1CR7A

Peanut lectin-lactose complex monoclinic form
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
232
structure length
232
Chain Sequence
AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords LECTIN
publication title Crystal structures of the peanut lectin-lactose complex at acidic pH: retention of unusual quaternary structure, empty and carbohydrate bound combining sites, molecular mimicry and crystal packing directed by interactions at the combining site.
pubmed doi rcsb
total genus 51
structure length 232
sequence length 232
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 1999-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1cr7A00
3NV1A 1LU2A 1QKQA 4FOYA 4CZSA 3WG2A 1C57A 1SLCA 1W6QB 4FP3A 3ZXFA 5F9TA 1QGLA 4XZPA 5GJ6A 4M3CA 1KQRA 3GNEA 1S1AA 5JVVA 3IPVA 1ZA4A 4Q26A 2P34A 1H9WA 5GLZA 4BLIA 4M3CF 3R05A 2GMPA 3POWA 1W0OA 2A71A 4H55A 2ZACA 4AGRA 4P9XA 1MS9A 5DXDA 1LESA 2A6VA 1BJQA 4WVVA 2ZGOA 1WBLA 3M3QA 4HL0A 4WV8A 2PHXA 3ZSKA 1FNYA 3WZ1A 4XMAA 4YM3A 1FYUA 1JN2P 1SLTA 2GN7A 4YM1A 2PHRA 2DTWA 4GA9A 4TZDA 4YFWA 1AZDA 4JRAA 1S0CA 3WHTA 3USUA 2W52A 4FP2A 3ASIA 1LOGA 4XYXA 4BOWA 3N7JA 1W6NB 3ILFA 2WLQA 3B69A 2DUPA 5IK7A 2E6VA 1VALA 3OY8B 2AREA 4XTMA 3ZXJA 2ZGNA 1D2SA 1LU1A 2ZA9A 2A70A 3T2TA 3ZSLA 4AYUA 3WG4A 3LCPA 1EPWA 1WLCA 4FPYA 2AR6A 4YW4A 5CNAA 1UKGA 1OQ1A 1UPSA 3MW3A 1YRZA 2ZKNA 1DFQA 1LHNA 4C1WA 4GALA 3IM0A 5F5QA 4YW2A 4XJZA 2A3XA 1DYKA 4Y1UA 5DZEA 1JBCA 2VU9A 1URXA 3SITA 2I2SA 2ZGRA 3ZSMA 4DS0A 2WT1A 3APBA 3DUIA 2CTVA 1KJRA 4Y22A 5DUUA 3FBYA 2D6NA 2D3RA 2PHTA 3AP9A 2JECA 2ARBA 3WUDA 1Q8SA 1QF3A 3NV2A 3N35A 1S0DA 3INAA 1MVEA 1UMZA 2A7AA 2GN3A 2ZMLA 1DHKB 1LECA 1F9KA 1YI7A 2XB6C 3DGTA 1MACA 1MS8A 1FNZA 4GKXA 4YM2A 4Q2FA 1LHUA 4YGBA 4Q8KA 1KRIA 4ASMB 1V6KA 2A5ZA 2DUQA 4XE9A 4HANA 4ISRA 4YW3A 3N3HA 1LCLA 1GSLA 2R1DA 4M3CB 4XJAA 2ZBJA 1GZCA 5T54A 1LGNA 2CL2A 1UX6A 3OYWA 3ENRA 1I3HA 3IPVB 3PVEA 4P9WA 3N7KA 5JOZA 3MW2A 4FPFA 4FVVA 2OVUA 3V65A 1W6MA 3HR9A 1DQ4A 5H9PA 4U36A 2A75A 2NM1A 4P9YA 1YYNA 4LBOA 3SISA 1V6LA 1NXD1 5LK5A 1DGLA 2NZ9A 1LULA 2JE7A 5KXBA 1IOAA 4CRQA 2A6XA 1JUIA 4K1ZA 1YIFA 4DQAA 3OJBA 1B09A 2V5YA 4BLJA 3V0AB 4LBLA 5GLVA 4WVWA 2YROA 3AP5A 4L8QA 1RINA 1GBGA 1V6MA 3LSDA 4W65A 3USUB 4DPNA 2ZHNA 1N47A 4XIOA 1QOTA 1YO8A 2GMMA 2CYFA 3WUCA 2R0FA 2WT2A 4IQPA 5GLUA 2D6MA 1IS6A 1Q8PA 2GNTA 5L73A 3FUOA 4PCRA 2UURA 1ZM1A 3OPZA 1SFYA 1RITA 1SCSA 3VKLA 4ATEA 1DIWA 1GZWA 1Q8OA 2Q5TA 1ULFA 2LTNA 3JUUA 2DYCA 3RMXA 2R16A 2CNAA 4YZ3A 3AZXA 4GWMA 4XMIA 1BQPA 1FAYA 3O12A 1S0IA 3AZWA 3WG3A 4BM8A 4NOTA 2WSVA 1MS4A 1W6OA 3GALA 1V00A 2C5DA 2R1BA 2EAKA 4K1YA 4RA0A 2D44A 1YXWA 1LOAA 4UW5A 1AF9A 1WW4A 1UAIA 3FLRA 4Y22B 3B3QE 2HYKA 3V64A 2UWCA 3AXEA 1Z78A 1LODA 4UW6A 2Z42A 3M3OA 5KXCA 3SH3A 2D3PA 2DUOA 4Y1XA 2D6PA 4U2AA 4YGEA 3WDVA 3ZYRA 4Y1YA 1LOBA 2VXRA 3AYDA 4LBJA 4M3CE 4FPEA 4TYSA 4BMBA 4LBQD 3WG1A 3RG0A 1W0PA 1AX0A 2D3SA 5GZFA 1LOEA 2FHRA 2NN8A 1WCSA 2EIGA 5JLVA 1LGCA 1S0EA 2DVDA 2OW4A 4XBLA 1GICA 1H9PA 2ZHMA 3CNAA 1C4RA 1HKDA 1OFSA 1QDOA 4XJ8A 4FPJA 4K21A 3AJYA 1SLIA 4LBNA 4BQ1A 3M3EA 5H9QA 4YW5A 1IKPA 4ITCA 1MS1A 1A78A 3OYWB 5CAZA 2ZAAA 2JE9A 3MPPG 3N36A 5HCAA 1G9AA 3IMNA 1V6JA 2CWMA 3VKNA 2V73A 2ERFA 4GXLA 3WCRA 1RIRA 1IKQA 3UJQA 1W6MB 4AVSA 3FUQA 4KBBA 2UU8A 4XDQA 2P2KA 3BTAA 2ZABA 3VUOA 1G9BA 1UZZA 4PF5A 5CA6A 4D69A 2D6OX 2E53A 2PHFA 3ZXKA 3POSA 1FATA 2BQPA 1SCRA 2D43A 3AZVA 1JW6A 4XJ9A 5DG2A 3WDYA 1JXNA 1UZYA 5JOYA 2ZGQA 1N3OA 1NLSA 2AENA 1GZ9A 3FLTA 3LSEA 1UN1A 2P3IA 3VV1A 1IS3A 1SBEA 4XTPA 3A4UA 2H0BA 5EWSA 1ULCA 2WT0A 1OKQA 1CIWA 5FRAA 5T5OA 3WVJA 2PHUA 2DWRA 2EXIA 5GM0A 2GDFA 4M00A 1BZWA 3O0XA 2D6LX 3B00A 4YG0A 2ZGPA 4YG6A 1KDMA 1A3KA 1CR7A 1QOSA 1S0JA 1HLCA 2JDZA 1LEDA 1GZWB 1W6QA 1GLHA 4MYEA 4XJUA 4XXAA 5GALA 3AJZA 4FOVA 2SLIA 5GZGA 4I30A 3ZVXA 4FPKA 1CESA 3A0KA 1VAVA 1N3PA 2DURA 3AP7A 4YZ4A 1W6OB 1DZQA 2AGSA 2ARXA 2JJ6A 4Y24A 3VKMA 4BMEA 1CN1A 3AK0A 5JOXA 1CPMA 1X50A 4FQZA 1D0HA 1LGBA 4UW3A 3ZXEA 1BKZA 4XOGA 1WD3A 3AZYA 4Y26A 3UJOA 3SLIA 5T52A 3WDWA 1LHWA 4YLZA 4P14A 4R9DA 3WCSA 2ZHLA 5EYYA 1MS5A 2TEPA 2E7QA 1WD4A 1QDCA 3RQ0A 1C1FA 4DRVA 4YGCA 1DYPA 3JU9A 2ZMNA 4XXPA 1HDKA 3IKWA 2A3YA 2CWSA 3WHUA 1N3QA 3M1HA 5H9SA 2XG3A 1C1LA 2WJSA 2W68A 5CB7A 2ENRA 5T50A 2ZGUA 3WDXA 3SH5A 2D6KA 3WDTA 1SBDA 1VIWB 3AFKA 1ULGA 2C9AA 2ZGLA 4Q1RA 1CONA 5KXDA 3ZXLA 2GMEA 3ZYPA 3BODA 2P3JA 2ES3A 2P3KA 3WV6A 1S0FA 1W6PA 2OUJA 1WW7A 1FX5A 2JD4A 4YW1A 3M2MA 1MZ5A 4Z8BA 3M3CA 4ZXKA 1LEMA 1JYCA 1ENSA 1Z0HA 2DVAA 1WBFA 3H0OA 5HCBA 5DG1A 5IT6A 1G86A 2VW2A 5E89A 4DFSA 1KJLA 3FFZA 1LHVA 3I4IA 5IK8A 1DLLA 1F31A 2A3WA 1AX2A 1WUVA 4PBPA 1LTEA 5JDBA 4BPZA 3WNXA 1BXHA 4XHXA 1Q56A 2NMNA 1PZ9A 1A8DA 3MEPA 3OBRA 1LOFC 3VKFC 1DQ6A 1LENA 1ONAA 1QNWA 2WSUA 1SLAA 5SV8A 3T1MA 1VAMA 1JHNA 1V6IA 3AXDA 5DZFA 4DRRA 5GZEA 2VUAA 3Q9OA 4Y1VA 2B7YA 4FOQA 2ZMKA 3PMEA 4LBQA 4XJWA 5FREA 1QOOA 4NO4A 4XIKA 3KM5A 2UWAA 4R9AA 3PJQA 2WQZC 3RSJA 1DQ1A 1AJOA 1ENQA 1ULEA 1V6OA 2ZGMA 1DQ2A 2EF6A 3MW4A 2SBAA 1ULDA 1JOJA 4ZKTB 5BYNA 1CPNA 1O4YA 3SH4A 1LOCA 4ATFA 1SLBA 1AXYA 3I8TA 1Q8QA 2G4IA 2VW0A 3OBTA 4PBOA 4SLIA 3AYEA 2AYHA 2DU0A 3U4XA 1MS3A 4Y20A 4YG3A 1FV2A 1UL9A 2DVGA 5T55A 1GANA 3R4UA 2ZHKA 4R9BA 5EYXA 5AVAA 4C1XA 1AVBA 5IUQA 1G9CA 1HQLA 4AVVA 1N1YA 3D4KA 3NV4A 1KITA 3N7LA 2R49A 3V0AA 5JOWA 3OGGA 3KQRA 2EXHA 3AYAA 4XHBA 3ILNA 2CY6A 4AWDA 1G8WA 4LBMA 3AYCA 3HMYA 1Q8VA 1WW5A 3R4SA 3FLPA 4Q8LA 5DUXA 3T1LA 4GWNA 5E88A 4XBQA 3TAYA 1F5FA 4F83A 2OUHA 2UWBA 3V0BA 2ZZJA 3L2YA 3QLQA 1IS4A 2JKBA 2NMOA 3PVOA 3D5OA 2RHPA 4AGGA 1W6PB 2PHWA 1KDKA 2ZGTA 5GZCA 4K20A 2ZGKA 3SNMA 2P37A 1G9DA 2E51A 1CQ9A 1I1EA 2GNDA 2KM2A 5JMCA 4FPCA 2DTYA 1ENRA 3BOPA 4FOWA 2NYYA 4JC1A 3A0NA 4LBKA 3RMYA 1WLDA 5IK5A 4YGDA 5T5PA 1QMJA 3ILRA 2YXSA 3PVNA 1SBFA 5DUVA 2YZ4A 1AXZA 5GLTA 1APNA 4AGVA 4FPOB 5T5JA 4AVTA 2GNBA 1G9FA 2W08A 2YY1A 1H30A 1WW6A 2LALA 4FPGA 2A6WA 5GLWA 1N1SA 4LBQB 2R0HA 1DBNA 2AUYA 1WLWA 1MVQA 2EXKA 3WDUA 1PZ7A 2A6ZA 4PQ9A 2DV9A 4YZ5A 1GV9A 5H9RA 1LHOA 1JYIA 3AP4A 4Q1PA 3W58A 2D7FA 2DVFA 5T5LA 2PELA 1MS0A 3POYA 2EXJA 4OZXA 1Y7BA 1SLLA 4FQ4A 4ISQA 1DQ5A 1GNHA 5KXEA 5IK4A 3NWKA 1W6NA 2NP0A 1S0BA 3AZZA 2EALA 3C2UA 3UL2A 3OY8A 1PZ8A 4JCKA 3B9CA 3VKOA 3HN1A 4CTEA 1QNYA 2A6YA 3O5SA 1GNZA 3RS6A 3O0WA 1N1VA 1AXKA 1VLNA 3D6EA 4Y20B 5DUWA 3N7MA 1LJ7A 2DVBA 2FMDA 3QCWA 4Q27A 1DQ0A 1CVNA 2E7TA 2VH9A 4YM0A 3RRDA 1AX1A 1HQWA 4WZFA 4XILA 1SACA 1N1TA 3IN9A 1MR5A 5DZGA 4YZ1A 1XQNA 1G7YA 1CJPA 1S0GA 2VY0A 3B01A 1R1ZA 2ZGSA 3ZPYA 4UW4A 3AX4A 4GKYA 1MZ6A 1TEIA 4R9CA 2YV8A 3ZSJA 4FPHA 1IS5A 2YMZA 3NV3A 3WLUA 1AJKA 4M01A 4RL7A 5GZDA 2WKKA 5HCFA 1V6NA 2GALA 5EXOA 1GYKA 3BIWE 1QU0A 2GNMA 2AH2A 4YFZA 1FV3A 1O4ZA 3AP6A 2WNEA 4XBNA 3V0BB 4YZ2A 4Y1ZA 1U0AA 5E8AA 1BYHA 2DU1A 3O0VA 3ATGA 4FPLA 2W39A 3WOGA 3TB0A 3W59A 1J1TA 3UK9A 1LOFA 5CBLA 1GKBA 2VW1A
chains in the Genus database with same CATH superfamily
1PO13 4YWAA 4CZSA 1XNBA 1C57A 1VMHA 1W6QB 2H6CA 5F9TA 2WFF2 5GJ6A 2WNUA 2WFPA 4M3CA 1W8OA 4HG6B 4WM8C 3SCGA 4N7UA 1POQA 1XNCA 3HPNA 1ZA4A 1RVF3 2ZXQA 2VJXA 2YFUA 5FKCA 1OT5A 2BFUL 4IEQA 1PGL1 2AACA 1TME3 1W0OA 1AYM2 3J9SA 1YI9A 3FN9A 4URTA 5BXXA 1H2MA 4AHWA 1MS9A 5DXDA 3VL9A 1BJQA 1BVP1 1GR3A 1TZOA 4LJHA 4WVVA 1Y43B 4UI9L 4YW6A 4F7ZA 1JZ8A 4FXGB 5I0TA 2QQVA 1FNYA 3PL0A 1JN2P 3OF1A 1XNAA 3Q8EA 4GA9A 3ZM8A 1YWKA 4AI1A 1HW5A 4BIOA 4JRAA 1YLLA 4CP1A 1FMD2 4MGTA 4EWDA 2BDRA 4LOSA 2WNVC 4CXXA 1QJX2 4AAPA 3S57A 4MGYE 5DAPA 2JG8B 1MEC3 2JE8A 3OY8B 3ZXJA 4XTMA 2WRAA 3ACFA 1ND2C 1PMIA 5FYTA 2A70A 2HWF3 2VQ0A 3VBUA 4AHZA 1HQNA 2J1TA 1NLQA 1IGOA 3WP3A 1GZTA 2G9GA 4FPYA 2AR6A 2WIIB 3NNFA 1OQ1A 2BUKA 3SCFA 3MW3A 3UGGA 4JVAA 5APAA 4DY3A 2WUHA 2GSYA 1LR5A 2O8OA 2PLV1 1VPHA 2RS11 4A6SA 3UV9A 4LIUA 1DYKA 3ECQA 3T08A 5C3SA 2P6HA 1XOYA 4COUA 3LPGA 1OLME 3I2GA 4LT5A 1AHSA 2A1XA 2QQNA 1V9U2 3APBA 2ZEXA 4Q0QA 3MF9A 3AP9A 2ARBA 4LMFA 3N35A 3CJIA 4GB31 4EROA 4XFBA 2ZMLA 1FPN1 1RUJ2 1YFUA 5FPAA 1YI7A 3VDAA 1MS8A 1OXCA 4PJYA 1NG0A 4QWNA 5DAVA 1BVVA 3EB7A 3MV11 5I0SA 1KRIA 3KZ4C 4ASMB 4ZU4A 2QCSB 5F3EA 1V6KA 2A5ZA 1PK6A 4O9GA 3HNMA 3PUSA 3VBOA 4IE4A 5A3PA 2C9KA 2XH6A 3UT0A 1CX4A 2JDKA 2GH2A 3N3HA 1RUF2 2P17A 2ZBJA 1GZCA 2QQKA 3N9PA 2YB7A 5BPXA 3U07A 3ENRA 4HETA 3IPVB 1SFPA 2JDPA 4XDPA 1W2UA 2RR12 3MZHA 2DCZA 2KD7A 4UXAA 3V65A 2RM23 3TYJA 3P1IA 3SISA 1YYNA 4LBOA 3J8F3 1NXD1 1WMEA 3NL1A 1H1IA 4UFLA 3VBSB 5C4WC 2A6XA 2KXLA 4JGYC 2I45A 3CKHA 5CISA 3OJBA 3W20A 1YQ5A 1RUD1 4LBLA 2FBEA 1VBE1 4DO0A 2YROA 1RINA 1QXPA 4XFIA 3USUB 4AEDC 4LEJA 4ATEA 3B9IA 4DPNA 1R1A1 2ZHNA 4NHKA 4DXRA 1N47A 4Q4Y1 1RUOA 2GC3A 3BPZA 3KV5A 2CYFA 3LZZA 1F2NA 4MVTA 2TUNA 1IG3A 2WT2A 3WUCA 4DZGA 1YJKA 4N43B 1QJU2 1Q8PA 1AR63 4PCRA 2BOIA 2IVIB 1AR92 5FZEA 1MQTB 1RITA 3VKLA 1AL21 2RS31 1Q8OA 1UZWA 4RGKA 2JDHA 5A7SA 2QE3A 2WN2A 2WQ8A 3GZTB 4WVMB 5LBBA 4YVSC 3AZXA 3HT2A 4LO6B 5FY5A 2GC1A 4UF0A 1H1MA 1NXMA 4GMP0 2ZX0A 3THCA 1JZ4A 4NOTA 3RZMA 1I5ZA 4Z92B 3WD5A 2WINB 3GALA 5G05L 1YXWA 1UAIA 4QPGC 4LLFA 4XF9A 4Y22B 1PVC3 5T3NA 1RJ8A 1RUH2 2RVAA 3WQBA 1OBNA 3MIFA 5EQUA 1IZ3A 4Y1XA 3ZYRA 2DFCA 1ZRFA 1F8VA 3RDIA 1GQGA 1HXS2 2VXRA 3AYDA 4I0BA 4M3CE 4FPEA 2FDJA 5IHRA 3Q8FA 1UU4A 4EN0A 4HKOA 4IV3C 3WSOA 3ETPA 4RR3A 3AKPA 4AHXA 5F7UA 1GICA 2ZHMA 3CNAA 2LUWA 3JBG2 1EP0A 4WVZA 4CU7A 4Q0SA 1H1AA 5FZ8A 1QDOA 1ZZ9A 2FMYA 2HEVF 1KS4A 1NA1A 2PQQA 4JHTA 3LB9A 1ALYA 5A3UA 2WL1A 4YW5A 2ZKLA 3OYWB 1W99A 4MGZE 3RYKA 4CCMA 1PNGA 5CAZA 2E31A 4AQTA 1CIYA 2W46A 2ZZQA 1TQ5A 3VKNA 1POV0 1JH5A 4K8FA 4GXLA 1NCRC 1US3A 4RQPC 3MO4A 3WCRA 3UJQA 1QJY3 4AVSA 4XQDA 2YC2A 1I6XA 2ZTNA 3JZVA 3IAQA 4XDQA 4AK3A 2JDMA 2ZABA 3ZFGB 3VUOA 1G9BA 4CP0A 2OQ7A 1NCQC 2IZWA 4HSLA 2J1SA 5CA6A 5DAXA 2PHFA 2DCTA 3POSA 1HRI1 1VBC1 1HX6A 2BQPA 5JXGA 3AZVA 1JW6A 5F3CA 3WDYA 4I0AA 4LIVA 4K40A 1NLSA 2AENA 1GZ9A 2NPIA 4P02B 3VD5A 4BQ3A 3VDDB 4Q4X3 5EWSA 5LZ6A 4P08A 3HQRA 3MICA 4NAMA 3JQWA 2PHUA 4XFGA 1C8M2 2EXIA 1VBA2 2K0GA 2RJ2A 4M00A 1BZWA 4QQOA 5GM0A 3VHNA 2JDUA 5JZGA 1VBB3 5ERLA 1JYVA 4JDNA 1RHI3 1VBD1 1KDMA 4Y3OA 1A3KA 4FFIA 3J7MA 4UOJA 4YVWA 5C8CB 1UYPA 1HLCA 4IETA 1LEDA 4IEVA 4PI2A 4YYOA 4OHWA 1OH4A 1E5IA 2HWD1 1GLHA 3BOWA 3RI8A 1FI2A 4XJUA 3RPQA 4R52A 3WW4A 2W91A 2WWSA 2SLIA 4C91A 3LQCA 4DXSA 5JIUA 2OX0A 4XF3A 4S2DA 3IDAA 1CESA 5ACA2 2AC1A 1RUG3 3PTRB 4ZY9A 2FZ2A 3ZFEA 1W8FA 3LDBA 4OMDA 1CPMA 1X50A 5IFTA 5HBAA 3A21A 3ZXEA 5F3IA 1YIPA 4XOGA 1WD3A 3UJOA 1UMHA 2VBBA 3WDWA 3BVCA 3KD4A 5FP7A 3IMMA 2RDQA 4R9DA 3WCSA 3VBRA 1B35C 1D0GA 4IL7A 4CDUB 4COZA 2PMWB 2YPJA 4ONUA 4NIIA 3WX5A 4DRVA 1WD4A 1QDCA 3PUIA 4B1MA 3HEIA 4AEKA 4CCNA 2Z5WA 4XFHA 4BQ4A 3IWZA 1Z7S2 4XXPA 3IKWA 1W9WA 1OURA 4KGGA 5FZKA 4X6RB 1EV12 2W68A 3AB0A 4Q4V1 3LGRA 1F35A 1J84A 1UIJA 2BJSA 1X33A 3CZUA 3WXPA 1JODA 2C26A 5C8WA 3AFKA 4PQQA 3DF0A 3PMSA 2E7AA 5FK8A 4FAHA 2D93A 3VZJA 2CSGA 4FI9A 4V2VA 3ZXLA 4WM7B 4LK7A 5IVEA 3WV6A 1DGRA 2YU2A 2OUJA 5JPNB 4Z8BA 4KWJA 5LASA 2D5FA 5FQ0B 4ZXKA 2J7MA 4E4ZA 4LKSA 1KEXA 4OHZA 1BEV1 2QVSB 5BNQA 1ZBA1 1WBFA 5D8AC 3WEZA 1G86A 1PO11 3KT1A 4D94A 4DFSA 3U78A 5I93A 4ZXEA 3FFZA 5IK8A 2HEWF 4QXHA 1OUXA 1WUVA 4PBPA 4LITA 2ZOEB 4D6SA 5JDBA 3IIIA 1PZ9A 2VBDA 5DDJ3 1RVF1 5F6KA 3SHRA 3VKFC 1PO22 4CEYC 4FSJA 1SLAA 4NWWA 1TME1 2XLFA 5SV8A 2X29A 4Y1VA 5L7OC 4LBQA 4OHXA 2RJLA 1DZTA 4HVQA 4Q0PA 4XIKA 2QJVA 4QX8A 2UWAA 1NKGA 3PJQA 3NW4A 1GP6A 3RSJA 5CZKA 4D8MA 1V6OA 5IVJA 3DPRA 4PIZA 3A23A 5CFDC 1DQ2A 1L7LA 3CHXA 3UYJA 2JG9A 1ULDA 5FZMA 1JOJA 3ZKUA 4XCAA 5BYNA 5C33A 4AE2A 3SH4A 5HPOA 1SLBA 3I8TA 1AR73 4Q4W2 3OBTA 2VW0A 5DPNA 1HJFA 1D4VB 3AYEA 2VVDA 1XNTA 5HI0A 3U4XA 1NE4A 1MEC1 4Y20A 5J7MA 2IC1A 1NY72 1TMF3 5FP8A 1L7RA 5T55A 2HWF1 3ST7A 4BA6A 4XFFA 2ZHKA 3SEEA 3QH6A 4NE9A 4CDXA 1COV3 1O5LA 2XXZA 3D4KA 3OGSA 2W2IA 2GC0A 1OVSA 2HWE3 1S2KA 3J4UH 3P3PA 1YQ2A 2OT7A 3PIGA 5FZHA 2KA3A 4P9IA 4LLOA 2VQAA 2XHKA 5A3WA 2X5IA 3HMYA 2E63A 3VHRA 1BHGA 1CJDA 2Q1FA 4LO7A 1UZ0A 4QM8A 2VMIA 1ZZ7A 1F5FA 2OUHA 5IVVA 2Z79A 3V0BA 2ZZJA 2OQ6A 4XW3A 4BJ0A 3QLQA 3RZKA 2PAKA 1OD5A 1H8TA 1UXZA 3MLKA 5AFBA 2VNGA 3FZ3A 4KWLA 4IEOA 4CUAA 3RZHA 4O7XA 4XVHA 5FYBA 3GZEA 3SNMA 1G9DA 4M0HA 2D5HA 1HRV3 3JXSA 5JI7A 2DTYA 4GJYA 3PVBB 1YHFA 3CJIC 2RS13 2WFF3 1WCKA 4FOWA 4QM9A 4JC1A 1GQHA 2X05A 3KSCA 2ZEZA 3I2JA 3OPWA 3V56A 1U12A 2WYFA 3GCWA 2E32A 5T5PA 3ILRA 3THTA 5FBJA 2PHLA 5F39A 1AYM3 1AXZA 4AGVA 4GB33 2XJRA 3WNLA 3F95A 5I8TA 2Y6KA 1YNAA 3VBOC 4XQWA 1G9FA 4OUSA 2VR4A 3ZFFB 1H30A 2RM21 5CU1A 2WYSA 4CCOA 4HZFA 3O1PA 1ULPA 4BQWA 4CPBD 4PQ9A 1CAUB 5LA9A 3POJA 3I3EA 4PI0A 2GZWA 1JYIA 2RDRA 1IPSA 2D7FA 2DVFA 1W9FA 4NPLA 3EO6A 4Y5SA 1SLLA 2JICA 1FMD3 1GNHA 2BBAA 3WQ1A 5FYSA 2NP0A 1O8SA 1ZVFA 1QJX3 2XJTA 1S0BA 2JG8A 2N7GA 3C2UA 4HKWA 5C5UA 3OY8A 1PZ8A 1CGPA 1C5IA 3UNPA 4CTEA 3SMHA 3CBNA 3T2OA 3Q8CA 2EVXA 5A80A 3G6JB 3QCWA 4Q27A 1DQ0A 4RN5A 4FFGA 5FYYA 1XSRA 1C5HA 2VZSA 4CDWB 1SACA 4HPKB 1L3JA 3AKRA 3IN9A 3WF0A 5A1LA 1MR5A 1H0BA 1P8JA 1G7YA 1G6NA 1E5SA 3B01A 4IV1B 4YW7A 4QQ2A 1SFNA 3OG2A 1HB2A 3ROUA 1TEIA 1X9PA 4MUVA 4R9CA 1IS5A 1ZREA 2VULA 1V9U3 5K4LA 2Y64A 3W21A 5HCFA 3BTYA 1GP5A 1UKRA 3NQHA 3S5QA 1GYKA 2OZJA 2GNMA 3ZR6A 1PVC1 3VN4A 1VP6A 4XFCA 3AP6A 4XDOA 3MF6A 4XBNA 4YZ2A 2R072 3I97A 1RUJ3 4GQ7A 4LE4A 5FYHA 3VBHB 3HIFA 5JSOA 3TEWA 3H8OA 2FDFA 2DU1A 3WOGA 3ATGA 4LPLA 1WMDA 5E6HA 2RS33 3VBFB 3ETQA 3UK9A 4KU7A 3OUJA 1U5IA 5CBLA 4JKLA 4PDWC 3WF4A 5BNPB 3NV1A 5C9AC 5IATA 2KR2A 1O4TA 1PGW1 3PURA 3HBKA 2XWBB 4PLMA 1SLCA 3SKJE 4D3WA 4CXYA 1QGLA 1W04A 2VCCA 4K3UA 4S2FA 4XZPA 5IVCA 1AL0G 3OTFA 4TWTA 4MGQA 4L0PA 5DABA 4BDVB 3IPVA 3E6BA 2P34A 1LNSA 1REEA 5FZ1A 1UU6A 4YNIA 4BH9A 5C7GA 4RR3C 5KHIA 2RR13 1IPKA 2XDVA 3W5NA 2ZACA 2RV9A 3QBQA 4P9XA 5FP9A 1J1LA 4O9EA 3GDBA 4N53B 2ZGOA 1QJY1 3D8CA 4HL0A 3FE5A 4WV8A 1IG0A 2PHXA 3JB8A 5JMOA 5FZ9A 3WZ1A 2DF7A 4IXLA 4XMAA 1FYUA 3O1VA 4J1XA 1RMU3 3T2QA 3VD4A 4TZDA 4YFWA 3UESA 3USUA 4E4SA 1OF4A 1RXGA 3JD73 2XLGA 4LKFA 4BOWA 4CYDA 5BNNB 3N7JA 1W6NB 5IK7A 1GU3A 2WLQA 3B69A 2E6VA 3U37A 3LAGA 4Q4X1 4HMZA 1ODNA 2ZGNA 4N43A 1D2SA 2ZA9A 5FTTC 3T2TA 1W8HA 4AYUA 1QJU3 4C90A 1IQDC 1Y3TA 2ZCWA 4KH9A 3I3DA 3LCPA 1MQTA 5ISLA 4WBBA 1VBB1 1J3QA 1JZ6A 1HB1A 1RHI1 4WVMA 1RJ7A 4XABA 1FOD2 1VR3A 2I74A 4B7KA 2ZKNA 5FYUA 1HB4A 3AVRA 4FFFA 4BQYA 2ZX3A 3RGBA 3UGHA 5CFCC 3FFQA 4NRQA 4PLOA 2RJKA 2Z2SB 2ZAHA 3C3VA 3LDKA 3IAPA 1VBC3 4IEZA 2A3XA 2HWC1 5FZFA 3VD3A 1X8EA 5IVFA 4AL9A 3UKNA 4RSUA 5JZGC 3VDBA 2VU9A 4CCCA 1URXA 3DKQA 3SITA 2MHFA 4YVWC 1U5YA 1RUG1 2ZGRA 2WT1A 5FY9A 3ZSMA 5CADA 5JWPA 1PMHX 2CTVA 1KJRA 3I59B 4Y22A 3FBYA 5EFUA 5FLJA 5FYMA 5LY1A 2D6NA 2D3RA 1HN1A 2PHTA 2JECA 4IEWA 3UKTA 5D1IA 1RUH3 1QF3A 3ACIA 3S7IA 3WUDA 4ES8A 1QJFA 3U0ZA 1NUKA 1A34A 4S2HA 2A7AA 2PXJA 5KWRA 1ND3B 1DHKB 3C7OA 1HXS3 1F9KA 2XB6C 3POFA 5C3OA 3JCIA 4JGZB 4CCEA 1PHMA 1JUHA 4YGBA 5FY8A 3U10A 1GNYA 3JBG3 4KQ7A 5CG9A 4HANA 4ISRA 1W8TA 1W9YA 4A6OA 1Y9MA 2G19A 3OGRA 2Q1ZB 1XRUA 3FMGA 4BQ5A 1ASJ2 4FBFA 1W8NA 2FCTA 2R1DA 2Y6GA 1S2EA 5ANQA 4IEXA 1EY2A 1R64A 2W0XA 2XJPA 4XJAA 1ST8A 2CL2A 1UX6A 4A2UA 3OYWA 5IAXA 3DYOA 4ARYA 5FLIA 4HXCA 3ZN4A 3IZOA 2YGLA 3AKQA 4NHMA 3PVEA 1E5HA 2NQYA 2Q8OA 3WF2A 5SV5A 4AVCA 3ABZA 4A44A 4CEWC 5FO8B 3EBRA 1S4CA 2J22A 1DQ4A 5L9BA 4U36A 4Y4YA 5BY5A 4LE3A 2IXHA 1V6LA 4PT6A 5LK5A 2X8KA 5GKAC 5KXBA 2JE7A 2Y6JA 1RUC2 1YIFA 4DQAA 1UYXA 1ODMA 1B09A 2V5YA 3OBAA 1CAXB 4QPWA 4MXWB 2VCMA 1GBGA 3U11A 1UU5A 4UFMA 3VDDA 3KHBA 5C6CA 1F4HA 3VHOA 5A3NA 3AMNA 4LHNA 2R0FA 4IQPA 1C8M3 1VBA3 4KWUA 1ULOA 4G4FA 4P9JA 5C8CA 1JOBA 1VAKA 2UURA 1ZM1A 4OYUA 1SFYA 2OZ6A 1PIV1 1SCSA 4MLOA 4QMAA 1DIWA 4CCJA 2Q5TA 1PM7A 4ASKA 2DYCA 1BEV3 1W39A 3D0JA 3I3MA 2CNAA 1ZBA3 4HONA 3I49A 1BQPA 3O12A 2R061 3ZDVA 2FD8A 5K0UB 1QJZA 3ACLA 1RTVA 5ACA3 2WZR2 2WSVA 1MS4A 1WZXA 5FJHA 3C7EA 1AR71 2W1SA 3E5QA 3FL7A 3HNYM 4K1YA 5CIRA 4ASLA 3I2IA 4JQRA 1A8MA 3LE0A 2WS92 1R082 5EV7A 3B3QE 3V64A 1OSGA 3TEXA 1TMF1 1H2LA 3M3OA 4EWEA 5KXCA 3SH3A 2D3PA 3E6DA 1JI6A 4E9KA 4I01A 2B8MA 3A22A 1COV1 4TYSA 2V5DA 4CDUA 4JDMA 1W0PA 1AX0A 2OPWA 4HT1T 4KU8A 5GZFA 5TSWA 5A7QA 2WZPP 3VZOA 1WCSA 1S0EA 2HWE1 2Y6FA 1H9PA 2GU9A 1Z7S3 3DCQA 5FYCA 1H4HA 2QBXA 1FXZA 2BVBA 2WBKA 2WO2A 1EV13 4XJ8A 4FPJA 4AFBA 4SBVA 4CDXC 2R30A 3PTYA 3QOPA 4LBNA 3VHPA 1EUUA 2GAUA 4BQ1A 3ZMOA 1IKPA 3PJYA 4HFSA 1VRH2 1US2A 4WM7A 3SEPA 2EA7A 5FMCA 2JE9A 3WT3A 4CSWA 5HCAA 1V6JA 1AYN1 4YRDA 5FQ0A 3MI8A 1ZYBA 1IKQA 1Q3EA 2BW8A 4IGQA 3AFGA 1W6MB 3KS7A 2W1UA 3FUQA 3SC7X 3AMHA 3BTAA 1HRV1 2JDYA 2Y38A 3B02A 3ZN6B 3USSA 2J1RA 3BB6A 4D69A 2D6OX 2ID4A 2E53A 4XUQA 3ZXKA 3DXUA 1FATA 2VMGA 3M8LA 2WFF1 2YBKA 4LQRA 1H8TC 2VOVA 3K77A 1WWYA 4P9LA 1JXNA 1UZYA 2ZGQA 1LB2A 3ZN5A 3BCWA 3FBMA 1UN1A 1PNFA 1PO23 4XTPA 3A4UA 4JGYB 3T4VA 1AYM1 3L9JT 5FRAA 3T0AA 1ZRDA 4A4AA 5FWEA 1QIQA 2GDFA 3B00A 3B5LB 2XVKA 2VO5A 2CGOA 4RFT0 1CR7A 2DBIA 2Y0OA 4RGAA 1OFNA 3ZYJB 4CDQC 1K12A 3D82A 2C6SA 1GZWB 1E57A 2VOXA 3KLSA 1SG3A 2QUOA 2VVFA 4XXAA 3AJZA 2XJSA 1LKNA 2ADDA 4AAXA 3O1RA 1A6CA 1FMD1 1W3VA 4Q4W3 1OVPA 1VAVA 1N3PA 3AP7A 2JKXA 4JDOA 3CO2A 2ARXA 4NIAA 1QJX1 2JJ6A 5FUPA 3VKMA 4N90A 5JOXA 2W47A 4IGOA 4FQZA 1D0HA 2QTWB 2XKOA 3E6CC 1H2NA 3AZYA 4Y26A 3TN92 3SLIA 4NN0A 2ARCA 3THDA 4Q5OA 2BWCA 3O1UA 2E9QA 4P14A 2BGPA 4EQVA 5EYYA 3KQ4B 1UXXX 2TBVA 3I7DA 2VE1A 4GJZA 2ZMNA 3CMGA 4HKLA 5FZ3A 3FHIB 5FMDA 3M1HA 4ORFA 3WHUA 3QACA 2BYVE 2ZGUA 3NAPB 3WDXA 5A6QA 4A7ZA 1V9U1 3SH5A 4JZRA 3WDTA 5FZ7A 4IV3B 2VPVA 3ME2A 4G3YC 2ZGLA 1NAEA 5KXDA 3BODA 4JKMA 2ATFA 2VZ3A 2P3KA 1XU1A 4E27A 4D6RA 1RUJ1 1STMA 1I5PA 4HK8A 4LUKA 2ET7A 4QDQA 3MPBA 5KHJA 1EPZA 1LEMA 3O7OA 1JYCA 4H7LA 1ENSA 1Z0HA 1EAH2 2DVAA 3C7HA 3M70A 5HCBA 5J36A 4N8MA 1ZBE2 3OD4A 4GH4A 1Q43A 1DLLA 1F31A 2J1VA 2QQMA 4RQPB 1DYOA 4QKDA 1REFA 2WNOA 4JKKA 1HV0A 2ZEYA 3IDBB 4BPZA 3WNXA 1Q56A 3E97A 2X10A 3OBRA 5EJZB 1DQ6A 5F1RA 1LENA 2DFBA 1ONAA 4OMCA 4LKDA 3WNOA 1QNWA 1RB8G 4CUBA 2XGXA 2RR11 4X8NA 1VMJA 3S30A 2WA4A 3ZFFA 1QHDA 2VUAA 2B7YA 2ZMKA 3DN7A 4XPVA 4P5YA 2B5HA 5LK7B 1JYWA 1CAUA 2XONA 4L99A 4MSVA 2WQZC 2RG4A 1RMU1 1QWRA 4OI2A 1DGRN 2CGNA 3U75A 1DLCA 3GJBA 3TRSB 2BFUS 3R0RA 2VZOA 2G4IA 3JD71 4PBOA 4SLIA 5CKNA 4FTBA 1GOHA 2HKXA 4MGIE 3VBSC 3DXTA 4KNCA 4GAZA 5IAVA 3R6SA 4EN9B 2DVGA 1UCXA 4Q0VA 2WZ8A 4C0HA 2E33A 4RGGA 3ZDSA 4DMIA 3T0DA 1OI6A 1GANA 1QJU1 5EYXA 3KVBA 5AVAA 2R042 1KS5A 2WABA 1AVBA 1ZRIA 2VZUA 3K4ZA 1W8WA 3P5BA 5FK7A 1AR91 4HPKA 4CDWA 1G9CA 3OGJA 1N1YA 5J37A 1TNFA 1KITA 2R49A 3V0AA 4IV1A 4IEYA 3OGGA 3KQRA 3WQ0A 3AYAA 2QQLA 4B1LA 4L97A 4AWDA 4MXVA 1T6GC 3WNMA 3FJSA 3AYCA 1Q5OA 1GP4A 1Q8VA 2V4AA 4LKEA 4GMP1 4GWNA 5E88A 4NR1A 4XBQA 1JYXA 3VLBB 1RUH1 4AZZA 3L2YA 3VBHA 2BTVC 2NMOA 4QPIC 3ZYFA 5CEHA 4B3NA 5FJKA 3VBFA 2PHWA 2Q1MA 1HXS1 1KDKA 4UYBA 4K20A 1WCDJ 2P37A 2E51A 3PHMA 5BNPA 5FDBA 4COVA 2GNDA 5DAQA 1BK1A 4E4HA 2VTFA 3AC0A 2C1FA 1Y4WA 2BZDA 5FZ4A 5LB6A 2BNOA 3JBG1 3ZIXA 2Q4SA 2W1QA 4LBKA 3A0NA 2HWC3 1UZVA 3RMYA 5B4NA 1WLDA 2BBVA 5KHGA 4Q4V2 5CG8A 1DGWX 1O8PA 5A6YA 1YUDA 1JTZX 2R32A 3HT1A 1DP0A 3DYPA 1O7FA 1S55A 4EZHA 4BQ2A 2YZ4A 4QKFA 4E4DX 2IXIA 4AVTA 4QDRA 2VOWA 4XACA 4N53A 3ZSLA 4UT5A 5GLWA 5A3MA 4AVBA 2A6WA 1N1SA 1POV1 2WLPA 2R0HA 3H7YA 2VW1A 2F17A 5I8SA 3RZZA 1TE1B 2EXKA 4QHZA 1PZ7A 1CX1A 2DV9A 2V72A 3GBFA 5H9RA 3NNLA 3AP4A 3FHQA 4Z07A 5F8PA 5T5LA 2BV4A 3TNPB 4BWOA 5JPMB 3RZJA 2EXJA 1Y7BA 1XU2A 1TVGA 4E2SA 5JXHA 1DQ5A 2JDNA 4FT8A 5HXMA 3H8UA 4OLLA 5BNNA 1W6NA 3TBDA 5LA2A 3AZZA 2EALA 3UL2A 3ZFGC 3C8XA 5IFPA 4RS5A 4JCKA 3OB8A 3B9CA 5EZWA 3T09A 3VKOA 1ENXA 4LK6A 3U14A 3RS6A 2A6YA 3O5SA 4HBNA 3D6EA 5LATA 1C8M1 1VBA1 3RYPA 4LULA 2VCBA 1YCIA 2DVBA 4TSVA 2FMDA 2IXCA 1YJLA 4YM0A 3N4MA 4NHYA 4XILA 1CWPA 1OHFA 1N1TA 3K3OA 3VDDC 5DZGA 3ZSEA 2G1MA 2QQPA 3T0BA 5I8YA 2VY0A 2VOTA 2DCYA 5FMBA 5FOJB 1K42A 3AX4A 3KCXA 5FPVA 1W06A 4CUCA 3BU7A 1PX4A 5ACA1 5C8CC 3ZSJA 4FPHA 5C3QA 3RZGA 2YMZA 3I59A 3NV3A 4M01A 4RL7A 4F8AA 5EXOA 3BIWE 1QU0A 4XAEA 4YFZA 3D3AA 2ZPXA 4NRPA 3T2PA 4BYYA 4GIQA 3AL6A 1ND3A 3NJXA 4KBZA 2ZX4A 4DEQA 3HVDA 4JGZA 2OA2A 2WNUC 2W39A 3R4DB 1PIV3 4LUMA 1LOFA 2E26A 1I9RA 1SHWB 2UY9A 5JUVA 1O91A 1GKBA 3DECA 4FAGA 1QKQA 2VMEA 4FP3A 1Z7S1 2R063 3ZXFA 1D4M2 3LEKA 4MG2A 1ASJ3 4XURA 3W9AA 1GWMA 1EV11 1KFXL 2HWB2 1KQRA 3GNEA 3BN6A 1KXGA 4CDUC 4NHXA 2HEYF 1M06G 5FXZA 5GLZA 4UWDA 3R05A 2GMPA 1SQ4A 2A71A 3POWA 3IDCB 3G7DA 1JYNA 4QX7A 5FZGA 4LXLA 2A6VA 2ZX2A 2XLAA 1MZEA 4CCLA 2VMFA 3H8RA 4W8JA 4BCUA 2BGOA 4JQTA 1RUC3 4N9HA 3ZSKA 1XYPA 1UW8A 4WM7C 5DQ0A 1PX3A 2QQJA 1CAXA 4BK5A 4MXWA 2DTWA 3NMBA 3VBUC 4R4ZA 2TNFA 1S0CA 4N9IA 3WHTA 4FP2A 2R7EB 2RS52 3ASIA 1LOGA 3ILFA 3HOBA 1PO21 1UNBA 2AEYA 1WKYA 3PIJA 3O14A 4O61A 3WG4A 1AYN3 4BB3A 4AFDA 1EPWA 1WLCA 1GWKA 2Q8DA 2OIIA 1U5ZA 1UKGA 3J8F2 1UPSA 1UOJA 1YRZA 1DFQA 1ZZBA 2RDNA 5K0UA 3FX3A 3IM0A 3GCXA 5F5QA 4DUWA 4NPRA 3M3IA 3U4SA 2B45X 2WZR3 3Q8AA 1PVXA 4J6GA 5JXJA 2O1QA 5DZEA 4BXFA 2O8QA 3IIAA 2PN5A 4GH4B 4Q4W1 5L9VA 3KT7A 2DCJA 1BBT2 2WQ4A 1R083 2K9ZA 2WS93 5DUUA 4QB2A 4EJRA 1X9TA 1S0DA 4NMIA 1NY71 3INAA 1MVEA 2Y60A 4QXKA 5LEJA 4FO9A 4TN7A 1PK6C 1AR62 4LR4A 1F15A 1LECA 4CPBA 3DGTA 1MACA 3H1WA 5FO7B 1FNZA 1O59A 4A45A 3TWIA 3QH7A 5F32A 4GKXA 2PQSA 4RHV2 4YM2A 5F6LB 4Q8KA 1RUI2 1S2BA 5A7NA 1XYNA 3Q8BA 1UQXA 1UY2A 2DUQA 4XE9A 1W2NA 3WY6A 4AI3A 4YW3A 5A3LA 1AR82 1UOGA 3DYMA 4NHLA 4D6QA 1GSLA 3K48A 3WQ7A 4AG4A 1YFYA 4QHOA 5D21A 1QQP2 2VBPA 1WLTA 5T54A 3RJ2X 4B4PA 4P00B 1RYYA 4QX3A 1W9TA 5L9RA 2W92A 1BMV2 5LBEA 1I3HA 1VRH3 3S5AA 2P6CA 3MDPA 5C9AB 4P9WA 1W3XA 3N7KA 3N9LA 3NRUA 3MW2A 4FPFA 4FVVA 2OVUA 4QT6A 3KHCA 5FZAA 1W8ZA 1W6MA 3HR9A 4MADA 1D7PM 2A75A 3OCPA 4P9YA 5HV4A 4E2QA 3ZN6A 1DGLA 2PA7A 2NZ9A 1YFWA 1IOAA 3ELNA 1XB9A 1JUIA 4XEZA 4W50A 1OOPB 5FXVA 2VQUA 2IWGB 1C8NA 1XXNA 5LW9A 4BLJA 2WO7A 4TXWA 3V0AB 2ZJCA 5GLVA 1O3RA 4WVWA 4MZUA 2HH9A 3GM8A 4L8QA 4R4XA 1V6MA 3LSDA 3H3UA 5ABJB 1CZVA 3O1OA 2IFRA 4JGYA 4LO8A 4V1PA 4XIOA 5B4XA 4NWVA 2WA3A 3TEYA 3WF1A 1IS6A 2GNTA 3P6BA 3FUOA 1QJY2 4UFKA 3OOXA 2JIJA 1GZWA 1SDWA 1ZZ6A 3JUUA 1ULFA 2Y33A 3LKJA 5CKQA 3RMXA 2R16A 4YZ3A 1FAYA 4RFRB 3H9AA 4M4RA 1HIXA 2XOMA 4XC9A 5FIXA 2V09A 4ZU7A 3EXUA 2J1EA 4FXKB 3WG3A 4BM8A 3KV9A 4BU2A 1RUF3 3CEWA 3EHKA 1V00A 2FCVA 2R1BA 2EAKA 2ZEWA 4PIYA 3SXWA 2D44A 1LOAA 1W2OA 1AF9A 5LRRA 2WO1A 4C8DA 4QDSA 5LRSA 4AI2A 2HYKA 5CFCB 2Q30A 5FV3A 2UWCA 4UW6A 1Z78A 5KC6A 5FZIA 5IYYA 3TN93 2LROA 1SPPB 2D6PA 2JIGA 4U2AA 2F4LA 4MGKE 4Y1YA 5J09A 2VMDA 2Y8KA 1UOFA 2W1WA 3HWJA 1RGSA 3MIDA 3CJXA 3WG1A 1NA1C 4LHSA 2D3SA 3MGUA 3N9MA 2XR4A 3W5MA 2NN8A 3LEMA 5AC92 1R092 2EIGA 2OYZA 4AXOA 2OW4A 3OPTA 4XBLA 5A32B 4B29A 5JLVA 4JAAA 3LEGA 1K5MB 5BNOB 2MEV2 1HKDA 1OFSA 3NAPA 3AJYA 4EN6B 4IV3A 2WAAA 1YQ6A 2Q8EA 1JMUB 3GZAA 4ITCA 4XETA 1MS1A 4GD4A 2CHHA 2G9ZA 2IXKA 3MPPG 4MV2A 4QX5A 3IMNA 4RS5B 3MIBA 2K2SA 4NJ4A 1PGSA 2XUMA 2QZ3A 3KB5A 3K3NA 2ERFA 2PAMA 2R071 2JWPA 3BGAA 1KD7A 4QAWA 4XFAA 4HVOA 1AR93 3POBA 1IHMA 2WN3A 4JX0A 4AFCA 3F2ZA 2XL9A 1EAH3 2AEZA 3OD0A 1CAWB 1UZZA 4PF5A 1W2AX 1ZBE3 1DU3D 3MIGA 4ARXA 4BK4A 4BQXA 2XVGA 5FZLA 4CEWB 2RMU2 2ORZA 4RQPA 3VBHC 1JS9A 3HD8B 5DG2A 4CU6A 3VBFC 4J25A 1HJGA 5JOYA 3FLTA 3LSEA 2HBTA 4GMP3 3MFAA 1IS3A 4ZS2A 4EV0A 2UYBA 3ZYHA 2YC4A 3EJKA 1ULCA 2OS2A 2WT0A 5T5OA 3WVJA 5HXVA 4XUOA 1OLMA 1QH6A 1UF2C 2DWRA 2Z4FA 3E5UA 3I2FA 4YG0A 3BU0A 2ZGPA 1VJ2A 3AMQA 4M0NA 2Y26A 1S0JA 3BTZA 3EYPA 3VD7A 3ZFEC 5A1AA 5BUVA 2ORXA 5GZGA 4META 4QB1A 4OCTA 3ES1A 3J7HA 4A7KA 3ZXGA 3ZVXA 3H42B 4N53C 1UMIA 2BNMA 4YZ4A 3ZMNA 3HNBM 3TNQA 1W6OB 1DZQA 4X8PA 1F5JA 5DDJ2 4Y24A 3ZXAC 4BMEA 3VBRC 3AK0A 3KF3A 4LHLA 1OLQA 2ILMA 2RE9A 3WF3A 5B2GB 1LGBA 4UW3A 2YUEA 4JTOA 5FY7A 3VZLA 1BKZA 3WNKA 3LA3A 3DL3A 4LO5B 4MGSA 2R043 4Y5TA 5T52A 2XBO2 1LHWA 4KI5M 2X53S 4OUEA 4OVEA 4WM8B 4EWAA 1V70A 5BNNC 1POV3 2ZHLA 2PTMA 4CA9A 1FOD1 1MS5A 3RQ0A 1RUE2 1C1FA 1H2KA 4FCAA 2BP6A 5F3GA 3POGA 4RD7A 3WNNA 1HDKA 2A3YA 2CWSA 4XAAA 1O3TA 4I02A 1N3QA 1W9SA 5L36A 3ACHA 1C1LA 2WJSA 5J3UA 2DCKA 2QQWA 1B35A 2YBPA 3I54A 5FZ0A 3ZYBA 3I2OA 2D6KA 1SBDA 1VIWB 1EYBA 4D7YA 1XE0A 5FZOB 1ULGA 2C9AA 1PGL2 2R6QA 1NT0A 1XC6A 2GMEA 2VM9A 1J58A 1QY4A 2ES3A 5A6ZA 1XSQA 1ZZCA 4ES9A 4I3PA 1FX5A 1VB2A 2JD4A 4YW1A 1MZ5A 1COV2 1NQJA 5FPZA 1VRBA 1H6XA 2VNOA 4CUGA 2WNVB 2MPFA 3DEMA 5IT6A 5JI9A 2HWE2 3WP4A 4KMQA 5DG1A 2VW2A 3LDRA 3ZR5A 2Q0AA 1KJLA 1ND2B 1LHVA 1ND3C 2L9LA 1ASJ1 3D0SA 5FP3A 5FZBA 4AHYA 2RDSA 4AQ6A 3PUHA 1LTEA 3GBGA 1BXHA 4XHXA 2NMNA 4H7MA 5J1XA 1OH3A 1A8DA 3MEPA 1LOFC 1YEWA 3AKSA 1UY3A 4DEVA 1OQDA 1WCUA 4NIDA 2VZQA 3K75B 1JHNA 1V6IA 3DPRC 5EHDA 3AXDA 5A7OA 2EAAA 4IE6A 5GZEA 4DRRA 4EE2A 5FREA 4FOQA 4XJWA 2JG9C 1QOOA 1OMIA 3LPFA 4NO4A 3KMHA 1PMJX 1JU3A 3GJAA 2LM3A 1DQ1A 1AJOA 1ENQA 1RUC1 1ULEA 1VB4A 4LO4B 3CL1A 2PLV2 5D2AA 2RS12 3MW4A 5L7OA 1JZ3A 2D98A 2BOJA 4WZCA 4ZKTB 1CPNA 1O4YA 5EP9A 4TLFA 4MX3A 4ATFA 2EIDA 1AXYA 2VGDA 1Q8QA 2IXJA 4CDQB 3I3BA 3LWCA 2AYHA 3ITQA 2B4KA 5CFDA 1MS3A 3CQOA 4YG3A 1UL9A 3OUIA 2JX9A 4GB32 3ZIWA 3B7MA 4MHUA 3LOIA 5CKMA 4IESA 5LWBA 3R4UA 4R9BA 1FPN2 3VZMA 1JZ2A 4ET7A 1UYZA 1HQLA 2IFWA 2X5IC 3NV4A 4Z82A 1AUYA 1L7QA 5EIYB 2XPJA 3N7LA 3AMMA 4COYA 1HV1A 2FCUA 1CAVB 1FT9A 2EXHA 4X6QB 3WINE 1SZBA 2VAUA 1SMVA 3I3QA 2CY6A 3ILNA 1G8WA 2WZR1 4Q0UA 5F5CA 5FPLA 2I07B 4E2GA 5I0RA 3N9NA 1WW5A 4Q8LA 4D7TA 5JR2A 1RC6A 5J48A 2WS91 1R081 5A33B 5LCWL 4F83A 2BPA2 4PF1A 5C4WB 3A7QA 2UWBA 1WGPA 5K0UC 2O0OA 3RNSA 2BRTA 3D5OA 5ANNA 4AGGA 3UKVA 1W6PB 4W6WA 2ZGTA 1UOBA 3ES4A 1CQ9A 3GBWA 2J1UA 1UO9A 3URFA 4AEDB 2KM2A 5JMCA 5FCCA 3JQXA 1WCQA 1RUNA 2HBUA 2YC0A 1D4M3 5I91A 1W28A 2NYYA 2W95A 1RUD2 1VBE2 1HB3A 2HWB3 2D40A 1OPMA 2AZ5A 5IK5A 3POEA 4YGDA 3HJRA 2B39A 1QMJA 1R1A2 4LTAA 1XBFA 3RI9A 1UYYA 1HN0A 4OHVA 4Q4Y2 4AEJA 4CP9B 1VRH1 5DUVA 5J98B 4YVSB 2CDOA 1APNA 3QD6A 4FPOB 4AI0A 4K8RB 2GNBA 1WW6A 3IT8A 4FPGA 3SKVA 4B4RA 2QKDA 5KHKA 1AL22 2RS32 2FQPA 5IJRA 5A7WB 1WLWA 4W6XA 3H50A 3TOJA 3WDUA 2JG8C 4P5HA 4QPGB 3CU7A 3W58A 2PELA 3POYA 2C0ZA 4OZXA 3MIEA 4BXSV 5FZ6A 5HV0A 4FQ4A 2VL4A 4L9BA 5K8SA 5KXEA 2RS53 5IK4A 2VUCA 3PUQA 1RL3A 1XPWA 3OEBA 4UAPA 5L19A 3KT4A 3HN1A 3O1MA 1QNYA 1GNZA 4QU1A 1AXKA 1VLNA 2XWJB 5F2SA 3WP5A 2X09A 2IUWA 3X29B 1CVNA 2E7TA 3RRDA 1OD3A 5C5TA 1HQWA 1QEXA 2O14A 4WZFA 4YPJA 3KVAA 2GP3A 5JCTA 1XQNA 4E8DA 1TNRA 3AKTA 1YC61 1RMU2 1T6BX 2J42A 1R1ZA 4UW4A 5FWJA 4YARA 2CAUA 1MZ6A 4GKYA 2JB8A 4UBHA 3JD72 1NCRB 3VZNA 1RUF1 2F6BA 1AJKA 1BBT3 2EIBA 3WLUA 5GZDA 2WKKA 3HAGA 2W87A 2JEMA 1O4ZA 3GGLA 1NCQB 4JV4A 4QU2A 5E1RA 4ZPIA 4AQSA 1NLRA 2WNEA 1GWLA 2YHJA 3LF7A 3MFCA 3FC0A 4Y1ZA 2WR9A 5E8AA 3TN91 5I0DA 4AI8A 2VNRA 5FO9B 3W59A 5FOBB 1J1TA 4QX2A 3RWKX 3P3NA 2DBNA 4RHV3 1RUI3 2JXAA 3S6PA 2EIEA 1LU2A 2VZRA 3NSTA 2VMCA 4FOYA 1GOFA 3WG2A 2VTXJ 1HRI2 1VBC2 1AR83 2HLEA 3PU3A 3RVHA 1JYTA 4QPIB 3K4DA 1IPJA 4KGQA 4CXWA 1QQP3 1S1AA 4IE5A 5JVVA 4PDWA 4Q26A 5DMYA 1H9WA 3NNJA 2W9XA 4BLIA 4M3CF 4BE3A 1DF0A 2BU9A 5C9AA 3VGIA 5JSRA 2BEOA 5C3RA 1SDDB 3MYXA 2W3JA 4H55A 4AGRA 4LOTA 3NJYA 4J1WA 3PNAA 2LRPA 1LESA 5AVPA 5IVYA 3NAPC 3THPA 1VBD2 3M3QA 1WBLA 4RYDA 3ZYIB 5FKBA 2QNKA 3AM2A 5A3TA 1EAH1 2HWD2 4HN0A 1OOPA 4YM3A 1ZBE1 4B4QA 1SLTA 5CYYA 2GN7A 4N43C 2PHRA 2QQUA 4YM1A 4DB5A 1AZDA 4Y4RA 4I2OA 5ABJA 2W52A 3PUAA 3MIHA 1MQTC 4XYXA 4Z2WA 1GUIA 1QH7A 2DUPA 2VZ1A 1B35B 4FTSA 1VALA 2AREA 5A3OA 5FPXA 3C7FA 1LU1A 2JDAA 2P1BA 2CDPA 1QXJA 4K6BA 2R073 1UY0A 2BNNA 4ZU5A 4YW4A 2B46X 5CNAA 5FYVA 4XF1A 4IEPA 1UY1A 3L2HA 3ZPOA 2PFWA 3KGZA 2XQXA 4QGLA 3T30A 1LHNA 4C1WA 1MZFA 1OA4A 3NKTA 4GALA 3J7NA 4HVRA 5DAWA 3VZKA 4YW2A 3UGFA 2XJUA 3CDZB 4XJZA 4TTGA 4B8EA 4NIGA 3NVCA 3WNPA 5FP4A 4Y1UA 2YGMA 1JBCA 1BCXA 3BUCA 1ACCA 1UWWA 2I2SA 4DS0A 4W6YA 4FTEA 3DUIA 4A41A 4BIFA 2QDRA 2ZX1A 4XQ4A 5CFCA 4KG0A 2Y6LA 1W05A 2BWAA 2VUJA 3KWVA 3H3LA 4K7JA 4NRMA 5D8AB 1Q8SA 3NV2A 3OGVA 5KR7A 3ACGA 3BTXA 4OI1A 3I2HA 1SPPA 1UMZA 2GN3A 1WA6X 2VUDA 2WWJA 3IB3A 2FDKA 2R041 5FAXA 2VZPA 1OC1A 4QKBA 1BEV2 1J59A 5HCHA 3EMRA 1LHUA 4Q2FA 5A32A 1R093 1ZBA2 4QXBA 5AC93 2Z69A 1K5MA 4CEYB 1PO12 5BNOA 5K9YA 2MEV3 1W03A 5A7PA 3VB9A 4FFHA 2GP5A 1LCLA 1T2XA 5L7OB 1ZRRA 4Y33A 2WNUB 4M3CB 3NNGA 3HQUA 3ALQA 1LGNA 5J96B 1RVF2 4AFAA 4IERA 5FBZA 1EUTA 1UY4A 4BZ4A 1TME2 5JOZA 2YDEA 4AW7A 5CFDB 1YQ8A 4INDA 4ZS3A 5H9PA 4LHKA 2NM1A 2WC2A 2Y34A 3ZKYA 4QX1A 1CAWA 1LULA 1FOD3 4CRQA 1TG7A 2ETEA 3K4AA 4S2GA 3VDCA 4K1ZA 4CEWA 4CP2A 2XJVA 4NVPA 4F3JA 3K51A 2PYTA 2RMU3 1UIKA 5I0UA 2A73B 3WR0A 2C4XA 4XF0A 3AP5A 1CD3G 4MOAA 2QQIA 4W65A 5FMOL 1C28A 1ZZ8A 1YQCA 2HYXA 1QOTA 4CU8A 1YO8A 2GMMA 1MEC2 1SEFA 2B9VA 4EN7B 5IVBA 5LBFA 2HWF2 2Y0IA 5GLUA 2D6MA 3N9QA 1GQPA 5L73A 3VBUB 4A7YA 2NLRA 2VZVA 1WMFA 1NQDA 1XNDA 2WDBA 3OPZA 4DOUA 4B7EA 5KBFA 3CLPA 2LTNA 5A1FA 2DDUA 5JR7B 2YG0A 4GWMA 3KF5A 4XMIA 3M7AA 4D0QA 1O6UA 5BV6A 3DV8A 4DUVA 2XJQA 5JSPA 4LA3A 1S0IA 3AZWA 3CF6E 2YBSA 3LFMA 5KHHA 3S7EA 1W6OA 4NPMA 1W8UA 2C5DA 1V0AA 3OUHA 4QQPA 2YPDA 4RA0A 4UW5A 2FDHA 1WW4A 2FZ1A 3FLRA 2BVVA 4DXTA 4JRLA 4H3WA 5CVRA 3LIGA 4OI0A 3AXEA 1LODA 1OA3A 2Z42A 2XKPA 3LEIA 3CJIB 2LW8A 2FDGA 2EICA 3FHAA 4WM8A 2DUOA 2PAEA 2XBO3 3HN3A 4YGEA 3WDVA 1LOBA 3PU8A 4IGPA 3LOBA 4HLTA 4G9SB 4BMBA 2OPKA 4LBQD 3RG0A 4OUMA 3BKZA 1LOEA 1RUE3 2FHRA 2XMLA 4CCKA 4AI9A 1LGCA 2DVDA 1C3HA 3OSDA 4AR2A 4H14A 5JXIA 1GFF2 1XNKA 3K46A 1C4RA 1G9AA 1PK6B 4C0BA 4D7SA 3VBOB 3AMPA 4IDZA 4QD2A 4PLNA 4K21A 1SLIA 3PDQA 3UETA 2VVEA 4GZ9A 3EQEA 3M3EA 5FZOA 5H9QA 5AFEA 3RJRA 4CCDA 1A78A 4QX0A 2VECA 1MPXA 2ZAAA 3N36A 1JOPA 4AEMA 2G9FA 4AFMA 2CWMA 4XF4A 2V73A 2GC2A 2RM22 1RIRA 3VL8A 2CAVA 2ZS6B 2WNVA 5EJ3A 3H8XA 4KBBA 1J83A 1GMMA 5FY1A 3GZUC 4I09A 2UU8A 2P2KA 5FXXA 5C70A 2ADEA 1NE6A 2WO3A 2YYOA 1DG6A 1DCSA 3SQOA 5A6XA 3S0MA 1ND2A 2VCAA 1BLZA 4GULA 2YFZA 4UFJA 4HN1A 2VG9A 1D4M1 2VXJA 3GHNA 2J1AA 3J26N 1SCRA 2D43A 5F2WA 1OQEA 3MHZA 2HWB1 4XJ9A 3VD9A 1XE8A 1N3OA 3KCCA 2CV6A 3VV1A 4HK9A 2P3IA 4HSJA 1SBEA 4HOOA 4GWJA 4OULA 2H0BA 1OKQA 1CIWA 2XHNA 3CIHA 3IDEA 4AOCA 5FR3A 3O0XA 2D6LX 3LA2A 4MO3M 1UD1A 4YG6A 2VC9A 2GH8A 1OF3A 2W94A 1QOSA 3T4HB 4O65A 2JDZA 3GXUA 2K46A 4COWA 2HJIA 1VMFA 1W6QA 2UY8A 5JAXA 4MYEA 5FYZA 5GALA 4BISA 2PLV3 4FOVA 5EPAA 3O1SA 4I30A 1JZ5A 3AVSA 4FPKA 4UF0B 1ZNPA 4NROA 4I0WB 2QQOA 3A0KA 4CDQA 2RS51 2DURA 2AGSA 1CN1A 1CZSA 4PDWB 4M4PA 1PVC2 3WW2A 2H0VA 3NO8A 3H7JA 2CU5A 1J3RA 4OZOA 1O3QA 1FPN3 4XUPA 3MV01 4NAOA 1LRHA 3ZX7A 1DDLA 4YLZA 2UYAA 3J8F1 4L11A 2C24A 3H3ZA 3OBZA 3GF6A 1NYWA 3FWEA 2TEPA 2E7QA 2OXBA 3KCYA 1CAVA 2JB4A 3HQXA 4UFIA 4YGCA 1PGW2 1DYPA 3JU9A 4RR3B 3AL5A 4IE0A 3ZLIA 3MUY1 2XL7A 5H9SA 2XG3A 5CB7A 2ARAA 5T50A 2ENRA 2QZ2A 1OKOA 1XYOA 5LA0A 4QQHA 5A33A 3JB4C 1BBT1 1NA1B 1NOVA 1OUSA 5C4WA 1QXRA 1IQAA 2IXLA 2W5FA 5FY0A 4Q1RA 1CONA 2IVJA 1W0NA 3KV4A 2BERA 3RWNA 3ZYPA 2P3JA 5FUIA 3WW1A 1S0FA 1AR61 1E5RA 1W6PA 1ZA7A 1WW7A 4GH4C 3RYRA 3SCHA 1WA4A 3M2MA 3O1TA 3M3CA 4AEDA 4MH0E 1OLRA 1Y9QA 5LA1A 4QB6A 3GYDA 4QGMA 4RHV1 3H0OA 1RUI1 5G04L 4NIHA 4URAA 4DNYA 3HBZA 1REDA 5E89A 4PIXA 1ZRCA 5F5IA 1JHJA 3I4IA 5IWFA 1RUD3 1AR81 5FMOS 1VBE3 1Y9GA 5LY2A 5FLHA 2V4VA 3H1YA 3ZFFC 2A3WA 1AX2A 4Y5Z0 4DINB 1QQP1 2B42B 2XVLA 1R1A3 1OA2A 1J3PA 4CP9A 1BMV1 4Q4Y3 4YVSA 1U5XA 3GHMA 4Q4X2 1WMXA 2WSUA 4H2AA 4IEUA 1VAMA 3T1MA 4ZHNA 5DZFA 3Q9OA 1RXFA 3PMEA 4NUBA 4QKNA 5FUNA 1VBB2 5A7WA 5JZGB 4JTNA 1AL23 1RHI2 3KM5A 2QDNA 4YVWB 4L2NA 1UPIA 4R9AA 4A3ZA 4QPGA 3I2DA 2B9UA 2ZGMA 2VNVA 5M0TA 2JENA 4LORA 1X36A 3I2KA 2EF6A 3BYWA 2SBAA 3PLQA 2HWC2 2WAOA 3BPSA 1PM4A 1JU4A 1CZTA 3ON7A 1LOCA 4OQ9A 1RUG2 3T3YA 4CDWC 3U1XA 2VD7A 2MNGA 3ZFEB 1K3IA 2DU0A 2PHDA 1K45A 1OOPC 1FV2A 1KGYA 3NJVA 3OEAA 4V2WA 1X82A 2VZTA 2XUEA 3POIA 4IV1C 5FY4A 4C1XA 4CE8A 3NNMA 5IUQA 5ABJC 2YU1A 5A70A 1W2TA 3VBSA 4AVVA 3NJZA 1LAJA 3BALA 1F4AA 4AVAA 3VBRB 1D2QA 5FXWA 5JOWA 1DGWA 4DY5A 2VQTA 4AQ2A 4IE7A 4XHBA 3J7LA 1NCRA 4LBMA 4MHRA 2FDIA 3CZJA 3T1LA 2WWUA 3R4SA 5DUXA 3FLPA 4ZZ8A 5IW0A 5DN2A 3E1F1 4OHYA 1NCQA 1X8MA 1GOGA 5BNPC 3TAYA 2D97A 1K5JA 4QXCA 5KC5A 3RFRA 4LA2A 1IS4A 2JKBA 1H6YA 3PVOA 2LS6A 2RHPA 4DUXA 4XZUG 5EJ1B 4KG8A 5GZCA 2ZGKA 3LIHA 4CVUA 1I1EA 4OQ8A 3IBMA 5FZCA 4A42A 4IW3A 5AC91 4FPCA 1R091 2F4PA 2P5BA 2ET1A 2VTXA 2OKXA 1ENRA 1HRI3 4QPIA 4Z1VA 3NKGA 3KV6A 5K7PA 3BOPA 4IUGA 2MEV1 3LFIA 3ZO0B 1XE7A 3MLJA 4EYUA 1M4WA 2WZEA 4ZZ5A 1QJEA 4XCBA 4TLGA 2YXSA 3PVNA 1SBFA 5C71A 4CU9A 1K5MC 5E16A 5GLTA 5BNOC 3MUZ1 5JIAA 3TEZA 3RZLA 3MBWA 5T5JA 4PHZA 4XUTA 4XUNA 3WP6A 1O5UA 2W08A 2YY1A 3H1MA 1VBD3 2LALA 3KGLA 3ZOIA 4EZ4A 4LBQB 3K2OA 1PIV2 4QHBA 1DBNA 2AUYA 4Q29A 3BIEA 1MVQA 2HWD3 2A6ZA 3LA7A 4YZ5A 2CGPA 1GV9A 1LHOA 4RS5C 2VOKA 1OPOA 4Q1PA 5C3PA 4I3GA 2R062 1MS0A 3DPRB 2RMU1 4GWIA 4ISQA 3B94A 2JG9B 1NX9A 1VE0A 3NWKA 1XJAA 4E8CA 1AR72 1X7NA 4QPYA 2JD9A 4EN8B 5FFOC 3WW3A 3E5XA 4K9SA 4OFGA 1JZ7A 1NZCA 5FPBA 3O0WA 1N1VA 4P9GA 5DUWA 4Y20B 1BK0A 4DIQA 1TMF2 3MLLA 2Y6HA 2VMHA 3N7MA 4UFHA 1NZIA 1LJ7A 2P3YA 4JHZA 3BI3A 2VH9A 3ZFGA 1AX1A 1ZX5A 4CDXB 4UBGA 4L92A 4Z2AA 4A3XA 3C7GA 4KWKA 5FYIA 4LNVA 4YZ1A 4W4ZA 4BHPA 1CJPA 1S0GA 5LEKA 5FZDA 2ZGSA 3ZPYA 3B93A 3ORJA 2P4EA 3LD8A 5FPUA 1KFUL 2H6BA 2YV8A 3ZXDA 4Q4V3 5F37A 3ZYGA 2X5IB 1DZRA 4JGZC 5F5AA 5DDJ1 1V6NA 2GALA 4QGNA 5D8AA 4DXZA 2BGCA 5LBCA 1H4GA 2AH2A 1FV3A 4R8HA 4OI4A 1YFXA 3M4FA 1AYN2 3V0BB 4ZONA 1U0AA 3N9OA 1BYHA 1UX7A 2Q8CA 2XBO1 4AF9A 1W90A 1O3SA 2QFEA 1H8TB 3DKWA 3O0VA 4FPLA 4YSFA 3TB0A 2XQRA 4KL1A 1HRV2 4QQLA 4CEYA 4LBJA 1H8VA 1RUE1 4N7IA
chains in the Genus database with same CATH topology
1PO13 4CZSA 1XNBA 1C57A 1W6QB 2H6CA 5F9TA 2WFF2 5GJ6A 2WNUA 2WFPA 4M3CA 4WM8C 3SCGA 4N7UA 1XNCA 1ZA4A 1RVF3 1PGL1 2BFUL 4IEQA 1TME3 1W0OA 1AYM2 3J9SA 1YI9A 4URTA 5BXXA 1H2MA 4AHWA 1MS9A 5DXDA 3VL9A 1BJQA 1BVP1 1GR3A 4F7ZA 4WVVA 1Y43B 4FXGB 5I0TA 1FNYA 1JN2P 3OF1A 4GA9A 4AI1A 1YWKA 4BIOA 1HW5A 4JRAA 1YLLA 4CP1A 1FMD2 4EWDA 2WNVC 1QJX2 4MGYE 2JG8B 1MEC3 3OY8B 3ZXJA 4XTMA 1ND2C 1PMIA 3VBUA 2A70A 2HWF3 2VQ0A 4AHZA 1HQNA 1IGOA 3WP3A 4FPYA 2G9GA 2AR6A 2WIIB 1OQ1A 2BUKA 3SCFA 3MW3A 4JVAA 4DY3A 2GSYA 1LR5A 2O8OA 2PLV1 2RS11 3UV9A 1DYKA 3ECQA 4COUA 4LT5A 1AHSA 3APBA 1V9U2 4Q0QA 3MF9A 3AP9A 2ARBA 3N35A 3CJIA 4GB31 4EROA 4XFBA 2ZMLA 1FPN1 1RUJ2 1YFUA 1YI7A 1MS8A 4PJYA 1NG0A 1BVVA 5I0SA 1KRIA 3KZ4C 4ASMB 4ZU4A 2QCSB 1V6KA 2A5ZA 1PK6A 4O9GA 3VBOA 2XH6A 1CX4A 3N3HA 2GH2A 1RUF2 2P17A 2ZBJA 1GZCA 3U07A 5BPXA 3ENRA 4HETA 3IPVB 1W2UA 2RR12 3MZHA 2DCZA 4UXAA 3V65A 2RM23 3TYJA 3SISA 1YYNA 4LBOA 3J8F3 1NXD1 1WMEA 3NL1A 1H1IA 3VBSB 5C4WC 2A6XA 2KXLA 4JGYC 2I45A 3OJBA 1RUD1 4LBLA 2FBEA 1VBE1 2YROA 1RINA 1QXPA 4XFIA 3USUB 4AEDC 4LEJA 4DPNA 3B9IA 1R1A1 2ZHNA 4NHKA 1N47A 4Q4Y1 1RUOA 2GC3A 3BPZA 2CYFA 3LZZA 1F2NA 4MVTA 2TUNA 3WUCA 2WT2A 4DZGA 1YJKA 4N43B 1QJU2 1Q8PA 1AR63 4PCRA 1AR92 1MQTB 1RITA 3VKLA 1AL21 2RS31 1Q8OA 4ATEA 2FZ2A 2QE3A 3GZTB 4WVMB 4YVSC 3AZXA 3HT2A 4LO6B 2GC1A 1H1MA 1NXMA 4GMP0 2ZX0A 4NOTA 1I5ZA 4Z92B 3WD5A 2WINB 3GALA 1YXWA 1UAIA 4QPGC 4LLFA 4XF9A 4Y22B 1PVC3 5T3NA 1RJ8A 1RUH2 3MIFA 1IZ3A 4Y1XA 3ZYRA 2DFCA 1ZRFA 1F8VA 3RDIA 1GQGA 1HXS2 2VXRA 3AYDA 4I0BA 4M3CE 4FPEA 1UU4A 4EN0A 4HKOA 4IV3C 4RR3A 3AKPA 4AHXA 1GICA 2ZHMA 3CNAA 2LUWA 3JBG2 1EP0A 4WVZA 4Q0SA 1H1AA 1QDOA 1ZZ9A 2FMYA 2HEVF 1KS4A 1NA1A 2PQQA 3LB9A 1ALYA 2WL1A 4YW5A 2ZKLA 3OYWB 4MGZE 3RYKA 5CAZA 1PNGA 4AQTA 2ZZQA 1TQ5A 3VKNA 1POV0 1JH5A 4K8FA 4GXLA 1NCRC 4RQPC 3WCRA 3UJQA 1QJY3 4AVSA 4XQDA 1I6XA 2ZTNA 3JZVA 4XDQA 4AK3A 2ZABA 3ZFGB 3VUOA 1G9BA 4CP0A 1NCQC 2IZWA 4HSLA 5CA6A 2PHFA 2DCTA 3POSA 1HRI1 1VBC1 1HX6A 2BQPA 3AZVA 1JW6A 3WDYA 4I0AA 4K40A 1NLSA 2AENA 1GZ9A 2NPIA 3VDDB 4Q4X3 5EWSA 3MICA 3JQWA 2PHUA 4XFGA 1C8M2 2EXIA 1VBA2 2K0GA 5GM0A 4M00A 1BZWA 4QQOA 3VHNA 5JZGA 1VBB3 4JDNA 1RHI3 1VBD1 1KDMA 4YVWA 1A3KA 5C8CB 1HLCA 4IETA 1LEDA 4IEVA 4YYOA 4OHWA 2HWD1 1GLHA 3BOWA 3RI8A 1FI2A 4XJUA 3RPQA 4R52A 3WW4A 5JIUA 2WWSA 2SLIA 4C91A 4XF3A 4S2DA 1CESA 5ACA2 1RUG3 3ZFEA 1CPMA 1X50A 5HBAA 3ZXEA 1YIPA 4XOGA 1WD3A 3UJOA 3WDWA 3KD4A 4R9DA 3WCSA 3VBRA 1B35C 1D0GA 4IL7A 4CDUB 4COZA 2YPJA 3WX5A 4ONUA 5BV6A 4DRVA 1WD4A 1QDCA 4AEKA 2Z5WA 4XFHA 3IWZA 1Z7S2 4XXPA 3IKWA 4KGGA 4X6RB 1EV12 2W68A 3AB0A 4Q4V1 3LGRA 1UIJA 1X33A 3WXPA 5C8WA 3AFKA 3DF0A 3PMSA 2E7AA 4FAHA 2D93A 3VZJA 3ZXLA 4WM7B 3WV6A 1DGRA 2OUJA 5JPNB 4Z8BA 4KWJA 2D5FA 5FQ0B 4ZXKA 4E4ZA 4OHZA 1BEV1 2QVSB 5BNQA 1ZBA1 1WBFA 5D8AC 1G86A 1PO11 3KT1A 4D94A 4DFSA 5I93A 3FFZA 5IK8A 2HEWF 1WUVA 4PBPA 2ZOEB 5JDBA 1PZ9A 5DDJ3 1RVF1 5F6KA 3SHRA 3VKFC 1PO22 4CEYC 4FSJA 1SLAA 4NWWA 1TME1 2XLFA 5SV8A 2X29A 4Y1VA 5L7OC 4LBQA 4OHXA 2RJLA 1DZTA 4HVQA 4Q0PA 4XIKA 2QJVA 2UWAA 3PJQA 3NW4A 3RSJA 1V6OA 3DPRA 4PIZA 5CFDC 1DQ2A 2JG9A 1ULDA 1JOJA 5BYNA 5C33A 4AE2A 3SH4A 1SLBA 3I8TA 1AR73 4Q4W2 3OBTA 2VW0A 1D4VB 3AYEA 2VVDA 5HI0A 3U4XA 1NE4A 1MEC1 4Y20A 5J7MA 2IC1A 1NY72 1TMF3 4BA6A 5T55A 2HWF1 3ST7A 4XFFA 2ZHKA 3QH6A 4CDXA 1COV3 1O5LA 3D4KA 2GC0A 2HWE3 1S2KA 3J4UH 3P3PA 2KA3A 4P9IA 4LLOA 2VQAA 2XHKA 2X5IA 3HMYA 2E63A 3VHRA 1CJDA 4LO7A 4QM8A 2VMIA 1ZZ7A 1F5FA 2OUHA 2Z79A 3V0BA 2ZZJA 4XW3A 3QLQA 2PAKA 1OD5A 1H8TA 3MLKA 5AFBA 2VNGA 3FZ3A 4KWLA 4IEOA 1G9DA 3SNMA 4M0HA 2D5HA 1HRV3 5JI7A 2DTYA 3PVBB 1YHFA 3CJIC 2RS13 2WFF3 1WCKA 4FOWA 4QM9A 4JC1A 1GQHA 3KSCA 3V56A 1U12A 5T5PA 3ILRA 3THTA 2PHLA 1AYM3 1AXZA 4AGVA 4GB33 2XJRA 5I8TA 1YNAA 3VBOC 4XQWA 1G9FA 4OUSA 3ZFFB 1H30A 2RM21 5CU1A 4HZFA 4PQ9A 1CAUB 2GZWA 1JYIA 2D7FA 2DVFA 3EO6A 1SLLA 2JICA 1FMD3 1GNHA 3WQ1A 2NP0A 1ZVFA 1QJX3 2XJTA 1S0BA 2JG8A 2N7GA 3C2UA 4HKWA 1CGPA 3OY8A 1PZ8A 1C5IA 4CTEA 3SMHA 2EVXA 3G6JB 3QCWA 4Q27A 1DQ0A 1C5HA 4CDWB 1SACA 4HPKB 1L3JA 3AKRA 3IN9A 1MR5A 1H0BA 1G7YA 1G6NA 3B01A 4IV1B 4QQ2A 1SFNA 3ROUA 1TEIA 4R9CA 4MUVA 1IS5A 1ZREA 2VULA 1V9U3 5HCFA 1UKRA 1GYKA 2OZJA 2GNMA 1PVC1 3VN4A 1VP6A 4XFCA 3AP6A 3MF6A 4XBNA 4YZ2A 2R072 4GQ7A 1RUJ3 4LE4A 5JSOA 3VBHB 3HIFA 2DU1A 3WOGA 3ATGA 1WMDA 3VBFB 2RS33 3ETQA 3UK9A 4KU7A 1U5IA 5CBLA 4PDWC 5BNPB 3NV1A 5C9AC 1O4TA 1PGW1 4PLMA 2XWBB 4D3WA 1SLCA 1QGLA 4K3UA 4XZPA 4S2FA 1AL0G 3OTFA 4TWTA 3IPVA 3E6BA 2P34A 1REEA 4BH9A 1UU6A 4YNIA 4RR3C 5KHIA 2RR13 1IPKA 2ZACA 3QBQA 4P9XA 1J1LA 4O9EA 4N53B 2ZGOA 1QJY1 3D8CA 4HL0A 3FE5A 4WV8A 2PHXA 3JB8A 3WZ1A 2DF7A 4IXLA 4XMAA 1FYUA 4J1XA 1RMU3 4TZDA 4YFWA 3USUA 4E4SA 3JD73 2XLGA 4BOWA 4CYDA 5BNNB 3N7JA 1W6NB 5IK7A 2WLQA 3B69A 2E6VA 3LAGA 4Q4X1 4HMZA 2ZGNA 4N43A 1D2SA 2ZA9A 5FTTC 3T2TA 4AYUA 1QJU3 4C90A 1Y3TA 2ZCWA 4KH9A 3LCPA 1MQTA 4WBBA 1VBB1 1J3QA 1RHI1 4WVMA 1RJ7A 1FOD2 1VR3A 2I74A 4B7KA 2ZKNA 2ZX3A 5CFCC 3FFQA 4PLOA 2RJKA 2Z2SB 2ZAHA 3C3VA 1VBC3 4IEZA 2A3XA 2HWC1 1X8EA 3UKNA 4RSUA 5JZGC 2VU9A 1URXA 3SITA 5CADA 2MHFA 4YVWC 1U5YA 1RUG1 2ZGRA 2WT1A 3ZSMA 5JWPA 2CTVA 1KJRA 3I59B 4Y22A 3FBYA 5EFUA 5FLJA 2D6NA 2D3RA 2PHTA 2JECA 4IEWA 3UKTA 5D1IA 1RUH3 1QF3A 3S7IA 3WUDA 4ES8A 3U0ZA 4S2HA 2A7AA 5KWRA 1ND3B 1DHKB 1HXS3 1F9KA 2XB6C 3JCIA 4JGZB 1PHMA 1JUHA 4YGBA 3U10A 3JBG3 4KQ7A 5CG9A 4HANA 4ISRA 2Q1ZB 1XRUA 3FMGA 4FBFA 1ASJ2 2R1DA 4IEXA 1EY2A 4XJAA 2W0XA 2XJPA 2CL2A 1UX6A 4A2UA 3OYWA 5FLIA 3ZN4A 2YGLA 3AKQA 4NHMA 3PVEA 2NQYA 2Q8OA 4AVCA 5SV5A 5FO8B 4CEWC 3EBRA 1DQ4A 4U36A 4Y4YA 5BY5A 4LE3A 2IXHA 1V6LA 5LK5A 2X8KA 5GKAC 5KXBA 2JE7A 1RUC2 1YIFA 4DQAA 1B09A 2V5YA 1CAXB 4MXWB 1GBGA 3U11A 1UU5A 3VDDA 5C6CA 3VHOA 3AMNA 4LHNA 2R0FA 4IQPA 1C8M3 1VBA3 4G4FA 4P9JA 5C8CA 1VAKA 2UURA 1ZM1A 1SFYA 2OZ6A 1PIV1 1SCSA 4MLOA 4QMAA 1DIWA 2Q5TA 1PM7A 2DYCA 1BEV3 1W39A 3D0JA 2CNAA 1ZBA3 1BQPA 3O12A 2R061 5K0UB 1QJZA 3ACLA 1RTVA 5ACA3 2WZR2 2WSVA 1MS4A 3E5QA 1AR71 5CIRA 4K1YA 4ASLA 4JQRA 1A8MA 2WS92 1R082 5EV7A 3B3QE 3V64A 1OSGA 1TMF1 1H2LA 3M3OA 4EWEA 5KXCA 3SH3A 2D3PA 3E6DA 4E9KA 4I01A 2B8MA 4CDUA 1COV1 4TYSA 4JDMA 1W0PA 1AX0A 4HT1T 4KU8A 5GZFA 5TSWA 2WZPP 3VZOA 1WCSA 1S0EA 2HWE1 1H9PA 2GU9A 1Z7S3 1H4HA 1FXZA 2BVBA 1EV13 4XJ8A 4FPJA 4AFBA 4SBVA 4CDXC 2R30A 3PTYA 3QOPA 4LBNA 3VHPA 2GAUA 4BQ1A 3ZMOA 1IKPA 3PJYA 4HFSA 1VRH2 4WM7A 2EA7A 2JE9A 3WT3A 5HCAA 1V6JA 1AYN1 4YRDA 5FQ0A 3MI8A 1ZYBA 1IKQA 1Q3EA 2BW8A 3AFGA 1W6MB 3KS7A 3FUQA 3AMHA 3BTAA 1HRV1 3B02A 2Y38A 3ZN6B 3USSA 3BB6A 4D69A 2D6OX 2E53A 3ZXKA 2VMGA 1FATA 3M8LA 2WFF1 1H8TC 2VOVA 4P9LA 1JXNA 1UZYA 2ZGQA 1LB2A 3ZN5A 3BCWA 3FBMA 1UN1A 1PNFA 1PO23 4XTPA 3A4UA 4JGYB 1AYM1 3L9JT 5FRAA 1ZRDA 2GDFA 3B00A 3B5LB 2XVKA 2CGOA 4RFT0 1CR7A 2Y0OA 4RGAA 1OFNA 3ZYJB 4CDQC 3D82A 1GZWB 1E57A 2VOXA 3KLSA 2QUOA 2VVFA 4XXAA 3AJZA 2XJSA 1LKNA 1A6CA 1FMD1 4Q4W3 1VAVA 1N3PA 3AP7A 4JDOA 3CO2A 2ARXA 1QJX1 2JJ6A 3VKMA 4N90A 5JOXA 4FQZA 1D0HA 2XKOA 3E6CC 1H2NA 3AZYA 4Y26A 3TN92 3SLIA 4NN0A 2BWCA 2E9QA 4P14A 5EYYA 2TBVA 3I7DA 2ZMNA 4HKLA 3FHIB 3WHUA 3M1HA 4ORFA 3QACA 2BYVE 2ZGUA 3NAPB 3WDXA 4A7ZA 1V9U1 3SH5A 3WDTA 4IV3B 2VPVA 3ME2A 4G3YC 2ZGLA 5KXDA 3BODA 2ATFA 2P3KA 1XU1A 4E27A 1RUJ1 4HK8A 4LUKA 2ET7A 3MPBA 5KHJA 1EPZA 1LEMA 3O7OA 1JYCA 4H7LA 1ENSA 1Z0HA 1EAH2 2DVAA 3M70A 5HCBA 5J36A 1ZBE2 3OD4A 4GH4A 1Q43A 1DLLA 1F31A 4RQPB 1REFA 1HV0A 3IDBB 4BPZA 3WNXA 1Q56A 3E97A 3OBRA 5F1RA 1DQ6A 1LENA 2DFBA 1ONAA 1QNWA 1RB8G 2XGXA 2RR11 4X8NA 3S30A 2WA4A 3ZFFA 1QHDA 2VUAA 2B7YA 2ZMKA 3DN7A 4XPVA 2B5HA 5LK7B 1CAUA 4L99A 4MSVA 2WQZC 1RMU1 1QWRA 4OI2A 1DGRN 2CGNA 3TRSB 2BFUS 3R0RA 2G4IA 3JD71 4PBOA 4SLIA 4FTBA 2HKXA 4MGIE 3VBSC 4KNCA 3R6SA 4EN9B 2DVGA 1UCXA 4Q0VA 4C0HA 4RGGA 3ZDSA 4DMIA 1OI6A 1GANA 1QJU1 5EYXA 5AVAA 2R04