1CR7A

Peanut lectin-lactose complex monoclinic form
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
232
structure length
232
Chain Sequence
b'AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LECTIN
publication title Crystal structures of the peanut lectin-lactose complex at acidic pH: retention of unusual quaternary structure, empty and carbohydrate bound combining sites, molecular mimicry and crystal packing directed by interactions at the combining site.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 51
structure length 232
sequence length 232
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 1999-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1cr7A00
3ZXKA 2AUYA 2ZGKA 3B3QE 3OBTA 1S0DA 5IUQA 3SH4A 4Q8KA 1W6NB 1MZ5A 2E7TA 3UK9A 4LBJA 3ZVXA 1JUIA 4LBOA 3PVNA 5EYYA 4M3CF 2DUQA 4Y22B 3T1MA 1OFSA 4RL7A 1YRZA 4P14A 1MVEA 1WW7A 1AX1A 2W68A 3WDUA 4FOQA 2A3WA 4FVVA 5DZGA 3WG1A 1C57A 1SBEA 1LGCA 1X50A 3AP4A 2EF6A 4XTMA 1R1ZA 5DZFA 1FATA 3ZSJA 2ZGQA 4R9AA 2ARBA 2D44A 1OQ1A 1DFQA 4P9YA 4XJWA 1D0HA 1UZZA 4YW3A 2R0HA 4YM0A 4Z8BA 2SLIA 1LEMA 2GDFA 1BYHA 3WHTA 1W0PA 1KJLA 5GLZA 5F9TA 1W6PB 3AZWA 3AP6A 3IPVB 3WDYA 4PQ9A 2WSUA 3N35A 1LU2A 5GM0A 3L2YA 4M3CB 4CZSA 3IKWA 2NMNA 2EXJA 3B00A 1QNWA 2A3YA 2YV8A 3ILNA 2ZHLA 1G9DA 3AXEA 3INAA 4GWNA 3N7JA 1ULFA 3POYA 5H9SA 3AP7A 3AZZA 1HLCA 2LTNA 1DQ5A 1PZ8A 4XJ8A 2CWSA 3MW3A 2E6VA 2D43A 3SH5A 4BLIA 2DVBA 3M3EA 4R9DA 1FYUA 4TZDA 5H9PA 1GANA 1V6KA 3V65A 3KQRA 3USUA 4XBNA 4WVVA 5DG2A 5T54A 2A71A 2ZGRA 3WV6A 3M3CA 3AZXA 4YFZA 5IK4A 4HL0A 2E53A 5CBLA 1DQ1A 1SLTA 2ZACA 3MEPA 3V0BA 5FREA 3NV4A 3QCWA 3FUOA 1MS9A 1LECA 2TEPA 4BPZA 2GMPA 1ULGA 2PHRA 4L8QA 3M3QA 3V0AA 3ILRA 1UL9A 5GLWA 1VAMA 3V64A 1MACA 5F5QA 4P9WA 1S0FA 4Y26A 4BOWA 2D3PA 1V6JA 2UWBA 4R9BA 4BM8A 1DQ6A 1V6NA 3VV1A 4FPHA 4GKXA 4WZFA 1N1YA 4BLJA 4XMIA 1YI7A 1IS4A 2NYYA 1TEIA 4FPCA 1RIRA 2GNTA 2OUHA 1FV3A 3A0NA 4XIOA 1LEDA 1Q8OA 3DGTA 2AYHA 1G7YA 1SBDA 3PVEA 2UURA 2R1BA 1YYNA 2ZA9A 3UJQA 1CVNA 1IKQA 1GNZA 5E88A 5FRAA 5GJ6A 2GMEA 1QOSA 5EWSA 2CNAA 2P3IA 4ZXKA 1ULCA 1ENRA 4K20A 1UN1A 1DQ4A 3AX4A 1CPMA 4Y1VA 4UW4A 4WVWA 4U36A 3WDXA 1GICA 1QDOA 2WLQA 4FPLA 4I30A 2DV9A 5H9RA 3O0VA 3ZXLA 2EAKA 1IS6A 2P37A 4LBQA 1ENQA 3ATGA 1SLCA 3BODA 1LTEA 3OPZA 3AJZA 4Y20B 4FOWA 1CR7A 1CONA 4YZ2A 5GALA 3A0KA 5AVAA 4XOGA 3VKNA 2YXSA 1LU1A 1PZ7A 2YMZA 3AYCA 3GNEA 2VW2A 2D6KA 4YZ5A 1CIWA 3WNXA 1G9CA 1I1EA 2VW1A 3ZYPA 2CTVA 3LCPA 3AYEA 4AVSA 1QDCA 4FP2A 1ENSA 2FHRA 1LOCA 1IKPA 2P2KA 3RS6A 3O12A 1WLCA 1GZWA 4LBQD 3I8TA 1BZWA 4XILA 1S0CA 5IT6A 2ZMKA 2JE7A 1D2SA 1GYKA 3AP9A 5DUVA 3W59A 3WG3A 3PMEA 1FNZA 3SITA 3ZXEA 1JBCA 3N36A 5DUXA 1GLHA 2OW4A 1N1VA 1W6QA 2EALA 2GMMA 3D5OA 2C9AA 5HCAA 1CN1A 1G8WA 3NV1A 4HANA 5JDBA 4FQ4A 4BQ1A 3BTAA 4ITCA 1LHNA 3OBRA 3WZ1A 4XHXA 5T5JA 1LHOA 1WBFA 2C5DA 2AGSA 3OY8A 4K21A 1DIWA 1W6NA 2NZ9A 1MS4A 2A75A 4YM2A 2CY6A 1AVBA 2CWMA 2I2SA 4YGEA 1JXNA 2A5ZA 3D6EA 4Y22A 4OZXA 2A6ZA 2GNMA 1FX5A 3H0OA 3O5SA 2SBAA 4M3CE 3WVJA 3B01A 2GALA 3RRDA 1KITA 3WDVA 2WNEA 1OKQA 1PZ9A 3N7KA 1MS3A 1KDMA 3FLRA 1WBLA 1MZ6A 2A7AA 1UPSA 2CL2A 2PHUA 2D6LX 5GZFA 2NM1A 1QOTA 4FOYA 4NO4A 2WKKA 2ZABA 2A6VA 2BQPA 2EXIA 3IPVA 2GNDA 2JECA 1G9FA 2R1DA 4CRQA 1GZCA 4YM3A 5LK5A 4ASMB 2D6OX 5JOZA 2DVFA 3APBA 4YFWA 5IK5A 1GV9A 3N7MA 4Q26A 5GLTA 1AZDA 1DLLA 5KXEA 3WDWA 2A6XA 3BIWE 4PCRA 5H9QA 5IK7A 3WLUA 1VALA 4FPEA 4FPFA 1AX0A 1MS8A 1W6MB 3AK0A 3N3HA 2AREA 4FOVA 4YM1A 3SNMA 4YW2A 5JVVA 1A8DA 2PHFA 1Z78A 1Q8VA 1GNHA 2ZHNA 3OGGA 3USUB 3DUIA 3FUQA 3TAYA 3N7LA 3RQ0A 3LSDA 4XDQA 3C2UA 3I4IA 1A78A 1SBFA 1LCLA 3MPPG 4DRRA 2ZHMA 1MVQA 4M00A 4Y24A 3AFKA 3POWA 1G86A 1AXYA 2OVUA 1ONAA 1URXA 1WD3A 1IS5A 1YXWA 2DU0A 2G4IA 1LHVA 3AP5A 3B69A 1LOFA 3ZSLA 1WLWA 2WT0A 1V6IA 3LSEA 1DYPA 1AF9A 1FNYA 3RMYA 1U0AA 1EPWA 3M1HA 3ZYRA 1WCSA 1ULEA 3IMNA 1DQ0A 1CESA 2FMDA 2V5YA 3VUOA 2JDZA 1LJ7A 3U4XA 1ULDA 3ENRA 4YGBA 5GLUA 3VKLA 5BYNA 2A70A 4PF5A 5JMCA 2WQZC 1N3QA 2JKBA 2ZGLA 2UWAA 4ZKTB 3VKOA 1LOEA 3FLPA 3NV2A 3IN9A 2KM2A 3WOGA 5DUWA 1SLLA 3A4UA 4XJ9A 3WCSA 1V00A 1Q8SA 1FAYA 1JW6A 2AENA 1QNYA 3AZYA 5JOWA 2ARXA 1KJRA 1GBGA 3KM5A 1DGLA 1QGLA 4LBLA 4ISRA 5CA6A 5JLVA 1LULA 1RITA 2HYKA 3AJYA 5KXBA 5L73A 4PBPA 4FPOB 5T5LA 1NXD1 2ZMLA 3NV3A 4P9XA 3GALA 3RG0A 1J1TA 1LODA 3O0WA 1QF3A 4YZ4A 1W6OB 4Q2FA 4XTPA 4XJUA 1AXZA 4YZ3A 5T5PA 1V6MA 2NN8A 4Y1UA 2RHPA 4BMEA 1RINA 3SH3A 5GZGA 1C1LA 4LBQB 3CNAA 3IM0A 4RA0A 4YG0A 3SLIA 2ZKNA 2R49A 1BXHA 4XJZA 2W39A 3D4KA 3R4SA 4FQZA 4C1XA 3JUUA 4GALA 5DG1A 1SCSA 3OYWB 5HCFA 4Y20A 2XG3A 1UMZA 1JOJA 2ZZJA 1QMJA 4LBNA 1JN2P 2XB6C 3FLTA 5EYXA 4DRVA 1SFYA 3O0XA 3FFZA 5SV8A 2P34A 1QOOA 1W0OA 3T2TA 4F83A 3ASIA 5E89A 2ZGNA 5DUUA 4FP3A 1SCRA 1AJOA 2PHWA 2ZHKA 1S1AA 5GZCA 1QKQA 3WUDA 1G9AA 3WG2A 3QLQA 2YY1A 1WUVA 3JU9A 2EXHA 1DBNA 2DUPA 4YZ1A 1C1FA 2VU9A 3ZPYA 2DU1A 2P3KA 2W52A 4UW5A 2P3JA 1MS5A 5DZEA 1N1TA 2DWRA 1V6LA 2E51A 1APNA 2JE9A 2ZGOA 4MYEA 4W65A 1YO8A 2ZGPA 3RMXA 5JOYA 2NP0A 3WDTA 3M2MA 2Q5TA 4XXAA 1ZA4A 4YLZA 4GA9A 1LOFC 3ZXJA 4IQPA 4CTEA 1H9WA 1SLIA 1BQPA 1VIWB 3WG4A 1KRIA 1Q56A 2VY0A 1MS1A 2ZBJA 1JYIA 4XZPA 1LENA 4YG6A 4AGRA 3ILFA 5KXDA 2EIGA 1LOGA 4AVTA 1UZYA 2DYCA 3ZSKA 1S0EA 2A6YA 3Q9OA 4ATFA 1G9BA 5GZEA 1YIFA 5CAZA 1WW6A 2GN7A 1Q8QA 2D3SA 1DYKA 1HKDA 2PHXA 1LGNA 1W6PA 3W58A 4H55A 1UX6A 1LOAA 5JOXA 2D3RA 4FPGA 2YZ4A 1GKBA 3B9CA 2LALA 4M3CA 4C1WA 1AX2A 4JC1A 1HDKA 1F31A 2DUOA 4M01A 1NLSA 4GWMA 1S0JA 4DQAA 4WV8A 1UAIA 3HMYA 4Y1YA 1SACA 3BOPA 4XE9A 4DFSA 1DHKB 5T55A 3ZSMA 4JCKA 1VLNA 2YROA 4XHBA 3R4UA 4XYXA 1WLDA 4D69A 1Z0HA 2VH9A 5GLVA 4DPNA 4AWDA 4GKYA 1SLBA 2VUAA 2V73A 2NMOA 4K1ZA 2ZGTA 3TB0A 4Y1ZA 2JJ6A 1WW4A 1W6MA 4Q8LA 5KXCA 4YW1A 4Y1XA 3PVOA 3R05A 5IK8A 3V0BB 2D6NA 4AGGA 4FPYA 1HQLA 1ZM1A 5CNAA 2R16A 2AH2A 2WT2A 1LHWA 5T52A 4XMAA 3V0AB 4UW3A 1KQRA 3AYDA 3OJBA 2ERFA 3PJQA 1CPNA 1LOBA 4YGDA 1LGBA 2B7YA 3MW2A 1GZ9A 2A3XA 2WT1A 1AJKA 4U2AA 1MS0A 3AYAA 2ES3A 1HQWA 4NOTA 2D6PA 1LESA 1F5FA 4YG3A 4FPKA 3T1LA 2EXKA 3SISA 1Q8PA 1O4YA 4AVVA 1IOAA 1QU0A 1I3HA 4YW5A 2WSVA 3HR9A 1GSLA 1S0GA 4PBOA 3VKMA 1BJQA 1DQ2A 3ZXFA 1KDKA 1N47A 2UWCA 2E7QA 3NWKA 3HN1A 3UJOA 2WJSA 4GXLA 4XBQA 2A6WA 4K1YA 2OUJA 1CQ9A 5GZDA 2ZGMA 3VKFC 1BKZA 2DURA 2GNBA 4UW6A 4Q27A 4XBLA 1A3KA 5CB7A 4KBBA 5HCBA 4SLIA 2PHTA 1CJPA 2GN3A 1V6OA 4R9CA 1LHUA 2ZGSA 1DZQA 1WW5A 3WUCA 4XXPA 5T50A 1S0BA 5E8AA 2W08A 4LBKA 2DTYA 2Z42A 1F9KA 1W6OA 2PELA 2DVAA 4XJAA 4AYUA 4DS0A 2R0FA 4FPJA 1H30A 1MR5A 1H9PA 2D7FA 1S0IA 2D6MA 2ZGUA 2H0BA 2ZMNA 3M3OA 1SLAA 3RSJA 1AXKA 2JD4A 4YGCA 2ENRA 5EXOA 3AXDA 4ATEA 4BMBA 2AR6A 1IS3A 2VW0A 1GZWB 3OYWA 1O4ZA 3WCRA 4Q1RA 1Y7BA 1B09A 5T5OA 4XIKA 1UKGA 1FV2A 4TYSA 4JRAA 4YW4A 3UL2A 2DTWA 1JHNA 2VXRA 3WHUA 1WD4A 2ZAAA 4ISQA 1C4RA 1N1SA 1W6QB 1XQNA 5DXDA 4LBMA 4AGVA 2CYFA 2DVDA 1N3OA 3FBYA 2UU8A 3POSA 4Q1PA 2DVGA 1VAVA 1JYCA 3MW4A 3AZVA 1N3PA 3OY8B
chains in the Genus database with same CATH superfamily
3ZXKA 5EV7A 3JQXA 1FT9A 1OA4A 1MZ5A 1OC1A 3K77A 4R52A 4LBJA 2OXBA 4RD7A 5A7PA 4DO0A 5AC92 4LOSA 5EYYA 4QPWA 5FPAA 1DYOA 1R1A1 2C26A 2DUQA 3POGA 3HWJA 3T1MA 1RUF3 2BU9A 1JU4A 1YRZA 2W68A 3H3LA 4GMP1 2FD8A 4FOQA 2FZ2A 1YQ5A 3T0DA 2JG8A 4FVVA 2RR11 5DZGA 1ODNA 3ZPOA 1C57A 1Q3EA 1SBEA 2EF6A 4IV1B 4XABA 4H7LA 5E16A 2VCMA 5FZKA 5BNOA 2YBSA 1NZIA 1OQ1A 4OULA 4QXHA 1ZZ7A 2VVDA 3VDDC 1PGW2 4CSWA 4FTEA 4P9YA 4MGZE 1D0HA 4HVOA 4XJWA 4YW3A 3PU3A 4G9SB 4Q4Y3 2VO5A 3VHPA 4CXWA 2GDFA 3BU0A 1BYHA 1TZOA 5K0UB 4QB6A 1S2BA 3AP6A 4E9KA 3I97A 3IPVB 4D6SA 1GMMA 2LM3A 1R092 1QJY1 1NE4A 3KHBA 1XE8A 2YUEA 4X8NA 1UYPA 4PDWB 1OOPC 5BNNC 1PO21 1X36A 2YHJA 2A3YA 3HNBM 5C4WC 2H6BA 4RFRB 3MFCA 1G9DA 1A34A 3INAA 3WX5A 2E33A 3N7JA 4CEYC 5H9SA 3PUIA 5I0SA 1REFA 1HLCA 1VBC3 2XONA 3THTA 1UY3A 1W8OA 4K8RB 4XJ8A 1JYNA 1NQJA 4UFLA 2D43A 1RUNA 3E1F1 3M3EA 4LQRA 5JI7A 5H9PA 4NR1A 1GANA 4MXVA 3BTYA 1PHMA 1LR5A 3AKTA 1HRV3 1XU1A 3JB8A 4WVVA 5EJ3A 5CFCB 4CCCA 2A71A 3VBHA 1VBB1 3WV6A 4BWOA 4C0BA 4NHXA 4YFZA 2UY8A 2Y33A 4LE4A 4LR4A 4XCBA 3VZMA 1RJ7A 5FREA 3QCWA 2ZPXA 2QDRA 1LECA 2IC1A 4ET7A 3EHKA 4BQ2A 1QJX2 3V0AA 2RJLA 1JYWA 1U12A 2A73B 1LKNA 2DFCA 2ZEXA 3PURA 2XVLA 3JD73 1W3VA 4JX0A 4NE9A 4PIZA 5A32B 1KXGA 3J8F2 5F3EA 4BOWA 2Y34A 3TN92 4UFKA 1OBNA 4BM8A 4CUAA 5FYVA 2VBDA 5FYUA 5JIUA 1J3QA 1JS9A 2GSYA 2TNFA 4CPBA 1YI7A 2OZJA 4FPCA 4N53B 2GNTA 1NOVA 3BN6A 3PUQA 4XIOA 5FV3A 1HJGA 1Q8OA 1EV11 3DGTA 3LA7A 3N9MA 1WCDJ 2Y8KA 5FZOA 2C0ZA 1CZSA 5FZFA 5I8TA 1SBDA 2ZA9A 1CVNA 1IKQA 1GNZA 3SQOA 3LKJA 1F4HA 4AF9A 3K4ZA 2P3IA 3RPQA 3KD4A 4ZXKA 1ULCA 1UYZA 4INDA 4K20A 1DQ4A 3AX4A 5FYTA 4Y1VA 2ZAHA 1TE1B 4YRDA 2OX0A 5F37A 3ZXLA 1IS6A 5DN2A 1HRI3 4LO4B 2JDKA 5AFBA 4L11A 2BTVC 2J7MA 2X05A 1LTEA 1RUE2 4IESA 4Y4YA 1QXPA 5LASA 4BK4A 4CA9A 5FY5A 2ILMA 4Y20B 1ENXA 1OA3A 1CONA 1GP4A 4QX8A 4IEZA 5AVAA 4KI5M 2HYXA 3VKNA 1PMHX 1LU1A 3GNEA 3NL1A 3D8CA 1C8M1 1RMU3 3ZXDA 4P9GA 1UZWA 1UY4A 3ZYPA 5JSOA 4AHXA 2LS6A 4JGZC 3AYEA 1QDCA 2XVKA 1LOCA 1HXS1 5IVJA 1BEV2 5BNPB 5A70A 5F1RA 2ZMKA 5DUVA 5F9TA 1GYKA 1WMXA 3PMEA 4QHBA 3SITA 3MDPA 3N36A 3Q8AA 4LKSA 1WMFA 4K8FA 4B4QA 3PNAA 1NQDA 2OW4A 1L3JA 4CP2A 1W6QA 4KU7A 3LFIA 4QHZA 2EALA 2GMMA 4IGOA 1IQDC 1G8WA 3C3VA 4HANA 2H6CA 2E63A 3DPRC 3IDEA 2WZEA 3BTAA 1K5JA 1EUTA 2GC1A 2JIGA 3HBKA 4FFIA 4K21A 1VAKA 2CGOA 3LPGA 4AI8A 3FL7A 3UNPA 5E6HA 1DIWA 1OH3A 1CX1A 1FMD1 2JG9A 4V2WA 4D94A 3L9JT 2NZ9A 3AB0A 2A75A 4YM2A 4YVSB 3GHNA 1JZ7A 2CY6A 3GCWA 2I2SA 3NW4A 4HSLA 3BIEA 4Y22A 2GNMA 1FX5A 2BOJA 4JTNA 3H0OA 4AXOA 1VBE2 3FX3A 3GHMA 3NKGA 3OEAA 3WVJA 2ARAA 4W4ZA 5A1AA 4ZS2A 3J7HA 4NN0A 4D7SA 3MGUA 2B45X 3N7KA 3U14A 2VVEA 3C7FA 2VZUA 3QD6A 3PUHA 1JODA 1YI9A 3ZR6A 2Q1MA 3LOBA 2WDBA 5IFPA 1E5HA 3RNSA 1KD7A 4DUXA 2PHUA 2NM1A 5F3CA 5CG8A 4D3WA 2A6VA 2WC2A 5FLJA 2R041 2R1DA 4CRQA 4YM3A 5J09A 1BHGA 4E4ZA 2Z5WA 1K5MB 5FP7A 1OFNA 1VRH2 4YFWA 1OQDA 5FWJA 1GV9A 2ID4A 3MZHA 3SMHA 1AZDA 2A1XA 3ACFA 3NAPC 4W6XA 2VZQA 2JE8A 3KF5A 2Q8OA 3WLUA 4AI2A 2HWD1 2E31A 4QB1A 4Q4Y2 3I49A 4YM1A 4FOVA 4N43C 1DU3D 1US2A 1XXNA 5JVVA 4EJRA 1L7QA 3ZM8A 2KD7A 3DUIA 4Y33A 1AR62 4N7IA 4Q4V1 5FCCA 3RQ0A 3I2DA 2V4AA 4MVTA 4IEVA 3I4IA 3WP4A 4PHZA 3H42B 4QGLA 4JQRA 5JR2A 1HX6A 1IPSA 3OGSA 4DNYA 1QHDA 2BGCA 4D7TA 4F3JA 4IEYA 2ZHMA 5I0TA 4FFHA 3AFKA 4AEDC 1GNYA 3DYPA 1CAXA 1URXA 4LIVA 2J1EA 3B69A 1UXXX 3ZSLA 2O14A 1DYPA 5FBJA 1ASJ3 4UXAA 1U0AA 3WW4A 1PK6B 1WCSA 2W46A 1CESA 1QJY3 1W9TA 1QQP2 2V5YA 2Y0IA 1T6GC 3HEIA 2ZOEB 1ULDA 1PO23 2ZCWA 5GLUA 1VRBA 2XHNA 2A70A 4KH9A 4PF5A 3WF2A 1M4WA 2WQZC 3DF0A 3LAGA 1N3QA 3IZOA 4I0WB 4PF1A 4XF3A 2JDNA 2UWAA 1YEWA 3NV2A 3M4FA 4LUKA 2KM2A 3HT1A 5DUWA 3KCCA 1STMA 2JDMA 2VOXA 3GZTB 4E4HA 4OZOA 1QNYA 4KL1A 5C3OA 2WRAA 3MLLA 5D8AA 4B1MA 4LBLA 3RJRA 3VBFB 5JLVA 1LULA 2VBBA 2XOMA 3I3EA 2HYKA 1UPIA 4PBPA 2RMU1 1NXD1 1KEXA 3JD72 1H8TB 3ZN5A 1E5RA 5LW9A 2WYFA 5KWRA 4TLFA 5L7OA 1W8WA 1LODA 2WZR1 1VBB3 3ETQA 4YZ4A 5FTTC 1OOPA 2W91A 5F5AA 2BFUL 2R072 3GDBA 4XJUA 1AXZA 4XTPA 2WO3A 2YPJA 5C71A 5EJZB 1AR71 2XHKA 1V6MA 2ZX1A 3Q8EA 4Z1VA 5B2GB 2RHPA 1JZ5A 3ZOIA 1BMV1 4GH4A 4WBBA 3SLIA 1HB4A 1UW8A 1GQHA 5B4NA 2WO2A 3MO4A 3VDCA 3D4KA 4E4SA 3R4SA 4FQZA 4URAA 5FZ4A 3VN4A 4AFMA 4GALA 2CAVA 3OYWB 5HCFA 3LFMA 1JMUB 2XG3A 1FOD1 3U07A 1UMZA 1POV0 5IAXA 5L9BA 3VD3A 1V9U1 3PTRB 1QMJA 4OQ8A 2D5FA 5JXJA 4LBNA 2XB6C 4E2QA 5FFOC 3ST7A 3FFZA 3U1XA 1QOOA 2XQXA 4AAXA 3PUSA 5EHDA 4PLNA 4F83A 3ASIA 4Y5Z0 4CE8A 5JCTA 2VMCA 1SCRA 3ZMNA 1ZBE1 1EV13 3KV9A 4BQXA 3OUJA 4IV3A 3ZFGC 1CD3G 1Z7S3 1G9AA 3ACGA 1XNTA 3VHNA 4MXWB 4KG0A 3CQOA 2V09A 3LA3A 5FZLA 1TME1 3VDBA 1RUJ2 2RS53 4QPIC 4KWJA 3ZPYA 4EE2A 1YHFA 1JZ2A 3AMQA 2W52A 2HWF2 5FZHA 3TRSB 4CUCA 2W1UA 5DQ0A 4JDOA 3RMXA 2JG8B 3ZMOA 2VVFA 4A4AA 5LWBA 2NP0A 3WDTA 3M2MA 4XXAA 3B9IA 4YLZA 2FDHA 1LOFC 3EBRA 1SLIA 1BQPA 1VIWB 4XFAA 3WG4A 4AVCA 4CU8A 2PXJA 4QQ2A 1MS1A 2ZBJA 5A80A 4IEWA 4IV1A 5FO8B 2HWB3 2BFUS 1QWRA 1MZEA 2C9KA 3ILFA 1FPN2 2WABA 2G9ZA 2YB7A 1F5JA 5EZWA 2C24A 2WS93 4QGNA 1WW6A 4MGIE 3EJKA 4F7ZA 1Q8QA 2D3SA 3FBMA 5K0UA 4BE3A 4IERA 3MIHA 1H4GA 2XPJA 1RUD1 2JXAA 4UT5A 2XGXA 1H6XA 5LBCA 4LUMA 2WINB 2CSGA 2E7AA 3M3IA 2LALA 4BQ5A 4IUGA 2AACA 3N9QA 1HDKA 1F31A 2DBIA 2DUOA 5FK8A 2JKXA 3ZFEC 3ZLIA 4CU7A 5FLIA 4DQAA 2X53S 1J84A 3OTFA 4WV8A 3OG2A 3S5AA 4DFSA 2BW8A 2F4LA 3SC7X 5T55A 1PX3A 2WBKA 3K46A 2VMEA 2YU1A 2YROA 5ACA1 4G3YC 1Z0HA 3U11A 4AWDA 1YFYA 2VUAA 4JGZA 3IDBB 4DY5A 1U5IA 2VZVA 3VBHB 4MGTA 3I2JA 2JJ6A 1XC6A 1ZYBA 1GQPA 3IIIA 4CDXA 5KXCA 3BU7A 3ZYBA 5JWPA 4GAZA 5F5IA 5D21A 5EP9A 3MFAA 2D6NA 5C3PA 5FYZA 1GQGA 1ZM1A 1W2NA 4AR2A 1LHWA 3E6BA 5IYYA 1O59A 4XMAA 3V0AB 5ABJB 5LY1A 5FZEA 2Q30A 3OJBA 1VJ2A 3KMHA 1CPNA 1LOBA 3PJQA 3DPRA 3ZX7A 2BPA2 1OA2A 1VBA1 2B7YA 4XETA 4DUVA 4R8HA 2A3XA 2FDKA 1MS0A 4XUOA 3KV5A 3VZKA 2ES3A 3ME2A 5FMOL 1HQWA 2VECA 4NOTA 5KHHA 2KXLA 4XQ4A 1LESA 1MEC3 5FP9A 1R1A2 1UOJA 4PLMA 2EXKA 2HWE3 2YG0A 3MLKA 1Q8PA 1O4YA 3N9OA 5FPLA 3ZSEA 4AVVA 1YQCA 5CKNA 1O8PA 1UXZA 2R043 3HOBA 2RR12 2PTMA 1IQAA 1O3SA 2IUWA 5FZOB 2UWCA 1HN0A 4I09A 3HN1A 4PIYA 4OHZA 3UJOA 3BUCA 4K1YA 1TNRA 2MEV3 3H8XA 3HD8B 2ZGMA 3RZZA 5HXVA 1XNAA 3WF4A 4EN6B 1JYVA 2HWD3 2XWJB 4R4ZA 3QBQA 2GNBA 1UYXA 3C7EA 2Z2SB 3ABZA 3JQWA 4UW6A 2F17A 4D6RA 1HJFA 3RZGA 5IVFA 4CUBA 4JGYA 2PHTA 4R9CA 1RUF1 3SCHA 3RZKA 4Q4V3 4BQ4A 4KQ7A 2JB4A 3FMGA 1WW5A 1V70A 2OA2A 2UY9A 3WUCA 4LHKA 4M4RA 4CU9A 2WWSA 2RE9A 5E8AA 4XUNA 4HN1A 3JBG1 4QQOA 2DVAA 3IMMA 4FFGA 4AYUA 1UU4A 2R0FA 4QPGC 1MR5A 3B7MA 1S0IA 1GWMA 2D6MA 4UBHA 2H0BA 3M3OA 3OGVA 4AFBA 4WM8A 1R083 2JD4A 2ENRA 2WA3A 4JDNA 5BUVA 5FP8A 1O5LA 2FZ1A 4OI0A 1H1IA 1IS3A 2RS12 1O4ZA 2FCVA 3GXUA 4QM9A 1B09A 1CAVB 5FMOS 1UKGA 3KLSA 4TYSA 4JRAA 5T5OA 3O1SA 1GOHA 2BDRA 3OGJA 4AE2A 3WHUA 5BNPA 2QNKA 2Y60A 5BPXA 1XQNA 1W6QB 2QKDA 3W5NA 3K4DA 3O1TA 1PMIA 1VBC1 4AGVA 2W94A 4F8AA 2CYFA 2FBEA 3P5BA 5KBFA 1QY4A 2DVGA 3W9AA 1O5UA 4P9JA 3WINE 5F39A 1UMHA 2RMU3 4UFHA 2AUYA 3B3QE 4YPJA 4JTOA 3SH4A 2JG9B 2D98A 1OD3A 2DCZA 3LEKA 4XDOA 5DDJ3 2X5IC 3I2KA 3UK9A 3ZVXA 4BQYA 1JUIA 4Y22B 4P14A 4XZUG 1WW7A 1AX1A 2Q8CA 3WDUA 4L9BA 1W2AX 2ZKLA 2A3WA 4ZPIA 1FXZA 1BLZA 3WG1A 2VJXA 1DP0A 1LGCA 4NAMA 3AP4A 1SPPA 5DZFA 4AHZA 2ZGQA 3ALQA 3IBMA 2ARBA 3CL1A 5CFDC 2YGMA 1R64A 1PIV3 3ACIA 4CCNA 5A1FA 3AMMA 5FK7A 3RZLA 4XC9A 1DFQA 3UGHA 1UWWA 4LORA 4K6BA 1V9U3 4YM0A 5EQUA 3ZKYA 3LEMA 4UF0B 4Z8BA 1LEMA 4K3UA 1ZRRA 1W0PA 1KJLA 4NRPA 1W6PB 3AZWA 2C6SA 4EZ4A 5C8CC 5A7NA 3U10A 4O9EA 1UIJA 2Y6GA 3R4DB 2RM21 3E5XA 4GULA 4PQ9A 4ZU4A 4A41A 1OD5A 1OQEA 1W8TA 3I7DA 3NO8A 4CUGA 1PGL2 4UI9L 4D7YA 3B00A 3LZZA 4Q0UA 4DEQA 5J1XA 4JAAA 4IGQA 2WL1A 3AXEA 1RXFA 4GWNA 4CP1A 4XAEA 3J9SA 1TME3 3AP7A 1OMIA 4LO7A 1XE0A 4XF1A 3E6CC 3LGRA 1UD1A 5A6QA 3MW3A 1C8M2 3SH5A 3H1YA 1KS5A 2VNGA 3BALA 2GC2A 4C91A 4W8JA 1WWYA 3RYPA 5FJKA 2DCYA 1ULPA 3ORJA 1HXS2 1XYPA 2JDHA 4XBNA 5DG2A 3CDZB 5FLHA 1QJU3 1AR82 3W20A 1H2MA 2MNGA 1PVC3 4E2GA 4LA2A 4QQHA 1NCRC 1SLTA 2F4PA 2B9VA 3WF0A 4HK8A 4P02B 1X33A 2ZX0A 4UYBA 4DUWA 5HPOA 3UGFA 4BIFA 3FUOA 1QXJA 1RVF2 3I3MA 2GC3A 2GMPA 5LBEA 2PAEA 4YVWC 3WQBA 4BPZA 2VNOA 4CDQC 4XF9A 1RMU1 5IVVA 2HWC3 1W9WA 3ES4A 3HNYM 3V64A 1VAMA 2BVBA 1MACA 1RUD3 5F5QA 4AEMA 4IEPA 2J1UA 1S0FA 2VZ1A 1FMD2 2D3PA 2AEYA 1V6JA 5FBZA 3OSDA 5FZGA 2UWBA 4HLTA 4R9BA 4GWIA 2LROA 3GGLA 3VDDB 4FPHA 4WZFA 3CHXA 2DCJA 4BLJA 4XMIA 3FHQA 1TEIA 1E5SA 5D8AB 3LEGA 2WR9A 4HETA 3A0NA 4EN7B 3TYJA 3U4SA 5LZ6A 1OHFA 1O8SA 5FZ9A 2AYHA 4PLOA 1MPXA 4QD2A 2G9FA 4XUQA 2R1BA 4Z92B 5FRAA 4WM7C 5L7OB 1QOSA 3M7AA 5CYYA 1IPKA 4W6WA 1OOPB 5HXMA 2NQYA 5J37A 2W0XA 3WNOA 3FWEA 2XBO1 4OQ9A 4COUA 1UX7A 2E32A 4AI3A 1ZZ9A 2XJRA 4WVWA 1QDOA 4FPLA 2WLQA 4OUMA 3ZFEA 4GH4B 4CEYB 5H9RA 3O0VA 2VZOA 2P37A 4JHZA 4E8CA 1IG0A 1TMF1 2DDUA 5FMBA 1SLCA 3BODA 2ZJCA 3LB9A 3Q8FA 1C8NA 1VBA3 3QH7A 5L9VA 5LY2A 3OPZA 3AJZA 4AL9A 4N90A 4YZ2A 4R4XA 4COYA 2HWD2 3T2PA 1VMJA 3IDAA 3HNMA 2VUCA 2YXSA 1DLCA 5JIAA 2D6KA 4YZ5A 3WNXA 3I3BA 4LEJA 4A3ZA 1GP5A 3DKQA 5CG9A 2CTVA 3LF7A 3OF1A 5JZGC 1ENSA 5A3MA 4XURA 2P2KA 2WFF1 4OHWA 4DB5A 3O12A 5JR7B 1WLCA 3P1IA 4IV3B 1J1LA 1WA4A 3I8TA 4LBQD 1S0CA 2J1TA 3AP9A 2JE7A 3W59A 2B4KA 1GLHA 4MXWA 1JTZX 1W03A 5C8WA 5LCWL 4RQPC 3WNLA 3R0RA 1C5IA 4QX2A 4BQ1A 4P9IA 5HV0A 2FCUA 4B3NA 3WQ1A 3ON7A 1XJAA 5C9AA 4RGKA 3OBRA 2ATFA 3WZ1A 4XHXA 5FYIA 2TUNA 2WQ8A 1SFNA 1UZVA 2C5DA 4NHMA 3EQEA 3TBDA 3U78A 5LRSA 1JYTA 2XKOA 4OUSA 5CZKA 5LEJA 1W6NA 1Y9QA 1T6BX 4GB31 1SDWA 4Q0QA 5FUNA 3VBRA 4YGEA 2HBTA 3JBG3 5C3RA 2VQ0A 3D6EA 2I74A 2A6ZA 2FDJA 1AUYA 5FZIA 3KVBA 4CDWC 4ES8A 3KV4A 1H2KA 3S57A 2VOVA 2B42B 2BBAA 4OVEA 2IXIA 2WIIB 1ASJ1 5FYYA 1Q43A 2OQ7A 2BV4A 1OKQA 2RMU2 2WNEA 4XQDA 4KWUA 3WP3A 5C6CA 1KDMA 3GZAA 4MG2A 1ODMA 2WZR2 1MZ6A 4N8MA 4QQPA 5HCHA 2J42A 1X9PA 4AVTA 1HQNA 3LD8A 1UNBA 4BCUA 1AR72 4FOYA 4NO4A 4DY3A 2WKKA 3PUAA 1PM7A 4XFCA 1COV3 4UOJA 1BMV2 2GNDA 1UU5A 1XNKA 4B1LA 3KT7A 4TLGA 3IWZA 2WAAA 3A21A 4A3XA 3ZDVA 3APBA 5FZ1A 2CGNA 4IDZA 3ZYGA 4JGZB 3AC0A 5LRRA 3BIWE 3I2HA 4HN0A 4L97A 1FOD2 1VALA 3ZN6A 5IK7A 1P8JA 1V9U2 4FPFA 4CDXB 1VR3A 2VCCA 3SXWA 2PHFA 1GR3A 4YWAA 3AKRA 2FDGA 3VBUC 4DIQA 3USUB 5IAVA 2GH2A 3N7LA 4DINB 3J7LA 5FPVA 4NPRA 1ZBE2 5JXIA 4CDUC 2VPVA 2XDVA 2XJSA 2R30A 3DPRB 3KV6A 1NT0A 3MPPG 4COVA 3BPSA 4PQQA 4DRRA 5ABJA 5F7UA 2RJ2A 2W1WA 4HPKA 2B46X 4BA6A 3VBOC 4AZZA 1RXGA 1WD3A 4J25A 2VZPA 1WLWA 2WT0A 2X5IA 3R6SA 1TNFA 3MI8A 1RJ8A 3NJVA 3SCGA 3M1HA 4AI0A 2QE3A 1ND2C 1ZVFA 4HVQA 3URFA 2RM23 2FMDA 1CZVA 5A6XA 3VUOA 1LJ7A 3U4XA 3AFGA 2QTWB 3ENRA 3KS7A 2YC2A 3VKLA 4BU2A 4HMZA 2XUEA 4KNCA 1WZXA 4ZU7A 4A7YA 2Q0AA 2QDNA 1Z7S1 4LXLA 3GJBA 1RHI2 5F3IA 5BY5A 4N7UA 4AG4A 3A4UA 4QDRA 1V00A 4QXBA 5L36A 2RS51 2R062 4JVAA 4MX3A 1GBGA 3KM5A 4JGYB 1DGLA 4ZY9A 4BISA 1OPOA 1RITA 3OPTA 4XUTA 4Q4X3 4YW6A 5LATA 3AJYA 4ZZ8A 5L73A 1UO9A 1C3HA 5T5LA 5LA2A 3NV3A 3RG0A 3GALA 3PLQA 4RR3C 4B7KA 4C8DA 1XRUA 4DXZA 3SEEA 2HWB1 1SEFA 5T5PA 1UQXA 4Y1UA 4H7MA 3SH3A 5GZGA 1JH5A 4LBQB 4RA0A 4ASLA 4IE6A 3H7YA 4WM8B 2W1QA 2WS91 5ACA2 4MGKE 2W39A 1HIXA 3T08A 4C1XA 1RUG3 4QKBA 4Y3OA 2ZX3A 2O8QA 4LE3A 1SCSA 3W21A 3FE5A 2HBUA 4PDWC 1HV1A 4BIOA 5L19A 1CAVA 3TNPB 4DRVA 1BBT3 4Q0VA 5C5TA 4GMP0 5JSPA 3O0XA 1W0OA 2PHLA 2Y6FA 4AEDB 4ZONA 4QGMA 5DUUA 2PHDA 3W5MA 4E27A 2VTXA 1S1AA 3I2FA 5GZCA 3WG2A 5FDBA 2YY1A 1WUVA 4I2OA 1GWKA 4RS5C 2DBNA 2DUPA 2QQNA 1C1FA 2PMWB 5CKQA 5C5UA 4A7KA 3LDBA 1BK0A 2XBO3 2ADDA 4UW5A 1N1TA 2DWRA 1APNA 1Q5OA 4A45A 2Q5TA 3ZXJA 4GA9A 1TMF3 1SPPB 4NIHA 1Q56A 1U5ZA 3I54A 4QU1A 5DPNA 5FP3A 4XZPA 4E2SA 1DGWA 3WP5A 4FSJA 4Y5SA 1LENA 1VBD1 3WQ7A 1K45A 2XL7A 2W2IA 3MBWA 3MV11 2N7GA 2A6YA 1QXRA 1ST8A 5GZEA 1NG0A 1YIFA 3MF6A 5APAA 4NVPA 4UF0A 2OQ6A 2XR4A 1MEC1 4NIIA 2XUMA 2HWE1 4ONUA 3WF1A 1RUF2 1W6PA 4LO6B 1UX6A 5CISA 1LOAA 4L99A 4XFHA 5JOXA 2WFF3 1QJEA 2P6HA 2Y64A 1D4M3 1GKBA 4FFFA 2EIDA 4N53C 2IXLA 1BVVA 1W8HA 4C1WA 1AX2A 3N9LA 4AQ2A 4MLOA 4A6SA 4M01A 3FN9A 1JZ6A 4GWMA 2MEV1 5IVBA 4IGPA 4O7XA 3O1RA 1Y9GA 1OLME 2AC1A 4S2FA 4XE9A 4S2DA 3ZFFC 5KHGA 4O61A 2ET7A 1VLNA 3KSCA 3JXSA 4K9SA 1WLDA 2QCSB 4DPNA 3PDQA 1MZFA 1EAH3 1SLBA 2V73A 2BYVE 2NMOA 2VMHA 2VXJA 4JKKA 4L0PA 1AYM1 4GB33 1HW5A 5FYCA 3TB0A 1RUI3 3ECQA 1LNSA 1WW4A 3S7IA 1O3QA 1YC61 5I0DA 4LNVA 3PVOA 3CLPA 2OS2A 4IEOA 4AGGA 4ZHNA 1XB9A 1HQLA 1LB2A 1JOPA 1VBC2 4LKDA 5CNAA 4QPIB 3VDAA 5T3NA 5T52A 1OLRA 4UW3A 3TEZA 1KQRA 3AYDA 3EYPA 3N9NA 1EYBA 4FAHA 1R081 4OI4A 4P9LA 4AQ6A 4CXYA 4LJHA 1AJKA 4U2AA 2BZDA 1HRV2 2OIIA 4DXTA 2YFZA 3T1LA 4HZFA 3RDIA 3SISA 2GZWA 1QJFA 4YW5A 3VDDA 3LIHA 1GSLA 1S0GA 1KFUL 1HB2A 4PBOA 3BOWA 1BJQA 2P1BA 2J1VA 1N47A 3NWKA 4LIUA 3K2OA 5BV6A 5A1LA 4XFIA 4GXLA 4HSJA 2X8KA 3PJYA 1CQ9A 3T30A 4AHYA 4EROA 5C33A 5JSRA 2VQAA 2XL9A 1AL21 4FXKB 4IEXA 4TSVA 5DDJ1 2B5HA 4Q27A 3MPBA 5CB7A 1UKRA 3GZUC 5BNNA 2EVXA 1W9YA 5EJ1B 5C4WA 4LT5A 3ZFEB 1CJPA 4Y5TA 5FQ0A 3H1MA 2ZGSA 3GBGA 4AFAA 2RM22 4CEYA 1SMVA 5A7SA 5CU1A 4SBVA 2VTXJ 3ES1A 3BGAA 4XXPA 2Y38A 3VZNA 4XACA 3O1VA 4NHYA 2W08A 4LBKA 2OPWA 2Y0OA 1RUC1 1W6OA 5A7QA 3VL9A 1DCSA 2Q1FA 1PIV1 3MUY1 1F35A 2ADEA 2D7FA 4KG8A 1NA1C 2YC4A 3VD5A 2BERA 1SLAA 3DV8A 3RSJA 4TTGA 4BYYA 3NJZA 4BZ4A 5JXHA 1PO13 1OPMA 2AR6A 4I0BA 4RHV3 3RJ2X 2VW0A 3WCRA 1NY71 1OVPA 4B8EA 3N4MA 1Y7BA 4YNIA 1HRI2 1PNGA 4YW4A 3T09A 1K5MC 2D97A 1WD4A 1H0BA 4XVHA 3CJXA 1OI6A 5DABA 4S2HA 1HB3A 3VBSC 1XBFA 2VUDA 1N1SA 4FXGB 4UFIA 5DXDA 5A6ZA 1UF2C 3NJXA 1X9TA 3OD0A 3THDA 4M0NA 1N3OA 4LPLA 1RMU2 3POSA 5C9AB 1VAVA 2ETEA 1W8ZA 3AZVA 5BXXA 5KHKA 3NVCA 4CEWC 2ZGKA 4Q8KA 1S0DA 5IUQA 1HN1A 1W6NB 4I0AA 3RVHA 3BYWA 3RZJA 2MPFA 3VBRB 1XNDA 1QJU1 4LBOA 4COWA 4Z07A 3PVNA 2IFWA 1U5YA 3RI8A 1QJX1 2XJTA 4M3CF 1PVC1 3ACHA 1OFSA 1QEXA 5C7GA 5LA0A 5KHIA 4AW7A 4QPYA 3WNNA 1NCQC 3J8F1 1X50A 4XTMA 4W6YA 5D2AA 1R1ZA 1REEA 3ZSJA 1JHJA 4EN8B 4R9AA 2K9ZA 1PK6C 2HWC1 4K40A 3C8XA 1JZ4A 4QDQA 2CU5A 3FHAA 5FZBA 4MHUA 1YFXA 4N9IA 1VP6A 1GZTA 4RR3A 1I6XA 3OGRA 1O91A 3WHTA 2XBO2 1MQTC 4HXCA 1UCXA 3THPA 1RUOA 3MUZ1 2WSUA 3KGLA 2P6CA 3PL0A 1TMF2 3IKWA 2NMNA 2EXJA 2XQRA 5FZAA 4CZSA 2ZX2A 1QNWA 2BGPA 4MO3M 3ILNA 2ZHLA 3VBFC 1ZZBA 4OLLA 3LA2A 4QX0A 5IVYA 3CJIC 3AVSA 1ULFA 2GP5A 3H3UA 5DAQA 3ZN6B 2RDRA 2XLFA 2WLPA 1H8TC 3NNFA 2LTNA 4CCLA 1PZ8A 3EMRA 1ND3C 4AI1A 2DVBA 5FZ8A 1IZ3A 1UY2A 4R9DA 5F8PA 1A8MA 4BH9A 2BGOA 3CO2A 3V65A 5LK7B 4QXKA 3RZHA 3KQRA 3USUA 4BDVB 1VPHA 1ZBA3 2WFF2 4P5HA 4EYUA 3AKSA 4MGSA 3C7HA 3M3CA 5CADA 3WW2A 2Z79A 1VBD3 4HPKB 4HL0A 5CBLA 1DQ1A 2ZACA 2ZEWA 3MEPA 1X7NA 2IXJA 1LAJA 3DKWA 3NV4A 2X5IB 4W50A 2TEPA 1XYNA 4S2GA 4HVRA 2PHRA 4B4PA 3M3QA 1BEV1 2OKXA 5J96B 1UL9A 4KBZA 5GLWA 5CEHA 1OF4A 4P9WA 1D0GA 4GB32 1W04A 1RUH3 2F6BA 3ZYIB 1DQ6A 3FFQA 4NAOA 4CCJA 4COZA 5CFDB 3VV1A 4AVBA 5J7MA 4BQWA 4MUVA 1IS4A 1ZRCA 1GOFA 3VD9A 3KT4A 1C28A 1ASJ2 3A22A 4NHLA 1G7YA 4I3PA 3T4HB 3RYRA 1QJY2 3U0ZA 1ALYA 1S2KA 5BNQA 1I5ZA 2GMEA 1AYM3 2G9GA 1Y43B 1PO22 2CNAA 4GQ7A 1VBE1 5I91A 3I3QA 1UN1A 2RS33 4UWDA 5BNOC 5FOJB 2OT7A 4UW4A 2WNUC 1ZZ6A 4XF4A 4U36A 5LBFA 3J7NA 3WDXA 1H1AA 1GP6A 2DV9A 3NAPA 4LMFA 3H8RA 2EAKA 2VNRA 3PMSA 2VQUA 4LBQA 1FI2A 1I9RA 2EIEA 2QQWA 2I45A 4N43A 1CAUA 1ZZ8A 4UFMA 2CHHA 3HN3A 4OFGA 4QKNA 2XLGA 1CWPA 4FOWA 1CR7A 4A2UA 3A0KA 2XJUA 4IE5A 5DMYA 1VBB2 5FO7B 2VW2A 3B94A 3I59A 1G9CA 2PLV3 1IHMA 1I1EA 3KGZA 2HKXA 5FKCA 4AVSA 3LCPA 4QU2A 4AEDA 4FP2A 1COV1 1W99A 2FHRA 3RS6A 4J6GA 2K2SA 5ERLA 4ZS3A 1GZWA 1OSGA 4YVWB 4CDQB 1BZWA 1YFWA 4OI1A 5AC93 4CXXA 5IT6A 2RG4A 3WG3A 3ZXEA 1FNZA 2J1RA 2VMIA 5DUXA 3ITQA 4AEJA 1T2XA 1AL23 3IAPA 5EIYB 1AR91 3IB3A 3LQCA 1U5XA 3VBHC 2C9AA 3E5QA 1CN1A 3RZMA 1ZREA 3DL3A 4NUBA 4E4DX 5E1RA 4MADA 1EP0A 4Y4RA 2VZTA 2JENA 5T5JA 1LHOA 1WBFA 1OT5A 3CMGA 3O1MA 5FYBA 1OUXA 2O8OA 1MS4A 1EV12 1RUC3 5FY8A 1AVBA 2CWMA 3D3AA 4KMQA 1JXNA 1Z7S2 2A5ZA 2XVGA 4CCMA 4CCOA 1QQP1 1XOYA 3PIGA 2RS52 3O14A 3O5SA 4Z2AA 3WNKA 4D6QA 4M3CE 4AEKA 3VHOA 3CKHA 3J7MA 2GALA 2QQOA 4WVMA 1YQ6A 1KITA 4MGQA 3X29B 3GJAA 2EAAA 1WBLA 2CL2A 1SFPA 5GZFA 2D6LX 2HWB2 3DECA 5J48A 3HQXA 4Q29A 3BB6A 2FDFA 2BWCA 3ZYFA 2WNOA 2WWJA 4Q5OA 5L9RA 4C90A 2JECA 1G9FA 4PI2A 3ZKUA 1GZCA 3CEWA 3AMNA 3N9PA 4ASMB 2WS92 4NWVA 2DVFA 3UKVA 3AVRA 5G04L 2JDYA 2YBKA 2X10A 3GM8A 1DLLA 4Q4X1 5GLTA 2Q8DA 2A6XA 4PCRA 4N9HA 5IWFA 5J3UA 4KGGA 5EPAA 4CP0A 1ZZCA 5JZGB 3OUHA 1AX0A 1MS8A 3N3HA 2AREA 1QJX3 5FZ3A 4CVUA 5I0RA 1UMIA 4TWTA 4ZXEA 4LLFA 1D4VB 3ZFGA 1Z78A 1GNHA 2ZHNA 1YJKA 2P3YA 2VR4A 3I3DA 4OUEA 3VD4A 3TAYA 3J8F3 1W9FA 2E26A 2UYBA 2WZ8A 1B35C 4QPIA 3TN93 1J59A 3E5UA 3GCXA 4H2AA 4QM8A 2JD9A 3MYXA 4GJYA 1RUG1 4Y24A 2P4EA 4X6QB 2RDNA 3LDKA 4CEWA 1AXYA 3J26N 5JPMB 2OZ6A 4QKFA 2DU0A 3O1PA 2G4IA 2VD7A 1LOFA 2H0VA 2CGPA 2JDUA 1V6IA 1AF9A 1FNYA 1BBT1 1POQA 2YFUA 1EPWA 3ZYRA 4HT1T 3MIGA 1K12A 3IMNA 2J1AA 3JCIA 3AM2A 3NNJA 2VCAA 4NPMA 4CDWB 4YGBA 5BYNA 5IFTA 2IXHA 1RUJ1 2QQJA 3KWVA 3VL8A 2ZGLA 5B4XA 2HWF1 4ZKTB 5LA1A 3VKOA 1LOEA 4HKWA 3FLPA 3WOGA 3ZXGA 3ZXAC 2WNVC 2V4VA 1XU2A 2AENA 1FAYA 1S4CA 2VAUA 5BNNB 5JOWA 1KJRA 5C4WB 4TN7A 1MEC2 4ISRA 5CA6A 2HWE2 5FQ0B 3OOXA 1MQTA 5FYSA 4HKLA 4CP9B 5DAVA 2WQ4A 2R042 4FPOB 4P9XA 4IE0A 3HQRA 5FMCA 1O7FA 4D0QA 1J1TA 5FZDA 3RGBA 2BNOA 1W6OB 4Q2FA 1K3IA 5FYHA 4LULA 5M0TA 2MEV2 2NN8A 3Q8BA 1JUHA 5JUVA 3CJIA 4BMEA 1XE7A 4YG0A 3IM0A 1W28A 2NPIA 4QMAA 4AQSA 3ZIWA 3BTZA 2ZKNA 4MGYE 1BEV3 3LE0A 3T0BA 1UIKA 2BWAA 2XLAA 4Q4V2 5DG1A 3EXUA 4HK9A 2AZ5A 2VCBA 4LITA 1JOJA 3B5LB 3NJYA 1D4M1 5EYXA 2YDEA 1VMFA 3I2GA 2J1SA 4QHOA 1DZTA 2P34A 5A3TA 1HB1A 1S2EA 2IXCA 3VLBB 1K42A 1AJOA 2IZWA 2PHWA 3B93A 2ZHKA 4G4FA 3MIFA 1R082 3FC0A 2CDPA 3QLQA 4H14A 2WUHA 5FWEA 1ND2B 2PQQA 4E8DA 1W2OA 3HBZA 3BKZA 3LWCA 1EAH1 2QQLA 1VBE3 4MHRA 1RUI1 1F4AA 2P3JA 1MS5A 5DZEA 5ISLA 5HI0A 1V6LA 2JE9A 4MYEA 4DXSA 4Q0SA 1TVGA 4W65A 5JOYA 2W47A 1ZA4A 4I3GA 2DCTA 2GC0A 4IQPA 3OCPA 2ORXA 1QIQA 1CZTA 1W2UA 2VY0A 3LEIA 5IATA 5FJHA 5JI9A 2WN2A 4ES9A 1RYYA 3MICA 3NNGA 2B39A 2QQMA 4XFFA 5FPZA 5K4LA 4AGRA 1XPWA 5KXDA 2EIGA 4BK5A 1AL22 1LOGA 4RR3B 3TOJA 1UZYA 3POBA 5DDJ2 1S0EA 2W92A 3ZSKA 4ATFA 1G9BA 5CAZA 3IT8A 3DXTA 4IE4A 4BXSV 4XEZA 1VRH3 2VZ3A 1HKDA 2PHXA 4UAPA 2LW8A 2WNUA 1UOBA 1J3PA 3OD4A 4QPGA 5HBAA 3KF3A 5J36A 4FTSA 2PN5A 3CF6E 2IFRA 4PJYA 5D8AC 2PFWA 3DXUA 3FZ3A 2WO7A 5FXWA 4DXRA 4L2NA 1UZ0A 1EPZA 1RUC2 4PI0A 2R32A 4QWNA 3KCYA 3JB4C 3H9AA 4GJZA 4NRMA 1NLSA 1PIV2 3ROUA 1UAIA 2C1FA 1AR63 3HMYA 2D40A 4Y1YA 1AR93 4OHXA 3WD5A 5L7OC 3BOPA 1XYOA 3MIEA 3VBUA 4OHVA 4JCKA 4XFBA 4AI9A 1H6YA 2VULA 2OPKA 4BJ0A 5A6YA 3R4UA 2VZSA 5A3LA 2WWUA 2VH9A 4WZCA 2XXZA 5CIRA 4ORFA 4DMIA 4GKYA 4AK3A 4GH4C 1Y4WA 3ZYHA 2BVVA 1NY72 3K51A 3T3YA 4Y1ZA 5FIXA 5C3SA 1PM4A 3UV9A 3O1OA 1W6MA 2G1MA 2XJPA 1WCQA 1UOGA 3PTYA 3OB8A 1ACCA 4RS5B 5FY7A 3R05A 5IK8A 5JXGA 1X82A 4XQWA 1QQP3 1TME2 4FPYA 5F2SA 3TWIA 2R16A 1PGSA 2RS11 4YSFA 4OHYA 3L2HA 1DDLA 1SZBA 4PIXA 2ERFA 2RV9A 3BVCA 3OPWA 2CV6A 4EN9B 1LGBA 1VB2A 4LKFA 2ZEZA 1ZRDA 1PO11 4RHV1 5LBBA 1QJU2 4IV3C 1F5FA 2GP3A 4FPKA 1PVC2 3TEXA 4LHSA 4EWAA 1IOAA 5CFDA 3NNLA 3EB7A 1QU0A 1I3HA 4KGQA 1LRHA 2WSVA 3HR9A 4QQLA 4RGAA 1NE6A 1US3A 2RDSA 5AVPA 4OMDA 1GU3A 3VKMA 4PT6A 1X8MA 1KDKA 2JEMA 2E7QA 2R073 2WJSA 3OBZA 2AEZA 2A6WA 4A44A 2HWC2 5C8CA 4GD4A 1RUD2 5GZDA 5F32A 3VKFC 5I8SA 4ZZ5A 3IAQA 3NNMA 4IE7A 3GBFA 4XBLA 4OCTA 3FHIB 4J1WA 3MIBA 4IV1C 1BCXA 5HCBA 5C70A 5JMOA 2GN3A 1NZCA 4QX5A 1AYN1 1LHUA 2ZX4A 3NAPB 2BNNA 3USSA 5D1IA 1XNCA 1NAEA 1RTVA 3ZFFB 3K75B 1J83A 4N43B 4HONA 1CAUB 2DTYA 2Z42A 5K0UC 4XJAA 2W3JA 4LOTA 4URTA 4FPJA 3VB9A 1H30A 1W8UA 1V0AA 1JZ3A 3WF3A 4OYUA 2ZGUA 2IXKA 5K9YA 3I59B 3I2OA 1PGL1 3KB5A 4MZUA 4YGCA 3ZIXA 2I07B 1NCRA 5EXOA 5A3NA 5FPBA 1OLQA 4WVZA 2Y6HA 4ATEA 3VZLA 4FTBA 1GZWB 4ARYA 1RUJ3 4XIKA 1FV2A 1WA6X 4QT6A 1XSRA 3P3PA 4H3WA 1B35A 2HWF3 1JHNA 2VXRA 4V1PA 2ZAAA 3ETPA 4YVWA 1VBA2 3LIGA 3UT0A 3WW1A 2PAKA 1S55A 1C4RA 2PA7A 2XMLA 4CCDA 3WQ0A 2QQPA 4LBMA 5IW0A 5CFCC 1HV0A 4CDXC 1A6CA 1AR81 3FBYA 2UU8A 4KU8A 4HBNA 2ZS6B 4HFSA 3MW4A 5FY9A 1WMDA 2Y26A 4NMIA 1DZRA 5I93A 3OBTA 1FPN3 3AMHA 3M8LA 4JQTA 2BEOA 1ZBA1 2E7TA 3Q8CA 4RYDA 2WFPA 1DGRN 4LHNA 1RVF1 4JKLA 5K8SA 1POV1 4OMCA 4RL7A 4NIAA 1MVEA 3POJA 3QOPA 3MHZA 4MV2A 5JAXA 5KR7A 5IVEA 2WNVA 2TBVA 4WM7A 3RWKX 4WVMB 1FATA 2EA7A 3HJRA 2D44A 5A7WA 3DEMA 1M06G 2HH9A 2BP6A 2VQTA 4B29A 1UZZA 5CVRA 2R0HA 2XH6A 3MF9A 4IW3A 4BB3A 2SLIA 1RUH1 2Y6LA 3JBG2 5GLZA 2Y6JA 3H8UA 2Q1ZB 1W2TA 2JX9A 4LO5B 3WDYA 5A3PA 1EUUA 3BPZA 3N35A 1LU2A 3P6BA 5GM0A 1NA1B 3RFRA 1YQ2A 3L2YA 4M3CB 3VD7A 1J3RA 3VZOA 2YV8A 4JGYC 4YARA 3UETA 1RL3A 2VMFA 1REDA 3POYA 4A42A 1SDDB 3KHCA 3AZZA 1ZX5A 5JZGA 1DQ5A 5DAPA 2KA3A 5GKAC 2CWSA 3THCA 4MSVA 4I01A 2E6VA 3I2IA 3ZFGB 4BLIA 3KZ4C 2RS31 1FYUA 4J1XA 2WA4A 4META 4UBGA 2IVIB 5FXZA 1W0NA 1V6KA 4TZDA 3VBSB 1VB4A 1OLMA 2NLRA 2X29A 1COV2 4Q4W1 5T54A 4RQPA 3A23A 1W8FA 2ZGRA 4HOOA 4WM8C 4B4RA 5TSWA 3AZXA 4IEUA 1R1A3 3LDRA 1DG6A 5ANQA 4QKDA 1BK1A 5IK4A 4CEWB 2E53A 4GMP3 1JYXA 1CAWB 3V0BA 2RR13 3QACA 5FY1A 1AR92 1RC6A 1MS9A 2WZPP 4RFT0 1ULGA 2JWPA 5BNPC 4L8QA 2Z69A 2LUWA 3E97A 3KVAA 3D0SA 3ILRA 2PLV1 3GBWA 5A3UA 5FOBB 1JZ8A 4M0HA 2JICA 2YYOA 1D7PM 1YFUA 3POIA 4JDMA 4QX1A 1L7LA 2DCKA 2HEVF 4Y26A 1NCQB 2BUKA 2RDQA 4CDWA 2Q4SA 4OI2A 4CYDA 5AC91 4JHTA 1V6NA 1WKYA 4X6RB 3TEYA 3K3OA 4GKXA 4Q0PA 1N1YA 3IDCB 4QX7A 2QQVA 1E57A 2NYYA 3CZJA 3NQHA 3AMPA 5ANNA 1W90A 1RIRA 2OUHA 3MIDA 1FV3A 3P3NA 4YVSC 4BQ3A 1LEDA 1MQTB 1Y9MA 3D82A 4LHLA 1JOBA 2OYZA 3ACLA 5F3GA 3PVEA 3HIFA 2UURA 4GIQA 3WNPA 1YYNA 4AQTA 1CGPA 4IXLA 1PGW1 2KR2A 3DYMA 2FMYA 5E88A 1NXMA 3PVBB 5GJ6A 3UJQA 4CP9A 4CU6A 5EWSA 5FZ0A 1E5IA 3K3NA 5FUIA 1H2LA 1ENRA 1CPMA 1IGOA 4EV0A 1OKOA 3CJIB 1GICA 2BJSA 2BOIA 4I30A 1R091 1GFF2 4CPBD 2RS13 4EZHA 2VG9A 1ND3B 1ENQA 3ATGA 5FZCA 1Y3TA 2B9UA 2RVAA 4RN5A 3TEWA 5FPUA 4Q4X2 4UFJA 4D8MA 3H1WA 1PX4A 5CKMA 3UGGA 3FJSA 1W8NA 5GALA 4RSUA 2W5FA 3UKTA 2VM9A 4XOGA 3H8OA 4B7EA 1PZ7A 2YMZA 3AYCA 1YLLA 4CDUA 3B02A 1CIWA 2VW1A 4Z82A 2QVSB 2HLEA 2QZ2A 3VBOA 1IKPA 4XCAA 2HEWF 5A33B 1H1MA 3HT2A 1QJZA 4XILA 3SCFA 1ULOA 3BTXA 1D2SA 1RUG2 1W05A 1JBCA 2VE1A 2WYSA 3H3ZA 1ND2A 5LB6A 5FZ6A 2ZZQA 1KFXL 2W9XA 3D0JA 5DAWA 1N1VA 2VOWA 3J4UH 3T2OA 3D5OA 5HCAA 5IJRA 1W3XA 3NV1A 4I02A 5JDBA 1BBT2 4FQ4A 3NKTA 4ITCA 4L92A 1LHNA 1AYN3 3T0AA 3PHMA 2VUJA 2D5HA 3CIHA 2AGSA 3OY8A 3BI3A 3EO6A 1SG3A 3ZYJB 2FCTA 1YNAA 3F95A 2JB8A 2XKPA 1OF3A 1OUSA 1RGSA 1ZRIA 2G19A 3TN91 5FY0A 1W39A 1PMJX 3S7EA 5FKBA 4CCEA 4OZXA 3S5QA 2VTFA 2HJIA 5LA9A 4YW7A 3WP6A 2VNVA 5FO9B 3BCWA 2SBAA 3KT1A 1GUIA 5BNOB 3B01A 2WNUB 3RRDA 1L7RA 3E6DA 3WDVA 4QPGB 1PZ9A 1RHI1 4JRLA 1MS3A 4XF0A 5F6KA 4KWKA 3FLRA 4P5YA 1TQ5A 2ZXQA 4NHKA 2A7AA 4AOCA 2QBXA 4P00B 1UPSA 3GZEA 1C8M3 2R061 3HPNA 4HG6B 1QOTA 4FCAA 4XDPA 2QUOA 2ZABA 2BQPA 5FP4A 2EXIA 3IPVA 5KC6A 4A7ZA 1HXS3 3G6JB 3VBUB 5LK5A 1AR83 2D6OX 4JV4A 2QZ3A 2W87A 4CDQA 1ZA7A 2UYAA 4PDWA 5JOZA 1RUE1 5IK5A 3N7MA 3O1UA 5A3WA 4Q26A 1IG3A 2GU9A 2K46A 4AVAA 1UU6A 2IVJA 3WDWA 5KXEA 2GAUA 5H9QA 3TNQA 2J22A 4FPEA 1D4M2 1RVF3 3SNMA 3AK0A 1W6MB 3AKPA 1POV3 4YW2A 4EWEA 1X8EA 1A8DA 5A7OA 1Q8VA 1YIPA 2ARCA 3OGGA 4RS5A 3FUQA 1W06A 3ZDSA 1FMD3 4LLOA 3LSDA 4XDQA 3C2UA 1A78A 1TG7A 1SBFA 1XSQA 1LCLA 2YC0A 5CFCA 5IHRA 1MVQA 4M00A 3WNMA 3A7QA 3POWA 1EAH2 1G86A 2V5DA 3WXPA 1GOGA 1ONAA 2OVUA 4EQVA 1IS5A 3AP5A 1YXWA 2QFEA 1LHVA 3M70A 3LOIA 3POFA 4XPVA 3LSEA 5FY4A 1RUI2 4EN0A 3RWNA 1JI6A 5FMDA 3RMYA 2O0OA 1KRIA 1ULEA 1DQ0A 2JDZA 5A32A 1NX9A 4BXFA 3U37A 3UESA 3HAGA 5DAXA 5JMCA 3DYOA 2JKBA 1O4TA 2IWGB 5C9AC 5C8CB 1NUKA 3IN9A 2JG8C 1SLLA 4XJ9A 2Z4FA 3WCSA 1Q8SA 1JW6A 2VC9A 3AZYA 4MH0E 1AHSA 2ARXA 4FT8A 4N53A 3VBRC 1QGLA 4LO8A 1NLRA 2V72A 3AL5A 3RI9A 4QAWA 5KXBA 4AFDA 2PYTA 4Q4W3 2BBVA 2ZMLA 1F8VA 4NROA 3O0WA 1QF3A 3ZFFA 2Y6KA 5F5CA 4XUPA 3SHRA 2Q8EA 3VGIA 4YZ3A 1RINA 1C1LA 4XW3A 3CNAA 1H2NA 1WCUA 2BNMA 3K48A 2R49A 1BXHA 1KGYA 3KCXA 4GZ9A 1UOFA 4XJZA 1NCRB 1VRH1 3WT3A 3DCQA 3ELNA 3JUUA 1OH4A 3H50A 2HEYF 4NJ4A 4Y20A 5G05L 2VMGA 4YYOA 2ZZJA 1B35B 4Q4Y1 1JN2P 3FLTA 2C4XA 1DGRA 1SFYA 1UY0A 5SV8A 1WGPA 4NPLA 2WO1A 3T2TA 2L9LA 1VE0A 1C5HA 1AR61 4LTAA 5E89A 3VHRA 2ZGNA 4QX3A 3WR0A 4FP3A 3V56A 2YBPA 1QKQA 3WUDA 2VGDA 1SHWB 3JU9A 4C0HA 2EXHA 1PO12 1DBNA 3NMBA 1F15A 4QDSA 4YZ1A 2FQPA 4RHV2 4FI9A 1YWKA 2VU9A 5JPNB 1UYYA 3HQUA 4JZRA 2BRTA 2DU1A 5ABJC 2P3KA 1OVSA 1EY2A 1QH7A 2XJQA 3PIJA 3AL6A 2E51A 1G6NA 1R093 2WNVB 1YO8A 2ZGOA 2ZGPA 3OEBA 4MOAA 4WM7B 3VZJA 1O3RA 2CAUA 4CTEA 2WZR3 1HRV1 1H9WA 2VOKA 3U75A 4ASKA 4DEVA 1KS4A 1XNBA 2LRPA 5I8YA 5A7WB 1JYIA 4YVSA 3SKVA 1AR73 4Z2WA 4YG6A 3RYKA 4HKOA 3POEA 4IEQA 2DYCA 4CCKA 3Q9OA 4JKMA 4NWWA 1CIYA 1YJLA 4FO9A 3CU7A 2GN7A 2R7EB 1DYKA 5FUPA 1LGNA 1AYN2 3W58A 4H55A 3WW3A 4AAPA 2VL4A 1FOD3 2YU2A 2D3RA 1NLQA 3JD71 3MLJA 4FPGA 2YZ4A 2VZRA 4QB2A 1NA1A 3B9CA 4M3CA 4JC1A 4O9GA 2YPDA 1NKGA 2R071 1OXCA 2ET1A 3S30A 3CBNA 5K7PA 1S0JA 2YGLA 1WCKA 3GYDA 3QH6A 1SACA 2O1QA 3G7DA 3OUIA 1DHKB 1ZBE3 3ZSMA 1CX4A 4XFGA 1D2QA 5FXXA 1K5MA 4XHBA 2DF7A 2E9QA 1ZRFA 2R6QA 4XYXA 1SQ4A 4O65A 2ZTNA 4D69A 3IIAA 5GLVA 2K0GA 2XWBB 2D93A 3VBSA 5I0UA 2ZEYA 4AHWA 3WSOA 2P5BA 5KC5A 2JDAA 4QXCA 4K1ZA 2ZGTA 4RQPB 3SKJE 4NRQA 5KHJA 5AFEA 4Q8LA 3CZUA 3GF6A 3KQ4B 1PVXA 2RJKA 4P08A 4YW1A 4DOUA 5FZ7A 4Y1XA 5EFUA 3V0BB 1O3TA 3NRUA 2QQIA 4ZU5A 3WY6A 1CAWA 4LK7A 2AH2A 2WT2A 2JIJA 2GH8A 3HVDA 1VMHA 1W9SA 1OURA 1HRI1 3NSTA 4LK6A 1I5PA 5F6LB 1BVP1 5FXVA 4NIDA 2W1SA 1RHI3 4YGDA 4BHPA 3MW2A 5FYMA 1GZ9A 2MHFA 1YCIA 1CAXB 2WT1A 3SEPA 4AFCA 2B8MA 1ZBA2 1QH6A 3AYAA 4X8PA 4M4PA 3ZN4A 1NCQA 2R063 1H8VA 2D6PA 4DZGA 4YG3A 1VBD2 1PK6A 3JZVA 5HV4A 1RB8G 3O7OA 2JG9C 3K4AA 3ZO0B 5C3QA 3S6PA 4TXWA 4LKEA 5J98B 1DQ2A 3F2ZA 3UKNA 3ZXFA 4FAGA 2X09A 1H4HA 1UY1A 1RUE3 5F2WA 4GWJA 4XBQA 1O6UA 2OUJA 2FDIA 1PNFA 3PU8A 1FPN1 1BKZA 1J58A 5FPXA 2DURA 1F2NA 4KWLA 4LA3A 1A3KA 1RUH2 5ACA3 4KBBA 2CDOA 3S0MA 2P17A 4EWDA 4SLIA 3VBFA 2WAOA 1V6OA 2VBPA 2PAMA 4RGGA 1DZQA 5FZMA 2PQSA 5FAXA 1H8TA 2QQUA 5T50A 3MV01 3C7OA 3T2QA 1S0BA 3T4VA 1ND3A 2ORZA 1WMEA 1F9KA 2PELA 2W95A 4IETA 3DN7A 4XAAA 4DS0A 2EIBA 3H7JA 5FR3A 4NIGA 1H9PA 1AYM2 4FBFA 1NYWA 4CDUB 2ZMNA 1WLTA 1ZNPA 1YQ8A 2EICA 2RS32 1AXKA 2DFBA 3UYJA 5IVCA 1GWLA 4K7JA 2QQKA 1IPJA 1YUDA 2QJVA 3VBOB 1JU3A 3AXDA 4Q4W2 1AL0G 4BMBA 2JDPA 3LPFA 2WN3A 3AKQA 3OYWA 4Q1RA 5LEKA 5A33A 3UL2A 2DTWA 4A6OA 2VMDA 1CJDA 4IL7A 2XJVA 3C7GA 1DF0A 4ISQA 3OBAA 4V2VA 3WEZA 3ZR5A 1DGWX 5A3OA 2DVDA 5SV5A 4Q1PA 2VOTA 1JYCA 2PLV2 4ARXA 1N3PA 3OY8B
chains in the Genus database with same CATH topology
3ZXKA 5EV7A 3JQXA 1FT9A 1OA4A 1MZ5A 4R52A 4LBJA 4RD7A 5AC92 5EYYA 1R1A1 2DUQA 3T1MA 3HWJA 1RUF3 1YRZA 2W68A 4GMP1 4FOQA 2FZ2A 2JG8A 4FVVA 2RR11 5DZGA 1C57A 1Q3EA 1SBEA 2EF6A 4IV1B 4H7LA 5E16A 5BNOA 1OQ1A 4OULA 3VDDC 1ZZ7A 2VVDA 1PGW2 4FTEA 4P9YA 4MGZE 1D0HA 4HVOA 4XJWA 4YW3A 4G9SB 3VHPA 4Q4Y3 2GDFA 1BYHA 5K0UB 1S2BA 3AP6A 4E9KA 3IPVB 2LM3A 1R092 1QJY1 1NE4A 1XE8A 2YUEA 4X8NA 4PDWB 1OOPC 5BNNC 1PO21 1X36A 2YHJA 2A3YA 5C4WC 2H6BA 1G9DA 3MFCA 3INAA 3WX5A 3N7JA 4CEYC 5H9SA 5I0SA 1REFA 1HLCA 1VBC3 3THTA 4XJ8A 1NQJA 2D43A 1RUNA 3M3EA 5JI7A 5H9PA 4NR1A 1GANA 4MXVA 1PHMA 1LR5A 3AKTA 1HRV3 1XU1A 3JB8A 4WVVA 5EJ3A 5CFCB 2A71A 3VBHA 1VBB1 3WV6A 4BWOA 4C0BA 4YFZA 2UY8A 4LE4A 4LR4A 3VZMA 1RJ7A 5FREA 3QCWA 2ZPXA 2QDRA 1LECA 2IC1A 3EHKA 1QJX2 3V0AA 2RJLA 1U12A 2A73B 1LKNA 2DFCA 5A32B 2XVLA 3JD73 4PIZA 1KXGA 3J8F2 4BOWA 3TN92 4BM8A 5JIUA 1J3QA 2GSYA 2TNFA 1YI7A 2OZJA 4FPCA 4N53B 2GNTA 1NOVA 4XIOA 1Q8OA 1EV11 3DGTA 3LA7A 1WCDJ 2C0ZA 5I8TA 1SBDA 2ZA9A 1CVNA 1IKQA 1GNZA 3LKJA 4AF9A 2P3IA 3RPQA 3KD4A 4ZXKA 1ULCA 4INDA 4K20A 1DQ4A 3AX4A 4Y1VA 2ZAHA 1TE1B 4YRDA 3ZXLA 1IS6A 1HRI3 4LO4B 5AFBA 4L11A 2BTVC 1LTEA 1RUE2 4IESA 4Y4YA 1QXPA 2ILMA 4Y20B 1ENXA 1OA3A 1CONA 4IEZA 5AVAA 3VKNA 1LU1A 3GNEA 3NL1A 3D8CA 1C8M1 1RMU3 3ZXDA 4P9GA 3ZYPA 5JSOA 4AHXA 4JGZC 3AYEA 1QDCA 2XVKA 1LOCA 1HXS1 1BEV2 5BNPB 5F1RA 2ZMKA 5DUVA 5F9TA 1GYKA 3PMEA 4QHBA 3SITA 3MDPA 3N36A 1WMFA 4K8FA 4B4QA 3PNAA 1NQDA 2OW4A 1L3JA 4CP2A 1W6QA 4KU7A 2EALA 2GMMA 1G8WA 3C3VA 4HANA 2H6CA 2E63A 3DPRC 3IDEA 3BTAA 2GC1A 4K21A 1VAKA 2CGOA 4AI8A 1DIWA 1FMD1 2JG9A 4D94A 3L9JT 2NZ9A 3AB0A 2A75A 4YM2A 4YVSB 3GHNA 2CY6A 2I2SA 3NW4A 4HSLA 4Y22A 2GNMA 1FX5A 4JTNA 3H0OA 4AXOA 1VBE2 3FX3A 3GHMA 3NKGA 3WVJA 4NN0A 4D7SA 3MGUA 2B45X 3N7KA 2VVEA 3QD6A 1YI9A 2Q1MA 3LOBA 3RNSA 1KD7A 2PHUA 2NM1A 5CG8A 4D3WA 2A6VA 2WC2A 5FLJA 2R041 2R1DA 4CRQA 4YM3A 5J09A 4E4ZA 2Z5WA 1K5MB 1OFNA 1VRH2 4YFWA 1OQDA 1GV9A 3MZHA 3SMHA 1AZDA 3NAPC 4W6XA 4AI2A 2Q8OA 3WLUA 2HWD1 4Q4Y2 4YM1A 4FOVA 4N43C 1DU3D 1XXNA 5JVVA 4EJRA 3DUIA 1AR62 4N7IA 4Q4V1 5FCCA 3RQ0A 3I2DA 4MVTA 4IEVA 3I4IA 3WP4A 4QGLA 4JQRA 1HX6A 4DNYA 1QHDA 2BGCA 4D7TA 4F3JA 4IEYA 2ZHMA 5I0TA 3AFKA 4AEDC 1CAXA 1URXA 3B69A 3ZSLA 1DYPA 1ASJ3 4UXAA 1U0AA 3WW4A 1PK6B 1WCSA 1CESA 1QJY3 2V5YA 1QQP2 2Y0IA 1T6GC 2ZOEB 1ULDA 1PO23 2ZCWA 5GLUA 2A70A 4KH9A 4PF5A 1M4WA 2WQZC 3DF0A 3LAGA 1N3QA 4I0WB 4XF3A 2UWAA 3NV2A 3M4FA 4LUKA 2KM2A 3HT1A 5DUWA 3KCCA 2VOXA 3GZTB 1QNYA 4KL1A 3MLLA 5D8AA 4LBLA 3RJRA 3VBFB 5JLVA 1LULA 2HYKA 1UPIA 4PBPA 2RMU1 1NXD1 3JD72 1H8TB 3ZN5A 5L7OA 5KWRA 4TLFA 1LODA 2WZR1 1VBB3 3ETQA 4YZ4A 5FTTC 1OOPA 2BFUL 2R072 4XTPA 4XJUA 1AXZA 2YPJA 1AR71 2XHKA 1V6MA 2ZX1A 4Z1VA 5B2GB 2RHPA 1BMV1 4GH4A 4WBBA 3SLIA 1UW8A 1GQHA 3D4KA 4E4SA 3R4SA 4FQZA 3VN4A 4AFMA 4GALA 2CAVA 3OYWB 5HCFA 2XG3A 1FOD1 3U07A 1UMZA 1POV0 1V9U1 1QMJA 2D5FA 4LBNA 2XB6C 4E2QA 5FFOC 3ST7A 3FFZA 1QOOA 4PLNA 4F83A 3ASIA 4Y5Z0 5JCTA 1SCRA 3ZMNA 1ZBE1 1EV13 4IV3A 3ZFGC 1G9AA 1CD3G 1Z7S3 3VHNA 4MXWB 4KG0A 2V09A 3LA3A 1TME1 1RUJ2 2RS53 4QPIC 4KWJA 3ZPYA 1YHFA 3AMQA 2W52A 2HWF2 3TRSB 3RMXA 4JDOA 2JG8B 3ZMOA 2VVFA 2NP0A 3WDTA 3M2MA 4XXAA 3B9IA 4YLZA 1LOFC 3EBRA 1SLIA 1BQPA 1VIWB 4XFAA 3WG4A 4AVCA 1KRIA 5FO8B 4QQ2A 1MS1A 2ZBJA 4IEWA 4IV1A 2HWB3 2BFUS 1QWRA 1MZEA 3ILFA 1FPN2 1F5JA 5EZWA 2WS93 4QGNA 1WW6A 4MGIE 3EJKA 4F7ZA 1Q8QA 2D3SA 3FBMA 5K0UA 4BE3A 4IERA 3MIHA 1H4GA 2XPJA 1RUD1 2JXAA 2XGXA 4LUMA 2WINB 2E7AA 3M3IA 2LALA 1HDKA 1F31A 2DUOA 3ZFEC 5FLIA 4DQAA 2X53S 3OTFA 4WV8A 4DFSA 2BW8A 5T55A 2YROA 5ACA1 4G3YC 1Z0HA 3U11A 4AWDA 1YFYA 2VUAA 4JGZA 3IDBB 4DY5A 1U5IA 3VBHB 2JJ6A 1ZYBA 4CDXA 5KXCA 3BU7A 5JWPA 3MFAA 2D6NA 1GQGA 1ZM1A 1LHWA 3E6BA 4XMAA 3V0AB 5ABJB 2Q30A 3OJBA 1VJ2A 3KMHA 1CPNA 1LOBA 3PJQA 3DPRA 3ZX7A 2BPA2 1OA2A 1VBA1 2B7YA 4XETA 4R8HA 2A3XA 1MS0A 3VZKA 2ES3A 3ME2A 5FMOL 1HQWA 2VECA 4NOTA 5KHHA 2KXLA 4XQ4A 1LESA 1MEC3 1R1A2 4PLMA 2EXKA 2HWE3 3MLKA 1Q8PA 1O4YA 3ZSEA 4AVVA 2R043 2RR12 2PTMA 1IQAA 1O3SA 2UWCA 4I09A 3HN1A 4PIYA 4OHZA 3UJOA 4K1YA 1TNRA 2MEV3 3HD8B 2ZGMA 3RZZA 5HXVA 4EN6B 2HWD3 2XWJB 4R4ZA 3QBQA 2GNBA 4UW6A 3JQWA 2Z2SB 4JGYA 2PHTA 4R9CA 1RUF1 3SCHA 4Q4V3 4KQ7A 3FMGA 1WW5A 1V70A 2OA2A 2UY9A 3WUCA 4LHKA 2WWSA 2RE9A 5E8AA 4HN1A 3JBG1 4QQOA 2DVAA 4AYUA 1UU4A 2R0FA 4QPGC 1MR5A 3B7MA 1S0IA 2D6MA 4UBHA 2H0BA 3M3OA 4AFBA 4WM8A 1R083 2JD4A 2ENRA 2WA3A 4JDNA 5BUVA 1O5LA 2FZ1A 4OI0A 1H1IA 1IS3A 2RS12 1O4ZA 3VBUC 4QM9A 1B09A 1CAVB 5FMOS 1UKGA 3KLSA 4TYSA 4JRAA 5T5OA 3OGJA 4AE2A 5BNPA 3WHUA 2QNKA 5BPXA 1XQNA 1W6QB 2QKDA 1PMIA 1VBC1 4AGVA 4F8AA 2CYFA 2FBEA 5KBFA 1QY4A 2DVGA 3W9AA 1O5UA 4P9JA 3WINE 2RMU3 2AUYA 3B3QE 3SH4A 4JTOA 2JG9B 2D98A 2DCZA 5DDJ3 2X5IC 3UK9A 3ZVXA 1JUIA 4Y22B 4P14A 1WW7A 1AX1A 3WDUA 4L9BA 2ZKLA 2A3WA 1FXZA 3WG1A 1LGCA 3AP4A 5DZFA 4AHZA 2ZGQA 3ALQA 3IBMA 2ARBA 3CL1A 5CFDC 2YGMA 1PIV3 3AMMA 1DFQA 4K6BA 1V9U3 4YM0A 4Z8BA 1LEMA 4K3UA 1ZRRA 1W0PA 1KJLA 1W6PB 3AZWA 5C8CC 3U10A 4O9EA 1UIJA 3R4DB 2RM21 3E5XA 4GULA 4PQ9A 4ZU4A 1OD5A 1OQEA 3I7DA 3NO8A 1PGL2 4D7YA 3B00A 3LZZA 4Q0UA 4JAAA 2WL1A 3AXEA 4GWNA 4CP1A 3J9SA 1TME3 3AP7A 1OMIA 4LO7A 4XF1A 3E6CC 3LGRA 1UD1A 3MW3A 1C8M2 3SH5A 3H1YA 1KS5A 2VNGA 3BALA 2GC2A 4C91A 3RYPA 2DCYA 1HXS2 1XYPA 4XBNA 5DG2A 5FLHA 1QJU3 1AR82 1H2MA 2MNGA 1PVC3 4E2GA 4LA2A 4QQHA 1NCRC 1SLTA 2F4PA 4HK8A 1X33A 2ZX0A 4BIFA 3FUOA 1QXJA 1RVF2 2GC3A 2GMPA 4BPZA 2PAEA 4YVWC 4CDQC 2VNOA 4XF9A 1RMU1 2HWC3 3ES4A 3V64A 1VAMA 2BVBA 1MACA 1RUD3 5F5QA 4AEMA 4IEPA 1S0FA 1FMD2 2D3PA 5FBZA 1V6JA 2UWBA 4HLTA 4R9BA 3VDDB 4FPHA 4WZFA 2DCJA 4BLJA 4XMIA 1TEIA 5D8AB 4HETA 3A0NA 4EN7B 3TYJA 1OHFA 2AYHA 4PLOA 4QD2A 2G9FA 2R1BA 4Z92B 5FRAA 4WM7C 5L7OB 1QOSA 3M7AA 1IPKA 4W6WA 1OOPB 5J37A 2NQYA 2W0XA 3FWEA 2XBO1 4COUA 4AI3A 1ZZ9A 2XJRA 4WVWA 1QDOA 4FPLA 2WLQA 4OUMA 3ZFEA 4GH4B 4CEYB 5H9RA 3O0VA 2P37A 1TMF1 1SLCA 3BODA 2ZJCA 3LB9A 1C8NA 1VBA3 3QH7A 3OPZA 3AJZA 4N90A 4YZ2A 4R4XA 4COYA 2HWD2 2YXSA 5JIAA 2D6KA 4YZ5A 3WNXA 4LEJA 5CG9A 2CTVA 3OF1A 5JZGC 1ENSA 5A3MA 2P2KA 2WFF1 4OHWA 4DB5A 3O12A 5JR7B 1WLCA 4IV3B 1J1LA 1WA4A 3I8TA 4LBQD 1S0CA 3AP9A 2JE7A 3W59A 1GLHA 4MXWA 1JTZX 5C8WA 4RQPC 3R0RA 1C5IA 4BQ1A 4P9IA 4B3NA 3WQ1A 5C9AA 3OBRA 2ATFA 3WZ1A 4XHXA 2TUNA 3TBDA 1SFNA 4NHMA 2C5DA 3EQEA 5LRSA 2XKOA 4OUSA 5LEJA 1W6NA 1Y9QA 4GB31 1SDWA 4Q0QA 3VBRA 4YGEA 3JBG3 2VQ0A 3D6EA 2I74A 2A6ZA 1AUYA 4CDWC 4ES8A 1H2KA 2VOVA 2B42B 4OVEA 2IXIA 2WIIB 1ASJ1 1Q43A 2WNEA 1OKQA 2RMU2 3WP3A 4XQDA 5C6CA 1KDMA 3GZAA 2WZR2 1MZ6A 4QQPA 1HQNA 4BCUA 1AR72 4FOYA 4NO4A 4DY3A 2WKKA 4XFCA 1PM7A 1COV3 1BMV2 2GNDA 1UU5A 1XNKA 3KT7A 3IWZA 4A3XA 3APBA 2CGNA 3ZYGA 4JGZB 5LRRA 3ZN6A 3BIWE 4HN0A 4L97A 5IK7A 1FOD2 1VALA 1V9U2 4FPFA 4CDXB 1VR3A 3SXWA 2PHFA 1GR3A 3AKRA 3USUB 2GH2A 3N7LA 4DINB 4NPRA 1ZBE2 4CDUC 2VPVA 2XJSA 2R30A 3DPRB 3MPPG 4COVA 5ABJA 4DRRA 4HPKA 4BA6A 2B46X 3VBOC 1WD3A 1WLWA 2WT0A 2X5IA 3R6SA 1TNFA 3MI8A 1RJ8A 3SCGA 3M1HA 4AI0A 2QE3A 1ND2C 1ZVFA 4HVQA 3URFA 2RM23 2FMDA 3VUOA 1LJ7A 3U4XA 3AFGA 3ENRA 3KS7A 3VKLA 4HMZA 4KNCA 4ZU7A 4A7YA 2Q0AA 2QDNA 1Z7S1 1RHI2 5BY5A 4N7UA 4AG4A 3A4UA 1V00A 5L36A 2RS51 2R062 4JVAA 4MX3A 1GBGA 3KM5A 4JGYB 1DGLA 1OPOA 1RITA 4Q4X3 3AJYA 5L73A 5T5LA 1C3HA 3NV3A 3RG0A 3GALA 3PLQA 4RR3C 4B7KA 1XRUA 4DXZA 2HWB1 1SEFA 5T5PA 4Y1UA 4H7MA 3SH3A 5GZGA 1JH5A 4LBQB 4RA0A 4ASLA 3H7YA 4WM8B 2WS91 5ACA2 4MGKE 2W39A 1HIXA 4C1XA 1RUG3 2ZX3A 2O8QA 4LE3A 1SCSA 3FE5A 4PDWC 4BIOA 1HV1A 5L19A 1CAVA 3TNPB 4DRVA 1BBT3 4Q0VA 4GMP0 5JSPA 3O0XA 1W0OA 2PHLA 4AEDB 4QGMA 5DUUA 2PHDA 4E27A 1S1AA 5GZCA 3WG2A 5FDBA 2YY1A 1WUVA 4I2OA 4RS5C 2DUPA 1C1FA 4A7KA 2XBO3 4UW5A 1N1TA 2DWRA 1APNA 1Q5OA 2Q5TA 3ZXJA 4GA9A 1TMF3 1Q56A 1U5ZA 3I54A 4XZPA 4E2SA 1DGWA 3WP5A 4FSJA 3WQ7A 1LENA 1VBD1 2XL7A 2N7GA 2A6YA 1QXRA 5GZE