1BLZ A;  3DGT A;  3MIB A;  1YUD A;  1JUI A;  4AI3 A;  1PMI A;  2CGO A;  5A1L A;  1BHG A;  2JB8 A;  2YXS A;  1S0F A;  3O1O A;  5JAX A;  1ND3 B;  1X8E A;  1XB9 A;  1IGO A;  2GAL A;  3OGV A;  4GH4 B;  3VBS B;  4ZZ8 A;  5FQ0 A;  4TZD A;  2QVS B;  4E9K A;  3B00 A;  4CUA A;  1QNW A;  3N9L A;  1O6U A;  2GNT A;  1W2U A;  5FTT C;  3O1R A;  3V0A B;  2XGX A;  3ABZ A;  3HWJ A;  4LBN A;  3NW4 A;  4BIF A;  3POJ A;  4ZKT B;  4OLL A;  4JGZ C;  1UZZ A;  1DGL A;  2XJV A;  1W8U A;  4H7M A;  4BCU A;  1JYX A;  1ZM1 A;  3UJQ A;  1NE6 A;  2C9A A;  1QEX A;  4I0W B;  4S2G A;  1FOD 2;  1QGL A;  3S57 A;  1AR6 1;  4AOC A;  4D94 A;  3SQO A;  3AJZ A;  1YHF A;  1GZC A;  3AYE A;  2BGC A;  4N53 C;  2MNG A;  2NZ9 A;  1YJL A;  2CGN A;  4P5H A;  1PZ9 A;  1LED A;  1CAV A;  1W8T A;  2RS1 1;  3JQX A;  3Q8E A;  2D6L X;  1MS8 A;  2TEP A;  4QQP A;  1PK6 B;  2ZZJ A;  4IE7 A;  1FMD 3;  4A41 A;  2RR1 3;  2A75 A;  2OVU A;  5AVP A;  3RJR A;  4XYX A;  2JWP A;  3FE5 A;  4BQ2 A;  2ARX A;  4Y1U A;  1MEC 1;  2VBD A;  4YYO A;  5F3E A;  4IEZ A;  2GMP A;  4HL0 A;  5HPO A;  5FZC A;  1BEV 1;  1OHF A;  4W65 A;  3TOJ A;  3KD4 A;  5CG8 A;  4QQL A;  5I8S A;  4A7Y A;  3VHN A;  5EIY B;  1REE A;  2WWS A;  1XND A;  2W9X A;  3NMB A;  3OY8 B;  1H2L A;  5A1F A;  4GMP 1;  4LIU A;  1S2K A;  1AF9 A;  1OPM A;  4QHO A;  2YRO A;  5AVA A;  2BER A;  2ZMN A;  5D1I A;  5FPL A;  5ANN A;  4ARX A;  1HB1 A;  1PGS A;  3VD5 A;  4NPM A;  4I01 A;  2Z4F A;  1H2N A;  1ZRF A;  4AVV A;  4MSV A;  1DG6 A;  4PT6 A;  5FZA A;  3RFR A;  1A6C A;  1QXP A;  3WF4 A;  4U36 A;  2RDN A;  1RUH 2;  3K51 A;  4Q0V A;  2WAB A;  5F6K A;  3W20 A;  4HG6 B;  4DRR A;  1SLL A;  1XNC A;  2D93 A;  3LPG A;  3FZ3 A;  4DMI A;  3M70 A;  3DKW A;  3N7J A;  2ARA A;  4B1L A;  1BKZ A;  4MUV A;  2Q1M A;  5BNP B;  4C1W A;  1DIW A;  2WA3 A;  2VQT A;  4GIQ A;  2LUW A;  3JD7 1;  3MZH A;  3PME A;  3BGA A;  3H8O A;  2WNU B;  2ZAH A;  4Q0U A;  3HQR A;  4LXL A;  1O59 A;  2D6K A;  3TWI A;  3LDB A;  5FYH A;  5DUV A;  4D6Q A;  3W58 A;  4FPC A;  1V6L A;  3K75 B;  3GZU C;  4L9B A;  2J1R A;  4QPI C;  4R52 A;  2KA3 A;  4RR3 C;  4RYD A;  3BI3 A;  2WC2 A;  5FP7 A;  1W8F A;  2PMW B;  3A23 A;  3A0N A;  5F2W A;  3WQB A;  4OHW A;  4FOW A;  2CYF A;  2ZHL A;  5FY4 A;  4MGS A;  5A7P A;  2ZAC A;  4MGK E;  2BNN A;  2BFU L;  2PHR A;  3AB0 A;  1JN2 P;  1QY4 A;  1W9F A;  1C1L A;  1RUH 3;  5DAX A;  5FR3 A;  4YW7 A;  2G19 A;  5EQU A;  5C6C A;  1Z0H A;  4CP9 A;  4JDO A;  3ETP A;  4QX2 A;  4QXK A;  1X82 A;  5IAV A;  3POS A;  2OS2 A;  2GC1 A;  3NKG A;  2UYB A;  4AQT A;  3VBR A;  3AXE A;  5IVJ A;  2W52 A;  3C3V A;  5FMC A;  1W6M A;  1RUE 1;  1W0O A;  4JHT A;  3C7G A;  5DG2 A;  1AYM 1;  2UUR A;  4MGT A;  1DQ6 A;  1UY2 A;  3VKF C;  2ZZQ A;  5A3U A;  3CZU A;  1W06 A;  2VOV A;  5IVV A;  4KWL A;  2IZW A;  4KGG A;  3RZM A;  1RHI 1;  4AW7 A;  3U0Z A;  1C4R A;  1U5Z A;  3ILR A;  4FPL A;  2HWC 3;  5A80 A;  4DUV A;  1CX1 A;  5F3I A;  1H6X A;  2A3X A;  4YM0 A;  5FOB B;  4FTB A;  4Z8B A;  3WV6 A;  4URT A;  1TE1 B;  3VLB B;  4XVH A;  1W8H A;  1HRV 2;  1Q3E A;  3GBG A;  1NUK A;  4CUG A;  5JR2 A;  4CTE A;  2A3W A;  1XYO A;  4FFH A;  4P9X A;  4QX1 A;  3BU7 A;  5J3U A;  5A7O A;  3QBQ A;  2RDQ A;  3VDC A;  3ASI A;  1YCI A;  4LNV A;  5L36 A;  1ULC A;  1YRZ A;  1QJZ A;  2K0G A;  1QDO A;  3NNJ A;  2I74 A;  3ACI A;  3LCP A;  1UCX A;  4Y22 A;  2WA4 A;  4XDO A;  2WS9 2;  1COV 1;  1OD5 A;  2JIJ A;  1UIJ A;  1WLC A;  2DTW A;  2VTF A;  4OUS A;  3ZM8 A;  3E6C C;  2Q30 A;  3FLT A;  4GZ9 A;  4DY3 A;  1O3S A;  1AYN 3;  1BZW A;  1ZRE A;  5FP3 A;  4Y1Z A;  1YI7 A;  3RZG A;  5IUQ A;  1XSQ A;  2G1M A;  1UY1 A;  3OJB A;  1STM A;  4RSU A;  3VGI A;  3W59 A;  1RUN A;  4EWE A;  1D7P M;  2XML A;  5CIR A;  1MVQ A;  5CFD A;  1VE0 A;  3DV8 A;  1W2O A;  3GBW A;  4YVS B;  1QJY 3;  4AAP A;  5BNN A;  2AYH A;  2W0X A;  5FO9 B;  3B3Q E;  3WNO A;  4AK3 A;  2GNB A;  4X8N A;  1UU6 A;  1LHO A;  1VMF A;  1HRV 3;  3EXU A;  5FUP A;  1E5R A;  2Y34 A;  4FCA A;  2XJU A;  5FJK A;  5F32 A;  1UU5 A;  4IV3 B;  4QB1 A;  4J1W A;  3ZPY A;  1QIQ A;  4LBL A;  4MH0 E;  1NCR B;  5B2G B;  1H1M A;  5IT6 A;  4O61 A;  5I0T A;  4W6X A;  1UL9 A;  1RUO A;  3LA3 A;  5T5J A;  1F4A A;  1C8M 1;  4GWJ A;  5A7N A;  4DRV A;  3DPR C;  5HBA A;  1SAC A;  1PO1 1;  4YVW A;  2QZ2 A;  4F7Z A;  4YZ1 A;  2QQK A;  2WS9 3;  4F83 A;  4PIY A;  4WM8 B;  4BLJ A;  3AP7 A;  5F2S A;  2AAC A;  1G6N A;  2P3I A;  1OF4 A;  2FDJ A;  1O5L A;  3M4F A;  3KB5 A;  2EIC A;  3E5U A;  1H8T B;  1KQR A;  2RJ2 A;  2GSY A;  4OHY A;  3NNF A;  1NQJ A;  2VVD A;  3AMP A;  4OHZ A;  1RGS A;  1D4V B;  1TMF 1;  3KMH A;  4GD4 A;  4I09 A;  5FMD A;  1PM4 A;  4OHX A;  2PFW A;  4QB6 A;  2ZGM A;  4LE4 A;  5LEJ A;  1CVN A;  2VGD A;  1VBB 2;  5ACA 1;  5T5O A;  1HN0 A;  4XCB A;  3UGG A;  2D5H A;  4M0H A;  4LK6 A;  4TLF A;  2P6H A;  4ZXK A;  3O1T A;  1W03 A;  2V09 A;  4OYU A;  3BTX A;  3AC0 A;  1VB4 A;  1ZA7 A;  3KQ4 B;  4QDR A;  4YRD A;  3LZZ A;  3WW3 A;  4CP9 B;  1W0N A;  1RUD 2;  2HWE 2;  5C4W A;  1GR3 A;  2Q4S A;  4Y1V A;  1YLL A;  2Z42 A;  1QOO A;  3MFC A;  1O4T A;  4CCC A;  3BIW E;  4FFF A;  3DYP A;  5K7P A;  2B45 X;  1UYX A;  4UW6 A;  4R9C A;  3WR0 A;  1IKQ A;  4LQR A;  2SBA A;  4LOT A;  1S0J A;  5I91 A;  4XFB A;  3VBH B;  1MPX A;  1ZZB A;  1UPI A;  2XHK A;  5IVY A;  2UWB A;  5IK4 A;  2QBX A;  1JOB A;  1W6N B;  1WKY A;  1WMF A;  1BBT 1;  1C3H A;  2PHW A;  5FKB A;  3AYC A;  3QH6 A;  4PF5 A;  1HRI 1;  1PVC 2;  2LRP A;  5L7O A;  2VXJ A;  3N7M A;  1VBB 3;  2VQA A;  3ES4 A;  1W04 A;  2ZMK A;  4QGM A;  2JDH A;  3ALQ A;  4AQS A;  5J98 B;  3CLP A;  3AZZ A;  1AX0 A;  1RL3 A;  4N43 C;  5D8A C;  3KQR A;  1YQ8 A;  4NE9 A;  3I3Q A;  4M00 A;  2OKX A;  3WHU A;  2W87 A;  2XKO A;  1VBC 2;  2ZX1 A;  3LSE A;  1RUD 3;  3V0B B;  1GBG A;  2XR4 A;  1ZBE 1;  1CIW A;  4A7Z A;  4CU7 A;  4IEY A;  2ZHK A;  5FYI A;  1BMV 2;  2HWD 2;  1DP0 A;  2FCV A;  2V73 A;  1U5Y A;  3DEM A;  3H1M A;  4KBZ A;  1HN1 A;  3WNX A;  1KRI A;  2ZHM A;  1DGR A;  2R06 3;  5KBF A;  4MYE A;  3T0B A;  1JS9 A;  3NAP B;  5LA2 A;  4YGB A;  1J83 A;  5JZG B;  1TME 2;  1TVG A;  4XCA A;  5EYY A;  3THT A;  2C1F A;  2X10 A;  1J3P A;  4K40 A;  4QXH A;  4YFW A;  1ZZ8 A;  4K21 A;  2VVE A;  3EBR A;  1NCQ C;  1NZC A;  5ANQ A;  1YJK A;  2B5H A;  4FXG B;  5FZ8 A;  3R6S A;  5FBZ A;  5F5I A;  1CAU B;  4FT8 A;  1I6X A;  4DOU A;  4Q4Y 1;  1UF2 C;  2CV6 A;  1PVC 3;  2XUE A;  1SDW A;  3WG3 A;  3SEP A;  4NOT A;  3R4U A;  3ZFF A;  4HVQ A;  1B35 A;  3GCW A;  4P5Y A;  4LTA A;  4O7X A;  5T50 A;  1UMZ A;  3JBG 2;  4V2W A;  5FO7 B;  4FPJ A;  2ZGS A;  2FDF A;  1POV 3;  5JI9 A;  1VBC 3;  2OT7 A;  1EV1 2;  1MQT C;  1A8D A;  1Q43 A;  4YVW B;  4CZS A;  2HWD 3;  4BHP A;  4AVB A;  2VU9 A;  2RS3 2;  4XUO A;  5C8W A;  1LAJ A;  1PHM A;  3FLP A;  4FOQ A;  4F3J A;  1UMI A;  5FZM A;  2HEY F;  4NRM A;  1BYH A;  3THP A;  1AL0 G;  4MV2 A;  1TME 3;  3P6B A;  1F5F A;  1HLC A;  3POI A;  1IPK A;  4XHX A;  3KSC A;  2WFP A;  4XQD A;  3MIH A;  2RS5 2;  3NKT A;  5IVF A;  1D2S A;  2CNA A;  3PJY A;  4LJH A;  3ZYH A;  4AGR A;  5JMC A;  3P3N A;  5JOY A;  1G9F A;  1UOF A;  2RE9 A;  3NNM A;  4CCO A;  3TEX A;  1PX4 A;  1LTE A;  1N47 A;  2GN3 A;  4JCK A;  4C91 A;  1UKR A;  1A8M A;  4RHV 2;  5A6Z A;  5CA6 A;  3ZN4 A;  3C7E A;  3JBG 3;  4OI2 A;  4LOR A;  1RXF A;  1OVS A;  4NMI A;  5SV5 A;  1YNA A;  5C4W B;  1OT5 A;  4XUT A;  5FZ0 A;  3ZYP A;  1NOV A;  1EUU A;  4OMC A;  3PUI A;  5JSR A;  1WD4 A;  2VOW A;  1CON A;  3IMM A;  1KFU L;  3TN9 1;  1WW5 A;  2P34 A;  1EV1 3;  2VMC A;  1MZ5 A;  3CKH A;  5FZ9 A;  2RS3 3;  2X8K A;  3TRS B;  2WO7 A;  5FY1 A;  2VZT A;  4COU A;  1JZ2 A;  2ZX4 A;  3RPQ A;  2PHD A;  3I54 A;  4MGQ A;  2LW8 A;  4M3C F;  1W8Z A;  4PDW C;  2WR9 A;  3MGU A;  4GB3 1;  4NWW A;  4Y5S A;  2BOI A;  1BXH A;  4DXR A;  1JZ4 A;  1SPP A;  4DPN A;  3KV9 A;  5D2A A;  3ZXJ A;  1U5X A;  1TEI A;  4ZPI A;  5A7Q A;  1CX4 A;  4UXA A;  4R4X A;  1NXD 1;  5KWR A;  1H6Y A;  3B69 A;  4N8M A;  3LOB A;  2DFB A;  5C8C B;  1RVF 2;  5FYB A;  1VRB A;  5E89 A;  5FYV A;  1TQ5 A;  5F5Q A;  2WZR 1;  4UFJ A;  1AR7 1;  5JOX A;  2FDK A;  1Q5O A;  4EZH A;  1JOJ A;  1UYP A;  4RHV 3;  5J1X A;  2HEV F;  1Q8P A;  3GHM A;  5FY0 A;  2WZE A;  5LRR A;  3VBF C;  1OA3 A;  3J7N A;  3BKZ A;  4LKE A;  4YW3 A;  5DN2 A;  5LRS A;  2Q8C A;  2JG8 C;  5TSW A;  1RMU 1;  1CR7 A;  1FI2 A;  2RG4 A;  3FL7 A;  1E5S A;  4XXP A;  4IUG A;  4FQ4 A;  1LCL A;  2QQN A;  1VB2 A;  4JAA A;  2Q0A A;  4UOJ A;  5DDJ 3;  1GIC A;  2VNR A;  1LHN A;  3JXS A;  3PVB B;  2DCZ A;  1SCS A;  1L7Q A;  1EY2 A;  1NA1 B;  2NPI A;  5E6H A;  2WZ8 A;  4IXL A;  1JBC A;  4I30 A;  5EJ3 A;  5APA A;  5FZI A;  5LAS A;  3ROU A;  1VBA 1;  1PGL 1;  3HT2 A;  4CDQ C;  2VZQ A;  3IDA A;  4WM7 B;  3VBU C;  5LZ6 A;  2QQI A;  1PIV 1;  5DUX A;  4LO5 B;  2DCJ A;  1JMU B;  2YY1 A;  1ASJ 2;  2ZX0 A;  5LBE A;  4Q0S A;  5J36 A;  5LA0 A;  2RM2 2;  1O91 A;  3GZE A;  1RVF 3;  3EHK A;  4OMD A;  1GKB A;  3D4K A;  3OD0 A;  3SKV A;  3ZIW A;  5JPM B;  3ZFF B;  2HLE A;  1B35 B;  1U5I A;  4HBN A;  4UW5 A;  1VLN A;  3VKL A;  2XBO 3;  2VZV A;  4JRL A;  4QX7 A;  1SBD A;  2B46 X;  1HXS 1;  2ILM A;  1M4W A;  3Q8F A;  4BJ0 A;  5FZO A;  2XQX A;  2CU5 A;  2EIE A;  1GWM A;  3INA A;  3IZO A;  4JTO A;  3ZSE A;  2WO1 A;  4NVP A;  5DAV A;  2VNO A;  2HJI A;  3DXT A;  2XVL A;  1QOT A;  3ACL A;  4LHL A;  1WA4 A;  2Y0I A;  1RUG 1;  5DMY A;  1MVE A;  4W8J A;  1QKQ A;  2BNM A;  2BGP A;  3VBS C;  5F9T A;  2VL4 A;  3PUR A;  3KT1 A;  1ZZC A;  4JGY C;  4A3Z A;  5FLI A;  4DXT A;  1FT9 A;  2A6W A;  1QJE A;  2VUJ A;  1ULD A;  3NVC A;  4AED C;  4O9G A;  4YNI A;  2WJS A;  3KV6 A;  1FNZ A;  4AF9 A;  3ZYI B;  3WW4 A;  4PQQ A;  2JE7 A;  2UY8 A;  4QU2 A;  4RS5 C;  5KXB A;  2BNO A;  1US2 A;  5DAB A;  1DF0 A;  3LA2 A;  5BNO B;  4PJY A;  5EYX A;  1MS4 A;  3VBO B;  2BFU S;  2IC1 A;  3O0W A;  4LR4 A;  4XTP A;  1ZRC A;  1W9S A;  3M3I A;  1PZ8 A;  2DBI A;  4LKS A;  1LGB A;  3ZKY A;  1O3T A;  2WWJ A;  5FKC A;  5A3L A;  3SH4 A;  2JDU A;  5FZH A;  1LOB A;  1KXG A;  2W68 A;  3O12 A;  4CEW B;  1JU3 A;  5HCA A;  4Q4V 2;  2VZO A;  4Y33 A;  4AEM A;  4IEW A;  3VKN A;  5C9A C;  2NLR A;  3AKS A;  3CJI A;  3QH7 A;  4LOS A;  3B93 A;  3IT8 A;  1UYZ A;  2GAU A;  1H30 A;  4XFI A;  4PHZ A;  3WNK A;  4ASK A;  3GDB A;  2JKX A;  2X53 S;  2Y6H A;  1RUF 3;  1FV2 A;  1OPO A;  4TN7 A;  1LNS A;  4BDV B;  4MGZ E;  4C90 A;  4M3C E;  1PGW 2;  2VCM A;  1SLI A;  2ES3 A;  3POB A;  5FYT A;  3DN7 A;  3BPS A;  3KCC A;  4QGL A;  4NR1 A;  5LK7 B;  5JWP A;  4B4Q A;  1CAX A;  4B3N A;  3AVS A;  2YGL A;  2J1S A;  1SBF A;  3KS7 A;  5I8T A;  2V4V A;  4KU8 A;  5F6L B;  1CES A;  1H4H A;  1JHJ A;  3OYW A;  2V72 A;  4HN0 A;  1KJR A;  5JMO A;  4CP0 A;  5LB6 A;  4ZXE A;  5ABJ A;  5FXX A;  2W94 A;  1W6O A;  3VV1 A;  1K5M A;  3VDD B;  4IV1 A;  4BQY A;  1R08 1;  1QQP 1;  1QJX 2;  1YO8 A;  2GND A;  1UZV A;  2PHU A;  3A4U A;  4CA9 A;  4EWA A;  1I5Z A;  3KZ4 C;  3SXW A;  1JTZ X;  3W5N A;  1ZBA 2;  5FYY A;  4YSF A;  3JB4 C;  4WVM A;  4Q4V 3;  4Z92 B;  1OOP A;  4NID A;  4E27 A;  4MXW B;  4MX3 A;  3RG0 A;  5GZE A;  2VMI A;  5K0U A;  3THD A;  4XEZ A;  4QU1 A;  3WZ1 A;  1J59 A;  3P1I A;  3KV5 A;  4BPZ A;  4D3W A;  3H42 B;  2E32 A;  3NWK A;  2PLV 2;  1ODM A;  3LEI A;  1AL2 2;  1N1V A;  1U12 A;  4M0N A;  4BXF A;  1KEX A;  1KGY A;  2HWF 2;  4BXS V;  4E2Q A;  2DV9 A;  3UET A;  2MEV 1;  1Z7S 2;  2XL9 A;  4JC1 A;  4D0Q A;  1WMX A;  2WSV A;  2BTV C;  3BU0 A;  4CDW C;  2B7Y A;  1XYP A;  2EXH A;  4BQ1 A;  3SC7 X;  2R16 A;  3TEY A;  1DU3 D;  2JDN A;  2DCY A;  4H7L A;  2CDP A;  4W4Z A;  4OCT A;  1V00 A;  2P6C A;  3NV4 A;  5DG1 A;  3RNS A;  4QM9 A;  4FXK B;  4ERO A;  3PUQ A;  3W5M A;  1ONA A;  4B8E A;  1HQW A;  1J58 A;  3JU9 A;  1K12 A;  4Z07 A;  1ND3 C;  1FPN 1;  2JG9 A;  4GH4 C;  1ZBA 3;  5J37 A;  5A1A A;  3I4I A;  4QDS A;  1IKP A;  4H2A A;  4KH9 A;  5GZC A;  3OEA A;  2XQR A;  4I02 A;  4CDU C;  3DYM A;  3OF1 A;  5IYY A;  5FUN A;  4XAA A;  4HON A;  3B01 A;  4JKL A;  1S4C A;  4XDQ A;  2OXB A;  2WLQ A;  4YG0 A;  2RMU 1;  3IN9 A;  3VL8 A;  2WIN B;  4AHW A;  4Z2W A;  2J1T A;  3UL2 A;  2XLF A;  1ZRD A;  3U14 A;  4AI1 A;  2PLV 3;  4IGQ A;  4K1Y A;  1AL2 3;  2IXH A;  2J1U A;  2PTM A;  3KF3 A;  4YM2 A;  2HH9 A;  3V65 A;  4BB3 A;  3GYD A;  2DU1 A;  4LA3 A;  2R49 A;  3ILN A;  3FUQ A;  5A6Y A;  2WNV C;  2XB6 C;  4QAW A;  3OEB A;  1V9U 3;  4D6R A;  1H9W A;  5CKM A;  5FK7 A;  5A33 A;  5FV3 A;  2XKP A;  1JYN A;  3O1M A;  4NJ4 A;  2Q1F A;  3ZKU A;  3OG2 A;  2X29 A;  2WDB A;  4GJY A;  3AMM A;  2GNM A;  1UAI A;  4SLI A;  2HKX A;  1XNA A;  1AR6 2;  1W99 A;  4A42 A;  1UU4 A;  2CAV A;  4FOY A;  3GJA A;  3OOX A;  1OI6 A;  4K1Z A;  1WLW A;  1OQ1 A;  4AFB A;  1BQP A;  2PHT A;  4BQW A;  5A3P A;  2KD7 A;  1XC6 A;  1W9W A;  4BOW A;  1JOD A;  2VTX J;  1DGR N;  2W1U A;  4JGZ A;  4M4P A;  1CPN A;  1OVP A;  5CNA A;  4XFC A;  2GP3 A;  1RUI 1;  3H3Z A;  4YW4 A;  1XQN A;  4CDX B;  1L3J A;  5F39 A;  4I3P A;  1FMD 2;  2B9U A;  2RR1 2;  4CE8 A;  4JDM A;  4N53 A;  1CAX B;  3TB0 A;  1IZ3 A;  3VD3 A;  2JIC A;  2GDF A;  3ON7 A;  2Q8D A;  4CCJ A;  1W3V A;  4CEY B;  1OA2 A;  2PN5 A;  3HN1 A;  2GME A;  4YW2 A;  1MS3 A;  3HD8 B;  4D69 A;  1BJQ A;  4XFA A;  1UY3 A;  4YM1 A;  4RQP B;  1SDD B;  1DFQ A;  1W6O B;  1AXK A;  2AC1 A;  2PA7 A;  1R64 A;  2G9F A;  2D6O X;  4NUB A;  1J3R A;  1DQ4 A;  3C2U A;  3MUZ 1;  1JZ8 A;  1ND2 B;  1AX1 A;  3H1W A;  4YGC A;  4JKK A;  3KWV A;  2OQ6 A;  3IDE A;  4AI8 A;  1KS5 A;  4WVM B;  3VN4 A;  1AR6 3;  1GU3 A;  2UYA A;  2FDI A;  4R9B A;  1ENQ A;  5DZG A;  4CCM A;  5K0U B;  2A6V A;  4D7T A;  4WVZ A;  3T2O A;  2XJT A;  4KL1 A;  4I0B A;  2PQQ A;  1CJD A;  1IS4 A;  1YQ6 A;  4ASL A;  3DKQ A;  3UNP A;  3FC0 A;  2R07 1;  3FLR A;  1ZX5 A;  3QAC A;  2W1Q A;  1NYW A;  5IK8 A;  1MEC 3;  1ALY A;  4BZ4 A;  5CFC C;  1N1T A;  1BEV 3;  3JQW A;  1KJL A;  4ASM B;  5I0R A;  1IG3 A;  1A34 A;  2D40 A;  3WW1 A;  4GMP 3;  3BTZ A;  5D21 A;  3AX4 A;  4E4H A;  2AZ5 A;  5CG9 A;  4QDQ A;  1G8W A;  4Y1Y A;  1AJO A;  2DVD A;  3ZDS A;  2A3Y A;  3I2F A;  3FJS A;  1DYK A;  2C26 A;  1RED A;  2HWB 2;  4UWD A;  1OLM E;  5LY1 A;  3I49 A;  4CUB A;  3HT1 A;  1RYY A;  1RJ7 A;  1W2A X;  4QPI A;  4RR3 A;  2Y33 A;  4Y24 A;  5K4L A;  3O1S A;  3OGJ A;  4LIV A;  3LF7 A;  1BCX A;  1XE0 A;  2E33 A;  4ITC A;  4G4F A;  5G04 L;  1GUI A;  3V56 A;  5BUV A;  4MHU A;  2B9V A;  2R30 A;  1RUC 2;  4P9G A;  3THC A;  3WP3 A;  2W2I A;  2VCB A;  3S7E A;  3CDZ B;  3RZJ A;  2XWJ B;  1H8V A;  2PEL A;  3NJY A;  1W05 A;  4QQ2 A;  3VHP A;  4Y4Y A;  3OB8 A;  4NHM A;  1O4Z A;  3O1V A;  1S55 A;  4Q0P A;  2GU9 A;  2IFW A;  5A33 B;  3N4M A;  3A7Q A;  2ATF A;  1POQ A;  3B94 A;  1RHI 2;  4Z82 A;  4N9H A;  3USS A;  1O3R A;  4HK8 A;  3VL9 A;  4QKB A;  1LOG A;  2W08 A;  1EUT A;  3V64 A;  4LUM A;  3B7M A;  1FOD 1;  4AQ6 A;  1DLL A;  1GWL A;  2DUR A;  1EAH 2;  4UW3 A;  4AAX A;  1XE8 A;  2HWC 2;  4RD7 A;  2IVJ A;  3ILF A;  2VZ3 A;  3WP5 A;  1Y3T A;  4GMP 0;  1VJ2 A;  1H2M A;  2HWB 3;  3S6P A;  4NIH A;  4I2O A;  1I3H A;  5JUV A;  3H9A A;  1P8J A;  4JGZ B;  2B42 B;  4HVO A;  2JDP A;  4E4D X;  4XZP A;  2H0V A;  2J7M A;  3ACG A;  4EV0 A;  3GF6 A;  4S2D A;  3AP4 A;  4D6S A;  3D0S A;  2WRA A;  2N7G A;  2FQP A;  1G9D A;  4QPG C;  1RUC 3;  3BCW A;  4YVS C;  3LA7 A;  4N53 B;  4IE4 A;  1GZW A;  4LBQ A;  4XJ8 A;  2FBE A;  4FAH A;  5K8S A;  3K3N A;  1DLC A;  1NG0 A;  3BOP A;  3WT3 A;  3AKT A;  1F35 A;  1MS5 A;  2VO5 A;  5FQ0 B;  1W6Q A;  4YWA A;  1LOF C;  2JXA A;  5GZF A;  3BTY A;  5K9Y A;  2EID A;  4IV3 C;  1OH3 A;  4XAC A;  4F8A A;  1AYN 2;  4IEO A;  2FCT A;  1NCR C;  2BDR A;  1LR5 A;  2D6M A;  2Z5W A;  3U1X A;  2HBT A;  1OUX A;  3AZW A;  1RHI 3;  1PMH X;  1ZNP A;  4BQ5 A;  2W92 A;  1GOF A;  2GC0 A;  2BEO A;  3UKN A;  2Y6F A;  1QDC A;  2D43 A;  1EAH 3;  4K8F A;  1QJY 2;  4P02 B;  2O14 A;  5IWF A;  2QQV A;  1VRH 2;  5L73 A;  2YYO A;  4WM8 C;  5GZD A;  1FNY A;  4A3X A;  4BM8 A;  1JI6 A;  2WO2 A;  1AXZ A;  5DXD A;  1VAK A;  1WLT A;  3N35 A;  4Y1X A;  3WLU A;  2VR4 A;  1YIF A;  1H8T C;  2JD9 A;  4Q29 A;  4XBQ A;  1T6B X;  1CAV B;  4HOO A;  3MV1 1;  3J26 N;  2OZ6 A;  1YFY A;  4FOV A;  1WZX A;  1MAC A;  1VMH A;  4MAD A;  3SCF A;  5F3G A;  3R05 A;  2R1D A;  2ZGT A;  2VTX A;  3D82 A;  4GAZ A;  4DZG A;  5M0T A;  1XU2 A;  4LPL A;  4RA0 A;  1Y43 B;  4NIA A;  3ZDV A;  2J42 A;  1F15 A;  1Z78 A;  3VZN A;  2VOX A;  4OQ8 A;  1PMJ X;  3DPR A;  3HAG A;  2ZTN A;  3WY6 A;  1REF A;  4J25 A;  2ETE A;  3EJK A;  3BPZ A;  1TMF 2;  3MBW A;  4NHY A;  4QX3 A;  4FBF A;  4BYY A;  3E5Q A;  5F1R A;  1CN1 A;  5ACA 2;  3IM0 A;  3UYJ A;  2GH8 A;  3HEI A;  3PVO A;  3RSJ A;  4EN9 B;  1JZ7 A;  2A5Z A;  2H6C A;  2JDK A;  2OZJ A;  4R8H A;  3DEC A;  5JIA A;  5FXZ A;  4XJ9 A;  4CXW A;  4QPI B;  3TAY A;  2GZW A;  4HK9 A;  2VZR A;  1VRH 3;  3VBH C;  1QXR A;  1Q8S A;  3WF2 A;  1LGC A;  5GKA C;  3WQ0 A;  3ATG A;  4UFL A;  2D6P A;  1BVP 1;  3A21 A;  1DHK B;  2BBV A;  2DU0 A;  1DZQ A;  3WG2 A;  4BA6 A;  4PBP A;  4EN8 B;  2IVI B;  3WCS A;  2CL2 A;  1PO1 3;  1UOJ A;  4AVS A;  3BYW A;  4QMA A;  3MDP A;  5ERL A;  3K2O A;  2Y38 A;  3NO8 A;  2LRO A;  1UN1 A;  2BVV A;  3OPT A;  5IJR A;  3C7O A;  1XYN A;  2GN7 A;  3BVC A;  2ENR A;  4PIX A;  1L7L A;  4BME A;  5KC5 A;  1W2T A;  2XVG A;  3N9M A;  1TMF 3;  1HRI 2;  1N3O A;  3D5O A;  4LO4 B;  2Z2S B;  4PIZ A;  3VD9 A;  5IVC A;  1DQ2 A;  3PMS A;  5ACA 3;  4CXX A;  4EJR A;  2NMO A;  5HCH A;  2W39 A;  4KWU A;  4BQX A;  1GFF 2;  4X8P A;  2IXL A;  1TNF A;  3NAP C;  4A45 A;  4Q8K A;  4CPB A;  5JXH A;  4B7K A;  5JZG C;  4BK4 A;  2LAL A;  4QPY A;  1HB2 A;  3OBA A;  1YFW A;  5T55 A;  3HBK A;  3WQ7 A;  3MIE A;  1EYB A;  2L9L A;  1DBN A;  3RGB A;  2ORZ A;  2WS9 1;  3MPP G;  3N36 A;  4K8R B;  3SNM A;  3T30 A;  1UX6 A;  3RDI A;  2VEC A;  4ZU5 A;  1GZW B;  5D8A A;  4N43 A;  4LBQ B;  3VBR B;  3IDB B;  3J7L A;  1W6M B;  2UWA A;  1MZE A;  3ECQ A;  4LO6 B;  2R06 2;  3ZFG C;  2SLI A;  1W6Q B;  3H8U A;  4WZC A;  5LBB A;  2IUW A;  1SMV A;  1O5U A;  3AKP A;  4OZX A;  5C3Q A;  1M06 G;  1S2B A;  1R1A 1;  1S0D A;  1LHW A;  2YZ4 A;  2WBK A;  3ZXK A;  4RL7 A;  2QFE A;  1LJ7 A;  1BBT 3;  3DL3 A;  2WWU A;  3ELN A;  3K3O A;  5CKQ A;  1UOB A;  2JDA A;  2J1E A;  5DUU A;  2PHF A;  3H7Y A;  5FP4 A;  2ARE A;  5A32 A;  5JSO A;  4KU7 A;  1HRI 3;  3RQ0 A;  2A71 A;  3NJV A;  2VM9 A;  4RFR B;  1GNY A;  4WZF A;  5FAX A;  3UES A;  4YG3 A;  2MPF A;  3DUI A;  2CY6 A;  3E1F 1;  3N7K A;  1H1I A;  2D7F A;  3ZXG A;  1NCQ A;  3C7H A;  2EA7 A;  1QH7 A;  5EV7 A;  5C33 A;  1PZ7 A;  2WKK A;  1FX5 A;  4NHK A;  4NAM A;  2EF6 A;  1OMI A;  1UX7 A;  3DF0 A;  1VBE 2;  2QQM A;  4CVU A;  1X9T A;  3I59 A;  2YV8 A;  2DVG A;  4Q4W 2;  4UI9 L;  2QQL A;  5EFU A;  1UY0 A;  3WDU A;  4MLO A;  3OUJ A;  4J1X A;  2XJQ A;  5B4X A;  4BU2 A;  4C0H A;  1O7F A;  4Y22 B;  4IGP A;  4AYU A;  5DQ0 A;  1W28 A;  3EMR A;  4MGY E;  1T2X A;  3D0J A;  4XDP A;  3VZO A;  5C70 A;  4ZON A;  4YZ2 A;  4XW3 A;  1LEM A;  1MQT A;  1Q8V A;  1K45 A;  2JDZ A;  5T5P A;  1G9B A;  2YPJ A;  5FMB A;  2EIG A;  5GJ6 A;  1X9P A;  5CEH A;  2IFR A;  3POW A;  3MF6 A;  1LHV A;  3X29 B;  5J96 B;  2WN3 A;  3BAL A;  3RRD A;  2VXR A;  2DTY A;  4Q4Y 3;  3RWN A;  1N3P A;  1SCR A;  5CFD B;  1GNZ A;  5BNN B;  2WT2 A;  3OCP A;  2VNV A;  2JDY A;  2VW0 A;  3RMX A;  2HWE 1;  5FY8 A;  4ZU7 A;  1GZT A;  1SFP A;  1LHU A;  3WHT A;  3J8F 1;  1O3Q A;  3CNA A;  1W8O A;  3T09 A;  3KM5 A;  5CBL A;  4OHV A;  2HYX A;  2XDV A;  5C5T A;  1TNR A;  1QH6 A;  1VBE 3;  3AK0 A;  1LU2 A;  3FWE A;  4LO8 A;  4DXZ A;  2W3J A;  4LUK A;  2OUJ A;  1O8S A;  5C8C C;  4Q4W 3;  4KGQ A;  4C0B A;  4AHX A;  3PTR B;  1FXZ A;  3NL1 A;  1LOA A;  4IEP A;  3U10 A;  1YC6 1;  2DWR A;  4XJZ A;  1LKN A;  3PNA A;  5CU1 A;  5KXE A;  4ONU A;  3HQX A;  1HV0 A;  1WGP A;  1UIK A;  2ZKL A;  1NX9 A;  5L19 A;  2FZ1 A;  2D5F A;  3ME2 A;  2VW1 A;  1IHM A;  1O4Y A;  1PO2 1;  5LK5 A;  3L2H A;  2P3Y A;  4I3G A;  3AP9 A;  2YFU A;  2XL7 A;  4UFH A;  4P08 A;  1SEF A;  2VUD A;  1IS3 A;  1POV 1;  3M3O A;  3NST A;  3PVE A;  4LIT A;  4PDW A;  5E8A A;  3IAQ A;  3L9J T;  1NA1 C;  5CB7 A;  2JEN A;  2W91 A;  4UF0 A;  4ARY A;  3T4V A;  4PLO A;  1BMV 1;  1W8N A;  5FPX A;  4ISR A;  4WM7 C;  2VUA A;  1FV3 A;  3JZV A;  2F17 A;  1RMU 2;  2OW4 A;  2VBP A;  2TUN A;  3UKV A;  3W9A A;  2QJV A;  2DBN A;  5FWE A;  2A1X A;  4XC9 A;  2R04 1;  2RV9 A;  2FCU A;  4N43 B;  5D8A B;  5LAT A;  5DDJ 2;  1UPS A;  4Y26 A;  5FCC A;  3VBF A;  5KHH A;  3WNN A;  4Q4X 1;  2ZGL A;  3WW2 A;  2ZOE B;  4P9Y A;  3VDB A;  1VBA 2;  2JG8 A;  4A2U A;  3WSO A;  5A3W A;  4CCE A;  2GMM A;  2RDR A;  2BV4 A;  4COV A;  3RI9 A;  2I07 B;  2BWA A;  1YXW A;  2W47 A;  4Y20 A;  3NV1 A;  4GKY A;  2VCC A;  1V70 A;  3RZH A;  1DGW X;  3MIC A;  2XPJ A;  1NZI A;  4UAP A;  4QT6 A;  4LKD A;  4GXL A;  4YGE A;  3TNP B;  4OQ9 A;  3GNE A;  5L7O B;  4CDQ A;  3K4Z A;  2WZR 3;  4Q2F A;  4XBN A;  1AR7 3;  1UW8 A;  3VBU A;  4AFC A;  2Z79 A;  3AJY A;  1NCQ B;  3LWC A;  2XBO 2;  1QNY A;  4EN7 B;  3MW3 A;  3MPB A;  3AP6 A;  5C3R A;  4XOG A;  4XPV A;  3POG A;  1PM7 A;  1SFY A;  1ZRR A;  4QXC A;  4B4R A;  4YW1 A;  1OSG A;  1RMU 3;  1YEW A;  2D3R A;  3I59 B;  4HKW A;  1RUG 2;  1IPS A;  2OPW A;  4JV4 A;  3O0V A;  2V5D A;  1IOA A;  3E5X A;  4LLO A;  4XF4 A;  1WCS A;  2Y6K A;  1CAW A;  5BNO C;  1SLB A;  5FZ4 A;  5FMO L;  5FXW A;  2BGO A;  5BXX A;  4HFS A;  1SG3 A;  2AUY A;  3VBO C;  2VNG A;  3W21 A;  4AGV A;  1H9P A;  1VBA 3;  2X5I C;  4HVR A;  1Y9M A;  4Q5O A;  3VKM A;  2RS5 1;  4ISQ A;  1DZT A;  1GZ9 A;  1JYC A;  3AM2 A;  2YGM A;  4XIL A;  1PIV 3;  4KQ7 A;  4KNC A;  3NNL A;  3POF A;  2VQ0 A;  2AEY A;  5T52 A;  3U4X A;  3H8X A;  5IK7 A;  2R32 A;  2Y8K A;  2GC2 A;  2E31 A;  2QZ3 A;  3VBS A;  4CEW C;  4Y5T A;  2YPD A;  4L99 A;  1XBF A;  3LKJ A;  4RHV 1;  2P37 A;  4JGY A;  3SHR A;  3VKO A;  3FFZ A;  2Q1Z B;  3O14 A;  2KR2 A;  4CU6 A;  3PU3 A;  4AED A;  2F4L A;  1YQ5 A;  3I3B A;  3DCQ A;  4AHZ A;  4ZZ5 A;  5C3P A;  4XIK A;  4XMA A;  3RYK A;  2ZCW A;  3IB3 A;  2ZML A;  1VBD 1;  2ZAB A;  4RS5 A;  4EQV A;  5JDB A;  5KXD A;  5EXO A;  3M2M A;  3MIG A;  1QJU 2;  2BP6 A;  3AZV A;  3L2Y A;  3MLK A;  1GOG A;  1RUG 3;  3A0K A;  3JCI A;  1DGW A;  5FYS A;  3KGL A;  4FQZ A;  4QWN A;  4QHB A;  4NWV A;  3NRU A;  1F2N A;  5ISL A;  1OC1 A;  3NQH A;  3ZSK A;  1C1F A;  1RUF 2;  2VPV A;  5FZE A;  2OX0 A;  1JW6 A;  4DO0 A;  1XNT A;  3E6D A;  4QQH A;  5FYZ A;  3VDD C;  2PHX A;  5C9A A;  5A70 A;  2VC9 A;  3O5S A;  3ZIX A;  1ZRI A;  2DUP A;  2BZD A;  5IVB A;  4DIN B;  2DVA A;  1CPM A;  3T3Y A;  2OII A;  2Z69 A;  5EHD A;  3CL1 A;  4XFG A;  3T1L A;  1LOC A;  2ZGP A;  2GP5 A;  4S2H A;  4QPW A;  1CQ9 A;  1D4M 1;  1V6I A;  5LBC A;  1BVV A;  2ERF A;  2CGP A;  3GBF A;  5JOW A;  4DEQ A;  2AH2 A;  2WT1 A;  3F95 A;  4BQ4 A;  1UOG A;  1NLQ A;  1URX A;  2VVF A;  3IAP A;  5LWB A;  3CJX A;  3ST7 A;  2G9Z A;  2PAK A;  3ZYG A;  5KC6 A;  1CGP A;  1QJU 3;  5FPB A;  1W8W A;  2C6S A;  3PUH A;  1NY7 1;  2BRT A;  2IXJ A;  1WD3 A;  3KT7 A;  1QWR A;  3ZFE C;  4IET A;  2JG8 B;  1NLS A;  4IEQ A;  4A6S A;  2C5D A;  3N9N A;  3HBZ A;  5LCW L;  3N9O A;  1ASJ 1;  2R7E B;  2WQZ C;  3OGS A;  3PUA A;  4Y20 B;  2RM2 1;  3S30 A;  4A7K A;  5IK5 A;  4M3C A;  1WW7 A;  3WNL A;  2WFF 2;  1SPP B;  3LOI A;  2QQW A;  5F3C A;  3PVN A;  2DUQ A;  2DCT A;  5GLV A;  4P9W A;  4RGG A;  5IAT A;  4XHB A;  4E2G A;  4XJU A;  4N7U A;  2AEZ A;  3I3E A;  4LMF A;  2YC4 A;  1WCU A;  5KHK A;  3BOW A;  4OUE A;  1HQL A;  2E7T A;  3IWZ A;  4GA9 A;  5F5A A;  3FUO A;  3H3U A;  1RUJ 1;  4FPK A;  4AZZ A;  1DDL A;  1D0G A;  1HKD A;  1ULP A;  1R08 3;  1QQP 3;  3GM8 A;  4OVE A;  5FP9 A;  3T2Q A;  4XQW A;  5CKN A;  3SIT A;  4CDW A;  3LEG A;  1FPN 2;  3SEE A;  2BW8 A;  2DUO A;  4K20 A;  1OFS A;  2EXI A;  4I0A A;  4DUX A;  5AC9 2;  2DYC A;  4RGA A;  3RZK A;  5BYN A;  2NMN A;  2ZAA A;  1AR8 2;  3M3Q A;  1A78 A;  5A7S A;  2RMU 2;  3PJQ A;  2I45 A;  3M3E A;  2P1B A;  1ST8 A;  3HNM A;  1ND3 A;  4GH4 A;  5T3N A;  2O0O A;  3TEZ A;  3J4U H;  3UV9 A;  4BQ3 A;  2P5B A;  1O8P A;  4LBJ A;  4PLM A;  1W9Y A;  2FMD A;  2WFF 3;  4P9L A;  4JVA A;  4XUP A;  4NHX A;  5GLZ A;  3ZN6 A;  4CDU A;  1YIP A;  3V0A A;  2MEV 3;  3OUI A;  1CZT A;  2VD7 A;  3QOP A;  3BUC A;  1RB8 G;  2BUK A;  4IE0 A;  5H9S A;  1ENX A;  4W6W A;  4H55 A;  1MS9 A;  1RJ8 A;  1V9U 2;  2YUE A;  3AMQ A;  4QM8 A;  4J6G A;  4CSW A;  3WIN E;  1DZR A;  5FZO B;  4COW A;  4Q4V 1;  4C8D A;  2CWM A;  2VZ1 A;  3HPN A;  3HIF A;  2VJX A;  3PUS A;  1UZY A;  4CDX C;  2VY0 A;  2E7A A;  2WNV A;  1ULO A;  3OPZ A;  2WNE A;  1JOP A;  1KS4 A;  3GHN A;  3VZJ A;  1R09 1;  2D3P A;  1FPN 3;  3H8R A;  4Q27 A;  4CEY C;  4JX0 A;  4LO7 A;  5AFB A;  1DCS A;  1ENS A;  3HMY A;  5AC9 3;  3I97 A;  5G05 L;  4TTG A;  1NQD A;  4XZU G;  5FZ7 A;  4RQP C;  1AR8 3;  3S7I A;  2VUL A;  3K46 A;  4COY A;  4MHR A;  4NRP A;  4CYD A;  2VE1 A;  1AR9 2;  2RMU 3;  4RGK A;  2BYV E;  4LK7 A;  3VB9 A;  1VR3 A;  2QKD A;  4FFG A;  1HB4 A;  3LEM A;  1ND2 C;  1XPW A;  3C8X A;  4OZO A;  4QKF A;  1Y7B A;  2LM3 A;  5I0U A;  1MS0 A;  3CHX A;  4Y4R A;  2BVB A;  3ZXA C;  4CCN A;  5JXJ A;  2EXJ A;  4DIQ A;  1W90 A;  2WQ8 A;  3OD4 A;  5FFO C;  1QJX 1;  3FX3 A;  3C7F A;  2AEN A;  2CTV A;  2R0F A;  1XSR A;  3SKJ E;  4BH9 A;  1C5I A;  2Q8O A;  4FP2 A;  5H9Q A;  5JPN B;  4L8Q A;  1OD3 A;  2G9G A;  1PK6 C;  1SBE A;  4QX0 A;  4P9I A;  1W3X A;  2QTW B;  3T2T A;  5DAP A;  2A70 A;  2UY9 A;  1VAV A;  4AE2 A;  4PQ9 A;  1RXG A;  3ETQ A;  3CJI B;  2ZX3 A;  2ET7 A;  1GP6 A;  4ZY9 A;  4XMI A;  5FO8 B;  3ZSJ A;  2RS1 2;  3MLJ A;  1PNF A;  4AQ2 A;  3J7M A;  1AR9 3;  2HWF 1;  3B5L B;  3RI8 A;  4URA A;  1Z7S 1;  5DAQ A;  3RYR A;  3D3A A;  2P2K A;  3K4A A;  3RYP A;  4DS0 A;  4TXW A;  1MEC 2;  5FOJ B;  5BNQ A;  1QF3 A;  3CU7 A;  4KBB A;  3I7D A;  5E1R A;  1PGL 2;  5FZL A;  3HN3 A;  5JVV A;  1BEV 2;  4CP2 A;  2ZHN A;  3MW2 A;  1EPW A;  2JEM A;  4QKN A;  2DVF A;  4UT5 A;  3FHA A;  1OLQ A;  3KCY A;  4DXS A;  3ZXE A;  3OYW B;  2WZP P;  5T54 A;  1OF3 A;  5A6X A;  4KWJ A;  5ABJ B;  3NV3 A;  1UMH A;  1S0B A;  5BNP C;  1K5M B;  4IV1 B;  5CFC A;  4GWI A;  2G4I A;  2VME A;  4JDN A;  4XJA A;  4CDW B;  1X36 A;  3G7D A;  5JXI A;  4WVV A;  5KHG A;  2PXJ A;  4LEJ A;  4TWT A;  2Y6J A;  5FPU A;  2WNU C;  4UFM A;  4GWM A;  1F5J A;  4XXA A;  3WNP A;  4OUL A;  1I1E A;  5E88 A;  3UGF A;  1OOP B;  4MET A;  3LFI A;  1C28 A;  3U37 A;  5A6Q A;  4R9D A;  1ZA4 A;  5FPZ A;  4EN0 A;  4Z2A A;  1OQE A;  4FPE A;  2RS1 3;  2VOT A;  2R07 3;  4IND A;  3I2H A;  1V6O A;  3JD7 2;  3ZN6 B;  2WAO A;  1WUV A;  4CDU B;  4YAR A;  4FVV A;  4AG4 A;  3ZYJ B;  2WL1 A;  4E4Z A;  2XLA A;  2E7Q A;  2QDR A;  1YFU A;  5I0S A;  4ZS3 A;  5L9V A;  3G6J B;  4OUM A;  5A3O A;  4AFA A;  4Q8L A;  3JB8 A;  4WVW A;  3U11 A;  3B9I A;  3AL6 A;  4QGN A;  2IXI A;  2VMD A;  1AJK A;  2WNV B;  3WUC A;  5JLV A;  4ZS2 A;  2QUO A;  2YMZ A;  4OFG A;  3UK9 A;  3GJB A;  3KV4 A;  3MO4 A;  3OGG A;  1XE7 A;  4V1P A;  3LIH A;  2JG9 B;  4N7I A;  1JYV A;  4EYU A;  2BWC A;  1OLM A;  2VH9 A;  4BLI A;  4AFM A;  3RZZ A;  1FMD 1;  4ZU4 A;  3BIE A;  2RR1 1;  2NM1 A;  1J1T A;  2D97 A;  2D3S A;  2JKB A;  2J1A A;  1WCD J;  1OKO A;  1SFN A;  2ZJC A;  3JD7 3;  4FPH A;  4QB2 A;  1X50 A;  4LA2 A;  4Z1V A;  1RUE 2;  1H0B A;  3ITQ A;  3N3H A;  3USU A;  3ZN5 A;  1AYM 2;  1XNK A;  3WVJ A;  1ULF A;  2ZEX A;  5EP9 A;  2DF7 A;  1WWY A;  1TZO A;  1BK0 A;  2BJS A;  3I2I A;  3KGZ A;  1DQ0 A;  3ZPO A;  1K5J A;  4QPG A;  4XFH A;  5HV0 A;  5FZ1 A;  4HKO A;  3EQE A;  5JI7 A;  4YVS A;  1JZ6 A;  2ARC A;  2XH6 A;  4LE3 A;  1JYW A;  3O0X A;  3GCX A;  1FOD 3;  3D8C A;  3I3D A;  5JCT A;  1OA4 A;  2A73 B;  1LOF A;  5J48 A;  2F4P A; 
#chains in the Genus database with same CATH homology
 3WNM A;  3K4D A;  1JZ3 A;  2WBK A;  3FL7 A;  4IUG A;  2QQN A;  2YC2 A;  4UOJ A;  2JDA A;  2J1E A;  3JXS A;  2ZEY A;  2B4K A;  4A44 A;  1L7Q A;  2Y6G A;  3NJV A;  2VM9 A;  4E8D A;  2WZ8 A;  1GNY A;  4ARY A;  1K42 A;  3UES A;  3E1F 1;  3LEK A;  4L0P A;  1SHW B;  2VZQ A;  3IDA A;  2QQI A;  3C7H A;  4CUC A;  2DCJ A;  4A6O A;  1UX7 A;  4YPJ A;  5LA0 A;  3A22 A;  2QQM A;  5IFT A;  3SKV A;  4OMD A;  1US3 A;  3GGL A;  2HLE A;  2QQL A;  2VZP A;  1UY0 A;  4UI9 L;  5B4X A;  5F7U A;  2VZV A;  3ACH A;  3EB7 A;  4BJ0 A;  3T2P A;  5DQ0 A;  3FHQ A;  2XQX A;  2EIE A;  1T2X A;  5IHR A;  3ACF A;  5C70 A;  2WO1 A;  4JKM A;  2W1S A;  1K45 A;  2WYS A;  5DMY A;  4W8J A;  2WN3 A;  5LA1 A;  1IQD C;  2E26 A;  2BGP A;  2VL4 A;  1W9T A;  4DXT A;  3I2G A;  4A3Z A;  4P00 B;  2ID4 A;  2ZEZ A;  4LHS A;  1UYY A;  2Y64 A;  1UXZ A;  3HNY M;  2QQO A;  1W8O A;  3T09 A;  4MOA A;  4PQQ A;  2HYX A;  2ZXQ A;  1UZ0 A;  1US2 A;  2J1V A;  3LE0 A;  1I5P A;  2W3J A;  1O8S A;  2X09 A;  3J7H A;  1W9S A;  4LKS A;  4W50 A;  1BHG A;  4ZZ8 A;  3OGV A;  1NX9 A;  1JU3 A;  4CUA A;  2VZO A;  1UYZ A;  3ABZ A;  4JHZ A;  3WNK A;  3GDB A;  2JKX A;  2Y6H A;  2YFU A;  4BDV B;  4P08 A;  1LNS A;  4MO3 M;  1JYX A;  3IAQ A;  2RVA A;  2W91 A;  1JU4 A;  1W8N A;  3LQC A;  2J1S A;  2JE8 A;  2V4V A;  3K77 A;  2RV9 A;  3HJR A;  1JHJ A;  2V72 A;  4PF1 A;  5JMO A;  4ZXE A;  2VZS A;  3WNN A;  4A41 A;  2W94 A;  3VDB A;  3WSO A;  2W47 A;  5HPO A;  3W5N A;  2VCC A;  5EIY B;  2W9X A;  4UAP A;  1TG7 A;  1L7R A;  2BER A;  4FI9 A;  3THD A;  4ARX A;  3K4Z A;  3HOB A;  3VD5 A;  3P1I A;  4KI5 M;  2C9K A;  2Z4F A;  3WF3 A;  2E32 A;  3NJX A;  3LEI A;  4PT6 A;  3WF4 A;  5EJZ B;  1KEX A;  1KGY A;  2WAB A;  4HG6 B;  4BXS V;  2VCA A;  3LPG A;  3UET A;  3I2J A;  4D0Q A;  2V5D A;  5I0D A;  2Y6K A;  2VQT A;  2BGO A;  1SG3 A;  2CDP A;  3BGA A;  4W4Z A;  3GXU A;  1O59 A;  3W5M A;  5JXG A;  1K12 A;  3K75 B;  2Y8K A;  4QDS A;  2E31 A;  2ORX A;  5A1A A;  2J1R A;  3OEA A;  4RYD A;  4CU9 A;  3DYM A;  5IYY A;  3A23 A;  2YB7 A;  4A4A A;  4CU6 A;  4JKL A;  3WQB A;  3I3B A;  4MGS A;  2J1T A;  4ZZ5 A;  3IB3 A;  5B4N A;  2J1U A;  2W1W A;  4XUN A;  2WN2 A;  3CIH A;  4CU8 A;  3ETP A;  1GOG A;  4QX2 A;  4QAW A;  3OEB A;  3NRU A;  3WF1 A;  3NQH A;  1JYN A;  3OG2 A;  1XNT A;  3C7G A;  2WDB A;  1UY2 A;  1XNA A;  4DEV A;  2VC9 A;  1W99 A;  2BZD A;  4A42 A;  3CZU A;  1UY4 A;  2DDU A;  2KD7 A;  1XC6 A;  1W9W A;  3III A;  4QPW A;  2W1U A;  4M4P A;  1CX1 A;  4DUV A;  3F2Z A;  1H6X A;  4DEQ A;  1OH4 A;  4XVH A;  3T08 A;  4M4R A;  1NUK A;  5JR2 A;  2YG0 A;  5FUI A;  3WEZ A;  3IAP A;  3VD3 A;  4QX1 A;  3VDA A;  3VDC A;  1NAE A;  2VMF A;  1F4H A;  1UY3 A;  3PUH A;  1SDD B;  3ACI A;  1R64 A;  3MUZ 1;  5LCW L;  3I2K A;  1JZ8 A;  2VTF A;  3ZM8 A;  2R7E B;  1YQ2 A;  3OGS A;  2YFZ A;  4JKK A;  4GZ9 A;  1CZS A;  1UXX X;  3WNL A;  5CYY A;  1GU3 A;  3VD4 A;  1UY1 A;  3I3E A;  3T2O A;  1D7P M;  2YC4 A;  4OUE A;  5HXM A;  3UNP A;  4RN5 A;  3CMG A;  3WNO A;  1NKG A;  2W1Q A;  4DUW A;  1ULP A;  2XON A;  3GM8 A;  3T2Q A;  4QB1 A;  4XUR A;  3LEG A;  3SEE A;  4DUX A;  2W46 A;  2Y6L A;  1F4A A;  4GWJ A;  4QDQ A;  1J84 A;  2XHN A;  2QQK A;  1GQP A;  3I2F A;  2C26 A;  1GOH A;  3HNM A;  1OF4 A;  4CUB A;  1O8P A;  1RYY A;  2EIC A;  4XUP A;  2RJ2 A;  2E33 A;  5G04 L;  1CZT A;  1GUI A;  4QB6 A;  3VD7 A;  2B9V A;  1CZV A;  3MUY 1;  3THC A;  2VCB A;  3CDZ B;  3NNG A;  2VZ1 A;  4OYU A;  3HPN A;  3AC0 A;  2VJX A;  4QDR A;  3OB8 A;  1JZ5 A;  1ULO A;  1W0N A;  3A7Q A;  3FN9 A;  4JX0 A;  3DYP A;  1UYX A;  3I97 A;  1CIY A;  5G05 L;  4TTG A;  4XZU G;  1EUT A;  4LQR A;  3K46 A;  4AAX A;  1MPX A;  3CQO A;  2VZ3 A;  4OZO A;  3C8X A;  1XPW A;  2QBX A;  1WKY A;  5JUV A;  1P8J A;  5IFP A;  2J7M A;  3ACG A;  5JXJ A;  2WUH A;  2WQ8 A;  3C7F A;  2VZU A;  2WO3 A;  3SKJ E;  2QQJ A;  4ET7 A;  1OD3 A;  1DLC A;  1PX3 A;  4QX0 A;  2VO5 A;  2OKX A;  2W87 A;  4D8M A;  2X05 A;  3HNB M;  3CZJ A;  2EID A;  4CU7 A;  1DP0 A;  5DPN A;  4ZY9 A;  1HN1 A;  1PMH X;  1UWW A;  2W92 A;  1GOF A;  3T0B A;  5LA2 A;  1J83 A;  4P02 B;  1TVG A;  2X10 A;  3D3A A;  1JI6 A;  3K4A A;  2WO2 A;  4TXW A;  5C7G A;  2VR4 A;  2XOM A;  2JD9 A;  3HN3 A;  3DYO A;  3FHA A;  4DXS A;  3MV1 1;  3SEP A;  2WAA A;  1OF3 A;  4P5Y A;  1UMH A;  4MAD A;  4XUQ A;  3WF0 A;  4GWI A;  2VME A;  3T0D A;  1GMM A;  5JXI A;  4LPL A;  2CDO A;  2Y6J A;  1PMJ X;  2W5F A;  4QX3 A;  3WNP A;  3T0A A;  3MBW A;  3U37 A;  4XUO A;  3HEI A;  1DYO A;  4Z2A A;  1JZ7 A;  1UMI A;  2EIB A;  2VOT A;  3DEC A;  3I2H A;  2C4X A;  3LPF A;  3P6B A;  2VZR A;  2WAO A;  5CZK A;  4AG4 A;  3WF2 A;  4KMQ A;  3A21 A;  2ZEW A;  1PX4 A;  2W95 A;  2VMD A;  1K3I A;  3C7E A;  2J22 A;  4BK5 A;  5IJR A;  1OT5 A;  3C7O A;  2BBA A;  4XUT A;  2PQS A;  4OMC A;  1EUU A;  3MO4 A;  3PUI A;  1JYV A;  2VMC A;  5C71 A;  3CKH A;  5EJ1 B;  3VD9 A;  2VZT A;  1JZ2 A;  4KWU A;  4MGQ A;  2LW8 A;  3EYP A;  4A45 A;  2J1A A;  5JXH A;  2VQU A;  4DXR A;  3BN6 A;  4CVU A;  4QB2 A;  1JZ4 A;  4BK4 A;  3OBA A;  2ZEX A;  1H6Y A;  2L9L A;  4E8C A;  2LS6 A;  2ORZ A;  3I2I A;  1WCQ A;  3OGR A;  1JZ6 A;  1JYW A;  5J1X A;  2DCK A;  3I3D A;  2WZE A;  3ECQ A;  3MV0 1;  5DN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...