2J1UA

Structure of a streptococcus pneumoniae fucose binding module in complex with the blood group a-tetrasaccharide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
141
structure length
141
Chain Sequence
KFNDGNLNIAYAKPTTQSSVDYNGDPNRAVDGNRNGNFNSGSVTHTRADNPSWWEVDLKKMDKVGLVKIYNRTDAETQRLSNFDVILYDNNRNEVAKKHVNNLSGESVSLDFKEKGARYIKVKLLTSGVPLSLAEVEVFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Carbohydrate-binding protein
molecule keywords FUCOLECTIN-RELATED PROTEIN
publication title Blood Group Antigen Recognition by a Streptococcus Pneumoniae Virulence Factor
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 40
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2j1uA00
1I5PA 2JKXA 4MOAA 4PT6A 1XPWA 2OKXA 3IIIA 3NNGA 1W8OA 2JD9A 2BBAA 1J83A 1PX4A 2J1UA 2YFUA 2WZ8A 2XQXA 4CU6A 2Y8KA 3WNLA 1XC6A 1JYXA 2B9VA 2YG0A 2WZEA 2VTFA 3T2PA 5A1AA 4CUAA 2WBKA 1DYOA 2WAAA 3OGVA 4DXRA 1W9TA 2Y64A 1NUKA 1K12A 3K46A 3VD4A 4BDVB 3HNYM 5DMYA 4ZZ5A 3ACGA 2YB7A 4A3ZA 2VQTA 2VR4A 3LEKA 2E32A 3UETA 5IFPA 4ZXEA 2Y6LA 3T08A 1XNTA 3IAPA 2L9LA 1UXZA 4MADA 2ORZA 3C8XA 4OYUA 2VO5A 3WNNA 2VZUA 4CVUA 1US2A 2ZEZA 2W1SA 2JE8A 5JMOA 2W87A 3FHAA 4W8JA 4M4PA 2X10A 2XONA 1WCQA 2VZRA 1R64A 2J7MA 2C26A 3VDCA 1F4HA 3A23A 1J84A 2VCBA 1CZTA 3EB7A 4P02B 3ACHA 4XUNA 1JYVA 4P08A 2WAOA 3MUY1 2BGOA 5CZKA 4JHZA 4JKLA 4JKMA 3OB8A 3T2QA 3JXSA 4ZY9A 4E8DA 4CUBA 3NRUA 3ACIA 2E31A 1UY2A 1UZ0A 2ORXA 3MO4A 4XUTA 4UAPA 5C7GA 2XHNA 1UMHA 1UY3A 4BK4A 2QQLA 2WABA 3DYMA 3WEZA 3C7GA 2JDAA 3GXUA 4XUQA 2C9KA 2EIDA 1IQDC 1T2XA 1BHGA 3MV01 3ETPA 3IDAA 2W92A 3LE0A 2BGPA 3MBWA 1NKGA 2W9XA 2Z4FA 4QDRA 3OG2A 4A6OA 3WF4A 2LW8A 2WYSA 2YC4A 1JU4A 5J1XA 1D7PM 1US3A 3BGAA 5DPNA 5LA1A 1O59A 2CDPA 3C7OA 4BXSV 4A42A 1H6YA 1CX1A 2X05A 1OT5A 3SEEA 2YFZA 1UYZA 2E33A 3J7HA 4GZ9A 1PMHX 3A22A 1EUUA 2VJXA 4MO3M 3A7QA 3UESA 3C7EA 3WNMA 1F4AA 2LS6A 2QQIA 3WQBA 4UOJA 3T0BA 2J1TA 3T0DA 2Y6KA 5JUVA 5IYYA 4ARXA 2J1VA 3WNKA 4A45A 4E8CA 1JZ3A 4XUPA 3VD7A 2VQUA 1DP0A 4DEQA 2WO1A 2VL4A 4BJ0A 1CZSA 2VMDA 1H6XA 1UMIA 2WO3A 2W3JA 4KI5M 2ZEYA 3THDA 1UYYA 5JXIA 4AAXA 2VZ1A 3K77A 4JKKA 3VD3A 2E26A 1MPXA 4BK5A 3GDBA 1TG7A 4XUOA 1PX3A 1JU3A 4MGQA 1UX7A 3CIHA 3P6BA 4OMDA 5B4NA 3K4DA 4QX3A 2XOMA 3I2JA 3OEBA 2W94A 5C71A 3C7HA 2VOTA 5IJRA 1L7QA 2VZVA 3THCA 3T2OA 3EYPA 4QB2A 3HEIA 4M4RA 1ULOA 1EUTA 2QQJA 2ZEXA 4OZOA 3HNMA 1DLCA 1UWWA 3I2IA 1O8SA 4D0QA 4KMQA 4QDSA 3T09A 4XVHA 1SDDB 4MGSA 4XURA 2J1EA 2QQOA 3WNOA 5C70A 2DDUA 3DYOA 4GWIA 3OEAA 4P5YA 2V4VA 3CDZB 3WF1A 2B4KA 2VZOA 3FN9A 3ECQA 1GNYA 3OGRA 3SKVA 1K42A 1GU3A 2EIBA 1UY1A 2KD7A 2VCCA 2BERA 4QB1A 3I2GA 1JYWA 2J1SA 2YC2A 4GWJA 4LQRA 1L7RA 4L0PA 1GOHA 3P1IA 4D8MA 3LPFA 3U37A 5FUIA 1CIYA 4DUWA 2W1QA 4DEVA 5I0DA 3HN3A 4YPJA 2BZDA 4ET7A 2QBXA 1GQPA 4QAWA 5LA2A 2EIEA 1W9WA 3GGLA 3D3AA 5EIYB 2WUHA 4XZUG 3I2HA 4OMCA 3HJRA 1JZ6A 5DN2A 4DXSA 4FI9A 3ZM8A 1SG3A 1WKYA 2V72A 5DQ0A 2VCAA 3OGSA 1XNAA 4A41A 4DUXA 2J22A 1NAEA 2W46A 2VZTA 1RYYA 3HPNA 1KGYA 1JZ2A 3WF3A 2ZEWA 2VMFA 4RYDA 1JI6A 3IB3A 3VD9A 2WDBA 3C7FA 2W95A 4A4AA 3CZUA 4IUGA 1K45A 1YQ2A 4LPLA 5JR2A 1TVGA 3WSOA 2PQSA 1HN1A 3NJXA 4ARYA 2VZ3A 1UYXA 1JHJA 2Y6JA 2W1UA 1KEXA 3CZJA 4W50A 4QX2A 1OF4A 3GM8A 1JZ7A 1SHWB 4CUCA 5IHRA 1LNSA 1GOGA 3SKJE 3ACFA 3NQHA 4PQQA 5G05L 1UY4A 2EICA 4PF1A 4OUEA 1JZ5A 2VZQA 3VD5A 3DECA 5G04L 1P8JA 4LHSA 3HOBA 4QPWA 4W4ZA 5F7UA 3K75B 4KWUA 2HYXA 4CU8A 3PUIA 4QX0A 1W0NA 3IAQA 2J1AA 2WQ8A 4TXWA 3LEGA 5JXHA 3CQOA 4RN5A 3I3EA 3LEIA 1OH4A 2VMCA 4LKSA 2C4XA 3CKHA 3MUZ1 3MV11 1OF3A 4HG6B 1W99A 1JYNA 2WN2A 1W9SA 1PMJX 3K4AA 5JXJA 2CDOA 2DCKA 5JXGA 4QX1A 1W8NA 2RJ2A 2QQNA 1NX9A 3LPGA 2W5FA 3VDAA 3WNPA 3I3BA 3K4ZA 2VZPA 3PUHA 4QB6A 3VDBA 2WN3A 4TTGA 3ABZA 3OBAA 1JZ4A 2W1WA 4QDQA 3CMGA 5HXMA 3FHQA 5LA0A 2Y6HA 5IFTA 1GMMA 2X09A 3BN6A 2Y6GA 3NJVA 3W5MA 3SEPA 1UXXX 5HPOA 3I2FA 2DCJA 2QQMA 2WO2A 2HLEA 3HNBM 3LQCA 3F2ZA 2ID4A 4UI9L 2ZXQA 4ZZ8A 4CU9A 4CU7A 2R7EB 1CZVA 1O8PA 2J1RA 1ULPA 3WF0A 1UY0A 3DYPA 5B4XA 2RVAA 3WF2A 4DXTA 3I97A 2W91A 1JZ8A 4JX0A 3W5NA 3E1F1 2QQKA 5LCWL 3UNPA 5EJZB 1GOFA 2VC9A 2RV9A 2V5DA 1K3IA 1OD3A 4Z2AA 5EJ1B 4DUVA 2W47A 3FL7A 2VMEA 3I3DA 1GUIA 4AG4A 5CYYA 3A21A 3AC0A 2VZSA 3I2KA 4P00B 3T0AA 4A44A 2VM9A
chains in the Genus database with same CATH superfamily
2AACA 3E5UA 4COYA 4DQAA 4LBMA 4YM0A 1AUYA 1DFQA 2X5IB 4AGGA 2HWF2 1BCXA 1OXCA 1V6OA 4Q4W3 4OVEA 4QT6A 2QTWB 5A3MA 2JD9A 3WG1A 4EJRA 1FT9A 4Q4V1 1J83A 3DV8A 1QOSA 1ND2A 2J1UA 5LK5A 1ND3C 4R9CA 5A7WB 5JLVA 3NO8A 4AE2A 4I09A 1AL22 1UAIA 1MS1A 2R043 3AK0A 4HZFA 1JYXA 1AYN3 4YW3A 3TNQA 3HD8B 5CBLA 2YG0A 1MACA 1PK6C 3ST7A 4CUAA 1FOD2 3AVSA 3I2DA 5FZHA 4DXRA 4LORA 3ASIA 4KGQA 2I74A 4N53C 4N9IA 5A7OA 2EIGA 4OHVA 1K12A 3K46A 1EV11 3JD72 4IERA 4MXWA 1RVF3 3HBKA 4FFGA 1O3SA 5ANQA 2V73A 4LEJA 2RS11 3AFGA 2XWJB 2VQTA 1W0OA 2CY6A 1UZWA 3LEKA 3WDUA 1ZX5A 3MIHA 3TN93 3UETA 5IFPA 5CFDB 1YRZA 4RS5C 1ENQA 2KR2A 4CP2A 2YV8A 5C9AA 1QJZA 1BBT2 3USSA 4FQ4A 3CBNA 4XF1A 1WBLA 1IPKA 2HWE3 2QDRA 4MADA 3FLRA 3Q8FA 3KV5A 3OD4A 4WM8A 1Q8PA 4WBBA 3ME2A 1MVQA 3D5OA 1ND2C 2W1SA 5F1RA 4K1ZA 1TZOA 3AP4A 2W87A 5DUUA 3SC7X 4M4PA 4BB3A 4CCDA 4IW3A 4GIQA 1HRV3 1NLQA 3FMGA 2BP6A 3GBWA 3JQWA 1LGBA 3POWA 4CP1A 1F4HA 1O4TA 1YLLA 3A23A 3ZFEB 1S0DA 4YGCA 1I9RA 1R091 3ACHA 4JCKA 3ZXKA 1HRI1 1C57A 2JDMA 2ZBJA 2XDVA 5FTTC 2HWF1 2WAOA 5IK8A 5FMOL 2BGOA 4Y5SA 3S7IA 2RJLA 4PIXA 1RGSA 1ZBA1 4JKLA 3O1UA 3AFKA 4JKMA 4UFMA 3AYAA 3IMMA 4X6RB 2Z5WA 3EQEA 3N7KA 3JXSA 4ONUA 1GLHA 4E8DA 1AL21 3NRUA 1E57A 1QF3A 1XOYA 1D2SA 2GMPA 2E31A 3ACIA 1LHNA 1W6QA 1UY2A 4KL1A 5C9AC 3MFAA 4CXYA 1UZ0A 2ZHNA 3RMXA 2ZMLA 5C7GA 1JMUB 1DIWA 2JDNA 1UY3A 1FOD1 3UGGA 3BODA 2QQLA 2WABA 5BNPA 2BBVA 3DYMA 1WCUA 3GCXA 3AM2A 2JDAA 3GXUA 3WEZA 3Q8BA 1O3RA 2DU0A 2D6PA 3AMHA 4EN8B 3FHIB 2WSVA 5F6KA 1X8EA 4P9WA 4YG6A 2ZKNA 4OHYA 1IQDC 5DXDA 4ATEA 1BHGA 2JG9B 3TWIA 4AVSA 2YROA 3WW1A 2ET7A 1A8MA 5DUVA 4UFIA 4YFZA 4P9XA 3DGTA 4Q4Y1 5FZ1A 1C5HA 2QE3A 2Z79A 1AJOA 4CCCA 2HWD2 1EP0A 1EAH2 4AVAA 1BQPA 3MBWA 3WQ1A 1LOEA 1BBT1 5T5JA 4CDUB 3KV6A 4Y1XA 4HOOA 3WF4A 2YC4A 4JQTA 4MZUA 3KGZA 1JOJA 2WT0A 3FX3A 3MLLA 1O59A 4FQZA 2CDPA 3C7OA 3V0AA 4MLOA 1OVPA 2JB4A 4R4XA 4XJWA 2WWJA 1SLCA 4BE3A 2XVKA 3JB4C 4CE8A 2YFZA 3OD0A 4MGTA 5FFOC 1F5JA 1IG3A 3J7HA 3ZPOA 1AX2A 1HQNA 2Q8OA 1AR62 1O5UA 1PMHX 2VTXJ 2BEOA 2DFBA 2VNGA 3UGFA 5JOYA 2VJXA 1ZRCA 4CDWA 5IWFA 2E51A 1BVVA 1HB3A 3MYXA 2QQIA 2QVSB 3WNMA 1QQP2 5BNPC 4UOJA 3T0BA 4QQPA 2YBSA 2GMMA 1D4M1 4QU1A 3U10A 3PVOA 5DDJ3 5BNOA 5IK7A 1QJU3 1LAJA 1WCDJ 4ARXA 4RHV3 1WMEA 5FZAA 5BV6A 3S57A 1ZRIA 3KV9A 2PQQA 3ZYGA 1JS9A 2RDQA 2Y0IA 3M70A 4NO4A 3VD7A 2VQUA 1IS5A 2Q1MA 2VCMA 2ZGUA 4HK8A 3WQ0A 1GV9A 1RIRA 1I6XA 1V0AA 3D0JA 4IV1B 3VKOA 2Q0AA 3OCPA 2PHTA 1AX1A 4BJ0A 2ZX3A 3NJYA 2BJSA 3USUA 5FPVA 2HEYF 4K8FA 4LBQA 2ZEYA 3ILFA 3B7MA 2VVEA 3N9OA 1R082 4ITCA 2HWD1 3DXUA 5A70A 1EAH1 1LHOA 1W2UA 3VKLA 4YGBA 3WP5A 4ZPIA 2PA7A 2Q8EA 3GDBA 4XUOA 1PX3A 1JU3A 3THPA 2VE1A 1ZRFA 4PBPA 4XPVA 4IE7A 3O0VA 5BNOC 1S0FA 4FPJA 5B4NA 4QX3A 2XOMA 3I2JA 3OEBA 1MZ5A 3TBDA 3THCA 2XVLA 3EYPA 4WM7A 5FZLA 4BQ2A 1NXMA 1ULOA 2AEZA 1EUTA 3G7DA 1QXRA 1S55A 2VPVA 2WNEA 5CNAA 4DB5A 1C4RA 1W6OB 1RUJ3 4OZOA 1OHFA 1UWWA 5A3LA 4R9DA 1RJ8A 1U5XA 1X7NA 1YXWA 2C9AA 2JENA 4FPGA 3ZSKA 4QDSA 5DG2A 1AXYA 5T5LA 1S0JA 3CLPA 4Q0SA 4XVHA 2ZHMA 1W9FA 4Z92B 1PHMA 3OY8A 2QKDA 4NVPA 2D43A 5FY1A 1UNBA 4Y5TA 5F8PA 1LKNA 4XF4A 3NSTA 2WZR2 4ES8A 1Q43A 3M1HA 5C8WA 4DRRA 4FPFA 3O0XA 4GWIA 2P3KA 2YZ4A 4TLFA 5FY4A 4Y22A 4G9SB 2D5HA 5FV3A 4GJZA 1CQ9A 1Y9MA 2MEV3 5A80A 4YM3A 5C3PA 3QH7A 4XJZA 3DXTA 2BWCA 4XXAA 2ENRA 1H4GA 3KHBA 3FFZA 4AW7A 1GU3A 5JIUA 4BXFA 1HJGA 2ARCA 1J3PA 4Q29A 4PLMA 1KQRA 4OI0A 2VCCA 4WM7C 1UOGA 1N47A 5A6YA 1LEMA 3I2GA 2WFF2 2QJVA 1R081 3M3EA 2NMOA 4GWJA 1AYM1 3LEMA 4LQRA 2NM1A 1NG0A 4IE4A 3O14A 1PVC3 3RG0A 3VHNA 4URTA 3O1RA 1QMJA 1W6NA 4RQPB 1OA3A 4Q2FA 5E88A 1QEXA 2GNMA 1F2NA 3BPSA 3WT3A 5E8AA 4R4ZA 2JECA 4YPJA 4HN0A 5LB6A 2QQWA 3A0KA 1E5RA 5ACA3 5KHJA 1Q5OA 2QBXA 4FT8A 5LK7B 3H8OA 4QAWA 5A7QA 4XILA 4AQ6A 2VU9A 5F3CA 2QQUA 4TN7A 1NYWA 2R073 5LA2A 3PJQA 4QHZA 3UKNA 5EIYB 3QD6A 3W9AA 1X36A 2GN3A 4D6QA 5JOWA 3LKJA 5DAVA 4AQ2A 2HWB2 4LITA 5C3QA 2WNOA 1A6CA 1LU1A 4P5HA 4JZRA 3AMMA 4D6RA 3KV4A 3SLIA 4QXCA 3UKTA 1SG3A 2CU5A 2G9ZA 3NV1A 1TME2 5F5CA 3VL8A 1BEV3 3WDYA 5JSPA 2WZR1 4CDQA 3LSDA 2JEMA 4KGGA 2W46A 1UZVA 1RYYA 1FAYA 1Y7BA 2ZHKA 2ZJCA 2VBPA 2VBBA 4XTPA 3TRSB 4AHWA 2RDRA 3WF3A 1RUE2 1JZ2A 1O7FA 4RYDA 2RHPA 3IB3A 3BU0A 2OIIA 3CJIA 3VD9A 5GLUA 4YW2A 4D6SA 2WRAA 2B46X 4AI3A 4RL7A 2PHDA 3G6JB 4JGYC 2IXJA 3OJBA 1PGL1 5FYVA 1O3QA 3HBZA 3N9NA 2ZMKA 1QXJA 1AR92 4V2WA 3KD4A 3VLBB 5HCBA 1E5SA 1KDMA 2CNAA 4IE5A 4CEWB 1W3VA 1WMDA 3NV4A 4AXOA 2XUEA 2F6BA 4K1YA 4AVTA 3BKZA 1C8M2 1AX0A 3B00A 5CISA 4QX2A 1OF4A 2E9QA 1DZTA 5HCAA 1XYNA 1YJLA 4R52A 1TMF2 1HV0A 2K9ZA 2UWAA 5LASA 2R30A 2Q8DA 2AREA 3KWVA 4J1XA 3SKJE 1W2OA 1KS4A 2VNOA 1DF0A 3ACFA 2WYFA 3VBFC 3W21A 1RC6A 2P2KA 3N7JA 4Q4X2 5G05L 4XABA 4ZS2A 4GB33 5FAXA 4CDQC 1VBE1 1XNDA 1BZWA 2EICA 4PF1A 3UJQA 4XTMA 1H0BA 1ND3B 1DQ0A 3VD5A 1JZ5A 3LF7A 4QMAA 3RQ0A 3WW4A 2JE9A 4ZHNA 1P8JA 4LHSA 2NLRA 1V9U3 3CJIC 4QPWA 3MZHA 3HVDA 2LTNA 1LOFA 4PI0A 4OQ9A 1HKDA 1PK6B 2ZGKA 4BISA 4CU8A 2AYHA 4ISQA 2XXZA 1VRH1 3SHRA 2GC3A 1W8ZA 3H3ZA 1LU2A 1JN2P 3LEGA 5JXHA 3I3EA 1QIQA 5FZ8A 3R0RA 3S30A 2BVVA 4BPZA 1HB1A 3AKPA 4DY5A 3LB9A 1UPSA 3R05A 1RL3A 3BOWA 4N90A 3O1VA 5FMBA 4AQTA 1AR83 4YYOA 3MUZ1 1RUE1 1OF3A 3MV11 4IEYA 5GZGA 1IS3A 3V64A 1SACA 3T30A 4RS5B 1FNZA 1HXS2 1G8WA 3POBA 4XMAA 5CAZA 5LWBA 2UY9A 3ACLA 1PMJX 2EF6A 2CDOA 1A3KA 1J3QA 3POJA 4L9BA 4IDZA 4BIFA 3S5AA 2ZAAA 1W8NA 1SCSA 4HONA 4HETA 2R1DA 1ND2B 1AR91 2W5FA 4AHYA 3KVAA 1AZDA 2XJPA 4Q1PA 2DVAA 1UOFA 3LIHA 4FCAA 4KNCA 1DQ5A 3I7DA 4LKDA 2C5DA 3PUHA 1SFPA 2JG8A 1LOFC 1PGSA 3C2UA 2HEWF 3OBAA 1JZ4A 2BFUS 1QJEA 1YO8A 2W1WA 3FUQA 4NHLA 3WD5A 1WD4A 5HXMA 3MIEA 5J7MA 2DBIA 3ROUA 4K7JA 4MXWB 4Q4X1 2JKBA 4XAAA 5F5IA 4JGZA 2WWUA 2YU1A 4P14A 5IVEA 5LBBA 1OSGA 2P6CA 3RS6A 4BCUA 4BOWA 2IXLA 2QQMA 3E5XA 1PO21 1NY72 2WO2A 5DAQA 5FPBA 5EWSA 3HNBM 2P34A 2JDYA 4OHWA 2BUKA 1OLQA 3U0ZA 1DDLA 4XJAA 3E5QA 2XJVA 2D5FA 5H9PA 1T6BX 1CZVA 1NA1A 2B42B 3LCPA 3D8CA 2QNKA 4QQLA 3DF0A 5CKMA 2CGNA 4KQ7A 1DQ4A 1UX6A 4X6QB 1C28A 3VZJA 1YIFA 5GLVA 1OLRA 1V6MA 2E7AA 4OUMA 5CG8A 5FO7B 1VBA1 2W91A 4BYYA 2VMIA 5LRSA 5LCWL 4O65A 2JG8C 1Y9QA 1PIV3 1HXS1 1GOFA 2DCYA 4X8NA 4UF0B 4WVZA 5C6CA 1W03A 4FP2A 4CCEA 3B9IA 3RWKX 2OUJA 1EV13 4JGZC 3NJZA 5K8SA 4QKFA 2FDKA 3AP6A 3GHMA 5LATA 3I3DA 3KQRA 3PJYA 4GQ7A 2W0XA 2NZ9A 2V4AA 4JC1A 5AFEA 1MEC2 3HIFA 5CYYA 5FLJA 3NAPA 5FYHA 4CPBD 5IUQA 3BIEA 1ZZ9A 1JODA 1EPZA 1UZZA 3MPPG 4Y3OA 5A1LA 1W6QB 3AP9A 2Q5TA 5C4WB 3I4IA 2ZGTA 5FZ6A 1GZWA 1NA1C 2Z69A 5H9RA 1KXGA 5FXWA 3GF6A 3WG4A 1I5PA 1W90A 3PU8A 1C5IA 4MOAA 5AVAA 4FOVA 2OKXA 3M3IA 1GWKA 1C1FA 3WHTA 2BBAA 2K46A 4AYUA 5J09A 4F83A 5T54A 3PIGA 4M3CA 2PTMA 3TEYA 3N7LA 3PIJA 4LLOA 4KWJA 2RS52 3ZSMA 4WZFA 4CU6A 4LOTA 4C1WA 1XC6A 4GKXA 5LY2A 4XFHA 3URFA 1NY71 3ZIXA 1XYPA 1H30A 5ISLA 2CGPA 1CAXB 2WZEA 3MIFA 3JZVA 3T2PA 1R093 4XDPA 2WBKA 2WAAA 1NLRA 1BK1A 5FZEA 2R49A 1FX5A 1HRI3 1WW4A 2B7YA 1AR72 3GBFA 4EZ4A 5FPLA 5A32A 1RTVA 3RZLA 4NIAA 3UKVA 4A7ZA 4BDVB 1VRBA 5DMYA 1ZBA3 3DKWA 4MXVA 1QY4A 2GC0A 4NWWA 2VMGA 3NAPC 4GH4A 4NPLA 1AL23 4ZXEA 4N9HA 3J7NA 3T08A 2H6CA 3SQOA 3OOXA 1ASJ1 2BOIA 3EO6A 4Y20A 1Q8VA 1FOD3 5FPXA 3TAYA 4CA9A 1POQA 2VO5A 3UT0A 4HANA 4CTEA 5JMOA 2DUPA 1RHI2 3FHAA 4OUSA 5IK4A 5T50A 1PNFA 4L97A 4S2FA 1R64A 4Q4Y3 1MEC1 5KXBA 4ASKA 5KC5A 3IWZA 4IGPA 1IGOA 4HT1T 1MQTC 1J84A 4JRLA 3IIAA 2WR9A 5FXXA 4GAZA 1BBT3 1S2EA 2D40A 4XUNA 1FPN3 3MDPA 2DBNA 5GJ6A 5EXOA 3MUY1 4R9AA 2IFWA 3D82A 5KHHA 1RUH3 2VULA 2WT1A 1XU2A 3OB8A 3USUB 5GM0A 3NV3A 4FSJA 4OFGA 4RFT0 3WOGA 2C24A 3N9PA 2CYFA 4K20A 5BNNA 3T2QA 5FKCA 2WIIB 4GH4C 1RXFA 3VBUA 5I93A 4CUBA 2X29A 2WFPA 4LBQB 4FAGA 2OUHA 1RUC2 5F39A 1KJRA 3VBRB 4UW3A 3SISA 4ASMB 3MO4A 5FDBA 4HMZA 4XUTA 1UMHA 2WC2A 3FZ3A 4UFKA 1RUG1 5CIRA 4B3NA 4BK4A 1RUF2 2QQVA 2OQ7A 1MZFA 1XE0A 1AR71 3BTAA 4IEWA 3RPQA 5BUVA 2RDNA 1A34A 1D4M3 3INAA 1RINA 3TEWA 2GMEA 1STMA 4OULA 1T2XA 4L99A 5EP9A 4AEDA 3I2OA 1CN1A 3ETPA 1CAUA 1DGRA 4QGLA 5IVFA 2JDPA 2SBAA 4B29A 3WXPA 2VOXA 1SDWA 2W92A 3JBG2 5FYTA 3LDBA 5FP7A 1IZ3A 4E27A 2BGPA 1SZBA 3MEPA 1POV1 2GDFA 2GN7A 2Z4FA 1W6PB 1H8VA 3ETQA 4QDRA 1HB4A 3ZYPA 4UFLA 4AAPA 4A6OA 4CPBA 1FMD2 3M3QA 2WYSA 4CCMA 5A3UA 5J1XA 3FFQA 1RMU2 1US3A 3BGAA 4ORFA 4I30A 2ARBA 3H1WA 4A3XA 4LHNA 4IV3A 1WZXA 5KHGA 1O91A 2TBVA 3MLKA 5BNNC 3BU7A 1RHI1 3OY8B 1DLLA 5FYSA 2IZWA 2OZJA 5T5PA 1T6GC 1NXD1 4FP3A 3VBUC 4D7TA 2E33A 2Q4SA 3ZR6A 4GZ9A 5CB7A 2K0GA 3A22A 4BU2A 2HWD3 3J8F3 1EUUA 2A6ZA 4U2AA 5L7OB 4PBOA 4Y22B 4DOUA 3GHNA 2R1BA 1F4AA 2P4EA 2BQPA 1K5MA 5I8YA 1ZZ7A 3O1MA 5D8AA 1GBGA 3GYDA 3VBOA 2ET1A 3V65A 3U07A 2Y6KA 4LKEA 4XZPA 1WD3A 2I45A 3OTFA 4XFAA 4AEDC 1ULDA 2BPA2 5E16A 5ERLA 4LLFA 1VBB3 2N7GA 3WDTA 4ASLA 5KXCA 5JAXA 2AGSA 1MZ6A 1RUI2 2H0BA 2FQPA 2O1QA 2WINB 4XCAA 2JIJA 4HBNA 3QH6A 1RUC1 2KM2A 2A3XA 3KLSA 4IESA 4BQ5A 3RZMA 1DP0A 1SBEA 1S0CA 2DUQA 2FDJA 2D6KA 1LHUA 1W06A 3J4UH 3VBSA 1LGNA 1GANA 2VL4A 2VH9A 4PF5A 3WDWA 1RUF1 4RFRB 4Z82A 1FXZA 5C33A 2IVIB 3NKTA 4IV3C 3FBMA 2PYTA 1W8FA 3AMPA 2YPJA 3CF6E 4GD4A 2VMDA 3P3PA 4DIQA 3RSJA 5J36A 2TUNA 2V5YA 3ZX7A 4JGYB 2CWSA 3GCWA 5FJKA 4Q26A 2WO3A 2W3JA 1GSLA 3JBG1 3THDA 1W2TA 4BQYA 5JXIA 5HCHA 1L3JA 1DQ2A 1HB2A 3K77A 4PIYA 4LIUA 5F2SA 3HMYA 5I8SA 4IEXA 4XQDA 3ZYBA 3U4XA 1K5MC 1FMD1 1QJY1 5D8AC 5FREA 4MGQA 3VBOC 5ABJC 1IKPA 4YVSA 3B94A 1ZZ6A 1SBFA 2A3YA 3CIHA 2KXLA 4B8EA 1OVSA 1NQJA 3K4DA 4KH9A 2B5HA 2W94A 5C71A 3C7HA 4NPMA 2Y26A 1NT0A 1AVBA 1L7QA 4QGMA 3JU9A 3T2OA 3VBFB 4M3CF 1L7LA 2I07B 1CPNA 5L36A 3W58A 1R083 2VGDA 3NNJA 5IVCA 1H9WA 1AYM3 2ZEXA 2BU9A 4JTNA 4P9YA 3VBSC 1QJX2 1W8TA 4LO5B 3AKRA 1EPWA 3VDDA 4YSFA 4OQ8A 3HNMA 3I2IA 3W20A 2ZX1A 3FLPA 4H55A 3I54A 5CFCA 5I8TA 1TE1B 3CJIB 4XJ8A 4UFHA 4LBKA 2ATFA 2MPFA 2Q1ZB 3N7MA 2WS91 1J58A 1NCQA 1OA2A 5IVYA 5AC92 2QQOA 4MUVA 3WNOA 5JZGA 3OYWA 4UYBA 1RUI1 3M8LA 5FLHA 5C70A 4GULA 3NNMA 1WMXA 4Y5Z0 4GA9A 2GNDA 5DAWA 3RZZA 3ZR5A 1KFUL 1ULFA 5A33A 3AYEA 2V4VA 1H1IA 4Y1VA 3H7JA 3ZSEA 3E6DA 5FR3A 1M06G 2CAVA 2VZOA 2O14A 3R4SA 2RR12 3M4FA 3U4SA 1COV2 1GNYA 4WVMA 4YVSC 2WSUA 1K42A 2Y0OA 1U5IA 4QPIA 1C1LA 1UY1A 3I8TA 1OD5A 1REDA 3ZFFA 4CDXA 4YM1A 2GAUA 2KD7A 3DPRA 4WM8C 2LRPA 2IUWA 2BERA 2HH9A 3WLUA 3JD71 2WZR3 4DMIA 2WQ4A 1IQAA 5E6HA 4V2VA 2P17A 3VDDC 1L7RA 4FPCA 5CFCC 3D6EA 3P1IA 3HWJA 4W6XA 4C1XA 5I0SA 1KRIA 4AHZA 3U37A 1GYKA 3IBMA 1HQWA 1IPSA 1NCQC 4NN0A 3WNXA 4Y24A 4DUWA 2W1QA 4DEVA 1QU0A 1SEFA 3FE5A 2PHLA 2EAKA 1XXNA 4Z8BA 3JQXA 2JX9A 1ZBE2 4AEMA 1B35A 1SFYA 1CJDA 2OS2A 2XKPA 3ELNA 3J7MA 1PO12 4H2AA 4Z1VA 2EIEA 3ZN6B 1W9WA 3D3AA 3AKQA 4NHMA 4WV8A 1F9KA 4E4HA 3IM0A 1BKZA 3WVJA 5FYZA 4XZUG 4ZU7A 1UF2C 2D3SA 1MS5A 3ZSJA 4BA6A 4XFIA 3POYA 1DGWX 1XJAA 2WLQA 4OMCA 1ZZCA 3OSDA 4QPIC 1UD1A 1UO9A 1WLTA 4B7KA 4FI9A 3GALA 4FTEA 4CDXC 3ILRA 3ZFFC 1S1AA 1LOAA 1WKYA 3DPRC 3H0OA 5AC91 3VHPA 4S2GA 2GC2A 2A1XA 2CTVA 2YBKA 5LA9A 3ZXJA 2CWMA 1VBE3 2J22A 1FV2A 1XNBA 2VTXA 2VZTA 4LE4A 4XW3A 5FUPA 1KGYA 5ANNA 3U75A 4N43A 2ZEWA 4IEUA 2RR11 1XNKA 1IG0A 3HT1A 1COV1 1JI6A 4FPYA 1H2KA 3C7FA 5C5UA 5K9YA 2VECA 1ZZBA 4A4AA 4M0NA 3CZUA 5JCTA 1VRH3 1K45A 3ZYRA 4YRDA 3K2OA 1B35C 4NE9A 3BOPA 1PGW2 1UW8A 4O9EA 2XR4A 1MVEA 3RMYA 2P3YA 3I3MA 3NJXA 4C91A 4ARYA 3AJZA 4AI8A 1UYXA 1JHJA 4QPGA 1V6NA 2XGXA 1HJFA 4YNIA 3SITA 2Y6JA 1QGLA 4JV4A 4MSVA 1RVF2 1H8TA 3OGGA 4W50A 4LOSA 1CR7A 5E89A 2HBTA 5K0UB 1JZ7A 4CDWC 3MIGA 1NA1B 3WG2A 5FQ0A 5I91A 4AF9A 2RM22 5LEJA 5FZ3A 3V0BA 3TN92 5FLIA 3LA3A 2Z42A 1TNFA 3AP7A 1UY4A 4UWDA 1SLBA 4META 4UW6A 5IK5A 1SLLA 4HKLA 5KR7A 2R0FA 1AR93 1KFXL 2D7FA 2VVFA 1PO11 2EA7A 1BK0A 1DZRA 4N43C 3A0NA 4URAA 5G04L 2WA4A 4S2DA 4HVOA 3X29B 5HBAA 5A6ZA 2UY8A 3HOBA 1VR3A 5F7UA 5FP3A 1AR61 2F4PA 3OGJA 2HYXA 2Y38A 3PUIA 1VAMA 4QX0A 2D97A 2YGLA 2PHRA 1HRV2 1W0NA 1DYKA 1QQP1 1GP4A 3AL5A 4Q4X3 5B2GB 2WJSA 2GSYA 2VMCA 2XJTA 2C1FA 3P3NA 2K2SA 3H7YA 4LKSA 1SPPA 4QPGC 3U1XA 2O8OA 2WNVB 3CKHA 3O5SA 4HKWA 3ZVXA 2WT2A 3NAPB 1PO23 3KT4A 1YYNA 4XACA 1IPJA 4J25A 2BGCA 1H8TC 2RS33 4LUMA 4S2HA 2VY0A 3ZO0B 4EV0A 3AZYA 1W9SA 4PHZA 1DBNA 3LIGA 3VHRA 3ZOIA 2XPJA 4MYEA 3ZPYA 2RJ2A 2ZGPA 2XJRA 2YHJA 1VBC2 2XJQA 3FBYA 2G1MA 3KSCA 3NW4A 3ZYIB 4FAHA 1V70A 1PGW1 4CXWA 3LPGA 4NPRA 4QWNA 5K4LA 1VBA3 2B45X 1VPHA 1U0AA 1RITA 3RZGA 1JHNA 1WMFA 2B8MA 4Y33A 4ZXKA 1KD7A 1D0HA 3ZLIA 3RJRA 1MQTB 1RVF1 1DZQA 2PN5A 2GP5A 2Q30A 3CJXA 2RMU3 1HX6A 3UYJA 4M00A 2RM21 4F3JA 1OOPA 1UU4A 5FYIA 2ZKLA 3GJAA 5FUNA 2E7QA 2X09A 3AL6A 5HPOA 4OI2A 1GR3A 4L92A 5FWJA 3SH3A 1LR5A 5T55A 5FMCA 1PM7A 3IPVA 1YNAA 2HLEA 4NAMA 3T3YA 2ID4A 4LKFA 2ZXQA 1D2QA 4CU9A 5FOJB 5HXVA 4JAAA 3VL9A 2J1RA 1ULPA 5A7WA 2ZA9A 3T4HB 4E2QA 1KJLA 4YG0A 4XC9A 2VQAA 5FZOB 1UY0A 3LSEA 5B4XA 3RYKA 2RVAA 1UKGA 3WF2A 3NL1A 4JX0A 3W5NA 2QCSB 1BJQA 2EXJA 2XG3A 3WP6A 1WA4A 4LK7A 4YZ5A 1QXPA 2QQKA 5DDJ2 3UNPA 4XQ4A 3B5LB 1D0GA 2VC9A 2A75A 2V5DA 2Y60A 1LOBA 3LDRA 5EFUA 3FJSA 3LWCA 4Q0VA 1SBDA 4MH0E 2IXCA 4IL7A 4DUVA 5FOBB 2W47A 3L2HA 4Q0UA 2WNUB 5EPAA 5CFDA 2HWC2 4ZKTB 1VBC1 1W6MB 2CV6A 1C8NA 2WKKA 1GUIA 3I59A 2VOVA 4HPKA 3GNEA 4JDMA 4AG4A 4XE9A 5BNNB 4NIDA 3CEWA 2VW0A 3VBUB 4FPEA 2RE9A 4CYDA 5BNOB 4DUXA 5E1RA 3VZKA 3T0AA 2WFF1 4WZCA 2C6SA 2VM9A 4DFSA 1SCRA 1CAVB 4NRMA 3RZKA 1ASJ3 2VNVA 4PLOA 5FYMA 3KM5A 5JSOA 4NHXA 3WP3A 4EWAA 3MGUA 4FO9A 1YQCA 2IC1A 4UFJA 1XPWA 4ATFA 3IIIA 2ADDA 2UWBA 3NNGA 1QKQA 1RXGA 1GWMA 3P5BA 5FYBA 1R1A3 3L9JT 3BUCA 4LIVA 1PX4A 2YFUA 3MW2A 1TQ5A 1VMJA 2WZ8A 1RUD2 4JTOA 4XAEA 1ALYA 4YLZA 3B3QE 1LTEA 2DCTA 4AEDB 3PHMA 3WNLA 3GZUC 3W59A 3PTRB 2FDFA 5FRAA 2FBEA 4PIZA 4CP0A 1X8MA 1URXA 3QBQA 2VTFA 5A1AA 1DYOA 1OPMA 4COZA 4PQ9A 1W9TA 2FZ2A 2IFRA 2JICA 4B1MA 3ILNA 1NUKA 4LO8A 2ZGOA 5F3EA 2JB8A 2P1BA 2HWB1 3ACGA 4AI0A 1HDKA 1POV0 4A3ZA 4YZ1A 4FTSA 2BYVE 5A3PA 4LR4A 5D1IA 4N53B 1TME1 3D4KA 4NIHA 2VUDA 2D93A 2Y6LA 4W65A 5DDJ1 4HVQA 3KMHA 4EQVA 1RUNA 2VW1A 1JYCA 1XNTA 2G9GA 2XLAA 5KC6A 4I2OA 3IAPA 2L9LA 2JG9A 1E5HA 1UXZA 1RUG3 1K5MB 5D8AB 5ABJB 1ZNPA 4OYUA 4FPHA 1AR73 2PAEA 3CO2A 5F9TA 4XBQA 2HWC1 1GKBA 2JE8A 5T3NA 3KB5A 5GZCA 2VQ0A 5LY1A 4W8JA 2X10A 1JUHA 3DL3A 4CDUA 1V6JA 4AFDA 1WCQA 2MEV2 4QQOA 4NOTA 5F5AA 4WVVA 4A7KA 3TEXA 5FP4A 5GZFA 1POV3 3PVBB 1CZTA 4N7UA 4QPYA 3AZZA 3EB7A 3PUAA 2O0OA 4X8PA 1LJ7A 4LHLA 3VV1A 4LT5A 3VZMA 3POEA 3ZYFA 3N4MA 3RYRA 1ZZ8A 4NIGA 1YHFA 3FLTA 4GJYA 4XJUA 5CZKA 1SLIA 1W9YA 1C8M1 4JHZA 3THTA 4R9BA 1W2AX 4K21A 1G7YA 3IKWA 4TZDA 5FZ0A 3GZTB 1RUD1 1PVC2 1RHI3 1TMF1 1Y3TA 1NE4A 1HV1A 2XH6A 3ES4A 3LFMA 5GLWA 5GZEA 5GZDA 3B01A 3RZHA 1N1YA 3POSA 2HEVF 5C3SA 3S6PA 1GP6A 5DZGA 1PZ9A 1XSRA 2XMLA 2BFUL 2FHRA 2JG9C 4KBBA 5BXXA 2XHNA 1GFF2 4BQ4A 3WG3A 1GNHA 1HW5A 5ACA2 3SNMA 1DCSA 1OLME 1X82A 3BCWA 2OPKA 2C9KA 2XLFA 4XUQA 1WLCA 1A78A 3ATGA 4YVSB 5C9AB 5I0RA 5FZGA 2E7TA 4BMEA 2G4IA 3MV01 1QDOA 2I2SA 3IDAA 1J1TA 2BDRA 1SQ4A 3LDKA 4WM8B 3APBA 2FZ1A 2A70A 5FP8A 1NKGA 4Q4V3 2W9XA 4EYUA 5LBFA 1MZEA 2FDHA 3O1PA 3OPWA 1ULEA 1Z7S2 3ZXDA 3VDDB 2ERFA 1BEV2 1S0GA 1W04A 1D7PM 3NV2A 1JOBA 1RUF3 4ZONA 2YC0A 4QD2A 5HCFA 3VKMA 4AR2A 3NNLA 4BXSV 1H6YA 1AF9A 3AP5A 2OQ6A 1WLDA 4RSUA 4AL9A 2D6MA 5FYYA 4QQHA 2PFWA 3AXEA 2X53S 3JBG3 5FY7A 1FV3A 1YEWA 3H8UA 2Y34A 5A33B 1CIWA 3KCXA 2O8QA 3VHOA 2CHHA 3A7QA 3HQXA 2RS13 3C7EA 3N9LA 3J9SA 3WQBA 4D7SA 1EYBA 1FMD3 1OI6A 1QJY3 1YUDA 2JXAA 5A3OA 2DWRA 3T1LA 3HQUA 4UXAA 3OUJA 3ZN4A 4A2UA 3BTXA 2EALA 3M3CA 3R4UA 1QH6A 3MPBA 4LE3A 1PZ7A 4KWKA 4DPNA 3QCWA 4A45A 1LB2A 1XQNA 3ZFFB 5BNPB 1W6OA 1PVC1 2NMNA 1Q3EA 2TEPA 4E8CA 1LECA 1JZ3A 5H9QA 1H2MA 4UT5A 3SH4A 3MI8A 1UN1A 3J7LA 3ZN5A 4XFFA 5F2WA 2ZGNA 2CL2A 2ZMNA 4PDWA 4QQ2A 2OZ6A 5ACA1 3GBGA 1K5JA 2KA3A 2YBPA 2ZGQA 5FY8A 4KU7A 2FDIA 1KITA 2EVXA 1CONA 2Q1FA 2DFCA 1CZSA 2YGMA 2WS93 1LOGA 1H6XA 3PTYA 4GKYA 4XEZA 5IVVA 3VUOA 1BVP1 2V09A 3OBZA 1WW5A 1ODMA 4Y1ZA 1V9U2 2HWF3 1RUI3 1B35B 4KBZA 3MFCA 1REEA 3V0AB 2JIGA 2DU1A 2B9UA 2PHUA 4JKKA 3VD3A 3ZXEA 1MPXA 4BK5A 4CP9A 4QGNA 5JSRA 1TG7A 1Z7S1 3LAGA 5T5OA 1BEV1 3B02A 5CU1A 1OURA 2D3PA 3WCSA 4MGYE 1GQHA 2E63A 3P6BA 5FBJA 1WBFA 1G9AA 1H1MA 4CDWB 2XVGA 1RB8G 2IXKA 1SLTA 4IGOA 5FKBA 2VOTA 3H3UA 4QX8A 1RUOA 3OBTA 2ZX0A 3B93A 2ARAA 2VUCA 3HEIA 5A7PA 4M4RA 3OPZA 4RQPA 1F5FA 2OXBA 3JD73 5FJHA 4LO7A 3H8XA 2DVFA 2QQJA 4RGGA 4YG3A 4LBLA 4PDWC 4N43B 4UW4A 1DLCA 1OUSA 3QOPA 3H3LA 2VW2A 1DGLA 1OC1A 2PMWB 5JR7B 4EN9B 3T09A 5GALA 4FFFA 1SDDB 2AH2A 5FIXA 2QUOA 5FZ9A 4CEYA 2UYBA 3HN1A 1YI7A 2GP3A 1WGPA 2DVBA 4B4RA 3DYOA 3ZSLA 2XUMA 3CL1A 3OEAA 3MW4A 3CDZB 4P5YA 4AFCA 4EE2A 2B4KA 3S5QA 2RS51 4UW5A 3WUDA 3BIWE 3WUCA 4N7IA 5FPZA 2AENA 4AFBA 1UOBA 4PJYA 3RJ2X 3OGRA 3SKVA 4E2GA 1JOPA 4EROA 3ZXGA 2RJKA 5F37A 4JRAA 3PUSA 4OCTA 3ZKYA 4QU2A 5FQ0B 4AK3A 2GZWA 4IEVA 1B09A 3V0BB 3MF9A 4IEZA 4MGIE 1N3OA 5LRRA 1V9U1 4PLNA 2HBUA 1LHVA 4RQPC 1YCIA 1WA6X 3NKGA 1MS9A 1NOVA 4L2NA 4XJ9A 1UKRA 2VNRA 2ARXA 2JWPA 2YC2A 3HR9A 5DUXA 3ZXFA 4GWNA 2GC1A 1I3HA 3ZYHA 1NCRA 4L0PA 4WM7B 2RR13 1COV3 4K3UA 1ENXA 4CCNA 4D8MA 4QKBA 2AC1A 4NMIA 5FUIA 4BQWA 1V6LA 5FO9B 1F15A 4CEYC 2YMZA 3IDCB 3DKQA 4E4SA 5EZWA 4GWMA 4CEWA 4HSJA 3PU3A 4ET7A 4XF3A 1PIV2 5BY5A 1GQPA 1ENSA 4LHKA 4D3WA 3IDEA 2F4LA 4FFIA 1JBCA 2PLV2 4LXLA 1BXHA 1SPPB 3GGLA 2WUHA 3M3OA 3PVNA 2A73B 4E2SA 5DZEA 1EV12 3ZFGA 3AKSA 2G9FA 4MX3A 1EAH3 1DGWA 1VAVA 4CCKA 2B39A 1IS4A 3HJRA 1VB4A 4XHXA 2E53A 5DN2A 5A1FA 1JZ6A 5DAXA 3ZM8A 2ZS6B 5DQ0A 1QNYA 2VCAA 3OGSA 4H3WA 2JE7A 3UK9A 1J59A 1XNAA 1OH3A 4A41A 2ZGLA 1UIKA 4M01A 2DF7A 4UBHA 4YZ4A 1NAEA 1PK6A 1VBD2 2Q8CA 1LOCA 3WW3A 4HFSA 4A6SA 1Q8QA 1NCRC 4BLJA 2A6VA 2PXJA 2VMFA 3DEMA 4YM2A 2DTYA 1H1AA 3MLJA 4CZSA 2WDBA 4I02A 1AR63 3L2YA 1QDCA 2W95A 1LULA 4EZHA 2UU8A 4CEWC 3VKFC 4YW5A 4LPLA 5CEHA 1UCXA 4RR3A 1W6NB 1QQP3 3GZEA 3VBHA 1LODA 3WSOA 1UOJA 4FOWA 1YFXA 4RS5A 5L9RA 3C3VA 4HKOA 5A3NA 4O9GA 1V6IA 4IE6A 2YXSA 1XE7A 3D0SA 1HRI2 1ZRDA 1CX4A 2GH2A 1YIPA 5JWPA 1G9DA 3IPVB 3ZFGC 1REFA 1GQGA 2W1UA 1KEXA 1ZBA2 1JYIA 4BWOA 3K3NA 3GM8A 1SHWB 5F6LB 1MS4A 5IT6A 4CUCA 1FYUA 5IHRA 2ZABA 2A6YA 4LBNA 5J48A 3AJYA 1RMU1 5CKNA 2ZHLA 1OBNA 5JI9A 1PM4A 3POFA 1PIV1 4P9IA 4BLIA 4OZXA 4OUEA 2XL7A 2ZX4A 4W6WA 2PLV1 2VZQA 5D2AA 4AOCA 4BQ1A 4CCLA 1QOOA 1XSQA 5C3OA 2XBO2 3PL0A 1DQ1A 4IEPA 4K40A 1W05A 3K75B 4KWUA 3S7EA 4M0HA 4CDQB 4I0AA 4P9JA 1YQ5A 3PVEA 4B4QA 4YVWA 2BNOA 4DNYA 4Q4Y2 4RR3C 3VBHC 2RM23 3R6SA 2FMDA 3K48A 3CQOA 1W8HA 1OH4A 2RG4A 1FPN2 3HAGA 3I59B 2GNTA 4HPKB 1VBD1 3SMHA 3O1OA 1AJKA 2EXHA 1OFNA 5KWRA 4XBLA 4XETA 2BNNA 1RUH2 5DUWA 1V00A 3MIDA 2WN2A 4J1WA 4CXXA 2Y6FA 3CHXA 4LBQD 4GALA 3K4AA 5JXJA 3POGA 2UYAA 4D69A 2DCKA 5JXGA 4QKNA 4NWVA 3NVCA 4WVWA 3LOBA 2VXJA 2QQNA 2GALA 2R062 3N3HA 4FVVA 5FMOS 5KXEA 2W52A 4NUBA 2BOJA 1ZM1A 4MHUA 4DINB 4NRQA 3RRDA 4UF0A 3VDAA 2OX0A 3EBRA 1YFUA 3WNPA 2MNGA 4E4ZA 3I3BA 1Z78A 3K4ZA 4O7XA 1D4M2 3Q8CA 2VZPA 3WHUA 3DCQA 5KBFA 3VDBA 1HLCA 2PAMA 4QHBA 3MW3A 3N36A 4TTGA 4RGKA 4YVWC 4C8DA 4A7YA 1O3TA 1ULGA 4BQ3A 1ZA7A 3ON7A 5FWEA 1U5ZA 5IFTA 5C4WA 1GICA 1GMMA 3BN6A 2Y6GA 3W5MA 1VBC3 1FNYA 5LW9A 2D3RA 5JZGC 4Q8KA 1VMHA 5JVVA 2A6XA 3IT8A 1JYTA 3ORJA 2XBO1 2GU9A 1F31A 3H42B 3F2ZA 3LQCA 4L8QA 2ADEA 4TLGA 5D21A 2WFF3 5GLTA 1BYHA 1ZVFA 3O0WA 5TSWA 4EN7B 1FATA 1QJX1 4Z07A 3WF0A 3EMRA 5F3GA 2R32A 2NYYA 3B9CA 4XCBA 5IW0A 4CCJA 4KG0A 4DRVA 3J8F2 2QZ3A 1OQDA 1ULCA 1YQ6A 4W6YA 1CAXA 4DXTA 4AFMA 5J98B 1FPN1 3EJKA 1MS8A 3R4DB 4AGRA 2NP0A 1D4VB 4BIOA 1C3HA 1LRHA 2DCZA 3OUHA 2C0ZA 1RUH1 2JDHA 3ZXLA 1N1TA 4CSWA 2RV9A 5C8CA 1W8WA 2EXIA 1UU5A 1OD3A 1VBB2 5FPUA 1OKQA 4Z2AA 1DGRN 3ITQA 1HIXA 4Q4W2 1WW6A 1UIJA 5FZ7A 5C4WC 2JG8B 1LESA 1UYPA 2A3WA 2HWB3 2R061 3E6BA 2ZZQA 3WCRA 3S0MA 1GZ9A 2G19A 1S4CA 4AHXA 5IVJA 3E97A 2D6OX 2R042 5JOZA 1AYN2 2YPDA 3FC0A 4DXZA 3A21A 3AC0A 5J3UA 1OFSA 1TME3 1VJ2A 2LROA 4H7LA 4FPKA 4P00B 4JGZB 4A44A 5CKQA 3UL2A 4C90A 1CAWA 4OHZA 5JPMB 4Q0QA 4COWA 1YJKA 5LEKA 1UPIA 2JKXA 1HN0A 4PT6A 2A7AA 1Q56A 1RUE3 1ST8A 4GMP1 4LBJA 3RWNA 4AGVA 4DY3A 5JDBA 1W8OA 1G86A 5IAVA 3RGBA 1NLSA 3LD8A 2HYKA 4Y4YA 5HV0A 2HWC3 4KU8A 4MVTA 3VZLA 4NHYA 3AMQA 2XQXA 1LHWA 3A4UA 2XLGA 4TYSA 3WINE 4BM8A 2Y8KA 3WDXA 1DYPA 2DV9A 1YC61 1ZRRA 1NZIA 3AKTA 3H50A 1XNCA 2VAUA 3M7AA 4YW4A 4IE0A 4FTBA 1ZBE1 2B9VA 5C5TA 4KG8A 3FUOA 3MICA 5C8CC 2DYCA 2HWE2 4HLTA 4I0BA 3JCIA 3OGVA 1QHDA 1BLZA 4QX7A 3LFIA 2Y64A 1AXZA 1QH7A 2ILMA 3LOIA 3AZWA 1DU3D 4NIIA 3VD4A 3WW2A 4BMBA 2VMHA 3HNYM 1C8M3 3J8F1 4LA2A 4ZZ5A 4Q27A 2BRTA 1AYM2 2YB7A 3AVRA 3VBRA 1MS0A 2P5BA 1RUD3 1TMF3 1SMVA 3AYDA 2VR4A 2E32A 5CVRA 4AEKA 1A8DA 3TB0A 4EN0A 3ALQA 1U5YA 3H1YA 4YWAA 4ZS3A 1VE0A 2XJSA 4RD7A 4YFWA 4G3YC 5FY5A 2IXHA 3F95A 3EHKA 1VBB1 1XBFA 2VOWA 2ORZA 2YY1A 1YFYA 3C8XA 4Q4W1 4XIKA 3O1SA 5EQUA 4QKDA 1R1ZA 3WNNA 1YWKA 2VZUA 4CVUA 1US2A 3IN9A 2ZEZA 1GZWB 3MIBA 5A7NA 4NHKA 1X50A 1W6PA 4XXPA 4YW7A 5J96B 3KVBA 3LGRA 2XONA 1LENA 1O4ZA 2VZRA 2J7MA 2R041 3BTZA 1G9CA 1AYN1 2C26A 2ZGSA 3VDCA 4LO6B 3BI3A 5EJ3A 4CRQA 1MR5A 1LCLA 5JPNB 4I3PA 1YQ8A 4M3CB 4XDOA 1H2NA 1JXNA 2VCBA 1QNWA 2R16A 4P02B 3E6CC 4PDWB 1LEDA 4YZ2A 4Y4RA 3AZVA 1JYVA 4P08A 2CSGA 4EWEA 4Y1YA 4FOYA 1HXS3 3VBRC 4G4FA 2QZ2A 4IQPA 1PZ8A 2VXRA 5IVBA 2PAKA 4LJHA 5FBZA 4ZY9A 5A32B 5A7SA 3TN91 2IWGB 4FXGB 3ZDVA 2VOKA 1VB2A 4Q5OA 4LULA 1XRUA 3SCGA 3UV9A 4K6BA 5H9SA 2BTVC 1CPMA 2ORXA 4MV2A 4Q8LA 4UAPA 2HWE1 4CP9B 3ENRA 1ONAA 2X5IA 4GH4B 4JDNA 4QHOA 1PGL2 3C7GA 2QFEA 3TOJA 1WCKA 4R8HA 4OI1A 2EIDA 3IMNA 2P3IA 1X9TA 4Y20B 2W68A 3H9AA 2EXKA 4HL0A 2BV4A 1HRV1 4E9KA 3RI8A 5J37A 3LE0A 2YU2A 4NRPA 1S0IA 1VMFA 3AMNA 4H14A 5CG9A 5FZMA 2VBDA 4AVBA 3OG2A 4L11A 4QXHA 2LW8A 2NN8A 4JGYA 1JU4A 2P3JA 1ENRA 2XWBB 3N9QA 4QM8A 4U36A 5DPNA 1QJFA 4DZGA 3CU7A 1QJU2 5LA1A 1VBE2 3RFRA 4BHPA 1BMV2 1U12A 1AXKA 3K3OA 1OMIA 3OUIA 4RHV2 3SXWA 5CADA 4A42A 1N3PA 3WY6A 3GJBA 2OW4A 1OT5A 1ACCA 5FZCA 2X05A 3SEEA 4AFAA 4CEYB 2W39A 1OOPC 3PDQA 1UYZA 3VZNA 2D6LX 4JVAA 2EAAA 2JDUA 4B7EA 4KWLA 3TNPB 4MO3M 2Y33A 1VRH2 3UESA 4AI1A 2R6QA 2SLIA 2X5IC 2LS6A 2OT7A 4NAOA 1Z7S3 2J1TA 3T0DA 1IHMA 4XF9A 4OHXA 3VBFA 4FXKB 5FK8A 1YFWA 5JUVA 4PI2A 1G9FA 3SCHA 1OQ1A 1Q8SA 5LBEA 5IYYA 4BZ4A 2J1VA 4BH9A 3WNKA 3TEZA 2P6HA 2PELA 2HKXA 2FD8A 2XHKA 3NWKA 4SBVA 4YGDA 4XUPA 4XDQA 3ZFEA 1W0PA 4XMIA 3ZDSA 4DEQA 1CAUB 2WO1A 3AB0A 2JJ6A 5JOXA 4JHTA 1NCRB 4QXKA 1OA4A 2A71A 3EXUA 4J6GA 3T1MA 3T2TA 1MEC3 4MHRA 2NPIA 3CNAA 5FY0A 1CGPA 1UMIA 4XFCA 2WL1A 1CESA 5EYYA 1V6KA 4KI5M 4LBOA 1IS6A 4IV3B 5CFDC 2H0VA 5SV5A 2XQRA 4NROA 1WUVA 1UYYA 5BPXA 1J3RA 1Z0HA 2WWSA 4FBFA 4AAXA 1TNRA 2VZ1A 1RUJ2 1OQEA 1DHKB 2E26A 2RS53 3KCYA 3ZYJB 4EN6B 3MF6A 1GWLA 3AXDA 1H4HA 4B1LA 4Z2WA 3ZFGB 1UX7A 1JTZX 1OLMA 1QJU1 5FZ4A 4IEOA 4I0WB 4AI9A 5FCCA 1BMV1 4OMDA 5I0UA 4RHV1 3FWEA 4F7ZA 2FCUA 3AYCA 1PO22 4XFGA 2VZVA 5IJRA 3VBOB 3UGHA 2RS32 5BNQA 4QB2A 3ZKUA 3LZZA 5FO8B 3ZFEC 2DVDA 2CAUA 2YYOA 1WWYA 3O1TA 2A5ZA 4DS0A 1X33A 1ZREA 1GNZA 1O8SA 2ES3A 5A6QA 4HK9A 4JDOA 4D0QA 4Y1UA 4KMQA 2VG9A 3IZOA 1H2LA 5T52A 1H9PA 2XJUA 3H1MA 5DZFA 5AVPA 4B4PA 4COUA 5HV4A 1TEIA 2JDKA 4YGEA 4XOGA 4MGSA 4XURA 1VBA2 3O12A 3VBSB 2J1EA 3ZN6A 5A6XA 1OUXA 4NR1A 4RR3B 3VBHB 3WR0A 3Q9OA 1UZYA 4I01A 2OA2A 4E4DX 2DDUA 5HI0A 4FPOB 4YARA 1UMZA 2WA3A 5FXZA 3WF1A 2RMU2 2UWCA 4AVVA 3FN9A 3ECQA 4HSLA 4QXBA 4ES9A 2QQPA 4SLIA 2IXIA 1WCSA 2WO7A 3BVCA 4TSVA 2D98A 3RVHA 2W2IA 4ZU5A 2VD7A 2EIBA 2YUEA 5FMDA 1G6NA 5FY9A 2PHXA 4JQRA 2NQYA 1G9BA 1I1EA 1XE8A 3VGIA 3IDBB 4QB1A 4D7YA 1F8VA 5LBCA 4QM9A 1JYWA 2R072 2J1SA 4TWTA 2P37A 4CDUC 2ZAHA 2D44A 3POIA 4LNVA 1RUJ1 5FZFA 2DVGA 2CGOA 1GOHA 4IV1A 4C0BA 4UBGA 4RA0A 2LM3A 2IVJA 2DUOA 2XB6C 4O61A 3LPFA 1RUC3 3WV6A 1CIYA 1IKQA 3NMBA 4LA3A 4YVWB 3HN3A 5I0DA 2OYZA 3H8RA 2BWAA 5CFCB 2BZDA 1OPOA 4C0HA 1F35A 3PMEA 2RS31 5L7OA 2Z2SB 4IETA 2AUYA 4YZ3A 3WX5A 5JIAA 5L19A 4FPLA 5FPAA 1NCQB 4AZZA 3U14A 5K0UA 5EV7A 4HXCA 5JZGB 3OYWB 1UQXA 2DURA 1VLNA 2MEV1 2ZCWA 2ZACA 1E5IA 3I2HA 2WZPP 2ZOEB 3WQ7A 1O5LA 4LUKA 2BW8A 2TNFA 5L9BA 4DXSA 1MS3A 1PNGA 4H7MA 3VZOA 1AHSA 3MHZA 4XF0A 4AVCA 2V72A 2WQZC 1S2BA 4WVMB 4MG2A 1RMU3 1DQ6A 5F32A 5F3IA 5GKAC 3RDIA 2A6WA 4QPIB 4Q1RA 1ASJ2 1M4WA 2RDSA 3DUIA 5K7PA 5A3TA 2X8KA 3HPNA 2RMU1 1YI9A 2PLV3 4CDXB 3T4VA 2J42A 3GZAA 1PMIA 4COVA 3DPRB 2ZGRA 4IV1C 3PLQA 1W39A 1R1A2 5I0TA 3OF1A 1GZCA 1Y9GA 5JI7A 3WP4A 2YDEA 2ZGMA 2ZZJA 4YW6A 1VAKA 4IUGA 1YQ2A 2WNVA 4XYXA 5JR2A 1TVGA 4GB32 5KHIA 5L7OC 3I49A 1XU1A 3JUUA 4LMFA 2PQSA 1HN1A 1S0EA 3PUQA 5K0UC 2R071 1CVNA 1NE6A 2PHFA 4NJ4A 2VZ3A 1VBD3 1O6UA 2OVUA 4K8RB 1WW7A 2GNBA 4INDA 4D94A 4FOQA 1CD3G 3CZJA 3PNAA 5CA6A 3KF5A 3BTYA 1N3QA 1GZTA 1KDKA 1LNSA 4XQWA 1GOGA 1KS5A 3OBRA 3ZXAC 5BYNA 5FP9A 3Q8AA 1FI2A 2DTWA 3NQHA 4IGQA 1I5ZA 1QWRA 3KZ4C 4PQQA 3J26N 3VN4A 4CCOA 5FZDA 3KF3A 1MQTA 3LA7A 2AEYA 4V1PA 2UURA 1AR82 5FYCA 1RUG2 3U78A 3ZMOA 4AI2A 1XB9A 1Y43B 3DECA 5DABA 5DG1A 5SV8A 1W3XA 4CUGA 1AL0G 3M2MA 4W4ZA 1APNA 2WLPA 2ZPXA 3PMSA 2H6BA 2HJIA 2JD4A 1UL9A 2OPWA 4P9LA 5C8CB 5C3RA 3NNFA 4AQSA 2ZTNA 4ZU4A 3I3QA 5FZIA 3KT7A 2WNVC 3LA2A 3KCCA 1VIWB 3IAQA 2FMYA 2J1AA 2MHFA 1X9PA 2WQ8A 4TXWA 3N35A 3UJOA 1JH5A 2PHWA 3K51A 4RN5A 3LEIA 4MGZE 1VALA 3QLQA 3VKNA 1ZA4A 2C4XA 1VP6A 4DO0A 4PCRA 4Y26A 1IOAA 1O4YA 3HT2A 4HG6B 5LZ6A 1ODNA 1W99A 1S2KA 2XBO3 1JYNA 1R1A1 1W8UA 3KT1A 4IXLA 5FZOA 1CAWB 1NZCA 3OPTA 4LO4B 2BNMA 4QPGB 1HQLA 1EY2A 1PVXA 1QJX3 1SFNA 4QX1A 4F8AA 5DAPA 4GB31 1H8TB 3BYWA 3KS7A 2XKOA 4M3CE 1NX9A 2AR6A 1CX1A 4YW1A 3ES1A 1N1SA 2FCVA 5FZBA 3RI9A 1S0BA 1Y4WA 4RGAA 5AC93 5KHKA 5KXDA 1N1VA 1UU6A 4N8MA 1XYOA 2BVBA 2W08A 3KQ4B 4GMP0 4QB6A 5FZKA 1WLWA 2WNUA 3SH5A 4AWDA 2AZ5A 2VUAA 4LK6A 1W6MA 1SLAA 2WN3A 3RZJA 3ABZA 5APAA 4IEQA 1JW6A 4MGKE 3BPZA 4OI4A 3CMGA 1GP5A 4QDQA 4HN1A 3B69A 4EWDA 5L9VA 2ETEA 1QOTA 2LUWA 3FHQA 2Y6HA 4XIOA 5FK7A 5LA0A 1OKOA 3PURA 4Q4V2 2VUJA 1NQDA 2R063 3NJVA 4QX5A 4FFHA 3SEPA 1UXXX 3WDVA 1Q8OA 3V56A 3WZ1A 1CAVA 2F17A 3AX4A 3I2FA 1CJPA 1AR81 2DCJA 5AFBA 4HVRA 3JB8A 4GXLA 5FYUA 3SCFA 5IATA 1CWPA 3O7OA 4UI9L 4ZZ8A 5IAXA 4I3GA 3Q8EA 4OLLA 2R7EB 4CU7A 5F5QA 2R0HA 3KGLA 1O8PA 3BALA 3HQRA 5GLZA 2FCTA 5A3WA 4GMP3 3VB9A 1JUIA 2XL9A 1W2NA 4XFBA 4AEJA 4BQXA 3DYPA 3ZMNA 3RNSA 4LTAA 4XHBA 3U11A 5EYXA 2RS12 2FDGA 1ND3A 1RJ7A 2D6NA 3I97A 1JZ8A 1QJY2 3ZIWA 1W28A 4Q0PA 3E1F1 1ZYBA 2VVDA 3TYJA 2WNUC 3BB6A 5JMCA 1ZBE3 3N9MA 5EJZB 3RYPA 1J1LA 1K3IA 1PO13 2JDZA 1DG6A 2LALA 4K9SA 5EJ1B 4ISRA 4N53A 2ZX2A 2QDNA 1LGCA 5FXVA 3FL7A 2VMEA 3QACA 3AZXA 4P9GA 2E6VA 1OOPB 3DN7A 5M0TA 2GH8A 3KHCA 2VZSA 5ABJA 3I2KA 5EHDA 5L73A 1R092 4XBNA 2WS92
chains in the Genus database with same CATH topology
1I5PA 2JKXA 4MOAA 4PT6A 1XPWA 2OKXA 3IIIA 3NNGA 1W8OA 2JD9A 2BBAA 1J83A 1PX4A 2J1UA 2YFUA 2WZ8A 2XQXA 4CU6A 2Y8KA 3WNLA 1XC6A 1JYXA 2B9VA 2YG0A 2WZEA 2VTFA 3T2PA 5A1AA 4CUAA 2WBKA 1DYOA 2WAAA 3OGVA 4DXRA 1W9TA 2Y64A 1NUKA 1K12A 3K46A 3VD4A 4BDVB 3HNYM 5DMYA 4ZZ5A 3ACGA 2YB7A 4A3ZA 2VQTA 2VR4A 3LEKA 2E32A 3UETA 5IFPA 4ZXEA 2Y6LA 3T08A 1XNTA 3IAPA 2L9LA 1UXZA 4MADA 2ORZA 3C8XA 4OYUA 2VO5A 3WNNA 2VZUA 4CVUA 1US2A 2ZEZA 2W1SA 2JE8A 5JMOA 2W87A 3FHAA 4W8JA 4M4PA 2X10A 2XONA 1WCQA 2VZRA 1R64A 2J7MA 2C26A 3VDCA 1F4HA 3A23A 1J84A 2VCBA 1CZTA 3EB7A 4P02B 3ACHA 4XUNA 1JYVA 4P08A 2WAOA 3MUY1 2BGOA 5CZKA 4JHZA 4JKLA 4JKMA 3OB8A 3T2QA 3JXSA 4ZY9A 4E8DA 4CUBA 3NRUA 3ACIA 2E31A 1UY2A 1UZ0A 2ORXA 3MO4A 4XUTA 4UAPA 5C7GA 2XHNA 1UMHA 1UY3A 4BK4A 2QQLA 2WABA 3DYMA 3WEZA 3C7GA 2JDAA 3GXUA 4XUQA 2C9KA 2EIDA 1IQDC 1T2XA 1BHGA 3MV01 3ETPA 3IDAA 2W92A 3LE0A 2BGPA 3MBWA 1NKGA 2W9XA 2Z4FA 4QDRA 3OG2A 4A6OA 3WF4A 2LW8A 2WYSA 2YC4A 1JU4A 5J1XA 1D7PM 1US3A 3BGAA 5DPNA 5LA1A 1O59A 2CDPA 3C7OA 4BXSV 4A42A 1H6YA 1CX1A 2X05A 1OT5A 3SEEA 2YFZA 1UYZA 2E33A 3J7HA 4GZ9A 1PMHX 3A22A 1EUUA 2VJXA 4MO3M 3A7QA 3UESA 3C7EA 3WNMA 1F4AA 2LS6A 2QQIA 3WQBA 4UOJA 3T0BA 2J1TA 3T0DA 2Y6KA 5JUVA 5IYYA 4ARXA 2J1VA 3WNKA 4A45A 4E8CA 1JZ3A 4XUPA 3VD7A 2VQUA 1DP0A 4DEQA 2WO1A 2VL4A 4BJ0A 1CZSA 2VMDA 1H6XA 1UMIA 2WO3A 2W3JA 4KI5M 2ZEYA 3THDA 1UYYA 5JXIA 4AAXA 2VZ1A 3K77A 4JKKA 3VD3A 2E26A 1MPXA 4BK5A 3GDBA 1TG7A 4XUOA 1PX3A 1JU3A 4MGQA 1UX7A 3CIHA 3P6BA 4OMDA 5B4NA 3K4DA 4QX3A 2XOMA 3I2JA 3OEBA 2W94A 5C71A 3C7HA 2VOTA 5IJRA 1L7QA 2VZVA 3THCA 3T2OA 3EYPA 4QB2A 3HEIA 4M4RA 1ULOA 1EUTA 2QQJA 2ZEXA 4OZOA 3HNMA 1DLCA 1UWWA 3I2IA 1O8SA 4D0QA 4KMQA 4QDSA 3T09A 4XVHA 1SDDB 4MGSA 4XURA 2J1EA 2QQOA 3WNOA 5C70A 2DDUA 3DYOA 4GWIA 3OEAA 4P5YA 2V4VA 3CDZB 3WF1A 2B4KA 2VZOA 3FN9A 3ECQA 1GNYA 3OGRA 3SKVA 1K42A 1GU3A 2EIBA 1UY1A 2KD7A 2VCCA 2BERA 4QB1A 3I2GA 1JYWA 2J1SA 2YC2A 4GWJA 4LQRA 1L7RA 4L0PA 1GOHA 3P1IA 4D8MA 3LPFA 3U37A 5FUIA 1CIYA 4DUWA 2W1QA 4DEVA 5I0DA 3HN3A 4YPJA 2BZDA 4ET7A 2QBXA 1GQPA 4QAWA 5LA2A 2EIEA 1W9WA 3GGLA 3D3AA 5EIYB 2WUHA 4XZUG 3I2HA 4OMCA 3HJRA 1JZ6A 5DN2A 4DXSA 4FI9A 3ZM8A 1SG3A 1WKYA 2V72A 5DQ0A 2VCAA 3OGSA 1XNAA 4A41A 4DUXA 2J22A 1NAEA 2W46A 2VZTA 1RYYA 3HPNA 1KGYA 1JZ2A 3WF3A 2ZEWA 2VMFA 4RYDA 1JI6A 3IB3A 3VD9A 2WDBA 3C7FA 2W95A 4A4AA 3CZUA 4IUGA 1K45A 1YQ2A 4LPLA 5JR2A 1TVGA 3WSOA 2PQSA 1HN1A 3NJXA 4ARYA 2VZ3A 1UYXA 1JHJA 2Y6JA 2W1UA 1KEXA 3CZJA 4W50A 4QX2A 1OF4A 3GM8A 1JZ7A 1SHWB 4CUCA 5IHRA 1LNSA 1GOGA 3SKJE 3ACFA 3NQHA 4PQQA 5G05L 1UY4A 2EICA 4PF1A 4OUEA 1JZ5A 2VZQA 3VD5A 3DECA 5G04L 1P8JA 4LHSA 3HOBA 4QPWA 4W4ZA 5F7UA 3K75B 4KWUA 2HYXA 4CU8A 3PUIA 4QX0A 1W0NA 3IAQA 2J1AA 2WQ8A 4TXWA 3LEGA 5JXHA 3CQOA 4RN5A 3I3EA 3LEIA 1OH4A 2VMCA 4LKSA 2C4XA 3CKHA 3MUZ1 3MV11 1OF3A 4HG6B 1W99A 1JYNA 2WN2A 1W9SA 1PMJX 3K4AA 5JXJA 2CDOA 2DCKA 5JXGA 4QX1A 1W8NA 2RJ2A 2QQNA 1NX9A 3LPGA 2W5FA 3VDAA 3WNPA 3I3BA 3K4ZA 2VZPA 3PUHA 4QB6A 3VDBA 2WN3A 4TTGA 3ABZA 3OBAA 1JZ4A 2W1WA 4QDQA 3CMGA 5HXMA 3FHQA 5LA0A 2Y6HA 5IFTA 1GMMA 2X09A 3BN6A 2Y6GA 3NJVA 3W5MA 3SEPA 1UXXX 5HPOA 3I2FA 2DCJA 2QQMA 2WO2A 2HLEA 3HNBM 3LQCA 3F2ZA 2ID4A 4UI9L 2ZXQA 4ZZ8A 4CU9A 4CU7A 2R7EB 1CZVA 1O8PA 2J1RA 1ULPA 3WF0A 1UY0A 3DYPA 5B4XA 2RVAA 3WF2A 4DXTA 3I97A 2W91A 1JZ8A 4JX0A 3W5NA 3E1F1 2QQKA 5LCWL 3UNPA 5EJZB 1GOFA 2VC9A 2RV9A 2V5DA 1K3IA 1OD3A 4Z2AA 5EJ1B 4DUVA 2W47A 3FL7A 2VMEA 3I3DA 1GUIA 4AG4A 5CYYA 3A21A 3AC0A 2VZSA 3I2KA 4P00B 3T0AA 4A44A 2VM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I5P A;  2JKX A;  4MOA A;  4PT6 A;  1XPW A;  2OKX A;  3III A;  3NNG A;  1W8O A;  2JD9 A;  2BBA A;  1J83 A;  1PX4 A;  2J1U A;  2YFU A;  2WZ8 A;  2XQX A;  4CU6 A;  2Y8K A;  3WNL A;  1XC6 A;  1JYX A;  2B9V A;  2YG0 A;  2WZE A;  2VTF A;  3T2P A;  5A1A A;  4CUA A;  2WBK A;  1DYO A;  2WAA A;  3OGV A;  4DXR A;  1W9T A;  2Y64 A;  1NUK A;  1K12 A;  3K46 A;  3VD4 A;  4BDV B;  3HNY M;  5DMY A;  4ZZ5 A;  3ACG A;  2YB7 A;  4A3Z A;  2VQT A;  2VR4 A;  3LEK A;  2E32 A;  3UET A;  5IFP A;  4ZXE A;  2Y6L A;  3T08 A;  1XNT A;  3IAP A;  2L9L A;  1UXZ A;  4MAD A;  2ORZ A;  3C8X A;  4OYU A;  2VO5 A;  3WNN A;  2VZU A;  4CVU A;  1US2 A;  2ZEZ A;  2W1S A;  2JE8 A;  5JMO A;  2W87 A;  3FHA A;  4W8J A;  4M4P A;  2X10 A;  2XON A;  1WCQ A;  2VZR A;  1R64 A;  2J7M A;  2C26 A;  3VDC A;  1F4H A;  3A23 A;  1J84 A;  2VCB A;  1CZT A;  3EB7 A;  4P02 B;  3ACH A;  4XUN A;  1JYV A;  4P08 A;  2WAO A;  3MUY 1;  2BGO A;  5CZK A;  4JHZ A;  4JKL A;  4JKM A;  3OB8 A;  3T2Q A;  3JXS A;  4ZY9 A;  4E8D A;  4CUB A;  3NRU A;  3ACI A;  2E31 A;  1UY2 A;  1UZ0 A;  2ORX A;  3MO4 A;  4XUT A;  4UAP A;  5C7G A;  2XHN A;  1UMH A;  1UY3 A;  4BK4 A;  2QQL A;  2WAB A;  3DYM A;  3WEZ A;  3C7G A;  2JDA A;  3GXU A;  4XUQ A;  2C9K A;  2EID A;  1IQD C;  1T2X A;  1BHG A;  3MV0 1;  3ETP A;  3IDA A;  2W92 A;  3LE0 A;  2BGP A;  3MBW A;  1NKG A;  2W9X A;  2Z4F A;  4QDR A;  3OG2 A;  4A6O A;  3WF4 A;  2LW8 A;  2WYS A;  2YC4 A;  1JU4 A;  5J1X A;  1D7P M;  1US3 A;  3BGA A;  5DPN A;  5LA1 A;  1O59 A;  2CDP A;  3C7O A;  4BXS V;  4A42 A;  1H6Y A;  1CX1 A;  2X05 A;  1OT5 A;  3SEE A;  2YFZ A;  1UYZ A;  2E33 A;  3J7H A;  4GZ9 A;  1PMH X;  3A22 A;  1EUU A;  2VJX A;  4MO3 M;  3A7Q A;  3UES A;  3C7E A;  3WNM A;  1F4A A;  2LS6 A;  2QQI A;  3WQB A;  4UOJ A;  3T0B A;  2J1T A;  3T0D A;  2Y6K A;  5JUV A;  5IYY A;  4ARX A;  2J1V A;  3WNK A;  4A45 A;  4E8C A;  1JZ3 A;  4XUP A;  3VD7 A;  2VQU A;  1DP0 A;  4DEQ A;  2WO1 A;  2VL4 A;  4BJ0 A;  1CZS A;  2VMD A;  1H6X A;  1UMI A;  2WO3 A;  2W3J A;  4KI5 M;  2ZEY A;  3THD A;  1UYY A;  5JXI A;  4AAX A;  2VZ1 A;  3K77 A;  4JKK A;  3VD3 A;  2E26 A;  1MPX A;  4BK5 A;  3GDB A;  1TG7 A;  4XUO A;  1PX3 A;  1JU3 A;  4MGQ A;  1UX7 A;  3CIH A;  3P6B A;  4OMD A;  5B4N A;  3K4D A;  4QX3 A;  2XOM A;  3I2J A;  3OEB A;  2W94 A;  5C71 A;  3C7H A;  2VOT A;  5IJR A;  1L7Q A;  2VZV A;  3THC A;  3T2O A;  3EYP A;  4QB2 A;  3HEI A;  4M4R A;  1ULO A;  1EUT A;  2QQJ A;  2ZEX A;  4OZO A;  3HNM A;  1DLC A;  1UWW A;  3I2I A;  1O8S A;  4D0Q A;  4KMQ A;  4QDS A;  3T09 A;  4XVH A;  1SDD B;  4MGS A;  4XUR A;  2J1E A;  2QQO A;  3WNO A;  5C70 A;  2DDU A;  3DYO A;  4GWI A;  3OEA A;  4P5Y A;  2V4V A;  3CDZ B;  3WF1 A;  2B4K A;  2VZO A;  3FN9 A;  3ECQ A;  1GNY A;  3OGR A;  3SKV A;  1K42 A;  1GU3 A;  2EIB A;  1UY1 A;  2KD7 A;  2VCC A;  2BER A;  4QB1 A;  3I2G A;  1JYW A;  2J1S A;  2YC2 A;  4GWJ A;  4LQR A;  1L7R A;  4L0P A;  1GOH A;  3P1I A;  4D8M A;  3LPF A;  3U37 A;  5FUI A;  1CIY A;  4DUW A;  2W1Q A;  4DEV A;  5I0D A;  3HN3 A;  4YPJ A;  2BZD A;  4ET7 A;  2QBX A;  1GQP A;  4QAW A;  5LA2 A;  2EIE A;  1W9W A;  3GGL A;  3D3A A;  5EIY B;  2WUH A;  4XZU G;  3I2H A;  4OMC A;  3HJR A;  1JZ6 A;  5DN2 A;  4DXS A;  4FI9 A;  3ZM8 A;  1SG3 A;  1WKY A;  2V72 A;  5DQ0 A;  2VCA A;  3OGS A;  1XNA A;  4A41 A;  4DUX A;  2J22 A;  1NAE A;  2W46 A;  2VZT A;  1RYY A;  3HPN A;  1KGY A;  1JZ2 A;  3WF3 A;  2ZEW A;  2VMF A;  4RYD A;  1JI6 A;  3IB3 A;  3VD9 A;  2WDB A;  3C7F A;  2W95 A;  4A4A A;  3CZU A;  4IUG A;  1K45 A;  1YQ2 A;  4LPL A;  5JR2 A;  1TVG A;  3WSO A;  2PQS A;  1HN1 A;  3NJX A;  4ARY A;  2VZ3 A;  1UYX A;  1JHJ A;  2Y6J A;  2W1U A;  1KEX A;  3CZJ A;  4W50 A;  4QX2 A;  1OF4 A;  3GM8 A;  1JZ7 A;  1SHW B;  4CUC A;  5IHR A;  1LNS A;  1GOG A;  3SKJ E;  3ACF A;  3NQH A;  4PQQ A;  5G05 L;  1UY4 A;  2EIC A;  4PF1 A;  4OUE A;  1JZ5 A;  2VZQ A;  3VD5 A;  3DEC A;  5G04 L;  1P8J A;  4LHS A;  3HOB A;  4QPW A;  4W4Z A;  5F7U A;  3K75 B;  4KWU A;  2HYX A;  4CU8 A;  3PUI A;  4QX0 A;  1W0N A;  3IAQ A;  2J1A A;  2WQ8 A;  4TXW A;  3LEG A;  5JXH A;  3CQO A;  4RN5 A;  3I3E A;  3LEI A;  1OH4 A;  2VMC A;  4LKS A;  2C4X A;  3CKH A;  3MUZ 1;  3MV1 1;  1OF3 A;  4HG6 B;  1W99 A;  1JYN A;  2WN2 A;  1W9S A;  1PMJ X;  3K4A A;  5JXJ A;  2CDO A;  2DCK A;  5JXG A;  4QX1 A;  1W8N A;  2RJ2 A;  2QQN A;  1NX9 A;  3LPG A;  2W5F A;  3VDA A;  3WNP A;  3I3B A;  3K4Z A;  2VZP A;  3PUH A;  4QB6 A;  3VDB A;  2WN3 A;  4TTG A;  3ABZ A;  3OBA A;  1JZ4 A;  2W1W A;  4QDQ A;  3CMG A;  5HXM A;  3FHQ A;  5LA0 A;  2Y6H A;  5IFT A;  1GMM A;  2X09 A;  3BN6 A;  2Y6G A;  3NJV A;  3W5M A;  3SEP A;  1UXX X;  5HPO A;  3I2F A;  2DCJ A;  2QQM A;  2WO2 A;  2HLE A;  3HNB M;  3LQC A;  3F2Z A;  2ID4 A;  4UI9 L;  2ZXQ A;  4ZZ8 A;  4CU9 A;  4CU7 A;  2R7E B;  1CZV A;  1O8P A;  2J1R A;  1ULP A;  3WF0 A;  1UY0 A;  3DYP A;  5B4X A;  2RVA A;  3WF2 A;  4DXT A;  3I97 A;  2W91 A;  1JZ8 A;  4JX0 A;  3W5N A;  3E1F 1;  2QQK A;  5LCW L;  3UNP A;  5EJZ B;  1GOF A;  2VC9 A;  2RV9 A;  2V5D A;  1K3I A;  1OD3 A;  4Z2A A;  5EJ1 B;  4DUV A;  2W47 A;  3FL7 A;  2VME A;  3I3D A;  1GUI A;  4AG4 A;  5CYY A;  3A21 A;  3AC0 A;  2VZS A;  3I2K A;  4P00 B;  3T0A A;  4A44 A;  2VM9 A; 
#chains in the Genus database with same CATH topology
 2AAC A;  3E5U A;  4COY A;  4DQA A;  4LBM A;  4YM0 A;  1AUY A;  1DFQ A;  2X5I B;  4AGG A;  2HWF 2;  1BCX A;  1OXC A;  1V6O A;  4Q4W 3;  4OVE A;  4QT6 A;  2QTW B;  5A3M A;  2JD9 A;  3WG1 A;  4EJR A;  1FT9 A;  4Q4V 1;  1J83 A;  3DV8 A;  1QOS A;  1ND2 A;  2J1U A;  5LK5 A;  1ND3 C;  4R9C A;  5A7W B;  5JLV A;  3NO8 A;  4AE2 A;  4I09 A;  1AL2 2;  1UAI A;  1MS1 A;  2R04 3;  3AK0 A;  4HZF A;  1JYX A;  1AYN 3;  4YW3 A;  3TNQ A;  3HD8 B;  5CBL A;  2YG0 A;  1MAC A;  1PK6 C;  3ST7 A;  4CUA A;  1FOD 2;  3AVS A;  3I2D A;  5FZH A;  4DXR A;  4LOR A;  3ASI A;  4KGQ A;  2I74 A;  4N53 C;  4N9I A;  5A7O A;  2EIG A;  4OHV A;  1K12 A;  3K46 A;  1EV1 1;  3JD7 2;  4IER A;  4MXW A;  1RVF 3;  3HBK A;  4FFG A;  1O3S A;  5ANQ A;  2V73 A;  4LEJ A;  2RS1 1;  3AFG A;  2XWJ B;  2VQT A;  1W0O A;  2CY6 A;  1UZW A;  3LEK A;  3WDU A;  1ZX5 A;  3MIH A;  3TN9 3;  3UET A;  5IFP A;  5CFD B;  1YRZ A;  4RS5 C;  1ENQ A;  2KR2 A;  4CP2 A;  2YV8 A;  5C9A A;  1QJZ A;  1BBT 2;  3USS A;  4FQ4 A;  3CBN A;  4XF1 A;  1WBL A;  1IPK A;  2HWE 3;  2QDR A;  4MAD A;  3FLR A;  3Q8F A;  3KV5 A;  3OD4 A;  4WM8 A;  1Q8P A;  4WBB A;  3ME2 A;  1MVQ A;  3D5O A;  1ND2 C;  2W1S A;  5F1R A;  4K1Z A;  1TZO A;  3AP4 A;  2W87 A;  5DUU A;  3SC7 X;  4M4P A;  4BB3 A;  4CCD A;  4IW3 A;  4GIQ A;  1HRV 3;  1NLQ A;  3FMG A;  2BP6 A;  3GBW A;  3JQW A;  1LGB A;  3POW A;  4CP1 A;  1F4H A;  1O4T A;  1YLL A;  3A23 A;  3ZFE B;  1S0D A;  4YGC A;  1I9R A;  1R09 1;  3ACH A;  4JCK A;  3ZXK A;  1HRI 1;  1C57 A;  2JDM A;  2ZBJ A;  2XDV A;  5FTT C;  2HWF 1;  2WAO A;  5IK8 A;  5FMO L;  2BGO A;  4Y5S A;  3S7I A;  2RJL A;  4PIX A;  1RGS A;  1ZBA 1;  4JKL A;  3O1U A;  3AFK A;  4JKM A;  4UFM A;  3AYA A;  3IMM A;  4X6R B;  2Z5W A;  3EQE A;  3N7K A;  3JXS A;  4ONU A;  1GLH A;  4E8D A;  1AL2 1;  3NRU A;  1E57 A;  1QF3 A;  1XOY A;  1D2S A;  2GMP A;  2E31 A;  3ACI A;  1LHN A;  1W6Q A;  1UY2 A;  4KL1 A;  5C9A C;  3MFA A;  4CXY A;  1UZ0 A;  2ZHN A;  3RMX A;  2ZML A;  5C7G A;  1JMU B;  1DIW A;  2JDN A;  1UY3 A;  1FOD 1;  3UGG A;  3BOD A;  2QQL A;  2WAB A;  5BNP A;  2BBV A;  3DYM A;  1WCU A;  3GCX A;  3AM2 A;  2JDA A;  3GXU A;  3WEZ A;  3Q8B A;  1O3R A;  2DU0 A;  2D6P A;  3AMH A;  4EN8 B;  3FHI B;  2WSV A;  5F6K A;  1X8E A;  4P9W A;  4YG6 A;  2ZKN A;  4OHY A;  1IQD C;  5DXD A;  4ATE A;  1BHG A;  2JG9 B;  3TWI A;  4AVS A;  2YRO A;  3WW1 A;  2ET7 A;  1A8M A;  5DUV A;  4UFI A;  4YFZ A;  4P9X A;  3DGT A;  4Q4Y 1;  5FZ1 A;  1C5H A;  2QE3 A;  2Z79 A;  1AJO A;  4CCC A;  2HWD 2;  1EP0 A;  1EAH 2;  4AVA A;  1BQP A;  3MBW A;  3WQ1 A;  1LOE A;  1BBT 1;  5T5J A;  4CDU B;  3KV6 A;  4Y1X A;  4HOO A;  3WF4 A;  2YC4 A;  4JQT A;  4MZU A;  3KGZ A;  1JOJ A;  2WT0 A;  3FX3 A;  3MLL A;  1O59 A;  4FQZ A;  2CDP A;  3C7O A;  3V0A A;  4MLO A;  1OVP A;  2JB4 A;  4R4X A;  4XJW A;  2WWJ A;  1SLC A;  4BE3 A;  2XVK A;  3JB4 C;  4CE8 A;  2YFZ A;  3OD0 A;  4MGT A;  5FFO C;  1F5J A;  1IG3 A;  3J7H A;  3ZPO A;  1AX2 A;  1HQN A;  2Q8O A;  1AR6 2;  1O5U A;  1PMH X;  2VTX J;  2BEO A;  2DFB A;  2VNG A;  3UGF A;  5JOY A;  2VJX A;  1ZRC A;  4CDW A;  5IWF A;  2E51 A;  1BVV A;  1HB3 A;  3MYX A;  2QQI A;  2QVS B;  3WNM A;  1QQP 2;  5BNP C;  4UOJ A;  3T0B A;  4QQP A;  2YBS A;  2GMM A;  1D4M 1;  4QU1 A;  3U10 A;  3PVO A;  5DDJ 3;  5BNO A;  5IK7 A;  1QJU 3;  1LAJ A;  1WCD J;  4ARX A;  4RHV 3;  1WME A;  5FZA A;  5BV6 A;  3S57 A;  1ZRI A;  3KV9 A;  2PQQ A;  3ZYG A;  1JS9 A;  2RDQ A;  2Y0I A;  3M70 A;  4NO4 A;  3VD7 A;  2VQU A;  1IS5 A;  2Q1M A;  2VCM A;  2ZGU A;  4HK8 A;  3WQ0 A;  1GV9 A;  1RIR A;  1I6X A;  1V0A A;  3D0J A;  4IV1 B;  3VKO A;  2Q0A A;  3OCP A;  2PHT A;  1AX1 A;  4BJ0 A;  2ZX3 A;  3NJY A;  2BJS A;  3USU A;  5FPV A;  2HEY F;  4K8F A;  4LBQ A;  2ZEY A;  3ILF A;  3B7M A;  2VVE A;  3N9O A;  1R08 2;  4ITC A;  2HWD 1;  3DXU A;  5A70 A;  1EAH 1;  1LHO A;  1W2U A;  3VKL A;  4YGB A;  3WP5 A;  4ZPI A;  2PA7 A;  2Q8E A;  3GDB A;  4XUO A;  1PX3 A;  1JU3 A;  3THP A;  2VE1 A;  1ZRF A;  4PBP A;  4XPV A;  4IE7 A;  3O0V A;  5BNO C;  1S0F A;  4FPJ A;  5B4N A;  4QX3 A;  2XOM A;  3I2J A;  3OEB A;  1MZ5 A;  3TBD A;  3THC A;  2XVL A;  3EYP A;  4WM7 A;  5FZL A;  4BQ2 A;  1NXM A;  1ULO A;  2AEZ A;  1EUT A;  3G7D A;  1QXR A;  1S55 A;  2VPV A;  2WNE A;  5CNA A;  4DB5 A;  1C4R A;  1W6O B;  1RUJ 3;  4OZO A;  1OHF A;  1UWW A;  5A3L A;  4R9D A;  1RJ8 A;  1U5X A;  1X7N A;  1YXW A;  2C9A A;  2JEN A;  4FPG A;  3ZSK A;  4QDS A;  5DG2 A;  1AXY A;  5T5L A;  1S0J A;  3CLP A;  4Q0S A;  4XVH A;  2ZHM A;  1W9F A;  4Z92 B;  1PHM A;  3OY8 A;  2QKD A;  4NVP A;  2D43 A;  5FY1 A;  1UNB A;  4Y5T A;  5F8P A;  1LKN A;  4XF4 A;  3NST A;  2WZR 2;  4ES8 A;  1Q43 A;  3M1H A;  5C8W A;  4DRR A;  4FPF A;  3O0X A;  4GWI A;  2P3K A;  2YZ4 A;  4TLF A;  5FY4 A;  4Y22 A;  4G9S B;  2D5H A;  5FV3 A;  4GJZ A;  1CQ9 A;  1Y9M A;  2MEV 3;  5A80 A;  4YM3 A;  5C3P A;  3QH7 A;  4XJZ A;  3DXT A;  2BWC A;  4XXA A;  2ENR A;  1H4G A;  3KHB A;  3FFZ A;  4AW7 A;  1GU3 A;  5JIU A;  4BXF A;  1HJG A;  2ARC A;  1J3P A;  4Q29 A;  4PLM A;  1KQR A;  4OI0 A;  2VCC A;  4WM7 C;  1UOG A;  1N47 A;  5A6Y A;  1LEM A;  3I2G A;  2WFF 2;  2QJV A;  1R08 1;  3M3E A;  2NMO A;  4GWJ A;  1AYM 1;  3LEM A;  4LQR A;  2NM1 A;  1NG0 A;  4IE4 A;  3O14 A;  1PVC 3;  3RG0 A;  3VHN A;  4URT A;  3O1R A;  1QMJ A;  1W6N A;  4RQP B;  1OA3 A;  4Q2F A;  5E88 A;  1QEX A;  2GNM A;  1F2N A;  3BPS A;  3WT3 A;  5E8A A;  4R4Z A;  2JEC A;  4YPJ A;  4HN0 A;  5LB6 A;  2QQW A;  3A0K A;  1E5R A;  5ACA 3;  5KHJ A;  1Q5O A;  2QBX A;  4FT8 A;  5LK7 B;  3H8O A;  4QAW A;  5A7Q A;  4XIL A;  4AQ6 A;  2VU9 A;  5F3C A;  2QQU A;  4TN7 A;  1NYW A;  2R07 3;  5LA2 A;  3PJQ A;  4QHZ A;  3UKN A;  5EIY B;  3QD6 A;  3W9A A;  1X36 A;  2GN3 A;  4D6Q A;  5JOW A;  3LKJ A;  5DAV A;  4AQ2 A;  2HWB 2;  4LIT A;  5C3Q A;  2WNO A;  1A6C A;  1LU1 A;  4P5H A;  4JZR A;  3AMM A;  4D6R A;  3KV4 A;  3SLI A;  4QXC A;  3UKT A;  1SG3 A;  2CU5 A;  2G9Z A;  3NV1 A;  1TME 2;  5F5C A;  3VL8 A;  1BEV 3;  3WDY A;  5JSP A;  2WZR 1;  4CDQ A;  3LSD A;  2JEM A;  4KGG A;  2W46 A;  1UZV A;  1RYY A;  1FAY A;  1Y7B A;  2ZHK A;  2ZJC A;  2VBP A;  2VBB A;  4XTP A;  3TRS B;  4AHW A;  2RDR A;  3WF3 A;  1RUE 2;  1JZ2 A;  1O7F A;  4RYD A;  2RHP A;  3IB3 A;  3BU0 A;  2OII A;  3CJI A;  3VD9 A;  5GLU A;  4YW2 A;  4D6S A;  2WRA A;  2B46 X;  4AI3 A;  4RL7 A;  2PHD A;  3G6J B;  4JGY C;  2IXJ A;  3OJB A;  1PGL 1;  5FYV A;  1O3Q A;  3HBZ A;  3N9N A;  2ZMK A;  1QXJ A;  1AR9 2;  4V2W A;  3KD4 A;  3VLB B;  5HCB A;  1E5S A;  1KDM A;  2CNA A;  4IE5 A;  4CEW B;  1W3V A;  1WMD A;  3NV4 A;  4AXO A;  2XUE A;  2F6B A;  4K1Y A;  4AVT A;  3BKZ A;  1C8M 2;  1AX0 A;  3B00 A;  5CIS A;  4QX2 A;  1OF4 A;  2E9Q A;  1DZT A;  5HCA A;  1XYN A;  1YJL A;  4R52 A;  1TMF 2;  1HV0 A;  2K9Z A;  2UWA A;  5LAS A;  2R30 A;  2Q8D A;  2ARE A;  3KWV A;  4J1X A;  3SKJ E;  1W2O A;  1KS4 A;  2VNO A;  1DF0 A;  3ACF A;  2WYF A;  3VBF C;  3W21 A;  1RC6 A;  2P2K A;  3N7J A;  4Q4X 2;  5G05 L;  4XAB A;  4ZS2 A;  4GB3 3;  5FAX A;  4CDQ C;  1VBE 1;  1XND A;  1BZW A;  2EIC A;  4PF1 A;  3UJQ A;  4XTM A;  1H0B A;  1ND3 B;  1DQ0 A;  3VD5 A;  1JZ5 A;  3LF7 A;  4QMA A;  3RQ0 A;  3WW4 A;  2JE9 A;  4ZHN A;  1P8J A;  4LHS A;  2NLR A;  1V9U 3;  3CJI C;  4QPW A;  3MZH A;  3HVD A;  2LTN A;  1LOF A;  4PI0 A;  4OQ9 A;  1HKD A;  1PK6 B;  2ZGK A;  4BIS A;  4CU8 A;  2AYH A;  4ISQ A;  2XXZ A;  1VRH 1;  3SHR A;  2GC3 A;  1W8Z A;  3H3Z A;  1LU2 A;  1JN2 P;  3LEG A;  5JXH A;  3I3E A;  1QIQ A;  5FZ8 A;  3R0R A;  3S30 A;  2BVV A;  4BPZ A;  1HB1 A;  3AKP A;  4DY5 A;  3LB9 A;  1UPS A;  3R05 A;  1RL3 A;  3BOW A;  4N90 A;  3O1V A;  5FMB A;  4AQT A;  1AR8 3;  4YYO A;  3MUZ 1;  1RUE 1;  1OF3 A;  3MV1 1;  4IEY A;  5GZG A;  1IS3 A;  3V64 A;  1SAC A;  3T30 A;  4RS5 B;  1FNZ A;  1HXS 2;  1G8W A;  3POB A;  4XMA A;  5CAZ A;  5LWB A;  2UY9 A;  3ACL A;  1PMJ X;  2EF6 A;  2CDO A;  1A3K A;  1J3Q A;  3POJ A;  4L9B A;  4IDZ A;  4BIF A;  3S5A A;  2ZAA A;  1W8N A;  1SCS A;  4HON A;  4HET A;  2R1D A;  1ND2 B;  1AR9 1;  2W5F A;  4AHY A;  3KVA A;  1AZD A;  2XJP A;  4Q1P A;  2DVA A;  1UOF A;  3LIH A;  4FCA A;  4KNC A;  1DQ5 A;  3I7D A;  4LKD A;  2C5D A;  3PUH A;  1SFP A;  2JG8 A;  1LOF C;  1PGS A;  3C2U A;  2HEW F;  3OBA A;  1JZ4 A;  2BFU S;  1QJE A;  1YO8 A;  2W1W A;  3FUQ A;  4NHL A;  3WD5 A;  1WD4 A;  5HXM A;  3MIE A;  5J7M A;  2DBI A;  3ROU A;  4K7J A;  4MXW B;  4Q4X 1;  2JKB A;  4XAA A;  5F5I A;  4JGZ A;  2WWU A;  2YU1 A;  4P14 A;  5IVE A;  5LBB A;  1OSG A;  2P6C A;  3RS6 A;  4BCU A;  4BOW A;  2IXL A;  2QQM A;  3E5X A;  1PO2 1;  1NY7 2;  2WO2 A;  5DAQ A;  5FPB A;  5EWS A;  3HNB M;  2P34 A;  2JDY A;  4OHW A;  2BUK A;  1OLQ A;  3U0Z A;  1DDL A;  4XJA A;  3E5Q A;  2XJV A;  2D5F A;  5H9P A;  1T6B X;  1CZV A;  1NA1 A;  2B42 B;  3LCP A;  3D8C A;  2QNK A;  4QQL A;  3DF0 A;  5CKM A;  2CGN A;  4KQ7 A;  1DQ4 A;  1UX6 A;  4X6Q B;  1C28 A;  3VZJ A;  1YIF A;  5GLV A;  1OLR A;  1V6M A;  2E7A A;  4OUM A;  5CG8 A;  5FO7 B;  1VBA 1;  2W91 A;  4BYY A;  2VMI A;  5LRS A;  5LCW L;  4O65 A;  2JG8 C;  1Y9Q A;  1PIV 3;  1HXS 1;  1GOF A;  2DCY A;  4X8N A;  4UF0 B;  4WVZ A;  5C6C A;  1W03 A;  4FP2 A;  4CCE A;  3B9I A;  3RWK X;  2OUJ A;  1EV1 3;  4JGZ C;  3NJZ A;  5K8S A;  4QKF A;  2FDK A;  3AP6 A;  3GHM A;  5LAT A;  3I3D A;  3KQR A;  3PJY A;  4GQ7 A;  2W0X A;  2NZ9 A;  2V4A A;  4JC1 A;  5AFE A;  1MEC 2;  3HIF A;  5CYY A;  5FLJ A;  3NAP A;  5FYH A;  4CPB D;  5IUQ A;  3BIE A;  1ZZ9 A;  1JOD A;  1EPZ A;  1UZZ A;  3MPP G;  4Y3O A;  5A1L A;  1W6Q B;  3AP9 A;  2Q5T A;  5C4W B;  3I4I A;  2ZGT A;  5FZ6 A;  1GZW A;  1NA1 C;  2Z69 A;  5H9R A;  1KXG A;  5FXW A;  3GF6 A;  3WG4 A;  1I5P A;  1W90 A;  3PU8 A;  1C5I A;  4MOA A;  5AVA A;  4FOV A;  2OKX A;  3M3I A;  1GWK A;  1C1F A;  3WHT A;  2BBA A;  2K46 A;  4AYU A;  5J09 A;  4F83 A;  5T54 A;  3PIG A;  4M3C A;  2PTM A;  3TEY A;  3N7L A;  3PIJ A;  4LLO A;  4KWJ A;  2RS5 2;  3ZSM A;  4WZF A;  4CU6 A;  4LOT A;  4C1W A;  1XC6 A;  4GKX A;  5LY2 A;  4XFH A;  3URF A;  1NY7 1;  3ZIX A;  1XYP A;  1H30 A;  5ISL A;  2CGP A;  1CAX B;  2WZE A;  3MIF A;  3JZV A;  3T2P A;  1R09 3;  4XDP A;  2WBK A;  2WAA A;  1NLR A;  1BK1 A;  5FZE A;  2R49 A;  1FX5 A;  1HRI 3;  1WW4 A;  2B7Y A;  1AR7 2;  3GBF A;  4EZ4 A;  5FPL A;  5A32 A;  1RTV A;  3RZL A;  4NIA A;  3UKV A;  4A7Z A;  4BDV B;  1VRB A;  5DMY A;  1ZBA 3;  3DKW A;  4MXV A;  1QY4 A;  2GC0 A;  4NWW A;  2VMG A;  3NAP C;  4GH4 A;  4NPL A;  1AL2 3;  4ZXE A;  4N9H A;  3J7N A;  3T08 A;  2H6C A;  3SQO A;  3OOX A;  1ASJ 1;  2BOI A;  3EO6 A;  4Y20 A;  1Q8V A;  1FOD 3;  5FPX A;  3TAY A;  4CA9 A;  1POQ A;  2VO5 A;  3UT0 A;  4HAN A;  4CTE A;  5JMO A;  2DUP A;  1RHI 2;  3FHA A;  4OUS A;  5IK4 A;  5T50 A;  1PNF A;  4L97 A;  4S2F A;  1R64 A;  4Q4Y 3;  1MEC 1;  5KXB A;  4ASK A;  5KC5 A;  3IWZ A;  4IGP A;  1IGO A;  4HT1 T;  1MQT C;  1J84 A;  4JRL A;  3IIA A;  2WR9 A;  5FXX A;  4GAZ A;  1BBT 3;  1S2E A;  2D40 A;  4XUN A;  1FPN 3;  3MDP A;  2DBN A;  5GJ6 A;  5EXO A;  3MUY 1;  4R9A A;  2IFW A;  3D82 A;  5KHH A;  1RUH 3;  2VUL A;  2WT1 A;  1XU2 A;  3OB8 A;  3USU B;  5GM0 A;  3NV3 A;  4FSJ A;  4OFG A;  4RFT 0;  3WOG A;  2C24 A;  3N9P A;  2CYF A;  4K20 A;  5BNN A;  3T2Q A;  5FKC A;  2WII B;  4GH4 C;  1RXF A;  3VBU A;  5I93 A;  4CUB A;  2X29 A;  2WFP A;  4LBQ B;  4FAG A;  2OUH A;  1RUC 2;  5F39 A;  1KJR A;  3VBR B;  4UW3 A;  3SIS A;  4ASM B;  3MO4 A;  5FDB A;  4HMZ A;  4XUT A;  1UMH A;  2WC2 A;  3FZ3 A;  4UFK A;  1RUG 1;  5CIR A;  4B3N A;  4BK4 A;  1RUF 2;  2QQV A;  2OQ7 A;  1MZF A;  1XE0 A;  1AR7 1;  3BTA A;  4IEW A;  3RPQ A;  5BUV A;  2RDN A;  1A34 A;  1D4M 3;  3INA A;  1RIN A;  3TEW A;  2GME A;  1STM A;  4OUL A;  1T2X A;  4L99 A;  5EP9 A;  4AED A;  3I2O A;  1CN1 A;  3ETP A;  1CAU A;  1DGR A;  4QGL A;  5IVF A;  2JDP A;  2SBA A;  4B29 A;  3WXP A;  2VOX A;  1SDW A;  2W92 A;  3JBG 2;  5FYT A;  3LDB A;  5FP7 A;  1IZ3 A;  4E27 A;  2BGP A;  1SZB A;  3MEP A;  1POV 1;  2GDF A;  2GN7 A;  2Z4F A;  1W6P B;  1H8V A;  3ETQ A;  4QDR A;  1HB4 A;  3ZYP A;  4UFL A;  4AAP A;  4A6O A;  4CPB A;  1FMD 2;  3M3Q A;  2WYS A;  4CCM A;  5A3U A;  5J1X A;  3FFQ A;  1RMU 2;  1US3 A;  3BGA A;  4ORF A;  4I30 A;  2ARB A;  3H1W A;  4A3X A;  4LHN A;  4IV3 A;  1WZX A;  5KHG A;  1O91 A;  2TBV A;  3MLK A;  5BNN C;  3BU7 A;  1RHI 1;  3OY8 B;  1DLL A;  5FYS A;  2IZW A;  2OZJ A;  5T5P A;  1T6G C;  1NXD 1;  4FP3 A;  3VBU C;  4D7T A;  2E33 A;  2Q4S A;  3ZR6 A;  4GZ9 A;  5CB7 A;  2K0G A;  3A22 A;  4BU2 A;  2HWD 3;  3J8F 3;  1EUU A;  2A6Z A;  4U2A A;  5L7O B;  4PBO A;  4Y22 B;  4DOU A;  3GHN A;  2R1B A;  1F4A A;  2P4E A;  2BQP A;  1K5M A;  5I8Y A;  1ZZ7 A;  3O1M A;  5D8A A;  1GBG A;  3GYD A;  3VBO A;  2ET1 A;  3V65 A;  3U07 A;  2Y6K A;  4LKE A;  4XZP A;  1WD3 A;  2I45 A;  3OTF A;  4XFA A;  4AED C;  1ULD A;  2BPA 2;  5E16 A;  5ERL A;  4LLF A;  1VBB 3;  2N7G A;  3WDT A;  4ASL A;  5KXC A;  5JAX A;  2AGS A;  1MZ6 A;  1RUI 2;  2H0B A;  2FQP A;  2O1Q A;  2WIN B;  4XCA A;  2JIJ A;  4HBN A;  3QH6 A;  1RUC 1;  2KM2 A;  2A3X A;  3KLS A;  4IES A;  4BQ5 A;  3RZM A;  1DP0 A;  1SBE A;  1S0C A;  2DUQ A;  2FDJ A;  2D6K A;  1LHU A;  1W06 A;  3J4U H;  3VBS A;  1LGN A;  1GAN A;  2VL4 A;  2VH9 A;  4PF5 A;  3WDW A;  1RUF 1;  4RFR B;  4Z82 A;  1FXZ A;  5C33 A;  2IVI B;  3NKT A;  4IV3 C;  3FBM A;  2PYT A;  1W8F A;  3AMP A;  2YPJ A;  3CF6 E;  4GD4 A;  2VMD A;  3P3P A;  4DIQ A;  3RSJ A;  5J36 A;  2TUN A;  2V5Y A;  3ZX7 A;  4JGY B;  2CWS A;  3GCW A;  5FJK A;  4Q26 A;  2WO3 A;  2W3J A;  1GSL A;  3JBG 1;  3THD A;  1W2T A;  4BQY A;  5JXI A;  5HCH A;  1L3J A;  1DQ2 A;  1HB2 A;  3K77 A;  4PIY A;  4LIU A;  5F2S A;  3HMY A;  5I8S A;  4IEX A;  4XQD A;  3ZYB A;  3U4X A;  1K5M C;  1FMD 1;  1QJY 1;  5D8A C;  5FRE A;  4MGQ A;  3VBO C;  5ABJ C;  1IKP A;  4YVS A;  3B94 A;  1ZZ6 A;  1SBF A;  2A3Y A;  3CIH A;  2KXL A;  4B8E A;  1OVS A;  1NQJ A;  3K4D A;  4KH9 A;  2B5H A;  2W94 A;  5C71 A;  3C7H A;  4NPM A;  2Y26 A;  1NT0 A;  1AVB A;  1L7Q A;  4QGM A;  3JU9 A;  3T2O A;  3VBF B;  4M3C F;  1L7L A;  2I07 B;  1CPN A;  5L36 A;  3W58 A;  1R08 3;  2VGD A;  3NNJ A;  5IVC A;  1H9W A;  1AYM 3;  2ZEX A;  2BU9 A;  4JTN A;  4P9Y A;  3VBS C;  1QJX 2;  1W8T A;  4LO5 B;  3AKR A;  1EPW A;  3VDD A;  4YSF A;  4OQ8 A;  3HNM A;  3I2I A;  3W20 A;  2ZX1 A;  3FLP A;  4H55 A;  3I54 A;  5CFC A;  5I8T A;  1TE1 B;  3CJI B;  4XJ8 A;  4UFH A;  4LBK A;  2ATF A;  2MPF A;  2Q1Z B;  3N7M A;  2WS9 1;  1J58 A;  1NCQ A;  1OA2 A;  5IVY A;  5AC9 2;  2QQO A;  4MUV A;  3WNO A;  5JZG A;  3OYW A;  4UYB A;  1RUI 1;  3M8L A;  5FLH A;  5C70 A;  4GUL A;  3NNM A;  1WMX A;  4Y5Z 0;  4GA9 A;  2GND A;  5DAW A;  3RZZ A;  3ZR5 A;  1KFU L;  1ULF A;  5A33 A;  3AYE A;  2V4V A;  1H1I A;  4Y1V A;  3H7J A;  3ZSE A;  3E6D A;  5FR3 A;  1M06 G;  2CAV A;  2VZO A;  2O14 A;  3R4S A;  2RR1 2;  3M4F A;  3U4S A;  1COV 2;  1GNY A;  4WVM A;  4YVS C;  2WSU A;  1K42 A;  2Y0O A;  1U5I A;  4QPI A;  1C1L A;  1UY1 A;  3I8T A;  1OD5 A;  1RED A;  3ZFF A;  4CDX A;  4YM1 A;  2GAU A;  2KD7 A;  3DPR A;  4WM8 C;  2LRP A;  2IUW A;  2BER A;  2HH9 A;  3WLU A;  3JD7 1;  2WZR 3;  4DMI A;  2WQ4 A;  1IQA A;  5E6H A;  4V2V A;  2P17 A;  3VDD C;  1L7R A;  4FPC A;  5CFC C;  3D6E A;  3P1I A;  3HWJ A;  4W6X A;  4C1X A;  5I0S A;  1KRI A;  4AHZ A;  3U37 A;  1GYK A;  3IBM A;  1HQW A;  1IPS A;  1NCQ C;  4NN0 A;  3WNX A;  4Y24 A;  4DUW A;  2W1Q A;  4DEV A;  1QU0 A;  1SEF A;  3FE5 A;  2PHL A;  2EAK A;  1XXN A;  4Z8B A;  3JQX A;  2JX9 A;  1ZBE 2;  4AEM A;  1B35 A;  1SFY A;  1CJD A;  2OS2 A;  2XKP A;  3ELN A;  3J7M A;  1PO1 2;  4H2A A;  4Z1V A;  2EIE A;  3ZN6 B;  1W9W A;  3D3A A;  3AKQ A;  4NHM A;  4WV8 A;  1F9K A;  4E4H A;  3IM0 A;  1BKZ A;  3WVJ A;  5FYZ A;  4XZU G;  4ZU7 A;  1UF2 C;  2D3S A;  1MS5 A;  3ZSJ A;  4BA6 A;  4XFI A;  3POY A;  1DGW X;  1XJA A;  2WLQ A;  4OMC A;  1ZZC A;  3OSD A;  4QPI C;  1UD1 A;  1UO9 A;  1WLT A;  4B7K A;  4FI9 A;  3GAL A;  4FTE A;  4CDX C;  3ILR A;  3ZFF C;  1S1A A;  1LOA A;  1WKY A;  3DPR C;  3H0O A;  5AC9 1;  3VHP A;  4S2G A;  2GC2 A;  2A1X A;  2CTV A;  2YBK A;  5LA9 A;  3ZXJ A;  2CWM A;  1VBE 3;  2J22 A;  1FV2 A;  1XNB A;  2VTX A;  2VZT A;  4LE4 A;  4XW3 A;  5FUP A;  1KGY A;  5ANN A;  3U75 A;  4N43 A;  2ZEW A;  4IEU A;  2RR1 1;  1XNK A;  1IG0 A;  3HT1 A;  1COV 1;  1JI6 A;  4FPY A;  1H2K A;  3C7F A;  5C5U A;  5K9Y A;  2VEC A;  1ZZB A;  4A4A A;  4M0N A;  3CZU A;  5JCT A;  1VRH 3;  1K45 A;  3ZYR A;  4YRD A;  3K2O A;  1B35 C;  4NE9 A;  3BOP A;  1PGW 2;  1UW8 A;  4O9E A;  2XR4 A;  1MVE A;  3RMY A;  2P3Y A;  3I3M A;  3NJX A;  4C91 A;  4ARY A;  3AJZ A;  4AI8 A;  1UYX A;  1JHJ A;  4QPG A;  1V6N A;  2XGX A;  1HJF A;  4YNI A;  3SIT A;  2Y6J A;  1QGL A;  4JV4 A;  4MSV A;  1RVF 2;  1H8T A;  3OGG A;  4W50 A;  4LOS A;  1CR7 A;  5E89 A;  2HBT A;  5K0U B;  1JZ7 A;  4CDW C;  3MIG A;  1NA1 B;  3WG2 A;  5FQ0 A;  5I91 A;  4AF9 A;  2RM2 2;  5LEJ A;  5FZ3 A;  3V0B A;  3TN9 2;  5FLI A;  3LA3 A;  2Z42 A;  1TNF A;  3AP7 A;  1UY4 A;  4UWD A;  1SLB A;  4MET A;  4UW6 A;  5IK5 A;  1SLL A;  4HKL A;  5KR7 A;  2R0F A;  1AR9 3;  1KFX L;  2D7F A;  2VVF A;  1PO1 1;  2EA7 A;  1BK0 A;  1DZR A;  4N43 C;  3A0N A;  4URA A;  5G04 L;  2WA4 A;  4S2D A;  4HVO A;  3X29 B;  5HBA A;  5A6Z A;  2UY8 A;  3HOB A;  1VR3 A;  5F7U A;  5FP3 A;  1AR6 1;  2F4P A;  3OGJ A;  2HYX A;  2Y38 A;  3PUI A;  1VAM A;  4QX0 A;  2D97 A;  2YGL A;  2PHR A;  1HRV 2;  1W0N A;  1DYK A;  1QQP 1;  1GP4 A;  3AL5 A;  4Q4X 3;  5B2G B;  2WJS A;  2GSY A;  2VMC A;  2XJT A;  2C1F A;  3P3N A;  2K2S A;  3H7Y A;  4LKS A;  1SPP A;  4QPG C;  3U1X A;  2O8O A;  2WNV B;  3CKH A;  3O5S A;  4HKW A;  3ZVX A;  2WT2 A;  3NAP B;  1PO2 3;  3KT4 A;  1YYN A;  4XAC A;  1IPJ A;  4J25 A;  2BGC A;  1H8T C;  2RS3 3;  4LUM A;  4S2H A;  2VY0 A;  3ZO0 B;  4EV0 A;  3AZY A;  1W9S A;  4PHZ A;  1DBN A;  3LIG A;  3VHR A;  3ZOI A;  2XPJ A;  4MYE A;  3ZPY A;  2RJ2 A;  2ZGP A;  2XJR A;  2YHJ A;  1VBC 2;  2XJQ A;  3FBY A;  2G1M A;  3KSC A;  3NW4 A;  3ZYI B;  4FAH A;  1V70 A;  1PGW 1;  4CXW A;  3LPG A;  4NPR A;  4QWN A;  5K4L A;  1VBA 3;  2B45 X;  1VPH A;  1U0A A;  1RIT A;  3RZG A;  1JHN A;  1WMF A;  2B8M A;  4Y33 A;  4ZXK A;  1KD7 A;  1D0H A;  3ZLI A;  3RJR A;  1MQT B;  1RVF 1;  1DZQ A;  2PN5 A;  2GP5 A;  2Q30 A;  3CJX A;  2RMU 3;  1HX6 A;  3UYJ A;  4M00 A;  2RM2 1;  4F3J A;  1OOP A;  1UU4 A;  5FYI A;  2ZKL A;  3GJA A;  5FUN A;  2E7Q A;  2X09 A;  3AL6 A;  5HPO A;  4OI2 A;  1GR3 A;  4L92 A;  5FWJ A;  3SH3 A;  1LR5 A;  5T55 A;  5FMC A;  1PM7 A;  3IPV A;  1YNA A;  2HLE A;  4NAM A;  3T3Y A;  2ID4 A;  4LKF A;  2ZXQ A;  1D2Q A;  4CU9 A;  5FOJ B;  5HXV A;  4JAA A;  3VL9 A;  2J1R A;  1ULP A;  5A7W A;  2ZA9 A;  3T4H B;  4E2Q A;  1KJL A;  4YG0 A;  4XC9 A;  2VQA A;  5FZO B;  1UY0 A;  3LSE A;  5B4X A;  3RYK A;  2RVA A;  1UKG A;  3WF2 A;  3NL1 A;  4JX0 A;  3W5N A;  2QCS B;  1BJQ A;  2EXJ A;  2XG3 A;  3WP6 A;  1WA4 A;  4LK7 A;  4YZ5 A;  1QXP A;  2QQK A;  5DDJ 2;  3UNP A;  4XQ4 A;  3B5L B;  1D0G A;  2VC9 A;  2A75 A;  2V5D A;  2Y60 A;  1LOB A;  3LDR A;  5EFU A;  3FJS A;  3LWC A;  4Q0V A;  1SBD A;  4MH0 E;  2IXC A;  4IL7 A;  4DUV A;  5FOB B;  2W47 A;  3L2H A;  4Q0U A;  2WNU B;  5EPA A;  5CFD A;  2HWC 2;  4ZKT B;  1VBC 1;  1W6M B;  2CV6 A;  1C8N A;  2WKK A;  1GUI A;  3I59 A;  2VOV A;  4HPK A;  3GNE A;  4JDM A;  4AG4 A;  4XE9 A;  5BNN B;  4NID A;  3CEW A;  2VW0 A;  3VBU B;  4FPE A;  2RE9 A;  4CYD A;  5BNO B;  4DUX A;  5E1R A;  3VZK A;  3T0A A;  2WFF 1;  4WZC A;  2C6S A;  2VM9 A;  4DFS A;  1SCR A;  1CAV B;  4NRM A;  3RZK A;  1ASJ 3;  2VNV A;  4PLO A;  5FYM A;  3KM5 A;  5JSO A;  4NHX A;  3WP3 A;  4EWA A;  3MGU A;  4FO9 A;  1YQC A;  2IC1 A;  4UFJ A;  1XPW A;  4ATF A;  3III A;  2ADD A;  2UWB A;  3NNG A;  1QKQ A;  1RXG A;  1GWM A;  3P5B A;  5FYB A;  1R1A 3;  3L9J T;  3BUC A;  4LIV A;  1PX4 A;  2YFU A;  3MW2 A;  1TQ5 A;  1VMJ A;  2WZ8 A;  1RUD 2;  4JTO A;  4XAE A;  1ALY A;  4YLZ A;  3B3Q E;  1LTE A;  2DCT A;  4AED B;  3PHM A;  3WNL A;  3GZU C;  3W59 A;  3PTR B;  2FDF A;  5FRA A;  2FBE A;  4PIZ A;  4CP0 A;  1X8M A;  1URX A;  3QBQ A;  2VTF A;  5A1A A;  1DYO A;  1OPM A;  4COZ A;  4PQ9 A;  1W9T A;  2FZ2 A;  2IFR A;  2JIC A;  4B1M A;  3ILN A;  1NUK A;  4LO8 A;  2ZGO A;  5F3E A;  2JB8 A;  2P1B A;  2HWB 1;  3ACG A;  4AI0 A;  1HDK A;  1POV 0;  4A3Z A;  4YZ1 A;  4FTS A;  2BYV E;  5A3P A;  4LR4 A;  5D1I A;  4N53 B;  1TME 1;  3D4K A;  4NIH A;  2VUD A;  2D93 A;  2Y6L A;  4W65 A;  5DDJ 1;  4HVQ A;  3KMH A;  4EQV A;  1RUN A;  2VW1 A;  1JYC A;  1XNT A;  2G9G A;  2XLA A;  5KC6 A;  4I2O A;  3IAP A;  2L9L A;  2JG9 A;  1E5H A;  1UXZ A;  1RUG 3;  1K5M B;  5D8A B;  5ABJ B;  1ZNP A;  4OYU A;  4FPH A;  1AR7 3;  2PAE A;  3CO2 A;  5F9T A;  4XBQ A;  2HWC 1;  1GKB A;  2JE8 A;  5T3N A;  3KB5 A;  5GZC A;  2VQ0 A;  5LY1 A;  4W8J A;  2X10 A;  1JUH A;  3DL3 A;  4CDU A;  1V6J A;  4AFD A;  1WCQ A;  2MEV 2;  4QQO A;  4NOT A;  5F5A A;  4WVV A;  4A7K A;  3TEX A;  5FP4 A;  5GZF A;  1POV 3;  3PVB B;  1CZT A;  4N7U A;  4QPY A;  3AZZ A;  3EB7 A;  3PUA A;  2O0O A;  4X8P A;  1LJ7 A;  4LHL A;  3VV1 A;  4LT5 A;  3VZM A;  3POE A;  3ZYF A;  3N4M A;  3RYR A;  1ZZ8 A;  4NIG A;  1YHF A;  3FLT A;  4GJY A;  4XJU A;  5CZK A;  1SLI A;  1W9Y A;  1C8M 1;  4JHZ A;  3THT A;  4R9B A;  1W2A X;  4K21 A;  1G7Y A;  3IKW A;  4TZD A;  5FZ0 A;  3GZT B;  1RUD 1;  1PVC 2;  1RHI 3;  1TMF 1;  1Y3T A;  1NE4 A;  1HV1 A;  2XH6 A;  3ES4 A;  3LFM A;  5GLW A;  5GZE A;  5GZD A;  3B01 A;  3RZH A;  1N1Y A;  3POS A;  2HEV F;  5C3S A;  3S6P A;  1GP6 A;  5DZG A;  1PZ9 A;  1XSR A;  2XML A;  2BFU L;  2FHR A;  2JG9 C;  4KBB A;  5BXX A;  2XHN A;  1GFF 2;  4BQ4 A;  3WG3 A;  1GNH A;  1HW5 A;  5ACA 2;  3SNM A;  1DCS A;  1OLM E;  1X82 A;  3BCW A;  2OPK A;  2C9K A;  2XLF A;  4XUQ A;  1WLC A;  1A78 A;  3ATG A;  4YVS B;  5C9A B;  5I0R A;  5FZG A;  2E7T A;  4BME A;  2G4I A;  3MV0 1;  1QDO A;  2I2S A;  3IDA A;  1J1T A;  2BDR A;  1SQ4 A;  3LDK A;  4WM8 B;  3APB A;  2FZ1 A;  2A70 A;  5FP8 A;  1NKG A;  4Q4V 3;  2W9X A;  4EYU A;  5LBF A;  1MZE A;  2FDH A;  3O1P A;  3OPW A;  1ULE A;  1Z7S 2;  3ZXD A;  3VDD B;  2ERF A;  1BEV 2;  1S0G A;  1W04 A;  1D7P M;  3NV2 A;  1JOB A;  1RUF 3;  4ZON A;  2YC0 A;  4QD2 A;  5HCF A;  3VKM A;  4AR2 A;  3NNL A;  4BXS V;  1H6Y A;  1AF9 A;  3AP5 A;  2OQ6 A;  1WLD A;  4RSU A;  4AL9 A;  2D6M A;  5FYY A;  4QQH A;  2PFW A;  3AXE A;  2X53 S;  3JBG 3;  5FY7 A;  1FV3 A;  1YEW A;  3H8U A;  2Y34 A;  5A33 B;  1CIW A;  3KCX A;  2O8Q A;  3VHO A;  2CHH A;  3A7Q A;  3HQX A;  2RS1 3;  3C7E A;  3N9L A;  3J9S A;  3WQB A;  4D7S A;  1EYB A;  1FMD 3;  1OI6 A;  1QJY 3;  1YUD A;  2JXA A;  5A3O A;  2DWR A;  3T1L A;  3HQU A;  4UXA A;  3OUJ A;  3ZN4 A;  4A2U A;  3BTX A;  2EAL A;  3M3C A;  3R4U A;  1QH6 A;  3MPB A;  4LE3 A;  1PZ7 A;  4KWK A;  4DPN A;  3QCW A;  4A45 A;  1LB2 A;  1XQN A;  3ZFF B;  5BNP B;  1W6O A;  1PVC 1;  2NMN A;  1Q3E A;  2TEP A;  4E8C A;  1LEC A;  1JZ3 A;  5H9Q A;  1H2M A;  4UT5 A;  3SH4 A;  3MI8 A;  1UN1 A;  3J7L A;  3ZN5 A;  4XFF A;  5F2W A;  2ZGN A;  2CL2 A;  2ZMN A;  4PDW A;  4QQ2 A;  2OZ6 A;  5ACA 1;  3GBG A;  1K5J A;  2KA3 A;  2YBP A;  2ZGQ A;  5FY8 A;  4KU7 A;  2FDI A;  1KIT A;  2EVX A;  1CON A;  2Q1F A;  2DFC A;  1CZS A;  2YGM A;  2WS9 3;  1LOG A;  1H6X A;  3PTY A;  4GKY A;  4XEZ A;  5IVV A;  3VUO A;  1BVP 1;  2V09 A;  3OBZ A;  1WW5 A;  1ODM A;  4Y1Z A;  1V9U 2;  2HWF 3;  1RUI 3;  1B35 B;  4KBZ A;  3MFC A;  1REE A;  3V0A B;  2JIG A;  2DU1 A;  2B9U A;  2PHU A;  4JKK A;  3VD3 A;  3ZXE A;  1MPX A;  4BK5 A;  4CP9 A;  4QGN A;  5JSR A;  1TG7 A;  1Z7S 1;  3LAG A;  5T5O A;  1BEV 1;  3B02 A;  5CU1 A;  1OUR A;  2D3P A;  3WCS A;  4MGY E;  1GQH A;  2E63 A;  3P6B A;  5FBJ A;  1WBF A;  1G9A A;  1H1M A;  4CDW B;  2XVG A;  1RB8 G;  2IXK A;  1SLT A;  4IGO A;  5FKB A;  2VOT A;  3H3U A;  4QX8 A;  1RUO A;  3OBT A;  2ZX0 A;  3B93 A;  2ARA A;  2VUC A;  3HEI A;  5A7P A;  4M4R A;  3OPZ A;  4RQP A;  1F5F A;  2OXB A;  3JD7 3;  5FJH A;  4LO7 A;  3H8X A;  2DVF A;  2QQJ A;  4RGG A;  4YG3 A;  4LBL A;  4PDW C;  4N43 B;  4UW4 A;  1DLC A;  1OUS A;  3QOP A;  3H3L A;  2VW2 A;  1DGL A;  1OC1 A;  2PMW B;  5JR7 B;  4EN9 B;  3T09 A;  5GAL A;  4FFF A;  1SDD B;  2AH2 A;  5FIX A;  2QUO A;  5FZ9 A;  4CEY A;  2UYB A;  3HN1 A;  1YI7 A;  2GP3 A;  1WGP A;  2DVB A;  4B4R A;  3DYO A;  3ZSL A;  2XUM A;  3CL1 A;  3OEA A;  3MW4 A;  3CDZ B;  4P5Y A;  4AFC A;  4EE2 A;  2B4K A;  3S5Q A;  2RS5 1;  4UW5 A;  3WUD A;  3BIW E;  3WUC A;  4N7I A;  5FPZ A;  2AEN A;  4AFB A;  1UOB A;  4PJY A;  3RJ2 X;  3OGR A;  3SKV A;  4E2G A;  1JOP A;  4ERO A;  3ZXG A;  2RJK A;  5F37 A;  4JRA A;  3PUS A;  4OCT A;  3ZKY A;  4QU2 A;  5FQ0 B;  4AK3 A;  2GZW A;  4IEV A;  1B09 A;  3V0B B;  3MF9 A;  4IEZ A;  4MGI E;  1N3O A;  5LRR A;  1V9U 1;  4PLN A;  2HBU A;  1LHV A;  4RQP C;  1YCI A;  1WA6 X;  3NKG A;  1MS9 A;  1NOV A;  4L2N A;  4XJ9 A;  1UKR A;  2VNR A;  2ARX A;  2JWP A;  2YC2 A;  3HR9 A;  5DUX A;  3ZXF A;  4GWN A;  2GC1 A;  1I3H A;  3ZYH A;  1NCR A;  4L0P A;  4WM7 B;  2RR1 3;  1COV 3;  4K3U A;  1ENX A;  4CCN A;  4D8M A;  4QKB A;  2AC1 A;  4NMI A;  5FUI A;  4BQW A;  1V6L A;  5FO9 B;  1F15 A;  4CEY C;  2YMZ A;  3IDC B;  3DKQ A;  4E4S A;  5EZW A;  4GWM A;  4CEW A;  4HSJ A;  3PU3 A;  4ET7 A;  4XF3 A;  1PIV 2;  5BY5 A;  1GQP A;  1ENS A;  4LHK A;  4D3W A;  3IDE A;  2F4L A;  4FFI A;  1JBC A;  2PLV 2;  4LXL A;  1BXH A;  1SPP B;  3GGL A;  2WUH A;  3M3O A;  3PVN A;  2A73 B;  4E2S A;  5DZE A;  1EV1 2;  3ZFG A;  3AKS A;  2G9F A;  4MX3 A;  1EAH 3;  1DGW A;  1VAV A;  4CCK A;  2B39 A;  1IS4 A;  3HJR A;  1VB4 A;  4XHX A;  2E53 A;  5DN2 A;  5A1F A;  1JZ6 A;  5DAX A;  3ZM8 A;  2ZS6 B;  5DQ0 A;  1QNY A;  2VCA A;  3OGS A;  4H3W A;  2JE7 A;  3UK9 A;  1J59 A;  1XNA A;  1OH3 A;  4A41 A;  2ZGL A;  1UIK A;  4M01 A;  2DF7 A;  4UBH A;  4YZ4 A;  1NAE A;  1PK6 A;  1VBD 2;  2Q8C A;  1LOC A;  3WW3 A;  4HFS A;  4A6S A;  1Q8Q A;  1NCR C;  4BLJ A;  2A6V A;  2PXJ A;  2VMF A;  3DEM A;  4YM2 A;  2DTY A;  1H1A A;  3MLJ A;  4CZS A;  2WDB A;  4I02 A;  1AR6 3;  3L2Y A;  1QDC A;  2W95 A;  1LUL A;  4EZH A;  2UU8 A;  4CEW C;  3VKF C;  4YW5 A;  4LPL A;  5CEH A;  1UCX A;  4RR3 A;  1W6N B;  1QQP 3;  3GZE A;  3VBH A;  1LOD A;  3WSO A;  1UOJ A;  4FOW A;  1YFX A;  4RS5 A;  5L9R A;  3C3V A;  4HKO A;  5A3N A;  4O9G A;  1V6I A;  4IE6 A;  2YXS A;  1XE7 A;  3D0S A;  1HRI 2;  1ZRD A;  1CX4 A;  2GH2 A;  1YIP A;  5JWP A;  1G9D A;  3IPV B;  3ZFG C;  1REF A;  1GQG A;  2W1U A;  1KEX A;  1ZBA 2;  1JYI A;  4BWO A;  3K3N A;  3GM8 A;  1SHW B;  5F6L B;  1MS4 A;  5IT6 A;  4CUC A;  1FYU A;  5IHR A;  2ZAB A;  2A6Y A;  4LBN A;  5J48 A;  3AJY A;  1RMU 1;  5CKN A;  2ZHL A;  1OBN A;  5JI9 A;  1PM4 A;  3POF A;  1PIV 1;  4P9I A;  4BLI A;  4OZX A;  4OUE A;  2XL7 A;  2ZX4 A;  4W6W A;  2PLV 1;  2VZQ A;  5D2A A;  4AOC A;  4BQ1 A;  4CCL A;  1QOO A;  1XSQ A;  5C3O A;  2XBO 2;  3PL0 A;  1DQ1 A;  4IEP A;  4K40 A;  1W05 A;  3K75 B;  4KWU A;  3S7E A;  4M0H A;  4CDQ B;  4I0A A;  4P9J A;  1YQ5 A;  3PVE A;  4B4Q A;  4YVW A;  2BNO A;  4DNY A;  4Q4Y 2;  4RR3 C;  3VBH C;  2RM2 3;  3R6S A;  2FMD A;  3K48 A;  3CQO A;  1W8H A;  1OH4 A;  2RG4 A;  1FPN 2;  3HAG A;  3I59 B;  2GNT A;  4HPK B;  1VBD 1;  3SMH A;  3O1O A;  1AJK A;  2EXH A;  1OFN A;  5KWR A;  4XBL A;  4XET A;  2BNN A;  1RUH 2;  5DUW A;  1V00 A;  3MID A;  2WN2 A;  4J1W A;  4CXX A;  2Y6F A;  3CHX A;  4LBQ D;  4GAL A;  3K4A A;  5JXJ A;  3POG A;  2UYA A;  4D69 A;  2DCK A;  5JXG A;  4QKN A;  4NWV A;  3NVC A;  4WVW A;  3LOB A;  2VXJ A;  2QQN A;  2GAL A;  2R06 2;  3N3H A;  4FVV A;  5FMO S;  5KXE A;  2W52 A;  4NUB A;  2BOJ A;  1ZM1 A;  4MHU A;  4DIN B;  4NRQ A;  3RRD A;  4UF0 A;  3VDA A;  2OX0 A;  3EBR A;  1YFU A;  3WNP A;  2MNG A;  4E4Z A;  3I3B A;  1Z78 A;  3K4Z A;  4O7X A;  1D4M 2;  3Q8C A;  2VZP A;  3WHU A;  3DCQ A;  5KBF A;  3VDB A;  1HLC A;  2PAM A;  4QHB A;  3MW3 A;  3N36 A;  4TTG A;  4RGK A;  4YVW C;  4C8D A;  4A7Y A;  1O3T A;  1ULG A;  4BQ3 A;  1ZA7 A;  3ON7 A;  5FWE A;  1U5Z A;  5IFT A;  5C4W A;  1GIC A;  1GMM A;  3BN6 A;  2Y6G A;  3W5M A;  1VBC 3;  1FNY A;  5LW9 A;  2D3R A;  5JZG C;  4Q8K A;  1VMH A;  5JVV A;  2A6X A;  3IT8 A;  1JYT A;  3ORJ A;  2XBO 1;  2GU9 A;  1F31 A;  3H42 B;  3F2Z A;  3LQC A;  4L8Q A;  2ADE A;  4TLG A;  5D21 A;  2WFF 3;  5GLT A;  1BYH A;  1ZVF A;  3O0W A;  5TSW A;  4EN7 B;  1FAT A;  1QJX 1;  4Z07 A;  3WF0 A;  3EMR A;  5F3G A;  2R32 A;  2NYY A;  3B9C A;  4XCB A;  5IW0 A;  4CCJ A;  4KG0 A;  4DRV A;  3J8F 2;  2QZ3 A;  1OQD A;  1ULC A;  1YQ6 A;  4W6Y A;  1CAX A;  4DXT A;  4AFM A;  5J98 B;  1FPN 1;  3EJK A;  1MS8 A;  3R4D B;  4AGR A;  2NP0 A;  1D4V B;  4BIO A;  1C3H A;  1LRH A;  2DCZ A;  3OUH A;  2C0Z A;  1RUH 1;  2JDH A;  3ZXL A;  1N1T A;  4CSW A;  2RV9 A;  5C8C A;  1W8W A;  2EXI A;  1UU5 A;  1OD3 A;  1VBB 2;  5FPU A;  1OKQ A;  4Z2A A;  1DGR N;  3ITQ A;  1HIX A;  4Q4W 2;  1WW6 A;  1UIJ A;  5FZ7 A;  5C4W C;  2JG8 B;  1LES A;  1UYP A;  2A3W A;  2HWB 3;  2R06 1;  3E6B A;  2ZZQ A;  3WCR A;  3S0M A;  1GZ9 A;  2G19 A;  1S4C A;  4AHX A;  5IVJ A;  3E97 A;  2D6O X;  2R04 2;  5JOZ A;  1AYN 2;  2YPD A;  3FC0 A;  4DXZ A;  3A21 A;  3AC0 A;  5J3U A;  1OFS A;  1TME 3;  1VJ2 A;  2LRO A;  4H7L A;  4FPK A;  4P00 B;  4JGZ B;  4A44 A;  5CKQ A;  3UL2 A;  4C90 A;  1CAW A;  4OHZ A;  5JPM B;  4Q0Q A;  4COW A;  1YJK A;  5LEK A;  1UPI A;  2JKX A;  1HN0 A;  4PT6 A;  2A7A A;  1Q56 A;  1RUE 3;  1ST8 A;  4GMP 1;  4LBJ A;  3RWN A;  4AGV A;  4DY3 A;  5JDB A;  1W8O A;  1G86 A;  5IAV A;  3RGB A;  1NLS A;  3LD8 A;  2HYK A;  4Y4Y A;  5HV0 A;  2HWC 3;  4KU8 A;  4MVT A;  3VZL A;  4NHY A;  3AMQ A;  2XQX A;  1LHW A;  3A4U A;  2XLG A;  4TYS A;  3WIN E;  4BM8 A;  2Y8K A;  3WDX A;  1DYP A;  2DV9 A;  1YC6 1;  1ZRR A;  1NZI A;  3AKT A;  3H50 A;  1XNC A;  2VAU A;  3M7A A;  4YW4 A;  4IE0 A;  4FTB A;  1ZBE 1;  2B9V A;  5C5T A;  4KG8 A;  3FUO A;  3MIC A;  5C8C C;  2DYC A;  2HWE 2;  4HLT A;  4I0B A;  3JCI A;  3OGV A;  1QHD A;  1BLZ A;  4QX7 A;  3LFI A;  2Y64 A;  1AXZ A;  1QH7 A;  2ILM A;  3LOI A;  3AZW A;  1DU3 D;  4NII A;  3VD4 A;  3WW2 A;  4BMB A;  2VMH A;  3HNY M;  1C8M 3;  3J8F 1;  4LA2 A;  4ZZ5 A;  4Q27 A;  2BRT A;  1AYM 2;  2YB7 A;  3AVR A;  3VBR A;  1MS0 A;  2P5B A;  1RUD 3;  1TMF 3;  1SMV A;  3AYD A;  2VR4 A;  2E32 A;  5CVR A;  4AEK A;  1A8D A;  3TB0 A;  4EN0 A;  3ALQ A;  1U5Y A;  3H1Y A;  4YWA A;  4ZS3 A;  1VE0 A;  2XJS A;  4RD7 A;  4YFW A;  4G3Y C;  5FY5 A;  2IXH A;  3F95 A;  3EHK A;  1VBB 1;  1XBF A;  2VOW A;  2ORZ A;  2YY1 A;  1YFY A;  3C8X A;  4Q4W 1;  4XIK A;  3O1S A;  5EQU A;  4QKD A;  1R1Z A;  3WNN A;  1YWK A;  2VZU A;  4CVU A;  1US2 A;  3IN9 A;  2ZEZ A;  1GZW B;  3MIB A;  5A7N A;  4NHK A;  1X50 A;  1W6P A;  4XXP A;  4YW7 A;  5J96 B;  3KVB A;  3LGR A;  2XON A;  1LEN A;  1O4Z A;  2VZR A;  2J7M A;  2R04 1;  3BTZ A;  1G9C A;  1AYN 1;  2C26 A;  2ZGS A;  3VDC A;  4LO6 B;  3BI3 A;  5EJ3 A;  4CRQ A;  1MR5 A;  1LCL A;  5JPN B;  4I3P A;  1YQ8 A;  4M3C B;  4XDO A;  1H2N A;  1JXN A;  2VCB A;  1QNW A;  2R16 A;  4P02 B;  3E6C C;  4PDW B;  1LED A;  4YZ2 A;  4Y4R A;  3AZV A;  1JYV A;  4P08 A;  2CSG A;  4EWE A;  4Y1Y A;  4FOY A;  1HXS 3;  3VBR C;  4G4F A;  2QZ2 A;  4IQP A;  1PZ8 A;  2VXR A;  5IVB A;  2PAK A;  4LJH A;  5FBZ A;  4ZY9 A;  5A32 B;  5A7S A;  3TN9 1;  2IWG B;  4FXG B;  3ZDV A;  2VOK A;  1VB2 A;  4Q5O A;  4LUL A;  1XRU A;  3SCG A;  3UV9 A;  4K6B A;  5H9S A;  2BTV C;  1CPM A;  2ORX A;  4MV2 A;  4Q8L A;  4UAP A;  2HWE 1;  4CP9 B;  3ENR A;  1ONA A;  2X5I A;  4GH4 B;  4JDN A;  4QHO A;  1PGL 2;  3C7G A;  2QFE A;  3TOJ A;  1WCK A;  4R8H A;  4OI1 A;  2EID A;  3IMN A;  2P3I A;  1X9T A;  4Y20 B;  2W68 A;  3H9A A;  2EXK A;  4HL0 A;  2BV4 A;  1HRV 1;  4E9K A;  3RI8 A;  5J37 A;  3LE0 A;  2YU2 A;  4NRP A;  1S0I A;  1VMF A;  3AMN A;  4H14 A;  5CG9 A;  5FZM A;  2VBD A;  4AVB A;  3OG2 A;  4L11 A;  4QXH A;  2LW8 A;  2NN8 A;  4JGY A;  1JU4 A;  2P3J A;  1ENR A;  2XWB B;  3N9Q A;  4QM8 A;  4U36 A;  5DPN A;  1QJF A;  4DZG A;  3CU7 A;  1QJU 2;  5LA1 A;  1VBE 2;  3RFR A;  4BHP A;  1BMV 2;  1U12 A;  1AXK A;  3K3O A;  1OMI A;  3OUI A;  4RHV 2;  3SXW A;  5CAD A;  4A42 A;  1N3P A;  3WY6 A;  3GJB A;  2OW4 A;  1OT5 A;  1ACC A;  5FZC A;  2X05 A;  3SEE A;  4AFA A;  4CEY B;  2W39 A;  1OOP C;  3PDQ A;  1UYZ A;  3VZN A;  2D6L X;  4JVA A;  2EAA A;  2JDU A;  4B7E A;  4KWL A;  3TNP B;  4MO3 M;  2Y33 A;  1VRH 2;  3UES A;  4AI1 A;  2R6Q A;  2SLI A;  2X5I C;  2LS6 A;  2OT7 A;  4NAO A;  1Z7S 3;  2J1T A;  3T0D A;  1IHM A;  4XF9 A;  4OHX A;  3VBF A;  4FXK B;  5FK8 A;  1YFW A;  5JUV A;  4PI2 A;  1G9F A;  3SCH A;  1OQ1 A;  1Q8S A;  5LBE A;  5IYY A;  4BZ4 A;  2J1V A;  4BH9 A;  3WNK A;  3TEZ A;  2P6H A;  2PEL A;  2HKX A;  2FD8 A;  2XHK A;  3NWK A;  4SBV A;  4YGD A;  4XUP A;  4XDQ A;  3ZFE A;  1W0P A;  4XMI A;  3ZDS A;  4DEQ A;  1CAU B;  2WO1 A;  3AB0 A;  2JJ6 A;  5JOX A;  4JHT A;  1NCR B;  4QXK A;  1OA4 A;  2A71 A;  3EXU A;  4J6G A;  3T1M A;  3T2T A;  1MEC 3;  4MHR A;  2NPI A;  3CNA A;  5FY0 A;  1CGP A;  1UMI A;  4XFC A;  2WL1 A;  1CES A;  5EYY A;  1V6K A;  4KI5 M;  4LBO A;  1IS6 A;  4IV3 B;  5CFD C;  2H0V A;  5SV5 A;  2XQR A;  4NRO A;  1WUV A;  1UYY A;  5BPX A;  1J3R A;  1Z0H A;  2WWS A;  4FBF A;  4AAX A;  1TNR A;  2VZ1 A;  1RUJ 2;  1OQE A;  1DHK B;  2E26 A;  2RS5 3;  3KCY A;  3ZYJ B;  4EN6 B;  3MF6 A;  1GWL A;  3AXD A;  1H4H A;  4B1L A;  4Z2W A;  3ZFG B;  1UX7 A;  1JTZ X;  1OLM A;  1QJU 1;  5FZ4 A;  4IEO A;  4I0W B;  4AI9 A;  5FCC A;  1BMV 1;  4OMD A;  5I0U A;  4RHV 1;  3FWE A;  4F7Z A;  2FCU A;  3AYC A;  1PO2 2;  4XFG A;  2VZV A;  5IJR A;  3VBO B;  3UGH A;  2RS3 2;  5BNQ A;  4QB2 A;  3ZKU A;  3LZZ A;  5FO8 B;  3ZFE C;  2DVD A;  2CAU A;  2YYO A;  1WWY A;  3O1T A;  2A5Z A;  4DS0 A;  1X33 A;  1ZRE A;  1GNZ A;  1O8S A;  2ES3 A;  5A6Q A;  4HK9 A;  4JDO A;  4D0Q A;  4Y1U A;  4KMQ A;  2VG9 A;  3IZO A;  1H2L A;  5T52 A;  1H9P A;  2XJU A;  3H1M A;  5DZF A;  5AVP A;  4B4P A;  4COU A;  5HV4 A;  1TEI A;  2JDK A;  4YGE A;  4XOG A;  4MGS A;  4XUR A;  1VBA 2;  3O12 A;  3VBS B;  2J1E A;  3ZN6 A;  5A6X A;  1OUX A;  4NR1 A;  4RR3 B;  3VBH B;  3WR0 A;  3Q9O A;  1UZY A;  4I01 A;  2OA2 A;  4E4D X;  2DDU A;  5HI0 A;  4FPO B;  4YAR A;  1UMZ A;  2WA3 A;  5FXZ A;  3WF1 A;  2RMU 2;  2UWC A;  4AVV A;  3FN9 A;  3ECQ A;  4HSL A;  4QXB A;  4ES9 A;  2QQP A;  4SLI A;  2IXI A;  1WCS A;  2WO7 A;  3BVC A;  4TSV A;  2D98 A;  3RVH A;  2W2I A;  4ZU5 A;  2VD7 A;  2EIB A;  2YUE A;  5FMD A;  1G6N A;  5FY9 A;  2PHX A;  4JQR A;  2NQY A;  1G9B A;  1I1E A;  1XE8 A;  3VGI A;  3IDB B;  4QB1 A;  4D7Y A;  1F8V A;  5LBC A;  4QM9 A;  1JYW A;  2R07 2;  2J1S A;  4TWT A;  2P37 A;  4CDU C;  2ZAH A;  2D44 A;  3POI A;  4LNV A;  1RUJ 1;  5FZF A;  2DVG A;  2CGO A;  1GOH A;  4IV1 A;  4C0B A;  4UBG A;  4RA0 A;  2LM3 A;  2IVJ A;  2DUO A;  2XB6 C;  4O61 A;  3LPF A;  1RUC 3;  3WV6 A;  1CIY A;  1IKQ A;  3NMB A;  4LA3 A;  4YVW B;  3HN3 A;  5I0D A;  2OYZ A;  3H8R A;  2BWA A;  5CFC B;  2BZD A;  1OPO A;  4C0H A;  1F35 A;  3PME A;  2RS3 1;  5L7O A;  2Z2S B;  4IET A;  2AUY A;  4YZ3 A;  3WX5 A;  5JIA A;  5L19 A;  4FPL A;  5FPA A;  1NCQ B;  4AZZ A;  3U14 A;  5K0U A;  5EV7 A;  4HXC A;  5JZG B;  3OYW B;  1UQX A;  2DUR A;  1VLN A;  2MEV 1;  2ZCW A;  2ZAC A;  1E5I A;  3I2H A;  2WZP P;  2ZOE B;  3WQ7 A;  1O5L A;  4LUK A;  2BW8 A;  2TNF A;  5L9B A;  4DXS A;  1MS3 A;  1PNG A;  4H7M A;  3VZO A;  1AHS A;  3MHZ A;  4XF0 A;  4AVC A;  2V72 A;  2WQZ C;  1S2B A;  4WVM B;  4MG2 A;  1RMU 3;  1DQ6 A;  5F32 A;  5F3I A;  5GKA C;  3RDI A;  2A6W A;  4QPI B;  4Q1R A;  1ASJ 2;  1M4W A;  2RDS A;  3DUI A;  5K7P A;  5A3T A;  2X8K A;  3HPN A;  2RMU 1;  1YI9 A;  2PLV 3;  4CDX B;  3T4V A;  2J42 A;  3GZA A;  1PMI A;  4COV A;  3DPR B;  2ZGR A;  4IV1 C;  3PLQ A;  1W39 A;  1R1A 2;  5I0T A;  3OF1 A;  1GZC A;  1Y9G A;  5JI7 A;  3WP4 A;  2YDE A;  2ZGM A;  2ZZJ A;  4YW6 A;  1VAK A;  4IUG A;  1YQ2 A;  2WNV A;  4XYX A;  5JR2 A;  1TVG A;  4GB3 2;  5KHI A;  5L7O C;  3I49 A;  1XU1 A;  3JUU A;  4LMF A;  2PQS A;  1HN1 A;  1S0E A;  3PUQ A;  5K0U C;  2R07 1;  1CVN A;  1NE6 A;  2PHF A;  4NJ4 A;  2VZ3 A;  1VBD 3;  1O6U A;  2OVU A;  4K8R B;  1WW7 A;  2GNB A;  4IND A;  4D94 A;  4FOQ A;  1CD3 G;  3CZJ A;  3PNA A;  5CA6 A;  3KF5 A;  3BTY A;  1N3Q A;  1GZT A;  1KDK A;  1LNS A;  4XQW A;  1GOG A;  1KS5 A;  3OBR A;  3ZXA C;  5BYN A;  5FP9 A;  3Q8A A;  1FI2 A;  2DTW A;  3NQH A;  4IGQ A;  1I5Z A;  1QWR A;  3KZ4 C;  4PQQ A;  3J26 N;  3VN4 A;  4CCO A;  5FZD A;  3KF3 A;  1MQT A;  3LA7 A;  2AEY A;  4V1P A;  2UUR A;  1AR8 2;  5FYC A;  1RUG 2;  3U78 A;  3ZMO A;  4AI2 A;  1XB9 A;  1Y43 B;  3DEC A;  5DAB A;  5DG1 A;  5SV8 A;  1W3X A;  4CUG A;  1AL0 G;  3M2M A;  4W4Z A;  1APN A;  2WLP A;  2ZPX A;  3PMS A;  2H6B A;  2HJI A;  2JD4 A;  1UL9 A;  2OPW A;  4P9L A;  5C8C B;  5C3R A;  3NNF A;  4AQS A;  2ZTN A;  4ZU4 A;  3I3Q A;  5FZI A;  3KT7 A;  2WNV C;  3LA2 A;  3KCC A;  1VIW B;  3IAQ A;  2FMY A;  2J1A A;  2MHF A;  1X9P A;  2WQ8 A;  4TXW A;  3N35 A;  3UJO A;  1JH5 A;  2PHW A;  3K51 A;  4RN5 A;  3LEI A;  4MGZ E;  1VAL A;  3QLQ A;  3VKN A;  1ZA4 A;  2C4X A;  1VP6 A;  4DO0 A;  4PCR A;  4Y26 A;  1IOA A;  1O4Y A;  3HT2 A;  4HG6 B;  5LZ6 A;  1ODN A;  1W99 A;  1S2K A;  2XBO 3;  1JYN A;  1R1A 1;  1W8U A;  3KT1 A;  4IXL A;  5FZO A;  1CAW B;  1NZC A;  3OPT A;  4LO4 B;  2BNM A;  4QPG B;  1HQL A;  1EY2 A;  1PVX A;  1QJX 3;  1SFN A;  4QX1 A;  4F8A A;  5DAP A;  4GB3 1;  1H8T B;  3BYW A;  3KS7 A;  2XKO A;  4M3C E;  1NX9 A;  2AR6 A;  1CX1 A;  4YW1 A;  3ES1 A;  1N1S A;  2FCV A;  5FZB A;  3RI9 A;  1S0B A;  1Y4W A;  4RGA A;  5AC9 3;  5KHK A;  5KXD A;  1N1V A;  1UU6 A;  4N8M A;  1XYO A;  2BVB A;  2W08 A;  3KQ4 B;  4GMP 0;  4QB6 A;  5FZK A;  1WLW A;  2WNU A;  3SH5 A;  4AWD A;  2AZ5 A;  2VUA A;  4LK6 A;  1W6M A;  1SLA A;  2WN3 A;  3RZJ A;  3ABZ A;  5APA A;  4IEQ A;  1JW6 A;  4MGK E;  3BPZ A;  4OI4 A;  3CMG A;  1GP5 A;  4QDQ A;  4HN1 A;  3B69 A;  4EWD A;  5L9V A;  2ETE A;  1QOT A;  2LUW A;  3FHQ A;  2Y6H A;  4XIO A;  5FK7 A;  5LA0 A;  1OKO A;  3PUR A;  4Q4V 2;  2VUJ A;  1NQD A;  2R06 3;  3NJV A;  4QX5 A;  4FFH A;  3SEP A;  1UXX X;  3WDV A;  1Q8O A;  3V56 A;  3WZ1 A;  1CAV A;  2F17 A;  3AX4 A;  3I2F A;  1CJP A;  1AR8 1;  2DCJ A;  5AFB A;  4HVR A;  3JB8 A;  4GXL A;  5FYU A;  3SCF A;  5IAT A;  1CWP A;  3O7O A;  4UI9 L;  4ZZ8 A;  5IAX A;  4I3G A;  3Q8E A;  4OLL A;  2R7E B;  4CU7 A;  5F5Q A;  2R0H A;  3KGL A;  1O8P A;  3BAL A;  3HQR A;  5GLZ A;  2FCT A;  5A3W A;  4GMP 3;  3VB9 A;  1JUI A;  2XL9 A;  1W2N A;  4XFB A;  4AEJ A;  4BQX A;  3DYP A;  3ZMN A;  3RNS A;  4LTA A;  4XHB A;  3U11 A;  5EYX A;  2RS1 2;  2FDG A;  1ND3 A;  1RJ7 A;  2D6N A;  3I97 A;  1JZ8 A;  1QJY 2;  3ZIW A;  1W28 A;  4Q0P A;  3E1F 1;  1ZYB A;  2VVD A;  3TYJ A;  2WNU C;  3BB6 A;  5JMC A;  1ZBE 3;  3N9M A;  5EJZ B;  3RYP A;  1J1L A;  1K3I A;  1PO1 3;  2JDZ A;  1DG6 A;  2LAL A;  4K9S A;  5EJ1 B;  4ISR A;  4N53 A;  2ZX2 A;  2QDN A;  1LGC A;  5FXV A;  3FL7 A;  2VME A;  3QAC A;  3AZX A;  4P9G A;  2E6V A;  1OOP B;  3DN7 A;  5M0T A;  2GH8 A;  3KHC A;  2VZS A;  5ABJ A;  3I2K A;  5EHD A;  5L73 A;  1R09 2;  4XBN A;  2WS9 2; 
#chains in the Genus database with same CATH homology
 1I5P A;  2JKX A;  4MOA A;  4PT6 A;  1XPW A;  2OKX A;  3III A;  3NNG A;  1W8O A;  2JD9 A;  2BBA A;  1J83 A;  1PX4 A;  2J1U A;  2YFU A;  2WZ8 A;  2XQX A;  4CU6 A;  2Y8K A;  3WNL A;  1XC6 A;  1JYX A;  2B9V A;  2YG0 A;  2WZE A;  2VTF A;  3T2P A;  5A1A A;  4CUA A;  2WBK A;  1DYO A;  2WAA A;  3OGV A;  4DXR A;  1W9T A;  2Y64 A;  1NUK A;  1K12 A;  3K46 A;  3VD4 A;  4BDV B;  3HNY M;  5DMY A;  4ZZ5 A;  3ACG A;  2YB7 A;  4A3Z A;  2VQT A;  2VR4 A;  3LEK A;  2E32 A;  3UET A;  5IFP A;  4ZXE A;  2Y6L A;  3T08 A;  1XNT A;  3IAP A;  2L9L A;  1UXZ A;  4MAD A;  2ORZ A;  3C8X A;  4OYU A;  2VO5 A;  3WNN A;  2VZU A;  4CVU A;  1US2 A;  2ZEZ A;  2W1S A;  2JE8 A;  5JMO A;  2W87 A;  3FHA A;  4W8J A;  4M4P A;  2X10 A;  2XON A;  1WCQ A;  2VZR A;  1R64 A;  2J7M A;  2C26 A;  3VDC A;  1F4H A;  3A23 A;  1J84 A;  2VCB A;  1CZT A;  3EB7 A;  4P02 B;  3ACH A;  4XUN A;  1JYV A;  4P08 A;  2WAO A;  3MUY 1;  2BGO A;  5CZK A;  4JHZ A;  4JKL A;  4JKM A;  3OB8 A;  3T2Q A;  3JXS A;  4ZY9 A;  4E8D A;  4CUB A;  3NRU A;  3ACI A;  2E31 A;  1UY2 A;  1UZ0 A;  2ORX A;  3MO4 A;  4XUT A;  4UAP A;  5C7G A;  2XHN A;  1UMH A;  1UY3 A;  4BK4 A;  2QQL A;  2WAB A;  3DYM A;  3WEZ A;  3C7G A;  2JDA A;  3GXU A;  4XUQ A;  2C9K A;  2EID A;  1IQD C;  1T2X A;  1BHG A;  3MV0 1;  3ETP A;  3IDA A;  2W92 A;  3LE0 A;  2BGP A;  3MBW A;  1NKG A;  2W9X A;  2Z4F A;  4QDR A;  3OG2 A;  4A6O A;  3WF4 A;  2LW8 A;  2WYS A;  2YC4 A;  1JU4 A;  5J1X A;  1D7P M;  1US3 A;  3BGA A;  5DPN A;  5LA1 A;  1O59 A;  2CDP A;  3C7O A;  4BXS V;  4A42 A;  1H6Y A;  1CX1 A;  2X05 A;  1OT5 A;  3SEE A;  2YFZ A;  1UYZ A;  2E33 A;  3J7H A;  4GZ9 A;  1PMH X;  3A22 A;  1EUU A;  2VJX A;  4MO3 M;  3A7Q A;  3UES A;  3C7E A;  3WNM A;  1F4A A;  2LS6 A;  2QQI A;  3WQB A;  4UOJ A;  3T0B A;  2J1T A;  3T0D A;  2Y6K A;  5JUV A;  5IYY A;  4ARX A;  2J1V A;  3WNK A;  4A45 A;  4E8C A;  1JZ3 A;  4XUP A;  3VD7 A;  2VQU A;  1DP0 A;  4DEQ A;  2WO1 A;  2VL4 A;  4BJ0 A;  1CZS A;  2VMD A;  1H6X A;  1UMI A;  2WO3 A;  2W3J A;  4KI5 M;  2ZEY A;  3THD A;  1UYY A;  5JXI A;  4AAX A;  2VZ1 A;  3K77 A;  4JKK A;  3VD3 A;  2E26 A;  1MPX A;  4BK5 A;  3GDB A;  1TG7 A;  4XUO A;  1PX3 A;  1JU3 A;  4MGQ A;  1UX7 A;  3CIH A;  3P6B A;  4OMD A;  5B4N A;  3K4D A;  4QX3 A;  2XOM A;  3I2J A;  3OEB A;  2W94 A;  5C71 A;  3C7H A;  2VOT A;  5IJR A;  1L7Q A;  2VZV A;  3THC A;  3T2O A;  3EYP A;  4QB2 A;  3HEI A;  4M4R A;  1ULO A;  1EUT A;  2QQJ A;  2ZEX A;  4OZO A;  3HNM A;  1DLC A;  1UWW A;  3I2I A;  1O8S A;  4D0Q A;  4KMQ A;  4QDS A;  3T09 A;  4XVH A;  1SDD B;  4MGS A;  4XUR A;  2J1E A;  2QQO A;  3WNO A;  5C70 A;  2DDU A;  3DYO A;  4GWI A;  3OEA A;  4P5Y A;  2V4V A;  3CDZ B;  3WF1 A;  2B4K A;  2VZO A;  3FN9 A;  3ECQ A;  1GNY A;  3OGR A;  3SKV A;  1K42 A;  1GU3 A;  2EIB A;  1UY1 A;  2KD7 A;  2VCC A;  2BER A;  4QB1 A;  3I2G A;  1JYW A;  2J1S A;  2YC2 A;  4GWJ A;  4LQR A;  1L7R A;  4L0P A;  1GOH A;  3P1I A;  4D8M A;  3LPF A;  3U37 A;  5FUI A;  1CIY A;  4DUW A;  2W1Q A;  4DEV A;  5I0D A;  3HN3 A;  4YPJ A;  2BZD A;  4ET7 A;  2QBX A;  1GQP A;  4QAW A;  5LA2 A;  2EIE A;  1W9W A;  3GGL A;  3D3A A;  5EIY B;  2WUH A;  4XZU G;  3I2H A;  4OMC A;  3HJR A;  1JZ6 A;  5DN2 A;  4DXS A;  4FI9 A;  3ZM8 A;  1SG3 A;  1WKY A;  2V72 A;  5DQ0 A;  2VCA A;  3OGS A;  1XNA A;  4A41 A;  4DUX A;  2J22 A;  1NAE A;  2W46 A;  2VZT A;  1RYY A;  3HPN A;  1KGY A;  1JZ2 A;  3WF3 A;  2ZEW A;  2VMF A;  4RYD A;  1JI6 A;  3IB3 A;  3VD9 A;  2WDB A;  3C7F A;  2W95 A;  4A4A A;  3CZU A;  4IUG A;  1K45 A;  1YQ2 A;  4LPL A;  5JR2 A;  1TVG A;  3WSO A;  2PQS A;  1HN1 A;  3NJX A;  4ARY A;  2VZ3 A;  1UYX A;  1JHJ A;  2Y6J A;  2W1U A;  1KEX A;  3CZJ A;  4W50 A;  4QX2 A;  1OF4 A;  3GM8 A;  1JZ7 A;  1SHW B;  4CUC A;  5IHR A;  1LNS A;  1GOG A;  3SKJ E;  3ACF A;  3NQH A;  4PQQ A;  5G05 L;  1UY4 A;  2EIC A;  4PF1 A;  4OUE A;  1JZ5 A;  2VZQ A;  3VD5 A;  3DEC A;  5G04 L;  1P8J A;  4LHS A;  3HOB A;  4QPW A;  4W4Z A;  5F7U A;  3K75 B;  4KWU A;  2HYX A;  4CU8 A;  3PUI A;  4QX0 A;  1W0N A;  3IAQ A;  2J1A A;  2WQ8 A;  4TXW A;  3LEG A;  5JXH A;  3CQO A;  4RN5 A;  3I3E A;  3LEI A;  1OH4 A;  2VMC A;  4LKS A;  2C4X A;  3CKH A;  3MUZ 1;  3MV1 1;  1OF3 A;  4HG6 B;  1W99 A;  1JYN A;  2WN2 A;  1W9S A;  1PMJ X;  3K4A A;  5JXJ A;  2CDO A;  2DCK A;  5JXG A;  4QX1 A;  1W8N A;  2RJ2 A;  2QQN A;  1NX9 A;  3LPG A;  2W5F A;  3VDA A;  3WNP A;  3I3B A;  3K4Z A;  2VZP A;  3PUH A;  4QB6 A;  3VDB A;  2WN3 A;  4TTG A;  3ABZ A;  3OBA A;  1JZ4 A;  2W1W A;  4QDQ A;  3CMG A;  5HXM A;  3FHQ A;  5LA0 A;  2Y6H A;  5IFT A;  1GMM A;  2X09 A;  3BN6 A;  2Y6G A;  3NJV A;  3W5M A;  3SEP A;  1UXX X;  5HPO A;  3I2F A;  2DCJ A;  2QQM A;  2WO2 A;  2HLE A;  3HNB M;  3LQC A;  3F2Z A;  2ID4 A;  4UI9 L;  2ZXQ A;  4ZZ8 A;  4CU9 A;  4CU7 A;  2R7E B;  1CZV A;  1O8P A;  2J1R A;  1ULP A;  3WF0 A;  1UY0 A;  3DYP A;  5B4X A;  2RVA A;  3WF2 A;  4DXT A;  3I97 A;  2W91 A;  1JZ8 A;  4JX0 A;  3W5N A;  3E1F 1;  2QQK A;  5LCW L;  3UNP A;  5EJZ B;  1GOF A;  2VC9 A;  2RV9 A;  2V5D A;  1K3I A;  1OD3 A;  4Z2A A;  5EJ1 B;  4DUV A;  2W47 A;  3FL7 A;  2VME A;  3I3D A;  1GUI A;  4AG4 A;  5CYY A;  3A21 A;  3AC0 A;  2VZS A;  3I2K A;  4P00 B;  3T0A A;  4A44 A;  2VM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...