3FLPA

Crystal structure of native heptameric sap-like pentraxin from limulus polyphemus
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
217
structure length
217
Chain Sequence
AVDIRDVKISFPGTQNPKFPHLRFMQTLPAVRQLTVCQRIKPFHRNTGYIFSCATSNQDNQFITSMYVKSDGTLNLGLQVNASSNKYISCPIEIELGQWYHVCHVWSGVDGRMAVYANGSPCGTMENVGKGHQISAGGTVVIGQEQDKIGGGFEEQESWSGELSDLQVWDEALTTHQVSTVASCNGIRPRGNVISWMEDSFVADDGVIVGISHMCSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords SAP-like pentraxin
publication title Crystal structures of Limulus SAP-like pentraxin reveal two molecular aggregations.
pubmed rcsb
total genus 52
structure length 217
sequence length 217
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00354 Pentaxin Pentaxin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3flpA00
2W52A 1DQ6A 4YFWA 1N3OA 2WJSA 3V65A 4FOVA 3V0BA 1WLWA 2UWAA 1C1FA 3NV2A 1LGNA 5EWSA 4JCKA 1V6JA 2A3WA 2D6PA 3WDVA 1VALA 2VUAA 5H9PA 2HYKA 4YM0A 3NV3A 2E51A 2TEPA 1GV9A 1GLHA 1S0JA 2DTWA 2DTYA 3POYA 1LULA 3O0XA 4C1XA 1CN1A 2NP0A 1U0AA 3FLPA 3AZYA 1MS1A 2D6MA 4YGBA 1ZM1A 4YGCA 2P37A 5KXDA 3AJYA 3O12A 5T55A 2WSUA 2JD4A 4YG6A 1QGLA 2JDZA 2ZZJA 1GZ9A 2A7AA 1Q8SA 1CPMA 2ERFA 4CRQA 3B01A 4PBOA 4FPJA 5KXEA 3PJQA 4GXLA 4XHXA 1AXYA 3N36A 1QU0A 2WQZC 4Q2FA 5H9QA 2BQPA 3ZVXA 3SH5A 2AENA 4U2AA 3B69A 1LODA 1MS8A 2G4IA 4F83A 5CBLA 2VW0A 1IKQA 1ONAA 2JECA 1BKZA 4Q26A 1QOOA 3NV1A 4HL0A 2AUYA 2CL2A 1QOTA 2ZGSA 5DXDA 3HMYA 5E8AA 4YW3A 4H55A 2DVFA 2A71A 5DZGA 1N3PA 1IS3A 3AXDA 1SACA 3N7JA 2XB6C 1Q8PA 1QDOA 5GZCA 5T52A 3B00A 4Y1VA 4Z8BA 4OZXA 4GKYA 1QOSA 4GWNA 1W6MB 1QNYA 3PVEA 4Y26A 1N3QA 2LTNA 3MW4A 4UW6A 5GZEA 4FOYA 4YZ1A 1WLDA 3ZYPA 3OBRA 3RSJA 1FNYA 4XMAA 4AWDA 1DZQA 2W08A 3L2YA 2WLQA 1LECA 1W6OB 2ZMKA 1IS5A 1WW7A 4AGGA 1PZ9A 1JUIA 4FPYA 3VV1A 5EYXA 3TB0A 5IT6A 2GN3A 3A0KA 1G9AA 2ZMNA 1YIFA 4YW1A 4XTPA 4YFZA 4Y1XA 5LK5A 3HR9A 3RQ0A 1G7YA 3ZXKA 4TYSA 1URXA 1VLNA 4R9BA 2E53A 2XG3A 3O0WA 4ATEA 3PMEA 1YYNA 3T1LA 1AZDA 2A75A 2EXIA 1CR7A 4ISRA 2Z42A 1CJPA 4DFSA 4LBQB 2PHRA 4Q27A 4YG0A 1GBGA 4FQ4A 1TEIA 1VIWB 1PZ7A 3ZYRA 1JYCA 1CONA 1JN2P 2AH2A 3M2MA 4I30A 3ILFA 1AX0A 1LHNA 1C57A 4M3CF 2D3SA 4FOQA 4R9CA 1LESA 5GLVA 1DBNA 1KQRA 2R49A 2W39A 3BOPA 2EXHA 3SISA 1YRZA 3U4XA 3Q9OA 3WCRA 4PBPA 1WUVA 3INAA 1MZ5A 3DUIA 3V0AB 4Q8LA 4Q1PA 4BOWA 1KJRA 3IKWA 1WLCA 2R0FA 4Y1UA 2PHFA 2SLIA 1N47A 4XE9A 4YW5A 1WW6A 5GZGA 4LBQD 1QDCA 2A5ZA 1JHNA 4K21A 3CNAA 1DHKB 3RG0A 3V0BB 2VW2A 1YXWA 2A6XA 3AJZA 5GLUA 1WD3A 4BM8A 1S1AA 4GA9A 3M3OA 1F5FA 4JC1A 4W65A 3GALA 3T1MA 3V64A 2NZ9A 4NO4A 1QF3A 1Q8OA 2GNDA 1LOCA 2P3KA 1G86A 1DQ1A 1LJ7A 1SFYA 2CYFA 2VH9A 2GNTA 3WHUA 4AVSA 1UMZA 1KJLA 1JW6A 3AYEA 4ZKTB 3WUCA 1OKQA 5JMCA 4DRVA 2GN7A 1MS3A 3WHTA 5GLTA 2ZGQA 3IN9A 2EALA 4C1WA 1HQWA 1S0BA 2EAKA 3AZVA 3VKMA 1LOEA 3O0VA 3WDYA 3ZSKA 2GMPA 2WT1A 4YM1A 1GSLA 3APBA 1H9WA 1LEDA 3AP7A 3AP5A 3WV6A 4AVVA 3PVNA 1B09A 1SLIA 4WV8A 2DYCA 5DG1A 1FATA 1V00A 4XJ8A 2WNEA 1LHVA 4FP2A 4Y24A 1SLAA 1Q56A 3A0NA 1YI7A 1C4RA 2V5YA 4BLIA 2A6VA 3SH4A 5GLZA 2EIGA 4JRAA 3ZPYA 3USUA 4XTMA 3AP4A 3QCWA 4HANA 1FV3A 3B3QE 2YMZA 2ZABA 4NOTA 4BLJA 1GNHA 5KXBA 1VAVA 3BODA 1ULFA 4YG3A 1CESA 2D6KA 2AREA 5GLWA 2FHRA 1DQ2A 1ULDA 5GM0A 3WOGA 4LBOA 3TAYA 1CVNA 3W58A 5JOXA 4DPNA 4UW3A 2JE7A 2ARBA 3AYDA 4LBLA 2P2KA 3VKOA 1SCSA 1N1YA 1WBFA 3KQRA 4M3CA 5T5OA 4Y22B 2NN8A 2ZGRA 1GYKA 1WBLA 2P3IA 5GZFA 4D69A 2D6LX 4Q8KA 4XJZA 1N1TA 4XBNA 2GNBA 4FPEA 3OY8A 2OUJA 5DUWA 3WG2A 5IK8A 5CA6A 2A3YA 3D4KA 1SLLA 3RMYA 1LHWA 2D6OX 1N1VA 3UK9A 4CTEA 2CY6A 1DQ5A 4LBJA 1JYIA 5T5PA 1V6KA 1Y7BA 1ENRA 1MVEA 4DRRA 4WVWA 1SBEA 4Y20A 1WCSA 2A70A 2B7YA 5KXCA 1V6MA 4SLIA 4FPHA 4ASMB 4BMEA 2ZHKA 4M01A 4P14A 1LTEA 1D0HA 3ZXFA 1S0DA 1APNA 2CWSA 2C5DA 3R05A 4P9WA 4PF5A 3N3HA 3AZWA 2JE9A 4UW5A 2R1DA 5T50A 1I1EA 1IKPA 2DUOA 1HLCA 2LALA 1ULGA 3AYCA 3UL2A 3VKLA 1SBFA 3MEPA 4ATFA 1MR5A 3AYAA 1G9BA 4RA0A 2D7FA 2ES3A 4WZFA 4YGEA 3R4UA 1JBCA 1UZZA 3AP6A 2DURA 2I2SA 2P3JA 1NXD1 1FNZA 5CB7A 2A6YA 3VKNA 1AVBA 4FPKA 2VW1A 1UZYA 3D6EA 1A78A 3N7LA 3MW2A 4AGVA 1BQPA 2ZGNA 4BQ1A 5F9TA 1SCRA 3SITA 4XXAA 3N35A 4R9DA 3UJQA 3FLTA 1N1SA 3WG4A 4FPOB 3WDXA 3M3CA 2DVGA 3RRDA 1MS0A 3AFKA 4UW4A 2ZGPA 1LOGA 3QLQA 1ENSA 1A3KA 5E88A 2EF6A 2GDFA 3NV4A 4ISQA 5DUXA 3BIWE 3OPZA 1W6PA 3OJBA 3D5OA 5GJ6A 3IM0A 1KDKA 2KM2A 1MACA 1Z78A 3ZXJA 2OW4A 1H30A 3ZSMA 1W6NB 1HKDA 2PHWA 2UWBA 2DUQA 1XQNA 3M1HA 3NWKA 4GKXA 5GZDA 2JKBA 2WKKA 3I4IA 1DFQA 1S0FA 2D3RA 3ATGA 2YY1A 1WW4A 3ILNA 1V6NA 4YZ2A 4BPZA 5DUUA 1W6OA 3FFZA 4KBBA 2NMOA 2PHUA 3VKFC 1O4YA 1S0EA 4PCRA 1F31A 5T54A 5GALA 1MZ6A 3WG1A 5IK4A 4GALA 3ZSLA 1SLTA 2DVAA 2YROA 4YZ4A 1G9FA 1QMJA 1JXNA 1AF9A 2NMNA 4XOGA 3ENRA 1CQ9A 2UWCA 1GZWA 1SLBA 2JJ6A 4FPGA 1GICA 3AK0A 1BYHA 1HQLA 1W6QA 1IOAA 3WDWA 4LBQA 2ZGTA 1UKGA 1EPWA 4XJ9A 4FPCA 4M3CB 1C1LA 2ZGUA 1H9PA 2A3XA 3ASIA 3IPVA 2ARXA 2AYHA 1V6OA 3WLUA 1NLSA 2ENRA 1DQ0A 4XJWA 4LBKA 4YLZA 4TZDA 3OY8B 1LEMA 1QNWA 2D3PA 2PELA 2ZAAA 4Q1RA 4XMIA 4YZ3A 2D44A 3LCPA 2AR6A 3SNMA 3N7KA 3PVOA 4CZSA 2H0BA 3R4SA 1LOBA 1MS9A 3KM5A 1KRIA 2WSVA 2DV9A 2EXKA 2ZGLA 5SV8A 2VY0A 4XHBA 4XJUA 3FUQA 4Y1YA 3AXEA 2NYYA 5AVAA 4DQAA 2DUPA 2D43A 1KITA 1YO8A 1BJQA 1LENA 1GKBA 2CWMA 2ZHNA 1ZA4A 4M00A 5DUVA 3B9CA 1VAMA 2OVUA 2PHXA 4FVVA 3RMXA 3WDUA 2ZHMA 1CIWA 1RIRA 5L73A 1BXHA 3POWA 5EYYA 3LSDA 2Q5TA 4LBNA 1V6IA 3O5SA 5DZEA 1RINA 2YXSA 4FP3A 4M3CE 4XILA 3WUDA 3WG3A 2EXJA 5FREA 4XIKA 3FLRA 3OYWA 4FQZA 1G8WA 4BMBA 5H9RA 1CPNA 1Q8QA 5JOZA 2W68A 4DS0A 2GMMA 3RS6A 1WD4A 1LOFA 2E7TA 5JOWA 1BZWA 1DQ4A 3WVJA 1LU2A 2ZGOA 5EXOA 5CNAA 5E89A 2CNAA 5JDBA 3JUUA 3SLIA 3VUOA 1LGCA 4K1ZA 3WNXA 4XYXA 3M3EA 1V6LA 2V73A 2GNMA 2DVDA 1Q8VA 2ZMLA 4XBQA 2VU9A 2ZKNA 2R0HA 3M3QA 4IQPA 1AX1A 1W6PB 1ULCA 1AXZA 2ZGMA 1MS4A 3HN1A 2VXRA 1UL9A 1SBDA 5DG2A 3WZ1A 4K1YA 1GZCA 2ZHLA 3GNEA 1IS4A 1F9KA 2UU8A 4K20A 4XDQA 4XJAA 3WDTA 3IMNA 5DZFA 1DLLA 1UX6A 3JU9A 3OGGA 5IK5A 1LOAA 5BYNA 2NM1A 3MPPG 1W0OA 5T5LA 1FAYA 1MS5A 1PZ8A 1LHOA 1SLCA 1LU1A 4Y22A 2DU1A 1AX2A 5F5QA 1DGLA 2WT2A 3AP9A 3ZXLA 4GWMA 2A6ZA 2ZGKA 3LSEA 3T2TA 2PHTA 1A8DA 2DVBA 1GZWB 3WCSA 1FV2A 5IUQA 1AJKA 1W6QB 1UN1A 2GALA 5HCAA 1O4ZA 1ENQA 3MW3A 3AZZA 2CTVA 1OFSA 4ITCA 4XXPA 1W6MA 3FUOA 4YW4A 4FPFA 5HCBA 3ZXEA 3IPVB 1J1TA 4YZ5A 2YV8A 5HCFA 1LOFC 1ULEA 2RHPA 1LGBA 3FBYA 2OUHA 2YZ4A 4PQ9A 1DYPA 5FRAA 1GNZA 3C2UA 1JOJA 3BTAA 3USUB 1KDMA 5H9SA 2WT0A 4RL7A 4AGRA 1D2SA 4WVVA 3UJOA 2A6WA 1DYKA 2ZACA 4Y1ZA 4AVTA 3AZXA 2P34A 2C9AA 3SH3A 1OQ1A 5JLVA 1MVQA 2ZA9A 2GMEA 4YW2A 1HDKA 3OBTA 1LHUA 5JOYA 1G9DA 2E6VA 4LBMA 4MYEA 4ZXKA 1QKQA 1W0PA 1UPSA 4XIOA 4FOWA 3I8TA 4YGDA 1R1ZA 2SBAA 2ZBJA 2E7QA 3DGTA 5IK7A 1X50A 1AXKA 1LCLA 5CAZA 4P9YA 4YM2A 4FPLA 2AGSA 1FYUA 1AJOA 3N7MA 2R16A 1S0IA 1S0CA 1I3HA 3AX4A 4L8QA 1S0GA 4AYUA 1G9CA 1FX5A 5T5JA 2UURA 2DWRA 1IS6A 3H0OA 3OYWB 5JVVA 3W59A 2D6NA 3POSA 3ZSJA 2DU0A 4YM3A 1DIWA 3A4UA 3V0AA 2FMDA 1GANA 1RITA 4U36A 1Z0HA 2R1BA 1UAIA 4P9XA 1WW5A 4Y20B 4XBLA 3ILRA 4XZPA 4R9AA 1W6NA
chains in the Genus database with same CATH superfamily
2EVXA 1N3OA 2XLFA 2XVKA 5BNNB 1RUF3 4K7JA 3GBFA 4CSWA 3S7EA 2BOJA 2A3WA 1M4WA 5H9PA 2JDYA 1PIV3 3KV9A 2VCCA 2E51A 2QNKA 2OQ6A 4RR3A 3FFQA 1S0JA 3FZ3A 1H8TB 4HT1T 2DTYA 3MUY1 3ZLIA 4QDQA 5IFTA 3BU7A 3OBAA 4LO5B 5FKBA 1MS1A 1NYWA 3T0AA 1VMJA 3D82A 5AFBA 2JD4A 4YG6A 3O1RA 3GCXA 2RS12 4IE7A 5FZ8A 4B29A 3H7JA 1GZ9A 4GH4C 3T4HB 3VBUC 3RWNA 1Q8SA 1EV13 3HJRA 1UW8A 3B01A 4DMIA 2BV4A 5C8CC 4FPJA 5KXEA 1UYYA 3PJQA 4GXLA 3N36A 3MIEA 2Y0OA 3ZFGC 1W9TA 3IAQA 3SCHA 3B69A 3MHZA 2C24A 2G4IA 4I3GA 4F83A 5CBLA 1BKZA 1AL22 4CCCA 3Q8BA 2HLEA 5CIRA 5HBAA 1QJY1 1AR92 4LXLA 4H55A 2DVFA 5DZGA 4KU8A 2WA3A 1W9FA 4JHZA 4FTBA 3AL5A 1Q8PA 2XLAA 1FPN3 4IETA 5GZCA 4BQ2A 4BQ5A 4FXGB 1RUF1 4KGQA 5LRRA 2WNVA 4LJHA 2W92A 2PTMA 1BEV2 1MEC2 2EIDA 3POBA 3VHPA 1KS5A 3ZDSA 1PIV1 4FOYA 1XNAA 5D2AA 3ZYPA 3OBRA 3MIDA 4AWDA 2Y0IA 1DZQA 2BGPA 2VMHA 5FY4A 2Y34A 2ZMKA 1Z7S3 1GUIA 3AC0A 1H1AA 5IT6A 2ATFA 3ZYFA 3KV5A 1G9AA 4N7UA 4YW1A 4XTPA 3QH7A 1XYOA 3GZTB 3RQ0A 2YHJA 1G7YA 1TQ5A 4AI0A 1O6UA 1EV11 1URXA 4TYSA 4ZPIA 1D7PM 4AF9A 4ATEA 4B1LA 4CDXB 2B45X 4QGLA 1YYNA 4RYDA 5C8WA 2A75A 4HKWA 5C3PA 3CLPA 2GU9A 1CR7A 5K0UB 2ET7A 4JGZB 4Q27A 3ZXGA 1UZ0A 1NQDA 1ODNA 3TN92 1ND2B 5FY7A 1A8MA 3BTZA 2ZEYA 3M2MA 4XFGA 5EJ3A 4TWTA 1C57A 4MX3A 2VTXA 2D3SA 4FOQA 4RGAA 2HEWF 4CDWB 5GLVA 1V9U1 4ZZ8A 3VBHA 1KQRA 2FDHA 2PHLA 3DYPA 1C3HA 4S2DA 2VQ0A 2P3YA 2KD7A 4BWOA 5C4WB 4PBPA 3INAA 3SKVA 1Y9GA 3MIGA 4Q8LA 4BOWA 4QU2A 2KR2A 4Y1UA 2PHFA 2WRAA 3JD71 2SLIA 3ELNA 4ZU4A 4O61A 1XB9A 4LBQD 4IV3A 3ZIWA 4QB6A 4XF1A 1JHNA 3VD4A 2X5IC 1ULPA 1S2KA 3ZDVA 1YQ8A 4LULA 1Z7S1 4MZUA 3V0BB 3MPBA 1AR72 2KXLA 2VZUA 1AR83 3RNSA 4BM8A 4AEDC 1DGRA 1F5FA 2WNUC 3V64A 3GALA 1RUOA 4TN7A 5EHDA 2QDNA 1W06A 2YPJA 4CEYB 2CYFA 2VH9A 2WWUA 2E9QA 1SPPA 4M0HA 2IC1A 4P9JA 4P02B 4LO7A 2H6BA 3VBFC 1GWMA 1W9SA 3PUQA 1VAKA 3WUCA 3V56A 4B4PA 5FYVA 4Q4V2 4PI0A 1MS3A 2NQYA 3WHTA 2ZGQA 1W2AX 3IN9A 4CPBA 3IIAA 1S0BA 2WQ4A 4UI9L 1BLZA 5EPAA 3WDYA 2GMPA 3H8OA 2TUNA 1ST8A 3APBA 3PIGA 4AVVA 2VZ3A 2XJPA 2QBXA 2PN5A 2BWCA 4KU7A 4MGKE 4FP2A 1SLAA 2VBDA 5BV6A 1C4RA 2V5YA 1J58A 1R1A2 2W91A 3ETQA 4YVSC 5LB6A 2YC0A 5AC93 1WCQA 1ND3A 2QVSB 4LUKA 2G1MA 1OPOA 1W8ZA 4XTMA 4HANA 3VB9A 2BBVA 3DN7A 3I2GA 4IEVA 5G05L 3NVCA 4PLMA 3BODA 3J8F3 1CESA 1UNBA 1AR81 3F95A 2FHRA 2XQXA 1RGSA 3TAYA 1CVNA 1O3SA 4M0NA 5KHHA 1TME2 4HVOA 4Z92B 5DDJ2 4UW3A 1DF0A 3VBOB 2P2KA 2BJSA 3LF7A 1N1YA 3HQXA 3GGLA 1X8EA 3KQRA 4FTSA 2OA2A 3WINE 2FZ1A 3ECQA 3VBSB 1IPSA 5FP4A 4A7KA 1RUJ2 5C71A 3CEWA 1V0AA 1OH3A 2GNBA 4FPEA 1QHDA 2OUJA 5DUWA 2J1TA 1RUH3 4XAAA 5CA6A 5CEHA 1SLLA 4FO9A 3BPSA 1PGW2 4CTEA 2OQ7A 2AEYA 4RQPC 5F5CA 1CX1A 4BB3A 4ZS3A 1WMXA 4N53A 4AHXA 1ENRA 2Q4SA 5EQUA 3RZZA 1W99A 3NJXA 4DRRA 2DCZA 5KHJA 3AVRA 4IGQA 3ES1A 5AC91 3P1IA 3AL6A 4G4FA 5I0DA 2RMU3 4QPYA 3LOIA 1HXS1 3RFRA 4ASMB 4FBFA 2ZHKA 1D4M3 1YUDA 4M01A 2BFUS 4GIQA 5K8SA 3N4MA 4YVWA 4Q0QA 3R6SA 2ARCA 4P9WA 5ERLA 4EWEA 3N3HA 3AZWA 2WZPP 5LRSA 3TEXA 5FZHA 1CAUB 2JB4A 3AYCA 2PQQA 3J8F1 5F1RA 3HN3A 1CGPA 1MR5A 1O3RA 1NY72 4GMP1 5FCCA 2ES3A 3WX5A 4YGEA 4CUAA 1JBCA 5A6QA 2RJKA 1CAWB 2DURA 3HBZA 4RGKA 3ZFGB 1FNZA 2VMCA 4PF1A 1RUNA 3MGUA 2F6BA 5I0SA 1A78A 3U4SA 3N7LA 3O1PA 3PU3A 3MW2A 1E5HA 3ZR5A 4AGVA 4COWA 3W5MA 1A34A 3KCYA 1T6GC 1ZRRA 2BU9A 2OZJA 1HB2A 3UJQA 5D8AB 1RUH1 1QJX3 3OUHA 4F7ZA 1W39A 2G9FA 2WFF3 3AB0A 1LOGA 1CZSA 1ENSA 1YIPA 3AMMA 3KD4A 3NRUA 4ISQA 1UU4A 4EV0A 5F7UA 3ETPA 3OPZA 3K75B 1H4GA 4LEJA 4ZU5A 1W6PA 3LZZA 5GJ6A 2K2SA 4L11A 3SMHA 1NZIA 2Y33A 4XCAA 4DEVA 4P00B 1QJZA 4XUQA 3JCIA 3LA7A 1MACA 4PI2A 4ZZ5A 3ZXJA 4MG2A 3LQCA 2XJUA 3K3OA 1W6NB 5FP3A 3ZSMA 4COUA 5CFDB 1HRI3 4IXLA 4MADA 1TMF3 2PHWA 2UWBA 3BUCA 1O59A 3URFA 3VL9A 3AVSA 2IVIB 1S0FA 1W8FA 1RUE3 1WW4A 1YQCA 5EJZB 1K12A 3ILNA 3K4DA 1JOPA 5AVPA 3ZYIB 1PGSA 1CZTA 5DUUA 3AFGA 2YUEA 3LA2A 1S0EA 3ZKYA 4O7XA 1YI9A 3VHOA 4CPBD 4GALA 4NHLA 4DXRA 1JZ7A 4UFMA 1TE1B 1G9FA 1MQTB 1K5JA 2RG4A 1PVC3 1YFYA 4Q0VA 1AF9A 2D93A 3LDRA 2OZ6A 2XLGA 4E4ZA 1GZWA 4FPGA 3AK0A 1W6QA 4QXBA 5G04L 5C70A 4AR2A 4JGZA 1VBD3 2Q8CA 1UKGA 1QJX1 4XJ9A 2BEOA 1XNDA 3OEAA 3GBGA 3IPVA 4Q5OA 4META 4IERA 3LGRA 3NNGA 2W47A 4NRPA 1NLSA 4AHWA 2ENRA 1DQ0A 2VMEA 4RSUA 4QDRA 1RUC3 3MLJA 3RZHA 2DCKA 1XNBA 1BCXA 2D3PA 3DPRA 4TLFA 5EV7A 4BK5A 2P4EA 2XL7A 3PVOA 3NSTA 2J1SA 4NN0A 2X5IB 3R4SA 2E31A 1HQNA 1HRI1 1MS9A 3VN4A 3LFMA 1YFWA 1TMF1 3WP3A 3KT7A 2C6SA 4Q4W3 1NAEA 2EXKA 1YQ6A 2ZGLA 4AEDB 4XHBA 3RJRA 3FUQA 3WEZA 5FZMA 1QQP2 3MBWA 2VGDA 3W21A 5AVAA 3C8XA 1VRH1 4CEWC 1GP4A 2X29A 5FKCA 1YO8A 1VR3A 1X9PA 4QPWA 1LENA 1TZOA 4Q4X2 1GKBA 2VVEA 1I5ZA 4GWJA 5J48A 5DUVA 4HPKB 1SZBA 1OF4A 4I09A 3POFA 3MYXA 3VBFB 5L73A 3OD0A 5J37A 5EYYA 3ZYBA 4YNIA 3ZFFC 1ODMA 4LBNA 5DZEA 1IQAA 1PVC1 1ZZ8A 4QB1A 5DPNA 4B4QA 4CEYA 4AI9A 3DXTA 3Q8CA 4PIYA 3WUDA 4CDQA 2EXJA 2QQWA 3I2KA 5JAXA 5I0TA 1VBD1 2R30A 1TG7A 2VG9A 2W68A 4LHLA 1SFNA 1ZZBA 3OG2A 4LA2A 3FWEA 4YVSB 2E7TA 1DQ4A 1LU2A 1RUC1 3FMGA 4HSJA 2Y6HA 2ZGOA 2FBEA 1UOJA 5JZGB 5FPBA 2J7MA 4XF0A 3U78A 3NJZA 4AFAA 5ACA2 3WNXA 2E63A 3H8UA 4KG8A 3VZKA 1J1LA 2GNMA 2V5DA 4XBQA 4IQPA 4Q4W1 3FBMA 1MPXA 1ULCA 1WLTA 3U11A 5CFCA 1UL9A 1RMU2 1RTVA 4DINB 4K1YA 2ZHLA 1SMVA 1YHFA 4NVPA 4WVMB 3ZX7A 4EZ4A 5JXGA 5CKQA 4ZXEA 4K20A 2HWF2 2R073 3DL3A 2RR13 3IMNA 3OB8A 4QPIB 2AC1A 2QQVA 3WQBA 1ZBE2 2BUKA 5J1XA 4Z2WA 4B4RA 1IG3A 1EYBA 3MPPG 4UF0B 5T5LA 1FAYA 1PZ8A 4PDWC 1COV3 1LU1A 2J22A 3OGJA 4F3JA 5J7MA 1C8M2 4RQPB 5C5UA 1ASJ2 1DGLA 4PQQA 1NT0A 5FR3A 2AACA 1KD7A 3LA3A 5FFOC 3EMRA 2GC2A 2VNOA 3KCCA 4D8MA 1EP0A 3M70A 5JIAA 4HSLA 5BNPB 1YNAA 1ENXA 2FMYA 3HNMA 3BIEA 3DF0A 3MW3A 1VBC3 2BNOA 4WM7A 5A70A 1OLME 4YW4A 5HCBA 1W6MA 2Q1MA 3TYJA 4FPFA 2WN3A 1YFUA 3ZXEA 5FZ0A 4GB32 2WS92 1XE0A 3POJA 5F2SA 1BBT3 1ZBA2 1UKRA 1VBE2 1W3XA 3IB3A 4E27A 5HCFA 1LOFC 2RHPA 5HI0A 1Y9MA 3FBYA 3W9AA 1PO13 5FZIA 1DYPA 1MZFA 5FRAA 1GNZA 1OKOA 3RYKA 4BU2A 1EY2A 1W2TA 1CZVA 4AGRA 3UJOA 3WP6A 5DABA 1GR3A 2VE1A 4JAAA 4Y1ZA 4AVTA 1EUTA 3MLLA 4AAXA 2P34A 2R071 3VBUA 3E6CC 2RR11 4GH4A 4C0BA 5C8CA 1MVQA 3UGFA 2GMEA 5DAXA 1HDKA 2LM3A 3DKQA 2RS53 3OF1A 2E6VA 4LBMA 4ARXA 4BIFA 1H8TC 2VC9A 1G9DA 2XR4A 4ZXKA 2YGLA 1QKQA 4EZHA 3LFIA 1UPSA 4XIOA 4NJ4A 1R1ZA 1SDDB 4LR4A 1COV1 3WQ7A 4AQ6A 2VUDA 2FCTA 5KHKA 1AXKA 5FZCA 5BXXA 1RVF2 1UZVA 3J4UH 5FTTC 4E2SA 2WO2A 5I93A 4FPLA 2Y64A 1AJOA 2YGMA 4SBVA 1S0CA 3AX4A 2B8MA 3S0MA 5FWEA 3I49A 4R52A 4IEWA 1G6NA 1XNCA 3H0OA 1CAVB 1X33A 2D6NA 5JUVA 2XKPA 3POSA 3B9IA 2DU0A 3KVBA 2IXHA 2W2IA 3BB6A 3ZO0B 4YM3A 3V0AA 1LAJA 5A7PA 1BBT1 4P9XA 4CCEA 1W6NA 1W9WA 2YFUA 2W52A 5LZ6A 3CJXA 1RJ8A 4FOVA 3C3VA 2FQPA 2JIJA 1C1FA 3NV2A 1C8NA 1R083 4UFKA 5F5AA 2D6PA 4LA3A 4NWVA 4ES9A 1O3TA 5FYIA 2RS33 1RUD3 5FO8B 3NV3A 1RUG1 5FZOB 4JV4A 1OUXA 2XBO1 2TEPA 5HXVA 3ZIXA 4W6XA 1GLHA 5LBFA 3PTYA 3TNQA 3O1VA 2UY8A 3POYA 4LKEA 2BPA2 3RYPA 4AFCA 2C26A 5FZEA 2W3JA 3FLPA 2XHKA 2UY9A 3QD6A 3RPQA 5C9AC 3HEIA 1ZM1A 4UAPA 3AJYA 3O12A 5T55A 3I3EA 2XDVA 1QGLA 4OHVA 2JDZA 3K2OA 5FMCA 5FMBA 4Q4Y1 2A7AA 4CRQA 1CPMA 1OLRA 2ERFA 2WZR2 2DCTA 5FK7A 4IEXA 4TLGA 5CZKA 3QH6A 4IE6A 4CDXC 4E4HA 4H7MA 4Q2FA 4OI0A 2AENA 4JZRA 4U2AA 3LPFA 1MS8A 5K0UC 1VRBA 1JZ4A 2VW0A 1ONAA 4PIZA 4Q26A 4IE0A 4NRQA 1K3IA 4XFCA 4HL0A 4M4RA 1ND2C 2AUYA 3AMHA 3HMYA 4KWLA 3OEBA 3KCXA 4YW3A 3WNKA 3RDIA 2O0OA 4XUOA 2LROA 4CDWC 3AXDA 5L7OC 1D0GA 4X6RB 3N7JA 2VAUA 2X5IA 2B9UA 3K77A 4WM8B 3UETA 2HWB2 1FMD2 4OZXA 4GKYA 5C4WC 4C8DA 2JEMA 5CISA 2W46A 3RJ2X 4QMAA 1R081 1PO22 1U5ZA 2WNUA 5IVJA 3NJVA 2BFUL 3D0SA 3MIHA 4UW6A 5GZEA 1UMIA 3T0DA 3ZFFB 1YCIA 4XUPA 1FNYA 5FY5A 1OXCA 2K46A 4AI8A 4QT6A 1LECA 1WW7A 1PZ9A 1SFPA 1AYM2 2RM23 4IE5A 4N90A 4QX3A 1XYNA 3VZLA 2GN3A 4AOCA 5B2GB 4QPGB 3WNOA 4OUMA 2DF7A 4ZS2A 4BIOA 4YFZA 3MDPA 3K4AA 4CUCA 3HR9A 4DZGA 1OUSA 3I59A 2XG3A 3H3LA 1F5JA 3O0WA 3ZFEC 4AFBA 4CCMA 5JR7B 1AZDA 2EXIA 1NX9A 2XH6A 4MV2A 4LOTA 3TEWA 2VM9A 5GKAC 2Z42A 3SXWA 4YG0A 2Y38A 1W8WA 2XOMA 3I2FA 4YVSA 3ZYRA 1UMHA 2BVBA 4HK8A 4UFLA 5FUNA 4I30A 1L7LA 1CX4A 3ILFA 1LHNA 1RUI2 2JDUA 1NXMA 1LESA 2AZ5A 1NCQC 2YU1A 3JQWA 1RJ7A 3PTRB 3U1XA 4CCNA 3SISA 4E4SA 3VDAA 5CG8A 1I6XA 3U4XA 3WCRA 4E8DA 4FI9A 5LEJA 4OHXA 5A7SA 2QQPA 2F17A 2VZRA 4QXCA 4Q1PA 3VHRA 1OA2A 1ZRDA 5BPXA 4YW5A 4IEUA 3POEA 2Z79A 5BNOB 4XEZA 4G3YC 4QAWA 5CG9A 1W2UA 2VCBA 1DHKB 2GAUA 3CNAA 3ROUA 5JXHA 3AJZA 1WD3A 4QXHA 1S1AA 4GA9A 4XFAA 4IESA 4W65A 5B4NA 1DZRA 2NZ9A 1QF3A 1OURA 1Q8OA 2GNDA 2H0VA 2MEV2 4V2VA 4AI2A 5BUVA 1DQ1A 1SFYA 1IPJA 2GNTA 5SV5A 2HBTA 2VQAA 3ITQA 4RQPA 4XFIA 3AYEA 1Y43B 2J1AA 1XXNA 5FP9A 5JMCA 5LW9A 3DECA 1DP0A 3OTFA 3VBSC 1VBA3 2RDNA 3NMBA 4CCJA 4DXTA 4BE3A 2GH8A 1XSQA 2KA3A 3ACFA 3P6BA 3VKMA 3O0VA 1QJY3 1US3A 2R043 3ZSKA 5A1LA 3KGZA 4LHKA 1GSLA 2C1FA 1LEDA 3AP7A 3RVHA 5LWBA 3PU8A 1JU3A 4XETA 4KMQA 1RUF2 3ZN6B 4WV8A 1JZ6A 4AI3A 3SEEA 3CU7A 1V00A 4NHMA 4DO0A 2C9KA 3A0NA 1YI7A 2CAVA 2QUOA 2XHNA 1PIV2 2C0ZA 3UGGA 5FLJA 1WMFA 4JRAA 4AVBA 2O8OA 2Z5WA 3EHKA 2Q1FA 5FYZA 1PK6B 1J3PA 4NOTA 3B3QE 4ARYA 2X8KA 4QQ2A 4QX2A 1GNHA 4CCOA 1O3QA 3R0RA 1OBNA 4YG3A 2D6KA 2EIEA 4R8HA 2AREA 4OVEA 4LT5A 1EV12 4KNCA 1YJLA 2QZ2A 3HBKA 1E5SA 4QKDA 1QJEA 4DPNA 4XW3A 2JE7A 2ARBA 2ET1A 2VL4A 3DYOA 1WBFA 4URAA 1NZCA 4M3CA 4WZCA 5FYMA 3S57A 2ZGRA 1GYKA 2W5FA 4E2GA 3CJIC 1QWRA 2P3IA 4DNYA 4Q8KA 1VBA1 5JSOA 4L97A 1N1TA 4JDNA 3J7NA 1OHFA 2R041 3BPZA 5IVFA 1V9U3 4S2FA 5D8AC 1JHJA 1LHWA 1I9RA 1FPN2 4AE2A 3U0ZA 4LBJA 1JYIA 1Y7BA 5FZ4A 3I97A 4I0WB 1MVEA 3RZJA 5E16A 4WVWA 3KB5A 2YG0A 1YQ5A 5KXCA 1OOPC 1ZZCA 3JD73 5C33A 5ISLA 3JQXA 3VHNA 1D0HA 3HT2A 1JYNA 3I3DA 2CWSA 4XQDA 1Z7S2 4MGSA 3OOXA 5CFDC 2JE9A 3X29B 4LIUA 2ETEA 4K8FA 1GQHA 5C9AB 5A7QA 1CAXA 2LALA 2VBBA 1HLCA 4OQ9A 2W95A 3VKLA 1SBFA 4INDA 3MEPA 3AYAA 2EICA 2L9LA 2WZ8A 1O8SA 2D7FA 2Y26A 2ZEZA 3GYDA 3R4UA 3LKJA 1HV0A 2P3JA 1F35A 5CB7A 1UYZA 4BQ3A 2A6YA 4FPKA 2JDHA 3I54A 1MQTC 5F3EA 5KC6A 2R32A 4XC9A 2B39A 4Z07A 3DYMA 1NCRB 2ZGNA 3AMPA 3IDCB 3P5BA 5F9TA 3LEGA 1SCRA 5K7PA 5A3TA 3WG4A 4LOSA 4FPOB 3MO4A 4N9IA 3RRDA 3WSOA 5L7OB 4B8EA 3D3AA 5IVBA 2ZGPA 1QH7A 1A3KA 1WZXA 2GDFA 4P9GA 3HAGA 1W2NA 5EP9A 5A3OA 2Y6LA 1ZRFA 4TXWA 3IM0A 2HWC3 3WW1A 1WCKA 4CEWA 1JYTA 2JD9A 3E1F1 4K3UA 3TNPB 3MUZ1 3T09A 1WKYA 3U14A 2IZWA 3GZUC 1HKDA 2QQKA 1AR82 4QDSA 4HETA 4LKSA 4GKXA 2N7GA 2WKKA 2WR9A 1UOBA 2Y6FA 3ZFFA 2D3RA 4QKBA 3ATGA 2D97A 2VECA 1V6NA 1E5RA 3QACA 4YZ2A 1GQPA 3FFZA 1WCUA 3ACLA 2PHUA 3NKTA 1HB4A 3HIFA 4MXWB 3NAPA 3VKFC 2FDKA 3Q8EA 1F31A 4JKMA 5T54A 4LHSA 3ZFEB 1OA4A 1B35A 1K5MB 5DAQA 5FJKA 2WQ8A 1QMJA 2JG9A 1X9TA 4CXXA 2NMNA 2WYFA 3GZAA 3K46A 1K45A 1OMIA 2W87A 2UWCA 2JJ6A 3H1WA 1GICA 1HQLA 2JX9A 3A7QA 1UIKA 2BERA 2XONA 2JDAA 1NCQB 1AR73 4FPCA 4G9SB 1C1LA 2V09A 2PMWB 1H9PA 2VNVA 4H14A 4LORA 2I74A 3ASIA 4N43B 4S2HA 5AC92 2AYHA 3HOBA 3KHCA 1ZA7A 5DAPA 4IEZA 4Z1VA 5FMOS 1HXS3 2HWC1 2ORZA 4XJWA 5HPOA 4TZDA 3OY8B 1ZRCA 1DGWX 1RXGA 2ZAAA 2PELA 5JZGC 1L7RA 4FFFA 3JBG3 2PQSA 2P6HA 4NAOA 5L9RA 2H0BA 4OHZA 1LOBA 2D5FA 1DZTA 3J8F2 3KM5A 1REFA 5IW0A 4W8JA 5A6XA 2WSVA 4D0QA 2DV9A 3M7AA 4NPMA 2VY0A 4P9LA 3VDDC 5FQ0B 4GMP3 3AXEA 4DQAA 1H2KA 2W0XA 2DUPA 1X7NA 4PDWA 4UOJA 1S4CA 5I0RA 3IWZA 2ZHNA 4NAMA 3ZYGA 1VAMA 2PHXA 3WDUA 3MV11 1BXHA 4QPIC 2DCJA 3LSDA 4OUEA 4D6RA 1U5XA 3MFAA 4FP3A 4MSVA 1RUH2 3MI8A 3WG3A 4XUNA 3O1TA 3OYWA 2BGCA 1S55A 1UYXA 4BMBA 5FZLA 2ZZQA 3E6BA 5H9RA 4MGTA 2WA4A 5FUPA 1AR71 4YW6A 3GM8A 2ORXA 1GQGA 4B7EA 1WD4A 2VOXA 2V4AA 4QX5A 2RMU2 1LOFA 5APAA 2VZQA 1BZWA 1D4M2 3WVJA 5BNPC 2BGOA 3MV01 3FE5A 4FTEA 2A73B 5BNNA 2P5BA 2ZKLA 5IVYA 1UQXA 4N7IA 2CNAA 3JBG1 3LPGA 3SLIA 5JDBA 3VUOA 1LGCA 4K1ZA 4AQ2A 3M3EA 1V6LA 2V73A 2ZMLA 2DVDA 3DEMA 4Q4V1 5A7WB 2R0HA 4GD4A 1AX1A 4DXSA 2HWE3 2ZGMA 4GJZA 3HN1A 1BK1A 1H8TA 4H7LA 3OUIA 2YDEA 3PMSA 4I3PA 4NRMA 2E7AA 4EN0A 3GNEA 5FYSA 1M06G 2TNFA 4KBZA 4BISA 1F9KA 2PLV3 1ALYA 2UU8A 4H2AA 4XDQA 1LB2A 4XJAA 3WF2A 4JKKA 4GJYA 2YBPA 5FP8A 1JZ2A 5FYHA 3KMHA 1WWYA 2WN2A 3IIIA 5FLIA 3JU9A 3CJIB 3JB8A 1LOAA 2NM1A 5FYTA 4CUGA 1NQJA 5A7NA 5J36A 4ET7A 1QJX2 5JWPA 3S5QA 1DCSA 2WFF2 5DMYA 5FXXA 2WT2A 3AP9A 3LE0A 2YC2A 4K40A 4L9BA 2ZGKA 5FMDA 1UXZA 4NIHA 1A8DA 2QQOA 4QU1A 1H1MA 2VOVA 4XF4A 3B94A 1OOPB 2B46X 2DVBA 4QKFA 1AJKA 4BA6A 2WYSA 3T2PA 2GALA 5HCAA 2CV6A 2WIIB 3WF3A 1HRI2 4W4ZA 1TMF2 1OFSA 4ITCA 4X8NA 2JWPA 3GJAA 1T6BX 4PT6A 1RUE2 2YYOA 4QGMA 2FCVA 1NA1B 3PJYA 4MGYE 3GZEA 1UO9A 5CKMA 1RUJ1 2O8QA 1ULEA 1W28A 4A4AA 2YZ4A 1VRH3 2HWE1 3M3IA 4I2OA 1PGW1 5C9AA 2CGNA 1NLRA 4LITA 5H9SA 4BQYA 2VD7A 2WT0A 4YSFA 4XZUG 2CHHA 1FOD3 2A6WA 4Y33A 2PLV1 5FZAA 3AZXA 1XPWA 4ASKA 1PVC2 2C9AA 2PYTA 1JI6A 1OQ1A 5JLVA 1AYN3 4YW2A 3UGHA 4BJ0A 1DGRN 5JOYA 1DDLA 4CDXA 1JYWA 3RYRA 2QDRA 4YW7A 1W0PA 1VBD2 2PAKA 3I8TA 3F2ZA 2ZBJA 2E7QA 3DGTA 5K0UA 5FY0A 1R64A 5A33B 2PXJA 1IGOA 1LCLA 4E2QA 5CAZA 3Q8AA 1ND2A 1JZ3A 3N7MA 3S5AA 1RUC2 1S0IA 1VBB3 1I3HA 4L8QA 3C7HA 4CDWA 1G9CA 5L7OA 4UT5A 2UURA 4Q29A 4UBHA 4X6QB 5JVVA 5D1IA 4XFHA 5ABJB 1R093 5C4WA 4A41A 2J1RA 3ST7A 5FPUA 4WBBA 4Q4W2 4CP9B 3GF6A 2C4XA 1Z0HA 1UAIA 4Y3OA 2XVGA 3PUHA 1WW5A 4Y20B 2FDJA 4XBLA 5KWRA 3IDAA 4XZPA 3VDBA 5SV8A 5DAVA 3HD8B 2WJSA 1AR63 3V0BA 4WM8C 3IZOA 4ASLA 1WLWA 2UWAA 2YU2A 5DQ0A 4BCUA 4LHNA 4EYUA 1V6JA 5A32B 3AKPA 1FOD1 2J1VA 1KS4A 2MHFA 4RS5B 3TRSB 3WDVA 3UNPA 1NE6A 3D8CA 2BDRA 3I3QA 3NJYA 1GZTA 2OKXA 3RZKA 1GV9A 3T2QA 1AYN1 4DUWA 3MIBA 2DTWA 1XNKA 3I2OA 2GP5A 1AHSA 4C1XA 2ZCWA 3USSA 4HOOA 2K9ZA 3AZYA 2D6MA 3KSCA 4YGBA 4YGCA 2P37A 4LTAA 2WSUA 1IHMA 3LEKA 4LE3A 4QPGC 1C5HA 3EQEA 1QQP3 4CDUB 4PBOA 2BNNA 1VBB1 1NCQA 3H3UA 3HNYM 2X09A 3T3YA 2WQZC 3SH5A 3GHNA 1SDWA 4NWWA 1QXJA 3LOBA 1LODA 2IVJA 1GU3A 2ZPXA 1R091 3WD5A 1U12A 3UT0A 3NV1A 4Y4RA 1F4AA 1PNFA 5FP7A 3R4DB 5DXDA 1QH6A 2O14A 3VDDB 2A71A 3O1OA 3RZGA 1N3PA 1SACA 2DBIA 1CJDA 2XB6C 1QDOA 4NHXA 3WW3A 1AR61 3B00A 4Y1VA 1U5YA 4EWDA 3W20A 3G6JB 2R072 4GWNA 1QNYA 2RR12 4MLOA 4Y26A 3MW4A 4KWJA 4RHV3 3RI8A 2RDSA 3PIJA 3H42B 1UX7A 1WLDA 3RGBA 3RSJA 2J1EA 5BNOC 3L2YA 5JSPA 5K9YA 3VBOA 1S2EA 2F4LA 1IS5A 1COV2 3I2IA 4OI4A 3VV1A 1JYVA 3OGSA 4HZFA 1XE7A 3MFCA 4KG0A 3VBSA 2HKXA 3HWJA 2ZMNA 4ZONA 2IFWA 4Y1XA 2JE8A 2W1SA 1QQP1 5J09A 1JZ8A 3K48A 3ZXKA 1DLCA 4V2WA 4R9BA 4Y5Z0 3TOJA 1PM7A 3PMEA 4N9HA 4RFRB 1VBC2 3N9NA 2VVDA 2WO7A 5J96B 1CJPA 4LBQB 2PHRA 5FZDA 5JIUA 2WNOA 5KBFA 2WINB 4OI1A 1TEIA 2E33A 1PZ7A 1S2BA 2VOKA 1BBT2 4MOAA 1CONA 1JN2P 1UU6A 2AH2A 2ADEA 4M3CF 2ADDA 2R7EB 2QFEA 1PO12 1H6XA 1DBNA 2R49A 4Q0SA 3BOPA 2WAAA 1D2QA 2EXHA 2GSYA 2FDIA 2ZX3A 5L19A 3Q9OA 4JGYB 2JICA 4FSJA 2VZOA 3DUIA 1CAUA 2D5HA 1WMDA 4A7ZA 2EIBA 3LIHA 4O65A 3OGRA 3C7FA 2R0FA 1RUG3 5AFEA 2JKXA 4RHV1 1CIYA 4XE9A 2RS52 2XBO3 5GZGA 1BMV1 4M4PA 1QDCA 1JMUB 1CAWA 1PK6C 4QWNA 5FY8A 4E4DX 2TBVA 4HKOA 4K21A 3ZFGA 3NQHA 3WR0A 2VW2A 1YXWA 3GJBA 2FDGA 3VGIA 5FY1A 3M3OA 3AKQA 1XSRA 4UWDA 4Q4Y3 2PAEA 4NO4A 4EJRA 4RR3B 2VO5A 4YVWC 4BQXA 3GCWA 3PNAA 1GP5A 1LOCA 1G86A 2P3KA 2WWSA 3EBRA 5D8AA 3WHUA 4AVSA 3SQOA 1KJLA 4IV1C 4BDVB 4CCKA 3BGAA 1OKQA 4MGIE 1ZZ7A 4DRVA 2GN7A 2VOTA 3FHIB 4JRLA 5GLTA 4QB2A 1KGYA 2EALA 1HQWA 1X82A 1OOPA 3AZVA 5C6CA 2WT1A 1JOBA 1YQ2A 5FXZA 2ZS6B 3AP5A 4Q0UA 2RDRA 1OFNA 3WV6A 3PVNA 1B09A 4UFJA 4DXZA 3E5QA 3CHXA 4CVUA 4HFSA 5CFDA 1NG0A 2BWAA 1FATA 1R082 5FWJA 2WNEA 1LHVA 4MXVA 1LKNA 4AEMA 1Q56A 3O14A 4S2GA 5FMOL 1JTZX 1OD3A 3KHBA 2RS32 4BLIA 1RUD2 1PVXA 5A3LA 3SH4A 2EIGA 1FI2A 2X10A 5BNQA 4JDOA 2CDPA 4QQLA 4QXKA 1FV3A 4UBGA 2IXIA 2QKDA 2ZABA 5HV4A 4NROA 4XVHA 3QOPA 2E32A 1VAVA 1MQTA 2YB7A 3VBRC 4GB31 5GLWA 3O1UA 1Q43A 5FLHA 5A3WA 1DQ2A 1T2XA 1ULDA 1W03A 1ZBA1 5FUIA 1VBE1 2VZTA 4LBOA 5GM0A 3UKVA 1W05A 3WOGA 4DY5A 3EO6A 2VZ1A 3WQ0A 2FD8A 4QHBA 3VKOA 1J84A 4R4XA 3RI9A 3U10A 3NL1A 2FZ2A 3HT1A 1JS9A 1L7QA 4MGQA 5TSWA 2XUMA 3DCQA 4ZHNA 2OS2A 5A6YA 2VQUA 1Y4WA 4XJZA 1O7FA 1NCRC 4FFIA 1KFUL 3ME2A 4KWUA 3SCGA 5FZ9A 3WG2A 5IK8A 1H2NA 4JTOA 2ZX1A 2D6OX 4JTNA 1N1VA 4CU9A 5HXMA 2CY6A 1DQ5A 2Y6KA 4CE8A 5FDBA 2DBNA 1XNTA 3AM2A 5FZ7A 2VMIA 2EA7A 4L0PA 3CMGA 4AEDA 4HXCA 5EJ1B 4Y20A 2A70A 1PMHX 2B7YA 2VNGA 2VCAA 3I2HA 4LLFA 4FPHA 3OSDA 4SLIA 4GMP0 4BMEA 4P14A 1LTEA 5FPXA 1S0DA 1APNA 2XJRA 4Y5TA 4D6SA 2C5DA 3R05A 4IEYA 4Y4YA 1BVP1 4BZ4A 2RM22 1O4TA 4PF5A 4HPKA 1VMHA 3KLSA 3VBFA 5T50A 4EWAA 3RZLA 1DGWA 1O5LA 2XJQA 4MHUA 1UY4A 2EAAA 4ATFA 1G9BA 4K9SA 1KFXL 2OPWA 2RE9A 4RA0A 2UYBA 4XF9A 3B02A 4IV3B 1POV3 1QY4A 3AP6A 3H3ZA 2I2SA 3UESA 2CAUA 3AKSA 1K5MC 5LK7B 1PGL1 1JU4A 3O7OA 3D6EA 2LS6A 4QHZA 1BQPA 1OA3A 4BQ1A 2V72A 4XDPA 4B7KA 4PIXA 4W6WA 5C7GA 4IUGA 3ACGA 4XXAA 5JZGA 3T2OA 3M3CA 2DVGA 1MS0A 1ACCA 3AKTA 5E88A 1P8JA 2JB8A 2QQLA 4N43C 5FOJB 3BIWE 4L2NA 4KI5M 1XU2A 5IFPA 4H3WA 1OLMA 4NHKA 3LIGA 5J98B 4AHZA 3NNMA 3E5XA 1BVVA 5A6ZA 4QQPA 3NNJA 2G19A 4UXAA 3O1MA 4WVMA 5LY1A 1OQEA 4EN6B 4A6SA 1HRV3 1EAH3 3NWKA 3I4IA 2RV9A 2ZEWA 4QPIA 1DFQA 2CU5A 2YY1A 1XJAA 1QJU3 3N9PA 4BPZA 1ND3B 4UF0A 2HWD3 4KBBA 5FY9A 2NMOA 1O4YA 4UFHA 3AKRA 1POQA 1KXGA 4A6OA 5GALA 1MZ6A 3T08A 1POV1 3UKTA 5FBZA 2CSGA 1FMD1 1SLTA 2HWB1 2Y8KA 2YROA 4YZ4A 5CADA 4GQ7A 1VBA2 4XDOA 5F37A 1IPKA 1JXNA 5FZBA 1XYPA 4A3XA 2R063 1QJY2 2R042 5CFCC 1IQDC 5BNPA 1PHMA 1SLBA 5DUXA 1HB1A 1BYHA 4I0AA 4NIAA 4CXWA 3WDWA 3UKNA 4LBQA 2FDFA 4LQRA 2R6QA 3BU0A 1ZYBA 4QGNA 2JDMA 3H1MA 4UW4A 1SG3A 1V6OA 5LBEA 1RHI3 4D94A 1IG0A 1RC6A 3CO2A 5LA2A 3U37A 2Q8EA 4LBKA 3T4VA 4YLZA 2PA7A 4CP1A 1QNWA 4XMIA 4D7SA 3ZPOA 4L99A 4Q1RA 3ZMNA 2D44A 1LNSA 3ZR6A 5C3OA 5IVEA 4DB5A 2AR6A 4CZSA 4DUVA 4HK9A 3S6PA 1W8UA 3CIHA 2HYXA 3I3BA 2ARAA 1HRV1 1EAH1 2JDPA 3MICA 3ORJA 4R4ZA 1ULOA 3BN6A 1X8MA 2WL1A 4J25A 4IW3A 1QJU1 2HWD1 2X53S 4WM7C 4YVWB 1BJQA 2YBSA 3RZMA 2CWMA 3B5LB 1ZA4A 2QQNA 4M00A 3B9CA 4IV1B 1OD5A 4FVVA 3RMXA 2OPKA 1TNRA 4OHWA 4ZY9A 2X05A 4KGGA 3POWA 2Q5TA 1WA4A 1RINA 2YXSA 3K4ZA 2R061 1OVPA 3CDZB 1V9U2 5FREA 2OYZA 4XIKA 4BQ4A 4IEQA 3U07A 1CAVA 1G8WA 2WDBA 3BALA 4LPLA 4CU7A 5JOZA 1W8HA 1YFXA 5I8SA 2RS13 3RS6A 1H4HA 2BRTA 3JD72 1RHI1 5FXWA 4YPJA 5JOWA 3N9LA 3EJKA 2MEV1 2RJLA 5T3NA 2VULA 1PNGA 5CNAA 3DXUA 3LD8A 3ZYHA 4XYXA 1GWLA 5ANNA 4AW7A 1AL23 2VU9A 1HJFA 4LUMA 5FZOA 2MNGA 1W6PB 3VBRB 1NA1C 1AR93 2A1XA 1AXZA 2YC4A 1MS4A 3J9SA 2WAOA 1SBDA 2QZ3A 1WGPA 3FJSA 4FT8A 1RL3A 4HMZA 1OC1A 1IS4A 1E57A 5J3UA 1XU1A 3ACIA 3WDTA 3SKJE 4IGPA 4OZOA 1W2OA 1SQ4A 5DZFA 5FPLA 1BEV3 1MEC3 1UX6A 1OQDA 2RDQA 3OGGA 5IK5A 1C5IA 4Z82A 5BYNA 3A23A 3LWCA 2VPVA 5I8YA 4I0BA 1SLCA 4C91A 4LNVA 3BKZA 5E1RA 2BOIA 5F5QA 4DOUA 2XPJA 1QXPA 2WO3A 4KQ7A 1HV1A 4GWMA 1SHWB 2QJVA 4JQRA 2HWC2 2RS11 2PHTA 3CZUA 4A3ZA 5KC5A 4CCDA 4OCTA 3WCSA 1GZWB 3ZN4A 1FV2A 5IUQA 1W6QB 1UN1A 4OI2A 1ENQA 4I02A 2DCYA 4WM8A 3H50A 3FL7A 4FCAA 5ABJC 1PMIA 1VMFA 2CTVA 5FYYA 4XXPA 3FUOA 3TWIA 3PUIA 4AI1A 3IPVB 1J1TA 2Q8OA 3TN93 1AL21 4LO8A 1LGBA 1AR91 1QJFA 2QQIA 3DPRB 4PQ9A 5LEKA 3C2UA 1JOJA 1FPN1 1VPHA 3USUB 4AEJA 5EIYB 4RL7A 1W8OA 4XABA 4QPGA 1NE4A 5JMOA 1DYKA 2ZACA 4RS5C 2GC1A 3RWKX 4FFGA 5F6KA 1BEV1 1MEC1 1Y3TA 2ZA9A 3KV4A 3TBDA 2I07B 5L9VA 3LEIA 4MYEA 3A21A 1JZ5A 4YGDA 5IK7A 1X50A 3M4FA 5FO7B 5FBJA 4P9YA 4RN5A 4YM2A 5FJHA 1X36A 5HV0A 1K42A 2IXJA 4XACA 2AGSA 1FYUA 5F32A 2XMLA 2OX0A 2R16A 4CDUC 4A7YA 1HXS2 1PM4A 4BXFA 5A3MA 2B9VA 4AYUA 3K3NA 4CDQB 3KV6A 3H1YA 3WP5A 1H2MA 2DDUA 1W8NA 1NOVA 1IS6A 2DWRA 3JBG2 3W59A 4BH9A 3J26N 5IHRA 4J6GA 3WF1A 1DG6A 3B7MA 5FK8A 4O9EA 1UOFA 4UYBA 5F3IA 1DIWA 2WUHA 5IAVA 4Q4V3 2G9GA 3S7IA 1GANA 1RITA 4TSVA 4U36A 2BYVE 4Y5SA 4A45A 2R1BA 4RGGA 5BY5A 3TN91 4MUVA 4LKDA 5BNOA 3OUJA 2WLPA 1UIJA 2WO1A 4UW5A 2JG8C 2IXCA 1DQ6A 4YFWA 3V65A 3MF6A 1FT9A 1LGNA 5EWSA 4JCKA 2MPFA 1VALA 2VUAA 2VJXA 2HYKA 1R1A3 3VZNA 4YM0A 3I7DA 2GC0A 2HEYF 1GMMA 4F8AA 2WZEA 5CFCB 1LULA 3O0XA 3BOWA 5LA0A 3SEPA 1CN1A 1J59A 4OHYA 4HONA 2NP0A 1U0AA 3N9MA 4XAEA 1O5UA 2OXBA 1YWKA 5KXDA 3KF3A 5K4LA 1O91A 4Q0PA 4OULA 1F8VA 2ZZJA 1UY2A 5CKNA 3LB9A 3WP4A 3HQUA 3UV9A 3LDBA 1TME3 3IMMA 3POGA 4XHXA 5F2WA 1AXYA 2UYAA 5DDJ3 1QU0A 5H9QA 3ZN6A 2BQPA 3ZVXA 2ZJCA 1IKQA 2JECA 3W5NA 2XJSA 3GXUA 2J42A 5FZGA 1QOOA 3EXUA 3VLBB 4OYUA 2CL2A 5C3QA 1QOTA 2ZGSA 5FYUA 2HWE2 5C3RA 1RUJ3 2BP6A 5E8AA 2W94A 4NE9A 3I2JA 4CYDA 1IS3A 2D98A 5JXJA 1PK6A 2Q1ZB 4WM7B 5T52A 2PLV2 3BTXA 4Z8BA 5F5IA 1QOSA 4JGYC 1W6MB 3PVEA 3ZKUA 2LUWA 1N3QA 3ON7A 1ZZ9A 2LTNA 5CYYA 5FYBA 5FZ1A 3UYJA 3P3PA 4BXSV 3CQOA 1R1A1 3OPWA 4YZ1A 3ALQA 1DYOA 4XMAA 4HVQA 2W08A 1WCDJ 4C0HA 5FZ3A 2WLQA 4K6BA 2PHDA 1W6OB 1NUKA 2XGXA 3KF5A 4IV1A 4AGGA 1JUIA 4FPYA 5EYXA 1GOFA 3TB0A 1F4HA 4CUBA 2ZEXA 5FPZA 3A0KA 5FZ6A 1HJGA 1YIFA 2NLRA 1W3VA 3VBUB 4GH4B 5LK5A 2JDNA 4AFMA 4DEQA 5C8CB 4MGZE 4RR3C 1VLNA 2E53A 2ZAHA 1TME1 4URTA 3T1LA 5DDJ1 2B4KA 1OI6A 1GNYA 2VVFA 4ISRA 1LR5A 4DFSA 1Y9QA 4HBNA 1MZEA 4IEPA 1GBGA 4FQ4A 1VIWB 4LK7A 1JYCA 4NHYA 1AX0A 5JXIA 1ZNPA 5L9BA 5A1AA 1VRH2 4R9CA 5FV3A 2WABA 3GBWA 5IWFA 2W39A 4AVCA 3S30A 2Y60A 1EPZA 1YRZA 3SCFA 5L36A 1FOD2 1WUVA 5F39A 3VBRA 1MZ5A 2XWJB 4OQ8A 3V0AB 3MZHA 3NNLA 2QQMA 1KJRA 2F4PA 2P1BA 3IKWA 1UXXX 1WLCA 2VBPA 1AYN2 2RMU1 4NR1A 1N47A 4GWIA 5KHIA 1D4M1 4KWKA 1WW6A 5JCTA 3BTYA 4IL7A 2A5ZA 1GWKA 1W8TA 1POV0 4XF3A 3QBQA 3JB4C 3RG0A 2VTFA 1PX4A 4ORFA 4NUBA 3J7LA 2A6XA 1CD3G 4MO3M 5FPAA 5GLUA 3WF4A 4EQVA 5A3PA 2WNVC 5LATA 4YYOA 4AVAA 4JC1A 1AUYA 3IDEA 1UOGA 1NCRA 3K51A 2XWBB 3C7EA 1VBB2 5FZFA 1KEXA 1BK0A 4EN7B 2CGOA 3TEZA 4OUSA 5LCWL 1NY71 3N9QA 1F2NA 2JDKA 1LJ7A 2VXJA 3J7MA 4GZ9A 3THCA 1UMZA 1JW6A 2IUWA 5F3CA 1R092 5FPVA 4ZKTB 3POIA 2CDOA 1YEWA 2VZVA 4C1WA 2Y6GA 2EAKA 3THDA 1LOEA 1XBFA 4UFIA 4YM1A 3LEMA 4AQTA 2WBKA 1D4VB 3JZVA 4RFT0 1H9WA 3LAGA 2IWGB 4P5HA 2I45A 2RVAA 1AR62 1GP6A 3FN9A 1SLIA 1ZVFA 5EZWA 2WFF1 2DYCA 5DG1A 5A1FA 3THTA 3H7YA 4XJ8A 1UPIA 4Y24A 5F6LB 5JPNB 3CBNA 5FZKA 2A6VA 2XXZA 4W50A 4AAPA 1I5PA 3NKGA 4QX8A 5GLZA 1XC6A 1DU3D 3ZPYA 1JH5A 3PDQA 4MXWA 3USUA 4L92A 4QD2A 3AP4A 3QCWA 3VBHC 3ZSEA 2YMZA 3ABZA 1UY0A 1U5IA 3EYPA 4FXKB 3ZFEA 1K5MA 4BLJA 5IAXA 5KXBA 3U75A 4XQWA 4COZA 1JODA 3M8LA 1ULFA 4JDMA 1OSGA 2GH2A 4EE2A 4PLOA 4A42A 2WNUB 3G7DA 1RUE1 4BK4A 3W58A 3PLQA 4EROA 2FCUA 1YJKA 5JOXA 2G9ZA 5LBBA 4IV3C 2RJ2A 5FOBB 3AYDA 4LBLA 4ES8A 3VD9A 1ZREA 3PURA 3SC7X 4HG6B 1SCSA 4Q4X3 2VMDA 4K8RB 3VZMA 2E26A 5T5OA 2OT7A 4Y22B 1GOHA 4N43A 4AEKA 2NN8A 4BQWA 1WBLA 1UCXA 5GZFA 4D69A 2D6LX 1OVSA 1LRHA 3VZOA 3ES4A 4XBNA 4QX7A 3NAPC 3OY8A 3I59B 1WMEA 2A3YA 3D4KA 3KGLA 3RMYA 4YRDA 3UK9A 3VZJA 1B35C 2HBUA 2JG8B 5T5PA 1V6KA 3KS7A 5IATA 3FC0A 2JG9C 1OT5A 1HIXA 2JENA 1O8PA 4RHV2 1SBEA 3ZM8A 1WCSA 5FQ0A 4OLLA 1V6MA 1BMV2 4LO6B 3ZXFA 2VUJA 4CU6A 2IXLA 5JPMB 2VNRA 1BHGA 4COYA 1CWPA 1JYXA 3GDBA 5LASA 1VB4A 1W04A 1QIQA 3P3NA 3WT3A 3OPTA 2R1DA 5ACA3 5C5TA 2XUEA 1IKPA 1SEFA 2DUOA 4A44A 1ULGA 1W0NA 3UL2A 1I1EA 3VD3A 3OGVA 2DFCA 1ND3C 3T0BA 1HN1A 3NNFA 3IBMA 4ONUA 4WZFA 2H6CA 1UZZA 4XFFA 1RMU3 1RUI1 5I91A 1ZX5A 4XUTA 2HEVF 4DIQA 3JXSA 3ZXDA 1NXD1 4Q4X1 3MLKA 3VKNA 1AVBA 4EN9B 2VW1A 1UZYA 1ZRIA 2HWF3 2Y6JA 4J1WA 3FHAA 2BBAA 4JKLA 4LIVA 1ZBE3 2IXKA 1XE8A 4W6YA 2LW8A 3HQRA 3KQ4B 3GHMA 5FIXA 1ZZ6A 3SITA 2BVVA 3N35A 4R9DA 3FLTA 1Q5OA 1N1SA 1GFF2 1REEA 1YLLA 3WDXA 3BI3A 3KT1A 3HNBM 3AFKA 1UYPA 3QLQA 4YWAA 5EFUA 1C8M3 2EF6A 3NV4A 1ASJ3 1QXRA 4D7YA 1J3QA 4ZU7A 2ZX2A 4JX0A 5A7WA 5C3SA 5IJRA 1EUUA 3OJBA 1VE0A 3D5OA 1RUG2 1W9YA 5B4XA 3I3MA 2XBO2 3THPA 3WF0A 4C90A 1KDKA 2KM2A 2P6CA 3BVCA 1Z78A 1YC61 2OW4A 1H30A 3CKHA 4QHOA 2Q0AA 1H0BA 3WXPA 2XJTA 4JQTA 4DUXA 3PUAA 2JIGA 3CZJA 2DUQA 1XQNA 2O1QA 3M1HA 3E97A 4N53C 2JKBA 1VB2A 5GZDA 2VMGA 5ACA1 4GB33 2WS93 4P5YA 3CJIA 4Q4Y2 2W9XA 3L2HA 1ZBA3 2JXAA 1VBE3 1FXZA 4AFDA 2VZPA 1W6OA 3WNMA 5LBCA 4PCRA 3VD5A 4BYYA 5BNNC 4Z2AA 1HX6A 1E5IA 5DN2A 1RMU1 3C7GA 5ANQA 3WG1A 5IK4A 3ZSLA 2Q30A 2QTWB 2DVAA 2Z4FA 1UY3A 3IT8A 2PAMA 5M0TA 2HWF1 1J3RA 4QQHA 4XOGA 3ENRA 1ZBE1 1CQ9A 4XQ4A 2B42B 2VZSA 3H8RA 2NPIA 4OMCA 4N8MA 1IOAA 3MIFA 2ZGTA 2VQTA 4X8PA 1EPWA 4M3CB 2ZOEB 2ZGUA 2A3XA 1C8M1 3AMQA 1UZWA 1RVF3 1ASJ1 2ARXA 2XJVA 3CL1A 4MH0E 1VP6A 1NA1A 3VL8A 3WLUA 1C28A 1GOGA 3NW4A 3ZYJB 2BNMA 2GP3A 3O1SA 4D6QA 3SHRA 1LEMA 5A3NA 1WA6X 4YZ3A 2Z69A 2ZX4A 1VBC1 2W1WA 3LCPA 5I0UA 5F8PA 3SNMA 3N7KA 4IDZA 3TEYA 3ZXAC 5FYCA 4LK6A 2VCMA 1Q3EA 1UD1A 3OD4A 5FXVA 3IAPA 1NLQA 3FX3A 1KRIA 2WNVB 4QX0A 2WS91 4XJUA 4Y1YA 2HJIA 2NYYA 4MVTA 2VUCA 4DY3A 1PO11 2D43A 2K0GA 1KITA 2ILMA 2VMFA 4WVZA 1PGL2 2AEZA 4NPRA 2IFRA 2OVUA 3IDBB 5A33A 4FAGA 2BZDA 1CAXB 1CIWA 1RIRA 2ZHMA 2WFPA 3WNLA 1V6IA 2GZWA 3DV8A 3O5SA 4M3CE 3BYWA 2RS51 1NKGA 4XILA 5IVCA 4CXYA 5DAWA 5A32A 2XVLA 1A6CA 4NIIA 5JSRA 3WW4A 2WC2A 3FLRA 4FQZA 2ID4A 2W1UA 4XPVA 3A22A 2VTXJ 4OFGA 2VR4A 1H2LA 1CPNA 4JHTA 3ZOIA 4COVA 5ABJA 1Q8QA 1UF2C 2GC3A 1HB3A 3B93A 2QCSB 4DS0A 2GMMA 2QE3A 4CP9A 1OF3A 1RVF1 3VD7A 2WZR3 3C7OA 3I2DA 4J1XA 1RB8G 1QEXA 4HN0A 3OCPA 2LRPA 2VOWA 4HKLA 5EXOA 5CU1A 1UY1A 3L9JT 1REDA 4JGZC 4LMFA 5E89A 5LY2A 1H1IA 4HN1A 3VBHB 3JUUA 3DKWA 4PLNA 4HLTA 5A7OA 4RS5A 3WQ1A 4LE4A 3T30A 1HN0A 4E8CA 1Q8VA 4FAHA 2ZKNA 5A3UA 3M3QA 4AG4A 5JR2A 3BCWA 3PHMA 3FHQA 4XURA 4PHZA 3Q8FA 2WWJA 3T1MA 2YFZA 2VXRA 4CEWB 2HH9A 1J83A 5CVRA 3DPRC 5DG2A 3WZ1A 4CA9A 5LA1A 1GZCA 2ZTNA 2QQUA 4AQSA 4EN8B 2XL9A 1XOYA 4AK3A 2HWB3 1FMD3 1TNFA 2B5HA 4IGOA 1DLLA 1PO23 2DFBA 1RUD1 2RS31 2YPDA 1JUHA 4CDUA 3H8XA 3KWVA 5I8TA 1PX3A 4D3WA 3KT4A 5JI9A 1W0OA 1MS5A 3NAPB 1LHOA 4PJYA 4Y22A 4OMDA 5KR7A 2DU1A 3D0JA 1AYM3 1AX2A 1B35B 4IEOA 1SPPB 4P9IA 2BTVC 1OH4A 4V1PA 3KVAA 4CP2A 3ZXLA 3CF6E 2JG9B 4QKNA 3WY6A 3WNPA 2A6ZA 5KHGA 4QM9A 3LSEA 3T2TA 2Z2SB 4CEYC 3VDDA 3WW2A 2WZR1 1IZ3A 4FFHA 4CDQC 2JG8A 1H6YA 1VJ2A 1O4ZA 4LLOA 4P08A 3VDCA 3AZZA 4NMIA 4A2UA 3AMNA 1OPMA 3HPNA 4BHPA 5FO9B 1HRV2 1EAH2 2P17A 4XFBA 4JVAA 2ZX0A 4NPLA 3HVDA 2YV8A 4YZ5A 1QJU2 3NO8A 1F15A 1RUI3 2HWD2 3PVBB 4B1MA 5F3GA 2OUHA 4HVRA 1UWWA 4O9GA 1OLQA 1UU5A 5A80A 4CCLA 3N9OA 2D40A 3BTAA 4I01A 4LO4B 1KDMA 2QQJA 4AL9A 2XQRA 1D2SA 2YBKA 4WVVA 3WNNA 4RD7A 1RXFA 2OIIA 3J7HA 2Q8DA 3PUSA 5FAXA 2R062 1PO21 3SH3A 2CGPA 3OBTA 1LHUA 1W90A 4KH9A 2ZXQA 5D21A 4PDWB 4FOWA 4AXOA 4GAZA 2RM21 2SBAA 3LDKA 4GULA 1AYM1 1PMJX 3ZMOA 5IYYA 4NIGA 1HW5A 1AL0G 1V70A 1RHI2 3H9AA 4MHRA 4CU8A 3PL0A 4IE4A 2V4VA 4LKFA 4CP0A 3EB7A 3ZN5A 1S0GA 3VBOC 2W1QA 4NIDA 1FX5A 5T5JA 2MEV3 3ACHA 4YARA 4TTGA 2J1UA 3OYWB 2PFWA 4QQOA 3ZSJA 1STMA 4JGYA 5LA9A 4E9KA 1US2A 3A4UA 4B3NA 2FMDA 2XKOA 3KZ4C 4XCBA 4N53B 4QX1A 4QM8A 5JI7A 1RYYA 3E5UA 1H8VA 3OBZA 3E6DA 4KL1A 5E6HA 4D7TA 4AZZA 1XRUA 3MF9A 2BW8A 4AHYA 5IVVA 5HCHA 3ILRA 1TVGA 4R9AA 1L3JA
chains in the Genus database with same CATH topology
2EVXA 1N3OA 2XLFA 2XVKA 5BNNB 1RUF3 4K7JA 3GBFA 3S7EA 2A3WA 1M4WA 5H9PA 1PIV3 2E51A 2QNKA 4RR3A 3FFQA 1S0JA 3FZ3A 1H8TB 4HT1T 2DTYA 3BU7A 4LO5B 1MS1A 1NYWA 3D82A 5AFBA 2JD4A 4YG6A 2RS12 4B29A 3H7JA 1GZ9A 4GH4C 3VBUC 3RWNA 1Q8SA 1EV13 5C8CC 1UW8A 3B01A 4DMIA 4FPJA 5KXEA 3PJQA 4GXLA 3N36A 3MIEA 2Y0OA 3ZFGC 3SCHA 3B69A 2G4IA 4I3GA 4F83A 5CBLA 1BKZA 1AL22 5CIRA 5HBAA 1QJY1 1AR92 4H55A 2DVFA 5DZGA 4KU8A 2WA3A 4FTBA 1Q8PA 2XLAA 1FPN3 4IETA 5GZCA 4FXGB 1RUF1 4KGQA 5LRRA 2WNVA 2PTMA 1BEV2 1MEC2 3VHPA 1KS5A 3ZDSA 1PIV1 4FOYA 3ZYPA 3OBRA 3MIDA 4AWDA 2Y0IA 1DZQA 2VMHA 2ZMKA 1Z7S3 1H1AA 5IT6A 2ATFA 1G9AA 4N7UA 4YW1A 4XTPA 3QH7A 1XYOA 3GZTB 3RQ0A 2YHJA 1G7YA 1TQ5A 4AI0A 1EV11 1URXA 4TYSA 4AF9A 4ATEA 4CDXB 2B45X 4QGLA 1YYNA 5C8WA 2A75A 4HKWA 3CLPA 2GU9A 1CR7A 5K0UB 2ET7A 4JGZB 4Q27A 3ZXGA 1NQDA 3TN92 1ND2B 1A8MA 3M2MA 4XFGA 5EJ3A 4TWTA 1C57A 4MX3A 2D3SA 4FOQA 4RGAA 2HEWF 4CDWB 5GLVA 1V9U1 3VBHA 1KQRA 2PHLA 1C3HA 4S2DA 2VQ0A 4BWOA 5C4WB 4PBPA 3INAA 3MIGA 4Q8LA 4BOWA 4QU2A 4Y1UA 2PHFA 4ZU4A 3JD71 2SLIA 3ELNA 4LBQD 4IV3A 3ZIWA 4XF1A 1JHNA 2X5IC 1S2KA 4LULA 3V0BB 1Z7S1 4MZUA 3MPBA 1AR72 2KXLA 1AR83 3RNSA 4BM8A 4AEDC 1DGRA 1F5FA 2WNUC 3V64A 3GALA 1RUOA 2QDNA 2YPJA 4CEYB 2CYFA 2VH9A 2E9QA 4M0HA 4P9JA 2IC1A 4LO7A 2H6BA 3VBFC 1VAKA 3WUCA 3V56A 4B4PA 4Q4V2 1MS3A 2NQYA 3WHTA 2ZGQA 3IN9A 3IIAA 1S0BA 2WQ4A 3WDYA 2GMPA 2TUNA 3APBA 4AVVA 2XJPA 2PN5A 2BWCA 4KU7A 4MGKE 4FP2A 1SLAA 5BV6A 2V5YA 1C4RA 1J58A 1R1A2 3ETQA 5AC93 4YVSC 2YC0A 1ND3A 2QVSB 4LUKA 1OPOA 4XTMA 4HANA 2BBVA 3DN7A 4IEVA 3NVCA 4PLMA 3BODA 3J8F3 1CESA 1AR81 2FHRA 1RGSA 3TAYA 1CVNA 1O3SA 4M0NA 5KHHA 1TME2 4HVOA 4Z92B 5DDJ2 4UW3A 1DF0A 3VBOB 2P2KA 1N1YA 3HQXA 1X8EA 3KQRA 4FTSA 2OA2A 3WINE 2FZ1A 3ECQA 3VBSB 4A7KA 1RUJ2 3CEWA 2GNBA 4FPEA 1QHDA 2OUJA 5DUWA 1RUH3 5CA6A 1SLLA 4FO9A 1PGW2 4CTEA 4RQPC 4N53A 4AHXA 1ENRA 2Q4SA 3RZZA 4DRRA 2DCZA 5KHJA 3ES1A 5AC91 4G4FA 2RMU3 4QPYA 3LOIA 1HXS1 4ASMB 4FBFA 2ZHKA 1D4M3 1YUDA 4M01A 2BFUS 4GIQA 5K8SA 3N4MA 4YVWA 4Q0QA 3R6SA 4P9WA 4EWEA 3N3HA 3AZWA 2WZPP 5LRSA 1CAUB 3J8F1 3AYCA 2PQQA 5F1RA 1CGPA 1MR5A 1O3RA 1NY72 4GMP1 5FCCA 2ES3A 3WX5A 4YGEA 1JBCA 2RJKA 1CAWB 2DURA 3HBZA 3ZFGB 1FNZA 1RUNA 3MGUA 2F6BA 5I0SA 1A78A 3N7LA 3MW2A 4AGVA 4COWA 3KCYA 1T6GC 1ZRRA 2OZJA 3UJQA 5D8AB 1RUH1 1QJX3 4F7ZA 1W39A 2G9FA 2WFF3 3AB0A 1LOGA 1YIPA 1ENSA 3AMMA 3KD4A 4UW4A 4EV0A 4ISQA 1UU4A 3OPZA 1H4GA 4LEJA 4ZU5A 1W6PA 3LZZA 5GJ6A 2K2SA 4L11A 3SMHA 1QJZA 3JCIA 3LA7A 1MACA 3ZXJA 2XJUA 3ZSMA 1W6NB 5CFDB 4COUA 1HRI3 4IXLA 1TMF3 2PHWA 2UWBA 3URFA 3VL9A 1S0FA 1RUE3 1WW4A 3ILNA 3ZYIB 5AVPA 1PGSA 5DUUA 3AFGA 2YUEA 3LA2A 1S0EA 1YI9A 3VHOA 4GALA 4NHLA 1TE1B 1G9FA 1MQTB 1PVC3 1YFYA 4Q0VA 1AF9A 2D93A 2OZ6A 2XLGA 4E4ZA 1GZWA 4FPGA 3AK0A 1W6QA 4JGZA 1VBD3 1UKGA 1QJX1 4XJ9A 2BEOA 1XNDA 3GBGA 3IPVA 4META 4IERA 3LGRA 4AHWA 1NLSA 2ENRA 1DQ0A 4RSUA 1RUC3 3MLJA 2DCKA 1XNBA 1BCXA 2D3PA 3DPRA 4TLFA 5EV7A 2XL7A 3PVOA 3NSTA 4NN0A 2X5IB 3R4SA 1HQNA 1HRI1 1MS9A 3VN4A 1YFWA 1TMF1 3WP3A 3KT7A 4Q4W3 2EXKA 4AEDB 2ZGLA 4XHBA 3RJRA 3FUQA 1QQP2 2VGDA 5AVAA 1VRH1 4CEWC 2X29A 1YO8A 1VR3A 5J48A 1LENA 4Q4X2 1GKBA 2VVEA 1I5ZA 5DUVA 4HPKB 4I09A 3MYXA 3VBFB 5L73A 3OD0A 5J37A 5EYYA 4YNIA 3ZFFC 4LBNA 5DZEA 1IQAA 1PVC1 1ZZ8A 4B4QA 4CEYA 4PIYA 4CDQA 3WUDA 2EXJA 5JAXA 5I0TA 1VBD1 2R30A 2VG9A 4LHLA 2W68A 1SFNA 1ZZBA 4LA2A 3FWEA 4YVSB 2E7TA 1DQ4A 1LU2A 1RUC1 3FMGA 4HSJA 2ZGOA 2FBEA 5JZGB 4XF0A 3NJZA 4AFAA 5ACA2 3WNXA 2E63A 3H8UA 4KG8A 3VZKA 1J1LA 2GNMA 4XBQA 4IQPA 4Q4W1 3FBMA 1ULCA 1WLTA 3U11A 5CFCA 1UL9A 1RMU2 1RTVA 4DINB 4K1YA 2ZHLA 1SMVA 1YHFA 4NVPA 4WVMB 3ZX7A 4K20A 2HWF2 2R073 3DL3A 2RR13 3IMNA 4QPIB 1ZBE2 2BUKA 4Z2WA 4B4RA 1EYBA 3MPPG 5T5LA 1FAYA 1PZ8A 4PDWC 1COV3 1LU1A 3OGJA 4F3JA 5J7MA 1C8M2 4RQPB 1ASJ2 1DGLA 3LA3A 1KD7A 5FFOC 2GC2A 2VNOA 3KCCA 1EP0A 3M70A 5JIAA 4HSLA 5BNPB 1YNAA 1ENXA 2FMYA 3DF0A 3MW3A 1VBC3 2BNOA 4WM7A 4YW4A 5HCBA 1W6MA 2Q1MA 3TYJA 4FPFA 3ZXEA 1YFUA 4GB32 2WS92 1BBT3 1ZBA2 1UKRA 1VBE2 4E27A 5HCFA 1LOFC 2RHPA 5HI0A 3FBYA 3W9AA 1PO13 1DYPA 1MZFA 5FRAA 1GNZA 3RYKA 1EY2A 4AGRA 3UJOA 3WP6A 1GR3A 4JAAA 4Y1ZA 4AVTA 3MLLA 2P34A 2R071 3VBUA 3E6CC 2RR11 4GH4A 4C0BA 5C8CA 1MVQA 2GMEA 1HDKA 2LM3A 3OF1A 2RS53 4BIFA 2E6VA 4LBMA 1G9DA 1H8TC 4ZXKA 2YGLA 1QKQA 1UPSA 4XIOA 1R1ZA 4LR4A 1COV1 3WQ7A 4AQ6A 5KHKA 1AXKA 5BXXA 1RVF2 3J4UH 5FTTC 4E2SA 5I93A 4FPLA 1AJOA 2YGMA 4SBVA 1S0CA 3AX4A 2B8MA 3S0MA 4R52A 4IEWA 1G6NA 1XNCA 3H0OA 1CAVB 1X33A 2D6NA 2XKPA 3POSA 3B9IA 2DU0A 4YM3A 2IXHA 3BB6A 3ZO0B 3V0AA 1BBT1 4P9XA 1W6NA 2W52A 3CJXA 1RJ8A 4FOVA 3C3VA 2FQPA 1C1FA 3NV2A 1C8NA 1R083 2D6PA 4LA3A 4NWVA 4ES9A 2RS33 1RUD3 5FO8B 3NV3A 1RUG1 4JV4A 2XBO1 2TEPA 5HXVA 3ZIXA 4W6XA 1GLHA 3TNQA 3PTYA 2UY8A 3POYA 2BPA2 3RYPA 4AFCA 3FLPA 2XHKA 2UY9A 3QD6A 3RPQA 5C9AC 1ZM1A 3AJYA 3O12A 5T55A 1QGLA 4OHVA 2JDZA 4Q4Y1 2A7AA 4CRQA 1CPMA 1OLRA 2ERFA 2WZR2 2DCTA 4IEXA 3QH6A 4CDXC 4H7MA 4Q2FA 4OI0A 2AENA 4U2AA 5K0UC 1MS8A 2VW0A 1ONAA 4PIZA 4Q26A 4XFCA 4HL0A 1ND2C 2AUYA 3AMHA 3HMYA 4KWLA 4YW3A 3KCXA 3RDIA 2O0OA 4CDWC 3AXDA 5L7OC 1D0GA 4X6RB 3N7JA 2X5IA 2B9UA 4WM8B 2HWB2 1FMD2 4OZXA 4GKYA 5C4WC 2JEMA 3RJ2X 4QMAA 1R081 1PO22 1U5ZA 2WNUA 4UW6A 2BFUL 3D0SA 3MIHA 5GZEA 3ZFFB 1YCIA 1FNYA 4AI8A 4QT6A 1LECA 1WW7A 1PZ9A 1AYM2 2RM23 4N90A 1XYNA 3VZLA 2GN3A 5B2GB 4QPGB 4OUMA 2DF7A 4BIOA 4YFZA 3MDPA 3HR9A 4DZGA 3I59A 2XG3A 3O0WA 1F5JA 4AFBA 3ZFEC 5JR7B 1AZDA 2EXIA 2XH6A 4MV2A 5GKAC 2Z42A 3SXWA 4YG0A 2Y38A 4YVSA 3ZYRA 2BVBA 4HK8A 4I30A 3ILFA 1CX4A 1LHNA 1RUI2 1NXMA 1LESA 2AZ5A 1NCQC 3JQWA 1RJ7A 4E4SA 3SISA 5CG8A 1I6XA 3U4XA 3WCRA 5LEJA 4OHXA 2QQPA 4Q1PA 3VHRA 1OA2A 1ZRDA 5BPXA 4YW5A 4IEUA 2Z79A 5BNOB 4XEZA 4G3YC 5CG9A 1W2UA 3CNAA 1DHKB 2GAUA 3ROUA 3AJZA 1WD3A 1S1AA 4GA9A 4XFAA 4IESA 4W65A 1DZRA 2NZ9A 1QF3A 1Q8OA 2GNDA 2H0VA 2MEV2 4AI2A 5BUVA 1DQ1A 1SFYA 1IPJA 2GNTA 5SV5A 2VQAA 4RQPA 4XFIA 3AYEA 1Y43B 1XXNA 5JMCA 3OTFA 3VBSC 1VBA3 4BE3A 2GH8A 2KA3A 3VKMA 3O0VA 1QJY3 2R043 3ZSKA 3KGZA 4LHKA 1GSLA 2C1FA 1LEDA 3AP7A 4XETA 1RUF2 3ZN6B 4WV8A 4AI3A 3CU7A 1V00A 4NHMA 3A0NA 1YI7A 2CAVA 2QUOA 1PIV2 2C0ZA 5FLJA 1WMFA 4JRAA 4AVBA 2O8OA 2Z5WA 3EHKA 1PK6B 1J3PA 4NOTA 3B3QE 2X8KA 4QQ2A 1GNHA 1O3QA 3R0RA 4YG3A 2D6KA 4R8HA 2AREA 4OVEA 4LT5A 1EV12 4KNCA 1YJLA 2QZ2A 4DPNA 4XW3A 2JE7A 2ARBA 2ET1A 1WBFA 1NZCA 4M3CA 4WZCA 2ZGRA 1GYKA 4E2GA 3CJIC 1QWRA 2P3IA 4DNYA 4Q8KA 1VBA1 5JSOA 4L97A 1N1TA 4JDNA 1OHFA 2R041 3BPZA 1V9U3 4S2FA 5D8AC 1LHWA 1I9RA 1FPN2 4AE2A 3U0ZA 4LBJA 1JYIA 1Y7BA 4I0WB 1MVEA 5E16A 4WVWA 3KB5A 5KXCA 1OOPC 1ZZCA 3JD73 5C33A 3JQXA 3VHNA 1D0HA 3HT2A 4XQDA 2CWSA 1Z7S2 5CFDC 2JE9A 3X29B 5C9AB 2ETEA 4K8FA 1GQHA 1CAXA 2LALA 3VKLA 1HLCA 1SBFA 4INDA 3MEPA 3AYAA 2D7FA 2Y26A 3GYDA 3R4UA 3LKJA 1HV0A 2P3JA 5CB7A 2A6YA 4FPKA 3I54A 1MQTC 5KC6A 2R32A 2B39A 4Z07A 1NCRB 2ZGNA 3AMPA 3IDCB 5F9TA 1SCRA 5K7PA 3WG4A 4FPOB 4N9IA 3RRDA 5L7OB 4B8EA 2ZGPA 1QH7A 1A3KA 2GDFA 4P9GA 3HAGA 1ZRFA 3IM0A 2HWC3 3WW1A 1WCKA 4CEWA 4K3UA 3TNPB 2IZWA 3GZUC 1HKDA 1AR82 4HETA 4GKXA 2N7GA 2WKKA 3ZFFA 2D3RA 3ATGA 2D97A 2VECA 1V6NA 3QACA 4YZ2A 3FFZA 3VKFC 3ACLA 2PHUA 3NKTA 3HIFA 4MXWB 3NAPA 1F31A 5T54A 3ZFEB 1OA4A 1B35A 1K5MB 1QMJA 2JG9A 2NMNA 3GZAA 1OMIA 2UWCA 2JJ6A 3H1WA 1GICA 1HQLA 2JX9A 1UIKA 1NCQB 1AR73 4FPCA 4G9SB 1C1LA 2V09A 1H9PA 4H14A 4N43B 4S2HA 2I74A 3ASIA 5AC92 2AYHA 4Z1VA 4IEZA 5FMOS 1HXS3 2HWC1 4XJWA 1ZRCA 4TZDA 3OY8B 1DGWX 2ZAAA 2PELA 5JZGC 3JBG3 2H0BA 4OHZA 1LOBA 2D5FA 1DZTA 3J8F2 3KM5A 1REFA 2WSVA 2DV9A 3M7AA 2VY0A 4P9LA 3VDDC 5FQ0B 4GMP3 3AXEA 4DQAA 1H2KA 2W0XA 2DUPA 1X7NA 4PDWA 5I0RA 3IWZA 2ZHNA 3ZYGA 1VAMA 2PHXA 3WDUA 1BXHA 4QPIC 2DCJA 3LSDA 1U5XA 3MFAA 4FP3A 4MSVA 1RUH2 3MI8A 3WG3A 3OYWA 2BGCA 1S55A 4BMBA 2ZZQA 3E6BA 5H9RA 2WA4A 1AR71 1GQGA 4B7EA 1WD4A<